1EQ0A

Solution structure of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with mgamppcp
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 6-HYDROXYMETHYL-7,8-DIHYDROPTERIN PYROPHOSPHOKINASE
publication title Unusual conformational changes in 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase as revealed by X-ray crystallography and NMR.
pubmed rcsb
source organism Escherichia coli
total genus 20
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2000-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1eq0A00
3KUGA 4M5NA 5ETSA 1F9HA 5ETVA 4CWBA 1HKAA 3ILJA 3HSJA 3ILOA 4PZVA 3MCMA 1RB0A 3UDEA 4M5LA 2CG8A 3IP0A 4M5JA 5ETPA 4CYUB 3ILLA 1Q0NA 1RU2A 4M5HA 4M5KA 5ETNA 1EQ0A 1RU1A 2QX0A 3HT0A 4M5MA 4CYUA 2BMBA 2F65A 3HD1A 3ILIA 5ETQA 4AD6A 5ETLA 4M5IA 3UD5A 4F7VA 1CBKA 3KUHA 3UDVA 3HSZA 5ETRA 3KUEA 1TMMA 3HCXA 1RAOA 4CRJA 2F63A 5ETMA 3HSGA 4M5GA 1EQMA 1KBRA 1RTZA 3MCNA 5ETOA 1DY3A 1EX8A 1HQ2A 5ETTA 5ETKA 3MCOA 3HD2A 1G4CA 3HSDA 3QBCA 1IM6A 1TMJA
chains in the Genus database with same CATH superfamily
3RGIA 2IVYA 2OPSA 1FCAA 1YJ9S 2I5JB 4F8RA 3QWUA 2LP4A 2GVDA 3BO3A 1S1XB 1S49A 2NXJA 4TLRA 1IQTA 1HLWA 5D8HB 1FERA 5J1PA 2CVEA 2F4VJ 4P75A 2QO3A 4OI0A 4ED7A 2W7OA 2DEIA 4KC5A 4ZIVA 3W9JA 3T9ZA 3PHEA 1RAGB 2ZC3A 2VB6A 2CDRB 3KLHA 4KH1B 4NA1A 2A6OA 4B9NA 1Y5NB 3OTDA 4MK8A 5AE2A 2M52A 4NYOA 1NEEA 1Q5VA 3MCNA 2HLUA 4DCOB 1RWPB 4C2MA 4LQ3A 4C0OC 1K1SA 4Q45A 5E33A 3GB0A 2RD5C 4KIAA 1NSPA 1TKTB 4P52A 1HR0J 3NNCA 5FLXY 2PFFB 4RR5A 5E7OB 2R7XA 4L74A 1U0HA 3CMES 2OEKA 4YS2A 1BQMA 3C6UB 1IKXA 2QN6B 1JLGA 3N79A 3AD7C 4I67A 1X9WA 4P2FA 3UWTA 2BJ1A 2DNOA 2DIVA 1QVFR 3EJMA 4FYWB 1SUQB 1RA6A 2MHEA 2XLKA 3DLBA 4CWBA 3RAXA 5KFKA 5CYJA 5KFHA 2CPEA 4LMZA 1N33F 2I1RA 3D6TB 4ELTA 1RWWB 4R8UB 1FTRA 3RUBL 1S5ZA 2U2FA 4I2PA 3MPYA 2H4YB 4F3MA 4C48A 4DFPA 1M0SA 3KDNA 1UMJA 3LALA 1U1KA 1YTYA 1JNRB 2AIRB 1P6TA 2XNQA 4BWMA 2R8HA 3Q86A 3OL7A 2OPRA 3C6TB 7FD1A 3MPVA 1CJTA 2GNKA 1JJ4A 1NHKL 4CH0S 3HDSA 4RUCA 4MMOA 4CLLA 2DY1A 2QL9B 4AFFA 4CT8A 3MECB 5D6GA 4DV3J 3D4JA 2C3MA 3MURP 1VQSA 4J9NA 4NLTA 5F9NA 3R7SB 3NGSA 3O3LA 4YUDA 2HZCA 4O0NA 3PYEA 1CULB 2VBZA 1CC8A 2VIHA 1ZS6A 3ZZZA 3KJFB 3K2YA 4NZ7A 2AJ4A 3LAKA 4B9SA 3H8YA 1I94J 4X65J 4BC7A 3EVWA 4PQUA 4ZJLA 2ZH2A 2IFXA 5DZ6A 2DGVA 9ATCB 3IM8A 3IRWP 1OY9A 2W7PA 3PW2A 3RW7A 3LGNA 4LF8F 3PACA 3CSKA 2FVPA 2H5JB 4J7CA 2VFTA 2R7QA 5F3TA 2DK2A 4JP8A 1YBTA 4NXMF 3H5XA 1QY7A 3CDEA 4MJKA 3TWZA 4LF7F 5E41A 5KFCA 2L9DA 5EN1A 1CQMA 1NSQA 2JSXA 3HVTA 3KLIB 2IBOA 2GHVC 1FE4A 4DI6A 2D69A 3GILA 4C3KA 5J2MA 1V5VA 4PPZA 3NS7B 3G96A 2LXIA 4OJGA 2CZVC 2K1RB 3US5A 5D3GA 5ETVA 2HS4A 1C4CA 1RA7A 3F73A 2HFSA 2KHCA 2ZJPQ 3ENVA 1OQ3A 2OPPA 2I5JA 3T1YJ 2F1FA 5I3UA 2F40A 3W2WA 1Q7LB 3HSGA 1GMWD 3MMAB 4MKYA 2EFVA 3HHNB 1H3DA 3MF5A 2VOPA 1FJGF 2BJ3A 5A8WB 3OR2B 4NPOA 1IR0A 2VHGA 2V68A 1DHMA 4JYAJ 3V4MA 1UWAA 1UVJA 3I55S 1QE1B 4ZLLA 1JXEA 5CH7B 2XZDB 1WDTA 3WIVA 4OI6A 4EWTA 4P71A 1RAJA 4H54A 2PSZA 4HDHA 2MEWA 4KKOA 3ZC4A 3FFIB 4LSZB 3LA0A 3TP2A 1U1PA 4L75A 4H4OB 1Y00A 1PCAA 2HHTA 3N9UC 4G65A 4ZJQA 2JFKA 5THWA 1N5YA 1UPMB 3NGTA 1X0FA 1TL7B 1VRUB 2XEXA 4CI0B 3GV8B 1EB0A 2A3JA 2PI4A 4ZHRB 2QSWA 1DBDA 3IAM9 2MB0B 1H7XA 1WELA 4NE9C 2ZD1B 4BDPA 2CQBA 2E9TA 4Y2MA 3W9IA 2Y1JA 1LXNA 2XMAA 2HQGA 1PBUA 4IRCA 5MLCV 3VAFA 4Y65A 5KOXA 4DUTA 1NK6A 4B9UA 2DR7A 4FKYA 2VG5B 3FSXA 2WBMA 2MZ1A 2QIFA 2DYAA 3N6NA 3WBZA 2ZJQQ 1OMSA 1C4AA 2B4UA 3DLJA 2PA3A 1FFSB 4TY9A 4EBDA 4LBHA 5C2CA 3TUZC 2OHDA 2KZMA 1CLFA 1FKOB 3I87A 1U02A 4LIWA 4PXEA 4NLDA 1M1HA 2R8GA 1S1TA 1S7IA 2AU0A 1DZ5A 1AXQA 3CD0A 3W1YC 3DRPA 4ETXA 3GG0A 1FEHA 1C0TA 3EM1A 1U6FA 4C0BA 2RE1A 3J7A1 5KFMA 4N47A 2J9DE 4JI0J 2X7IA 4HI2A 2OUGA 1CJUA 2YTCA 1MU2B 2HNYA 1JLCB 2W24A 4R25A 3G8SA 5CAAA 2KZZA 3UD3P 2ZBCA 2M8HA 1YKWA 2NLWA 2HK2A 4OMFG 4DEZA 2WVFA 1UVNA 4K4XA 5HANA 1XNQF 4DV4J 5DG8A 5J1EB 4JI6F 1UW9A 4ZJOA 3NLCA 1XR7A 2ROEA 1ZZFA 5DO2A 1R8PA 4JI4J 3RB4A 1ICEB 3BBFA 2BQRA 2F9JA 5KFVA 3PW7A 5J2NB 2KG0A 1SV5B 4F4XA 2X51A 2R7OA 2ADCA 2DVIA 8RUCA 1SXLA 3U27A 3ZTOA 4LRCA 3C15B 3I5BA 5A0YA 3OSPA 4OJ3A 2RSQA 2HFVA 2DGSA 3LQVA 2DH9A 4TU8A 4NLWA 2Q3PA 4TXSA 3WIUA 4MTPA 4U7CA 3MEGB 3R97A 1FESA 3CIZA 1JLFB 2OMOA 3Q89A 2GHWA 1KNZA 1NDPA 4OLOA 4KO0A 2XI2A 3UDCA 1M1GA 1OYEA 1VYAA 1I1GA 3UW1A 3MMJA 2EFNA 2CPIA 4P2MA 2MKKA 2DD8S 2L9NA 1H98A 2QLXA 4OZ1A 2E7WA 1YZ6A 2AZ1A 1X7VA 5DG7A 4PKDB 1ZM4A 2ZVIA 4RPFA 1U0SA 4ITSA 5D77A 2K7JA 2XGPA 2E7VA 2ZBPA 3M8ZA 5AE3A 1OY8A 1YBUA 4C8ZA 4NYZA 3ITHB 3H25A 2VQFF 4FXWA 5KFBA 4Q43A 1TKZB 4X84A 2O01C 2RMLA 2BKOA 3W8PA 4RW8A 5E3QA 3LAMA 1O51A 2WZ1A 1NK4A 1KBRA 2XS5A 1SVDA 2XCPA 1RBOB 1XMOJ 3RZAA 1MSWD 4NLYA 5AXNA 1IUJA 2P8IA 1X8DA 3DRRB 2E1RA 2UUCF 1WHXA 3PEHA 4IOAQ 2Z2ZA 4YDXA 3G6VA 2P9CA 3W7BA 4RNOA 2HMIB 2WAQD 2V2KA 1VRUA 1Q8IA 2DGUA 5DGAA 4ZHRA 1AYEA 3OUYA 3OFFA 5D4PA 3X1LB 4X4RA 3R5DA 1HKAA 4IO1A 2ZD1A 2D41A 2R4FA 2OKQA 2ILZA 4YY3J 1UA1A 5EWGA 1FVSA 4IH7A 4IDKA 1F60B 2OAUA 2OP5A 3ENAA 2HIQA 4KAIA 4DZ6A 2OTJS 2BQUA 4WE1B 3DHWC 5CYQA 2WOMA 1BY9A 2ZNYA 2QV6A 1UVMA 3NMAA 4UOHA 2EKNA 5K5MA 5DDOC 4ZPVR 4JI8F 4EYIB 1IJEB 1Y5IB 2G0JA 4JI3F 3RBZA 3D9BA 3VZHA 1X4FA 5KFDA 4QIFA 2A10A 1SH3A 4I56A 1ZOTA 1UJ5A 3CD6S 3DMJB 4ETZA 5GADI 2HHVA 3SXLA 3ILLA 1HBNB 4PWDB 4E8UA 4EGLA 1HPZA 4ZP6A 4B08A 1UCNA 3J80Y 3RRKA 3M9NB 3BDPA 4H4KA 2AMCB 2ZE2B 2ZH3A 2Y1IA 1MU2A 5KT5A 3HP6A 4DU8A 3TX8A 4DSIA 1WC0A 4P72A 4RW9A 3MOJB 3KK3B 3V81A 4DPOA 1U6ZA 4ICLB 2V94A 3J81U 1YJNS 4F4ZA 1HBUB 5K9FA 1FA0A 4USIA 5D78A 3SIPB 3IBWA 3R9LA 3VR1A 2ZWPA 2HVHA 2N82B 2NYIA 3CJKB 1YX2A 2OI2A 2QA1A 3VAKA 4B3TJ 1VBKA 2J0QD 1NB7A 4DF8A 4DX7A 2DNYA 2K7KA 3MR2A 1WC1A 4LFCF 1SV5A 2M2BA 4FYXB 2O3DA 1SKRA 3W61A 4AL6A 3D67A 1Y9OA 5F8LA 3DLEB 4M5GA 3C15A 3QAEA 4NOHA 2CPFA 1GNKA 1WORA 1FD2A 1UZHA 2Y1RI 2OFGX 1NJZA 2DPIA 3P5BP 1S0MA 3H5UA 3MAAB 3MM7B 1I51B 1XR5A 2YX4A 1S0VA 2JEIA 4B3MF 2FVRA 5C5JA 3UNGC 2CNLB 1TL1B 4NWBA 4IH6A 1LK7A 4OZ5A 1N52B 3CUNA 2ZZNA 3DM2B 2J7WA 1K9MT 1UA0A 1G3OA 3H4DA 1AA1B 5D0GA 3H98A 1XTZA 4NA2A 5A8KB 4X4QA 4J90A 2UVVA 1Q79A 3UQSA 4O3PA 4NASA 4DF4A 4GKJJ 3GMGA 2FHJA 4GC7A 2NPIA 2ABYA 2VH7A 3MCOA 3I6PA 1FX4A 2XWXA 2BOPA 2ZH4A 3H2VE 2ZUGA 3L7OA 1U2CA 4WYWA 2CPXA 3QSIA 5G0RA 1TKZA 1RSCA 3R2CJ 3EMTA 1OWXA 3K5LA 3A4TA 2HNZA 2AJ2A 4I69A 3AJDA 2B3TB 3Q83A 1B3TA 2LU1A 1JXLA 2KFNA 1IBMJ 1XIQA 3IFEA 1WHYA 3M8YA 3BBCA 2HHXA 4QPTA 4XDCA 4Y2AA 1J2VA 5ETOA 3WC0A 1VQOS 2VFRA 3TUPA 3TQ1A 2CQ4A 2EFQA 2GCFA 4FF2A 2DGTA 5M2RA 2LQ8A 4X2BA 3IA0A 4ECYA 3EGNA 3SCJE 3CCMS 1ZPVA 4RU2A 3ELHA 3PW0A 3TYTA 1F3VA 4I6YA 2XQCA 1HMVA 1DJ0A 2AJ1A 3MCSA 3SYZA 1U1LA 1RB0A 4WXOA 4HHHA 1U4BA 4PXDA 1IKVB 3PIPQ 2MDAA 4X4VA 4DSEA 5B7WA 1P9YA 2CYYA 1QJHA 2NCKL 3LW5C 2Q1LA 2IRUA 4K0KJ 4TU7A 4QZVB 2GO9A 1SL0A 3V2UC 1R0AB 5AJ3F 2PN6A 1JLEA 3I4HX 3RAMA 2F8HA 1MMLA 3C14A 1Q8LA 1RAFB 1KOOA 5L46A 5F8NA 1RWMB 2JLGA 5GAGI 2VASA 4M8LA 2W2MP 5JJBA 2HHHF 2DIUA 4OYOA 2H51B 4MIWA 3WX4A 1WC4A 3RR7A 4X4TA 2CPZA 4PWDA 1U1MA 2XCAA 3TARA 3BGFA 2JOQA 1SQEA 1FDAA 4ID8A 4DR5J 2ZE2A 5C25B 5J2QA 4B3SJ 3KK3A 2HBRB 2C3YA 1I3OB 4DG1B 1S6OA 1HBUA 4LFAF 2W1BA 3H5SA 4Y0FA 1KD1T 2FGOA 2DR6A 3QAUA 4ZVPB 5GAHU 5IQ6A 2M7SA 2ATLA 5A8RA 4CP5A 3G6ES 1WF0A 4AL7A 4DPYA 3CJKA 4HEA9 4M5IA 1ZTTA 3M6UA 3NS6A 1HL6A 4DR2J 2FJXA 2AQ4A 3DOMA 3X3UA 3QO9A 4OYWA 3LUYA 5DLGA 2BX6A 1F2GA 5H9EK 3VALA 2MZQA 1R31A 4CO4A 4CLTA 3PEJA 1PJ5A 4TNOA 3HHLA 4YFUA 2QA4S 2B9YA 4QWCA 2X1BA 1M5HA 5E0OA 3FUYA 1LKZA 1MROA 1U48A 5HQMA 3UFCX 3Q2SC 5LMUF 5CZXA 3IR6B 4FN5A 2PT0A 4PG6A 4ZCLA 3HMJG 2OEMA 4USKA 1UPPA 1RHJB 4DR4J 1TL1A 3C16B 1UEVA 3IBFB 1U7LA 3M4XA 1K47A 5LT5A 5ETMA 3NAIA 2G1HA 3QATA 1TKXB 3MM8A 4MKBA 3QIPA 1YI2S 2HQIA 4DOZA 1JXVA 5A8KA 4ANEA 3IRXA 3U02A 3FMWA 3SV4A 1E6YB 3HVAA 3IS9A 3V6DB 5D4OA 5LMNJ 4RUBA 1N32F 2YH0A 1RT4A 4X62J 1NHVA 3L9ZA 4XPEA 2XC9A 1RTHB 3CWJA 5KG4A 3PJWA 4KB7A 2JEJA 1SPBP 2XHWA 1RBLA 2ZH9A 4QIVA 1N4LA 2IM2A 3AOAA 3NWGA 3TAMB 2W9AA 3RG6A 4ECWA 1SCJB 1B0PA 4DUZF 3KG1A 4GKKF 5K20B 4LF9F 4DV1F 5D4NA 3TEHB 1JWWA 2VG6A 3BQ0A 2R2UA 4ZPWR 2FHJD 5AT1B 3P3DA 4JI2F 1TUWA 1EP4B 2OELA 3OVBA 3M1VA 4WBFA 3RBEA 1Y5LB 1SIZA 4DR6J 1S4FA 4I68A 3HHKA 2DPJA 1HWUA 2YKQA 3VF0B 1KDNA 4CLUA 4F0MA 3S8SA 4OX9F 4QW9A 1SJ4P 1KLMA 1SL1A 4DX8H 1IBLF 2MQOA 3FGVA 2V69A 3MEEB 5C42A 5AXMA 5RUBA 1CQNA 1JB0C 2HQ3A 2YNHB 2MKIA 2KU7A 3D6MB 5DM7Q 3DDIA 1HWJA 4IG0B 1DLOB 2V6AA 1TL5A 4DPXA 3ENWA 4ZVFA 2PD1A 4P10A 1FWKA 3VHQA 5KT4A 5IXUA 4K8RA 1U6BA 1PYTA 3FEZA 3IO1A 3E01B 1R0AA 2J8SA 4EBCA 5DZ7A 4G1QB 2IC3B 1GQEA 4OFZA 2DR5A 3MUVP 2CPYA 4N77A 2FD2A 3ICLA 3W5XA 2GS8A 2MLYA 3CMAS 1FKPA 4DQRA 3VV2B 1IKYA 3N01A 2FJAB 3K5NA 4EU0A 1LWEB 3AHPA 4W98A 4FYYB 4LSNB 4ZLJA 4N8NA 3UDVA 2ASJA 1IKWB 2WVEA 5EX0A 5H9FK 1CJKB 5I42A 1S1VB 2VC1A 4QPXA 3KG0A 3EDQB 3KHLA 4KGXB 3MPDA 2E5LJ 4OZJA 2FPHX 3D6FB 1JLAA 2OD6A 1XERA 5E3PA 3QRPA 2VQEJ 1B64A 4OL8A 4J9LA 4PR6A 3O5TB 1GX5A 3MPWA 2MPUA 3QLHB 3SDEB 1N0VC 3T5JA 3ISND 2AZ3A 2WVCA 1FK9B 1WEXA 2FZKB 1QTNB 4WFYA 4OV6A 1PYOB 3HHEA 4ZVOB 2BABA 3TEGA 3KLGB 1FT8A 5HATA 4F4WA 2D3ZA 2L48A 2HNDB 2F8MA 3KK2B 3KTQA 2LDIA 4NXNJ 5DQGA 3KUGA 2Z58B 2KJWA 4NX9A 3NMRA 3PYFA 3QMQA 1S0NA 1KS2A 4DZDA 1LW2B 1M5SA 4DPWA 2YNGB 3PRVA 4RWWA 1SQFA 3C16A 3SQGA 3J7ZT 5KFIA 4UY85 3HLUA 2X3GA 3D68A 2X1AA 2ZUAA 3CJ8A 3LP0B 3DGPA 4YR2A 5HQ8A 4M5KA 1KHVA 3OXGA 2VICA 1VC5A 2XI3A 1KHWA 1RT5A 1X5OA 2R7VA 2ZWOA 3D28A 3GLJA 4X4NA 1E6YA 4XK8C 3W5YA 1NJYA 2WONB 3ZO7A 4JBCA 1KVIA 4ZPCA 4QWAA 1VC0A 3RJMB 1YSJA 5IWAJ 2F4VF 3M2VA 3JYTA 4WZMA 1VLOA 3KXDA 1S59A 2WBRA 1JQGA 3Q8VA 5KT2A 2A1BA 4Q44A 1I5OB 4WIIA 2H9ZA 3GCWP 1VQ7S 5F9LA 3NEKA 5HP1B 3POTA 2RQCA 3TJAA 5GMKa 2LFVA 4C3MA 2D9OA 1PJ7A 2HVDA 4LT6A 1IJFB 2VA3A 1U47A 4NLSA 5D0EA 2DNZA 3CJ5A 3TJ9A 4RNFA 3CULA 3PZPA 5KFRA 3MUTP 4CTAA 3FQLA 2YBVA 2N4DA 2CQ2A 4AD6A 2BVZA 1U45A 3UR3C 3EPGA 3KUEA 3CCLS 3PNIA 3KNGA 2IAJA 3T5HA 3D54A 3O2IA 1BWEA 3DLKA 3D2WA 1S6QB 1X60A 4ZVTB 1DLOA 3PW5A 2C2MB 2GVZB 3PYGA 3UN2A 2DO0A 4FNIA 4ED5A 4HLBA 2I0XA 3FCWA 4HYKA 4ALZA 3E01A 3OXLA 2RDDA 2RQKA 4G1QA 1TR0A 5EDWA 2DGQA 4L72B 4KYZA 3IWXA 3OHAA 1NB2A 4WCEQ 5KG0A 4YHHJ 1S77D 4ZDNA 2W9CA 2RRNA 1M5KC 4NLRA 2HBYB 3DDNA 1LWEA 3CO9A 4I6AA 1HI0P 1XC9A 1HD1A 2EEYA 3W8GA 3M8WA 4F7VA 4RO0A 4Q5VA 3U7JA 4ZLPA 2VZ9A 1S1VA 2ZM6J 4NCGB 1AUSL 2IDLA 4LF5J 2UXBJ 2CQIA 3GV7B 2AKWB 3MM9A 1WC5A 4DPUA 1X5SA 2B6AA 3QGIA 1UJ6A 1U49A 2RHSB 3W3SA 3EICA 3Q22A 3A8KA 2K3IA 1YJRA 4PG7A 1TAUA 2KG1A 4DN9A 1I94F 3PKMA 1TP7A 3BPSP 4DFMA 1RHQB 3UCZP 1T03A 1FJEB 2YWHA 1Q1KA 1FK9A 4DV0J 4PXBA 5B0FA 3DHXA 4K4WA 4RL1A 3KJVB 3MDFA 5CQGA 2RU9A 4LSLB 3A1YG 4PQAA 1RTJA 5E2QA 3R7BB 2UVRA 2HAFA 4FF3A 5HMWA 3WDOA 1H72C 2MSTA 2IHR1 2GMJA 5IFMA 2MKCA 2ZVSA 2HNDA 4CLYA 1XNRJ 3GPAA 3W2VB 1WACA 2IJRA 4ECTA 5KFAA 3DRSA 3M8SA 3M8PA 5KFUA 4DLEA 2XULA 1RHRB 4UT4A 3KLVA 5A6WA 4P7TA 2ALZA 4B02A 2R2SA 1RTDB 4B17A 1SIWB 3HXMA 2GX8A 3E3XA 4DCPB 3V4IA 1ZAVA 3DLGB 3GSIA 5ETSA 2G4BA 1FVQA 1B70B 3PXGa 3T1YF 3ZZPA 1OJ4A 2BUNA 3HJVA 4IYQA 3BQ1A 1P9QC 2RF2B 2DNGA 3KYLA 4WFAQ 1IM6A 1F5CA 2JVOA 3SSSA 2B4PA 3PX6A 1SJ3P 4Y28C 3BO4A 3PKYA 1PO6A 3FKBA 2ACYA 4ER8A 2M4MA 4UOCA 2QG9B 2R3VA 3AQOA 5EHHA 5AE1A 3DOLA 2CZ9A 4HH1A 2BE2B 2PDAA 2HKEA 2P6SA 3QGPA 2Q66A 2YNFB 5I3PA 3DYAB 4LF4J 1GFWB 4MK9A 2HGMA 2VPYB 4LRAA 3R8YA 3S6EA 2C3OA 3GR0A 1HA1A 3IXQA 2CNNB 3V6KA 5CHCB 3TUJC 2C2OB 2Z2LA 5HJYA 2DKOB 2KFYA 3A8JA 4DQPA 5CYMB 3PM9A 2DGOA 1Q7YT 1D3WA 4ZVSB 2UVWA 1VBYA 1X4EA 3HKZD 2AEFA 1WC6A 2V9KA 1S9EB 2F5GA 1VQMS 1CVJA 4DR1J 5I3QA 2PIIA 3CC4S 1R8AA 4QU6A 3BEGB 1TUVA 2MJUA 2AV5A 1RWKB 1U1OA 5T41A 3OBIA 2QEXS 1SKUB 2CWXA 3R5AA 4DV7J 3CVKA 4HL9A 2Q6CA 2XSJB 2AGOA 3OQ2A 1BC6A 4QCLA 3Q24A 2COLA 3R6GB 2FLPA 4DXLA 1NMEB 2Q43A 5GAEU 1N48A 4BCAA 1KKHA 3IG1B 2C28A 2GFFA 3BO2A 3AB4B 4NEYA 4IFYB 2KL8A 3TZXA 4P73A 4DL0C 1D1UA 1TL3A 2GAGC 1KN6A 2YKNB 1F9EB 2C2RA 3CCQS 2E9ZA 2B4VA 1B4SA 1QAIA 2DEJA 2ZKTA 1QAYA 2ZEJA 2EBGA 2GAHC 1NK8A 3BKTA 1U1NA 1WOSA 3G86A 4PAAA 4A8FA 4DR7J 3HT0A 1XJWB 4WP8A 1QAXA 4JI0F 3OR1B 3ETOA 4O4GA 1UFKA 3MM5A 2XNRA 4A46A 2IDEA 2BV3A 1FKAF 3BGRB 4IQXA 4HH0A 3U1NA 3FMBA 2J9DA 1N6QB 2G2OA 3P96A 1K0TA 2UXDJ 1Z2ZA 3I4PA 4O44A 3SSQA 2CJ9A 4CH7A 4OYZA 1RYSA 4OV1A 1RWXB 1UL3A 4JI4F 1JLBA 3P49B 3JXOA 4D3GA 1KVJA 5DDPC 3OTOJ 3OTBA 4LSLA 1KRPA 3GJTB 3PRBA 4OLPA 1S1UB 4QYZJ 2ZBQA 2ATCB 3R2DJ 4OZNA 2HW3A 1YG0A 3D3BJ 2OGUA 3HVWA 5KT6A 4JV0A 3W2VA 3GFYA 2NUUG 1CJVB 2GV1A 3NGKA 4LFBJ 2ZKUA 3BBBA 3K17A 5KFOA 1VIXA 4NLVA 4Y2KA 3HT3A 1PG5B 3EGZA 2DJWA 2UV8G 1VJWA 4M95A 1JLQB 1W26A 2VFUA 4J9QA 4Q0BB 2KI2A 1SC3B 1VQLS 2UU9J 3TA1A 2FC8A 1H2TZ 4EBEA 4IOBA 4TY8A 1RWOB 3NRBA 2RF2A 5FDLA 4MKAA 1B7YB 3ZZUA 3T5LA 2CJKA 2ZH6A 2BJ7A 4USUA 5KFLA 4Z37A 3HJFA 5J2PA 4NA3A 1GXUA 2OPSB 3CTRA 4MKVA 1RKJA 5KFFA 3QT5A 4ZVHA 1NNDA 4U6PA 2GVDB 3EWGA 5L1LA 2YNFA 4LF7J 3DYAA 4K4TA 4WYLA 3H20A 4WFBQ 2UXCJ 2HRTA 3EVMA 1VCTA 1XMOF 4CQ1A 1SH0A 3IGNA 2ASLA 4DV6J 3GFXA 5CYMA 3CCJS 4GO5X 4BWJA 1LFPA 3CE8A 4RWXA 3KLHB 1DAXA 2VF3A 2YVSA 1S9EA 4ZN3A 4USVA 3OW2R 3TRGA 4OIXA 2NXEA 2J6UA 4OYMA 1LWCB 1FJGJ 3GFZA 1D0EA 2RT3A 4P9SA 2XSJA 2UV8A 4CT9A 1C1CA 2NUHA 3M32A 3P8BB 2DH8A 2VFSA 2DGWA 1RAIB 4CNYA 5HSPA 3IG1A 1X5TA 2YH1A 5LL6d 3ZZYA 1V3ZA 4DLGA 5KFWA 2KXNB 1WKLA 2HVIA 4IFYA 4EO6A 2AD9A 5KG6A 3KOAA 1HYSA 3KDOA 1JLGB 3MEKA 3UDLA 1HQUA 5IT9U 2YKNA 4LBIA 2QLFB 4JI7J 4L73A 2BRKA 1DTTB 4F50A 1K8AT 3SSRA 1B0TA 2EG1A 1WUUA 5L1JA 1Q81T 5HROA 5L8RC 3IR5B 2BA9A 2FLOA 3BH6B 3H2UB 1X9MA 4I2PB 3NBPA 3GZ7A 5B0BA 5HL7Q 3OJUA 3HI9A 1NRKA 4NZ6A 3OR1A 3ZTPA 2VPWB 2JFDA 3HF5A 4GVLA 3KMSA 3VAMA 3OSNA 2I2YA 1NH8A 3RU0A 4WKYA 2MQPA 2E29A 4DFJA 1UWBB 3DXBA 3NGUA 5F8HA 1IBCB 4LF1A 2Z2MA 1Q0NA 4J37A 2YWWA 1Y7PA 4N56A 2P5VA 1EETA 4B3TF 3UR0A 2IY5B 4S0MA 2DHHA 2ZBIA 3AD9C 3D0GE 2DRDA 2V8VA 4C11A 3L4BC 3CCTA 1M90T 2CFXA 1D9DA 4JI1F 1FXRA 2LU2A 3ILJA 3CJTA 4CH1A 2UVUA 4QYRA 4K59A 3LGMA 2V8PA 5D0RA 2Y1LB 2AGQA 4EYHB 1FI4A 1DTQA 1T95A 2AX0A 2XMTA 4TLQA 4JV2A 2L41A 2QX0A 1JLQA 4YDDB 4Q0BA 3C3LA 3HZGA 5DDQC 2DTJA 5DG9A 3TZYA 4KFBA 4EI2A 1RLDA 3R5JB 3AJ1A 1N8RT 2FGCA 1WDDA 3FC9A 2NS1B 1FWLA 3RRHA 5F8GA 5HVHA 4GKJF 3HPOA 5B08A 5L1IA 2CQDA 2KO1A 3OTEA 2QRRA 3HD2A 1R8HA 4FVCA 2IVMA 4ZK7M 3AAWB 4E0DA 2OPPB 2XY6A 2FVSA 4CO0A 4UOFA 5I3UB 4FXVA 3W2WB 5IM0A 3PRDA 2QC3A 5F8IA 2JH3A 1HHQA 1EX8A 1NPKA 1MWQA 3ISNC 3M7VA 4NI2A 1WOOA 1OYDA 1S9GB 5G4DA 4WTOB 1UZDA 1PGZA 1IBMF 2H1YA 2ZITA 1P8GA 5BYSA 1WWHA 1P27B 3W60A 4QR0A 4ANDA 4X4OA 4YB7A 3L7UA 4ZVEA 2B9WA 3C8YA 3SCKE 2MGZA 1GXLA 2B56A 3UE2A 1RP5A 1MLAA 4HTJA 4OZ2A 1HNIA 1SJ1A 1JNZB 3TVZA 4KKOB 1YITS 1RWUA 3HKWA 1YJWS 1PBAA 2KTQA 3AJ2A 1SJRA 4RW4B 4F4KA 4C98A 1LWCA 5FJ4A 2YPZA 2ZNZA 1N5YB 3VTIA 3NCQA 3P45B 1T11A 4AXIA 3OD2A 2RAQA 4LR9A 1VK3A 2DNRA 4O3OA 2Y8YA 1G4CA 2B8PA 5KFEA 1TKDA 1SQGA 4ZP8A 4A8SA 4QIGA 3NNHA 3N6MA 3LO3A 3OL9A 3I96A 3Q23A 3GWCA 2LXUA 3U1MA 3JB9k 2CJQA 4K0KF 3SZ2A 1EZZB 3A3NB 1C2PA 3KWMA 3Q8RB 2I38A 1B99A 5H1SV 1DTTA 2BDPA 2VONA 4KV8B 1X4AA 5FLXU 4X66J 3CW2C 2L9WA 4RJVA 2RQMA 2C2NA 1NJIT 1RT1A 4GVBA 2PMWA 5ETQA 4OQJA 5D4LA 1CEZA 1C0UA 3G4SS 2HG4A 4RUAA 4WZQA 4IFVB 4WK1A 1S1TB 5ETPA 4DR5F 3TZWA 2ZOMA 1N34J 2L3MA 4B3SF 1YVFA 3DRPB 4WU3A 1WNEA 1MWZA 1C0TB 1UWBA 4DV2J 1Q53A 2F3JA 2FYXA 2NSBA 1V9OA 4WK3A 1AB8A 4TU9A 1HFEL 1WI8A 2FHOB 1CJUB 3KHRA 1J5OA 1LFWA 3TO8A 4Y00A 5HN0A 2HNYB 2HHQA 1HBOB 3HO1A 1R7IA 3CDUA 4P6QA 3G71S 4H4MA 1T05A 1OPZA 2XB2D 2JHEA 1NU4A 2ILYA 2JJ4D 2NQPA 3K0JA 4GO7X 1M5VC 2IIHA 4J9UE 1F3FA 4I64A 1HNZJ 4QR2A 3EX7B 3TVYA 2MLXA 3BSNA 1XBWA 2YWEA 4Y2IA 3DI6A 1QSYA 2B4OA 4K4UA 1HI8A 2DXFA 3M6WA 1S97A 3TAQA 4RNMA 2FJEB 2EG2A 5HBMA 3TNVA 2V9WA 2PMHA 2Y0BB 1FDBA 5A0YB 2IA0A 1S72S 4OYBA 5F41A 4HT5A 4HI1A 4OYPA 1GK8A 3ETMA 4N7TA 1F9FA 2KB2A 2RDJA 4PEOA 4PWWA 1CC7A 2FLNA 2EPIA 4KO0B 3K5MA 2XYPB 4EMDA 1IR2A 1BGXT 1LK5A 1VQ4S 2W8LA 5LMNF 4ZVRB 3P6YC 4DL2A 1BE4A 3SMZA 4OHZA 2ZHAA 2CA9A 2CJYB 4IR1A 3VGSA 2R7RA 3HSDA 3JSBA 2HQDA 2EKYA 1YJ7A 3QJPA 1S9GA 4P74A 1RCXB 2CDQA 4DL3A 3LOUA 4OHXA 3I0RA 2G2ZA 4PZVA 2BANA 4Q7AA 1PKUA 1Z1ZA 4TYAA 3PHTA 4RW8B 1TAQA 1NUEA 2G9OA 2HS3A 2AEJA 2YQ0A 4DR6F 1NCLA 2IMOA 1KOHA 1P1LA 3AD8C 3KNAA 1C1BB 1X4HA 2E5HA 2EFGA 7FDRA 3R3TA 4RW4A 4WWSA 4F0KA 2P9EA 1V6HA 3A3PB 4U7UK 2OPQA 1SC1B 4FS2A 1V3SA 2JL9A 2PEBA 5DJBA 3N5BA 2IRYA 3CB4A 4B3RJ 3BDEA 4AT1B 3QNWB 4KHRA 3OUYB 2HVZA 4UW2A 2DISA 2EFOA 2LMIA 4ED8A 4XTTA 2Y0SD 1VJQA 3DGVA 2HSEB 5ETNA 4ELUA 4IDKB 4PRFA 4GMKA 1PSDA 5HK4A 1RCOB 4KV8A 4F2SA 3IMQJ 5CYQB 2WOMB 1HARA 2DRBA 4ZN1A 1S48A 4Y3CA 3K5PA 1RT7B 2XYHB 2YXLA 4G1IA 2QMWA 1NJWA 2WSFC 2J7UA 1S7HA 2DXEA 1FDNA 3MR5A 3AT1B 1TUGB 2V2ZA 3L3CA 4OYXA 3M05A 4IFVA 4CZCA 2JWNA 1VOMA 4WU2A 4HACB 4ECQA 3MEDB 2FUG9 2RDIA 5KFZA 4UTGA 2ZH5A 1OS5A 2OD4A 1FDDA 2PO4A 2POKA 3CCES 2YX1A 1HPZB 2R9LA 2E5LF 1QM9A 2XTJP 2Y9HA 4N5SA 4MIAA 2VQEF 3AQPA 3B78A 2H48B 4U95A 1HBOA 4RW9B 4YB6A 1N5TA 3V81B 2E1MC 4ZPDA 3AODA 3DLLQ 4JB8B 1R89A 3GTYX 1RTIA 2I9SA 3QZ8A 2IMWP 3SQOP 1LOUA 1VQ5S 1NDKA 3A3OB 2G1DA 5EWEA 2BJEA 4J9MA 1FRJA 4DUYJ 1F1BB 2LQBA 3OV7A 1QLNA 1TK0A 1T7PA 3ULHA 2M8DB 5DQHA 2RS2A 2XHCA 4NXNF 1FXDA 1U1QA 1RT2A 4HHUA 5KFTA 4A8KA 3S1TA 2BZ2A 3NP5A 2KVIA 5KFJA 3MMBB 1S10A 2MKJA 4G6VB 1XMQF 3RBDA 3PVXA 3Q0AA 1HQ2A 5K14A 3M8RA 2BW7A 1T9TA 5KG2A 5BYQA 2VOOA 3NXZA 2BJ8A 4CLFA 4TKTA 1OIAA 2C3UA 3B8HA 2DXDA 3G82A 1PC4A 1J5EJ 1Q5YA 3PFEA 3G6YA 2E1PA 4F25A 1WJ9A 1U09A 1X5PA 4RX6A 4M5NA 1TL4A 3CJ2A 2J8AA 3ZTSA 1N36J 1ZTWA 3GG1A 5HJXA 4U96A 3KK1B 1CS4A 4ILMA 1VRTA 1B0VA 5GMEA 5IWAF 4F26A 1Q8BA 5MAOA 1IVZA 4KHMA 3AB2B 2K3KA 3TOQA 3RAQA 1TFWA 4ILLA 3MPUB 3N0VA 3P4UB 5ETLA 4LR7A 4X64J 1RXOB 1WTBA 1KEKA 2KT2A 5K8PA 2DNHA 2VODA 2CNKB 2IRXA 2HLTA 6FD1A 3I0SA 5G0RB 1YZ7A 4X4UA 2OSQA 3D7SB 2HNZB 3W63A 2W2PP 5C24B 2HHPA 3H90A 2GGPB 3M6VA 2ZC4A 2E66A 4I1TA 1Y4ZB 4B9MA 2HFOA 2MZTA 4OI2A 1C1BA 2OFHX 2MXYA 3BSOA 1GAOA 2GA7A 3CT9A 5JUMA 5IZHA 3M2RA 2JEFA 1AW0A 1N32J 2W7AA 1NLKL 4LRFA 1W2BR 1NBEB 2D1CA 5JVGQ 4FS1A 4KRWA 3JSYA 1U2RA 4JOUA 3HFVA 3KHHA 2JZ5A 2FJWA 3F44A 1VQPS 1Q16B 3M30A 3R5CA 4WXWA 2R8JA 3DU6A 1HMVB 5F8JA 5LSOA 2C1EB 3G8QA 1MNEA 3GYGA 4PWUA 2KYXA 5ETRA 3J7Z5 3FSIA 3O6QA 3IM9A 4WF9Q 3AXMA 5EGYA 4PG8A 2QYCA 3VAGA 2H4WB 4I4BA 3MWBA 1YRTA 3VQSA 2VA2A 3B6BA 1K1QA 1WKJA 2IM1A 4UOGA 2FJVA 1RT7A 2D9PA 4YHHF 4USWA 4LRDA 2Y3YA 4W4MA 1JLEB 3CGIA 4RZRA 3C14B 3ZTRA 1SKSA 2Q79A 1D9FA 4FNHA 4ZPAA 4DQIA 5M2UA 1X31C 3I82A 1IBLJ 1F6TA 2D7SA 3CJ3A 1VBXA 2CADA 4HACA 1VQKS 4OYAA 3MEDA 2GZOA 2GW8A 3LP1A 3SV3A 2ZM6F 1QUVA 4F2RA 2UXBF 2W2QP 4LF5F 3FEXB 3D0IE 2KJVA 3MAQA 3K5OA 1TV6B 1JKHA 2HFUA 4JI5J 5J2QB 2UUTA 5KTQA 4UY8T 3N28A 4OI3A 2ROGA 3GJRB 2QL5B 1RE1B 1WG4A 2V67A 4M1KA 3PO4A 1T9UA 5B0CA 3CC2S 2IVFB 1VHIA 1BHNA 4D3HA 4DV0F 2VU5A 5A8RB 1D9AA 5A2QY 1LQ9A 2GJIA 3J80U 1VQNS 4QU7A 3DOMB 3OFHA 3PTWA 3QO9B 2R7TA 1SI9A 4PUOA 2MQQA 2PMZD 1TFYA 3SBMA 3JAMY 3D3CJ 2VJUA 2IYGA 1FFWB 5IV4A 1XNRF 3DKDA 4WJBA 4FBUA 2XWYA 3MMBA 2HRUA 4G1PA 3HHLB 2CQPA 2R2TA 3A8IA 5ETKA 2JC0A 2QA4G 4I2QB 5AXKA 3MCMA 1MROB 3JQMA 5HMXA 1VHFA 4J9OA 4UZCA 2YNIB 1IR1A 2HQCA 4PYAA 2Z4PA 2GIFA 2M3DA 3EPIA 3CD7A 1NPRA 5CD4H 3GSDA 5BR8J 3KK1A 5T7LA 3MM8B 1A7GE 4ED0A 1FRHA 2KXHA 3T6BA 3QIPB 1VQ8S 1UTAA 3FBEA 4XO0A 3THTA 3IRXB 2D3O1 1QTMA 3IS9B 1Q95G 4LF4F 4L76A 1KVKA 1RT4B 1URRA 3MUMP 4NLQA 2P2CB 4Q2LA 2J0SD 3RB6A 5HLFA 2BJ9A 2AGPA 3PIOQ 2YWFA 2MMYA 2F8EX 3M6XA 4A8MP 1AFJA 4IOCQ 3QYYA 5C24A 2A0FB 4GRSA 2ASYA 3W65A 3TQEA 2GGPA 1EARA 4DR1F 4DL4A 2VG6B 4YR0A 4FYDA 1R8CA 3EXCX 2WW4A 4Q8EA 2GMLA 4HDGA 4K2XA 1YIJS 1BQNA 2XYGB 4DV7F 3M1VB 3B4MA 1MMDA 1MWYA 2A18A 1NKCA 1LV5A 2HYIB 2O5DA 1B7FA 4C8YA 2V4JB 5KAKA 1Q86T 4DJBA 4XPCA 4TQSA 3K57A 2CJBA 3TJ8A 1U1RA 2C2KB 3TX0A 1KLMB 4ZS6A 3F0NA 2NSCA 5EX3A 2K06A 3SFUA 4ERDA 5C42B 3KLFB 4PG5A 4I7FA 4ED3A 2AJFE 2SXLA 1XR6A 3ZZOA 2J7KA 2NYHA 3I31A 2YQ1A 4F67A 2BACA 1HQEB 4DX5A 2OMLA 3Q8YA 3SCIE 1G7CB 2W9BA 4BBYA 2GO8A 2XZWA 3OL8A 4O23A 4ED4A 4DR7F 2XY7A 1RAHB 4DS4A 4RW6A 5ADZA 2RKIA 3QT8A 4M5LA 1WG1A 2WTFA 1FKPB 2X1GA 2QFIA 3GCXP 1IKYB 3QJJA 2OJ3A 3BSCA 2RH3A 2UXDF 2EC0A 1TV6A 4KHPF 1YGYA 2IM0A 2JLEA 3VCDA 3IWNC 3IP0A 1PC5A 2XM3A 4KGVB 1P1TA 3D66A 2WB1D 1D09B 5I42B 1RHMB 3NOCA 1N88A 3CXCR 3OTOF 1JLAB 1WF2A 3TR5A 2VBWA 4OI1A 1A9NB 4YR3A 1ZH5A 1VLYA 4RNHA 4J9VA 1NM2A 2AEMA 2AWZA 4YB1P 3QFHA 4FF4A 1ZAWA 2BRLA 2V63A 3DOKA 3GU0A 2XY5A 1DQAA 4O4RA 2DHAA 1VC6A 1HHTP 2GQQA 4LRBA 1JK9B 2DB1A 3MFIA 1XK8A 4OZ0A 4LFBF 4QQBA 3E51A 3HHDA 1QAJA 3CO0P 1L3VA 2FDNA 5C2GA 4NRTA 4I2QA 3V5RA 4ECXA 3DC2A 1RISA 2E44A 3AOBA 4UF4A 2V4QA 2YNIA 2UU9F 1O0PA 4USJC 1GX6A 3GE9A 3KJNB 3ZTQA 4ZVQB 2JC1A 4J91A 3JTNA 4C97A 4CLKA 3NGDA 4F02A 5JXSA 4DR3J 1DQ9A 2CWKA 3SQGB 1JMTA 4N76A 1U25A 3OL6A 1HI1A 3CCWA 4QR1A 3MR6A 2R2RA 2ZOFA 4M5DA 1RADB 3DGPB 2Q6BA 2QJ3A 1NDLA 3IC1A 1WHVA 1ZETA 1RT5B 1KQFB 2DO4A 1EIYB 4MYUA 1NSAA 2Z0GA 1A0OB 4QBUA 1KFSA 3MMCA 2UXCF 3HX9A 3ILOA 2DNKA 5IT4A 2JX2A 4WP3A 2O66A 2AX1A 2PA8D 2CG8A 2EK6A 3T3FA 3M2VB 3H5YA 4DV6F 3JYTB 1CBKA 1U8WA 4HHJA 1UAWA 2HK3A 2DCUB 5D0HA 1LNQA 3VWSA 2RIJA 4CYUB 2WHOA 3POTB 2MZJA 3UCUP 2J0XA 1HWIA 4NLOA 1OPIA 3UCGA 5L9NA 4F3QA 4ENOA 1TMJA 2AW0A 5K8OA 2UUAJ 1S1XA 1U8SA 3QFWA 1VS3A 1OY6A 2ZFHA 4A8OA 3UVJB 2V4JA 1W25A 4ECRA 3KHGA 4ZP9A 4CTAB 4ZCIA 1EKRA 4P7VA 4OX7A 3HSJA 4UUXA 2CJXB 2AYGA 1ZM2A 2M88A 4KR0B 3W64A 3KLFA 1JX4A 2IAJB 4AQYJ 5GADU 3DLKB 4OZ3A 2YKAA 1OSCA 1N56A 4JI7F 3KMQA 2HGNA 2BM0A 3UPFA 2GJFA 4FP9A 3RBXA 1HQEA 2ROPA 4A4JA 1MMNA 3TA0A 4DV5J 1BQXA 3GR1A 1TKTA 4IQMA 4C8OA 3NCPA 2VDHA 4E98A 1DQ8A 4IR9A 1H73A 3W9HA 3R5BA 3CCUS 2U1AA 5HO4A 1NHUA 3RW6A 1KONA 3NKYA 4ES3A 3C6UA 4RBTA 1R0CB 2W9CB 2AHOB 1FWPA 3RB3A 2RQ4A 4CNZA 1ZAXA 3ZFVA 2ADBA 4NMLA 3FRYA 3AXKA 3CCZA 1SUQA 1HNXJ 1RGVA 3CC7S 4K4ZA 1UFWA 4ZPTR 2FZCB 4R8UA 1H38A 1RYRA 3VAIA 4U8VA 3MM9B 2B7CB 2B6AB 5KFYA 3Q8SB 4JUZA 3T5KA 2BOAA 1VGYA 2QMXA 5KG3A 3RYLA 3C6TA 3DU5A 3T1HJ 1T03B 2RHQB 2HIYA 2CQCA 5L9XA 2M70A 3MECA 3MR7A 3FSYA 2XG8A 4JV5J 2WRMA 1RTJB 2A6MA 1U26A 3OVAA 3MD3A 2G2YA 3MFHA 1H7WA 4NLGA 3ZNUA 1BLUA 1HNWJ 1T3OA 4C8MA 4F4YA 1XMBA 4LF6J 1DRZA 2QYGA 1CULA 3B82A 4ES1A 3DRSB 3M8PB 2KM8B 2GQ2A 2MKSA 1GMUA 1YRXA 2EVZA 1FNMA 3NGRA 3B4DA 5DETA 4EFAC 2D74B 2V4RA 1PILA 4QIEA 3V4IB 5A76A 4ZP7A 1AFIA 3L95X 2ZBRA 4C7QA 3R1HA 2CQ0A 1L3KA 1F9HA 3HHLD 4G3IA 4DDFA 2ZJRQ 3E8OA 4Y34A 1T9VA 4EEYA 1REVB 2CJAA 2XS2A 3OFGA 2NZ4A 3BJYA 3J7YI 1JJCB 1FJ7A 3H42A 3EVOA 3CJ0A 3MOZA 6FDRA 5GAHI 3KLIA 4M5HA 1FNOA 3VGTA 4EK2A 1NKEA 5CCLA 1VRQC 2RJZA 2ASDA 3DOLB 2LDYA 3TI0A 2HBQB 1HBMB 1NZAA 4DFKA 2K1RA 5B0AA 1GTHA 3VZIA 3NNAA 4CYUA 3GP9A 3IN5A 1RBAA 2D3OR 3GIIA 1ZPWX 3BSAA 2ERRA 3VQTA 2GJ2A 3K8WA 3UN3A 3MMAA 5U47A 1S6UA 1U2FA 5HQLA 5A8WA 3OR2A 4B9LA 3QWPA 3LTOA 3ET6B 2MZSA 2V5HG 3PR4A 3UVJA 4AUKA 3TUIC 3PFOA 1QE1A 2K2PA 1HR0F 3FEYB 1FD8A 4TN2A 2UUBJ 2AYEA 2QLWA 1YK9A 1FJCA 5GAGU 2M0GB 2CQ3A 2XLJA 4KTQA 3FFIA 2MKHA 3SEOA 2C2DA 1F5AA 4H4OA 1SKWA 3FRZA 1VQ6S 3PDNA 1GXTA 4BHQA 4QWDA 4NZ0A 5DQIA 1H6KX 2Z57B 1DFDA 4W92B 3A13A 4K5SA 4X66F 2JDJA 1TL7A 2RUGA 4DQQA 2DITA 2XSFA 2YKMB 2RS8A 3GFHA 3DFEA 1TL3B 2LEPA 1SH2A 5H9EJ 2ZOGA 1V3RA 4A8WA 3E2EA 1F0XA 4P2XA 3OHBA 2RRAA 2X3DA 2DH7A 4RBUA 2C2ZB 1NK5A 1M5PC 3FVYA 4RW7B 4M63A 1N34F 4ID5B 3ENQA 1R27B 3HULA 2LKZA 2XMJA 4DL7A 2VG5A 4ZA1A 2PE8A 4DV2F 1XQIA 3H7HB 2VKZG 1M1KT 2IBKA 3R27A 4KGMA 2DNMA 2N3LA 2KYZA 2HHSA 3K59A 4O4GB 3BREA 3MM5B 1IM4A 2VPZB 1NO8A 2B8QA 2F63A 1LWFB 1RAEB 4KH0B 4DV3F 1Y3KA 4DL5A 2B9EA 1UVLA 2FZGB 3I5AA 1Y0HA 3BGUA 5KG1A 4M5JA 2GQCA 1FKOA 2BEFA 1WTFA 1AZSB 4O44B 3LANA 1H2VZ 2V2QA 2R7SA 3THVA 2WSEC 2FVCA 3J81Y 1EQ0A 3T19A 3NS5A 4J9SA 1JLBB 1HNZF 1S79A 3PJ9A 3U1LA 1W2IA 3OPKA 4X65F 1S1WB 2XGQA 2BKPA 4WTYA 5L39A 3ZZRA 5HVFA 3FDSA 4K4VA 2VBXA 4FF1A 2HAIA 5IQQA 5IC6B 3BKFA 1JLCA 3QRRA 3SCLE 4DX6A 1JIHA 5LJ3Y 1MN9A 4DSLA 2WB4A 4ZITA 2FHMA 1NK9A 4LVNP 3TW0A 3GIMA 3D0HE 2GIQA 1FF2A 3PX0A 1WI6A 3WC2A 5J1EA 5B0EA 2OLWA 3ILIA 3ZNJ1 5KG7A 3LGHA 5F0UA 3MGJA 1LXJA 1UJ4A 4USTA 2UZAA 4UQGA 5J2NA 4K5RA 3WX8A 3MZIA 4OX8A 3R1LA 2HVEA 3EE3A 2LYVA 2EK1A 4TQRA 4MYTA 4WP9A 9RUBA 1REVA 4JI1J 2J76E 4TY8B 5FDLB 3D1QA 4FPIA 4IRDA 1HWLA 3PO5A 1HW9A 1Y11A 5EWFA 3NCRA 3Q2TC 3MEGA 2F65A 4JYAF 1WF1A 5J2PB 3UD5A 5BJRA 1JLFA 4ZCKA 4UZBA 5GVQA 4ZVGA 4A8QA 3CJSA 2V2VA 1HBMA 2ACMA 2HWTA 1IBKJ 1NK0A 5DM6Q 4FPRA 4KPYA 4PCQA 5LJ5Y 1RWNB 2AYMA 1LWXA 3MHYA 1X4BA 3CIMA 5F8MA 2CIMA 3BB5A 3R5GA 4MH8A 4AE5A 4FYVB 4RUHA 3WHIA 3VGVA 2KKHA 4CO2A 1T9WA 4K2JA 2GMHA 3ET6A 3RR8A 2OIHA 1IQZA 1R6YA 1HNVB 3KLEB 1ZBTA 4B3RF 3ITHA 1NAQA 2QZ8A 3T6JA 4NYPA 2ZZMA 2EC2A 3ZZ0A 4PPDA 1Y10A 4OHWA 1O5JA 2WSCC 5K8MA 5H9FJ 4F36A 3BGOP 1J27A 1C1CB 1S9FA 2F7VA 3M32B 3DRRA 2DCLA 3PV8A 2ZH1A 1K44A 4KQZA 2W4PA 3G2XA 2KRRA 2YKOA 3QBCA 4ECSA 1UW4A 2AT1B 2HMIA 1UEKA 5LSLA 4J9RA 2O67A 3HD1A 2YKMA 4CIOA 1HYSB 2VUGA 3AOCA 3TANA 2O1PA 2R7UA 1HQUB 2K8GA 2G0IA 3PY8A 4OHYA 3JSRA 2BKNA 4RW7A 4CDIA 2ZZTA 4ID5A 2ALYB 5HROB 2WVBA 5L1KA 3S7RA 5LXRA 2MYFA 2BQ3A 4DL6A 2IA6A 1RJJA 5LOQA 5HAOA 4F04B 3VAHA 1U24A 3NBPB 4WPAA 3IBCB 4WE1A 1CG2A 1TTHB 1L3SA 1VISA 2DBBA 1KP6A 1LWFA 2C3PA 4KY3A 3O44A 2KN4A 4B3OB 3N5FA 2KHDA 1MG7A 4DPTA 2E9RX 1Q78A 1AZSA 3SFGA 1YRUA 3ADAC 4DV4F 5IV3A 1N33J 3BN4A 3O1LA 3DMJA 1TK8A 3L09A 4RU9A 1EETB 1Z2LA 4DUYF 3BPDA 1HBNA 1S1WA 1GT8A 2D3UA 2P9GA 3B54A 3UN5A 4C11B 1QUPA 1RLCL 4CO1A 2CPDA 3PG9A 1V5IB 4L3KA 2FJBB 2B5JB 4A48A 1PIEA 4ICLA 3J7YU 1IWAA 2MQNA 2FJDB 4CM0A 1MW7A 3PW4A 1PYSB 5KFSA 1DTQB 1TMMA 3HCXA 2AYBA 2MQMA 1J5EF 1WG5A 2DNNA 2RB7A 3G87A 2HZAA 4O3NA 4F0HA 2LECA 5IC4B 5HVGA 1QSSA 4DS5A 1N36F 1S4EA 1L5UA 2FC9A 1ZZNA 3BN7A 2KXFA 3QIDA 1TZ0A 4KFBB 3DLEA 2C22A 1D8YA 1IWGA 2FHKA 3CJ4A 4ZLNA 4TYBA 4K50A 2BR0A 4IUFA 1Z4UA 3AY0A 2YY3A 3MAAA 3T1AA 2CNOB 4X64F 3MM7A 4BC9A 1VIOA 2M5YA 1YWXA 4DSFA 4LF8J 1RI7A 5IM0B 2B43A 4QJVA 4NXMJ 3IR7B 1NDCA 3CJRA 1FO1A 4H4KC 2P6TA 5J1NA 4NI2B 4ZKAA 4WFNQ 5DS7A 3M9MB 5KFXA 3CD5A 3DM2A 1HWKA 1WSVA 2VD3A 1QSLA 2MGZB 1GH8A 2LQJA 1HNIB 3ZXWA 5FIIA 1JJ2R 2HPUA 3J81j 1T9XA 4C4WA 1HNVA 3KLEA 3IAS9 4C8NA 2VL1A 3VVUA 3FZ2A 4CLSA 1JJHA 3NOGA 1APSA 4Q2MA 2VFVA 4A8YA 1X4CA 4Y6IA 4C0HA 1FRMA 5DRKA 1RZMA 3HZEA 1VI7A 1H2UX 1S12A 4YY3F 4NLPA 1G6BA 3GIKA 2NPFA 2DNPA 2AP6A 3FK4A 3QT6A 4B9TA 2NXCA 2HHUA 3M8QB 4URGA 1SB6A 3LF0A 4FVMA 1AROP 3N6LA 3QPIA 1W7WA 4ELVA 3HVRA 3QRQA 1RUSA 1KTVA 3MTJA 1XEZA 1VK8A 3BV8A 3BF4A 1REGX 2GHPA 3MR3A 1T8EA 2MHNA 5DGBA 2H54B 2CXEA 3K7RA 2QGFB 4R5PB 2RRBA 1NJXA 2I8EA 1RT1B 4JV1A 4GVBB 1SBRA 2V0NA 2VBYA 3Q8PB 4FZVA 4RKUC 2HURA 1C0UB 2CUYA 1IKVA 1F2HA 1SJFA 1KLNA 3NL0A 1YHQS 4JI5F 1KFDA 2F4FA 1MN7A 4YQWA 4E2FB 1SC6A 3DNCA 2BM1A 1PAUB 4B3OA 4OJHA 2V50A 4RLEA 4MIBA 2IM3A 2GIRA 4LVOP 1J5OB 4IO9Q 3C19A 1KQSR 1N54B 1ZM9A 3PCOB 1CSJA 3CDBA 5GAEI 4M94A 2QL7B 3QGGA 5CD4A 4KBIA 4H4MB 1T05B 2IJFA 4C8KA 5IT0A 2FB0A 3OXFA 3LPYA 3VAJA 3BR8A 1NSKL 2QLBB 5C25A 3OFEA 3JSMB 4AXJA 5LSRA 3PJXA 1R0BG 2B5JA 1QVGR 2E5JA 4ANCA 2B51A 4DWIA 1R6VA 4LIRA 4LUBA 4DG1A 4KT0C 1X9SA 3TVKA 3DI6B 3DXSX 2J6SA 1WHWA 5HMZA 4URQU 4RNNA 1KSPA 2HBZB 3T9NA 2LLZA 3K8VA 2E7XA 1URNA 3JQJA 2FTRA 1BD6A 5HBMB 1R8BA 2CPHA 1ROFA 1HD0A 1VFJA 1Q82T 3OJSA 2NREA 4NMXA 5BR8F 1XNQJ 3TAPA 4JI6J 3OLBA 3VVTA 3JTOA 3THPA 1K0VA 1WEYA 2QE5A 2MTLA 3GIRA 1WD6A 1O8BA 1HW8A 1YBAA 4YB5A 4V19J 1ZA1B 2H5EA 4ECUA 1CPZA 2Y8WA 2CAJA 4BS2A 2ZDPA 3GJSB 3CDWA 1Y3JA 2QMUB 1XMQJ 3GV5B 2IJNA 2N7CA 1LW0B 2CQGA 1SC4B 1UETA 3JTPA 1TKXA 1RACB 3DRYA 4K7QA 4DU7A 2RILA 3FJ2A 2R8KA 4USHA 2DHXA 3I0RB 3TA2A 2B9XA 2BANB 3HM9A 3I56S 3V6DA 2XZTB 1R3NA 2BBEA 1VR6A 5EUHA 4YP3A 3D6HB 4KGZB 1RTHA 4Z7YA 2ZH8A 3S01A 2HRYA 3TAMA 1YJTA 2CZ4A 4DSKA 4QYZK 4MFBB 2JEGA 4O0IA 4CO5A 2FY8A 2OPQB 1RHKB 4KGKA 2IPOB 3HHLC 4OI4A 3GYXB 2LXFA 2VQFJ 4U7UD 4DN0A 4U8YA 4MK7A 4PG4A 5GMDA 4ZVUB 2CPJA 4LREA 1KQKA 1WKKA 3H59A 4AYBD 1EP4A 5E3AA 1BMQB 3M8QA 1FEEA 3CDAA 3BKUA 5M2PA 2H3EB 4YN3B 2UUCJ 2OO4A 2VC0A 1OO0B 1YDLA 2W4DA 1X4GA 3HSZA 2B7BB 1DURA 2VV5A 3LWLA 7AT1B 4R5PA 1TK5A 5D15A 4OX6A 1VQ9S 3MEEA 5AXLA 4V19X 1PJ6A 3DRXA 2YNHA 1RT6B 1S76D 3BYPA 3MTKA 3K89A 5B09A 4QW8A 4IG0A 3CJQA 4EZ9A 1UEUA 5CZVA 2VKRA 3K58A 3FCVA 2LA6A 4OZLA 1T3NA 1S6PB 1RTZA 4HTIA 2IC3A 5KFNA 1EKSA 2XO7A 1T9YA 4ZMMA 5CA5A 1WOPA 2W2NP 3W66A 2I6WA 3M9OB 2LA4A 1KQGB 1XWLA 4JI8J 2C42A 1OQ6A 4DR2F 2LQ5A 3LP2B 4IKAA 4JI3J 1RTIB 5FD1A 2XBPA 4LSNA 3BS9A 3L7PA 4Z7CA 1TU0B 3JSMA 1WEZA 3BGLA 3EZOA 2V8GA 2ZHBA 3NAHA 1IKWA 3C2PA 1CJKA 3FNNA 4ILRA 2XMWA 4HVZA 1RABB 5BYRA 2NXNA 2Z8QA 1N5VA 3V6HA 1RT2B 2OTLS 5JVHQ 3GJQB 5KT7A 4NRUA 2MLZA 1H0HB 2A2DA 1FRLA 3OTCA 2XMMA 4DR3F 3CNQP 4DR4F 4USMA 3QLHA 1ITPA 3SDEA 5K14B 3KFWX 4ED1A 3PX4A 5B0GA 2AF6A 1N5SA 1RDRA 3CCRS 3AA8A 4I0WA 5BXIA 2DT9A 3C46A 2Z2YB 3Q8UA 4OYIA 1XN9A 3G82B 3H2LA 3KLGA 3G8TA 5E5NA 2EBEA 3BH7B 4MT1A 3CMQA 3KK2A 2HFZA 4LFCJ 5DLFA 4L3NA 1FRIA 3AFGA 1L3TA 1S57A 1CS4B 4X62F 1FE0A 3NWRA 3P5TL 1VRTB 1LW2A 4HT7A 4N41A 3LWMA 2FVQA 2YNGA 3ONQA 2KVQE 4O3RA 2MQ8A 2XMKA 1DY3A 4O3QA 4B9VA 1LW0A 4AL5A 1VBZA 4DCJB 3UO0A 2ZH7A 3LP0A 4PYDA 4IG3B 4C6AA 3HFKA 4U9RA 4B3MJ 4UUWA 5F0WA 3WQPA 3I0SB 2WCXA 3MD1A 3J7AN 2FLLA 4J5OA 3Q8QB 4CM2A 3WZ0A 3O8WA 3MM6B 2WONA 2UUAF 2DHSA 2WVDA 2HWIA 1GTEA 5CXTA 5JMNA 2V8HA 5B0DA 3IWLA 1RAOA 3KJQB 3CEDA 4QWEA 3QQCD 4A47A 2CKWA 2N4CA 3V6JA 4P2SA 3BQ2A 4MFBA 3M2RB 2XMVA 1EAYC 2JVRA 4ZPBA 3RB0A 2BE9B 5HP1A 3VGUA 1ZYQA 4ED2A 2PGCA 1WC3A 3H40A 3GONA 2Z30B 2QLJB 4AQYF 3EUNA 4C8LA 3JQKA 4L6V3 3M2UB 1ACMB 2H65B 2H5IB 2HFNA 4CO3A 3M30B 1E6VB 3OT9A 1TVRB 1BWVA 2N3OA 2Z56B 2EXUA 1Q4RA 1M5OC 4R0JA 4RBVA 4ATNA 2MY7A 1YQHA 1IXKA 4W90B 1KTQA 4DV5F 3ISZA 2J5AA 1X0PA 4I6WA 2YWGA 6AT1B 4V1Ak 5HI7A 2R7WA 4PABA 5LM7E 4OJ1A 5C7PA 1TELA 2YX7A 2PEHA 1A6LA 2KDOA 4LQ9A 4CCHA 3QJLA 2JRSA 2IYIA 4LF2A 2MZRA 2UUWA 2J6TA 2EW9A 1RT6A 2PI5A 1S6QA 1EJ7L 3FBFA 2XMUA 2RUSA 2PC6A 2HEKA 2VPXB 3NG8A 3DN9A 4C9DA 2N7YA 3RRGA 2GVZA 2FQQB 3C66A 2MJNA 1HNXF 1KC8T 5KFPA 3KUHA 4WFXA 3LP1B 1S0OA 1VMBA 3EGWB 2KFZA 1S6PA 3BR9A 2KT5A 3GIJA 5A6PA 2DGXA 1QDUB 2E5IA 1PAEX 1UFLA 1JKHB 3KKFA 3LPEA 3W62A 1KWMA 1OSDA 1VQYA 4DMZA 4MAKA 1FRXA 4PXCA 3FQKA 5IS2A 5AJ3J 3LP2A 2L08A 3OVSA 3T1HF 2HS0A 1KR4A 3GYNA 4BLGA 2W25A 2PFDA 1D8ZA 1Q8KA 2DNLA 1BUXA 2NZCA 2BE7D 2QSFA 1TQLA 2BJDA 3MXHP 2HHHJ 4K4SA 4JV5F 2GC8A 3EZ5A 3CCSS 1K73T 3HK2A 3FCHA 3H0PA 4NCGA 1HNWF 4PUOB 3D1OA 1SL2A 4URSA 4LF6F 2WW8A 2MQLA 4NEZA 3DDKA 4KE5A 2RVJA 4KHPJ 2BYCA 3LH2S 4UQTA 4QWBA 2NR0A 3UD4P 2E5GA 2LCWA 1R43A 2V8DA 1RWVB 4ED6A 3DLHA 2FIUA 2HGLA 3F56A 3HFZB 4LFAJ 4YEAA 2ZDOA 1IN0A 3A12A 2AJQA 2EI5A 3KJVA 2FY1A 4FXDA 2DNQA 2CQ1A 4EZ6A 3CPWR 1ZM3A 2W2OP 4U67Q 4LBPA 3PR5B 3I5CA 4LR8A 4EUVA 2NXUA 3UNYA 4NCBA 1RKIA 5T7LB 5CABA 4R0EA 1I6JA 2VDIA 2VG7B 3I9ZA 3EXYA 4IRKA 3R6LB 1RTDA 4N8OA 3EDRB 2G13A 1S99A 2QTWA 1N0UA 8ATCB 1RT3B 3DLGA 1RU2A 1GMVA 2LVWA 5LMUJ 3FBCA 3AA9A 1NK7A 4IG3A 1EQMA 4CLPA 3F41A 5HLFB 5LXYA 1UVIA 3MM6A 1T0TV 2DY9A 3ZZTA 2A2CA 3QZ7A 1H74A 2ZHOA 5ITHA 5E3CA 3PYDA 1NH7A 4EO8A 4M5DB 2LEBA 4DQSA 2CG4A 2HHWA 2UP1A 2BE2A 4M5MA 2F9DA 5I4MA 1T02A 2UUBF 1FFGB 1BQNB 4X4SA 3BYRA 2KRBA 2BXJA 4DBQA 4FDFA 2YPYA 3RTVA 4HKQA 4QOTA 1X4DA 2R8IA 4WKRA 3AH6A 4O3SA 4ECZA 1AT1B 3M2UA 1L3UA 4DUZJ 1NKBA 4CLZA 2DRAA 5K8NA 4GKKJ 4Y2CA 1E6VA 2KM8C 1TVRA 2OEJA 4LF9J 4DV1J 2MKYA 4DHVA 3QT7A 1WSRA 2G0CA 1G1XA 4K4YA 2KH9A 4YOEA 4ZCMA 5KT3A 4C3LA 5HMYA 1UVKA 4HR2A 5IOLA 3D5MA 4I7FB 4KPCA 2W4CA 1F5BA 4IH5A 1UKUA 4F3OA 5CCMA 2CQHA 4JI2J 2R42A 2B0GA 4DSJA 1FXLA 3MI7X 1GEHA 5SUHA 5DDRC 5IT9Y 2XO6A 4CRJA 2W9BB 1ULRA 3FZBA 3MAHA 5ETTA 4NL5A 1N5QA 2X1FA 4OX9J 2XS7A 3H4BA 1U0HB 5KOWA 4OHVA 3T41A 3I9V9 2W01A 4RW6B 1YJUA 2RKIB 2DR8A 1ZA2B 1BQMB 4J9PA 1LEOA 1IKXB 1YLXA 4LJMA 3FBBA 1FHTA 2MY8A 1RAAB 3I32A 3UI3A 1G2EA 4YMEA 2C2EA 1NPPA 2YWKA 4KJIA 1SJQA 2CRLA 4WFZA 4ZIWA 4NLXA 1FRKA 1RK8A 3QGHA 3EZUA 2YKPA 1UP1A 4X4PA 3IGVA 3JS9A 5E3RA 2HZVA 2J9EA 1HHSA 2MSSA 3N4WA 1NXIA 1FTCA 5SZTA 3BGRA 4XDDA 2V34A 2QA2A 1NZ8A 2LEAA 2WK4A 2OPRB 4CLWA 3DOKB 3R7NB 5T14A 1CJTB 1N6QA 2DHGA 5KFQA 3NY0A 3TZZA 2OH2A 1FNXH 2KT3A 1RHUB 4GC6A 2E1CA 1ELOA 2AJ0A 1HIYA 5A2QU 4QIWD 4J9KA 2LQ9A 4F4AA 2BW2A 3CF5Q 1AUDA 4A8XA 2OSRA 4TVAB 2RNEA 2EWHA 1T94A 4WIQA 2JLFA 3JAMU 4FKXA 1S1UA 2YQ3A 1BXNA 3SI8A 1EHWA 3EGVA 2E1AA 3UDEA 4PQUB 4NLUA 2RU3A 4ES2A 3CCVS 2DR9A 1FX2A 4XIUA 2XLIA 3QSYB 1CJVA 4KSEB 2VJVA 2QT7A 2VG7A 3DCAA 2J9CA 5F3ZA 2M9KA 2J0WA 3BM7A 2QFJA 2APOA 3G9CA 5L38A 3OLAA 1RT3A 1QD1A 1GMWA 1IBKF 3BZQA 3KG4A 2CVIA 4ZOSA 3G6XA 3MMCB 1RQ0A 4NCAA 3HVTB 5KG5A 2W8KA 3A8EA 1VDHA 1YJVA 4XAKA 3EYZA 1DARA 5J2MB 1RU1A 4ECVA 2HWHA 3W5ZA 4Z2XA 8AT1B 2BMBA 4FBTA 3GQCA 2EFPA 1O6XA 3D1HA 5D3GB 4Q8FA 2JNJA 2HQFA 5KFGA
chains in the Genus database with same CATH topology
3KUGA 4M5NA 5ETSA 1F9HA 5ETVA 4CWBA 1HKAA 3ILJA 3HSJA 3ILOA 4PZVA 3MCMA 1RB0A 3UDEA 4M5LA 2CG8A 3IP0A 4M5JA 5ETPA 4CYUB 3ILLA 1Q0NA 1RU2A 4M5HA 4M5KA 5ETNA 1EQ0A 1RU1A 2QX0A 3HT0A 4M5MA 4CYUA 2BMBA 2F65A 3HD1A 3ILIA 5ETQA 4AD6A 5ETLA 4M5IA 3UD5A 4F7VA 1CBKA 3KUHA 3UDVA 3HSZA 5ETRA 3KUEA 1TMMA 3HCXA 1RAOA 4CRJA 2F63A 5ETMA 3HSGA 4M5GA 1EQMA 1KBRA 1RTZA 3MCNA 5ETOA 1DY3A 1EX8A 1HQ2A 5ETTA 5ETKA 3MCOA 3HD2A 1G4CA 3HSDA 3QBCA 1IM6A 1TMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KUG A;  4M5N A;  5ETS A;  1F9H A;  5ETV A;  4CWB A;  1HKA A;  3ILJ A;  3HSJ A;  3ILO A;  4PZV A;  3MCM A;  1RB0 A;  3UDE A;  4M5L A;  2CG8 A;  3IP0 A;  4M5J A;  5ETP A;  4CYU B;  3ILL A;  1Q0N A;  1RU2 A;  4M5H A;  4M5K A;  5ETN A;  1EQ0 A;  1RU1 A;  2QX0 A;  3HT0 A;  4M5M A;  4CYU A;  2BMB A;  2F65 A;  3HD1 A;  3ILI A;  5ETQ A;  4AD6 A;  5ETL A;  4M5I A;  3UD5 A;  4F7V A;  1CBK A;  3KUH A;  3UDV A;  3HSZ A;  5ETR A;  3KUE A;  1TMM A;  3HCX A;  1RAO A;  4CRJ A;  2F63 A;  5ETM A;  3HSG A;  4M5G A;  1EQM A;  1KBR A;  1RTZ A;  3MCN A;  5ETO A;  1DY3 A;  1EX8 A;  1HQ2 A;  5ETT A;  5ETK A;  3MCO A;  3HD2 A;  1G4C A;  3HSD A;  3QBC A;  1IM6 A;  1TMJ A; 
#chains in the Genus database with same CATH topology
 3RGI A;  2IVY A;  2OPS A;  1FCA A;  1YJ9 S;  2I5J B;  4F8R A;  3QWU A;  2LP4 A;  2GVD A;  3BO3 A;  1S1X B;  1S49 A;  2NXJ A;  4TLR A;  1IQT A;  1HLW A;  5D8H B;  1FER A;  5J1P A;  2CVE A;  2F4V J;  4P75 A;  2QO3 A;  4OI0 A;  4ED7 A;  2W7O A;  2DEI A;  4KC5 A;  4ZIV A;  3W9J A;  3T9Z A;  3PHE A;  1RAG B;  2ZC3 A;  2VB6 A;  2CDR B;  3KLH A;  4KH1 B;  4NA1 A;  2A6O A;  4B9N A;  1Y5N B;  3OTD A;  4MK8 A;  5AE2 A;  2M52 A;  4NYO A;  1NEE A;  1Q5V A;  3MCN A;  2HLU A;  4DCO B;  1RWP B;  4C2M A;  4LQ3 A;  4C0O C;  1K1S A;  4Q45 A;  5E33 A;  3GB0 A;  2RD5 C;  4KIA A;  1NSP A;  1TKT B;  4P52 A;  1HR0 J;  3NNC A;  5FLX Y;  2PFF B;  4RR5 A;  5E7O B;  2R7X A;  4L74 A;  1U0H A;  3CME S;  2OEK A;  4YS2 A;  1BQM A;  3C6U B;  1IKX A;  2QN6 B;  1JLG A;  3N79 A;  3AD7 C;  4I67 A;  1X9W A;  4P2F A;  3UWT A;  2BJ1 A;  2DNO A;  2DIV A;  1QVF R;  3EJM A;  4FYW B;  1SUQ B;  1RA6 A;  2MHE A;  2XLK A;  3DLB A;  4CWB A;  3RAX A;  5KFK A;  5CYJ A;  5KFH A;  2CPE A;  4LMZ A;  1N33 F;  2I1R A;  3D6T B;  4ELT A;  1RWW B;  4R8U B;  1FTR A;  3RUB L;  1S5Z A;  2U2F A;  4I2P A;  3MPY A;  2H4Y B;  4F3M A;  4C48 A;  4DFP A;  1M0S A;  3KDN A;  1UMJ A;  3LAL A;  1U1K A;  1YTY A;  1JNR B;  2AIR B;  1P6T A;  2XNQ A;  4BWM A;  2R8H A;  3Q86 A;  3OL7 A;  2OPR A;  3C6T B;  7FD1 A;  3MPV A;  1CJT A;  2GNK A;  1JJ4 A;  1NHK L;  4CH0 S;  3HDS A;  4RUC A;  4MMO A;  4CLL A;  2DY1 A;  2QL9 B;  4AFF A;  4CT8 A;  3MEC B;  5D6G A;  4DV3 J;  3D4J A;  2C3M A;  3MUR P;  1VQS A;  4J9N A;  4NLT A;  5F9N A;  3R7S B;  3NGS A;  3O3L A;  4YUD A;  2HZC A;  4O0N A;  3PYE A;  1CUL B;  2VBZ A;  1CC8 A;  2VIH A;  1ZS6 A;  3ZZZ A;  3KJF B;  3K2Y A;  4NZ7 A;  2AJ4 A;  3LAK A;  4B9S A;  3H8Y A;  1I94 J;  4X65 J;  4BC7 A;  3EVW A;  4PQU A;  4ZJL A;  2ZH2 A;  2IFX A;  5DZ6 A;  2DGV A;  9ATC B;  3IM8 A;  3IRW P;  1OY9 A;  2W7P A;  3PW2 A;  3RW7 A;  3LGN A;  4LF8 F;  3PAC A;  3CSK A;  2FVP A;  2H5J B;  4J7C A;  2VFT A;  2R7Q A;  5F3T A;  2DK2 A;  4JP8 A;  1YBT A;  4NXM F;  3H5X A;  1QY7 A;  3CDE A;  4MJK A;  3TWZ A;  4LF7 F;  5E41 A;  5KFC A;  2L9D A;  5EN1 A;  1CQM A;  1NSQ A;  2JSX A;  3HVT A;  3KLI B;  2IBO A;  2GHV C;  1FE4 A;  4DI6 A;  2D69 A;  3GIL A;  4C3K A;  5J2M A;  1V5V A;  4PPZ A;  3NS7 B;  3G96 A;  2LXI A;  4OJG A;  2CZV C;  2K1R B;  3US5 A;  5D3G A;  5ETV A;  2HS4 A;  1C4C A;  1RA7 A;  3F73 A;  2HFS A;  2KHC A;  2ZJP Q;  3ENV A;  1OQ3 A;  2OPP A;  2I5J A;  3T1Y J;  2F1F A;  5I3U A;  2F40 A;  3W2W A;  1Q7L B;  3HSG A;  1GMW D;  3MMA B;  4MKY A;  2EFV A;  3HHN B;  1H3D A;  3MF5 A;  2VOP A;  1FJG F;  2BJ3 A;  5A8W B;  3OR2 B;  4NPO A;  1IR0 A;  2VHG A;  2V68 A;  1DHM A;  4JYA J;  3V4M A;  1UWA A;  1UVJ A;  3I55 S;  1QE1 B;  4ZLL A;  1JXE A;  5CH7 B;  2XZD B;  1WDT A;  3WIV A;  4OI6 A;  4EWT A;  4P71 A;  1RAJ A;  4H54 A;  2PSZ A;  4HDH A;  2MEW A;  4KKO A;  3ZC4 A;  3FFI B;  4LSZ B;  3LA0 A;  3TP2 A;  1U1P A;  4L75 A;  4H4O B;  1Y00 A;  1PCA A;  2HHT A;  3N9U C;  4G65 A;  4ZJQ A;  2JFK A;  5THW A;  1N5Y A;  1UPM B;  3NGT A;  1X0F A;  1TL7 B;  1VRU B;  2XEX A;  4CI0 B;  3GV8 B;  1EB0 A;  2A3J A;  2PI4 A;  4ZHR B;  2QSW A;  1DBD A;  3IAM 9;  2MB0 B;  1H7X A;  1WEL A;  4NE9 C;  2ZD1 B;  4BDP A;  2CQB A;  2E9T A;  4Y2M A;  3W9I A;  2Y1J A;  1LXN A;  2XMA A;  2HQG A;  1PBU A;  4IRC A;  5MLC V;  3VAF A;  4Y65 A;  5KOX A;  4DUT A;  1NK6 A;  4B9U A;  2DR7 A;  4FKY A;  2VG5 B;  3FSX A;  2WBM A;  2MZ1 A;  2QIF A;  2DYA A;  3N6N A;  3WBZ A;  2ZJQ Q;  1OMS A;  1C4A A;  2B4U A;  3DLJ A;  2PA3 A;  1FFS B;  4TY9 A;  4EBD A;  4LBH A;  5C2C A;  3TUZ C;  2OHD A;  2KZM A;  1CLF A;  1FKO B;  3I87 A;  1U02 A;  4LIW A;  4PXE A;  4NLD A;  1M1H A;  2R8G A;  1S1T A;  1S7I A;  2AU0 A;  1DZ5 A;  1AXQ A;  3CD0 A;  3W1Y C;  3DRP A;  4ETX A;  3GG0 A;  1FEH A;  1C0T A;  3EM1 A;  1U6F A;  4C0B A;  2RE1 A;  3J7A 1;  5KFM A;  4N47 A;  2J9D E;  4JI0 J;  2X7I A;  4HI2 A;  2OUG A;  1CJU A;  2YTC A;  1MU2 B;  2HNY A;  1JLC B;  2W24 A;  4R25 A;  3G8S A;  5CAA A;  2KZZ A;  3UD3 P;  2ZBC A;  2M8H A;  1YKW A;  2NLW A;  2HK2 A;  4OMF G;  4DEZ A;  2WVF A;  1UVN A;  4K4X A;  5HAN A;  1XNQ F;  4DV4 J;  5DG8 A;  5J1E B;  4JI6 F;  1UW9 A;  4ZJO A;  3NLC A;  1XR7 A;  2ROE A;  1ZZF A;  5DO2 A;  1R8P A;  4JI4 J;  3RB4 A;  1ICE B;  3BBF A;  2BQR A;  2F9J A;  5KFV A;  3PW7 A;  5J2N B;  2KG0 A;  1SV5 B;  4F4X A;  2X51 A;  2R7O A;  2ADC A;  2DVI A;  8RUC A;  1SXL A;  3U27 A;  3ZTO A;  4LRC A;  3C15 B;  3I5B A;  5A0Y A;  3OSP A;  4OJ3 A;  2RSQ A;  2HFV A;  2DGS A;  3LQV A;  2DH9 A;  4TU8 A;  4NLW A;  2Q3P A;  4TXS A;  3WIU A;  4MTP A;  4U7C A;  3MEG B;  3R97 A;  1FES A;  3CIZ A;  1JLF B;  2OMO A;  3Q89 A;  2GHW A;  1KNZ A;  1NDP A;  4OLO A;  4KO0 A;  2XI2 A;  3UDC A;  1M1G A;  1OYE A;  1VYA A;  1I1G A;  3UW1 A;  3MMJ A;  2EFN A;  2CPI A;  4P2M A;  2MKK A;  2DD8 S;  2L9N A;  1H98 A;  2QLX A;  4OZ1 A;  2E7W A;  1YZ6 A;  2AZ1 A;  1X7V A;  5DG7 A;  4PKD B;  1ZM4 A;  2ZVI A;  4RPF A;  1U0S A;  4ITS A;  5D77 A;  2K7J A;  2XGP A;  2E7V A;  2ZBP A;  3M8Z A;  5AE3 A;  1OY8 A;  1YBU A;  4C8Z A;  4NYZ A;  3ITH B;  3H25 A;  2VQF F;  4FXW A;  5KFB A;  4Q43 A;  1TKZ B;  4X84 A;  2O01 C;  2RML A;  2BKO A;  3W8P A;  4RW8 A;  5E3Q A;  3LAM A;  1O51 A;  2WZ1 A;  1NK4 A;  1KBR A;  2XS5 A;  1SVD A;  2XCP A;  1RBO B;  1XMO J;  3RZA A;  1MSW D;  4NLY A;  5AXN A;  1IUJ A;  2P8I A;  1X8D A;  3DRR B;  2E1R A;  2UUC F;  1WHX A;  3PEH A;  4IOA Q;  2Z2Z A;  4YDX A;  3G6V A;  2P9C A;  3W7B A;  4RNO A;  2HMI B;  2WAQ D;  2V2K A;  1VRU A;  1Q8I A;  2DGU A;  5DGA A;  4ZHR A;  1AYE A;  3OUY A;  3OFF A;  5D4P A;  3X1L B;  4X4R A;  3R5D A;  1HKA A;  4IO1 A;  2ZD1 A;  2D41 A;  2R4F A;  2OKQ A;  2ILZ A;  4YY3 J;  1UA1 A;  5EWG A;  1FVS A;  4IH7 A;  4IDK A;  1F60 B;  2OAU A;  2OP5 A;  3ENA A;  2HIQ A;  4KAI A;  4DZ6 A;  2OTJ S;  2BQU A;  4WE1 B;  3DHW C;  5CYQ A;  2WOM A;  1BY9 A;  2ZNY A;  2QV6 A;  1UVM A;  3NMA A;  4UOH A;  2EKN A;  5K5M A;  5DDO C;  4ZPV R;  4JI8 F;  4EYI B;  1IJE B;  1Y5I B;  2G0J A;  4JI3 F;  3RBZ A;  3D9B A;  3VZH A;  1X4F A;  5KFD A;  4QIF A;  2A10 A;  1SH3 A;  4I56 A;  1ZOT A;  1UJ5 A;  3CD6 S;  3DMJ B;  4ETZ A;  5GAD I;  2HHV A;  3SXL A;  3ILL A;  1HBN B;  4PWD B;  4E8U A;  4EGL A;  1HPZ A;  4ZP6 A;  4B08 A;  1UCN A;  3J80 Y;  3RRK A;  3M9N B;  3BDP A;  4H4K A;  2AMC B;  2ZE2 B;  2ZH3 A;  2Y1I A;  1MU2 A;  5KT5 A;  3HP6 A;  4DU8 A;  3TX8 A;  4DSI A;  1WC0 A;  4P72 A;  4RW9 A;  3MOJ B;  3KK3 B;  3V81 A;  4DPO A;  1U6Z A;  4ICL B;  2V94 A;  3J81 U;  1YJN S;  4F4Z A;  1HBU B;  5K9F A;  1FA0 A;  4USI A;  5D78 A;  3SIP B;  3IBW A;  3R9L A;  3VR1 A;  2ZWP A;  2HVH A;  2N82 B;  2NYI A;  3CJK B;  1YX2 A;  2OI2 A;  2QA1 A;  3VAK A;  4B3T J;  1VBK A;  2J0Q D;  1NB7 A;  4DF8 A;  4DX7 A;  2DNY A;  2K7K A;  3MR2 A;  1WC1 A;  4LFC F;  1SV5 A;  2M2B A;  4FYX B;  2O3D A;  1SKR A;  3W61 A;  4AL6 A;  3D67 A;  1Y9O A;  5F8L A;  3DLE B;  4M5G A;  3C15 A;  3QAE A;  4NOH A;  2CPF A;  1GNK A;  1WOR A;  1FD2 A;  1UZH A;  2Y1R I;  2OFG X;  1NJZ A;  2DPI A;  3P5B P;  1S0M A;  3H5U A;  3MAA B;  3MM7 B;  1I51 B;  1XR5 A;  2YX4 A;  1S0V A;  2JEI A;  4B3M F;  2FVR A;  5C5J A;  3UNG C;  2CNL B;  1TL1 B;  4NWB A;  4IH6 A;  1LK7 A;  4OZ5 A;  1N52 B;  3CUN A;  2ZZN A;  3DM2 B;  2J7W A;  1K9M T;  1UA0 A;  1G3O A;  3H4D A;  1AA1 B;  5D0G A;  3H98 A;  1XTZ A;  4NA2 A;  5A8K B;  4X4Q A;  4J90 A;  2UVV A;  1Q79 A;  3UQS A;  4O3P A;  4NAS A;  4DF4 A;  4GKJ J;  3GMG A;  2FHJ A;  4GC7 A;  2NPI A;  2ABY A;  2VH7 A;  3MCO A;  3I6P A;  1FX4 A;  2XWX A;  2BOP A;  2ZH4 A;  3H2V E;  2ZUG A;  3L7O A;  1U2C A;  4WYW A;  2CPX A;  3QSI A;  5G0R A;  1TKZ A;  1RSC A;  3R2C J;  3EMT A;  1OWX A;  3K5L A;  3A4T A;  2HNZ A;  2AJ2 A;  4I69 A;  3AJD A;  2B3T B;  3Q83 A;  1B3T A;  2LU1 A;  1JXL A;  2KFN A;  1IBM J;  1XIQ A;  3IFE A;  1WHY A;  3M8Y A;  3BBC A;  2HHX A;  4QPT A;  4XDC A;  4Y2A A;  1J2V A;  5ETO A;  3WC0 A;  1VQO S;  2VFR A;  3TUP A;  3TQ1 A;  2CQ4 A;  2EFQ A;  2GCF A;  4FF2 A;  2DGT A;  5M2R A;  2LQ8 A;  4X2B A;  3IA0 A;  4ECY A;  3EGN A;  3SCJ E;  3CCM S;  1ZPV A;  4RU2 A;  3ELH A;  3PW0 A;  3TYT A;  1F3V A;  4I6Y A;  2XQC A;  1HMV A;  1DJ0 A;  2AJ1 A;  3MCS A;  3SYZ A;  1U1L A;  1RB0 A;  4WXO A;  4HHH A;  1U4B A;  4PXD A;  1IKV B;  3PIP Q;  2MDA A;  4X4V A;  4DSE A;  5B7W A;  1P9Y A;  2CYY A;  1QJH A;  2NCK L;  3LW5 C;  2Q1L A;  2IRU A;  4K0K J;  4TU7 A;  4QZV B;  2GO9 A;  1SL0 A;  3V2U C;  1R0A B;  5AJ3 F;  2PN6 A;  1JLE A;  3I4H X;  3RAM A;  2F8H A;  1MML A;  3C14 A;  1Q8L A;  1RAF B;  1KOO A;  5L46 A;  5F8N A;  1RWM B;  2JLG A;  5GAG I;  2VAS A;  4M8L A;  2W2M P;  5JJB A;  2HHH F;  2DIU A;  4OYO A;  2H51 B;  4MIW A;  3WX4 A;  1WC4 A;  3RR7 A;  4X4T A;  2CPZ A;  4PWD A;  1U1M A;  2XCA A;  3TAR A;  3BGF A;  2JOQ A;  1SQE A;  1FDA A;  4ID8 A;  4DR5 J;  2ZE2 A;  5C25 B;  5J2Q A;  4B3S J;  3KK3 A;  2HBR B;  2C3Y A;  1I3O B;  4DG1 B;  1S6O A;  1HBU A;  4LFA F;  2W1B A;  3H5S A;  4Y0F A;  1KD1 T;  2FGO A;  2DR6 A;  3QAU A;  4ZVP B;  5GAH U;  5IQ6 A;  2M7S A;  2ATL A;  5A8R A;  4CP5 A;  3G6E S;  1WF0 A;  4AL7 A;  4DPY A;  3CJK A;  4HEA 9;  4M5I A;  1ZTT A;  3M6U A;  3NS6 A;  1HL6 A;  4DR2 J;  2FJX A;  2AQ4 A;  3DOM A;  3X3U A;  3QO9 A;  4OYW A;  3LUY A;  5DLG A;  2BX6 A;  1F2G A;  5H9E K;  3VAL A;  2MZQ A;  1R31 A;  4CO4 A;  4CLT A;  3PEJ A;  1PJ5 A;  4TNO A;  3HHL A;  4YFU A;  2QA4 S;  2B9Y A;  4QWC A;  2X1B A;  1M5H A;  5E0O A;  3FUY A;  1LKZ A;  1MRO A;  1U48 A;  5HQM A;  3UFC X;  3Q2S C;  5LMU F;  5CZX A;  3IR6 B;  4FN5 A;  2PT0 A;  4PG6 A;  4ZCL A;  3HMJ G;  2OEM A;  4USK A;  1UPP A;  1RHJ B;  4DR4 J;  1TL1 A;  3C16 B;  1UEV A;  3IBF B;  1U7L A;  3M4X A;  1K47 A;  5LT5 A;  5ETM A;  3NAI A;  2G1H A;  3QAT A;  1TKX B;  3MM8 A;  4MKB A;  3QIP A;  1YI2 S;  2HQI A;  4DOZ A;  1JXV A;  5A8K A;  4ANE A;  3IRX A;  3U02 A;  3FMW A;  3SV4 A;  1E6Y B;  3HVA A;  3IS9 A;  3V6D B;  5D4O A;  5LMN J;  4RUB A;  1N32 F;  2YH0 A;  1RT4 A;  4X62 J;  1NHV A;  3L9Z A;  4XPE A;  2XC9 A;  1RTH B;  3CWJ A;  5KG4 A;  3PJW A;  4KB7 A;  2JEJ A;  1SPB P;  2XHW A;  1RBL A;  2ZH9 A;  4QIV A;  1N4L A;  2IM2 A;  3AOA A;  3NWG A;  3TAM B;  2W9A A;  3RG6 A;  4ECW A;  1SCJ B;  1B0P A;  4DUZ F;  3KG1 A;  4GKK F;  5K20 B;  4LF9 F;  4DV1 F;  5D4N A;  3TEH B;  1JWW A;  2VG6 A;  3BQ0 A;  2R2U A;  4ZPW R;  2FHJ D;  5AT1 B;  3P3D A;  4JI2 F;  1TUW A;  1EP4 B;  2OEL A;  3OVB A;  3M1V A;  4WBF A;  3RBE A;  1Y5L B;  1SIZ A;  4DR6 J;  1S4F A;  4I68 A;  3HHK A;  2DPJ A;  1HWU A;  2YKQ A;  3VF0 B;  1KDN A;  4CLU A;  4F0M A;  3S8S A;  4OX9 F;  4QW9 A;  1SJ4 P;  1KLM A;  1SL1 A;  4DX8 H;  1IBL F;  2MQO A;  3FGV A;  2V69 A;  3MEE B;  5C42 A;  5AXM A;  5RUB A;  1CQN A;  1JB0 C;  2HQ3 A;  2YNH B;  2MKI A;  2KU7 A;  3D6M B;  5DM7 Q;  3DDI A;  1HWJ A;  4IG0 B;  1DLO B;  2V6A A;  1TL5 A;  4DPX A;  3ENW A;  4ZVF A;  2PD1 A;  4P10 A;  1FWK A;  3VHQ A;  5KT4 A;  5IXU A;  4K8R A;  1U6B A;  1PYT A;  3FEZ A;  3IO1 A;  3E01 B;  1R0A A;  2J8S A;  4EBC A;  5DZ7 A;  4G1Q B;  2IC3 B;  1GQE A;  4OFZ A;  2DR5 A;  3MUV P;  2CPY A;  4N77 A;  2FD2 A;  3ICL A;  3W5X A;  2GS8 A;  2MLY A;  3CMA S;  1FKP A;  4DQR A;  3VV2 B;  1IKY A;  3N01 A;  2FJA B;  3K5N A;  4EU0 A;  1LWE B;  3AHP A;  4W98 A;  4FYY B;  4LSN B;  4ZLJ A;  4N8N A;  3UDV A;  2ASJ A;  1IKW B;  2WVE A;  5EX0 A;  5H9F K;  1CJK B;  5I42 A;  1S1V B;  2VC1 A;  4QPX A;  3KG0 A;  3EDQ B;  3KHL A;  4KGX B;  3MPD A;  2E5L J;  4OZJ A;  2FPH X;  3D6F B;  1JLA A;  2OD6 A;  1XER A;  5E3P A;  3QRP A;  2VQE J;  1B64 A;  4OL8 A;  4J9L A;  4PR6 A;  3O5T B;  1GX5 A;  3MPW A;  2MPU A;  3QLH B;  3SDE B;  1N0V C;  3T5J A;  3ISN D;  2AZ3 A;  2WVC A;  1FK9 B;  1WEX A;  2FZK B;  1QTN B;  4WFY A;  4OV6 A;  1PYO B;  3HHE A;  4ZVO B;  2BAB A;  3TEG A;  3KLG B;  1FT8 A;  5HAT A;  4F4W A;  2D3Z A;  2L48 A;  2HND B;  2F8M A;  3KK2 B;  3KTQ A;  2LDI A;  4NXN J;  5DQG A;  3KUG A;  2Z58 B;  2KJW A;  4NX9 A;  3NMR A;  3PYF A;  3QMQ A;  1S0N A;  1KS2 A;  4DZD A;  1LW2 B;  1M5S A;  4DPW A;  2YNG B;  3PRV A;  4RWW A;  1SQF A;  3C16 A;  3SQG A;  3J7Z T;  5KFI A;  4UY8 5;  3HLU A;  2X3G A;  3D68 A;  2X1A A;  2ZUA A;  3CJ8 A;  3LP0 B;  3DGP A;  4YR2 A;  5HQ8 A;  4M5K A;  1KHV A;  3OXG A;  2VIC A;  1VC5 A;  2XI3 A;  1KHW A;  1RT5 A;  1X5O A;  2R7V A;  2ZWO A;  3D28 A;  3GLJ A;  4X4N A;  1E6Y A;  4XK8 C;  3W5Y A;  1NJY A;  2WON B;  3ZO7 A;  4JBC A;  1KVI A;  4ZPC A;  4QWA A;  1VC0 A;  3RJM B;  1YSJ A;  5IWA J;  2F4V F;  3M2V A;  3JYT A;  4WZM A;  1VLO A;  3KXD A;  1S59 A;  2WBR A;  1JQG A;  3Q8V A;  5KT2 A;  2A1B A;  4Q44 A;  1I5O B;  4WII A;  2H9Z A;  3GCW P;  1VQ7 S;  5F9L A;  3NEK A;  5HP1 B;  3POT A;  2RQC A;  3TJA A;  5GMK a;  2LFV A;  4C3M A;  2D9O A;  1PJ7 A;  2HVD A;  4LT6 A;  1IJF B;  2VA3 A;  1U47 A;  4NLS A;  5D0E A;  2DNZ A;  3CJ5 A;  3TJ9 A;  4RNF A;  3CUL A;  3PZP A;  5KFR A;  3MUT P;  4CTA A;  3FQL A;  2YBV A;  2N4D A;  2CQ2 A;  4AD6 A;  2BVZ A;  1U45 A;  3UR3 C;  3EPG A;  3KUE A;  3CCL S;  3PNI A;  3KNG A;  2IAJ A;  3T5H A;  3D54 A;  3O2I A;  1BWE A;  3DLK A;  3D2W A;  1S6Q B;  1X60 A;  4ZVT B;  1DLO A;  3PW5 A;  2C2M B;  2GVZ B;  3PYG A;  3UN2 A;  2DO0 A;  4FNI A;  4ED5 A;  4HLB A;  2I0X A;  3FCW A;  4HYK A;  4ALZ A;  3E01 A;  3OXL A;  2RDD A;  2RQK A;  4G1Q A;  1TR0 A;  5EDW A;  2DGQ A;  4L72 B;  4KYZ A;  3IWX A;  3OHA A;  1NB2 A;  4WCE Q;  5KG0 A;  4YHH J;  1S77 D;  4ZDN A;  2W9C A;  2RRN A;  1M5K C;  4NLR A;  2HBY B;  3DDN A;  1LWE A;  3CO9 A;  4I6A A;  1HI0 P;  1XC9 A;  1HD1 A;  2EEY A;  3W8G A;  3M8W A;  4F7V A;  4RO0 A;  4Q5V A;  3U7J A;  4ZLP A;  2VZ9 A;  1S1V A;  2ZM6 J;  4NCG B;  1AUS L;  2IDL A;  4LF5 J;  2UXB J;  2CQI A;  3GV7 B;  2AKW B;  3MM9 A;  1WC5 A;  4DPU A;  1X5S A;  2B6A A;  3QGI A;  1UJ6 A;  1U49 A;  2RHS B;  3W3S A;  3EIC A;  3Q22 A;  3A8K A;  2K3I A;  1YJR A;  4PG7 A;  1TAU A;  2KG1 A;  4DN9 A;  1I94 F;  3PKM A;  1TP7 A;  3BPS P;  4DFM A;  1RHQ B;  3UCZ P;  1T03 A;  1FJE B;  2YWH A;  1Q1K A;  1FK9 A;  4DV0 J;  4PXB A;  5B0F A;  3DHX A;  4K4W A;  4RL1 A;  3KJV B;  3MDF A;  5CQG A;  2RU9 A;  4LSL B;  3A1Y G;  4PQA A;  1RTJ A;  5E2Q A;  3R7B B;  2UVR A;  2HAF A;  4FF3 A;  5HMW A;  3WDO A;  1H72 C;  2MST A;  2IHR 1;  2GMJ A;  5IFM A;  2MKC A;  2ZVS A;  2HND A;  4CLY A;  1XNR J;  3GPA A;  3W2V B;  1WAC A;  2IJR A;  4ECT A;  5KFA A;  3DRS A;  3M8S A;  3M8P A;  5KFU A;  4DLE A;  2XUL A;  1RHR B;  4UT4 A;  3KLV A;  5A6W A;  4P7T A;  2ALZ A;  4B02 A;  2R2S A;  1RTD B;  4B17 A;  1SIW B;  3HXM A;  2GX8 A;  3E3X A;  4DCP B;  3V4I A;  1ZAV A;  3DLG B;  3GSI A;  5ETS A;  2G4B A;  1FVQ A;  1B70 B;  3PXG a;  3T1Y F;  3ZZP A;  1OJ4 A;  2BUN A;  3HJV A;  4IYQ A;  3BQ1 A;  1P9Q C;  2RF2 B;  2DNG A;  3KYL A;  4WFA Q;  1IM6 A;  1F5C A;  2JVO A;  3SSS A;  2B4P A;  3PX6 A;  1SJ3 P;  4Y28 C;  3BO4 A;  3PKY A;  1PO6 A;  3FKB A;  2ACY A;  4ER8 A;  2M4M A;  4UOC A;  2QG9 B;  2R3V A;  3AQO A;  5EHH A;  5AE1 A;  3DOL A;  2CZ9 A;  4HH1 A;  2BE2 B;  2PDA A;  2HKE A;  2P6S A;  3QGP A;  2Q66 A;  2YNF B;  5I3P A;  3DYA B;  4LF4 J;  1GFW B;  4MK9 A;  2HGM A;  2VPY B;  4LRA A;  3R8Y A;  3S6E A;  2C3O A;  3GR0 A;  1HA1 A;  3IXQ A;  2CNN B;  3V6K A;  5CHC B;  3TUJ C;  2C2O B;  2Z2L A;  5HJY A;  2DKO B;  2KFY A;  3A8J A;  4DQP A;  5CYM B;  3PM9 A;  2DGO A;  1Q7Y T;  1D3W A;  4ZVS B;  2UVW A;  1VBY A;  1X4E A;  3HKZ D;  2AEF A;  1WC6 A;  2V9K A;  1S9E B;  2F5G A;  1VQM S;  1CVJ A;  4DR1 J;  5I3Q A;  2PII A;  3CC4 S;  1R8A A;  4QU6 A;  3BEG B;  1TUV A;  2MJU A;  2AV5 A;  1RWK B;  1U1O A;  5T41 A;  3OBI A;  2QEX S;  1SKU B;  2CWX A;  3R5A A;  4DV7 J;  3CVK A;  4HL9 A;  2Q6C A;  2XSJ B;  2AGO A;  3OQ2 A;  1BC6 A;  4QCL A;  3Q24 A;  2COL A;  3R6G B;  2FLP A;  4DXL A;  1NME B;  2Q43 A;  5GAE U;  1N48 A;  4BCA A;  1KKH A;  3IG1 B;  2C28 A;  2GFF A;  3BO2 A;  3AB4 B;  4NEY A;  4IFY B;  2KL8 A;  3TZX A;  4P73 A;  4DL0 C;  1D1U A;  1TL3 A;  2GAG C;  1KN6 A;  2YKN B;  1F9E B;  2C2R A;  3CCQ S;  2E9Z A;  2B4V A;  1B4S A;  1QAI A;  2DEJ A;  2ZKT A;  1QAY A;  2ZEJ A;  2EBG A;  2GAH C;  1NK8 A;  3BKT A;  1U1N A;  1WOS A;  3G86 A;  4PAA A;  4A8F A;  4DR7 J;  3HT0 A;  1XJW B;  4WP8 A;  1QAX A;  4JI0 F;  3OR1 B;  3ETO A;  4O4G A;  1UFK A;  3MM5 A;  2XNR A;  4A46 A;  2IDE A;  2BV3 A;  1FKA F;  3BGR B;  4IQX A;  4HH0 A;  3U1N A;  3FMB A;  2J9D A;  1N6Q B;  2G2O A;  3P96 A;  1K0T A;  2UXD J;  1Z2Z A;  3I4P A;  4O44 A;  3SSQ A;  2CJ9 A;  4CH7 A;  4OYZ A;  1RYS A;  4OV1 A;  1RWX B;  1UL3 A;  4JI4 F;  1JLB A;  3P49 B;  3JXO A;  4D3G A;  1KVJ A;  5DDP C;  3OTO J;  3OTB A;  4LSL A;  1KRP A;  3GJT B;  3PRB A;  4OLP A;  1S1U B;  4QYZ J;  2ZBQ A;  2ATC B;  3R2D J;  4OZN A;  2HW3 A;  1YG0 A;  3D3B J;  2OGU A;  3HVW A;  5KT6 A;  4JV0 A;  3W2V A;  3GFY A;  2NUU G;  1CJV B;  2GV1 A;  3NGK A;  4LFB J;  2ZKU A;  3BBB A;  3K17 A;  5KFO A;  1VIX A;  4NLV A;  4Y2K A;  3HT3 A;  1PG5 B;  3EGZ A;  2DJW A;  2UV8 G;  1VJW A;  4M95 A;  1JLQ B;  1W26 A;  2VFU A;  4J9Q A;  4Q0B B;  2KI2 A;  1SC3 B;  1VQL S;  2UU9 J;  3TA1 A;  2FC8 A;  1H2T Z;  4EBE A;  4IOB A;  4TY8 A;  1RWO B;  3NRB A;  2RF2 A;  5FDL A;  4MKA A;  1B7Y B;  3ZZU A;  3T5L A;  2CJK A;  2ZH6 A;  2BJ7 A;  4USU A;  5KFL A;  4Z37 A;  3HJF A;  5J2P A;  4NA3 A;  1GXU A;  2OPS B;  3CTR A;  4MKV A;  1RKJ A;  5KFF A;  3QT5 A;  4ZVH A;  1NND A;  4U6P A;  2GVD B;  3EWG A;  5L1L A;  2YNF A;  4LF7 J;  3DYA A;  4K4T A;  4WYL A;  3H20 A;  4WFB Q;  2UXC J;  2HRT A;  3EVM A;  1VCT A;  1XMO F;  4CQ1 A;  1SH0 A;  3IGN A;  2ASL A;  4DV6 J;  3GFX A;  5CYM A;  3CCJ S;  4GO5 X;  4BWJ A;  1LFP A;  3CE8 A;  4RWX A;  3KLH B;  1DAX A;  2VF3 A;  2YVS A;  1S9E A;  4ZN3 A;  4USV A;  3OW2 R;  3TRG A;  4OIX A;  2NXE A;  2J6U A;  4OYM A;  1LWC B;  1FJG J;  3GFZ A;  1D0E A;  2RT3 A;  4P9S A;  2XSJ A;  2UV8 A;  4CT9 A;  1C1C A;  2NUH A;  3M32 A;  3P8B B;  2DH8 A;  2VFS A;  2DGW A;  1RAI B;  4CNY A;  5HSP A;  3IG1 A;  1X5T A;  2YH1 A;  5LL6 d;  3ZZY A;  1V3Z A;  4DLG A;  5KFW A;  2KXN B;  1WKL A;  2HVI A;  4IFY A;  4EO6 A;  2AD9 A;  5KG6 A;  3KOA A;  1HYS A;  3KDO A;  1JLG B;  3MEK A;  3UDL A;  1HQU A;  5IT9 U;  2YKN A;  4LBI A;  2QLF B;  4JI7 J;  4L73 A;  2BRK A;  1DTT B;  4F50 A;  1K8A T;  3SSR A;  1B0T A;  2EG1 A;  1WUU A;  5L1J A;  1Q81 T;  5HRO A;  5L8R C;  3IR5 B;  2BA9 A;  2FLO A;  3BH6 B;  3H2U B;  1X9M A;  4I2P B;  3NBP A;  3GZ7 A;  5B0B A;  5HL7 Q;  3OJU A;  3HI9 A;  1NRK A;  4NZ6 A;  3OR1 A;  3ZTP A;  2VPW B;  2JFD A;  3HF5 A;  4GVL A;  3KMS A;  3VAM A;  3OSN A;  2I2Y A;  1NH8 A;  3RU0 A;  4WKY A;  2MQP A;  2E29 A;  4DFJ A;  1UWB B;  3DXB A;  3NGU A;  5F8H A;  1IBC B;  4LF1 A;  2Z2M A;  1Q0N A;  4J37 A;  2YWW A;  1Y7P A;  4N56 A;  2P5V A;  1EET A;  4B3T F;  3UR0 A;  2IY5 B;  4S0M A;  2DHH A;  2ZBI A;  3AD9 C;  3D0G E;  2DRD A;  2V8V A;  4C11 A;  3L4B C;  3CCT A;  1M90 T;  2CFX A;  1D9D A;  4JI1 F;  1FXR A;  2LU2 A;  3ILJ A;  3CJT A;  4CH1 A;  2UVU A;  4QYR A;  4K59 A;  3LGM A;  2V8P A;  5D0R A;  2Y1L B;  2AGQ A;  4EYH B;  1FI4 A;  1DTQ A;  1T95 A;  2AX0 A;  2XMT A;  4TLQ A;  4JV2 A;  2L41 A;  2QX0 A;  1JLQ A;  4YDD B;  4Q0B A;  3C3L A;  3HZG A;  5DDQ C;  2DTJ A;  5DG9 A;  3TZY A;  4KFB A;  4EI2 A;  1RLD A;  3R5J B;  3AJ1 A;  1N8R T;  2FGC A;  1WDD A;  3FC9 A;  2NS1 B;  1FWL A;  3RRH A;  5F8G A;  5HVH A;  4GKJ F;  3HPO A;  5B08 A;  5L1I A;  2CQD A;  2KO1 A;  3OTE A;  2QRR A;  3HD2 A;  1R8H A;  4FVC A;  2IVM A;  4ZK7 M;  3AAW B;  4E0D A;  2OPP B;  2XY6 A;  2FVS A;  4CO0 A;  4UOF A;  5I3U B;  4FXV A;  3W2W B;  5IM0 A;  3PRD A;  2QC3 A;  5F8I A;  2JH3 A;  1HHQ A;  1EX8 A;  1NPK A;  1MWQ A;  3ISN C;  3M7V A;  4NI2 A;  1WOO A;  1OYD A;  1S9G B;  5G4D A;  4WTO B;  1UZD A;  1PGZ A;  1IBM F;  2H1Y A;  2ZIT A;  1P8G A;  5BYS A;  1WWH A;  1P27 B;  3W60 A;  4QR0 A;  4AND A;  4X4O A;  4YB7 A;  3L7U A;  4ZVE A;  2B9W A;  3C8Y A;  3SCK E;  2MGZ A;  1GXL A;  2B56 A;  3UE2 A;  1RP5 A;  1MLA A;  4HTJ A;  4OZ2 A;  1HNI A;  1SJ1 A;  1JNZ B;  3TVZ A;  4KKO B;  1YIT S;  1RWU A;  3HKW A;  1YJW S;  1PBA A;  2KTQ A;  3AJ2 A;  1SJR A;  4RW4 B;  4F4K A;  4C98 A;  1LWC A;  5FJ4 A;  2YPZ A;  2ZNZ A;  1N5Y B;  3VTI A;  3NCQ A;  3P45 B;  1T11 A;  4AXI A;  3OD2 A;  2RAQ A;  4LR9 A;  1VK3 A;  2DNR A;  4O3O A;  2Y8Y A;  1G4C A;  2B8P A;  5KFE A;  1TKD A;  1SQG A;  4ZP8 A;  4A8S A;  4QIG A;  3NNH A;  3N6M A;  3LO3 A;  3OL9 A;  3I96 A;  3Q23 A;  3GWC A;  2LXU A;  3U1M A;  3JB9 k;  2CJQ A;  4K0K F;  3SZ2 A;  1EZZ B;  3A3N B;  1C2P A;  3KWM A;  3Q8R B;  2I38 A;  1B99 A;  5H1S V;  1DTT A;  2BDP A;  2VON A;  4KV8 B;  1X4A A;  5FLX U;  4X66 J;  3CW2 C;  2L9W A;  4RJV A;  2RQM A;  2C2N A;  1NJI T;  1RT1 A;  4GVB A;  2PMW A;  5ETQ A;  4OQJ A;  5D4L A;  1CEZ A;  1C0U A;  3G4S S;  2HG4 A;  4RUA A;  4WZQ A;  4IFV B;  4WK1 A;  1S1T B;  5ETP A;  4DR5 F;  3TZW A;  2ZOM A;  1N34 J;  2L3M A;  4B3S F;  1YVF A;  3DRP B;  4WU3 A;  1WNE A;  1MWZ A;  1C0T B;  1UWB A;  4DV2 J;  1Q53 A;  2F3J A;  2FYX A;  2NSB A;  1V9O A;  4WK3 A;  1AB8 A;  4TU9 A;  1HFE L;  1WI8 A;  2FHO B;  1CJU B;  3KHR A;  1J5O A;  1LFW A;  3TO8 A;  4Y00 A;  5HN0 A;  2HNY B;  2HHQ A;  1HBO B;  3HO1 A;  1R7I A;  3CDU A;  4P6Q A;  3G71 S;  4H4M A;  1T05 A;  1OPZ A;  2XB2 D;  2JHE A;  1NU4 A;  2ILY A;  2JJ4 D;  2NQP A;  3K0J A;  4GO7 X;  1M5V C;  2IIH A;  4J9U E;  1F3F A;  4I64 A;  1HNZ J;  4QR2 A;  3EX7 B;  3TVY A;  2MLX A;  3BSN A;  1XBW A;  2YWE A;  4Y2I A;  3DI6 A;  1QSY A;  2B4O A;  4K4U A;  1HI8 A;  2DXF A;  3M6W A;  1S97 A;  3TAQ A;  4RNM A;  2FJE B;  2EG2 A;  5HBM A;  3TNV A;  2V9W A;  2PMH A;  2Y0B B;  1FDB A;  5A0Y B;  2IA0 A;  1S72 S;  4OYB A;  5F41 A;  4HT5 A;  4HI1 A;  4OYP A;  1GK8 A;  3ETM A;  4N7T A;  1F9F A;  2KB2 A;  2RDJ A;  4PEO A;  4PWW A;  1CC7 A;  2FLN A;  2EPI A;  4KO0 B;  3K5M A;  2XYP B;  4EMD A;  1IR2 A;  1BGX T;  1LK5 A;  1VQ4 S;  2W8L A;  5LMN F;  4ZVR B;  3P6Y C;  4DL2 A;  1BE4 A;  3SMZ A;  4OHZ A;  2ZHA A;  2CA9 A;  2CJY B;  4IR1 A;  3VGS A;  2R7R A;  3HSD A;  3JSB A;  2HQD A;  2EKY A;  1YJ7 A;  3QJP A;  1S9G A;  4P74 A;  1RCX B;  2CDQ A;  4DL3 A;  3LOU A;  4OHX A;  3I0R A;  2G2Z A;  4PZV A;  2BAN A;  4Q7A A;  1PKU A;  1Z1Z A;  4TYA A;  3PHT A;  4RW8 B;  1TAQ A;  1NUE A;  2G9O A;  2HS3 A;  2AEJ A;  2YQ0 A;  4DR6 F;  1NCL A;  2IMO A;  1KOH A;  1P1L A;  3AD8 C;  3KNA A;  1C1B B;  1X4H A;  2E5H A;  2EFG A;  7FDR A;  3R3T A;  4RW4 A;  4WWS A;  4F0K A;  2P9E A;  1V6H A;  3A3P B;  4U7U K;  2OPQ A;  1SC1 B;  4FS2 A;  1V3S A;  2JL9 A;  2PEB A;  5DJB A;  3N5B A;  2IRY A;  3CB4 A;  4B3R J;  3BDE A;  4AT1 B;  3QNW B;  4KHR A;  3OUY B;  2HVZ A;  4UW2 A;  2DIS A;  2EFO A;  2LMI A;  4ED8 A;  4XTT A;  2Y0S D;  1VJQ A;  3DGV A;  2HSE B;  5ETN A;  4ELU A;  4IDK B;  4PRF A;  4GMK A;  1PSD A;  5HK4 A;  1RCO B;  4KV8 A;  4F2S A;  3IMQ J;  5CYQ B;  2WOM B;  1HAR A;  2DRB A;  4ZN1 A;  1S48 A;  4Y3C A;  3K5P A;  1RT7 B;  2XYH B;  2YXL A;  4G1I A;  2QMW A;  1NJW A;  2WSF C;  2J7U A;  1S7H A;  2DXE A;  1FDN A;  3MR5 A;  3AT1 B;  1TUG B;  2V2Z A;  3L3C A;  4OYX A;  3M05 A;  4IFV A;  4CZC A;  2JWN A;  1VOM A;  4WU2 A;  4HAC B;  4ECQ A;  3MED B;  2FUG 9;  2RDI A;  5KFZ A;  4UTG A;  2ZH5 A;  1OS5 A;  2OD4 A;  1FDD A;  2PO4 A;  2POK A;  3CCE S;  2YX1 A;  1HPZ B;  2R9L A;  2E5L F;  1QM9 A;  2XTJ P;  2Y9H A;  4N5S A;  4MIA A;  2VQE F;  3AQP A;  3B78 A;  2H48 B;  4U95 A;  1HBO A;  4RW9 B;  4YB6 A;  1N5T A;  3V81 B;  2E1M C;  4ZPD A;  3AOD A;  3DLL Q;  4JB8 B;  1R89 A;  3GTY X;  1RTI A;  2I9S A;  3QZ8 A;  2IMW P;  3SQO P;  1LOU A;  1VQ5 S;  1NDK A;  3A3O B;  2G1D A;  5EWE A;  2BJE A;  4J9M A;  1FRJ A;  4DUY J;  1F1B B;  2LQB A;  3OV7 A;  1QLN A;  1TK0 A;  1T7P A;  3ULH A;  2M8D B;  5DQH A;  2RS2 A;  2XHC A;  4NXN F;  1FXD A;  1U1Q A;  1RT2 A;  4HHU A;  5KFT A;  4A8K A;  3S1T A;  2BZ2 A;  3NP5 A;  2KVI A;  5KFJ A;  3MMB B;  1S10 A;  2MKJ A;  4G6V B;  1XMQ F;  3RBD A;  3PVX A;  3Q0A A;  1HQ2 A;  5K14 A;  3M8R A;  2BW7 A;  1T9T A;  5KG2 A;  5BYQ A;  2VOO A;  3NXZ A;  2BJ8 A;  4CLF A;  4TKT A;  1OIA A;  2C3U A;  3B8H A;  2DXD A;  3G82 A;  1PC4 A;  1J5E J;  1Q5Y A;  3PFE A;  3G6Y A;  2E1P A;  4F25 A;  1WJ9 A;  1U09 A;  1X5P A;  4RX6 A;  4M5N A;  1TL4 A;  3CJ2 A;  2J8A A;  3ZTS A;  1N36 J;  1ZTW A;  3GG1 A;  5HJX A;  4U96 A;  3KK1 B;  1CS4 A;  4ILM A;  1VRT A;  1B0V A;  5GME A;  5IWA F;  4F26 A;  1Q8B A;  5MAO A;  1IVZ A;  4KHM A;  3AB2 B;  2K3K A;  3TOQ A;  3RAQ A;  1TFW A;  4ILL A;  3MPU B;  3N0V A;  3P4U B;  5ETL A;  4LR7 A;  4X64 J;  1RXO B;  1WTB A;  1KEK A;  2KT2 A;  5K8P A;  2DNH A;  2VOD A;  2CNK B;  2IRX A;  2HLT A;  6FD1 A;  3I0S A;  5G0R B;  1YZ7 A;  4X4U A;  2OSQ A;  3D7S B;  2HNZ B;  3W63 A;  2W2P P;  5C24 B;  2HHP A;  3H90 A;  2GGP B;  3M6V A;  2ZC4 A;  2E66 A;  4I1T A;  1Y4Z B;  4B9M A;  2HFO A;  2MZT A;  4OI2 A;  1C1B A;  2OFH X;  2MXY A;  3BSO A;  1GAO A;  2GA7 A;  3CT9 A;  5JUM A;  5IZH A;  3M2R A;  2JEF A;  1AW0 A;  1N32 J;  2W7A A;  1NLK L;  4LRF A;  1W2B R;  1NBE B;  2D1C A;  5JVG Q;  4FS1 A;  4KRW A;  3JSY A;  1U2R A;  4JOU A;  3HFV A;  3KHH A;  2JZ5 A;  2FJW A;  3F44 A;  1VQP S;  1Q16 B;  3M30 A;  3R5C A;  4WXW A;  2R8J A;  3DU6 A;  1HMV B;  5F8J A;  5LSO A;  2C1E B;  3G8Q A;  1MNE A;  3GYG A;  4PWU A;  2KYX A;  5ETR A;  3J7Z 5;  3FSI A;  3O6Q A;  3IM9 A;  4WF9 Q;  3AXM A;  5EGY A;  4PG8 A;  2QYC A;  3VAG A;  2H4W B;  4I4B A;  3MWB A;  1YRT A;  3VQS A;  2VA2 A;  3B6B A;  1K1Q A;  1WKJ A;  2IM1 A;  4UOG A;  2FJV A;  1RT7 A;  2D9P A;  4YHH F;  4USW A;  4LRD A;  2Y3Y A;  4W4M A;  1JLE B;  3CGI A;  4RZR A;  3C14 B;  3ZTR A;  1SKS A;  2Q79 A;  1D9F A;  4FNH A;  4ZPA A;  4DQI A;  5M2U A;  1X31 C;  3I82 A;  1IBL J;  1F6T A;  2D7S A;  3CJ3 A;  1VBX A;  2CAD A;  4HAC A;  1VQK S;  4OYA A;  3MED A;  2GZO A;  2GW8 A;  3LP1 A;  3SV3 A;  2ZM6 F;  1QUV A;  4F2R A;  2UXB F;  2W2Q P;  4LF5 F;  3FEX B;  3D0I E;  2KJV A;  3MAQ A;  3K5O A;  1TV6 B;  1JKH A;  2HFU A;  4JI5 J;  5J2Q B;  2UUT A;  5KTQ A;  4UY8 T;  3N28 A;  4OI3 A;  2ROG A;  3GJR B;  2QL5 B;  1RE1 B;  1WG4 A;  2V67 A;  4M1K A;  3PO4 A;  1T9U A;  5B0C A;  3CC2 S;  2IVF B;  1VHI A;  1BHN A;  4D3H A;  4DV0 F;  2VU5 A;  5A8R B;  1D9A A;  5A2Q Y;  1LQ9 A;  2GJI A;  3J80 U;  1VQN S;  4QU7 A;  3DOM B;  3OFH A;  3PTW A;  3QO9 B;  2R7T A;  1SI9 A;  4PUO A;  2MQQ A;  2PMZ D;  1TFY A;  3SBM A;  3JAM Y;  3D3C J;  2VJU A;  2IYG A;  1FFW B;  5IV4 A;  1XNR F;  3DKD A;  4WJB A;  4FBU A;  2XWY A;  3MMB A;  2HRU A;  4G1P A;  3HHL B;  2CQP A;  2R2T A;  3A8I A;  5ETK A;  2JC0 A;  2QA4 G;  4I2Q B;  5AXK A;  3MCM A;  1MRO B;  3JQM A;  5HMX A;  1VHF A;  4J9O A;  4UZC A;  2YNI B;  1IR1 A;  2HQC A;  4PYA A;  2Z4P A;  2GIF A;  2M3D A;  3EPI A;  3CD7 A;  1NPR A;  5CD4 H;  3GSD A;  5BR8 J;  3KK1 A;  5T7L A;  3MM8 B;  1A7G E;  4ED0 A;  1FRH A;  2KXH A;  3T6B A;  3QIP B;  1VQ8 S;  1UTA A;  3FBE A;  4XO0 A;  3THT A;  3IRX B;  2D3O 1;  1QTM A;  3IS9 B;  1Q95 G;  4LF4 F;  4L76 A;  1KVK A;  1RT4 B;  1URR A;  3MUM P;  4NLQ A;  2P2C B;  4Q2L A;  2J0S D;  3RB6 A;  5HLF A;  2BJ9 A;  2AGP A;  3PIO Q;  2YWF A;  2MMY A;  2F8E X;  3M6X A;  4A8M P;  1AFJ A;  4IOC Q;  3QYY A;  5C24 A;  2A0F B;  4GRS A;  2ASY A;  3W65 A;  3TQE A;  2GGP A;  1EAR A;  4DR1 F;  4DL4 A;  2VG6 B;  4YR0 A;  4FYD A;  1R8C A;  3EXC X;  2WW4 A;  4Q8E A;  2GML A;  4HDG A;  4K2X A;  1YIJ S;  1BQN A;  2XYG B;  4DV7 F;  3M1V B;  3B4M A;  1MMD A;  1MWY A;  2A18 A;  1NKC A;  1LV5 A;  2HYI B;  2O5D A;  1B7F A;  4C8Y A;  2V4J B;  5KAK A;  1Q86 T;  4DJB A;  4XPC A;  4TQS A;  3K57 A;  2CJB A;  3TJ8 A;  1U1R A;  2C2K B;  3TX0 A;  1KLM B;  4ZS6 A;  3F0N A;  2NSC A;  5EX3 A;  2K06 A;  3SFU A;  4ERD A;  5C42 B;  3KLF B;  4PG5 A;  4I7F A;  4ED3 A;  2AJF E;  2SXL A;  1XR6 A;  3ZZO A;  2J7K A;  2NYH A;  3I31 A;  2YQ1 A;  4F67 A;  2BAC A;  1HQE B;  4DX5 A;  2OML A;  3Q8Y A;  3SCI E;  1G7C B;  2W9B A;  4BBY A;  2GO8 A;  2XZW A;  3OL8 A;  4O23 A;  4ED4 A;  4DR7 F;  2XY7 A;  1RAH B;  4DS4 A;  4RW6 A;  5ADZ A;  2RKI A;  3QT8 A;  4M5L A;  1WG1 A;  2WTF A;  1FKP B;  2X1G A;  2QFI A;  3GCX P;  1IKY B;  3QJJ A;  2OJ3 A;  3BSC A;  2RH3 A;  2UXD F;  2EC0 A;  1TV6 A;  4KHP F;  1YGY A;  2IM0 A;  2JLE A;  3VCD A;  3IWN C;  3IP0 A;  1PC5 A;  2XM3 A;  4KGV B;  1P1T A;  3D66 A;  2WB1 D;  1D09 B;  5I42 B;  1RHM B;  3NOC A;  1N88 A;  3CXC R;  3OTO F;  1JLA B;  1WF2 A;  3TR5 A;  2VBW A;  4OI1 A;  1A9N B;  4YR3 A;  1ZH5 A;  1VLY A;  4RNH A;  4J9V A;  1NM2 A;  2AEM A;  2AWZ A;  4YB1 P;  3QFH A;  4FF4 A;  1ZAW A;  2BRL A;  2V63 A;  3DOK A;  3GU0 A;  2XY5 A;  1DQA A;  4O4R A;  2DHA A;  1VC6 A;  1HHT P;  2GQQ A;  4LRB A;  1JK9 B;  2DB1 A;  3MFI A;  1XK8 A;  4OZ0 A;  4LFB F;  4QQB A;  3E51 A;  3HHD A;  1QAJ A;  3CO0 P;  1L3V A;  2FDN A;  5C2G A;  4NRT A;  4I2Q A;  3V5R A;  4ECX A;  3DC2 A;  1RIS A;  2E44 A;  3AOB A;  4UF4 A;  2V4Q A;  2YNI A;  2UU9 F;  1O0P A;  4USJ C;  1GX6 A;  3GE9 A;  3KJN B;  3ZTQ A;  4ZVQ B;  2JC1 A;  4J91 A;  3JTN A;  4C97 A;  4CLK A;  3NGD A;  4F02 A;  5JXS A;  4DR3 J;  1DQ9 A;  2CWK A;  3SQG B;  1JMT A;  4N76 A;  1U25 A;  3OL6 A;  1HI1 A;  3CCW A;  4QR1 A;  3MR6 A;  2R2R A;  2ZOF A;  4M5D A;  1RAD B;  3DGP B;  2Q6B A;  2QJ3 A;  1NDL A;  3IC1 A;  1WHV A;  1ZET A;  1RT5 B;  1KQF B;  2DO4 A;  1EIY B;  4MYU A;  1NSA A;  2Z0G A;  1A0O B;  4QBU A;  1KFS A;  3MMC A;  2UXC F;  3HX9 A;  3ILO A;  2DNK A;  5IT4 A;  2JX2 A;  4WP3 A;  2O66 A;  2AX1 A;  2PA8 D;  2CG8 A;  2EK6 A;  3T3F A;  3M2V B;  3H5Y A;  4DV6 F;  3JYT B;  1CBK A;  1U8W A;  4HHJ A;  1UAW A;  2HK3 A;  2DCU B;  5D0H A;  1LNQ A;  3VWS A;  2RIJ A;  4CYU B;  2WHO A;  3POT B;  2MZJ A;  3UCU P;  2J0X A;  1HWI A;  4NLO A;  1OPI A;  3UCG A;  5L9N A;  4F3Q A;  4ENO A;  1TMJ A;  2AW0 A;  5K8O A;  2UUA J;  1S1X A;  1U8S A;  3QFW A;  1VS3 A;  1OY6 A;  2ZFH A;  4A8O A;  3UVJ B;  2V4J A;  1W25 A;  4ECR A;  3KHG A;  4ZP9 A;  4CTA B;  4ZCI A;  1EKR A;  4P7V A;  4OX7 A;  3HSJ A;  4UUX A;  2CJX B;  2AYG A;  1ZM2 A;  2M88 A;  4KR0 B;  3W64 A;  3KLF A;  1JX4 A;  2IAJ B;  4AQY J;  5GAD U;  3DLK B;  4OZ3 A;  2YKA A;  1OSC A;  1N56 A;  4JI7 F;  3KMQ A;  2HGN A;  2BM0 A;  3UPF A;  2GJF A;  4FP9 A;  3RBX A;  1HQE A;  2ROP A;  4A4J A;  1MMN A;  3TA0 A;  4DV5 J;  1BQX A;  3GR1 A;  1TKT A;  4IQM A;  4C8O A;  3NCP A;  2VDH A;  4E98 A;  1DQ8 A;  4IR9 A;  1H73 A;  3W9H A;  3R5B A;  3CCU S;  2U1A A;  5HO4 A;  1NHU A;  3RW6 A;  1KON A;  3NKY A;  4ES3 A;  3C6U A;  4RBT A;  1R0C B;  2W9C B;  2AHO B;  1FWP A;  3RB3 A;  2RQ4 A;  4CNZ A;  1ZAX A;  3ZFV A;  2ADB A;  4NML A;  3FRY A;  3AXK A;  3CCZ A;  1SUQ A;  1HNX J;  1RGV A;  3CC7 S;  4K4Z A;  1UFW A;  4ZPT R;  2FZC B;  4R8U A;  1H38 A;  1RYR A;  3VAI A;  4U8V A;  3MM9 B;  2B7C B;  2B6A B;  5KFY A;  3Q8S B;  4JUZ A;  3T5K A;  2BOA A;  1VGY A;  2QMX A;  5KG3 A;  3RYL A;  3C6T A;  3DU5 A;  3T1H J;  1T03 B;  2RHQ B;  2HIY A;  2CQC A;  5L9X A;  2M70 A;  3MEC A;  3MR7 A;  3FSY A;  2XG8 A;  4JV5 J;  2WRM A;  1RTJ B;  2A6M A;  1U26 A;  3OVA A;  3MD3 A;  2G2Y A;  3MFH A;  1H7W A;  4NLG A;  3ZNU A;  1BLU A;  1HNW J;  1T3O A;  4C8M A;  4F4Y A;  1XMB A;  4LF6 J;  1DRZ A;  2QYG A;  1CUL A;  3B82 A;  4ES1 A;  3DRS B;  3M8P B;  2KM8 B;  2GQ2 A;  2MKS A;  1GMU A;  1YRX A;  2EVZ A;  1FNM A;  3NGR A;  3B4D A;  5DET A;  4EFA C;  2D74 B;  2V4R A;  1PIL A;  4QIE A;  3V4I B;  5A76 A;  4ZP7 A;  1AFI A;  3L95 X;  2ZBR A;  4C7Q A;  3R1H A;  2CQ0 A;  1L3K A;  1F9H A;  3HHL D;  4G3I A;  4DDF A;  2ZJR Q;  3E8O A;  4Y34 A;  1T9V A;  4EEY A;  1REV B;  2CJA A;  2XS2 A;  3OFG A;  2NZ4 A;  3BJY A;  3J7Y I;  1JJC B;  1FJ7 A;  3H42 A;  3EVO A;  3CJ0 A;  3MOZ A;  6FDR A;  5GAH I;  3KLI A;  4M5H A;  1FNO A;  3VGT A;  4EK2 A;  1NKE A;  5CCL A;  1VRQ C;  2RJZ A;  2ASD A;  3DOL B;  2LDY A;  3TI0 A;  2HBQ B;  1HBM B;  1NZA A;  4DFK A;  2K1R A;  5B0A A;  1GTH A;  3VZI A;  3NNA A;  4CYU A;  3GP9 A;  3IN5 A;  1RBA A;  2D3O R;  3GII A;  1ZPW X;  3BSA A;  2ERR A;  3VQT A;  2GJ2 A;  3K8W A;  3UN3 A;  3MMA A;  5U47 A;  1S6U A;  1U2F A;  5HQL A;  5A8W A;  3OR2 A;  4B9L A;  3QWP A;  3LTO A;  3ET6 B;  2MZS A;  2V5H G;  3PR4 A;  3UVJ A;  4AUK A;  3TUI C;  3PFO A;  1QE1 A;  2K2P A;  1HR0 F;  3FEY B;  1FD8 A;  4TN2 A;  2UUB J;  2AYE A;  2QLW A;  1YK9 A;  1FJC A;  5GAG U;  2M0G B;  2CQ3 A;  2XLJ A;  4KTQ A;  3FFI A;  2MKH A;  3SEO A;  2C2D A;  1F5A A;  4H4O A;  1SKW A;  3FRZ A;  1VQ6 S;  3PDN A;  1GXT A;  4BHQ A;  4QWD A;  4NZ0 A;  5DQI A;  1H6K X;  2Z57 B;  1DFD A;  4W92 B;  3A13 A;  4K5S A;  4X66 F;  2JDJ A;  1TL7 A;  2RUG A;  4DQQ A;  2DIT A;  2XSF A;  2YKM B;  2RS8 A;  3GFH A;  3DFE A;  1TL3 B;  2LEP A;  1SH2 A;  5H9E J;  2ZOG A;  1V3R A;  4A8W A;  3E2E A;  1F0X A;  4P2X A;  3OHB A;  2RRA A;  2X3D A;  2DH7 A;  4RBU A;  2C2Z B;  1NK5 A;  1M5P C;  3FVY A;  4RW7 B;  4M63 A;  1N34 F;  4ID5 B;  3ENQ A;  1R27 B;  3HUL A;  2LKZ A;  2XMJ A;  4DL7 A;  2VG5 A;  4ZA1 A;  2PE8 A;  4DV2 F;  1XQI A;  3H7H B;  2VKZ G;  1M1K T;  2IBK A;  3R27 A;  4KGM A;  2DNM A;  2N3L A;  2KYZ A;  2HHS A;  3K59 A;  4O4G B;  3BRE A;  3MM5 B;  1IM4 A;  2VPZ B;  1NO8 A;  2B8Q A;  2F63 A;  1LWF B;  1RAE B;  4KH0 B;  4DV3 F;  1Y3K A;  4DL5 A;  2B9E A;  1UVL A;  2FZG B;  3I5A A;  1Y0H A;  3BGU A;  5KG1 A;  4M5J A;  2GQC A;  1FKO A;  2BEF A;  1WTF A;  1AZS B;  4O44 B;  3LAN A;  1H2V Z;  2V2Q A;  2R7S A;  3THV A;  2WSE C;  2FVC A;  3J81 Y;  1EQ0 A;  3T19 A;  3NS5 A;  4J9S A;  1JLB B;  1HNZ F;  1S79 A;  3PJ9 A;  3U1L A;  1W2I A;  3OPK A;  4X65 F;  1S1W B;  2XGQ A;  2BKP A;  4WTY A;  5L39 A;  3ZZR A;  5HVF A;  3FDS A;  4K4V A;  2VBX A;  4FF1 A;  2HAI A;  5IQQ A;  5IC6 B;  3BKF A;  1JLC A;  3QRR A;  3SCL E;  4DX6 A;  1JIH A;  5LJ3 Y;  1MN9 A;  4DSL A;  2WB4 A;  4ZIT A;  2FHM A;  1NK9 A;  4LVN P;  3TW0 A;  3GIM A;  3D0H E;  2GIQ A;  1FF2 A;  3PX0 A;  1WI6 A;  3WC2 A;  5J1E A;  5B0E A;  2OLW A;  3ILI A;  3ZNJ 1;  5KG7 A;  3LGH A;  5F0U A;  3MGJ A;  1LXJ A;  1UJ4 A;  4UST A;  2UZA A;  4UQG A;  5J2N A;  4K5R A;  3WX8 A;  3MZI A;  4OX8 A;  3R1L A;  2HVE A;  3EE3 A;  2LYV A;  2EK1 A;  4TQR A;  4MYT A;  4WP9 A;  9RUB A;  1REV A;  4JI1 J;  2J76 E;  4TY8 B;  5FDL B;  3D1Q A;  4FPI A;  4IRD A;  1HWL A;  3PO5 A;  1HW9 A;  1Y11 A;  5EWF A;  3NCR A;  3Q2T C;  3MEG A;  2F65 A;  4JYA F;  1WF1 A;  5J2P B;  3UD5 A;  5BJR A;  1JLF A;  4ZCK A;  4UZB A;  5GVQ A;  4ZVG A;  4A8Q A;  3CJS A;  2V2V A;  1HBM A;  2ACM A;  2HWT A;  1IBK J;  1NK0 A;  5DM6 Q;  4FPR A;  4KPY A;  4PCQ A;  5LJ5 Y;  1RWN B;  2AYM A;  1LWX A;  3MHY A;  1X4B A;  3CIM A;  5F8M A;  2CIM A;  3BB5 A;  3R5G A;  4MH8 A;  4AE5 A;  4FYV B;  4RUH A;  3WHI A;  3VGV A;  2KKH A;  4CO2 A;  1T9W A;  4K2J A;  2GMH A;  3ET6 A;  3RR8 A;  2OIH A;  1IQZ A;  1R6Y A;  1HNV B;  3KLE B;  1ZBT A;  4B3R F;  3ITH A;  1NAQ A;  2QZ8 A;  3T6J A;  4NYP A;  2ZZM A;  2EC2 A;  3ZZ0 A;  4PPD A;  1Y10 A;  4OHW A;  1O5J A;  2WSC C;  5K8M A;  5H9F J;  4F36 A;  3BGO P;  1J27 A;  1C1C B;  1S9F A;  2F7V A;  3M32 B;  3DRR A;  2DCL A;  3PV8 A;  2ZH1 A;  1K44 A;  4KQZ A;  2W4P A;  3G2X A;  2KRR A;  2YKO A;  3QBC A;  4ECS A;  1UW4 A;  2AT1 B;  2HMI A;  1UEK A;  5LSL A;  4J9R A;  2O67 A;  3HD1 A;  2YKM A;  4CIO A;  1HYS B;  2VUG A;  3AOC A;  3TAN A;  2O1P A;  2R7U A;  1HQU B;  2K8G A;  2G0I A;  3PY8 A;  4OHY A;  3JSR A;  2BKN A;  4RW7 A;  4CDI A;  2ZZT A;  4ID5 A;  2ALY B;  5HRO B;  2WVB A;  5L1K A;  3S7R A;  5LXR A;  2MYF A;  2BQ3 A;  4DL6 A;  2IA6 A;  1RJJ A;  5LOQ A;  5HAO A;  4F04 B;  3VAH A;  1U24 A;  3NBP B;  4WPA A;  3IBC B;  4WE1 A;  1CG2 A;  1TTH B;  1L3S A;  1VIS A;  2DBB A;  1KP6 A;  1LWF A;  2C3P A;  4KY3 A;  3O44 A;  2KN4 A;  4B3O B;  3N5F A;  2KHD A;  1MG7 A;  4DPT A;  2E9R X;  1Q78 A;  1AZS A;  3SFG A;  1YRU A;  3ADA C;  4DV4 F;  5IV3 A;  1N33 J;  3BN4 A;  3O1L A;  3DMJ A;  1TK8 A;  3L09 A;  4RU9 A;  1EET B;  1Z2L A;  4DUY F;  3BPD A;  1HBN A;  1S1W A;  1GT8 A;  2D3U A;  2P9G A;  3B54 A;  3UN5 A;  4C11 B;  1QUP A;  1RLC L;  4CO1 A;  2CPD A;  3PG9 A;  1V5I B;  4L3K A;  2FJB B;  2B5J B;  4A48 A;  1PIE A;  4ICL A;  3J7Y U;  1IWA A;  2MQN A;  2FJD B;  4CM0 A;  1MW7 A;  3PW4 A;  1PYS B;  5KFS A;  1DTQ B;  1TMM A;  3HCX A;  2AYB A;  2MQM A;  1J5E F;  1WG5 A;  2DNN A;  2RB7 A;  3G87 A;  2HZA A;  4O3N A;  4F0H A;  2LEC A;  5IC4 B;  5HVG A;  1QSS A;  4DS5 A;  1N36 F;  1S4E A;  1L5U A;  2FC9 A;  1ZZN A;  3BN7 A;  2KXF A;  3QID A;  1TZ0 A;  4KFB B;  3DLE A;  2C22 A;  1D8Y A;  1IWG A;  2FHK A;  3CJ4 A;  4ZLN A;  4TYB A;  4K50 A;  2BR0 A;  4IUF A;  1Z4U A;  3AY0 A;  2YY3 A;  3MAA A;  3T1A A;  2CNO B;  4X64 F;  3MM7 A;  4BC9 A;  1VIO A;  2M5Y A;  1YWX A;  4DSF A;  4LF8 J;  1RI7 A;  5IM0 B;  2B43 A;  4QJV A;  4NXM J;  3IR7 B;  1NDC A;  3CJR A;  1FO1 A;  4H4K C;  2P6T A;  5J1N A;  4NI2 B;  4ZKA A;  4WFN Q;  5DS7 A;  3M9M B;  5KFX A;  3CD5 A;  3DM2 A;  1HWK A;  1WSV A;  2VD3 A;  1QSL A;  2MGZ B;  1GH8 A;  2LQJ A;  1HNI B;  3ZXW A;  5FII A;  1JJ2 R;  2HPU A;  3J81 j;  1T9X A;  4C4W A;  1HNV A;  3KLE A;  3IAS 9;  4C8N A;  2VL1 A;  3VVU A;  3FZ2 A;  4CLS A;  1JJH A;  3NOG A;  1APS A;  4Q2M A;  2VFV A;  4A8Y A;  1X4C A;  4Y6I A;  4C0H A;  1FRM A;  5DRK A;  1RZM A;  3HZE A;  1VI7 A;  1H2U X;  1S12 A;  4YY3 F;  4NLP A;  1G6B A;  3GIK A;  2NPF A;  2DNP A;  2AP6 A;  3FK4 A;  3QT6 A;  4B9T A;  2NXC A;  2HHU A;  3M8Q B;  4URG A;  1SB6 A;  3LF0 A;  4FVM A;  1ARO P;  3N6L A;  3QPI A;  1W7W A;  4ELV A;  3HVR A;  3QRQ A;  1RUS A;  1KTV A;  3MTJ A;  1XEZ A;  1VK8 A;  3BV8 A;  3BF4 A;  1REG X;  2GHP A;  3MR3 A;  1T8E A;  2MHN A;  5DGB A;  2H54 B;  2CXE A;  3K7R A;  2QGF B;  4R5P B;  2RRB A;  1NJX A;  2I8E A;  1RT1 B;  4JV1 A;  4GVB B;  1SBR A;  2V0N A;  2VBY A;  3Q8P B;  4FZV A;  4RKU C;  2HUR A;  1C0U B;  2CUY A;  1IKV A;  1F2H A;  1SJF A;  1KLN A;  3NL0 A;  1YHQ S;  4JI5 F;  1KFD A;  2F4F A;  1MN7 A;  4YQW A;  4E2F B;  1SC6 A;  3DNC A;  2BM1 A;  1PAU B;  4B3O A;  4OJH A;  2V50 A;  4RLE A;  4MIB A;  2IM3 A;  2GIR A;  4LVO P;  1J5O B;  4IO9 Q;  3C19 A;  1KQS R;  1N54 B;  1ZM9 A;  3PCO B;  1CSJ A;  3CDB A;  5GAE I;  4M94 A;  2QL7 B;  3QGG A;  5CD4 A;  4KBI A;  4H4M B;  1T05 B;  2IJF A;  4C8K A;  5IT0 A;  2FB0 A;  3OXF A;  3LPY A;  3VAJ A;  3BR8 A;  1NSK L;  2QLB B;  5C25 A;  3OFE A;  3JSM B;  4AXJ A;  5LSR A;  3PJX A;  1R0B G;  2B5J A;  1QVG R;  2E5J A;  4ANC A;  2B51 A;  4DWI A;  1R6V A;  4LIR A;  4LUB A;  4DG1 A;  4KT0 C;  1X9S A;  3TVK A;  3DI6 B;  3DXS X;  2J6S A;  1WHW A;  5HMZ A;  4URQ U;  4RNN A;  1KSP A;  2HBZ B;  3T9N A;  2LLZ A;  3K8V A;  2E7X A;  1URN A;  3JQJ A;  2FTR A;  1BD6 A;  5HBM B;  1R8B A;  2CPH A;  1ROF A;  1HD0 A;  1VFJ A;  1Q82 T;  3OJS A;  2NRE A;  4NMX A;  5BR8 F;  1XNQ J;  3TAP A;  4JI6 J;  3OLB A;  3VVT A;  3JTO A;  3THP A;  1K0V A;  1WEY A;  2QE5 A;  2MTL A;  3GIR A;  1WD6 A;  1O8B A;  1HW8 A;  1YBA A;  4YB5 A;  4V19 J;  1ZA1 B;  2H5E A;  4ECU A;  1CPZ A;  2Y8W A;  2CAJ A;  4BS2 A;  2ZDP A;  3GJS B;  3CDW A;  1Y3J A;  2QMU B;  1XMQ J;  3GV5 B;  2IJN A;  2N7C A;  1LW0 B;  2CQG A;  1SC4 B;  1UET A;  3JTP A;  1TKX A;  1RAC B;  3DRY A;  4K7Q A;  4DU7 A;  2RIL A;  3FJ2 A;  2R8K A;  4USH A;  2DHX A;  3I0R B;  3TA2 A;  2B9X A;  2BAN B;  3HM9 A;  3I56 S;  3V6D A;  2XZT B;  1R3N A;  2BBE A;  1VR6 A;  5EUH A;  4YP3 A;  3D6H B;  4KGZ B;  1RTH A;  4Z7Y A;  2ZH8 A;  3S01 A;  2HRY A;  3TAM A;  1YJT A;  2CZ4 A;  4DSK A;  4QYZ K;  4MFB B;  2JEG A;  4O0I A;  4CO5 A;  2FY8 A;  2OPQ B;  1RHK B;  4KGK A;  2IPO B;  3HHL C;  4OI4 A;  3GYX B;  2LXF A;  2VQF J;  4U7U D;  4DN0 A;  4U8Y A;  4MK7 A;  4PG4 A;  5GMD A;  4ZVU B;  2CPJ A;  4LRE A;  1KQK A;  1WKK A;  3H59 A;  4AYB D;  1EP4 A;  5E3A A;  1BMQ B;  3M8Q A;  1FEE A;  3CDA A;  3BKU A;  5M2P A;  2H3E B;  4YN3 B;  2UUC J;  2OO4 A;  2VC0 A;  1OO0 B;  1YDL A;  2W4D A;  1X4G A;  3HSZ A;  2B7B B;  1DUR A;  2VV5 A;  3LWL A;  7AT1 B;  4R5P A;  1TK5 A;  5D15 A;  4OX6 A;  1VQ9 S;  3MEE A;  5AXL A;  4V19 X;  1PJ6 A;  3DRX A;  2YNH A;  1RT6 B;  1S76 D;  3BYP A;  3MTK A;  3K89 A;  5B09 A;  4QW8 A;  4IG0 A;  3CJQ A;  4EZ9 A;  1UEU A;  5CZV A;  2VKR A;  3K58 A;  3FCV A;  2LA6 A;  4OZL A;  1T3N A;  1S6P B;  1RTZ A;  4HTI A;  2IC3 A;  5KFN A;  1EKS A;  2XO7 A;  1T9Y A;  4ZMM A;  5CA5 A;  1WOP A;  2W2N P;  3W66 A;  2I6W A;  3M9O B;  2LA4 A;  1KQG B;  1XWL A;  4JI8 J;  2C42 A;  1OQ6 A;  4DR2 F;  2LQ5 A;  3LP2 B;  4IKA A;  4JI3 J;  1RTI B;  5FD1 A;  2XBP A;  4LSN A;  3BS9 A;  3L7P A;  4Z7C A;  1TU0 B;  3JSM A;  1WEZ A;  3BGL A;  3EZO A;  2V8G A;  2ZHB A;  3NAH A;  1IKW A;  3C2P A;  1CJK A;  3FNN A;  4ILR A;  2XMW A;  4HVZ A;  1RAB B;  5BYR A;  2NXN A;  2Z8Q A;  1N5V A;  3V6H A;  1RT2 B;  2OTL S;  5JVH Q;  3GJQ B;  5KT7 A;  4NRU A;  2MLZ A;  1H0H B;  2A2D A;  1FRL A;  3OTC A;  2XMM A;  4DR3 F;  3CNQ P;  4DR4 F;  4USM A;  3QLH A;  1ITP A;  3SDE A;  5K14 B;  3KFW X;  4ED1 A;  3PX4 A;  5B0G A;  2AF6 A;  1N5S A;  1RDR A;  3CCR S;  3AA8 A;  4I0W A;  5BXI A;  2DT9 A;  3C46 A;  2Z2Y B;  3Q8U A;  4OYI A;  1XN9 A;  3G82 B;  3H2L A;  3KLG A;  3G8T A;  5E5N A;  2EBE A;  3BH7 B;  4MT1 A;  3CMQ A;  3KK2 A;  2HFZ A;  4LFC J;  5DLF A;  4L3N A;  1FRI A;  3AFG A;  1L3T A;  1S57 A;  1CS4 B;  4X62 F;  1FE0 A;  3NWR A;  3P5T L;  1VRT B;  1LW2 A;  4HT7 A;  4N41 A;  3LWM A;  2FVQ A;  2YNG A;  3ONQ A;  2KVQ E;  4O3R A;  2MQ8 A;  2XMK A;  1DY3 A;  4O3Q A;  4B9V A;  1LW0 A;  4AL5 A;  1VBZ A;  4DCJ B;  3UO0 A;  2ZH7 A;  3LP0 A;  4PYD A;  4IG3 B;  4C6A A;  3HFK A;  4U9R A;  4B3M J;  4UUW A;  5F0W A;  3WQP A;  3I0S B;  2WCX A;  3MD1 A;  3J7A N;  2FLL A;  4J5O A;  3Q8Q B;  4CM2 A;  3WZ0 A;  3O8W A;  3MM6 B;  2WON A;  2UUA F;  2DHS A;  2WVD A;  2HWI A;  1GTE A;  5CXT A;  5JMN A;  2V8H A;  5B0D A;  3IWL A;  1RAO A;  3KJQ B;  3CED A;  4QWE A;  3QQC D;  4A47 A;  2CKW A;  2N4C A;  3V6J A;  4P2S A;  3BQ2 A;  4MFB A;  3M2R B;  2XMV A;  1EAY C;  2JVR A;  4ZPB A;  3RB0 A;  2BE9 B;  5HP1 A;  3VGU A;  1ZYQ A;  4ED2 A;  2PGC A;  1WC3 A;  3H40 A;  3GON A;  2Z30 B;  2QLJ B;  4AQY F;  3EUN A;  4C8L A;  3JQK A;  4L6V 3;  3M2U B;  1ACM B;  2H65 B;  2H5I B;  2HFN A;  4CO3 A;  3M30 B;  1E6V B;  3OT9 A;  1TVR B;  1BWV A;  2N3O A;  2Z56 B;  2EXU A;  1Q4R A;  1M5O C;  4R0J A;  4RBV A;  4ATN A;  2MY7 A;  1YQH A;  1IXK A;  4W90 B;  1KTQ A;  4DV5 F;  3ISZ A;  2J5A A;  1X0P A;  4I6W A;  2YWG A;  6AT1 B;  4V1A k;  5HI7 A;  2R7W A;  4PAB A;  5LM7 E;  4OJ1 A;  5C7P A;  1TEL A;  2YX7 A;  2PEH A;  1A6L A;  2KDO A;  4LQ9 A;  4CCH A;  3QJL A;  2JRS A;  2IYI A;  4LF2 A;  2MZR A;  2UUW A;  2J6T A;  2EW9 A;  1RT6 A;  2PI5 A;  1S6Q A;  1EJ7 L;  3FBF A;  2XMU A;  2RUS A;  2PC6 A;  2HEK A;  2VPX B;  3NG8 A;  3DN9 A;  4C9D A;  2N7Y A;  3RRG A;  2GVZ A;  2FQQ B;  3C66 A;  2MJN A;  1HNX F;  1KC8 T;  5KFP A;  3KUH A;  4WFX A;  3LP1 B;  1S0O A;  1VMB A;  3EGW B;  2KFZ A;  1S6P A;  3BR9 A;  2KT5 A;  3GIJ A;  5A6P A;  2DGX A;  1QDU B;  2E5I A;  1PAE X;  1UFL A;  1JKH B;  3KKF A;  3LPE A;  3W62 A;  1KWM A;  1OSD A;  1VQY A;  4DMZ A;  4MAK A;  1FRX A;  4PXC A;  3FQK A;  5IS2 A;  5AJ3 J;  3LP2 A;  2L08 A;  3OVS A;  3T1H F;  2HS0 A;  1KR4 A;  3GYN A;  4BLG A;  2W25 A;  2PFD A;  1D8Z A;  1Q8K A;  2DNL A;  1BUX A;  2NZC A;  2BE7 D;  2QSF A;  1TQL A;  2BJD A;  3MXH P;  2HHH J;  4K4S A;  4JV5 F;  2GC8 A;  3EZ5 A;  3CCS S;  1K73 T;  3HK2 A;  3FCH A;  3H0P A;  4NCG A;  1HNW F;  4PUO B;  3D1O A;  1SL2 A;  4URS A;  4LF6 F;  2WW8 A;  2MQL A;  4NEZ A;  3DDK A;  4KE5 A;  2RVJ A;  4KHP J;  2BYC A;  3LH2 S;  4UQT A;  4QWB A;  2NR0 A;  3UD4 P;  2E5G A;  2LCW A;  1R43 A;  2V8D A;  1RWV B;  4ED6 A;  3DLH A;  2FIU A;  2HGL A;  3F56 A;  3HFZ B;  4LFA J;  4YEA A;  2ZDO A;  1IN0 A;  3A12 A;  2AJQ A;  2EI5 A;  3KJV A;  2FY1 A;  4FXD A;  2DNQ A;  2CQ1 A;  4EZ6 A;  3CPW R;  1ZM3 A;  2W2O P;  4U67 Q;  4LBP A;  3PR5 B;  3I5C A;  4LR8 A;  4EUV A;  2NXU A;  3UNY A;  4NCB A;  1RKI A;  5T7L B;  5CAB A;  4R0E A;  1I6J A;  2VDI A;  2VG7 B;  3I9Z A;  3EXY A;  4IRK A;  3R6L B;  1RTD A;  4N8O A;  3EDR B;  2G13 A;  1S99 A;  2QTW A;  1N0U A;  8ATC B;  1RT3 B;  3DLG A;  1RU2 A;  1GMV A;  2LVW A;  5LMU J;  3FBC A;  3AA9 A;  1NK7 A;  4IG3 A;  1EQM A;  4CLP A;  3F41 A;  5HLF B;  5LXY A;  1UVI A;  3MM6 A;  1T0T V;  2DY9 A;  3ZZT A;  2A2C A;  3QZ7 A;  1H74 A;  2ZHO A;  5ITH A;  5E3C A;  3PYD A;  1NH7 A;  4EO8 A;  4M5D B;  2LEB A;  4DQS A;  2CG4 A;  2HHW A;  2UP1 A;  2BE2 A;  4M5M A;  2F9D A;  5I4M A;  1T02 A;  2UUB F;  1FFG B;  1BQN B;  4X4S A;  3BYR A;  2KRB A;  2BXJ A;  4DBQ A;  4FDF A;  2YPY A;  3RTV A;  4HKQ A;  4QOT A;  1X4D A;  2R8I A;  4WKR A;  3AH6 A;  4O3S A;  4ECZ A;  1AT1 B;  3M2U A;  1L3U A;  4DUZ J;  1NKB A;  4CLZ A;  2DRA A;  5K8N A;  4GKK J;  4Y2C A;  1E6V A;  2KM8 C;  1TVR A;  2OEJ A;  4LF9 J;  4DV1 J;  2MKY A;  4DHV A;  3QT7 A;  1WSR A;  2G0C A;  1G1X A;  4K4Y A;  2KH9 A;  4YOE A;  4ZCM A;  5KT3 A;  4C3L A;  5HMY A;  1UVK A;  4HR2 A;  5IOL A;  3D5M A;  4I7F B;  4KPC A;  2W4C A;  1F5B A;  4IH5 A;  1UKU A;  4F3O A;  5CCM A;  2CQH A;  4JI2 J;  2R42 A;  2B0G A;  4DSJ A;  1FXL A;  3MI7 X;  1GEH A;  5SUH A;  5DDR C;  5IT9 Y;  2XO6 A;  4CRJ A;  2W9B B;  1ULR A;  3FZB A;  3MAH A;  5ETT A;  4NL5 A;  1N5Q A;  2X1F A;  4OX9 J;  2XS7 A;  3H4B A;  1U0H B;  5KOW A;  4OHV A;  3T41 A;  3I9V 9;  2W01 A;  4RW6 B;  1YJU A;  2RKI B;  2DR8 A;  1ZA2 B;  1BQM B;  4J9P A;  1LEO A;  1IKX B;  1YLX A;  4LJM A;  3FBB A;  1FHT A;  2MY8 A;  1RAA B;  3I32 A;  3UI3 A;  1G2E A;  4YME A;  2C2E A;  1NPP A;  2YWK A;  4KJI A;  1SJQ A;  2CRL A;  4WFZ A;  4ZIW A;  4NLX A;  1FRK A;  1RK8 A;  3QGH A;  3EZU A;  2YKP A;  1UP1 A;  4X4P A;  3IGV A;  3JS9 A;  5E3R A;  2HZV A;  2J9E A;  1HHS A;  2MSS A;  3N4W A;  1NXI A;  1FTC A;  5SZT A;  3BGR A;  4XDD A;  2V34 A;  2QA2 A;  1NZ8 A;  2LEA A;  2WK4 A;  2OPR B;  4CLW A;  3DOK B;  3R7N B;  5T14 A;  1CJT B;  1N6Q A;  2DHG A;  5KFQ A;  3NY0 A;  3TZZ A;  2OH2 A;  1FNX H;  2KT3 A;  1RHU B;  4GC6 A;  2E1C A;  1ELO A;  2AJ0 A;  1HIY A;  5A2Q U;  4QIW D;  4J9K A;  2LQ9 A;  4F4A A;  2BW2 A;  3CF5 Q;  1AUD A;  4A8X A;  2OSR A;  4TVA B;  2RNE A;  2EWH A;  1T94 A;  4WIQ A;  2JLF A;  3JAM U;  4FKX A;  1S1U A;  2YQ3 A;  1BXN A;  3SI8 A;  1EHW A;  3EGV A;  2E1A A;  3UDE A;  4PQU B;  4NLU A;  2RU3 A;  4ES2 A;  3CCV S;  2DR9 A;  1FX2 A;  4XIU A;  2XLI A;  3QSY B;  1CJV A;  4KSE B;  2VJV A;  2QT7 A;  2VG7 A;  3DCA A;  2J9C A;  5F3Z A;  2M9K A;  2J0W A;  3BM7 A;  2QFJ A;  2APO A;  3G9C A;  5L38 A;  3OLA A;  1RT3 A;  1QD1 A;  1GMW A;  1IBK F;  3BZQ A;  3KG4 A;  2CVI A;  4ZOS A;  3G6X A;  3MMC B;  1RQ0 A;  4NCA A;  3HVT B;  5KG5 A;  2W8K A;  3A8E A;  1VDH A;  1YJV A;  4XAK A;  3EYZ A;  1DAR A;  5J2M B;  1RU1 A;  4ECV A;  2HWH A;  3W5Z A;  4Z2X A;  8AT1 B;  2BMB A;  4FBT A;  3GQC A;  2EFP A;  1O6X A;  3D1H A;  5D3G B;  4Q8F A;  2JNJ A;  2HQF A;  5KFG A; 
#chains in the Genus database with same CATH homology
 3KUG A;  4M5N A;  5ETS A;  1F9H A;  5ETV A;  4CWB A;  1HKA A;  3ILJ A;  3HSJ A;  3ILO A;  4PZV A;  3MCM A;  1RB0 A;  3UDE A;  4M5L A;  2CG8 A;  3IP0 A;  4M5J A;  5ETP A;  4CYU B;  3ILL A;  1Q0N A;  1RU2 A;  4M5H A;  4M5K A;  5ETN A;  1EQ0 A;  1RU1 A;  2QX0 A;  3HT0 A;  4M5M A;  4CYU A;  2BMB A;  2F65 A;  3HD1 A;  3ILI A;  5ETQ A;  4AD6 A;  5ETL A;  4M5I A;  3UD5 A;  4F7V A;  1CBK A;  3KUH A;  3UDV A;  3HSZ A;  5ETR A;  3KUE A;  1TMM A;  3HCX A;  1RAO A;  4CRJ A;  2F63 A;  5ETM A;  3HSG A;  4M5G A;  1EQM A;  1KBR A;  1RTZ A;  3MCN A;  5ETO A;  1DY3 A;  1EX8 A;  1HQ2 A;  5ETT A;  5ETK A;  3MCO A;  3HD2 A;  1G4C A;  3HSD A;  3QBC A;  1IM6 A;  1TMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...