1PGZA

Crystal structure of up1 complexed with d(ttagggttag(6-mi)g); a human telomeric repeat containing 6-methyl-8-(2-deoxy-beta-ribofuranosyl)isoxanthopteridine (6-mi)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
183
structure length
183
Chain Sequence
KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-based incorporation of 6-methyl-8-(2-deoxy-beta-ribofuranosyl)isoxanthopteridine into the human telomeric repeat DNA as a probe for UP1 binding and destabilization of G-tetrad structures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*T*TP*AP*GP*GP*GP*TP*TP*AP*GP*(6MI)P*G)-3'
total genus 48
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2003-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1pgzA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1pgzA02
3DXBA 2LEAA 5LXRA 2KM8B 5IFMA 4ERDA 3UD4P 3DLLQ 3VAGA 1VQ7S 2U1AA 2OJ3A 4U67Q 2RQCA 2DIVA 2I38A 3P3DA 2YTCA 2E5IA 2CPJA 4P6QA 5GAEU 2YH1A 1VQ9S 2UP1A 2DO0A 1B7FA 1WEYA 2XS7A 1WHWA 2DGOA 2HYIB 3FEYB 1SJ4P 2N3OA 2NLWA 2HGNA 3CMAS 4WFAQ 2YH0A 5LXYA 1A7GE 2AD9A 2U2FA 3CC4S 2LKZA 2OTJS 2JWNA 1IQTA 1VQLS 2X1AA 2DK2A 3P5TL 3R27A 5D77A 1FJEB 1D9AA 2QEXS 2MJUA 4WFBQ 3I56S 1U1RA 1VQ6S 1WF2A 1X4EA 4YUDA 3EGNA 3UCUP 1URNA 4TU8A 1X4GA 4M5DB 5CYJA 1JJ4A 2CQ4A 2ERRA 2SXLA 2FPHX 3LPYA 2MYFA 4FXWA 3MXHP 3VF0B 5DDQC 2MKIA 1DHMA 2F9JA 3MOJB 3CCQS 2MMYA 2DHAA 3HI9A 1PO6A 3S6EA 5HO4A 1QVGR 2RT3A 2KM8C 3V4MA 2JRSA 2M9KA 2B0GA 2DNZA 1OPIA 5GAHU 2CQ0A 1X0FA 1WEXA 3G8SA 1R8PA 5H1SV 1U1LA 4QPTA 1U1MA 1X5PA 3G8TA 1WI8A 2NZ4A 2KG1A 2KRRA 1HD1A 2DIUA 1O0PA 2I2YA 3H2VE 1WHXA 3PIPQ 3HHNB 1X5SA 1A9NB 1YIJS 2XNRA 3VAJA 3MUTP 2ADCA 2AYMA 3BO4A 2M2BA 2E5HA 3SMZA 2GO9A 5LJ3Y 2MPUA 1RK8A 2DGWA 2MY7A 1KQSR 3SXLA 2KT5A 2MSSA 3OW2R 2F3JA 3NNAA 2HGMA 1WF0A 2G1DA 1NJIT 5LJ5Y 1XN9A 5DDRC 2OTLS 4YOEA 5JVGQ 1ZZFA 2LA4A 1U6BA 2MZSA 1OO0B 2XS2A 3BS9A 2MJNA 3CCSS 2Q79A 2RS2A 2LYVA 2RNEA 1JMTA 4QU7A 3MUMP 2CPDA 4OZ1A 5GAGU 1UW4A 3SDEA 2E44A 2JVRA 2MQMA 2DNQA 1M5VC 5CA5A 3VAKA 4J5OA 2LEBA 1YTYA 5JVHQ 2F9DA 5IM0B 2DNMA 2RQ4A 2LXIA 1H6KX 3IWNC 2FC8A 4TU7A 1U2FA 2JVOA 4LMZA 3ZZYA 3MUVP 3CC7S 2D9OA 1YJWS 2OSRA 3VAMA 2HVZA 2KI2A 1X4CA 3PIOQ 3R1HA 1JJ2R 1QVFR 2MB0B 3J7ZT 3B4DA 1WF1A 1HA1A 2MKKA 4BS2A 4WIIA 1CVJA 4WKRA 2MZQA 1X4HA 2MY8A 1D8ZA 1WG5A 2PE8A 4PKDB 3ULHA 3CPWR 2KFYA 3IRWP 2EVZA 1KD1T 1VC0A 1H2UX 4C4WA 2MKSA 3CCUS 4V19X 2YWKA 3BO3A 4IUFA 2LMIA 1U1OA 4WFNQ 2MQNA 5DM7Q 1U1QA 2K8GA 3VAFA 2CQCA 4OZ0A 2HZCA 1VC6A 1M5OC 4QU6A 2CQ1A 1VBZA 2DO4A 5ITHA 3H2UB 3CMES 1KC8T 1WEZA 3MI7X 5D78A 3MURP 1WWHA 2CPIA 2KXHA 2O3DA 4CQ1A 1FHTA 3MD3A 2RU3A 4A8XA 1VQ8S 3VALA 3CUNA 1X5TA 1VQNS 2L41A 2CPHA 2ZJRQ 1YITS 4IOCQ 2CPZA 3S8SA 1ZH5A 2MGZB 2AYEA 2N82B 2M4MA 3MDFA 2DGSA 2D9PA 1WI6A 1WHVA 1Q82T 1S79A 2MXYA 2MQQA 2LA6A 2N7CA 3CXCR 3NMRA 1DRZA 1N52B 1VBXA 3U1MA 5IQQA 2MKCA 3G71S 1U1PA 4WCEQ 2CQ2A 3G9CA 5EN1A 2RVJA 1FO1A 3P6YC 2J0QD 3NS6A 3SDEB 3JB9k 2KRBA 3UE2A 2CJKA 2DNKA 3NNHA 1X4FA 3VAIA 1G2EA 1X4DA 1M5PC 1RKJA 1M5KC 2CQBA 2CQDA 2CPXA 5BJRA 2AYBA 2A3JA 2KXNB 5GMKa 3CCJS 2K3KA 3RW6A 2DGQA 2CPYA 1HD0A 3THTA 1YI2S 5DDOC 3TO8A 1WG1A 2KHCA 3LQVA 1VQPS 4IOAQ 1UFWA 2MKHA 5LSLA 2J0SD 2KVIA 2FY1A 1FJ7A 2MZJA 3THPA 1N88A 1NU4A 1KOOA 2X1FA 2J8AA 5GVQA 2G4BA 2DNRA 2BOPA 1VQ4S 1FT8A 2XNQA 2LXUA 2CPFA 2YKAA 2ZJQQ 4QQBA 2KG0A 2VODA 2CQIA 2MQPA 4UY8T 5DETA 2KH9A 3NS5A 2E5GA 2M8DB 1K73T 1K8AT 5MLCV 1M90T 4RU2A 1ZZNA 3BEGB 2RRAA 1L3KA 1HL6A 2L9WA 2DH8A 3BO2A 3G6ES 3CULA 4ZKAA 2QFJA 2J76E 1S72S 3L3CA 5HL7Q 1SJQA 1Q7YT 1P1TA 2JX2A 2WBRA 2DNYA 4Y0FA 1YJNS 1U1NA 1WELA 3CTRA 4TU9A 2CQ3A 3TYTA 1VQMS 1OIAA 2CPEA 2FC9A 3ZZZA 2FHOB 2RRBA 2CQHA 2MHNA 2DHGA 4CH1A 3B4MA 2AYGA 4PR6A 1VC5A 1P27B 2DH7A 1VQKS 2RS8A 4LJMA 3UCGA 2EK1A 4Y00A 1SJRA 1SXLA 2MQOA 3P49B 1FXLA 2N3LA 3UD3P 4CIOA 1VQ5S 4Z2XA 3CCES 2XS5A 1KOHA 2L08A 2DGXA 2ZJPQ 1U1KA 5DM6Q 4YB1P 2DNGA 3CCRS 4W90B 2MZTA 5IM0A 3R1LA 2M88A 4TLQA 2MZ1A 1H2VZ 3I55S 4PRFA 2DNNA 3UCZP 2LQ5A 1R8HA 2X1GA 4EGLA 4F26A 4UQTA 1X5OA 2VONA 1Q81T 2CQPA 4FXVA 1N8RT 2QA4S 4LIRA 4C7QA 2BZ2A 1NO8A 1Q86T 2VOPA 3FEXB 2PEHA 5FJ4A 3G96A 2DH9A 1X4AA 2DB1A 2EK6A 2M70A 2DGVA 2M7SA 4W92B 3RW7A 2LCWA 1JJHA 3CCMS 3D2WA 2MKJA 2RUGA 2DNPA 3NNCA 1AUDA 2DNLA 4IO9Q 3CD6S 2M0GB 1DZ5A 1WHYA 3S7RA 2KXFA 3US5A 1FJCA 1VQOS 2D3OR 3CC2S 4F25A 2V94A 1YJ9S 2MQLA 2OIHA 2DITA 1UAWA 1WTBA 1UP1A 3MD1A 1M1KT 4F02A 2M8HA 2DHXA 1VBYA 1SJFA 2XB2D 5CXTA 2DGUA 2DHSA 3Q2SC 2VOOA 3EX7B 1SJ3P 5DDPC 1U6FA 2M52A 1W2BR 1K9MT 4ED5A 2MSTA 3TP2A 2E5JA 2KN4A 2DNOA 3N9UC 2DISA 5LSOA 3U1LA 1DBDA 2OSQA 2MGZA 2ADBA 2MZRA 1H2TZ 1QM9A 2G0CA 3Q2TC 2DNHA 2HGLA 3VAHA 2GHPA 3CCLS 3K0JA 5GADU 1YWXA 2CQGA 1WG4A 2DGTA 2LECA 2X1BA 3S01A 1FNXH 4CH0S 3EGZA 3CCVS 1YHQS 3G4SS 2KYXA 2XSFA 1F9FA 3CF5Q 4C0OC 4WF9Q 2KU7A 1PGZA 1X4BA 1N54B 3J7YU 1OWXA 1BY9A 3UWTA
chains in the Genus database with same CATH superfamily
4PABA 1MSWD 5KG7A 2KM8B 4FS1A 1HBMB 3OHAA 2R7VA 3T6JA 3MCSA 3DC2A 4OYPA 2U1AA 5CD4A 5I3QA 2XBPA 4M5IA 5IT0A 3AJ1A 4DUTA 2LQ8A 1RTJA 3KK1A 4JI4F 5IWAJ 4JV5J 1CJKA 3IR7B 2HBYB 1FERA 2ALYB 3DI6A 1R89A 1RAAB 2YTCA 4P6QA 5GAEU 1VQ9S 2UP1A 2C2OB 3P96A 1B7FA 5JUMA 1VQSA 2OELA 5F8HA 2FDNA 3A8KA 1SKSA 1NJXA 2J8SA 3CDAA 3FEYB 3R5BA 2W24A 1RAIB 1ZYQA 2YXLA 3UFCX 4B08A 4F4YA 2DVIA 4JI5J 4KGVB 4WFAQ 4C2MA 5L1IA 5LXYA 2ZDOA 4MKBA 3M8PB 4ZJOA 4ZVGA 2MLZA 5EDWA 3RTVA 3D4JA 3FMWA 2DT9A 4QWEA 4M5MA 2HZVA 2OTJS 4RO0A 3WIUA 1S1TB 1UETA 3CJ0A 1ZM4A 3MPUB 4MIWA 4XDDA 1S77D 2C1EB 4QCLA 4LSZB 5F8MA 1OPZA 2DK2A 2M5YA 1M5SA 2QL9B 2HNDB 1RWWB 1FKPA 2K7KA 3AAWB 3QMQA 4NYOA 3JSMB 3ZNUA 2MJUA 3V6JA 1D9FA 2QEXS 3FRYA 3LGNA 5D15A 3UD5A 1VQ6S 2GMHA 1BUXA 2FUG9 3BH7B 1JKHB 3NXZA 1NSQA 2IYIA 1TL3A 3M2UA 4OX9F 3TRGA 3Q89A 1URNA 2HFUA 4TU8A 2DXFA 2C2DA 2GQCA 3MPVA 4PQUB 5BR8F 5DQHA 1YLXA 1R3NA 1SI9A 3FSXA 4ICLA 1U0SA 1URRA 4P73A 3W63A 1VK3A 1JLAB 4JI6F 3ZFVA 1DHMA 4FYWB 2MKIA 4F4KA 2UXBF 3M30B 1RI7A 3SSRA 4K8RA 3BKUA 4ECZA 5LM7E 4KGXB 2ILYA 2NS1B 2LP4A 3SQGA 4OI1A 3HI9A 4DR1F 2D3ZA 2HS0A 5B0CA 1QVGR 3DYAA 3C3LA 2B3TB 2RT3A 3NCPA 4ZPCA 1WC6A 2OPRB 3V4MA 3G8QA 5DGAA 2M9KA 2DNZA 3ISND 3HFZB 3AOBA 3SBMA 3WX4A 1WEXA 4ANEA 5KFOA 4NZ7A 2ZOFA 1R8PA 3G8SA 4BDPA 1WUUA 2HHUA 2NXEA 4QPTA 3EXCX 3Q0AA 5HMWA 1Q5YA 2OMLA 4TYAA 3UR0A 4KH0B 2WVCA 4N56A 1EKSA 3CJQA 2D69A 2VC1A 2KG1A 3NAHA 3QNWB 4ID5A 4B9TA 1O0PA 4ZDNA 4NI2A 5J2QB 1S99A 2ZBCA 3PEHA 4CTAB 3HHNB 2VIHA 3BYRA 4JI1J 1SPBP 4RWXA 4LSNB 3KLHA 2M3DA 2PC6A 3N6LA 4ZP7A 2R2TA 3SV4A 1HARA 4UUWA 5ETLA 3HP6A 4ECSA 3CVKA 5DS7A 2ZE2A 5B0FA 2LQJA 3SMZA 3FBFA 3OBIA 1L5UA 3SI8A 4OJ3A 2PD1A 2GO9A 1UPPA 4P10A 3BGRB 2DGWA 3HZGA 3NCRA 1O8BA 4CO4A 3DI6B 1LFPA 2MSSA 3IS9B 2B6AA 2DR5A 1YZ6A 2LLZA 5KT7A 4UW2A 3FC9A 2XMUA 5E3RA 3TX0A 4WZMA 2BRKA 1SUQA 3CT9A 5BYQA 3GPAA 4J9KA 4NLQA 2P9GA 4XO0A 1HNWF 3R2DJ 5JVGQ 2E9RX 2LA4A 1NSKL 1U6BA 2XWXA 5FD1A 2R7SA 1OO0B 3G6YA 1ZA2B 2V8HA 3N28A 2MJNA 1GX6A 4N5SA 4QIVA 1YZ7A 3BBFA 4C8KA 4QU7A 4X2BA 3LANA 4W4MA 3BF4A 2MEWA 1S0MA 2MQMA 3MECB 3C6UA 2Q6CA 1XK8A 2V6AA 4N8NA 2NQPA 5FLXY 5C25B 4J5OA 4WJBA 2YPZA 1HQEA 3KK2B 4OJ1A 2LEBA 1YTYA 1KFSA 2F9DA 4WBFA 1CJUB 2HLTA 5ETRA 4NMXA 3GJSB 4L76A 5DLFA 2RMLA 3NGTA 2O66A 1GQEA 4MFBA 5DJBA 5AE1A 4RNNA 1U2FA 3IMQJ 3LW5C 3TAQA 2W7AA 5H9FK 4R8UA 2C3OA 1DAXA 1FTRA 2EC2A 4EBDA 2IRXA 3R5AA 1D0EA 2OSRA 3VAMA 4GKKF 2YWWA 4M5GA 1HNXJ 3IR6B 3OR1A 2RH3A 4OZ3A 2BBEA 4YY3J 4USWA 2IYGA 2AMCB 4CCHA 2XLJA 2VFVA 3EGVA 2MKKA 2XYHB 4WIIA 4WKRA 3ET6B 3FQKA 5GAGI 1XNQJ 2K1RA 1TP7A 2VPXB 3CO0P 2B6AB 5D0HA 3K8WA 3KFWX 4GVBB 1KEKA 1D8ZA 1WG5A 2PE8A 4C0BA 3MR2A 3W1YC 2CZ4A 1VRUB 4CRJA 4ANDA 3EWGA 3LTOA 3TNVA 1GFWB 4FNHA 3GSIA 4F7VA 2KFYA 1VC0A 1KD1T 4C4WA 5J2PA 2ZH5A 2JNJA 4V19X 4OZJA 4B3SJ 1MN7A 1YGYA 4K0KF 3LWLA 1UJ4A 4I2PA 1S7IA 5D4LA 1SL2A 1H74A 4OJGA 3VQTA 1KLMA 3FBEA 2WK4A 4C98A 4ZN3A 2W8LA 1RADB 4ZVQB 3ZZPA 3LF0A 5I42A 4QW9A 4K5RA 2OPSB 4C97A 2RDJA 4ZOSA 1RAGB 2DD8S 5KFGA 1U1QA 5HN0A 2KB2A 2CQCA 2YWGA 4OZ0A 2XTJP 1LWEB 1AB8A 1R43A 4PG4A 2EFVA 4QU6A 3KLGB 2DO4A 4O3SA 1JB0C 2VQEJ 2HHTA 3CE8A 2VC0A 4DFPA 3F73A 3K5OA 1O5JA 3OTOJ 4DUZF 3CMES 2DHHA 1CLFA 3OFFA 5D78A 3HJVA 2CPIA 1SC3B 3L7OA 5CZVA 3SFUA 1KLMB 2XHWA 3RBXA 3NP5A 4PZVA 1TL7B 2G2YA 3BDPA 4WP3A 4JV1A 2KL8A 1REVA 3AXMA 4JP8A 1H7WA 3CUNA 3VALA 2F4VF 5C24A 4ZCMA 3BPSP 5GAHI 3KG0A 3RBDA 1FFWB 3EVMA 5A6WA 2GQ2A 4L3KA 4IOCQ 2PFDA 1OY9A 1BD6A 3E8OA 3F44A 3UVJA 2VHGA 1E6VA 2FZCB 3RYLA 3RBEA 5KFSA 5AJ3J 2XCPA 1IM4A 2CPZA 3SCJE 3HPOA 5HJYA 2DY9A 2AYEA 3BZQA 4HHHA 3SQGB 4MAKA 4DFKA 4ZVTB 4GMKA 4U7UK 4DR6J 4X4VA 3BREA 4KKOB 2UUTA 2F40A 2KYZA 5F8GA 1WI6A 5JXSA 2E5LJ 1RWMB 1WHVA 3VVTA 4RLEA 1Z2LA 2MXYA 1TZ0A 3ICLA 3PFEA 1V5IB 4FXDA 1SJ1A 1SH3A 1GXTA 3G2XA 3DLJA 1VRQC 2LA6A 1CJTB 2O5DA 2VF3A 4R25A 4ZJQA 2N7CA 1DRZA 4DX5A 4AXIA 1VISA 4YB7A 3LP0A 4N7TA 5EUHA 5AXKA 2NREA 3U1MA 3I0SA 4JOUA 4YDDB 1UJ5A 3TJ9A 6AT1B 4A8OA 4WCEQ 2KO1A 3T3FA 2Y1JA 1SC1B 2YY3A 3AA8A 1RLCL 2VKRA 1FO1A 3PYDA 3QFWA 4AE5A 1Y9OA 4X4OA 3OUYB 2R8KA 4PAAA 2E1RA 3GG0A 2HFSA 4P2XA 1S1TA 4Q7AA 3SDEB 4OV1A 3TW0A 5A6PA 3KLFB 1WC3A 2X51A 3P8BB 4LF7F 2DNKA 2YWFA 1HQ2A 1CULB 3IBCB 3M2VB 4CO1A 4DPWA 5E3QA 4BC7A 2JEJA 4YMEA 5U47A 1CC7A 2YNIA 3CD0A 2CQDA 4R0EA 2YQ0A 4CM2A 2Z30B 1UWAA 3JQMA 4I2PB 4PWDB 3OT9A 2WOMB 4CLWA 1H38A 1SB6A 2N4DA 2JZ5A 3MMAA 4A4JA 4YQWA 3IXQA 4M1KA 4JV0A 4NLTA 4ELTA 5IT9U 2CJAA 1G3OA 2VD3A 1HW9A 3OTBA 2C3MA 4CLPA 1JLBB 4LF9J 3BQ0A 3TA0A 4J9PA 4KHMA 2K3KA 2DGQA 2ASLA 1RYSA 1FFSB 3M7VA 4WZQA 1VJWA 3W9IA 4DEZA 4X84A 4LFAJ 4J9LA 3N4WA 1T11A 3H20A 1WG1A 4YEAA 3CJKB 3QZ8A 1UFWA 1EJ7L 1U4BA 1NK8A 4KQZA 2UVWA 1XMOF 2CJYB 1R0AA 4NCGB 2BRLA 1N88A 3FKBA 3TZXA 4DCJB 2H65B 4FBTA 1FXLA 3PDNA 4DQQA 1HMVA 4DL2A 1S57A 4ECTA 1SKWA 2VH7A 1HFEL 2V4RA 3LP1B 4K4UA 2IHR1 3PYFA 3RRGA 4C9DA 2DNRA 4WYWA 1NH8A 1HBUB 1FT8A 1DQAA 1SL0A 4DQRA 1JNZB 4K4SA 4OV6A 1AZSB 5GADI 3ADAC 2LVWA 3CJ8A 3FZBA 3IGVA 4A8WA 5KG0A 1RT6A 1LXNA 1V6HA 2VODA 1VLYA 2FVPA 1FWPA 1S6OA 2NUHA 2V9KA 1FX4A 2E5GA 1K8AT 2KTQA 4XK8C 3GV5B 3TUZC 2GHVC 4RU2A 2V69A 3BEGB 1L3KA 3AB4B 4PXCA 3MEDB 3D0IE 1FK9B 2DH8A 2GCFA 1WOPA 4FP9A 3G6ES 1U8WA 2CG4A 1ZTTA 2QL5B 3HKWA 2QFJA 3DNCA 1S1XA 4DUYJ 1S72S 4URSA 3M05A 1NK0A 5DQIA 3HSDA 4KV8B 1H72C 4F3QA 2WBRA 4O23A 4Y0FA 3RB3A 1YJNS 3CWJA 5DO2A 2RF2B 2NSCA 3BGLA 2YKNA 4WTYA 4RJVA 4RKUC 3GV8B 4TU9A 2ZH2A 2CQ3A 5DG7A 2ALZA 4F50A 1NK5A 1ICEB 3W3SA 3TOQA 1WKJA 1OIAA 1FRXA 3TANA 1GT8A 2FHJD 4DSLA 4DV6J 2FC9A 2XMJA 3DM2B 4Y65A 3SYZA 3AOAA 4OHYA 1UVLA 4OHZA 2HNZB 1Y5IB 1D3WA 1VIOA 3R5CA 1TKXB 1R8CA 1AUSL 2FHOB 3GFYA 3TZZA 1LW0A 2XMKA 4G3IA 4CH1A 3T5KA 2UUAF 1NH7A 4RL1A 1RACB 2HS3A 2FJAB 1VC5A 2OPPB 3TA1A 2R8JA 1NKBA 1YSJA 1VRTB 5IZHA 3OUYA 4U7CA 4GO7X 2EK1A 2CJBA 1SJRA 5T7LA 4Y00A 3TX8A 3P49B 2ZWOA 3DRSB 4HACB 1FKOA 2HMIB 3HHLB 4PUOB 2A0FB 4LBIA 3IRXB 1W2IA 3UO0A 1JXEA 1RU1A 4Z2XA 4ZVPB 3A3OB 1J5OA 1VQ5S 4JI2J 3I5BA 1Y11A 4WK1A 3W5ZA 2A18A 2QYCA 1BGXT 2DGXA 4LF5F 4NYZA 1FRLA 1T05B 4ZVSB 2ZJPQ 1U1KA 4DR4J 4AXJA 2QT7A 4C3MA 3CCRS 4W90B 4QYZJ 2JH3A 5B0GA 4GRSA 2IVYA 2HHXA 5E0OA 4YB6A 3DGPA 2R7UA 2M88A 4K4YA 1TL5A 3EUNA 3TVZA 2BABA 4PRFA 2CNOB 2UXCJ 5CHCB 3PRVA 2BE7D 2A2DA 3AD9C 4JI6J 3EJMA 3RZAA 4ZVUB 1LKZA 2CVIA 5D0GA 3HF5A 5F9NA 1X5OA 2V34A 3GYNA 2XO7A 4X64J 3U1NA 1Q81T 4I0WA 2VONA 5A8KB 1QAIA 2EBEA 3DGPB 3IAM9 3PRDA 3KLEA 1XMOJ 4DZDA 5K8OA 2E7XA 3FFIB 2J0WA 4NLDA 1NXIA 1W7WA 2ZNZA 2BZ2A 1NO8A 1N5VA 2RILA 3C6UB 5KT2A 1B0PA 2PEHA 4KY3A 4M5LA 4M5DA 3GIIA 3W2VB 3D6FB 3NEKA 3HMJG 3MFIA 2XULA 1DY3A 4K50A 4USKA 2DB1A 1SH0A 2EK6A 2FHJA 1EB0A 2QSWA 1FD8A 3PXGa 4CLSA 2RHQB 5E3AA 2NSBA 3B54A 5L1KA 1C2PA 3GCWP 4FF1A 4F8RA 4HR2A 5KTQA 2RUGA 3IR5B 3DU5A 2GJ2A 3MAHA 2UU9F 4NLSA 4IO9Q 5EWFA 4WYLA 2JSXA 2IJFA 1ZPVA 3MAAA 1KP6A 3OXLA 2B43A 4C6AA 1LW0B 4YS2A 2VPZB 5F3ZA 4KB7A 4P74A 5I3UB 3HT3A 5D8HB 3SZ2A 1HYSB 1FJCA 3HHLC 2F8EX 2V0NA 2HNZA 4NWBA 1S6QA 2R7OA 5F41A 2DITA 3PO5A 1AROP 1UAWA 1XTZA 3GFHA 2WVFA 1FDAA 3WIVA 4HKQA 4JV5F 2DHXA 4C8LA 3EDRB 2I0XA 4DR3F 4KH1B 2DHSA 4CLLA 1XR6A 2ZD1A 1TK8A 3AD7C 4IRCA 5I3UA 1VDHA 2V67A 3GZ7A 1U25A 4IQXA 2FY8A 5C5JA 3OR2A 5DDPC 1S6PA 4DL7A 1U6FA 3X1LB 2ZC3A 3GMGA 4ES2A 3GIMA 1W2BR 5G4DA 2QMXA 4DF8A 2MSTA 2DKOB 3EZUA 8ATCB 1HPZB 1RT5A 3PNIA 3M9OB 4DV0J 2KN4A 3LH2S 2B56A 3N9UC 3V81A 1RAEB 3JTNA 4WFXA 2BUNA 1RA7A 3H42A 4O4RA 1ZBTA 1RT3A 1PYTA 4KHPJ 3GCXP 2PMHA 3W2VA 2FZKB 3PYGA 2MGZA 2ADBA 2OPRA 2Z57B 2BW7A 4AL5A 1S9EB 4EO8A 4I69A 4UQGA 2G0CA 1H2TZ 4MFBB 1GTEA 4L6V3 2HGLA 3OSNA 2LDYA 4ZPBA 1R8AA 3JYTB 2R9LA 4P72A 2FJWA 3QIPB 2IBKA 3J80U 4H4OA 3BGFA 1FXRA 1XMQF 5B0DA 3RB6A 1M0SA 4DJBA 2HPUA 2P2CB 4CH0S 4ZITA 3GONA 3TEGA 3G4SS 3O44A 1XNRJ 4IH7A 3CF5Q 2OKQA 2AJFE 2R4FA 3G82A 2ZH6A 3UDVA 2N4CA 3Q22A 2AGOA 1X4BA 1X8DA 2W9BB 3CC2S 4LBPA 1OQ3A 2H5IB 3OQ2A 4KFBB 4OHVA 1S9FA 2KFNA 5IFMA 4ED7A 3DRSA 3DLGA 3VAGA 2OJ3A 2BE2B 3ISZA 2UUWA 1B70B 3A13A 3HT0A 2VG5B 3HSJA 3AY0A 3D6MB 3L4BC 3VGVA 3JSMA 4RBUA 4HYKA 2DIVA 3DOKA 3IS9A 1BQNB 3HXMA 1PG5B 3P3DA 2JEGA 4AUKA 1DJ0A 1WDDA 4QR2A 5ETNA 4CT9A 2W4CA 2DO0A 1WEYA 2XS7A 1WHWA 2CRLA 1A0OB 4TQRA 5F8NA 3K5LA 4K4ZA 5D0EA 4C11A 3W64A 4HEA9 1L3UA 2NLWA 4USIA 2YNFA 5A76A 3U7JA 3CMAS 2F4VJ 4KHRA 2BANB 4Q5VA 4IR1A 2ZBRA 2VB6A 1A7GE 4OYOA 2ZM6J 3D67A 2U2FA 1OMSA 2K06A 1IBLF 2BM1A 3M8YA 1CG2A 1VQLS 4J90A 4CYUA 1BWEA 5KOWA 2D3UA 1UTAA 5D77A 4OJHA 4ZLJA 2DEJA 4KSEB 5CZXA 3IG1A 5H9EK 4AL7A 1F0XA 2LQ9A 4F36A 5ADZA 3KJVB 3I56S 1U1RA 4RBVA 2Q6BA 1P9QC 1S4EA 3ZTPA 4X4QA 3HLUA 4J9MA 1T03A 4C8ZA 4DFMA 5ETOA 1VMBA 4F3OA 2IAJB 2BJ7A 1RYRA 1UVIA 4IFYB 4M5DB 3MMCA 3ZZ0A 5CYJA 3UDCA 4AQYF 1FF2A 2CQ4A 2RF2A 1K1SA 4KRWA 4KBIA 1RT7A 2SXLA 2FPHX 3KLIA 1RABB 2MYFA 4TLRA 1U24A 5HANA 4BHQA 4Z37A 6FDRA 5D4NA 4JYAJ 1G1XA 4Q44A 3FQLA 1FNMA 1R0BG 1WDTA 2Q43A 2ZZTA 3C14A 5IV4A 3BQ1A 5KFAA 4ECQA 2IY5B 1QJHA 2F9JA 3SSSA 5L9NA 1RBLA 3FBBA 2AEFA 3DLKB 2DHAA 1EP4A 3TVKA 4OI3A 2Z2LA 4DV7J 4KTQA 4PQUA 3DFEA 2V4QA 3D54A 4LR8A 3S6EA 1W25A 5HO4A 1TAUA 5ETKA 4K7QA 5HI7A 2A1BA 5J2NB 3UQSA 3BGOP 2KM8C 5CYQB 1N5YA 4IRKA 2LXFA 2B0GA 4YR0A 1OPIA 3MMBB 1IWAA 3RRKA 2CADA 4UOCA 1T95A 3QRRA 5KFUA 4NXMJ 2K2PA 4XTTA 1U1LA 4DL4A 2MDAA 4HACA 1U1MA 2HMIA 1X5PA 2OGUA 1SQGA 1TFWA 3B6BA 1M5HA 2NZ4A 3K8VA 3W9JA 1WNEA 1N4LA 5G0RB 1IR1A 1WHXA 3MTKA 4NRUA 3PIPQ 1YJRA 3I6PA 2R8HA 2D1CA 1NJZA 2P5VA 3G6VA 3VAJA 1R8BA 3MUTP 1NCLA 2M2BA 1QD1A 1TMMA 2HIQA 5HBMA 4ZHRB 2W8KA 4L72B 2B4PA 2GAGC 2MPUA 1RK8A 2QLFB 3QO9A 4LSLB 2MY7A 4NLXA 4WXWA 3RR7A 2BYCA 4H4MA 4O0IA 4K0KJ 5B09A 3OW2R 3M6WA 2F3JA 2HLUA 2HGMA 4RW6B 1JQGA 1WF0A 3NG8A 2BR0A 1XN9A 5HROB 3M6XA 2AF6A 4RU9A 3I87A 3VZIA 4DV1J 2BQUA 3I31A 4NXNJ 1S1VA 2RDDA 4ZP6A 4CLZA 1NHUA 2JOQA 2OP5A 3W9HA 2NR0A 3AD8C 2I9SA 2Z2MA 3T19A 3TJAA 3KYLA 1GXUA 2NXCA 2VPYB 3BS9A 3CCSS 2RS2A 1O51A 2LYVA 1N5YB 1JMTA 1S49A 4K2JA 1RWKB 1GMWA 4MKAA 3T6BA 2CPDA 1HQUB 4OZ1A 3W62A 3SDEA 3UPFA 1CEZA 3CGIA 2DNQA 4DR1J 1M5VC 3MM8A 3H4BA 1RBAA 3CJSA 5IC4B 3V6HA 4HI1A 3VAKA 1IKYA 5F0UA 3LALA 3OV7A 2CKWA 2RAQA 4DR4F 3DCAA 1LWCA 1IJFB 5KFTA 5C42A 3DRXA 1KQKA 3NWGA 5LMNJ 3BKFA 3CC7S 3GE9A 3MUVP 1S9EA 1BE4A 1H3DA 2D9OA 2OFGX 4DN9A 1YJWS 1HR0F 3CD5A 2KI2A 3RB0A 1X4CA 1FX2A 2FHKA 1J5OB 2DPJA 3LUYA 4EO6A 1REVB 2BEFA 1QVFR 2IRUA 3KK2A 2XC9A 1WF1A 4OYXA 4J91A 1YVFA 7FDRA 1HA1A 5DG9A 2XGPA 3RAXA 4Q8FA 1Z4UA 2R3VA 2KHDA 1CVJA 3DDKA 2P9CA 2BE9B 3RJMB 2A6MA 3KOAA 3HHKA 2MZQA 1X4HA 2BDPA 2MHEA 2MY8A 4LF6J 3I32A 4ID8A 4PKDB 3DKDA 1LV5A 1KONA 5KFDA 3A12A 1CPZA 4ED1A 1Y00A 3BN4A 3PR4A 2VZ9A 3IA0A 2BANA 3LA0A 1CJVB 1PCAA 1TKXA 4UOHA 4LRAA 4R0JA 2CIMA 3I4HX 3POTB 2QL7B 2YWKA 3D0GE 1I94J 2B5JA 4QWBA 4WTOB 2LMIA 3PACA 2WVEA 4OMFG 4LRDA 3TR5A 4YHHJ 1S6PB 4NLWA 1T7PA 4JV2A 5KG2A 4X4SA 1WD6A 3FSIA 5B08A 1S6UA 2C2KB 4H4MB 2RHSB 1S5ZA 2J0XA 1QTMA 1HNZF 2HZCA 4AYBD 1IKXA 3TUJC 4ZHRA 3I5CA 1S6QB 2CQ1A 2KZZA 2UZAA 4K59A 5ETQA 1FRIA 3S1TA 2P8IA 3AXKA 3H2UB 1CULA 1WC4A 5ITHA 1IBMF 1KC8T 3HZEA 3MI7X 1WKLA 2XZWA 4DV5J 3MTJA 4FYDA 3OVBA 2LEPA 3W2WB 1UA0A 2G2ZA 5HMXA 5BR8J 4B3OB 1FHTA 1MG7A 3PW7A 4USJC 2RU3A 1VQ8S 1JLCA 2RKIA 2R7TA 3MHYA 4LF5J 3PG9A 4EEYA 3AA9A 5K14B 1VQNS 2CPHA 5HQ8A 2YKMB 1ZM9A 4DV4J 3PY8A 2E66A 2HQGA 1D09B 4WK3A 1MMLA 3S8SA 2Z58B 5C42B 3RU0A 4YB5A 2MGZB 2R2RA 1Q4RA 1UEVA 1KQGB 2FHMA 2M4MA 2ZEJA 2G9OA 1U0HB 2BOAA 4O0NA 3QIDA 3Q8YA 4CZCA 1V5VA 1UPMB 2FJDB 1RBOB 2IVMA 4QIEA 5C25A 2VBZA 3KK3B 5A8KA 4M95A 2RQKA 2C2ZB 4Q2LA 3N01A 3HCXA 3CMQA 4F04B 2Y0BB 3NMAA 3CXCR 8AT1B 3OLBA 2XSJA 1FCAA 1SKUB 2YKMA 3QZ7A 2ADCA 2E1CA 1T02A 2MKCA 1YJ7A 3MEGB 3PRBA 4B9SA 4LF1A 3G71S 2CQ2A 2W2NP 2WOMA 4KGZB 3P6YC 2AJQA 1WORA 3ZTRA 1KKHA 4E0DA 2HQ3A 2HFNA 2H4YB 1LXJA 3PYEA 1N34J 1XERA 3HHEA 4L3NA 3UE2A 2OPPA 3HSZA 4ZN1A 4ZLLA 4N8OA 2OHDA 4M63A 2IM0A 2BJ8A 3SQOP 4NLYA 2H5JB 1KHVA 2Z2YB 4KE5A 3VZHA 4OLOA 5A0YB 1V9OA 1M5KC 1AFIA 3DRYA 3D28A 3MEEB 4WFYA 3ILOA 5E2QA 2NUUG 1MMNA 4H4KA 4L75A 4N76A 1B64A 3KJNB 2J6SA 2ATCB 3DDNA 4M5KA 2F5GA 4Y2IA 4KGMA 4LSNA 4ZVOB 3IFEA 5BJRA 6FD1A 4FBUA 3GJRB 1RWPB 2AYBA 3MOZA 4XIUA 8RUCA 1FVQA 1CSJA 3R2CJ 2KXNB 4AD6A 4LIWA 5GMKa 4DV6F 2W2OP 4IR9A 1RHRB 3EGWB 4ZPAA 3AJDA 4Q45A 3M9NB 3BGRA 2XG8A 1Q95G 3THTA 2VICA 2W9CA 2BW2A 4OI2A 4O44B 2XY6A 1VQPS 1KNZA 3MEKA 5LSLA 2MKHA 1Q8IA 5A8RB 1VHIA 4Y2AA 1KWMA 3OL6A 1SKRA 1CS4A 1HBOA 1G4CA 4FZVA 1PYOB 1L3VA 3T1YJ 3MAQA 2WONA 2L3MA 4RR5A 2HFOA 3C2PA 5J2NA 4CTAA 2A2CA 4UZCA 1KOOA 4WXOA 5J1EB 3E01A 1RSCA 1WTFA 3FNNA 2JEIA 2XMAA 1Q16B 2MLYA 1DFDA 2BOPA 4U95A 1HW8A 1PJ6A 4Y34A 1RJJA 3BBBA 2VBXA 1F5BA 5J1PA 4RUBA 5K5MA 5LL6d 1PJ7A 3TZYA 2O01C 3KK1B 2XY5A 1SV5B 1UW9A 2GNKA 2YKAA 3DRPA 3CCTA 3JSRA 4OX8A 4OZLA 4QQBA 2ZJQQ 5E5NA 1DLOA 4UY8T 2J6TA 1N5SA 4NCAA 4ZK7M 2KH9A 2XMMA 3KHHA 4LRFA 2XQCA 2MKYA 2GC8A 2HFVA 4P2FA 2ABYA 1K73T 2M8DB 3MF5A 1VOMA 2HSEB 4DV3J 4CDIA 4ECXA 1KVJA 3EM1A 1T03B 2CDQA 2E7WA 4LF7J 3PHEA 3OL8A 3CULA 1QUVA 1AZSA 1NAQA 1SVDA 1ZM2A 1NHKL 2J76E 2PMWA 2ROGA 1JLAA 1PJ5A 3IG1B 1LWEA 3L3CA 1TFYA 2W2PP 1P1TA 2KJVA 2BJEA 3QBCA 3W65A 1R31A 2CA9A 2DNYA 2V68A 3ILIA 5HVHA 1NKCA 3J7AN 2J9DA 1IKVA 5CCLA 1G7CB 1I5OB 3PW5A 3CTRA 4HDHA 2QC3A 3TYTA 2C42A 3GLJA 1RKIA 2ACYA 3AODA 4NMLA 2CAJA 2J9CA 1S97A 1CS4B 1HBOB 5LSRA 1QUPA 3HKZD 4J9NA 3POTA 3F56A 4ZIWA 2GHWA 4WKYA 1EKRA 4AT1B 3GYXB 2ZBIA 1RTHB 2EEYA 4YR2A 2HQFA 1RT4B 1PC4A 2HWHA 2GZOA 2QLBB 4RW6A 1JLFA 4ECYA 3MGJA 2DHGA 1HI0P 3C66A 4QJVA 4LF4F 3VCDA 5KFBA 2YKNB 4QWAA 4ETZA 1VLOA 4ZCIA 1X9SA 4QYZK 2XI2A 4J9RA 1YBUA 1HHTP 1YDLA 3UCGA 4N47A 1SXLA 3KHRA 4P9SA 2MQOA 4ILRA 3T1AA 1R7IA 2Z4PA 3MR6A 3AHPA 4A8YA 5M2UA 4B9UA 2HVIA 2XM3A 4PWDA 1FRMA 4DX6A 2VDIA 4CO3A 2YQ3A 4EMDA 3OXGA 2VJVA 3V4IA 1SIWB 2HBRB 4RW8B 3GQCA 3MEDA 4JI8F 2E9ZA 3TI0A 1TK5A 2L08A 4NCBA 4ZVHA 3QWUA 2WZ1A 2HVHA 1TL1B 2ASJA 4HTJA 4PWUA 2HK3A 2OPQA 4K4WA 3DOLA 2YKQA 5DM6Q 4YB1P 3Q8QB 4DR5J 1JXVA 2DNGA 1DLOB 1G6BA 2DXEA 4DR3J 2ILZA 4O3OA 4URGA 4GC7A 3GFZA 2PI4A 4J37A 1FXDA 3FVYA 5A8WB 2NXNA 2JEFA 1T9TA 3FGVA 5CYMA 4IKAA 1H2VZ 2P9EA 1FVSA 1O6XA 3IGNA 3PKYA 2E5LF 3GJTB 1YBAA 2CZVC 3UCZP 1HWIA 1KRPA 3GU0A 2AZ3A 2LQ5A 4ER8A 2R7WA 4FPRA 1ZTWA 1R6VA 4EGLA 4UQTA 1V3RA 4MK7A 1TU0B 3W8PA 3KG4A 3NBPB 3NCQA 5GMDA 3J80Y 1B3TA 4O4GB 1SV5A 1DARA 1YRUA 2DCLA 2XMTA 3DRPB 3JTOA 4OQJA 3KK3A 4ZVFA 4FXVA 1H73A 1CQNA 2AEMA 1H98A 2CJQA 3KUHA 2R7XA 4KKOA 1FFGB 1BQMB 3MCNA 1RQ0A 3BH6B 4L73A 1C1CB 1Q86T 1ZETA 1RT7B 1TELA 2CWXA 3FEXB 3Q86A 2VA2A 2QA2A 4B3MF 2VOPA 5FJ4A 3H59A 3IC1A 3C8YA 3DHXA 3PEJA 1YJVA 3ISNC 5KT5A 2QN6B 1JLFB 1L3SA 4W92B 2UUAJ 4N41A 4GVLA 3RW7A 1ZS6A 1JJHA 2AJ4A 2HURA 5ETTA 3CCMS 2C2EA 2DBBA 4LRBA 4LF6F 4CLYA 3QT6A 3SV3A 4DOZA 1NB2A 2DNPA 1YJUA 1JLEB 3NNCA 4B3RJ 1WSVA 1PYSB 3KUGA 1AUDA 2DEIA 4TN2A 1FKAF 4RW9A 3CD6S 4K4XA 1S59A 2OPSA 3GTYX 1EAYC 2VJUA 2YPYA 3S7RA 5CCMA 4PXDA 3KLFA 3UNGC 1ELOA 4HH1A 1VQOS 1QTNB 2DTJA 2BJ3A 3I0RB 1YJ9S 4WIQA 5FLXU 1WTBA 3MD1A 1NK7A 4OYMA 1IKXB 3PJWA 4PYAA 1M1KT 1IM6A 1PAUB 1HBMA 1V3ZA 1RAJA 5D4PA 5KFEA 3GR0A 2QV6A 2B4VA 3EXYA 1UFLA 2I1RA 4A8FA 1BHNA 3Q2SC 1KTVA 3KLVA 4K5SA 2RJZA 5ETPA 4MYTA 1EX8A 3IWXA 3EX7B 1SJ3P 1I51B 1TVRB 2LU2A 2W25A 3HVTA 4WP9A 3D1HA 5B0EA 4USMA 3QJLA 1FDNA 3BDEA 3GJQB 4G1PA 3R6GB 4KIAA 4KV8A 3L95X 1IR2A 4LT6A 4OYAA 4Y2CA 1X9MA 1CJVA 3BV8A 3DOMA 5LSOA 4U8YA 4O4GA 1P8GA 1J27A 4IG0B 4NLVA 1QSLA 4O3RA 2ZOMA 3UI3A 4QIWD 2Y9HA 3PW0A 5DZ7A 3ELHA 2DNHA 2FLOA 2V8PA 3DLKA 4CI0B 4RBTA 5CD4H 4MT1A 3CCLS 1DTTA 3FCHA 2G13A 1YWXA 2HAFA 1LQ9A 5BYRA 3HDSA 4C8MA 1M1GA 2E1AA 4JYAF 1W26A 4DUYF 4ECWA 1F9FA 3DXSX 3PCOB 4LQ3A 2ZOGA 2B9EA 1RDRA 2F63A 5DG8A 3KNAA 4M8LA 4Y2MA 4CP5A 1KS2A 2DCUB 1U2RA 3DXBA 2LEAA 5BYSA 5L1JA 4PG5A 4ERDA 1GAOA 2CNNB 4NLPA 2COLA 3UD4P 2W2MP 4C11B 2WSCC 3Q83A 3DLHA 1RTZA 3I9ZA 5A8RA 4OYWA 3MCMA 3QGIA 4F67A 4BBYA 4QIFA 4X4UA 4Q43A 2I8EA 3JTPA 2RQCA 2ZH1A 4XPEA 4NXMF 1S7HA 2RQMA 3BSOA 1QAYA 2E5IA 1MROA 1NHVA 5DZ6A 2YH1A 1TKZA 3LWMA 3ZTQA 1HI1A 2YNHB 3M8RA 2DGOA 5L1LA 1YJTA 3CSKA 1I94F 3LOUA 4JB8B 3V2UC 1N32F 1RB0A 1S1WA 1YRXA 1SJ4P 2KVQE 2N3OA 2CVEA 3MM9B 4I7FB 5LT5A 2HGNA 1D9DA 2YH0A 4LF8J 1HYSA 1ROFA 4X62F 1F60B 2HFZA 2QGFB 2ASDA 4C0HA 3NLCA 2W9BA 2VL1A 2CFXA 2V8DA 1TKZB 2AW0A 2AD9A 3CC4S 2LKZA 2AU0A 3DOKB 4EUVA 2JWNA 1GTHA 1V3SA 4JI2F 2WSFC 3T5LA 1IQTA 2BQRA 3DU6A 4DXLA 2XYGB 1QE1A 3KMSA 2E7VA 2RDIA 5MAOA 1D9AA 5D4OA 3K58A 5HBMB 1WC5A 2ACMA 4J9OA 1NB7A 4WFBQ 1ZAWA 4D3GA 1X31C 1IBMJ 1X4EA 2ZH9A 4YUDA 3EGNA 3RGIA 3UCUP 3HVAA 3OTDA 1XMBA 1X4GA 2J9DE 4I6WA 3EZ5A 5K8MA 1T8EA 2IA6A 4DV1F 1HWJA 4R8UB 2J5AA 1SC6A 1PILA 2BJ9A 3LPYA 4FXWA 1IN0A 1FEEA 4V1Ak 3VQSA 3VF0B 5AE3A 2FVRA 5DDQC 4F2SA 2V8GA 2AJ2A 3CDWA 4ZLPA 9RUBA 2EW9A 3FDSA 2C2NA 4OIXA 1LWFA 1XWLA 1HPZA 1RT5B 3MOJB 3CCQS 3C46A 3QJPA 3H4DA 2V4JA 3V6DB 4NRTA 4RUCA 1F9HA 3CNQP 3W2WA 2AX0A 3GIKA 4DDFA 1U45A 1HQUA 1SIZA 2EC0A 2GX8A 2JRSA 4NA2A 1MMDA 3I4PA 5GAHU 2CQ0A 4UTGA 3R7SB 2WONB 1X0FA 2R8GA 4LRCA 1LW2A 4PCQA 1KQFB 2RU9A 3BYPA 4PWWA 2XCAA 3NGRA 1U02A 3W61A 3QT8A 4I64A 1I1GA 1WI8A 2HS4A 5KG1A 5HROA 1IQZA 2GA7A 2QLJB 3LP2B 2ZDPA 4FKXA 3KLIB 5HK4A 1I3OB 2UUBJ 2IRYA 3ETOA 1IXKA 4NA3A 1HD1A 4HVZA 3K59A 2I2YA 1H0HB 3H2VE 4LFBF 2NPFA 2GVZA 3SSQA 5T41A 2IFXA 1X5SA 1A9NB 1HHSA 5KFIA 3ZTSA 1HIYA 2VG7B 5A2QY 2F7VA 1Y4ZB 1TV6B 1S10A 2QIFA 1ZAVA 1GXLA 2AYMA 2XEXA 2V5HG 4WE1B 5GMEA 3KJFB 1BC6A 3AFGA 4Y28C 3R97A 3OXFA 3NGSA 3I0RA 1JLGA 2EBGA 3OFHA 4USVA 1FD2A 4OZ5A 3SXLA 1TK0A 2D74B 1PBUA 3BQ2A 2KT5A 2YWHA 4ZJLA 2R7RA 2IPOB 5G0RA 4EZ6A 1TKTA 3NNAA 3VR1A 3MM7A 1X7VA 2G1DA 1BWVA 5HP1A 3JAMY 2AGPA 5LJ5Y 5DDRC 1UEKA 4U8VA 1NJIT 3FEZA 4YOEA 4MH8A 4AQYJ 3C19A 2HQDA 2Z0GA 3CJ4A 3CIZA 5KG5A 2VG7A 4DV0F 2K3IA 4BC9A 4OI6A 1U7LA 1EARA 3IN5A 1NDPA 4DBQA 4C3KA 1YRTA 3NS7B 1J5EF 1P1LA 5GAGU 1UW4A 2YX4A 2E44A 2DYAA 1C1BB 1GEHA 5CA5A 4K4TA 4DV7F 2VASA 4FKYA 4B02A 3CJ3A 3ENWA 1GK8A 4MYUA 1Q53A 3ZXWA 3VVUA 2DNMA 4A47A 4OHWA 4CLFA 2EFPA 2RQ4A 1T94A 5KFVA 2CYYA 4RZRA 3IWNC 4NOHA 1XMQJ 4TU7A 2JVOA 1N5TA 2MB0B 2H4WB 1N0UA 3OLAA 5HSPA 3MMCB 1RXOB 4ED8A 4RNHA 4MK9A 2HVZA 1XNRF 3PIOQ 1K1QA 4AFFA 1QAXA 1SQEA 4EBEA 4V19J 4BCAA 4J7CA 3HHLA 1N48A 2DY1A 3UR3C 1FKOB 1MWQA 2KDOA 3B4DA 1TL7A 2ROPA 2G0IA 3C14B 3GB0A 3IM9A 3QAUA 1C1BA 4AL6A 4DSJA 2VDHA 1HHQA 2OEMA 3ILLA 5AXNA 3A8IA 4BS2A 3G6XA 1VFJA 3KDOA 4KPCA 5KFQA 2FJVA 5LOQA 2UXDF 1VI7A 2XYPB 2PA3A 4X4PA 1T05A 2AJ0A 3CW2C 2L48A 3A8EA 2WRMA 2IM3A 2MTLA 4I4BA 2EVZA 3KLGA 1F5CA 1UEUA 4DMZA 3ENAA 5M2PA 3CCUS 1RAHB 1WSRA 3N6NA 3FCVA 3JSBA 4DL0C 3PO4A 3AQOA 4D3HA 1S0VA 3PKMA 3K7RA 4DI6A 5HP1B 4IUFA 1SL1A 3VWSA 1F1BB 1OSDA 3HFKA 2ZZMA 1B4SA 2WCXA 2GVZB 2JHEA 1U2CA 2MQNA 2OAUA 3N5FA 1JLBA 4FVCA 4C3LA 5IC6B 3LPEA 4EWTA 1QAJA 4ECUA 2K8GA 5KFMA 1EETB 2ZM6F 2ZKUA 4EU0A 3B82A 3LP2A 2YNFB 1KHWA 4LSLA 4LBHA 3ZC4A 4WE1A 4DN0A 1VC6A 2VFRA 3WZ0A 2ZE2B 4PUOA 1LOUA 2YNGA 2E1MC 3ENQA 3TVYA 1S9GA 1WC1A 2YQ1A 4YN3B 4M5HA 2FGCA 2QMUB 3UN5A 4XAKA 3NGDA 4A8SA 4B3OA 2OO4A 3CJ2A 4ZP9A 2B9WA 4JBCA 1WEZA 4LFAF 1PAEX 3UNYA 3MURP 1WWHA 2KXHA 1FE4A 1XR7A 3AT1B 1OQ6A 2O3DA 1U48A 1FRHA 1RHQB 4IQMA 1UZDA 1M1HA 4TY8B 3V6DA 3OJUA 2BE2A 2ZKTA 1Z2ZA 2XGQA 1F9EB 5LMNF 3M32B 4A8XA 1VJQA 4B9LA 1FESA 3O3LA 4HTIA 1FA0A 3TARA 3M8QB 1FWLA 1NM2A 1RISA 1RUSA 1X0PA 4PG6A 3TA2A 3WHIA 2ZJRQ 4DR5F 2W2QP 5KOXA 5KFJA 3IBFB 2CXEA 4M5NA 2H9ZA 4QZVB 4N77A 1SQFA 3C16B 3HVRA 4H54A 1YQHA 2N82B 4DV2F 2Y1RI 4Y2KA 3GR1A 3L7UA 1RT2B 1NJWA 4L74A 1FRJA 4OZNA 3H0PA 3HHLD 4ITSA 3U27A 4DU8A 3CDEA 1FRKA 5C2CA 4LFCF 1DTTB 4G6VB 3ETMA 1E6YB 2UVVA 2YKOA 2J9EA 5FDLB 1HBNB 1GMVA 2B7CB 2BM0A 2OPQB 5HLFA 3T41A 2DRBA 2WB1D 2MQQA 1NLKL 3E01B 5KAKA 5H9FJ 4DSKA 2HRYA 3OR2B 3NMRA 4PG7A 4DG1B 2AGQA 2UU9J 2HBQB 3RRHA 1VBXA 1KTQA 4UOGA 5IQQA 1IKWB 4RW4B 4RW7A 1Y5NB 5EGYA 4URQU 2IC3A 5EN1A 4W98A 3G9CA 2RVJA 1DURA 2BMBA 2J0QD 1D8YA 4P7VA 3A1YG 1OY6A 3DN9A 2CDRB 3MM7B 1B0VA 3JB9k 2VG6A 4DR2F 4NLOA 3DHWC 1X4FA 4TVAB 3VAIA 4BWMA 1U8SA 3QPIA 4IFVA 2QMWA 1NPRA 5EWGA 2WHOA 1RKJA 1T9VA 2W4PA 1MW7A 3M8PA 1SC4B 2CQBA 3TQ1A 3MR5A 3M1VA 3QSYB 3MZIA 4R5PA 1KR4A 3QT5A 5KFLA 3X3UA 2ZNYA 5HJXA 3T5HA 5DQGA 1D1UA 1XIQA 3Q8SB 1RTIB 4DQSA 5D0RA 5HQLA 4NXNF 2A3JA 2ZFHA 4HHUA 5KFKA 5I42B 1JX4A 4ES3A 3CCJS 1HWKA 3G82B 1T9YA 1RZMA 2NXJA 2CPYA 5IOLA 1TUVA 4KPYA 1HD0A 3TAMA 1YI2S 4DV4F 3LGMA 3O2IA 3TO8A 2KHCA 3VV2B 3DMJB 4JI7J 2J0SD 1VCTA 2NYHA 1VS3A 4QYRA 4ZA1A 2IIHA 2ZUGA 4NEYA 4F0MA 2XLIA 2DR8A 3IM8A 1JLQA 2FY1A 2IMWP 3THPA 4UUXA 3D3BJ 4B17A 3MEGA 1IWGA 2PEBA 1YX2A 3JQJA 1C4CA 4X66F 2X1FA 2HNYA 2J8AA 2G4BA 1GMWD 3WDOA 1XBWA 2C3UA 1UVNA 2WSEC 4IG0A 4U96A 2R2UA 2CZ9A 3MFHA 2AT1B 2AX1A 5C24B 2LXUA 2CPFA 1FK9A 3O1LA 1VQYA 1KN6A 2ZHBA 2UV8G 2GIRA 1U0HA 2MQPA 3GV7B 3W5XA 5DETA 4TY9A 3WC0A 4ZCKA 2EFQA 1NPPA 3VTIA 3C16A 3QJJA 4F0KA 1FJGF 4CT8A 5MLCV 1ZZNA 2RRAA 1HL6A 2LFVA 2MQ8A 3CJ5A 4OX6A 5A2QU 3GIJA 1Y7PA 1RAFB 1RT1B 1YG0A 4KC5A 1N34F 2HNDA 1UL3A 4Q0BB 2JX2A 3CCWA 2DR7A 4GKJF 1C0UA 1J2VA 2ZBPA 1QY7A 2VU5A 1U1NA 1HNVA 1KVKA 3NGKA 4I2QB 5ETMA 1NK4A 5HATA 3DLBA 4YHHF 3K17A 3CJRA 3OSPA 3U02A 4DPUA 2FTRA 1UMJA 2CJXB 1XJWB 1EZZB 1KFDA 2NPIA 2ROEA 3BM7A 1BLUA 2W1BA 1T0TV 4MJKA 4OX7A 1T3OA 2IJNA 4O3PA 5BXIA 4R5PB 3D68A 2HHPA 1HNZJ 4MMOA 2RRBA 2I5JB 4P7TA 2MHNA 4KR0B 5DLGA 2HRUA 2JLFA 2LU1A 5D6GA 3PJXA 2Q3PA 3R5JB 4PR6A 1P27B 2YVSA 3GIRA 1VQKS 4LR9A 5EX3A 4EFAC 2QLWA 4USTA 2QX0A 5C2GA 2ERRA 1TQLA 3HM9A 7AT1B 3IP0A 1PKUA 2Y1LB 4QR1A 4B3RF 4DV5F 4LF8F 5KFXA 2B7BB 2JC1A 2HHHF 1AT1B 2FD2A 4NEZA 2IVFB 2R42A 3MM5B 3R7BB 4WU3A 3TZWA 4CIOA 1LW2B 2Y3YA 3Q8PB 3CCES 4QWDA 3UD3P 2YNIB 1NZ8A 5B0BA 1MROB 1KOHA 1BMQB 3CEDA 4DX8H 5AT1B 3UN3A 4NLUA 2PN6A 1Q5VA 1NKEA 5L38A 2XMWA 4I1TA 1ULRA 4X4RA 4X65J 2KT3A 1MU2B 1HI8A 3FSYA 3D6TB 4OX9J 5IM0A 5H9EJ 2Z56B 2ZZNA 4DR7F 4H4OB 5CABA 2V8VA 3QIPA 3BJYA 1RT2A 3KLEB 2MZ1A 3PTWA 1EQMA 3PW4A 2DNNA 3O5TB 1MNEA 3T9NA 1ITPA 1EQ0A 1R8HA 2X1GA 5KG4A 4F26A 2VA3A 4EZ9A 2LQBA 3LAKA 3CO9A 2HWTA 5B7WA 1LWCB 4PYDA 1UVJA 1FDBA 3HULA 1EHWA 3M8ZA 3PZPA 5A8WA 2Q1LA 2UUCJ 4NZ0A 4ELVA 3CDBA 2DR9A 4JI0F 1MU2A 1IKYB 1HBUA 3OVSA 4LUBA 1RHUB 4CNYA 3DOLB 4DF4A 2I6WA 5KT3A 4U7UD 1VK8A 3G96A 3K2YA 4FVMA 4FF2A 2POKA 1VR6A 1X9WA 2PI5A 2DH9A 4XPCA 1X4AA 4RW8A 3C6TA 4RX6A 2DGVA 1KVIA 1X60A 1RWNB 2LCWA 2H5EA 3IRXA 1RWUA 4QW8A 1MLAA 1BXNA 3D2WA 4O44A 1NNDA 1PC5A 4B3TJ 1N32J 4PG8A 2JC0A 4DCPB 1EETA 2EKNA 1ZM3A 5T7LB 4ATNA 2W7PA 4A8MP 1K0TA 2VFSA 4JI1F 2GVDA 3VHQA 1DZ5A 3HSGA 4P71A 3TJ8A 4OHXA 1WHYA 2GGPA 3G87A 2J7KA 1IKVB 3EDQB 3FBCA 3R8YA 3US5A 2KT2A 1RTDA 3QQCD 4JI8J 2E9TA 1N56A 2YX1A 2F1FA 2V94A 2KKHA 2MQLA 2B9XA 5HMYA 1IBKF 1XC9A 1NSAA 1Y3JA 4WPAA 1SBRA 4ECRA 1UP1A 3NRBA 4I67A 2V2QA 1VBYA 4ZCLA 1SJFA 2Y8YA 1Q8BA 3M2RB 2DGUA 1LFWA 3NKYA 4LVOP 3WBZA 5KFNA 2FZGB 1TL4A 3OJSA 2HIYA 4CLTA 2VOOA 2EG1A 2X3DA 4OI0A 3T1YF 2B4UA 1C4AA 3DGVA 4EYIB 4M94A 2QA1A 4GC6A 3IAS9 5KFWA 2GFFA 3F41A 1C1CA 4IOBA 1K9MT 3OFGA 3J81U 2V50A 3C15A 2E5JA 5CAAA 4Y6IA 4QPXA 3D7SB 5J2PB 2XZTB 5IT9Y 2IMOA 2QG9B 4E8UA 3U1LA 1DBDA 2FVQA 4NLGA 4J9QA 3LP0B 2OSQA 3P45B 3DYAB 5LMUJ 4OYZA 1I6JA 2NZCA 2MZRA 2HBZB 4WFZA 4DL6A 2PFFB 1E6VB 1QM9A 3AH6A 4Y3CA 1TTHB 1KSPA 1CBKA 1P9YA 3Q2TC 4CWBA 4ILLA 1RCOB 1K0VA 3VAHA 2C2RA 4B3MJ 2GHPA 3E51A 2CG8A 2A10A 3P4UB 3OTCA 2HHSA 5L9XA 2GMJA 2LECA 1FNXH 2X1BA 3OR1B 3S01A 2QZ8A 2AKWB 3EMTA 2HRTA 3KHGA 1VHFA 5E41A 2KYXA 4GKKJ 3D9BA 4DSIA 4DZ6A 1HKAA 2OMOA 4C0OC 1YK9A 1CC8A 4RUAA 3KDNA 4IFYA 3OVAA 5LMUF 4ENOA 3J7YU 4FF3A 3PX4A 4NASA 1BY9A 4DFJA 4DPXA 2J7WA 1B7YB 4KGKA 5LXRA 2AJ1A 1JLCB 2RKIB 3PFOA 4GO5X 3V4IB 1U49A 3M6VA 2IM2A 1VQ7S 3BSCA 3DLLQ 1XNQF 2OI2A 3BB5A 4OZ2A 3OFEA 4U67Q 4RNOA 1MWZA 4TKTA 4XDCA 2DR6A 3WX8A 4CYUB 1Q8LA 3TAPA 1NJYA 4HLBA 4MIAA 4DQIA 3FJ2A 5E3PA 2DXDA 2I38A 3ZZRA 4E2FB 2CPJA 2OH2A 2GVDB 4G1IA 2JFKA 4B3SF 5RUBA 4DHVA 4JI3J 3H5XA 3NL0A 2ASYA 1JLEA 4LF4J 1RTHA 3B8HA 2C3PA 5KG3A 4QWCA 2OEKA 2HYIB 1U6ZA 3M1VB 5IXUA 1IBCB 3N6MA 4FDFA 4EI2A 2IDLA 3T1HJ 1RLDA 2W9AA 1TUWA 5KT4A 3G86A 2GGPB 1VRUA 3ITHB 4YP3A 1N36F 1R6YA 3A3PB 3BKTA 3TQEA 1CJKB 2QO3A 2NXUA 4FN5A 3N5BA 1CJTA 2OLWA 4KO0A 2X1AA 2K1RB 4Q2MA 4O3NA 4E98A 3LGHA 3P5TL 3TUIC 2V63A 3SCIE 2RIJA 2BA9A 2GQQA 3CB4A 2VQEF 3Q24A 1NRKA 4UZBA 1FJEB 2WBMA 3BGUA 1RT1A 4DSEA 1S1XB 4FYYB 4IYQA 2BVZA 4OLPA 1IKWA 4RW4A 1WF2A 3V6KA 3RAQA 4OYIA 1NK6A 1OYEA 4OFZA 4ETXA 1T9XA 3PW2A 1QLNA 4KT0C 1FI4A 4C48A 3FUYA 1UFKA 1C0UB 1HNWJ 1NUEA 3WQPA 3JS9A 3MMJA 3RAMA 3MXHP 4I68A 4ELUA 2J7UA 3MR7A 4MIBA 1VYAA 4WU2A 4Q0BA 4F2RA 4U9RA 2PMZD 1QDUB 3EPIA 2ZITA 1N33J 2XI3A 1J5EJ 3BN7A 3QFHA 4UF4A 2HAIA 4LVNP 2MMYA 1WACA 4DX7A 1APSA 1Q7LB 3NY0A 4F3MA 1RHMB 1PO6A 3TWZA 5KFRA 2VFTA 5L8RC 4CH7A 3EICA 5KFZA 1N6QA 1AFJA 1L3TA 3KUEA 2QSFA 2ZVIA 2HHWA 2BACA 4JI4J 5IWAF 5H1SV 2ZH3A 2G0JA 2HZAA 2HQCA 3LAMA 4RNFA 3M30A 1AA1B 2DJWA 1YKWA 3DRRB 3G8TA 1RAOA 3K5PA 3CJKA 1JJ4A 1RTDB 4ICLB 2KRRA 2VBWA 4PEOA 2DIUA 3FZ2A 3J7Z5 4KO0B 4DSFA 5FIIA 5J1EA 1Q78A 4ZVRB 3ZZTA 3BBCA 4FYXB 1NDLA 3D3CJ 4U6PA 1T9UA 2KJWA 1TL3B 3M2UB 4X62J 1GX5A 2XY7A 1YIJS 2DRDA 2XNRA 2UXDJ 1S9GB 3H5UA 3MMAB 4FS2A 2B5JB 4YFUA 3MPWA 3H2LA 1CQMA 3HX9A 3BO4A 2E5HA 5C7PA 1H7XA 2CNLB 2P6TA 5HVFA 1K47A 4F4AA 2CNKB 3V5RA 4HT5A 5KFCA 2WTFA 5LJ3Y 2B4OA 4NA1A 3LO3A 4MKVA 2X3GA 2V2KA 1BQNA 3UDLA 1KQSR 1VGYA 2E29A 3QATA 3ITHA 1S1UB 3MM6A 4DL5A 3D0HE 4RW9B 1YBTA 2RD5C 1JNRB 4NPOA 3K57A 4WWSA 3RR8A 4B9NA 2OTLS 3KLHB 4CLUA 2GJFA 1ZZFA 5EHHA 1F2GA 1GH8A 2MZSA 5A0YA 2DPIA 2NYIA 3WC2A 2PT0A 4BWJA 2XS2A 4TXSA 3R9LA 2UXBJ 4IFVB 1WKKA 2Q79A 4F4WA 1UJ6A 2RNEA 4LF9F 2AIRB 3JSYA 3MUMP 3W66A 3HK2A 4C8YA 4IH6A 3R5GA 4YR3A 1HNIB 2JVRA 3H98A 2YBVA 4OI4A 5B0AA 4HHJA 2HVDA 1U26A 3GWCA 4HT7A 2ZUAA 3F0NA 3FFIA 1F5AA 1NBEB 4DUZJ 1Q7YT 1S0OA 2ZH4A 2PA8D 5JVHQ 3FRZA 2F65A 1EIYB 3OTEA 4QR0A 2ATLA 2ZBQA 5IM0B 2V9WA 2BKNA 2EPIA 3MMBA 4MK8A 2LXIA 1H6KX 1DQ8A 2FC8A 1RU2A 3BR9A 3QYYA 4LMZA 4DG1A 1AYEA 1RGVA 2OUGA 3PX0A 3ZZYA 1RP5A 2B9YA 4ED6A 1Y3KA 5FDLA 2D41A 2BV3A 4KJIA 3E3XA 3KG1A 3R1HA 3KXDA 5K14A 1JJ2R 2QJ3A 3H40A 2UUBF 1JLQB 2FIUA 1RWOB 2GW8A 3W5YA 3BSAA 4ZS6A 5HVGA 3JAMU 2JLEA 3J7ZT 1OJ4A 3PX6A 3J7A1 2EG2A 3MM8B 3MPDA 4DV2J 4DR6F 1TVRA 3HVTB 3MECA 5HMZA 2PO4A 4HH0A 3R6LB 1Y5LB 5CQGA 3ULHA 4CLKA 3CPWR 4LFCJ 5DGBA 3I5AA 3IRWP 3PJ9A 3QO9B 4MTPA 1H2UX 2MKSA 1DQ9A 3DLEA 1S1VB 3H90A 2FLPA 2G2OA 3M2RA 2YNGB 3KJVA 2HHQA 2WVDA 1RWXB 5KFHA 2GO8A 1XQIA 3GP9A 1FKPB 2BJ1A 2QRRA 4TY8A 5DRKA 3KHLA 3BPDA 3BO3A 1UWBA 2C2MB 4EYHB 3D1OA 1F3VA 3D66A 3QT7A 3PR5B 4USHA 4ZPTR 3PVXA 2Y1IA 4F4ZA 4WFNQ 1VRTA 3RUBL 1U1OA 3J81Y 2HWIA 3GFXA 1ZPWX 4C8NA 5DM7Q 4JI5F 1TAQA 4RPFA 3HFVA 3SIPB 4ANCA 2APOA 1A6LA 4ID5B 3VAFA 3TUPA 3QGPA 1HWUA 2OEJA 4HDGA 3IBWA 3T9ZA 1RT4A 2EWHA 1M5OC 3ZTOA 2QTWA 4DR2J 1TKDA 1TV6A 3O8WA 2Y8WA 5E33A 1XR5A 1U47A 1VBZA 5F8LA 3AB2B 1MWYA 2P6SA 4X4NA 4KYZA 1TMJA 3C6TB 3PHTA 2BX6A 3M4XA 1K44A 5HQMA 3BSNA 3KTQA 4CO2A 1KBRA 1Y0HA 4CNZA 2IJRA 5HAOA 4CM0A 1REGX 2HHHJ 2YX7A 2IA0A 2ZWPA 4M5JA 3QSIA 4ZIVA 4CQ1A 3ET6A 5IV3A 3QAEA 2JL9A 4YDXA 2L9NA 1OS5A 2EFGA 3MD3A 3N79A 3VGUA 3ZZUA 2R8IA 1N5QA 3DLGB 3Q23A 3DRRA 4PPZA 2D7SA 3M6UA 4ZPDA 5AE2A 1QSYA 1X5TA 1NK9A 2PDAA 1F3FA 2L41A 1FWKA 2YWEA 1YITS 2RRNA 1RWVB 1Q8KA 2XHCA 4YY3F 4JI7F 5KFFA 1ZH5A 2EKYA 5AXMA 4NE9C 4DS5A 2FVSA 2AEJA 4ILMA 2RE1A 3MDFA 2H54B 5F3TA 1RT6B 2DGSA 5CYMB 2PSZA 2Z8QA 2D9PA 5IQ6A 2H51B 4IG3B 2UXCF 4J9SA 3JYTA 1Q82T 1HQEB 1S79A 5K8NA 3QWPA 2BQ3A 2ZC4A 4TYBA 1HNIA 4USUA 2F8MA 2O1PA 2V2VA 3OD2A 3ONQA 2PIIA 4JUZA 3M9MB 4A8QA 4X64F 4J9UE 1S48A 2HG4A 5JJBA 1SCJB 3EE3A 1TL1A 2OD4A 2JLGA 2GV1A 1NZAA 3QLHA 1N52B 2UUCF 2OD6A 4O3QA 4NCGA 3RB4A 2ZHOA 5F8JA 2A6OA 3M8QA 4G1QB 2GJIA 4LFBJ 1IVZA 1JKHA 3Q8VA 1U1PA 1AW0A 2IM1A 4CO0A 5IS2A 1LEOA 1NSPA 4IH5A 3KNGA 1N0VC 1FJGJ 1SUQB 1QE1B 2PGCA 2E1PA 2QYGA 3SFGA 5KG6A 3IO1A 3NS6A 4IDKB 1RE1B 4DWIA 1S76D 3I9V9 2W9CB 2C22A 2X7IA 2VQFJ 2FJEB 2KRBA 2EXUA 2BXJA 2CJKA 3NNHA 1R0CB 2WB4A 5E3CA 3GILA 1G2EA 1X4DA 2AZ1A 3H5SA 1M5PC 1RTJB 4DPYA 2I5JA 3HD2A 3DDIA 2GIFA 2J6UA 1C0TB 4B3TF 2G1HA 2Y0SD 3MM9A 3MM5A 4I7FA 2CPXA 2IC3B 2F4FA 4PPDA 3AQPA 4ZPVR 4LQ9A 3HJFA 2YNHA 4G1QA 2FJBB 2FVCA 4FYVB 1S12A 1TKTB 3J81j 1ZAXA 2QA4G 3VGTA 2GS8A 3KJQB 3M2VA 3MCOA 4NLRA 4QOTA 1IBKJ 4B9VA 5KT6A 3RW6A 4A8KA 4IDKA 4NX9A 1UWBB 2VG5A 1HBNA 5HLFB 2AV5A 4I56A 5K20B 5DDOC 3LQVA 1ZA1B 2D3O1 2DRAA 4IOAQ 1UVMA 3HHDA 2VQFF 2NCKL 4DV3F 2KVIA 1KLNA 1FEHA 3QRPA 4KFBA 2B8QA 2MZJA 1FJ7A 2GMLA 3EVOA 5ETSA 3JXOA 2HEKA 5K8PA 4Q8EA 4FF4A 3I0SB 3P5BP 1TUGB 3R5DA 2RB7A 4ZPWR 4DCOB 5F9LA 1NU4A 1PBAA 1N6QB 2ZHAA 1PSDA 3O6QA 3JQKA 2BJDA 3GSDA 5GVQA 4TQSA 4UT4A 3AOCA 2N7YA 4RUHA 1VQ4S 3MPYA 1EP4B 2FGOA 2W01A 2WVBA 2XNQA 3ENVA 3ZZOA 4KHPF 1JIHA 3UN2A 3M32A 1Y10A 1HNXF 3CD7A 5T14A 2KG0A 1QSSA 2YKPA 1PIEA 4X65F 4ECVA 2CQIA 5IT4A 1Q0NA 1UA1A 3L7PA 3LP1A 2AP6A 3D5MA 3NS5A 3UVJB 2HNYB 3EYZA 4ED2A 2AHOB 2V2ZA 3KWMA 1M90T 3D6HB 2F8HA 3L9ZA 3OPKA 2V4JB 4A46A 5D3GB 2L9WA 3RBZA 2HK2A 3K89A 3V81B 3BO2A 3CIMA 3OL9A 3NGUA 4ZKAA 4PXBA 3RG6A 5HL7Q 5CH7B 3MR3A 1SJQA 3UDEA 4UOFA 4HI2A 4BLGA 1IJEB 4ED0A 2RSQA 1UCNA 3VGSA 2VKZG 1WELA 3A4TA 2CUYA 4PXEA 5SZTA 5J2MA 2IAJA 4ZLNA 2FLNA 3E2EA 3SCKE 1DTQA 1WC0A 4G65A 1VQMS 4OL8A 1IR0A 2CPEA 2H3EB 4I6YA 1JK9B 1S1WB 3DMJA 1GMUA 1VIXA 3MEEA 4NL5A 4UY85 3Q8UA 5I4MA 3ZZZA 1MN9A 3GG1A 3W7BA 4A48A 3D1QA 2XO6A 2HVEA 1FTCA 2CQHA 2FYXA 4JI3F 1SH2A 3EPGA 3IWLA 1DTQB 3K5MA 3B4MA 4DLEA 2AYGA 1OSCA 1GNKA 2UVRA 3BR8A 4C8OA 2IDEA 1UVKA 1HNVB 2DH7A 3I96A 4I2QA 4DS4A 2KFZA 2WW8A 3ILJA 3SCLE 2RS8A 4ZMMA 1JLGB 1R27B 3OTOF 1FNOA 1RTIA 2R7QA 4LJMA 3KMQA 3NWRA 1T9WA 4DU7A 4X66J 4ED3A 3FCWA 4RNMA 2WW4A 4FNIA 4IO1A 3DM2A 4DPTA 1WOOA 5K9FA 3T5JA 2B8PA 1OYDA 2N3LA 4P75A 3W60A 1Q79A 4OYBA 3ZO7A 2H1YA 2XS5A 3NOGA 3FMBA 3J7YI 3K5NA 3HD1A 2XSJB 7FD1A 4WP8A 2ZH7A 3SEOA 2W7OA 1B99A 2BKOA 3QRQA 1BQMA 4EBCA 5AJ3F 2MZTA 4ES1A 1LK7A 1RA6A 1LWFB 3R1LA 4FPIA 4RW7B 5SUHA 4TLQA 5D3GA 3W8GA 3I55S 2EI5A 2ZH8A 4KAIA 1WOSA 1ZOTA 2L9DA 1Z1ZA 2Z2ZA 2XLKA 4H4KC 2AQ4A 5I3PA 3UW1A 1JWWA 1N33F 3PM9A 5E7OB 4LF2A 4GKJJ 1E6YA 1XEZA 2UVUA 4QBUA 3C15B 2CQPA 4IG3A 3NOCA 1VBKA 4S0MA 1N8RT 4QIGA 1NDCA 2HHVA 2QA4S 5KFYA 2C3YA 4LIRA 1OY8A 2UV8A 4P52A 2HKEA 3MWBA 4C7QA 1LNQA 4DL3A 5F8IA 3TAMB 2EFOA 2FB0A 2CWKA 1F2HA 2LDIA 3QGHA 2H48B 4NYPA 1IUJA 1F6TA 5AXLA 5EWEA 1RT3B 5THWA 4ZVEA 3T1HF 2M70A 1R0AB 2M7SA 2VPWB 4HL9A 5L39A 2RUSA 4F4XA 1T3NA 9ATCB 1U09A 2XZDB 3KKFA 1UZHA 4ED4A 2W4DA 3M8WA 4I6AA 3EVWA 2XWYA 2MKJA 2XMVA 5EX0A 4CO5A 4DQPA 1C0TA 3R3TA 4IRDA 5ETVA 1S1UA 1B0TA 2DNLA 3MM6B 4RWWA 2R2SA 2C28A 2M0GB 3AJ2A 3B78A 3CCZA 4J9VA 3GYGA 1RCXB 4F0HA 3CJTA 5J2MB 3I82A 3Q8RB 1JXLA 2CJ9A 2JFDA 2KZMA 2KXFA 2VUGA 2VG6B 2JJ4D 3R27A 1HWLA 2D3OR 2AWZA 2JDJA 4F25A 2MLXA 2OIHA 3FK4A 4LR7A 1KDNA 3ZNJ1 5KFPA 1RHJB 4F02A 5JMNA 2VFUA 2IBOA 2M8HA 3H25A 1HLWA 2FLLA 2QLXA 4PQAA 2XB2D 5CXTA 4NZ6A 1FDDA 2OFHX 1ACMB 3HVWA 4X4TA 4GVBA 4MKYA 3CDUA 3MAAB 3EZOA 3A3NB 4DR7J 4NI2B 5J2QA 4DPOA 4LREA 5F0WA 1BQXA 2M52A 5L46A 3QGGA 3M8SA 4ALZA 1S0NA 4K2XA 5J1NA 4ED5A 1LK5A 3TP2A 3PV8A 1N36J 4EK2A 3OHBA 2DNOA 4P2SA 2DISA 4TNOA 1IBLJ 3DLEB 4K4VA 1AXQA 3NBPA 3THVA 1Q1KA 1FE0A 1RHKB 3QLHB 5GAEI 1UKUA 2O67A 5CYQA 1NDKA 1NEEA 3OL7A 2HQIA 2VBYA 3H5YA 3NAIA 1S4FA 4ZP8A 2GAHC 1TR0A 4JI0J 1HMVB 3H8YA 2VV5A 1CJUA 4B9MA 4DLGA 1WJ9A 2FJXA 2FQQB 3L09A 4P2MA 3HO1A 2ZVSA 3DOMB 3K0JA 1NMEB 2WAQD 5GADU 2CQGA 1WG4A 2DGTA 3H7HB 2B51A 2K7JA 2QE5A 2Q66A 3EGZA 3CCVS 5M2RA 2GIQA 1HR0J 1YHQS 2XSFA 2EFNA 1JJCB 1LWXA 1P6TA 3A8JA 4Z7YA 3N0VA 1NPKA 2QFIA 3R7NB 3TEHB 4WF9Q 2KU7A 1PGZA 1N54B 4Z7CA 2BKPA 1OWXA 2HW3A 2ZD1B 3UWTA
chains in the Genus database with same CATH topology
1MSWD 5KG7A 2KM8B 4FS1A 1HBMB 3OHAA 2R7VA 3T6JA 3MCSA 3DC2A 2U1AA 5I3QA 2XBPA 5IT0A 3AJ1A 1RTJA 3KK1A 4JI4F 3IR7B 1FERA 3DI6A 1R89A 2YTCA 4P6QA 5GAEU 1VQ9S 2UP1A 3P96A 1B7FA 5JUMA 1VQSA 5F8HA 1SKSA 2FDNA 1NJXA 3CDAA 3FEYB 3R5BA 2W24A 1ZYQA 3UFCX 2DVIA 4B08A 4F4YA 4WFAQ 4C2MA 5L1IA 5LXYA 2ZDOA 4MKBA 3M8PB 5EDWA 4ZVGA 3RTVA 3FMWA 2DT9A 4QWEA 2OTJS 1S77D 1S1TB 1UETA 3CJ0A 1ZM4A 4MIWA 4QCLA 4XDDA 5F8MA 3KK1B 1OPZA 2DK2A 2M5YA 1M5SA 3AAWB 2HNDB 2K7KA 1FKPA 3QMQA 3R27A 4NYOA 3JSMB 2QEXS 3V6JA 2MJUA 1D9FA 3FRYA 3LGNA 1VQ6S 2GMHA 2FUG9 5KFFA 3TRGA 1JKHB 2IYIA 1TL3A 3M2UA 4OX9F 1URNA 4TU8A 2C2DA 2GQCA 3MPVA 4PQUB 5BR8F 5DQHA 1R3NA 1SI9A 3FSXA 4ICLA 1URRA 1VK3A 1JLAB 4JI6F 3ZFVA 1DHMA 2MKIA 4F4KA 2UXBF 3M30B 1RI7A 3SSRA 4ECZA 2ILYA 2NS1B 3SQGA 4OI1A 3HI9A 4DR1F 2D3ZA 2HS0A 5B0CA 1QVGR 3DYAA 3C3LA 2B3TB 2RT3A 3NCPA 4ZPCA 2OPRB 3V4MA 5DGAA 3G8QA 2M9KA 2DNZA 3ISND 3WX4A 5KFOA 1WEXA 4NZ7A 2ZOFA 1R8PA 3G8SA 4BDPA 2HHUA 4QPTA 3EXCX 3Q0AA 5HMWA 2OMLA 4TYAA 3UR0A 4N56A 2KG1A 2VC1A 3NAHA 4ID5A 4B9TA 1O0PA 4ZDNA 5J2QB 1S99A 2ZBCA 3PEHA 4CTAB 3HHNB 4RWXA 4LSNB 3KLHA 2M3DA 2PC6A 3N6LA 4ZP7A 2R2TA 3SV4A 1HARA 4UUWA 3HP6A 4ECSA 2ADCA 3CVKA 5DS7A 2ZE2A 5B0FA 2LQJA 3SMZA 3OBIA 1L5UA 3SI8A 4OJ3A 2PD1A 2GO9A 3BGRB 2DGWA 3HZGA 3NCRA 1O8BA 4CO4A 3DI6B 1LFPA 2MSSA 3IS9B 2B6AA 2DR5A 2LLZA 5KT7A 4UW2A 5E3RA 2XMUA 4WZMA 2BRKA 1SUQA 3CT9A 4J9KA 4NLQA 2P9GA 4XO0A 1HNWF 5JVGQ 2E9RX 2LA4A 1U6BA 2XWXA 5FD1A 2R7SA 1OO0B 3G6YA 2V8HA 3N28A 2MJNA 1GX6A 4N5SA 4QIVA 4C8KA 4QU7A 4X2BA 3LANA 3BF4A 1S0MA 2MQMA 3MECB 3C6UA 2Q6CA 1XK8A 4N8NA 2NQPA 5FLXY 5C25B 4J5OA 4WJBA 2LEBA 1HQEA 3KK2B 4OJ1A 1YTYA 1KFSA 2F9DA 2HLTA 5DLFA 2RMLA 4MFBA 2O66A 1GQEA 5DJBA 5AE1A 4RNNA 3TAQA 1U2FA 3LW5C 2W7AA 4R8UA 2C3OA 1DAXA 1FTRA 4EBDA 2IRXA 3R5AA 1D0EA 2OSRA 3VAMA 4GKKF 3IR6B 3OR1A 2RH3A 2BBEA 2IYGA 4CCHA 2XLJA 2VFVA 2MKKA 4WIIA 4WKRA 3FQKA 5GAGI 2K1RA 1TP7A 2VPXB 2B6AB 3K8WA 3KFWX 1KEKA 1D8ZA 1WG5A 2PE8A 4C0BA 3MR2A 2CZ4A 1VRUB 2KFYA 2IBKA 3TNVA 1KD1T 4FNHA 1VC0A 4C4WA 5J2PA 4V19X 4OZJA 1YGYA 4K0KF 3LWLA 1UJ4A 4I2PA 5D4LA 1SL2A 4OJGA 3VQTA 1KLMA 2WK4A 4C98A 2W8LA 3ZZPA 3LF0A 5I42A 4QW9A 4K5RA 2OPSB 4C97A 2RDJA 4ZOSA 2DD8S 5KFGA 1U1QA 5HN0A 2KB2A 2CQCA 2YWGA 4OZ0A 1LWEB 1R43A 4PG4A 2EFVA 4QU6A 3KLGB 2DO4A 4O3SA 1JB0C 2HHTA 3CE8A 2VC0A 4DFPA 3F73A 3K5OA 1O5JA 4DUZF 3CMES 1CLFA 3OFFA 5D78A 2CPIA 3L7OA 5CZVA 3SFUA 1KLMB 2XHWA 3NP5A 4JV1A 1REVA 3VALA 3CUNA 1H7WA 5C24A 4ZCMA 5GAHI 3KG0A 3RBDA 5A6WA 2GQ2A 4IOCQ 3E8OA 1BD6A 3F44A 1E6VA 3RYLA 3RBEA 5KFSA 2XCPA 3HPOA 1IM4A 2CPZA 3SCJE 4DFKA 2AYEA 3BZQA 3SQGB 4MAKA 4U7UK 4GMKA 4X4VA 3BREA 4KKOB 2UUTA 2F40A 2KYZA 5F8GA 1WI6A 5JXSA 1WHVA 4RLEA 1Z2LA 2MXYA 1TZ0A 3ICLA 3PFEA 4FXDA 1SJ1A 1SH3A 1GXTA 3DLJA 2LA6A 2N7CA 2O5DA 4R25A 1DRZA 4AXIA 4YB7A 3LP0A 5EUHA 5AXKA 2NREA 3U1MA 3I0SA 4JOUA 4YDDB 1UJ5A 4A8OA 4WCEQ 2KO1A 3T3FA 2Y1JA 3AA8A 2YY3A 4AE5A 2VKRA 1FO1A 4X4OA 1Y9OA 2R8KA 3OUYB 2E1RA 3GG0A 3SDEB 5A6PA 1S1TA 4Q7AA 4OV1A 3TW0A 3KLFB 2X51A 4LF7F 2DNKA 2YWFA 3M2VB 4CO1A 5E3QA 4BC7A 2JEJA 4YMEA 5U47A 1CC7A 2YNIA 3CD0A 2CQDA 4R0EA 4PWDB 4I2PB 1H38A 2WOMB 1SB6A 2N4DA 2JZ5A 3MMAA 4A4JA 4YQWA 3IXQA 4M1KA 4JV0A 4NLTA 4ELTA 2CJAA 1G3OA 2VD3A 1HW9A 3OTBA 2C3MA 1JLBB 3BQ0A 3TA0A 4J9PA 4KHMA 2K3KA 2DGQA 2ASLA 1RYSA 4WZQA 1VJWA 4J9LA 4DEZA 4X84A 3N4WA 3H20A 1WG1A 4YEAA 3CJKB 3QZ8A 1UFWA 1U4BA 1NK8A 4KQZA 2UVWA 1XMOF 1R0AA 4NCGB 2BRLA 1N88A 4FBTA 1FXLA 3PDNA 4DQQA 1HMVA 4DL2A 1SKWA 4ECTA 4K4UA 2VH7A 1HFEL 2V4RA 3LP1B 2IHR1 3RRGA 4C9DA 2DNRA 4WYWA 1NH8A 1HBUB 1FT8A 1DQAA 1SL0A 4DQRA 1JNZB 4K4SA 5GADI 2LVWA 3FZBA 3IGVA 4A8WA 5KG0A 1RT6A 1LXNA 1V6HA 2VODA 1VLYA 2FVPA 1S6OA 2NUHA 2V9KA 2E5GA 1K8AT 2KTQA 4XK8C 3GV5B 3TUZC 2GHVC 4RU2A 3BEGB 1L3KA 3AB4B 4PXCA 3MEDB 3D0IE 1FK9B 2DH8A 2GCFA 1ZTTA 4FP9A 3G6ES 2CG4A 3BDPA 3HKWA 2QFJA 3DNCA 1S1XA 1S72S 4URSA 3M05A 1NK0A 5DQIA 4F3QA 4KV8B 2WBRA 4O23A 4Y0FA 3RB3A 1YJNS 3CWJA 5DO2A 2RF2B 2NSCA 3BGLA 2YKNA 4WTYA 3GV8B 4RKUC 2ZH2A 4TU9A 5DG7A 2CQ3A 2ALZA 4F50A 1NK5A 3W3SA 3TOQA 1OIAA 1FRXA 3TANA 1GT8A 2FHJD 4DSLA 3SYZA 2FC9A 2XMJA 3DM2B 4Y65A 1UVLA 4OHZA 1Y5IB 2HNZB 1D3WA 1VIOA 3R5CA 1TKXB 1R8CA 2FHOB 3GFYA 1LW0A 2XMKA 4G3IA 4CH1A 3T5KA 2UUAF 1NH7A 2HS3A 2FJAB 1VC5A 2OPPB 3TA1A 2R8JA 1NKBA 1YSJA 1VRTB 5IZHA 3OUYA 4U7CA 4GO7X 2EK1A 2CJBA 1SJRA 5T7LA 4Y00A 3TX8A 3P49B 3DRSB 2HMIB 1FKOA 3HHLB 4PUOB 3IRXB 1W2IA 1JXEA 1VQ5S 4Z2XA 1J5OA 3I5BA 4WK1A 2A18A 2QYCA 1BGXT 2DGXA 4LF5F 4NYZA 1FRLA 1T05B 2ZJPQ 1U1KA 4AXJA 2QT7A 4C3MA 3CCRS 4W90B 2JH3A 5B0GA 2IVYA 2HHXA 5E0OA 4YB6A 3DGPA 2R7UA 2M88A 4K4YA 1TL5A 3EUNA 3TVZA 2BABA 4PRFA 5CHCB 2A2DA 3RZAA 1LKZA 2CVIA