2IBOA

X-ray crystal structure of protein sp2199 from streptococcus pneumoniae. northeast structural genomics consortium target spr31
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
MKASIALQVLPLVQGIDRIAVIDQVIAYLQTQEVTMVVTPFETVLEGEFDELMRILKEALEVAGQEADNVFANVKINVGEILSIDEKLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein SP2199
publication title Crystal structure of the hypothetical protein SP2199 from Streptococcus pneumoniae, Northeast structural genomics target SpR31
rcsb
source organism Streptococcus pneumoniae tigr4
total genus 19
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01910 Thiamine_BP Thiamine-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.930 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iboA00
2IBOA 1LXNA 1VK8A 1S7HA 2EPIA 2EKYA 1SBRA 1LXJA 1S99A 1YQHA
chains in the Genus database with same CATH superfamily
2RILA 1SJ1A 3Q0AA 5I42B 3LP0A 1RWKB 3IGNA 1I3OB 2RU9A 4IDKA 2HQGA 4B02A 2CQ0A 3MECB 3GG1A 1TUGB 2ZKUA 3PX6A 1CJKB 3BH7B 3HHDA 1JIHA 2G0CA 3AQOA 2EVZA 3CJSA 3VR1A 4M8LA 1Y11A 3KDOA 2DXFA 1RHKB 1X4CA 2GMJA 3R6LB 3O6QA 1YSJA 1DTQB 1U1NA 4OYWA 2H51B 1X0PA 4OJHA 1EZZB 3GSIA 3KLIB 3GV8B 2UUCJ 3DOKB 4I67A 1UVKA 1FNXH 1NNDA 3ILOA 1F9EB 3CJTA 2QJ3A 4FS1A 3EGNA 1LK7A 2B4PA 3BJYA 3BREA 3NCQA 4QWAA 4IQMA 2CADA 3MEDB 4L72B 4IH5A 3M8RA 4NMLA 3W5XA 4ICLB 5E3QA 2O66A 3PVXA 3M8ZA 1S79A 4MFBA 1KTQA 4LSLB 2JVRA 2B7BB 3TA2A 4KGZB 2V0NA 4J7CA 4Y65A 5K5MA 1NU4A 4CTAA 1X60A 2FC8A 1S9GB 4CLTA 2E1CA 1BQMA 3I5AA 2H5EA 2DH8A 4QIVA 4CI0B 3Q8UA 1QAYA 4ZP9A 1U6ZA 2YY3A 4RWXA 3DXSX 2XB2D 2H9ZA 2MQOA 3FZ2A 2VHGA 2AJ0A 4ZVOB 3OD2A 2YKNA 3BPSP 6FDRA 2JH3A 2OPPB 3OTOF 2FJVA 4DF4A 4YR0A 3FBEA 2E1MC 4RUCA 1CJTA 4Q2LA 1TV6B 2WBRA 1OO0B 1IBKJ 5SZTA 1UA0A 2A2DA 3CJ4A 1SQEA 2JEIA 2G1DA 5KFJA 3CULA 4LT6A 1VFJA 3T41A 2O1PA 1D8ZA 1WC6A 5EWEA 2W2PP 3NBPB 2HFNA 4GC6A 2WK4A 1WOOA 1EETA 5DO2A 3DI6A 3CMES 1QSLA 3BV8A 1RHUB 3JXOA 1A6LA 3R6GB 1VQNS 2R8HA 1AW0A 1XTZA 3LPYA 2RIJA 1Y00A 2CPDA 4BWMA 4M63A 3ZC4A 1NB7A 4Q44A 3TJAA 4FNIA 4NLVA 2QE5A 3H5YA 2BJEA 3BKUA 3SQGB 4DUZF 4DR4J 4LVNP 1NK8A 5J2NB 2A3JA 4KO0B 2FD2A 2YWEA 4Q43A 1KOHA 1GXUA 3FCWA 2UUAF 1EHWA 4F26A 1JXLA 3MM6A 3BSOA 3C8YA 4P7VA 1SVDA 2C2RA 1UCNA 1J5EJ 1V3ZA 4XAKA 1RT2B 4WP9A 3PW7A 1T9YA 3UDVA 1HD1A 3DC2A 2VA2A 4QU6A 1NHUA 4NZ6A 2UXCJ 1U0SA 4UZCA 2DGSA 4H4OA 4KPYA 1Q0NA 2Y1LB 1H0HB 1YTYA 3SFUA 1D1UA 3QJPA 1KHWA 2RS2A 3HSJA 2MXYA 2V94A 4DQIA 3RYLA 2J76E 2UXBJ 2LEAA 3DLBA 4X66J 1RWVB 5KT7A 3I9ZA 5A8KB 5MLCV 4F7VA 3KLGB 1CULB 2ZD1A 4LFAJ 4ZPVR 4J9SA 1HR0J 2D3UA 1M5PC 4DG1A 2HBRB 3FSIA 3PIPQ 3VVUA 1M1GA 3CC2S 1AZSA 4E2FB 2YX1A 3QRQA 1U6FA 2OI2A 2VFTA 5H9FK 2DGVA 2DO0A 4KFBA 1GMWD 2LKZA 1APSA 3HDSA 4TU8A 1N5YB 5ETNA 3KMSA 1CG2A 4ILLA 2A10A 3I82A 1QUVA 2UUTA 3A3NB 1Y4ZB 5KG5A 1FRMA 4ZCMA 1YDLA 5GMEA 4DSEA 1G3OA 5KG4A 4NI2B 3LAKA 3PRDA 2DHAA 3D1QA 1K0TA 2JC1A 1UPPA 3GPAA 2BJ8A 1FJGJ 1RWWB 3QGHA 5F0UA 3W2WA 2HBYB 1ITPA 4NLTA 2HFUA 3QT6A 2XCAA 1UZDA 3K58A 4ILRA 3D67A 3MEEA 4RBVA 3CD7A 1SCJB 3MMBB 4FF3A 3R5GA 4YB5A 3GMGA 1RADB 2DPJA 1WWHA 2KFYA 2DBBA 4ZVEA 1Y3KA 2MQPA 3HD2A 1DTTB 1IBLF 5KT4A 3OTEA 5EUHA 4JI0J 1F0XA 4DCJB 1VHIA 4DX6A 2BE7D 1LK5A 1RKIA 2VPYB 3N6LA 3PJWA 1SUQA 5DLFA 4RNMA 2Y1IA 3I31A 1X4FA 5HATA 3KLHA 2CPXA 1RA7A 2NUUG 4HVZA 3M8YA 1BWVA 1NH7A 2Z58B 4WXWA 4F4ZA 2N82B 2YNIB 1FRIA 5B0CA 4DSFA 4J9OA 3BQ0A 3O1LA 3TAMB 5C42A 3MURP 1ZAXA 1C0UB 4QR2A 3ZTRA 5CYQA 4HTJA 3EZUA 2HIYA 1IKYA 3W60A 1DQAA 4OHVA 1RYRA 2KI2A 4U7UD 2BOPA 1VMBA 3BO4A 4X64J 1FTCA 1PILA 4OZ1A 4Q7AA 2A0FB 4PR6A 3T19A 4OJ3A 1FVQA 4HDGA 1RTDA 2F8EX 4PXCA 5EX0A 3KWMA 1Q81T 1H2VZ 3ITHB 3BH6B 1ZAWA 1HFEL 2M5YA 5I42A 2WW8A 1KBRA 4ZLJA 2EG1A 4F25A 2V8GA 8ATCB 2VG7B 2C3PA 1ZZNA 3G6YA 2DRAA 2ZBCA 3PO5A 3TR5A 3MECA 2DGOA 4LIWA 4DR1J 4ED1A 2PSZA 4C8NA 2UU9F 1HBOB 1UJ5A 2IA6A 3PRVA 3HVTB 4ECTA 1RLCL 1DTQA 5K20B 2QMUB 4N5SA 2M0GB 3BYPA 5HMXA 3Q8PB 4B3MF 4DX5A 3KTQA 4LSNB 1RT4A 2QC3A 4C8LA 3CC7S 3JS9A 4B3OB 3BKFA 3I0SB 3NAHA 3DOKA 2HLUA 4DV2J 4M5GA 4QQBA 1RTIA 3KHLA 2UVVA 2WB4A 3PKYA 5IT0A 5KT6A 1JKHB 1VRUB 1JB0C 4OI1A 4RW7B 1P9YA 2CA9A 4ED5A 3MEDA 3R27A 4J9KA 1FERA 2KZMA 4M95A 4NRTA 2J5AA 4PAAA 3KJVB 1JJHA 4ICLA 1FFGB 2F4VJ 1T03A 4X4TA 5FIIA 2CQBA 4PYDA 3KJNB 2E5GA 1S99A 2CQ1A 3BKTA 4PWUA 2Z30B 3HJFA 1TK5A 1F5AA 1B70B 2EG2A 5H9EJ 1B7FA 4GRSA 3RRKA 4P9SA 3TJ9A 1KNZA 2DY9A 1EB0A 2I2YA 1WEYA 3LP2A 3OSNA 3PDNA 4KGVB 4ES3A 5IT9U 4DCOB 4C8OA 1RABB 2CFXA 2OPPA 1LWCB 4JI8J 2AEFA 4FVMA 2W2NP 5U47A 2VBXA 4YY3J 3I6PA 2ZWOA 1RBLA 3TO8A 1DARA 4U67Q 1S59A 2VG6B 3QSYB 3MF5A 1EKSA 3AXKA 5I3PA 1YRUA 4X4PA 4FBTA 3NBPA 4C6AA 3DHWC 3QIDA 4C98A 2ZEJA 4M5HA 2DIUA 3EPGA 3PCOB 3OTCA 1B0TA 5LJ3Y 2DNPA 3TUPA 2DNKA 3UW1A 3W66A 1SKWA 1IVZA 2KHDA 2XMTA 4N47A 3RJMB 2RRAA 4FZVA 3QBCA 3SQGA 4AL6A 2V50A 5J2NA 4IFVB 4KO0A 2EPIA 4K4WA 3D3BJ 1HWJA 4QOTA 2HVIA 4KB7A 2RNEA 2HHWA 3GB0A 1KQFB 4Z7CA 2D3O1 2W4PA 4ITSA 1IJFB 4KE5A 4WPAA 3C15A 1BUXA 2NXUA 3MTJA 4KHMA 2LLZA 4ALZA 3DLEB 1F5BA 2BE9B 2KRRA 5D15A 2D7SA 2P5VA 4F8RA 1NK9A 2IRYA 5GAEU 3RB0A 2MSSA 2NYIA 5K14B 1PAEX 3N5FA 4ZVTB 4ECVA 3PW2A 5A8KA 2IM3A 4QR0A 3W9JA 2OPSB 1N4LA 3OV7A 1VHFA 3KLGA 1CULA 4LF2A 3RZAA 1HNZF 1HBUB 1Q78A 1NPRA 1FRXA 3PKMA 2XHCA 2LA4A 3HHLC 2QL5B 2ZH7A 4B3SJ 2MHEA 2CZ9A 4NA1A 2VIHA 1U0HB 2I1RA 1QVFR 4G1IA 1NDPA 5K8OA 2IVFB 1S4FA 3D68A 4G1PA 1VQLS 3J80Y 1N5YA 4JI5J 2HZVA 4F3OA 1HPZA 4LF5J 2HNYB 4K0KJ 1R27B 2ZUGA 3BDEA 1S7IA 4ZCKA 3RBEA 1U2CA 4OV6A 2J9DA 2HQCA 3CMAS 2IYGA 2W9BB 2QV6A 4NI2A 1W7WA 5LL6d 4PRFA 2MZQA 1A9NB 2I5JB 2FGCA 1NXIA 1RWNB 2OD4A 3FMWA 2UXDJ 2X7IA 3HLUA 5CXTA 3EXCX 4WIQA 1JX4A 1SKRA 1NAQA 3MMBA 2CPEA 5HLFB 2YWKA 3K89A 2BDPA 2R7WA 2IJFA 5KFDA 1DTTA 4O23A 4MK9A 3WBZA 4I4BA 2R8JA 1SI9A 2V8PA 3CE8A 2V2KA 4CLFA 2BKNA 2CG8A 1S9EB 2MKYA 3ZTPA 4GVBB 3C6UB 1UPMB 4PCQA 1TL7B 4C8KA 4Q8EA 3R7BB 3LWLA 2J0SD 1UFLA 4NXMF 3JSBA 3M32B 4FF4A 5AE1A 2YNIA 4WXOA 1WC0A 1EP4A 1N6QB 2HRYA 3OL8A 2EK6A 4I56A 2V67A 3C19A 1E6VB 3SQOP 3V6HA 2BM1A 2VFRA 3R5JB 4NCBA 4KC5A 1E6YB 1WF1A 2DNMA 2ASYA 3LA0A 4AQYJ 2BW2A 4M94A 3RBDA 2AT1B 3L9ZA 1LW2B 5GAEI 3GE9A 2CQCA 2LP4A 3ITHA 5D4OA 4ZN1A 1FO1A 1I94F 1T7PA 1XERA 4LQ3A 4OHWA 4WWSA 4QZVB 4NLWA 5HJXA 2VG7A 3CB4A 3Q8YA 4BC9A 1RXOB 1NSPA 1EQ0A 3HKWA 1VQMS 3AJDA 5HL7Q 2J9EA 4B3RF 3J81Y 2FB0A 5G4DA 1VRTA 2DNYA 3DM2A 1SV5B 4YR3A 5J1NA 3T9ZA 4AUKA 4EU0A 4NE9C 5CZVA 1PBUA 4DZ6A 4WP8A 4LSNA 3A12A 4B3OA 3AOBA 4KTQA 3I0SA 2LU2A 1M5VC 2QLWA 1TAUA 1UJ6A 2CPHA 1LEOA 5BR8F 4OZLA 3O3LA 4O44B 4JI1F 2YNHB 2JFDA 3BN7A 1JKHA 1VRUA 3ZZZA 1N5VA 5IQ6A 1WHYA 1Z1ZA 4RW7A 1OY6A 1J27A 2ZH6A 1PGZA 1S1UA 2UVRA 2FDNA 1S76D 4ES1A 1XR6A 2JFKA 2N7YA 3VAGA 4ID8A 4NA2A 3CNQP 2WVCA 4H4KC 3S7RA 2FVPA 1T94A 1F1BB 1XMOJ 3QJJA 2MLYA 4ZN3A 2CJXB 2GVDB 4KGXB 3FSYA 2RRNA 2EC0A 3P8BB 1VGYA 4ID5B 1RJJA 2ZH4A 2AYMA 4O3RA 4WKYA 3OFHA 3OFEA 4RX6A 2PN6A 2HHUA 1Y5NB 4CP5A 2L9DA 1GAOA 1MG7A 3GJRB 4OHXA 4WF9Q 5A76A 2LYVA 1BXNA 5AXNA 4EI2A 4OZ2A 3CIMA 3TJ8A 3LP1A 4K59A 1LOUA 5CQGA 2XMKA 4M5LA 1PO6A 5J1PA 3M9OB 2ZE2A 3U1LA 1SH2A 5A0YB 1H6KX 2QA4G 3RGIA 2LECA 2R7QA 3A4TA 3TUJC 1XNQF 2GJ2A 4OYMA 2QL9B 3I4PA 2B7CB 3OSPA 3HHLD 4A8OA 3SSQA 4JI7F 2HFSA 3QT8A 1Q7LB 3E3XA 2X1GA 2MDAA 4EBDA 2DNHA 1QY7A 2GV1A 2OP5A 3PX0A 2XYHB 4LFCJ 1D0EA 5LT5A 3CXCR 1X0FA 5JMNA 3C66A 3W8PA 2ZZMA 4F36A 4UUXA 1FTRA 2DNGA 1TL1B 2VJVA 3KUGA 3DDIA 4R0JA 2QLBB 3GFHA 5F3ZA 4RW4B 2RT3A 2E7WA 2VPWB 3M8PB 4JYAJ 2C2ZB 2RSQA 3WX8A 4FXVA 3AD7C 1B0VA 3FFIB 5KFZA 3FEZA 1NCLA 2HVHA 1GNKA 1H2UX 1AB8A 1X4HA 3X1LB 1SQFA 4CO5A 5K8NA 3AH6A 3G8SA 4FYDA 3I4HX 1URRA 1FXRA 1QM9A 3DLEA 2FLOA 4P74A 4RUHA 2BRLA 2AD9A 3MCSA 3P3DA 3EYZA 4PUOB 1ZYQA 2BQRA 5K14A 2GQ2A 1X4GA 1M90T 1TL5A 3P45B 3RUBL 1DLOB 2OPSA 4A47A 2VKZG 4DHVA 1HBUA 1S0VA 2M70A 4FS2A 1RBOB 4F3MA 1RE1B 2J6TA 4YDDB 1Q8IA 4DR4F 3LANA 2P9EA 4RW6B 4UOGA 1WEXA 4K4VA 2MYFA 4DL0C 5D78A 1U0HA 3PX4A 4USUA 4DLGA 4ZVSB 1PC4A 2BEFA 3K5OA 2MQ8A 4DL3A 3L09A 1GTEA 3AOAA 2QA4S 1J5EF 4WZQA 3Q22A 4L3NA 3LGMA 1CPZA 2XSFA 1B7YB 1T9WA 2FTRA 3RAMA 2UXCF 2J6SA 5E33A 2FZKB 1RU2A 1K0VA 2W9BA 5LXRA 1HARA 3CJRA 1Y3JA 2LXUA 3DU5A 5D0GA 3BGRA 1VYAA 2LEPA 1IXKA 2GQQA 3CJQA 1YVFA 2I5JA 3RU0A 1KD1T 2JEJA 1X4DA 4RU9A 4G65A 5DQGA 1CQNA 4CQ1A 1U25A 1XBWA 2W9CB 5I3UB 2NLWA 3M2VB 4KBIA 2FHMA 4LFAF 2ASDA 2RAQA 5ETPA 4YDXA 4DUYF 4OYBA 4ZK7M 4ZJQA 3BGOP 2IHR1 4RW8B 3U27A 4DFPA 4I0WA 4DR7J 3TW0A 3IAM9 5DZ7A 2F5GA 4B3TF 1L3KA 1Y0HA 4EEYA 2ADCA 1S97A 3ELHA 1WOPA 5B0GA 1AYEA 5KFYA 1K47A 3M6UA 1TKTA 3PTWA 4OYPA 4GVBA 3C6UA 2V6AA 3ZFVA 1TL7A 1RWPB 2WVEA 3AD9C 3KJQB 4JV2A 2DK2A 2G2YA 1VC6A 2G0IA 1LFWA 4ZPAA 4XO0A 1XC9A 5MAOA 3MM8A 1S4EA 4L74A 1R8PA 1T9TA 3MD1A 1E6VA 4P2SA 3WIVA 3P49B 1F5CA 1RT3B 4E98A 5I3QA 5D6GA 3CCWA 1SBRA 4M5JA 2W01A 2WVDA 4J90A 4ZVFA 2CRLA 2B5JA 2QLJB 1IR0A 5LM7E 2FLNA 2K3KA 3NG8A 4DI6A 1JNZB 2CPZA 3A3OB 3DRYA 1KDNA 4ZKAA 1VBZA 1VQSA 1YRTA 2NXJA 3OR2B 1YGYA 2NPIA 1Q4RA 4C0OC 3RBXA 1KFSA 2XSJA 3N28A 2VPZB 2KHCA 2E1RA 1PAUB 4W92B 4ECXA 2FHKA 4WFYA 4IFYB 3AOCA 4WIIA 5E3PA 3RAQA 1NDLA 2XYPB 4LUBA 1VJWA 1B3TA 4QBUA 6AT1B 1GXTA 5KG1A 2OPRB 4OX6A 2FVQA 3EICA 2HK2A 4A8XA 4CH7A 1SV5A 1NLKL 3FSXA 3CMQA 3K57A 3A8KA 4LSZB 3U02A 2KJWA 2YKAA 3AB2B 3KG1A 2HQDA 4DV1J 3TWZA 4O44A 1U1PA 3M30B 4CIOA 3LGHA 3L7UA 3MGJA 4CZCA 2Z4PA 4DL6A 1TK0A 4X4NA 2IC3B 2NPFA 2F40A 3GILA 2DXEA 4GC7A 3K5NA 2W24A 2CZVC 1BWEA 5GAGU 2KO1A 4TQSA 3PEJA 4NASA 4IR9A 4CNYA 4I64A 2IBOA 2GVDA 3NGDA 1T9UA 4DR1F 1N36F 3LALA 3Q8SB 4I68A 3SCLE 3HD1A 4HT7A 3D6HB 2K8GA 4ID5A 2KH9A 4YS2A 2NXNA 1HBMA 2H48B 1FX2A 4ENOA 4NLGA 3IWXA 4OYZA 4U96A 2AZ3A 4G3IA 2VUGA 3UVJB 2VA3A 4KGKA 2Y0BB 2A6OA 2FC9A 3VQTA 4DV2F 3HZEA 2R8IA 3CDWA 4HI2A 1TVRB 3U1NA 3UQSA 4KQZA 4WFNQ 5A0YA 2J7KA 4YOEA 5J2PB 1SH0A 3KG0A 3A1YG 4L73A 1UAWA 2VBZA 1U4BA 1KQGB 3M05A 2E5LF 3TZXA 3E51A 4EYIB 4ED6A 4A4JA 1CJUB 3R97A 5B0AA 4C8YA 1RACB 3F44A 4TKTA 3CO0P 1YBAA 2ZDPA 5J1EB 3VAFA 4C8ZA 4ZIWA 4R8UB 2DCUB 3OHAA 3A8JA 3RR7A 2J7WA 4ZVQB 5HQ8A 4HLBA 4DSJA 1YLXA 4ZP7A 3IG1A 4K4TA 4ECSA 4CO4A 2B6AB 1S48A 1TL1A 2QIFA 4QPTA 3V4MA 2GVZB 4CT9A 1P1TA 3ZZUA 4RW4A 3MM5A 1FDBA 1HD0A 2CJBA 1TAQA 5ETQA 1HBNA 5HBMA 2PMZD 3DGVA 3M8PA 4YY3F 1WDDA 1UTAA 3M2RB 2XNQA 5D3GB 1SPBP 5IT9Y 2ZBQA 1IBMF 3P96A 1JLBB 4F2RA 3DU6A 2XYGB 1AFJA 2GZOA 4ETXA 1BQNB 1WOSA 1T9VA 9ATCB 2X1BA 1HW8A 1VC0A 5A2QU 4P71A 3PV8A 3HSGA 3CJ3A 2DR7A 1YJWS 4PUOA 2W2QP 4MKAA 2V8DA 4PG8A 1YKWA 4AT1B 1DLOA 4IYQA 1JMTA 1SC6A 4UQTA 4C48A 3S01A 2F3JA 1K44A 1OQ3A 4K2JA 3KK2A 3GLJA 5KFIA 5GAGI 2K7KA 1FRJA 1NSKL 4RW6A 2Z2LA 1UWAA 1YWXA 5LJ5Y 2AP6A 4RR5A 2DNZA 1RT5B 2YKQA 4X2BA 2M7SA 3MFIA 1Q1KA 2XY6A 3ZTQA 2HWTA 4WU3A 3DLJA 4MTPA 4Y2KA 5IS2A 2VDIA 4PWDB 2JX2A 4JUZA 1O5JA 4DCPB 3MR5A 4ERDA 2G0JA 2OFGX 5K8PA 4HI1A 4OZNA 5HMZA 4TLQA 4Z37A 4HKQA 1S0MA 4NMXA 3ETMA 4ZPTR 1XR5A 2CVIA 2OEJA 3UD4P 1XR7A 5LXYA 5IXUA 1JJCB 5FLXU 2FVRA 4DLEA 2C2OB 4U9RA 4LMZA 4UOHA 2I8EA 4J9PA 3V6DB 1S1VB 2DGUA 5IZHA 2OH2A 4YB6A 4QCLA 1YJRA 2JLEA 3M2VA 3PFOA 3FK4A 1V6HA 4N8OA 1WELA 2F7VA 2FJAB 5RUBA 1RAFB 4EWTA 4RW8A 4B3SF 3QFHA 2H4YB 5KFCA 1WSVA 2MKCA 1Q8LA 3V6KA 3R5CA 3W5YA 3OW2R 1S0OA 2HLTA 4PKDB 4JI5F 2GO8A 2IJNA 3SEOA 3OL7A 2J0WA 4FF2A 2COLA 1PSDA 2CPJA 4LF5F 1D09B 2V69A 2HSEB 3CT9A 3BSNA 4JI4F 4LR7A 4A48A 4FKXA 3IR6B 2UVWA 3JAMU 2K7JA 1XJWB 1KHVA 4EUVA 5HSPA 2CQGA 3H4DA 3MR3A 5F9NA 4LJMA 4XTTA 2D3ZA 4BBYA 1G2EA 3POTB 2BR0A 3UWTA 5JUMA 4XDDA 3QRPA 3QAUA 1PJ6A 2QYCA 3B4MA 5JXSA 1Q82T 1UP1A 3UNYA 3CCLS 1VQOS 2PO4A 1CSJA 2EBEA 1RT3A 5DM6Q 2W2MP 2ACMA 1U1MA 4Y2CA 2FHOB 2HMIA 4EYHB 3T6BA 4ZA1A 4CH1A 1U6BA 2Q79A 3T5LA 3N9UC 2ZJQQ 3FQKA 4CRJA 3GZ7A 1YIJS 3I56S 2QLXA 1RT7A 2DKOB 1UEUA 2AJ4A 3OR2A 2M52A 1TZ0A 5HROA 5DDOC 2G2ZA 2RDIA 2ASJA 2B0GA 2X1FA 4GKKJ 3O44A 2B9EA 1U24A 4PQUA 4OFZA 3CJ0A 1KLMB 2X3GA 4IFYA 3OFFA 2NREA 2VQEJ 1VI7A 3ZZ0A 3DLKA 1AXQA 2ZC4A 1O0PA 2HFZA 2RE1A 2OPRA 1S6UA 4GKJJ 2GHPA 2J7UA 3MPWA 1TUWA 3PACA 1WC4A 5E3RA 3LAMA 2A18A 5T14A 1KONA 4W90B 1R0AA 3MM9B 2RQKA 3C6TB 4IH6A 4Y00A 4MKYA 4NPOA 3BSCA 1RB0A 3ISNC 4LQ9A 1P9QC 3GTYX 1YRXA 4K2XA 4DV5F 2VQFJ 1DHMA 2JJ4D 4UTGA 4N76A 1S1WA 4IRKA 2ASLA 5KT5A 4A46A 2IC3A 2UV8G 4NLXA 1JLQB 4JV5J 2L9NA 1OS5A 4DR3J 2CWXA 3W65A 2RF2A 3M8QB 2HIQA 4JBCA 5F8IA 1RK8A 4DFKA 2U2FA 3T1YJ 3TP2A 2CQ4A 5K8MA 3CPWR 4ZP8A 3TANA 3IC1A 1RDRA 2N4CA 3GSDA 3IBFB 4OHYA 5D4PA 5HQMA 3DOMB 2K1RB 2JSXA 4DR6J 2WVFA 2IAJB 4RBTA 4U8YA 2M2BA 3EDQB 3MDFA 4Q5VA 3S6EA 2JWNA 3UVJA 1VISA 1HQUB 1RTHB 2H65B 5DGAA 3W2VA 2RS8A 4RW9B 3PM9A 2IMWP 1VBKA 2XMUA 1N48A 1KRPA 3NGSA 2QYGA 2CKWA 1TVRA 1UEVA 1FNOA 2VJUA 2E7XA 1OYEA 3UNGC 4X4SA 3VAHA 3O8WA 1VQYA 1LWXA 3G2XA 3R7SB 3MMAA 1KSPA 3AB4B 3IBCB 1C0TB 1UEKA 4HH1A 5J2PA 2DY1A 4MT1A 3M7VA 3DLLQ 5F3TA 3FKBA 2V4QA 2KFZA 4IO1A 1RYSA 4U6PA 2BJ7A 5J1EA 2RRBA 5GMDA 1UZHA 4NYZA 2OO4A 1RT6A 5J2QB 1WF2A 4KY3A 2HWIA 2AKWB 3E8OA 2HURA 2HS0A 3RW6A 3A8EA 2N3OA 4YB1P 4C97A 2PT0A 2CJAA 3KNAA 3CCRS 3DLGB 3KLVA 2C2EA 2B6AA 1G4CA 1NO8A 5DDQC 2GVZA 3V81B 2AEJA 1U02A 1K1QA 2J8AA 1Q95G 2KZZA 1NJYA 2KG1A 2UUWA 2BKOA 1KKHA 5BYQA 1M1KT 3M1VA 5LSRA 2EKYA 4I6WA 1JLBA 3CJKB 4LF7F 3V2UC 4LF9J 4X84A 1J5OA 3FVYA 2CJQA 3I0RB 1T0TV 1HNVB 1TU0B 4JV0A 2DNLA 1X9SA 3MM7B 1U45A 5GAHU 4B9SA 2MKJA 1M5SA 3Q23A 3DNCA 4OQJA 4W98A 1FRKA 4M5KA 4EO6A 2OD6A 1N8RT 2JEFA 4M1KA 2H3EB 3NEKA 4Q45A 4P2FA 2RKIB 2XO7A 2HHHJ 4C0HA 3MUMP 4LFCF 1NJWA 3PNIA 1ZETA 5HJYA 1S9FA 2HAIA 4ED3A 3TRGA 2VH7A 1TUVA 1FCAA 1XN9A 5DGBA 3TARA 1RT5A 3Q24A 2FPHX 4U7UK 2ZHBA 3LO3A 1UW9A 2CPFA 4J9NA 3J7ZT 4PWDA 3JSMB 4ETZA 4LR8A 2EXUA 1JLAB 2KTQA 1YI2S 2WSCC 4WJBA 2HGLA 1SC3B 3C14B 4OI6A 3R5DA 1X5PA 4OZ5A 1YBUA 4RWWA 4WYWA 1TFYA 3GYNA 3UN3A 1QJHA 3G8TA 4H54A 1KVKA 1X9MA 1RAAB 4TU7A 5D4NA 1S1VA 4RNOA 1MU2A 2HFOA 1UL3A 1UETA 4CM0A 3KUEA 3QT7A 2IIHA 4A8FA 4USWA 3TZYA 1FXLA 5T7LB 3QMQA 1F6TA 3JYTA 2MZRA 4DEZA 3QQCD 1Q8KA 1U49A 1A0OB 1BLUA 2MQMA 3KDNA 4UQGA 5BYSA 5E7OB 2DEJA 3PW0A 4NCGB 4GVLA 1VQPS 4Y34A 1P1LA 4LF8F 4IQXA 3HHKA 4WFBQ 4NEYA 3ILIA 5HO4A 3IXQA 4AL7A 1Z2ZA 5IV3A 2V8VA 2R9LA 1EKRA 2EC2A 3ISND 1CC7A 4F04B 3JTOA 1FHTA 4X4VA 1J2VA 2B4OA 4FPIA 1MROA 3QGIA 3NY0A 4AXIA 3D6MB 4Q2MA 5LSOA 2OUGA 2ZM6J 5F8LA 2Z2ZA 4F4YA 4PG7A 4OI0A 4DSIA 5AJ3J 2XZTB 3BGFA 2OSQA 1N34J 3N6NA 1RHMB 3UE2A 5GAHI 3CUNA 1F60B 3KUHA 4FP9A 3EVWA 3AJ1A 4IRDA 3NWRA 4X65F 3UN5A 3GYGA 2NUHA 4UT4A 2DHHA 1I6JA 1HNWJ 1BGXT 3TVZA 2BM0A 4B9VA 4D3HA 3T6JA 3GFXA 2Y3YA 1Q86T 4RZRA 5B09A 4QPXA 2XGPA 3QT5A 1Z2LA 1W26A 1KLMA 3BPDA 2YNFB 4ZOSA 1LWFB 1L3UA 4RBUA 4AYBD 2OTJS 2NQPA 3NP5A 2BJ9A 4DS5A 4OL8A 3KMQA 2VOPA 2BANB 2F9JA 1K9MT 3MEKA 2AEMA 2W4DA 1FX4A 1FDAA 3P4UB 1SJ3P 3BGUA 3C6TA 4LR9A 1WF0A 2RH3A 3ZNUA 1N5QA 4HEA9 3AT1B 4WK3A 4DX8H 1HKAA 3QZ7A 3MR2A 2KRBA 3D54A 3QGGA 1RT1A 2WONA 2FYXA 5JVGQ 2R7OA 2IDEA 1F2GA 1ROFA 2MJNA 4ZIVA 3MXHP 1RTJB 1JLQA 4K4UA 2VONA 2DHSA 3B82A 2R2UA 3G8QA 3FBFA 3M8QA 4DUZJ 3CVKA 4M5NA 1R0CB 4NLQA 1NKBA 3KG4A 2XMVA 2LDYA 2UUAJ 3NNHA 2JZ5A 3QJLA 1UA1A 4P2XA 3NAIA 1K8AT 4XPCA 3DOMA 7AT1B 3Q83A 2VD3A 1PKUA 3QZ8A 5B0BA 2IAJA 2CIMA 4ZLNA 3GIJA 2ATLA 4GO5X 2XI3A 2V4RA 2CJYB 1RUSA 1WG1A 1HQUA 3UCUP 4F4XA 2MQNA 4RW9A 4HT5A 3D5MA 2DJWA 4MIBA 5KFNA 2D69A 1HNIA 2G2OA 5HQLA 1C0TA 1JJ4A 5GADU 4XPEA 1U2FA 1FJ7A 4DV4F 5KG7A 3EZOA 3GCWP 3IMQJ 3KHRA 3VCDA 3SCIE 1IQZA 3BN4A 4N7TA 5K9FA 5B08A 3Q89A 4ECYA 1UVIA 1SC1B 4RPFA 1VR6A 2CJ9A 1CVJA 3H5XA 5EDWA 2CWKA 3OVSA 2R2TA 3WIUA 3DOLA 2HBZB 2QSWA 2C2KB 2LXIA 4O3OA 2LU1A 2WCXA 2GHVC 3WQPA 3FCHA 3US5A 1QAJA 1HYSB 3IRXB 2OEKA 1N52B 1YJUA 1FNMA 4XDCA 4FYYB 2N3LA 1KFDA 1RAEB 1REGX 1BHNA 3E01A 3GFYA 1HQEA 3O2IA 1VLOA 3QIPB 3CJKA 1O51A 1ZM2A 3MR6A 2DNRA 3I0RA 1HNVA 2CNLB 2Z8QA 5ETRA 1ZS6A 1S1XA 2RU3A 3MM7A 1F2HA 3TAQA 3T3FA 1HA1A 2XMAA 1WKLA 4X62F 3U1MA 2CPYA 4R0EA 2BZ2A 4YR2A 5KFQA 1X5TA 4AE5A 1CS4A 4FVCA 2EW9A 3W9IA 1R6VA 3MPUB 3G82B 3MAAA 2DGTA 3IS9A 1NK4A 4PZVA 4N77A 2V63A 1RWMB 2XMMA 3HX9A 3CDAA 2YKMA 4F50A 5H1SV 2BQUA 3D66A 2WAQD 3ZTSA 3SI8A 4IRCA 4OLPA 2YH0A 2QA1A 1TKZB 4UY8T 3ENAA 1PG5B 3V6JA 4K5SA 4CLYA 4BWJA 4USVA 5CD4A 2VFUA 3IR5B 3GYXB 3C14A 3OVBA 2OKQA 2P9GA 3DMJB 3HSZA 4DFMA 4O3PA 5KFVA 3PR5B 3UO0A 3DRRB 2F4FA 1KN6A 1R0BG 3VTIA 1WI8A 1FFWB 4J5OA 5CCLA 1VIOA 2RUSA 2F63A 1SKSA 3UR0A 2ZJRQ 1RZMA 4DV7F 2P2CB 3PYDA 4XK8C 4A8QA 2K3IA 3E2EA 3VHQA 2OPQB 2Z2YB 3TX8A 3PW5A 2ZH1A 2C3OA 1YITS 3H2LA 3ET6A 4M5DB 5DG7A 4IG3B 5A2QY 3HMJG 4DR5F 2QG9B 5KOWA 2CZ4A 2HQFA 4J9QA 5GADI 2C3MA 1FKOB 2PI4A 1DURA 2W7PA 3KK1B 3EVOA 2HBQB 2AJ2A 5IWAJ 2MKKA 4TY8B 2YKPA 2DEIA 4JOUA 5C24B 2UU9J 1DRZA 4DBQA 1OY9A 5KFGA 5IQQA 3R8YA 3EVMA 1HWUA 2J9CA 1CJVA 2EFVA 4B3MJ 5FDLB 2RDJA 2RHQB 2MQLA 3OPKA 3W9HA 2RUGA 5M2PA 2KFNA 1S6OA 1X4EA 2GFFA 3EUNA 1UWBA 4LF4J 1T11A 3UDCA 5HMWA 4NYOA 3RTVA 4TXSA 5DRKA 4U95A 4QIEA 3WX4A 3VGSA 3QFWA 3KYLA 5KFWA 2EFNA 2DRDA 2D1CA 2ZWPA 4P75A 3C16B 5FLXY 3W61A 3FJ2A 4ZVGA 3LP0B 1OWXA 4NRUA 2Y1JA 3M2UA 5HI7A 3TAPA 4DXLA 4PG4A 3FEXB 5KFHA 3H40A 3PXGa 4S0MA 1KTVA 5D0RA 4ZPBA 2B8PA 4DV0J 3BBCA 2XS2A 2M3DA 4CT8A 2JVOA 3NGUA 4FXDA 2EFPA 2DB1A 2HVDA 4CO3A 4OLOA 3Q86A 1CJKA 4CO2A 4OYXA 2MTLA 5KAKA 4DS4A 1C4CA 2YNFA 1MWYA 2LQ8A 1UJ4A 2BRKA 1M5HA 1EQMA 3H42A 1NK7A 1RKJA 4CCHA 4AL5A 3KLIA 5C2CA 2BANA 1PBAA 3L7OA 2GJIA 3JAMY 2QX0A 2GIRA 3TEHB 3DRSB 4RO0A 2MB0B 2SXLA 1ELOA 2CQDA 3T1HJ 1FK9B 1HMVB 4BC7A 3HCXA 4RJVA 4MFBB 1WTBA 5T41A 5KFBA 4LIRA 4AXJA 3F41A 3W1YC 1SKUB 3PO4A 4DL5A 4DDFA 5CH7B 4WKRA 4TYBA 4JI2F 1TFWA 3SXLA 3TVKA 1BQMB 5FD1A 3OHBA 4HL9A 4LSLA 3HI9A 1OSCA 2YH1A 4HH0A 2DNOA 2C42A 3C46A 4OX9F 1FJCA 1S9GA 2PFFB 1R7IA 2J0QD 1YG0A 3TZZA 1S77D 4GMKA 3ZTOA 1D9FA 1RHQB 1QAXA 1CJTB 3IN5A 4NL5A 5DZ6A 1UKUA 2IMOA 5D77A 4WZMA 3WZ0A 2D74B 5ADZA 1DFDA 2YWFA 2QRRA 2N4DA 1N0UA 3ZZYA 5ETTA 1DJ0A 1VK3A 1TV6A 3DI6B 3I9V9 4RU2A 2PC6A 4NX9A 1QUPA 2B4UA 3K17A 4UUWA 2XULA 4A8YA 2KB2A 4KH0B 1GXLA 1LKZA 2MHNA 2VC1A 2KDOA 4JV5F 5LMUF 5J2MB 4HACB 3OL6A 1AA1B 3MCMA 3RB6A 1XIQA 3GV5B 5A8RB 1FXDA 3T1YF 2E9TA 4ZS6A 2XNRA 2F8MA 1N33F 1NBEB 2VG5B 4UOFA 1N56A 5KG0A 4Y2MA 4ZVHA 2GIQA 1FJEB 1ZA1B 4I6YA 3UN2A 2CDRB 2VICA 4B9MA 2OFHX 1NK6A 3H90A 1H38A 4B9TA 2J6UA 3L3CA 2DR8A 4H4OB 1IKWB 1HYSA 1SL1A 1NJXA 1HI8A 1RT2A 2MPUA 2LQBA 4RNHA 1YZ7A 2FJEB 1VCTA 1R43A 3B8HA 3MFHA 3QIPA 4A8KA 4DOZA 4TY9A 4DG1B 3TYTA 1DQ8A 1AZSB 1FWLA 3ZZOA 1LXJA 4NZ7A 3DFEA 3M6WA 2IRXA 2X3DA 5F9LA 1WI6A 1KQSR 5KT3A 2R7UA 3PRBA 2KXHA 5KFTA 4KFBB 3G82A 2ZBPA 5KFKA 4CLSA 3HVRA 5AXKA 4ZPWR 2HG4A 3GG0A 2E5JA 2AX1A 1W25A 2DVIA 2MKHA 2MY7A 3LPEA 4CH0S 3AQPA 5B0EA 2AYGA 2XTJP 2WRMA 1AUSL 4P52A 2XLJA 1TKZA 3G9CA 2ZBIA 1BY9A 4NXMJ 3D6FB 4KHRA 2DYAA 3NGRA 4DPOA 1BE4A 4GO7X 3MWBA 1OQ6A 2G13A 3TQ1A 1AT1B 2DR9A 3UDLA 3W2WB 3MOZA 2ROGA 1T9XA 4C2MA 3SCKE 3CDUA 3DXBA 5C25B 4NOHA 3DRRA 1X4BA 3OTBA 3OTDA 2ZH5A 2EFOA 2HVEA 1U47A 3RR8A 5IV4A 2DGXA 4TN2A 4KHPJ 2I6WA 3MAQA 2ACYA 3RAXA 1IQTA 3NGTA 5A8WB 1RAJA 1HL6A 3NRBA 1XNRF 4M5DA 3G96A 1UFKA 4PYAA 1SUQB 1FKOA 5L8RC 3VAMA 4OV1A 3KK1A 2ZHOA 4YFUA 4NXNF 2BOAA 1JNRB 1NMEB 2QMXA 1QSYA 5C24A 1T02A 1I51B 1YJTA 3IFEA 1PC5A 2KVQE 3B54A 1O6XA 4WFAQ 5LOQA 1NJZA 4UZBA 4V1Ak 5C42B 4FN5A 4DPYA 2NCKL 4LVOP 5FDLA 5CYQB 1MWZA 3BEGB 3T1AA 1Q5VA 3C3LA 5M2UA 4Q0BB 2R7XA 4NA3A 3TAMA 2MKIA 1C0UA 2G9OA 1RLDA 4G6VB 1YBTA 1C1BB 3OJUA 4JB8B 4DF8A 2AYBA 1RTDB 2C3YA 4LFBF 5HVFA 1OSDA 4ZLLA 2WW4A 3C16A 1M1HA 3MD3A 4QU7A 4QJVA 2A2CA 3VGUA 3N01A 1U1OA 3B4DA 1RU1A 4IOBA 1UVNA 2Q1LA 4X4QA 1AROP 4CLWA 1O8BA 4ANCA 3PY8A 3G6XA 3OQ2A 4ZVRB 3GV7B 3FBBA 5KOXA 1C4AA 3UFCX 2H1YA 3M9MB 3R5BA 2AW0A 2LA6A 3PR4A 2BYCA 1RWOB 1HBOA 1RT4B 2D41A 4CO0A 4CYUB 1LQ9A 2QTWA 3HVTA 3AD8C 1X7VA 4NLYA 5KFLA 1JXVA 1RTIB 4ELTA 3MUVP 3MZIA 4X4OA 4I2QB 1ZM9A 1WG4A 5GVQA 2GC8A 2Y9HA 2FHJA 2MLXA 4MIAA 2ZM6F 2XC9A 1T3OA 3DRSA 1S10A 2UUBJ 3I55S 1L3TA 5ETKA 8AT1B 1XNQJ 4URQU 1EX8A 1DAXA 5AJ3F 4DV3F 2G4BA 2E66A 3CEDA 1N34F 2HW3A 1HIYA 3M4XA 1XMQF 2RVJA 4DL4A 4ED8A 1T03B 1FK9A 1HMVA 4JI7J 3S1TA 4I7FB 2V2QA 2BJDA 5F41A 4J9VA 2FVCA 2KT2A 1VLYA 3KJVA 3UD5A 4TLRA 4A8MP 4USTA 1HNWF 1HI0P 4Y2AA 1VQ8S 3FMBA 2P9CA 4G1QB 4I2PB 3W62A 4C3LA 1WC1A 1MWQA 1UVLA 1Q7YT 1Y9OA 1U2RA 3LP2B 4DL2A 3BBFA 1M5OC 2HEKA 3PYEA 2ZJPQ 4RUAA 3LWMA 4BLGA 2YVSA 1KR4A 5CA5A 3W3SA 4K4SA 4OJGA 2IJRA 2Y8YA 1FD2A 2BW7A 2DGQA 4W4MA 2H5IB 1FESA 2J0XA 2UUCF 3Q8QB 5G0RB 1LWCA 2ADBA 3KHHA 1GMVA 2E5IA 3FRYA 2WHOA 2XBPA 4FDFA 1RAGB 3TA0A 2VG6A 4OI3A 4DJBA 2KL8A 2HWHA 1RAIB 4FXWA 1HHTP 5FJ4A 3BB5A 1K73T 2CAJA 4DX7A 2B4VA 3MMCB 1L5UA 5J2MA 1WJ9A 4HACA 5EWGA 4O4GB 1IKXB 2XGQA 4IOAQ 1G6BA 4QYZK 5A8RA 4UF4A 2IY5B 2VG5A 1FRLA 5LMNJ 2L9WA 3QRRA 2QN6B 2HZCA 5C5JA 3CCSS 1NDKA 1VBYA 4IFVA 2QFIA 5DLGA 3AODA 1IUJA 1JK9B 4DPTA 3TA1A 2VBYA 3C15B 2ZNZA 2H54B 3ICLA 1IKWA 2BE2B 4RKUC 4E0DA 4FNHA 3GP9A 1IBKF 2PD1A 2NR0A 3W5ZA 1S49A 3JTNA 5CHCB 4TYAA 1A7GE 2LFVA 4ED4A 2DHXA 3GQCA 1ACMB 2IYIA 3EJMA 3L95X 3HT0A 1QDUB 4DUYJ 1OMSA 2KT3A 4JP8A 1X4AA 5HMYA 3IM9A 4LF1A 2DNQA 3HJVA 3LTOA 4LF6J 2VDHA 1R8BA 3I96A 3D9BA 2LEBA 4DN9A 4B3TJ 4EO8A 1V5VA 1U8SA 2FY1A 3MOJB 3SZ2A 2J9DE 1FD8A 4Q8FA 2XMWA 3MAHA 1HPZB 2UZAA 3K8WA 2B3TB 1S72S 6FD1A 2W4CA 1FRHA 3HSDA 5C7PA 1HI1A 4LBIA 3N79A 4TQRA 3HK2A 3NOCA 2MGZB 3VQSA 2P6TA 4P7TA 3CD5A 3R2CJ 3ILLA 3AA8A 1VK8A 2R2RA 2HNYA 1H2TZ 2XQCA 3GIKA 2AIRB 4I1TA 4EFAC 5CCMA 2DISA 3DDNA 1G1XA 4ZITA 3LUYA 1N32J 2DH9A 3THTA 4ECZA 2BV3A 3K59A 1YK9A 5F0WA 1TKXB 5C25A 4HR2A 1S0NA 4DZDA 2UXBF 4X66F 1GMUA 2BVZA 2ZZNA 3CJ8A 1P8GA 2J8SA 1IN0A 3THPA 1T8EA 1HR0F 3JB9k 3GR0A 2CYYA 5IC6B 2ZH8A 4KT0C 2YQ1A 3RW7A 5HLFA 3NS5A 5A8WA 1HNXJ 5KT2A 1VQ9S 2ROPA 2D9OA 3F73A 1EARA 4P10A 3IGVA 1NH8A 3CJ2A 2OLWA 2CQ2A 1Y5IB 5EN1A 2W7OA 2BX6A 2ZFHA 2F1FA 4P2MA 1N88A 2VF3A 1IBCB 1JLEB 1S9EA 1H7WA 4DQQA 1EP4B 3J7YU 2IRUA 2RDDA 1UFWA 3ZZTA 4HDHA 3PJXA 4OHZA 3M32A 3UD3P 3OFGA 4Q0BA 1N6QA 1AUDA 1AFIA 1IKVB 1FJGF 4NLOA 3HP6A 3VAJA 2VZ9A 2L48A 1C1BA 1UVMA 2C2DA 2KG0A 1YJVA 1E6YA 1WC5A 2NZ4A 4P73A 4Y3CA 5F8MA 2XHWA 4ZMMA 1S7HA 5DS7A 1Q16B 2XWYA 4DPWA 4C0BA 2OHDA 4OI2A 1LW2A 4JI0F 1FKAF 2AX0A 5IWAF 2RQCA 1N36J 4LRCA 3CW2C 5ETMA 3FGVA 1VRTB 4DFJA 2GGPB 2XS7A 4OZ3A 1R3NA 2DR5A 2JL9A 3DM2B 3N5BA 5D0EA 2E5HA 4DV6J 4BHQA 1YZ6A 5DQHA 2ZKTA 3FCVA 3SDEB 3B78A 4CYUA 4NCAA 1Q79A 4USJC 3DHXA 1YQHA 1JQGA 4LF4F 3IM8A 1PIEA 1RHJB 3ISZA 3VAIA 3NS6A 4I2QA 2ZVSA 2OEMA 2MQQA 2OMLA 1CQMA 2WZ1A 1OJ4A 1GH8A 1S1UB 4MYUA 1GT8A 4B08A 2JLGA 1M5KC 1VC5A 1SQGA 1DBDA 3BSAA 1GMWA 1Y7PA 2YNHA 4J9RA 2Z2MA 3KFWX 4YHHJ 5DDPC 4X64F 3SMZA 2GIFA 2HRTA 1TL3B 2CVEA 3MCOA 2W8KA 2E5LJ 1L3SA 4A8SA 2LVWA 2YWHA 2MLZA 4I7FA 4PQAA 2FLLA 5CYJA 1FEHA 1NHKL 2KVIA 2XM3A 2R2SA 2QT7A 4CLPA 4DV0F 2HHSA 1WD6A 2HNZB 4ECWA 4HHHA 1ZZFA 3OXFA 2DPIA 3R7NB 2PA8D 4G1QA 1MMDA 3EWGA 1RBAA 4I2PA 4HHUA 2A6MA 2KM8C 5DG8A 2YTCA 4NYPA 2JC0A 3CCTA 4O0NA 1QD1A 4F0MA 4C3KA 1MW7A 4J9UE 3PFEA 3GIRA 2ZH2A 1BQXA 1I5OB 3LP1B 4BS2A 2EBGA 2V2ZA 4KV8B 2FJWA 5AE3A 5KG6A 2XS5A 3HKZD 2OTLS 2PMHA 2ZE2B 4LRAA 1IBMJ 3J7YI 5AE2A 5G0RA 2X51A 3H98A 4LRDA 4WU2A 2MZSA 2R7SA 2FIUA 2HS3A 1VQ7S 1VJQA 3T1HF 1OY8A 2KYZA 2V8HA 3HFKA 2WBMA 2C2MB 1LW0B 4L75A 5BYRA 2MEWA 2JNJA 2NS1B 2Y8WA 1KP6A 5CABA 5C2GA 3FNNA 4F67A 3OJSA 1NDCA 2Q43A 4F0KA 3A8IA 2F4VF 2XZWA 5KTQA 3D7SB 2WSFC 3MMCA 4EZ9A 5ETVA 3OUYB 2MY8A 5E41A 2XCPA 1RSCA 4O4GA 1IKXA 1OIAA 3C2PA 3BYRA 3BQ2A 2YXLA 7FD1A 2WVBA 5AXMA 4URGA 3TUIC 3PYGA 3QLHB 3PIOQ 5AT1B 3LQVA 1KEKA 2BBEA 4CLLA 4MJKA 1WORA 1URNA 2H4WB 2WOMB 3W63A 7FDRA 1XWLA 2ZC3A 3HHNB 4K4XA 2W1BA 4JI8F 2E1PA 4WTYA 2BUNA 3J7A1 2MMYA 1D9AA 1X31C 2YNGB 2BE2A 3FFIA 1P6TA 5HP1B 3VGVA 2LMIA 2FZGB 2PDAA 3GJSB 4U8VA 2B51A 1MSWD 5DG9A 4ECRA 2AF6A 1FWPA 3D3CJ 2XO6A 2KKHA 4TNOA 2AU0A 4NLRA 4KRWA 2OJ3A 4EMDA 4F4KA 1KC8T 2QMWA 3J7Z5 4P72A 3R9LA 4CDIA 2GMLA 4MIWA 2HHPA 4N56A 1V5IB 2QFJA 1XQIA 1CC8A 4ZCIA 3I87A 3W64A 2Y1RI 3TUZC 2KXFA 2LQ5A 4DSLA 4I6AA 3G6VA 2IDLA 2FGOA 4PG5A 2EEYA 4FPRA 3I5BA 4JI4J 3UDEA 2MGZA 1OPIA 1WTFA 2MZJA 2XG8A 3ZZRA 3TQEA 2AGOA 2B56A 1B64A 1WACA 4OYOA 4F4WA 5E0OA 3SCJE 3BGRB 2ZOGA 3OL9A 4LREA 4EK2A 2P8IA 2HQIA 5EX3A 4IG0B 4NEZA 5CAAA 4CM2A 3BM7A 1TKXA 3WC0A 5EGYA 3DRPB 2CNKB 2NYHA 4ECQA 1GTHA 4M5IA 1C2PA 3M8WA 2W9CA 5I3UA 1N54B 1WC3A 3T5JA 3MCNA 1VQKS 4F02A 5E2QA 2FJBB 2IVMA 4WCEQ 2PIIA 4C8MA 3EDRB 4UOCA 2MJUA 4PEOA 1FFSB 1ZM4A 2KXNB 3VAKA 1NKCA 2ZVIA 1TMMA 2F8HA 2HVZA 1TKTB 2QL7B 3R2DJ 1U26A 1IM6A 4NLDA 1F9HA 1QSSA 5JVHQ 2JLFA 4DWIA 4DU7A 3HHLB 1NM2A 2AV5A 1JLEA 4K0KF 2BJ1A 2Q66A 4K7QA 3EM1A 3MM8B 2DITA 3VV2B 4IUFA 2O67A 1PYTA 4NZ0A 4JI3J 4K8RA 3T5KA 4RNFA 4LBPA 2BQ3A 3MR7A 4OZ0A 4OZJA 4Y0FA 3CSKA 4PPZA 5F8NA 1NKEA 2BACA 3HM9A 2FQQB 4IOCQ 1IKVA 3RB4A 1T95A 4J37A 4DV5J 3GJTB 5M2RA 2MZ1A 2DCLA 3P5TL 2UXDF 2VB6A 3OLAA 2B5JB 3D4JA 4KHPF 1JXEA 1GK8A 3A3PB 3OT9A 4JI6J 3TVYA 1RQ0A 5KFUA 1IR1A 3GONA 4EBEA 2LQ9A 2XSJB 3B6BA 1WKJA 3QWPA 2F65A 2KU7A 1IWAA 1B0PA 4WYLA 4ZVPB 3ZXWA 1XEZA 1MN7A 3K7RA 1REVB 2I0XA 2GGPA 3IRWP 1PJ7A 4CNZA 3AXMA 4C11B 2M88A 3TX0A 2HRUA 3NMRA 1RI7A 3D1OA 3D1HA 3G86A 3CDBA 4DL7A 3SDEA 3CCES 3QATA 2VOOA 2ZUAA 2HK3A 2HPUA 1FVSA 3HFZB 1S6PB 3CCQS 3RBZA 4HTIA 3ADAC 2FLPA 3LGNA 5F8JA 3D0IE 5DETA 2V4JB 2GQCA 2YPZA 3HFVA 5KFXA 4ECUA 3DKDA 1OYDA 4OYAA 3V4IB 2E1AA 3PW4A 1KVJA 3VGTA 1RWXB 3M30A 4ZJLA 4AQYF 3GIIA 2OSRA 4F3QA 3G87A 1QAIA 1TL3A 4NLPA 1H98A 4KSEB 2JOQA 2C22A 3MPYA 2WB1D 5A6WA 1JLFB 1NK0A 5IOLA 2ZBRA 3GCXP 2EK1A 1IWGA 2AYEA 1JWWA 3ZO7A 2FJDB 1KLNA 2L3MA 2F9DA 3H5UA 2Y0SD 3MUTP 2HNZA 2HFVA 2PMWA 3QNWB 2EFQA 2FY8A 3AHPA 1HBMB 3H20A 3OXLA 2RB7A 1NUEA 1LNQA 1W2IA 2XY7A 2ZZTA 5CD4H 1NJIT 2IFXA 4USKA 1SJRA 3BBBA 4MMOA 4O3QA 3ETOA 1TELA 3AY0A 3HVAA 1GX5A 5KFRA 2HHQA 5HVGA 4KV8A 3K2YA 2M8DB 1FE0A 3H0PA 1MMNA 4USHA 4LF7J 4L3KA 4QWCA 4RLEA 2UUBF 3TZWA 3KK3B 2ZOMA 4L76A 3MTKA 4OI4A 4QIFA 1LW0A 5EWFA 3FZBA 1TP7A 3HHEA 3PEHA 2EKNA 2RHSB 4F2SA 1LWEB 1S1TB 1ZTWA 3J7AN 2W25A 4ED0A 1CJUA 1R8AA 2E44A 5KFFA 1XMOF 4H4MB 3OUYA 3IG1B 1W2BR 2GAHC 5H9FJ 3V5RA 2BABA 1NZAA 1PCAA 4R8UA 1G7CB 3FQLA 1F3FA 1ZPVA 2VPXB 5H9EK 3M6XA 1XK8A 2ZHAA 4B17A 2IPOB 3QLHA 4MAKA 1VBXA 3MM5B 5L1IA 4DMZA 1VOMA 4J9MA 1HBNB 5HBMB 1C1CB 1TMJA 2O5DA 3BDPA 4DR2J 1WHXA 4WK1A 3PG9A 2WOMA 2AQ4A 2GA7A 1FKPB 3MEGB 2R7VA 1ICEB 3G6ES 1IJEB 4DPXA 5EHHA 3IR7B 3M8SA 2YNGA 3M2RA 5D3GA 3H59A 4PABA 1SL0A 5HP1A 1R8HA 5CYMB 2HQ3A 3CWJA 3SV3A 4B9NA 2VU5A 2M4MA 4ZP6A 1Y5LB 4KKOB 1BQNA 4MK7A 4TU9A 3NCPA 5F8GA 3S8SA 3PYFA 4UY85 1RTZA 5KFOA 3KK2B 4WBFA 3D28A 3HO1A 5HK4A 4FYXB 3NLCA 5B7WA 2CNNB 5IM0B 2DT9A 3CIZA 5F8HA 3CCVS 5LMNF 2AGPA 1SL2A 1RGVA 4ATNA 3HT3A 4E8UA 4LF8J 2ERRA 3GJQB 3GIMA 3IO1A 2PEHA 4KPCA 3IWLA 1YX2A 5A6PA 3DLHA 3W7BA 3MMJA 2HNDB 2CQ3A 2IBKA 3MPVA 4JYAF 2M8HA 3H8YA 3DDKA 3N0VA 2YX7A 4PG6A 2WSEC 3HZGA 3H7HB 4CO1A 2CJKA 4K4ZA 4IG0A 2QSFA 3AFGA 1K1SA 2LDIA 3VF0B 2AZ1A 2OELA 4I69A 1HW9A 3BR8A 3DRPA 1T05B 3V6DA 1HWLA 1HLWA 1D3WA 4PWWA 4QWEA 2CPIA 1R89A 1PYSB 3H4BA 1KQKA 4LF6F 1NPKA 4X65J 1U1RA 4C9DA 1Q8BA 1ZAVA 4N8NA 5B0FA 4CLKA 4U7CA 3P5BP 3BR9A 4ILMA 1L3VA 1NSAA 2XLIA 4NLUA 1MLAA 4BDPA 1GQEA 1WHVA 4MH8A 3SSSA 5E3CA 5D0HA 4Y2IA 3OVAA 4USMA 3HHLA 2DD8S 4J91A 2V9WA 2V68A 1JJ2R 1ZBTA 4QR1A 1S57A 1N32F 2CQIA 1HWKA 3TNVA 1QVGR 3CD0A 3EZ5A 4YP3A 3BO2A 1JLCB 4ER8A 9RUBA 2GO9A 2ZOFA 5IT4A 3POTA 2HMIB 3KLFB 2DIVA 5HVHA 2VODA 1RT7B 3NKYA 1HNXF 2V2VA 3ENVA 5HN0A 5HROB 5L38A 2AWZA 4DR7F 2CG4A 2ATCB 2XLKA 1F9FA 1WSRA 3FUYA 4PQUB 2NZCA 3EE3A 3AAWB 1X8DA 3GR1A 3EGVA 1H3DA 1VIXA 1ZM3A 1U1LA 2A1BA 3DLKB 3CGIA 3PHTA 2IA0A 1REVA 1TKDA 5ETSA 4K5RA 4ZDNA 4X4UA 4C11A 2JRSA 2G1HA 1MMLA 1ZPWX 2POKA 1R0AB 1U09A 5D8HB 4KGMA 2XEXA 3G4SS 2AJ1A 3OTOJ 2DO4A 3PHEA 1FDNA 2UV8A 2BMBA 2VBWA 1ULRA 4CWBA 1NPPA 1CBKA 4WFZA 1S6PA 5KFAA 2JDJA 1RAOA 2R8KA 2Q6CA 3HVWA 3LW5C 3MM9A 3I32A 2E9ZA 1HHQA 2YBVA 2YQ3A 4EGLA 1V9OA 4R5PB 2V4JA 4QIGA 3K5LA 1EIYB 2PE8A 1S1WB 2FVSA 5KFEA 4Z7YA 3D0GE 1FF2A 3OBIA 5GMKa 3EPIA 3V4IA 2FJXA 2O3DA 1TK8A 5L1KA 1WNEA 2DGWA 4DV4J 3BGLA 2E29A 1RAHB 2RF2B 4Y6IA 3Q8VA 4UW2A 1H74A 2ALYB 1JLFA 4KJIA 3NL0A 3SYZA 1YJ9S 3JQMA 3NMAA 3VZHA 4C3MA 3W8GA 2RQ4A 2LQJA 3P6YC 1WEZA 4O0IA 2NSBA 3D2WA 4R25A 2XWXA 1Z4UA 4IH7A 1HQ2A 4YUDA 4DV6F 1SXLA 4USIA 2Z57B 3OLBA 1LFPA 3KHGA 3QGPA 5IFMA 1XMBA 1NB2A 2K1RA 1UMJA 3W2VB 3X3UA 5E3AA 1GX6A 2BA9A 4ANDA 3NS7B 2VFSA 3CCMS 1BMQB 2ILYA 3QO9B 1SIZA 4ZCLA 4KH1B 1RTHA 4RNNA 5L46A 1T3NA 4F4AA 3MMAB 4DV1F 1FDDA 4NWBA 5L9NA 4YHHF 3KK3A 1H73A 5L1LA 1KVIA 3BF4A 4X62J 3DRXA 3HF5A 5CZXA 2C1EB 2UP1A 3R5AA 1DQ9A 1RHRB 3A13A 1N0VC 2ZH3A 2HS4A 3WC2A 1LWEA 1S1TA 2ZITA 3NGKA 4ZHRB 4FKYA 1RT6B 1R6YA 4IR1A 5L1JA 4PPDA 1YJ7A 5DJBA 5BXIA 3IP0A 4H4MA 4V19J 3VWSA 1Q53A 3SFGA 2QO3A 1QLNA 2N7CA 3OR1B 4OYIA 1S5ZA 2V9KA 2HGMA 4HHJA 2M9KA 2GMHA 3DCAA 5J2QA 1HHSA 2DXDA 4H4KA 3HULA 4ZLPA 4QW9A 5KFSA 1C1CA 3JQJA 2GW8A 1QTNB 3DLGA 4FBUA 3NNCA 2RMLA 2Q6BA 2KM8B 2OIHA 1S12A 3BZQA 3EXYA 3CDEA 4P6QA 3M1VB 1UW4A 3IA0A 3WHIA 1FKPA 3MEGA 4O3SA 1J5OB 2D9PA 5IC4B 3CCUS 3V81A 2RD5C 1VRQC 4PXDA 4WTOB 3RRGA 1UVJA 3L7PA 2ABYA 4C7QA 5HANA 2NXEA 4KAIA 5CYMA 4URSA 2PI5A 2AGQA 4DV7J 4KKOA 1SIWB 1YJNS 3MPDA 1I1GA 4DR5J 2VASA 3LF0A 1IBLJ 3OXGA 3WDOA 2HHTA 3DN9A 3J81j 4RUBA 3KLEB 2ILZA 2RKIA 1M0SA 1B99A 2KYXA 1WHWA 1S6QB 5IM0A 3ZNJ1 2BXJA 2AHOB 1N5TA 1NHVA 3CTRA 4LRFA 3SIPB 2CUYA 2HAFA 2LXFA 2NXCA 3GWCA 4D3GA 2HNDA 5KG2A 2ZH9A 4DSKA 3JSMA 3DYAB 1JLAA 2WTFA 2PEBA 2K2PA 2KJVA 2L41A 2MKSA 2BJ3A 4KIAA 3FRZA 1JLGB 2CQHA 2YQ0A 3FEYB 2R3VA 4WE1B 1TR0A 1ZOTA 2H5JB 2QEXS 1VS3A 3K0JA 1MU2B 4MYTA 2GHWA 1FEEA 4YEAA 3TI0A 3G71S 1U48A 2DHGA 1T05A 3CO9A 3JYTB 4HYKA 2FZCB 2FUG9 1FT8A 4WFXA 3RRHA 4YB7A 5BJRA 2HYIB 2VC0A 1RCXB 3CC4S 1KWMA 5T7LA 2R7TA 2HKEA 4EBCA 4TVAB 1BD6A 2QA2A 2PFDA 4L6V3 2DRBA 1CLFA 1QTMA 1RP5A 3JTPA 4NCGA 4X4RA 2VFVA 4EZ6A 4ED7A 4BCAA 3FC9A 1IM4A 3U7JA 1ZTTA 3NOGA 1MROB 2YKOA 4MKVA 3QYYA 2JEGA 3DGPB 1RCOB 1ZA2B 3GFZA 3KJFB 1QE1B 2VKRA 4B9UA 3EX7B 3SV4A 2YPYA 4DQPA 2IM1A 3KNGA 1JLCA 2XMJA 3EGZA 3AA9A 3LH2S 4WP3A 4OMFG 3PJ9A 1X5OA 4ZPCA 3KLFA 5L9XA 4QWDA 3VZIA 2P6SA 3ENWA 1V3RA 4JI2J 3NNAA 3R1LA 4IDKB 2LCWA 1P27B 2QLFB 4ZVUB 3BO3A 1FE4A 5I4MA 4OX9J 1SJQA 3EGWB 1VQ4S 4V19X 2HGNA 8RUCA 3QWUA 2V34A 1H7XA 1U1QA 3IAS9 3NCRA 1TL4A 2EI5A 1LWFA 3ULHA 3I5CA 4CLZA 4YN3B 4JI3F 5B0DA 1U1KA 4K4YA 3BS9A 2UVUA 2IM0A 3CCJS 2MSTA 2IVYA 3UPFA 4OJ1A 1RT1B 4R5PA 3JSYA 2WONB 1TQLA 1TTHB 3K5MA 2GNKA 2B9WA 1DY3A 5ITHA 4RL1A 2CXEA 4JI6F 2I38A 5AXLA 4YMEA 2HHXA 4B9LA 5LMUJ 2QGFB 1SB6A 2MZTA 4CTAB 4Y28C 4IO9Q 4QYZJ 4ED2A 1MNEA 1RTJA 2ZDOA 2JHEA 4QYRA 1N33J 2E7VA 1D8YA 1B4SA 1NRKA 3AJ2A 4GKKF 2ALZA 2YKNB 4ES2A 1WUUA 2VQEF 5THWA 3Q2SC 2C28A 3HXMA 1KS2A 2KN4A 3VVTA 2Z0GA 1NEEA 4GKJF 2E9RX 2XZDB 4O4RA 5DM7Q 2YWWA 2B8QA 2QZ8A 5L39A 2VV5A 1GEHA 4A8WA 3QO9A 1HNIB 3M9NB 1EJ7L 2DNNA 1R31A 1X9WA 1KOOA 4IKAA 1EETB 1RA6A 4DPUA 4C4WA 2VQFF 1Y10A 1ZH5A 4ANEA 2BKPA 3UCZP 3PZPA 3ZZPA 3KOAA 1FA0A 2I9SA 3QPIA 3UCGA 2PGCA 3CD6S 1HNZJ 5D4LA 1WKKA 4XIUA 4ELVA 3MI7X 4DR3F 1FWKA 3LOUA 4ZHRA 4F0HA 2GCFA 3TEGA 2IM2A 2Q3PA 4FYVB 2DR6A 3H2UB 3DOLB 3J80U 3NWGA 2V5HG 3D0HE 2B43A 2B9YA 1U7LA 3QAEA 4ZJOA 3OR1A 3MM6B 5KFMA 2AJFE 3L4BC 4DR6F 2DH7A 3K8VA 1CEZA 3EMTA 2YWGA 3TOQA 1GFWB 5DDRC 4Z2XA 3E01B 1HQEB 3Q2TC 3Q8RB 1N5SA 3IRXA 1D9DA 2W7AA 4DUTA 5KFPA 1S1XB 2RJZA 4DQSA 3BQ1A 5LSLA 1SC4B 4ELUA 1SJFA 2W2OP 1CS4B 4YQWA 5SUHA 1SH3A 2ZD1B 4KYZA 3VALA 2R8GA 2D3OR 3MAAB 1VQ5S 3IS9B 2KT5A 4KR0B 1BC6A 2K06A 1XNRJ 1U8WA 2XY5A 4MKBA 2NSCA 2XI2A 2FHJD 2YKMB 2W9AA 3H2VE 5KG3A 3UI3A 4NXNJ 1YHQS 3N4WA 2CQPA 3FBCA 4DQRA 1WDTA 3KLEA 5DQIA 1VQ6S 4AD6A 1S6QA 3UR3C 1LXNA 1OPZA 2CDQA 2AJQA 1MN9A 1NK5A 4AFFA 1FI4A 3KXDA 5ETLA 2OAUA 2R7RA 5ETOA 1NSQA 4MK8A 4DR2F 4N41A 2HHVA 1RISA 2R4FA 4O3NA 3ONQA 2OGUA 5E5NA 5HAOA 4JV1A 1VDHA 3O5TB 3DYAA 4LRBA 5JJBA 3F56A 3ENQA 4OIXA 2C2NA 2GS8A 2EFGA 2YX4A 3K5PA 1JLGA 4CLUA 4LF9F 1NZ8A 3DMJA 3H5SA 4DN0A 1PJ5A 2HZAA 4J9LA 4WE1A 3RG6A 3IBWA 3MEEB 4LFBJ 3JQKA 3ET6B 4LBHA 4PXBA 3T5HA 3KKFA 1H72C 2ZNYA 3JSRA 1PYOB 1RWUA 4FYWB 3MHYA 2GX8A 2OPQA 3SBMA 2ROEA 3IWNC 2U1AA 3D6TB 4QWBA 4FF1A 4K50A 4M5MA 1I94J 4IG3A 2HHHF 2C3UA 2B9XA 1Q5YA 3J81U 3HPOA 3N6MA 3M6VA 4QIWD 2OMOA 1IR2A 2GAGC 3R1HA 2X1AA 2Z56B 2CNOB 4TY8A 3KLHB 3F0NA 2O01C 2AMCB 1X5SA 4B3RJ 1CJVB 1WG5A 1V3SA 3GU0A 1SJ4P 2GJFA 1DZ5A 4ZPDA 1HWIA 4OX7A 3CJ5A 2APOA 4QW8A 3RB3A 4DU8A 1F3VA 1UWBB 3FDSA 3SSRA 1LV5A 2R42A 3QSIA 4PXEA 3DGPA 2RQMA 3R3TA 3NXZA 1IKYB 2VL1A 1QE1A 5BR8J 3H25A 3CCZA 4OX8A 4JI1J 1R8CA 2EWHA 4DV3J 2DTJA 3M2UB 3CF5Q 2PA3A 1XMQJ 1EAYC 2W8LA 3THVA 3T9NA 2L08A 3ILJA 4NLSA
chains in the Genus database with same CATH topology
4PG4A 3FEXB 2RILA 3TVYA 5KFHA 3H40A 2B5JA 1SJ1A 3Q0AA 5I42B 1IR0A 2FLNA 1RQ0A 3LP0A 2K3KA 3NG8A 3PXGa 1JNZB 2CPZA 5KFUA 3DRYA 4EBEA 3IGNA 2LQ9A 2XSJB 4ZKAA 1VBZA 1KTVA 1VQSA 2RU9A 4IDKA 1YRTA 3QWPA 4ZPBA 3OR2B 1YGYA 4B02A 2NPIA 1Q4RA 4C0OC 2KU7A 2CQ0A 1KFSA 2XSJA 3N28A 1B0PA 2VPZB 3MECB 4WYLA 2KHCA 3GG1A 2E1RA 4W92B 4ECXA 2XS2A 2ZKUA 2M3DA 4CT8A 1XEZA 2JVOA 3PX6A 3HHDA 2FHKA 1JIHA 4FXDA 2EFPA 3K7RA 2DB1A 2G0CA 4IFYB 4WIIA 4WFYA 5E3PA 3RAQA 3AQOA 2EVZA 1REVB 2I0XA 2GGPA 3VR1A 4M8LA 4CO3A 3IRWP 4LUBA 4CNZA 4OLOA 1VJWA 4C11B 4QBUA 2M88A 1GXTA 1X4CA 4CO2A 2GMJA 5KAKA 4DS4A 2HRUA 3O6QA 1YSJA 1DTQB 1U1NA 1C4CA 5KG1A 2OPRB 3NMRA 1RI7A 4OJHA 1X0PA 4OX6A 2YNFA 3D1OA 1MWYA 2FVQA 3D1HA 1UJ4A 3G86A 2BRKA 3KLIB 3CDBA 1M5HA 4A8XA 4CH7A 4DL7A 1NK7A 1SV5A 3GV8B 1RKJA 3FSXA 3SDEA 4CCHA 3CCES 4AL5A 3K57A 3KLIA 2VOOA 3DOKB 2BANA 2HPUA 4I67A 1UVKA 3L7OA 3U02A 1FNXH 1FVSA 1NNDA 2GJIA 3JAMY 1S6PB 3CCQS 2GIRA 2KJWA 4HTIA 2YKAA 3AB2B 2FLPA 3LGNA 3KG1A 3DRSB 5F8JA 3D0IE 5DETA 4FS1A 2MB0B 2V4JB 2GQCA 3EGNA 2SXLA 1ELOA 4O44A 1LK7A 2B4PA 5KFXA 4ECUA 2CQDA 3BJYA 1U1PA 3BREA 3M30B 3NCQA 4CIOA 4QWAA 4IQMA 5HI7A 3V4IB 2E1AA 3PW4A 3MGJA 1KVJA 3MEDB 4L72B 1FK9B 1HMVB 4BC7A 4IH5A 4CZCA 2Z4PA 3M30A 4DL6A 4MFBB 3M8RA 4AQYF 3GIIA 2OSRA 4NMLA 1WTBA 1TK0A 5T41A 4F3QA 1QAIA 4ICLB 1TL3A 5KFBA 4X4NA 2IC3B 4LIRA 4AXJA 3F41A 5E3QA 4NLPA 2O66A 2NPFA 3PVXA 1S79A 1H98A 4KSEB 2JOQA 3PO4A 2F40A 4DL5A 3GILA 4MFBA 5CH7B 1KTQA 4DDFA 4GC7A 4LSLB 2C22A 3MPYA 3K5NA 4WKRA 4TYBA 4JI2F 2WB1D 2JVRA 5A6WA 2B7BB 2CZVC 2W24A 3TA2A 1JLFB 1TFWA 2V0NA 1BWEA 4Y65A 5GAGU 2KO1A 5K5MA 3SXLA 3TVKA 1BQMB 5FD1A 4TQSA 1NK0A 3PEJA 1NU4A 3OHBA 4CTAA 2EK1A 4HL9A 4LSLA 3HI9A 4IR9A 4CNYA 4I64A 2AYEA 1OSCA 1JWWA 2YH1A 2FJDB 4HH0A 2FC8A 1KLNA 1S9GB 2L3MA 2DNOA 2F9DA 3H5UA 2Y0SD 3MUTP 1BQMA 2HNZA 2E1CA 3I5AA 2C42A 3C46A 2H5EA 2IBOA 2DH8A 4QIVA 4CI0B 3NGDA 1QAYA 4DR1F 4OX9F 1N36F 4ZP9A 2EFQA 3LALA 3AHPA 1HBMB 1U6ZA 3H20A 3OXLA 2YY3A 3Q8SB 4RWXA 1FJCA 1S9GA 2PFFB 2RB7A 4I68A 3DXSX 3SCLE 2XB2D 1R7IA 4HT7A 2J0QD 1W2IA 2K8GA 2H9ZA 4ID5A 1YG0A 2MQOA 2KH9A 2XY7A 3FZ2A 4GMKA 5CD4H 1NJIT 1D9FA 1S77D 2IFXA 2AJ0A 1HBMA 1SJRA 2YKNA 4MMOA 4O3QA 3ETOA 4NLGA 1QAXA 3IWXA 6FDRA 3IN5A 3AY0A 4NL5A 3HVAA 1GX5A 1UKUA 2IMOA 5KFRA 2JH3A 2OPPB 5D77A 3OTOF 4G3IA 2FJVA 2HHQA 4WZMA 4DF4A 2VUGA 4YR0A 3WZ0A 2E1MC 4RUCA 4KGKA 2VA3A 2D74B 4KV8A 5ADZA 3K2YA 4Q2LA 2M8DB 1DFDA 2YWFA 2QRRA 1TV6B 1FE0A 2N4DA 2FC9A 2WBRA 1N0UA 3VQTA 4DV2F 3HZEA 1MMNA 1OO0B 2R8IA 3ZZYA 5SZTA 3CDWA 1UA0A 1DJ0A 4USHA 2A2DA 3CJ4A 1SQEA 4QWCA 2JEIA 4RLEA 2UUBF 2G1DA 2ZC4A 5KFJA 1VK3A 1TV6A 1TVRB 4HI2A 3CULA 4LT6A 1VFJA 1N5YB 3U1NA 3UQSA 4KQZA 3DI6B 4WFNQ 2O1PA 1D8ZA 5EWEA 5A0YA 3NBPB 3I9V9 4RU2A 2HFNA 3KK3B 2J7KA 2ZOMA 4YOEA 2PC6A 4GC6A 4NX9A 2WK4A 1QUPA 2B4UA 1EETA 3MTKA 4OI4A 4QIFA 5DO2A 1LW0A 5J2PB 3DI6A 1SH0A 4UUWA 3KG0A 3A1YG 3CMES 5EWFA 2XULA 1QSLA 1UAWA 4A8YA 2KB2A 2VBZA 3FZBA 1U4BA 1KQGB 3M05A 1TP7A 3HHEA 1GXLA 1LKZA 2MHNA 2VC1A 3E51A 3PEHA 4EYIB 2E5LF 4F2SA 2KDOA 4JV5F 4ED6A 4A4JA 1LWEB 1A6LA 1VQNS 2R8HA 5B0AA 1S1TB 5LMUF 1AW0A 4C8YA 5J2MB 1ZTWA 2W25A 3F44A 4TKTA 1XTZA 3LPYA 2RIJA 1YBAA 1Y00A 3OL6A 2CPDA 2ZDPA 4BWMA 4M63A 3ZC4A 5J1EB 3VAFA 4C8ZA 3RB6A 4ED0A 1R8AA 4R8UB 2E44A 2DCUB 5KFFA 4Q44A 1NB7A 1XMOF 3OHAA 3GV5B 4H4MB 5A8RB 1FXDA 4FNIA 3T1YF 4NLVA 3OUYA 3RR7A 2E9TA 4ZS6A 3IG1B 1W2BR 5H9FJ 2XNRA 3V5RA 2QE5A 2F8MA 2J7WA 2BJEA 3H5YA 2BABA 3SQGB 4DUZF 1N33F 2VG5B 5HQ8A 1NZAA 4HLBA 4DSJA 4R8UA 4LVNP 1NK8A 1G7CB 3FQLA 5J2NB 1ZPVA 1N56A 2A3JA 2VPXB 4KO0B 4ZP7A 5KG0A 2FD2A 3IG1A 2YWEA 4Q43A 4K4TA 4Y2MA 1KOHA 1GXUA 4ZVHA 2UUAF 3M6XA 4F26A 2GIQA 1JXLA 1FJEB 1XK8A 2ZHAA 4ECSA 4B17A 4I6YA 3MM6A 3BSOA 4CO4A 2B6AB 1S48A 3QLHA 4MAKA 1TL1A 2QIFA 4QPTA 4B9MA 2OFHX 1VBXA 3MM5B 5L1IA 4DMZA 2HHXA 1VOMA 3V4MA 4J9MA 1NK6A 1HBNB 3C8YA 5HBMB 1C1CB 1H38A 4P7VA 2C2RA 4CT9A 2O5DA 3BDPA 4B9TA 1P1TA 3ZZUA 4RW4A 1V3ZA 3MM5A 2J6UA 4XAKA 1FDBA 1HD0A 1WHXA 2CJBA 1TAQA 4WK1A 3L3CA 1RT2B 2WOMA 1HBNA 4H4OB 5HBMA 2PMZD 2DR8A 2AQ4A 2GA7A 1IKWB 1FKPB 3M8PA 3PW7A 3MEGB 4YY3F 1HYSA 2R7VA 1HD1A 3DC2A 1SL1A 2VA2A 1NJXA 4QU6A 3M2RB 1HI8A 3G6ES 1NHUA 2XNQA 4NZ6A 5D3GB 5IT9Y 1IJEB 2DGSA 1RT2A 5EHHA 2MPUA 4H4OA 1IBMF 3IR7B 4KPYA 3P96A 1JLBB 4F2RA 2LQBA 3M8SA 4RNHA 2FJEB 2YNGA 3DU6A 3M2RA 1R43A 5D3GA 1H0HB 3B8HA 1YTYA 3MFHA 1AFJA 3H59A 1SL0A 3SFUA 5HP1A 1D1UA 3QJPA 1KHWA 1R8HA 5CYMB 2RS2A 2HQ3A 3QIPA 2MXYA 2V94A 4ETXA 3CWJA 4A8KA 4DQIA 3RYLA 1BQNB 3SV3A 2X1BA 2J76E 2LEAA 4DOZA 3DLBA 1HW8A 4B9NA 1VC0A 2M4MA 5KT7A 4ZP6A 4TY9A 1Y5LB 3I9ZA 4DG1B 3PV8A 4KKOB 3TYTA 5A8KB 3CJ3A 2DR7A 1BQNA 5MLCV 4MK7A 1YJWS 1DQ8A 4PUOA 3KLGB 4TU9A 2ZD1A 4J9SA 4ZPVR 3NCPA 3ZZOA 2D3UA 1LXJA 4NZ7A 1M5PC 4DG1A 3DFEA 4MKAA 3S8SA 5F8GA 3M6WA 2IRXA 3FSIA 4UY85 3PIPQ 2V8DA 4PG8A 3CC2S 5F9LA 1DLOA 1WI6A 1KQSR 5KT3A 5KFOA 2R7UA 3KK2B 2YX1A 3D28A 4IYQA 3PRBA 1JMTA 2KXHA 5KFTA 1U6FA 4KFBB 1SC6A 4UQTA 3S01A 3HO1A 2VFTA 2F3JA 1OQ3A 3NLCA 5KFKA 2DGVA 5B7WA 3KK2A 5IM0B 2DT9A 3CIZA 5KFIA 5GAGI 2K7KA 2DO0A 4KFBA 3HVRA 1FRJA 5F8HA 5AXKA 3CCVS 5LMNF 2AGPA 4ZPWR 4RW6A 2Z2LA 2HG4A 2LKZA 1APSA 1YWXA 1SL2A 5LJ5Y 3GG0A 2AP6A 3HDSA 1RGVA 4TU8A 4ATNA 2E5JA 2AX1A 1W25A 1RT5B 2DNZA 2YKQA 2M7SA 4E8UA 3HT3A 3MFIA 1Q1KA 2DVIA 2ERRA 3KMSA 4X2BA 2MKHA 3GIMA 2XY6A 2MY7A 1CG2A 4CH0S 2HWTA 3AQPA 5B0EA 2AYGA 3IO1A 4WU3A 3DLJA 4MTPA 2PEHA 4Y2KA 5IS2A 2WRMA 3IWLA 2XLJA 5A6PA 1TKZA 3DLHA 4ILLA 4PWDB 2A10A 2JX2A 3G9CA 2ZBIA 1QUVA 3I82A 3W7BA 1BY9A 4JUZA 1O5JA 2UUTA 3MR5A 4ERDA 3MMJA 2HNDB 2CQ3A 4KHRA 2OFGX 1Y4ZB 2IBKA 4DPOA 5K8PA 3MPVA 4GO7X 4JYAF 5KG5A 1FRMA 4ZCMA 2M8HA 3MWBA 4DSEA 4HI1A 1OQ6A 1G3OA 4OZNA 2G13A 5KG4A 3H8YA 3DDKA 5HMZA 3TQ1A 3LAKA 3N0VA 3PRDA 2DR9A 3UDLA 3W2WB 4TLQA 4Z37A 4HKQA 2DHAA 2YX7A 3D1QA 2ROGA 3MOZA 4PG6A 1S0MA 1K0TA 4ZPTR 2WSEC 4C2MA 1XR5A 2CVIA 3HZGA 2JC1A 3SCKE 3UD4P 4CO1A 3CDUA 3DXBA 1XR7A 2CJKA 3QGHA 5F0UA 3W2WA 5LXYA 5IXUA 4K4ZA 4IG0A 2QSFA 5C25B 4NLTA 4NOHA 3DRRA 2FVRA 4DLEA 4U9RA 1K1SA 2LDIA 1X4BA 3OTBA 3OTDA 2XCAA 2ZH5A 4LMZA 2I8EA 4J9PA 3VF0B 3V6DB 1S1VB 2EFOA 1U47A 3RR8A 3K58A 2DGUA 4ILRA 4I69A 3MEEA 1HW9A 4RBVA 4YB6A 5IZHA 2OH2A 2DGXA 4QCLA 3BR8A 3DRPA 1YJRA 1T05B 3CD7A 2JLEA 3MMBB 4FF3A 4TN2A 4YB5A 3GMGA 3V6DA 1HWLA 2DPJA 3M2VA 3PFOA 1WWHA 1D3WA 1V6HA 4N8OA 3MAQA 2KFYA 4QWEA 1WELA 2ACYA 2CPIA 1R89A 2DBBA 2F7VA 4ZVEA 3RAXA 3H4BA 1KQKA 4LF6F 1IQTA 1Y3KA 2FJAB 5A8WB 2MQPA 1RAJA 1DTTB 1HL6A 3NRBA 1U1RA 1IBLF 1XNRF 4C9DA 4M5DA 5KT4A 3OTEA 3G96A 1Q8BA 5EUHA 4EWTA 1ZAVA 4N8NA 4RW8A 5B0FA 1F0XA 4B3SF 4U7CA 1SUQB 1FKOA 5L8RC 3VAMA 3BR9A 5KFCA 4OV1A 4ILMA 3KK1A 2ZHOA 4YFUA 1L3VA 4NXNF 1LK5A 2MKCA 1Q8LA 1RKIA 2VPYB 3N6LA 3V6KA 2XLIA 3R5CA 4NLUA 1JNRB 3PJWA 1SUQA 2QMXA 5DLFA 3OW2R 1S0OA 1QSYA 4RNMA 2HLTA 4PKDB 4JI5F 2Y1IA 2GO8A 5C24A 2IJNA 1T02A 3SEOA 3OL7A 2J0WA 4BDPA 1YJTA 4FF2A 1GQEA 2COLA 3IFEA 1WHVA 3I31A 1PC5A 4MH8A 1X4FA 5E3CA 3SSSA 1PSDA 3KLHA 2CPXA 1RA7A 2CPJA 2NUUG 4HVZA 4WFAQ 4LF5F 1NJZA 1NH7A 3CT9A 4WXWA 4F4ZA 3BSNA 4JI4F 4Y2IA 2N82B 3OVAA 5C42B 4A48A 3HHLA 3IR6B 2YNIB 4FN5A 1FRIA 2UVWA 2DD8S 4LVOP 2K7JA 5B0CA 1KHVA 4EUVA 5FDLA 4DSFA 5CYQB 1MWZA 4J9OA 2CQGA 3BQ0A 3BEGB 3O1LA 3T1AA 2V9WA 3H4DA 3TAMB 5C42A 3MURP 1ZAXA 1JJ2R 3MR3A 1C0UB 4QR2A 3C3LA 5M2UA 4Q0BB 1ZBTA 5F9NA 4QR1A 1N32F 5CYQA 4HTJA 4LJMA 2D3ZA 3EZUA 2R7XA 2CQIA 4BBYA 4NA3A 3TAMA 1G2EA 1HWKA 3POTB 3TNVA 2BR0A 1QVGR 1IKYA 3CD0A 1DQAA 3UWTA 4YP3A 2MKIA 4OHVA 3EZ5A 5JUMA 1C0UA 4XDDA 3BO2A 2KI2A 1RYRA 3QAUA 1JLCB 2G9OA 2QYCA 3B4MA 5JXSA 2GO9A 2ZOFA 2BOPA 4G6VB 1Q82T 1UP1A 3CCLS 1VQOS 5IT4A 1C1BB 3OJUA 2PO4A 3POTA 1VMBA 1CSJA 2EBEA 3BO4A 1RT3A 4DF8A 2AYBA 2HMIB 1RTDB 3KLFB 1FTCA 2C3YA 5DM6Q 4LFBF 1PILA 4OZ1A 4Q7AA 1OSDA 4PR6A 1U1MA 4Y2CA 3T19A 4OJ3A 1FVQA 2FHOB 2DIVA 4HDGA 3MD3A 2HMIA 1RTDA 2F8EX 4PXCA 4EYHB 3T6BA 4QU7A 4QJVA 5EX0A 2VODA 3KWMA 1Q81T 1H2VZ 2A2CA 4ZA1A 3ITHB 3N01A 1U1OA 4CH1A 1RT7B 1ZAWA 1U6BA 3NKYA 1HNXF 1HFEL 2M5YA 2Q79A 5I42A 3T5LA 3B4DA 3N9UC 2WW8A 2ZJQQ 3ENVA 3FQKA 3GZ7A 1YIJS 5HN0A 3I56S 5HROB 2EG1A 4F25A 4IOBA 2V8GA 5L38A 2AWZA 2QLXA 1UVNA 4DR7F 1RT7A 2CG4A 2VG7B 2C3PA 1UEUA 2XLKA 2Q1LA 4X4QA 1F9FA 1AROP 2AJ4A 3OR2A 1ZZNA 2M52A 3G6YA 2DRAA 2ZBCA 1O8BA 1TZ0A 4PQUB 3PO5A 3TR5A 5HROA 3AAWB 1X8DA 3GR1A 3MECA 5DDOC 1F2GA 2DGOA 2RDIA 2ASJA 4LIWA 1H3DA 2B0GA 3PY8A 1VIXA 3G6XA 2X1FA 1ZM3A 3O44A 3OQ2A 4ED1A 1U1LA 2A1BA 2PSZA 1U24A 4PQUA 3DLKB 3GV7B 4OFZA 4C8NA 3CJ0A 1KLMB 2UU9F 2X3GA 3CGIA 5KOXA 4IFYA 1HBOB 1C4AA 3UFCX 1UJ5A 3M9MB 2IA0A 1REVA 3OFFA 1TKDA 2IA6A 2NREA 4K5RA 3R5BA 1VI7A 2AW0A 2LA6A 4ZDNA 3ZZ0A 3HVTB 3PR4A 4C11A 4ECTA 4X4UA 3DLKA 2BYCA 2JRSA 1MMLA 1AXQA