2QLXA

Crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum in complex with l-rhamnose
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
108
structure length
108
Chain Sequence
GDMTLEKHAFKMQLNPGMEAEYRKRHDEIWPELVDLLHQSGASDYSIHLDRETNTLFGVLTRPKDHTMASLPDHPVMKKWWAHMADIMATNPDNSPVQSDLVTLFHMP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title RhaU of Rhizobium leguminosarum is a rhamnose mutarotase.
pubmed doi rcsb
source organism Rhizobium leguminosarum bv. trifolii
molecule tags Isomerase
molecule keywords L-rhamnose mutarotase
total genus 19
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature ec 5.1.3.32: L-rhamnose mutarotase.
pdb deposition date 2007-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05336 rhaM L-rhamnose mutarotase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qlxA01
2K7JA 2GGPB 1FE0A 3CJKA 1N5TA 1S6OA 3TOQA 1APSA 2ROEA 2OKQA 4DL0C 3I9ZA 4A4JA 4Y2IA 2ASYA 4HL9A 2FIUA 4YEAA 3KG0A 5B0EA 1TL5A 1AFJA 2EW9A 5KAKA 1IUJA 4NL5A 1P6TA 2XMJA 4NPOA 3E8OA 1Q8BA 4OJ1A 3F44A 1N5QA 4HH1A 4QOTA 1OPZA 1VQSA 2GFFA 2HFOA 2IFXA 2OD6A 3HFKA 4FNIA 1SQEA 4OJHA 2QIFA 1OQ6A 1XBWA 2OAUA 3VTIA 1OSDA 5B0GA 2LDIA 2N7YA 1R6YA 3BB5A 4HI2A 1YRXA 1Q53A 1WD6A 1V3ZA 2BYCA 2XMMA 4DN9A 3T9NA 2OMOA 3HHLB 2QYCA 3DXSX 3BM7A 2Q3PA 3DCAA 4ZOSA 1KQKA 2XMKA 4A46A 1X7VA 1CPZA 1YJTA 2BUNA 1Y0HA 2XMVA 1YG0A 1FVSA 1YJUA 1AFIA 2RMLA 3MZIA 3CJKB 1SI9A 2LQ9A 2QLWA 3LGMA 5K9FA 1FVQA 2BJDA 2KKHA 3IWXA 2JDJA 2ACYA 3BN7A 2OFHX 2KYZA 1URRA 2CRLA 3TNVA 2OFGX 2BBEA 2L3MA 1N5VA 5F0UA 1N5SA 2N4DA 4U9RA 1MWYA 1Y3JA 3IWLA 1KVJA 2XMUA 3KG1A 1GXUA 3HHLC 3HF5A 2G9OA 2BJEA 3K7RA 3KNGA 4EFAC 1P8GA 2OD4A 1K0VA 1LQ9A 3BGUA 5B0AA 1KVIA 1Y3KA 1OQ3A 5T7LA 4OJ3A 1RJJA 2XMWA 2GGPA 5B0CA 1S6UA 4OJGA 1JK9B 2RSQA 2RU9A 2IYGA 3KKFA 1Q8LA 2AJ0A 2ZDPA 3LGNA 2N4CA 1X0PA 2GV1A 2PGCA 1MWZA 2ROGA 4Q2LA 3FMBA 5F0WA 5B09A 1CC8A 1YJRA 1FE4A 1FD8A 2VH7A 1Y9OA 4A48A 2IYIA 3FRYA 4HI1A 3FGVA 2K7KA 4F67A 3GZ7A 2RILA 2K1RA 2W4PA 1FESA 1JWWA 2LXFA 4A47A 2HFNA 2KT2A 1TR0A 1CC7A 3QGPA 2FB0A 3WDOA 5A6PA 1SB6A 3HHLA 2HIQA 2LQBA 3HHLD 2W4DA 4OIXA 4Q2MA 1U7LA 2ROPA 5B08A 2FTRA 1TL4A 2PD1A 3BDEA 4ZA1A 4Y2MA 1YJVA 2XMTA 2GCFA 3HX9A 2AP6A 3LO3A 4HH0A 2QLXA 2K2PA 2ZDOA 3TRGA 2K1RB 3UDCA 3QMQA 2AW0A 3MCSA 1X8DA 5B0DA 3HDSA 1AW0A 3BF4A 3BR8A 5T7LB 2GO8A 5A6WA 1TUVA 2AJ1A 5B0FA 4FNHA 1W2IA 2GA7A 5B0BA 4YDXA 1VQYA 1FEEA 1QUPA 2OP5A 2HLTA 2HQIA 1GXTA 2HLUA 1Q4RA 2VV5A 2FHMA 2W4CA 1TZ0A 2KT3A 4Y2KA 1ULRA 5IXUA 4DPOA
chains in the Genus database with same CATH superfamily
1KWMA 2MLZA 1NXIA 4ED0A 4DL3A 1UWAA 3AD8C 2DRAA 2ROEA 3EGVA 4OI6A 5J2MB 4UZBA 3BSCA 3CDUA 1CJKB 3Q89A 4YB6A 3LP2B 2R7VA 4DV6J 1KN6A 4FXVA 1NJWA 2CPEA 1BXNA 3GE9A 1N54B 2NZCA 2ZWPA 2AJ4A 4ECQA 4IFYA 1FKAF 2F65A 2CVIA 1T9VA 2ZC3A 5ETLA 2ZFHA 2J0QD 3QIPB 2CZ4A 2P8IA 2FJEB 4IG0A 1P1LA 4QR1A 4F4KA 5KFKA 1HNZF 1YRTA 3HVAA 4FVMA 4EU0A 5KG5A 2OEJA 3A8EA 3DLKB 4ED4A 1GTEA 5B7WA 3OVAA 3H40A 3JQMA 1ZTWA 2VG5A 4M5DB 4FPRA 2DNRA 1V3ZA 4LUBA 2F1FA 5AJ3F 2UU9J 1TELA 1WOSA 2BZ2A 4WK1A 2MGZA 1Q86T 2KL8A 1UA1A 2V94A 3LP0A 5KG2A 2R7OA 3TZZA 4RUAA 1H7XA 3CC7S 1JLFA 2RKIB 4K4ZA 1U6ZA 2JVRA 3UD3P 2QL9B 2V0NA 1AFIA 2RMLA 1JLGA 1NKEA 3K2YA 4RW8A 3FSIA 4U7UK 4KAIA 4QYZK 2WTFA 3TA0A 4WKRA 1WHVA 1HNXF 1HBNA 4DLEA 3N6MA 3CUNA 3MR6A 4YN3B 3ISND 4YMEA 3CJ2A 4P2XA 2D3OR 2R42A 3IS9B 3KK3B 2CJYB 3L09A 4Y00A 3AHPA 4BCAA 3FSXA 2E5LF 2VDIA 3HF5A 2VBXA 4IH5A 2Q79A 2K8GA 3KNGA 2OD4A 3ZZ0A 1RA6A 4K8RA 1RKJA 3CCVS 1MN7A 2WVFA 2JVOA 3HVTA 2J76E 4KSEB 1DURA 4OJGA 3TUIC 4FP9A 3O8WA 2DKOB 4YS2A 3CCLS 2VONA 3LGNA 3W2WA 1AZSB 2WONA 3OQ2A 1YGYA 4EYHB 2GVDB 4YP3A 4WFBQ 2BQUA 2KDOA 2M4MA 4RZRA 4JI7J 1FNMA 1FJEB 1A0OB 2DNHA 3KLGB 2DXFA 4LQ3A 1M5OC 1IBMJ 2HKEA 4NRUA 2HHQA 2HHSA 2VH7A 3JSMA 4PG7A 1M5VC 1RHJB 4B02A 2UVRA 5GMKa 1TFYA 3OLAA 1PYTA 2IM0A 3GZ7A 1YRUA 4NLWA 2W4PA 4J37A 4XPCA 1W7WA 4RR5A 4Q5VA 3RBXA 5F8LA 3KLEB 2RRNA 4Y28C 1S99A 6FDRA 1VQLS 2KTQA 5IT9Y 3MECB 4ZVUB 3HHLA 1CJTA 1IR2A 1WF1A 2L48A 2ZC4A 1TV6B 2X1AA 3VV2B 3ZO7A 4TKTA 4FF3A 2CJAA 2FTRA 2R7QA 3Q8SB 3GP9A 4YDDB 2QZ8A 2Y8WA 2RDJA 3FCVA 5K8NA 2XMTA 3TW0A 4JV2A 4G1PA 5IT0A 1JXEA 2AP6A 4DL5A 3FFIB 1YBUA 1U8SA 2EVZA 4KO0B 3PDNA 3VZIA 1PJ6A 2YWWA 2F4VF 3D6TB 1JJ4A 1LOUA 4JV5J 4DMZA 5KG6A 1SJRA 3MCSA 4QWAA 5IM0A 5KFAA 2CVEA 2YX4A 5G0RB 2R7UA 4LR8A 2WBRA 1RTJA 1NHUA 2HG4A 2DGVA 2ZEJA 2H1YA 3R27A 2VQEF 2LXUA 1S0VA 4YDXA 1Q82T 1HPZA 1S1WB 4WP3A 2QA4S 3EJMA 5KFNA 1WC4A 2AWZA 2VV5A 2W4CA 1TZ0A 5HQLA 4J9KA 4KTQA 4Y2KA 4WKYA 3J7AN 2B7CB 1ULRA 3G71S 3DXBA 4TQSA 1RAHB 1QAJA 1SJ3P 1MROA 2IIHA 3UVJB 2XNRA 1GXLA 2WCXA 5F41A 2QX0A 3ZNUA 4S0MA 1BUXA 4DL0C 4DBQA 5HMZA 2FVRA 1RABB 2G1HA 3AH6A 3DRRB 4MT1A 2XGPA 2R8KA 2VG7A 4LF7F 3M2RA 3IGVA 3D66A 1RHUB 3T1AA 3KG0A 5B0EA 1TL5A 1RXOB 3C19A 5J2NB 4W90B 1F9HA 1X4FA 4NPOA 1PIEA 3RRHA 2C28A 5A76A 4JI7F 1F2GA 3PJWA 5BYQA 1VQ7S 4J90A 3ZZPA 4X4VA 1CS4B 1LWEB 1VQSA 2V8GA 1KQFB 1LWFB 1R8HA 2OD6A 3GU0A 1H0HB 3HFKA 3HULA 4MK8A 2J8AA 4OJHA 1HBOA 5JUMA 3L3CA 2ZZNA 3GYNA 4C0HA 1CJVB 3TWZA 1N32J 3CTRA 2OGUA 1KP6A 1U1LA 4WIQA 4AYBD 4MFBA 5E41A 1RWXB 3R1HA 1NHVA 2QMXA 4FYDA 2P2CB 2VHGA 3MUTP 3LGHA 4LF6F 1VFJA 3CJ8A 3QRPA 2GJ2A 2ZE2B 4B3RJ 5KFUA 4FYVB 1YSJA 2ZKUA 3I6PA 4A8MP 2F63A 3F41A 3R6GB 4ZLLA 3MZIA 5U47A 2C22A 2JLFA 3IR5B 2NYHA 2GIQA 2B4UA 2YWGA 2GAGC 3T6BA 5HROB 2FVSA 4USVA 2OJ3A 2B5JB 4C4WA 3HO1A 2AJFE 1MWQA 1S1WA 2ABYA 5J2PB 7AT1B 5F8GA 3MD3A 1J5EF 4WP9A 2ZH6A 1E6VB 4O4RA 5E3AA 3MEEB 1QY7A 2KO1A 3IWLA 3GTYX 3JQJA 4R0JA 4JUZA 2I6WA 5C42A 5KFWA 3I96A 1SIWB 4TYBA 1E6YA 5GAEI 3QZ8A 2A6OA 3HSZA 1R27B 1QAXA 4P2SA 4X65J 4I64A 1Y7PA 5LOQA 5J2QA 2JLEA 4W4MA 3P49B 1UZHA 1U09A 1GAOA 5GADU 2GHPA 2RSQA 1XC9A 1NJZA 3NWRA 4J7CA 1N48A 3D3CJ 3VAFA 3IAM9 3M9MB 1QDUB 4QWEA 3F73A 2FJWA 5JVHQ 4P2FA 2C2DA 4NXNJ 3DC2A 2BVZA 1Y10A 2QLFB 4X4SA 4GO5X 4MIBA 4ECTA 1BMQB 1VIOA 5KFBA 3QYYA 2MZTA 3DMJB 3HVWA 1RYRA 1N6QA 4OYZA 4LSLA 4DJBA 1ZPWX 2LEPA 3PR5B 1UEUA 4CLPA 3LP0B 4CLYA 4DL4A 2UUAJ 4KKOB 3ZXWA 2KFNA 4C8LA 2LQBA 5M2RA 4DS5A 4B3SF 2ZUGA 3ILLA 2UXCJ 2XHCA 2ZKTA 3J7YI 2HBQB 4IG3B 2MY8A 4N77A 4QW8A 2ZD1B 2BW2A 3K0JA 2MKIA 3V4MA 1FRKA 2H4WB 1TKZB 4OZ0A 3V6HA 5HLFB 1ZM9A 1J2VA 1WSVA 2W9CB 2LCWA 3DI6A 3FKBA 4HH0A 2DHXA 1OS5A 3C6UB 2DCLA 3CCMS 5LXYA 2BDPA 2HNYB 6AT1B 5IWAJ 4I67A 1M1HA 2BKNA 2OPPB 2ZHOA 2VODA 1N33F 4QWBA 1Q1KA 2J9DE 2Y0BB 2C2KB 2B4PA 2GO8A 2H5EA 2IDEA 2L9DA 4NYOA 2HS3A 3GFXA 2ZJPQ 4DV2J 3ONQA 4NWBA 1IJFB 1E6YB 2CNLB 4F3QA 4LSNA 1RHQB 5DG9A 3FCHA 4DUZF 3E51A 1CJUA 1GXTA 4BHQA 2XI2A 5CD4H 1XR7A 2MZRA 4RW4A 1F3FA 2IYGA 4MIAA 3KMQA 1IKWB 3BGOP 2B4VA 3CIMA 3OTDA 3RRKA 4CH7A 5DQHA 2XBPA 2YKPA 2DR5A 5MAOA 1RT5B 1WTFA 4ZJLA 3OR1A 4QIVA 4XK8C 5ETMA 3H90A 4A4JA 3B54A 1XMQJ 3VZHA 1C1BA 1EKRA 3P5BP 1X9MA 2OUGA 4WYWA 4WFAQ 2UXCF 1PJ7A 1T9UA 2CJBA 4K59A 3M8SA 4LJMA 4UUWA 2RHQB 3F44A 4N8NA 1OY6A 1NK9A 4OI3A 1WKLA 1NRKA 2B56A 2FHOB 1VISA 1FA0A 2FVQA 4CTAA 4I69A 2QIFA 2ZH8A 3OFFA 2MTLA 3SSSA 4R5PA 2XZTB 5A8KA 1LV5A 3W8PA 2IA0A 1RLDA 3AJ2A 4CI0B 1YRXA 2N3LA 5HBMB 2BANB 1D8YA 4RW7B 4WFXA 1FERA 2D41A 1AB8A 1CS4A 1LWEA 3PJ9A 4J91A 4LF4F 5C5JA 5KT6A 2ACMA 3DXSX 4N41A 2DR6A 3AA9A 4J9UE 3VQSA 1HD0A 4WU2A 5C25B 4F2SA 3W61A 2F4VJ 4I68A 3HSGA 2HHPA 2DPIA 1LW2B 3OFGA 3WX8A 3VAGA 4AQYF 2W8KA 3B8HA 3RBDA 3RR8A 3W5ZA 3KJVB 1B0PA 2YKNA 3LGMA 1DZ5A 1FJ7A 1TKXB 2H3EB 2ZBCA 3Q8QB 1YIJS 2X1BA 2HZVA 3D6MB 2ACYA 2IDLA 2M88A 2V8HA 3K5OA 2OFHX 1S5ZA 1KFSA 3F0NA 1I94F 2CPHA 1VQOS 3GIJA 1MWYA 4I0WA 3NOCA 1KVJA 3CWJA 4DS4A 3HHLC 4Q44A 3MUVP 2Z58B 4ECYA 4RNNA 3L7PA 3JXOA 4JYAJ 5HMXA 2ZH7A 3A3PB 5EWGA 5HROA 4O3RA 1C0TA 1VDHA 1HD1A 3D1OA 4MH8A 4A8KA 4BS2A 2XMWA 3UDEA 3QFHA 2M0GB 2R7TA 1DLOA 4BC9A 4ZPTR 2RT3A 4I6AA 3V81A 1AUSL 1L3SA 1REVB 4PWWA 1UVJA 4FN5A 3RR7A 1ACMB 5J2PA 3FVYA 4B9SA 5EUHA 5B09A 1FE4A 2M7SA 2QRRA 5F8HA 4TYAA 4NEYA 2UP1A 3MM9B 5AJ3J 1Y5LB 1XIQA 2KM8C 4EI2A 1IKXA 1U2RA 3HLUA 3K5PA 4NLSA 3ZZYA 4F67A 2DIVA 1RHRB 4DV6F 4GKJF 4HYKA 2Q66A 1C2PA 2QA2A 1NCLA 2FQQB 3M7VA 3WHIA 3G4SS 1TR0A 4FPIA 1S10A 4QPTA 1RGVA 3G6VA 1ZZNA 1FK9A 1F1BB 1X4GA 2WOMB 2P9GA 2X1GA 1S6QA 3BZQA 3FFIA 3H2VE 5IS2A 2MQOA 2BXJA 5HMYA 1HNIB 4C6AA 4N5SA 4FBUA 5L1JA 1RT3B 4ETZA 2CUYA 2E5IA 2PD1A 1T03B 2G0JA 3SSQA 1TQLA 3QZ7A 2VFVA 4OV1A 2F3JA 2FUG9 2YH1A 3BGLA 1RYSA 3GSDA 3OPKA 2NXEA 1B99A 1FI4A 2DGUA 2DY9A 2KJWA 2QLXA 2V2KA 2GNKA 2K1RB 3ICLA 3D1QA 4Y34A 2XYHB 4R0EA 2MB0B 2I0XA 1SCJB 1MU2B 2IM2A 2CQ2A 2W7AA 3B6BA 3M8ZA 4XDCA 3VWSA 3QT5A 1WF0A 1AW0A 1IBCB 5T7LB 3EX7B 4YQWA 4AL6A 1N36F 1HQUB 2EXUA 4F26A 4YFUA 1Q0NA 1X60A 5B0BA 2RRAA 3I32A 4UT4A 5DQGA 2PIIA 4KPYA 2HQIA 4CIOA 2VPWB 4NMLA 4P6QA 4ZLNA 2HQDA 5KT5A 2B5JA 4HACA 3OV7A 4DL6A 4MKAA 3W2WB 3C46A 2VG6B 3NLCA 2AGQA 2YX7A 2B8QA 3BSNA 3NS6A 3OVBA 2H4YB 1B0TA 2V6AA 1N0VC 1CULA 3E01B 2WRMA 5IQ6A 4Y2IA 8ATCB 4HL9A 1RAAB 1RTZA 3UN5A 2E1MC 3D6FB 1LW2A 4FYXB 1DJ0A 5AXLA 3E3XA 4LSNB 1BQNB 1F5AA 3TI0A 2XS5A 3ZTQA 5D4OA 4K4WA 2V4RA 4CH0S 2KZZA 1N5QA 3IM8A 4KE5A 5KFSA 2V8DA 4QOTA 3K5LA 3MPYA 1CJTB 5LMUJ 5GVQA 2WOMA 3NAIA 3ENWA 4O0IA 3ENVA 2OAUA 3PM9A 4BBYA 1WORA 3VTIA 5CYMB 2DGQA 3DDKA 3TANA 2BOPA 1FRMA 4JI2J 4NXNF 2ZZTA 3SIPB 4C48A 2P6TA 2RQMA 3GIKA 2R7XA 1GTHA 2IMOA 1O5JA 1FRXA 4FF4A 5J2NA 2KT5A 3DU5A 2ZBIA 3BYPA 2K3KA 4ZP9A 4C3LA 1Y5NB 3AOAA 4A46A 4B17A 1UFWA 3KLGA 2CPXA 3BKTA 3RAQA 2ZBRA 3CJKB 2OPRA 4EK2A 1FFWB 3E2EA 3TAQA 4DSJA 1DTTA 2J0WA 2O01C 4UOCA 2JEFA 2CPJA 3ITHB 3OFHA 2HGMA 2MLYA 3UO0A 4DUZJ 4HTIA 4ZPCA 2CDRB 4U6PA 1JX4A 2QO3A 2FJXA 2ZHAA 3UCUP 4DWIA 1F9FA 2GS8A 3HKWA 3IS9A 3JTOA 3SDEA 1FRLA 2VKRA 2CQBA 3CVKA 3HZGA 3KHGA 3THVA 1UAWA 1T3NA 1P8GA 3DM2A 2QSFA 5CZXA 1NBEB 2FY1A 1RUSA 2AYEA 5FLXU 4KBIA 7FDRA 2AQ4A 2NQPA 4TU9A 4F0HA 5EN1A 2HK3A 1Q8LA 5JMNA 2M5YA 4C8YA 1S4EA 3DLGA 4RWXA 1HR0J 4IYQA 4O3PA 1X5OA 2CQ0A 3O2IA 4P7TA 4ED2A 2MKCA 4OHVA 3QT6A 4ZPWR 2D9PA 4CNYA 3PX4A 2IYIA 1TTHB 1S97A 2W9AA 2ALYB 2Z57B 1CQNA 3IFEA 1WNEA 1IVZA 2J9DA 2KT2A 2KG1A 4DV4J 1VRUB 3IBFB 5D4LA 2NLWA 1KVKA 3WQPA 4CLKA 1R0BG 3VGVA 1VLOA 4QW9A 1JKHB 4OYMA 2VOOA 4QU7A 4Q2MA 1U7LA 5EGYA 4DFJA 2ROPA 4DG1B 1NDKA 1R8CA 1RWVB 1SL1A 4O44B 3I0RB 5DG8A 1B7FA 4NI2B 2VASA 4E2FB 3ELHA 4ED3A 1MG7A 1S49A 3H7HB 3VAKA 1EB0A 1Z1ZA 2QG9B 4USWA 2D69A 3MCOA 2C2RA 4F3MA 2FLPA 3RW6A 3WC2A 2W2QP 5AXKA 1Q5YA 4C8KA 1XNRF 4GMKA 4NLUA 2XSJB 1XMOJ 2XLIA 2H54B 1I94J 4F3OA 1FX4A 4M5HA 3CJTA 3CCSS 1X8DA 4O23A 2E66A 4K7QA 2LEAA 5B0FA 2M52A 3A8IA 1RWUA 4DQSA 4FS1A 4ZVHA 1Q95G 2HWTA 3RB6A 1FDAA 1U1KA 2OP5A 1HWKA 4PUOB 1VMBA 3KHRA 4RNFA 4U67Q 3TAMA 1BD6A 1ZAWA 2GGPB 4GC6A 2JNJA 1HW9A 2Z2ZA 3THTA 4XPEA 3HHNB 1NPKA 3T9ZA 1FEHA 2IAJA 1LWXA 5A2QY 1S76D 3MF5A 1B4SA 2ASYA 3A4TA 3M2VB 1BLUA 3NOGA 3M9NB 2CJXB 1WHXA 5JJBA 3W63A 2CPIA 2F9DA 4MTPA 4DL7A 3PHEA 3RBEA 4Y2CA 3E8OA 4NE9C 3UCGA 5HSPA 5EX3A 3DOMB 4B08A 3GB0A 3PCOB 4M5LA 3SQGA 3ITHA 1OPZA 1IWAA 2HRTA 1O51A 2HPUA 3IAS9 4NA1A 4ITSA 2JC1A 5D77A 2HGNA 3ULHA 3M1VA 2AEFA 1HA1A 1TK5A 1KHVA 1DFDA 2HVIA 3T1HF 3PIOQ 4FS2A 5KFXA 4DCPB 4J9SA 3GYXB 3M8YA 4CH1A 2EC2A 4F0KA 4MKVA 4LFBJ 3DLEA 3QO9A 1RWWB 4WFNQ 3CJSA 2BQRA 2CJKA 3OTBA 2HHHJ 3ZTSA 1RAOA 4E98A 2EKNA 3C3LA 4ZDNA 4UY85 1VS3A 2VL1A 1IM6A 3RTVA 1V9OA 1RTIB 2DIUA 2RVJA 3SFUA 3AT1B 3W9HA 4ZMMA 4ECWA 3X3UA 3CJ4A 4NCGB 8AT1B 2R7RA 2CG8A 3N5FA 3WC0A 2VDHA 1HYSA 3DMJA 2E29A 3OL8A 1RTHA 4MIWA 2B6AA 2KXNB 1Q81T 2ATLA 4EEYA 1TVRA 5E3QA 1XEZA 3JYTA 4LBIA 4G1IA 2XLJA 2AYGA 1A9NB 1NJYA 3TUPA 2AGPA 1Q8KA 2IVFB 3MFIA 1N5VA 1SVDA 2DGXA 1RHKB 5C24A 4TN2A 3W2VB 1SH3A 4Y65A 2YKQA 2G9OA 4G6VB 1PJ5A 4F0MA 3I9V9 5SZTA 3HJVA 2AGOA 5F8IA 3S7RA 2XWYA 2I5JB 3KXDA 4YUDA 3BBFA 4EZ6A 2OPQA 2BACA 1SUQA 1R8BA 4YB7A 5LXRA 1VBZA 5EDWA 3KHLA 1SC3B 2N4CA 4BDPA 2GV1A 1BWEA 2F8MA 3CCZA 4IOAQ 1TL1B 3MR5A 1IBKF 4G3IA 3I0RA 3T6JA 1HQEB 3W66A 1XMQF 1SJQA 2I2YA 4A8WA 2K7KA 2KG0A 1HKAA 2C1EB 5G0RA 2E1RA 2QEXS 4KV8A 3SI8A 2ADCA 3NNHA 2NUUG 3MAHA 3WBZA 4K5RA 2MZ1A 1DTQA 3DNCA 5CCLA 1VI7A 5AE1A 3PZPA 5LT5A 3LAMA 5C25A 4EZ9A 2BX6A 4O0NA 5KT3A 3J80Y 2LU2A 3GJQB 3UNYA 1XR6A 4DX6A 2O66A 3VAIA 1X5PA 2RS8A 4I2QB 5CYMA 4NLYA 1ZAXA 1QTNB 2QLBB 4WK3A 4F2RA 3FEZA 2Z0GA 1TUGB 2NSCA 3H20A 2B51A 3QGIA 3UDVA 1D8ZA 5C2GA 3OLBA 1AXQA 3R5AA 1YBAA 1RBLA 5M2UA 1QSYA 2B43A 2WVCA 3WIUA 2WSCC 3SQGB 3RU0A 3HDSA 4Q45A 3OVSA 3J81U 4QWCA 1N8RT 4JI1F 4M5KA 2CPFA 1F3VA 1HNXJ 3NCPA 1SKUB 1RISA 3TZWA 3VVTA 1K73T 2OPSA 3UWTA 4W98A 2Y1IA 1LFWA 2FHMA 3R9LA 3V81B 4R8UB 2W2NP 2ZZMA 2D1CA 2OSRA 4JI6J 4K2JA 1JJCB 1WG1A 3GQCA 1EETB 4DZ6A 4H4OB 1RTDA 2BA9A 2XI3A 2WZ1A 1X4CA 4RBVA 4X2BA 3KUGA 4IOBA 4DPUA 5IZHA 3K58A 2E9RX 3J7YU 4NCAA 1MMLA 3GR0A 4IR1A 2EC0A 3I55S 4XIUA 2VQFF 4NCGA 4DV5F 4ED5A 4F7VA 1UW4A 4I4BA 3OL9A 2HNDA 1QD1A 3NKYA 2B6AB 4DFKA 2JEGA 4ED1A 4LRCA 3LQVA 1N5YB 4GKKJ 3S6EA 4CT8A 2UUAF 3QJJA 2MQ8A 3GILA 3T41A 4PPDA 4L72B 2DGSA 1R89A 3QNWB 1WG5A 1QE1B 5F3TA 4CLLA 4R5PB 3AXKA 4HI2A 3V6KA 4P74A 2Q1LA 1JLBB 4DV3J 1DBDA 3P6YC 1NDCA 3MWBA 5DS7A 1T05A 3BJYA 4ENOA 3DLKA 3DOMA 3Q2TC 4CWBA 2IM1A 2B9YA 1TL3A 5CH7B 2AD9A 4CO4A 3UNGC 1JKHA 1WWHA 2IC3B 2K06A 1YJUA 1S4FA 2V67A 3KJNB 2Z2YB 4LSZB 1JLQB 5C2CA 3CPWR 1YBTA 3QT7A 1D9AA 5I3PA 4DL2A 3KUHA 4ZN3A 4JI0J 3H59A 1PKUA 4ZVSB 4CLTA 1FXRA 3QGGA 2HZCA 1N56A 3FC9A 2DHSA 2BBEA 2O5DA 1VBKA 4DZDA 2ZH5A 4LF7J 1CJKA 1FWLA 3M6XA 2IAJB 1SKSA 1PC4A 2VF3A 4DEZA 1M1GA 1RAEB 2BJEA 1IKWA 5IM0B 1M1KT 1WF2A 5J2MA 4X4UA 3KK3A 3QWPA 4NZ0A 4WWSA 4ZPDA 4OJ3A 2DY1A 5DDPC 1AUDA 1WG4A 1TVRB 1WOOA 4OV6A 2QSWA 4DR6F 1S1TB 4DV2F 4Q2LA 4PUOA 3UFCX 4WE1B 2IM3A 2FHJD 2LP4A 3SSRA 2Z8QA 4X4PA 4FBTA 2G4BA 1YJRA 2OEKA 1E6VA 2U2FA 3A3OB 4FYWB 5KFEA 4LFAF 3AOCA 4QCLA 2HW3A 4IOCQ 1H98A 2AIRB 2MGZB 2DGOA 1NK8A 1KONA 3GONA 4LBPA 2RQ4A 3DLEB 3QO9B 2OPPA 2B3TB 3M2UB 4ZVFA 2A3JA 2RKIA 3CCQS 1NM2A 3EDRB 2CJ9A 2HNZB 4LFBF 1U6FA 3MR3A 4U96A 2KU7A 4NA2A 4LF4J 2XTJP 4C3MA 3KLVA 3OFEA 4JI0F 4C11B 2RH3A 2LVWA 1QTMA 3MMCB 1TL4A 4JI2F 1CVJA 4Z37A 1G3OA 3KLFB 3UQSA 4Y2MA 4OZ1A 1RT7B 3HFZB 5FD1A 2UUBF 4MKYA 4C8ZA 4QU6A 3OR1B 3UR3C 4BLGA 1VC6A 3QIDA 3HX9A 3RB3A 1ZA2B 3QIPA 3A8JA 4LSLB 2XMAA 4DV1J 3UCZP 4E0DA 2HYIB 4WTYA 4DR3F 3ZC4A 2DHAA 2DNNA 4OYOA 1WC3A 4DDFA 4O3SA 5HQMA 4KY3A 1WHWA 5IT9U 3OHAA 3K59A 1D1UA 1G6BA 3PW4A 1T9XA 3EGWB 2BRLA 2UU9F 1KTQA 1VQ8S 1Y5IB 2KN4A 3DM2B 4G1QB 1D3WA 3IA0A 2CQ1A 1QUPA 3OD2A 4C8MA 4GVLA 3JS9A 5IV4A 3CMES 2YWHA 4FKYA 1UPPA 1W2BR 4MMOA 2EBEA 2J7WA 5CAAA 2XB2D 2MEWA 1SIZA 3MM7B 1LWCB 3VCDA 4RW8B 3EGZA 3I87A 1GH8A 3MEGB 3QQCD 2ZBPA 3C15A 4NCBA 1Q78A 1F6TA 5BYSA 3EPGA 2HHUA 3MEEA 1DY3A 1B70B 3H2LA 1BE4A 1HBMA 4D3GA 5KFQA 3NP5A 1R0AA 1S0OA 2OPRB 2FJVA 2RU3A 4YHHJ 4OZ2A 3G8TA 3H2UB 4ECRA 1Z2ZA 1AFJA 4HDHA 4P71A 1IUJA 1WDDA 4L73A 2MXYA 2MPUA 1YDLA 4YR0A 1NAQA 1JLQA 5F8MA 2I1RA 5ITHA 2NCKL 2NXJA 3HSJA 3D4JA 3CT9A 4ECZA 5KFGA 4PQUA 2WK4A 3OXGA 4KO0A 1L3VA 3T19A 4DFMA 2FZGB 2N7YA 4GC7A 2CPDA 3CMQA 3TP2A 3RB0A 2EPIA 2LYVA 1DAXA 1P9QC 1AT1B 5J1EB 2C2EA 4ZPBA 5E0OA 1U48A 3M05A 1N5YA 3VF0B 3EZOA 2UVVA 5IC4B 4PQUB 1FKPB 1RT6B 4NYPA 5HJXA 1KQKA 4MFBB 5HMWA 1P27B 2BUNA 3M6VA 5ETPA 4I56A 5KFMA 3NS7B 5LSOA 2BR0A 2V2QA 2HWIA 2KYXA 4JI5F 4DQQA 2PN6A 2JL9A 3L9ZA 1VQPS 2BJDA 4DOZA 2OELA 3PEHA 1LFPA 2ZH4A 2RDDA 4JI1J 2PO4A 1Q79A 2VPYB 3J7ZT 2RRBA 2CKWA 2OFGX 2O67A 2W24A 2W25A 1NSQA 2QV6A 1RWNB 4HT7A 4CYUA 3W65A 4NA3A 2GHVC 2GW8A 4PABA 3W9JA 4X4TA 4Y0FA 3Q8YA 3T3FA 3V5RA 3KK1B 2MQPA 5DZ7A 2D74B 3CJQA 3D0IE 1TL1A 1Q5VA 1GXUA 1IJEB 3MCMA 4ZVPB 3SDEB 3M6UA 3UVJA 1WC6A 2RIJA 2WBMA 4LRBA 5B0AA 2VG6A 1K8AT 1Y3KA 4RU9A 1J5OB 1VCTA 3AB4B 5KFDA 2ZH1A 4A8QA 3C14A 5C42B 4LRFA 3U27A 3H5SA 4DV5J 3KKFA 3HFVA 4L74A 5EX0A 1FFSB 1X0PA 3HD1A 5BR8J 2ROGA 3M30B 2M9KA 1NZAA 2MMYA 4UZCA 4ZJQA 5E3PA 2M3DA 4C8NA 2E7VA 4WP8A 1RLCL 2M70A 1RCOB 2FJBB 1MU2A 1H7WA 3NG8A 1FKOB 4F4AA 3NY0A 3SZ2A 2DB1A 2K1RA 5ETVA 1JWWA 5K8OA 1MMDA 4JI3F 2PI4A 3MPWA 3FEXB 3R7BB 5AE2A 1Y4ZB 1S79A 3N0VA 2V50A 1R3NA 2WSEC 4EUVA 4ZKAA 3PR4A 3ET6B 2R2UA 4IR9A 2DT9A 1BHNA 2NYIA 4LVNP 1RT4B 4UOGA 4ZITA 3KWMA 5HP1A 4ZIVA 5HANA 4LF6J 2CXEA 4LMZA 5E3RA 1TV6A 3AJ1A 1RQ0A 3THPA 4DX7A 2E1CA 2IJFA 4PQAA 3H5XA 1EP4B 1IKXB 3EICA 3LWMA 4OZ5A 1RWPB 4YY3J 4DV7J 1UPMB 2BEFA 2P9CA 2JRSA 2P5VA 2DH9A 2CDQA 1RP5A 2V2ZA 2QGFB 2OHDA 4H4KC 2BW7A 2P9EA 5HATA 3LF0A 3FEYB 3NGRA 4DPTA 4C9DA 4ZVQB 1YQHA 3P5TL 3TJAA 2GIRA 5HL7Q 4UQTA 4IFVB 3POTA 1T8EA 3K57A 3LTOA 5K8PA 4WZMA 2RD5C 1KTVA 5D0HA 2GA7A 4ZLJA 1T7PA 4AL5A 2HHWA 4DPWA 1HPZB 1KS2A 3MTJA 1VQ9S 1K9MT 1M5PC 2R2SA 1RACB 4ATNA 4OHWA 5A6PA 1UTAA 4ELUA 3AD9C 1N5TA 1S6OA 4IRCA 4IDKA 1HWJA 4RNHA 2G0IA 1MMNA 4B9UA 5ETTA 1ZS6A 1O8BA 3EGNA 2QA1A 2A6MA 4GO7X 4JI8F 1VQ4S 2KH9A 5IOLA 1JLFB 1WSRA 2NREA 3CXCR 4LFCF 3G6XA 4Q8EA 1FKPA 1RT6A 1CEZA 3W5YA 2KVIA 1J27A 2J8SA 2M8HA 5DLFA 3CNQP 1X4BA 4LIRA 2Q6CA 1YI2S 2XEXA 1NKBA 1KR4A 2DGTA 2ZUAA 2CIMA 2DNGA 4I7FA 2K3IA 3NMAA 3HD2A 3T5JA 4KR0B 4U8YA 4URQU 3BB5A 2XZDB 4C2MA 5EWEA 2I8EA 2RUGA 2UZAA 4FVCA 2EG1A 2XG8A 1NSPA 2MY7A 4K5SA 3D1HA 3IC1A 1L3KA 4LF8J 3KDNA 1NH8A 2QN6B 4O44A 4RO0A 2J0XA 3HKZD 4DN9A 5A8KB 1KRPA 3SV4A 2JC0A 1S57A 4Z7YA 5LMNJ 2YBVA 1N52B 3D28A 5HBMA 5DJBA 1Y0HA 2YY3A 3I5AA 2ZM6J 3NL0A 1K44A 3VGUA 5GAEU 4RU2A 2DEIA 2XCPA 1MROB 3KLHB 2QLWA 2QMWA 3W5XA 4ID5A 1CBKA 1RI7A 2ZVIA 2F9JA 2SXLA 2CYYA 2DYAA 2X51A 1IKVA 5IFMA 5GADI 4KJIA 2CRLA 2KB2A 3TNVA 3TVZA 1M5SA 2JFKA 3MM7A 3N6LA 4RW4B 1S9EB 1N5SA 1YJNS 2CAJA 1ICEB 4P52A 1Q8IA 3K7RA 4PCQA 4LFCJ 4X4OA 1M5KC 1LQ9A 1RT5A 5E3CA 3ZZRA 1HHSA 1OQ3A 4DI6A 1U45A 5GAGU 1YHQS 3GCWP 2DNOA 2PA8D 3Q22A 4KFBB 4MAKA 5LL6d 3ZTRA 1S7IA 2DR8A 4CLWA 3PIPQ 1U0SA 4PAAA 2WVBA 2C2ZB 3BKUA 1CC8A 1FT8A 3IMQJ 1FD8A 4NOHA 1XWLA 1RTIA 2X3GA 3LANA 5KT4A 3I5CA 2JX2A 2PSZA 3MHYA 2F8HA 2MLXA 4B3RF 3S1TA 2LLZA 1XNQF 3CD0A 3BO4A 1FDNA 3H4BA 5A8RB 4KH1B 4TNOA 2Z4PA 3WDOA 3L4BC 4DR5F 1SB6A 4USHA 3HVRA 2HIQA 1UFKA 3DFEA 1PYOB 1IKYA 1XERA 2OH2A 3AD7C 1WEZA 2DEJA 2HSEB 2JZ5A 5B08A 3C66A 1T02A 2L08A 4IG3A 2Z2LA 2BQ3A 4ZVGA 1YTYA 2IJRA 2LU1A 4ZS6A 1D9DA 4B9MA 3G9CA 3X1LB 1W25A 2Y8YA 2GIFA 4F02A 4J9MA 1G2EA 3M2VA 5D0GA 3TJ8A 1NLKL 3CDBA 3HVTB 3UDCA 1BC6A 4NLXA 4X64J 3CCJS 2DH8A 2G2YA 2HFSA 5D3GB 2V34A 4WPAA 4CO5A 4J9RA 4PWDA 4ES3A 1VHIA 3W2VA 4IO9Q 4JYAF 1X5TA 5A8WA 1VQYA 3HHKA 4LRAA 1P9YA 4X66J 1AROP 2ILZA 2YNGA 4ZJOA 1NDLA 2IRXA 3OL7A 3M9OB 3G8SA 1S1TA 3GJTB 2XS7A 1HNWJ 3LP1B 4CDIA 2OSQA 3TZXA 2XSJA 1V5VA 5BR8F 2QC3A 3MMJA 1FE0A 3Q8VA 1RTDB 3OSPA 3ZZZA 2W01A 1X4HA 1ZM4A 3CC4S 1FO1A 2H51B 3AAWB 3CCTA 3DGPB 3JAMU 1FF2A 1H72C 2LDYA 3KYLA 2KZMA 2R8IA 2BJ8A 4ILRA 1ZOTA 2EEYA 2FJDB 1M5HA 1RBOB 2B9XA 2EW9A 1HWUA 2OEMA 1UCNA 3GG1A 3BH6B 3FRZA 4UF4A 3IRXB 3SEOA 5DGBA 3PKYA 4B3MF 1FDBA 1ZM3A 1I3OB 4FYYB 4OYPA 5LJ3Y 4KHPJ 2R3VA 2HHXA 2KRBA 1IKVB 2QYGA 2GFFA 4AFFA 4URGA 1NU4A 2UXDJ 3LWLA 1RWOB 2LXIA 3SCJE 2H9ZA 4WIIA 2H5IB 2ADBA 3HM9A 2RQCA 4F4YA 4KKOA 2AZ3A 1FJGF 4X64F 3UR0A 4DV4F 1Z2LA 4AL7A 1HQ2A 1WD6A 3NGSA 1JB0C 3CJ0A 5D4NA 3GMGA 3N28A 1RK8A 2N3OA 2GC8A 5HVGA 3RAMA 1XN9A 1RAJA 4EGLA 1RT4A 3OR2B 3JSYA 4PYDA 3MECA 2J9EA 1SI9A 1OIAA 1U02A 2B4OA 1D9FA 4V1Ak 4WU3A 1X5SA 1L3TA 1JNZB 1KQGB 3PYEA 3Q83A 4WCEQ 1UETA 2CZ9A 2VQEJ 2IY5B 1FHTA 2EG2A 1V3RA 1UJ4A 2FHKA 2YH0A 4KGZB 3J81Y 2JHEA 2PI5A 1N33J 1RT1B 2OI2A 1T9YA 1VR6A 2I9SA 2JWNA 4DV7F 1ZH5A 4IDKB 2BJ1A 2OPSB 1QVFR 5I3QA 2CADA 1RSCA 4H4OA 4D3HA 2MQNA 1NK5A 1AZSA 2WONB 1CULB 3E01A 2HBZB 4HTJA 1K0VA 1QSLA 1RJJA 4RL1A 1S6UA 2V9WA 3CB4A 1ZA1B 2PFDA 3DRPA 4J9LA 1FJCA 3CJRA 4L76A 1NH7A 2MJUA 2POKA 5C24B 6FD1A 1TL3B 2DNKA 2HS0A 3ETMA 4A48A 1WEYA 4HI1A 3VALA 2RILA 1NKCA 1OYDA 2RQKA 3HHEA 3PX6A 2CQGA 3PJXA 2LXFA 3MFHA 2IA6A 2FGOA 4B9TA 3CDWA 3OJSA 1CC7A 3QGPA 1WACA 1LXJA 3AODA 4DV3F 4ZK7M 2D3ZA 3BH7B 4OI1A 5LJ5Y 1T05B 2W1BA 3ILIA 1LWFA 4K4VA 1RWKB 3R7NB 4CLZA 2HFVA 1S1UA 2VC1A 2HMIA 2YKMB 3BDEA 1MLAA 3CO9A 3DHXA 3H98A 3HSDA 2M2BA 3M32B 1X4AA 4UW2A 1CJVA 5FIIA 1KNZA 2DNYA 1HBUB 3QRQA 3DRSB 1HBOB 3BGRA 1OWXA 2HURA 3FUYA 4MKBA 2NR0A 5CYQB 1KQSR 3OXLA 2NS1B 3MMBA 3VQTA 1VOMA 5K20B 4K0KF 1RHMB 3K5NA 2ZJRQ 4IQXA 4HHUA 4PG5A 2V8VA 2CQ3A 2FYXA 1Q16B 3GFHA 3PW7A 3FBEA 3OXFA 4NLPA 5LMNF 1ZAVA 3PX0A 4PXBA 3C14B 3CCUS 1Q4RA 3DGVA 1S77D 1X0FA 3K17A 4HEA9 5KFPA 1HL6A 1YLXA 4UTGA 3TA1A 1KC8T 1SKRA 1DQ9A 5L9NA 3DYAB 5AXMA 1LKZA 1LWCA 1L5UA 2ZBQA 1T11A 3I9ZA 3PW2A 1VQ6S 4P2MA 4YEAA 3R2DJ 4ZVEA 4NLOA 5ETRA 1EIYB 3JB9k 3PO4A 4X62F 1PSDA 1KBRA 2AF6A 3Q8UA 2GHWA 1OY9A 5KFJA 4HH1A 5E2QA 1NUEA 3BKFA 1WC5A 2A18A 5HP1B 1GMUA 3MM6A 4TQRA 2YPZA 4DV0F 1S6PA 1SQEA 2HS4A 2MJNA 4UOFA 1C1CB 1UA0A 3DOKB 1NK7A 2YKAA 4Y2AA 1TMJA 2BE2B 1EP4A 3R5CA 3NBPB 2U1AA 3P96A 1JLEB 2MZSA 3IWNC 2ZWOA 3KLFA 1S9GA 5CHCB 1SV5A 3ISZA 5HI7A 3EVMA 3UN3A 5CYJA 2VC0A 2PC6A 2XMKA 3KK2A 3CC2S 5H9EK 4L75A 4ELVA 3QLHA 1JXVA 1FWPA 2DPJA 1UW9A 4L3NA 4OLOA 4CT9A 1REVA 1VK8A 5KFLA 1JIHA 3CDEA 2IRYA 2IVMA 3DRPB 5CABA 3PFOA 1SL0A 1QAIA 3MEKA 4ICLA 4TLRA 5KG0A 3OTOJ 3FNNA 4HR2A 5DDRC 4K4YA 4QPXA 1SJFA 1YVFA 3KG1A 2CG4A 3FCWA 4I6WA 4O3OA 4RBTA 3V4IA 5DG7A 3UW1A 1SH2A 1EZZB 2QJ3A 5GAHU 3G6ES 2C3UA 1U24A 3LPYA 2FDNA 2NPFA 3MEGA 4OX9J 4DV0J 2A0FB 3EUNA 2OMLA 3CCRS 4EBDA 1WHYA 4JI6F 1C4AA 1HNVB 2HGLA 3ADAC 3W9IA 4F8RA 2A1BA 1CLFA 2YNGB 4DSLA 4B3MJ 2XY7A 1WUUA 3GFYA 1K1QA 1A7GE 2HQ3A 2QLJB 1TMMA 2YKMA 1F60B 3D0GE 3R5DA 1ZPVA 4X84A 4X66F 4ES1A 4K4XA 3QSIA 3C6TB 1KOHA 3FRYA 3HHDA 3IGNA 3BGFA 4QIGA 8RUCA 2QE5A 2ILYA 4USUA 2COLA 5IT4A 3DLBA 1NPRA 4EBCA 1MSWD 4HHJA 3P45B 5K14A 4IH7A 4ZCIA 3NGTA 1DTTB 3QFWA 4F4WA 2H5JB 4LR9A 5AE3A 3G96A 2VU5A 3FQLA 3RZAA 3FBFA 2FZKB 3FZBA 5ETKA 1UP1A 2MKSA 2HBYB 5KG1A 2VG5B 4M5DA 1N32F 3QAUA 3CMAS 4B3TJ 2J6SA 3W3SA 4DG1A 2DBBA 2HQFA 3Q8RB 2JEJA 4LF8F 1WJ9A 1GX6A 2EFNA 1HBMB 1WKJA 2EK1A 5MLCV 1NB2A 2VUGA 3LO3A 1O0PA 2K2PA 3PRVA 1R0AB 1DHMA 1VRQC 1OMSA 1H6KX 3NGUA 4Q0BB 3EPIA 2MKHA 5HAOA 1D0EA 3M8QA 1UVLA 3IR7B 5H9EJ 3TVKA 1U1MA 3MMAA 3OUYB 5A6WA 3SXLA 3RGIA 4CO2A 1W2IA 4FF2A 2KRRA 4N76A 3KOAA 1VIXA 3EYZA 2E9ZA 4J9QA 2UXBF 1RAGB 3O44A 3R1LA 5SUHA 3D68A 1PBUA 2CQDA 2H65B 1N34F 4UY8T 2RNEA 1TKXA 1I6JA 2CPZA 4PRFA 4KGVB 2RJZA 4M1KA 5KFCA 5DM7Q 2PA3A 1F0XA 1APSA 1OJ4A 2BJ7A 1UFLA 2OKQA 1TP7A 2RAQA 4KPCA 3ZNJ1 1H2VZ 2X7IA 5L1IA 2NUHA 1SJ4P 3KLHA 2R7WA 3LUYA 3QLHB 4FF1A 1BY9A 1VQKS 2RDIA 2XMJA 4EMDA 4ALZA 2GQQA 4M5MA 3B4MA 2BM1A 5KFOA 3OTCA 3HT0A 3CULA 4OHXA 3HI9A 2XC9A 4X4RA 1P1TA 2LQ5A 1IKYB 3ILOA 1VRUA 2VD3A 2L9NA 3BS9A 5HLFA 4DPXA 2ZITA 2IRUA 2C2MB 3BREA 3HCXA 4AUKA 2LDIA 4I7FB 2JH3A 4R25A 3BGRB 2XHWA 5IWAF 3GIMA 1O6XA 3QPIA 3KG4A 5F8NA 4GRSA 3M2UA 2ZNYA 4YB5A 2WB1D 3GR1A 2QYCA 3I4HX 3PEJA 3T5HA 4B9LA 1SQFA 2HWHA 2Q3PA 3NCQA 3DOKA 1JLBA 1YG0A 3B82A 4G65A 4OI2A 1FK9B 4KFBA 5C7PA 4P9SA 1N34J 1I5OB 5GMEA 4H4MA 1UWBB 2QMUB 4ED7A 1TAQA 4XAKA 2VIHA 3R5BA 4DV1F 3IWXA 4OYIA 1WC0A 3IXQA 5DRKA 4OX7A 1FCAA 2EK6A 3JTNA 5HVFA 4DR3J 2PFFB 1URRA 1VBYA 1WDTA 2X3DA 5K5MA 3TZYA 3VAHA 5CCMA 3KMSA 2YQ0A 4DR7F 1BQNA 5LSLA 1PAUB 5DQIA 1S0NA 4W92B 2C2OB 3KHHA 5KT7A 2CNKB 1HHQA 3FJ2A 2Y9HA 1S59A 1XK8A 3VAMA 1IBLF 5L9XA 3EMTA 5T7LA 2UUCF 3IG1B 2F4FA 2UXDF 5A0YB 2VQFJ 4NX9A 4CP5A 1JK9B 5CD4A 1V3SA 4N56A 2RU9A 1LEOA 1WC1A 2NXUA 4USIA 3N6NA 2KXHA 2DXDA 1BQXA 4OX8A 5IV3A 2KJVA 1RE1B 1RU1A 2J9CA 1MW7A 2HQGA 2Y0SD 1RT1A 3KLIB 3FQKA 4WFZA 5IQQA 1K0TA 2AMCB 2EFOA 2V5HG 2FC9A 2B7BB 3FGVA 1H74A 4YB1P 3Q24A 4P75A 3MUMP 1S1UB 5I3UA 2HMIB 2HHVA 3I5BA 2YWKA 3T1YF 2ALZA 2FB0A 1PYSB 3NRBA 3V2UC 1YZ7A 2W2OP 5KG3A 2PEHA 1DTQB 4OZ3A 2E9TA 2MYFA 1SH0A 4U8VA 2OO4A 2W4DA 4ES2A 3N79A 4A8YA 2OIHA 2DXEA 4ID8A 3UI3A 1WTBA 3MM6B 3MAQA 1EKSA 5I42B 3R7SB 3MAAB 1IR1A 3M4XA 4DUYF 2RF2A 1HNIA 1XMBA 2GCFA 4CRJA 3P8BB 5HN0A 2PMZD 1D09B 4U7CA 2ZOMA 1B3TA 2E5LJ 2Q6BA 3N01A 2MZQA 4ZP8A 2ZH9A 1NDPA 2ZDOA 1KKHA 2EWHA 4CQ1A 4LIWA 2CQCA 2XYGB 4DPYA 3R6LB 1NB7A 2BOAA 2L9WA 2YXLA 3NAHA 3TR5A 1KFDA 5KFYA 3MOZA 1EQMA 1X4DA 2HRUA 4ANCA 2B8PA 2CFXA 1SQGA 4C97A 5B0DA 1RU2A 3MGJA 3RB4A 5D8HB 1K1SA 4LF1A 4OMFG 4PR6A 2YNFB 2KHDA 1LXNA 1S9EA 1U2CA 3O5TB 4MYUA 3I0SA 4X65F 5L1KA 1DLOB 2J6TA 1YK9A 1ZZFA 4CO0A 1EARA 4NZ7A 3U7JA 4EBEA 3U1MA 3IG1A 1EJ7L 2KT3A 4CYUB 2VPZB 3A8KA 1GEHA 4M5GA 1TL7A 3PXGa 3KFWX 4FKXA 4DPOA 1HBNB 3OW2R 3PW5A 2VBWA 4KGMA 2R8GA 1VJWA 4RW6B 5A2QU 3KK1A 3MMBB 2IC3A 1K47A 2BKOA 3NXZA 1OO0B 2MKJA 4IH6A 3W7BA 1C4CA 4ZHRA 2VICA 3MEDB 4QZVB 4FXDA 1IQTA 4I2QA 4Q7AA 4USKA 4J5OA 3WIVA 1RBAA 3GWCA 1P6TA 2MKYA 3K8WA 4NL5A 5GAHI 3UD4P 1U1PA 1Q8BA 3T5LA 1T03A 2C3MA 5FDLB 4L3KA 3QATA 3D2WA 1HYSB 2QFIA 3A12A 4NXMJ 1H38A 1TFWA 3W64A 3HK2A 3PHTA 1UWBA 5KFRA 5F9NA 1NK0A 2VA3A 1C0UB 5D0EA 3EVWA 2YVSA 4ZVTB 4B9VA 4DSFA 3RYLA 1Q7LB 1HARA 1T94A 5D0RA 1TKTB 4RUHA 3ZZUA 4DX8H 5G4DA 3AQPA 3IBCB 1SL2A 1QLNA 3DLLQ 2LA4A 2ZD1A 2OMOA 2WHOA 3HHLB 4K2XA 1S48A 3GJSB 1URNA 4B3OA 3OT9A 3GV5B 1X7VA 4JBCA 3NGDA 1UJ5A 2PE8A 1AA1B 2FVCA 2RB7A 3LPEA 5BJRA 2FLOA 1U0HA 2AHOB 1KLMA 5DGAA 3OBIA 4NLRA 3TO8A 4DR5J 2XO6A 4DSEA 2GMJA 3QT8A 4ECSA 1IXKA 2MDAA 2YNHA 5KG7A 1UVNA 1JMTA 4J9VA 1RT2B 2V4JB 2YPYA 1ROFA 1T9WA 3ENAA 4HACB 4H4KA 3G8QA 4J9PA 4OYBA 4PWUA 2W9BB 3TEHB 5J1NA 3CD5A 1JLAA 1UMJA 2JSXA 9ATCB 1HWLA 3A1YG 4I2PB 4RUBA 3H25A 4U9RA 4CM0A 4K4UA 3ZFVA 3IM9A 3TYTA 2FC8A 3DHWC 2IBOA 4EFAC 3DN9A 3ZZOA 1F5BA 3AB2B 2P6SA 3BYRA 3LP1A 4LVOP 3OUYA 2VBYA 4H4MB 3VGTA 4DSKA 3DOLA 5A8WB 3BSAA 4C3KA 2GQ2A 2C3PA 5HJYA 1U6BA 3KNAA 2FPHX 3CF5Q 4WF9Q 2YKNB 4OI0A 2DVIA 2ASDA 3R3TA 2LEBA 1WELA 4LT6A 4OZNA 4DU8A 2WSFC 4CZCA 3BBBA 1VRTA 1S9FA 2BM0A 5J1EA 1KDNA 3BPSP 4LF2A 2DHGA 5KOWA 5T14A 1PCAA 3CSKA 2CJQA 2W2MP 4DR2F 1Q7YT 4JI8J 4B9NA 2E1PA 2HRYA 2MHEA 2E7WA 3O1LA 2FLNA 1PO6A 4TU7A 3J7A1 4M8LA 2V63A 2VFSA 1RAIB 4N8OA 2HNZA 3QJPA 2LKZA 4DR4J 3HHLD 3GFZA 1R6VA 4OIXA 2YX1A 5HQ8A 2XM3A 3KK2B 4DQPA 3LH2S 4K50A 4RKUC 1NSKL 3H5UA 3KLIA 4C0OC 2ZJQQ 3L7UA 3I82A 1A6LA 1HI1A 4TY8B 1U1RA 3C6TA 2MSTA 2ZNZA 1CSJA 4O4GA 4C98A 1VK3A 2DISA 2R2TA 3PKMA 2PEBA 3T1HJ 1IR0A 2I5JA 3HMJG 4RJVA 2ZM6F 4BWMA 3OJUA 4YR3A 4A8XA 2O3DA 4BC7A 4ERDA 5FDLA 3D9BA 2KFYA 1RA7A 2C2NA 3FK4A 4USTA 1EQ0A 3TAMB 4F50A 4EO8A 4OYWA 3G2XA 1ZETA 2W7OA 1VJQA 4DX5A 1WOPA 2HLTA 2UV8G 3O6QA 4C0BA 3PRBA 2DR7A 3JYTB 3TQ1A 4JV1A 1HNVA 3QGHA 2W2PP 4NASA 1RTHB 4K0KJ 5IXUA 1F5CA 3OTEA 1I1GA 4YR2A 4I1TA 4QIFA 3W1YC 1XNQJ 1LNQA 2JFDA 2CWXA 3MTKA 3CW2C 4DN0A 1YZ6A 2FIUA 1L3UA 4B3SJ 4ELTA 1GQEA 2AYMA 1U0HB 2E5JA 3MMAB 1T95A 4HT5A 4TXSA 4DR4F 3I0SB 4M5IA 5LMUF 3BSOA 4IQMA 1HWIA 2DNMA 1FRJA 2YNHB 1HR0F 3AQOA 3KUEA 1KLMB 2YWEA 1EAYC 3FBBA 4DR2J 5KTQA 2DTJA 3C16A 4Z7CA 1IN0A 1CQMA 1EHWA 3P4UB 1ZYQA 4M5NA 4CLFA 1JJ2R 1FWKA 4DQRA 4KQZA 2JOQA 2GVZB 2NPIA 3DDNA 3I4PA 3IO1A 4KHRA 4Y3CA 3M8RA 1XMOF 2UUWA 3BPDA 2UVUA 4J9OA 1PC5A 2GX8A 1WEXA 4YY3F 2BYCA 4WJBA 3ZZTA 2DD8S 1GMWD 3TUZC 5L8RC 1REGX 4CM2A 2D7SA 3DCAA 1FXDA 1U2FA 2F40A 3T1YJ 1YJTA 2QTWA 2XMVA 2G2ZA 3SBMA 4ANDA 1OPIA 3C15B 4NLVA 1C0UA 2I38A 2LQ9A 3EVOA 4KYZA 2B9WA 3CD7A 4WXOA 1FVQA 2E5GA 5K9FA 3ZTOA 2LMIA 4F4XA 1NJXA 2KKHA 1S1VB 2VB6A 3DRYA 4QR2A 1NNDA 1HI0P 3M8PA 2EBGA 3ETOA 2HVZA 2AX0A 5F9LA 2AX1A 2LFVA 3TARA 1Y3JA 1V6HA 2BMBA 1CG2A 2V68A 2XWXA 2A2CA 2ZOGA 3KJQB 5E33A 3K8VA 4PG6A 4DF8A 2LECA 2D9OA 3I31A 4RLEA 2APOA 3GIRA 1N0UA 3P3DA 4N7TA 3S8SA 1S72S 2KVQE 2W8LA 1VC5A 2HNYA 5KFFA 4ILMA 3R97A 3EZUA 4QQBA 1KEKA 3HZEA 4NYZA 4ZVRB 3MI7X 2V4QA 5F0WA 1MWZA 2CWKA 3W60A 1RT7A 3PTWA 1RWMB 4HLBA 1SV5B 2NSBA 1ZM2A 2YQ1A 1B64A 2E1AA 3DRSA 1B7YB 1HQUA 4RPFA 1RKIA 4Q43A 5ETNA 5I4MA 4ZCMA 5I42A 3D67A 3H0PA 3PYDA 1SKWA 4CNZA 4IO1A 4ED8A 1NZ8A 3R5JB 1HMVA 1C1CA 4KGKA 2G1DA 3NBPA 3UPFA 3KJVA 2WVEA 2FLLA 2ZE2A 2VA2A 4B3OB 2BE2A 2HEKA 1YX2A 4OZJA 3MR2A 3IR6B 3RJMB 2Z30B 4C7QA 3OL6A 1RT3A 1HNZJ 4KV8B 1FTCA 1LK5A 3GYGA 3RBZA 2LQJA 4NLDA 5E5NA 3UN2A 1VRTB 1KHWA 2CNNB 1DQAA 3MCNA 2BJ9A 3D6HB 4RNMA 1YJVA 1NPPA 3N5BA 3CO0P 2AV5A 2A2DA 4HVZA 1R0CB 2VFRA 3QBCA 4Y6IA 2BANA 2IJNA 3DLJA 3EXCX 4EWTA 4PXDA 3PV8A 1KSPA 2CQ4A 1BWVA 3CCWA 4GVBA 4CCHA 3CIZA 4DCJB 2R9LA 4DSIA 3CDAA 4PYAA 1F2HA 1GNKA 3GSIA 2GO9A 1X31C 4PXCA 2KHCA 2BABA 4LBHA 1TL7B 4DR1J 4JI5J 2Y1JA 4LF9F 1UKUA 2AJ1A 4R8UA 1X9SA 1U47A 1UJ6A 2DO4A 1PILA 5RUBA 3MURP 4A8SA 2DJWA 1SUQB 4LF5F 5D3GA 3NNCA 4JV5F 1IBMF 2ZHBA 3O3LA 4OX9F 3EWGA 4ZCLA 3PVXA 2EFGA 4DR6J 3IBWA 1U26A 3PACA 3BV8A 3TX0A 5CA5A 1R43A 2VZ9A 4ID5B 2F7VA 5EWFA 3H5YA 1FTRA 1U8WA 3CJKA 4M63A 3K5MA 4A8OA 2L41A 1TKDA 1ITPA 3J81j 2EFQA 4OLPA 1EX8A 2AJ2A 5K8MA 2DNQA 5DZ6A 5L46A 1T9TA 4AXIA 3CCES 2ZVSA 5KAKA 2DHHA 4USJC 2YNIB 4OFZA 1UL3A 4WYLA 2MQQA 4ZVOB 2IVYA 3M8PB 4HHHA 2VJUA 2IFXA 2O1PA 2ERRA 1HLWA 1QSSA 2JEIA 4FNIA 2BKPA 1GFWB 1HW8A 4RW7A 1OQ6A 1XBWA 3WX4A 4K4TA 1N4LA 5FJ4A 2XS2A 5H1SV 5JXSA 3AY0A 3A13A 1R6YA 3EE3A 5KFIA 3L95X 1SC1B 1T0TV 2GJIA 2V8PA 1GMVA 3HXMA 1NO8A 3BQ0A 1R7IA 1S12A 3Q86A 1S6QB 1N36J 2HQCA 1G7CB 2XNQA 4NLQA 3CJ3A 1R8AA 3LW5C 3DRRA 2H48B 4Z2XA 3JSMB 4F04B 2GVZA 1G4CA 2G2OA 2Z56B 4URSA 3H4DA 5H9FJ 3KLEA 2HAIA 3LP2A 1TAUA 3B78A 5A8RA 3IRWP 4O3NA 4CO3A 4U95A 3TAPA 4IUFA 2GZOA 2RUSA 3K89A 2J6UA 3C8YA 2YKOA 3FZ2A 1SXLA 2DGWA 2DCUB 1YJ7A 4JP8A 5CXTA 4NZ6A 2IBKA 2UXBJ 3DGPA 3JQKA 5CQGA 5F0UA 4O3QA 1LK7A 2V69A 5FLXY 4OYAA 2UUBJ 1IQZA 1RTJB 1W26A 2FGCA 4FDFA 5DM6Q 1NK4A 3R8YA 4AD6A 2XZWA 1FRIA 2ZH3A 3PRDA 5KOXA 4WXWA 1U1NA 4ER8A 3KTQA 2HHTA 4LF5J 1KVIA 3G82A 2GGPA 5JVGQ 3PY8A 1UVKA 1VQNS 4QYZJ 3SMZA 1S1VA 2BRKA 3US5A 3PO5A 2HVHA 4L6V3 2MZJA 3MOJB 3TX8A 3V6DA 1WI6A 2PGCA 2DITA 3ENQA 4MK9A 1JLCA 5D15A 1VC0A 2NZ4A 2MSSA 1DRZA 4DLGA 4I2PA 1BGXT 4M95A 4PWDB 3QSYB 1BQMA 1HHTP 4NLGA 4ECUA 3HJFA 2YTCA 1TKZA 5L39A 4KRWA 5KT2A 1H73A 3I56S 2WW8A 3W62A 4A47A 3B4DA 1UEVA 2HFNA 4M94A 1FD2A 3J7Z5 3M1VB 2CA9A 3C6UA 4TU8A 5EHHA 2NXNA 1XR5A 2AJQA 1M90T 1V5IB 2J7UA 4OHYA 1H2TZ 2XULA 4OQJA 3SFGA 1N88A 3KJFB 4IG0B 2D3O1 4OX6A 1XTZA 4NI2A 1RZMA 2PDAA 4DHVA 1HFEL 4X4NA 2HZAA 5LM7E 2HFZA 4KGXB 2F5GA 1I51B 1RCXB 2OTJS 3AA8A 1SC4B 3MDFA 5A0YA 1FDDA 3DLGB 1XNRJ 4IRKA 1J5OA 3QRRA 4XTTA 2R8HA 2AW0A 3ZTPA 4ZIWA 2M8DB 4DR7J 4KIAA 1VYAA 1XJWB 4KH0B 5AXNA 3BF4A 1VLYA 1NK6A 1TUVA 3MXHP 2UV8A 2YNIA 5D4PA 3AXMA 1F9EB 3D7SB 4RUCA 4U7UD 1H2UX 3MPUB 2UUCJ 3DOLB 2WW4A 1VGYA 3G82B 4NEZA 2R2RA 1QUVA 2MKKA 2DNZA 2VBZA 4CLSA 2KI2A 3MM8B 4NXMF 3PG9A 2ZOFA 2K7JA 4OYXA 4RX6A 4Q0BA 3TOQA 2J7KA 3RRGA 3OR2A 3Q23A 3BQ2A 2W9CA 1RADB 2BJ3A 1ZBTA 4DUTA 1MNEA 2RE1A 1M0SA 4QYRA 3PNIA 2GAHC 5L1LA 3NMRA 2LQ8A 4GKJJ 4UOHA 3GIIA 4LR7A 1JXLA 1RT2A 2FHJA 2V4JA 2VOPA 1AYEA 3JSRA 2HK2A 4XDDA 2C3YA 2W9BA 4C11A 3D54A 5HK4A 5E7OB 4UQGA 2DR9A 1YITS 3MMCA 2AKWB 4P73A 1VHFA 3SCKE 1DARA 4DCOB 2FVPA 1GMWA 1TUWA 1OSDA 5CYQA 2RHSB 1Y00A 5B0GA 3TUJC 5DLGA 2MHNA 4TY8A 5ETOA 2XGQA 2ASLA 3U02A 2GQCA 3JSBA 1HBUA 1SJ1A 4TLQA 1S6PB 1YWXA 4LQ9A 2RF2B 4EYIB 1TKTA 4OI4A 2ZH2A 3BR9A 3JAMY 4K4SA 3MAAA 3T9NA 3DKDA 1JNRB 2DRBA 1FX2A 1C1BB 1UEKA 3BM7A 2C3OA 3V6DB 3SV3A 5IC6B 3HPOA 2B9EA 4MYTA 2VG7B 4UUXA 2XY5A 3FBCA 4PEOA 1HNWF 4ZN1A 4TVAB 1S1XB 4LF9J 1PGZA 1LW0A 2JDJA 3BEGB 3EXYA 2A10A 3DYAA 3R5GA 4AT1B 3UD5A 2PMHA 2KYZA 2XY6A 1HIYA 3D3BJ 5F3ZA 5F8JA 4CLUA 1ZTTA 1U1OA 3WZ0A 2L3MA 2QT7A 1NMEB 1JLAB 2AEJA 3SQOP 3AJDA 2XMUA 1QJHA 4FZVA 2Z2MA 4ICLB 4MJKA 5ETSA 2FJAB 5ADZA 1VQ5S 1GT8A 5J2QB 4KHMA 5ETQA 1QAYA 3FMWA 4RW6A 3EDQB 1YJWS 3POTB 4ZP7A 2OPQB 5B0CA 5KFHA 3D5MA 4OHZA 4DR1F 2KFZA 4DU7A 4O4GB 1S0MA 1OYEA 2AJ0A 2DNLA 4X62J 3NNAA 3LAKA 2B0GA 2VJVA 3FMBA 1FJGJ 1FXLA 7FD1A 1TK8A 2AYBA 4QR0A 1Y11A 1Y9OA 1JLEA 1T3OA 2PMWA 4JB8B 4LREA 3IP0A 4RW9A 3TQEA 9RUBA 4KT0C 4QIEA 1FNXH 4TY9A 1TU0B 1FESA 2VPXB 1FFGB 4JOUA 3CGIA 3DDIA 3Q0AA 3RAXA 4RNOA 1QVGR 1KD1T 4WZQA 4WTOB 4KHPF 3U1LA 3MPVA 2HBRB 1SBRA 1QE1A 4GVBB 2AU0A 2HVEA 4MK7A 3MM5A 4QJVA 2EKYA 1UVMA 3IN5A 3DLHA 3Q8PB 3T5KA 4QWDA 1PBAA 1KOOA 3AFGA 1KLNA 1JJHA 3UDLA 2QL5B 2BE9B 3ET6A 2F8EX 1VQMS 2IHR1 2LA6A 3CJ5A 2HNDB 1NHKL 4PG4A 5KFZA 2V2VA 1PG5B 3NEKA 4OL8A 1ELOA 3MR7A 3MEDA 4ZP6A 1G1XA 3PYFA 2CNOB 3EM1A 3GJRB 5KG4A 1HMVB 4ZHRB 4CTAB 4ED6A 4DQIA 2CQIA 2IPOB 5H9FK 1JQGA 4RWWA 2DNPA 2NXCA 4AE5A 2QFJA 4AQYJ 1OY8A 4JI4J 5D6GA 4HKQA 2FZCB 2XCAA 3V4IB 2JJ4D 3UE2A 1HQEA 2E44A 4F36A 1TK0A 2HFUA 1RB0A 2FD2A 2HLUA 2GVDA 4IFVA 3OHBA 1Z4UA 4ECVA 1WKKA 1PAEX 3W8GA 1GX5A 2IMWP 1U25A 3C2PA 4Q8FA 4JI3J 5DDQC 2EI5A 1C0TB 3N4WA 1XQIA 2QL7B 4LRDA 4QIWD 2XLKA 2CPYA 4AXJA 3OTOF 4F25A 3LALA 2G0CA 2YNFA 2CQPA 4KB7A 4FXWA 2DRDA 5GAGI 3M32A 4PG8A 4I6YA 2ATCB 5BYRA 1S1XA 4OJ1A 1IBKJ 3G86A 3G87A 4V19J 2OLWA 2HFOA 2EFPA 3A3NB 4PXEA 5AT1B 3BO3A 2Q43A 1DQ8A 2FY8A 3MM5B 1JLGB 3TEGA 2ASJA 1NJIT 3PW0A 3SYZA 4X4QA 5T41A 4B3TF 2E7XA 2R4FA 5D78A 5M2PA 4ETXA 4LFAJ 1Q53A 3NS5A 3VHQA 2CZVC 3CEDA 2XMMA 3F56A 1X4EA 3H8YA 4DF4A 2XSFA 4A8FA 1FKOA 4ZOSA 4IFYB 3MM9A 4NRTA 3QAEA 4P10A 1CPZA 3SCLE 2DK2A 4DXLA 1FVSA 2JLGA 3BDPA 2VFUA 5HVHA 1X9WA 4DUYJ 3LOUA 5KFVA 1IM4A 3S01A 2GMHA 4USMA 3NWGA 1EETA 5DDOC 1VBXA 4EO6A 2Y1RI 4RW9B 2YWFA 2MQMA 1RDRA 3CD6S 3RUBL 5K14B 4E8UA 4OZLA 1R8PA 3BN7A 3BBCA 3Q2SC 4BWJA 3V6JA 3VR1A 3VVUA 4HDGA 5BXIA 1U4BA 3MM8A 2WVDA 2HVDA 1FRHA 2N4DA 2DH7A 4IKAA 4NMXA 5THWA 3RG6A 3U1NA 5LSRA 3GV7B 2X1FA 2HAFA 3SCIE 1JLCB 3VGSA 2VFTA 4ZPVR 2Y3YA 3FSYA 3FDSA 3MD1A 3QWUA 3NCRA 3BGUA 1HI8A 2AT1B 2D3UA 1U1QA 5HO4A 2J0SD 3M6WA 3G6YA 4WFYA 4C8OA 4GKKF 4ECXA 1SPBP 1CJUB 1YKWA 2GMLA 1LW0B 3M8QB 1U49A 2ZDPA 2GJFA 5DETA 2G13A 3H42A 3NGKA 4NLTA 2AEMA 4XO0A 3HP6A 2VKZG 3CE8A 4ZA1A 2Y1LB 3EZ5A 1WI8A 2QA4G 2AZ1A 1UVIA 4G1QA 3GV8B 3DU6A 3D0HE 4WBFA 3TA2A 2RS2A 4P7VA 4KC5A 2MQLA 2WAQD 3DI6B 3TVYA 2R7SA 2UUTA 1GK8A 1OSCA 4M5JA 1RAFB 3C16B 1SC6A 1FNOA 2J5AA 3GLJA 4JI4F 3JTPA 3J80U 2HIYA 1NSAA 4H54A 1H3DA 3MPDA 4PPZA 3RW7A 5I3UB 4YHHF 2XQCA 4QBUA 2XO7A 2UVWA 5L38A 3N9UC 3BO2A 5GMDA 4ANEA 2DO0A 3IRXA 5KFTA 3GG0A 2V9KA 3LA0A 1N6QB 1S9GB 3QJLA 3ILJA 2C42A 1UZDA 3M30A 1B0VA 3OSNA 1BQMB 2KXFA 1J5EJ 2BV3A 4N47A 4ZCKA 2KM8B 3HT3A 3R2CJ 3DRXA 2W7PA 4F4ZA 4P72A 3TRGA 4PZVA 3KDOA 3AOBA 4RBUA 2BE7D 3TJ9A 2WB4A 1YJ9S 4V19X 3QMQA 4PKDB 1NEEA 2E5HA 4YOEA 2OTLS 4ILLA 1R31A 1IWGA 1MN9A 3M8WA 3ISNC 3PFEA 1QM9A 1S7HA 3BR8A 5CZVA 4JV0A 3L7OA 4WE1A 2XYPB 4DFPA 2HHHF 2YQ3A 3GPAA 4FNHA 4ZPAA 3GCXP 2N7CA 3VAJA 1FEEA 3PYGA 1IBLJ 4CO1A 2PT0A 2EFVA 3M2RB 3BQ1A 4J9NA 3BN4A 4IRDA 5J1PA 2CQHA 4ZLPA 2N82B 2R8JA 5DO2A
chains in the Genus database with same CATH topology
4ED0A 4DL3A 2DRAA 2ROEA 4OI6A 5J2MB 3BSCA 3CDUA 4YB6A 3LP2B 2R7VA 1KN6A 4FXVA 1NJWA 2CPEA 3GE9A 1N54B 2AJ4A 4ECQA 4IFYA 1FKAF 2CVIA 2ZC3A 2ZFHA 2J0QD 3QIPB 2CZ4A 4IG0A 2FJEB 1P1LA 4QR1A 4F4KA 5KFKA 1HNZF 1YRTA 3HVAA 4FVMA 4EU0A 5KG5A 3DLKB 3A8EA 1GTEA 5B7WA 3OVAA 3H40A 2VG5A 4M5DB 4FPRA 2DNRA 1V3ZA 4LUBA 2F1FA 5AJ3F 2BZ2A 4WK1A 2MGZA 1Q86T 1UA1A 2V94A 3LP0A 5KG2A 2R7OA 4RUAA 1H7XA 3CC7S 1JLFA 2RKIB 4K4ZA 1U6ZA 2JVRA 3UD3P 2V0NA 1AFIA 2RMLA 1JLGA 1NKEA 3K2YA 4RW8A 3FSIA 4U7UK 4KAIA 2WTFA 3TA0A 4WKRA 1WHVA 1HNXF 1HBNA 4DLEA 3N6MA 3CUNA 3MR6A 3ISND 4YMEA 3CJ2A 2D3OR 3KK3B 3IS9B 4Y00A 3L09A 3AHPA 4BCAA 3FSXA 2E5LF 3HF5A 4IH5A 2VBXA 2Q79A 2K8GA 3KNGA 2OD4A 3ZZ0A 1RA6A 1RKJA 3CCVS 3HVTA 2JVOA 2J76E 4KSEB 1DURA 4OJGA 3TUIC 4FP9A 3O8WA 3CCLS 2VONA 3LGNA 3W2WA 2WONA 3OQ2A 2BQUA 1YGYA 4EYHB 4YP3A 4WFBQ 2KDOA 2M4MA 4RZRA 1FNMA 1FJEB 2DNHA 4LQ3A 3KLGB 2HHQA 1M5OC 2HHSA 4NRUA 2VH7A 3JSMA 4PG7A 1M5VC 4B02A 2UVRA 1TFYA 5GMKa 3OLAA 2IM0A 3GZ7A 1YRUA 4NLWA 2W4PA 4J37A 4XPCA 4Q5VA 3KLEB 5F8LA 2RRNA 4Y28C 1S99A 6FDRA 2KTQA 5IT9Y 3MECB 3HHLA 1WF1A 2L48A 2ZC4A 1TV6B 2X1AA 4TKTA 4FF3A 2CJAA 2FTRA 2R7QA 3Q8SB 4YDDB 2QZ8A 2RDJA 5K8NA 2XMTA 3TW0A 4JV2A 4G1PA 5IT0A 1JXEA 2AP6A 4DL5A 3FFIB 1U8SA 2EVZA 4KO0B 3PDNA 3VZIA 2F4VF 1JJ4A 1LOUA 4DMZA 5KG6A 1SJRA 3MCSA 4QWAA 5IM0A 5KFAA 2CVEA 2YX4A 5G0RB 2R7UA 2WBRA 1RTJA 1NHUA 2HG4A 2DGVA 3R27A 2VQEF 1S0VA 2LXUA 4YDXA 1Q82T 1HPZA 1S1WB 2QA4S 5KFNA 2AWZA 2VV5A 2W4CA 4KTQA 1TZ0A 4J9KA 4Y2KA 4WKYA 2B7CB 1ULRA 3G71S 3DXBA 4TQSA 1QAJA 1SJ3P 1MROA 2XNRA 1GXLA 2WCXA 5F41A 4DBQA 5HMZA 2FVRA 4DL0C 3DRRB 3AH6A 2XGPA 2R8KA 2VG7A 4LF7F 3M2RA 3IGVA 3T1AA 3KG0A 5B0EA 1TL5A 5J2NB 4W90B 4NPOA 1X4FA 3RRHA 2C28A 4JI7F 1F2GA 3PJWA 5BYQA 1VQ7S 3ZZPA 4X4VA 1LWEB 1VQSA 2V8GA 1KQFB 1ZTWA 1LWFB 1R8HA 2OD6A 3HFKA 1H0HB 3L3CA 4MK8A 2J8AA 4OJHA 1HBOA 5JUMA 2ZZNA 3GYNA 4C0HA 3CTRA 1U1LA 4AYBD 4MFBA 5E41A 4FYDA 3R1HA 1NHVA 2QMXA 3MUTP 4LF6F 1VFJA 2GJ2A 2ZE2B 5KFUA 1YSJA 2ZKUA 3I6PA 4A8MP 3F41A 3MZIA 5U47A 2C22A 2JLFA 3IR5B 2GIQA 2B4UA 2YWGA 5HROB 3T6BA 2FVSA 2OJ3A 2B5JB 4C4WA 3HO1A 2AJFE 1S1WA 2ABYA 5J2PB 3MD3A 1J5EF 2ZH6A 1E6VB 4O4RA 5E3AA 3MEEB 1QY7A 2KO1A 3IWLA 4R0JA 4JUZA 5C42A 5KFWA 4J9OA 3I96A 1SIWB 4TYBA 1E6YA 5GAEI 3QZ8A 4P2SA 1R27B 1QAXA 4I64A 1Y7PA 5J2QA 3P49B 2JLEA 1U09A 1GAOA 5GADU 2GHPA 2RSQA 1XC9A 1NJZA 1N48A 3VAFA 3IAM9 3M9MB 4QWEA 2FJWA 3F73A 5JVHQ 2C2DA 3DC2A 2BVZA 4X4SA 4ECTA 4GO5X 4MIBA 1VIOA 5KFBA 3QYYA 2MZTA 3DMJB 1RYRA 1N6QA 4LSLA 4DJBA 1ZPWX 2LEPA 3PR5B 1UEUA 3LP0B 4DL4A 4KKOB 2KFNA 4C8LA 2LQBA 5M2RA 4DS5A 2ZUGA 2ZKTA 3J7YI 4IG3B 4N77A 2MY8A 4QW8A 2ZD1B 2BW2A 2MKIA 3V4MA 1FRKA 3V6HA 1TKZB 4OZ0A 5HLFB 1ZM9A 1J2VA 2W9CB 3DI6A 2LCWA 4HH0A 2DHXA 1OS5A 3C6UB 2DCLA 3CCMS 5LXYA 2BDPA 2HNYB 4I67A 2OPPB 2ZHOA 1N33F 2VODA 4QWBA 1Q1KA 2J9DE 2H5EA 2B4PA 2GO8A 4NYOA 2ZJPQ 2L9DA 2HS3A 3GFXA 3ONQA 4NWBA 1IJFB 1E6YB 4F3QA 4LSNA 5DG9A 3FCHA 4DUZF 3E51A 1GXTA 4BHQA 2XI2A 5CD4H 1XR7A 2MZRA 4RW4A 3KMQA 2IYGA 4MIAA 1IKWB 3CIMA 2B4VA 3RRKA 3OTDA 4CH7A 5DQHA 2XBPA 2YKPA 2DR5A 5MAOA 1RT5B 1WTFA 4A4JA 3OR1A 4QIVA 4XK8C 3K0JA 3VZHA 1C1BA 1X9MA 4WYWA 4WFAQ 2UXCF 4K59A 3M8SA 2CJBA 2QA4G 4ED5A 4LJMA 4UUWA 3F44A 4N8NA 1NK9A 4OI3A 1NRKA 2B56A 2FHOB 1FA0A 2FVQA 4CTAA 4I69A 2QIFA 2ZH8A 3OFFA 3SSSA 4R5PA 5A8KA 1LV5A 2IA0A 3AJ2A 1D8YA 4CI0B 1YRXA 2N3LA 5HBMB 2BANB 4RW7B 4WFXA 1FERA 2D41A 1LWEA 4LF4F 5C5JA 5KT6A 3DXSX 4N41A 3AA9A 3VQSA 4F2SA 1HD0A 4WU2A 5C25B 2HHPA 2DPIA 1LW2B 3OFGA 3RBDA 3VAGA 4AQYF 2W8KA 3B8HA 3RR8A 4JI4F 3KJVB 1FJ7A 1B0PA 2YKNA 3LGMA 1DZ5A 1TKXB 2ZBCA 3Q8QB 1YIJS 2X1BA 2ACYA 2M88A 2V8HA 3K5OA 2OFHX 1KFSA 1I94F 2CPHA 1VQOS 3GIJA 1MWYA 4I0WA 1KVJA 3CWJA 4DS4A 3HHLC 4Q44A 3MUVP 4ECYA 4RNNA 3L7PA 5HMXA 2ZH7A 5HROA 5EWGA 4O3RA 1HD1A 1C0TA 3D1OA 4MH8A 4A8KA 4BS2A 2XMWA 2M0GB 2R7TA 1DLOA 4BC9A 4ZPTR 2RT3A 4I6AA 3V81A 1L3SA 1UVJA 1REVB 4FN5A 3RR7A 5J2PA 3FVYA 4B9SA 5EUHA 5B09A 1FE4A 2M7SA 2QRRA 5F8HA 4TYAA 2UP1A 3MM9B 1Y5LB 2KM8C 1IKXA 1U2RA 3HLUA 3K5PA 4NLSA 3ZZYA 4F67A 2DIVA 4DV6F 4GKJF 4HYKA 2Q66A 1C2PA 2QA2A 1S10A 3G4SS 1TR0A 4QPTA 1RGVA 3G6VA 1ZZNA 1FK9A 1X4GA 2WOMB 3BZQA 2P9GA 2X1GA 1S6QA 3FFIA 3H2VE 4KFBB 5IS2A 2MQOA 2BXJA 5HMYA 1HNIB 4FBUA 4N5SA 5L1JA 1RT3B 4ETZA 2E5IA 2PD1A 1T03B 3SSQA 1TQLA 3QZ7A 2VFVA 4OV1A 2F3JA 2FUG9 2YH1A 3BGLA 1RYSA 3GSDA 3OPKA 2QLXA 2DGUA 2KJWA 2V2KA 3ICLA 4Y34A 2GNKA 2K1RB 4EYIB 3D1QA 2OH2A 4R0EA 2I0XA 1MU2B 2IM2A 2W7AA 2CQ2A 4XDCA 3VWSA 1WF0A 1AW0A 5T7LB 3EX7B 4YQWA 4AL6A 1N36F 1HQUB 4F26A 4YFUA 5B0BA 2RRAA 3I32A 5DQGA 2PIIA 4KPYA 2HQIA 4CIOA 2VPWB 4NMLA 4P6QA 4DL6A 5KT5A 3OV7A 2B5JA 5D3GB 1UVNA 4MKAA 3W2WB 3C46A 2VG6B 3NLCA 2AGQA 2YX7A 3BSNA 3NS6A 3OVBA 1B0TA 1N0VC 3E01B 5IQ6A 2WRMA 4Y2IA 4HL9A 2E1MC 5AXLA 1LW2A 1DJ0A 3E3XA 4LSNB 1BQNB 1F5AA 3TI0A 2XS5A 4K4WA 5D4OA 2V4RA 4CH0S 2KZZA 1N5QA 4KE5A 5KFSA 2V8DA 4QOTA 3K5LA 3MPYA 5GVQA 2WOMA 3NAIA 3ENWA 4O0IA 3ENVA 2OAUA 3PM9A 4BBYA 3VTIA 5CYMB 2DGQA 3DDKA 3TANA 2BOPA 1FRMA 4NXNF 2P6TA 2RQMA 3GIKA 2R7XA 1GTHA 2IMOA 1O5JA 1FRXA 4FF4A 5J2NA 2KT5A 3DU5A 2ZBIA 2K3KA 4ZP9A 4C3LA 1Y5NB 4A46A 4B17A 1UFWA 3KLGA 2CPXA 3RAQA 3CJKB 2OPRA 3E2EA 3TAQA 4DSJA 1DTTA 2J0WA 2O01C 4UOCA 2JEFA 2CPJA 3ITHB 3OFHA 2HGMA 4HTIA 4ZPCA 4U6PA 1JX4A 2QO3A 2FJXA 2ZHAA 3UCUP 4DWIA 1F9FA 3HKWA 3IS9A 3JTOA 3SDEA 1FRLA 2VKRA 2CQBA 3CVKA 3HZGA 3KHGA 3THVA 1UAWA 1T3NA 1P8GA 3DM2A 2QSFA 5CZXA 2FY1A 2AYEA 4KBIA 7FDRA 2AQ4A 2NQPA 4TU9A 5EN1A 1Q8LA 2M5YA 4C8YA 3DLGA 4RWXA 4IYQA 4O3PA 1X5OA 2CQ0A 3O2IA 4P7TA 4ED2A 2MKCA 4OHVA 4ZPWR 4CNYA 2D9PA 3PX4A 2IYIA 1S97A 2W9AA 1CQNA 3IFEA 1WNEA 2J9DA 2KT2A 2KG1A 1VRUB 5D4LA 2NLWA 4QW9A 1JKHB 2VOOA 4QU7A 4Q2MA 1U7LA 5EGYA 4DFJA 2ROPA 4DG1B 1R8CA 1SL1A 1B7FA 4O44B 3I0RB 5DG8A 2VASA 4ED3A 1S49A 3VAKA 1Z1ZA 2C2RA 4F3MA 3RW6A 3WC2A 5AXKA 4C8KA 1XNRF 4GMKA 4NLUA 2XSJB 2XLIA 3CCSS 1X8DA 4O23A 2E66A 5B0FA 2LEAA 2M52A 1RWUA 4DQSA 4FS1A 4ZVHA 2HWTA 3RB6A 1FDAA 1U1KA 2OP5A 1HWKA 4PUOB 1VMBA 3KHRA 4RNFA 4U67Q 3TAMA 1BD6A 1ZAWA 2GGPB 4GC6A 1HW9A 3THTA 4XPEA 3HHNB 3T9ZA 1FEHA 2IAJA 5A2QY 1S76D 3MF5A 2ASYA 3M2VB 1BLUA 3M9NB 1WHXA 5JJBA 2CPIA 2F9DA 4MTPA 4DL7A 3PHEA 4Y2CA 3E8OA 3UCGA 5EX3A 4B08A 3GB0A 3SQGA 3ITHA 1OPZA 1O51A 2HPUA 3IAS9 4NA1A 4ITSA 2JC1A 5D77A 2HGNA 3ULHA 3M1VA 1TK5A 1HA1A 1DFDA 1KHVA 3T1HF 4FS2A 5KFXA 4J9SA 3GYXB 4CH1A 3DLEA 3QO9A 4WFNQ 2BQRA 2CJKA 3OTBA 4E98A 3C3LA 4ZDNA 4UY85 1VS3A 2VL1A 3RTVA 1V9OA 1RTIB 2DIUA 2RVJA 3SFUA 4ZMMA 4ECWA 3X3UA 3CJ4A 4NCGB 2R7RA 3N5FA 3WC0A 1HYSA 3DMJA 2E29A 3OL8A 1RTHA 4MIWA 2B6AA 2KXNB 1Q81T 2ATLA 4EEYA 1TVRA 5E3QA 1XEZA 3JYTA 2XLJA 4G1IA 2AYGA 1A9NB 1NJYA 2AGPA 2IVFB 3MFIA 1N5VA 2DGXA 5C24A 4TN2A 3W2VB 1SH3A 4Y65A 2YKQA 2G9OA 4G6VB 3I9V9 5SZTA 2AGOA 5F8IA 3S7RA 2XWYA 2I5JB 4YUDA 4EZ6A 2OPQA 2BACA 1SUQA 1R8BA 4YB7A 5LXRA 1VBZA 5EDWA 3KHLA 4BDPA 2N4CA 1BWEA 2GV1A 2F8MA 3CCZA 4IOAQ 1TL1B 1IBKF 4G3IA 3I0RA 3T6JA 1HQEB 1XMQF 2I2YA 1SJQA 4A8WA 2K7KA 2KG0A 5G0RA 2E1RA 2QEXS 4KV8A 3SI8A 2ADCA 3NNHA 2NUUG 3MAHA 3WBZA 4K5RA 2MZ1A 1DTQA 3DNCA