2KVQE

Solution structure of nuse:nusg-ctd complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
80
structure length
80
Chain Sequence
NQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRSRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords NusE
publication title A NusE:NusG complex links transcription and translation.
pubmed doi rcsb
source organism Escherichia coli
total genus 16
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2kvqE00
5LM7E 3R2DJ 3JAMU 4B3TJ 4KY3A 3OTOJ 2MTLA 4AQYJ 5IT9U 3W1YC 3D3CJ 4NXMJ 4K0KJ 4JI6J 1N33J 1I94J 4LFCJ 4JI2J 4RJVA 2VQFJ 1HR0J 4JI3J 4KHPJ 4LFAJ 2UXCJ 4LF7J 3D3BJ 4LF9J 2UUCJ 4DV0J 4DV7J 4JI7J 4DR7J 4JYAJ 4LF6J 5LMUJ 3IMQJ 4LF8J 4V1Ak 5BR8J 4GKJJ 4JI5J 4DV1J 4B3RJ 1HNXJ 4DR6J 5AJ3J 4DR5J 4DV2J 4B3MJ 1IBMJ 2MEWA 4JI0J 1J5EJ 4JV5J 1XMOJ 2UUAJ 4DV3J 4YY3J 4DR4J 1HNZJ 3J81U 2MQ8A 1N32J 4JI4J 3T1HJ 4NXNJ 5LMNJ 3J80U 4X66J 5A2QU 2KVQE 2UU9J 4DV6J 4NEYA 4DR3J 2UXDJ 2VQEJ 2HHHJ 5FLXU 4KYZA 4X65J 2ZM6J 4LF4J 4DR2J 1FJGJ 3R2CJ 4DV5J 2UXBJ 4JI8J 4JI1J 5IWAJ 2KL8A 4X62J 4DUYJ 1XMQJ 2E5LJ 2UUBJ 4NEZA 4DV4J 3T1YJ 1IBKJ 4B3SJ 4DR1J 1N36J 4OX9J 3J7AN 4YHHJ 4PWWA 4HHUA 2F4VJ 4X64J 1IBLJ 4LFBJ 1XNRJ 4LF5J 4DUZJ 1HNWJ 1N34J 4GKKJ 1XNQJ
chains in the Genus database with same CATH superfamily
2Y1LB 4JI5F 3S7RA 1U0SA 3TI0A 5HMYA 4PKDB 2BV3A 4NZ0A 2RDJA 3ILLA 3H40A 4DV0J 4OI3A 1RT2A 2KZZA 4OYOA 2AZ3A 4EFAC 1HNVB 3HHDA 2Q79A 1HWIA 4M5NA 2I9SA 5KOXA 3D28A 3ZNUA 1U1NA 2MKKA 3J81U 2OEMA 2Z30B 4B3SF 1N36F 3MEGA 3NAHA 3R6LB 4FBUA 2CQDA 2MDAA 4J9MA 3K7RA 2VFRA 3G6VA 4QIEA 4TQSA 2UXBJ 4PUOA 4DQSA 1S6QA 3T1YJ 3W2VA 4CLWA 3MEEA 3IM8A 3ENAA 2X51A 2LQJA 1NSQA 3M9NB 1FKPB 1CS4B 3PJWA 3EJMA 5I3QA 2DGUA 3LGMA 3FKBA 1VR6A 3W9HA 3OL8A 4KR0B 2YWHA 1IWAA 3KK1B 4EBEA 4H4OB 5G0RB 4ID8A 3KNGA 2EG2A 2XS2A 2LU1A 3T1AA 3HF5A 2HHTA 2XYHB 3R7BB 4OI1A 2J6UA 2YKNA 4WIQA 5C25B 1WHVA 3IGNA 3JQMA 5E41A 1F9HA 1D8ZA 2JVRA 4CLUA 3IG1A 2IJFA 3UN5A 2RHQB 3IXQA 4G1IA 2NS1B 3DYAA 1UZHA 3D1QA 5L46A 2QT7A 3HSGA 4QJVA 4O0NA 2Q1LA 1WI8A 1SKRA 5A8KB 5K8NA 1GTHA 1RCXB 3TA1A 1TKXA 2RD5C 3KMSA 4KKOB 3ZZ0A 2ZBRA 2J9CA 2O3DA 4KHMA 2WB1D 2XO6A 3M6WA 2OD6A 3E51A 4URSA 2E5IA 3M8YA 4TVAB 4NCBA 4ZDNA 4YB6A 1TVRB 1A7GE 2RS8A 2V2QA 3TQEA 4C4WA 4WFZA 1F3FA 2Z57B 3R7SB 1QSLA 1R27B 4Y34A 3KLHB 1MROA 2F4FA 3BN7A 1M5VC 2X1BA 2WSEC 5DM6Q 4PPDA 5K14A 4XO0A 2C3PA 1X4BA 2ZH8A 3KK2A 4P72A 1KTVA 3ZTOA 3VAHA 3EPIA 1T9UA 4NI2A 2VG6A 4ZLNA 3IRXB 1N5YA 1XR7A 1CC8A 1VISA 3I55S 1U09A 2MSTA 4DX7A 3DLEB 1OY9A 4B3TF 1OQ3A 3UNGC 3MXHP 3TO8A 3CC4S 1IQTA 3UVJA 2AWZA 2V8GA 3P49B 3K5PA 3RAMA 3MMJA 4EEYA 3WX4A 5KTQA 2G1HA 1RAHB 5B08A 2YKAA 3M8RA 4NRUA 3CB4A 3K2YA 2DISA 1RT5B 2LXFA 1VBKA 1FXRA 4OYZA 1RAOA 1K44A 3V6DA 3KLIA 3OVBA 3GIJA 1GMWD 2RH3A 4R0EA 1RTZA 4E2FB 1YTYA 2FVSA 1OPZA 3UDEA 5HQ8A 4DSKA 3HHEA 3MOJB 1VQ6S 3POTB 3C19A 1JIHA 2XYPB 2IA6A 3EYZA 2QE5A 3QIDA 1RACB 4KO0B 4NLQA 4LIWA 4A8YA 2R2RA 4OV1A 4ZMMA 3Q0AA 3NY0A 4Y2MA 3MCOA 4X64F 3UW1A 4TY8B 3N4WA 3CCVS 4DR3J 1JK9B 1JMTA 2OPSB 4KIAA 3EPGA 2BKPA 4CRJA 4JI1J 1J5OA 1FRLA 2XMVA 2WVCA 4ZVUB 1GT8A 1LW2A 1LFPA 2HK2A 5BYRA 2DBBA 4Y00A 4HACB 2BANB 3V81B 4HHUA 1PC5A 1FHTA 2ZBQA 3ZNJ1 2BJEA 4J90A 3WQPA 2DGQA 4NX9A 2MQPA 3W1YC 4LIRA 2F40A 4Q7AA 3VV2B 5KG0A 1AFIA 1S1UB 1HNVA 1UW4A 1Z2ZA 1WF2A 2VB6A 1VFJA 1J27A 3P3DA 3VAMA 3HP6A 3RW6A 3G8TA 4KJIA 3MM8B 1QE1B 4BLGA 2AJ1A 1C1BB 1BXNA 3HVRA 3BN4A 1SKSA 2QMWA 3W5ZA 2QX0A 2FJXA 2FJAB 1VQ7S 3UD5A 1KS2A 1TL7B 4ERDA 1KP6A 4OLOA 5I42B 2PC6A 1VHFA 1S77D 1H2UX 4TY9A 3ZTPA 2YNHB 1FKPA 1CS4A 4NLYA 3J80Y 3TAMB 4A47A 1XEZA 2VDIA 2YTCA 4DLGA 3RB6A 2BJ1A 4LF1A 1HLWA 4H4OA 5BR8F 5G0RA 2Y1RI 4QYZJ 3CMAS 3GE9A 3I32A 1N5VA 1PIEA 2XMMA 2BR0A 2CZVC 4MIAA 3Q8VA 4K0KJ 4P2MA 5C25A 2ZE2B 2QLFB 3SCLE 3NKYA 3M6VA 4KFBA 3WHIA 3JTNA 4DUTA 1IUJA 4JI7J 1Y5IB 3H5YA 2JL9A 3GSDA 2VUGA 1HNXJ 3E2EA 2N3OA 2HFZA 4B3MJ 4OI2A 2EVZA 3DDKA 2R7OA 1BD6A 3NG8A 3CVKA 3ADAC 4B3OA 5ETLA 4UT4A 1CLFA 5HJYA 5ETKA 5GADI 3JQJA 5LMNJ 4YFUA 4A46A 2YX7A 4KKOA 2NCKL 4GMKA 2OMLA 1FFGB 4X62J 2OIHA 4WCEQ 3UN2A 3X1LB 4X4QA 3RTVA 3K57A 2VQFF 2P9GA 2DRDA 3VGUA 3IR7B 3KK3A 4B02A 1HBMB 2R8GA 1HWLA 1XNRJ 3EDQB 1TVRA 2ZNZA 1NXIA 3ENVA 1AZSA 1EKSA 1VQKS 3KLHA 1EZZB 1H6KX 2V8DA 3GB0A 2V68A 4ZJQA 5E3RA 1UAWA 5E3QA 4LRFA 2W1BA 2P9EA 5KFOA 1OSCA 1JKHB 2FLPA 1B99A 4QBUA 4FXVA 1C0UB 1X4CA 5E3CA 4UY8T 2B5JB 4ZCMA 3UPFA 4IYQA 1U2RA 2Q66A 4CTAB 3HHLB 2Y1JA 3PKMA 3IRXA 3AOBA 2KH9A 1WOPA 1RK8A 2KKHA 4F04B 3DLEA 4BHQA 3I0SA 3T1HJ 1IVZA 3AXMA 5JUMA 4L75A 3BR9A 1IBLF 3FC9A 2IVFB 2UXDJ 3DXBA 3BQ2A 3BGFA 2NPFA 4EBCA 2HHVA 1KVIA 1TL3A 3OPKA 2VC0A 2M8DB 3HHLC 2B43A 1T9XA 5EHHA 4CM2A 4LFAF 1RT5A 1IR2A 3UDCA 4DX5A 4JYAF 2XMAA 4OZ1A 4F50A 4F4AA 4DL4A 3QGIA 5KT5A 1FDNA 1N5QA 2OSRA 1N6QB 1R0AA 2HHXA 4ECTA 3EE3A 4PXEA 3POTA 4FF1A 1X7VA 4DV7J 3T5LA 1RYRA 2QO3A 4USVA 3FNNA 2YX4A 4LSZB 2HNYA 4ILMA 2PN6A 3TARA 3CO0P 4ZLPA 4P7VA 2OO4A 4YB5A 3W2WB 1MG7A 5DG9A 3I4PA 2ZJRQ 1X4EA 2MGZB 1UETA 2BX6A 2OPSA 3QZ8A 2ACMA 1JLEB 5F8LA 2GMHA 5F8JA 2RQMA 3AFGA 4LVOP 2C3OA 1HNWF 2NREA 4P9SA 1WJ9A 4HACA 4B9MA 4V19X 3V81A 2MLZA 3DI6B 4NE9C 1GNKA 4WP8A 1FI4A 1ZOTA 3AJ2A 1NCLA 3DLGA 4EK2A 3PYEA 3G6XA 1UJ5A 4CLKA 3MM9A 3H4BA 3H5SA 2GMLA 3TOQA 1VRTA 2Q6CA 3MEDB 2JLFA 1NH7A 3AB2B 1T9YA 2GQ2A 1UWBB 4X4OA 4ECZA 1T8EA 3LGNA 2KVIA 3AXKA 4X84A 1PC4A 3KLVA 2D41A 3MM8A 4P7TA 3EGNA 2P8IA 4JV1A 4RL1A 1NPPA 1CJUB 3BREA 4WP9A 1C1BA 4YR0A 2HAFA 2HNDB 4KGXB 9ATCB 1O5JA 2LA4A 3TEHB 1RHMB 1X9MA 1TL7A 4CNYA 2AZ1A 2E5JA 4MIBA 4DZ6A 2HQIA 4E8UA 3G8SA 1FE0A 3R3TA 1U6BA 1R31A 1N4LA 4KHRA 2ZHBA 1U45A 3QT8A 1SC1B 2GCFA 3PHEA 3PR5B 3TAMA 2QMUB 3D66A 3NXZA 1U2CA 2LQBA 4LRAA 4PQUA 2CVIA 1HQEB 1SUQA 5FD1A 3DHWC 5FIIA 1YKWA 3KJQB 2WW8A 1LWEB 3CJTA 1HI0P 2MB0B 3I5AA 4F4YA 2MJNA 4LMZA 4K4VA 4FYVB 3MM5B 3M2UB 4DL3A 2HS0A 2MTLA 5J1EA 4A8WA 1H7XA 1L5UA 3JSBA 1J5EF 3NS7B 3H5XA 1JXEA 4MKYA 4JI3J 4UY85 1WWHA 9RUBA 2EFQA 1DTQA 4LF8J 2XNRA 2HVZA 2FVCA 3HVTB 1FESA 1NSAA 5A76A 3ZZRA 3EGZA 1VDHA 3MMCB 3F41A 4OFZA 4Z2XA 4RW9B 2QLXA 2YPYA 1FK9B 3D67A 2HVIA 1XJWB 4L73A 2NSBA 5KFXA 4BWMA 5AXMA 4ZVGA 1F5AA 3RBXA 4J9SA 3C3LA 2ZM6J 1HBMA 3GTYX 5IWAJ 4MKBA 4HH0A 4F4WA 2KRRA 1RHQB 2J0XA 3PCOB 2CQGA 3BF4A 2FJBB 4X4UA 5M2RA 3DLKB 2EWHA 2JNJA 4ECXA 4PPZA 2ZBCA 1JKHA 2DHHA 3TZZA 2DPJA 1C0UA 3NMRA 2GAGC 3BGRB 3O6QA 4CTAA 3HHLA 1S7HA 1PJ5A 3D0GE 3DN9A 3AQPA 3DC2A 3HKZD 3DOKA 2NQPA 1C1CB 2HGLA 1HBUB 1IKWB 2P2CB 4JI0J 4YDXA 3MR2A 2OPRB 1QUVA 5KG7A 2AGPA 2OTLS 7FDRA 3Q23A 3MR5A 2E5LF 1CJVB 1BQMB 2FIUA 1SC3B 3G82B 4DR1F 5IZHA 1OQ6A 2DT9A 2A6OA 2DH7A 3K8VA 4LF5F 1C4AA 3C6TB 1HD1A 3ETOA 3ELHA 4UF4A 5JVGQ 2QL9B 1OS5A 1CULA 2VHGA 1WTFA 1NJYA 4OZNA 1Y0HA 4OX9J 4PWDB 4C8ZA 1N6QA 1ZM3A 1U1LA 3NGRA 5HVFA 2MMYA 4GVLA 4GC7A 4W98A 2Z2MA 3IWNC 4RU9A 4OLPA 1VQMS 3QAUA 4FNHA 3Q24A 4H54A 1VBXA 3W2WA 5ETMA 2FC9A 2VBZA 1AXQA 5C42B 1ZTTA 4KGZB 1Q79A 4CO1A 1S9GB 2U1AA 2Q43A 3GLJA 2OGUA 5F9LA 3PEHA 4A8FA 3WX8A 4NZ6A 3A8KA 2Y8WA 1M1KT 1R8AA 3VR1A 1KKHA 4M5JA 2K1RA 3EGWB 1R0BG 5JXSA 4FYWB 3HHKA 4K4ZA 2H1YA 3G4SS 3B6BA 3B4MA 3Q83A 1UVJA 2GVZB 4J9PA 2C2RA 2AX1A 3MM6B 2JLGA 1TELA 2KXFA 2CG4A 1UWBA 1OY8A 2BW2A 5BJRA 1FTRA 4NLUA 3P8BB 2HNZA 5J1NA 2HIYA 3ZO7A 1RT1A 5EWEA 1N34J 2NXEA 2XULA 4FF4A 4KAIA 2ZZMA 3IS9B 4KY3A 4DR5F 3I6PA 2Y3YA 1BMQB 2HNDA 3C14B 5L1JA 2NYIA 3QRRA 3TANA 1FVQA 1CJTB 2VL1A 5DETA 5DLFA 3FSIA 1KVJA 4DV6F 3TAPA 5KFMA 5KFBA 2JH3A 3M8QA 2GVDA 2NR0A 2BW7A 4DL0C 2WHOA 2KXHA 1BGXT 4WFYA 3J7YU 1J2VA 4NXNF 3A12A 4XPCA 3I5BA 2DRBA 4QWBA 3T6JA 2O66A 1HQEA 3OXGA 2EKNA 3DRPB 3OFFA 4QZVB 3KJVA 2V9WA 1LWEA 5AT1B 4I56A 4OHWA 5LL6d 1NJZA 3UNYA 1NNDA 3FBFA 5F8HA 3UCGA 2B9WA 3X3UA 3MM5A 3M2UA 4C11B 4ZVPB 4LFBJ 3M2VB 1WEYA 4EBDA 2OD4A 4AL7A 3H5UA 2AX0A 3BO2A 4CP5A 1S59A 1LW0B 2QA2A 4ZS6A 1M1HA 1IJEB 4DG1B 2EKYA 3BEGB 4JUZA 4ZA1A 4CH7A 3P5BP 3ZZOA 3K59A 3MTKA 1FJCA 5J1PA 2VIHA 2OFGX 2HIQA 5JVHQ 2QGFB 4J37A 3OLBA 1N0VC 2V2VA 2ZD1A 4GKJJ 3MMCA 2J0SD 4RNOA 4DFKA 1HWKA 2YX1A 4RW9A 5IS2A 4DR4J 3KYLA 1KLMB 2BEFA 4OI4A 1WHXA 2R2TA 3VCDA 3HSDA 4GC6A 1T02A 2LEPA 5F9NA 4NEYA 5KFFA 2DIVA 5H9EK 2VQEJ 2IM3A 2EXUA 2BA9A 1HIYA 3PIOQ 3DLKA 3DXSX 2I1RA 4TN2A 1KTQA 3CNQP 1WC5A 1H7WA 4CM0A 5K5MA 3DRYA 4FN5A 2FHJD 3BGRA 3B54A 5C24B 4CI0B 1G7CB 4OJGA 1ZPWX 1SKUB 3OTOJ 2JDJA 1X5OA 1RLDA 2Z2ZA 4W90B 3TX8A 1C1CA 5B0CA 5G4DA 1HBUA 1IKWA 4LF9F 1RHJB 2WOMB 2OPRA 2V8VA 2B9XA 2LVWA 1SV5A 3E3XA 3IR5B 3PEJA 3FRZA 1CJKB 5CCLA 1M5PC 4C3MA 4DR6J 4IRKA 2PI4A 4W92B 4CT9A 3VAGA 1MMDA 3CCZA 4QWAA 2MXYA 4ZK7M 4ECYA 4JI8F 2VA2A 4WXOA 3C6TA 4DWIA 4AUKA 2DXFA 2G2OA 3ZZTA 3PO5A 3R6GB 4HDHA 3HM9A 3JYTA 1Y4ZB 3IAS9 2X3GA 4MT1A 1WKLA 3NOGA 1V9OA 4O3OA 3VHQA 3WIVA 4ZCLA 1DY3A 1BWEA 3MUVP 1OSDA 2D74B 1GMWA 5ETRA 3AAWB 1VIXA 3HFZB 2GHWA 3PR4A 2AF6A 1X8DA 3H8YA 2MHNA 4NPOA 3P45B 4J9LA 1F6TA 2BJ7A 5DRKA 1RTHB 5C42A 1FFWB 3IWXA 5KG2A 4IRDA 4ENOA 1S9GA 2YWEA 1DTTB 3MPWA 3VAKA 2XI3A 2C2EA 3KG0A 2UUCJ 1BE4A 1YIJS 4J9VA 3DDIA 3VAJA 1N52B 3M6XA 4AE5A 5CD4H 4K2XA 3LALA 5KFZA 1SH3A 4YB1P 3MURP 5I4MA 4X65F 1IN0A 4TLQA 2U2FA 3H59A 3K0JA 1OYDA 2O1PA 2H48B 2KRBA 2J76E 3O1LA 1KQKA 2XY5A 2GVZA 4XDDA 1Q5VA 1TK8A 3P5TL 4YHHF 2CQ4A 3GONA 2LDYA 4RZRA 3IRWP 4ALZA 2YNIA 3GFXA 2B4OA 2WVFA 3K58A 2QA4G 2GIQA 3FFIB 4OYAA 5L1KA 1YJVA 4QWCA 2FZKB 5KFJA 1XC9A 1JLBB 3EGVA 3BS9A 3MDFA 3OHAA 1TZ0A 5C7PA 3CMQA 1WD6A 4H4KC 1YZ7A 3SYZA 4ELVA 1CJTA 2DGSA 2MQLA 5KFIA 5AE2A 3H2VE 4NZ7A 1ZM2A 2DR6A 5LOQA 2QA1A 4F3QA 3W8PA 2AGOA 2ILZA 3UD4P 8AT1B 2IM2A 3CJ3A 3M30B 4IG0B 5CQGA 2ASJA 2M7SA 3KLFA 2R7UA 3OVAA 1MWYA 2A6MA 3DRPA 1RLCL 2ZOGA 4ICLB 3C46A 2K3KA 5EWFA 5IT9Y 5A2QU 1TKZA 4QYZK 2DCLA 3GV7B 1VQ5S 3QT5A 5DQHA 3OBIA 2APOA 4C11A 4TXSA 2W9CB 4WFBQ 3LTOA 1YLXA 3KHLA 3NOCA 4NLTA 2RAQA 4F25A 4PG5A 3C2PA 3OLAA 1VC5A 1VJWA 3NGDA 1DQ9A 4F4KA 2QYCA 4DG1A 3PV8A 2V0NA 1UZDA 4OZLA 1DQAA 1S1WA 2BACA 4P2SA 1DZ5A 1UFKA 4OYWA 4Q0BB 1S72S 3QIPA 1X60A 2HZAA 1NAQA 1G1XA 2XGQA 1V3SA 1P9YA 3A8JA 4PZVA 5MLCV 2IAJB 5KFRA 4NRTA 2C28A 4B3RJ 1HKAA 3EVOA 3RAQA 1HW9A 1HPZB 3GU0A 2YKOA 1VC6A 3CJKB 5AXKA 1SXLA 2HBRB 2R8KA 1FDBA 2J7UA 4DFJA 3N6MA 1WDTA 2BJDA 2X1AA 3LP2B 4YS2A 4CO3A 3IAM9 1U1QA 2MKYA 2ALZA 2YWFA 5E3AA 3DRRA 4CDIA 2F4VF 2YNFB 5HI7A 5KT7A 4QIWD 5L1LA 1S76D 2WOMA 2HLUA 4WTYA 2CPJA 1IBMF 1I94F 5A6PA 1CJKA 1N33J 1HR0F 1BUXA 3KDOA 5HP1B 1ZBTA 1S79A 1XMBA 5DDRC 1WG1A 4M8LA 4JI4F 2ATLA 3RYLA 5ADZA 3N5FA 4J5OA 2AD9A 2DGWA 1GK8A 4NL5A 2OP5A 4I7FA 4ED7A 2JHEA 4ED8A 2N4CA 4Y3CA 3LWLA 3BKUA 2XY7A 3ICLA 3OFGA 3A1YG 1FKAF 4IDKB 4PYAA 4NXNJ 2ZBPA 3TVZA 5E5NA 2GNKA 1VQ4S 2DNRA 1EP4A 3VGTA 5IC4B 4ELTA 4RUAA 3P96A 1TR0A 1UA0A 1JB0C 3B4DA 1YBAA 3NBPA 2ASYA 2E9RX 2JZ5A 1XBWA 4N41A 4HT7A 2DJWA 1RTHA 1G3OA 4IO9Q 4RO0A 4DSIA 5DDPC 4ZP9A 4ZVQB 1H72C 2CQ2A 3GJTB 4URGA 3RBZA 4ECSA 1DTTA 4BC7A 1RB0A 2HS4A 2VJVA 2MZSA 2V94A 5CABA 3RRKA 2ALYB 2DXDA 4L74A 5IM0B 2XMTA 4G1QA 4IR1A 2POKA 1N88A 2MYFA 3J7A1 3NGKA 1NJIT 5GMDA 2XO7A 2JRSA 2JJ4D 2PMZD 2DY9A 2KB2A 3MMBB 3H42A 1S0MA 1K9MT 3G6ES 4ZHRB 2EI5A 1NDKA 3MMAA 5HQMA 2AEFA 3KJFB 3FFIA 4X66J 3FCVA 5ETOA 1SL1A 4DQQA 3RGIA 1JLBA 3HHNB 3T6BA 1LFWA 2QL7B 3JQKA 2Y8YA 4LREA 1XIQA 3PACA 4F0KA 2IDLA 4G1PA 4JV2A 4WE1B 2A10A 4NOHA 2UUBJ 4QU7A 3V6KA 1S6PB 1PYTA 4PYDA 1JJCB 4D3GA 3DU5A 2XLIA 4EMDA 2D3ZA 3BKTA 1N0UA 3VAFA 5SUHA 5KFHA 1MWZA 1ZAVA 4PEOA 3GV8B 1OO0B 1O8BA 2RU9A 3RJMB 5KFNA 4UUWA 5ETPA 2RJZA 3OQ2A 1F5BA 2HGNA 5KFUA 1B3TA 5A8WB 4LF9J 2VOOA 4QIGA 2FY8A 3DRXA 1B0PA 2H5EA 2FGOA 2V2ZA 3LP0B 3KWMA 5BXIA 4O3SA 3CC7S 3RZAA 1OIAA 2G0CA 4MTPA 5ETQA 1PBUA 2E66A 2KHCA 4F2SA 2HHWA 4UOFA 1KQFB 4NCAA 4MAKA 5KG6A 1U1MA 1O6XA 5F0WA 3T9NA 4DL6A 2MZQA 1W7WA 1L3KA 4KYZA 4OZ0A 3CIMA 1WSRA 2BZ2A 1L3UA 1KSPA 1H73A 2V9KA 1NHUA 3UFCX 4FBTA 4GO5X 1ZAWA 4DV0F 3BSCA 3NGUA 1K0TA 3D6MB 2GFFA 2VV5A 1TU0B 4D3HA 4ED3A 3OL9A 4ANDA 2LKZA 2CPEA 2WRMA 1IKXA 4RW4A 5CZVA 2XB2D 4LFCJ 2B4PA 4QWEA 4KHPJ 1SBRA 4EI2A 2N82B 4QW8A 2V5HG 4FKXA 5FLXY 4NA2A 4ZP7A 4YN3B 2OAUA 3MCSA 1DLOB 1H98A 3DDNA 3UDVA 4DX8H 2E1MC 4DN0A 1C2PA 4H4MB 3C6UB 1P9QC 4FXDA 3TW0A 2QEXS 1Q16B 3MECB 1S1TB 2CJBA 2YKQA 2LEBA 4ED5A 2UXBF 3VWSA 2BBEA 1X0FA 1S6UA 1RWUA 2N7YA 3T1YF 2KG1A 3CCJS 4M1KA 1CEZA 1S0OA 1TL1B 4ES3A 5HMXA 3THTA 2DH8A 2BVZA 3GCWP 3J81j 2HBZB 3QSIA 3RG6A 1RWMB 1RAAB 2RRBA 1DARA 1CQNA 2FC8A 3EDRB 2AJFE 1NO8A 2BQRA 1X5SA 2V8HA 1ROFA 1Y3KA 2L3MA 2C22A 1HBOB 4PRFA 2W01A 3BGUA 1PGZA 3AA8A 1F2HA 3RR8A 4LQ9A 3GYNA 2M8HA 4LT6A 3IMQJ 2XSFA 4DLEA 5LSRA 3FSXA 4M5DB 4TLRA 3B78A 3JTPA 1NU4A 3M9OB 4IDKA 2N3LA 3BBFA 1VQOS 2WAQD 1NHKL 1QLNA 5A8RB 3DMJB 3M8PB 4QPXA 1Z4UA 3VZHA 4WP3A 2IPOB 3OUYB 1FRIA 4F3MA 4B9VA 3OSNA 2ZH1A 2UU9J 2G0IA 4B9UA 2P6TA 1AB8A 4FVCA 3MM7B 2LCWA 4MH8A 3MPDA 3AOAA 5I3PA 3CDWA 1JLFA 5K8OA 5LXRA 1ZZNA 2QSWA 4DSLA 3GFZA 3PRBA 1REVB 5IM0A 1IXKA 4J9RA 4AL6A 4FZVA 1D0EA 5CYJA 1BWVA 3BPSP 5B09A 4ZCIA 4RPFA 2FHOB 5HMWA 1GFWB 2K3IA 4MYUA 3MUTP 3ITHA 4TNOA 3MMBA 3AD9C 2IC3A 4WZMA 4C48A 4EO8A 1RWVB 1WDDA 4ES2A 3IBFB 4BC9A 4FVMA 1P8GA 4CIOA 1FA0A 4WZQA 4F8RA 1M5OC 3PG9A 2GIFA 2CQPA 4C8YA 4U96A 2MZRA 3T9ZA 2CIMA 5GAHI 4ZOSA 2H3EB 2DGXA 1S99A 6AT1B 1S6PA 2G2YA 3N9UC 2E9ZA 2JEFA 1ACMB 1HHTP 2ADCA 4OYIA 4PXCA 3TNVA 3I0RB 4Y2KA 2BQUA 3SIPB 1U6FA 4BS2A 2RMLA 1RBOB 4N76A 3F44A 2K8GA 2ZITA 1FO1A 2F4VJ 3CCES 2JC0A 1B64A 1B0TA 3V4MA 4ZCKA 2J7WA 4DL7A 2OMOA 4AQYJ 2M3DA 1EQ0A 3MGJA 2ERRA 3LP0A 1I94J 1GXTA 1HR0J 2NPIA 5THWA 1KN6A 4P10A 2PA8D 1RT6B 5DQGA 4O44B 4K4YA 2IM0A 3MI7X 2OPPA 3NRBA 4DR3F 3D54A 2Z8QA 1UCNA 1F2GA 2C2ZB 3R7NB 1VRQC 4Y2CA 1Q4RA 2EFNA 4N47A 5AXLA 1XMOJ 3KUEA 1NK5A 4JI1F 4N5SA 2CPHA 1HHSA 1N32J 1HMVA 1LEOA 2HBYB 1WOOA 1QAJA 3C16B 4Z37A 1P27B 5B0EA 4JBCA 3SEOA 4Y2AA 3KHGA 2IMOA 2HKEA 2BE2B 4ZVTB 3J7Z5 3MCNA 3FZ2A 4ZPCA 1YSJA 2H5JB 4GVBB 4BCAA 2VG7B 4HI1A 3BJYA 2JOQA 3IBWA 5F8NA 1JLQB 2R7SA 1DLOA 1QM9A 1UVIA 5KG1A 4HEA9 4JI6F 5SZTA 1Q8IA 4H4MA 3C6UA 4OZJA 2ZUAA 1LOUA 2QLJB 3MECA 1S1TA 4RW6B 1I3OB 3PYGA 2CDQA 3RB4A 4CLYA 1FRKA 3FEZA 2KZMA 3M2RB 3SQGB 2YVSA 3UO0A 4GRSA 1TL1A 5AE1A 1NHVA 3CJRA 2NXCA 1JLGA 3L4BC 5IXUA 3KLGB 2KFNA 3JSYA 4ZVEA 1U4BA 2OLWA 1CC7A 4KGMA 1T03A 1KBRA 2FHJA 2DNQA 2ROPA 2Y0SD 2GQQA 3Q22A 4J9OA 1Q81T 3FDSA 1SVDA 4DV5J 1XN9A 2H54B 3CD0A 4K0KF 5EN1A 5A2QY 2R7TA 1E6YB 4Z7CA 4HH1A 3ZTRA 2EK1A 4JI7F 2QIFA 5GAGI 1S1VB 3A3OB 5CZXA 5CA5A 1WEXA 4HVZA 6FDRA 3OL7A 1HNXF 1W25A 3OR2B 1JQGA 4B3MF 4JB8B 2AJQA 4USWA 4M5DA 2W9BA 2CG8A 3LAMA 5E2QA 1VS3A 3CJ2A 3ZZUA 3LP1B 2UXCJ 2DR9A 5A8RA 3DMJA 4LF6J 4ZP6A 5LMNF 3PW4A 1SPBP 1PSDA 5HANA 1S4FA 1BQNB 2DTJA 4QR2A 4DOZA 4Q44A 1T05B 4PG8A 1GX6A 1WHWA 4K4UA 3BSAA 2YNGB 4X62F 4PG4A 4ILRA 1CVJA 4RUBA 4RW7A 5J2MB 1PG5B 2WTFA 3MM7A 1GEHA 8RUCA 2RVJA 4NYOA 1T3OA 3R5JB 4C3LA 3TYTA 3VGVA 2CYYA 1XNRF 1TUWA 5L9XA 3D5MA 3QAEA 1UVNA 1JXLA 4WJBA 5GADU 2DNMA 3BV8A 4LF4J 1FJGJ 1REVA 2C1EB 1UEUA 3D9BA 1RTJA 1RDRA 2E44A 3GFHA 1M5HA 3FEXB 3DKDA 1U7LA 2KYXA 4DL5A 3EVMA 2VF3A 2W2PP 2BQ3A 4RR5A 3HFVA 2GGPB 4ITSA 4LR7A 2R2UA 2WSCC 3AHPA 2AKWB 1RT4A 3T5HA 2FTRA 5B0GA 4ZPDA 3IFEA 3CCQS 2J8AA 3GIKA 2VC1A 5CYMB 5E7OB 2HURA 1NZ8A 2D9OA 1O0PA 4IOCQ 2Y1IA 2XNQA 2IRUA 3T1HF 5CHCB 5EGYA 3OTDA 1LK7A 2UXDF 3F0NA 3CF5Q 2CKWA 2IY5B 1HNIB 3OTBA 1TK5A 2WK4A 5HJXA 2M70A 4RU2A 3OXLA 3UQSA 1TTHB 3MEKA 3I0RA 3QSYB 2ROGA 1FERA 5DG7A 3MAAB 3QWUA 4DDFA 4U67Q 1Y3JA 3LO3A 1U6ZA 4CH0S 2JFDA 2WCXA 4DV7F 2FY1A 2ZC3A 2X1GA 2XSJB 4WF9Q 1P1TA 2D7SA 4O44A 2AP6A 1TFYA 2ZH7A 4FDFA 2A1BA 2ZJPQ 1P1LA 3UWTA 2DCUB 2DRAA 1OMSA 1T7PA 2R4FA 2EFOA 3K17A 3PFEA 3DLHA 2AJ0A 2MQQA 1R0CB 2B8PA 3C16A 3NWRA 1RE1B 3N0VA 3TJ9A 2AQ4A 4P73A 4AD6A 1D9AA 2B6AB 1VRUB 2LQ5A 2BE2A 1YI2S 3O2IA 4YP3A 4ECVA 2VONA 3FGVA 4ILLA 3AB4B 2UP1A 3NCRA 3SBMA 4ATNA 4ANEA 3D2WA 1WF0A 2R9LA 4I6WA 5H9EJ 2VG7A 3TUPA 1KHWA 3I82A 1L3SA 2PT0A 1HWJA 1SIWB 4UOGA 2EC0A 1JLQA 2C3UA 4DV4J 2VPZB 5CYQB 1T94A 2VG5A 2FUG9 2EFGA 2PGCA 3PW5A 1TUVA 3AD8C 4DF4A 3FQKA 3FK4A 4ER8A 2W25A 2C3YA 3TVKA 2HPUA 3D0HE 5ETSA 4CLPA 3M2RA 4ID5B 2K2PA 4AXIA 1PYSB 1FEEA 4F2RA 1NUEA 4MYTA 3V6JA 3DOMB 2E1AA 3KLGA 4ZJLA 4RNNA 1VJQA 4FS2A 3BO3A 3RRHA 3QPIA 4CNZA 1H0HB 1RAEB 2UV8G 1LWCA 3RB0A 2KN4A 5DGBA 4WWSA 3GIIA 1QY7A 2HMIB 1RT3B 4MK8A 2F65A 2KL8A 4KQZA 1IKYB 1RAJA 2DNNA 1PYOB 1WNEA 4JI3F 3SCJE 5GMKa 3PFOA 5A6WA 4LF8F 2M0GB 3EX7B 1FRHA 2FZCB 3ZZPA 1VBYA 4RBTA 1LWFB 4QQBA 3T41A 3KLEB 4TQRA 4ECQA 4RJVA 1BQNA 4Y28C 3OVSA 2XS7A 3CPWR 1T05A 2YNGA 2B3TB 1E6VA 3TA2A 3D0IE 3A3PB 4OHXA 2G0JA 1SI9A 2HVEA 1UL3A 2GS8A 3EXYA 2ZM6F 2GC8A 5IWAF 4YR3A 1HNZJ 1D9FA 1LXJA 2CPYA 2W7PA 2JEIA 2LQ8A 5JMNA 4ZLLA 5DG8A 3ETMA 2V4RA 4B9LA 5T7LB 3U1LA 3IBCB 3PJ9A 2FLOA 3K5NA 4I2QB 1FF2A 3QJLA 4WIIA 5D15A 3QJJA 4M94A 5J2NB 5CYMA 1XNQJ 4ECRA 4UZCA 4NMLA 2HFUA 2ZJQQ 3ISND 2V50A 3ILIA 3UN3A 1PKUA 2CNNB 4JI0F 2CNKB 4JI6J 3KG4A 2QG9B 4Q45A 5K20B 2XZTB 1XR6A 5D0RA 3DM2B 1S49A 2HQCA 2B9EA 5LSOA 1LWXA 2IIHA 2RKIB 4DF8A 5IV3A 1S12A 2NUUG 2RQ4A 1Y7PA 4L3NA 2MSSA 3IR6B 3EZ5A 1ZAXA 2ZH5A 3DOLB 2W2QP 1FDAA 2DNGA 2CPIA 3MAAA 3GG1A 4OX9F 8ATCB 1FD8A 1TL5A 3M7VA 3FCHA 2ZNYA 4K8RA 1HA1A 3Q8QB 2YKPA 1DURA 3KK1A 3LOUA 3CSKA 5KAKA 3CJ8A 3D6FB 1ZA1B 4DR2J 3C66A 4M5MA 2IBOA 3M8ZA 1EJ7L 3OXFA 4PXBA 1IBKJ 2CAJA 3RR7A 4KPCA 1KNZA 3CO9A 5DQIA 2MZTA 5D4PA 3S8SA 3OFEA 4UOHA 1IWGA 4F7VA 3WC2A 4X4NA 4JP8A 3TX0A 2B9YA 2DO0A 2HQGA 5KFWA 2WVBA 2OTJS 2XTJP 1YBTA 1WACA 1PJ6A 2QA4S 5A8KA 3W65A 3KDNA 3LGHA 1VRUA 4DV1J 1BY9A 1RAIB 2HGMA 1C0TB 3HXMA 4WXWA 3QQCD 2DGTA 1RWOB 4ZN3A 2ZVSA 3QRQA 3AJDA 4RW8B 5ITHA 3CXCR 2RRNA 4FPIA 1FD2A 2HHHJ 1N34F 5D0EA 4USIA 2CQ1A 1PAUB 2AYGA 4OYMA 5HK4A 1TUGB 3FBEA 3W66A 4A8KA 2WW4A 4QOTA 2D3OR 4U8YA 2PEHA 4LBHA 2E7WA 4CWBA 4PR6A 3H7HB 1FX2A 3PJXA 1N48A 1QJHA 3LAKA 2V4JB 3DOMA 2HEKA 1Q7YT 2VODA 4XDCA 1YJUA 3QLHB 4LF7J 5DO2A 1UVMA 3TUJC 5D6GA 4V1Ak 4F4ZA 2MY8A 4Q2MA 1Q8BA 1NKBA 1KHVA 5DLGA 3CCWA 4NASA 4IOAQ 5C5JA 4OJ1A 1GXUA 3Q8SB 3RUBL 4N56A 1DBDA 1VK8A 2G9OA 4RBVA 2HMIA 1RA6A 2XMKA 3G87A 1IKYA 3OL6A 2XGPA 4LFBF 1FNXH 1QAXA 3CDBA 1WC1A 4MK7A 1RT2B 3UI3A 3O3LA 2IJRA 3OSPA 3TR5A 3AH6A 1QUPA 3GPAA 4ZP8A 3MFHA 1F1BB 4ZVFA 3KLEA 4I6YA 2XMJA 4GKJF 3VTIA 3PO4A 1MW7A 1KOHA 2A2DA 3NP5A 5I3UB 4KO0A 5IT9U 4NXMJ 2PEBA 1SJ3P 3AY0A 2HRTA 4DR4F 3HVAA 4Q5VA 4TY8A 1AYEA 4J9NA 4B17A 2I38A 3I5CA 4DR7J 2CADA 5H1SV 4EZ9A 4PUOB 2GO9A 1S6QB 2XBPA 4ZIVA 3KTQA 3MEEB 3QYYA 5AJ3J 3HULA 2VQEF 4RNFA 2C2MB 4MK9A 1SCJB 1RABB 1NK6A 5LXYA 2UUAJ 3QWPA 3HD2A 4G65A 2M52A 2BANA 3UR3C 3HFKA 2ZH4A 1V5VA 3QGPA 5T7LA 1T3NA 5HBMB 4N7TA 2ZKTA 3CDAA 2VJUA 2IRXA 3UR0A 1YJNS 5J2NA 1S1UA 3OTOF 2GX8A 1T0TV 4DUYJ 4AYBD 3CTRA 3QJPA 2CJKA 1QE1A 3P6YC 2FGCA 4UQGA 4HR2A 3EICA 5T14A 4DSEA 3DM2A 1FWPA 2E5HA 2Y9HA 4DR6F 2W4PA 3BDPA 1KONA 1UEKA 3SDEB 4DSFA 3CJ0A 3PW2A 2M5YA 2ZHAA 5DZ6A 1HWUA 4A8SA 4NLVA 5I42A 1TKXB 2GIRA 1UTAA 2PE8A 2J0QD 3DOLA 4USHA 2YNHA 2C2OB 2K7KA 3K5MA 3SSRA 2NYHA 3RB3A 3FMBA 1ZYQA 3CGIA 2DK2A 1GMUA 1RWKB 2H51B 3L7OA 1RP5A 2P6SA 4C8NA 3G71S 4O0IA 2ZE2A 1EB0A 4WFNQ 1MROB 3AD7C 2R8IA 1JNZB 1HQ2A 1IR0A 5K14B 5HQLA 3O8WA 2GA7A 2VH7A 3TWZA 1FVSA 1D09B 3FBBA 4EUVA 2FYXA 5C2GA 2UUCF 1Q53A 3KK2B 2ILYA 1U26A 1FKOB 4NI2B 4I69A 3TJ8A 2G1DA 3SMZA 1N5YB 4NLGA 2OEJA 1TMJA 2DNYA 4PG6A 1B70B 1GH8A 2EBEA 1C0TA 1S5ZA 5AXNA 2HRUA 3THVA 3UVJB 2ATCB 5HL7Q 2UUTA 1NK4A 4DV2J 3BR8A 4E0DA 4RW8A 4OJHA 4IFYB 4YY3J 4WK3A 4DS5A 2DHGA 1EHWA 3UE2A 2KG0A 5IT4A 3O5TB 3VALA 2RILA 2W2MP 1MN9A 3V6DB 2CPZA 2MQMA 2PI5A 1X5PA 3GR1A 2FB0A 4RBUA 3Q8UA 4USTA 2QFIA 1VK3A 2XWYA 1F60B 2JVOA 3AA9A 1S57A 1KEKA 3BB5A 4USUA 3TVYA 2B5JA 1AFJA 2V4JA 4FYXB 4NCGB 4PWWA 5F8GA 3PXGa 4ANCA 4TYAA 1HHQA 3QLHA 2K7JA 4C9DA 4C8LA 1RKJA 5ETTA 2OI2A 3D4JA 4ZPAA 2CQ3A 1HBNB 1MNEA 4TYBA 1KFDA 1KD1T 4NMXA 1TMMA 4DFMA 5KOWA 1LW2B 5LMUJ 3QGGA 4F0HA 3W63A 3R5DA 5LJ5Y 1VMBA 1RCOB 2DGVA 2F8EX 1NJWA 2HWHA 4MJKA 4XK8C 2J9DA 5F41A 2MKSA 4DV3J 4AT1B 1I1GA 3FRYA 2VBXA 5F3TA 3RAXA 1RU2A 1T9TA 4FNIA 2C42A 5D8HB 2M2BA 1X9WA 2F8MA 5HVHA 2IYGA 5GMEA 1R3NA 1RWPB 1VQ8S 4LUBA 1RT7B 4ZITA 1UJ4A 3R2CJ 4HTJA 2F8HA 2FVPA 2CXEA 1ZPVA 4RWWA 1DJ0A 5I3UA 3CCLS 2ZH2A 4J9UE 4RUCA 3HZEA 2MGZA 4B3RF 1URNA 3D7SB 1SH0A 4NYZA 2XY6A 1S0NA 1JLEA 1GXLA 1ZS6A 4NLXA 3GSIA 4O3NA 3FSYA 2FJEB 2JC1A 4JI2J 3KHRA 2DNPA 2NXJA 3HJFA 2B4VA 3RU0A 4UOCA 3HCXA 2Y0BB 3DI6A 5D0GA 1YITS 3BO4A 5JJBA 1Y00A 4K5SA 4WK1A 5HBMA 2MEWA 2WBRA 3BM7A 2CPFA 1T9WA 3W62A 4XAKA 2XM3A 1U1OA 4HDGA 3MEDA 3OW2R 1YRUA 1SB6A 1YX2A 5HAOA 4QR1A 4KV8B 3AODA 3GYGA 5GAEI 1IKVB 1Q1KA 4KFBB 2KT2A 5FLXU 1R8BA 2Z58B 3MZIA 1RBLA 1CJUA 2DYAA 4OMFG 4U7UD 4KSEB 1N33F 2V67A 3SDEA 3SSQA 4B3OB 4FF2A 2QV6A 1OYEA 3FBCA 2IMWP 5KG4A 3HSZA 2OEKA 1AUSL 2EPIA 3EXCX 1UA1A 2MQOA 2VKZG 1R43A 4FP9A 5KFTA 4ZIWA 1MSWD 1FX4A 1A6LA 5RUBA 2FQQB 1WKJA 1D9DA 2B4UA 4C0OC 4Q8FA 1GQEA 4TKTA 5IC6B 3PNIA 2X3DA 2LDIA 3ISNC 4YEAA 3GIMA 2I8EA 3KK3B 1K47A 1NB2A 3CD6S 1Q8KA 4KPYA 3DGVA 1VQPS 1HW8A 1AZSB 2XQCA 1FEHA 2KM8B 2MLYA 5E0OA 1SQFA 2PMHA 3M9MB 4XIUA 4P2XA 1UVLA 4UZBA 1GTEA 4ZKAA 1IBCB 1RTIB 4DFPA 1FKOA 4DZDA 2R7RA 4KRWA 2GJFA 4YDDB 4OYXA 4LSNB 4U8VA 1RGVA 3HVTA 2KM8C 3NS5A 2KTQA 1YJRA 2W7AA 4CYUB 2LP4A 3I0SB 3R2DJ 4N77A 2G4BA 4OX7A 5HN0A 1DRZA 1Y5NB 3GJQB 2ZDOA 4C3KA 3V2UC 2CZ4A 1FK9A 1U25A 2HFVA 1TL3B 4DPOA 3HDSA 2HFOA 2A18A 4IFYA 4DSJA 4X66F 5B0AA 1FRJA 1U47A 4J7CA 1F5CA 2H65B 2NXNA 3PW7A 2HHQA 2MZ1A 2UUBF 4HHJA 3ZZZA 2FHKA 1XTZA 3ET6B 3OTCA 3D6TB 4AXJA 2KO1A 1R0AB 2VFTA 4MFBB 4OZ2A 4QR0A 5HROB 4HLBA 4NCGA 4B9SA 5IQ6A 1FRMA 2LEAA 2HNYB 1VQLS 1WI6A 3R97A 1BQXA 3IA0A 5EX0A 5KFDA 4LR8A 3R9LA 2LMIA 1Y11A 1HBNA 2VKRA 4DUZJ 2VA3A 4GKKJ 3TUZC 2G13A 5LT5A 4M5LA 3L7PA 1QDUB 4KGVB 1Q86T 1CJVA 1BQMA 3UD3P 3K5LA 1KLNA 3KFWX 4C97A 3G82A 4A4JA 1MU2B 2ZVIA 2FLNA 4K4SA 1U02A 5HATA 3CULA 3CD7A 5K8MA 2L41A 2EFVA 1KR4A 4K59A 3DLGB 4RX6A 3MM9B 1XERA 1JXVA 1VRTB 4MKAA 3PM9A 4ZPWR 4IFVB 4RLEA 4PWDA 3VF0B 2CJQA 1Z2LA 1RT7A 2RUSA 1NEEA 4K5RA 3Q2SC 2J0WA 4U6PA 5L9NA 4KT0C 3GP9A 4DS4A 1UVKA 5KFKA 1SJ1A 2DNZA 4EYIB 3NGTA 2E7XA 5FDLB 2VFVA 3TZWA 1YGYA 4OIXA 1XMQJ 4Z7YA 4LFCF 2KYZA 4KHPF 2F63A 2DGOA 1QD1A 3KXDA 1S4EA 1FXDA 5KFSA 3MPVA 2CZ9A 5F8IA 4ZLJA 2DEIA 3NWGA 4PAAA 3RRGA 3PYFA 3UCZP 3A8EA 3PKYA 4PQUB 2HSEB 4PG7A 2V34A 2G2ZA 2WSFC 1YJ7A 2F9JA 1YBUA 3PX4A 1QVFR 4IH6A 4P2FA 1SUQB 2DKOB 2DPIA 4KV8A 2ZKUA 4CCHA 2IDEA 3MM6A 2HK3A 3N5BA 3MUMP 1IKVA 4A8MP 3TZYA 2ZZTA 4QW9A 3RW7A 4URQU 4KGKA 2RT3A 5J1EB 4USMA 3IS9A 2LXUA 2LXIA 4K4WA 4DCJB 4CH1A 1U1KA 1D1UA 1TP7A 3LANA 3C14A 2BOAA 1DTQB 3W9IA 4ZVRB 4IUFA 5LSLA 3PX0A 4I6AA 2W2NP 1BLUA 1T95A 3FVYA 3EVWA 1U1RA 1G2EA 3NNAA 3ENQA 4IH5A 1K0VA 3PY8A 3P4UB 4QU6A 1K8AT 3FMWA 1WOSA 4USKA 2VPWB 4M5IA 3CE8A 1S1XB 1RSCA 1K1SA 1H38A 2XLKA 4YQWA 2AMCB 3W64A 1YRTA 3IO1A 4AL5A 2CPDA 2D1CA 4DQPA 1YK9A 3GG0A 3JSMB 3DLBA 3F73A 5CAAA 1N56A 3NGSA 3W61A 2HHUA 5B0DA 2UU9F 1NK7A 4JI5J 1S9EB 4MKVA 2BM0A 3JS9A 1V5IB 2EW9A 2J6TA 4BDPA 1DHMA 3M2VA 5ETNA 3FZBA 3DLLQ 3TUIC 1U0HB 1Q78A 4C98A 2UVWA 1RTIA 4DCOB 1LW0A 3NAIA 4DI6A 3BH6B 2ZH9A 4K7QA 4IQXA 1WKKA 3OD2A 4LSNA 4HTIA 2HFSA 4DXLA 3DOKB 4CYUA 2GMJA 2UUWA 4B3SJ 1N36J 3KUGA 3SCIE 1SJ4P 4J9KA 4DN9A 2OUGA 3RBDA 1KLMA 1NZAA 1RWWB 2QJ3A 1WEZA 3LUYA 3KMQA 3PRVA 5B0BA 4OHYA 4F0MA 2I0XA 4Y65A 4I68A 1CULB 2QZ8A 3NS6A 2FJDB 2KHDA 1WC6A 2DVIA 4OI6A 2CJYB 5DGAA 3ET6A 2BE7D 4G6VB 1HL6A 4EU0A 2FJVA 4F02A 2R7VA 1Y5LB 1PJ7A 2YWGA 4WU2A 1MMLA 4MFBA 5HROA 4ES1A 3KNAA 2MQ8A 3JAMY 5C24A 5GAHU 2NZ4A 4HYKA 1UKUA 4K4XA 2E1RA 2IJNA 2DNKA 3ZXWA 2H9ZA 5KFYA 2ASDA 4AQYF 4DQIA 4L3KA 3H2LA 3CCRS 2NSCA 1MU2A 3TZXA 3A8IA 1SC4B 2RS2A 4P71A 3I31A 2ZWPA 7FD1A 1GAOA 2K1RB 3HLUA 2P5VA 3K89A 3JSRA 2XHWA 1XMOF 5B7WA 1B4SA 3SV4A 1NH8A 4IFVA 1N32F 2COLA 4ED1A 1YHQS 5H9FJ 1B7FA 3IWLA 4KBIA 4DMZA 5L38A 2HHPA 2HNZB 3CJ5A 3V4IB 1YG0A 4KE5A 1RT1B 1VCTA 4ZPBA 1WC3A 2BJ8A 4QWDA 1WTBA 4LJMA 2CNOB 5FDLA 2Z2YB 3G8QA 2N7CA 3M1VB 2A2CA 2VU5A 4KH0B 1NSPA 4DPUA 1XWLA 1R8CA 3Q86A 4CO2A 3JB9k 1CG2A 3M8QB 2GVDB 3BYRA 4I2PB 2Q6BA 3PZPA 2IVMA 4F26A 3TQ1A 1VLYA 2HQ3A 4B3TJ 3G6YA 2PFDA 2YXLA 3KJVB 1RUSA 4H4KA 4TU7A 2DR8A 1FNOA 2HHSA 4OYPA 1YJTA 3MD3A 2EFPA 2FZGB 3QBCA 2XZWA 1RHUB 2MY7A 2FHMA 3VZIA 4WPAA 4OL8A 4DJBA 1QTNB 5CD4A 3EMTA 2GJ2A 1DAXA 3MCMA 4DV5F 4X4SA 5KT4A 3QT7A 3H0PA 2QMXA 5L39A 3I9V9 2HQDA 3H90A 5IV4A 3I96A 2DB1A 2KVQE 2A3JA 3THPA 1SIZA 4EZ6A 1NK8A 2ZD1B 2HG4A 1WG4A 1S1XA 2QFJA 1N54B 1U1PA 3M30A 4IG0A 4DU7A 4NEZA 5HMZA 1R6VA 2E5GA 1Q0NA 1R89A 1JJHA 2B7CB 2UXCF 1PO6A 4X64J 1RA7A 4LF6F 2BRLA 3N6LA 3L09A 2BE9B 4I64A 1FTCA 4Q2LA 3J81Y 1VIOA 3JSMA 3OJUA 4ICLA 4IO1A 4FXWA 3M6UA 1D8YA 5GAGU 4A8XA 1S9EA 4NLSA 2V2KA 2CQHA 5D0HA 4OV6A 4XPEA 4OYBA 2HQFA 1T11A 1FT8A 1TK0A 2W9CA 3QT6A 3A4TA 1SL2A 2E1PA 2HVDA 2YQ3A 2W9AA 1M1GA 1EQMA 2R3VA 2YPZA 2OJ3A 5U47A 1U0HA 4LF4F 3KUHA 1FJGF 2AIRB 3HPOA 4CLLA 2KT3A 4I4BA 1GX5A 2AYMA 3R5BA 2JEJA 3NNCA 2ZDPA 3U1MA 4Q0BA 2E7VA 2HFNA 1SV5B 2CQCA 4DX6A 2HW3A 3LW5C 1K1QA 4L76A 2E29A 2CQIA 2IAJA 1BC6A 1U48A 3C15B 1TKTB 3E01B 1OWXA 1RKIA 4O3PA 2HWTA 1L3TA 2C2KB 2F9DA 1CQMA 1GMVA 1HPZA 3CJKA 2VFSA 2I6WA 1RAFB 4Q43A 1R6YA 1NPRA 2LFVA 4JV0A 3JYTB 4C8KA 4MIWA 4F3OA 3HZGA 1VQNS 2MZJA 2C2DA 3QATA 4LRDA 2DIUA 3SZ2A 2F5GA 5BR8J 3TAQA 3LP2A 5EDWA 1S10A 2VICA 2D3UA 2NUHA 2QSFA 1KOOA 3PVXA 3CCUS 4LQ3A 3C8YA 4YOEA 4P52A 2YNFA 1MN7A 3CJQA 1YJ9S 3TJAA 1RQ0A 3MD1A 3OT9A 1TAQA 1FJEB 4PCQA 5KT2A 2V8PA 5HP1A 3CJ4A 4WU3A 2WVEA 1RJJA 3U1NA 4ZPTR 1M5KC 4OQJA 1ICEB 4EYHB 4DPYA 4BBYA 4LF2A 2F3JA 4OZ3A 5DM7Q 3SXLA 4LSLB 5LM7E 2BXJA 4HL9A 4K2JA 2YNIB 4DL2A 3PIPQ 1SQGA 2VQFJ 2KI2A 1EAYC 3V4IA 2UVVA 4RNHA 1JJ4A 3GFYA 2FJWA 1ZM4A 3R1LA 3NL0A 3M32B 3G96A 2ZOMA 1H3DA 4MMOA 4O3QA 4YR2A 3M1VA 3N79A 1V3RA 3WC0A 4K4TA 1RAGB 3MWBA 2M9KA 4DV4F 5B0FA 3BPDA 4EGLA 2QN6B 2XC9A 4I2PA 3MFIA 2RQCA 2BJ3A 2WB4A 3CT9A 2VASA 3KOAA 3DRSB 3W5YA 2PA3A 3KLFB 3N01A 3EWGA 2H4YB 1WHYA 1KDNA 1IBLJ 2RDIA 1NDPA 4X4VA 1KVKA 5D78A 1NJXA 3O44A 2JEGA 4ECUA 4ZHRA 1VYAA 1NLKL 2W24A 1PAEX 2GV1A 1X4DA 1TKZB 1RHKB 4C0BA 2YH0A 5CCMA 4LFAJ 3WIUA 1ZH5A 1X5TA 5E33A 3EZOA 5D77A 2O67A 4JYAJ 4NLRA 3IP0A 4WE1A 2UVRA 3G2XA 1KWMA 2JX2A 2CUYA 4NLOA 3VVUA 2B0GA 2Q3PA 3MF5A 1S9FA 1Y9OA 3HMJG 3KJNB 2KFYA 4NLPA 3T3FA 1S1WB 2KJVA 3NEKA 3G9CA 4DPXA 2GQCA 4F4XA 4C8OA 4F36A 4U7CA 3QIPB 2R8HA 2P9CA 1V6HA 4PWUA 3PW0A 1YRXA 5A8WA 4C8MA 3IC1A 3EUNA 2M88A 3TRGA 3CDEA 2ZZNA 3JTOA 4I0WA 2CRLA 3Q8PB 2HRYA 3CMES 4U9RA 1HNWJ 3QFWA 4R5PB 1ZA2B 4RWXA 2DR5A 1N8RT 1H74A 3MR7A 1VBZA 1HNZF 4K50A 1VGYA 4OX6A 3GV5B 4M5GA 4X4TA 3NCPA 1LV5A 1W26A 1I51B 1SJFA 2IA0A 3DRRB 4Y0FA 2FDNA 5KG5A 4YUDA 3VQSA 5F3ZA 2HVHA 3SFUA 1CSJA 2DH9A 3EM1A 2CFXA 3C15A 5FJ4A 1TKTA 3E01A 3DGPB 1XNQF 3ILJA 2OELA 5E3PA 3ZC4A 3MTJA 1VLOA 3Q8RB 1TV6B 2VDHA 4FKYA 1Y10A 4I7FB 3GYXB 4V19J 1CBKA 2AYBA 2BMBA 1IR1A 1I5OB 1AW0A 2BRKA 2GHPA 2J9DE 4B9NA 3SI8A 4N8OA 4YB7A 1Z1ZA 4W4MA 2RQKA 1EP4B 1JLAB 3U27A 4CO5A 3A13A 3FCWA 4DEZA 4X4RA 3NBPB 3HVWA 3MPYA 2D9PA 3JXOA 4LVNP 2RHSB 4U95A 3S1TA 2BABA 2MKCA 3MHYA 1J5EJ 1C4CA 4DR2F 3R5CA 1JWWA 4IH7A 2RE1A 1TAUA 4PABA 1RTDB 2CA9A 1VHIA 1HBOA 1IBKF 2VOPA 6FD1A 1U24A 3LPEA 4IG3B 1NDLA 4G1QB 1FNMA 1JLCB 2OSQA 1RU1A 3N6NA 1NK0A 5BYSA 5HO4A 4TU9A 4ZVHA 2RRAA 1UMJA 4LSLA 4O4GB 2XS5A 1UP1A 2R7QA 2R8JA 1IQZA 2FVRA 1G4CA 3CCMS 3MOZA 2HZCA 4OHZA 2CWKA 1HI1A 3LQVA 4RNMA 2ASLA 3D6HB 1VOMA 1EETB 3M8PA 3MMAB 4I67A 1QSYA 1T9VA 4DV1F 3NLCA 3N28A 3LA0A 4R25A 4R0JA 2BDPA 2W2OP 3OUYA 4WFAQ 3M32A 2JLEA 2ADBA 2RIJA 4DU8A 7AT1B 4E98A 3UCUP 2OKQA 2VZ9A 1I6JA 3QNWB 3DNCA 3AOCA 2BOPA 5EUHA 2BKOA 3ENWA 4M95A 2HHHF 3AQOA 5DZ7A 4KTQA 4FF3A 2W8LA 2VFUA 1U8SA 2DHSA 3DRSA 2A0FB 1S6OA 2WONB 3W5XA 5D4OA 1R7IA 1WUUA 1WC4A 4O4RA 3GMGA 3W3SA 5DDQC 1OPIA 3HJVA 3PDNA 1M5SA 2RNEA 1MWQA 1VQSA 2E5LJ 2EEYA 1NKCA 1Q7LB 2L9WA 4ED6A 2DHXA 3VAIA 3ZFVA 4DR1J 2QLWA 3J7AN 5DDOC 4LF7F 2AYEA 2DY1A 4R8UB 1NMEB 4LF5J 2O01C 3W9JA 2QLBB 3S6EA 3HSJA 2H4WB 5DJBA 1ELOA 2HLTA 4X2BA 1XR5A 2Z2LA 4FS1A 2C3MA 1X4HA 4NA1A 2NLWA 2D69A 1SJRA 2GW8A 4NLDA 4NWBA 1PILA 2RDDA 1PBAA 2W8KA 3I9ZA 3H98A 4DCPB 1JJ2R 1OY6A 3BKFA 1IM4A 4JV5F 4Y6IA 5J2PB 1FWLA 3L9ZA 1S0VA 4DBQA 4C0HA 2D3O1 2C2NA 2DO4A 4FYDA 1UWAA 1IKXB 1RYSA 2XI2A 4CZCA 1NRKA 4RW4B 2DNOA 3PHTA 2HBQB 2XWXA 3D68A 2HZVA 1S48A 4LBPA 1RWNB 2IBKA 5D3GB 1QTMA 2AW0A 4IKAA 4LRBA 1RADB 3T19A 1RT6A 4R5PA 4NXMF 1M90T 2CJAA 3BSNA 1HFEL 3VGSA 1ZETA 3L7UA 2AU0A 1QAYA 3OFHA 2MJUA 2W7OA 2FD2A 2RF2B 4DR7F 4CLZA 3WZ0A 1K73T 4QCLA 5AJ3F 2PD1A 1UFLA 2UUAF 3SSSA 4USJC 2NZCA 4TU8A 1DFDA 3FUYA 4ZN1A 2XEXA 3PRDA 5AE3A 1UW9A 4YMEA 1PCAA 1U49A 2ABYA 1ZM9A 5D4NA 4JOUA 4DR5J 3J7YI 2UVUA 3SCKE 1X4GA 5F8MA 3RBEA 2V69A 1Q82T 1TFWA 2CDRB 4GVBA 3DGPA 4DUYF 4G3IA 3M8WA 2VPYB 2HAIA 2J5AA 2AJ2A 3OJSA 1TV6A 4L72B 4DV6J 3WDOA 4HI2A 3BSOA 1ULRA 2SXLA 5L8RC 3HI9A 2I2YA 2DNLA 1YDLA 4RW6A 4U7UK 2IVYA 2KXNB 4IOBA 5CH7B 1O51A 2GJIA 3BH7B 4ECWA 1JLAA 5J2QB 3W8GA 1FJ7A 3SQGA 3DCAA 3VQTA 4XTTA 2DD8S 1FRXA 2VBYA 2MKIA 1KC8T 3KG1A 4HKQA 4OX8A 1IM6A 4CLTA 2CNLB 4O23A 1LKZA 3W60A 5GVQA 3QFHA 4UW2A 3CCSS 4KC5A 2BJ9A 3A3NB 2W4DA 1QSSA 1RTDA 5KFQA 3D1HA 4IQMA 1JLFB 1NKEA 1ZZFA 1E6YA 2E1CA 2JWNA 4C7QA 3U02A 4IG3A 5L1IA 1JLCA 3FQLA 4CQ1A 1S1VA 1SQEA 1X0PA 5KFPA 1FDDA 4O4GA 3V6HA 3OR2A 5HVGA 3GCXP 2J8SA 3ITHB 1H2TZ 3B8HA 4PXDA 3MR6A 2DHAA 4WFXA 2IC3B 5KFGA 3PYDA 4ZVSB 4AFFA 3LP1A 3OHBA 1EETA 2ZC4A 2DITA 1L3VA 4KB7A 5A0YB 2RU3A 5EWGA 2HYIB 1P6TA 4ELUA 3Q8YA 2HWIA 5DS7A 4B9TA 4OJ3A 1NBEB 3CIZA 5H9FK 3T5KA 4B08A 5ETVA 3NMAA 3I87A 3ULHA 3LF0A 1FE4A 3H25A 5J2MA 3F56A 3TEGA 2HS3A 4DV2F 1APSA 4ED4A 3D3CJ 1N5SA 3H2UB 2R7WA 4YY3F 1KRPA 1ITPA 2B8QA 2MPUA 2XYGB 5KFVA 2YQ1A 1A0OB 2YBVA 2MLXA 5T41A 4RUHA 2VPXB 1B7YB 1RBAA 4CT8A 1HYSB 2OH2A 4QIFA 2ZOFA 3ZTQA 1B0VA 5D4LA 5KFCA 2K06A 1WORA 2WONA 2L9DA 2MKJA 2ZFHA 2PDAA 3SV3A 1UEVA 2LA6A 1TKDA 2MKHA 1WELA 2GGPA 1F0XA 3MPUB 2KFZA 3ISZA 3CUNA 5F0UA 1AUDA 2EC2A 4EO6A 2UV8A 2X1FA 3NCQA 4R8UA 1QAIA 4JI8J 2YY3A 3TP2A 3GR0A 2OPPB 3CW2C 2XCAA 2YKMB 4KH1B 4O3RA 1YVFA 1R8HA 1LXNA 4P74A 3BZQA 3IN5A 4NA3A 1W2BR 4CO4A 2DEJA 2IM1A 5LMUF 3FJ2A 3OTEA 1HNIA 2Z56B 1HMVB 4L6V3 4BWJA 2AHOB 3HT3A 3BBBA 2V63A 2KT5A 3HT0A 2YQ0A 4DV3F 1ZTWA 4Q8EA 5J2PA 5HLFB 1YJWS 5IFMA 3IM9A 3M4XA 3M05A 3US5A 3CC2S 3I56S 2W4CA 5IQQA 4Y2IA 2I5JB 3QMQA 1IJFB 3DLJA 3DU6A 3BGOP 3ILOA 1EIYB 2CJ9A 2XSJA 4WKRA 1HQUB 5D3GA 2LECA 4QPTA 1RZMA 5KFAA 3QO9B 2ROEA 2DR7A 3HO1A 1Q95G 4HHHA 3V5RA 1LK5A 2OPQB 4X65J 1U8WA 2RF2A 1S97A 1A9NB 1NB7A 2CQ0A 4ZPVR 4M5KA 2GZOA 2YWWA 3OR1B 4OHVA 2KU7A 4JI2F 5K9FA 3OV7A 4YHHJ 1JLGB 2LLZA 1KQSR 4EWTA 1F9FA 3LPYA 4DQRA 2LYVA 2EBGA 1T03B 2B6AA 3BYPA 3VVTA 2PO4A 3Q2TC 3U7JA 1W2IA 2J9EA 3J7ZT 1RISA 2XLJA 3L3CA 4UUXA 2QC3A 2QRRA 1FWKA 4A8QA 3GILA 2CQBA 2ZUGA 2L08A 2IYIA 4F67A 3GZ7A 3D1OA 3UDLA 3TA0A 5CYQA 2RSQA 3AJ1A 4WYLA 3QGHA 2ZEJA 1CPZA 2R2SA 1MMNA 3J80U 2W9BB 2E9TA 1YQHA 5BYQA 2AEMA 4P75A 5GAEU 1X31C 1LQ9A 5J2QA 4ID5A 3IGVA 2ZWOA 1RWXB 1LNQA 2RUGA 1XQIA 2VBWA 3MAHA 3ZTSA 4ETZA 1X4FA 3R8YA 1G6BA 2CWXA 4UQTA 4RW7B 5KFEA 2YWKA 2FVQA 4QYRA 3KHHA 2BYCA 1D3WA 1EKRA 2EG1A 4WTOB 2F7VA 1FCAA 2YH1A 4A8OA 3W7BA 4X4PA 1NK9A 5M2PA 3HD1A 2XHCA 1RTJB 1U2FA 2H5IB 1RT3A 3PTWA 5KG3A 1VQ9S 3LH2S 1SKWA 2QL5B 2Z4PA 1VQYA 2Z0GA 3I4HX 1FFSB 4JV5J 2ZHOA 2ZH3A 1WSVA 1UPPA 1RT4B 2NXUA 1RXOB 1V3ZA 3GQCA 4ZJOA 4LR9A 1LWFA 5A0YA 1JX4A 1X4AA 4FYYB 2XG8A 2XCPA 1NDCA 2JFKA 3GJRB 2M4MA 3MEGB 2PMWA 2CVEA 1WF1A 3E8OA 3AT1B 3QZ7A 2X7IA 1UFWA 1HD0A 1RHRB 3BQ0A 5LJ3Y 1TL4A 2GAHC 3L95X 3HX9A 3R5AA 2WVDA 4WYWA 4M5HA 2CJXB 1VC0A 3W2VB 1WC0A 1NPKA 4M63A 1X9SA 3R5GA 1HYSA 5MAOA 2F1FA 4DHVA 2ZBIA 1AA1B 3D3BJ 2IRYA 2ZH6A 1N5TA 2PIIA 4IRCA 1JNRB 2R7XA 1SJQA 2AEJA 1AROP 2B51A 4UTGA 5HSPA 2AGQA 1BHNA 4I2QA 4WBFA 1HI8A 5IOLA 1DQ8A 3CWJA 3S01A 1IBMJ 1KQGB 1EX8A 3K5OA 3CEDA 3Q89A 5CXTA 2JSXA 4C6AA 1AT1B 2YKNB 2AV5A 3QRPA 3BBCA 4JI4J 2EK6A 2V4QA 5M2UA 4J9QA 1SH2A 3SQOP 1TQLA 2YKMA 4A48A 3IG1B 3H4DA 3BGLA 2LU2A 4CLFA 4DUZF 4PQAA 4GKKF 2DXEA 3MAQA 3PX6A 4ETXA 3DYAB 3R27A 4J91A 2RKIA 2BUNA 5C2CA 5KFLA 3BQ1A 1Q5YA 2KDOA 2PFFB 2QTWA 2UZAA 5HLFA 3JAMU 2OHDA 4CLSA 3NNHA 4GO7X 4HT5A 1SC6A 1FXLA 2I5JA 2RB7A 3GJSB 1NM2A 2FPHX 2MHEA 1QVGR 1HQUA 1H2VZ 5EX3A 2VG5B 4DPTA 3QO9A 2BKNA 3GWCA 2AJ4A 1XK8A 4IR9A 2OPQA 2MQNA 1XMQF 3EZUA 3BDEA 2VD3A 3HHLD 2PSZA 4DPWA 1REGX 2KJWA 2O5DA 4LRCA 1MLAA 2J6SA 3OR1A 3T5JA 1F3VA 3ONQA 4WKYA 2R42A 4FPRA 3B82A 3FEYB 2VG6B 3H20A 1UJ6A 2FLLA 1YZ6A 2IFXA 4ZVOB 2N4DA 1Q8LA 1UPMB 4NLWA 4ED0A 1LWCB 2CPXA 4P6QA 4N8NA 3DHXA 2QYGA 1WG5A 1VI7A 2J7KA 2WZ1A 2GO8A 3HK2A 1HARA 2OFHX 3CCTA 2XMWA 3CD5A 2LQ9A 3GIRA 3HKWA 4RKUC 3WBZA 2XMUA 3DFEA 1S7IA 1URRA 4NYPA 3SFGA 2V6AA 3KLIB 3MR3A 5K8PA 5IT0A 2L9NA 3CJSA 1YWXA 5KT6A 1OJ4A 5KT3A 2IHR1 2B56A 3ZZYA 4ED2A 3M8SA 1SL0A 1NSKL 2AT1B 4OZ5A 1RI7A 4C2MA 3KKFA 1E6VB 4LBIA 3LWMA 1EARA 4I1TA 4CO0A 1M0SA 1R8PA 3R1HA 1F9EB 1KFSA 4OI0A 3G86A 2DNHA 2ACYA 2BM1A 2L48A 4S0MA 2XZDB 3CDUA 3K8WA 2GHVC 1J5OB 2B7BB 2WBMA 4QIVA
chains in the Genus database with same CATH topology
5LM7E 3R2DJ 3JAMU 4B3TJ 4KY3A 3OTOJ 2MTLA 4AQYJ 5IT9U 3W1YC 3D3CJ 4NXMJ 4K0KJ 4JI6J 1N33J 1I94J 4LFCJ 4JI2J 4RJVA 2VQFJ 1HR0J 4JI3J 4KHPJ 4LFAJ 2UXCJ 4LF7J 3D3BJ 4LF9J 2UUCJ 4DV0J 4DV7J 4JI7J 4DR7J 4JYAJ 4LF6J 5LMUJ 3IMQJ 4LF8J 4V1Ak 5BR8J 4GKJJ 4JI5J 4DV1J 4B3RJ 1HNXJ 4DR6J 5AJ3J 4DR5J 4DV2J 4B3MJ 1IBMJ 2MEWA 4JI0J 1J5EJ 4JV5J 1XMOJ 2UUAJ 4DV3J 4YY3J 4DR4J 1HNZJ 3J81U 2MQ8A 1N32J 4JI4J 3T1HJ 4NXNJ 5LMNJ 3J80U 4X66J 5A2QU 2KVQE 2UU9J 4DV6J 4NEYA 4DR3J 2UXDJ 2VQEJ 2HHHJ 5FLXU 4KYZA 4X65J 2ZM6J 4LF4J 4DR2J 1FJGJ 3R2CJ 4DV5J 2UXBJ 4JI8J 4JI1J 5IWAJ 2KL8A 4X62J 4DUYJ 1XMQJ 2E5LJ 2UUBJ 4NEZA 4DV4J 3T1YJ 1IBKJ 4B3SJ 4DR1J 1N36J 4OX9J 3J7AN 4YHHJ 4PWWA 4HHUA 2F4VJ 4X64J 1IBLJ 4LFBJ 1XNRJ 4LF5J 4DUZJ 1HNWJ 1N34J 4GKKJ 1XNQJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LM7 E;  3R2D J;  3JAM U;  4B3T J;  4KY3 A;  3OTO J;  2MTL A;  4AQY J;  5IT9 U;  3W1Y C;  3D3C J;  4NXM J;  4K0K J;  4JI6 J;  1N33 J;  1I94 J;  4LFC J;  4JI2 J;  4RJV A;  2VQF J;  1HR0 J;  4JI3 J;  4KHP J;  4LFA J;  2UXC J;  4LF7 J;  3D3B J;  4LF9 J;  2UUC J;  4DV0 J;  4DV7 J;  4JI7 J;  4DR7 J;  4JYA J;  4LF6 J;  5LMU J;  3IMQ J;  4LF8 J;  4V1A k;  5BR8 J;  4GKJ J;  4JI5 J;  4DV1 J;  4B3R J;  1HNX J;  4DR6 J;  5AJ3 J;  4DR5 J;  4DV2 J;  4B3M J;  1IBM J;  2MEW A;  4JI0 J;  1J5E J;  4JV5 J;  1XMO J;  2UUA J;  4DV3 J;  4YY3 J;  4DR4 J;  1HNZ J;  3J81 U;  2MQ8 A;  1N32 J;  4JI4 J;  3T1H J;  4NXN J;  5LMN J;  3J80 U;  4X66 J;  5A2Q U;  2KVQ E;  2UU9 J;  4DV6 J;  4NEY A;  4DR3 J;  2UXD J;  2VQE J;  2HHH J;  5FLX U;  4KYZ A;  4X65 J;  2ZM6 J;  4LF4 J;  4DR2 J;  1FJG J;  3R2C J;  4DV5 J;  2UXB J;  4JI8 J;  4JI1 J;  5IWA J;  2KL8 A;  4X62 J;  4DUY J;  1XMQ J;  2E5L J;  2UUB J;  4NEZ A;  4DV4 J;  3T1Y J;  1IBK J;  4B3S J;  4DR1 J;  1N36 J;  4OX9 J;  3J7A N;  4YHH J;  4PWW A;  4HHU A;  2F4V J;  4X64 J;  1IBL J;  4LFB J;  1XNR J;  4LF5 J;  4DUZ J;  1HNW J;  1N34 J;  4GKK J;  1XNQ J; 
#chains in the Genus database with same CATH topology
 2Y1L B;  4JI5 F;  3S7R A;  1U0S A;  3TI0 A;  5HMY A;  4PKD B;  2BV3 A;  4NZ0 A;  2RDJ A;  3ILL A;  3H40 A;  4DV0 J;  4OI3 A;  1RT2 A;  2KZZ A;  4OYO A;  2AZ3 A;  4EFA C;  1HNV B;  3HHD A;  2Q79 A;  1HWI A;  4M5N A;  2I9S A;  5KOX A;  3D28 A;  3ZNU A;  1U1N A;  2MKK A;  3J81 U;  2OEM A;  2Z30 B;  4B3S F;  1N36 F;  3MEG A;  3NAH A;  3R6L B;  4FBU A;  2CQD A;  2MDA A;  4J9M A;  3K7R A;  2VFR A;  3G6V A;  4QIE A;  4TQS A;  2UXB J;  4PUO A;  4DQS A;  1S6Q A;  3T1Y J;  3W2V A;  4CLW A;  3MEE A;  3IM8 A;  3ENA A;  2X51 A;  2LQJ A;  1NSQ A;  3M9N B;  1FKP B;  1CS4 B;  3PJW A;  3EJM A;  5I3Q A;  2DGU A;  3LGM A;  3FKB A;  1VR6 A;  3W9H A;  3OL8 A;  4KR0 B;  2YWH A;  1IWA A;  3KK1 B;  4EBE A;  4H4O B;  5G0R B;  4ID8 A;  3KNG A;  2EG2 A;  2XS2 A;  2LU1 A;  3T1A A;  3HF5 A;  2HHT A;  2XYH B;  3R7B B;  4OI1 A;  2J6U A;  2YKN A;  4WIQ A;  5C25 B;  1WHV A;  3IGN A;  3JQM A;  5E41 A;  1F9H A;  1D8Z A;  2JVR A;  4CLU A;  3IG1 A;  2IJF A;  3UN5 A;  2RHQ B;  3IXQ A;  4G1I A;  2NS1 B;  3DYA A;  1UZH A;  3D1Q A;  5L46 A;  2QT7 A;  3HSG A;  4QJV A;  4O0N A;  2Q1L A;  1WI8 A;  1SKR A;  5A8K B;  5K8N A;  1GTH A;  1RCX B;  3TA1 A;  1TKX A;  2RD5 C;  3KMS A;  4KKO B;  3ZZ0 A;  2ZBR A;  2J9C A;  2O3D A;  4KHM A;  2WB1 D;  2XO6 A;  3M6W A;  2OD6 A;  3E51 A;  4URS A;  2E5I A;  3M8Y A;  4TVA B;  4NCB A;  4ZDN A;  4YB6 A;  1TVR B;  1A7G E;  2RS8 A;  2V2Q A;  3TQE A;  4C4W A;  4WFZ A;  1F3F A;  2Z57 B;  3R7S B;  1QSL A;  1R27 B;  4Y34 A;  3KLH B;  1MRO A;  2F4F A;  3BN7 A;  1M5V C;  2X1B A;  2WSE C;  5DM6 Q;  4PPD A;  5K14 A;  4XO0 A;  2C3P A;  1X4B A;  2ZH8 A;  3KK2 A;  4P72 A;  1KTV A;  3ZTO A;  3VAH A;  3EPI A;  1T9U A;  4NI2 A;  2VG6 A;  4ZLN A;  3IRX B;  1N5Y A;  1XR7 A;  1CC8 A;  1VIS A;  3I55 S;  1U09 A;  2MST A;  4DX7 A;  3DLE B;  1OY9 A;  4B3T F;  1OQ3 A;  3UNG C;  3MXH P;  3TO8 A;  3CC4 S;  1IQT A;  3UVJ A;  2AWZ A;  2V8G A;  3P49 B;  3K5P A;  3RAM A;  3MMJ A;  4EEY A;  3WX4 A;  5KTQ A;  2G1H A;  1RAH B;  5B08 A;  2YKA A;  3M8R A;  4NRU A;  3CB4 A;  3K2Y A;  2DIS A;  1RT5 B;  2LXF A;  1VBK A;  1FXR A;  4OYZ A;  1RAO A;  1K44 A;  3V6D A;  3KLI A;  3OVB A;  3GIJ A;  1GMW D;  2RH3 A;  4R0E A;  1RTZ A;  4E2F B;  1YTY A;  2FVS A;  1OPZ A;  3UDE A;  5HQ8 A;  4DSK A;  3HHE A;  3MOJ B;  1VQ6 S;  3POT B;  3C19 A;  1JIH A;  2XYP B;  2IA6 A;  3EYZ A;  2QE5 A;  3QID A;  1RAC B;  4KO0 B;  4NLQ A;  4LIW A;  4A8Y A;  2R2R A;  4OV1 A;  4ZMM A;  3Q0A A;  3NY0 A;  4Y2M A;  3MCO A;  4X64 F;  3UW1 A;  4TY8 B;  3N4W A;  3CCV S;  4DR3 J;  1JK9 B;  1JMT A;  2OPS B;  4KIA A;  3EPG A;  2BKP A;  4CRJ A;  4JI1 J;  1J5O A;  1FRL A;  2XMV A;  2WVC A;  4ZVU B;  1GT8 A;  1LW2 A;  1LFP A;  2HK2 A;  5BYR A;  2DBB A;  4Y00 A;  4HAC B;  2BAN B;  3V81 B;  4HHU A;  1PC5 A;  1FHT A;  2ZBQ A;  3ZNJ 1;  2BJE A;  4J90 A;  3WQP A;  2DGQ A;  4NX9 A;  2MQP A;  3W1Y C;  4LIR A;  2F40 A;  4Q7A A;  3VV2 B;  5KG0 A;  1AFI A;  1S1U B;  1HNV A;  1UW4 A;  1Z2Z A;  1WF2 A;  2VB6 A;  1VFJ A;  1J27 A;  3P3D A;  3VAM A;  3HP6 A;  3RW6 A;  3G8T A;  4KJI A;  3MM8 B;  1QE1 B;  4BLG A;  2AJ1 A;  1C1B B;  1BXN A;  3HVR A;  3BN4 A;  1SKS A;  2QMW A;  3W5Z A;  2QX0 A;  2FJX A;  2FJA B;  1VQ7 S;  3UD5 A;  1KS2 A;  1TL7 B;  4ERD A;  1KP6 A;  4OLO A;  5I42 B;  2PC6 A;  1VHF A;  1S77 D;  1H2U X;  4TY9 A;  3ZTP A;  2YNH B;  1FKP A;  1CS4 A;  4NLY A;  3J80 Y;  3TAM B;  4A47 A;  1XEZ A;  2VDI A;  2YTC A;  4DLG A;  3RB6 A;  2BJ1 A;  4LF1 A;  1HLW A;  4H4O A;  5BR8 F;  5G0R A;  2Y1R I;  4QYZ J;  3CMA S;  3GE9 A;  3I32 A;  1N5V A;  1PIE A;  2XMM A;  2BR0 A;  2CZV C;  4MIA A;  3Q8V A;  4K0K J;  4P2M A;  5C25 A;  2ZE2 B;  2QLF B;  3SCL E;  3NKY A;  3M6V A;  4KFB A;  3WHI A;  3JTN A;  4DUT A;  1IUJ A;  4JI7 J;  1Y5I B;  3H5Y A;  2JL9 A;  3GSD A;  2VUG A;  1HNX J;  3E2E A;  2N3O A;  2HFZ A;  4B3M J;  4OI2 A;  2EVZ A;  3DDK A;  2R7O A;  1BD6 A;  3NG8 A;  3CVK A;  3ADA C;  4B3O A;  5ETL A;  4UT4 A;  1CLF A;  5HJY A;  5ETK A;  5GAD I;  3JQJ A;  5LMN J;  4YFU A;  4A46 A;  2YX7 A;  4KKO A;  2NCK L;  4GMK A;  2OML A;  1FFG B;  4X62 J;  2OIH A;  4WCE Q;  3UN2 A;  3X1L B;  4X4Q A;  3RTV A;  3K57 A;  2VQF F;  2P9G A;  2DRD A;  3VGU A;  3IR7 B;  3KK3 A;  4B02 A;  1HBM B;  2R8G A;  1HWL A;  1XNR J;  3EDQ B;  1TVR A;  2ZNZ A;  1NXI A;  3ENV A;  1AZS A;  1EKS A;  1VQK S;  3KLH A;  1EZZ B;  1H6K X;  2V8D A;  3GB0 A;  2V68 A;  4ZJQ A;  5E3R A;  1UAW A;  5E3Q A;  4LRF A;  2W1B A;  2P9E A;  5KFO A;  1OSC A;  1JKH B;  2FLP A;  1B99 A;  4QBU A;  4FXV A;  1C0U B;  1X4C A;  5E3C A;  4UY8 T;  2B5J B;  4ZCM A;  3UPF A;  4IYQ A;  1U2R A;  2Q66 A;  4CTA B;  3HHL B;  2Y1J A;  3PKM A;  3IRX A;  3AOB A;  2KH9 A;  1WOP A;  1RK8 A;  2KKH A;  4F04 B;  3DLE A;  4BHQ A;  3I0S A;  3T1H J;  1IVZ A;  3AXM A;  5JUM A;  4L75 A;  3BR9 A;  1IBL F;  3FC9 A;  2IVF B;  2UXD J;  3DXB A;  3BQ2 A;  3BGF A;  2NPF A;  4EBC A;  2HHV A;  1KVI A;  1TL3 A;  3OPK A;  2VC0 A;  2M8D B;  3HHL C;  2B43 A;  1T9X A;  5EHH A;  4CM2 A;  4LFA F;  1RT5 A;  1IR2 A;  3UDC A;  4DX5 A;  4JYA F;  2XMA A;  4OZ1 A;  4F50 A;  4F4A A;  4DL4 A;  3QGI A;  5KT5 A;  1FDN A;  1N5Q A;  2OSR A;  1N6Q B;  1R0A A;  2HHX A;  4ECT A;  3EE3 A;  4PXE A;  3POT A;  4FF1 A;  1X7V A;  4DV7 J;  3T5L A;  1RYR A;  2QO3 A;  4USV A;  3FNN A;  2YX4 A;  4LSZ B;  2HNY A;  4ILM A;  2PN6 A;  3TAR A;  3CO0 P;  4ZLP A;  4P7V A;  2OO4 A;  4YB5 A;  3W2W B;  1MG7 A;  5DG9 A;  3I4P A;  2ZJR Q;  1X4E A;  2MGZ B;  1UET A;  2BX6 A;  2OPS A;  3QZ8 A;  2ACM A;  1JLE B;  5F8L A;  2GMH A;  5F8J A;  2RQM A;  3AFG A;  4LVO P;  2C3O A;  1HNW F;  2NRE A;  4P9S A;  1WJ9 A;  4HAC A;  4B9M A;  4V19 X;  3V81 A;  2MLZ A;  3DI6 B;  4NE9 C;  1GNK A;  4WP8 A;  1FI4 A;  1ZOT A;  3AJ2 A;  1NCL A;  3DLG A;  4EK2 A;  3PYE A;  3G6X A;  1UJ5 A;  4CLK A;  3MM9 A;  3H4B A;  3H5S A;  2GML A;  3TOQ A;  1VRT A;  2Q6C A;  3MED B;  2JLF A;  1NH7 A;  3AB2 B;  1T9Y A;  2GQ2 A;  1UWB B;  4X4O A;  4ECZ A;  1T8E A;  3LGN A;  2KVI A;  3AXK A;  4X84 A;  1PC4 A;  3KLV A;  2D41 A;  3MM8 A;  4P7T A;  3EGN A;  2P8I A;  4JV1 A;  4RL1 A;  1NPP A;  1CJU B;  3BRE A;  4WP9 A;  1C1B A;  4YR0 A;  2HAF A;  2HND B;  4KGX B;  9ATC B;  1O5J A;  2LA4 A;  3TEH B;  1RHM B;  1X9M A;  1TL7 A;  4CNY A;  2AZ1 A;  2E5J A;  4MIB A;  4DZ6 A;  2HQI A;  4E8U A;  3G8S A;  1FE0 A;  3R3T A;  1U6B A;  1R31 A;  1N4L A;  4KHR A;  2ZHB A;  1U45 A;  3QT8 A;  1SC1 B;  2GCF A;  3PHE A;  3PR5 B;  3TAM A;  2QMU B;  3D66 A;  3NXZ A;  1U2C A;  2LQB A;  4LRA A;  4PQU A;  2CVI A;  1HQE B;  1SUQ A;  5FD1 A;  3DHW C;  5FII A;  1YKW A;  3KJQ B;  2WW8 A;  1LWE B;  3CJT A;  1HI0 P;  2MB0 B;  3I5A A;  4F4Y A;  2MJN A;  4LMZ A;  4K4V A;  4FYV B;  3MM5 B;  3M2U B;  4DL3 A;  2HS0 A;  2MTL A;  5J1E A;  4A8W A;  1H7X A;  1L5U A;  3JSB A;  1J5E F;  3NS7 B;  3H5X A;  1JXE A;  4MKY A;  4JI3 J;  4UY8 5;  1WWH A;  9RUB A;  2EFQ A;  1DTQ A;  4LF8 J;  2XNR A;  2HVZ A;  2FVC A;  3HVT B;  1FES A;  1NSA A;  5A76 A;  3ZZR A;  3EGZ A;  1VDH A;  3MMC B;  3F41 A;  4OFZ A;  4Z2X A;  4RW9 B;  2QLX A;  2YPY A;  1FK9 B;  3D67 A;  2HVI A;  1XJW B;  4L73 A;  2NSB A;  5KFX A;  4BWM A;  5AXM A;  4ZVG A;  1F5A A;  3RBX A;  4J9S A;  3C3L A;  2ZM6 J;  1HBM A;  3GTY X;  5IWA J;  4MKB A;  4HH0 A;  4F4W A;  2KRR A;  1RHQ B;  2J0X A;  3PCO B;  2CQG A;  3BF4 A;  2FJB B;  4X4U A;  5M2R A;  3DLK B;  2EWH A;  2JNJ A;  4ECX A;  4PPZ A;  2ZBC A;  1JKH A;  2DHH A;  3TZZ A;  2DPJ A;  1C0U A;  3NMR A;  2GAG C;  3BGR B;  3O6Q A;  4CTA A;  3HHL A;  1S7H A;  1PJ5 A;  3D0G E;  3DN9 A;  3AQP A;  3DC2 A;  3HKZ D;  3DOK A;  2NQP A;  1C1C B;  2HGL A;  1HBU B;  1IKW B;  2P2C B;  4JI0 J;  4YDX A;  3MR2 A;  2OPR B;  1QUV A;  5KG7 A;  2AGP A;  2OTL S;  7FDR A;  3Q23 A;  3MR5 A;  2E5L F;  1CJV B;  1BQM B;  2FIU A;  1SC3 B;  3G82 B;  4DR1 F;  5IZH A;  1OQ6 A;  2DT9 A;  2A6O A;  2DH7 A;  3K8V A;  4LF5 F;  1C4A A;  3C6T B;  1HD1 A;  3ETO A;  3ELH A;  4UF4 A;  5JVG Q;  2QL9 B;  1OS5 A;  1CUL A;  2VHG A;  1WTF A;  1NJY A;  4OZN A;  1Y0H A;  4OX9 J;  4PWD B;  4C8Z A;  1N6Q A;  1ZM3 A;  1U1L A;  3NGR A;  5HVF A;  2MMY A;  4GVL A;  4GC7 A;  4W98 A;  2Z2M A;  3IWN C;  4RU9 A;  4OLP A;  1VQM S;  3QAU A;  4FNH A;  3Q24 A;  4H54 A;  1VBX A;  3W2W A;  5ETM A;  2FC9 A;  2VBZ A;  1AXQ A;  5C42 B;  1ZTT A;  4KGZ B;  1Q79 A;  4CO1 A;  1S9G B;  2U1A A;  2Q43 A;  3GLJ A;  2OGU A;  5F9L A;  3PEH A;  4A8F A;  3WX8 A;  4NZ6 A;  3A8K A;  2Y8W A;  1M1K T;  1R8A A;  3VR1 A;  1KKH A;  4M5J A;  2K1R A;  3EGW B;  1R0B G;  5JXS A;  4FYW B;  3HHK A;  4K4Z A;  2H1Y A;  3G4S S;  3B6B A;  3B4M A;  3Q83 A;  1UVJ A;  2GVZ B;  4J9P A;  2C2R A;  2AX1 A;  3MM6 B;  2JLG A;  1TEL A;  2KXF A;  2CG4 A;  1UWB A;  1OY8 A;  2BW2 A;  5BJR A;  1FTR A;  4NLU A;  3P8B B;  2HNZ A;  5J1N A;  2HIY A;  3ZO7 A;  1RT1 A;  5EWE A;  1N34 J;  2NXE A;  2XUL A;  4FF4 A;  4KAI A;  2ZZM A;  3IS9 B;  4KY3 A;  4DR5 F;  3I6P A;  2Y3Y A;  1BMQ B;  2HND A;  3C14 B;  5L1J A;  2NYI A;  3QRR A;  3TAN A;  1FVQ A;  1CJT B;  2VL1 A;  5DET A;  5DLF A;  3FSI A;  1KVJ A;  4DV6 F;  3TAP A;  5KFM A;  5KFB A;  2JH3 A;  3M8Q A;  2GVD A;  2NR0 A;  2BW7 A;  4DL0 C;  2WHO A;  2KXH A;  1BGX T;  4WFY A;  3J7Y U;  1J2V A;  4NXN F;  3A12 A;  4XPC A;  3I5B A;  2DRB A;  4QWB A;  3T6J A;  2O66 A;  1HQE A;  3OXG A;  2EKN A;  3DRP B;  3OFF A;  4QZV B;  3KJV A;  2V9W A;  1LWE A;  5AT1 B;  4I56 A;  4OHW A;  5LL6 d;  1NJZ A;  3UNY A;  1NND A;  3FBF A;  5F8H A;  3UCG A;  2B9W A;  3X3U A;  3MM5 A;  3M2U A;  4C11 B;  4ZVP B;  4LFB J;  3M2V B;  1WEY A;  4EBD A;  2OD4 A;  4AL7 A;  3H5U A;  2AX0 A;  3BO2 A;  4CP5 A;  1S59 A;  1LW0 B;  2QA2 A;  4ZS6 A;  1M1H A;  1IJE B;  4DG1 B;  2EKY A;  3BEG B;  4JUZ A;  4ZA1 A;  4CH7 A;  3P5B P;  3ZZO A;  3K59 A;  3MTK A;  1FJC A;  5J1P A;  2VIH A;  2OFG X;  2HIQ A;  5JVH Q;  2QGF B;  4J37 A;  3OLB A;  1N0V C;  2V2V A;  2ZD1 A;  4GKJ J;  3MMC A;  2J0S D;  4RNO A;  4DFK A;  1HWK A;  2YX1 A;  4RW9 A;  5IS2 A;  4DR4 J;  3KYL A;  1KLM B;  2BEF A;  4OI4 A;  1WHX A;  2R2T A;  3VCD A;  3HSD A;  4GC6 A;  1T02 A;  2LEP A;  5F9N A;  4NEY A;  5KFF A;  2DIV A;  5H9E K;  2VQE J;  2IM3 A;  2EXU A;  2BA9 A;  1HIY A;  3PIO Q;  3DLK A;  3DXS X;  2I1R A;  4TN2 A;  1KTQ A;  3CNQ P;  1WC5 A;  1H7W A;  4CM0 A;  5K5M A;  3DRY A;  4FN5 A;  2FHJ D;  3BGR A;  3B54 A;  5C24 B;  4CI0 B;  1G7C B;  4OJG A;  1ZPW X;  1SKU B;  3OTO J;  2JDJ A;  1X5O A;  1RLD A;  2Z2Z A;  4W90 B;  3TX8 A;  1C1C A;  5B0C A;  5G4D A;  1HBU A;  1IKW A;  4LF9 F;  1RHJ B;  2WOM B;  2OPR A;  2V8V A;  2B9X A;  2LVW A;  1SV5 A;  3E3X A;  3IR5 B;  3PEJ A;  3FRZ A;  1CJK B;  5CCL A;  1M5P C;  4C3M A;  4DR6 J;  4IRK A;  2PI4 A;  4W92 B;  4CT9 A;  3VAG A;  1MMD A;  3CCZ A;  4QWA A;  2MXY A;  4ZK7 M;  4ECY A;  4JI8 F;  2VA2 A;  4WXO A;  3C6T A;  4DWI A;  4AUK A;  2DXF A;  2G2O A;  3ZZT A;  3PO5 A;  3R6G B;  4HDH A;  3HM9 A;  3JYT A;  1Y4Z B;  3IAS 9;  2X3G A;  4MT1 A;  1WKL A;  3NOG A;  1V9O A;  4O3O A;  3VHQ A;  3WIV A;  4ZCL A;  1DY3 A;  1BWE A;  3MUV P;  1OSD A;  2D74 B;  1GMW A;  5ETR A;  3AAW B;  1VIX A;  3HFZ B;  2GHW A;  3PR4 A;  2AF6 A;  1X8D A;  3H8Y A;  2MHN A;  4NPO A;  3P45 B;  4J9L A;  1F6T A;  2BJ7 A;  5DRK A;  1RTH B;  5C42 A;  1FFW B;  3IWX A;  5KG2 A;  4IRD A;  4ENO A;  1S9G A;  2YWE A;  1DTT B;  3MPW A;  3VAK A;  2XI3 A;  2C2E A;  3KG0 A;  2UUC J;  1BE4 A;  1YIJ S;  4J9V A;  3DDI A;  3VAJ A;  1N52 B;  3M6X A;  4AE5 A;  5CD4 H;  4K2X A;  3LAL A;  5KFZ A;  1SH3 A;  4YB1 P;  3MUR P;  5I4M A;  4X65 F;  1IN0 A;  4TLQ A;  2U2F A;  3H59 A;  3K0J A;  1OYD A;  2O1P A;  2H48 B;  2KRB A;  2J76 E;  3O1L A;  1KQK A;  2XY5 A;  2GVZ A;  4XDD A;  1Q5V A;  1TK8 A;  3P5T L;  4YHH F;  2CQ4 A;  3GON A;  2LDY A;  4RZR A;  3IRW P;  4ALZ A;  2YNI A;  3GFX A;  2B4O A;  2WVF A;  3K58 A;  2QA4 G;  2GIQ A;  3FFI B;  4OYA A;  5L1K A;  1YJV A;  4QWC A;  2FZK B;  5KFJ A;  1XC9 A;  1JLB B;  3EGV A;  3BS9 A;  3MDF A;  3OHA A;  1TZ0 A;  5C7P A;  3CMQ A;  1WD6 A;  4H4K C;  1YZ7 A;  3SYZ A;  4ELV A;  1CJT A;  2DGS A;  2MQL A;  5KFI A;  5AE2 A;  3H2V E;  4NZ7 A;  1ZM2 A;  2DR6 A;  5LOQ A;  2QA1 A;  4F3Q A;  3W8P A;  2AGO A;  2ILZ A;  3UD4 P;  8AT1 B;  2IM2 A;  3CJ3 A;  3M30 B;  4IG0 B;  5CQG A;  2ASJ A;  2M7S A;  3KLF A;  2R7U A;  3OVA A;  1MWY A;  2A6M A;  3DRP A;  1RLC L;  2ZOG A;  4ICL B;  3C46 A;  2K3K A;  5EWF A;  5IT9 Y;  5A2Q U;  1TKZ A;  4QYZ K;  2DCL A;  3GV7 B;  1VQ5 S;  3QT5 A;  5DQH A;  3OBI A;  2APO A;  4C11 A;  4TXS A;  2W9C B;  4WFB Q;  3LTO A;  1YLX A;  3KHL A;  3NOC A;  4NLT A;  2RAQ A;  4F25 A;  4PG5 A;  3C2P A;  3OLA A;  1VC5 A;  1VJW A;  3NGD A;  1DQ9 A;  4F4K A;  2QYC A;  4DG1 A;  3PV8 A;  2V0N A;  1UZD A;  4OZL A;  1DQA A;  1S1W A;  2BAC A;  4P2S A;  1DZ5 A;  1UFK A;  4OYW A;  4Q0B B;  1S72 S;  3QIP A;  1X60 A;  2HZA A;  1NAQ A;  1G1X A;  2XGQ A;  1V3S A;  1P9Y A;  3A8J A;  4PZV A;  5MLC V;  2IAJ B;  5KFR A;  4NRT A;  2C28 A;  4B3R J;  1HKA A;  3EVO A;  3RAQ A;  1HW9 A;  1HPZ B;  3GU0 A;  2YKO A;  1VC6 A;  3CJK B;  5AXK A;  1SXL A;  2HBR B;  2R8K A;  1FDB A;  2J7U A;  4DFJ A;  3N6M A;  1WDT A;  2BJD A;  2X1A A;  3LP2 B;  4YS2 A;  4CO3 A;  3IAM 9;  1U1Q A;  2MKY A;  2ALZ A;  2YWF A;  5E3A A;  3DRR A;  4CDI A;  2F4V F;  2YNF B;  5HI7 A;  5KT7 A;  4QIW D;  5L1L A;  1S76 D;  2WOM A;  2HLU A;  4WTY A;  2CPJ A;  1IBM F;  1I94 F;  5A6P A;  1CJK A;  1N33 J;  1HR0 F;  1BUX A;  3KDO A;  5HP1 B;  1ZBT A;  1S79 A;  1XMB A;  5DDR C;  1WG1 A;  4M8L A;  4JI4 F;  2ATL A;  3RYL A;  5ADZ A;  3N5F A;  4J5O A;  2AD9 A;  2DGW A;  1GK8 A;  4NL5 A;  2OP5 A;  4I7F A;  4ED7 A;  2JHE A;  4ED8 A;  2N4C A;  4Y3C A;  3LWL A;  3BKU A;  2XY7 A;  3ICL A;  3OFG A;  3A1Y G;  1FKA F;  4IDK B;  4PYA A;  4NXN J;  2ZBP A;  3TVZ A;  5E5N A;  2GNK A;  1VQ4 S;  2DNR A;  1EP4 A;  3VGT A;  5IC4 B;  4ELT A;  4RUA A;  3P96 A;  1TR0 A;  1UA0 A;  1JB0 C;  3B4D A;  1YBA A;  3NBP A;  2ASY A;  2E9R X;  2JZ5 A;  1XBW A;  4N41 A;  4HT7 A;  2DJW A;  1RTH A;  1G3O A;  4IO9 Q;  4RO0 A;  4DSI A;  5DDP C;  4ZP9 A;  4ZVQ B;  1H72 C;  2CQ2 A;  3GJT B;  4URG A;  3RBZ A;  4ECS A;  1DTT A;  4BC7 A;  1RB0 A;  2HS4 A;  2VJV A;  2MZS A;  2V94 A;  5CAB A;  3RRK A;  2ALY B;  2DXD A;  4L74 A;  5IM0 B;  2XMT A;  4G1Q A;  4IR1 A;  2POK A;  1N88 A;  2MYF A;  3J7A 1;  3NGK A;  1NJI T;  5GMD A;  2XO7 A;  2JRS A;  2JJ4 D;  2PMZ D;  2DY9 A;  2KB2 A;  3MMB B;  3H42 A;  1S0M A;  1K9M T;  3G6E S;  4ZHR B;  2EI5 A;  1NDK A;  3MMA A;  5HQM A;  2AEF A;  3KJF B;  3FFI A;  4X66 J;  3FCV A;  5ETO A;  1SL1 A;  4DQQ A;  3RGI A;  1JLB A;  3HHN B;  3T6B A;  1LFW A;  2QL7 B;  3JQK A;  2Y8Y A;  4LRE A;  1XIQ A;  3PAC A;  4F0K A;  2IDL A;  4G1P A;  4JV2 A;  4WE1 B;  2A10 A;  4NOH A;  2UUB J;  4QU7 A;  3V6K A;  1S6P B;  1PYT A;  4PYD A;  1JJC B;  4D3G A;  3DU5 A;  2XLI A;  4EMD A;  2D3Z A;  3BKT A;  1N0U A;  3VAF A;  5SUH A;  5KFH A;  1MWZ A;  1ZAV A;  4PEO A;  3GV8 B;  1OO0 B;  1O8B A;  2RU9 A;  3RJM B;  5KFN A;  4UUW A;  5ETP A;  2RJZ A;  3OQ2 A;  1F5B A;  2HGN A;  5KFU A;  1B3T A;  5A8W B;  4LF9 J;  2VOO A;  4QIG A;  2FY8 A;  3DRX A;  1B0P A;  2H5E A;  2FGO A;  2V2Z A;  3LP0 B;  3KWM A;  5BXI A;  4O3S A;  3CC7 S;  3RZA A;  1OIA A;  2G0C A;  4MTP A;  5ETQ A;  1PBU A;  2E66 A;  2KHC A;  4F2S A;  2HHW A;  4UOF A;  1KQF B;  4NCA A;  4MAK A;  5KG6 A;  1U1M A;  1O6X A;  5F0W A;  3T9N A;  4DL6 A;  2MZQ A;  1W7W A;  1L3K A;  4KYZ A;  4OZ0 A;  3CIM A;  1WSR A;  2BZ2 A;  1L3U A;  1KSP A;  1H73 A;  2V9K A;  1NHU A;  3UFC X;  4FBT A;  4GO5 X;  1ZAW A;  4DV0 F;  3BSC A;  3NGU A;  1K0T A;  3D6M B;  2GFF A;  2VV5 A;  1TU0 B;  4D3H A;  4ED3 A;  3OL9 A;  4AND A;  2LKZ A;  2CPE A;  2WRM A;  1IKX A;  4RW4 A;  5CZV A;  2XB2 D;  4LFC J;  2B4P A;  4QWE A;  4KHP J;  1SBR A;  4EI2 A;  2N82 B;  4QW8 A;  2V5H G;  4FKX A;  5FLX Y;  4NA2 A;  4ZP7 A;  4YN3 B;  2OAU A;  3MCS A;  1DLO B;  1H98 A;  3DDN A;  3UDV A;  4DX8 H;  2E1M C;  4DN0 A;  1C2P A;  4H4M B;  3C6U B;  1P9Q C;  4FXD A;  3TW0 A;  2QEX S;  1Q16 B;  3MEC B;  1S1T B;  2CJB A;  2YKQ A;  2LEB A;  4ED5 A;  2UXB F;  3VWS A;  2BBE A;  1X0F A;  1S6U A;  1RWU A;  2N7Y A;  3T1Y F;  2KG1 A;  3CCJ S;  4M1K A;  1CEZ A;  1S0O A;  1TL1 B;  4ES3 A;  5HMX A;  3THT A;  2DH8 A;  2BVZ A;  3GCW P;  3J81 j;  2HBZ B;  3QSI A;  3RG6 A;  1RWM B;  1RAA B;  2RRB A;  1DAR A;  1CQN A;  2FC8 A;  3EDR B;  2AJF E;  1NO8 A;  2BQR A;  1X5S A;  2V8H A;  1ROF A;  1Y3K A;  2L3M A;  2C22 A;  1HBO B;  4PRF A;  2W01 A;  3BGU A;  1PGZ A;  3AA8 A;  1F2H A;  3RR8 A;  4LQ9 A;  3GYN A;  2M8H A;  4LT6 A;  3IMQ J;  2XSF A;  4DLE A;  5LSR A;  3FSX A;  4M5D B;  4TLR A;  3B78 A;  3JTP A;  1NU4 A;  3M9O B;  4IDK A;  2N3L A;  3BBF A;  1VQO S;  2WAQ D;  1NHK L;  1QLN A;  5A8R B;  3DMJ B;  3M8P B;  4QPX A;  1Z4U A;  3VZH A;  4WP3 A;  2IPO B;  3OUY B;  1FRI A;  4F3M A;  4B9V A;  3OSN A;  2ZH1 A;  2UU9 J;  2G0I A;  4B9U A;  2P6T A;  1AB8 A;  4FVC A;  3MM7 B;  2LCW A;  4MH8 A;  3MPD A;  3AOA A;  5I3P A;  3CDW A;  1JLF A;  5K8O A;  5LXR A;  1ZZN A;  2QSW A;  4DSL A;  3GFZ A;  3PRB A;  1REV B;  5IM0 A;  1IXK A;  4J9R A;  4AL6 A;  4FZV A;  1D0E A;  5CYJ A;  1BWV A;  3BPS P;  5B09 A;  4ZCI A;  4RPF A;  2FHO B;  5HMW A;  1GFW B;  2K3I A;  4MYU A;  3MUT P;  3ITH A;  4TNO A;  3MMB A;  3AD9 C;  2IC3 A;  4WZM A;  4C48 A;  4EO8 A;  1RWV B;  1WDD A;  4ES2 A;  3IBF B;  4BC9 A;  4FVM A;  1P8G A;  4CIO A;  1FA0 A;  4WZQ A;  4F8R A;  1M5O C;  3PG9 A;  2GIF A;  2CQP A;  4C8Y A;  4U96 A;  2MZR A;  3T9Z A;  2CIM A;  5GAH I;  4ZOS A;  2H3E B;  2DGX A;  1S99 A;  6AT1 B;  1S6P A;  2G2Y A;  3N9U C;  2E9Z A;  2JEF A;  1ACM B;  1HHT P;  2ADC A;  4OYI A;  4PXC A;  3TNV A;  3I0R B;  4Y2K A;  2BQU A;  3SIP B;  1U6F A;  4BS2 A;  2RML A;  1RBO B;  4N76 A;  3F44 A;  2K8G A;  2ZIT A;  1FO1 A;  2F4V J;  3CCE S;  2JC0 A;  1B64 A;  1B0T A;  3V4M A;  4ZCK A;  2J7W A;  4DL7 A;  2OMO A;  4AQY J;  2M3D A;  1EQ0 A;  3MGJ A;  2ERR A;  3LP0 A;  1I94 J;  1GXT A;  1HR0 J;  2NPI A;  5THW A;  1KN6 A;  4P10 A;  2PA8 D;  1RT6 B;  5DQG A;  4O44 B;  4K4Y A;  2IM0 A;  3MI7 X;  2OPP A;  3NRB A;  4DR3 F;  3D54 A;  2Z8Q A;  1UCN A;  1F2G A;  2C2Z B;  3R7N B;  1VRQ C;  4Y2C A;  1Q4R A;  2EFN A;  4N47 A;  5AXL A;  1XMO J;  3KUE A;  1NK5 A;  4JI1 F;  4N5S A;  2CPH A;  1HHS A;  1N32 J;  1HMV A;  1LEO A;  2HBY B;  1WOO A;  1QAJ A;  3C16 B;  4Z37 A;  1P27 B;  5B0E A;  4JBC A;  3SEO A;  4Y2A A;  3KHG A;  2IMO A;  2HKE A;  2BE2 B;  4ZVT B;  3J7Z 5;  3MCN A;  3FZ2 A;  4ZPC A;  1YSJ A;  2H5J B;  4GVB B;  4BCA A;  2VG7 B;  4HI1 A;  3BJY A;  2JOQ A;  3IBW A;  5F8N A;  1JLQ B;  2R7S A;  1DLO A;  1QM9 A;  1UVI A;  5KG1 A;  4HEA 9;  4JI6 F;  5SZT A;  1Q8I A;  4H4M A;  3C6U A;  4OZJ A;  2ZUA A;  1LOU A;  2QLJ B;  3MEC A;  1S1T A;  4RW6 B;  1I3O B;  3PYG A;  2CDQ A;  3RB4 A;  4CLY A;  1FRK A;  3FEZ A;  2KZM A;  3M2R B;  3SQG B;  2YVS A;  3UO0 A;  4GRS A;  1TL1 A;  5AE1 A;  1NHV A;  3CJR A;  2NXC A;  1JLG A;  3L4B C;  5IXU A;  3KLG B;  2KFN A;  3JSY A;  4ZVE A;  1U4B A;  2OLW A;  1CC7 A;  4KGM A;  1T03 A;  1KBR A;  2FHJ A;  2DNQ A;  2ROP A;  2Y0S D;  2GQQ A;  3Q22 A;  4J9O A;  1Q81 T;  3FDS A;  1SVD A;  4DV5 J;  1XN9 A;  2H54 B;  3CD0 A;  4K0K F;  5EN1 A;  5A2Q Y;  2R7T A;  1E6Y B;  4Z7C A;  4HH1 A;  3ZTR A;  2EK1 A;  4JI7 F;  2QIF A;  5GAG I;  1S1V B;  3A3O B;  5CZX A;  5CA5 A;  1WEX A;  4HVZ A;  6FDR A;  3OL7 A;  1HNX F;  1W25 A;  3OR2 B;  1JQG A;  4B3M F;  4JB8 B;  2AJQ A;  4USW A;  4M5D A;  2W9B A;  2CG8 A;  3LAM A;  5E2Q A;  1VS3 A;  3CJ2 A;  3ZZU A;  3LP1 B;  2UXC J;  2DR9 A;  5A8R A;  3DMJ A;  4LF6 J;  4ZP6 A;  5LMN F;  3PW4 A;  1SPB P;  1PSD A;  5HAN A;  1S4F A;  1BQN B;  2DTJ A;  4QR2 A;  4DOZ A;  4Q44 A;  1T05 B;  4PG8 A;  1GX6 A;  1WHW A;  4K4U A;  3BSA A;  2YNG B;  4X62 F;  4PG4 A;  4ILR A;  1CVJ A;  4RUB A;  4RW7 A;  5J2M B;  1PG5 B;  2WTF A;  3MM7 A;  1GEH A;  8RUC A;  2RVJ A;  4NYO A;  1T3O A;  3R5J B;  4C3L A;  3TYT A;  3VGV A;  2CYY A;  1XNR F;  1TUW A;  5L9X A;  3D5M A;  3QAE A;  1UVN A;  1JXL A;  4WJB A;  5GAD U;  2DNM A;  3BV8 A;  4LF4 J;  1FJG J;  1REV A;  2C1E B;  1UEU A;  3D9B A;  1RTJ A;  1RDR A;  2E44 A;  3GFH A;  1M5H A;  3FEX B;  3DKD A;  1U7L A;  2KYX A;  4DL5 A;  3EVM A;  2VF3 A;  2W2P P;  2BQ3 A;  4RR5 A;  3HFV A;  2GGP B;  4ITS A;  4LR7 A;  2R2U A;  2WSC C;  3AHP A;  2AKW B;  1RT4 A;  3T5H A;  2FTR A;  5B0G A;  4ZPD A;  3IFE A;  3CCQ S;  2J8A A;  3GIK A;  2VC1 A;  5CYM B;  5E7O B;  2HUR A;  1NZ8 A;  2D9O A;  1O0P A;  4IOC Q;  2Y1I A;  2XNQ A;  2IRU A;  3T1H F;  5CHC B;  5EGY A;  3OTD A;  1LK7 A;  2UXD F;  3F0N A;  3CF5 Q;  2CKW A;  2IY5 B;  1HNI B;  3OTB A;  1TK5 A;  2WK4 A;  5HJX A;  2M70 A;  4RU2 A;  3OXL A;  3UQS A;  1TTH B;  3MEK A;  3I0R A;  3QSY B;  2ROG A;  1FER A;  5DG7 A;  3MAA B;  3QWU A;  4DDF A;  4U67 Q;  1Y3J A;  3LO3 A;  1U6Z A;  4CH0 S;  2JFD A;  2WCX A;  4DV7 F;  2FY1 A;  2ZC3 A;  2X1G A;  2XSJ B;  4WF9 Q;  1P1T A;  2D7S A;  4O44 A;  2AP6 A;  1TFY A;  2ZH7 A;  4FDF A;  2A1B A;  2ZJP Q;  1P1L A;  3UWT A;  2DCU B;  2DRA A;  1OMS A;  1T7P A;  2R4F A;  2EFO A;  3K17 A;  3PFE A;  3DLH A;  2AJ0 A;  2MQQ A;  1R0C B;  2B8P A;  3C16 A;  3NWR A;  1RE1 B;  3N0V A;  3TJ9 A;  2AQ4 A;  4P73 A;  4AD6 A;  1D9A A;  2B6A B;  1VRU B;  2LQ5 A;  2BE2 A;  1YI2 S;  3O2I A;  4YP3 A;  4ECV A;  2VON A;  3FGV A;  4ILL A;  3AB4 B;  2UP1 A;  3NCR A;  3SBM A;  4ATN A;  4ANE A;  3D2W A;  1WF0 A;  2R9L A;  4I6W A;  5H9E J;  2VG7 A;  3TUP A;  1KHW A;  3I82 A;  1L3S A;  2PT0 A;  1HWJ A;  1SIW B;  4UOG A;  2EC0 A;  1JLQ A;  2C3U A;  4DV4 J;  2VPZ B;  5CYQ B;  1T94 A;  2VG5 A;  2FUG 9;  2EFG A;  2PGC A;  3PW5 A;  1TUV A;  3AD8 C;  4DF4 A;  3FQK A;  3FK4 A;  4ER8 A;  2W25 A;  2C3Y A;  3TVK A;  2HPU A;  3D0H E;  5ETS A;  4CLP A;  3M2R A;  4ID5 B;  2K2P A;  4AXI A;  1PYS B;  1FEE A;  4F2R A;  1NUE A;  4MYT A;  3V6J A;  3DOM B;  2E1A A;  3KLG A;  4ZJL A;  4RNN A;  1VJQ A;  4FS2 A;  3BO3 A;  3RRH A;  3QPI A;  4CNZ A;  1H0H B;  1RAE B;  2UV8 G;  1LWC A;  3RB0 A;  2KN4 A;  5DGB A;  4WWS A;  3GII A;  1QY7 A;  2HMI B;  1RT3 B;  4MK8 A;  2F65 A;  2KL8 A;  4KQZ A;  1IKY B;  1RAJ A;  2DNN A;  1PYO B;  1WNE A;  4JI3 F;  3SCJ E;  5GMK a;  3PFO A;  5A6W A;  4LF8 F;  2M0G B;  3EX7 B;  1FRH A;  2FZC B;  3ZZP A;  1VBY A;  4RBT A;  1LWF B;  4QQB A;  3T41 A;  3KLE B;  4TQR A;  4ECQ A;  4RJV A;  1BQN A;  4Y28 C;  3OVS A;  2XS7 A;  3CPW R;  1T05 A;  2YNG A;  2B3T B;  1E6V A;  3TA2 A;  3D0I E;  3A3P B;  4OHX A;  2G0J A;  1SI9 A;  2HVE A;  1UL3 A;  2GS8 A;  3EXY A;  2ZM6 F;  2GC8 A;  5IWA F;  4YR3 A;  1HNZ J;  1D9F A;  1LXJ A;  2CPY A;  2W7P A;  2JEI A;  2LQ8 A;  5JMN A;  4ZLL A;  5DG8 A;  3ETM A;  2V4R A;  4B9L A;  5T7L B;  3U1L A;  3IBC B;  3PJ9 A;  2FLO A;  3K5N A;  4I2Q B;  1FF2 A;  3QJL A;  4WII A;  5D15 A;  3QJJ A;  4M94 A;  5J2N B;  5CYM A;  1XNQ J;  4ECR A;  4UZC A;  4NML A;  2HFU A;  2ZJQ Q;  3ISN D;  2V50 A;  3ILI A;  3UN3 A;  1PKU A;  2CNN B;  4JI0 F;  2CNK B;  4JI6 J;  3KG4 A;  2QG9 B;  4Q45 A;  5K20 B;  2XZT B;  1XR6 A;  5D0R A;  3DM2 B;  1S49 A;  2HQC A;  2B9E A;  5LSO A;  1LWX A;  2IIH A;  2RKI B;  4DF8 A;  5IV3 A;  1S12 A;  2NUU G;  2RQ4 A;  1Y7P A;  4L3N A;  2MSS A;  3IR6 B;  3EZ5 A;  1ZAX A;  2ZH5 A;  3DOL B;  2W2Q P;  1FDA A;  2DNG A;  2CPI A;  3MAA A;  3GG1 A;  4OX9 F;  8ATC B;  1FD8 A;  1TL5 A;  3M7V A;  3FCH A;  2ZNY A;  4K8R A;  1HA1 A;  3Q8Q B;  2YKP A;  1DUR A;  3KK1 A;  3LOU A;  3CSK A;  5KAK A;  3CJ8 A;  3D6F B;  1ZA1 B;  4DR2 J;  3C66 A;  4M5M A;  2IBO A;  3M8Z A;  1EJ7 L;  3OXF A;  4PXB A;  1IBK J;  2CAJ A;  3RR7 A;  4KPC A;  1KNZ A;  3CO9 A;  5DQI A;  2MZT A;  5D4P A;  3S8S A;  3OFE A;  4UOH A;  1IWG A;  4F7V A;  3WC2 A;  4X4N A;  4JP8 A;  3TX0 A;  2B9Y A;  2DO0 A;  2HQG A;  5KFW A;  2WVB A;  2OTJ S;  2XTJ P;  1YBT A;  1WAC A;  1PJ6 A;  2QA4 S;  5A8K A;  3W65 A;  3KDN A;  3LGH A;  1VRU A;  4DV1 J;  1BY9 A;  1RAI B;  2HGM A;  1C0T B;  3HXM A;  4WXW A;  3QQC D;  2DGT A;  1RWO B;  4ZN3 A;  2ZVS A;  3QRQ A;  3AJD A;  4RW8 B;  5ITH A;  3CXC R;  2RRN A;  4FPI A;  1FD2 A;  2HHH J;  1N34 F;  5D0E A;  4USI A;  2CQ1 A;  1PAU B;  2AYG A;  4OYM A;  5HK4 A;  1TUG B;  3FBE A;  3W66 A;  4A8K A;  2WW4 A;  4QOT A;  2D3O R;  4U8Y A;  2PEH A;  4LBH A;  2E7W A;  4CWB A;  4PR6 A;  3H7H B;  1FX2 A;  3PJX A;  1N48 A;  1QJH A;  3LAK A;  2V4J B;  3DOM A;  2HEK A;  1Q7Y T;  2VOD A;  4XDC A;  1YJU A;  3QLH B;  4LF7 J;  5DO2 A;  1UVM A;  3TUJ C;  5D6G A;  4V1A k;  4F4Z A;  2MY8 A;  4Q2M A;  1Q8B A;  1NKB A;  1KHV A;  5DLG A;  3CCW A;  4NAS A;  4IOA Q;  5C5J A;  4OJ1 A;  1GXU A;  3Q8S B;  3RUB L;  4N56 A;  1DBD A;  1VK8 A;  2G9O A;  4RBV A;  2HMI A;  1RA6 A;  2XMK A;  3G87 A;  1IKY A;  3OL6 A;  2XGP A;  4LFB F;  1FNX H;  1QAX A;  3CDB A;  1WC1 A;  4MK7 A;  1RT2 B;  3UI3 A;  3O3L A;  2IJR A;  3OSP A;  3TR5 A;  3AH6 A;  1QUP A;  3GPA A;  4ZP8 A;  3MFH A;  1F1B B;  4ZVF A;  3KLE A;  4I6Y A;  2XMJ A;  4GKJ F;  3VTI A;  3PO4 A;  1MW7 A;  1KOH A;  2A2D A;  3NP5 A;  5I3U B;  4KO0 A;  5IT9 U;  4NXM J;  2PEB A;  1SJ3 P;  3AY0 A;  2HRT A;  4DR4 F;  3HVA A;  4Q5V A;  4TY8 A;  1AYE A;  4J9N A;  4B17 A;  2I38 A;  3I5C A;  4DR7 J;  2CAD A;  5H1S V;  4EZ9 A;  4PUO B;  2GO9 A;  1S6Q B;  2XBP A;  4ZIV A;  3KTQ A;  3MEE B;  3QYY A;  5AJ3 J;  3HUL A;  2VQE F;  4RNF A;  2C2M B;  4MK9 A;  1SCJ B;  1RAB B;  1NK6 A;  5LXY A;  2UUA J;  3QWP A;  3HD2 A;  4G65 A;  2M52 A;  2BAN A;  3UR3 C;  3HFK A;  2ZH4 A;  1V5V A;  3QGP A;  5T7L A;  1T3N A;  5HBM B;  4N7T A;  2ZKT A;  3CDA A;  2VJU A;  2IRX A;  3UR0 A;  1YJN S;  5J2N A;  1S1U A;  3OTO F;  2GX8 A;  1T0T V;  4DUY J;  4AYB D;  3CTR A;  3QJP A;  2CJK A;  1QE1 A;  3P6Y C;  2FGC A;  4UQG A;  4HR2 A;  3EIC A;  5T14 A;  4DSE A;  3DM2 A;  1FWP A;  2E5H A;  2Y9H A;  4DR6 F;  2W4P A;  3BDP A;  1KON A;  1UEK A;  3SDE B;  4DSF A;  3CJ0 A;  3PW2 A;  2M5Y A;  2ZHA A;  5DZ6 A;  1HWU A;  4A8S A;  4NLV A;  5I42 A;  1TKX B;  2GIR A;  1UTA A;  2PE8 A;  2J0Q D;  3DOL A;  4USH A;  2YNH A;  2C2O B;  2K7K A;  3K5M A;  3SSR A;  2NYH A;  3RB3 A;  3FMB A;  1ZYQ A;  3CGI A;  2DK2 A;  1GMU A;  1RWK B;  2H51 B;  3L7O A;  1RP5 A;  2P6S A;  4C8N A;  3G71 S;  4O0I A;  2ZE2 A;  1EB0 A;  4WFN Q;  1MRO B;  3AD7 C;  2R8I A;  1JNZ B;  1HQ2 A;  1IR0 A;  5K14 B;  5HQL A;  3O8W A;  2GA7 A;  2VH7 A;  3TWZ A;  1FVS A;  1D09 B;  3FBB A;  4EUV A;  2FYX A;  5C2G A;  2UUC F;  1Q53 A;  3KK2 B;  2ILY A;  1U26 A;  1FKO B;  4NI2 B;  4I69 A;  3TJ8 A;  2G1D A;  3SMZ A;  1N5Y B;  4NLG A;  2OEJ A;  1TMJ A;  2DNY A;  4PG6 A;  1B70 B;  1GH8 A;  2EBE A;  1C0T A;  1S5Z A;  5AXN A;  2HRU A;  3THV A;  3UVJ B;  2ATC B;  5HL7 Q;  2UUT A;  1NK4 A;  4DV2 J;  3BR8 A;  4E0D A;  4RW8 A;  4OJH A;  4IFY B;  4YY3 J;  4WK3 A;  4DS5 A;  2DHG A;  1EHW A;  3UE2 A;  2KG0 A;  5IT4 A;  3O5T B;  3VAL A;  2RIL A;  2W2M P;  1MN9 A;  3V6D B;  2CPZ A;  2MQM A;  2PI5 A;  1X5P A;  3GR1 A;  2FB0 A;  4RBU A;  3Q8U A;  4UST A;  2QFI A;  1VK3 A;  2XWY A;  1F60 B;  2JVO A;  3AA9 A;  1S57 A;  1KEK A;  3BB5 A;  4USU A;  3TVY A;  2B5J A;  1AFJ A;  2V4J A;  4FYX B;  4NCG B;  4PWW A;  5F8G A;  3PXG a;  4ANC A;  4TYA A;  1HHQ A;  3QLH A;  2K7J A;  4C9D A;  4C8L A;  1RKJ A;  5ETT A;  2OI2 A;  3D4J A;  4ZPA A;  2CQ3 A;  1HBN B;  1MNE A;  4TYB A;  1KFD A;  1KD1 T;  4NMX A;  1TMM A;  4DFM A;  5KOW A;  1LW2 B;  5LMU J;  3QGG A;  4F0H A;  3W63 A;  3R5D A;  5LJ5 Y;  1VMB A;  1RCO B;  2DGV A;  2F8E X;  1NJW A;  2HWH A;  4MJK A;  4XK8 C;  2J9D A;  5F41 A;  2MKS A;  4DV3 J;  4AT1 B;  1I1G A;  3FRY A;  2VBX A;  5F3T A;  3RAX A;  1RU2 A;  1T9T A;  4FNI A;  2C42 A;  5D8H B;  2M2B A;  1X9W A;  2F8M A;  5HVH A;  2IYG A;  5GME A;  1R3N A;  1RWP B;  1VQ8 S;  4LUB A;  1RT7 B;  4ZIT A;  1UJ4 A;  3R2C J;  4HTJ A;  2F8H A;  2FVP A;  2CXE A;  1ZPV A;  4RWW A;  1DJ0 A;  5I3U A;  3CCL S;  2ZH2 A;  4J9U E;  4RUC A;  3HZE A;  2MGZ A;  4B3R F;  1URN A;  3D7S B;  1SH0 A;  4NYZ A;  2XY6 A;  1S0N A;  1JLE A;  1GXL A;  1ZS6 A;  4NLX A;  3GSI A;  4O3N A;  3FSY A;  2FJE B;  2JC1 A;  4JI2 J;  3KHR A;  2DNP A;  2NXJ A;  3HJF A;  2B4V A;  3RU0 A;  4UOC A;  3HCX A;  2Y0B B;  3DI6 A;  5D0G A;  1YIT S;  3BO4 A;  5JJB A;  1Y00 A;  4K5S A;  4WK1 A;  5HBM A;  2MEW A;  2WBR A;  3BM7 A;  2CPF A;  1T9W A;  3W62 A;  4XAK A;  2XM3 A;  1U1O A;  4HDG A;  3MED A;  3OW2 R;  1YRU A;  1SB6 A;  1YX2 A;  5HAO A;  4QR1 A;  4KV8 B;  3AOD A;  3GYG A;  5GAE I;  1IKV B;  1Q1K A;  4KFB B;  2KT2 A;  5FLX U;  1R8B A;  2Z58 B;  3MZI A;  1RBL A;  1CJU A;  2DYA A;  4OMF G;  4U7U D;  4KSE B;  1N33 F;  2V67 A;  3SDE A;  3SSQ A;  4B3O B;  4FF2 A;  2QV6 A;  1OYE A;  3FBC A;  2IMW P;  5KG4 A;  3HSZ A;  2OEK A;  1AUS L;  2EPI A;  3EXC X;  1UA1 A;  2MQO A;  2VKZ G;  1R43 A;  4FP9 A;  5KFT A;  4ZIW A;  1MSW D;  1FX4 A;  1A6L A;  5RUB A;  2FQQ B;  1WKJ A;  1D9D A;  2B4U A;  4C0O C;  4Q8F A;  1GQE A;  4TKT A;  5IC6 B;  3PNI A;  2X3D A;  2LDI A;  3ISN C;  4YEA A;  3GIM A;  2I8E A;  3KK3 B;  1K47 A;  1NB2 A;  3CD6 S;  1Q8K A;  4KPY A;  3DGV A;  1VQP S;  1HW8 A;  1AZS B;  2XQC A;  1FEH A;  2KM8 B;  2MLY A;  5E0O A;  1SQF A;  2PMH A;  3M9M B;  4XIU A;  4P2X A;  1UVL A;  4UZB A;  1GTE A;  4ZKA A;  1IBC B;  1RTI B;  4DFP A;  1FKO A;  4DZD A;  2R7R A;  4KRW A;  2GJF A;  4YDD B;  4OYX A;  4LSN B;  4U8V A;  1RGV A;  3HVT A;  2KM8 C;  3NS5 A;  2KTQ A;  1YJR A;  2W7A A;  4CYU B;  2LP4 A;  3I0S B;  3R2D J;  4N77 A;  2G4B A;  4OX7 A;  5HN0 A;  1DRZ A;  1Y5N B;  3GJQ B;  2ZDO A;  4C3K A;  3V2U C;  2CZ4 A;  1FK9 A;  1U25 A;  2HFV A;  1TL3 B;  4DPO A;  3HDS A;  2HFO A;  2A18 A;  4IFY A;  4DSJ A;  4X66 F;  5B0A A;  1FRJ A;  1U47 A;  4J7C A;  1F5C A;  2H65 B;  2NXN A;  3PW7 A;  2HHQ A;  2MZ1 A;  2UUB F;  4HHJ A;  3ZZZ A;  2FHK A;  1XTZ A;  3ET6 B;  3OTC A;  3D6T B;  4AXJ A;  2KO1 A;  1R0A B;  2VFT A;  4MFB B;  4OZ2 A;  4QR0 A;  5HRO B;  4HLB A;  4NCG A;  4B9S A;  5IQ6 A;  1FRM A;  2LEA A;  2HNY B;  1VQL S;  1WI6 A;  3R97 A;  1BQX A;  3IA0 A;  5EX0 A;  5KFD A;  4LR8 A;  3R9L A;  2LMI A;  1Y11 A;  1HBN A;  2VKR A;  4DUZ J;  2VA3 A;  4GKK J;  3TUZ C;  2G13 A;  5LT5 A;  4M5L A;  3L7P A;  1QDU B;  4KGV B;  1Q86 T;  1CJV A;  1BQM A;  3UD3 P;  3K5L A;  1KLN A;  3KFW X;  4C97 A;  3G82 A;  4A4J A;  1MU2 B;  2ZVI A;  2FLN A;  4K4S A;  1U02 A;  5HAT A;  3CUL A;  3CD7 A;  5K8M A;  2L41 A;  2EFV A;  1KR4 A;  4K59 A;  3DLG B;  4RX6 A;  3MM9 B;  1XER A;  1JXV A;  1VRT B;  4MKA A;  3PM9 A;  4ZPW R;  4IFV B;  4RLE A;  4PWD A;  3VF0 B;  2CJQ A;  1Z2L A;  1RT7 A;  2RUS A;  1NEE A;  4K5R A;  3Q2S C;  2J0W A;  4U6P A;  5L9N A;  4KT0 C;  3GP9 A;  4DS4 A;  1UVK A;  5KFK A;  1SJ1 A;  2DNZ A;  4EYI B;  3NGT A;  2E7X A;  5FDL B;  2VFV A;  3TZW A;  1YGY A;  4OIX A;  1XMQ J;  4Z7Y A;  4LFC F;  2KYZ A;  4KHP F;  2F63 A;  2DGO A;  1QD1 A;  3KXD A;  1S4E A;  1FXD A;  5KFS A;  3MPV A;  2CZ9 A;  5F8I A;  4ZLJ A;  2DEI A;  3NWG A;  4PAA A;  3RRG A;  3PYF A;  3UCZ P;  3A8E A;  3PKY A;  4PQU B;  2HSE B;  4PG7 A;  2V34 A;  2G2Z A;  2WSF C;  1YJ7 A;  2F9J A;  1YBU A;  3PX4 A;  1QVF R;  4IH6 A;  4P2F A;  1SUQ B;  2DKO B;  2DPI A;  4KV8 A;  2ZKU A;  4CCH A;  2IDE A;  3MM6 A;  2HK3 A;  3N5B A;  3MUM P;  1IKV A;  4A8M P;  3TZY A;  2ZZT A;  4QW9 A;  3RW7 A;  4URQ U;  4KGK A;  2RT3 A;  5J1E B;  4USM A;  3IS9 A;  2LXU A;  2LXI A;  4K4W A;  4DCJ B;  4CH1 A;  1U1K A;  1D1U A;  1TP7 A;  3LAN A;  3C14 A;  2BOA A;  1DTQ B;  3W9I A;  4ZVR B;  4IUF A;  5LSL A;  3PX0 A;  4I6A A;  2W2N P;  1BLU A;  1T95 A;  3FVY A;  3EVW A;  1U1R A;  1G2E A;  3NNA A;  3ENQ A;  4IH5 A;  1K0V A;  3PY8 A;  3P4U B;  4QU6 A;  1K8A T;  3FMW A;  1WOS A;  4USK A;  2VPW B;  4M5I A;  3CE8 A;  1S1X B;  1RSC A;  1K1S A;  1H38 A;  2XLK A;  4YQW A;  2AMC B;  3W64 A;  1YRT A;  3IO1 A;  4AL5 A;  2CPD A;  2D1C A;  4DQP A;  1YK9 A;  3GG0 A;  3JSM B;  3DLB A;  3F73 A;  5CAA A;  1N56 A;  3NGS A;  3W61 A;  2HHU A;  5B0D A;  2UU9 F;  1NK7 A;  4JI5 J;  1S9E B;  4MKV A;  2BM0 A;  3JS9 A;  1V5I B;  2EW9 A;  2J6T A;  4BDP A;  1DHM A;  3M2V A;  5ETN A;  3FZB A;  3DLL Q;  3TUI C;  1U0H B;  1Q78 A;  4C98 A;  2UVW A;  1RTI A;  4DCO B;  1LW0 A;  3NAI A;  4DI6 A;  3BH6 B;  2ZH9 A;  4K7Q A;  4IQX A;  1WKK A;  3OD2 A;  4LSN A;  4HTI A;  2HFS A;  4DXL A;  3DOK B;  4CYU A;  2GMJ A;  2UUW A;  4B3S J;  1N36 J;  3KUG A;  3SCI E;  1SJ4 P;  4J9K A;  4DN9 A;  2OUG A;  3RBD A;  1KLM A;  1NZA A;  1RWW B;  2QJ3 A;  1WEZ A;  3LUY A;  3KMQ A;  3PRV A;  5B0B A;  4OHY A;  4F0M A;  2I0X A;  4Y65 A;  4I68 A;  1CUL B;  2QZ8 A;  3NS6 A;  2FJD B;  2KHD A;  1WC6 A;  2DVI A;  4OI6 A;  2CJY B;  5DGA A;  3ET6 A;  2BE7 D;  4G6V B;  1HL6 A;  4EU0 A;  2FJV A;  4F02 A;  2R7V A;  1Y5L B;  1PJ7 A;  2YWG A;  4WU2 A;  1MML A;  4MFB A;  5HRO A;  4ES1 A;  3KNA A;  2MQ8 A;  3JAM Y;  5C24 A;  5GAH U;  2NZ4 A;  4HYK A;  1UKU A;  4K4X A;  2E1R A;  2IJN A;  2DNK A;  3ZXW A;  2H9Z A;  5KFY A;  2ASD A;  4AQY F;  4DQI A;  4L3K A;  3H2L A;  3CCR S;  2NSC A;  1MU2 A;  3TZX A;  3A8I A;  1SC4 B;  2RS2 A;  4P71 A;  3I31 A;  2ZWP A;  7FD1 A;  1GAO A;  2K1R B;  3HLU A;  2P5V A;  3K89 A;  3JSR A;  2XHW A;  1XMO F;  5B7W A;  1B4S A;  3SV4 A;  1NH8 A;  4IFV A;  1N32 F;  2COL A;  4ED1 A;  1YHQ S;  5H9F J;  1B7F A;  3IWL A;  4KBI A;  4DMZ A;  5L38 A;  2HHP A;  2HNZ B;  3CJ5 A;  3V4I B;  1YG0 A;  4KE5 A;  1RT1 B;  1VCT A;  4ZPB A;  1WC3 A;  2BJ8 A;  4QWD A;  1WTB A;  4LJM A;  2CNO B;  5FDL A;  2Z2Y B;  3G8Q A;  2N7C A;  3M1V B;  2A2C A;  2VU5 A;  4KH0 B;  1NSP A;  4DPU A;  1XWL A;  1R8C A;  3Q86 A;  4CO2 A;  3JB9 k;  1CG2 A;  3M8Q B;  2GVD B;  3BYR A;  4I2P B;  2Q6B A;  3PZP A;  2IVM A;  4F26 A;  3TQ1 A;  1VLY A;  2HQ3 A;  4B3T J;  3G6Y A;  2PFD A;  2YXL A;  3KJV B;  1RUS A;  4H4K A;  4TU7 A;  2DR8 A;  1FNO A;  2HHS A;  4OYP A;  1YJT A;  3MD3 A;  2EFP A;  2FZG B;  3QBC A;  2XZW A;  1RHU B;  2MY7 A;  2FHM A;  3VZI A;  4WPA A;  4OL8 A;  4DJB A;  1QTN B;  5CD4 A;  3EMT A;  2GJ2 A;  1DAX A;  3MCM A;  4DV5 F;  4X4S A;  5KT4 A;  3QT7 A;  3H0P A;  2QMX A;  5L39 A;  3I9V 9;  2HQD A;  3H90 A;  5IV4 A;  3I96 A;  2DB1 A;  2KVQ E;  2A3J A;  3THP A;  1SIZ A;  4EZ6 A;  1NK8 A;  2ZD1 B;  2HG4 A;  1WG4 A;  1S1X A;  2QFJ A;  1N54 B;  1U1P A;  3M30 A;  4IG0 A;  4DU7 A;  4NEZ A;  5HMZ A;  1R6V A;  2E5G A;  1Q0N A;  1R89 A;  1JJH A;  2B7C B;  2UXC F;  1PO6 A;  4X64 J;  1RA7 A;  4LF6 F;  2BRL A;  3N6L A;  3L09 A;  2BE9 B;  4I64 A;  1FTC A;  4Q2L A;  3J81 Y;  1VIO A;  3JSM A;  3OJU A;  4ICL A;  4IO1 A;  4FXW A;  3M6U A;  1D8Y A;  5GAG U;  4A8X A;  1S9E A;  4NLS A;  2V2K A;  2CQH A;  5D0H A;  4OV6 A;  4XPE A;  4OYB A;  2HQF A;  1T11 A;  1FT8 A;  1TK0 A;  2W9C A;  3QT6 A;  3A4T A;  1SL2 A;  2E1P A;  2HVD A;  2YQ3 A;  2W9A A;  1M1G A;  1EQM A;  2R3V A;  2YPZ A;  2OJ3 A;  5U47 A;  1U0H A;  4LF4 F;  3KUH A;  1FJG F;  2AIR B;  3HPO A;  4CLL A;  2KT3 A;  4I4B A;  1GX5 A;  2AYM A;  3R5B A;  2JEJ A;  3NNC A;  2ZDP A;  3U1M A;  4Q0B A;  2E7V A;  2HFN A;  1SV5 B;  2CQC A;  4DX6 A;  2HW3 A;  3LW5 C;  1K1Q A;  4L76 A;  2E29 A;  2CQI A;  2IAJ A;  1BC6 A;  1U48 A;  3C15 B;  1TKT B;  3E01 B;  1OWX A;  1RKI A;  4O3P A;  2HWT A;  1L3T A;  2C2K B;  2F9D A;  1CQM A;  1GMV A;  1HPZ A;  3CJK A;  2VFS A;  2I6W A;  1RAF B;  4Q43 A;  1R6Y A;  1NPR A;  2LFV A;  4JV0 A;  3JYT B;  4C8K A;  4MIW A;  4F3O A;  3HZG A;  1VQN S;  2MZJ A;  2C2D A;  3QAT A;  4LRD A;  2DIU A;  3SZ2 A;  2F5G A;  5BR8 J;  3TAQ A;  3LP2 A;  5EDW A;  1S10 A;  2VIC A;  2D3U A;  2NUH A;  2QSF A;  1KOO A;  3PVX A;  3CCU S;  4LQ3 A;  3C8Y A;  4YOE A;  4P52 A;  2YNF A;  1MN7 A;  3CJQ A;  1YJ9 S;  3TJA A;  1RQ0 A;  3MD1 A;  3OT9 A;  1TAQ A;  1FJE B;  4PCQ A;  5KT2 A;  2V8P A;  5HP1 A;  3CJ4 A;  4WU3 A;  2WVE A;  1RJJ A;  3U1N A;  4ZPT R;  1M5K C;  4OQJ A;  1ICE B;  4EYH B;  4DPY A;  4BBY A;  4LF2 A;  2F3J A;  4OZ3 A;  5DM7 Q;  3SXL A;  4LSL B;  5LM7 E;  2BXJ A;  4HL9 A;  4K2J A;  2YNI B;  4DL2 A;  3PIP Q;  1SQG A;  2VQF J;  2KI2 A;  1EAY C;  3V4I A;  2UVV A;  4RNH A;  1JJ4 A;  3GFY A;  2FJW A;  1ZM4 A;  3R1L A;  3NL0 A;  3M32 B;  3G96 A;  2ZOM A;  1H3D A;  4MMO A;  4O3Q A;  4YR2 A;  3M1V A;  3N79 A;  1V3R A;  3WC0 A;  4K4T A;  1RAG B;  3MWB A;  2M9K A;  4DV4 F;  5B0F A;  3BPD A;  4EGL A;  2QN6 B;  2XC9 A;  4I2P A;  3MFI A;  2RQC A;  2BJ3 A;  2WB4 A;  3CT9 A;  2VAS A;  3KOA A;  3DRS B;  3W5Y A;  2PA3 A;  3KLF B;  3N01 A;  3EWG A;  2H4Y B;  1WHY A;  1KDN A;  1IBL J;  2RDI A;  1NDP A;  4X4V A;  1KVK A;  5D78 A;  1NJX A;  3O44 A;  2JEG A;  4ECU A;  4ZHR A;  1VYA A;  1NLK L;  2W24 A;  1PAE X;  2GV1 A;  1X4D A;  1TKZ B;  1RHK B;  4C0B A;  2YH0 A;  5CCM A;  4LFA J;  3WIU A;  1ZH5 A;  1X5T A;  5E33 A;  3EZO A;  5D77 A;  2O67 A;  4JYA J;  4NLR A;  3IP0 A;  4WE1 A;  2UVR A;  3G2X A;  1KWM A;  2JX2 A;  2CUY A;  4NLO A;  3VVU A;  2B0G A;  2Q3P A;  3MF5 A;  1S9F A;  1Y9O A;  3HMJ G;  3KJN B;  2KFY A;  4NLP A;  3T3F A;  1S1W B;  2KJV A;  3NEK A;  3G9C A;  4DPX A;  2GQC A;  4F4X A;  4C8O A;  4F36 A;  4U7C A;  3QIP B;  2R8H A;  2P9C A;  1V6H A;  4PWU A;  3PW0 A;  1YRX A;  5A8W A;  4C8M A;  3IC1 A;  3EUN A;  2M88 A;  3TRG A;  3CDE A;  2ZZN A;  3JTO A;  4I0W A;  2CRL A;  3Q8P B;  2HRY A;  3CME S;  4U9R A;  1HNW J;  3QFW A;  4R5P B;  1ZA2 B;  4RWX A;  2DR5 A;  1N8R T;  1H74 A;  3MR7 A;  1VBZ A;  1HNZ F;  4K50 A;  1VGY A;  4OX6 A;  3GV5 B;  4M5G A;  4X4T A;  3NCP A;  1LV5 A;  1W26 A;  1I51 B;  1SJF A;  2IA0 A;  3DRR B;  4Y0F A;  2FDN A;  5KG5 A;  4YUD A;  3VQS A;  5F3Z A;  2HVH A;  3SFU A;  1CSJ A;  2DH9 A;  3EM1 A;  2CFX A;  3C15 A;  5FJ4 A;  1TKT A;  3E01 A;  3DGP B;  1XNQ F;  3ILJ A;  2OEL A;  5E3P A;  3ZC4 A;  3MTJ A;  1VLO A;  3Q8R B;  1TV6 B;  2VDH A;  4FKY A;  1Y10 A;  4I7F B;  3GYX B;  4V19 J;  1CBK A;  2AYB A;  2BMB A;  1IR1 A;  1I5O B;  1AW0 A;  2BRK A;  2GHP A;  2J9D E;  4B9N A;  3SI8 A;  4N8O A;  4YB7 A;  1Z1Z A;  4W4M A;  2RQK A;  1EP4 B;  1JLA B;  3U27 A;  4CO5 A;  3A13 A;  3FCW A;  4DEZ A;  4X4R A;  3NBP B;  3HVW A;  3MPY A;  2D9P A;  3JXO A;  4LVN P;  2RHS B;  4U95 A;  3S1T A;  2BAB A;  2MKC A;  3MHY A;  1J5E J;  1C4C A;  4DR2 F;  3R5C A;  1JWW A;  4IH7 A;  2RE1 A;  1TAU A;  4PAB A;  1RTD B;  2CA9 A;  1VHI A;  1HBO A;  1IBK F;  2VOP A;  6FD1 A;  1U24 A;  3LPE A;  4IG3 B;  1NDL A;  4G1Q B;  1FNM A;  1JLC B;  2OSQ A;  1RU1 A;  3N6N A;  1NK0 A;  5BYS A;  5HO4 A;  4TU9 A;  4ZVH A;  2RRA A;  1UMJ A;  4LSL A;  4O4G B;  2XS5 A;  1UP1 A;  2R7Q A;  2R8J A;  1IQZ A;  2FVR A;  1G4C A;  3CCM S;  3MOZ A;  2HZC A;  4OHZ A;  2CWK A;  1HI1 A;  3LQV A;  4RNM A;  2ASL A;  3D6H B;  1VOM A;  1EET B;  3M8P A;  3MMA B;  4I67 A;  1QSY A;  1T9V A;  4DV1 F;  3NLC A;  3N28 A;  3LA0 A;  4R25 A;  4R0J A;  2BDP A;  2W2O P;  3OUY A;  4WFA Q;  3M32 A;  2JLE A;  2ADB A;  2RIJ A;  4DU8 A;  7AT1 B;  4E98 A;  3UCU P;  2OKQ A;  2VZ9 A;  1I6J A;  3QNW B;  3DNC A;  3AOC A;  2BOP A;  5EUH A;  2BKO A;  3ENW A;  4M95 A;  2HHH F;  3AQO A;  5DZ7 A;  4KTQ A;  4FF3 A;  2W8L A;  2VFU A;  1U8S A;  2DHS A;  3DRS A;  2A0F B;  1S6O A;  2WON B;  3W5X A;  5D4O A;  1R7I A;  1WUU A;  1WC4 A;  4O4R A;  3GMG A;  3W3S A;  5DDQ C;  1OPI A;  3HJV A;  3PDN A;  1M5S A;  2RNE A;  1MWQ A;  1VQS A;  2E5L J;  2EEY A;  1NKC A;  1Q7L B;  2L9W A;  4ED6 A;  2DHX A;  3VAI A;  3ZFV A;  4DR1 J;  2QLW A;  3J7A N;  5DDO C;  4LF7 F;  2AYE A;  2DY1 A;  4R8U B;  1NME B;  4LF5 J;  2O01 C;  3W9J A;  2QLB B;  3S6E A;  3HSJ A;  2H4W B;  5DJB A;  1ELO A;  2HLT A;  4X2B A;  1XR5 A;  2Z2L A;  4FS1 A;  2C3M A;  1X4H A;  4NA1 A;  2NLW A;  2D69 A;  1SJR A;  2GW8 A;  4NLD A;  4NWB A;  1PIL A;  2RDD A;  1PBA A;  2W8K A;  3I9Z A;  3H98 A;  4DCP B;  1JJ2 R;  1OY6 A;  3BKF A;  1IM4 A;  4JV5 F;  4Y6I A;  5J2P B;  1FWL A;  3L9Z A;  1S0V A;  4DBQ A;  4C0H A;  2D3O 1;  2C2N A;  2DO4 A;  4FYD A;  1UWA A;  1IKX B;  1RYS A;  2XI2 A;  4CZC A;  1NRK A;  4RW4 B;  2DNO A;  3PHT A;  2HBQ B;  2XWX A;  3D68 A;  2HZV A;  1S48 A;  4LBP A;  1RWN B;  2IBK A;  5D3G B;  1QTM A;  2AW0 A;  4IKA A;  4LRB A;  1RAD B;  3T19 A;  1RT6 A;  4R5P A;  4NXM F;  1M90 T;  2CJA A;  3BSN A;  1HFE L;  3VGS A;  1ZET A;  3L7U A;  2AU0 A;  1QAY A;  3OFH A;  2MJU A;  2W7O A;  2FD2 A;  2RF2 B;  4DR7 F;  4CLZ A;  3WZ0 A;  1K73 T;  4QCL A;  5AJ3 F;  2PD1 A;  1UFL A;  2UUA F;  3SSS A;  4USJ C;  2NZC A;  4TU8 A;  1DFD A;  3FUY A;  4ZN1 A;  2XEX A;  3PRD A;  5AE3 A;  1UW9 A;  4YME A;  1PCA A;  1U49 A;  2ABY A;  1ZM9 A;  5D4N A;  4JOU A;  4DR5 J;  3J7Y I;  2UVU A;  3SCK E;  1X4G A;  5F8M A;  3RBE A;  2V69 A;  1Q82 T;  1TFW A;  2CDR B;  4GVB A;  3DGP A;  4DUY F;  4G3I A;  3M8W A;  2VPY B;  2HAI A;  2J5A A;  2AJ2 A;  3OJS A;  1TV6 A;  4L72 B;  4DV6 J;  3WDO A;  4HI2 A;  3BSO A;  1ULR A;  2SXL A;  5L8R C;  3HI9 A;  2I2Y A;  2DNL A;  1YDL A;  4RW6 A;  4U7U K;  2IVY A;  2KXN B;  4IOB A;  5CH7 B;  1O51 A;  2GJI A;  3BH7 B;  4ECW A;  1JLA A;  5J2Q B;  3W8G A;  1FJ7 A;  3SQG A;  3DCA A;  3VQT A;  4XTT A;  2DD8 S;  1FRX A;  2VBY A;  2MKI A;  1KC8 T;  3KG1 A;  4HKQ A;  4OX8 A;  1IM6 A;  4CLT A;  2CNL B;  4O23 A;  1LKZ A;  3W60 A;  5GVQ A;  3QFH A;  4UW2 A;  3CCS S;  4KC5 A;  2BJ9 A;  3A3N B;  2W4D A;  1QSS A;  1RTD A;  5KFQ A;  3D1H A;  4IQM A;  1JLF B;  1NKE A;  1ZZF A;  1E6Y A;  2E1C A;  2JWN A;  4C7Q A;  3U02 A;  4IG3 A;  5L1I A;  1JLC A;  3FQL A;  4CQ1 A;  1S1V A;  1SQE A;  1X0P A;  5KFP A;  1FDD A;  4O4G A;  3V6H A;  3OR2 A;  5HVG A;  3GCX P;  2J8S A;  3ITH B;  1H2T Z;  3B8H A;  4PXD A;  3MR6 A;  2DHA A;  4WFX A;  2IC3 B;  5KFG A;  3PYD A;  4ZVS B;  4AFF A;  3LP1 A;  3OHB A;  1EET A;  2ZC4 A;  2DIT A;  1L3V A;  4KB7 A;  5A0Y B;  2RU3 A;  5EWG A;  2HYI B;  1P6T A;  4ELU A;  3Q8Y A;  2HWI A;  5DS7 A;  4B9T A;  4OJ3 A;  1NBE B;  3CIZ A;  5H9F K;  3T5K A;  4B08 A;  5ETV A;  3NMA A;  3I87 A;  3ULH A;  3LF0 A;  1FE4 A;  3H25 A;  5J2M A;  3F56 A;  3TEG A;  2HS3 A;  4DV2 F;  1APS A;  4ED4 A;  3D3C J;  1N5S A;  3H2U B;  2R7W A;  4YY3 F;  1KRP A;  1ITP A;  2B8Q A;  2MPU A;  2XYG B;  5KFV A;  2YQ1 A;  1A0O B;  2YBV A;  2MLX A;  5T41 A;  4RUH A;  2VPX B;  1B7Y B;  1RBA A;  4CT8 A;  1HYS B;  2OH2 A;  4QIF A;  2ZOF A;  3ZTQ A;  1B0V A;  5D4L A;  5KFC A;  2K06 A;  1WOR A;  2WON A;  2L9D A;  2MKJ A;  2ZFH A;  2PDA A;  3SV3 A;  1UEV A;  2LA6 A;  1TKD A;  2MKH A;  1WEL A;  2GGP A;  1F0X A;  3MPU B;  2KFZ A;  3ISZ A;  3CUN A;  5F0U A;  1AUD A;  2EC2 A;  4EO6 A;  2UV8 A;  2X1F A;  3NCQ A;  4R8U A;  1QAI A;  4JI8 J;  2YY3 A;  3TP2 A;  3GR0 A;  2OPP B;  3CW2 C;  2XCA A;  2YKM B;  4KH1 B;  4O3R A;  1YVF A;  1R8H A;  1LXN A;  4P74 A;  3BZQ A;  3IN5 A;  4NA3 A;  1W2B R;  4CO4 A;  2DEJ A;  2IM1 A;  5LMU F;  3FJ2 A;  3OTE A;  1HNI A;  2Z56 B;  1HMV B;  4L6V 3;  4BWJ A;  2AHO B;  3HT3 A;  3BBB A;  2V63 A;  2KT5 A;  3HT0 A;  2YQ0 A;  4DV3 F;  1ZTW A;  4Q8E A;  5J2P A;  5HLF B;  1YJW S;  5IFM A;  3IM9 A;  3M4X A;  3M05 A;  3US5 A;  3CC2 S;  3I56 S;  2W4C A;  5IQQ A;  4Y2I A;  2I5J B;  3QMQ A;  1IJF B;  3DLJ A;  3DU6 A;  3BGO P;  3ILO A;  1EIY B;  2CJ9 A;  2XSJ A;  4WKR A;  1HQU B;  5D3G A;  2LEC A;  4QPT A;  1RZM A;  5KFA A;  3QO9 B;  2ROE A;  2DR7 A;  3HO1 A;  1Q95 G;  4HHH A;  3V5R A;  1LK5 A;  2OPQ B;  4X65 J;  1U8W A;  2RF2 A;  1S97 A;  1A9N B;  1NB7 A;  2CQ0 A;  4ZPV R;  4M5K A;  2GZO A;  2YWW A;  3OR1 B;  4OHV A;  2KU7 A;  4JI2 F;  5K9F A;  3OV7 A;  4YHH J;  1JLG B;  2LLZ A;  1KQS R;  4EWT A;  1F9F A;  3LPY A;  4DQR A;  2LYV A;  2EBG A;  1T03 B;  2B6A A;  3BYP A;  3VVT A;  2PO4 A;  3Q2T C;  3U7J A;  1W2I A;  2J9E A;  3J7Z T;  1RIS A;  2XLJ A;  3L3C A;  4UUX A;  2QC3 A;  2QRR A;  1FWK A;  4A8Q A;  3GIL A;  2CQB A;  2ZUG A;  2L08 A;  2IYI A;  4F67 A;  3GZ7 A;  3D1O A;  3UDL A;  3TA0 A;  5CYQ A;  2RSQ A;  3AJ1 A;  4WYL A;  3QGH A;  2ZEJ A;  1CPZ A;  2R2S A;  1MMN A;  3J80 U;  2W9B B;  2E9T A;  1YQH A;  5BYQ A;  2AEM A;  4P75 A;  5GAE U;  1X31 C;  1LQ9 A;  5J2Q A;  4ID5 A;  3IGV A;  2ZWO A;  1RWX B;  1LNQ A;  2RUG A;  1XQI A;  2VBW A;  3MAH A;  3ZTS A;  4ETZ A;  1X4F A;  3R8Y A;  1G6B A;  2CWX A;  4UQT A;  4RW7 B;  5KFE A;  2YWK A;  2FVQ A;  4QYR A;  3KHH A;  2BYC A;  1D3W A;  1EKR A;  2EG1 A;  4WTO B;  2F7V A;  1FCA A;  2YH1 A;  4A8O A;  3W7B A;  4X4P A;  1NK9 A;  5M2P A;  3HD1 A;  2XHC A;  1RTJ B;  1U2F A;  2H5I B;  1RT3 A;  3PTW A;  5KG3 A;  1VQ9 S;  3LH2 S;  1SKW A;  2QL5 B;  2Z4P A;  1VQY A;  2Z0G A;  3I4H X;  1FFS B;  4JV5 J;  2ZHO A;  2ZH3 A;  1WSV A;  1UPP A;  1RT4 B;  2NXU A;  1RXO B;  1V3Z A;  3GQC A;  4ZJO A;  4LR9 A;  1LWF A;  5A0Y A;  1JX4 A;  1X4A A;  4FYY B;  2XG8 A;  2XCP A;  1NDC A;  2JFK A;  3GJR B;  2M4M A;  3MEG B;  2PMW A;  2CVE A;  1WF1 A;  3E8O A;  3AT1 B;  3QZ7 A;  2X7I A;  1UFW A;  1HD0 A;  1RHR B;  3BQ0 A;  5LJ3 Y;  1TL4 A;  2GAH C;  3L95 X;  3HX9 A;  3R5A A;  2WVD A;  4WYW A;  4M5H A;  2CJX B;  1VC0 A;  3W2V B;  1WC0 A;  1NPK A;  4M63 A;  1X9S A;  3R5G A;  1HYS A;  5MAO A;  2F1F A;  4DHV A;  2ZBI A;  1AA1 B;  3D3B J;  2IRY A;  2ZH6 A;  1N5T A;  2PII A;  4IRC A;  1JNR B;  2R7X A;  1SJQ A;  2AEJ A;  1ARO P;  2B51 A;  4UTG A;  5HSP A;  2AGQ A;  1BHN A;  4I2Q A;  4WBF A;  1HI8 A;  5IOL A;  1DQ8 A;  3CWJ A;  3S01 A;  1IBM J;  1KQG B;  1EX8 A;  3K5O A;  3CED A;  3Q89 A;  5CXT A;  2JSX A;  4C6A A;  1AT1 B;  2YKN B;  2AV5 A;  3QRP A;  3BBC A;  4JI4 J;  2EK6 A;  2V4Q A;  5M2U A;  4J9Q A;  1SH2 A;  3SQO P;  1TQL A;  2YKM A;  4A48 A;  3IG1 B;  3H4D A;  3BGL A;  2LU2 A;  4CLF A;  4DUZ F;  4PQA A;  4GKK F;  2DXE A;  3MAQ A;  3PX6 A;  4ETX A;  3DYA B;  3R27 A;  4J91 A;  2RKI A;  2BUN A;  5C2C A;  5KFL A;  3BQ1 A;  1Q5Y A;  2KDO A;  2PFF B;  2QTW A;  2UZA A;  5HLF A;  3JAM U;  2OHD A;  4CLS A;  3NNH A;  4GO7 X;  4HT5 A;  1SC6 A;  1FXL A;  2I5J A;  2RB7 A;  3GJS B;  1NM2 A;  2FPH X;  2MHE A;  1QVG R;  1HQU A;  1H2V Z;  5EX3 A;  2VG5 B;  4DPT A;  3QO9 A;  2BKN A;  3GWC A;  2AJ4 A;  1XK8 A;  4IR9 A;  2OPQ A;  2MQN A;  1XMQ F;  3EZU A;  3BDE A;  2VD3 A;  3HHL D;  2PSZ A;  4DPW A;  1REG X;  2KJW A;  2O5D A;  4LRC A;  1MLA A;  2J6S A;  3OR1 A;  3T5J A;  1F3V A;  3ONQ A;  4WKY A;  2R42 A;  4FPR A;  3B82 A;  3FEY B;  2VG6 B;  3H20 A;  1UJ6 A;  2FLL A;  1YZ6 A;  2IFX A;  4ZVO B;  2N4D A;  1Q8L A;  1UPM B;  4NLW A;  4ED0 A;  1LWC B;  2CPX A;  4P6Q A;  4N8N A;  3DHX A;  2QYG A;  1WG5 A;  1VI7 A;  2J7K A;  2WZ1 A;  2GO8 A;  3HK2 A;  1HAR A;  2OFH X;  3CCT A;  2XMW A;  3CD5 A;  2LQ9 A;  3GIR A;  3HKW A;  4RKU C;  3WBZ A;  2XMU A;  3DFE A;  1S7I A;  1URR A;  4NYP A;  3SFG A;  2V6A A;  3KLI B;  3MR3 A;  5K8P A;  5IT0 A;  2L9N A;  3CJS A;  1YWX A;  5KT6 A;  1OJ4 A;  5KT3 A;  2IHR 1;  2B56 A;  3ZZY A;  4ED2 A;  3M8S A;  1SL0 A;  1NSK L;  2AT1 B;  4OZ5 A;  1RI7 A;  4C2M A;  3KKF A;  1E6V B;  4LBI A;  3LWM A;  1EAR A;  4I1T A;  4CO0 A;  1M0S A;  1R8P A;  3R1H A;  1F9E B;  1KFS A;  4OI0 A;  3G86 A;  2DNH A;  2ACY A;  2BM1 A;  2L48 A;  4S0M A;  2XZD B;  3CDU A;  3K8W A;  2GHV C;  1J5O B;  2B7B B;  2WBM A;  4QIV A; 
#chains in the Genus database with same CATH homology
 5LM7 E;  3R2D J;  3JAM U;  4B3T J;  4KY3 A;  3OTO J;  2MTL A;  4AQY J;  5IT9 U;  3W1Y C;  3D3C J;  4NXM J;  4K0K J;  4JI6 J;  1N33 J;  1I94 J;  4LFC J;  4JI2 J;  4RJV A;  2VQF J;  1HR0 J;  4JI3 J;  4KHP J;  4LFA J;  2UXC J;  4LF7 J;  3D3B J;  4LF9 J;  2UUC J;  4DV0 J;  4DV7 J;  4JI7 J;  4DR7 J;  4JYA J;  4LF6 J;  5LMU J;  3IMQ J;  4LF8 J;  4V1A k;  5BR8 J;  4GKJ J;  4JI5 J;  4DV1 J;  4B3R J;  1HNX J;  4DR6 J;  5AJ3 J;  4DR5 J;  4DV2 J;  4B3M J;  1IBM J;  2MEW A;  4JI0 J;  1J5E J;  4JV5 J;  1XMO J;  2UUA J;  4DV3 J;  4YY3 J;  4DR4 J;  1HNZ J;  3J81 U;  2MQ8 A;  1N32 J;  4JI4 J;  3T1H J;  4NXN J;  5LMN J;  3J80 U;  4X66 J;  5A2Q U;  2KVQ E;  2UU9 J;  4DV6 J;  4NEY A;  4DR3 J;  2UXD J;  2VQE J;  2HHH J;  5FLX U;  4KYZ A;  4X65 J;  2ZM6 J;  4LF4 J;  4DR2 J;  1FJG J;  3R2C J;  4DV5 J;  2UXB J;  4JI8 J;  4JI1 J;  5IWA J;  2KL8 A;  4X62 J;  4DUY J;  1XMQ J;  2E5L J;  2UUB J;  4NEZ A;  4DV4 J;  3T1Y J;  1IBK J;  4B3S J;  4DR1 J;  1N36 J;  4OX9 J;  3J7A N;  4YHH J;  4PWW A;  4HHU A;  2F4V J;  4X64 J;  1IBL J;  4LFB J;  1XNR J;  4LF5 J;  4DUZ J;  1HNW J;  1N34 J;  4GKK J;  1XNQ J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...