2OSQA

Nmr structure of rrm-1 of yeast npl3 protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
74
structure length
74
Chain Sequence
ELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKILNGFAFVEFEEAESAAKAIEEVHGKSFANQPLEVVYSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Nucleolar protein 3
publication title Structure of the yeast SR protein Npl3 and Interaction with mRNA 3'-end processing signals.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 7
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2osqA00
1WG5A 2MKHA 2LXIA 2YH0A 2X1FA 4PRFA 2KG0A 2NLWA 2N3LA 2QFJA 2DH8A 2CPXA 2K8GA 3TYTA 1U1RA 2CQBA 4TU9A 2DH9A 1KOOA 3BS9A 2LMIA 2LECA 3CCUS 3G6ES 3EGNA 1WEZA 2F9DA 3VAHA 2DGTA 1JJHA 1L3KA 1WELA 2EK1A 4F26A 1G2EA 3J7ZT 3UCGA 2G0CA 2J76E 1FT8A 2D9OA 1A9NB 2Q79A 2B0GA 3SMZA 5LSLA 2DK2A 5DM6Q 2AYEA 1X5SA 1PO6A 3PIOQ 1OIAA 2CQ1A 1VQ7S 2MPUA 3BO4A 1U1PA 2CQ4A 2MXYA 3U1MA 3MI7X 1VQMS 3NS5A 1H2TZ 2MY8A 1S72S 3NNAA 2DGUA 1Q82T 1Q86T 3D2WA 2ZJPQ 2LCWA 3IWNC 5D78A 1KD1T 2DISA 4RU2A 1X4AA 1FXLA 2L08A 3V4MA 1YITS 3VAKA 2MY7A 2OSQA 5BJRA 3S8SA 3UE2A 5MLCV 1X4EA 3CUNA 2JX2A 2CQPA 1WEYA 2M7SA 2NZ4A 2CPHA 1CVJA 3BO2A 2J0SD 2MJUA 1WWHA 3P49B 2F3JA 3UD4P 3DLLQ 2AYBA 1K9MT 2E5IA 1WF0A 4BS2A 4W92B 1DHMA 1QM9A 2CQHA 3G8SA 2A3JA 2MKSA 1HD0A 4J5OA 1B7FA 3ZZZA 1UFWA 3RW6A 1U1LA 2CQ2A 4WIIA 2PE8A 3CTRA 3H2VE 2OJ3A 2XNRA 2RU3A 1SJRA 1U1OA 5GADU 5IM0B 2EVZA 4V19X 2DO0A 1YJ9S 3ULHA 1VQ5S 4IO9Q 2J8AA 2DGOA 2KFYA 1U1NA 2RQCA 2DNNA 2M4MA 2CQ3A 5LXYA 3VAGA 4W90B 2DGWA 2VOPA 2FHOB 1VQPS 3TP2A 1X4GA 4M5DB 1YIJS 4OZ0A 1N88A 1SJ4P 5CYJA 2OIHA 2DNLA 1M5PC 3P3DA 2M70A 3CULA 1P27B 4WF9Q 2LA4A 2M88A 4TLQA 2X1BA 1H2VZ 1ZZFA 2X1AA 3NNCA 3CC7S 2DO4A 2K3KA 1M90T 1ZH5A 2N3OA 5EN1A 3B4DA 1YI2S 2DB1A 1M1KT 2HVZA 1SJFA 1YTYA 1SXLA 2MZSA 3MURP 3NNHA 1JJ2R 3I56S 3Q2TC 2N7CA 3S6EA 3J7YU 2DGSA 4F25A 3CXCR 2HZCA 1JMTA 2FPHX 2YH1A 3RW7A 2MZTA 2FC8A 4UY8T 1N52B 4U67Q 1NU4A 2DIVA 4CQ1A 2DHXA 3VAMA 2O3DA 2CQ0A 1YHQS 1H2UX 5LXRA 2RRBA 2AD9A 1VQOS 2XSFA 1VC5A 2ZJQQ 2E5JA 2KG1A 2KM8B 4LMZA 1D8ZA 1X0FA 2CQCA 2KXFA 3MD3A 2N82B 1VQ4S 4UQTA 1WF1A 2I38A 1WF2A 3G96A 3VAJA 4C4WA 2HGNA 1QVGR 5DDRC 2F9JA 3R1HA 3UD3P 4IOAQ 4QQBA 2GHPA 1Q7YT 3G71S 2MHNA 2M8DB 3CD6S 3R27A 5CXTA 2KM8C 2GO9A 4WKRA 2JVRA 2DNRA 1FJCA 4PKDB 1WG1A 1YJWS 4FXVA 4LIRA 3LQVA 1DBDA 3U1LA 3CMES 5LSOA 4WFAQ 2HYIB 2LQ5A 5GVQA 1WI6A 3SXLA 2XNQA 3LPYA 1DRZA 2DNKA 1OO0B 2KI2A 4OZ1A 3VAIA 1X4FA 2RT3A 3CMAS 1VQLS 2RUGA 5IQQA 4TU8A 3G8TA 2JRSA 2U2FA 1YJNS 3EGZA 1X4HA 1ZZNA 3VAFA 2XB2D 2RS2A 1HA1A 1XN9A 1WEXA 1HD1A 4CH0S 5GAHU 2LXUA 2OTLS 4FXWA 5H1SV 1PGZA 2XS5A 3PIPQ 3CCRS 1AUDA 2E44A 3CCJS 2LEAA 1M5KC 3THPA 2DNHA 2MQQA 5FJ4A 3IRWP 2E5GA 3BO3A 2JVOA 3TO8A 2J0QD 3MUTP 2FC9A 2D9PA 1M5OC 2YTCA 2MKJA 4C0OC 4WFBQ 1QVFR 1R8PA 5HO4A 2MSSA 3VF0B 1OWXA 3P5TL 4P6QA 4WFNQ 1M5VC 2QA4S 3CCVS 1X5TA 2DNZA 3UWTA 2ZJRQ 1UAWA 3S01A 2RS8A 4LJMA 2M2BA 2E5HA 2DNOA 5JVGQ 3MDFA 3CC2S 3MOJB 1X5PA 1VQ8S 3CF5Q 1VQNS 3CPWR 2I2YA 3UCUP 1UW4A 2DITA 4IUFA 3US5A 2RVJA 2DGXA 1VC0A 2L41A 3HHNB 1U1KA 2MQOA 4ED5A 2G4BA 1VBYA 2M9KA 1NO8A 5ITHA 1OPIA 3OW2R 3MUVP 2X1GA 4WCEQ 3R1LA 1DZ5A 3UCZP 5D77A 2D3OR 4A8XA 5LJ5Y 3CCMS 3THTA 3CC4S 2KVIA 1F9FA 2V94A 4YB1P 2WBRA 5DM7Q 1JJ4A 1FJEB 2BOPA 1X4BA 2UP1A 3I55S 2MKCA 2LA6A 5DDOC 2MJNA 2CPZA 3DXBA 2CPJA 2DNPA 1K8AT 2JWNA 5GAEU 3CCLS 2PEHA 2OTJS 5DDPC 1R8HA 2EK6A 4Y0FA 2YKAA 4IOCQ 1RK8A 3G4SS 4YOEA 1BY9A 1WHWA 3EX7B 4F02A 1WHYA 2RRAA 3FEYB 2MZQA 1YWXA 2VODA 2ADBA 3NMRA 4PR6A 3MXHP 2ADCA 3HI9A 1VQ9S 2OSRA 2BZ2A 4QPTA 2CPDA 3ZZYA 4CH1A 2HGMA 2L9WA 1UP1A 2LKZA 4Z2XA 2MKKA 1X4CA 1U2FA 1K73T 1NJIT 2AYGA 2KN4A 5CA5A 1SJ3P 1D9AA 1N8RT 4QU7A 3BEGB 3FEXB 1URNA 1U1QA 2RNEA 2YWKA 2XS7A 2G1DA 2KYXA 1FHTA 5DETA 3B4MA 2CQDA 2ERRA 2KU7A 3L3CA 1WHXA 1VBZA 5LJ3Y 1WHVA 2MYFA 3CCES 2VOOA 2RQ4A 3MUMP 4TU7A 5IM0A 2DHAA 3NS6A 1WTBA 2LEBA 2M8HA 3VALA 1Q81T 1S79A 2VONA 4ZKAA 1VC6A 2CQIA 2MZ1A 2MKIA 2U1AA 5DDQC 1IQTA 2DHSA 2MB0B 2MSTA 1A7GE 2AYMA 2KRRA 1X5OA 4C7QA 2MZJA 3P6YC 3SDEA 1H6KX 1U1MA 2LYVA 2CJKA 2DNGA 1P1TA 2CPIA 2DHGA 2CPEA 2DGQA 3Q2SC 4ERDA 5HL7Q 1FNXH 2CQGA 2DGVA 2MGZA 2DNQA 2KT5A 4Y00A 1N54B 1KC8T 3H2UB 2KXHA 2M52A 2KH9A 2XS2A 2DIUA 3G9CA 2SXLA 2QEXS 3K0JA 4QU6A 3JB9k 1VQKS 1KQSR 2DNYA 1SJQA 2KHCA 1VBXA 5GMKa 3N9UC 3CCQS 2MQNA 4EGLA 1U6BA 2MQPA 1X4DA 1FO1A 4CIOA 3S7RA 3CCSS 1VQ6S 5GAGU 2MQMA 5IFMA 1U6FA 2DH7A 2CPFA 1WI8A 2KXNB 1W2BR 3SDEB 1FJ7A 3MD1A 1RKJA 2KRBA 2MZRA 5JVHQ 2CPYA 2MMYA 1O0PA 2MGZB 2HGLA 2FY1A 1WG4A 2DNMA 1HL6A 1KOHA 2MQLA 4YUDA 2M0GB
chains in the Genus database with same CATH superfamily
2C3PA 3MECB 1J2VA 3LP1B 4IFVA 5H9EK 2DPJA 1G7CB 5L1LA 2BABA 5KT5A 1HHTP 3Q89A 2QLXA 4EBEA 3BN4A 2AJ1A 1OMSA 3BGRA 1SJ1A 5LSLA 3Q8UA 3H2LA 1VIXA 5I42A 2ZKTA 1VQMS 2YKQA 3TUZC 4Y28C 3IWNC 4M5NA 1JXEA 2JDJA 3G87A 2DISA 1FXLA 1T9TA 3OBIA 5DZ7A 3CUNA 2IA0A 1QTNB 5K9FA 4EWTA 2FVSA 2RRNA 2O1PA 2XTJP 4PUOA 1BXNA 3BKUA 1I6JA 3HDSA 5HJXA 1B7FA 4EU0A 2RB7A 2FLNA 3OFGA 1S6QA 2HLTA 1R6YA 4Y2KA 1WD6A 4V19X 1B70B 5KG7A 4NZ0A 1UVMA 4BLGA 2MKYA 2E5LJ 4M5DB 1YIJS 1N88A 4B3TJ 4LF8F 4GKKF 2WW4A 5KG0A 5KFRA 3UN2A 4N47A 4L6V3 1MU2A 2X1BA 1QAXA 2UUAF 5M2PA 5IQ6A 5I3UB 3BBFA 2HVZA 3NOCA 4JI7F 1RAGB 1JJ2R 2UUCJ 3BREA 2DTJA 1R0AB 3QWUA 1DQ9A 1MW7A 4JYAJ 1T95A 4ID5B 5KFXA 1ZM2A 2QE5A 4LBHA 1X0FA 4OX9J 3G96A 1FVSA 4HTIA 2I5JA 4LFCJ 1S1VA 3NS7B 3MAAA 2PMWA 2F8MA 2NS1B 4LF6J 1CJTA 1JLGA 2YWWA 1R6VA 4OLOA 3J81U 2Y1JA 5GVQA 3VQTA 2GO8A 2VQEF 2RUGA 3OVAA 4A8MP 3RR8A 3CCTA 4CTAA 4DR6F 1F0XA 2R2RA 2ZDOA 4U8YA 2XS5A 1VRQC 3KLGB 3BN7A 2Q6BA 5I42B 3FJ2A 4ILMA 4MKAA 4WFXA 5AXMA 1RHMB 4RUAA 3PFOA 4ILRA 3UQSA 2UXBJ 2I6WA 2MSSA 4ENOA 2ZH2A 4TYAA 3KXDA 4OZNA 3OTOJ 4MIWA 4Y6IA 4PUOB 1SC4B 1HI8A 4G1QA 3CC2S 4DG1B 2RVJA 4YP3A 1NO8A 2AEFA 3MUVP 1S6QB 4ZLLA 4HKQA 2IM3A 4HT7A 1HR0J 1KQGB 3MR2A 4HHUA 3PX0A 4G1IA 1EARA 2XWYA 3IFEA 4NEZA 2PMHA 2HEKA 2V68A 4LREA 2EG1A 2JOQA 1D0EA 2ZNYA 2PI4A 3O8WA 3TUPA 5GAEU 2OTJS 5DDPC 1W2IA 4IOCQ 5DG9A 1MU2B 4F02A 2VKZG 2D1CA 2GHWA 3QZ8A 1WOPA 3DRSB 2IBKA 5JMNA 1NK8A 1MN7A 3EXYA 3HMJG 5C5JA 4NA2A 4ZVEA 1RHUB 3M8WA 1LW0A 2YX1A 2H9ZA 3SV3A 3ZZYA 2H5EA 5THWA 4JV5J 1NK4A 1D8YA 3M2UA 4DX7A 1HNZJ 5KFUA 1N0VC 2H5JB 2Z58B 3HVWA 4A8YA 4JI4F 2WVDA 2P6TA 3RAXA 4NLWA 3D0GE 8RUCA 2DHAA 1DAXA 2GVDB 3SCKE 2VG7B 3PKMA 2DCUB 2LEBA 3MAAB 4WFYA 4LR9A 2BOAA 1TMJA 1JLGB 5C24A 5T14A 3IAS9 3TA2A 4DZDA 4ERDA 2G2OA 5F8LA 1RKIA 4K2JA 5FD1A 4AD6A 2HHPA 1SVDA 4CTAB 1FRMA 1QUVA 3HP6A 3OTDA 4DV4F 2ATLA 1SJQA 1XEZA 3BKTA 2WSEC 4DX6A 5IFMA 3OFEA 3D6TB 3FBBA 1WI8A 3HHDA 2W2PP 3RB6A 3I31A 3MMAA 3Q24A 2EFVA 4EYHB 1BD6A 1VQSA 2RQKA 1NPKA 5K20B 2FJBB 3HF5A 2HGLA 1WG4A 4YUDA 5J1EB 2EFGA 2GQQA 4CT8A 3UVJB 3P45B 2DH8A 2H54B 2CQBA 2XMKA 2B3TB 1HKAA 1GTHA 1WEZA 3HFKA 8AT1B 3M6XA 2A6OA 2NXUA 3UCGA 1A9NB 5KFHA 2QYCA 5HN0A 1U7LA 3M8QB 2AYEA 4LIWA 3PIOQ 3EGWB 3FMBA 2V8GA 1FFGB 4XO0A 1RLCL 2X3GA 5D0GA 3NCQA 2Z0GA 3Q8QB 2CNKB 4F4KA 3UO0A 2BR0A 1RABB 1TVRA 3OSNA 1LW0B 4F04B 2JX2A 2ZVSA 2W4PA 2HFOA 4DR4F 4IRDA 3P49B 2F3JA 1XNQF 4BS2A 1DHMA 1QM9A 4JI3F 4B08A 3MCMA 1JLQA 2D7SA 3LALA 2OJ3A 4QIEA 1FF2A 1TAQA 1G6BA 4ECVA 3AD9C 2E9TA 1KHVA 4CLUA 3T1HF 4QIWD 2J8AA 1QY7A 3VAGA 2FHOB 4OZ0A 3SFGA 2W2OP 3C46A 2CNLB 1U4BA 3VR1A 4TNOA 2FJEB 1MWZA 4PG4A 2DD8S 4TQRA 3DGVA 7FDRA 1R8CA 1D09B 3FCWA 2R7XA 4LSLB 1FDAA 4L74A 3H90A 4OMFG 3MM9A 5KG3A 3M30A 2W2MP 5T41A 3R97A 4CM0A 2ZBQA 1SKSA 3GSDA 3PEJA 5DQIA 4I69A 3C15B 3I5AA 3HZGA 4B3MF 1RTJA 3LPEA 1Q16B 3RU0A 4B9TA 2QLFB 4F4WA 2HVDA 3RAQA 2HYIB 1RBAA 4CO3A 2HHTA 5J1PA 1YSJA 2JRSA 3MM8A 2AEJA 3M8YA 4C48A 2CWXA 4EK2A 3CSKA 4NPOA 5LSRA 3PW5A 4O23A 2ALYB 1MSWD 2CJQA 1NXIA 1N6QA 2QL9B 4J9PA 1V6HA 3TVKA 4A8OA 1NK6A 3NCRA 5FJ4A 2Q1LA 2E5GA 1EAYC 4OJHA 5BR8F 2JL9A 5AE2A 4FDFA 1TL1A 3QIPA 4ZIVA 3DKDA 1UFKA 3VF0B 5G0RA 3OLAA 4NCGA 4C6AA 1WC0A 1EX8A 1VQNS 4G65A 5DG8A 3DXSX 2QA2A 2NPIA 5ITHA 1U0SA 4NXNJ 2YKNA 3KLFA 3GONA 2D3OR 1IBCB 1CULB 3MEEB 3CCMS 4BWMA 1F9FA 5HMZA 5DM7Q 1M0SA 4PXEA 3CD7A 3DXBA 2DNPA 3EDRB 1K8AT 2F8EX 4YB5A 2R3VA 4BDPA 3KUEA 1NKEA 3G4SS 1TUVA 4N56A 3EX7B 2QT7A 1WHYA 5HMXA 1OJ4A 5ETRA 3TZZA 5C7PA 2VPXB 4QPTA 2RKIA 5KFSA 1VIOA 2BDPA 3FKBA 4DSEA 2H3EB 2HKEA 2YKOA 2W7OA 3QO9A 1XJWB 3HZEA 2ROGA 5HBMB 4B3RJ 3M7VA 2HRYA 1TL7A 4C0BA 3NGSA 2C3YA 2HRUA 3RTVA 1RTJB 4OX8A 4DL4A 3PW4A 1RT1B 3KDNA 5DQHA 1HYSB 2HHHF 4F67A 3IXQA 2OMLA 1H6KX 1C2PA 2MLZA 1YZ7A 4B3OA 5KFCA 3MM8B 1K0VA 4AFFA 3TAMA 2AW0A 3H2UB 2B51A 5D3GB 3FQKA 2FZCB 5L38A 1Q8BA 1J5EF 5IWAJ 2V67A 1IBKJ 3QIPB 4NLDA 4FVMA 3VQSA 3TZXA 3AA8A 5FDLB 4Q44A 1EETA 4ECQA 4PWDB 4ZVSB 3IBCB 2FGCA 4P73A 2ALZA 3MMCA 2N3LA 1UVKA 2UXCJ 4QIGA 4XDCA 4EZ6A 2R8KA 3MM5A 3EGNA 5EX3A 2UUBF 1WELA 2YXLA 5I3PA 3H5YA 2ZOGA 4Q5VA 1WOOA 2OO4A 4LF7J 2JH3A 3U1MA 4X62F 1ROFA 4DQPA 4KAIA 3I4HX 4I6WA 2L08A 3D67A 3EMTA 1Y9OA 4BWJA 2RKIB 4IH7A 2H48B 3J81j 4M5MA 5KOWA 3QO9B 2CVIA 4P74A 4W92B 4C3KA 4MTPA 1B0PA 3QATA 2BE7D 1F9HA 1U1LA 3CTRA 5L1KA 2VICA 2ILYA 2HWTA 5I4MA 2FJVA 1B64A 2WRMA 4IYQA 1VJQA 5L1IA 5LXYA 3GFHA 5KFBA 4W90B 4Q0BB 2OPPA 4LF5F 1RISA 3CULA 1CJUA 1AZSA 4B3OB 4EZ9A 3GFXA 2IVYA 1IBLJ 3NNCA 1ZTWA 3TAMB 1OQ3A 2WZ1A 3KG4A 4LQ9A 2MZSA 2X7IA 4QYZJ 2W7AA 2EW9A 3Q83A 3VCDA 1K44A 3VZIA 2DHHA 2KG1A 4I7FA 4PYAA 3GYXB 1U48A 4RW9B 2J7WA 3G82A 3PACA 4LF9J 1KHWA 2GC8A 3ZTQA 2VD3A 4U96A 3NY0A 4RNNA 4C8OA 1D1UA 4RBUA 1UPPA 1LWXA 2MHNA 3DU6A 2XCAA 3AJ1A 3QQCD 4LFBJ 5ADZA 3HPOA 4NLTA 3JQJA 2XNQA 2DNKA 3UW1A 4OZ1A 3VAIA 4F4YA 3QGHA 3MM5B 4F2RA 2DRBA 4LFAJ 1RZMA 2DBBA 2GV1A 2VUGA 4RW7B 4WYWA 3QIDA 4DCOB 3EM1A 3KK1B 2FVQA 2LQ8A 3THPA 4YB7A 1BQXA 3T5KA 4CLPA 4Y2AA 2K7JA 4XTTA 5F41A 5BXIA 1EQ0A 4OYMA 4CDIA 2R2UA 4A8SA 5FLXY 4WP3A 1HQ2A 2BJ8A 1ZPWX 3VGVA 3W62A 1IM6A 4UZCA 4YDDB 2ZC3A 3WX8A 3H0PA 4JI8J 2HHXA 3MOJB 5F3TA 3X1LB 4BC9A 2I2YA 4O0NA 1WDDA 4J9RA 1ZOTA 2X1GA 1DZ5A 3RYLA 1I94F 4I56A 1JLAA 4HACA 3M2RA 3GP9A 2W2NP 4MFBB 1S77D 3IGVA 4K4ZA 4H4OA 3J7A1 1Q5VA 3AFGA 3O3LA 4D3HA 4OJ1A 3BJYA 3OXGA 4DV5J 2V0NA 1NJZA 4ZP9A 1L5UA 4M8LA 1FDDA 1KWMA 4DN9A 1PBAA 3OTCA 4K4YA 1T9XA 1RSCA 4KJIA 3CJ4A 1SQFA 2M3DA 2YNIB 4JP8A 3KJFB 3V4IB 2KN4A 3NGRA 2ZM6J 2UUWA 2UVRA 3M32B 1HI1A 4NYPA 3G82B 2EC2A 2IDLA 1RAAB 4TU7A 3NS6A 3LA0A 4L73A 2F5GA 4DUZF 1BE4A 2XYPB 3GJTB 2HWHA 2KRRA 3H25A 2DNGA 3SV4A 3BKFA 1YK9A 1OSDA 3H59A 1Y3KA 2B4PA 3V6JA 3I9V9 2KT3A 4KH0B 5AE1A 1FFSB 2IRYA 4CI0B 4PXCA 1RCOB 1YBAA 3SDEB 4ZITA 3LWMA 1FJ7A 1RKJA 4DR1J 2MZRA 2HW3A 1FTCA 5JVHQ 1IBMJ 2MMYA 3FZ2A 1AFIA 3TVYA 2E7XA 2OEKA 3K58A 3JTNA 2KG0A 4H4KA 2ASLA 5KFZA 1X7VA 5DLGA 3ITHA 4RO0A 1KOOA 3BS9A 3DGPA 2VDHA 2LECA 4P52A 4IH5A 3NGUA 5E5NA 3IBWA 2YNGA 2L9DA 1XR5A 4RW6B 4DX5A 3HFVA 3LP0B 4H4OB 2FJDB 4I6YA 1VRTA 4DSIA 2JHEA 2WVBA 3KMSA 2DCLA 5BYQA 5HANA 3DCAA 5IC6B 1XR6A 2QMXA 3K17A 3QT8A 5D78A 2C2MB 4NLUA 3DM2B 3R7SB 3QFHA 1S1TB 4Q8FA 1AROP 4Y2CA 4FPRA 2WSFC 2V8DA 2NPFA 1VOMA 2P9EA 2B8QA 3CDBA 3MEDB 1Z2LA 4QWBA 5H9FJ 4ZP8A 1EP4A 2XO6A 1X31C 4K59A 3W2VB 2XNRA 3GYNA 2RU3A 3RBZA 1DTTA 3BZQA 1JLFB 1R8BA 1VQ5S 1OPZA 4M1KA 5AXKA 2W4CA 3KK3A 1S9GA 5K14A 4ANCA 1UTAA 4DU7A 3KFWX 3NAIA 3UNGC 1PYSB 2HHQA 3KLEB 4GKJF 3IP0A 3MR5A 1UCNA 3RW7A 2QA4G 3LP2A 1JLCB 2AJQA 3RUBL 1MMNA 4KHPJ 2ZJQQ 3G6VA 1JJCB 2DR8A 1D8ZA 5HVHA 4AQYF 1UMJA 4UQTA 1JLEB 2FVRA 4CLTA 1NHVA 2PSZA 4RJVA 1P6TA 2HNZB 4C8NA 1SL2A 2CNNB 4MYTA 4I2PB 4PPZA 1CJKA 4WKRA 2IRXA 3ITHB 2NZCA 1Q8KA 1OO0B 4M5LA 3A3NB 1XIQA 1MMLA 3PEHA 1FKOB 5E3PA 5U47A 4RLEA 2YNGB 3M6WA 1HD1A 4CH0S 2ZBRA 4DUZJ 3PX6A 1YVFA 3CCRS 3WBZA 4IDKB 2BQ3A 2BACA 2OD4A 1UWAA 3OJSA 1FE0A 3Q8YA 2Z2MA 5CYQA 4K5RA 4FYWB 4ED0A 2FZGB 2E5HA 3CJTA 1EP4B 3D6MB 3I0RA 2BANA 4KHRA 3OW2R 2HAIA 3GR0A 1XMOF 1IN0A 1DTTB 3R2DJ 2R7OA 1TK8A 1QAYA 2BOPA 1RU1A 1TKXA 2C2RA 4X4RA 4ZVOB 4O3OA 4O3SA 2K3IA 1OYEA 2YKAA 3MF5A 4ZHRB 4FYVB 3DN9A 4Q2MA 3DOKB 3KTQA 2RRAA 4Y34A 3HM9A 2VODA 2H4WB 1H3DA 4DFKA 3MXHP 4NL5A 1S1UA 4KIAA 2HBYB 5L9NA 2QLWA 1U47A 5D4NA 2YX7A 4Q2LA 1N8RT 5IS2A 1FD8A 3PJWA 1S1XB 2AGPA 1RWMB 4EO8A 4RNMA 3MWBA 1ITPA 2VU5A 3Q8VA 3SCLE 3TZWA 2ZEJA 4JI1J 5EWFA 4OYZA 3WQPA 1S79A 3I82A 1KVIA 4HR2A 4MKVA 5LMNJ 1RI7A 4USJC 3GB0A 2RD5C 2OUGA 1YJTA 1DQ8A 2E1MC 1L3TA 4C7QA 3P6YC 4DL6A 1FXDA 3K8WA 1P1TA 3H42A 2ASDA 2A0FB 2CPEA 3Q2SC 3PR5B 5HL7Q 4ED6A 4ZCLA 4FF4A 4DR7J 3UR0A 2SXLA 1TUGB 4NEYA 4XK8C 2DT9A 4FPIA 1RT3A 2JEJA 3GIRA 3BB5A 1NB7A 3DRYA 3CCSS 1I5OB 2MQMA 4NMLA 5CYQB 4YY3F 3HJFA 1FNMA 2VC0A 1NNDA 1KOHA 2HIQA 2MKHA 2KJWA 2CVEA 2JC1A 1U8WA 2QL7B 5KFNA 3A8IA 3I0RB 1KQFB 1MN9A 1Q8IA 3PR4A 1NH7A 4YEAA 5DJBA 2IPOB 4DHVA 3J80Y 1HNVA 2ASJA 3W5XA 2BV3A 2Q79A 2GMHA 2B0GA 2BW2A 5HMWA 1ZETA 3P8BB 4YHHF 3NNAA 1REVA 2IC3B 2LCWA 4J9VA 1F3FA 4NMXA 2E1PA 1N5TA 2UU9J 5T7LB 2YNFA 4NLGA 4O44B 4ZLNA 3HULA 2IDEA 4R8UA 1G1XA 5EWGA 5E3AA 1K9MT 1HQEA 3LWLA 2R42A 5B7WA 3U7JA 3AOCA 3H2VE 3RGIA 3CE8A 1BWEA 3W5ZA 4KGMA 5E3RA 2IAJA 1XK8A 4BCAA 3W5YA 4O0IA 2VFRA 4B9SA 2OIHA 3IN5A 1P27B 3RB0A 3GIJA 3EVMA 2X1AA 2VJVA 4HVZA 1AXQA 4OHZA 5EN1A 2GJFA 1M1KT 4NYZA 5D4LA 4NRUA 3Q2TC 1IKYA 2CRLA 1T05B 3N5BA 1UJ5A 4U67Q 2CJXB 4LF4J 4IKAA 3M9NB 5LXRA 1GTEA 1XMQJ 1VRUB 1RT6A 3RB4A 5C25A 5J2QA 4JI5F 2IRUA 3QPIA 1UPMB 3PRDA 4RNHA 2YBVA 4LBIA 1YZ6A 5LM7E 4ED4A 1BLUA 3OTBA 2JVRA 3C19A 1YJWS 4ETXA 3CMES 5F8HA 2QJ3A 1UW9A 3KNAA 4ZPCA 3LPYA 1LK5A 2FVPA 5IQQA 2GIRA 2DVIA 4NLPA 4B9VA 2P8IA 5CCLA 2CIMA 4KB7A 1NDCA 2OTLS 3NMAA 5B0EA 3MR7A 3DOMB 4ZPVR 2DNHA 1RHKB 1GQEA 1Y00A 4FF3A 5A6PA 2D9PA 2QSFA 4C3LA 1LNQA 4JV0A 5B0GA 1QVFR 3HHLA 2AMCB 1PKUA 4UOCA 5DGBA 3R5GA 4IRKA 3IMQJ 2XZDB 1HQEB 3US5A 1YG0A 3IR7B 1RT5B 2M9KA 3KLIA 3BPSP 1OPIA 5J2NA 1WJ9A 3LGHA 4X4SA 2VQFF 4XPEA 1B4SA 4O3QA 3CC4S 1T9VA 4YB1P 3LGNA 4TY8A 4DLGA 4PQAA 4X4TA 2QL5B 5KFOA 2V9WA 3R6LB 5L39A 2VB6A 1L3VA 1BY9A 3I5BA 2VPYB 2ZHOA 3AH6A 5KFLA 4LUBA 2ADBA 4OV6A 2ZZMA 2OPRB 2ADCA 1RYRA 5JJBA 3MAHA 2CUYA 1R0BG 1QAJA 2RF2B 1D9DA 2V4JB 4I2QB 4CLSA 2ZZTA 2HK2A 4DV2F 3AODA 2BRKA 1PYTA 4YB6A 1AUSL 2ZD1B 5I3QA 2BJDA 4ZPBA 1FEHA 4ES3A 2BE2B 1OQ6A 1WHXA 4HHJA 1RTDA 1FWLA 1HNXJ 1IR1A 3N6MA 3QWPA 4R0EA 1YKWA 3FC9A 3OR2A 2DR5A 2C3UA 2CQIA 2LVWA 4J90A 4EEYA 3MPYA 1RTHA 2MSTA 3DMJA 3CJSA 2IFXA 1SKWA 1G4CA 3KG0A 5HATA 2DGQA 1FNXH 3Q23A 4IH6A 5F8JA 2MGZA 2KT5A 2XYGB 6FD1A 3G9CA 4DV6F 3BYPA 2J9CA 3TRGA 1GT8A 4HL9A 2NXJA 3TJ8A 1RHQB 1M1HA 3KLHA 4LVOP 1TK5A 4DPYA 1KKHA 3OL6A 2FHMA 2OEMA 3FSIA 3GLJA 2AJ4A 3DRRA 4Y65A 2YH0A 1LV5A 2F63A 3FFIA 1Y4ZB 3ET6B 4B9LA 4L3KA 4NI2A 1F5AA 4JI2F 1T8EA 4RUCA 3JSMA 4ALZA 3TQ1A 3CCUS 1R0CB 4UZBA 1HMVA 4Q7AA 9RUBA 4DV7J 3Q8SB 3OUYA 4TY8B 3NKYA 1YJRA 1DLOB 3TQEA 1L3SA 2J0XA 1T0TV 2HQDA 1U1PA 4Q8EA 2MXYA 5HVFA 1FI4A 1N36F 3NS5A 1CS4A 1GK8A 3D2WA 2OELA 1BHNA 2AU0A 1IJEB 1XR7A 2UXDF 4OYIA 2OKQA 1IKXA 4DV3F 3DYAA 3DLKA 4X4VA 2A18A 1XMBA 1FK9A 3MHYA 2OPSA 3M2VB 3TAQA 3POTA 2YVSA 3SSSA 2VBYA 1SH2A 2DGOA 1KS2A 7AT1B 3I0SA 2ZE2A 2VOPA 5J2PB 1X4GA 3OLBA 1SJ4P 4ZVTB 3HX9A 3V6KA 2EXUA 3OHBA 4C98A 4CT9A 2EWHA 2I0XA 2PO4A 3TOQA 1M90T 4KFBB 3VVTA 1S57A 2J8SA 1SXLA 1SH0A 5HSPA 4F8RA 3W61A 2HZCA 2YH1A 3NWRA 3ENQA 1ZA1B 4OI2A 2AHOB 2DR7A 1N52B 1C4CA 3WC0A 4FKYA 3J7Z5 3OJUA 3L7PA 3ZC4A 1FX2A 3NP5A 2GVZB 1KTQA 3CJ5A 1SQEA 3DRRB 1LKZA 4DV2J 3C6UA 1HWUA 1VI7A 6AT1B 1NMEB 3FFIB 3CD6S 2VASA 1B3TA 4GVBB 4QR1A 1JNRB 3JSMB 4DV0F 1Z1ZA 2CJ9A 1WKJA 2B56A 3D1QA 2RS2A 2F40A 3PW2A 5GAHU 3BDPA 1T03A 3KWMA 4AXJA 3ZTSA 3IRWP 1CS4B 3BO3A 2HMIB 3R5JB 2BJ7A 3MUTP 1X9SA 5IV3A 1M5OC 3T1YF 1KDNA 2DRDA 3JYTA 4YMEA 4DV6J 4NXMF 3CCVS 4K2XA 5B08A 2GHVC 2ZJRQ 1HNWJ 3S01A 2KJVA 1N32F 3DYAB 1GMWA 1BQNA 3QMQA 4F4ZA 3EE3A 4DQRA 1R31A 5J1NA 2GS8A 2AP6A 2CJYB 4B9UA 3POTB 4DPXA 3MM7A 4LF2A 4TQSA 2V94A 2WBRA 2UP1A 3QFWA 3BGFA 2LA6A 1QSYA 2D3O1 3CEDA 3K5NA 4RR5A 2PEHA 1FJGF 2WVEA 3GPAA 2ZITA 2ZUAA 4PABA 5D0HA 1GMUA 4AT1B 1QLNA 1C4AA 3L4BC 3CVKA 3FEYB 2AJ0A 4PG6A 2DKOB 4WWSA 2VA3A 1W26A 5ETKA 4X4QA 1GXLA 3DFEA 3AD8C 4QZVB 4ZN3A 1KLMB 3FRYA 3EXCX 1SI9A 2CPDA 4OI3A 2LP4A 1LW2A 3WIVA 1GX6A 2EBGA 1R89A 1U2FA 2HQ3A 3NOGA 4USUA 5CA5A 4RBVA 5DS7A 4MH8A 3GCXP 2YWKA 1FHTA 2WVFA 4NA3A 2V2KA 4CH7A 1WHVA 4MIAA 2AZ1A 2BJ9A 3RJMB 4N8NA 3C6UB 5LMUJ 1HQUB 1VC6A 2WSCC 2MZ1A 3PO4A 3MMJA 2DHSA 2MB0B 4RKUC 4KTQA 1U1MA 3C14A 4ECSA 1IKVB 1MROA 1LWCB 2CZ9A 1S7IA 3AHPA 3CD0A 1H0HB 2GGPB 1QSLA 1RLDA 2DR9A 3PFEA 1U49A 4J9OA 4OJGA 1U6BA 4UUWA 1AB8A 2JFDA 2V6AA 5KFMA 2AJ2A 3PHEA 1C0TB 4UW2A 1FRIA 2NUHA 4P72A 1TP7A 4JI0F 3MD1A 1S76D 4DL7A 1E6VB 1TL3A 4R25A 2COLA 1BQNB 4QYZK 4DX8H 3TYTA 2HIYA 4CO5A 5C2CA 3KKFA 1SUQA 3MM7B 3V6DA 1JXVA 1L3KA 4DR2J 2WK4A 2YWGA 3D1HA 3MZIA 3SMZA 4OX7A 4N5SA 2QN6B 1WC3A 2MPUA 1S4FA 4LRBA 4USVA 1DQAA 1GXTA 3DLGB 2JEFA 2W9BB 4MK7A 4HLBA 3OL7A 5MLCV 1X4EA 2ZH1A 1PC5A 1RTIA 3SSQA 4MMOA 2M7SA 3W1YC 4ZIWA 3C16A 2VG5A 3FGVA 2FY8A 1R8AA 2A10A 3N4WA 4C8LA 3SEOA 2NXEA 3OXLA 5GADU 2DO0A 3EVWA 4P2XA 1N48A 3ZTOA 3ZZ0A 1NH8A 5B0BA 1NZ8A 2OLWA 3EPGA 5KT2A 2BE9B 2KFZA 4K4UA 2M70A 4KBIA 1Q8LA 4J37A 2ZFHA 1H2VZ 1ZZFA 3CDAA 1NZAA 2K3KA 1ZH5A 4LSZB 2WOMB 4QR2A 2V2VA 3J7YU 3M8RA 1H72C 1Y3JA 3CXCR 1NLKL 5KT3A 3C2PA 1IR0A 1NU4A 4WXOA 3EJMA 2O3DA 3K5PA 1FE4A 1M1GA 2AD9A 4I1TA 2JSXA 3ISZA 2B7CB 2KXFA 2OH2A 1YJVA 3VAJA 1QVGR 1RT7A 2IM2A 4ES1A 2M8DB 1RXOB 1VFJA 4CLKA 3ZO7A 3QAEA 2LQ5A 1XNRJ 1WI6A 1F5BA 4BC7A 1SUQB 1YJNS 4CO1A 4I68A 1ZZNA 1WOSA 3VAFA 1DJ0A 5CH7B 2QSWA 3KUGA 1JNZB 5HP1B 4OYOA 2HHSA 4KQZA 1CEZA 2E44A 3CCJS 2J0WA 1NK0A 5HVGA 4ZLJA 1LWEA 2XC9A 1NHKL 3ENAA 4LRCA 3P5TL 4I0WA 1M5VC 4I64A 1U2CA 1X5TA 1RTIB 4M5IA 5FLXU 2M2BA 3C16B 3MDFA 2IVMA 5KOXA 1X5PA 1ACMB 4RL1A 2L41A 3GV7B 5C42A 1TKTB 3ZNUA 1VBYA 3CDUA 2WB1D 3UCZP 4Z37A 2L48A 5AJ3F 4Q45A 3PRVA 3HVTB 4UY85 1RBOB 3AXKA 1SQGA 3UDVA 5KT4A 2W9AA 4A8FA 1X4BA 4JV2A 5HMYA 2DRAA 4LSNA 1R8HA 1K47A 4KY3A 4DFPA 2NXCA 4X65J 2KT2A 4O3PA 1KNZA 3HI9A 3V5RA 5KTQA 4DBQA 4DR3F 3DLHA 3KYLA 4ED8A 4KPCA 4KKOB 3IWLA 2VF3A 2QLBB 4LR8A 1EKRA 1C0UA 3KOAA 2QG9B 4CWBA 2W7PA 2Q3PA 2UV8A 4PYDA 3CO0P 3QGGA 2VOOA 1RT7B 3OR1B 1YX2A 2M8HA 3ENVA 4ZKAA 1V5IB 3QJPA 3KJVA 2W4DA 1IQTA 5HJYA 1NK9A 4KGKA 2LQBA 4KV8B 2FLLA 3E2EA 2EFNA 2FJAB 1HLWA 2CPIA 3IC1A 2Y1RI 5H9FK 4CLFA 1N54B 3NG8A 1IWGA 4F4XA 4C8MA 3IR5B 1RGVA 4E2FB 4ZVFA 1LXNA 2ROEA 5L1JA 1VBXA 2ZDPA 2MQNA 2MQPA 2XY5A 3IM9A 4NLVA 2BM0A 1LWEB 4H4MB 1W2BR 3AJDA 3BQ0A 2JEIA 3HJVA 2CNOB 3DOLB 2YNHA 2WHOA 2X1FA 3T6BA 2QTWA 2N4DA 5A8KA 4YDXA 3CDEA 3MTKA 4OYWA 2XSJA 3A13A 5LT5A 2P9CA 4DUYF 3K2YA 3T6JA 3FBEA 3CNQP 1JJHA 1KVJA 1TKZA 4LSNB 1PO6A 1FERA 2FGOA 3QYYA 4KC5A 4IFVB 2HVEA 3UI3A 1N0UA 3R3TA 3V4MA 1S10A 2EBEA 1FVQA 1PG5B 4MKYA 2KDOA 3MAQA 3BGRB 3BO2A 5F9LA 1S59A 1FRJA 4J5OA 4K8RA 4A47A 2CQ2A 3OTEA 3WC2A 4N76A 1HFEL 1N5VA 3ULHA 3JQMA 5DLFA 2M4MA 3FDSA 3GQCA 2OD6A 2PI5A 2FD2A 3U1NA 4JI6J 2XBPA 2I9SA 5CYJA 3T41A 1PAUB 2RDDA 3TARA 4WU3A 2VIHA 4HHHA 4WBFA 1HARA 1YTYA 3NNHA 1RBLA 4DPUA 4ATNA 1S4EA 4NOHA 2XMWA 3BV8A 2D3ZA 4ANDA 4ELVA 2XSFA 2MTLA 1RWNB 3CIMA 4N8OA 1VBKA 3QZ7A 2WB4A 3I6PA 1S97A 4QQBA 2GHPA 2ZH8A 3G71S 1TMMA 3TA0A 1GAOA 3ZFVA 2DNRA 1WG1A 3M6VA 3VZHA 3G6YA 3HLUA 2R7UA 5F9NA 3N6NA 3DI6A 3CMAS 2R4FA 4TU8A 1CC7A 2U2FA 1FKPA 4P71A 4PCQA 4DCPB 2ACMA 1FXRA 4K4VA 4EO6A 3UDLA 1AUDA 1SCJB 2B5JA 3MR6A 2I5JB 1S1VB 1RT2A 1M5KC 2E29A 4CYUA 1CJTB 2MHEA 3TO8A 2RDIA 2OPQA 4OZ3A 4X4UA 2QA4S 1IKWA 1JB0C 3SQGA 3SI8A 5E3CA 2CZVC 3HT3A 2G13A 3KK2A 4LF8J 4GKKJ 2FJXA 4IUFA 3H4DA 1C1BA 2MDAA 4M63A 1AA1B 2AZ3A 2W01A 1DARA 4QWDA 2DXEA 2UUAJ 2UZAA 2HVHA 5ETVA 4P7VA 3THTA 2Y8WA 2K1RA 4JI7J 3H8YA 3D54A 5DDOC 1HBUA 3D6HB 2F4VF 3CMQA 3T5LA 4K4TA 4G1QB 1NAQA 2FIUA 4YOEA 3AD7C 4DUYJ 4NA1A 3L09A 2BJ3A 4OLPA 3E3XA 1FRLA 3TA1A 3NMRA 3KNGA 4X64F 3KMQA 4A8WA 1RT4A 3HVAA 1EB0A 1P9YA 4XPCA 1UP1A 3DU5A 2F1FA 4DSLA 4ZOSA 4OL8A 3A1YG 4EUVA 3BSCA 2GCFA 4RUHA 2NYIA 4UTGA 2KKHA 1F2HA 2C2OB 2VQEJ 2DJWA 4IFYA 1ZS6A 4DR6J 1YRXA 1D9FA 3RRKA 2J7KA 4ECXA 1ZAWA 5D4PA 1Q79A 4URGA 3Q86A 1WSVA 3M2UB 1JKHA 3GV8B 3G6XA 1BUXA 3VHQA 4OI0A 3K57A 1SL0A 3MPWA 2J6UA 2OHDA 1E6YA 2VBZA 1U45A 2B5JB 3V6HA 1KQSR 4PAAA 1V3RA 3I5CA 1B7YB 4CYUB 1RAFB 5C24B 1VMBA 2G2ZA 1UZDA 5D15A 5KG1A 3QBCA 4I6AA 4AYBD 1IKWB 1WNEA 4IR9A 4IRCA 1TZ0A 2HZVA 3JSRA 2G0JA 3GCWP 3KK2B 4GC7A 5KFPA 2NLWA 1RWPB 3IBFB 3K7RA 3MPVA 3G6ES 3VAHA 3GYGA 2DGTA 3MMAB 4ZPWR 2B9EA 3J7ZT 3GJRB 2HAFA 2J76E 4OIXA 2GMLA 3QT7A 1HBUB 1DTQA 3QSYB 1RUSA 1LFWA 2D41A 3N01A 3J80U 2G9OA 2QFIA 4ZP7A 1P9QC 2DGUA 3CIZA 3ZZOA 4JI4J 3DNCA 4IQXA 3GSIA 1YITS 2E1CA 1VLYA 1RTZA 4USWA 1QSSA 1UJ4A 5EX0A 5BJRA 1VK3A 1RT4B 4K50A 3IO1A 3OFHA 2ZHBA 2Y1IA 4W98A 4CLWA 2R2SA 2CQPA 2R9LA 2V34A 4DN0A 1RA6A 4R5PA 1ZM9A 1JLBA 4CO2A 4DOZA 3ZZZA 1WC4A 1TL5A 3BQ1A 3MM6A 2HS0A 4IFYB 1VISA 3GIKA 1U1OA 1U2RA 3GE9A 2ZWOA 1TVRB 4DS4A 2KFYA 4DV4J 2CQ3A 1VYAA 2DGWA 3TX8A 4DUTA 1RAJA 1VQPS 3A4TA 2G1HA 1HBOA 5G4DA 4WTYA 2A6MA 1JKHB 3FSYA 2D3UA 4C11A 2VDIA 2M88A 4NZ7A 4IG0A 4TLQA 1JLQB 1FRKA 2VBXA 4RPFA 3CC7S 2DO4A 4MJKA 2DB1A 4A48A 4CLLA 3CJ3A 1JMTA 5GAGI 4CCHA 4FNHA 4V1Ak 3H40A 3ILLA 1Q53A 1WUUA 5D4OA 3VAMA 1FEEA 2KFNA 1VQOS 4C2MA 4DPOA 1WF1A 4ZVHA 1WF2A 1YRTA 4WK1A 4ECRA 2AKWB 1T94A 1Q7YT 5K8PA 3OQ2A 1SB6A 2ZBPA 1BMQB 5HAOA 4FXVA 1DBDA 2JLEA 4CNZA 3MM9B 1IM4A 1HHQA 2WTFA 1X4FA 3M30B 3ENWA 1PBUA 1KN6A 2H51B 2K2PA 1UKUA 1HA1A 3PV8A 1RCXB 4LQ3A 4DR4J 3KUHA 4KO0A 1XNQJ 2FVCA 4P2MA 4JI3J 2XEXA 2LLZA 3TW0A 4L72B 3HHEA 2FYXA 2XLJA 1CG2A 2YTCA 1N34F 4DMZA 1R8PA 4ECYA 4A46A 2IM0A 5GAHI 1RJJA 3T1HJ 2DNZA 3VVUA 2C3OA 1T3NA 1JLBB 5KFGA 1N6QB 2BW7A 2VPWB 3DDIA 2CWKA 3LUYA 1VC0A 4HI1A 5CCMA 4O4GA 1RWOB 2HNDA 2R7QA 2XWXA 4R0JA 5HROA 1TL1B 4C8YA 1PIEA 5LJ5Y 2AX1A 1V3SA 3R5BA 2MKCA 5G0RB 4NLSA 4NCGB 5K8NA 1HBOB 1RADB 2ZH4A 1QE1A 2HS3A 4C11B 4IG0B 5F8GA 1WHWA 1T9WA 3TJAA 1NRKA 2EEYA 1RB0A 1TR0A 3W2WA 2YKNB 3AA9A 1R3NA 3KLFB 2W8KA 3MGJA 1HW8A 4B3MJ 4OHWA 3QSIA 5AE3A 1K73T 3AOBA 2AYGA 4NZ6A 4U7CA 1S5ZA 4FYXB 2KYXA 5DETA 2ROPA 2F7VA 2E7VA 2MYFA 1DFDA 2HG4A 1FRHA 4KHMA 4G3IA 1PJ5A 2V8PA 4RWWA 1KVKA 2BMBA 3KHLA 2MKIA 3SCJE 1WC6A 1MWYA 3T9ZA 2E7WA 5BR8J 5ETNA 1KLNA 2W8LA 2V50A 2RJZA 5AXNA 1TL7B 4MYUA 2XS2A 2DIUA 3MECA 3LP1A 3UN5A 3JB9k 2FHJA 2E5LF 4RZRA 2WW8A 4X2BA 1FO1A 2PC6A 2VPZB 2BJEA 2HFSA 4HDGA 1Q95G 4OHXA 3RB3A 2KRBA 4JUZA 3JTOA 3W7BA 2O66A 1R7IA 2LXIA 1YBTA 3Q0AA 3ILJA 5A6WA 4WKYA 4JYAF 1NDPA 4ZVRB 2XG8A 2K8GA 1X60A 4USMA 4FXDA 1UEUA 2HNDB 4RBTA 4TU9A 2OEJA 3FUYA 4WP9A 2R7RA 1Y10A 2YQ3A 4DS5A 1Q7LB 4LFCF 1YJUA 2G0CA 1I51B 1FT8A 3RBXA 1EETB 2IM1A 2CQ1A 4LF6F 1QE1B 4QPXA 8ATCB 3MMCB 3NGDA 4ELUA 2IY5B 4Y3CA 3W2WB 4RNOA 4N7TA 2B9WA 2PGCA 1FA0A 2CJAA 5KT6A 1SIZA 1WEYA 3PX4A 3EZOA 2CPHA 1CVJA 1WWHA 1RAOA 4FBUA 4KR0B 2H1YA 4NLOA 2E5IA 1MWQA 3AT1B 2HHHJ 2GA7A 3M6UA 1KR4A 5HLFA 5I3UA 1RHRB 2UXBF 4BHQA 1SC3B 1U1NA 4LRAA 3OTOF 2B43A 3CGIA 1R0AA 2BKPA 5DRKA 4KH1B 3GG0A 4PG7A 4ID5A 1J5EJ 4KE5A 4PXDA 1M5PC 2Y0SD 3K5OA 4F7VA 2LA4A 5K5MA 5E2QA 1VGYA 3NWGA 5GADI 1HR0F 5L8RC 2QYGA 2Z8QA 4ZPDA 3HD2A 3B8HA 1WC5A 3R5AA 3GWCA 2EFQA 4X66F 2XMVA 2FC8A 4UY8T 4X4NA 5DO2A 2DIVA 2W2QP 2HVIA 2XY7A 2NYHA 2YPYA 3G8QA 2OPPB 4OQJA 2Y3YA 4Z7CA 1Y11A 4QOTA 1CJUB 1S49A 1AZSB 4DEZA 4F4AA 5JUMA 2HGNA 2UUBJ 3J7YI 4DDFA 1WSRA 2P6SA 2H4YB 3KLGA 1EKSA 4JV5F 4NCBA 1RYSA 4AL7A 1NK5A 1HNZF 2GO9A 1U0HA 5GMEA 1XBWA 2PA3A 4ZJQA 3BH6B 5LSOA 4X62J 4I4BA 1M5SA 4I7FB 3G8TA 3C3LA 4DJBA 2Q66A 2UV8G 1XN9A 3HKZD 4ZCIA 4ECUA 1SH3A 4N41A 4DG1A 2BVZA 2C1EB 5KFAA 1H98A 2LXFA 4DCJB 2ZWPA 4O3RA 2R2TA 5JVGQ 4ZMMA 4LF5J 2AX0A 2MLYA 4KSEB 2DGXA 1FWKA 2LDIA 3DRSA 2XMUA 1W25A 3NGKA 5HLFB 2WBMA 2VJUA 4TY9A 4WZMA 3AXMA 4UOGA 1O5JA 2V69A 3QGIA 4J91A 2AQ4A 1Y5LB 2KZZA 3KG1A 5KFIA 1AFJA 2RU9A 1NK7A 2EK6A 3T5JA 2ZBCA 2E66A 2EKNA 4CP5A 4DFMA 5KFFA 2V2QA 4PR6A 2GVDA 3M9OB 2CADA 2VG7A 2RDJA 2DR6A 3TANA 1JLAB 1JWWA 4HACB 4CH1A 2ZHAA 3M2RB 2L9WA 2W9CA 3N6LA 4DV1F 4Z2XA 5ETSA 3R2CJ 4ZN1A 3JSBA 1NJIT 1BWVA 2XHCA 2HZAA 1HPZA 1D9AA 2GX8A 4AL5A 3CJ8A 1V9OA 1EHWA 4DL5A 2ACYA 5LJ3Y 1ZYQA 3M1VA 3GIMA 3MUMP 3HFZB 1WTBA 2XM3A 4CM2A 3ISNC 1NEEA 2U1AA 2HRTA 1U0HB 4DXLA 4CLZA 3WIUA 2AYMA 1KP6A 2Z2ZA 4RNFA 4OYBA 3H5SA 5J1EA 2M52A 2B7BB 1GMWD 1I1GA 4QU6A 2RAQA 1MG7A 3UVJA 2FJWA 3NEKA 4HI2A 3CCQS 3WHIA 2V4QA 4CIOA 4GO5X 1CJVA 1OSCA 2CPFA 3KHRA 5K8OA 2DEJA 1QAIA 3FVYA 3M8SA 1I94J 4C8ZA 2GFFA 4X66J 2LQ9A 3M8QA 4LRFA 1B0TA 2OGUA 2YKMA 3G86A 4URQU 3CD5A 1ZPVA 3AB2B 4OV1A 1UWBA 4NLYA 1UA1A 2C22A 2R7TA 3VV2B 3W64A 2F9DA 1G2EA 2Y1LB 5J2MA 5EHHA 2HFZA 2DK2A 3D68A 4C8KA 5MAOA 3NBPA 3L7OA 3EGVA 1H2TZ 2MY8A 3OV7A 2R8IA 2DPIA 3VAKA 1S1WA 3DGPB 4JV1A 2PIIA 3EZ5A 1NUEA 3C8YA 3LW5C 2W9CB 2PEBA 4H4KC 2O5DA 4CLYA 2X51A 4ES2A 3UD4P 3HVRA 3DLLQ 1HPZB 1WF0A 2BYCA 2D69A 3PTWA 1VRTB 2A3JA 1HD0A 3G8SA 2D74B 2KL8A 2RHQB 3M1VB 9ATCB 3GILA 2Y0BB 5DG7A 3SFUA 2PD1A 4LSLA 1U02A 4F0KA 4ZS6A 5AT1B 2ZUGA 2DNLA 1PCAA 3BR9A 5E41A 2BJ1A 2YQ1A 2KVQE 4NXNF 2GNKA 1Y5IB 2AGQA 4ZJOA 1V5VA 3O1LA 3C15A 3OHAA 1VK8A 4IO1A 2R8HA 1YI2S 3O2IA 1U25A 1X9MA 2FPHX 3CJRA 2WVCA 3L95X 2DHXA 3MCOA 3CB4A 1CJVB 3CCWA 2ATCB 3F44A 3KK3B 1S9GB 2UVUA 2GZOA 3TEHB 3PVXA 5K14B 2QA1A 2YWEA 2N82B 3K89A 1K0TA 2F9JA 2Q43A 4DV1J 2IJNA 5EWEA 2MLXA 2YKMB 2JLGA 4DI6A 3PO5A 3IWXA 2W25A 1UWBB 3LP2B 5L9XA 4OYPA 4FNIA 2KI2A 3SBMA 4B3RF 2V2ZA 1HHSA 1UJ6A 2J6SA 1H7WA 2XY6A 2QMUB 5J2MB 5D0EA 3ZZTA 3ZZPA 1Q5YA 3BH7B 3NBPB 1JQGA 4UOFA 2OFHX 2MQQA 4KGVB 1CJKB 3UN3A 2VFVA 1CULA 3MEEA 1S1WB 1QUPA 3NAHA 4P6QA 1NSQA 5F8MA 4E98A 3SSRA 3PYDA 1H74A 3EWGA 2B4OA 1PAEX 1QJHA 5IWAF 2DITA 4ZPTR 2MQOA 2M5YA 1IBKF 5BYRA 3PY8A 1PILA 4C3MA 2GIQA 4GKJJ 3ELHA 5KFTA 3PG9A 2A1BA 3HT0A 1JXLA 4RUBA 2R7VA 5HBMA 2UXCF 5RUBA 1LK7A 2BQUA 2BANB 1N56A 1S0MA 1F2GA 1QTMA 4AQYJ 3CT9A 1YWXA 5EGYA 3ZTPA 2GIFA 3VGTA 2E9RX 5IXUA 4OHYA 4DZ6A 1RACB 3W9JA 2IYGA 1RT1A 3MOZA 1HYSA 1F1BB 1TKXB 3DC2A 4LF7F 4CRJA 3QT5A 2KHDA 4YS2A 2I8EA 5F3ZA 1Q0NA 1IXKA 5GMDA 4DLEA 2PFFB 5D3GA 4K4XA 1MLAA 1WDTA 3TZYA 4RWXA 3BGOP 1S1UB 4U7UK 4K4WA 1O51A 1PYOB 4EBDA 1J27A 4AUKA 3TAPA 3NXZA 3ADAC 4Z7YA 2CQGA 5FDLA 4Q43A 3EYZA 1TFWA 4PWDA 4J9QA 3JAMY 3DRPA 1SL1A 5E0OA 2L9NA 3PYGA 2DNYA 1O8BA 4EGLA 1VQ6S 3RAMA 1NDKA 2DH7A 2XLKA 1XMOJ 4PG5A 1ZM4A 1IBLF 3MCSA 5A76A 1K1QA 2DXDA 3FMWA 2XGQA 3MTJA 2A2CA 3LOUA 4ICLA 1HL6A 5A2QU 1WG5A 2KO1A 1LFPA 1XTZA 3V2UC 4WIQA 4ZCKA 3QNWB 4LR7A 1RT3B 2QFJA 2AT1B 4F0MA 4K0KF 4IG3A 3NCPA 3TX0A 3N5FA 2Y9HA 4XAKA 4LF9F 4OZLA 2FHKA 5KFEA 1S6UA 2VZ9A 5IT4A 2UVWA 3FCHA 2C2EA 4LFBF 1NPPA 1S72S 3R6GB 3B6BA 1KD1T 4LFAF 2OSQA 1JIHA 2NSBA 4DQIA 1AYEA 4B9MA 1H38A 4OZJA 3LGMA 4QR0A 4Q0BA 2HHWA 2KTQA 1HNVB 4MAKA 4QBUA 3AQOA 3A8EA 3PRBA 1TK0A 4ITSA 2F4FA 2Z56B 4HEA9 3NGTA 1YRUA 1TTHB 3RW6A 5IT9U 3AY0A 1ZTTA 1REVB 1F9EB 4IO9Q 2YNFB 1RWWB 1FTRA 4JI8F 4ECTA 2HBZB 1NJYA 1IQZA 3L7UA 3QJJA 1TQLA 4R8UB 1MNEA 2J9EA 4F50A 3ILIA 2GAHC 4RW9A 2EFPA 3FZBA 4YY3J 3W66A 5CZXA 4F3OA 3B4DA 3MURP 3DRPB 2IAJB 3V81A 2HBRB 4J7CA 4F2SA 4U8VA 4DSJA 4MT1A 2CQ0A 5EUHA 1VC5A 4DV5F 2WAQD 3T3FA 2YWFA 2J9DE 4RW7A 1KQKA 3GU0A 4XIUA 4ICLB 3R1HA 1TFYA 3KK1A 2FLOA 1FESA 3BM7A 3W9IA 4QYRA 1IKYB 3H4BA 4IG3B 3LQVA 3BPDA 2ZM6F 4GMKA 4YHHJ 3FBCA 2QV6A 5A8WA 4FZVA 1RT6B 5E7OB 3PW0A 5C25B 2FLPA 2JLFA 5J2QB 4UUXA 2VG6A 2EKYA 2BXJA 3P4UB 1OY9A 4PWUA 3N28A 2ZH3A 3PIPQ 4NLRA 3GJSB 2XYHB 3FQLA 3AOAA 4DL0C 3B78A 4E0DA 3CDWA 4G6VB 2HLUA 2FUG9 4TVAB 5HI7A 4QIVA 2OAUA 3PJXA 3TUIC 4NLXA 4MFBA 3HXMA 4B17A 2OI2A 3AB4B 4F3MA 4MIBA 1VQ8S 1UW4A 4J9LA 3HHNB 5HQLA 3CJ2A 4DR1F 2FB0A 1IBMF 2YNIA 3HHLB 2BA9A 1WACA 4DPTA 4O4RA 1Y5NB 3V4IA 4K0KJ 2ZOFA 1GNKA 3M32A 3D4JA 1DY3A 2CAJA 4OI6A 4FS2A 2N4CA 2XI2A 3OSPA 3HHLC 4F3QA 3KLIB 4NRTA 5J2NB 3Q8RB 3M05A 2PDAA 2PFDA 4M94A 3IG1A 4JI5J 4A8KA 3V81B 1WTFA 3VGSA 4WTOB 3GR1A 3H7HB 1Q78A 3HCXA 3HO1A 3E8OA 2HNYA 4USTA 1VBZA 2Z30B 3CCES 2AV5A 3ETMA 4DPWA 2CJBA 2ZH9A 1N4LA 3VALA 3IM8A 4PWWA 3M4XA 1RP5A 3PKYA 4EBCA 2KB2A 1X5OA 3DHXA 4ZVGA 3SDEA 1XQIA 3MMBA 5A8WB 4ZDNA 2YY3A 5DZ6A 4FKXA 2VG6B 1RTDB 4C0HA 1HWIA 1IUJA 2ABYA 5B0AA 5CZVA 3KHHA 1UEVA 3OR2B 2B4VA 3QRQA 1X4DA 4B3SF 4YR3A 5GAGU 3HSDA 1RTHB 3DMJB 5LL6d 2EPIA 3D0HE 1U8SA 2VQFJ 5M2UA 4RW6A 5ETTA 2PT0A 1O0PA 2MGZB 1ZBTA 3LP0A 3D3BJ 2OFGX 2J9DA 2JEGA 3W8PA 4EYIB 2CDRB 4PZVA 4KHPF 3E51A 5LOQA 1U1RA 3DM2A 3A3PB 2B9YA 2LMIA 1S1TA 4OI1A 3GJQB 3KLHB 3RG6A 4YQWA 4UQGA 5E33A 3MEDA 2D9OA 5DM6Q 3OVBA 4L76A 4TKTA 5IZHA 4WPAA 1C1CA 3JXOA 4AE5A 4A4JA 3W2VA 4NI2B 1X4AA 1JLFA 3PDNA 2IHR1 2BKOA 3HSGA 3IG1B 2CDQA 3UE2A 1HMVB 3BGLA 2KZMA 1VS3A 1UVNA 3PM9A 4X84A 5L46A 3QJLA 2DY9A 1REGX 1CC8A 1HIYA 2MQ8A 3OUYB 3OL9A 1SPBP 1VHFA 2G0IA 2MJUA 5KFKA 2XO7A 1UFWA 3CJKA 2HNYB 3KLEA 2PE8A 4WP8A 4NWBA 1SJRA 1XERA 2NXNA 4RW8A 1RA7A 4Y2IA 3ZZUA 3RZAA 3LH2S 2DNNA 1S6OA 2OMOA 3BSAA 1JLCA 1LEOA 2X3DA 5SZTA 4NCAA 1IKXB 2R8JA 3JQKA 2WCXA 4OHVA 3DLKB 2J5AA 3MMBB 4WF9Q 1JLEA 4L75A 4NLQA 1FK9B 2N3OA 2OPSB 2HNZA 4K5SA 3QRPA 2J6TA 3I56S 4K7QA 2N7CA 3S6EA 3A8KA 2DGSA 4I2PA 3D6FB 3J7AN 5M2RA 3CW2C 2MZTA 3SQOP 2P5VA 5H9EJ 2R8GA 1W7WA 1TELA 2F8HA 1FFWB 2ZE2B 3I0SB 5KT7A 3RBEA 5CQGA 1HBMA 4JI2J 2BRLA 1FKOA 1QD1A 1FDNA 4FN5A 1R43A 4LT6A 5DGAA 3EPIA 3UD3P 4IOAQ 3L9ZA 4IDKA 3J81Y 2C2ZB 4ETZA 1LQ9A 2VHGA 2I1RA 2RILA 3U1LA 1DURA 4F0HA 1N36J 4HH0A 3QRRA 4WYLA 3WX4A 2P9GA 2LEPA 2RT3A 1LOUA 4DF8A 4CZCA 3GMGA 4FF2A 2XB2D 3I96A 4JI1F 3JSYA 5A0YA 1Z4UA 2UXDJ 5LMNF 4DV3J 3M8ZA 3ZXWA 2VKRA 4QW9A 1N5SA 1GFWB 1C1CB 2ZNZA 2JVOA 2RUSA 2PA8D 2MKJA 3M8PA 1XWLA 2XMAA 5HO4A 5D6GA 1IWAA 4DR7F 5HQMA 4QCLA 1S48A 5CHCB 1CPZA 2RS8A 3TJ9A 4DWIA 2GQCA 4B3SJ 1GH8A 4ZHRA 3DOKA 3CJKB 1T03B 1SC6A 3NLCA 2V4RA 2GJ2A 2YX4A 1YGYA 4RW8B 4DQQA 1NB2A 3CJ0A 1CQMA 1JJ4A 2HURA 3JYTB 3T9NA 1PJ7A 1S1XA 4A8QA 4Y0FA 3I9ZA 2XLIA 4DL3A 3DHWC 4WXWA 1IR2A 3IGNA 2F65A 3D3CJ 1GEHA 4B02A 1TAUA 3K5MA 4WJBA 2JNJA 2IMWP 3R5CA 3C6TA 2NSCA 2VFSA 4XDDA 3BDEA 3BBBA 3C66A 2MKKA 1X4CA 3ONQA 3RRGA 2K06A 3BEGB 1HBMB 3B54A 3IAM9 4RU9A 2LDYA 1JK9B 3L3CA 4DV0J 5B0DA 3DLJA 5B09A 2UU9F 5CD4H 5IM0A 4DSKA 2R7SA 3UPFA 2VONA 3OD2A 1LW2B 3VTIA 4ED1A 1KFSA 3DDKA 4RX6A 2LYVA 1NKBA 1PSDA 3T1YJ 2DHGA 1S12A 2L3MA 3I4PA 4NXMJ 2C2DA 5A0YB 3OPKA 2QEXS 3LTOA 4GRSA 1N32J 1WC1A 2KHCA 3CWJA 3U02A 5KG5A 2GAGC 1Q1KA 4P7TA 3M8PB 3C14B 4ZVUB 1MROB 2HFVA 1P8GA 5ETOA 2HS4A 1G3OA 3FEZA 2HQIA 1LXJA 4AL6A 5AXLA 2FY1A 2YWHA 3Q22A 3JS9A 5KFDA 3VWSA 1EIYB 3TI0A 4ED7A 4EI2A 4LF4F 1FJGJ 4ED2A 2IC3A 2CPXA 1XMQF 1HWKA 2DH9A 3NL0A 4UF4A 2B8PA 2DY1A 5T7LA 4W4MA 5KG4A 3KHGA 4O44A 4IR1A 5GAEI 1YBUA 1OY8A 1AT1B 2DEIA 2HFUA 2GQ2A 4H54A 1TL3B 4ILLA 1VQ7S 2PN6A 2C42A 3BO4A 3H98A 2CQ4A 4WFZA 2QRRA 4ZVPB 1S9FA 3FRZA 4ZCMA 4GC6A 2V5HG 1P1LA 2ZJPQ 5KFWA 1HBNA 5F0UA 1X0PA 1FD2A 1TU0B 3S8SA 3C6TB 3V6DB 3TWZA 4WZQA 2IYIA 2NZ4A 1VLOA 1YDLA 4PPDA 3MFIA 2AYBA 2BKNA 2N7YA 1AW0A 4WE1A 4WIIA 4BBYA 3BGUA 3EVOA 5DQGA 1NPRA 5IM0B 2EVZA 1A0OB 2BEFA 3D0IE 1RQ0A 2FHJD 1T05A 1NSKL 2ZVIA 2QC3A 2V8HA 1X8DA 2HK3A 4YFUA 2RHSB 3MCNA 3N79A 3ETOA 2VG5B 1VRUA 4USHA 3P3DA 4KRWA 3PXGa 1UVLA 2NQPA 2YQ0A 2QLJB 2VL1A 4URSA 4JOUA 4JI0J 2VBWA 2ZZNA 3P5BP 4KT0C 5K8MA 1BQMA 2XMMA 1U24A 4NE9C 3HK2A 2LQJA 4C97A 2HQFA 2IJRA 4ANEA 4X4PA 2RRBA 4FS1A 2E5JA 2CQCA 1TKDA 4CNYA 1HI0P 4LBPA 3KDOA 5CAAA 1ZAXA 3MPUB 3RR7A 3BR8A 3R7BB 1TV6A 2BUNA 3EUNA 3A12A 2HPUA 3DOMA 1S0VA 3HD1A 1HWJA 1NBEB 4PKDB 1FJCA 3FBFA 4LIRA 4QW8A 2QX0A 1SV5A 2RQMA 4QWCA 3IS9A 1RWKB 1HNXF 1KEKA 3RRHA 2XCPA 1KONA 4K4SA 3B82A 4M5KA 2XGPA 3QLHA 2LEAA 4J9NA 1RE1B 2XI3A 1RT5A 5HQ8A 1R27B 4J9MA 1HBNB 5FIIA 2HBQB 2Z57B 2LU1A 4C0OC 2AEMA 4YR2A 1T7PA 4WFNQ 4U6PA 3MEGA 1UAWA 1SBRA 4ZP6A 4O3NA 3CF5Q 2XZWA 4GO7X 2LU2A 2Y8YA 1RDRA 4WE1B 4EFAC 4WCEQ 2OPRA 5D77A 4FBTA 2RF2A 1WKLA 3O44A 5A2QY 1B0VA 2KVIA 2V4JA 4I2QA 1FJEB 4P75A 2NCKL 1YJ7A 2B9XA 2CPJA 2ZKUA 2ZD1A 1S6PA 3ISND 1FNOA 2BE2A 4CO4A 1NCLA 1RK8A 5BYSA 4KPYA 3D7SB 3R7NB 3N0VA 2APOA 2RE1A 2MZQA 2BBEA 5C42B 2O67A 3W9HA 1SKUB 1RWUA 3DDNA 1Y0HA 1KRPA 3WZ0A 1BQMB 4DV7F 4DSFA 2Z2YB 1N33F 1RWVB 1OY6A 3BQ2A 4DFJA 1Q4RA 3H20A 1SJ3P 4QU7A 1F5CA 3HKWA 3FEXB 3LAMA 2XS7A 2Q6CA 4MK9A 2CA9A 1NHUA 2KU7A 2C28A 3JTPA 4HDHA 2FTRA 4OYAA 2QO3A 2ZC4A 4Y2MA 1GXUA 2VH7A 1TV6B 1APSA 4EMDA 2VC1A 2AJFE 2ZH6A 3ZTRA 1A7GE 5B0FA 3T1AA 1SV5B 4YN3B 1C0UB 5IT9Y 3FNNA 2CJKA 3E01A 2YPZA 3IS9B 2DGVA 4LRDA 4Y00A 4NX9A 2KXHA 1F6TA 3QLHB 3K8VA 1O6XA 2V8VA 3UDEA 4E8UA 4IQMA 5GMKa 3ET6A 2JFKA 3KJVB 4LVNP 1U6FA 1CLFA 4TXSA 2KXNB 5AJ3J 3UDCA 4KYZA 4TYBA 3FCVA 3HSJA 3IA0A 3D9BA 3D1OA 3MEGB 1VR6A 5D8HB 2G2YA 1DLOA 1RAEB 5CYMA 3FK4A 1OYDA 3P96A 3TEGA 4OZ2A 4JB8B 2EK1A 4F26A 4ZK7M 2HQCA 3O6QA 4DR3J 3AJ2A 3BYRA 3CO9A 5A8RA 2EC0A 1S6PB 2CYYA 1X5SA 2YNHB 4QWAA 2UUTA 3O5TB 3GZ7A 3MI7X 1UA0A 1HWLA 5A8KB 3HHKA 2WONA 1Q82T 3M2VA 3LO3A 2XSJB 2W1BA 2ILZA 2MY7A 4RW4A 5F8IA 2BQRA 1SKRA 3EDQB 1UFLA 3LANA 1SIWB 4YR0A 2POKA 5J2PA 1EJ7L 2CFXA 3AQPA 5KFQA 1NM2A 3BSOA 1TKZB 5ETPA 1YLXA 5B0CA 1S0OA 2MKSA 1VCTA 1ZM3A 4D3GA 2XMTA 3TVZA 4KFBA 2IVFB 1IVZA 3TNVA 3UR3C 2JJ4D 3GIIA 4C9DA 1HNWF 2RQCA 2CZ4A 4ID8A 3T5HA 3CCZA 3TP2A 1T02A 2YKPA 5IC4B 3GFYA 3PYFA 4PEOA 1NDLA 3E01B 3PYEA 1U09A 1FDBA 1X9WA 3VGUA 2GVZA 1SC1B 4N77A 1FRXA 1SJFA 1EQMA 4OYXA 4P9SA 3A8JA 4F25A 2XZTB 4GVBA 5JXSA 4CO0A 2LFVA 4CQ1A 2AF6A 1H2UX 4J9UE 3W63A 4HH1A 2FZKB 4G1PA 4LMZA 1J5OA 1VQ4S 3EZUA 1N33J 4FVCA 6FDRA 3W60A 1PC4A 5DDRC 3QT6A 3WDOA 1KFDA 4ER8A 3OT9A 4S0MA 2H65B 3R27A 5CXTA 5CYMB 4QWEA 3NRBA 4F36A 4ED3A 4KGXB 2HMIA 1L3UA 4ELTA 3OVSA 3F73A 5CABA 3SXLA 1UVIA 1U6ZA 1VQLS 1U26A 1NKCA 3EGZA 3QGPA 2W24A 2IIHA 3F56A 3SCIE 4J9KA 2HHUA 5LMUF 1FKAF 2Z2LA 5A8RB 4LF1A 2J7UA 4PG8A 4DF4A 2QIFA 2XHWA 5KFVA 3KLVA 2EFOA 3SZ2A 4QIFA 3I87A 2P2CB 2WONB 2ZH5A 4PQUA 3ICLA 2FC9A 1D3WA 4ECWA 3DI6B 4RW4B 2ZOMA 2A2DA 3UNYA 2RH3A 4P2FA 1FKPB 5IV4A 3TUJC 2DNOA 4B9NA 3PNIA 1RAHB 1URRA 2ZBIA 4L3NA 1RT2B 1VJWA 4HTJA 4ED5A 1N5YA 3H5XA 5C2GA 4M95A 4ZJLA 2OPQB 1KLMA 1ZAVA 1VHIA 1RU2A 3BF4A 1T3OA 2R7WA 3D28A 2UVVA 3MFHA 1NJXA 2MJNA 3D5MA 2CPZA 3GFZA 3SQGB 3W3SA 2HFNA 2IBOA 1LWFA 1Y7PA 2BX6A 1ULRA 1K1SA 1MMDA 1F60B 1T9YA 1C1BB 3BBCA 2V9KA 1S0NA 2NREA 1HQUA 1VQ9S 5KG6A 2OSRA 1TUWA 1V3ZA 4DR2F 2BZ2A 2K1RB 2HGMA 3PHTA 2RSQA 2NR0A 5KFYA 2FQQB 2IMOA 1IKVA 1LWCA 1U1QA 4OI4A 2RNEA 2G1DA 1J5OB 3B4MA 2CQDA 3H5UA 5ETLA 2RQ4A 2VFUA 5EDWA 2GGPA 1UVJA 3A3OB 4MKBA 2VA2A 5DDQC 2E1RA 1A6LA 2C2KB 1RHJB 4ZPAA 1C0TA 2HQGA 2MZJA 2RIJA 2CG4A 2XQCA 3DLEA 3QAUA 4M5JA 1E6VA 4UOHA 2QGFB 1PJ6A 2DXFA 3K5LA 3K0JA 1RWXB 3N9UC 4V19J 4DQSA 3JAMU 2NUUG 3S7RA 4PQUB 4USIA 4AXIA 3DLBA 4U95A 2GMJA 3SYZA 3AAWB 2BM1A 2PMZD 3S1TA 2CPYA 2QZ8A 2MQLA 3PCOB 3EICA 1E6YB 4PXBA 4PRFA 3W65A 3DLGA 3LAKA 2F4VJ 2AGOA 1N5YB 2B4UA 2W9BA 3ZZRA 4FYYB 1UETA 4U9RA 2FDNA 4TN2A 4I67A 2ZH7A 4FYDA 4X64J 5IT0A 1VDHA 3K59A 2RMLA 3W8GA 2VV5A 3UFCX 1HNIA 1NSPA 1OIAA 3ZNJ1 2DYAA 1LWFB 3GG1A 4P2SA 1XNRF 1EZZB 1Q86T 4ZA1A 1UEKA 1XC9A 4RU2A 2HSEB 2OP5A 2IA6A 2QMWA 1NJWA 4ECZA 3GTYX 1GX5A 1TL4A 2J0SD 1KTVA 3IRXA 1S9EA 1DTQB 3DRXA 1M5HA 2CQHA 3PW7A 1F3VA 4UT4A 4P10A 1ICEB 4DR5F 3G2XA 3KJNB 1CQNA 2GJIA 2WOMA 3D66A 4KGZB 1QDUB 1YJ9S 1BGXT 3PJ9A 5KFJA 4OFZA 4WU2A 1Z2ZA 4QJVA 1RAIB 4HYKA 4R5PB 2XMJA 3ILOA 3CJQA 2VFTA 2C3MA 1CBKA 1FCAA 1UL3A 3HSZA 3DLEB 3U27A 3MM6B 3R9LA 2ASYA 2MEWA 5ETMA 2CG8A 1GMVA 2Z4PA 1YHQS 2E9ZA 3SIPB 2KM8B 3R5DA 4X65F 3MD3A 2I38A 5HP1A 3I32A 1H73A 4C4WA 3R8YA 4NYOA 1ELOA 1YQHA 3MR3A 5IOLA 2KM8C 1VQYA 1NSAA 3LF0A 1ZA2B 4HT5A 4WFAQ 1S7HA 1DRZA 4FP9A 2E1AA 3OFFA 1B99A 4OJ3A 1X4HA 5CD4A 1IJFB 2IJFA 1WEXA 2LXUA 4FXWA 1HNIB 5H1SV 1PGZA 1S99A 3THVA 1T9UA 5E3QA 5KAKA 2JC0A 1TKTA 1BC6A 2V63A 1UZHA 2J0QD 3HVTA 2GW8A 5F0WA 1KSPA 3HHLD 4WFBQ 1OWXA 2XULA 5F8NA 2AIRB 5SUHA 3UWTA 2CXEA 4LJMA 4U7UD 2B6AA 3IRXB 1JX4A 3FSXA 1S9EB 3CPWR 5ETQA 3T19A 2O01C 4KO0B 3UCUP 1U1KA 4FF1A 4B3TF 2G4BA 3R1LA 1T11A 4TLRA 1H7XA 4DL2A 4A8XA 4X4OA 4IOBA 4KKOA 5KG2A 3I55S 2UUCF 4WK3A 1CSJA 2JWNA 3CCLS 3Q8PB 4M5HA 1FX4A 3BSNA 1WORA 4ZLPA 3M9MB 1FWPA 4O4GB 4JBCA 1WKKA 3OR1A 4OX9F 1KBRA 5HROB 4USKA 1OS5A 3F41A 3OXFA 2AWZA 4NASA 3TR5A 2LKZA 5D0RA 4KV8A 7FD1A 1URNA 2JZ5A 4J9SA 2HHVA 2ERRA 2EI5A 3PZPA 2C2NA 4OX6A 3MPDA 4M5GA 1Q81T 2KYZA 3IR6B 3GV5B 2HWIA 4GVLA 4M5DA 4DR5J 4H4MA 2EG2A 5HK4A 2H5IB 3UD5A 3RBDA 3DOLA 2DNQA 1N34J 1KC8T 4DU8A 1HW9A 2KH9A 3X3UA 4MK8A 1VQKS 3OL8A 3F0NA 1N5QA 4JI6F 3MEKA 4OZ5A 4ZVQB 2K7KA 1I3OB 3KJQB 2DNMA 2CKWA 2M0GB 2B6AB
chains in the Genus database with same CATH topology
2MKHA 2KJWA 2C3PA 3JSRA 2OFGX 2J9DA 2CVEA 2JEGA 2JC1A 3KK2B 3MECB 1J2VA 3LP1B 4EYIB 5KFNA 5KFPA 4GC7A 3I0RB 1KQFB 4IFVA 2NLWA 4KHPF 1Q8IA 3E51A 1U1RA 3PR4A 3K7RA 3DM2A 1G7CB 2DPJA 2B9YA 5L1LA 2LMIA 2BABA 1S1TA 3MPVA 4OI1A 5KT5A 1HHTP 3G6ES 3KLHB 1NH7A 3VAHA 2QLXA 4YEAA 2DGTA 5DJBA 3MMAB 4EBEA 4YQWA 3BN4A 4ZPWR 4DHVA 2AJ1A 3J7ZT 3BGRA 1SJ1A 1HNVA 3J80Y 2ASJA 4UQGA 2BV3A 2J76E 5E33A 3MEDA 2D9OA 4OIXA 2GMLA 2Q79A 2GMHA 2B0GA 5LSLA 1HBUB 1DTQA 5DM6Q 3OVBA 3H2LA 1VIXA 2BW2A 4TKTA 1LFWA 5IZHA 2D41A 3N01A 2ZKTA 5HMWA 5I42A 2G9OA 1ZETA 1C1CA 1P9QC 2YKQA 4ZP7A 3TUZC 1VQMS 4YHHF 3NNAA 4AE5A 4A4JA 2DGUA 3CIZA 3W2VA 3ZZOA 4Y28C 1REVA 2IC3B 2LCWA 3IWNC 1JXEA 2JDJA 2DISA 1FXLA 1X4AA 3DNCA 4IQXA 1JLFA 3PDNA 1YITS 2E1CA 1VLYA 2IHR1 1QSSA 1UJ4A 1N5TA 3OBIA 5EX0A 5BJRA 1VK3A 1RT4B 4K50A 5T7LB 2YNFA 3IO1A 3IG1B 3OFHA 2ZHBA 2CDQA 3UE2A 2Y1IA 1HMVB 3BGLA 4O44B 3CUNA 2IA0A 4NLGA 2KZMA 1VS3A 1UVNA 3PM9A 4X84A 2R2SA 3QJLA 2CQPA 5K9FA 2R9LA 1CC8A 4EWTA 2FVSA 3OUYB 4DN0A 3OL9A 1RA6A 2RRNA 2O1PA 1ZM9A 1VHFA 4R5PA 4R8UA 4PUOA 2MJUA 1JLBA 5KFKA 4CO2A 4DOZA 1G1XA 5EWGA 5E3AA 1K9MT 1I6JA 3HDSA 1HQEA 3LWLA 2XO7A 1B7FA 3ZZZA 1UFWA 4EU0A 3CJKA 5B7WA 2HNYB 3U7JA 2RB7A 3KLEA 1TL5A 3BQ1A 2PE8A 2FLNA 3H2VE 2HS0A 3MM6A 3CE8A 3OFGA 1BWEA 4IFYB 1S6QA 2HLTA 4KGMA 4NWBA 1R6YA 1SJRA 3GIKA 1XERA 1U1OA 5E3RA 4Y2KA 1U2RA 3GE9A 4RW8A 1WD6A 4V19X 1RA7A 2IAJA 4Y2IA 3ZZUA 4NZ0A 1XK8A 5KG7A 1TVRB 3RZAA 4DS4A 2KFYA 4BCAA 3LH2S 2DNNA 1S6OA 2OMOA 3BSAA 2CQ3A 1JLCA 1UVMA 2DGWA 3TX8A 1RAJA 5SZTA 4O0IA 1VQPS 4M5DB 1YIJS 1IKXB 4NCAA 1N88A 2VFRA 2R8JA 2WCXA 4B9SA 1HBOA 4LF8F 2OIHA 4GKKF 4OHVA 5G4DA 3DLKB 2J5AA 4WTYA 1JKHB 3MMBB 3FSYA 2D3UA 5KG0A 4C11A 5KFRA 3IN5A 4N47A 1P27B 3RB0A 4WF9Q 4L6V3 2M88A 4NZ7A 3GIJA 4IG0A 1JLEA 1MU2A 2X1BA 4TLQA 1JLQB 1FRKA 2VBXA 4NLQA 1FK9B 1QAXA 2X1AA 2UUAF 4HVZA 5M2PA 3CC7S 5IQ6A 2DO4A 2N3OA 1AXQA 5I3UB 4OHZA 2OPSB 2HNZA 4K5SA 4MJKA 5EN1A 2J6TA 2DB1A 4A48A 2HVZA 1M1KT 4JI7F 4NYZA 1JJ2R 3CJ3A 5D4LA 3I56S 3BREA 4NRUA 2N7CA 3Q2TC 1IKYA 3S6EA 2DGSA 2CRLA 4I2PA 1T05B 1JMTA 5GAGI 4CCHA 5M2RA 3N5BA 2DTJA 2MZTA 1UJ5A 1R0AB 4U67Q 4FNHA 2P5VA 5H9EJ 2R8GA 3H40A 2F8HA 1Q53A 3I0SB 2ZE2B 5D4OA 3VAMA 3QWUA 1DQ9A 1FEEA 1MW7A 4IKAA 5KT7A 3M9NB 5LXRA 1T95A 2KFNA 1GTEA 4ID5B 5KFXA 1VQOS 3RBEA 1ZM2A 5CQGA 1HBMA 2QE5A 1VRUB 1RT6A 2BRLA 4C2MA 3RB4A 4DPOA 1X0FA 1FKOA 5C25A 1WF1A 5J2QA 4ZVHA 1FDNA 4FN5A 1WF2A 1R43A 1YRTA 4WK1A 3G96A 4LT6A 4ECRA 1FVSA 1T94A 5DGAA 4HTIA 3EPIA 3UD3P 4IOAQ 4JI5F 2IRUA 1Q7YT 3QPIA 2I5JA 1S1VA 4IDKA 5K8PA 3PRDA 3OQ2A 4RNHA 3J81Y 1SB6A 4ETZA 2F8MA 1LQ9A 2NS1B 1BLUA 3OTBA 1JLGA 2JVRA 2I1RA 2RILA 1YJWS 4FXVA 4OLOA 4ETXA 1DBDA 3U1LA 1DURA 5F8HA 2Y1JA 3CMES 4HH0A 2JLEA 5GVQA 3KNAA 4CNZA 4ZPCA 3LPYA 3MM9B 4WYLA 1IM4A 1LK5A 2WTFA 3VQTA 3WX4A 1X4FA 2GO8A 2P9GA 2VQEF 2LEPA 2RT3A 2FVPA 2RUGA 3M30B 1LOUA 2GIRA 5IQQA 3OVAA 4DF8A 2DVIA 3ENWA 4A8MP 4CZCA 3GMGA 4NLPA 4FF2A 3RR8A 1KN6A 3CCTA 4CTAA 4B9VA 4DR6F 2K2PA 1UKUA 2XB2D 3I96A 1HA1A 5CCLA 2CIMA 1F0XA 3PV8A 4JI1F 3JSYA 4KB7A 5A0YA 2R2RA 2OTLS 2ZDOA 1Z4UA 3NMAA 4LQ3A 2XS5A 5LMNF 5B0EA 4KO0A 3KLGB 3BN7A 2Q6BA 2VKRA 5I42B 2FVCA 4ZPVR 1N5SA 2DNHA 4QW9A 1C1CB 3FJ2A 2XEXA 4ILMA 2LLZA 2ZNZA 4MKAA 4WFXA 1GQEA 3TW0A 1Y00A 4L72B 2JVOA 3HHEA 5AXMA 4FF3A 2PA8D 5A6PA 2D9PA 2QSFA 4C3LA 1CG2A 2YTCA 4RUAA 2XLJA 3PFOA 2MKJA 3M8PA 4ILRA 1XWLA 4JV0A 5B0GA 3UQSA 1N34F 3HHLA 1R8PA 4DMZA 5HO4A 1QVFR 2MSSA 5D6GA 4ECYA 4A46A 2IM0A 5GAHI 1RJJA 4DR7F 2ZH2A 4UOCA 4TYAA 4QCLA 1S48A 5CHCB 5DGBA 2DNZA 4OZNA 1CPZA 4MIWA 2C3OA 2RS8A 4Y6IA 4PUOB 4DWIA 4IRKA 1T3NA 2GQCA 1JLBB 5KFGA 1GH8A 1HI8A 4G1QA 3CC2S 4ZHRA 1N6QB 1HQEB 4DG1B 2VPWB 3LUYA 2RVJA 3US5A 4YP3A 3DOKA 1YG0A 1VC0A 3CJKB 1T03B 3IR7B 4HI1A 5CCMA 1SC6A 4O4GA 1RT5B 2M9KA 1NO8A 3KLIA 3NLCA 2V4RA 1OPIA 2HNDA 5J2NA 2GJ2A 3MUVP 1S6QB 2YX4A 2R7QA 2XWXA 4R0JA 5HROA 1YGYA 2IM3A 4HT7A 1TL1B 4C8YA 4X4SA 4HKQA 1KQGB 3MR2A 3PX0A 4RW8B 2VQFF 5LJ5Y 4DQQA 4XPEA 4G1IA 3CJ0A 4O3QA 2XWYA 3IFEA 3CC4S 1CQMA 2AX1A 4YB1P 1JJ4A 2PMHA 3JYTB 1V3SA 3LGNA 3T9NA 3R5BA 2MKCA 4TY8A 5G0RB 2EG1A 4NLSA 4DLGA 2JOQA 1D0EA 4PQAA 4NCGB 2ZNYA 2PI4A 3O8WA 4X4TA 5K8NA 5GAEU 1HBOB 5KFOA 1S1XA 2V9WA 2OTJS 5L39A 5DDPC 4A8QA 1W2IA 3I9ZA 4Y0FA 2ZH4A 1QE1A 2XLIA 2HS3A 4IOCQ 2VB6A 5DG9A 4C11B 1L3VA 4DL3A 1BY9A 3DHWC 4WXWA 3I5BA 2VPYB 4IG0B 2ZHOA 1MU2B 1WHWA 5F8GA 4F02A 3AH6A 5KFLA 2VKZG 1NRKA 3IGNA 4LUBA 2D1CA 2GHWA 3QZ8A 3DRSB 2IBKA 2ADBA 1NK8A 2ZZMA 1TR0A 2OPRB 2ADCA 3W2WA 5JJBA 1RYRA 3EXYA 3HMJG 4B02A 2YKNB 3AA9A 1R3NA 3MAHA 5C5JA 3KLFB 4NA2A 4ZVEA 1TAUA 3K5MA 4WJBA 2W8KA 3MGJA 2RF2B 1QAJA 1HW8A 2IMWP 1LW0A 2YX1A 3R5CA 3C6TA 2H9ZA 3SV3A 2NSCA 4OHWA 3ZZYA 2VFSA 1D9DA 2H5EA 5THW