1PGZA

Crystal structure of up1 complexed with d(ttagggttag(6-mi)g); a human telomeric repeat containing 6-methyl-8-(2-deoxy-beta-ribofuranosyl)isoxanthopteridine (6-mi)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
183
structure length
183
Chain Sequence
b'KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*T*TP*AP*GP*GP*GP*TP*TP*AP*GP*(6MI)P*G)-3'
publication title Structure-based incorporation of 6-methyl-8-(2-deoxy-beta-ribofuranosyl)isoxanthopteridine into the human telomeric repeat DNA as a probe for UP1 binding and destabilization of G-tetrad structures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 48
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2003-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1pgzA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1pgzA02
2M8DB 2CQ2A 1FO1A 1S72S 2RU3A 2DHGA 2RQ4A 2DHXA 3CMES 1OIAA 3K0JA 3ZZZA 2JVOA 1KQSR 2N82B 3G4SS 3J7ZT 5CA5A 1VQLS 5CYJA 2LEBA 3B4DA 2DHAA 1U6BA 2MQOA 3G8SA 3EX7B 1M5PC 2SXLA 5DDQC 2K3KA 1BY9A 3G8TA 2FC9A 2MXYA 2DGOA 2DGXA 2HGNA 1SJFA 2HGMA 2N3LA 1X4HA 2YTCA 2MJNA 1OPIA 3CTRA 2MGZA 1WG4A 2CPEA 3JB9k 2LQ5A 2DIUA 2L08A 1ZH5A 1HD1A 3S6EA 3S7RA 5JVHQ 3MUVP 1DHMA 2MKCA 4EGLA 1UW4A 1WI8A 2F9DA 2HGLA 2JX2A 3R27A 2MZSA 1S79A 2MB0B 2FC8A 1H6KX 2CQ0A 2G1DA 2CQ3A 3L3CA 2VODA 2A3JA 1VQ4S 1WF1A 2I2YA 2OTLS 1X5OA 4YOEA 2E5JA 2L9WA 3MXHP 2O3DA 3P3DA 2E5IA 3EGZA 1X4DA 3NS5A 1NJIT 2N7CA 1UFWA 2DB1A 3NMRA 5IQQA 2YWKA 5MLCV 1VBXA 1WHYA 2ADBA 3CCMS 2DNMA 3SDEB 2KHCA 5D77A 3BO3A 1JJ2R 2AYBA 4F02A 2M52A 3P5TL 1SJ3P 4OZ0A 1F9FA 2DH7A 5HO4A 4RU2A 1YIJS 1U1MA 3P6YC 2DNPA 4W92B 1K9MT 2MZ1A 2N3OA 2EVZA 4C7QA 2E5GA 2MZTA 5DM7Q 1JJHA 1U1LA 2ADCA 1N8RT 2DNLA 3H2UB 4QU7A 3I55S 1FJCA 2RNEA 1WG1A 2XNRA 3S8SA 5LSLA 2CQPA 3TP2A 2DHSA 1FJEB 3CD6S 3MOJB 1KOOA 5DETA 2VOPA 4ED5A 2PE8A 3U1MA 2DNGA 1Q81T 2OIHA 2LA4A 2DNHA 2J8AA 1RK8A 2WBRA 2CPXA 1VQMS 4A8XA 3ZZYA 4TU9A 2M9KA 1FHTA 4FXVA 2DGSA 2M0GB 3CXCR 2AYEA 3CF5Q 5FJ4A 1M5OC 1H2TZ 3BO4A 2EK6A 1H2VZ 2HVZA 1L3KA 4CIOA 2MHNA 4J5OA 2VOOA 2E5HA 3CC2S 1U2FA 2MY8A 2CPZA 3H2VE 2PEHA 4CQ1A 1ZZFA 3VAMA 2DH9A 2DGQA 1UP1A 1N88A 1P27B 5LJ5Y 2CPJA 5DDOC 2NLWA 1OWXA 5LXYA 4CH1A 2M4MA 3CUNA 2LEAA 1D9AA 2MGZB 1U6FA 1VQ5S 3IRWP 4W90B 1X5SA 4TU8A 2CQIA 2OSQA 2DISA 2M88A 1JMTA 2MQLA 5DDPC 1WEZA 3HI9A 3D2WA 1R8HA 3R1HA 2ERRA 2MMYA 4CH0S 2BOPA 2LKZA 2GHPA 1QVFR 4IO9Q 2J76E 2M70A 2X1FA 2XS5A 2KM8C 1WELA 4ERDA 1WTBA 2CPYA 3IWNC 2MQQA 3DLLQ 2G4BA 2QEXS 2RS8A 4FXWA 2DNNA 2RT3A 1X4GA 2M2BA 4Z2XA 3MI7X 4UY8T 2DO0A 2KG1A 4U67Q 2JRSA 5GAGU 3MURP 3CULA 2CQCA 2D9OA 2D9PA 2KT5A 4BS2A 4C0OC 2AYMA 5ITHA 1YITS 3CCES 3UCGA 1X4FA 3SMZA 2U1AA 3Q2TC 2LCWA 3J7YU 1W2BR 1P1TA 3CCLS 5IM0B 1H2UX 1SXLA 3I56S 2MSSA 2MQNA 5LXRA 2X1GA 3ULHA 5IM0A 4LIRA 2XS2A 1R8PA 2D3OR 1XN9A 2DH8A 2KM8B 1A7GE 1YHQS 3G96A 3HHNB 1K8AT 4PKDB 1VQ8S 1SJQA 2MQPA 5GMKa 3UD3P 1VQKS 2M8HA 1N52B 2MKSA 4P6QA 3CPWR 3UWTA 3CC7S 1WWHA 1YJNS 3MD1A 4YB1P 2KFYA 3CCSS 2F3JA 3BO2A 3MUTP 1VQ6S 4LJMA 1YTYA 1X5PA 1NO8A 5GVQA 1YJWS 3VAFA 2DNOA 3CCQS 5D78A 1VBYA 1N54B 2BZ2A 2V94A 2DNQA 3LQVA 1WHWA 4WFBQ 1A9NB 2B0GA 1O0PA 4YUDA 1SJ4P 1Q7YT 4UQTA 5IFMA 1VC6A 2UP1A 3VAJA 5H1SV 2GO9A 4QPTA 2LYVA 1YJ9S 1M5VC 2KXFA 2LA6A 1U1KA 1IQTA 1VC0A 2CJKA 3TO8A 3FEXB 1U1RA 2DO4A 3UD4P 2CPFA 2DGUA 1U1PA 2G0CA 1AUDA 2DNRA 4PR6A 1WF2A 4TLQA 1WEXA 5GADU 2ZJPQ 3VF0B 1U1OA 2RVJA 2CQGA 1G2EA 2JVRA 2DGWA 1U1QA 1PO6A 2CPHA 3NNCA 2DITA 3UCZP 2ZJQQ 3Q2SC 2KXHA 3CCUS 4C4WA 2CQHA 1X4AA 3FEYB 2RS2A 1FJ7A 1WHXA 2E44A 3PIOQ 3VAGA 1Q82T 1VQ7S 1X4EA 4LMZA 3G6ES 1D8ZA 3DXBA 2CQ1A 2DK2A 3U1LA 1FNXH 1HA1A 3US5A 2MPUA 1DRZA 2DGVA 2FHOB 1X4BA 2X1BA 3EGNA 2ZJRQ 4Y0FA 1K73T 4WKRA 5EN1A 2AYGA 1KD1T 2KXNB 2YH1A 2EK1A 1YWXA 2LXUA 4F26A 2OJ3A 3UCUP 2J0SD 4PRFA 2MKJA 2LXIA 1WEYA 5JVGQ 2YH0A 3NNAA 2DNYA 2DNZA 3VAIA 4TU7A 3VALA 2OTJS 1CVJA 2FPHX 2RQCA 3VAHA 1WHVA 2XNQA 3OW2R 5GAEU 3V4MA 1FXLA 2AD9A 4IUFA 4Y00A 2MZJA 1VC5A 1HD0A 1WG5A 3B4MA 2LMIA 2CPIA 2MZQA 2X1AA 1HL6A 4WIIA 3TYTA 1VQNS 2YKAA 1M1KT 1VQPS 1OO0B 3N9UC 3G71S 1X5TA 5CXTA 2KRRA 2FY1A 4QU6A 1DBDA 3MD3A 3R1LA 2XSFA 1VQOS 1B7FA 2KI2A 3THTA 5DM6Q 2QFJA 3RW7A 3LPYA 2MKKA 3BS9A 3CCRS 1UAWA 1RKJA 3CMAS 1VQ9S 1NU4A 1WI6A 2HZCA 2MY7A 3BEGB 1ZZNA 3PIPQ 3UE2A 2J0QD 1X0FA 2RRAA 2CQ4A 3MDFA 2NZ4A 3SDEA 3CC4S 1WF0A 3RW6A 1Q86T 2MJUA 2RUGA 2M7SA 4F25A 3NNHA 1URNA 1U1NA 2DIVA 1PGZA 2K8GA 2OSRA 2XS7A 2KH9A 1FT8A 2DGTA 1YI2S 5DDRC 2U2FA 1VBZA 2MYFA 3SXLA 3S01A 2F9JA 5LSOA 2RRBA 2KG0A 4V19X 2KRBA 2XB2D 2KN4A 2LECA 5BJRA 4QQBA 2MKHA 3VAKA 5LJ3Y 4WFAQ 1KC8T 1DZ5A 4IOCQ 4WCEQ 1QM9A 4ZKAA 2I38A 2QA4S 3CCJS 2CPDA 2MZRA 3CCVS 2VONA 3G9CA 2MQMA 2DNKA 2MSTA 3THPA 5GAHU 5HL7Q 4IOAQ 3NS6A 2CQBA 1M5KC 4WFNQ 2KYXA 2JWNA 4WF9Q 1SJRA 2KU7A 4OZ1A 1KOHA 2KVIA 3P49B 3MUMP 2CQDA 1JJ4A 2Q79A 1QVGR 1X4CA 1M90T 2MKIA 4M5DB 2HYIB 2L41A
chains in the Genus database with same CATH superfamily
4ZHRA 5HROA 3FBEA 5AXMA 3FSIA 1RCXB 1KQSR 3G4SS 1NJWA 2Y1JA 1TUWA 3GYGA 1RAFB 4DR1J 3AB2B 4N5SA 2KB2A 3AOBA 3KLIB 2HGMA 2HHWA 2VG6B 3KLEB 3SV4A 5L8RC 3NGKA 2YKPA 2D74B 3T3FA 4OI3A 3TQ1A 1DLOA 3P3DA 5THWA 1M5SA 4UUWA 2G2ZA 4PAAA 4OLPA 1VS3A 3P8BB 4KHPF 4G1PA 2FJDB 4XAKA 2RB7A 3OR1B 2EW9A 3MEGB 1FJCA 2VU5A 3M8QB 3D4JA 4ED3A 1SJ1A 5I3UA 1Q8LA 2OPSA 3V6JA 4DSIA 4BWMA 3MPVA 2W9CA 1VQMS 3EVMA 5F3ZA 4LF9F 3D3CJ 3JQKA 1FHTA 4F4YA 1QJHA 3CIMA 4LBIA 1HNVA 2ZD1A 3BGOP 1AW0A 3LANA 3RGIA 3H7HB 1U2FA 2MY8A 2R4FA 1RT7B 1S0VA 5A6WA 3UQSA 1ZA2B 3QAEA 3VAMA 1T3OA 1S1UB 3RAXA 5LJ5Y 5H9EK 4ZVTB 2GAHC 2B43A 3SZ2A 3ZC4A 2KZZA 4DV7F 1FFWB 4RWXA 7FD1A 4IYQA 4ZLJA 1VQ5S 5HVGA 1PAUB 1EHWA 3HI9A 2XM3A 1TELA 1WKLA 2AP6A 3HSJA 2KFZA 4LFAF 2KHDA 1F5CA 2BJ7A 4ZCIA 1NH7A 5F0WA 2YNHA 1NXIA 2FZGB 2GNKA 2RT3A 2HBRB 1X4GA 4Z2XA 2XLKA 4JI8F 3EJMA 4F4AA 2Z58B 3M6WA 3CCES 2BJEA 5C5JA 3MMAB 2YWHA 1FDDA 1RTHA 1SKSA 3I56S 4DV0F 1DJ0A 4GO5X 2C2NA 3PYFA 2QLJB 2WSEC 2DH8A 2BE9B 3M6UA 1K1SA 1VQ8S 1TK0A 3K5LA 2NPIA 3T1YF 2OI2A 1GEHA 4QYRA 4DR3F 5B09A 3CJ3A 4FP9A 3HZEA 4ZVRB 2B51A 4B3TF 1DY3A 4ZOSA 1A9NB 2C3YA 1SJ4P 5BXIA 2O67A 4DCJB 1RP5A 5A0YB 4RBVA 1EKSA 3IS9B 2E1MC 1AUDA 4U96A 2ZJPQ 3DNCA 2HHXA 5HK4A 1IBKF 1I3OB 2RKIA 1WACA 3J81j 3J7AN 2J6UA 2K1RA 1VQ7S 2AGQA 2ZUAA 2BANA 5D6GA 3EZ5A 3U1LA 2XZTB 4WKRA 3CEDA 3DYAA 4DR6F 1QE1B 3D1QA 1H0HB 3MEEA 1QAIA 2IFXA 4CCHA 2OHDA 1HI1A 3D68A 1VDHA 4OJHA 1ROFA 2A2DA 4D3GA 2YNFB 4OHZA 2BMBA 2IM3A 4FYYB 3V5RA 1TV6A 1P8GA 4DV6J 1HBUA 1UAWA 1NU4A 2BVZA 3MM5B 2ZH4A 4M5LA 4DV4F 3CC4S 1Q8IA 3VTIA 1IUJA 2MJUA 3UVJB 4LVOP 3DLGB 4X66J 2K8GA 2COLA 4XIUA 2MYFA 3SSSA 1V9OA 1NDCA 5LMNJ 3DHXA 4N8NA 1U26A 1FD8A 3CCVS 3G9CA 1A0OB 4ZVSB 2ZEJA 5AE1A 1KBRA 3CJTA 4PXBA 4CLKA 2XCAA 1RWNB 1QSSA 4B9MA 1VGYA 3ICLA 4OZLA 4J37A 5GAGI 1F1BB 2VFVA 3K0JA 1QTNB 2O01C 5E2QA 2DHAA 3UDCA 2B4PA 3EX7B 1N5SA 1AXQA 1HHQA 3NAIA 4XO0A 4NCBA 4DL6A 3DRYA 2OD4A 3J81Y 2CJYB 5L38A 1UJ5A 2MGZA 3K58A 2HIYA 3CD0A 2IA6A 2DIUA 2IDEA 1ZH5A 3H5XA 3QMQA 5JVHQ 3T5KA 1Q5VA 1S1XA 3MMBB 2ROGA 3R3TA 5DGBA 1FX2A 5KG0A 1FXRA 2V4RA 3OUYA 1JLEA 1LXNA 1S6QA 1CPZA 2BE7D 2VA2A 3J7Z5 2YWKA 3ZNUA 1HBOB 3W8GA 1FCAA 4DPUA 2CWKA 4PEOA 3M32A 2B9EA 2B9YA 1U8WA 2QMUB 3OTEA 3W5YA 1IKXB 2MZ1A 3CO0P 5EWFA 2YKMB 3T6JA 3F0NA 5G4DA 2XNRA 1RWMB 3S8SA 1RGVA 4OX8A 4ILRA 3EUNA 2CJXB 4JI2F 2WBRA 3FVYA 4KY3A 4NLQA 1OYDA 3ZZ0A 4FXVA 2M0GB 5C7PA 2Y1RI 2GO8A 1R27B 4A8MP 4OZ2A 3KLHA 5HROB 2BQUA 1HQUA 4KSEB 4PWWA 5IS2A 3TAPA 5F8LA 3RB6A 5CYMA 4CQ1A 2DCLA 2FHKA 1Q7LB 3EVOA 4PG6A 4PPDA 3H40A 1JX4A 2OFHX 3MECB 2J6SA 4FVMA 2M88A 2P9GA 4HHJA 4P73A 5L1JA 1C1CA 1TKZB 3NOCA 5T7LB 4C8LA 3EGWB 3W65A 1FRJA 3T6BA 2DO0A 2F5GA 1BQMA 5HI7A 1JLBB 3UR3C 3IXQA 3IA0A 1NCLA 3KJQB 4YP3A 2LCWA 4RUBA 4LF7F 2GHWA 1T0TV 3LOUA 3CCLS 5IM0B 1HW9A 2A6OA 1H2UX 4EYIB 2X1GA 4JI7J 2XHCA 1SPBP 1YHQS 1TVRB 1VQKS 3BSCA 2UU9J 4H4MB 2LXFA 3A8KA 2VDHA 1SIZA 2XGQA 1PC4A 5J2QA 1XMBA 1YTYA 4UY85 3QSYB 3LGMA 1VBYA 1NZ8A 1R0CB 3LQVA 5F9NA 3OTOF 3CB4A 1HNVB 2CJBA 2QX0A 1QAJA 1HLWA 2R7TA 2HNYA 4QPTA 5E3RA 4RUCA 2C42A 2IPOB 1E6YB 2FD2A 3J80Y 2ZE2A 5HANA 3T5HA 3E8OA 2EG1A 2YNGA 1XNQJ 2NREA 5J2PB 2VQEJ 3UW1A 1YKWA 1U1QA 3KG1A 1JLQA 1NK8A 4KGXB 3UCZP 2ZJQQ 2UV8G 4X4RA 2CG4A 1FJ7A 5D4PA 1U0HA 2IJFA 4TVAB 2VD3A 2NR0A 2CQ1A 1G3OA 2V2ZA 2WCXA 2YH1A 2W2NP 4ZP8A 3K59A 4I2QA 4XPCA 2DNZA 1KONA 3VAHA 4WTYA 1RE1B 4I6WA 4Y00A 3LW5C 2F65A 2Y0BB 3W7BA 1Q78A 4GMKA 2R7OA 3C15B 1GTHA 2KRRA 2D3UA 1ZETA 3GIKA 4HYKA 3W5ZA 1S1WB 1UKUA 3JQMA 3CMAS 2MY7A 5CAAA 1FK9A 4OFZA 4OI6A 3DI6A 2RILA 5HJYA 4ZLPA 2HHPA 3W8PA 1WKKA 3BDEA 1S77D 2P6TA 1NKBA 3UFCX 2V68A 5DG8A 3K89A 2N7YA 2E9RX 4DCOB 4LSNA 3ILOA 4C11A 4ICLB 2CUYA 2GJFA 3I5CA 3MGJA 4QQBA 2W4CA 3KK2A 5KG3A 1TL4A 2ZBPA 2NS1B 1QM9A 4Y3CA 1LW0B 1J5OA 4DR4J 5L1LA 2AEJA 4QIFA 1U6ZA 1JIHA 2V6AA 1NMEB 2GV1A 1YDLA 4AD6A 2RKIB 4M95A 2CQDA 2W4DA 2Q79A 2WONA 5BYRA 3G87A 2F8EX 3RAMA 2HYIB 3GFZA 2BDPA 4C8KA 4ZPCA 1S1TA 5IWAJ 4L3KA 1R0AB 2I5JA 3KUHA 3SCJE 3EXCX 2IYIA 5CA5A 2ZHBA 3AQPA 3PRBA 1M5PC 3OHAA 2QL9B 1EIYB 2OMOA 3G8TA 2FC9A 3DOMB 3GIRA 4DUZF 3BGRA 4G65A 3LALA 2H5JB 3UI3A 5DQGA 3S6EA 4Q0BA 1WOSA 4JP8A 5A2QY 4RU9A 5ETNA 1SL1A 1H6KX 4CLLA 3KLGB 2A3JA 4CDIA 2UXCF 2JLFA 4KHMA 2JZ5A 3TVZA 2HHUA 2E5IA 2XO7A 2N7CA 4U95A 3NMAA 3T1AA 4WZQA 4M5HA 1WHYA 3I96A 5D77A 3VGVA 1JJ2R 3ZTOA 3V6DB 2AT1B 4ZPTR 3P6YC 3RRKA 8AT1B 3DFEA 4DV1J 2P6SA 2Y8WA 3FDSA 4C6AA 1U1LA 2R8HA 1NK7A 3OPKA 4U6PA 3CDAA 4CO4A 2PE8A 3OTDA 4CO0A 3HT3A 2WHOA 1QSYA 2OAUA 4GO7X 4A8XA 3SQGB 4TU9A 3RU0A 2B4UA 5FLXY 1XEZA 4F0HA 2V8PA 2DXFA 4K4XA 4DQIA 3AJ1A 2KT3A 3OBIA 2N4CA 2HWTA 2FY8A 2HIQA 4A48A 1UCNA 5DO2A 4CLTA 1N88A 4MK7A 1KTVA 4QW9A 4WZMA 2BJ9A 2M4MA 5EX0A 3HO1A 2MGZB 2E1RA 1C1BA 4LF4F 1S4FA 2CQIA 1YBAA 1S1XB 2MQLA 2MQ8A 3CDBA 5DDPC 1NK4A 2ERRA 4CH0S 2BOPA 3B78A 3CCZA 1K44A 3CMQA 4DS4A 1S6QB 3B54A 4JI6J 4C2MA 3R7BB 1Y5IB 4K7QA 1RAAB 2B56A 3U02A 3ILLA 5HMZA 1VLYA 3QRQA 2EFVA 4DXLA 3MMJA 1DURA 2XYPB 3KLVA 5GAHI 4I64A 4USVA 3HT0A 1JXEA 3TX0A 4DPXA 3Q24A 3OFGA 1WWHA 4KGMA 4U8YA 1RAGB 3DRPB 4DZ6A 1Q7YT 3OL8A 1VMBA 4KO0A 2UVUA 3GSDA 2Y1IA 3PG9A 3V2UC 1CJUA 1FE0A 1IQTA 3TO8A 3RBXA 1GNKA 3FUYA 4IFVB 4BDPA 1HMVA 2OO4A 2GVZA 3NCPA 1G4CA 3BR8A 4DF4A 1RDRA 3FBCA 4HACB 4M5DA 2E44A 4C3MA 1LWFA 3EZOA 1CC7A 5ETLA 3ZZTA 2J5AA 3NRBA 2DXEA 3MR5A 4DG1B 3LTOA 2E1PA 1PJ7A 1FWPA 2HBYB 1K73T 1OJ4A 1Y00A 1IR1A 1RT3A 3KHRA 4DSFA 3PYGA 4J9SA 4P7TA 4IUFA 2IDLA 1K47A 4FBUA 4DL4A 4KBIA 3KMSA 3MM8A 3PKYA 3BKUA 5MAOA 1EX8A 5KFWA 2AJQA 2XSFA 1CJTA 3NGRA 1RKJA 5B0GA 1N0UA 3PNIA 2RDJA 3SDEA 4AL6A 1OQ6A 2LVWA 3T19A 1URNA 2H65B 2X51A 4ZCMA 3JYTA 1LFWA 3NWGA 4K5RA 2PN6A 2RRBA 3AJDA 2HNYB 4A8KA 4DEZA 2XZWA 3GR0A 1AA1B 3A8JA 4DV6F 5HJXA 3EE3A 1VJQA 4RW8A 3FCVA 2I38A 4ECTA 4F3OA 2CNLB 1CJKA 3OFFA 4M8LA 4TYBA 1EP4B 2BBEA 4H4OA 2JWNA 5KG4A 4RPFA 4ZVOB 4AT1B 1YLXA 1CQMA 2FJBB 2BKPA 5LMNF 2M8DB 3M8ZA 1U0HB 3TA2A 1KLNA 2QA4G 2ZC4A 2ATCB 1UW9A 2E9ZA 3J7ZT 1VHIA 5CCMA 3M9NB 1U6BA 3J7YI 5DDQC 5K14A 3VZHA 3LWLA 2BM1A 3RBDA 1HNZJ 3MEDB 4I2QB 2N3LA 4NMXA 3N5BA 4CTAA 1RISA 3O6QA 3I87A 3QRRA 2R7QA 4EWTA 2YY3A 3RRGA 2W7PA 1A6LA 4QIGA 2L9WA 3JXOA 1T11A 2H9ZA 4ATNA 4B3OA 1R6VA 1N5QA 1NSKL 1VBXA 1L3VA 1JLFA 3TX8A 2BQ3A 2VUGA 4B3MF 2Q3PA 1VK8A 1NK6A 1VRQC 2A2CA 1L3SA 1IJFB 1RT5A 1JJHA 2NXCA 2ZNYA 3H2UB 1WG1A 5IQ6A 2EFNA 1OY6A 2CKWA 5DJBA 2HG4A 5DETA 3U1MA 2YX1A 4NX9A 3I4PA 3UN5A 1TKTA 4PQUA 3CJSA 5IT9U 4HHHA 2OPPA 2IC3A 2WONB 1REVB 5KFOA 4DPYA 5A8RA 3BO4A 2IAJA 1JLGB 3E01B 3F44A 1NHKL 3E2EA 2VOOA 5E7OB 5DGAA 1S1TB 2R2UA 2AZ1A 4KGZB 2I5JB 5HP1A 3GMGA 5GAEI 2X7IA 1YK9A 3TI0A 1WC6A 1GK8A 6AT1B 1UP1A 3KYLA 1G7CB 2NLWA 2HRTA 4Y2MA 4RUHA 3ET6A 2R7RA 3HHLA 3PY8A 1VLOA 3UNYA 1NPKA 1X5SA 1SV5B 3KNGA 4Q0BB 4O4RA 1FKOB 1QVFR 2XMWA 1WTBA 2MQQA 2RS8A 4UOGA 5J1EA 4UY8T 4HDHA 2KG1A 4LF5J 4RX6A 4G1QA 3R9LA 2YX4A 3KK1A 1JKHB 4WFZA 1RWOB 4C3KA 1AFIA 3I32A 5LXRA 5KFMA 2E5LJ 4DWIA 4JI1F 1A7GE 1T02A 3G96A 4YR3A 1RAOA 5HMXA 2N4DA 2BKOA 2BE2B 1KQFB 3H4DA 3BBFA 3PX0A 4KE5A 4YHHJ 2K7KA 2JH3A 4IFYA 4QWBA 4K4WA 3ITHB 2CG8A 2FTRA 3R8YA 1WOPA 2DHHA 1YJUA 2ASLA 3VAJA 3Q23A 5E33A 3FKBA 2OKQA 4RNMA 3FEXB 2FZCB 3LUYA 2UU9F 2K06A 2G0CA 1GMUA 4PR6A 5GADU 2OP5A 1HNWJ 4RBUA 4U7UD 3FEYB 3TWZA 1GXTA 4I0WA 1S5ZA 4C8MA 5U47A 3BH7B 1WSRA 2NYIA 4UOHA 3O5TB 1YRUA 2VDIA 2CAJA 1J5EJ 3A3PB 1NUEA 2AYGA 5E0OA 4C48A 2RDIA 3RBZA 3KHLA 2EK1A 3DMJB 2KO1A 2Y1LB 3Q0AA 4GKKF 1TMJA 1BLUA 3EPIA 3QIPA 4B17A 4EU0A 2BJ8A 5KFKA 3DRRB 2OH2A 3QQCD 1IBLF 2I0XA 5H9FJ 3NXZA 2IMWP 5IT4A 2JEGA 2QA1A 1AROP 2B7CB 2JHEA 4NI2A 5HBMA 2HKEA 5LOQA 5LT5A 4LFBJ 3Q8PB 2WBMA 4NCGB 1LWCA 4QWAA 2OSRA 2B5JB 4ED2A 5HLFB 5AE2A 3CD5A 3QZ7A 4NEZA 3CJ8A 3JS9A 2QA2A 5HVHA 3GV7B 4QPXA 2QA4S 3CCJS 3H4BA 1OMSA 1JXLA 4IH6A 1XNRF 1HMVB 2CQBA 4DFJA 4WFNQ 1C2PA 2AQ4A 3HHKA 3DOLB 1ZYQA 2MKIA 4M5DB 4R8UA 1LWFB 3LO3A 1U45A 3CMES 4OI2A 1T05B 2MTLA 2DD8S 2FVPA 4DR4F 3M7VA 3B4DA 1NSPA 1HQEA 1PYSB 4JI0J 3SV3A 2RIJA 3GFXA 2ZH2A 1P6TA 2HSEB 5ETRA 2HGNA 3W9HA 3EM1A 1MMDA 3MTJA 3ISZA 5AXNA 5IWAF 4Q2LA 2CJAA 3M8RA 2CQ3A 1F5BA 3W5XA 3FK4A 1UFWA 2IM0A 3CD7A 3GP9A 3CCMS 4DV2J 4RUAA 1EETB 2JLEA 4F2RA 1U0SA 3HFZB 3SDEB 3BO3A 3PYDA 2J9DA 1RKIA 3RB0A 2C28A 4RU2A 1T03A 2DNPA 4HT5A 4ZP9A 4C7QA 3JSMA 5DM7Q 2GMJA 2QIFA 2B8QA 2PC6A 3I55S 3V6HA 3BB5A 5DRKA 2W9BB 3GCWP 1I5OB 2HNZA 2DYAA 3OR2A 1Y5LB 3M8WA 4MKAA 4ENOA 4A46A 2XTJP 3UNGC 3DU5A 3PW7A 1HKAA 4MJKA 3D1OA 4K4UA 2V5HG 3OXFA 4RW9B 3MM7A 4KIAA 1LK7A 3CC2S 3MOZA 5ADZA 4OZNA 4GRSA 5T41A 3FNNA 3MM9B 3B8HA 2PEHA 1Y10A 2HBQB 1N6QB 2YX7A 4O4GA 1P27B 4ILMA 4CO5A 2BXJA 5I3PA 1U25A 4CH1A 3OV7A 1JQGA 1ZM9A 3QT5A 2VZ9A 1RHUB 4Z7CA 4CT9A 1U47A 2UUCF 1TL5A 3R1HA 5KFJA 4JI5F 6FDRA 4ES2A 2P8IA 3DLBA 1Q53A 4RW4A 2M70A 2CRLA 2HAFA 1RT4A 4KT0C 3WIUA 2WVEA 2RQMA 1HBMA 3DLKB 1UVMA 2VV5A 4DLEA 3X1LB 1JLFB 2GC8A 2C3PA 2U1AA 4LF8J 3AA9A 4I2PB 4GVLA 3RBEA 3D0IE 3ULHA 4ES1A 4MT1A 2WSFC 4P2XA 3M8PB 1KHWA 1S10A 3AD9C 3RRHA 2BOAA 3ENQA 2LQ8A 1UVJA 1D8YA 4U7CA 4QWCA 1NJZA 1AZSA 1TKTB 4HT7A 3DC2A 2F3JA 4PYAA 2VQFJ 3N79A 3C2PA 1C0TA 5C2CA 3PJXA 1WORA 2VICA 2HQGA 3M2VA 1PC5A 2J6TA 4DUTA 3SIPB 1NJXA 4P75A 4ALZA 2GQCA 4OYWA 5K9FA 1LW2A 4NXNJ 5SUHA 2CQGA 4IRCA 5K8MA 4FYXB 4NLVA 3KOAA 1PO6A 1JLCA 3IAM9 3IP0A 1XBWA 4FPIA 2E7VA 3ET6B 4USMA 2ZH5A 3HHLB 3KK3A 4M5MA 1Q79A 1LNQA 4IH5A 4L6V3 1BMQB 2ZBCA 3MR3A 2DK2A 5G0RB 5SZTA 5L9NA 2ZKTA 4GVBA 4K2XA 2V2QA 2EKYA 1GX5A 2AJ0A 2GGPB 1CJVB 4YDDB 3GILA 3KFWX 2LXUA 1YWXA 1RLDA 4PRFA 4OLOA 3VAIA 5I3QA 2FPHX 3IBFB 3KK1B 3WDOA 3OTBA 5DQIA 3DDKA 2H5IB 4JV5F 1VC5A 4OYMA 1SBRA 4YY3J 4MMOA 3IR7B 1Y11A 1KLMB 1RU1A 1S1VA 3GB0A 4OV1A 1WI6A 1E6VA 2CQ4A 4CYUB 1ZS6A 1T7PA 4B9SA 4LF9J 3RR7A 4ANEA 2W2MP 2XS7A 4LBPA 1FT8A 4BHQA 3OT9A 2Y8YA 1UJ4A 3LP2A 1VRUA 5KFNA 4MKYA 3I5BA 2XB2D 4MK9A 4N76A 1UEKA 1F3VA 4IOCQ 2E9TA 4LSLA 1ZM3A 1GMVA 3V81B 4TXSA 1ZBTA 4Y2KA 4DV7J 2XWXA 4P52A 1KOHA 3L95X 5HN0A 2HRUA 1S49A 2CZVC 2GJ2A 3H8YA 3POTB 2CQ2A 1R8CA 3FJ2A 2EBGA 1TFWA 2BKNA 5DG7A 1UWAA 3QSIA 4LFAJ 2N82B 2OLWA 1BWEA 1S59A 4JI8J 4HH1A 1TU0B 5KFGA 4PCQA 2RAQA 2YTCA 4HI2A 3JAMU 2L08A 3TZWA 1Y0HA 1HD1A 1F0XA 2F9DA 4IG3A 3QIPB 2ALYB 4WYWA 2VODA 4DV0J 1VQ4S 1WF1A 2OTLS 1RWKB 2E5JA 5KOWA 1FFSB 3DGPA 1TR0A 3E51A 4RW6A 3QGGA 1HFEL 2OPRB 4A8SA 3ZTRA 2NCKL 3T1YJ 3OXGA 5F3TA 4DR3J 2HZVA 2AYBA 1DTQA 5HBMB 2AHOB 2XC9A 4OI4A 4B3TJ 2Z0GA 3P5TL 1LWCB 2QC3A 1YIJS 2ZITA 1U1MA 2E5GA 5HQ8A 2X3DA 4TKTA 4C8ZA 3LP1B 3RJMB 3CJ0A 1FJEB 3K8WA 4N56A 1R0BG 1KOOA 2FQQB 5D0GA 1EQMA 4Y2IA 2IVYA 4M5IA 4A8WA 2J8AA 1RK8A 3A8IA 5CD4A 2DGSA 1S76D 2W7AA 1H2VZ 3IWLA 2PEBA 2P9CA 1JNZB 4DHVA 4EEYA 1VFJA 2ILYA 1IKWB 2DGQA 2EEYA 3HM9A 5F8NA 4DR6J 1HIYA 2HHVA 5F9LA 2VA3A 2VFUA 2LEAA 1D9AA 1U6FA 4OX7A 1QSLA 2BR0A 2ZUGA 4B3SJ 1OS5A 2ACYA 4YB6A 2LKZA 4W98A 2QO3A 1BQNB 4PYDA 3CJRA 3KJVB 2CPYA 3L7PA 2C2DA 4OX9J 3MI7X 4ED8A 2A18A 4ZK7M 5T14A 4E98A 4LVNP 4DSJA 5D3GA 5F41A 1B70B 1SC4B 1T03B 2ZDPA 4KHRA 3K2YA 2VBWA 1HYSB 2MSSA 4Y34A 4NLGA 3GG1A 2FDNA 3QATA 1N36J 4LF5F 1MROA 4I68A 2ZM6F 2QN6B 3OR2B 3TUZC 2B9XA 1TMMA 5CD4H 3GV5B 3VQSA 5EUHA 1WHWA 3Q89A 1CSJA 2KXFA 2KJWA 5CYQA 1U1KA 5IXUA 4HI1A 3CJ5A 5LM7E 1VBKA 4EK2A 4IRKA 4YMEA 4YHHF 4O4GB 4DF8A 4BC7A 1TAUA 2HURA 2JVRA 4RLEA 5DZ7A 3SSQA 4X4NA 3C14A 3FSXA 1HBNA 2AX1A 4FS1A 4B08A 4ZDNA 1N5YA 1DTTA 1WC0A 2YKNA 3W3SA 4ZCLA 1SQEA 1HNWF 2GHVC 1F9EB 1HBMB 1VRTA 4XK8C 2VFTA 4HKQA 1WEYA 2C22A 3PHEA 4ZVGA 4TU7A 4ECRA 3AXMA 1HI8A 1WD6A 3V4MA 2V8DA 2MZJA 1HD0A 2D41A 4TY8A 2AMCB 2WRMA 2ZWOA 3KLFB 4QU6A 4DFPA 3VZIA 4UUXA 3THTA 2AKWB 2HW3A 4NXMJ 2LEPA 5KFSA 2VPXB 4RL1A 5C24A 1NK0A 1D9DA 2RRAA 5HAOA 2NZ4A 4JI2J 9RUBA 1UFLA 3NNHA 1U1NA 1FRMA 3WX8A 2PI5A 2HFUA 2QRRA 1R8AA 3P5BP 4M5KA 4X4TA 3PYEA 3DRXA 4KKOA 1MMNA 3M9MB 1V6HA 2RDDA 3JQJA 1S7HA 3KNAA 3K8VA 2MQMA 4K50A 1X7VA 2MSTA 2XBPA 3OSNA 4LFBF 2KYXA 1RHMB 4YB5A 2JJ4D 1NSQA 2RU3A 4ED1A 1U7LA 4NLOA 4LRCA 4GVBB 1SKUB 3GONA 2IVFB 4ZLLA 3F41A 4ED6A 3RUBL 2LEBA 4MFBA 2XSJB 1GTEA 2FJEB 2MXYA 2B9WA 1SH2A 3GE9A 3TRGA 3BSNA 1WTFA 2DTJA 1NDKA 4LF7J 2JX2A 2WTFA 2X3GA 3MPUB 4JI0F 2O3DA 1XQIA 3BREA 4LRAA 2HHSA 1RBAA 3K5OA 5J1NA 3QJJA 1UVIA 2HZAA 2C2RA 2Q6BA 2DNMA 5IC4B 3KTQA 4DPWA 4F02A 4CWBA 1RHKB 3QO9B 1GX6A 1K9MT 1PYTA 2MZTA 3EICA 1PAEX 4M5NA 3W9JA 4ID5B 5LSLA 3HVTA 3R6GB 1NB7A 1YBTA 3MOJB 5E41A 4DV2F 2OEKA 3IWXA 1RT6A 2VPWB 3PW2A 4I7FA 4F36A 2CPXA 2ZC3A 5EX3A 3MF5A 4KGKA 3T5LA 3ZZRA 2QTWA 1CLFA 2IRXA 2MEWA 4WK1A 1ZZFA 1B0TA 2E7XA 2BRKA 4CNZA 2HHHF 2JEJA 1OSCA 3OD2A 2VIHA 4RJVA 3IBWA 4NLWA 3TANA 4IG3B 4MK8A 2AGOA 2V8GA 1VI7A 4IO9Q 1XMOF 1NKEA 3K7RA 2AGPA 1WELA 3DOKA 4DPTA 2YNIA 5KFQA 3T9NA 4FXWA 2ALZA 4P7VA 1FEHA 1UFKA 4RR5A 3QGPA 3C6UB 4U67Q 1NJYA 3ZNJ1 1TZ0A 4ID8A 1DTQB 2V4JA 4DJBA 3PEHA 2AJFE 5DQHA 1SC3B 3H5SA 3PM9A 2DCUB 5L39A 2XS2A 1TL1A 3M30A 2QLFB 1SB6A 4OI0A 4I4BA 1N52B 3CPWR 2G0IA 2XCPA 3D6MB 4DFKA 4DLGA 2QZ8A 1NO8A 4OZ3A 9ATCB 1N54B 1HNIB 1QLNA 3HHLC 1SKRA 2B0GA 1T9XA 2YWEA 3HHEA 4DZDA 1YJTA 3WBZA 1ZPVA 1S99A 1IWGA 5LSRA 4RBTA 1PSDA 3G6YA 1TK5A 1N5TA 4HDGA 2MLYA 2ZZMA 3OJSA 4TLQA 3G6VA 2C3MA 4OV6A 1MWZA 4PWDB 2JC1A 2DGWA 2R7XA 3Q2SC 2KXHA 5I42A 3DRSB 1S57A 1B3TA 1UETA 2AF6A 2XY5A 2UXCJ 4NLSA 2MPUA 3BGLA 4Y2CA 4CLUA 4NXNF 2B6AA 2JEIA 3EGNA 1HI0P 3ETOA 2FHMA 4RNHA 3UCUP 2NQPA 2H51B 1RJJA 2OTJS 5ETVA 3MAAA 2O1PA 4J9NA 5AJ3F 4H4KA 2E66A 3Q83A 2X1AA 3TYTA 1FDBA 1O5JA 1OO0B 3N9UC 4DV5F 1RUSA 1YRXA 1RT1B 2KI2A 4ZIVA 3PXGa 2XMTA 4I67A 3W9IA 3NWRA 1ZZNA 2Z8QA 3UE2A 4F3QA 4ZIWA 1FTRA 2HS0A 3O44A 2DY1A 1YJVA 3GZ7A 3TAMA 5KFVA 2UV8A 4YY3F 4QCLA 4HTJA 2DRAA 2HFZA 4HL9A 3VGUA 3L7OA 4AXIA 2KL8A 1PYOB 1Y9OA 2MKHA 5CYQB 2HMIA 2BJ3A 4X4OA 3R5JB 1TKXB 5L1IA 3NL0A 5J2MA 2WW4A 1IVZA 3NS6A 3IO1A 5BYSA 4NYOA 3R5BA 3W2WA 4L76A 1VCTA 4LF4J 3CIZA 3CSKA 2ZH6A 3GJRB 1N4LA 2HVHA 2DHGA 2CZ4A 2FVCA 3JSBA 3IRXA 2JVOA 3C8YA 1N5YB 1MU2A 3G8SA 4O3PA 1GT8A 1VRTB 4X62F 4QYZK 2OD6A 3RYLA 2BW7A 4A8FA 5ETPA 3PO5A 1TL7B 4ETZA 3JB9k 1KVKA 4O0NA 3CT9A 5F8IA 4O44B 3B6BA 2Z2ZA 5GMEA 2LDYA 2CJQA 1WUUA 4URGA 1Q8BA 2ZWPA 2KVQE 4PQAA 2BX6A 2RE1A 2I8EA 4NLYA 3FFIB 4EZ6A 3D9BA 2YKOA 5KFRA 3V4IA 4FYVB 4P71A 3PKMA 5MLCV 2XO6A 7FDRA 1RTIB 2DY9A 4DQRA 4DSEA 4YR0A 4WKYA 2NUUG 3DLJA 3G82B 4KFBA 5HO4A 3L9ZA 2N3OA 1WC4A 2VFRA 4QU7A 4KKOB 4P72A 1IKVB 4WU2A 3W64A 2F1FA 2OEMA 5J2NA 4TQRA 1EARA 2ZBIA 1RTZA 1LWEA 3M2UB 3ISNC 4PWUA 3EXYA 3T5JA 3LGNA 4UOCA 1PCAA 1O8BA 3P4UB 2AYEA 1FKPB 1S9GA 1H2TZ 2KTQA 2HVZA 4ZPDA 2RSQA 2HLUA 2NYHA 4CLYA 3QJLA 3FCWA 1SL2A 2W9AA 3TOQA 2QL7B 3R2CJ 1KN6A 2CJ9A 4S0MA 3U27A 1L5UA 1HWLA 1XWLA 1WDTA 4OYIA 3HDSA 4YQWA 4Z7YA 1WEZA 5ETKA 1JNRB 2GHPA 3R2DJ 3TA1A 2AIRB 4ERDA 2VBXA 2FB0A 1KFDA 4PXEA 3TEHB 1NPRA 1WC1A 3HMJG 3CJ2A 3S1TA 2AW0A 2BYCA 2CQCA 3CJKA 4I1TA 2ZBQA 4B3SF 3A1YG 4OJGA 1YITS 3UCGA 3SMZA 1W2BR 1RAJA 3HP6A 2HVEA 2JLGA 4A8QA 1P1TA 1ZOTA 3LGHA 4B3RF 2B4VA 5K5MA 3M2RB 5FIIA 4R5PA 3IN5A 5A8WA 1WSVA 3LAMA 3THVA 4OX9F 1GQEA 3HHNB 4U9RA 3BPDA 1CULB 3HHDA 3UD3P 4PG5A 3AOCA 3QAUA 4FF3A 4DBQA 4Q7AA 4RNNA 4NWBA 4NLXA 4CLPA 1U02A 1N34J 2DNQA 4HR2A 3TEGA 1P1LA 5I4MA 3ZZUA 2V34A 4LFCF 5H1SV 1NRKA 5C25A 3OXLA 2WW8A 1N36F 1RBOB 1NHVA 1S4EA 2JFDA 1S6PA 2DGUA 2V4QA 2RF2B 4MYUA 1F6TA 3CW2C 4YR2A 5KTQA 2HFSA 4M94A 2AEFA 4AFFA 2VBZA 4ZJLA 1Q82T 1XMQF 4OYAA 4J9UE 1XJWB 3KDOA 5K20B 1SCJB 1W2IA 4ZS6A 3PFEA 2PMHA 2JFKA 1UZHA 4E8UA 1FRIA 2YNIB 4IDKA 4FKYA 2R2RA 3QPIA 1WNEA 2LXIA 3D3BJ 2APOA 3TQEA 3QGIA 3VALA 3MMCA 4B3MJ 1TAQA 4K0KJ 2RQKA 3I9V9 1TL3A 1VQNS 3PV8A 4DX5A 3WQPA 5ETTA 3C66A 1IM6A 1U2CA 1S9EA 4M5JA 2VG5A 3RW7A 4LRBA 4WP3A 2HZCA 4BLGA 4K5SA 2XMMA 2H5EA 1Z1ZA 1FVQA 4B9VA 1RTJB 3U7JA 2DGTA 5KFBA 4DU7A 2QYCA 3W63A 3VAKA 4NXMF 1KC8T 3UPFA 1MWYA 1YRTA 3V6KA 2NXNA 1KSPA 4U8VA 3GG0A 1NK5A 3QT7A 3C46A 2BABA 2RRNA 3QYYA 2XMKA 2LU1A 2ZVSA 2H4YB 2DXDA 2QLXA 2KU7A 3N6NA 5I42B 3RB4A 3P49B 4ZHRB 1TFYA 3N6LA 4YB7A 4KC5A 3N4WA 2RQ4A 4IOBA 2HVIA 1BQXA 2R42A 4QBUA 1IBMJ 1Q5YA 3W60A 3E3XA 4DL2A 1RAHB 2XG8A 3D5MA 4JV2A 5HQMA 3IG1A 2VG6A 2HGLA 3I0SA 3N6MA 4NYPA 3L3CA 3NBPA 2BEFA 3KDNA 1DLOB 3K5PA 1PIEA 2W24A 4V19J 4JI1J 2GX8A 1S48A 4DSKA 4RKUC 3PTWA 3CE8A 1ICEB 3AXKA 3EGVA 3ZZOA 3R97A 3QZ8A 3HXMA 2M52A 2PFDA 2HNDA 3OL9A 2RHQB 2QJ3A 2QL5B 4RNFA 5C2GA 3OR1A 3MEGA 4C8YA 5I3UB 1IR0A 2OPSB 3M8QA 2DHSA 5KFZA 1HR0F 5KG6A 2IBKA 2W9CB 1CC8A 5KG1A 1Q81T 2EFOA 2MHEA 2AJ1A 1S12A 2FVRA 2GIRA 3ZZYA 3N5FA 2ZD1B 4EI2A 3FMWA 5H9FK 3EMTA 2F40A 1Y5NB 3R5CA 2EK6A 3K5NA 2D3O1 2EG2A 4K8RA 3Q22A 1RT7A 4MAKA 4ED0A 2J9EA 1UZDA 1S1UA 1C4CA 2FLPA 3PHTA 4GKKJ 3KUGA 4X65F 2BUNA 3SSRA 2QLBB 2DISA 1R8HA 1MW7A 2KJVA 2BA9A 3TJ9A 2DR7A 5AXKA 2YNHB 1KR4A 2C1EB 1IBLJ 1SUQA 2JL9A 1C0UA 1U48A 1SQGA 2D9OA 2HQFA 2AJ4A 2YWWA 5ITHA 4LQ3A 4UZCA 3UDEA 4ZPWR 1B0VA 4KFBB 1RTHB 3ZTSA 4DL0C 3B82A 3MMAA 4IKAA 4UZBA 1SI9A 4QWEA 4OX6A 1XN9A 2HAIA 1KP6A 2B8PA 1B64A 4OZJA 4OMFG 2J8SA 1X9MA 1XNRJ 5FD1A 1VQ6S 2DR9A 1RBLA 1X5PA 1YG0A 4O0IA 3M6VA 4C8NA 1ZAWA 5IT9Y 4P10A 3DDNA 3AODA 3A4TA 1PBAA 1UJ6A 2KKHA 3IS9A 1NH8A 2XI2A 1F3FA 3OSPA 1G2EA 2A10A 2NUHA 2K1RB 2CQHA 2G9OA 3H5YA 2BANB 3HJFA 3H25A 1RWUA 2EC2A 4WU3A 4ETXA 1D8ZA 3OVSA 5E3CA 2FHOB 3DYAB 2X1BA 1KD1T 1HHTP 4KR0B 2OFGX 1UEVA 3VGTA 1JK9B 1LQ9A 3MEEB 1B4SA 2KT2A 3TZZA 1RADB 2DNYA 4X84A 3WX4A 2E1CA 4PXCA 1KKHA 1QE1A 2DR8A 2AD9A 3HSZA 2OPQA 4WIQA 1WG5A 3PO4A 2GMLA 2GVDA 2YKAA 1VQPS 1R89A 1TV6B 2YNFA 5CXTA 1DBDA 3MPYA 1XC9A 2G2OA 5A8WB 1HBUB 2FJWA 4HLBA 4DSLA 3PIPQ 2CYYA 5M2RA 3MM5A 2FZKB 2W2QP 5KFYA 1SH0A 3UVJA 1IXKA 1HWUA 1XIQA 3DLGA 4NLPA 5IZHA 3PX6A 2H1YA 1YI2S 4MTPA 5DDRC 2HQ3A 3IFEA 1VBZA 2F9JA 4C3LA 4J9QA 1GH8A 4J90A 3PR4A 5LJ3Y 2HEKA 2UUBJ 1IKYA 1ZM2A 2DT9A 2E29A 3WC2A 4WCEQ 2CDRB 2F8HA 1M0SA 2IM1A 3T9ZA 4F4XA 4IOAQ 5M2UA 4LBHA 4UF4A 2ZZNA 1JXVA 3HKZD 3DGVA 4DR2F 2UUCJ 3QT8A 4JI5J 2K7JA 2VHGA 5HVFA 2M5YA 2VKRA 3JTPA 2WOMA 5CYJA 2B3TB 2Q6CA 2SXLA 2K3KA 1RYRA 3T1HF 3H59A 2AWZA 1X4HA 2LQ5A 2R8KA 1DHMA 1UW4A 3OFEA 1JLEB 3OUYB 1X9SA 1F2GA 2I9SA 3MMBA 3R5GA 4ZPAA 1S9EB 1X4DA 3NGTA 4F3MA 2DB1A 3SBMA 5K8NA 3M32B 3DLHA 1I6JA 1NLKL 1HBOA 5K8OA 3MPDA 3ENAA 2XHWA 2LQJA 1F9FA 3CCWA 3NP5A 3C3LA 1UL3A 4F7VA 1IKXA 4EO8A 2HFNA 4ED7A 2BV3A 1VQSA 2YKMA 3CVKA 4K4TA 4ZP7A 3MPWA 4O3RA 3L09A 2LA4A 2DNHA 2W7OA 1RACB 3AD7C 4FF4A 3MCNA 1JJCB 4DX6A 4NL5A 1D3WA 2EFQA 3KLHB 3O1LA 1HQUB 1L3KA 1T9TA 1EKRA 3Q8VA 4N77A 3VGSA 5CYMB 1FF2A 3FSYA 4QR1A 1N48A 2CPZA 2WVFA 3TNVA 5KG7A 3TJAA 2CPJA 2Y9HA 2R8JA 3BGFA 3SFUA 1EZZB 2UXBF 2V9WA 4TU8A 4JV5J 3MECA 3IG1B 4DN9A 2EKNA 2ILZA 3NOGA 3KHHA 1W26A 1HQ2A 1Y3JA 3I0SB 1C1CB 3NBPB 5HQLA 2WB1D 1Q0NA 1IBCB 2J76E 3GPAA 2XS5A 4OL8A 4Q8EA 5A6PA 5EWEA 5EHHA 3BKFA 1TKZA 5T7LA 1JB0C 1BQMB 2V50A 2DPJA 1JLBA 1BD6A 1GFWB 2HNDB 2YKQA 2YWFA 3AFGA 4EUVA 3OTCA 2JOQA 2L48A 5IM0A 4X4UA 1NK9A 2ZFHA 1TVRA 5J2QB 4ILLA 1JLAA 2KFYA 3P45B 4KPCA 4H4MA 1FWKA 3NG8A 2PFFB 3UDLA 4R0EA 2Y0SD 4LR7A 3W1YC 4U7UK 2UP1A 2GO9A 1M5VC 1YJ9S 3NY0A 3ZZPA 1RCOB 4QR2A 1G6BA 4FBTA 2ZE2B 1REGX 1GXUA 4C97A 3UD5A 2YNGB 1E6YA 4I56A 1AYEA 2VJVA 1JLQB 2HS3A 5D4NA 1FESA 3BSOA 1UA0A 1N34F 5J2PA 3M9OB 5JMNA 3W66A 4C4WA 4G3IA 3ENWA 5HMWA 2ZKUA 1WHXA 2Z30B 3ADAC 1CEZA 1HPZA 4USIA 4CO2A 5DLGA 3AH6A 4LMZA 2Z2YB 2QE5A 4O3SA 1PILA 4GKJJ 3R6LB 2HS4A 3QWUA 4PG7A 1OSDA 1F60B 1SUQB 4KH1B 1C0UB 3I82A 5JVGQ 5KFAA 4CM2A 2PMWA 1HL6A 3NEKA 1URRA 1T95A 4OQJA 2YBVA 5JUMA 4CLZA 3C15A 3I9ZA 1FK9B 2ROEA 3DI6B 1Q8KA 1LWXA 1IWAA 1IJEB 2LFVA 4DX7A 1S1WA 2J0QD 2IJNA 1ZAVA 1Q86T 4K0KF 2Q43A 4DQQA 3PW4A 4LSNB 4B02A 4C11B 4V19X 3DLEA 3CDWA 4IR9A 3OLBA 3KK2B 5D0RA 2GIFA 3L7UA 4ICLA 1DZ5A 1J5OB 1AUSL 1UWBA 2PI4A 3D54A 3MR2A 2DNKA 4NZ0A 4WFYA 3SCIE 2BQRA 3TA0A 1LW0A 1JWWA 1YSJA 1LXJA 4P2MA 3QRPA 4UQGA 2HBZB 2PA3A 3GR1A 2HK2A 3MR7A 4H4KC 2VL1A 4B9TA 4DN0A 1R0AA 2D7SA 4EBEA 3BGRB 3HSDA 2W2PP 3DOMA 1NDLA 3VWSA 1V5IB 2DBBA 3MUVP 2OPQB 2G1HA 4P2SA 5KT4A 2GVDB 3VCDA 3QIDA 1IBMF 4YOEA 5E5NA 3KLGA 5IV4A 3IBCB 2Q1LA 1D0EA 2ZM6J 4F50A 1MN7A 4KYZA 4WXWA 4FF2A 1FWLA 1QAXA 1RWWB 4ZP6A 1QD1A 4C0HA 1T3NA 1MN9A 3GCXP 3QFHA 3C6TA 3V6DA 2R8IA 5GADI 2UUWA 2AZ3A 1N8RT 4UT4A 5F8HA 2HWIA 3ZTPA 2KDOA 1IKYB 3CD6S 1I94F 3HFVA 3DM2A 4NRUA 4ZLNA 5HMYA 3QT6A 3SQGA 2PIIA 1M5OC 2QT7A 2EPIA 2BACA 4FNIA 4J9MA 2AEMA 4CM0A 4EBDA 2WOMB 2FGCA 4L74A 4WK3A 3LF0A 2C2KB 3A3NB 1CS4A 2UVWA 1C1BB 1PJ6A 2BJ1A 2EBEA 1BXNA 3IRWP 2FLNA 4OYZA 5JXSA 1RHJB 1TKDA 3TUJC 2ROPA 1TUGB 2RMLA 2WK4A 3K17A 3JAMY 4AL7A 2O66A 1QTMA 4LQ9A 3IWNC 3HK2A 5GAGU 3QLHA 1NEEA 3CULA 2D9PA 4JV1A 4XPEA 2P2CB 4KV8A 2R2SA 4WYLA 4O23A 2LQ9A 3BDPA 1WC3A 1KQKA 4EFAC 1SXLA 3CNQP 1HWKA 3RG6A 4LIRA 5IC6B 3NKYA 1UPMB 2RU9A 2M8HA 2VB6A 5EDWA 2G2YA 3BO2A 2I6WA 2EI5A 2ZOFA 3VAFA 2YQ1A 4KO0B 1M5HA 3H98A 3DRPA 3HHLD 5KFPA 3A13A 1CJUB 1OY8A 4WXOA 3LA0A 4MH8A 5L9XA 4I69A 2CJKA 1U1RA 4YDXA 3I0RA 2GAGC 2FJXA 2DNRA 3R5DA 4B9NA 2KFNA 5B08A 3R7SB 2GVZB 4AQYF 2Z4PA 4K2JA 4IFVA 2VBYA 4ZA1A 2CPHA 4J9PA 4LRDA 1GAOA 2FGOA 1IQZA 4F4WA 3D6HB 2W4PA 2FVSA 4HACA 4P2FA 1FD2A 2G0JA 2CIMA 3MAHA 5AE3A 4TNOA 3FBFA 1O6XA 4Y65A 4DG1A 2LU2A 1S0NA 4WBFA 1RT3B 1ELOA 4ECWA 2GZOA 2ASYA 4ECQA 2YPYA 3G2XA 2V63A 4DCPB 3M8SA 3IMQJ 4QIWD 2XNQA 2YVSA 2B4OA 3MM8B 2MZQA 3GSIA 4YEAA 1CJTB 4KJIA 1AFJA 3MD3A 4ZVUB 2H48B 4O3NA 3VR1A 2QFJA 1V3ZA 1VQ9S 4USTA 1X0FA 4NA2A 4DR5F 1JLAB 3RW6A 4C98A 4X4PA 5LMUF 2BM0A 4JI3F 1IN0A 3JYTB 4NA1A 4DUYJ 2HQIA 1YBUA 4KB7A 2CADA 3S01A 4XDCA 4NCAA 2KRBA 3EPGA 2FHJD 4RW8B 4YS2A 4AL5A 1WKJA 2DR5A 3BH6B 2QMXA 1SL0A 1CJKB 2OMLA 4H4OB 2HHHJ 3OVAA 3KG0A 2J7KA 1EP4A 1X4CA 2I1RA 3HSGA 1HPZB 3K5MA 1VHFA 3PVXA 2UUBF 3PACA 2CVEA 3GIMA 4JYAJ 4DU8A 1XMOJ 1RWVB 2ZH7A 3EWGA 5K14B 1V3RA 3PEJA 1KQGB 4NEYA 4DV3F 3FQKA 2DGXA 1SJFA 4CTAB 3MEDA 2MKCA 1YX2A 2CNOB 1TUVA 4NRTA 2CQ0A 2YQ0A 4B3OB 3PCOB 3IR6B 3EGZA 1VISA 1UVLA 3NMRA 5HSPA 1Z2LA 4DR7J 2ATLA 2Z56B 2ADBA 3VQTA 2QSFA 4ZMMA 1R6YA 5ETSA 1MMLA 1X0PA 3C16A 4MIAA 1SJ3P 1U4BA 4J7CA 3LH2S 5D4LA 1RT5B 5CZXA 4LR8A 2YQ3A 1I1GA 3DLEB 4UW2A 2KYZA 1HWIA 3NCRA 4ECUA 7AT1B 1UWBB 4PQUB 2DNGA 4Q5VA 1NM2A 2OPPB 4OYPA 3CJQA 5KFHA 1NPPA 2HWHA 3QFWA 2IC3B 1MSWD 3GYXB 3ISND 4ECVA 4PUOA 1S6UA 5A8RB 2FVQA 3SQOP 2IAJB 4OHVA 5FJ4A 2GMHA 3NGSA 4OYXA 3G8QA 1REVA 4J5OA 1RA7A 5HP1B 4MIWA 4F4KA 1JLGA 3E01A 2L9NA 3AJ2A 4FS2A 2JSXA 2YXLA 4MKBA 3D6TB 3AD8C 1N32J 1MNEA 1EJ7L 1QY7A 3AAWB 2HVDA 2CFXA 2NXJA 2VPZB 3H0PA 5KG5A 4ELTA 4W90B 3GV8B 2QYGA 5AJ3J 8RUCA 2OSQA 4YN3B 1JMTA 1SV5A 4DV5J 1D09B 4DL3A 3HCXA 4LSZB 3J7A1 1FKOA 1ZM4A 1RQ0A 2PO4A 4DR1F 3DLLQ 2G4BA 3D6FB 3T41A 5J1EB 3D0GE 4FVCA 3LP0A 3AY0A 4IRDA 2JRSA 2Z2MA 4G1QB 1SQFA 4BS2A 5KG2A 1Z4UA 2PA8D 3C6TB 1Q95G 4BCAA 1FX4A 1WJ9A 2C3OA 1JKHA 1SKWA 2MQNA 1FEEA 2LQBA 3BSAA 3O3LA 4C0BA 2ZH9A 4L73A 1HNXJ 4IO1A 1FTCA 2CNKB 1SJQA 2MQPA 4USJC 3DM2B 4IFYB 4X64J 2BE2A 3DCAA 3AB4B 3Q8UA 5GVQA 5ETOA 2QFIA 1S7IA 1T9UA 3VVTA 3ITHA 2F7VA 2FJVA 4ZJQA 2CA9A 2LYVA 3MEKA 1I51B 2JDJA 2W8KA 1RT2A 3MFIA 4FPRA 1U1PA 1YJRA 4J9KA 1LK5A 1WF2A 4X62J 3ETMA 5L46A 3MFHA 3NNCA 1CS4B 2UVVA 1XR5A 5JJBA 2J7UA 4KGVB 5A8KA 1TP7A 1X4EA 4L72B 3TW0A 4P9SA 1HW8A 2EFPA 3MR6A 3J81U 2W8LA 3JTOA 1FRXA 1DRZA 4ER8A 3N28A 5EN1A 2AX0A 2XYGB 4KH0B 2J0SD 2MKJA 1T9YA 1Y4ZB 2GFFA 3M1VA 1H74A 3DMJA 3QLHB 2C2ZB 4KV8B 1RA6A 4ZVFA 1ACMB 1UMJA 1C4AA 1H7WA 3W62A 4GKJF 1U8SA 2H54B 1M1HA 4WP9A 3IGVA 1VQOS 3I4HX 2GA7A 1TK8A 3DRRA 4DL7A 2HHQA 3BEGB 4NI2B 3LPEA 2Z2LA 1WF0A 3DDIA 2LP4A 3HJVA 2RUGA 2M7SA 1Y7PA 1PG5B 1NNDA 3W2VA 1FRLA 2KH9A 8ATCB 1RWXB 2UUAJ 4NCGA 2B5JA 1RHQB 1KHVA 2U2FA 5HLFA 5LSOA 2KG0A 3CCTA 1RWPB 5H9EJ 2XY6A 2OGUA 4ELUA 3I0RB 2QG9B 4XTTA 3SFGA 4QYZJ 4R25A 3NGUA 4QZVB 4B9UA 2R9LA 1FE4A 2JEFA 5GAHU 1H73A 2VC1A 4WF9Q 4OZ1A 1Z2ZA 4R8UB 5J1PA 1RU2A 3BQ2A 3DOLA 1FO1A 3R7NB 2FIUA 1P9YA 3A12A 5A76A 3ZZZA 1HQEB 1T05A 4DFMA 1RAEB 1VQLS 4RW7A 3FGVA 3PR5B 1YZ6A 2RUSA 3H42A 2DGOA 4FXDA 3CTRA 2CPEA 2XULA 4K4SA 3TJ8A 4JI4J 2RH3A 4LT6A 2FC8A 1CG2A 4B3RJ 3BN4A 3FZ2A 4CH7A 3MXHP 3U1NA 2OUGA 3WHIA 4FNHA 2NPFA 3RTVA 2V67A 3FMBA 4Q45A 2KHCA 1EAYC 4HH0A 4E0DA 2A1BA 1EETA 1BGXT 3AA8A 4C8OA 2V2VA 1W25A 3JSMB 3KJNB 2BJDA 4LFCJ 4N41A 4FN5A 2WZ1A 3CO9A 2DNLA 2V2KA 4CNYA 1RXOB 3ZO7A 3TP2A 4DPOA 2HNZB 2W9BA 3PJWA 2OELA 1G1XA 2FYXA 4X2BA 4Q2MA 1L3TA 4GC7A 2M9KA 1UVKA 4X66F 3J80U 3GFHA 1NB2A 4IQMA 3CF5Q 3MM7B 1XMQJ 2V8HA 4RW9A 2E5HA 1U24A 4NOHA 4JV0A 2ZDOA 2DRBA 3MM9A 3Q8QB 2QMWA 1N6QA 5DDOC 1K0TA 1GMWD 3CUNA 4LRFA 3NGDA 3TVYA 5AXLA 4TYAA 4RW4B 5DLFA 1RT4B 5KOXA 3UDVA 4WE1A 3ONQA 3SEOA 3KMQA 1NSAA 3I6PA 4ITSA 1S0MA 2AV5A 1FJGJ 3BYPA 3DLKA 2RHSB 3MURP 5EGYA 2B7BB 4RNOA 4NLDA 3AHPA 3C16B 3HVRA 3SCKE 3J7YU 1MG7A 4KQZA 3H20A 4OHWA 3LWMA 3QJPA 4I2PA 2KM8B 1XR7A 1R3NA 4CRJA 1K8AT 4PKDB 1AZSB 3M8PA 2DKOB 2A0FB 4P6QA 2CNNB 3CCSS 2JNJA 4LJMA 2DNOA 4J91A 1C0TB 5D78A 3KHGA 4QJVA 4PUOB 5B0EA 5F8GA 1PKUA 1SIWB 5CCLA 4ED4A 3M2VB 4WTOB 1YJ7A 4HVZA 1R8BA 1LW2B 1T9VA 1CBKA 3OL6A 2CPFA 2XMAA 1S0OA 4CP5A 5B0CA 2IBOA 1JLCB 2ZZTA 3TAQA 4F8RA 1QDUB 2EWHA 2IY5B 5IOLA 2DITA 3KK3B 2VG7A 4NMLA 1KTQA 2CVIA 4KPYA 5KFXA 3OFHA 3KKFA 3G6ES 6FD1A 3TVKA 1FNXH 1HA1A 4G1IA 5G0RA 1X4BA 2PGCA 4EO6A 1NKCA 1RTDA 4NA3A 5A2QU 2OJ3A 2E7WA 3BR9A 3LP0B 2GGPA 1CJVA 1Q16B 1UA1A 1DFDA 5KT7A 2RQCA 1WHVA 5GAEU 3G6XA 1FXLA 3B4MA 2YPZA 1NAQA 2P9EA 5KT6A 2F63A 1SC6A 3CDEA 1S1VB 2K3IA 1MLAA 4UOFA 2NXEA 1HR0J 1E6VB 4NZ6A 1KLMA 2V69A 2JC0A 4RO0A 2HHTA 3ZTQA 4CYUA 3HZGA 4DS5A 2IM2A 4N47A 3OVBA 5RUBA 3LP2B 1VRUB 5EWGA 2P5VA 5CZVA 2KN4A 4JI7F 3Q86A 1S9FA 2J7WA 1RT2B 4LSLB 1ZTTA 2CPDA 1S6OA 4ES3A 5FLXU 3C19A 3PRDA 3PFOA 1M5KC 5KFTA 3BM7A 3V81A 4DUYF 4EBCA 4X65J 2HFVA 1M90T 2IYGA 5A8KB 4FF1A 3FZBA 3NLCA 1KS2A 3POTA 4OIXA 2FHJA 1OIAA 4LF2A 2NSCA 1F2HA 1ITPA 4WJBA 1F5AA 1GXLA 1XNQF 1BY9A 4H54A 2VQEF 3IAS9 4K4YA 4OHYA 3M1VB 1T9WA 1Q1KA 4J9RA 4ANDA 1EQ0A 4ZVQB 3D28A 1WI8A 5E3AA 4JYAF 3F56A 3VVUA 3DGPB 3M6XA 2R7VA 1J27A 4RW6B 3MAQA 2C3UA 4ELVA 2Y3YA 4OYOA 1DQ9A 2OPRA 1X9WA 4NASA 4FDFA 5BYQA 4A4JA 4Q43A 1SVDA 5KFUA 3PRVA 3W2VB 3FQLA 4OZ0A 1NHUA 1VIXA 4PPZA 3CDUA 2GJIA 2HRYA 3I31A 4ZVPB 4P74A 1HWJA 2WSCC 2RNEA 4D3HA 3D0HE 2UXDJ 4PZVA 4DR7F 1EB0A 3D7SB 3ILIA 2VOPA 3LP1A 1UEUA 2CZ9A 2E1AA 2OIHA 4IH7A 3VHQA 2XGPA 5KT2A 4USKA 2VASA 2GIQA 1DARA 4PG8A 3RB3A 3O8WA 4L75A 5KFDA 4BWJA 2RJZA 2F4FA 5CABA 4LREA 2HK3A 3CGIA 4LF6J 3ELHA 2GQ2A 3GQCA 3PX4A 4X4SA 4RW7B 2DEJA 5B0FA 4ECSA 1FI4A 5ETQA 1VOMA 4RWWA 1H3DA 1IKWA 2F8MA 3HD2A 1OWXA 2ZH8A 3H5UA 1LOUA 3UR0A 4NZ7A 2V9KA 4AE5A 2VKZG 4NYZA 1N33J 1ZAXA 3BQ0A 1LKZA 3JSYA 5D15A 1N32F 1BQNA 4DQPA 1D1UA 2BW2A 1U2RA 1AT1B 2DR6A 2QEXS 3KJVA 3H2LA 2EXUA 5L1KA 2W2OP 5D3GB 2KT5A 4C0OC 1PBUA 3AOAA 1H98A 4F04B 2H3EB 2ZNZA 5FDLA 4ZJOA 4N8OA 5C42A 3IR5B 1HYSA 4F0KA 4E2FB 4EMDA 1MROB 3FRYA 1LFPA 2MKSA 3MWBA 2HQDA 3MUTP 2J0WA 4QIVA 4QIEA 1NDPA 4JOUA 2V94A 3KJFB 4WFBQ 3MM6A 3WZ0A 1O0PA 1H72C 2WVBA 4YUDA 4DL5A 4DV1F 4UQTA 3JTNA 3DKDA 4DR2J 2RD5C 1HNXF 5LL6d 4LUBA 1OY9A 2UVRA 1FVSA 1T94A 3KXDA 3HFKA 2W25A 4TN2A 1Q4RA 4X64F 4EYHB 3T1HJ 3DXSX 4ECZA 3M8YA 2J0XA 4ECYA 2PMZD 3C14B 4M1KA 3KUEA 4MYTA 5DZ6A 5ETMA 5BR8J 1HBNB 4Z37A 2RS2A 5KFLA 3VAGA 1RYSA 4CO3A 1APSA 1DTTB 3DXBA 5AT1B 2YKNB 2EFGA 3US5A 4LR9A 4I6AA 3FBBA 4WE1B 3DU6A 2G13A 1T8EA 5KFCA 4X4VA 4MKVA 1WC5A 1R43A 4BC9A 4K4ZA 2F4VJ 2YH0A 4J9OA 1FDNA 1BWVA 4F4ZA 4TY8B 4QWDA 1FRKA 4L3NA 3IC1A 3G71S 3RR8A 2FY1A 4LF1A 3TR5A 5B7WA 3KLFA 3TZYA 4K4VA 4JI6F 5C24B 3NS7B 1FNOA 3P96A 4DOZA 2XMUA 2DIVA 2DPIA 4DX8H 1PGZA 5KT5A 2C2OB 4I6YA 4DI6A 4ZPBA 1RABB 4KAIA 1FNMA 4KRWA 2LECA 3BPSP 3KWMA 1BUXA 2MZRA 3Q8SB 2VFSA 2VC0A 5HL7Q 2GCFA 2UUAF 1KFSA 1ZPWX 2VG7B 1SC1B 2V8VA 2ZBRA 3MUMP 1ZA1B 1QVGR 2UXBJ 4J9LA 1U09A 2L41A 3HKWA 5K8PA 4X4QA 2EC0A 4MFBB 1K1QA 1P9QC 3TUIC 3EYZA 1KDNA 1RTDB 3O2IA 3D67A 2MDAA 2XSJA 2L3MA 3G86A 2WVCA 4ZN3A 5HATA 3LAKA 1WG4A 2ACMA 3QNWB 1R7IA 4TQSA 3WIVA 4ZITA 4KHPJ 4EGLA 3RAQA 4HHUA 3EZUA 4URSA 2MB0B 2V0NA 4AUKA 2R3VA 1YVFA 2KZMA 4FZVA 3F73A 1NJIT 1DAXA 5IQQA 2BRLA 2YWGA 1HHSA 5M2PA 4JI4F 1VR6A 2DH7A 3IM9A 3BN7A 4TY9A 3QO9A 2VJUA 3L4BC 3DN9A 3HVTB 3M05A 2ADCA 3FRZA 3IM8A 4FYDA 2CQPA 4A47A 3HF5A 3FCHA 1FERA 4ID5A 1NBEB 1RT6B 1KNZA 3UO0A 3MCMA 4ZCKA 4I7FB 3HULA 4OZ5A 1XERA 4IG0A 1RLCL 1O51A 4Y6IA 1AB8A 1RAIB 1H7XA 2GS8A 3BGUA 5KT3A 3OQ2A 1S97A 3FC9A 1X60A 4Y28C 3Q8YA 5IT0A 3D66A 4CLSA 1UTAA 3EDRB 3GIJA 3UN2A 3TUPA 5D4OA 3D1HA 5F8JA 2IIHA 3ILJA 2IHR1 2C2MB 2OEJA 4IR1A 5LXYA 1YQHA 2FLLA 2QSWA 4ANCA 4RZRA 4EZ9A 4O3OA 3A3OB 4USUA 2MMYA 3NCQA 3QBCA 3GU0A 2XZDB 3K57A 1QUVA 3DOKB 2KM8C 3JSRA 1ULRA 1LV5A 1IR2A 2M2BA 2DRDA 1HNZF 2V4JB 4NE9C 4Q44A 2XMVA 1GMWA 3C6UA 1KVIA 2D3ZA 1X4FA 3Q2TC 2QLWA 1W7WA 1TL1B 3M30B 1R8PA 2D3OR 1V5VA 4PXDA 1J2VA 5CHCB 2FJAB 2W01A 3MHYA 1KVJA 1FJGF 3ZXWA 5GMKa 4HTIA 4CLWA 2UZAA 3Q8RB 4AYBD 3VV2B 1IBKJ 5GMDA 3CCQS 1R31A 2UUTA 5CH7B 4J9VA 2ABYA 1HNIA 2IRUA 4G6VB 5IFMA 4NLTA 1VJWA 3HD1A 1VC0A 4XDDA 2GW8A 2IVMA 1U1OA 2XWYA 2FLOA 5DS7A 5D0HA 5E3PA 4NLRA 4PWDA 1VQYA 2R8GA 5D0EA 2XEXA 1IM4A 3DHWC 3DRSA 1SH3A 3GFYA 2B6AB 2DGVA 2ZJRQ 4A8OA 2ASJA 3GWCA 4Y2AA 3KLIA 3MAAB 3NNAA 1M1GA 4DV4J 3OW2R 1ZTWA 2L9DA 1WDDA 2GQQA 3KLEA 4GC6A 5FDLB 2MKYA 4WIIA 4BBYA 5C42B 1X5TA 4ECXA 3R1LA 3X3UA 5DM6Q 3R5AA 1I94J 2VPYB 2MKKA 3CCRS 1RT1A 3MDFA 4O3QA 2PDAA 4USHA 2PT0A 3OLAA 3TAMB 1RI7A 4F25A 4AXJA 2DVIA 2J9CA 3MM6B 3BKTA 2O5DA 3SXLA 4DQSA 2HMIB 2PSZA 5BJRA 3N0VA 2E5LF 4R0JA 3BQ1A 1FRHA 5J2MB 3I5AA 4ZKAA 1KRPA 4OYBA 2VONA 1D9FA 1TKXA 2C2EA 3THPA 3A8EA 2MLXA 2NZCA 2NXUA 1OYEA 1FKAF 3W2WB 3HVAA 1NZAA 1U49A 2IMOA 2XI3A 3HPOA 4K59A 2POKA 1JJ4A 3N01A 3KG4A 1S72S 3IRXB 3OHBA 2DHXA 3BJYA 1CQNA 4WP8A 1MU2B 2MQOA 4CT8A 3EVWA 1B99A 2D1CA 3SI8A 1TTHB 1FA0A 2MJNA 4QW8A 1OPIA 1QAYA 5E3QA 3BF4A 3IGNA 1TL7A 3S7RA 1VK3A 3R27A 2MZSA 1S79A 4O44A 2G1DA 3PDNA 2LLZA 2I2YA 4N7TA 4ZPVR 3PZPA 1X5OA 4HEA9 5F0UA 3V4IB 1J5EF 4B9LA 3NS5A 4V1Ak 3FFIA 3NAHA 1XK8A 3ZFVA 3SYZA 1UPPA 3OL7A 2H4WB 1RTIA 2J9DE 4CO1A 3M4XA 4WFXA 4TLRA 4W92B 2EVZA 3G82A 1VYAA 3QGHA 3HLUA 5J2NB 2VH7A 1IKVA 4OHXA 1MWQA 1N5VA 4ED5A 1LWEB 3GYNA 4LIWA 2ZVIA 4AQYJ 2HLTA 2K2PA 2XMJA 3UN3A 3M2UA 1FFGB 2A6MA 1S9GB 1RB0A 1BC6A 3CXCR 1X8DA 3GTYX 4CLFA 2UXDF 1FKPA 4CIOA 2MHNA 3BBBA 5A0YA 4M5GA 4IQXA 1V3SA 5KAKA 4OJ3A 4JB8B 2DJWA 3BYRA 1XTZA 3H2VE 1HARA 2FUG9 3MZIA 2DH9A 2WB4A 1F9HA 4NLUA 5CQGA 4A8YA 3GJQB 5D8HB 2WVDA 2D69A 1RSCA 5B0DA 2QGFB 4UTGA 3GLJA 5KFFA 3D2WA 4LF6F 1B7YB 1VIOA 5DG9A 1K0VA 4WPAA 3SCLE 4USWA 2X1FA 2XQCA 1WOOA 3GIIA 2VF3A 4CI0B 2ZHOA 4C9DA 2DNNA 1LEOA 3CJKB 4DR5J 2XLJA 5LMUJ 3GJSB 2XYHB 4JI3J 3OJUA 2R2TA 4FKXA 5F8MA 4ZVEA 2AYMA 2AU0A 1N33F 5B0BA 1YGYA 1X31C 4W4MA 4OI1A 4QR0A 2IRYA 3RZAA 4R5PB 3OTOJ 1N56A 3FEZA 4JUZA 3WC0A 1Y3KA 3M2RA 3QWPA 1DQ8A 1OPZA 4DMZA 3UWTA 5KFEA 3CC7S 1CULA 1YJNS 3MD1A 4YB1P 1BE4A 1OQ3A 1BHNA 4IG0B 4WWSA 1H38A 1YJWS 5IV3A 2BZ2A 3H90A 3PW5A 1VC6A 4URQU 5C25B 3HX9A 2LA6A 3AT1B 1PJ5A 3MCOA 1S6PB 2DO4A 3UD4P 2IJRA 2QV6A 2XLIA 3W61A 1WEXA 4M63A 3MCSA 3VF0B 2RVJA 4DV3J 1RHRB 2RF2A 2R7UA 2ASDA 1FDAA 4F67A 2ZH3A 4NPOA 3CCUS 2ZOGA 4ZN1A 4KTQA 1X4AA 1FXDA 2R7SA 3CWJA 3ENVA 3PIOQ 4CZCA 2HPUA 1KWMA 4QOTA 1QUPA 2NSBA 2CDQA 4IDKB 4Y0FA 4FYWB 2KXNB 4F26A 2LDIA 2WAQD 2ZOMA 3EDQB 5BR8F 2CXEA 1TQLA 3MMCB 2Q66A 1CVJA 2PD1A 3AQOA 1TL3B 2XY7A 3BV8A 2W1BA 4PABA 2ZHAA 2LMIA 3PJ9A 2CPIA 5KFIA 4MIBA 3CJ4A 1M1KT 4DDFA 3MTKA 3PW0A 1RZMA 2VG5B 2HQCA 1B7FA 3LPYA 3BS9A 5B0AA 2F4VF 4OJ1A 2IA0A 4F2SA 1KEKA 4JBCA 1XR6A 4LF8F 2CWXA 1RTJA 1DQAA 3BZQA 2M3DA 1N0VC 3TARA 1L3UA 4WFAQ 2ZH1A 4ZVHA 1YZ7A 2DEIA 4F0MA 2Z57B 3BBCA 2HFOA 4Q8FA 4PG4A 3TZXA 2MLZA 2AJ2A 1B0PA 3GJTB 3HVWA 2VQFF 4YFUA 1SJRA 2KVIA 2R7WA 4DUZJ 1UVNA
chains in the Genus database with same CATH topology
4YB7A 4ZHRA 1FO1A 4KC5A 3LO3A 1U45A 3N4WA 2RQ4A 2FIUA 5HROA 3CMES 4IOBA 4OI2A 5AXMA 1T05B 3FSIA 2HVIA 1BQXA 2DD8S 3ZZZA 1KQSR 4QBUA 3G4SS 1NJWA 1HQEB 2FVPA 1T05A 4DR4F 4DFMA 2Y1JA 1VQLS 3B4DA 4RW7A 1HQEA 3FGVA 3AB2B 4N5SA 3SV3A 2KB2A 2RIJA 3GFXA 3PR5B 2ZH2A 3E3XA 1P6TA 4DL2A 2DGOA 3KLIB 2HGNA 2HGMA 4FXDA 3CTRA 2HHWA 1MMDA 2CPEA 2XG8A 2XULA 3MTJA 4K4SA 3D5MA 2VG6B 4JV2A 3ISZA 2RH3A 4LT6A 3IG1A 5AXNA 3KLEB 3SV4A 5L8RC 2VG6A 5IWAF 2HGLA 4Q2LA 3NGKA 3I0SA 2CJAA 2FC8A 1CG2A 3N6MA 4NYPA 3M8RA 2CQ3A 2YKPA 3L3CA 3BN4A 3NBPA 2D74B 1DLOB 3T3FA 3FZ2A 3K5PA 2W24A 4OI3A 3TQ1A 4CH7A 1F5BA 3MXHP 3U1NA 4V19J 1DLOA 3P3DA 2GX8A 1S48A 4DSKA 1UFWA 2IM0A 4RKUC 3CD7A 3CE8A 4FNHA 3ZZOA 5THWA 2NPFA 3CCMS 4RUAA 1EETB 2JLEA 3RTVA 4F2RA 1M5SA 3FMBA 4UUWA 3SDEB 4Q45A 2KHCA 3BO3A 4HH0A 2J9DA 4E0DA 2A1BA 4OLPA 1EETA 1BGXT 1RKIA 3AA8A 3QZ8A 1VS3A 3HXMA 3RB0A 2M52A 4C8OA 4KHPF 2C28A 1W25A 3JSMB 4RU2A 2BJDA 1T03A 2DNPA 2HNDA 4HT5A 4G1PA 2FJDB 4XAKA 2RB7A 4ZP9A 4FN5A 4C7QA 4N41A 3JSMA 3OL9A 5DM7Q 2GMJA 3OR1B 2EW9A 2QIFA 3MEGB 3CO9A 2DNLA 2PC6A 2V2KA 4RNFA 3I55S 1FJCA 4CNYA 3V6HA 3OR1A 3M8QB 3MEGA 4C8YA 3BB5A 5DRKA 4ED3A 5I3UB 3TP2A 1IR0A 2OPSB 2W9BB 3M8QA 2DHSA 5KFZA 1HR0F 1SJ1A 4DPOA 5I3UA 2HNZB 1Q8LA 2OPSA 5KG6A 2W9BA 2IBKA 3PJWA 3V6JA 2W9CB 4DSIA 1CC8A 2HNZA 4BWMA 5KG1A 1Q81T 1G1XA 3OR2A 3MPVA 1Y5LB 2EFOA 4X2BA 4MKAA 4Q2MA 2MHEA 2AJ1A 2W9CA 1L3TA 2FVRA 4A46A 2GIRA 1VQMS 3ZZYA 3N5FA 5F3ZA 4LF9F 2ZD1B 3FMWA 2M9KA 1UVKA 4X66F 4GC7A 1FHTA 4F4YA 1QJHA 3GFHA 3UNGC 3CIMA 2F40A 3DU5A 3PW7A 1HNVA 1Y5NB 2ZD1A 3R5CA 4IQMA 3CF5Q 3MM7B 4MJKA 3D1OA 4K4UA 2EK6A 2V5HG 2V8HA 3OXFA 1AW0A 4RW9B 3LANA 3MM7A 4KIAA 1LK7A 4RW9A 2E5HA 3CC2S 3MOZA 3K5NA 5ADZA 2EG2A 1U2FA 4OZNA 2MY8A 5T41A 1U24A 2R4FA 3FNNA 1RT7B 4NOHA 4JV0A 1S0VA 3MM9B 3B8HA 2PEHA 5A6WA 3UQSA 3QAEA 1N6QB 3Q22A 1RT7A 2ZDOA 3VAMA 2YX7A 4MAKA 4O4GA 2DRBA 3MM9A 1T3OA 1S1UB 3Q8QB 4ED0A 3RAXA 1P27B 2QMWA 5LJ5Y 2J9EA 4ILMA 1N6QA 5DDOC 4CO5A 1S1UA 1K0TA 2BXJA 1C4CA 2FLPA 5I3PA 1U25A 2B43A 3SZ2A 4CH1A 3ZC4A 3OV7A 3CUNA 1ZM9A 4DV7F 2KZZA 4RWXA 7FD1A 4IYQA 2VZ9A 4X65F 1VQ5S 2BUNA 3SSRA 4CT9A 3NGDA 1U47A 3TVYA 2DISA 2UUCF 1TL5A 3HI9A 1R8HA 5AXLA 1MW7A 2KJVA 5KFJA 4TYAA 3R1HA 2AP6A 4JI5F 4RW4B 2BA9A 4ES2A 6FDRA 5DLFA 2DR7A 4LFAF 2KFZA 3DLBA 1Q53A 1RT4B 2KHDA 4RW4A 5KOXA 2M70A 1F5CA 2CRLA 5AXKA 2YNHB 4WE1A 1RT4A 4KT0C 3ONQA 4ZCIA 1NH7A 1KR4A 5F0WA 4K50A 3SEOA 2YNHA 1SUQA 2JL9A 2RQMA 3KMQA 1C0UA 1HBMA 2GNKA 3I6PA 4ITSA 3DLKB 1U48A 2RT3A 1UVMA 1X4GA 4Z2XA 2XLKA 1S0MA 2VV5A 2AV5A 4JI8F 4DLEA 3X1LB 3DLKA 1JLFB 3MURP 2D9OA 5EGYA 2B7BB 4RNOA 4NLDA 2AJ4A 2GC8A 3AHPA 3M6WA 5ITHA 4LQ3A 3HVRA 2BJEA 4ZPWR 2C3PA 3SCKE 5C5JA 3CCES 1B0VA 3MMAB 1RTHB 4KFBB 2U1AA 3J7YU 4KQZA 4DL0C 3H20A 2YWHA 1FDDA 3B82A 3AA9A 3MMAA 4OHWA 1RTHA 4IKAA 3LWMA 3QJPA 4I2PB 1SKSA 3I56S 1SI9A 1DJ0A 4DV0F 4QWEA 4GO5X 4OX6A 3RBEA 3D0IE 3ULHA 4ES1A 4I2PA 1XN9A 2WSFC 2WSEC 2DH8A 2KM8B 3M8PB 1KHWA 1S10A 2HAIA 3RRHA 1XR7A 3M6UA 1K1SA 1R3NA 1K8AT 3ENQA 4PKDB 1VQ8S 3M8PA 1UVJA 1B64A 4OZJA 4OMFG 1D8YA 4U7CA 1TK0A 4QWCA 1NJZA 4P6QA 3K5LA 2NPIA 1X9MA 3T1YF 1TKTB 4QYRA 4DR3F 4HT7A 5B09A 3CCSS 5FD1A 3DC2A 2F3JA 3CJ3A 4FP9A 1VQ6S 4LJMA 2DR9A 3HZEA 1X5PA 2DNOA 1YG0A 1C0TB 2B51A 5D78A 4B3TF 3KHGA 4QJVA 4ZOSA 1A9NB 3N79A 4PUOB 5B0EA 2C3YA 5F8GA 1C0TA 3C2PA 4O0IA 1SJ4P 3M6VA 4C8NA 1SIWB 3PJXA 5CCLA 2O67A 1ZAWA 3M2VB 5IT9Y 1RP5A 3M2VA 1PC5A 2J6TA 4HVZA 5A0YB 1R8BA 1LW2B 3DDNA 4RBVA 1NJXA 3IS9B 4ALZA 2GQCA 5K9FA 1LW2A 3OL6A 2CPFA 2E1MC 1UJ6A 2KKHA 3IS9A 1AUDA 1S0OA 1NH8A 2XI2A 5SUHA 2IBOA 3DNCA 5B0CA 2ZJPQ 2HHXA 3OSPA 2CQGA 4IRCA 1IBKF 1G2EA 5K8MA 1JLCB 2A10A 3TAQA 4NLVA 4F8RA 2EWHA 3KOAA 1PO6A 2NUHA 2DITA 1JLCA 2RKIA 3IAM9 1XBWA 3KK3B 1WACA 2VG7A 4NMLA 1KTQA 2CVIA 4KPYA 2K1RB 2ZH5A 3HHLB 2CQHA 2G9OA 3KK3A 3H5YA 2BANB 5KFXA 2J6UA 1Q79A 2K1RA 3OFHA 3KKFA 3HJFA 4IH5A 3H25A 1VQ7S 2AGQA 2BANA 1RWUA 4L6V3 5D6GA 3EZ5A 3G6ES 6FD1A 4WU3A 4ETXA 1D8ZA 3TVKA 3OVSA 2ZBCA 5E3CA 3MR3A 2DK2A 5G0RB 5SZTA 5L9NA 3U1LA 1FNXH 1HA1A 4G1IA 2ZKTA 4K2XA 5G0RA 2FHOB 1X4BA 3DYAB 2EKYA 1GX5A 2X1BA 2AJ0A 2PGCA 4WKRA 3CEDA 4EO6A 1NKCA 2GGPB 1KD1T 4KR0B 2OFGX 4YDDB 3GILA 1HHTP 3DYAA 3KFWX 1RTDA 1UEVA 2LXUA 1YWXA 4NA3A 2OJ3A 2E7WA 3BR9A 1JK9B 1LQ9A 2GGPA 3LP0B 3MEEB 4PRFA 2KT2A 4DR6F 1QE1B 3D1QA 4OLOA 1H0HB 3MEEA 1Q16B 2DNYA 4X84A 3VAIA 1UA1A 5KT7A 5I3QA 3WX4A 2E1CA 1DFDA 4PXCA 2FPHX 1QE1A 2IFXA 2RQCA 1QAIA 2DR8A 1WHVA 1HI1A 4CCHA 3KK1B 5GAEU 3WDOA 3OTBA 5DQIA 3G6XA 1FXLA 3DDKA 2AD9A 2OPQA 4OJHA 1ROFA 2A2DA 4D3GA 1VC5A 4JV5F 1WG5A 3B4MA 3PO4A 1SBRA 2GMLA 1NAQA 2YNFB 2P9EA 2YKAA 4MMOA 4OHZA 5KT6A 3IR7B 1VQPS 1R89A 1SC6A 1TV6B 1S1VB