2KVQE

Solution structure of nuse:nusg-ctd complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
80
structure length
80
Chain Sequence
NQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRSRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NusE
publication title A NusE:NusG complex links transcription and translation.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 16
structure length 80
sequence length 80
ec nomenclature
pdb deposition date 2010-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 2kvqE00
4DR3J 2VQFJ 1HNWJ 1XMQJ 2HHHJ 3W1YC 4DR2J 4X62J 5IWAJ 4DUZJ 4JI8J 5IT9U 2UUAJ 1J5EJ 2UU9J 4AQYJ 4PWWA 1N33J 4LF6J 2VQEJ 4KHPJ 1I94J 2UXBJ 4DV1J 4DR6J 5A2QU 1IBLJ 2F4VJ 4LF8J 4LF5J 4NXNJ 2UUCJ 2KVQE 5LMNJ 4LFAJ 4X66J 4DV0J 1FJGJ 4JI3J 4DV2J 4JI4J 4DV5J 5BR8J 4K0KJ 4LF9J 3R2DJ 1N34J 5LM7E 4DV6J 2E5LJ 1IBKJ 1N32J 4RJVA 4OX9J 4DR5J 4X65J 3J80U 3OTOJ 4DV4J 2UXCJ 5AJ3J 4GKJJ 4B3RJ 4JI0J 3IMQJ 4YY3J 4JI2J 4JV5J 4DR7J 3T1HJ 2MEWA 2MTLA 1HR0J 4JYAJ 4JI5J 4NEZA 4LF4J 4JI6J 4NXMJ 4GKKJ 1N36J 1HNZJ 4JI7J 5LMUJ 2UUBJ 4X64J 4LFBJ 3D3BJ 3J81U 4DR4J 1HNXJ 5FLXU 1XNRJ 4YHHJ 4LFCJ 4DR1J 1XNQJ 4B3TJ 3J7AN 4V1Ak 4KYZA 2ZM6J 4DV7J 2MQ8A 4DUYJ 4DV3J 3D3CJ 1IBMJ 3R2CJ 2KL8A 4LF7J 4HHUA 1XMOJ 4KY3A 2UXDJ 4B3SJ 4NEYA 3JAMU 4B3MJ 3T1YJ 4JI1J
chains in the Genus database with same CATH superfamily
3DM2A 1FRXA 4RW7A 4O3QA 1FRKA 2LQ9A 5KFDA 1HWUA 4EYIB 3CF5Q 3VTIA 1W2IA 2H51B 1FJEB 2Y1IA 4TYAA 3OHBA 1MSWD 3R7NB 3ET6B 1G4CA 4DUYF 4NI2B 3WHIA 1ICEB 3DDNA 4USVA 2GX8A 4DLGA 3EWGA 3VVUA 2QMUB 4LVNP 4OI1A 2HK3A 4C3MA 3HMJG 4DF4A 2ZJQQ 1U1QA 4C97A 2D41A 3BQ0A 2F4VF 4WF9Q 2C2RA 5LJ5Y 2FVCA 2P5VA 3D3BJ 1GQEA 2D3UA 1Q7YT 2XG8A 1I51B 2LA4A 3TVKA 2MQOA 3H4DA 5I42B 4O0IA 1T03A 3HVWA 3BSCA 3BGRB 2BM1A 3PRBA 5KFEA 2XI3A 4BLGA 2X3DA 3OT9A 2ZOMA 3HSZA 2DD8S 2W2NP 4XIUA 3CT9A 3PKMA 2HNYB 1RABB 1E6VA 2FHJA 4UW2A 4PQAA 4BWJA 4WP3A 5DQIA 3H59A 3PRVA 4LUBA 1ZYQA 3R2DJ 1H3DA 5LM7E 1RKIA 1OYEA 5I42A 1H6KX 2KT2A 3BGRA 1VQ4S 2XYGB 4ZKAA 1N5VA 2BZ2A 1FK9B 5BXIA 3D0HE 3TAQA 4QIVA 1R43A 2Y8WA 1N5TA 4P74A 1RJJA 2G2OA 4PXEA 5IXUA 2MGZB 2HNYA 1QAXA 2ROGA 2YX1A 2CZVC 5D78A 1R89A 3Q8VA 2FTRA 3CVKA 2HVDA 1FRMA 3R2CJ 2VJVA 1FFSB 1Q7LB 1RTIB 5K8OA 3BGFA 5ETTA 2E1PA 4IO9Q 1EJ7L 3OD2A 1FK9A 2ZFHA 2ALZA 4ZVQB 1UA0A 1XJWB 1ZTTA 4NXNJ 1UWAA 1C4CA 1RK8A 2G1HA 4DSEA 1G1XA 1UAWA 2MGZA 3RBXA 3FCWA 2HMIB 3KJQB 4WU2A 5E3AA 5IOLA 1HI8A 4I64A 2RS2A 4QIEA 5IQQA 1SC1B 2ZWPA 3TX0A 4J90A 5D15A 1OY8A 3LPYA 4R25A 5HBMB 4ICLB 2E1CA 1S9GB 1S12A 1K0TA 4WZMA 1IM6A 1GXUA 4P75A 1KKHA 4ZHRB 1SC3B 3PYGA 4KGMA 2HFOA 3IGVA 2CPXA 3RW6A 3CULA 4R0EA 2A18A 2EW9A 3KHRA 1TK8A 4Y00A 4WTOB 5KFAA 1FWPA 4JI1J 2WTFA 2NLWA 5C24B 4JI7F 1HHTP 1OJ4A 2PT0A 5HBMA 4ICLA 3HHLB 2G0CA 4RLEA 4QCLA 2LQ5A 3D1QA 3U1MA 4DV7F 1S9EB 4R5PB 3LAMA 3EYZA 4ZMMA 5U47A 4DSFA 5KFFA 3CO9A 1X5SA 2QZ8A 4NCBA 2YWHA 1XBWA 3IP0A 5F8JA 2NR0A 3EZ5A 3SMZA 1FVSA 1T9UA 2PO4A 5C24A 4KPYA 4AT1B 3PCOB 1FD2A 3BREA 1TFYA 4WP8A 2CQDA 2VASA 4N8NA 5KFIA 2UUBJ 4JI3F 1UVMA 3HHLA 1YBTA 3KDOA 2LXUA 1S9EA 4J9PA 2JLFA 4R5PA 4KGVB 1S1UB 4YUDA 2BJDA 2IFXA 1RACB 3L7OA 3JTPA 4RNHA 1TUWA 4Y6IA 3EPGA 1MROB 3RAMA 4OYPA 2XWYA 2UV8G 1VI7A 2KJWA 1CJVB 2VZ9A 1JK9B 2QC3A 2W7AA 3RZAA 3DHXA 4NLSA 3RB0A 2IPOB 4CO2A 2UUCJ 2ZM6F 3TOQA 2MB0B 4CH1A 4ZPWR 4DU8A 3EUNA 1EETB 3BS9A 1S1UA 3EVOA 3M6VA 3EMTA 3LOUA 5FD1A 4CT8A 1FEHA 2X1AA 4TU9A 4ILMA 1MROA 1QVFR 3IAM9 1IQZA 3KXDA 1CJVA 2DPIA 3SFUA 3TZWA 3DU6A 4JYAJ 3D5MA 1SH2A 3P3DA 3NBPA 3KLHB 2AJ4A 2XI2A 4PYAA 4NMLA 4C8KA 3TQ1A 1YBUA 4KYZA 1NJWA 2NYIA 1EETA 4U95A 2J6UA 2GFFA 1HIYA 4Q8EA 2JEJA 2ZOGA 4KQZA 3R1HA 2C22A 2AZ1A 3GIRA 4M63A 4CCHA 1TKTB 1S72S 1RI7A 1WD6A 4Y2KA 2H5EA 4LFBF 3I9ZA 4PWWA 2MKKA 2VQEJ 3BYRA 3KHGA 1W26A 1WHXA 2CNNB 2FJAB 4RBVA 5DLGA 3PHTA 5EN1A 1MWYA 2AZ3A 3IN5A 5GAHU 2AEMA 1REGX 4YOEA 1RHJB 4RJVA 2PFFB 3QSIA 2C3PA 2GJIA 4RU9A 3L09A 4KHPF 4FYYB 3W5ZA 4OX6A 3N6LA 1YK9A 2NXUA 1TKTA 5D4PA 5LMNF 2RDDA 5HANA 1GMWA 1V3RA 2AX0A 2L9WA 1GEHA 4Y2AA 1RTJA 2V50A 4LR9A 1UTAA 3TEGA 2EI5A 3GQCA 5KFUA 3OSNA 4BC7A 2IJFA 3CC7S 2ABYA 2Z30B 3O5TB 3QLHB 1KVJA 4GMKA 2KDOA 1T7PA 1NHVA 2YX7A 1RT1B 5B0FA 5ADZA 3Q83A 3OL9A 3PW2A 4OZLA 1V3ZA 4B9NA 1Q5VA 2DGSA 3LP2B 4UOCA 1BY9A 4ECYA 4LT6A 2JJ4D 4YS2A 2F9JA 3WX8A 4WYWA 1OQ3A 1VFJA 1B64A 3GR1A 4LBHA 2R7WA 4V19X 5D0EA 1S1TB 1H73A 4CLTA 4IQMA 3FBFA 1YIJS 1FE4A 3QFWA 4UOGA 1VC5A 3QLHA 5DM7Q 2RQ4A 2PD1A 2EVZA 1L3VA 2CDRB 1RT1A 3DRPB 1YRXA 1RA7A 2BE7D 2RJZA 4I1TA 1I5OB 5L1JA 3LP2A 4L73A 3TJ8A 5LOQA 4UOFA 3Q8YA 1FFWB 3W64A 1DAXA 4WWSA 4G3IA 3KLGB 3VWSA 3DFEA 4ECQA 5HVHA 2IYGA 4O0NA 1QE1B 5KFSA 4LSZB 3ZZUA 4B9LA 1RSCA 4W92B 2L08A 2FUG9 4P72A 3AFGA 1EX8A 3DKDA 5KT2A 3SI8A 1PO6A 3KHHA 4M5DB 3DRPA 2H5JB 2QSWA 1UA1A 1JLEB 1JLFA 2WONB 5JXSA 4X4VA 4Q5VA 2W9CA 2E29A 1DFDA 4NLRA 5BR8J 1D09B 1LQ9A 1N52B 2P9GA 3C15B 2ROEA 2LDIA 3KLGA 3DLHA 2EC2A 1QE1A 4BBYA 4A8SA 2HK2A 1PGZA 1IBLF 4CT9A 3NLCA 3I87A 1SIZA 4KJIA 2XYPB 1CJKB 1WI8A 5A8KA 2IVFB 3QMQA 4TY9A 1KHVA 2HNZB 4Y3CA 2ZC3A 4M5DA 2RIJA 3HDSA 5KFPA 3EZUA 1JLEA 4E0DA 2WONA 1Q0NA 4F7VA 4AUKA 4ANDA 1NDLA 2AYMA 5L38A 3MR3A 3C15A 1QTMA 4F8RA 4G65A 1QAJA 3MM9B 1F2HA 3GILA 2HIYA 5E3RA 3A8EA 2V2VA 4TLQA 2K3IA 1CJKA 3TA2A 2UUTA 2H4YB 2HNZA 1SJ4P 1NJYA 1VQMS 4F4YA 2GIRA 5J1NA 4X4RA 1KWMA 3UCUP 1K1QA 1Z2ZA 2X1BA 2Z2LA 2ZH3A 1PAEX 2QX0A 2KI2A 2R8GA 3P8BB 2EFQA 1N8RT 2ZH4A 1N4LA 2ZEJA 2QO3A 2E5JA 3AA8A 1WOOA 4IOBA 1KEKA 2FD2A 2JEGA 2IA0A 2XMJA 3MM9A 4UQGA 1S9FA 2KXHA 2KN4A 2YNHB 4GVBB 3NG8A 5GAHI 1XNQJ 3HD2A 5ITHA 1KBRA 4UOHA 3PY8A 2VONA 1UW4A 2KM8C 2PI4A 1TK5A 4MFBB 3W3SA 1ZPWX 5KFMA 2VG5B 2RQCA 3JTOA 3K5PA 4ANCA 4DQIA 1M1GA 1DZ5A 1VDHA 2RU9A 3Q0AA 4CYUB 3QAUA 3DU5A 2L3MA 3CCVS 3RB3A 4E8UA 1EQ0A 4GVBA 4OZ0A 3CO0P 4D3GA 3DXSX 2B5JB 1K8AT 4TXSA 3HPOA 4NWBA 4OJ1A 1RZMA 3VAGA 2DHSA 1NM2A 1IR1A 3LWMA 3N9UC 3CB4A 2DGQA 2NUUG 1KD1T 3S8SA 4MFBA 3Q8QB 3FUYA 3QZ7A 2VG5A 2D9OA 2BX6A 1FKPB 3EZOA 1NZ8A 1Q78A 3B78A 4RO0A 3AHPA 2IIHA 4CYUA 2NCKL 3T41A 4HACB 5L1IA 3W7BA 4DI6A 4Z7YA 2B5JA 1UJ4A 1YSJA 1KHWA 1U8SA 4EI2A 2IJNA 4KHRA 1RTZA 4X62J 3OR2B 3BGOP 1QM9A 3JYTB 3QRPA 2OD4A 1FKPA 1JJCB 2R42A 2M0GB 2J76E 2ZH6A 4JB8B 4L3KA 2AU0A 4UUXA 1YG0A 2AYGA 4HACA 3M8QB 3CMQA 3MPVA 3UD3P 2E5LJ 1FX2A 1HW9A 3HSJA 2J9DE 4CLPA 2YKPA 2EG2A 4ED8A 3J80U 4MYUA 2DNOA 4PG6A 2OAUA 3HFKA 2Z58B 4HL9A 1M5VC 3GFHA 2ERRA 4NXNF 1GK8A 1WOPA 3OR2A 3H5UA 4NEZA 3BKTA 4RW4B 1FCAA 3QNWB 3D6TB 3JYTA 4FS2A 4FVMA 2ZNYA 4ED7A 1HBNB 2B4VA 4OL8A 4HI2A 3M8QA 5CZXA 5HATA 2XMWA 5T41A 4U8YA 2AJ0A 4N7TA 3CGIA 2HHPA 4HR2A 4LRAA 3H5YA 3RRKA 2FLPA 3ZZPA 3QIPB 2OTJS 3RAXA 5KT7A 3MTKA 3K0JA 3GIIA 1HI1A 5CYMB 4RW4A 5GMKa 4Y65A 2FJDB 2DNRA 2IY5B 2BJ8A 4WIQA 1HBNA 2E1RA 2C2ZB 2JEFA 3OSPA 3C16B 5KG5A 3DRSB 4JI1F 2CVEA 1SQGA 1NK6A 4A47A 2L9NA 1VRUA 2BACA 3HM9A 4RNFA 4ECVA 3DLGB 1U2CA 2BJ3A 1RISA 3AJDA 3UE2A 3W61A 4QU7A 1MW7A 5CYMA 1XNRJ 3IR7B 3DLKB 4EGLA 1WI6A 4MTPA 2MLZA 4DV3J 5KFLA 4RL1A 2ALYB 3C16A 4Y28C 2DO4A 1S0NA 1FFGB 2XLIA 1WELA 2EK1A 2IM0A 2DNMA 2CPZA 5F9NA 1Z4UA 2UUBF 3BR8A 1VRQC 1YJ7A 1JIHA 5B7WA 1WKJA 3NGSA 2VPWB 2KVQE 4LSLA 3WC0A 2P8IA 4YDDB 4M5GA 1NNDA 1HQUB 1VBYA 3TVZA 3DLKA 2KFZA 1U0HB 1UZDA 1VMBA 1YJWS 2GS8A 4OX9J 4QW9A 3PYFA 3TP2A 3OBIA 3QGHA 3AD9C 2GVZB 1AXQA 3IBCB 1FXRA 1RAJA 5KFJA 2UUCF 3SCJE 4RU2A 4KPCA 2OPSB 2HAFA 2VDHA 2AJ2A 4TU8A 1Q16B 4IR1A 4F4XA 2KFYA 2CQBA 1C2PA 2DY1A 5HO4A 5ETLA 1HQUA 3E2EA 3D54A 4OHZA 2RQKA 1SIWB 2ZZMA 3S01A 3NNAA 4IRCA 1UKUA 2FJVA 4HHHA 4JYAF 5D4NA 1R6YA 1UL3A 4F67A 1S59A 2JC1A 3IR6B 4PXCA 4ZLNA 2UVWA 2RUGA 3PX4A 1RAFB 2PA8D 1NHKL 4IRDA 3FRYA 3BF4A 4Q45A 1NB7A 1QSSA 2OPSA 2V4JB 4NLDA 5GAGU 4EZ9A 4WKYA 4ECXA 4XO0A 4AL5A 4QWEA 1JNRB 2BQUA 3HZGA 3W65A 5F0WA 4DV6J 3B8HA 1HHQA 1NXIA 2HG4A 2BMBA 5CXTA 1U7LA 4KTQA 3TYTA 2QSFA 3PX6A 1LW2B 4O3PA 3G8SA 3T9NA 4NL5A 2VQEF 3QBCA 3T5LA 3MPDA 2FY1A 1KLNA 4I68A 3R5GA 5HVGA 1BHNA 3AB4B 4LIWA 3NWRA 3QT8A 1XK8A 3NS5A 5LSLA 2V4JA 4LFCJ 1B0PA 4L75A 3B6BA 2F5GA 4U9RA 2XEXA 2QGFB 2I0XA 1M1HA 3Q23A 3MM8A 4PYDA 3D3CJ 4WJBA 1BQMB 4AE5A 3OPKA 1HNWJ 1LW2A 2FZCB 3POTB 1PCAA 1U48A 2KU7A 4CLSA 1OSCA 2VH7A 2BE9B 2IRYA 2XB2D 2H3EB 4TNOA 4E98A 2DJWA 3NEKA 1HD0A 5K9FA 3V6KA 4M5KA 1TMJA 2IMOA 1NMEB 3SYZA 5KOWA 1BUXA 1BQMA 4P7TA 4OI6A 5CD4A 2XGPA 1SCJB 3CJ5A 4L6V3 2OO4A 2CQ3A 2XO6A 5KFOA 1YJ9S 3WIUA 1YITS 3POTA 4H4OB 4URGA 4ZVOB 1JX4A 1NU4A 2V4RA 1RWWB 2ZH9A 4NE9C 4YHHJ 1WG5A 4M5LA 1B4SA 1SKUB 2CQIA 5K5MA 3KHLA 4J9KA 3MURP 3HHNB 1TUGB 2YNGB 3FJ2A 1HPZA 5IC4B 2F7VA 3OL6A 3RUBL 2IC3B 3DCAA 3NCPA 3OFHA 5DDRC 2I5JB 1RT3B 1I3OB 3I31A 4G1PA 3SV4A 2R2UA 4CLZA 2GHVC 4H4OA 5KFQA 1SBRA 4ES1A 2WB4A 2XZDB 2CKWA 2RNEA 4EO6A 1S7IA 2E5HA 3FMWA 3HLUA 2W7OA 5ETOA 2KXNB 2ZDOA 2YNGA 5IFMA 4GO7X 2IC3A 1NPRA 4H4KA 3WIVA 3LALA 3UDVA 5F8LA 2I5JA 1RT3A 4X64J 5BR8F 2OMOA 1O5JA 3H4BA 2AEFA 1K73T 2OUGA 2VV5A 3TZXA 3PIOQ 4C0BA 1LWCB 5A0YA 2UVUA 2KL8A 1RUSA 1UJ5A 2Y9HA 1HD1A 1TZ0A 3A1YG 5DLFA 4M5MA 1OPZA 1NSKL 2FHOB 2ZBRA 4JV2A 1IWAA 3SSQA 3BM7A 5A2QU 2V8DA 2DNQA 3BBFA 3PJXA 2GHPA 1S4EA 3TNVA 4X66J 4FKXA 1X9WA 3N01A 1WACA 1T9XA 2M7SA 2EXUA 4ZVFA 3LAKA 1VS3A 2CYYA 1LWCA 3R5JB 3DXBA 4J9MA 3PW7A 3ILLA 3DOLA 1TMMA 4DR7J 4EBEA 1KFSA 4DN9A 5GAGI 4DN0A 3IM8A 5F0UA 1KQFB 3THPA 1UCNA 3CJQA 2CVIA 5ETKA 4IOAQ 4QW8A 1M5KC 1ZH5A 2QTWA 4HDGA 4OZ1A 1AZSB 3LGHA 2HHUA 3MMCB 1IBCB 1L3TA 3VR1A 1HARA 1T11A 2KG1A 3MF5A 2XTJP 1JNZB 2XYHB 1NCLA 3UN2A 3GYGA 4FZVA 1P9QC 1XNQF 4Q8FA 5KFRA 4LF5J 2EG1A 3O44A 1U1NA 1PAUB 2R7VA 2F65A 3CCUS 2M88A 1D3WA 1R31A 1WHVA 2I8EA 2FZGB 1N48A 4IH7A 3D6MB 2C2DA 1ZM9A 4FF3A 1AZSA 2LMIA 1H72C 2E7WA 3MMCA 4PKDB 3E01B 3GB0A 5ETRA 3OTOJ 1NK9A 1F0XA 3T6BA 1U09A 1U1RA 1TVRB 4PG5A 3QRQA 1R8CA 2VG7B 1N56A 2N3LA 1RE1B 2GMHA 4M5IA 3OL7A 3F73A 3GLJA 1HNZJ 2HBQB 4F3MA 4DS4A 1IR0A 2DNKA 4F0KA 1LXJA 4IOCQ 2AD9A 5AE1A 3HVRA 2PSZA 2AGPA 2KHDA 1WEXA 4P2FA 4EBDA 1X4BA 2MZQA 2PMWA 3E01A 2WSEC 4C8NA 2A6MA 3JSMB 3NP5A 3R3TA 4N41A 3GONA 2VG7A 4CI0B 4X4SA 4USKA 1K9MT 2EC0A 3QFHA 2WVEA 4LBIA 2YH0A 2DT9A 2OGUA 4C4WA 2RDIA 4H4MB 1YVFA 1GTHA 5B09A 1Q8KA 2Z8QA 3LP0A 1RU1A 5DETA 1AT1B 5H9EJ 4OMFG 4X62F 4EO8A 4ZP9A 1O8BA 4ID5B 4ILRA 4HEA9 1PJ5A 1LFPA 2O5DA 2CUYA 3MEEB 3LW5C 1KVIA 1JKHA 3F56A 4ERDA 3VQSA 2HHXA 1FJ7A 3DHWC 1HI0P 3RTVA 4DR4J 3KLFA 1WTBA 2E5LF 3QATA 1P27B 1LWFB 2C42A 1VISA 2B7CB 4ZVHA 4FF2A 2DRDA 2WSFC 3PR5B 4DCPB 1MWQA 3KLEB 2P9EA 3G86A 2B43A 3AOBA 1X4AA 3TZYA 4HDHA 3GG1A 3UCZP 4AL6A 1S97A 2VBWA 1Q81T 4ID5A 3FVYA 4O4RA 2LP4A 2FB0A 4OYZA 1EB0A 2KYZA 3MEEA 1X4FA 4WE1B 2XY7A 2GHWA 3R7BB 2Q1LA 3OL8A 4EU0A 1FXLA 2B4UA 2EBGA 3AB2B 1CQNA 2V4QA 2GA7A 1LWFA 3ADAC 3L9ZA 1DQ9A 2IJRA 1B0TA 5L9XA 3KLEA 2VFUA 4I2QA 3GSIA 3OVBA 1ZM3A 3CPWR 3KNAA 5KG3A 3R5DA 1F9HA 4I4BA 4WXWA 2E9RX 4M5HA 3R97A 1UFWA 3VAKA 1YJNS 4Q43A 4J7CA 4NLQA 1U49A 3P6YC 5LMUJ 2M3DA 3J81Y 3F0NA 2VOPA 4WE1A 1AA1B 4GVLA 3IBWA 3K7RA 2HHSA 1NUEA 2VFTA 2H9ZA 3HKZD 4IFYB 2LQ8A 2DR8A 1QTNB 3KUEA 1OIAA 5E41A 4UY85 4B3MJ 3IR5B 1C0UB 2AJQA 3MGJA 4WK3A 1V9OA 1SJQA 3W5YA 3UR3C 2ROPA 5T14A 4M94A 1N5YA 1XNRF 2JLGA 4NZ6A 2HFUA 2YH1A 4ZCIA 2V2ZA 4DV3F 2PMHA 2POKA 3D28A 2CJQA 3EX7B 2Y1RI 1S6QB 1IBKJ 2V2KA 3F41A 1CPZA 2AMCB 1C1CA 3RG6A 5DG9A 1RGVA 2DIUA 4HH0A 2BANA 2FGCA 4JV0A 1C0UA 2ZUGA 3AD8C 4MK7A 3PDNA 2RRAA 3ZO7A 1HR0J 4HHJA 5ETNA 2ASJA 2HRTA 4NLOA 2RMLA 2W7PA 5ETPA 4C0HA 2MSSA 4OX9F 3HHLC 5AXKA 4NPOA 4ZCLA 1TL1A 3D7SB 2JC0A 2LQJA 4D3HA 2DISA 3NGKA 2UUAJ 4DZDA 1X4GA 3AODA 1TFWA 3X3UA 3UCGA 2O66A 4DL6A 5DG7A 2HLUA 1PYSB 1GAOA 5HMZA 1ZZFA 2B3TB 5B0EA 4USMA 4I67A 3NXZA 1VBKA 3W9IA 2HWIA 2XNQA 2C2EA 3VZIA 2EKNA 4ES2A 3E51A 3PFOA 3VALA 5J2MB 2QLJB 1XR6A 1KNZA 5HQ8A 2HFNA 3CDWA 3ZZRA 4ED3A 2X7IA 5GMDA 1JLGB 4F25A 1LNQA 2F63A 2QLFB 5H9FJ 1XEZA 1R6VA 1RWUA 4I6WA 3H0PA 5KG4A 2ZBIA 2DXFA 2DITA 4DV6F 3J7AN 2ZJRQ 3VHQA 3DYAB 4RWWA 3IA0A 5L46A 4QWBA 3IM9A 5AXNA 5HJXA 4DL3A 4L72B 3SIPB 4DPWA 1VRTB 2ZH7A 1ZZNA 4CRJA 3P49B 5FIIA 1U1OA 2OPQB 1YDLA 3GYNA 3AA9A 2KB2A 3PEHA 4ZLLA 2ZBQA 3A12A 4ED4A 3TUZC 2DK2A 2AYEA 1JLGA 3OFGA 4C3LA 4OI0A 1PC5A 4OIXA 3ZZYA 4U67Q 4LFCF 4KBIA 3PACA 3BGLA 3VQTA 2V2QA 3ZXWA 3ZZ0A 3Q2SC 5DZ6A 1ZETA 4NASA 4WP9A 1WOSA 4YN3B 3KMQA 1F60B 3C3LA 1WORA 2CPEA 3DYAA 2YKAA 1HNWF 3PO5A 3KJNB 1VRTA 3I5CA 3BSAA 3IRWP 3AH6A 4Q44A 2OPQA 4LR7A 1SJFA 4WBFA 3LQVA 4MK8A 4FYDA 3T5HA 4FXWA 2MDAA 4EYHB 2IBOA 4ETZA 3P4UB 2GJFA 1WEYA 3VZHA 2MQMA 2ZITA 5BYRA 3UDEA 1CC7A 2WZ1A 4OZ2A 3R6LB 2HBRB 2FC9A 3BPDA 3ITHB 2OH2A 4DSIA 3W62A 4B3SJ 3DLEB 3FCHA 4PAAA 2DH8A 2V34A 2VICA 2VG6B 3AXMA 2DGTA 4Y2CA 4DPOA 2E9ZA 4RUBA 4DSLA 3I4HX 4YHHF 1U02A 4FBTA 7FDRA 1F2GA 4A48A 1UWBA 4ZOSA 3FCVA 2HYIB 5CAAA 4NCGB 2DY9A 2WVFA 5A2QY 1HFEL 2HW3A 2CNLB 1URRA 3ITHA 2QA2A 1JXVA 4YFUA 3E3XA 3T5KA 3QJPA 3TUJC 2VG6A 1HNVB 2Q79A 3IRXB 3CJ2A 2EFOA 5EDWA 5KG2A 1G6BA 3UD5A 3NS7B 1U47A 4RUCA 4OJGA 4ZPDA 3M9NB 2HNDB 2MHNA 4Z7CA 4N56A 4EWTA 2X3GA 1TKDA 3K57A 2L41A 2HVHA 3HSDA 1S48A 3NOCA 4G6VB 4NCGA 5HMYA 3K5OA 3VV2B 1L3KA 2FPHX 4LRBA 3FRZA 1QJHA 4OJHA 4JBCA 5JMNA 2MMYA 2VQFJ 1U8WA 4CM0A 4JI8J 5D6GA 4X64F 2WRMA 1X9SA 4N8OA 1HNVA 3D0GE 3TARA 2HS4A 4KKOB 2OJ3A 3PW4A 3IBFB 3ISNC 4DL4A 2HNDA 1X4HA 3IWLA 4IR9A 3AAWB 3KK1B 1WF2A 2Q6CA 1U2FA 2HSEB 2XULA 1VK3A 4CZCA 4C3KA 4DOZA 4FPIA 4HVZA 5AE3A 2R8KA 3ILOA 1SKWA 4GKJJ 2QA4G 4CTAB 3P5BP 3ULHA 1UFKA 9RUBA 3AQPA 3A4TA 2DEJA 4X66F 1FWKA 1WC4A 2HHWA 3EDRB 2PIIA 2ZHBA 2BR0A 2D74B 4O23A 4TLRA 5IT4A 2CJ9A 3H5XA 3KMSA 4C8YA 2HQDA 1HA1A 4HTIA 2QFIA 4FYXB 3KK1A 4DR7F 3FZ2A 3MXHP 3HP6A 1RAEB 1SVDA 3ICLA 4URSA 1S0MA 3GE9A 3W8PA 2RAQA 2COLA 4CTAA 1KN6A 1FEEA 4QWDA 1TAUA 3DLLQ 4KIAA 3UFCX 1HLWA 2LU2A 1FNMA 4P73A 1KLMB 4UZCA 1U45A 4N47A 3H42A 3M05A 4K4UA 2K7KA 3FSYA 3AOCA 2ZBPA 2CJBA 4ED6A 2AT1B 8AT1B 1CS4A 3VGVA 1JWWA 3O1LA 2UXCJ 3DOMB 3HD1A 3TO8A 4CLWA 5I3UA 4XPCA 3PKYA 4LF5F 4NLXA 1YRTA 2O01C 3DN9A 1IKXA 4C8ZA 2JEIA 1NO8A 2R8JA 2A10A 5EWGA 2QL9B 4DR1J 1LWEB 3H2UB 4V1Ak 1WC0A 1OY9A 2KXFA 4RNNA 1RWOB 2CPIA 1KLMA 3OTOF 1TL5A 3R7SB 2Z2ZA 3JB9k 2P6TA 2QA4S 5A6PA 5A8RB 2VA3A 1HNZF 3HHKA 4NOHA 3G2XA 3EDQB 1C1BB 3TW0A 4EK2A 4DBQA 1J5OB 1H2UX 5DRKA 2B9WA 5J2QB 1Q82T 2XQCA 3CC2S 1LWEA 2AF6A 2CQ4A 2HEKA 3ENAA 5F8NA 4AXIA 5CYJA 5LSRA 1Q5YA 2YKOA 4NLYA 5CABA 5KFBA 1QY7A 2J5AA 3ETMA 5A8RA 2W8KA 4B3RJ 3ILJA 3T1HJ 5HK4A 1S1XB 5CZVA 2BKOA 2CPJA 4ZPVR 2DH7A 2RVJA 1YQHA 2CDQA 4ZP6A 1C1BA 2J7KA 1S57A 1Z1ZA 3UN5A 1BXNA 1J5OA 4OLPA 5J2QA 3GIJA 4O4GB 3OJSA 3ZNUA 1N6QB 4NA3A 1Q53A 3IG1B 1Q8BA 4N76A 2V8VA 1XMOJ 1KSPA 1HBOA 5IQ6A 3MI7X 3MD1A 3KK3A 1T03B 4OYBA 3FQKA 1DY3A 4DR4F 3MR7A 1KS2A 3W9JA 3UQSA 1S1XA 1KDNA 2AGOA 3HCXA 1UPPA 1JLAB 2MXYA 3KG0A 3TJ9A 3MMAB 1REVB 1DURA 5CHCB 3O6QA 2DGOA 2G9OA 1S6UA 1QUVA 4KHMA 5D4OA 1E6VB 5KFTA 4O4GA 1N6QA 1UMJA 3IG1A 4XPEA 1ZPVA 1L5UA 5IC6B 3W5XA 3A3OB 3I4PA 2QE5A 4B9VA 4M95A 2Y3YA 1VR6A 1U24A 4A8MP 3RGIA 1JLAA 2VODA 6FD1A 3MMAA 1REVA 4RR5A 3KDNA 2VF3A 1SQEA 2R8IA 2Z2YB 3OVAA 3GV7B 3DDIA 1JLCA 3UR0A 2W25A 5CYQB 4F0MA 1G2EA 1AW0A 4ECTA 3JTNA 5LMUF 1ITPA 5DO2A 1VQ6S 4GC6A 2EPIA 2ZH5A 3GJSB 1I94J 4C2MA 4ECWA 1EQMA 2A3JA 1SKRA 1IKVB 2ZNZA 3OXLA 1PYTA 2CJYB 4PG8A 2ACYA 3GZ7A 2WVBA 2G13A 2QIFA 2IVMA 2OPRB 3M8SA 4B3MF 1MMLA 3ZZTA 3KWMA 4S0MA 2IBKA 3FC9A 1RAOA 5CYQA 4Y34A 3PRDA 3CJTA 2PI5A 4YR0A 4KV8A 5HLFB 1QDUB 3IXQA 3RR7A 2CQHA 3CJ3A 2HQFA 4KAIA 3W66A 3J7A1 4Y2IA 3MEKA 1IKVA 1S6OA 2V63A 1RLCL 1IBKF 1U25A 1RYRA 2QT7A 3QJJA 3CE8A 3KLIB 3SBMA 2JRSA 4J37A 3BYPA 4K50A 2OPRA 3LANA 1RT5B 2CADA 3WDOA 3R5AA 1TU0B 1UFLA 4JP8A 1SI9A 1PBAA 1HR0F 1NK0A 1R8AA 3W9HA 2QMXA 5BJRA 3Q2TC 1YZ6A 5AXLA 5B0DA 5HLFA 3D66A 3H20A 2VU5A 3CJ0A 3BZQA 4QQBA 1HKAA 4F02A 1X5OA 1GT8A 1FRJA 3GP9A 3KLIA 2KJVA 2BVZA 4DR5J 2FIUA 4EZ6A 3DOKB 2RHSB 1RT5A 1S6PB 2UUAF 3NOGA 2RB7A 2AWZA 2GQCA 3R8YA 4X4QA 2E66A 5E3CA 4TYBA 3W2VB 2VBYA 1H2TZ 2NPIA 1FF2A 2IDLA 3RB6A 4C8LA 3DC2A 4M8LA 4M5NA 2ZWOA 3QWPA 3GJTB 4TN2A 4LSNB 4MK9A 2BRLA 5LXYA 5HVFA 3DGPB 3RJMB 3KOAA 2HHVA 3DOKA 1S6PA 4PZVA 3A3NB 1NJIT 4DV1J 2XHWA 5LXRA 4RW8B 2DPJA 1YX2A 3W2VA 4I56A 4DFMA 5CD4H 1NH7A 1LWXA 4ZVTB 3J81j 4USIA 1RWMB 3LTOA 2BBEA 1GMVA 2YWEA 4LSNA 3CCSS 2RH3A 2YBVA 4B9MA 2DNGA 2Q43A 4J9SA 1XC9A 3I0RB 3DGPA 1UPMB 5DDOC 4USUA 2ADCA 3TVYA 3NNCA 2MJUA 2IRXA 2G2YA 1PYOB 4USJC 2OI2A 4RW8A 1VCTA 2YX4A 3MFHA 2CQGA 4ZDNA 5DDPC 3MCSA 2BQRA 2IDEA 1FI4A 2BW7A 1BLUA 3NBPB 3NMAA 2YY3A 2HHTA 4X4PA 1V6HA 3FSXA 3K89A 4K4SA 3LO3A 3B4MA 3BGUA 3I0RA 1EKRA 4OYIA 4IQXA 3M9MB 1FVQA 4C98A 3L7PA 3DRXA 2RILA 4ZN3A 3GJQB 2OELA 5IM0B 1JJ4A 4B3SF 3R6GB 2N7YA 1Y5IB 2XMUA 3THTA 3V6DB 5KFXA 4K8RA 4MIAA 2AQ4A 1ELOA 2DCLA 5L1KA 4ZJLA 3VAIA 1NPPA 4JI6J 2KFNA 4DL0C 4PXDA 3VGSA 4QYZJ 1EP4B 1TTHB 3CCTA 2V9KA 3GR0A 3U27A 3HHDA 2JOQA 3M8WA 4DX6A 1U1MA 1RHMB 5IM0A 3MHYA 4RW6A 1RQ0A 2JNJA 3I82A 3MOZA 3NGTA 2MY7A 5KFNA 3MD3A 3D9BA 1RTJB 2QLBB 5D8HB 1FX4A 2FLNA 4RW9B 3V6DA 5E7OB 2IRUA 2RF2B 4C11B 2XNRA 4KT0C 2FJXA 1WF1A 4UY8T 4DUZJ 2XLJA 4X4OA 3IC1A 4AYBD 3ENVA 3SV3A 3EICA 3HJFA 3N6MA 1F1BB 4F26A 2DR9A 1EP4A 2DNLA 3KFWX 2KRBA 5ETSA 3ETOA 2N4CA 2FZKB 1F9EB 1XIQA 3D67A 2CJKA 1Q8LA 2VQFF 1IVZA 3QGIA 4JI8F 4KFBB 1D0EA 4FPRA 5FDLA 5DQGA 4ELVA 4IDKA 4RW9A 1SH0A 1UEVA 2RF2A 4C11A 1MMDA 5C2CA 2D69A 4PPDA 3B54A 1GH8A 2J0QD 4WCEQ 3DRYA 1C0TB 2ZZNA 4ZPCA 4KO0A 3ZZOA 2MPUA 4H4KC 3KG1A 1VJQA 2VBZA 4NMXA 4AFFA 2MZJA 1Y3KA 2GMLA 3SSSA 1K1SA 1NLKL 1SL0A 3C14B 4BCAA 1FDBA 4GKJF 2YKNB 3D1HA 2XM3A 4XK8C 3MCOA 1VQLS 4YR2A 2Q6BA 3SFGA 1B7YB 4KFBA 5D3GB 1XMQJ 5C5JA 1RBAA 3CCRS 2PFDA 4PWDB 2MKIA 4QR0A 1BQNB 1IN0A 3UDLA 1YJUA 1C0TA 5GADU 5D4LA 1M5SA 5IV4A 4E2FB 3CSKA 2BOAA 3T6JA 3VAHA 1Q8IA 1Y5LB 4LQ3A 3CUNA 1KFDA 3FZBA 2IM2A 5A76A 1JLFB 4USWA 4MMOA 1RT7A 1YLXA 3C14A 4MAKA 2W9CB 3ELHA 3OTEA 2YKNA 3H7HB 1NBEB 2HBYB 1H0HB 2D3ZA 2B4PA 5D3GA 2CWXA 5KTQA 4A8WA 1X8DA 2E7XA 4OFZA 4OZ5A 2ZKTA 4PWDA 4AXJA 4DSJA 4NLWA 3D6FB 3OTCA 3KJVA 1BQNA 1S99A 1RB0A 3RAQA 2XWXA 2HFVA 4WK1A 1U1PA 4LJMA 7AT1B 3RRHA 2XLKA 2G1DA 1F6TA 5AT1B 1U26A 3FBEA 5A8KB 4N5SA 2UXCF 1HNIB 4FBUA 2FJBB 1NPKA 4LF7J 3HVTB 2WW4A 1X5TA 4B3OB 1RCOB 3CCZA 3PTWA 4IH5A 4C9DA 4PPZA 1D9FA 1PILA 1QAIA 1L3UA 4LF6J 1QAYA 4DR1F 2WVDA 3AXKA 4J91A 2H65B 2DH9A 2GIQA 2K7JA 1S4FA 2Z57B 2V6AA 3K59A 1M1KT 1HNIA 4IKAA 4LF9F 2EBEA 3HVTA 3PXGa 3M4XA 4P2MA 3SQGA 4B3OA 3FFIA 3PVXA 3P45B 1U0SA 2OD6A 2I2YA 1GX5A 2IM1A 5LSOA 5D77A 2DNNA 1AUSL 1Y5NB 3RYLA 2HS0A 2M8DB 4NX9A 2L9DA 4TKTA 2QFJA 3AQOA 3KNGA 2N82B 4KGZB 3BBCA 2R2TA 1PSDA 1NK5A 5LJ3Y 2NUHA 3N79A 1D9DA 3MEGB 3M8ZA 5H1SV 4YB7A 4ER8A 3C8YA 1X9MA 5EX0A 4B3RF 3T1HF 4F4KA 5JVGQ 2W1BA 1UEKA 1OS5A 4CP5A 1LK7A 4P9SA 2IA6A 1HWKA 3BO3A 1PBUA 1S49A 1U6ZA 2D3O1 4DV0J 2MZ1A 3M2VB 2XC9A 4C48A 1XMOF 4ELTA 4CH0S 4Q0BB 2JVOA 1VQ8S 1UJ6A 2WBMA 2GMJA 3MEGA 2B6AB 6FDRA 5GVQA 4FNIA 1S1VA 3RBEA 1R7IA 1NK4A 2J0XA 3PM9A 5E2QA 2MTLA 3J7ZT 4CO1A 2J6TA 3HJVA 4ED1A 4ALZA 4I69A 1SC6A 1XR5A 1A6LA 3ISZA 2WW8A 3M2VA 4LBPA 2ZE2B 4USHA 5EUHA 4OYOA 2PEBA 1KQSR 4Q0BA 3I5AA 4LRFA 4CO3A 2ZHAA 3X1LB 2B6AA 3OW2R 2DBBA 1YI2S 3H40A 3ZC4A 3DRRB 4B9UA 5J2PB 2A6OA 1P1LA 1PIEA 2PN6A 4YMEA 4AL7A 4DR6J 4OX8A 3V2UC 2MZTA 3GSDA 3I6PA 2MKYA 1U6FA 1E6YB 2XS7A 1BWEA 4ENOA 4PG4A 2R7TA 5M2UA 2ZE2A 2VPZB 3K2YA 2QJ3A 3M8RA 4O3RA 5HQMA 5K20B 1WC1A 1I94F 5DG8A 3M8PB 3DRRA 4P10A 1RHKB 5J2PA 2G4BA 3RBZA 4DXLA 1FDNA 4PQUB 1WF0A 1HNXJ 3BH6B 3QIDA 3PNIA 1FRHA 1E6YA 5F3ZA 4WXOA 4I2PB 1WTFA 2ZZTA 2NPFA 3G6ES 3I32A 2W2MP 3HULA 2HVEA 4V19J 1V5VA 2FVPA 2LEBA 1Q79A 4ZA1A 4DPYA 2I9SA 3UNGC 4OV6A 4OI4A 5KT6A 1H7WA 4DFPA 1X7VA 5KFGA 4NA2A 1XERA 1C4AA 4QR2A 2DHHA 1XWLA 4O3NA 9ATCB 3DNCA 2FDNA 2WB1D 1TKXB 3M8PA 3HFVA 1CBKA 4MKVA 3ZTPA 3CCES 3CD5A 3EE3A 4PQUA 3KUHA 4MT1A 4OHXA 4I2PA 1OQ6A 3C66A 3KKFA 3KYLA 3HZEA 1AB8A 4DV4J 2H5IB 3AD7C 3BN7A 4A8OA 4LMZA 2EFGA 1DLOA 3CD6S 1VOMA 4MYTA 4RNMA 1TKXA 1VRUB 4IO1A 4Z37A 3QT5A 1SQFA 1OO0B 3IFEA 1GNKA 2W4CA 1BGXT 3CJSA 4DR5F 3H8YA 1SKSA 4ZJOA 2G0JA 2JH3A 4DLEA 3MAAB 2KTQA 3FK4A 3FQLA 1TAQA 4Q7AA 5EGYA 3QRRA 3CDAA 3ET6A 4OHVA 4DR2J 3IAS9 4NI2A 2CAJA 4HKQA 2LA6A 5KFYA 4ED2A 5KFZA 2R7SA 1GTEA 2K3KA 3M1VB 1FJCA 1Q1KA 1KQGB 5E5NA 2MJNA 3M8YA 3D2WA 3AY0A 3WBZA 4USTA 1N5SA 4K0KJ 1WEZA 5ETVA 1N32J 2DHGA 2ZKUA 4LSLB 2QMWA 2VKZG 4CO5A 3MAAA 2MQLA 1FA0A 5KFHA 4DV1F 2AV5A 1P8GA 2BYCA 1X60A 3UD4P 4JI5J 3BR9A 2ZC4A 3EGNA 1N36J 2HURA 1X4DA 4M5JA 4RKUC 1NSAA 3M1VA 3BSNA 2MZSA 4NRTA 1K0VA 2Q66A 3OFEA 2EEYA 2CXEA 4QIWD 3RRGA 4J9UE 4H54A 3TRGA 2JHEA 5C25B 2A2CA 2BM0A 2NS1B 2LEPA 2CFXA 2HHHJ 4OYXA 1RWXB 2GV1A 2FVRA 1VIOA 2Y1JA 3U02A 3Q8SB 1ZTWA 2CG4A 3OR1B 3W8GA 2QL7B 4K4YA 4IUFA 1WHWA 2YWWA 3NY0A 1VC6A 3G6YA 4CNZA 1KONA 5EX3A 3VVTA 2ATLA 4CNYA 4J9VA 4LIRA 2KT3A 2HRYA 3QPIA 5C25A 4DJBA 1BC6A 2JL9A 3R27A 2ZH8A 5DS7A 1KVKA 3Q86A 2FQQB 3BN4A 3OR1A 3N5FA 1WSRA 2Y0BB 4W4MA 3KK2B 4J9RA 4ZIVA 2ZD1B 2HQCA 1EAYC 1M5PC 1RTIA 1TKZB 1DARA 4MKAA 2C2KB 1GXTA 4WTYA 1ZM4A 1TQLA 4JUZA 1TELA 2V68A 4A4JA 1ROFA 1S79A 4JI6F 5J1EB 2ZJPQ 2PC6A 3MM8B 4XTTA 2HMIA 5IT9U 5E33A 1KC8T 1NK7A 3RW7A 2V8GA 2NZ4A 1KR4A 1S10A 1H74A 5K8NA 4P52A 1F5BA 3B4DA 3LGNA 2ATCB 3L3CA 3KK2A 4FN5A 1FRIA 2ZD1A 3PHEA 3G71S 2VHGA 4EMDA 1NKCA 1S9GA 1YZ7A 1TKZA 4QR1A 4DUZF 3OLAA 1QD1A 5AJ3J 4F3QA 4QU6A 3BO2A 3R5CA 3PJ9A 5J1EA 4ZHRA 1W25A 4K5RA 2VBXA 3MTJA 4OI2A 2JX2A 4UQTA 3CW2C 4U96A 2MZRA 1R27B 2FY8A 3CCLS 2DGUA 2RRNA 3MM6B 5SZTA 2HZAA 3V6HA 5I3QA 2D3OR 4DX8H 2VC1A 1DHMA 4CLYA 1F3FA 1NK8A 4FYWB 3MCMA 3T1YJ 2R8HA 4J9OA 5HL7Q 1VLOA 3K5NA 2B4OA 1NZAA 1P1TA 1X4EA 3ZTQA 3SXLA 3DLJA 1S77D 2KVIA 1NSPA 2HWTA 2R9LA 3GFZA 3LH2S 3B82A 2UXBJ 4URQU 1HPZB 1AFIA 5THWA 4RX6A 1JLBB 4LFAJ 3GCWP 1RBLA 1DQAA 3PYDA 2KH9A 4OV1A 2DXEA 1T0TV 1UP1A 3U7JA 1TUVA 3LA0A 1RT2B 2AGQA 2V67A 2WCXA 2FHJD 3MM6A 1FESA 2DRAA 2LLZA 2ASDA 4PCQA 1XMQF 4UUWA 1VQKS 2EFNA 1SJ3P 3CJKB 2HZCA 1RKJA 3G8QA 2E9TA 1OPIA 4K59A 1R8HA 2VIHA 1RAAB 2R7UA 4EUVA 2W8LA 2XS2A 4ZVUB 4Y2MA 1RHRB 5RUBA 3Q22A 1OSDA 2RD5C 1JLBA 1RLDA 2JFKA 1RT2A 5D0HA 2KT5A 3OXGA 4YDXA 2V94A 3WQPA 1BE4A 2RSQA 3CJKA 3EM1A 5A0YB 4ATNA 2GAGC 3I96A 3THVA 1EIYB 4KGXB 4ES3A 5KT4A 5HN0A 1CULB 3G6XA 3UPFA 2NXEA 4P71A 4DV5J 4LF7F 1NEEA 2DKOB 2CJAA 1IJEB 2XY6A 3M7VA 2GO8A 1I1GA 2MKSA 2AKWB 4A46A 2RUSA 5DQHA 4WFXA 4KSEB 5JVHQ 3H5SA 1VHFA 4LF6F 3KLHA 4JI0J 4YY3J 1T05B 2D9PA 2W9AA 5BYSA 5EWFA 4LF4J 3OLBA 2C28A 1LOUA 1WG4A 3TANA 3GMGA 3IGNA 3DOLB 2PEHA 2VFSA 4DMZA 2VFVA 2Z4PA 5F8GA 2BW2A 1CULA 2FHKA 1ZA1B 4P2XA 3CDBA 4K4ZA 2F8EX 1H7XA 4OZ3A 2OFGX 2KZMA 1VIXA 2A0FB 4FVCA 4MH8A 3MR6A 3A3PB 1T05A 3NGRA 4ZPTR 1GFWB 2RKIB 5CQGA 3RB4A 4BS2A 2EFVA 5A6WA 2YXLA 3VAMA 4QJVA 4QOTA 2MKCA 1URNA 2CA9A 4A8QA 4O3SA 1YJVA 1S0VA 3D6HB 4PWUA 3VGTA 1IXKA 1HHSA 4C6AA 2DGWA 1G3OA 1UVIA 3BBBA 5KG0A 2XZTB 2CWKA 1SUQB 3FBCA 3PX0A 4GKKJ 4DV0F 2ZHOA 1HBUB 2Z0GA 4DZ6A 2RKIA 4O3OA 3UO0A 2PGCA 1S76D 2XMMA 3MOJB 4WPAA 4CDIA 1U6BA 2DYAA 3HHLD 8ATCB 4DFJA 5HP1B 3FBBA 1F5CA 3C46A 3RR8A 5C2GA 1XTZA 1SUQA 2H1YA 3EPIA 1UVLA 3LPEA 1KQKA 4DPXA 3GU0A 2OEKA 4L74A 3R1LA 4WFZA 3CDUA 1S1TA 3QT7A 2J7UA 1HBUA 3SDEB 2MQPA 2M5YA 2YKMB 2HS3A 4EBCA 3QGGA 4CLFA 2UVRA 2M2BA 3J80Y 2YKQA 3CIZA 5KG1A 5HP1A 4LF2A 2IHR1 2AX1A 3MR5A 3ILIA 4DR6F 2B8QA 2R7QA 3M6UA 4XDCA 4JV5J 3LP0B 4NLVA 1RWNB 5JUMA 2KZZA 2DXDA 2HGLA 4DEZA 1Y11A 1FXDA 1IJFB 3MAQA 2QRRA 2PA3A 3SDEA 1L3SA 4PXBA 1JKHB 1U2RA 2R7OA 4DPUA 2GJ2A 5K8MA 1FWLA 2YKMA 3MM5B 4CQ1A 2VDIA 4HHUA 3KLFB 1X0PA 5F8MA 2DNHA 3UN3A 3DMJB 2FYXA 1TV6B 1AYEA 2YNFB 2LXIA 2VFRA 3H98A 4DQQA 2R7RA 4CO0A 1HNXF 3VCDA 2V9WA 1SL2A 4HYKA 5IT0A 2UV8A 1ZAWA 1RTHB 3HX9A 4CWBA 3W2WB 1FJGJ 2YTCA 3IO1A 2GQ2A 3JQJA 4ZCKA 5DDQC 4AD6A 1T02A 1CLFA 2QA1A 4P2SA 2J0WA 4X65J 3MM5A 1NJZA 1T94A 3ZTSA 1HWLA 1GXLA 2YWFA 3TQEA 4F4WA 3DMJA 4ZP7A 1TV6A 4NLTA 4W98A 2G0IA 1RWVB 2YNFA 1T9YA 3FEYB 2RRBA 3CD0A 4I2QB 4LQ9A 3Q89A 3EGWB 4KR0B 2R2SA 2CPFA 1YHQS 1RTHA 3ZFVA 3W2WA 3PW5A 3FDSA 2LYVA 4DV4F 1LEOA 1GMWD 3ENWA 4A8XA 1TR0A 2O3DA 1ZA2B 2KG0A 3BKFA 3A13A 2NQPA 2L48A 4NCAA 1WC6A 3K17A 1TK0A 1RWKB 2VJUA 1UETA 3S6EA 1LW0B 4QIFA 1M90T 4DF8A 1N5YB 2BEFA 5KT5A 1HBMB 2F3JA 5KFVA 3NCQA 3OJUA 4DR2F 3DI6B 2CZ9A 2RHQB 4DQPA 4QPXA 4MKBA 2YNHA 1W2BR 2XS5A 1VQSA 3VGUA 2YWGA 3A8IA 5LT5A 3MECB 1C1CB 1DQ8A 2XCPA 2BANB 3BB5A 1KTQA 5LL6d 5A8WB 2OTLS 4K0KF 5FLXU 4NLPA 5F41A 2E1AA 4L76A 1N32F 2DGVA 3Q24A 2C2NA 1LW0A 4C0OC 4FXVA 4ED5A 4LRCA 2CG8A 1HBMA 4TU7A 3BQ1A 2DVIA 1KTVA 2RE1A 4K4WA 3DI6A 3TZZA 4JI5F 4UT4A 3OV7A 1N36F 3ONQA 1VJWA 1TP7A 5C42B 2BJEA 3TI0A 2BKNA 3MECA 3G6VA 1TL1B 2GIFA 1PC4A 1F5AA 2F8MA 5ETQA 3FGVA 2QEXS 2W2OP 3K58A 5A8WA 2HQ3A 5HMXA 2UUWA 3QO9B 5IT9Y 2OP5A 3ISND 3O3LA 4C7QA 2K1RB 2RU3A 2J0SD 3G82B 1NKBA 2HHHF 2HHQA 1WHYA 3N0VA 2VB6A 1VQ9S 1RHQB 3JXOA 5IS2A 3O8WA 1RADB 3US5A 2AP6A 3N28A 3TAPA 4F2SA 5I4MA 4LF1A 3MZIA 1H38A 5C42A 3I5BA 3G8TA 3MM7B 1NSQA 4FF1A 2JVRA 3OUYB 2ACMA 4RUAA 1AUDA 2W01A 1VQ7S 3QO9A 3MMBB 4I0WA 2EWHA 1U1LA 2K1RA 5B0AA 1IBMJ 2CQCA 1NHUA 4Q2MA 2N4DA 2JDJA 1CC8A 3G82A 4OQJA 4FDFA 1FNXH 4AQYJ 2BQ3A 2Y1LB 1BMQB 4X2BA 1NH8A 2DO0A 1MWZA 4ECZA 1FERA 3HT0A 3MM7A 2CZ4A 2DNYA 3EXCX 2N7CA 3OUYA 1ACMB 3NGUA 4A8KA 4DSKA 4ECSA 2DR5A 3SQOP 2RT3A 2FJWA 4F50A 2J6SA 3MMBA 1WUUA 2J9CA 4WZQA 1WG1A 2CNKB 2GGPB 3UWTA 4NRUA 4BWMA 1CVJA 1PKUA 4RUHA 2J8SA 3TAMB 3FNNA 1S7HA 5K14B 1UW9A 3GG0A 4B17A 3PEJA 3DGVA 3CD7A 2E1MC 3PO4A 4OYWA 1FO1A 2XHCA 1UVJA 2G2ZA 4OHWA 3KLVA 1X4CA 2CQ1A 5AJ3F 1OY6A 3QIPA 5HQLA 4X4TA 3NWGA 5H9EK 2F8HA 3HSGA 1CG2A 2B51A 5BYQA 2GGPA 1N33J 2BV3A 3K8WA 2BABA 2AYBA 3NKYA 1VQPS 3TAMA 3DRSA 4FF4A 3MDFA 4CH7A 5K14A 3HFZB 5J2NB 4CO4A 4GO5X 1YWXA 5KFCA 1ZS6A 2J9EA 4B9TA 1K47A 3V4MA 1V5IB 3DLGA 3JSBA 2C2OB 3IWXA 3T1YF 5E3QA 3C2PA 2NXCA 1UWBB 4ZP8A 3JSYA 2UXBF 4JI2J 1EARA 2SXLA 4O44B 2IAJB 1FE0A 4U7CA 1U4BA 4K4VA 1ZM2A 1VGYA 4LFAF 4ZVEA 1OYDA 4ED0A 2W2PP 2FJEB 3J81U 4WFAQ 5J2NA 2XGQA 2BRKA 3G96A 5F9LA 3SEOA 3RBDA 2YNIB 4J9NA 2JFDA 3MEDB 1N5QA 1VBZA 1QVGR 2CQ0A 5HSPA 3TJAA 3UNYA 1JXEA 4K4TA 2W4PA 3TUIC 1R8PA 3Q8PB 4G1IA 3HKWA 4B08A 3CCMS 2B7BB 1VQNS 3TWZA 4DQRA 5IWAJ 3MPWA 3HXMA 3OHAA 4O44A 4OZJA 2GAHC 2IAJA 3CJRA 2HAIA 4P6QA 1U0HA 1G7CB 2XMKA 3GFYA 1D9AA 3BJYA 3OQ2A 1WDDA 4MIBA 3J7Z5 4KB7A 3PYEA 2YVSA 2GVZA 4OJ3A 3T5JA 1SJRA 2YNIA 3QZ8A 3V81B 3MEDA 1TL7B 3MPUB 2E5IA 1WDTA 4KGKA 4BC9A 4ID8A 1KOOA 5F3TA 2LKZA 4MKYA 2FVQA 3EJMA 4DV5F 2NREA 2OIHA 3CXCR 2QV6A 1YJRA 2VKRA 2UVVA 3BEGB 4Q2LA 1ZAVA 4ELUA 3NS6A 2E7VA 4ANEA 3L95X 2JLEA 2BJ1A 2VL1A 3V81A 4JI0F 4YY3F 2LVWA 1TL7A 1SPBP 1RAHB 4CLUA 1JJHA 1NJXA 4LF4F 1R0BG 1NDPA 4DHVA 4DG1B 5D0GA 4PEOA 2UP1A 2APOA 2CPHA 2U2FA 1F3VA 1PG5B 4R8UB 1MN9A 2GNKA 5E0OA 3QAEA 7FD1A 3BH7B 3K8VA 3NL0A 4ZVSB 1RA6A 4F2RA 1T9VA 2E44A 2LEAA 2X51A 5GAEU 4EEYA 2E5GA 2BE2B 2HRUA 4TQRA 4HT5A 3Q8UA 1FD8A 1KP6A 4DL5A 1FDAA 4PABA 4DG1A 1EHWA 1CS4B 2OSQA 5MLCV 2GC8A 2IYIA 2W24A 1D8YA 3CC4S 1JXLA 4R8UA 5I3UB 3F44A 4B3TJ 4PRFA 1RTDB 2IMWP 5HAOA 3KG4A 2DR7A 1IKXB 4G1QB 4WIIA 3MMJA 4U8VA 2UXDJ 3GYXB 4RZRA 2MLYA 2BE2A 4QPTA 4GKKF 1SC4B 2PMZD 2HFZA 3M2RB 1YJTA 3GWCA 4RWXA 2H54B 4WU3A 2MKHA 2OKQA 5SUHA 4LF8J 5H9FK 2V8HA 3CJ4A 4OI3A 4MIWA 3ZNJ1 3AT1B 4F36A 2XMVA 2V69A 2NXJA 1WWHA 3QWUA 1WKKA 1RTDA 2LU1A 1LKZA 3NMRA 2M70A 4G1QA 3LUYA 1H98A 2OEJA 2WK4A 1NAQA 3BV8A 1A0OB 1WSVA 2XSJB 2AHOB 4NLUA 3LWLA 1GMUA 1WNEA 2BA9A 4NXMJ 3M2RA 3MUVP 3IS9B 3KJFB 3Q8RB 4X84A 4DCJB 2A1BA 1X0FA 3VAFA 1CEZA 4DS5A 3DDKA 4ZS6A 5CCLA 1VBXA 2OLWA 4RPFA 1S5ZA 2AEJA 5T7LB 4JV5F 3JAMU 3MWBA 1WJ9A 4DR3J 2A2DA 3BPSP 1CSJA 2C1EB 2KRRA 3CIMA 1F9FA 2CPDA 4TVAB 1ZAXA 1QSLA 2RQMA 3ZZZA 2UU9J 5AE2A 2XSJA 3K5MA 1HBOB 4NZ0A 4WFBQ 3KK3B 3IS9A 2JWNA 5B0CA 4FXDA 2QLXA 4DV2J 4K4XA 3CCJS 3M9OB 2DEIA 1RDRA 5M2PA 1SH3A 4DUTA 1LFWA 2QL5B 5T7LA 2VPXB 1I6JA 2FC8A 4K5SA 4LREA 1QUPA 3IMQJ 2JZ5A 1O0PA 4YQWA 2ASLA 3WX4A 1FJGF 2HFSA 4OLOA 3H25A 2B56A 5HJYA 3GV8B 1XN9A 4YP3A 4Y0FA 4OZNA 5C7PA 2P2CB 1T95A 1Y7PA 4X65F 2HLTA 3SCKE 2P6SA 3NAHA 4DDFA 2MHEA 3H90A 5B0GA 1WKLA 2XO7A 6AT1B 3SCIE 2MQNA 2K8GA 5FLXY 1WC3A 1B99A 1B3TA 1JLCB 1GX6A 1APSA 1TL3B 2HKEA 1J5EJ 3NRBA 2DR6A 5EWEA 1VLYA 2BOPA 2W2QP 3QJLA 1NB2A 3PJWA 2WOMB 3FEXB 1RCXB 2B9XA 2YPYA 2M4MA 5IZHA 2GVDB 3I56S 3LGMA 3JQKA 1R0AB 1X31C 3QSYB 3C6UB 2KO1A 4KH1B 5F8HA 3QGPA 2I1RA 3M6WA 3L7UA 1IWGA 1TL3A 4DX5A 4ZJQA 1YGYA 1FTCA 1ZBTA 3VF0B 2WOMA 4UZBA 2KHCA 1IQTA 1RT6B 4ZPBA 2JSXA 4KV8B 1SXLA 5GAEI 2F4FA 1IKWB 2GW8A 3BKUA 1JQGA 2GVDA 3MCNA 4NA1A 2HQGA 1CQMA 4QZVB 4IG0B 1R0AA 2W9BB 3AOAA 3C6UA 4RNOA 5DJBA 2GO9A 4ZN1A 3W1YC 5DZ7A 1RT4B 3CMAS 1Y9OA 1FKAF 3EVMA 1U1KA 1Y3JA 3H2LA 2P9CA 3BO4A 3VAJA 8RUCA 2DIVA 1OMSA 2R7XA 2KM8B 4ECRA 1NDKA 2K2PA 4BHQA 4JI4J 1TVRA 1RT6A 3GIKA 1N34J 3NAIA 3C6TB 2RS8A 2OEMA 1IKWA 2VPYB 1O6XA 3V6JA 4IG0A 2W9BA 2KKHA 1JMTA 5ETMA 2XMAA 4DQSA 1EZZB 3I9V9 1SJ1A 1RT4A 3DLBA 2F40A 2IM3A 3CWJA 4PUOB 2VC0A 4X4NA 4QWAA 2YQ1A 4HH1A 4CLLA 4W90B 1NKEA 1P6TA 1N0UA 3JSMA 4DUYJ 3R9LA 1X5PA 2WBRA 2YQ3A 2LCWA 5G0RB 2C3UA 3C6TA 4GRSA 1N0VC 2PE8A 2BDPA 1VQYA 3PV8A 1XQIA 4ZPAA 1R0CB 3S7RA 3UI3A 5DM6Q 3FEZA 2HWHA 4H4MA 1S0OA 1B70B 2F4VJ 3G87A 3CCWA 2XY5A 3JSRA 4PUOA 5JJBA 1T9WA 2HVZA 3WZ0A 1IBMF 3EGVA 2Z2MA 5D0RA 1ZOTA 2YPZA 1J27A 2M9KA 2BKPA 5G0RA 3V5RA 2WAQD 2B8PA 4AQYF 2UZAA 2VUGA 3MFIA 2LDYA 1VHIA 1R3NA 1HQEB 2HBZB 3P96A 3T3FA 4ECUA 4F3OA 3LP1B 4OX7A 5DGAA 4TY8B 2D1CA 2WHOA 4PG7A 3KTQA 3C19A 4YB1P 2N3OA 4ZLJA 4DFKA 4KC5A 2GQQA 4R0JA 3HF5A 3CNQP 4F0HA 2DHAA 2O1PA 5CH7B 1S1WB 4BDPA 2U1AA 3GJRB 3IWNC 2I6WA 3K5LA 2BUNA 2H4WB 4NZ7A 4M1KA 3G4SS 4U7UD 4DCOB 2WVCA 1FTRA 1T3OA 2QLWA 4DPTA 2X1GA 4DX7A 1M5HA 4CIOA 1HQEA 3H2VE 2DGXA 3BQ2A 1RHUB 4XAKA 3LP1A 4CLKA 2HPUA 4TY8A 1A9NB 3NCRA 2M52A 2QN6B 4ZK7M 4ITSA 2V0NA 5M2RA 1SL1A 1S1WA 1RAIB 3OTDA 5L39A 5F8IA 1N33F 2DNPA 3QYYA 1IM4A 2Q3PA 4I6AA 3ENQA 4DL7A 1VQOS 2HGMA 3CTRA 2DHXA 2R4FA 4K2JA 1RU2A 3TX8A 4J5OA 3CDEA 4IFYA 4QWCA 3AJ2A 3A8JA 1RBOB 5FJ4A 2XBPA 4WFNQ 5E3PA 2Y8YA 2X1FA 1UVKA 2ILYA 4J9QA 2KYXA 2BJ9A 3S1TA 4ZITA 4QBUA 1MG7A 4KY3A 4JI2F 2FHMA 2J7WA 1ULRA 2ZVSA 4RW6B 3J7YU 1Q86T 2HIQA 2LECA 1DBDA 1A7GE 2M8HA 2MY8A 5HI7A 3TUPA 2CPYA 2HQIA 1W7WA 3UVJB 2VA2A 1S6QA 5G4DA 2OPPB 2DNZA 1Y10A 5MAOA 2PDAA 5HROB 3D1OA 5DGBA 3PZPA 3FKBA 2BXJA 5K8PA 2AJ1A 5IV3A 3I0SB 2XMTA 1K44A 1H2VZ 1BWVA 4B9SA 1FDDA 5IWAF 3JS9A 4JV1A 2O67A 1T3NA 1MMNA 3D4JA 1N88A 2DCUB 1YKWA 1DTQB 4FYVB 1RYSA 1RP5A 2MKJA 2AW0A 1KOHA 4JI7J 5FDLB 3UVJA 4ZIWA 4QYRA 4IDKB 3SCLE 2OPPA 3HVAA 3MPYA 3GIMA 4IG3B 3PR4A 1T9TA 5KFWA 4FNHA 1XMBA 1BQXA 2CNOB 5HROA 4DV7J 2MQ8A 3GV5B 2QYGA 4KO0B 3MR2A 2MLXA 4HT7A 3I0SA 2NZCA 4OYAA 1TL4A 1UZHA 4U6PA 2ZH2A 5AXMA 3MUTP 1DTQA 3UDCA 3OXFA 4A8YA 1FT8A 3TEHB 2OHDA 2ADBA 2VOOA 5J2MA 4N77A 1HL6A 4JI3J 3FSIA 4IG3A 1DTTB 3PG9A 2HZVA 3QQCD 3HT3A 1AROP 3WC2A 2MYFA 4DWIA 4P7VA 3AJ1A 2R2RA 3PW0A 2J8AA 1RT7B 3SZ2A 5J1PA 4UF4A 3T9ZA 4ILLA 1YRUA 4ZVRB 3L4BC 3KUGA 3ZTOA 4IH6A 2Z56B 2ZM6J 2OFHX 3W63A 1DTTA 2HGNA 1FHTA 2NSBA 4LR8A 1JB0C 2NXNA 3KJVB 2EKYA 2MSTA 4WKRA 3NGDA 4NEYA 1DRZA 4LRDA 3BDEA 1P9YA 4ZVPB 1B7FA 3V4IB 4B02A 1RAGB 3T1AA 4B3TF 3GCXP 4NYZA 4K2XA 3G9CA 3N5BA 2GCFA 3JAMY 4ZVGA 2FLOA 4HLBA 5KFKA 2R3VA 2UXDF 1FNOA 4NLGA 3D0IE 4YB6A 3CMES 3ZTRA 4A8FA 1RXOB 2FGOA 5L8RC 3I55S 4TQSA 4LF8F 3R5BA 3CCQS 1HMVB 1MLAA 2ASYA 3V4IA 2NSCA 2CQPA 4LFBJ 1SB6A 1PJ7A 5KT3A 3SQGB 2B9EA 4PR6A 1SV5B 1WC5A 4EFAC 4IYQA 3FFIB 3DLEA 1Y00A 4FS1A 1MNEA 2V5HG 1EKSA 3BDPA 2H48B 3GTYX 4NYPA 1CJTB 3EXYA 2B0GA 2LFVA 4FP9A 2XCAA 5L9NA 2D7SA 3NNHA 3N6NA 4YEAA 2CQ2A 4NXMF 1PJ6A 2CRLA 4OHYA 1QSYA 1BD6A 1HQ2A 4DU7A 4KHPJ 1XR7A 4DL2A 4UTGA 3T19A 4F04B 3JQMA 4MJKA 1HMVA 2AIRB 4F4AA 3E8OA 1IKYB 5LMNJ 1YTYA 4WYLA 3GPAA 4C8OA 3OTBA 5KOXA 1SV5A 2AJFE 4RBTA 1D1UA 2OMLA 3HK2A 1VK8A 4GC7A 4XDDA 4DR3F 3MAHA 4C8MA 3IRXA 4JOUA 2LXFA 5EHHA 3J7YI 1CJTA 1J2VA 2F1FA 3D68A 2UU9F 3GFXA 2C3YA 3TA1A 5KAKA 2BJ7A 1JLQB 4IFVB 1OWXA 1N54B 1S1VB 5B08A 1T8EA 3OFFA 3M6XA 4DV2F 4X4UA 1Z2LA 4ETXA 2EK6A 5L1LA 1LV5A 1IKYA 1VC0A 3TA0A 2ILZA 2B9YA 4L3NA 4YB5A 3QT6A 1CJUB 1LK5A 2DRBA 3MUMP 1MN7A 2XZWA 1KRPA 4KKOA 1FKOB 1O51A 3P5TL 2CJXB 1LXNA 3CJ8A 3UW1A 1JLQA 1HW8A 1UVNA 4IFVA 5B0BA 3HI9A 4ZLPA 2GZOA 1IUJA 4YR3A 4CM2A 3FMBA 5HMWA 4QYZK 1AFJA 1JJ2R 1VQ5S 4Z2XA 3EVWA 2I38A 4F4ZA 2K06A 2F9DA 2YQ0A 1R8BA 1CJUA 4WFYA 1V3SA 1UEUA 2CIMA 2WSCC 3M32B 4I7FB 1J5EF 4HI1A 2OSRA 4KE5A 1Q4RA 2LQBA 1FKOA 2DTJA 5KG6A 3U1NA 3PIPQ 2YWKA 3A8KA 2EFPA 3W60A 5KG7A 4KH0B 1DJ0A 4IRKA 1M5OC 3PFEA 3U1LA 3M2UB 2IVYA 3LF0A 1YBAA 1IR2A 5I3PA 4OYMA 2XSFA 2QYCA 2FLLA 2C3MA 2ZBCA 1RWPB 3M32A 4I7FA 3M30B 2V8PA 2ZOFA 4K7QA 5CA5A 3BSOA 1M0SA 1MU2B 4NYOA 1IBLJ 1HYSB 2ZVIA 2C2MB 4QIGA 3OVSA 2W4DA 1VYAA 1FRLA 3DOMA 4HTJA 4LF9J 2Y0SD 3EGZA 3RU0A 2VD3A 5GADI 3HO1A 4KRWA 3M2UA 1HWJA 3DM2B 3SSRA 4RW7B 2DB1A 3O2IA 3CEDA 3HHEA 1Y4ZB 2QG9B 1Y0HA 2MQQA 2MEWA 3M30A 2C3OA 4FKYA 5GMEA 4LVOP 4RBUA 2J9DA 3N4WA 2HVIA 4JI4F 4I6YA 1MU2A 4ZCMA 2FVSA 1HYSA 1N34F 1NRKA 1DLOB 2ZH1A 2NYHA 1NDCA 1D8ZA 2ZDPA 1QLNA 2RDJA 4J9LA 1B0VA 1Q95G 4U7UK 2ZUAA 1HWIA 5CCMA 3TR5A
chains in the Genus database with same CATH topology
4DR3J 2VQFJ 1HNWJ 1XMQJ 2HHHJ 3W1YC 4DR2J 4X62J 5IWAJ 4DUZJ 4JI8J 5IT9U 2UUAJ 1J5EJ 2UU9J 4AQYJ 4PWWA 1N33J 4LF6J 2VQEJ 4KHPJ 1I94J 2UXBJ 4DV1J 4DR6J 5A2QU 1IBLJ 2F4VJ 4LF8J 4LF5J 4NXNJ 2UUCJ 2KVQE 5LMNJ 4LFAJ 4X66J 4DV0J 1FJGJ 4JI3J 4DV2J 4JI4J 4DV5J 5BR8J 4K0KJ 4LF9J 3R2DJ 1N34J 5LM7E 4DV6J 2E5LJ 1IBKJ 1N32J 4RJVA 4OX9J 4DR5J 4X65J 3J80U 3OTOJ 4DV4J 2UXCJ 5AJ3J 4GKJJ 4B3RJ 4JI0J 3IMQJ 4YY3J 4JI2J 4JV5J 4DR7J 3T1HJ 2MEWA 2MTLA 1HR0J 4JYAJ 4JI5J 4NEZA 4LF4J 4JI6J 4NXMJ 4GKKJ 1N36J 1HNZJ 4JI7J 5LMUJ 2UUBJ 4X64J 4LFBJ 3D3BJ 3J81U 4DR4J 1HNXJ 5FLXU 1XNRJ 4YHHJ 4LFCJ 4DR1J 1XNQJ 4B3TJ 3J7AN 4V1Ak 4KYZA 2ZM6J 4DV7J 2MQ8A 4DUYJ 4DV3J 3D3CJ 1IBMJ 3R2CJ 2KL8A 4LF7J 4HHUA 1XMOJ 4KY3A 2UXDJ 4B3SJ 4NEYA 3JAMU 4B3MJ 3T1YJ 4JI1J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR3 J;  2VQF J;  1HNW J;  1XMQ J;  2HHH J;  3W1Y C;  4DR2 J;  4X62 J;  5IWA J;  4DUZ J;  4JI8 J;  5IT9 U;  2UUA J;  1J5E J;  2UU9 J;  4AQY J;  4PWW A;  1N33 J;  4LF6 J;  2VQE J;  4KHP J;  1I94 J;  2UXB J;  4DV1 J;  4DR6 J;  5A2Q U;  1IBL J;  2F4V J;  4LF8 J;  4LF5 J;  4NXN J;  2UUC J;  2KVQ E;  5LMN J;  4LFA J;  4X66 J;  4DV0 J;  1FJG J;  4JI3 J;  4DV2 J;  4JI4 J;  4DV5 J;  5BR8 J;  4K0K J;  4LF9 J;  3R2D J;  1N34 J;  5LM7 E;  4DV6 J;  2E5L J;  1IBK J;  1N32 J;  4RJV A;  4OX9 J;  4DR5 J;  4X65 J;  3J80 U;  3OTO J;  4DV4 J;  2UXC J;  5AJ3 J;  4GKJ J;  4B3R J;  4JI0 J;  3IMQ J;  4YY3 J;  4JI2 J;  4JV5 J;  4DR7 J;  3T1H J;  2MEW A;  2MTL A;  1HR0 J;  4JYA J;  4JI5 J;  4NEZ A;  4LF4 J;  4JI6 J;  4NXM J;  4GKK J;  1N36 J;  1HNZ J;  4JI7 J;  5LMU J;  2UUB J;  4X64 J;  4LFB J;  3D3B J;  3J81 U;  4DR4 J;  1HNX J;  5FLX U;  1XNR J;  4YHH J;  4LFC J;  4DR1 J;  1XNQ J;  4B3T J;  3J7A N;  4V1A k;  4KYZ A;  2ZM6 J;  4DV7 J;  2MQ8 A;  4DUY J;  4DV3 J;  3D3C J;  1IBM J;  3R2C J;  2KL8 A;  4LF7 J;  4HHU A;  1XMO J;  4KY3 A;  2UXD J;  4B3S J;  4NEY A;  3JAM U;  4B3M J;  3T1Y J;  4JI1 J; 
#chains in the Genus database with same CATH topology
 3DM2 A;  1FRX A;  4RW7 A;  4O3Q A;  1FRK A;  2LQ9 A;  5KFD A;  1HWU A;  4EYI B;  3CF5 Q;  3VTI A;  1W2I A;  2H51 B;  1FJE B;  2Y1I A;  4TYA A;  3OHB A;  1MSW D;  3R7N B;  3ET6 B;  1G4C A;  4DUY F;  4NI2 B;  3WHI A;  1ICE B;  3DDN A;  4USV A;  2GX8 A;  4DLG A;  3EWG A;  3VVU A;  2QMU B;  4LVN P;  4OI1 A;  2HK3 A;  4C3M A;  3HMJ G;  4DF4 A;  2ZJQ Q;  1U1Q A;  4C97 A;  2D41 A;  3BQ0 A;  2F4V F;  4WF9 Q;  2C2R A;  5LJ5 Y;  2FVC A;  2P5V A;  3D3B J;  1GQE A;  2D3U A;  1Q7Y T;  2XG8 A;  1I51 B;  2LA4 A;  3TVK A;  2MQO A;  3H4D A;  5I42 B;  4O0I A;  1T03 A;  3HVW A;  3BSC A;  3BGR B;  2BM1 A;  3PRB A;  5KFE A;  2XI3 A;  4BLG A;  2X3D A;  3OT9 A;  2ZOM A;  3HSZ A;  2DD8 S;  2W2N P;  4XIU A;  3CT9 A;  3PKM A;  2HNY B;  1RAB B;  1E6V A;  2FHJ A;  4UW2 A;  4PQA A;  4BWJ A;  4WP3 A;  5DQI A;  3H59 A;  3PRV A;  4LUB A;  1ZYQ A;  3R2D J;  1H3D A;  5LM7 E;  1RKI A;  1OYE A;  5I42 A;  1H6K X;  2KT2 A;  3BGR A;  1VQ4 S;  2XYG B;  4ZKA A;  1N5V A;  2BZ2 A;  1FK9 B;  5BXI A;  3D0H E;  3TAQ A;  4QIV A;  1R43 A;  2Y8W A;  1N5T A;  4P74 A;  1RJJ A;  2G2O A;  4PXE A;  5IXU A;  2MGZ B;  2HNY A;  1QAX A;  2ROG A;  2YX1 A;  2CZV C;  5D78 A;  1R89 A;  3Q8V A;  2FTR A;  3CVK A;  2HVD A;  1FRM A;  3R2C J;  2VJV A;  1FFS B;  1Q7L B;  1RTI B;  5K8O A;  3BGF A;  5ETT A;  2E1P A;  4IO9 Q;  1EJ7 L;  3OD2 A;  1FK9 A;  2ZFH A;  2ALZ A;  4ZVQ B;  1UA0 A;  1XJW B;  1ZTT A;  4NXN J;  1UWA A;  1C4C A;  1RK8 A;  2G1H A;  4DSE A;  1G1X A;  1UAW A;  2MGZ A;  3RBX A;  3FCW A;  2HMI B;  3KJQ B;  4WU2 A;  5E3A A;  5IOL A;  1HI8 A;  4I64 A;  2RS2 A;  4QIE A;  5IQQ A;  1SC1 B;  2ZWP A;  3TX0 A;  4J90 A;  5D15 A;  1OY8 A;  3LPY A;  4R25 A;  5HBM B;  4ICL B;  2E1C A;  1S9G B;  1S12 A;  1K0T A;  4WZM A;  1IM6 A;  1GXU A;  4P75 A;  1KKH A;  4ZHR B;  1SC3 B;  3PYG A;  4KGM A;  2HFO A;  3IGV A;  2CPX A;  3RW6 A;  3CUL A;  4R0E A;  2A18 A;  2EW9 A;  3KHR A;  1TK8 A;  4Y00 A;  4WTO B;  5KFA A;  1FWP A;  4JI1 J;  2WTF A;  2NLW A;  5C24 B;  4JI7 F;  1HHT P;  1OJ4 A;  2PT0 A;  5HBM A;  4ICL A;  3HHL B;  2G0C A;  4RLE A;  4QCL A;  2LQ5 A;  3D1Q A;  3U1M A;  4DV7 F;  1S9E B;  4R5P B;  3LAM A;  3EYZ A;  4ZMM A;  5U47 A;  4DSF A;  5KFF A;  3CO9 A;  1X5S A;  2QZ8 A;  4NCB A;  2YWH A;  1XBW A;  3IP0 A;  5F8J A;  2NR0 A;  3EZ5 A;  3SMZ A;  1FVS A;  1T9U A;  2PO4 A;  5C24 A;  4KPY A;  4AT1 B;  3PCO B;  1FD2 A;  3BRE A;  1TFY A;  4WP8 A;  2CQD A;  2VAS A;  4N8N A;  5KFI A;  2UUB J;  4JI3 F;  1UVM A;  3HHL A;  1YBT A;  3KDO A;  2LXU A;  1S9E A;  4J9P A;  2JLF A;  4R5P A;  4KGV B;  1S1U B;  4YUD A;  2BJD A;  2IFX A;  1RAC B;  3L7O A;  3JTP A;  4RNH A;  1TUW A;  4Y6I A;  3EPG A;  1MRO B;  3RAM A;  4OYP A;  2XWY A;  2UV8 G;  1VI7 A;  2KJW A;  1CJV B;  2VZ9 A;  1JK9 B;  2QC3 A;  2W7A A;  3RZA A;  3DHX A;  4NLS A;  3RB0 A;  2IPO B;  4CO2 A;  2UUC J;  2ZM6 F;  3TOQ A;  2MB0 B;  4CH1 A;  4ZPW R;  4DU8 A;  3EUN A;  1EET B;  3BS9 A;  1S1U A;  3EVO A;  3M6V A;  3EMT A;  3LOU A;  5FD1 A;  4CT8 A;  1FEH A;  2X1A A;  4TU9 A;  4ILM A;  1MRO A;  1QVF R;  3IAM 9;  1IQZ A;  3KXD A;  1CJV A;  2DPI A;  3SFU A;  3TZW A;  3DU6 A;  4JYA J;  3D5M A;  1SH2 A;  3P3D A;  3NBP A;  3KLH B;  2AJ4 A;  2XI2 A;  4PYA A;  4NML A;  4C8K A;  3TQ1 A;  1YBU A;  4KYZ A;  1NJW A;  2NYI A;  1EET A;  4U95 A;  2J6U A;  2GFF A;  1HIY A;  4Q8E A;  2JEJ A;  2ZOG A;  4KQZ A;  3R1H A;  2C22 A;  2AZ1 A;  3GIR A;  4M63 A;  4CCH A;  1TKT B;  1S72 S;  1RI7 A;  1WD6 A;  4Y2K A;  2H5E A;  4LFB F;  3I9Z A;  4PWW A;  2MKK A;  2VQE J;  3BYR A;  3KHG A;  1W26 A;  1WHX A;  2CNN B;  2FJA B;  4RBV A;  5DLG A;  3PHT A;  5EN1 A;  1MWY A;  2AZ3 A;  3IN5 A;  5GAH U;  2AEM A;  1REG X;  4YOE A;  1RHJ B;  4RJV A;  2PFF B;  3QSI A;  2C3P A;  2GJI A;  4RU9 A;  3L09 A;  4KHP F;  4FYY B;  3W5Z A;  4OX6 A;  3N6L A;  1YK9 A;  2NXU A;  1TKT A;  5D4P A;  5LMN F;  2RDD A;  5HAN A;  1GMW A;  1V3R A;  2AX0 A;  2L9W A;  1GEH A;  4Y2A A;  1RTJ A;  2V50 A;  4LR9 A;  1UTA A;  3TEG A;  2EI5 A;  3GQC A;  5KFU A;  3OSN A;  4BC7 A;  2IJF A;  3CC7 S;  2ABY A;  2Z30 B;  3O5T B;  3QLH B;  1KVJ A;  4GMK A;  2KDO A;  1T7P A;  1NHV A;  2YX7 A;  1RT1 B;  5B0F A;  5ADZ A;  3Q83 A;  3OL9 A;  3PW2 A;  4OZL A;  1V3Z A;  4B9N A;  1Q5V A;  2DGS A;  3LP2 B;  4UOC A;  1BY9 A;  4ECY A;  4LT6 A;  2JJ4 D;  4YS2 A;  2F9J A;  3WX8 A;  4WYW A;  1OQ3 A;  1VFJ A;  1B64 A;  3GR1 A;  4LBH A;  2R7W A;  4V19 X;  5D0E A;  1S1T B;  1H73 A;  4CLT A;  4IQM A;  3FBF A;  1YIJ S;  1FE4 A;  3QFW A;  4UOG A;  1VC5 A;  3QLH A;  5DM7 Q;  2RQ4 A;  2PD1 A;  2EVZ A;  1L3V A;  2CDR B;  1RT1 A;  3DRP B;  1YRX A;  1RA7 A;  2BE7 D;  2RJZ A;  4I1T A;  1I5O B;  5L1J A;  3LP2 A;  4L73 A;  3TJ8 A;  5LOQ A;  4UOF A;  3Q8Y A;  1FFW B;  3W64 A;  1DAX A;  4WWS A;  4G3I A;  3KLG B;  3VWS A;  3DFE A;  4ECQ A;  5HVH A;  2IYG A;  4O0N A;  1QE1 B;  5KFS A;  4LSZ B;  3ZZU A;  4B9L A;  1RSC A;  4W92 B;  2L08 A;  2FUG 9;  4P72 A;  3AFG A;  1EX8 A;  3DKD A;  5KT2 A;  3SI8 A;  1PO6 A;  3KHH A;  4M5D B;  3DRP A;  2H5J B;  2QSW A;  1UA1 A;  1JLE B;  1JLF A;  2WON B;  5JXS A;  4X4V A;  4Q5V A;  2W9C A;  2E29 A;  1DFD A;  4NLR A;  5BR8 J;  1D09 B;  1LQ9 A;  1N52 B;  2P9G A;  3C15 B;  2ROE A;  2LDI A;  3KLG A;  3DLH A;  2EC2 A;  1QE1 A;  4BBY A;  4A8S A;  2HK2 A;  1PGZ A;  1IBL F;  4CT9 A;  3NLC A;  3I87 A;  1SIZ A;  4KJI A;  2XYP B;  1CJK B;  1WI8 A;  5A8K A;  2IVF B;  3QMQ A;  4TY9 A;  1KHV A;  2HNZ B;  4Y3C A;  2ZC3 A;  4M5D A;  2RIJ A;  3HDS A;  5KFP A;  3EZU A;  1JLE A;  4E0D A;  2WON A;  1Q0N A;  4F7V A;  4AUK A;  4AND A;  1NDL A;  2AYM A;  5L38 A;  3MR3 A;  3C15 A;  1QTM A;  4F8R A;  4G65 A;  1QAJ A;  3MM9 B;  1F2H A;  3GIL A;  2HIY A;  5E3R A;  3A8E A;  2V2V A;  4TLQ A;  2K3I A;  1CJK A;  3TA2 A;  2UUT A;  2H4Y B;  2HNZ A;  1SJ4 P;  1NJY A;  1VQM S;  4F4Y A;  2GIR A;  5J1N A;  4X4R A;  1KWM A;  3UCU P;  1K1Q A;  1Z2Z A;  2X1B A;  2Z2L A;  2ZH3 A;  1PAE X;  2QX0 A;  2KI2 A;  2R8G A;  3P8B B;  2EFQ A;  1N8R T;  2ZH4 A;  1N4L A;  2ZEJ A;  2QO3 A;  2E5J A;  3AA8 A;  1WOO A;  4IOB A;  1KEK A;  2FD2 A;  2JEG A;  2IA0 A;  2XMJ A;  3MM9 A;  4UQG A;  1S9F A;  2KXH A;  2KN4 A;  2YNH B;  4GVB B;  3NG8 A;  5GAH I;  1XNQ J;  3HD2 A;  5ITH A;  1KBR A;  4UOH A;  3PY8 A;  2VON A;  1UW4 A;  2KM8 C;  2PI4 A;  1TK5 A;  4MFB B;  3W3S A;  1ZPW X;  5KFM A;  2VG5 B;  2RQC A;  3JTO A;  3K5P A;  4ANC A;  4DQI A;  1M1G A;  1DZ5 A;  1VDH A;  2RU9 A;  3Q0A A;  4CYU B;  3QAU A;  3DU5 A;  2L3M A;  3CCV S;  3RB3 A;  4E8U A;  1EQ0 A;  4GVB A;  4OZ0 A;  3CO0 P;  4D3G A;  3DXS X;  2B5J B;  1K8A T;  4TXS A;  3HPO A;  4NWB A;  4OJ1 A;  1RZM A;  3VAG A;  2DHS A;  1NM2 A;  1IR1 A;  3LWM A;  3N9U C;  3CB4 A;  2DGQ A;  2NUU G;  1KD1 T;  3S8S A;  4MFB A;  3Q8Q B;  3FUY A;  3QZ7 A;  2VG5 A;  2D9O A;  2BX6 A;  1FKP B;  3EZO A;  1NZ8 A;  1Q78 A;  3B78 A;  4RO0 A;  3AHP A;  2IIH A;  4CYU A;  2NCK L;  3T41 A;  4HAC B;  5L1I A;  3W7B A;  4DI6 A;  4Z7Y A;  2B5J A;  1UJ4 A;  1YSJ A;  1KHW A;  1U8S A;  4EI2 A;  2IJN A;  4KHR A;  1RTZ A;  4X62 J;  3OR2 B;  3BGO P;  1QM9 A;  3JYT B;  3QRP A;  2OD4 A;  1FKP A;  1JJC B;  2R42 A;  2M0G B;  2J76 E;  2ZH6 A;  4JB8 B;  4L3K A;  2AU0 A;  4UUX A;  1YG0 A;  2AYG A;  4HAC A;  3M8Q B;  3CMQ A;  3MPV A;  3UD3 P;  2E5L J;  1FX2 A;  1HW9 A;  3HSJ A;  2J9D E;  4CLP A;  2YKP A;  2EG2 A;  4ED8 A;  3J80 U;  4MYU A;  2DNO A;  4PG6 A;  2OAU A;  3HFK A;  2Z58 B;  4HL9 A;  1M5V C;  3GFH A;  2ERR A;  4NXN F;  1GK8 A;  1WOP A;  3OR2 A;  3H5U A;  4NEZ A;  3BKT A;  4RW4 B;  1FCA A;  3QNW B;  3D6T B;  3JYT A;  4FS2 A;  4FVM A;  2ZNY A;  4ED7 A;  1HBN B;  2B4V A;  4OL8 A;  4HI2 A;  3M8Q A;  5CZX A;  5HAT A;  2XMW A;  5T41 A;  4U8Y A;  2AJ0 A;  4N7T A;  3CGI A;  2HHP A;  4HR2 A;  4LRA A;  3H5Y A;  3RRK A;  2FLP A;  3ZZP A;  3QIP B;  2OTJ S;  3RAX A;  5KT7 A;  3MTK A;  3K0J A;  3GII A;  1HI1 A;  5CYM B;  4RW4 A;  5GMK a;  4Y65 A;  2FJD B;  2DNR A;  2IY5 B;  2BJ8 A;  4WIQ A;  1HBN A;  2E1R A;  2C2Z B;  2JEF A;  3OSP A;  3C16 B;  5KG5 A;  3DRS B;  4JI1 F;  2CVE A;  1SQG A;  1NK6 A;  4A47 A;  2L9N A;  1VRU A;  2BAC A;  3HM9 A;  4RNF A;  4ECV A;  3DLG B;  1U2C A;  2BJ3 A;  1RIS A;  3AJD A;  3UE2 A;  3W61 A;  4QU7 A;  1MW7 A;  5CYM A;  1XNR J;  3IR7 B;  3DLK B;  4EGL A;  1WI6 A;  4MTP A;  2MLZ A;  4DV3 J;  5KFL A;  4RL1 A;  2ALY B;  3C16 A;  4Y28 C;  2DO4 A;  1S0N A;  1FFG B;  2XLI A;  1WEL A;  2EK1 A;  2IM0 A;  2DNM A;  2CPZ A;  5F9N A;  1Z4U A;  2UUB F;  3BR8 A;  1VRQ C;  1YJ7 A;  1JIH A;  5B7W A;  1WKJ A;  3NGS A;  2VPW B;  2KVQ E;  4LSL A;  3WC0 A;  2P8I A;  4YDD B;  4M5G A;  1NND A;  1HQU B;  1VBY A;  3TVZ A;  3DLK A;  2KFZ A;  1U0H B;  1UZD A;  1VMB A;  1YJW S;  2GS8 A;  4OX9 J;  4QW9 A;  3PYF A;  3TP2 A;  3OBI A;  3QGH A;  3AD9 C;  2GVZ B;  1AXQ A;  3IBC B;  1FXR A;  1RAJ A;  5KFJ A;  2UUC F;  3SCJ E;  4RU2 A;  4KPC A;  2OPS B;  2HAF A;  2VDH A;  2AJ2 A;  4TU8 A;  1Q16 B;  4IR1 A;  4F4X A;  2KFY A;  2CQB A;  1C2P A;  2DY1 A;  5HO4 A;  5ETL A;  1HQU A;  3E2E A;  3D54 A;  4OHZ A;  2RQK A;  1SIW B;  2ZZM A;  3S01 A;  3NNA A;  4IRC A;  1UKU A;  2FJV A;  4HHH A;  4JYA F;  5D4N A;  1R6Y A;  1UL3 A;  4F67 A;  1S59 A;  2JC1 A;  3IR6 B;  4PXC A;  4ZLN A;  2UVW A;  2RUG A;  3PX4 A;  1RAF B;  2PA8 D;  1NHK L;  4IRD A;  3FRY A;  3BF4 A;  4Q45 A;  1NB7 A;  1QSS A;  2OPS A;  2V4J B;  4NLD A;  5GAG U;  4EZ9 A;  4WKY A;  4ECX A;  4XO0 A;  4AL5 A;  4QWE A;  1JNR B;  2BQU A;  3HZG A;  3W65 A;  5F0W A;  4DV6 J;  3B8H A;  1HHQ A;  1NXI A;  2HG4 A;  2BMB A;  5CXT A;  1U7L A;  4KTQ A;  3TYT A;  2QSF A;  3PX6 A;  1LW2 B;  4O3P A;  3G8S A;  3T9N A;  4NL5 A;  2VQE F;  3QBC A;  3T5L A;  3MPD A;  2FY1 A;  1KLN A;  4I68 A;  3R5G A;  5HVG A;  1BHN A;  3AB4 B;  4LIW A;  3NWR A;  3QT8 A;  1XK8 A;  3NS5 A;  5LSL A;  2V4J A;  4LFC J;  1B0P A;  4L75 A;  3B6B A;  2F5G A;  4U9R A;  2XEX A;  2QGF B;  2I0X A;  1M1H A;  3Q23 A;  3MM8 A;  4PYD A;  3D3C J;  4WJB A;  1BQM B;  4AE5 A;  3OPK A;  1HNW J;  1LW2 A;  2FZC B;  3POT B;  1PCA A;  1U48 A;  2KU7 A;  4CLS A;  1OSC A;  2VH7 A;  2BE9 B;  2IRY A;  2XB2 D;  2H3E B;  4TNO A;  4E98 A;  2DJW A;  3NEK A;  1HD0 A;  5K9F A;  3V6K A;  4M5K A;  1TMJ A;  2IMO A;  1NME B;  3SYZ A;  5KOW A;  1BUX A;  1BQM A;  4P7T A;  4OI6 A;  5CD4 A;  2XGP A;  1SCJ B;  3CJ5 A;  4L6V 3;  2OO4 A;  2CQ3 A;  2XO6 A;  5KFO A;  1YJ9 S;  3WIU A;  1YIT S;  3POT A;  4H4O B;  4URG A;  4ZVO B;  1JX4 A;  1NU4 A;  2V4R A;  1RWW B;  2ZH9 A;  4NE9 C;  4YHH J;  1WG5 A;  4M5L A;  1B4S A;  1SKU B;  2CQI A;  5K5M A;  3KHL A;  4J9K A;  3MUR P;  3HHN B;  1TUG B;  2YNG B;  3FJ2 A;  1HPZ A;  5IC4 B;  2F7V A;  3OL6 A;  3RUB L;  2IC3 B;  3DCA A;  3NCP A;  3OFH A;  5DDR C;  2I5J B;  1RT3 B;  1I3O B;  3I31 A;  4G1P A;  3SV4 A;  2R2U A;  4CLZ A;  2GHV C;  4H4O A;  5KFQ A;  1SBR A;  4ES1 A;  2WB4 A;  2XZD B;  2CKW A;  2RNE A;  4EO6 A;  1S7I A;  2E5H A;  3FMW A;  3HLU A;  2W7O A;  5ETO A;  2KXN B;  2ZDO A;  2YNG A;  5IFM A;  4GO7 X;  2IC3 A;  1NPR A;  4H4K A;  3WIV A;  3LAL A;  3UDV A;  5F8L A;  2I5J A;  1RT3 A;  4X64 J;  5BR8 F;  2OMO A;  1O5J A;  3H4B A;  2AEF A;  1K73 T;  2OUG A;  2VV5 A;  3TZX A;  3PIO Q;  4C0B A;  1LWC B;  5A0Y A;  2UVU A;  2KL8 A;  1RUS A;  1UJ5 A;  2Y9H A;  1HD1 A;  1TZ0 A;  3A1Y G;  5DLF A;  4M5M A;  1OPZ A;  1NSK L;  2FHO B;  2ZBR A;  4JV2 A;  1IWA A;  3SSQ A;  3BM7 A;  5A2Q U;  2V8D A;  2DNQ A;  3BBF A;  3PJX A;  2GHP A;  1S4E A;  3TNV A;  4X66 J;  4FKX A;  1X9W A;  3N01 A;  1WAC A;  1T9X A;  2M7S A;  2EXU A;  4ZVF A;  3LAK A;  1VS3 A;  2CYY A;  1LWC A;  3R5J B;  3DXB A;  4J9M A;  3PW7 A;  3ILL A;  3DOL A;  1TMM A;  4DR7 J;  4EBE A;  1KFS A;  4DN9 A;  5GAG I;  4DN0 A;  3IM8 A;  5F0U A;  1KQF B;  3THP A;  1UCN A;  3CJQ A;  2CVI A;  5ETK A;  4IOA Q;  4QW8 A;  1M5K C;  1ZH5 A;  2QTW A;  4HDG A;  4OZ1 A;  1AZS B;  3LGH A;  2HHU A;  3MMC B;  1IBC B;  1L3T A;  3VR1 A;  1HAR A;  1T11 A;  2KG1 A;  3MF5 A;  2XTJ P;  1JNZ B;  2XYH B;  1NCL A;  3UN2 A;  3GYG A;  4FZV A;  1P9Q C;  1XNQ F;  4Q8F A;  5KFR A;  4LF5 J;  2EG1 A;  3O44 A;  1U1N A;  1PAU B;  2R7V A;  2F65 A;  3CCU S;  2M88 A;  1D3W A;  1R31 A;  1WHV A;  2I8E A;  2FZG B;  1N48 A;  4IH7 A;  3D6M B;  2C2D A;  1ZM9 A;  4FF3 A;  1AZS A;  2LMI A;  1H72 C;  2E7W A;  3MMC A;  4PKD B;  3E01 B;  3GB0 A;  5ETR A;  3OTO J;  1NK9 A;  1F0X A;  3T6B A;  1U09 A;  1U1R A;  1TVR B;  4PG5 A;  3QRQ A;  1R8C A;  2VG7 B;  1N56 A;  2N3L A;  1RE1 B;  2GMH A;  4M5I A;  3OL7 A;  3F73 A;  3GLJ A;  1HNZ J;  2HBQ B;  4F3M A;  4DS4 A;  1IR0 A;  2DNK A;  4F0K A;  1LXJ A;  4IOC Q;  2AD9 A;  5AE1 A;  3HVR A;  2PSZ A;  2AGP A;  2KHD A;  1WEX A;  4P2F A;  4EBD A;  1X4B A;  2MZQ A;  2PMW A;  3E01 A;  2WSE C;  4C8N A;  2A6M A;  3JSM B;  3NP5 A;  3R3T A;  4N41 A;  3GON A;  2VG7 A;  4CI0 B;  4X4S A;  4USK A;  1K9M T;  2EC0 A;  3QFH A;  2WVE A;  4LBI A;  2YH0 A;  2DT9 A;  2OGU A;  4C4W A;  2RDI A;  4H4M B;  1YVF A;  1GTH A;  5B09 A;  1Q8K A;  2Z8Q A;  3LP0 A;  1RU1 A;  5DET A;  1AT1 B;  5H9E J;  4OMF G;  4X62 F;  4EO8 A;  4ZP9 A;  1O8B A;  4ID5 B;  4ILR A;  4HEA 9;  1PJ5 A;  1LFP A;  2O5D A;  2CUY A;  3MEE B;  3LW5 C;  1KVI A;  1JKH A;  3F56 A;  4ERD A;  3VQS A;  2HHX A;  1FJ7 A;  3DHW C;  1HI0 P;  3RTV A;  4DR4 J;  3KLF A;  1WTB A;  2E5L F;  3QAT A;  1P27 B;  1LWF B;  2C42 A;  1VIS A;  2B7C B;  4ZVH A;  4FF2 A;  2DRD A;  2WSF C;  3PR5 B;  4DCP B;  1MWQ A;  3KLE B;  2P9E A;  3G86 A;  2B43 A;  3AOB A;  1X4A A;  3TZY A;  4HDH A;  3GG1 A;  3UCZ P;  4AL6 A;  1S97 A;  2VBW A;  1Q81 T;  4ID5 A;  3FVY A;  4O4R A;  2LP4 A;  2FB0 A;  4OYZ A;  1EB0 A;  2KYZ A;  3MEE A;  1X4F A;  4WE1 B;  2XY7 A;  2GHW A;  3R7B B;  2Q1L A;  3OL8 A;  4EU0 A;  1FXL A;  2B4U A;  2EBG A;  3AB2 B;  1CQN A;  2V4Q A;  2GA7 A;  1LWF A;  3ADA C;  3L9Z A;  1DQ9 A;  2IJR A;  1B0T A;  5L9X A;  3KLE A;  2VFU A;  4I2Q A;  3GSI A;  3OVB A;  1ZM3 A;  3CPW R;  3KNA A;  5KG3 A;  3R5D A;  1F9H A;  4I4B A;  4WXW A;  2E9R X;  4M5H A;  3R97 A;  1UFW A;  3VAK A;  1YJN S;  4Q43 A;  4J7C A;  4NLQ A;  1U49 A;  3P6Y C;  5LMU J;  2M3D A;  3J81 Y;  3F0N A;  2VOP A;  4WE1 A;  1AA1 B;  4GVL A;  3IBW A;  3K7R A;  2HHS A;  1NUE A;  2VFT A;  2H9Z A;  3HKZ D;  4IFY B;  2LQ8 A;  2DR8 A;  1QTN B;  3KUE A;  1OIA A;  5E41 A;  4UY8 5;  4B3M J;  3IR5 B;  1C0U B;  2AJQ A;  3MGJ A;  4WK3 A;  1V9O A;  1SJQ A;  3W5Y A;  3UR3 C;  2ROP A;  5T14 A;  4M94 A;  1N5Y A;  1XNR F;  2JLG A;  4NZ6 A;  2HFU A;  2YH1 A;  4ZCI A;  2V2Z A;  4DV3 F;  2PMH A;  2POK A;  3D28 A;  2CJQ A;  3EX7 B;  2Y1R I;  1S6Q B;  1IBK J;  2V2K A;  3F41 A;  1CPZ A;  2AMC B;  1C1C A;  3RG6 A;  5DG9 A;  1RGV A;  2DIU A;  4HH0 A;  2BAN A;  2FGC A;  4JV0 A;  1C0U A;  2ZUG A;  3AD8 C;  4MK7 A;  3PDN A;  2RRA A;  3ZO7 A;  1HR0 J;  4HHJ A;  5ETN A;  2ASJ A;  2HRT A;  4NLO A;  2RML A;  2W7P A;  5ETP A;  4C0H A;  2MSS A;  4OX9 F;  3HHL C;  5AXK A;  4NPO A;  4ZCL A;  1TL1 A;  3D7S B;  2JC0 A;  2LQJ A;  4D3H A;  2DIS A;  3NGK A;  2UUA J;  4DZD A;  1X4G A;  3AOD A;  1TFW A;  3X3U A;  3UCG A;  2O66 A;  4DL6 A;  5DG7 A;  2HLU A;  1PYS B;  1GAO A;  5HMZ A;  1ZZF A;  2B3T B;  5B0E A;  4USM A;  4I67 A;  3NXZ A;  1VBK A;  3W9I A;  2HWI A;  2XNQ A;  2C2E A;  3VZI A;  2EKN A;  4ES2 A;  3E51 A;  3PFO A;  3VAL A;  5J2M B;  2QLJ B;  1XR6 A;  1KNZ A;  5HQ8 A;  2HFN A;  3CDW A;  3ZZR A;  4ED3 A;  2X7I A;  5GMD A;  1JLG B;  4F25 A;  1LNQ A;  2F63 A;  2QLF B;  5H9F J;  1XEZ A;  1R6V A;  1RWU A;  4I6W A;  3H0P A;  5KG4 A;  2ZBI A;  2DXF A;  2DIT A;  4DV6 F;  3J7A N;  2ZJR Q;  3VHQ A;  3DYA B;  4RWW A;  3IA0 A;  5L46 A;  4QWB A;  3IM9 A;  5AXN A;  5HJX A;  4DL3 A;  4L72 B;  3SIP B;  4DPW A;  1VRT B;  2ZH7 A;  1ZZN A;  4CRJ A;  3P49 B;  5FII A;  1U1O A;  2OPQ B;  1YDL A;  3GYN A;  3AA9 A;  2KB2 A;  3PEH A;  4ZLL A;  2ZBQ A;  3A12 A;  4ED4 A;  3TUZ C;  2DK2 A;  2AYE A;  1JLG A;  3OFG A;  4C3L A;  4OI0 A;  1PC5 A;  4OIX A;  3ZZY A;  4U67 Q;  4LFC F;  4KBI A;  3PAC A;  3BGL A;  3VQT A;  2V2Q A;  3ZXW A;  3ZZ0 A;  3Q2S C;  5DZ6 A;  1ZET A;  4NAS A;  4WP9 A;  1WOS A;  4YN3 B;  3KMQ A;  1F60 B;  3C3L A;  1WOR A;  2CPE A;  3DYA A;  2YKA A;  1HNW F;  3PO5 A;  3KJN B;  1VRT A;  3I5C A;  3BSA A;  3IRW P;  3AH6 A;  4Q44 A;  2OPQ A;  4LR7 A;  1SJF A;  4WBF A;  3LQV A;  4MK8 A;  4FYD A;  3T5H A;  4FXW A;  2MDA A;  4EYH B;  2IBO A;  4ETZ A;  3P4U B;  2GJF A;  1WEY A;  3VZH A;  2MQM A;  2ZIT A;  5BYR A;  3UDE A;  1CC7 A;  2WZ1 A;  4OZ2 A;  3R6L B;  2HBR B;  2FC9 A;  3BPD A;  3ITH B;  2OH2 A;  4DSI A;  3W62 A;  4B3S J;  3DLE B;  3FCH A;  4PAA A;  2DH8 A;  2V34 A;  2VIC A;  2VG6 B;  3AXM A;  2DGT A;  4Y2C A;  4DPO A;  2E9Z A;  4RUB A;  4DSL A;  3I4H X;  4YHH F;  1U02 A;  4FBT A;  7FDR A;  1F2G A;  4A48 A;  1UWB A;  4ZOS A;  3FCV A;  2HYI B;  5CAA A;  4NCG B;  2DY9 A;  2WVF A;  5A2Q Y;  1HFE L;  2HW3 A;  2CNL B;  1URR A;  3ITH A;  2QA2 A;  1JXV A;  4YFU A;  3E3X A;  3T5K A;  3QJP A;  3TUJ C;  2VG6 A;  1HNV B;  2Q79 A;  3IRX B;  3CJ2 A;  2EFO A;  5EDW A;  5KG2 A;  1G6B A;  3UD5 A;  3NS7 B;  1U47 A;  4RUC A;  4OJG A;  4ZPD A;  3M9N B;  2HND B;  2MHN A;  4Z7C A;  4N56 A;  4EWT A;  2X3G A;  1TKD A;  3K57 A;  2L41 A;  2HVH A;  3HSD A;  1S48 A;  3NOC A;  4G6V B;  4NCG A;  5HMY A;  3K5O A;  3VV2 B;  1L3K A;  2FPH X;  4LRB A;  3FRZ A;  1QJH A;  4OJH A;  4JBC A;  5JMN A;  2MMY A;  2VQF J;  1U8W A;  4CM0 A;  4JI8 J;  5D6G A;  4X64 F;  2WRM A;  1X9S A;  4N8O A;  1HNV A;  3D0G E;  3TAR A;  2HS4 A;  4KKO B;  2OJ3 A;  3PW4 A;  3IBF B;  3ISN C;  4DL4 A;  2HND A;  1X4H A;  3IWL A;  4IR9 A;  3AAW B;  3KK1 B;  1WF2 A;  2Q6C A;  1U2F A;  2HSE B;  2XUL A;  1VK3 A;  4CZC A;  4C3K A;  4DOZ A;  4FPI A;  4HVZ A;  5AE3 A;  2R8K A;  3ILO A;  1SKW A;  4GKJ J;  2QA4 G;  4CTA B;  3P5B P;  3ULH A;  1UFK A;  9RUB A;  3AQP A;  3A4T A;  2DEJ A;  4X66 F;  1FWK A;  1WC4 A;  2HHW A;  3EDR B;  2PII A;  2ZHB A;  2BR0 A;  2D74 B;  4O23 A;  4TLR A;  5IT4 A;  2CJ9 A;  3H5X A;  3KMS A;  4C8Y A;  2HQD A;  1HA1 A;  4HTI A;  2QFI A;  4FYX B;  3KK1 A;  4DR7 F;  3FZ2 A;  3MXH P;  3HP6 A;  1RAE B;  1SVD A;  3ICL A;  4URS A;  1S0M A;  3GE9 A;  3W8P A;  2RAQ A;  2COL A;  4CTA A;  1KN6 A;  1FEE A;  4QWD A;  1TAU A;  3DLL Q;  4KIA A;  3UFC X;  1HLW A;  2LU2 A;  1FNM A;  4P73 A;  1KLM B;  4UZC A;  1U45 A;  4N47 A;  3H42 A;  3M05 A;  4K4U A;  2K7K A;  3FSY A;  3AOC A;  2ZBP A;  2CJB A;  4ED6 A;  2AT1 B;  8AT1 B;  1CS4 A;  3VGV A;  1JWW A;  3O1L A;  2UXC J;  3DOM B;  3HD1 A;  3TO8 A;  4CLW A;  5I3U A;  4XPC A;  3PKY A;  4LF5 F;  4NLX A;  1YRT A;  2O01 C;  3DN9 A;  1IKX A;  4C8Z A;  2JEI A;  1NO8 A;  2R8J A;  2A10 A;  5EWG A;  2QL9 B;  4DR1 J;  1LWE B;  3H2U B;  4V1A k;  1WC0 A;  1OY9 A;  2KXF A;  4RNN A;  1RWO B;  2CPI A;  1KLM A;  3OTO F;  1TL5 A;  3R7S B;  2Z2Z A;  3JB9 k;  2P6T A;  2QA4 S;  5A6P A;  5A8R B;  2VA3 A;  1HNZ F;  3HHK A;  4NOH A;  3G2X A;  3EDQ B;  1C1B B;  3TW0 A;  4EK2 A;  4DBQ A;  1J5O B;  1H2U X;  5DRK A;  2B9W A;  5J2Q B;  1Q82 T;  2XQC A;  3CC2 S;  1LWE A;  2AF6 A;  2CQ4 A;  2HEK A;  3ENA A;  5F8N A;  4AXI A;  5CYJ A;  5LSR A;  1Q5Y A;  2YKO A;  4NLY A;  5CAB A;  5KFB A;  1QY7 A;  2J5A A;  3ETM A;  5A8R A;  2W8K A;  4B3R J;  3ILJ A;  3T1H J;  5HK4 A;  1S1X B;  5CZV A;  2BKO A;  2CPJ A;  4ZPV R;  2DH7 A;  2RVJ A;  1YQH A;  2CDQ A;  4ZP6 A;  1C1B A;  2J7K A;  1S57 A;  1Z1Z A;  3UN5 A;  1BXN A;  1J5O A;  4OLP A;  5J2Q A;  3GIJ A;  4O4G B;  3OJS A;  3ZNU A;  1N6Q B;  4NA3 A;  1Q53 A;  3IG1 B;  1Q8B A;  4N76 A;  2V8V A;  1XMO J;  1KSP A;  1HBO A;  5IQ6 A;  3MI7 X;  3MD1 A;  3KK3 A;  1T03 B;  4OYB A;  3FQK A;  1DY3 A;  4DR4 F;  3MR7 A;  1KS2 A;  3W9J A;  3UQS A;  1S1X A;  1KDN A;  2AGO A;  3HCX A;  1UPP A;  1JLA B;  2MXY A;  3KG0 A;  3TJ9 A;  3MMA B;  1REV B;  1DUR A;  5CHC B;  3O6Q A;  2DGO A;  2G9O A;  1S6U A;  1QUV A;  4KHM A;  5D4O A;  1E6V B;  5KFT A;  4O4G A;  1N6Q A;  1UMJ A;  3IG1 A;  4XPE A;  1ZPV A;  1L5U A;  5IC6 B;  3W5X A;  3A3O B;  3I4P A;  2QE5 A;  4B9V A;  4M95 A;  2Y3Y A;  1VR6 A;  1U24 A;  4A8M P;  3RGI A;  1JLA A;  2VOD A;  6FD1 A;  3MMA A;  1REV A;  4RR5 A;  3KDN A;  2VF3 A;  1SQE A;  2R8I A;  2Z2Y B;  3OVA A;  3GV7 B;  3DDI A;  1JLC A;  3UR0 A;  2W25 A;  5CYQ B;  4F0M A;  1G2E A;  1AW0 A;  4ECT A;  3JTN A;  5LMU F;  1ITP A;  5DO2 A;  1VQ6 S;  4GC6 A;  2EPI A;  2ZH5 A;  3GJS B;  1I94 J;  4C2M A;  4ECW A;  1EQM A;  2A3J A;  1SKR A;  1IKV B;  2ZNZ A;  3OXL A;  1PYT A;  2CJY B;  4PG8 A;  2ACY A;  3GZ7 A;  2WVB A;  2G13 A;  2QIF A;  2IVM A;  2OPR B;  3M8S A;  4B3M F;  1MML A;  3ZZT A;  3KWM A;  4S0M A;  2IBK A;  3FC9 A;  1RAO A;  5CYQ A;  4Y34 A;  3PRD A;  3CJT A;  2PI5 A;  4YR0 A;  4KV8 A;  5HLF B;  1QDU B;  3IXQ A;  3RR7 A;  2CQH A;  3CJ3 A;  2HQF A;  4KAI A;  3W66 A;  3J7A 1;  4Y2I A;  3MEK A;  1IKV A;  1S6O A;  2V63 A;  1RLC L;  1IBK F;  1U25 A;  1RYR A;  2QT7 A;  3QJJ A;  3CE8 A;  3KLI B;  3SBM A;  2JRS A;  4J37 A;  3BYP A;  4K50 A;  2OPR A;  3LAN A;  1RT5 B;  2CAD A;  3WDO A;  3R5A A;  1TU0 B;  1UFL A;  4JP8 A;  1SI9 A;  1PBA A;  1HR0 F;  1NK0 A;  1R8A A;  3W9H A;  2QMX A;  5BJR A;  3Q2T C;  1YZ6 A;  5AXL A;  5B0D A;  5HLF A;  3D66 A;  3H20 A;  2VU5 A;  3CJ0 A;  3BZQ A;  4QQB A;  1HKA A;  4F02 A;  1X5O A;  1GT8 A;  1FRJ A;  3GP9 A;  3KLI A;  2KJV A;  2BVZ A;  4DR5 J;  2FIU A;  4EZ6 A;  3DOK B;  2RHS B;  1RT5 A;  1S6P B;  2UUA F;  3NOG A;  2RB7 A;  2AWZ A;  2GQC A;  3R8Y A;  4X4Q A;  2E66 A;  5E3C A;  4TYB A;  3W2V B;  2VBY A;  1H2T Z;  2NPI A;  1FF2 A;  2IDL A;  3RB6 A;  4C8L A;  3DC2 A;  4M8L A;  4M5N A;  2ZWO A;  3QWP A;  3GJT B;  4TN2 A;  4LSN B;  4MK9 A;  2BRL A;  5LXY A;  5HVF A;  3DGP B;  3RJM B;  3KOA A;  2HHV A;  3DOK A;  1S6P A;  4PZV A;  3A3N B;  1NJI T;  4DV1 J;  2XHW A;  5LXR A;  4RW8 B;  2DPJ A;  1YX2 A;  3W2V A;  4I56 A;  4DFM A;  5CD4 H;  1NH7 A;  1LWX A;  4ZVT B;  3J81 j;  4USI A;  1RWM B;  3LTO A;  2BBE A;  1GMV A;  2YWE A;  4LSN A;  3CCS S;  2RH3 A;  2YBV A;  4B9M A;  2DNG A;  2Q43 A;  4J9S A;  1XC9 A;  3I0R B;  3DGP A;  1UPM B;  5DDO C;  4USU A;  2ADC A;  3TVY A;  3NNC A;  2MJU A;  2IRX A;  2G2Y A;  1PYO B;  4USJ C;  2OI2 A;  4RW8 A;  1VCT A;  2YX4 A;  3MFH A;  2CQG A;  4ZDN A;  5DDP C;  3MCS A;  2BQR A;  2IDE A;  1FI4 A;  2BW7 A;  1BLU A;  3NBP B;  3NMA A;  2YY3 A;  2HHT A;  4X4P A;  1V6H A;  3FSX A;  3K89 A;  4K4S A;  3LO3 A;  3B4M A;  3BGU A;  3I0R A;  1EKR A;  4OYI A;  4IQX A;  3M9M B;  1FVQ A;  4C98 A;  3L7P A;  3DRX A;  2RIL A;  4ZN3 A;  3GJQ B;  2OEL A;  5IM0 B;  1JJ4 A;  4B3S F;  3R6G B;  2N7Y A;  1Y5I B;  2XMU A;  3THT A;  3V6D B;  5KFX A;  4K8R A;  4MIA A;  2AQ4 A;  1ELO A;  2DCL A;  5L1K A;  4ZJL A;  3VAI A;  1NPP A;  4JI6 J;  2KFN A;  4DL0 C;  4PXD A;  3VGS A;  4QYZ J;  1EP4 B;  1TTH B;  3CCT A;  2V9K A;  3GR0 A;  3U27 A;  3HHD A;  2JOQ A;  3M8W A;  4DX6 A;  1U1M A;  1RHM B;  5IM0 A;  3MHY A;  4RW6 A;  1RQ0 A;  2JNJ A;  3I82 A;  3MOZ A;  3NGT A;  2MY7 A;  5KFN A;  3MD3 A;  3D9B A;  1RTJ B;  2QLB B;  5D8H B;  1FX4 A;  2FLN A;  4RW9 B;  3V6D A;  5E7O B;  2IRU A;  2RF2 B;  4C11 B;  2XNR A;  4KT0 C;  2FJX A;  1WF1 A;  4UY8 T;  4DUZ J;  2XLJ A;  4X4O A;  3IC1 A;  4AYB D;  3ENV A;  3SV3 A;  3EIC A;  3HJF A;  3N6M A;  1F1B B;  4F26 A;  2DR9 A;  1EP4 A;  2DNL A;  3KFW X;  2KRB A;  5ETS A;  3ETO A;  2N4C A;  2FZK B;  1F9E B;  1XIQ A;  3D67 A;  2CJK A;  1Q8L A;  2VQF F;  1IVZ A;  3QGI A;  4JI8 F;  4KFB B;  1D0E A;  4FPR A;  5FDL A;  5DQG A;  4ELV A;  4IDK A;  4RW9 A;  1SH0 A;  1UEV A;  2RF2 A;  4C11 A;  1MMD A;  5C2C A;  2D69 A;  4PPD A;  3B54 A;  1GH8 A;  2J0Q D;  4WCE Q;  3DRY A;  1C0T B;  2ZZN A;  4ZPC A;  4KO0 A;  3ZZO A;  2MPU A;  4H4K C;  3KG1 A;  1VJQ A;  2VBZ A;  4NMX A;  4AFF A;  2MZJ A;  1Y3K A;  2GML A;  3SSS A;  1K1S A;  1NLK L;  1SL0 A;  3C14 B;  4BCA A;  1FDB A;  4GKJ F;  2YKN B;  3D1H A;  2XM3 A;  4XK8 C;  3MCO A;  1VQL S;  4YR2 A;  2Q6B A;  3SFG A;  1B7Y B;  4KFB A;  5D3G B;  1XMQ J;  5C5J A;  1RBA A;  3CCR S;  2PFD A;  4PWD B;  2MKI A;  4QR0 A;  1BQN B;  1IN0 A;  3UDL A;  1YJU A;  1C0T A;  5GAD U;  5D4L A;  1M5S A;  5IV4 A;  4E2F B;  3CSK A;  2BOA A;  3T6J A;  3VAH A;  1Q8I A;  1Y5L B;  4LQ3 A;  3CUN A;  1KFD A;  3FZB A;  2IM2 A;  5A76 A;  1JLF B;  4USW A;  4MMO A;  1RT7 A;  1YLX A;  3C14 A;  4MAK A;  2W9C B;  3ELH A;  3OTE A;  2YKN A;  3H7H B;  1NBE B;  2HBY B;  1H0H B;  2D3Z A;  2B4P A;  5D3G A;  2CWX A;  5KTQ A;  4A8W A;  1X8D A;  2E7X A;  4OFZ A;  4OZ5 A;  2ZKT A;  4PWD A;  4AXJ A;  4DSJ A;  4NLW A;  3D6F B;  3OTC A;  3KJV A;  1BQN A;  1S99 A;  1RB0 A;  3RAQ A;  2XWX A;  2HFV A;  4WK1 A;  1U1P A;  4LJM A;  7AT1 B;  3RRH A;  2XLK A;  2G1D A;  1F6T A;  5AT1 B;  1U26 A;  3FBE A;  5A8K B;  4N5S A;  2UXC F;  1HNI B;  4FBU A;  2FJB B;  1NPK A;  4LF7 J;  3HVT B;  2WW4 A;  1X5T A;  4B3O B;  1RCO B;  3CCZ A;  3PTW A;  4IH5 A;  4C9D A;  4PPZ A;  1D9F A;  1PIL A;  1QAI A;  1L3U A;  4LF6 J;  1QAY A;  4DR1 F;  2WVD A;  3AXK A;  4J91 A;  2H65 B;  2DH9 A;  2GIQ A;  2K7J A;  1S4F A;  2Z57 B;  2V6A A;  3K59 A;  1M1K T;  1HNI A;  4IKA A;  4LF9 F;  2EBE A;  3HVT A;  3PXG a;  3M4X A;  4P2M A;  3SQG A;  4B3O A;  3FFI A;  3PVX A;  3P45 B;  1U0S A;  2OD6 A;  2I2Y A;  1GX5 A;  2IM1 A;  5LSO A;  5D77 A;  2DNN A;  1AUS L;  1Y5N B;  3RYL A;  2HS0 A;  2M8D B;  4NX9 A;  2L9D A;  4TKT A;  2QFJ A;  3AQO A;  3KNG A;  2N82 B;  4KGZ B;  3BBC A;  2R2T A;  1PSD A;  1NK5 A;  5LJ3 Y;  2NUH A;  3N79 A;  1D9D A;  3MEG B;  3M8Z A;  5H1S V;  4YB7 A;  4ER8 A;  3C8Y A;  1X9M A;  5EX0 A;  4B3R F;  3T1H F;  4F4K A;  5JVG Q;  2W1B A;  1UEK A;  1OS5 A;  4CP5 A;  1LK7 A;  4P9S A;  2IA6 A;  1HWK A;  3BO3 A;  1PBU A;  1S49 A;  1U6Z A;  2D3O 1;  4DV0 J;  2MZ1 A;  3M2V B;  2XC9 A;  4C48 A;  1XMO F;  4ELT A;  4CH0 S;  4Q0B B;  2JVO A;  1VQ8 S;  1UJ6 A;  2WBM A;  2GMJ A;  3MEG A;  2B6A B;  6FDR A;  5GVQ A;  4FNI A;  1S1V A;  3RBE A;  1R7I A;  1NK4 A;  2J0X A;  3PM9 A;  5E2Q A;  2MTL A;  3J7Z T;  4CO1 A;  2J6T A;  3HJV A;  4ED1 A;  4ALZ A;  4I69 A;  1SC6 A;  1XR5 A;  1A6L A;  3ISZ A;  2WW8 A;  3M2V A;  4LBP A;  2ZE2 B;  4USH A;  5EUH A;  4OYO A;  2PEB A;  1KQS R;  4Q0B A;  3I5A A;  4LRF A;  4CO3 A;  2ZHA A;  3X1L B;  2B6A A;  3OW2 R;  2DBB A;  1YI2 S;  3H40 A;  3ZC4 A;  3DRR B;  4B9U A;  5J2P B;  2A6O A;  1P1L A;  1PIE A;  2PN6 A;  4YME A;  4AL7 A;  4DR6 J;  4OX8 A;  3V2U C;  2MZT A;  3GSD A;  3I6P A;  2MKY A;  1U6F A;  1E6Y B;  2XS7 A;  1BWE A;  4ENO A;  4PG4 A;  2R7T A;  5M2U A;  2ZE2 A;  2VPZ B;  3K2Y A;  2QJ3 A;  3M8R A;  4O3R A;  5HQM A;  5K20 B;  1WC1 A;  1I94 F;  5DG8 A;  3M8P B;  3DRR A;  4P10 A;  1RHK B;  5J2P A;  2G4B A;  3RBZ A;  4DXL A;  1FDN A;  4PQU B;  1WF0 A;  1HNX J;  3BH6 B;  3QID A;  3PNI A;  1FRH A;  1E6Y A;  5F3Z A;  4WXO A;  4I2P B;  1WTF A;  2ZZT A;  2NPF A;  3G6E S;  3I32 A;  2W2M P;  3HUL A;  2HVE A;  4V19 J;  1V5V A;  2FVP A;  2LEB A;  1Q79 A;  4ZA1 A;  4DPY A;  2I9S A;  3UNG C;  4OV6 A;  4OI4 A;  5KT6 A;  1H7W A;  4DFP A;  1X7V A;  5KFG A;  4NA2 A;  1XER A;  1C4A A;  4QR2 A;  2DHH A;  1XWL A;  4O3N A;  9ATC B;  3DNC A;  2FDN A;  2WB1 D;  1TKX B;  3M8P A;  3HFV A;  1CBK A;  4MKV A;  3ZTP A;  3CCE S;  3CD5 A;  3EE3 A;  4PQU A;  3KUH A;  4MT1 A;  4OHX A;  4I2P A;  1OQ6 A;  3C66 A;  3KKF A;  3KYL A;  3HZE A;  1AB8 A;  4DV4 J;  2H5I B;  3AD7 C;  3BN7 A;  4A8O A;  4LMZ A;  2EFG A;  1DLO A;  3CD6 S;  1VOM A;  4MYT A;  4RNM A;  1TKX A;  1VRU B;  4IO1 A;  4Z37 A;  3QT5 A;  1SQF A;  1OO0 B;  3IFE A;  1GNK A;  2W4C A;  1BGX T;  3CJS A;  4DR5 F;  3H8Y A;  1SKS A;  4ZJO A;  2G0J A;  2JH3 A;  4DLE A;  3MAA B;  2KTQ A;  3FK4 A;  3FQL A;  1TAQ A;  4Q7A A;  5EGY A;  3QRR A;  3CDA A;  3ET6 A;  4OHV A;  4DR2 J;  3IAS 9;  4NI2 A;  2CAJ A;  4HKQ A;  2LA6 A;  5KFY A;  4ED2 A;  5KFZ A;  2R7S A;  1GTE A;  2K3K A;  3M1V B;  1FJC A;  1Q1K A;  1KQG B;  5E5N A;  2MJN A;  3M8Y A;  3D2W A;  3AY0 A;  3WBZ A;  4UST A;  1N5S A;  4K0K J;  1WEZ A;  5ETV A;  1N32 J;  2DHG A;  2ZKU A;  4LSL B;  2QMW A;  2VKZ G;  4CO5 A;  3MAA A;  2MQL A;  1FA0 A;  5KFH A;  4DV1 F;  2AV5 A;  1P8G A;  2BYC A;  1X60 A;  3UD4 P;  4JI5 J;  3BR9 A;  2ZC4 A;  3EGN A;  1N36 J;  2HUR A;  1X4D A;  4M5J A;  4RKU C;  1NSA A;  3M1V A;  3BSN A;  2MZS A;  4NRT A;  1K0V A;  2Q66 A;  3OFE A;  2EEY A;  2CXE A;  4QIW D;  3RRG A;  4J9U E;  4H54 A;  3TRG A;  2JHE A;  5C25 B;  2A2C A;  2BM0 A;  2NS1 B;  2LEP A;  2CFX A;  2HHH J;  4OYX A;  1RWX B;  2GV1 A;  2FVR A;  1VIO A;  2Y1J A;  3U02 A;  3Q8S B;  1ZTW A;  2CG4 A;  3OR1 B;  3W8G A;  2QL7 B;  4K4Y A;  4IUF A;  1WHW A;  2YWW A;  3NY0 A;  1VC6 A;  3G6Y A;  4CNZ A;  1KON A;  5EX3 A;  3VVT A;  2ATL A;  4CNY A;  4J9V A;  4LIR A;  2KT3 A;  2HRY A;  3QPI A;  5C25 A;  4DJB A;  1BC6 A;  2JL9 A;  3R27 A;  2ZH8 A;  5DS7 A;  1KVK A;  3Q86 A;  2FQQ B;  3BN4 A;  3OR1 A;  3N5F A;  1WSR A;  2Y0B B;  4W4M A;  3KK2 B;  4J9R A;  4ZIV A;  2ZD1 B;  2HQC A;  1EAY C;  1M5P C;  1RTI A;  1TKZ B;  1DAR A;  4MKA A;  2C2K B;  1GXT A;  4WTY A;  1ZM4 A;  1TQL A;  4JUZ A;  1TEL A;  2V68 A;  4A4J A;  1ROF A;  1S79 A;  4JI6 F;  5J1E B;  2ZJP Q;  2PC6 A;  3MM8 B;  4XTT A;  2HMI A;  5IT9 U;  5E33 A;  1KC8 T;  1NK7 A;  3RW7 A;  2V8G A;  2NZ4 A;  1KR4 A;  1S10 A;  1H74 A;  5K8N A;  4P52 A;  1F5B A;  3B4D A;  3LGN A;  2ATC B;  3L3C A;  3KK2 A;  4FN5 A;  1FRI A;  2ZD1 A;  3PHE A;  3G71 S;  2VHG A;  4EMD A;  1NKC A;  1S9G A;  1YZ7 A;  1TKZ A;  4QR1 A;  4DUZ F;  3OLA A;  1QD1 A;  5AJ3 J;  4F3Q A;  4QU6 A;  3BO2 A;  3R5C A;  3PJ9 A;  5J1E A;  4ZHR A;  1W25 A;  4K5R A;  2VBX A;  3MTJ A;  4OI2 A;  2JX2 A;  4UQT A;  3CW2 C;  4U96 A;  2MZR A;  1R27 B;  2FY8 A;  3CCL S;  2DGU A;  2RRN A;  3MM6 B;  5SZT A;  2HZA A;  3V6H A;  5I3Q A;  2D3O R;  4DX8 H;  2VC1 A;  1DHM A;  4CLY A;  1F3F A;  1NK8 A;  4FYW B;  3MCM A;  3T1Y J;  2R8H A;  4J9O A;  5HL7 Q;  1VLO A;  3K5N A;  2B4O A;  1NZA A;  1P1T A;  1X4E A;  3ZTQ A;  3SXL A;  3DLJ A;  1S77 D;  2KVI A;  1NSP A;  2HWT A;  2R9L A;  3GFZ A;  3LH2 S;  3B82 A;  2UXB J;  4URQ U;  1HPZ B;  1AFI A;  5THW A;  4RX6 A;  1JLB B;  4LFA J;  3GCW P;  1RBL A;  1DQA A;  3PYD A;  2KH9 A;  4OV1 A;  2DXE A;  1T0T V;  1UP1 A;  3U7J A;  1TUV A;  3LA0 A;  1RT2 B;  2AGQ A;  2V67 A;  2WCX A;  2FHJ D;  3MM6 A;  1FES A;  2DRA A;  2LLZ A;  2ASD A;  4PCQ A;  1XMQ F;  4UUW A;  1VQK S;  2EFN A;  1SJ3 P;  3CJK B;  2HZC A;  1RKJ A;  3G8Q A;  2E9T A;  1OPI A;  4K59 A;  1R8H A;  2VIH A;  1RAA B;  2R7U A;  4EUV A;  2W8L A;  2XS2 A;  4ZVU B;  4Y2M A;  1RHR B;  5RUB A;  3Q22 A;  1OSD A;  2RD5 C;  1JLB A;  1RLD A;  2JFK A;  1RT2 A;  5D0H A;  2KT5 A;  3OXG A;  4YDX A;  2V94 A;  3WQP A;  1BE4 A;  2RSQ A;  3CJK A;  3EM1 A;  5A0Y B;  4ATN A;  2GAG C;  3I96 A;  3THV A;  1EIY B;  4KGX B;  4ES3 A;  5KT4 A;  5HN0 A;  1CUL B;  3G6X A;  3UPF A;  2NXE A;  4P71 A;  4DV5 J;  4LF7 F;  1NEE A;  2DKO B;  2CJA A;  1IJE B;  2XY6 A;  3M7V A;  2GO8 A;  1I1G A;  2MKS A;  2AKW B;  4A46 A;  2RUS A;  5DQH A;  4WFX A;  4KSE B;  5JVH Q;  3H5S A;  1VHF A;  4LF6 F;  3KLH A;  4JI0 J;  4YY3 J;  1T05 B;  2D9P A;  2W9A A;  5BYS A;  5EWF A;  4LF4 J;  3OLB A;  2C28 A;  1LOU A;  1WG4 A;  3TAN A;  3GMG A;  3IGN A;  3DOL B;  2PEH A;  2VFS A;  4DMZ A;  2VFV A;  2Z4P A;  5F8G A;  2BW2 A;  1CUL A;  2FHK A;  1ZA1 B;  4P2X A;  3CDB A;  4K4Z A;  2F8E X;  1H7X A;  4OZ3 A;  2OFG X;  2KZM A;  1VIX A;  2A0F B;  4FVC A;  4MH8 A;  3MR6 A;  3A3P B;  1T05 A;  3NGR A;  4ZPT R;  1GFW B;  2RKI B;  5CQG A;  3RB4 A;  4BS2 A;  2EFV A;  5A6W A;  2YXL A;  3VAM A;  4QJV A;  4QOT A;  2MKC A;  1URN A;  2CA9 A;  4A8Q A;  4O3S A;  1YJV A;  1S0V A;  3D6H B;  4PWU A;  3VGT A;  1IXK A;  1HHS A;  4C6A A;  2DGW A;  1G3O A;  1UVI A;  3BBB A;  5KG0 A;  2XZT B;  2CWK A;  1SUQ B;  3FBC A;  3PX0 A;  4GKK J;  4DV0 F;  2ZHO A;  1HBU B;  2Z0G A;  4DZ6 A;  2RKI A;  4O3O A;  3UO0 A;  2PGC A;  1S76 D;  2XMM A;  3MOJ B;  4WPA A;  4CDI A;  1U6B A;  2DYA A;  3HHL D;  8ATC B;  4DFJ A;  5HP1 B;  3FBB A;  1F5C A;  3C46 A;  3RR8 A;  5C2G A;  1XTZ A;  1SUQ A;  2H1Y A;  3EPI A;  1UVL A;  3LPE A;  1KQK A;  4DPX A;  3GU0 A;  2OEK A;  4L74 A;  3R1L A;  4WFZ A;  3CDU A;  1S1T A;  3QT7 A;  2J7U A;  1HBU A;  3SDE B;  2MQP A;  2M5Y A;  2YKM B;  2HS3 A;  4EBC A;  3QGG A;  4CLF A;  2UVR A;  2M2B A;  3J80 Y;  2YKQ A;  3CIZ A;  5KG1 A;  5HP1 A;  4LF2 A;  2IHR 1;  2AX1 A;  3MR5 A;  3ILI A;  4DR6 F;  2B8Q A;  2R7Q A;  3M6U A;  4XDC A;  4JV5 J;  3LP0 B;  4NLV A;  1RWN B;  5JUM A;  2KZZ A;  2DXD A;  2HGL A;  4DEZ A;  1Y11 A;  1FXD A;  1IJF B;  3MAQ A;  2QRR A;  2PA3 A;  3SDE A;  1L3S A;  4PXB A;  1JKH B;  1U2R A;  2R7O A;  4DPU A;  2GJ2 A;  5K8M A;  1FWL A;  2YKM A;  3MM5 B;  4CQ1 A;  2VDI A;  4HHU A;  3KLF B;  1X0P A;  5F8M A;  2DNH A;  3UN3 A;  3DMJ B;  2FYX A;  1TV6 B;  1AYE A;  2YNF B;  2LXI A;  2VFR A;  3H98 A;  4DQQ A;  2R7R A;  4CO0 A;  1HNX F;  3VCD A;  2V9W A;  1SL2 A;  4HYK A;  5IT0 A;  2UV8 A;  1ZAW A;  1RTH B;  3HX9 A;  4CWB A;  3W2W B;  1FJG J;  2YTC A;  3IO1 A;  2GQ2 A;  3JQJ A;  4ZCK A;  5DDQ C;  4AD6 A;  1T02 A;  1CLF A;  2QA1 A;  4P2S A;  2J0W A;  4X65 J;  3MM5 A;  1NJZ A;  1T94 A;  3ZTS A;  1HWL A;  1GXL A;  2YWF A;  3TQE A;  4F4W A;  3DMJ A;  4ZP7 A;  1TV6 A;  4NLT A;  4W98 A;  2G0I A;  1RWV B;  2YNF A;  1T9Y A;  3FEY B;  2RRB A;  3CD0 A;  4I2Q B;  4LQ9 A;  3Q89 A;  3EGW B;  4KR0 B;  2R2S A;  2CPF A;  1YHQ S;  1RTH A;  3ZFV A;  3W2W A;  3PW5 A;  3FDS A;  2LYV A;  4DV4 F;  1LEO A;  1GMW D;  3ENW A;  4A8X A;  1TR0 A;  2O3D A;  1ZA2 B;  2KG0 A;  3BKF A;  3A13 A;  2NQP A;  2L48 A;  4NCA A;  1WC6 A;  3K17 A;  1TK0 A;  1RWK B;  2VJU A;  1UET A;  3S6E A;  1LW0 B;  4QIF A;  1M90 T;  4DF8 A;  1N5Y B;  2BEF A;  5KT5 A;  1HBM B;  2F3J A;  5KFV A;  3NCQ A;  3OJU A;  4DR2 F;  3DI6 B;  2CZ9 A;  2RHQ B;  4DQP A;  4QPX A;  4MKB A;  2YNH A;  1W2B R;  2XS5 A;  1VQS A;  3VGU A;  2YWG A;  3A8I A;  5LT5 A;  3MEC B;  1C1C B;  1DQ8 A;  2XCP A;  2BAN B;  3BB5 A;  1KTQ A;  5LL6 d;  5A8W B;  2OTL S;  4K0K F;  5FLX U;  4NLP A;  5F41 A;  2E1A A;  4L76 A;  1N32 F;  2DGV A;  3Q24 A;  2C2N A;  1LW0 A;  4C0O C;  4FXV A;  4ED5 A;  4LRC A;  2CG8 A;  1HBM A;  4TU7 A;  3BQ1 A;  2DVI A;  1KTV A;  2RE1 A;  4K4W A;  3DI6 A;  3TZZ A;  4JI5 F;  4UT4 A;  3OV7 A;  1N36 F;  3ONQ A;  1VJW A;  1TP7 A;  5C42 B;  2BJE A;  3TI0 A;  2BKN A;  3MEC A;  3G6V A;  1TL1 B;  2GIF A;  1PC4 A;  1F5A A;  2F8M A;  5ETQ A;  3FGV A;  2QEX S;  2W2O P;  3K58 A;  5A8W A;  2HQ3 A;  5HMX A;  2UUW A;  3QO9 B;  5IT9 Y;  2OP5 A;  3ISN D;  3O3L A;  4C7Q A;  2K1R B;  2RU3 A;  2J0S D;  3G82 B;  1NKB A;  2HHH F;  2HHQ A;  1WHY A;  3N0V A;  2VB6 A;  1VQ9 S;  1RHQ B;  3JXO A;  5IS2 A;  3O8W A;  1RAD B;  3US5 A;  2AP6 A;  3N28 A;  3TAP A;  4F2S A;  5I4M A;  4LF1 A;  3MZI A;  1H38 A;  5C42 A;  3I5B A;  3G8T A;  3MM7 B;  1NSQ A;  4FF1 A;  2JVR A;  3OUY B;  2ACM A;  4RUA A;  1AUD A;  2W01 A;  1VQ7 S;  3QO9 A;  3MMB B;  4I0W A;  2EWH A;  1U1L A;  2K1R A;  5B0A A;  1IBM J;  2CQC A;  1NHU A;  4Q2M A;  2N4D A;  2JDJ A;  1CC8 A;  3G82 A;  4OQJ A;  4FDF A;  1FNX H;  4AQY J;  2BQ3 A;  2Y1L B;  1BMQ B;  4X2B A;  1NH8 A;  2DO0 A;  1MWZ A;  4ECZ A;  1FER A;  3HT0 A;  3MM7 A;  2CZ4 A;  2DNY A;  3EXC X;  2N7C A;  3OUY A;  1ACM B;  3NGU A;  4A8K A;  4DSK A;  4ECS A;  2DR5 A;  3SQO P;  2RT3 A;  2FJW A;  4F50 A;  2J6S A;  3MMB A;  1WUU A;  2J9C A;  4WZQ A;  1WG1 A;  2CNK B;  2GGP B;  3UWT A;  4NRU A;  4BWM A;  1CVJ A;  1PKU A;  4RUH A;  2J8S A;  3TAM B;  3FNN A;  1S7H A;  5K14 B;  1UW9 A;  3GG0 A;  4B17 A;  3PEJ A;  3DGV A;  3CD7 A;  2E1M C;  3PO4 A;  4OYW A;  1FO1 A;  2XHC A;  1UVJ A;  2G2Z A;  4OHW A;  3KLV A;  1X4C A;  2CQ1 A;  5AJ3 F;  1OY6 A;  3QIP A;  5HQL A;  4X4T A;  3NWG A;  5H9E K;  2F8H A;  3HSG A;  1CG2 A;  2B51 A;  5BYQ A;  2GGP A;  1N33 J;  2BV3 A;  3K8W A;  2BAB A;  2AYB A;  3NKY A;  1VQP S;  3TAM A;  3DRS A;  4FF4 A;  3MDF A;  4CH7 A;  5K14 A;  3HFZ B;  5J2N B;  4CO4 A;  4GO5 X;  1YWX A;  5KFC A;  1ZS6 A;  2J9E A;  4B9T A;  1K47 A;  3V4M A;  1V5I B;  3DLG A;  3JSB A;  2C2O B;  3IWX A;  3T1Y F;  5E3Q A;  3C2P A;  2NXC A;  1UWB B;  4ZP8 A;  3JSY A;  2UXB F;  4JI2 J;  1EAR A;  2SXL A;  4O44 B;  2IAJ B;  1FE0 A;  4U7C A;  1U4B A;  4K4V A;  1ZM2 A;  1VGY A;  4LFA F;  4ZVE A;  1OYD A;  4ED0 A;  2W2P P;  2FJE B;  3J81 U;  4WFA Q;  5J2N A;  2XGQ A;  2BRK A;  3G96 A;  5F9L A;  3SEO A;  3RBD A;  2YNI B;  4J9N A;  2JFD A;  3MED B;  1N5Q A;  1VBZ A;  1QVG R;  2CQ0 A;  5HSP A;  3TJA A;  3UNY A;  1JXE A;  4K4T A;  2W4P A;  3TUI C;  1R8P A;  3Q8P B;  4G1I A;  3HKW A;  4B08 A;  3CCM S;  2B7B B;  1VQN S;  3TWZ A;  4DQR A;  5IWA J;  3MPW A;  3HXM A;  3OHA A;  4O44 A;  4OZJ A;  2GAH C;  2IAJ A;  3CJR A;  2HAI A;  4P6Q A;  1U0H A;  1G7C B;  2XMK A;  3GFY A;  1D9A A;  3BJY A;  3OQ2 A;  1WDD A;  4MIB A;  3J7Z 5;  4KB7 A;  3PYE A;  2YVS A;  2GVZ A;  4OJ3 A;  3T5J A;  1SJR A;  2YNI A;  3QZ8 A;  3V81 B;  3MED A;  1TL7 B;  3MPU B;  2E5I A;  1WDT A;  4KGK A;  4BC9 A;  4ID8 A;  1KOO A;  5F3T A;  2LKZ A;  4MKY A;  2FVQ A;  3EJM A;  4DV5 F;  2NRE A;  2OIH A;  3CXC R;  2QV6 A;  1YJR A;  2VKR A;  2UVV A;  3BEG B;  4Q2L A;  1ZAV A;  4ELU A;  3NS6 A;  2E7V A;  4ANE A;  3L95 X;  2JLE A;  2BJ1 A;  2VL1 A;  3V81 A;  4JI0 F;  4YY3 F;  2LVW A;  1TL7 A;  1SPB P;  1RAH B;  4CLU A;  1JJH A;  1NJX A;  4LF4 F;  1R0B G;  1NDP A;  4DHV A;  4DG1 B;  5D0G A;  4PEO A;  2UP1 A;  2APO A;  2CPH A;  2U2F A;  1F3V A;  1PG5 B;  4R8U B;  1MN9 A;  2GNK A;  5E0O A;  3QAE A;  7FD1 A;  3BH7 B;  3K8V A;  3NL0 A;  4ZVS B;  1RA6 A;  4F2R A;  1T9V A;  2E44 A;  2LEA A;  2X51 A;  5GAE U;  4EEY A;  2E5G A;  2BE2 B;  2HRU A;  4TQR A;  4HT5 A;  3Q8U A;  1FD8 A;  1KP6 A;  4DL5 A;  1FDA A;  4PAB A;  4DG1 A;  1EHW A;  1CS4 B;  2OSQ A;  5MLC V;  2GC8 A;  2IYI A;  2W24 A;  1D8Y A;  3CC4 S;  1JXL A;  4R8U A;  5I3U B;  3F44 A;  4B3T J;  4PRF A;  1RTD B;  2IMW P;  5HAO A;  3KG4 A;  2DR7 A;  1IKX B;  4G1Q B;  4WII A;  3MMJ A;  4U8V A;  2UXD J;  3GYX B;  4RZR A;  2MLY A;  2BE2 A;  4QPT A;  4GKK F;  1SC4 B;  2PMZ D;  2HFZ A;  3M2R B;  1YJT A;  3GWC A;  4RWX A;  2H54 B;  4WU3 A;  2MKH A;  2OKQ A;  5SUH A;  4LF8 J;  5H9F K;  2V8H A;  3CJ4 A;  4OI3 A;  4MIW A;  3ZNJ 1;  3AT1 B;  4F36 A;  2XMV A;  2V69 A;  2NXJ A;  1WWH A;  3QWU A;  1WKK A;  1RTD A;  2LU1 A;  1LKZ A;  3NMR A;  2M70 A;  4G1Q A;  3LUY A;  1H98 A;  2OEJ A;  2WK4 A;  1NAQ A;  3BV8 A;  1A0O B;  1WSV A;  2XSJ B;  2AHO B;  4NLU A;  3LWL A;  1GMU A;  1WNE A;  2BA9 A;  4NXM J;  3M2R A;  3MUV P;  3IS9 B;  3KJF B;  3Q8R B;  4X84 A;  4DCJ B;  2A1B A;  1X0F A;  3VAF A;  1CEZ A;  4DS5 A;  3DDK A;  4ZS6 A;  5CCL A;  1VBX A;  2OLW A;  4RPF A;  1S5Z A;  2AEJ A;  5T7L B;  4JV5 F;  3JAM U;  3MWB A;  1WJ9 A;  4DR3 J;  2A2D A;  3BPS P;  1CSJ A;  2C1E B;  2KRR A;  3CIM A;  1F9F A;  2CPD A;  4TVA B;  1ZAX A;  1QSL A;  2RQM A;  3ZZZ A;  2UU9 J;  5AE2 A;  2XSJ A;  3K5M A;  1HBO B;  4NZ0 A;  4WFB Q;  3KK3 B;  3IS9 A;  2JWN A;  5B0C A;  4FXD A;  2QLX A;  4DV2 J;  4K4X A;  3CCJ S;  3M9O B;  2DEI A;  1RDR A;  5M2P A;  1SH3 A;  4DUT A;  1LFW A;  2QL5 B;  5T7L A;  2VPX B;  1I6J A;  2FC8 A;  4K5S A;  4LRE A;  1QUP A;  3IMQ J;  2JZ5 A;  1O0P A;  4YQW A;  2ASL A;  3WX4 A;  1FJG F;  2HFS A;  4OLO A;  3H25 A;  2B56 A;  5HJY A;  3GV8 B;  1XN9 A;  4YP3 A;  4Y0F A;  4OZN A;  5C7P A;  2P2C B;  1T95 A;  1Y7P A;  4X65 F;  2HLT A;  3SCK E;  2P6S A;  3NAH A;  4DDF A;  2MHE A;  3H90 A;  5B0G A;  1WKL A;  2XO7 A;  6AT1 B;  3SCI E;  2MQN A;  2K8G A;  5FLX Y;  1WC3 A;  1B99 A;  1B3T A;  1JLC B;  1GX6 A;  1APS A;  1TL3 B;  2HKE A;  1J5E J;  3NRB A;  2DR6 A;  5EWE A;  1VLY A;  2BOP A;  2W2Q P;  3QJL A;  1NB2 A;  3PJW A;  2WOM B;  3FEX B;  1RCX B;  2B9X A;  2YPY A;  2M4M A;  5IZH A;  2GVD B;  3I56 S;  3LGM A;  3JQK A;  1R0A B;  1X31 C;  3QSY B;  3C6U B;  2KO1 A;  4KH1 B;  5F8H A;  3QGP A;  2I1R A;  3M6W A;  3L7U A;  1IWG A;  1TL3 A;  4DX5 A;  4ZJQ A;  1YGY A;  1FTC A;  1ZBT A;  3VF0 B;  2WOM A;  4UZB A;  2KHC A;  1IQT A;  1RT6 B;  4ZPB A;  2JSX A;  4KV8 B;  1SXL A;  5GAE I;  2F4F A;  1IKW B;  2GW8 A;  3BKU A;  1JQG A;  2GVD A;  3MCN A;  4NA1 A;  2HQG A;  1CQM A;  4QZV B;  4IG0 B;  1R0A A;  2W9B B;  3AOA A;  3C6U A;  4RNO A;  5DJB A;  2GO9 A;  4ZN1 A;  3W1Y C;  5DZ7 A;  1RT4 B;  3CMA S;  1Y9O A;  1FKA F;  3EVM A;  1U1K A;  1Y3J A;  3H2L A;  2P9C A;  3BO4 A;  3VAJ A;  8RUC A;  2DIV A;  1OMS A;  2R7X A;  2KM8 B;  4ECR A;  1NDK A;  2K2P A;  4BHQ A;  4JI4 J;  1TVR A;  1RT6 A;  3GIK A;  1N34 J;  3NAI A;  3C6T B;  2RS8 A;  2OEM A;  1IKW A;  2VPY B;  1O6X A;  3V6J A;  4IG0 A;  2W9B A;  2KKH A;  1JMT A;  5ETM A;  2XMA A;  4DQS A;  1EZZ B;  3I9V 9;  1SJ1 A;  1RT4 A;  3DLB A;  2F40 A;  2IM3 A;  3CWJ A;  4PUO B;  2VC0 A;  4X4N A;  4QWA A;  2YQ1 A;  4HH1 A;  4CLL A;  4W90 B;  1NKE A;  1P6T A;  1N0U A;  3JSM A;  4DUY J;  3R9L A;  1X5P A;  2WBR A;  2YQ3 A;  2LCW A;  5G0R B;  2C3U A;  3C6T A;  4GRS A;  1N0V C;  2PE8 A;  2BDP A;  1VQY A;  3PV8 A;  1XQI A;  4ZPA A;  1R0C B;  3S7R A;  3UI3 A;  5DM6 Q;  3FEZ A;  2HWH A;  4H4M A;  1S0O A;  1B70 B;  2F4V J;  3G87 A;  3CCW A;  2XY5 A;  3JSR A;  4PUO A;  5JJB A;  1T9W A;  2HVZ A;  3WZ0 A;  1IBM F;  3EGV A;  2Z2M A;  5D0R A;  1ZOT A;  2YPZ A;  1J27 A;  2M9K A;  2BKP A;  5G0R A;  3V5R A;  2WAQ D;  2B8P A;  4AQY F;  2UZA A;  2VUG A;  3MFI A;  2LDY A;  1VHI A;  1R3N A;  1HQE B;  2HBZ B;  3P96 A;  3T3F A;  4ECU A;  4F3O A;  3LP1 B;  4OX7 A;  5DGA A;  4TY8 B;  2D1C A;  2WHO A;  4PG7 A;  3KTQ A;  3C19 A;  4YB1 P;  2N3O A;  4ZLJ A;  4DFK A;  4KC5 A;  2GQQ A;  4R0J A;  3HF5 A;  3CNQ P;  4F0H A;  2DHA A;  2O1P A;  5CH7 B;  1S1W B;  4BDP A;  2U1A A;  3GJR B;  3IWN C;  2I6W A;  3K5L A;  2BUN A;  2H4W B;  4NZ7 A;  4M1K A;  3G4S S;  4U7U D;  4DCO B;  2WVC A;  1FTR A;  1T3O A;  2QLW A;  4DPT A;  2X1G A;  4DX7 A;  1M5H A;  4CIO A;  1HQE A;  3H2V E;  2DGX A;  3BQ2 A;  1RHU B;  4XAK A;  3LP1 A;  4CLK A;  2HPU A;  4TY8 A;  1A9N B;  3NCR A;  2M52 A;  2QN6 B;  4ZK7 M;  4ITS A;  2V0N A;  5M2R A;  1SL1 A;  1S1W A;  1RAI B;  3OTD A;  5L39 A;  5F8I A;  1N33 F;  2DNP A;  3QYY A;  1IM4 A;  2Q3P A;  4I6A A;  3ENQ A;  4DL7 A;  1VQO S;  2HGM A;  3CTR A;  2DHX A;  2R4F A;  4K2J A;  1RU2 A;  3TX8 A;  4J5O A;  3CDE A;  4IFY A;  4QWC A;  3AJ2 A;  3A8J A;  1RBO B;  5FJ4 A;  2XBP A;  4WFN Q;  5E3P A;  2Y8Y A;  2X1F A;  1UVK A;  2ILY A;  4J9Q A;  2KYX A;  2BJ9 A;  3S1T A;  4ZIT A;  4QBU A;  1MG7 A;  4KY3 A;  4JI2 F;  2FHM A;  2J7W A;  1ULR A;  2ZVS A;  4RW6 B;  3J7Y U;  1Q86 T;  2HIQ A;  2LEC A;  1DBD A;  1A7G E;  2M8H A;  2MY8 A;  5HI7 A;  3TUP A;  2CPY A;  2HQI A;  1W7W A;  3UVJ B;  2VA2 A;  1S6Q A;  5G4D A;  2OPP B;  2DNZ A;  1Y10 A;  5MAO A;  2PDA A;  5HRO B;  3D1O A;  5DGB A;  3PZP A;  3FKB A;  2BXJ A;  5K8P A;  2AJ1 A;  5IV3 A;  3I0S B;  2XMT A;  1K44 A;  1H2V Z;  1BWV A;  4B9S A;  1FDD A;  5IWA F;  3JS9 A;  4JV1 A;  2O67 A;  1T3N A;  1MMN A;  3D4J A;  1N88 A;  2DCU B;  1YKW A;  1DTQ B;  4FYV B;  1RYS A;  1RP5 A;  2MKJ A;  2AW0 A;  1KOH A;  4JI7 J;  5FDL B;  3UVJ A;  4ZIW A;  4QYR A;  4IDK B;  3SCL E;  2OPP A;  3HVA A;  3MPY A;  3GIM A;  4IG3 B;  3PR4 A;  1T9T A;  5KFW A;  4FNH A;  1XMB A;  1BQX A;  2CNO B;  5HRO A;  4DV7 J;  2MQ8 A;  3GV5 B;  2QYG A;  4KO0 B;  3MR2 A;  2MLX A;  4HT7 A;  3I0S A;  2NZC A;  4OYA A;  1TL4 A;  1UZH A;  4U6P A;  2ZH2 A;  5AXM A;  3MUT P;  1DTQ A;  3UDC A;  3OXF A;  4A8Y A;  1FT8 A;  3TEH B;  2OHD A;  2ADB A;  2VOO A;  5J2M A;  4N77 A;  1HL6 A;  4JI3 J;  3FSI A;  4IG3 A;  1DTT B;  3PG9 A;  2HZV A;  3QQC D;  3HT3 A;  1ARO P;  3WC2 A;  2MYF A;  4DWI A;  4P7V A;  3AJ1 A;  2R2R A;  3PW0 A;  2J8A A;  1RT7 B;  3SZ2 A;  5J1P A;  4UF4 A;  3T9Z A;  4ILL A;  1YRU A;  4ZVR B;  3L4B C;  3KUG A;  3ZTO A;  4IH6 A;  2Z56 B;  2ZM6 J;  2OFH X;  3W63 A;  1DTT A;  2HGN A;  1FHT A;  2NSB A;  4LR8 A;  1JB0 C;  2NXN A;  3KJV B;  2EKY A;  2MST A;  4WKR A;  3NGD A;  4NEY A;  1DRZ A;  4LRD A;  3BDE A;  1P9Y A;  4ZVP B;  1B7F A;  3V4I B;  4B02 A;  1RAG B;  3T1A A;  4B3T F;  3GCX P;  4NYZ A;  4K2X A;  3G9C A;  3N5B A;  2GCF A;  3JAM Y;  4ZVG A;  2FLO A;  4HLB A;  5KFK A;  2R3V A;  2UXD F;  1FNO A;  4NLG A;  3D0I E;  4YB6 A;  3CME S;  3ZTR A;  4A8F A;  1RXO B;  2FGO A;  5L8R C;  3I55 S;  4TQS A;  4LF8 F;  3R5B A;  3CCQ S;  1HMV B;  1MLA A;  2ASY A;  3V4I A;  2NSC A;  2CQP A;  4LFB J;  1SB6 A;  1PJ7 A;  5KT3 A;  3SQG B;  2B9E A;  4PR6 A;  1SV5 B;  1WC5 A;  4EFA C;  4IYQ A;  3FFI B;  3DLE A;  1Y00 A;  4FS1 A;  1MNE A;  2V5H G;  1EKS A;  3BDP A;  2H48 B;  3GTY X;  4NYP A;  1CJT B;  3EXY A;  2B0G A;  2LFV A;  4FP9 A;  2XCA A;  5L9N A;  2D7S A;  3NNH A;  3N6N A;  4YEA A;  2CQ2 A;  4NXM F;  1PJ6 A;  2CRL A;  4OHY A;  1QSY A;  1BD6 A;  1HQ2 A;  4DU7 A;  4KHP J;  1XR7 A;  4DL2 A;  4UTG A;  3T19 A;  4F04 B;  3JQM A;  4MJK A;  1HMV A;  2AIR B;  4F4A A;  3E8O A;  1IKY B;  5LMN J;  1YTY A;  4WYL A;  3GPA A;  4C8O A;  3OTB A;  5KOX A;  1SV5 A;  2AJF E;  4RBT A;  1D1U A;  2OML A;  3HK2 A;  1VK8 A;  4GC7 A;  4XDD A;  4DR3 F;  3MAH A;  4C8M A;  3IRX A;  4JOU A;  2LXF A;  5EHH A;  3J7Y I;  1CJT A;  1J2V A;  2F1F A;  3D68 A;  2UU9 F;  3GFX A;  2C3Y A;  3TA1 A;  5KAK A;  2BJ7 A;  1JLQ B;  4IFV B;  1OWX A;  1N54 B;  1S1V B;  5B08 A;  1T8E A;  3OFF A;  3M6X A;  4DV2 F;  4X4U A;  1Z2L A;  4ETX A;  2EK6 A;  5L1L A;  1LV5 A;  1IKY A;  1VC0 A;  3TA0 A;  2ILZ A;  2B9Y A;  4L3N A;  4YB5 A;  3QT6 A;  1CJU B;  1LK5 A;  2DRB A;  3MUM P;  1MN7 A;  2XZW A;  1KRP A;  4KKO A;  1FKO B;  1O51 A;  3P5T L;  2CJX B;  1LXN A;  3CJ8 A;  3UW1 A;  1JLQ A;  1HW8 A;  1UVN A;  4IFV A;  5B0B A;  3HI9 A;  4ZLP A;  2GZO A;  1IUJ A;  4YR3 A;  4CM2 A;  3FMB A;  5HMW A;  4QYZ K;  1AFJ A;  1JJ2 R;  1VQ5 S;  4Z2X A;  3EVW A;  2I38 A;  4F4Z A;  2K06 A;  2F9D A;  2YQ0 A;  1R8B A;  1CJU A;  4WFY A;  1V3S A;  1UEU A;  2CIM A;  2WSC C;  3M32 B;  4I7F B;  1J5E F;  4HI1 A;  2OSR A;  4KE5 A;  1Q4R A;  2LQB A;  1FKO A;  2DTJ A;  5KG6 A;  3U1N A;  3PIP Q;  2YWK A;  3A8K A;  2EFP A;  3W60 A;  5KG7 A;  4KH0 B;  1DJ0 A;  4IRK A;  1M5O C;  3PFE A;  3U1L A;  3M2U B;  2IVY A;  3LF0 A;  1YBA A;  1IR2 A;  5I3P A;  4OYM A;  2XSF A;  2QYC A;  2FLL A;  2C3M A;  2ZBC A;  1RWP B;  3M32 A;  4I7F A;  3M30 B;  2V8P A;  2ZOF A;  4K7Q A;  5CA5 A;  3BSO A;  1M0S A;  1MU2 B;  4NYO A;  1IBL J;  1HYS B;  2ZVI A;  2C2M B;  4QIG A;  3OVS A;  2W4D A;  1VYA A;  1FRL A;  3DOM A;  4HTJ A;  4LF9 J;  2Y0S D;  3EGZ A;  3RU0 A;  2VD3 A;  5GAD I;  3HO1 A;  4KRW A;  3M2U A;  1HWJ A;  3DM2 B;  3SSR A;  4RW7 B;  2DB1 A;  3O2I A;  3CED A;  3HHE A;  1Y4Z B;  2QG9 B;  1Y0H A;  2MQQ A;  2MEW A;  3M30 A;  2C3O A;  4FKY A;  5GME A;  4LVO P;  4RBU A;  2J9D A;  3N4W A;  2HVI A;  4JI4 F;  4I6Y A;  1MU2 A;  4ZCM A;  2FVS A;  1HYS A;  1N34 F;  1NRK A;  1DLO B;  2ZH1 A;  2NYH A;  1NDC A;  1D8Z A;  2ZDP A;  1QLN A;  2RDJ A;  4J9L A;  1B0V A;  1Q95 G;  4U7U K;  2ZUA A;  1HWI A;  5CCM A;  3TR5 A; 
#chains in the Genus database with same CATH homology
 4DR3 J;  2VQF J;  1HNW J;  1XMQ J;  2HHH J;  3W1Y C;  4DR2 J;  4X62 J;  5IWA J;  4DUZ J;  4JI8 J;  5IT9 U;  2UUA J;  1J5E J;  2UU9 J;  4AQY J;  4PWW A;  1N33 J;  4LF6 J;  2VQE J;  4KHP J;  1I94 J;  2UXB J;  4DV1 J;  4DR6 J;  5A2Q U;  1IBL J;  2F4V J;  4LF8 J;  4LF5 J;  4NXN J;  2UUC J;  2KVQ E;  5LMN J;  4LFA J;  4X66 J;  4DV0 J;  1FJG J;  4JI3 J;  4DV2 J;  4JI4 J;  4DV5 J;  5BR8 J;  4K0K J;  4LF9 J;  3R2D J;  1N34 J;  5LM7 E;  4DV6 J;  2E5L J;  1IBK J;  1N32 J;  4RJV A;  4OX9 J;  4DR5 J;  4X65 J;  3J80 U;  3OTO J;  4DV4 J;  2UXC J;  5AJ3 J;  4GKJ J;  4B3R J;  4JI0 J;  3IMQ J;  4YY3 J;  4JI2 J;  4JV5 J;  4DR7 J;  3T1H J;  2MEW A;  2MTL A;  1HR0 J;  4JYA J;  4JI5 J;  4NEZ A;  4LF4 J;  4JI6 J;  4NXM J;  4GKK J;  1N36 J;  1HNZ J;  4JI7 J;  5LMU J;  2UUB J;  4X64 J;  4LFB J;  3D3B J;  3J81 U;  4DR4 J;  1HNX J;  5FLX U;  1XNR J;  4YHH J;  4LFC J;  4DR1 J;  1XNQ J;  4B3T J;  3J7A N;  4V1A k;  4KYZ A;  2ZM6 J;  4DV7 J;  2MQ8 A;  4DUY J;  4DV3 J;  3D3C J;  1IBM J;  3R2C J;  2KL8 A;  4LF7 J;  4HHU A;  1XMO J;  4KY3 A;  2UXD J;  4B3S J;  4NEY A;  3JAM U;  4B3M J;  3T1Y J;  4JI1 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...