2OSQA

Nmr structure of rrm-1 of yeast npl3 protein
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
74
structure length
74
Chain Sequence
b'ELSNTRLFVRPFPLDVQESELNEIFGPFGPMKEVKILNGFAFVEFEEAESAAKAIEEVHGKSFANQPLEVVYSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleolar protein 3
publication title Structure of the yeast SR protein Npl3 and Interaction with mRNA 3'-end processing signals.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 7
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2osqA00
2MQMA 4WFBQ 2DNMA 2MKHA 3TYTA 4Z2XA 3MURP 3UWTA 4YB1P 3THTA 3J7YU 1X4BA 3PIOQ 3VALA 5EN1A 3TP2A 5LXYA 1WHYA 2MMYA 4IO9Q 2RS2A 1WF2A 5CYJA 3RW7A 3BO3A 2F3JA 2KXHA 3CC7S 1WHVA 1K73T 1VQNS 1NO8A 3BO4A 1H6KX 2LA4A 5IFMA 5LSOA 2CPXA 2RQCA 2MZ1A 2DB1A 3H2VE 1PGZA 5DETA 2RRBA 1XN9A 2MQPA 5HO4A 2F9DA 3U1MA 1VQLS 1VC0A 3Q2TC 3VAGA 1U1NA 4CQ1A 3EGZA 1AUDA 3MD3A 2LXIA 3CCRS 4PRFA 3MOJB 4PR6A 3G8TA 2MQQA 1WEYA 3EGNA 4WIIA 2M70A 2DGTA 4IOAQ 2JVOA 2CPIA 1QVGR 1VBZA 2XS2A 2CQPA 2E44A 2I38A 2DNYA 3CCMS 1U1PA 2CQ4A 2DH9A 4TU9A 4TLQA 3VAMA 2KU7A 3CCQS 1JJ2R 2NLWA 1VQ6S 4ZKAA 4IUFA 4F25A 3D2WA 1VQ9S 1VQ5S 3NMRA 1KOOA 2MJNA 2KHCA 1VQOS 3SMZA 1SJQA 2PEHA 3MUTP 2M52A 1M5OC 3S7RA 3G6ES 4LMZA 5CA5A 1KQSR 2X1GA 1YJWS 3HI9A 2HGLA 1FJCA 2OSRA 2RVJA 1DBDA 1FXLA 1Q82T 2KYXA 3CD6S 2DGQA 1VQ7S 2M4MA 1SJ3P 3I56S 3UD3P 1X5PA 2DGOA 3P5TL 5GVQA 2DNGA 2DH7A 2QFJA 2VONA 1RK8A 2CQ0A 3CMAS 1YI2S 1A9NB 2MKSA 2KH9A 2DH8A 2ADBA 1IQTA 2DGWA 3LQVA 2CPZA 2U1AA 1S72S 2DIVA 4C0OC 1P1TA 5GAGU 5DDOC 1CVJA 3UCUP 2E5GA 3UE2A 2YH1A 1YJNS 4TU8A 1QVFR 3P49B 2M0GB 2M9KA 2J8AA 1WG1A 4C7QA 2FY1A 1WELA 3CUNA 5ITHA 2KI2A 4P6QA 3ULHA 2OSQA 2MHNA 5GADU 1S79A 1U1LA 5LJ3Y 3NNAA 5DDPC 2CQCA 1YTYA 4QU7A 3CCUS 1UFWA 2HGMA 3MDFA 2J0QD 2OTJS 2ZJPQ 3G71S 2CPYA 4FXVA 2CPJA 3MD1A 5IM0A 4WFAQ 3CULA 3ZZYA 2K3KA 2DGXA 3NNCA 1VBYA 1X4HA 4CIOA 2MSSA 4M5DB 3VAFA 4CH1A 5IM0B 1KC8T 2DHSA 2DK2A 1X4FA 1RKJA 2M7SA 3R1LA 2N3LA 2CQ2A 3L3CA 2XB2D 2LECA 2HGNA 1WG4A 3CXCR 3V4MA 3MI7X 3S01A 4Y00A 4IOCQ 1YHQS 3U1LA 1X4EA 2L9WA 3MUVP 4Y0FA 3CC4S 2AYGA 4ED5A 1ZZFA 5DDRC 2KRRA 2EK1A 2CQ3A 2QEXS 1SJ4P 2Q79A 3R27A 5LSLA 4F02A 2YWKA 1U1KA 2D9PA 1M5VC 3CCJS 3P6YC 2E5IA 3R1HA 2DNRA 2MZRA 2LEBA 3CC2S 3CCES 2X1AA 2CPDA 2LQ5A 2CJKA 1JMTA 1M1KT 3CCLS 2BOPA 1X4DA 2MY8A 2X1BA 4EGLA 2J0SD 5MLCV 2ZJRQ 1O0PA 1R8PA 2K8GA 2YTCA 1VBXA 5LJ5Y 2RQ4A 1L3KA 2MSTA 3UCZP 1U6BA 2DGUA 2CQGA 1VC6A 1FHTA 4OZ0A 3NS6A 2DGSA 2EK6A 1Q7YT 5DM7Q 1N54B 1U2FA 4J5OA 3TO8A 3CTRA 4QPTA 3ZZZA 2G1DA 1BY9A 1WI8A 1VC5A 3CMES 2NZ4A 2XS7A 2D9OA 3Q2SC 4ERDA 2CPEA 1WWHA 1HD1A 2FHOB 1SXLA 1DRZA 3LPYA 2RT3A 3OW2R 1A7GE 2MY7A 1X4CA 1U1MA 2XNRA 2KVIA 1JJ4A 2FPHX 3G4SS 4RU2A 2VOPA 2CQ1A 5D78A 2MZSA 1OPIA 2N82B 1OO0B 2ZJQQ 1VQKS 2DO0A 3P3DA 2O3DA 1H2VZ 5HL7Q 2KT5A 2PE8A 1M5KC 4V19X 2JVRA 1KOHA 2J76E 3CCVS 2BZ2A 1X4GA 3FEXB 5JVGQ 2L41A 1G2EA 2MZQA 4FXWA 2HVZA 1P27B 2DNOA 3DLLQ 1JJHA 3SDEA 4TU7A 4WCEQ 2JWNA 3H2UB 3RW6A 1M5PC 1SJRA 3SDEB 3MUMP 2DNQA 2RRAA 4QU6A 2AYBA 2ADCA 2MPUA 2E5JA 1WHWA 1VQPS 2DO4A 3UD4P 2M88A 2F9JA 1DZ5A 5FJ4A 3EX7B 1ZZNA 2VOOA 3US5A 1HD0A 2DNNA 2MKCA 3N9UC 2KM8C 4W90B 2LKZA 1M90T 1WI6A 3S8SA 2DIUA 1WG5A 2WBRA 3VF0B 3S6EA 3BO2A 1WTBA 2GHPA 4LIRA 1SJFA 5JVHQ 1YIJS 1WEZA 2DHXA 2MGZA 1U6FA 1UAWA 2ERRA 2HYIB 1NJIT 1VQ4S 1R8HA 2RUGA 4YOEA 5DM6Q 2DHGA 1OIAA 5BJRA 1X5SA 1K8AT 5H1SV 3FEYB 2MGZB 3VAKA 1FO1A 3CF5Q 2DITA 1U1QA 4CH0S 4UQTA 3IWNC 2MYFA 2MXYA 1N8RT 2G0CA 2OJ3A 2FC9A 3CPWR 3MXHP 2DNKA 2OTLS 1Q86T 1WEXA 2CPFA 2UP1A 2MJUA 2MKIA 2MZJA 4WFNQ 1D8ZA 4OZ1A 2U2FA 2N7CA 2MZTA 1WF0A 4U67Q 2LYVA 2DHAA 3K0JA 1FT8A 4BS2A 2EVZA 1U1OA 2AYMA 1QM9A 3HHNB 2KRBA 2JX2A 2KG0A 3CCSS 5CXTA 1VQ8S 2DNPA 2LCWA 2LXUA 5GAHU 3VAIA 1FJEB 1HL6A 2DNLA 4YUDA 2RS8A 2B0GA 1N52B 2MQNA 1ZH5A 1YJ9S 2MQOA 2A3JA 1H2TZ 2CPHA 2VODA 5GMKa 1WHXA 3VAHA 2HZCA 3IRWP 4F26A 1YWXA 3G9CA 3I55S 4WF9Q 2KG1A 1K9MT 5D77A 2M2BA 2DGVA 1YITS 2MB0B 1X5OA 2MKJA 1PO6A 2XS5A 2YKAA 3THPA 1B7FA 3SXLA 2DNZA 2AYEA 2KFYA 1HA1A 1VQMS 2GO9A 3UCGA 1UW4A 3G8SA 2LEAA 3BEGB 2KXNB 2M8HA 3VAJA 2MQLA 1FNXH 1DHMA 4C4WA 1U1RA 2CQIA 5IQQA 1WF1A 1URNA 2LA6A 2CQHA 2KXFA 2YH0A 4PKDB 2OIHA 3B4DA 2JRSA 2DNHA 1F9FA 3NNHA 2AD9A 2LMIA 1NU4A 2D3OR 2CQBA 3BS9A 4W92B 2QA4S 2I2YA 3B4MA 5DDQC 2RNEA 2V94A 4LJMA 4QQBA 2RU3A 1Q81T 2M8DB 1X4AA 2CQDA 2DISA 1UP1A 5LXRA 3NS5A 2X1FA 1N88A 3JB9k 1KD1T 2XSFA 1H2UX 4A8XA 2KN4A 2XNQA 1OWXA 2L08A 3G96A 2G4BA 1D9AA 1X0FA 2MKKA 3J7ZT 2KM8B 2E5HA 2N3OA 1X5TA 1FJ7A 5GAEU 4WKRA 1W2BR 3DXBA 2SXLA 3PIPQ 4UY8T 2FC8A
chains in the Genus database with same CATH superfamily
3TR5A 1PJ7A 2JLFA 2DNMA 2ZH6A 4DPYA 2ZOFA 2BEFA 1F9EB 2UUTA 3EZUA 4NMLA 4ZCKA 5F0WA 1S6QB 3V4IB 4PXCA 4GO7X 1NSQA 4UOFA 3GFZA 5E7OB 1V6HA 2CAJA 5FIIA 3VGVA 4J37A 1PGZA 2HLTA 1RT2B 4I0WA 2RMLA 3R7BB 3M6XA 2E7WA 3R5CA 2UVWA 5FLXU 4KKOA 5KFLA 2BM0A 1UKUA 2CPIA 5KFMA 3R2DJ 1ZA1B 3GJRB 2DNYA 3CCQS 3ZTSA 4IRKA 2C3UA 4XIUA 1SC6A 1HHQA 1VQOS 3W5XA 1HW8A 3MM6B 4RBVA 3S7RA 2IBOA 4A8MP 5IQ6A 2HRUA 2EBGA 4ZVUB 2RHQB 2I5JB 2IJNA 1VRQC 1X5PA 3NAIA 2WAQD 4IDKA 5KFAA 1XMBA 3MM7A 4OLOA 5KFZA 2MKSA 4ZLLA 5KTQA 1MMLA 3GCWP 1CJUA 2XZWA 3DGVA 3UCUP 3ZO7A 3MM9A 2M0GB 1HQEB 3MM8B 1WG1A 3IS9A 4P6QA 2KKHA 2CWXA 4ZP8A 2UXCJ 3R7NB 4KYZA 1SPBP 2YY3A 4O3SA 1NK0A 2RDIA 1Y11A 2QIFA 2GV1A 1E6YB 4HL9A 1VBYA 4JI0F 3POTB 4FYDA 1M1HA 3G87A 1HMVA 4JI6J 5AXKA 2RAQA 4DUTA 4NASA 1YHQS 4RW8A 3WDOA 5KOWA 4JI1J 2I6WA 1R0AB 1PYOB 3KDNA 4M5JA 2HHPA 2V63A 2XQCA 3D54A 4KIAA 4ICLB 5JJBA 1X4DA 3W9JA 1RBAA 3C6TB 3MTJA 5KFYA 2HNDB 1KFDA 4NCGB 1NB2A 2G1DA 1WI8A 2E5LF 2O5DA 1FK9A 2QLXA 3L7PA 1XMOJ 1U0HB 4OMFG 3AT1B 3MR7A 2FHOB 2ZH3A 1S6PA 3EPIA 3V2UC 2F1FA 4FF1A 5A2QY 3OFEA 4ZK7M 3UN5A 4RU2A 4WE1B 2LVWA 4YB5A 3RR8A 4B9UA 2Y8YA 1RTJA 1ZM2A 4LBHA 3W1YC 1M5PC 3LP1A 1F5AA 3TEHB 2ZDPA 4DL6A 3UD4P 4B3MF 1DQAA 2XCAA 2DNNA 4X65J 4CO4A 4W98A 3X1LB 4DJBA 2MGZA 4DU7A 3LGMA 1TKXB 2LEPA 1T03B 3BQ1A 5I3QA 4H54A 3HKZD 3IMQJ 4DFKA 1JB0C 1F2HA 2PEBA 1U1QA 4CH0S 3KLHB 5I42A 2PI5A 3H20A 4HI1A 2QGFB 3MECA 3D3BJ 5GADI 2MJUA 4OYOA 1SKWA 2GVZB 1T11A 5D8HB 4I2QA 4MFBA 3PKYA 4BS2A 3QBCA 1DURA 3BQ0A 2V8DA 4ED4A 1RADB 2HQFA 3M32B 3M2VA 4TY8A 4ZVOB 4WXOA 1Q5VA 3QJPA 5B0CA 3HO1A 1B7FA 3OXGA 4M5IA 1YRXA 1RA7A 5KFRA 4J9NA 3QQCD 4WFZA 4HHUA 3G8SA 3O3LA 3I6PA 1NPPA 2ZC4A 4BCAA 2QL7B 4QBUA 4PKDB 1NK8A 3B4DA 4ZVFA 4J9UE 2AJ2A 1NK5A 4JV5J 1S7HA 2QA4S 5DDQC 5E3RA 3HP6A 2BUNA 1XTZA 3KKFA 2X1FA 3MR3A 4Q5VA 1RWMB 4KGXB 4FP9A 4F4AA 2E7VA 1CPZA 1DAXA 2Z2MA 1HBMA 3W5YA 3CEDA 3MOZA 3TP2A 3I5CA 3HX9A 1B99A 4ED6A 2UZAA 1Q1KA 3BO3A 2KXHA 2G0IA 3CC7S 1K73T 2OMLA 1QDUB 2OHDA 3QSYB 2RDJA 3HCXA 1U45A 4N56A 3M30A 2JZ5A 2Q6BA 4DHVA 3EGZA 5KFNA 2WTFA 3MOJB 3LW5C 2YWGA 3MEGB 4C11B 1N36J 4B3RJ 3LALA 3RTVA 3SI8A 3MR5A 2OPSB 2CQPA 1BE4A 1NHUA 4Y2KA 4TU9A 3OR1B 3VAMA 3M6WA 3D1OA 4NEYA 4F25A 3NGTA 1FNOA 3FRZA 2M52A 4HTIA 3TUZC 1OQ3A 2MKYA 2XC9A 4C8LA 3ZFVA 4FBTA 3I5BA 4DV7F 5F3ZA 3IWLA 1XNQF 4J9SA 3LF0A 3UD3P 1YSJA 4FPIA 3FK4A 4M5NA 2BJ1A 1REVB 2FHMA 4J9LA 5EWEA 2P5VA 4C98A 3KLIA 2HNYB 5B0BA 3P49B 1YJVA 5HATA 3NWRA 4DR1J 2Z0GA 4U6PA 2HEKA 4ZP6A 2R3VA 2J9DA 2MDAA 3A8IA 3I96A 1UZHA 1S0VA 3BV8A 4UW2A 1FFGB 4DBQA 4BDPA 3L4BC 2W9CA 3GR1A 1P1LA 3QFHA 3V4MA 3R6LB 3ZXWA 2L9WA 2IVMA 1RBLA 3CC4S 1T9TA 2EK1A 3ZZRA 5CABA 2YWKA 3DOMA 2W01A 2X1AA 1JMTA 3NXZA 1SQGA 4CLKA 2BOPA 2MY8A 3LAMA 4KH1B 1KN6A 4QZVB 3RB3A 2F63A 2CQGA 2EKNA 4IR9A 1JXVA 3AODA 3QPIA 1BY9A 3OL9A 2P8IA 2AGOA 3EE3A 3MTKA 1B64A 5H9EK 2VJVA 4RZRA 2ZBCA 4YY3J 2QLBB 5A76A 1P8GA 3ITHA 3W2VA 1MW7A 4H4OA 3O6QA 5KFUA 4DR6F 4ZVTB 1A6LA 4K4VA 4V19X 3R7SB 2WVDA 2BZ2A 1IR0A 1X4GA 1ZM4A 2LU1A 2HRYA 3L95X 4OYZA 3TJAA 2L41A 1G2EA 4USIA 1RDRA 1MWQA 1T9VA 5KFEA 1ZPVA 3LGNA 3R8YA 3SDEB 1MROB 3GB0A 4EBDA 1RTZA 4CO0A 2IRXA 3US5A 4ID5A 1HPZA 1S6OA 3P5BP 1R0CB 3BZQA 4NLPA 2VBZA 2XBPA 1WG5A 3S6EA 3AD7C 2QSFA 1W25A 4IH7A 4K4TA 4OJ3A 1HWKA 5J2MB 4O3NA 2M3DA 2FJBB 1U49A 1TK5A 1NKEA 3H25A 3D1QA 3FKBA 4Q8FA 3RBDA 2DNKA 2WW4A 3F44A 1Y5NB 5FLXY 3JTOA 2BE9B 1TL7A 4N8NA 1GK8A 4PWDA 2WSEC 1RWKB 3E01B 4M5LA 5HVHA 1WOPA 3OT9A 5HP1B 1LKZA 4KE5A 1FKPB 2RS8A 2B0GA 4TY9A 4DR2F 4RBTA 4Y2CA 3ETOA 3OV7A 2E66A 4K2XA 1ZM9A 1S97A 2ROEA 3N6NA 3NWGA 1UFKA 3OFFA 3UR3C 4CLFA 2XS5A 4CO5A 4B3TJ 3G6VA 1SIZA 4RNNA 2J9EA 2RE1A 2KFYA 3SCLE 1FEHA 3T3FA 4NYZA 1IVZA 1H0HB 1DHMA 1HWUA 3JXOA 3NL0A 1GAOA 2BJDA 3P45B 5A8WB 3DRPA 3I9ZA 5H9FJ 4YR3A 2Z56B 4NWBA 2WOMA 2BE2B 3BYPA 2LMIA 1X7VA 3BBFA 3SQGB 3GMGA 4L3KA 1KVJA 2V2KA 4OYAA 2RDDA 1Y3KA 5LXRA 3DCAA 2WSFC 1HNXJ 4LBPA 2MKKA 5D4LA 1FESA 2V4JA 1KRPA 4ECZA 3NCPA 2MQMA 3BQ2A 2HFVA 4QCLA 5LXYA 4DV1F 5IWAF 2ZH1A 3IBFB 3NOGA 2YNHA 3C16B 1S9FA 1VQNS 2VFTA 3RYLA 3BO4A 4GKJJ 3FC9A 3W8GA 3UDVA 5DETA 2HHXA 2FLOA 3NY0A 3GIJA 2C2ZB 3HHLC 2YBVA 5DG9A 2ZDOA 5ETOA 3EDRB 3JAMU 3LP0A 2FZKB 4IH5A 2XS2A 4AD6A 3WHIA 4C6AA 1OSCA 4AL5A 4QIFA 4IYQA 4WYWA 3HFVA 1S1UB 1KOOA 2BKOA 3K5PA 1NSKL 2J9CA 1ZTTA 7FDRA 5ETPA 4OZJA 1UA0A 6FD1A 1S12A 3FZBA 2XZTB 1R7IA 5CHCB 1IQTA 1MNEA 4P2FA 1WJ9A 5HMYA 4PQUB 1HHSA 3FDSA 4UZBA 5DDOC 2JHEA 2EW9A 4IQMA 5A6PA 4RW6B 4AQYF 2M9KA 3I0RB 1WELA 2HBRB 3ULHA 5RUBA 3SZ2A 1IR1A 1C0TB 1BQNA 3UO0A 1KBRA 3MDFA 5B08A 3QSIA 2OMOA 3TQEA 3EICA 2CPJA 2D74B 1B0PA 1TL3A 2OEJA 4B3SF 2V34A 3M6VA 4LSZB 2DHSA 2H4WB 3CSKA 4O44A 1TELA 4X4OA 3TZYA 4Q2LA 3HF5A 2BXJA 1X4EA 1NAQA 2QE5A 3KLEA 1KLMA 1TKZA 1S1VA 3QIDA 3DLGB 5E2QA 2OPRB 4X66J 3FBCA 3KYLA 1XR6A 1ZAXA 2EFNA 1VJQA 1GMVA 2WSCC 2EC0A 1HBNB 3MEEA 1L3KA 1SB6A 1XR5A 3UCZP 1SKUB 1FHTA 1N54B 1RT3A 3AD8C 4QPTA 1VDHA 3R3TA 1SC3B 3R6GB 3MM5B 3Q89A 5LOQA 3OFGA 2B3TB 2Z2LA 5C24A 1HD1A 1DRZA 1JLAB 2E29A 4OV1A 5ETKA 2ZD1B 3CJKB 2HQGA 2Z4PA 1RSCA 2V8VA 3C14A 4MYTA 2YKQA 3QGIA 2R7RA 4DV0J 4DR3F 1M5KC 4LSNB 3LANA 4M63A 1G3OA 1TVRB 2WZ1A 1XBWA 3PHTA 1JLFB 2JWNA 4IG0B 4KR0B 3H5YA 1SV5A 1FKOB 1SCJB 1QLNA 2DNQA 3UW1A 2HLUA 2F7VA 2JC0A 1IKXB 1WHWA 1YX2A 1U0SA 3BR9A 1RT1B 3EX7B 2E9RX 1FRIA 2XYGB 4WP8A 2UU9J 2IA0A 1WI6A 2K2PA 1PC5A 1SJFA 1B0TA 2HVIA 4ZA1A 2JLGA 4OQJA 2ERRA 3OL8A 2QZ8A 3NGSA 2WK4A 2GC8A 1WC5A 2HHHJ 3OR2B 5A8KA 3HK2A 4U95A 4DPWA 2KTQA 4Z7CA 1Y10A 1IWGA 4P75A 2ZM6F 2EEYA 2GQQA 2MZTA 2COLA 5HAOA 2Y0BB 2KRBA 1UEUA 4V19J 4N77A 5GAHU 1HL6A 2NUHA 1VFJA 2CPHA 1JLQA 4A8QA 1IXKA 4ZMMA 1T9YA 4LFCF 1P6TA 4ZVSB 1Y5IB 4TXSA 1HBOB 3K57A 4DSFA 1VLOA 2BJ3A 1DLOA 1NBEB 3IAM9 3TZZA 5KFQA 2UUAJ 1FDAA 3HD2A 4OYMA 3GR0A 1H73A 1YDLA 3B78A 2KJWA 1WF1A 1QSYA 4YHHJ 2JRSA 3RRGA 1RTDB 3JQJA 3GSDA 4DV3F 3DLJA 4MAKA 4WTYA 4OX9F 1R8CA 2AP6A 5HJXA 2XSFA 4GVBB 1BQXA 5KFGA 3N4WA 2G4BA 3C66A 2B4UA 4ZVRB 3ZZOA 3WZ0A 2SXLA 4IG3B 4LQ3A 1S76D 1IKYB 4X64F 2PFFB 3A8KA 4Z2XA 1E6VA 4DU8A 3J7YU 2G1HA 2E1MC 1WHYA 2RS2A 5K14A 2CZVC 4Z37A 3ZTPA 1HQ2A 3FUYA 2UV8A 4YQWA 3OL7A 1FJGJ 3VGSA 2MQPA 2C2EA 4CNZA 2F9DA 4OJ1A 3OSNA 1KTQA 4WK3A 4Q2MA 5L1IA 3DFEA 4OI3A 5F8MA 2V4RA 2I38A 3QLHA 1B0VA 1JJ2R 3PW2A 2FIUA 2DXDA 3EJMA 1TR0A 2PEHA 4KHPJ 1KQSR 4M95A 2DR8A 3PO4A 1S1XA 6FDRA 4KB7A 3HFKA 1SIWB 1RLCL 3HXMA 3DU6A 5CD4A 2DGOA 2KZZA 2QA1A 1RK8A 1ZM3A 4RNMA 4ZITA 1KKHA 1UEVA 2ADBA 3OBIA 4ATNA 2WVBA 2IM1A 2XI3A 3MM7B 1WNEA 4HI2A 1WC0A 3CJTA 1JLEA 3FMBA 1HHTP 3UE2A 4LIWA 1CJUB 1VI7A 2FY1A 5CZXA 1GMUA 5LJ3Y 3MM9B 5DDPC 3GSIA 1RISA 3IS9B 3EXYA 1UFWA 2ZWPA 4M5DA 5HJYA 5D4PA 2ZUGA 2HFUA 4GKKF 2E9TA 3MI7X 2E7XA 5IV3A 1HMVB 4WIQA 5I3UA 1ZZFA 2QEXS 1FD2A 3M8RA 4ZPTR 2B7BB 4DX8H 4DV6J 1GT8A 3R1HA 3MCSA 3VWSA 4ILLA 4XO0A 3BPSP 1TU0B 1SQEA 2FTRA 2WCXA 1PG5B 1VS3A 5LSRA 2PI4A 1T9UA 1RAAB 3QAUA 2EK6A 1Q7YT 1LW0A 2J0WA 4MIAA 5KG7A 5KFCA 4JUZA 1QAYA 1CJVA 3OTBA 4URGA 4ERDA 1VRUA 2HWHA 5LMNJ 2CWKA 1FK9B 1QAXA 2ZZTA 1DQ9A 2WW8A 5ETMA 1BC6A 2J7UA 1YJTA 2ZOMA 1S6PB 2LLZA 1S4FA 4ZCLA 3J7Z5 2FVPA 3DHXA 1HI8A 1U8WA 3GIMA 3CB4A 3TVZA 2MZQA 3BGOP 1RT6A 1RTJB 4USHA 5EWFA 3DMJB 2W9BA 5AT1B 3QZ8A 3EMTA 3FEZA 4NLGA 1ACMB 2V9WA 3KHRA 3LP1B 4DQSA 3RBZA 1RT7A 2GHVC 3HVRA 3MGJA 1N0VC 1X9SA 3BO2A 3OLAA 4P2XA 3Q8SB 3M9NB 4ALZA 3V5RA 4ELVA 2MGZB 3VAKA 1EKSA 2H51B 2W7AA 2VDHA 5HBMA 5I42B 4EO6A 1ZOTA 2U2FA 4JI6F 2GAHC 1SL2A 3MECB 3VGTA 4A8OA 2IAJB 2YWFA 4Y65A 1QM9A 4USWA 4I2QB 4MFBB 2LCWA 4YUDA 3T41A 3DOLA 2MQOA 4DQRA 4K4WA 5KOXA 3R5AA 3TAMA 3I55S 1GMWA 2DGVA 1FDBA 4X4UA 1YITS 3M2VB 1PAEX 2ZKTA 4TY8B 3UD5A 4R8UA 2BJEA 1FEEA 4EUVA 1R27B 1B3TA 4PAAA 1OJ4A 2GJIA 1XMOF 1FNXH 4KGZB 2PMHA 2W24A 4F3MA 1U1RA 4N47A 5AXNA 2R7VA 5HN0A 2ZZMA 4B3MJ 2IM2A 2B7CB 5HQ8A 4F0KA 2VA3A 1VHFA 1X4AA 3PACA 5ETTA 1V3ZA 2QA2A 4A8XA 5D0HA 1F5CA 3LP2A 1X5TA 2ABYA 5GAEU 2X3DA 1VIXA 3DLHA 2AGPA 2WONA 1VR6A 2OPPA 1HBMB 5KFTA 4OHZA 2G9OA 2F3JA 3T6JA 2YNIA 1T3NA 3MPVA 4KFBA 4X65F 1MN7A 3U1MA 2VIHA 4HDHA 3HMJG 3MD3A 2LXIA 4P73A 3M30B 3KUHA 4LR7A 2WVEA 1TQLA 1NDPA 3DU5A 3FCVA 4NXMJ 3MMAA 2ROGA 2BV3A 3KG0A 2R8KA 3D2WA 1WACA 1NK4A 4FBUA 3FQKA 1KHVA 1Z2ZA 3HI9A 1DBDA 2V69A 2CDRB 1VQ7S 2M4MA 1SJ3P 2HFZA 2QL9B 4H4KC 1N5VA 4Y2MA 3PW4A 4DV2F 5GAHI 2DIVA 3D66A 2HZVA 3KLIB 2O66A 4R0EA 4MIWA 4ZCIA 3B82A 1KSPA 2MHNA 1UVIA 3UPFA 3A3NB 3I32A 3KUGA 2J0QD 4RUHA 1FRJA 5CYMA 4JV5F 3UVJA 4K4ZA 3CJ3A 3L3CA 3M8PA 1J5OA 5ETNA 1JNRB 2WVFA 3A1YG 1WC6A 2KRRA 1NJWA 2Q79A 3K17A 3HHLA 2ZHBA 1FTRA 2IDLA 3HDSA 1BUXA 2ZNZA 1JX4A 2CJKA 3DOMB 1OMSA 2DXEA 3W9HA 4RW4A 5F9LA 1WDTA 1Q4RA 2HG4A 3QJJA 2ZE2A 5KT3A 2NQPA 1YBAA 3A3OB 2DJWA 3J7YI 2R2SA 1BQMA 2NZ4A 1SC1B 2VG5A 5L39A 4DS4A 4G3IA 2AZ3A 4E98A 2JL9A 5KFVA 1N36F 4B3RF 2VC0A 2HHQA 4J9RA 3NGUA 1PBAA 3J81j 2WB1D 3HJFA 5KG4A 3SCKE 3ITHB 3W2VB 2GQCA 4H4OB 3TA0A 2DO0A 4WFYA 4UY85 2HVEA 5KT5A 4ZVGA 3IGVA 3PR4A 2JVRA 2YKPA 1IR2A 5JVGQ 4FXWA 1P27B 3PYGA 5IXUA 4IRCA 1Z2LA 2HK2A 1VYAA 1ZAWA 1Y00A 4FKYA 4JI2J 4M8LA 1FD8A 3EPGA 3GJSB 2YQ1A 3D6FB 3WX8A 3GIIA 5GMDA 1WDDA 1HD0A 3UI3A 2GMHA 8ATCB 2O01C 4NE9C 4ID5B 4WU3A 4ILMA 5A0YA 1HPZB 2IYIA 2XO6A 4DR1F 4LF4F 1PILA 3VVUA 1CSJA 4Z7YA 2YWHA 2MYFA 2FY8A 3CWJA 3O1LA 4MTPA 3PO5A 3K0JA 1TL7B 4DL3A 4JOUA 4PWDB 2EVZA 3KHLA 4C11A 4ZVQB 4OX7A 2Z2ZA 2JX2A 3D67A 5IT9Y 5CXTA 2OPSA 2BX6A 4K4YA 1N52B 2A3JA 2R8HA 4WF9Q 2JLEA 3OXFA 1AFIA 3SCIE 3OLBA 2DY9A 3HSDA 5L8RC 4DPTA 4M5GA 3N6LA 2DNZA 2PT0A 1HLWA 2CZ4A 5AE1A 3VAJA 3EVMA 1N5TA 4DR5F 2CA9A 3U7JA 2DYAA 3JQKA 1K0VA 1B7YB 1NU4A 4KJIA 3DRPB 2V2QA 2ATCB 1NK9A 2WOMB 3B4MA 3TI0A 4QIVA 2NZCA 5IT0A 2BJ8A 1TL4A 4I4BA 2HIQA 3W62A 2KM8B 3J7ZT 2RD5C 1U26A 2AEMA 3DXBA 2BW2A 2GW8A 1T05A 2V4JB 4F36A 4JI3F 2F4FA 3E3XA 3VALA 1OY8A 1WF2A 2WRMA 3K8VA 2V8HA 2YNHB 3W60A 5LT5A 4O3PA 2E1AA 3NLCA 4O3QA 4DR2J 3FCHA 3ZNUA 1AUDA 3ADAC 1S5ZA 4KPYA 4QPXA 1GH8A 2ILYA 2VPWB 5EDWA 4IOAQ 1VBZA 1DY3A 1X31C 2P9GA 2AJ1A 2YNGA 3LP0B 3QYYA 1L3SA 3PTWA 2MJNA 3SMZA 4Y2AA 1S0OA 5BYQA 1K1QA 5LL6d 3CO9A 4K8RA 3KK3A 2KYXA 5GVQA 1TKTA 5FDLA 3MR6A 2YQ3A 2Y1JA 3ZZUA 2CQ0A 1YI2S 1XMQJ 5F8JA 1AZSB 5ETQA 5KFFA 4KBIA 2XULA 3WC0A 5AE2A 2QJ3A 1FDDA 3EXCX 4TU8A 2XMKA 3MCNA 5ITHA 4LSLB 3PG9A 4R0JA 3KMQA 4YS2A 4ZN1A 4BC7A 2Z2YB 3J80Y 2AV5A 4F4ZA 5IWAJ 2NXCA 1BQNB 4KHRA 4CIOA 4FYVB 4LRFA 1TL3B 2YQ0A 3BB5A 3S01A 3ZC4A 3ETMA 3MUVP 4O44B 3G8QA 5K8MA 2HK3A 5IC6B 2AEJA 2PO4A 5G4DA 2K06A 2FJVA 3KLEB 1KLMB 1M5VC 1QY7A 2BKNA 1TKZB 1S1VB 3JSRA 3LTOA 2GAGC 3CCES 2CPDA 3CCLS 3I82A 2XTJP 1EETA 1Q8BA 1B4SA 4JYAF 5DZ7A 4LRDA 2K1RA 2HQIA 1EIYB 2XYPB 5KT7A 2BQUA 3P8BB 3MEEB 1T02A 4GKJF 4OI0A 3Q22A 5KFIA 4PCQA 2D9OA 1QAJA 1RT3B 5CCMA 3EGWB 1U02A 1HNZJ 2ZBPA 3C6UA 4O3RA 1NCLA 5C24B 2ZUAA 2B5JA 4CI0B 4HTJA 2XLKA 1PJ5A 4DLGA 5D0GA 4AQYJ 3C14B 1L3UA 3OVBA 4F4KA 4L75A 5CQGA 1RCXB 1TL1A 4USVA 3KWMA 5C2CA 2ZBRA 1X0PA 2UV8G 2B51A 3BH7B 2CNOB 1SV5B 2OPQA 1DTTA 3OUYA 4ZHRB 2F9JA 4CP5A 3A4TA 5J2PA 3KFWX 2ZBQA 3MMBA 4NX9A 3PDNA 2B56A 3AAWB 3IR6B 1TUGB 1R8HA 3AOBA 3DKDA 2I0XA 4QWDA 2FLPA 5AE3A 3T1HJ 1VRTA 3MFIA 2Z57B 4LFBJ 2VBXA 2VPXB 4URSA 2ASJA 4GVLA 3W8PA 3CPWR 4BC9A 2CNNB 4AE5A 5M2UA 5A8KB 2VB6A 4HEA9 1VOMA 1JJCB 4XDCA 3D6HB 1S10A 3SV4A 2ZH5A 4DL5A 3M8QA 4EYHB 1VISA 1WC1A 2Y0SD 1VQ8S 2YX7A 4Y3CA 1Z4UA 4X66F 2HHVA 4YFUA 4DSLA 5D3GA 2OI2A 1WD6A 1JIHA 3T6BA 1NDLA 1JLQB 1NM2A 4ED0A 1OS5A 4DR3J 1X5OA 2XMTA 4MMOA 3ICLA 1DLOB 2XMUA 1Q8IA 3ISNC 4Q45A 2A0FB 1XERA 1MN9A 2DT9A 2FHKA 5DLGA 1LW2A 1PCAA 4PYAA 1URNA 2A6OA 2LA6A 3NCRA 5D0RA 3SEOA 2XSJA 2OIHA 1IBKF 1AB8A 2OEMA 1NPRA 1VBKA 2K7KA 3BM7A 3R5GA 4CTAA 5CH7B 3I9V9 2ZVIA 3BS9A 4NYOA 3DNCA 2W4CA 1JXLA 5KG6A 1QTNB 4DV5J 4QOTA 2A18A 4DV0F 2KN4A 2GS8A 4RNFA 4LF2A 1UWBA 4I69A 2H65B 2XHWA 2PN6A 2LQ8A 1UA1A 4CRJA 3TQ1A 4UY8T 3HT3A 3Q8QB 2MKHA 2HSEB 3IM9A 3UWTA 3R2CJ 1RWNB 2ZM6J 3IWXA 4X4VA 3Q8YA 4ECRA 1FRKA 5K14B 4OI4A 3GV8B 1XN9A 4LF8J 4CQ1A 1S9GB 3W63A 1UCNA 1YJUA 1R43A 4FS2A 4LFCJ 3GONA 2XY7A 4JI7J 3PY8A 4BBYA 5J1NA 1HR0J 3VR1A 1Q5YA 4C8YA 2P9CA 4ES2A 1W7WA 1TFWA 2HHWA 2NPIA 4DCJB 5CZVA 3QLHB 1T3OA 2B6AA 3MUTP 1IKVB 3KJNB 3NAHA 3I0SA 2KT2A 4Y34A 3PX6A 1S1XB 2D69A 1UPMB 4HHJA 1UPPA 1SL1A 5HMWA 3V6KA 2DTJA 4DZDA 4PABA 3OTOJ 2UUAF 1S1WA 2ZHOA 3GU0A 1V3RA 3VVTA 5GAGU 2E5GA 1NMEB 1JLEB 3K59A 4I64A 2DR7A 3CO0P 2OSQA 2F5GA 4X64J 4P2MA 2PFDA 1BWEA 5KFJA 1RABB 3EYZA 1G6BA 1UJ5A 4A8SA 3GP9A 2QYGA 2AT1B 1AA1B 4P9SA 2YX4A 2OH2A 3T1YJ 4M5DB 3IBWA 5EUHA 3TAPA 4ENOA 2AEFA 3PYFA 4Y0FA 2EPIA 3RUBL 2BDPA 5I3UB 3G6XA 1HNWF 4PEOA 5KG1A 2LQ5A 1J27A 3BGLA 1LFPA 4TQSA 4HKQA 2O67A 3V6DA 2QT7A 1IUJA 3BSAA 4QW8A 2IVFB 1S0NA 2UVVA 2MSTA 1RT5B 1R6VA 1LW0B 3SV3A 2BA9A 4KRWA 2IM0A 2BANA 3BDEA 1CJVB 5KFDA 3RAMA 1VRUB 4H4KA 4NRUA 3OHBA 4PPDA 4NZ0A 4K2JA 3HULA 3KDOA 2ROPA 5HL7Q 3SSSA 4X4RA 4QYZJ 4DL2A 4N41A 4KHPF 3BH6B 1PYSB 3A13A 1DARA 2RIJA 1RB0A 1LWFA 4IQXA 1YLXA 1QD1A 1RAGB 4IOBA 1RACB 2BYCA 4PPZA 3THVA 2VKRA 3M05A 1RT6B 1SJ1A 2CIMA 3HT0A 1NNDA 2W9BB 2DO4A 4Y28C 2VU5A 2HURA 1RT7B 2DIUA 3VF0B 2GHPA 3K5OA 3LWLA 4TLRA 4C0HA 1NJIT 4DUYJ 2GIFA 2OD6A 2VICA 3AJ1A 3HSZA 1FRLA 2MXYA 4C9DA 4EBCA 2LXFA 2EKYA 2FC9A 4WP9A 2HNZA 1TKDA 2UP1A 1TAUA 3K5MA 1RTHA 1IBCB 5HBMB 2PDAA 2OFHX 1D0EA 4U8YA 3IA0A 1FT8A 4PYDA 1FXRA 2YVSA 3CCSS 3KG1A 2LXUA 4WXWA 4DV6F 1KNZA 1Q8KA 1H74A 3SIPB 5GMKa 2HVDA 4C8ZA 2HZCA 3CD0A 3DOLB 4J7CA 2KG1A 3TAMB 4KSEB 3HVAA 2MB0B 2RRNA 2YKAA 2PSZA 2AYEA 4R8UB 2MLXA 3UCGA 4KTQA 4CLUA 4I68A 5LMNF 1CULA 4A8WA 3Q8PB 2IC3A 1WKJA 3L9ZA 2E1CA 1FA0A 3ZTOA 5K8NA 2Q66A 4YMEA 3CD5A 4TVAB 2FDNA 2NREA 1KTVA 4F7VA 2M8DB 1N32F 4HH1A 1GXLA 4A47A 3G96A 4P52A 5DGBA 2IPOB 5AXMA 3QJLA 3DYAA 2E9ZA 2B8PA 1UEKA 4LREA 3LP2B 4AL7A 1HWIA 2HAFA 2WONB 2UVRA 1MU2A 4C2MA 2OPPB 3C15A 2R7QA 2XO7A 3SCJE 4GC7A 4ANEA 4ED7A 2YNIB 4QYRA 2VDIA 4KFBB 1YRTA 4J9MA 2B4VA 1X60A 3H4DA 3D3CJ 3W5ZA 1F9HA 1ZPWX 1U09A 2DRAA 5CCLA 2JEGA 1FCAA 3BJYA 2GGPA 4TN2A 4WIIA 1QVGR 2CJAA 3C46A 4O4RA 1EHWA 5GMEA 1U48A 4OYWA 3MMAB 7FD1A 3NMRA 1RWVB 2KHCA 1YG0A 1RJJA 1M5OC 3MPDA 4MKAA 4YB7A 2VZ9A 5CA5A 4LMZA 2BMBA 4ZP9A 2H9ZA 4ILRA 2C1EB 2DRDA 2W9AA 1F60B 1GQEA 1AFJA 3QMQA 2DCUB 2R7TA 3G6YA 5J1EA 2RSQA 2KDOA 1S49A 4DSIA 3MZIA 4J9OA 3MFHA 4NXNJ 4FS1A 2LQJA 3DMJA 4ZCMA 4NMXA 4J9QA 3NNAA 2KVQE 4MH8A 4LF9J 1TZ0A 3G71S 3MD1A 5IM0A 3ZZYA 2K3KA 2IMWP 2DGXA 2RB7A 4XDDA 5CYMB 3UVJB 5DS7A 2YKNA 2HGNA 4PQAA 3CXCR 3QGGA 1S6UA 1KQKA 3W7BA 1NKCA 5ETSA 3UNGC 1RAJA 1EJ7L 3M8PB 1J5OB 3TZWA 5KG3A 1HI0P 4HT5A 3MAQA 3HHLB 3TVYA 1ICEB 3K7RA 3OFHA 5IOLA 2IAJA 4EU0A 4AXJA 1FNMA 4USMA 4RW4B 2V4QA 2VJUA 2J6SA 2QLWA 1XK8A 2ZE2B 4J5OA 1Y0HA 4F04B 1AYEA 1O6XA 3CMES 1P9QC 1H3DA 5HSPA 1WSRA 1BQMB 4OZ3A 3AFGA 1NRKA 2VG5B 3LPYA 1X4CA 3QWPA 4DV2J 3HJVA 4NXMF 2VOPA 5IT4A 2CJYB 1TTHB 3CVKA 2AX1A 2W2QP 5KFWA 4DQQA 2DNOA 2NPFA 1PKUA 2QLJB 2V8GA 1T94A 3IC1A 3C19A 5B0EA 2XGQA 1RT4A 2ADCA 3AJDA 2G0JA 5CD4H 5A8RA 2XY6A 3D6TB 2EI5A 2A2CA 3R5DA 1IN0A 4N8OA 4R5PB 3BN7A 5KFOA 3N9UC 3KOAA 5J1PA 3CDBA 2UUCF 2HYIB 4MK9A 5A0YB 3KK2A 3PYEA 2OLWA 1G1XA 5GAGI 1MSWD 1HWJA 2X51A 7AT1B 3IWNC 1RWUA 1WKLA 3M1VA 1RAOA 4L6V3 2EXUA 4DX7A 1VQYA 2C2DA 1WF0A 2Z8QA 3PRDA 4RW7A 3HHNB 4RUCA 2N4CA 4EZ9A 1IBMF 4MKBA 5ETVA 1ZH5A 5E5NA 4NZ7A 1PYTA 2DD8S 2M2BA 1X8DA 1R89A 2RQMA 3CJ2A 4XPEA 4ZPAA 5L9NA 1CC8A 4A48A 2RF2A 1K44A 4AFFA 2J8SA 3SFGA 1UW4A 4CH7A 3BEGB 2M8HA 1CQMA 4PG4A 2CQHA 1Q16B 3OHAA 1L3VA 1U25A 1SH2A 4NLRA 1IBLJ 3PEHA 3OVAA 3R97A 2RNEA 2PA8D 2V2VA 4NPOA 1V3SA 2Q3PA 4LF4J 1ULRA 1OWXA 5D6GA 1D1UA 2L08A 5F8HA 3Q0AA 2GA7A 1GXTA 4ECVA 3F56A 3VGUA 1N34J 5F8IA 4KC5A 1I6JA 1KLNA 1Y3JA 2V50A 1RQ0A 2KO1A 4GMKA 2VH7A 1T05B 4JI2F 3R5JB 1NO8A 3ISND 5IFMA 4DG1A 2P2CB 1TMMA 4HDGA 1HI1A 1RYSA 3ELHA 2GIQA 5KG0A 5C2GA 2YKMA 1FX4A 4V1Ak 2XMJA 2DGTA 2JVOA 1X9MA 2ASDA 4MJKA 2DH9A 3MMCA 1F3VA 2YNGB 3SBMA 4MK8A 5E41A 1RU1A 3T5LA 2QMWA 2NXEA 4D3HA 4ZIVA 2R8GA 4DR5J 3KUEA 1JXEA 2DHHA 3D7SB 1Y4ZB 5A2QU 4EO8A 2DGQA 3I56S 5HMXA 3KK3B 1RAFB 1FX2A 2VFUA 2VA2A 3A12A 1TKTB 1A9NB 5FDLB 4F4XA 2CYYA 1T9WA 1AT1B 9ATCB 2Y9HA 4X4NA 3FRYA 1UL3A 4IRDA 2P9EA 3D1HA 3J81U 2CJ9A 5B0GA 2FB0A 2DY1A 4JI3J 2ZNYA 2ZJPQ 2CPYA 1LWXA 1Y5LB 2JJ4D 4WFAQ 3CULA 5EX3A 3DN9A 3CJ4A 4CH1A 2ZH7A 3M2RA 2GMJA 1JNZB 1GX6A 2N3LA 2R4FA 3GTYX 1ZETA 1JLBA 2VF3A 3GZ7A 1GEHA 5L1KA 2CQ3A 4I2PA 1ZBTA 3NOCA 1KEKA 3CCJS 2F4VJ 4LQ9A 1VK8A 4DF4A 5KFSA 1KQGB 4EGLA 4IFYA 4O0NA 2NS1B 1EETB 2DVIA 2XI2A 2OELA 3MR2A 2K1RB 1VC6A 2VD3A 1RHJB 2R7UA 2R7OA 4DCPB 5L46A 2XS7A 3ENQA 4ZS6A 2CPEA 2H5JB 5DLFA 1SUQA 3UNYA 3RBXA 4LF7J 3BPDA 3C6UB 1RWWB 1Q7LB 2QMUB 2B5JB 4ECYA 4G1PA 2HFNA 1OO0B 3LGHA 3CMQA 2IDEA 4C97A 1NH8A 2DEJA 2UVUA 4IFVA 1K1SA 4OHYA 3CE8A 3FEXB 3D28A 2D3O1 1J2VA 2VL1A 2OFGX 5KAKA 3PKMA 1RHMB 2GHWA 3GG1A 2VC1A 4DN0A 2QA4G 1RU2A 1TL1B 1BHNA 2RH3A 4DSJA 2QYCA 1XMQF 3PJXA 1IJEB 3UQSA 4X4TA 1LNQA 1RZMA 3GFYA 2KB2A 2PA3A 2OPQB 1DTTB 2XG8A 3OUYB 2XYHB 5J2PB 5ADZA 3MMBB 2DPJA 5DGAA 1U6FA 3LWMA 2AZ1A 4JYAJ 1RWXB 2CG8A 4LR8A 4FDFA 3BSCA 4UQTA 1N8RT 2AGQA 2FHJD 1VRTB 4OYPA 1WEXA 3CD7A 4WFNQ 4FVCA 2NXJA 3H5SA 2W7PA 2LFVA 3PXGa 4OX8A 1G4CA 3KJQB 4JI4F 2IJFA 1YJ9S 3M8QB 4A46A 1H2TZ 3NGRA 4B9VA 1NZAA 1ZA2B 3M9MB 3OTDA 4WYLA 1J5EF 4R25A 3G9CA 5T7LA 5D3GB 3CNQP 2FHJA 4P72A 4K7QA 4ANCA 2GQ2A 4NLDA 3S1TA 2CNKB 4DEZA 5AJ3J 5E3AA 4XAKA 2NUUG 4NL5A 3JSBA 1K0TA 1YRUA 3V81A 3L7UA 3TUIC 1HNZF 1AZSA 4NA2A 1LW2B 1JLGA 4RW9A 1EB0A 4BHQA 3QRPA 4HACA 2XSJB 3AB2B 2CQBA 1F1BB 4FYYB 4ETXA 3IGNA 4CTAB 1I94F 4LSLA 1FVSA 2CUYA 4LJMA 4QQBA 5BR8F 4KAIA 3AXKA 1H2UX 2CZ9A 4WKYA 1HKAA 3JSMA 3RU0A 1IJFB 2Z58B 1TK0A 2YWEA 1UWBB 2R7XA 4Y2IA 4WFBQ 3LUYA 1NHKL 5M2PA 1SL0A 4FPRA 3RAQA 3K5LA 2NXNA 3PIOQ 3MEDA 3OXLA 4KO0A 1RGVA 2LP4A 4X4QA 5CYJA 1AROP 5EGYA 2BOAA 1FWPA 3ILLA 1SH0A 3PX4A 3KNGA 4YDXA 1KR4A 4P7VA 3VAGA 1PBUA 1QUPA 1YZ7A 4PRFA 1WC4A 5AXLA 3RZAA 2V9KA 3T1HF 4N5SA 4LFBF 3EDQB 4DL4A 3OTEA 1RCOB 2KU7A 4DOZA 2VBYA 5ETLA 3KHHA 2EG2A 3QIPA 4RNOA 2B6AB 1YJWS 2M5YA 4RX6A 1H72C 1FXLA 1IBKJ 3I0SB 3PW5A 5KT6A 4JP8A 2WB4A 4CO3A 3KLFA 1C1BA 1Q79A 3AOCA 2ATLA 4L74A 3DLEA 2G2YA 2VQEJ 1TAQA 3TJ8A 2DH8A 3GYNA 3PM9A 3HZEA 2DGWA 4RLEA 5JMNA 2YH1A 1S1WB 3AQPA 1NKBA 3M7VA 1R6YA 1C4CA 1KWMA 2HBQB 1U1LA 1TUVA 3QGPA 1BGXT 1HFEL 1VGYA 5JXSA 3TEGA 3KJVA 2W25A 4QWEA 4ZHRA 2N7YA 3IAS9 2NSCA 4B9LA 1G7CB 5MAOA 4DV5F 1UVNA 1CS4A 4YR0A 1MMNA 5J2NA 4DS5A 8RUCA 4LUBA 2DNRA 4HVZA 2UUBJ 2QV6A 2D3UA 5C25A 2LDIA 1R8PA 3KK1A 3FFIA 4RUBA 1MWZA 3H5UA 2IY5B 3V6DB 4O4GA 3IFEA 3QRRA 1RE1B 4L72B 4NLVA 1T7PA 4E8UA 3AA8A 1VHIA 4LF8F 5F3TA 1V5IB 3CJ0A 3IBCB 2R2TA 2FJEB 2AQ4A 1N33F 2CVIA 2BANB 2HBZB 4JI7F 2UUWA 3GQCA 1HR0F 2NR0A 2MTLA 3G4SS 3ENAA 3SQOP 4UT4A 3NRBA 3PNIA 1JK9B 2O3DA 2Z30B 4USUA 2PE8A 3CJRA 2IYGA 5LMUF 3W61A 2W8KA 5IZHA 3DLLQ 1LWFB 1HNVA 3KLVA 4TKTA 2HFOA 3Q8RB 3HHDA 2AHOB 3L7OA 4AUKA 4Q7AA 2DR6A 1DZ5A 3OTOF 3TWZA 4OLPA 2UXDF 1M0SA 2ASYA 3FJ2A 3S8SA 1HNWJ 1U24A 4LIRA 5JVHQ 3H4BA 2RUGA 1XNRF 2PMZD 3I4PA 2B9EA 1CQNA 5U47A 1PAUB 4ZOSA 2GJFA 3T1YF 2KYZA 2IRUA 3DRXA 3WX4A 1S9GA 2AW0A 2HNZB 4U7UD 1RTHB 4F8RA 4ZVHA 2IBKA 1OYDA 4ELUA 3E8OA 4WP3A 5KG2A 4QYZK 4C8NA 3D0GE 2K7JA 4FYXB 2R2RA 4DWIA 1GTEA 1YWXA 2OO4A 3GCXP 1DQ8A 1GTHA 1IKVA 3G86A 5D77A 3LOUA 3TRGA 4U7UK 3THPA 3SXLA 1HA1A 2A10A 2ILZA 3AY0A 3R9LA 2YNFA 2LEAA 2R7WA 3MCOA 2AJ4A 5IQQA 2XHCA 3DM2A 2HQDA 2PIIA 4EMDA 1HARA 5G0RB 1CULB 3TNVA 3J81Y 2BQ3A 2IC3B 2A2DA 2D3OR 3VV2B 3FQLA 4NA3A 2I2YA 4F4WA 1I3OB 2DPIA 2ZOGA 2QTWA 4UOGA 1UP1A 4K4XA 3NS5A 3JB9k 4AL6A 1RWOB 3BKTA 3QWUA 1D9AA 3BKUA 2R8IA 2IIHA 3DRRA 2VQFJ 1S4EA 3ZZTA 3KHGA 1XR7A 1UZDA 2XWYA 3DYAB 1IQZA 1UW9A 2ZWOA 2ZEJA 4HR2A 4OZNA 3IG1A 1S48A 4GRSA 4A8KA 5T14A 2F8EX 3HKWA 3VHQA 3TA2A 3HHEA 3W64A 1H6KX 1MU2B 2MZ1A 4NCAA 2W4DA 3C15B 2RRBA 1CJKA 3D4JA 4EBEA 1UVMA 3Q2TC 1UJ6A 4QWCA 4DUYF 2XY5A 2X3GA 1NK7A 1RT5A 4PG8A 3W3SA 4OL8A 4LFAF 1LXJA 2GGPB 3CCMS 1U1PA 3F73A 4B17A 4G65A 4KT0C 3JTPA 2V5HG 3RJMB 3T5JA 4DSKA 3W66A 2OSRA 4ED8A 2EBEA 4ECXA 1ZS6A 3V6HA 3C8YA 4WU2A 1M5SA 2DNGA 3NKYA 1NDKA 1NLKL 4NA1A 2IRYA 4DX5A 1MG7A 2V2ZA 2CPZA 1N32J 2U1AA 2HHUA 4DPOA 2RILA 5J1EB 4QIEA 5C5JA 1UFLA 5K9FA 4U8VA 3BGRA 2ZH9A 1N5SA 1BMQB 3UDCA 1FVQA 3TVKA 2RKIA 3FSYA 2ACMA 3CGIA 1N5YA 5IM0B 1TMJA 2CRLA 2CQ2A 3A3PB 3BYRA 2KZMA 1FF2A 2EFVA 2YKNB 2AYGA 4F50A 3R27A 1UTAA 2F65A 2PGCA 4CWBA 2BJ7A 3BDPA 4EWTA 3JAMY 5J2QA 1JLCA 2FJXA 4F3QA 5E3PA 3TZXA 3HD1A 1U2FA 2EC2A 3CTRA 3VCDA 1RA6A 5K8OA 4K5SA 3HZGA 4I56A 5A6WA 5KT2A 3ET6A 4OX6A 2ZHAA 4DI6A 3Q8VA 4PZVA 2GZOA 4ANDA 4MK7A 5B0AA 5HROA 2MZSA 2DRBA 3BBBA 4ZPVR 4OYBA 3TX8A 4I7FB 2HVZA 2Y1LB 2EFQA 1R3NA 3OJSA 1ZTWA 3NS7B 4A8FA 4X4PA 4QU6A 1A0OB 3HSJA 2RRAA 4ZN3A 1REGX 4CYUA 1RT4B 5A8RB 1ITPA 3J7AN 3EM1A 3CJ8A 2OAUA 4NXNF 1NZ8A 1M90T 3MAAA 5E33A 2AKWB 1YGYA 4B02A 2HPUA 1QE1A 1OIAA 2XWXA 3PX0A 1LQ9A 4LF9F 2L48A 2DBBA 3KK2B 3OD2A 3MXHP 4CZCA 3CT9A 1Q78A 2E1PA 5EX0A 4ELTA 3TOQA 3M1VB 4CLYA 2V0NA 4L73A 2V6AA 5F41A 2JEFA 1YVFA 3DLBA 1U1OA 5KG5A 4RW7B 3PV8A 2DNPA 1FJEB 3MPUB 4JI8J 1WORA 1N6QA 1YK9A 1FRHA 4NI2A 2JSXA 4GC6A 3W65A 2G2ZA 1YBUA 3FBBA 4O0IA 5I4MA 4B9SA 2J6TA 1HQUA 1H7WA 4WZQA 2GO9A 4CLWA 2MHEA 3UR0A 3OVSA 2RF2B 4K4SA 1MWYA 1S9EA 2VKZG 2BABA 2DR9A 3E2EA 3BF4A 3RGIA 1FFWB 3KNAA 1F9FA 1UVKA 3CIMA 4EI2A 2VG7A 4OV6A 2W2MP 3K89A 2V94A 1F6TA 2VG6A 3TAQA 2CQDA 1UVLA 1YQHA 4C3KA 2UUCJ 2N3OA 3B6BA 4UF4A 2A1BA 1W2BR 5IS2A 4DR4J 1KDNA 1HBUA 1EX8A 4YB1P 4F4YA 2GX8A 3TX0A 5EN1A 4IO1A 4JI5J 4ZLNA 2B9YA 3H90A 3MPWA 4LF6F 3RW7A 3D9BA 2HRTA 5ETRA 1P9YA 4KGVB 4FVMA 2GVDA 2H5IB 3QGHA 1EKRA 1C1CA 3PFEA 4DG1B 1IBMJ 1RHKB 2BR0A 3CDUA 3T9NA 2R7SA 3KLGA 2JC1A 2V67A 4I1TA 4S0MA 1I5OB 2ZKUA 1ZYQA 4OI2A 4ZLPA 9RUBA 2YKMB 2HFSA 4C3LA 1VQ9S 1VQ5S 2FZCB 1SJQA 3MMCB 1FE0A 3QFWA 3PW0A 3CIZA 2W2OP 3K58A 3FBEA 4KH0B 1RUSA 3TANA 2PD1A 3PJWA 2FJDB 2FYXA 3GILA 1R8AA 4JV1A 1LWCA 2QFJA 1SI9A 2JH3A 4P2SA 3W2WA 2LDYA 3WQPA 3LQVA 1KONA 4NCBA 3MMJA 1S1TA 3BGFA 3N0VA 4M5HA 4OZLA 2NYIA 1SQFA 5D4NA 1FE4A 1PC4A 4C7QA 2OKQA 3ENWA 1PJ6A 2HBYB 2JEJA 1TUWA 1TV6A 4ZJLA 2B4PA 3NP5A 4R5PA 5M2RA 2IFXA 2NCKL 2E1RA 4FN5A 4F0MA 2XEXA 3U27A 1IBLF 1KC8T 4J90A 2DR5A 1EARA 1D09B 3DGPA 3M2RB 4Y00A 4B9TA 4MYUA 1HIYA 1EP4A 4ED5A 1JLBB 4XPCA 1Q8LA 3BREA 3K2YA 1RLDA 4I2PB 1N34F 3ONQA 3CC2S 3NG8A 5BYSA 3MAHA 4DQIA 3G2XA 4PUOA 5MLCV 2K8GA 2YTCA 4ES1A 4ECWA 4J91A 3DLKB 4XTTA 4IFYB 3D0HE 5E3QA 1NHVA 3GPAA 4Y6IA 2DGSA 4OHXA 2VFRA 3ZZZA 1VC5A 3QRQA 4KV8A 4ED3A 1LWEA 3F0NA 3IRXA 3DDKA 1RTIA 4WJBA 5C42A 1ELOA 1SXLA 5B0FA 1SUQB 2APOA 3OW2R 1U1MA 2KVIA 3CJQA 4FF4A 1W26A 3RRKA 3BGUA 2CQ1A 3DOKA 2ZJQQ 4Q8EA 1HNIA 3M8SA 2KT5A 2H5EA 1TP7A 1KOHA 2FQQB 4ZJOA 2XMVA 1CLFA 3IP0A 2MEWA 1XWLA 2FJWA 2C42A 4IFVB 4KQZA 2KFZA 1JJHA 2VHGA 3UN3A 2C3YA 4YEAA 3FSIA 4C8OA 2RU9A 4LF1A 4PXEA 3PRBA 2MPUA 2VFVA 4OZ5A 5DQHA 1EQ0A 4QIGA 1H38A 1QSLA 4L3NA 3VTIA 1NJYA 5L1LA 2MKCA 1VIOA 4W90B 2LKZA 4YR2A 1Y7PA 1L3TA 4IR1A 1UETA 3M6UA 2DHGA 5BJRA 1K8AT 5H1SV 3FEYB 3D68A 4G6VB 3HSGA 3SSRA 1NJZA 2VPYB 2G0CA 4PWUA 2VFSA 4ECTA 1Q86T 2G2OA 2OTLS 1N48A 1CC7A 2CPFA 1SBRA 3RRHA 1D8ZA 3T1AA 3FNNA 2AJQA 5F8GA 3HVWA 2C3MA 2LYVA 4TYAA 4ECUA 5DO2A 2C3OA 4KPCA 4M94A 2B9XA 4YDDB 2YWWA 1RHUB 2MQNA 2F4VF 2DEIA 2OD4A 3VAHA 5HQLA 4FF2A 5H9FK 3DI6A 4OYIA 1F0XA 4C8KA 1RWPB 5T7LB 5L38A 4XK8C 3PW7A 1EAYC 1VQMS 3H7HB 2BW7A 5CYQA 4RWWA 3V81B 1F5BA 3NBPA 4DZ6A 2UXBF 2DKOB 4WFXA 4LF7F 1XEZA 4ZPBA 2XM3A 1JLGB 4W92B 4RW9B 3MF5A 4DV4J 4HACB 3QT8A 4ZDNA 2GMLA 2RU3A 4G1IA 4DMZA 2AWZA 3TA1A 3Q23A 3GWCA 4RO0A 1T8EA 2F8MA 1NK6A 4B9MA 2IVYA 5T41A 2GCFA 4DXLA 3JYTA 3PIPQ 4WPAA 3AOAA 4U7CA 3JSMB 2CJBA 3TYTA 5B09A 1S57A 1U2RA 2XCPA 2FJAB 4M5KA 4F2RA 2L9DA 3MEDB 1RHQB 4JB8B 4KO0B 3IN5A 2B43A 2CPXA 5HVGA 3AHPA 3BKFA 2RQCA 1LV5A 3CDEA 2J9DE 5HO4A 4JI4J 1TFYA 1VQLS 3TUPA 4ECSA 1CJTA 3CCZA 4P10A 2CADA 4DX6A 3G8TA 1J5EJ 5L1JA 4MKYA 3PZPA 4DR7F 3N79A 5GAEI 2E44A 4RUAA 4TLQA 2NLWA 4ZKAA 2N4DA 2I9SA 2EG1A 1N56A 4B3OA 4NLQA 2IJRA 4X84A 3X3UA 3T5KA 3V6JA 2YPYA 1LXNA 2AX0A 3QIPB 2RVJA 5DZ6A 1Q82T 4NLWA 3AA9A 1DJ0A 4CLLA 2BRKA 3M4XA 1UWAA 3M2UA 3MCMA 4X4SA 1I94J 3KLFB 4HHHA 1C1BB 4JBCA 3DLEB 4X62J 5BR8J 1H98A 1C0UA 1S72S 4C0OC 4DUZJ 4OJHA 1GX5A 5HK4A 5AJ3F 1YJNS 1QVFR 2FLNA 2J8AA 3U02A 5DJBA 2KI2A 1CEZA 2I1RA 1U6ZA 5BYRA 3PHEA 4OHWA 3QO9A 2OTJS 2DXFA 2ASLA 4KHMA 4BWMA 3FBFA 3KJVB 1KFSA 2Y3YA 3H98A 4D3GA 1RKJA 1M5HA 2QMXA 3H59A 3G82A 2O1PA 3UDLA 1T0TV 5KFXA 4PG6A 4IOCQ 3IR7B 4O23A 2AIRB 3A8JA 3OL6A 3DDIA 1NXIA 5HMZA 2L9NA 3HVTA 5LSLA 4CO1A 1CS4B 4UQGA 2D9PA 1NJXA 4ZJQA 2E5IA 2BQRA 5J2NB 5HI7A 4Q0BA 1IKWA 3AXMA 4JV2A 2C3PA 2ZJRQ 2KHDA 3B8HA 3IM8A 2C2MB 4TNOA 4KKOB 5C25B 3BN4A 3KK1B 3FFIB 3GV7B 4DFPA 5IT9U 4O4GB 4P7TA 1XJWB 2G13A 4C3MA 2LU2A 3Q2SC 4LRBA 3GE9A 3NMAA 3I31A 3HLUA 3LA0A 4K5RA 3T19A 4K0KF 2MY7A 4NLYA 4G1QA 3O8WA 3NCQA 1RKIA 2N82B 2BJ9A 4IDKB 4KGMA 4OI1A 3P3DA 1JKHA 3KMSA 5DQIA 4LF5J 2D1CA 3CCVS 4Q44A 2IM3A 1YBTA 1FRXA 2HMIA 1JQGA 2GO8A 3H2UB 1O51A 3HFZB 1BWVA 2EFGA 1HNVB 1UJ4A 2VQEF 4N76A 4NLOA 2HS4A 1NDCA 2NSBA 1WUUA 2M88A 2RHSB 1S77D 4QIWD 5FJ4A 3GG0A 2VOOA 4BWJA 1WOOA 2VUGA 1HYSA 4CM0A 4K4UA 1WTBA 4FYWB 4H4MA 4LRAA 1Q53A 1UAWA 4CT9A 4NLSA 1QUVA 4RW8B 3SFUA 3GJQB 1FO1A 2CG4A 2C2NA 1VQSA 3DXSX 2XLJA 4MIBA 4X2BA 2VV5A 4N7TA 3AJ2A 3RB0A 2N7CA 2QX0A 5B0DA 2CXEA 2FVRA 2AF6A 4FF3A 4AXIA 3ZZPA 2F40A 1N33J 3PCOB 1U2CA 3VAIA 1GNKA 1DTQA 4USKA 2UUBF 3OTCA 5KFBA 4F26A 1K47A 1LEOA 3I5AA 1U7LA 4ZPWR 2ZITA 3PR5B 2XGPA 2GIRA 1URRA 1PO6A 1WOSA 3GLJA 5LMUJ 1HWLA 4YB6A 1X9WA 4ZVPB 2JDJA 2MQLA 4U96A 3CCWA 4WTOB 3CDWA 2FD2A 2YNFB 1LFWA 2B9WA 4NEZA 5HLFA 4A8YA 4RKUC 2FGOA 2HQCA 1RHRB 3DM2B 3P96A 1NPKA 4PWWA 3PEJA 4EK2A 4JI0J 4OIXA 2UXDJ 2ACYA 2Y1RI 3N5FA 4CM2A 3ZTRA 3DRSA 4DF8A 2XNQA 1R8BA 1XNRJ 3J80U 2E5HA 4WKRA 3NGKA 1S6QA 3DRRB 2UXCF 2W8LA 2J7WA 3V4IA 1NEEA 3EUNA 3M9OB 3THTA 1FXDA 2AJ0A 1I1GA 2MMYA 4IO9Q 1PSDA 4CT8A 3N5BA 3IG1B 3O44A 1GMWD 5DQGA 1RT2A 5LSOA 3F41A 3O2IA 3O5TB 2ZC3A 2E5LJ 3C2PA 4UUXA 5KT4A 1APSA 1VC0A 5KFHA 3GIKA 2C22A 1Q95G 3CCRS 1CJKB 3TARA 4JI1F 1OY6A 1WEYA 2M70A 1EQMA 5DRKA 5HQMA 4LT6A 1FWLA 1R31A 2HWIA 2ALZA 4IUFA 3MM6A 2BKPA 3JS9A 3GFXA 2I5JA 2HGLA 3AB4B 4ZVEA 2ZH2A 3CD6S 4DQPA 2CNLB 1V9OA 1OYEA 2DH7A 1NH7A 2VONA 3VQSA 4TYBA 4KY3A 4IKAA 1OQ6A 1FFSB 2RUSA 1RAIB 2CVEA 2IHR1 3MM8A 1HQEA 2FGCA 4L76A 2ZZNA 2EFOA 2QO3A 4NLTA 2OEKA 4E0DA 1W2IA 2QLFB 3CUNA 3BSNA 3BSOA 3CJSA 1QAIA 4BLGA 4NYPA 3BGRB 5K5MA 4QU7A 1E6YA 2HGMA 2H54B 2PMWA 1SH3A 1TK8A 3POTA 2R42A 3M8WA 3DRYA 5F8LA 1X4HA 2RKIB 3D0IE 1X4FA 1V5VA 3EZOA 1N5YB 3H2LA 3U1LA 3EGVA 1R0AA 4FNIA 4F02A 2VQFF 4ICLA 1SKSA 3SSQA 4LFAJ 4LBIA 4DFMA 4ITSA 3C6TA 3FCWA 4HT7A 2HNDA 4NCGA 1O0PA 1VBXA 2WHOA 4OHVA 4KGKA 4RPFA 4OZ0A 3NS6A 1PIEA 4CNYA 5J2QB 1JLCB 4RJVA 1WSVA 1U0HA 1VCTA 2ZBIA 3AH6A 2C28A 1XIQA 3GV5B 1OY9A 4UOCA 4WE1A 2HHSA 2KFNA 2XNRA 3ET6B 3N6MA 5D78A 1VQKS 5HROB 1H2VZ 2QN6B 4EFAC 3QT6A 3Q24A 4K59A 2J6UA 5G0RA 4J9KA 4DDFA 3HHLD 1NSAA 3PRVA 4DPUA 3RW6A 3UFCX 3QT7A 4ZLJA 1WC3A 4PG7A 1FRMA 2BE7D 1TL5A 2BACA 3LH2S 4UTGA 4CYUB 4UZCA 1RI7A 3QT5A 1XC9A 2CDQA 1T03A 1TKXA 2W9CB 2CKWA 2ZFHA 2DHXA 4B08A 5EWGA 3MAAB 2Q6CA 4YOEA 5DM6Q 1T95A 3T5HA 3KLHA 4EYIB 4O3OA 2QC3A 1QE1B 4FNHA 3CF5Q 1Y9OA 2OJ3A 2JEIA 2D7SA 2GVZA 2GFFA 2NXUA 4AYBD 2MZJA 4EZ6A 2FVCA 2HWTA 4U67Q 2Q1LA 4OZ2A 3EZ5A 2AYMA 4EEYA 3NEKA 4NZ6A 3RB6A 4RBUA 4DV7J 4ES3A 1S99A 1XNQJ 3OQ2A 3M32A 2A6MA 2VODA 3IRWP 4ID8A 4JV0A 3OJUA 3JQMA 5F9NA 1N6QB 2QG9B 4ED2A 1QJHA 3MPYA 4FKXA 4NI2B 4CLTA 3UN2A 3FGVA 3MWBA 2BRLA 1HQUB 3FSXA 3FVYA 1FKAF 1VLYA 4NLXA 2CQIA 1AUSL 1GFWB 1S9EB 4A4JA 2V68A 1D3WA 1IWAA 5HVFA 2HW3A 5KFKA 1FI4A 1HW9A 1VMBA 5LM7E 2JFDA 2VG7B 2C2OB 5I3PA 4USTA 1S7IA 3RG6A 4ER8A 4CDIA 1KD1T 3DDNA 2VG6B 2LQ9A 4DCOB 4LR9A 5L9XA 2D41A 4ZP7A 2JNJA 3CCTA 1SVDA 4ECQA 1HBUB 4I6YA 1RXOB 1WKKA 2LA4A 1OSDA 2DB1A 3N28A 3PYDA 3EWGA 2KJVA 3HPOA 3ISZA 2GVDB 3K8WA 1LOUA 2X7IA 2AU0A 2DCLA 1C1CB 3M8ZA 3MEGA 3LPEA 6AT1B 4PR6A 3MEKA 3PJ9A 3WBZA 5F0UA 3KLGB 3EGNA 3OR1A 2CQ4A 4RR5A 1VQ6S 4DR6J 1N0UA 3K5NA 2QRRA 4DL0C 1AXQA 3G6ES 1S59A 3HM9A 2X1GA 2HHTA 1FJCA 1NB7A 2H1YA 5B7WA 4I6WA 4UOHA 3LAKA 4YN3B 2H4YB 3P5TL 4JI8F 3WIVA 3CMAS 1REVA 4UUWA 4OYXA 2KH9A 1LWCB 4YY3F 2W2NP 2HNYA 3SYZA 2J7KA 4I7FA 1P1TA 3W2WB 2WBMA 1S1TB 1O8BA 2POKA 3J7A1 5H9EJ 1S79A 1H7XA 3ZZ0A 1NUEA 1U4BA 3Q8UA 2GJ2A 3TJ9A 4RWXA 4J9VA 4LF6J 1TV6B 5CAAA 2MSSA 2FVQA 2DK2A 3QATA 2NYHA 3R1LA 8AT1B 1Q0NA 1T9XA 3CDAA 3DGPB 1L5UA 1LK5A 1SJ4P 5IC4B 1FDNA 2QL5B 1M1GA 1EP4B 3P6YC 4DR4F 3ZNJ1 2KT3A 2MZRA 1M1KT 3TW0A 2J0SD 4JI5F 4OJGA 4PUOB 4DL7A 2XMAA 2W2PP 1U6BA 2P6SA 3ILJA 5DM7Q 2PC6A 3RBEA 1F3FA 4OI6A 1KS2A 2ZH8A 4KV8B 1LWEB 1YZ6A 4FZVA 1D9FA 3IRXB 3R5BA 1RTIB 4QR0A 4TQRA 2VPZB 1RYRA 4P74A 1U47A 5C42B 2RT3A 3VZIA 1A7GE 4C0BA 1JJ4A 3FMWA 2FPHX 3KXDA 2YKOA 1RAEB 2F8HA 3DOKB 2FVSA 2J76E 4B3TF 1HNIB 2W1BA 5SZTA 3ENVA 5DG8A 3SDEA 4F67A 4TU7A 4DLEA 2QSWA 3WIUA 1SJRA 2HS0A 1UVJA 3MUMP 4QR2A 1SKRA 1MROA 2AYBA 1CBKA 2B8QA 2E5JA 4DV1J 3GYXB 1VQPS 3IO1A 1QSSA 4LRCA 2W7OA 3L09A 4I67A 1KVKA 2HQ3A 3BBCA 4QW9A 2EFPA 5J2MA 2WBRA 1U8SA 4USJC 1YIJS 1WEZA 2BVZA 3GFHA 1HNXF 5E0OA 1X5SA 5K20B 5BXIA 1WTFA 2DITA 2HAIA 2MQ8A 2MLYA 1YJ7A 4CO2A 2H48B 3E01A 4ETZA 3RR7A 1MLAA 4F3OA 4OZ1A 2AMCB 2P6TA 5HP1A 5K8PA 3Q83A 1FKPA 2W4PA 3H5XA 2KG0A 4QJVA 1D8YA 1UMJA 2DNLA 3HHKA 4ZIWA 3T9ZA 2MLZA 3CW2C 3DHWC 3LO3A 4CLPA 4HYKA 1FWKA 3OPKA 1K9MT 2XMWA 3IXQA 4OFZA 1RAHB 4U9RA 3DI6B 2AJFE 2YPZA 3DC2A 2ZH4A 5SUHA 1SC4B 3BR8A 2EWHA 2FZGB 4FXDA 5KFPA 5EHHA 5A8WA 2WVCA 5CYQB 1BLUA 2BE2A 2KXFA 2YH0A 3H8YA 2DNHA 3SQGA 1XQIA 3NBPB 4DPXA 2Q43A 3NNHA 4B3SJ 1YKWA 2L3MA 1EZZB 1YJRA 2YXLA 2DISA 2I8EA 3NGDA 1N88A 2OP5A 1ROFA 1FJ7A 2FC8A 4WZMA 3MURP 3JYTB 1X4BA 3C16A 2LQBA 1BD6A 3EVOA 3H0PA 1WHVA 1I51B 1R0BG 1MMDA 3H2VE 3EVWA 4NRTA 4E2FB 4WWSA 1U1NA 1ZAVA 4ZPDA 3VQTA 3TUJC 3DLKA 2MQQA 1CJTB 2D3ZA 3PFOA 3A8EA 2QFIA 1S1UA 2XLIA 4LVOP 1BXNA 3GYGA 4B3OB 1RP5A 2V8PA 2HS3A 2KL8A 2UXBJ 2HVHA 2FUG9 2R8JA 3AD9C 4PQUA 3N01A 3M2UB 3QZ7A 3ZTQA 4RW6A 4F0HA 5IV4A 3PVXA 3I0RA 3Q86A 1CVJA 3B54A 1C0UB 4PG5A 2VBWA 1VK3A 1C0TA 3U1NA 4MT1A 5GADU 4GO5X 2CQCA 1YTYA 1B70B 3CCUS 1N4LA 2XZDB 2OGUA 3D6MB 1IM4A 1KQFB 2ALYB 4FXVA 3CJ5A 1O5JA 3NNCA 3QO9B 3H40A 1S0MA 3VAFA 4RNHA 4CCHA 2ZVSA 4DV4F 3JSYA 2M7SA 4RU9A 1E6VB 2GNKA 2K3IA 2XB2D 2LECA 1WG4A 3KG4A 1GXUA 1IM6A 3G82B 2J0XA 4AT1B 5DG7A 3DLGA 5DDRC 2OPRA 4DN9A 2UU9F 1U1KA 4K50A 3KJFB 3HVTB 1D9DA 2LEBA 2VASA 4DR7J 5THWA 5F8NA 1C2PA 1JWWA 4Q43A 1HBNA 1FTCA 2X1BA 1F2GA 2HHHF 3GIRA 4Q0BB 3RAXA 1IKWB 1VJWA 5LJ5Y 2RQ4A 3VZHA 2Y1IA 2R2UA 2DGUA 4J9PA 1CG2A 3MM5A 1KP6A 3TO8A 1C4AA 4C48A 3WC2A 4MKVA 3GJTB 1WWHA 4ZPCA 1JLAA 2C2KB 4DSEA 3I4HX 2ZD1A 4B9NA 3CJKA 1FERA 2R9LA 2H3EB 2CJQA 3JTNA 4DV3J 5E3CA 4OX9J 3ILOA 3UDEA 4C8MA 1OPIA 4G1QB 4LSNA 2CJXB 3M8YA 1TVRA 1OPZA 3H42A 1JKHB 1JLFA 4IG0A 4WBFA 1RBOB 1DFDA 1FKOA 4WCEQ 2HMIB 2FLLA 3MHYA 1IKXA 3C3LA 4YHHF 1RT1A 5D4OA 2J5AA 2RQKA 4X62F 3E51A 4WK1A 4IH6A 2BM1A 4DUZF 1ZZNA 2KM8C 4LVNP 4HLBA 2CFXA 3IR5B 4QR1A 1HYSB 3OR2A 1VQ4S 2IA6A 4H4MB 5FD1A 4CLSA 4QWAA 4M5MA 5C7PA 3QNWB 4NLUA 3AQOA 4HH0A 2MKIA 4PXDA 2C2RA 4P71A 2OUGA 2DHAA 1KVIA 3ILIA 4PXBA 1FJGF 3FZ2A 1AW0A 2IMOA 3QAEA 4RL1A 4YP3A 4K0KJ 1HBOA 2HIYA 2XMMA 1KHWA 2HKEA 1LK7A 1WHXA 1DTQB 2JOQA 1NSPA 2JFKA 4CLZA 2MKJA 3D5MA 4M1KA 3P4UB 4NOHA 4W4MA 5HANA 5JUMA 2Y8WA 2KXNB 4C4WA 4DFJA 2HZAA 1N5QA 1Z1ZA 1RTDA 3W9IA 5D15A 5HLFB 4ED1A 2AD9A 1QTMA 2RJZA 4GKKJ 4GVBA 1Q81T 2YX1A 3I87A 4I6AA 4F2SA 4LF5F 2BBEA 3OSPA 2B4OA 4IG3A 1X0FA 5D0EA 3DRSB 3RB4A 4QWBA 1IKYA 3KTQA 4URQU
chains in the Genus database with same CATH topology
3TR5A 3DLHA 2AGPA 2WONA 4KC5A 5F8IA 2JLFA 4U7CA 3JSMB 2DNMA 1Y3JA 2CJBA 3TYTA 1I6JA 2ZH6A 1RQ0A 2KO1A 2ZOFA 4GMKA 5B09A 2UUTA 2VH7A 3EZUA 4NMLA 1T05B 1U2RA 5F0WA 4ZCKA 1S6QB 2OPPA 1HBMB 5KFTA 4OHZA 2XCPA 2FJAB 4JI2F 3V4IB 4F2RA 2L9DA 4PXCA 4GO7X 2G9OA 3IRWP 3MEDB 2F3JA 3T6JA 4KO0B 1NO8A 2YNIA 3GFZA 3ISND 1T3NA 3IN5A 3MPVA 5E7OB 4DG1A 1V6HA 2B43A 2CPXA 4KFBA 3AHPA 5FIIA 5IFMA 2RQCA 4X65F 4HDGA 4J37A 1LV5A 1PGZA 2HLTA 3CDEA 2J9DE 1HI1A 1RT2B 4I0WA 5HO4A 1RYSA 1TFYA 3U1MA 1VQLS 2RMLA 2GIQA 4ECSA 5KG0A 3M6XA 4HDHA 3HMJG 3CCZA 3MD3A 2YKMA 2LXIA 2E7WA 3R5CA 2UVWA 3M30B 4KKOA 3G8TA 5KFLA 2BM0A 1TQLA 2XMJA 3DU5A 1UKUA 2DGTA 5L1JA 4MKYA 2JVOA 2CPIA 5KFMA 1X9MA 2ASDA 3PZPA 4DR7F 3N79A 5GAEI 4MJKA 2E44A 4RUAA 2DNYA 3MMAA 2DH9A 2ROGA 4TLQA 3CCQS 2NLWA 2BV3A 3KG0A 3MMCA 2N4DA 2I9SA 4ZKAA 2R8KA 4IRKA 2EG1A 2C3UA 1N56A 4XIUA 1WACA 1SC6A 2YNGB 3D2WA 4NLQA 1NK4A 4MK8A 5E41A 4FBUA 4B3OA 4X84A 3FQKA 3T5LA 2QMWA 1VQOS 3X3UA 1HW8A 3MM6B 4RBVA 4D3HA 3S7RA 3T5KA 2IBOA 3V6JA 4A8MP 1KHVA 2R8GA 1Z2ZA 3HI9A 1JXEA 1LXNA 2AX0A 3QIPB 2RVJA 1DBDA 5IQ6A 1Q82T 2HRUA 2EBGA 1Y4ZB 4EO8A 2DGQA 1VQ7S 2M4MA 2I5JB 1SJ3P 3I56S 2IJNA 1X5PA 2HFZA 5HMXA 3NAIA 2WAQD 3KK3B 4NLWA 3AA9A 4IDKA 4H4KC 1DJ0A 2BRKA 3M4XA 1N5VA 5KFAA 3M2UA 2VFUA 2VA2A 1XMBA 4Y2MA 3MM7A 4OLOA 5KFZA 4X4SA 1TKTB 3PW4A 5FDLB 1A9NB 2MKSA 3KLFB 4F4XA 1C1BB 5KTQA 2CYYA 4JBCA 1MMLA 3DLEB 4DV2F 1H98A 5GAHI 4X4NA 1C0UA 3FRYA 1S72S 2DIVA 4C0OC 2XZWA 1UL3A 4IRDA 4OJHA 1GX5A 3UCUP 2P9EA 5AJ3F 1YJNS 3D1HA 1QVFR 3MM9A 2FLNA 2M0GB 1HQEB 3MM8B 2J8AA 1WG1A 2O66A 3KLIB 4R0EA 5DJBA 3U02A 3IS9A 4MIWA 4ZCIA 2KI2A 2KKHA 3B82A 4P6QA 4ZP8A 1KSPA 2I1RA 1CEZA 2MHNA 2CJ9A 5B0GA 2FB0A 2YY3A 1U6ZA 5BYRA 4O3SA 1NK0A 2RDIA 2ZNYA 1UVIA 3UPFA 2QIFA 2GV1A 3PHEA 3I32A 4OHWA 2J0QD 3QO9A 2OTJS 2ZJPQ 2CPYA 1Y5LB 2JJ4D 4RUHA 1FRJA 5CYMA 2ASLA 1E6YB 4HL9A 4WFAQ 3CULA 4KHMA 4BWMA 3KJVB 4JV5F 1KFSA 4K4ZA 1VBYA 5EX3A 3DN9A 4JI0F 3CJ4A 3POTB 4CH1A 3H98A 2ZH7A 3M2RA 2GMJA 4D3GA 4FYDA 3CJ3A 1JNZB 1GX6A 1M5HA 2QMXA 1RKJA 1HMVA 3H59A 2N3LA 3L3CA 5AXKA 2O1PA 2R4FA 3UDLA 3M8PA 1J5OA 5KFXA 4PG6A 1ZETA 4IOCQ 1JLBA 1YHQS 3IR7B 1JNRB 4O23A 3GZ7A 4RW8A 3WDOA 3OL6A 3A1YG 5KOWA 2KRRA 5L1KA 2CQ3A 4I2PA 5HMZA 1NJWA 2L9NA 2Q79A 3HVTA 2ZHBA 3HHLA 5LSLA 4CO1A 1FTRA 4UQGA 1ZBTA 3HDSA 2D9PA 2ZNZA 1KEKA 1NJXA 3CCJS 1R0AB 2E5IA 4LQ9A 1VK8A 2BQRA 2HHPA 1JX4A 5J2NB 4DF4A 2CJKA 5KFSA 3D54A 4KIAA 5HI7A 4Q0BA 1IKWA 1KQGB 4ICLB 5JJBA 1X4DA 4EGLA 4IFYA 4RW4A 4JV2A 5F9LA 2C3PA 2ZJRQ 2NS1B 2KHDA 3B8HA 1EETB 3C6TB 4TNOA 1Q4RA 2DVIA 4KKOB 2HG4A 2XI2A 3MTJA 5KFYA 3QJJA 2HNDB 5C25B 3MR2A 2K1RB 2ZE2A 3BN4A 1KFDA 4NCGB 1VC6A 3KK1B 3FFIB 5KT3A 3GV7B 4DFPA 1YBAA 2NQPA 2VD3A 2DJWA 2G1DA 4O4GB 2R7UA 1WI8A 3J7YI 2R7OA 2E5LF 4P7TA 1BQMA 2O5DA 2R2SA 2XS7A 1FK9A 2NZ4A 2G13A 4C3MA 3ENQA 2LU2A 2QLXA 3Q2SC 4ZS6A 3L7PA 2CPEA 2VG5A 3GE9A 5L39A 4DS4A 4OMFG 3NMAA 4G3IA 5DLFA 1SUQA 3I31A 2FHOB 3HLUA 4E98A 2ZH3A 4K5RA 2JL9A 3T19A 5KFVA 1N36F 4B3RF 1S6PA 3EPIA 3C6UB 4K0KF 2MY7A 3V2UC 2F1FA 2VC0A 4FF1A 2HHQA 4NLYA 4J9RA 5A2QY 3OFEA 1Q7LB 4G1QA 3O8WA 4ZK7M 2WB1D 4RU2A 3NCQA 4WE1B 2LVWA 1RKIA 3HJFA 5KG4A 2B5JB 4ECYA 4G1PA 3SCKE 3ITHB 4YB5A 3W2VB 2N82B 2HFNA 1OO0B 4IDKB 2GQCA 4H4OB 4KGMA 3TA0A 2DO0A 4WFYA 4OI1A 4UY85 3P3DA 4C97A 1JKHA 5KT5A 3KMSA 4ZVGA 1NH8A 3IGVA 2JVRA 5DQIA 3PR4A 2UVUA 2D1CA 3CCVS 4IFVA 1K1SA 4Q44A 2YKPA 3CE8A 3FEXB 4OHYA 3D28A 2IM3A 3RR8A 4B9UA 1J2VA 2VL1A 5JVGQ 2OFGX 1FRXA 1RTJA 4FXWA 2HMIA 5KAKA 1P27B 3PKMA 5IXUA 1ZM2A 2GO8A 4IRCA 3H2UB 2GHWA 1Z2LA 1M5PC 3GG1A 1O51A 2VC1A 4DN0A 2QA4G 2EFGA 1HNVB 1ZAWA 3LP1A 1F5AA 1TL1B 1UJ4A 2VQEF 1Y00A 2RH3A 4M8LA 4DSJA 2QYCA 1XMQF 1FD8A 3EPGA 2ZDPA 2HS4A 3PJXA 4NLOA 4N76A 2NSBA 4DL6A 1IJEB 3UQSA 3UD4P 4B3MF 4X4TA 3GFYA 2M88A 2KB2A 1DQAA 2PA3A 3GIIA 1S77D 4QIWD 2XCAA 5FJ4A 3GG0A 2OPQB 2VOOA 1DTTB 1HD0A 4BWJA 2XG8A 3UI3A 2DNNA 2VUGA 3OUYB 4CO4A 2GMHA 1HYSA 4K4UA 5J2PB 2O01C 5ADZA 4ID5B 4WU3A 4ILMA 1WTBA 3MMBB 3X1LB 5A0YA 1HPZB 2IYIA 4DJBA 2DPJA 4H4MA 4DR1F 4LF4F 1PILA 5DGAA 2MGZA 1Q53A 1U6FA 1UAWA 4CT9A 3LWMA 3LGMA 1TKXB 2LEPA 4NLSA 1T03B 1QUVA 3BQ1A 4RW8B 1CSJA 5I3QA 4H54A 3HKZD 3SFUA 1FO1A 2CG4A 3BSCA 4DFKA 1JB0C 1U1QA 2YWHA 4CH0S 4UQTA 1VQSA 2MYFA 3DXSX 3KLHB 5I42A 1N8RT 2AGQA 2PI5A 3H20A 4HI1A 3CWJA 2FHJD 1VRTB 3O1LA 2XLJA 4MIBA 3MECA 1WEXA 4MTPA 5GADI 4X2BA 2MJUA 2VV5A 3PO5A 3CD7A 4WFNQ 1SKWA 3AJ2A 3RB0A 2N7CA 4FVCA 5D8HB 3H5SA 3K0JA 5B0DA 4DL3A 4I2QA 4MFBA 3PKYA 4JOUA 2W7PA 2FVRA 2AF6A 4BS2A 4FF3A 4PWDB 2EVZA 4AXIA 3KHLA 3PXGa 4OX8A 4C11A 3ZZPA 2F40A 4OX7A 2JX2A 5IT9Y 1DURA 5CXTA 2OPSA 3VAIA 4JI4F 3BQ0A 2IJFA 4K4YA 1N52B 1YJ9S 2V8DA 3M8QB 4A46A 2A3JA 1GNKA 1DTQA 1H2TZ 4B9VA 2UUBF 1NZAA