1PGZA

Crystal structure of up1 complexed with d(ttagggttag(6-mi)g); a human telomeric repeat containing 6-methyl-8-(2-deoxy-beta-ribofuranosyl)isoxanthopteridine (6-mi)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
183
structure length
183
Chain Sequence
KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*T*TP*AP*GP*GP*GP*TP*TP*AP*GP*(6MI)P*G)-3'
publication title Structure-based incorporation of 6-methyl-8-(2-deoxy-beta-ribofuranosyl)isoxanthopteridine into the human telomeric repeat DNA as a probe for UP1 binding and destabilization of G-tetrad structures
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 183
sequence length 183
ec nomenclature
pdb deposition date 2003-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1pgzA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1pgzA02
2M52A 2DH8A 1X5TA 5GAEU 5FJ4A 4Y0FA 2G4BA 3MI7X 2HVZA 1VC0A 4Z2XA 2ZJPQ 2RUGA 2G1DA 1U1QA 1WHXA 2MHNA 3UCGA 1W2BR 3OW2R 2MQMA 1YWXA 2E5JA 1KOHA 2MZJA 3H2UB 5DETA 3BS9A 2CPEA 2MYFA 3EX7B 1K8AT 1VQ9S 2AYBA 2KI2A 1WG1A 3S01A 2I2YA 2AYEA 4WF9Q 3G71S 2DNLA 1X5PA 2DGOA 2GO9A 2CQGA 3BO2A 3HI9A 2DNRA 2K8GA 2DNQA 2DGXA 2DNKA 2MQQA 2FC8A 3UD4P 1Q86T 2J8AA 2DB1A 5MLCV 2YH0A 3VALA 2KFYA 2DGSA 4WIIA 1OIAA 2JX2A 2DNHA 2LA4A 1FJ7A 1YJWS 2VOPA 3FEYB 1H6KX 2M4MA 1VBZA 2DH7A 1H2TZ 3S8SA 3BO3A 3NS6A 1SJFA 3R1LA 1VQMS 3VAMA 3VAGA 5CXTA 3HHNB 2E5HA 4OZ0A 4ZKAA 1YJ9S 3R27A 1DHMA 1SJ3P 2DNYA 4WFAQ 2M2BA 2M70A 2RU3A 1UP1A 2DHSA 1L3KA 2G0CA 5DDRC 3EGZA 3UE2A 5LJ5Y 1H2UX 3SXLA 2CQDA 2DIVA 3G8TA 2MKHA 4YOEA 4LIRA 2KVIA 2E44A 1WI6A 1QVGR 2PEHA 5BJRA 2A3JA 2KXHA 3DLLQ 3S7RA 3PIOQ 1P1TA 2BOPA 2DGWA 2DNZA 3CCQS 1SJRA 1R8HA 2RQ4A 4J5OA 2HGMA 1Q81T 3K0JA 1JJ4A 5LXRA 2HGNA 1Q82T 1X4FA 2CQ4A 1KC8T 2J0SD 2CPIA 2LECA 2MKJA 3FEXB 2D9PA 4P6QA 3UCUP 1WG5A 1WHYA 2MQPA 2JVRA 1VBXA 4UQTA 2RQCA 1U1KA 2LQ5A 3NMRA 2LEAA 2MZRA 3H2VE 5CA5A 5ITHA 1VQOS 2LEBA 4QQBA 2DHXA 2KRRA 3P49B 1OO0B 1U1OA 2XNRA 2DHAA 2LXUA 4WFBQ 3NS5A 3EGNA 3CCJS 1ZH5A 1VQ7S 3I55S 3D2WA 3MOJB 2KG0A 1X4HA 2FHOB 2MKKA 2MZTA 2DIUA 2N3LA 3CCMS 2DK2A 2F9DA 2OJ3A 2KYXA 1M90T 3S6EA 5GADU 4TLQA 2RVJA 1BY9A 2MZQA 2B0GA 1VQ8S 2KXNB 2CQ3A 5DDPC 3G4SS 1WEZA 1NO8A 4QU6A 3CF5Q 2QFJA 2VONA 5GVQA 2YH1A 5D77A 2JVOA 2NLWA 3VAJA 3CD6S 2K3KA 2MKIA 1N8RT 4V19X 2DNOA 1FT8A 2YKAA 3MXHP 3TO8A 2Q79A 1WHWA 2M7SA 4UY8T 3US5A 3NNAA 4F02A 1U6BA 2ADCA 2XB2D 2MSSA 3LQVA 4FXVA 1FNXH 3MUMP 1JJ2R 2PE8A 2D9OA 2CPXA 5GAGU 3R1HA 1X4CA 3B4MA 2MGZA 1K73T 2KM8B 4PR6A 5LSOA 5JVHQ 1JMTA 1VQ6S 2XS5A 3RW6A 4ERDA 2RRBA 2DO4A 4QU7A 2X1AA 1X5OA 1WTBA 2KH9A 2DGTA 1X4DA 3CUNA 2CQCA 2ZJRQ 3CCSS 2FPHX 2U1AA 3CPWR 1WHVA 2GHPA 5D78A 1YI2S 2KG1A 2MKSA 5JVGQ 1U1PA 1M5PC 2CQBA 1NJIT 1M5KC 2ERRA 5IFMA 1VQPS 2LXIA 1U1NA 3VF0B 2MQNA 3B4DA 5DM6Q 2MJNA 3CMES 1AUDA 1URNA 1KOOA 4EGLA 1M1KT 3BEGB 1YTYA 2LMIA 5GMKa 4WKRA 2M9KA 2CQ0A 3P3DA 3P6YC 2EK1A 4FXWA 2L9WA 2O3DA 2F3JA 1PGZA 3CCES 2KN4A 2ZJQQ 3MD3A 4IOAQ 2XNQA 2N7CA 1U2FA 2FC9A 3N9UC 1WG4A 1CVJA 2QEXS 2DH9A 2MZSA 1U1MA 2L08A 2X1FA 2MSTA 2OSRA 2YWKA 2EK6A 1VBYA 2DGVA 2AD9A 3Q2SC 1WF0A 1VC5A 2QA4S 2I38A 3MUVP 1RKJA 2HZCA 5CYJA 2MQOA 2DGUA 1M5VC 1HD1A 1UW4A 3LPYA 3ZZZA 2MKCA 5IQQA 1X5SA 4C7QA 1VQKS 2E5GA 5LJ3Y 2EVZA 3ULHA 2CQ2A 2OIHA 4W92B 4CIOA 3CC7S 2CQIA 2KRBA 2XS7A 3NNHA 4CH1A 1UFWA 1IQTA 1VQNS 4LJMA 3MURP 1FJCA 2CPYA 2DNPA 2LCWA 1YHQS 1WEYA 2RS8A 5HL7Q 2M88A 5LSLA 4C4WA 1DBDA 2CPDA 5LXYA 2MQLA 2RNEA 1FXLA 2BZ2A 3G8SA 2JRSA 3G96A 2SXLA 4IOCQ 2AYGA 1WWHA 1Q7YT 4YB1P 2LKZA 2FY1A 2MMYA 3I56S 2WBRA 1HA1A 2MY7A 2MZ1A 2MGZB 1KQSR 1OPIA 2CQHA 5DDQC 1VQ4S 3CULA 1U1RA 4LMZA 1K9MT 2N3OA 2AYMA 2M8DB 1WI8A 2J76E 2VODA 2DISA 3THTA 1X0FA 1DRZA 3UCZP 2MY8A 3J7ZT 3CC4S 2N82B 2MB0B 4M5DB 3P5TL 4U67Q 3U1MA 2D3OR 2CPJA 1D9AA 3DXBA 4BS2A 1P27B 1R8PA 5IM0A 3G9CA 3VAHA 3SDEB 3J7YU 4TU7A 3TP2A 1XN9A 5HO4A 4F25A 3MDFA 2DHGA 2V94A 1SXLA 4OZ1A 1HD0A 3V4MA 2RS2A 1KD1T 2OSQA 1YIJS 1H2VZ 2KU7A 3CXCR 1SJQA 1OWXA 3SDEA 1G2EA 2X1BA 1D8ZA 3IRWP 3L3CA 4CQ1A 2NZ4A 2DNGA 3U1LA 2RRAA 2DNNA 1S79A 2KHCA 1WF1A 3CCVS 4ED5A 1QM9A 2OTJS 2E5IA 2M8HA 1U1LA 5EN1A 2LA6A 4YUDA 4QPTA 3RW7A 3VAIA 2KM8C 3IWNC 1B7FA 1U6FA 2L41A 3SMZA 1WELA 3CCUS 1N52B 5GAHU 2LYVA 2U2FA 2DO0A 4Y00A 5H1SV 4PRFA 3CTRA 1F9FA 3BO4A 3ZZYA 3NNCA 1X4AA 2CQPA 2DGQA 1X4EA 2HYIB 2X1GA 2MXYA 4CH0S 1RK8A 3TYTA 3THPA 2MPUA 3CCRS 1YJNS 2JWNA 2MJUA 3CMAS 1A7GE 4IO9Q 2DITA 2KT5A 4WFNQ 2CPZA 4IUFA 3CC2S 1HL6A 2RT3A 4TU9A 2J0QD 4A8XA 3UWTA 2F9JA 3UD3P 3VAFA 1N88A 3G6ES 1NU4A 1ZZNA 1N54B 1WEXA 4F26A 1SJ4P 2OTLS 1M5OC 1DZ5A 1FHTA 2UP1A 1VC6A 1ZZFA 2YTCA 4PKDB 3CCLS 4TU8A 2XSFA 1YITS 2M0GB 1O0PA 3MD1A 3PIPQ 3Q2TC 1UAWA 5DM7Q 4C0OC 1X4GA 1A9NB 1PO6A 3VAKA 3MUTP 1QVFR 2HGLA 2CJKA 2XS2A 1WF2A 2CPHA 2CQ1A 1VQLS 1FO1A 2KXFA 5DDOC 3JB9k 1S72S 2VOOA 2DNMA 1X4BA 5IM0B 1VQ5S 1FJEB 4WCEQ 4W90B 4RU2A 2CPFA 1JJHA 2ADBA
chains in the Genus database with same CATH superfamily
1KWMA 5ETNA 1TFYA 1WKLA 4RKUC 1VC0A 2ZJPQ 1ZAXA 2RUGA 4A8WA 3OW2R 1IJFB 1TL3B 4RNMA 2CPEA 3DYAB 4I7FA 1KN6A 4KTQA 3F73A 3AFGA 4R0JA 2K2PA 4GC6A 1Y3KA 1FRMA 3G71S 4ZPBA 5ETLA 3MEDB 2RE1A 3GJRB 4DL2A 3MM6B 4RW8A 5D4NA 2HKEA 1TAQA 1P8GA 3SYZA 1R0AB 4LSZB 3T5LA 3CJ5A 3RR7A 1OYEA 3KHHA 4LFBF 2I8EA 3QWUA 1LW2B 1UP1A 1L3KA 1WOOA 3CJSA 3LGMA 4ICLA 4ZVOB 2W9BA 1GK8A 2BOPA 4JV1A 1ELOA 4PUOA 2VKRA 4WK3A 3GJTB 1KC8T 1FDNA 2IM2A 2KHDA 1BC6A 2BW2A 1OQ3A 2P6SA 3C6TA 2EBGA 2MQPA 2JVRA 1U1KA 3ZZOA 5ITHA 1VQOS 3MR2A 1CC8A 3GSDA 1NH7A 4KO0A 3NWGA 1NK0A 4JOUA 5SZTA 2HRUA 3TZYA 3M2RA 2V8VA 2E7VA 2F9DA 4LF4F 1TKDA 3L95X 1DQ8A 3J7A1 1FDDA 2GCFA 1QUPA 1MWZA 3HVWA 3H5XA 3M9OB 2RIJA 3UDLA 3T1AA 3CF5Q 4WWSA 2VPXB 2BE7D 1U0SA 2HEKA 2G0IA 4K5SA 3MXHP 2PD1A 4GVBB 1ZETA 1S1UB 2ADCA 3ENQA 2XMUA 2PC6A 4X4TA 1HBOB 2UXDJ 1JMTA 4P72A 5IT4A 1WTBA 4ZS6A 5K8NA 4J9NA 3BGRA 4PXBA 4DV3J 3OPKA 1LOUA 1P1LA 3VZHA 2BJ7A 5I3UB 1YDLA 2XYHB 4QWBA 3ZTQA 3TARA 2IM3A 3MEKA 1IKWB 1EKRA 4ZPCA 2E9ZA 4O4RA 2L9WA 2O3DA 3ISZA 1EQ0A 4DUZJ 2LQ9A 1S9EB 4PPDA 2KN4A 4DPOA 1Q0NA 1CC7A 4M5LA 2AJ4A 4QOTA 4I2QB 2X1FA 5HMZA 5J2QA 2CIMA 1I3OB 1PYOB 3EUNA 1M5SA 1UW4A 3LPYA 2MKCA 4XPEA 3OFFA 5B08A 4C7QA 2EVZA 2UXDF 1DTTB 3C6UB 2V9WA 1UVMA 1FJCA 1FWPA 4DV3F 5LXYA 3UR0A 1LV5A 3NEKA 4P2MA 4IOCQ 4OI0A 3ILJA 1MW7A 1S6UA 4PABA 2ZOFA 2XMMA 7FD1A 1KTVA 2IVFB 3WC2A 4I67A 1J5EJ 2N3OA 3RBZA 2IMOA 3UN3A 3G2XA 4X84A 1M1HA 4G6VB 4DCJB 3GCXP 1Y7PA 2ZZTA 4M1KA 4NZ6A 2ILZA 4Z37A 4X65J 1S9GB 2H3EB 2HW3A 1PCAA 3PW7A 1FNOA 3HHLB 4AYBD 4UOFA 3VVTA 4WK1A 3DI6A 4GKKJ 1UJ4A 2HWHA 1RISA 1VOMA 3CJ4A 1C4CA 4DQQA 2LA6A 1AFIA 1RWNB 3N6NA 4TXSA 5KG0A 4K50A 4PWDA 1RA7A 1TK0A 3QATA 5EX3A 2FLNA 1TKZA 2FHJA 1X31C 1X4AA 4PAAA 2V2ZA 2JWNA 1RT6B 4JI7J 3IGNA 3OR2A 1AB8A 3MPDA 4X65F 1NPRA 3VAFA 2QLFB 1XMQJ 1ZOTA 3I5CA 1F9HA 3AD8C 1F6TA 4TU8A 4H54A 1Y00A 3ETMA 5K9FA 1HYSA 4UT4A 3QQCD 1S49A 1LWFA 3DLHA 5HLFB 3OT9A 3QAEA 1H3DA 2E1CA 1NSKL 5DDOC 3JB9k 5IM0B 4N7TA 2CJAA 4NPOA 4ENOA 1HWKA 2ZD1A 1CJUA 3H2LA 2EG2A 4U8VA 4HL9A 2GQQA 1JLAA 1C1BA 5KFJA 3JSMA 2VU5A 2VC0A 3FBBA 2HFUA 2HHTA 2PA3A 4PWUA 5KFPA 2C2DA 3EX7B 4AXIA 3EVMA 1GMWD 4H4OB 4JI7F 2I1RA 4ETZA 1W7WA 4DG1A 3KG0A 5D3GA 3CNQP 3OJSA 1XMQF 2LDYA 2DNKA 2MQQA 2ZDOA 2FC8A 1Q86T 3NGKA 2PMWA 2DH7A 1H2TZ 2JDJA 3KLEB 4ZKAA 3M32B 4QPXA 2DR8A 3GR0A 2IVMA 1QSYA 1NSAA 1IWAA 5C2CA 1FCAA 2QYGA 2DGWA 2DNZA 2RQ4A 3DRPA 1JLQA 2JC1A 3SCJE 3MR5A 2LXFA 3ILLA 4YY3J 2VBWA 5H9EK 4P6QA 1UFKA 1UVLA 4KAIA 3CJ0A 2GMHA 1IKYB 4G3IA 3LOUA 2HBQB 2DHXA 3P8BB 1TUGB 4I69A 1U1OA 1Q78A 3QZ7A 5KTQA 2Z2LA 4IG0A 2VFUA 1ZH5A 3O8WA 4IDKB 3LP0A 3M8ZA 4RLEA 4O23A 2JZ5A 3EDQB 4OYAA 4USVA 3D0HE 2MZQA 3G8QA 2KKHA 3HP6A 5E3AA 4JYAJ 3Q22A 3JTPA 1UFLA 4B3MJ 2A0FB 5KFAA 1RT3A 3K5OA 5K14B 4NCGB 2E7XA 2NXNA 1LNQA 1JJ2R 2DY1A 4DSEA 2PE8A 2D9OA 1N32J 2MGZA 5JVHQ 3DOLB 4B3SJ 3Q89A 1QTMA 2VBZA 2R7WA 1SH3A 1TL7B 3IG1A 2VG7A 1D9DA 3MM8A 2GHPA 3IXQA 3KNAA 4Q0BA 2CUYA 5JVGQ 3UO0A 2CQBA 2WVCA 2OPSB 3VQSA 2ZBPA 4O3RA 2UVWA 4OYBA 3HZEA 3CGIA 5KT5A 4JYAF 5CH7B 4LRFA 2V4JA 2WVBA 1HNVA 4R5PA 3N9UC 2DH9A 1U1MA 5KFUA 4RW4B 4PXEA 3JSYA 1N32F 4N77A 5F8NA 1X5SA 4B3SF 1UL3A 2DRBA 1U0HA 1S1XB 2UZAA 2GAGC 3H8YA 4B9SA 2YNHA 2RF2A 4RUCA 4C4WA 4DWIA 3TR5A 3H20A 2CXEA 3DMJA 1Q7YT 4Q8FA 1KVJA 5A0YA 4ELUA 5JXSA 3VR1A 3BGOP 2COLA 4IFYB 4EK2A 2W25A 2Z56B 1EAYC 1VQ4S 3CULA 4DX7A 1IJEB 3ONQA 4NOHA 3I0RB 3THTA 3UCZP 4ED2A 3AB2B 1N36J 4OLPA 5H9EJ 3OFHA 3DKDA 1UWBA 1ROFA 2OI2A 4BS2A 2PI4A 2QC3A 3U1NA 4ZMMA 3V6DA 4UUWA 4NMLA 4N56A 2V94A 1NKCA 3KTQA 4DS4A 3I82A 3W9IA 4B17A 2B5JA 3MCSA 4RL1A 4IOBA 4NLWA 2O5DA 5HBMA 5IQ6A 4UY85 2V69A 1HQEA 4HVZA 4OFZA 3MCMA 3QFHA 1QAYA 4CDIA 2E5IA 1U1LA 2FVPA 1NK9A 3VAIA 2KM8C 4QR2A 2RSQA 4NLXA 1WDTA 3RB3A 1E6VB 4JI6J 4Y00A 2ZITA 3K2YA 3F44A 4LQ3A 3G6VA 3GP9A 3H5UA 2XMWA 1S1VB 1JLBA 1N36F 1RAAB 4R0EA 1RK8A 3A8EA 2MPUA 3R3TA 3WIUA 4CCHA 1A7GE 2DITA 4RUAA 3I9ZA 4OQJA 3Q8VA 1FEHA 4I6WA 3OSNA 3TEHB 2UUCJ 2WSCC 5KG3A 4EBEA 4HACA 3M30A 1PYTA 3R2DJ 1X4BA 4F2RA 1T0TV 4K2XA 1JLEB 4NLSA 4KY3A 1DAXA 2AHOB 3ISND 1GMWA 5SUHA 1YRUA 4ZITA 5FJ4A 3MI7X 5IC4B 2F40A 4JI6F 1VRQC 2QGFB 5A8RB 3W64A 2HIQA 4YMEA 3KLFA 2E5JA 2GVZB 5ETOA 5GAGI 4XIUA 1RHRB 2ZHBA 1VQ9S 2OEJA 1LK7A 3EPGA 3LAMA 3RTVA 4MAKA 1RTDB 2GO9A 1SBRA 3L9ZA 2DNQA 3V6JA 2GZOA 2VJUA 5MLCV 4DZDA 4AL5A 2UUCF 1JB0C 4CRJA 3NS6A 1OS5A 4TY8B 4U9RA 2YQ1A 3R5GA 2UUAJ 3OR1B 3KK1A 3U27A 4YFUA 1I1GA 3RAXA 4KPYA 4C8ZA 2AEJA 2HVEA 2ZBCA 5BJRA 1RTJA 1HBUA 1NK4A 2YQ3A 3I0SB 2XMVA 1WOSA 3QWPA 5KFHA 3NAIA 2OGUA 4OHXA 5KG2A 2EKNA 4C3MA 1WG5A 3MAAB 5CD4H 4UQTA 3NGUA 3Q8QB 1NJXA 4TYBA 4HYKA 1VQ7S 2MLZA 3TA2A 3BZQA 1FKPB 4PQAA 1HMVA 2Y0SD 3AA8A 1RHUB 5GADU 2BRLA 2QN6B 1Y11A 2QMWA 2FDNA 2UUAF 5F8JA 2YH1A 3CD6S 2RRNA 3FBEA 2R4FA 4ECRA 3KYLA 5KT2A 5E2QA 5DG8A 3DHXA 4NEZA 4QWDA 5GAGU 4A48A 2DY9A 3T6BA 2OAUA 2HLUA 4E98A 2DD8S 2AT1B 1Y5NB 3MCNA 3NCPA 2KH9A 2DGTA 4WKYA 1RBLA 4WYLA 3KUHA 5B09A 2GGPA 3PRBA 1LWXA 1U26A 4LVOP 2MKSA 3N5BA 5KFYA 2LXIA 2B43A 4NI2A 4FPIA 4H4MA 3HF5A 1S6OA 2M9KA 2CQ0A 3P3DA 5F8LA 5KT4A 5HROA 4WFYA 1YJTA 3SEOA 1GFWB 1JXVA 3NRBA 2OUGA 1GX5A 2Y1IA 3I5BA 2KTQA 2MZSA 4P75A 2YNGB 5IS2A 1X7VA 3H4DA 3FSIA 4ZHRA 1UKUA 5B7WA 3DU5A 4X62J 3MECA 3PW2A 1JLCB 5CCMA 4DR2J 5ETSA 4DV0J 1FRJA 1PJ6A 4P2XA 4ZVSB 3MPUB 1FRLA 2VQFJ 3OLBA 4NEYA 3FDSA 1RTIA 3HPOA 1YJVA 2IC3B 2OELA 1M1GA 4ZIVA 1JLGA 2MY7A 3TA0A 5U47A 3POTB 4DSIA 1RWMB 4ED7A 3MM9A 1SUQB 1V3RA 1NZ8A 5JUMA 2EKYA 1FTRA 2IFXA 1WD6A 1HKAA 2APOA 1U47A 3PHTA 2YKMB 4A8YA 2QT7A 4BWJA 4X62F 4B3OB 3GIJA 4RNFA 1LWEB 2ZHAA 4DR2F 4DV0F 3ZNUA 2LQJA 4WPAA 2PFDA 3MCOA 2RRAA 1OY8A 3EE3A 3CCVS 1JQGA 1WF1A 3E01B 3T1HJ 1HWJA 1KVIA 2HNYA 3KLHB 4Y6IA 2J0WA 3EZ5A 3NOGA 1XNRJ 4NYPA 3E3XA 3SMZA 4ZPWR 1TKTB 2CNOB 2R9LA 2NUHA 5A8KB 4ZJQA 1U45A 3BO4A 2J7WA 1TZ0A 2X1GA 5K8OA 1RCXB 1H74A 5J2PB 4FBTA 1RU1A 2A2CA 1VRUB 3IRXA 4CTAA 1FRKA 2PMZD 1T3OA 4NX9A 2UVRA 3FFIA 4DR7J 4RW6B 1M5OC 5A8WA 1O0PA 3T41A 2HS0A 3M9NB 3JYTA 3KJQB 1D09B 2F8MA 3T1HF 3DGPA 1RGVA 1VJQA 3Q23A 2QYCA 2ADBA 1RWPB 5K5MA 1XNRF 3O3LA 2G4BA 2KZZA 3KLIB 1K0VA 1WC3A 2ILYA 1W2BR 5AXLA 4ZCMA 2EI5A 1F2GA 1YBTA 2V68A 4DV7F 1RAHB 2BMBA 4USMA 2XC9A 3WDOA 1F60B 2HBZB 3WHIA 1BXNA 4XTTA 1N5TA 4N5SA 3DM2A 1OSCA 3TX0A 2LA4A 1FJ7A 3FEYB 2M4MA 4NA2A 2XMKA 5E3CA 3DHWC 1PILA 4EYHB 2XHCA 5FIIA 3VVUA 3L09A 3A12A 2WSEC 2L48A 4HDGA 5B0BA 1R8HA 3D67A 2UXCJ 2DBBA 9RUBA 2BKNA 4K4VA 3UN5A 5EWGA 1RAFB 1M0SA 1REVB 4WE1B 2OLWA 4KQZA 2I0XA 2IJFA 2RAQA 4ZCLA 1NLKL 3QGPA 3HFVA 1SV5A 3NS5A 4N76A 4RO0A 4IH7A 1RDRA 2FHOB 5J2MA 1QAJA 3ITHB 4P9SA 2N3LA 5DRKA 2EFQA 1M90T 3HD2A 3NCRA 1Z2ZA 2CQ3A 5DDPC 4CYUB 2B9WA 3FCVA 2VONA 5KFLA 1TUVA 1SKWA 2M7SA 3EGWB 4GKJF 1FI4A 2MHEA 2UXCF 2RH3A 4FVMA 1IR2A 4K4UA 2DO4A 1DTQA 2XULA 1C1CA 1T05B 1VQYA 3FNNA 2A18A 3IFEA 2B7BB 3CCSS 5HP1A 3KK3B 2RDJA 4C3KA 3BV8A 3UVJB 4JV5J 3UNYA 2QLXA 1U1NA 2HZAA 1FJGF 1KOOA 1R89A 2C2OB 4ID5B 3FMWA 1FD2A 2VFVA 3CCES 2WW8A 3CCZA 1T8EA 2G2OA 2GVDB 4ID8A 4S0MA 2L08A 2DCUB 3GYNA 3CC7S 4ANCA 2KRBA 3QSIA 3IWXA 1UFWA 3P96A 3SSRA 5T41A 3QYYA 2CJ9A 3FBCA 2XG8A 1RAIB 2WBMA 4NLUA 5KG6A 2BZ2A 4I64A 5HSPA 4JV5F 2AYGA 1WWHA 4OYIA 1VGYA 1FDAA 4ES1A 3I56S 4QBUA 2CQHA 3PW0A 2YKPA 2CNNB 1K9MT 1X0FA 3OQ2A 4WFXA 5E41A 3GYGA 3HDSA 1FKAF 5E0OA 3T5KA 3HJVA 2W8KA 3L7PA 2UUWA 2C2NA 3SDEB 4NZ7A 1DURA 4H4KA 1NNDA 5F9LA 4DPYA 3N28A 4C8MA 4ECSA 1IKVA 5A6PA 5HVFA 4XDDA 3IRWP 1RT7A 1RQ0A 3Q8SB 3U1LA 2KHCA 5DGAA 2LLZA 1QM9A 1FFSB 5FDLA 3CCUS 4ED0A 1W2IA 2CRLA 3N6MA 2HVDA 4A8FA 5D6GA 2ZDPA 1VHIA 5I3QA 4YHHJ 3C2PA 4P74A 3THPA 3VHQA 3N6LA 2MJUA 4WXWA 3A13A 4E2FB 4USWA 4CI0B 2F9JA 4Q45A 4F26A 1SJ4P 5DGBA 2UP1A 3PEHA 3IBCB 4G1QA 4RX6A 4X66J 4F4YA 3TAQA 1BQNB 2XSFA 2B7CB 5DQGA 2RD5C 2YWGA 5KFEA 2HGLA 3J7AN 4L76A 5J2NB 1S48A 2BE2A 2H9ZA 1QTNB 5GMEA 3UR3C 3KJFB 1NPPA 5GAEU 3JSBA 4F4KA 3W5YA 2ZE2B 3J80U 3FSYA 3DLEB 2J9EA 2B8PA 2OPPB 4YHHF 3PKMA 3PNIA 4DX8H 2R7XA 4LR9A 2BM1A 3RAQA 1RUSA 1S1TA 2JSXA 2MTLA 5IV3A 2YX7A 1HPZA 5J1PA 3J7Z5 3H5SA 4Y2KA 4WIIA 4X66F 2JX2A 4F2SA 4WJBA 2F8HA 3PR5B 4Y2MA 2VG5A 3GB0A 4O3QA 4FYVB 4MT1A 1YSJA 5T7LB 2DIVA 2R8GA 1RBAA 2A3JA 1VDHA 4J9SA 1RT2A 1IBCB 4Q8EA 3DNCA 3T19A 2HGNA 3QJPA 3IAM9 5D0GA 2Z30B 1PG5B 3K5LA 2DCLA 4ED1A 3QLHA 3MM5A 3D7SB 2AU0A 1XNQJ 2Q43A 1T03A 2KG0A 3C16B 3H40A 1HBNB 3BPSP 4I7FB 2FLLA 4IFVA 1L3TA 2IBOA 2GS8A 4K4WA 5AT1B 1VIOA 2HQFA 3CVKA 8RUCA 3AY0A 2P9GA 5JMNA 2B56A 4RW8B 4FXVA 4LRCA 3HT0A 4RBUA 4DXLA 3VGSA 2W2NP 2HNZB 3PACA 2PGCA 6FD1A 2P2CB 2DRDA 3DRRA 3QGGA 1XNQF 3UPFA 4ICLB 2XLKA 2W9BB 5IFMA 1QJHA 4PUOB 3K59A 1NDKA 3CMES 3DLKA 2D1CA 4ALZA 1PAUB 1NJYA 4WZQA 3M2UA 4LF5J 2GAHC 2N7CA 1U2FA 3R5AA 3AT1B 4ZCKA 3L7OA 1SVDA 1IQZA 1QLNA 2EK6A 4KO0B 2FGOA 2JLGA 2FYXA 4YB6A 1UEVA 2RMLA 3WZ0A 4I0WA 2KJWA 1EARA 5C24B 4K0KJ 3TVZA 1VQNS 3T1YJ 2RS8A 4A8MP 4MMOA 5L39A 4NLQA 3KLVA 2HLTA 3TWZA 3KDNA 4UF4A 2ZNYA 3T3FA 4YB1P 4LF2A 1FK9A 2W9AA 4ZK7M 1RWOB 2ZZNA 1VRTA 1G3OA 2HHQA 2M8DB 3PG9A 2JC0A 2VODA 3NWRA 4OI3A 4LF5F 4AUKA 3BGRB 2QZ8A 4C3LA 3PEJA 1R8AA 1SPBP 1IM4A 5HO4A 4P2SA 2RUSA 4F25A 3L4BC 1OMSA 3BGUA 2RS2A 4HT7A 4K0KF 2W01A 2VPWB 4KFBB 3T1YF 4WP9A 3M6VA 4ILLA 1UMJA 2FJVA 3D6FB 5J2QB 1CQNA 2JJ4D 5EN1A 1Q4RA 1YJUA 2ZBRA 3IWNC 5L1IA 5B0AA 3V81B 2I5JA 1HNIB 4ZJLA 4O44A 2B9XA 5BYRA 5GAHU 4PEOA 3OL9A 4DR5J 4U6PA 1U49A 4GC7A 1MU2A 4CH0S 1TV6A 1SC3B 1UA0A 2FLOA 3E51A 4RNNA 2Z2YB 3EJMA 4WU3A 5HVGA 1BWVA 4ZLPA 4PKDB 2FJWA 1QSLA 2WW4A 4KHRA 1NDCA 4RWXA 4BCAA 2BQ3A 1FXRA 4B9VA 1WF2A 1KQGB 2C2MB 4W90B 3TJAA 4HI1A 1BWEA 4ZN3A 1ULRA 3DDNA 3UCGA 4J9RA 3MMCA 1N5YB 4DR5F 3DI6B 4OJGA 1AT1B 5CABA 3NS7B 3LALA 5D0EA 1L3SA 1U02A 3TAMA 4F0KA 5CQGA 2CNKB 1G6BA 2PN6A 3DYAA 4V1Ak 2KFYA 4PWDB 1S4FA 2IYIA 2DNHA 3OFGA 1VFJA 4FBUA 1KLMB 1WC4A 4MK7A 3CDBA 2RU9A 3H4BA 3BPDA 3OR2B 3LTOA 4B9TA 2FVCA 4FPRA 3DLLQ 3RUBL 4KB7A 4KR0B 4J5OA 3BN7A 4LF8J 4OV1A 3GJQB 4QWCA 1HYSB 5B0GA 1FNMA 1RZMA 3EVWA 2RQCA 3GV7B 5KG7A 2YQ0A 3HSDA 2LEBA 2KL8A 4YR3A 2ZD1B 1CJUB 1FFWB 1TK8A 4WFBQ 1WC1A 5I4MA 1L3UA 3LO3A 3D2WA 4NLDA 1N6QB 1U09A 1V9OA 3OBIA 4KT0C 2XGPA 4A8KA 3HO1A 1T9YA 4Y34A 1VQ8S 3G4SS 3D4JA 1SJ1A 2QFJA 4OZ3A 4FDFA 2JL9A 2V50A 3UFCX 5D3GB 2CKWA 3R6GB 2FVQA 3D54A 3QIPA 3SQGB 6AT1B 1U6ZA 4RR5A 5KT3A 4K4SA 3DRSB 2JEJA 1LEOA 4LF8F 1NB2A 3B4MA 4RW7B 3G6XA 1HW8A 2Z4PA 3EWGA 5CHCB 4XK8C 3W62A 2AX0A 3D6TB 2W24A 4MYUA 1RAGB 1HBOA 1ZS6A 3GLJA 2Q3PA 2KG1A 1HIYA 1M5KC 2YKQA 5DM6Q 1JLQB 2EFVA 4C48A 1Q5YA 4OI2A 2OKQA 4EGLA 3D1OA 2ASDA 2LMIA 4EFAC 4USHA 2V2KA 3QJJA 2YKNA 2XQCA 5I3UA 4FKYA 4USTA 4G65A 2PIIA 3KJVA 1IKWA 4MIAA 1DFDA 4IQMA 4IG0B 4RW9B 5KG4A 3JAMY 4LSLB 3BQ1A 3K17A 1MWYA 1S9EA 5E7OB 3IWLA 4F7VA 4USIA 4K2JA 2AGOA 2E5GA 3TVYA 3HVAA 1G7CB 1FKOB 1LK5A 2HQIA 2HAIA 2VPYB 1LWCA 1FTCA 3M8SA 5E3RA 2GA7A 2W1BA 1WEYA 3R9LA 3CDWA 2DVIA 2HQGA 2VQEF 3QT7A 2JRSA 1DTTA 3WBZA 3GWCA 3KHRA 1X9WA 4KHMA 1HA1A 2MGZB 3OUYA 4C8LA 2B6AB 4ATNA 3N5FA 4E8UA 4C8OA 4WIQA 2MY8A 3IG1B 4YB5A 4U8YA 2WZ1A 3QAUA 5EHHA 3MM8B 5C2GA 3CJ3A 1BGXT 4Q0BB 4PYAA 4DL6A 3HULA 1P27B 2WK4A 2AIRB 4CO3A 5L1KA 4LREA 3C19A 2NZCA 1KHWA 3BSNA 5HI7A 3LW5C 4HT5A 3EDRB 1VK3A 4OMFG 2AQ4A 4KIAA 3Q8UA 2R8KA 1BQMB 1G2EA 2ZOGA 4LR7A 4CQ1A 2V4JB 1U8WA 1HNVB 3T9NA 2B4OA 4IQXA 1DQAA 2IMWP 3PX4A 2CG8A 1R6YA 4JI0J 1AA1B 1U0HB 4MFBA 2U2FA 2W8LA 2GIRA 1VI7A 2XI2A 2YNHB 2RF2B 3LH2S 3D6HB 4AL6A 5L8RC 2KT5A 4N41A 3OL7A 5A0YB 3MHYA 2Z0GA 3CEDA 3I4PA 4MIBA 1NU4A 3PYGA 4G1IA 2LQ8A 4WXOA 2BW7A 4JI1J 5KT7A 4TY9A 4BHQA 3KJNB 3KMSA 4DL4A 3A1YG 4JBCA 3OXFA 1WACA 1KQFB 1UWBB 1VQLS 2HHHJ 4G1PA 4DPUA 4I56A 4EO8A 1IBKJ 2M52A 5HLFA 3EZOA 3ILOA 2BACA 1MSWD 4YDDB 1QDUB 4JI0F 2LU1A 4Z2XA 1APSA 1SL0A 2G1DA 3A8IA 1U1QA 5HBMB 5DETA 3EVOA 1LXJA 1QE1A 4PG6A 1KS2A 5KAKA 2I2YA 2HRTA 4JI3J 3PX6A 2D74B 2CNLB 2CQGA 2UV8G 1MN7A 2IHR1 5HQMA 1T9TA 3F0NA 5J1EA 2J8AA 2DB1A 3PJ9A 4JI1F 2JLEA 1WORA 2AX1A 1GX6A 2IRYA 3WX8A 3BO3A 4C11A 2FLPA 3SV4A 3PV8A 1JLBB 1VS3A 5KG1A 3RAMA 2HHHF 3KG4A 1IBKF 4K7QA 5ETKA 8ATCB 2UV8A 5GMDA 4M5JA 3U02A 2V34A 3PIOQ 1WNEA 1Q7LB 3M32A 3CCQS 2D41A 2B4VA 2HGMA 1UVJA 2G13A 1X8DA 2CADA 3W2WB 4RUBA 3JXOA 1YK9A 3DRYA 2XY6A 3IS9B 2L3MA 4HACB 3M30B 4WP3A 3AOAA 3BR8A 4EUVA 2LEAA 2MZRA 3H2VE 4JI3F 1MNEA 2DEIA 3KLGA 1LQ9A 2KRRA 1OO0B 2XNRA 1GH8A 3EMTA 1R7IA 5KFDA 1H0HB 2FZCB 3GCWP 1KBRA 1HHSA 2GC8A 1IKYA 1F3FA 3KLFB 2QA2A 4OX7A 2RVJA 3R7BB 1FA0A 4X4RA 1NO8A 3UDEA 3IGVA 3K8VA 1D9FA 3HHKA 2XCAA 2MKIA 4LFCJ 1WDDA 3JTNA 4BDPA 3NNAA 5EX0A 2J9DE 1S0NA 1SH0A 3DLBA 2MDAA 3OHAA 3HD1A 5LSOA 4KC5A 1JKHA 4FP9A 4DX5A 2Z2ZA 3V5RA 4ZLNA 5K14A 1EX8A 4M94A 4ECXA 2OMOA 1R8BA 3I87A 1WHVA 4F36A 4F3OA 3MEGB 4FF3A 1HBUB 2D3ZA 2MJNA 1PJ5A 1X60A 1B7YB 4DV4J 1JK9B 2KVQE 1HFEL 3B82A 1RT5B 5KFNA 1HNWJ 3VGTA 4QYZK 3DDKA 1H7WA 3FVYA 3P4UB 3T9ZA 2KT2A 2BQRA 1T9UA 3AB4B 3B6BA 1VBYA 4DN0A 4DHVA 2MQOA 5G0RA 3GFXA 1HMVB 1CBKA 3SSSA 3W3SA 4LR8A 3OL6A 1EP4B 1PAEX 2GMLA 5KFRA 4RW4A 1Q8IA 2Q66A 1YHQS 4R8UA 4ECZA 2BBEA 1Z1ZA 4QIEA 1RHMB 1B3TA 3FKBA 2CA9A 1RHJB 2QO3A 2WOMA 3BYPA 4U7UK 2GV1A 2K1RA 2W7PA 3PY8A 4C8KA 2JFKA 1FX2A 4M5GA 4LMZA 4IRKA 2XY5A 3SCIE 5IOLA 4MKVA 4IFYA 4F3QA 2FVRA 2GGPB 3M8QB 4ED4A 1HQ2A 2YNFB 4HKQA 2B4UA 2C28A 1HARA 2XZDB 1HHTP 4NI2B 1IM6A 2VF3A 2ZH2A 2V9KA 1XC9A 4LF6J 2FD2A 3FCWA 3LANA 3CXCR 1RU2A 5HROB 2OMLA 1OWXA 3D5MA 4NCBA 3Q24A 4B9NA 2QV6A 5I42A 1Q8BA 4ITSA 3RR8A 4LF4J 4OJHA 4ZHRB 4YUDA 4QPTA 3G87A 1U6FA 2EEYA 2L41A 4ECWA 1XR5A 2DO0A 1C0UA 1UETA 1WC0A 4ZJOA 3MR7A 2DGQA 1RTIB 4YR2A 4N8OA 1JWWA 2E1PA 1E6VA 2E7WA 2V67A 2ZH3A 1N88A 2DTJA 3ZZRA 1XIQA 4LF6F 2YTCA 3CCLS 5DM7Q 1QY7A 1XR6A 1X4GA 4RJVA 3KUEA 3VAKA 2DKOB 1BHNA 4XPCA 3U7JA 5F3TA 4L75A 2YWHA 4LUBA 1VQ5S 4QYZJ 4RU2A 3UQSA 1NSPA 1RE1B 3FK4A 4WFZA 1B0PA 2YWWA 1FD8A 1L5UA 2OFGX 1KOHA 2CVIA 1JLEA 3VV2B 2MZJA 1RACB 3MM7A 2BJDA 3QPIA 1RT1A 2HZVA 2KFNA 1Y5IB 2AYEA 4WF9Q 3O44A 4M63A 4F3MA 4J37A 4CP5A 1ZA1B 2E66A 3HKZD 5HVHA 1DARA 2W2QP 4ECUA 3DRXA 2POKA 2K8GA 3QMQA 4B3TJ 5B0EA 3NGTA 4MIWA 1B4SA 3EPIA 4EMDA 2GO8A 4OYXA 3GV8B 4J9UE 3IRXB 2ATCB 3S7RA 1V5IB 5A8WB 2Y1JA 1Y5LB 3KNGA 3PYFA 1BUXA 1MLAA 1OJ4A 1FVSA 1KKHA 5DQIA 2WONA 2D9PA 3GIMA 1WHYA 2G0JA 1VBXA 3I0SA 3AOBA 3NMRA 4Q2LA 3NLCA 1XERA 1R3NA 5HQLA 3MOJB 4B3TF 1NK5A 3D3CJ 2OJ3A 4KHPJ 4K4TA 2W4DA 5GVQA 2UVVA 2C2EA 5IV4A 1RWXB 2W2OP 1HLWA 3TUJC 2YKAA 3TO8A 2Q79A 4LVNP 2NREA 4UY8T 5CYMA 2Z58B 5IXUA 1SL2A 1V6HA 2ZEJA 2IRUA 3M6UA 2BJ8A 1X4CA 4RU9A 1CJVB 1KFSA 1S59A 3QSYB 4CZCA 1UWAA 5D0RA 2HMIA 3CPWR 1S6QA 2A1BA 2DXEA 4FYDA 3LF0A 2AWZA 4KKOA 3AODA 1X9MA 3C8YA 4ZPAA 4EYIB 4Q44A 3MZIA 4KHPF 1ACMB 3I6PA 2EK1A 3D9BA 5C7PA 4C8YA 1AXQA 2DXDA 1SV5B 2EBEA 2BDPA 4MK8A 2FTRA 3ZZZA 2WB4A 2CQ2A 2I6WA 2V6AA 1I6JA 2YNGA 3H90A 2DNPA 2RHQB 2R8HA 4ZP7A 3BKUA 1UEKA 2BANA 3TUIC 4DLEA 4USUA 1NSQA 1YKWA 3MMBA 2MMYA 3GZ7A 2GFFA 1CG2A 3BSCA 3W2VA 2AZ3A 1H98A 2AJ0A 1QUVA 1U2CA 2E9RX 1QAIA 5HP1B 2YNIA 1RAJA 4J9MA 3VAHA 1VR6A 4NMXA 1V3ZA 2K7JA 1XN9A 2H5EA 3GILA 4YP3A 3GTYX 4F4XA 1EZZB 1Z2LA 2E1AA 1RAEB 1RABB 4PCQA 1A6LA 1PC5A 1AFJA 3WIVA 3PXGa 4JB8B 2A2DA 5IT0A 2YKMA 3L3CA 5B0DA 1AYEA 2C3MA 1UJ5A 1RSCA 2CWKA 4AXJA 2X7IA 2OD6A 1T7PA 3C15A 2XYPB 3W7BA 2HPUA 2VZ9A 3MPWA 3TOQA 3DXSX 3E01A 1HI0P 3KDOA 3QT5A 4DR3J 1YJNS 2FY8A 2ALZA 1F1BB 3KMQA 1TKTA 2J0QD 2EFNA 4JI5J 3MOZA 2CG4A 4OYOA 3WQPA 1DZ5A 5J2PA 3KXDA 2M0GB 2ZOMA 5EWEA 2Q6CA 1B70B 2CQ1A 1FO1A 2KXFA 4YR0A 4LSNA 5AJ3J 1T02A 5DLGA 1TTHB 4QW8A 2PDAA 4IG3B 1RWKB 3CJKA 2O01C 1IKVB 5E3PA 4D3GA 2MQMA 3QT6A 3H2UB 4HEA9 3GPAA 3A4TA 4L6V3 4DR3F 4TNOA 3GFZA 3EZUA 5HMXA 2OPQA 4ZVPB 4PG8A 1FFGB 2F63A 1ZM3A 2DNRA 4JI5F 5FDLB 3AOCA 3BKFA 1TUWA 4ZPTR 4FZVA 4Q43A 1NDLA 4F0HA 4IH6A 3DLGB 2ZH6A 2QMXA 4O0IA 3R1LA 1YZ6A 4OZ0A 2V4RA 4BWMA 2DNYA 2FZGB 1XTZA 4OZ5A 4X4UA 5DDRC 5AJ3F 1RCOB 2XMJA 3QNWB 1TU0B 4YOEA 2K3IA 3CDEA 3EYZA 2ROPA 1EETB 3HHLC 3AD7C 5C25A 5HANA 4G1QB 2M5YA 4KE5A 2V2VA 4Z7YA 4KBIA 4F4AA 2ZWPA 3Q86A 2UXBJ 1YZ7A 4FXDA 2BR0A 4WU2A 2BE2B 4QQBA 2XHWA 3PZPA 2PI5A 4ZA1A 2WAQD 2DK2A 4WE1A 3HVRA 1K1QA 3G82A 4CM0A 3W5ZA 4ES3A 3ITHA 3HHDA 1TL1A 1I51B 2JVOA 2C3UA 4JP8A 1VYAA 4NL5A 1S1TB 1IBLJ 4HTJA 3SFUA 1U6BA 4DLGA 3TUPA 4DQPA 7FDRA 2H5IB 4CYUA 2CPXA 4DJBA 1ZAWA 1ICEB 1NAQA 5CD4A 2WHOA 3RYLA 4CWBA 2XS5A 4FYWB 2VG5B 2IM0A 9ATCB 2WVDA 2UXBF 4LFAJ 5HJYA 3LP2A 5KFVA 4C9DA 4DPWA 2CDRB 1M5PC 1VLYA 4ED8A 1T05A 1RT2B 3KWMA 3B54A 4PQUA 2Z2MA 2ZNZA 3IA0A 5F8HA 1V5VA 2D69A 1TFWA 3KK3A 4FXWA 3UVJA 2L9DA 2QL9B 3TZXA 2W2PP 2IPOB 2IVYA 2V8PA 2FGCA 3M05A 1IBLF 1T03B 3AXKA 2DGVA 4CT8A 4O3PA 4DU8A 3MUVP 2R7SA 3H5YA 5CYJA 1UW9A 1HNXJ 5DJBA 2J8SA 2XS7A 2CJQA 1FEEA 2FHMA 4LFAF 4IFVB 4LRAA 4B9UA 5K8MA 3R5CA 2IJRA 1RB0A 2CPDA 3BR9A 3M8RA 1YJ7A 2LEPA 1RP5A 4ZP6A 2QLJB 1GXTA 2WTFA 3KHGA 2KJVA 4OI1A 1LW0A 1FRXA 5GADI 1KQSR 3OV7A 2JEFA 5DDQC 1CULA 4DR1J 4QIGA 4Y65A 2QSWA 3K89A 3GMGA 1UPPA 4QZVB 4FF4A 3U1MA 5G4DA 1NBEB 1R8PA 2ZH5A 4L3KA 3G9CA 3TP2A 3PJWA 2VFSA 4RBTA 3HZGA 4A4JA 1CJTB 3DLKB 1DLOA 4PXCA 4OYWA 1GAOA 2OHDA 1HNXF 5LL6d 2OPRA 3SDEA 2X1BA 1D8ZA 2HK2A 2Y0BB 3HSJA 3BKTA 4CLTA 4ED5A 2KFZA 2VJVA 2OTJS 1O5JA 3CJRA 2F4VF 4DN9A 1TKXB 4DR1F 1WOPA 2XI3A 5H1SV 5E3QA 4CNZA 2KO1A 4OYZA 3N01A 2BJ3A 4N47A 4QJVA 3LWLA 4ZIWA 3BDPA 5HMYA 5D8HB 2HWIA 1FK9B 1BD6A 3IO1A 4A8XA 2W4PA 1T94A 2VH7A 3V6KA 1VRTB 3MMAA 2OTLS 1YBAA 1ZZFA 3CJ8A 1CS4A 1P9YA 1A9NB 2VDIA 4DX6A 1PO6A 1QVFR 1NK6A 1SQGA 2BE9B 2XS2A 4ZVTB 4GO5X 1HQUA 3SV3A 1D0EA 3LPEA 1JJHA 1TMMA 4OZ2A 1Y9OA 2P8IA 4C0HA 4DUYF 1CJKA 5J2NA 3ZTPA 1K8AT 2NSBA 3PRVA 2FHKA 4AT1B 2IDEA 1UZDA 3DLEA 2CJYB 4BLGA 1MG7A 2VUGA 2I5JB 1S10A 3BBCA 4O44B 4TVAB 1LXNA 4TYAA 5D0HA 2AV5A 1CQMA 1AUSL 2EFOA 2Z8QA 3VAGA 1TL4A 5CXTA 5F0WA 3OFEA 4QW9A 1NM2A 1MU2B 5ETTA 1TV6B 1IXKA 1MWQA 2DHSA 1LFPA 2FB0A 1H2UX 2ZM6J 2KVIA 4DFJA 3OXLA 2KXHA 3DLJA 1C0TA 5HMWA 4DL3A 2LDIA 2C2ZB 4KGMA 3DOKA 2GNKA 2OH2A 1KHVA 3R7SB 1S6PA 5T7LA 1S0OA 4A46A 1UVIA 1S1WA 2HG4A 3TZZA 2LFVA 4CO5A 5CA5A 2F4FA 5M2PA 4QIVA 2HQDA 1GMUA 1IR1A 2E1RA 1VBKA 4ZPDA 2KXNB 2WCXA 4Y2IA 8AT1B 3AJ1A 2VDHA 3C16A 3FQLA 3TAMB 1TK5A 3MEEB 3EM1A 2FQQB 2ZM6F 3VCDA 3VAJA 1HBNA 2HNDB 4QR1A 3GIKA 1FT8A 2R7OA 1WHWA 3EXCX 4B08A 4KJIA 2XB2D 2J9CA 5H9FK 3IM9A 3NAHA 4Q7AA 3W66A 3RB0A 3QRPA 2GJ2A 2AJ1A 2R42A 3TW0A 1CPZA 1RI7A 3TQ1A 2ZJRQ 5KFGA 2ASJA 3NGSA 4M5DA 2FPHX 4ZP8A 5EGYA 5D4LA 3PFEA 5D78A 3R2CJ 2PFFB 2HNZA 3FJ2A 3PYEA 5AXMA 3VF0B 3OTBA 1MROA 1HW9A 3UNGC 4DS5A 5KOXA 4DV6J 1K1SA 2FJDB 2VD3A 4WKRA 1Y3JA 3GG0A 1ZPVA 1JNRB 3G6YA 2HVHA 1WG4A 1CVJA 5LT5A 4B3RJ 1HBMA 1J27A 4CLZA 4ER8A 3Q8RB 1AZSB 1WF0A 2I38A 1GNKA 4LIWA 3MR3A 3V4IA 4DV7J 5IQQA 3NBPA 3TNVA 2LP4A 2RQKA 2QA4G 4EU0A 2CQIA 4K5RA 4I68A 3MURP 2N4CA 4V19J 3GU0A 2VL1A 2MQLA 2RNEA 1YGYA 3GQCA 5C42A 3G96A 2SXLA 3QIPB 1FXDA 1HWUA 5C24A 2FY1A 5IC6B 2MZ1A 4DV6F 1OPIA 1SIZA 3CO9A 5F3ZA 3CIZA 2AYMA 5KFQA 5LMNJ 1DRZA 4C97A 3J7ZT 4ZPVR 1HHQA 4P52A 2MB0B 2VA3A 5DO2A 4U67Q 3NGDA 2IBKA 4B3RF 2HS4A 1D9AA 3SQOP 2F7VA 3WX4A 5F41A 3OLAA 4A47A 2AMCB 2R7RA 3HVTA 1R0CB 1HD0A 3DOMB 3UI3A 1N56A 3TZWA 5ADZA 4ES2A 4IR9A 1JLFA 2YKNB 1F9EB 3IBWA 3OVSA 2Y3YA 3BGFA 3KJVB 3TVKA 3VQTA 1S79A 2WVFA 4YN3B 3M1VA 1Q79A 1NHVA 2EFGA 1MMNA 2W9CA 2P9EA 3RW7A 4KFBA 2XWXA 5F8IA 4OHVA 1S5ZA 4YB7A 4TQRA 3O5TB 2CVEA 1LWCB 3AXMA 5H9FJ 5LMNF 5DQHA 3IBFB 3W5XA 4DMZA 2ZZMA 3OSPA 3RZAA 2HYIB 3V81A 4W98A 2MXYA 4GKJJ 1EIYB 1IR0A 1HNIA 3GFHA 3HCXA 4J90A 3M8PB 1RTHB 4IUFA 3CC2S 1N54B 3OUYB 2KB2A 1S76D 1FHTA 2GQCA 2QG9B 3MD1A 3NCQA 4HHUA 4O4GB 1FJGJ 2V5HG 1S72S 4DPXA 4DF4A 4DUZF 3HLUA 2H4WB 1RBOB 3R97A 1X5TA 2VV5A 1D8YA 1T95A 2DPIA 4DSKA 2ZH8A 2VG6A 3W60A 4EBDA 2RKIB 5D15A 4CO4A 3HT3A 2QMUB 3FZBA 3M7VA 3BM7A 2DNLA 1UZHA 4J91A 1N5VA 1N5YA 2Y8WA 2AP6A 3KKFA 1PKUA 1NXIA 3V6HA 2V8GA 1TVRB 4MFBB 1Q53A 1OYDA 3ZTRA 1H6KX 2MKYA 1WC6A 4DL7A 2ZH4A 1FWLA 4JI2J 1J5EF 1T9VA 1D3WA 3EGZA 4DBQA 5KT6A 1S99A 2XSJB 1RLCL 2PEHA 1FRHA 1KLMA 3CJ2A 5CCLA 2R7TA 2BV3A 1Q81T 4CLLA 4YDXA 2LECA 2HSEB 1J2VA 4P73A 2D3O1 2LQ5A 2VFTA 3UDVA 2QFIA 1NDPA 4F0MA 4ZDNA 1U4BA 2AEMA 3P49B 4GKKF 2B3TB 4UZBA 4EEYA 3FEZA 3Q8PB 2VFRA 4EZ6A 3RGIA 2KYXA 3GFYA 3R5BA 2OO4A 5KFSA 4IH5A 1UEUA 2DPJA 4DI6A 1GXUA 4X2BA 1QE1B 2O67A 4JI2F 1FESA 3PO5A 1N6QA 4KRWA 4ILMA 3GE9A 5KFTA 2IA6A 2DJWA 5GAEI 4USKA 1U8SA 5EUHA 2QJ3A 5J1EB 4NLRA 2MSSA 1SH2A 4E0DA 1SC4B 4WYWA 4AE5A 2KM8B 4PR6A 1NRKA 4QR0A 4C11B 4Y2CA 3I31A 3PKYA 3NY0A 3SQGA 3IR7B 3DRSA 2BXJA 1D1UA 2XZTB 3IC1A 4CO0A 2U1AA 3DCAA 4A8QA 4RW7A 3F56A 1IKXA 1U1PA 3H42A 1I5OB 1URNA 4ZVHA 3IN5A 3D66A 4Y28C 3BGLA 2ZJQQ 1U25A 4IOAQ 3M2VA 2NPFA 3OXGA 4LBHA 3KLGB 2QEXS 1VC5A 4PXDA 2E9TA 5DG9A 5F0UA 3ENWA 1M5VC 2YVSA 1AW0A 4HI2A 2C22A 3LAKA 2X3DA 2PO4A 4RW9A 3K7RA 4LSLA 4MKYA 2QL5B 4DQRA 2VKZG 5HL7Q 3CSKA 3LP1A 4MJKA 1RXOB 1TP7A 1UCNA 5LMUJ 1FKOA 3FSXA 1NK7A 4MKAA 3EICA 3PYDA 1X0PA 5A76A 1JKHB 2BOAA 4FKXA 1WI8A 3ICLA 4TQSA 3CC4S 2XZWA 2BA9A 2CJBA 1AROP 5I3PA 1SC6A 3KFWX 4YY3F 2B6AA 3D1QA 4TU7A 4OX6A 5KFXA 3C3LA 1SXLA 4OZ1A 4ELVA 1SI9A 4F04B 1H2VZ 4NYOA 4F67A 1WSRA 2J7UA 1J5OB 1SJQA 1JXLA 2CZ4A 3BSOA 3CO0P 5HK4A 4ZVEA 1HI8A 1H73A 3R8YA 5LMUF 4NLTA 1MMDA 5G0RB 1BQMA 3A3OB 1EHWA 1XWLA 1HR0J 2E29A 1RWWB 1WKJA 4WBFA 4B3MF 3FRZA 1N52B 4I2PA 1JNZB 2LYVA 4XDCA 4PRFA 3NP5A 4OI4A 2ABYA 4R8UB 3NOCA 3CCRS 1S97A 3JSRA 3H7HB 4IO9Q 2WOMB 4EI2A 1YLXA 1HL6A 5L1JA 1RHQB 4TU9A 2K1RB 4UOCA 2ZWOA 2XLIA 1N34J 2DR9A 4FNIA 3CMQA 1WJ9A 3CD7A 1K47A 2CJKA 2JLFA 2AF6A 2CPFA 5DZ7A 3V2UC 1HR0F 1WUUA 2L9NA 3BDEA 4OHZA 3SI8A 3LGNA 1E6YA 3CD5A 1WHXA 3B8HA 3C14A 4DF8A 3TANA 4KH1B 1QAXA 3DGVA 2FJEB 5LOQA 2B4PA 1OPZA 4FVCA 5I42B 3S01A 4DDFA 2CWXA 1ZTTA 1X5PA 4NXNJ 1KDNA 3MTKA 2G2ZA 3HX9A 1IBMJ 1TL5A 4C0BA 3PO4A 5ETPA 2DGSA 2AKWB 1N34F 3SSQA 1C0UB 5ETRA 1Q1KA 5E5NA 1VQMS 3HHNB 3R27A 3TEGA 1SJ3P 3IR6B 3KHLA 4OYMA 1T3NA 4ED3A 2AJQA 3BBFA 2MKHA 1WI6A 3VTIA 1CEZA 4DR4J 4DCOB 1VK8A 1SKSA 3PDNA 5GAHI 3C6TB 5IT9Y 3EXYA 3AA9A 1TMJA 3MGJA 3ET6A 2CPIA 5KFOA 4C8NA 5AXKA 2QSFA 1W25A 1KVKA 2BKPA 3M2RB 4JV0A 3FUYA 1F0XA 5B0CA 4JUZA 3W2WA 4NXNF 2YPZA 2NUUG 3IAS9 1FRIA 1IBMF 3IS9A 4NA3A 3D0IE 3BQ2A 1WSVA 3ADAC 4DCPB 2IDLA 2RQMA 4DOZA 3MM7B 1VMBA 1RT1B 1RAOA 4QU6A 3H25A 1RT4A 4O3OA 3I32A 1KFDA 2RHSB 1RADB 4DR4F 3PFOA 5K20B 5D4OA 1SCJB 1XMOJ 3W1YC 3J7YI 2Y8YA 1VQ6S 4IKAA 5IZHA 2MLXA 2DR6A 2EXUA 4QU7A 3J81j 3QO9A 4M5KA 4LRDA 1WKKA 2G1HA 3G86A 2UUTA 2EWHA 1YI2S 1OSDA 3RJMB 4HR2A 3HHEA 1VQPS 4Y3CA 4UOGA 4CLKA 1WC5A 1AUDA 4CO1A 4YQWA 3BEGB 1YTYA 3D3BJ 3IR5B 3MEGA 3BH7B 2WONB 4FF2A 5KOWA 1B99A 1NUEA 2BEFA 2Y1LB 3MD3A 2FC9A 4LF1A 5CYQA 2AW0A 3L7UA 5B0FA 4ZN1A 3D68A 1XMOF 1SIWB 1RT5A 3HHLD 1RWUA 1BQXA 2NCKL 4CM2A 4KV8A 5L46A 4DL0C 2J6SA 4CIOA 4DFPA 4RUHA 1R0BG 4CH1A 4LJMA 1QSSA 5M2RA 3GYXB 2LCWA 2DR7A 2QX0A 1DBDA 3R5JB 3DC2A 1EP4A 5CYMB 3KK2A 4NLOA 2QLBB 1JX4A 2WBRA 4OZLA 4LBPA 4DSFA 1S7IA 2QTWA 2HHVA 1O6XA 2E5LJ 4PG7A 2ROEA 4CT9A 2ZKUA 2HMIB 1S6QB 3R7NB 2CPJA 2IAJA 4NLPA 5HJXA 4KKOB 3IP0A 1UA1A 4RPFA 3J7YU 1KRPA 3BBBA 2AJ2A 2HK3A 4URGA 4OX8A 2R2SA 4BC7A 4EO6A 5KFWA 2ZC3A 2OSQA 3M8QA 1K44A 4HTIA 3BF4A 2YNFA 2ZUGA 4W4MA 3ZZUA 3EGVA 4UUXA 1TL3A 2EC0A 1Q16B 2EC2A 2F8EX 2C3PA 2Y1RI 4IR1A 2W7OA 3RRGA 4I6AA 4XAKA 3PHEA 4IRDA 2XGQA 2JFDA 3O6QA 3MEDA 3W8PA 2D7SA 1TKZB 4RNOA 2H4YB 3W9JA 3TX8A 1HI1A 2BVZA 2JHEA 3MM6A 4X4VA 4U7UD 1S9FA 4LT6A 2W7AA 2E5LF 3MMJA 1R0AA 3K5NA 4FYYB 4ZVUB 2VBXA 1LW2A 3T5HA 2BANB 1UPMB 1RYSA 1FWKA 4WFNQ 2CPZA 4OZJA 1LWFB 1S4EA 3MMBB 3G6ES 3SCKE 3W2VB 1DJ0A 3TRGA 2FJBB 1NCLA 2ACMA 2XO7A 1K0TA 4C0OC 1VHFA 4NCAA 4QIWD 2YNIB 3HFKA 1JLAB 1C1BB 3JSMB 1KSPA 1RWVB 2DNMA 3SIPB 4WCEQ 4JV2A 4HH1A 4K4ZA 4F02A 1RHKB 3CIMA 2NYIA 5CZVA 2CZ9A 4Y0FA 4J9VA 2OEKA 4DG1B 4R25A 1YWXA 3BS9A 4PPZA 2YBVA 2AYBA 4NLGA 2NS1B 1NH8A 1EB0A 2HFVA 3OVAA 4DQIA 3MWBA 3C15B 4GVLA 2VQFF 2UU9J 2HHSA 3JQJA 2XEXA 1GEHA 2BJEA 4GVBA 2DGXA 1S1UA 3HSZA 3UD4P 5J1NA 1VISA 1OIAA 5MAOA 2BM0A 1VBZA 2C3OA 2GJIA 2VQEJ 4BC9A 2GHVC 4J7CA 1XEZA 1N0UA 2E5HA 1REGX 1DHMA 3RB6A 2IIHA 3DRPB 4MK9A 4UW2A 3CB4A 2M70A 3ILIA 4HHJA 3CDUA 3UE2A 2ZBIA 2MQ8A 3QT8A 3J80Y 2CQDA 3LUYA 1KTQA 2G2YA 2E44A 3FZ2A 1H72C 1Z4UA 2C2RA 4F4ZA 1NKBA 3K0JA 4KGVB 4BBYA 3OJUA 2EW9A 2CQ4A 2MKJA 3FEXB 3UCUP 1OQ6A 3LP0B 3KG1A 1UJ6A 4LSNB 5IWAJ 4EZ9A 2UU9F 4I2QA 1NZAA 2LXUA 1SL1A 3CJKB 1X4HA 3ZC4A 1UVNA 2GIFA 2MZTA 1N4LA 4DU7A 4IO1A 1MN9A 3SFGA 1RT3B 2YY3A 3C6UA 2B0GA 1WEZA 2GX8A 3AHPA 4M95A 3PCOB 3PX0A 5AXNA 5D77A 3A3PB 2OPQB 5FLXY 1XQIA 3OTCA 2OFHX 4B9LA 2VG7B 1FNXH 2ALYB 5IT9U 5DLFA 1IVZA 3R1HA 4B02A 3RW6A 2P6TA 2RRBA 3CDAA 1X5OA 4O0NA 4DR7F 1NMEB 2GQ2A 3CUNA 3ZFVA 1LFWA 5IWAF 2QE5A 2GHWA 1YX2A 4DV1J 1CJVA 4YEAA 1NJIT 2ERRA 4ZOSA 5C25B 1YG0A 4R5PB 1S9GA 1VQSA 3E2EA 2HWTA 4DV5J 5GMKa 4J9OA 3HHLA 3P6YC 3SBMA 2XMAA 1PGZA 2FUG9 3K57A 1PC4A 4MTPA 3RBDA 1XK8A 3VGVA 2JEIA 2YWKA 3R5DA 2VA2A 5ETQA 3Q2SC 1Q8LA 1RKJA 1ZPWX 3CJTA 2PMHA 2CAJA 1VJWA 2RB7A 2AZ1A 2NR0A 3DMJB 3GV5B 2RJZA 3G82B 3AQPA 3ZZPA 1IQTA 4OV6A 1TL1B 5LSLA 1FERA 2O1PA 4DV1F 3G8SA 1RT6A 2QL7B 4L73A 1Y4ZB 2VBYA 3D0GE 3TQEA 3CJQA 2J0XA 4DV5F 2V8DA 2KT3A 4LRBA 4DZ6A 3V6DB 2LQBA 3DU6A 1NK8A 5CAAA 1TR0A 5A2QY 3MTJA 1RLDA 2N82B 3LP2B 3P5TL 1S12A 2J5AA 2CZVC 2B5JB 3RBEA 4CLPA 5IM0A 3FQKA 1KR4A 1U2RA 4ILRA 3DFEA 4PQUB 4OI6A 4NYZA 1HQEB 2OEMA 1F2HA 4K8RA 1GMVA 2ZUAA 1KD1T 2N4DA 4P10A 1VIXA 2QA1A 1U48A 5LSRA 3MR6A 4Q5VA 3ELHA 2EG1A 2IY5B 3BQ0A 4H4OA 5BYSA 3N79A 7AT1B 3GIIA 1B7FA 2HHXA 2F65A 1G4CA 1IN0A 4FYXB 3IMQJ 4RZRA 3KLEA 4XO0A 2V2QA 2BQUA 2ZH9A 2YKOA 1OY6A 3MFIA 3C46A 1M5HA 4DPTA 4F4WA 3MPYA 2RDIA 5KFZA 1LW0B 3UWTA 1WTFA 1WEXA 3HK2A 1CULB 5L9XA 3ZZ0A 3LGHA 1S0VA 2V8HA 2HHWA 1HWIA 3A8KA 2VB6A 3HM9A 2CPHA 2CFXA 2IA0A 2HFZA 4I4BA 3W63A 3HSGA 4ZVFA 4J9PA 3GONA 2DH8A 2FJAB 1DLOB 4IDKA 4ZVGA 4NA1A 3M6WA 4UQGA 1Q95G 2OPRB 3CW2C 4AQYJ 2NQPA 2AGPA 3A3NB 4IG3A 1RJJA 3E8OA 1TAUA 2QLWA 5LM7E 2HURA 1OY9A 4NCGA 2YH0A 3KK1B 2ZBQA 2YX4A 2Z57B 1YQHA 2VICA 4HHHA 3NKYA 1LKZA 3DOLA 1RTJB 3VWSA 1UVKA 1GTHA 1IUJA 1TL7A 1PBUA 3PTWA 4WFAQ 2OD4A 2G0CA 2HIYA 5LJ5Y 3S1TA 4EWTA 3SXLA 2DR5A 4PYDA 3DLGA 1QVGR 3FBFA 2V4QA 4AL7A 1QD1A 3MMAB 2OPSA 2VPZB 1JJ4A 1ZA2B 5LXRA 4RNHA 1CS4B 1NKEA 4AQYF 3ENVA 2VHGA 3HFZB 4DSJA 3GR1A 1EETA 4ETXA 1FF2A 1HQUB 2ZFHA 2DHAA 4ECQA 1KLNA 3EGNA 3JS9A 1PYSB 2ZHOA 3PM9A 3I55S 2MKKA 1GTEA 2JH3A 1CJKB 1VLOA 4URQU 4N8NA 3S6EA 1BY9A 1H7XA 3I4HX 2GMJA 1S1XA 2IJNA 5JJBA 5KFBA 1N8RT 4V19X 4M8LA 2RDDA 4NXMJ 5AE1A 3US5A 1N33J 1S77D 3QIDA 2R8IA 3BN4A 1K73T 1FX4A 3SZ2A 1SKUB 4D3HA 3BH6B 3I0RA 3JAMU 5DG7A 4H4MB 2CQCA 2GJFA 2R7QA 1C0TB 3DOKB 2MQNA 3B4DA 2ZVIA 3R6LB 1S6PB 2IM1A 1IWGA 3M8YA 2HHPA 5E33A 2KZMA 5F9NA 4P7VA 1S1WB 4ZVQB 3NL0A 2VC1A 2XNQA 3MECB 2M3DA 5HATA 3GSIA 4CLUA 4NXMF 5FLXU 1N33F 2OSRA 4IRCA 1NPKA 3AH6A 1YBUA 6FDRA 1VQKS 3MPVA 5LJ3Y 3M6XA 1U24A 3NNHA 4KGZB 1Y10A 4FN5A 2R7VA 2CPYA 1JLGB 3Q8YA 1S1VA 3T5JA 2EFPA 3UD5A 5HQ8A 4MKBA 4HLBA 2B51A 1RTZA 1F5BA 3BREA 4ED6A 2NPIA 3MM9B 3O1LA 2X51A 2C3YA 3M4XA 2J76E 2DRAA 3I9V9 3X1LB 3QJLA 2MEWA 2AGQA 4M5DB 2QIFA 3DXBA 3FRYA 2JOQA 4KGKA 4FF1A 2LU2A 5HN0A 2J7KA 3NG8A 1MROB 4Y2AA 3BB5A 3V4MA 1P9QC 2XBPA 5A8RA 2R3VA 2HNYB 3ZTOA 2GVZA 1CJTA 2NZ4A 3I5AA 1HBMB 4M5NA 1PBAA 4KYZA 3ZNJ1 3VGUA 2M8HA 4OL8A 1CSJA 3K5PA 1RTDA 3V4IB 1NB7A 3ZTSA 4KH0B 5ETVA 3NBPB 3MAHA 1WELA 1FDBA 4NZ0A 2PT0A 4CTAB 3CTRA 4P2FA 3ZZTA 1SQFA 1TELA 1KNZA 4DL5A 4TY8A 5A2QU 3FFIB 1X4EA 5KG5A 1TKXA 2HQCA 4CLFA 3OR1A 5C42B 4CH7A 1FE0A 2DXFA 3JYTB 4DSLA 1S0MA 3UD3P 2YPYA 1ZZNA 3GJSB 3FCHA 4OJ3A 2J9DA 3DGPB 3K8WA 4I6YA 2JEGA 4JI4J 3H98A 2HVIA 1UAWA 4TLRA 1EJ7L 2MLYA 2YX1A 3RRKA 3MAAA 2ZH1A 2HFOA 5A6WA 2PEBA 1FJEB 5EWFA 2XO6A 3K58A 3HVTB 4ECVA 2BX6A 5KFMA 4GO7X 2HVZA 1FKPA 1JLFB 3AAWB 2NXCA 2ATLA 4ZLJA 3CCTA 3ZO7A 1SKRA 2MYFA 4NRUA 2R7UA 3DM2B 1PIEA 1WG1A 2DEJA 4M5IA 3M1VB 3OTOJ 2DGOA 2BABA 4ZP9A 2W9CB 3BO2A 5KFFA 4U7CA 5EDWA 1GT8A 2NXUA 4X4NA 3VALA 5BR8J 3M8WA 4JI4F 3MFHA 1YJWS 3W9HA 3TJ8A 3GG1A 1SJFA 3O2IA 3UDCA 5F8GA 2C42A 2NSCA 2NXEA 1YJRA 2M2BA 3QRQA 3OTDA 3G8TA 4OLOA 2NXJA 3BYRA 5DZ6A 3AJ2A 1P1TA 5AE2A 4UZCA 1ZM4A 3K5MA 5KFKA 1Q82T 1X9SA 4HH0A 2XM3A 3TUZC 1L3VA 2D3UA 3UN2A 1NJWA 5J2MB 1NHUA 4O3NA 5CZXA 2BYCA 1ZYQA 2N7YA 5AE3A 3OTOF 4PZVA 2H5JB 4FS2A 2XLJA 3C66A 3JTOA 2ZKTA 4OZNA 5BR8F 2DIUA 4J9KA 1ZBTA 3CCMS 1XBWA 2P9CA 2VG6B 2Q6BA 1JLCA 2DYAA 1MMLA 4U95A 2PA8D 3PRDA 3N0VA 5THWA 2R2UA 2NLWA 4QWEA 2K3KA 1DTQB 5K8PA 4CLWA 3OVBA 1C1CB 2DNOA 2ACYA 2IC3A 2WRMA 4C6AA 3LQVA 4GRSA 2ASLA 2BJ1A 3MUMP 4NLVA 1DQ9A 4I1TA 3MEEA 4LQ9A 2Q1LA 2HNDA 2B9EA 3QGIA 4DV2J 1VCTA 4K4XA 2ZVSA 3POTA 4OYPA 5T14A 3N4WA 3VZIA 2HBRB 5L9NA 1SUQA 1H38A 5FD1A 3FC9A 2XY7A 5RUBA 2H51B 4B3OA 3CWJA 1M1KT 4A8OA 1R6VA 3W65A 1LWEA 1B0TA 2Y9HA 3AQOA 2HBYB 1RYRA 2BJ9A 1B64A 3DN9A 4U96A 4FNHA 1ZTWA 3BSAA 2MSTA 5BXIA 3KLHA 4OHYA 1NHKL 2DGUA 2KDOA 1XMBA 2B9YA 3A8JA 2XYGB 2OIHA 1O8BA 3MF5A 4DV2F 1B0VA 1R43A 1KEKA 3QBCA 1AZSA 5A8KA 1RA6A 2IRXA 1EKSA 3HKWA 3D28A 4C98A 4HDHA 4B9MA 3JQMA 2LKZA 1VRUA 2ZH7A 4QYRA 3ISNC 3TJ9A 2P5VA 2ASYA 4RW6A 3OL8A 1PSDA 4WZMA 2DISA 3J81Y 5HAOA 2YXLA 4DR6J 4WP8A 1F5AA 1BLUA 4K4YA 1IKXB 4F50A 1C2PA 5KFCA 1RT7B 3MDFA 1ZM9A 3KLIA 2V63A 3X3UA 3SCLE 3PW5A 4OHWA 3CCWA 3OHBA 2XCPA 1R8CA 3M2VB 4CLYA 3ENAA 2DNGA 1T9WA 2DNNA 3DOMA 1GQEA 2WSFC 2FZKB 3THVA 2F5GA 1HWLA 4QIFA 3CD0A 5ETMA 2GIQA 4LF9J 1ZM2A 1KQKA 4DR6F 4WTOB 3ZZYA 3LP1B 3NNCA 2CQPA 4DUTA 3TYTA 5F8MA 4DEZA 1F3VA 3LWMA 5C5JA 2H48B 4NE9C 2HFSA 4ANEA 4CNYA 2A6OA 2LVWA 2V0NA 3PVXA 2HHUA 1YRTA 2QRRA 4X4QA 2YWEA 2IYGA 3M8PA 3Q2TC 3HMJG 1RTHA 3B78A 1HNZJ 1F5CA 2ROGA 2HQ3A 3MUTP 1REVA 3OTEA 2H65B 2VOOA 3BJYA 4UOHA 4ANDA 2DHHA 2UVUA 4URSA 4O4GA 1W26A 4L72B 4LF9F 4A8SA 4ZCIA 2MHNA 4Q2MA 3JQKA 3P5BP 1HPZB 3P45B 3Q83A 1TQLA 2K7KA 4CLSA 2KI2A 2HFNA 4K59A 2DT9A 1Q5VA 1CLFA 3HI9A 4X4OA 2RKIA 3I96A 2KYZA 4X4PA 4I2PB 1UTAA 3D6MB 2VOPA 2YWFA 3S8SA 1SB6A 3D1HA 3VAMA 1HNZF 1GXLA 1YJ9S 1U7LA 4TKTA 4PG4A 4J9LA 2RU3A 1TVRA 4M5HA 3ETOA 4LIRA 4EBCA 5M2UA 1O51A 2WB1D 2HS3A 4OX9J 3W61A 1SJRA 1S7HA 3ZXWA 3AJDA 3QLHB 3MM5B 3W8GA 1X4FA 2J0SD 3TAPA 1N5QA 4ID5A 2CJXB 3LA0A 2XSJA 3F41A 4OIXA 2BUNA 4L74A 1XR7A 2GVDA 4QCLA 1BE4A 4KSEB 3KOAA 2RILA 2FIUA 4PG5A 3CCJS 2VASA 2XWYA 2X3GA 1E6YB 1T11A 1T9XA 3C14B 2CDQA 2J6UA 2W4CA 4P7TA 4TLQA 2XMTA 1FE4A 2W2MP 2AJFE 1I94J 2F4VJ 2A10A 4X64J 3NMAA 4OX9F 3GIRA 2C1EB 2BKOA 4ZVRB 2O66A 4IYQA 3DRRB 4ERDA 2R2RA 1P6TA 4ZLLA 2X1AA 4NLYA 3HXMA 2OP5A 3RRHA 1X4DA 4PWWA 3PJXA 1RKIA 2UUBJ 2HRYA 4H4KC 1JIHA 5KFIA 3M2UB 2A6MA 3FMBA 3PW4A 4ECTA 2K06A 4GMKA 3ET6B 4LF7J 3RU0A 2F3JA 4FS1A 1I94F 4MH8A 3RBXA 4JI8J 2R8JA 4KPCA 4X64F 1URRA 4DUYJ 2XTJP 3UW1A 1XJWB 4P71A 2AD9A 1N0VC 3KUGA 2QA4S 2J6TA 2R2TA 3QZ8A 2HZCA 1HD1A 2EPIA 1A0OB 2FJXA 3Q0AA 3QRRA 3TI0A 3ULHA 4AD6A 1DY3A 4AFFA 4MYTA 4W92B 1KONA 3CE8A 1RT4B 2GW8A 3H59A 4RWWA 4NRTA 2M88A 1SC1B 4QWAA 2FVSA 2UUBF 2C2KB 3IM8A 1FXLA 2NYHA 2B8QA 1KP6A 4CO2A 3RG6A 1N5SA 1U1RA 4LF7F 1BQNA 3RB4A 3H0PA 3QO9B 4UTGA 1Y0HA 2BRKA 4JI8F 1ITPA 1SQEA 1PJ7A 1V3SA 3CT9A 1ZAVA 4C2MA 2G9OA 2PSZA 2D3OR 5D4PA 3MAQA 4USJC 3OD2A 4DFKA 4Z7CA 3PR4A 3T6JA 2DHGA 2AEFA 2CYYA 2HAFA 4YS2A 2ZC4A 1YIJS 2KU7A 2ZE2A 4NASA 4M5MA 4TN2A 1C4AA 3QGHA 2OPPA 5CYQB 2I9SA 1S57A 4RBVA 3DDIA 3M9MB 1BMQB 1J5OA 2H1YA 3QFWA 4KV8B 4OJ1A 5L1LA 4J9QA 4LFCF 4LBIA 5DS7A 4DFMA 4ELTA 3WC0A 1N48A 1F9FA 3J81U 1EQMA 1JJCB 4X4SA 4KGXB 2E1MC 1R31A 1R27B 1NJZA 3NXZA 4O3SA 3NGRA 5L38A 4NWBA 3AD9C 3CMAS 4WTYA 3TA1A 1YRXA 4F8RA 2H54B 3FGVA 3HJFA 5BYQA 2RT3A 3KK2B 1Q8KA 2F1FA 2VIHA 2FHJD 1VC6A 4L3NA 1YITS 3PIPQ 4DQSA 2WVEA 2JNJA 4DV4F 4ECYA 4LFBJ 1YVFA 1G1XA 1NEEA 2IAJB 1JXEA 1FVQA 3MMCB 1HNWF
chains in the Genus database with same CATH topology
4QW8A 2PDAA 3CIMA 2NYIA 5CZVA 4IG3B 5GAEU 4Y0FA 3CJKA 1TFYA 4RKUC 2O01C 1VC0A 1IKVB 3JSBA 2ZJPQ 5E3PA 1ZAXA 2RUGA 4F4KA 2ZE2B 4A8WA 4DG1B 4D3GA 3OW2R 4R25A 2MQMA 1YWXA 3DLEB 3FSYA 1IJFB 1TL3B 3H2UB 4HEA9 2J9EA 4RNMA 3BS9A 4PPZA 2OPPB 2CPEA 3DYAB 4L6V3 4I7FA 4YHHF 2AYBA 3PKMA 3PNIA 1KN6A 4DX8H 4KTQA 4DR3F 2R7XA 3F73A 2BM1A 4R0JA 3GFZA 2K2PA 3EZUA 4TNOA 1Y3KA 2NS1B 1NH8A 4GC6A 3RAQA 1FRMA 5HMXA 3OVAA 3G71S 4DQIA 3MWBA 2OPQA 4ZPBA 3MEDB 4PG8A 1S1TA 2RE1A 2VQFF 1ZM3A 2HHSA 2XEXA 2DNRA 4JI5F 2BJEA 2JSXA 2YX7A 5FDLB 1HPZA 2DGXA 5J1PA 1S1UA 3UD4P 4ZPTR 5J1NA 4DL2A 3J7Z5 3MM6B 4RW8A 5D4NA 3H5SA 4FZVA 4Y2KA 4Q43A 4WIIA 4X66F 1OIAA 2JX2A 2BM0A 5MAOA 4F2SA 4WJBA 2F8HA 4IH6A 3DLGB 1VBZA 2C3OA 2GJIA 1TAQA 3PR5B 1P8GA 4Y2MA 4BC9A 2GHVC 2QMXA 4O0IA 2ZH6A 3SYZA 1R0AB 1XEZA 3T5LA 3R1LA 2VG5A 3CJ5A 3GB0A 4O3QA 3RR7A 1N0UA 2E5HA 4OZ0A 2V4RA 3KHHA 1DHMA 3RB6A 4BWMA 4LFBF 2DNYA 2I8EA 1XTZA 3DRPB 1LW2B 3QWUA 4MK9A 4OZ5A 4UW2A 3CB4A 2M70A 4X4UA 1UP1A 1L3KA 5DDRC 4HHJA 3CDUA 3UE2A 1YSJA 2ZBIA 5AJ3F 2XMJA 3J80Y 5T7LB 2CQDA 3LUYA 1KTQA 2DIVA 4YOEA 2E44A 2R8GA 2K3IA 3CDEA 3FZ2A 3LGMA 4ICLA 2A3JA 3EYZA 2ROPA 2W9BA 1EETB 1Z4UA 4J9SA 1RT2A 2BOPA 3HHLC 1ELOA 4JV1A 4Q8EA 4PUOA 5C25A 2C2RA 4F4ZA 4G1QB 2VKRA 1NKBA 3K0JA 2M5YA 4WK3A 3DNCA 3T19A 4BBYA 2HGNA 3OJUA 3QJPA 3IAM9 2EW9A 4KE5A 2CQ4A 1KC8T 1FDNA 2IM2A 2MKJA 3FEXB 3K5LA 2KHDA 1BC6A 2BW2A 1OQ3A 4KBIA 2P6SA 3UCUP 1OQ6A 3LP0B 3KG1A 2DCLA 4ED1A 3C6TA 2EBGA 2MQPA 2JVRA 1U1KA 1UJ6A 4LSNB 4FXDA 2BR0A 3QLHA 3MM5A 4WU2A 3ZZOA 2BE2B 5ITHA 1VQOS 2AU0A 3MR2A 1CC8A 2XHWA 4QQBA 4EZ9A 3PZPA 2Q43A 2UU9F 4I2QA 1NZAA 3GSDA 2LXUA 1T03A 1NH7A 1SL1A 4KO0A 3NWGA 3CJKB 1NK0A 4JOUA 1X4HA 2KG0A 5SZTA 2HRUA 3ZC4A 3H40A 2MZTA 2PI5A 1N4LA 1UVNA 4ZA1A 3M2RA 2V8VA 2WAQD 2DK2A 2F9DA 4WE1A 1HBNB 4LF4F 1TKDA 3L95X 1DQ8A 3J7A1 1FDDA 2GCFA 4IO1A 1QUPA 3SFGA 1MWZA 1RT3B 2YY3A 3C6UA 3HVRA 1K1QA 2B0GA 3HVWA 3H5XA 1WEZA 3M9OB 2RIJA 3UDLA 2GX8A 3AHPA 4I7FB 4M95A 3T1AA 3CF5Q 4ES3A 2FLLA 4IFVA 2VPXB 1L3TA 3PX0A 5AXNA 5D77A 2IBOA 3ITHA 3HHDA 1TL1A 2JVOA 4K5SA 2C3UA 2OPQB 4K4WA 5FLXY 1VIOA 3CVKA 4NL5A 1S1TB 3MXHP 4HTJA 2PD1A 3OTCA 2OFHX 3SFUA 3AY0A 4B9LA 2P9GA 1ZETA 1S1UB 2VG7B 4DLGA 2ADCA 2B56A 3ENQA 1U6BA 4DQPA 7FDRA 4RW8B 4FXVA 2XMUA 1FNXH 5DLFA 2PC6A 4X4TA 2CPXA 3R1HA 4DJBA 1HBOB 4RBUA 1ZAWA 1NAQA 4B02A 2WHOA 3RYLA 3RW6A 1JMTA 2P6TA 2XS5A 2RRBA 3CDAA 1X5OA 2VG5B 2IM0A 5IT4A 2HNZB 3PACA 1WTBA 4ZS6A 2PGCA 5K8NA 4J9NA 6FD1A 4DR7F 2GQ2A 3CUNA 2UXBF 3DRRA 3BGRA 3ZFVA 1LFWA 3QGGA 4PXBA 5IWAF 2QE5A 3LP2A 3OPKA 5KFVA 2GHWA 1XNQF 1LOUA 4C9DA 1P1LA 3VZHA 3UPFA 4ICLB 1M5PC 4YEAA 2XLKA 1VLYA 1NJIT 2ERRA 2W9BB 5IFMA 4ZOSA 4ED8A 1QJHA 1T05A 1RT2B 5I3UB 4PUOB 3KWMA 5C25B 3K59A 4PQUA 3CMES 4QWBA 2Z2MA 1YG0A 2ZNZA 3DLKA 3TARA 2D1CA 2IM3A 3IA0A 4R5PB 3MEKA 1S9GA 1VQSA 4ALZA 1IKWB 5F8HA 1NJYA 1TFWA 3E2EA 2HWTA 3KK3A 5GMKa 4ZPCA 4WZQA 2E9ZA 4O4RA 4J9OA 3HHLA 3M2UA 3P6YC 4FXWA 2L9WA 2O3DA 1PGZA 3ISZA 2L9DA 2LQ9A 1S9EB 4PPDA 2KN4A 4DPOA 1CC7A 2FUG9 2N7CA 1U2FA 3R5AA 4ZCKA 3K57A 1PC4A 2AJ4A 4QOTA 2IVYA 4MTPA 3L7OA 3RBDA 1XK8A 2FGCA 3M05A 1IBLF 4I2QB 2X1FA 1T03B 1IQZA 1QLNA 2YWKA 3R5DA 2EK6A 5HMZA 2VA2A 2DGVA 4CT8A 3Q2SC 4KO0B 2FGOA 5J2QA 2CIMA 2JLGA 4O3PA 4YB6A 1Q8LA 3MUVP 3EUNA 1RKJA 2R7SA 1ZPWX 3H5YA 5CYJA 1UEVA 1M5SA 1UW4A 3LPYA 2PMHA 2MKCA 4XPEA 3OFFA 5B08A 2RMLA 4C7QA 1VJWA 2RB7A 2EVZA 2UXDF 2NR0A 1DTTB 3C6UB 3DMJB 3GV5B 5DJBA 3WZ0A 2RJZA 2V9WA 4I0WA 2KJWA 2XS7A 2CJQA 1FEEA 3AQPA 3ZZPA 2FHMA 1UVMA 5C24B 1IQTA 3TVZA 1VQNS 1FJCA 4LFAF 4IFVB 4B9UA 2RS8A 5K8MA 1TL1B 4DV3F 3R5CA 5LSLA 1FERA 2CPDA 2O1PA 5LXYA 3BR9A 4A8MP 4MMOA 3UR0A 5L39A 4DV1F 4NLQA 3KLVA 2HLTA 3M8RA 1LV5A 3G8SA 2LEPA 1RT6A 4IOCQ 2ZNYA 4OI0A 3T3FA 4YB1P 1RP5A 4ZP6A 1Y4ZB 1MW7A 2VBYA 1GXTA 2WTFA 1FK9A 3D0GE 3KHGA 2KJVA 4OI1A 1LW0A 1FRXA 1S6UA 2W9AA 2ZOFA 5GADI 2XMMA 7FD1A 4ZK7M 1KQSR 1VRTA 1KTVA 1G3OA 3OV7A 2IVFB 2J0XA 4DV5F 2JEFA 3WC2A 2ZZNA 2V8DA 2KT3A 5DDQC 4I67A 2HHQA 4QIGA 4Y65A 2N3OA 2M8DB 2VODA 2JC0A 2QSWA 2IMOA 3V6DB 2LQBA 4OI3A 3DU6A 1NK8A 4LF5F 4X84A 4G6VB 1TR0A 3GMGA 5A2QY 3MTJA 4QZVB 3BGRB 4AUKA 2N82B 4FF4A 3LP2B 3P5TL 3U1MA 2J5AA 5G4DA 2QZ8A 2CZVC 2B5JB 1Y7PA 3RBEA 4C3LA 4M1KA 4NZ6A 1R8PA 5IM0A 3FQKA 1KR4A 3PEJA 2ZH5A 3G9CA 1U2RA 4ILRA 1R8AA 2ILZA 1IM4A 3DFEA 3TP2A 4Z37A 3PJWA 2VFSA 5HO4A 4P2SA 4RBTA 3HZGA 4PQUB 4F25A 4OI6A 3DLKB 4A4JA 4NYZA 1S9GB 1HQEB 1DLOA 4PXCA 3BGUA 2RS2A 1GAOA 1KD1T 1HNXF 2HW3A 2N4DA 3PW7A 1FNOA 1VIXA 3HHLB 4HT7A 4AYBD 2QA1A 5LL6d 1U48A 4K0KF 5LSRA 4WK1A 2OPRA 3MR6A 3SDEA 3DI6A 2VPWB 4KFBB 2X1BA 3T1YF 1D8ZA 4Q5VA 1UJ4A 2EG1A 2HWHA 3M6VA 1RISA 3BQ0A 1VOMA 3CJ4A 4ILLA 1C4CA 4H4OA