4CO5A

Structure of pii signaling protein glnz from azospirillum brasilense in complex with tartrate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
104
Chain Sequence
MKLVMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFGQTEIYRGAEYSVSFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PII-LIKE PROTEIN PZ
publication title Structure and Thermodynamics of Effector Molecule Binding to the Nitrogen Signal Transduction Pii Protein Glnz from Azospirillum Brasilense.
pubmed doi rcsb
molecule tags Signaling protein
total genus 21
structure length 104
sequence length 108
ec nomenclature
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4co5A00
2XG8A 3HLUA 2PIIA 3M05A 4CO3A 3TA1A 3TA2A 2ZOMA 4YB6A 3TA0A 3AH6A 2J9DE 3NCRA 3OPKA 4CO4A 5D4LA 2DCLA 4C3KA 2EG1A 1O5JA 2J9DA 4RWWA 4RLEA 4USJC 4NYOA 2EG2A 5D4NA 4WK3A 1O51A 5D4PA 5DS7A 2O67A 3NCQA 4YB7A 1QY7A 4D3GA 3T9ZA 1OSCA 3N5BA 3O5TB 5DRKA 4CO2A 1UKUA 1Q1KA 1HWUA 4CNYA 3NCPA 4AFFA 4CO0A 4OZLA 4OZJA 4D3HA 4NYPA 2E66A 4USIA 4WK1A 2VD3A 4ZK7M 3AA8A 1PILA 4C3LA 1NH7A 2JJ4D 1UMJA 1VFJA 2CZ4A 3L7PA 3CE8A 2XBPA 4CNZA 2V5HG 3X3UA 3LF0A 1V6HA 1V3SA 2XZWA 1XK8A 1GNKA 1J2VA 4CO1A 2NUHA 4Y65A 2ZFHA 3O8WA 1V3RA 2Z0GA 4OZNA 3GSDA 3AA9A 2O66A 1NAQA 4E98A 4C3MA 1VHFA 1NH8A 3AHPA 4IYQA 3BZQA 2GNKA 1KR4A 2GW8A 2NS1B 3DFEA 4YB5A 1V9OA 5L9NA 1H3DA 1NZAA 2XULA 1P1LA 1UFLA 2J9EA 2J9CA 2RD5C 4CO5A 2NUUG 3MHYA 4R25A 1UL3A 4RX6A 4Y6IA 2GX8A 5D4OA 4USHA 4RWXA
chains in the Genus database with same CATH superfamily
2QA1A 2FJDB 2V8PA 5B7WA 3RAMA 4F4AA 3M2VA 3PIOQ 5F8IA 3KWMA 1O5JA 1IBMF 4DV5F 3ZTSA 3PFEA 4DV5J 5J2QB 3CDAA 2B9WA 3MCOA 4ED5A 3MD3A 2VDIA 2VASA 1D0EA 4Y28C 4NASA 3CCRS 4ZP8A 2LECA 2F7VA 5F41A 3M1VB 2AYMA 1P8GA 3CCWA 1ZM3A 3PO5A 1HNIB 5F8LA 1RXOB 2FIUA 4GVBA 3PYGA 2EK1A 3TP2A 2JEFA 1FCAA 3PRDA 1RACB 4YB1P 4ETZA 3LP0A 2NUHA 2ZFHA 2W9CB 2H5IB 4HACB 4U7UD 4F4YA 2EVZA 4RO0A 4NLRA 3AB2B 3MM7B 2A3JA 4MK9A 3D68A 3C3LA 4PWDB 3CDEA 2Q6BA 2HBZB 4ZVSB 1PC5A 4FXWA 5KFFA 5LSLA 4C0HA 2CQ2A 4IOCQ 2QT7A 1U02A 2JDJA 1RAOA 2HFVA 1JLQA 2AHOB 3HHLA 1QAXA 3K5PA 3DKDA 4JUZA 3K5LA 2N7CA 1FT8A 1PJ7A 4KB7A 5CYQB 2IM1A 3DLJA 1UW9A 1N88A 1RAAB 4ITSA 1VQMS 2DR8A 4OHYA 2AX1A 1S6PA 1HD0A 2HGLA 3M9NB 3L7UA 4DCOB 2OO4A 1OO0B 2MQNA 1KWMA 2WCXA 5KG5A 2UUTA 1VC6A 2VFVA 1DTTB 2EWHA 3IM8A 3CDWA 3EGVA 4Z37A 4FBTA 1Q81T 4OV1A 1TKDA 3EGZA 4DI6A 1H7XA 1YBUA 3KLIB 4FZVA 2FY1A 1Y4ZB 4C4WA 1EHWA 3DDKA 2BXJA 1PJ6A 4B3SF 3ET6A 4B3SJ 4ECUA 3MD1A 4HTJA 1YBAA 4WK3A 1LQ9A 4IR1A 1NB7A 3LP1B 2LA6A 4LF1A 2COLA 1JMTA 1CJTB 2FHOB 3RBZA 2BQRA 1ZOTA 5LSOA 2C42A 4ZVUB 3OTBA 5I42A 2KB2A 1B4SA 2I5JB 3DOKB 4DR2F 4RU9A 3OL9A 1BD6A 4DR2J 4NMLA 1F3FA 5FD1A 3NRBA 4DWIA 2KZZA 3RJMB 3CWJA 3IR6B 4CWBA 2NXJA 1ZS6A 3HKWA 2XLKA 2FVQA 3M8WA 2K06A 2ILYA 2JSXA 2FLPA 2E5HA 3HFZB 1TKXB 4DQQA 2ZDPA 2PT0A 1HKAA 4NRUA 3AQPA 4J5OA 3LPEA 1S6QB 3I0SB 2XMTA 1CBKA 1X4AA 2IYGA 3M8PA 3VQSA 2K1RB 2QSWA 1O6XA 3VVTA 3D3BJ 2CRLA 3TUPA 2IAJB 2M88A 4USWA 4ELVA 5KG6A 1HQEB 4YUDA 2VQFF 2KFZA 3AFGA 2VQFJ 3BS9A 2HZVA 3HKZD 2MKHA 3EX7B 4OJ1A 3G6ES 4F8RA 4OQJA 3IWNC 4B3OA 2IMWP 2CZVC 5D0RA 1DBDA 3AOBA 5C7PA 5K20B 2XGQA 3QSYB 4RW6A 3ONQA 3S7RA 2R7RA 2FVSA 2CVEA 4NRTA 3ILLA 4TLQA 4LSNB 4ZCKA 3M2RA 3CPWR 3BBBA 1R8HA 2GFFA 2HLTA 1YHQS 2J8AA 5AE2A 3GR1A 1UVKA 2OPSB 4KV8B 4MJKA 2MYFA 4X84A 1I1GA 4BC7A 1M1HA 4ZCLA 3OXGA 1RHUB 2Q3PA 2HHPA 3UNGC 2BANB 3N5BA 2KFNA 2VA3A 5BJRA 3MECA 3G87A 1WC1A 1MG7A 1TP7A 2ZZTA 5KFRA 1P1TA 3P96A 1VJQA 4E2FB 1SVDA 4ZPTR 3VGUA 2FZCB 2G0CA 2BDPA 4QR2A 2MKIA 2MLYA 2QE5A 2HK3A 3GIMA 2VQEF 2Y8YA 4E98A 4Q44A 2VQEJ 5H9FK 4ANEA 1K9MT 4JI7F 3Q89A 5MAOA 1JLGB 2PFDA 2GNKA 4JI7J 3I0RB 1WOOA 5J2QA 3ILIA 3ZZPA 1QJHA 4WFXA 1UFLA 3F41A 3M1VA 4WP9A 5LJ3Y 1U1RA 3EZ5A 4MIBA 4DR7F 2OPQB 4DR7J 1HNIA 4Y3CA 4F0KA 3US5A 4MK7A 4A8YA 3N9UC 4MH8A 1HD1A 1R8BA 2ZH2A 2W9CA 4HHHA 4HACA 4DL4A 2GVDB 2XMUA 3HMJG 2MPUA 3T5LA 1YRTA 2VC1A 2LQ8A 1H74A 1RZMA 1S77D 2PGCA 5J2MB 1T03B 4FNIA 3MM7A 1X5TA 4OYZA 3H5YA 4LRAA 4LIRA 5E3CA 1IM6A 4PWDA 2XMKA 1RTZA 3RZAA 2FHJD 2XHWA 1RJJA 2ACYA 1HHTP 4A8FA 2R7OA 3SBMA 5KFIA 2QMWA 3HI9A 1CSJA 3T5HA 1T02A 5KFMA 2EEYA 3HX9A 1LV5A 1NM2A 3W8PA 5CYQA 1DY3A 2V68A 2JWNA 2F3JA 1X5OA 2XC9A 4TU8A 1RA7A 1X4DA 4LF7F 1SPBP 3C66A 4U95A 2JH3A 5CH7B 2DK2A 4LF7J 2DNMA 2EFVA 1VQOS 1GXTA 4P75A 4RR5A 5H1SV 2ZNZA 4IG0B 3JSYA 3FSXA 2D9PA 1DTTA 4MKBA 2AKWB 4FYVB 3EPGA 2IM3A 2BJEA 2Y1IA 4WBFA 3LWMA 3PEJA 3V2UC 4KRWA 5GVQA 4GMKA 3IBCB 4CLTA 1U1PA 4IG3B 1UMJA 1TTHB 4CI0B 3I96A 4C8NA 4YDXA 5KFGA 3KLIA 3IWXA 3CC4S 2AYBA 4ZP6A 2MZJA 4C6AA 5HANA 2F8MA 2FTRA 1FDAA 4OI2A 1CLFA 1KONA 3D6MB 4I69A 4PG8A 2XM3A 3VAFA 2E7XA 3PX4A 4ED8A 2X1BA 1HWIA 3D1HA 3QGPA 2RU3A 3OJUA 4OZ5A 4TY8B 3HHLD 2YNHB 2C2NA 3T6JA 1CJTA 5ETSA 5KFOA 2ZJRQ 2Z2ZA 1FTCA 1RAGB 4O4RA 2MKKA 5HLFB 2O5DA 4DL5A 1KOHA 4RUHA 3BGLA 2RJZA 2DXDA 2EKYA 4X4NA 4FBUA 2I5JA 3DOKA 2KFYA 4ERDA 3SCJE 5D4PA 4ICLB 3OTCA 4D3GA 1WDTA 4ELUA 3UD4P 4QIEA 4ZIWA 3QT5A 3RR7A 1CJKB 3AD9C 2X3GA 2QC3A 5ETKA 2P9GA 1XNQF 1Z2ZA 1S6UA 1XNQJ 2QZ8A 2NZCA 2MZQA 4CLSA 4LF8F 3H2LA 2DRBA 3GYXB 4LF8J 1WD6A 3M8QB 2LXFA 3ZZOA 3AOAA 3PX6A 4P52A 3MR6A 1TKXA 2HWHA 3IXQA 4O3OA 1NSPA 4ZHRB 2I6WA 4HHJA 3NEKA 1VQ7S 1S6QA 3I0SA 1FDDA 1GMWA 2CNNB 1K73T 1VISA 2DCUB 3ZC4A 4TLRA 2K1RA 2RVJA 2ZBRA 1E6VB 2IAJA 1YX2A 1D09B 3CEDA 3ISND 2ALZA 2XMWA 1TK8A 1NDCA 1IN0A 2V4QA 3HZGA 2GAGC 4L3KA 4DQSA 5D4LA 4OYAA 1NZ8A 2W24A 2VG5B 4DL3A 5CQGA 2VOOA 1PYTA 5D4NA 1SC6A 3A3OB 2XS2A 2GA7A 3A8JA 1EB0A 4AL6A 3DRRB 2KG0A 1XR5A 4LUBA 2ZNYA 1BWVA 3P8BB 4TQRA 1WNEA 1WHYA 2E7VA 4IFYB 4LSNA 2IJFA 3ZZRA 2XZWA 3HHEA 4UOCA 2RQKA 3MUMP 2YWHA 3SSQA 3ISZA 5IFMA 3UPFA 2HFSA 2OPSA 4KV8A 5IQQA 4BDPA 1GK8A 2LXUA 1DFDA 5KG7A 4QWCA 1WTFA 2FQQB 5DGAA 4S0MA 4I4BA 4N7TA 1AUDA 4TKTA 2BANA 3I5AA 3MURP 4P7TA 1LXJA 5KT2A 1TL4A 2YX4A 1S0NA 2XB2D 1VQPS 3H4DA 1ROFA 5ETQA 1GMUA 2EFQA 1JNRB 2KRBA 4CO3A 4NLDA 3THVA 1P6TA 1RWPB 1WWHA 1UZDA 5FLXU 4KJIA 4AD6A 3Q8UA 1IQZA 3D1OA 2B9XA 1G1XA 4NZ0A 3KMQA 2KHCA 1OJ4A 4CO2A 1SC1B 3LW5C 2HIYA 2BZ2A 2QYGA 3AXMA 5D3GB 3HZEA 4B9MA 2WVBA 1R0AA 3PXGa 2BRLA 5B0GA 1JLGA 1N33F 4XDCA 4ILLA 3I0RA 1N33J 1IBLF 4BWJA 3JSRA 1IBLJ 1FI4A 5IQ6A 1GFWB 1YJUA 2MQMA 2VJVA 1X9SA 3DC2A 4URGA 1KHWA 2OPQA 3U27A 1SXLA 2B56A 1WC5A 5T7LB 5CD4A 2FJEB 2XGPA 4F0HA 4YFUA 4UOFA 3C16B 5HQMA 2H9ZA 2GVDA 2HMIB 4OHWA 4ZCMA 1SQGA 2PD1A 4ED3A 5J2MA 6FD1A 5B0AA 2VPWB 2PFFB 2RHSB 1T03A 1C4AA 3FDSA 1X5PA 4OX7A 3IP0A 1H2TZ 3PV8A 4QW9A 2XCAA 3GILA 5CCMA 3X1LB 5KT3A 3QWUA 3CD6S 2GCFA 3QBCA 2QL9B 3OFFA 2O67A 2VG7B 3P6YC 5D77A 4CRJA 3T3FA 4X4SA 3TEHB 2MTLA 3NGRA 2F40A 4NLVA 2LLZA 3KJNB 4NPOA 5KTQA 1YI2S 2XBPA 2AJ4A 1FHTA 1TELA 2ILZA 1HNZF 3FFIB 4WPAA 1HNZJ 2YH0A 2CWKA 1T05B 3H42A 2CJ9A 5KG1A 3CMES 3LAMA 4M8LA 2DYAA 2MZRA 2KJVA 1B7FA 3KHGA 1M5KC 3DLEB 4IG0A 4JOUA 5HVGA 1I5OB 2F63A 2OMOA 1VRUB 2H5EA 1WEXA 2QA4S 1UTAA 1FKOB 3MUTP 1WORA 1ZM4A 3B78A 4IG3A 1FJGF 1LK5A 1SJRA 1WUUA 1FJGJ 3K89A 3HD2A 3QJLA 2RDJA 1N34F 2Q79A 3OR1B 1N34J 5DRKA 4JI0F 3K8WA 1S59A 2IA6A 1UKUA 4O0IA 4ED2A 4DLEA 3KLFB 4JI0J 2UV8G 1S49A 3A12A 4ETXA 3Q24A 5LM7E 2HG4A 2OTJS 1OYDA 5DG8A 2JLGA 5F8GA 1FTRA 1FNMA 4TY8A 3LF0A 2YNHA 3ELHA 1U6ZA 1HWKA 4ZMMA 4O3QA 4AXIA 4NLGA 5HLFA 1YTYA 3BKTA 2Y1JA 2CADA 2CQ0A 3Q2TC 3KMSA 1FRMA 5ETMA 1M1KT 5KFYA 5JUMA 4ICLA 1YJ7A 2ACMA 3D0HE 2CQHA 5I4MA 1PGZA 4OZ3A 4OFZA 1H3DA 2YXLA 3SYZA 3K2YA 1CJKA 2GMHA 2ZH1A 5DDPC 2B7CB 4DQPA 1NRKA 4IO1A 3LALA 2L9NA 2XWYA 2RH3A 5K5MA 4I68A 4V1Ak 5GMEA 3J80Y 3G6XA 1U1MA 3M8QA 4LVNP 5CHCB 2HQDA 4ATNA 2C3YA 1NK9A 4ZHRA 5F8NA 2IFXA 2FZGB 3QFHA 3FCVA 4K2XA 2CPJA 2P6SA 4NYPA 9RUBA 1MMDA 1RQ0A 2HRYA 2ZH4A 1FEEA 2JLEA 2DHHA 3I9ZA 3MPUB 4FYXB 7FDRA 4JI1F 1UWBB 3AA9A 1W2IA 4JI1J 3HVWA 1UPMB 2VG5A 2DO4A 3BN4A 2CG4A 1VBXA 4ZLLA 4OYPA 1DQ9A 4TY9A 3DRRA 4ES3A 3P45B 3KLGA 3J81U 4IFYA 3DU5A 1Y3JA 4ECWA 3QZ8A 3R1HA 2HK2A 2J9DA 3I56S 4WP8A 1LWCB 2KVIA 3GV5B 3JQMA 1N52B 2H65B 1LNQA 3P3DA 4NCBA 2Z2LA 3KLVA 2HQIA 4G1QB 5SUHA 1R8AA 2W9AA 3VGVA 5ETRA 1TR0A 3BSOA 1WACA 3R7NB 1GMWD 3RR8A 2PA3A 1YJRA 4K59A 2NXUA 4PG6A 4M5KA 2XY7A 2CQIA 2NPFA 5KT5A 1RCXB 2QA4G 1UVLA 2BE7D 2JLFA 1XQIA 2QEXS 1HHQA 2GMJA 4ZPBA 2IM2A 1FDBA 3MF5A 1QLNA 1ZPVA 2W4CA 3PRBA 5A6PA 2ZJPQ 1S7IA 1X4HA 4KY3A 4DMZA 2F5GA 5D3GA 4R25A 2BACA 4F4WA 5JVGQ 4HDGA 4NA2A 2D3UA 2MJNA 4LR9A 1L3VA 3OT9A 4OMFG 4CTAB 3MMJA 4EWTA 2BQUA 3TEGA 1SKUB 3CTRA 2EFPA 4XPEA 3D66A 2B3TB 2OMLA 3E01A 5T7LA 2UUCF 8AT1B 2UUCJ 5K8OA 2BJ3A 1UJ4A 3C16A 1PILA 4OZ2A 4JYAF 4LRDA 2PEHA 4JYAJ 2GQQA 3VWSA 1W2BR 1P27B 3MR3A 2HMIA 2FJAB 5HMYA 4MIAA 1ACMB 2QL7B 3NGUA 2HHWA 4EK2A 3MOZA 2DIVA 2E5IA 2XMAA 2MZ1A 3DNCA 1LFPA 5E3RA 4PPZA 1X7VA 5HVHA 3PEHA 5KFJA 3H5XA 4LF6F 3U7JA 2VG7A 1VMBA 5KAKA 1QTMA 1T95A 4LF6J 3HFKA 5AE1A 2FYXA 4IQXA 5C25B 3UN3A 4ZJOA 3EVOA 4DR3F 1TZ0A 3BF4A 4EO8A 4DR3J 3W65A 1CPZA 2OPRB 2F4FA 1BHNA 4KBIA 1KLNA 1T7PA 4ZVQB 3FFIA 2CPZA 4A8KA 1QAJA 2FJXA 4QWDA 3FUYA 2H4YB 3KXDA 4Q8FA 1T05A 3H2VE 2GMLA 3PZPA 4KH0B 4E0DA 1TL5A 1FXDA 2JC1A 5ETLA 1TL1B 1K0TA 4QPXA 4WZQA 1RAFB 3DLEA 3NNHA 4YY3F 3SDEB 3BBCA 4YY3J 1UJ5A 4F4KA 1DURA 3DI6B 5L39A 4PR6A 1FKOA 1Y3KA 4ZJQA 1CJVB 4P71A 4FXDA 4NLPA 1TL3B 3KG0A 3N6MA 3E51A 2VDHA 3EJMA 5G4DA 3BQ1A 1R0CB 3J7AN 1NK5A 1OY8A 3R7SB 4C8OA 3T5KA 3V6KA 3OTOF 2HAIA 3OTOJ 2UXDF 3KLFA 2EXUA 4O3PA 1MMLA 2UXDJ 3LANA 2H48B 1JLEB 3QGGA 5KT4A 2ASDA 3EXYA 4PXBA 1I3OB 1U6FA 4DX8H 3C46A 4LT6A 2RSQA 3GYNA 3W66A 2I8EA 4YR3A 1A0OB 2HHXA 1YQHA 1NH7A 1YJWS 3HO1A 3BR8A 2HQGA 3J7YU 1V3SA 2AJFE 5DM6Q 3KYLA 5FIIA 3UCUP 1QUVA 4M5DB 2DY1A 5D0HA 3KLEB 1JJCB 1S9GB 2DY9A 3NBPB 3TZWA 3A8KA 3OSNA 2K2PA 2CQ1A 2CVIA 1XJWB 2WBRA 2E9ZA 1RBOB 3O1LA 4A8XA 4DQIA 3M6VA 2ZJQQ 2DEIA 4X4OA 5KFTA 5FDLA 1JX4A 1HWJA 1JB0C 1OSCA 1U1OA 1UWBA 1B7YB 5E3QA 2HGMA 1H2UX 4ZJLA 2DGVA 3MM5B 1VBKA 2UZAA 4PZVA 4J9QA 4M5GA 1KKHA 1Y7PA 5HI7A 3G8QA 3L09A 1VIOA 2WRMA 3LTOA 3MCMA 1N5QA 1XR7A 3D6HB 4JI4F 4C0BA 4JI4J 4EBDA 4ZVTB 3QO9B 5KFEA 1LWCA 1HL6A 1RTIA 2MLZA 1RTJB 1S72S 3KK2B 3MMCB 3TX8A 5THWA 4G1QA 4LFBF 4R0JA 4J7CA 2GIFA 4LFBJ 5D4OA 1JXEA 3NY0A 3WC0A 1Y10A 4CH1A 2E1RA 2YTCA 3CVKA 4F02A 3KUHA 4YN3B 2CDQA 2HRUA 1CULB 5GAEU 1GXUA 2QLXA 4FYWB 1RU1A 1WKLA 2YKMA 2QYCA 2W4PA 5BYSA 4MFBB 1T9VA 1SQFA 4ZITA 4EMDA 5DETA 4MK8A 5ETTA 3BKUA 3HPOA 2AEMA 3DRSB 4K5RA 2KJWA 4TXSA 2VPZB 3OHAA 3DOMB 2ROPA 3WZ0A 3BN7A 3LP2A 4AXJA 3PYEA 2HVIA 4CTAA 3MDFA 1PYOB 2W01A 4I7FB 4J9KA 3IC1A 5SZTA 3ETOA 1D9FA 4QR0A 2J0QD 3I5CA 2GC8A 3HCXA 4ED4A 1S9FA 1NSQA 2X51A 4DV3F 4CT9A 1LXNA 3MHYA 3L9ZA 1Q7LB 5DG7A 4DV3J 4EI2A 1SB6A 3WIVA 3PIPQ 2Z56B 4ALZA 1WHWA 1RADB 2M9KA 3P5TL 2DGOA 3TA2A 5KFHA 3FEYB 2PMZD 3HXMA 2G1HA 1UFWA 4ECXA 2YH1A 3M6UA 3BO3A 3FCHA 1B0VA 1YK9A 4FF3A 1CEZA 4ES1A 2GQ2A 1S12A 3KHHA 4UT4A 3OW2R 2RQMA 4ZP9A 4C0OC 2WBMA 2XEXA 3PDNA 2OEJA 5HJXA 1BUXA 5C25A 5A0YB 2FGOA 1TKZB 2JOQA 3FNNA 2OPRA 2IRYA 3PX0A 3GCXP 1U09A 4NA1A 2DNYA 2XYGB 4XIUA 4PCQA 1EQMA 1S0VA 4LF9F 2CJKA 2DNZA 3ZZUA 4LF9J 1VS3A 1QD1A 2KU7A 3A3NB 5DLGA 2MY7A 3R5DA 1LFWA 2CFXA 3VHQA 2NQPA 4RW9B 2AJ2A 4ECSA 3NLCA 4ZS6A 4OYXA 1UVMA 5AXLA 3ZTQA 3CJ2A 3CCVS 2GJ2A 2QIFA 3SDEA 2VG6B 4ZVRB 1R8PA 4EZ9A 5L46A 3DI6A 2ABYA 5IS2A 1YRUA 5B0BA 4RNNA 1CJVA 2OLWA 5JMNA 4X4TA 3EICA 2KM8B 1TL3A 1XBWA 2HYIB 3L95X 8ATCB 1YRXA 2MGZB 5M2PA 2LCWA 5IC4B 2WSEC 2XO6A 1RE1B 5GAHU 3DGPB 1UCNA 1S57A 2CQ4A 2H4WB 4ED0A 1X60A 1KVJA 2CQDA 2ZBCA 1WELA 3V6DA 1M0SA 1HI8A 4UOGA 4OZNA 3LGMA 4DR1F 4MT1A 3VGSA 1JLEA 3T5JA 1KQGB 4PQUB 4DR1J 1TFYA 3LPYA 2OUGA 1SKSA 1F60B 1IR1A 2M52A 3DLHA 4RW4B 2WW4A 3M9OB 1Q4RA 5H9FJ 3AOCA 2U2FA 3ADAC 1NHUA 1DTQB 3FVYA 2UVWA 3AH6A 4C8MA 2DH9A 3GMGA 1X4CA 1KC8T 2UVVA 1O51A 1ZTTA 2DNKA 1UEUA 4FKYA 4IFVB 4M5DA 3TUZC 3U02A 1AROP 4F4XA 2E9TA 3LUYA 2CJQA 3KLEA 4PG7A 4B02A 3WHIA 1S9GA 3NBPA 1OSDA 2MB0B 3CC7S 4KGXB 3W61A 2Z30B 3X3UA 4KAIA 2VB6A 1KVIA 1TUVA 1GAOA 5EX0A 4OLOA 2FHMA 3VV2B 1XIQA 4AUKA 5IV4A 1U1QA 5AE3A 3RRHA 2D3O1 1BQNB 2ZD1B 2VZ9A 2UU9F 1VQ5S 1RDRA 2UU9J 5HSPA 2V8HA 2W7AA 3KDOA 1RABB 4CQ1A 1RB0A 4OI0A 3SV3A 4HDHA 2CG8A 4L74A 1RT2B 1F9HA 1UA0A 1IBCB 5ITHA 3W63A 2BMBA 5DG9A 3MM5A 2BABA 4CDIA 5KOXA 5AT1B 2D9OA 3QT7A 1D1UA 4YMEA 4J9NA 4OX9F 2R7TA 1EIYB 4OX9J 1IKWB 3CJ3A 1VDHA 2DHAA 5IC6B 5L8RC 3NOCA 4F2RA 2C2RA 3KG1A 3NCPA 1TU0B 4WCEQ 1QAYA 1DLOB 3QO9A 3MR5A 2IM0A 1RTJA 2YX7A 3CW2C 1HBNB 3KK2A 2MKJA 1FKAF 3AJ1A 1T3NA 2NXEA 5GAEI 2DH8A 4EUVA 1FK9B 1YZ6A 2DO0A 4HL9A 4K4VA 3UR0A 1JJ2R 5B0EA 1CULA 4A8WA 1F9FA 3CD5A 3DRXA 3BZQA 3GIRA 1NKBA 4YB5A 2LKZA 5L9NA 4MFBA 1WSRA 2L41A 1FWLA 1S1UA 4QWAA 3MPWA 3Q8RB 1XTZA 2G0JA 3DRSA 2VKRA 2M7SA 3IGVA 5KT6A 4GKKF 2IJRA 2RMLA 3QWPA 4GKKJ 2EC0A 4HT5A 3DOMA 1TL7B 3H8YA 4NLQA 3GSIA 3Q8YA 1M1GA 3TVKA 1Q78A 4A8QA 4I7FA 1RTDB 5KFSA 2VOPA 2JX2A 5CCLA 2D7SA 1W25A 5EWGA 1RHJB 5HQLA 1K1QA 4RUAA 2K7KA 2HS4A 4R0EA 1SH3A 2MKCA 3CJ0A 1C1BB 4DV4F 5DQGA 2ZHBA 2FJVA 2M2BA 4DV4J 4JI3F 1RT7B 2OD4A 2ZH6A 4ZPVR 1B0TA 3PW0A 4JI3J 3I4PA 2WVFA 1KN6A 2F9JA 3I32A 5K8PA 2RAQA 2V8VA 2XS7A 3SCIE 2IRUA 3H59A 3DCAA 4MMOA 2RUGA 4Y6IA 1EKSA 1JXVA 2WSCC 3DN9A 2ZKUA 3M05A 2RRAA 1IWAA 1UWAA 3P4UB 2J9DE 2E1CA 1S9EB 3HSGA 4KSEB 2KKHA 2JEGA 3NAIA 2AEFA 2EG2A 3CDBA 2Z58B 1IM4A 4LRCA 4Y34A 1VOMA 3D3CJ 3K58A 3ZZTA 5A0YA 1VQYA 4DU7A 5HBMB 1TKZA 3OXLA 1HNXF 5BR8F 4F2SA 1HNXJ 2OEMA 4D3HA 1FWPA 1FESA 2A6OA 5BR8J 1NJZA 1JLBB 1FJCA 4DSEA 1VIXA 4GC7A 4F25A 4XAKA 4TQSA 4QW8A 5DLFA 1U2RA 4FXVA 4LRFA 4RW9A 2C3MA 2RKIB 3H90A 3PW7A 4MIWA 1Q16B 2GAHC 1HMVB 2VG6A 2J7KA 1C0UB 2XZTB 3L4BC 3TR5A 4WFBQ 4DSJA 1UAWA 5JXSA 4WZMA 1FRHA 4ECYA 2C3PA 3R6GB 3HHLC 2MGZA 2YY3A 3MR2A 3TA0A 2ZVSA 4DPXA 3DGPA 3JS9A 7FD1A 1MU2A 1CG2A 3PYDA 4YHHF 1SQEA 3NCQA 2DISA 3ENQA 4YHHJ 3ZTOA 4URQU 2RRBA 2EBEA 4DPTA 1NK0A 4KHMA 5FJ4A 1QUPA 1N5SA 4N8NA 4X62F 3BO4A 2DVIA 3KJVB 1Q5YA 2DITA 4RW4A 1MLAA 4X62J 2BE2B 5KFQA 4DUTA 1Y11A 2UXBF 4HHUA 3BO2A 2UXBJ 3QRRA 3QGHA 1N5YB 1QE1B 2ZH3A 3B54A 1DTQA 2F4VF 4FF1A 2F4VJ 3NMAA 3AHPA 1N8RT 1SKWA 2Y9HA 2ZWPA 4GKJF 2ERRA 1RWMB 4GKJJ 1S4FA 3N4WA 4IFVA 3MUVP 3AJ2A 2WOMB 4CIOA 4J91A 1FFGB 2HFZA 2AWZA 2I9SA 1S79A 2R8KA 2A1BA 3HHDA 1KOOA 3Q8VA 5KFAA 2QGFB 3ETMA 1Q8LA 2EK6A 3DMJB 2YQ1A 4RUBA 3ISNC 1S0OA 3CO9A 2B7BB 5E41A 2Q43A 3W60A 1UZHA 2EPIA 3QSIA 3OV7A 2ZE2B 3PJ9A 4OLPA 4AFFA 1ITPA 3RAQA 1BQNA 3SSSA 5EUHA 5HMWA 2B4PA 3QNWB 4Y2CA 1RHMB 1ZAWA 1CJUA 2P2CB 2LDYA 3EWGA 4F4ZA 4ZIVA 2BA9A 4LFAF 2C2KB 4DV0F 1RT2A 4LFAJ 4DUYF 4DV0J 4M95A 3KUGA 2G4BA 4LF4F 4DUYJ 1BWEA 3CSKA 2IHR1 5KG4A 4USVA 4LF4J 2LP4A 1IKXB 3GIIA 1H6KX 4RBTA 1NJXA 4XDDA 4DG1B 2IRXA 5HROB 5ETPA 5KFZA 3VZIA 1IKWA 1WEYA 1JK9B 2V2QA 2MSSA 2O1PA 3B8HA 4EYHB 2HW3A 3VGTA 2N3OA 1BLUA 2WK4A 4PG5A 4F50A 1IBMJ 3KOAA 1JLCB 1DLOA 1GQEA 3CB4A 3PW5A 4M5JA 1R89A 1NNDA 4ID8A 4YB6A 1HBNA 1FX4A 4JV0A 3JYTB 1JIHA 4NYOA 1AB8A 2VONA 1FK9A 4DS5A 3RRKA 3TANA 4WFYA 2R42A 3FQLA 1HHSA 2ZH5A 2DPJA 1LWEB 1IKVB 4JI5F 4JI5J 3KJFB 4F26A 1GTEA 1YJ9S 4F3OA 1BGXT 1RUSA 2VODA 2C28A 1G7CB 3DDNA 3MMAB 4LREA 2AJ0A 3C6TB 2DR6A 1G2EA 5RUBA 4JI8F 3KK1B 1URRA 2CPFA 4JI8J 4NLXA 1S1TB 4I2QB 2H3EB 2C22A 4USUA 3LA0A 5ETOA 4CLYA 1B0PA 2NR0A 2CPXA 2CUYA 4X4QA 1TL7A 4KFBB 3E2EA 1M5PC 2ZM6F 1FJ7A 1Y0HA 2ZM6J 1XR6A 3ZXWA 2MSTA 7AT1B 1RTDA 1NKCA 4MKVA 1RP5A 2X1GA 1QSSA 2Z4PA 4CZCA 2DEJA 4Z7CA 1KTVA 4YQWA 5F0UA 3HP6A 1N4LA 1APSA 3LGHA 2LEBA 3G2XA 2QL5B 4B3RF 2WW8A 2WZ1A 2IBKA 4B3RJ 3MEGB 1C1BA 4RUCA 3K7RA 2HNYB 4YR2A 3TAMB 1T9TA 3GG1A 1RT7A 2VA2A 5C2GA 2B6AB 1NO8A 4J90A 3DHWC 4DHVA 3OLAA 1EJ7L 4P10A 1N36F 3H5UA 4E8UA 1N36J 3TOQA 3S1TA 2GZOA 3T41A 2JRSA 2H5JB 3IM9A 1RT3B 1ULRA 1VLYA 3N79A 2KXNB 1S9EA 4NEYA 4KE5A 2ZH8A 4DV7F 3MXHP 3GR0A 1KBRA 2AGQA 4DV7J 3D6FB 4IH6A 3DLLQ 4B9TA 2E5LF 2LA4A 2E5LJ 5HBMA 1NZAA 3OR2A 1VI7A 2RRNA 1RYRA 4DFPA 1X4EA 4OI3A 1JLBA 4B9NA 2RS8A 2ZOMA 4J9UE 3B82A 4ZP7A 4DS4A 1NK8A 2DKOB 3SIPB 1YDLA 4DV1F 1EZZB 2V4JB 2Z57B 1HQ2A 4DV1J 2RKIA 3H7HB 1X4FA 3R7BB 3QAUA 1H2VZ 1HMVA 3WQPA 3FRZA 5KFVA 2FUG9 5D8HB 4IR9A 4ZK7M 5A8RB 1C0UA 4LFCF 3GFYA 1YIJS 4LFCJ 4C2MA 3UWTA 1RWKB 1WC3A 4J9RA 5JJBA 4N56A 1FO1A 1FVSA 3SSRA 4R8UB 3QGIA 2QRRA 4NWBA 4DN9A 1QVFR 4EZ6A 1F0XA 4GRSA 3TYTA 4FYYB 2KN4A 2XMVA 4USMA 4BLGA 2IDLA 5K14B 4QCLA 4B9UA 4NEZA 4ILMA 3TQEA 3T1AA 2YNIB 2YWEA 3UI3A 2XULA 4RL1A 4HT7A 4UOHA 5E5NA 1RK8A 2DB1A 2YKOA 2WONA 5HP1B 3KJVA 5DO2A 4Y2IA 2M4MA 2BE2A 2E5JA 5C2CA 2C2ZB 3QATA 2E44A 2CPYA 2G0IA 1N5YA 1QE1A 1U2FA 2N7YA 3CJSA 4CM0A 2F1FA 3CO0P 4ANDA 2DGTA 2VKZG 2XYHB 2C2MB 2XHCA 4G1PA 1RTHB 2YWKA 2QSFA 2D3OR 3FK4A 3J80U 1CS4B 3CE8A 5DQHA 2AV5A 2H51B 5AJ3F 2R2UA 2WOMA 3J81j 5A8KB 1GNKA 3NGDA 5AJ3J 4WIIA 2LU1A 2YQ0A 2VBWA 3DMJA 1KSPA 1RWNB 3HD1A 4H54A 3W5YA 4CLFA 2DHXA 4J9SA 1R31A 3CJKB 1YWXA 3CCTA 2IJNA 3WDOA 4N76A 4K4YA 3TI0A 2ZE2A 3M8ZA 1M5VC 3SV4A 4CO5A 2XYPB 2MQ8A 1NU4A 1FRIA 3RB0A 3GV8B 3V81B 1SI9A 2IYIA 5IXUA 4FS2A 1TAUA 3JQKA 4DN0A 1N6QB 2K3IA 2E1PA 2M0GB 5HJYA 4DSFA 1PKUA 4ZVOB 3G4SS 1F5CA 3L7OA 4Z2XA 1KQFB 4WFAQ 4MAKA 1IKXA 1M5OC 3N6LA 3W2WB 3SQOP 4DG1A 3RW6A 2BEFA 1NUEA 2CZ4A 2D3ZA 4ANCA 5KFXA 3V6JA 3GJQB 2CDRB 3MAAB 2C2EA 1JLCA 1R0BG 3GFZA 2R7VA 1L3UA 1XMQF 4TU7A 1FXRA 1HBMB 1WF0A 4DCPB 1XMQJ 1VQKS 3HJVA 3KK3B 2JVRA 2NLWA 4EFAC 3JYTA 4QPTA 5B0FA 2FVPA 4N77A 1DRZA 3IAS9 3GU0A 2CXEA 4ZVPB 2OKQA 3KFWX 3R5AA 2B0GA 2L48A 1IKVA 2A10A 4KO0B 5CA5A 1ZAVA 3LH2S 2VICA 2AJQA 2QLFB 1A7GE 4I2PB 3UDEA 3OPKA 2MLXA 4ELTA 3E3XA 1FXLA 1SBRA 3MMAA 1YITS 3G82B 1KVKA 3C6TA 4KPCA 2WVCA 3WX8A 4I6AA 1XWLA 3KK1A 3AT1B 1URNA 3QQCD 2Z8QA 3D7SB 2C3UA 4I2QA 4WJBA 4JV2A 2DNRA 4ES2A 4EGLA 2AEJA 1WF2A 1HBOB 2JJ4D 3VAMA 4KFBA 3RYLA 4WP3A 3ZZYA 3HT3A 3R2DJ 3HJFA 2R7SA 1RAIB 4RJVA 3R2CJ 9ATCB 3M4XA 3ZZ0A 3RB3A 4F3QA 3M8SA 2XTJP 1PAEX 1MWZA 3TARA 4BHQA 3C8YA 4DR6F 4RNOA 1C1CB 4DR6J 3MEGA 4RBUA 2M5YA 3GLJA 1Q79A 2HNYA 3TAMA 1N0VC 3W1YC 5E33A 4F3MA 2B6AA 2AGOA 1TQLA 3IAM9 4B9LA 2BE9B 3B6BA 3OBIA 5E2QA 4BCAA 1XN9A 1SKRA 4DU8A 1GT8A 3AD7C 2XNQA 4PUOB 1RT3A 1K47A 2R2RA 3BH6B 3R9LA 4DSLA 4TN2A 4KGKA 3IRWP 2D69A 2LMIA 2VD3A 4PAAA 3UDLA 3BV8A 3NL0A 3HVTB 3SCKE 1FVQA 2ASLA 3G8TA 4P2SA 4DOZA 3GZ7A 3LP1A 4C11B 4MTPA 1ZH5A 3I87A 3NOGA 4NLUA 3BYPA 1N48A 4C98A 5DGBA 1VK3A 5HATA 3CT9A 1EAYC 4J9MA 2V4JA 2J8SA 5DQIA 2A0FB 3GPAA 4OYWA 1VQ8S 3S6EA 1TFWA 3FJ2A 1U6BA 1ICEB 1X31C 4RNFA 3VAIA 2AQ4A 3KJQB 1DAXA 2HQCA 2XY5A 1CC7A 1RAEB 2CZ9A 4Q5VA 1M5SA 3CCLS 2QG9B 3JXOA 1S48A 2JFDA 2UUBF 2CJBA 4R8UA 5DS7A 5LXRA 2W9BB 5KFNA 2UUBJ 1UA1A 4P74A 1KD1T 3RBDA 2CJAA 5K14A 2CWXA 2KTQA 4DZ6A 3FBFA 3PVXA 2YNIA 3NWRA 2K8GA 3IGNA 1V6HA 2POKA 2Q6CA 4BBYA 4DR5F 3CCQS 1JWWA 2I2YA 4DR5J 4CLPA 2CNKB 3VCDA 3CIZA 5HP1A 4I0WA 1QVGR 2QMXA 2M8DB 4W90B 3MM9B 2BYCA 2JVOA 4QZVB 1HQEA 4C3MA 2E7WA 2DPIA 1HI0P 5ADZA 4DL2A 5D0EA 3SEOA 3PY8A 1D9AA 1Y5NB 2XCPA 6FDRA 3M8YA 4LR7A 3SZ2A 1RTHA 1RHRB 5EN1A 1H72C 5GMDA 4Q45A 1CS4A 1ZA2B 1WHVA 4X4UA 4HEA9 3KG4A 5A8KA 3BREA 3JQJA 4OJ3A 4DL7A 3HF5A 1BQXA 4PXCA 3TZYA 4I6YA 4ZOSA 2ADCA 2RIJA 4FYDA 3UE2A 4B9SA 3MGJA 3CJKA 1FEHA 3C19A 1HFEL 2KH9A 4USTA 1NJYA 4XK8C 2VV5A 2EFGA 1V3RA 3V81A 1RI7A 5D15A 3BGRB 1PIEA 1N6QA 1N0UA 1RT1B 3N01A 2DGXA 2OH2A 3NMRA 1TUWA 1NB2A 5U47A 3A8EA 4FDFA 4DL0C 3IRXB 2BUNA 1V9OA 5GMKa 1UFKA 1R6YA 4FS1A 4L73A 4RU2A 2FLNA 3V4MA 5L1LA 3W2WA 4PKDB 2XNRA 2JZ5A 1WOSA 4YDDB 4NZ6A 3O44A 2B9EA 2QO3A 4LF5F 1U7LA 1IVZA 1KRPA 4LF5J 3MAAA 1X4GA 2KXHA 1TKTB 1HBMA 3KK3A 1LWFB 3I82A 4USIA 2C2DA 2AGPA 3VF0B 4USKA 1RCOB 2HHVA 2DXEA 3DXBA 5CD4H 1NK4A 1GMVA 4TYAA 3V6HA 3M9MB 4KO0A 4QJVA 5IT0A 3I31A 1DJ0A 3KKFA 5EX3A 1GH8A 3MR7A 3G82A 3SMZA 2GW8A 4W92B 1U47A 2CPHA 2OP5A 1LW0B 1HBOA 3K8VA 4DUZF 3BSAA 1J27A 4DUZJ 1Q0NA 4X64F 3HFVA 2H1YA 3OFEA 3G9CA 3W3SA 1LW2B 4OX6A 2HVZA 1GTHA 4DSKA 1HR0F 2KDOA 1HR0J 3D1QA 4HI1A 4AE5A 3BBFA 3EGWB 3D6TB 4CLWA 1JNZB 3D5MA 3D0GE 4OL8A 3I55S 1IQTA 3CCUS 2GGPB 3LAKA 3EMTA 1WSVA 1C1CA 3JSMB 4OV6A 4KHPF 4KHPJ 2KRRA 2AW0A 3PR5B 1XC9A 4WU3A 4V19J 4C8LA 2N4CA 4X66F 5EWFA 1YKWA 4X66J 3IMQJ 3Q86A 4YEAA 2YKNB 2AYGA 1WTBA 4K4ZA 4Q43A 4PUOA 5F3TA 2BOAA 2J9CA 2J7UA 5I3UB 4RX6A 2CQGA 1REVB 4TU9A 4ED1A 2ZHOA 3HVTA 3A1YG 2MQQA 1VQSA 3MWBA 2YVSA 1XMOF 1MNEA 2L9DA 1XMOJ 1S1XB 1NSKL 4OI1A 4C11A 1QAIA 3CD7A 3PCOB 3JAMY 4O3RA 2B9YA 3D54A 4OZJA 4IOAQ 4P9SA 2HS0A 1IJEB 3H0PA 1V5IB 2HVDA 4TNOA 3IR5B 5EDWA 5E7OB 1TK5A 3QPIA 2WVDA 3FRYA 4IOBA 4LF2A 2FLLA 1VC5A 2P9CA 2RDIA 1RWWB 1C2PA 3FSIA 3OLBA 1EARA 2YKAA 1NXIA 2CKWA 1I94F 3FCWA 4C97A 3NWGA 3BB5A 3OD2A 2XLIA 1I94J 2CNLB 5H9EK 1S0MA 3EPIA 3IS9B 3TO8A 1B64A 3HULA 2W9BA 1FKPB 1FNOA 3ENVA 3C14B 4WTOB 2G2OA 4K5SA 4NLOA 1UPPA 2OTLS 2Q66A 4AT1B 1GX6A 2R8GA 4P2FA 3MPVA 4PPDA 2OGUA 2R8HA 2HLUA 1U48A 1DQ8A 4DFMA 2R2SA 4YOEA 1E6VA 2G13A 1UP1A 3O5TB 3ULHA 1FD2A 5F8MA 3MM9A 4CNYA 1UEVA 2MDAA 1B99A 2CJXB 2E66A 5CABA 1N5VA 1VJWA 2ZC3A 1L3KA 4KTQA 1FE0A 2W1BA 1XERA 1WKKA 2P9EA 2YQ3A 1BQMB 1X8DA 2UUAF 2RNEA 2WB1D 4FF4A 2UUAJ 2R7QA 1Q7YT 2YPZA 1PJ5A 1R43A 2YWFA 2X1AA 3W5XA 4G65A 2VFSA 3EXCX 1I6JA 1O8BA 4JV1A 3MPDA 1EP4B 3D67A 4HKQA 4I6WA 1F2GA 3H2UB 1RBAA 4C9DA 4QYZK 2DGQA 3RG6A 4DZDA 3A4TA 1RLCL 5CZXA 4BWMA 2XI2A 2AYEA 3BGRA 2W2MP 1RT5B 2XZDB 3MMBB 1HWUA 1RT1A 5BXIA 1L5UA 3ILJA 4WK1A 3DU6A 2LQBA 3I9V9 3DLGB 2R9LA 1OWXA 3IRXA 4PWUA 4CNZA 1JQGA 3MTJA 3ZO7A 2ROGA 2CNOB 1AFJA 2UXCF 3KNAA 5BYQA 2UXCJ 4Q2MA 3GJRB 3OTEA 4UZCA 4LVOP 4KQZA 4Y0FA 4JB8B 3M2UB 2QTWA 3T1HF 3T1HJ 1TKTA 3TAQA 4OHXA 2MY8A 2DTJA 1LWFA 1KEKA 2B8QA 4DPYA 1RKJA 4OJHA 1MN9A 3HLUA 1TAQA 3AODA 1XEZA 1XMBA 1Q5VA 4IRCA 1AFIA 1EX8A 4WKRA 3ZZZA 1VGYA 2BX6A 3JTNA 2V2VA 4NI2B 2MQOA 2F8HA 1YJVA 3VAGA 3N5FA 1WI8A 2VUGA 3T9NA 2V4RA 4LQ9A 2F65A 3OL6A 1RWUA 2HBRB 4C8ZA 1G4CA 5B0DA 2JC0A 5CXTA 4HTIA 1PC4A 3TUIC 5F9NA 1FRKA 1IUJA 1KLMB 1Q8IA 2Y8WA 1RWVB 1S6OA 4K4SA 3BSCA 1KTQA 1TVRB 3CCZA 1RLDA 2YWGA 1LW0A 4FKXA 4FP9A 2MQPA 5F8JA 3L3CA 1SJFA 4ER8A 3KUEA 1LW2A 4QIFA 5LMUF 2YPYA 5HN0A 4OI4A 5LMUJ 4CCHA 3DFEA 2IBOA 5KG0A 1AYEA 2Y1LB 3TJ9A 2RD5C 5M2UA 4UY85 1HW9A 2O01C 4H4MB 2YWWA 1WF1A 4DEZA 1ZA1B 3RGIA 2VL1A 2GGPA 1R0AB 2HQ3A 2W2QP 2HAFA 5L9XA 1SL2A 4ID5B 3JSMA 3K59A 2FC8A 3D2WA 5HL7Q 4C3KA 5A2QY 2QJ3A 3EZOA 2GO9A 1KFSA 4Y2MA 2I1RA 1SC3B 2CPEA 3EE3A 4ZN3A 4DR4F 3BSNA 4DR4J 1VRUA 2QV6A 4M5MA 1PBUA 4ECVA 2HFOA 2Z2MA 2YKNA 3OFGA 1S4EA 1ZM9A 4L76A 1RHQB 3BDEA 3KNGA 2E9RX 3PJXA 2E1AA 5I3UA 5D6GA 1VC0A 3C6UB 1LWXA 3OR1A 2KHDA 1EKRA 1REVA 5HMXA 2DD8S 2GHPA 4ZPCA 4DLGA 3BDPA 2HNDB 5L38A 3QIDA 2CQCA 1RBLA 4IYQA 3MFHA 1S1XA 1KNZA 3IA0A 3TUJC 3FBEA 3R5JB 2ALYB 2OFHX 3VALA 2G2YA 1DHMA 3H25A 2GX8A 4C7QA 2XSFA 1N32F 1B3TA 1N32J 4GO5X 2ZKTA 2KYXA 2FC9A 1OQ3A 4QQBA 3QJPA 4USJC 2N3LA 2B4OA 5T41A 3G86A 3K17A 1HARA 2PEBA 2G9OA 3V4IB 1W26A 1H38A 3Q23A 1IBKF 3IS9A 1NEEA 3QAEA 2ZBPA 3SFUA 1IBKJ 1BXNA 4FVMA 3UFCX 1P9QC 1FKPA 3C14A 2PSZA 4OJGA 3K5OA 1JLAB 3OQ2A 3KHLA 2BJ9A 4M5HA 1Q8KA 2WHOA 2NYIA 5DDRC 1JJHA 3M30B 1SL1A 1A6LA 1U1NA 2FY8A 5KOWA 2J6UA 3M6XA 4YR0A 4LSLB 1UVIA 3AY0A 1Z1ZA 4G3IA 4UF4A 5I3PA 3DRPB 1FDNA 2ROEA 2GIQA 2ZZNA 1VRTB 4UUWA 1T9WA 3MCNA 3TX0A 3S01A 4MKAA 5GADU 4NZ7A 4USHA 1RISA 3TA1A 3O6QA 1S10A 1X5SA 2XO7A 1JKHB 2CQBA 1MW7A 1S97A 2F9DA 1BQMA 3DXSX 4LSZB 4CO0A 1KS2A 5KT7A 3GE9A 1HW8A 4CM2A 3BM7A 3HSDA 4C3LA 1V3ZA 1ZETA 4PXDA 1NCLA 2P8IA 4DDFA 1EP4A 3IWLA 5L1IA 1ZTWA 3Q2SC 3TRGA 1UEKA 2O66A 2R8IA 1NAQA 1F2HA 4ILRA 2N82B 4RW7B 1FE4A 3W2VB 1Q95G 5E3PA 4QWEA 2OD6A 1RT5A 3F73A 3HK2A 3MMBA 3PHEA 1KDNA 4B17A 4M5NA 2DGWA 2ZOGA 3OTDA 3GJTB 4M63A 1D9DA 4Y2KA 1RWXB 3GONA 3N6NA 1YGYA 1M90T 4U8YA 4KKOB 3J7A1 2HKEA 3DLGA 4DJBA 3HHKA 1YJTA 4NLSA 3W64A 4QIGA 1UJ6A 2HSEB 3ITHB 3F44A 3ICLA 1Q53A 1TV6B 3FC9A 2EW9A 2RU9A 2OELA 4FPIA 2AZ3A 3PO4A 2M70A 2IVFB 3M2UA 3DYAB 2PN6A 2DH7A 3AJDA 4A8MP 4EO6A 1SL0A 5CZVA 4RZRA 1CVJA 1ZZNA 2C3OA 2LQ5A 1MN7A 3GFHA 2BJDA 1U8WA 3LO3A 5T14A 3CD0A 3PJWA 2LYVA 3OVAA 3NS6A 3M7VA 1REGX 3EUNA 4N47A 3KLGB 3R97A 2N4DA 1NSAA 1OYEA 4NI2A 3MM8B 2V6AA 1NDPA 3MEEB 3ZNJ1 2MQLA 4HLBA 5LT5A 2KXFA 2L3MA 1SV5B 2ZC4A 4CH7A 3NAHA 3MAQA 2HHQA 1NLKL 4EBCA 3IO1A 1U8SA 1U1KA 3NCRA 4DPWA 1KLMA 2B5JB 2MKYA 3MM6B 1IKYB 3P49B 1RSCA 4RLEA 4GO7X 5KFPA 1ZYQA 1TVRA 2FB0A 1SJ1A 2EFOA 3PTWA 1VBZA 2B4UA 3M32B 4LBIA 1WJ9A 4PABA 3R1LA 4P7VA 5A6WA 4DFKA 1VRQC 1WC0A 4DF8A 3UD3P 1G3OA 1MMNA 3BQ2A 2EBGA 2V94A 1GX5A 2BR0A 2V8DA 2EKNA 1FA0A 2HWTA 5LSRA 4H4MA 3OXFA 4P2MA 4WWSA 2BBEA 4XO0A 4CLUA 1ZPWX 4ID5A 2OSQA 2DR9A 2HVHA 5D0GA 1TL1A 1LOUA 4TYBA 4XPCA 2BJ8A 1S76D 4Y2AA 4DQRA 2RF2B 3P5BP 2FJBB 3E01B 2W4DA 2R3VA 3THTA 3R5BA 4IRDA 3QT8A 2VFUA 4BC9A 3R6LB 4NLTA 1AXQA 2HGNA 1VK8A 2R4FA 1NK6A 2BKPA 1SJ4P 2ASYA 5KG3A 3C6UA 1NDLA 3BH7B 3N0VA 2NYHA 1J5EF 2V34A 4ZCIA 2HNDA 1J5EJ 2R2TA 1U26A 1H0HB 5LOQA 3PKMA 4ED7A 1U1LA 3H98A 1WG1A 4RNMA 1JXLA 2LFVA 4ZVFA 1UETA 4KHRA 1T3OA 3JSBA 3K57A 3GQCA 5ETNA 3GWCA 2VJUA 3IBFB 4HR2A 2WAQD 3B4MA 1HYSB 2DIUA 1F3VA 4LIWA 1SCJB 3VTIA 5IV3A 1D3WA 1IR2A 3OVSA 4U67Q 3I6PA 1DZ5A 4QR1A 3CIMA 3V4IA 3ZTRA 1NBEB 4B9VA 1OPIA 2LDIA 2NREA 4RWXA 4J9VA 4A8OA 4UTGA 1TMMA 3IFEA 3OJSA 4L6V3 1KQKA 4M94A 1JLAA 3RRGA 4DX6A 4P2XA 3TVYA 5HVFA 3GB0A 3M30A 3EZUA 4WIQA 1KHVA 2JFKA 3B4DA 3O3LA 4LSLA 2XMMA 4H4OB 2APOA 5GADI 3DRPA 2GVZB 3DGVA 3RTVA 1VRTA 1VYAA 4CYUB 3WC2A 1XK8A 4PRFA 2W2NP 4DCJB 3CMQA 3PNIA 5C5JA 1NPPA 4CT8A 4KGVB 3VVUA 4AQYF 4NOHA 4AQYJ 3QLHB 4L3NA 2KI2A 2QLBB 3NNCA 1VHFA 3U1LA 1JKHA 4IH5A 4K2JA 4B08A 4ECZA 3T6BA 3W62A 2KM8C 3CULA 5HAOA 3KLHB 2JNJA 2VF3A 2OSRA 2J9EA 2EFNA 1VBYA 2DXFA 2UP1A 2W8KA 3M8RA 4Q2LA 2XS5A 4QU7A 2ASJA 4CO4A 2LVWA 1S1WB 2V63A 2VIHA 2XQCA 2HPUA 1Z4UA 5ETVA 3NKYA 4RWWA 4OHZA 3G6YA 2BRKA 2CPIA 2A2DA 2H54B 3MMCA 4YB7A 4LQ3A 3RB4A 2EC2A 3CNQP 1KFDA 2E5GA 2MHEA 4IO9Q 4CLZA 3TAPA 4RW7A 3W2VA 1F5AA 4ED6A 4J9LA 2X7IA 1PAUB 4IUFA 3PG9A 1RWOB 1UVJA 4G6VB 3E8OA 2O3DA 1RA6A 3UD5A 2JL9A 2MKSA 1RAHB 4PYAA 2B8PA 2LEAA 4TVAB 4KKOA 4IRKA 5HK4A 4C8YA 5K8MA 2JHEA 2PI5A 2VHGA 1HPZB 3ITHA 1U0HB 2GQCA 2KT3A 5FDLB 1X0PA 1TV6A 4QWBA 3MZIA 1VQ6S 4A47A 3DYAA 2CJYB 2PIIA 2YKPA 3EVWA 2W2PP 3UVJB 3TJ8A 4DL6A 2F8EX 2DNOA 1FFWB 4FPRA 2J0SD 3MOJB 1WC4A 4FVCA 2GHWA 4Q8EA 4F36A 2VFRA 3WBZA 3QT6A 2BM0A 4RBVA 1X0FA 1RHKB 2K3KA 3NS5A 3MM8A 3G96A 3V5RA 2FZKB 4HI2A 1RTIB 4NMXA 2FVCA 3MEEA 4IDKB 4C48A 1ZAXA 3GP9A 3GTYX 5KG2A 2ATLA 2V8GA 1SV5A 2ZH7A 2ZVIA 2B43A 4K4UA 4A8SA 3CJQA 1Q86T 2V69A 1QSYA 4UY8T 2W8LA 2HBQB 2B5JA 3MM6A 1IKYA 4DPOA 2J0XA 5KFDA 2G2ZA 2ZUGA 3K5MA 4DXLA 2X1FA 2YKMB 4EYIB 3M32A 2PDAA 1AZSB 1IJFB 2D74B 2EI5A 4UQGA 3I4HX 2SXLA 3M6WA 4AL5A 1AT1B 3MPYA 4HYKA 4F04B 2OI2A 5IT4A 1NPRA 1OMSA 2PA8D 3NGTA 4QBUA 2GO8A 3R3TA 4X4RA 3OFHA 2B51A 4UUXA 2IIHA 4OZ1A 3HVAA 4R5PB 4PG4A 3U1NA 3LP2B 3J7Z5 1GXLA 2CA9A 2Z2YB 1HBUB 1F5BA 4ZN1A 3QYYA 3OVBA 1CQNA 2RF2A 4U7CA 2FHKA 3W9HA 2KYZA 4XTTA 3FBCA 4V19X 3BJYA 4WKYA 4P6QA 2KO1A 2WB4A 2LU2A 1WHXA 1OQ6A 3FGVA 2ZHAA 1VQ9S 1FF2A 5G0RB 2DGSA 1X4BA 4WYWA 2NUUG 1IR0A 4NLYA 1KQSR 3T1YF 1FFSB 1PBAA 4OI6A 2HZCA 3T1YJ 2RQ4A 1MROB 1OIAA 2DNNA 4FNHA 4PQUA 2IC3B 1TMJA 4JI2F 4K50A 1S1VB 2CYYA 3FBBA 3FEZA 2AP6A 4JI2J 2EG1A 3NXZA 4PEOA 2DJWA 1A9NB 3D9BA 3W7BA 2BJ7A 4J37A 2HBYB 2LXIA 2RS2A 1VQNS 1HYSA 3TZXA 1NHVA 4NCGB 3H40A 2CPDA 1RT4B 3NNAA 2MHNA 2MZTA 1FJEB 3Q22A 3R5CA 3MEDB 1P9YA 3PR4A 2MXYA 3UCGA 4IQMA 4ZDNA 5A8WB 1G6BA 3R8YA 3CF5Q 2U1AA 2HHSA 2LQJA 1T9XA 4CP5A 4YP3A 3DM2B 3D0IE 2PO4A 4KGMA 1QSLA 3A8IA 1SIWB 1N56A 1MWQA 1T11A 1V5VA 4QYRA 2IY5B 3UO0A 1SUQB 2V9WA 1VHIA 2DHSA 1PG5B 4H4OA 5CYMB 3POTB 2J0WA 3RB6A 4UZBA 2A6MA 1MSWD 5EWEA 1C4CA 1XNRF 1K1SA 3VAJA 2AJ1A 2GVZA 3CJTA 3OL7A 1WDDA 1XNRJ 3PW4A 2ZD1A 3IN5A 2QFJA 4QU6A 4L75A 4CYUA 4OHVA 1BMQB 2PI4A 3TW0A 1CQMA 1KP6A 3KDNA 3V6DB 2V67A 5GAGU 3QLHA 5IZHA 3CMAS 3BYRA 3DHXA 3NP5A 1F9EB 2GJFA 2BKOA 1QM9A 2AF6A 4ECTA 3KLHA 4OYMA 1QTNB 1L3TA 3MAHA 5L1JA 1S99A 1FERA 4YS2A 1R7IA 4PXEA 3Q8SB 1FX2A 3SFGA 2D1CA 3LWLA 1LKZA 5IOLA 5DDOC 2A18A 3CCJS 1S1WA 4WTYA 3UN5A 1YLXA 1NH8A 1L3SA 1T9UA 1NK7A 3R5GA 1RU2A 2NS1B 3Q0AA 2OEKA 1Y5IB 2ZEJA 2BW7A 1Y5LB 4ZVEA 3OUYB 2CAJA 2KT5A 2WVEA 1K0VA 2XWXA 3IG1B 2RB7A 1FRLA 8RUCA 1R6VA 3PKYA 4DV6F 4W4MA 4QIVA 1N5TA 4DV6J 3GIKA 1NPKA 1Q1KA 3FMBA 1RKIA 4Q0BB 2XSJB 4OZLA 2AZ1A 1PYSB 2G1DA 3CDUA 2QMUB 4LMZA 2NPIA 2VH7A 1HPZA 2MEWA 1U0HA 2J76E 2VBZA 1HI1A 3MTKA 1S7HA 1TK0A 1WI6A 3BPDA 1U2CA 2Y3YA 2IVMA 2Z0GA 4ZLPA 1M5HA 3DDIA 4O23A 4OZ0A 3UVJA 2VU5A 4X4VA 4HH0A 3Q8PB 4G1IA 1T8EA 2ZUAA 3WX4A 2AT1B 2MJUA 2IPOB 2WSFC 5F9LA 2AIRB 5FLXY 1S5ZA 1UW4A 3EDRB 1U4BA 1U0SA 4O44B 2R7UA 2OPPB 1NHKL 2P6TA 3HHNB 4A48A 5H9EJ 2ZBQA 2Y0BB 2RHQB 4LBPA 1UL3A 3TNVA 3PACA 3QIPB 3G8SA 5AXKA 4O3SA 2HRTA 2HZAA 1IWGA 1VR6A 1RYSA 2J7WA 1YZ7A 4IDKA 5E0OA 2XI3A 4ZPAA 2HNZB 4C8KA 4DV2F 1AUSL 4DV2J 2QLWA 5IT9U 1H7WA 3AD8C 1R3NA 3UCZP 5J2NB 1H98A 1ELOA 4ZPDA 2ZOFA 5KFBA 3UQSA 1EETB 4M5IA 2V2KA 1AZSA 2HQFA 1NMEB 1S1UB 2BKNA 2FJWA 3BGUA 2YNGB 2JEJA 4M1KA 3DLBA 2BM1A 4AYBD 4JBCA 1N54B 1OY6A 3VQTA 1H73A 5B0CA 4NCAA 3GCWP 4DPUA 3HM9A 4R5PA 2RILA 4JP8A 4RW8B 3JB9k 2QA2A 1O0PA 1HBUA 1YVFA 4IH7A 1U45A 5HMZA 4NE9C 4N8OA 1RT6B 3D28A 2Y0SD 5K8NA 5HQ8A 5DZ7A 4ZVGA 2ZBIA 3GYGA 3H5SA 3FQKA 4I67A 4GC6A 1HNVB 4QYZJ 1IXKA 4LJMA 1HIYA 3BKFA 4BS2A 3A3PB 1SJQA 2ZWOA 4DF4A 3AQOA 5G0RA 2V5HG 1YJNS 2DRDA 5F3ZA 3I5BA 3N28A 3O8WA 4RKUC 3JAMU 4DBQA 3FZ2A 4X4PA 2C1EB 1MROA 5DDQC 1W7WA 2IC3A 1R8CA 1S1VA 1NJWA 3GJSB 2B4VA 3PHTA 2Q1LA 2DNHA 4F0MA 4B3TF 1D8ZA 1VLOA 4B3TJ 2K7JA 5LJ5Y 3QRPA 1WEZA 3A13A 4WE1B 3TQ1A 2QFIA 1D8YA 5LMNF 4DX7A 2HURA 3RBXA 5LMNJ 3OHBA 2P5VA 2NSBA 4NCGA 2FPHX 2XY6A 1RT4A 3KTQA 3FEXB 2J5AA 2WTFA 3GG0A 5JVHQ 2AX0A 3C2PA 1TUGB 3DRYA 1WG4A 3MEDA 2E29A 5KFCA 2OHDA 3DOLB 3W9JA 2UVRA 2HHTA 5A8WA 1AW0A 4PQAA 1VQ4S 2ZITA 1C0TB 2HHUA 4URSA 3DM2A 4OYIA 4K4TA 4MYTA 3VR1A 4ZA1A 5K9FA 2BV3A 5J1EB 4X65F 5KFWA 4NXMF 1LEOA 1OPZA 4KR0B 1Q82T 4X65J 2HHHF 3QMQA 1WOPA 4U9RA 3LOUA 4NXMJ 3SI8A 2DNPA 1SUQA 2HHHJ 4H4KC 5DJBA 3G6VA 2X3DA 5CYMA 3POTA 5C24B 3K0JA 1HQUB 2VBYA 1T9YA 5LXYA 1B70B 2IMOA 3H4BA 2D41A 2ATCB 1F1BB 4F67A 5GAGI 2W7PA 3C15B 1MU2B 1DQAA 4OIXA 2DBBA 3DLKB 2IDEA 2QN6B 3VZHA 3RW7A 5IM0B 4I56A 1Q8BA 4NX9A 2NSCA 1HA1A 2YBVA 1HWLA 4WF9Q 3HT0A 1EQ0A 3VAKA 5HROA 5L1KA 3NG8A 1I51B 2M3DA 3W8GA 2BQ3A 3J7YI 3FKBA 2AMCB 1BY9A 5CAAA 3IBWA 3T19A 5J2PB 5DM7Q 1JLFB 4GVLA 1E6YB 2V0NA 4ZLJA 3QFWA 2R7XA 3K5NA 5AXNA 3JTOA 4O4GB 3SCLE 3EM1A 2OIHA 3OUYA 4NLWA 2M8HA 2V2ZA 1AA1B 4OYBA 1LWEA 3IG1A 2LQ9A 3LGNA 3SQGB 2IA0A 3J81Y 2GS8A 2MMYA 1NJIT 2J6SA 5A76A 2DNLA 3EYZA 4K4XA 2DR5A 3QJJA 4ZKAA 3U1MA 1P1LA 1SH2A 4Q0BA 2XSJA 2LEPA 1U49A 5KFLA 1T94A 2CIMA 4ENOA 1J5OB 2XG8A 3RU0A 1CJUB 3ENWA 5J1PA 1S1TA 1RAJA 4B3MF 3LQVA 2YNFB 3ILOA 4B3MJ 2RT3A 1X9MA 5C42B 2UUWA 1QY7A 3T9ZA 4M5LA 2I0XA 3FZBA 2L9WA 1FRXA 1SIZA 2FD2A 5MLCV 1JJ4A 4U7UK 3M2VB 2VPYB 1HNWF 1QDUB 3OSPA 5KFUA 2FDNA 4O44A 2OPPA 2OAUA 3EGNA 2NXNA 1HNWJ 3NGSA 2XLJA 4EEYA 1ZZFA 4IKAA 3QIPA 4K0KF 3GSDA 4Z7YA 3AB4B 4K0KJ 3VAHA 4WU2A 6AT1B 4KGZB 4LBHA 4KC5A 3CJRA 3MFIA 2CQPA 4RPFA 2DNQA 3FMWA 2HFNA 2HNZA 3HSZA 3UR3C 2R8JA 4QIWD 1HLWA 4MYUA 2OFGX 2C2OB 3WIUA 4U8VA 4GVBB 2GV1A 2QX0A 3AAWB 4J9PA 3BGOP 2DR7A 5BYRA 1WG5A 4KH1B 3RAXA 3LP0B 3R27A 1BC6A 3CC2S 4A4JA 5J2NA 3EDQB 3J7ZT 4PYDA 4Q7AA 3W5ZA 4X2BA 2GJIA 2KL8A 1EETA 1NDKA 1ZM2A 3MEKA 4A46A 3HSJA 2BW2A 2YNGA 5B08A 3CJ4A 2BVZA 3UN2A 3GIJA 2KT2A 1X9WA 1U24A 4WXOA 4N41A 2A2CA 3D4JA 4H4KA 5AXMA 1RGVA 4LRBA 3FSYA 4P72A 2HEKA 3L7PA 5A2QU 4N5SA 2RQCA 4WFNQ 4PWWA 2DNGA 4RW8A 1JLQB 3TJAA 5EGYA 3HHLB 2I38A 4DX5A 2PMWA 4OX8A 1DARA 2HS3A 3EVMA 1RT6A 1K8AT 2W2OP 3NGKA 3KHRA 4DFJA 3W9IA 4LR8A 1CC8A 3F56A 5A8RA 5KFKA 3Q83A 4J9OA 3TZZA 4ECRA 1S6PB 4KPYA 1BE4A 4NL5A 4WXWA 1HNVA 2J6TA 2KVQE 3HVRA 4JI6F 2BOPA 4K8RA 4EU0A 2E1MC 3CGIA 4JI6J 2FVRA 2KZMA 4DSIA 2XMJA 2FLOA 1YSJA 2V9KA 1Y9OA 2PMHA 2VC0A 2GHVC 1K44A 2DT9A 1UVNA 3UDVA 3CJ5A 4HH1A 4WYLA 2DHGA 4FF2A 3TWZA 1PCAA 1FD8A 4UW2A 4K7QA 1YBTA 4OYOA 4ZLNA 4Y00A 1FWKA 2PE8A 2VFTA 1WKJA 2HWIA 3MCSA 3UNYA 3AA8A 3PFOA 3ET6B 2W25A 4NXNF 2L08A 4O3NA 4NXNJ 5I3QA 1Z2LA 4KYZA 3BQ0A 2AD9A 4WE1A 2HVEA 4KT0C 3OR2B 2ADBA 4ZVHA 4U96A 2RUSA 4AL7A 2FGCA 1SJ3P 3O2IA 4EBEA 3BR9A 4MKYA 3PRVA 3CCSS 4KIAA 2NCKL 3DOLA 1KR4A 3H20A 3MI7X 4K4WA 2DRAA 4O0NA 3UDCA 5I42B 3BEGB 4NA3A 1C0TA 4I64A 3ZNUA 1T0TV 3AXKA 1U25A 5J1EA 3OL8A 2CQ3A 3ZTPA 2ZH9A 5E3AA 2AU0A 2DCLA 3CJ8A 3IR7B 4I1TA 1PSDA 1NKEA 5GAHI 5B09A 2YX1A 5C24A 1HQUA 4NYZA 4F7VA 3GFXA 4U6PA 2ZDOA 2UVUA 1SH0A 1MWYA 5CYJA 3CUNA 4UQTA 3TVZA 3C15A 3BPSP 2UV8A 4JV5F 2RE1A 1VFJA 3DLKA 4JV5J 2KG1A 1YG0A 3M8PB 5IM0A 1R27B 4CO1A 5D78A 4CH0S 4Y65A 4L72B 1FRJA 4CLLA 1VQLS 2WONB 3PYFA 5J1NA 3BGFA 3NS7B 5HO4A 3JTPA 1FNXH 3F0NA 2V50A 1OY9A 5EHHA 2PC6A 3PM9A 2NZ4A 3ZFVA 4W98A 2YKQA 5J2PA 5F0WA 1JLFA 4B3OB 1E6YA 3S8SA 2ZZMA 3G71S 2R7WA 4O4GA 2JEIA 3RBEA 2RDDA 3QZ7A 3ENAA 3RUBL 4QOTA 2W7OA 4RW6B 4ZPWR 3HDSA 2MZSA 4RNHA 1VCTA 3M2RB 2QLJB 3QRQA 2DGUA 1F6TA 3SQGA 1PO6A 5DZ6A 3THPA 1WC6A 3UW1A 5IWAF 4I2PA 5IWAJ 1LK7A 3SXLA 1SC4B 2NXCA 5M2RA 2Y1RI 1ZBTA 4ECQA 5LL6d 1GEHA 2IVYA 1J2VA 2GIRA 2HFUA 1J5OA 4WFZA 2BJ1A 5IT9Y 3MECB 2HIQA 3CXCR 3GV7B 2OJ3A 3PW2A 2VBXA 2YNFA 4FN5A 3CCMS 5C42A 5F8HA 3CCES 4X64J 4CLKA 2FHJA 1OS5A 4HVZA 2VPXB 1Y00A 4P73A 3Q8QB
chains in the Genus database with same CATH topology
2QA1A 2FJDB 5B7WA 3LANA 3RAMA 4A8OA 3M2VA 1JLEB 2AJQA 3PIOQ 3QGGA 1A7GE 5F8IA 3IFEA 4I2PB 5KT4A 3OPKA 3OJSA 2ASDA 4L6V3 4ELTA 3KWMA 1KQKA 4M94A 1O5JA 3E3XA 1SBRA 3EXYA 3MMAA 1IBMF 1YITS 1FXLA 1JLAA 4DV5F 4PXBA 3PFEA 1U6FA 3RRGA 5J2QB 3CDAA 4DX8H 3TVYA 3C46A 2B9WA 4LT6A 3GB0A 3C6TA 3M30A 2RSQA 4ED5A 3EZUA 3MD3A 4I6AA 3GYNA 1XWLA 2VASA 1D0EA 4Y28C 3KK1A 1KHVA 2JFKA 3B4DA 4ZP8A 3CCRS 2LECA 3O3LA 4LSLA 1URNA 2I8EA 2F7VA 4YR3A 5F41A 2Z8QA 2XMMA 2C3UA 3M1VB 4H4OB 4I2QA 2AYMA 1P8GA 4WJBA 2APOA 3CCWA 4JV2A 1ZM3A 2DNRA 2HHXA 1YQHA 4ES2A 4EGLA 5GADI 3PO5A 3DRPA 1WF2A 1HBOB 1HNIB 1NH7A 2JJ4D 3VAMA 4KFBA 1YJWS 5F8LA 3HO1A 3RYLA 3RTVA 2FIUA 3BR8A 1VRTA 3ZZYA 3J7YU 3HT3A 2EK1A 3TP2A 2JEFA 3HJFA 3WC2A 1V3SA 2R7SA 2AJFE 1FCAA 3PRDA 1XK8A 5DM6Q 4YB1P 3M4XA 4ETZA 3LP0A 2NUHA 3ZZ0A 4F3QA 3KYLA 5FIIA 2ZFHA 3M8SA 3RB3A 4PRFA 2W9CB 3PNIA 5C5JA 3UCUP 1QUVA 4M5DB 4CT8A 4AQYF 4F4YA 1MWZA 2EVZA 3TARA 4NOHA 3KLEB 3QLHB 4L3NA 2KI2A 3NNCA 1VHFA 4NLRA 3U1LA 1S9GB 3C8YA 4BHQA 1JKHA 3AB2B 4IH5A 3NBPB 4B08A 4ECZA 3T6BA 3OSNA 3MM7B 2A3JA 2K2PA 4DR6F 2KM8C 2CQ1A 4RNOA 1C1CB 2CVIA 3CULA 3KLHB 2WBRA 3MEGA 4RBUA 2M5YA 2E9ZA 4MK9A 1Q79A 2OSRA 2HNYA 2J9EA 3TAMA 2EFNA 3C3LA 1N0VC 1VBYA 4PWDB 3CDEA 5E33A 4F3MA 2UP1A 3O1LA 4A8XA 4DQIA 2Q6BA 2W8KA 3M6VA 1PC5A 4FXWA 2B6AA 5KFFA 3M8RA 5LSLA 4Q2LA 2XS5A 4C0HA 2AGOA 4QU7A 1TQLA 3IAM9 2ZJQQ 2CQ2A 4B9LA 4IOCQ 2QT7A 2ASJA 4CO4A 2LVWA 2JDJA 1S1WB 3OBIA 4X4OA 1JLQA 5E2QA 4BCAA 2HPUA 1XN9A 1Z4UA 3HHLA 3NKYA 4RWWA 1SKRA 4OHZA 1QAXA 5KFTA 3G6YA 3K5PA 4JUZA 1GT8A 5FDLA 3K5LA 2BRKA 2CPIA 2A2DA 3MMCA 4YB7A 2N7CA 3RB4A 1HWJA 2XNQA 1JX4A 4LQ3A 1JB0C 4PUOB 1FT8A 1OSCA 1RT3A 4KB7A 1U1OA 1UWBA 2R2RA 5CYQB 2IM1A 4DSLA 4TN2A 5E3QA 1KFDA 2E5GA 2MHEA 3DLJA 4KGKA 3IRWP 4IO9Q 1N88A 3TAPA 4ITSA 2HGMA 1H2UX 4RW7A 3W2VA 2DGVA 1F5AA 2LMIA 1VQMS 2VD3A 4ED6A 2DR8A 3MM5B 3UDLA 4J9LA 3NL0A 4OHYA 2UZAA 3HVTB 2AX1A 3SCKE 1S6PA 1HD0A 1FVQA 2HGLA 4J9QA 2ASLA 4IUFA 3G8TA 3M9NB 4P2SA 1UVJA 1Y7PA 4DOZA 2OO4A 4G6VB 1OO0B 3GZ7A 5HI7A 3E8OA 3G8QA 2O3DA 1VIOA 2MQNA 3L09A 1RA6A 2WCXA 2WRMA 3LP1A 2JL9A 2MKSA 4C11B 5KG5A 2UUTA 4MTPA 1VC6A 3I87A 2VFVA 1ZH5A 2LEAA 1DTTB 4KKOA 4NLUA 4IRKA 2EWHA 1N5QA 1XR7A 5K8MA 4C8YA 2JHEA 3CDWA 4JI4F 2PI5A 4C0BA 4Z37A 4FBTA 1N48A 1Q81T 4OV1A 4C98A 5DGBA 4EBDA 1VK3A 1TKDA 3QO9B 3EGZA 1HPZB 5KFEA 1LWCA 3CT9A 1HL6A 1RTIA 3ITHA 4J9MA 1RTJB 1S72S 2V4JA 2GQCA 1H7XA 2KT3A 3KK2B 5FDLB 1X0PA 1TV6A 3MMCB 3TX8A 3KLIB 5DQIA 4FZVA 5THWA 4QWBA 1VQ8S 3S6EA 1TFWA 3FJ2A 3MZIA 4G1QA 1Y4ZB 2FY1A 1U6BA 4C4WA 1VQ6S 4LFBF 4A47A 4R0JA 4RNFA 3DDKA 5D4OA 1JXEA 2BXJA 3VAIA 3DYAA 3WC0A 4B3SF 2AQ4A 2PIIA 1DAXA 2YKPA 4CH1A 2E1RA 2YTCA 3CVKA 4F02A 2XY5A 1CC7A 4DL6A 4ECUA 2CDQA 2F8EX 2HRUA 4Q5VA 2DNOA 1GXUA 5GAEU 2QLXA 1M5SA 3MD1A 4HTJA 1YBAA 4FPRA 2J0SD 3CCLS 3MOJB 4FVCA 4WK3A 1S48A 1LQ9A 2GHWA 2JFDA 2UUBF 4Q8EA 2CJBA 4R8UA 4IR1A 5DS7A 1NB7A 5LXRA 2W9BB 2YKMA 3LP1B 5KFNA 2QYCA 2LA6A 2W4PA 5BYSA 1UA1A 2VFRA 4MFBB 3WBZA 2COLA 1JMTA 1KD1T 5DETA 2FHOB 2BM0A 1ZOTA 2BQRA 4RBVA 3RBDA 4MK8A 5LSOA 1X0FA 2C42A 3HPOA 2CJAA 2K3KA 5K14A 3NS5A 2KTQA 3DRSB 3MM8A 3G96A 3V5RA 4HI2A 1RTIB 2FVCA 3PVXA 2YNIA 3OTBA 4K5RA 3MEEA 2K8GA 2KJWA 4IDKB 3IGNA 1V6HA 5I42A 1ZAXA 4TXSA 2KB2A 2POKA 2Q6CA 2I5JB 2VPZB 3DOKB 3OHAA 4BBYA 4DR2F 4DR5F 3CCQS 2ROPA 3WZ0A 5KG2A 4RU9A 2ATLA 3OL9A 2V8GA 2I2YA 1JWWA 1BD6A 1SV5A 2ZH7A 3BN7A 3LP2A 2B43A 3VCDA 4AXJA 4K4UA 4NMLA 4A8SA 1Q86T 3CIZA 5HP1A 1QSYA 4I0WA 1QVGR 2QMXA 4CTAA 2M8DB 4UY8T 3MM9B 2BYCA 2HVIA 4W90B 2JVOA 2W8LA 4QZVB 1HQEA 3MDFA 4C3MA 5FD1A 2B5JA 3NRBA 4DWIA 4I7FB 3MM6A 1IKYA 4J9KA 2KZZA 3CWJA 3IC1A 4DPOA 2J0XA 5SZTA 2E7WA 3ETOA 3IR6B 5KFDA 1D9FA 2ZUGA 3K5MA 4QR0A 3HKWA 1HI0P 2DPIA 2J0QD 5ADZA 4DL2A 3I5CA 2XLKA 3SEOA 2X1FA 3PY8A 2YKMB 4EYIB 2FVQA 3M32A 2GC8A 1S9FA 2PDAA 1D9AA 1Y5NB 2ILYA 2JSXA 2X51A 4DV3F 4CT9A 1LXNA 2XCPA 1IJFB 3MHYA 6FDRA 1Q7LB 2D74B 5DG7A 2EI5A 4UQGA 3I4HX 3SZ2A 1SB6A 2FLPA 2SXLA 2E5HA 3M6WA 3PIPQ 4AL5A 1TKXB 1RTHA 4DQQA 2ZDPA 2PT0A 4ALZA 5EN1A 3MPYA 1WHWA 4NRUA 3AQPA 2M9KA 4J5OA 4HYKA 2KZMA 3P5TL 2DGOA 4Q45A 3TA2A 5IT4A 5KFHA 4X4UA 1S6QB 1WHVA 2PA8D 4HEA9 4QBUA 2GO8A 3I0SB 2XMTA 3FEYB 3KG4A 3R3TA 1X4AA 4X4RA 3OFHA 2IYGA 3M8PA 2B51A 4UUXA 2PMZD 5A8KA 3BREA 3VQSA 3HXMA 1UFWA 2K1RB 4OZ1A 2QSWA 4OJ3A 4DL7A 3HF5A 1BQXA 4ECXA 2YH1A 4PXCA 3HVAA 4I6YA 3M6UA 4R5PB 4PG4A 3U1NA 3LP2B 2CRLA 3J7Z5 2IAJB 4ZOSA 1GXLA 3FCHA 2M88A 3BO3A 2ADCA 1B0VA 2RIJA 4ELVA 4FYDA 5KG6A 1HBUB 3UE2A 4B9SA 4FF3A 1CEZA 1F5BA 3MGJA 3CJKA 1HQEB 1FEHA 4ES1A 4YUDA 2VQFF 2GQ2A 2KFZA 1HFEL 3KHHA 3QYYA 2KH9A 3BS9A 3OW2R 3OVBA 1CQNA 2RF2A 4U7CA 3HKZD 2MKHA 2RQMA 1NJYA 4ZP9A 4XK8C 3EX7B 4OJ1A 2FHKA 3G6ES 4F8RA 2KYZA 4OQJA 4C0OC 2WBMA 3IWNC 2VV5A 2XEXA 2EFGA 4B3OA 3PDNA 1V3RA 2IMWP 2CZVC 3V81A 4V19X 1RI7A 3BJYA 5C25A 3BGRB 4WKYA 1DBDA 4P6QA 5A0YB 2KO1A 1N6QA 2FGOA 1TKZB 2JOQA 1N0UA 3FNNA 1RT1B 2WB4A 2LU2A 2OPRA 1WHXA 2IRYA 1OQ6A 3FGVA 3N01A 3PX0A 2XGQA 2DGXA 1U09A 4NA1A 2DNYA 2ZHAA 4XIUA 2OH2A 3NMRA 4PCQA 1VQ9S 4RW6A 3ONQA 5U47A 3S7RA 3A8EA 2R7RA 2FVSA 2CVEA 1S0VA 4LF9F 1FF2A 2CJKA 2DNZA 4DL0C 4NRTA 3IRXB 3ZZUA 4TLQA 4LSNB 5G0RB 4ZCKA 1VS3A 2BUNA 1V9OA 5GMKa 2DGSA 3M2RA 2KU7A 1X4BA 4WYWA 1R6YA 4FS1A 5DLGA 2MY7A 4RU2A 3CPWR 2NUUG 2FLNA 3V4MA 3R5DA 5L1LA 1IR0A 1LFWA 2CFXA 4NLYA 3W2WA 1KQSR 4PKDB 3T1YF 4OI6A 2XNRA 2NQPA 2JZ5A 4RW9B 2HZCA 4ECSA 1R8HA 4YDDB 2GFFA 2RQ4A 4NZ6A 1MROB 1OIAA 2DNNA 2HLTA 4FNHA 3NLCA 1YHQS 2J8AA 4ZS6A 4PQUA 1UVMA 3O44A 5AE2A 2IC3B 2QO3A 5AXLA 3CJ2A 3GR1A 1UVKA 4JI2F 4K50A 1S1VB 4LF5F 3CCVS 2OPSB 2CYYA 4KV8B 4MJKA 2GJ2A 1U7LA 3FEZA 2AP6A 2MYFA 2QIFA 4X84A 1I1GA 3SDEA 2EG1A 1KRPA 2VG6B 4BC7A 1X4GA 1R8PA 4EZ9A 2DJWA 4ZCLA 3OXGA 1A9NB 3DI6A 2ABYA 3W7BA 5IS2A 2Q3PA 2HHPA 2KXHA 3UNGC 1YRUA 2BANB 1TKTB 3N5BA 4J37A 1HBMA 2LXIA 2KFNA 2RS2A 5B0BA 4RNNA 2OLWA 3KK3A 2VA3A 1VQNS 4X4TA 5BJRA 1HYSA 2KM8B 3MECA 1LWFB 1NHVA 3I82A 4USIA 1TL3A 4NCGB 3H40A 2C2DA 2AGPA 2CPDA 1XBWA 3VF0B 2HYIB 1RT4B 3L95X 3NNAA 2MHNA 2HHVA 1TP7A 1YRXA 2MGZB 2MZTA 5KFRA 1FJEB 5M2PA 2LCWA 3Q22A 1P1TA 2WSEC 3P96A 3R5CA 3MEDB 3DXBA 4ZPTR 5CD4H 5GAHU 3PR4A 1NK4A 4TYAA 2CQ4A 4ED0A 3V6HA 3M9MB 2MXYA 2G0CA 3UCGA 1KVJA 4IQMA 2BDPA 4QR2A 4KO0A 4ZDNA 5A8WB 2MKIA 1G6BA 2CQDA 4QJVA 2ZBCA 1WELA 3CF5Q 3V6DA 2U1AA 1M0SA 2HHSA 2QE5A 1HI8A 4OZNA 3LGMA 3GIMA 4DR1F 2VQEF 2LQJA 1JLEA 4YP3A 3T5JA 1KQGB 4E98A 4PQUB 5IT0A 3DM2B 3I31A 4Q44A 1DJ0A 1TFYA 3KKFA 5EX3A 3D0IE 1GH8A 2PO4A 1K9MT 4JI7F 4KGMA 1QSLA 1SIWB 3LPYA 5MAOA 1JLGB 1N56A 2GNKA 3SMZA 1SKSA 3I0RB 2GW8A 1F60B 5J2QA 2M52A 4QYRA 4W92B 3ZZPA 3DLHA 4RW4B 1QJHA 4WFXA 1U47A 1SUQB 1Q4RA 3M9OB 2V9WA 5H9FJ 1UFLA 3F41A 2DHSA 2CPHA 3M1VA 4H4OA 3POTB 5CYMB 2J0WA 5LJ3Y 3RB6A 1U1RA 3EZ5A 4MIBA 2U2FA 4DR7F 2OPQB 1MSWD 5EWEA 2OP5A 1C4CA 1LW0B 1HBOA 1NHUA 3K8VA 1HNIA 4Y3CA 4DUZF 1XNRF 1K1SA 3BSAA 1DTQB 3VAJA 2AJ1A 3FVYA 3US5A 4MK7A 2UVWA 3OL7A 4A8YA 3PW4A 4X64F 2ZD1A 3AH6A 3IN5A 2QFJA 3OFEA 3G9CA 4QU6A 3N9UC 4MH8A 4C8MA 3W3SA 1HD1A 1LW2B 4OX6A 2DH9A 1R8BA 4OHVA 2ZH2A 3GMGA 1X4CA 1KC8T 2HVZA 2PI4A 2UVVA 1O51A 1GTHA 2W9CA 4DSKA 1ZTTA 2DNKA 1HR0F 1UEUA 3TW0A 1CQMA 4DL4A 2XMUA 3HMJG 2KDOA 3V6DB 4IFVB 4M5DA 3TUZC 3U02A 1AROP 4F4XA 2MPUA 3D1QA 3T5LA 1YRTA 2VC1A 4HI1A 4AE5A 2E9TA 3LUYA 5GAGU 2CJQA 3EGWB 1S77D 2PGCA 3KLEA 3QLHA 5IZHA 3CMAS 1JNZB 3D5MA 5J2MB 3D0GE 4PG7A 4B02A 3DHXA 4OL8A 3NP5A 3I55S 1IQTA 1S9GA 3CCUS 2GGPB 3LAKA 3NBPA 1T03B 1OSDA 1QM9A 4FNIA 3MM7A 2MB0B 3CC7S 1X5TA 1C1CA 2AF6A 3JSMB 4ECTA 3KLHA 4KHPF 1L3TA 3H5YA 3X3UA 4LIRA 4KAIA 3MAHA 2VB6A 5L1JA 5E3CA 1KVIA 1S99A 1TUVA 1GAOA 1FERA 2KRRA 4PWDA 2AW0A 3PR5B 2XMKA 5EX0A 1XC9A 4WU3A 1R7IA 4PXEA 4OLOA 3RZAA 2FHJD 2FHMA 2XHWA 3Q8SB 1RJJA 2ACYA 1HHTP 4AUKA 4V19J 3SFGA 4A8FA 4C8LA 2D1CA 2N4CA 3LWLA 2R7OA 4X66F 1LKZA 5KFIA 5DDOC 2A18A 3CCJS 1U1QA 5AE3A 5EWFA 1S1WA 3RRHA 1BQNB 2ZD1B 4WTYA 2VZ9A 2QMWA 2UU9F 1VQ5S 1NH8A 3HI9A 1CSJA 4YEAA 2YKNB 2AYGA 1WTBA 3T5HA 4K4ZA 1RDRA