2QLXA

Crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum in complex with l-rhamnose
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
b'GDMTLEKHAFKMQLNPGMEAEYRKRHDEIWPELVDLLHQSGASDYSIHLDRETNTLFGVLTRPKDHTMASLPDHPVMKKWWAHMADIMATNPDNSPVQSDLVTLFHMP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-rhamnose mutarotase
publication title RhaU of Rhizobium leguminosarum is a rhamnose mutarotase.
pubmed doi rcsb
source organism Rhizobium leguminosarum bv. trifolii
molecule tags Isomerase
total genus 19
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 5.1.3.32: L-rhamnose mutarotase.
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05336 rhaM L-rhamnose mutarotase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qlxA01
3DXSX 5B0EA 4ZA1A 2GV1A 2G9OA 2OD4A 1MWYA 3TNVA 3HHLB 5K9FA 1APSA 3HHLD 5IXUA 3FRYA 4OJ1A 2W4CA 2XMJA 1RJJA 2K1RA 3LGNA 2ACYA 4HH0A 2HFOA 5B0GA 2QLXA 2OAUA 2HIQA 1LQ9A 2BJEA 4HI2A 2LQ9A 1FD8A 1FE0A 3BF4A 2RILA 1N5SA 2BUNA 5B0AA 3BR8A 5B0BA 2N4DA 2AP6A 2HLTA 1FESA 2ROGA 2XMUA 4HI1A 4YEAA 5B0FA 3HFKA 3CJKB 2FIUA 3FGVA 2OP5A 3IWXA 1Y3KA 1CC7A 3FMBA 5F0UA 2OKQA 1KQKA 4OJGA 3VTIA 1Q4RA 2GCFA 1GXTA 1YJTA 3WDOA 2K1RB 4QOTA 2BBEA 1Q8BA 2XMTA 2PGCA 4Y2IA 1AFIA 2GA7A 3TOQA 1FEEA 1TR0A 3I9ZA 4A4JA 1MWZA 2EW9A 1QUPA 5F0WA 2PD1A 4FNHA 1X8DA 1YJVA 3QMQA 2KT3A 2RU9A 1K0VA 3KG0A 2ZDPA 1GXUA 4U9RA 3KKFA 3KG1A 2L3MA 2ROPA 4Y2KA 1KVIA 4ZOSA 3BN7A 3HX9A 3MCSA 4Q2MA 5A6PA 1Q53A 3E8OA 4Y2MA 4A47A 1YJUA 1FVQA 1SB6A 2K7JA 2OMOA 2VV5A 1YJRA 3HDSA 4HL9A 4OJHA 3BGUA 4OJ3A 3LO3A 5A6WA 3HHLC 1AW0A 1OQ3A 4A46A 1URRA 1OSDA 2ZDOA 4DPOA 1XBWA 2HFNA 1N5QA 1TL5A 1V3ZA 1VQYA 3GZ7A 5T7LB 4DN9A 2GGPB 1Y0HA 1FE4A 3TRGA 1U7LA 2FB0A 2KT2A 5B0DA 2JDJA 5T7LA 2FTRA 3DCAA 2HQIA 2Q3PA 1CPZA 2GGPA 2AJ0A 1X7VA 3MZIA 3F44A 1OPZA 2QIFA 2KKHA 5B08A 4NL5A 2IYGA 1TUVA 1Y9OA 2BJDA 2BYCA 2HLUA 2XMMA 3KNGA 4OIXA 2GFFA 2QLWA 2OFGX 1YG0A 3BDEA 1N5VA 1SI9A 2W4DA 1AFJA 2IYIA 1P8GA 1TZ0A 1JK9B 4DL0C 2AW0A 1YRXA 1R6YA 1S6OA 2OFHX 3K7RA 1WD6A 1X0PA 3HF5A 3UDCA 3IWLA 5KAKA 2W4PA 4YDXA 4F67A 5B09A 1TL4A 2LXFA 2KYZA 2CRLA 2GO8A 1FVSA 3T9NA 2K2PA 1OQ6A 2ASYA 2XMVA 1Y3JA 3HHLA 2AJ1A 1SQEA 2IFXA 1S6UA 1ULRA 2XMWA 3LGMA 1Q8LA 2OD6A 4NPOA 1W2IA 2N7YA 4HH1A 5B0CA 1CC8A 2RSQA 2VH7A 4FNIA 2FHMA 1P6TA 1JWWA 1VQSA 2RMLA 3BM7A 4A48A 4EFAC 1KVJA 2XMKA 2N4CA 4Q2LA 2LDIA 2ROEA 3BB5A 3QGPA 1N5TA 1IUJA 2LQBA 2QYCA 2K7KA 3CJKA
chains in the Genus database with same CATH superfamily
1HBOA 2F8EX 2W2MP 1FKPB 3K58A 4ZPBA 4LMZA 4DV2J 4L3KA 4P52A 1UAWA 4JI2F 2HBQB 4HI1A 3KJNB 2QSFA 1MNEA 4FN5A 3OTOJ 4DL6A 3NBPB 1FEEA 1LXNA 5F0WA 5L9NA 2BW2A 2CG8A 2H48B 1S1VA 2UUAJ 2BR0A 2YX4A 1XR5A 4NXMF 2HRUA 1NDPA 4PG8A 2C2DA 4MFBB 1B0TA 1S1WA 2W2PP 1IBKJ 3PIOQ 3D6FB 2DGWA 1FRXA 5MLCV 1CJUB 2R8HA 2BYCA 2GFFA 5HLFA 2FD2A 2F8HA 5RUBA 4ZPTR 1TL3B 1J27A 2WHOA 5AE1A 4IOAQ 2DITA 1PBAA 3UPFA 3GYXB 2ADCA 3EMTA 3EX7B 1KDNA 2XS7A 4K2XA 1FX2A 2EVZA 4J5OA 3NXZA 2V68A 1IR1A 1EETA 4IRCA 3JSBA 2JLFA 4Q7AA 2R2UA 4I2PB 4ZKAA 1SC1B 2YQ1A 4Y2AA 4ED8A 3ILLA 4OYWA 3IM8A 2P5VA 2ZVSA 4ZLPA 2WCXA 3PW2A 3NGSA 2LXUA 2FZGB 3SFUA 2DRDA 5KFTA 2GHPA 1XTZA 3IA0A 1NJWA 3TA1A 1HD0A 1JLBA 2VBXA 1RAHB 2G0JA 2MQMA 3M32B 1L3VA 3BSCA 2ZEJA 3MEGA 1QAYA 4RUHA 2LQ5A 1WEYA 4TU9A 1JNRB 4B17A 3CGIA 3KJQB 1P6TA 4ZDNA 1U24A 3DHWC 2D41A 4W98A 1NSPA 2RDIA 2W25A 2EFQA 2CPDA 4QWCA 1VRTB 2K7KA 3O2IA 1RT5B 3EUNA 1GX6A 5I3PA 2HNYA 3DC2A 3MD3A 2KRBA 3AD8C 4QYZJ 2E9RX 1AZSA 3Q8YA 3VQSA 5ETVA 3R9LA 4PQAA 3BSNA 3MUTP 4I0WA 1XWLA 2IM0A 4PUOB 2CYYA 3LH2S 5IC4B 4C3LA 2YKPA 2UV8A 4WIQA 2UVRA 1VR6A 4H54A 1EKSA 1V3SA 2E7XA 3NCRA 1LV5A 4IFVB 2LP4A 2AX1A 1UL3A 1BY9A 2BJDA 3G71S 2BOAA 3BO4A 1TFYA 1NKEA 1VBKA 4YB1P 1F2GA 2R7UA 4LUBA 1FXDA 4LF6F 1ZBTA 1LWCB 4DFKA 2HFUA 4Q2LA 4P9SA 1RA7A 1H2VZ 3HSDA 4WK1A 4ZJLA 5HJXA 1Z2ZA 5KT5A 2RD5C 4F04B 2YNIA 2YX1A 4J9NA 1FKPA 3K5PA 2LQ9A 2WTFA 3HFKA 1BC6A 4V19J 5DM7Q 1VQMS 1FF2A 2XO6A 5AE2A 2KRRA 4IQXA 5HJYA 3QJLA 1JB0C 5K8MA 2AYEA 3NBPA 1VDHA 1KN6A 2M2BA 2IC3B 3ILJA 1ZAVA 4UTGA 5HK4A 2K7JA 3MUMP 2DCLA 4F3MA 2HHTA 3OD2A 2RRBA 3W66A 1RE1B 4MKBA 4DR3F 4MFBA 1F3FA 5FD1A 1TKZB 3WBZA 3MZIA 1VJWA 2WVCA 3PJXA 3QAUA 3LPEA 3MFIA 2RHQB 3P3DA 1IXKA 1R6YA 3C2PA 1O8BA 1X60A 1TL3A 4PXCA 4FS2A 2YH1A 4CLSA 3DMJB 1IBCB 4LF5J 3EYZA 4DXLA 2N4CA 3CWJA 1XC9A 2NSBA 4DQRA 2HQFA 5K5MA 2CXEA 2IBOA 4ECXA 4PAAA 5E3AA 1TVRA 1VQ6S 4N77A 5K8OA 2CNOB 2CPXA 5IXUA 2K3KA 2VA3A 3PRDA 2DY1A 2V63A 2C3YA 2MPUA 1ZA1B 5HMZA 1SH0A 2X3DA 1H72C 2FLLA 5E0OA 1TK5A 2JNJA 4IKAA 4I2PA 3W9JA 5CCLA 4J9MA 3IG1B 2KT3A 4B9LA 4R25A 4JI1F 3CO0P 2C2NA 2DRBA 4YQWA 3ZTRA 5HL7Q 3PJWA 3PYEA 1HYSB 4RX6A 1DTQB 4XIUA 2OI2A 2BQRA 1KLMB 4U7UD 4DR2J 2UUCJ 5HATA 4C6AA 3ISND 4ANCA 4LF8F 4G1QB 4IG3A 2XG8A 2XLKA 2G4BA 3T6BA 2JFKA 4UUWA 1U0HA 2DISA 3K7RA 3HVWA 3PZPA 1WOSA 4BWMA 2H51B 4PG4A 1VJQA 1HARA 4HHJA 3I5CA 3HHLA 3M32A 1XMBA 4DR1F 1N6QB 1GMUA 1MU2B 3C15B 1W2IA 3M6WA 2LXIA 5DJBA 2B8QA 4IOBA 3WIVA 2HBZB 1TUWA 2DNLA 1D9AA 4WZQA 4OHYA 2R8GA 1VRTA 3TO8A 2YVSA 1HWKA 3RAQA 3VHQA 5JXSA 3OXGA 2F9DA 4I7FB 2NYHA 4NZ7A 4KY3A 1HFEL 2B9XA 2MHEA 4MJKA 4JI8F 4MK8A 3G96A 1VRUB 2VU5A 4PUOA 4UOFA 3N79A 5I3UB 4DSIA 3IN5A 8AT1B 4M1KA 2RB7A 1T8EA 1F5BA 3JSRA 2GJ2A 2AJFE 2IMOA 3MAAB 3A3NB 4IFVA 2ILZA 4JI6F 3RW6A 4DR4J 4YB7A 3W65A 4JBCA 3BM7A 3OUYB 5IT9Y 3DU5A 3UWTA 2KM8B 1ZPVA 1SJFA 4R0EA 4F4YA 2FVSA 2EKNA 3I9V9 3MR3A 2CWXA 1WOOA 1U8SA 3EXCX 5THWA 1SL1A 5KFWA 1KSPA 2CIMA 1YBUA 4OJGA 3HSGA 1GXTA 4A8OA 5E41A 4OYMA 3THTA 3Q8PB 1R6VA 2VFUA 2DR5A 3ZO7A 4Y2MA 3B82A 1U1RA 2ZH1A 2O5DA 3DDKA 1WTBA 1V3ZA 3D1HA 1R3NA 1XNQJ 2DGSA 1TL7B 1FA0A 1NJXA 2IDEA 1Q86T 1W25A 1TKZA 3MPWA 2XGQA 2WW4A 1S6OA 1U47A 5HVGA 4DL3A 3BBFA 2P9CA 2KZZA 3T1YJ 2DK2A 2VG7B 1WEXA 3UO0A 3BH7B 2ZJPQ 3ZZTA 1KVJA 2KJVA 3PYGA 3POTB 4KGMA 2GAHC 4X64F 3CJKA 3FVYA 4BBYA 2W7OA 2C28A 1F6TA 2V34A 2FJDB 4J9OA 3I4HX 1N36F 4PWDA 3V81B 4GKJJ 4C7QA 1ICEB 5G0RB 2H5EA 4Q43A 1T94A 4O3RA 2ATLA 1XJWB 1NU4A 3L7PA 1J2VA 3WDOA 1R8CA 1I51B 3TAPA 3DLHA 2G1HA 4O3PA 4KPCA 2XC9A 4OX8A 2OMLA 3IG1A 2UXCJ 4U8VA 4KHPF 3GWCA 2VQEF 4ZCMA 4EK2A 2M9KA 2CQDA 1HYSA 3M2VB 1DTQA 3EXYA 2ZE2B 4CM0A 2NLWA 1WI6A 1KLMA 4UQGA 3OLAA 3MPVA 3HSJA 4ZPAA 2QIFA 4OX9F 1HNZF 3P49B 3F0NA 4EWTA 2QL7B 4YR2A 4OIXA 5E3CA 1SUQB 1YG0A 1UPMB 2G2YA 4G1QA 1CJKA 2VFVA 2H3EB 3D0GE 4OLOA 1VBZA 1H6KX 1HW9A 4KO0B 2W4PA 4YFUA 2GHWA 2OGUA 1VK3A 5DDOC 1CULB 2GIQA 2HS0A 1WHYA 4KJIA 2H65B 3MMCB 2MQQA 3OL7A 5E3PA 2HS4A 1MU2A 2AYBA 2BJ8A 1URNA 3IS9B 2A1BA 2IIHA 3D0IE 2F4VJ 3I6PA 3QYYA 1FE0A 1RT1A 2BJ1A 5LM7E 5F9LA 1ZETA 3BREA 1MROB 4CM2A 1HNIB 4IQMA 4OL8A 5LXRA 4KC5A 3PYFA 2C2KB 1WF0A 1GMVA 1RHKB 3M6UA 3BV8A 4OI3A 1RTIA 4BDPA 1KLNA 1HKAA 1VRUA 3VAGA 3DRYA 1TP7A 5BJRA 1SIZA 3W9HA 5AXMA 5I3UA 1IKYB 1RK8A 4M5LA 4XDCA 3G8TA 3W8PA 3CCES 3MAAA 2H9ZA 5KFIA 2FJVA 2FJXA 2UUAF 3CTRA 5DQIA 5HVHA 1Q7YT 2DKOB 3R1LA 2KXNB 2YWWA 3O5TB 1B70B 1CLFA 1VQ5S 5KFUA 3JYTB 3WIUA 4C8YA 1Y5NB 1IBKF 2XI2A 1NO8A 2IM1A 2Y1JA 3LANA 1X4CA 5HVFA 2JL9A 2DHGA 2M88A 4F4AA 3TUZC 1U6FA 2DHHA 2R7WA 2E7VA 2GS8A 4P75A 2KHDA 2EK1A 5ETLA 2DHXA 2WVEA 1H7XA 4BLGA 1JLCB 2BJ7A 4FP9A 2COLA 2R2TA 3CCSS 2UUWA 1VIOA 4IRKA 3FEYB 4QYRA 2R4FA 1U02A 1PSDA 2M8HA 3KUHA 2CG4A 3MAQA 4DF4A 4R0JA 3TA0A 3W61A 3M8SA 1FERA 5KOWA 2V4QA 2OTJS 5IM0B 1TL7A 1R0BG 3GB0A 1DARA 2DGOA 1NAQA 1DURA 1UEVA 1VLYA 4JOUA 3BYRA 3J81j 5HP1B 2VG7A 2BDPA 4AFFA 2LU2A 3T5KA 5KFKA 2K8GA 4GO7X 3POTA 1SKSA 2A0FB 3M8QB 1FJCA 4RW6B 3A8IA 4X65J 1HWLA 4BC7A 2ZH9A 2OSRA 1X4EA 4FF2A 4RU2A 3I0RB 3EPIA 1HR0J 1WKLA 2HLTA 3V81A 2VFRA 4G65A 3D68A 5G0RA 2V8DA 3N0VA 1JIHA 3CVKA 1TTHB 1Q53A 2GJFA 1FX4A 4E2FB 1T11A 3VALA 1YX2A 4QW8A 1RT6B 2NR0A 2R7XA 2VG6B 3M2VA 3CDWA 2ZE2A 4P2MA 4TQSA 2HZCA 4JI7J 2CAJA 3OTCA 1SUQA 1NK0A 2I38A 3D0HE 2UZAA 5KFVA 3Q23A 4KO0A 1RXOB 2VOPA 3M8PB 4YY3J 5B0CA 2NUHA 3N5BA 1CULA 3QPIA 4DLEA 3HKZD 2BA9A 4JB8B 5DLFA 2GV1A 3RAXA 5FLXU 4O3OA 3BKUA 3GPAA 3IRWP 2BJEA 3D54A 2R8IA 5B0BA 4WE1B 2MKJA 3R6GB 8ATCB 3QGGA 3DLGB 3CXCR 1MROA 1SKUB 4ECUA 1WC4A 1QUPA 3NOCA 2HHSA 3QSYB 1LWEB 4P7TA 2NPFA 4JV5J 3I55S 3CJ2A 3NWRA 5A6WA 3OT9A 4K4VA 4CO0A 1R8BA 1DQ8A 3HVRA 3VGTA 4ZVSB 3R2CJ 1S0NA 3IRXA 1IKYA 1NRKA 4CH7A 1IKXB 1HWJA 4MK7A 4J9VA 3CC4S 1VQPS 3ONQA 1SKWA 2CRLA 2V9KA 1YZ6A 2MKYA 3FRZA 5A0YB 1Q8LA 1ZYQA 4RU9A 4PYDA 2KB2A 1YBTA 2DR8A 4ZP9A 3JYTA 4DG1B 4USKA 2GQCA 4DUYJ 1AXQA 2IVFB 2M8DB 4Y6IA 3L09A 3MTJA 4Y34A 3VTIA 3CDEA 4NLDA 3AOBA 5ETOA 3RJMB 4A4JA 4IDKA 4K4XA 4ITSA 4D3GA 2N3LA 2ZOGA 2B4VA 5ETKA 1JLCA 1VI7A 2PIIA 2RE1A 5D78A 1YIJS 3CJ3A 1S1TB 4JI0F 3K2YA 4RWXA 1UETA 2MLXA 1OPZA 2MZJA 3OL9A 2CWKA 2VDHA 1RZMA 1YK9A 3GMGA 2IRXA 1Y4ZB 4DSFA 2HPUA 2R9LA 7FDRA 1U1NA 4RNHA 4O3QA 3R2DJ 4URQU 4O3SA 2BMBA 1XMOJ 4B3OA 1VQSA 4JV2A 3TX0A 2F65A 3QGPA 1FJGJ 5HP1A 3NGUA 3US5A 3W9IA 4DR2F 1RWKB 2UUCF 3BQ1A 1T9YA 4W4MA 5T14A 3M8QA 1GFWB 4RW6A 1S77D 2MLYA 4HYKA 1JMTA 2J6UA 5J2NB 4LR9A 4AL7A 3KJFB 2VPYB 3R5DA 2LECA 2IM2A 4ZJOA 1DQ9A 1JXVA 1WWHA 2UUBJ 3MEEB 4LBIA 3PFOA 2E1RA 2M5YA 2RQMA 2OPRB 4ZS6A 2DO0A 1VMBA 5KFLA 3QQCD 2H4WB 2AZ1A 1RT6A 3UCGA 2VG6A 4XTTA 3DNCA 1IBMJ 4AYBD 3HJFA 2X1GA 2PO4A 4U95A 2HAIA 2OD6A 2VUGA 3H98A 4FNIA 2FHMA 2ZH3A 3M8PA 3V4MA 3E01B 2ALZA 4DQQA 1FNXH 3CDAA 1TUGB 3H2UB 2Y1IA 2JOQA 4PZVA 2E1AA 3WHIA 1FHTA 4DHVA 1NUEA 4B3RJ 1TQLA 3L9ZA 4Q45A 4S0MA 3BH6B 1WJ9A 3H0PA 1IKVB 1HI0P 3TVYA 4WE1A 1F60B 2AJ4A 6FD1A 2KVIA 3DLGA 3EWGA 4Z2XA 1T9VA 3AAWB 1LWEA 1S0VA 5J1EB 3D3BJ 3LP2B 1SH2A 1XBWA 1M5OC 3QT8A 3HHKA 2BE7D 1WC6A 1QAIA 4P71A 3TUIC 4GMKA 4K5RA 4IR1A 1SH3A 4ZPWR 2AWZA 1SL0A 4CH0S 1Q82T 1RKJA 1IKXA 2DTJA 1X4AA 3G87A 2VG5B 4NLPA 2JEIA 1UVKA 3RBXA 3KMQA 4FKYA 2ZWPA 4KT0C 4ZHRA 3PV8A 4ICLB 3A3OB 2B4UA 3LGMA 3QJPA 2W9BA 5A0YA 4DS5A 5KFMA 2WBRA 4M63A 2QL5B 2KHCA 3P5TL 5L46A 3IR7B 1Y00A 1N33J 4OHVA 4LR8A 2ZFHA 4M5NA 2AQ4A 5LMUJ 1RHMB 1FFSB 3RG6A 4LSNA 4Y3CA 2CNKB 2ASLA 3CCUS 2E5JA 1CG2A 3T1YF 2WSEC 4NASA 2GQQA 4DUTA 3ZZPA 1U26A 3BZQA 3KLVA 1FEHA 3VGVA 1T02A 5JJBA 4DI6A 4CO3A 5DQGA 4ZVEA 2I1RA 1AYEA 4DV6J 4DN9A 1S1TA 2KO1A 2KT2A 1RT4B 4K4ZA 4NZ6A 4AL6A 1RUSA 3G82B 2XQCA 1UWBB 1RU2A 1H38A 1NNDA 2MMYA 2JJ4D 5C24B 2NXEA 3LP0A 3LP1B 4AD6A 1OY8A 3BGOP 3FCWA 2VBWA 5CYQA 2A2DA 2E9ZA 4N5SA 2Z58B 5DGAA 4B02A 4ZLJA 5ETNA 2HSEB 1MWQA 3Q8QB 5B0EA 5HQLA 3AD7C 1X5OA 4KHRA 3SFGA 3CCLS 3U02A 1B7YB 3G2XA 3BSAA 1AT1B 2ZKTA 5J2NA 3HFZB 5F0UA 5BYSA 5DO2A 2XLIA 3QT5A 1VQLS 1WF1A 3T5JA 3MR7A 3PHEA 3MEEA 4A47A 2F4VF 4LREA 1FJEB 5CZVA 1HW8A 1KTVA 4F36A 3A13A 3CJ5A 2OPQB 3QO9B 1KKHA 1FE4A 1ZH5A 2JZ5A 1KTQA 3H2VE 5GVQA 5B08A 3T6JA 2HBRB 2KT5A 1P9QC 4LFBF 3I4PA 2B9EA 1AFJA 4AXIA 2BACA 4NYZA 4ZJQA 2POKA 2ASYA 3O3LA 4P72A 2DIUA 4DV5J 4K2JA 2XMWA 2IJFA 1U2CA 3X3UA 2QFJA 4B9TA 3C66A 3TAMA 3MPYA 1LFWA 3QIPB 3E01A 1MWYA 3TNVA 1LOUA 3H42A 2E5LF 4KV8A 1N32J 4Q44A 3TARA 2R2RA 5H9EJ 3GP9A 3SEOA 4IG0B 5IWAJ 2CQIA 2YTCA 1XMQF 1W26A 2DNZA 5F9NA 4PG5A 2HGMA 2M3DA 5ETTA 2WOMB 3UW1A 2VQFJ 1JKHB 1E6VA 3K5LA 3J81Y 4FF3A 5J1EA 4YR0A 1VQYA 3LP2A 2BQ3A 3SMZA 3AA9A 2IAJB 2GNKA 5HN0A 1RT7B 2Z2YB 4JYAJ 4DSLA 3KNGA 2W2OP 3IFEA 1N5VA 2IYIA 4HHUA 1HWUA 1B0VA 1T9UA 3ZXWA 2C3UA 1WC5A 3M9NB 1AA1B 1G4CA 2Z2MA 2BXJA 1QE1B 1KFSA 1FXRA 4RW8B 3LQVA 1IQZA 2YKNB 1HHQA 1FDDA 1NLKL 2DNKA 3KUGA 4ZVHA 2KJWA 2IVMA 4MYUA 4PXBA 2VDIA 3OL8A 1NPRA 2B7BB 5AXKA 2ZOFA 5ETPA 1T3OA 4C8MA 3MR2A 2VONA 3NMAA 4NCGB 2K1RB 5L1KA 4GKKJ 4WXOA 1X31C 4HLBA 2L9NA 4QCLA 1UKUA 1QJHA 2KM8C 3M6VA 4M5IA 4YR3A 2AIRB 2RDJA 4X65F 4ENOA 7FD1A 2X1BA 4F8RA 1NSAA 2EC2A 3M8ZA 4UOHA 2HIYA 2AYMA 3RRKA 3UDEA 1RT4A 3MAHA 2ZM6F 3G82A 3HP6A 3GLJA 2D1CA 2U2FA 2CJBA 2CQ2A 1Q8KA 5HBMB 2Y9HA 4XAKA 4CP5A 5C24A 3DN9A 4A8MP 3LP1A 2DPJA 1KWMA 2GHVC 2OJ3A 4NA1A 3JQJA 4EFAC 4DL2A 1S4EA 2BQUA 2RT3A 2BABA 4DX8H 3V6HA 3D3CJ 1H7WA 3MEDB 3AXKA 1YDLA 5C2GA 5CZXA 3OPKA 4JI7F 2EBEA 1C2PA 4XPCA 1KONA 2BKPA 3CD7A 2DT9A 2FLPA 1CJVB 3RR7A 3NKYA 2F40A 4QWBA 3A3PB 4YY3F 3HCXA 4K4WA 4GC6A 3Q24A 4FNHA 3PW4A 3UN5A 2DXDA 4LRFA 5DDRC 3GIKA 4ED3A 3PW5A 3VAHA 4RW9A 2Z2LA 3AY0A 1XEZA 2JDJA 2OELA 3QO9A 3NLCA 4J9QA 4DR7J 1RTHA 2DNQA 3JTNA 3R3TA 1VISA 2SXLA 2I2YA 2BJ3A 2B7CB 1FRMA 3Q8UA 5KFOA 3HKWA 1R7IA 1RBLA 4I6YA 3UDLA 1VQ4S 2XY7A 1Q0NA 3RB0A 4Y65A 1KHWA 1N56A 2CVEA 4OMFG 2FVPA 2KVQE 4UZBA 7AT1B 5D6GA 1NBEB 3TUJC 2VD3A 2RILA 3VZHA 4HVZA 5CH7B 4M5KA 4DBQA 2JRSA 4ECQA 4IG0A 1KNZA 3RGIA 5HMXA 2I8EA 2XWXA 3KXDA 1JLFB 4HT7A 4ZOSA 3ZTQA 2MKKA 2VV5A 2JEFA 2DXEA 2WOMA 1S9GA 1JKHA 1HQEB 2DR7A 4I2QB 3G9CA 2E1MC 3MWBA 3UNGC 3FK4A 4K4SA 3TR5A 2XCAA 2G2OA 5DLGA 5K8NA 3U7JA 3J7A1 4IFYA 1AUSL 1K0TA 3ADAC 4LFCJ 1RTZA 1RT7A 4RWWA 3RW7A 3TUPA 4X4QA 4NLYA 3KLGB 2A10A 4ECVA 2NXCA 5HROB 3HM9A 3AB4B 1QE1A 1JJHA 4NEZA 4RW8A 1SJRA 1PGZA 2KZMA 1SXLA 2AEJA 2YKNA 1RHJB 4U8YA 3BYPA 1I3OB 4FYVB 2BW7A 3HULA 2AMCB 3MMBB 2FC8A 1QY7A 1IKWB 1TL1B 2CUYA 2QC3A 1FKAF 4Y28C 1XMOF 1FXLA 1FJGF 1ZTWA 2D3UA 3MCMA 3QGHA 1FO1A 4ECZA 2N82B 2YH0A 3CW2C 2RRAA 3HDSA 1Y11A 3W5XA 1OQ3A 3QWUA 1NK6A 3LW5C 3HPOA 3IR5B 3T41A 2E29A 3DDIA 3NGDA 2M70A 3F73A 2ZC4A 4RUBA 2QO3A 2KXFA 5HMWA 5FDLA 2BKNA 1GX5A 1JK9B 1UFLA 5AXNA 2UUBF 1Y7PA 1Z4UA 5HBMA 4CZCA 4OV1A 9ATCB 3PO5A 1PYSB 4K7QA 2V5HG 3UCZP 3CSKA 5LMNJ 3FCVA 4CYUB 4ED4A 5U47A 4UT4A 5GAEI 1D9FA 1IUJA 1UEUA 3HD1A 3PW0A 1U8WA 3MEDA 1IBMF 1DRZA 1HQUB 3DGPA 2KFZA 4I68A 2IM3A 3SCJE 2HHWA 5J1PA 3AH6A 1SC4B 1CJVA 4FDFA 3T5HA 1FRKA 3TYTA 3M30B 1BWEA 1T05B 4U9RA 3QAEA 1HHSA 1L5UA 2FZCB 1F2HA 3I32A 4DWIA 3EGZA 3GIRA 2WK4A 1NCLA 2FC9A 1NM2A 2RIJA 4QIVA 3SDEB 2FJBB 2OEJA 3GE9A 5CYMB 4OI2A 2G0IA 1KR4A 1UA1A 4DN0A 4RL1A 4LFAF 2C2MB 1VGYA 3QZ8A 3GILA 1WSVA 5AXLA 2JC1A 2D9PA 5HO4A 3ILIA 5A2QU 2NXUA 4YHHJ 2GX8A 1UMJA 2FPHX 1H3DA 2DVIA 5LJ3Y 5CD4A 5D4PA 4PQUB 3AJ2A 1RADB 3QRPA 4DCPB 3MMAB 4ED1A 1RJJA 2NXNA 3T19A 4DV1J 1K47A 2B0GA 2JEGA 2JLEA 4HDGA 4WFZA 2ZH8A 1WACA 4YEAA 2FLOA 3AQPA 1YJTA 4A8YA 2HURA 2B4OA 1EJ7L 3PCOB 5F8GA 4YP3A 4CNYA 1QSSA 3MCSA 1JLFA 2OMOA 4O4GA 5FIIA 4F0MA 2Q43A 1A9NB 1R31A 4WU2A 4LF9J 1N5QA 1RHUB 2R7QA 3PNIA 3R5BA 3DDNA 2Q6CA 2ZNYA 1VLOA 4I2QA 2ZH5A 4F4KA 1TMJA 2RF2B 2CQCA 3VAMA 4PKDB 2EC0A 1NZAA 1IR0A 4RBUA 2XYGB 1SL2A 1SJ3P 4DSEA 1G6BA 2L08A 1PJ5A 1TFWA 3ENVA 4A48A 4Q5VA 4NCAA 4DV6F 4CRJA 1RWXB 5HROA 1S10A 3D6TB 4ELVA 1VFJA 2ZITA 4Z37A 1UVMA 3M9OB 4YMEA 2VIHA 5A8WB 3GFHA 3AXMA 5DS7A 1M1KT 2VFSA 3CD5A 3B78A 5GMEA 2ZUGA 4B9NA 3MMBA 4NLOA 4MTPA 3C14B 4J7CA 3FSIA 4CLFA 4C0HA 4I6WA 3SXLA 4C3KA 2CQGA 4ILLA 3CCWA 1HL6A 4C0BA 4B3MJ 1QUVA 1RHRB 2VBYA 2Z8QA 2PMHA 4URSA 2F1FA 2FY8A 2V8PA 2NREA 3M6XA 1R0CB 1X7VA 1TKTB 3MGJA 1ROFA 3WX8A 4HEA9 3G8QA 3N6LA 4EZ6A 2GIRA 4I56A 5BR8J 4JV0A 4GVLA 3VAKA 3ISNC 2PEHA 1TMMA 4DCOB 4USJC 3TI0A 4RKUC 1E6YB 1QTMA 2ZKUA 5MAOA 3BBBA 1KC8T 5I42B 2CFXA 3FBCA 2CA9A 2G2ZA 1FWKA 1KQSR 2W4CA 3ILOA 1N34F 3GV8B 1ZM3A 2H4YB 3MR5A 4H4OB 1A6LA 1MG7A 1RACB 4ZVTB 3FGVA 5M2UA 5D77A 2RQCA 4ZLNA 1KQGB 2L48A 3UN2A 2XMTA 5GAHI 3V2UC 2RUGA 1SPBP 4Y2KA 4X4SA 3LA0A 2YWEA 3RTVA 3BGUA 3QZ7A 3OVAA 1AUDA 3R5JB 3DLBA 2DCUB 3P5BP 4EUVA 1N32F 3CC2S 3WC0A 1RAIB 2NUUG 1UZHA 4N76A 2DGVA 5IWAF 3OFHA 4DL7A 3SDEA 3AB2B 4WFBQ 3CJQA 5CYMA 1NXIA 2XB2D 2IFXA 3MM6B 2GIFA 2UXBF 2VH7A 2AX0A 2DB1A 3MM8B 2XSJB 2RS2A 3F56A 3VVTA 4CCHA 2CQHA 2FDNA 2LEAA 2Z56B 4DL4A 1H2TZ 4PQUA 3IXQA 1M5HA 2UVWA 3Q8SB 3MMAA 4JYAF 3PEHA 2D3OR 2ZJRQ 3DFEA 3CDBA 5KG1A 1YQHA 4N47A 1NHKL 3TZZA 1YI2S 1A0OB 5M2RA 2V8HA 2I9SA 1X4DA 4ES1A 4A8XA 4QR2A 4KGZB 1DZ5A 2A6OA 1U1PA 1UFKA 4DPXA 3BS9A 2MZRA 2RU3A 1X4GA 3H25A 2DBBA 3MPUB 4M95A 1WEZA 2J9DE 4M94A 4HACB 1Q78A 3HSZA 5L1IA 2OPPB 4O3NA 4DX7A 3GONA 4C11B 4DPYA 4DR5J 3PKMA 2XS2A 3W2WB 4ZVOB 1N5YB 4CLPA 3SIPB 2YKMA 2MQNA 4GKKF 1RWVB 3R6LB 4D3HA 2RF2A 3TZYA 2KU7A 3CIMA 3S8SA 1TL4A 3SSSA 5KFSA 4ZVUB 1B0PA 5IT4A 4RNOA 4NA3A 4O4RA 1WTFA 3GJRB 2OO4A 1SJQA 1G3OA 4FVCA 5LSRA 3IR6B 2V69A 2XEXA 2CDQA 2DD8S 2I5JB 2CQBA 1WKKA 5SZTA 5B0GA 1CVJA 3HJVA 5A8WA 4QYZK 4CWBA 3G6YA 3U1LA 3OSPA 3D1QA 5KFFA 3H7HB 2AYGA 4NXNJ 3MPDA 3C14A 3BO2A 3CC7S 2A2CA 3P6YC 2J6SA 2XNQA 3PX0A 1FI4A 3HXMA 1Q79A 4A46A 4USMA 5C25A 4LRAA 5A76A 5HAOA 2YWHA 3D4JA 3RBEA 2W9CB 2HGLA 4NL5A 3LWMA 3ZNUA 1NK8A 2V4JB 4KIAA 1RWOB 2Y8WA 2JVRA 1SVDA 3N01A 1U48A 3N4WA 2N7YA 3TW0A 3CO9A 3KLHA 5LSOA 2F3JA 1KQFB 4NYOA 3R7BB 3KG4A 4CLWA 4J9UE 4U7CA 5BYQA 2VC1A 5DRKA 4KH1B 3HZGA 3LGNA 4DFMA 3QLHB 2JX2A 3F41A 3KJVB 4DR7F 5KFAA 4ED2A 4ZITA 3Q22A 3KK2B 1NB7A 2EFNA 1XIQA 4H4OA 4ZCLA 2CPFA 1ZAXA 2BX6A 1KQKA 3W3SA 2OH2A 2WB4A 1JJ4A 3GSDA 1AFIA 3K59A 4RBVA 5C42B 1HQ2A 4PXDA 4X62J 3J7YI 1X5SA 1MN7A 4U6PA 5EWFA 1B7FA 4BWJA 5K14B 4J37A 3K89A 2AHOB 2VJUA 1Q5YA 3F44A 4KH0B 3S1TA 3KWMA 2RJZA 3IM9A 1KBRA 4X4VA 2W4DA 1XQIA 3M7VA 4Z7YA 3KDNA 5J2MB 3DLJA 2HYIB 2HHVA 2CPYA 3GCXP 3MM6A 2JEJA 3CJRA 3MM8A 2XSJA 2CJXB 4B08A 1W7WA 1VQKS 2E5HA 1D1UA 2P6TA 2HQCA 1WC0A 2BE2B 4LFCF 4U7UK 5E7OB 5B0FA 4AL5A 1EB0A 2IJNA 3PKYA 1P9YA 3HMJG 1RAOA 4DQIA 1F9HA 3Q83A 3H5YA 1SV5B 4WFYA 3V5RA 3TX8A 4A8KA 1TKXB 2G0CA 4TN2A 4ZVRB 2EXUA 1BQNB 1U25A 4JI3F 4HACA 1VK8A 2HQIA 5D3GB 1P1TA 3H90A 1OWXA 4C11A 4OYBA 2B6AB 5DG7A 2XCPA 1UJ6A 2LDYA 3FCHA 2FHJD 3W2WA 1S1UB 2XULA 4JUZA 2J9EA 1N5YA 4OZNA 1YJ7A 1TZ0A 2MGZA 2DNGA 1S12A 4RNMA 1SQEA 3J80Y 1SC6A 3NOGA 4C48A 3KHHA 1BE4A 4PCQA 2G1DA 2UVUA 1NH7A 3JB9k 4PG7A 3OV7A 1IBLJ 3C6UB 2ZH4A 4MKAA 3G86A 2I5JA 4ETXA 4LQ3A 2HHHF 2HWHA 3X1LB 3KLIB 1F1BB 2LKZA 1Q4RA 1YWXA 5IQ6A 3W62A 1BWVA 2QJ3A 2XMAA 5DETA 5EX0A 1N4LA 4LF4J 3JTOA 4WTOB 1CJUA 1YZ7A 1U2RA 1DBDA 2DPIA 3AT1B 1KRPA 2WVFA 5IT0A 2E66A 4DSJA 2W8KA 2Q3PA 2KKHA 1TUVA 5A8RB 5L1LA 2EK6A 3K5MA 4C8LA 2CZ4A 3OLBA 2V4JA 3SYZA 1B64A 1RWPB 3TEHB 3TJAA 3BBCA 1N54B 2AJ2A 5LXYA 4HH1A 4ECYA 1D8YA 4DEZA 3DOKB 2F5GA 5H1SV 3UVJB 2VPWB 2PSZA 2B9YA 4KYZA 2XS5A 5SUHA 1N0UA 2KG1A 4I1TA 2MHNA 3KJVA 4ZCIA 5AJ3J 3SBMA 2GVDB 3IWXA 1UP1A 4QR1A 1OJ4A 1NEEA 2JLGA 4OQJA 2QZ8A 2MZSA 3NGRA 4HTIA 3W60A 1HNXF 3AOAA 8RUCA 4F25A 5EGYA 4DL5A 3PG9A 1FK9B 3T1AA 4K4YA 1RBOB 5LOQA 2LFVA 4DV1F 5K14A 3C8YA 3RB3A 5EUHA 2ZBCA 3KHRA 3KK1B 4OYAA 3NP5A 2XY6A 4ILRA 1U6BA 2XTJP 2Z4PA 2GO8A 3R5AA 2DO4A 1RT5A 5J2MA 3DXBA 3NL0A 2AU0A 3CJSA 3GCWP 2JHEA 4USHA 3OJUA 3QT7A 5C2CA 2R2SA 2PFDA 5IS2A 2QYGA 2J9CA 2LQBA 2YWKA 2EFVA 2WBMA 5E2QA 3CMQA 3G6ES 2A6MA 4JV1A 4LJMA 2BE2A 1N5SA 3CT9A 1VQNS 2ZZNA 4IH7A 3NMRA 2PI5A 2BRLA 3ZC4A 4LRCA 4DX5A 2C3MA 1IVZA 2QN6B 5LT5A 1SV5A 5ITHA 4WFAQ 4DR3J 1IJFB 1UJ4A 4MYTA 2BV3A 4DS4A 1Q8IA 1FFGB 1YHQS 4DU7A 2ILYA 3FMWA 3LF0A 4V1Ak 4KKOB 4I67A 2D74B 4Z7CA 1I5OB 1VC0A 5D3GA 1LWCA 3JS9A 2OFGX 3M1VB 4DMZA 2RKIB 3I56S 2HWIA 2MSSA 1S1UA 5C5JA 2VKZG 4B3MF 1DTTB 4CIOA 1TAQA 4FVMA 3DI6B 4KBIA 4RW7B 2YNFB 2R8JA 1RSCA 4RW4B 4RR5A 2B43A 1TV6B 4TU8A 3AFGA 2BVZA 1PILA 1RKIA 2YQ0A 3AJDA 2XMJA 1SJ4P 3C6UA 4ZN3A 5HANA 1EP4B 4DFJA 5B0AA 5BR8F 2XWYA 1C4AA 2IC3A 4EEYA 1C0TB 2LQJA 4M5MA 1Z1ZA 1Q8BA 2N7CA 2IVYA 2MQLA 2P6SA 3ZNJ1 1D3WA 2YNGB 3RBDA 2QEXS 2QA4G 3VVUA 1BUXA 4LVNP 3RB6A 5IQQA 4EO6A 2DGXA 5BXIA 1NSKL 3BPDA 3UDVA 4FKXA 2XBPA 2MY8A 2QLJB 1YJWS 2KN4A 3DMJA 3LAMA 3ZZOA 1U0SA 3D66A 3JQKA 2QLWA 4ECWA 1FNOA 3HHNB 2KFNA 3MEKA 5A8RA 1AB8A 3I5BA 2WRMA 1ZA2B 2E44A 2NPIA 2Y3YA 3B4MA 3MHYA 4Y2CA 3OVSA 4CLTA 4X4UA 2CJYB 2DR9A 2EBGA 3TQ1A 5D0HA 3CUNA 5KG4A 2QLBB 5E5NA 3NGTA 3DOKA 1T95A 3UVJA 5C7PA 2O67A 3LTOA 3HLUA 1OSCA 1NMEB 1KOHA 3BGLA 2GMJA 4OI4A 3QJJA 2ZBRA 3UR0A 3GFZA 2HEKA 2RH3A 2F9JA 1T9WA 3GR0A 1NJIT 1YLXA 3D28A 1HBOB 3V6KA 1R89A 4PWWA 2ZHAA 4EBEA 2GVDA 2C2EA 1PAEX 3KHLA 1ELOA 3BQ0A 3KKFA 3SQGB 1RBAA 2HRTA 2XLJA 2L9WA 1EZZB 2FQQB 3PRBA 2ZH7A 2DNYA 1RWUA 4EZ9A 4B9UA 3D67A 5K8PA 3PR5B 3OJSA 1HNVB 1VBYA 5D4NA 2O3DA 4MKYA 4G3IA 3OSNA 3UD4P 1TU0B 2CPHA 1T7PA 1O6XA 2HVIA 2NSCA 5LSLA 2VB6A 1N6QA 4F3OA 4I64A 3C15A 1HBMB 3KK1A 1K1SA 4ED5A 3PJ9A 1Y10A 1ZM9A 5IV4A 1UFWA 1YRUA 4ECRA 5IC6B 4C4WA 1RDRA 4KRWA 2J8SA 3MD1A 4LBHA 4QU7A 4I7FA 1RAAB 4C8ZA 3GTYX 2BM0A 2XM3A 1H0HB 3MOJB 5KFZA 4NCBA 1F0XA 1V6HA 2FJWA 4DV2F 3D1OA 1ZM4A 4EYHB 3E51A 4QOTA 2DH8A 1IM6A 2J0WA 1M1HA 3JXOA 4UOGA 3V6JA 2P8IA 3CCVS 3OTOF 3TP2A 1YGYA 1EQMA 1IQTA 4ED0A 3CJTA 1RABB 2B8PA 2XO7A 4WFNQ 5M2PA 4F50A 4KR0B 4QR0A 4M5JA 3I82A 4NXNF 3OUYA 4EBCA 1PC5A 3M1VA 1QSLA 2RKIA 1FVSA 2OHDA 3L7OA 3GQCA 3PDNA 4X64J 2Q66A 1DTTA 5ETMA 2YPYA 4NPOA 3CMES 1JLBB 3DI6A 5KG5A 4RW7A 2YNFA 1NK9A 2LDIA 2PMWA 1ZM2A 1N36J 3IC1A 4RW4A 3DXSX 3WZ0A 1TV6A 1OO0B 1N48A 1NB2A 3EICA 1I94J 4OX7A 3OXFA 1JX4A 2JVOA 2MY7A 3SSQA 2MB0B 1EP4A 1S7IA 4F0KA 3PHTA 5HI7A 2GCFA 4WP8A 2D9OA 2RRNA 3BN4A 4TYAA 3I9ZA 1S6PB 1B4SA 5KFDA 3GJTB 4NLQA 1OY6A 2HHQA 1S6QB 1PYTA 2ASJA 1YITS 3EPGA 2YNGA 3OFEA 4AE5A 3EVWA 1OSDA 1T9XA 3K57A 1N52B 3ET6B 1PJ7A 3GIIA 3LWLA 3SCIE 1M1GA 3NNCA 2PT0A 3ETMA 2B4PA 1GEHA 4ATNA 2KFYA 4OHXA 4X62F 2HMIB 4YB6A 1PCAA 2DNOA 3MM7B 4G1IA 2QSWA 2GAGC 4NMLA 3QFWA 4I6AA 4FXWA 1RCXB 2BZ2A 4A8FA 2JFDA 3N6NA 5KFQA 2E1PA 3MM9B 2HVHA 3I87A 3IBWA 2OD4A 3OR1B 4TNOA 1APSA 3E3XA 3IAM9 3DGVA 4HTJA 4IH6A 1D9DA 5DZ6A 3EVOA 2MZQA 4WP3A 4B3SJ 3ULHA 3VF0B 2MJNA 3M05A 3D6MB 1IJEB 1FNMA 2YNIB 2DGTA 1Q81T 2HK2A 4USVA 2GQ2A 4AXJA 2LMIA 3RU0A 5A6PA 3SQGA 2CNLB 1KS2A 3PW7A 2J0QD 1URRA 4X4NA 2V94A 1Y5IB 1CQMA 4CNZA 4JI4J 4OV6A 1HNVA 4ZIWA 3D5MA 5GAGI 1DQAA 4WTYA 1EHWA 2QV6A 3MMCA 1JLQB 4F2RA 4DPTA 1HBMA 1JJCB 3IS9A 4ELTA 1WDDA 2ZOMA 1CJTB 2KYZA 4DV4J 3OTEA 5B7WA 2M0GB 4MIBA 1V5IB 1WHWA 4J9LA 3CB4A 2MQ8A 2VZ9A 3DHXA 3O8WA 1SKRA 5AT1B 1HNIA 4V19X 1CS4B 4QPXA 2HIQA 1LQ9A 4CLLA 2YKQA 1KD1T 4ZMMA 3UE2A 4OYZA 5CD4H 4K0KJ 3RBZA 1TVRB 4LF1A 2OPSB 5KFXA 1WKJA 3ZTOA 4OZ2A 4LBPA 3HFVA 3EZUA 3C6TB 1NK4A 4P6QA 3KG0A 4NE9C 1SIWB 2ZHBA 1HBUB 4L72B 1IBLF 4JP8A 4DPOA 1S0MA 1WSRA 1NHVA 1S79A 4QIWD 3C16B 2AJ0A 1RYRA 1U1OA 2H5IB 5IT9U 2OLWA 4OZ1A 5I3QA 5I4MA 3V6DB 3H5XA 4LF4F 1Y3JA 5T41A 3DKDA 1R8AA 4IG3B 3QSIA 4DZDA 3CPWR 2FY1A 2EWHA 1U0HB 2BANB 5A8KB 3AHPA 2ACMA 4LF5F 2DH7A 3IGVA 3HHLB 2MKCA 4ZK7M 3HK2A 2F63A 5IV3A 5H9FK 2ZUAA 4AT1B 5E3RA 3DRSB 4ALZA 2RVJA 3CCZA 5KOXA 2UP1A 2HBYB 4P2SA 3FMBA 4RUAA 3M2RB 4C3MA 2B51A 5EHHA 1K0VA 1S6PA 1T9TA 3PEJA 2W9AA 3T1HJ 2W24A 2V0NA 4DV3J 1S6QA 5IM0A 2B9WA 4E8UA 3Q2SC 1IWAA 2FGOA 4MIWA 3NG8A 2XZWA 2D3ZA 2YPZA 1LWFB 2HQGA 2GGPB 4NLXA 3BR9A 1VIXA 3JSYA 5AJ3F 5IOLA 4K4TA 3ET6A 3MURP 2YBVA 4RNFA 1NSQA 1YBAA 3ZZ0A 2DRAA 3CF5Q 2VF3A 4YOEA 1RTJB 4K59A 2HMIA 1REVB 2KYXA 1X4BA 2YY3A 3FFIB 3OTDA 3MM7A 3CD0A 2M4MA 3R8YA 2VPZB 3K5OA 3I0RA 4WKRA 3M8RA 1S5ZA 3EZ5A 1U1QA 2EFPA 3RYLA 3TA2A 2L41A 2G9OA 3MM9A 3G6XA 2KDOA 2DGQA 2CPJA 2QGFB 4EO8A 2QLXA 3OR1A 3R27A 3O44A 3BF4A 4N41A 4RBTA 1U1KA 4L75A 2QE5A 1LK5A 4ED7A 3T9ZA 1M5PC 2ZH6A 1YTYA 4ZVGA 1UVNA 4H4KA 5D0EA 4IRDA 4NX9A 2FHJA 1AW0A 5J2QB 2CQPA 4H4MB 4GO5X 4EGLA 1C1BB 4K8RA 2FTRA 3DCAA 4KGKA 1JXLA 4ER8A 4EBDA 2IYGA 1V3RA 3LAKA 4A8SA 3PYDA 3BDEA 1J5EJ 1JLQA 2QA2A 4UOCA 3QNWB 3D6HB 6AT1B 1WELA 1PG5B 2RAQA 1BGXT 1S6UA 1CJTA 4IUFA 1NJYA 4NLUA 5H9FJ 2YX7A 1RAFB 1JWWA 4PPZA 2VBZA 4ZPVR 4DR4F 1UVLA 4NEYA 3QRQA 4F4ZA 1QVFR 2R7SA 3C46A 1WUUA 4DUZJ 5CHCB 5CABA 1CS4A 3VGUA 1WHVA 5F3ZA 3CJKB 5GAGU 2VODA 2OPSA 2OEMA 4GRSA 3TWZA 1EQ0A 1JXEA 1S99A 2AF6A 4PWDB 3C6TA 4JI0J 2ZH2A 4NA2A 4ZP8A 1R43A 1HBUA 4NYPA 2WAQD 4W92B 3R1HA 4ID8A 1WDTA 5KTQA 3C16A 4C8KA 3RB4A 4NLTA 1XNQF 4DU8A 2HHPA 1B3TA 3NY0A 4DG1A 1M90T 3V6DA 3OR2B 2I6WA 4TY9A 2RSQA 2YWGA 3NCPA 3PVXA 1CJKB 4RO0A 4QPTA 2Q79A 3CCJS 4CO1A 2BANA 5A8KA 3Q0AA 2KH9A 4DJBA 1HPZB 3FRYA 4OJ1A 3A8JA 5F8MA 3D7SB 4AQYJ 2MDAA 5H9EK 3P8BB 3NWGA 2AGOA 2O66A 3DRSA 5FLXY 3JAMU 5KFPA 4GKJF 4OZLA 3M2RA 3ENAA 4FF1A 4ID5B 2ZDPA 1KEKA 1RT1B 1K8AT 5EWGA 3R7NB 3MECB 1G2EA 4RJVA 1A7GE 2CVIA 4X4TA 2WSCC 4UY8T 4J9PA 2V67A 2FGCA 4USIA 3GJSB 2UXCF 1FD2A 2GC8A 1LWFA 1FRIA 3TQEA 2GGPA 2VA2A 2NCKL 4DOZA 3SI8A 5CYJA 3H4DA 2LCWA 1RTIB 1VRQC 1HA1A 3KDOA 2EI5A 1HWIA 2HGNA 4FXDA 4TQRA 1VYAA 2W2QP 4KPYA 1RTJA 3ZZZA 1REVA 3UI3A 1SQGA 1PKUA 2RMLA 2FHKA 4L6V3 3EGVA 3FFIA 5IFMA 1ACMB 1O0PA 4CT9A 4QW9A 3V4IB 3TAQA 1XNRJ 3ELHA 1RLCL 2JH3A 3CD6S 4HI2A 1FRHA 3CIZA 3OHAA 4LRDA 1L3UA 4F0HA 2ZD1B 2W2NP 3SCKE 2OPRA 1SCJB 4MT1A 1XERA 3QFHA 4Y0FA 1HI8A 4TVAB 1CSJA 2HQ3A 2JWNA 3PY8A 2B3TB 2FJEB 4N8NA 1K44A 1QAJA 4OZ0A 4WFXA 3P4UB 2C3PA 1TL5A 2AEFA 3U1MA 1U7LA 5J2QA 3Q89A 4H4MA 2CJQA 1C1BA 2DIVA 2XZDB 1EAYC 3BSOA 1KP6A 3UD5A 3K0JA 3I0SB 2FJAB 3U27A 3HI9A 4YDXA 2K2PA 2EEYA 3ZTPA 2NZCA 4LF2A 1L3KA 2ZBIA 3FSXA 2XMKA 1HHTP 4DPWA 4KQZA 1IN0A 4USTA 1IKVA 3ISZA 2DNHA 3M8YA 1ZOTA 2OAUA 3P96A 4RNNA 1S1XB 2Q6BA 3CEDA 3CE8A 4HHHA 5KFBA 1VHFA 4LF7J 4PG6A 1HD1A 3DM2B 4OYIA 2EW9A 2WVDA 5EX3A 1UVIA 3GU0A 1XR7A 2J0XA 1YJRA 2BKOA 1FKOB 1I94F 1VOMA 2VG5A 1S4FA 1LXJA 4BS2A 1S49A 3MM5B 4ICLA 2B5JB 3OVBA 2W1BA 1SC3B 2LVWA 2HZAA 1TK0A 3W1YC 2CJ9A 1OQ6A 5F41A 1U1LA 4OZJA 2AT1B 4WYLA 1RLDA 3OR2A 3EDRB 2OIHA 3TEGA 4P2XA 4LIRA 2W8LA 2KL8A 4ZVPB 1OYEA 4QWAA 2HFOA 4M5DB 2DGUA 1HPZA 1Q16B 2MYFA 1W2BR 1UA0A 3DLKB 3S7RA 2HS3A 1REGX 2XMUA 3CJ8A 2EKYA 5F8IA 3FQKA 2F8MA 3UCUP 4QU6A 1LNQA 4KSEB 2LEBA 1HR0F 2R7TA 2ZBQA 3NRBA 2QFIA 2L3MA 4ID5A 3HX9A 1YJUA 2EPIA 1UWBA 5KG0A 1MMNA 3MECA 4P10A 3H20A 2XHWA 2ZDOA 4QIEA 2P9GA 4LFBJ 1ZS6A 2GO9A 4DR6J 1MSWD 4B3SF 4L73A 4TXSA 3EZOA 4CQ1A 2UU9J 3NCQA 3CNQP 1WOPA 2HW3A 4F67A 4QIFA 3VZIA 3IRXB 4WU3A 2ALYB 3FBEA 4NLGA 2B56A 2NQPA 4WBFA 1X9SA 4JI4F 1BLUA 1N5TA 2E5LJ 3BN7A 2BE9B 5L38A 4TU7A 3LOUA 1BQMB 2PMZD 4QZVB 3V4IA 1XMQJ 1FRLA 3IBCB 1PJ6A 2CJAA 4DV4F 2WW8A 2Y1LB 2HHXA 1G7CB 4DPUA 2ZVIA 2YKAA 2ZD1A 1D0EA 1MWZA 2GVZB 2P9EA 2DEIA 2OPQA 3L95X 4KTQA 1L3TA 3LPYA 3TZWA 2VKRA 5ETSA 4G1PA 4UZCA 3FEXB 1KOOA 3WX4A 4HL9A 3MUVP 2V2KA 4NI2B 4IDKB 4DV7J 1S57A 1RGVA 5KFYA 1Y0HA 3MCNA 2A18A 4JV5F 3GFYA 5B0DA 4K0KF 3QBCA 4DQSA 3PX4A 3JAMY 1AROP 3SV3A 5JVGQ 4DLGA 1U09A 1C4CA 3I0SA 3AJ1A 3QIPA 3B8HA 5GMKa 1RWWB 1RQ0A 4LR7A 5F8JA 1HI1A 2ADBA 5J2PB 5D15A 4BCAA 2KI2A 4B9VA 5EWEA 2F7VA 4NOHA 1S9EB 5CCMA 2QA1A 4B3OB 3HVTB 2AZ3A 4HT5A 2LQ8A 1GTHA 5KFRA 1S1XA 2ABYA 3NNHA 3TJ9A 4DUYF 3GR1A 2HFSA 3W8GA 1TR0A 3N6MA 1OY9A 4M8LA 2ZBPA 2RU9A 2DNMA 1GMWD 3DM2A 1HBNB 1HMVB 3H5UA 2LEPA 2IAJA 3ITHB 2UVVA 3DRRB 2C42A 1R8HA 2FUG9 5DZ7A 2QL9B 3PTWA 1T3NA 2GZOA 2ZM6J 2N3OA 1FKOA 2Z0GA 3MM5A 2UXDJ 4E98A 1J5OB 1WI8A 4OHWA 2B5JA 4CLZA 4LSLB 3HD2A 2QX0A 3IWLA 4J9SA 2C2OB 4UF4A 4NZ0A 3T1HF 2XMVA 4DV3F 2YQ3A 4WP9A 3KNAA 4DZ6A 4QWDA 2Y8YA 2C22A 3BB5A 4F3QA 1NDLA 3IAS9 1LEOA 2PC6A 1UW4A 4TKTA 4NCGA 4BHQA 3OFGA 2IBKA 2QMWA 4QBUA 2K1RA 4HH0A 3KK3B 3NS6A 4M5DA 1H2UX 3NAIA 4WK3A 3DLKA 2YNHB 2L9DA 1IM4A 2OKQA 3I31A 4OLPA 2GA7A 2R8KA 4KAIA 1PYOB 3A1YG 4RPFA 5DQHA 4FPIA 4O0NA 2BEFA 4FZVA 3I96A 2R7OA 2V2VA 4NLRA 2A3JA 1V5VA 3EM1A 3MMJA 4B3TJ 2J7KA 1X9MA 1F5CA 2DHSA 1S48A 3W63A 3HF5A 1K73T 4YS2A 2LA4A 2E5IA 5BYRA 4ED6A 2FLNA 3O6QA 1DLOB 2Z30B 3JSMB 4KB7A 1WORA 5G4DA 1FWPA 3FKBA 4L74A 2CKWA 4ZHRB 2BRKA 4Q8EA 4JI5J 1ITPA 2W9BB 1QD1A 1BQMA 1C0UB 5JVHQ 1J5EF 2V8GA 3IP0A 1X5PA 2OP5A 4X4OA 1VQ9S 5L39A 3C19A 4NRUA 1NJZA 3LGHA 2CNNB 1YJNS 3FZ2A 4X84A 3KLEB 4X2BA 5F8LA 4LIWA 4B3RF 4UY85 4LSNB 2GVZA 3SQOP 4ELUA 1TKDA 2IRUA 3DRPB 1ZAWA 2J76E 3K8VA 4DUZF 2PDAA 3HO1A 3VWSA 4MK9A 4NI2A 4DQPA 1M0SA 5JUMA 1RA6A 5J1NA 2MZTA 4OFZA 3OFFA 4NLVA 2DR6A 1UTAA 2VICA 4ES3A 4H4KC 2X1FA 3TVKA 4YDDB 4FBTA 2PN6A 4OYPA 2VL1A 4IOCQ 1X0FA 2E7WA 5GADI 3LP0B 2J6TA 5J2PA 4UUXA 5CYQB 3AA8A 3A12A 1S9EA 3DYAB 2KG0A 2ASDA 3MI7X 1FESA 3HVTA 3BKFA 1N33F 2E1CA 4GVBB 3FDSA 5LMUF 4O44B 3J81U 1RAJA 1HQEA 2W01A 3MCOA 4CO2A 1Q1KA 4Q0BB 1O51A 3H2LA 4XO0A 1HBNA 1HMVA 2EG2A 4OJ3A 1OS5A 4EU0A 3ITHA 3QT6A 3DRRA 2CPZA 4AQYF 3ENWA 1VBXA 2W7PA 4IH5A 3ZTSA 1YSJA 1CPZA 3PXGa 3KLGA 2X1AA 2AV5A 3DLLQ 1VQ7S 1H74A 1J5OA 4M5HA 3MXHP 3RAMA 1TELA 3NS5A 4ZCKA 4LSLA 3T9NA 3NEKA 1G1XA 2IJRA 3GYGA 2IHR1 3M4XA 1U1MA 2V4RA 4FS1A 4F4WA 4C8OA 1GQEA 3ZFVA 1NKCA 4PWUA 5LL6d 4OI1A 1WG4A 5D0RA 1IKWA 1TL1A 1X4HA 1GTEA 3KFWX 2UV8G 5KG6A 2E5GA 3HHEA 4NLWA 1HIYA 3KK3A 3Q8VA 4R5PB 3TAMB 2ROGA 2AP6A 4QIGA 1DY3A 2MQPA 1D09B 1EKRA 2YNHA 3BGRB 2HFVA 2J7WA 4Y2IA 2HVDA 5FJ4A 4EMDA 1T03B 2DH9A 4PEOA 2ERRA 4KV8B 3TANA 4F02A 1VS3A 1GK8A 1RU1A 2J8AA 3JTPA 4FYYB 4ZN1A 3ZZYA 3HHLC 1XNRF 2HVZA 4DSKA 2ATCB 2HFNA 4FYWB 5KFCA 4LFAJ 1YJ9S 2O01C 2H54B 1ZPWX 1Y9OA 1E6VB 2AJQA 4CYUA 4ZP7A 4YB5A 5KT6A 5B09A 3BKTA 5KT2A 2ZC3A 4CTAB 1FCAA 1UZDA 2Y1RI 1YVFA 1DLOA 1HQUA 2V2ZA 1U45A 4OZ5A 1XN9A 3JSMA 3N28A 4CI0B 2DHAA 4DV5F 4MMOA 2D69A 2CQ3A 1IWGA 1RISA 3G8SA 2HG4A 2R3VA 1RI7A 4KHMA 3M30A 2YXLA 2RQ4A 1I1GA 1T05A 3H4BA 1C0UA 3QWPA 4WYWA 3FUYA 1P27B 1JJ2R 3IWNC 2QG9B 4U67Q 1SQFA 4FBUA 5GAEU 1U2FA 2LU1A 1SBRA 3KLEA 1FDNA 1N0VC 1KVIA 4FYXB 2QA4S 2AD9A 3DOMB 4LVOP 4RLEA 3E8OA 1F5AA 3DRPA 4OJHA 1CEZA 1XR6A 3D2WA 2IA0A 4EYIB 3CCQS 4ZLLA 2IRYA 3TRGA 1ZZNA 3CCMS 1NH8A 3CCTA 4KGXB 2VQFF 5D4OA 1ZZFA 4LF7F 2ZNZA 1QTNB 2PE8A 2HFZA 4B9SA 5GMDA 3FBFA 1T0TV 2Z57B 4J9RA 1R0AB 2FVRA 4X66J 3CDUA 3A8EA 1NK5A 3GJQB 2E9TA 5L8RC 2LLZA 1MMLA 1H98A 3B54A 1S7HA 4USWA 5ETQA 3W2VB 4C2MA 1JQGA 3R7SB 3BJYA 3DYAA 1Y3KA 3KLFB 2H5JB 5ETRA 4WWSA 2FZKB 4GVBA 2GMLA 1JLGB 3BQ2A 2LA6A 4O44A 2YWFA 1NDCA 4X4RA 1WHXA 3VV2B 4A8WA 3ZZRA 4OYOA 4Q0BA 5D8HB 3BGFA 1S76D 1HNWJ 4N56A 5T7LB 5GADU 1V9OA 2XSFA 1TK8A 4RUCA 5KFHA 5KT3A 2HKEA 3HT3A 3KOAA 3O1LA 4F2SA 3BEGB 3UN3A 1P8GA 4RW9B 1PAUB 2OUGA 3Q86A 3FJ2A 3CJ0A 1RHQB 4MAKA 5KT4A 1WF2A 3H59A 3RRHA 4F7VA 2V50A 3TZXA 3OHBA 4I69A 1CC8A 2ZWOA 1RTHB 5ADZA 4O0IA 1N34J 2MXYA 1K9MT 2VJVA 2CQ0A 4DR6F 1PIEA 5A2QY 3Q8RB 4CT8A 2QT7A 2MZ1A 3BO3A 3PX6A 3W5ZA 2UU9F 3PRVA 3K17A 1BMQB 3BDPA 1LKZA 3NGKA 4Y00A 2F4FA 3N5FA 3SZ2A 2P2CB 2XY5A 2BOPA 4J90A 3I5AA 4R5PA 3KUEA 2MKSA 3H40A 1KFDA 1F9FA 1DAXA 2NS1B 5EN1A 4IYQA 3BGRA 5E33A 2M7SA 2WZ1A 3RUBL 1T03A 3FZBA 1R27B 1TKTA 4P2FA 3J7ZT 5CA5A 3RZAA 2GMHA 3WC2A 2V8VA 3GZ7A 2G13A 2CDRB 2U1AA 2CZVC 3UR3C 3OXLA 3GV5B 3DLEB 1E6YA 1EARA 1JNZB 2DXFA 1O5JA 2D7SA 4CH1A 1S9GB 2UXBJ 5I42A 2HQDA 4PXEA 4CO4A 2XYPB 2MLZA 1VCTA 4KFBB 3MR6A 4CTAA 3TJ8A 5D0GA 1LW2B 4IFYB 4DV7F 3HZEA 2ROEA 1M5KC 9RUBA 3H8YA 2MKHA 4ETZA 3C3LA 4F4XA 2VOOA 2HWTA 4C0OC 4AUKA 1UCNA 4PYAA 3VR1A 3FEZA 3M9MB 1QLNA 2N4DA 4DV0J 2CPIA 3LUYA 2FIUA 4GC7A 1GH8A 1WG5A 3MF5A 4QWEA 2FVCA 4Q8FA 1C1CB 2CJKA 2Y0BB 3MTKA 5KFGA 5DG9A 3AODA 1MW7A 1S72S 2PEBA 3IMQJ 3DOMA 3GSIA 2ZZMA 2QTWA 4IR9A 4OYXA 3K8WA 5L1JA 2RUSA 3EE3A 2CPEA 4R8UB 5GAHU 3MDFA 2PA3A 4RZRA 2K06A 4DL0C 4J9KA 2XHCA 4JI2J 1X0PA 1RT2B 2J9DA 5DM6Q 2AJ1A 3NAHA 4LRBA 2DJWA 4FXVA 2RS8A 5FDLB 1JLAB 4ANEA 2MSTA 1R0AA 1NZ8A 1EX8A 4C8NA 2R7RA 4M5GA 4NXMJ 4KGVB 4NRTA 2UXDF 3U1NA 1ZTTA 4USUA 1OPIA 3W2VA 4C97A 2DY9A 2HNZB 3AOCA 3VAIA 1FFWB 3KHGA 4MKVA 2X51A 3IBFB 2HZVA 5CXTA 3KLFA 1FDBA 3DGPB 1GXLA 2OPPA 1YJVA 3JQMA 3QMQA 4XK8C 1JLGA 4FF4A 4YN3B 4NWBA 5E3QA 1NPPA 2X7IA 4K5SA 2M52A 4O23A 3S6EA 1CBKA 2C2RA 1OYDA 3FSYA 3RR8A 5T7LA 3FBBA 3VAFA 4LT6A 2NYIA 5KFJA 3EJMA 3R5GA 2EG1A 3R5CA 1NKBA 1UWAA 1X5TA 3A4TA 5KG2A 3G6VA 1GAOA 6FDRA 2GW8A 4NMXA 1P1LA 1RYSA 4CLYA 2ZZTA 5LMNF 1KHVA 4TY8B 4B3TF 4LSZB 1B99A 3EVMA 2ACYA 2VPXB 2Y0SD 4OI6A 4ZP6A 4ECTA 4WXWA 1CC7A 4WCEQ 3G4SS 2ZHOA 2EFOA 4CLKA 4ES2A 4CO5A 2R42A 1X8DA 1PC4A 1UVJA 2JSXA 5KG3A 1BQXA 2RQKA 2ROPA 3EGWB 2RHSB 2W9CA 2VHGA 2NZ4A 4K50A 4JI5F 3PR4A 3FQLA 1KVKA 3MFHA 3FNNA 4HDHA 2CQ4A 2PI4A 2XZTB 1N8RT 2CADA 5EDWA 4DFPA 4O4GB 1S97A 3DLEA 4I4BA 3GIMA 3A8KA 1WD6A 3NS7B 3GFXA 2ZJQQ 4C9DA 4EI2A 4F26A 1VQ8S 5F8NA 4W90B 4ERDA 1LK7A 3QLHA 4KFBA 1LW2A 1UPPA 4E0DA 3KK2A 4YHHF 3TVZA 2AEMA 5K9FA 3HHLD 1H73A 1D8ZA 5C42A 1GMWA 2BUNA 1PO6A 4CLUA 3B4DA 4OI0A 1JLEB 4G6VB 3J7AN 2MTLA 4L76A 1BHNA 1X4FA 4LQ9A 3TOQA 2DNPA 1YRTA 4JI3J 1LW0B 2JC0A 1C1CA 3H5SA 1FDAA 2XYHB 3OTBA 3CCRS 1FVQA 4LF6J 2MQOA 3FC9A 2R7VA 4ZVFA 3KMSA 1QM9A 1RTDB 2FYXA 1NHUA 2VASA 4XDDA 4LF9F 3PACA 3D9BA 3DU6A 2XMMA 1SJ1A 4R8UA 3J7YU 1UEKA 1YRXA 5KFNA 3ICLA 2WONB 1WG1A 3PO4A 1RT2A 2RDDA 3QGIA 2AGPA 3UD3P 3UFCX 1S0OA 4IO1A 1JLAA 2OEKA 4QQBA 2HHHJ 4DF8A 2C1EB 4OHZA 4P7VA 2WSFC 5DGBA 5L9XA 4XPEA 1Z2LA 1FT8A 2K3IA 1FJ7A 2J5AA 3CMAS 4CDIA 4UW2A 2KTQA 2XGPA 3VQTA 1TKXA 3ZZUA 4P74A 1BQNA 2HNZA 2PGCA 2D3O1 1QDUB 3NNAA 4L3NA 1RT3B 2J0SD 1UW9A 2B6AA 1RAGB 2NXJA 5F3TA 3OW2R 2Z2ZA 1QVGR 4ZPCA 1RB0A 1LFPA 3QATA 4PRFA 1F3VA 3AQOA 2V2QA 3P45B 2QLFB 3UQSA 3THPA 5CAAA 2HHUA 2WVBA 4ZPDA 4MH8A 2VC0A 3L7UA 4JI1J 4NLSA 3KLIA 3GIJA 1EIYB 4PPDA 3DOLB 4B9MA 1OIAA 3GV7B 2J7UA 4TY8A 2APOA 3M2UB 3ENQA 3L3CA 1QAXA 3OBIA 2DEJA 1RAEB 2C2ZB 4LF8J 1HNXJ 2BBEA 2MKIA 4QJVA 2HAFA 1FWLA 1MLAA 3PM9A 3PIPQ 1FTRA 2PFFB 2BM1A 3R97A 4DR1J 1U6ZA 1BD6A 4ECSA 1Q5VA 4KE5A 4K4UA 4URGA 4OX6A 3THVA 4DCJB 1YKWA 2OTLS 5KG7A 2OFHX 2HNDB 5KAKA 5K20B 1WC1A 5CQGA 2MEWA 2YKMB 3CULA 3W5YA 2IPOB 1MN9A 1Q7LB 1PBUA 2MJUA 2IDLA 2RNEA 2QYCA 3T3FA 4YUDA 4JI8J 4IO9Q 1R8PA 4ZIVA 2QMUB 3S01A 4DDFA 1S9FA 3W7BA 4DX6A 3BR8A 1QSYA 3BPSP 5DDPC 1FK9A 1JLEA 3J7Z5 4FYDA 1S1VB 1GNKA 4JI6J 1GXUA 2AGQA 4X66F 4X4PA 2KXHA 2IA6A 4WZMA 1LW0A 2DNRA 1S1WB 4WF9Q 1K1QA 3VGSA 2WB1D 1RCOB 4PR6A 3VAJA 4P73A 3GYNA 4WJBA 2DNNA 1RTDA 1CQNA 5HLFB 2GJIA 4DR5F 5C25B 2AW0A 1Q95G 2EFGA 2BJ9A 1X9WA 4HR2A 1DFDA 1NK7A 1IR2A 3IO1A 4WIIA 2WONA 2UUTA 2CQ1A 1HNWF 2LYVA 2XI3A 2IY5B 1WNEA 1EETB 4WKYA 5F8HA 1GT8A 4HKQA 4C98A 3KLHB 4ZVQB 2HVEA 3B6BA 4WPAA 2X3GA 2H1YA 1WC3A 5D4LA 4KKOA 4ILMA 2PD1A 5DG8A 1L3SA 4J91A 1U49A 3KG1A 4UQTA 1M5SA 3EDQB 3EGNA 5HQ8A 1F9EB 4Q2MA 2QMXA 2IMWP 1SB6A 3VCDA 3IGNA 1RT3A 2V9WA 3HT0A 4N8OA 2DYAA 1HLWA 2OSQA 1VC6A 1VHIA 2FB0A 5HQMA 2AKWB 3CJ4A 1OMSA 1FRJA 3J80U 1DJ0A 1Y5LB 1XK8A 3UDCA 3GG1A 3MEGB 3T5LA 2LXFA 2Q1LA 3K5NA 3QRRA 3UNYA 1DHMA 2CZ9A 5AE3A 4A8QA 3WQPA 1BXNA 4OZ3A 3SCLE 4U96A 4ZA1A 3OL6A 1C0TA 2HRYA 4KHPJ 3SSRA 2VQEJ 1NPKA 4MIAA 2PA8D 3DOLA 2HNYB 2HK3A 2XNRA 1FD8A 3ETOA 3QIDA 3M2UA 5IZHA 3PFEA 3KYLA 5HSPA 1VQOS 1AZSB 1HNZJ 4OX9J 3Q2TC 1FTCA 2W7AA 1U4BA 4FPRA 1RP5A 3LALA 3KTQA 4TYBA 3W64A 3E2EA 5KT7A 1UJ5A 4BC9A 1S59A 1RWNB 3LO3A 3L4BC 1M5VC 3OQ2A 2QRRA 5LJ5Y 2C3OA 5KFEA 3RRGA 1NDKA 4DV0F 3GG0A 2FHOB 1N88A 3HVAA 4TLQA 3SV4A 1RWMB 2VFTA 5JMNA 1I6JA 2HLUA 4PABA 2I0XA 1SI9A 3DRXA 1LWXA 5HMYA 2FVQA 3M8WA 4N7TA 2V6AA 2HNDA 3AD9C 3MOZA 2O1PA 5DDQC 1ULRA 2YKOA 3HHDA 4ANDA 1MMDA 1VC5A 4TLRA 3N9UC 2MGZB 1TAUA
chains in the Genus database with same CATH topology
2EFVA 1HBOA 3Q8QB 1UW4A 2WBMA 5E2QA 5B0EA 2F8EX 4TKTA 4NCGA 3SFGA 1X5OA 4KHRA 4BHQA 3OFGA 2IBKA 2QMWA 3CCLS 4QBUA 1FKPB 2K1RA 4HH0A 3K58A 3U02A 4ZPBA 3G6ES 3KK3B 4LMZA 3NS6A 4JV1A 3BSAA 4LJMA 2BE2A 4M5DA 1N5SA 3CT9A 1UAWA 2ZKTA 1H2UX 1VQNS 4JI2F 3NAIA 4WK3A 3DLKA 4HI1A 2YNHB 2L9DA 2ZZNA 1IM4A 4IH7A 2QSFA 3NMRA 5J2NA 5F0UA 2OKQA 2PI5A 3I31A 1MNEA 5BYSA 2BRLA 4FN5A 5DO2A 2XLIA 3ZC4A 4OLPA 4DL6A 2GA7A 3NBPB 1FEEA 2R8KA 1VQLS 1LXNA 5F0WA 2C3MA 4KAIA 5L9NA 2BW2A 1WF1A 3A1YG 3T5JA 5DQHA 1S1VA 3PHEA 2BR0A 5LT5A 1SV5A 5ITHA 2YX4A 4WFAQ 1IJFB 1UJ4A 4MYTA 2BV3A 4DS4A 1Q8IA 3MEEA 4A47A 1YHQS 2F4VF 1XR5A 4NXMF 2HRUA 4FZVA 1FJEB 2ILYA 3FMWA 4PG8A 3I96A 2C2DA 2R7OA 3LF0A 5CZVA 4MFBB 1HW8A 1KTVA 4KKOB 4NLRA 2A3JA 2D74B 4I67A 1B0TA 1S1WA 3CJ5A 2OPQB 3QO9B 1FE4A 1ZH5A 3PIOQ 1VC0A 2JZ5A 1KTQA 3H2VE 5GVQA 3MMJA 2DGWA 2DR9A 1FRXA 5B08A 3T6JA 2J7KA 1X9MA 5MLCV 2KT5A 5D3GA 1P9QC 2R8HA 1LWCA 2BYCA 2GFFA 4LFBF 3I4PA 2OFGX 3M1VB 4DMZA 1F5CA 2DHSA 1AFJA 4AXIA 2RKIB 3I56S 2HWIA 2MSSA 1S1UA 5HLFA 1S48A 2BACA 2FD2A 2F8HA 5C5JA 3HF5A 4NYZA 4ZPTR 1TL3B 2POKA 2VKZG 1K73T 2LA4A 4B3MF 1DTTB 2E5IA 5BYRA 4CIOA 4ED6A 2FLNA 3O6QA 2ASYA 1TAQA 1DLOB 3O3LA 2DIUA 2WHOA 4FVMA 3DI6B 5AE1A 2XMWA 2DITA 4KBIA 4IOAQ 2IJFA 4RW7B 2YNFB 2R8JA 3JSMB 3UPFA 3X3UA 3GYXB 2QFJA 4B9TA 2ADCA 3C66A 4RW4B 4KB7A 5G4DA 2B43A 1TV6B 3TAMA 3EX7B 2CKWA 3MPYA 1LFWA 4TU8A 3QIPB 4ZHRB 2XS7A 3E01A 2BRKA 2BVZA 1PILA 1RKIA 4K2XA 1MWYA 3TNVA 4Q8EA 2EVZA 4J5OA 1LOUA 2XMJA 1SJ4P 2W9BB 1BQMA 1C0UB 1EETA 3C6UA 2E5LF 4IRCA 5JVHQ 3JSBA 2JLFA 4KV8A 1J5EF 1EP4B 2V8GA 4DFJA 5B0AA 5BR8F 4Q44A 2XWYA 3TARA 4Q7AA 2R2RA 1C4AA 2IC3A 5H9EJ 2R2UA 1X5PA 2OP5A 3SEOA 4X4OA 4I2PB 1VQ9S 4IG0B 1C0TB 5L39A 2LQJA 4EEYA 4NRUA 1NJZA 2CQIA 4ZKAA 1YJNS 1Z1ZA 3FZ2A 4X84A 2YTCA 1Q8BA 3KLEB 1XMQF 4X2BA 5F8LA 4Y2AA 4LIWA 4ED8A 2N7CA 4B3RF 4UY85 2IVYA 2DNZA 4LSNB 5F9NA 2MQLA 4ELUA 2P5VA 2ZVSA 2P6SA 4ZLPA 1TKDA 4PG5A 2WCXA 3PW2A 2IRUA 2LXUA 1D3WA 3DRPB 2HGMA 1ZAWA 2M3DA 2YNGB 3SFUA 3RBDA 2QEXS 2QA4G 2WOMB 3UW1A 1JKHB 4LVNP 1E6VA 5KFTA 3K5LA 3RB6A 3J81Y 2J76E 3K8VA 4FF3A 5IQQA 4EO6A 5J1EA 2DGXA 2PDAA 4DUZF 3HO1A 3VWSA 4YR0A 4MK9A 1VQYA 2GHPA 3LP2A 1XTZA 2BQ3A 4DQPA 1M0SA 2XBPA 5JUMA 3IA0A 2MY8A 1RA6A 1YJWS 3SMZA 3AA9A 2IAJB 2GNKA 5J1NA 1NJWA 2KN4A 5HN0A 2MZTA 3DMJA 1RT7B 3TA1A 4OFZA 1HD0A 3LAMA 3OFFA 4NLVA 3ZZOA 4DSLA 3KNGA 1JLBA 2QLWA 4ECWA 1FNOA 4ES3A 3HHNB 3IFEA 3MEKA 1N5VA 5A8RA 2KFNA 2VBXA 2IYIA 3I5BA 1HWUA 2MQMA 1B0VA 2WRMA 4H4KC 2C3UA 3M32B 1L3VA 3BSCA 3M9NB 2X1FA 2E44A 2NPIA 3MEGA 1QAYA 3B4MA 4RUHA 3TVKA 4YDDB 2LQ5A 2Z2MA 3MHYA 1WEYA 4TU9A 4FBTA 2BXJA 1QE1B 1KFSA 1JNRB 4Y2CA 2PN6A 3OVSA 4B17A 1FXRA 3CGIA 4X4UA 1P6TA 2EBGA 2VL1A 3LQVA 4RW8B 4ZDNA 5KG4A 3CUNA 4IOCQ 1U24A 3TQ1A 1X0FA 1IQZA 3DHWC 2E7WA 5E5NA 5GADI 2D41A 3LP0B 3DOKA 2J6TA 2YKNB 1T95A 2RDIA 2W25A 5J2PA 2EFQA 2CPDA 4QWCA 2O67A 1FDDA 4UUXA 1VRTB 2K7KA 3HLUA 3O2IA 1GH8A 2DNKA 1OSCA 1RT5B 1KOHA 5CYQB 4ZVHA 2KJWA 3BGLA 3AA8A 2IVMA 3EUNA 2GMJA 4MYUA 4PXBA 3OL8A 1GX6A 4OI4A 3QJJA 1S9EA 3UR0A 3GFZA 2B7BB 5I3PA 2RH3A 2F9JA 3DYAB 2HNYA 5AXKA 2KG0A 2ZOFA 2ASDA 3GR0A 1T3OA 4C8MA 3DC2A 3MD3A 1FESA 3MI7X 3HVTA 3MR2A 1NJIT 2VONA 3D28A 3NMAA 1HBOB 2KRBA 1N33F 2E1CA 4QYZJ 3V6KA 1R89A 4NCGB 3FDSA 5LMUF 2ZHAA 4EBEA 2E9RX 2K1RB 5L1KA 2C2EA 4O44B 4WXOA 3VQSA 1RAJA 4HLBA 1HQEA 2L9NA 3KHLA 1ELOA 1UKUA 3BQ0A 4QCLA 4PQAA 3BSNA 3MUTP 4I0WA 1XWLA 1QJHA 4CO2A 2KM8C 1Q1KA 3KKFA 3SQGB 4Q0BB 2XLJA 2L9WA 2IM0A 4PUOB 3M6VA 1O51A 3H2LA 3PRBA 1HBNA 4XO0A 2ZH7A 4YR3A 1HMVA 2CYYA 2EG2A 3LH2S 4OJ3A 2DNYA 1OS5A 4EU0A 2RDJA 1RWUA 3ITHA 4C3LA 4X65F 3DRRA 4EZ9A 2YKPA 4B9UA 5K8PA 2CPZA 2UV8A 3PR5B 1HNVB 7FD1A 3OJSA 2UVRA 2X1BA 4AQYF 4F8RA 1VBYA 4H54A 5D4NA 3ENWA 2O3DA 4MKYA 4G3IA 1VBXA 3OSNA 2W7PA 4IH5A 3UD4P 1V3SA 1YSJA 1CPZA 2E7XA 2CPHA 2AYMA 3NCRA 1T7PA 3RRKA 2HVIA 1RT4A 3MAHA 3PXGa 2NSCA 5LSLA 1LV5A 3KLGA 4IFVB 2VB6A 2X1AA 2ZM6F 1N6QA 4I64A 4F3OA 2AX1A 2AV5A 3HP6A 1UL3A 1BY9A 2BJDA 1HBMB 2D1CA 2CJBA 2CQ2A 2U2FA 3KK1A 3G71S 3DLLQ 1VQ7S 5HBMB 3BO4A 1TFYA 1J5OA 1K1SA 1NKEA 4ED5A 4XAKA 4YB1P 3MXHP 3RAMA 1F2GA 3NS5A 4ZCKA 4LSLA 5C24A 3DN9A 2R7UA 4LUBA 3T9NA 1ZM9A 4A8MP 1FXDA 3LP1A 1G1XA 1UFWA 2DPJA 4LF6F 2IHR1 3M4XA 2GHVC 1ZBTA 1U1MA 1LWCB 2V4RA 4DFKA 2OJ3A 4FS1A 4NA1A 4F4WA 4EFAC 4C8OA 4DL2A 1GQEA 4Q2LA 3ZFVA 1NKCA 4PWUA 1RA7A 5LL6d 1H2VZ 1YRUA 2BQUA 2RT3A 2BABA 4ECRA 4OI1A 4DX8H 3V6HA 4WK1A 1WG4A 4C4WA 1IKWA 1TL1A 1H7WA 1RDRA 3MEDB 4KRWA 1X4HA 1GTEA 5CZXA 3KFWX 3MD1A 3OPKA 1Z2ZA 2UV8G 5KG6A 5KT5A 4QU7A 4I7FA 2RD5C 2EBEA 4JI7F 1C2PA 2YNIA 2YX1A 4J9NA 4C8ZA 1FKPA 2E5GA 3HHEA 3K5PA 4XPCA 1KONA 2LQ9A 4NLWA 3KK3A 2BM0A 3CD7A 2DT9A 4R5PB 3TAMB 2FLPA 2ROGA 2AP6A 2WTFA 1H0HB 4QIGA 3MOJB 3HFKA 3RR7A 3NKYA 1BC6A 5KFZA 4NCBA 1F0XA 4V19J 1V6HA 5DM7Q 2FJWA 4DV2F 2MQPA 1VQMS 3D1OA 1ZM4A 2YNHA 4EYHB 2F40A 4QWBA 3E51A 1FF2A 3BGRB 2DH8A 4QOTA 5AE2A 2KRRA 4YY3F 4IQXA 4K4WA 2J7WA 4Y2IA 3QJLA 4GC6A 5FJ4A 2J0WA 3Q24A 1JB0C 5K8MA 4FNHA 2DH9A 1T03B 2ERRA 4KV8B 2AYEA 3TANA 3NBPA 4F02A 1KN6A 3V6JA 2M2BA 1VS3A 3PW4A 3CCVS 2IC3B 3OTOF 1ZAVA 3TP2A 1YGYA 2J8AA 3JTPA 2K7JA 3ZZYA 3MUMP 3HHLC 1IQTA 5DDRC 3GIKA 4ED3A 2DCLA 4ED0A 3PW5A 1XNRF 2HVZA 4DSKA 4F3MA 2HHTA 3VAHA 2HFNA 2RRBA 4MKBA 4RW9A 4DR3F 2XO7A 2Z2LA 4MFBA 3AY0A 1XEZA 4WFNQ 5KFCA 2JDJA 5M2PA 4F50A 3QO9A 5FD1A 1TKZB 4KR0B 1YJ9S 3WBZA 2O01C 4QR0A 3MZIA 1VJWA 3NLCA 4J9QA 3PJXA 1ZPWX 3QAUA 1Y9OA 1E6VB 3I82A 3MFIA 2AJQA 1RTHA 3P3DA 2DNQA 4NXNF 1IXKA 3JTNA 3OUYA 4EBCA 3R3TA 4ZP7A 4YB5A 1R6YA 2SXLA 1PC5A 2I2YA 2B7CB 3M1VA 1FRMA 5KT6A 1QSLA 5B09A 5KFOA 3C2PA 1O8BA 2RKIA 3HKWA 5KT2A 1FVSA 2ZC3A 1R7IA 4CTAB 3L7OA 1FCAA 1TL3A 4PXCA 4I6YA 3GQCA 4FS2A 2YH1A 3PDNA 3UDLA 2Y1RI 2XY7A 3RB0A 1VQ4S 2Q66A 1DTTA 3DMJB 4Y65A 1YVFA 4NPOA 3CMES 1DLOA 1HQUA 3EYZA 1JLBB 1U45A 3DI6A 5KG5A 1KHWA 2N4CA 4OZ5A 4RW7A 2YNFA 3CWJA 1XC9A 2LDIA 1XN9A 1NK9A 2NSBA 3JSMA 3N28A 4DQRA 5K5MA 1ZM2A 4CI0B 2IBOA 1N56A 2CVEA 4OMFG 4ECXA 2DHAA 3IC1A 4MMOA 4RW4A 1TVRA 5E3AA 4DV5F 3DXSX 2CQ3A 4N77A 2FVPA 1VQ6S 3WZ0A 1TV6A 1OO0B 5K8OA 1N48A 1RISA 2CPXA 5IXUA 3G8SA 2K3KA 2VA3A 5D6GA 2HG4A 3PRDA 4OX7A 3TUJC 2C3YA 2MPUA 1RI7A 4KHMA 2VD3A 3M30A 5HMZA 3OXFA 1SH0A 2RQ4A 1I1GA 2RILA 1T05A 1JX4A 3H4BA 2JVOA 1C0UA 3QWPA 2MY7A 3SSQA 4WYWA 2FLLA 2MB0B 1EP4A 1P27B 5E0OA 1TK5A 3VZHA 1JJ2R 4HVZA 5CH7B 5HI7A 3IWNC 4DBQA 2JRSA 2GCFA 2D9OA 4ECQA 2RRNA 4IKAA 4I2PA 4U67Q 4FBUA 5GAEU 4IG0A 3BN4A 4TYAA 3I9ZA 1S6PB 1KNZA 1U2FA 2LU1A 5CCLA 5KFDA 4J9MA 1SBRA 5HMXA 3KLEA 2I8EA 1FDNA 2KT3A 3IG1B 4NLQA 2XWXA 4B9LA 4R25A 2HHQA 1JLFB 4JI1F 1N0VC 1KVIA 1S6QB 2QA4S 4HT7A 4ZOSA 2AD9A 4LVOP 2DRBA 4YQWA 4RLEA 2ASJA 3E8OA 1YITS 5HL7Q 1F5AA 3PJWA 2MKKA 2VV5A 3EPGA 3DRPA 4OJHA 2YNGA 1XR6A 1CEZA 3OFEA 1HYSB 4RX6A 1DTQB 4AE5A 3D2WA 2JEFA 2IA0A 1OSDA 4EYIB 4XIUA 3CCQS 3K57A 2WOMA 1N52B 1S9GA 1JKHA 1HQEB 2BQRA 2DR7A 1KLMB 2IRYA 3TRGA 1ZZNA 3CCMS 4I2QB 1NH8A 3G9CA 2E1MC 3CCTA 3MWBA 3GIIA 2VQFF 3UNGC 3LWLA 4K4SA 3SCIE 3TR5A 3ISND 5D4OA 1ZZFA 2XCAA 4LF7F 3NNCA 4LF8F 5DLGA 2ZNZ