1EQ0A

Solution structure of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with mgamppcp
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
158
structure length
158
Chain Sequence
b'TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-HYDROXYMETHYL-7,8-DIHYDROPTERIN PYROPHOSPHOKINASE
publication title Unusual conformational changes in 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase as revealed by X-ray crystallography and NMR.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 20
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2000-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1eq0A00
1RU1A 3HD2A 3ILOA 3MCMA 1F9HA 1IM6A 3HD1A 3HT0A 5ETNA 5ETMA 4M5NA 1RB0A 5ETVA 3KUEA 5ETLA 3KUHA 1RTZA 1G4CA 2F63A 3HSDA 3KUGA 1RAOA 1TMMA 2QX0A 3MCOA 1HKAA 4M5LA 4M5MA 5ETTA 5ETPA 5ETQA 4CWBA 4F7VA 4CRJA 2CG8A 3ILJA 1EQMA 1EX8A 1HQ2A 4M5HA 3HSGA 3ILIA 4M5KA 4PZVA 4AD6A 5ETSA 5ETOA 1DY3A 4M5JA 4CYUA 1RU2A 2F65A 3HSZA 4M5GA 3UDEA 3ILLA 4CYUB 1EQ0A 2BMBA 1TMJA 3HSJA 1Q0NA 3QBCA 4M5IA 3UDVA 3UD5A 5ETKA 3MCNA 5ETRA 3HCXA 1KBRA 3IP0A 1CBKA
chains in the Genus database with same CATH superfamily
1WF0A 1VBKA 1KEKA 4LSLA 2NQPA 2C2ZB 2EFQA 2IVYA 3MDFA 3OJSA 1TELA 4DG1A 3LTOA 3FBCA 3M8ZA 3MOZA 1FD2A 1RCOB 2Y0SD 3TA2A 1UVNA 4OZLA 1YJRA 4Q45A 2VA2A 4DX6A 1TK8A 3TX8A 5ETQA 4CP5A 3OVSA 1RI7A 3DRYA 3OSPA 3N0VA 1REVA 3SCIE 4ZJOA 4NCGA 2HS3A 2B0GA 3M7VA 3QGPA 1AUDA 1S6UA 1BQNA 1T02A 4K4SA 4F25A 1RT6B 3GSIA 2QFJA 4DF8A 1RAIB 3IFEA 2E9TA 3SZ2A 1QY7A 1SH0A 3CCUS 1HI1A 4RU2A 5RUBA 3IBWA 4ZA1A 1PYOB 1B7FA 4QWEA 3D6MB 2M5YA 4URGA 2R7OA 1Z1ZA 2YWFA 1SL0A 1S10A 2DH9A 2BV3A 1HD0A 5IM0A 3I0RB 1VQSA 3AY0A 2ZM6J 1N5VA 4JYAF 1ACMB 2VFTA 3QIDA 3R5DA 2LQBA 3GG1A 4FS1A 3ZZZA 2YKOA 1IKYB 1WTBA 2BRLA 2JDJA 3F44A 2YNIB 2ZBCA 2NZCA 2FZCB 1HBMA 2E7XA 2CQ4A 4FYDA 1SJRA 5F8MA 1RT7A 3QQCD 4IQMA 3TAQA 2RU3A 4DR6J 3NRBA 1GEHA 4QZVB 3FRZA 1NJYA 4K4XA 3CJ0A 2GVDB 3I31A 1S0VA 4HKQA 1WF2A 4LVOP 1KRPA 3AJ1A 3OR1B 4JI5J 3LGHA 3QGHA 2POKA 3W5ZA 5JJBA 1GMUA 4JV1A 4EO6A 2DIUA 2UUCF 2C42A 3K17A 3FZ2A 1S1WA 2KM8C 5J2QB 4O3SA 2WVDA 2KXFA 3AAWB 4S0MA 2C2RA 2HNYA 4KY3A 2DR9A 2YNHB 4W98A 3HSZA 1U47A 3LGMA 5F8NA 4ZHRB 2CNKB 4IFVB 4F3QA 3GFZA 5DQHA 4OJ3A 1SJ1A 1VRTB 3NGSA 2HRYA 1SV5A 1YJ7A 2CVEA 4ID5A 2VB6A 2YWKA 3MWBA 3GFYA 3PNIA 1NJIT 1PG5B 4Q0BA 1YBAA 2GIQA 3W60A 2W2PP 3FEXB 5KFBA 4WK1A 4FF3A 2IBOA 3V6DB 2J0WA 1XN9A 4WE1B 3C8YA 2OD6A 2UUWA 3CC7S 1VQMS 2CNLB 1N36J 2RF2A 3C14A 2VODA 4F0KA 2DRBA 2J8SA 2G0JA 4JI1F 4YP3A 1RKIA 2AJ1A 4M5DA 2OP5A 8ATCB 4KFBA 2U2FA 2ZOFA 3M8SA 5BR8J 2E5JA 2NSBA 3H98A 3VCDA 4Q2LA 1L3VA 1I51B 3CD5A 2HQCA 3IWXA 1Q16B 3SEOA 4C3KA 4QIWD 1JLEB 2B56A 2OPSB 2E1RA 2NREA 2ZUGA 4DV1F 4QW9A 4JI3F 3B6BA 4N77A 1YDLA 4RW8A 3H20A 2RQ4A 1C4AA 1UWAA 2KU7A 3MM5B 4LQ3A 3OT9A 4LREA 4FS2A 4O44A 1S9EA 4ELUA 1HWIA 2YPZA 4K4WA 2DVIA 3A8IA 1HYSB 1B4SA 2RH3A 1DAXA 1TL3A 4NLUA 4L3NA 4ER8A 2HZVA 2Z58B 2DGOA 4C9DA 4OYXA 2W9BB 4BBYA 3KJVB 1F2GA 3R5AA 4YMEA 3W5XA 4ZPTR 3O44A 3PFOA 2YKNA 1P27B 4RW6A 2OUGA 2W4CA 2WVFA 4MMOA 4F3OA 2GAGC 2HHSA 1HQUB 3UN2A 3TUIC 1XNQF 3KHLA 2NYIA 4ZOSA 3EGNA 5DZ6A 2W4PA 2W1BA 4IRKA 1N33F 5KFCA 1ELOA 4N8OA 1RSCA 5IOLA 4NX9A 3CO0P 5I42A 2IRUA 1S12A 4WFAQ 2DXFA 5KFPA 2BQRA 1U6BA 3B78A 4RPFA 4WK3A 5JMNA 1GTEA 4OJGA 5HVFA 4J5OA 2NXEA 2I1RA 1RZMA 5DM7Q 1T9UA 1KHWA 4J9UE 2UVWA 4RX6A 2ZBPA 3D6FB 1VBYA 3ZZUA 3MR6A 3BBBA 1TL5A 2OELA 4DPWA 4PG8A 6FD1A 3TW0A 2XO6A 5ETOA 3SSRA 2VJUA 3Q2SC 3R6GB 4A8FA 4MKBA 3SYZA 1CEZA 1SKSA 1RWXB 2RIJA 3SDEA 4K4TA 2ADCA 4FF1A 1TK0A 2PEBA 3TEGA 2ZNYA 1UEUA 2UUBF 2XS7A 2VG6A 3X1LB 2HHTA 5BXIA 1S6QA 1T8EA 1VQ7S 5L39A 2ZE2A 4F7VA 4ED3A 1AFJA 2ADBA 2HS4A 4A46A 3GV8B 3UD5A 4LR8A 5KOWA 2CPYA 1VIOA 1W26A 2E44A 4DR2F 1T9VA 1XMBA 4RNFA 4CO3A 3IM8A 4GO7X 2JZ5A 1KS2A 2OIHA 3V4IA 4WFYA 2VUGA 1YZ7A 4IFYA 4B3RJ 1UPPA 2KFZA 3TRGA 1TK5A 4DV7F 2K2PA 3FZBA 4M95A 2ZFHA 1OYDA 2V2ZA 4F4YA 4ZCKA 2VD3A 1F3VA 1NAQA 2HBRB 2P5VA 5KFZA 3PYFA 3ZC4A 1ZZNA 2EG1A 1CPZA 5J2QA 2FVCA 2QMUB 1VK3A 2V6AA 1J5EJ 5IWAJ 1RTIB 3IGVA 1HR0J 4C97A 1SUQB 4KV8A 4ICLA 3ZO7A 3T5JA 3PKYA 2XI2A 2WW8A 1HNXF 2D41A 1VK8A 9ATCB 3GIKA 4B3OA 5HL7Q 4YDDB 4PXBA 3DHWC 2IJFA 1UVMA 3CE8A 4Y2KA 4LF5J 4TKTA 1VRTA 1FX4A 4DV6F 4ECUA 3HSDA 5HQMA 3HHLA 1TMMA 4DUZF 1Q78A 4LSNB 2RJZA 4B9LA 5G0RB 3KLEA 4ENOA 3B82A 1LWFB 2IPOB 2V5HG 2KRRA 2QL7B 3ENAA 5H1SV 4DFKA 5D8HB 2LKZA 3RR7A 2DO0A 3TZYA 1HNZF 1JK9B 3CJQA 3C3LA 2FHOB 3RAXA 3FSXA 3GONA 2ZOMA 3HCXA 4DR5F 4TLQA 2MLYA 1P6TA 5F8LA 4PYDA 2V2VA 4NEZA 1AYEA 4FKXA 3HP6A 2UVRA 1S7IA 2ZWPA 3AH6A 1R8AA 3G8SA 4CZCA 5D0RA 2UZAA 4O3RA 2Y8WA 2ZZNA 2HQFA 4OI0A 5HMWA 2PI4A 2HVZA 2KM8B 5IV4A 4G1QB 1GFWB 3HM9A 2UXBJ 1AROP 2VG5B 4OZ2A 3IG1A 4AE5A 4M94A 3R5CA 2V9WA 4QBUA 2RILA 1KQSR 3EGZA 4O23A 3QPIA 2RHSB 3OV7A 3M2VA 4Y0FA 1R43A 1IN0A 3Q89A 2XBPA 4C8YA 3D3CJ 2R7TA 2ZWOA 1XMOJ 2IRXA 4DXLA 1BD6A 2A6MA 1MROB 5A6PA 2HIYA 3HFKA 3HULA 3LUYA 1WSRA 5LMUF 3ISNC 1X5PA 2YX1A 1Z2ZA 3H8YA 2JVOA 1TTHB 3ZTRA 4MYTA 4ECWA 2BKOA 2I9SA 4XTTA 2CADA 2DR6A 4MH8A 4HVZA 4K2JA 3L95X 3MCOA 4QIVA 1MMLA 4B08A 3OLAA 2LA4A 1FK9B 4UY85 4B3TJ 1V5VA 5KFUA 5KAKA 1GX5A 4I2QB 3EVMA 3CCES 1E6YB 1XEZA 1VQ9S 3L7PA 3NMRA 1BWVA 3TVKA 3EMTA 1NSKL 5KFXA 2J8AA 3GG0A 5BYRA 5T7LA 2DHXA 1RT4B 5A8KA 1H2UX 3V4MA 3CTRA 2VBWA 5KFWA 4DX7A 3M8PB 3VZHA 4M5MA 1I5OB 2JLEA 2OEJA 2ZH8A 2ZM6F 2W8KA 1V5IB 1QAIA 1RWKB 4M5NA 1VJQA 2BM0A 4OL8A 4TXSA 3PACA 3KUGA 4BWJA 2BJ3A 1FE0A 4OLPA 3C66A 4U7UD 1N0VC 4DN9A 2ZOGA 2JL9A 3MUMP 1BE4A 2OH2A 4J9OA 2OFGX 2CJXB 1JLGA 4ZCMA 1U02A 5MAOA 1JJ4A 4DR6F 2NUUG 4Y2CA 5HQ8A 4ZJQA 5D4PA 3IRWP 1WKJA 3MI7X 4JP8A 3GYXB 4C11A 4OQJA 2H3EB 2U1AA 1ZM2A 1DURA 3D66A 3CSKA 4RNMA 3KUEA 3M8QB 4ECVA 1FX2A 2X1GA 1WOPA 5HAOA 1X4GA 2OPPA 2RS8A 3FFIA 3I87A 2DNHA 5HROB 3BQ0A 3GIRA 5DG7A 1TKDA 1DQ8A 2FHJA 4PWDB 3TA0A 1KQKA 2ZBQA 3DI6B 3SQGB 3NCRA 1SC4B 1XBWA 4X4VA 3CDBA 2E9ZA 1W2BR 4Y00A 1QD1A 2UP1A 1BLUA 1RXOB 5ETTA 2HFOA 4N8NA 1H98A 1WDTA 1HNVA 3UD3P 4EWTA 5DDRC 1DHMA 4TQSA 4YQWA 4CH7A 5G0RA 3ADAC 3KLHA 3OXFA 3SBMA 1LWFA 4USTA 3DLJA 4NE9C 1JKHA 2EK1A 1N36F 2ROEA 2QL5B 3FUYA 4DI6A 2B9YA 5LL6d 1N5YB 1RTZA 3H2VE 3LAKA 2Y1JA 3KJQB 2IVFB 2C22A 3MEGB 1QM9A 2GHPA 2XYGB 5BR8F 4PQUB 1OY6A 4O0NA 3MAAB 3N9UC 2WHOA 4Z7YA 4X64J 3FNNA 2CQGA 3TZWA 4MIWA 2LU1A 4QR2A 4O0IA 4PWUA 3ETMA 4L76A 5E5NA 1ZTTA 3I32A 4M63A 2FB0A 2V4RA 3IR5B 5DG9A 2IBKA 1PBUA 2KTQA 3IGNA 1SH3A 4F0MA 2MQQA 3DDKA 2F4VJ 2BW7A 1REGX 1JQGA 3V6HA 3RRGA 1IKXB 2P2CB 1ZAWA 2HURA 3ET6B 3ZZRA 1U1RA 1TKZB 4NI2B 4HI1A 4NLVA 1JB0C 5K14A 1NO8A 3GU0A 4A8OA 1FEEA 1LK5A 4ZVOB 3P6YC 4AL6A 4CTAB 2I8EA 4U8YA 3D2WA 1V6HA 1H7XA 4ZP6A 2EBEA 1S0MA 2DTJA 2C28A 8RUCA 4WJBA 4X62J 2KO1A 1S9GB 2JRSA 4Z37A 2VFRA 1SCJB 4PXCA 5CXTA 1HQ2A 1U26A 3BGRB 2HHWA 5D4OA 1VFJA 2ZHOA 1JLFB 2XMVA 1FE4A 5KFEA 4X4UA 2R7SA 2EC0A 2JEIA 3P5TL 4UOFA 3JTOA 1KQGB 5FLXU 2L9NA 2H4YB 1FWPA 1RU2A 4N41A 1Q81T 1PO6A 3UD4P 3AT1B 1IBKJ 1U1QA 1JXEA 3F56A 2B4PA 4BHQA 4CLZA 1NDPA 4NASA 2QMWA 2Y3YA 1FXLA 2CPJA 3JB9k 1DLOA 3NGTA 2UXDJ 2QMXA 3CULA 4J9SA 1RTHA 3BPDA 4DEZA 4EK2A 1FDBA 2YH1A 4H4KA 2KHDA 1KTVA 4ZKAA 1N6QA 1GXLA 5LSLA 2DYAA 2AGQA 1VLOA 2CNOB 1FFWB 3LO3A 3PM9A 3UR3C 1X4CA 3N28A 4FYXB 2HRTA 1NRKA 2HFSA 2JC0A 3CO9A 3RBZA 2HGNA 4DOZA 4FBTA 1PKUA 2V9KA 2XMMA 2FJWA 2BJ1A 1RKJA 1T9XA 1U2FA 2CPHA 1HBNB 2D3UA 5CYQA 5IT9Y 2DNLA 5GAGI 4B3RF 1XK8A 3NBPB 1FERA 4TY8B 1CS4A 3M8QA 1CJVB 1HL6A 4DX8H 2JLFA 1PGZA 3DGPB 3VGTA 1VDHA 4NA3A 5GMDA 2DR7A 4ES1A 3LP1B 2VHGA 2FJDB 2I5JA 3RB4A 1HWLA 3D0HE 4FKYA 1N52B 2MJNA 4ED0A 4I56A 3UDCA 1J5EF 5DLFA 1PILA 5IWAF 1HR0F 1CULB 2XLJA 2X1FA 1R89A 3ZZ0A 3IRXB 1C0UA 4LF5F 3DHXA 1MU2B 3FBFA 1QSSA 2EEYA 2B5JA 3MMAB 2BJ9A 3DYAB 3T9ZA 1NSPA 3GQCA 1H38A 1IKWA 2UXCJ 2Y9HA 4PPDA 1VR6A 5THWA 3RAMA 2DPIA 3VAIA 4A8SA 3MPWA 5M2PA 1OO0B 4LR7A 4X4PA 4LRCA 3T1AA 4KO0A 3OLBA 4YB7A 3D1HA 2DJWA 3PHEA 1RP5A 4FPIA 4P72A 1X5TA 3FCWA 2DGVA 2LEAA 2YWHA 2QFIA 3QZ8A 1HI0P 2YY3A 2WOMB 4GVLA 5E3CA 4JI4J 4QJVA 1B0VA 1Q7LB 5C42B 4NEYA 2V8VA 1S6PA 1SJ3P 3A8EA 2HQIA 1WC1A 2RDIA 1TU0B 3KG4A 2IAJA 5KFYA 1L3UA 2EFVA 4U7UK 2LCWA 1P1LA 3S01A 3AB4B 1IKXA 1LV5A 1TFWA 3MEEA 1NK4A 2QA4S 1CQMA 5L1LA 1GX6A 1XMOF 3C6TB 3ET6A 3OUYB 2C2DA 1K9MT 2Z57B 2KZZA 3I6PA 1JLBA 2V4QA 4E2FB 1NKEA 1R8CA 3G86A 4RW7A 4QW8A 2HFUA 5J2NB 5HJXA 3D28A 2WONA 3C19A 4BC7A 3OTCA 3GR1A 4MK9A 3FEYB 1HNIA 1N32F 2RVJA 5A0YA 1YJVA 1SJ4P 4A8QA 1CQNA 4LRDA 1EP4B 2QN6B 4NPOA 1LWEB 5C2CA 1LKZA 4NYZA 2OI2A 2UUAJ 1S4FA 2D3ZA 3CMES 2ZITA 3VAHA 2ALZA 1NNDA 2QRRA 1RQ0A 3E01B 3IAM9 2MSTA 2LDIA 3T5HA 4EZ6A 2F9DA 4ZLPA 4DS4A 2H9ZA 3MMCA 4M8LA 5LSRA 1AZSB 2G1HA 3U1MA 1Q5VA 3IXQA 2PGCA 4ZMMA 2DNQA 3K89A 2PMWA 5KFJA 3U1NA 3T9NA 3TARA 1R0CB 3C16A 5LM7E 4CYUB 1YJ9S 2DO4A 1Y3JA 5AXKA 3US5A 1RT1B 4IRDA 1QDUB 2VPXB 3NP5A 3KLIB 2AJ4A 3DLKB 2BE2A 1GQEA 4RNNA 5DQIA 9RUBA 3FCVA 2R7QA 2ZVIA 4ANEA 3PJ9A 5EX0A 2HLTA 1CVJA 3LAMA 5KFHA 2ZKTA 4RUBA 2E5GA 3QT6A 4NXMJ 4I6AA 3OHAA 2PD1A 3DRPB 2VC1A 1Q79A 1FJ7A 5C24A 5CCMA 4ED2A 3H7HB 5AXLA 1W2IA 3PV8A 3NS7B 3HZEA 2H1YA 2CQIA 4TY8A 2IM0A 2NCKL 2ZEJA 1M90T 2UVVA 1OIAA 3JQKA 4DR4J 1U1MA 2JSXA 3JQMA 3LP1A 5B08A 1WG1A 4ED8A 4CCHA 2VBYA 5J2PB 1K1SA 4USMA 3LF0A 2L9WA 4DDFA 2K1RB 1LNQA 3H4DA 1HW8A 3BBFA 2IJNA 3K5OA 2DEJA 5CHCB 3MECA 3E2EA 1ZS6A 1VHFA 3SSSA 4NLOA 3HHKA 4TYBA 1VQKS 5KG3A 3NAHA 1TZ0A 1YI2S 3DYAA 2YNGA 2FD2A 4I4BA 2R7WA 2FVPA 4EBEA 4NLSA 3CJKB 2J0SD 5D3GA 1VQNS 3N4WA 3HPOA 4OZ3A 3P8BB 3M6WA 3N79A 2BOPA 2A0FB 4IQXA 5LXYA 1VJWA 2C1EB 4OZ5A 1FJGJ 4LFBJ 4QYRA 3M2RB 1RYRA 4OMFG 3VHQA 3QFHA 3WBZA 4KIAA 3G82A 3OPKA 1DTQA 4CWBA 3MAHA 2XNRA 1TV6A 3NCPA 2C3PA 1RBOB 2CDRB 3O8WA 3LWMA 2WOMA 4P2SA 2W25A 1E6VB 1R27B 4ALZA 3DRSA 1TL4A 5C42A 4KB7A 2V8PA 1D9FA 1O6XA 1JLCB 2D3O1 4L75A 1MN7A 2F4VF 1EKRA 2E5LJ 3CWJA 4B9NA 5K8MA 2YBVA 4ATNA 4LRFA 2WSEC 1S1TA 3KG0A 3W3SA 3UCZP 1HPZB 3C6TA 4WP9A 1HWJA 4KRWA 4FPRA 3LP0B 1HARA 2MYFA 3GCXP 4N47A 3PXGa 4CLUA 2HFVA 2GVZB 1YVFA 5BYQA 4X62F 2XI3A 3POTA 2JOQA 3THPA 2VBZA 1QLNA 2M0GB 1R3NA 5F41A 3BH6B 2MY7A 4CDIA 3NY0A 3NWGA 4LMZA 4G65A 4ITSA 2VONA 2PT0A 2HIQA 2V34A 2OMOA 2R8KA 2WBMA 4DPXA 3MM7A 2YWGA 4OIXA 2YNFA 3T6BA 2GGPB 3E01A 2ZC3A 1NB7A 2CIMA 2VG7B 1IBKF 1SC6A 1F0XA 1ZM3A 3MMBB 1RACB 4A8MP 2AGOA 4JI6J 1RHUB 1S0NA 1HQEB 3QO9A 1U8WA 4NLXA 2QE5A 3TR5A 2QA2A 4IH5A 2UXDF 2B7CB 4ZVGA 1K8AT 3SXLA 3SV3A 3BO2A 5D0EA 2W4DA 4ZLJA 3OD2A 2BABA 2N82B 1JLQB 1RYSA 5CA5A 2G0CA 1HW9A 4FVMA 3ETOA 2H5IB 1QUPA 3VR1A 2MGZB 5LJ5Y 5GMEA 2E1CA 4P2MA 4F50A 2D1CA 2QSFA 4QWCA 2KFNA 1VYAA 4M5IA 1Y0HA 4ZPCA 4CLTA 4ZITA 2XWYA 4K0KF 1KNZA 2XY5A 1LW2B 2CPIA 2ZUAA 2QEXS 3UE2A 4JV5F 4Y2AA 4CH1A 3PW7A 2CQBA 2MY8A 1PAEX 4DV3F 4LRAA 1HWKA 3V6KA 5DO2A 2GO8A 4RJVA 1F2HA 1ZBTA 3K8WA 1U25A 2EKYA 4DPTA 2BE9B 1P9YA 1H72C 3Q0AA 4Q5VA 3F73A 1VC5A 1KWMA 1TAQA 4RL1A 4UOCA 2RQCA 4WIQA 3A3OB 2J5AA 4WU3A 5LMNF 1BQMB 1Q95G 4KE5A 4B3MJ 4ZJLA 2A2DA 2XMJA 4Z2XA 2QLFB 4X4TA 3HX9A 4WPAA 3Q83A 2PO4A 5IZHA 2K1RA 1KVIA 3RGIA 3W2WB 2GAHC 2BR0A 4YB6A 3P49B 2HMIA 3KKFA 2BXJA 2OO4A 2XCPA 2PA8D 2R7RA 3ZXWA 3ENQA 3M1VB 2Z2MA 5KFGA 4TLRA 2LXFA 3CMAS 3I5AA 4A8XA 1EKSA 2FY1A 2BJDA 4YB1P 2CQ2A 2NS1B 5D78A 3CJKA 2VBXA 1ZPVA 2F9JA 4DCJB 2F4FA 3MEDA 4CH0S 1Y7PA 4ILRA 4BDPA 2QYGA 3M2RA 3AA8A 1R8PA 4DLGA 4OJ1A 4UOGA 5H9FK 1SB6A 3P5BP 4JI4F 3PJXA 3M32B 1IQZA 3GJRB 2ZJPQ 4EI2A 4B9SA 1H73A 2EFNA 1WHYA 2W8LA 2AP6A 1PJ6A 1MMNA 3GV5B 3OHBA 1TMJA 2JH3A 4IO1A 1RE1B 4KPCA 4XO0A 3DRRB 1GAOA 2MPUA 2CPDA 4A8KA 1M5VC 2CRLA 1L3SA 1MWQA 3SV4A 2IIHA 4BWMA 1V3SA 2MKJA 2HEKA 2CJKA 1RAGB 2GJ2A 4FDFA 2GQQA 3I4HX 2E5HA 1KHVA 4CLPA 3ZFVA 4B3SF 1PC5A 3DOLB 1JIHA 4WXWA 2UUTA 3OL6A 4NMLA 4EEYA 3ONQA 1DRZA 2NPIA 4IDKA 5T41A 2H5EA 4LF4J 4URSA 1AA1B 2GVZA 3DCAA 4DQIA 4PG6A 3W9IA 3KXDA 1MWYA 4JB8B 2KFYA 3D68A 2B6AB 2OEMA 5KT7A 1CJKB 4K8RA 1FCAA 2UUAF 2LYVA 2YXLA 1VRQC 2QA1A 3LWLA 2FJVA 3CUNA 3MCNA 3M2UA 4KJIA 4CLWA 2HNDB 3HK2A 4GKJF 4MKAA 4KBIA 3M8RA 3CW2C 3M9MB 1ZA2B 4AYBD 1FFGB 2F40A 1IKVB 5HMZA 3CT9A 2EXUA 3DXSX 3IMQJ 3JYTA 2DT9A 1ZTWA 4DQSA 1GMWD 3R9LA 1EETA 2O67A 2N3OA 2XMAA 4UT4A 3BB5A 3KYLA 1BY9A 1RLDA 4PUOA 3NNAA 3W1YC 3W66A 2DGSA 3BDPA 1Q4RA 1WC6A 3MHYA 3MMJA 2BDPA 1URRA 1FRXA 4PCQA 4KH0B 2AYEA 2J7WA 3CJ4A 2HS0A 4C98A 2V8GA 1EQMA 2YKMA 1JLQA 3G8QA 1T03A 1T9YA 1WHWA 2AX0A 2ATLA 1T9TA 4DX5A 1NBEB 4WFBQ 5I3PA 2PC6A 3N6LA 1HMVA 3SCLE 4AQYJ 1XR5A 4LSLB 3MAQA 4EZ9A 5DRKA 3CJSA 1RAOA 2YWWA 3A1YG 3GIJA 2EPIA 4LR9A 1AXQA 2W2OP 3TWZA 4DG1B 3J81j 4YUDA 3K57A 1N54B 3OTDA 3U27A 3UPFA 2B3TB 2Z30B 1MMDA 1S0OA 2PI5A 1FVSA 4G1PA 5D0HA 1P8GA 4K4UA 4PR6A 2YPYA 2LQ5A 1FESA 4ZVEA 4DV2F 3PFEA 1REVB 1FDAA 3TAMA 2D3OR 1C0TA 3A8JA 3TP2A 2GHVC 3MCSA 4NCGB 3MM9B 8AT1B 4J9PA 2NXUA 1BQNB 2OPQA 4C8LA 4YHHJ 4KQZA 3PR4A 1NHUA 5B0BA 3KLFB 5C25B 2G9OA 4I1TA 3HJFA 2ZNZA 4NYPA 1U4BA 2HPUA 1DQAA 3CJ3A 3TQ1A 2GC8A 3SFUA 1S72S 3BKUA 1Y5NB 2J0QD 5IM0B 1WELA 3THTA 5CYJA 4ECSA 3FGVA 3AD9C 3VQTA 1VC0A 3HHLC 3HD1A 3EM1A 4UF4A 2YTCA 3K5LA 2CVIA 3KHHA 2FQQB 1IBLJ 1N56A 2WCXA 1FRMA 2XZWA 4DF4A 1UJ5A 3Q8YA 2W2QP 4ETZA 2J7KA 4HDHA 1EQ0A 1HBMB 1KLNA 3K58A 1RT7B 3RBEA 2B51A 2VC0A 4ECTA 2EVZA 2MHEA 1Q8KA 1L5UA 2XGQA 5ADZA 4LFBF 4DSFA 4X84A 2G2OA 3WIVA 3PW5A 3H5UA 3DOMB 3PYEA 4BLGA 2LQ9A 5M2UA 3TYTA 5KFDA 1RA7A 2AZ1A 1NHKL 1N34J 2BQUA 4X2BA 4OI3A 2WVCA 3CD6S 2DGWA 2HBYB 1S1WB 2MKYA 2Y1RI 5B0DA 2C2EA 1KN6A 4DZ6A 3GIMA 1JNRB 4K4ZA 2MQNA 2HNYB 1TL1A 2GV1A 2RDDA 4ERDA 4OYPA 2E5LF 3M05A 4EBCA 4EYHB 2MKCA 1OY8A 2CJBA 1YLXA 3P4UB 4H54A 1Z2LA 1S59A 3DRRA 4P73A 5C5JA 2ABYA 2IRYA 1NJXA 1SV5B 3E3XA 4ID5B 4B9TA 4PZVA 5L46A 4O3PA 2RMLA 3HKZD 2GHWA 4Q0BB 2LMIA 2LU2A 1Q7YT 2QO3A 2IJRA 1RAAB 3GZ7A 1YJTA 2RAQA 2HBZB 4ZIWA 4RUAA 4E0DA 4LF1A 1ICEB 2XS5A 2RF2B 3C14B 1BGXT 1SXLA 1L3KA 3HJVA 3IC1A 1UW4A 2ACYA 2ZBRA 2XLKA 2ZHBA 2RRBA 3L7UA 5D4LA 1CLFA 4M5JA 4R8UB 4F26A 2O66A 4KFBB 4RLEA 4YDXA 3DKDA 4K2XA 1IXKA 5E0OA 2RKIA 5IS2A 2B6AA 4DUTA 2WK4A 4R0JA 3OL8A 3J81U 5H9FJ 2MZTA 3H25A 1JNZB 1XC9A 5HK4A 3J7YU 1WUUA 1IBMJ 4CRJA 4F04B 4J7CA 1S1UB 1X4EA 3KK3B 1K0VA 4HACB 1HI8A 4RW8B 3OR2B 2XYPB 2CXEA 1CJUB 2HK2A 4H4OB 1FRIA 3VAMA 2AIRB 3TO8A 2GW8A 4O44B 1YZ6A 2L08A 1YRUA 1FTCA 5HSPA 1IKVA 1S9EB 3ZTQA 1UEVA 4JI6F 4KSEB 1FVQA 2IDLA 3KWMA 4RU9A 2MSSA 3QT8A 1SKUB 2DITA 3UW1A 4YR3A 3UFCX 1TL3B 5L9XA 4CLKA 1FKOA 4KGMA 3DM2A 4CLSA 1YITS 2DRDA 2HAIA 1ZOTA 1XJWB 3FEZA 3J7YI 4WTYA 4DR3J 4RUCA 3MM6A 2YKNB 4FN5A 2KZMA 4RW6B 2DGTA 2CA9A 4O4RA 4WBFA 2K3IA 4Y28C 4EO8A 1ULRA 2MZQA 4ID8A 3AD8C 1F9FA 3CIZA 3TQEA 4WKYA 3VAKA 4F0HA 3M6VA 1XTZA 4UQGA 2XZTB 5I42B 4EBDA 1R0AA 2HRUA 4HHUA 1LFPA 4QOTA 2QTWA 5B0AA 5KFAA 4J9LA 5J1NA 3KG1A 4LF9F 4QPXA 2R2UA 4C7QA 5IXUA 4KKOB 4OHXA 2ILYA 2OTLS 1KKHA 4P75A 1NZAA 2GMLA 4PQAA 5H9EK 1SJQA 2ZZMA 1HNWJ 3MM9A 1FKPA 4ZDNA 3HI9A 2ALYB 3G8TA 3R7NB 2R8IA 2YQ3A 3TUZC 2J9DE 3VVTA 3KLFA 4ED6A 3PYDA 5C25A 4CLFA 3M4XA 2DISA 3W61A 2Z8QA 1FXRA 4B3MF 1C1BA 4ETXA 3MPDA 3FVYA 1FI4A 1FA0A 1RBLA 2FPHX 1DTTA 1WC3A 5ETVA 1Q53A 2HWHA 3SQOP 2YKAA 3SDEB 1TL7A 5J1PA 2Y0BB 3W65A 1UVJA 1RHMB 1RTDA 2VG6B 3Q8QB 4ZVSB 1S6QB 3Q2TC 3MOJB 3GPAA 5KG2A 5KFRA 4DV4J 2V94A 2ZE2B 1VQYA 3RAQA 1OMSA 3I0SA 4ZVRB 3G9CA 2XG8A 1X4AA 2C3OA 2DHSA 2NYHA 4LIWA 4NLRA 1QSYA 4QPTA 2BRKA 3C2PA 3W64A 1TVRA 5E3QA 2HHXA 3IAS9 4TU9A 3V4IB 4OZNA 3I5BA 3H0PA 1U1KA 2MZRA 1FDNA 4IFYB 1UVIA 2HVEA 3DOMA 4DSLA 3L7OA 3KLGA 3OQ2A 5EHHA 4GC6A 3QAEA 3G6ES 3MUVP 3P45B 4I7FA 1T94A 5FD1A 1Q8LA 3C6UA 4O4GA 1VBZA 3LOUA 4KV8B 1Q86T 4ZVPB 4ICLB 5EWEA 3OBIA 1LEOA 4B3OB 3OFFA 1FO1A 1M5OC 1RHQB 2Q3PA 4J9MA 3HHLB 1YHQS 4HDGA 4M5KA 3KLEB 5ETSA 1W7WA 3EXYA 2JNJA 2FZGB 5E41A 2F3JA 4FYYB 2C2NA 1X8DA 4ILMA 1BC6A 2KVQE 1VRUA 2EBGA 3ULHA 4LF4F 3O5TB 4RW4A 1PSDA 3KDOA 4USJC 1RABB 2AWZA 2BVZA 2HNZB 1S1VA 3H59A 4E8UA 2IA0A 3PRVA 3N01A 4GRSA 1UZDA 3QLHA 3HHNB 1HBUA 3EVOA 3HVTA 2F63A 4XPCA 3DLGA 3S7RA 4R8UA 3NG8A 2AJFE 1NK5A 3PRDA 4QIGA 4Z7CA 2FY8A 2EW9A 2V8DA 4LSZB 3PHTA 2JFDA 2BX6A 4IOAQ 1ITPA 3QWUA 3CPWR 1UETA 4AUKA 1SH2A 3FSYA 1H3DA 3BREA 1RWMB 1S1UA 4ECZA 1RADB 3R6LB 3KK3A 3GIIA 4HACA 3OR2A 4P7VA 3IG1B 1CJUA 3S8SA 2DXEA 4B9UA 3LQVA 2M4MA 4H4OA 2Y1IA 1X9MA 4DPOA 4C6AA 4IG0B 4A47A 2RSQA 3M2VB 2MZJA 2V2QA 4WP8A 4F36A 3TX0A 2OJ3A 3I55S 1DFDA 2XMWA 1PJ7A 3O6QA 2OFHX 2LP4A 2XZDB 2E5IA 4H4KC 1T11A 4DV5J 1NDKA 3VALA 3AOBA 2XYHB 4NLYA 5AJ3F 1GT8A 2F65A 5AE3A 3FQKA 2Q6CA 4GKKJ 3L4BC 3D67A 1ZH5A 2L9DA 2A1BA 4Q44A 4KYZA 4R25A 1A7GE 2FLLA 3GE9A 4U7CA 2CQ0A 4DSIA 4USUA 4NOHA 1FJCA 1T95A 1RT2A 4PRFA 4N7TA 2DNYA 3PY8A 2E9RX 2J9DA 5MLCV 1C1CA 3JS9A 2RHQB 2PA3A 5I4MA 4KKOA 2MHNA 4YHHF 1VQ6S 5B0CA 2CFXA 3HKWA 1D1UA 2WVEA 4ED4A 5EDWA 5T7LB 3BR9A 5A8KB 5ETKA 3MPVA 1X0PA 1NU4A 2MKSA 1Q82T 3P96A 3A12A 2LEBA 4DR1F 1FRLA 5I3QA 4F02A 4F2SA 1FHTA 5IT4A 3SSQA 4UUWA 2VQEJ 1T9WA 3VQSA 1D09B 2FJXA 3BZQA 3BSCA 4FZVA 3J7AN 3H90A 4W4MA 4DU8A 2Z2ZA 4RNHA 2CJQA 3C15A 1LOUA 1JMTA 1HKAA 1FRHA 1NXIA 1IBLF 3PO5A 2FHKA 2YQ0A 5F0UA 3HVRA 3FCHA 3CCWA 4DQPA 2FHMA 3DDIA 5ETRA 4P7TA 4DPYA 1ROFA 3OTBA 3TAPA 2W7AA 1NHVA 2JWNA 5K9FA 1JLGB 5AXMA 2UUCJ 2BEFA 5IV3A 2HFNA 3EX7B 3JTPA 1NPRA 2ROPA 4K59A 4C11B 3FC9A 1LQ9A 3PG9A 2RT3A 4P2FA 3KJFB 5H9EJ 4O3QA 4UOHA 4C8ZA 2OPPB 1KQFB 4F4KA 1N34F 1S6OA 4QR0A 3FFIB 5E3RA 3DLBA 3JAMU 3BGFA 3R8YA 5KFTA 1RWNB 2MXYA 5L8RC 2H48B 3ISZA 1X5SA 1U1OA 5F3TA 2CAJA 2VPZB 2KT3A 2GZOA 3VVUA 3N6NA 2H51B 1P1TA 4ELTA 4ECXA 2A10A 4F4XA 5AE2A 3MR3A 1T3OA 1EB0A 2XSFA 4U9RA 4JI0F 2WB4A 1MW7A 4P10A 2AGPA 2N4CA 2QZ8A 2NSCA 4DBQA 1HNVB 1NH7A 4JI1J 1WWHA 4DL0C 1WI6A 3UCGA 5IC4B 1HHQA 5M2RA 1EZZB 1F3FA 2VH7A 3KLHB 1URNA 1JKHB 2HYIB 1XMQJ 4XK8C 4C8KA 4ZS6A 2KI2A 1NPPA 4DV1J 2AHOB 1K1QA 4WP3A 3NNCA 4IR9A 2HNZA 4NCAA 2XO7A 5FLXY 3K2YA 4MK8A 4ZVHA 1CG2A 3JSMA 3TUPA 1K44A 4B17A 3NMAA 2QLBB 3U02A 1KVJA 5AXNA 1KTQA 1IBMF 1VQ4S 5LT5A 1N48A 3ENVA 5BYSA 4C8OA 3QGIA 1R0BG 1Y5IB 3RB0A 1YBUA 1UWBB 4I2PA 3CCRS 4Y65A 1T0TV 1B3TA 1PJ5A 1UL3A 4ZPWR 3BO4A 1JJCB 1GMVA 1F9EB 1R8HA 4ZPAA 4DMZA 5ITHA 4IG0A 4HH0A 4FYWB 1OY9A 2OKQA 3TVZA 3HSGA 2Q66A 5K14B 4OI4A 3ILLA 2ZH2A 4DR3F 3HHEA 5CD4A 4D3HA 4X4NA 1F9HA 4DQRA 3DDNA 4PABA 2FJAB 4DS5A 5KG0A 1F60B 1M1GA 4F4WA 1WI8A 3Q23A 2XSJA 3BQ2A 3ILOA 4XPEA 1LW0B 4PWWA 3QSIA 1G7CB 2VL1A 1W25A 1UFKA 2ILZA 5KOXA 2O5DA 4E98A 4NLWA 2QG9B 2EC2A 3EZ5A 3Q8PB 2DH7A 2BANA 3ILJA 1WC0A 5CCLA 5B7WA 3VAFA 1HNWF 2ERRA 3CF5Q 4C3LA 1HWUA 5ETNA 5KTQA 3GFXA 5HBMA 1N0UA 1IR0A 3FJ2A 4Q2MA 5B0GA 1DLOB 5CAAA 1RTHB 1S9FA 3ZNJ1 5HN0A 3PVXA 3NCQA 3CCQS 3EYZA 3KTQA 4DPUA 1N6QB 5F8JA 2KL8A 4DL3A 2F8HA 1WDDA 2MMYA 1VI7A 3J80Y 4OLOA 5GAEU 4FXDA 3BKFA 5HANA 4TN2A 4YS2A 3NOGA 3W2VB 2WAQD 3U1LA 4DV4F 1H2VZ 1IR1A 4EU0A 1U6ZA 4CIOA 1QE1A 2M3DA 5L1IA 5HI7A 3RU0A 1NPKA 1TKTA 3K5PA 2GIFA 3IN5A 4W90B 5KFVA 1H7WA 5CH7B 1KR4A 3KJNB 3PX0A 5CYQB 5DG8A 3G2XA 4QWDA 2AX1A 1PYTA 3BGUA 4U95A 3WZ0A 1CS4B 3QJPA 4JI5F 3AB2B 3A13A 1U0SA 5GAEI 4QCLA 4ZCLA 4CQ1A 2BOAA 1BQXA 2HG4A 2I5JB 1BMQB 5AT1B 1KBRA 1WHXA 1RU1A 1YSJA 2UU9J 3KHRA 2OMLA 4DV6J 5FDLA 4DCOB 1WJ9A 4IO9Q 3MURP 1IJFB 3ZTSA 4N5SA 1RAHB 1SJFA 1RWWB 1MWZA 1WOOA 1VQ8S 4ZLNA 2OHDA 2K06A 3LANA 1D3WA 1ZAVA 1C0UB 1HNZJ 1SQGA 2ASJA 4M5LA 4DL7A 1K73T 4K5SA 1VLYA 2B5JB 5I3UB 1U49A 4R0EA 2QLJB 3IS9A 2CWKA 2CJ9A 1IKWB 4HHJA 4CNZA 1LXNA 5ETMA 3D7SB 5EX3A 3FSIA 1FD8A 4V1Ak 2VOOA 1YIJS 3ZZYA 1TQLA 4P2XA 3NXZA 1VBXA 4A48A 2CQPA 4KO0B 1H0HB 5AE1A 3AJDA 5LJ3Y 3Q8VA 2QV6A 5D0GA 4NCBA 4RKUC 1FWKA 4I67A 3DOKA 4OI2A 3I82A 1KONA 3HT3A 1RB0A 2CG4A 2YKQA 3UVJB 1S6PB 2V4JA 1N5TA 2GCFA 1T05A 2DEIA 2Q1LA 2CDQA 1Y11A 1UWBA 2FGOA 4DU7A 4CO2A 2EK6A 3T5KA 4J90A 3Q8SB 2LQJA 2IAJB 2FC8A 2GQCA 2YVSA 4J9QA 1JJ2R 1NK9A 2V50A 1F5AA 2K7JA 2KYXA 4DR7J 2C3YA 5HVHA 3AOCA 2IYIA 3MEEB 4C0BA 3ISND 4DV5F 3T3FA 4LUBA 5DS7A 2IC3A 3I9V9 1JLBB 2PFDA 4MJKA 3K0JA 2X1AA 4DLEA 3CCTA 3GWCA 5EN1A 3W7BA 4FBUA 2HWIA 4U67Q 4RW7B 3FK4A 2CQ1A 2V67A 4ANCA 2WONB 5F3ZA 4GKKF 2X3GA 4JI8J 1YWXA 3KK2A 1HNIB 2G13A 2COLA 2F1FA 5A0YB 2N7CA 1DJ0A 1LW0A 2KHCA 3Q22A 5C7PA 3I5CA 2AU0A 1TFYA 1FTRA 4HTIA 1X4FA 3R5JB 4GVBA 4UUXA 2XY6A 3PZPA 3TJAA 3A8KA 2AYBA 4X66J 4B02A 4QYZK 3O1LA 4Y2IA 1B64A 4URQU 2VU5A 2OSRA 3BF4A 2OPRA 1VMBA 1SIZA 3BBCA 4JI2J 3MMCB 3CXCR 1KLMA 4IKAA 2DY1A 3WX8A 1CJTA 4RW9A 4QR1A 4CT8A 1GMWA 2FC9A 2OAUA 2XULA 1JLAA 1ZYQA 2VQEF 2DPJA 2W7OA 3MXHP 4WTOB 2HLUA 1F5CA 1PYSB 3PEHA 2M2BA 2HWTA 4WXOA 3C16B 3TUJC 7AT1B 5HP1B 4HT5A 4W92B 3HVAA 4QQBA 1WKKA 1N5QA 2QA4G 1RHKB 1A6LA 4RZRA 1FJEB 1HBOB 1S49A 4I6WA 4C0HA 4Q8FA 2ZKUA 5GAGU 1HHSA 5B09A 3BSOA 4YR2A 4DSJA 5F8HA 4ZLLA 2BE2B 2HZCA 3UNGC 3GMGA 5IQQA 4NA2A 3MFIA 4WYLA 1FNXH 2BKPA 2ZDPA 2PIIA 3W2VA 3MD1A 3BDEA 2HGMA 1RBAA 2FVQA 3DXBA 2C2KB 5A8WA 2AEMA 1HHTP 2VOPA 3B4DA 3IWLA 1B0TA 1RUSA 5KG6A 2AF6A 1FT8A 1PBAA 3MGJA 5C24B 3OVAA 2GQ2A 4HH1A 5CYMA 4NZ6A 3DU5A 4UY8T 2DNRA 1GXUA 2UV8G 2CZVC 1RTJA 2RQMA 4OHZA 2XCAA 1TUWA 2Z0GA 3CGIA 2YQ1A 4MT1A 4JV0A 1BUXA 1Y4ZB 3NKYA 2O1PA 5IC6B 4N56A 4Q8EA 4JOUA 2A2CA 2ZC4A 2R8JA 5DETA 2CPZA 3R5GA 1RWOB 1N4LA 3J7A1 2VA3A 2OD4A 3S6EA 2L41A 4ZPDA 4WCEQ 4KC5A 1X4BA 3W9HA 3MECB 4LF7J 1NK0A 4FXVA 1ZAXA 2J6TA 3EDQB 4EMDA 1EARA 5I3UA 5D15A 2YNGB 5CD4H 1TUVA 2E7WA 4ECYA 4DJBA 3KMSA 5JUMA 3MF5A 3OJUA 3D6TB 5D3GB 3R3TA 1XMQF 3FQLA 3CD7A 3J80U 3CCJS 3EXCX 4CO5A 2NXJA 2R8HA 2EI5A 1JXVA 1BHNA 1NM2A 1VISA 4AT1B 3VF0B 7FD1A 3G82B 3LALA 1DTQB 4GMKA 1DARA 2Q43A 1TV6B 3MZIA 3RYLA 3KOAA 3RRKA 1S5ZA 3EVWA 3JXOA 4CO0A 2IM3A 5L1JA 3HFZB 1UA0A 3KMQA 4OHVA 1FNOA 5HJYA 3KHGA 4ED5A 3JTNA 1K0TA 3DRSB 3KUHA 4USWA 2MKKA 5HO4A 3UVJA 5A2QY 2BACA 2UXBF 3MR5A 5B0EA 2NPFA 4U6PA 2DH8A 4LT6A 3SCJE 1IWGA 1YGYA 4OHWA 4IR1A 2HGLA 4WYWA 1AT1B 3MM8A 2DNZA 1MNEA 4PG7A 3DNCA 3KK1A 5HLFA 4A8WA 1PCAA 1S1TB 4ZIVA 2Z2LA 4TNOA 2N7YA 3CCMS 3JSRA 3Q86A 4OYIA 4J9KA 2BBEA 3DLLQ 2G0IA 2D7SA 2O01C 4F4AA 5KG5A 2M7SA 4BS2A 3VTIA 3DMJB 1VHIA 3BKTA 1IM6A 3UDLA 5CQGA 3HF5A 2WZ1A 3POTB 2RS2A 4YB5A 3TOQA 3CC4S 4IRCA 2ZH3A 1RAFB 3ITHB 2Y8YA 1PIEA 1RT6A 4R5PB 1U48A 5KT5A 1M0SA 3NOCA 2JVRA 4ZP7A 2ZD1B 3OSNA 2W7PA 3WIUA 3SIPB 1DZ5A 3RW7A 4B3TF 3MM7B 1HA1A 3V5RA 2CWXA 2YNFB 4QIFA 3RG6A 4FXWA 1EAYC 2PSZA 2HZAA 1FEHA 3RTVA 2XY7A 2HBQB 3I0RA 2I6WA 3QT5A 2EFPA 3QO9B 2KT5A 2VFUA 2XTJP 2R7UA 4J9NA 3V6JA 1CSJA 4X4SA 3EGWB 5KT4A 5GMKa 1IKYA 3PCOB 5HP1A 3GCWP 2YNIA 3CB4A 4WF9Q 1NSQA 2C3UA 4RBTA 1HBOA 2HQDA 2YWEA 4KR0B 4TU8A 2ZJQQ 1VQPS 4RBUA 2AJQA 3HO1A 1V3ZA 2DK2A 2GVDA 4K5RA 4MFBB 1I1GA 2YX7A 4NRTA 3A3PB 2QLWA 3OR1A 1U1LA 2LVWA 3NS6A 1X4DA 2WVBA 2XHWA 1X7VA 3VAGA 1X0FA 2KH9A 3B4MA 4LFCJ 3OW2R 3PW4A 3AOAA 1UZHA 4QYZJ 2KJWA 3TI0A 1WNEA 3NWRA 4UQTA 1C2PA 2I38A 1IUJA 4KT0C 1WHVA 2CZ4A 2FVSA 2YNHA 3BS9A 4X65J 3QRPA 3CEDA 2HHVA 2D74B 4USIA 4RO0A 4ZHRA 3GYNA 4IFVA 3F0NA 1NKCA 4G1IA 3CCSS 4ANDA 4OZ1A 2UU9F 4O3OA 4ILLA 1AFIA 1IBCB 4NLDA 2BJ7A 4NMXA 4XDDA 2XMUA 3H2UB 4FVCA 3W8GA 3CDEA 2W2NP 3V6DA 4CLLA 1YTYA 5CABA 1R8BA 4WE1A 5ETLA 4O3NA 2LXUA 4RBVA 2KXNB 1WORA 3RW6A 2KN4A 2RU9A 2J7UA 2HMIB 5L38A 2NUHA 2RQKA 2WRMA 3BN7A 3MPUB 4UZBA 4OYMA 2D9PA 2K8GA 1UJ6A 1Z4UA 1YJUA 5FJ4A 3OVBA 1S1XB 4MAKA 1KOOA 2P9EA 3AA9A 1JLEA 2R2TA 3VGVA 2OPSA 1KDNA 3NGKA 3MEDB 1XWLA 2VKZG 2J76E 3MM5A 2PDAA 7FDRA 1LK7A 2GNKA 5HVGA 5F8IA 4X64F 1M5HA 4XIUA 1HYSA 2DNPA 3U7JA 4C3MA 2RRNA 3LH2S 4IG3B 3HSJA 5KG4A 1J2VA 4CT9A 4LIRA 2QYCA 2W9BA 2MQMA 4V19X 3KNGA 3KJVA 3T1YJ 1QUVA 3PJWA 1BXNA 3A4TA 4LF8J 2JJ4D 4DR7F 1HQUA 3BM7A 3HLUA 3HZGA 1RK8A 4NYOA 4HI2A 1IR2A 1UPMB 1ZETA 3UCUP 3O3LA 1N32J 2XEXA 4USKA 3CJ8A 4LBIA 5KFKA 2B4VA 1Y3KA 2CPXA 1VC6A 5LXRA 4UW2A 1G4CA 2C3MA 1I94J 4IDKB 5F8GA 3DRXA 4K4YA 4JI8F 4HEA9 4C8NA 1U1PA 4DSKA 3DMJA 1OPZA 5DGAA 4WZQA 3TZZA 3OL7A 5DM6Q 3VZIA 2OEKA 3TVYA 3LP2B 4OX9J 3UNYA 3AXKA 3ITHA 3R2CJ 2BE7D 3CCVS 3W5YA 4R5PA 1SI9A 2FJEB 3I4PA 2JEJA 3M2UB 1ZPWX 2BA9A 4X66F 3IR6B 3BEGB 1S97A 3EZUA 1G3OA 1H6KX 2ZD1A 4FP9A 3HVWA 3QNWB 2EFGA 3OL9A 2G2ZA 2PMHA 1YJWS 3QJLA 4JI2F 3JYTB 2BUNA 1J27A 3PR5B 2XGPA 1EETB 3MFHA 1VIXA 4C2MA 4ZP8A 2BZ2A 4PUOB 4FNHA 1RDRA 2HW3A 4PEOA 4L72B 3BQ1A 5A2QU 2AZ3A 3D9BA 5T14A 1V3RA 3VWSA 3P3DA 5CZVA 1U8SA 2YKMB 2XS2A 1T03B 5D77A 4ZVTB 3GR0A 1SC3B 1RWPB 2QIFA 1HMVB 5HATA 2HVDA 3LW5C 3WHIA 3OFEA 2JEFA 1SL2A 1YKWA 4MFBA 1CC7A 1OSDA 4P9SA 2DNGA 4NWBA 2J6SA 4G6VB 2GS8A 3MTJA 3WX4A 2B9XA 4JV2A 1FF2A 1L3TA 2R8GA 5HMYA 3HHDA 2WSFC 1GH8A 2VFVA 4PYAA 3TAMB 1C0TB 1FRKA 2IFXA 2OPQB 4OHYA 1A0OB 4UTGA 2IY5B 1RTIA 1SUQA 4I64A 5A8RB 4NXNJ 1JJHA 2AD9A 1U1NA 2F8EX 3QT7A 4RWXA 4DCPB 2ZH1A 2BW2A 5LOQA 3T41A 4KTQA 4LSNA 4TQRA 2ZH6A 3WC0A 4F8RA 2B7BB 3NL0A 2E1AA 4P52A 3CNQP 2ZH9A 4AXJA 3UN3A 4WFNQ 2ASLA 2FLPA 2CPFA 5JVGQ 2HVIA 4TVAB 3BSAA 3D0GE 4MTPA 4LF7F 4RNOA 1FDDA 2AKWB 3EJMA 3T1HJ 1SKWA 1VOMA 3EZOA 5GADU 4AXIA 1FXDA 1N5SA 3NEKA 3UDEA 1Y00A 3CMQA 2UXCF 2HK3A 1DBDA 1G6BA 1IM4A 2MTLA 3KNAA 3QJJA 2NXCA 3W62A 3RRHA 3J81Y 3E51A 2RD5C 1D8YA 4DUYJ 1S1XA 4YFUA 4LF2A 2G4BA 3R1HA 1P9QC 1RISA 4ED7A 3D1QA 3W8PA 3R2DJ 3D3BJ 4G1QA 2XQCA 1OWXA 2VG5A 5GADI 5E2QA 3MR7A 4OJHA 4LFAJ 4IH6A 3CJTA 2VIHA 2MJUA 2LXIA 2L3MA 3PX6A 3AQPA 2ZBIA 3ILIA 2GJFA 4IG3A 5GAHU 1TL1B 3BPSP 4RWWA 3D4JA 4L73A 5GVQA 4DFJA 2FGCA 4TYAA 3BO3A 1MROA 1QAJA 2F5GA 1WG5A 3KDNA 4PKDB 5G4DA 1NUEA 3QBCA 4K7QA 4HT7A 1OS5A 1XERA 3OXLA 4WFZA 3R5BA 3V2UC 2L48A 2BJ8A 3H42A 1WG4A 2QL9B 4XDCA 2N3LA 3LPYA 4DN0A 2GMHA 5KFLA 2ZH4A 3CDUA 2VQFJ 3SFGA 3G6XA 2X1BA 5GAHI 2XMTA 4Y3CA 3VGSA 1RJJA 1FK9A 4FNIA 2DIVA 2E1PA 1S48A 2E66A 1SIWB 4I2QA 1E6YA 3PX4A 2RKIB 3HT0A 4L6V3 5E3AA 3LP2A 3H40A 1NH8A 1RT4A 2KKHA 3OTOJ 3HMJG 2E1MC 2B43A 4P71A 3UR0A 2P6TA 3RBDA 5K8PA 1QTNB 1YRTA 4D3GA 3M8PA 4KHRA 4JBCA 3MTKA 4NLTA 5DGBA 2WTFA 3SCKE 2R4FA 1UVLA 2GIRA 1ZM9A 2R9LA 3LA0A 1O8BA 2YH0A 2V69A 4ELVA 1BWEA 1UFWA 3PDNA 1FKOB 3PKMA 3DM2B 2R2RA 4NLPA 2VDHA 4J37A 2W9CB 3OXGA 4MKYA 3MM6B 3FDSA 3N5BA 3PW0A 4USHA 4IOBA 1UJ4A 2FDNA 1RHJB 4ZVUB 4K0KJ 1NB2A 4CM2A 3VV2B 1A9NB 3CJ2A 5K5MA 4ECRA 3FBEA 4JV5J 1NJWA 2CNNB 3GFHA 4LBHA 5JXSA 4ZN3A 3CD0A 1OJ4A 2R42A 4DV3J 1NK6A 1R0AB 1KC8T 1KSPA 3CIMA 1QSLA 2ZDOA 4NXMF 4LFCF 2VF3A 4J9RA 2DGUA 5HROA 3L3CA 1JWWA 3W63A 3GV7B 2W2MP 1F1BB 1WF1A 2CQCA 3D5MA 5KFNA 3T5LA 2G2YA 4PWDA 5LMNJ 4X65F 1XNRJ 3DI6A 2NXNA 3CCLS 3SQGA 1FKPB 4ZN1A 1UW9A 1UTAA 2A6OA 5A8RA 4WU2A 1I6JA 3PIPQ 4PG4A 5J2MB 2JHEA 3UO0A 4DR4F 1EX8A 1FNMA 3KFWX 1Y5LB 2V2KA 2NZ4A 4OFZA 1C1BB 2ZVSA 4I68A 2R7VA 2ZH7A 1KD1T 1DTTB 3H4BA 2XC9A 3TJ9A 1TL7B 4KHPJ 1WC4A 1D9DA 1X4HA 2FJBB 3K5NA 1H74A 3V81B 1N5YA 1U24A 3M9OB 2HQ3A 1RTDB 4EFAC 2J9CA 2RUSA 1EJ7L 4OYZA 2MZSA 3MEGA 4ZCIA 2ZZTA 3I0SB 3IM9A 4C0OC 2AMCB 4PQUA 4U8VA 3IWNC 3MAAA 2AQ4A 1GTHA 5SZTA 3QAUA 4I69A 1TVRB 2MLZA 1LXJA 2M8DB 3QSYB 4L3KA 2W01A 5KT2A 1EIYB 1VQOS 3CDWA 1T7PA 2CJAA 2X7IA 4F4ZA 1FJGF 1Y9OA 4ZP9A 2XLIA 2YKPA 2Q79A 3Q8UA 1SQFA 4HHHA 2O3DA 4QIEA 2HHHJ 4X4RA 1U2CA 3BR8A 2DCUB 2H65B 3EPGA 2CG8A 3K8VA 3KLGB 5DDQC 1LWXA 3THVA 4J9VA 4I7FB 3Q8RB 1RCXB 3C6UB 4O4GB 2WSCC 5DLGA 1OSCA 2DD8S 1PAUB 1S79A 2AT1B 3T1YF 1V9OA 1TKZA 4NI2A 3EUNA 4B3SJ 2AYGA 3X3UA 2BMBA 4LF8F 4CTAA 2HVHA 3RR8A 3UN5A 1U0HB 3W9JA 1ZA1B 4UZCA 2GO9A 2KRBA 2GJIA 1S9GA 3DLHA 3OFHA 2MZ1A 3CJRA 5F9LA 3TNVA 1SKRA 5CZXA 3BGRA 1I94F 1VRUB 3KLVA 1RT3B 4B9VA 1JLFA 2VASA 1FWLA 5K8NA 5J1EB 3G87A 2DXDA 1RT5B 3M30B 4RW4B 3SMZA 1S1VB 1APSA 3DLEB 4GKJJ 3AODA 1D8ZA 4FYVB 3QLHB 1HBUB 3HVTB 3DLGB 4OX7A 4OX9F 2CPEA 2FZKB 4HLBA 2W9AA 2AW0A 1S4EA 1IQTA 4DZDA 1UKUA 2DHHA 4JUZA 1SPBP 4H4MB 1OQ6A 4B9MA 2ATCB 3SI8A 3QIPB 2DR5A 2CKWA 2DNNA 4YEAA 1NCLA 3MEKA 3RZAA 2MDAA 4CNYA 3OFGA 2B4UA 2PE8A 2F7VA 1WKLA 1HFEL 3G6VA 4DV0J 2J6UA 3MD3A 4JI7J 3D0IE 2IM2A 4EUVA 3L09A 2A3JA 2CZ9A 2Z4PA 3IP0A 4LQ9A 1G1XA 2LEPA 3G6YA 5KFIA 3PW2A 2LLZA 3L9ZA 3GSDA 3NS5A 1NMEB 2W9CA 4M1KA 4MYUA 1SBRA 3BH7B 3J7ZT 4MKVA 1WEXA 1YG0A 2AV5A 4MIBA 4WZMA 1HBNA 5ETPA 5HQLA 2EWHA 2X51A 5LSOA 2ACMA 2JEGA 1UVKA 4F3MA 3G4SS 4KGKA 4DV2J 3TZXA 3RB3A 5BJRA 2MQPA 2V0NA 2YX4A 4CI0B 3NBPA 1S76D 1CJVA 3CC2S 1RT2B 3R7BB 4K4VA 2HAFA 3DGPA 2KDOA 1C1CB 1TKXB 2M52A 3H5SA 1WACA 3JAMY 5SUHA 3M8WA 4IOCQ 1N88A 2JC1A 3FRYA 1VS3A 4DL4A 3ZZTA 1F5BA 4Y6IA 1KOHA 4NXNF 4Q43A 1CULA 1VQ5S 1U2RA 1N8RT 4J91A 2VV5A 2ZHAA 4BCAA 3IRXA 4I6YA 2CYYA 3NGDA 2OTJS 3HHLD 1MU2A 5J2MA 3ZNUA 5D6GA 2B4OA 1QAXA 1RLCL 3MMAA 2RRAA 1B99A 3B8HA 3PRBA 3UQSA 2PFFB 1RAJA 2DR8A 2FIUA 3M9NB 5EWGA 2XB2D 1AB8A 3C15B 4FF2A 3AJ2A 2XMKA 2KT2A 3T1HF 1RAEB 3JSYA 2UV8A 3EGVA 1TR0A 1MN9A 3V81A 2AYMA 3HFVA 3RJMB 4F67A 4LRBA 4PXEA 4KAIA 2D69A 2QGFB 2LDYA 2P8IA 3DU6A 4AD6A 5A76A 4MIAA 5D4NA 4HYKA 2HHPA 4DUYF 3R1LA 2ROGA 2K7KA 3FMBA 5IT9U 1YJNS 1NKBA 4NL5A 3QRRA 3R97A 3DFEA 4U96A 4K50A 4EYIB 3K59A 2DB1A 3LGNA 3BJYA 4LFAF 2PEHA 2IA6A 3K7RA 2H54B 4WFXA 2IHR1 3ZZOA 1XR6A 4PAAA 3VAJA 1QJHA 3K5MA 4OV1A 2M88A 1NZ8A 1U09A 3OUYA 4FF4A 2DNOA 3NNHA 1XQIA 3TANA 2NR0A 3BV8A 3CCZA 2BYCA 4ES2A 1PC4A 1VGYA 1KVKA 5J2NA 1U45A 3GTYX 5KT6A 3PTWA 3QMQA 1QAYA 1UA1A 2H4WB 1U0HA 1X60A 1SQEA 3NGUA 4N76A 3RB6A 4KGZB 3S1TA 1ZZFA 2DRAA 5DZ7A 2VKRA 2VICA 3BGOP 4OI1A 2VQFF 3EWGA 1EP4A 4Y34A 4ES3A 1HLWA 1Q8BA 1LWEA 3ICLA 2HHQA 1RT3A 2DNKA 3T19A 5J1EA 4A4JA 3QWPA 1RT5A 3M30A 1RWUA 4L74A 4OYOA 5KFMA 2AEFA 1NDLA 3DLEA 3LPEA 1T3NA 3JSMB 2XM3A 5E33A 3IA0A 1VQLS 2MLXA 3OTOF 3E8OA 2DHGA 1DY3A 1J5OB 1IWAA 1RGVA 1AZSA 2DBBA 2RDJA 4AL5A 1S77D 4YN3B 4H4MA 4ZK7M 1M1HA 2MKIA 4I2PB 1HD1A 4YY3J 3QIPA 4OZ0A 4NLQA 1UFLA 1KFDA 4CYUA 5KFQA 2VZ9A 3NGRA 1Q0NA 2IDEA 1LFWA 1G2EA 3M6UA 5E7OB 5KG1A 1RT1A 4LBPA 3WC2A 4OI6A 3KLIA 4KPYA 1O0PA 4LF6J 3DLKA 3C46A 3QATA 1SVDA 3DGVA 2LQ8A 2UVUA 2VPWB 3DC2A 3PYGA 5K8OA 4PPZA 4OYBA 3IO1A 2D9OA 4X4QA 5F0WA 2R7XA 2IM1A 4QU7A 2JX2A 2CQDA 2SXLA 3A3NB 4LF9J 3DRPA 3QYYA 1LWCB 2I2YA 1MG7A 2XSJB 5IQ6A 4OV6A 4AQYF 2V8HA 2ASDA 1S99A 5C2GA 4DL6A 2FVRA 2CQHA 2KYZA 3CJ5A 2RE1A 4HR2A 4NRUA 2Z2YB 3BYPA 1QTMA 2DGQA 1TKXA 2FHJD 3IBFB 2BANB 2IYGA 2OGUA 4IUFA 4AFFA 5J2PA 1AW0A 2KB2A 1XNRF 3JQJA 3UI3A 4CO1A 2WW4A 3EE3A 2HFZA 4KH1B 2EKNA 2CJYB 1UAWA 2VFSA 1U6FA 2RB7A 5DDPC 3G71S 5HBMB 2FLNA 1KFSA 1XIQA 3JSBA 1FFSB 3QFWA 1RA6A 2CUYA 4JYAJ 5DJBA 1WTFA 3IBCB 4WIIA 4TY9A 2ZH5A 2WB1D 5KFFA 1YBTA 3H2LA 2Y1LB 4EGLA 5KG7A 1WEYA 4KHPF 1JXLA 2GX8A 2QC3A 2AEJA 4Y2MA 2Z56B 4YR0A 2APOA 5KT3A 5EUHA 3GLJA 4QU6A 3CVKA 1QE1B 5HMXA 4NA1A 2JFKA 4ZVQB 1TKTB 3FMWA 3RBXA 1WSVA 1O51A 2MQOA 2QX0A 2KG0A 1NSAA 3T6JA 2FUG9 2M70A 2OSQA 1UCNA 1QVGR 1E6VA 4PXDA 3B54A 1OPIA 2BM1A 4CLYA 3IR7B 2HHHF 1JLCA 1UMJA 1I3OB 2LECA 3VGUA 1X5OA 1NK7A 2LA6A 2J0XA 2FTRA 3MR2A 6AT1B 1UP1A 3MCMA 2I0XA 2QSWA 1TP7A 2P6SA 5FDLB 3BSNA 5IT0A 1B7YB 1JX4A 1YQHA 4PG5A 3I9ZA 1M5PC 3AQOA 1HPZA 4WKRA 2N4DA 2X3DA 2OLWA 3J7Z5 2E29A 3PIOQ 1IVZA 2WBRA 4DQQA 3LP0A 4GC7A 4TU7A 1GXTA 4KGXB 4OYWA 1RHRB 4NZ7A 3HDSA 3IS9B 4OYAA 1S57A 2BJEA 2DGXA 2HQGA 5F9NA 1H2TZ 1X31C 1Q1KA 2V68A 4C4WA 4M5GA 4OZJA 3H5XA 1UEKA 4CO4A 1FRJA 2DNMA 4KGVB 1Q5YA 3AHPA 4IYQA 2VPYB 3NLCA 3TEHB 2KVIA 4NZ0A 4JI3J 2QJ3A 5B0FA 2KG1A 2GGPA 2K3KA 1B0PA 2R3VA 3F41A 2G1DA 3DOKB 1QVFR 4LJMA 2VG7A 3MMBA 2XHCA 4OX6A 1KP6A 1WEZA 2FYXA 5KFSA 1SC1B 1YX2A 2QT7A 1HQEA 1J5OA 2V4JB 2FLOA 3M6XA 1T05B 4LVNP 2NLWA 2QLXA 1R7IA 3EICA 1R31A 4G3IA 3D54A 4IH7A 2DCLA 1HIYA 3EPIA 1OQ3A 5L1KA 4DV0F 4JI7F 1MLAA 4M5HA 5AJ3J 1NEEA 2B8QA 2DY9A 3MPYA 1NLKL 2J9EA 1GK8A 3DN9A 3AFGA 1TAUA 3BGLA 4ED1A 1XNQJ 2MGZA 4RR5A 2DKOB 2IMWP 2IC3B 2KXHA 4V19J 3ELHA 3AD7C 1N33J 1M5SA 1R6YA 4C48A 5KFOA 2M8HA 3UWTA 3GJTB 3H5YA 1M1KT 5DDOC 4QWAA 4OX8A 1NDCA 4CM0A 1MSWD 1LW2A 1FKAF 1M5KC 3KK2B 3QRQA 2ZJRQ 1WD6A 1LWCA 5EWFA 4KHMA 4GO5X 4AL7A 3NAIA 2AJ0A 4BC9A 3GJQB 4YOEA 3PEJA 4ZVFA 3QGGA 4Q7AA 3FKBA 4GVBB 4RUHA 2XWXA 3D1OA 1C4CA 2VDIA 4DR1J 3GILA 5L9NA 5EGYA 1NJZA 3ENWA 1Q8IA 2ASYA 3D6HB 1BQMA 2B9EA 2OPRB 1KLMB 1CJTB 4RW9B 3I96A 1B70B 2XNQA 4USVA 3W2WA 1JLAB 5K20B 4X4OA 2HHUA 2UUBJ 3TJ8A 2PN6A 2IMOA 3M1VA 2EG2A 4WWSA 1CC8A 5JVHQ 1VCTA 1U7LA 3WDOA 2MKHA 3RUBL 2C2MB 1OYEA 4DR2J 2P9CA 1NK8A 1D0EA 1AUSL 5A8WB 2C2OB 2RUGA 1X9WA 3GYGA 2LFVA 3ZTPA 3PO4A 4NLGA 2Q6BA 4DV7J 3M32A 2BQ3A 2MEWA 3AXMA 5CYMB 2EFOA 2DHAA 4QWBA 1RTJB 2HKEA 2MQLA 2B8PA 2KJVA 1R6VA 3M8YA 2P9GA 4JI0J 3CDAA 1X9SA 1HNXJ 3GJSB 3N5FA 1YK9A 3G96A 3HXMA 3BYRA 4DUZJ 1XR7A 4ECQA 1S7HA 3I56S 3Q24A 2AJ2A 5A6WA 1WC5A 3R27A 4A8YA 2BKNA 3DOLA 1RWVB 4C8MA 2E7VA 2B9WA 6FDRA 3O2IA 5FIIA 1CBKA 1F6TA 1K47A 2MB0B 5IFMA 2GMJA 3N6MA 3ZTOA 2M9KA 4M5DB 2RNEA 2V63A 5U47A 1Y10A 4DR5J 4XAKA 4DFMA 3QZ7A 3HD2A 1GNKA 1DQ9A 4HTJA 2R2SA 3EDRB 4P6QA 1CJKA 3MUTP 5DQGA 2A18A 4F2RA 1YRXA 3ZZPA 3UDVA 3FBBA 4MK7A 2HNDA 4DHVA 4DWIA 3OTEA 4I0WA 1D9AA 2H5JB 4DFPA 3GB0A 1ZM4A 4DL2A 2CQ3A 2F8MA 4P74A 2PMZD 1SL1A 4ZPVR 2MQ8A 2GFFA 4DSEA 2GA7A 4YY3F 2IVMA 2JLGA 5E3PA 3R7SB 4HL9A 4DL5A 3GP9A 4ZPBA 1O5JA 2W24A 3BN4A 3WQPA 1WOSA 1EHWA 1TUGB 3MM8B 2HSEB 4LF6F 3KK1B 5HLFB 1IJEB 3TA1A 2VJVA 5LMUJ
chains in the Genus database with same CATH topology
1RU1A 3HD2A 3ILOA 3MCMA 1F9HA 1IM6A 3HD1A 3HT0A 5ETNA 5ETMA 4M5NA 1RB0A 5ETVA 3KUEA 5ETLA 3KUHA 1RTZA 1G4CA 2F63A 3HSDA 3KUGA 1RAOA 1TMMA 2QX0A 3MCOA 1HKAA 4M5LA 4M5MA 5ETTA 5ETPA 5ETQA 4CWBA 4F7VA 4CRJA 2CG8A 3ILJA 1EQMA 1EX8A 1HQ2A 4M5HA 3HSGA 3ILIA 4M5KA 4PZVA 4AD6A 5ETSA 5ETOA 1DY3A 4M5JA 4CYUA 1RU2A 2F65A 3HSZA 4M5GA 3UDEA 3ILLA 4CYUB 1EQ0A 2BMBA 1TMJA 3HSJA 1Q0NA 3QBCA 4M5IA 3UDVA 3UD5A 5ETKA 3MCNA 5ETRA 3HCXA 1KBRA 3IP0A 1CBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RU1 A;  3HD2 A;  3ILO A;  3MCM A;  1F9H A;  1IM6 A;  3HD1 A;  3HT0 A;  5ETN A;  5ETM A;  4M5N A;  1RB0 A;  5ETV A;  3KUE A;  5ETL A;  3KUH A;  1RTZ A;  1G4C A;  2F63 A;  3HSD A;  3KUG A;  1RAO A;  1TMM A;  2QX0 A;  3MCO A;  1HKA A;  4M5L A;  4M5M A;  5ETT A;  5ETP A;  5ETQ A;  4CWB A;  4F7V A;  4CRJ A;  2CG8 A;  3ILJ A;  1EQM A;  1EX8 A;  1HQ2 A;  4M5H A;  3HSG A;  3ILI A;  4M5K A;  4PZV A;  4AD6 A;  5ETS A;  5ETO A;  1DY3 A;  4M5J A;  4CYU A;  1RU2 A;  2F65 A;  3HSZ A;  4M5G A;  3UDE A;  3ILL A;  4CYU B;  1EQ0 A;  2BMB A;  1TMJ A;  3HSJ A;  1Q0N A;  3QBC A;  4M5I A;  3UDV A;  3UD5 A;  5ETK A;  3MCN A;  5ETR A;  3HCX A;  1KBR A;  3IP0 A;  1CBK A; 
#chains in the Genus database with same CATH topology
 1WF0 A;  1VBK A;  1KEK A;  4LSL A;  2NQP A;  2C2Z B;  2EFQ A;  2IVY A;  3MDF A;  3OJS A;  1TEL A;  4DG1 A;  3LTO A;  3FBC A;  3M8Z A;  3MOZ A;  1FD2 A;  1RCO B;  2Y0S D;  3TA2 A;  1UVN A;  4OZL A;  1YJR A;  4Q45 A;  2VA2 A;  4DX6 A;  1TK8 A;  3TX8 A;  5ETQ A;  4CP5 A;  3OVS A;  1RI7 A;  3DRY A;  3OSP A;  3N0V A;  1REV A;  3SCI E;  4ZJO A;  4NCG A;  2HS3 A;  2B0G A;  3M7V A;  3QGP A;  1AUD A;  1S6U A;  1BQN A;  1T02 A;  4K4S A;  4F25 A;  1RT6 B;  3GSI A;  2QFJ A;  4DF8 A;  1RAI B;  3IFE A;  2E9T A;  3SZ2 A;  1QY7 A;  1SH0 A;  3CCU S;  1HI1 A;  4RU2 A;  5RUB A;  3IBW A;  4ZA1 A;  1PYO B;  1B7F A;  4QWE A;  3D6M B;  2M5Y A;  4URG A;  2R7O A;  1Z1Z A;  2YWF A;  1SL0 A;  1S10 A;  2DH9 A;  2BV3 A;  1HD0 A;  5IM0 A;  3I0R B;  1VQS A;  3AY0 A;  2ZM6 J;  1N5V A;  4JYA F;  1ACM B;  2VFT A;  3QID A;  3R5D A;  2LQB A;  3GG1 A;  4FS1 A;  3ZZZ A;  2YKO A;  1IKY B;  1WTB A;  2BRL A;  2JDJ A;  3F44 A;  2YNI B;  2ZBC A;  2NZC A;  2FZC B;  1HBM A;  2E7X A;  2CQ4 A;  4FYD A;  1SJR A;  5F8M A;  1RT7 A;  3QQC D;  4IQM A;  3TAQ A;  2RU3 A;  4DR6 J;  3NRB A;  1GEH A;  4QZV B;  3FRZ A;  1NJY A;  4K4X A;  3CJ0 A;  2GVD B;  3I31 A;  1S0V A;  4HKQ A;  1WF2 A;  4LVO P;  1KRP A;  3AJ1 A;  3OR1 B;  4JI5 J;  3LGH A;  3QGH A;  2POK A;  3W5Z A;  5JJB A;  1GMU A;  4JV1 A;  4EO6 A;  2DIU A;  2UUC F;  2C42 A;  3K17 A;  3FZ2 A;  1S1W A;  2KM8 C;  5J2Q B;  4O3S A;  2WVD A;  2KXF A;  3AAW B;  4S0M A;  2C2R A;  2HNY A;  4KY3 A;  2DR9 A;  2YNH B;  4W98 A;  3HSZ A;  1U47 A;  3LGM A;  5F8N A;  4ZHR B;  2CNK B;  4IFV B;  4F3Q A;  3GFZ A;  5DQH A;  4OJ3 A;  1SJ1 A;  1VRT B;  3NGS A;  2HRY A;  1SV5 A;  1YJ7 A;  2CVE A;  4ID5 A;  2VB6 A;  2YWK A;  3MWB A;  3GFY A;  3PNI A;  1NJI T;  1PG5 B;  4Q0B A;  1YBA A;  2GIQ A;  3W60 A;  2W2P P;  3FEX B;  5KFB A;  4WK1 A;  4FF3 A;  2IBO A;  3V6D B;  2J0W A;  1XN9 A;  4WE1 B;  3C8Y A;  2OD6 A;  2UUW A;  3CC7 S;  1VQM S;  2CNL B;  1N36 J;  2RF2 A;  3C14 A;  2VOD A;  4F0K A;  2DRB A;  2J8S A;  2G0J A;  4JI1 F;  4YP3 A;  1RKI A;  2AJ1 A;  4M5D A;  2OP5 A;  8ATC B;  4KFB A;  2U2F A;  2ZOF A;  3M8S A;  5BR8 J;  2E5J A;  2NSB A;  3H98 A;  3VCD A;  4Q2L A;  1L3V A;  1I51 B;  3CD5 A;  2HQC A;  3IWX A;  1Q16 B;  3SEO A;  4C3K A;  4QIW D;  1JLE B;  2B56 A;  2OPS B;  2E1R A;  2NRE A;  2ZUG A;  4DV1 F;  4QW9 A;  4JI3 F;  3B6B A;  4N77 A;  1YDL A;  4RW8 A;  3H20 A;  2RQ4 A;  1C4A A;  1UWA A;  2KU7 A;  3MM5 B;  4LQ3 A;  3OT9 A;  4LRE A;  4FS2 A;  4O44 A;  1S9E A;  4ELU A;  1HWI A;  2YPZ A;  4K4W A;  2DVI A;  3A8I A;  1HYS B;  1B4S A;  2RH3 A;  1DAX A;  1TL3 A;  4NLU A;  4L3N A;  4ER8 A;  2HZV A;  2Z58 B;  2DGO A;  4C9D A;  4OYX A;  2W9B B;  4BBY A;  3KJV B;  1F2G A;  3R5A A;  4YME A;  3W5X A;  4ZPT R;  3O44 A;  3PFO A;  2YKN A;  1P27 B;  4RW6 A;  2OUG A;  2W4C A;  2WVF A;  4MMO A;  4F3O A;  2GAG C;  2HHS A;  1HQU B;  3UN2 A;  3TUI C;  1XNQ F;  3KHL A;  2NYI A;  4ZOS A;  3EGN A;  5DZ6 A;  2W4P A;  2W1B A;  4IRK A;  1N33 F;  5KFC A;  1ELO A;  4N8O A;  1RSC A;  5IOL A;  4NX9 A;  3CO0 P;  5I42 A;  2IRU A;  1S12 A;  4WFA Q;  2DXF A;  5KFP A;  2BQR A;  1U6B A;  3B78 A;  4RPF A;  4WK3 A;  5JMN A;  1GTE A;  4OJG A;  5HVF A;  4J5O A;  2NXE A;  2I1R A;  1RZM A;  5DM7 Q;  1T9U A;  1KHW A;  4J9U E;  2UVW A;  4RX6 A;  2ZBP A;  3D6F B;  1VBY A;  3ZZU A;  3MR6 A;  3BBB A;  1TL5 A;  2OEL A;  4DPW A;  4PG8 A;  6FD1 A;  3TW0 A;  2XO6 A;  5ETO A;  3SSR A;  2VJU A;  3Q2S C;  3R6G B;  4A8F A;  4MKB A;  3SYZ A;  1CEZ A;  1SKS A;  1RWX B;  2RIJ A;  3SDE A;  4K4T A;  2ADC A;  4FF1 A;  1TK0 A;  2PEB A;  3TEG A;  2ZNY A;  1UEU A;  2UUB F;  2XS7 A;  2VG6 A;  3X1L B;  2HHT A;  5BXI A;  1S6Q A;  1T8E A;  1VQ7 S;  5L39 A;  2ZE2 A;  4F7V A;  4ED3 A;  1AFJ A;  2ADB A;  2HS4 A;  4A46 A;  3GV8 B;  3UD5 A;  4LR8 A;  5KOW A;  2CPY A;  1VIO A;  1W26 A;  2E44 A;  4DR2 F;  1T9V A;  1XMB A;  4RNF A;  4CO3 A;  3IM8 A;  4GO7 X;  2JZ5 A;  1KS2 A;  2OIH A;  3V4I A;  4WFY A;  2VUG A;  1YZ7 A;  4IFY A;  4B3R J;  1UPP A;  2KFZ A;  3TRG A;  1TK5 A;  4DV7 F;  2K2P A;  3FZB A;  4M95 A;  2ZFH A;  1OYD A;  2V2Z A;  4F4Y A;  4ZCK A;  2VD3 A;  1F3V A;  1NAQ A;  2HBR B;  2P5V A;  5KFZ A;  3PYF A;  3ZC4 A;  1ZZN A;  2EG1 A;  1CPZ A;  5J2Q A;  2FVC A;  2QMU B;  1VK3 A;  2V6A A;  1J5E J;  5IWA J;  1RTI B;  3IGV A;  1HR0 J;  4C97 A;  1SUQ B;  4KV8 A;  4ICL A;  3ZO7 A;  3T5J A;  3PKY A;  2XI2 A;  2WW8 A;  1HNX F;  2D41 A;  1VK8 A;  9ATC B;  3GIK A;  4B3O A;  5HL7 Q;  4YDD B;  4PXB A;  3DHW C;  2IJF A;  1UVM A;  3CE8 A;  4Y2K A;  4LF5 J;  4TKT A;  1VRT A;  1FX4 A;  4DV6 F;  4ECU A;  3HSD A;  5HQM A;  3HHL A;  1TMM A;  4DUZ F;  1Q78 A;  4LSN B;  2RJZ A;  4B9L A;  5G0R B;  3KLE A;  4ENO A;  3B82 A;  1LWF B;  2IPO B;  2V5H G;  2KRR A;  2QL7 B;  3ENA A;  5H1S V;  4DFK A;  5D8H B;  2LKZ A;  3RR7 A;  2DO0 A;  3TZY A;  1HNZ F;  1JK9 B;  3CJQ A;  3C3L A;  2FHO B;  3RAX A;  3FSX A;  3GON A;  2ZOM A;  3HCX A;  4DR5 F;  4TLQ A;  2MLY A;  1P6T A;  5F8L A;  4PYD A;  2V2V A;  4NEZ A;  1AYE A;  4FKX A;  3HP6 A;  2UVR A;  1S7I A;  2ZWP A;  3AH6 A;  1R8A A;  3G8S A;  4CZC A;  5D0R A;  2UZA A;  4O3R A;  2Y8W A;  2ZZN A;  2HQF A;  4OI0 A;  5HMW A;  2PI4 A;  2HVZ A;  2KM8 B;  5IV4 A;  4G1Q B;  1GFW B;  3HM9 A;  2UXB J;  1ARO P;  2VG5 B;  4OZ2 A;  3IG1 A;  4AE5 A;  4M94 A;  3R5C A;  2V9W A;  4QBU A;  2RIL A;  1KQS R;  3EGZ A;  4O23 A;  3QPI A;  2RHS B;  3OV7 A;  3M2V A;  4Y0F A;  1R43 A;  1IN0 A;  3Q89 A;  2XBP A;  4C8Y A;  3D3C J;  2R7T A;  2ZWO A;  1XMO J;  2IRX A;  4DXL A;  1BD6 A;  2A6M A;  1MRO B;  5A6P A;  2HIY A;  3HFK A;  3HUL A;  3LUY A;  1WSR A;  5LMU F;  3ISN C;  1X5P A;  2YX1 A;  1Z2Z A;  3H8Y A;  2JVO A;  1TTH B;  3ZTR A;  4MYT A;  4ECW A;  2BKO A;  2I9S A;  4XTT A;  2CAD A;  2DR6 A;  4MH8 A;  4HVZ A;  4K2J A;  3L95 X;  3MCO A;  4QIV A;  1MML A;  4B08 A;  3OLA A;  2LA4 A;  1FK9 B;  4UY8 5;  4B3T J;  1V5V A;  5KFU A;  5KAK A;  1GX5 A;  4I2Q B;  3EVM A;  3CCE S;  1E6Y B;  1XEZ A;  1VQ9 S;  3L7P A;  3NMR A;  1BWV A;  3TVK A;  3EMT A;  1NSK L;  5KFX A;  2J8A A;  3GG0 A;  5BYR A;  5T7L A;  2DHX A;  1RT4 B;  5A8K A;  1H2U X;  3V4M A;  3CTR A;  2VBW A;  5KFW A;  4DX7 A;  3M8P B;  3VZH A;  4M5M A;  1I5O B;  2JLE A;  2OEJ A;  2ZH8 A;  2ZM6 F;  2W8K A;  1V5I B;  1QAI A;  1RWK B;  4M5N A;  1VJQ A;  2BM0 A;  4OL8 A;  4TXS A;  3PAC A;  3KUG A;  4BWJ A;  2BJ3 A;  1FE0 A;  4OLP A;  3C66 A;  4U7U D;  1N0V C;  4DN9 A;  2ZOG A;  2JL9 A;  3MUM P;  1BE4 A;  2OH2 A;  4J9O A;  2OFG X;  2CJX B;  1JLG A;  4ZCM A;  1U02 A;  5MAO A;  1JJ4 A;  4DR6 F;  2NUU G;  4Y2C A;  5HQ8 A;  4ZJQ A;  5D4P A;  3IRW P;  1WKJ A;  3MI7 X;  4JP8 A;  3GYX B;  4C11 A;  4OQJ A;  2H3E B;  2U1A A;  1ZM2 A;  1DUR A;  3D66 A;  3CSK A;  4RNM A;  3KUE A;  3M8Q B;  4ECV A;  1FX2 A;  2X1G A;  1WOP A;  5HAO A;  1X4G A;  2OPP A;  2RS8 A;  3FFI A;  3I87 A;  2DNH A;  5HRO B;  3BQ0 A;  3GIR A;  5DG7 A;  1TKD A;  1DQ8 A;  2FHJ A;  4PWD B;  3TA0 A;  1KQK A;  2ZBQ A;  3DI6 B;  3SQG B;  3NCR A;  1SC4 B;  1XBW A;  4X4V A;  3CDB A;  2E9Z A;  1W2B R;  4Y00 A;  1QD1 A;  2UP1 A;  1BLU A;  1RXO B;  5ETT A;  2HFO A;  4N8N A;  1H98 A;  1WDT A;  1HNV A;  3UD3 P;  4EWT A;  5DDR C;  1DHM A;  4TQS A;  4YQW A;  4CH7 A;  5G0R A;  3ADA C;  3KLH A;  3OXF A;  3SBM A;  1LWF A;  4UST A;  3DLJ A;  4NE9 C;  1JKH A;  2EK1 A;  1N36 F;  2ROE A;  2QL5 B;  3FUY A;  4DI6 A;  2B9Y A;  5LL6 d;  1N5Y B;  1RTZ A;  3H2V E;  3LAK A;  2Y1J A;  3KJQ B;  2IVF B;  2C22 A;  3MEG B;  1QM9 A;  2GHP A;  2XYG B;  5BR8 F;  4PQU B;  1OY6 A;  4O0N A;  3MAA B;  3N9U C;  2WHO A;  4Z7Y A;  4X64 J;  3FNN A;  2CQG A;  3TZW A;  4MIW A;  2LU1 A;  4QR2 A;  4O0I A;  4PWU A;  3ETM A;  4L76 A;  5E5N A;  1ZTT A;  3I32 A;  4M63 A;  2FB0 A;  2V4R A;  3IR5 B;  5DG9 A;  2IBK A;  1PBU A;  2KTQ A;  3IGN A;  1SH3 A;  4F0M A;  2MQQ A;  3DDK A;  2F4V J;  2BW7 A;  1REG X;  1JQG A;  3V6H A;  3RRG A;  1IKX B;  2P2C B;  1ZAW A;  2HUR A;  3ET6 B;  3ZZR A;  1U1R A;  1TKZ B;  4NI2 B;  4HI1 A;  4NLV A;  1JB0 C;  5K14 A;  1NO8 A;  3GU0 A;  4A8O A;  1FEE A;  1LK5 A;  4ZVO B;  3P6Y C;  4AL6 A;  4CTA B;  2I8E A;  4U8Y A;  3D2W A;  1V6H A;  1H7X A;  4ZP6 A;  2EBE A;  1S0M A;  2DTJ A;  2C28 A;  8RUC A;  4WJB A;  4X62 J;  2KO1 A;  1S9G B;  2JRS A;  4Z37 A;  2VFR A;  1SCJ B;  4PXC A;  5CXT A;  1HQ2 A;  1U26 A;  3BGR B;  2HHW A;  5D4O A;  1VFJ A;  2ZHO A;  1JLF B;  2XMV A;  1FE4 A;  5KFE A;  4X4U A;  2R7S A;  2EC0 A;  2JEI A;  3P5T L;  4UOF A;  3JTO A;  1KQG B;  5FLX U;  2L9N A;  2H4Y B;  1FWP A;  1RU2 A;  4N41 A;  1Q81 T;  1PO6 A;  3UD4 P;  3AT1 B;  1IBK J;  1U1Q A;  1JXE A;  3F56 A;  2B4P A;  4BHQ A;  4CLZ A;  1NDP A;  4NAS A;  2QMW A;  2Y3Y A;  1FXL A;  2CPJ A;  3JB9 k;  1DLO A;  3NGT A;  2UXD J;  2QMX A;  3CUL A;  4J9S A;  1RTH A;  3BPD A;  4DEZ A;  4EK2 A;  1FDB A;  2YH1 A;  4H4K A;  2KHD A;  1KTV A;  4ZKA A;  1N6Q A;  1GXL A;  5LSL A;  2DYA A;  2AGQ A;  1VLO A;  2CNO B;  1FFW B;  3LO3 A;  3PM9 A;  3UR3 C;  1X4C A;  3N28 A;  4FYX B;  2HRT A;  1NRK A;  2HFS A;  2JC0 A;  3CO9 A;  3RBZ A;  2HGN A;  4DOZ A;  4FBT A;  1PKU A;  2V9K A;  2XMM A;  2FJW A;  2BJ1 A;  1RKJ A;  1T9X A;  1U2F A;  2CPH A;  1HBN B;  2D3U A;  5CYQ A;  5IT9 Y;  2DNL A;  5GAG I;  4B3R F;  1XK8 A;  3NBP B;  1FER A;  4TY8 B;  1CS4 A;  3M8Q A;  1CJV B;  1HL6 A;  4DX8 H;  2JLF A;  1PGZ A;  3DGP B;  3VGT A;  1VDH A;  4NA3 A;  5GMD A;  2DR7 A;  4ES1 A;  3LP1 B;  2VHG A;  2FJD B;  2I5J A;  3RB4 A;  1HWL A;  3D0H E;  4FKY A;  1N52 B;  2MJN A;  4ED0 A;  4I56 A;  3UDC A;  1J5E F;  5DLF A;  1PIL A;  5IWA F;  1HR0 F;  1CUL B;  2XLJ A;  2X1F A;  1R89 A;  3ZZ0 A;  3IRX B;  1C0U A;  4LF5 F;  3DHX A;  1MU2 B;  3FBF A;  1QSS A;  2EEY A;  2B5J A;  3MMA B;  2BJ9 A;  3DYA B;  3T9Z A;  1NSP A;  3GQC A;  1H38 A;  1IKW A;  2UXC J;  2Y9H A;  4PPD A;  1VR6 A;  5THW A;  3RAM A;  2DPI A;  3VAI A;  4A8S A;  3MPW A;  5M2P A;  1OO0 B;  4LR7 A;  4X4P A;  4LRC A;  3T1A A;  4KO0 A;  3OLB A;  4YB7 A;  3D1H A;  2DJW A;  3PHE A;  1RP5 A;  4FPI A;  4P72 A;  1X5T A;  3FCW A;  2DGV A;  2LEA A;  2YWH A;  2QFI A;  3QZ8 A;  1HI0 P;  2YY3 A;  2WOM B;  4GVL A;  5E3C A;  4JI4 J;  4QJV A;  1B0V A;  1Q7L B;  5C42 B;  4NEY A;  2V8V A;  1S6P A;  1SJ3 P;  3A8E A;  2HQI A;  1WC1 A;  2RDI A;  1TU0 B;  3KG4 A;  2IAJ A;  5KFY A;  1L3U A;  2EFV A;  4U7U K;  2LCW A;  1P1L A;  3S01 A;  3AB4 B;  1IKX A;  1LV5 A;  1TFW A;  3MEE A;  1NK4 A;  2QA4 S;  1CQM A;  5L1L A;  1GX6 A;  1XMO F;  3C6T B;  3ET6 A;  3OUY B;  2C2D A;  1K9M T;  2Z57 B;  2KZZ A;  3I6P A;  1JLB A;  2V4Q A;  4E2F B;  1NKE A;  1R8C A;  3G86 A;  4RW7 A;  4QW8 A;  2HFU A;  5J2N B;  5HJX A;  3D28 A;  2WON A;  3C19 A;  4BC7 A;  3OTC A;  3GR1 A;  4MK9 A;  3FEY B;  1HNI A;  1N32 F;  2RVJ A;  5A0Y A;  1YJV A;  1SJ4 P;  4A8Q A;  1CQN A;  4LRD A;  1EP4 B;  2QN6 B;  4NPO A;  1LWE B;  5C2C A;  1LKZ A;  4NYZ A;  2OI2 A;  2UUA J;  1S4F A;  2D3Z A;  3CME S;  2ZIT A;  3VAH A;  2ALZ A;  1NND A;  2QRR A;  1RQ0 A;  3E01 B;  3IAM 9;  2MST A;  2LDI A;  3T5H A;  4EZ6 A;  2F9D A;  4ZLP A;  4DS4 A;  2H9Z A;  3MMC A;  4M8L A;  5LSR A;  1AZS B;  2G1H A;  3U1M A;  1Q5V A;  3IXQ A;  2PGC A;  4ZMM A;  2DNQ A;  3K89 A;  2PMW A;  5KFJ A;  3U1N A;  3T9N A;  3TAR A;  1R0C B;  3C16 A;  5LM7 E;  4CYU B;  1YJ9 S;  2DO4 A;  1Y3J A;  5AXK A;  3US5 A;  1RT1 B;  4IRD A;  1QDU B;  2VPX B;  3NP5 A;  3KLI B;  2AJ4 A;  3DLK B;  2BE2 A;  1GQE A;  4RNN A;  5DQI A;  9RUB A;  3FCV A;  2R7Q A;  2ZVI A;  4ANE A;  3PJ9 A;  5EX0 A;  2HLT A;  1CVJ A;  3LAM A;  5KFH A;  2ZKT A;  4RUB A;  2E5G A;  3QT6 A;  4NXM J;  4I6A A;  3OHA A;  2PD1 A;  3DRP B;  2VC1 A;  1Q79 A;  1FJ7 A;  5C24 A;  5CCM A;  4ED2 A;  3H7H B;  5AXL A;  1W2I A;  3PV8 A;  3NS7 B;  3HZE A;  2H1Y A;  2CQI A;  4TY8 A;  2IM0 A;  2NCK L;  2ZEJ A;  1M90 T;  2UVV A;  1OIA A;  3JQK A;  4DR4 J;  1U1M A;  2JSX A;  3JQM A;  3LP1 A;  5B08 A;  1WG1 A;  4ED8 A;  4CCH A;  2VBY A;  5J2P B;  1K1S A;  4USM A;  3LF0 A;  2L9W A;  4DDF A;  2K1R B;  1LNQ A;  3H4D A;  1HW8 A;  3BBF A;  2IJN A;  3K5O A;  2DEJ A;  5CHC B;  3MEC A;  3E2E A;  1ZS6 A;  1VHF A;  3SSS A;  4NLO A;  3HHK A;  4TYB A;  1VQK S;  5KG3 A;  3NAH A;  1TZ0 A;  1YI2 S;  3DYA A;  2YNG A;  2FD2 A;  4I4B A;  2R7W A;  2FVP A;  4EBE A;  4NLS A;  3CJK B;  2J0S D;  5D3G A;  1VQN S;  3N4W A;  3HPO A;  4OZ3 A;  3P8B B;  3M6W A;  3N79 A;  2BOP A;  2A0F B;  4IQX A;  5LXY A;  1VJW A;  2C1E B;  4OZ5 A;  1FJG J;  4LFB J;  4QYR A;  3M2R B;  1RYR A;  4OMF G;  3VHQ A;  3QFH A;  3WBZ A;  4KIA A;  3G82 A;  3OPK A;  1DTQ A;  4CWB A;  3MAH A;  2XNR A;  1TV6 A;  3NCP A;  2C3P A;  1RBO B;  2CDR B;  3O8W A;  3LWM A;  2WOM A;  4P2S A;  2W25 A;  1E6V B;  1R27 B;  4ALZ A;  3DRS A;  1TL4 A;  5C42 A;  4KB7 A;  2V8P A;  1D9F A;  1O6X A;  1JLC B;  2D3O 1;  4L75 A;  1MN7 A;  2F4V F;  1EKR A;  2E5L J;  3CWJ A;  4B9N A;  5K8M A;  2YBV A;  4ATN A;  4LRF A;  2WSE C;  1S1T A;  3KG0 A;  3W3S A;  3UCZ P;  1HPZ B;  3C6T A;  4WP9 A;  1HWJ A;  4KRW A;  4FPR A;  3LP0 B;  1HAR A;  2MYF A;  3GCX P;  4N47 A;  3PXG a;  4CLU A;  2HFV A;  2GVZ B;  1YVF A;  5BYQ A;  4X62 F;  2XI3 A;  3POT A;  2JOQ A;  3THP A;  2VBZ A;  1QLN A;  2M0G B;  1R3N A;  5F41 A;  3BH6 B;  2MY7 A;  4CDI A;  3NY0 A;  3NWG A;  4LMZ A;  4G65 A;  4ITS A;  2VON A;  2PT0 A;  2HIQ A;  2V34 A;  2OMO A;  2R8K A;  2WBM A;  4DPX A;  3MM7 A;  2YWG A;  4OIX A;  2YNF A;  3T6B A;  2GGP B;  3E01 A;  2ZC3 A;  1NB7 A;  2CIM A;  2VG7 B;  1IBK F;  1SC6 A;  1F0X A;  1ZM3 A;  3MMB B;  1RAC B;  4A8M P;  2AGO A;  4JI6 J;  1RHU B;  1S0N A;  1HQE B;  3QO9 A;  1U8W A;  4NLX A;  2QE5 A;  3TR5 A;  2QA2 A;  4IH5 A;  2UXD F;  2B7C B;  4ZVG A;  1K8A T;  3SXL A;  3SV3 A;  3BO2 A;  5D0E A;  2W4D A;  4ZLJ A;  3OD2 A;  2BAB A;  2N82 B;  1JLQ B;  1RYS A;  5CA5 A;  2G0C A;  1HW9 A;  4FVM A;  3ETO A;  2H5I B;  1QUP A;  3VR1 A;  2MGZ B;  5LJ5 Y;  5GME A;  2E1C A;  4P2M A;  4F50 A;  2D1C A;  2QSF A;  4QWC A;  2KFN A;  1VYA A;  4M5I A;  1Y0H A;  4ZPC A;  4CLT A;  4ZIT A;  2XWY A;  4K0K F;  1KNZ A;  2XY5 A;  1LW2 B;  2CPI A;  2ZUA A;  2QEX S;  3UE2 A;  4JV5 F;  4Y2A A;  4CH1 A;  3PW7 A;  2CQB A;  2MY8 A;  1PAE X;  4DV3 F;  4LRA A;  1HWK A;  3V6K A;  5DO2 A;  2GO8 A;  4RJV A;  1F2H A;  1ZBT A;  3K8W A;  1U25 A;  2EKY A;  4DPT A;  2BE9 B;  1P9Y A;  1H72 C;  3Q0A A;  4Q5V A;  3F73 A;  1VC5 A;  1KWM A;  1TAQ A;  4RL1 A;  4UOC A;  2RQC A;  4WIQ A;  3A3O B;  2J5A A;  4WU3 A;  5LMN F;  1BQM B;  1Q95 G;  4KE5 A;  4B3M J;  4ZJL A;  2A2D A;  2XMJ A;  4Z2X A;  2QLF B;  4X4T A;  3HX9 A;  4WPA A;  3Q83 A;  2PO4 A;  5IZH A;  2K1R A;  1KVI A;  3RGI A;  3W2W B;  2GAH C;  2BR0 A;  4YB6 A;  3P49 B;  2HMI A;  3KKF A;  2BXJ A;  2OO4 A;  2XCP A;  2PA8 D;  2R7R A;  3ZXW A;  3ENQ A;  3M1V B;  2Z2M A;  5KFG A;  4TLR A;  2LXF A;  3CMA S;  3I5A A;  4A8X A;  1EKS A;  2FY1 A;  2BJD A;  4YB1 P;  2CQ2 A;  2NS1 B;  5D78 A;  3CJK A;  2VBX A;  1ZPV A;  2F9J A;  4DCJ B;  2F4F A;  3MED A;  4CH0 S;  1Y7P A;  4ILR A;  4BDP A;  2QYG A;  3M2R A;  3AA8 A;  1R8P A;  4DLG A;  4OJ1 A;  4UOG A;  5H9F K;  1SB6 A;  3P5B P;  4JI4 F;  3PJX A;  3M32 B;  1IQZ A;  3GJR B;  2ZJP Q;  4EI2 A;  4B9S A;  1H73 A;  2EFN A;  1WHY A;  2W8L A;  2AP6 A;  1PJ6 A;  1MMN A;  3GV5 B;  3OHB A;  1TMJ A;  2JH3 A;  4IO1 A;  1RE1 B;  4KPC A;  4XO0 A;  3DRR B;  1GAO A;  2MPU A;  2CPD A;  4A8K A;  1M5V C;  2CRL A;  1L3S A;  1MWQ A;  3SV4 A;  2IIH A;  4BWM A;  1V3S A;  2MKJ A;  2HEK A;  2CJK A;  1RAG B;  2GJ2 A;  4FDF A;  2GQQ A;  3I4H X;  2E5H A;  1KHV A;  4CLP A;  3ZFV A;  4B3S F;  1PC5 A;  3DOL B;  1JIH A;  4WXW A;  2UUT A;  3OL6 A;  4NML A;  4EEY A;  3ONQ A;  1DRZ A;  2NPI A;  4IDK A;  5T41 A;  2H5E A;  4LF4 J;  4URS A;  1AA1 B;  2GVZ A;  3DCA A;  4DQI A;  4PG6 A;  3W9I A;  3KXD A;  1MWY A;  4JB8 B;  2KFY A;  3D68 A;  2B6A B;  2OEM A;  5KT7 A;  1CJK B;  4K8R A;  1FCA A;  2UUA F;  2LYV A;  2YXL A;  1VRQ C;  2QA1 A;  3LWL A;  2FJV A;  3CUN A;  3MCN A;  3M2U A;  4KJI A;  4CLW A;  2HND B;  3HK2 A;  4GKJ F;  4MKA A;  4KBI A;  3M8R A;  3CW2 C;  3M9M B;  1ZA2 B;  4AYB D;  1FFG B;  2F40 A;  1IKV B;  5HMZ A;  3CT9 A;  2EXU A;  3DXS X;  3IMQ J;  3JYT A;  2DT9 A;  1ZTW A;  4DQS A;  1GMW D;  3R9L A;  1EET A;  2O67 A;  2N3O A;  2XMA A;  4UT4 A;  3BB5 A;  3KYL A;  1BY9 A;  1RLD A;  4PUO A;  3NNA A;  3W1Y C;  3W66 A;  2DGS A;  3BDP A;  1Q4R A;  1WC6 A;  3MHY A;  3MMJ A;  2BDP A;  1URR A;  1FRX A;  4PCQ A;  4KH0 B;  2AYE A;  2J7W A;  3CJ4 A;  2HS0 A;  4C98 A;  2V8G A;  1EQM A;  2YKM A;  1JLQ A;  3G8Q A;  1T03 A;  1T9Y A;  1WHW A;  2AX0 A;  2ATL A;  1T9T A;  4DX5 A;  1NBE B;  4WFB Q;  5I3P A;  2PC6 A;  3N6L A;  1HMV A;  3SCL E;  4AQY J;  1XR5 A;  4LSL B;  3MAQ A;  4EZ9 A;  5DRK A;  3CJS A;  1RAO A;  2YWW A;  3A1Y G;  3GIJ A;  2EPI A;  4LR9 A;  1AXQ A;  2W2O P;  3TWZ A;  4DG1 B;  3J81 j;  4YUD A;  3K57 A;  1N54 B;  3OTD A;  3U27 A;  3UPF A;  2B3T B;  2Z30 B;  1MMD A;  1S0O A;  2PI5 A;  1FVS A;  4G1P A;  5D0H A;  1P8G A;  4K4U A;  4PR6 A;  2YPY A;  2LQ5 A;  1FES A;  4ZVE A;  4DV2 F;  3PFE A;  1REV B;  1FDA A;  3TAM A;  2D3O R;  1C0T A;  3A8J A;  3TP2 A;  2GHV C;  3MCS A;  4NCG B;  3MM9 B;  8AT1 B;  4J9P A;  2NXU A;  1BQN B;  2OPQ A;  4C8L A;  4YHH J;  4KQZ A;  3PR4 A;  1NHU A;  5B0B A;  3KLF B;  5C25 B;  2G9O A;  4I1T A;  3HJF A;  2ZNZ A;  4NYP A;  1U4B A;  2HPU A;  1DQA A;  3CJ3 A;  3TQ1 A;  2GC8 A;  3SFU A;  1S72 S;  3BKU A;  1Y5N B;  2J0Q D;  5IM0 B;  1WEL A;  3THT A;  5CYJ A;  4ECS A;  3FGV A;  3AD9 C;  3VQT A;  1VC0 A;  3HHL C;  3HD1 A;  3EM1 A;  4UF4 A;  2YTC A;  3K5L A;  2CVI A;  3KHH A;  2FQQ B;  1IBL J;  1N56 A;  2WCX A;  1FRM A;  2XZW A;  4DF4 A;  1UJ5 A;  3Q8Y A;  2W2Q P;  4ETZ A;  2J7K A;  4HDH A;  1EQ0 A;  1HBM B;  1KLN A;  3K58 A;  1RT7 B;  3RBE A;  2B51 A;  2VC0 A;  4ECT A;  2EVZ A;  2MHE A;  1Q8K A;  1L5U A;  2XGQ A;  5ADZ A;  4LFB F;  4DSF A;  4X84 A;  2G2O A;  3WIV A;  3PW5 A;  3H5U A;  3DOM B;  3PYE A;  4BLG A;  2LQ9 A;  5M2U A;  3TYT A;  5KFD A;  1RA7 A;  2AZ1 A;  1NHK L;  1N34 J;  2BQU A;  4X2B A;  4OI3 A;  2WVC A;  3CD6 S;  2DGW A;  2HBY B;  1S1W B;  2MKY A;  2Y1R I;  5B0D A;  2C2E A;  1KN6 A;  4DZ6 A;  3GIM A;  1JNR B;  4K4Z A;  2MQN A;  2HNY B;  1TL1 A;  2GV1 A;  2RDD A;  4ERD A;  4OYP A;  2E5L F;  3M05 A;  4EBC A;  4EYH B;  2MKC A;  1OY8 A;  2CJB A;  1YLX A;  3P4U B;  4H54 A;  1Z2L A;  1S59 A;  3DRR A;  4P73 A;  5C5J A;  2ABY A;  2IRY A;  1NJX A;  1SV5 B;  3E3X A;  4ID5 B;  4B9T A;  4PZV A;  5L46 A;  4O3P A;  2RML A;  3HKZ D;  2GHW A;  4Q0B B;  2LMI A;  2LU2 A;  1Q7Y T;  2QO3 A;  2IJR A;  1RAA B;  3GZ7 A;  1YJT A;  2RAQ A;  2HBZ B;  4ZIW A;  4RUA A;  4E0D A;  4LF1 A;  1ICE B;  2XS5 A;  2RF2 B;  3C14 B;  1BGX T;  1SXL A;  1L3K A;  3HJV A;  3IC1 A;  1UW4 A;  2ACY A;  2ZBR A;  2XLK A;  2ZHB A;  2RRB A;  3L7U A;  5D4L A;  1CLF A;  4M5J A;  4R8U B;  4F26 A;  2O66 A;  4KFB B;  4RLE A;  4YDX A;  3DKD A;  4K2X A;  1IXK A;  5E0O A;  2RKI A;  5IS2 A;  2B6A A;  4DUT A;  2WK4 A;  4R0J A;  3OL8 A;  3J81 U;  5H9F J;  2MZT A;  3H25 A;  1JNZ B;  1XC9 A;  5HK4 A;  3J7Y U;  1WUU A;  1IBM J;  4CRJ A;  4F04 B;  4J7C A;  1S1U B;  1X4E A;  3KK3 B;  1K0V A;  4HAC B;  1HI8 A;  4RW8 B;  3OR2 B;  2XYP B;  2CXE A;  1CJU B;  2HK2 A;  4H4O B;  1FRI A;  3VAM A;  2AIR B;  3TO8 A;  2GW8 A;  4O44 B;  1YZ6 A;  2L08 A;  1YRU A;  1FTC A;  5HSP A;  1IKV A;  1S9E B;  3ZTQ A;  1UEV A;  4JI6 F;  4KSE B;  1FVQ A;  2IDL A;  3KWM A;  4RU9 A;  2MSS A;  3QT8 A;  1SKU B;  2DIT A;  3UW1 A;  4YR3 A;  3UFC X;  1TL3 B;  5L9X A;  4CLK A;  1FKO A;  4KGM A;  3DM2 A;  4CLS A;  1YIT S;  2DRD A;  2HAI A;  1ZOT A;  1XJW B;  3FEZ A;  3J7Y I;  4WTY A;  4DR3 J;  4RUC A;  3MM6 A;  2YKN B;  4FN5 A;  2KZM A;  4RW6 B;  2DGT A;  2CA9 A;  4O4R A;  4WBF A;  2K3I A;  4Y28 C;  4EO8 A;  1ULR A;  2MZQ A;  4ID8 A;  3AD8 C;  1F9F A;  3CIZ A;  3TQE A;  4WKY A;  3VAK A;  4F0H A;  3M6V A;  1XTZ A;  4UQG A;  2XZT B;  5I42 B;  4EBD A;  1R0A A;  2HRU A;  4HHU A;  1LFP A;  4QOT A;  2QTW A;  5B0A A;  5KFA A;  4J9L A;  5J1N A;  3KG1 A;  4LF9 F;  4QPX A;  2R2U A;  4C7Q A;  5IXU A;  4KKO B;  4OHX A;  2ILY A;  2OTL S;  1KKH A;  4P75 A;  1NZA A;  2GML A;  4PQA A;  5H9E K;  1SJQ A;  2ZZM A;  1HNW J;  3MM9 A;  1FKP A;  4ZDN A;  3HI9 A;  2ALY B;  3G8T A;  3R7N B;  2R8I A;  2YQ3 A;  3TUZ C;  2J9D E;  3VVT A;  3KLF A;  4ED6 A;  3PYD A;  5C25 A;  4CLF A;  3M4X A;  2DIS A;  3W61 A;  2Z8Q A;  1FXR A;  4B3M F;  1C1B A;  4ETX A;  3MPD A;  3FVY A;  1FI4 A;  1FA0 A;  1RBL A;  2FPH X;  1DTT A;  1WC3 A;  5ETV A;  1Q53 A;  2HWH A;  3SQO P;  2YKA A;  3SDE B;  1TL7 A;  5J1P A;  2Y0B B;  3W65 A;  1UVJ A;  1RHM B;  1RTD A;  2VG6 B;  3Q8Q B;  4ZVS B;  1S6Q B;  3Q2T C;  3MOJ B;  3GPA A;  5KG2 A;  5KFR A;  4DV4 J;  2V94 A;  2ZE2 B;  1VQY A;  3RAQ A;  1OMS A;  3I0S A;  4ZVR B;  3G9C A;  2XG8 A;  1X4A A;  2C3O A;  2DHS A;  2NYH A;  4LIW A;  4NLR A;  1QSY A;  4QPT A;  2BRK A;  3C2P A;  3W64 A;  1TVR A;  5E3Q A;  2HHX A;  3IAS 9;  4TU9 A;  3V4I B;  4OZN A;  3I5B A;  3H0P A;  1U1K A;  2MZR A;  1FDN A;  4IFY B;  1UVI A;  2HVE A;  3DOM A;  4DSL A;  3L7O A;  3KLG A;  3OQ2 A;  5EHH A;  4GC6 A;  3QAE A;  3G6E S;  3MUV P;  3P45 B;  4I7F A;  1T94 A;  5FD1 A;  1Q8L A;  3C6U A;  4O4G A;  1VBZ A;  3LOU A;  4KV8 B;  1Q86 T;  4ZVP B;  4ICL B;  5EWE A;  3OBI A;  1LEO A;  4B3O B;  3OFF A;  1FO1 A;  1M5O C;  1RHQ B;  2Q3P A;  4J9M A;  3HHL B;  1YHQ S;  4HDG A;  4M5K A;  3KLE B;  5ETS A;  1W7W A;  3EXY A;  2JNJ A;  2FZG B;  5E41 A;  2F3J A;  4FYY B;  2C2N A;  1X8D A;  4ILM A;  1BC6 A;  2KVQ E;  1VRU A;  2EBG A;  3ULH A;  4LF4 F;  3O5T B;  4RW4 A;  1PSD A;  3KDO A;  4USJ C;  1RAB B;  2AWZ A;  2BVZ A;  2HNZ B;  1S1V A;  3H59 A;  4E8U A;  2IA0 A;  3PRV A;  3N01 A;  4GRS A;  1UZD A;  3QLH A;  3HHN B;  1HBU A;  3EVO A;  3HVT A;  2F63 A;  4XPC A;  3DLG A;  3S7R A;  4R8U A;  3NG8 A;  2AJF E;  1NK5 A;  3PRD A;  4QIG A;  4Z7C A;  2FY8 A;  2EW9 A;  2V8D A;  4LSZ B;  3PHT A;  2JFD A;  2BX6 A;  4IOA Q;  1ITP A;  3QWU A;  3CPW R;  1UET A;  4AUK A;  1SH2 A;  3FSY A;  1H3D A;  3BRE A;  1RWM B;  1S1U A;  4ECZ A;  1RAD B;  3R6L B;  3KK3 A;  3GII A;  4HAC A;  3OR2 A;  4P7V A;  3IG1 B;  1CJU A;  3S8S A;  2DXE A;  4B9U A;  3LQV A;  2M4M A;  4H4O A;  2Y1I A;  1X9M A;  4DPO A;  4C6A A;  4IG0 B;  4A47 A;  2RSQ A;  3M2V B;  2MZJ A;  2V2Q A;  4WP8 A;  4F36 A;  3TX0 A;  2OJ3 A;  3I55 S;  1DFD A;  2XMW A;  1PJ7 A;  3O6Q A;  2OFH X;  2LP4 A;  2XZD B;  2E5I A;  4H4K C;  1T11 A;  4DV5 J;  1NDK A;  3VAL A;  3AOB A;  2XYH B;  4NLY A;  5AJ3 F;  1GT8 A;  2F65 A;  5AE3 A;  3FQK A;  2Q6C A;  4GKK J;  3L4B C;  3D67 A;  1ZH5 A;  2L9D A;  2A1B A;  4Q44 A;  4KYZ A;  4R25 A;  1A7G E;  2FLL A;  3GE9 A;  4U7C A;  2CQ0 A;  4DSI A;  4USU A;  4NOH A;  1FJC A;  1T95 A;  1RT2 A;  4PRF A;  4N7T A;  2DNY A;  3PY8 A;  2E9R X;  2J9D A;  5MLC V;  1C1C A;  3JS9 A;  2RHQ B;  2PA3 A;  5I4M A;  4KKO A;  2MHN A;  4YHH F;  1VQ6 S;  5B0C A;  2CFX A;  3HKW A;  1D1U A;  2WVE A;  4ED4 A;  5EDW A;  5T7L B;  3BR9 A;  5A8K B;  5ETK A;  3MPV A;  1X0P A;  1NU4 A;  2MKS A;  1Q82 T;  3P96 A;  3A12 A;  2LEB A;  4DR1 F;  1FRL A;  5I3Q A;  4F02 A;  4F2S A;  1FHT A;  5IT4 A;  3SSQ A;  4UUW A;  2VQE J;  1T9W A;  3VQS A;  1D09 B;  2FJX A;  3BZQ A;  3BSC A;  4FZV A;  3J7A N;  3H90 A;  4W4M A;  4DU8 A;  2Z2Z A;  4RNH A;  2CJQ A;  3C15 A;  1LOU A;  1JMT A;  1HKA A;  1FRH A;  1NXI A;  1IBL F;  3PO5 A;  2FHK A;  2YQ0 A;  5F0U A;  3HVR A;  3FCH A;  3CCW A;  4DQP A;  2FHM A;  3DDI A;  5ETR A;  4P7T A;  4DPY A;  1ROF A;  3OTB A;  3TAP A;  2W7A A;  1NHV A;  2JWN A;  5K9F A;  1JLG B;  5AXM A;  2UUC J;  2BEF A;  5IV3 A;  2HFN A;  3EX7 B;  3JTP A;  1NPR A;  2ROP A;  4K59 A;  4C11 B;  3FC9 A;  1LQ9 A;  3PG9 A;  2RT3 A;  4P2F A;  3KJF B;  5H9E J;  4O3Q A;  4UOH A;  4C8Z A;  2OPP B;  1KQF B;  4F4K A;  1N34 F;  1S6O A;  4QR0 A;  3FFI B;  5E3R A;  3DLB A;  3JAM U;  3BGF A;  3R8Y A;  5KFT A;  1RWN B;  2MXY A;  5L8R C;  2H48 B;  3ISZ A;  1X5S A;  1U1O A;  5F3T A;  2CAJ A;  2VPZ B;  2KT3 A;  2GZO A;  3VVU A;  3N6N A;  2H51 B;  1P1T A;  4ELT A;  4ECX A;  2A10 A;  4F4X A;  5AE2 A;  3MR3 A;  1T3O A;  1EB0 A;  2XSF A;  4U9R A;  4JI0 F;  2WB4 A;  1MW7 A;  4P10 A;  2AGP A;  2N4C A;  2QZ8 A;  2NSC A;  4DBQ A;  1HNV B;  1NH7 A;  4JI1 J;  1WWH A;  4DL0 C;  1WI6 A;  3UCG A;  5IC4 B;  1HHQ A;  5M2R A;  1EZZ B;  1F3F A;  2VH7 A;  3KLH B;  1URN A;  1JKH B;  2HYI B;  1XMQ J;  4XK8 C;  4C8K A;  4ZS6 A;  2KI2 A;  1NPP A;  4DV1 J;  2AHO B;  1K1Q A;  4WP3 A;  3NNC A;  4IR9 A;  2HNZ A;  4NCA A;  2XO7 A;  5FLX Y;  3K2Y A;  4MK8 A;  4ZVH A;  1CG2 A;  3JSM A;  3TUP A;  1K44 A;  4B17 A;  3NMA A;  2QLB B;  3U02 A;  1KVJ A;  5AXN A;  1KTQ A;  1IBM F;  1VQ4 S;  5LT5 A;  1N48 A;  3ENV A;  5BYS A;  4C8O A;  3QGI A;  1R0B G;  1Y5I B;  3RB0 A;  1YBU A;  1UWB B;  4I2P A;  3CCR S;  4Y65 A;  1T0T V;  1B3T A;  1PJ5 A;  1UL3 A;  4ZPW R;  3BO4 A;  1JJC B;  1GMV A;  1F9E B;  1R8H A;  4ZPA A;  4DMZ A;  5ITH A;  4IG0 A;  4HH0 A;  4FYW B;  1OY9 A;  2OKQ A;  3TVZ A;  3HSG A;  2Q66 A;  5K14 B;  4OI4 A;  3ILL A;  2ZH2 A;  4DR3 F;  3HHE A;  5CD4 A;  4D3H A;  4X4N A;  1F9H A;  4DQR A;  3DDN A;  4PAB A;  2FJA B;  4DS5 A;  5KG0 A;  1F60 B;  1M1G A;  4F4W A;  1WI8 A;  3Q23 A;  2XSJ A;  3BQ2 A;  3ILO A;  4XPE A;  1LW0 B;  4PWW A;  3QSI A;  1G7C B;  2VL1 A;  1W25 A;  1UFK A;  2ILZ A;  5KOX A;  2O5D A;  4E98 A;  4NLW A;  2QG9 B;  2EC2 A;  3EZ5 A;  3Q8P B;  2DH7 A;  2BAN A;  3ILJ A;  1WC0 A;  5CCL A;  5B7W A;  3VAF A;  1HNW F;  2ERR A;  3CF5 Q;  4C3L A;  1HWU A;  5ETN A;  5KTQ A;  3GFX A;  5HBM A;  1N0U A;  1IR0 A;  3FJ2 A;  4Q2M A;  5B0G A;  1DLO B;  5CAA A;  1RTH B;  1S9F A;  3ZNJ 1;  5HN0 A;  3PVX A;  3NCQ A;  3CCQ S;  3EYZ A;  3KTQ A;  4DPU A;  1N6Q B;  5F8J A;  2KL8 A;  4DL3 A;  2F8H A;  1WDD A;  2MMY A;  1VI7 A;  3J80 Y;  4OLO A;  5GAE U;  4FXD A;  3BKF A;  5HAN A;  4TN2 A;  4YS2 A;  3NOG A;  3W2V B;  2WAQ D;  3U1L A;  4DV4 F;  1H2V Z;  1IR1 A;  4EU0 A;  1U6Z A;  4CIO A;  1QE1 A;  2M3D A;  5L1I A;  5HI7 A;  3RU0 A;  1NPK A;  1TKT A;  3K5P A;  2GIF A;  3IN5 A;  4W90 B;  5KFV A;  1H7W A;  5CH7 B;  1KR4 A;  3KJN B;  3PX0 A;  5CYQ B;  5DG8 A;  3G2X A;  4QWD A;  2AX1 A;  1PYT A;  3BGU A;  4U95 A;  3WZ0 A;  1CS4 B;  3QJP A;  4JI5 F;  3AB2 B;  3A13 A;  1U0S A;  5GAE I;  4QCL A;  4ZCL A;  4CQ1 A;  2BOA A;  1BQX A;  2HG4 A;  2I5J B;  1BMQ B;  5AT1 B;  1KBR A;  1WHX A;  1RU1 A;  1YSJ A;  2UU9 J;  3KHR A;  2OML A;  4DV6 J;  5FDL A;  4DCO B;  1WJ9 A;  4IO9 Q;  3MUR P;  1IJF B;  3ZTS A;  4N5S A;  1RAH B;  1SJF A;  1RWW B;  1MWZ A;  1WOO A;  1VQ8 S;  4ZLN A;  2OHD A;  2K06 A;  3LAN A;  1D3W A;  1ZAV A;  1C0U B;  1HNZ J;  1SQG A;  2ASJ A;  4M5L A;  4DL7 A;  1K73 T;  4K5S A;  1VLY A;  2B5J B;  5I3U B;  1U49 A;  4R0E A;  2QLJ B;  3IS9 A;  2CWK A;  2CJ9 A;  1IKW B;  4HHJ A;  4CNZ A;  1LXN A;  5ETM A;  3D7S B;  5EX3 A;  3FSI A;  1FD8 A;  4V1A k;  2VOO A;  1YIJ S;  3ZZY A;  1TQL A;  4P2X A;  3NXZ A;  1VBX A;  4A48 A;  2CQP A;  4KO0 B;  1H0H B;  5AE1 A;  3AJD A;  5LJ3 Y;  3Q8V A;  2QV6 A;  5D0G A;  4NCB A;  4RKU C;  1FWK A;  4I67 A;  3DOK A;  4OI2 A;  3I82 A;  1KON A;  3HT3 A;  1RB0 A;  2CG4 A;  2YKQ A;  3UVJ B;  1S6P B;  2V4J A;  1N5T A;  2GCF A;  1T05 A;  2DEI A;  2Q1L A;  2CDQ A;  1Y11 A;  1UWB A;  2FGO A;  4DU7 A;  4CO2 A;  2EK6 A;  3T5K A;  4J90 A;  3Q8S B;  2LQJ A;  2IAJ B;  2FC8 A;  2GQC A;  2YVS A;  4J9Q A;  1JJ2 R;  1NK9 A;  2V50 A;  1F5A A;  2K7J A;  2KYX A;  4DR7 J;  2C3Y A;  5HVH A;  3AOC A;  2IYI A;  3MEE B;  4C0B A;  3ISN D;  4DV5 F;  3T3F A;  4LUB A;  5DS7 A;  2IC3 A;  3I9V 9;  1JLB B;  2PFD A;  4MJK A;  3K0J A;  2X1A A;  4DLE A;  3CCT A;  3GWC A;  5EN1 A;  3W7B A;  4FBU A;  2HWI A;  4U67 Q;  4RW7 B;  3FK4 A;  2CQ1 A;  2V67 A;  4ANC A;  2WON B;  5F3Z A;  4GKK F;  2X3G A;  4JI8 J;  1YWX A;  3KK2 A;  1HNI B;  2G13 A;  2COL A;  2F1F A;  5A0Y B;  2N7C A;  1DJ0 A;  1LW0 A;  2KHC A;  3Q22 A;  5C7P A;  3I5C A;  2AU0 A;  1TFY A;  1FTR A;  4HTI A;  1X4F A;  3R5J B;  4GVB A;  4UUX A;  2XY6 A;  3PZP A;  3TJA A;  3A8K A;  2AYB A;  4X66 J;  4B02 A;  4QYZ K;  3O1L A;  4Y2I A;  1B64 A;  4URQ U;  2VU5 A;  2OSR A;  3BF4 A;  2OPR A;  1VMB A;  1SIZ A;  3BBC A;  4JI2 J;  3MMC B;  3CXC R;  1KLM A;  4IKA A;  2DY1 A;  3WX8 A;  1CJT A;  4RW9 A;  4QR1 A;  4CT8 A;  1GMW A;  2FC9 A;  2OAU A;  2XUL A;  1JLA A;  1ZYQ A;  2VQE F;  2DPJ A;  2W7O A;  3MXH P;  4WTO B;  2HLU A;  1F5C A;  1PYS B;  3PEH A;  2M2B A;  2HWT A;  4WXO A;  3C16 B;  3TUJ C;  7AT1 B;  5HP1 B;  4HT5 A;  4W92 B;  3HVA A;  4QQB A;  1WKK A;  1N5Q A;  2QA4 G;  1RHK B;  1A6L A;  4RZR A;  1FJE B;  1HBO B;  1S49 A;  4I6W A;  4C0H A;  4Q8F A;  2ZKU A;  5GAG U;  1HHS A;  5B09 A;  3BSO A;  4YR2 A;  4DSJ A;  5F8H A;  4ZLL A;  2BE2 B;  2HZC A;  3UNG C;  3GMG A;  5IQQ A;  4NA2 A;  3MFI A;  4WYL A;  1FNX H;  2BKP A;  2ZDP A;  2PII A;  3W2V A;  3MD1 A;  3BDE A;  2HGM A;  1RBA A;  2FVQ A;  3DXB A;  2C2K B;  5A8W A;  2AEM A;  1HHT P;  2VOP A;  3B4D A;  3IWL A;  1B0T A;  1RUS A;  5KG6 A;  2AF6 A;  1FT8 A;  1PBA A;  3MGJ A;  5C24 B;  3OVA A;  2GQ2 A;  4HH1 A;  5CYM A;  4NZ6 A;  3DU5 A;  4UY8 T;  2DNR A;  1GXU A;  2UV8 G;  2CZV C;  1RTJ A;  2RQM A;  4OHZ A;  2XCA A;  1TUW A;  2Z0G A;  3CGI A;  2YQ1 A;  4MT1 A;  4JV0 A;  1BUX A;  1Y4Z B;  3NKY A;  2O1P A;  5IC6 B;  4N56 A;  4Q8E A;  4JOU A;  2A2C A;  2ZC4 A;  2R8J A;  5DET A;  2CPZ A;  3R5G A;  1RWO B;  1N4L A;  3J7A 1;  2VA3 A;  2OD4 A;  3S6E A;  2L41 A;  4ZPD A;  4WCE Q;  4KC5 A;  1X4B A;  3W9H A;  3MEC B;  4LF7 J;  1NK0 A;  4FXV A;  1ZAX A;  2J6T A;  3EDQ B;  4EMD A;  1EAR A;  5I3U A;  5D15 A;  2YNG B;  5CD4 H;  1TUV A;  2E7W A;  4ECY A;  4DJB A;  3KMS A;  5JUM A;  3MF5 A;  3OJU A;  3D6T B;  5D3G B;  3R3T A;  1XMQ F;  3FQL A;  3CD7 A;  3J80 U;  3CCJ S;  3EXC X;  4CO5 A;  2NXJ A;  2R8H A;  2EI5 A;  1JXV A;  1BHN A;  1NM2 A;  1VIS A;  4AT1 B;  3VF0 B;  7FD1 A;  3G82 B;  3LAL A;  1DTQ B;  4GMK A;  1DAR A;  2Q43 A;  1TV6 B;  3MZI A;  3RYL A;  3KOA A;  3RRK A;  1S5Z A;  3EVW A;  3JXO A;  4CO0 A;  2IM3 A;  5L1J A;  3HFZ B;  1UA0 A;  3KMQ A;  4OHV A;  1FNO A;  5HJY A;  3KHG A;  4ED5 A;  3JTN A;  1K0T A;  3DRS B;  3KUH A;  4USW A;  2MKK A;  5HO4 A;  3UVJ A;  5A2Q Y;  2BAC A;  2UXB F;  3MR5 A;  5B0E A;  2NPF A;  4U6P A;  2DH8 A;  4LT6 A;  3SCJ E;  1IWG A;  1YGY A;  4OHW A;  4IR1 A;  2HGL A;  4WYW A;  1AT1 B;  3MM8 A;  2DNZ A;  1MNE A;  4PG7 A;  3DNC A;  3KK1 A;  5HLF A;  4A8W A;  1PCA A;  1S1T B;  4ZIV A;  2Z2L A;  4TNO A;  2N7Y A;  3CCM S;  3JSR A;  3Q86 A;  4OYI A;  4J9K A;  2BBE A;  3DLL Q;  2G0I A;  2D7S A;  2O01 C;  4F4A A;  5KG5 A;  2M7S A;  4BS2 A;  3VTI A;  3DMJ B;  1VHI A;  3BKT A;  1IM6 A;  3UDL A;  5CQG A;  3HF5 A;  2WZ1 A;  3POT B;  2RS2 A;  4YB5 A;  3TOQ A;  3CC4 S;  4IRC A;  2ZH3 A;  1RAF B;  3ITH B;  2Y8Y A;  1PIE A;  1RT6 A;  4R5P B;  1U48 A;  5KT5 A;  1M0S A;  3NOC A;  2JVR A;  4ZP7 A;  2ZD1 B;  3OSN A;  2W7P A;  3WIU A;  3SIP B;  1DZ5 A;  3RW7 A;  4B3T F;  3MM7 B;  1HA1 A;  3V5R A;  2CWX A;  2YNF B;  4QIF A;  3RG6 A;  4FXW A;  1EAY C;  2PSZ A;  2HZA A;  1FEH A;  3RTV A;  2XY7 A;  2HBQ B;  3I0R A;  2I6W A;  3QT5 A;  2EFP A;  3QO9 B;  2KT5 A;  2VFU A;  2XTJ P;  2R7U A;  4J9N A;  3V6J A;  1CSJ A;  4X4S A;  3EGW B;  5KT4 A;  5GMK a;  1IKY A;  3PCO B;  5HP1 A;  3GCW P;  2YNI A;  3CB4 A;  4WF9 Q;  1NSQ A;  2C3U A;  4RBT A;  1HBO A;  2HQD A;  2YWE A;  4KR0 B;  4TU8 A;  2ZJQ Q;  1VQP S;  4RBU A;  2AJQ A;  3HO1 A;  1V3Z A;  2DK2 A;  2GVD A;  4K5R A;  4MFB B;  1I1G A;  2YX7 A;  4NRT A;  3A3P B;  2QLW A;  3OR1 A;  1U1L A;  2LVW A;  3NS6 A;  1X4D A;  2WVB A;  2XHW A;  1X7V A;  3VAG A;  1X0F A;  2KH9 A;  3B4M A;  4LFC J;  3OW2 R;  3PW4 A;  3AOA A;  1UZH A;  4QYZ J;  2KJW A;  3TI0 A;  1WNE A;  3NWR A;  4UQT A;  1C2P A;  2I38 A;  1IUJ A;  4KT0 C;  1WHV A;  2CZ4 A;  2FVS A;  2YNH A;  3BS9 A;  4X65 J;  3QRP A;  3CED A;  2HHV A;  2D74 B;  4USI A;  4RO0 A;  4ZHR A;  3GYN A;  4IFV A;  3F0N A;  1NKC A;  4G1I A;  3CCS S;  4AND A;  4OZ1 A;  2UU9 F;  4O3O A;  4ILL A;  1AFI A;  1IBC B;  4NLD A;  2BJ7 A;  4NMX A;  4XDD A;  2XMU A;  3H2U B;  4FVC A;  3W8G A;  3CDE A;  2W2N P;  3V6D A;  4CLL A;  1YTY A;  5CAB A;  1R8B A;  4WE1 A;  5ETL A;  4O3N A;  2LXU A;  4RBV A;  2KXN B;  1WOR A;  3RW6 A;  2KN4 A;  2RU9 A;  2J7U A;  2HMI B;  5L38 A;  2NUH A;  2RQK A;  2WRM A;  3BN7 A;  3MPU B;  4UZB A;  4OYM A;  2D9P A;  2K8G A;  1UJ6 A;  1Z4U A;  1YJU A;  5FJ4 A;  3OVB A;  1S1X B;  4MAK A;  1KOO A;  2P9E A;  3AA9 A;  1JLE A;  2R2T A;  3VGV A;  2OPS A;  1KDN A;  3NGK A;  3MED B;  1XWL A;  2VKZ G;  2J76 E;  3MM5 A;  2PDA A;  7FDR A;  1LK7 A;  2GNK A;  5HVG A;  5F8I A;  4X64 F;  1M5H A;  4XIU A;  1HYS A;  2DNP A;  3U7J A;  4C3M A;  2RRN A;  3LH2 S;  4IG3 B;  3HSJ A;  5KG4 A;  1J2V A;  4CT9 A;  4LIR A;  2QYC A;  2W9B A;  2MQM A;  4V19 X;  3KNG A;  3KJV A;  3T1Y J;  1QUV A;  3PJW A;  1BXN A;  3A4T A;  4LF8 J;  2JJ4 D;  4DR7 F;  1HQU A;  3BM7 A;  3HLU A;  3HZG A;  1RK8 A;  4NYO A;  4HI2 A;  1IR2 A;  1UPM B;  1ZET A;  3UCU P;  3O3L A;  1N32 J;  2XEX A;  4USK A;  3CJ8 A;  4LBI A;  5KFK A;  2B4V A;  1Y3K A;  2CPX A;  1VC6 A;  5LXR A;  4UW2 A;  1G4C A;  2C3M A;  1I94 J;  4IDK B;  5F8G A;  3DRX A;  4K4Y A;  4JI8 F;  4HEA 9;  4C8N A;  1U1P A;  4DSK A;  3DMJ A;  1OPZ A;  5DGA A;  4WZQ A;  3TZZ A;  3OL7 A;  5DM6 Q;  3VZI A;  2OEK A;  3TVY A;  3LP2 B;  4OX9 J;  3UNY A;  3AXK A;  3ITH A;  3R2C J;  2BE7 D;  3CCV S;  3W5Y A;  4R5P A;  1SI9 A;  2FJE B;  3I4P A;  2JEJ A;  3M2U B;  1ZPW X;  2BA9 A;  4X66 F;  3IR6 B;  3BEG B;  1S97 A;  3EZU A;  1G3O A;  1H6K X;  2ZD1 A;  4FP9 A;  3HVW A;  3QNW B;  2EFG A;  3OL9 A;  2G2Z A;  2PMH A;  1YJW S;  3QJL A;  4JI2 F;  3JYT B;  2BUN A;  1J27 A;  3PR5 B;  2XGP A;  1EET B;  3MFH A;  1VIX A;  4C2M A;  4ZP8 A;  2BZ2 A;  4PUO B;  4FNH A;  1RDR A;  2HW3 A;  4PEO A;  4L72 B;  3BQ1 A;  5A2Q U;  2AZ3 A;  3D9B A;  5T14 A;  1V3R A;  3VWS A;  3P3D A;  5CZV A;  1U8S A;  2YKM B;  2XS2 A;  1T03 B;  5D77 A;  4ZVT B;  3GR0 A;  1SC3 B;  1RWP B;  2QIF A;  1HMV B;  5HAT A;  2HVD A;  3LW5 C;  3WHI A;  3OFE A;  2JEF A;  1SL2 A;  1YKW A;  4MFB A;  1CC7 A;  1OSD A;  4P9S A;  2DNG A;  4NWB A;  2J6S A;  4G6V B;  2GS8 A;  3MTJ A;  3WX4 A;  2B9X A;  4JV2 A;  1FF2 A;  1L3T A;  2R8G A;  5HMY A;  3HHD A;  2WSF C;  1GH8 A;  2VFV A;  4PYA A;  3TAM B;  1C0T B;  1FRK A;  2IFX A;  2OPQ B;  4OHY A;  1A0O B;  4UTG A;  2IY5 B;  1RTI A;  1SUQ A;  4I64 A;  5A8R B;  4NXN J;  1JJH A;  2AD9 A;  1U1N A;  2F8E X;  3QT7 A;  4RWX A;  4DCP B;  2ZH1 A;  2BW2 A;  5LOQ A;  3T41 A;  4KTQ A;  4LSN A;  4TQR A;  2ZH6 A;  3WC0 A;  4F8R A;  2B7B B;  3NL0 A;  2E1A A;  4P52 A;  3CNQ P;  2ZH9 A;  4AXJ A;  3UN3 A;  4WFN Q;  2ASL A;  2FLP A;  2CPF A;  5JVG Q;  2HVI A;  4TVA B;  3BSA A;  3D0G E;  4MTP A;  4LF7 F;  4RNO A;  1FDD A;  2AKW B;  3EJM A;  3T1H J;  1SKW A;  1VOM A;  3EZO A;  5GAD U;  4AXI A;  1FXD A;  1N5S A;  3NEK A;  3UDE A;  1Y00 A;  3CMQ A;  2UXC F;  2HK3 A;  1DBD A;  1G6B A;  1IM4 A;  2MTL A;  3KNA A;  3QJJ A;  2NXC A;  3W62 A;  3RRH A;  3J81 Y;  3E51 A;  2RD5 C;  1D8Y A;  4DUY J;  1S1X A;  4YFU A;  4LF2 A;  2G4B A;  3R1H A;  1P9Q C;  1RIS A;  4ED7 A;  3D1Q A;  3W8P A;  3R2D J;  3D3B J;  4G1Q A;  2XQC A;  1OWX A;  2VG5 A;  5GAD I;  5E2Q A;  3MR7 A;  4OJH A;  4LFA J;  4IH6 A;  3CJT A;  2VIH A;  2MJU A;  2LXI A;  2L3M A;  3PX6 A;  3AQP A;  2ZBI A;  3ILI A;  2GJF A;  4IG3 A;  5GAH U;  1TL1 B;  3BPS P;  4RWW A;  3D4J A;  4L73 A;  5GVQ A;  4DFJ A;  2FGC A;  4TYA A;  3BO3 A;  1MRO A;  1QAJ A;  2F5G A;  1WG5 A;  3KDN A;  4PKD B;  5G4D A;  1NUE A;  3QBC A;  4K7Q A;  4HT7 A;  1OS5 A;  1XER A;  3OXL A;  4WFZ A;  3R5B A;  3V2U C;  2L48 A;  2BJ8 A;  3H42 A;  1WG4 A;  2QL9 B;  4XDC A;  2N3L A;  3LPY A;  4DN0 A;  2GMH A;  5KFL A;  2ZH4 A;  3CDU A;  2VQF J;  3SFG A;  3G6X A;  2X1B A;  5GAH I;  2XMT A;  4Y3C A;  3VGS A;  1RJJ A;  1FK9 A;  4FNI A;  2DIV A;  2E1P A;  1S48 A;  2E66 A;  1SIW B;  4I2Q A;  1E6Y A;  3PX4 A;  2RKI B;  3HT0 A;  4L6V 3;  5E3A A;  3LP2 A;  3H40 A;  1NH8 A;  1RT4 A;  2KKH A;  3OTO J;  3HMJ G;  2E1M C;  2B43 A;  4P71 A;  3UR0 A;  2P6T A;  3RBD A;  5K8P A;  1QTN B;  1YRT A;  4D3G A;  3M8P A;  4KHR A;  4JBC A;  3MTK A;  4NLT A;  5DGB A;  2WTF A;  3SCK E;  2R4F A;  1UVL A;  2GIR A;  1ZM9 A;  2R9L A;  3LA0 A;  1O8B A;  2YH0 A;  2V69 A;  4ELV A;  1BWE A;  1UFW A;  3PDN A;  1FKO B;  3PKM A;  3DM2 B;  2R2R A;  4NLP A;  2VDH A;  4J37 A;  2W9C B;  3OXG A;  4MKY A;  3MM6 B;  3FDS A;  3N5B A;  3PW0 A;  4USH A;  4IOB A;  1UJ4 A;  2FDN A;  1RHJ B;  4ZVU B;  4K0K J;  1NB2 A;  4CM2 A;  3VV2 B;  1A9N B;  3CJ2 A;  5K5M A;  4ECR A;  3FBE A;  4JV5 J;  1NJW A;  2CNN B;  3GFH A;  4LBH A;  5JXS A;  4ZN3 A;  3CD0 A;  1OJ4 A;  2R42 A;  4DV3 J;  1NK6 A;  1R0A B;  1KC8 T;  1KSP A;  3CIM A;  1QSL A;  2ZDO A;  4NXM F;  4LFC F;  2VF3 A;  4J9R A;  2DGU A;  5HRO A;  3L3C A;  1JWW A;  3W63 A;  3GV7 B;  2W2M P;  1F1B B;  1WF1 A;  2CQC A;  3D5M A;  5KFN A;  3T5L A;  2G2Y A;  4PWD A;  5LMN J;  4X65 F;  1XNR J;  3DI6 A;  2NXN A;  3CCL S;  3SQG A;  1FKP B;  4ZN1 A;  1UW9 A;  1UTA A;  2A6O A;  5A8R A;  4WU2 A;  1I6J A;  3PIP Q;  4PG4 A;  5J2M B;  2JHE A;  3UO0 A;  4DR4 F;  1EX8 A;  1FNM A;  3KFW X;  1Y5L B;  2V2K A;  2NZ4 A;  4OFZ A;  1C1B B;  2ZVS A;  4I68 A;  2R7V A;  2ZH7 A;  1KD1 T;  1DTT B;  3H4B A;  2XC9 A;  3TJ9 A;  1TL7 B;  4KHP J;  1WC4 A;  1D9D A;  1X4H A;  2FJB B;  3K5N A;  1H74 A;  3V81 B;  1N5Y A;  1U24 A;  3M9O B;  2HQ3 A;  1RTD B;  4EFA C;  2J9C A;  2RUS A;  1EJ7 L;  4OYZ A;  2MZS A;  3MEG A;  4ZCI A;  2ZZT A;  3I0S B;  3IM9 A;  4C0O C;  2AMC B;  4PQU A;  4U8V A;  3IWN C;  3MAA A;  2AQ4 A;  1GTH A;  5SZT A;  3QAU A;  4I69 A;  1TVR B;  2MLZ A;  1LXJ A;  2M8D B;  3QSY B;  4L3K A;  2W01 A;  5KT2 A;  1EIY B;  1VQO S;  3CDW A;  1T7P A;  2CJA A;  2X7I A;  4F4Z A;  1FJG F;  1Y9O A;  4ZP9 A;  2XLI A;  2YKP A;  2Q79 A;  3Q8U A;  1SQF A;  4HHH A;  2O3D A;  4QIE A;  2HHH J;  4X4R A;  1U2C A;  3BR8 A;  2DCU B;  2H65 B;  3EPG A;  2CG8 A;  3K8V A;  3KLG B;  5DDQ C;  1LWX A;  3THV A;  4J9V A;  4I7F B;  3Q8R B;  1RCX B;  3C6U B;  4O4G B;  2WSC C;  5DLG A;  1OSC A;  2DD8 S;  1PAU B;  1S79 A;  2AT1 B;  3T1Y F;  1V9O A;  1TKZ A;  4NI2 A;  3EUN A;  4B3S J;  2AYG A;  3X3U A;  2BMB A;  4LF8 F;  4CTA A;  2HVH A;  3RR8 A;  3UN5 A;  1U0H B;  3W9J A;  1ZA1 B;  4UZC A;  2GO9 A;  2KRB A;  2GJI A;  1S9G A;  3DLH A;  3OFH A;  2MZ1 A;  3CJR A;  5F9L A;  3TNV A;  1SKR A;  5CZX A;  3BGR A;  1I94 F;  1VRU B;  3KLV A;  1RT3 B;  4B9V A;  1JLF A;  2VAS A;  1FWL A;  5K8N A;  5J1E B;  3G87 A;  2DXD A;  1RT5 B;  3M30 B;  4RW4 B;  3SMZ A;  1S1V B;  1APS A;  3DLE B;  4GKJ J;  3AOD A;  1D8Z A;  4FYV B;  3QLH B;  1HBU B;  3HVT B;  3DLG B;  4OX7 A;  4OX9 F;  2CPE A;  2FZK B;  4HLB A;  2W9A A;  2AW0 A;  1S4E A;  1IQT A;  4DZD A;  1UKU A;  2DHH A;  4JUZ A;  1SPB P;  4H4M B;  1OQ6 A;  4B9M A;  2ATC B;  3SI8 A;  3QIP B;  2DR5 A;  2CKW A;  2DNN A;  4YEA A;  1NCL A;  3MEK A;  3RZA A;  2MDA A;  4CNY A;  3OFG A;  2B4U A;  2PE8 A;  2F7V A;  1WKL A;  1HFE L;  3G6V A;  4DV0 J;  2J6U A;  3MD3 A;  4JI7 J;  3D0I E;  2IM2 A;  4EUV A;  3L09 A;  2A3J A;  2CZ9 A;  2Z4P A;  3IP0 A;  4LQ9 A;  1G1X A;  2LEP A;  3G6Y A;  5KFI A;  3PW2 A;  2LLZ A;  3L9Z A;  3GSD A;  3NS5 A;  1NME B;  2W9C A;  4M1K A;  4MYU A;  1SBR A;  3BH7 B;  3J7Z T;  4MKV A;  1WEX A;  1YG0 A;  2AV5 A;  4MIB A;  4WZM A;  1HBN A;  5ETP A;  5HQL A;  2EWH A;  2X51 A;  5LSO A;  2ACM A;  2JEG A;  1UVK A;  4F3M A;  3G4S S;  4KGK A;  4DV2 J;  3TZX A;  3RB3 A;  5BJR A;  2MQP A;  2V0N A;  2YX4 A;  4CI0 B;  3NBP A;  1S76 D;  1CJV A;  3CC2 S;  1RT2 B;  3R7B B;  4K4V A;  2HAF A;  3DGP A;  2KDO A;  1C1C B;  1TKX B;  2M52 A;  3H5S A;  1WAC A;  3JAM Y;  5SUH A;  3M8W A;  4IOC Q;  1N88 A;  2JC1 A;  3FRY A;  1VS3 A;  4DL4 A;  3ZZT A;  1F5B A;  4Y6I A;  1KOH A;  4NXN F;  4Q43 A;  1CUL A;  1VQ5 S;  1U2R A;  1N8R T;  4J91 A;  2VV5 A;  2ZHA A;  4BCA A;  3IRX A;  4I6Y A;  2CYY A;  3NGD A;  2OTJ S;  3HHL D;  1MU2 A;  5J2M A;  3ZNU A;  5D6G A;  2B4O A;  1QAX A;  1RLC L;  3MMA A;  2RRA A;  1B99 A;  3B8H A;  3PRB A;  3UQS A;  2PFF B;  1RAJ A;  2DR8 A;  2FIU A;  3M9N B;  5EWG A;  2XB2 D;  1AB8 A;  3C15 B;  4FF2 A;  3AJ2 A;  2XMK A;  2KT2 A;  3T1H F;  1RAE B;  3JSY A;  2UV8 A;  3EGV A;  1TR0 A;  1MN9 A;  3V81 A;  2AYM A;  3HFV A;  3RJM B;  4F67 A;  4LRB A;  4PXE A;  4KAI A;  2D69 A;  2QGF B;  2LDY A;  2P8I A;  3DU6 A;  4AD6 A;  5A76 A;  4MIA A;  5D4N A;  4HYK A;  2HHP A;  4DUY F;  3R1L A;  2ROG A;  2K7K A;  3FMB A;  5IT9 U;  1YJN S;  1NKB A;  4NL5 A;  3QRR A;  3R97 A;  3DFE A;  4U96 A;  4K50 A;  4EYI B;  3K59 A;  2DB1 A;  3LGN A;  3BJY A;  4LFA F;  2PEH A;  2IA6 A;  3K7R A;  2H54 B;  4WFX A;  2IHR 1;  3ZZO A;  1XR6 A;  4PAA A;  3VAJ A;  1QJH A;  3K5M A;  4OV1 A;  2M88 A;  1NZ8 A;  1U09 A;  3OUY A;  4FF4 A;  2DNO A;  3NNH A;  1XQI A;  3TAN A;  2NR0 A;  3BV8 A;  3CCZ A;  2BYC A;  4ES2 A;  1PC4 A;  1VGY A;  1KVK A;  5J2N A;  1U45 A;  3GTY X;  5KT6 A;  3PTW A;  3QMQ A;  1QAY A;  1UA1 A;  2H4W B;  1U0H A;  1X60 A;  1SQE A;  3NGU A;  4N76 A;  3RB6 A;  4KGZ B;  3S1T A;  1ZZF A;  2DRA A;  5DZ7 A;  2VKR A;  2VIC A;  3BGO P;  4OI1 A;  2VQF F;  3EWG A;  1EP4 A;  4Y34 A;  4ES3 A;  1HLW A;  1Q8B A;  1LWE A;  3ICL A;  2HHQ A;  1RT3 A;  2DNK A;  3T19 A;  5J1E A;  4A4J A;  3QWP A;  1RT5 A;  3M30 A;  1RWU A;  4L74 A;  4OYO A;  5KFM A;  2AEF A;  1NDL A;  3DLE A;  3LPE A;  1T3N A;  3JSM B;  2XM3 A;  5E33 A;  3IA0 A;  1VQL S;  2MLX A;  3OTO F;  3E8O A;  2DHG A;  1DY3 A;  1J5O B;  1IWA A;  1RGV A;  1AZS A;  2DBB A;  2RDJ A;  4AL5 A;  1S77 D;  4YN3 B;  4H4M A;  4ZK7 M;  1M1H A;  2MKI A;  4I2P B;  1HD1 A;  4YY3 J;  3QIP A;  4OZ0 A;  4NLQ A;  1UFL A;  1KFD A;  4CYU A;  5KFQ A;  2VZ9 A;  3NGR A;  1Q0N A;  2IDE A;  1LFW A;  1G2E A;  3M6U A;  5E7O B;  5KG1 A;  1RT1 A;  4LBP A;  3WC2 A;  4OI6 A;  3KLI A;  4KPY A;  1O0P A;  4LF6 J;  3DLK A;  3C46 A;  3QAT A;  1SVD A;  3DGV A;  2LQ8 A;  2UVU A;  2VPW B;  3DC2 A;  3PYG A;  5K8O A;  4PPZ A;  4OYB A;  3IO1 A;  2D9O A;  4X4Q A;  5F0W A;  2R7X A;  2IM1 A;  4QU7 A;  2JX2 A;  2CQD A;  2SXL A;  3A3N B;  4LF9 J;  3DRP A;  3QYY A;  1LWC B;  2I2Y A;  1MG7 A;  2XSJ B;  5IQ6 A;  4OV6 A;  4AQY F;  2V8H A;  2ASD A;  1S99 A;  5C2G A;  4DL6 A;  2FVR A;  2CQH A;  2KYZ A;  3CJ5 A;  2RE1 A;  4HR2 A;  4NRU A;  2Z2Y B;  3BYP A;  1QTM A;  2DGQ A;  1TKX A;  2FHJ D;  3IBF B;  2BAN B;  2IYG A;  2OGU A;  4IUF A;  4AFF A;  5J2P A;  1AW0 A;  2KB2 A;  1XNR F;  3JQJ A;  3UI3 A;  4CO1 A;  2WW4 A;  3EE3 A;  2HFZ A;  4KH1 B;  2EKN A;  2CJY B;  1UAW A;  2VFS A;  1U6F A;  2RB7 A;  5DDP C;  3G71 S;  5HBM B;  2FLN A;  1KFS A;  1XIQ A;  3JSB A;  1FFS B;  3QFW A;  1RA6 A;  2CUY A;  4JYA J;  5DJB A;  1WTF A;  3IBC B;  4WII A;  4TY9 A;  2ZH5 A;  2WB1 D;  5KFF A;  1YBT A;  3H2L A;  2Y1L B;  4EGL A;  5KG7 A;  1WEY A;  4KHP F;  1JXL A;  2GX8 A;  2QC3 A;  2AEJ A;  4Y2M A;  2Z56 B;  4YR0 A;  2APO A;  5KT3 A;  5EUH A;  3GLJ A;  4QU6 A;  3CVK A;  1QE1 B;  5HMX A;  4NA1 A;  2JFK A;  4ZVQ B;  1TKT B;  3FMW A;  3RBX A;  1WSV A;  1O51 A;  2MQO A;  2QX0 A;  2KG0 A;  1NSA A;  3T6J A;  2FUG 9;  2M70 A;  2OSQ A;  1UCN A;  1QVG R;  1E6V A;  4PXD A;  3B54 A;  1OPI A;  2BM1 A;  4CLY A;  3IR7 B;  2HHH F;  1JLC A;  1UMJ A;  1I3O B;  2LEC A;  3VGU A;  1X5O A;  1NK7 A;  2LA6 A;  2J0X A;  2FTR A;  3MR2 A;  6AT1 B;  1UP1 A;  3MCM A;  2I0X A;  2QSW A;  1TP7 A;  2P6S A;  5FDL B;  3BSN A;  5IT0 A;  1B7Y B;  1JX4 A;  1YQH A;  4PG5 A;  3I9Z A;  1M5P C;  3AQO A;  1HPZ A;  4WKR A;  2N4D A;  2X3D A;  2OLW A;  3J7Z 5;  2E29 A;  3PIO Q;  1IVZ A;  2WBR A;  4DQQ A;  3LP0 A;  4GC7 A;  4TU7 A;  1GXT A;  4KGX B;  4OYW A;  1RHR B;  4NZ7 A;  3HDS A;  3IS9 B;  4OYA A;  1S57 A;  2BJE A;  2DGX A;  2HQG A;  5F9N A;  1H2T Z;  1X31 C;  1Q1K A;  2V68 A;  4C4W A;  4M5G A;  4OZJ A;  3H5X A;  1UEK A;  4CO4 A;  1FRJ A;  2DNM A;  4KGV B;  1Q5Y A;  3AHP A;  4IYQ A;  2VPY B;  3NLC A;  3TEH B;  2KVI A;  4NZ0 A;  4JI3 J;  2QJ3 A;  5B0F A;  2KG1 A;  2GGP A;  2K3K A;  1B0P A;  2R3V A;  3F41 A;  2G1D A;  3DOK B;  1QVF R;  4LJM A;  2VG7 A;  3MMB A;  2XHC A;  4OX6 A;  1KP6 A;  1WEZ A;  2FYX A;  5KFS A;  1SC1 B;  1YX2 A;  2QT7 A;  1HQE A;  1J5O A;  2V4J B;  2FLO A;  3M6X A;  1T05 B;  4LVN P;  2NLW A;  2QLX A;  1R7I A;  3EIC A;  1R31 A;  4G3I A;  3D54 A;  4IH7 A;  2DCL A;  1HIY A;  3EPI A;  1OQ3 A;  5L1K A;  4DV0 F;  4JI7 F;  1MLA A;  4M5H A;  5AJ3 J;  1NEE A;  2B8Q A;  2DY9 A;  3MPY A;  1NLK L;  2J9E A;  1GK8 A;  3DN9 A;  3AFG A;  1TAU A;  3BGL A;  4ED1 A;  1XNQ J;  2MGZ A;  4RR5 A;  2DKO B;  2IMW P;  2IC3 B;  2KXH A;  4V19 J;  3ELH A;  3AD7 C;  1N33 J;  1M5S A;  1R6Y A;  4C48 A;  5KFO A;  2M8H A;  3UWT A;  3GJT B;  3H5Y A;  1M1K T;  5DDO C;  4QWA A;  4OX8 A;  1NDC A;  4CM0 A;  1MSW D;  1LW2 A;  1FKA F;  1M5K C;  3KK2 B;  3QRQ A;  2ZJR Q;  1WD6 A;  1LWC A;  5EWF A;  4KHM A;  4GO5 X;  4AL7 A;  3NAI A;  2AJ0 A;  4BC9 A;  3GJQ B;  4YOE A;  3PEJ A;  4ZVF A;  3QGG A;  4Q7A A;  3FKB A;  4GVB B;  4RUH A;  2XWX A;  3D1O A;  1C4C A;  2VDI A;  4DR1 J;  3GIL A;  5L9N A;  5EGY A;  1NJZ A;  3ENW A;  1Q8I A;  2ASY A;  3D6H B;  1BQM A;  2B9E A;  2OPR B;  1KLM B;  1CJT B;  4RW9 B;  3I96 A;  1B70 B;  2XNQ A;  4USV A;  3W2W A;  1JLA B;  5K20 B;  4X4O A;  2HHU A;  2UUB J;  3TJ8 A;  2PN6 A;  2IMO A;  3M1V A;  2EG2 A;  4WWS A;  1CC8 A;  5JVH Q;  1VCT A;  1U7L A;  3WDO A;  2MKH A;  3RUB L;  2C2M B;  1OYE A;  4DR2 J;  2P9C A;  1NK8 A;  1D0E A;  1AUS L;  5A8W B;  2C2O B;  2RUG A;  1X9W A;  3GYG A;  2LFV A;  3ZTP A;  3PO4 A;  4NLG A;  2Q6B A;  4DV7 J;  3M32 A;  2BQ3 A;  2MEW A;  3AXM A;  5CYM B;  2EFO A;  2DHA A;  4QWB A;  1RTJ B;  2HKE A;  2MQL A;  2B8P A;  2KJV A;  1R6V A;  3M8Y A;  2P9G A;  4JI0 J;  3CDA A;  1X9S A;  1HNX J;  3GJS B;  3N5F A;  1YK9 A;  3G96 A;  3HXM A;  3BYR A;  4DUZ J;  1XR7 A;  4ECQ A;  1S7H A;  3I56 S;  3Q24 A;  2AJ2 A;  5A6W A;  1WC5 A;  3R27 A;  4A8Y A;  2BKN A;  3DOL A;  1RWV B;  4C8M A;  2E7V A;  2B9W A;  6FDR A;  3O2I A;  5FII A;  1CBK A;  1F6T A;  1K47 A;  2MB0 B;  5IFM A;  2GMJ A;  3N6M A;  3ZTO A;  2M9K A;  4M5D B;  2RNE A;  2V63 A;  5U47 A;  1Y10 A;  4DR5 J;  4XAK A;  4DFM A;  3QZ7 A;  3HD2 A;  1GNK A;  1DQ9 A;  4HTJ A;  2R2S A;  3EDR B;  4P6Q A;  1CJK A;  3MUT P;  5DQG A;  2A18 A;  4F2R A;  1YRX A;  3ZZP A;  3UDV A;  3FBB A;  4MK7 A;  2HND A;  4DHV A;  4DWI A;  3OTE A;  4I0W A;  1D9A A;  2H5J B;  4DFP A;  3GB0 A;  1ZM4 A;  4DL2 A;  2CQ3 A;  2F8M A;  4P74 A;  2PMZ D;  1SL1 A;  4ZPV R;  2MQ8 A;  2GFF A;  4DSE A;  2GA7 A;  4YY3 F;  2IVM A;  2JLG A;  5E3P A;  3R7S B;  4HL9 A;  4DL5 A;  3GP9 A;  4ZPB A;  1O5J A;  2W24 A;  3BN4 A;  3WQP A;  1WOS A;  1EHW A;  1TUG B;  3MM8 B;  2HSE B;  4LF6 F;  3KK1 B;  5HLF B;  1IJE B;  3TA1 A;  2VJV A;  5LMU J; 
#chains in the Genus database with same CATH homology
 1RU1 A;  3HD2 A;  3ILO A;  3MCM A;  1F9H A;  1IM6 A;  3HD1 A;  3HT0 A;  5ETN A;  5ETM A;  4M5N A;  1RB0 A;  5ETV A;  3KUE A;  5ETL A;  3KUH A;  1RTZ A;  1G4C A;  2F63 A;  3HSD A;  3KUG A;  1RAO A;  1TMM A;  2QX0 A;  3MCO A;  1HKA A;  4M5L A;  4M5M A;  5ETT A;  5ETP A;  5ETQ A;  4CWB A;  4F7V A;  4CRJ A;  2CG8 A;  3ILJ A;  1EQM A;  1EX8 A;  1HQ2 A;  4M5H A;  3HSG A;  3ILI A;  4M5K A;  4PZV A;  4AD6 A;  5ETS A;  5ETO A;  1DY3 A;  4M5J A;  4CYU A;  1RU2 A;  2F65 A;  3HSZ A;  4M5G A;  3UDE A;  3ILL A;  4CYU B;  1EQ0 A;  2BMB A;  1TMJ A;  3HSJ A;  1Q0N A;  3QBC A;  4M5I A;  3UDV A;  3UD5 A;  5ETK A;  3MCN A;  5ETR A;  3HCX A;  1KBR A;  3IP0 A;  1CBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...