2KVQE

Solution structure of nuse:nusg-ctd complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
80
structure length
80
Chain Sequence
NQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRSRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A NusE:NusG complex links transcription and translation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords NusE
total genus 16
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2kvqE00
2E5LJ 4KYZA 2MQ8A 1IBKJ 3IMQJ 1XMQJ 4NXMJ 4DV7J 1XNQJ 4B3MJ 4X64J 4PWWA 4LF6J 4K0KJ 2KVQE 5BR8J 4JI0J 4LF7J 5LM7E 4JI7J 3D3CJ 5IT9U 4LF4J 2UXDJ 4JI5J 4HHUA 4B3SJ 4DV1J 4LF8J 1IBLJ 1XNRJ 4DR7J 4X62J 2HHHJ 2UUAJ 4JI8J 1FJGJ 5AJ3J 5A2QU 1XMOJ 4DUYJ 4DR4J 1N36J 2UUCJ 1HNXJ 3W1YC 3D3BJ 4DV4J 4GKJJ 4X66J 4LFCJ 4LFBJ 4DR3J 3T1HJ 4B3RJ 5IWAJ 2UXBJ 4DUZJ 2KL8A 4DV3J 1HNWJ 3R2CJ 1HNZJ 4DR6J 4V1Ak 4JI1J 3OTOJ 4DR5J 5LMNJ 2VQFJ 5LMUJ 1J5EJ 4JI3J 1N33J 1N32J 3R2DJ 4KY3A 2VQEJ 2UUBJ 3T1YJ 1N34J 4DR2J 4JI6J 4YY3J 4DV2J 4DV6J 5FLXU 3JAMU 4JV5J 2UU9J 4NEYA 4DR1J 4NXNJ 4X65J 2MTLA 2ZM6J 4NEZA 4OX9J 4YHHJ 4LFAJ 4LF5J 4DV0J 1I94J 4JI4J 3J81U 4DV5J 4LF9J 2UXCJ 3J7AN 1HR0J 4GKKJ 4JYAJ 1IBMJ 2MEWA 4AQYJ 4KHPJ 3J80U 2F4VJ 4B3TJ 4JI2J 4RJVA
chains in the Genus database with same CATH superfamily
1WF0A 3DLHA 3EXCX 4YEAA 4NX9A 3IBFB 4JI5F 3TJAA 4EYHB 5J2NB 3MCNA 1L3SA 4X65F 3AXKA 3KLEB 3KLIB 1RWNB 1H2TZ 3NP5A 4RW4A 5M2RA 1TQLA 2C1EB 2OPPA 2IBOA 1FCAA 1DBDA 2DEJA 4OYWA 1RAAB 3QAEA 4LBIA 2EFNA 4URSA 2KT5A 2W4DA 4NA3A 3RUBL 4AL7A 2CJAA 2V94A 2RUSA 2DGWA 5CYMA 1EKRA 1AFJA 3MM6B 3MAAA 2OPQA 4G1QA 3GJRB 2RS2A 3EZOA 4H4KC 3CPWR 2QA4G 3QLHA 2NUHA 5D0RA 1S7HA 4ZVEA 1VI7A 2UUAF 3BH7B 2EEYA 4I2PA 5EDWA 2QYCA 3HT0A 5HQMA 1ZOTA 4OI3A 2ZH6A 5KFXA 2OPPB 2RAQA 3B54A 5H9EJ 1TKDA 1NPRA 3DDIA 4HL9A 4C98A 2YX1A 4QIWD 4RW4B 5AXKA 1ZPVA 4XIUA 2XGPA 2QL7B 2HZAA 3G87A 3KK1A 1RT3B 3KUHA 2EKYA 2OMOA 3R6GB 4DV2F 3UE2A 2V8GA 3KUGA 3L4BC 3QSIA 2FVSA 2HVHA 3M6XA 1YVFA 2FUG9 2J9CA 1YTYA 1S4FA 4A47A 1DURA 2VG5B 2YXLA 1L5UA 4JI8J 1NPKA 3L3CA 2DR7A 5DZ7A 1S10A 1Y0HA 3CCVS 1NKBA 1J5EF 3FKBA 5HMXA 3GJTB 4WE1A 2UUCJ 2CQ3A 1U45A 3DLGB 2FLOA 4LQ9A 3D0HE 3PNIA 5KFHA 4J9NA 2CJBA 5HP1B 1CJKA 1MG7A 4CLLA 3W3SA 2C3PA 2GA7A 4WYLA 3OSPA 1SH2A 1SCJB 3UDEA 1H74A 4B3SF 3C19A 4DI6A 2G1DA 2QO3A 2ZJRQ 2DCLA 3V6DA 1TKXB 5DETA 1TK0A 2RQ4A 4EZ9A 3HVTA 4DU7A 2SXLA 3NEKA 1YGYA 1N32F 2I0XA 3D1QA 2HQCA 4LRAA 5B0BA 3SCIE 3G2XA 4B3RJ 3RBXA 2FYXA 4B9LA 1UMJA 4XAKA 4Y2IA 3UQSA 3KOAA 3PW4A 1QSSA 2CQHA 1RXOB 5CABA 3OVBA 4Y6IA 5FJ4A 1Y11A 4IYQA 4RUAA 4OFZA 1R0CB 3M2VA 2ZZNA 3CXCR 2AHOB 1PYTA 2AEFA 2GO8A 2HSEB 3HX9A 4V1Ak 3AJ2A 3BO2A 1VQ5S 4KO0A 4C0BA 3GV7B 3KHLA 4X4RA 3JYTA 2G2YA 4QYZK 3TAQA 4XTTA 1C4AA 1SIZA 3MMJA 1IBKF 3G8SA 2HNYB 3CDAA 1EX8A 1WI6A 3QIPA 2OKQA 3K2YA 3WBZA 4QWDA 3PYGA 4X4TA 2DY1A 3W66A 2HWIA 2QMUB 3LP0A 1P9YA 2RRBA 4NLXA 5D0GA 4USMA 1QSYA 4A8MP 1R8HA 1QY7A 2HK3A 3F73A 4DL4A 2GQQA 4XPCA 3M8PB 1RT5B 2BM1A 3QZ8A 5B0CA 3RTVA 1N0VC 1PIEA 1ZPWX 2CWKA 3W7BA 2LQJA 2CPXA 5JVGQ 2GGPB 4NEZA 7FDRA 2UUCF 2QC3A 5HI7A 4LF5J 2JH3A 1AB8A 1YSJA 3BR9A 5I3PA 2WOMA 1S7IA 3TAMA 1QD1A 1S77D 4QU7A 3HCXA 4JI0F 3HSJA 4FNHA 1UVMA 1L3VA 2CQDA 4QYRA 3MTJA 5E3CA 3OR1B 3TRGA 1K44A 3ZTPA 2RQMA 3C15A 3KTQA 5C5JA 4EBDA 4KGZB 1Y5IB 5GMKa 1TKTA 4B3TJ 1QLNA 3KG4A 2AEJA 4H4MA 3IS9A 3CJRA 1G1XA 1MN9A 1VS3A 1LKZA 2OD4A 3CC4S 3Q89A 3UCZP 3BR8A 2CQ2A 1RT4B 4TKTA 3CCRS 3ETMA 1RHMB 2OLWA 2QLXA 1F3VA 1K1SA 2I8EA 4USUA 3PKYA 3KLGB 1Q7LB 4H54A 4NCGB 1R8AA 4O44B 3R1LA 1UVJA 1OPIA 3FBCA 5HJYA 1NRKA 2KJWA 3BB5A 1EETB 3SCJE 3BQ1A 2AYEA 3C66A 4AQYF 4LIWA 3VGVA 3OXFA 1UJ5A 5U47A 3AD7C 3VZHA 2GIFA 3D3CJ 4MK9A 5JMNA 3UPFA 1AT1B 3C8YA 1LXJA 1NKCA 2J6SA 2FDNA 5KFTA 3C14B 1FJCA 4H4OB 4ZK7M 4FF3A 3J7YI 3KJQB 2MPUA 3PYEA 4P73A 1FKOA 2F40A 2DGVA 4WKRA 4DX6A 1AW0A 2HWTA 3OVSA 5L38A 1BUXA 2FHOB 1VQYA 1VRTB 3OTBA 3NLCA 3FEXB 3D0IE 5KG1A 3BSOA 4J9KA 3PCOB 4HLBA 4F4WA 4LF8J 2VH7A 3OUYB 4OX9F 2KXHA 3CJQA 4EO6A 3AJDA 2HNDA 2XO6A 2CQIA 2IM2A 2XC9A 3VAFA 1TV6B 2YY3A 3BSCA 2BZ2A 3FC9A 2C3YA 4H4OA 4NZ7A 1KVJA 2IRXA 1X5OA 3NS7B 5I3UB 4NLGA 1WDDA 4N7TA 1O0PA 2CRLA 4QIVA 3DRPA 2OMLA 4ZCLA 2ZH1A 2BJ3A 1N36J 4EEYA 2CG8A 3CW2C 2DT9A 3KG0A 4IR1A 3B78A 4JV2A 2BQUA 4USJC 5A8RA 4KKOB 2UVUA 2D41A 4N77A 1SH0A 2V2QA 3EZUA 2HGLA 2BACA 2E7VA 3V4MA 4F2SA 2DHHA 4Q7AA 3OUYA 3VGTA 4I64A 3DM2A 4RKUC 2QLFB 2G0CA 1K73T 2CJ9A 2G0JA 3OJSA 3P8BB 4FVMA 1FNXH 1FA0A 3AA9A 1UP1A 2H48B 4H4MB 3MOJB 5F3TA 1S9GA 3ZNUA 5K14B 4A8FA 4WP8A 2IVYA 2M70A 2IAJA 3CIMA 4DWIA 1PC5A 4Y00A 2NSCA 4WFNQ 5DDPC 1RWPB 1UTAA 3C16A 2W4PA 4NYPA 1HNVA 1RACB 1U6FA 2F9JA 4Y2KA 1S6QA 3GZ7A 2KFYA 1HNZJ 4DEZA 2BW7A 8RUCA 1RISA 2EC2A 1YJ7A 1U6BA 3Q23A 3ETOA 3W2VA 1F3FA 2XMJA 3D0GE 1PJ5A 2AJ0A 2J9EA 2DIUA 3DRXA 3OHAA 4USTA 3M2RB 2XY7A 1UAWA 1SC3B 3TOQA 4RU2A 3M8PA 4IQXA 2QGFB 1S1XA 3NGTA 2IVMA 3G9CA 2DK2A 4ZOSA 2GJFA 3RB0A 3QAUA 2GS8A 2ZH8A 2KFNA 2ZWPA 4K4UA 3FZ2A 4ES3A 5FLXU 1KFSA 4RX6A 1E6YA 4IFVB 4DR1J 4DOZA 1FE4A 3HFKA 5E33A 2GHPA 1TKTB 1NDLA 2F8MA 1VBYA 1CVJA 1VQLS 4KAIA 5HVFA 1RT2A 2CG4A 3OR1A 2L41A 1CJUA 2Q1LA 1XC9A 4GC7A 2XB2D 3CTRA 2W7OA 1FDDA 1LW0A 4NLTA 1X0FA 2ZH4A 1NK9A 3I4HX 4QWBA 3TAPA 1J5OA 4CLZA 4TXSA 4DUTA 2C28A 3HHDA 4NLDA 3ZZTA 1KHVA 1F5CA 4UTGA 4KHMA 2AYBA 1DTTB 4QWCA 1FKPB 1RAGB 4WP9A 4Y2AA 2VQFF 1RT5A 4OYXA 3QT6A 1TAUA 3IG1B 1TMJA 1FRHA 1TL3A 2ZVIA 2OD6A 3HVTB 3UR3C 3TUZC 2BUNA 2P6TA 5KT7A 5F8MA 5IQ6A 3IWLA 2XGQA 1ZYQA 2B51A 3T1YF 3VAGA 2QLBB 4DF4A 2JOQA 2AJ2A 4HACA 4P75A 1FNOA 1UPPA 1IBLF 1RKIA 4USHA 4E8UA 4B3MJ 2DH8A 1I5OB 1S6UA 3IAS9 5MLCV 4F4XA 4DR5F 3A4TA 3R1HA 3DLGA 2EKNA 4TLQA 3ZFVA 2FJAB 2CKWA 3J7ZT 3R9LA 4UQTA 2BV3A 3UN5A 4CO4A 4C0OC 2DGTA 3IO1A 2KVQE 4KGVB 2B5JA 3CWJA 2C2OB 3F56A 3NY0A 2YKMB 5T14A 2V2VA 1VRQC 2MLZA 4Y3CA 1NEEA 2CA9A 4DX5A 5BYQA 3NMRA 4QIFA 3GP9A 1ULRA 2M2BA 3MAHA 3MDFA 3TZZA 2H3EB 1HI0P 2ZHOA 1QUPA 4RWWA 1RT3A 1PGZA 2AQ4A 4TQRA 2HYIB 3K0JA 2DIVA 1FFSB 1UL3A 2XHWA 4IG0B 2XY6A 3HZGA 5GMEA 1X9WA 1TZ0A 2DBBA 2IYIA 2BA9A 2Z2LA 1T9VA 5HSPA 4LF2A 2UVRA 4ELUA 4QQBA 4F2RA 3CJ2A 1RT6B 2GHVC 2KHCA 2V63A 3E8OA 3JSMA 3R8YA 5A8KA 4JV1A 2QJ3A 2HBZB 4P71A 5DDRC 1C0UB 2PMWA 3AD9C 2OPQB 4EUVA 3M6WA 4OJ1A 1FJGJ 1EQMA 3MEGB 3OR2A 4G1IA 4J9MA 4RW8B 3LP2B 4FVCA 2MKKA 3AT1B 1UZDA 3KNGA 1Q82T 3RW6A 1VQPS 1APSA 1U0HB 4DZDA 1C1CB 1TR0A 3DOKA 2YWWA 5HROA 4WFZA 4DMZA 2E5LF 1NCLA 2WB1D 3T1AA 4DPOA 2HZCA 5CCMA 2W2QP 4KHRA 2PI5A 5E0OA 2B9WA 3KK1B 4V19J 3VAMA 2LU1A 2R8KA 5HROB 3DNCA 3G8TA 4K2JA 1HL6A 2CVIA 4FXDA 4TYBA 1F2HA 4RW6A 3HJFA 2Y8WA 1HBUB 3R5CA 1H6KX 3FCHA 3IR6B 1N88A 4PG7A 2PA8D 2GNKA 3W63A 5CQGA 1G3OA 2FHKA 2XYPB 3MCOA 4OLOA 1N8RT 5CZXA 1JKHB 1KWMA 3MAAB 4G1QB 5IT0A 4DR6J 4NCBA 4C8KA 4RNMA 2VODA 3OTOJ 3I56S 3JSMB 3LANA 3IM8A 4JI1J 1T0TV 4EO8A 4ECWA 2RHSB 2BE2A 2G1HA 2ZFHA 3DC2A 5FLXY 2QRRA 3UD3P 2M8DB 2CPIA 1FRKA 3KLIA 1AROP 3MMAA 1GT8A 4WCEQ 2KXNB 3KLEA 3OLAA 3MUTP 5L1JA 3ET6B 2HVDA 2UXDF 3GIJA 3KUEA 1GMUA 3BGRA 2VBXA 4DR7F 1TVRA 1PYSB 3UVJA 4C0HA 4U8VA 3CJTA 4CTAA 4LR9A 2RILA 4W98A 5KG5A 2QT7A 3OJUA 5KG7A 4DFPA 4B3OB 2NXUA 2QA1A 1FXDA 4KV8A 1BWVA 3W5YA 2QZ8A 3M32A 4ZN3A 3SXLA 3OBIA 2VQEF 5DLFA 2C2EA 1SL1A 2MKCA 1HBOB 1L3UA 4C8YA 2HMIB 3DOLA 4WBFA 1WF2A 2OELA 1FX4A 3MM5A 1N5YA 2HVZA 2G2OA 3AXMA 3HSZA 1WKKA 2LA4A 4OZ5A 5LT5A 1N34F 2FJXA 1HBNA 1M1HA 1FJ7A 1FRJA 1VK8A 4NLRA 3U27A 1M5PC 4HT7A 5KOXA 1TL1B 2X3GA 5KOWA 3KK2B 2FY8A 2U2FA 2VL1A 4WKYA 4KC5A 2JZ5A 2VHGA 4JBCA 3HVAA 4KBIA 3IGVA 2F7VA 3DHWC 4FNIA 2ASYA 2DY9A 5KG0A 3BO4A 2MZJA 2C2ZB 1U8SA 3BPSP 4MFBB 4DV7J 1KKHA 4ECZA 2GFFA 4QR1A 1OPZA 1YRUA 2ALYB 2J9DA 1VYAA 3IA0A 1A6LA 1LW0B 1T95A 3LAKA 1KQKA 3H5YA 5DM7Q 1P9QC 4MMOA 1HPZA 3IM9A 1WDTA 3LPEA 4GVBB 3UCUP 4A8OA 5BR8J 4JI0J 1WOPA 2LVWA 2V6AA 5FD1A 2WVEA 1AZSA 3PXGa 2ATCB 1D8YA 4ED0A 4PKDB 1GFWB 2CPEA 1M5SA 4OI4A 3ILLA 4ZIVA 2R2RA 5L1LA 3SV3A 3UNYA 3V4IA 2GVDA 2KN4A 1V3SA 1G4CA 3HHLC 5DGBA 2A2CA 4HHUA 4TQSA 3RJMB 2BOAA 2IM0A 1Q0NA 1D8ZA 4B3SJ 1TELA 2GHWA 4CT9A 1U2CA 1RB0A 4DU8A 4A8YA 4PABA 2C22A 3KK3B 3GG0A 2P9CA 1RTHA 4F26A 4B3RF 5F8HA 3H5XA 3B6BA 2RVJA 4FYDA 2FVPA 4P74A 3SSSA 2KRBA 1F60B 2V2ZA 3PTWA 2IDLA 1OYDA 2AU0A 1U02A 2YH0A 2ZE2A 3C6TA 3E3XA 2WW8A 1IQTA 5E3RA 4CM0A 2KFZA 4M8LA 4B17A 4A8WA 4DLEA 1HPZB 3P5TL 4C11A 3CJ4A 2N3LA 3RB4A 3B4DA 4CDIA 5K8MA 3EPGA 1EQ0A 3MPWA 1BE4A 1NHUA 1GEHA 4ITSA 2IMOA 4DR1F 3DM2B 4MFBA 4F0MA 3SI8A 2I9SA 4KHPF 2RKIB 1UW4A 2DCUB 5ETLA 2COLA 4G65A 4BHQA 5KFYA 2RT3A 1GX6A 4F4ZA 3MXHP 2EFOA 4LFCJ 3GU0A 3BF4A 4KKOA 4DR6F 2YKOA 4QR2A 4ZVUB 2Q6BA 3KK2A 2YTCA 3QZ7A 2MB0B 3MPUB 1S79A 4YR2A 2CAJA 2QMWA 3PX4A 3SFUA 3CCWA 3TUJC 2KM8C 1WC0A 2OPSB 2V67A 4OI1A 1MMDA 4FYWB 4LSLB 3MWBA 5B0FA 2B4VA 4C3MA 4ZVHA 3M9NB 1N56A 1XNQF 4UF4A 4DQPA 2OEMA 3PRDA 2I38A 1DHMA 2F1FA 1FDNA 3M32B 5KFSA 5LMUJ 1MWZA 1J5EJ 2JLEA 4JI3J 4HI1A 1GH8A 4MKVA 1TFYA 3T1HF 2FVCA 1HHSA 3R2DJ 2I5JA 3MOZA 3O44A 5ETMA 2ZITA 1IVZA 4K4TA 1YIJS 1FRMA 4CTAB 4QPXA 3DFEA 2DNPA 3KHHA 4WXOA 1SJQA 5A6PA 5HMZA 2WVCA 1IM6A 2H4YB 3K5PA 2RQKA 3HHNB 4DV6J 2XMVA 1T9UA 2GMHA 5HQLA 2Y1IA 4R5PB 4P6QA 4RUCA 3VAHA 3HVRA 4BC7A 1IWAA 2R8GA 3ZZRA 1F5AA 3AODA 1KC8T 2MQPA 1I94F 1T02A 3EUNA 3NAHA 2W2MP 5IT4A 1UVIA 3AAWB 1S1WA 3QPIA 2MZ1A 4M5LA 1JJ2R 3DMJB 5E41A 1V5IB 2ZH2A 4DSLA 4DN0A 1AFIA 2MKYA 4QOTA 4C97A 5KG3A 2DGXA 3VCDA 3ZC4A 4O3NA 3GPAA 5DDQC 1HI1A 3EZ5A 2VJUA 1U1MA 3MM8A 5D3GB 1RTDA 2GVZB 5L9NA 2JEIA 4F3QA 4B9TA 2RH3A 1RT1B 2KJVA 2F9DA 4BCAA 5CA5A 3IS9B 4NA1A 2VICA 4DSEA 4ECUA 2OTJS 2Y9HA 2E5LJ 2OJ3A 2F63A 3DRRA 2MJNA 2ZEJA 1JLBA 3D28A 2YH1A 3QT8A 1RU2A 1NNDA 2UVWA 1Q95G 2Z2YB 1IKWB 1G7CB 3ZZUA 1FEHA 4AD6A 1AUSL 4DCJB 3HM9A 2DR5A 4ED7A 1U0HA 1ROFA 2WOMB 3BBBA 3CMAS 4R25A 3ZTQA 1VQ8S 2D3UA 2PD1A 3BKUA 3H8YA 1RTIB 1ZH5A 2G0IA 4DV5F 4LF7J 3R5DA 4HH1A 4MK7A 3BJYA 3PYFA 4ID5A 3BSAA 4HDHA 3W61A 3QGGA 3GIIA 3GFHA 1C0UA 5DG7A 4HYKA 2AD9A 4LFAF 3AB4B 4PG8A 4EFAC 1XJWB 5B08A 1NSPA 3THTA 4ECQA 4U95A 1EAYC 2DHSA 1X5TA 2MLYA 3G82A 4E0DA 3KKFA 3CC7S 2VV5A 2AEMA 2BEFA 2K8GA 3IC1A 4MIAA 1Q8IA 1UWBB 3I4PA 3CCLS 2HNYA 3DLJA 1CSJA 2L9NA 4I2QB 4MKAA 3RGIA 5J1EB 2HHQA 4I6YA 4ECSA 3SDEA 4PPZA 2WSEC 3MPDA 3W9JA 3KMQA 1HMVA 3ZTOA 2J76E 4KO0B 5C24B 2KO1A 4DSFA 4WFBQ 3L95X 4Z7CA 2HGMA 3T5LA 4GRSA 3UI3A 5KFPA 3HFVA 4B3MF 3W62A 1RLDA 2GV1A 4FN5A 4FS1A 1LFPA 3U1NA 3K59A 1LW2A 5HMYA 2EK6A 1KQGB 2Z56B 1DJ0A 3TZYA 3DYAA 3X1LB 4ANEA 4DG1B 5A76A 2IY5B 2HBYB 3CF5Q 5GAHU 4F8RA 4DV3F 1SKRA 1SKSA 4FS2A 1TKXA 4OYZA 4P10A 1HNXJ 3V2UC 1S0VA 2B9YA 3D3BJ 2DXFA 1BLUA 3SMZA 1GXTA 5J2PA 4DJBA 1U25A 2HHXA 1CEZA 1R3NA 1OQ3A 1HNWF 3IG1A 1C1BA 2ZZTA 3MPYA 4FYXB 4WFXA 1NUEA 1N5VA 1LW2B 3PM9A 2B8PA 2EWHA 2HS0A 2YQ0A 3Q8YA 3QMQA 1T05A 4TY9A 4NXMF 4MIBA 1UEUA 4NMLA 3Q24A 2DKOB 2WRMA 1RTZA 1FO1A 5DDOC 2YWEA 2VA2A 1A7GE 2NXCA 3RW7A 2XNQA 1RWMB 5CCLA 4DQRA 1JLEB 1KHWA 2LEPA 5J1EA 4JI7F 2XHCA 4I2QA 4ANDA 2WHOA 3GYGA 2UUBJ 1UWBA 1KLMA 1E6YB 2FHJD 2W7AA 4IFVA 4DZ6A 7AT1B 3RR8A 1RAEB 2M7SA 1RAJA 2PC6A 1VQNS 1NAQA 2FC9A 2J7KA 3GV8B 2DRBA 3EGVA 3P49B 2E5HA 4JV5J 4G3IA 1D3WA 2UU9J 2CPDA 2W2PP 1FTRA 1U6ZA 4UOFA 4LRFA 1S1XB 4NXNJ 1C2PA 1RA7A 2LA6A 4I6WA 3WDOA 1Q79A 2LQ5A 1Y10A 3M8ZA 2AJ1A 3CGIA 4PCQA 2K7JA 3M30A 1JNRB 2YPZA 4LJMA 3M8WA 3JQKA 3N5BA 4ZLPA 2X1GA 1JXLA 5BJRA 4Q0BA 5EGYA 2E5GA 4DPUA 1MU2B 2M8HA 1X5PA 4U7UD 5GAEU 1QE1A 2HEKA 2NLWA 4K50A 2J0WA 1QJHA 5J2NA 2BKOA 3PFEA 2P5VA 1FVQA 4NLOA 5BYSA 1KTVA 3D66A 2R9LA 5ETNA 4RJVA 4I56A 5IC6B 2HLUA 3N4WA 5LMUF 1P6TA 2PMHA 3W9IA 3IBCB 5HVGA 3GJSB 2MJUA 2POKA 2MQOA 2RF2B 2A1BA 2B6AA 1W2BR 3HO1A 2W7PA 4WWSA 4USVA 1CG2A 4IRKA 4M1KA 4MKBA 1U09A 1X31C 1SQFA 5SUHA 5KG4A 2NPIA 2EXUA 1JJCB 2JHEA 2DGOA 2BKPA 1P27B 3R5AA 1Y3KA 3ILIA 3CJKB 5KFMA 5H9EK 1D9DA 4Z2XA 2EFVA 3UNGC 1ZZFA 1XEZA 2V8PA 4O0IA 4CLKA 3FSYA 4DX8H 3AY0A 2DNZA 2E7WA 3GWCA 4YB5A 3RBZA 3H0PA 3HP6A 5CYJA 4DUYF 1KD1T 3CO9A 1OY8A 3NGUA 3BGFA 5J2QB 2CPZA 2AYMA 4J7CA 3SIPB 4D3GA 2OFGX 3E51A 3FMWA 4I1TA 4CLPA 2R2TA 1JLFB 3LUYA 4JI5J 2HHWA 3HD2A 1YX2A 4DCPB 2XLJA 5RUBA 1DY3A 1FD8A 1FVSA 2BANB 1FRXA 1HHQA 3SV4A 1V6HA 3FSXA 3I5CA 3N5FA 2A6MA 2YPYA 2BJ8A 1VRUA 2ZOGA 3C14A 4O23A 4ZDNA 5KFEA 3N79A 5AJ3J 2WONB 2UUAJ 1S9FA 4Q45A 4PXEA 2MGZA 4NA2A 4UOHA 1HYSA 3BGUA 1HQEB 2DITA 1S97A 2XMKA 3D9BA 4Q8EA 1FWKA 3H2VE 1RSCA 3Q2SC 4ANCA 5F9LA 3M4XA 3HMJG 3AA8A 4FXWA 5LXYA 1NDKA 3J80Y 1HA1A 3OHBA 3UW1A 5DJBA 2CPJA 1RHRB 3B82A 4A8QA 4I0WA 1ZZNA 2R7SA 4RW7A 2J0QD 2LFVA 2MHNA 4L6V3 3PVXA 1BQMA 3HULA 2EFGA 3EX7B 4X4SA 1X4FA 2M3DA 3MMBB 1JLGA 4PG5A 2YKAA 3R7SB 3RBEA 3LP1B 4IFYB 4ZPAA 2RQCA 2UUTA 1ZA1B 3I55S 3TEHB 1JMTA 2CPHA 3I5AA 4FYVB 3ZTRA 3C6TB 1RABB 5ETKA 4NOHA 1J2VA 4F25A 1UJ4A 2J0XA 3Q8PB 3BN7A 2GQ2A 1RYSA 3TUIC 4OLPA 2W9CB 2VOOA 2E1AA 1RA6A 4ECTA 3TA1A 1FDBA 3IWNC 3PV8A 3UD5A 3MEDB 1Z4UA 2GGPA 3QWUA 2UXCF 1U1QA 2QSWA 5ADZA 3M9OB 4IR9A 1VQ6S 2DB1A 1XK8A 1N32J 4PR6A 4WF9Q 1WF1A 4OZ3A 5CD4A 1XMQF 5DQIA 1N34J 1BQXA 3WX8A 2D3OR 3MGJA 4KE5A 3P5BP 1TU0B 5HBMA 5KFIA 3M6UA 4RNHA 5KTQA 1NSQA 2HS3A 3KFWX 1T3NA 2B9EA 2QE5A 3M1VB 3PDNA 3HI9A 5KFQA 1W26A 2HVIA 2FJVA 3QIPB 2QMXA 4I68A 4LUBA 2EC0A 1WSRA 3P6YC 1HQ2A 5I42B 4F4KA 2Y3YA 1S9EA 4URQU 2ASJA 1TUVA 2E9ZA 1BD6A 2VIHA 2ZM6J 1T9WA 2Q79A 4ALZA 5KT4A 1FESA 2CZ9A 5K9FA 5LXRA 2LDIA 2Q43A 3RBDA 4U67Q 2K3KA 1S0MA 4DV7F 4JI3F 1VK3A 3WX4A 4PXBA 2LP4A 3GLJA 2CXEA 1R8PA 3DGPB 4MJKA 1NDCA 2PEBA 4DFJA 3H2LA 2ZDPA 1IBMJ 1CJTA 1NK0A 2HAIA 2Y0SD 2CQPA 3K5LA 2DXEA 1SJFA 1QSLA 4H4KA 2Z8QA 3K7RA 4JI2J 3QQCD 1KVKA 2C3MA 3DU6A 2VDHA 2NQPA 2RD5C 1TL1A 4IH7A 5AE2A 1UVKA 3DOMB 2QYGA 2IC3B 2JFKA 1T7PA 2LQBA 2KZMA 1WEYA 5K8PA 3KLHB 3CE8A 1HHTP 3QATA 4PPDA 2R8IA 3CC2S 5DQGA 2BM0A 4PZVA 4N41A 1SJ1A 2BW2A 1VIXA 2GIQA 3UD4P 2XSFA 2V9KA 4O3PA 4X64J 2R3VA 4ZLLA 2GIRA 3KG1A 3M9MB 2JLGA 4R8UB 2A6OA 4ZCMA 1KVIA 1R6YA 5F0UA 4K0KJ 2O3DA 5GMDA 4TU7A 1F9FA 2AX1A 3OFFA 1VQ9S 3KJNB 5G0RA 2VG5A 4IRCA 3DU5A 4L3NA 2Z2MA 3RB6A 2FTRA 1SC4B 2NCKL 2OEJA 1RHUB 1WOSA 4ZVGA 4CYUB 1O51A 2K7KA 1Q1KA 3BGRB 4QIGA 2Y1JA 1MROA 3ET6A 1NJIT 4IO1A 2LLZA 1IR1A 4OI2A 4K0KF 1RWXB 2IM1A 3TJ8A 4PRFA 1SC1B 4AE5A 4OQJA 3DN9A 4NXNF 4ZP9A 5IV3A 2FZGB 1NK7A 3D7SB 1DLOA 1S5ZA 1WWHA 2MQMA 4I2PB 1PCAA 2ZH7A 4ELVA 4JV5F 5D4OA 1SVDA 4K4SA 2P8IA 2B43A 3P3DA 3PW5A 3H20A 1FKAF 3BZQA 3ENWA 3MM6A 3GR1A 1GXUA 2BRKA 3MR3A 1R31A 1D0EA 1CJTB 3QIDA 1XMOJ 1H2UX 3WIVA 2IDEA 3WIUA 6AT1B 4O3QA 3MFHA 2PMZD 4TNOA 1H73A 2AKWB 1IKVA 1UA1A 5BR8F 1NU4A 5J1PA 3G6XA 2AGQA 2F8HA 4OYBA 1UFLA 1FF2A 5B0DA 3M6VA 1D9FA 3VAKA 2K1RB 4IUFA 2CPYA 4O3OA 3KLFB 4WIIA 3TW0A 1HQUB 4DV1F 1JX4A 1N0UA 2WVFA 1YBAA 2YBVA 1JK9B 3LOUA 3MHYA 3E01B 4Q2MA 1JNZB 4OYPA 1Q5YA 3W60A 1YBUA 2FB0A 5B09A 4DL5A 4DL3A 5J2MA 5CXTA 3HSDA 3T1HJ 4MTPA 3PR5B 1P8GA 3DRSB 3FGVA 3MTKA 3VV2B 3NS6A 4EK2A 2UZAA 2KG0A 3NL0A 1S12A 4O4GB 4R0EA 4RW8A 4P72A 3MEGA 1NJWA 1UW9A 3D68A 4HHJA 3TQEA 4F3MA 1HNWJ 2C3UA 3R5BA 1OWXA 2HNZB 4KQZA 5A8KB 4WTYA 4CLTA 2K3IA 1RT6A 3O2IA 4LVOP 4CLWA 5L39A 1YJUA 3HDSA 4N8NA 3S8SA 1EP4B 2LMIA 1U1RA 2MZRA 5ETRA 4B9MA 2D9PA 3CCZA 2HKEA 4RW9B 2W9CA 1RT7B 3TANA 2R8JA 2CJXB 2FC8A 1HLWA 2GCFA 2PGCA 2W2OP 3PJ9A 5A8WA 2AT1B 3NOGA 1FEEA 1S49A 1TKZA 2JVOA 3A3OB 3N6MA 1N5TA 4CM2A 4E98A 3S01A 1Q78A 1UFKA 1LNQA 2O01C 3NAIA 4UY85 4LREA 3FK4A 5L9XA 3MMBA 3OL9A 2BX6A 3EM1A 5DZ6A 3SZ2A 3CJ5A 4NCAA 2GQCA 4TY8B 3BS9A 1JLQB 4USWA 2P9GA 4DR4F 1Y00A 2GMLA 3LGHA 2D3ZA 4KT0C 4C4WA 1N48A 4WP3A 3K89A 1WUUA 3J81U 4LF9J 3FBEA 1U49A 2LQ8A 1ZM4A 1HQEA 4WFAQ 5EX3A 1M1KT 4GKKJ 1RE1B 1MMNA 3H2UB 3FSIA 1YHQS 1B64A 1YJ9S 1K0VA 4KTQA 2V4JB 4KHPJ 2LXIA 2GC8A 3VTIA 3ITHB 1U1NA 3PO5A 2FD2A 4BS2A 2WBRA 3K5OA 2ZHBA 5D4NA 4G1PA 2VDIA 1N5QA 4L76A 4AFFA 2I6WA 2XCAA 2DR9A 2LDYA 1DTQA 2C2NA 1RP5A 2FQQB 2DTJA 3J7Z5 1S0NA 1IBKJ 3GCWP 2FLNA 3NG8A 1QVFR 3I0SA 1SPBP 1U4BA 1PKUA 2MY8A 3M8RA 1JJ4A 2YWGA 1XBWA 3L7PA 4GO5X 3UCGA 4IDKA 2ZVSA 4X4NA 4OYIA 4UY8T 5KFLA 2KYZA 2XYGB 4OV6A 3H98A 4LF6J 1WHVA 2ALZA 3ELHA 4CLFA 1RT2B 1QAJA 1FERA 4ED8A 5LM7E 4XPEA 5KAKA 3R5JB 5HMWA 2PT0A 1VIOA 3HHLA 3O3LA 1YRXA 4J5OA 3SFGA 1KFDA 2Y8YA 1DFDA 1NDPA 3D6HB 2W01A 3QO9B 4F04B 1IR0A 2M5YA 2ZUGA 5LJ3Y 3UN2A 3ENQA 1HWKA 3F0NA 2F65A 3FMBA 3NMAA 1F9EB 1HI8A 2KT3A 2JX2A 2BE7D 2YQ3A 3FUYA 2CZVC 3NGKA 4OJHA 4OX8A 2HBRB 4Q44A 2C2DA 1K8AT 4ILRA 1PSDA 2V5HG 4FYYB 1HNZF 2HURA 2R7QA 1U1PA 2HFOA 2XLKA 1VDHA 2NREA 4OHXA 2FIUA 4LSNA 2OH2A 4HKQA 3ZXWA 3BKTA 4YN3B 1RQ0A 4KH0B 2PO4A 4YUDA 3JSYA 5HANA 2P6SA 2HQFA 1NXIA 1WG5A 2KU7A 3GCXP 3NBPB 5CZVA 2ZH9A 2PSZA 1T03A 4OYOA 2Y1RI 1U24A 4IOAQ 5IM0B 4NLQA 1MLAA 2RDIA 2VFRA 5LL6d 1CQNA 4B08A 2HWHA 2MQNA 3CNQP 4FPRA 1DZ5A 3PHEA 3BBFA 3CO0P 4LSZB 4DR3J 4QZVB 2GO9A 3MF5A 3C3LA 2VKRA 2XZWA 1HWJA 5FDLB 1HIYA 4NLVA 2B56A 1YITS 5AE3A 2OHDA 3CVKA 1WC5A 2DEIA 1JLEA 2XBPA 5E7OB 1TV6A 2YWFA 1RAIB 4P2FA 5ETOA 2HLTA 2DGQA 4GO7X 4DUZF 2FVRA 2V8HA 1EKSA 2XMMA 2DISA 2X51A 1LWCA 3GSDA 1DQ9A 3S7RA 3KYLA 3EGZA 2R7VA 3BYPA 4TVAB 3Q8UA 1OYEA 2V68A 1IKXA 5GADI 2KG1A 4D3HA 3HF5A 3G6VA 4JYAF 4J9UE 5KFWA 2J9DE 3PR4A 2E44A 4C9DA 1DTQB 5ETTA 2DGUA 2M9KA 2RDDA 4PG6A 5LSOA 1VC6A 1NJXA 1NMEB 2HK2A 1VQOS 2U1AA 1RADB 1YJRA 3BPDA 1O8BA 3EVOA 4YFUA 2CZ4A 1X4DA 3GYXB 4ZP8A 4J37A 1FJGF 3QYYA 3PFOA 2DNQA 3K8WA 2N7YA 2ZKTA 1EARA 4I69A 2CIMA 3GIRA 3CCJS 2YKQA 4QJVA 4IQMA 4YHHJ 3U02A 2ZBQA 5E3PA 1SBRA 3G71S 1PYOB 3KWMA 2DNOA 4O44A 5K5MA 3KLGA 4F36A 1I94J 1UEKA 1CS4A 2BVZA 1WC4A 2ZBIA 1JIHA 2ZBCA 1LEOA 3W2WB 1WC6A 5C25A 4PWDA 2MEWA 2C3OA 4X4PA 3G96A 4FBTA 3R97A 5F8JA 3MMCA 2OO4A 1Z2ZA 2YKNA 5BXIA 2UV8A 4ID8A 3J81Y 4ZJLA 3OFEA 2O66A 1F6TA 3MEEA 2FLPA 2DNRA 4DX7A 1WEXA 5A8WB 2MZTA 2QLJB 4N5SA 2XQCA 4NXMJ 3MM9A 3DXSX 2J5AA 3WQPA 3AJ1A 2W1BA 2Q6CA 2V50A 3M8QA 4X4OA 3G4SS 4PUOA 1R6VA 4AUKA 1FFWB 3E2EA 3G6YA 2D69A 3K17A 4NZ6A 3PKMA 2W9BA 3H90A 5CH7B 1VHIA 5KT2A 3ONQA 3I96A 4OMFG 4P9SA 2HFSA 3IP0A 3PJXA 4KFBB 5IT9U 4UT4A 2V2KA 3I9V9 5KFRA 3CDUA 2W9BB 4LFCF 1X4HA 4RLEA 5AJ3F 4DR2F 4LF7F 1GXLA 3DXBA 3M2UA 2KM8B 3OXGA 5HO4A 4P7VA 1C0TA 5KFFA 3M8QB 3AD8C 2QX0A 3O5TB 2CJYB 1XERA 2EK1A 1O5JA 1Y9OA 1FXRA 4C6AA 1I6JA 2DD8S 5L1IA 4OHYA 5I4MA 4IO9Q 4FXVA 5D0EA 5IV4A 1JLBB 3VHQA 1JQGA 3DRRB 2WCXA 3ENAA 4UZCA 5M2PA 2RDJA 4CCHA 4DPYA 2FZCB 2J6TA 5KFBA 4L74A 3D1HA 1IKVB 4JB8B 5A2QU 5A2QY 1SJ3P 1KQSR 1ZBTA 2HGNA 2KHDA 4Y2MA 1RT1A 5C25B 4FDFA 2BJ7A 2DH9A 3W2WA 1QAIA 4DBQA 2RMLA 1RI7A 3LAMA 4FPIA 4CZCA 1ELOA 4BC9A 3JB9k 1PO6A 3EGNA 2QA4S 2N82B 4JI1F 1VBXA 3UDVA 1GNKA 2AJ4A 2MHEA 2PE8A 3IAM9 3H40A 1UA0A 3DMJA 4KIAA 4NE9C 4MYUA 3KDNA 3A3PB 4X2BA 2CPFA 1S1UA 3EYZA 2OIHA 3SQGA 2XM3A 2EG2A 4AYBD 4OJ3A 2VG6A 1NJZA 1TL7A 4FKXA 3NNAA 1Q8BA 3KMSA 4WFYA 2ASDA 3CUNA 2VFUA 1KR4A 4ZPCA 3AHPA 4OZ0A 5G0RB 1FK9B 5K8OA 1ZM3A 1F0XA 4ETZA 4RL1A 1U1OA 4DN9A 4B9SA 3PG9A 3NCQA 2YWHA 1N33J 2LYVA 4ED1A 3HSGA 4Q43A 4K2XA 4C3LA 1DQAA 2HHUA 1S99A 3QWPA 2IJFA 2R2UA 3VVTA 1SKUB 2EPIA 2HRTA 3FFIA 2XS2A 2YNFA 2AV5A 2OPSA 4ZP7A 3KLHA 4DQIA 1ZM2A 3IN5A 2DH7A 4A48A 1K1QA 4KR0B 5KG6A 4USIA 3POTB 2QFIA 4YHHF 1ZTWA 4P52A 3A8KA 5H9FJ 1Q7YT 5DG8A 3TI0A 2IRYA 2X1AA 4K4WA 4LMZA 5CYMB 2AYGA 1VQKS 3OL7A 2O5DA 2LQ9A 3DDNA 4OX9J 2R7OA 1H72C 1PBUA 1NK6A 4DV6F 2W2NP 2VBZA 3CD7A 4O4RA 1X4EA 2CADA 1ZA2B 4C8MA 2HBQB 4JI4J 4RUHA 4J90A 4ZVPB 1RTJB 2ZE2B 3L7OA 4LSNB 3ZZOA 2H5JB 1YLXA 3SQOP 2PFFB 2BXJA 1S1VA 2ZC4A 1IKYB 3BBCA 2KDOA 2D7SA 2K2PA 3A12A 1S1TB 3V5RA 4CI0B 1WSVA 4UZBA 3HHKA 2ZH3A 1JXEA 1REVA 2DO4A 3OTCA 2EVZA 3VQTA 1FTCA 1LWFB 3L9ZA 5C7PA 3DLEA 5GAEI 4XO0A 4ZHRA 1LWXA 2NXJA 4CO1A 4GVLA 3GONA 2R7UA 2HFZA 2BQ3A 1XMBA 3QT7A 1WC1A 5C42A 3FRYA 2GJIA 2MSTA 2CDRB 9RUBA 3UR0A 2PFDA 3OTOF 4I67A 2JEFA 5IWAF 3WC2A 2B4UA 2XMTA 1PAEX 3ZNJ1 2Z58B 4ZN1A 4DS4A 1BC6A 1RWVB 5IFMA 1RKJA 3IBWA 3LWLA 1RHJB 4L75A 3S1TA 4DSJA 3PX6A 2VC0A 2R2SA 4F4AA 1K0TA 1TUWA 2H5EA 1UVNA 1CPZA 4W90B 1LWEA 1WKLA 4ZVOB 2HQDA 4P2XA 4JI6F 3TARA 4LFBF 4LF6F 2FGCA 2ZKUA 3IR7B 1V5VA 4G6VB 4IFYA 2KH9A 5CYQA 3CDWA 4WPAA 1YJVA 1WORA 5KFCA 4IG3B 4DV1J 4PYDA 1WD6A 4ZVSB 3PY8A 2A0FB 2A3JA 2YX4A 1VBKA 4IRDA 1B70B 2VU5A 1R0AA 4WYWA 2XMUA 3OPKA 1D9AA 3X3UA 3G6ES 5IZHA 3M8SA 2VFTA 4YR0A 4KGXB 1FRLA 4DPTA 3IFEA 3ULHA 5KFDA 1YJNS 1D1UA 2LXUA 1URNA 1RAHB 1HBNB 4PYAA 3RU0A 4M95A 1OY6A 4CQ1A 1FHTA 3H42A 3HPOA 5HK4A 4ILMA 3JXOA 2YWKA 1BY9A 4HI2A 4K7QA 4DCOB 3DOLB 2MXYA 3WHIA 6FDRA 2VB6A 1FE0A 5KFUA 3OT9A 1ACMB 2H5IB 4ZLJA 2RB7A 3J7YU 2VJVA 4M5MA 5E3AA 1S72S 2RU9A 1I1GA 4AT1B 3I0RB 1NSKL 4ZHRB 5L46A 1CBKA 3FBBA 4DV4J 4A8KA 3PZPA 2HMIA 4GKJJ 4RPFA 2JEJA 1VFJA 1VQ7S 4L73A 3TJ9A 1M5VC 2CNKB 1S1VB 2FJEB 5CYQB 3VR1A 4J91A 1TKZB 4XDDA 2DPIA 2MYFA 1BMQB 4DL7A 2CNNB 2VKZG 1RTJA 4PAAA 2J6UA 3Q2TC 2B4OA 2KL8A 2V4RA 3LALA 4OZ2A 2XWXA 3PX0A 1RT7A 3R2CJ 5MAOA 4J9QA 2YNGA 4DR5J 3LA0A 3NCPA 2BQRA 4M94A 2F8EX 4F4YA 1XQIA 3CMES 4TYAA 5LMNJ 1VQ4S 3PHTA 2FHJA 1R0BG 2YVSA 4MH8A 2CDQA 2YNIB 1GTEA 4KSEB 2MMYA 4KY3A 2A10A 4L72B 3BV8A 5AXLA 2J0SD 4OHZA 3T1YJ 4GKKF 1V9OA 1UEVA 2E9RX 4LF5F 5DG9A 4USKA 4B02A 4F3OA 1VQMS 1U2RA 4PQAA 3MM7A 2J7WA 1IUJA 4HDGA 1B0PA 1WC3A 4ECRA 2GAGC 3P45B 3E01A 5E2QA 1RK8A 3ZO7A 1R27B 4WK3A 2DNHA 2RSQA 3C6UB 1EB0A 3MURP 4L3KA 1KOOA 2MLXA 3OFGA 4JI8F 3TA0A 2ADBA 1HNIB 1NO8A 2GX8A 1VISA 5ETSA 3Q8QB 2ZM6F 2V69A 2APOA 2OSRA 3DLKA 4AXIA 3VAIA 2UXCJ 3SCLE 4HEA9 2DO0A 2QFJA 1X4AA 3LP2A 5HLFA 2D9OA 3OR2B 4YDDB 3ISND 4AQYJ 2F4VJ 4A4JA 7FD1A 1BHNA 2ZC3A 3N0VA 2R42A 2R4FA 1TL7B 5GADU 4EI2A 2VG7A 3POTA 3UWTA 1U47A 1YQHA 4UOCA 3R27A 4LBPA 2FZKB 3A8EA 1LK5A 1VHFA 2EI5A 5IS2A 1KLMB 2ZHAA 4AL6A 4OL8A 4IG0A 1SV5B 2XMWA 1KQFB 5KFJA 2R8HA 1HW9A 1NKEA 2B8QA 4CT8A 2NR0A 4J9VA 2DNGA 4U6PA 4JI7J 2JRSA 4WTOB 1JLCB 1FK9A 4MT1A 3D5MA 4DL2A 4P7TA 4LF4J 1JLAB 1UJ6A 5IQQA 4F7VA 2B5JB 5EWFA 1RJJA 1S4EA 5F0WA 3MECA 2KRRA 1W7WA 2XG8A 1WG1A 1WG4A 2XSJB 4I4BA 2K06A 4F0HA 2UXDJ 1REGX 1WTFA 4I7FB 1FWPA 2IIHA 1MWYA 1RBLA 4QW8A 1CC8A 2M52A 2RIJA 3AH6A 3IGNA 1C0TB 3DHXA 1PAUB 5FIIA 5ETQA 4A8SA 1RDRA 3I82A 1U26A 4IH5A 1R8BA 3EWGA 2HHSA 1UKUA 3DOMA 5F8GA 1NK5A 3QFWA 3CCSS 2XI3A 2XZDB 4KFBA 3Q8SB 4UW2A 3DYAB 1FKPA 2DNMA 2XLIA 1K9MT 2GAHC 1DTTA 4DR4J 2DRDA 5G4DA 4URGA 3CJ8A 3EDRB 4NLPA 3EICA 3QGIA 1KTQA 1XR7A 3RZAA 3DKDA 5HJXA 2HIQA 2E1CA 3KXDA 2W25A 3AOAA 3HKZD 4OZNA 3JS9A 4QR0A 2CNLB 1T9YA 5KT6A 4HR2A 1HBMA 1T8EA 3CJSA 2ILZA 2FVQA 5HATA 3L7UA 2Q3PA 2O1PA 1Q53A 2LEBA 1S9EB 5I42A 2KVIA 2YNHA 2BDPA 4KJIA 2YKNB 3VZIA 2RRNA 4LFBJ 1TK5A 3GTYX 1Q86T 4DDFA 3G82B 3LPYA 4QBUA 4RNOA 3T5KA 2EFQA 2IFXA 4M5GA 1S6PA 3DI6A 1H0HB 4P2SA 1RUSA 2LKZA 5BYRA 4ZS6A 5L8RC 3T5JA 3FQKA 1X9SA 3DGVA 1J27A 1WHXA 4OI6A 4C8LA 3CIZA 4ED4A 3M2RA 1TFWA 2HS4A 2UVVA 4JI2F 3S6EA 2WK4A 2ZJQQ 2UXBF 5LSRA 4ZJOA 2IBKA 3KLVA 4ES1A 2XTJP 1SJRA 1YG0A 2VQEJ 2DHGA 3H5SA 1Y5NB 4LRCA 1TTHB 4DF8A 3FCWA 2IAJB 2ABYA 2RE1A 4ZA1A 3W5XA 5B0AA 3IRXA 1S57A 1JLAA 2IVFB 3MUMP 4ZVRB 2ZNZA 2OP5A 4BWJA 4DPXA 4ES2A 1YI2S 4ILLA 4X65J 3MMCB 3AQPA 4X4UA 3DCAA 1BQMB 1SB6A 2OEKA 2MTLA 4TLRA 4CH1A 4YB7A 1BQNB 1KLNA 2GVZA 1UZHA 3EMTA 4C3KA 1RTDB 1CS4B 3GSIA 2PEHA 2WTFA 2OSQA 5IC4B 1SV5A 4DV0J 4LR8A 4J9RA 5A8RB 3Q83A 2E7XA 1NBEB 5IT9Y 5T7LB 2HRYA 1FT8A 3UO0A 3MR2A 1S1WB 4RO0A 3TEGA 4N8OA 5T41A 1RWUA 5I3QA 3DRPB 1N36F 1M5OC 1HYSB 4AL5A 1MN7A 3OW2R 3O8WA 3J80U 3KJVA 3PACA 5EHHA 4E2FB 4LRDA 2EBEA 5C2GA 2N4CA 2XCPA 5LMNF 2UUWA 3TQ1A 3BREA 4KYZA 3PIOQ 2HNDB 2BKNA 1O6XA 2MZSA 1Q8KA 2BANA 2QL9B 2Z2ZA 3H5UA 1U1LA 1LXNA 2UUBF 1NSAA 1KONA 2RS8A 2NYHA 2FLLA 3FBFA 1VRTA 1TUGB 3HVWA 3NRBA 4FKYA 1Z1ZA 1WJ9A 3EDQB 1CJVB 3J81j 4K4ZA 1IBCB 2BE9B 2OAUA 4KPCA 5DM6Q 3C6UA 3EVMA 3JSRA 2AP6A 3GFXA 1F9HA 1XNRF 1M90T 2DRAA 5A0YB 3I9ZA 4F02A 1WEZA 1UPMB 4LSLA 2Z30B 5JUMA 1P1TA 5JXSA 3MM7B 2VFVA 4NI2A 4MYTA 4A8XA 3ZZ0A 2XS5A 3GG1A 4M5HA 3U1LA 3VVUA 4CWBA 3BSNA 2Y0BB 1X7VA 3MPVA 4LIRA 4NCGA 2E9TA 2NUUG 2H65B 1RHKB 4KPYA 3QRQA 5DRKA 2YNIA 2F4VF 1MSWD 3RB3A 1XNRJ 3H4BA 2B6AB 3K5MA 1JJHA 2B3TB 4PQUA 1U8WA 2PA3A 2NYIA 4LRBA 3VWSA 4BLGA 1ZAWA 4DV0F 2XY5A 3C2PA 1LFWA 5A0YA 1I51B 1WELA 1M5HA 2DGSA 3D67A 4CO0A 2J7UA 3SEOA 4LF8F 1RYRA 4N76A 4DPWA 2L9DA 2QEXS 1QE1B 3ILJA 1CJVA 4X4VA 2D3O1 4O3SA 2JL9A 1NK8A 4Q0BB 4C8ZA 1WACA 2JNJA 3VGSA 5CD4H 1Q5VA 2OUGA 3I0SB 3JTNA 1RTHB 3R7NB 5DQHA 1VOMA 5SZTA 4O3RA 1ITPA 1KBRA 3ZTSA 3GV5B 1JWWA 3MR6A 2IA6A 4HHHA 2E66A 1A0OB 1RBAA 2DNNA 2FGOA 4UQGA 1DRZA 1H98A 2MY7A 4EBEA 1TP7A 2AW0A 3ENVA 2GVDB 4J9PA 2MQLA 1PC4A 4K4YA 1FXLA 2UXBJ 1H3DA 2ROGA 5D15A 3HK2A 2ACMA 1GAOA 2DVIA 3OFHA 1B99A 4HVZA 5T7LA 3W9HA 4CNYA 4DV3J 2ZBRA 1AZSB 2CVEA 5THWA 2OGUA 3VGUA 2BJEA 3VAJA 1HR0F 4NZ0A 5DLGA 2LCWA 1XTZA 4GVBA 4W4MA 1BQNA 3M8YA 4B3TF 5F3ZA 4TY8A 4IDKB 2W8LA 1PG5B 4J9SA 1HWLA 1SC6A 2DNLA 3M2VB 1SQGA 3R5GA 4IG3A 4CO2A 5LOQA 3N6NA 3THVA 1MNEA 1NH8A 3IRXB 2RRAA 2O67A 1T05B 4WZMA 4AXJA 3H25A 4M5DA 4YY3J 2B4PA 1SL2A 4NEYA 5KFKA 2VPWB 4WJBA 2XWYA 2ATLA 2HFUA 3SBMA 4QPTA 2LECA 1EJ7L 2W9AA 2PN6A 3V6JA 2AGPA 5D8HB 3OSNA 1H38A 1Q4RA 1X0PA 1XR5A 3T19A 1BGXT 4TU8A 4LFAJ 1N5YB 2UU9F 3Q22A 3ZZPA 3MEKA 1DQ8A 2MKHA 5HP1A 5AXMA 3UDCA 4XK8C 1VC5A 4JV0A 4ETXA 2R7WA 3U7JA 2ERRA 3MD3A 1JLQA 2CUYA 2V0NA 3K57A 1URRA 5GVQA 3T6JA 2ZD1B 1NHKL 3R6LB 3ADAC 1QUVA 3R3TA 2IRUA 1UWAA 1VR6A 1N33F 2MQQA 3RRHA 5C24A 1X4GA 3HLUA 1RHQB 2BRLA 1HMVB 2JVRA 3TVKA 5C42B 3T5HA 3KLFA 1XIQA 4OYAA 2BBEA 4PWUA 1HBMB 3BKFA 4ZVFA 2FJDB 4QWEA 1U1KA 4W92B 1X60A 2HPUA 3O6QA 2I1RA 4P2MA 1ZETA 4YDXA 2JFDA 4ICLB 5IOLA 2D1CA 1B4SA 4MK8A 5B0EA 1JXVA 2ADCA 1SH3A 2F3JA 2CJKA 1N5SA 1KDNA 2BE2B 2L3MA 4YB1P 4NYZA 2R7XA 2OI2A 4WIQA 1GQEA 4ZLNA 5L1KA 3TP2A 2M0GB 1NH7A 2VUGA 4Q5VA 2VA3A 1HNXF 1GMWD 1TL4A 4ID5B 4K8RA 1OSCA 2W8KA 1N6QB 2WAQD 3MR5A 2E1PA 2VZ9A 3SSRA 3CULA 2HHVA 5EN1A 3JYTB 3OLBA 4EYIB 4RZRA 1HBUA 4IOBA 4ZP6A 3JQJA 3GMGA 2NPFA 5F41A 1YWXA 5EUHA 5EWEA 2HVEA 3SCKE 4ZJQA 1OIAA 2XSJA 1T9XA 2HW3A 1HQUA 4DL0C 2XS7A 4DR7J 2AF6A 2NXEA 4X62J 2KT2A 3CD6S 3EJMA 5E3QA 3OTEA 1HD1A 1OMSA 2MZQA 1JLCA 1FRIA 1K47A 3BEGB 4DUYJ 2HZVA 4X84A 2H54B 4LR7A 1T11A 1R8CA 3RAMA 1RWWB 3AB2B 2AIRB 2AGOA 3GIKA 4CH7A 3ZZYA 3TO8A 2VG6B 1KEKA 3OVAA 1PJ7A 4NPOA 1T9TA 1WHYA 4PXDA 1GX5A 5KFGA 3FRZA 3W1YC 1DLOB 3QRPA 3RRKA 1YZ6A 2BJ9A 4X66J 4K59A 2JEGA 2ZBPA 2NZCA 3BGOP 1Y5LB 5H9FK 4EBCA 3ISNC 4RUBA 5CHCB 5KFAA 1MROB 5DS7A 3IR5B 4RBTA 2HQIA 3ISZA 4JOUA 3DGPA 1CULB 1IJEB 1IN0A 1VGYA 2X3DA 4YR3A 3DLKB 4HH0A 1OSDA 4I6AA 4CP5A 3JAMY 2I5JB 3AOCA 4Y28C 1EHWA 4OZJA 3I6PA 1RWKB 5HQ8A 1QTMA 3CMQA 2WBMA 4DXLA 3D6MB 3FQLA 4R8UA 1BWEA 3D6FB 3FCVA 4Z37A 2XNRA 1E6VB 3V6KA 3I87A 2HQ3A 2R7TA 2PIIA 4HACB 1M1GA 1YK9A 4DR2J 1FFGB 5B0GA 3NWGA 3CCTA 3MD1A 5HAOA 2GMJA 1N6QA 3KNAA 1H2VZ 1DARA 3CJ0A 1TL3B 1KN6A 3H4DA 2DNYA 2EG1A 1LV5A 4WZQA 2MKSA 4NLYA 2AZ1A 3HKWA 2AJFE 1SIWB 2FPHX 2RKIA 2V8VA 3B4MA 3HHEA 3ILOA 2XEXA 2V9WA 3MEDA 4LF9F 4N47A 5H1SV 2XZTB 2H4WB 3A8JA 1VJQA 1J5OB 3LF0A 4PUOB 3GFYA 3LO3A 4ICLA 1IM4A 8AT1B 4JP8A 3T9ZA 1OJ4A 2DR8A 3QGPA 1N52B 3TX0A 3HFZB 1VLYA 1CJUB 4KGKA 1U7LA 3V81A 5A6WA 4JYAJ 1IXKA 4CLSA 4O0NA 3TYTA 3HXMA 4DV4F 1SKWA 1NB2A 3EGWB 3LP1A 4YB6A 2VPXB 4B9VA 1RAFB 4FF2A 1JLGB 2V34A 4IH6A 4QWAA 5ETVA 1T3OA 2XI2A 3M1VA 1SUQA 4HTJA 4ZVQB 2CQBA 4PWDB 2ZD1A 4ZCKA 4F0KA 2VOPA 3IMQJ 4RW7B 4U8YA 1Y3JA 3I0RA 4ZIWA 5HBMB 1QTNB 3MFIA 2R7RA 1U48A 4ERDA 3V6HA 2KZZA 3CDBA 4EWTA 4IOCQ 1R43A 3M05A 1GTHA 2UV8G 4KH1B 5J1NA 2IPOB 3BDPA 4CLUA 3NGDA 1VCTA 1Y7PA 5F8IA 1YRTA 3W2VB 1ZTTA 1WNEA 2L08A 3D6TB 5HVHA 4BBYA 2MDAA 4CLYA 4ZKAA 4OHVA 2E29A 2W4CA 3TNVA 2WONA 2BJ1A 2H1YA 5KFZA 1HNVB 4FBUA 3NWRA 4PEOA 1VRUB 3C16B 3PO4A 2JSXA 2IJNA 4NWBA 5C2CA 3LH2S 4M5DB 2M88A 2ZNYA 2EBGA 3DLLQ 2AJQA 2XYHB 1GMWA 1R0AB 2HHPA 1NJYA 1MMLA 1X4CA 5K14A 3W8GA 2W24A 4ZITA 2QTWA 1S9GB 4X62F 3Q0AA 4DS5A 4MAKA 1IKXB 2WSCC 1X8DA 2ZOFA 3AOBA 4M5KA 4ZPBA 4ED6A 2C42A 1RU1A 1JLFA 2DXDA 4OYMA 1QAXA 3RRGA 1XWLA 3GJQB 2C2KB 1WOOA 2DR6A 2GW8A 4NLUA 3EE3A 5E5NA 3W65A 4C7QA 1KSPA 3QJLA 1CQMA 1RAOA 3O1LA 2HG4A 1H7WA 4Z7YA 1N54B 2CWXA 4LQ3A 2E1RA 2HAFA 4DFKA 1L3TA 4M63A 2KTQA 4RR5A 2HHHF 2MGZB 4BDPA 1VLOA 4R0JA 1SQEA 4YP3A 5I3UA 2IYGA 2WB4A 4OJGA 5B7WA 4QU6A 1ZS6A 1RZMA 2OFHX 5D78A 3ZZZA 5ITHA 2P9EA 4M5JA 3FVYA 3DLEB 4EU0A 3W5ZA 4B3OA 1T03B 3CD0A 3NBPA 5J2QA 1IJFB 1S1TA 1M0SA 3D2WA 1IKYA 2VD3A 5EX0A 3PEHA 3G8QA 1DAXA 5KFVA 4Q2LA 3AFGA 1TVRB 2VBWA 1WHWA 2XULA 3NCRA 4WU3A 2FY1A 2V4QA 1A9NB 5KG2A 3OXLA 2J8SA 2ROEA 2Z57B 4RBUA 4QW9A 3MAQA 3QT5A 1OY9A 3D54A 1MU2A 2DYAA 3GYNA 2B7CB 2E5IA 3BM7A 3RAXA 5EWGA 5DO2A 3FEYB 1TMMA 3HHLD 3TZWA 4PQUB 4NRUA 1HW8A 1AA1B 1MWQA 2WZ1A 1KOHA 1EETA 2L9WA 1NZAA 3CJKA 3QNWB 3SYZA 1G2EA 2XO7A 3EPIA 3CCES 5IXUA 2QG9B 3JTPA 1SL0A 2MKJA 3DLBA 1RT4A 1UETA 3QGHA 1C4CA 4TN2A 3K5NA 2G4BA 3DDKA 4NI2B 4C2MA 2BABA 1B7YB 2P2CB 3BYRA 4K4XA 2YNFB 1XN9A 2BOPA 3FFIB 3N6LA 2CFXA 2ROPA 4F50A 2HHTA 1KP6A 4ZPVR 3QRRA 1RWOB 3MUVP 1IQZA 1HKAA 3U1MA 1PILA 2B7BB 4CO3A 4B9NA 1SI9A 2M4MA 1FDAA 2WW4A 3B8HA 2G2ZA 1F5BA 2ZDOA 2PI4A 2JLFA 3QJJA 1C1CA 3DOKB 4U7UK 3TWZA 3BH6B 3CDEA 3Q86A 2I2YA 3H59A 3NXZA 3T9NA 3M30B 5F9NA 2N7CA 1HR0J 3MCMA 3IRWP 2FJBB 2EW9A 4U96A 4ZPWR 1ZAXA 3KJVB 2J8AA 4OI0A 4K4VA 4IKAA 4CIOA 3SQGB 4WXWA 2B9XA 1S1UB 3VALA 4YQWA 4ED2A 1XMQJ 2MSSA 4ELTA 4Y65A 1QDUB 1S48A 4JUZA 2DHAA 4MKYA 4ER8A 3N9UC 5D4PA 3CCMS 1D09B 1KRPA 1AYEA 1JB0C 2A2DA 3T6BA 1WTBA 2V8DA 1IBMF 1CLFA 4KB7A 3PIPQ 2CQ4A 4FF1A 5GAGI 3RR7A 4ED5A 4ENOA 2DHXA 3Q8RB 3P4UB 3CSKA 4NYOA 2CNOB 3CB4A 4YMEA 5ETPA 2C2RA 3N28A 2YKMA 4EMDA 3PW7A 2NSBA 2BYCA 3I31A 2ACYA 2AMCB 2IJRA 4OHWA 4A46A 3SDEB 1C1BB 3CD5A 5D6GA 1NB7A 4EGLA 3JQMA 2X1FA 3CT9A 4RW9A 2FJWA 1XR6A 1IBLJ 3UN3A 5J2PB 3M2UB 5KFOA 2JC1A 2ZWOA 1UCNA 4C8OA 2YQ1A 4OZLA 3PRBA 2HHHJ 2HNZA 4U7CA 3ICLA 1OS5A 1RCXB 1AXQA 3PEJA 4KRWA 4OZ1A 1QAYA 4DG1A 1LOUA 3DRYA 3MCSA 4LBHA 2JWNA 3BO3A 3GQCA 1N4LA 1S6PB 3DI6B 4O4GA 1RTIA 4RNFA 1VQSA 1Z2LA 4QIEA 2VBYA 3P96A 5LSLA 3CCQS 3H7HB 1EIYB 2Q66A 4ED3A 2YNHB 1WI8A 5J2MB 4TU9A 3MM9B 4YY3F 3D4JA 3T41A 3R7BB 4RNNA 1QVGR 1Q8LA 2D74B 2QLWA 1U2FA 2K1RA 2KI2A 2ILYA 1NPPA 3MEEB 5HN0A 5KFNA 3BQ2A 3TUPA 2BJDA 1PJ6A 2BR0A 3W8PA 3WZ0A 2GJ2A 3MR7A 4K5RA 1TK8A 4UUWA 1F1BB 2NXNA 1FD2A 3A1YG 2HIYA 1NK4A 4WK1A 4DUZJ 3BQ0A 4M5NA 3PW0A 3LGNA 3MM8B 3QLHB 1HFEL 1U0SA 2QSFA 3N01A 4C48A 4ZMMA 3A8IA 1S59A 1SXLA 1T94A 2KYXA 3BDEA 6FD1A 4NLWA 1V3ZA 1FWLA 4LF1A 1MW7A 1X5SA 2RNEA 3AQOA 3LW5C 2ZZMA 2IA0A 1IWGA 1Q16B 2PDAA 2WVBA 3EXYA 3LTOA 2H9ZA 4ZPTR 3UDLA 2AX0A 3PRVA 5JJBA 2VQFJ 2AWZA 4B9UA 3LGMA 4DR3F 1RLCL 1S6QB 1YDLA 1X9MA 1S0OA 3KHGA 4I7FA 1G6BA 2IM3A 3FEZA 4R5PA 4RWXA 1IKWA 2ZUAA 1PBAA 4NLSA 4RBVA 3I32A 2IMWP 3BN4A 3MECB 5D0HA 4CYUA 4DV2J 3G86A 3JAMU 3GFZA 5F8LA 4RU9A 2DPJA 1RBOB 4J9OA 1Y4ZB 3JSBA 4JI4F 1LWCB 2A18A 4PXCA 5LJ5Y 3GE9A 1XNQJ 5D3GA 3QJPA 4M5IA 2Y1LB 3HJVA 3K58A 4F67A 1UFWA 1AUDA 1YBTA 4Y0FA 2KXFA 4MIWA 2EFPA 2DNKA 2Z0GA 3D1OA 5FDLA 3CEDA 3RAQA 1FJEB 1HARA 3KHRA 3LQVA 4K5SA 3UFCX 1HWUA 2WSFC 3QBCA 1WKJA 1EZZB 2IC3A 2JDJA 2VG7B 3A3NB 1TAQA 4GC6A 2VPYB 3L09A 4DQSA 3PJWA 1B0TA 3M7VA 4ECXA 3OQ2A 4FZVA 5D77A 4YOEA 2VPZB 2ZH5A 2C2MB 5F8NA 1B7FA 2MQ8A 2JC0A 5HLFB 1BXNA 2HRUA 1FX2A 2QV6A 4ZVTB 5IM0A 2VONA 1LQ9A 4YS2A 3HZEA 3THPA 4ZPDA 1HNIA 4LVNP 3PYDA 2ASLA 5K8NA 3LWMA 4C8NA 2QL5B 2L48A 1P1LA 3CJ3A 4C11B 2G9OA 1VMBA 4ECVA 4DLGA 1FKOB 4PWWA 1VJWA 2ZOMA 1R7IA 1YJTA 4QCLA 1FI4A 1OQ6A 2YKPA 3GILA 4Q8FA 1NLKL 8ATCB 4X64F 2F5GA 4S0MA 1Q81T 3TVYA 3SSQA 1B0VA 2H51B 2OTLS 1W25A 1SJ4P 4X66F 3FNNA 4NRTA 1X4BA 1M5KC 3VQSA 5JVHQ 1GK8A 1IR2A 2X7IA 3NGSA 4N56A 2NZ4A 2LXFA 1H7XA 4Y2CA 3NKYA 4Y34A 2B0GA 1YJWS 4OIXA 4V19X 1FNMA 4QYZJ 3OD2A 3QO9A 2JJ4D 3OTDA 3TX8A 3VF0B 4X4QA 3V4IB 1KNZA 5M2UA 1SUQB 4DSIA 1W2IA 2YNGB 2ZJPQ 1VBZA 5D4LA 3TZXA 3FZBA 2UP1A 3HHLB 3MZIA 3US5A 3T3FA 2RJZA 3F44A 1S76D 2OPRB 1V3RA 4FF4A 3C15B 1S6OA 2GZOA 3PW2A 3FJ2A 5K20B 3V81B 5KT3A 4LF4F 1ZAVA 3Q8VA 4U9RA 3RG6A 2OPRA 3TR5A 5AXNA 1F2GA 3FDSA 2QIFA 3WC0A 4GKJF 4NASA 4OX7A 4BWMA 3KJFB 3TAMB 2MKIA 2E1MC 3QSYB 2RHQB 3GB0A 1OO0B 1RCOB 4PG4A 5AT1B 1HD0A 5AE1A 2DJWA 3KK3A 3GR0A 5DGAA 2N3OA 3JTOA 2HFVA 3IWXA 3NNCA 2F4FA 2KKHA 4UUXA 3CCUS 1KS2A 4EZ6A 3ITHA 4FP9A 4XDCA 9ATCB 4ECYA 5IWAJ 2V4JA 2QN6B 5KT5A 1QM9A 3LP0B 1B3TA 1HWIA 1ZM9A 2VFSA 3I5BA 4OX6A 3OV7A 3MM5B 3KDOA 4NMXA 3OL6A 2LEAA 2WVDA 3EVWA 5HL7Q 1VC0A 5GAGU 2VF3A 3IXQA 3NOCA 1E6VA 2CQCA 2G13A 3HD1A 4UOGA 2HQGA 3W64A 1NM2A 2X1BA 3C46A 4KV8B 1YKWA 1UVLA 4ZCIA 2CQ1A 2CQ0A 2VASA 3NGRA 1ICEB 1NHVA 4KGMA 3TVZA 4OV1A 2CJQA 1CULA 3RYLA 3UVJB 3OL8A 4JI6J 4WU2A 4HTIA 2IHR1 2CQGA 4HT5A 1LWEB 3HT3A 4CO5A 2Z4PA 3QFHA 2XMAA 3MMAB 3GIMA 5CAAA 2BMBA 3J7A1 3NS5A 2FHMA 4NL5A 2VC1A 1YZ7A 4ATNA 3V6DB 3A13A 2AZ3A 2LU2A 4CH0S 1EP4A 2N4DA 2E5JA 2QA2A 4DL6A 1XMOF 4LT6A 4DHVA 1I3OB 4DFMA 1NZ8A 1CJKB 2YX7A 2NS1B 3BGLA 3F41A 1JKHA 1GMVA 1LK7A 1CC7A 1R89A 1RGVA 3TA2A 1HBOA 4GMKA 2RUGA 4CRJA 2RU3A 4DV5J 4J9LA 4DSKA 5GAHI 3NNHA 2KB2A 3MI7X 4DQQA 3J7AN 4WE1B 2CYYA 1L3KA 1LWFA 1TL5A 2RF2A 1REVB 3DRSA 4RW6B 3K8VA 4CNZA 2HFNA
chains in the Genus database with same CATH topology
2E5LJ 4KYZA 2MQ8A 1IBKJ 3IMQJ 1XMQJ 4NXMJ 4DV7J 1XNQJ 4B3MJ 4X64J 4PWWA 4LF6J 4K0KJ 2KVQE 5BR8J 4JI0J 4LF7J 5LM7E 4JI7J 3D3CJ 5IT9U 4LF4J 2UXDJ 4JI5J 4HHUA 4B3SJ 4DV1J 4LF8J 1IBLJ 1XNRJ 4DR7J 4X62J 2HHHJ 2UUAJ 4JI8J 1FJGJ 5AJ3J 5A2QU 1XMOJ 4DUYJ 4DR4J 1N36J 2UUCJ 1HNXJ 3W1YC 3D3BJ 4DV4J 4GKJJ 4X66J 4LFCJ 4LFBJ 4DR3J 3T1HJ 4B3RJ 5IWAJ 2UXBJ 4DUZJ 2KL8A 4DV3J 1HNWJ 3R2CJ 1HNZJ 4DR6J 4V1Ak 4JI1J 3OTOJ 4DR5J 5LMNJ 2VQFJ 5LMUJ 1J5EJ 4JI3J 1N33J 1N32J 3R2DJ 4KY3A 2VQEJ 2UUBJ 3T1YJ 1N34J 4DR2J 4JI6J 4YY3J 4DV2J 4DV6J 5FLXU 3JAMU 4JV5J 2UU9J 4NEYA 4DR1J 4NXNJ 4X65J 2MTLA 2ZM6J 4NEZA 4OX9J 4YHHJ 4LFAJ 4LF5J 4DV0J 1I94J 4JI4J 3J81U 4DV5J 4LF9J 2UXCJ 3J7AN 1HR0J 4GKKJ 4JYAJ 1IBMJ 2MEWA 4AQYJ 4KHPJ 3J80U 2F4VJ 4B3TJ 4JI2J 4RJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5L J;  4KYZ A;  2MQ8 A;  1IBK J;  3IMQ J;  1XMQ J;  4NXM J;  4DV7 J;  1XNQ J;  4B3M J;  4X64 J;  4PWW A;  4LF6 J;  4K0K J;  2KVQ E;  5BR8 J;  4JI0 J;  4LF7 J;  5LM7 E;  4JI7 J;  3D3C J;  5IT9 U;  4LF4 J;  2UXD J;  4JI5 J;  4HHU A;  4B3S J;  4DV1 J;  4LF8 J;  1IBL J;  1XNR J;  4DR7 J;  4X62 J;  2HHH J;  2UUA J;  4JI8 J;  1FJG J;  5AJ3 J;  5A2Q U;  1XMO J;  4DUY J;  4DR4 J;  1N36 J;  2UUC J;  1HNX J;  3W1Y C;  3D3B J;  4DV4 J;  4GKJ J;  4X66 J;  4LFC J;  4LFB J;  4DR3 J;  3T1H J;  4B3R J;  5IWA J;  2UXB J;  4DUZ J;  2KL8 A;  4DV3 J;  1HNW J;  3R2C J;  1HNZ J;  4DR6 J;  4V1A k;  4JI1 J;  3OTO J;  4DR5 J;  5LMN J;  2VQF J;  5LMU J;  1J5E J;  4JI3 J;  1N33 J;  1N32 J;  3R2D J;  4KY3 A;  2VQE J;  2UUB J;  3T1Y J;  1N34 J;  4DR2 J;  4JI6 J;  4YY3 J;  4DV2 J;  4DV6 J;  5FLX U;  3JAM U;  4JV5 J;  2UU9 J;  4NEY A;  4DR1 J;  4NXN J;  4X65 J;  2MTL A;  2ZM6 J;  4NEZ A;  4OX9 J;  4YHH J;  4LFA J;  4LF5 J;  4DV0 J;  1I94 J;  4JI4 J;  3J81 U;  4DV5 J;  4LF9 J;  2UXC J;  3J7A N;  1HR0 J;  4GKK J;  4JYA J;  1IBM J;  2MEW A;  4AQY J;  4KHP J;  3J80 U;  2F4V J;  4B3T J;  4JI2 J;  4RJV A; 
#chains in the Genus database with same CATH topology
 1WF0 A;  3DLH A;  3EXC X;  4YEA A;  4NX9 A;  3IBF B;  4JI5 F;  3TJA A;  4EYH B;  5J2N B;  3MCN A;  1L3S A;  4X65 F;  3AXK A;  3KLE B;  3KLI B;  1RWN B;  1H2T Z;  3NP5 A;  4RW4 A;  5M2R A;  1TQL A;  2C1E B;  2OPP A;  2IBO A;  1FCA A;  1DBD A;  2DEJ A;  4OYW A;  1RAA B;  3QAE A;  4LBI A;  2EFN A;  4URS A;  2KT5 A;  2W4D A;  4NA3 A;  3RUB L;  4AL7 A;  2CJA A;  2V94 A;  2RUS A;  2DGW A;  5CYM A;  1EKR A;  1AFJ A;  3MM6 B;  3MAA A;  2OPQ A;  4G1Q A;  3GJR B;  2RS2 A;  3EZO A;  4H4K C;  3CPW R;  2QA4 G;  3QLH A;  2NUH A;  5D0R A;  1S7H A;  4ZVE A;  1VI7 A;  2UUA F;  3BH7 B;  2EEY A;  4I2P A;  5EDW A;  2QYC A;  3HT0 A;  5HQM A;  1ZOT A;  4OI3 A;  2ZH6 A;  5KFX A;  2OPP B;  2RAQ A;  3B54 A;  5H9E J;  1TKD A;  1NPR A;  3DDI A;  4HL9 A;  4C98 A;  2YX1 A;  4QIW D;  4RW4 B;  5AXK A;  1ZPV A;  4XIU A;  2XGP A;  2QL7 B;  2HZA A;  3G87 A;  3KK1 A;  1RT3 B;  3KUH A;  2EKY A;  2OMO A;  3R6G B;  4DV2 F;  3UE2 A;  2V8G A;  3KUG A;  3L4B C;  3QSI A;  2FVS A;  2HVH A;  3M6X A;  1YVF A;  2FUG 9;  2J9C A;  1YTY A;  1S4F A;  4A47 A;  1DUR A;  2VG5 B;  2YXL A;  1L5U A;  4JI8 J;  1NPK A;  3L3C A;  2DR7 A;  5DZ7 A;  1S10 A;  1Y0H A;  3CCV S;  1NKB A;  1J5E F;  3FKB A;  5HMX A;  3GJT B;  4WE1 A;  2UUC J;  2CQ3 A;  1U45 A;  3DLG B;  2FLO A;  4LQ9 A;  3D0H E;  3PNI A;  5KFH A;  4J9N A;  2CJB A;  5HP1 B;  1CJK A;  1MG7 A;  4CLL A;  3W3S A;  2C3P A;  2GA7 A;  4WYL A;  3OSP A;  1SH2 A;  1SCJ B;  3UDE A;  1H74 A;  4B3S F;  3C19 A;  4DI6 A;  2G1D A;  2QO3 A;  2ZJR Q;  2DCL A;  3V6D A;  1TKX B;  5DET A;  1TK0 A;  2RQ4 A;  4EZ9 A;  3HVT A;  4DU7 A;  2SXL A;  3NEK A;  1YGY A;  1N32 F;  2I0X A;  3D1Q A;  2HQC A;  4LRA A;  5B0B A;  3SCI E;  3G2X A;  4B3R J;  3RBX A;  2FYX A;  4B9L A;  1UMJ A;  4XAK A;  4Y2I A;  3UQS A;  3KOA A;  3PW4 A;  1QSS A;  2CQH A;  1RXO B;  5CAB A;  3OVB A;  4Y6I A;  5FJ4 A;  1Y11 A;  4IYQ A;  4RUA A;  4OFZ A;  1R0C B;  3M2V A;  2ZZN A;  3CXC R;  2AHO B;  1PYT A;  2AEF A;  2GO8 A;  2HSE B;  3HX9 A;  4V1A k;  3AJ2 A;  3BO2 A;  1VQ5 S;  4KO0 A;  4C0B A;  3GV7 B;  3KHL A;  4X4R A;  3JYT A;  2G2Y A;  4QYZ K;  3TAQ A;  4XTT A;  1C4A A;  1SIZ A;  3MMJ A;  1IBK F;  3G8S A;  2HNY B;  3CDA A;  1EX8 A;  1WI6 A;  3QIP A;  2OKQ A;  3K2Y A;  3WBZ A;  4QWD A;  3PYG A;  4X4T A;  2DY1 A;  3W66 A;  2HWI A;  2QMU B;  3LP0 A;  1P9Y A;  2RRB A;  4NLX A;  5D0G A;  4USM A;  1QSY A;  4A8M P;  1R8H A;  1QY7 A;  2HK3 A;  3F73 A;  4DL4 A;  2GQQ A;  4XPC A;  3M8P B;  1RT5 B;  2BM1 A;  3QZ8 A;  5B0C A;  3RTV A;  1N0V C;  1PIE A;  1ZPW X;  2CWK A;  3W7B A;  2LQJ A;  2CPX A;  5JVG Q;  2GGP B;  4NEZ A;  7FDR A;  2UUC F;  2QC3 A;  5HI7 A;  4LF5 J;  2JH3 A;  1AB8 A;  1YSJ A;  3BR9 A;  5I3P A;  2WOM A;  1S7I A;  3TAM A;  1QD1 A;  1S77 D;  4QU7 A;  3HCX A;  4JI0 F;  3HSJ A;  4FNH A;  1UVM A;  1L3V A;  2CQD A;  4QYR A;  3MTJ A;  5E3C A;  3OR1 B;  3TRG A;  1K44 A;  3ZTP A;  2RQM A;  3C15 A;  3KTQ A;  5C5J A;  4EBD A;  4KGZ B;  1Y5I B;  5GMK a;  1TKT A;  4B3T J;  1QLN A;  3KG4 A;  2AEJ A;  4H4M A;  3IS9 A;  3CJR A;  1G1X A;  1MN9 A;  1VS3 A;  1LKZ A;  2OD4 A;  3CC4 S;  3Q89 A;  3UCZ P;  3BR8 A;  2CQ2 A;  1RT4 B;  4TKT A;  3CCR S;  3ETM A;  1RHM B;  2OLW A;  2QLX A;  1F3V A;  1K1S A;  2I8E A;  4USU A;  3PKY A;  3KLG B;  1Q7L B;  4H54 A;  4NCG B;  1R8A A;  4O44 B;  3R1L A;  1UVJ A;  1OPI A;  3FBC A;  5HJY A;  1NRK A;  2KJW A;  3BB5 A;  1EET B;  3SCJ E;  3BQ1 A;  2AYE A;  3C66 A;  4AQY F;  4LIW A;  3VGV A;  3OXF A;  1UJ5 A;  5U47 A;  3AD7 C;  3VZH A;  2GIF A;  3D3C J;  4MK9 A;  5JMN A;  3UPF A;  1AT1 B;  3C8Y A;  1LXJ A;  1NKC A;  2J6S A;  2FDN A;  5KFT A;  3C14 B;  1FJC A;  4H4O B;  4ZK7 M;  4FF3 A;  3J7Y I;  3KJQ B;  2MPU A;  3PYE A;  4P73 A;  1FKO A;  2F40 A;  2DGV A;  4WKR A;  4DX6 A;  1AW0 A;  2HWT A;  3OVS A;  5L38 A;  1BUX A;  2FHO B;  1VQY A;  1VRT B;  3OTB A;  3NLC A;  3FEX B;  3D0I E;  5KG1 A;  3BSO A;  4J9K A;  3PCO B;  4HLB A;  4F4W A;  4LF8 J;  2VH7 A;  3OUY B;  4OX9 F;  2KXH A;  3CJQ A;  4EO6 A;  3AJD A;  2HND A;  2XO6 A;  2CQI A;  2IM2 A;  2XC9 A;  3VAF A;  1TV6 B;  2YY3 A;  3BSC A;  2BZ2 A;  3FC9 A;  2C3Y A;  4H4O A;  4NZ7 A;  1KVJ A;  2IRX A;  1X5O A;  3NS7 B;  5I3U B;  4NLG A;  1WDD A;  4N7T A;  1O0P A;  2CRL A;  4QIV A;  3DRP A;  2OML A;  4ZCL A;  2ZH1 A;  2BJ3 A;  1N36 J;  4EEY A;  2CG8 A;  3CW2 C;  2DT9 A;  3KG0 A;  4IR1 A;  3B78 A;  4JV2 A;  2BQU A;  4USJ C;  5A8R A;  4KKO B;  2UVU A;  2D41 A;  4N77 A;  1SH0 A;  2V2Q A;  3EZU A;  2HGL A;  2BAC A;  2E7V A;  3V4M A;  4F2S A;  2DHH A;  4Q7A A;  3OUY A;  3VGT A;  4I64 A;  3DM2 A;  4RKU C;  2QLF B;  2G0C A;  1K73 T;  2CJ9 A;  2G0J A;  3OJS A;  3P8B B;  4FVM A;  1FNX H;  1FA0 A;  3AA9 A;  1UP1 A;  2H48 B;  4H4M B;  3MOJ B;  5F3T A;  1S9G A;  3ZNU A;  5K14 B;  4A8F A;  4WP8 A;  2IVY A;  2M70 A;  2IAJ A;  3CIM A;  4DWI A;  1PC5 A;  4Y00 A;  2NSC A;  4WFN Q;  5DDP C;  1RWP B;  1UTA A;  3C16 A;  2W4P A;  4NYP A;  1HNV A;  1RAC B;  1U6F A;  2F9J A;  4Y2K A;  1S6Q A;  3GZ7 A;  2KFY A;  1HNZ J;  4DEZ A;  2BW7 A;  8RUC A;  1RIS A;  2EC2 A;  1YJ7 A;  1U6B A;  3Q23 A;  3ETO A;  3W2V A;  1F3F A;  2XMJ A;  3D0G E;  1PJ5 A;  2AJ0 A;  2J9E A;  2DIU A;  3DRX A;  3OHA A;  4UST A;  3M2R B;  2XY7 A;  1UAW A;  1SC3 B;  3TOQ A;  4RU2 A;  3M8P A;  4IQX A;  2QGF B;  1S1X A;  3NGT A;  2IVM A;  3G9C A;  2DK2 A;  4ZOS A;  2GJF A;  3RB0 A;  3QAU A;  2GS8 A;  2ZH8 A;  2KFN A;  2ZWP A;  4K4U A;  3FZ2 A;  4ES3 A;  5FLX U;  1KFS A;  4RX6 A;  1E6Y A;  4IFV B;  4DR1 J;  4DOZ A;  1FE4 A;  3HFK A;  5E33 A;  2GHP A;  1TKT B;  1NDL A;  2F8M A;  1VBY A;  1CVJ A;  1VQL S;  4KAI A;  5HVF A;  1RT2 A;  2CG4 A;  3OR1 A;  2L41 A;  1CJU A;  2Q1L A;  1XC9 A;  4GC7 A;  2XB2 D;  3CTR A;  2W7O A;  1FDD A;  1LW0 A;  4NLT A;  1X0F A;  2ZH4 A;  1NK9 A;  3I4H X;  4QWB A;  3TAP A;  1J5O A;  4CLZ A;  4TXS A;  4DUT A;  2C28 A;  3HHD A;  4NLD A;  3ZZT A;  1KHV A;  1F5C A;  4UTG A;  4KHM A;  2AYB A;  1DTT B;  4QWC A;  1FKP B;  1RAG B;  4WP9 A;  4Y2A A;  2VQF F;  1RT5 A;  4OYX A;  3QT6 A;  1TAU A;  3IG1 B;  1TMJ A;  1FRH A;  1TL3 A;  2ZVI A;  2OD6 A;  3HVT B;  3UR3 C;  3TUZ C;  2BUN A;  2P6T A;  5KT7 A;  5F8M A;  5IQ6 A;  3IWL A;  2XGQ A;  1ZYQ A;  2B51 A;  3T1Y F;  3VAG A;  2QLB B;  4DF4 A;  2JOQ A;  2AJ2 A;  4HAC A;  4P75 A;  1FNO A;  1UPP A;  1IBL F;  1RKI A;  4USH A;  4E8U A;  4B3M J;  2DH8 A;  1I5O B;  1S6U A;  3IAS 9;  5MLC V;  4F4X A;  4DR5 F;  3A4T A;  3R1H A;  3DLG A;  2EKN A;  4TLQ A;  3ZFV A;  2FJA B;  2CKW A;  3J7Z T;  3R9L A;  4UQT A;  2BV3 A;  3UN5 A;  4CO4 A;  4C0O C;  2DGT A;  3IO1 A;  2KVQ E;  4KGV B;  2B5J A;  3CWJ A;  2C2O B;  3F56 A;  3NY0 A;  2YKM B;  5T14 A;  2V2V A;  1VRQ C;  2MLZ A;  4Y3C A;  1NEE A;  2CA9 A;  4DX5 A;  5BYQ A;  3NMR A;  4QIF A;  3GP9 A;  1ULR A;  2M2B A;  3MAH A;  3MDF A;  3TZZ A;  2H3E B;  1HI0 P;  2ZHO A;  1QUP A;  4RWW A;  1RT3 A;  1PGZ A;  2AQ4 A;  4TQR A;  2HYI B;  3K0J A;  2DIV A;  1FFS B;  1UL3 A;  2XHW A;  4IG0 B;  2XY6 A;  3HZG A;  5GME A;  1X9W A;  1TZ0 A;  2DBB A;  2IYI A;  2BA9 A;  2Z2L A;  1T9V A;  5HSP A;  4LF2 A;  2UVR A;  4ELU A;  4QQB A;  4F2R A;  3CJ2 A;  1RT6 B;  2GHV C;  2KHC A;  2V63 A;  3E8O A;  3JSM A;  3R8Y A;  5A8K A;  4JV1 A;  2QJ3 A;  2HBZ B;  4P71 A;  5DDR C;  1C0U B;  2PMW A;  3AD9 C;  2OPQ B;  4EUV A;  3M6W A;  4OJ1 A;  1FJG J;  1EQM A;  3MEG B;  3OR2 A;  4G1I A;  4J9M A;  4RW8 B;  3LP2 B;  4FVC A;  2MKK A;  3AT1 B;  1UZD A;  3KNG A;  1Q82 T;  3RW6 A;  1VQP S;  1APS A;  1U0H B;  4DZD A;  1C1C B;  1TR0 A;  3DOK A;  2YWW A;  5HRO A;  4WFZ A;  4DMZ A;  2E5L F;  1NCL A;  2WB1 D;  3T1A A;  4DPO A;  2HZC A;  5CCM A;  2W2Q P;  4KHR A;  2PI5 A;  5E0O A;  2B9W A;  3KK1 B;  4V19 J;  3VAM A;  2LU1 A;  2R8K A;  5HRO B;  3DNC A;  3G8T A;  4K2J A;  1HL6 A;  2CVI A;  4FXD A;  4TYB A;  1F2H A;  4RW6 A;  3HJF A;  2Y8W A;  1HBU B;  3R5C A;  1H6K X;  3FCH A;  3IR6 B;  1N88 A;  4PG7 A;  2PA8 D;  2GNK A;  3W63 A;  5CQG A;  1G3O A;  2FHK A;  2XYP B;  3MCO A;  4OLO A;  1N8R T;  5CZX A;  1JKH B;  1KWM A;  3MAA B;  4G1Q B;  5IT0 A;  4DR6 J;  4NCB A;  4C8K A;  4RNM A;  2VOD A;  3OTO J;  3I56 S;  3JSM B;  3LAN A;  3IM8 A;  4JI1 J;  1T0T V;  4EO8 A;  4ECW A;  2RHS B;  2BE2 A;  2G1H A;  2ZFH A;  3DC2 A;  5FLX Y;  2QRR A;  3UD3 P;  2M8D B;  2CPI A;  1FRK A;  3KLI A;  1ARO P;  3MMA A;  1GT8 A;  4WCE Q;  2KXN B;  3KLE A;  3OLA A;  3MUT P;  5L1J A;  3ET6 B;  2HVD A;  2UXD F;  3GIJ A;  3KUE A;  1GMU A;  3BGR A;  2VBX A;  4DR7 F;  1TVR A;  1PYS B;  3UVJ A;  4C0H A;  4U8V A;  3CJT A;  4CTA A;  4LR9 A;  2RIL A;  4W98 A;  5KG5 A;  2QT7 A;  3OJU A;  5KG7 A;  4DFP A;  4B3O B;  2NXU A;  2QA1 A;  1FXD A;  4KV8 A;  1BWV A;  3W5Y A;  2QZ8 A;  3M32 A;  4ZN3 A;  3SXL A;  3OBI A;  2VQE F;  5DLF A;  2C2E A;  1SL1 A;  2MKC A;  1HBO B;  1L3U A;  4C8Y A;  2HMI B;  3DOL A;  4WBF A;  1WF2 A;  2OEL A;  1FX4 A;  3MM5 A;  1N5Y A;  2HVZ A;  2G2O A;  3AXM A;  3HSZ A;  1WKK A;  2LA4 A;  4OZ5 A;  5LT5 A;  1N34 F;  2FJX A;  1HBN A;  1M1H A;  1FJ7 A;  1FRJ A;  1VK8 A;  4NLR A;  3U27 A;  1M5P C;  4HT7 A;  5KOX A;  1TL1 B;  2X3G A;  5KOW A;  3KK2 B;  2FY8 A;  2U2F A;  2VL1 A;  4WKY A;  4KC5 A;  2JZ5 A;  2VHG A;  4JBC A;  3HVA A;  4KBI A;  3IGV A;  2F7V A;  3DHW C;  4FNI A;  2ASY A;  2DY9 A;  5KG0 A;  3BO4 A;  2MZJ A;  2C2Z B;  1U8S A;  3BPS P;  4MFB B;  4DV7 J;  1KKH A;  4ECZ A;  2GFF A;  4QR1 A;  1OPZ A;  1YRU A;  2ALY B;  2J9D A;  1VYA A;  3IA0 A;  1A6L A;  1LW0 B;  1T95 A;  3LAK A;  1KQK A;  3H5Y A;  5DM7 Q;  1P9Q C;  4MMO A;  1HPZ A;  3IM9 A;  1WDT A;  3LPE A;  4GVB B;  3UCU P;  4A8O A;  5BR8 J;  4JI0 J;  1WOP A;  2LVW A;  2V6A A;  5FD1 A;  2WVE A;  1AZS A;  3PXG a;  2ATC B;  1D8Y A;  4ED0 A;  4PKD B;  1GFW B;  2CPE A;  1M5S A;  4OI4 A;  3ILL A;  4ZIV A;  2R2R A;  5L1L A;  3SV3 A;  3UNY A;  3V4I A;  2GVD A;  2KN4 A;  1V3S A;  1G4C A;  3HHL C;  5DGB A;  2A2C A;  4HHU A;  4TQS A;  3RJM B;  2BOA A;  2IM0 A;  1Q0N A;  1D8Z A;  4B3S J;  1TEL A;  2GHW A;  4CT9 A;  1U2C A;  1RB0 A;  4DU8 A;  4A8Y A;  4PAB A;  2C22 A;  3KK3 B;  3GG0 A;  2P9C A;  1RTH A;  4F26 A;  4B3R F;  5F8H A;  3H5X A;  3B6B A;  2RVJ A;  4FYD A;  2FVP A;  4P74 A;  3SSS A;  2KRB A;  1F60 B;  2V2Z A;  3PTW A;  2IDL A;  1OYD A;  2AU0 A;  1U02 A;  2YH0 A;  2ZE2 A;  3C6T A;  3E3X A;  2WW8 A;  1IQT A;  5E3R A;  4CM0 A;  2KFZ A;  4M8L A;  4B17 A;  4A8W A;  4DLE A;  1HPZ B;  3P5T L;  4C11 A;  3CJ4 A;  2N3L A;  3RB4 A;  3B4D A;  4CDI A;  5K8M A;  3EPG A;  1EQ0 A;  3MPW A;  1BE4 A;  1NHU A;  1GEH A;  4ITS A;  2IMO A;  4DR1 F;  3DM2 B;  4MFB A;  4F0M A;  3SI8 A;  2I9S A;  4KHP F;  2RKI B;  1UW4 A;  2DCU B;  5ETL A;  2COL A;  4G65 A;  4BHQ A;  5KFY A;  2RT3 A;  1GX6 A;  4F4Z A;  3MXH P;  2EFO A;  4LFC J;  3GU0 A;  3BF4 A;  4KKO A;  4DR6 F;  2YKO A;  4QR2 A;  4ZVU B;  2Q6B A;  3KK2 A;  2YTC A;  3QZ7 A;  2MB0 B;  3MPU B;  1S79 A;  4YR2 A;  2CAJ A;  2QMW A;  3PX4 A;  3SFU A;  3CCW A;  3TUJ C;  2KM8 C;  1WC0 A;  2OPS B;  2V67 A;  4OI1 A;  1MMD A;  4FYW B;  4LSL B;  3MWB A;  5B0F A;  2B4V A;  4C3M A;  4ZVH A;  3M9N B;  1N56 A;  1XNQ F;  4UF4 A;  4DQP A;  2OEM A;  3PRD A;  2I38 A;  1DHM A;  2F1F A;  1FDN A;  3M32 B;  5KFS A;  5LMU J;  1MWZ A;  1J5E J;  2JLE A;  4JI3 J;  4HI1 A;  1GH8 A;  4MKV A;  1TFY A;  3T1H F;  2FVC A;  1HHS A;  3R2D J;  2I5J A;  3MOZ A;  3O44 A;  5ETM A;  2ZIT A;  1IVZ A;  4K4T A;  1YIJ S;  1FRM A;  4CTA B;  4QPX A;  3DFE A;  2DNP A;  3KHH A;  4WXO A;  1SJQ A;  5A6P A;  5HMZ A;  2WVC A;  1IM6 A;  2H4Y B;  3K5P A;  2RQK A;  3HHN B;  4DV6 J;  2XMV A;  1T9U A;  2GMH A;  5HQL A;  2Y1I A;  4R5P B;  4P6Q A;  4RUC A;  3VAH A;  3HVR A;  4BC7 A;  1IWA A;  2R8G A;  3ZZR A;  1F5A A;  3AOD A;  1KC8 T;  2MQP A;  1I94 F;  1T02 A;  3EUN A;  3NAH A;  2W2M P;  5IT4 A;  1UVI A;  3AAW B;  1S1W A;  3QPI A;  2MZ1 A;  4M5L A;  1JJ2 R;  3DMJ B;  5E41 A;  1V5I B;  2ZH2 A;  4DSL A;  4DN0 A;  1AFI A;  2MKY A;  4QOT A;  4C97 A;  5KG3 A;  2DGX A;  3VCD A;  3ZC4 A;  4O3N A;  3GPA A;  5DDQ C;  1HI1 A;  3EZ5 A;  2VJU A;  1U1M A;  3MM8 A;  5D3G B;  1RTD A;  2GVZ B;  5L9N A;  2JEI A;  4F3Q A;  4B9T A;  2RH3 A;  1RT1 B;  2KJV A;  2F9D A;  4BCA A;  5CA5 A;  3IS9 B;  4NA1 A;  2VIC A;  4DSE A;  4ECU A;  2OTJ S;  2Y9H A;  2E5L J;  2OJ3 A;  2F63 A;  3DRR A;  2MJN A;  2ZEJ A;  1JLB A;  3D28 A;  2YH1 A;  3QT8 A;  1RU2 A;  1NND A;  2UVW A;  1Q95 G;  2Z2Y B;  1IKW B;  1G7C B;  3ZZU A;  1FEH A;  4AD6 A;  1AUS L;  4DCJ B;  3HM9 A;  2DR5 A;  4ED7 A;  1U0H A;  1ROF A;  2WOM B;  3BBB A;  3CMA S;  4R25 A;  3ZTQ A;  1VQ8 S;  2D3U A;  2PD1 A;  3BKU A;  3H8Y A;  1RTI B;  1ZH5 A;  2G0I A;  4DV5 F;  4LF7 J;  3R5D A;  4HH1 A;  4MK7 A;  3BJY A;  3PYF A;  4ID5 A;  3BSA A;  4HDH A;  3W61 A;  3QGG A;  3GII A;  3GFH A;  1C0U A;  5DG7 A;  4HYK A;  2AD9 A;  4LFA F;  3AB4 B;  4PG8 A;  4EFA C;  1XJW B;  5B08 A;  1NSP A;  3THT A;  4ECQ A;  4U95 A;  1EAY C;  2DHS A;  1X5T A;  2MLY A;  3G82 A;  4E0D A;  3KKF A;  3CC7 S;  2VV5 A;  2AEM A;  2BEF A;  2K8G A;  3IC1 A;  4MIA A;  1Q8I A;  1UWB B;  3I4P A;  3CCL S;  2HNY A;  3DLJ A;  1CSJ A;  2L9N A;  4I2Q B;  4MKA A;  3RGI A;  5J1E B;  2HHQ A;  4I6Y A;  4ECS A;  3SDE A;  4PPZ A;  2WSE C;  3MPD A;  3W9J A;  3KMQ A;  1HMV A;  3ZTO A;  2J76 E;  4KO0 B;  5C24 B;  2KO1 A;  4DSF A;  4WFB Q;  3L95 X;  4Z7C A;  2HGM A;  3T5L A;  4GRS A;  3UI3 A;  5KFP A;  3HFV A;  4B3M F;  3W62 A;  1RLD A;  2GV1 A;  4FN5 A;  4FS1 A;  1LFP A;  3U1N A;  3K59 A;  1LW2 A;  5HMY A;  2EK6 A;  1KQG B;  2Z56 B;  1DJ0 A;  3TZY A;  3DYA A;  3X1L B;  4ANE A;  4DG1 B;  5A76 A;  2IY5 B;  2HBY B;  3CF5 Q;  5GAH U;  4F8R A;  4DV3 F;  1SKR A;  1SKS A;  4FS2 A;  1TKX A;  4OYZ A;  4P10 A;  1HNX J;  3V2U C;  1S0V A;  2B9Y A;  3D3B J;  2DXF A;  1BLU A;  3SMZ A;  1GXT A;  5J2P A;  4DJB A;  1U25 A;  2HHX A;  1CEZ A;  1R3N A;  1OQ3 A;  1HNW F;  3IG1 A;  1C1B A;  2ZZT A;  3MPY A;  4FYX B;  4WFX A;  1NUE A;  1N5V A;  1LW2 B;  3PM9 A;  2B8P A;  2EWH A;  2HS0 A;  2YQ0 A;  3Q8Y A;  3QMQ A;  1T05 A;  4TY9 A;  4NXM F;  4MIB A;  1UEU A;  4NML A;  3Q24 A;  2DKO B;  2WRM A;  1RTZ A;  1FO1 A;  5DDO C;  2YWE A;  2VA2 A;  1A7G E;  2NXC A;  3RW7 A;  2XNQ A;  1RWM B;  5CCL A;  4DQR A;  1JLE B;  1KHW A;  2LEP A;  5J1E A;  4JI7 F;  2XHC A;  4I2Q A;  4AND A;  2WHO A;  3GYG A;  2UUB J;  1UWB A;  1KLM A;  1E6Y B;  2FHJ D;  2W7A A;  4IFV A;  4DZ6 A;  7AT1 B;  3RR8 A;  1RAE B;  2M7S A;  1RAJ A;  2PC6 A;  1VQN S;  1NAQ A;  2FC9 A;  2J7K A;  3GV8 B;  2DRB A;  3EGV A;  3P49 B;  2E5H A;  4JV5 J;  4G3I A;  1D3W A;  2UU9 J;  2CPD A;  2W2P P;  1FTR A;  1U6Z A;  4UOF A;  4LRF A;  1S1X B;  4NXN J;  1C2P A;  1RA7 A;  2LA6 A;  4I6W A;  3WDO A;  1Q79 A;  2LQ5 A;  1Y10 A;  3M8Z A;  2AJ1 A;  3CGI A;  4PCQ A;  2K7J A;  3M30 A;  1JNR B;  2YPZ A;  4LJM A;  3M8W A;  3JQK A;  3N5B A;  4ZLP A;  2X1G A;  1JXL A;  5BJR A;  4Q0B A;  5EGY A;  2E5G A;  4DPU A;  1MU2 B;  2M8H A;  1X5P A;  4U7U D;  5GAE U;  1QE1 A;  2HEK A;  2NLW A;  4K50 A;  2J0W A;  1QJH A;  5J2N A;  2BKO A;  3PFE A;  2P5V A;  1FVQ A;  4NLO A;  5BYS A;  1KTV A;  3D66 A;  2R9L A;  5ETN A;  4RJV A;  4I56 A;  5IC6 B;  2HLU A;  3N4W A;  5LMU F;  1P6T A;  2PMH A;  3W9I A;  3IBC B;  5HVG A;  3GJS B;  2MJU A;  2POK A;  2MQO A;  2RF2 B;  2A1B A;  2B6A A;  1W2B R;  3HO1 A;  2W7P A;  4WWS A;  4USV A;  1CG2 A;  4IRK A;  4M1K A;  4MKB A;  1U09 A;  1X31 C;  1SQF A;  5SUH A;  5KG4 A;  2NPI A;  2EXU A;  1JJC B;  2JHE A;  2DGO A;  2BKP A;  1P27 B;  3R5A A;  1Y3K A;  3ILI A;  3CJK B;  5KFM A;  5H9E K;  1D9D A;  4Z2X A;  2EFV A;  3UNG C;  1ZZF A;  1XEZ A;  2V8P A;  4O0I A;  4CLK A;  3FSY A;  4DX8 H;  3AY0 A;  2DNZ A;  2E7W A;  3GWC A;  4YB5 A;  3RBZ A;  3H0P A;  3HP6 A;  5CYJ A;  4DUY F;  1KD1 T;  3CO9 A;  1OY8 A;  3NGU A;  3BGF A;  5J2Q B;  2CPZ A;  2AYM A;  4J7C A;  3SIP B;  4D3G A;  2OFG X;  3E51 A;  3FMW A;  4I1T A;  4CLP A;  2R2T A;  1JLF B;  3LUY A;  4JI5 J;  2HHW A;  3HD2 A;  1YX2 A;  4DCP B;  2XLJ A;  5RUB A;  1DY3 A;  1FD8 A;  1FVS A;  2BAN B;  1FRX A;  1HHQ A;  3SV4 A;  1V6H A;  3FSX A;  3I5C A;  3N5F A;  2A6M A;  2YPY A;  2BJ8 A;  1VRU A;  2ZOG A;  3C14 A;  4O23 A;  4ZDN A;  5KFE A;  3N79 A;  5AJ3 J;  2WON B;  2UUA J;  1S9F A;  4Q45 A;  4PXE A;  2MGZ A;  4NA2 A;  4UOH A;  1HYS A;  3BGU A;  1HQE B;  2DIT A;  1S97 A;  2XMK A;  3D9B A;  4Q8E A;  1FWK A;  3H2V E;  1RSC A;  3Q2S C;  4ANC A;  5F9L A;  3M4X A;  3HMJ G;  3AA8 A;  4FXW A;  5LXY A;  1NDK A;  3J80 Y;  1HA1 A;  3OHB A;  3UW1 A;  5DJB A;  2CPJ A;  1RHR B;  3B82 A;  4A8Q A;  4I0W A;  1ZZN A;  2R7S A;  4RW7 A;  2J0Q D;  2LFV A;  2MHN A;  4L6V 3;  3PVX A;  1BQM A;  3HUL A;  2EFG A;  3EX7 B;  4X4S A;  1X4F A;  2M3D A;  3MMB B;  1JLG A;  4PG5 A;  2YKA A;  3R7S B;  3RBE A;  3LP1 B;  4IFY B;  4ZPA A;  2RQC A;  2UUT A;  1ZA1 B;  3I55 S;  3TEH B;  1JMT A;  2CPH A;  3I5A A;  4FYV B;  3ZTR A;  3C6T B;  1RAB B;  5ETK A;  4NOH A;  1J2V A;  4F25 A;  1UJ4 A;  2J0X A;  3Q8P B;  3BN7 A;  2GQ2 A;  1RYS A;  3TUI C;  4OLP A;  2W9C B;  2VOO A;  2E1A A;  1RA6 A;  4ECT A;  3TA1 A;  1FDB A;  3IWN C;  3PV8 A;  3UD5 A;  3MED B;  1Z4U A;  2GGP A;  3QWU A;  2UXC F;  1U1Q A;  2QSW A;  5ADZ A;  3M9O B;  4IR9 A;  1VQ6 S;  2DB1 A;  1XK8 A;  1N32 J;  4PR6 A;  4WF9 Q;  1WF1 A;  4OZ3 A;  5CD4 A;  1XMQ F;  5DQI A;  1N34 J;  1BQX A;  3WX8 A;  2D3O R;  3MGJ A;  4KE5 A;  3P5B P;  1TU0 B;  5HBM A;  5KFI A;  3M6U A;  4RNH A;  5KTQ A;  1NSQ A;  2HS3 A;  3KFW X;  1T3N A;  2B9E A;  2QE5 A;  3M1V B;  3PDN A;  3HI9 A;  5KFQ A;  1W26 A;  2HVI A;  2FJV A;  3QIP B;  2QMX A;  4I68 A;  4LUB A;  2EC0 A;  1WSR A;  3P6Y C;  1HQ2 A;  5I42 B;  4F4K A;  2Y3Y A;  1S9E A;  4URQ U;  2ASJ A;  1TUV A;  2E9Z A;  1BD6 A;  2VIH A;  2ZM6 J;  1T9W A;  2Q79 A;  4ALZ A;  5KT4 A;  1FES A;  2CZ9 A;  5K9F A;  5LXR A;  2LDI A;  2Q43 A;  3RBD A;  4U67 Q;  2K3K A;  1S0M A;  4DV7 F;  4JI3 F;  1VK3 A;  3WX4 A;  4PXB A;  2LP4 A;  3GLJ A;  2CXE A;  1R8P A;  3DGP B;  4MJK A;  1NDC A;  2PEB A;  4DFJ A;  3H2L A;  2ZDP A;  1IBM J;  1CJT A;  1NK0 A;  2HAI A;  2Y0S D;  2CQP A;  3K5L A;  2DXE A;  1SJF A;  1QSL A;  4H4K A;  2Z8Q A;  3K7R A;  4JI2 J;  3QQC D;  1KVK A;  2C3M A;  3DU6 A;  2VDH A;  2NQP A;  2RD5 C;  1TL1 A;  4IH7 A;  5AE2 A;  1UVK A;  3DOM B;  2QYG A;  2IC3 B;  2JFK A;  1T7P A;  2LQB A;  2KZM A;  1WEY A;  5K8P A;  3KLH B;  3CE8 A;  1HHT P;  3QAT A;  4PPD A;  2R8I A;  3CC2 S;  5DQG A;  2BM0 A;  4PZV A;  4N41 A;  1SJ1 A;  2BW2 A;  1VIX A;  2GIQ A;  3UD4 P;  2XSF A;  2V9K A;  4O3P A;  4X64 J;  2R3V A;  4ZLL A;  2GIR A;  3KG1 A;  3M9M B;  2JLG A;  4R8U B;  2A6O A;  4ZCM A;  1KVI A;  1R6Y A;  5F0U A;  4K0K J;  2O3D A;  5GMD A;  4TU7 A;  1F9F A;  2AX1 A;  3OFF A;  1VQ9 S;  3KJN B;  5G0R A;  2VG5 A;  4IRC A;  3DU5 A;  4L3N A;  2Z2M A;  3RB6 A;  2FTR A;  1SC4 B;  2NCK L;  2OEJ A;  1RHU B;  1WOS A;  4ZVG A;  4CYU B;  1O51 A;  2K7K A;  1Q1K A;  3BGR B;  4QIG A;  2Y1J A;  1MRO A;  3ET6 A;  1NJI T;  4IO1 A;  2LLZ A;  1IR1 A;  4OI2 A;  4K0K F;  1RWX B;  2IM1 A;  3TJ8 A;  4PRF A;  1SC1 B;  4AE5 A;  4OQJ A;  3DN9 A;  4NXN F;  4ZP9 A;  5IV3 A;  2FZG B;  1NK7 A;  3D7S B;  1DLO A;  1S5Z A;  1WWH A;  2MQM A;  4I2P B;  1PCA A;  2ZH7 A;  4ELV A;  4JV5 F;  5D4O A;  1SVD A;  4K4S A;  2P8I A;  2B43 A;  3P3D A;  3PW5 A;  3H20 A;  1FKA F;  3BZQ A;  3ENW A;  3MM6 A;  3GR1 A;  1GXU A;  2BRK A;  3MR3 A;  1R31 A;  1D0E A;  1CJT B;  3QID A;  1XMO J;  1H2U X;  3WIV A;  2IDE A;  3WIU A;  6AT1 B;  4O3Q A;  3MFH A;  2PMZ D;  4TNO A;  1H73 A;  2AKW B;  1IKV A;  1UA1 A;  5BR8 F;  1NU4 A;  5J1P A;  3G6X A;  2AGQ A;  2F8H A;  4OYB A;  1UFL A;  1FF2 A;  5B0D A;  3M6V A;  1D9F A;  3VAK A;  2K1R B;  4IUF A;  2CPY A;  4O3O A;  3KLF B;  4WII A;  3TW0 A;  1HQU B;  4DV1 F;  1JX4 A;  1N0U A;  2WVF A;  1YBA A;  2YBV A;  1JK9 B;  3LOU A;  3MHY A;  3E01 B;  4Q2M A;  1JNZ B;  4OYP A;  1Q5Y A;  3W60 A;  1YBU A;  2FB0 A;  5B09 A;  4DL5 A;  4DL3 A;  5J2M A;  5CXT A;  3HSD A;  3T1H J;  4MTP A;  3PR5 B;  1P8G A;  3DRS B;  3FGV A;  3MTK A;  3VV2 B;  3NS6 A;  4EK2 A;  2UZA A;  2KG0 A;  3NL0 A;  1S12 A;  4O4G B;  4R0E A;  4RW8 A;  4P72 A;  3MEG A;  1NJW A;  1UW9 A;  3D68 A;  4HHJ A;  3TQE A;  4F3M A;  1HNW J;  2C3U A;  3R5B A;  1OWX A;  2HNZ B;  4KQZ A;  5A8K B;  4WTY A;  4CLT A;  2K3I A;  1RT6 A;  3O2I A;  4LVO P;  4CLW A;  5L39 A;  1YJU A;  3HDS A;  4N8N A;  3S8S A;  1EP4 B;  2LMI A;  1U1R A;  2MZR A;  5ETR A;  4B9M A;  2D9P A;  3CCZ A;  2HKE A;  4RW9 B;  2W9C A;  1RT7 B;  3TAN A;  2R8J A;  2CJX B;  2FC8 A;  1HLW A;  2GCF A;  2PGC A;  2W2O P;  3PJ9 A;  5A8W A;  2AT1 B;  3NOG A;  1FEE A;  1S49 A;  1TKZ A;  2JVO A;  3A3O B;  3N6M A;  1N5T A;  4CM2 A;  4E98 A;  3S01 A;  1Q78 A;  1UFK A;  1LNQ A;  2O01 C;  3NAI A;  4UY8 5;  4LRE A;  3FK4 A;  5L9X A;  3MMB A;  3OL9 A;  2BX6 A;  3EM1 A;  5DZ6 A;  3SZ2 A;  3CJ5 A;  4NCA A;  2GQC A;  4TY8 B;  3BS9 A;  1JLQ B;  4USW A;  2P9G A;  4DR4 F;  1Y00 A;  2GML A;  3LGH A;  2D3Z A;  4KT0 C;  4C4W A;  1N48 A;  4WP3 A;  3K89 A;  1WUU A;  3J81 U;  4LF9 J;  3FBE A;  1U49 A;  2LQ8 A;  1ZM4 A;  1HQE A;  4WFA Q;  5EX3 A;  1M1K T;  4GKK J;  1RE1 B;  1MMN A;  3H2U B;  3FSI A;  1YHQ S;  1B64 A;  1YJ9 S;  1K0V A;  4KTQ A;  2V4J B;  4KHP J;  2LXI A;  2GC8 A;  3VTI A;  3ITH B;  1U1N A;  3PO5 A;  2FD2 A;  4BS2 A;  2WBR A;  3K5O A;  2ZHB A;  5D4N A;  4G1P A;  2VDI A;  1N5Q A;  4L76 A;  4AFF A;  2I6W A;  2XCA A;  2DR9 A;  2LDY A;  1DTQ A;  2C2N A;  1RP5 A;  2FQQ B;  2DTJ A;  3J7Z 5;  1S0N A;  1IBK J;  3GCW P;  2FLN A;  3NG8 A;  1QVF R;  3I0S A;  1SPB P;  1U4B A;  1PKU A;  2MY8 A;  3M8R A;  1JJ4 A;  2YWG A;  1XBW A;  3L7P A;  4GO5 X;  3UCG A;  4IDK A;  2ZVS A;  4X4N A;  4OYI A;  4UY8 T;  5KFL A;  2KYZ A;  2XYG B;  4OV6 A;  3H98 A;  4LF6 J;  1WHV A;  2ALZ A;  3ELH A;  4CLF A;  1RT2 B;  1QAJ A;  1FER A;  4ED8 A;  5LM7 E;  4XPE A;  5KAK A;  3R5J B;  5HMW A;  2PT0 A;  1VIO A;  3HHL A;  3O3L A;  1YRX A;  4J5O A;  3SFG A;  1KFD A;  2Y8Y A;  1DFD A;  1NDP A;  3D6H B;  2W01 A;  3QO9 B;  4F04 B;  1IR0 A;  2M5Y A;  2ZUG A;  5LJ3 Y;  3UN2 A;  3ENQ A;  1HWK A;  3F0N A;  2F65 A;  3FMB A;  3NMA A;  1F9E B;  1HI8 A;  2KT3 A;  2JX2 A;  2BE7 D;  2YQ3 A;  3FUY A;  2CZV C;  3NGK A;  4OJH A;  4OX8 A;  2HBR B;  4Q44 A;  2C2D A;  1K8A T;  4ILR A;  1PSD A;  2V5H G;  4FYY B;  1HNZ F;  2HUR A;  2R7Q A;  1U1P A;  2HFO A;  2XLK A;  1VDH A;  2NRE A;  4OHX A;  2FIU A;  4LSN A;  2OH2 A;  4HKQ A;  3ZXW A;  3BKT A;  4YN3 B;  1RQ0 A;  4KH0 B;  2PO4 A;  4YUD A;  3JSY A;  5HAN A;  2P6S A;  2HQF A;  1NXI A;  1WG5 A;  2KU7 A;  3GCX P;  3NBP B;  5CZV A;  2ZH9 A;  2PSZ A;  1T03 A;  4OYO A;  2Y1R I;  1U24 A;  4IOA Q;  5IM0 B;  4NLQ A;  1MLA A;  2RDI A;  2VFR A;  5LL6 d;  1CQN A;  4B08 A;  2HWH A;  2MQN A;  3CNQ P;  4FPR A;  1DZ5 A;  3PHE A;  3BBF A;  3CO0 P;  4LSZ B;  4DR3 J;  4QZV B;  2GO9 A;  3MF5 A;  3C3L A;  2VKR A;  2XZW A;  1HWJ A;  5FDL B;  1HIY A;  4NLV A;  2B56 A;  1YIT S;  5AE3 A;  2OHD A;  3CVK A;  1WC5 A;  2DEI A;  1JLE A;  2XBP A;  5E7O B;  1TV6 A;  2YWF A;  1RAI B;  4P2F A;  5ETO A;  2HLT A;  2DGQ A;  4GO7 X;  4DUZ F;  2FVR A;  2V8H A;  1EKS A;  2XMM A;  2DIS A;  2X51 A;  1LWC A;  3GSD A;  1DQ9 A;  3S7R A;  3KYL A;  3EGZ A;  2R7V A;  3BYP A;  4TVA B;  3Q8U A;  1OYE A;  2V68 A;  1IKX A;  5GAD I;  2KG1 A;  4D3H A;  3HF5 A;  3G6V A;  4JYA F;  4J9U E;  5KFW A;  2J9D E;  3PR4 A;  2E44 A;  4C9D A;  1DTQ B;  5ETT A;  2DGU A;  2M9K A;  2RDD A;  4PG6 A;  5LSO A;  1VC6 A;  1NJX A;  1NME B;  2HK2 A;  1VQO S;  2U1A A;  1RAD B;  1YJR A;  3BPD A;  1O8B A;  3EVO A;  4YFU A;  2CZ4 A;  1X4D A;  3GYX B;  4ZP8 A;  4J37 A;  1FJG F;  3QYY A;  3PFO A;  2DNQ A;  3K8W A;  2N7Y A;  2ZKT A;  1EAR A;  4I69 A;  2CIM A;  3GIR A;  3CCJ S;  2YKQ A;  4QJV A;  4IQM A;  4YHH J;  3U02 A;  2ZBQ A;  5E3P A;  1SBR A;  3G71 S;  1PYO B;  3KWM A;  2DNO A;  4O44 A;  5K5M A;  3KLG A;  4F36 A;  1I94 J;  1UEK A;  1CS4 A;  2BVZ A;  1WC4 A;  2ZBI A;  1JIH A;  2ZBC A;  1LEO A;  3W2W B;  1WC6 A;  5C25 A;  4PWD A;  2MEW A;  2C3O A;  4X4P A;  3G96 A;  4FBT A;  3R97 A;  5F8J A;  3MMC A;  2OO4 A;  1Z2Z A;  2YKN A;  5BXI A;  2UV8 A;  4ID8 A;  3J81 Y;  4ZJL A;  3OFE A;  2O66 A;  1F6T A;  3MEE A;  2FLP A;  2DNR A;  4DX7 A;  1WEX A;  5A8W B;  2MZT A;  2QLJ B;  4N5S A;  2XQC A;  4NXM J;  3MM9 A;  3DXS X;  2J5A A;  3WQP A;  3AJ1 A;  2W1B A;  2Q6C A;  2V50 A;  3M8Q A;  4X4O A;  3G4S S;  4PUO A;  1R6V A;  4AUK A;  1FFW B;  3E2E A;  3G6Y A;  2D69 A;  3K17 A;  4NZ6 A;  3PKM A;  2W9B A;  3H90 A;  5CH7 B;  1VHI A;  5KT2 A;  3ONQ A;  3I96 A;  4OMF G;  4P9S A;  2HFS A;  3IP0 A;  3PJX A;  4KFB B;  5IT9 U;  4UT4 A;  2V2K A;  3I9V 9;  5KFR A;  3CDU A;  2W9B B;  4LFC F;  1X4H A;  4RLE A;  5AJ3 F;  4DR2 F;  4LF7 F;  1GXL A;  3DXB A;  3M2U A;  2KM8 B;  3OXG A;  5HO4 A;  4P7V A;  1C0T A;  5KFF A;  3M8Q B;  3AD8 C;  2QX0 A;  3O5T B;  2CJY B;  1XER A;  2EK1 A;  1O5J A;  1Y9O A;  1FXR A;  4C6A A;  1I6J A;  2DD8 S;  5L1I A;  4OHY A;  5I4M A;  4IO9 Q;  4FXV A;  5D0E A;  5IV4 A;  1JLB B;  3VHQ A;  1JQG A;  3DRR B;  2WCX A;  3ENA A;  4UZC A;  5M2P A;  2RDJ A;  4CCH A;  4DPY A;  2FZC B;  2J6T A;  5KFB A;  4L74 A;  3D1H A;  1IKV B;  4JB8 B;  5A2Q U;  5A2Q Y;  1SJ3 P;  1KQS R;  1ZBT A;  2HGN A;  2KHD A;  4Y2M A;  1RT1 A;  5C25 B;  4FDF A;  2BJ7 A;  2DH9 A;  3W2W A;  1QAI A;  4DBQ A;  2RML A;  1RI7 A;  3LAM A;  4FPI A;  4CZC A;  1ELO A;  4BC9 A;  3JB9 k;  1PO6 A;  3EGN A;  2QA4 S;  2N82 B;  4JI1 F;  1VBX A;  3UDV A;  1GNK A;  2AJ4 A;  2MHE A;  2PE8 A;  3IAM 9;  3H40 A;  1UA0 A;  3DMJ A;  4KIA A;  4NE9 C;  4MYU A;  3KDN A;  3A3P B;  4X2B A;  2CPF A;  1S1U A;  3EYZ A;  2OIH A;  3SQG A;  2XM3 A;  2EG2 A;  4AYB D;  4OJ3 A;  2VG6 A;  1NJZ A;  1TL7 A;  4FKX A;  3NNA A;  1Q8B A;  3KMS A;  4WFY A;  2ASD A;  3CUN A;  2VFU A;  1KR4 A;  4ZPC A;  3AHP A;  4OZ0 A;  5G0R B;  1FK9 B;  5K8O A;  1ZM3 A;  1F0X A;  4ETZ A;  4RL1 A;  1U1O A;  4DN9 A;  4B9S A;  3PG9 A;  3NCQ A;  2YWH A;  1N33 J;  2LYV A;  4ED1 A;  3HSG A;  4Q43 A;  4K2X A;  4C3L A;  1DQA A;  2HHU A;  1S99 A;  3QWP A;  2IJF A;  2R2U A;  3VVT A;  1SKU B;  2EPI A;  2HRT A;  3FFI A;  2XS2 A;  2YNF A;  2AV5 A;  2OPS A;  4ZP7 A;  3KLH A;  4DQI A;  1ZM2 A;  3IN5 A;  2DH7 A;  4A48 A;  1K1Q A;  4KR0 B;  5KG6 A;  4USI A;  3POT B;  2QFI A;  4YHH F;  1ZTW A;  4P52 A;  3A8K A;  5H9F J;  1Q7Y T;  5DG8 A;  3TI0 A;  2IRY A;  2X1A A;  4K4W A;  4LMZ A;  5CYM B;  2AYG A;  1VQK S;  3OL7 A;  2O5D A;  2LQ9 A;  3DDN A;  4OX9 J;  2R7O A;  1H72 C;  1PBU A;  1NK6 A;  4DV6 F;  2W2N P;  2VBZ A;  3CD7 A;  4O4R A;  1X4E A;  2CAD A;  1ZA2 B;  4C8M A;  2HBQ B;  4JI4 J;  4RUH A;  4J90 A;  4ZVP B;  1RTJ B;  2ZE2 B;  3L7O A;  4LSN B;  3ZZO A;  2H5J B;  1YLX A;  3SQO P;  2PFF B;  2BXJ A;  1S1V A;  2ZC4 A;  1IKY B;  3BBC A;  2KDO A;  2D7S A;  2K2P A;  3A12 A;  1S1T B;  3V5R A;  4CI0 B;  1WSV A;  4UZB A;  3HHK A;  2ZH3 A;  1JXE A;  1REV A;  2DO4 A;  3OTC A;  2EVZ A;  3VQT A;  1FTC A;  1LWF B;  3L9Z A;  5C7P A;  3DLE A;  5GAE I;  4XO0 A;  4ZHR A;  1LWX A;  2NXJ A;  4CO1 A;  4GVL A;  3GON A;  2R7U A;  2HFZ A;  2BQ3 A;  1XMB A;  3QT7 A;  1WC1 A;  5C42 A;  3FRY A;  2GJI A;  2MST A;  2CDR B;  9RUB A;  3UR0 A;  2PFD A;  3OTO F;  4I67 A;  2JEF A;  5IWA F;  3WC2 A;  2B4U A;  2XMT A;  1PAE X;  3ZNJ 1;  2Z58 B;  4ZN1 A;  4DS4 A;  1BC6 A;  1RWV B;  5IFM A;  1RKJ A;  3IBW A;  3LWL A;  1RHJ B;  4L75 A;  3S1T A;  4DSJ A;  3PX6 A;  2VC0 A;  2R2S A;  4F4A A;  1K0T A;  1TUW A;  2H5E A;  1UVN A;  1CPZ A;  4W90 B;  1LWE A;  1WKL A;  4ZVO B;  2HQD A;  4P2X A;  4JI6 F;  3TAR A;  4LFB F;  4LF6 F;  2FGC A;  2ZKU A;  3IR7 B;  1V5V A;  4G6V B;  4IFY A;  2KH9 A;  5CYQ A;  3CDW A;  4WPA A;  1YJV A;  1WOR A;  5KFC A;  4IG3 B;  4DV1 J;  4PYD A;  1WD6 A;  4ZVS B;  3PY8 A;  2A0F B;  2A3J A;  2YX4 A;  1VBK A;  4IRD A;  1B70 B;  2VU5 A;  1R0A A;  4WYW A;  2XMU A;  3OPK A;  1D9A A;  3X3U A;  3G6E S;  5IZH A;  3M8S A;  2VFT A;  4YR0 A;  4KGX B;  1FRL A;  4DPT A;  3IFE A;  3ULH A;  5KFD A;  1YJN S;  1D1U A;  2LXU A;  1URN A;  1RAH B;  1HBN B;  4PYA A;  3RU0 A;  4M95 A;  1OY6 A;  4CQ1 A;  1FHT A;  3H42 A;  3HPO A;  5HK4 A;  4ILM A;  3JXO A;  2YWK A;  1BY9 A;  4HI2 A;  4K7Q A;  4DCO B;  3DOL B;  2MXY A;  3WHI A;  6FDR A;  2VB6 A;  1FE0 A;  5KFU A;  3OT9 A;  1ACM B;  2H5I B;  4ZLJ A;  2RB7 A;  3J7Y U;  2VJV A;  4M5M A;  5E3A A;  1S72 S;  2RU9 A;  1I1G A;  4AT1 B;  3I0R B;  1NSK L;  4ZHR B;  5L46 A;  1CBK A;  3FBB A;  4DV4 J;  4A8K A;  3PZP A;  2HMI A;  4GKJ J;  4RPF A;  2JEJ A;  1VFJ A;  1VQ7 S;  4L73 A;  3TJ9 A;  1M5V C;  2CNK B;  1S1V B;  2FJE B;  5CYQ B;  3VR1 A;  4J91 A;  1TKZ B;  4XDD A;  2DPI A;  2MYF A;  1BMQ B;  4DL7 A;  2CNN B;  2VKZ G;  1RTJ A;  4PAA A;  2J6U A;  3Q2T C;  2B4O A;  2KL8 A;  2V4R A;  3LAL A;  4OZ2 A;  2XWX A;  3PX0 A;  1RT7 A;  3R2C J;  5MAO A;  4J9Q A;  2YNG A;  4DR5 J;  3LA0 A;  3NCP A;  2BQR A;  4M94 A;  2F8E X;  4F4Y A;  1XQI A;  3CME S;  4TYA A;  5LMN J;  1VQ4 S;  3PHT A;  2FHJ A;  1R0B G;  2YVS A;  4MH8 A;  2CDQ A;  2YNI B;  1GTE A;  4KSE B;  2MMY A;  4KY3 A;  2A10 A;  4L72 B;  3BV8 A;  5AXL A;  2J0S D;  4OHZ A;  3T1Y J;  4GKK F;  1V9O A;  1UEV A;  2E9R X;  4LF5 F;  5DG9 A;  4USK A;  4B02 A;  4F3O A;  1VQM S;  1U2R A;  4PQA A;  3MM7 A;  2J7W A;  1IUJ A;  4HDG A;  1B0P A;  1WC3 A;  4ECR A;  2GAG C;  3P45 B;  3E01 A;  5E2Q A;  1RK8 A;  3ZO7 A;  1R27 B;  4WK3 A;  2DNH A;  2RSQ A;  3C6U B;  1EB0 A;  3MUR P;  4L3K A;  1KOO A;  2MLX A;  3OFG A;  4JI8 F;  3TA0 A;  2ADB A;  1HNI B;  1NO8 A;  2GX8 A;  1VIS A;  5ETS A;  3Q8Q B;  2ZM6 F;  2V69 A;  2APO A;  2OSR A;  3DLK A;  4AXI A;  3VAI A;  2UXC J;  3SCL E;  4HEA 9;  2DO0 A;  2QFJ A;  1X4A A;  3LP2 A;  5HLF A;  2D9O A;  3OR2 B;  4YDD B;  3ISN D;  4AQY J;  2F4V J;  4A4J A;  7FD1 A;  1BHN A;  2ZC3 A;  3N0V A;  2R42 A;  2R4F A;  1TL7 B;  5GAD U;  4EI2 A;  2VG7 A;  3POT A;  3UWT A;  1U47 A;  1YQH A;  4UOC A;  3R27 A;  4LBP A;  2FZK B;  3A8E A;  1LK5 A;  1VHF A;  2EI5 A;  5IS2 A;  1KLM B;  2ZHA A;  4AL6 A;  4OL8 A;  4IG0 A;  1SV5 B;  2XMW A;  1KQF B;  5KFJ A;  2R8H A;  1HW9 A;  1NKE A;  2B8Q A;  4CT8 A;  2NR0 A;  4J9V A;  2DNG A;  4U6P A;  4JI7 J;  2JRS A;  4WTO B;  1JLC B;  1FK9 A;  4MT1 A;  3D5M A;  4DL2 A;  4P7T A;  4LF4 J;  1JLA B;  1UJ6 A;  5IQQ A;  4F7V A;  2B5J B;  5EWF A;  1RJJ A;  1S4E A;  5F0W A;  3MEC A;  2KRR A;  1W7W A;  2XG8 A;  1WG1 A;  1WG4 A;  2XSJ B;  4I4B A;  2K06 A;  4F0H A;  2UXD J;  1REG X;  1WTF A;  4I7F B;  1FWP A;  2IIH A;  1MWY A;  1RBL A;  4QW8 A;  1CC8 A;  2M52 A;  2RIJ A;  3AH6 A;  3IGN A;  1C0T B;  3DHX A;  1PAU B;  5FII A;  5ETQ A;  4A8S A;  1RDR A;  3I82 A;  1U26 A;  4IH5 A;  1R8B A;  3EWG A;  2HHS A;  1UKU A;  3DOM A;  5F8G A;  1NK5 A;  3QFW A;  3CCS S;  2XI3 A;  2XZD B;  4KFB A;  3Q8S B;  4UW2 A;  3DYA B;  1FKP A;  2DNM A;  2XLI A;  1K9M T;  2GAH C;  1DTT A;  4DR4 J;  2DRD A;  5G4D A;  4URG A;  3CJ8 A;  3EDR B;  4NLP A;  3EIC A;  3QGI A;  1KTQ A;  1XR7 A;  3RZA A;  3DKD A;  5HJX A;  2HIQ A;  2E1C A;  3KXD A;  2W25 A;  3AOA A;  3HKZ D;  4OZN A;  3JS9 A;  4QR0 A;  2CNL B;  1T9Y A;  5KT6 A;  4HR2 A;  1HBM A;  1T8E A;  3CJS A;  2ILZ A;  2FVQ A;  5HAT A;  3L7U A;  2Q3P A;  2O1P A;  1Q53 A;  2LEB A;  1S9E B;  5I42 A;  2KVI A;  2YNH A;  2BDP A;  4KJI A;  2YKN B;  3VZI A;  2RRN A;  4LFB J;  1TK5 A;  3GTY X;  1Q86 T;  4DDF A;  3G82 B;  3LPY A;  4QBU A;  4RNO A;  3T5K A;  2EFQ A;  2IFX A;  4M5G A;  1S6P A;  3DI6 A;  1H0H B;  4P2S A;  1RUS A;  2LKZ A;  5BYR A;  4ZS6 A;  5L8R C;  3T5J A;  3FQK A;  1X9S A;  3DGV A;  1J27 A;  1WHX A;  4OI6 A;  4C8L A;  3CIZ A;  4ED4 A;  3M2R A;  1TFW A;  2HS4 A;  2UVV A;  4JI2 F;  3S6E A;  2WK4 A;  2ZJQ Q;  2UXB F;  5LSR A;  4ZJO A;  2IBK A;  3KLV A;  4ES1 A;  2XTJ P;  1SJR A;  1YG0 A;  2VQE J;  2DHG A;  3H5S A;  1Y5N B;  4LRC A;  1TTH B;  4DF8 A;  3FCW A;  2IAJ B;  2ABY A;  2RE1 A;  4ZA1 A;  3W5X A;  5B0A A;  3IRX A;  1S57 A;  1JLA A;  2IVF B;  3MUM P;  4ZVR B;  2ZNZ A;  2OP5 A;  4BWJ A;  4DPX A;  4ES2 A;  1YI2 S;  4ILL A;  4X65 J;  3MMC B;  3AQP A;  4X4U A;  3DCA A;  1BQM B;  1SB6 A;  2OEK A;  2MTL A;  4TLR A;  4CH1 A;  4YB7 A;  1BQN B;  1KLN A;  2GVZ A;  1UZH A;  3EMT A;  4C3K A;  1RTD B;  1CS4 B;  3GSI A;  2PEH A;  2WTF A;  2OSQ A;  5IC4 B;  1SV5 A;  4DV0 J;  4LR8 A;  4J9R A;  5A8R B;  3Q83 A;  2E7X A;  1NBE B;  5IT9 Y;  5T7L B;  2HRY A;  1FT8 A;  3UO0 A;  3MR2 A;  1S1W B;  4RO0 A;  3TEG A;  4N8O A;  5T41 A;  1RWU A;  5I3Q A;  3DRP B;  1N36 F;  1M5O C;  1HYS B;  4AL5 A;  1MN7 A;  3OW2 R;  3O8W A;  3J80 U;  3KJV A;  3PAC A;  5EHH A;  4E2F B;  4LRD A;  2EBE A;  5C2G A;  2N4C A;  2XCP A;  5LMN F;  2UUW A;  3TQ1 A;  3BRE A;  4KYZ A;  3PIO Q;  2HND B;  2BKN A;  1O6X A;  2MZS A;  1Q8K A;  2BAN A;  2QL9 B;  2Z2Z A;  3H5U A;  1U1L A;  1LXN A;  2UUB F;  1NSA A;  1KON A;  2RS8 A;  2NYH A;  2FLL A;  3FBF A;  1VRT A;  1TUG B;  3HVW A;  3NRB A;  4FKY A;  1Z1Z A;  1WJ9 A;  3EDQ B;  1CJV B;  3J81 j;  4K4Z A;  1IBC B;  2BE9 B;  2OAU A;  4KPC A;  5DM6 Q;  3C6U A;  3EVM A;  3JSR A;  2AP6 A;  3GFX A;  1F9H A;  1XNR F;  1M90 T;  2DRA A;  5A0Y B;  3I9Z A;  4F02 A;  1WEZ A;  1UPM B;  4LSL A;  2Z30 B;  5JUM A;  1P1T A;  5JXS A;  3MM7 B;  2VFV A;  4NI2 A;  4MYT A;  4A8X A;  3ZZ0 A;  2XS5 A;  3GG1 A;  4M5H A;  3U1L A;  3VVU A;  4CWB A;  3BSN A;  2Y0B B;  1X7V A;  3MPV A;  4LIR A;  4NCG A;  2E9T A;  2NUU G;  2H65 B;  1RHK B;  4KPY A;  3QRQ A;  5DRK A;  2YNI A;  2F4V F;  1MSW D;  3RB3 A;  1XNR J;  3H4B A;  2B6A B;  3K5M A;  1JJH A;  2B3T B;  4PQU A;  1U8W A;  2PA3 A;  2NYI A;  4LRB A;  3VWS A;  4BLG A;  1ZAW A;  4DV0 F;  2XY5 A;  3C2P A;  1LFW A;  5A0Y A;  1I51 B;  1WEL A;  1M5H A;  2DGS A;  3D67 A;  4CO0 A;  2J7U A;  3SEO A;  4LF8 F;  1RYR A;  4N76 A;  4DPW A;  2L9D A;  2QEX S;  1QE1 B;  3ILJ A;  1CJV A;  4X4V A;  2D3O 1;  4O3S A;  2JL9 A;  1NK8 A;  4Q0B B;  4C8Z A;  1WAC A;  2JNJ A;  3VGS A;  5CD4 H;  1Q5V A;  2OUG A;  3I0S B;  3JTN A;  1RTH B;  3R7N B;  5DQH A;  1VOM A;  5SZT A;  4O3R A;  1ITP A;  1KBR A;  3ZTS A;  3GV5 B;  1JWW A;  3MR6 A;  2IA6 A;  4HHH A;  2E66 A;  1A0O B;  1RBA A;  2DNN A;  2FGO A;  4UQG A;  1DRZ A;  1H98 A;  2MY7 A;  4EBE A;  1TP7 A;  2AW0 A;  3ENV A;  2GVD B;  4J9P A;  2MQL A;  1PC4 A;  4K4Y A;  1FXL A;  2UXB J;  1H3D A;  2ROG A;  5D15 A;  3HK2 A;  2ACM A;  1GAO A;  2DVI A;  3OFH A;  1B99 A;  4HVZ A;  5T7L A;  3W9H A;  4CNY A;  4DV3 J;  2ZBR A;  1AZS B;  2CVE A;  5THW A;  2OGU A;  3VGU A;  2BJE A;  3VAJ A;  1HR0 F;  4NZ0 A;  5DLG A;  2LCW A;  1XTZ A;  4GVB A;  4W4M A;  1BQN A;  3M8Y A;  4B3T F;  5F3Z A;  4TY8 A;  4IDK B;  2W8L A;  1PG5 B;  4J9S A;  1HWL A;  1SC6 A;  2DNL A;  3M2V B;  1SQG A;  3R5G A;  4IG3 A;  4CO2 A;  5LOQ A;  3N6N A;  3THV A;  1MNE A;  1NH8 A;  3IRX B;  2RRA A;  2O67 A;  1T05 B;  4WZM A;  4AXJ A;  3H25 A;  4M5D A;  4YY3 J;  2B4P A;  1SL2 A;  4NEY A;  5KFK A;  2VPW B;  4WJB A;  2XWY A;  2ATL A;  2HFU A;  3SBM A;  4QPT A;  2LEC A;  1EJ7 L;  2W9A A;  2PN6 A;  3V6J A;  2AGP A;  5D8H B;  3OSN A;  1H38 A;  1Q4R A;  1X0P A;  1XR5 A;  3T19 A;  1BGX T;  4TU8 A;  4LFA J;  1N5Y B;  2UU9 F;  3Q22 A;  3ZZP A;  3MEK A;  1DQ8 A;  2MKH A;  5HP1 A;  5AXM A;  3UDC A;  4XK8 C;  1VC5 A;  4JV0 A;  4ETX A;  2R7W A;  3U7J A;  2ERR A;  3MD3 A;  1JLQ A;  2CUY A;  2V0N A;  3K57 A;  1URR A;  5GVQ A;  3T6J A;  2ZD1 B;  1NHK L;  3R6L B;  3ADA C;  1QUV A;  3R3T A;  2IRU A;  1UWA A;  1VR6 A;  1N33 F;  2MQQ A;  3RRH A;  5C24 A;  1X4G A;  3HLU A;  1RHQ B;  2BRL A;  1HMV B;  2JVR A;  3TVK A;  5C42 B;  3T5H A;  3KLF A;  1XIQ A;  4OYA A;  2BBE A;  4PWU A;  1HBM B;  3BKF A;  4ZVF A;  2FJD B;  4QWE A;  1U1K A;  4W92 B;  1X60 A;  2HPU A;  3O6Q A;  2I1R A;  4P2M A;  1ZET A;  4YDX A;  2JFD A;  4ICL B;  5IOL A;  2D1C A;  1B4S A;  4MK8 A;  5B0E A;  1JXV A;  2ADC A;  1SH3 A;  2F3J A;  2CJK A;  1N5S A;  1KDN A;  2BE2 B;  2L3M A;  4YB1 P;  4NYZ A;  2R7X A;  2OI2 A;  4WIQ A;  1GQE A;  4ZLN A;  5L1K A;  3TP2 A;  2M0G B;  1NH7 A;  2VUG A;  4Q5V A;  2VA3 A;  1HNX F;  1GMW D;  1TL4 A;  4ID5 B;  4K8R A;  1OSC A;  2W8K A;  1N6Q B;  2WAQ D;  3MR5 A;  2E1P A;  2VZ9 A;  3SSR A;  3CUL A;  2HHV A;  5EN1 A;  3JYT B;  3OLB A;  4EYI B;  4RZR A;  1HBU A;  4IOB A;  4ZP6 A;  3JQJ A;  3GMG A;  2NPF A;  5F41 A;  1YWX A;  5EUH A;  5EWE A;  2HVE A;  3SCK E;  4ZJQ A;  1OIA A;  2XSJ A;  1T9X A;  2HW3 A;  1HQU A;  4DL0 C;  2XS7 A;  4DR7 J;  2AF6 A;  2NXE A;  4X62 J;  2KT2 A;  3CD6 S;  3EJM A;  5E3Q A;  3OTE A;  1HD1 A;  1OMS A;  2MZQ A;  1JLC A;  1FRI A;  1K47 A;  3BEG B;  4DUY J;  2HZV A;  4X84 A;  2H54 B;  4LR7 A;  1T11 A;  1R8C A;  3RAM A;  1RWW B;  3AB2 B;  2AIR B;  2AGO A;  3GIK A;  4CH7 A;  3ZZY A;  3TO8 A;  2VG6 B;  1KEK A;  3OVA A;  1PJ7 A;  4NPO A;  1T9T A;  1WHY A;  4PXD A;  1GX5 A;  5KFG A;  3FRZ A;  3W1Y C;  1DLO B;  3QRP A;  3RRK A;  1YZ6 A;  2BJ9 A;  4X66 J;  4K59 A;  2JEG A;  2ZBP A;  2NZC A;  3BGO P;  1Y5L B;  5H9F K;  4EBC A;  3ISN C;  4RUB A;  5CHC B;  5KFA A;  1MRO B;  5DS7 A;  3IR5 B;  4RBT A;  2HQI A;  3ISZ A;  4JOU A;  3DGP A;  1CUL B;  1IJE B;  1IN0 A;  1VGY A;  2X3D A;  4YR3 A;  3DLK B;  4HH0 A;  1OSD A;  4I6A A;  4CP5 A;  3JAM Y;  2I5J B;  3AOC A;  4Y28 C;  1EHW A;  4OZJ A;  3I6P A;  1RWK B;  5HQ8 A;  1QTM A;  3CMQ A;  2WBM A;  4DXL A;  3D6M B;  3FQL A;  4R8U A;  1BWE A;  3D6F B;  3FCV A;  4Z37 A;  2XNR A;  1E6V B;  3V6K A;  3I87 A;  2HQ3 A;  2R7T A;  2PII A;  4HAC B;  1M1G A;  1YK9 A;  4DR2 J;  1FFG B;  5B0G A;  3NWG A;  3CCT A;  3MD1 A;  5HAO A;  2GMJ A;  1N6Q A;  3KNA A;  1H2V Z;  1DAR A;  3CJ0 A;  1TL3 B;  1KN6 A;  3H4D A;  2DNY A;  2EG1 A;  1LV5 A;  4WZQ A;  2MKS A;  4NLY A;  2AZ1 A;  3HKW A;  2AJF E;  1SIW B;  2FPH X;  2RKI A;  2V8V A;  3B4M A;  3HHE A;  3ILO A;  2XEX A;  2V9W A;  3MED A;  4LF9 F;  4N47 A;  5H1S V;  2XZT B;  2H4W B;  3A8J A;  1VJQ A;  1J5O B;  3LF0 A;  4PUO B;  3GFY A;  3LO3 A;  4ICL A;  1IM4 A;  8AT1 B;  4JP8 A;  3T9Z A;  1OJ4 A;  2DR8 A;  3QGP A;  1N52 B;  3TX0 A;  3HFZ B;  1VLY A;  1CJU B;  4KGK A;  1U7L A;  3V81 A;  5A6W A;  4JYA J;  1IXK A;  4CLS A;  4O0N A;  3TYT A;  3HXM A;  4DV4 F;  1SKW A;  1NB2 A;  3EGW B;  3LP1 A;  4YB6 A;  2VPX B;  4B9V A;  1RAF B;  4FF2 A;  1JLG B;  2V34 A;  4IH6 A;  4QWA A;  5ETV A;  1T3O A;  2XI2 A;  3M1V A;  1SUQ A;  4HTJ A;  4ZVQ B;  2CQB A;  4PWD B;  2ZD1 A;  4ZCK A;  4F0K A;  2VOP A;  3IMQ J;  4RW7 B;  4U8Y A;  1Y3J A;  3I0R A;  4ZIW A;  5HBM B;  1QTN B;  3MFI A;  2R7R A;  1U48 A;  4ERD A;  3V6H A;  2KZZ A;  3CDB A;  4EWT A;  4IOC Q;  1R43 A;  3M05 A;  1GTH A;  2UV8 G;  4KH1 B;  5J1N A;  2IPO B;  3BDP A;  4CLU A;  3NGD A;  1VCT A;  1Y7P A;  5F8I A;  1YRT A;  3W2V B;  1ZTT A;  1WNE A;  2L08 A;  3D6T B;  5HVH A;  4BBY A;  2MDA A;  4CLY A;  4ZKA A;  4OHV A;  2E29 A;  2W4C A;  3TNV A;  2WON A;  2BJ1 A;  2H1Y A;  5KFZ A;  1HNV B;  4FBU A;  3NWR A;  4PEO A;  1VRU B;  3C16 B;  3PO4 A;  2JSX A;  2IJN A;  4NWB A;  5C2C A;  3LH2 S;  4M5D B;  2M88 A;  2ZNY A;  2EBG A;  3DLL Q;  2AJQ A;  2XYH B;  1GMW A;  1R0A B;  2HHP A;  1NJY A;  1MML A;  1X4C A;  5K14 A;  3W8G A;  2W24 A;  4ZIT A;  2QTW A;  1S9G B;  4X62 F;  3Q0A A;  4DS5 A;  4MAK A;  1IKX B;  2WSC C;  1X8D A;  2ZOF A;  3AOB A;  4M5K A;  4ZPB A;  4ED6 A;  2C42 A;  1RU1 A;  1JLF A;  2DXD A;  4OYM A;  1QAX A;  3RRG A;  1XWL A;  3GJQ B;  2C2K B;  1WOO A;  2DR6 A;  2GW8 A;  4NLU A;  3EE3 A;  5E5N A;  3W65 A;  4C7Q A;  1KSP A;  3QJL A;  1CQM A;  1RAO A;  3O1L A;  2HG4 A;  1H7W A;  4Z7Y A;  1N54 B;  2CWX A;  4LQ3 A;  2E1R A;  2HAF A;  4DFK A;  1L3T A;  4M63 A;  2KTQ A;  4RR5 A;  2HHH F;  2MGZ B;  4BDP A;  1VLO A;  4R0J A;  1SQE A;  4YP3 A;  5I3U A;  2IYG A;  2WB4 A;  4OJG A;  5B7W A;  4QU6 A;  1ZS6 A;  1RZM A;  2OFH X;  5D78 A;  3ZZZ A;  5ITH A;  2P9E A;  4M5J A;  3FVY A;  3DLE B;  4EU0 A;  3W5Z A;  4B3O A;  1T03 B;  3CD0 A;  3NBP A;  5J2Q A;  1IJF B;  1S1T A;  1M0S A;  3D2W A;  1IKY A;  2VD3 A;  5EX0 A;  3PEH A;  3G8Q A;  1DAX A;  5KFV A;  4Q2L A;  3AFG A;  1TVR B;  2VBW A;  1WHW A;  2XUL A;  3NCR A;  4WU3 A;  2FY1 A;  2V4Q A;  1A9N B;  5KG2 A;  3OXL A;  2J8S A;  2ROE A;  2Z57 B;  4RBU A;  4QW9 A;  3MAQ A;  3QT5 A;  1OY9 A;  3D54 A;  1MU2 A;  2DYA A;  3GYN A;  2B7C B;  2E5I A;  3BM7 A;  3RAX A;  5EWG A;  5DO2 A;  3FEY B;  1TMM A;  3HHL D;  3TZW A;  4PQU B;  4NRU A;  1HW8 A;  1AA1 B;  1MWQ A;  2WZ1 A;  1KOH A;  1EET A;  2L9W A;  1NZA A;  3CJK A;  3QNW B;  3SYZ A;  1G2E A;  2XO7 A;  3EPI A;  3CCE S;  5IXU A;  2QG9 B;  3JTP A;  1SL0 A;  2MKJ A;  3DLB A;  1RT4 A;  1UET A;  3QGH A;  1C4C A;  4TN2 A;  3K5N A;  2G4B A;  3DDK A;  4NI2 B;  4C2M A;  2BAB A;  1B7Y B;  2P2C B;  3BYR A;  4K4X A;  2YNF B;  1XN9 A;  2BOP A;  3FFI B;  3N6L A;  2CFX A;  2ROP A;  4F50 A;  2HHT A;  1KP6 A;  4ZPV R;  3QRR A;  1RWO B;  3MUV P;  1IQZ A;  1HKA A;  3U1M A;  1PIL A;  2B7B B;  4CO3 A;  4B9N A;  1SI9 A;  2M4M A;  1FDA A;  2WW4 A;  3B8H A;  2G2Z A;  1F5B A;  2ZDO A;  2PI4 A;  2JLF A;  3QJJ A;  1C1C A;  3DOK B;  4U7U K;  3TWZ A;  3BH6 B;  3CDE A;  3Q86 A;  2I2Y A;  3H59 A;  3NXZ A;  3T9N A;  3M30 B;  5F9N A;  2N7C A;  1HR0 J;  3MCM A;  3IRW P;  2FJB B;  2EW9 A;  4U96 A;  4ZPW R;  1ZAX A;  3KJV B;  2J8A A;  4OI0 A;  4K4V A;  4IKA A;  4CIO A;  3SQG B;  4WXW A;  2B9X A;  1S1U B;  3VAL A;  4YQW A;  4ED2 A;  1XMQ J;  2MSS A;  4ELT A;  4Y65 A;  1QDU B;  1S48 A;  4JUZ A;  2DHA A;  4MKY A;  4ER8 A;  3N9U C;  5D4P A;  3CCM S;  1D09 B;  1KRP A;  1AYE A;  1JB0 C;  2A2D A;  3T6B A;  1WTB A;  2V8D A;  1IBM F;  1CLF A;  4KB7 A;  3PIP Q;  2CQ4 A;  4FF1 A;  5GAG I;  3RR7 A;  4ED5 A;  4ENO A;  2DHX A;  3Q8R B;  3P4U B;  3CSK A;  4NYO A;  2CNO B;  3CB4 A;  4YME A;  5ETP A;  2C2R A;  3N28 A;  2YKM A;  4EMD A;  3PW7 A;  2NSB A;  2BYC A;  3I31 A;  2ACY A;  2AMC B;  2IJR A;  4OHW A;  4A46 A;  3SDE B;  1C1B B;  3CD5 A;  5D6G A;  1NB7 A;  4EGL A;  3JQM A;  2X1F A;  3CT9 A;  4RW9 A;  2FJW A;  1XR6 A;  1IBL J;  3UN3 A;  5J2P B;  3M2U B;  5KFO A;  2JC1 A;  2ZWO A;  1UCN A;  4C8O A;  2YQ1 A;  4OZL A;  3PRB A;  2HHH J;  2HNZ A;  4U7C A;  3ICL A;  1OS5 A;  1RCX B;  1AXQ A;  3PEJ A;  4KRW A;  4OZ1 A;  1QAY A;  4DG1 A;  1LOU A;  3DRY A;  3MCS A;  4LBH A;  2JWN A;  3BO3 A;  3GQC A;  1N4L A;  1S6P B;  3DI6 B;  4O4G A;  1RTI A;  4RNF A;  1VQS A;  1Z2L A;  4QIE A;  2VBY A;  3P96 A;  5LSL A;  3CCQ S;  3H7H B;  1EIY B;  2Q66 A;  4ED3 A;  2YNH B;  1WI8 A;  5J2M B;  4TU9 A;  3MM9 B;  4YY3 F;  3D4J A;  3T41 A;  3R7B B;  4RNN A;  1QVG R;  1Q8L A;  2D74 B;  2QLW A;  1U2F A;  2K1R A;  2KI2 A;  2ILY A;  1NPP A;  3MEE B;  5HN0 A;  5KFN A;  3BQ2 A;  3TUP A;  2BJD A;  1PJ6 A;  2BR0 A;  3W8P A;  3WZ0 A;  2GJ2 A;  3MR7 A;  4K5R A;  1TK8 A;  4UUW A;  1F1B B;  2NXN A;  1FD2 A;  3A1Y G;  2HIY A;  1NK4 A;  4WK1 A;  4DUZ J;  3BQ0 A;  4M5N A;  3PW0 A;  3LGN A;  3MM8 B;  3QLH B;  1HFE L;  1U0S A;  2QSF A;  3N01 A;  4C48 A;  4ZMM A;  3A8I A;  1S59 A;  1SXL A;  1T94 A;  2KYX A;  3BDE A;  6FD1 A;  4NLW A;  1V3Z A;  1FWL A;  4LF1 A;  1MW7 A;  1X5S A;  2RNE A;  3AQO A;  3LW5 C;  2ZZM A;  2IA0 A;  1IWG A;  1Q16 B;  2PDA A;  2WVB A;  3EXY A;  3LTO A;  2H9Z A;  4ZPT R;  3UDL A;  2AX0 A;  3PRV A;  5JJB A;  2VQF J;  2AWZ A;  4B9U A;  3LGM A;  4DR3 F;  1RLC L;  1S6Q B;  1YDL A;  1X9M A;  1S0O A;  3KHG A;  4I7F A;  1G6B A;  2IM3 A;  3FEZ A;  4R5P A;  4RWX A;  1IKW A;  2ZUA A;  1PBA A;  4NLS A;  4RBV A;  3I32 A;  2IMW P;  3BN4 A;  3MEC B;  5D0H A;  4CYU A;  4DV2 J;  3G86 A;  3JAM U;  3GFZ A;  5F8L A;  4RU9 A;  2DPJ A;  1RBO B;  4J9O A;  1Y4Z B;  3JSB A;  4JI4 F;  1LWC B;  2A18 A;  4PXC A;  5LJ5 Y;  3GE9 A;  1XNQ J;  5D3G A;  3QJP A;  4M5I A;  2Y1L B;  3HJV A;  3K58 A;  4F67 A;  1UFW A;  1AUD A;  1YBT A;  4Y0F A;  2KXF A;  4MIW A;  2EFP A;  2DNK A;  2Z0G A;  3D1O A;  5FDL A;  3CED A;  3RAQ A;  1FJE B;  1HAR A;  3KHR A;  3LQV A;  4K5S A;  3UFC X;  1HWU A;  2WSF C;  3QBC A;  1WKJ A;  1EZZ B;  2IC3 A;  2JDJ A;  2VG7 B;  3A3N B;  1TAQ A;  4GC6 A;  2VPY B;  3L09 A;  4DQS A;  3PJW A;  1B0T A;  3M7V A;  4ECX A;  3OQ2 A;  4FZV A;  5D77 A;  4YOE A;  2VPZ B;  2ZH5 A;  2C2M B;  5F8N A;  1B7F A;  2MQ8 A;  2JC0 A;  5HLF B;  1BXN A;  2HRU A;  1FX2 A;  2QV6 A;  4ZVT B;  5IM0 A;  2VON A;  1LQ9 A;  4YS2 A;  3HZE A;  3THP A;  4ZPD A;  1HNI A;  4LVN P;  3PYD A;  2ASL A;  5K8N A;  3LWM A;  4C8N A;  2QL5 B;  2L48 A;  1P1L A;  3CJ3 A;  4C11 B;  2G9O A;  1VMB A;  4ECV A;  4DLG A;  1FKO B;  4PWW A;  1VJW A;  2ZOM A;  1R7I A;  1YJT A;  4QCL A;  1FI4 A;  1OQ6 A;  2YKP A;  3GIL A;  4Q8F A;  1NLK L;  8ATC B;  4X64 F;  2F5G A;  4S0M A;  1Q81 T;  3TVY A;  3SSQ A;  1B0V A;  2H51 B;  2OTL S;  1W25 A;  1SJ4 P;  4X66 F;  3FNN A;  4NRT A;  1X4B A;  1M5K C;  3VQS A;  5JVH Q;  1GK8 A;  1IR2 A;  2X7I A;  3NGS A;  4N56 A;  2NZ4 A;  2LXF A;  1H7X A;  4Y2C A;  3NKY A;  4Y34 A;  2B0G A;  1YJW S;  4OIX A;  4V19 X;  1FNM A;  4QYZ J;  3OD2 A;  3QO9 A;  2JJ4 D;  3OTD A;  3TX8 A;  3VF0 B;  4X4Q A;  3V4I B;  1KNZ A;  5M2U A;  1SUQ B;  4DSI A;  1W2I A;  2YNG B;  2ZJP Q;  1VBZ A;  5D4L A;  3TZX A;  3FZB A;  2UP1 A;  3HHL B;  3MZI A;  3US5 A;  3T3F A;  2RJZ A;  3F44 A;  1S76 D;  2OPR B;  1V3R A;  4FF4 A;  3C15 B;  1S6O A;  2GZO A;  3PW2 A;  3FJ2 A;  5K20 B;  3V81 B;  5KT3 A;  4LF4 F;  1ZAV A;  3Q8V A;  4U9R A;  3RG6 A;  2OPR A;  3TR5 A;  5AXN A;  1F2G A;  3FDS A;  2QIF A;  3WC0 A;  4GKJ F;  4NAS A;  4OX7 A;  4BWM A;  3KJF B;  3TAM B;  2MKI A;  2E1M C;  3QSY B;  2RHQ B;  3GB0 A;  1OO0 B;  1RCO B;  4PG4 A;  5AT1 B;  1HD0 A;  5AE1 A;  2DJW A;  3KK3 A;  3GR0 A;  5DGA A;  2N3O A;  3JTO A;  2HFV A;  3IWX A;  3NNC A;  2F4F A;  2KKH A;  4UUX A;  3CCU S;  1KS2 A;  4EZ6 A;  3ITH A;  4FP9 A;  4XDC A;  9ATC B;  4ECY A;  5IWA J;  2V4J A;  2QN6 B;  5KT5 A;  1QM9 A;  3LP0 B;  1B3T A;  1HWI A;  1ZM9 A;  2VFS A;  3I5B A;  4OX6 A;  3OV7 A;  3MM5 B;  3KDO A;  4NMX A;  3OL6 A;  2LEA A;  2WVD A;  3EVW A;  5HL7 Q;  1VC0 A;  5GAG U;  2VF3 A;  3IXQ A;  3NOC A;  1E6V A;  2CQC A;  2G13 A;  3HD1 A;  4UOG A;  2HQG A;  3W64 A;  1NM2 A;  2X1B A;  3C46 A;  4KV8 B;  1YKW A;  1UVL A;  4ZCI A;  2CQ1 A;  2CQ0 A;  2VAS A;  3NGR A;  1ICE B;  1NHV A;  4KGM A;  3TVZ A;  4OV1 A;  2CJQ A;  1CUL A;  3RYL A;  3UVJ B;  3OL8 A;  4JI6 J;  4WU2 A;  4HTI A;  2IHR 1;  2CQG A;  4HT5 A;  1LWE B;  3HT3 A;  4CO5 A;  2Z4P A;  3QFH A;  2XMA A;  3MMA B;  3GIM A;  5CAA A;  2BMB A;  3J7A 1;  3NS5 A;  2FHM A;  4NL5 A;  2VC1 A;  1YZ7 A;  4ATN A;  3V6D B;  3A13 A;  2AZ3 A;  2LU2 A;  4CH0 S;  1EP4 A;  2N4D A;  2E5J A;  2QA2 A;  4DL6 A;  1XMO F;  4LT6 A;  4DHV A;  1I3O B;  4DFM A;  1NZ8 A;  1CJK B;  2YX7 A;  2NS1 B;  3BGL A;  3F41 A;  1JKH A;  1GMV A;  1LK7 A;  1CC7 A;  1R89 A;  1RGV A;  3TA2 A;  1HBO A;  4GMK A;  2RUG A;  4CRJ A;  2RU3 A;  4DV5 J;  4J9L A;  4DSK A;  5GAH I;  3NNH A;  2KB2 A;  3MI7 X;  4DQQ A;  3J7A N;  4WE1 B;  2CYY A;  1L3K A;  1LWF A;  1TL5 A;  2RF2 A;  1REV B;  3DRS A;  4RW6 B;  3K8V A;  4CNZ A;  2HFN A; 
#chains in the Genus database with same CATH homology
 2E5L J;  4KYZ A;  2MQ8 A;  1IBK J;  3IMQ J;  1XMQ J;  4NXM J;  4DV7 J;  1XNQ J;  4B3M J;  4X64 J;  4PWW A;  4LF6 J;  4K0K J;  2KVQ E;  5BR8 J;  4JI0 J;  4LF7 J;  5LM7 E;  4JI7 J;  3D3C J;  5IT9 U;  4LF4 J;  2UXD J;  4JI5 J;  4HHU A;  4B3S J;  4DV1 J;  4LF8 J;  1IBL J;  1XNR J;  4DR7 J;  4X62 J;  2HHH J;  2UUA J;  4JI8 J;  1FJG J;  5AJ3 J;  5A2Q U;  1XMO J;  4DUY J;  4DR4 J;  1N36 J;  2UUC J;  1HNX J;  3W1Y C;  3D3B J;  4DV4 J;  4GKJ J;  4X66 J;  4LFC J;  4LFB J;  4DR3 J;  3T1H J;  4B3R J;  5IWA J;  2UXB J;  4DUZ J;  2KL8 A;  4DV3 J;  1HNW J;  3R2C J;  1HNZ J;  4DR6 J;  4V1A k;  4JI1 J;  3OTO J;  4DR5 J;  5LMN J;  2VQF J;  5LMU J;  1J5E J;  4JI3 J;  1N33 J;  1N32 J;  3R2D J;  4KY3 A;  2VQE J;  2UUB J;  3T1Y J;  1N34 J;  4DR2 J;  4JI6 J;  4YY3 J;  4DV2 J;  4DV6 J;  5FLX U;  3JAM U;  4JV5 J;  2UU9 J;  4NEY A;  4DR1 J;  4NXN J;  4X65 J;  2MTL A;  2ZM6 J;  4NEZ A;  4OX9 J;  4YHH J;  4LFA J;  4LF5 J;  4DV0 J;  1I94 J;  4JI4 J;  3J81 U;  4DV5 J;  4LF9 J;  2UXC J;  3J7A N;  1HR0 J;  4GKK J;  4JYA J;  1IBM J;  2MEW A;  4AQY J;  4KHP J;  3J80 U;  2F4V J;  4B3T J;  4JI2 J;  4RJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...