2IBOA

X-ray crystal structure of protein sp2199 from streptococcus pneumoniae. northeast structural genomics consortium target spr31
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
90
structure length
90
Chain Sequence
MKASIALQVLPLVQGIDRIAVIDQVIAYLQTQEVTMVVTPFETVLEGEFDELMRILKEALEVAGQEADNVFANVKINVGEILSIDEKLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein SP2199
publication title Crystal structure of the hypothetical protein SP2199 from Streptococcus pneumoniae, Northeast structural genomics target SpR31
rcsb
source organism Streptococcus pneumoniae tigr4
molecule tags Structural genomics, unknown function
total genus 19
structure length 90
sequence length 90
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01910 Thiamine_BP Thiamine-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.930 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iboA00
2IBOA 1YQHA 1S99A 1SBRA 1LXJA 1S7HA 2EPIA 1LXNA 1VK8A 2EKYA
chains in the Genus database with same CATH superfamily
1SI9A 4JI4J 3HPOA 2QA4S 2Q43A 1DQ9A 3D1OA 4KH1B 2ADBA 4I6YA 2RAQA 4PXDA 2WOMB 1Y11A 1UCNA 3C6TB 2LU2A 4LR9A 4Z37A 5GAGI 4NLTA 3NOCA 3FMBA 1T11A 2A6MA 2HSEB 4DCOB 1OMSA 1OIAA 4G1IA 3DHXA 3QGPA 1MMLA 4OI4A 4RL1A 4Q5VA 2CIMA 2BJ1A 1NK6A 4JOUA 1Q1KA 2V8DA 4KKOB 3W63A 4BC9A 4RW6B 2K2PA 2C28A 5FD1A 1GK8A 2DNOA 1D8YA 5D4PA 4K4XA 3SI8A 4LR7A 1WHVA 1RCXB 2RS8A 3HHNB 3UCZP 1CQNA 1OYDA 2HGLA 4WP3A 3V5RA 1FRXA 1YHQS 4PUOB 4M5GA 1N4LA 1PYTA 4X66J 4IH7A 1U0HA 1UFWA 1XJWB 1S0OA 1NKEA 1NRKA 4CWBA 1FRIA 4DHVA 2ABYA 3W5YA 3D3CJ 1ZBTA 2ZUGA 2WVCA 4OX8A 4XAKA 2DR7A 1IBLJ 2V6AA 5K9FA 1JLCB 1BD6A 1RWUA 2FVQA 1IBMF 5IQQA 4PZVA 4CYUA 5DM7Q 5ETTA 1DFDA 1U49A 2ZD1A 2M2BA 2C1EB 3OD2A 1K47A 2EBGA 4F3QA 4WIQA 3S1TA 4IOCQ 4NYZA 1DY3A 2MY8A 2CQ0A 4DL4A 1FKPA 2KFYA 1H3DA 2ROPA 2B56A 2ZBIA 1NK7A 4RPFA 1KDNA 5LT5A 2FZGB 1TMJA 3HFKA 2HYIB 4FNIA 1RWOB 4HI2A 2V34A 2QC3A 1X31C 2CVIA 5LOQA 4JV5F 3NKYA 4L3KA 1JLQB 5LMNJ 4LQ9A 2GX8A 1RB0A 1RT7B 2AQ4A 3UN3A 3DDNA 3UO0A 1J27A 2RQ4A 1HD0A 4ED2A 2XM3A 2W25A 2C2EA 2LECA 3QBCA 1LWEA 4B3SF 2CQPA 5T7LA 1NB7A 1S5ZA 1YVFA 1NKCA 5JUMA 5KG4A 1IKVA 1FA0A 5HN0A 3RR7A 3BYRA 2IVMA 2NLWA 4M94A 2XNRA 4R8UB 2XNQA 1UJ5A 3PO5A 1WEXA 4P74A 1LFPA 2NYIA 2ZH2A 4ZP6A 2OD4A 4NWBA 2W4CA 2DNYA 2LQJA 2WW4A 3HFZB 2ASDA 3V6DA 1FJ7A 4E0DA 1DQ8A 3EYZA 4YHHJ 3MTJA 1UZHA 2MHEA 3NNHA 4K4UA 3R1LA 3AB4B 3BM7A 3MFHA 2OI2A 2C2NA 1F5AA 2UVVA 1H72C 4MJKA 2UUBF 4PR6A 4LIRA 3ISZA 3ILOA 4HEA9 1P1LA 1SUQA 3DRRB 4L75A 4JI8J 4OI2A 1KEKA 2DBBA 2Y8YA 3QQCD 1OYEA 4UUXA 2FB0A 3OBIA 5ETOA 1VBKA 3BSNA 3Q24A 4OYAA 2R7SA 4Y6IA 2QFJA 3L9ZA 3DLGA 4EUVA 4PG7A 3CB4A 3A1YG 2VH7A 1WTFA 2RUSA 4ELVA 2CQ2A 1QE1A 1IR2A 2AX0A 3H40A 3G86A 4NLGA 2HQ3A 3FZ2A 1IKXA 4ZPDA 3R6LB 5I3PA 2J0QD 4RNFA 2ZBRA 3OVBA 1NHVA 2PGCA 4AE5A 4OI3A 1NSAA 1CJKB 5K20B 3BN7A 1U0HB 2D7SA 5KFQA 1SJ1A 1FRLA 1A7GE 3N6MA 3SXLA 5HMZA 5DZ6A 2YQ3A 2XB2D 4W4MA 1VJQA 4NXNF 4DR2F 3P8BB 8ATCB 3KJNB 2PA8D 1T3OA 3R1HA 4YB7A 4URSA 3POTA 4CYUB 2XY5A 2VF3A 1IQZA 2DGXA 2ZD1B 3OLAA 1SJFA 1W2BR 4K8RA 4USUA 2YX1A 5F9NA 1MROB 4ELTA 4WZMA 4J9PA 3PJ9A 1WSRA 5HMXA 3D28A 3D4JA 1Q4RA 4TYBA 3G87A 1BC6A 4QJVA 2DGWA 3W66A 1N5TA 4RNOA 2E5LJ 4CO4A 4WZQA 2MXYA 3KLGA 2I2YA 2QYGA 3J81Y 3AHPA 1VISA 4ALZA 3H42A 1WHYA 1VC6A 2OHDA 4WPAA 2LXFA 1VMBA 4LR8A 3EPIA 1KFDA 2NPFA 4LF7F 4U8VA 1YDLA 2VG6A 2V69A 1LWEB 1S9GA 2MLYA 3C46A 3G96A 5T7LB 5KFZA 2XMVA 4M5LA 3PW7A 2ZJRQ 3K7RA 4ZCMA 3CO0P 2HHWA 2YPYA 3J7YI 2QSFA 2E5IA 2RH3A 1RBAA 2XLIA 3QWUA 1N5QA 4YDXA 2F8MA 3PHTA 3GLJA 1VS3A 2BKNA 3N4WA 4OX6A 3TX8A 2EW9A 3RGIA 1WTBA 4WU2A 2VC1A 3V6DB 3GU0A 4KJIA 3OR1A 2HQGA 2GMLA 2W9BA 4GMKA 1B99A 1S49A 2HHUA 1L3VA 1F6TA 2CZ4A 4Y2AA 2R7TA 5GAEU 2CVEA 2CQ4A 2VQEF 4E2FB 3T5KA 1XMQF 5I3UA 2H5IB 2OGUA 2EBEA 5KFMA 3MXHP 4DR3F 4Y2CA 1N6QA 3G82A 3W9HA 1SUQB 2LQ9A 1KQSR 1VQOS 1KS2A 2DY9A 3FNNA 1HWUA 1EAYC 3K5OA 1WJ9A 3L4BC 4I1TA 1B70B 4N47A 3SV3A 1R0CB 2YKMB 3CJ0A 5D4LA 3W8GA 3AD8C 3D9BA 4CLKA 2Z2MA 4CNZA 2F4VJ 1DZ5A 1FDAA 1IUJA 3K0JA 3PX0A 3AJ2A 2HFZA 1FDDA 1QE1B 2DCUB 3IMQJ 3BO3A 3PW2A 1R0AA 3W60A 4WFBQ 4C8ZA 2GGPA 2O67A 3OXFA 2RB7A 3MEEA 5L9NA 2LMIA 1H0HB 2W2QP 3GFHA 1C0UA 5KG2A 4N41A 4E8UA 2CNNB 4OLPA 2KKHA 3VWSA 1TV6B 3G9CA 1NDCA 3MAHA 3UD3P 2XZWA 1UEUA 3Q8RB 3ZTQA 4O3NA 1K1QA 3ILLA 3CJ2A 2OPSB 1F9FA 2DY1A 4AT1B 4CRJA 2NXJA 2K1RA 1QAYA 1REVA 5KT5A 1XK8A 2YQ1A 1FX2A 2IRXA 5AXLA 4NXMJ 1TK8A 4CO5A 2V2ZA 3A8JA 3EXYA 1HBOA 2AYBA 4KGZB 4OZLA 1HW8A 3KLGB 4WJBA 2COLA 1RAGB 1DQAA 5GAGU 2NXEA 5L1IA 1C2PA 4WP8A 2QA2A 3CF5Q 1RLCL 5CH7B 1I1GA 3AQPA 1YWXA 2OAUA 2KXFA 3BQ1A 2FJXA 2FHJD 3MOJB 3MDFA 2DITA 2MQMA 4ZVPB 1S1UA 1KTVA 1T0TV 2PFFB 5A6PA 1UEKA 3MPUB 3HT3A 2I1RA 1E6VB 3PTWA 5T14A 4ECYA 1S10A 2HBQB 3VAFA 5DGAA 4NLYA 3FK4A 3T9ZA 2MKJA 4ZP9A 3CJ3A 2YKNA 2CJ9A 4ES2A 4LF9J 2NXCA 3DXBA 4P72A 3GYXB 2MKSA 3WX4A 2AHOB 5C42A 4DSIA 1KBRA 2JEGA 4YR3A 5A6WA 2HS0A 3OR1B 4AL7A 2ZWOA 1NPKA 5CQGA 2W9BB 1PJ5A 3CPWR 3BF4A 3O5TB 2KFZA 2QA1A 3RR8A 1HNIB 2IDLA 5J2PA 4PCQA 5HSPA 2WB4A 2OTJS 5I3UB 3MMBB 2CWKA 1JLAA 4CLUA 1Y4ZB 1JLFA 3A8IA 2PEHA 5BYRA 3G82B 1WI8A 5HVGA 1T05A 4DN9A 4QR2A 2OD6A 2UXBF 4PQAA 3RW6A 3BQ0A 1UW9A 1NDKA 2MZJA 3IGNA 1AT1B 1QD1A 3SQGA 1RYRA 5EHHA 2DK2A 3W7BA 4ZHRA 1J2VA 6AT1B 1S57A 1TELA 2HRUA 2V67A 4YDDB 4HH1A 2RJZA 3HFVA 4TNOA 3GG0A 4DJBA 4UY85 3OJSA 4R0JA 1KHWA 2ASYA 3M8QA 3ISND 1ZM9A 1R0AB 1TKXA 3G8SA 3MEEB 1F9HA 2B8PA 2BOPA 5KT6A 1C0UB 2VFTA 2MQ8A 2X1AA 4DV2J 4J7CA 1FEEA 1YI2S 2WSFC 1UPMB 4OI0A 1JNRB 4N76A 2LEAA 3LP1B 1RDRA 1H2UX 1S0NA 3UDLA 2ZH9A 1OY8A 2RQCA 3AJ1A 1CBKA 4JBCA 1VQLS 1WELA 2R2TA 3VTIA 4KHPJ 1YJ7A 3BGOP 4EO8A 1S6UA 4HKQA 1HNZJ 2XSFA 1VHFA 2GO9A 3QFHA 2K1RB 4FXDA 4YFUA 3G8QA 3NAHA 4Z7YA 3CMQA 4X4SA 2DRAA 2AYEA 2V8HA 1HBOB 2NR0A 4EBEA 1ZAVA 1NJYA 5DETA 3S6EA 2OMLA 1NB2A 1ZPVA 1VQ4S 1S12A 4KGXB 1FXLA 4ZMMA 4NLPA 4UOFA 4DI6A 3E51A 2W7OA 3CULA 3E8OA 4F7VA 1WC5A 2WW8A 1P9QC 4MK9A 3ULHA 3ADAC 2YNGA 3OL7A 1VIXA 1HHQA 2GHPA 2X3DA 3VV2B 4OHWA 2YWHA 1X4HA 3TVKA 8RUCA 1HBMA 3TJ8A 3CMES 3KHGA 2HNYA 1V5VA 5KFFA 3LPEA 2YKNB 4FNHA 1X4DA 2YKPA 2IBOA 1EARA 4ZLNA 4W98A 3WC2A 2HFUA 1UTAA 2ATLA 3QJLA 2Z2LA 1Q8KA 2KH9A 1DRZA 3W5XA 3PR4A 3HSZA 2C2RA 3THTA 2EK6A 2XMWA 4JYAF 2G0CA 4M1KA 4KHRA 1HA1A 1FFGB 4L6V3 4UW2A 2DNQA 2XCAA 5J2PB 1DHMA 2XHWA 3G2XA 1VK8A 2D41A 1FRKA 1JLAB 3A8KA 1JLFB 2XGPA 4I7FB 4I2QA 3BB5A 3AODA 1M5PC 2FHKA 2WCXA 2DNMA 3AT1B 3T5HA 2CPYA 2IJFA 2RT3A 4RLEA 3FMWA 1U25A 4IOAQ 1GXUA 2OPRA 5C7PA 1WC0A 3U7JA 1KP6A 3K5LA 4CT9A 4ZHRB 3RAXA 4USVA 3D1QA 2HS3A 4CO0A 2VJUA 1U2CA 4WCEQ 3NS5A 4LRDA 1XNQF 2YH1A 4KV8B 3M8QB 4KQZA 1YZ6A 1RWVB 3DOKA 1TKXB 4J9QA 1LWXA 5BR8F 5SUHA 2AZ3A 1WF1A 5E7OB 3VZHA 1K8AT 1LWFA 4RO0A 3RBZA 1BQXA 3GV7B 2ZKUA 4X65F 4CH7A 1ZETA 2NCKL 1U02A 4USHA 2N82B 2AP6A 1V9OA 3R7NB 3MZIA 4DFJA 1OQ3A 5EX0A 2RS2A 3I4HX 3M6WA 3EDRB 1N33F 4DL7A 1KKHA 4N8OA 4P52A 1S0MA 3BBBA 5K8PA 2VG5A 2RD5C 2YNHA 3R8YA 3BSOA 2XEXA 1D0EA 1DAXA 3TZXA 4HACA 3D0HE 1TL3A 2ZZNA 2W24A 3NLCA 3HZGA 2M0GB 3OJUA 2BOAA 4K59A 3G6XA 4P2XA 3CJ5A 4M95A 3NNCA 3CEDA 1TKZA 2E5GA 3PY8A 2KZMA 1ZH5A 1N48A 4ZLPA 2HZCA 5CD4H 2D9PA 3FSYA 3HHLA 4F2SA 2Z58B 1FESA 2R7UA 3B6BA 2WK4A 2CKWA 2LKZA 1F9EB 3GP9A 1BWVA 1WG4A 3B78A 4ED8A 4JI1F 2I5JA 4Y65A 2YNGB 3EZUA 4HHUA 4JI3F 2CDQA 1Q5YA 1Q8LA 1VBYA 2E7VA 3D6MB 2GNKA 3MHYA 3OPKA 3GIKA 4CQ1A 3CMAS 5LMUF 4ZVTB 4ZVRB 3DN9A 4CLSA 4R5PA 5CCLA 2J9DE 1EB0A 3P45B 1RP5A 3K17A 4DV0F 4NOHA 2V0NA 1KWMA 2DXEA 4F02A 4HHHA 3MM6B 1J5EF 3TVYA 2HMIA 1F2GA 2ZDPA 1F0XA 1S79A 3OQ2A 2XO6A 3W5ZA 2PA3A 1HKAA 4J9LA 5G4DA 3IR5B 2FC9A 4USJC 2V8VA 4TU9A 2HQDA 5MAOA 1FERA 2P6SA 4MKYA 4Q43A 4LFAF 3VGSA 4I2QB 5ETLA 2CPDA 2J7KA 4ECXA 1A6LA 3L7PA 3FDSA 4PAAA 2QSWA 3DLHA 4R0EA 1FJGJ 1VLOA 1RWXB 3MMCB 1TTHB 3M2RB 4OHXA 1HYSA 1B0VA 4OX9J 2OPRB 1S9EB 2V9KA 4M5MA 2FC8A 4OQJA 2QYCA 1LEOA 4ZIWA 3L09A 1B4SA 5B0AA 2XWXA 1QAIA 3PRBA 4DR3J 5DQGA 5E41A 1XWLA 4DR6F 2RRBA 1BY9A 2JVOA 2MB0B 4K4WA 1S59A 2CJYB 5ETSA 3C14A 1LWFB 3BDEA 2ROGA 2QA4G 3ZTPA 2XMAA 3VGUA 1B64A 1CEZA 4ECTA 5C5JA 3HCXA 4ZCKA 2R9LA 2VA2A 4B17A 5D6GA 2APOA 2ZC3A 2ZNZA 5CD4A 4J9MA 5BYSA 1I94F 3GV8B 4NYPA 2Y1JA 3LP2A 2VG5B 2YNHB 5AJ3J 1RU2A 2MJUA 3NAIA 5F8NA 3UWTA 2KDOA 3HMJG 2RU9A 4KGKA 1TL3B 4NZ0A 4WFYA 3KDOA 4RWXA 1Q79A 3R5AA 2RE1A 4B9TA 5GAHI 1GH8A 1IKWB 2EFNA 1R43A 3DM2A 3M8PB 4USMA 5J2MA 4DX6A 1Q0NA 3H0PA 3W9JA 1T7PA 2LQ8A 3WDOA 4DXLA 4F4ZA 3OHBA 2ATCB 1ZAWA 2FLLA 3HHLB 3TO8A 1QUPA 2RILA 3WHIA 3VAMA 4DS4A 3CW2C 2XLKA 1YJVA 1YBTA 4ZDNA 2OPQA 1YZ7A 4P9SA 2N3LA 2RHSB 2ALYB 2R2SA 5K5MA 1FX4A 4OJ3A 5DDRC 2B43A 4N5SA 3R5BA 2B7CB 4H4KC 2KJVA 4DU7A 1L3SA 3I0RA 2HFNA 4KO0B 2DD8S 1ZA1B 3EGNA 5K8OA 4OYBA 5DDOC 1SV5A 1RHRB 1H7WA 4R5PB 1HNXJ 1VLYA 4TLRA 2CQ3A 4AQYJ 3N28A 2AT1B 5M2RA 5KT3A 4Q0BA 1WD6A 3JB9k 1UL3A 2NPIA 5IM0A 4N7TA 1EKSA 2N4CA 2KZZA 2HZAA 5L39A 2VICA 2HMIB 3QPIA 1P8GA 1D09B 1EZZB 2OELA 4FYVB 5F8JA 2QTWA 3I5BA 2B9YA 5IV4A 2MZRA 3MWBA 3FRYA 1Z4UA 2Z4PA 3ZTOA 3OTOJ 1IBKF 2DHXA 4OZ2A 1NMEB 5LM7E 2XYHB 1WDDA 4MK8A 1EIYB 4DV4F 1S48A 3J80U 1SXLA 1NO8A 2Y0BB 1SJQA 2QZ8A 3MGJA 1LW2B 4W90B 2PE8A 2W9AA 1QLNA 3QIPA 2GIFA 1HYSB 2W2OP 4DPOA 4DUYF 5F8HA 3BZQA 2PN6A 3TJ9A 2WB1D 4ERDA 5F8IA 5ETRA 2XS2A 5KOXA 2RU3A 1H73A 4ZVEA 3R5CA 2EFQA 3MM5B 2C22A 5EUHA 1Q8IA 4ZOSA 4JI2J 3MECA 1XQIA 5ITHA 2AYMA 5KT7A 1S1WB 4ZA1A 1RAOA 1YGYA 2UXBJ 1CS4A 3AAWB 2MSSA 3C14B 2B4VA 4AL6A 3TQ1A 2BQRA 4PWUA 5LXYA 3AD9C 3PJWA 3D2WA 5DQHA 4M63A 1TL7A 1N5SA 6FDRA 5J1NA 3A12A 4RUCA 4WYWA 1S97A 2R8GA 2KRBA 2J76E 3TA1A 1VIOA 2J0XA 3LP2B 2R7RA 2X1FA 4LRCA 2VOPA 4IOBA 3QAEA 3FFIB 4B9SA 1T02A 3BGRA 3SDEB 4NEYA 3B8HA 2J7UA 2VDIA 3CCES 4XIUA 3OFHA 2X3GA 3T1HF 2ZOFA 2YTCA 4P75A 1LKZA 4DG1B 4B3TJ 4K0KF 2LP4A 5AT1B 2F40A 5J2MB 3VVTA 3VALA 2BE2A 4DZDA 4ZJOA 4PQUA 1CJUA 3I0SA 3LGMA 4OYWA 3HHLC 2IFXA 4DV3J 2E1RA 3Q83A 3F73A 4GKKF 4GO7X 1HR0J 1XNRJ 2XS7A 3FBEA 2OPQB 4IFYB 4KE5A 4RBTA 5JVGQ 4BWJA 2H1YA 1NDPA 4TU7A 3I0RB 5KFDA 5GMKa 2DH9A 3M8WA 4V19J 3MUTP 2YY3A 1IN0A 3BKUA 1SV5B 2M4MA 1NZ8A 5KFXA 2QLJB 2JX2A 4Y2MA 2MY7A 2LDIA 3JQKA 4C48A 2W2PP 1VQMS 3Q23A 4FKXA 1T8EA 5IM0B 1OY6A 1ZYQA 1TMMA 3TAMB 2M70A 2Q3PA 5KFTA 3AXKA 3M32A 4L76A 2YWFA 5HMYA 4O3SA 1Y3KA 2HQIA 2CQIA 1ZOTA 1JQGA 2I0XA 4LFBJ 3JSMA 3G6YA 3P4UB 2CJQA 2EK1A 2DGTA 5J1PA 1X5SA 3CTRA 4JI0J 4I0WA 2QL5B 4X66F 2A18A 1YKWA 4A8SA 4EU0A 2L3MA 3QIPB 2MKCA 4HR2A 5H9EK 3GIRA 1S6PA 2DPJA 1SJRA 4Z2XA 1IBLF 2QMXA 2WONA 2VFUA 4DMZA 3TUIC 1K9MT 5M2UA 2MZQA 2ZJQQ 2P8IA 4MKVA 3DYAA 1EETB 3MECB 4XDCA 2YWWA 3HVTB 1TKTB 3D6FB 1WORA 2BM0A 3KK3B 4IFVB 2FGOA 4LF4F 1CS4B 3K8WA 1KVKA 3LP0A 4ZLJA 4CDIA 4NLWA 3TUJC 2W8KA 2IM3A 2BE9B 4JI5J 2CQDA 3N6LA 1CJTA 2XWYA 2AEMA 5H1SV 3A3PB 3I31A 5HL7Q 3TX0A 1TL7B 3DLLQ 2UU9J 1XNQJ 2QLWA 3BS9A 4WU3A 4USKA 2OEJA 2OP5A 3TW0A 2WVDA 2C3MA 2A3JA 1E6YB 4WFAQ 4DR5J 2DXDA 1F2HA 5AE2A 2UUWA 2CQGA 2A6OA 4LF5F 4FKYA 1NM2A 3KNGA 2HAFA 3PW0A 2A2DA 1F5BA 5HROA 2FVCA 2RIJA 2RRNA 4ILMA 5KFVA 3I96A 3Q89A 2Y1RI 3OFGA 4PG6A 3MM7B 2VHGA 1CJUB 1RLDA 2N7CA 4RR5A 4BLGA 2GHVC 2DO4A 5B7WA 1RSCA 2AIRB 1TU0B 4URGA 5HP1A 3OL6A 4D3HA 3LOUA 3AA8A 5KFOA 3K58A 4YHHF 3V4MA 1JIHA 2UZAA 4RW9A 4DL2A 2B7BB 2JC0A 1NH7A 2YPZA 2ZVIA 3PEHA 3J81U 4K2JA 4YB5A 4A47A 2VOOA 1VRTA 4IUFA 4ED7A 3GONA 1Q86T 5HO4A 1UAWA 1HLWA 4LMZA 4JI8F 1ICEB 1S6OA 3HK2A 2OSRA 3DMJB 1FRJA 3KLHA 2E5HA 3PNIA 3M32B 1M5SA 3DOMA 2M8DB 1YITS 5ADZA 5LMUJ 1UEVA 3UN2A 4NLSA 1X7VA 1RAEB 4DZ6A 5KFEA 4QWAA 4DQPA 4YY3J 3T5JA 4WF9Q 2BV3A 3ET6A 4XDDA 5LSLA 1SIWB 3FQKA 2IRUA 3C3LA 1RBOB 1U6FA 4FVCA 2GAGC 3HJFA 1VQNS 2UXCJ 4ECVA 2V63A 2XY6A 1S6PB 3H5YA 4QWDA 3A3NB 2OLWA 1RE1B 3CGIA 2W01A 2WONB 3GFYA 4Y00A 1OPIA 3MF5A 4K4ZA 2ZBCA 5BXIA 3D54A 1K1SA 4FS2A 3DYAB 1U1NA 2VC0A 5DLFA 3SV4A 3CCVS 1N88A 4QIWD 4C3MA 2Z8QA 1U1OA 1WDTA 2RHQB 3HJVA 1SPBP 4MIWA 3RAMA 3BKTA 4RU2A 3AH6A 5KG1A 3BN4A 3LP0B 1NXIA 2QLFB 3M30A 2RKIA 4GVBB 1VQ6S 3C6UB 1RYSA 3GJSB 2O01C 4B9MA 4LF8F 2FVRA 3AD7C 4USTA 1RT2B 2JH3A 1XBWA 2MKKA 4ZK7M 1AW0A 1EQ0A 4F04B 4WE1A 1WG5A 1J5OB 3OL8A 2QRRA 4I2PA 1URRA 2KJWA 3B4DA 3KKFA 1QAXA 2PIIA 1WC4A 3TQEA 5E3QA 1RWWB 2R8IA 2V2QA 2GIRA 3DOLA 2AU0A 1LNQA 2KRRA 3N0VA 4RZRA 4DPTA 4Q44A 5IS2A 4LSLA 3FZBA 4NA3A 3CCLS 2DNNA 1IM6A 2YNFB 4KSEB 1OJ4A 2MGZA 1U1QA 3RB4A 3NS6A 4LF6J 2CQHA 2HZVA 3QWPA 4ZLLA 4DCPB 3H90A 3KUEA 5HP1B 4XTTA 4TU8A 4FPRA 3VF0B 3Q8SB 2E66A 4RW4A 3D5MA 3K8VA 5E3AA 3KHHA 4DL0C 4RUHA 4LVOP 1WI6A 2RRAA 3DDIA 2DTJA 4MIBA 4N77A 2JLEA 2YWGA 2FLNA 2R8HA 2KT5A 3FQLA 4P10A 5EN1A 2JC1A 4EWTA 1NEEA 2HVIA 3IGVA 5LL6d 1FD2A 1U48A 3PFOA 3DDKA 3NL0A 4ZPTR 4KY3A 1KQGB 1R6VA 4EK2A 3HVRA 1S1XA 3KLHB 4M5KA 4CTAB 1Q16B 2XTJP 1IBCB 3WIUA 4J9OA 3HKWA 3HVAA 4M5DB 2HPUA 1NUEA 4ZCIA 4QU7A 4OFZA 2F4VF 2GW8A 2HS4A 1XR5A 1SC6A 2JZ5A 4TQRA 2XULA 3KLVA 4QPXA 4ZPAA 2F3JA 4CLZA 3V6JA 2MKHA 3DCAA 3JYTA 3HF5A 2OFHX 4YEAA 2LEBA 3ET6B 3MR5A 1PBUA 3W62A 2XO7A 1U09A 2HHXA 2Y0SD 4YS2A 1RAIB 3MR2A 3RUBL 4ES3A 1VQKS 3JSRA 4DX7A 4Q8FA 4LSNA 4CLPA 4RW8A 2PMZD 3JAMY 1U1KA 3T9NA 3H2UB 3T41A 3CD7A 2F4FA 3TA2A 4I69A 1WF2A 4I67A 3OR2A 3J81j 4LRFA 1NPRA 2DR5A 2FGCA 5J1EA 2QT7A 2ZNYA 4YR0A 2WTFA 5IZHA 2MEWA 2MQPA 2VASA 2DO0A 4ZVHA 1MU2A 4YN3B 1RAFB 4F0HA 4O0NA 3RBEA 3LQVA 4DR4J 3DGPA 2VODA 3U02A 1Y0HA 3DRPA 1RHQB 3F44A 4DSKA 1KC8T 1MN7A 2GC8A 2O3DA 4ITSA 4NXMF 1XMOJ 3UVJA 3LTOA 2Y1LB 4KPCA 3EGZA 2GJ2A 3M30B 2RKIB 4C6AA 4O3PA 3IC1A 2FQQB 4ECWA 5F9LA 2YWEA 2BJEA 4X4PA 3TAPA 3B4MA 2YXLA 4DWIA 5GAEI 1TVRB 4WE1B 1RGVA 1X5PA 2IAJA 2MDAA 3WQPA 5C25A 3I55S 5F8MA 4BS2A 2GA7A 4IKAA 1QSLA 4DUZJ 2ZOMA 4WKYA 2IM0A 1LFWA 4DV6J 2JDJA 3OLBA 3DOLB 3N79A 3GMGA 2IM1A 2GVDA 1T9VA 3PDNA 1SIZA 1R31A 4LSLB 1FXDA 3DI6B 4K5SA 2HBRB 4FYXB 1N8RT 3ZNUA 4NLUA 5EDWA 2MGZB 4ILRA 1B0TA 2EXUA 4LFCJ 4DSEA 2BZ2A 3W61A 4QIFA 1IR1A 2RSQA 5D4OA 4QW9A 3C66A 2FDNA 4HI1A 1VGYA 2RQKA 1RA6A 3SMZA 1WOOA 4QWCA 5A8WA 5KG0A 4E98A 1GQEA 1FE4A 3UPFA 3EE3A 2C3UA 4KHMA 1JXVA 3I5CA 1FF2A 3JQJA 2EKNA 1Q82T 3KK1B 4NEZA 1C1BB 1FTRA 1X4EA 2HHHJ 5HVHA 4IDKB 2K06A 1FWLA 3BEGB 3SIPB 1SH0A 5K8NA 1M5KC 4RWWA 1WC3A 2W7PA 2DVIA 3R5DA 5D0EA 2FYXA 2HK2A 3KDNA 2XSJA 3PRDA 2RF2A 4L72B 5LSRA 3SEOA 1GMWD 1S1XB 1RWKB 4ICLA 4CM2A 1AUDA 4RW7A 3TR5A 3GJQB 5AE3A 2IJNA 2AX1A 4C9DA 2ZHOA 2JVRA 3AOCA 3BBFA 1HI8A 1P9YA 3NGRA 1B7YB 4UQGA 1FJEB 2HG4A 1EP4A 5I4MA 1Q7LB 4B3OA 2ZH3A 4J5OA 5CAAA 3SCJE 3HSJA 1KLMA 1MMNA 3UR3C 4DV2F 4RW8B 1NKBA 1UVKA 1O8BA 1D9DA 1AZSA 2U2FA 1MSWD 2M88A 2WVEA 3DU6A 3OR2B 3ZZYA 3LALA 3KLFA 3W1YC 4NLQA 4NA1A 2AW0A 5J1EB 5JXSA 2P5VA 1MU2B 1BWEA 1FKAF 2NUUG 1U8WA 9RUBA 1T3NA 4X2BA 4H4OA 3BBCA 4KHPF 1OSDA 1LXNA 1C1CB 3GJTB 3OXLA 2XZTB 1UPPA 1HNZF 3S7RA 2EFVA 3M2UB 2MLXA 1UA0A 2M5YA 3QFWA 1RTHB 2OTLS 5KOWA 4RBUA 2KFNA 2IJRA 4ANDA 4J90A 1G3OA 3D1HA 3GYNA 1URNA 2Z30B 2FJDB 2E7WA 4OZ0A 3K2YA 2XCPA 1T9WA 2BW7A 1SL1A 2BANB 1NHUA 1TUVA 3C19A 3RYLA 5FDLA 3OVAA 2W9CA 1RT6B 4DV5J 2OUGA 1L3KA 2DB1A 3QGIA 3UQSA 2BM1A 3PR5B 2EG1A 3FJ2A 1RT3A 5DG8A 3MD3A 2V5HG 4F4AA 4LF4J 1X0PA 1PYOB 2O1PA 2M52A 4ID5A 4OV1A 1RAAB 2IMOA 1VHIA 3MMAA 2XI2A 3DRYA 5EGYA 2PFDA 3DC2A 5E5NA 2DCLA 2EC0A 2MQOA 3GIMA 2HNZA 1G4CA 5J2QA 2XQCA 2Q6BA 1NZAA 1FNMA 3NEKA 3Q8QB 3W8PA 3CCWA 1D9AA 2RDDA 3DLJA 4X64J 4FXVA 2EEYA 1PGZA 4DDFA 3A3OB 3PRVA 1SKSA 3MM9A 5CABA 4A48A 2ZZMA 1YSJA 4LF5J 4H4MA 1FK9A 2I8EA 2V9WA 3KHRA 2DGVA 4OYIA 4U7UD 3CJQA 4TKTA 5CYMA 2W7AA 4MFBB 5D3GA 3Q8PB 3S8SA 4JI6J 3I6PA 3DXSX 3TOQA 3HP6A 3IXQA 3P96A 4DSFA 4C11A 1N54B 2RF2B 2WVBA 3M2VB 4F4WA 5HVFA 1VBZA 1RT4A 4P2SA 1QSSA 3TZZA 2HFOA 2R8KA 4RW7B 2B6AA 1HNWJ 1RWPB 3AA9A 3W2VA 3DLBA 1PSDA 1P1TA 2VFRA 3MCOA 3D0IE 4DV7J 1YIJS 5D15A 1RHJB 4FPIA 2E9ZA 1S7HA 5ETQA 5CHCB 1H98A 4NZ7A 1EP4B 4PG5A 2EFGA 3MPVA 3W65A 1AFJA 2MHNA 1N36J 3T6BA 3QAUA 2B9EA 1GTEA 2GV1A 3D68A 1KTQA 4MYTA 1SVDA 3NGDA 3GE9A 3OSNA 3MEGA 4CO1A 1GEHA 1OPZA 4BCAA 2HHQA 2CPHA 1S76D 2HHTA 2V94A 3KMQA 1GMUA 3IN5A 5KFIA 3QRQA 5D0RA 2MKYA 4CLWA 1R27B 1GT8A 3QZ8A 1DLOA 1VRUA 4DCJB 3ENVA 3MCMA 1GX5A 5KFYA 2Q79A 4GO5X 3IP0A 2G1HA 1VBXA 4OI6A 4F26A 3KG0A 1TL4A 1VDHA 4YOEA 3J7A1 1NJXA 2J6UA 1WF0A 4HDGA 4K4VA 3Q2TC 3NMRA 1IXKA 3M1VA 2W9CB 3I9V9 2DNHA 2FPHX 1YX2A 2W8LA 3TUPA 3AFGA 3K89A 1FKPB 2OEMA 2MQLA 2ACMA 2XS5A 1RTDA 4C98A 3EICA 1N52B 3MMAB 3QGHA 3H2VE 4B9VA 1TAUA 1DARA 1UVNA 2E9TA 2BE7D 4RUBA 1BLUA 2AD9A 4LF8J 2HNZB 4W92B 5B0FA 4HT7A 2LA6A 5J2QB 3KOAA 2KG0A 3IRWP 2OMOA 2BA9A 2NXUA 3SFGA 4YQWA 4ZITA 3MM8A 4DPWA 4FF1A 3GILA 4AXJA 4AYBD 1R8HA 1R3NA 5HQLA 1B0PA 1TFYA 1JJHA 3MM9B 3TYTA 3EM1A 3MOZA 4K4YA 3FC9A 4TN2A 4H4MB 1FK9B 1BE4A 1IKVB 2ZM6F 1TP7A 3O6QA 2D1CA 4DN0A 2XMMA 3I9ZA 4K5RA 2VBZA 4NMXA 5CYMB 1Q78A 3P49B 3TNVA 2BJ3A 1HQ2A 2MZSA 2NREA 1WHXA 4NLDA 4TLQA 3GIJA 4DQIA 3MUMP 1FJGF 4C3LA 3LA0A 3OUYA 1RT4B 3FUYA 1F3FA 3K5PA 1T9TA 2B6AB 4OX9F 2KYZA 4OJGA 1CJVA 3W2VB 1S7IA 4ATNA 4IH6A 1UJ6A 5ETNA 2E5JA 1R7IA 3Q0AA 1HHSA 2P9GA 3GG1A 4G65A 2DR6A 2Q1LA 1SQFA 4J9NA 4ANCA 4ECZA 1GNKA 3J7ZT 4WWSA 3ZZTA 4J37A 1HBNA 5L38A 2HLUA 2JLFA 3LGHA 4L73A 1QUVA 5LJ3Y 5MLCV 4UOHA 3E01A 4J9VA 3V6HA 4FYYB 2HNDA 5KT2A 4WKRA 4F2RA 4IG0A 3DLGB 2JEIA 1RWNB 3HSGA 4ZKAA 4PYDA 2FUG9 4EO6A 5KFGA 1U2RA 5I42A 3LWMA 3Q2SC 4HVZA 3MFIA 1S72S 2YH0A 1TUWA 5AJ3F 2FLPA 2WSCC 1TL1A 1LQ9A 3KLEA 1D8ZA 1GMVA 3GIIA 1IKXB 1NJWA 1EX8A 1G1XA 3I5AA 3FEZA 5B08A 2HFSA 4KB7A 3UDVA 2XG8A 1BQNA 1Y00A 4FF2A 2CJKA 2FY8A 1S99A 3NRBA 4LT6A 3W9IA 1KHVA 1JMTA 2GZOA 1M1GA 3IBWA 2ZH8A 3HO1A 2VQFJ 2FVPA 3RBXA 3TRGA 2N7YA 2VD3A 3POTB 2G4BA 2B4OA 3MMJA 1SKRA 3CCZA 4ZPCA 2O66A 3EJMA 3D67A 3PFEA 3QT6A 2DNPA 2KYXA 3M1VB 2MPUA 2ZC4A 1V6HA 2V4JA 3CCUS 5HBMA 4YB1P 2FIUA 2F9DA 4I6AA 2MSTA 2QX0A 3MAAA 1N5YA 5FIIA 2W1BA 2KI2A 2F5GA 4ELUA 1JLEA 4NLOA 3L95X 2D3O1 3CC4S 3C16A 2IM2A 2DGOA 4ZVQB 2YVSA 1U1RA 2DR8A 2MQNA 1JX4A 1MNEA 4ZJQA 1SL2A 1HNXF 3EWGA 4AQYF 1BGXT 5SZTA 3NCPA 2A10A 3Q8VA 2IDEA 3IBFB 4OZNA 3ZTSA 3BR8A 3E3XA 3PO4A 3MM8B 3UCUP 2RDJA 2ZHBA 2HHVA 3QNWB 1ZAXA 2VG6B 1FXRA 2XYGB 2FJAB 1F5CA 4OJHA 1S9GB 1OY9A 3P5TL 4DU8A 3QT5A 2DPIA 1X4GA 1QY7A 2AEJA 3CDWA 3H20A 2KO1A 1B3TA 3OTOF 1HQEA 3S01A 1FRMA 4A8MP 4DFPA 3QO9A 3Q8UA 4EZ6A 2QJ3A 3QYYA 1BUXA 3GCWP 2CG4A 2B0GA 2ZJPQ 2IA6A 1N0VC 2J9CA 5KFCA 3OUYB 3IO1A 3GYGA 4B02A 2C42A 2WOMA 1LOUA 2XYPB 3N01A 3KJQB 4I68A 1Q95G 1YQHA 2PDAA 3DRSA 4LRBA 2KM8B 2DIUA 2R7OA 2UVRA 1U1MA 2J0WA 2MMYA 2VJVA 1WOPA 1N6QB 4JI2F 1SC4B 4KT0C 3HULA 3EUNA 3GSIA 5J2NA 4KKOA 1HBNB 4OYXA 4XK8C 4NASA 2WSEC 5ETPA 2VU5A 4DBQA 4J91A 3E01B 3FEXB 2HNDB 3H5SA 2CDRB 4NRUA 2QIFA 4C97A 4M5NA 1JKHA 3PG9A 3LANA 4FBUA 3CSKA 4WK1A 1HFEL 2YKOA 3GSDA 3VAGA 2C2MB 2XMUA 1TL1B 3KLEB 2GGPB 4FVMA 4UTGA 1JJ2R 2V4RA 1BQNB 1JLCA 3MUVP 3Q22A 4ECUA 4DR1J 1YTYA 3ZXWA 1UFKA 3NGTA 4B3TF 2B51A 2E29A 1MW7A 2GQCA 2BDPA 4FDFA 4JUZA 4P2MA 2YX7A 1PCAA 1U6BA 3TARA 2ROEA 1G7CB 4TYAA 1HARA 1Z2LA 2N3OA 3PCOB 1QTMA 3EMTA 3BREA 4NRTA 3SBMA 1RI7A 1WKLA 4DV3F 1FFSB 2UP1A 1WNEA 2BJDA 2KVIA 1HR0F 1XNRF 2DR9A 1REVB 1UVLA 1UMJA 3NCRA 3IM9A 3MAAB 2HIQA 1U6ZA 2B4UA 3NY0A 1JLQA 3H59A 3AOBA 1SL0A 5AE1A 3CNQP 3C16B 3GCXP 1Y5NB 3GQCA 3SQOP 5B0EA 1QVGR 2KG1A 4X4VA 2KTQA 1VYAA 3MPDA 3JS9A 3RZAA 2NYHA 5B0CA 2VIHA 3NG8A 4IRCA 1Q81T 2KXNB 3PX6A 2NS1B 5E2QA 1S1UB 2JL9A 4B08A 2D3UA 4EBDA 1U0SA 3UD4P 3RJMB 3HKZD 3CDAA 1SH2A 5KFJA 1T9YA 4I56A 3ENAA 4C8YA 3CVKA 3BKFA 3M6UA 3BO2A 3EVOA 1FI4A 2G2OA 4ED1A 4LFBF 2CYYA 1HQEB 4ED5A 3QO9B 3IWNC 4UQTA 3B54A 3R6GB 5IC4B 2A0FB 3LUYA 4BBYA 5IT0A 3C2PA 2O5DA 5C42B 4JI0F 2C2DA 4Q8EA 2VBWA 5F8GA 2B5JA 2WZ1A 2J0SD 3RB0A 7FDRA 2MJNA 3N6NA 1Q7YT 5KG5A 4QZVB 1TR0A 1SJ3P 3LWLA 2OPPA 3DRSB 4KAIA 4O44A 3D3BJ 4CH0S 3DRRA 2KM8C 3EVMA 2E9RX 2G0JA 3AOAA 4C8LA 1VCTA 2UXDJ 3CIMA 4C7QA 3CCQS 4UF4A 1M5HA 1T05B 5DJBA 5J2NB 5IQ6A 4QBUA 4PYAA 2F8HA 1K73T 4KFBA 5G0RA 1H2VZ 2DEIA 3BQ2A 3SQGB 1YG0A 2UUCJ 1FD8A 4JI5F 1EKRA 4Q2MA 3K59A 1UZDA 1JKHB 4EI2A 1JXLA 4DFKA 2JNJA 2UU9F 2PT0A 3H8YA 1X4AA 3HHDA 1JWWA 4LREA 1R8PA 2F9JA 3KG4A 1CJKA 3BPSP 3THVA 5KAKA 2CA9A 4KR0B 5IT9Y 4MMOA 4F0KA 4O4GA 4G6VB 4IO1A 1SCJB 4C8OA 3JTNA 5JVHQ 4DR5F 1U24A 2G2YA 3SCIE 1T94A 3ZO7A 2ZH4A 1S6QA 2CG8A 3W2WA 1JB0C 5EX3A 5DQIA 2HK3A 3UDEA 2DGQA 2E1MC 3B82A 1MROA 3H5XA 2AV5A 1Y10A 1KSPA 2QG9B 2D3ZA 1RK8A 3O3LA 5C2GA 3TZYA 1K44A 1Z2ZA 3UR0A 4FP9A 2BMBA 4C0BA 3MTKA 2ZITA 4AXIA 3LAKA 5DGBA 2R7QA 1CPZA 4F25A 1I51B 3JTPA 2Z2YB 4NZ6A 1ZTTA 2HRTA 2JEFA 1M1KT 3D6HB 5KG7A 1QVFR 3RB3A 4OIXA 2UVWA 2CPEA 3IAM9 1JJ4A 2YX4A 5LJ5Y 2CUYA 3ITHA 1CC8A 2DJWA 4KTQA 5DG7A 2RUGA 2E1PA 2L41A 3IAS9 2R2RA 3IRXA 2XZDB 4HDHA 5E0OA 2QEXS 4UZBA 1LK5A 5DRKA 3OFFA 1UKUA 3RTVA 2C2ZB 2BACA 5KT4A 2JJ4D 3DLEA 4ILLA 1KOHA 4K2XA 1HWIA 1HBUA 2D9OA 1ZM3A 2RMLA 2HBZB 1KD1T 1HBMB 4G1QA 2ZH1A 1RT1A 4NCBA 3SSRA 4PG8A 5AXNA 2HNYB 5LXRA 4YY3F 1RAJA 3EDQB 2G2ZA 5HLFA 2ACYA 3UE2A 3N5BA 7AT1B 4FN5A 4PG4A 2KU7A 1KVIA 4M5IA 1NJIT 4DQRA 2EWHA 1L3TA 2B5JB 2EKYA 2UXCF 2QO3A 3MCNA 1T95A 5GADI 1PO6A 2ZM6J 2CPZA 1JK9B 2OPPB 4A8KA 3BDPA 4O44B 3EVWA 4OHYA 4DSJA 1IQTA 3LH2S 3A13A 3NWGA 5IWAJ 4Z7CA 4QR0A 2AZ1A 4NA2A 1FNOA 2Z2ZA 1H74A 4B3MJ 2UUAJ 4HH0A 5E3CA 3IWLA 5C2CA 3OTEA 3JSBA 2YKMA 4Y34A 4L74A 1M90T 3CD5A 4KFBB 5G0RB 2HWHA 4ZPWR 1AXQA 4TVAB 4JP8A 2D3OR 1PC5A 3MEDA 1XTZA 1UJ4A 3MD1A 3TEHB 4YP3A 1IM4A 4A4JA 1GX6A 5F0WA 3K57A 1WEYA 1SQEA 2V68A 4EYHB 1NSQA 4F4KA 1KLNA 4DUTA 4J9SA 3DOKB 3D6TB 4O4GB 4C8NA 4F36A 1EJ7L 3ELHA 1TV6A 1F60B 1KOOA 2FZKB 1HL6A 3JAMU 5IC6B 3WIVA 3E2EA 1S6QB 3IG1A 3W2WB 2HGMA 4K4SA 3IBCB 2FY1A 2H65B 4IRKA 5F3TA 3HDSA 3NCQA 4LF2A 2OPSA 2PO4A 2H4YB 2HAIA 4USWA 2YBVA 4DQSA 2IC3A 3GPAA 5E3PA 4LF6F 4K4TA 5HAOA 5T41A 4IQXA 4NLVA 3BV8A 2DISA 1VR6A 3BR9A 1FWKA 2FHJA 1UW4A 4HACB 2HKEA 3QATA 4OL8A 3O1LA 2L48A 4X4RA 2ZE2A 3OL9A 2J8SA 1TKZB 1PAEX 2J5AA 5JJBA 3ZNJ1 4EBCA 3WC0A 3R27A 2YQ0A 4WFZA 3W3SA 1VQ9S 4C8MA 2R4FA 4CNYA 1TL5A 3GR0A 2XHCA 3VAJA 3RAQA 4URQU 3ITHB 3BSCA 4EGLA 2NQPA 4KBIA 1E6VA 3CCTA 1VQYA 3THPA 1FRHA 2GMJA 4FF3A 3IRXB 2CJBA 3PKYA 4MT1A 2NSBA 2HVEA 3OVSA 2I5JB 3F56A 4BWMA 4OZ1A 3DLEB 4U9RA 4DR7F 3UD5A 4MYUA 1HBUB 1DURA 2FJWA 5FLXY 4ZVFA 1M1HA 3QT7A 1RABB 3UCGA 4PABA 3HHLD 2LYVA 2VDHA 4G1QB 2AGOA 1RT1B 3GR1A 1NK4A 1YJ9S 2ZBQA 5KFBA 5KG3A 3AJDA 3PEJA 5EWFA 5HLFB 4LBHA 2DH8A 2DRDA 2M7SA 1HNIA 2CQ1A 6FD1A 2F8EX 1RBLA 3MMBA 3ZC4A 1CC7A 4LUBA 2DHSA 2GFFA 3ZZZA 3OTBA 2R42A 4JV0A 3G6VA 1SKWA 3M7VA 3D7SB 2BR0A 3M9NB 2LQBA 4DR4F 2FZCB 2BUNA 1YLXA 4YMEA 1JLBA 1RA7A 4ED6A 1XMOF 3OTDA 4B3RJ 4HYKA 5A2QY 4GKJJ 5KFHA 1PBAA 2CRLA 4X62J 3NNAA 3M9MB 3MEDB 3UI3A 4D3GA 4IYQA 2ZKTA 3IR7B 2UVUA 1I6JA 2BJ8A 5F41A 4JI7J 4DV1J 3L7OA 3PM9A 1KR4A 3M4XA 2J6SA 3OFEA 4U8YA 3N9UC 3G6ES 2KXHA 2MTLA 4U6PA 5HMWA 2DNLA 3PYGA 1V3ZA 4TY9A 4OJ1A 4DOZA 3ONQA 4DUZF 4DLEA 3LP1A 3ICLA 3O8WA 2BYCA 4DV6F 4IQMA 3V2UC 2RDIA 3OW2R 3DGVA 2IMWP 4RX6A 3IG1B 4PWWA 4P7TA 4A8YA 1S1TA 5THWA 2GJIA 2OSQA 1FT8A 3PKMA 2CFXA 2IC3B 2B8QA 2YKAA 4LRAA 4LFCF 2AJFE 3EGWB 1LXJA 4RBVA 1ZM4A 3T1YJ 3CIZA 3AXMA 2GQQA 3FGVA 2HIYA 2HW3A 3ZFVA 4RJVA 2JFDA 5IFMA 2VBYA 2CPXA 2ZE2B 4Y28C 3DM2B 4KIAA 4CLFA 3PX4A 2VV5A 2HHHF 1HQUA 3FVYA 1XIQA 1GFWB 5A8RA 4L3NA 2J7WA 4N8NA 4U96A 1ZZNA 5KFRA 3P5BP 4OZJA 3UFCX 2XMJA 3BH7B 1X4BA 4WTOB 2L9DA 3TEGA 5JMNA 4O4RA 2BEFA 4Q45A 5D4NA 2CZ9A 1C4AA 1WOSA 2VPZB 1C0TA 1QDUB 1RHKB 1QSYA 2B4PA 2HEKA 2HFVA 5IOLA 4Y2IA 2AF6A 1LK7A 4NX9A 4HTJA 2CQCA 2FVSA 4TQSA 4DX8H 5KFPA 4Q0BB 4QWEA 1VFJA 3C8YA 2R7WA 3EPGA 1I3OB 2HBYB 4NYOA 3RW7A 3VZIA 1O5JA 3TAQA 2M3DA 3HSDA 4WIIA 3N5FA 3VQSA 2EFOA 2DH7A 4F50A 5BJRA 3QLHA 3BYPA 2AGQA 2WHOA 1APSA 2DNZA 3KHLA 5HJYA 3AB2B 4I7FA 4MTPA 4KH0B 3IA0A 1R6YA 1RWMB 1CVJA 2EI5A 3CJKA 2W2NP 1CG2A 1FFWB 2BBEA 1JLBB 3GFXA 2CAJA 2E1AA 2GIQA 4XPCA 4Q7AA 1MN9A 4O0IA 1VI7A 4ZVUB 4ANEA 3M8RA 2DHAA 2OIHA 4QIEA 4QYZJ 3IM8A 3VQTA 2POKA 3M8ZA 1AYEA 3CDBA 4KV8A 1Z1ZA 4CI0B 4U67Q 4QYZK 2I6WA 2AWZA 4B9NA 3ETOA 2P9EA 1VOMA 3RB6A 3CD0A 1WEZA 2H3EB 4DV5F 4JV1A 3M6VA 4WFXA 1KQKA 3KJFB 4PEOA 2LXIA 4P6QA 1Y5LB 3M8YA 3MEKA 2HLTA 5HQMA 4QOTA 4ZN3A 3PYEA 1O51A 4NE9C 1MWQA 2HHSA 1S1TB 4NCAA 3V4IA 1X60A 4WP9A 2MLZA 1FVQA 2ZBPA 2Q66A 1H7XA 1PJ7A 9ATCB 5L8RC 4AL5A 4Y3CA 4WXOA 4X64F 4GC6A 2AMCB 5AXKA 2KT3A 2F63A 1SBRA 1RHMB 2EG2A 3BGRB 3H4BA 5GADU 4YUDA 4CLYA 3PXGa 4F3MA 4GRSA 1IBMJ 3T1AA 2H4WB 4C3KA 2GJFA 2EFPA 3GZ7A 1WHWA 2QFIA 2XY7A 2KVQE 2BE2B 5E33A 2PMWA 1HQUB 2DEJA 4JI6F 4PQUB 3MR3A 1GXTA 5A8RB 3I0SB 4WBFA 4C8KA 1ACMB 3FBFA 1U47A 4H4KA 2BQ3A 2MZTA 1MLAA 4XO0A 1HNWF 2GQ2A 5KFNA 1C0TB 3VAHA 4JV5J 3BGFA 1RUSA 1RADB 1QAJA 1U26A 5L1KA 1D3WA 4DV7F 4LF1A 4IRDA 2BX6A 3V6KA 1LWCA 2E44A 3FKBA 4USIA 3R3TA 3MM6A 1FEHA 3D66A 1HWKA 2J6TA 4B3SJ 2DNKA 1MWZA 3PHEA 3J7Z5 4C0OC 3H4DA 4MKBA 4ZPBA 1N36F 2QE5A 4O3OA 3QSIA 3QLHB 4QR1A 5RUBA 2AGPA 3TANA 3M6XA 2G9OA 2G0IA 2ZUAA 2PD1A 2VPYB 3X3UA 3G8TA 1R0BG 1U45A 2I38A 1VRQC 1FDBA 3JSMB 4OMFG 3CC7S 4ZVOB 5DLGA 5A76A 1U8SA 3MMCA 3CJKB 1U4BA 3M2RA 3ISNC 3CCRS 1FWPA 1NLKL 4ENOA 1S9EA 1IJFB 3R2DJ 2X7IA 1UWBA 5D0HA 3FRZA 2PSZA 3BPDA 1F1BB 1S9FA 3NGSA 1SC3B 2VG7A 2PEBA 4QU6A 2UUBJ 4ES1A 2YWKA 5I3QA 1FE0A 5D0GA 4KGMA 2PMHA 4IO9Q 1NSKL 3U27A 4FXWA 2G13A 4LSZB 1KRPA 4RNHA 4AUKA 1YK9A 4NCGA 2QMWA 1PKUA 2DXFA 3J7YU 4X4OA 5K14A 2AJ4A 3VGTA 1SH3A 3KWMA 2FLOA 3DNCA 1N0UA 5A8KA 3I32A 3H7HB 1HWLA 1CJTB 3SCKE 2R8JA 3PV8A 5IT4A 3V4IB 5GVQA 3U1NA 2K3IA 2X1BA 1YBAA 3BO4A 4ZVGA 4H54A 4F0MA 3O44A 3BJYA 4ZCLA 3EGVA 1M0SA 4QQBA 2W4PA 5KFLA 2WVFA 1IKWA 2DGSA 4UUWA 2AJQA 3M8PA 1MMDA 2VKZG 1XR6A 3FCHA 4NXNJ 4DR2J 2WRMA 2FD2A 4DX5A 1YJTA 5KFKA 4FBTA 2VPWB 5HROB 1RAHB 3DLKA 3ENQA 1G2EA 2ZDOA 5ETKA 2FHMA 2HGNA 4S0MA 4ID8A 3FSIA 2JRSA 5IV3A 2OO4A 4X4NA 4JB8B 1N5VA 3KMSA 2Y3YA 1S4EA 3IWXA 1JNZB 4KO0A 3FBCA 1UA1A 2OKQA 4RW9B 2R7XA 5EWGA 3QRPA 3ZZPA 3I4PA 2M9KA 4MIAA 2JWNA 2WAQD 1REGX 5CZVA 1NPPA 1I5OB 3IFEA 2HQFA 1UVMA 1VRTB 2C2KB 1X5TA 4RNMA 1LWCB 2IVYA 4LF7J 4WFNQ 4OHZA 2HURA 2R2UA 1TAQA 3TZWA 3DHWC 4NL5A 2H54B 1VQSA 1WWHA 1N56A 3G71S 1IR0A 4I6WA 4DR7J 4X4UA 1CQMA 1Y5IB 2AEFA 2NZ4A 3RRKA 3NBPA 5K8MA 2DKOB 1N32F 1HMVA 3C15A 1F3VA 2J9DA 2B9XA 3DOMB 3DFEA 3HZEA 5DG9A 2XLJA 1DTQA 2IRYA 1VQPS 5CCMA 2NZCA 4CM0A 4G1PA 1WSVA 4ZP7A 2UUTA 1LW2A 3PJXA 1W7WA 1RTJA 2DHGA 1UWBB 4DF8A 3D0GE 3L3CA 1RZMA 2VQEJ 2C3PA 3U1LA 1XMQJ 1JJCB 2VG7B 3SYZA 2N4DA 3MM5A 2VQFF 4ED3A 1Y7PA 1S1WA 4KYZA 5L1LA 1JLGA 3PW4A 4KGVB 2HRYA 1WUUA 4NI2A 4NCGB 3WBZA 1CULA 2SXLA 3F0NA 2P9CA 2CNKB 1YRTA 1NCLA 4CLLA 5KFWA 5K14B 1O0PA 2XI3A 3KUHA 3MPYA 4ZVSB 1QJHA 3VAIA 5A8KB 2DNGA 3T5LA 4AFFA 3US5A 4BDPA 2K7JA 2XC9A 3Q8YA 1RXOB 4P73A 3KK2A 2KL8A 5AXMA 4CIOA 1TK0A 1VC0A 3FFIA 3CJTA 1QM9A 3NGKA 3H5UA 4C4WA 3VVUA 3SDEA 4LBIA 4LJMA 4G3IA 2BRKA 4DL3A 1H6KX 4ETXA 4DG1A 4I2PB 3PIPQ 4X84A 2CNOB 5DDQC 3HD1A 3M9OB 4ZP8A 2QN6B 1VC5A 1NDLA 4RU9A 3DLKB 2QMUB 3PYDA 3KNAA 2RNEA 4ED4A 2A1BA 4WK3A 4O3RA 1AB8A 1TQLA 2JHEA 1D9FA 2G1DA 5D78A 4PXBA 4IFYA 2CNLB 4A8OA 1A9NB 4P2FA 3WX8A 1U1PA 4CT8A 5L46A 3T19A 3KXDA 3OTCA 4MH8A 4FYWB 2PC6A 4RW4B 3KYLA 1KFSA 4MK7A 2CXEA 5DZ7A 1OWXA 1M5OC 1L5UA 1QTNB 1X5OA 2IHR1 2ZVSA 1PC4A 4RNNA 2XBPA 4F67A 1X4CA 4OX7A 5HJXA 3PW5A 1ROFA 2GS8A 2L9NA 3TAMA 3I82A 2VUGA 1FCAA 3CCSS 3HD2A 2L9WA 3R2CJ 1TFWA 1PAUB 3BH6B 3T3FA 3IS9A 1DBDA 4OZ5A 4ECSA 3PIOQ 1C4CA 4PXCA 4PWDA 2IPOB 3UNGC 1PJ6A 1RJJA 3NBPB 2KT2A 1HMVB 3C15B 1FO1A 2FTRA 3MR6A 2LFVA 1NNDA 2K7KA 1DTQB 4A8WA 4BHQA 2H48B 4ED0A 2DT9A 5L1JA 1ZTWA 2DGUA 3RU0A 3JYTB 2Z0GA 4RUAA 2CJXB 4I64A 1N34F 2KHCA 2IYIA 1RTJB 3CDUA 3HHKA 2F65A 1RTIA 2EVZA 2LU1A 4LSNB 1FKOA 4UOGA 1EQMA 4DR1F 4DFMA 2BW2A 3CUNA 1EETA 5A0YA 3HVTA 1TKTA 4OYOA 1YJUA 3EZ5A 3KK3A 1P6TA 4IFVA 2F7VA 2H9ZA 2HQCA 1JLGB 2VZ9A 2ADCA 2V2VA 3CO9A 1ZPWX 3CCMS 3QT8A 4NI2B 1BXNA 3MCSA 1KQFB 1CULB 3DGPB 2JOQA 1O6XA 5ETVA 2JLGA 3DRPB 2V2KA 1X0FA 4V19X 1LV5A 3OHAA 4EZ9A 4ZPVR 5CA5A 3UVJB 3EX7B 3FCWA 2GHWA 2HWTA 3FBBA 4EMDA 3J7AN 2A2CA 3HLUA 1U7LA 4AD6A 3EZOA 4DPUA 3KK2B 2HVZA 4LBPA 4M8LA 2E7XA 3SSSA 1E6YA 1SQGA 1T9UA 3U1MA 1X9SA 4Q2LA 2V50A 1NJZA 2IAJB 5IT9U 5C25B 1RACB 3X1LB 2U1AA 4A46A 1VK3A 3TUZC 2LA4A 4GVLA 5GMDA 1ELOA 2AYGA 5KFAA 2BJ7A 1WKKA 5H9FJ 3MM7A 2VFSA 2GVDB 2FJVA 3QRRA 4X4QA 4ECRA 2Z57B 2ALZA 1G6BA 4KC5A 2J8AA 1NBEB 2LCWA 2CPFA 5H9FK 2FJEB 4WXWA 5B0DA 5CZXA 2E1CA 1ULRA 1HW9A 3CDEA 2J9EA 4U7UK 1T9XA 2ILZA 2CWXA 1HIYA 1VQ7S 4JI4F 3MI7X 2IY5B 5M2PA 4QWBA 1BQMA 4MAKA 1RKJA 1OO0B 3HHEA 4A8QA 4ZN1A 2OJ3A 5A8WB 1IKYA 2LQ5A 2IA0A 2KB2A 3FCVA 2YNIA 2M8HA 4PPDA 1ZA2B 5F0UA 4IH5A 2UXDF 4DEZA 1ZZFA 3R7BB 3DMJA 4GC7A 2WBMA 1Q5VA 1D1UA 1KVJA 2XSJB 1UP1A 4NLRA 2RQMA 3MR7A 3IS9B 3UN5A 4ICLB 3ZZUA 3TVZA 2W2MP 1PYSB 4CLTA 4Y2KA 5HATA 2UUCF 4PWDB 1CSJA 3I87A 3CE8A 3SZ2A 1YJWS 3V81A 2RVJA 1IWGA 2IVFB 1RISA 3KJVA 7FD1A 3JQMA 3FSXA 4OI1A 2HHPA 5H9EJ 3GJRB 3O2IA 4JYAJ 2QLXA 4B3OB 1SC1B 5HI7A 3NGUA 1KLMB 1RTIB 2IYGA 2VONA 1FJCA 2D69A 1FKOB 5D77A 1AZSB 4N56A 4P7VA 3JSYA 2AKWB 2GAHC 3JTOA 3PVXA 1AFIA 5A0YB 3KLFB 2DRBA 3OXGA 1Q8BA 1NH8A 2BKPA 1XN9A 1PIEA 1DTTA 4J9UE 4H4OB 4EFAC 4KPYA 2XGQA 2Z56B 1NK9A 1HHTP 2NUHA 4GVBA 3C6UA 5ETMA 1GTHA 2MYFA 4EEYA 5KTQA 4QIVA 4UY8T 2ZH5A 4QPTA 1PILA 2LLZA 1S4FA 1RT2A 1W26A 4DL6A 2OEKA 5LMNF 1OQ6A 2BQUA 5DM6Q 1XC9A 4J9RA 3LO3A 2C2OB 2VB6A 1J5OA 2PI5A 1V5IB 4ECQA 3VGVA 3DU5A 2BABA 5FDLB 3HVWA 4F4YA 5BR8J 1K0VA 4UT4A 4Y0FA 4IR9A 3CD6S 4QYRA 3NMAA 1WKJA 3LAMA 4FS1A 4X65J 1NSPA 1RT3B 3CC2S 5B09A 1YBUA 3RBDA 1IVZA 3PACA 4ID5B 2YNFA 1YJRA 2ZHAA 1UVIA 4DSLA 1N33J 2KHDA 2HVDA 1NK5A 4B9LA 3HXMA 2ZH6A 3ZZ0A 1L3UA 4J9KA 1BMQB 1HNVA 4PXEA 1RCOB 4U7CA 3SCLE 5DS7A 4XPEA 3FEYB 3ZZOA 1FNXH 1UVJA 5F8LA 4A8FA 4NPOA 2AJ2A 2CQBA 2ZFHA 4CO3A 4P71A 1HI0P 4A8XA 3A4TA 1BQMB 3QZ7A 3TP2A 2JSXA 2FJBB 3LGNA 1WACA 2OFGX 1IKYB 3SFUA 3ILJA 3K5NA 2YKQA 1ZM2A 2YNIB 2IBKA 1WG1A 1RQ0A 2R3VA 3R9LA 1YJNS 4ETZA 3KTQA 5IWAF 5D3GB 2DHHA 4UOCA 4ZS6A 4B3MF 3HX9A 2UUAF 1FVSA 2XMTA 4F4XA 4JI1J 2CADA 4CTAA 4M5HA 4OLOA 1W2IA 2V8GA 4JI3J 3HT0A 4C11B 4M5DA 4K7QA 3H25A 4TY8A 2IIHA 8AT1B 1WC6A 1W25A 2F1FA 3JXOA 4QCLA 4CCHA 3AQOA 5FLXU 3DKDA 4DS5A 4B9UA 3Q86A 5B0BA 3V81B 1VJWA 4UZCA 2X1GA 3KJVB 1HI1A 4DV0J 2Y8WA 5GAHU 4RKUC 3WZ0A 3GWCA 1J5EJ 3RRGA 4FZVA 2VPXB 2LXUA 1R8BA 1UETA 3HI9A 3KLIA 2XMKA 1FDNA 1RTZA 3M05A 5LSOA 4CO2A 1WC1A 1BHNA 3H98A 1A0OB 5CYQA 4LFAJ 1N32J 2FHOB 3KUGA 3MEGB 4FF4A 2L08A 5FJ4A 1RU1A 2C3YA 4PKDB 1DTTB 3MURP 4IG3A 5KFSA 2Y9HA 2CJAA 1Y9OA 5EWEA 5BYQA 4I4BA 2CPIA 1RKIA 3LF0A 2ASLA 4JV2A 2E5LF 1DLOB 1VRUB 5DO2A 4KRWA 5L9XA 1T03A 3UW1A 5A2QU 4ZIVA 5U47A 2ZOGA 3TJAA 1XEZA 4BC7A 2V8PA 2BRLA 4O3QA 4ER8A 1SKUB 2H5EA 5KFUA 4OZ3A 1TVRA 2ZEJA 2QL7B 3NS7B 4DR6J 1U2FA 1GAOA 2K8GA 1R8CA 4YR2A 3EXCX 4QW8A 1XERA 2GVZA 3NWRA 5CXTA 1RHUB 1U1LA 1YRUA 4WYLA 3OV7A 4DPXA 4OHVA 2LVWA 4M5JA 2H51B 1EHWA 1HD1A 1RTDB 3DI6A 2V4QA 5HK4A 5B0GA 2JEJA 2OH2A 1RT5A 1I94J 1NK0A 5C24A 1S1VA 3QGGA 2BVZA 3CJ8A 1FHTA 1ITPA 1LW0A 1NU4A 1P27B 1HPZA 2AJ0A 5F3ZA 3LPYA 1HNVB 3QIDA 3CJSA 1Q53A 3ETMA 3OT9A 2UV8G 3A8EA 2I9SA 1CLFA 2DNRA 1FTCA 3TWZA 4EYIB 4OYPA 4C2MA 1GMWA 3MPWA 1M5VC 1HWJA 1KONA 4FYDA 3KK1A 1C1BA 4IDKA 4X4TA 2ZZTA 3CT9A 4CH1A 2CZVC 3CJRA 4ZJLA 2NXNA 3DRXA 3NP5A 4MKAA 3P3DA 4CZCA 3G4SS 3PZPA 1H2TZ 1UWAA 3KG1A 5KG6A 3BGLA 4QIGA 1NAQA 2BKOA 4B3RF 4TY8B 1DJ0A 4GKJF 3GTYX 1CJVB 4X62F 1NHKL 3C6TA 3L7UA 4DQQA 1IJEB 4HT5A 2QLBB 2BXJA 3MAQA 3R7SB 1TUGB 2HVHA 1AUSL 1IWAA 3LW5C 4JI7F 5IXUA 4DV1F 1TKDA 2DIVA 4U95A 1VQ8S 2CPJA 2AJ1A 3UDCA 2MKIA 3VR1A 2QV6A 3IR6B 1V3RA 3NOGA 2EC2A 3R5JB 4RW6A 2X51A 2JFKA 2D74B 3KLIB 4OYMA 2B3TB 1ZS6A 1MWYA 3PYFA 4C0HA 1H38A 1NK8A 3QMQA 3VCDA 3TA0A 3VAKA 3GV5B 1IBKJ 1GXLA 4LQ3A 3R97A 1SJ4P 1K0TA 4IG0B 5CYQB 3H2LA 1R8AA 3UNYA 2MQQA 1C1CA 3M2UA 4DV4J 4PUOA 1RTHA 4NMLA 5I42B 3GFZA 4IG3B 2ZWPA 2LDYA 2GCFA 3ZZRA 1OSCA 2GO8A 3T1YF 1N34J 2VBXA 1R89A 2P6TA 4O23A 3CCJS 3RG6A 4DUYJ 1X9MA 2VL1A 4HLBA 2KN4A 4WTYA 4IR1A 1TK5A 1T03B 2BANA 2QL9B 5CYJA 1X9WA 4HHJA 3CXCR 1RT6A 4DPYA 3SSQA 4HTIA 3F41A 1KN6A 2GVZB 2P2CB 5HANA 3I56S 1S0VA 1Y3JA 2V4JB 5DDPC 4YB6A 2C3OA 4HL9A 5HBMB 1S77D 2GMHA 2MZ1A 1KNZA 4F3OA 4R25A 2Y1IA 1N5YB 1X4FA 3KFWX 1JLEB 3AY0A 2Q6CA 4DF4A 1UFLA 2WBRA 1RT5B 2PI4A 3P6YC 4LF9F 1RT7A 2HWIA 5C24B 5E3RA 1B7FA 1S1VB 1LW0B 3R5GA 3ZTRA 5HQ8A 3QSYB 1X8DA 1V3SA 4DLGA 1AA1B 4K50A 1HPZB 4LIWA 3TI0A 3OSPA 2BJ9A 1XR7A 2LEPA 1XMBA 3ENWA 1MG7A 4LVNP 5GMEA 2R7VA 3W64A 4NLXA 3K5MA 1YRXA 3CJ4A 4DL5A 1OS5A 3T1HJ 2B9WA 3M8SA 4K0KJ 2VA3A 2NSCA 4PRFA 1VQ5S 1TZ0A 5D8HB 4F8RA 3QJJA 3VHQA 4R8UA 2K3KA 4MFBA 3T6JA 1SB6A 2UV8A 1AROP 3GB0A 3ILIA 2DYAA 4OYZA 2ASJA 4CP5A 1PG5B 2W4DA 3RRHA 3J80Y 2QGFB 3HM9A 2ZH7A 2H5JB 4OV6A 4GKKJ 3BGUA 3M2VA 1JXEA 2ERRA 3QJPA 2ILYA 2VFVA 3CWJA 4PPZA 3NXZA 2EPIA 2VKRA 3BSAA 4V1Ak 4TXSA
chains in the Genus database with same CATH topology
1SI9A 4ZPBA 1N36F 2QE5A 5F8JA 3HPOA 2QA4S 3K5PA 2Q43A 2B6AB 4OX9F 4O3OA 2KYZA 4OJGA 3I5BA 2B9YA 1DQ9A 3QLHB 4QR1A 3D1OA 2ADBA 2AGPA 3W2VB 3TANA 2MZRA 3MWBA 4I6YA 4ATNA 3M6XA 4PXDA 3FRYA 2G9OA 2WOMB 1Z4UA 2Z4PA 4IH6A 2PD1A 1UJ6A 2VPYB 3X3UA 3C6TB 2E5JA 2LU2A 1IBKF 3G8TA 4Z37A 1U45A 5GAGI 4NLTA 2DHXA 2I38A 1R7IA 3Q0AA 3FMBA 1HHSA 1FDBA 3JSMB 2P9GA 4OMFG 3GG1A 3CC7S 4MK8A 2Q1LA 4J9NA 1OIAA 4G1IA 4DV4F 1GNKA 5DLGA 4ECZA 1S48A 3DHXA 3J7ZT 1U8SA 3QGPA 1MMLA 3ZZTA 1SXLA 1NO8A 3MMCA 3CJKB 4J37A 4OI4A 1U4BA 1SJQA 3M2RA 4Q5VA 1HBNA 2QZ8A 5L38A 2CIMA 3ISNC 2HLUA 3CCRS 1NK6A 4JOUA 1Q1KA 3MGJA 2JLFA 1LW2B 4W90B 1S9EA 1IJFB 2PE8A 2W9AA 2V8DA 1QLNA 4KKOB 1QUVA 5LJ3Y 4BC9A 4RW6B 1UWBA 2K2PA 3FRZA 3QIPA 5MLCV 1HYSB 2C28A 2PSZA 4DPOA 3E01A 4DUYF 5F8HA 3V6HA 5FD1A 2DNOA 1S9FA 1D8YA 2HNDA 3BZQA 5D4PA 5KT2A 2VG7A 2PN6A 4WKRA 2WB1D 4F2RA 4IG0A 4K4XA 4QU6A 4ES1A 4ERDA 2YWKA 3DLGB 3SI8A 5F8IA 5I3QA 1FE0A 2XS2A 1WHVA 2JEIA 5KOXA 2RU3A 2RS8A 4ZVEA 3UCZP 3HHNB 3R5CA 1CQNA 2EFQA 4ZKAA 3MM5B 4KGMA 2PMHA 2FUG9 5EUHA 4EO6A 1Q8IA 2HGLA 1U2RA 4ZOSA 5KFGA 1FRXA 3MECA 3Q2SC 3V5RA 2AYMA 5ITHA 5KT7A 4HVZA 3MFIA 1S72S 4IO9Q 3U27A 4FXWA 2G13A 2YH0A 1YHQS 1KRPA 4PUOB 4RNHA 1S1WB 4AUKA 5AJ3F 2FLPA 2WSCC 4ZA1A 1TL1A 1LQ9A 3KLEA 1YGYA 1D8ZA 1N4LA 3GIIA 4NCGA 1IKXB 2QMWA 1NJWA 4IH7A 1G1XA 3J7YU 3OUYA 1UFWA 2MSSA 3AAWB 1S0OA 1NKEA 1NRKA 3I5AA 1FRIA 3FEZA 4DHVA 5B08A 4X4OA 4KB7A 2ABYA 2B4VA 4AL6A 5K14A 2AJ4A 3TQ1A 2XG8A 1BQNA 1ZBTA 1SH3A 2ZUGA 1Y00A 4FF2A 2BQRA 4OX8A 3KWMA 2CJKA 1S99A 2FLOA 4XAKA 2DR7A 3DNCA 3NRBA 4LT6A 4PWUA 5K9FA 1N0UA 1JLCB 5LXYA 1BD6A 5I42A 1RWUA 5A8KA 1KHVA 3PJWA 1JMTA 2FVQA 1IBMF 3D2WA 5DQHA 3I32A 3IBWA 2ZH8A 3HO1A 4M63A 5IQQA 2FVPA 1HWLA 5DM7Q 3TRGA 1DFDA 1U49A 2N7YA 3SCKE 2R8JA 2VD3A 2ZD1A 3POTB 5IT4A 3PV8A 1N5SA 2G4BA 2B4OA 2M2BA 3MMJA 6FDRA 3V4IB 5GVQA 1SKRA 3CCZA 5J1NA 3U1NA 2K3IA 2EBGA 4ZPCA 2O66A 4F3QA 4RUCA 2X1BA 4WYWA 1YBAA 3BO4A 3S1TA 4IOCQ 1S97A 2R8GA 3PFEA 4NYZA 4ZVGA 2KRBA 2J76E 4H54A 2DNPA 1VIOA 2J0XA 2KYXA 3LP2B 3TA1A 2MY8A 3M1VB 2R7RA 2X1FA 2VOPA 4IOBA 2MPUA 2ZC4A 2CQ0A 3O44A 3BJYA 4ZCLA 3QAEA 3FFIB 4B9SA 1M0SA 4QQBA 1T02A 1V6HA 2V4JA 3CCUS 2W4PA 5KFLA 4DL4A 1FKPA 5HBMA 4YB1P 2FIUA 2KFYA 1H3DA 2ROPA 3BGRA 2B56A 2ZBIA 3SDEB 1NK7A 1IKWA 3B8HA 2DGSA 2F9DA 2J7UA 4I6AA 2MSTA 4UUWA 3M8PA 3CCES 2AJQA 1MMDA 2VKZG 1XR6A 3OFHA 4XIUA 3FCHA 5LT5A 2X3GA 3T1HF 2ZOFA 2YTCA 3HFKA 1LKZA 1N5YA 4DG1B 5FIIA 2WRMA 2KI2A 4ELUA 4K0KF 1JLEA 4NLOA 2HYIB 4FNIA 2F40A 5J2MB 2FD2A 3L95X 4HI2A 1YJTA 5KFKA 2CVIA 3CC4S 4FBTA 2IM2A 2DGOA 2VPWB 3VALA 5HROB 4JV5F 3NKYA 2YVSA 1U1RA 1JLQB 3DLKA 2BE2A 2MQNA 4LQ9A 1MNEA 1JX4A 3ENQA 2DR8A 2GX8A 1G2EA 2ZDOA 1SL2A 1RT7B 2AQ4A 1HNXF 4PQUA 3DDNA 4AQYF 1BGXT 2FHMA 5SZTA 3I0SA 3LGMA 2RQ4A 2HGNA 3NCPA 4ID8A 3FSIA 1HD0A 4ED2A 3HHLC 2IFXA 2A10A 2JRSA 2E1RA 4OZNA 2W25A 2C2EA 3BR8A 2OO4A 3E3XA 3F73A 3PO4A 3MM8B 3UCUP 4X4NA 2LECA 4GKKF 4GO7X 2XS7A 1LWEA 2RDJA 2ZHBA 1N5VA 4B3SF 2CQPA 3KMSA 2HHVA 2OPQB 5T7LA 1ZAXA 2VG6B 1NB7A 1FXRA 2FJAB 3IWXA 4IFYB 1YVFA 4KE5A 1F5CA 4RBTA 5JUMA 1NKCA 5JVGQ 4OJHA 1JNZB 1S9GB 4KO0A 4BWJA 5KG4A 1IKVA 1UA1A 2OKQA 4TU7A 1FA0A 3I0RB 3P5TL 5HN0A 5KFDA 2DPIA 3RR7A 1X4GA 5GMKa 4RW9B 2DH9A 2R7XA 5EWGA 2IVMA 3ZZPA 2NLWA 1QY7A 3I4PA 2M9KA 4M94A 2XNRA 4V19J 3MUTP 4MIAA 3CDWA 2YY3A 3H20A 1IN0A 2JWNA 2WAQD 4R8UB 2XNQA 1SV5B 2M4MA 2KO1A 1UJ5A 5CZVA 3PO5A 3OTOF 5KFXA 1WEXA 1HQEA 3S01A 1FRMA 1LFPA 2NYIA 2ZH2A 4ZP6A 4A8MP 3IFEA 4DFPA 2JX2A 3QO9A 1UVMA 2OD4A 4Y2MA 1VRTB 2MY7A 1X5TA 4NWBA 4RNMA 2W4CA 1LWCB 2LDIA 2IVYA 4EZ6A 2DNYA 1VQMS 3Q23A 3QYYA 4WFNQ 1T8EA 2LQJA 5IM0B 1ZYQA 4OHZA 2R2UA 1TAQA 3DHWC 2ASDA 4NL5A 2CG4A 3V6DA 1FJ7A 2B0GA 1DQ8A 2M70A 3TAMB 3EYZA 2ZJPQ 3MTJA 2MHEA 4E0DA 3NNHA 4K4UA 2IA6A 1VQSA 1N0VC 3R1LA 1WWHA 2J9CA 5KFCA 2Q3PA 3AB4B 5KFTA 3OUYB 3BM7A 3IO1A 3MFHA 4B02A 2C42A 3M32A 1N56A 2WOMA 1LOUA 2YWFA 3N01A 5HMYA 4O3SA 1F5AA 1Y3KA 2HQIA 3G71S 1IR0A 4I68A 4I6WA 4X4UA 1CQMA 1Y5IB 2CQIA 1YQHA 1ZOTA 2PDAA 2I0XA 3DRSA 3NBPA 3RRKA 2NZ4A 5K8MA 4MJKA 3JSMA 2UUBF 2KM8B 4PR6A 3G6YA 1N32F 4LIRA 1HMVA 2DIUA 3ISZA 2J9DA 2R7OA 2B9XA 2UVRA 4HEA9 1P1LA 3DFEA 3HZEA 5DG9A 1U1MA 2CJQA 2XLJA 1DTQA 1SUQA 3DRRB 2J0WA 2MMYA 2EK1A 2IRYA 1VQPS 1N6QB 4JI2F 5CCMA 2DGTA 4OI2A 1KEKA 5J1PA 4G1PA 4KT0C 4ZP7A 2UUTA 3EUNA 2DBBA 1X5SA 1LW2A 3CTRA 5J2NA 4I0WA 4KKOA 1HBNB 4XK8C 4UUXA 3PJXA 2FB0A 3OBIA 2WSEC 4X66F 2A18A 1RTJA 2DHGA 3LWMA 4DBQA 4A8SA 4EU0A 2L3MA 1UWBB 3QIPB 2MKCA 4DF8A 3BSNA 3D0GE 3Q24A 2R7SA 4Y6IA 2QFJA 3E01B 3L3CA 1S6PA 2DPJA 3FEXB 3DLGA 4EUVA 2HNDB 1SJRA 2C3PA 4PG7A 3H5SA 3U1LA 4Z2XA 1IBLF 2VG7B 2QMXA 3CB4A 4NRUA 3A1YG 2WONA 2VFUA 3SYZA 2N4DA 2VH7A 3MM5A 2QIFA 4DMZA 2VQFF 4C97A 3TUIC 1WTFA 1JKHA 1K9MT 5M2UA 2CQ2A 2MZQA 4ELVA 2ZJQQ 4ED3A 1Y7PA 1QE1A 3LANA 4FBUA 2AX0A 3H40A 1S1WA 3G86A 3CSKA 3DYAA 1EETB 5L1LA 3MECB 4XDCA 4NLGA 4WK1A 2HQ3A 3HVTB 3FZ2A 1JLGA 1IKXA 4ZPDA 1TKTB 1HFEL 2YKOA 3GSDA 5I3PA 3VAGA 2J0QD 4RNFA 3PW4A 2BM0A 2XMUA 3KK3B 1TL1B 2HRYA 3KLEB 4IFVB 3OVBA 2GGPB 1NHVA 2PGCA 4AE5A 2FGOA 4OI3A 4NCGB 3WBZA 4FVMA 4LF4F 2SXLA 3K8WA 3BN7A 1JJ2R 2P9CA 2D7SA 5KFQA 1YRTA 1SJ1A 1FRLA 5KFWA 1A7GE 3LP0A 3N6MA 3SXLA 5HMZA 2W8KA 4NLWA 5K14B 3TUJC 2IM3A 2V4RA 1O0PA 1BQNB 2XI3A 2YQ3A 1JLCA 3MUVP 2XB2D 3Q22A 4NXNF 3MPYA 4DR2F 4ECUA 2CQDA 1YTYA 3N6LA 4B3TF 2PA8D 1T3OA 1QJHA 2XWYA 2B51A 2E29A 3POTA 4URSA 1MW7A 2DNGA 2GQCA 4YB7A 5A8KB 3T5LA 2BDPA 5H1SV 4AFFA 3I31A 5HL7Q 3US5A 2XY5A 4BDPA 1IQZA 2K7JA 4JUZA 2XC9A 2DGXA 2ZD1B 3DLLQ 2YX7A 3OLAA 3KK2A 1SJFA 1W2BR 2QLWA 5AXMA 1U6BA 3BS9A 4WU3A 4CIOA 1TK0A 1VC0A 3FFIA 3TARA 2ROEA 1G7CB 4TYAA 1HARA 1Z2LA 2YX1A 1MROB 5F9NA 1QM9A 2N3OA 1QTMA 4ELTA 4WZMA 3NGKA 3H5UA 3BREA 4NRTA 4J9PA 4C4WA 1RI7A 4DV3F 2OP5A 3TW0A 5HMXA 3SDEA 3D28A 2UP1A 2C3MA 1Q4RA 4LJMA 2A3JA 1WNEA 1E6YB 2BJDA 4WFAQ 2KVIA 4TYBA 1HR0F 4G3IA 1XNRF 5AE2A 1BC6A 2UUWA 2BRKA 4DL3A 1H6KX 2CQGA 4QJVA 1REVB 4DG1A 4I2PB 2DGWA 4ETXA 3PIPQ 2DR9A 4LF5F 1UVLA 4X84A 1UMJA 3NCRA 1N5TA 4RNOA 3KNGA 3PW0A 2HIQA 4CO4A 2MXYA 3KLGA 4WZQA 2A2DA 2I2YA 1U6ZA 1F5BA 5DDQC 2B4UA 5HROA 3M9OB 4ZP8A 1JLQA 3J81Y 2FVCA 3H59A 2RIJA 1SL0A 3AHPA 2RRNA 1VC5A 5AE1A 4ILMA 5KFVA 3I96A 4ALZA 1Y5NB 4RU9A 2Y1RI 1WHYA 3DLKB 3GQCA 1VC6A 3OFGA 4PG6A 3KNAA 2RNEA 3MM7B 5B0EA 2LXFA 2KG1A 1QVGR 4X4VA 2N7CA 2KTQA 1VMBA 2A1BA 2GHVC 4WK3A 4O3RA 2DO4A 5B7WA 1TQLA 2JHEA 1D9FA 2G1DA 5D78A 3EPIA 1KFDA 2NPFA 4LF7F 4PXBA 3RZAA 5B0CA 2VG6A 4IFYA 4A8OA 1A9NB 4URGA 5HP1A 3NG8A 1LWEB 1S9GA 4IRCA 3C46A 3OL6A 3G96A 1Q81T 2KXNB 4D3HA 3PX6A 5T7LB 1U1PA 3LOUA 2NS1B 3AA8A 5E2QA 4CT8A 5KFZA 5KFOA 1S1UB 2XMVA 3K58A 3T19A 2JL9A 4YHHF 3OTCA 4B08A 3PW7A 2ZJRQ 3V4MA 3K7RA 2D3UA 1JIHA 4EBDA 2UZAA 4MH8A 4RW9A 4DL2A 4RW4B 2PC6A 4ZCMA 3KYLA 3UD4P 2HHWA 2B7BB 1KFSA 2JC0A 1NH7A 3HKZD 3PEHA 3CDAA 4MK7A 1SH2A 5KFJA 4I56A 4C8YA 3J7YI 3CVKA 1OWXA 2QSFA 3BO2A 3M6UA 1M5OC 1L5UA 2E5IA 1X5OA 2IHR1 2RH3A 4ED1A 2ZVSA 4YB5A 4A47A 4LFBF 2XLIA 1PC4A 1VRTA 3QWUA 4IUFA 2VOOA 1N5QA 4YDXA 2CYYA 4ED7A 1HQEB 2F8MA 4ED5A 4RNNA 2XBPA 1Q86T 5HO4A 4F67A 3QO9B 1UAWA 3IWNC 1VS3A 1X4CA 4UQTA 3N4WA 4OX6A 4OX7A 4LMZA 3TX8A 4JI8F 3PW5A 1ROFA 2EW9A 3LUYA 2L9NA 3TAMA 4BBYA 5IT0A 3I82A 3C2PA 2VUGA 1WTBA 1FCAA 3CCSS 1S6OA 3HK2A 2O5DA 5C42B 2OSRA 3DMJB 4WU2A 4JI0F 2C2DA 2L9WA 2VC1A 3V6DB 1TFWA 1FRJA 3KLHA 4KJIA 2E5HA 3OR1A 4Q8EA 3PNIA 2GMLA 2W9BA 4GMKA 2VBWA 5F8GA 3T3FA 1S49A 2HHUA 2B5JA 2J0SD 3IS9A 1DBDA 4OZ5A 3M32B 7FDRA 4ECSA 3RB0A 2MJNA 3PIOQ 1L3VA 1C4CA 3N6NA 1Q7YT 2CZ4A 4PXCA 4Y2AA 2R7TA 5GAEU 2CVEA 2CQ4A 5KG5A 2VQEF 3UNGC 4PWDA 4QZVB 1M5SA 3T5KA 1XMQF 5I3UA 1TR0A 1SJ3P 3LWLA 1RJJA 2OPPA 3DOMA 3DRSB 2M8DB 1YITS 3NBPB 4KAIA 4O44A 5ADZA 1UEVA 2EBEA 4NLSA 1X7VA 4CH0S 3DRRA 5KFMA 3MXHP 2KT2A 1HMVB 2KM8C 4DR3F 4Y2CA 2E9RX 1N6QA 1FO1A 4C8LA 2FTRA 3MR6A 5KFEA 4QWAA 1NNDA 2K7KA 1DTQB 1SUQB 2LQ9A 4A8WA 4DQPA 3T5JA 3CIMA 4WF9Q 4C7QA 2BV3A 1KQSR 4BHQA 1VQOS 4XDDA 5LSLA 3CCQS 4ED0A 2DT9A 5L1JA 1M5HA 1SIWB 1KS2A 1ZTWA 3FNNA 1T05B 2DGUA 5DJBA 3RU0A 3JYTB 3FQKA 1HWUA 2Z0GA 3K5OA 4RUAA 2IRUA 5J2NB 3C3LA 4I64A 5IQ6A 1N34F 1U6FA 2KHCA 4QBUA 4I1TA 2IYIA 4FVCA 1RTJB 3CDUA 3HHKA 2F8HA 1K73T 4KFBA 4N47A 3SV3A 1VQNS 5G0RA 1H2VZ 1RTIA 2EVZA 2LU1A 3HJFA 2YKMB 3CJ0A 5D4LA 3BQ2A 4ECVA 4LSNB 1FKOA 1YG0A 3SQGB 2XY6A 1S6PB 3H5YA 1FD8A 4QWDA 4JI5F 4DR1F 2Z2MA 4CNZA 2OLWA 4DFMA 4Q2MA 3K59A 3CGIA 2WONB 2BW2A 3GFYA 1DZ5A 4Y00A 1OPIA 3MF5A 3CUNA 4K4ZA 1FDAA 1IUJA 3K0JA 1EETA 5A0YA 1JKHB 3PX0A 2ZBCA 1JXLA 4DFKA 3AJ2A 3HVTA 2HFZA 1FDDA 1TKTA 3D54A 1QE1B 1K1SA 2DCUB 1YJUA 2UU9F 2PT0A 3BO3A 3PW2A 1R0AA 3EZ5A 4WFBQ 3KK3A 4FS2A 1P6TA 3DYAB 3H8YA 4IFVA 1U1NA 2GGPA 2O67A 1X4AA 3HHDA 3O