2QLXA

Crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum in complex with l-rhamnose
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
GDMTLEKHAFKMQLNPGMEAEYRKRHDEIWPELVDLLHQSGASDYSIHLDRETNTLFGVLTRPKDHTMASLPDHPVMKKWWAHMADIMATNPDNSPVQSDLVTLFHMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords L-rhamnose mutarotase
publication title RhaU of Rhizobium leguminosarum is a rhamnose mutarotase.
pubmed doi rcsb
source organism Rhizobium leguminosarum bv. trifolii
total genus 19
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 5.1.3.32: L-rhamnose mutarotase.
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05336 rhaM L-rhamnose mutarotase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qlxA01
5B0DA 2RILA 4HL9A 2BUNA 3HHLC 2W4CA 5B0CA 1VQYA 4A48A 4NL5A 1TL5A 2PD1A 4F67A 5A6PA 4HI1A 4HI2A 2AJ1A 2FTRA 2ROGA 3HDSA 3TOQA 2N4DA 2HIQA 4FNIA 3KNGA 4OIXA 1YJUA 2LDIA 1N5QA 3FMBA 1FEEA 1Q53A 1FVSA 1Q8LA 2HLTA 4Q2LA 1TR0A 1TZ0A 3HX9A 4OJ1A 3TRGA 1X0PA 1N5TA 2LXFA 4DN9A 2BBEA 2OKQA 4HH0A 1N5SA 2KYZA 5B09A 3KG1A 2EW9A 2OP5A 2OAUA 3DCAA 4ZA1A 2IYIA 5B0FA 2AP6A 3HHLB 3FGVA 3BGUA 1KQKA 1U7LA 2RU9A 1TL4A 1X7VA 3F44A 2K1RA 1TUVA 4ZOSA 1LQ9A 3LGNA 5F0WA 1FESA 2XMMA 3BN7A 3MCSA 5F0UA 4DPOA 3TNVA 4FNHA 2ZDPA 4A47A 5KAKA 2LQ9A 3BR8A 1GXTA 1SB6A 2VH7A 3CJKA 3UDCA 3I9ZA 3WDOA 1APSA 4YDXA 2L3MA 3HF5A 2GA7A 1XBWA 2KKHA 1FE4A 3DXSX 1YJRA 2PGCA 2QLWA 5T7LA 3KG0A 3BF4A 2GGPA 1CC7A 4NPOA 2N7YA 5B0AA 2ROEA 1KVJA 2GFFA 2OMOA 2XMJA 3K7RA 2GV1A 1URRA 3E8OA 4QOTA 2HQIA 1W2IA 2KT2A 1Q8BA 1P6TA 1P8GA 2K7JA 1OQ3A 2G9OA 2VV5A 1Y3JA 3IWLA 5K9FA 2GCFA 5A6WA 2OD6A 2HLUA 3LO3A 2XMUA 2QYCA 2HFNA 4EFAC 4Q2MA 1JWWA 2AW0A 1KVIA 1MWZA 1SQEA 2FIUA 3HHLD 3MZIA 1FD8A 2OFGX 2ZDOA 5B0GA 1IUJA 1OPZA 1R6YA 1ULRA 2OFHX 2BYCA 1YJTA 1V3ZA 2K7KA 2XMWA 4Y2MA 3HFKA 1SI9A 2KT3A 1AW0A 1MWYA 2XMKA 3KKFA 4OJHA 3HHLA 1CC8A 1QUPA 5B0BA 4U9RA 2BJEA 4Y2IA 1N5VA 1WD6A 2OD4A 2QIFA 4A46A 2AJ0A 2FHMA 4A4JA 2GO8A 1Q4RA 2LQBA 4OJGA 2JDJA 1X8DA 4OJ3A 3T9NA 3BM7A 4DL0C 1FVQA 4YEAA 1Y9OA 2FB0A 1VQSA 4HH1A 2RMLA 2XMTA 2XMVA 1OSDA 1AFIA 3VTIA 2IFXA 2W4PA 2K1RB 2RSQA 1K0VA 1JK9B 2QLXA 1GXUA 3QGPA 2Q3PA 2N4CA 1YG0A 2BJDA 3GZ7A 1AFJA 1OQ6A 2ACYA 3IWXA 2HFOA 3BB5A 3CJKB 3FRYA 3LGMA 2CRLA 1YRXA 5IXUA 1FE0A 2ASYA 2ROPA 5B0EA 3BDEA 5T7LB 1Y0HA 1RJJA 1CPZA 1YJVA 2GGPB 1S6UA 2K2PA 4Y2KA 2W4DA 5B08A 2IYGA 3QMQA 1S6OA 1Y3KA
chains in the Genus database with same CATH superfamily
1PYTA 3V6KA 2MQQA 4DPXA 3QYYA 3HT3A 3SEOA 1SKUB 2IY5B 2X1FA 4HHJA 2HYIB 1IQZA 4DG1B 3VHQA 4P52A 4U67Q 3GIRA 3MMAA 4ANCA 3IBCB 2CNKB 3CC2S 3RTVA 2E1CA 3O2IA 4FNHA 3CC4S 3V5RA 1Z1ZA 3UVJA 1GQEA 3MF5A 3MOZA 4BLGA 1RAEB 3HZGA 1Q81T 3UO0A 1U1LA 2XNRA 2HNYB 5KFUA 3K0JA 2MHEA 5AE2A 2VQEJ 2IPOB 3C6UA 1VRUA 3K8WA 3BJYA 3H5SA 3ZXWA 5C24B 4F3MA 2B9YA 5KFFA 1KRPA 3JQKA 3LWMA 2CPFA 5T14A 4ZCMA 2I0XA 2OPRB 2HG4A 1H3DA 1PG5B 2JWNA 4N47A 3KK3A 2J7WA 3A4TA 3DMJA 2R8IA 4J9PA 3P5TL 4HI2A 1H74A 1KP6A 2A2CA 4B3SF 3MMCA 1WHXA 3EE3A 2MMYA 4P2XA 3S1TA 4KKOB 1RSCA 3HHLB 4LT6A 4ZDNA 2GMHA 4K2JA 2JJ4D 1E6VA 2OMLA 4ILMA 5IWAF 2B6AB 2BKOA 2RDDA 5KFHA 4I67A 2O66A 3EDRB 2IRUA 3FRZA 4ED1A 1V5IB 4KB7A 1OQ3A 3TWZA 3BKTA 1S1VA 2ABYA 3IS9B 2DITA 1RADB 1RHQB 2Y8YA 1OPZA 2OFHX 4QYZK 4K5SA 2CQ3A 1SI9A 5BYSA 3RZAA 1K1SA 4TQRA 4USTA 3Q8PB 4RW8B 2ZVIA 3D5MA 1VJQA 3CCQS 1TKXB 3RR7A 1S1TA 2MZJA 1BWEA 2LCWA 3EPIA 1NPPA 4C48A 1ZETA 2UV8A 3IWXA 1RT6A 3EGWB 1WWHA 3HVTB 3NXZA 1IKYB 1DBDA 4ES2A 5T7LB 3DHWC 3T6BA 2W9BA 4PUOB 4I2QA 4ITSA 1OSCA 2QTWA 3FC9A 4OHYA 3N6NA 3CCMS 2W4CA 4H4MB 2L08A 4A8MP 2AD9A 3MGJA 3TZZA 4FNIA 1R0CB 3WHIA 4DV4J 4LFCF 5IT4A 1TV6B 3MOJB 2CQ2A 4K2XA 2PC6A 2BBEA 1B64A 4PXCA 2RDJA 1LFWA 2Y1LB 2YNHB 2A10A 2DHHA 4DPYA 2BE7D 2JFKA 4DV6F 4K4YA 1RLCL 1VRQC 3DI6B 2YY3A 2JX2A 2JVRA 5K8NA 4WZQA 5F9LA 1JKHA 3OL9A 2FQQB 2HFUA 2QL5B 5ETLA 2UUBF 3KUEA 2B51A 1DRZA 3P49B 3KDNA 1WOSA 2ZH5A 2FVCA 3OLBA 1L3TA 2VU5A 2HWTA 1LW0B 1FWPA 1K9MT 5L9NA 2DK2A 1RGVA 4Y34A 2CQ4A 2ZBCA 1VMBA 4OZ3A 4JYAJ 1AFIA 2R8JA 2K1RB 1NK8A 2WK4A 1X31C 2GHPA 4UF4A 3LANA 2RKIA 2W4DA 4RBVA 3NGUA 2BA9A 4NXNF 2VFRA 2WOMA 3UDEA 1FWLA 1B7FA 5AXNA 4AYBD 4YS2A 1UMJA 2OP5A 3AA9A 3C19A 2J6TA 1SC1B 3W2WA 2KYXA 3CD5A 5EN1A 3CUNA 1Q7LB 3G8SA 2MEWA 5HP1A 2RHSB 2MZRA 1E6YB 2ZFHA 3SDEA 3BGLA 4K0KF 4LREA 2OPSB 1X5TA 2JRSA 1ZH5A 2BDPA 2JNJA 2ZC3A 4EO6A 2R2UA 4X65J 4J9LA 4YR0A 2HMIA 1SC6A 3P5BP 4RW6B 3KKFA 4DV1F 3MEGB 3DLGB 1N5VA 1NBEB 1YKWA 4O0IA 4H4KA 1RT3A 3EICA 3MM6A 3J80Y 1Q0NA 2HFOA 1R8CA 4F4WA 1EETA 4P73A 1TMJA 4MFBA 2DBBA 3KNAA 2BEFA 5CZXA 3KMSA 3MMJA 2FC9A 1RTJB 3L7PA 3OTOF 3GIMA 5HBMB 1WI8A 1RAGB 1RAIB 5F0WA 1BUXA 2VQFJ 1UTAA 1C1BB 4CLUA 4JI7F 2QLBB 2V9WA 4LRCA 4XTTA 3G4SS 1O5JA 4J9NA 1JJ4A 2IAJA 1RYSA 4ED7A 1Z4UA 2DKOB 2K7JA 3SFUA 3S8SA 2G0JA 4K4XA 5BR8J 1EX8A 3AD9C 4NYOA 4DMZA 3EGZA 1X4HA 4F7VA 3BSCA 1QUPA 1YZ7A 2HHSA 1Y7PA 1GX6A 3C6TA 1Y9OA 3CCSS 2F5GA 1NCLA 3ZNUA 1IM4A 1U26A 2R7XA 2FVPA 2JC0A 4ZITA 4RBTA 1RB0A 3G8QA 2V4QA 1B7YB 3CPWR 2MZSA 4UZCA 1WOOA 1T7PA 2YX7A 2IJRA 3JYTA 4F4KA 2AJ1A 3QPIA 1FRMA 4DR1F 1BHNA 3IMQJ 1Q8LA 3CCZA 2DISA 4ED4A 1WDDA 1M5SA 1HQUA 3R7NB 4ES1A 3OR2B 5RUBA 4LF6F 3MWBA 2MQOA 1NHUA 3C3LA 4JI3F 1XBWA 1RHRB 1X4BA 2QMWA 1FXRA 2JLEA 2JOQA 1UL3A 1LWCB 4ED2A 1W26A 2KT2A 4IH5A 3TI0A 3CD0A 1VIXA 2C2EA 2B4PA 1HKAA 1QE1A 3POTA 2V8HA 3OTEA 3PM9A 4DU7A 2KFZA 1AT1B 1XC9A 4UQGA 3A8IA 5LSOA 2DR7A 3R6GB 2VKRA 1PYOB 2V67A 1TAQA 1VQPS 2ZVSA 3HP6A 2Y0BB 3VGVA 3EM1A 1K44A 3JB9k 3DN9A 1NK5A 3GV7B 1ELOA 4UT4A 1BQNA 4E0DA 4DR7F 1WG4A 3M6VA 2IM3A 3QGHA 2F7VA 2G1HA 2XG8A 2DEIA 3BGRB 3UD5A 4PR6A 2H4WB 4HHUA 2VG5A 1YBUA 3KLEA 3CMES 5KG7A 1DTQB 2V4JB 2W2PP 1WC1A 1A6LA 2E9TA 3KG0A 2P8IA 3VWSA 1PJ6A 1C0TB 1H98A 1F6TA 3PJWA 1KQFB 2HQIA 3QGGA 2DNYA 4OQJA 5JVGQ 2OIHA 2K7KA 3CCUS 1AW0A 2WB4A 2HHWA 3C8YA 3NLCA 4A4JA 3IAM9 1RUSA 3RUBL 1S1WA 4HEA9 4TY8B 4F4YA 3PDNA 3AD7C 4ZVPB 3DOMB 2M88A 3ENQA 1Y11A 3ILLA 2R8HA 3OJUA 1T95A 3MDFA 1B0TA 1R31A 3GPAA 4OMFG 3LAKA 1FK9B 3K5MA 3G6ES 1VISA 2E29A 4DJBA 1YJUA 4EWTA 2KYZA 5DG8A 3SCIE 5CD4H 4NCBA 4ZA1A 1TL4A 2FDNA 1ZS6A 1VHFA 4PXBA 2VPWB 1FEHA 4X4TA 3CJ0A 2HQFA 4D3HA 1Y4ZB 5KFXA 4OZ2A 2YQ1A 1CJVA 2ZOGA 3Q22A 3IO1A 4IG0B 4WU3A 3Q8QB 4USIA 4DQQA 2DHXA 3JAMY 3EZ5A 5KT6A 2FIUA 1BY9A 2DRAA 5KFLA 4LF7J 4Q8EA 4B17A 4ZJQA 3CNQP 4LF9J 1V6HA 4LF8J 3ZTOA 2LYVA 2HRYA 2H54B 4CO5A 2EK1A 1GT8A 1HPZB 2HVZA 1XMOF 2BJ3A 3K58A 3VVUA 3OXFA 2I5JA 5IXUA 2F65A 1JLBA 3GILA 2XSJB 3BH7B 3QT7A 2BMBA 4DV2F 3OBIA 3Q83A 2ZJRQ 4B9NA 3NMAA 1N5TA 5HSPA 2UXDJ 3I0RB 3GCWP 1SCJB 3MEDB 2JEGA 3ZTSA 4KQZA 3JSMB 1A9NB 1FJ7A 3JSBA 1NJWA 4OI1A 3NS6A 5K8OA 1KC8T 3FBCA 2DNPA 4C2MA 5KFPA 2KT5A 4CLLA 4PG7A 1NH8A 2WVDA 4L73A 2GIFA 1OMSA 4CNZA 3IWLA 2OD6A 3W7BA 4F2SA 4D3GA 1OPIA 1RWVB 1ULRA 2ZM6F 3MPUB 2XY6A 1RWUA 2HZCA 2YNGB 4IR9A 4NLTA 1NJXA 2IJFA 1CJTB 1LWEA 3PYEA 1OSDA 4DSLA 5CAAA 4NYPA 2IA6A 3C46A 2RAQA 1QSSA 4P2FA 3OSNA 2MJNA 2VASA 4FN5A 4PKDB 5D3GB 5K14B 1ZM9A 2W9CB 4GVBB 2PI5A 2RS8A 2ASLA 2VQEF 1TL5A 5BXIA 4DX7A 5L8RC 3PY8A 1S0MA 1U0SA 3N5FA 3H5YA 2M4MA 1YRUA 5DLFA 3CXCR 4RUCA 3GQCA 2LLZA 2YKAA 3W2VB 4PPDA 3UDCA 3MECA 3CJ8A 2VFSA 2ZH1A 1VC6A 1IWAA 1CS4B 2LEPA 2LP4A 2VFUA 2IDLA 3R6LB 4UOGA 2HNDB 1NDLA 4YP3A 1FNOA 2IM2A 2QX0A 4O3RA 2RUGA 2GIQA 2BX6A 2EBGA 3C66A 4DQPA 1BGXT 3CB4A 1YBAA 1HBUB 2QFIA 2QA4S 1VRTB 4FBTA 3RAMA 2DGVA 3Q24A 2VG6B 4URSA 2BW2A 2GJIA 4ZP9A 4F50A 4C6AA 2GHVC 5FDLB 4OL8A 2XY7A 2CFXA 2IC3B 2XCAA 1EHWA 1FNXH 3HT0A 4BC9A 2CVIA 4FXDA 4QIWD 1JX4A 1N34J 1NSPA 4HYKA 4NMLA 2AYBA 4X84A 2QN6B 5BJRA 3SIPB 3QSYB 1RWKB 4O4GA 3E8OA 1RTIB 3M8SA 1Q8KA 5HMWA 4C0OC 2ZJPQ 4AXIA 1JWWA 5EGYA 4DV4F 2P2CB 1MMDA 1IUJA 2J6UA 4E2FB 4LR7A 4TU8A 1UA0A 2QV6A 1MMNA 8ATCB 5J2MA 5KFZA 1CQNA 4LSLA 5J2NA 2EC2A 6FD1A 2MKCA 3IM9A 3HM9A 9ATCB 5IZHA 1HBMB 1S7IA 3KLIA 4LFBJ 5LMNJ 2VFVA 2ERRA 4HH0A 4C0HA 1Q8IA 1F5CA 3EXYA 4EU0A 1OWXA 3LA0A 1TK8A 4ZPBA 1PJ7A 2Z2ZA 3ENVA 3CJSA 1SQFA 2GGPA 2PFDA 3OL7A 2XY5A 1RT5B 4DXLA 4ZLNA 2V2ZA 1HWUA 2DYAA 1K73T 1V3SA 3ZZYA 4BWJA 1VBZA 4DHVA 3MAHA 3HHLD 3T41A 1KFDA 3CO9A 1QAIA 2XYPB 1IR2A 1VQ5S 1S57A 3CULA 3KLHB 5THWA 2Y1RI 1AUDA 1GAOA 4OZ5A 2Q43A 5A2QY 3T3FA 2DY9A 3W5XA 1EQMA 1RTDB 2WBRA 2XULA 1HARA 1TAUA 3DRRB 2D3OR 1XR7A 3M8QA 1HYSB 2V8GA 5JXSA 4V19X 4X65F 4LRFA 5F3ZA 1NKCA 1U1PA 2V68A 2MJUA 4OI2A 3ZZUA 2AHOB 4DQIA 1S1UA 2D41A 1TUVA 4OX8A 3DYAA 5KT4A 5HVFA 4XPEA 1SL2A 2KKHA 3I96A 5HMXA 5I3UB 2M8DB 2GV1A 4HKQA 3M8YA 3P96A 4YB1P 3QLHB 2W01A 4KHPJ 3GP9A 4LUBA 1AZSB 2VG7B 2P6SA 4U96A 1MNEA 3TAMA 4Y2IA 4UUWA 1ICEB 4OJGA 2VQFF 2W9BB 2RDIA 2NR0A 1FCAA 3Q8UA 3AQPA 3DLEA 3MURP 3D9BA 2MTLA 1QVGR 3CMAS 3NL0A 5IM0B 1QM9A 3BDEA 4LF2A 5KFJA 5KFNA 5B0CA 4JI1J 5HATA 3I56S 2ASJA 5HMZA 1JLCA 2OO4A 3OFFA 5GMEA 4EYIB 4JV0A 2BRLA 3ZZ0A 3D28A 3SV3A 4ZCKA 4WTYA 4FYYB 3MUVP 2PEHA 3QT6A 3T5LA 4B9SA 3HF5A 1F60B 1LXNA 3FEZA 1ACMB 5D77A 4MT1A 2IM0A 3A8JA 1RHMB 4EZ6A 1N0UA 2RB7A 4RUBA 4ZHRB 4ZPTR 4LQ9A 1HR0J 3V6JA 4P7TA 3PRBA 2I38A 2BKNA 1GMVA 2QMUB 5EDWA 3G82B 3FZBA 3GFHA 3IRXA 2BANA 4DSFA 1ZA2B 1FT8A 3QATA 4UOFA 4ZVQB 4ZJOA 1VK8A 1UW4A 5C42B 3H7HB 5SUHA 2PIIA 3TA1A 2DEJA 3KK2B 4C8KA 2B4UA 3PYDA 2E5HA 2PMHA 3T19A 4M5JA 3VR1A 3G6YA 1LKZA 2YVSA 4MIWA 4OZNA 2KI2A 3PFOA 2HBYB 4K59A 2PO4A 2AX0A 2Z2LA 3M2UA 4NLWA 1FKPA 3LGHA 1AA1B 3D1HA 5KFWA 5ITHA 3FSYA 5D0RA 4I7FB 1DAXA 1M1GA 1MN7A 4O44A 2UUWA 4X4RA 4YDDB 2VA3A 4LIRA 3ZZPA 3BBFA 4ZCIA 1WC3A 1FA0A 2G13A 4NZ7A 2DR8A 2ZWPA 5DZ6A 3ZFVA 3H20A 3V6DA 1VGYA 3ETMA 4Z37A 4LF5F 1DHMA 4FYDA 2PMZD 5A0YA 4EZ9A 1NUEA 5CCLA 4F04B 2X7IA 2HS0A 3LF0A 4P10A 2X1GA 1WG5A 3IG1A 4PG8A 1D8ZA 2AGOA 2XO7A 2YPZA 3FKBA 5DDQC 3TEGA 3WIVA 3I55S 3OL8A 3R5GA 4U7UK 3GV5B 3WZ0A 5B0FA 3US5A 4NEYA 2RUSA 4YN3B 2GC8A 3O1LA 2PDAA 3CJKA 4J91A 5IC4B 4PWUA 4ZIVA 5HAOA 1TMMA 4Q45A 2KM8C 2MY7A 3PYFA 4RR5A 2DPIA 5HLFA 4YHHJ 4WPAA 3KYLA 5K8PA 1LOUA 1UZDA 4AL5A 1AYEA 5E3CA 2FY8A 2XS7A 2H3EB 5F9NA 1FWKA 4NCGA 4IO9Q 2EK6A 2HWIA 4PEOA 1DZ5A 1YJNS 1NDKA 2OSQA 3K59A 1SUQB 2NQPA 1Q7YT 1HWKA 1RBOB 4ZVUB 2HBZB 2UVWA 5KFEA 4DSIA 3T5KA 2FZCB 2YXLA 3E01B 3OVAA 4I2PB 3FFIA 3AJDA 4LF7F 1OY9A 3GV8B 4Z2XA 2H9ZA 4LF9F 4ZVGA 4DPTA 2M70A 3DRPA 4LF8F 3MM8A 2EWHA 4ZP7A 4USMA 3ZTRA 2DNGA 1HNXJ 4TKTA 3PX6A 3JSYA 4DWIA 2OUGA 4ZIWA 2M3DA 4WK1A 2H48B 2GQCA 2OMOA 2U1AA 3ADAC 1SKSA 3F73A 2J0QD 4EFAC 2RIJA 4G1QB 2W7AA 3EX7B 5ETSA 3NCPA 3L3CA 4RWXA 4CO3A 2UXDF 1G7CB 2J76E 1HD0A 3IP0A 4OJHA 1U6ZA 2Y0SD 3UCZP 3BSOA 4DZ6A 1RU2A 3NGKA 2R2TA 3P45B 2PA8D 2O1PA 3M1VA 4CO4A 1NK0A 5LSLA 1U8WA 1C1CA 3NGSA 5DJBA 3DKDA 1SC4B 3D0IE 4X4QA 1RP5A 1Q53A 3G86A 5I3QA 2IVYA 2LXFA 3RW6A 3PX4A 2OHDA 2K3KA 2HFSA 5D0GA 1JMTA 1GFWB 4B3OA 3AQOA 1OYDA 2OLWA 2F40A 3TQ1A 5J1EB 1RACB 2LEAA 2K8GA 4KPCA 2J9CA 2AJ2A 1HQ2A 4O3SA 2CYYA 3GYNA 1REVA 1B0PA 1EARA 4ZPCA 2KFYA 3EDQB 3DLKB 3M2RB 4CLKA 3OFGA 1ZAVA 2CQIA 4LSNA 2BJ8A 1PSDA 1WSVA 4NASA 3UD4P 4M63A 3J7A1 1QTMA 2R7SA 2N3OA 2QT7A 5K5MA 1HNVA 5G0RB 3KLFB 3W8PA 1P27B 2CNNB 3D6TB 3HKZD 2C1EB 2CQPA 3JTNA 4CT9A 2C28A 1U02A 2C3PA 3W1YC 1U1NA 4AL6A 3DOKA 5HJXA 1S6OA 2V6AA 5F3TA 3QRRA 1JLGA 4RU2A 3V81B 3AOCA 3H2VE 3M4XA 3H25A 1Q79A 1F0XA 2CDQA 1SIWB 4NLGA 3EZUA 4Y28C 2E5LF 4DEZA 2QLWA 3OVSA 3TUPA 1S1XA 4CH7A 1I5OB 2MKHA 5KFCA 3LP0A 1F2GA 4N5SA 3OV7A 5F41A 2FJBB 2WAQD 2EEYA 2MDAA 2LECA 1JJ2R 4EGLA 2PA3A 4J9RA 3KOAA 1OO0B 4DR2J 1TKZB 1N34F 5DQHA 1M5OC 3J7Z5 3HJVA 3DOLB 3QFHA 3OQ2A 4DV5F 1S9EA 4DL2A 5DGAA 3BSNA 2BJDA 2YNFB 5ADZA 1FKOB 2CQ0A 5KG4A 1VQ7S 5M2UA 1UKUA 2J8SA 3CJ5A 4I6YA 1G1XA 4YB7A 1UWBA 2HK2A 5CZVA 4BWMA 4KGZB 4OLPA 1TR0A 3O44A 1NK9A 5GVQA 5EHHA 1KQKA 1PO6A 2HEKA 5F8IA 3M9MB 2AU0A 2VPYB 4DPOA 2MHNA 1MWQA 5AXKA 2AEFA 4U7CA 2UVRA 4YMEA 1AROP 3BF4A 3R27A 2CQHA 3PR4A 2XO6A 2GFFA 3T1YF 4PYDA 1Q86T 5A8RA 2DGXA 2HVEA 3CDEA 1QLNA 5F8NA 4DUYJ 3MAAA 4LFBF 1KS2A 5LMNF 4C98A 4QWEA 2B43A 4RO0A 2DR5A 2HVDA 2C2KB 4GMKA 3DM2A 4NCAA 2FHJD 2QFJA 4WP8A 1VQSA 1IBLJ 4CO1A 1SH3A 2EFNA 5F8LA 2VODA 1CBKA 3QRPA 3I0SA 3NMRA 2PN6A 2J6SA 1YIJS 3GSDA 2CZ4A 3A12A 1IKXB 2KHDA 4ECQA 1YRXA 2ROPA 1NKBA 1S48A 1WF2A 3KXDA 4HACB 4B3MJ 4QIEA 5HANA 3Q8RB 1RHKB 1C0UB 3MR7A 1WSRA 1FO1A 1FDAA 2D3UA 4H4KC 3X1LB 4M5LA 1T9XA 4JI8J 2PEBA 4L74A 1Y5LB 3MTKA 1NU4A 3D1OA 2KU7A 3A13A 2J9EA 5J2QB 4NLQA 2RD5C 2DGTA 4DSEA 2BJ1A 4DOZA 2E1RA 3C16A 5C7PA 4OI6A 4QOTA 4JI4J 4NRUA 4QIFA 3PCOB 5A6WA 1S9GB 1JNRB 1TFWA 1X60A 4N41A 1N4LA 3HHNB 2YPYA 2CPDA 3OVBA 2KJVA 1N5YB 2NXNA 2XI2A 3GFZA 2R7OA 4DUTA 5C25B 3FZ2A 1N56A 4UQTA 2XYHB 2HSEB 1J27A 4QBUA 1TTHB 1S4EA 2M8HA 3PJ9A 1IBKJ 1U2FA 5CH7B 3KJVA 2H5IB 5KFIA 2Q1LA 3TR5A 4QWCA 1ITPA 1U24A 4KHPF 3A3NB 1TVRB 4IRKA 4FF1A 4DR5J 4B3RF 1HBOA 2ZH8A 2FJVA 3W61A 2WZ1A 4M5MA 4C8NA 3JAMU 1KTVA 1VHIA 4C11B 2DNRA 3ENAA 4JI0J 1DTTB 1DFDA 3R1HA 3RG6A 1IKWB 1D9AA 2IRXA 2CXEA 2GMJA 2HPUA 1HNIA 5KG3A 1BQMA 1PC5A 1WUUA 2AGPA 1HMVA 4GC7A 2GVZA 4JI1F 3F56A 2UUTA 3D3CJ 4X2BA 2XMWA 2D69A 2DR9A 4PG5A 4M5DA 4K50A 5LM7E 4RW9A 2GZOA 3H4DA 4LBIA 5E7OB 5FJ4A 3S6EA 1CULA 4FYVB 1MN9A 3GIKA 3DGPA 4PPZA 1BE4A 2ILZA 1K1QA 3R1LA 2V2VA 5A8KB 3RR8A 2A18A 3N4WA 2ACYA 3HPOA 2ZE2A 4DPWA 1RJJA 2VJUA 3K5OA 2NXEA 2FVQA 4MK9A 2MKIA 4KGKA 1N32F 3LP1A 4KBIA 2QA2A 2VC1A 3K5PA 1T3NA 4ECZA 1SKRA 1HIYA 3MI7X 4HT7A 3D4JA 2V2KA 1JLFB 3PRVA 5KT7A 3TQEA 1PAEX 4BDPA 2HFVA 2PE8A 4IKAA 2HVHA 3TNVA 2Z2YB 1S97A 4CTAA 2C2MB 4UY8T 2JL9A 4H4OB 3DU5A 1NMEB 3M30B 3Q86A 5DQIA 4KV8A 2YNIA 4A8KA 4WE1A 2GQ2A 2Y1IA 1JLEB 2IBOA 2F4FA 3OUYA 1RQ0A 2DGQA 3O6QA 3NOCA 2OPQB 1RI7A 4P7VA 2QMXA 1MMLA 4PG6A 3FDSA 4CO0A 5B0BA 1NSQA 1CLFA 3RAXA 1SV5B 2MQPA 4LR9A 2W8KA 1NEEA 1GNKA 2RQMA 2OEKA 3MEEB 3I5CA 1J5OA 2IMWP 2HGMA 1AFJA 4DF8A 2XQCA 1XMQF 3D0GE 1NKEA 4ED6A 2DJWA 2CDRB 4X62J 4KO0A 2P9CA 2CG4A 2PSZA 4NL5A 4R5PB 4LRDA 1CJUB 3B8HA 1YDLA 2AGQA 2RNEA 4M5NA 1VLOA 2VDHA 1WF1A 4ANEA 5L1KA 1GMUA 4TU7A 4GKKJ 4OYMA 5J1PA 1MROA 4DPUA 2HAIA 1FRIA 1RT1A 4GO7X 3PR5B 2QLJB 4QJVA 5BYRA 1MU2B 3HD2A 1IQTA 3R5AA 3K5NA 3ISZA 3OW2R 4I1TA 4J9MA 2C2RA 3B6BA 2KXNB 4Q2MA 1UA1A 4OV1A 3GG0A 3FUYA 1TL1A 2AT1B 5CYJA 1O6XA 1QAXA 1KONA 2XYGB 4P74A 1HBNB 2CG8A 5KFVA 4XAKA 1SPBP 4ECTA 5I3PA 4IFYA 4KT0C 2HHHJ 3S7RA 4DR3J 2A3JA 2JH3A 2JVOA 1RCXB 1TL3A 2L9DA 2EFOA 5KT3A 1UP1A 3EVWA 2HW3A 2FPHX 4CO2A 1UEKA 2R4FA 4ENOA 3QT5A 2GAGC 2W7PA 4YHHF 1S0VA 5LXYA 2KO1A 4IRDA 3TARA 1CJKA 5IC6B 2QO3A 2SXLA 3VAFA 2CPXA 2AMCB 5FLXU 3DU6A 2B5JB 2IRYA 4ZVSB 4QZVB 4ZOSA 2ZH3A 4CIOA 1SH2A 1WKKA 2MGZB 5M2RA 5EWGA 5FD1A 4ECWA 3WQPA 5DO2A 4LMZA 1JLQB 2CQDA 4LSZB 1KN6A 2J0XA 1Y3JA 3L7OA 1U2CA 1RHJB 2YX1A 3EPGA 4I0WA 2KXHA 1VQLS 1U48A 5JUMA 2HS3A 3QJPA 4U9RA 3PNIA 1WD6A 3HVRA 5GAGU 3CCLS 1S6PB 2FJWA 1HHSA 1NJYA 4OHWA 1IBMJ 3PHEA 3QGPA 5ETVA 4ID8A 1RU1A 2RS2A 5DQGA 5D0EA 1KLMA 4NI2B 3CVKA 4CYUA 3BH6B 2K2PA 1SQGA 3QMQA 4ICLB 1MSWD 3OSPA 3NCRA 2LA6A 4HI1A 2WB1D 3U27A 3DRXA 3AXKA 3TRGA 4AT1B 3PW0A 4OX7A 3IRWP 3PV8A 3UI3A 3TUZC 3HJFA 4IR1A 1Q78A 4P6QA 2NZCA 3GFXA 2VONA 3OPKA 2GVDA 2ZH9A 4A47A 1M90T 3K17A 4G65A 2V63A 5A2QU 2JEJA 3NWRA 1P6TA 1IM6A 2QYCA 4YQWA 1KVIA 2XSFA 3ET6A 4Y0FA 3IXQA 3V6DB 3W3SA 3QIPB 3HXMA 3EGVA 1R0AB 3MAQA 1WI6A 2IDEA 2HQDA 2XMVA 4IO1A 3EUNA 3FCVA 3E3XA 1N0VC 5DDPC 2RU3A 1RTHA 1U6FA 5CYMA 2CWKA 5IFMA 2FUG9 1S6UA 4FVMA 4IOAQ 4W4MA 3P3DA 1VQKS 1FJCA 2DNQA 2JC1A 3MMBB 4O3NA 3UW1A 2LU1A 4WXOA 3QNWB 1CG2A 3PW5A 1R6VA 2KG1A 1XWLA 2DNKA 5L1IA 5I42A 1SB6A 3B82A 3CDAA 2BE2A 4DR4J 4HHHA 1U8SA 2YH1A 2ZWOA 5H9EJ 2KRRA 3VQSA 2F4VJ 2N7YA 1W7WA 2XMJA 4QPTA 2Y3YA 4M8LA 1LWFB 4KRWA 3L9ZA 2YKMB 4DQSA 4DG1A 3VQTA 3MPDA 1P9YA 2MSTA 4X4OA 2IIHA 4KPYA 1U45A 1ZA1B 1UFWA 3WC2A 3UDLA 2E5JA 2N7CA 2X1AA 5CD4A 2XZTB 3MM9B 2KFNA 2NYIA 1TK5A 1M5VC 3AY0A 4PRFA 3MPYA 3KDOA 3CCWA 4CH1A 4J9OA 1RLDA 2HNYA 3LAMA 2WONB 2V4RA 4AXJA 4PQUB 2HHQA 2OTLS 2LU2A 3T5JA 5HN0A 4EUVA 4OYOA 4WFBQ 2CJYB 1QSYA 3DLBA 3EWGA 4LBHA 5L46A 1PILA 4DR2F 4KHMA 2E1AA 4J9KA 2Z56B 1Y10A 1I94J 2R7UA 4ZVRB 5C24A 2L9WA 4USUA 4CLPA 5HQMA 1F2HA 1NK4A 4OHZA 3C2PA 2OPRA 4K4WA 3UCUP 3MPWA 4KGMA 2ALZA 4YB6A 3SCJE 2G2OA 1S59A 4PAAA 2BE9B 4MYTA 3WBZA 2FGOA 4DR6J 4KKOA 3HHLA 2C3UA 4KH0B 3BO2A 2W8LA 4C97A 3MM7B 2B6AA 4FF3A 2LFVA 3NNAA 4MYUA 3P8BB 3ITHB 4FZVA 2UUAJ 2E9RX 3IS9A 1XJWB 1TK0A 4DUYF 1WNEA 1WTFA 3MD1A 4LF1A 1SH0A 1ROFA 2H4YB 1TKXA 1IBLF 5LL6d 1QTNB 5E33A 4YY3F 1FESA 2UXCJ 5A8WB 1ZOTA 4FF2A 4JOUA 1ZAXA 2GA7A 1IKYA 5T7LA 3MR5A 4PUOA 4C8MA 3TUIC 4B3MF 3BO3A 3ULHA 1LW2B 2F3JA 2CA9A 2YWEA 4H4MA 3C15A 3C14B 1REGX 3UCGA 5C2GA 1TV6A 2AZ3A 3QJJA 1KHVA 2YNHA 2EVZA 4RNNA 3PVXA 2XHCA 4UOHA 3DI6A 3HFVA 1T05B 2IMOA 3TEHB 2KRBA 2YKNA 2UXBF 4J37A 2VICA 2A6OA 3KK1B 3AHPA 4ED5A 4PWWA 1XEZA 5DM7Q 4LIWA 1JLGB 4JI4F 1U2RA 3GU0A 1S12A 3W5ZA 2YX4A 3O5TB 3GMGA 4WF9Q 1LW0A 3HVAA 1EB0A 3J7ZT 1B3TA 2CZVC 4WK3A 4O4RA 2QL9B 2NXCA 3QAEA 4ATNA 2K1RA 4J5OA 1N48A 3BN7A 3LP0B 3QWUA 2CPEA 3CCTA 2KJWA 1HD1A 3HHKA 1CQMA 1H2UX 4ED0A 4DFJA 3ISNC 3QIDA 5C5JA 1JJCB 5L9XA 4ECSA 5H9FJ 4DR5F 4OYXA 2VBYA 3GYGA 2CJQA 2L41A 2G1DA 3KJQB 1NRKA 3HHEA 1FTRA 3HHDA 4JI0F 2PFFB 2QE5A 3VGSA 4L72B 3TZYA 1DJ0A 4J7CA 2DGWA 1B70B 4PWDB 3D54A 1FNMA 2OPSA 1WTBA 3FK4A 4HL9A 4ED3A 3KFWX 2OEJA 4YOEA 3EVOA 4RW6A 2O3DA 3MEGA 3DLGA 4V1Ak 2DHSA 1VCTA 5B09A 1KSPA 2HURA 5D4LA 4A8WA 5DRKA 3SQGB 1H72C 2VBZA 4A8QA 1SJ1A 1H7XA 4C9DA 2O5DA 4JV1A 3TW0A 1FFWB 4HDGA 2NXJA 2ZBQA 4DFMA 2R2SA 1IKVB 1I1GA 2H1YA 5KFRA 1B99A 1RAOA 1XR6A 2J9DA 1N36F 1UJ4A 4RX6A 3ZZZA 4FKYA 3NEKA 1RTJA 4Y3CA 2EBEA 3CIZA 4OX9F 3IBFB 5HBMA 1D9DA 2BOAA 3LP2B 2DIUA 1WHYA 1W25A 3H40A 1C1BA 3HK2A 2FLOA 1NNDA 3WIUA 2NZ4A 4ZJLA 4XO0A 3OHBA 1ZZFA 1JB0C 4ZPVR 4LFCJ 3QO9B 4WBFA 4ECRA 3VAIA 4DV6J 3PTWA 4N7TA 4ZLLA 3N01A 4F0MA 5MAOA 3UFCX 1RT4B 3J81Y 2ZUAA 4JI6J 4F3QA 2B9EA 4ID5B 1EP4B 1RTZA 3MCSA 3KLGB 2VH7A 2KB2A 1SJ3P 1SL0A 2FJEB 4X62F 4IG3B 2M0GB 3RB3A 3T1AA 3NG8A 3P6YC 1ZZNA 3NKYA 3L4BC 2YWWA 5G4DA 5KFOA 1HQEB 5ETNA 3MCOA 3MR3A 4N8NA 1FJEB 2YKPA 5HROB 2GO8A 4GKKF 3OR2A 1UJ6A 2MLYA 2OELA 1L5UA 1FTCA 2MQLA 2C2OB 2DRBA 1LWCA 3MPVA 3PO4A 1HBOB 1RZMA 1NB2A 1UVNA 3PO5A 2JZ5A 3KHRA 2VHGA 2C42A 2DY1A 4UOCA 4Q0BB 3PRDA 5J2PB 2HAFA 1WKJA 1WDTA 4QWBA 1YTYA 1UZHA 1VFJA 3JTOA 1WKLA 2HHHF 3W66A 4DR3F 2UU9J 1NHVA 5I4MA 4CH0S 2GX8A 3L7UA 4K0KJ 5K8MA 4CM2A 4DV7F 3GJRB 2ZKTA 2RT3A 4K7QA 4OYBA 3RBDA 4ZPWR 1MLAA 3Q2SC 3CDBA 3H42A 1L3UA 4IOCQ 4URQU 3H59A 3BGRA 2FYXA 4GO5X 4RW7B 2BYCA 1YWXA 3RBZA 1VBXA 3MUMP 2FVSA 1F9EB 2BJEA 3CCVS 2QSFA 2J0WA 2QSWA 1DTQA 2ADCA 4CLZA 3TAQA 2MKJA 2DXFA 4IH6A 1AXQA 2XC9A 1YVFA 4USKA 1C0TA 4J9VA 1R7IA 4JI2J 4LVOP 1PKUA 3MM5B 1S0NA 2HNZB 5B0DA 1BC6A 1FD2A 1XNQJ 5KFBA 1NM2A 1YX2A 2HIQA 4Q2LA 4OJ1A 3M32B 4DCOB 1DLOA 2VPZB 4TY8A 2H5JB 5EWEA 3BPDA 2BJ9A 3DOMA 4XIUA 2RF2B 2F9DA 1IBMF 3M6WA 3VVTA 2ZC4A 3M2VB 2C22A 3KMQA 3KLVA 3DC2A 3OL6A 4RKUC 3VZHA 3PW2A 1FK9A 3TYTA 2Z57B 5CXTA 4AQYJ 1OJ4A 4KYZA 4PG4A 1TKTA 1HWLA 1F5AA 4CRJA 4LQ3A 3NCQA 5EX3A 1YJ7A 2UV8G 5M2PA 3MCMA 3PHTA 4HT5A 3VALA 3A3OB 3QQCD 2P5VA 2VC0A 1N54B 1T03B 1IWGA 1GXUA 5KFDA 4YFUA 4IG0A 2KN4A 3CCES 4WCEQ 4TNOA 1R8PA 5SZTA 2F63A 3SSRA 3HFZB 3NRBA 1HFEL 2DXDA 2BR0A 4N8OA 4R8UB 4UZBA 1X4AA 4WKYA 1X0PA 1H7WA 4AFFA 1S4FA 4DCPB 1FRHA 4I4BA 4ZVOB 4WFYA 2Z4PA 2LXUA 2BABA 2CJBA 4JUZA 3K8VA 4B9VA 1HPZA 2HBQB 4ZN3A 1GTEA 1SL1A 1R8HA 1WOPA 3IGVA 1FDNA 3JSRA 1RT7B 1BLUA 1TFYA 4KTQA 3PW7A 2XS2A 4Q7AA 2XSJA 1VI7A 3DRSB 2R8GA 1S6QB 5LJ3Y 1UFLA 1P8GA 3L09A 3HI9A 4L3KA 4MIAA 1RCOB 2ZD1A 2ZHAA 2HIYA 4FP9A 3I0RA 5IT9U 1UPMB 1RT2B 4KC5A 3MEDA 2XS5A 2V50A 4AD6A 3DNCA 1KOHA 3JSMA 4M95A 3R2DJ 1WC0A 4NXMJ 2FC8A 3HSGA 4LF4F 3NY0A 4NYZA 2F4VF 3BB5A 3EMTA 2UUCJ 4PQAA 3CSKA 1ZTTA 4RW4B 3OJSA 4LVNP 1S10A 3ELHA 2ZNZA 1X0FA 1FRKA 4G1PA 5F8HA 4BC7A 2LDIA 3RU0A 2BQRA 4RNFA 2YNGA 4Y2CA 5JJBA 2OKQA 4WIIA 2HVIA 1CJTA 3FGVA 3NBPB 1VOMA 3IR7B 1X7VA 1NDCA 1O51A 2WTFA 3ZZOA 4KH1B 2GW8A 3FCWA 4KE5A 5D3GA 3JQJA 5K14A 2BW7A 2MY8A 2WRMA 2W9CA 2QEXS 4GVBA 3PIOQ 2OPPB 4JV5J 3ICLA 3R8YA 4OZLA 5HQ8A 1KNZA 3M8PB 2OFGX 1R6YA 1UVJA 1JNZB 1J5EJ 2DCUB 5D0HA 1MG7A 2IVFB 1I94F 3G96A 3CCRS 3W2VA 2GQQA 2C3OA 4ZLPA 2FHJA 1PYSB 4AUKA 1FI4A 3FRYA 1T9VA 4U6PA 1CS4A 1JLAB 3Q2TC 5B0EA 4WIQA 3GFYA 1UAWA 4NLYA 4Y2KA 1Y3KA 1YGYA 2HNDA 1XTZA 3G6VA 1YBTA 1T9TA 1UJ5A 2QC3A 4NRTA 4DR6F 4DDFA 1TL7B 4WYLA 3OR1B 5IOLA 7FDRA 4ZP8A 4DFKA 2D3ZA 2M52A 1VIOA 2DGUA 1RAAB 2ZEJA 1HBUA 1VRTA 2WSCC 2HGNA 2BM0A 4DL7A 3OFHA 4OZ1A 3WDOA 2VG6A 4NLPA 3UR3C 2W25A 3D0HE 5HMYA 5ETPA 4F3OA 2UUAF 1UEVA 4DFPA 3KUGA 4F2RA 1UVMA 5FDLA 4NX9A 1N6QB 2IC3A 4HR2A 2DB1A 4Y6IA 2NSCA 3MTJA 1OIAA 4IQMA 4WFNQ 2CZ9A 1VYAA 1NJZA 1SIZA 3W5YA 3OXLA 1V9OA 1VC5A 2GO9A 4IDKB 4YEAA 2UXCF 4NZ6A 1A7GE 4A8YA 4KY3A 2Q3PA 2CPHA 4G3IA 1RTIA 1FE0A 1LWXA 5JVHQ 1N5QA 1RDRA 1UVKA 3V4IB 2DNZA 1ZM4A 3OD2A 4JI5J 5KFYA 2HQ3A 4DUZJ 1X9MA 2G4BA 2LQ9A 1Y00A 1Q5VA 5HO4A 3EXCX 1EKSA 2IBKA 4IFVB 1YJRA 2LQ5A 2YQ3A 1HBMA 1M5KC 2ZM6J 1VQ4S 2XM3A 3NAHA 2V2QA 2B3TB 1HWJA 3N6MA 3CTRA 1VR6A 2HRUA 3WX8A 4JBCA 3W9IA 4CDIA 2QGFB 2XHWA 5KG6A 4LFAJ 5F8JA 3MMAB 4Q44A 1FJGJ 2IFXA 4E8UA 4CZCA 1PJ5A 2H5EA 3IA0A 4A8OA 2YBVA 1RT5A 5DG9A 1VQ6S 4O0NA 3UVJB 3BO4A 2AJ4A 4JYAF 4TN2A 4A48A 1YJWS 3LWLA 4FYWB 4YR2A 3G2XA 2HLTA 4GRSA 4MKYA 3KLHA 2F9JA 3CD7A 3C6UB 2F1FA 1VRUB 3TA0A 2V8DA 4ELVA 1RTDA 4YDXA 4LRAA 3DRRA 1HYSA 1M5HA 3BQ2A 2EPIA 3KJNB 1YZ6A 3KK3B 2C3YA 1FD8A 3DMJB 1I6JA 2QJ3A 1YJTA 3J81j 1OS5A 3MMCB 2MQMA 3GYXB 4CLTA 2KZMA 5KFKA 3BKFA 4C3LA 1XR5A 2HGLA 5E2QA 1R8AA 1E6VB 3D2WA 4K4VA 3THTA 5I3UA 2PI4A 4DX8H 2NSBA 3I4PA 4QYZJ 3I5AA 3QLHA 3R5BA 1IR0A 3M8WA 4KGXB 1AZSA 1GMWD 1IBCB 5IQQA 3W60A 2VG7A 2Z30B 4ETZA 3QWPA 1S1VB 1J2VA 3RRHA 1U4BA 4DN9A 2NLWA 1RWPB 4OYAA 3D3BJ 2MLZA 2C2ZB 1XMBA 2CADA 1LFPA 4P71A 5EUHA 1X5OA 1F3VA 1M5PC 4I64A 3UN2A 4N56A 2C3MA 4A8XA 3C15B 1S1TB 2AF6A 5IM0A 2XLKA 2DCLA 1RT6B 2BRKA 3P4UB 3BEGB 4FF4A 2POKA 1NPRA 2HLUA 2R42A 4I2QB 1X5SA 3LUYA 3KWMA 3PG9A 3NWGA 3R5CA 1RA7A 4NE9C 2G0IA 1M1KT 1TKDA 3SQOP 2YKNB 4JI6F 3TAPA 1Q4RA 1C4CA 4RWWA 5BR8F 1S7HA 4PXDA 1CSJA 3NGTA 2AEJA 2QLXA 3CJ3A 4WTOB 2KTQA 1A0OB 3CO0P 3QZ8A 4DX5A 3LGMA 2AQ4A 4W90B 3AJ2A 2CKWA 4EBDA 4GVLA 1C2PA 4CI0B 1JKHB 3X3UA 2PD1A 2J8AA 4F67A 4ZHRA 1LXJA 2E5IA 3H90A 2W2OP 3UN3A 2ZH2A 3KG1A 5ETOA 1UEUA 4RUAA 3G82A 4B3TJ 1ZYQA 1APSA 3FBBA 4CLSA 1RWXB 3SSQA 4Y65A 2QLFB 4TYBA 3J7AN 5C42A 3V4MA 4CCHA 1OY6A 5ETTA 2RKIB 1PC4A 2HFNA 3T5HA 3KK2A 2BOPA 1NH7A 2KT3A 2MKKA 2WOMB 1FDDA 2UU9F 1Q5YA 2MSSA 2QIFA 4PXEA 4RUHA 4DZDA 2W2QP 1JK9B 1U0HA 5AJ3J 1UETA 3W2WB 4ERDA 2DGOA 3HVWA 5HP1B 3SDEB 1T94A 4I7FA 2YTCA 4RU9A 4C8LA 3HDSA 1QSLA 3TANA 2E7XA 2LVWA 3CIMA 2LXIA 1TZ0A 4LR8A 1IJFB 4DCJB 3OHAA 2HMIB 3D66A 1RE1B 9RUBA 3GIIA 3TJ8A 3AH6A 2CUYA 1VDHA 3BQ0A 2KL8A 3LGNA 5A76A 4ZK7M 3FJ2A 3NGRA 1SJ4P 3I9ZA 1XNRJ 1RT3B 2VDIA 5E41A 2VBWA 4NOHA 4JI2F 2CJAA 3PZPA 3MM6B 4RBUA 2DT9A 2CVEA 1O8BA 1EETB 2G2YA 3M8RA 2WVBA 2ZBRA 4MH8A 1XNQF 3QRQA 3K57A 4MKAA 3LPEA 4MFBB 2XWYA 2WVCA 2ZDOA 3CJQA 4NZ0A 3W8GA 3KUHA 4FYXB 7AT1B 2BXJA 1FDBA 1R8BA 2V8PA 3NNCA 4OLOA 2JSXA 4UUXA 4DL0C 1HHTP 3DLHA 2VB6A 2G0CA 4FDFA 4O23A 1IXKA 1EQ0A 1RBAA 3ZTPA 1QUVA 2X3GA 4DS4A 1U25A 3RW7A 4LBPA 1JIHA 3N5BA 3BS9A 3R9LA 3AOAA 4AQYF 2IAJB 2HQCA 2CPYA 2HFZA 2EFGA 4TQSA 3VAMA 4XK8C 2V69A 2CAJA 2KG0A 1D9FA 4MK8A 1HW9A 2BQ3A 1IJEB 3TZWA 1SUQA 4RPFA 3C6TB 2B8PA 3MR2A 3I82A 3PX0A 4EYHB 2XWXA 5KFTA 4F02A 4R0JA 4X64J 3E01A 4I2PA 2FD2A 3BREA 2OJ3A 1X4GA 1IVZA 3JYTB 3N9UC 1T0TV 2FZGB 1NZ8A 1Z2LA 2UP1A 3IC1A 2D9OA 3MFHA 3CD6S 1WC5A 3IBWA 2RMLA 2XI3A 1HQUB 2D1CA 2MYFA 3B4MA 2ZOMA 2JLGA 2FY1A 4USHA 1UWAA 3PJXA 4XPCA 6FDRA 3IGNA 1L3VA 4G1QA 3WC0A 4L6V3 2XZDB 1XK8A 3QGIA 4NLVA 1QE1B 2GMLA 3POTB 8RUCA 1FFGB 1U09A 3SI8A 4NXMF 3CJ4A 2YWHA 5F0UA 3RB4A 2HHTA 4C3KA 2UUCF 2DO0A 2ROEA 4Z7CA 1N88A 3VGUA 1BQNB 3LO3A 4ZKAA 4X66J 2A1BA 5B0GA 5EX0A 2RRBA 3CCJS 5DM6Q 5CQGA 3I9V9 4LF5J 3W9HA 5KFGA 2EKYA 1B0VA 1BXNA 2MZTA 5CA5A 1WG1A 5J1EA 2VG5B 3MR6A 2Y8WA 1RWWB 3KLEB 4TXSA 3FEYB 2NUHA 4DU8A 2DR6A 3TVZA 1X4DA 4JV5F 4EBEA 1RKIA 4RLEA 4ZN1A 1DLOB 3DLKA 3E2EA 3HHLC 3M2RA 4M94A 4Q8FA 4MKBA 1J5EF 1LV5A 2W1BA 2IHR1 2E7WA 2NPFA 1EKRA 2AYMA 1G4CA 3QSIA 2DPJA 4WP9A 5G0RA 3KLFA 1ZPWX 2MB0B 3GONA 3J80U 3AJ1A 4TVAB 1S1WB 1MW7A 4PYAA 2MKYA 3FEXB 3F0NA 1TKTB 2ZHBA 4NPOA 4URGA 5B0AA 3CJ2A 2Q66A 1FFSB 3W9JA 1ZAWA 2XLJA 1T3OA 3V81A 3O3LA 4OYIA 1M1HA 1S0OA 4RJVA 1CVJA 3F41A 1GEHA 4QQBA 5E0OA 5B7WA 2XMTA 2I2YA 1TUGB 5D15A 3OTCA 4ED8A 3NAIA 3A8EA 3J81U 3DHXA 3H2UB 2Z8QA 2XBPA 5DS7A 1CJVB 4UTGA 1QAYA 1HI0P 4QWAA 4V19J 3Q8YA 1U47A 2OTJS 4IYQA 4OHVA 1TKZA 4NLXA 1VBYA 1Q95G 3R7BB 3DOLA 5HJYA 2M5YA 4ZVEA 1PBAA 3Q89A 5DZ7A 2YWFA 3FNNA 1K8AT 2YNFA 2ZD1B 1FKOA 5HI7A 4YR3A 3DDIA 5J1NA 4BHQA 4MK7A 3K7RA 1GK8A 2Z0GA 2I5JB 4DN0A 4WZMA 1JLBB 1R3NA 2XMUA 3NGDA 2AJQA 1XERA 1SQEA 2DNLA 2F8EX 1D8YA 2CJKA 4PABA 5E3QA 1H73A 1MWYA 4ECYA 3LALA 4W92B 4WKRA 4JI5F 2WW4A 2HHUA 1UFKA 2DD8S 4DUZF 3BM7A 1N8RT 4USWA 2KZZA 4F0KA 1FXDA 1VQNS 2NPIA 3TJ9A 2QYGA 2XGPA 1OQ6A 1H2VZ 4WFXA 3VAGA 2GS8A 3UDVA 2F8MA 1RK8A 2RILA 2LA4A 2FTRA 2VOOA 4ER8A 1UVIA 1H2TZ 3RRGA 3GJSB 1OY8A 3PFEA 4LFAF 3HSZA 2W7OA 4DV0J 3PW4A 2AP6A 4ZP6A 2HBRB 1C4AA 1FJGF 4TLRA 1LWEB 5H1SV 3HO1A 1IKXA 3Q8VA 4OYWA 3J7YI 1H38A 1HI1A 2E7VA 4HACA 3A1YG 2GIRA 2IVMA 2R2RA 3UNYA 4XDDA 4KR0B 2MZ1A 2GCFA 4DV3J 2JEIA 1C0UA 4I68A 2ZZMA 2VD3A 4KGVB 5E3PA 5GAHI 5AE1A 3NP5A 4OYZA 1VC0A 2HKEA 2X1BA 2VKZG 2OD4A 2JDJA 4OJ3A 1FKAF 3G9CA 1KQSR 5J2QA 2A6MA 2I8EA 2J5AA 1TU0B 2AJFE 3TZXA 3QT8A 2ZUGA 2ASYA 3BQ1A 3MECB 3U7JA 1S9GA 4ALZA 2X3DA 3UE2A 3IFEA 1N5YA 2VBXA 3WX4A 3HSJA 3D6MB 4ZVFA 5C25A 2E5LJ 4F8RA 2AX1A 4HLBA 2O67A 4OI3A 1YHQS 4NEZA 2JHEA 3U1LA 1YQHA 1AB8A 3LTOA 1H0HB 4H54A 3T9ZA 4TY9A 5GAEI 1VJWA 3FBEA 4C3MA 2B7CB 1WF0A 3BPSP 3LOUA 2RH3A 2EI5A 4KHRA 2E66A 1T9WA 2RVJA 5LMUJ 1TVRA 3PYGA 2G9OA 4RZRA 1Z2ZA 3EGNA 3UN5A 5F8MA 1HWIA 2EC0A 4DV5J 2B4VA 4JP8A 4C11A 2V9KA 2Y9HA 1NK7A 2RQCA 1DTTA 4OHXA 4QR1A 1FXLA 1RXOB 1NXIA 1RBLA 1IKWA 5FLXY 1X4EA 2K06A 3G6XA 1TELA 2XMAA 4DL6A 1VQOS 2M9KA 3BN4A 4O4GB 3RBEA 1S76D 1HI8A 1JXLA 2ZJQQ 1UVLA 3J7YU 4JV2A 3BR9A 2KHCA 1FVSA 2J7UA 4I56A 5D4NA 2RHQB 4I6WA 2OAUA 5J2MB 1SKWA 3T1YJ 4LSLB 1BMQB 5A8KA 2NUUG 5GAHU 2XGQA 4QIVA 4J9QA 5D78A 3M8ZA 5J2NB 2Q6CA 3CWJA 3TX8A 2CPIA 3GCXP 3AB4B 1NLKL 2EKNA 3CW2C 1X4FA 1D0EA 4OI0A 3FQKA 3PIPQ 1FX4A 4QIGA 3QFWA 5L1JA 1V3ZA 2BZ2A 1JLFA 3KLIB 4NWBA 1CC8A 2QL7B 2UZAA 2D74B 4P2SA 2LQBA 4B3TF 4HH1A 4H4OA 3D7SB 3M30A 5KG0A 2E1PA 3GLJA 1HR0F 3AA8A 4HVZA 4ECVA 2V5HG 1JLEA 5C2CA 2OI2A 4ELUA 1WHWA 2GGPB 2KXFA 3TO8A 4X4VA 2OPQA 1CEZA 5GAEU 1G3OA 4GC6A 1QD1A 5DDOC 3I6PA 4X4UA 2V0NA 2ALYB 1ZBTA 3H0PA 1SV5A 3BKUA 4UY85 3KHGA 3DCAA 1NZAA 4B9LA 2ZNYA 2COLA 3SYZA 3MEEA 5ETQA 2XMMA 5AJ3F 3CJTA 2P9GA 4QR2A 3ZNJ1 4DLGA 5KFAA 2QA4G 4CQ1A 3U1NA 1YLXA 3K5LA 2AYEA 2UVVA 3H4BA 4KFBA 4DL5A 1VQ9S 3BDPA 1QDUB 2L9NA 4EK2A 3CE8A 4R5PA 3M8QB 1CJUA 3RB0A 1U1KA 4NLSA 1OYEA 4GKJJ 1NJIT 3W65A 1HHQA 3ILIA 2P9EA 2KH9A 1T9UA 3CEDA 4F25A 5GAGI 1D3WA 1S1UB 3VTIA 3GG1A 2VA2A 3ZZTA 1XNRF 2B56A 3DYAB 1MU2A 4B3RJ 5E3RA 1N33J 2ZH6A 2D7SA 2OSRA 4RL1A 1M0SA 3QJLA 4CLFA 1WORA 3BYPA 2CWXA 1VQYA 3G87A 2YKOA 4I6AA 4DS5A 1H6KX 1HBNA 1RWNB 1YK9A 2WBMA 1FRLA 5HQLA 4USJC 1N5SA 2P6TA 2BV3A 3TAMB 2B9WA 1TUWA 4F0HA 3OT9A 3D6FB 4LRBA 1LQ9A 2VOPA 3TUJC 5KAKA 4RNMA 3HULA 3VCDA 1WC4A 1YI2S 4WYWA 3DLLQ 1WACA 3TX0A 1CC7A 3N0VA 3CGIA 3DLEB 1VK3A 2W2MP 5LXRA 4K8RA 4PZVA 1UPPA 3IR6B 2B5JA 2WSEC 4Z7YA 2DVIA 5KOXA 4X4NA 3N28A 1JLCB 4NLUA 2MGZA 4EBCA 3BGFA 1NK6A 1WELA 4DI6A 4K5RA 3BYRA 3LH2S 1N32J 2HS4A 2DH7A 1JLQA 1X5PA 1JQGA 2FLNA 4X64F 3UNGC 2LQ8A 3D1QA 2C2NA 3H2LA 2B0GA 4Y00A 1JXVA 2WSFC 4F4AA 1RWMB 2HHVA 1PCAA 4OIXA 4DSJA 5KOWA 3AD8C 3T1HJ 3PXGa 1S6PA 4R25A 3GE9A 1RYRA 1V5VA 4ZVHA 3JS9A 5HK4A 1U49A 2HZAA 1RABB 4DSKA 2AZ1A 2MQ8A 1ZM2A 4NI2A 1S5ZA 3IRXB 4L76A 2BANB 3BBCA 4ICLA 1HNXF 2KDOA 2HRTA 2IJNA 3RYLA 2MZQA 5KT2A 2DO4A 3OLAA 1KBRA 2R3VA 4QW9A 2ZZNA 2LMIA 1U0HB 5AE3A 1XMQJ 1YSJA 2AJ0A 4ECXA 4CLWA 2VUGA 2XCPA 1F5BA 3VAHA 3I87A 4ZVTB 1KR4A 2I1RA 3ZTQA 3H5UA 3OFEA 1EZZB 5D8HB 1Y0HA 4JB8B 2ACMA 3M2UB 3VGTA 2U2FA 1FKPB 4AL7A 4X66F 3AODA 4B9UA 3QIPA 4O44B 1ZPVA 1RWOB 1R0AA 1U1MA 2EFVA 3FVYA 2I6WA 4C0BA 2H51B 1D1UA 2CIMA 1WEYA 4R0EA 1GH8A 5KG5A 2K3IA 2EG1A 6AT1B 2DGSA 2WCXA 5A0YB 5IT0A 3M7VA 5CYQA 1L3SA 2NREA 4KIAA 1U6BA 3MUTP 3DDNA 3IG1B 3MMBA 3GB0A 4Y2MA 5CABA 4FS2A 1HL6A 4OZ0A 3TVKA 2A0FB 4YB5A 3THPA 3VF0B 1KD1T 2FHMA 1T11A 5HVHA 3OTDA 3SSSA 2GAHC 2J7KA 4WFAQ 1ZTWA 3OXGA 3OTBA 1PAUB 1I3OB 1AUSL 3E51A 2N4CA 3PKYA 4NA2A 3CJKB 2HZVA 2V8VA 2DNMA 3THVA 3RBXA 1LWFA 3DXBA 2E44A 2YKMA 1G6BA 4P9SA 5HLFB 1KWMA 5H9EK 2GJFA 2ZHOA 2R8KA 1R89A 1ZM3A 2N3LA 5T41A 5KFQA 4C7QA 2MKSA 2IYIA 4C8YA 1U7LA 1U1QA 3MM9A 2MXYA 4NCGB 3V2UC 3Q0AA 4OYPA 4U7UD 1FE4A 1NHKL 1U1OA 3I32A 1SC3B 2WONA 4PQUA 2YKQA 3MD3A 3H98A 1W2IA 3EZOA 3FFIB 4X4SA 4HTJA 5CCMA 1X9WA 2OH2A 3D68A 3ZO7A 2YQ0A 3T9NA 4USVA 3DRPB 1F9HA 1HW8A 3MM8B 4M1KA 2NXUA 1F1BB 1DY3A 3FMWA 3A8KA 4P72A 2QRRA 3N6LA 4L3NA 2XB2D 5A6PA 2FGCA 3HCXA 2ROGA 1EIYB 5GMDA 4K4UA 2V34A 2HHPA 2VFTA 5JMNA 4ZPAA 2PT0A 2KVIA 3MM7A 3BGUA 3TVYA 4FPIA 3K89A 2GJ2A 3ITHA 2PGCA 3R5JB 5GMKa 2E5GA 1GTHA 2UVUA 2RRAA 2FHKA 1Y5NB 3M1VB 1QJHA 1HNZJ 1C1CB 5IQ6A 3RB6A 2R7VA 2CJXB 2BM1A 4OV6A 4E98A 1FX2A 2ZH4A 4DV0F 1BQXA 3BV8A 4YUDA 1HNWJ 5A8WA 3D6HB 1P1LA 1S9FA 4L75A 4ZMMA 1D09B 4ILRA 2R7RA 2ASDA 2E1MC 4B3OB 2DXEA 2O01C 4RW8A 1LW2A 4Q5VA 1K0TA 1KHWA 1YJVA 2ZITA 4DV3F 3C14A 3JXOA 5KG1A 1REVB 5GADI 3KTQA 3HVTA 3FMBA 1FRXA 4W98A 1GMWA 4DL3A 2AWZA 3D67A 4WFZA 4J9SA 3B4DA 4LSNB 4C8OA 3W62A 3CT9A 2EW9A 3AOBA 7FD1A 4NMXA 2BKPA 3U1MA 1T05A 1N52B 4FS1A 4IQXA 4IH7A 2DNOA 3SBMA 1KDNA 3TP2A 4FVCA 3ZZRA 3KK1A 1HNVB 1RAHB 3HKWA 4JI8F 3DXSX 3ILJA 1UW9A 1PGZA 4IRCA 1KVJA 1WHVA 3HMJG 5D6GA 3UD3P 1Q8BA 1W2BR 1FRJA 2C2DA 1XQIA 3DOKB 3RGIA 4J90A 2CQ1A 3PEHA 3BSAA 2H65B 4CP5A 1S72S 1K0VA 2EG2A 1YITS 5L1LA 2LKZA 2DH9A 2N82B 3AB2B 2VIHA 1Q16B 3JTPA 5LMUF 2RRNA 2ZBIA 1WEXA 3GR0A 2JFDA 3AAWB 3M6XA 1S1XB 2DHAA 1VLYA 1GX5A 3A3PB 1SJRA 5DG7A 5F8GA 1IBKF 1FEEA 2F8HA 1V3RA 4B9TA 3K2YA 4OX6A 5H9FK 1IR1A 5EWFA 5K20B 4ANDA 3M05A 4U95A 1F3FA 4PWDA 2L3MA 4NLRA 1S9EB 3ILOA 1DQ8A 1RHUB 2PMWA 4BBYA 3GR1A 4MJKA 2RQKA 2QA1A 5LSRA 3PACA 3MFIA 1UWBB 1VBKA 2AYGA 2FVRA 2J9DE 1E6YA 1FF2A 2RE1A 5AT1B 1X4CA 1HA1A 4B3SJ 2R7TA 2FJDB 3SQGA 1LK5A 4MMOA 3Q23A 4QR0A 4U8YA 3SCLE 5GADU 2FB0A 5L39A 3AT1B 4LJMA 4X4PA 1L3KA 1WEZA 1UCNA 2Y1JA 4M5HA 3SCKE 4DL4A 1NO8A 5IWAJ 3O8WA 3FSIA 1IKVA 1CPZA 3CJRA 4O3PA 2RQ4A 2NS1B 4HDHA 3DRYA 5A8RB 3DDKA 2LEBA 4YY3J 2N4DA 2W9AA 3HD1A 4O3OA 3W63A 2M2BA 4TYAA 4AE5A 3MAAB 3N79A 3FQLA 1FHTA 2B4OA 3LP2A 2WVFA 1S77D 5KTQA 1KFSA 1KTQA 3EJMA 2G2ZA 2DRDA 3DM2B 2RJZA 2XTJP 3NS5A 2ZZTA 5BYQA 3IAS9 2OEMA 3I0SB 3QO9A 2Q6BA 3R2CJ 1VS3A 1LNQA 2ZBPA 5IV4A 1B4SA 3SZ2A 1LK7A 1URRA 3S01A 1KKHA 1NPKA 2CQGA 5MLCV 3HLUA 4J9UE 3CMQA 3I5BA 2B7BB 2UXBJ 2AKWB 2R9LA 1RT4A 4BS2A 1URNA 1S49A 3HZEA 3DGVA 4K4ZA 4ID5A 4OI4A 1EP4A 4FBUA 2W2NP 3KLGA 2ZH7A 2EFPA 1KQGB 4F36A 5KFSA 2QG9B 3QBCA 4IG3A 2E9ZA 5E5NA 3C16B 3UQSA 2BUNA 4CNYA 3V6HA 1XN9A 3M9OB 2UUBJ 1HQEA 3ONQA 4GKJF 4WWSA 3AXMA 2ATLA 5HROA 2IM1A 4M5KA 2CNLB 1DARA 8AT1B 5IT9Y 4ZLJA 5KT5A 2MQNA 5U47A 4QYRA 3CC7S 2APOA 1N33F 5LJ5Y 3PKMA 4OZJA 2B9XA 2HQGA 2XZWA 1BD6A 4Q0BA 4DLEA 4MIBA 5J2PA 5ETRA 3KJVB 4G1IA 2AEMA 2GHWA 1QY7A 3Q8SB 1XIQA 3GJQB 3JQMA 4EEYA 4NXNJ 2KVQE 3UWTA 3MEKA 3LPYA 5DDRC 2B8QA 2M7SA 1EAYC 4TLQA 1NAQA 3QZ7A 3R97A 3QAUA 1JXEA 3VAJA 1KLNA 4P75A 2Z2MA 3M9NB 1NSAA 4ETXA 1O0PA 1SJQA 1HNIB 2EXUA 1BQMB 5CHCB 2ATCB 4U8VA 4KJIA 4RW7A 2R7QA 1HMVB 2GVZB 1R43A 3SV4A 1RA6A 1TQLA 4M5DB 4RW9B 4DV1J 1NB7A 4IOBA 4XDCA 4NLDA 1CULB 2V94A 3DGPB 4A8SA 4F4ZA 1GXTA 4WP3A 1VQMS 1N36J 4N76A 3TA2A 1LEOA 2MLXA 2QZ8A 1KEKA 3MM5A 2A2DA 4N77A 3VV2B 2HNZA 2ZE2B 2L48A 4OX9J 2V4JA 2ZKUA 3BZQA 3GIJA 3VAKA 4NLOA 2YWKA 1NDPA 3R7SB 2FJAB 3NS7B 4RNHA 3M32A 1RKJA 3LP1B 2HHXA 3B54A 4WU2A 3T1HF 3HFKA 1T8EA 3DLJA 4MTPA 2J0SD 4DBQA 2RF2A 4CWBA 2AIRB 2NCKL 1WJ9A 2WVEA 3OTOJ 3M2VA 2RSQA 4FKXA 3BBBA 1G2EA 3GZ7A 2I9SA 4JI7J 4CTAB 4CM0A 1S99A 1X9SA 4KV8B 2Q79A 2YNIB 4WE1B 1YRTA 4Q43A 3RAQA 4DF4A 3FSXA 3OUYB 4FPRA 3MXHP 3KNGA 3KHHA 3U02A 4IUFA 3W64A 2XLIA 4UW2A 4ELTA 4CT8A 5HL7Q 1SBRA 1T03A 4KFBB 3GJTB 5AXLA 1PBUA 1J5OB 5ETKA 4B9MA 2CPZA 5LT5A 2CPJA 3R5DA 4OFZA 5K9FA 3EYZA 4R8UA 1I51B 3NNHA 4KO0B 3TJAA 4DR1J 3DFEA 3KHLA 5IS2A 2XMKA 4ZS6A 1DQAA 3IN5A 1X8DA 4MKVA 5DLGA 2ILYA 1FVQA 1EJ7L 5FIIA 1VQ8S 1GXLA 2CQBA 2VJVA 1RT7A 2FZKB 5IV3A 3UR0A 4LF6J 2Z58B 3RRKA 4JI3J 1MROB 3DRSA 3PEJA 2DNNA 1IN0A 2CJ9A 1S6QA 1RT1B 3M6UA 4PCQA 5HVGA 2VZ9A 1DQ9A 1R0BG 4KAIA 4EI2A 3UPFA 3ISND 3KG4A 5KFMA 3TOQA 1Y5IB 1RT2A 3FBFA 4DV7J 4FXVA 1TL1B 3GSIA 4BCAA 4ZCLA 3F44A 4IFYB 3ZC4A 1WC6A 3LW5C 1KVKA 4A8FA 2AV5A 2FLPA 4QPXA 1TL3B 2JLFA 3VZIA 4DX6A 4NA1A 2FJXA 4P2MA 4F4XA 2DTJA 4RW4A 2NYHA 2ZOFA 2YWGA 1DURA 3AFGA 4DR7J 4QU7A 3L95X 3EVMA 5ETMA 2AW0A 4DR4F 1Q82T 2LDYA 1CJKB 4CLYA 3I4HX 2DH8A 2HWHA 3NBPA 4A46A 4WJBA 4ILLA 2WW8A 2XEXA 4K4TA 3LQVA 3GWCA 3IWNC 2W4PA 3NOGA 2MPUA 3RJMB 1P1TA 4WXWA 5L38A 4QU6A 2OPPA 1T02A 4RNOA 4K4SA 4M5GA 3B78A 4S0MA 1TP7A 3M8PA 4ZPDA 4C8ZA 3H5XA 3SFGA 2WHOA 1HLWA 1RISA 4HTIA 2ADBA 3FCHA 1JJHA 1S79A 4MAKA 2LQJA 3GTYX 2VPXB 1RAFB 3T6JA 1JLAA 2R7WA 1NSKL 4TU9A 4EO8A 1RAJA 3KJFB 4B02A 1QVFR 2IA0A 2DNHA 1T9YA 1KLMB 4CYUB 2CNOB 1MWZA 2FHOB 1P9QC 1TL7A 2EFQA 3OR1A 2D3O1 3BGOP 2BQUA 3I31A 5DGBA 2BVZA 4NA3A 2GVDB 1Q1KA 2X51A 2OGUA 2XNQA 2CRLA 4ECUA 2HK3A 2YH0A 3R3TA 4DQRA 1N6QA 5KG2A 5B08A 1SJFA 2IYGA 1U1RA 4F26A 1HNZF 4FXWA 3MHYA 4QCLA 1FERA 5DETA 2D9PA 3MCNA 4ES3A 3HX9A 3ET6B 3SMZA 3CF5Q 4IDKA 1HNWF 3SXLA 2DHGA 4I69A 4QW8A 2RU9A 4EMDA 5D4PA 1BWVA 2W24A 5LOQA 3ENWA 4B08A 2CQCA 5CYQB 2ZDPA 3G71S 3BR8A 2KM8B 1YJ9S 1SXLA 4G6VB 1XMOJ 2FLLA 3ETOA 1F9FA 1KOOA 3CDUA 1RTHB 2VF3A 5CYMB 2VV5A 4Y2AA 2BJ7A 3G8TA 5AXMA 3CDWA 4DV2J 3MZIA 4KSEB 3V4IA 4LF4J 2GNKA 4QWDA 3IR5B 4C4WA 1PIEA 1R27B 2JEFA 2DIVA 1SVDA 5D4OA 3H8YA 4IFVA 1YG0A 2VL1A 5I42B 2BE2B 5E3AA 4M5IA 1K47A 3IM8A 3HSDA 1QAJA 2BACA 4O3QA
chains in the Genus database with same CATH topology
1S76D 4UOCA 4Q0BB 3V6KA 2MQQA 3E01B 1HI8A 3PRDA 3OVAA 4I2PB 5J2PB 1JXLA 2ZJQQ 3FFIA 1UVLA 4QWBA 3QYYA 3J7YU 4JV2A 4LF7F 3HT3A 3BR9A 3SEOA 2KHCA 1FVSA 3GV8B 1YTYA 2X1FA 2J7UA 4Z2XA 2H9ZA 4HHJA 4I56A 5D4NA 2HYIB 4LF9F 4ZVGA 1IQZA 1VFJA 3JTOA 2M70A 4DG1B 2HHHF 4I6WA 2OAUA 4U67Q 3MMAA 4DR3F 3DRPA 5J2MB 1SKWA 1NHVA 4LF8F 5I4MA 4CH0S 3MM8A 2EWHA 2GX8A 3CC2S 4ZP7A 4LSLB 3RTVA 2E1CA 5A8KA 5K8MA 3O2IA 2NUUG 5GAHU 2XGQA 4QIVA 4J9QA 4FNHA 5D78A 2DNGA 4DV7F 2ZKTA 4TKTA 2RT3A 3CC4S 3V5RA 1Z1ZA 5J2NB 3PX6A 2Q6CA 1GQEA 3JSYA 4DWIA 3CWJA 3MF5A 3MOZA 3TX8A 2CPIA 2M3DA 4WK1A 3HZGA 3RBDA 2GQCA 2OMOA 2U1AA 1Q81T 1U1LA 3AB4B 4ZPWR 1X4FA 1D0EA 1SKSA 2XNRA 2HNYB 3Q2SC 5KFUA 3F73A 3K0JA 3CDBA 2J0QD 4OI0A 1L3UA 2MHEA 3FQKA 4EFAC 3PIPQ 4IOCQ 4URQU 2RIJA 4QIGA 3H59A 2W7AA 3BGRA 4G1QB 5AE2A 5L1JA 4GO5X 3EX7B 4RW7B 3NCPA 3C6UA 1V3ZA 2BYCA 3L3CA 2BZ2A 4RWXA 4CO3A 1YWXA 2UXDF 1G7CB 2J76E 1JLFA 1VBXA 3MUMP 3KLIB 1HD0A 4NWBA 4OJHA 2FVSA 1CC8A 1VRUA 2BJEA 2UZAA 2QSFA 3CCVS 3K8WA 2D74B 4P2SA 3BJYA 1U6ZA 2J0WA 2LQBA 3H5SA 2Y0SD 3UCZP 2QSWA 1DTQA 4B3TF 3BSOA 2ADCA 3TAQA 4HH1A 2MKJA 5C24B 4F3MA 4IH6A 2B9YA 4H4OA 1AXQA 3NGKA 5KFFA 2XC9A 1KRPA 3M30A 1YVFA 5KG0A 3LWMA 2R2TA 1C0TA 1HR0F 2CPFA 3AA8A 4HVZA 5T14A 2PA8D 1R7IA 4ECVA 2O1PA 1JLEA 2V5HG 4ZCMA 4LVOP 3M1VA 2I0XA 2OPRB 4CO4A 3MM5B 1S0NA 2HG4A 1NK0A 4ELUA 5LSLA 1H3DA 1WHWA 2GGPB 1C1CA 2KXFA 3TO8A 2HNZB 2JWNA 4X4VA 4N47A 5B0DA 3KK3A 2OPQA 2J7WA 1CEZA 5GAEU 5DJBA 1G3OA 1BC6A 3DMJA 1FD2A 2R8IA 4GC6A 4J9PA 5KFBA 3P5TL 4HI2A 2A2CA 2HIQA 3D0IE 5DDOC 4X4QA 1RP5A 1Q53A 3I6PA 4Q2LA 4X4UA 2V0NA 3G86A 4B3SF 1ZBTA 4OJ1A 5I3QA 2IVYA 2LXFA 1SV5A 3MMCA 3M32B 1DLOA 1WHXA 2VPZB 2MMYA 4TY8A 5EWEA 4UY85 3RW6A 3PX4A 3KHGA 2K3KA 3S1TA 3DCAA 1NZAA 4B9LA 2ZNYA 4KKOB 3HHLB 3DOMA 4LT6A 1JMTA 2COLA 4ZDNA 2GMHA 4XIUA 2JJ4D 3SYZA 3MEEA 4B3OA 3AQOA 2RF2B 1E6VA 2F9DA 2OLWA 1IBMF 2OMLA 2XMMA 2F40A 3TQ1A 5J1EB 4ILMA 5AJ3F 3M6WA 2P9GA 4QR2A 2LEAA 5IWAF 2ZC4A 2K8GA 3M2VB 4DLGA 2C22A 3KMQA 2J9CA 2B6AB 3KLVA 5KFAA 3DC2A 2QA4G 5KFHA 3OL6A 4RKUC 3VZHA 4CQ1A 4I67A 3U1NA 2O66A 3K5LA 3PW2A 4O3SA 2AYEA 2UVVA 2IRUA 3H4BA 1FK9A 2CYYA 3GYNA 3FRZA 1REVA 4KFBA 1B0PA 4DL5A 1VQ9S 4ED1A 4ZPCA 4KB7A 3BDPA 1OQ3A 3TYTA 2L9NA 3CE8A 4R5PA 3M8QB 1S1VA 2KFYA 5CXTA 2ABYA 3IS9B 2DITA 3DLKB 3M2RB 4PG4A 1TKTA 3OFGA 1HWLA 1ZAVA 3RB0A 1OPZA 1F5AA 2CQIA 2OFHX 4NLSA 1U1KA 4LSNA 4LQ3A 1PSDA 4K5SA 2CQ3A 1SI9A 3NCQA 5EX3A 5BYSA 1NJIT 3RZAA 1K1SA 4TQRA 2UV8G 3UD4P 4M63A 3Q8PB 3J7A1 4RW8B 2P9EA 5M2PA 1QTMA 2KH9A 2R7SA 2N3OA 2QT7A 4HT5A 3CEDA 3D5MA 4F25A 5K5MA 3CCQS 1TKXB 1HNVA 5G0RB 3KLFB 3VALA 3RR7A 5GAGI 2P5VA 1P27B 2VC0A 1S1TA 1D3WA 1S1UB 3VTIA 3GG1A 1N54B 2MZJA 1T03B 3ZZTA 2VA2A 1XNRF 1BWEA 2LCWA 3EPIA 1GXUA 2B56A 3DYAB 5KFDA 4YFUA 4IG0A 1ZETA 2UV8A 3HKZD 1MU2A 2CQPA 3IWXA 2KN4A 3JTNA 4CT9A 1RT6A 3EGWB 1WWHA 3CCES 2C28A 5E3RA 3HVTB 4WCEQ 4TNOA 2ZH6A 2D7SA 1IKYB 1DBDA 2C3PA 2OSRA 1M0SA 4ES2A 5T7LB 3DHWC 3T6BA 2W9BA 4AL6A 1U1NA 3QJLA 4PUOB 1R8PA 4I2QA 5SZTA 4ITSA 3DOKA 1OSCA 1S6OA 3SSRA 4OHYA 3N6NA 5F3TA 3CCMS 2W4CA 3NRBA 2L08A 4H4MB 4A8MP 1VQYA 2AD9A 4I6AA 2YKOA 3MGJA 1HFEL 4DS5A 2BR0A 1H6KX 4N8OA 4R8UB 4FNIA 1HBNA 2WBMA 1JLGA 1FRLA 1X4AA 5IT4A 4LFCF 1TV6B 4WKYA 2CQ2A 4K2XA 4USJC 3MOJB 4RU2A 1X0PA 3H2VE 3V81B 2PC6A 2BBEA 1H7WA 4PXCA 1B64A 4AFFA 1N5SA 3M4XA 2RDJA 1LFWA 1S4FA 2YNHB 2P6TA 1FRHA 4I4BA 2BV3A 3TAMB 2B9WA 3H25A 1Q79A 2A10A 4WFYA 2Z4PA 2LXUA 2JFKA 2BABA 1F0XA 1LQ9A 2CDQA 2CJBA 4JUZA 3K8VA 4B9VA 1SIWB 4DV6F 4K4YA 1HPZA 1GTEA 4NLGA 2VOPA 3DI6B 3TUJC 1SL1A 5KAKA 3EZUA 1R8HA 2YY3A 2JX2A 1FDNA 3IGVA 3JSRA 1RT7B 2JVRA 4Y28C 1BLUA 3VCDA 4RNMA 2E5LF 5K8NA 1YI2S 1TFYA 4WYWA 3DLLQ 4DEZA 1WACA 2QLWA 3OVSA 4KTQA 3PW7A 1CC7A 2XS2A 3N0VA 4WZQA 4Q7AA 3CGIA 5F9LA 3DLEB 2XSJA 1VI7A 1S1XA 4CH7A 3DRSB 1JKHA 2R8GA 3OL9A 1S6QB 2MKHA 5LJ3Y 5KFCA 1UFLA 1P8GA 3LP0A 1F2GA 3L09A 3HI9A 4N5SA 4MIAA 2UUBF 1VK3A 3OV7A 2B51A 2ZD1A 5F41A 2FJBB 2WAQD 5LXRA 2ZHAA 1DRZA 3P49B 2MDAA 4FP9A 2LECA 3I0RA 1JJ2R 2ZH5A 3IR6B 2FVCA 3OLBA 2B5JA 1RT2B 2WSEC 4EGLA 2DVIA 4KC5A 1L3TA 5KOXA 4X4NA 2HWTA 1JLCB 1LW0B 2PA3A 3N28A 4J9RA 3KOAA 3MEDA 2XS5A 1OO0B 4NLUA 2DK2A 5L9NA 1K9MT 3DNCA 1RGVA 1KOHA 1TKZB 3JSMA 4Y34A 1N34F 5DQHA 4M95A 1M5OC 2MGZA 4EBCA 3BGFA 3J7Z5 1NK6A 3DOLB 2CQ4A 2ZBCA 1VMBA 3OQ2A 1WELA 1AFIA 4DV5F 2R8JA 2K1RB 4K5RA 1S9EA 2FC8A 4DL2A 5DGAA 4LF4F 3LH2S 3BSNA 2BJDA 2HS4A 4NYZA 1NK8A 2F4VF 3BB5A 2YNFB 2DH7A 2WK4A 5ADZA 1JLQA 1FKOB 1X5PA 2CQ0A 2FLNA 5KG4A 1VQ7S 4X64F 3UNGC 2GHPA 4PQAA 5M2UA 1UKUA 3CJ5A 3D1QA 3CSKA 4I6YA 3LANA 4YB7A 2RKIA 2W4DA 4RBVA 3H2LA 1UWBA 2B0GA 4RW4B 4LVNP 3OJSA 1S10A 4Y00A 5CZVA 2WSFC 2ZNZA 1X0FA 1FRKA 2BA9A 4G1PA 4BWMA 2HHVA 4NXNF 4OIXA 4OLPA 5F8HA 4BC7A 2LDIA 2VFRA 3RU0A 4DSJA 2WOMA 2BQRA 5KOWA 1TR0A 3O44A 4RNFA 2YNGA 4Y2CA 5JJBA 1B7FA 2OKQA 4WIIA 2HVIA 5AXNA 4AYBD 3PXGa 1UMJA 1NK9A 1S6PA 2OP5A 4R25A 5GVQA 5EHHA 1KQKA 3FGVA 3NBPB 1VOMA 3GE9A 3IR7B 3AA9A 1X7VA 1PO6A 1RYRA 5F8IA 4ZVHA 3M9MB 2AU0A 2J6TA 2VPYB 4DPOA 2MHNA 1U49A 5AXKA 1O51A 2WTFA 3W2WA 2KYXA 3CD5A 4U7CA 5EN1A 3CUNA 4DSKA 3ZZOA 2UVRA 2GW8A 4YMEA 1Q7LB 1ZM2A 3G8SA 4KE5A 5HP1A 5D3GA 2MZRA 1AROP 1E6YB 3BF4A 5K14A 2ZFHA 2CQHA 3IRXB 3R27A 3SDEA 2MY8A 2WRMA 3PR4A 2BANB 2GFFA 2W9CA 2QEXS 3T1YF 3BGLA 4ICLA 2OPPB 3PIOQ 4K0KF 1Q86T 5A8RA 3ICLA 2DGXA 3CDEA 4OZLA 1HNXF 2OPSB 5HQ8A 2KDOA 1X5TA 1KNZA 1QLNA 5F8NA 2JRSA 2IJNA 1ZH5A 2BDPA 3M8PB 3RYLA 2MZQA 5KT2A 2DO4A 1KS2A 3OLAA 5LMNF 4LFBF 2ZC3A 2OFGX 4C98A 4EO6A 1R6YA 1UVJA 4QW9A 2R2UA 2ZZNA 1JNZB 4QWEA 4J9LA 4YR0A 2B43A 2DCUB 1SC6A 2HMIA 4RW6B 2LMIA 2DR5A 2IVFB 3KKFA 5AE3A 4GMKA 4DV1F 1I94F 3G96A 3MEGB 3DLGB 1N5VA 3DM2A 1YSJA 2AJ0A 4ECXA 4NCAA 2FHJD 3CCRS 2QFJA 4O0IA 1VQSA 4CO1A 1SH3A 3W2VA 2EFNA 2GQQA 4H4KA 2VUGA 5F8LA 2C3OA 2VODA 1RT3A 4ZLPA 2XCPA 1F5BA 3I0SA 3NMRA 2FHJA 3I87A 3VAHA 1KR4A 2I1RA 3MM6A 2PN6A 3H5UA 3J80Y 2J6SA 4AUKA 1YIJS 3OFEA 2HFOA 3GSDA 2CZ4A 3FRYA 1R8CA 1IKXB 4U6PA 2KHDA 4ECQA 4F4WA 1YRXA 1EETA 1JLAB 3Q2TC 2ROPA 5B0EA 1NKBA 5D8HB 1S48A 1Y0HA 1WF2A 3GFYA 1UAWA 4NLYA 3M2UB 4Y2KA 2U2FA 1FKPB 4QIEA 1Y3KA 1YGYA 3Q8RB 4MFBA 2HNDA 2DBBA 4AL7A 1XTZA 4X66F 3G6VA 4B9UA 1C0UB 1UJ5A 3KNAA 3QIPA 4O44B 4NRTA 1FO1A 1ZPVA 1FDAA 4DR6F 2D3UA 4DDFA 4H4KC 3X1LB 4WYLA 3OR1B 5CZXA 3KMSA 3MMJA 2FC9A 7FDRA 1R0AA 4ZP8A 4DFKA 1U1MA 2D3ZA 2M52A 1VIOA 2DGUA 1RTJB 3L7PA 3FVYA 2EFVA 3OTOF 1Y5LB 3MTKA 3GIMA 5HBMB 1HBUA 4C0BA 1WI8A 1NU4A 1D1UA 1VRTA 2CIMA 2WSCC 2HGNA 2BM0A 3D1OA 5F0WA 2KU7A 4DL7A 3OFHA 1C1BB 1WEYA 2J9EA 4OZ1A 3WDOA 5J2QB 4JI7F 4R0EA 4NLQA 2VG6A 4NLPA 3UR3C 2RD5C 2DGTA 5KG5A 4DSEA 1GH8A 2W25A 3D0HE 2V9WA 4DOZA 2K3IA 2E1RA 5HMYA 4F3OA 4OI6A 2EG1A 3G4SS 2UUAF 1UEVA 4DFPA 1O5JA 4J9NA 1JJ4A 2DGSA 4F2RA 2IAJA 2WCXA 4QOTA 5A0YB 5IT0A 1RYSA 4NRUA 1UVMA 4ED7A 1Z4UA 3S8SA 2K7JA 4QIFA 5FDLA 4NX9A 5CYQA 5A6WA 3SFUA 1S9GB 1L3SA 1N6QB 2NREA 1JNRB 1TFWA 4KIAA 2IC3A 4N41A 2DB1A 1N4LA 4Y6IA 4K4XA 3HHNB 1U6BA 2NSCA 3MUTP 3DDNA 3MTJA 1OIAA 3IG1B 3MMBA 4IQMA 2CPDA 4WFNQ 3OVBA 2KJVA 1N5YB 4NYOA 4DMZA