1EQ0A

Solution structure of 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase complexed with mgamppcp
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual conformational changes in 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase as revealed by X-ray crystallography and NMR.
pubmed rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 6-HYDROXYMETHYL-7,8-DIHYDROPTERIN PYROPHOSPHOKINASE
total genus 20
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2000-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 1eq0A00
3QBCA 1IM6A 1EX8A 4M5HA 3ILOA 3HCXA 3KUHA 5ETSA 2CG8A 3UD5A 4M5IA 5ETRA 4M5NA 3UDVA 3HD1A 1KBRA 3ILLA 5ETQA 3MCMA 3KUGA 4M5LA 1CBKA 3HSJA 3HSGA 4M5MA 5ETLA 5ETNA 1HQ2A 5ETVA 1EQMA 3IP0A 5ETTA 1RU2A 4CYUA 4M5GA 1F9HA 1HKAA 2BMBA 4PZVA 2F63A 1Q0NA 5ETMA 1RAOA 4CWBA 3HT0A 3HD2A 1RU1A 1RB0A 3HSDA 3KUEA 4F7VA 3ILIA 3MCOA 1TMMA 1RTZA 3UDEA 4AD6A 3MCNA 1TMJA 1EQ0A 2F65A 3ILJA 4M5JA 5ETPA 4CRJA 1G4CA 5ETOA 2QX0A 4M5KA 4CYUB 5ETKA 3HSZA 1DY3A
chains in the Genus database with same CATH superfamily
2J7KA 5IV3A 2MQNA 3D54A 4HHHA 1TZ0A 3V6KA 3V4IA 4B9SA 1SJ1A 2ZNYA 1JLFB 2XLKA 3DRPA 1GFWB 1NK9A 2R8KA 3NNHA 1U7LA 5RUBA 3BGRB 1Y11A 2YKQA 3DDKA 4NCGB 2XY5A 3K5NA 3UVJB 3R1HA 2OPPA 3ZNJ1 1Q5VA 3HSGA 2R8GA 1M0SA 3V5RA 1B7YB 4MFBA 4OYXA 1SVDA 3UFCX 2LEPA 5HMZA 2FJXA 4IRDA 3EDRB 5T7LA 3HVRA 1JLEB 3GJTB 3Q24A 2Q6CA 4BLGA 4OZ3A 4O3NA 2C2OB 3PO5A 5A8WA 3SZ2A 1YGYA 1OQ6A 2EG1A 4I2QA 4KGMA 3RTVA 5DETA 3FBBA 2WK4A 3NGDA 1P1LA 3ILIA 3NRBA 3WX8A 3MFHA 1MWYA 3ISND 3MMAA 2J7UA 5DQIA 5K8PA 4WFBQ 2BA9A 1YJWS 1T05A 3ENAA 4OYWA 2OPSB 5KFZA 2UVWA 4LFAF 3QYYA 4DUZJ 3TJ9A 3IS9A 3RZAA 4AE5A 2YNHB 4KKOB 5D78A 2B4UA 3IGVA 5F0WA 1RWPB 4OHZA 2MQPA 3KHLA 1UKUA 2E9TA 2AT1B 2J5AA 1KKHA 3CJ2A 5JVHQ 2E5IA 3A3PB 2FHOB 2HHSA 4B9MA 4QW9A 1VRTB 4DX6A 2UV8G 1FKAF 3KJQB 1B4SA 1XJWB 2ZVSA 2BANB 3MCSA 3M9NB 2UV8A 1K8AT 2UXBJ 2XGPA 2IBOA 3O44A 3TNVA 3K58A 2KTQA 1YVFA 3MPUB 3OL8A 2IFXA 1PC4A 2CYYA 2W9BB 4ECYA 2IPOB 3TWZA 3G8SA 3OXLA 3GG1A 3B8HA 1VRQC 4ATNA 4C8YA 3FRYA 2VFUA 2VH7A 3E01A 4F3OA 4LSZB 2HW3A 4O3RA 2DNMA 1J5OB 1TVRA 3BGRA 5KFWA 2BDPA 2CPIA 4C8MA 2IJNA 4HYKA 2UXDF 3GYXB 3CIMA 1HARA 2H5EA 4DZDA 2VFTA 2YKNA 2C2DA 3J81U 1QE1B 2LDYA 1M5KC 2UXCF 3DM2A 3FKBA 2NXUA 2LQJA 1HW8A 2JX2A 1R0CB 2QLBB 4DHVA 5HBMA 2B9YA 4CYUA 1FXDA 9RUBA 2PA8D 1FFWB 1YITS 1VI7A 5CCLA 2F3JA 3VAKA 4R0JA 4PWDA 4AYBD 2VQEF 2OMLA 1QM9A 4YR0A 2GHWA 2WVCA 4UQTA 1UJ6A 1S6PA 5C7PA 3M8SA 2PGCA 4TQSA 4F4AA 1BWVA 1W2IA 4NYZA 4CT8A 2DD8S 5BYQA 2CQ0A 2YNIB 2B5JA 3OSPA 3J7A1 3T5HA 3EPGA 3EZUA 1KQKA 1R0AA 3QO9B 2F4VJ 3G6ES 2IDEA 3D6TB 4IDKB 4K2XA 3PRVA 3TYTA 3KHHA 5IQQA 4MMOA 5L9XA 3V2UC 2W4DA 4KB7A 2AEMA 1OPIA 3ILOA 3L7UA 5LMNJ 2YWKA 1H7WA 4FZVA 3R2DJ 1IKWB 1RAAB 2BABA 2DY9A 2UUAJ 4DWIA 4DQRA 4IOBA 4WP9A 1JLFA 1FJEB 4U6PA 1FK9A 4J9MA 3K89A 3W62A 1KLMA 1VQSA 3G71S 3CW2C 4YB1P 2K2PA 2ZJPQ 4EYIB 1KFDA 1BUXA 2WB4A 1YHQS 4IYQA 2PD1A 4ZVQB 1B99A 2LP4A 5M2PA 1FRJA 1WHXA 2P9EA 2F9JA 4J7CA 3W5YA 2CRLA 3ET6A 4HACA 1RT1B 4ELVA 4KYZA 4MYTA 5GMDA 2OLWA 1HD0A 1NB2A 2AYGA 4NXMF 3ZTSA 2P9CA 3HJVA 1N5SA 1SC1B 1RLCL 5B08A 1UVJA 2DPIA 1XIQA 1Y9OA 3QJJA 4IH7A 3U7JA 3OVAA 3GLJA 2RU9A 1KQFB 5DG8A 4BC9A 3PR5B 1RHJB 5I3QA 3MZIA 1R27B 4QIEA 2LA4A 3M8ZA 3UE2A 1EETA 3DGPB 1S0MA 1FD2A 3FFIB 4ED0A 4DL4A 1ZH5A 3MCMA 2DNGA 1MN7A 1UMJA 4KV8B 4QPTA 2W4CA 1Z4UA 2HQFA 3PX0A 1RQ0A 5J2PB 3CIZA 2KI2A 1S59A 2LXUA 3CDAA 3H2LA 4Y65A 4ELTA 4ZVTB 1J2VA 3G2XA 1RT1A 3QIDA 2I38A 3MM8A 1RTZA 3JXOA 3VZHA 4DV5J 1CJKB 1FEHA 5LT5A 2RUSA 3H5SA 3T6JA 1GMVA 2GQQA 4I56A 4DXLA 3O2IA 4O44B 4RUAA 4WZQA 4EU0A 2IRYA 1VQKS 4LRBA 3AQPA 2MZRA 1N6QA 5C2CA 2VUGA 1DAXA 4DV7J 4J91A 4NI2A 4OJ1A 3HD1A 4RKUC 1FERA 3PR4A 3CJTA 1XTZA 4OYAA 4WKYA 3OTCA 1GMWD 1NSQA 2DKOB 3TAPA 4DSKA 2CPYA 2ZBPA 4F4KA 2V8GA 1MU2B 2DNNA 1RWMB 2RQ4A 2CKWA 1EB0A 1SH3A 2KYZA 4ZVRB 4IUFA 4LF5J 2BUNA 2Z0GA 3C6TB 3Q8YA 5IV4A 3PW0A 4V1Ak 5K8OA 4DU8A 3W8PA 2IY5B 2DEIA 5B0CA 3H5UA 3GJQB 4KRWA 4DR3J 1S6PB 3OLBA 1QAXA 3D9BA 3I82A 4CRJA 4BC7A 3ZZZA 3OHBA 2XY7A 1M5VC 2F4VF 4PWDB 1CJUB 2XB2D 2E1PA 4FF2A 3FMWA 3BGFA 4LRFA 3FMBA 3VCDA 2R42A 3DM2B 4U96A 4B17A 4ILMA 4NZ7A 2RHQB 2YH1A 1PCAA 3QAEA 1TVRB 4UUWA 3HZEA 4P73A 3TQEA 4DV7F 3BKFA 1YRUA 1KSPA 2QL7B 1FRKA 4OL8A 4B9UA 1HKAA 4KH1B 1J5OA 2BM1A 3A3OB 3I96A 8RUCA 4E98A 1N5YB 4R0EA 1LK7A 4ED5A 5HQ8A 3SFGA 1WC1A 3DLGB 3F56A 4EWTA 4JBCA 4CO5A 2R7XA 5CH7B 1VLYA 2B8PA 2XSFA 2XZDB 3AD8C 3EXYA 3OTDA 3PYEA 3BSAA 4F0MA 4CIOA 4DL0C 3CCQS 1GMWA 3TJAA 2O67A 4ECWA 2UVVA 4MH8A 1YG0A 1F5BA 2A6MA 1J5EJ 1BQMB 5KOXA 3KLEB 3AXMA 3Q8RB 2OI2A 1S1TB 1IM6A 1YLXA 4FDFA 4B08A 4OI1A 1DZ5A 1HMVA 3H2VE 2AJ4A 4K4WA 1MROB 1CJTB 5IC6B 3QGIA 2P5VA 5K20B 1D8YA 4R5PA 1P8GA 1S4EA 3QMQA 2IC3B 4Q7AA 1HPZA 1SC3B 3IR5B 3A8EA 3PJ9A 3GU0A 5KG7A 4X66F 3CC7S 4DZ6A 1VK8A 2K8GA 3DU5A 2A6OA 2C2KB 3TAMB 5C2GA 3VAHA 4JI7J 3QJLA 3I0RA 4NYPA 4C3KA 4DPXA 5L1IA 2ATLA 2UUCJ 3I4HX 3OVBA 2HHXA 3I31A 4QU7A 1HBNB 1QUVA 5C24B 1LV5A 1YRTA 3DLHA 2CQ4A 1RACB 3LGHA 4UOHA 4WYLA 3W9IA 3OV7A 4DLGA 4DQSA 4IR9A 5K8MA 3DLKA 3KLHB 3MDFA 3RYLA 4LF8F 2MPUA 3VAJA 2NREA 3E2EA 2V8DA 1TKTB 4WTOB 1RGVA 2ZITA 1RT6A 2PEHA 2DIUA 3QGGA 5HQLA 1KRPA 3PFEA 4KIAA 2MB0B 1HNVB 1VGYA 2H9ZA 3QIPB 3WC2A 1HWKA 2V6AA 3TX0A 4NI2B 1RTJA 4GO5X 3IWNC 3DRPB 3BKTA 1IWAA 2KH9A 5F8GA 3V4IB 5FD1A 5IWAJ 3FRZA 4HDGA 4DS5A 4KSEB 3CJRA 3NMAA 2MJNA 2OTJS 1TUWA 1Q53A 4J9OA 5FIIA 2KJVA 2B6AB 2E9ZA 4XPEA 2NYIA 4DSJA 1YJUA 1H74A 4OFZA 3W5ZA 3MM8B 2XTJP 4J90A 4LR9A 4LBIA 2BKNA 4UOFA 1BMQB 1S1WB 2LQ5A 3HK2A 1NZ8A 2Q79A 4UT4A 1UVMA 3BBFA 4PR6A 4B02A 3QLHB 4KGXB 1ICEB 1P9QC 4ECXA 2KT2A 2NS1B 1ZTWA 1YRXA 2V4JB 3AODA 2ASJA 4OQJA 2C3MA 2GVDA 2OPRB 2DR5A 4B3OB 3BV8A 3DCAA 1LW0A 2AKWB 3O1LA 1M5HA 2OFHX 3BDEA 1NSAA 1LWXA 1MN9A 1UWAA 1IN0A 3HT3A 3LWLA 1Y5LB 4W92B 2L9NA 4IFYA 4CLUA 2CJAA 3D0HE 4J9VA 1H0HB 5M2RA 5DM6Q 2G2YA 3KK1A 2AU0A 4A46A 2R7VA 1HWUA 5D0RA 2IYIA 3ZTRA 3R27A 5KFAA 1NMEB 1YDLA 2WOMB 3R7NB 4F67A 3HI9A 2EFNA 4HT5A 2F65A 1I6JA 3BEGB 4ZCMA 4JI3F 5KFOA 3M9MB 3SQGB 4Y28C 3HVWA 3AY0A 2R9LA 2C2EA 3C2PA 4J9RA 4UY8T 3NS7B 3G87A 1KC8T 1IBKF 2WCXA 3W2WB 1X9WA 1VBKA 2HVHA 2ZH1A 4ZN3A 2HBRB 4NEYA 5B0BA 3HKZD 3KK3A 3MEDB 4MKAA 2RRAA 3EMTA 4NLQA 2HSEB 5K5MA 4ZPBA 5CA5A 1AZSB 4OX7A 3LP0A 2EVZA 5EX3A 2L48A 4DLEA 3RRHA 4L6V3 4NLYA 4LIRA 2P8IA 2V69A 1NRKA 4Y2CA 2MKKA 4EFAC 4JI7F 5KFGA 4TY8A 1N33J 4B3TJ 3CJQA 5CQGA 3U27A 5EN1A 2HHPA 1RAOA 2QN6B 2KFYA 4LMZA 2E5HA 1V3ZA 5A8KA 4LR7A 3H8YA 3KKFA 3MPYA 2E1CA 4Q43A 2BACA 2L9WA 4PUOA 1VQ7S 4RBVA 1DTTA 1HBOA 3MAAA 2FGCA 2DGTA 1N0VC 4IO9Q 2Y8YA 1SIZA 3MECB 2J9CA 4ITSA 2IJRA 3QT8A 3KLFA 1R43A 4ZVUB 5BYRA 1HFEL 3SIPB 3S8SA 1EX8A 5JMNA 4Q2MA 2VJUA 1CG2A 3PFOA 2VQFF 4LIWA 1RKIA 1VQ8S 1BQMA 1LNQA 2J6SA 3ICLA 3ILLA 4RNOA 1DRZA 2PFFB 1UVKA 1WC4A 2G2OA 2VPWB 3HLUA 3HSJA 3JQJA 4KTQA 1Q81T 1S79A 1LXNA 5H9FJ 5MLCV 3H90A 4H4OB 2YBVA 2BE2A 4CO2A 1YZ6A 2QGFB 1F60B 1XERA 2AJ1A 4L3KA 1REGX 2FJDB 4ZP6A 1QY7A 4LF7F 2FHJD 4CNZA 2VASA 4WXWA 4U95A 1AYEA 5F8IA 4X64J 2BANA 3RW6A 2W9BA 2FVQA 4ICLB 2HIQA 1FJ7A 5LOQA 4A8MP 2JC0A 2ZOMA 2ZHAA 4C98A 4F4XA 2DJWA 5GVQA 4DR4J 4K4ZA 4QCLA 1WC0A 3GG0A 5J2MB 1NNDA 2AJQA 4USIA 4PKDB 4Q45A 3QNWB 4ED2A 1Y7PA 2ILYA 3TX8A 5G4DA 5F8MA 4CI0B 3MEEA 4YR3A 3GIJA 1ZETA 1RSCA 1YJNS 3VGSA 4ETZA 1HLWA 5BR8F 4NMLA 4WU2A 4BWMA 1KS2A 4GVBA 2B7BB 2LXFA 4FVMA 1HNWF 2QLWA 2E5LJ 1FJGJ 3R5BA 3C15B 3JTNA 4USVA 1C4AA 2FJAB 2IHR1 4G1PA 4UQGA 4DR5J 5A6WA 1JX4A 3BS9A 2MSTA 1PJ5A 2V2QA 1CULB 1XNRJ 2EFOA 4A8SA 1T7PA 3HHLB 4RW9A 2DCUB 3H2UB 4JI3J 2GVZA 4X64F 2ZM6J 4YB5A 4MIBA 4C6AA 1S1VB 2OSQA 5I3PA 4DL5A 2DRAA 1TV6B 2K3KA 1R8HA 2KHDA 4ID8A 4CLLA 2CJYB 3RJMB 3MPDA 4WFXA 5KG1A 2FGOA 2WBMA 4WCEQ 4OI6A 3P49B 2CG8A 4USMA 2P9GA 1TKZB 3GFZA 5KFEA 1LWCB 3RBEA 2CZ4A 3NGRA 4I0WA 4DPWA 2XMMA 3IG1A 2DNPA 4QWEA 4ECTA 1T03B 3J7AN 3IR6B 4DFMA 1UP1A 1UWBA 4JI6F 1NXIA 1RT4A 3P5BP 2YQ3A 3CJKA 4DPOA 3QSYB 3T1AA 3DYAB 4PG5A 2UZAA 4LVNP 4P2SA 5GADI 5HP1A 1S1UA 2D74B 2VC0A 4F8RA 2HHWA 5F9NA 5GAHI 4CO4A 4IFYB 1JLGA 1LXJA 3NGTA 2UVUA 2O66A 2W4PA 1JNZB 4UTGA 4QBUA 1U1MA 2ZZMA 1GXLA 3J7YI 3SQOP 1G3OA 4HR2A 2XMKA 2VG7B 2Q1LA 3PHEA 4ECZA 1UWBB 3AFGA 2QT7A 3DC2A 5E3CA 5J2QB 3RRGA 1H2TZ 2VFSA 3NGKA 1VRUA 1T11A 2RF2A 3D0IE 2Z8QA 4NX9A 2RQCA 1WHVA 3KDOA 5CXTA 1UPMB 4JI4F 2MY8A 1S0OA 2QLJB 3DFEA 2CNKB 2PN6A 4DSFA 2Q66A 1RAIB 4LF6F 4NASA 4DDFA 5C5JA 4USUA 3WX4A 4B9VA 2VL1A 4QJVA 4ED8A 5D3GB 4O0IA 1QAJA 1GT8A 5JVGQ 3NOCA 4LT6A 2M8DB 4R25A 3U1LA 3K5LA 1XNQF 3AOAA 3MM5B 1AT1B 1HNZJ 4V19X 4LJMA 3JYTA 3UDCA 4YOEA 1KHVA 3QSIA 1HI1A 5J2PA 2K3IA 3HXMA 1HBUB 2ACYA 4L3NA 5ADZA 3E3XA 4L72B 3HSZA 1DY3A 4OI4A 3TA1A 2CWKA 4KO0A 3S1TA 2APOA 3I0SA 4CM2A 5ETSA 1SXLA 2M8HA 4RO0A 3PYFA 3KG1A 2LKZA 3I55S 5T41A 1QLNA 1ZZFA 2J0XA 1I1GA 2D3ZA 3UQSA 1U48A 4ZP8A 2BJ8A 2NSCA 5EHHA 2VU5A 5F9LA 5J2MA 3PO4A 4OZ0A 2YX1A 1SV5B 1EHWA 1FKPA 2JNJA 4B9LA 1N36F 1Z2ZA 3D1QA 3VF0B 5HO4A 4ZLPA 1UCNA 4X4RA 2HNYB 2PSZA 3L3CA 2V4QA 3VQSA 3AA9A 4Y2AA 1N54B 2E5JA 2MLZA 1WSRA 2Q6BA 4K8RA 2AD9A 2O1PA 4LF9J 2LVWA 2JZ5A 4DG1A 2HAIA 4RW7A 5LXYA 5A2QU 5KT2A 3T9NA 1ZAWA 3EGVA 5K14A 4CT9A 1U1RA 1MU2A 1GX6A 1HBMB 2VDHA 4IG3A 3ZTPA 2BVZA 1F3VA 2GHVC 4C97A 3D2WA 1KNZA 1DURA 1MWZA 3DRSB 3QGHA 5KT6A 2JH3A 3OTEA 5E3RA 1F9FA 1RT6B 3A4TA 1IWGA 2DNLA 2Y0SD 3THVA 2QMUB 4PXCA 2C3YA 2ZUAA 4PG7A 4ES2A 2FLOA 3IM8A 3E01B 4QWAA 2LDIA 2IM1A 2V8PA 3SDEA 2L9DA 4ZVGA 1IJEB 2CDQA 4RNMA 1LWFA 1KTVA 2L3MA 3D6MB 4YDDB 1Q7YT 1AB8A 1HHQA 3I5AA 4I4BA 3TA2A 2LECA 1B0VA 2MEWA 5F3ZA 4DCPB 3I0RB 2HWTA 4I2PA 4A8WA 2HHQA 1FD8A 1MLAA 2BKPA 3ILJA 4LRAA 3KLGA 4KJIA 2XO6A 3CGIA 2QMWA 3Q22A 1NJZA 2P2CB 4ZPWR 1JQGA 4NPOA 5J2QA 2NXCA 3UDVA 1JLQA 5DQGA 5HK4A 2PDAA 1TUVA 4KAIA 3MMAB 4XDCA 2E29A 4LSLA 2J9EA 4RJVA 2F7VA 2OP5A 1B0PA 2N3LA 2DHHA 5AE3A 3GQCA 3DDIA 2GHPA 3MURP 3HD2A 2HKEA 3N6LA 3AD9C 1VJWA 3G8QA 1SC6A 1Q8BA 4WE1A 3GSDA 3KMQA 3KK1B 1Y3KA 4O4RA 4ZN1A 2BW2A 5D3GA 1BE4A 2HHUA 1NPPA 4NEZA 3D5MA 2MZJA 2OELA 3OR2B 5HATA 1NK6A 2GX8A 1YIJS 2EK1A 4DFPA 3N5FA 1N56A 2UUAF 4EZ6A 1S6QB 1MNEA 2B4VA 1DHMA 2HNDB 4DN9A 4PPDA 4B3MF 4WK1A 3P3DA 3W3SA 1ROFA 5KAKA 3MM9B 4Z2XA 4DSLA 1DTQA 1C1CA 2HFVA 5GAGI 2HVZA 2DT9A 3DRXA 2VG7A 2DH7A 4NLSA 1RKJA 5A8KB 4RL1A 5FLXU 2D3OR 1M5OC 2LYVA 2OAUA 1F2HA 1LK5A 5KFJA 4TVAB 3W66A 3GFYA 2C2ZB 3KJVA 3D4JA 1VBZA 2JEFA 2H5IB 2ZEJA 2CJ9A 3E51A 3MWBA 4PYAA 1KD1T 1ZTTA 1TP7A 1KQGB 4DU7A 3GV5B 3PYDA 3SSRA 4DPYA 3NNAA 2FTRA 4R8UB 1FNXH 2Q43A 4J5OA 3QQCD 1YQHA 1DBDA 2CPDA 2J8AA 2XYPB 2V4RA 2MKSA 4USTA 2MZ1A 6FD1A 4K4YA 3NP5A 3THPA 1SC4B 1TL5A 3PHTA 3SQGA 4WWSA 2XCPA 2W2OP 4P9SA 1YK9A 4DR7J 4ZLJA 1UEVA 2VG5B 2R2UA 3DHXA 3M1VB 2NYHA 4YB7A 3GP9A 5LJ3Y 1NK0A 1NDCA 2IMOA 5JUMA 2WVBA 4OI2A 4JI2F 2DISA 5AXMA 3KLHA 1JWWA 2KU7A 2HZCA 4L76A 3TZZA 1RWWB 1UPPA 4LFCF 1NO8A 3OFEA 3T1YJ 4EZ9A 4I6YA 4XO0A 3EPIA 4UY85 3ZO7A 1SPBP 2MHEA 1F0XA 1QAYA 2E66A 3V6JA 2XSJA 1SJRA 1KEKA 2PO4A 4RNHA 3TJ8A 3TI0A 3FUYA 1CJTA 1CC8A 3VAGA 1VC0A 3MFIA 4CO3A 1T9UA 2XG8A 1N8RT 2B3TB 4RX6A 1CBKA 2B5JB 2JSXA 1QTMA 3FK4A 1ITPA 1UA0A 1RWKB 2HMIB 1DTTB 3HKWA 4X4UA 4F4YA 2GAGC 2C42A 1S4FA 3BYPA 2EC2A 3WDOA 1JLAB 2ZKUA 4LSNB 3PNIA 4GO7X 1S99A 3MMCA 2AWZA 5FDLA 3TP2A 3TZXA 2GIFA 3T6BA 4QR2A 4DR3F 4M1KA 5KFLA 4X65J 1NH8A 3I87A 4OHYA 4DV4J 3CC2S 4DFKA 2G0JA 3R1LA 4ZLNA 4RNNA 1RA7A 3LP0B 4H4OA 1NUEA 2ZZTA 1TAUA 1GTHA 5E3QA 2O5DA 1M1GA 3LALA 2IDLA 2R7TA 1IKWA 3HMJG 1K1SA 2W2QP 6FDRA 4LQ3A 4FYYB 1JIHA 1TL3A 3FQLA 3I9V9 2MGZB 3H4DA 1IKVB 1D3WA 1FRHA 4M5NA 1MW7A 3DNCA 3ZZPA 1RI7A 1X9MA 3Q2TC 2W9AA 4HTJA 1LOUA 4MTPA 3G9CA 2DBBA 2UP1A 1CJUA 3K57A 3T1HF 4ER8A 5EX0A 1VQ9S 3MECA 2E7VA 1Q4RA 1VLOA 3LOUA 1U2FA 2NSBA 4J9LA 2J9DA 1YJTA 4Y3CA 4AL5A 4WYWA 4EI2A 4CWBA 2DIVA 3C16B 4ZVFA 3L09A 1RU1A 1U0HA 1SJFA 3A13A 2K7KA 3V6DB 2N7CA 4PWUA 1CEZA 3OVSA 4DV4F 1EQ0A 3ISZA 3NBPA 1VC5A 1MG7A 1RTIB 4M5KA 4LF8J 2VF3A 2Y3YA 3BGLA 3SDEB 3KDNA 4NLXA 3IFEA 3RGIA 3UR3C 1U1NA 4JI5F 4ZVOB 1FKOB 1R8AA 2HFZA 3ITHB 1YTYA 2ALZA 2MXYA 3D7SB 5FJ4A 2GVDB 1HNXJ 2ZH2A 1FVQA 4B3OA 3NCPA 1RTHB 2KVIA 2VPXB 3DI6A 3NCRA 3PDNA 2AGQA 2VA3A 4Z37A 2ZH3A 4C8OA 1C4CA 3EGZA 1S5ZA 4ED6A 1U24A 1IBLF 2UVRA 1LW2B 4BWJA 5CD4H 3MM5A 2GJFA 3UCGA 4ES3A 4EGLA 4HTIA 1CQNA 3UCUP 3MI7X 4ILLA 1QJHA 1URRA 1ULRA 2M88A 2HPUA 4HH1A 4MFBB 2R7RA 3T1YF 3PG9A 1RLDA 2WONB 3M7VA 1S57A 4KBIA 3CC4S 3TVYA 3HHLD 5A76A 4DUZF 1LWEB 2B9XA 3DRRB 4ZCKA 2DEJA 4PXBA 3DLJA 1H73A 1T9TA 2VPYB 1WD6A 2AX1A 3RG6A 3ZTQA 4IRKA 3PKMA 4XTTA 4R8UA 2NUHA 3CD5A 5KFPA 5K9FA 4F4WA 5J1PA 2CZ9A 2JJ4D 3I0SB 3P6YC 3IWXA 4MJKA 3DOKA 4OZ1A 4K59A 1XMQJ 1U0SA 3QLHA 2G1DA 2DGOA 3EVMA 1UJ5A 2AX0A 3H59A 1L5UA 1XR6A 4I6WA 2AJFE 2DH8A 1GX5A 4N8NA 2XBPA 5B0DA 3FBCA 1MMDA 1ZA1B 1RT4B 2DCLA 1S1UB 3AOCA 4P2XA 4EYHB 1DTQB 3MR7A 4QPXA 3DDNA 3L95X 3O3LA 2UUBF 1Q79A 3GCXP 1WORA 2VG6A 1NK8A 2XEXA 2HAFA 1N6QB 4ZKAA 2VPZB 2RSQA 4OI0A 3W9JA 3ELHA 4F0HA 1R8CA 4KQZA 5HSPA 5JJBA 4LVOP 1UL3A 1TL4A 3GMGA 5H9EK 3CMQA 1F9EB 4IDKA 4P72A 2KRRA 4WJBA 3OFGA 4YHHF 4N5SA 3OTOF 3HHLA 4RW9B 2YH0A 1O6XA 4ANEA 2OD4A 4ED1A 3CCTA 2X3GA 1S72S 4UOGA 1E6YA 2F40A 2YXLA 2V2ZA 3M6UA 3HFKA 3DGVA 3TAQA 4X4OA 5IOLA 2GQ2A 2YNFB 3I5BA 3K8WA 4OZ2A 3U1NA 3AA8A 4C0BA 4FKXA 4HDHA 2ZBQA 2V94A 4H4MA 1FFGB 4NL5A 1AW0A 4I68A 2ASLA 2Y1LB 5I42A 1WKKA 1R7IA 1U8WA 4OHXA 5I3UB 5ITHA 1L3UA 1K0TA 4EEYA 4RNFA 4ZLLA 3K5PA 4WXOA 3OQ2A 4XAKA 1VR6A 5IM0B 2V0NA 3CO0P 4ZHRB 1DLOB 1I5OB 2CPEA 4P71A 3MAHA 4M5MA 3BO4A 2EFVA 1YSJA 1KLNA 1F5AA 2QMXA 1Q8IA 1RZMA 2KL8A 3OTOJ 3PYGA 3MEKA 2ZWOA 1R6YA 3W7BA 4DI6A 3FSIA 2WSCC 2C2MB 3KUEA 1UVLA 2EBGA 2G0CA 1K73T 4MIWA 1WEXA 3UDEA 4JV2A 1V5IB 3GJRB 3KMSA 2R3VA 1G6BA 1NSPA 3MUMP 4KE5A 4JI0J 6AT1B 5KFFA 1JLBA 3R5JB 2EXUA 2D3O1 1RABB 4PG4A 4F36A 5DDPC 1HQEB 1CJVA 3W61A 1RYSA 2HHTA 1IR0A 3UWTA 4PQUA 5AXKA 4URSA 2YPYA 1IKXB 4DBQA 2C3OA 1X5TA 1WOSA 3JSMB 3D66A 2HNZB 2HGLA 1HBMA 1VQYA 5HAOA 2VODA 1T9XA 4A4JA 4JP8A 5BJRA 2MKYA 1WSVA 4DG1B 1CJKA 1V9OA 1G2EA 2QZ8A 1ZPVA 1S9FA 2IVMA 4A8OA 3Q0AA 1B64A 4CO1A 2HVEA 3FEXB 4LF2A 1N88A 2VIHA 5A8RA 2MZQA 3WC0A 2DGXA 4USJC 5HL7Q 4I69A 2V2KA 1HHTP 4WZMA 1E6VB 2EG2A 3LP2A 1NHUA 4C3LA 4DV5F 1PO6A 1SV5A 3CJ5A 3VALA 4FNHA 1WF1A 1O8BA 4EBCA 1LWFB 2UUBJ 2GMLA 3NOGA 2ZDPA 2RUGA 1FDDA 1HNIA 2X7IA 2ZFHA 4O23A 4DV6F 2H4WB 3OFHA 4WP3A 4DUYF 3PW2A 3R2CJ 2P6SA 5E2QA 4CH1A 3Q86A 3K7RA 1TFWA 3PZPA 3M30B 2R7UA 4DQIA 2IRUA 2CQBA 2QSWA 4IH6A 4YY3F 2XYGB 4LF1A 1OSDA 4IG3B 1MSWD 4YHHJ 1WI6A 1WG1A 2W1BA 5F3TA 2HGNA 4EO6A 4DQPA 5KFNA 3ENQA 3S6EA 4ECVA 2UXBF 3D67A 5HROA 2HHHJ 4FYWB 1RT5A 3WQPA 2RKIA 1U6BA 1RT2A 2FHMA 2JVOA 3BZQA 1GTEA 3M2UB 2KRBA 3I9ZA 2BOAA 2XULA 3C14A 1Y0HA 4OYZA 3SCLE 4BHQA 4ZMMA 5E41A 5KT7A 1S6UA 1UW4A 3PW5A 2QA4G 2Y8WA 2RD5C 4DSEA 4C8KA 1Y5NB 5L1JA 3TQ1A 5KT3A 4DUYJ 3UPFA 1U45A 2XMWA 4MT1A 1CPZA 2RJZA 3BN7A 3W63A 4EMDA 2KT3A 2GAHC 2YVSA 3X3UA 5I42B 3OJUA 3AJDA 4PG8A 1RCOB 5KFVA 1LEOA 1IKXA 4YS2A 3M2VB 4ZIWA 4QYRA 4D3HA 2GV1A 4FF4A 2WRMA 4HL9A 2IYGA 2LQBA 2K1RA 1N52B 2DPJA 3CF5Q 4FBTA 2DYAA 3BREA 4N77A 3CXCR 2GJIA 1EJ7L 5DZ7A 1UFWA 3UD4P 2ZUGA 1XBWA 3QWUA 1HA1A 5GMEA 2ADBA 2RE1A 1F1BB 2I0XA 2CPHA 2G9OA 1EKRA 1VMBA 1FDNA 3FNNA 4MKVA 3CJKB 4N56A 2FVSA 2HG4A 2E5GA 1YKWA 3K8VA 5ETOA 3K5MA 3IMQJ 4FF3A 4O4GB 2NCKL 2FC9A 3N6NA 5E0OA 2CJQA 3WIUA 3UR0A 3FEZA 3HZGA 4AXIA 3CJ0A 4P74A 1ZYQA 1F2GA 3OUYB 4I7FB 4JI4J 1JXVA 2LA6A 3F44A 3HPOA 2D41A 3ZZ0A 1C1BA 2VDIA 1YZ7A 2PC6A 3EZOA 2CUYA 2LU2A 3KLIA 3MUTP 1R3NA 5L1KA 4DR1J 4Y6IA 3IRWP 1O51A 3MHYA 4C11B 3IAS9 2F8EX 1MWQA 3R8YA 5AE1A 1CULA 2PFDA 2XS7A 2YWWA 3L7PA 1BY9A 1B0TA 3N9UC 1UFLA 2M0GB 2OO4A 2X3DA 2JHEA 1WOOA 3OXGA 4OZJA 3W2VB 3MR5A 3T5KA 3RR7A 4JI1J 1SCJB 4LF9F 1FNOA 2HQCA 4OYMA 2AMCB 3DOLB 1C0UA 4RR5A 4UW2A 5K8NA 3EYZA 2QX0A 5DLFA 5HLFB 3HHEA 1XC9A 1KQSR 2FJEB 1X0PA 5CYMA 2R2SA 3TR5A 3ZZOA 4KC5A 2D9OA 4ED7A 5HBMB 3PVXA 4F3QA 1S1XB 2YNHA 3Q8UA 2BJDA 1LFWA 2RNEA 1M1HA 2G0IA 3IXQA 3MPWA 3OD2A 3TEGA 1YJVA 3GONA 3M6XA 1TK8A 3BGOP 2XMJA 5ETLA 3CDEA 3BGUA 1U1OA 1L3KA 4PAAA 4RBUA 4MK8A 1TV6A 2RKIB 2DHAA 5IS2A 2GNKA 3SFUA 2VBYA 2HYIB 2QEXS 1SUQB 1L3VA 1FA0A 3N01A 4IQXA 2BJ7A 2M5YA 2DHXA 3H40A 2ZE2B 3HHLC 1HYSA 2MJUA 4Q0BB 1WG4A 2RDDA 1Q5YA 4O3OA 2R7WA 4Q8EA 5GAEI 2QA2A 3NWRA 2HLUA 2I1RA 1NDPA 2RB7A 2XI3A 4KFBB 3EVOA 2W8LA 1X7VA 1U49A 4RW8B 1M5PC 1OPZA 2MQOA 2MLYA 4HVZA 4M94A 1OS5A 3KG0A 3OLAA 2G2ZA 1TU0B 1HPZB 3IA0A 3T9ZA 4YN3B 3O6QA 2WW4A 1SJ3P 1UETA 3ENVA 4RU2A 3GV7B 1HNIB 3MAQA 1HMVB 5HVFA 4GKKJ 4KKOA 1U1LA 2GMHA 3KLGB 2JLFA 1VBXA 1HBOB 4Y2KA 1F9HA 1MMNA 4CH7A 5LSRA 5DGAA 2FVPA 4ELUA 4KFBA 1U47A 4OLOA 1FRIA 1KDNA 2XLIA 4LF5F 4FYVB 3CDUA 5C42B 1X31C 2KYXA 5CYQA 4DPTA 1X4EA 4TN2A 1JLCA 3BR9A 3B82A 1RWUA 4RUBA 2W9CA 3G6XA 1JJ2R 4GKJF 4KPYA 2WBRA 1RAEB 5KFIA 4CM0A 8ATCB 5KFQA 1VQ5S 4USKA 1QVFR 2B9EA 1JLEA 2JFKA 1LW2A 3I56S 3HHNB 4NRUA 4Y2MA 3QWPA 4FS1A 3NNCA 2LEBA 1S0VA 5KFUA 4DOZA 2BQ3A 1C1BB 3W1YC 4B9NA 3ULHA 1UVIA 2FVCA 4ALZA 1N34J 3LTOA 3AJ1A 1I51B 2BX6A 2DTJA 3DRYA 4KGZB 5K14B 1S1XA 3SYZA 2AP6A 1WOPA 3A3NB 4FVCA 4LF4F 2KO1A 2NPIA 2VFRA 1FKOA 2QA1A 4FNIA 3KLFB 2ZJQQ 3OXFA 3L9ZA 5DZ6A 1S97A 3LAKA 2WOMA 4P2FA 4PZVA 5CZXA 4J9UE 5EGYA 1VQNS 2KKHA 2YKMB 4RUHA 2LMIA 4F7VA 7FD1A 2VOPA 1SL2A 1BGXT 4WKRA 1RT3B 3RB3A 2NXNA 2YQ1A 5ETPA 4OJ3A 5KFBA 1K0VA 4EBDA 2M7SA 2KB2A 4ZVHA 4JV5F 2OMOA 1G7CB 3DXSX 4E8UA 2F8MA 2QC3A 1H2UX 3HDSA 4KV8A 4UZCA 1RTDA 1CVJA 3M2RA 3OR1B 2MQ8A 1SIWB 2BBEA 3VVTA 5DM7Q 3BSCA 2GW8A 1N5QA 3DGPA 3EE3A 4QIWD 4LRCA 3BF4A 1D9AA 1VS3A 2CDRB 4RW4B 2RAQA 2X1BA 3W8GA 3ZZRA 5A0YA 4CLTA 3DRRA 3IP0A 2ADCA 1TK0A 2H65B 2ATCB 2ILZA 3B54A 3PW7A 5J1EA 1AA1B 4DV1J 5A2QY 2EFPA 2W8KA 1VQMS 3OJSA 2HQGA 2NR0A 2YKAA 4Y2IA 1PBAA 2GIRA 4A8YA 1Y10A 3RB4A 3BPSP 4JI2J 3C46A 1CC7A 1PILA 4KY3A 3DYAA 4L75A 2X1AA 4F2RA 4NXMJ 4AD6A 5G0RB 4HKQA 3N79A 4Q2LA 3EVWA 1M5SA 3JS9A 2OFGX 1VHFA 3MEGB 4S0MA 5ETKA 3HO1A 1WKJA 4PABA 3WZ0A 4ZCLA 4ZJOA 3QBCA 2X51A 4J9SA 4KH0B 1ZAVA 4CLPA 4QYZJ 4CNYA 2OD6A 2HS0A 1RAHB 1ZS6A 1RHRB 1EP4A 1NU4A 3EWGA 3CCES 3BQ0A 2YWEA 2RRBA 2GFFA 4DR7F 3CJSA 3CCUS 3DOLA 2P6TA 1T9YA 5AXNA 4C8NA 5IXUA 1IM4A 1ZOTA 1YJRA 1T3NA 2PMWA 2DXFA 3CNQP 1O5JA 3R9LA 4NLUA 1XNRF 3HSDA 4TYAA 1JJ4A 1NKEA 2PI5A 3US5A 5LL6d 4OMFG 1WF0A 2HWHA 3DOKB 1PBUA 2V5HG 5EWFA 2A10A 3KLIB 4K7QA 2CPXA 2BJ1A 3MM9A 4MAKA 3RAMA 2KFZA 3IG1B 3VGTA 2JFDA 4BBYA 1R6VA 1WTFA 3OBIA 3CMES 2Z30B 1MROA 2R8IA 4M63A 3TVKA 4RWXA 4H54A 1OY8A 1S1TA 5KG5A 3GWCA 1GK8A 1X5OA 1ZM9A 1SL0A 3F41A 2ERRA 3VR1A 2L08A 5F8JA 2YKPA 3AJ2A 1Y3JA 1RBLA 3A8IA 4IOCQ 1NEEA 2ROEA 5DQHA 3IN5A 3RAXA 5EUHA 4NLWA 1EARA 4V19J 2CVIA 4FXDA 4JI1F 4ENOA 2IA0A 1FJCA 2YTCA 1XK8A 1D9FA 1X5SA 3QAUA 2AQ4A 2HS4A 3FGVA 1X4HA 2XCAA 4J9PA 2EEYA 2OTLS 3LQVA 3GYGA 4PG6A 3QT7A 3GIRA 2YWGA 3GIKA 2HGMA 1KVJA 2XMVA 3R5DA 3TA0A 3P4UB 4TLQA 5BYSA 1VQ4S 1U02A 2DO4A 5DDQC 4R5PB 1ZM4A 1IJFB 2AZ1A 2BXJA 3ITHA 4QW8A 2ZJRQ 1WI8A 3BQ1A 3H25A 2HFSA 2L41A 2UU9J 1W25A 2OPSA 1IKYB 2F8HA 4X4NA 5U47A 2VJVA 1TKXB 3IS9B 1CJVB 4LF6J 2BOPA 3T41A 4CLFA 2JVRA 3T1HJ 2OJ3A 3LAMA 4UZBA 4ZP7A 2WZ1A 1XNQJ 3ZNUA 3NL0A 3OL7A 1RISA 3HF5A 4MYUA 4A8QA 1XQIA 4Y0FA 4I64A 4I2QB 1TELA 1JK9B 1X4GA 4EBEA 3BB5A 1NJWA 4FP9A 4DX8H 5L39A 1U4BA 1AUDA 5IT4A 1PSDA 3UD3P 3M1VA 1RP5A 1C0TA 4LR8A 4M5JA 4HHUA 2E7XA 3D1HA 3IBCB 4GMKA 3BO3A 3V6HA 2ZZNA 3MR2A 5SZTA 3MTJA 3HCXA 2GGPB 3UD5A 2JEJA 2AV5A 2OKQA 5F8HA 4J9QA 4O4GA 3A8KA 2MQQA 2B56A 2NUUG 1UJ4A 2ZH5A 1QSYA 4OYIA 2MMYA 4OLPA 5KOWA 3F0NA 2BJEA 3W64A 1R8PA 4XPCA 1ZM2A 4DV0F 4C8ZA 2MQMA 1XMQF 2CQHA 1CSJA 3KG4A 4GRSA 4WK3A 4U8VA 1NDKA 3UCZP 4HI1A 2F5GA 4NCBA 4IKAA 3U1MA 4USWA 4CLWA 5CD4A 1KOHA 5D4OA 3RAQA 3RR8A 2CAJA 3CSKA 5L9NA 1GNKA 2GA7A 1A9NB 2V68A 2QA4S 3W60A 3G86A 1RHKB 1XR7A 3M32A 1PJ7A 5IZHA 1FXRA 4DR2J 2FJBB 2VBXA 2DRBA 4NLGA 4DR4F 3NCQA 1FFSB 3B78A 3CCSS 3R5GA 4K4UA 5E7OB 1YWXA 1T9VA 1IR2A 2FC8A 4CTAB 1HWIA 2V67A 1Q86T 3POTB 3C19A 1VQLS 4F3MA 3OUYA 1RJJA 4ILRA 4UOCA 4XDDA 1Q8KA 4K4TA 1S9EB 4WFAQ 4M5LA 5BR8J 2V2VA 1XWLA 3O5TB 2FJWA 1JKHA 3KTQA 5IWAF 5I3UA 5CYJA 2MTLA 4QIFA 3R6GB 2FHJA 4FF1A 4OI3A 1S12A 2XM3A 1X4DA 2Z57B 3DN9A 3J7Z5 1S49A 8AT1B 2CJBA 1IVZA 3GE9A 3IRXA 3QFHA 1H6KX 2POKA 1TL1A 1WJ9A 2R2TA 3J7ZT 3DOMA 3P8BB 4RPFA 1OJ4A 3VTIA 4QYZK 1OQ3A 1QD1A 4ZOSA 3THTA 2VD3A 1S9EA 4RW6A 4JI0F 5J1EB 1DQ9A 2JLGA 1APSA 2DNHA 2YPZA 3JSYA 4X62F 2AZ3A 2ZBIA 3K59A 2M52A 2M70A 2KXNB 3QT6A 2B51A 4M5IA 4OIXA 2E44A 3BYRA 3FFIA 2W7PA 2UU9F 4CLYA 3AHPA 3G82B 4OX9F 5H9FK 1CLFA 2FZKB 4RBTA 4O3PA 1S76D 3MXHP 1A6LA 2KXFA 3CD6S 2R7SA 3TRGA 4NXNJ 3CWJA 3MOZA 3KJNB 4KGKA 3OTBA 2W7OA 2WONA 3GJSB 2RU3A 2BQRA 1KVIA 2VZ9A 2JC1A 4OZNA 1Y00A 1FT8A 3RW7A 4ZK7M 3K2YA 2ZD1A 4X4SA 1VQOS 3F73A 4PXDA 3R6LB 4K4XA 1WUUA 1VQ6S 3C66A 2GO8A 4FPIA 3PM9A 3PTWA 3ZC4A 4URGA 2Z2MA 1PYTA 2LEAA 3M8QB 5KG0A 1URNA 4LBHA 2HVIA 1FWPA 3CVKA 2H4YB 1N0UA 2HFNA 2UXDJ 2GGPA 4DL2A 4ZVPB 3IAM9 2D7SA 2AJ0A 2HQDA 1WEYA 2CPFA 2MSSA 3M30A 1W2BR 1SQGA 2FYXA 4ZVEA 3L4BC 2GO9A 3DRSA 3NLCA 4CTAA 4YQWA 3PCOB 5AXLA 3Q8VA 4AQYJ 1D1UA 3KK2B 3M9OB 4AFFA 3R5CA 4NYOA 4P7TA 2NXJA 3MMBB 4MKBA 4ZP9A 3CB4A 2U1AA 2EK6A 3GIIA 1IBMF 4O3SA 2F63A 3IBWA 1KONA 2B7CB 4B3TF 2K7JA 1HBNA 2YX7A 1JXEA 3B6BA 1ZA2B 5C24A 2IBKA 1I94F 2G4BA 2QE5A 2ZKTA 1UEUA 4DR6F 2KJWA 2FHKA 4FPRA 1TKXA 3HVTB 3GFXA 4NOHA 5IM0A 5DDOC 1JLQB 3I6PA 4X84A 3VQTA 3ISNC 1T03A 4KHMA 5LMNF 2IC3A 1JMTA 1N5VA 3KUHA 2BJ3A 2CXEA 3FVYA 1IUJA 4MK7A 2XGQA 1SKWA 3BDPA 3G8TA 1PYOB 5BXIA 5KFYA 3AB2B 3UNYA 3JSMA 4FYDA 4K5RA 3SCIE 4X66J 4YY3J 4TU8A 3WIVA 3DU6A 3M6WA 2PE8A 3MPVA 2AGPA 2KT5A 2QYCA 4CCHA 4QIGA 4DL7A 2MDAA 3UDLA 3BN4A 4TLRA 2QTWA 3HT0A 3PJWA 3C6TA 2DGUA 1RT7A 2HVDA 2CNLB 4G1IA 2CJKA 3TW0A 4LBPA 1OIAA 1H38A 3MCNA 2FUG9 3D68A 1NSKL 1YBUA 4CZCA 2V50A 5HANA 4DR6J 5GMKa 3UVJA 2XMUA 1CS4B 1TL7B 2HWIA 1U1PA 2VG5A 1RUSA 2WSFC 2QYGA 2W2NP 3LW5C 3E8OA 2DHGA 4KT0C 3MM6B 4K5SA 3C8YA 4C9DA 1NBEB 4DF8A 1PAUB 2Y1IA 1SQFA 4OX9J 1SJ4P 2W2MP 1VRUB 1FRXA 2M3DA 1TFYA 3VHQA 4ZITA 1OO0B 4H4KA 2CA9A 1R8BA 5JXSA 2JWNA 4G65A 4RW7B 2W24A 1KHWA 4QOTA 3SV4A 3P45B 4NXNF 4RU9A 4K2JA 1WTBA 3HM9A 4UF4A 3CCMS 1WHWA 1RAJA 3Q89A 3VGVA 3WHIA 2IRXA 3B4MA 2BJ9A 2A0FB 5IC4B 1JLGB 1U1QA 2DHSA 4USHA 5LMUF 4XIUA 2VKRA 3KNGA 3J80U 1GXTA 2OEJA 3UO0A 5HP1B 5AJ3J 4URQU 3HP6A 1AZSA 2WW8A 5HMWA 3HULA 1REVA 3Q83A 1IKVA 4IQMA 4CO0A 4AL7A 3D28A 2J0QD 2O3DA 3KK3B 1RBAA 4MIAA 4UUXA 4ZJQA 3WBZA 4C8LA 2N3OA 1RDRA 3QFWA 1SQEA 1U6ZA 5AT1B 3NXZA 2V9KA 3J81j 1FNMA 2CJXB 5KFMA 4DR1F 1UW9A 3ZTOA 1RT2B 5CZVA 2CNNB 3ET6B 4HACB 2ROGA 3AB4B 3R5AA 3TEHB 2JEIA 5KFTA 3FZ2A 2VA2A 3N0VA 2A2CA 1VDHA 2JL9A 4KPCA 1N32J 5LMUJ 3Q23A 2K1RB 1D8ZA 2C3PA 1JKHB 2FIUA 4OX8A 4OYOA 3TUIC 5M2UA 3CULA 3M05A 4RW4A 3JSBA 2ZHOA 4YDXA 2MZSA 1WHYA 4YMEA 3FEYB 1FEEA 1NPKA 2EKYA 1DARA 3JB9k 3BSNA 1ZZNA 1RWNB 2YY3A 1Z1ZA 1EETB 2AIRB 2IM2A 4OZLA 4QIVA 2IAJA 2OPRA 3HHKA 1FF2A 5B0AA 1FE4A 4YUDA 5D0GA 3QRRA 5DRKA 3QRPA 2V4JA 3P5TL 4F25A 3JQMA 4G1QB 2EC0A 4L74A 4DV3F 1V6HA 2GMJA 4ANDA 1HIYA 1IR1A 2DGWA 4B3MJ 3MTKA 4GKKF 3C14B 1U2CA 2LU1A 5B0GA 4ETXA 1RU2A 1RTDB 2G1HA 1U1KA 2WTFA 3MEGA 3LGNA 3U02A 1X8DA 2RDIA 1RT5B 2VFVA 3CD0A 3ETMA 4PWWA 3C16A 3PXGa 2XMAA 5J2NA 2R8JA 5THWA 4WF9Q 4F02A 2B6AA 2J76E 4P2MA 1VFJA 3VVUA 3PRBA 4EO8A 1TMMA 3EGWB 3IWLA 1VCTA 2DR6A 2OSRA 3A12A 1K9MT 3T5JA 2EW9A 2H3EB 1J5EF 4OV6A 1WC5A 1WC6A 2QL5B 1ZM3A 2VBWA 3DMJB 1T0TV 1SKRA 3CMAS 1D9DA 2C28A 1HI8A 2HBZB 4U67Q 2J6TA 2Z2LA 4N76A 4DF4A 3MM6A 3EDQB 2GCFA 1BXNA 4OJGA 1HQUB 5D0HA 3S01A 2KDOA 4EK2A 5C25B 3VAFA 4ZDNA 2NQPA 1B70B 4K4SA 1NHKL 1R31A 3FC9A 2OHDA 4NLRA 4ED4A 4NZ0A 4QWDA 3DLBA 4B9TA 2YWHA 5D0EA 3SXLA 1HI0P 2GVZB 2XNQA 3ADAC 2FZCB 2CQDA 1BQXA 4M5DA 4ZJLA 1K1QA 1PAEX 2G13A 2J8SA 2RQMA 2NZCA 3V4MA 2HHHF 3H4BA 1BWEA 1NB7A 1IQZA 3IM9A 3NG8A 2COLA 5CYQB 3W65A 4C3MA 4HI2A 3GTYX 1HHSA 1UEKA 1WG5A 2QFIA 1V3SA 1W26A 3MM7B 2QG9B 2OIHA 4N41A 1IKYA 3TUJC 2H1YA 1NLKL 3AAWB 1SJQA 4IG0B 3SCJE 2DRDA 3NEKA 4GVLA 4TU7A 4ERDA 2B8QA 3J80Y 3FSXA 1I3OB 4O3QA 1WDTA 3VGUA 1S77D 2PT0A 1CS4A 1TL7A 3JTPA 5IT0A 3TUZC 5EWGA 3KUGA 1KP6A 4PQUB 3KFWX 4OV1A 2MKIA 4LF4J 1HNWJ 3BPDA 3KWMA 4WE1B 3RBZA 1F5CA 2ZE2A 4DUTA 1LQ9A 1VK3A 1HYSB 1R0BG 4GKJJ 4DCOB 4ZCIA 2IJFA 2VB6A 1S7HA 1OSCA 2BE2B 1N32F 1WWHA 3JAMY 1BD6A 3PIPQ 1WACA 3EXCX 1SUQA 5KTQA 4NA1A 2M4MA 4F04B 1DLOA 4DV2J 4ECSA 4ED3A 1VIOA 1R89A 2R7QA 5DJBA 2BQUA 1NPRA 1PC5A 1QSLA 5CCMA 2KHCA 2MLXA 2NZ4A 1RHQB 4LREA 4WIQA 4BS2A 2HURA 1RE1B 3POTA 2K06A 1T94A 3W9HA 2RDJA 3SSSA 3FCVA 2WB1D 3GILA 4JV1A 2ROPA 1UZDA 5HLFA 3H7HB 1B3TA 5ETVA 4M95A 1T95A 4PCQA 4NWBA 2DXEA 4Y34A 4RW8A 1Y5IB 5CYMB 2N82B 4H4MB 3NWGA 2YNFA 2CIMA 4NA3A 2Z4PA 3HVAA 2ALYB 1GMUA 3DKDA 2ACMA 4K0KF 1FX2A 4WTYA 4M5DB 5HJYA 3C3LA 3DLGA 1BC6A 4ZA1A 2FPHX 2KZMA 3QGPA 1V5VA 2J0SD 2GC8A 2PMHA 2XWYA 1NZAA 1QVGR 3LP1B 1BHNA 3CDBA 3QZ7A 4NCGA 4RZRA 2ZH9A 1IBKJ 4TKTA 3BO2A 1BQNB 4FXWA 2BM0A 4LFBF 1HQUA 1VHIA 4NLPA 1RK8A 3TO8A 5C25A 3OL9A 4NLTA 1LWCA 1AROP 3D6HB 2XC9A 1JNRB 1HNVA 3ENWA 3H42A 3IR7B 2FY8A 3DOMB 3M8YA 4A47A 4NRTA 4CH0S 3CCZA 1DJ0A 1HL6A 3D3BJ 3LP1A 2A3JA 3I32A 4PPZA 3SSQA 3TZWA 2QSFA 3J81Y 4K0KJ 4J37A 4DQQA 1L3TA 1RWVB 3R97A 5J2NB 2PEBA 4CP5A 1L3SA 4N8OA 1T02A 3RBXA 2Z56B 5EDWA 2DY1A 2FY1A 4HLBA 1VIXA 1G4CA 4DV6J 1MMLA 2DNKA 2EFGA 3IC1A 3M2VA 4TXSA 5B0EA 1WELA 3GIMA 4B3SJ 4YR2A 5DG9A 4HH0A 2HBYB 1X4BA 4LFBJ 1SBRA 2JEGA 2GQCA 4AXJA 3KOAA 1RHMB 5F8NA 2E1AA 2XI2A 4YB6A 5HN0A 3BH7B 4RW6B 3M32B 1NKCA 1FESA 2AW0A 4I2PB 4ZS6A 9ATCB 2YX4A 3H0PA 3N5BA 1N36J 1QAIA 3JYTB 1PIEA 4B3RJ 1YBTA 2CG4A 5F8LA 4RUCA 3M8RA 2HK3A 5B0FA 2OGUA 2WSEC 3M2UA 4C2MA 4JOUA 2AGOA 2UUCF 2XZTB 1RYRA 3DLEA 4LF7J 2X1FA 2GS8A 3VV2B 2I5JA 1M1KT 3D1OA 3PW4A 4D3GA 5L1LA 2I9SA 3EJMA 4X4TA 1RAFB 2DXDA 2E1RA 2PA3A 3CE8A 5E5NA 1RTHA 3DI6B 3EM1A 3LA0A 4HHJA 4AT1B 4QU6A 3EUNA 2GJ2A 2RILA 3SMZA 1TL3B 1W7WA 5A0YB 3SI8A 4K50A 3AH6A 3GSIA 3NY0A 2B4OA 3N6MA 1NHVA 5D6GA 4OYPA 1EIYB 3QRQA 2OPQB 1TUGB 3EZ5A 3D3CJ 4N47A 1R0AB 1TKTA 3PX6A 2ZH8A 3FCWA 2CQCA 2XHWA 2D69A 2YNIA 1IXKA 3FDSA 4CDIA 3DLKB 1X0FA 1PG5B 3DLLQ 4LFCJ 1SKUB 2QO3A 3LP2B 4DV0J 1FTRA 1ZAXA 3HVTA 3NBPB 2M9KA 4WFYA 2BE9B 1H72C 5IFMA 2DK2A 4PUOB 3V6DA 2MYFA 2MY7A 2DGQA 1U0HB 3MCOA 4LUBA 4X65F 1KN6A 3ETOA 5B09A 4Z7YA 5HJXA 4NCAA 4WBFA 2XNRA 1DFDA 4C48A 1OYEA 5LSLA 4IFVB 2CPJA 3AT1B 3FBEA 4I6AA 2WVDA 2RHSB 2N4CA 4ANCA 2MKHA 1X5PA 4NZ6A 3UI3A 3MMJA 2Z2ZA 3CCRS 4OHWA 1KWMA 1SI9A 2OPQA 3PACA 2UXCJ 1NK4A 3HFVA 2AYMA 3TANA 5KFCA 3M4XA 2DGVA 1NAQA 1ELOA 2CADA 5H1SV 1JXLA 1HQ2A 2W01A 1YI2S 3UN2A 4DSIA 1FE0A 1WDDA 1Q1KA 2CQ1A 3QO9A 2YNGB 1D0EA 2WVFA 2RH3A 1P6TA 1Q0NA 2FQQB 2YQ0A 3OPKA 4JYAF 3K5OA 5FDLB 5G0RA 4QR1A 4Q44A 2DITA 3FQKA 1YJ7A 3R3TA 4AL6A 2XS2A 3NS6A 3PIOQ 2ZHBA 2R7OA 4I1TA 2Y0BB 2ABYA 3PEHA 2ZH7A 5C42A 2ZWPA 3LANA 3OW2R 2MQLA 1U26A 2YKOA 4TY8B 1N5TA 4C0HA 5FLXY 2HQIA 3MEEB 2DGSA 4H4KC 1T3OA 5B7WA 3MOJB 4ECUA 2NPFA 2DR8A 1KFSA 2QL9B 2RRNA 5CABA 2FLLA 2QJ3A 3O8WA 1WF2A 3SCKE 4QR0A 3VZIA 4I67A 2BE7D 2IAJB 4PQAA 2V9WA 2NXEA 1EQMA 5GAEU 4U7CA 2KXHA 4G3IA 2BMBA 4CLZA 1JLBB 1NKBA 4JI8J 2VQEJ 1IBLJ 1FXLA 1E6YB 3H5XA 1N33F 2BRLA 3A8JA 2IM0A 4JYAJ 4DMZA 1VYAA 3JSRA 1YBAA 2BV3A 4LQ9A 4F2SA 2HHVA 4P52A 1VBYA 1TR0A 3QATA 1RADB 1UFKA 3EGNA 4G6VB 5HVHA 2XZWA 3RRKA 3EX7B 2YKMA 1TMJA 4ZPDA 4MKYA 5GAGU 1WNEA 3LUYA 4DR2F 2C22A 3PY8A 2A1BA 2VICA 1FRLA 2WAQD 1PJ6A 4A8FA 1PKUA 1FK9B 4C7QA 2VKZG 4ZHRA 1P9YA 2LFVA 1XMOF 1FWKA 4DS4A 2DR9A 1Q7LB 5LM7E 5D15A 3T5LA 2MKCA 2ZDOA 5KG4A 3DHWC 3MAAB 4FKYA 1FDBA 2Z2YB 4M5GA 4ID5B 2B9WA 3KJVB 5D77A 5KG6A 2EKNA 2KN4A 4DL3A 2W7AA 4JI8F 4WFNQ 4GC6A 4F26A 1SL1A 5KFKA 3MR3A 5D4LA 3CPWR 5GADU 1NM2A 3RBDA 3C15A 5KG2A 2EPIA 1VJQA 2HS3A 2C1EB 2JLEA 4L73A 4PXEA 2F4FA 5T7LB 2KZZA 4X62J 3TAMA 7AT1B 2GIQA 2C2NA 3L7OA 3M8PB 4WFZA 4IR1A 4X4VA 2OPPB 1JJHA 3FJ2A 4DJBA 1K47A 2LQ8A 3BR8A 2HNDA 2XMTA 4PEOA 2ZC4A 1S48A 3ONQA 1PGZA 1TKZA 1S7IA 2BZ2A 3GCWP 4FYXB 3QIPA 1NK5A 1NJIT 2BKOA 1EZZB 4AQYF 2V34A 2LLZA 1C0TB 1RHUB 3OR2A 3W5XA 2E5LF 3FCHA 1HWJA 1S1VA 4Q5VA 4WPAA 2D9PA 4ZPAA 2KG1A 1IBMJ 4KHPJ 2W2PP 4IOAQ 4A8XA 1OYDA 2CQPA 3C6UB 2I6WA 2F1FA 3Q2SC 3SBMA 2VONA 1RT7B 4OX6A 3ZZUA 1GEHA 1I94J 2DH9A 2N7YA 2ZBCA 4QWBA 3HJFA 4LSLB 1N5YA 3ZZYA 1KVKA 2HRTA 1FCAA 3LH2S 3KK2A 1FRMA 5HVGA 5HMYA 2A2DA 2HLTA 2V8HA 1Q82T 1HR0F 4W4MA 3NGUA 2C2RA 1RBOB 2E7WA 3PKYA 4NLDA 2BW7A 2CVEA 4DPUA 2KVQE 4DL6A 2HZVA 3KHGA 1VC6A 4J9KA 1JJCB 3UN5A 1O0PA 1YJ9S 2MHNA 2DNZA 3CTRA 2N4DA 3MD3A 3H5YA 5T14A 1RT3A 4IG0A 4P7VA 3BQ2A 7FDRA 4DV1F 2W9CB 1RXOB 3UN3A 2PIIA 1FTCA 2NLWA 4ICLA 3LGMA 4ZPCA 1V3RA 3QT5A 4U9RA 1UTAA 1AUSL 5IT9Y 1N4LA 4PRFA 1HW9A 1P27B 3AQOA 3VAMA 2V8VA 1QDUB 2R8HA 5DDRC 2W25A 2RT3A 3BBCA 1LKZA 3BM7A 3JTOA 3V81A 1AFIA 2QLFB 5L46A 3MMBA 5AE2A 4KGVB 3X1LB 1QE1A 1X60A 4IO1A 5F41A 2Y9HA 2H48B 2O01C 1DQAA 2CQGA 2J0WA 2C3UA 4NLOA 3GZ7A 4NMXA 3CJ3A 3TOQA 3CD7A 4OYBA 3HX9A 3QPIA 5L8RC 1J27A 2XYHB 3GFHA 1H3DA 1ACMB 2R4FA 2VOOA 2ASYA 2M2BA 3I4PA 2IVFB 2Q3PA 3V81B 1X4CA 4OZ5A 2F9DA 3NKYA 2E9RX 4NLVA 5F0UA 4F0KA 3ZXWA 5MAOA 2OH2A 2BRKA 3RU0A 1HNZF 1FO1A 2J7WA 1JLAA 4LSNA 4X4PA 5AJ3F 1XMBA 3NGSA 3RB6A 2JDJA 2DR7A 5E33A 2ZNZA 1QUPA 3CT9A 4TYBA 4Z7CA 2RQKA 1OY9A 4GC7A 1RAGB 3LPYA 1XMOJ 4JB8B 4FBUA 4DFJA 1EP4B 1RCXB 1S6OA 2HNZA 3AXKA 1C2PA 4G1QA 4ZPVR 4AUKA 4J9NA 3MEDA 2AEJA 3KYLA 4ECQA 1HBUA 2AYEA 5KG3A 4DV3J 4U7UD 1LFPA 1UAWA 1C0UB 5ETNA 3W2WA 2LQ9A 1HQEA 4KO0B 5LSOA 2EI5A 3FZBA 4QQBA 4IRCA 2FJVA 4KHPF 1Y4ZB 3LF0A 3CCWA 4N7TA 4JV0A 1IQTA 2DNRA 5DGBA 4KHRA 2AJ2A 1TL1B 1U2RA 3OSNA 3DLEB 1K44A 3C6UA 4ID5A 3UNGC 1GAOA 5D4PA 1A7GE 2XHCA 1FDAA 2HFOA 1KTQA 1VISA 4FN5A 4JUZA 3G4SS 4F4ZA 1NJXA 1FWLA 2HEKA 4BCAA 2OEKA 3CCJS 1HR0J 1RTJB 2MZTA 3M6VA 2WHOA 5SUHA 2R2RA 1UZHA 2OUGA 3CJ4A 1S9GB 1TAQA 1U8SA 2UUWA 4TU9A 3LO3A 1N34F 4X4QA 3KLVA 3T3FA 2RVJA 1OMSA 3M8PA 1SH2A 5E3AA 5ETTA 1KR4A 2KG0A 2ASDA 2FDNA 1UA1A 4TY9A 2U2FA 1F6TA 2GZOA 5LXRA 1OWXA 1S1WA 4KR0B 3TARA 3PRDA 4EUVA 1XEZA 5GAHU 3GB0A 3RUBL 2RMLA 1XN9A 1WC3A 4C11A 3OL6A 2KM8B 3MF5A 1RA6A 1T8EA 2AHOB 2X1GA 1Q8LA 3I5CA 1H98A 1RWXB 4ZVSB 2BEFA 2JRSA 3K0JA 2ZBRA 3PV8A 3AD7C 4I7FA 4RWWA 5IT9U 5CAAA 4YEAA 1KLMB 3P96A 1M90T 3NAIA 3R7BB 4NA2A 1FI4A 3IBFB 3D6FB 4P10A 1S6QA 3ZZTA 3GYNA 4DX7A 1EKSA 1DQ8A 4FS2A 4O44A 2CQ3A 2CZVC 2H51B 2J6UA 2JOQA 4P75A 2VG6B 3M8WA 4FXVA 2ZOFA 4NE9C 3OHAA 2DVIA 4WP8A 1UVNA 2HQ3A 4K4VA 2ZH6A 2I8EA 5D4NA 4E0DA 5ETMA 2EWHA 1RWOB 1EAYC 1RB0A 1TTHB 1U6FA 3MD1A 1FVSA 1U09A 4ES1A 1NCLA 2DO0A 3BKUA 1SH0A 3CO9A 3TZYA 4QWCA 4TNOA 3GPAA 4DEZA 4TQRA 2Y1JA 4MK9A 2CWXA 4DCJB 2KFNA 2LXIA 5A6PA 3S7RA 1QSSA 2EBEA 1Q78A 1VOMA 2D1CA 4JI5J 2RIJA 1C1CB 4IH5A 1X4FA 1XR5A 4GVBB 4QZVB 4M5HA 1HNXF 2A18A 2IMWP 4JV5J 5KFXA 5ETRA 2HZAA 4OHVA 5KFRA 1X4AA 3LPEA 1S9GA 1NH7A 2ZOGA 5KFDA 4IFVA 1SKSA 2B0GA 3NAHA 4W98A 2YWFA 4ZIVA 2HRUA 2CQ2A 4Q8FA 3BH6B 3KLEA 2HFUA 1LWEA 1BLUA 1ZPWX 4CLKA 4U8YA 4A8KA 3TUPA 4C4WA 1E6VA 1GXUA 2HIYA 4HEA9 4DX5A 3FSYA 1S10A 5HROB 5DLGA 4Q0BA 1KOOA 1D09B 3QZ8A 4W90B 5EWEA 1T9WA 4WIIA 2YNGA 1GQEA 2QRRA 2EFQA 2HK2A 3MUVP 2I2YA 1A0OB 5J1NA 3KXDA 1H7XA 3NMRA 5H9EJ 2XWXA 4DV2F 4LRDA 2QV6A 2H5JB 2OEMA 2ZH4A 5IQ6A 1QTNB 3EICA 2MGZA 1VRTA 1H2VZ 3PX4A 1HD1A 4M8LA 3HHDA 3SEOA 3N28A 1ZBTA 2V63A 1Q16B 5ETQA 3UW1A 1VQPS 1U25A 2CPZA 2CQIA 2QIFA 2XS5A 3GR0A 4O0NA 2AF6A 3TVZA 1WEZA 1PYSB 2I5JB 2ZC3A 2ZD1B 1HWLA 1JLCB 1JB0C 2VC1A 3M8QA 3MM7A 2RS8A 5CHCB 1T05B 5A8RB 2HBQB 2FLNA 4DR5F 2IVYA 3KHRA 2RS2A 1F3FA 1TQLA 3KJFB 3PEJA 3Q8QB 3G6YA 4CLSA 1IBCB 3GR1A 3CCLS 3OT9A 4YP3A 5DG7A 2PI4A 1Q95G 1NJYA 3ZFVA 4C0OC 3SV3A 2HMIA 3Q8SB 3IGNA 3H98A 2HRYA 4CYUB 4F50A 5LJ5Y 2B4PA 2H54B 5KFHA 2VBZA 1WKLA 1FKPB 5I4MA 4RLEA 2IM3A 1AFJA 2FB0A 2FVRA 2DB1A 2XY6A 1S0NA 1B7FA 4PYDA 2DNYA 3RB0A 3M2RB 2Y1RI 3OR1A 3PJXA 3G6VA 2B43A 2VQFJ 1G1XA 2VV5A 3IO1A 3CEDA 1X9SA 2KM8C 2CNOB 3OFFA 2DNQA 2FLPA 1P1TA 2CFXA 5DS7A 2XQCA 4WU3A 3DMJA 3FBFA 1AXQA 2AEFA 2XO7A 3G96A 4JI6J 2PMZD 3J7YU 3QJPA 3BBBA 1TKDA 3IRXB 3B4DA 1NDLA 3MGJA 4Y00A 4CQ1A 1N48A 3HFZB 5HI7A 4DN0A 5HMXA 3H20A 3VWSA 5L38A 2ZM6F 3CCVS 4A48A 3D0GE 3MMCB 2SXLA 3BSOA 1YX2A 4BDPA 1TK5A 2HNYA 2E1MC 5D8HB 3MR6A 1CQMA 4P6QA 4X2BA 1LW0B 2LCWA 2RF2B 3CDWA 3R7SB 4B3SF 3AOBA 3DXBA 1Z2LA 2WVEA 2AYBA 3G82A 1BQNA 2ZVIA 2MKJA 5HQMA 4YFUA 5E3PA 1REVB 2UUTA 3GV8B 2FD2A 1KBRA 2BR0A 1SB6A 3A1YG 4OJHA 5KFSA 3JAMU 4ECRA 2XSJB 2QLXA 1FJGF 3T19A 2XLJA 3CUNA 1GH8A 3BJYA 2Z58B 3VAIA 3W2VA 3CJ8A 1RTIA 3JQKA 2QFJA 4B3RF 2VHGA 2DNOA 3N4WA 3K17A 5A8WB 4ZPTR 2FZGB 2IIHA 5DO2A 1OY6A 2D3UA 3Q8PB 4HT7A 4XK8C 5KT5A 1NK7A 5KT4A 3LWMA 4U7UK 4E2FB 2BYCA 2IA6A 1FHTA 3NS5A 2J9DE 4LFAJ 3KNAA 1FX4A 2YKNB
chains in the Genus database with same CATH topology
3QBCA 1IM6A 1EX8A 4M5HA 3ILOA 3HCXA 3KUHA 5ETSA 2CG8A 3UD5A 4M5IA 5ETRA 4M5NA 3UDVA 3HD1A 1KBRA 3ILLA 5ETQA 3MCMA 3KUGA 4M5LA 1CBKA 3HSJA 3HSGA 4M5MA 5ETLA 5ETNA 1HQ2A 5ETVA 1EQMA 3IP0A 5ETTA 1RU2A 4CYUA 4M5GA 1F9HA 1HKAA 2BMBA 4PZVA 2F63A 1Q0NA 5ETMA 1RAOA 4CWBA 3HT0A 3HD2A 1RU1A 1RB0A 3HSDA 3KUEA 4F7VA 3ILIA 3MCOA 1TMMA 1RTZA 3UDEA 4AD6A 3MCNA 1TMJA 1EQ0A 2F65A 3ILJA 4M5JA 5ETPA 4CRJA 1G4CA 5ETOA 2QX0A 4M5KA 4CYUB 5ETKA 3HSZA 1DY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QBC A;  1IM6 A;  1EX8 A;  4M5H A;  3ILO A;  3HCX A;  3KUH A;  5ETS A;  2CG8 A;  3UD5 A;  4M5I A;  5ETR A;  4M5N A;  3UDV A;  3HD1 A;  1KBR A;  3ILL A;  5ETQ A;  3MCM A;  3KUG A;  4M5L A;  1CBK A;  3HSJ A;  3HSG A;  4M5M A;  5ETL A;  5ETN A;  1HQ2 A;  5ETV A;  1EQM A;  3IP0 A;  5ETT A;  1RU2 A;  4CYU A;  4M5G A;  1F9H A;  1HKA A;  2BMB A;  4PZV A;  2F63 A;  1Q0N A;  5ETM A;  1RAO A;  4CWB A;  3HT0 A;  3HD2 A;  1RU1 A;  1RB0 A;  3HSD A;  3KUE A;  4F7V A;  3ILI A;  3MCO A;  1TMM A;  1RTZ A;  3UDE A;  4AD6 A;  3MCN A;  1TMJ A;  1EQ0 A;  2F65 A;  3ILJ A;  4M5J A;  5ETP A;  4CRJ A;  1G4C A;  5ETO A;  2QX0 A;  4M5K A;  4CYU B;  5ETK A;  3HSZ A;  1DY3 A; 
#chains in the Genus database with same CATH topology
 2J7K A;  5IV3 A;  2MQN A;  3D54 A;  4HHH A;  1TZ0 A;  3V6K A;  3V4I A;  4B9S A;  1SJ1 A;  2ZNY A;  1JLF B;  2XLK A;  3DRP A;  1GFW B;  1NK9 A;  2R8K A;  3NNH A;  1U7L A;  5RUB A;  3BGR B;  1Y11 A;  2YKQ A;  3DDK A;  4NCG B;  2XY5 A;  3K5N A;  3UVJ B;  3R1H A;  2OPP A;  3ZNJ 1;  1Q5V A;  3HSG A;  2R8G A;  1M0S A;  3V5R A;  1B7Y B;  4MFB A;  4OYX A;  1SVD A;  3UFC X;  2LEP A;  5HMZ A;  2FJX A;  4IRD A;  3EDR B;  5T7L A;  3HVR A;  1JLE B;  3GJT B;  3Q24 A;  2Q6C A;  4BLG A;  4OZ3 A;  4O3N A;  2C2O B;  3PO5 A;  5A8W A;  3SZ2 A;  1YGY A;  1OQ6 A;  2EG1 A;  4I2Q A;  4KGM A;  3RTV A;  5DET A;  3FBB A;  2WK4 A;  3NGD A;  1P1L A;  3ILI A;  3NRB A;  3WX8 A;  3MFH A;  1MWY A;  3ISN D;  3MMA A;  2J7U A;  5DQI A;  5K8P A;  4WFB Q;  2BA9 A;  1YJW S;  1T05 A;  3ENA A;  4OYW A;  2OPS B;  5KFZ A;  2UVW A;  4LFA F;  3QYY A;  4DUZ J;  3TJ9 A;  3IS9 A;  3RZA A;  4AE5 A;  2YNH B;  4KKO B;  5D78 A;  2B4U A;  3IGV A;  5F0W A;  1RWP B;  4OHZ A;  2MQP A;  3KHL A;  1UKU A;  2E9T A;  2AT1 B;  2J5A A;  1KKH A;  3CJ2 A;  5JVH Q;  2E5I A;  3A3P B;  2FHO B;  2HHS A;  4B9M A;  4QW9 A;  1VRT B;  4DX6 A;  2UV8 G;  1FKA F;  3KJQ B;  1B4S A;  1XJW B;  2ZVS A;  2BAN B;  3MCS A;  3M9N B;  2UV8 A;  1K8A T;  2UXB J;  2XGP A;  2IBO A;  3O44 A;  3TNV A;  3K58 A;  2KTQ A;  1YVF A;  3MPU B;  3OL8 A;  2IFX A;  1PC4 A;  2CYY A;  2W9B B;  4ECY A;  2IPO B;  3TWZ A;  3G8S A;  3OXL A;  3GG1 A;  3B8H A;  1VRQ C;  4ATN A;  4C8Y A;  3FRY A;  2VFU A;  2VH7 A;  3E01 A;  4F3O A;  4LSZ B;  2HW3 A;  4O3R A;  2DNM A;  1J5O B;  1TVR A;  3BGR A;  5KFW A;  2BDP A;  2CPI A;  4C8M A;  2IJN A;  4HYK A;  2UXD F;  3GYX B;  3CIM A;  1HAR A;  2H5E A;  4DZD A;  2VFT A;  2YKN A;  2C2D A;  3J81 U;  1QE1 B;  2LDY A;  1M5K C;  2UXC F;  3DM2 A;  3FKB A;  2NXU A;  2LQJ A;  1HW8 A;  2JX2 A;  1R0C B;  2QLB B;  4DHV A;  5HBM A;  2B9Y A;  4CYU A;  1FXD A;  9RUB A;  2PA8 D;  1FFW B;  1YIT S;  1VI7 A;  5CCL A;  2F3J A;  3VAK A;  4R0J A;  4PWD A;  4AYB D;  2VQE F;  2OML A;  1QM9 A;  4YR0 A;  2GHW A;  2WVC A;  4UQT A;  1UJ6 A;  1S6P A;  5C7P A;  3M8S A;  2PGC A;  4TQS A;  4F4A A;  1BWV A;  1W2I A;  4NYZ A;  4CT8 A;  2DD8 S;  5BYQ A;  2CQ0 A;  2YNI B;  2B5J A;  3OSP A;  3J7A 1;  3T5H A;  3EPG A;  3EZU A;  1KQK A;  1R0A A;  3QO9 B;  2F4V J;  3G6E S;  2IDE A;  3D6T B;  4IDK B;  4K2X A;  3PRV A;  3TYT A;  3KHH A;  5IQQ A;  4MMO A;  5L9X A;  3V2U C;  2W4D A;  4KB7 A;  2AEM A;  1OPI A;  3ILO A;  3L7U A;  5LMN J;  2YWK A;  1H7W A;  4FZV A;  3R2D J;  1IKW B;  1RAA B;  2BAB A;  2DY9 A;  2UUA J;  4DWI A;  4DQR A;  4IOB A;  4WP9 A;  1JLF A;  1FJE B;  4U6P A;  1FK9 A;  4J9M A;  3K89 A;  3W62 A;  1KLM A;  1VQS A;  3G71 S;  3CW2 C;  4YB1 P;  2K2P A;  2ZJP Q;  4EYI B;  1KFD A;  1BUX A;  2WB4 A;  1YHQ S;  4IYQ A;  2PD1 A;  4ZVQ B;  1B99 A;  2LP4 A;  5M2P A;  1FRJ A;  1WHX A;  2P9E A;  2F9J A;  4J7C A;  3W5Y A;  2CRL A;  3ET6 A;  4HAC A;  1RT1 B;  4ELV A;  4KYZ A;  4MYT A;  5GMD A;  2OLW A;  1HD0 A;  1NB2 A;  2AYG A;  4NXM F;  3ZTS A;  2P9C A;  3HJV A;  1N5S A;  1SC1 B;  1RLC L;  5B08 A;  1UVJ A;  2DPI A;  1XIQ A;  1Y9O A;  3QJJ A;  4IH7 A;  3U7J A;  3OVA A;  3GLJ A;  2RU9 A;  1KQF B;  5DG8 A;  4BC9 A;  3PR5 B;  1RHJ B;  5I3Q A;  3MZI A;  1R27 B;  4QIE A;  2LA4 A;  3M8Z A;  3UE2 A;  1EET A;  3DGP B;  1S0M A;  1FD2 A;  3FFI B;  4ED0 A;  4DL4 A;  1ZH5 A;  3MCM A;  2DNG A;  1MN7 A;  1UMJ A;  4KV8 B;  4QPT A;  2W4C A;  1Z4U A;  2HQF A;  3PX0 A;  1RQ0 A;  5J2P B;  3CIZ A;  2KI2 A;  1S59 A;  2LXU A;  3CDA A;  3H2L A;  4Y65 A;  4ELT A;  4ZVT B;  1J2V A;  3G2X A;  1RT1 A;  3QID A;  2I38 A;  3MM8 A;  1RTZ A;  3JXO A;  3VZH A;  4DV5 J;  1CJK B;  1FEH A;  5LT5 A;  2RUS A;  3H5S A;  3T6J A;  1GMV A;  2GQQ A;  4I56 A;  4DXL A;  3O2I A;  4O44 B;  4RUA A;  4WZQ A;  4EU0 A;  2IRY A;  1VQK S;  4LRB A;  3AQP A;  2MZR A;  1N6Q A;  5C2C A;  2VUG A;  1DAX A;  4DV7 J;  4J91 A;  4NI2 A;  4OJ1 A;  3HD1 A;  4RKU C;  1FER A;  3PR4 A;  3CJT A;  1XTZ A;  4OYA A;  4WKY A;  3OTC A;  1GMW D;  1NSQ A;  2DKO B;  3TAP A;  4DSK A;  2CPY A;  2ZBP A;  4F4K A;  2V8G A;  1MU2 B;  2DNN A;  1RWM B;  2RQ4 A;  2CKW A;  1EB0 A;  1SH3 A;  2KYZ A;  4ZVR B;  4IUF A;  4LF5 J;  2BUN A;  2Z0G A;  3C6T B;  3Q8Y A;  5IV4 A;  3PW0 A;  4V1A k;  5K8O A;  4DU8 A;  3W8P A;  2IY5 B;  2DEI A;  5B0C A;  3H5U A;  3GJQ B;  4KRW A;  4DR3 J;  1S6P B;  3OLB A;  1QAX A;  3D9B A;  3I82 A;  4CRJ A;  4BC7 A;  3ZZZ A;  3OHB A;  2XY7 A;  1M5V C;  2F4V F;  4PWD B;  1CJU B;  2XB2 D;  2E1P A;  4FF2 A;  3FMW A;  3BGF A;  4LRF A;  3FMB A;  3VCD A;  2R42 A;  3DM2 B;  4U96 A;  4B17 A;  4ILM A;  4NZ7 A;  2RHQ B;  2YH1 A;  1PCA A;  3QAE A;  1TVR B;  4UUW A;  3HZE A;  4P73 A;  3TQE A;  4DV7 F;  3BKF A;  1YRU A;  1KSP A;  2QL7 B;  1FRK A;  4OL8 A;  4B9U A;  1HKA A;  4KH1 B;  1J5O A;  2BM1 A;  3A3O B;  3I96 A;  8RUC A;  4E98 A;  1N5Y B;  4R0E A;  1LK7 A;  4ED5 A;  5HQ8 A;  3SFG A;  1WC1 A;  3DLG B;  3F56 A;  4EWT A;  4JBC A;  4CO5 A;  2R7X A;  5CH7 B;  1VLY A;  2B8P A;  2XSF A;  2XZD B;  3AD8 C;  3EXY A;  3OTD A;  3PYE A;  3BSA A;  4F0M A;  4CIO A;  4DL0 C;  3CCQ S;  1GMW A;  3TJA A;  2O67 A;  4ECW A;  2UVV A;  4MH8 A;  1YG0 A;  1F5B A;  2A6M A;  1J5E J;  1BQM B;  5KOX A;  3KLE B;  3AXM A;  3Q8R B;  2OI2 A;  1S1T B;  1IM6 A;  1YLX A;  4FDF A;  4B08 A;  4OI1 A;  1DZ5 A;  1HMV A;  3H2V E;  2AJ4 A;  4K4W A;  1MRO B;  1CJT B;  5IC6 B;  3QGI A;  2P5V A;  5K20 B;  1D8Y A;  4R5P A;  1P8G A;  1S4E A;  3QMQ A;  2IC3 B;  4Q7A A;  1HPZ A;  1SC3 B;  3IR5 B;  3A8E A;  3PJ9 A;  3GU0 A;  5KG7 A;  4X66 F;  3CC7 S;  4DZ6 A;  1VK8 A;  2K8G A;  3DU5 A;  2A6O A;  2C2K B;  3TAM B;  5C2G A;  3VAH A;  4JI7 J;  3QJL A;  3I0R A;  4NYP A;  4C3K A;  4DPX A;  5L1I A;  2ATL A;  2UUC J;  3I4H X;  3OVB A;  2HHX A;  3I31 A;  4QU7 A;  1HBN B;  1QUV A;  5C24 B;  1LV5 A;  1YRT A;  3DLH A;  2CQ4 A;  1RAC B;  3LGH A;  4UOH A;  4WYL A;  3W9I A;  3OV7 A;  4DLG A;  4DQS A;  4IR9 A;  5K8M A;  3DLK A;  3KLH B;  3MDF A;  3RYL A;  4LF8 F;  2MPU A;  3VAJ A;  2NRE A;  3E2E A;  2V8D A;  1TKT B;  4WTO B;  1RGV A;  2ZIT A;  1RT6 A;  2PEH A;  2DIU A;  3QGG A;  5HQL A;  1KRP A;  3PFE A;  4KIA A;  2MB0 B;  1HNV B;  1VGY A;  2H9Z A;  3QIP B;  3WC2 A;  1HWK A;  2V6A A;  3TX0 A;  4NI2 B;  1RTJ A;  4GO5 X;  3IWN C;  3DRP B;  3BKT A;  1IWA A;  2KH9 A;  5F8G A;  3V4I B;  5FD1 A;  5IWA J;  3FRZ A;  4HDG A;  4DS5 A;  4KSE B;  3CJR A;  3NMA A;  2MJN A;  2OTJ S;  1TUW A;  1Q53 A;  4J9O A;  5FII A;  2KJV A;  2B6A B;  2E9Z A;  4XPE A;  2NYI A;  4DSJ A;  1YJU A;  1H74 A;  4OFZ A;  3W5Z A;  3MM8 B;  2XTJ P;  4J90 A;  4LR9 A;  4LBI A;  2BKN A;  4UOF A;  1BMQ B;  1S1W B;  2LQ5 A;  3HK2 A;  1NZ8 A;  2Q79 A;  4UT4 A;  1UVM A;  3BBF A;  4PR6 A;  4B02 A;  3QLH B;  4KGX B;  1ICE B;  1P9Q C;  4ECX A;  2KT2 A;  2NS1 B;  1ZTW A;  1YRX A;  2V4J B;  3AOD A;  2ASJ A;  4OQJ A;  2C3M A;  2GVD A;  2OPR B;  2DR5 A;  4B3O B;  3BV8 A;  3DCA A;  1LW0 A;  2AKW B;  3O1L A;  1M5H A;  2OFH X;  3BDE A;  1NSA A;  1LWX A;  1MN9 A;  1UWA A;  1IN0 A;  3HT3 A;  3LWL A;  1Y5L B;  4W92 B;  2L9N A;  4IFY A;  4CLU A;  2CJA A;  3D0H E;  4J9V A;  1H0H B;  5M2R A;  5DM6 Q;  2G2Y A;  3KK1 A;  2AU0 A;  4A46 A;  2R7V A;  1HWU A;  5D0R A;  2IYI A;  3ZTR A;  3R27 A;  5KFA A;  1NME B;  1YDL A;  2WOM B;  3R7N B;  4F67 A;  3HI9 A;  2EFN A;  4HT5 A;  2F65 A;  1I6J A;  3BEG B;  4ZCM A;  4JI3 F;  5KFO A;  3M9M B;  3SQG B;  4Y28 C;  3HVW A;  3AY0 A;  2R9L A;  2C2E A;  3C2P A;  4J9R A;  4UY8 T;  3NS7 B;  3G87 A;  1KC8 T;  1IBK F;  2WCX A;  3W2W B;  1X9W A;  1VBK A;  2HVH A;  2ZH1 A;  4ZN3 A;  2HBR B;  4NEY A;  5B0B A;  3HKZ D;  3KK3 A;  3MED B;  4MKA A;  2RRA A;  3EMT A;  4NLQ A;  2HSE B;  5K5M A;  4ZPB A;  5CA5 A;  1AZS B;  4OX7 A;  3LP0 A;  2EVZ A;  5EX3 A;  2L48 A;  4DLE A;  3RRH A;  4L6V 3;  4NLY A;  4LIR A;  2P8I A;  2V69 A;  1NRK A;  4Y2C A;  2MKK A;  4EFA C;  4JI7 F;  5KFG A;  4TY8 A;  1N33 J;  4B3T J;  3CJQ A;  5CQG A;  3U27 A;  5EN1 A;  2HHP A;  1RAO A;  2QN6 B;  2KFY A;  4LMZ A;  2E5H A;  1V3Z A;  5A8K A;  4LR7 A;  3H8Y A;  3KKF A;  3MPY A;  2E1C A;  4Q43 A;  2BAC A;  2L9W A;  4PUO A;  1VQ7 S;  4RBV A;  1DTT A;  1HBO A;  3MAA A;  2FGC A;  2DGT A;  1N0V C;  4IO9 Q;  2Y8Y A;  1SIZ A;  3MEC B;  2J9C A;  4ITS A;  2IJR A;  3QT8 A;  3KLF A;  1R43 A;  4ZVU B;  5BYR A;  1HFE L;  3SIP B;  3S8S A;  1EX8 A;  5JMN A;  4Q2M A;  2VJU A;  1CG2 A;  3PFO A;  2VQF F;  4LIW A;  1RKI A;  1VQ8 S;  1BQM A;  1LNQ A;  2J6S A;  3ICL A;  3ILL A;  4RNO A;  1DRZ A;  2PFF B;  1UVK A;  1WC4 A;  2G2O A;  2VPW B;  3HLU A;  3HSJ A;  3JQJ A;  4KTQ A;  1Q81 T;  1S79 A;  1LXN A;  5H9F J;  5MLC V;  3H90 A;  4H4O B;  2YBV A;  2BE2 A;  4CO2 A;  1YZ6 A;  2QGF B;  1F60 B;  1XER A;  2AJ1 A;  4L3K A;  1REG X;  2FJD B;  4ZP6 A;  1QY7 A;  4LF7 F;  2FHJ D;  4CNZ A;  2VAS A;  4WXW A;  4U95 A;  1AYE A;  5F8I A;  4X64 J;  2BAN A;  3RW6 A;  2W9B A;  2FVQ A;  4ICL B;  2HIQ A;  1FJ7 A;  5LOQ A;  4A8M P;  2JC0 A;  2ZOM A;  2ZHA A;  4C98 A;  4F4X A;  2DJW A;  5GVQ A;  4DR4 J;  4K4Z A;  4QCL A;  1WC0 A;  3GG0 A;  5J2M B;  1NND A;  2AJQ A;  4USI A;  4PKD B;  4Q45 A;  3QNW B;  4ED2 A;  1Y7P A;  2ILY A;  3TX8 A;  5G4D A;  5F8M A;  4CI0 B;  3MEE A;  4YR3 A;  3GIJ A;  1ZET A;  1RSC A;  1YJN S;  3VGS A;  4ETZ A;  1HLW A;  5BR8 F;  4NML A;  4WU2 A;  4BWM A;  1KS2 A;  4GVB A;  2B7B B;  2LXF A;  4FVM A;  1HNW F;  2QLW A;  2E5L J;  1FJG J;  3R5B A;  3C15 B;  3JTN A;  4USV A;  1C4A A;  2FJA B;  2IHR 1;  4G1P A;  4UQG A;  4DR5 J;  5A6W A;  1JX4 A;  3BS9 A;  2MST A;  1PJ5 A;  2V2Q A;  1CUL B;  1XNR J;  2EFO A;  4A8S A;  1T7P A;  3HHL B;  4RW9 A;  2DCU B;  3H2U B;  4JI3 J;  2GVZ A;  4X64 F;  2ZM6 J;  4YB5 A;  4MIB A;  4C6A A;  1S1V B;  2OSQ A;  5I3P A;  4DL5 A;  2DRA A;  1TV6 B;  2K3K A;  1R8H A;  2KHD A;  4ID8 A;  4CLL A;  2CJY B;  3RJM B;  3MPD A;  4WFX A;  5KG1 A;  2FGO A;  2WBM A;  4WCE Q;  4OI6 A;  3P49 B;  2CG8 A;  4USM A;  2P9G A;  1TKZ B;  3GFZ A;  5KFE A;  1LWC B;  3RBE A;  2CZ4 A;  3NGR A;  4I0W A;  4DPW A;  2XMM A;  3IG1 A;  2DNP A;  4QWE A;  4ECT A;  1T03 B;  3J7A N;  3IR6 B;  4DFM A;  1UP1 A;  1UWB A;  4JI6 F;  1NXI A;  1RT4 A;  3P5B P;  2YQ3 A;  3CJK A;  4DPO A;  3QSY B;  3T1A A;  3DYA B;  4PG5 A;  2UZA A;  4LVN P;  4P2S A;  5GAD I;  5HP1 A;  1S1U A;  2D74 B;  2VC0 A;  4F8R A;  2HHW A;  5F9N A;  5GAH I;  4CO4 A;  4IFY B;  1JLG A;  1LXJ A;  3NGT A;  2UVU A;  2O66 A;  2W4P A;  1JNZ B;  4UTG A;  4QBU A;  1U1M A;  2ZZM A;  1GXL A;  3J7Y I;  3SQO P;  1G3O A;  4HR2 A;  2XMK A;  2VG7 B;  2Q1L A;  3PHE A;  4ECZ A;  1UWB B;  3AFG A;  2QT7 A;  3DC2 A;  5E3C A;  5J2Q B;  3RRG A;  1H2T Z;  2VFS A;  3NGK A;  1VRU A;  1T11 A;  2RF2 A;  3D0I E;  2Z8Q A;  4NX9 A;  2RQC A;  1WHV A;  3KDO A;  5CXT A;  1UPM B;  4JI4 F;  2MY8 A;  1S0O A;  2QLJ B;  3DFE A;  2CNK B;  2PN6 A;  4DSF A;  2Q66 A;  1RAI B;  4LF6 F;  4NAS A;  4DDF A;  5C5J A;  4USU A;  3WX4 A;  4B9V A;  2VL1 A;  4QJV A;  4ED8 A;  5D3G B;  4O0I A;  1QAJ A;  1GT8 A;  5JVG Q;  3NOC A;  4LT6 A;  2M8D B;  4R25 A;  3U1L A;  3K5L A;  1XNQ F;  3AOA A;  3MM5 B;  1AT1 B;  1HNZ J;  4V19 X;  4LJM A;  3JYT A;  3UDC A;  4YOE A;  1KHV A;  3QSI A;  1HI1 A;  5J2P A;  2K3I A;  3HXM A;  1HBU B;  2ACY A;  4L3N A;  5ADZ A;  3E3X A;  4L72 B;  3HSZ A;  1DY3 A;  4OI4 A;  3TA1 A;  2CWK A;  4KO0 A;  3S1T A;  2APO A;  3I0S A;  4CM2 A;  5ETS A;  1SXL A;  2M8H A;  4RO0 A;  3PYF A;  3KG1 A;  2LKZ A;  3I55 S;  5T41 A;  1QLN A;  1ZZF A;  2J0X A;  1I1G A;  2D3Z A;  3UQS A;  1U48 A;  4ZP8 A;  2BJ8 A;  2NSC A;  5EHH A;  2VU5 A;  5F9L A;  5J2M A;  3PO4 A;  4OZ0 A;  2YX1 A;  1SV5 B;  1EHW A;  1FKP A;  2JNJ A;  4B9L A;  1N36 F;  1Z2Z A;  3D1Q A;  3VF0 B;  5HO4 A;  4ZLP A;  1UCN A;  4X4R A;  2HNY B;  2PSZ A;  3L3C A;  2V4Q A;  3VQS A;  3AA9 A;  4Y2A A;  1N54 B;  2E5J A;  2MLZ A;  1WSR A;  2Q6B A;  4K8R A;  2AD9 A;  2O1P A;  4LF9 J;  2LVW A;  2JZ5 A;  4DG1 A;  2HAI A;  4RW7 A;  5LXY A;  5A2Q U;  5KT2 A;  3T9N A;  1ZAW A;  3EGV A;  5K14 A;  4CT9 A;  1U1R A;  1MU2 A;  1GX6 A;  1HBM B;  2VDH A;  4IG3 A;  3ZTP A;  2BVZ A;  1F3V A;  2GHV C;  4C97 A;  3D2W A;  1KNZ A;  1DUR A;  1MWZ A;  3DRS B;  3QGH A;  5KT6 A;  2JH3 A;  3OTE A;  5E3R A;  1F9F A;  1RT6 B;  3A4T A;  1IWG A;  2DNL A;  2Y0S D;  3THV A;  2QMU B;  4PXC A;  2C3Y A;  2ZUA A;  4PG7 A;  4ES2 A;  2FLO A;  3IM8 A;  3E01 B;  4QWA A;  2LDI A;  2IM1 A;  2V8P A;  3SDE A;  2L9D A;  4ZVG A;  1IJE B;  2CDQ A;  4RNM A;  1LWF A;  1KTV A;  2L3M A;  3D6M B;  4YDD B;  1Q7Y T;  1AB8 A;  1HHQ A;  3I5A A;  4I4B A;  3TA2 A;  2LEC A;  1B0V A;  2MEW A;  5F3Z A;  4DCP B;  3I0R B;  2HWT A;  4I2P A;  4A8W A;  2HHQ A;  1FD8 A;  1MLA A;  2BKP A;  3ILJ A;  4LRA A;  3KLG A;  4KJI A;  2XO6 A;  3CGI A;  2QMW A;  3Q22 A;  1NJZ A;  2P2C B;  4ZPW R;  1JQG A;  4NPO A;  5J2Q A;  2NXC A;  3UDV A;  1JLQ A;  5DQG A;  5HK4 A;  2PDA A;  1TUV A;  4KAI A;  3MMA B;  4XDC A;  2E29 A;  4LSL A;  2J9E A;  4RJV A;  2F7V A;  2OP5 A;  1B0P A;  2N3L A;  2DHH A;  5AE3 A;  3GQC A;  3DDI A;  2GHP A;  3MUR P;  3HD2 A;  2HKE A;  3N6L A;  3AD9 C;  1VJW A;  3G8Q A;  1SC6 A;  1Q8B A;  4WE1 A;  3GSD A;  3KMQ A;  3KK1 B;  1Y3K A;  4O4R A;  4ZN1 A;  2BW2 A;  5D3G A;  1BE4 A;  2HHU A;  1NPP A;  4NEZ A;  3D5M A;  2MZJ A;  2OEL A;  3OR2 B;  5HAT A;  1NK6 A;  2GX8 A;  1YIJ S;  2EK1 A;  4DFP A;  3N5F A;  1N56 A;  2UUA F;  4EZ6 A;  1S6Q B;  1MNE A;  2B4V A;  1DHM A;  2HND B;  4DN9 A;  4PPD A;  4B3M F;  4WK1 A;  3P3D A;  3W3S A;  1ROF A;  5KAK A;  3MM9 B;  4Z2X A;  4DSL A;  1DTQ A;  1C1C A;  2HFV A;  5GAG I;  2HVZ A;  2DT9 A;  3DRX A;  2VG7 A;  2DH7 A;  4NLS A;  1RKJ A;  5A8K B;  4RL1 A;  5FLX U;  2D3O R;  1M5O C;  2LYV A;  2OAU A;  1F2H A;  1LK5 A;  5KFJ A;  4TVA B;  3W66 A;  3GFY A;  2C2Z B;  3KJV A;  3D4J A;  1VBZ A;  2JEF A;  2H5I B;  2ZEJ A;  2CJ9 A;  3E51 A;  3MWB A;  4PYA A;  1KD1 T;  1ZTT A;  1TP7 A;  1KQG B;  4DU7 A;  3GV5 B;  3PYD A;  3SSR A;  4DPY A;  3NNA A;  2FTR A;  4R8U B;  1FNX H;  2Q43 A;  4J5O A;  3QQC D;  1YQH A;  1DBD A;  2CPD A;  2J8A A;  2XYP B;  2V4R A;  2MKS A;  4UST A;  2MZ1 A;  6FD1 A;  4K4Y A;  3NP5 A;  3THP A;  1SC4 B;  1TL5 A;  3PHT A;  3SQG A;  4WWS A;  2XCP A;  2W2O P;  4P9S A;  1YK9 A;  4DR7 J;  4ZLJ A;  1UEV A;  2VG5 B;  2R2U A;  3DHX A;  3M1V B;  2NYH A;  4YB7 A;  3GP9 A;  5LJ3 Y;  1NK0 A;  1NDC A;  2IMO A;  5JUM A;  2WVB A;  4OI2 A;  4JI2 F;  2DIS A;  5AXM A;  3KLH A;  1JWW A;  2KU7 A;  2HZC A;  4L76 A;  3TZZ A;  1RWW B;  1UPP A;  4LFC F;  1NO8 A;  3OFE A;  3T1Y J;  4EZ9 A;  4I6Y A;  4XO0 A;  3EPI A;  4UY8 5;  3ZO7 A;  1SPB P;  2MHE A;  1F0X A;  1QAY A;  2E66 A;  3V6J A;  2XSJ A;  1SJR A;  1KEK A;  2PO4 A;  4RNH A;  3TJ8 A;  3TI0 A;  3FUY A;  1CJT A;  1CC8 A;  3VAG A;  1VC0 A;  3MFI A;  4CO3 A;  1T9U A;  2XG8 A;  1N8R T;  2B3T B;  4RX6 A;  1CBK A;  2B5J B;  2JSX A;  1QTM A;  3FK4 A;  1ITP A;  1UA0 A;  1RWK B;  2HMI B;  1DTT B;  3HKW A;  4X4U A;  4F4Y A;  2GAG C;  2C42 A;  1S4F A;  3BYP A;  2EC2 A;  3WDO A;  1JLA B;  2ZKU A;  4LSN B;  3PNI A;  4GO7 X;  1S99 A;  3MMC A;  2AWZ A;  5FDL A;  3TP2 A;  3TZX A;  2GIF A;  3T6B A;  4QR2 A;  4DR3 F;  4M1K A;  5KFL A;  4X65 J;  1NH8 A;  3I87 A;  4OHY A;  4DV4 J;  3CC2 S;  4DFK A;  2G0J A;  3R1L A;  4ZLN A;  4RNN A;  1RA7 A;  3LP0 B;  4H4O A;  1NUE A;  2ZZT A;  1TAU A;  1GTH A;  5E3Q A;  2O5D A;  1M1G A;  3LAL A;  2IDL A;  2R7T A;  1IKW A;  3HMJ G;  1K1S A;  2W2Q P;  6FDR A;  4LQ3 A;  4FYY B;  1JIH A;  1TL3 A;  3FQL A;  3I9V 9;  2MGZ B;  3H4D A;  1IKV B;  1D3W A;  1FRH A;  4M5N A;  1MW7 A;  3DNC A;  3ZZP A;  1RI7 A;  1X9M A;  3Q2T C;  2W9A A;  4HTJ A;  1LOU A;  4MTP A;  3G9C A;  2DBB A;  2UP1 A;  1CJU A;  3K57 A;  3T1H F;  4ER8 A;  5EX0 A;  1VQ9 S;  3MEC A;  2E7V A;  1Q4R A;  1VLO A;  3LOU A;  1U2F A;  2NSB A;  4J9L A;  2J9D A;  1YJT A;  4Y3C A;  4AL5 A;  4WYW A;  4EI2 A;  4CWB A;  2DIV A;  3C16 B;  4ZVF A;  3L09 A;  1RU1 A;  1U0H A;  1SJF A;  3A13 A;  2K7K A;  3V6D B;  2N7C A;  4PWU A;  1CEZ A;  3OVS A;  4DV4 F;  1EQ0 A;  3ISZ A;  3NBP A;  1VC5 A;  1MG7 A;  1RTI B;  4M5K A;  4LF8 J;  2VF3 A;  2Y3Y A;  3BGL A;  3SDE B;  3KDN A;  4NLX A;  3IFE A;  3RGI A;  3UR3 C;  1U1N A;  4JI5 F;  4ZVO B;  1FKO B;  1R8A A;  2HFZ A;  3ITH B;  1YTY A;  2ALZ A;  2MXY A;  3D7S B;  5FJ4 A;  2GVD B;  1HNX J;  2ZH2 A;  1FVQ A;  4B3O A;  3NCP A;  1RTH B;  2KVI A;  2VPX B;  3DI6 A;  3NCR A;  3PDN A;  2AGQ A;  2VA3 A;  4Z37 A;  2ZH3 A;  4C8O A;  1C4C A;  3EGZ A;  1S5Z A;  4ED6 A;  1U24 A;  1IBL F;  2UVR A;  1LW2 B;  4BWJ A;  5CD4 H;  3MM5 A;  2GJF A;  3UCG A;  4ES3 A;  4EGL A;  4HTI A;  1CQN A;  3UCU P;  3MI7 X;  4ILL A;  1QJH A;  1URR A;  1ULR A;  2M88 A;  2HPU A;  4HH1 A;  4MFB B;  2R7R A;  3T1Y F;  3PG9 A;  1RLD A;  2WON B;  3M7V A;  1S57 A;  4KBI A;  3CC4 S;  3TVY A;  3HHL D;  5A76 A;  4DUZ F;  1LWE B;  2B9X A;  3DRR B;  4ZCK A;  2DEJ A;  4PXB A;  3DLJ A;  1H73 A;  1T9T A;  2VPY B;  1WD6 A;  2AX1 A;  3RG6 A;  3ZTQ A;  4IRK A;  3PKM A;  4XTT A;  4R8U A;  2NUH A;  3CD5 A;  5KFP A;  5K9F A;  4F4W A;  5J1P A;  2CZ9 A;  2JJ4 D;  3I0S B;  3P6Y C;  3IWX A;  4MJK A;  3DOK A;  4OZ1 A;  4K59 A;  1XMQ J;  1U0S A;  3QLH A;  2G1D A;  2DGO A;  3EVM A;  1UJ5 A;  2AX0 A;  3H59 A;  1L5U A;  1XR6 A;  4I6W A;  2AJF E;  2DH8 A;  1GX5 A;  4N8N A;  2XBP A;  5B0D A;  3FBC A;  1MMD A;  1ZA1 B;  1RT4 B;  2DCL A;  1S1U B;  3AOC A;  4P2X A;  4EYH B;  1DTQ B;  3MR7 A;  4QPX A;  3DDN A;  3L95 X;  3O3L A;  2UUB F;  1Q79 A;  3GCX P;  1WOR A;  2VG6 A;  1NK8 A;  2XEX A;  2HAF A;  1N6Q B;  4ZKA A;  2VPZ B;  2RSQ A;  4OI0 A;  3W9J A;  3ELH A;  4F0H A;  1R8C A;  4KQZ A;  5HSP A;  5JJB A;  4LVO P;  1UL3 A;  1TL4 A;  3GMG A;  5H9E K;  3CMQ A;  1F9E B;  4IDK A;  4P72 A;  2KRR A;  4WJB A;  3OFG A;  4YHH F;  4N5S A;  3OTO F;  3HHL A;  4RW9 B;  2YH0 A;  1O6X A;  4ANE A;  2OD4 A;  4ED1 A;  3CCT A;  2X3G A;  1S72 S;  4UOG A;  1E6Y A;  2F40 A;  2YXL A;  2V2Z A;  3M6U A;  3HFK A;  3DGV A;  3TAQ A;  4X4O A;  5IOL A;  2GQ2 A;  2YNF B;  3I5B A;  3K8W A;  4OZ2 A;  3U1N A;  3AA8 A;  4C0B A;  4FKX A;  4HDH A;  2ZBQ A;  2V94 A;  4H4M A;  1FFG B;  4NL5 A;  1AW0 A;  4I68 A;  2ASL A;  2Y1L B;  5I42 A;  1WKK A;  1R7I A;  1U8W A;  4OHX A;  5I3U B;  5ITH A;  1L3U A;  1K0T A;  4EEY A;  4RNF A;  4ZLL A;  3K5P A;  4WXO A;  3OQ2 A;  4XAK A;  1VR6 A;  5IM0 B;  2V0N A;  3CO0 P;  4ZHR B;  1DLO B;  1I5O B;  2CPE A;  4P71 A;  3MAH A;  4M5M A;  3BO4 A;  2EFV A;  1YSJ A;  1KLN A;  1F5A A;  2QMX A;  1Q8I A;  1RZM A;  2KL8 A;  3OTO J;  3PYG A;  3MEK A;  2ZWO A;  1R6Y A;  3W7B A;  4DI6 A;  3FSI A;  2WSC C;  2C2M B;  3KUE A;  1UVL A;  2EBG A;  2G0C A;  1K73 T;  4MIW A;  1WEX A;  3UDE A;  4JV2 A;  1V5I B;  3GJR B;  3KMS A;  2R3V A;  1G6B A;  1NSP A;  3MUM P;  4KE5 A;  4JI0 J;  6AT1 B;  5KFF A;  1JLB A;  3R5J B;  2EXU A;  2D3O 1;  1RAB B;  4PG4 A;  4F36 A;  5DDP C;  1HQE B;  1CJV A;  3W61 A;  1RYS A;  2HHT A;  1IR0 A;  3UWT A;  4PQU A;  5AXK A;  4URS A;  2YPY A;  1IKX B;  4DBQ A;  2C3O A;  1X5T A;  1WOS A;  3JSM B;  3D66 A;  2HNZ B;  2HGL A;  1HBM A;  1VQY A;  5HAO A;  2VOD A;  1T9X A;  4A4J A;  4JP8 A;  5BJR A;  2MKY A;  1WSV A;  4DG1 B;  1CJK A;  1V9O A;  1G2E A;  2QZ8 A;  1ZPV A;  1S9F A;  2IVM A;  4A8O A;  3Q0A A;  1B64 A;  4CO1 A;  2HVE A;  3FEX B;  4LF2 A;  1N88 A;  2VIH A;  5A8R A;  2MZQ A;  3WC0 A;  2DGX A;  4USJ C;  5HL7 Q;  4I69 A;  2V2K A;  1HHT P;  4WZM A;  1E6V B;  2EG2 A;  3LP2 A;  1NHU A;  4C3L A;  4DV5 F;  1PO6 A;  1SV5 A;  3CJ5 A;  3VAL A;  4FNH A;  1WF1 A;  1O8B A;  4EBC A;  1LWF B;  2UUB J;  2GML A;  3NOG A;  2ZDP A;  2RUG A;  1FDD A;  1HNI A;  2X7I A;  2ZFH A;  4O23 A;  4DV6 F;  2H4W B;  3OFH A;  4WP3 A;  4DUY F;  3PW2 A;  3R2C J;  2P6S A;  5E2Q A;  4CH1 A;  3Q86 A;  3K7R A;  1TFW A;  3PZP A;  3M30 B;  2R7U A;  4DQI A;  2IRU A;  2CQB A;  2QSW A;  4IH6 A;  4YY3 F;  2XYG B;  4LF1 A;  1OSD A;  4IG3 B;  1MSW D;  4YHH J;  1WI6 A;  1WG1 A;  2W1B A;  5F3T A;  2HGN A;  4EO6 A;  4DQP A;  5KFN A;  3ENQ A;  3S6E A;  4ECV A;  2UXB F;  3D67 A;  5HRO A;  2HHH J;  4FYW B;  1RT5 A;  3WQP A;  2RKI A;  1U6B A;  1RT2 A;  2FHM A;  2JVO A;  3BZQ A;  1GTE A;  3M2U B;  2KRB A;  3I9Z A;  2BOA A;  2XUL A;  3C14 A;  1Y0H A;  4OYZ A;  3SCL E;  4BHQ A;  4ZMM A;  5E41 A;  5KT7 A;  1S6U A;  1UW4 A;  3PW5 A;  2QA4 G;  2Y8W A;  2RD5 C;  4DSE A;  4C8K A;  1Y5N B;  5L1J A;  3TQ1 A;  5KT3 A;  4DUY J;  3UPF A;  1U45 A;  2XMW A;  4MT1 A;  1CPZ A;  2RJZ A;  3BN7 A;  3W63 A;  4EMD A;  2KT3 A;  2GAH C;  2YVS A;  3X3U A;  5I42 B;  3OJU A;  3AJD A;  4PG8 A;  1RCO B;  5KFV A;  1LEO A;  1IKX A;  4YS2 A;  3M2V B;  4ZIW A;  4QYR A;  4D3H A;  2GV1 A;  4FF4 A;  2WRM A;  4HL9 A;  2IYG A;  2LQB A;  2K1R A;  1N52 B;  2DPJ A;  3CF5 Q;  4FBT A;  2DYA A;  3BRE A;  4N77 A;  3CXC R;  2GJI A;  1EJ7 L;  5DZ7 A;  1UFW A;  3UD4 P;  2ZUG A;  1XBW A;  3QWU A;  1HA1 A;  5GME A;  2ADB A;  2RE1 A;  1F1B B;  2I0X A;  2CPH A;  2G9O A;  1EKR A;  1VMB A;  1FDN A;  3FNN A;  4MKV A;  3CJK B;  4N56 A;  2FVS A;  2HG4 A;  2E5G A;  1YKW A;  3K8V A;  5ETO A;  3K5M A;  3IMQ J;  4FF3 A;  4O4G B;  2NCK L;  2FC9 A;  3N6N A;  5E0O A;  2CJQ A;  3WIU A;  3UR0 A;  3FEZ A;  3HZG A;  4AXI A;  3CJ0 A;  4P74 A;  1ZYQ A;  1F2G A;  3OUY B;  4I7F B;  4JI4 J;  1JXV A;  2LA6 A;  3F44 A;  3HPO A;  2D41 A;  3ZZ0 A;  1C1B A;  2VDI A;  1YZ7 A;  2PC6 A;  3EZO A;  2CUY A;  2LU2 A;  3KLI A;  3MUT P;  1R3N A;  5L1K A;  4DR1 J;  4Y6I A;  3IRW P;  1O51 A;  3MHY A;  4C11 B;  3IAS 9;  2F8E X;  1MWQ A;  3R8Y A;  5AE1 A;  1CUL A;  2PFD A;  2XS7 A;  2YWW A;  3L7P A;  1BY9 A;  1B0T A;  3N9U C;  1UFL A;  2M0G B;  2OO4 A;  2X3D A;  2JHE A;  1WOO A;  3OXG A;  4OZJ A;  3W2V B;  3MR5 A;  3T5K A;  3RR7 A;  4JI1 J;  1SCJ B;  4LF9 F;  1FNO A;  2HQC A;  4OYM A;  2AMC B;  3DOL B;  1C0U A;  4RR5 A;  4UW2 A;  5K8N A;  3EYZ A;  2QX0 A;  5DLF A;  5HLF B;  3HHE A;  1XC9 A;  1KQS R;  2FJE B;  1X0P A;  5CYM A;  2R2S A;  3TR5 A;  3ZZO A;  4KC5 A;  2D9O A;  4ED7 A;  5HBM B;  3PVX A;  4F3Q A;  1S1X B;  2YNH A;  3Q8U A;  2BJD A;  1LFW A;  2RNE A;  1M1H A;  2G0I A;  3IXQ A;  3MPW A;  3OD2 A;  3TEG A;  1YJV A;  3GON A;  3M6X A;  1TK8 A;  3BGO P;  2XMJ A;  5ETL A;  3CDE A;  3BGU A;  1U1O A;  1L3K A;  4PAA A;  4RBU A;  4MK8 A;  1TV6 A;  2RKI B;  2DHA A;  5IS2 A;  2GNK A;  3SFU A;  2VBY A;  2HYI B;  2QEX S;  1SUQ B;  1L3V A;  1FA0 A;  3N01 A;  4IQX A;  2BJ7 A;  2M5Y A;  2DHX A;  3H40 A;  2ZE2 B;  3HHL C;  1HYS A;  2MJU A;  4Q0B B;  1WG4 A;  2RDD A;  1Q5Y A;  4O3O A;  2R7W A;  4Q8E A;  5GAE I;  2QA2 A;  3NWR A;  2HLU A;  2I1R A;  1NDP A;  2RB7 A;  2XI3 A;  4KFB B;  3EVO A;  2W8L A;  1X7V A;  1U49 A;  4RW8 B;  1M5P C;  1OPZ A;  2MQO A;  2MLY A;  4HVZ A;  4M94 A;  1OS5 A;  3KG0 A;  3OLA A;  2G2Z A;  1TU0 B;  1HPZ B;  3IA0 A;  3T9Z A;  4YN3 B;  3O6Q A;  2WW4 A;  1SJ3 P;  1UET A;  3ENV A;  4RU2 A;  3GV7 B;  1HNI B;  3MAQ A;  1HMV B;  5HVF A;  4GKK J;  4KKO A;  1U1L A;  2GMH A;  3KLG B;  2JLF A;  1VBX A;  1HBO B;  4Y2K A;  1F9H A;  1MMN A;  4CH7 A;  5LSR A;  5DGA A;  2FVP A;  4ELU A;  4KFB A;  1U47 A;  4OLO A;  1FRI A;  1KDN A;  2XLI A;  4LF5 F;  4FYV B;  3CDU A;  5C42 B;  1X31 C;  2KYX A;  5CYQ A;  4DPT A;  1X4E A;  4TN2 A;  1JLC A;  3BR9 A;  3B82 A;  1RWU A;  4RUB A;  2W9C A;  3G6X A;  1JJ2 R;  4GKJ F;  4KPY A;  2WBR A;  1RAE B;  5KFI A;  4CM0 A;  8ATC B;  5KFQ A;  1VQ5 S;  4USK A;  1QVF R;  2B9E A;  1JLE A;  2JFK A;  1LW2 A;  3I56 S;  3HHN B;  4NRU A;  4Y2M A;  3QWP A;  4FS1 A;  3NNC A;  2LEB A;  1S0V A;  5KFU A;  4DOZ A;  2BQ3 A;  1C1B B;  3W1Y C;  4B9N A;  3ULH A;  1UVI A;  2FVC A;  4ALZ A;  1N34 J;  3LTO A;  3AJ1 A;  1I51 B;  2BX6 A;  2DTJ A;  3DRY A;  4KGZ B;  5K14 B;  1S1X A;  3SYZ A;  2AP6 A;  1WOP A;  3A3N B;  4FVC A;  4LF4 F;  2KO1 A;  2NPI A;  2VFR A;  1FKO A;  2QA1 A;  4FNI A;  3KLF B;  2ZJQ Q;  3OXF A;  3L9Z A;  5DZ6 A;  1S97 A;  3LAK A;  2WOM A;  4P2F A;  4PZV A;  5CZX A;  4J9U E;  5EGY A;  1VQN S;  2KKH A;  2YKM B;  4RUH A;  2LMI A;  4F7V A;  7FD1 A;  2VOP A;  1SL2 A;  1BGX T;  4WKR A;  1RT3 B;  3RB3 A;  2NXN A;  2YQ1 A;  5ETP A;  4OJ3 A;  5KFB A;  1K0V A;  4EBD A;  2M7S A;  2KB2 A;  4ZVH A;  4JV5 F;  2OMO A;  1G7C B;  3DXS X;  4E8U A;  2F8M A;  2QC3 A;  1H2U X;  3HDS A;  4KV8 A;  4UZC A;  1RTD A;  1CVJ A;  3M2R A;  3OR1 B;  2MQ8 A;  1SIW B;  2BBE A;  3VVT A;  5DM7 Q;  3BSC A;  2GW8 A;  1N5Q A;  3DGP A;  3EE3 A;  4QIW D;  4LRC A;  3BF4 A;  1D9A A;  1VS3 A;  2CDR B;  4RW4 B;  2RAQ A;  2X1B A;  3W8G A;  3ZZR A;  5A0Y A;  4CLT A;  3DRR A;  3IP0 A;  2ADC A;  1TK0 A;  2H65 B;  2ATC B;  2ILZ A;  3B54 A;  3PW7 A;  5J1E A;  1AA1 B;  4DV1 J;  5A2Q Y;  2EFP A;  2W8K A;  1VQM S;  3OJS A;  2HQG A;  2NR0 A;  2YKA A;  4Y2I A;  1PBA A;  2GIR A;  4A8Y A;  1Y10 A;  3RB4 A;  3BPS P;  4JI2 J;  3C46 A;  1CC7 A;  1PIL A;  4KY3 A;  3DYA A;  4L75 A;  2X1A A;  4F2R A;  4NXM J;  4AD6 A;  5G0R B;  4HKQ A;  3N79 A;  4Q2L A;  3EVW A;  1M5S A;  3JS9 A;  2OFG X;  1VHF A;  3MEG B;  4S0M A;  5ETK A;  3HO1 A;  1WKJ A;  4PAB A;  3WZ0 A;  4ZCL A;  4ZJO A;  3QBC A;  2X51 A;  4J9S A;  4KH0 B;  1ZAV A;  4CLP A;  4QYZ J;  4CNY A;  2OD6 A;  2HS0 A;  1RAH B;  1ZS6 A;  1RHR B;  1EP4 A;  1NU4 A;  3EWG A;  3CCE S;  3BQ0 A;  2YWE A;  2RRB A;  2GFF A;  4DR7 F;  3CJS A;  3CCU S;  3DOL A;  2P6T A;  1T9Y A;  5AXN A;  4C8N A;  5IXU A;  1IM4 A;  1ZOT A;  1YJR A;  1T3N A;  2PMW A;  2DXF A;  3CNQ P;  1O5J A;  3R9L A;  4NLU A;  1XNR F;  3HSD A;  4TYA A;  1JJ4 A;  1NKE A;  2PI5 A;  3US5 A;  5LL6 d;  4OMF G;  1WF0 A;  2HWH A;  3DOK B;  1PBU A;  2V5H G;  5EWF A;  2A10 A;  3KLI B;  4K7Q A;  2CPX A;  2BJ1 A;  3MM9 A;  4MAK A;  3RAM A;  2KFZ A;  3IG1 B;  3VGT A;  2JFD A;  4BBY A;  1R6V A;  1WTF A;  3OBI A;  3CME S;  2Z30 B;  1MRO A;  2R8I A;  4M63 A;  3TVK A;  4RWX A;  4H54 A;  1OY8 A;  1S1T A;  5KG5 A;  3GWC A;  1GK8 A;  1X5O A;  1ZM9 A;  1SL0 A;  3F41 A;  2ERR A;  3VR1 A;  2L08 A;  5F8J A;  2YKP A;  3AJ2 A;  1Y3J A;  1RBL A;  3A8I A;  4IOC Q;  1NEE A;  2ROE A;  5DQH A;  3IN5 A;  3RAX A;  5EUH A;  4NLW A;  1EAR A;  4V19 J;  2CVI A;  4FXD A;  4JI1 F;  4ENO A;  2IA0 A;  1FJC A;  2YTC A;  1XK8 A;  1D9F A;  1X5S A;  3QAU A;  2AQ4 A;  2HS4 A;  3FGV A;  1X4H A;  2XCA A;  4J9P A;  2EEY A;  2OTL S;  3LQV A;  3GYG A;  4PG6 A;  3QT7 A;  3GIR A;  2YWG A;  3GIK A;  2HGM A;  1KVJ A;  2XMV A;  3R5D A;  3TA0 A;  3P4U B;  4TLQ A;  5BYS A;  1VQ4 S;  1U02 A;  2DO4 A;  5DDQ C;  4R5P B;  1ZM4 A;  1IJF B;  2AZ1 A;  2BXJ A;  3ITH A;  4QW8 A;  2ZJR Q;  1WI8 A;  3BQ1 A;  3H25 A;  2HFS A;  2L41 A;  2UU9 J;  1W25 A;  2OPS A;  1IKY B;  2F8H A;  4X4N A;  5U47 A;  2VJV A;  1TKX B;  3IS9 B;  1CJV B;  4LF6 J;  2BOP A;  3T41 A;  4CLF A;  2JVR A;  3T1H J;  2OJ3 A;  3LAM A;  4UZB A;  4ZP7 A;  2WZ1 A;  1XNQ J;  3ZNU A;  3NL0 A;  3OL7 A;  1RIS A;  3HF5 A;  4MYU A;  4A8Q A;  1XQI A;  4Y0F A;  4I64 A;  4I2Q B;  1TEL A;  1JK9 B;  1X4G A;  4EBE A;  3BB5 A;  1NJW A;  4FP9 A;  4DX8 H;  5L39 A;  1U4B A;  1AUD A;  5IT4 A;  1PSD A;  3UD3 P;  3M1V A;  1RP5 A;  1C0T A;  4LR8 A;  4M5J A;  4HHU A;  2E7X A;  3D1H A;  3IBC B;  4GMK A;  3BO3 A;  3V6H A;  2ZZN A;  3MR2 A;  5SZT A;  3MTJ A;  3HCX A;  2GGP B;  3UD5 A;  2JEJ A;  2AV5 A;  2OKQ A;  5F8H A;  4J9Q A;  4O4G A;  3A8K A;  2MQQ A;  2B56 A;  2NUU G;  1UJ4 A;  2ZH5 A;  1QSY A;  4OYI A;  2MMY A;  4OLP A;  5KOW A;  3F0N A;  2BJE A;  3W64 A;  1R8P A;  4XPC A;  1ZM2 A;  4DV0 F;  4C8Z A;  2MQM A;  1XMQ F;  2CQH A;  1CSJ A;  3KG4 A;  4GRS A;  4WK3 A;  4U8V A;  1NDK A;  3UCZ P;  4HI1 A;  2F5G A;  4NCB A;  4IKA A;  3U1M A;  4USW A;  4CLW A;  5CD4 A;  1KOH A;  5D4O A;  3RAQ A;  3RR8 A;  2CAJ A;  3CSK A;  5L9N A;  1GNK A;  2GA7 A;  1A9N B;  2V68 A;  2QA4 S;  3W60 A;  3G86 A;  1RHK B;  1XR7 A;  3M32 A;  1PJ7 A;  5IZH A;  1FXR A;  4DR2 J;  2FJB B;  2VBX A;  2DRB A;  4NLG A;  4DR4 F;  3NCQ A;  1FFS B;  3B78 A;  3CCS S;  3R5G A;  4K4U A;  5E7O B;  1YWX A;  1T9V A;  1IR2 A;  2FC8 A;  4CTA B;  1HWI A;  2V67 A;  1Q86 T;  3POT B;  3C19 A;  1VQL S;  4F3M A;  3OUY A;  1RJJ A;  4ILR A;  4UOC A;  4XDD A;  1Q8K A;  4K4T A;  1S9E B;  4WFA Q;  4M5L A;  5BR8 J;  2V2V A;  1XWL A;  3O5T B;  2FJW A;  1JKH A;  3KTQ A;  5IWA F;  5I3U A;  5CYJ A;  2MTL A;  4QIF A;  3R6G B;  2FHJ A;  4FF1 A;  4OI3 A;  1S12 A;  2XM3 A;  1X4D A;  2Z57 B;  3DN9 A;  3J7Z 5;  1S49 A;  8AT1 B;  2CJB A;  1IVZ A;  3GE9 A;  3IRX A;  3QFH A;  1H6K X;  2POK A;  1TL1 A;  1WJ9 A;  2R2T A;  3J7Z T;  3DOM A;  3P8B B;  4RPF A;  1OJ4 A;  3VTI A;  4QYZ K;  1OQ3 A;  1QD1 A;  4ZOS A;  3THT A;  2VD3 A;  1S9E A;  4RW6 A;  4JI0 F;  5J1E B;  1DQ9 A;  2JLG A;  1APS A;  2DNH A;  2YPZ A;  3JSY A;  4X62 F;  2AZ3 A;  2ZBI A;  3K59 A;  2M52 A;  2M70 A;  2KXN B;  3QT6 A;  2B51 A;  4M5I A;  4OIX A;  2E44 A;  3BYR A;  3FFI A;  2W7P A;  2UU9 F;  4CLY A;  3AHP A;  3G82 B;  4OX9 F;  5H9F K;  1CLF A;  2FZK B;  4RBT A;  4O3P A;  1S76 D;  3MXH P;  1A6L A;  2KXF A;  3CD6 S;  2R7S A;  3TRG A;  4NXN J;  3CWJ A;  3MOZ A;  3KJN B;  4KGK A;  3OTB A;  2W7O A;  2WON A;  3GJS B;  2RU3 A;  2BQR A;  1KVI A;  2VZ9 A;  2JC1 A;  4OZN A;  1Y00 A;  1FT8 A;  3RW7 A;  4ZK7 M;  3K2Y A;  2ZD1 A;  4X4S A;  1VQO S;  3F73 A;  4PXD A;  3R6L B;  4K4X A;  1WUU A;  1VQ6 S;  3C66 A;  2GO8 A;  4FPI A;  3PM9 A;  3PTW A;  3ZC4 A;  4URG A;  2Z2M A;  1PYT A;  2LEA A;  3M8Q B;  5KG0 A;  1URN A;  4LBH A;  2HVI A;  1FWP A;  3CVK A;  2H4Y B;  1N0U A;  2HFN A;  2UXD J;  2GGP A;  4DL2 A;  4ZVP B;  3IAM 9;  2D7S A;  2AJ0 A;  2HQD A;  1WEY A;  2CPF A;  2MSS A;  3M30 A;  1W2B R;  1SQG A;  2FYX A;  4ZVE A;  3L4B C;  2GO9 A;  3DRS A;  3NLC A;  4CTA A;  4YQW A;  3PCO B;  5AXL A;  3Q8V A;  4AQY J;  1D1U A;  3KK2 B;  3M9O B;  4AFF A;  3R5C A;  4NYO A;  4P7T A;  2NXJ A;  3MMB B;  4MKB A;  4ZP9 A;  3CB4 A;  2U1A A;  2EK6 A;  3GII A;  1IBM F;  4O3S A;  2F63 A;  3IBW A;  1KON A;  2B7C B;  4B3T F;  2K7J A;  1HBN A;  2YX7 A;  1JXE A;  3B6B A;  1ZA2 B;  5C24 A;  2IBK A;  1I94 F;  2G4B A;  2QE5 A;  2ZKT A;  1UEU A;  4DR6 F;  2KJW A;  2FHK A;  4FPR A;  1TKX A;  3HVT B;  3GFX A;  4NOH A;  5IM0 A;  5DDO C;  1JLQ B;  3I6P A;  4X84 A;  3VQT A;  3ISN C;  1T03 A;  4KHM A;  5LMN F;  2IC3 A;  1JMT A;  1N5V A;  3KUH A;  2BJ3 A;  2CXE A;  3FVY A;  1IUJ A;  4MK7 A;  2XGQ A;  1SKW A;  3BDP A;  3G8T A;  1PYO B;  5BXI A;  5KFY A;  3AB2 B;  3UNY A;  3JSM A;  4FYD A;  4K5R A;  3SCI E;  4X66 J;  4YY3 J;  4TU8 A;  3WIV A;  3DU6 A;  3M6W A;  2PE8 A;  3MPV A;  2AGP A;  2KT5 A;  2QYC A;  4CCH A;  4QIG A;  4DL7 A;  2MDA A;  3UDL A;  3BN4 A;  4TLR A;  2QTW A;  3HT0 A;  3PJW A;  3C6T A;  2DGU A;  1RT7 A;  2HVD A;  2CNL B;  4G1I A;  2CJK A;  3TW0 A;  4LBP A;  1OIA A;  1H38 A;  3MCN A;  2FUG 9;  3D68 A;  1NSK L;  1YBU A;  4CZC A;  2V50 A;  5HAN A;  4DR6 J;  5GMK a;  3UVJ A;  2XMU A;  1CS4 B;  1TL7 B;  2HWI A;  1U1P A;  2VG5 A;  1RUS A;  2WSF C;  2QYG A;  2W2N P;  3LW5 C;  3E8O A;  2DHG A;  4KT0 C;  3MM6 B;  4K5S A;  3C8Y A;  4C9D A;  1NBE B;  4DF8 A;  1PAU B;  2Y1I A;  1SQF A;  4OX9 J;  1SJ4 P;  2W2M P;  1VRU B;  1FRX A;  2M3D A;  1TFY A;  3VHQ A;  4ZIT A;  1OO0 B;  4H4K A;  2CA9 A;  1R8B A;  5JXS A;  2JWN A;  4G65 A;  4RW7 B;  2W24 A;  1KHW A;  4QOT A;  3SV4 A;  3P45 B;  4NXN F;  4RU9 A;  4K2J A;  1WTB A;  3HM9 A;  4UF4 A;  3CCM S;  1WHW A;  1RAJ A;  3Q89 A;  3VGV A;  3WHI A;  2IRX A;  3B4M A;  2BJ9 A;  2A0F B;  5IC4 B;  1JLG B;  1U1Q A;  2DHS A;  4USH A;  5LMU F;  4XIU A;  2VKR A;  3KNG A;  3J80 U;  1GXT A;  2OEJ A;  3UO0 A;  5HP1 B;  5AJ3 J;  4URQ U;  3HP6 A;  1AZS A;  2WW8 A;  5HMW A;  3HUL A;  1REV A;  3Q83 A;  1IKV A;  4IQM A;  4CO0 A;  4AL7 A;  3D28 A;  2J0Q D;  2O3D A;  3KK3 B;  1RBA A;  4MIA A;  4UUX A;  4ZJQ A;  3WBZ A;  4C8L A;  2N3O A;  1RDR A;  3QFW A;  1SQE A;  1U6Z A;  5AT1 B;  3NXZ A;  2V9K A;  3J81 j;  1FNM A;  2CJX B;  5KFM A;  4DR1 F;  1UW9 A;  3ZTO A;  1RT2 B;  5CZV A;  2CNN B;  3ET6 B;  4HAC B;  2ROG A;  3AB4 B;  3R5A A;  3TEH B;  2JEI A;  5KFT A;  3FZ2 A;  2VA2 A;  3N0V A;  2A2C A;  1VDH A;  2JL9 A;  4KPC A;  1N32 J;  5LMU J;  3Q23 A;  2K1R B;  1D8Z A;  2C3P A;  1JKH B;  2FIU A;  4OX8 A;  4OYO A;  3TUI C;  5M2U A;  3CUL A;  3M05 A;  4RW4 A;  3JSB A;  2ZHO A;  4YDX A;  2MZS A;  1WHY A;  4YME A;  3FEY B;  1FEE A;  1NPK A;  2EKY A;  1DAR A;  3JB9 k;  3BSN A;  1ZZN A;  1RWN B;  2YY3 A;  1Z1Z A;  1EET B;  2AIR B;  2IM2 A;  4OZL A;  4QIV A;  2IAJ A;  2OPR A;  3HHK A;  1FF2 A;  5B0A A;  1FE4 A;  4YUD A;  5D0G A;  3QRR A;  5DRK A;  3QRP A;  2V4J A;  3P5T L;  4F25 A;  3JQM A;  4G1Q B;  2EC0 A;  4L74 A;  4DV3 F;  1V6H A;  2GMJ A;  4AND A;  1HIY A;  1IR1 A;  2DGW A;  4B3M J;  3MTK A;  4GKK F;  3C14 B;  1U2C A;  2LU1 A;  5B0G A;  4ETX A;  1RU2 A;  1RTD B;  2G1H A;  1U1K A;  2WTF A;  3MEG A;  3LGN A;  3U02 A;  1X8D A;  2RDI A;  1RT5 B;  2VFV A;  3CD0 A;  3ETM A;  4PWW A;  3C16 A;  3PXG a;  2XMA A;  5J2N A;  2R8J A;  5THW A;  4WF9 Q;  4F02 A;  2B6A A;  2J76 E;  4P2M A;  1VFJ A;  3VVU A;  3PRB A;  4EO8 A;  1TMM A;  3EGW B;  3IWL A;  1VCT A;  2DR6 A;  2OSR A;  3A12 A;  1K9M T;  3T5J A;  2EW9 A;  2H3E B;  1J5E F;  4OV6 A;  1WC5 A;  1WC6 A;  2QL5 B;  1ZM3 A;  2VBW A;  3DMJ B;  1T0T V;  1SKR A;  3CMA S;  1D9D A;  2C28 A;  1HI8 A;  2HBZ B;  4U67 Q;  2J6T A;  2Z2L A;  4N76 A;  4DF4 A;  3MM6 A;  3EDQ B;  2GCF A;  1BXN A;  4OJG A;  1HQU B;  5D0H A;  3S01 A;  2KDO A;  4EK2 A;  5C25 B;  3VAF A;  4ZDN A;  2NQP A;  1B70 B;  4K4S A;  1NHK L;  1R31 A;  3FC9 A;  2OHD A;  4NLR A;  4ED4 A;  4NZ0 A;  4QWD A;  3DLB A;  4B9T A;  2YWH A;  5D0E A;  3SXL A;  1HI0 P;  2GVZ B;  2XNQ A;  3ADA C;  2FZC B;  2CQD A;  1BQX A;  4M5D A;  4ZJL A;  1K1Q A;  1PAE X;  2G13 A;  2J8S A;  2RQM A;  2NZC A;  3V4M A;  2HHH F;  3H4B A;  1BWE A;  1NB7 A;  1IQZ A;  3IM9 A;  3NG8 A;  2COL A;  5CYQ B;  3W65 A;  4C3M A;  4HI2 A;  3GTY X;  1HHS A;  1UEK A;  1WG5 A;  2QFI A;  1V3S A;  1W26 A;  3MM7 B;  2QG9 B;  2OIH A;  4N41 A;  1IKY A;  3TUJ C;  2H1Y A;  1NLK L;  3AAW B;  1SJQ A;  4IG0 B;  3SCJ E;  2DRD A;  3NEK A;  4GVL A;  4TU7 A;  4ERD A;  2B8Q A;  3J80 Y;  3FSX A;  1I3O B;  4O3Q A;  1WDT A;  3VGU A;  1S77 D;  2PT0 A;  1CS4 A;  1TL7 A;  3JTP A;  5IT0 A;  3TUZ C;  5EWG A;  3KUG A;  1KP6 A;  4PQU B;  3KFW X;  4OV1 A;  2MKI A;  4LF4 J;  1HNW J;  3BPD A;  3KWM A;  4WE1 B;  3RBZ A;  1F5C A;  2ZE2 A;  4DUT A;  1LQ9 A;  1VK3 A;  1HYS B;  1R0B G;  4GKJ J;  4DCO B;  4ZCI A;  2IJF A;  2VB6 A;  1S7H A;  1OSC A;  2BE2 B;  1N32 F;  1WWH A;  3JAM Y;  1BD6 A;  3PIP Q;  1WAC A;  3EXC X;  1SUQ A;  5KTQ A;  4NA1 A;  2M4M A;  4F04 B;  1DLO A;  4DV2 J;  4ECS A;  4ED3 A;  1VIO A;  1R89 A;  2R7Q A;  5DJB A;  2BQU A;  1NPR A;  1PC5 A;  1QSL A;  5CCM A;  2KHC A;  2MLX A;  2NZ4 A;  1RHQ B;  4LRE A;  4WIQ A;  4BS2 A;  2HUR A;  1RE1 B;  3POT A;  2K06 A;  1T94 A;  3W9H A;  2RDJ A;  3SSS A;  3FCV A;  2WB1 D;  3GIL A;  4JV1 A;  2ROP A;  1UZD A;  5HLF A;  3H7H B;  1B3T A;  5ETV A;  4M95 A;  1T95 A;  4PCQ A;  4NWB A;  2DXE A;  4Y34 A;  4RW8 A;  1Y5I B;  5CYM B;  2N82 B;  4H4M B;  3NWG A;  2YNF A;  2CIM A;  4NA3 A;  2Z4P A;  3HVA A;  2ALY B;  1GMU A;  3DKD A;  2ACM A;  4K0K F;  1FX2 A;  4WTY A;  4M5D B;  5HJY A;  3C3L A;  3DLG A;  1BC6 A;  4ZA1 A;  2FPH X;  2KZM A;  3QGP A;  1V5V A;  2J0S D;  2GC8 A;  2PMH A;  2XWY A;  1NZA A;  1QVG R;  3LP1 B;  1BHN A;  3CDB A;  3QZ7 A;  4NCG A;  4RZR A;  2ZH9 A;  1IBK J;  4TKT A;  3BO2 A;  1BQN B;  4FXW A;  2BM0 A;  4LFB F;  1HQU A;  1VHI A;  4NLP A;  1RK8 A;  3TO8 A;  5C25 A;  3OL9 A;  4NLT A;  1LWC A;  1ARO P;  3D6H B;  2XC9 A;  1JNR B;  1HNV A;  3ENW A;  3H42 A;  3IR7 B;  2FY8 A;  3DOM B;  3M8Y A;  4A47 A;  4NRT A;  4CH0 S;  3CCZ A;  1DJ0 A;  1HL6 A;  3D3B J;  3LP1 A;  2A3J A;  3I32 A;  4PPZ A;  3SSQ A;  3TZW A;  2QSF A;  3J81 Y;  4K0K J;  4J37 A;  4DQQ A;  1L3T A;  1RWV B;  3R97 A;  5J2N B;  2PEB A;  4CP5 A;  1L3S A;  4N8O A;  1T02 A;  3RBX A;  2Z56 B;  5EDW A;  2DY1 A;  2FY1 A;  4HLB A;  1VIX A;  1G4C A;  4DV6 J;  1MML A;  2DNK A;  2EFG A;  3IC1 A;  3M2V A;  4TXS A;  5B0E A;  1WEL A;  3GIM A;  4B3S J;  4YR2 A;  5DG9 A;  4HH0 A;  2HBY B;  1X4B A;  4LFB J;  1SBR A;  2JEG A;  2GQC A;  4AXJ A;  3KOA A;  1RHM B;  5F8N A;  2E1A A;  2XI2 A;  4YB6 A;  5HN0 A;  3BH7 B;  4RW6 B;  3M32 B;  1NKC A;  1FES A;  2AW0 A;  4I2P B;  4ZS6 A;  9ATC B;  2YX4 A;  3H0P A;  3N5B A;  1N36 J;  1QAI A;  3JYT B;  1PIE A;  4B3R J;  1YBT A;  2CG4 A;  5F8L A;  4RUC A;  3M8R A;  2HK3 A;  5B0F A;  2OGU A;  2WSE C;  3M2U A;  4C2M A;  4JOU A;  2AGO A;  2UUC F;  2XZT B;  1RYR A;  3DLE A;  4LF7 J;  2X1F A;  2GS8 A;  3VV2 B;  2I5J A;  1M1K T;  3D1O A;  3PW4 A;  4D3G A;  5L1L A;  2I9S A;  3EJM A;  4X4T A;  1RAF B;  2DXD A;  2E1R A;  2PA3 A;  3CE8 A;  5E5N A;  1RTH A;  3DI6 B;  3EM1 A;  3LA0 A;  4HHJ A;  4AT1 B;  4QU6 A;  3EUN A;  2GJ2 A;  2RIL A;  3SMZ A;  1TL3 B;  1W7W A;  5A0Y B;  3SI8 A;  4K50 A;  3AH6 A;  3GSI A;  3NY0 A;  2B4O A;  3N6M A;  1NHV A;  5D6G A;  4OYP A;  1EIY B;  3QRQ A;  2OPQ B;  1TUG B;  3EZ5 A;  3D3C J;  4N47 A;  1R0A B;  1TKT A;  3PX6 A;  2ZH8 A;  3FCW A;  2CQC A;  2XHW A;  2D69 A;  2YNI A;  1IXK A;  3FDS A;  4CDI A;  3DLK B;  1X0F A;  1PG5 B;  3DLL Q;  4LFC J;  1SKU B;  2QO3 A;  3LP2 B;  4DV0 J;  1FTR A;  1ZAX A;  3HVT A;  3NBP B;  2M9K A;  4WFY A;  2BE9 B;  1H72 C;  5IFM A;  2DK2 A;  4PUO B;  3V6D A;  2MYF A;  2MY7 A;  2DGQ A;  1U0H B;  3MCO A;  4LUB A;  4X65 F;  1KN6 A;  3ETO A;  5B09 A;  4Z7Y A;  5HJX A;  4NCA A;  4WBF A;  2XNR A;  1DFD A;  4C48 A;  1OYE A;  5LSL A;  4IFV B;  2CPJ A;  3AT1 B;  3FBE A;  4I6A A;  2WVD A;  2RHS B;  2N4C A;  4ANC A;  2MKH A;  1X5P A;  4NZ6 A;  3UI3 A;  3MMJ A;  2Z2Z A;  3CCR S;  4OHW A;  1KWM A;  1SI9 A;  2OPQ A;  3PAC A;  2UXC J;  1NK4 A;  3HFV A;  2AYM A;  3TAN A;  5KFC A;  3M4X A;  2DGV A;  1NAQ A;  1ELO A;  2CAD A;  5H1S V;  1JXL A;  1HQ2 A;  2W01 A;  1YI2 S;  3UN2 A;  4DSI A;  1FE0 A;  1WDD A;  1Q1K A;  2CQ1 A;  3QO9 A;  2YNG B;  1D0E A;  2WVF A;  2RH3 A;  1P6T A;  1Q0N A;  2FQQ B;  2YQ0 A;  3OPK A;  4JYA F;  3K5O A;  5FDL B;  5G0R A;  4QR1 A;  4Q44 A;  2DIT A;  3FQK A;  1YJ7 A;  3R3T A;  4AL6 A;  2XS2 A;  3NS6 A;  3PIO Q;  2ZHB A;  2R7O A;  4I1T A;  2Y0B B;  2ABY A;  3PEH A;  2ZH7 A;  5C42 A;  2ZWP A;  3LAN A;  3OW2 R;  2MQL A;  1U26 A;  2YKO A;  4TY8 B;  1N5T A;  4C0H A;  5FLX Y;  2HQI A;  3MEE B;  2DGS A;  4H4K C;  1T3O A;  5B7W A;  3MOJ B;  4ECU A;  2NPF A;  2DR8 A;  1KFS A;  2QL9 B;  2RRN A;  5CAB A;  2FLL A;  2QJ3 A;  3O8W A;  1WF2 A;  3SCK E;  4QR0 A;  3VZI A;  4I67 A;  2BE7 D;  2IAJ B;  4PQA A;  2V9W A;  2NXE A;  1EQM A;  5GAE U;  4U7C A;  2KXH A;  4G3I A;  2BMB A;  4CLZ A;  1JLB B;  1NKB A;  4JI8 J;  2VQE J;  1IBL J;  1FXL A;  1E6Y B;  3H5X A;  1N33 F;  2BRL A;  3A8J A;  2IM0 A;  4JYA J;  4DMZ A;  1VYA A;  3JSR A;  1YBA A;  2BV3 A;  4LQ9 A;  4F2S A;  2HHV A;  4P52 A;  1VBY A;  1TR0 A;  3QAT A;  1RAD B;  1UFK A;  3EGN A;  4G6V B;  5HVH A;  2XZW A;  3RRK A;  3EX7 B;  2YKM A;  1TMJ A;  4ZPD A;  4MKY A;  5GAG U;  1WNE A;  3LUY A;  4DR2 F;  2C22 A;  3PY8 A;  2A1B A;  2VIC A;  1FRL A;  2WAQ D;  1PJ6 A;  4A8F A;  1PKU A;  1FK9 B;  4C7Q A;  2VKZ G;  4ZHR A;  1P9Y A;  2LFV A;  1XMO F;  1FWK A;  4DS4 A;  2DR9 A;  1Q7L B;  5LM7 E;  5D15 A;  3T5L A;  2MKC A;  2ZDO A;  5KG4 A;  3DHW C;  3MAA B;  4FKY A;  1FDB A;  2Z2Y B;  4M5G A;  4ID5 B;  2B9W A;  3KJV B;  5D77 A;  5KG6 A;  2EKN A;  2KN4 A;  4DL3 A;  2W7A A;  4JI8 F;  4WFN Q;  4GC6 A;  4F26 A;  1SL1 A;  5KFK A;  3MR3 A;  5D4L A;  3CPW R;  5GAD U;  1NM2 A;  3RBD A;  3C15 A;  5KG2 A;  2EPI A;  1VJQ A;  2HS3 A;  2C1E B;  2JLE A;  4L73 A;  4PXE A;  2F4F A;  5T7L B;  2KZZ A;  4X62 J;  3TAM A;  7AT1 B;  2GIQ A;  2C2N A;  3L7O A;  3M8P B;  4WFZ A;  4IR1 A;  4X4V A;  2OPP B;  1JJH A;  3FJ2 A;  4DJB A;  1K47 A;  2LQ8 A;  3BR8 A;  2HND A;  2XMT A;  4PEO A;  2ZC4 A;  1S48 A;  3ONQ A;  1PGZ A;  1TKZ A;  1S7I A;  2BZ2 A;  3GCW P;  4FYX B;  3QIP A;  1NK5 A;  1NJI T;  2BKO A;  1EZZ B;  4AQY F;  2V34 A;  2LLZ A;  1C0T B;  1RHU B;  3OR2 A;  3W5X A;  2E5L F;  3FCH A;  1HWJ A;  1S1V A;  4Q5V A;  4WPA A;  2D9P A;  4ZPA A;  2KG1 A;  1IBM J;  4KHP J;  2W2P P;  4IOA Q;  4A8X A;  1OYD A;  2CQP A;  3C6U B;  2I6W A;  2F1F A;  3Q2S C;  3SBM A;  2VON A;  1RT7 B;  4OX6 A;  3ZZU A;  1GEH A;  1I94 J;  2DH9 A;  2N7Y A;  2ZBC A;  4QWB A;  3HJF A;  4LSL B;  1N5Y A;  3ZZY A;  1KVK A;  2HRT A;  1FCA A;  3LH2 S;  3KK2 A;  1FRM A;  5HVG A;  5HMY A;  2A2D A;  2HLT A;  2V8H A;  1Q82 T;  1HR0 F;  4W4M A;  3NGU A;  2C2R A;  1RBO B;  2E7W A;  3PKY A;  4NLD A;  2BW7 A;  2CVE A;  4DPU A;  2KVQ E;  4DL6 A;  2HZV A;  3KHG A;  1VC6 A;  4J9K A;  1JJC B;  3UN5 A;  1O0P A;  1YJ9 S;  2MHN A;  2DNZ A;  3CTR A;  2N4D A;  3MD3 A;  3H5Y A;  5T14 A;  1RT3 A;  4IG0 A;  4P7V A;  3BQ2 A;  7FDR A;  4DV1 F;  2W9C B;  1RXO B;  3UN3 A;  2PII A;  1FTC A;  2NLW A;  4ICL A;  3LGM A;  4ZPC A;  1V3R A;  3QT5 A;  4U9R A;  1UTA A;  1AUS L;  5IT9 Y;  1N4L A;  4PRF A;  1HW9 A;  1P27 B;  3AQO A;  3VAM A;  2V8V A;  1QDU B;  2R8H A;  5DDR C;  2W25 A;  2RT3 A;  3BBC A;  1LKZ A;  3BM7 A;  3JTO A;  3V81 A;  1AFI A;  2QLF B;  5L46 A;  3MMB A;  5AE2 A;  4KGV B;  3X1L B;  1QE1 A;  1X60 A;  4IO1 A;  5F41 A;  2Y9H A;  2H48 B;  2O01 C;  1DQA A;  2CQG A;  2J0W A;  2C3U A;  4NLO A;  3GZ7 A;  4NMX A;  3CJ3 A;  3TOQ A;  3CD7 A;  4OYB A;  3HX9 A;  3QPI A;  5L8R C;  1J27 A;  2XYH B;  3GFH A;  1H3D A;  1ACM B;  2R4F A;  2VOO A;  2ASY A;  2M2B A;  3I4P A;  2IVF B;  2Q3P A;  3V81 B;  1X4C A;  4OZ5 A;  2F9D A;  3NKY A;  2E9R X;  4NLV A;  5F0U A;  4F0K A;  3ZXW A;  5MAO A;  2OH2 A;  2BRK A;  3RU0 A;  1HNZ F;  1FO1 A;  2J7W A;  1JLA A;  4LSN A;  4X4P A;  5AJ3 F;  1XMB A;  3NGS A;  3RB6 A;  2JDJ A;  2DR7 A;  5E33 A;  2ZNZ A;  1QUP A;  3CT9 A;  4TYB A;  4Z7C A;  2RQK A;  1OY9 A;  4GC7 A;  1RAG B;  3LPY A;  1XMO J;  4JB8 B;  4FBU A;  4DFJ A;  1EP4 B;  1RCX B;  1S6O A;  2HNZ A;  3AXK A;  1C2P A;  4G1Q A;  4ZPV R;  4AUK A;  4J9N A;  3MED A;  2AEJ A;  3KYL A;  4ECQ A;  1HBU A;  2AYE A;  5KG3 A;  4DV3 J;  4U7U D;  1LFP A;  1UAW A;  1C0U B;  5ETN A;  3W2W A;  2LQ9 A;  1HQE A;  4KO0 B;  5LSO A;  2EI5 A;  3FZB A;  4QQB A;  4IRC A;  2FJV A;  4KHP F;  1Y4Z B;  3LF0 A;  3CCW A;  4N7T A;  4JV0 A;  1IQT A;  2DNR A;  5DGB A;  4KHR A;  2AJ2 A;  1TL1 B;  1U2R A;  3OSN A;  3DLE B;  1K44 A;  3C6U A;  4ID5 A;  3UNG C;  1GAO A;  5D4P A;  1A7G E;  2XHC A;  1FDA A;  2HFO A;  1KTQ A;  1VIS A;  4FN5 A;  4JUZ A;  3G4S S;  4F4Z A;  1NJX A;  1FWL A;  2HEK A;  4BCA A;  2OEK A;  3CCJ S;  1HR0 J;  1RTJ B;  2MZT A;  3M6V A;  2WHO A;  5SUH A;  2R2R A;  1UZH A;  2OUG A;  3CJ4 A;  1S9G B;  1TAQ A;  1U8S A;  2UUW A;  4TU9 A;  3LO3 A;  1N34 F;  4X4Q A;  3KLV A;  3T3F A;  2RVJ A;  1OMS A;  3M8P A;  1SH2 A;  5E3A A;  5ETT A;  1KR4 A;  2KG0 A;  2ASD A;  2FDN A;  1UA1 A;  4TY9 A;  2U2F A;  1F6T A;  2GZO A;  5LXR A;  1OWX A;  1S1W A;  4KR0 B;  3TAR A;  3PRD A;  4EUV A;  1XEZ A;  5GAH U;  3GB0 A;  3RUB L;  2RML A;  1XN9 A;  1WC3 A;  4C11 A;  3OL6 A;  2KM8 B;  3MF5 A;  1RA6 A;  1T8E A;  2AHO B;  2X1G A;  1Q8L A;  3I5C A;  1H98 A;  1RWX B;  4ZVS B;  2BEF A;  2JRS A;  3K0J A;  2ZBR A;  3PV8 A;  3AD7 C;  4I7F A;  4RWW A;  5IT9 U;  5CAA A;  4YEA A;  1KLM B;  3P96 A;  1M90 T;  3NAI A;  3R7B B;  4NA2 A;  1FI4 A;  3IBF B;  3D6F B;  4P10 A;  1S6Q A;  3ZZT A;  3GYN A;  4DX7 A;  1EKS A;  1DQ8 A;  4FS2 A;  4O44 A;  2CQ3 A;  2CZV C;  2H51 B;  2J6U A;  2JOQ A;  4P75 A;  2VG6 B;  3M8W A;  4FXV A;  2ZOF A;  4NE9 C;  3OHA A;  2DVI A;  4WP8 A;  1UVN A;  2HQ3 A;  4K4V A;  2ZH6 A;  2I8E A;  5D4N A;  4E0D A;  5ETM A;  2EWH A;  1RWO B;  1EAY C;  1RB0 A;  1TTH B;  1U6F A;  3MD1 A;  1FVS A;  1U09 A;  4ES1 A;  1NCL A;  2DO0 A;  3BKU A;  1SH0 A;  3CO9 A;  3TZY A;  4QWC A;  4TNO A;  3GPA A;  4DEZ A;  4TQR A;  2Y1J A;  4MK9 A;  2CWX A;  4DCJ B;  2KFN A;  2LXI A;  5A6P A;  3S7R A;  1QSS A;  2EBE A;  1Q78 A;  1VOM A;  2D1C A;  4JI5 J;  2RIJ A;  1C1C B;  4IH5 A;  1X4F A;  1XR5 A;  4GVB B;  4QZV B;  4M5H A;  1HNX F;  2A18 A;  2IMW P;  4JV5 J;  5KFX A;  5ETR A;  2HZA A;  4OHV A;  5KFR A;  1X4A A;  3LPE A;  1S9G A;  1NH7 A;  2ZOG A;  5KFD A;  4IFV A;  1SKS A;  2B0G A;  3NAH A;  4W98 A;  2YWF A;  4ZIV A;  2HRU A;  2CQ2 A;  4Q8F A;  3BH6 B;  3KLE A;  2HFU A;  1LWE A;  1BLU A;  1ZPW X;  4CLK A;  4U8Y A;  4A8K A;  3TUP A;  4C4W A;  1E6V A;  1GXU A;  2HIY A;  4HEA 9;  4DX5 A;  3FSY A;  1S10 A;  5HRO B;  5DLG A;  4Q0B A;  1KOO A;  1D09 B;  3QZ8 A;  4W90 B;  5EWE A;  1T9W A;  4WII A;  2YNG A;  1GQE A;  2QRR A;  2EFQ A;  2HK2 A;  3MUV P;  2I2Y A;  1A0O B;  5J1N A;  3KXD A;  1H7X A;  3NMR A;  5H9E J;  2XWX A;  4DV2 F;  4LRD A;  2QV6 A;  2H5J B;  2OEM A;  2ZH4 A;  5IQ6 A;  1QTN B;  3EIC A;  2MGZ A;  1VRT A;  1H2V Z;  3PX4 A;  1HD1 A;  4M8L A;  3HHD A;  3SEO A;  3N28 A;  1ZBT A;  2V63 A;  1Q16 B;  5ETQ A;  3UW1 A;  1VQP S;  1U25 A;  2CPZ A;  2CQI A;  2QIF A;  2XS5 A;  3GR0 A;  4O0N A;  2AF6 A;  3TVZ A;  1WEZ A;  1PYS B;  2I5J B;  2ZC3 A;  2ZD1 B;  1HWL A;  1JLC B;  1JB0 C;  2VC1 A;  3M8Q A;  3MM7 A;  2RS8 A;  5CHC B;  1T05 B;  5A8R B;  2HBQ B;  2FLN A;  4DR5 F;  2IVY A;  3KHR A;  2RS2 A;  1F3F A;  1TQL A;  3KJF B;  3PEJ A;  3Q8Q B;  3G6Y A;  4CLS A;  1IBC B;  3GR1 A;  3CCL S;  3OT9 A;  4YP3 A;  5DG7 A;  2PI4 A;  1Q95 G;  1NJY A;  3ZFV A;  4C0O C;  3SV3 A;  2HMI A;  3Q8S B;  3IGN A;  3H98 A;  2HRY A;  4CYU B;  4F50 A;  5LJ5 Y;  2B4P A;  2H54 B;  5KFH A;  2VBZ A;  1WKL A;  1FKP B;  5I4M A;  4RLE A;  2IM3 A;  1AFJ A;  2FB0 A;  2FVR A;  2DB1 A;  2XY6 A;  1S0N A;  1B7F A;  4PYD A;  2DNY A;  3RB0 A;  3M2R B;  2Y1R I;  3OR1 A;  3PJX A;  3G6V A;  2B43 A;  2VQF J;  1G1X A;  2VV5 A;  3IO1 A;  3CED A;  1X9S A;  2KM8 C;  2CNO B;  3OFF A;  2DNQ A;  2FLP A;  1P1T A;  2CFX A;  5DS7 A;  2XQC A;  4WU3 A;  3DMJ A;  3FBF A;  1AXQ A;  2AEF A;  2XO7 A;  3G96 A;  4JI6 J;  2PMZ D;  3J7Y U;  3QJP A;  3BBB A;  1TKD A;  3IRX B;  3B4D A;  1NDL A;  3MGJ A;  4Y00 A;  4CQ1 A;  1N48 A;  3HFZ B;  5HI7 A;  4DN0 A;  5HMX A;  3H20 A;  3VWS A;  5L38 A;  2ZM6 F;  3CCV S;  4A48 A;  3D0G E;  3MMC B;  2SXL A;  3BSO A;  1YX2 A;  4BDP A;  1TK5 A;  2HNY A;  2E1M C;  5D8H B;  3MR6 A;  1CQM A;  4P6Q A;  4X2B A;  1LW0 B;  2LCW A;  2RF2 B;  3CDW A;  3R7S B;  4B3S F;  3AOB A;  3DXB A;  1Z2L A;  2WVE A;  2AYB A;  3G82 A;  1BQN A;  2ZVI A;  2MKJ A;  5HQM A;  4YFU A;  5E3P A;  1REV B;  2UUT A;  3GV8 B;  2FD2 A;  1KBR A;  2BR0 A;  1SB6 A;  3A1Y G;  4OJH A;  5KFS A;  3JAM U;  4ECR A;  2XSJ B;  2QLX A;  1FJG F;  3T19 A;  2XLJ A;  3CUN A;  1GH8 A;  3BJY A;  2Z58 B;  3VAI A;  3W2V A;  3CJ8 A;  1RTI A;  3JQK A;  2QFJ A;  4B3R F;  2VHG A;  2DNO A;  3N4W A;  3K17 A;  5A8W B;  4ZPT R;  2FZG B;  2IIH A;  5DO2 A;  1OY6 A;  2D3U A;  3Q8P B;  4HT7 A;  4XK8 C;  5KT5 A;  1NK7 A;  5KT4 A;  3LWM A;  4U7U K;  4E2F B;  2BYC A;  2IA6 A;  1FHT A;  3NS5 A;  2J9D E;  4LFA J;  3KNA A;  1FX4 A;  2YKN B; 
#chains in the Genus database with same CATH homology
 3QBC A;  1IM6 A;  1EX8 A;  4M5H A;  3ILO A;  3HCX A;  3KUH A;  5ETS A;  2CG8 A;  3UD5 A;  4M5I A;  5ETR A;  4M5N A;  3UDV A;  3HD1 A;  1KBR A;  3ILL A;  5ETQ A;  3MCM A;  3KUG A;  4M5L A;  1CBK A;  3HSJ A;  3HSG A;  4M5M A;  5ETL A;  5ETN A;  1HQ2 A;  5ETV A;  1EQM A;  3IP0 A;  5ETT A;  1RU2 A;  4CYU A;  4M5G A;  1F9H A;  1HKA A;  2BMB A;  4PZV A;  2F63 A;  1Q0N A;  5ETM A;  1RAO A;  4CWB A;  3HT0 A;  3HD2 A;  1RU1 A;  1RB0 A;  3HSD A;  3KUE A;  4F7V A;  3ILI A;  3MCO A;  1TMM A;  1RTZ A;  3UDE A;  4AD6 A;  3MCN A;  1TMJ A;  1EQ0 A;  2F65 A;  3ILJ A;  4M5J A;  5ETP A;  4CRJ A;  1G4C A;  5ETO A;  2QX0 A;  4M5K A;  4CYU B;  5ETK A;  3HSZ A;  1DY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...