4CO5A

Structure of pii signaling protein glnz from azospirillum brasilense in complex with tartrate
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
104
Chain Sequence
MKLVMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFGQTEIYRGAEYSVSFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords PII-LIKE PROTEIN PZ
publication title Structure and Thermodynamics of Effector Molecule Binding to the Nitrogen Signal Transduction Pii Protein Glnz from Azospirillum Brasilense.
pubmed doi rcsb
total genus 21
structure length 104
sequence length 108
ec nomenclature
pdb deposition date 2014-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4co5A00
3CE8A 2GW8A 1UMJA 2ZOMA 1NZAA 4C3KA 1OSCA 3GSDA 2ZFHA 4CO5A 1NH7A 1UKUA 2O67A 1V6HA 1VHFA 3DFEA 4RLEA 3TA2A 4OZNA 1HWUA 1UL3A 2GX8A 1P1LA 2NUHA 1V3SA 3MHYA 3X3UA 2XBPA 1V9OA 1GNKA 4YB6A 4USJC 5DRKA 4CNYA 2XZWA 3AHPA 4Y6IA 4CO0A 2XULA 3BZQA 4YB7A 4ZK7M 4AFFA 1UFLA 4E98A 2J9DA 2Z0GA 3T9ZA 2NUUG 2RD5C 5L9NA 2O66A 3L7PA 4USHA 3LF0A 3NCQA 5D4NA 5D4PA 4CO2A 2J9CA 2EG1A 3M05A 3NCPA 2J9EA 3AH6A 1H3DA 2GNKA 3AA8A 1NAQA 4IYQA 1QY7A 4OZLA 3O8WA 2JJ4D 2J9DE 4D3GA 1V3RA 3N5BA 4WK1A 3HLUA 2CZ4A 2V5HG 4RWWA 4USIA 4CNZA 2VD3A 4Y65A 3TA0A 4YB5A 5D4OA 2PIIA 4RWXA 5DS7A 4R25A 3TA1A 4D3HA 4CO1A 2DCLA 2NS1B 1XK8A 4NYOA 1Q1KA 4RX6A 1O5JA 3NCRA 2E66A 1O51A 4CO3A 3OPKA 1KR4A 5D4LA 4CO4A 3O5TB 1J2VA 1NH8A 2EG2A 2XG8A 3AA9A 1PILA 4OZJA 4WK3A 1VFJA 4C3LA 4NYPA 4C3MA
chains in the Genus database with same CATH superfamily
4ICLB 4O44A 1QJHA 1K9MT 4FXWA 2IAJA 4DF4A 1RHJB 5IC4B 4ZPVR 1XJWB 4CT9A 4KGMA 3U1NA 1U7LA 3TJ9A 2FVPA 4A8XA 5CZXA 1PIEA 4UOFA 3DRRA 3M8PB 3VQTA 2DY9A 1S1WB 1WEZA 2PA3A 3HHKA 1GNKA 2CQ2A 5HMYA 3OQ2A 3QT8A 4GMKA 2E5GA 1OY8A 2HNDA 3D3CJ 2AF6A 3BREA 5CA5A 1JLAB 2P6SA 3SV4A 2HZCA 3NGSA 3AJDA 1D1UA 4DSLA 1LWEB 2VG6A 5IFMA 4DBQA 2XMTA 5EN1A 4DR1J 5KFTA 3ILIA 5KFSA 4ZPAA 2C2KB 2RMLA 1DQ8A 1NO8A 3GYGA 4ETXA 3C15B 3ZZZA 2G4BA 3L7OA 1RHKB 2ERRA 2DHGA 1CC7A 4NXMJ 5DG8A 2AT1B 3PTWA 3NS5A 3M30B 2HNYB 3LP0B 5KAKA 2QV6A 2F8MA 2PFFB 2XGQA 3CSKA 3IBCB 5AJ3J 4OYBA 4YEAA 5ETLA 1K0VA 2YWHA 2WK4A 2N4CA 4ZHRA 1VQSA 1XTZA 2HVZA 3OTDA 4H4OB 3ZC4A 2EC0A 3LAMA 4LF7J 4ECZA 4C0HA 1NSAA 3BPDA 3QGGA 2VDHA 1EKSA 1T9VA 2FTRA 1FNOA 1X4GA 2VFTA 5KFRA 2M8HA 1A0OB 2IYIA 2BVZA 2HS3A 4DPOA 4DL5A 1PGZA 2M0GB 2IC3A 2XC9A 1HWJA 2P6TA 1I1GA 4GO7X 1K0TA 2XEXA 1WSVA 2DIUA 3V81B 4B3MF 1SV5A 1ZA1B 2ZBCA 5IM0A 4CH7A 5C25B 3KG4A 1AB8A 5C7PA 4FF3A 4LFCF 1MG7A 3KLFA 3K5OA 5U47A 2EK1A 4UQTA 1J27A 1V6HA 4QZVB 3TA2A 3C3LA 2ZZMA 1ZM4A 1LW2B 2QA1A 4QYZK 1MWZA 2C2ZB 2CQ3A 3IS9B 3RAXA 4L76A 4OFZA 4B9VA 1CULB 2H1YA 4WFNQ 2ABYA 4R8UB 5HQ8A 3DC2A 4YMEA 2EFPA 2ZHBA 1F6TA 3HVTB 5CD4A 1G7CB 4KH1B 3B82A 3JQJA 2VPYB 4F8RA 4DV2J 1HMVA 3MUVP 5ETRA 3NBPB 5HP1B 3TVZA 4EO6A 2C3MA 1RA6A 3N5BA 5HVFA 3CJKB 4GVBA 3J81j 2DHXA 3OSNA 1LXJA 2MJUA 3CT9A 2ZH5A 2GMLA 3DLHA 3CULA 3MM6B 3I56S 4CO4A 3TUIC 1HARA 3KHLA 2ATLA 1BHNA 2FVRA 1MROB 2IBKA 5D15A 3FZ2A 4DF8A 5D78A 4DX7A 2HFUA 4TU7A 3GWCA 1W25A 1Q53A 4KJIA 4DV7J 3IP0A 3G86A 1YJVA 3PW2A 5L38A 1AUSL 2KG0A 4NEZA 8AT1B 4QW9A 2ZWOA 3M8SA 2GVDA 3MMAB 2F4VF 1GMUA 2ZKTA 1NKCA 1FRIA 2HVHA 4LT6A 4DV0F 2GV1A 3IBFB 3M6XA 1GXUA 3FDSA 1N32J 1UJ6A 4TQRA 3HI9A 4OYXA 3D54A 5DG9A 1ZOTA 3B4DA 1MMDA 1RWVB 3I32A 1N5QA 3PYEA 2C28A 1NHKL 3IWNC 2WOMA 1FK9B 4JYAF 1I3OB 4CH0S 1QAYA 2WTFA 2APOA 4JI8J 1UEUA 2Q43A 3GFZA 3IG1B 4PXCA 5H9EK 1VRUA 4LMZA 1SL2A 1BY9A 3KK2A 4K2XA 4JV0A 4PWWA 1Q79A 2NXUA 1HNZF 5FDLA 3D6TB 4WXOA 2IFXA 4GC6A 5I3PA 4Q45A 3KK3B 4O23A 3AB2B 3BN7A 2QX0A 1SCJB 4ZK7M 3VQSA 4JI1J 4EYIB 5HAOA 3HKZD 2N4DA 4JUZA 2E5IA 1HNXJ 3RUBL 1AXQA 2HQCA 3KJVB 4WFXA 3PY8A 3M6UA 4AL6A 3AXKA 3G87A 4MYTA 1X5TA 3CDWA 3MECB 1TZ0A 1RAHB 3LGMA 2HG4A 4P71A 4ZPCA 2YX4A 2XSJA 3N79A 1IBMJ 5I4MA 3QJLA 2HHPA 1Y5NB 1HNVA 3SFGA 2C42A 3SFUA 4ELVA 1QTMA 1Q8BA 2C3OA 1REVA 4RU9A 2FZGB 3LQVA 2XGPA 1SUQB 3EGVA 4Z7YA 4QR0A 2BMBA 1JLQB 2DNRA 4A4JA 2F4FA 2RKIA 2Y0BB 2J6TA 4O0IA 5E3QA 1U1RA 3GIRA 4I2QB 3QRQA 4WCEQ 3IGNA 3LTOA 2OPQA 3THPA 4TY8B 1M5VC 3N6NA 1O8BA 3BKFA 4LQ3A 4F2RA 4BC9A 1T8EA 4OX8A 2A2CA 1NDPA 3DU5A 4NI2A 1F2GA 3SCJE 2OELA 4F67A 3O8WA 2VOOA 3AXMA 2XCAA 1YBAA 2GJFA 3ZZRA 1NK5A 2AYMA 3W60A 1WC6A 1CEZA 3M32A 3E8OA 2B4VA 5EHHA 3O6QA 9ATCB 4HR2A 1RTHA 1TVRB 4USUA 2C3UA 4CYUB 5D4LA 4CLYA 3TJAA 5L39A 2YY3A 1VC5A 1SIWB 2GVZB 2WVBA 4O3OA 2MLZA 1EIYB 4DQPA 1TAQA 4IG0A 4J9MA 1HYSB 2CIMA 2GHWA 3PRDA 3MCSA 1UVNA 1J5OA 4DL7A 4DSJA 1QUPA 4CLKA 2NSCA 4NLGA 4C8KA 1U24A 4YUDA 1Q7LB 2R8IA 2IM2A 3I5CA 2JEJA 1XNQJ 3PO5A 4I2PA 2G2YA 1CJTA 3D9BA 3MM9B 2UXDF 3GONA 3T1AA 1NB2A 2VJUA 4ZJLA 2V4JA 3QLHA 5K14B 3I55S 1ZYQA 3M05A 4DJBA 4DS4A 3SSSA 4ZP6A 3UN2A 3TUPA 4UQGA 3UVJB 3VF0B 2V2VA 3MM7B 1NKBA 4DG1A 2DYAA 4LBIA 2KB2A 1JLGA 1X4CA 5KG3A 1FT8A 4IRDA 5HMWA 3NKYA 2AX1A 2MPUA 2EXUA 1OQ3A 3DM2B 3IO1A 2YNFB 1VQ8S 3EGZA 5AE3A 3SBMA 2XS2A 4URGA 3UCZP 1RA7A 1EARA 3VR1A 2ACYA 4W92B 4FVMA 2XZDB 1GH8A 4KSEB 2KG1A 1TL7B 5GMKa 2DNGA 2QIFA 3MDFA 1TUWA 4LFBF 1M5KC 2HHHJ 4QJVA 4WWSA 2QEXS 2QFIA 4WIIA 3CD7A 1HA1A 3AODA 2YH1A 4U67Q 2LXIA 3GFHA 5HO4A 4CLZA 2ASDA 2KFNA 2IJRA 5HMXA 2HQDA 3PX6A 3H7HB 3S01A 4OX9J 1J5EJ 4PUOB 2P9EA 3QMQA 4RU2A 4IG3A 3S7RA 1NU4A 4XIUA 3DDNA 4WK1A 1BQMA 1R8PA 3H5XA 2HPUA 3NXZA 1YG0A 3TZXA 4YS2A 4ZOSA 3IAM9 2RS8A 2PIIA 2QMUB 4LRCA 4OYMA 1B4SA 3DU6A 1S10A 4FPRA 3UDVA 2MSSA 4RBVA 1PILA 3PYGA 3HF5A 4LRAA 3CIZA 4YN3B 2GW8A 4KC5A 1RU2A 4DV4F 4DN0A 2UUCF 5E3RA 1WF2A 2R7VA 2W4DA 4MK7A 2KFYA 1RJJA 1NDKA 2YWFA 5ETQA 2CPEA 2AEMA 2ROEA 4F04B 2FC9A 4DR7F 4PYAA 4U7UD 1JLAA 2FLNA 4USVA 2YTCA 3RG6A 3SMZA 2MYFA 2QG9B 5IT9Y 3H4DA 2J8SA 3KYLA 3K17A 2E5JA 1G1XA 4Q43A 4WP9A 3C8YA 2BJ7A 5JUMA 2OHDA 1X8DA 2BW7A 3IAS9 3C15A 1VQ7S 4WF9Q 2ILYA 3W8PA 1PYTA 4MH8A 5LXRA 2CQ1A 4IFVB 2MKSA 4ELTA 3M30A 2HNYA 3W1YC 3LP0A 3EM1A 1S6QB 3QPIA 3CJ4A 3M9OB 5D4OA 3QT6A 4DL3A 2UUTA 2LQ9A 4NYOA 2AHOB 3I87A 5DDPC 2CQGA 3PW0A 1N36F 1L3SA 1IJEB 4GRSA 4TNOA 4DWIA 1NK7A 5HMZA 2QA4S 3KK1A 2CJKA 5LSLA 3C6TB 2ZM6J 4HT5A 3HZEA 2J7UA 1R8AA 1YWXA 2EFNA 3OFHA 4U8YA 4ECTA 3OR2A 4HTIA 1AYEA 3A4TA 2RQKA 5I3QA 2CJAA 3NY0A 2CA9A 2Y1RI 1WOPA 4Q0BB 1EZZB 5IZHA 4DR4J 2VPWB 4Y6IA 4KHRA 1M1KT 3KKFA 4J9QA 2ATCB 4M94A 2V8DA 2V4RA 4JB8B 1FO1A 1Q78A 4ID5B 4ZLNA 4ES1A 5KG0A 4B3TJ 3AA8A 2R8GA 1S6PB 5C25A 2UZAA 3VGTA 2YWEA 3HLUA 2KXFA 4MJKA 3RRGA 4LR7A 4WU2A 4ED5A 2X1BA 2E7WA 4JI5J 3TA1A 2FJDB 4WBFA 4P9SA 1TL3B 2JHEA 2ADCA 5A8WA 4BS2A 3HHLC 4NA3A 1WKKA 3IS9A 3RBEA 2BZ2A 1KQGB 2E1AA 1CULA 1VQKS 3H2LA 4ED6A 2KHDA 2MHNA 2BJEA 4B9TA 2CPJA 5J1NA 3T1YF 4L72B 1N5VA 2B7BB 4I56A 2MQNA 2RT3A 5D8HB 4RJVA 5KFNA 4PG8A 4WTOB 5A2QY 3DYAB 1T7PA 2MGZB 1UVJA 3R2DJ 2CNKB 3FEYB 3CB4A 1CQNA 2GAGC 1NJYA 3BBFA 4DN9A 2DGVA 3WC2A 1XN9A 3FBCA 5HROB 1ZS6A 4IO9Q 2B8QA 3QJJA 3FVYA 1AFJA 1HIYA 1NJWA 1S9GA 3U7JA 4HI2A 2DB1A 2CUYA 4HVZA 1CBKA 5ETKA 1WG5A 2CRLA 2DNOA 3I96A 3RB3A 4XPCA 4B9UA 2Q1LA 3H0PA 1MROA 5KT2A 3BO3A 3QATA 2GQQA 4YY3F 1BXNA 4WZQA 1UPPA 1X5OA 1BE4A 3EZ5A 3CCSS 2Y8WA 4P10A 1WTFA 2Z57B 4M63A 1GMWA 3QWUA 3ZTOA 2XS7A 2P9GA 2A0FB 4DV6J 2R8JA 1PAUB 3ZNJ1 3BPSP 2KRBA 1CJVB 1VGYA 4JI6F 3DOLB 1S1XB 2NYHA 2XZWA 3QJPA 5IV3A 2GMJA 2ZNZA 4AFFA 4NE9C 3CF5Q 1TMJA 4NX9A 2YQ1A 3BGLA 1ITPA 2UUBJ 1F3VA 1S1VB 4UTGA 1HL6A 3U1MA 2DRAA 2AU0A 2FY8A 4CQ1A 1IVZA 1KOHA 4LRFA 3ILLA 2I1RA 1VIOA 1QAXA 3VVUA 2CDQA 2M7SA 2M52A 2H9ZA 1FK9A 2DRDA 4DU8A 4CNZA 1MLAA 5F8HA 2LQ8A 4OLOA 1ZAVA 1KKHA 3K2YA 2E66A 2P5VA 4HI1A 1QE1B 4NLRA 3NNCA 1YRTA 4M5JA 2C2RA 5K8PA 1UEKA 1NJIT 4X4PA 2U1AA 3KK3A 1RKIA 2PDAA 1JNZB 2VODA 1U1PA 3PX4A 3SI8A 2DNLA 3FEZA 3D0IE 2CXEA 1H7XA 3BQ1A 2LEPA 4J9NA 4XDDA 1H2UX 3BO2A 4ED2A 1G3OA 2VDIA 3H59A 1C0UB 3LUYA 2KN4A 3VCDA 1VRTB 3NGTA 2MY7A 1N33F 2J9DA 1FDBA 4I0WA 1FD2A 2IVFB 3JSYA 2NSBA 3SYZA 2ZVIA 3EDQB 3CCTA 3TW0A 4HTJA 2CQPA 3I0RB 2KU7A 2VUGA 2YKMB 3NMRA 1WOSA 3KJFB 3IWXA 2QT7A 3KLIA 2LDIA 2EC2A 4LSZB 3FBEA 1KEKA 2J6SA 4ECXA 3OTOF 1MW7A 2GGPA 2R9LA 1RCXB 2ZKUA 4IH5A 4RPFA 2I9SA 2B4OA 1FDAA 4K5RA 2LA6A 4X66F 4UUWA 3Q24A 3M8QB 3US5A 4DV5J 4URSA 4MKBA 2CQIA 2M70A 2Y9HA 4ZVHA 3DLJA 1N88A 3DOKA 4DU7A 3OFGA 2MQPA 1U1QA 5J2NB 1LFWA 3K7RA 4RO0A 2YKNA 3HJVA 4LFAF 2RU3A 1P1TA 3W9HA 2R7WA 3PW7A 2DCUB 1U1KA 2EK6A 3CCRS 4RUBA 4ID8A 3DDIA 1ELOA 1M5OC 2OSRA 1U1OA 3IM8A 2ZOGA 4K8RA 2XLIA 2MHEA 2KL8A 3VAMA 3AOCA 4X62J 3NAIA 3CPWR 1IBKJ 5CYMB 4N77A 2KJWA 1C0TB 3P45B 3PW4A 1K8AT 4KB7A 2OJ3A 1FKPA 2KHCA 3NCRA 3SCLE 1QAIA 3ELHA 2VFUA 1HYSA 1S4FA 1MMNA 2MY8A 4DR6J 3UO0A 3OVSA 3EVOA 1C2PA 3JTNA 4HH1A 1DARA 5CAAA 3MWBA 4O3SA 1QVGR 3PV8A 4DR3J 3MM5B 1SQEA 1F9FA 4ZVSB 2R4FA 3MM9A 2AJQA 4UY8T 1RDRA 2IJFA 2M9KA 2XBPA 1QAJA 5K14A 1NBEB 1S1TA 2YQ0A 4UOCA 3HSGA 3MAAB 4KTQA 1N4LA 4FF1A 2KH9A 2NUUG 1ZAXA 1D0EA 4NEYA 4X4OA 2KTQA 2FGCA 3HD1A 1SVDA 4ITSA 3PZPA 5A8RB 3GV7B 1H3DA 3UFCX 3OHAA 4DUZJ 2RHSB 4OZLA 1RUSA 3TR5A 2WZ1A 3G8SA 1RABB 3BDEA 4DSFA 5DDRC 3H5UA 4WP8A 3CJ3A 2GAHC 1P8GA 3LO3A 3GJTB 2CNOB 3FEXB 1T03B 1TL7A 1RE1B 3LANA 2EFOA 3EPIA 1CC8A 1F1BB 2MQQA 2H48B 5M2PA 2UXBJ 4I7FB 2IA6A 1FWKA 4K4ZA 2HAFA 5E33A 4N76A 5DQGA 1U0HB 2HWTA 5K8NA 3OL8A 1KTQA 1NSPA 1NK8A 2BXJA 3K8WA 1KVKA 3A3PB 2OSQA 1HW9A 1Z1ZA 1RK8A 2DITA 4OZ2A 4PQUB 3HVAA 1HBMB 4CLUA 3Q0AA 4DFKA 1YX2A 3DLGB 4FBTA 2HFOA 5EWEA 4ELUA 3I0SB 4Y28C 1X9SA 3Q8YA 2RAQA 8ATCB 2CFXA 3P3DA 1PJ6A 5G0RB 1RT4B 2ZBPA 1NRKA 1SQGA 1BQNB 2I6WA 4OHXA 2MKHA 5F0WA 2XWYA 3QRPA 3HZGA 2HGLA 1T9YA 4ILLA 1FNXH 1ZTWA 3JSRA 3ZTPA 1KBRA 5CYQA 2YNIB 3TUZC 3PEHA 2ROPA 4B3SJ 3VGUA 1GMWD 1NXIA 5E3PA 2E1CA 4WFYA 1VQYA 4I6YA 2FYXA 4DEZA 2M8DB 4TLRA 4Y3CA 4JI2J 4DX8H 2V34A 1DBDA 4K7QA 3Q2TC 2B5JA 3GSDA 1VQMS 2LMIA 2VJVA 2CVEA 3POTB 4MT1A 2W01A 5C5JA 3H8YA 2UUWA 3G8TA 3CTRA 1GAOA 1HQUA 3G96A 2FHKA 1R89A 2MQLA 1RAAB 3PDNA 3CJ0A 2BE2B 3PG9A 3K89A 2FD2A 1Y4ZB 2BBEA 3LWMA 2LCWA 4BWMA 2ZH8A 3H98A 3HVRA 2HFVA 4IQMA 3G82B 2GNKA 4QR2A 3T6BA 1IKWA 2BKNA 1YIJS 3ULHA 3BKTA 3SQOP 2E5LF 4J9SA 2QRRA 5I42B 4J37A 2BA9A 2FLPA 5DO2A 1RAEB 4PRFA 2OUGA 3M2VA 2J7WA 2HVEA 1APSA 5DS7A 4DS5A 1N6QB 3C6TA 1YVFA 2J0WA 4BWJA 2GHVC 3KNGA 2BUNA 4C9DA 1CJKA 4DOZA 4C6AA 2FJXA 1VJQA 1RZMA 4A8KA 4FYXB 1EETB 4Z2XA 4NOHA 3LGNA 1CJUA 4FBUA 2B9YA 2JNJA 2QGFB 3PEJA 2W2QP 2KYZA 3TX8A 4XK8C 3ETMA 1YQHA 1V3SA 1NK6A 3G71S 4P6QA 4LIRA 2V4QA 3OVAA 4GC7A 4ID5A 1OY6A 3IR5B 3JSMA 1D3WA 3DLKB 2UV8G 1XQIA 3QNWB 3BKUA 3NWGA 1HD1A 5AT1B 3D6FB 4CT8A 2DNHA 4C48A 3W5YA 1TUVA 1Y9OA 4PQAA 1D9DA 3TVYA 5HI7A 4KIAA 1TL3A 2KO1A 4JI4F 4KHPJ 4MKYA 2E1RA 2IRXA 1SL1A 1YJTA 4ED7A 2FIUA 2W9AA 1S6UA 4X64F 1KR4A 3CGIA 2MJNA 4LF1A 2VPZB 2CNNB 4WK3A 2XMAA 3OT9A 2OP5A 3BYPA 3FMWA 2HIQA 3S1TA 4LF4J 4I4BA 3N5FA 3QSIA 4GKJF 2PO4A 2Z2ZA 4RW4B 4ED8A 3RRHA 4Y00A 2I38A 4MFBB 5ADZA 2DTJA 2VH7A 5DGAA 1NSQA 2J7KA 1FKOB 3K57A 1Z4UA 4DL0C 3OV7A 1WOOA 1FKAF 4YFUA 1FXRA 3MR5A 2PE8A 3JQMA 2AYBA 1JLFA 1OWXA 3MM8B 4W98A 2VFVA 2X1FA 3DGPB 2ALYB 3VAFA 4OHZA 2MZ1A 2ZD1A 1LQ9A 4KGKA 2LEBA 2V9WA 3GLJA 1XMOF 3DGVA 4LBPA 3TA0A 4YB5A 4ANCA 2BDPA 1YLXA 2BQRA 2DGWA 2OEMA 5HSPA 2DVIA 5DZ7A 2VQFF 2PC6A 1RAJA 2EBEA 5CABA 3QFWA 1B70B 5E3AA 4O44B 3MMCA 1WACA 4CLSA 3RB6A 2AIRB 2ZOMA 4NLWA 3NMAA 3HD2A 1V5IB 1WI8A 4O4RA 2OTJS 6FD1A 5KOWA 2XHCA 3WZ0A 2W25A 3THTA 4C0OC 3D68A 2NQPA 1S1VA 3E51A 2V94A 2HNDB 1AROP 3MTJA 1HR0F 1H74A 2NXNA 3D1QA 2F40A 2V9KA 4N7TA 5B7WA 3EYZA 3L7PA 2VG6B 3GYXB 2QSFA 1D8ZA 3UD3P 5IT9U 1YI2S 2FVQA 2KT2A 4W4MA 3SCKE 3PW5A 1FWLA 5KFWA 1RI7A 2K7JA 2XZTB 2FB0A 2VD3A 2BW2A 1RYRA 1JKHB 2KXNB 4RWXA 1T9XA 2DNYA 4DPXA 1DQ9A 3P96A 2WW8A 5CH7B 4S0MA 4URQU 5A8KB 1KN6A 3ET6B 3CMAS 4FZVA 2E44A 1D9AA 3W66A 4GO5X 1VQOS 1DTQA 1FEHA 1T11A 1UWAA 4B3MJ 1OY9A 2L9WA 1B7FA 2YWKA 4RBTA 4RLEA 3R2CJ 1DLOB 2HW3A 2AD9A 3HPOA 4RNMA 2Z30B 3OL9A 3UE2A 3KLEB 3Q8QB 4X2BA 4LFCJ 3RW7A 1IN0A 4HHHA 2YBVA 5HJXA 3PHEA 4DX5A 1B3TA 5F8LA 2BJDA 3W8GA 3QWPA 4G65A 4OYWA 2FLLA 3D5MA 4J9PA 1T3NA 2RVJA 2Q6BA 2D7SA 1X0PA 3EVMA 2V5HG 2VKRA 3MCNA 1SV5B 5IM0B 1Y11A 3PIPQ 1TFWA 2R2RA 5KG5A 3LALA 4QU6A 2AYGA 3A12A 4LQ9A 5C24A 4J9LA 1FF2A 2FJEB 1UETA 4FYDA 4DV3F 4PWUA 4ECUA 3KJQB 4HL9A 3JTPA 4RW7A 3CD6S 4FKXA 3R6GB 3A3OB 4ECSA 4J9RA 1SI9A 3O3LA 2IVMA 2H5IB 3G6ES 3FSYA 3JXOA 3BM7A 5A76A 2B43A 2HURA 3ADAC 3JQKA 2Z0GA 5CYMA 1ULRA 4G1QB 4OYOA 2J9EA 1B7YB 1Q8LA 3LPYA 5KFCA 4RUAA 1A7GE 1VK3A 2CQDA 4GVBB 3UCUP 2RS2A 1WC0A 4E8UA 2A1BA 1NJXA 2RRNA 2F4VJ 1SKWA 3N4WA 2YX1A 3TAQA 2ZJPQ 4YDDB 3MM5A 2ZWPA 4DV0J 4NLVA 5I3UB 1SL0A 4IH7A 1I94F 2JEFA 4P74A 2KT3A 4F0KA 4NZ7A 3T19A 4O0NA 1TKTB 3MAAA 2XS5A 5IWAF 4OZNA 2VASA 4YOEA 3UDLA 2W4PA 3I82A 2JZ5A 2FVSA 4JYAJ 3BGFA 1F9EB 4C2MA 3V6HA 4CNYA 4NWBA 3I6PA 4GKKJ 4QIEA 3E2EA 2GVDB 3T9ZA 4USWA 3F41A 3PJWA 3VGVA 1U2CA 3CJ5A 3AH6A 2LDYA 3P8BB 1HNZJ 2B0GA 1YJNS 1S99A 1RTIA 5A6WA 1T95A 3KJNB 3ZZUA 2IMWP 5K8MA 3QBCA 4IOBA 2HQFA 3KUHA 1TQLA 2XO7A 4YB1P 1MN9A 1NDCA 3NS7B 2PMHA 4OHVA 3GV5B 4C8ZA 3T3FA 5F8IA 4DUTA 1VRUB 3RR7A 2WAQD 3KK2B 3PRBA 3FFIA 5DJBA 1JIHA 1GXTA 4MKAA 3I0SA 5FDLB 1WG1A 2VFSA 4Y2IA 3BQ0A 3L4BC 1YKWA 1PJ5A 2C3PA 4DPUA 4JI1F 4DLGA 4U8VA 4KFBA 1FI4A 2QLJB 3CCVS 1HNXF 4CO2A 4ZCIA 5K5MA 2QJ3A 5D3GA 2XM3A 5KG6A 3WIVA 4KO0B 1VIXA 1NPRA 2VBWA 4LF5F 3UDCA 2XSJB 4TN2A 2E9ZA 5KFUA 1U45A 4J9OA 1M1HA 4NLUA 1KVIA 5GADI 6AT1B 5GAHI 1HNVB 1XK8A 3UW1A 4KPYA 3P49B 1WHYA 3RAMA 1OIAA 4DX6A 2V2KA 2FHJA 1REVB 1I6JA 4NZ0A 2OPPB 2VC1A 3RU0A 1Q7YT 2XHWA 2GHPA 1H7WA 1ZBTA 2VBXA 3TO8A 2JDJA 3ICLA 4FS1A 1UTAA 2P8IA 2W9BA 2CZ9A 3BDPA 1KQSR 4FXVA 3CDAA 3FBFA 3SXLA 2JC1A 2EI5A 3R97A 1YITS 4IDKB 4B02A 3OTBA 2ZBIA 2Q6CA 1RBAA 1M5SA 2HAIA 5I42A 4NI2B 2AX0A 2BJ8A 4USHA 3NG8A 2DNNA 3R5AA 5F8NA 1N5TA 1A6LA 4YP3A 3OL7A 2R7RA 5KFFA 4WU3A 2UXDJ 3W62A 5KT3A 5SZTA 4OZ5A 1R0CB 1RQ0A 2B7CB 3A3NB 4TU9A 2DT9A 1Y10A 4A8SA 4USMA 3MPUB 4YHHF 4M5MA 5GAGI 1VOMA 3GCWP 3I4HX 3M8RA 4KT0C 4IG0B 4LUBA 2AWZA 1U1LA 4FP9A 3OJSA 3C14A 3GE9A 4LRBA 1J5OB 4H4KC 5B0EA 3CO0P 3AFGA 3L7UA 3ONQA 4O3PA 3UN5A 3A8KA 4I2PB 4ECQA 2H4YB 3A8JA 3FMBA 3PFEA 4N5SA 4LVNP 2XULA 3MF5A 3SEOA 1WEXA 5C42B 4IOAQ 2V4JB 3QLHB 1KTVA 3GIIA 2CWKA 1M90T 4EMDA 1RT2A 2DR9A 1TK0A 4LFBJ 1KLMB 2JEIA 2UU9J 4PG6A 4DG1B 2YX7A 4BBYA 4NLOA 1JLGB 2FZKB 3AQOA 1VDHA 5BR8F 2X7IA 1Q0NA 2OH2A 2CPDA 2RUGA 4GVLA 2JVOA 1F60B 2DHHA 2AYEA 3ENWA 4ED0A 3FCVA 3CJTA 2F8EX 2JX2A 2M4MA 1ZZNA 1OSDA 4HHJA 4QYRA 4MFBA 4F50A 4KE5A 4DSKA 1ZAWA 1TKZA 1FKOA 1OQ6A 2I8EA 1RLDA 2ZH4A 1VCTA 4F3QA 4U95A 4WTYA 2WSEC 3BYRA 4OMFG 3TX0A 1EB0A 3CJQA 1JQGA 3H2UB 1BWEA 2PN6A 3PNIA 1WEYA 4DV4J 2C2EA 2F5GA 2UUCJ 1UJ4A 3KUEA 4B9NA 2CVIA 4DR7J 2W8LA 5H9FJ 2F9JA 4KR0B 3U1LA 1HBOB 2XCPA 1HQEA 2OPRA 1NZ8A 1F5BA 4IG3B 2K2PA 2HHSA 2J9DE 1BQMB 3C66A 4I67A 1TKXB 5EGYA 2D9PA 1XWLA 2ZZNA 4BCAA 2GC8A 2DIVA 2WCXA 4RX6A 2HRUA 3ILOA 4UT4A 5HLFA 1NSKL 4DR5F 2EVZA 5FIIA 2X3DA 3HK2A 5EWFA 4EI2A 1RADB 3CJSA 1UPMB 2B4PA 3AY0A 2LXFA 2X1AA 4P73A 1JXEA 1R0AB 2JVRA 2F65A 3QGHA 3BSAA 2B9XA 4PXEA 3R7SB 1N36J 3RBDA 2BM1A 5LL6d 1ZPWX 4E2FB 4ZCLA 5F9NA 3WHIA 4A47A 4USJC 3VAHA 2KZZA 2D74B 2OGUA 4X4QA 1FJGF 4QQBA 2YNHA 3N6MA 1TAUA 4ECVA 1YK9A 4PG4A 4F0MA 2VG5A 4FS2A 2O1PA 2KVQE 4MIWA 4C7QA 2MKKA 1JKHA 2QMWA 3N6LA 3J81Y 1TV6A 5A8KA 3W7BA 2SXLA 3ET6A 3I9V9 4L73A 5EWGA 7FDRA 1VR6A 1SJ1A 5F3ZA 2R7UA 2NREA 2XG8A 4LJMA 1LK5A 4NCBA 1DLOA 4A46A 4F02A 2B9WA 3KK1B 3KLEA 5CCMA 3ITHA 5CZVA 3T41A 1TKDA 3OR2B 3RJMB 4EU0A 1L3UA 4ZVRB 3Q22A 3MPDA 4P2XA 3A8EA 5D0GA 2G9OA 1DY3A 2XY7A 2H3EB 1SJQA 4OX7A 4QOTA 2B4UA 3VAJA 4L75A 1GFWB 1CSJA 5HJYA 4NLTA 3C19A 2IY5B 2BACA 2V50A 1UFWA 1S59A 3NNAA 1HPZA 4AE5A 1QLNA 2MSTA 1MN7A 3T1YJ 3BQ2A 4FPIA 1Q5YA 3NWRA 1NDLA 1X9MA 1KD1T 3THVA 1FA0A 2FHJD 2H65B 5GVQA 3QYYA 2AJ2A 4EEYA 5FJ4A 4K59A 5L1LA 2KVIA 4USTA 1FFWB 1S9EB 5HANA 3D28A 2BANA 2CPXA 3OPKA 3MPWA 5A8WB 5A6PA 2MQMA 3O5TB 4NXNF 1WELA 5KTQA 2R2TA 4NYPA 1H72C 1RWWB 4LREA 3OFEA 4CWBA 4X84A 2ZDOA 3VZHA 4ES3A 3GIJA 4EYHB 2GX8A 4MKVA 4YY3J 1RWPB 3QGPA 4W90B 1M0SA 1HHTP 2DPIA 2CADA 4G1QA 2VBZA 1R31A 4J91A 2YNGB 3OUYA 1OPIA 1WHVA 2R2UA 2V69A 3TAMA 2BJ9A 4OI3A 3KG1A 2XTJP 3HT0A 3GTYX 2HFSA 2HBRB 3AJ1A 1HBUA 2IM3A 2P9CA 4JI6J 3UI3A 1S9GB 2HQIA 3M4XA 2R7TA 3W61A 2F8HA 4I64A 3LA0A 4Y34A 2Q66A 3GR0A 4ZLPA 1SKSA 5I3UA 1X4FA 2LQBA 1QSSA 2BKOA 2D3UA 3P4UB 3R1HA 4G1PA 1TKTA 4M5KA 2OFHX 1SPBP 2QLBB 3MR3A 2QLXA 1N56A 3DXBA 3ISND 2DR8A 3GJQB 4ZP9A 3ZZYA 1PO6A 3BB5A 1FRKA 2G0IA 2HVDA 2HHWA 3RB4A 3KNAA 2VV5A 3E01A 3H4BA 4F26A 4DSEA 3I5BA 1RTZA 2HK3A 1S57A 4DPTA 1U09A 5E3CA 2V8VA 3EMTA 2YQ3A 1HI8A 4N8NA 3DRSB 3PO4A 1VJWA 4ILRA 1JLCB 4LF6F 2O3DA 1Q16B 1RT7A 4DR2F 3CCMS 3FK4A 1JLEB 3GG1A 3KLVA 4M8LA 3J7YI 1WJ9A 5F3TA 3W9JA 3V4IA 1N33J 4ZP8A 5J2PA 1RAIB 4YR2A 1S0VA 1GK8A 4TVAB 1HKAA 1XERA 3ETOA 1NNDA 5D0RA 4O3NA 1ZM9A 2BOAA 1RT6A 2JC0A 4O3QA 1XNRF 1TR0A 3R5DA 3CE8A 5MLCV 3M2RB 3R5GA 1OSCA 3OTOJ 3BN4A 1PKUA 4H4MA 4OYPA 2JLFA 2NPFA 2MXYA 2FUG9 4HYKA 4O4GB 2EKYA 2CJQA 4QWEA 4X66J 1FNMA 2W1BA 4J9VA 1X9WA 4ZJOA 2QA2A 1JXVA 4KO0A 3BZQA 4YB7A 2ACMA 3H2VE 2VFRA 2CPHA 1LWFA 1XR7A 4RUHA 4B3OB 3W2WA 3K58A 1C1BA 1U2RA 2G2OA 2V0NA 3J7Z5 2OAUA 2DGSA 2MKCA 3U02A 1RTDA 1JX4A 1VQLS 3KLIB 4LFAJ 3D1OA 2HLTA 2OPPA 3TI0A 2VOPA 5IT0A 4WP3A 1DRZA 4EFAC 2GGPB 1WORA 2D3ZA 3DMJB 2BQUA 1H38A 2G1DA 1R27B 2VF3A 4MTPA 2IDEA 3JYTA 3HM9A 1IR2A 1Q81T 1VFJA 2DY1A 3HXMA 4LR8A 1B0VA 1N34J 1LWXA 3M6WA 2ZH7A 4RW8B 4IDKA 3EPGA 3HHLB 3DOKB 3VV2B 1CPZA 2XB2D 1RSCA 1FERA 3RR8A 4N47A 2PA8D 2O01C 1IBLF 1HWIA 3U27A 4QYZJ 2YKNB 1SB6A 3KLGB 4K50A 3QIPB 4DV1F 2W4CA 2B51A 3J7AN 3AD9C 2ZE2A 1QSYA 3MFIA 4P72A 3H5YA 4IO1A 4ZIWA 1EQMA 1FESA 2RUSA 3E3XA 1UFKA 3UQSA 1IBKF 2C3YA 5CQGA 4A8FA 3G8QA 2B6AA 1GX5A 5LMUF 2KZMA 4USIA 1FKPB 3N28A 4KBIA 2YWWA 2V2ZA 1R8BA 3ZNUA 2WHOA 2IBOA 2W2NP 1F0XA 3T1HF 3FJ2A 4DLEA 4DR6F 3IXQA 3PX0A 4Y0FA 2HHTA 2KM8C 1JWWA 3CNQP 2EFVA 2E1MC 1DURA 4IRCA 3NGUA 5CYJA 1FRHA 2V68A 1WF0A 3DFEA 5JMNA 2LQ5A 1BC6A 8RUCA 5BYRA 4DQSA 2W7OA 5C42A 5DQHA 1S1TB 1PC4A 1YRXA 3MOZA 1KLMA 4DQQA 3O1LA 2HMIA 1UFLA 4J9UE 2YPZA 2UVUA 1NEEA 3CCUS 3LF0A 1WKLA 3CJ2A 5K8OA 1Q82T 4WFZA 2HGMA 1RU1A 3TZYA 1WF1A 1MMLA 2MDAA 4J7CA 2UUAF 4LVOP 2Z4PA 2HZAA 4NMLA 1UZHA 1VI7A 3HJFA 4ZJQA 1M5HA 3HDSA 2JSXA 3DRXA 2VQEF 1FJCA 5F41A 3CJ8A 1RT3A 2DXFA 2F1FA 2DNKA 3HSJA 1S48A 1W26A 2A18A 2RRBA 3AOBA 4F4XA 3PHTA 5SUHA 3ISZA 3ZTRA 1KFDA 4U7CA 4PEOA 2BX6A 5H9EJ 3N9UC 3MHYA 1JJHA 4DFMA 3LP1A 1KHVA 5L46A 4TU8A 1HBOA 2H5JB 2UVVA 2AMCB 4ILMA 3WX4A 1Q95G 3IWLA 1TKXA 3HFVA 2R2SA 3QGIA 2HNZA 1ZM2A 3HHEA 4USKA 3AQPA 5LJ3Y 2Y0SD 1HBNB 1ICEB 4XDCA 1NK9A 5IS2A 4K4YA 4JV1A 4NLSA 3IRXA 1FE4A 2BE9B 5CYQB 1B0PA 5B09A 3Q8UA 5F9LA 3GP9A 2IRUA 4QWBA 1R6YA 2ASJA 1S4EA 4ZPWR 4C8YA 1R0AA 4DQRA 1VMBA 3HX9A 5KFAA 2F9DA 1VLYA 3O44A 2B5JB 3BBCA 2DD8S 4C3KA 1KS2A 3CDUA 3ILJA 2ZJQQ 1HQUB 1HNIB 3C46A 4U6PA 3B78A 2J0QD 1IKYB 4C8LA 3CD0A 2ZH6A 4ZVEA 3AD8C 3G6YA 5KT6A 1LW0B 1N5YA 1T05B 3M1VA 2C2OB 1SC3B 2DH7A 3HO1A 4B08A 2JH3A 1WC4A 1RYSA 3MEGB 3BSCA 4ZCMA 4JI3F 1IKWB 2HHXA 4OV6A 1KVJA 1S5ZA 3CCLS 1CQMA 2AZ3A 5D0EA 1KLNA 3M2VB 2W2PP 3Q8VA 4KAIA 3PIOQ 5J2QB 2NZCA 5GMEA 4D3HA 1H2VZ 3CDBA 4DL2A 1CJKB 2HFZA 2RDJA 2J0SD 2EG2A 1ZM3A 1CJUB 4K2JA 4NLXA 4EBDA 4JI4J 2UVRA 3M9NB 5K9FA 3A8IA 2RU9A 4IUFA 1NH7A 1N48A 3W5XA 1IWAA 2MZRA 4NCAA 4ECRA 4X64J 4G6VB 3B4MA 3KHGA 4KY3A 3BF4A 4WYLA 4C11A 7FD1A 1VYAA 4RNFA 3JSMB 1FVQA 4FYWB 3MR7A 2XQCA 4XTTA 4GKJJ 2UXCF 2E5HA 3X1LB 2Y1LB 2W9CA 3LPEA 1RHMB 1QVFR 1JJ2R 5HBMB 4M5GA 1S9EA 2JJ4D 1RXOB 4ECYA 1U6ZA 2XY6A 3HULA 4JI7F 2QTWA 2PEHA 2JRSA 2G2ZA 2RF2B 3N01A 3GV8B 1SC4B 1FX2A 3MCOA 4RNOA 3FC9A 2OMOA 3AT1B 5KOXA 3MMJA 3HMJG 1DJ0A 4C8OA 3QT7A 3ZTQA 2OO4A 4LR9A 1GTHA 3VTIA 1PAEX 2DJWA 2AEJA 4LF9F 4AYBD 3HFKA 3HVWA 4ZMMA 3T9NA 3W65A 1IXKA 2YNGA 2VQFJ 3NOCA 3ZZ0A 3LGHA 3T5LA 5DGBA 1WI6A 2LEAA 1VBKA 2CNLB 2YWGA 1JLFB 1SH2A 2K06A 1T0TV 3MR6A 2M3DA 3KDOA 3TAPA 2FVCA 2ZH2A 3NCPA 3FBBA 3TYTA 2ZD1B 5DM6Q 1X5PA 5F8GA 1HR0J 2HHUA 2LQJA 3EZOA 1ZA2B 5GMDA 3VAGA 4WKYA 4ZN3A 5AE1A 2DNQA 5IXUA 2N7YA 5JXSA 2RE1A 1VLOA 3RAQA 4QBUA 4CTAB 2AGQA 3MMCB 3D6HB 2C1EB 2NXCA 4JI0F 3SSQA 4MIBA 3DRYA 3AAWB 2QO3A 3GQCA 2ZUGA 1KC8T 2GFFA 1I5OB 4AT1B 2ZC3A 4RBUA 3BS9A 5HQMA 2QMXA 2BQ3A 4Q5VA 4K5SA 5MAOA 2RDDA 3DI6B 1W2IA 2RNEA 3OR1A 4IFYA 2NPIA 1N52B 3DRSA 5J2MA 5EDWA 1JLCA 3VZIA 3L95X 4OV1A 3HFZB 1NHVA 1X4BA 2DGTA 1IKXA 1JLEA 1HHQA 2COLA 1UWBA 2FJVA 4C0BA 3RBZA 3VALA 1HWKA 4OQJA 4D3GA 2D3O1 4ZCKA 4TYBA 1RB0A 3UPFA 2I0XA 1UJ5A 1GX6A 5BJRA 3SQGA 2V6AA 3M2RA 4YDXA 1H2TZ 2CJXB 1EQ0A 2D9OA 1H0HB 3J81U 2H4WB 1EKRA 2OPSA 4EBCA 4O4GA 2ZEJA 2D3OR 1DTQB 5T41A 1ZPVA 1VRQC 4WFBQ 2ZFHA 1XEZA 5T7LA 1HNWF 4R0EA 3CCWA 3A1YG 5GADU 1VQPS 3I31A 1R8HA 4R0JA 1NHUA 5GAHU 1U4BA 1SKRA 1X7VA 1R6VA 2HBZB 2ZBRA 2RJZA 1CS4B 3MR2A 4B3OA 4RW9B 3UD4P 1T02A 2KI2A 4YB6A 4DV3J 1QDUB 2ZDPA 2GO9A 5AXNA 1LXNA 1F2HA 5LOQA 3O2IA 2RQ4A 3MEEA 2FHOB 5KFHA 2XNQA 2D69A 5ETPA 4CZCA 2PSZA 4U7UK 3DMJA 4EZ6A 3GPAA 1S79A 2CZVC 1E6VA 1QSLA 1SC1B 4C97A 1PC5A 4U96A 3R8YA 1DZ5A 2VG7A 4EGLA 2R8HA 1U26A 1C4CA 1Q4RA 1P6TA 1O5JA 2HBYB 5DETA 4KHMA 5C24B 5KFLA 4RW8A 4WYWA 2Z2MA 3HHLA 4RNHA 3AA9A 2VZ9A 2V8HA 4JV5F 2V2QA 1GT8A 3B54A 1YJUA 3TRGA 1SJ3P 4RW7B 1Y5LB 1PG5B 2CWXA 3KLGA 2XMWA 3F73A 1Y0HA 1FFSB 3QIPA 3KLHB 3OTEA 4M5HA 3DLBA 1FRMA 3SV3A 1Q8KA 4LBHA 5G4DA 1YHQS 2W2OP 1MU2B 5GAGU 4IR9A 5RUBA 3J7A1 1IQTA 3C16A 2FGOA 1I94J 3KG0A 4ALZA 1AZSA 1TL5A 1BD6A 2PMWA 4E0DA 3KWMA 5IWAJ 4X4RA 2DNZA 1FDNA 1YSJA 1N8RT 3NCQA 1NCLA 1YDLA 4FF4A 3PJXA 5LMNF 1XMQF 3OJUA 2UV8A 2WONA 1Q5VA 4HACB 4RWWA 1UVKA 2MLXA 3EJMA 4KGZB 2PD1A 4C98A 2GIQA 1S1UB 5LT5A 4ZVTB 4DZDA 1UVIA 3VHQA 3EXCX 5HL7Q 2GZOA 1VQNS 4C3LA 3FZBA 2WBMA 3SDEA 1U8SA 3FCHA 2KFZA 2QLWA 3CO9A 3CCJS 1CLFA 2LECA 3LAKA 2L41A 3MURP 4B3RJ 2KYXA 2RIJA 5J1PA 3ENVA 4OYAA 1RWUA 1W7WA 4F25A 1JXLA 1U02A 4Q7AA 3FQLA 2DNPA 3W3SA 2G0JA 3CIMA 4GKKF 3PFOA 4F7VA 4KGXB 2C2DA 2AEFA 1K1QA 1RT1A 2IIHA 1V3ZA 1PSDA 4FNIA 3Q86A 1YZ6A 2LFVA 4CCHA 2CDRB 3CWJA 4J5OA 1RTIB 5ETNA 1RAOA 3G2XA 3G6XA 2VONA 1YZ7A 1T94A 2LXUA 1MWQA 3GSIA 1OO0B 2AV5A 1BWVA 1JMTA 3T6JA 2ZITA 3PCOB 4NLPA 4F4ZA 2B3TB 4QWAA 1HW8A 1S76D 5ETTA 4LF5J 4WE1A 2HGNA 3LWLA 2NYIA 2H5EA 4M1KA 1UCNA 3M8YA 2E7XA 2WB1D 2BRKA 3D0GE 3FFIB 2AGOA 2MLYA 1GXLA 1RWNB 3WDOA 4ZLJA 1TK5A 2IA0A 4RZRA 4ECWA 3QZ7A 1T9WA 5IQQA 1HBNA 3NGRA 2HHVA 5EX0A 2DHAA 5IOLA 4KFBB 5K20B 4ZVOB 4A8MP 3IGVA 5DQIA 2WBRA 4AQYF 2R42A 1BLUA 4M5DA 2RD5C 3RGIA 2WVDA 3RB0A 2C2NA 3EUNA 5D3GB 2J9CA 2EFQA 1BQXA 1Z2LA 2J0XA 1TL1A 4CH1A 2MTLA 4PPZA 2QYGA 4G1IA 2LA4A 2IDLA 4YQWA 3SSRA 3HHDA 3DRPB 3W2VB 3PR5B 4QR1A 1Y3JA 2Z58B 3NGKA 3IM9A 3EICA 3J80Y 3RW6A 4K4VA 4QCLA 5KFIA 3WBZA 1KWMA 2WRMA 2H51B 2CG4A 1HNIA 1UW9A 4I1TA 2IHR1 1IKYA 4PCQA 3FRZA 3T5JA 2XLKA 1LW0A 5L1KA 1T05A 5EX3A 4YHHJ 2W9BB 3FUYA 5B0GA 5D77A 4IKAA 1HWLA 3MEGA 5E7OB 4Y2MA 3IR7B 2EW9A 1UAWA 3R6LB 4OI0A 4KPCA 2ZZTA 3UDEA 2XYGB 1GQEA 2HVIA 2CQ4A 1HI0P 3BGRB 1U49A 5D4PA 2ZJRQ 2AGPA 2J5AA 1X60A 4ETZA 5J2QA 4J9KA 1RWXB 1LWCA 4ATNA 4A8QA 3DDKA 4ZITA 3QT5A 5HATA 2MZJA 3MD1A 4JBCA 1URNA 2LP4A 3P5BP 2FQQB 1P9QC 4QPXA 4FDFA 4RW6B 1F5CA 2YVSA 4R25A 3D7SB 3PR4A 1WKJA 4K0KF 3RZAA 3MCMA 2V8PA 1W2BR 3BSNA 2OLWA 3V2UC 2MEWA 4EK2A 5BR8J 1KOOA 3FRYA 1YTYA 2GJIA 3C14B 3UN3A 2WW4A 2I5JB 1H73A 1HHSA 1SIZA 1U1MA 2O67A 4OYZA 1MNEA 1YJRA 3R5CA 3CCZA 5A0YA 5J1EA 5KFBA 4WPAA 5HBMA 1K1SA 7AT1B 4LF8F 3W9IA 1HFEL 1DHMA 1REGX 1RT2B 4OLPA 5KG1A 4X65F 3PXGa 4F3OA 2HRTA 2A2DA 3H20A 4KV8A 1YJ7A 3NOGA 2RF2A 5KFOA 5F0UA 2VBYA 4DPYA 5B0BA 2UU9F 2AJ0A 5KFQA 2JLEA 3JAMU 3NGDA 4CLPA 5E41A 3HHLD 4J90A 2DEJA 1JJCB 4ED1A 2YKQA 4NCGB 4NLDA 1IKVA 4QW8A 2NS1B 2IRYA 4HH0A 4CO3A 1SJFA 3R5BA 4LSLB 2L9NA 2W8KA 5CD4H 2Y1JA 1EJ7L 2LU1A 1O0PA 5M2RA 5KFZA 1TKZB 3OFFA 1RT5A 4ICLA 4CLTA 4NASA 4ZVGA 2DGUA 1A9NB 2EKNA 3QO9B 2QSWA 2MMYA 3UNYA 4DR5J 3M8PA 1S1WA 2A6MA 3C2PA 1IWGA 1DTTB 2AJ1A 2DGQA 3GR1A 4CM0A 3AHPA 9RUBA 5KG4A 3GJSB 1MSWD 5FLXU 2K1RB 3GYNA 3CCQS 2E9RX 2JFDA 3TEGA 4ER8A 3EXYA 4DSIA 2EG1A 1HQEB 2OPRB 3R27A 4PWDB 2ILZA 1LWEA 3ENQA 3F56A 3IBWA 1IM6A 4X4VA 2KRRA 3TZZA 1KNZA 3ZZTA 2E9TA 4DUYF 2HFNA 4KRWA 1TFYA 1FJGJ 4CTAA 2BOPA 3IFEA 2L48A 4MAKA 1KP6A 2E1PA 2LYVA 2DCLA 2DR5A 5HLFB 3MZIA 4NRUA 3OW2R 1T9UA 4V1Ak 1RWOB 2RB7A 5B0CA 3RBXA 2W2MP 3DI6A 2C22A 3K5MA 3WQPA 1NK4A 1XC9A 3J7YU 2DISA 1D09B 3EX7B 4CO5A 3W64A 4JOUA 3EE3A 3GILA 5HVGA 3H90A 1L5UA 5IC6B 5GAEI 4TY9A 1R43A 3X3UA 4NMXA 2NZ4A 4H4OA 3BR8A 4OHYA 3BSOA 4B9SA 4DR1F 1X4EA 2YNHB 2F63A 5THWA 2DH8A 2VG5B 2PMZD 1L3KA 4NXMF 2KJVA 4TKTA 2EBGA 3NS6A 1D9FA 1D8YA 5EUHA 4TYAA 3AB4B 1TV6B 3VAKA 1FD8A 1XMBA 4NYZA 1JNRB 3LW5C 3JTOA 2CQHA 1TU0B 4Y65A 5AJ3F 3D6MB 2UVWA 1K47A 2K7KA 2ZNYA 3V81A 2FY1A 5KFGA 4OHWA 1AUDA 3HSDA 3K0JA 5HK4A 2YKOA 4NLQA 4OZJA 4LF7F 3ZZPA 3PVXA 2RHQB 3ITHB 2NCKL 1CS4A 4RW9A 5KFKA 4V19X 1PYOB 4M5LA 2AJ4A 5DZ6A 5ETMA 2VA2A 5L1IA 1F3FA 1B99A 4R5PB 2ZVSA 3BR9A 4NXNJ 1LW2A 2FPHX 3UR0A 1T9TA 3GB0A 3FNNA 4KYZA 2Z56B 2M2BA 4K4WA 5M2UA 4R8UA 2VU5A 1ROFA 2RQCA 5L9NA 3HVTA 1KQKA 1HPZB 5KFVA 5DDQC 3CCES 1QY7A 1R0BG 2QZ8A 3NBPA 5HP1A 2ASLA 2F3JA 2QLFB 4ZP7A 1VHIA 3CJKA 2PI5A 4ZIVA 2CG8A 2GQ2A 3KXDA 4QU7A 1KHWA 2BANB 5KFPA 1EP4B 1DAXA 2KDOA 2NR0A 3QFHA 3CVKA 4Y2CA 3BBBA 3KLHA 1OPZA 4ZPBA 3MM6A 1PJ7A 4TQSA 1RTJB 2XYHB 1MU2A 2RILA 1IM4A 4UZBA 3NRBA 2HWHA 5LM7E 4HKQA 4ZN1A 1FE0A 1NJZA 4L74A 1NB7A 2Z2LA 4IOCQ 1VC6A 1C4AA 3S8SA 2J6UA 2BABA 3UNGC 3AD7C 3NNHA 4OJ1A 1GEHA 3IC1A 4M5NA 5E2QA 4DV2F 2V67A 1Q8IA 1QTNB 2Y8YA 2CYYA 3OUYB 4A48A 2OMLA 2MKJA 3TARA 2J8AA 3TAMB 2DO0A 3MMAA 4HACA 4BC7A 1HBUB 1U2FA 4PKDB 2GJ2A 2ZH3A 2HSEB 4Q8FA 1S1UA 1V3RA 2IYGA 1UP1A 4PAAA 2GS8A 4NZ6A 3TVKA 4ZLLA 5DDOC 1G2EA 3OXLA 4LF6J 4PYDA 3Q8PB 4DR2J 1H6KX 4DV7F 4F4AA 3QZ8A 2HQGA 2IJNA 4QWCA 4RUCA 2X3GA 3TOQA 2N3OA 3CUNA 3GMGA 2BRLA 1UVLA 1FFGB 3IG1A 2R7OA 2VKZG 2W24A 2QL5B 4WFAQ 3E01B 3UD5A 5AXMA 1P27B 3RYLA 1XNRJ 1RBLA 3M2UB 4P2MA 3FGVA 3R3TA 2HKEA 3Q89A 3CXCR 1N32F 4L3KA 2C2MB 1G6BA 4AXIA 1C1CB 3D67A 1WC3A 2Q3PA 5KT7A 3IA0A 2RDIA 1RT7B 2L08A 1IJFB 3KJVA 1S72S 2V63A 1CVJA 4ZVQB 3VGSA 5D6GA 5CXTA 3V4IB 3IRWP 2DR7A 1S49A 4QIVA 2BJ3A 2CZ4A 3MECA 5J2PB 1V5VA 2L3MA 2QN6B 4JI8F 4P2SA 1Y00A 2ZBQA 1LEOA 1RT6B 4I69A 4FNHA 4F3MA 1NMEB 3UCGA 3PKYA 1U1NA 4N8OA 1VQ5S 2RRAA 4M5IA 1H98A 3MI7X 4XAKA 4PG7A 1UMJA 2CQ0A 1SUQA 4H4MB 1RAGB 1UKUA 4OYIA 5ETOA 1JLQA 4F4YA 3BGUA 3F44A 1U25A 4I2QA 3KMQA 5KFXA 2LKZA 2CPFA 3D0HE 3OL6A 1LV5A 4TY8A 1ZETA 5DLGA 3OVBA 4DDFA 4OL8A 1LWFB 3KHHA 2WB4A 1JK9B 4ES2A 3D1HA 3W2WB 1IBMF 1C1BB 3DRPA 3W2VA 2BKPA 1IBLJ 1RTDB 1U0SA 4HHUA 2WSCC 5F8JA 3QIDA 4DV1J 4UUXA 4IRKA 3CJRA 3K5LA 2E29A 3MD3A 3DLEB 3V6DB 3D4JA 1PCAA 1S0MA 3JYTB 1TVRA 2ROGA 4CYUA 4ED4A 2ZHAA 3M8ZA 4KKOB 2GVZA 4QIFA 2DHSA 5LMUJ 1N34F 1ZH5A 2LLZA 2FJBB 2ZH1A 2ASYA 3ENAA 2RSQA 4DXLA 2NUHA 2CKWA 3MEKA 3T1HJ 2GIFA 2Y3YA 1PYSB 3BGRA 1KQFB 3C6UB 2RH3A 4HEA9 1FRXA 4RR5A 4ZVPB 2ZE2B 2D41A 4CLFA 4FF2A 1FWPA 1VK8A 4MYUA 1X4AA 1S7IA 3CEDA 3EGNA 4RW6A 4P75A 4ANDA 2B6AB 2XO6A 3EVWA 3MMBB 4IH6A 3ZZOA 3UVJA 3NL0A 1ACMB 4OJHA 3MM7A 2VC0A 1Z2ZA 4PXBA 1U6BA 1I51B 3K8VA 1VQ9S 2GIRA 2I5JA 3DM2A 3MTKA 3IN5A 2DNMA 5BXIA 2YNFA 1JJ4A 4OI1A 1RHUB 2UP1A 2UUAJ 1VC0A 5KT5A 2BYCA 1XNQF 3GU0A 2RQMA 3MEDB 1URRA 2MZTA 4JV2A 1M5PC 2VQEJ 4B17A 2A10A 1RKJA 1V9OA 2HLUA 1NLKL 1WTBA 3DN9A 3KMSA 2HMIB 4I6AA 3TP2A 2Y1IA 1E6YB 2L9DA 2MQOA 2F7VA 3HKWA 3NP5A 4WZMA 4MK9A 3GIMA 3KTQA 2WSFC 4EO8A 4F2SA 1SKUB 2O5DA 4NL5A 2HBQB 1KONA 4NCGA 3J7ZT 4PUOA 3TQ1A 2R3VA 2HK2A 4LSLA 3MGJA 2MB0B 4KGVB 2HS4A 1FRLA 4H54A 3G6VA 5AXLA 2DH9A 1UA1A 2MKYA 1RT3B 2D1CA 3H5SA 2OI2A 3QO9A 2HHHF 2M88A 1OMSA 2KT5A 3QAEA 4PG5A 5KG2A 1GMVA 4ZVFA 4DCJB 3GZ7A 2R8KA 3D66A 3DHWC 5IT4A 2J76E 5B0FA 1DTTA 1S77D 1QM9A 1S0OA 1N0UA 2R7SA 1VHFA 3P6YC 1DFDA 2ADBA 3V4MA 1SQFA 4DHVA 1S9FA 3ZXWA 2LVWA 1IUJA 2K1RA 3LP1B 3EGWB 3UR3C 3NLCA 4OX9F 1J5EF 4CDIA 2MZQA 2OD4A 2PGCA 4PWDA 2XMKA 3G9CA 1NKEA 4DL6A 4RNNA 4E98A 5KFMA 2CAJA 2HNZB 1UVMA 1ZZFA 2A3JA 4C8NA 3QSYB 2BJ1A 4LIWA 1WDDA 3IRXB 1QD1A 4CI0B 3JB9k 2IPOB 4LSNB 5JVHQ 2GQCA 1BGXT 4IFVA 1L3VA 3GG0A 1RWMB 1S6QA 3MFHA 4IR1A 2CPYA 4JI3J 2FJAB 2WVFA 4ANEA 2VIHA 3CC7S 3P5TL 1J2VA 2WVEA 3M9MB 2BEFA 5KFYA 3J80U 2QL7B 4ENOA 4ZA1A 2CJYB 4PABA 4EUVA 4ZDNA 1Y7PA 1RISA 1N54B 3TQEA 4WKRA 3TJ8A 3FSIA 2R7QA 1T3OA 1R3NA 2G13A 1B64A 1Y5IB 1N5YB 3M1VB 4FYYB 4Q0BA 4BHQA 2JEGA 5KFDA 2FJWA 3ZFVA 4LRDA 2ALZA 2B56A 1EHWA 4K4SA 3KHRA 3I9ZA 3IMQJ 3AJ2A 3DOMB 3QAUA 1S6PA 4PXDA 3HT3A 4DQIA 4MK8A 2N7CA 3GJRB 2UXCJ 1RLCL 2ZM6F 2XYPB 1S0NA 2DK2A 3M8WA 1Q1KA 1O51A 2BV3A 3BJYA 3L3CA 4CIOA 3R9LA 4EBEA 1IQZA 3EWGA 5B08A 2EWHA 3CW2C 4R5PA 2HIYA 1YGYA 2CQCA 1R8CA 4JI7J 4DR4F 4ZS6A 2HEKA 3DCAA 1WSRA 4H4KA 4L3NA 1WHWA 4U9RA 3HCXA 2GO8A 1EX8A 5E0OA 2KM8B 4P7VA 1AT1B 4FN5A 4C11B 4B3TF 3TZWA 5LSRA 3M7VA 1X5SA 3CMQA 4LF9J 1VISA 2XMMA 3I4PA 5KFEA 3MPYA 4ED3A 2W9CB 3DYAA 4HT7A 2MGZA 2DKOB 3K59A 4JI5F 4UOHA 3K5PA 1FHTA 3V6KA 3JSBA 5B0AA 3H25A 2NXEA 3LP2B 2MQ8A 5HROA 4TLQA 1EP4A 1S97A 5H1SV 2W7PA 4RKUC 4F4WA 4I68A 5AXKA 2PT0A 1RTJA 1RP5A 4FVCA 2KKHA 1KRPA 1X31C 6FDRA 4HLBA 4MIAA 4A8OA 1NH8A 1WDTA 2QC3A 2XWXA 2JL9A 4HDHA 4EWTA 1G4CA 5L9XA 5DM7Q 1JLBB 4DCPB 1HD0A 5CHCB 5KT4A 1CJVA 1FX4A 4JI0J 4OI6A 1U8WA 2IAJB 1RHQB 2QA4G 4X4NA 1AA1B 3DOLA 1S1XA 4EZ9A 2XY5A 3HP6A 4OZ3A 1SJRA 3DRRB 2XNRA 2YXLA 3KOAA 2DO4A 5B0DA 1GTEA 1WWHA 4OZ0A 4OJGA 3T5HA 1WC5A 2IMOA 4P7TA 2JOQA 5FD1A 1NPPA 3LH2S 4Q2LA 2Z2YB 1FEEA 1AFIA 3D3BJ 4KH0B 2V8GA 3EDRB 2HS0A 2BM0A 4DV6F 3BGOP 4C8MA 3PRVA 1WD6A 2HWIA 3BH7B 4QIWD 3R7NB 4X4TA 1QE1A 3UWTA 5L8RC 1VQ6S 2EEYA 3MAHA 4OJ3A 3CMES 3TANA 2CPZA 3M2UA 4WJBA 5CCLA 1NK0A 2G1HA 2LU2A 4UY85 1OYEA 1F5AA 2UUBF 3OR1B 4IFYB 4CRJA 1C1CA 1UW4A 3KFWX 2X1GA 1ZTTA 5J2MB 2VICA 4FKYA 3TEHB 1HLWA 5JJBA 5DRKA 4CO0A 2PFDA 1IKXB 1JB0C 1UWBB 1C0UA 4ZHRB 1RCOB 2OFGX 3H40A 1HNWJ 1VRTA 2QE5A 2O66A 3FSXA 4L6V3 2DRBA 1XR5A 2FLOA 3I0RA 2VPXB 2YKMA 4JP8A 1KDNA 2JWNA 2AZ1A 1B0TA 3QRRA 2HQ3A 1FCAA 3VWSA 3SQGB 3IR6B 1QUVA 4ZPTR 3EZUA 3V5RA 1Y3KA 4F4KA 3OXGA 3KUGA 2NXJA 1L3TA 3KDNA 3OLBA 3MPVA 4NLYA 2IC3B 2OPSB 4OZ1A 2YH0A 4A8WA 3BEGB 4DL4A 3MUMP 3M6VA 2K3KA 1U6FA 4K4XA 3M8QA 2M5YA 5T7LB 1LFPA 2CJ9A 2ZUAA 1U47A 2POKA 2IVYA 5BYQA 1HWUA 1VQ4S 3H42A 4CLLA 2OTLS 5ITHA 3KLFB 4TXSA 5ETVA 3JS9A 4NA1A 4UZCA 4JV5J 4Z7CA 1FJEB 5J2NA 3F0NA 2E7VA 4ERDA 1X4HA 5AE2A 3MEEB 1OS5A 1LKZA 2KXHA 3DLLQ 2QFJA 1X4DA 2HRYA 2B9EA 4QPTA 4Z37A 2DGXA 3DLEA 3V6DA 4WIQA 1E6VB 1XR6A 1IR1A 3DHXA 5C2GA 2VG7B 2OEJA 4MMOA 4DV5F 1C0TA 4KKOA 1HMVB 5LMNJ 1XMQJ 5HQLA 2CJBA 1PBUA 1R7IA 5A2QU 3N0VA 1RHRB 4OI2A 2K3IA 4DCOB 1KSPA 5ETSA 1TL4A 5LSOA 4QWDA 2XI3A 5LJ5Y 1NUEA 3VAIA 1YBUA 3C6UA 1FXDA 4DMZA 4K4UA 2XMUA 3MOJB 4UW2A 1SC6A 2OKQA 4DI6A 4CM2A 3L9ZA 2JLGA 4A8YA 1F9HA 1RAFB 2GMHA 3ISNC 3C16B 5F8MA 3RRKA 4X62F 3BH6B 4FYVB 1AZSB 2HHQA 4LF2A 4I6WA 4NPOA 5IQ6A 2HZVA 3OXFA 3MMBA 4BLGA 3BV8A 5D4NA 4O3RA 2N82B 3GFXA 2ZH9A 3MAQA 3W63A 5A8RA 4F36A 2WONB 3HHNB 4K4TA 4Y2KA 2H54B 2XLJA 2ZC4A 3OHBA 2OIHA 3WIUA 3NAHA 5BYSA 5DG7A 2N3LA 4DR3F 3MEDA 4WXWA 1TK8A 2QYCA 3OTCA 2FHMA 4PZVA 2GCFA 1K44A 1S7HA 1TUGB 1T03A 3SDEB 2FZCB 2U2FA 3ZO7A 4I7FA 4V19J 2OD6A 4B3RF 3JAMY 2WOMB 1E6YA 4G3IA 3PM9A 4CP5A 1U0HA 4QIGA 1LK7A 3VVTA 4DUZF 2PEBA 3TWZA 1RT1B 1SJ4P 4PQUA 1HBMA 1YBTA 3TUJC 1YJWS 3DLGA 5H9FK 2WVCA 1LOUA 4YR0A 1YJ9S 1YRUA 4XPEA 2NLWA 3TNVA 1SBRA 3FCWA 5G0RA 5DLFA 1RT4A 1Q86T 2DXDA 1BQNA 2BR0A 4Q8EA 1HI1A 2AQ4A 2IM0A 2EPIA 1SH0A 4N41A 4AUKA 2UXBF 1WHXA 4AQYJ 2X51A 5HVHA 4ZKAA 1NPKA 2YNIA 2YKAA 4B9LA 2FC8A 3S6EA 5FLXY 3PACA 4WE1B 2YKPA 3Q8RB 3ZTSA 4ZPDA 4C3MA 4C4WA 4UOGA 2HYIB 1FVSA 1UZDA 2B8PA 3Q23A 1RACB 2DBBA 1EAYC 2JFKA 3FQKA 1X0FA 3CC2S 2VA3A 3POTA 2ZOFA 1OJ4A 3FKBA 1MWYA 1WG4A 4DPWA 5HN0A 2VHGA 4AL7A 3CDEA 3CD5A 3HSZA 2RKIB 1BMQB 1RGVA 2BE2A 1FJ7A 1SH3A 2BE7D 4M5DB 4RL1A 3QQCD 1OYDA 2OPQB 1RBOB 4AD6A 1N0VC 4LSNA 3BO4A 4B3SF 2AJFE 1SXLA 1TL1B 2YPYA 2DPJA 1FTCA 3G82A 1RWKB 5GAEU 1NAQA 1P9YA 4Q2MA 3NEKA 1PBAA 2DR6A 1M1GA 2E5LJ 2P2CB 1AW0A 4JI2F 1FDDA 1XBWA 3PKMA 4OX6A 1N6QA 3LOUA 4OI4A 4DFJA 1IBCB 2XMJA 1TELA 2XMVA 3M32B 4IQXA 4UF4A 1EETA 2VB6A 5LXYA 1NZAA 1RTHB 4KQZA 3SIPB 1S12A 3DNCA 2CQBA 3L09A 1TTHB 5T14A 2Z8QA 5E5NA 4K0KJ 3DKDA 1WC1A 5D0HA 4BDPA 2MKIA 5KFJA 2IM1A 4F0HA 2I2YA 1HQ2A 3T5KA 3DOMA 3B6BA 3WC0A 2QL9B 3DLKA 3PJ9A 4M95A 1DQAA 4P52A 5KG7A 1O6XA 5IV4A 4B9MA 2DEIA 4ZVUB 1LWCB 1VBXA 3RTVA 4DFPA 3DXSX 1CJTB 2DGOA 3OD2A 4AXJA 1N5SA 3AOAA 3GFYA 4LF8J 2W7AA 2Q79A 1VBYA 2XI2A 1FTRA 3R1LA 3W5ZA 3OSPA 3R5JB 4X65J 4CO1A 4PR6A 4CLWA 4AL5A 2GA7A 4Y2AA 4YR3A 2VL1A 3OBIA 3SCIE 3SZ2A 1VBZA 5L1JA 3PYDA 5C2CA 5JVGQ 4X4UA 1IR0A 3D2WA 1UA0A 1FRJA 2AW0A 2FDNA 4X4SA 1UL3A 4N56A 1WNEA 1P1LA 4RW4A 2A6OA 2EFGA 1TP7A 5A0YB 5J1EB 2G0CA 4XO0A 3PYFA 4HDGA 3OLAA 4FXDA 4NA2A 3R7BB 1LNQA 2DXEA 4P2FA 3G4SS 1CG2A 3V6JA 3B8HA 3LP2A 2OEKA 3GIKA 3Q83A 4DZ6A 4KHPF 3K5NA 4KV8B 1K73T 3MM8A 3Q8SB 3A13A 1S6OA 4Q44A 1FXLA 4IYQA 3DGPA 2AP6A 1WUUA 4OIXA 2ZHOA 3I5AA 3MXHP 1IKVB 1BUXA 4NRTA 4PPDA 2PI4A 4LF4F 3WX8A 1XMOJ 2XSFA 2AKWB 3CC4S 3MUTP 2R7XA 1XIQA 2K8GA 1JLBA 1U48A 1NM2A 4DUYJ 2CPIA 1UEVA 3Q2SC 1TMMA 1KFSA 3GCXP 1RT5B 2MZSA 1VS3A
chains in the Genus database with same CATH topology
1MU2A 4DX8H 4ICLB 3HXMA 4O44A 2RILA 1IM4A 1QJHA 3NRBA 1K9MT 1DBDA 4FXWA 2IAJA 2HWHA 4DF4A 3Q2TC 1B0VA 2B5JA 3GSDA 4HKQA 2ZH7A 3M6WA 1VQMS 2LMIA 4ZPVR 4CT9A 1FE0A 2CVEA 3POTB 1NJZA 1NB7A 2Z2LA 4RW8B 4IOCQ 1VC6A 1C4AA 4IDKA 3EPGA 4KGMA 3U1NA 5C5JA 3HHLB 3H8YA 3S8SA 2UUWA 3DOKB 2J6UA 3G8TA 2XB2D 1CPZA 2BABA 3UNGC 1U7LA 2FVPA 3NNHA 4A8XA 1FERA 4OJ1A 5CZXA 2PA8D 3CTRA 2O01C 3DRRA 3M8PB 1GAOA 1HQUA 4N47A 3IC1A 3VQTA 5E2QA 1IBLF 1S1WB 1WEZA 1HWIA 3G96A 4DV2F 2FHKA 1R89A 1Q8IA 2MQLA 2PA3A 3PDNA 3HHKA 3U27A 1GNKA 3CJ0A 2CQ2A 4QYZJ 2YKNB 2BE2B 3OQ2A 5HMYA 1SB6A 4GMKA 2FD2A 3KLGB 1Y4ZB 2BBEA 4K50A 2CYYA 2E5GA 3OUYB 3QIPB 4DV1F 2W4CA 2HNDA 4A48A 2OMLA 3LWMA 2B51A 2MKJA 2AF6A 2LCWA 3BREA 5CA5A 1JLAB 4BWMA 3TARA 2J8AA 2ZH8A 2P6SA 3H98A 3TAMB 2ZE2A 2DO0A 1QSYA 3SV4A 2HZCA 3HVRA 3MFIA 3MMAA 4IQMA 3H5YA 1D1UA 4DSLA 1LWEB 4IO1A 2VG6A 4BC7A 1HBUB 2GNKA 4QR2A 1U2FA 1FESA 5IFMA 4PKDB 3T6BA 4DBQA 1IKWA 1YIJS 2XMTA 5EN1A 3E3XA 3ULHA 3UQSA 2GJ2A 1IBKF 2E5LF 2C3YA 2ZH3A 4Q8FA 4J9SA 5CQGA 1S1UA 4A8FA 5KFTA 2QRRA 5I42B 3G8QA 1V3RA 2IYGA 2BA9A 2B6AA 4J37A 5KFSA 2FLPA 5DO2A 1GX5A 4ZPAA 1UP1A 2RMLA 1DQ8A 5LMUF 1NO8A 2KZMA 4PRFA 4NZ6A 4USIA 4ETXA 3TVKA 1FKPB 3M2VA 3ZZZA 3N28A 2J7WA 3L7OA 2G4BA 1APSA 2ERRA 4KBIA 5DS7A 5DDOC 4DS5A 1R8BA 2DHGA 1N6QB 1CC7A 3C6TA 1G2EA 5DG8A 3OXLA 2WHOA 1YVFA 2J0WA 2IBOA 4BWJA 2GHVC 3KNGA 2BUNA 4C9DA 1F0XA 3Q8PB 3T1HF 3FJ2A 4DLEA 3NS5A 3M30B 1H6KX 4DOZA 2HNYB 4DV7F 3QZ8A 2FJXA 4DR6F 3LP0B 3IXQA 3PX0A 4A8KA 5KAKA 4Y0FA 2QV6A 1EETB 2IJNA 4QWCA 4RUCA 2F8MA 2HHTA 2X3GA 2KM8C 1JWWA 4Z2XA 2PFFB 4NOHA 2XGQA 3LGNA 4FBUA 3CSKA 2B9YA 2EFVA 3PEJA 3TOQA 2E1MC 1DURA 2N3OA 3CUNA 4IRCA 5CYJA 1FRHA 2KYZA 2BRLA 3GMGA 4YEAA 1UVLA 3TX8A 1K0VA 4XK8C 3IG1A 2R7OA 2VKZG 1WF0A 2W24A 3DFEA 2LQ5A 1BC6A 2YWHA 4WFAQ 1YQHA 2WK4A 3E01B 1V3SA 2N4CA 5BYRA 4ZHRA 2W7OA 4DQSA 1NK6A 5C42A 5DQHA 1VQSA 1XTZA 5AXMA 4P6QA 3G71S 1P27B 4LIRA 3RYLA 2V4QA 2HVZA 3OTDA 4H4OB 3ZC4A 3OVAA 4GC7A 2EC0A 3LAMA 4ID5A 1S1TB 1PC4A 4ECZA 1YRXA 4C0HA 3M2UB 3MOZA 3IR5B 1KLMA 3FGVA 3R3TA 4DQQA 3QGGA 3CXCR 3JSMA 1N32F 3O1LA 2HMIA 1D3WA 1UFLA 3DLKB 2UV8G 2FTRA 1G6BA 4AXIA 2UVUA 1C1CB 1FNOA 1X4GA 1NEEA 2VFTA 5KFRA 3CCUS 2Q3PA 3LF0A 2M8HA 5KT7A 3IA0A 2IYIA 2BVZA 3CJ2A 3NWGA 2RDIA 1HD1A 5K8OA 1Q82T 4WFZA 1RT7B 4CT8A 2L08A 2HGMA 1IJFB 3KJVA 1S72S 2HS3A 2DNHA 1CVJA 1WF1A 1TUVA 1Y9OA 4PQAA 1MMLA 4DPOA 4DL5A 5D6GA 2MDAA 1PGZA 5CXTA 1D9DA 3V4IB 2M0GB 2IC3A 3IRWP 3TVYA 5HI7A 2XC9A 1S49A 2DR7A 4KIAA 1HWJA 1TL3A 4QIVA 4LVOP 2UUAF 2CZ4A 2P6TA 1I1GA 2Z4PA 2KO1A 3MECA 4GO7X 5J2PB 1K0TA 4JI4F 2L3MA 2XEXA 4JI8F 4NMLA 4MKYA 2DIUA 2E1RA 2IRXA 1SL1A 4P2SA 1Y00A 3V81B 4B3MF 1YJTA 4ED7A 1SV5A 2FIUA 2ZBCA 5IM0A 1VI7A 4CH7A 1RT6B 5C25B 3HJFA 1M5HA 2W9AA 4I69A 1S6UA 3KG4A 4FNHA 3HDSA 2JSXA 4F3MA 4X64F 1KR4A 3DRXA 2VQEF 1FJCA 5F41A 1RT3A 3UCGA 3CGIA 2MJNA 2F1FA 4FF3A 3PKYA 2VPZB 1U1NA 2DNKA 4WK3A 4N8OA 1VQ5S 4LFCF 2OP5A 2RRAA 1S48A 1H98A 2A18A 3MI7X 3RR8A 2RRBA 3FMWA 4XAKA 3KLFA 4PG7A 1UMJA 2HIQA 4F4XA 5SUHA 3ISZA 2CQ0A 1SUQA 3S1TA 3K5OA 5U47A 4H4MB 1KFDA 2EK1A 4U7CA 4I4BA 4UQTA 1UKUA 3N5FA 4GKJF 1JLQA 4F4YA 1V6HA 2PO4A 3BGUA 4QZVB 4RW4B 3F44A 4ED8A 3TA2A 5H9EJ 3RRHA 4Y00A 3C3LA 1U25A 1ZM4A 4I2QA 2ZZMA 1LW2B 3KMQA 5KFXA 2I38A 2QA1A 3N9UC 3MHYA 4MFBB 5ADZA 1MWZA 2VH7A 2DTJA 2LKZA 5DGAA 2CPFA 2CQ3A 3IS9B 1JJHA 3D0HE 3OL6A 4DFMA 1LV5A 2J7KA 3LP1A 3RAXA 1FKOB 1KHVA 4TY8A 3K57A 4TU8A 4OFZA 1Z4UA 4DL0C 1HBOA 4B9VA 3OV7A 4WFNQ 2UVVA 2ABYA 1FKAF 4YFUA 1ZETA 4R8UB 5HQ8A 5DLGA 3DC2A 4ILMA 3OVBA 1FXRA 3WX4A 4DDFA 4YMEA 3MR5A 4OL8A 1LWFB 2EFPA 2PE8A 2WB4A 3IWLA 3KHHA 2ZHBA 1JK9B 4ES2A 1TKXA 3D1HA 3HVTB 2R2SA 2AYBA 3QGIA 2HNZA 1ZM2A 1G7CB 3HHEA 1JLFA 1C1BB 1OWXA 3W2WB 1IBMF 3AQPA 3B82A 3DRPA 3W2VA 5LJ3Y 2VPYB 3MM8B 2Y0SD 1HBNB 4F8RA 1RTDB 2VFVA 2X1FA 2WSCC 3VAFA 1HMVA 4OHZA 3MUVP 5F8JA 2MZ1A 2ZD1A 4XDCA 1NK9A 5IS2A 3NBPB 3QIDA 5HP1B 1LQ9A 4K4YA 3TVZA 4JV1A 4NLSA 4EO6A 3IRXA 2C3MA 1FE4A 1RA6A 3N5BA 4KGKA 4UUXA 4IRKA 2LEBA 3CJKB 2V9WA 5CYQB 1B0PA 5B09A 5F9LA 2IRUA 4QWBA 3K5LA 1XMOF 2DHXA 3OSNA 2E29A 3MD3A 3TA0A 4YB5A 3DLEB 3V6DB 1R6YA 1LXJA 2MJUA 2ASJA 2BDPA 2BQRA 2DGWA 3CT9A 2ZH5A 2GMLA 4ZPWR 2DVIA 3DLHA 2VQFF 3CULA 4C8YA 1R0AA 1S0MA 2PC6A 3MM6B 3I56S 3JYTB 4CO4A 1RAJA 1VMBA 1TVRA 2EBEA 3HX9A 4DQRA 2ROGA 3TUIC 2ZHAA 1HARA 3KHLA 5E3AA 5KFAA 4KKOB 4O44B 4QIFA 3MMCA 2DHSA 2ATLA 2F9DA 1WACA 1VLYA 3O44A 2FVRA 2B5JB 3RB6A 2ZOMA 1N34F 2DD8S 1MROB 1ZH5A 4NLWA 1KS2A 4C3KA 3CDUA 2IBKA 3NMAA 2LLZA 2FJBB 3FZ2A 4DF8A 5D78A 2ZH1A 2ZJQQ 1WI8A 2ASYA 4O4RA 2OTJS 6FD1A 5KOWA 2RSQA 4TU7A 3GWCA 1HQUB 2NUHA 1HNIB 2CKWA 3C46A 1W25A 3MEKA 3WZ0A 4U6PA 2W25A 1Q53A 3THTA 4KJIA 3B78A 3BGRA 4C0OC 2J0QD 1IKYB 1KQFB 3C6UB 4C8LA 2NQPA 1S1VA 3E51A 2RH3A 3CD0A 3G86A 2ZH6A 2V94A 2HNDB 4ZVEA 3G6YA 1AROP 1YJVA 4HEA9 1LW0B 5KT6A 1N5YA 3MTJA 3PW2A 1T05B 1FRXA 3M1VA 1HR0F 3D1QA 2DH7A 3HO1A 5L38A 2ZE2B 2F40A 2V9KA 4B08A 5B7WA 2KG0A 2D41A 4QW9A 3M8SA 3EYZA 4FF2A 1VK8A 3L7PA 4MYUA 3MMAB 1X4AA 2JH3A 2VG6B 1RYSA 3MEGB 3GYXB 3CEDA 3BSCA 2QSFA 1D8ZA 4ZCMA 3UD3P 1YI2S 4JI3F 2F4VF 1IKWB 3EGNA 2HHXA 2ZKTA 2FVQA 1NKCA 4RW6A 1KVJA 2KT2A 1FRIA 2HVHA 3CCLS 4LT6A 2B6AB 3SCKE 4DV0F 3PW5A 1CQMA 2GV1A 3MMBB 4IH6A 3ZZOA 3M6XA 5KFWA 1GXUA 3FDSA 3NL0A 1UJ6A 4OJHA 1RI7A 2K7JA 3MM7A 4TQRA 3HI9A 1KLNA 3M2VB 2FB0A 3D54A 4KAIA 2VD3A 3PIOQ 5J2QB 5DG9A 2BW2A 1RYRA 1ZOTA 3B4DA 1JKHB 2KXNB 4RWXA 1MMDA 1Z2ZA 2VC0A 4D3HA 1H2VZ 3I32A 1N5QA 2DNYA 3CDBA 4PXBA 2C28A 1U6BA 3K8VA 4DL2A 1DQ9A 3P96A 2GIRA 1VQ9S 3IWNC 2WW8A 2WOMA 2HFZA 2I5JA 2RDJA 3DM2A 3MTKA 5CH7B 4URQU 2DNMA 3IN5A 2J0SD 2YNFA 2EG2A 5A8KB 1JJ4A 1FK9B 4OI1A 1KN6A 3CMAS 4FZVA 2UP1A 2E44A 4JYAF 1VC0A 1D9AA 5KT5A 1ZM3A 2BYCA 4NLXA 1XNQF 4CH0S 4GO5X 1QAYA 2WTFA 4EBDA 1VQOS 2APOA 2UVRA 2RQMA 3M9NB 5K9FA 3MEDB 1DTQA 1FEHA 1URRA 1UEUA 2Q43A 2MZTA 2RU9A 3GFZA 3IG1B 1NH7A 1N48A 4IUFA 4PXCA 2L9WA 4JV2A 1B7FA 1VRUA 2MZRA 2YWKA 4RBTA 4LMZA 4NCAA 1SL2A 4RLEA 1DLOB 1BY9A 4ECRA 3KK2A 4K2XA 4JV0A 1M5PC 2HW3A 2AD9A 1Q79A 3HPOA 4RNMA 4B17A 4G6VB 3OL9A 3B4MA 3KHGA 2A10A 1RKJA 3BF4A 3UE2A 1V9OA 4WYLA 2HLUA 3KLEB 2NXUA 3Q8QB 5FDLA 4C11A 1HNZF 4X2BA 7FD1A 4WXOA 2IFXA 3RW7A 4GC6A 5I3PA 1WTBA 1IN0A 4Q45A 4RNFA 3JSMB 3DN9A 3KMSA 3PHEA 4O23A 3AB2B 3KK3B 3BN7A 4I6AA 3TP2A 2HMIB 1FVQA 1E6YB 5F8LA 2Y1IA 2L9DA 4ZK7M 3VQSA 2BJDA 2MQOA 2F7VA 3QWPA 3HKWA 3NP5A 4EYIB 3HKZD 2UXCF 2E5HA 2N4DA 4JUZA 2E5IA 3X1LB 4WZMA 2FLLA 3D5MA 4MK9A 3GIMA 2W9CA 3KTQA 4J9PA 2WSFC 4EO8A 4F2SA 1AXQA 3KJVB 2O5DA 4NL5A 1T3NA 1QVFR 1KONA 4NCGA 4WFXA 2RVJA 1JJ2R 5HBMB 3J7ZT 3PY8A 3M6UA 4AL6A 1S9EA 2JJ4D 2Q6BA 4PUOA 4MYTA 1X5TA 4ECYA 3TQ1A 1U6ZA 3CDWA 2XY6A 2D7SA 3MECB 1X0PA 1TZ0A 4LSLA 3LGMA 4JI7F 2HG4A 2V5HG 3MGJA 2MB0B 2HS4A 2VKRA 1FRLA 2PEHA 4ZPCA 2JRSA 2YX4A 2XSJA 3N79A 1SV5B 4H54A 5IM0B 2RF2B 3N01A 3G6VA 5I4MA 3PIPQ 1TFWA 2R2RA 3QJLA 5AXLA 2DH9A 2HHPA 3GV8B 1UA1A 1Y5NB 5KG5A 4RNOA 3LALA 1HNVA 4QU6A 1RT3B 3SFGA 2C42A 2OMOA 2AYGA 3SFUA 4ELVA 4LQ9A 2D1CA 3H5SA 5KOXA 3MMJA 5C24A 4J9LA 1FF2A 3QO9A 3HMJG 1QTMA 2HHHF 2FJEB 2M88A 1Q8BA 1DJ0A 2KT5A 2C3OA 3QAEA 4C8OA 1UETA 4PG5A 5KG2A 1REVA 4RU9A 2OO4A 4FYDA 1GTHA 3VTIA 3LQVA 4ZVFA 2XGPA 4DV3F 1SUQB 3GZ7A 4PWUA 2R8KA 2DJWA 3DHWC 5IT4A 2J76E 4QR0A 4ECUA 5B0FA 4LF9F 1DTTA 1JLQB 2DNRA 4A4JA 4HL9A 2RKIA 4AYBD 2J6TA 1QM9A 3HFKA 3JTPA 5E3QA 3HVWA 4RW7A 4O0IA 1S0OA 1S77D 1N0UA 1U1RA 2R7SA 4ZMMA 3CD6S 4I2QB 3T9NA 1VHFA 1IXKA 4WCEQ 2YNGA 2ADBA 3P6YC 3V4MA 1DFDA 3IGNA 4DHVA 1S9FA 2LVWA 1IUJA 2K1RA 3ZZ0A 4ECSA 2OPQA 3THPA 3LP1B 3EGWB 3UR3C 4TY8B 4J9RA 3T5LA 1M5VC 3NLCA 4OX9F 1J5EF 1SI9A 3O3LA 2MZQA 2OD4A 3N6NA 1O8BA 2PGCA 4PWDA 5DGBA 2IVMA 1WI6A 2XMKA 3G9CA 2LEAA 1NKEA 3G6ES 4DL6A 3FSYA 4LQ3A 3BM7A 4RNNA 2B43A 4E98A 5KFMA 2YWGA 2HNZB 4F2RA 1JLFB 2Z0GA 1SH2A 4BC9A 1T8EA 4OX8A 5CYMA 3MR6A 1UVMA 2A2CA 2M3DA 1ZZFA 2A3JA 4C8NA 3TAPA 2FVCA 4LIWA 1ULRA 3DU5A 2ZH2A 4G1QB 3NCPA 2J9EA 3TYTA 1F2GA 2ZD1B 3SCJE 1Q8LA 3LPYA 4F67