1PGZA

Crystal structure of up1 complexed with d(ttagggttag(6-mi)g); a human telomeric repeat containing 6-methyl-8-(2-deoxy-beta-ribofuranosyl)isoxanthopteridine (6-mi)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
183
structure length
183
Chain Sequence
KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*T*TP*AP*GP*GP*GP*TP*TP*AP*GP*(6MI)P*G)-3'
publication title Structure-based incorporation of 6-methyl-8-(2-deoxy-beta-ribofuranosyl)isoxanthopteridine into the human telomeric repeat DNA as a probe for UP1 binding and destabilization of G-tetrad structures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 48
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2003-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1pgzA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1pgzA02
2UP1A 3RW6A 2JX2A 1FO1A 2OIHA 2XS2A 1VQ6S 2VONA 3MUMP 5HL7Q 2E44A 3SXLA 3US5A 2M88A 1WEXA 3Q2SC 1PGZA 1KC8T 2ADBA 2MSSA 1Q86T 1A7GE 1P1TA 2MMYA 1FNXH 2DGXA 1KOHA 2K3KA 2MJNA 3IWNC 3R1HA 4OZ0A 4WFBQ 2VOOA 1OIAA 5FJ4A 1N52B 3H2UB 1JMTA 4F25A 1N54B 2KG1A 1PO6A 4CH0S 3G9CA 3K0JA 2DH9A 2HGLA 2E5HA 3R27A 5LSLA 1W2BR 1K73T 2CPHA 3VAGA 1U1KA 4LMZA 1H2UX 1XN9A 3J7YU 1YIJS 1WHXA 2MQLA 2RU3A 2ZJRQ 4TU8A 3PIPQ 2OJ3A 2DHSA 2DGQA 2MKSA 1WHWA 2Q79A 1YJWS 4QU7A 4YOEA 1Q82T 2F3JA 1VQKS 1S72S 2YH0A 5IQQA 5GAHU 3MURP 1VQOS 2CQ0A 2MY8A 2X1FA 2DITA 4CIOA 2MB0B 3THTA 2X1AA 1N88A 1WHVA 1KD1T 2EVZA 2F9DA 2MXYA 5IM0A 2CQ2A 3CCVS 1WF2A 1FJCA 2HVZA 2CQDA 2RVJA 1VQNS 4PRFA 2DHGA 3UWTA 2XB2D 2I2YA 2FC9A 2L9WA 3NNHA 3P49B 2DGOA 1SJRA 2RS8A 2J76E 1O0PA 1VC6A 1X4EA 4C0OC 4F02A 2DGWA 2O3DA 1X4AA 1SJQA 1F9FA 4WFAQ 3CMAS 1N8RT 2DO0A 2QFJA 2RQCA 1U1OA 4CQ1A 2MGZA 4IOCQ 1URNA 2JWNA 1M5OC 2KXFA 1HD0A 3MI7X 2MKHA 1U2FA 1VQ9S 2YTCA 1X5PA 3S6EA 5MLCV 3G96A 1X4CA 1D8ZA 5BJRA 4A8XA 4WF9Q 1WG5A 1YTYA 4FXVA 3I55S 5DDPC 2DB1A 4Y00A 3CD6S 3CC7S 3G8TA 1WEYA 4ZKAA 2HYIB 5LXRA 1YI2S 1KQSR 2CJKA 1VQPS 2CQGA 3NNAA 2DNHA 2LYVA 1UAWA 1NJIT 3OW2R 2KRBA 4RU2A 5D77A 4QQBA 2KVIA 2FHOB 1ZZNA 2MKCA 2DNPA 1RKJA 5DM6Q 1UP1A 2G1DA 3LPYA 3CCRS 2DNQA 2HZCA 2LCWA 5CA5A 2KXNB 5CXTA 5GVQA 1JJ4A 3H2VE 2MKIA 3MUTP 1M90T 1FHTA 1RK8A 1SXLA 2N3OA 1UW4A 2MQQA 5DETA 5ITHA 2YKAA 2JVRA 1NO8A 2D3OR 1VQLS 2XNRA 4W92B 2CPFA 3BO4A 2CPEA 4J5OA 5H1SV 4U67Q 4IOAQ 4PKDB 2B0GA 2MQPA 2LMIA 2F9JA 5LXYA 3MUVP 3G71S 2MZRA 1IQTA 2L08A 1X4FA 2CQHA 2KFYA 1HL6A 2RRBA 4W90B 1H2VZ 1X4BA 5IFMA 3CCSS 2DHXA 2PE8A 4FXWA 4ERDA 1KOOA 5CYJA 1D9AA 3B4MA 3UD3P 2A3JA 1OO0B 2KN4A 2MQMA 1A9NB 2RQ4A 1L3KA 2LKZA 4YUDA 3CCMS 3CCLS 3S01A 3V4MA 3FEXB 2N82B 3CCES 2U2FA 2KXHA 5DDQC 1K8AT 2OSQA 3CXCR 2DO4A 2NZ4A 3HI9A 4OZ1A 2KYXA 3SDEB 2MHNA 1YJNS 2CPYA 3CULA 2M2BA 2DK2A 1X5OA 2M4MA 2D9OA 1R8PA 2XS7A 1WI6A 5LSOA 1M1KT 2KU7A 1YHQS 1YITS 2DGSA 2GHPA 3VALA 2DGTA 2CQIA 4WIIA 2PEHA 4LIRA 1WG1A 1JJHA 1U1QA 1QVGR 1VQ5S 3UCUP 1VBXA 5JVHQ 1X5SA 4IUFA 3CMES 2XSFA 3BO2A 3VAIA 3FEYB 3P3DA 2LECA 3D2WA 4TLQA 2M70A 3TP2A 1FJ7A 2YWKA 4F26A 2K8GA 2NLWA 2G0CA 2KM8C 3VAJA 3ZZZA 2CPIA 2EK6A 4QU6A 3VAFA 3JB9k 1G2EA 3MXHP 1DBDA 1HA1A 2LQ5A 1QVFR 2MQNA 3NS5A 2AYBA 4Z2XA 2M8HA 2X1GA 3MD3A 1FT8A 2MZQA 5DDOC 3DLLQ 1H6KX 2AYMA 2DH8A 2WBRA 3CCJS 2OTJS 3UCGA 1B7FA 2DGVA 2EK1A 3UCZP 2CPDA 1UFWA 2MSTA 5D78A 5DM7Q 1S79A 4EGLA 3G6ES 2U1AA 1WEZA 2MZJA 3EGZA 2RUGA 5GMKa 3PIOQ 2N3LA 2RT3A 2AD9A 1X4HA 2LEBA 1VQ4S 4M5DB 2KG0A 5JVGQ 1VQ8S 4BS2A 2CQPA 3J7ZT 4P6QA 2JRSA 2M7SA 1NU4A 2MZTA 3G4SS 2J0QD 5IM0B 2X1BA 5GADU 1WWHA 5LJ3Y 1YJ9S 1X0FA 2DIVA 1WF1A 2DNNA 2KM8B 2SXLA 2AYEA 2KHCA 1WELA 1WF0A 2HGMA 3TO8A 3VAMA 2LEAA 3CUNA 2KT5A 1WG4A 3SMZA 1DZ5A 2DNGA 2RNEA 2KRRA 3NS6A 4YB1P 2CQBA 2XS5A 1VC0A 1HD1A 5GAEU 3VAKA 2HGNA 3U1MA 2MGZB 3N9UC 3VAHA 3CC4S 2MKKA 4V19X 2YH1A 2MPUA 2DNOA 2ADCA 1U1LA 3BEGB 1YWXA 1Q7YT 1U1PA 4PR6A 4WCEQ 2DNRA 2CPZA 3S7RA 1CVJA 3S8SA 1X5TA 5LJ5Y 1ZH5A 2QA4S 3CPWR 3HHNB 1U6BA 1DRZA 1ZZFA 2DHAA 3VF0B 1OWXA 4WFNQ 5GAGU 2KH9A 1VQMS 1FJEB 1K9MT 2FY1A 2E5IA 4Y0FA 1AUDA 3UD4P 1SJ3P 1R8HA 1X4GA 3UE2A 3B4DA 4TU7A 2CQ1A 2DGUA 2DIUA 3U1LA 2M9KA 1U1MA 2MYFA 3MDFA 3BS9A 4QPTA 4UY8T 2DISA 2FPHX 1DHMA 3DXBA 1OPIA 2DH7A 3ULHA 2N7CA 2MZ1A 2AYGA 2DNMA 2CPXA 2KI2A 1BY9A 1Q81T 1U1RA 2L41A 2MQOA 2RS2A 2FC8A 3I56S 2E5JA 2MJUA 1WI8A 2M8DB 3TYTA 3R1LA 3P5TL 3CC2S 1WHYA 1U6FA 2MY7A 3EX7B 2D9PA 4ED5A 3THPA 1H2TZ 2JVOA 1M5KC 2CQ3A 3NMRA 2J8AA 2BZ2A 3CTRA 3MD1A 4LJMA 3CF5Q 2M0GB 2BOPA 1VC5A 1U1NA 1M5VC 3P6YC 2G4BA 2ZJPQ 2DNYA 3ZZYA 2LXIA 4C7QA 5HO4A 2V94A 2I38A 1JJ2R 1M5PC 2LA6A 1QM9A 3G8SA 2XNQA 2CQ4A 2LA4A 2DNZA 4CH1A 2MKJA 2CQCA 2VODA 2RRAA 1X4DA 1VBYA 3IRWP 2MZSA 2OSRA 2QEXS 1VQ7S 3CCUS 3Q2TC 3CCQS 3NNCA 2E5GA 2LXUA 2DNLA 5DDRC 3RW7A 5EN1A 2DNKA 1P27B 3LQVA 1WTBA 2ZJQQ 2M52A 1FXLA 3EGNA 3SDEA 2OTLS 2CPJA 4IO9Q 1SJ4P 1VBZA 3BO3A 4TU9A 2VOPA 3L3CA 4WKRA 3MOJB 4UQTA 2J0SD 2ERRA 1SJFA 4C4WA 2GO9A
chains in the Genus database with same CATH superfamily
3RW6A 3TZWA 4DEZA 5CYQA 3KNAA 4CYUB 4OZ3A 4NLWA 3CD0A 4ZMMA 3G87A 3R1HA 1U7LA 1TZ0A 2P9EA 3M2UA 3I4HX 1FDDA 3PR4A 2ATCB 4DX8H 4CH0S 2GV1A 1I1GA 2NXUA 4YHHJ 5CAAA 2RH3A 4AXIA 4UOFA 3VVUA 3VAGA 1XC9A 3PHEA 4RW9A 2RU3A 1U45A 1C1BB 1K1SA 1HNZJ 3LO3A 3BREA 3QIPA 2NPFA 4FKXA 5IQQA 1JLBA 2B9WA 3LPEA 3FKBA 1RYRA 1PILA 3B78A 1PYSB 3IP0A 2I2YA 4PXCA 3CVKA 3Q24A 2HVHA 2P6TA 1Q53A 3L9ZA 3A4TA 2DCLA 2HFUA 1FE4A 3HKZD 6FDRA 2O5DA 3IBFB 2BOAA 4DU7A 2HYIB 2CJKA 2EFGA 1PYTA 3PO5A 2IFXA 2DNHA 1IKXA 1UAWA 1ACMB 1HW9A 2CJ9A 4H54A 4P72A 5D0EA 5KFNA 5HANA 3IAM9 2QO3A 2VKRA 3KLFB 4ECRA 5CXTA 3CD5A 2FZCB 3MUTP 4O0NA 2CUYA 5E3QA 3OV7A 1NJZA 4HH1A 1TL3B 2Y9HA 2Y1RI 4DFPA 1S10A 4ZITA 1R8CA 4ZVRB 1X4FA 2B8PA 4X2BA 1WNEA 1EJ7L 1BQMA 2IDEA 2UVWA 4KV8B 2G2ZA 1OQ3A 3N0VA 1LWFB 3RAQA 3IAS9 1KR4A 2GIQA 4WP8A 4C97A 4OYZA 2BE2A 3DMJA 3ETOA 1WI6A 2IMOA 4ZVTB 5HLFA 2WK4A 4DFMA 4UQGA 1S97A 2R2SA 1K47A 3DU6A 3ZO7A 4A8FA 3BO2A 3P3DA 5K8OA 3ZTRA 1RWOB 3OSPA 3IS9A 2PC6A 3T9NA 1R0AB 2LQ5A 4B3SJ 4F8RA 5HQ8A 3LGMA 2B6AB 4DPOA 4IG0B 4PXDA 4EO6A 2J0XA 4USVA 1FDAA 4IRKA 5HVHA 1Y5NB 3M6UA 2CPDA 2NSCA 1WC3A 2RE1A 4F4YA 4OV1A 2X7IA 4M5DB 3SFUA 1LWFA 2ZWPA 5U47A 1S1VA 5GADU 1KONA 2IVYA 3QRQA 2Y0BB 4B3MJ 3DLJA 2BEFA 4FNIA 1W25A 3MEGB 4M1KA 2BW2A 3I6PA 3NS6A 4TQSA 3IBWA 3MEKA 4ZCMA 2MPUA 2O66A 3B54A 4X65J 1IR0A 3AD7C 4FBUA 4G1QA 3S7RA 4GKKF 5KFPA 1DRZA 3RB6A 4LF7J 2NUHA 3VF0B 4NLSA 3QQCD 1IBLJ 4CRJA 4Q2LA 2EC0A 4B08A 2MYFA 3CDBA 3I5AA 1DHMA 1LNQA 4ZCLA 4WP9A 1ZA2B 1TUGB 4ZK7M 2FVPA 4M5DA 2A10A 3I56S 3MMAB 3R1LA 1KDNA 1FKPA 3SCLE 2R2RA 2P9GA 3KJNB 2FJXA 4Q2MA 2CQ3A 4CLFA 2IM1A 5HBMB 4LUBA 3CTRA 2HVDA 4X4TA 3L95X 2EFQA 3MEGA 5DLFA 3FCVA 3N01A 1B0VA 2XYHB 5AXKA 3GJSB 1RXOB 2Q3PA 1FESA 3RW7A 4X64J 3NCQA 1N48A 2HZAA 3R6LB 3NCRA 3PNIA 4H4MB 2ZWOA 2UP1A 1LK7A 2OIHA 1RADB 4KFBB 3DRSB 2RU9A 2OKQA 3MMAA 1U2RA 4DSEA 2YKNB 1O51A 3RB0A 1RHQB 3BKTA 1FNXH 4ILLA 3IGVA 4O44A 4OX9F 4ECQA 2QLFB 2OP5A 3TOQA 4LR8A 4DXLA 2KG1A 4LBPA 5KFHA 2HGLA 2HZVA 2ZM6F 2PI5A 4KQZA 3LTOA 4N5SA 3DOLA 4ES2A 1P9YA 1U0HA 4TU8A 3ILJA 1NB7A 1RT5B 3AQOA 3OXGA 3ILOA 3HJVA 4OZJA 3MURP 4TYBA 9RUBA 2NYIA 4JI7F 1LXNA 1N88A 2D1CA 1SKSA 2W2OP 3QT5A 1VQNS 3LA0A 1Q8BA 2D3UA 4CO1A 2PI4A 3HVWA 3CO9A 4A8QA 1YZ7A 4KFBA 3HHLC 2O3DA 3DRSA 2W2NP 2DO0A 2FZKB 5L46A 4C0HA 5A8RA 1J2VA 1OY6A 2YNIB 5F8MA 4K4YA 3HMJG 4KY3A 4N41A 5H9EK 2IRXA 1NAQA 5B0EA 3T3FA 1WEYA 1FRKA 2VPYB 4WFZA 3PEJA 1TK0A 2Z0GA 5EX3A 4DUYJ 3H0PA 1HARA 4FYXB 1B3TA 2FHOB 2MKCA 1NEEA 4KHRA 4YB6A 2G1DA 2AJ1A 1Y3JA 2MKIA 4EBCA 2V4RA 2GAHC 3UDVA 2N3OA 4CNYA 4QWBA 2X3GA 2QMUB 1UW9A 4WBFA 3BO4A 4K4VA 4F2SA 1DY3A 3SQGA 1X60A 3LP1A 1RACB 3F73A 1BD6A 1SIZA 4RW7B 1PCAA 3KLHB 4MIBA 2LKZA 4QR0A 3S01A 2YNIA 4BLGA 4JI5F 1YVFA 3CCES 2KHDA 2CKWA 2DO4A 4CLTA 4OZ1A 3JQKA 1TKXA 2EFOA 4R8UB 5G4DA 3CD7A 1WC4A 4DR7F 3K5OA 2VB6A 2HVEA 2ROPA 4K2XA 1S7IA 3D2WA 2QE5A 5IC6B 1HPZA 2YWKA 2WVBA 2RB7A 2QFIA 4QPXA 4C3KA 4L6V3 4DR5F 4CP5A 3MXHP 4O3PA 3DI6A 1ZM4A 1VRTA 3G8QA 2M8HA 1Q5VA 1FF2A 3J81j 3UDEA 4ED4A 1B7FA 1JXVA 3UCZP 2RUGA 1PC5A 3E3XA 1Q16B 3RAXA 2RMLA 1U49A 1PBUA 5HJYA 3QPIA 3HHDA 3L09A 1QJHA 2HGMA 3PTWA 1VOMA 1GMUA 4R8UA 3EDRB 2KT3A 1DZ5A 4K5SA 4QYZK 3NG8A 4OYBA 5HSPA 3VAKA 4ID8A 4P2XA 3QO9A 2XG8A 2ADCA 3BEGB 2Z2YB 4LIWA 4OI0A 3DDIA 3PACA 1LW2B 2QA4S 1ZZFA 4AYBD 2V4JB 1XMBA 3RZAA 3V6JA 4Y0FA 1R8HA 3UE2A 3DN9A 3B4DA 1I51B 1YG0A 3Q8UA 1XR6A 1HYSB 2DPJA 2VZ9A 2UZAA 3AXKA 1TFYA 2M8DB 4M8LA 4DR6J 1U6FA 3QGPA 4JI2F 4BC9A 3OBIA 2VH7A 4JI0J 1NJYA 2RJZA 2BJ3A 1DLOB 3R5AA 1SV5A 2BOPA 3QJPA 4C6AA 4EEYA 5D4LA 3I0RB 1UETA 2XHWA 5E5NA 2NSBA 4QWEA 1M5PC 2PMWA 1HBMA 1TMJA 3WHIA 4ELUA 1FK9B 1X4DA 1P9QC 4HACB 3Q2TC 3CCQS 3NNCA 4GO5X 3HFZB 3BR9A 2DNKA 2V4JA 1FRMA 3IN5A 3FVYA 4PYDA 4RBTA 5D3GB 1Q7LB 3PCOB 2LLZA 1UJ5A 3H98A 2HRTA 5L9NA 4F3OA 2RDIA 4ILRA 2J6SA 4DHVA 1R8AA 2EG2A 1SH0A 4HT5A 1SBRA 2DGXA 1RJJA 3FGVA 4JV1A 2LEPA 1F2GA 1EKRA 4WU2A 1HWUA 3AB4B 1EARA 4KJIA 2DY1A 4IRDA 3MEEB 1WC6A 4JB8B 4Q8FA 4V1Ak 3R27A 2ZH3A 4XIUA 1FJGF 5B0BA 3GTYX 3TZZA 3VWSA 4HACA 4IH5A 3K59A 3FZ2A 4DOZA 2MY8A 1SH3A 4L74A 2E7VA 1KRPA 4IH6A 1YJVA 1FJCA 2XCAA 3AJ2A 2ZC4A 1R7IA 1QLNA 5D3GA 2CXEA 3GIKA 5AJ3J 1RTZA 1RWXB 4L3KA 2BM0A 2E5LJ 3EVMA 3Q8RB 2CZ4A 2VFRA 3S6EA 1D8ZA 1KTVA 1UWAA 5KOWA 2E9TA 3KK3A 1B99A 2BV3A 3DU5A 2ZH6A 1GAOA 3MEEA 2FJEB 1W2IA 4CLZA 1ZM2A 1WSRA 4Y2AA 1XIQA 4ATNA 1RCXB 3OVSA 4MK8A 5J2NA 4IFVB 3L4BC 4UOHA 2WVFA 2MDAA 3F44A 2GW8A 4KGKA 2JVRA 2B51A 3QLHA 3K5LA 4EFAC 3MEDA 1N6QA 1H7WA 3PFOA 2MQPA 5LMUJ 1LWXA 1U2CA 2UUBJ 1BQNB 1H2VZ 2FVQA 2PE8A 1S1UB 1ZM9A 4OX7A 3OLBA 2MQMA 1L3KA 4ED1A 1M5SA 2N82B 1Q8IA 2XMWA 4PWUA 3HI9A 2KYXA 1NDPA 4L75A 2E7XA 1CS4B 1B64A 1YHQS 4GC7A 3Q0AA 2FZGB 4MKVA 4X62J 4PCQA 2K3IA 3IR7B 1NXIA 5C2CA 4IFVA 3VVTA 3UCUP 1OQ6A 5KOXA 1ZETA 5IT0A 5JJBA 3TQ1A 1REVB 3M2RA 4F26A 1JIHA 1LK5A 3D5MA 3MM8B 1XNRF 1O6XA 5C2GA 1QVFR 3ENAA 4QWDA 3KLGA 1QTMA 2X1GA 3EXYA 2UUCF 4NZ6A 3QSIA 2GZOA 4F4ZA 1BQNA 3MM7B 3ISZA 5ETOA 5DGBA 1N5YB 1S1UA 4EGLA 1K0VA 1WEZA 4DF8A 4I2PB 2MZJA 2AD9A 3EZ5A 1MN9A 2HK2A 1ROFA 3NKYA 2NXEA 4ZP6A 2J0QD 5F9NA 3DRPB 5IM0B 1N5TA 4AT1B 5EHHA 2GQ2A 4DDFA 1CS4A 2ZZMA 2Q6BA 3IR5B 3CUNA 5H9FJ 4JV2A 4HHUA 3CGIA 2RNEA 4IR1A 2IJFA 2VBWA 3TUIC 2CJBA 3EGVA 2YH1A 1YWXA 4KH0B 3PXGa 2R7RA 2XM3A 2HHSA 1REVA 2R4FA 2AEJA 4M5JA 5LJ5Y 5I3UB 4RWWA 4LF5J 4ZLJA 3EWGA 3M8QB 5EWFA 2VQEF 3FDSA 3MM8A 2B56A 2BJ8A 3OFFA 5F0WA 4QW8A 2FY1A 1IVZA 2V63A 2V2QA 3D68A 1N5YA 2DH7A 3ULHA 2AYGA 1RU2A 3AA9A 4I2PA 1V3SA 2RUSA 3AT1B 2MQOA 2RS2A 1CEZA 5JUMA 3ENVA 3HPOA 3HZGA 3CC2S 2XHCA 1UEUA 4OZNA 5HP1B 1F3VA 2D9PA 3D6HB 5I3PA 2GAGC 1NZAA 1Y5IB 3HXMA 5F9LA 1T05A 1Z1ZA 3R9LA 2V94A 2VBYA 2V2KA 4MKBA 1NK5A 2PMZD 3K17A 3MCSA 2GJIA 4EBEA 2KYZA 1QTNB 2OELA 3M8QA 2HQFA 2YNFB 3D66A 2Z58B 3RBEA 1SJ4P 4QBUA 2KDOA 3C46A 2HEKA 2VG7B 4X66J 3OSNA 5HL7Q 3IG1A 2HURA 3OD2A 3R7NB 2XI3A 4CLKA 1I3OB 4PQUB 3W3SA 5HP1A 3CT9A 1UWBA 4LFAJ 5F41A 7FDRA 4B02A 4K4ZA 4JI4F 4ED0A 2YPYA 3K0JA 4ES1A 2VQFJ 4USTA 1NDKA 2K7JA 2MKSA 4NXMJ 3JAMU 2VBZA 4URSA 3TUPA 4YOEA 4B3TJ 1S72S 1JLEB 2HNYB 1VISA 1F9HA 1HR0J 3CEDA 1Z2ZA 3D3CJ 1DURA 3UWTA 5C5JA 3EXCX 2J6TA 3KUGA 1Q79A 5J1EB 3H5UA 2FJVA 4RNHA 4DL2A 4TVAB 2BYCA 3J80Y 1URNA 3EM1A 3B8HA 3V5RA 1KVIA 3MI7X 1U2FA 4MIAA 3MMJA 4MK9A 3OHAA 3G6YA 3GFYA 4C8NA 2BVZA 1WG5A 4YMEA 4QWCA 1FXRA 2UXCF 3CD6S 2PDAA 3W62A 3GZ7A 2CQGA 3EYZA 1RLCL 1SL0A 2YNGA 3MMCB 1NJIT 4RU2A 1WDDA 2AIRB 4DMZA 5LOQA 4O4RA 2ZBQA 1MNEA 1L3SA 4DV4F 4NX9A 1RKJA 4NRTA 3QWPA 2HZCA 3RBZA 5J2MB 4YP3A 5KFGA 2V0NA 3DLGB 2D3OR 2ZZTA 3SCKE 1KBRA 1N32J 1YJTA 3FNNA 3OXFA 3GG0A 4RNFA 2ZDPA 3TAMB 3UFCX 2LMIA 3OR2A 1SQEA 2H5JB 1IQTA 5J1EA 2OLWA 3NY0A 4CH7A 3MZIA 1KQGB 2XMJA 2ASDA 2BE9B 4DPXA 2B4PA 4QOTA 2RHSB 2U2FA 3TZYA 1GNKA 2MHNA 2DR9A 5F8NA 2VC0A 3OJUA 1R8PA 1GTEA 2R7WA 1F6TA 2W2PP 3KG1A 5KT7A 1XMOJ 4C8MA 4LIRA 4MJKA 5EUHA 3H20A 1FVQA 1GX6A 4NLPA 1PSDA 5J2MA 1T9YA 4WXWA 1XR5A 2DJWA 2KM8C 5IC4B 1T94A 2I9SA 3DLGA 4CWBA 3MWBA 3JB9k 1G2EA 4ZVUB 2IIHA 4JI8F 4FXDA 2BE7D 1NSAA 3TAMA 3IR6B 2J9DA 2DH8A 4FVMA 1IBKJ 1K1QA 4DV3F 2DGVA 3BJYA 1BC6A 3MMBA 1KFSA 1JNRB 2U1AA 1S99A 4USJC 3QNWB 5E0OA 1VQ4S 1HI0P 4DUTA 1FX4A 2H9ZA 3GFHA 3NBPB 5J1PA 1TL1B 2B9YA 3T5JA 3D7SB 4P6QA 1VHFA 5A76A 5KAKA 4PG4A 3N5BA 4DR3J 3C14A 4ZP8A 3KHLA 1AZSB 4IRCA 1S9GB 3M8WA 3POTA 4XTTA 3UO0A 4F0HA 2QL5B 3L7UA 3IWLA 2V4QA 2W2MP 4ETXA 5HQMA 1LV5A 4KO0B 1QSLA 2XS5A 1C0UA 4MYTA 2XBPA 3VAHA 2XGQA 3AJDA 3FMWA 4PWWA 2D74B 2ZH4A 1P1LA 3W9HA 3G2XA 5THWA 1S57A 3AQPA 3VGUA 4DFJA 1QUPA 3IMQJ 2KH9A 2YQ0A 3I9ZA 2XLKA 1K9MT 5E3CA 4DI6A 1H73A 2R2UA 2V8VA 1T02A 3DXBA 3SIPB 1OPIA 2J8SA 4ZN1A 4NA1A 3W7BA 2IMWP 3A8JA 3MR3A 4B3RJ 1Q5YA 3TYTA 3Q23A 2IPOB 2FVSA 1WORA 2GO8A 4GMKA 1WC1A 4PEOA 1H2TZ 1TAUA 2J8AA 4EWTA 2AJ4A 4HVZA 2YXLA 5HVFA 2P5VA 2LQ9A 1M5VC 4KKOB 2ZBPA 1JLAB 2YBVA 2BRLA 3FBCA 5DG9A 4NMXA 1XERA 4LF9J 2XNQA 1RWUA 4DX5A 2HS0A 3NXZA 3K5NA 2RRAA 4FS1A 2V67A 1KKHA 3EPIA 4WYWA 4J9LA 1SCJB 3EGNA 2OTLS 4UQTA 4C4WA 4FF4A 2JX2A 2VV5A 1R3NA 2AX0A 1WEXA 2V5HG 4FN5A 2R7VA 1HNXJ 2EBEA 3E2EA 1OJ4A 1KHWA 4F25A 1YBTA 4UUXA 1J27A 4ELVA 4ES3A 1TUWA 4KKOA 4Y2KA 5LSLA 1K73T 1JLAA 1U1KA 5FDLB 2POKA 2ZVIA 2EKYA 2ACYA 1OSCA 1E6YA 2GS8A 3M4XA 2WTFA 3C3LA 2AZ1A 1VQOS 1YDLA 2CQ0A 1RKIA 3F0NA 2MB0B 2ASJA 4IKAA 3U27A 2EVZA 3DNCA 2H4YB 2MXYA 2FVRA 5ETKA 1D9DA 1TFWA 4DV6J 2KJVA 2WZ1A 1LWCA 4B3MF 1X4EA 4DN9A 1NSQA 1X4AA 3D6FB 4N76A 3PR5B 4IOCQ 4ED6A 2BQUA 3M7VA 1VRUB 4JOUA 2YQ1A 3JXOA 2RIJA 5E33A 4X65F 4FXVA 4NLRA 3V2UC 2D3O1 2J9DE 5C42B 3CC7S 3G8TA 3TW0A 3NNAA 1C2PA 4OMFG 2KRBA 5FDLA 1IBLF 4S0MA 1FWLA 4URQU 2J6UA 2A6MA 1EAYC 1PYOB 2R7TA 3HT3A 1ZAVA 4J9QA 4F04B 1RK8A 4J9MA 5DETA 2B5JA 1X7VA 3OT9A 1HLWA 2HFOA 2CPEA 2DXFA 4J5OA 4IOAQ 2W7OA 1FFGB 4PKDB 1GXTA 1HI8A 3G71S 3O3LA 2IYGA 2KFYA 3AY0A 4BBYA 2H5IB 3CCSS 1HNWJ 4L73A 1S49A 3W5ZA 5IV3A 4GKJJ 3CDWA 1VRUA 1A9NB 4RUHA 4LF2A 4FPRA 4LR9A 2OPSB 1IBMF 5GMDA 2OAUA 3JTOA 2DY9A 3SDEB 2VDHA 2M4MA 4X64F 4FYYB 1M1KT 3OTCA 3A8EA 2C28A 2F1FA 1JJHA 1VQ5S 1YK9A 3HJFA 4OI6A 1J5EJ 1FDNA 5KFDA 1GK8A 1RE1B 2M70A 1GQEA 4JI1J 1ITPA 3O44A 5HROB 2CWXA 4NCGB 1S0OA 3VAFA 4KGXB 5T7LB 3QSYB 1R27B 2HWTA 3HT0A 2MQNA 1X9WA 1HWKA 4ZVSB 3OR1B 2XGPA 4M5KA 2MZQA 5DDOC 1YZ6A 2IM3A 2GX8A 2OTJS 2EK1A 5DQIA 1CLFA 3PIOQ 4C11A 5KFZA 4R0EA 2M7SA 3BN4A 3G4SS 4GVLA 1WJ9A 5HQLA 2DIVA 2DNNA 3D0HE 2LEAA 2GGPB 4J9OA 1KTQA 1NJWA 4EU0A 2B4OA 1WUUA 2PIIA 1VQYA 2MGZB 1SKRA 2DNOA 2EWHA 3BB5A 1U02A 2ZHBA 1N34J 4AQYJ 1CVJA 4N77A 3CPWR 2R8KA 2DHAA 4H4OB 1TKZB 2PSZA 1FJEB 3OR1A 1V5VA 2DGUA 4E98A 3MDFA 1S1XB 2ROEA 2FLNA 4J9PA 5K9FA 1GEHA 3NMAA 5A2QU 4DUYF 4CLSA 4NOHA 4TNOA 4TQRA 2MJUA 4PYAA 2FTRA 1RHKB 3W65A 3KDOA 1D1UA 1KP6A 2GMJA 5HK4A 4RX6A 1OY9A 2GGPA 5AXLA 4LJMA 3HM9A 4FS2A 3KDNA 2VICA 1J5OB 3RYLA 1SC6A 2G4BA 4OHVA 4IOBA 4DPWA 3TA2A 1S6UA 3T1YF 1N56A 3MAQA 1B4SA 2E5GA 2LXUA 4HL9A 4FP9A 4H4OA 3D0GE 1TKZA 2M52A 2XMMA 5B08A 2CPJA 2GVZB 3MOJB 2FDNA 4UZBA 3UPFA 2W25A 4O23A 4OZLA 2KVQE 1N4LA 3K57A 2C2ZB 2P6SA 3KK2B 1SUQB 2WB1D 5MAOA 2DYAA 1IM6A 1WD6A 1XK8A 3KXDA 1CQMA 5FJ4A 3JYTB 4K4WA 1RWVB 1T3OA 4DV1J 2JEFA 3GSDA 3MPVA 2IC3B 1FX2A 4UZCA 2VPWB 4OI4A 2N4DA 2YWWA 1Q82T 4K2JA 3LP0B 4BC7A 1EZZB 4RZRA 4I69A 4CO4A 1O5JA 4IDKA 8ATCB 2GVZA 4KGZB 2DGOA 3T9ZA 2W7PA 2YKMB 2ZITA 3AOCA 4DR2J 3PZPA 4C0OC 2GHVC 4Q45A 5CCLA 4JI3F 4JYAJ 3PX4A 1TKTB 1KLNA 4Q8EA 5LSRA 2GC8A 1T3NA 3PRDA 1SUQA 1AA1B 3HK2A 2XI2A 2COLA 1IKWB 4DL5A 4DLGA 2OI2A 5JMNA 3JYTA 2ZH7A 2ZDOA 2RF2B 4AFFA 4KE5A 1MN7A 2G2OA 3IRXB 4X4UA 1RHMB 4OHXA 2FJDB 2XTJP 2ATLA 2WAQD 4XK8C 4NLXA 2DNQA 5IS2A 3WIUA 2EC2A 1CC8A 3C8YA 4RW4A 3M8ZA 2IRUA 3W61A 4M95A 5LMNJ 4J91A 1C0TA 4ZPTR 4CLUA 1KLMB 3AFGA 4LBIA 4DV2F 1WTFA 4DR6F 3M8PB 4F4KA 2F40A 3GPAA 5ETSA 3ZTSA 2YKMA 1FNMA 4DV7J 1JX4A 4B9UA 2JC1A 1GMVA 1N33F 4F7VA 4W90B 2R3VA 4WE1B 3KTQA 1H3DA 1TKTA 2KO1A 2I5JA 5BXIA 3A12A 3I82A 3GV5B 1K8AT 3GJRB 1TTHB 4FPIA 3VHQA 4OI3A 2D9OA 2WVEA 2BKOA 3HO1A 2KU7A 1WACA 3VALA 2CQIA 3IRXA 3JSMB 2C3PA 2HKEA 1BXNA 1S9FA 2BBEA 2XSFA 1RT1A 2MTLA 3T5HA 3T1HJ 1R0BG 4ZJOA 3MFIA 4P71A 3PX6A 4MAKA 3RGIA 2YNHA 5IQ6A 3M8PA 5IWAJ 2FLOA 4K50A 3DLLQ 4OHWA 1CJUB 3CDAA 3TJ9A 3EPGA 2MSTA 5L1IA 4I64A 3TEGA 5ETLA 5DQGA 1RQ0A 3CO0P 1QDUB 4BS2A 3IA0A 3NAIA 4ZLPA 2LQBA 1JLCB 1QD1A 4E0DA 5ETTA 4KPYA 3A13A 4O0IA 3RRHA 3OLAA 1WG4A 3UVJB 1NSPA 3JSMA 5KFMA 1WKLA 5GAEU 1AYEA 1RHJB 4V19X 2K1RB 3GLJA 3BBBA 2BMBA 3S8SA 5HMXA 5AJ3F 1M1GA 5A6PA 1NMEB 2E5LF 1KQFB 4OFZA 2HAIA 1JK9B 2P2CB 3LWLA 1A6LA 1JNZB 1DARA 1KS2A 2R8GA 1UMJA 2AGOA 3H5SA 2CPXA 4AL7A 1WKKA 1BY9A 4PUOB 2YWEA 3D1OA 2WOMB 2E5JA 2L3MA 1WI8A 1TV6B 4XAKA 3HZEA 2B4VA 2MQ8A 2IHR1 5EWGA 2D41A 1BWVA 4UT4A 3UN3A 1GT8A 2NXCA 1MWYA 3U02A 4CM2A 1RT2B 3CCTA 1U47A 2R7UA 4C48A 3RU0A 5B09A 1VFJA 2OHDA 2ZJPQ 1HNVA 4YB5A 4CO0A 5HO4A 2UUBF 2I38A 1JJ2R 4Q0BB 2K1RA 2GNKA 3P5BP 1IKYB 1VBYA 4LQ3A 5A8KB 2F8HA 1TL4A 4DSIA 4J37A 2DR7A 4YS2A 2ZJQQ 5D15A 4H4KA 3TVKA 4O3QA 4TU9A 2VOPA 2W8KA 4HYKA 2GO9A 1RYSA 4O3OA 4CLWA 3TQEA 1FO1A 2VONA 4MYUA 4OZ5A 5BR8F 1PGZA 2BQ3A 3C15B 4K5RA 1MMDA 1RT7A 2WHOA 1FFSB 4WU3A 2HNDB 1TV6A 1G7CB 3R7BB 4USWA 3ZTOA 3UNYA 4EI2A 5KFAA 4CLPA 2EI5A 5J1NA 1RT2A 3G9CA 4EBDA 1Y4ZB 3H59A 5KG1A 1MG7A 4ZVFA 3KLIB 1WHXA 3N6NA 1FWKA 5AXNA 3J80U 1YJWS 1IKYA 2W4CA 2F3JA 5A8KA 3D4JA 1RWPB 5GAHU 3KKFA 1B7YB 4NLTA 1FTRA 2NZCA 3THTA 2C3OA 2W9AA 1ELOA 4K8RA 2VG6A 5KT2A 3P49B 1SJRA 2AJQA 4J7CA 1VC6A 2DGWA 2IM0A 2H1YA 4X4RA 4WFAQ 3ISND 4ALZA 4DQRA 1N8RT 4MMOA 3BPSP 4A8OA 2IM2A 3C15A 4GVBA 4LR7A 4V19J 2HLTA 2J7KA 3VGTA 4ZVGA 3GCWP 3FBBA 3G86A 1CG2A 4DPUA 3OUYB 2ALYB 2DB1A 3OHBA 2FY8A 4D3GA 1C1CA 3WX4A 2G1HA 1GMWA 5KFVA 3OW2R 2E29A 3KLIA 1CJKA 3CSKA 3M2VB 2W01A 3F56A 4ER8A 2LCWA 1XBWA 4WIQA 5H9FK 1KN6A 2RAQA 4R5PA 4ZN3A 3ZTPA 4ZJQA 3R7SB 5H1SV 1FTCA 2AJ0A 2VFVA 3QFHA 2F9JA 4R25A 1JB0C 5JXSA 3T5KA 4PG8A 3QFWA 5IFMA 2DHXA 5D0RA 4ILMA 1IN0A 3WQPA 3IM8A 1OPZA 4HI1A 2HRYA 1HBOB 4LF6F 5ETVA 3GYXB 4FF2A 4CCHA 4FBTA 1CULB 1YITS 4M63A 2BW7A 5CYQB 3OJSA 2VA2A 4NL5A 2HW3A 3W9JA 2QMXA 3M2VA 4EYIB 2AX1A 4X66F 1X5SA 2A6OA 4M5MA 3GU0A 1U4BA 4JV5F 3BSCA 3DLKB 3M2UB 2B7BB 4ECZA 2IAJB 4NLOA 4LFAF 1AT1B 5DZ7A 4HHHA 2BKPA 4LF1A 2VQFF 3QGHA 5GMKa 1JLBB 4MH8A 1X4HA 5D0HA 4ZVEA 1UPPA 4NXMF 1HBOA 3BQ0A 4ECUA 4PG6A 4RLEA 4USIA 2AYEA 1CULA 1HR0F 3BQ2A 1R8BA 3NWGA 2CQBA 5M2PA 4I0WA 1NCLA 1RLDA 2J9CA 1WOPA 3LP2A 4NCAA 2QLJB 2QA4G 1L3UA 2FHJA 4CI0B 3PM9A 3DLKA 1UFKA 2IAJA 1OWXA 1QUVA 1F9EB 4JI6F 1TP7A 1IKXB 3R2CJ 1X4GA 4QPTA 3QATA 1V3ZA 1RHRB 1RTIB 1GMWD 3G6XA 1MMLA 2N4CA 5T14A 1RT6A 2HQIA 5CZVA 3HSZA 3MM5B 2MY7A 1UA0A 3M30A 3THPA 3AJ1A 3JS9A 1Y0HA 1GX5A 2EKNA 4OYPA 1IUJA 1I94F 3MD1A 2ZM6J 3OTOJ 1NB2A 1N32F 5K8NA 2PGCA 4DV5J 1NHVA 2LXIA 1BQMB 4DPTA 2HBYB 1FEHA 1FCAA 2ZUAA 2QEXS 1K44A 2OPPA 4JI7J 2C2MB 2KKHA 3LANA 2NPIA 2BE2B 3ELHA 3DMJB 2KZMA 3KHRA 1MWZA 4RUAA 4U7CA 5HLFB 1H0HB 2LQ8A 3MTKA 3LF0A 4FZVA 1D0EA 1NHKL 2M88A 1RTIA 1CQNA 1PJ6A 4ZOSA 4DL6A 4G1IA 4RW8B 4BWJA 1ZAWA 5E41A 3IS9B 1T9TA 4GC6A 4HI2A 1P1TA 2L48A 4ZPWR 3MM5A 2C2EA 4R0JA 2P8IA 2VOOA 4YR0A 1RTHA 1N54B 3RR7A 4ECXA 1VJWA 2DH9A 4P9SA 4IG3A 2Z2ZA 3I5BA 2Z2LA 3SCJE 2CJAA 5FD1A 2ZJRQ 2OGUA 4J90A 2JEJA 2Q79A 4XPCA 3CIMA 3DFEA 2VUGA 3RG6A 3OFGA 1S1VB 3R2DJ 1AROP 3PHTA 3Q89A 4OJ1A 2CQ2A 1WF2A 2HVZA 5IT4A 2RVJA 4OHYA 2DHGA 3MCMA 3C6UA 3NNHA 1NPRA 2J76E 5KFQA 1F9FA 5D8HB 1V3RA 1U1OA 3QAEA 4G1QB 4RW8A 5KFWA 2ZHOA 5I42A 1IR2A 4JI5J 1YQHA 2AEMA 5K14B 4QIFA 2UU9F 1YX2A 1CSJA 1IWGA 5CHCB 4EK2A 3EVWA 2F5GA 3HSGA 4ZKAA 4DCJB 2JZ5A 3WC2A 2DKOB 3D6TB 3BGRB 2K7KA 1QAXA 3MCOA 4DR7J 3WBZA 5B0AA 3L7OA 3TA0A 4C9DA 1T11A 3HHLB 3ITHA 1FKPB 1M90T 2ZD1A 3TANA 2PO4A 2OPQB 4U6PA 2KTQA 4HH0A 4EYHB 3FEZA 5DJBA 3C16B 2W8LA 4C3LA 2LU1A 4DS5A 5G0RB 2YWHA 1FRHA 3BQ1A 4NLGA 1NK6A 4Y3CA 5K14A 4ZIWA 4C8YA 1X9SA 3CJ5A 2V50A 2JLEA 4HDHA 3CXCR 3IC1A 2XULA 2M2BA 2O67A 3UDCA 5CD4A 1SKUB 3JSRA 3BGRA 2DGSA 2DGTA 1BQXA 2GIRA 4PZVA 2CA9A 1V5IB 3M8RA 3HHLA 3OPKA 1FERA 4J9NA 4O44B 2OPQA 1RWWB 1DTTB 2ZH9A 2Q1LA 2QN6B 3SYZA 1LQ9A 5L38A 3C16A 3MHYA 5BYSA 1UFLA 5G0RA 3DOLB 1U0HB 2BJ7A 3QJLA 4O4GB 3I9V9 2CVIA 2ZOFA 4NRUA 3JTPA 4YQWA 5HAOA 3M6VA 3FQKA 3J7ZT 2QA2A 4JI2J 1S6PB 1WWHA 1T03A 3WZ0A 2KHCA 1BHNA 1WELA 4WFYA 1WF0A 1R6VA 3BBFA 1VDHA 2V8HA 2CZVC 2NXJA 4KGVB 3DM2A 5CABA 4KRWA 4Q5VA 1IM4A 3PV8A 2BUNA 3T6BA 2VPZB 4DV6F 4KH1B 1TUVA 3SSQA 1SI9A 4UF4A 1SQGA 5A8RB 1Q7YT 1MU2A 2NCKL 3ZNUA 4P2FA 4J9SA 3W2VA 1F5BA 1DTTA 5EDWA 4WFNQ 6FD1A 2DXEA 2UXDF 1T9WA 1Q8KA 2A0FB 2DIUA 5AXMA 4O4GA 5DLGA 2V8DA 3ZXWA 2GHWA 1Q81T 1S9EB 1JJCB 2H51B 3NGDA 2HHHJ 1S6PA 2QYCA 2FGCA 3I87A 3P4UB 1HHSA 3SQGB 1IKVA 3LP1B 1R6YA 1KEKA 2MHEA 3PVXA 2E1PA 4ELTA 2DNYA 3AD9C 1UPMB 2VDIA 2AJ2A 4FYDA 4PAAA 4N56A 2LA4A 4USKA 3QT7A 4MK7A 2X51A 4CO3A 9ATCB 5FLXU 1L3TA 3V81A 1TKXB 3M8YA 1GXLA 1X31C 3L3CA 2IBOA 2J0SD 3DLEB 1PBAA 2XS2A 2HIYA 3V6HA 3Q2SC 2IBKA 1S9EA 5GAEI 1HPZB 4NYPA 4IH7A 1NKCA 3MF5A 2C2KB 3UN5A 4OLPA 3K5MA 1J5EF 4DV0F 3DOMA 3IWNC 3HHLD 3DI6B 1VRTB 4X84A 1SL1A 3QBCA 4UUWA 4RKUC 1UZHA 4OYXA 1UVIA 2EG1A 4HDGA 4A46A 3J7YU 1TQLA 2NYHA 3H90A 3RBXA 2OJ3A 4X4OA 4Q7AA 2ZH1A 1DTQA 1C4AA 4DR4F 2JDJA 1TK8A 1SL2A 1HHTP 1SPBP 2F9DA 1NK8A 2FC9A 5DRKA 3DLEA 3QO9B 4F02A 5B0FA 2VFSA 3OFHA 3PO4A 2AMCB 2F4FA 1P8GA 2OEKA 1X5PA 2QL7B 1PJ7A 3CJTA 4A8XA 3A1YG 3RAMA 1N34F 4AQYF 2CJQA 2F63A 2V9WA 1VLOA 4M5LA 4CNZA 4ED7A 1R89A 5D77A 4E8UA 2UXBJ 2YX1A 3RJMB 1RSCA 1P6TA 3LPYA 2F4VJ 4DL3A 3C6TB 3VZIA 1JJ4A 1SQFA 3R5CA 5KFUA 4NYZA 3GYNA 2D3ZA 2XNRA 3CJRA 1SV5B 4I56A 4NEYA 4LFCJ 4AL5A 4I6AA 1DQAA 2AGPA 3SBMA 3N4WA 1HBMB 2OUGA 1D9AA 4LREA 1OO0B 3TVZA 3PJXA 2VIHA 1RWNB 3CCMS 4UY85 3I31A 3FEXB 4DG1B 5GAHI 2OPRB 1YJNS 1NBEB 2FVCA 1QAIA 4UOCA 3OVBA 2ZH2A 5BYQA 2GHPA 1YBAA 3PRVA 2H3EB 3D54A 5E2QA 2Y1JA 4IYQA 1FKOB 3C6TA 1JXLA 2LECA 1RBAA 5GMEA 3BV8A 2VQEJ 5D4NA 3ZZZA 2EK6A 2YKQA 4I67A 3CDEA 1DBDA 2AYBA 3GWCA 2ZBCA 3MD3A 2QSWA 3UCGA 1VK3A 5CYMB 4WK1A 3FK4A 2UVUA 2JJ4D 3ZZ0A 3AAWB 3EGZA 2NS1B 2C3YA 2XMKA 4OYIA 4NLDA 2XZWA 3BPDA 1S1WA 3JQJA 4TLRA 2VG5A 4DG1A 2OPRA 1WF1A 1SKWA 5L1KA 2PFFB 4J9VA 4I68A 4BCAA 2WW8A 1AUSL 1RWMB 3UDLA 4WTOB 2KRRA 1IJFB 1VC0A 4KBIA 1R43A 3QT6A 4ED2A 4ZLLA 3IBCB 1FKOA 2DRBA 4AUKA 4A47A 3GV7B 1SC4B 4IO1A 1ZH5A 4JYAF 2CWKA 5A6WA 3KK3B 1RP5A 4YEAA 4YFUA 3HVTB 2K2PA 1QAJA 1D9FA 1SJ3P 1NUEA 4WWSA 3MR6A 5J2NB 3GP9A 2XO7A 3BS9A 5CYMA 2DNMA 4ZS6A 3W63A 4B3OA 3J81Y 3RTVA 1KVJA 4CDIA 3OL6A 5IV4A 1VHIA 3GIMA 4M5NA 4DL7A 1N5QA 3QLHB 3DRRB 1RGVA 3MEDB 1N6QB 4JI4J 1M5KC 2QX0A 3NMRA 5AE3A 2IA0A 3DLBA 5HATA 2F65A 3ZNJ1 1QE1B 3AB2B 4DV7F 3GR0A 1UJ4A 1QM9A 1S5ZA 2BACA 2Z4PA 2VODA 2LP4A 2OSRA 3CCUS 4A4JA 2XO6A 5LT5A 2NREA 3HVTA 5AE2A 3J7Z5 2EPIA 1FXLA 3GSIA 2XY7A 1SIWB 2ZOGA 2IYIA 1RCOB 1RT4B 2W9CB 2BRKA 1VQ6S 4OYMA 2OMLA 3MUMP 4MFBA 3FUYA 3M2RB 1N36J 2EFPA 3Q8VA 1AW0A 3DRRA 4X4VA 1KOHA 2MJNA 5B0GA 4RNMA 4WFBQ 3NCPA 1T7PA 3T1HF 3W60A 2UXCJ 3KLGB 1UJ6A 4TYAA 1ZTWA 2CAJA 4RW6B 4YY3F 5IWAF 1BUXA 5KFJA 1QE1A 1H2UX 3HSJA 1HQEA 5C24B 2YWFA 4QU7A 3NS7B 1VQKS 2YH0A 2IY5B 2H48B 5HMYA 3R97A 3LUYA 3PW0A 4OIXA 3CJ8A 1EQ0A 3GMGA 4PRFA 1RT4A 2L9WA 1X0PA 2W9CA 3VTIA 2FQQB 3HDSA 3H4BA 4OZ2A 5KTQA 3EVOA 3BGOP 2KL8A 1HD0A 3T6JA 1VQ9S 2QV6A 1RZMA 3CJSA 4W98A 1VI7A 1XQIA 1HFEL 2CRLA 4Y00A 2UUAJ 4KHPJ 4XDCA 4RW6A 4HR2A 3ONQA 1KQSR 1VQPS 1U8SA 3X1LB 4LF4J 4YB7A 4LBHA 4ID5B 2J0WA 5C24A 3TX8A 3KJFB 4IQMA 3CCRS 5KFFA 3KWMA 1FHTA 2FJAB 2V69A 1APSA 1SXLA 1EX8A 1MROA 4JI8J 2Y1IA 1T05B 4DV3J 2CQHA 3SZ2A 5FIIA 2PD1A 1KOOA 3B4MA 5M2UA 1DFDA 2XLIA 3PKYA 3V4MA 4P73A 2NZ4A 4NASA 1Z2LA 2GQCA 4ECSA 2D7SA 3CJ2A 1YJRA 6AT1B 1RAGB 4WIIA 3VR1A 2VC1A 1V9OA 4ID5A 4PPZA 1QVGR 1WOSA 3IG1B 5KG7A 2B9XA 2VJVA 4IUFA 3CMES 3RRGA 3UI3A 5KG2A 4N7TA 4CYUA 3JAMY 1UWBB 3EUNA 2PN6A 2DXDA 4C8LA 1I5OB 4B9VA 4Z2XA 1CJVB 3MAAB 2K06A 2H65B 4LFBF 1HBUB 2XCPA 4X4PA 1U09A 5EWEA 1NPPA 4LRCA 1KQKA 1C1BA 2LEBA 4RWXA 1S4EA 2JRSA 2C2RA 2MZTA 2DPIA 2VKZG 4YDXA 5GADI 3NWRA 2FHKA 2KM8B 4Y28C 1GFWB 4EUVA 3N28A 3NGUA 3EDQB 4EZ9A 4DUZJ 4WK3A 4HTJA 3LWMA 3CC4S 4U7UK 5DGAA 1D3WA 4LSZB 1U1PA 2WCXA 4PR6A 2DNRA 1X5TA 3NEKA 4RBVA 1U6BA 3H40A 2HFZA 4QZVB 1WOOA 2WSEC 3MM9B 2LDYA 3KK1B 4XO0A 1CJVA 3MAAA 1AUDA 4BDPA 2E1CA 2YNGB 3HVAA 1BWEA 4FDFA 2RILA 4FF1A 3M9MB 1HBUA 5KFKA 4QIEA 2VJUA 2LDIA 4M5HA 1FI4A 4KSEB 3KLFA 1VIOA 3ADAC 3DHWC 2B7CB 1OS5A 2Y0SD 3KLEB 4ED5A 1TL3A 3OR2B 2JVOA 1T9UA 5K8PA 1HWLA 3MFHA 1U1NA 2CNLB 5SZTA 3BH7B 3VQSA 4CT9A 4Z7CA 2CQ4A 2DNZA 4QWAA 2CQCA 2HS4A 5AT1B 4KV8A 5DDRC 2JSXA 4B17A 2HFSA 3MM9A 3KK1A 3NRBA 1KVKA 4ZPAA 4IO9Q 4K0KJ 3CIZA 2DEJA 3GFZA 4NLVA 2HHWA 1Q8LA 3J7AN 4ZIVA 4LSLB 3R5JB 2CADA 2WRMA 1VYAA 4P2SA 2K3KA 5A8WB 2R42A 3KLEA 3HD2A 3H2UB 1R0AA 2Z2MA 2Q43A 2B6AA 2CPHA 3MMBB 4C2MA 4IG0A 3K89A 1KHVA 3QAUA 4YR2A 3HX9A 3CDUA 1WHWA 1D09B 3W66A 2ZZNA 2OEMA 2VD3A 3Q86A 3SQOP 4XDDA 2X1FA 3C14B 4CIOA 3SI8A 4LQ9A 3POTB 2CQDA 5F8IA 2VU5A 3W64A 1C0UB 1ZBTA 4HEA9 4RU9A 3MR7A 4ZDNA 2FB0A 4J9UE 1F5CA 1FD8A 2KXFA 1XNQJ 5L1LA 4LSLA 5E3PA 4RBUA 2YTCA 1IBMJ 4WYLA 5MLCV 5A8WA 4CM0A 2C2OB 3D9BA 1CJTB 3KLVA 4IFYB 1YI2S 3BH6B 3UN2A 1ICEB 5KFEA 2LYVA 2W9BB 4YHHF 4FKYA 1N5SA 1HNIB 2XZTB 3HF5A 1ZZNA 4K4UA 2DD8S 2QLBB 2HQ3A 1VRQC 4YR3A 1HNZF 5HJXA 3PJ9A 1QSYA 1Y7PA 2QMWA 4NLUA 1EQMA 3PYEA 2MQQA 1S0MA 5KG0A 1HWJA 4KYZA 3SV3A 2HAFA 3K2YA 1YRXA 2QSFA 3F41A 3L7PA 2DRAA 3MUVP 5HBMA 2L08A 1U6ZA 3W5XA 4A8WA 3W5YA 3OTOF 4PQAA 4DV5F 3J7YI 2A3JA 2HRUA 4A8KA 3ZZRA 5ETQA 4YUDA 1T8EA 2BQRA 4UTGA 2XC9A 1M5HA 1CJTA 3PEHA 3BGUA 2DK2A 1X5OA 3GQCA 1MWQA 3BBCA 4IFYA 4M94A 3OTDA 2W9BA 3IGNA 4QR2A 2PEHA 1ZAXA 4H4MA 1VLYA 3AOAA 1HNIA 2ZKTA 1VBXA 5JVHQ 1S6QB 2XYPB 1WC5A 3M6XA 2V68A 5CH7B 2LXFA 3H25A 3IFEA 2YKNA 3W1YC 1Q4RA 4ANDA 1HMVB 4RNOA 2BJEA 3S1TA 1L5UA 5AE1A 2XY6A 1FT8A 1H74A 3C2PA 4OLOA 4NZ7A 3TAPA 4HTIA 3H2LA 1REGX 2OD6A 2LU2A 4K4TA 3PW7A 3NGTA 1JLFB 1E6YB 1Q95G 1UTAA 5CCMA 2RT3A 3AA8A 8RUCA 1RT5A 2QYGA 3VV2B 2WVDA 1RBOB 1YJ9S 2LQJA 2G13A 1LWCB 4DSKA 2AQ4A 4YB1P 5KG6A 3KHGA 4DU8A 1S6QA 1WSVA 2MKKA 4L3NA 3T1YJ 3PW5A 4E2FB 5I3QA 4ETZA 3H5XA 3QJJA 2QLXA 2DR5A 1Z4UA 1HMVA 4LVNP 2IA6A 3OL8A 4B3SF 3VZHA 3FBFA 1UVMA 1HHQA 2M9KA 3O5TB 4DN0A 1O8BA 1YSJA 2DISA 3V4IB 1JLFA 1BE4A 1RTJB 1V6HA 2E1RA 1KNZA 5A0YB 2B5JB 1VIXA 5ETPA 2XSJB 4OI2A 2JL9A 4WXOA 2JEIA 2AGQA 3EX7B 1LXJA 2Y8WA 3FCWA 2VFTA 2BZ2A 2HHQA 3Q8PB 4ED8A 2M0GB 5DZ6A 1NSKL 1Q1KA 4DS4A 5IT9Y 4ZP7A 1XMQJ 5HMWA 4LVOP 2F7VA 4P7VA 1EETB 4NWBA 5EGYA 1JLGB 4RW7A 2MKJA 1KFDA 2V34A 4AD6A 4WZQA 3Q83A 3KLHA 3KUEA 2NR0A 1FDBA 2WB4A 1P27B 4KIAA 5D4OA 4LF7F 4PPDA 4PABA 3ZFVA 2JH3A 1QAYA 3E01B 2KZZA 1NPKA 3V4IA 1I6JA 1RTJA 4NCBA 4JI3J 2I6WA 2QGFB 1IQZA 4ZPVR 5A0YA 5ETNA 2ADBA 2OMOA 1Q86T 1A7GE 2XSJA 3OL7A 2G2YA 2MMYA 3M1VB 3GJTB 2JLFA 4LF8J 1N52B 5DQHA 4J9KA 2Q66A 2R7OA 2HIQA 1SC3B 2E5HA 1W2BR 1IR1A 4LMZA 1YIJS 5DS7A 2R8IA 3KG0A 1EETA 1JLGA 1A0OB 4Z7YA 4C11B 4KR0B 4NE9C 4ZA1A 4FYVB 1TVRB 4DV2J 1QSSA 3J7A1 1RI7A 3E01A 4BHQA 2HHVA 1N33J 1G3OA 5IXUA 3DDKA 1TELA 2A2DA 1RAAB 2O1PA 1YKWA 2HBQB 2HFVA 3FSIA 1Q0NA 5A2QY 3G96A 4ICLB 3M1VA 1LW2A 2HQDA 3GE9A 1S0NA 3KYLA 2VPXB 1AFIA 3UNGC 3H8YA 2BXJA 3FQLA 3D1QA 4L76A 4B9LA 3TJAA 1B70B 1HWIA 2L9DA 5E3RA 1HYSA 2HS3A 1JLQB 2DNPA 5DM6Q 2XZDB 4X4QA 1UP1A 4ECTA 1HBNB 5CA5A 1NK0A 2ILZA 2AF6A 1S7HA 4B9MA 5ITHA 2YKAA 1TVRA 3PW2A 2Z30B 4ECYA 2HHHF 3JTNA 2B0GA 3AHPA 4Y2IA 1DLOA 2E7WA 2YPZA 1U0SA 3I0RA 2A18A 3O2IA 3UD3P 1SVDA 2FIUA 4ICLA 3CCLS 1FK9A 4DSJA 1FFWB 3EMTA 1PAEX 2OSQA 2YKPA 4ITSA 1FXDA 4TY9A 3HKWA 3Q8QB 3DLHA 2JFDA 1JWWA 4CLYA 3I5CA 4QR1A 2OEJA 2XY5A 4DLEA 2QG9B 1M1HA 1W7WA 2Q6CA 1JLQA 3CB4A 2UVVA 1T0TV 3CJKB 1HBNA 1NH8A 1EB0A 3TP2A 3TI0A 2K8GA 4U96A 4NZ0A 2KB2A 2CPIA 1IBCB 3NP5A 2MLXA 3GCXP 1HA1A 3HLUA 4XPEA 3NS5A 1LFPA 3DRXA 4K7QA 1H6KX 2AYMA 4NEZA 5KFLA 2PMHA 3M32B 3PY8A 1VS3A 3BN7A 2BABA 3EGWB 3SV4A 2I8EA 2ZFHA 3OTEA 4IDKB 3KG4A 3M05A 5LJ3Y 1EIYB 1RAFB 1F1BB 2RKIB 3TWZA 4NA2A 1PC4A 3NGSA 1X8DA 3SMZA 2LVWA 2ACMA 2DEIA 1U24A 2EFNA 5C7PA 3CJKA 3J81U 2H54B 3QYYA 1SB6A 1H98A 2CPZA 2C2NA 2LFVA 1OSDA 3UD5A 3O1LA 1FNOA 5GAGU 4NXNJ 5L8RC 3IO1A 2ZOMA 1N0UA 4EMDA 1N5VA 1Y9OA 5LM7E 3M32A 3UW1A 1PJ5A 2F8EX 5BR8J 2DVIA 4HT7A 1YGYA 1LWEB 4RW4B 1YLXA 4QCLA 3CJ4A 1F3FA 2UXBF 3NAHA 3QZ8A 1C0TB 2F4VF 4G1PA 4I6WA 2RKIA 1URRA 2RHQB 2GVDB 2MKYA 2RDJA 4DZ6A 4KGMA 3BR8A 5KFTA 5KG3A 2PFDA 2BDPA 4LFCF 2I5JB 4C8KA 1ZTTA 3UR3C 2HVIA 1CC7A 4UW2A 3IRWP 2W24A 1NKEA 5RUBA 1TKDA 2JNJA 2FLPA 3LAMA 3PDNA 1SH2A 4J9RA 4QIGA 1Y11A 4AXJA 5KG4A 2EBGA 1B0PA 3WDOA 2VF3A 2C42A 1LWEA 4Y2CA 2ZH5A 4LRAA 1RT1B 1HW8A 5L39A 2MSSA 2HFNA 4HLBA 5F3TA 1G4CA 2E9ZA 2YNHB 4ED3A 1ZS6A 2J7UA 2DCUB 2I0XA 4OQJA 4JI0F 2GVDA 3R3TA 1EP4B 3CJ0A 1YRUA 3GIRA 1UCNA 2GA7A 3EE3A 3O6QA 3MM7A 4EZ6A 2CFXA 3ET6B 3LW5C 2YVSA 3KFWX 3D28A 3ILIA 2DITA 1GTHA 4WKYA 1BMQB 1Y10A 3DRPA 5IM0A 2HG4A 2CG4A 3LGHA 2VASA 5DG7A 1DJ0A 2ALZA 3PW4A 1QY7A 2R7XA 2RS8A 2GJ2A 1O0PA 5KT4A 1G6BA 1UZDA 2F8MA 1ZPVA 5B0DA 1UEKA 3CMAS 4YDDB 3EZUA 4CQ1A 2DTJA 2A1BA 5KFXA 3E8OA 4LF6J 3QZ7A 2H5EA 5I3UA 1RTDB 1RA6A 4F4AA 3E51A 1EP4A 5LXRA 3I0SB 3M8SA 1OYDA 1XEZA 1OMSA 3ET6A 2KXNB 3H2VE 3WC0A 3QMQA 4JV5J 1M0SA 1HI1A 3ZZPA 1NO8A 1NLKL 3VCDA 4YN3B 1EHWA 5BYRA 2ZVSA 1HNVB 3BDPA 1HL6A 4F3MA 4I6YA 1X4BA 3K8VA 1S59A 1RHUB 2KN4A 2C3MA 4DR1J 3TA1A 2Y3YA 4CTAB 3MTJA 2YX7A 2VFUA 1RWKB 2BJ1A 1RTDA 2CPYA 3CULA 3HULA 2YNFA 2BJDA 5CZXA 1RDRA 3I0SA 2H4WB 2CVEA 2NUUG 2FLLA 2VG7A 2FHMA 3MPYA 1RT7B 3CW2C 4ZCIA 3MOZA 1MSWD 5KFBA 2XMVA 2BX6A 1N36F 4PQUA 4JI6J 1NDCA 4N8OA 5LMUF 2WBRA 3KMSA 1FE0A 4JV0A 1VMBA 2M5YA 3TVYA 3HFKA 4QYRA 4CTAA 4PXEA 2JLGA 2UUTA 1UVLA 2CQPA 1JLEA 2HNYA 3GILA 2X1BA 4DBQA 1FRIA 4MKYA 2VG6B 4OX8A 4USUA 1I94J 4OJGA 3VAMA 4U95A 3DXSX 4X62F 4KC5A 2EXUA 5J2QB 3TJ8A 3MM6B 4TN2A 3U1MA 4GVBB 4DX6A 1YJUA 3EZOA 2B4UA 2G0JA 3CCZA 3FBEA 1ULRA 3VGVA 4IQXA 2QC3A 3G6VA 1C1CB 1VQMS 4N8NA 3PKMA 4TU7A 2UUAF 4DSLA 3IWXA 4KHPF 2Z56B 5HN0A 1CJKB 4AL6A 2B3TB 4K4XA 3MMCA 2ZEJA 4LF4F 2Z8QA 1ZOTA 1S1TB 2KI2A 5KT3A 3KUHA 5J2PB 3TX0A 1UVJA 4R5PB 4C98A 2FC8A 3WIVA 2CNKB 1E6VB 1LOUA 2RD5C 5K20B 1RAIB 3FRYA 5KFIA 2OH2A 2ZC3A 4ZVHA 3OXLA 2AU0A 3T19A 2HNZB 5CD4H 2QLWA 3CF5Q 4ZP9A 3DOKB 2IDLA 3UR0A 5J2QA 3MM6A 4C7QA 3CJ3A 3U1NA 3KJQB 4F36A 3BSAA 2LA6A 2GJFA 2QT7A 1U26A 2ASYA 2P9CA 4OYAA 1XR7A 2ROGA 4LF5F 3LQVA 2HMIB 3FC9A 2JOQA 1VBZA 4EO8A 5F8LA 1NH7A 5KFYA 3HHKA 5KT5A 1RABB 2E44A 3SXLA 4P2MA 1S1TA 2JC0A 2O01C 5J2PA 5K8MA 3I4PA 3RBDA 1W26A 1E6VA 4ZHRB 3FZBA 2UU9J 2CIMA 2PA3A 4LRBA 2CJXB 3DDNA 4DWIA 3NL0A 4OZ0A 2E9RX 4DF4A 1OIAA 2AKWB 4ENOA 4CO5A 3ZZTA 2HNZA 2XWYA 2RQKA 4NLQA 1NK4A 3DOKA 3R6GB 1PIEA 4RPFA 2C22A 1F0XA 3ENWA 3MPDA 3PIPQ 2DT9A 1ZA1B 3CMQA 1VCTA 4DCOB 1LW0B 4DCPB 1LEOA 3NBPA 1TL1A 2HMIA 4CO2A 3V6KA 1NM2A 3OFEA 1AZSA 2W2QP 1S9GA 2XB2D 3NOGA 5I4MA 4KO0A 2FUG9 3LP2B 2QFJA 4GKKJ 2RQCA 2HBRB 3C19A 1K0TA 3DKDA 4DUZF 3CNQP 2JWNA 2J7WA 4ZHRA 4MTPA 2OFGX 2ZNZA 3AD8C 3MR5A 5BJRA 1VGYA 5DDPC 3M9NB 1CBKA 4USMA 2RRNA 3LOUA 3PFEA 4L72B 4B9TA 2V9KA 3GYGA 3CCWA 1MMNA 1S12A 3SSSA 2C3UA 1XWLA 4GRSA 4FYWB 3FJ2A 3W8PA 4MIWA 1RT6B 1LW0A 5K5MA 4B3TF 2ZBRA 1UW4A 3M30B 1Y3KA 2BM1A 4W92B 3MPUB 2KFNA 3PYGA 5LXYA 2XYGB 2DRDA 4I2QB 4RNNA 3BZQA 3ENQA 2UV8G 2Y8YA 4FXWA 2ZKUA 4DX7A 2EW9A 1IXKA 4PG5A 4I4BA 3WX8A 4Y6IA 4QJVA 2OPPB 3BSOA 4PWDB 1FD2A 2HWHA 1U48A 2KXHA 4F67A 2BA9A 4RUBA 2VBXA 5LL6d 1GH8A 3N6LA 2XMTA 3W8GA 4RR5A 2AP6A 3KMQA 1BLUA 4ANCA 2E1AA 4WJBA 3KNGA 4ZLNA 4PXBA 2G9OA 4K0KF 1Y00A 1KSPA 3B82A 4OX9J 4TLQA 2IVMA 3LAKA 4DQPA 2NLWA 2G0CA 1FRJA 2W1BA 4QU6A 2E1MC 2R8HA 1RTHB 2X3DA 3K7RA 4DSFA 1UEVA 4DL0C 2UXDJ 5HMZA 1D8YA 1TR0A 2M3DA 2HQGA 4IG3B 4U8YA 3O8WA 4RO0A 5F8HA 3KHHA 2XLJA 4I2QA 3H4DA 1S79A 2XMAA 5H9EJ 4WFXA 1F5AA 3M9OB 3A3PB 3ZZOA 4PWDA 5JVGQ 3FCHA 1NU4A 1DQ9A 3OTBA 1N0VC 2V2ZA 3LALA 3C6UB 3DYAB 3T41A 3TO8A 1YJ7A 2KT5A 3QIDA 4ECVA 3W9IA 2AV5A 1YBUA 1PG5B 4LT6A 1XMOF 1TL7B 4KHMA 3N9UC 2MLZA 1UA1A 3R5BA 5I42B 2HSEB 2J5AA 1U1LA 1NDLA 1VBKA 4WCEQ 3DGPB 2ILYA 2KT2A 4DJBA 2BR0A 1AXQA 2JHEA 1XNQF 2CYYA 3DCAA 2HLUA 3N5FA 2CDQA 5C42A 3UD4P 4G65A 2NXNA 3ILLA 5IT9U 1NHUA 1U1MA 4Y65A 4UY8T 1IBKF 2I1RA 1HKAA 3HHEA 4I7FB 3ITHB 2ZD1B 4NA3A 3OQ2A 4USHA 7AT1B 4O3RA 1FRXA 4DV0J 2AHOB 4AE5A 3RB4A 4DR3F 1DQ8A 5KT6A 3R5GA 3DYAA 3VQTA 1RBLA 4DQIA 5E7OB 1ZYQA 1RAEB 2AEFA 1EKSA 1TL7A 3ZZYA 4D3HA 1GXUA 3A8IA 2AW0A 1R0CB 3DGPA 5B7WA 4OJHA 4DR4J 1VQ7S 3DHXA 3RR8A 2DNLA 2OPSA 2XMUA 3CE8A 2FHJD 3MAHA 3T1AA 3SDEA 1SJFA 2IRYA 5F8JA 1IWAA 4WKRA 1U25A 2ERRA 2YWGA 3GG1A 3JQMA 2VL1A 1H72C 4OYOA 3GONA 4I7FA 1KC8T 3FFIB 1H38A 1UL3A 4P10A 3HP6A 5ETMA 4DR5J 2HQCA 2RQMA 3BGFA 3SCIE 4B3RF 2BJ9A 4QYZJ 5HROA 3K8WA 4P52A 3JSYA 4NCGA 4B9NA 5T7LA 1PO6A 4OYWA 1S0VA 1B0TA 4WPAA 3N79A 5GAGI 2ZH8A 2A2CA 5KFSA 3QGGA 3QT8A 1RT3B 3A8KA 2DHSA 2KFZA 4LF9F 2OO4A 4C8ZA 2IJRA 1RUSA 4C3MA 1T03B 2X1AA 4G6VB 4OV6A 1F60B 1TU0B 3BYRA 3DM2B 4F2RA 2YY3A 1DAXA 3MCNA 2CDRB 3MPWA 2CG8A 4UOGA 4NLYA 3V6DB 5F3ZA 5EX0A 1MU2B 1TAQA 3AODA 3FFIA 3SEOA 2MGZA 1NNDA 3W2VB 4ZPDA 3D3BJ 2MKHA 3SFGA 2WSCC 1X4CA 4P74A 2GFFA 3BSNA 2OD4A 4WF9Q 2QL9B 3H42A 1HNXF 2JEGA 3RB3A 2APOA 4K4SA 1RAOA 3DC2A 2PT0A 2HK3A 4DZDA 4KPCA 1VQSA 1BGXT 3AXMA 1S1XA 2KVIA 1RT3A 4NYOA 1VR6A 3KJVB 3TAQA 3LGNA 5KG5A 1VJQA 3HSDA 3QGIA 4B9SA 4OX6A 2IVFB 1IKVB 2CPFA 4C8OA 4U67Q 3MR2A 5FLXY 4ZPCA 1TL5A 4TKTA 2MZRA 1RAJA 3V6DA 1LKZA 2R9LA 4GO7X 4X4SA 2RRBA 1S48A 1J5OA 4ERDA 3HFVA 2FGOA 3TEHB 4JBCA 3EICA 3FMBA 2E66A 2HPUA 1XMQF 4FNHA 3ZC4A 3D6MB 2RQ4A 4A8YA 2DR8A 2EEYA 2EFVA 1F2HA 3V81B 5DDQC 2ZBIA 2QTWA 2RDDA 1LFWA 1XTZA 1CPZA 3FRZA 3DRYA 1WC0A 2XS7A 1Y5LB 5HI7A 4LRFA 4DQQA 4TY8B 1U1QA 2PA8D 3KJVA 5C25B 3A3NB 3TUJC 3VAIA 2R2TA 1FJ7A 3DOMB 2GQQA 3KK2A 3IM9A 3GFXA 1RAHB 5DG8A 2XWXA 1NK7A 4MKAA 2Z57B 4JUZA 1FJGJ 3TARA 3BF4A 4LF8F 2ZNYA 3GIIA 7FD1A 3CCJS 1JQGA 2JFKA 4KB7A 3M6WA 4A48A 5D78A 1HNWF 1DTQB 2IC3A 3G6ES 4FVCA 4GKJF 2HWIA 2N3LA 3BDEA 4CLLA 2KG0A 1ZM3A 2V6AA 3BM7A 2HBZB 1UVNA 2IJNA 1SC1B 1AB8A 3LP0A 3MGJA 5D6GA 4DPYA 1PAUB 5T41A 4F4XA 2G0IA 3GR1A 1RISA 4X4NA 1YRTA 4IR9A 4TY8A 2HGNA 3GV8B 3SSRA 3NLCA 3ZTQA 2FJWA 2W4DA 5C25A 3ZZUA 3TZXA 5L9XA 3OVAA 1FKAF 3HHNB 4JI1F 4KAIA 1G1XA 4OJ3A 1FWPA 1IKWA 4CT8A 2E5IA 4A8SA 3IXQA 5HVGA 2R7SA 3U1LA 2RF2A 2VHGA 3QRRA 2W4PA 2FPHX 1WKJA 4K59A 2AZ3A 2ABYA 2N7CA 3KOAA 3C66A 3LH2S 3CJQA 2CNOB 4F50A 3NGKA 3D1HA 4O3NA 4O3SA 2QZ8A 3BKUA 3D67A 3K5PA 1HQ2A 4FF3A 1KLMA 4YY3J 3A3OB 4F3QA 3G82B 1FRLA 4WE1A 4M5IA 2R8JA 4CH1A 4URGA 1X9MA 2BKNA 4DFKA 3HD1A 2CZ9A 5CQGA 5EN1A 3GIJA 3JSBA 3CWJA 4HHJA 4G3IA 2GMLA 3BO3A 5KFOA 3ETMA 3TRGA 4WP3A 3US5A 5F8GA 1UVKA 1H7XA 2WW4A 4Y2MA 2B9EA 2BANB 2GCFA 1L3VA 1T95A 3TUZC 2R7QA 1XNRJ 4P7TA 1IJEB 2UUWA 1RA7A 2WBMA 3FSXA 2Y1LB 2UUCJ 3NGRA 1JMTA 4MT1A 1JXEA 4QIVA 4OI1A 3G82A 1U8WA 1XN9A 2UVRA 3Q8YA 2YX4A 4I1TA 1CJUA 5L1JA 3P96A 2C1EB 2MQLA 3MECB 4KTQA 2DGQA 3RUBL 3T5LA 4F4WA 1OY8A 1S1WB 2AT1B 2VG5B 3GJQB 1NZ8A 1WHVA 1JLCA 1JKHB 1KD1T 4WTYA 3CCVS 3DGVA 1NJXA 4PG7A 2PEBA 3P45B 4ECWA 2QIFA 1HQUB 4C0BA 3UVJA 3Q8SB 1SJQA 4Q44A 3PRBA 3PJWA 2BANA 2L9NA 5KFCA 1M5OC 1MLAA 2XQCA 4Q43A 4NPOA 1VK8A 3EJMA 2V8GA 4M5GA 1YTYA 3I55S 4JP8A 5SUHA 2UV8A 1TK5A 1UKUA 1RU1A 4NXNF 2WSFC 4QQBA 2KJWA 4N47A 4DV1F 3QRPA 4B3OB 2GIFA 3MECA 2GMHA 1FEEA 2ZHAA 4U9RA 5GVQA 4PUOA 3H7HB 4U8VA 2WOMA 5D0GA 2ZUGA 2YKOA 5M2RA 1JKHA 3ISNC 1VQLS 3ICLA 1FA0A 4LSNB 2C2DA 1NRKA 2W7AA 4LFBJ 1ZPWX 2AWZA 1HQUA 1NKBA 4DR2F 2DR6A 4BWMA 2MLYA 1AFJA 5CYJA 2FJBB 2J9EA 5ETRA 3X3UA 2QA1A 4Q0BA 2AJFE 2XEXA 2B8QA 2N7YA 3W2WB 4NMLA 3PX0A 2YQ3A 5IOLA 5B0CA 3AOBA 5LSOA 4HKQA 2VA3A 1WG1A 3TR5A 4F0KA 3HCXA 4P75A 3D0IE 3B6BA 4MFBB 4WZMA 1MW7A 3FEYB 3TNVA 2ASLA 1R31A 4U7UD 3THVA 1HIYA 3VAJA 3RRKA 2HNDA 2HHXA 4W4MA 3QWUA 4ZVQB 2WONB 4RUCA 5LMNF 2WVCA 3Q22A 4LSNA 4ZPBA 5ADZA 2HHPA 2OFHX 4KT0C 2V2VA 1TMMA 4CZCA 1HQEB 4F0MA 1UFWA 5DM7Q 3VGSA 8AT1B 4RJVA 3AH6A 3H5YA 2ZE2B 5E3AA 3W2WA 3R8YA 1VQ8S 1PKUA 4ZVPB 5KFRA 2D69A 3PG9A 3BYPA 4ZCKA 3HVRA 1X0FA 4H4KC 1S4FA 2SXLA 2V8PA 4A8MP 4Y34A 1XJWB 1C4CA 2NQPA 5DO2A 3GB0A 1T9VA 2CJYB 1S76D 2DNGA 1HD1A 4LRDA 4NI2B 3I32A 2HHTA 1OYEA 1SJ1A 2WONA 3PYDA 4OHZA 3OUYA 2DBBA 1S77D 1T9XA 1S6OA 3P8BB 4TXSA 3FSYA 4DL4A 2CQ1A 4DV4J 1Q78A 1KWMA 2QJ3A 1FVSA 3R5DA 4ZJLA 5F0UA 2MZ1A 3U7JA 2ZE2A 1U1RA 2L41A 2CNNB 2RSQA 4DQSA 3P5TL 5D4PA 3PYFA 1MROB 1WHYA 3UQSA 4ANEA 4QIWD 5IZHA 1VC5A 3N6MA 3BKFA 3P6YC 4ZVOB 2FD2A 4QW9A 4RW9B 2MEWA 3K58A 4NI2A 3G8SA 2QRRA 3QIPB 3OL9A 4RL1A 2MZSA 1RB0A 1WDTA 1NK9A 2DHHA 2FYXA 3BGLA 4DR1F 4Z37A 1WTBA 4OL8A 2B43A 3I96A 3NOCA 2HHUA
chains in the Genus database with same CATH topology
1B0PA 3RW6A 3DLEB 3WDOA 4FF4A 2JX2A 2XS2A 2VV5A 1R3NA 4DEZA 5CYQA 2C42A 1LWEA 4Y2CA 3V6HA 2ZH5A 3KNAA 2AX0A 1WEXA 2V5HG 3Q2SC 2IBKA 1RT1B 1S9EA 5GAEI 4NLWA 1HPZB 1HW8A 4NYPA 4IH7A 1NKCA 3CD0A 4FN5A 3MF5A 5L39A 2MSSA 4OLPA 2HFNA 3K5MA 4HLBA 1J5EF 2R7VA 5F3TA 4ZMMA 4DV0F 3DOMA 2E9ZA 3IWNC 2YNHB 4ED3A 3R1HA 2EBEA 3HHLD 3DI6B 3E2EA 2J7UA 1VRTB 1U7LA 1TZ0A 4X84A 1KHWA 2DCUB 2I0XA 2P9EA 4OQJA 1SL1A 3M2UA 4JI0F 3I4HX 1FDDA 4F25A 4UUWA 4RKUC 3PR4A 4DX8H 4CH0S 2GV1A 3R3TA 4UUXA 1EP4B 3CJ0A 1I1GA 4ELVA 2NXUA 2RH3A 4ES3A 1YRUA 1UVIA 4AXIA 4KKOA 4Y2KA 5LSLA 2GA7A 2EG1A 3VAGA 1JLAA 4HDGA 5FDLB 1U1KA 1XC9A 4A46A 1K73T 3J7YU 2POKA 1TQLA 3PHEA 3O6QA 3MM7A 4RW9A 2RU3A 4EZ6A 1U45A 2OJ3A 1C1BB 1K1SA 2CFXA 2EKYA 4Q7AA 4X4OA 2ZH1A 2ACYA 1DTQA 1OSCA 3LO3A 3BREA 3QIPA 1E6YA 2NPFA 3M4XA 2WTFA 1C4AA 4DR4F 3C3LA 3LW5C 2YVSA 3KFWX 5IQQA 1JLBA 2B9WA 1VQOS 2CQ0A 3D28A 1RKIA 2JDJA 2DITA 1GTHA 2MB0B 4WKYA 1RYRA 1TK8A 1SL2A 1PILA 2ASJA 1HHTP 4IKAA 3U27A 2EVZA 3DNCA 2F9DA 2MXYA 3DRPA 5IM0A 2HG4A 2FVRA 2CG4A 3B78A 1D9DA 1TFWA 2VASA 5DG7A 1DJ0A 1NK8A 2I2YA 2FC9A 2ALZA 3PW4A 5DRKA 1QY7A 2KJVA 2R7XA 2RS8A 3DLEA 2GJ2A 1LWCA 4B3MF 1O0PA 3QO9B 1X4EA 4DN9A 4F02A 4PXCA 5B0FA 5KT4A 3CVKA 1G6BA 2F8MA 2VFSA 1ZPVA 1X4AA 5B0DA 3Q24A 3CMAS 3OFHA 4YDDB 3PO4A 2HVHA 3EZUA 4N76A 2P6TA 4CQ1A 2DTJA 3PR5B 4IOCQ 4ED6A 2A1BA 1P8GA 1Q53A 2BQUA 2DCLA 1VRUB 4JOUA 1X5PA 5KFXA 3E8OA 2RIJA 3QZ7A 1FE4A 2H5EA 3HKZD 5E33A 4A8XA 3A1YG 4X65F 3RAMA 6FDRA 5I3UA 2O5DA 1N34F 4FXVA 4AQYF 4NLRA 3V2UC 1RTDB 2J9DE 5C42B 1RA6A 2CJQA 3CC7S 3G8TA 3E51A 3TW0A 2HYIB 2V9WA 1EP4A 5LXRA 2CJKA 2EFGA 3NNAA 3PO5A 3I0SB 4CNZA 2IFXA 2DNHA 1C2PA 1IKXA 1UAWA 4ED7A 4OMFG 3M8SA 1R89A 2KRBA 5FDLA 5D77A 4E8UA 1IBLF 1HW9A 2CJ9A 4H54A 4URQU 1XEZA 5KFNA 2YX1A 3IAM9 2QO3A 1P6TA 3LPYA 2J6UA 2VKRA 3KLFB 4ECRA 4DL3A 3C6TB 2KXNB 5CXTA 2R7TA 3VZIA 3CD5A 3HT3A 3H2VE 1ZAVA 3MUTP 1JJ4A 3WC0A 3QMQA 3R5CA 4J9QA 5KFUA 5E3QA 3OV7A 1RK8A 1NJZA 4NYZA 4HH1A 4J9MA 5DETA 1M0SA 2B5JA 1X7VA 1HI1A 3ZZPA 1NO8A 1TL3B 3GYNA 2D3ZA 2Y1RI 2XNRA 2HFOA 3VCDA 1SV5B 2CPEA 4I56A 4J5OA 4IOAQ 2W7OA 4DFPA 4PKDB 1S10A 1GXTA 1HI8A 5BYRA 4AL5A 1R8CA 3G71S 3O3LA 2IYGA 2ZVSA 4I6AA 1HNVB 3BDPA 1X4FA 2KFYA 3AY0A 1HL6A 4BBYA 4F3MA 4I6YA 1DQAA 2AGPA 1X4BA 3CCSS 3K8VA 1S49A 3N4WA 1HBMB 4X2BA 1WNEA 1BQMA 1D9AA 3CDWA 1OO0B 2KN4A 3TVZA 2C3MA 3PJXA 1VRUA 3TA1A 2UVWA 1A9NB 4CTAB 3MTJA 4RUHA 4KV8B 3CCMS 2YX7A 4FPRA 4UY85 1OQ3A 2OPSB 3N0VA 3I31A 3FEXB 1IBMF 1LWFB 3RAQA 2OAUA 3JTOA 2VFUA 4DG1B 5GAHI 2OPRB 3IAS9 1KR4A 1RTDA 2GIQA 3SDEB 1YJNS 2CPYA 3CULA 4C97A 2BE2A 2FVCA 2M4MA 1QAIA 4UOCA 2YNFA 3DMJA 3ETOA 1WI6A 3OVBA 4X64F 2ZH2A 2BJDA 1M1KT 3OTCA 5CZXA 1RDRA 3I0SA 5BYQA 3A8EA 2GHPA 2IMOA 2CVEA 2NUUG 2C28A 2FLLA 5HLFA 2WK4A 1YBAA 2VG7A 2F1FA 1JJHA 4DFMA 1VQ5S 2FHMA 4UQGA 1S97A 3D54A 3MPYA 2R2SA 3HJFA 1RT7B 4OI6A 3DU6A 5E2QA 2Y1JA 4IYQA 1FKOB 3C6TA 4A8FA 4ZCIA 3MOZA 3BO2A 1JXLA 1MSWD 1FDNA 3P3DA 5K8OA 2LECA 5KFDA 5KFBA 2M70A 1GQEA 2XMVA 3O44A 5HROB 3OSPA 5D4NA 4NCGB 3IS9A 2EK6A 3ZZZA 1S0OA 1N36F 2YKQA 3VAFA 4PQUA 2PC6A 4I67A 3CDEA 1DBDA 5T7LB 3T9NA 1R27B 1R0AB 2LQ5A 2HWTA 2MQNA 1X9WA 1HWKA 2AYBA 4N8OA 3GWCA 2ZBCA 3OR1B 2XGPA 4F8RA 3MD3A 2MZQA 5HQ8A 2QSWA 5DDOC 3LGMA 2B6AB 2IM3A 4DPOA 4IG0B 5LMUF 2GX8A 4PXDA 2WBRA 3KMSA 4EO6A 2J0XA 2OTJS 1FDAA 1VK3A 3UCGA 1FE0A 4IRKA 1Y5NB 2EK1A 5CYMB 5DQIA 3M6UA 4WK1A 2CPDA 1CLFA 2UVUA 4JV0A 2NSCA 2JJ4D 1VMBA 2RE1A 2M5YA 3AAWB 3TVYA 3ZZ0A 4F4YA 3EGZA 3HFKA 4OV1A 4QYRA 2NS1B 3PIOQ 2C3YA 2XMKA 4CTAA 4PXEA 4M5DB 2JLGA 4NLDA 3SFUA 2UUTA 2XZWA 5KFZA 2CQPA 1S1WA 4C11A 1UVLA 1LWFA 4TLRA 1JLEA 4R0EA 2HNYA 2M7SA 2VG5A 4DG1A 3BN4A 5U47A 3G4SS 2OPRA 3GILA 1S1VA 5GADU 2X1BA 4DBQA 1KONA 2IVYA 2DIVA 1WF1A 1SKWA 2DNNA 5L1KA 2PFFB 1FRIA 4MKYA 2VG6B 4OX8A 3D0HE 4I68A 4BCAA 2WW8A 3DLJA 4OJGA 3VAMA 2LEAA 2GGPB 4FNIA 1W25A 3MEGB 3UDLA 4M1KA 4J9OA 1KTQA 1NJWA 2BW2A 3I6PA 3DXSX 2KRRA 3NS6A 2B4OA 4KC5A 4EU0A 4X62F 4TQSA 1IJFB 1VC0A 5J2QB 2PIIA 4KBIA 1R43A 3MM6B 4TN2A 1VQYA 3U1MA 2MGZB 3IBWA 4ED2A 3MEKA 1SKRA 1YJUA 1FKOA 4ZCMA 2MPUA 2DRBA 2B4UA 2DNOA 4AUKA 2O66A 2EWHA 3BB5A 4A47A 3CCZA 3GV7B 1IR0A 2ZHBA 4FBUA 4G1QA 1ULRA 3S7RA 4IO1A 1CVJA 4GKKF 4N77A 1ZH5A 4JYAF 5KFPA 3CPWR 5A6WA 4IQXA 1DRZA 3RB6A 2R8KA 3KK3B 2DHAA 3G6VA 1RP5A 4YEAA 2NUHA 1C1CB 3VF0B 4H4OB 4YFUA 1TKZB 4NLSA 3HVTB 2K2PA 2PSZA 1VQMS 1QAJA 4N8NA 1FJEB 3PKMA 3OR1A 1D9FA 1SJ3P 4Q2LA 4TU7A 2UUAF 4DSLA 2EC0A 2DGUA 3IWXA 4B08A 4E98A 3MR6A 4KHPF 5HN0A 4AL6A 2MYFA 3MDFA 1S1XB 5J2NB 2ROEA 3CDBA 3I5AA 2XO7A 3BS9A 5CYMA 2B3TB 1DHMA 4K4XA 3MMCA 2FLNA 4J9PA 2Z8QA 4ZCLA 1ZOTA 4LF4F 2DNMA 1S1TB 4ZS6A 2KI2A 5K9FA 4B3OA 3J81Y 3RTVA