2D74B

Crystal structure of translation initiation factor aif2betagamma heterodimer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
137
structure length
137
Chain Sequence
b'IDYYDYEKLLEKAYQELPENVKHHKSRFEVPGALVTIEGNKTIIENFKDIADALNRDPQHLLKFLLREIATAGTLEGRRVVLQGRFTPYLIANKLKKYIKEYVICPVCGSPDTKIIKRDRFHFLKCEACGAETPIQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Translation
total genus 22
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2005-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01873 eIF-5_eIF-2B Domain found in IF2B/IF5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2d74B01
2DCUB 2NXUA 2D74B 1NEEA
chains in the Genus database with same CATH superfamily
2E5IA 1NZAA 1OIAA 1TKDA 3G8QA 4M5DA 4MTPA 3E51A 3SI8A 5MLCV 2JVOA 2HHPA 1G3OA 3HFVA 3IAM9 3VAJA 4OJ3A 2WVDA 3LP1B 1S6OA 2DRBA 3Q8UA 2KVQE 1MNEA 1JLEB 1RHUB 2BQRA 4NLPA 2DH8A 3V6DB 4FYVB 3NLCA 3W9HA 2CG8A 2FGCA 3C6UA 3ONQA 5IV4A 4QQBA 4C7QA 1CPZA 1N0UA 4G1IA 2JLGA 4ILLA 1ZYQA 4CLWA 2MZJA 2LA6A 2QFIA 4PRFA 1Y5IB 1NSAA 1R89A 4A8YA 1JJ2R 3E3XA 3SSRA 4P71A 3BEGB 1U25A 3EVMA 2BA9A 1JLFA 2V68A 2BE9B 5LT5A 3RW6A 2M88A 1VIOA 4N7TA 4O4GB 2LLZA 2I8EA 1U1PA 3UR0A 3M6XA 3GFXA 1XNQJ 5M2UA 4GKKF 2EW9A 3QFHA 5E7OB 1EETA 4ANDA 4I7FA 4CLSA 4G1PA 1VQKS 4DV3J 4J9SA 3MR5A 4ER8A 2VQFF 1XTZA 2I0XA 2AX1A 5LXYA 1MN9A 2XZWA 1N6QB 1JNRB 1OMSA 3O5TB 3Q83A 2GQQA 4X66F 1U45A 3BBBA 4FS2A 1E6VB 4CTAB 1KONA 1FFWB 4E98A 3L9ZA 2O67A 1BXNA 2QMUB 2JEGA 1RWMB 1DJ0A 4K4UA 4HDHA 3CXCR 1JLAA 4MK9A 4ED6A 2EC2A 4RW9A 3A4TA 2V4RA 2BW2A 4I2QA 2EG2A 3IRXB 4HI1A 2J6TA 2XWYA 3AH6A 1NAQA 4OZ3A 1T03B 3HZGA 2QSFA 1RJJA 4NYPA 2DXDA 2R2TA 3DM2A 4QR2A 1GTEA 3NP5A 4EGLA 2CQPA 2ZOFA 1N5QA 2AX0A 2G1HA 4QIVA 3DOLB 2FTRA 2HWTA 3ZXWA 1YJ7A 3Q8PB 3M05A 3DKDA 4DN9A 1YJ9S 1M5OC 1XR7A 1S9GB 1VS3A 2UUBF 1AFIA 3K59A 3AOCA 1RT6A 4J90A 3RB4A 5JJBA 2ZH8A 2UXBF 2W9CA 4LFCF 2DEJA 1CS4B 2WVFA 2CNOB 5KFKA 3HSZA 2VHGA 4DPXA 2LKZA 2R8IA 2BKNA 1BY9A 1G4CA 1QJHA 2C3OA 3H4DA 2D69A 1RYSA 1KLMA 4CLFA 2FVQA 2ERRA 3KYLA 2XGPA 3HXMA 1TUGB 5DS7A 3U1LA 5DDOC 1ACMB 1B99A 3JSMA 1EQ0A 1T8EA 4LF7J 1HPZB 2EI5A 3MM7A 2CPJA 4B3SF 3T5HA 2A10A 3KLGA 1QTNB 4MAKA 3DLJA 2EEYA 5LJ3Y 5CYMA 5HMXA 2J9EA 3NG8A 2ZBIA 4ZVHA 2V5HG 1WI8A 2E1MC 3MMCB 1S72S 4B3MJ 1X8DA 2MZTA 4ZPVR 3KMSA 1U47A 2YH1A 4YB5A 3JAMY 3W2VB 4H4OB 1VBKA 3I6PA 4OJGA 2HWHA 2PEBA 2XBPA 5A2QU 2KJWA 1XMQJ 1S1XB 1BQMA 3RR8A 1QM9A 2H5IB 4DL4A 3NBPB 3TRGA 3OL8A 1LWCA 1G1XA 3HJFA 1C1CB 4QIGA 4B9TA 3EGVA 3EZUA 2RS2A 1CEZA 4JI8F 3UCZP 3G4SS 5E3CA 3M2UA 3VF0B 3BDPA 4GO7X 1W2BR 3GIRA 4DS5A 4BWMA 3LGNA 3OHAA 3SFGA 4KJIA 4QPTA 3EUNA 3UW1A 3LAMA 5A6WA 4ED4A 3J7Z5 3BO2A 2HMIB 1NK0A 9ATCB 4CRJA 1U1QA 4F7VA 2XS5A 2CQHA 2DNLA 2HWIA 4LSLB 3LQVA 5C5JA 4DX8H 1C2PA 4WTYA 3WX8A 1GT8A 2HNYB 2XO6A 3HFKA 3BSAA 5IT9U 4PG7A 1W7WA 2YKPA 2E5LF 4B9LA 1HMVB 3VQTA 4N56A 5C2CA 3VZIA 5EN1A 1T9WA 4EI2A 4OX8A 5D4NA 3F73A 3FZBA 3LP2B 3BQ2A 1KBRA 2GHWA 2SXLA 1PIEA 3RB0A 3E01B 4P2MA 1U09A 1EB0A 2M70A 1RWNB 1SXLA 4GKKJ 2G0IA 4DL3A 2XMTA 4KPYA 4JI6F 2LYVA 5F0WA 1V5IB 3MTJA 2VQFJ 2BUNA 1UZHA 4LVOP 3GTYX 1X5PA 3S01A 2EFGA 1BC6A 1ZAVA 1JJCB 1U0HB 3UN2A 3EGZA 3ETOA 2RT3A 3DOKA 4ZPCA 3WQPA 1WHYA 1EHWA 4WXOA 4ANCA 3EE3A 4X66J 1HWLA 1OO0B 1HBNA 1QSLA 4XDCA 2K06A 4ANEA 3BQ0A 3BM7A 4CT8A 4C8OA 2KN4A 3GJQB 4LF9F 5KFVA 4BCAA 4W92B 4ZN3A 3DDIA 4L3KA 4Q0BB 5F0UA 5K8MA 4OYIA 2JX2A 2CPIA 1K1SA 2C3UA 3IM8A 3HHNB 3CIZA 2AQ4A 2K1RB 5F8LA 4OHYA 2HFVA 2H3EB 4Q8FA 4DJBA 4X4VA 2Z8QA 2CRLA 2Z2MA 2N7YA 3HLUA 4QWBA 1R7IA 4CTAA 2DNKA 2B4OA 1M5SA 2F8MA 3HMJG 2IM3A 1J5OB 3OTOF 2ZDOA 4USUA 2E29A 4NASA 4F4ZA 4KSEB 4ILRA 3CVKA 2JEIA 3M9MB 3MUTP 4ZDNA 2OD4A 3IRXA 1NDLA 4MIAA 3IGNA 3DLGB 4ZVRB 2BJEA 4HDGA 1WC4A 2WSCC 4OQJA 2UXBJ 4LFCJ 1RT4A 3IWLA 1T03A 1SJ4P 1SKUB 4ZMMA 4OHWA 3I0SB 4NL5A 1K8AT 2C2DA 3B78A 2X51A 3ZC4A 1S9FA 4TY9A 3A3PB 2NPFA 3CJRA 2BRKA 4OZ2A 1QUVA 1S12A 4C4WA 2G2YA 1LWEB 2EBEA 1S6PB 3VHQA 3RYLA 5KFNA 4O0NA 2A3JA 1F6TA 2IA0A 2ATLA 1FWLA 1AUSL 2F9DA 2EFOA 1S9GA 4ID8A 1DQAA 2FJWA 1N4LA 3T3FA 1SC4B 3W64A 2X7IA 1SV5B 1ZOTA 1CS4A 4WP9A 2CIMA 1S1WB 2WW4A 3QYYA 4KBIA 3HX9A 3D0HE 1MU2B 4P52A 4ELVA 1FRKA 3MZIA 2KM8C 3QAEA 1VR6A 4ZVPB 1TFWA 2DNMA 3PG9A 5ETVA 4EYIB 1X4HA 1EP4A 2KL8A 2Y8WA 2KXNB 2O66A 2KFYA 4WP3A 4OI3A 3SQGA 3UI3A 4OYPA 1PG5B 3LAKA 4NRTA 1RBOB 1HPZA 5HROB 1CJKA 2CVEA 4DU7A 2KXHA 3SCJE 3SCKE 5D4PA 1OY9A 1PYSB 2QO3A 2HVEA 4UOCA 1NKCA 3QGIA 5HVHA 3BS9A 4AXIA 1RAHB 1Y4ZB 1RT1B 3UDCA 1RAJA 4GC7A 3MMCA 2ASDA 1R8CA 2DCUB 4ES1A 4WF9Q 4H4OA 4CCHA 2XSJB 3UD5A 4EBDA 1HWKA 1FERA 5E0OA 1CC8A 3VGUA 4GVBB 2UUCF 2HIQA 4RWXA 4K4TA 2ZUAA 4DWIA 2FHOB 5HO4A 1VC6A 4JYAF 2CNLB 4RJVA 3ZZUA 4QPXA 5JXSA 3TEGA 2E5LJ 3HM9A 3NS5A 3C16B 2HMIA 2VA3A 1LOUA 1TMJA 2ZH3A 4WFAQ 2DR5A 4X64F 4C8KA 2E9RX 4OYZA 2ZH9A 1WEZA 4HLBA 4QWEA 1FWKA 1VQ8S 3A13A 4U67Q 1SH0A 3PHTA 3W8PA 1U1MA 5DGAA 2XEXA 4NWBA 2J6UA 2XC9A 4ZJLA 2QLJB 4O23A 2P8IA 2LCWA 1N5YA 3FMWA 4RKUC 1RWWB 2AW0A 5BYSA 3GZ7A 4P75A 1R0AA 1NHKL 4JI6J 4DF4A 3RBEA 5KFZA 2YWGA 4ZIWA 1MW7A 2FYXA 2B9EA 1ZTWA 2QYGA 4TXSA 1WDDA 1X4FA 1LK7A 3SEOA 4Q44A 2CPZA 1ROFA 2AKWB 2LU2A 3LP2A 5ETTA 3IWXA 3MPUB 3K58A 1V3RA 1D09B 3PW7A 5J2PB 3PX6A 3QZ8A 3DDKA 2FJXA 3E01A 1IKWB 5SUHA 2Q6CA 1LNQA 1CG2A 3SYZA 4QBUA 4CM2A 1RLCL 4NYOA 4JI3F 4OV1A 4C3MA 2XLIA 1TP7A 3SMZA 2RQMA 3OTCA 3VAFA 2NXCA 2XB2D 3MDFA 1YJUA 3C19A 3OUYA 1M1KT 4OI1A 3O1LA 4Q7AA 3I5BA 2MKSA 1NJXA 5J1NA 3AODA 1RHQB 4NXNF 4KV8A 1TTHB 2XNQA 5HL7Q 4ILMA 1U0HA 4C8NA 2OUGA 2V9KA 5D0HA 1VQLS 1NB2A 3L7OA 3IR5B 4IFVA 1ITPA 3DGPB 1GK8A 4DR4F 3H90A 2YWHA 3PTWA 3IBFB 3G71S 2LEAA 5DLFA 1RTJB 1L3SA 2ZC3A 1TQLA 2YQ1A 3OTOJ 1SJRA 3R8YA 3AAWB 4IRDA 3DU5A 3CTRA 3HP6A 3DLKA 1X9WA 4HH1A 3C14B 4Q0BA 1PYTA 3R5CA 1C0UB 1S7HA 1FJ7A 1VQ4S 1P1LA 5H9EK 1RI7A 2EG1A 3CCRS 2IAJB 4WTOB 5HP1B 2YKMB 2DHHA 5GAGU 4AL5A 3FBEA 2KHDA 3QRRA 2DNPA 1FJGF 3DRRB 3OBIA 3CJ4A 3MR2A 3DC2A 2HLUA 2C2RA 2RUGA 3UR3C 4UOGA 1U6ZA 3QGHA 3TWZA 4LF2A 5EUHA 4B9SA 2XS7A 4NPOA 3UCGA 4CO0A 3V5RA 1RTZA 1A9NB 3N5BA 3DLGA 4Y28C 1FE0A 3CDAA 3H40A 2BKOA 3QIPB 2QL5B 4U7UK 4QU7A 3NNHA 8RUCA 2MPUA 3UDLA 4I2PB 3I0SA 2HZVA 3Q23A 1KQKA 1VJWA 3K5PA 3V81A 1GMVA 4RW6B 3FBBA 1RXOB 2DHAA 2F40A 2OP5A 1KVIA 3GILA 1LWEA 4WKYA 4DQRA 1S6PA 5F8GA 3KKFA 1Q7YT 2OMLA 1EJ7L 3RGIA 2Z57B 1T11A 5JVGQ 1R27B 3HVTB 3I31A 1PC5A 2VBXA 3OR1B 2VFVA 2EFVA 1M1HA 3W61A 3TEHB 1F3VA 2YQ0A 5M2RA 4P9SA 2NPIA 4DR5F 4A8QA 3CNQP 1F0XA 2JWNA 2V50A 5ETKA 1FWPA 2DGVA 3I5CA 1HARA 1P9QC 1S97A 2YTCA 2A6OA 2COLA 1NJWA 2BMBA 4MKBA 4F26A 2L41A 1VHIA 3C6TB 3M30B 5E3AA 5HROA 2UUCJ 1YRTA 3OFHA 2D3UA 1VK8A 1AFJA 4PUOB 4NLQA 2DGTA 2ZKTA 4JV0A 3SDEB 4ZPTR 1CJTB 2PA3A 4F67A 3IWNC 1IBKF 5KFGA 2NXNA 4JYAJ 2GIFA 4C3KA 1RT1A 4QU6A 1N33F 2CNNB 2KI2A 3GE9A 5IXUA 1EQMA 2OTJS 3A8JA 1NDCA 2R2SA 1URRA 3W5XA 2XSJA 3TAMA 2RHSB 3CDBA 4X64J 2YKNB 5M2PA 3K57A 2OEKA 3UWTA 4PEOA 4GVBA 3MTKA 4UW2A 4IDKB 1FD2A 1SI9A 2E44A 2MLYA 4FYDA 4USMA 3US5A 5IC4B 1KS2A 2V4JA 4URSA 3PFOA 4EZ6A 1PYOB 2Y3YA 2KKHA 5L38A 4NLSA 4YB7A 5E3PA 2WBMA 1FXDA 4F3OA 2YNGB 2FQQB 1VQNS 4LFAF 3C8YA 2GHVC 1OQ6A 3GSIA 2K7KA 4ECWA 2CQDA 3MCNA 5FLXU 3SV3A 3FRZA 1SCJB 3GFHA 2CPEA 1HHTP 2IJFA 3ADAC 3A3OB 4ZIVA 4JI3J 1NO8A 2DNZA 5LJ5Y 1FJCA 1MMNA 1C4CA 1TU0B 4QWAA 3HK2A 3L7UA 2OSQA 1WC0A 1SQGA 4Q8EA 2V8HA 2Q66A 2XO7A 1N5SA 2HHWA 2WBRA 4NZ7A 1XNRF 3UQSA 3MEDB 2ASJA 1SJ1A 5LSLA 3M9OB 2RUSA 1YWXA 1F2GA 1WSRA 4X4UA 2XSFA 4DR4J 1SKRA 1VDHA 1WOSA 3T6BA 2V8VA 3DHXA 2ZBPA 3GG1A 3LGMA 1UL3A 2W4CA 3G6VA 3IG1A 3KLIB 3K7RA 1NEEA 4X4TA 4NLXA 1PJ5A 3NNCA 4XIUA 2E1AA 4FBUA 4CLLA 1QTMA 3GFZA 1UFLA 4DFKA 1HBUA 3AQPA 2AJ0A 1TUVA 2POKA 4B9MA 1DLOB 3TA1A 4OHVA 4PWDB 3HULA 3MR3A 2MQMA 4FKYA 2OELA 1FJGJ 2NREA 5EX0A 5HVGA 4CP5A 3GU0A 5KG5A 3BO4A 2Z30B 2BRLA 3PW4A 4P2XA 1HBOB 1SC6A 2GJFA 4ZLPA 1UFKA 2PEHA 4O44B 2GO9A 3BF4A 4RW4A 5AXLA 1C1BB 4KKOB 2FHJA 5D6GA 1HWIA 1UP1A 1TUWA 3KHLA 1BQNB 1JNZB 2DEIA 5CAAA 4OYAA 3TZWA 2IAJA 4DDFA 3NS6A 1RHJB 2YKMA 2EFNA 4B9NA 1AT1B 1YBUA 3B4MA 2HW3A 1UVIA 3H7HB 2QLBB 4TVAB 5A8WB 1T05A 2H5JB 4N76A 2W7PA 2GQCA 4JBCA 4YUDA 1KQSR 1ZTTA 1N34F 2R8GA 1UEKA 1Q82T 3KJFB 3HT3A 1NNDA 2ZD1B 1U24A 2UVWA 5KG3A 1JLQB 4Y2MA 3MURP 1GEHA 5J2QB 4GKJF 2ZH1A 4ED2A 1YJTA 3W9IA 5E41A 1H2UX 1XMBA 1A6LA 4DMZA 3M8PB 4USWA 2B56A 4USIA 2M7SA 1X4CA 3OL9A 3FBFA 4I2PA 3G8SA 4DR5J 2U1AA 1P1TA 3DLLQ 1VBXA 1U8WA 3OLBA 1N48A 4RX6A 4A8MP 2ZHBA 2XHCA 3FFIB 1YJRA 2G0JA 2HEKA 2H4WB 4RW6A 4CNZA 4B3RF 4ECUA 1WORA 1T9TA 3CD0A 5LL6d 5GMDA 3BN4A 1RT3B 4I6YA 4KC5A 3R27A 1EARA 1WF0A 2ILZA 1S6QB 3D0IE 1UTAA 3D2WA 1ZA2B 5KFQA 2L48A 1S6UA 2NS1B 4LQ3A 5DETA 2RQKA 2A2DA 2P9EA 2UU9F 1TL7B 3MFIA 4CH0S 5D78A 1FFSB 1IBKJ 1SIWB 4GRSA 4LFBF 3D66A 4I69A 1EKRA 2YX1A 1XMOJ 2RILA 5GAGI 2AYGA 1N33J 2B9YA 1RTHA 4LIWA 1TL4A 2UZAA 1F9HA 2B5JA 1IM6A 2WTFA 1YHQS 3W65A 4I0WA 2R9LA 1X0PA 3TA0A 2VBZA 2DGSA 3DNCA 5D3GA 1UVMA 4LF5J 3PNIA 3RJMB 4ZLJA 5I3PA 3KLFB 2HBRB 4ECYA 4K8RA 2OTLS 2ACMA 2HZAA 3AD8C 3SDEA 1CJTA 2HNDB 2DT9A 4OYOA 1HHSA 3GMGA 5KT3A 1VI7A 1NU4A 1VRTB 1F9FA 1KEKA 4OMFG 4DZ6A 2HGLA 2CQBA 5KT6A 2B6AB 3OL7A 1PAEX 1RTIB 2EXUA 4L73A 4YQWA 4B08A 3QT7A 4NRUA 3KUHA 2ZFHA 2C2NA 2CPYA 1S0NA 1YDLA 1WC1A 5HBMB 2YKNA 2R8JA 4IYQA 2EK6A 4Q5VA 3HT0A 5U47A 4QZVB 5FJ4A 2Q43A 4F2SA 3M8QB 4PWWA 3R6LB 2ZJRQ 2RS8A 1UPPA 1IBLF 1LW0A 4F3QA 1D8ZA 5G0RB 5BYRA 5H1SV 3WZ0A 4WFZA 3G8TA 2JFKA 4HTJA 2WHOA 2CPFA 2VD3A 2ZZTA 5J2NB 5LMNF 4BHQA 1CULA 5L8RC 3CMQA 3MMJA 3HHEA 2Z2ZA 2BEFA 2KT2A 2YNGA 3CCVS 1DARA 1RU1A 2FLLA 2K8GA 4ID5B 2MHEA 2PT0A 1H72C 5AE2A 2C3YA 4IG3B 4AFFA 1R8BA 2FY8A 1JKHB 1XWLA 3C2PA 2M2BA 5GMKa 2MKHA 2VJUA 3VALA 1NLKL 2IDEA 2B8PA 2VG7B 3MEDA 3G9CA 2P6TA 3S8SA 2FZCB 4IR9A 4O3RA 2V2ZA 1D9FA 3EYZA 1R3NA 2MKIA 2VA2A 3AOAA 4J9MA 3BGFA 3X3UA 1LWFB 4KAIA 2YQ3A 5FIIA 1OS5A 1O5JA 2BZ2A 1IWGA 2YPZA 2HG4A 4RNHA 1CQNA 4C98A 3CUNA 2XM3A 2DO4A 2YNIB 2IRYA 2V8DA 2MQ8A 3TX0A 2W2OP 2XULA 5K9FA 1S7IA 4IRCA 4AE5A 5RUBA 1DLOA 3CPWR 3EVWA 4J9KA 5HI7A 2ALZA 1DQ8A 4PWDA 1ZM9A 3FEXB 2LEPA 2LQBA 1CJVB 1HBOA 1N34J 1F9EB 1XQIA 2BE2A 2DNNA 1X0FA 4O44A 2RB7A 4ES3A 2VOPA 1LXJA 1YX2A 1C1BA 4KKOA 4AUKA 4PR6A 4KYZA 1YVFA 2J7KA 1BQNA 1O6XA 4GKJJ 2MZ1A 4XAKA 1X9MA 3DYAB 3VTIA 4NMXA 4KTQA 1IBMF 3CCQS 2F5GA 2MY8A 4J9PA 3QWPA 2VJVA 1VC0A 3I0RA 4GVLA 2DNYA 2XG8A 3KHHA 4F4KA 2J0XA 3ILOA 2AMCB 4F4XA 2HS4A 1HNVB 5DM7Q 4UY8T 1ZAWA 4B3RJ 3UDEA 2ZD1A 4A8XA 1OJ4A 3O3LA 3V4IB 1JLQA 3HJVA 1FRHA 2OMOA 5KFYA 4H4MA 2BBEA 2GMJA 5HAOA 1YKWA 1S0OA 2R7TA 3QPIA 3M8PA 4BLGA 3TX8A 4LF6F 3RB6A 1Z4UA 2ZWPA 1V5VA 2UU9J 1Q81T 2MHNA 2J9DA 2F8EX 2XMUA 3BZQA 1Q79A 4YR2A 2QLWA 4LFBJ 4I4BA 2XMAA 4V19X 1P6TA 3MUMP 3FFIA 5ETRA 1V6HA 1H73A 2W4DA 2J8AA 2O01C 1PGZA 3TZXA 4JI0F 4MT1A 3M9NB 3NOCA 3Q2SC 4YR0A 1RT3A 2WAQD 3FSYA 5B0BA 5T14A 3QJJA 1S6QA 1VOMA 2NCKL 4C2MA 4DSJA 1YITS 4EBEA 2PGCA 3TAPA 1UA0A 1U1OA 1HR0J 4E0DA 3T1HF 2CWKA 1X4BA 2V2KA 2GJ2A 4CLUA 2VC0A 4CZCA 1F5AA 4X4NA 3MM5A 4UUXA 4EYHB 2CPXA 5DZ7A 2EPIA 4DV7F 1YQHA 2QMXA 3Q86A 2RJZA 2O1PA 3KLFA 4LRDA 2M8HA 1R6VA 3JQJA 2P9CA 3RR7A 3KNGA 1UAWA 1IBLJ 2HNDA 4JI5F 1R0CB 4IO9Q 1Q0NA 3EPGA 2HS0A 4LBIA 4ZP7A 2YWFA 2RDIA 1FRMA 4OJ1A 3RRHA 4OV6A 4OI6A 2J7UA 1RAAB 4A8FA 2E66A 2GIQA 1IKYB 1BWVA 5LMNJ 4HEA9 1RTIA 3D9BA 4M5JA 3V6HA 2L9DA 4WJBA 1RWKB 2RRNA 5B09A 3BGUA 5K20B 3FGVA 3F41A 4NI2B 2R7RA 5KFLA 3HI9A 5HBMA 2OPQB 4KGXB 2FHJD 2HVDA 4UOHA 3O44A 2UV8G 3ZZTA 1HIYA 3QSIA 4RU9A 4KHMA 3OLAA 3R1HA 2YNFA 4DR1J 4U8VA 1FVSA 2GQ2A 3P45B 1FRLA 2AF6A 2LDIA 5J2NA 1HKAA 2RU3A 3OSPA 1FE4A 1Q78A 4M5GA 1WOOA 1VQYA 2RSQA 3W60A 2MGZA 5KFUA 2OD6A 1OPZA 1IWAA 2IDLA 3LA0A 4ECQA 2BACA 4Y2CA 5K14B 4ZJQA 1Y5NB 1XEZA 3J81Y 1JQGA 5DDQC 3MAAA 1WUUA 3FRYA 2F65A 4AD6A 1AXQA 3ISNC 1DHMA 1NK5A 5HN0A 4MYUA 4ZP9A 5KFCA 4USJC 2ZKUA 4F04B 4CT9A 1OY8A 3CD5A 2D3ZA 1I51B 4WFYA 1L5UA 4NLDA 2NXEA 2CJKA 4WFXA 2BJ7A 3OFGA 2VG7A 4CYUA 1HW9A 3GCWP 3D3CJ 4X62J 1U4BA 2GAHC 1N32J 3C46A 2VFSA 2I5JB 4J9VA 3Q2TC 3DRSB 3VAGA 4L3NA 2ZOMA 1KFDA 2GGPA 1LWFA 3M7VA 1HQEB 4OIXA 2WVCA 5CYQB 1NJYA 3CB4A 3ZTQA 4LF8F 1NM2A 4F25A 5EDWA 3CJTA 2IM2A 1YZ7A 2JL9A 2Z4PA 3SQOP 4K4ZA 2KYXA 4C97A 2MB0B 2AJ1A 2WB1D 3MECB 4DL5A 5KT7A 3SV4A 1IBMJ 2JLEA 4C8YA 2AGOA 1C0TB 1FFGB 3QGGA 3DLHA 2C2MB 2MKJA 1J2VA 2XYGB 3IA0A 3TUIC 1KR4A 3CULA 4CI0B 2MQLA 4CO4A 4UF4A 4PG5A 4EU0A 1CJVA 4P74A 2OPSA 4U9RA 4I7FB 2BVZA 2I2YA 1IQZA 2LDYA 1GH8A 2QE5A 3AB4B 2K7JA 3M8RA 3PW0A 2JEJA 3QT5A 4YB1P 3KK1A 3EWGA 3N79A 2J5AA 2QIFA 3QMQA 4WK3A 3CT9A 4LF6J 4WCEQ 4PWUA 1NK4A 1QY7A 2B51A 2VPWB 2WVBA 4OHXA 4RBTA 1B7YB 1HNXF 4ZITA 2UVVA 2N82B 4O3PA 3GJRB 3I55S 4ED8A 5THWA 2E5GA 3MEEA 2Z2LA 1HNVA 4PZVA 4RBVA 9RUBA 3CDUA 3ZTRA 4J9RA 2QJ3A 1OPIA 2D3O1 1H2VZ 1UVLA 4I2QB 2JNJA 2R7XA 1FKPA 4FZVA 1GQEA 1WKLA 2F9JA 1DTQB 2FVPA 1T3NA 1S10A 4KGMA 4U7CA 2IC3B 3WHIA 2H9ZA 3SXLA 3T1HJ 4IUFA 2CNKB 4FS1A 4ES2A 2VQEJ 5JMNA 3LGHA 4A47A 3RBZA 2ZE2B 3A8EA 1FK9B 4DV1J 3J7ZT 2V8PA 5L46A 2QLXA 1BD6A 1H98A 3B82A 4UZCA 3FJ2A 1YI2S 4MKVA 3J80Y 3GSDA 4ELTA 3EGWB 4JOUA 5HK4A 3OW2R 3C66A 1RT6B 1Q1KA 3GFYA 2H1YA 2IMOA 4RZRA 2LXUA 1Y0HA 2Q79A 1VBYA 4IKAA 4AQYF 3TOQA 3V6JA 2RRAA 3KUGA 2DY9A 1KNZA 4F0KA 1VFJA 5B08A 1RT2A 3HVRA 2CJAA 4OYMA 1KKHA 3MEGA 3CJ0A 1U26A 4U8YA 4ZCIA 1F60B 2Q3PA 1KD1T 1RWUA 2C2EA 5D0RA 3TAQA 4DX5A 4TU9A 3W8GA 5DLGA 1YLXA 4V19J 2KYZA 2OEMA 4MIWA 1RKJA 2XWXA 2JFDA 4A8WA 2KDOA 1NUEA 2CFXA 4JV2A 3KLGB 5CA5A 4OFZA 5CYMB 1HYSB 5IM0B 3HSJA 1MWZA 1SC3B 1L3KA 3CJ8A 1QAIA 4UY85 5DQIA 4LBPA 2XCAA 4EBCA 2CJXB 1SJ3P 2CAJA 4M63A 5KFXA 2J6SA 4NI2A 1BQMB 4X4QA 3T9NA 4I56A 4J9LA 4QYZJ 2C3PA 3RAMA 3BJYA 1LWCB 3ENVA 5KT2A 3CJ2A 2EKYA 2IVYA 2HQDA 3MPWA 5CYJA 2PO4A 1D8YA 2E7XA 1ULRA 2CVIA 1UVKA 2KZMA 1HNIB 1K47A 2YKAA 4GC6A 3MAHA 3W63A 3DOMB 4KRWA 4OZ5A 3PJXA 4QIEA 3DXBA 2VU5A 3UD3P 3H20A 4IQMA 2W4PA 5IQ6A 4K5RA 2ILYA 2U2FA 4CH7A 1MROA 1R8HA 3F0NA 2XYPB 1RP5A 1MG7A 1U1RA 3AJ1A 1FESA 4IH5A 7AT1B 2ZM6F 4DI6A 4DFMA 2VONA 1TAQA 4NE9C 2HFUA 3S7RA 1FDBA 5K14A 3QRQA 3W2WA 5I42A 2AHOB 3LP0B 4OI0A 6AT1B 8ATCB 1X7VA 4FVCA 5F3TA 3IRWP 3W7BA 1TVRB 2HRTA 2VUGA 4LF8J 2CZ4A 4F8RA 2MJUA 2R8HA 4J37A 3B8HA 3THPA 5D15A 4RL1A 1VGYA 3ZFVA 2GMHA 3FQKA 2BJ1A 3D4JA 1NK6A 1VLOA 2V69A 3H8YA 3EZ5A 3G6XA 3MOJB 5KG1A 2DCLA 3MUVP 3T19A 2ZOGA 3AJ2A 2I5JA 7FDRA 2B0GA 3DRSA 2QX0A 5EX3A 1HQEA 2M4MA 4PG6A 5CYQA 2CDRB 2BW7A 4HACB 2LECA 4EK2A 1WOPA 2Z0GA 2QA4S 5LM7E 3CC2S 5B0EA 1IN0A 3NCPA 1HHQA 2MQPA 2VZ9A 6FD1A 3U02A 2KFNA 2RF2A 1CLFA 2GFFA 2WONA 4P7VA 4M1KA 1QAXA 3MECA 1NHUA 3DOKB 4KGVB 4MYTA 1C0TA 2GW8A 3QSYB 4WU3A 4Y3CA 2GVDB 3QAUA 3KK2B 2D1CA 5LXRA 1HBNB 3NNAA 3PYEA 1HNXJ 5DG7A 4DBQA 2R7UA 2EC0A 3WIVA 2DR6A 2JHEA 2MKCA 3M8WA 1CC7A 3IM9A 4RNNA 4KO0B 2DB1A 4DR6F 1AZSA 2WSEC 2NR0A 3R1LA 3PY8A 2HBQB 4RUCA 5AT1B 1UKUA 3S6EA 3H59A 4LMZA 1HQ2A 5F8NA 5D0GA 1RGVA 2F4FA 3EGNA 4RO0A 2R7VA 3ZO7A 4OJHA 2HHSA 2FLPA 1B7FA 2JVRA 4DV4F 1HD0A 4KE5A 3P8BB 3DXSX 2JRSA 3TVKA 4YEAA 1KSPA 1FDNA 3GB0A 3KHRA 3P49B 4DV0J 3R7NB 4F4WA 1P9YA 4CM0A 3HKZD 3N6LA 4L76A 1C4AA 2E5HA 3D68A 3I82A 1DTQA 3G6ES 1HNWF 1RT4B 5DO2A 2IC3A 4RUBA 1PAUB 5J2MB 3KDNA 3CC7S 4AQYJ 5AJ3F 2XGQA 2WVEA 2IBKA 4G6VB 1HFEL 5HLFA 2IA6A 2HRYA 4FF2A 2B8QA 1K44A 2ZHOA 1WSVA 2ZE2A 3P5TL 1FK9A 3SFUA 2FJVA 1BMQB 1N36F 2W2QP 3IBCB 2A6MA 2BXJA 1UJ6A 3CMES 1WDTA 4L6V3 4R25A 1RT5A 6FDRA 4JV5F 5IOLA 1U02A 2N4CA 1FKOB 2XYHB 3C15A 4C9DA 1LFPA 1Y3KA 1G2EA 5B7WA 3RB3A 3VVTA 2J0WA 2YH0A 1WNEA 2NQPA 3DMJA 1UWAA 2DXEA 3VCDA 4F0HA 4B3OB 5KFWA 4DPOA 2HKEA 4TQRA 3MF5A 1EP4B 2DYAA 2D74B 3DFEA 4DG1B 2F7VA 1KN6A 3SQGB 1PJ7A 1X5TA 1N54B 2YBVA 2GA7A 2W9BB 2ALYB 1UJ5A 2A1BA 5DQGA 1UW4A 1U7LA 1CJKB 2DY1A 1HBMB 2VKZG 3MEKA 4DX6A 2LFVA 2KRRA 3R5JB 4Z2XA 3I56S 2MKKA 2EK1A 1X5SA 4ECZA 2L9WA 2OEJA 1HYSA 2E7VA 4MH8A 5IM0A 1REVA 4CO2A 3HFZB 2GIRA 2BX6A 2Y1IA 3CCES 4NX9A 3OT9A 3TJ8A 1SKWA 2GJIA 4HTIA 1DTTB 1QLNA 2LQJA 5KG0A 2W1BA 4RW8A 2ZM6J 2FIUA 3OJSA 2M5YA 3PW2A 4FF1A 4NLUA 3OFEA 3CJKB 3K5MA 1S1UB 5D77A 4ZCKA 3FSIA 1ZA1B 1HNIA 2OHDA 2G2OA 4LREA 4ZLNA 3DOMA 2LQ8A 4DFPA 4XO0A 2RDDA 1R31A 1KTQA 3SCLE 4U96A 2XMJA 4IOAQ 4K2JA 5DG8A 4R8UB 3GR0A 3LOUA 1RB0A 2QT7A 1NPRA 2CQIA 3D28A 1MMDA 2QN6B 3HKWA 3AY0A 3MR6A 2DH7A 2RD5C 3LP0A 3FKBA 3UPFA 1VCTA 3EX7B 2VKRA 1OSDA 1N0VC 3RAQA 1TVRA 3ISND 4QCLA 1N5YB 4DSFA 2LMIA 2QSWA 1B0PA 2LP4A 4TNOA 2X3GA 1SVDA 1NSQA 1R0AB 4Q2MA 2IM0A 4K4WA 3ZZOA 4ED1A 2VASA 3QLHB 2MQQA 3ZZZA 1NMEB 3BGLA 2ZNZA 4ECTA 4FXWA 3JQKA 3J81U 3GIKA 4M5IA 2AP6A 5GAEU 2KM8B 3H5YA 3AXKA 4BWJA 1YBTA 4EO8A 4NZ6A 2DGQA 4M5LA 1CBKA 1RWPB 1FXRA 2ZC4A 3M1VA 2BKPA 3WC2A 4QYRA 2CJYB 3GIIA 4HACA 1VQ5S 2R8KA 4YP3A 4RU2A 2DGXA 5KFHA 4DR6J 3OUYB 2Q1LA 2OH2A 4ZVQB 2JZ5A 4DV6F 2LEBA 1FX2A 2RQCA 4KV8B 3PV8A 2L3MA 4B02A 3K8VA 4W98A 4Q45A 3TJAA 2Y0SD 3MGJA 2MQNA 3T5JA 2PMZD 4N8NA 4DF8A 4IFVB 1FI4A 1K0TA 2K3IA 3MM8A 3CCTA 2GVDA 4WFNQ 1GX5A 3KK2A 3RBXA 3NWGA 3MPDA 5IT0A 1FA0A 2ZZNA 5DDRC 1YIJS 3MCOA 5GAHU 4DV4J 2J9DE 2D9PA 3DLKB 4KO0A 4CO3A 4DR3F 4PCQA 1NSKL 2XZTB 1JXEA 4M8LA 4LR7A 2XMWA 2R2UA 4OZ0A 4CQ1A 1UEVA 4KY3A 3ZZRA 2G13A 4ALZA 5A0YA 1HNWJ 3KOAA 3GV8B 3ILLA 3KLEA 5AJ3J 1FDAA 3KUEA 3CD7A 2CUYA 2XLKA 4DL0C 2H65B 2J76E 2WB4A 2FY1A 3AHPA 3TVYA 2NUUG 5LOQA 2BYCA 4OX7A 2AZ3A 4FP9A 2IJNA 4EUVA 2V6AA 1NSPA 4M5HA 1N36J 1S79A 3CJSA 3CJQA 5KOWA 3W5ZA 4QWDA 4DQSA 4FNHA 4WFBQ 3BN7A 2UUBJ 4DU8A 4CH1A 2MTLA 1JWWA 4RUHA 3H5UA 2E5JA 1X4EA 3W62A 5J2MA 3MCMA 2N3LA 1RWXB 3V81B 3OJUA 3M6VA 3GP9A 1ZPWX 1UA1A 1VBZA 5AE3A 1EAYC 2CQ2A 4EFAC 5D0EA 2GAGC 3K89A 2HHXA 1LKZA 2IY5B 2PE8A 2YNHA 5E2QA 4TLQA 1HW8A 5L1JA 4R5PB 3R5DA 4B3SJ 1RTDA 1U1NA 1VIXA 2BV3A 5CQGA 3BYRA 1FKOA 4F4YA 2CKWA 2ROPA 3HDSA 2L9NA 2C28A 4LSZB 2QYCA 1UJ4A 1DRZA 3GIMA 3PYDA 4B3OA 3T5KA 2NZ4A 4IFYB 4K4SA 4DG1A 2OKQA 1CJUB 3CJ3A 1H7WA 3BDEA 4JUZA 4CNYA 4KIAA 4YDXA 2R7OA 1RSCA 2W9BA 1HI1A 1ZAXA 3N28A 3QIDA 4GO5X 5GVQA 3HD2A 2W7AA 2ADCA 1S99A 1HBMA 2KB2A 1X9SA 4YDDB 2CDQA 4JI8J 4BBYA 3BGOP 2PMWA 2HSEB 3CO0P 4OYWA 1APSA 3CGIA 2IBOA 4PQAA 4P7TA 2V9WA 4YMEA 4DV3F 3A3NB 4K50A 1KVKA 4FYXB 2DXFA 1SL0A 2ZH7A 1DTTA 1SQEA 3TAMB 1TKXB 3U1MA 1WKJA 1YJNS 3EICA 3FNNA 3D1QA 4DSKA 3M2RB 4X4OA 2DK2A 3BR9A 3NGSA 4LIRA 2M3DA 3CJKA 4EZ9A 1S1UA 3VAHA 3UN5A 4J9NA 3P96A 1FNMA 2XMKA 2NLWA 4N8OA 3SIPB 5I3QA 2V4JB 1NJZA 4EO6A 1Q4RA 4PAAA 1KFSA 1I5OB 1UEUA 4K4YA 2ADBA 2R42A 3HZEA 3QJPA 2V67A 1HWUA 1IR1A 1FCAA 3E8OA 3CCZA 4R8UA 3CIMA 4PXCA 4NLTA 4Y6IA 2HLTA 3HF5A 3RUBL 2CZ9A 4KFBA 1T9YA 2X1BA 3RW7A 2DNQA 4FF3A 4RLEA 3HHKA 5A76A 1FRIA 1KHWA 2AIRB 2V0NA 3QWUA 2CG4A 5L1KA 3TUPA 1Y11A 2DGUA 1S76D 2HAIA 1ZBTA 2ZH5A 2HZCA 3G82B 3QLHA 5IWAF 4DV6J 2W2PP 2HNZB 1QE1B 3N6NA 1SQFA 3UD4P 4C11A 2IPOB 4NMLA 2VICA 2QRRA 4ZOSA 1UZDA 3ZNJ1 1IKVB 4RUAA 1VQ7S 5D8HB 3FQLA 4PABA 2N3OA 4UOFA 3PM9A 4H4KC 2LVWA 2EWHA 1Z1ZA 4Q43A 4LF9J 1OY6A 5KG7A 4NLYA 3IG1B 4UQTA 2HFOA 2XTJP 3D3BJ 1XR5A 2JEFA 5BXIA 4DR3J 2R3VA 2Y8YA 2HS3A 3ZTSA 4MKAA 2AEMA 4A8SA 2PN6A 1HBUB 5L9XA 1TK5A 2XZDB 4FNIA 1Q8KA 3CE8A 3WBZA 5L1IA 2E9TA 4LSNB 4ZP6A 3T6JA 1JLCA 5ETSA 1Q53A 2MKYA 2FDNA 1FT8A 4Y34A 1SJFA 5GMEA 4RW4B 4ATNA 1TKZA 3ICLA 3D7SB 1XMQF 2PFDA 3SBMA 2E1CA 2D7SA 3RG6A 3MD1A 1O8BA 2I1RA 2AGPA 1ICEB 1N88A 1WEYA 1QVFR 3D6HB 1BE4A 2OFHX 2FVSA 1A7GE 4QOTA 1DURA 4B3TF 2C42A 2G1DA 4I64A 2K3KA 2OPRB 2ABYA 1T05B 4I68A 1WC3A 5GAEI 2GC8A 2ZBRA 4WE1A 3IC1A 2QG9B 2PD1A 2AU0A 4DSIA 4DHVA 2VPYB 2PSZA 3G96A 4TYAA 5C24B 2MSTA 4W90B 1TK8A 3G86A 5ETNA 2AV5A 4N5SA 3KJNB 1MMLA 3KTQA 5C25B 2FPHX 4OX6A 4G3IA 4IO1A 3IXQA 3RAXA 2QA2A 2HAFA 4PG4A 4DXLA 3GJSB 3NL0A 1GX6A 2L08A 3THTA 1OYDA 3ILIA 3QBCA 4N41A 3K17A 4CLYA 5L9NA 4CDIA 1BQXA 3IO1A 5T7LB 4A8OA 5KT5A 5GAHI 4PXBA 1EZZB 2LU1A 1TL5A 2XNRA 4R5PA 1VRUB 4H4KA 3QT6A 1RUSA 4ZHRA 4J7CA 1GAOA 2KFZA 3PKMA 5HJXA 5G4DA 1ZS6A 1RCOB 2HHUA 4URQU 2W01A 4KPCA 1K0VA 5B0CA 2HK2A 2CA9A 1WEXA 4ZVOB 1LW2B 1RTHB 3AD9C 1NXIA 3NMRA 4IFYA 4G65A 4OI4A 1CJUA 2HVZA 2B5JB 4N77A 2B3TB 3IR7B 1F5BA 2FHMA 1N5TA 1P27B 5KFEA 5DZ6A 4IG0B 3EXCX 5DJBA 4ICLB 1WF2A 3AT1B 4ECXA 5D3GB 3MR7A 5IS2A 2BM1A 1X5OA 1FVQA 3GCXP 4D3GA 5GADI 3NEKA 3K5NA 4LQ9A 2MYFA 4DOZA 4ZPAA 4Q2LA 1FEHA 2HQ3A 1S0MA 1HNZF 3M2VB 2C1EB 3TQ1A 2OFGX 4FF4A 3AQOA 2ZITA 2FLOA 1TKXA 4C3LA 2HK3A 1FF2A 4LVNP 2DHXA 3M2RA 2OI2A 3KWMA 4N47A 1HL6A 4R0JA 5F9NA 2ZZMA 5ETPA 4IR1A 3N0VA 2LA4A 1LW0B 1U6BA 3D6MB 2ZVSA 3IAS9 4W4MA 2OJ3A 3JAMU 1BGXT 1TL3A 1SB6A 4USVA 1K9MT 5F3ZA 4CLPA 4NXMF 2MJNA 1CULB 1OQ3A 3EM1A 2QC3A 5F8IA 4OI2A 2QV6A 3NGDA 5IWAJ 3CCLS 5KFPA 3CCWA 2R7WA 3NY0A 3H0PA 4DQPA 1FD8A 4JI7F 1S0VA 3LUYA 1VISA 1I6JA 1RBLA 4DUTA 2LQ5A 1NDPA 2VPXB 1IR0A 4MMOA 4NZ0A 2C22A 3PYGA 4OX9F 3KK3A 4DV2F 2XI3A 5KFSA 1WTFA 3DRXA 1BUXA 2QLFB 2MZSA 2AT1B 1LXNA 3G82A 3OTDA 1RYRA 3NGTA 2QZ8A 3GLJA 2UV8A 5HQLA 2W9AA 2HNZA 1QE1A 4NXNJ 1KTVA 2K2PA 2BABA 4RR5A 1H7XA 3MOZA 2UXCF 1RA7A 3CF5Q 1Y3JA 1HA1A 1IKVA 3LO3A 3IMQJ 2BR0A 2B7BB 4X65F 4E2FB 2KRBA 3Q8YA 4PXDA 4DPTA 4ZCMA 4GMKA 4WKRA 4WZMA 3RRKA 5DQHA 1EIYB 5D4LA 1JK9B 5A8KA 3TARA 1NK9A 5B0GA 3X1LB 1O51A 3UNGC 5MAOA 1R0BG 4OLOA 2FJEB 4ZVTB 1WC6A 3NGKA 2AD9A 3PO5A 4I6WA 3QGPA 1UFWA 4DR7F 3BKTA 5DDPC 2ZUGA 4B3TJ 2J0QD 2HRUA 4ZK7M 5FLXY 3CJ5A 1M5HA 4LSNA 2H54B 2PFFB 1IJFB 1LWXA 4Y65A 3CDEA 2DH9A 1DAXA 2BE2B 3OXGA 5AXNA 3L95X 2QEXS 3G87A 2FC8A 3L7PA 1MN7A 1E6YB 4P2FA 4M94A 2VODA 2FZGB 2Y0BB 2JDJA 3QT8A 2AZ1A 3C3LA 3ZTOA 1OYEA 2V4QA 4K5SA 1MWYA 2CQ0A 4L74A 3N5FA 2DTJA 5CABA 3I0RB 3I87A 2B43A 3S1TA 3MPVA 2FHKA 2OPRA 3KLVA 3LP1A 3HO1A 2MQOA 3LALA 2IMWP 1KVJA 3FEZA 3LF0A 2ROGA 1JLEA 2DR9A 4WP8A 3CSKA 4NCBA 2HFNA 3V6DA 2VV5A 4K59A 2NZCA 2W2MP 2YXLA 4H4MB 3QRPA 5C24A 3P3DA 3OPKA 1S4FA 1T0TV 1JXLA 1Z2LA 2E1RA 2KTQA 1B64A 3SZ2A 4KR0B 4TKTA 3BKUA 2G9OA 2Z2YB 4ETZA 1VQOS 1T9UA 1G7CB 1WG1A 2JC0A 3JSYA 5C25A 5KG2A 2YWWA 3KXDA 2G2ZA 3EMTA 3JTOA 1URNA 3BBCA 1Y7PA 5H9FJ 1RACB 1WHVA 3EDQB 2H5EA 5T7LA 3K5OA 1WI6A 2UUTA 2B7CB 4QYZK 5L1LA 2OGUA 4O4GA 4U95A 1VRUA 3VGSA 4DL6A 1B0TA 4QR1A 5ITHA 1S1TB 4C48A 1L3UA 2DNRA 3PVXA 1SC1B 3F44A 4DZDA 2XS2A 1LW2A 1HNZJ 3BO3A 1NKBA 1OSCA 2CADA 3IR6B 2AWZA 3MM5B 4PKDB 3UO0A 3VGTA 1HWJA 3CW2C 2KXFA 2G0CA 2AJ2A 5I3UB 4IG0A 4ICLA 1N6QA 1GXTA 1TV6B 4F0MA 1L3VA 5B0AA 1U6FA 2MZRA 2ZBQA 2QA4G 5LSOA 2GV1A 1R43A 4DPYA 1E6VA 3WIUA 2DGWA 2X1FA 3BQ1A 1V3ZA 2VC1A 2LXIA 4DSLA 3FCVA 3SSSA 1H6KX 3TNVA 1IVZA 1D0EA 1DY3A 3M2VA 2J9CA 4F50A 2BOPA 4O3OA 4NXMJ 1RK8A 1XR6A 1V3SA 1I1GA 4PG8A 3AA8A 2DHSA 4JI2F 1CQMA 4JI7J 1WG4A 4LFAJ 3QO9B 3QATA 3H4BA 3VQSA 4DPWA 2RDJA 4J91A 2UUAF 2KT3A 5K8NA 2KU7A 2KO1A 4JI1F 4O0IA 4EWTA 3FC9A 2YNFB 4OX9J 3H25A 4DV2J 2HQCA 2RNEA 3JXOA 1I3OB 2EVZA 1ZZNA 3FVYA 2OAUA 5LSRA 3R5AA 3DOLA 1Q86T 1JJ4A 2QFJA 2MGZB 2IRUA 2CZVC 5HATA 1XNRJ 1BWEA 2Y1RI 2IVFB 2CQ4A 1NH7A 2UXCJ 2IFXA 2IYGA 2MY7A 4X65J 3MAAB 4QW8A 1FTRA 5KFBA 3UNYA 4K4VA 5FD1A 2FJAB 2GHPA 4WIIA 3V6KA 4EEYA 3B54A 3MWBA 3T41A 2WRMA 1FKAF 2E7WA 4C0BA 1YSJA 2ATCB 1AROP 1Y5LB 2Y1LB 3V4MA 3I32A 4CYUB 3Q22A 2C2KB 3PHEA 3UE2A 3OR2B 4Z7YA 2FLNA 4WWSA 4DR7J 3PEHA 1YG0A 2JLFA 3BB5A 3H5XA 4PPZA 4HI2A 2GGPB 4S0MA 4ETXA 4UUWA 1ZPVA 2VBWA 3UDVA 2OSRA 3W2VA 2B9WA 3KNAA 4J5OA 1S1XA 4X4RA 2A18A 3EJMA 3ITHB 1MSWD 3BSOA 3NBPA 2KVIA 3R5GA 3FSXA 4A48A 5EWGA 2G4BA 1GNKA 1C1CA 2CPDA 2VPZB 3P6YC 5KFJA 2VB6A 1ZH5A 3D67A 1NKEA 1JB0C 2WZ1A 2DPIA 4ZS6A 1RHRB 4KHRA 4RNMA 2OPSB 5KFMA 3OV7A 3MI7X 1W26A 4ZVEA 1NDKA 3PEJA 1RABB 2E1PA 4AL6A 1UCNA 4CLZA 1E6YA 3KK1B 4TLRA 3ISZA 1VYAA 4DFJA 4LSLA 4UQGA 2DNOA 1RAFB 3UVJB 2I6WA 3TVZA 3ELHA 4WZQA 2MDAA 1ZM2A 2PC6A 2HNYA 2X1GA 2DITA 2AYMA 3TZYA 4P6QA 3H2LA 3W3SA 4RW7B 2FVCA 1TKTB 3ENWA 3AOBA 3MD3A 4IOBA 4DUZF 3AFGA 2KJVA 1HMVA 3MEEB 4X4SA 3G2XA 2D3OR 1FJEB 5DM6Q 1RBAA 4UTGA 4YN3B 3TA2A 4RWWA 5E3QA 2OPPB 5C7PA 2MSSA 4CLKA 4CIOA 3NGRA 3R7SB 3PX0A 1FKPB 3EDRB 3HHLB 4F2RA 1T02A 3EXYA 1PCAA 2WOMB 3O6QA 2H48B 5BJRA 1GMUA 4USTA 1LQ9A 1ZM4A 1LFWA 2CXEA 2DNGA 2HHHF 3QJLA 4I67A 3PJWA 4WYLA 1PO6A 1H38A 2DRDA 1SL1A 3Q0AA 3QQCD 4X4PA 2AJ4A 1KC8T 4PQUB 3JTPA 1PSDA 4OZNA 2YY3A 2BJ8A 1W25A 3RTVA 3PRDA 1IR2A 3KJVB 3Q8RB 4OLPA 4ZJOA 2JC1A 4JI4F 3HHDA 3HSGA 5DG9A 3FCWA 2X3DA 2QTWA 3M8SA 4NLGA 3DI6B 4K0KF 2V2VA 1S1TA 2AGQA 1IQTA 2DPJA 3HVWA 1AYEA 1X60A 1RT2B 3BH6B 1RWVB 4TQSA 2IM1A 3MEGB 2CYYA 5KFOA 2GVZB 1YJWS 4NEYA 3Q8QB 4ZVUB 3QNWB 5I3UA 4QIFA 2K1RA 4WBFA 3M6UA 4JI2J 3PW5A 1TV6A 1H74A 2HVHA 2ASLA 2XCPA 2DR7A 1NZ8A 3KHGA 4R0EA 4Y2AA 2QMWA 1RT7B 2QL7B 2UUAJ 1HI8A 1J5OA 4JI1J 3SCIE 2A0FB 3T5LA 3VAKA 2VOOA 3BGRB 2DBBA 2RH3A 2PA8D 3BH7B 2RVJA 3GV5B 1J27A 3OXLA 3DRPB 4DUYF 4AL7A 4LF4F 2BDPA 2RIJA 2UVRA 3QO9A 5E33A 3M32B 3NXZA 1RCXB 2VIHA 4AT1B 4NCGB 3R6GB 5CXTA 4ZVGA 4PYAA 3BR8A 4USHA 2CJQA 3LWLA 3CCJS 4MFBB 3PR5B 3R5BA 2HPUA 3CO9A 4J9UE 1UVNA 2KG1A 3PRVA 2DJWA 2JOQA 1D9AA 1U49A 4NYZA 2GO8A 2Y1JA 3N01A 4JB8B 3K5LA 1NPKA 4FN5A 1MROB 1NK8A 2DD8S 1RZMA 3PIOQ 2N7CA 2BM0A 3KMQA 2AJFE 3R3TA 1SV5A 2PIIA 3WDOA 1ZZFA 1S1WA 3FMBA 3W2WB 5I42B 3ZZPA 3HHLC 4ZKAA 1MU2A 1AA1B 2XHWA 5AXKA 4HR2A 3DN9A 2JSXA 3A8IA 2M0GB 3NWRA 3KG0A 3T1AA 4ED5A 3R7BB 5JVHQ 4ZVSB 5HJYA 4TN2A 4KGKA 1HQUB 3IS9B 3TUJC 5LMUF 2GMLA 4KHPF 3EPIA 2NXJA 4P10A 3MPYA 3NGUA 4RPFA 3GYNA 1S4EA 4TYBA 3OR2A 1L3TA 4DCOB 3Q8VA 2NYHA 1R8AA 5K5MA 1Q95G 1K73T 2W25A 4RNOA 1XMOF 4YS2A 1YRUA 2UVUA 1XIQA 2IJRA 4NOHA 3MMAB 3LTOA 3WX4A 1KHVA 4ZPWR 2VL1A 2PDAA 1IXKA 3DCAA 1SIZA 2DR8A 1FRJA 2EBGA 1NK7A 4BDPA 4AYBD 2RAQA 2YPYA 3I5AA 4ENOA 2VH7A 3H98A 3GYXB 4G1QB 2ZNYA 3ITHA 2RF2B 2UUWA 2WONB 4LF5F 3HPOA 3BYPA 1ZM3A 2GCFA 1TMMA 3ZTPA 3OVAA 2LXFA 1H3DA 1Y9OA 4KQZA 3CDWA 3FZ2A 5BYQA 2I9SA 4CWBA 4OZLA 3DU6A 2J7WA 4TU7A 3U7JA 3LH2S 5F8HA 4DCPB 1P8GA 2RRBA 2ZH2A 4DUZJ 2F3JA 3W66A 1JMTA 1B3TA 2V2QA 4NCAA 3MXHP 3C16A 1QAJA 2OO4A 4CO5A 1RLDA 4ED3A 1RQ0A 3GYGA 1RAOA 3PACA 1AZSB 1RAGB 2FUG9 3UFCX 4YY3F 3PDNA 2HIYA 2W24A 3P4UB 4DV5F 4ECVA 3M4XA 3UVJA 3NKYA 2Z56B 3FK4A 1U1LA 1VQ6S 4V1Ak 4DCJB 1FRXA 4YR3A 2HHHJ 1NCLA 1J5EF 4RW7A 2CQ3A 1TKTA 1GMWA 4TY8B 1N56A 3GPAA 1TL1B 2ZWOA 1UVJA 2C3MA 3MHYA 5KFFA 2WK4A 1XK8A 2V8GA 4JI0J 2OLWA 4ZVFA 4C8ZA 5CCLA 1RAIB 2OPPA 5KG6A 2ZEJA 1FHTA 3HHLA 1JLGB 2P5VA 1SH3A 4JI4J 1PBAA 2WOMA 3PJ9A 1NB7A 5J2PA 3NOGA 1N52B 1SBRA 5KFIA 1IKWA 4LR8A 1NPPA 3TYTA 4K0KJ 3KLHB 4FVMA 2FZKB 4JV1A 3ZZ0A 4NA2A 5HLFB 2QGFB 2YWEA 3KG1A 1B4SA 4Y00A 1V9OA 1SKSA 5CZVA 4PQUA 1Q5VA 4ZLLA 5ETLA 3D0GE 3JYTB 4DV7J 4HH0A 5B0FA 3TJ9A 2V63A 3KJVA 1RT5B 1WKKA 3DGPA 3C15B 1LEOA 2YX4A 4WIQA 2R2RA 2NYIA 1WJ9A 3DI6A 4E8UA 1RTJA 1FDDA 4JI5J 3DMJB 4NLOA 4URGA 2VDIA 1S48A 1AB8A 4LF1A 3ZZYA 4I1TA 3O2IA 2AYBA 4Y2KA 3C14A 2HBYB 1C0UA 2R7SA 3TI0A 1NRKA 3CCMS 2GVZA 1QD1A 3N4WA 4DUYJ 1RKIA 4HYKA 4LRCA 5HP1A 4LF4J 3VAMA 3SSQA 3HD1A 1CVJA 2NXUA 4L72B 2MXYA 1WHWA 1N8RT 3OVBA 3GR1A 3I4HX 3DRRA 2UXDF 1RT7A 1G6BA 1REVB 2O5DA 4M5KA 2R4FA 1U2CA 3BGRA 7FD1A 5FDLB 1KRPA 1X4DA 1T94A 2DVIA 4YFUA 2Q6BA 3VWSA 2I38A 4ECRA 1K1QA 4P72A 3AXMA 3DRPA 2VG6B 1TFYA 1R8PA 1QSYA 4HT5A 1BLUA 3FEYB 3ULHA 4RW8B 3MMBB 2RQ4A 5IT4A 3QIPA 1EX8A 1NBEB 1IBCB 3ET6B 5BR8F 3GV7B 2ZVIA 3M32A 5DRKA 3BSNA 4B9UA 4NCGA 4LRBA 1PILA 3OTEA 3FBCA 4MFBA 3OQ2A 4TU8A 1DBDA 3NCQA 3TQEA 2ZBCA 3I9ZA 3L09A 1U8SA 4KGZB 3TZZA 3J7A1 5LMUJ 3ILJA 4KHPJ 2VFRA 4NA3A 5EHHA 4DQQA 3HVTA 3RU0A 5L39A 2VBYA 3OR1A 2A2CA 4F4AA 3EVOA 4C6AA 4F3MA 1SJQA 4M5MA 2YKOA 2H4YB 3Q89A 4IQXA 4DS4A 3JTNA 4A8KA 1S59A 4CO1A 1WF1A 4PXEA 1KWMA 2XLJA 1A0OB 3FUYA 1HQUA 2M9KA 5CZXA 3IS9A 4J9OA 3C6TA 4DLEA 3M30A 1KQFB 1CSJA 3MM9B 3H42A 5KTQA 4FYYB 1MWQA 2BQ3A 1VHFA 4PUOA 3L3CA 4IH7A 2ZH4A 3K8WA 2CJ9A 1HR0F 2FGOA 5E5NA 1WWHA 5IZHA 5KFDA 3M1VB 3MMAA 1DFDA 1AW0A 4ED0A 2EFQA 4OYXA 2KT5A 4YY3J 1JXVA 4G1QA 2FB0A 1TAUA 3ETMA 2KG0A 3U1NA 2RHQB 2DNHA 4DV5J 5SZTA 2EKNA 4IDKA 2W7OA 4F02A 3I4PA 2P6SA 1WELA 3MM8B 1QVGR 3CD6S 1XJWB 2UP1A 1YRXA 1HLWA 2W8KA 3QFWA 1J5EJ 1X31C 1F2HA 2P9GA 1Z2ZA 5CD4H 4C8LA 1Q8LA 4KT0C 4DEZA 3LPYA 1HI0P 2MEWA 3BV8A 1KOHA 3TP2A 4FPIA 4OYBA 1TK0A 5CCMA 4D3HA 3VAIA 2F63A 2C2OB 3OVSA 1IKXB 1M90T 4EMDA 3HVAA 4C0OC 1I94F 2M52A 5K8PA 5A0YB 3I9V9 4MK8A 3KFWX 3MM6B 4JP8A 3TR5A 3KLEB 2XMMA 1ELOA 2F1FA 4DR1F 1QAYA 1GXUA 3JSRA 5A8RB 4TY8A 2HQGA 1U48A 5EWEA 2HYIB 2OIHA 1TL1A 1XC9A 4WU2A 1SUQB 1KQGB 3J7YU 3T1YF 2ZH6A 4KH1B 1S77D 3R97A 5HMYA 3A8KA 1XERA 2BJDA 1F1BB 2WSFC 4NEZA 2HURA 8AT1B 3NAHA 2WCXA 4U7UD 3JB9k 1JLGA 1UMJA 1O0PA 2DRAA 4IH6A 4BS2A 3DLEB 5IV3A 4PYDA 5EGYA 2GX8A 3KLHA 1RDRA 4NLWA 2ASYA 2BQUA 5B0DA 5F8JA 3D54A 3KLIA 2YVSA 1YK9A 3BKFA 1SL2A 2ZJQQ 4HT7A 3CC4S 5J1EB 3CEDA 1TZ0A 1VK3A 4CLTA 3JYTA 2YNHB 2CPHA 1M5KC 1S9EB 4USKA 4X62F 2HHTA 3GIJA 1RA6A 1N32F 5ETQA 1RTDB 2XQCA 1RISA 3JS9A 2J0SD 3KJQB 5ETOA 2UXDJ 1JIHA 2CJBA 3PR4A 1VLYA 3GWCA 4Y0FA 1IJEB 1VJQA 3WC0A 4MKYA 1T3OA 2MZQA 2P2CB 2BJ3A 3POTB 3PYFA 4X2BA 1D3WA 5KG4A 5AXMA 2W2NP 1Q7LB 1AUDA 3OFFA 1YBAA 4OHZA 5I4MA 4YOEA 3BPSP 2ZJPQ 2YWKA 2CQCA 5HMZA 3RBDA 4J9QA 1GTHA 3LWMA 1TELA 3D1HA 4MIBA 4PPDA 1JLBB 3PRBA 5BR8J 4O3SA 3N6MA 1X4GA 4QR0A 4P73A 2RMLA 5A8WA 4P2SA 4DN0A 4LRAA 1WG5A 1B70B 5FDLA 1N5VA 2AEJA 4FXDA 3UN3A 1B0VA 5J2QA 4LT6A 2VG6A 3MFHA 2B4UA 2NSBA 3VR1A 3R2CJ 1T9XA 3MMBA 2VG5B 3ET6A 3BSCA 2ZHAA 2GS8A 1UW9A 4NLRA 1VQMS 3B4DA 1LK5A 3W5YA 1X4AA 3D1OA 4C0HA 4ZA1A 4BC7A 2AYEA 1UWBB 3CWJA 4ITSA 5C42B 5ADZA 4UT4A 5CD4A 1Q5YA 3HSDA 1MLAA 1GMWD 3UCUP 2HQFA 2HGNA 5H9EJ 2HVIA 5IC6B 3OSNA 2HHQA 4XDDA 2KHCA 3N9UC 3RRGA 2BE7D 4ECSA 5CHCB 3BPDA 1TL7A 4KFBB 2XMVA 1XBWA 3M8YA 3PIPQ 3HHLD 3PFEA 3E2EA 1NHVA 5KFAA 2VQEF 3ENQA 4LUBA 5CH7B 4IOCQ 3GQCA 3U27A 3W1YC 1S5ZA 4DV1F 3P5BP 2BANB 3A12A 1F5CA 1M5PC 2H51B 1U1KA 4C11B 4O4RA 4AXJA 3JQMA 1KOOA 3MM9A 5KFRA 1QDUB 4HKQA 5A2QY 3LW5C 2NUHA 3DGVA 4A46A 1VQPS 2XY7A 4ERDA 4DR2F 1QUPA 1NJIT 2XY6A 1IUJA 4I6AA 1KDNA 1FXLA 1WD6A 2R7QA 2HQIA 3OXFA 1VRTA 3L4BC 1S1VB 3AD7C 2QL9B 2GZOA 4B17A 4Y2IA 2B6AA 1OWXA 1Y00A 3BREA 3IFEA 1DZ5A 3PXGa 4FBTA 1KLNA 4DL2A 1M1GA 1W2IA 1FEEA 2HHVA 1I94J 3M8QA 1H0HB 3MCSA 2VF3A 1WC5A 4RNFA 3CCSS 3GONA 5F9LA 5G0RA 3H2VE 2DIVA 5IT9Y 1JLCB 1YJVA 2ZDPA 3CCUS 3NRBA 4YHHF 4Z7CA 3T1YJ 5H9FK 1TKZB 5AE1A 2FVRA 1RAEB 3R9LA 3Q8SB 3J81j 2N4DA 2RKIB 2F4VF 5HANA 3GJTB 1WTBA 1IKXA 4ZP8A 1YZ6A 3PZPA 4M5DB 1PC4A 4O3NA 4ID5A 5JUMA 5IFMA 3IBWA 4FPRA 2CWXA 3V2UC 3OHBA 5K8OA 1BHNA 3MM6A 1H2TZ 4IG3A 3LPEA 4MJKA 3EZOA 1RADB 2HFSA 4QJVA 5A8RA 2PMHA 2EFPA 1WHXA 5EWFA 4WE1B 2WW8A 1JKHA 1SUQA 1WACA 1Y10A 4FYWB 5E3RA 3NCRA 1VMBA 2DO0A 1RU2A 3TANA 2AEFA 4DX7A 3M6WA 5GADU 3C6UB 3J7AN 2MLZA 4QIWD 4L75A 5J1PA 4JV5J 4FDFA 4DSEA 2Y9HA 3DLEA 1FX4A 3I96A 2JJ4D 3KDOA 2JH3A 4U6PA 1KP6A 1T7PA 1SPBP 4BC9A 3DDNA 4NA1A 3LANA 4C8MA 1QSSA 1Q8IA 4UZBA 2IIHA 1FO1A 1RE1B 2PI5A 2ACYA 3W9JA 3VV2B 3TUZC 2YX7A 5J1EA 1PBUA 5KT4A 2IYIA 1JLFB 2YNIA 2VDHA 2DKOB 3FDSA 4DQIA 3CMAS 1S9EA 2CQGA 4NLVA 5KOXA 2FC9A 4WK1A 1JJHA 4ZHRB 2FJBB 5HQMA 2B4PA 4KB7A 3B6BA 1GFWB 1YGYA 4QW9A 1U2RA 1EETB 3PO4A 2B9XA 2DISA 4QWCA 5C2GA 3POTA 4RBUA 5ETMA 4OZJA 3M8ZA 4LR9A 2O3DA 3J80U 4DLGA 3Q24A 3OD2A 4WYWA 3K0JA 4HL9A 3DYAA 3TO8A 5IQQA 3KG4A 2DGOA 4KH0B 3J7YI 3D5MA 4LRFA 2AJQA 4FXVA 1JLBA 1S57A 3T9ZA 4OL8A 1EKSA 1F3FA 3QZ7A 2E9ZA 3BBFA 1XN9A 5HVFA 1XNQF 3IGVA 3D6FB 4LBHA 2QA1A 2F8HA 2X1AA 3DRYA 4XPCA 1VQSA 4FKXA 4A4JA 1JLAB 1FTCA 3NAIA 1T95A 2HBZB 2CQ1A 3PX4A 2DHGA 2VFUA 3V4IA 2APOA 1S49A 1YTYA 1M0SA 4RW9B 3H5SA 2KH9A 2M8DB 4DPUA 5F8MA 1D1UA 2HFZA 4ZPDA 4M5NA 2VG5A 3O8WA 2IRXA 4F36A 3ENAA 3GG0A 5F41A 3ZNUA 4WXWA 1UWBA 1ZETA 5A6PA 3H2UB 5KAKA 3VZHA 3DM2B 1DQ9A 5C42A 2XY5A 1TL3B 1Q16B 2IHR1 4ED7A 4HHHA 4K4XA 2C2ZB 5HMWA 4DV0F 1FNOA 3DHWC 1VRQC 1JX4A 5D4OA 3AA9A 4Z37A 3MAQA 1PJ6A 1HD1A 4H54A 4HHUA 4K2XA 1RHMB 4DR2J 2W9CB 1RHKB 1UPMB 3PCOB 2V34A 4B9VA 1KLMB 3KK3B 5HSPA 2J8SA 1LV5A 2GNKA 5HQ8A 4XTTA 2YKQA 3F56A 3G6YA 2BANA 3K2YA 2ROEA 4XPEA 2RE1A 3JSMB 3JSBA 1VQ9S 1VC5A 3IN5A 3D6TB 5T41A 3MM7B 4LJMA 3OTBA 1T9VA 1M5VC 2FD2A 4OZ1A 1U2FA 4ZPBA 2XI2A 2VFTA 2DIUA 3PKYA 3R2DJ 1U0SA 1Q8BA 2KZZA 2MMYA 4HHJA 2BOAA 1R6YA 1S1VA 4ZN1A 3NMAA 4WPAA 3OL6A 1IKYA 3NS7B 3RZAA 3AJDA 2Z58B 5DGBA 1TR0A 4YHHJ 1RWOB 5A8KB 2NSCA 4YB6A 1UETA 1GXLA 4HVZA 4LF7F 2F4VJ 2B4VA 2BJ9A 4IRKA 3VVUA 2OPQA 3IP0A 3DLBA 2HGMA 1PKUA 4K7QA 4X84A 2W8LA 1FNXH 3M2UB 2RU9A 4M95A 3VGVA 2D9OA 4B3MF 3THVA 3AB2B 1NH8A 4ELUA 2IVMA 1REGX 3A1YG 4O3QA 2FJDB 4MK7A 2V94A 3FCHA 2MLXA 4DL7A 2LQ9A 1SH2A 1D9DA 2RKIA 5KFTA 2PI4A 4ZCLA 3HCXA 3TW0A 4XK8C 1IM4A 2D41A
chains in the Genus database with same CATH topology
3CD0A 4R0EA 1VQ5S 4Y2AA 2E5IA 2QMWA 5LL6d 2R8KA 1RT7B 3BN4A 4YP3A 1NZAA 1RT3B 4I6YA 1HI8A 1J5OA 4RU2A 1OIAA 3SCIE 1TKDA 3T5LA 3G8QA 2DGXA 3R27A 4KC5A 4MTPA 3E51A 1WF0A 2ILZA 3BGRB 4M5DA 3SI8A 1S6QB 2VOOA 5KFHA 5MLCV 3D0IE 2JVOA 2DBBA 3OUYB 2Q1LA 3D2WA 5KFQA 2OH2A 2HHPA 2JZ5A 1G3OA 1S6UA 2L48A 2RH3A 2NS1B 2PA8D 4DV6F 4LQ3A 2LEBA 3IAM9 2RVJA 2RQCA 4KV8B 3GV5B 5DETA 2RQKA 3VAJA 3PV8A 2A2DA 2L3MA 2P9EA 4B02A 4OJ3A 3K8VA 2UU9F 3MFIA 4CH0S 3LP1B 1S6OA 5D78A 2DRBA 4Q45A 2Y0SD 3OXLA 3DRPB 3MGJA 2MQNA 1SIWB 4DUYF 3T5JA 2PMZD 1MNEA 4N8NA 4DF8A 4LFBF 4IFVB 4I69A 1K0TA 2K3IA 2YX1A 1JLEB 3MM8A 3CCTA 2BQRA 4NLPA 4WFNQ 1GX5A 2RILA 3KK2A 5GAGI 4AL7A 2AYGA 4LF4F 3NWGA 2B9YA 2DH8A 3V6DB 1RTHA 5IT0A 4LIWA 2BDPA 2RIJA 1TL4A 1FA0A 2UVRA 3QO9A 2ZZNA 2UZAA 5E33A 3M32B 3NLCA 5DDRC 2B5JA 1YIJS 2WTFA 1YHQS 4I0WA 2R9LA 5GAHU 2FGCA 3C6UA 3ONQA 4NCGB 1X0PA 2J9DE 2D9PA 4QQBA 5CXTA 3DLKB 4ZVGA 4C7QA 3TA0A 3BR8A 4USHA 2VBZA 1CPZA 2CJQA 3LWLA 3CCJS 4MFBB 2DGSA 4KO0A 3DNCA 3PR5B 4CO3A 1N0UA 5D3GA 4G1IA 3R5BA 4DR3F 1UVMA 4PCQA 3PNIA 2HPUA 2JLGA 3CO9A 5I3PA 3KLFB 4ECYA 2OTLS 1UVNA 4ILLA 1JXEA 1ZYQA 4M8LA 2KG1A 2MZJA 2DJWA 2JOQA 2LA6A 2XMWA 2R2UA 1D9AA 4OZ0A 3SDEA 4PRFA 1U49A 4CQ1A 1UEVA 1Y5IB 4NYZA 2GO8A 1R89A 2HNDB 2Y1JA 3N01A 2DT9A 3K5LA 3ZZRA 2G13A 1HHSA 4ALZA 4A8YA 1JJ2R 4FN5A 1MROB 3GMGA 3E3XA 1NK8A 3SSRA 5A0YA 5KT3A 1VI7A 1NU4A 1VRTB 1F9FA 2DD8S 3GV8B 1KEKA 3PIOQ 3KOAA 2N7CA 2BM0A 3BEGB 3KMQA 2AJFE 1U25A 4OMFG 3KLEA 3R3TA 2HGLA 2CQBA 5KT6A 1SV5A 2BA9A 1JLFA 2PIIA 2B6AB 3OL7A 1RTIB 3WDOA 1ZZFA 1S1WA 4YQWA 3FMBA 3W2WB 4B08A 4NRUA 5I42B 3ZZPA 1FDAA 2ZFHA 3CD7A 3HHLC 2CPYA 4ZKAA 1S0NA 1MU2A 5LT5A 3RW6A 2XLKA 2M88A 4DL0C 1VIOA 2J76E 2WB4A 4O4GB 2FY1A 3AHPA 2LLZA 5HBMB 2YKNA 2XHWA 2R8JA 4IYQA 2EK6A 5AXKA 3TVYA 3DN9A 2I8EA 2JSXA 4Q5VA 1U1PA 2NUUG 2BYCA 2M0GB 4OX7A 5U47A 4FP9A 3UR0A 3M6XA 2IJNA 3KG0A 4QZVB 4EUVA 3GFXA 3T1AA 5FJ4A 2Q43A 4F2SA 4ED5A 5M2UA 4GKKF 1S79A 2EW9A 3M8QB 5KOWA 4QWDA 5JVHQ 5E7OB 1EETA 2ZJRQ 4DQSA 4TN2A 2RS8A 4KGKA 4FNHA 4I7FA 1IBLF 1HQUB 1LW0A 3BN7A 4WFBQ 3IS9B 3TUJC 5LMUF 4G1PA 2GMLA 1D8ZA 4F3QA 5G0RB 1VQKS 5BYRA 5H1SV 4KHPF 3EPIA 4CH1A 3WZ0A 4J9SA 4WFZA 3G8TA 2JFKA 3MR5A 1JWWA 2VQFF 1XTZA 3MPYA 2I0XA 2AX1A 4RUHA 4HTJA 2WHOA 3H5UA 3GYNA 2E5JA 1X4EA 2CPFA 5LXYA 5J2MA 2VD3A 4TYBA 5J2NB 3OR2A 5LMNF 1L3TA 2N3LA 4BHQA 2XZWA 3V81B 3OJUA 5L8RC 1R8AA 1N6QB 1JNRB 5K5MA 3M6VA 3MMJA 1K73T 1ZPWX 2W25A 4RNOA 1UA1A 3HHEA 1VBZA 3O5TB 5AE3A 1XMOF 2GQQA 4X66F 1YRUA 1U45A 2UVUA 2CQ2A 4FS2A 2KT2A 2YNGA 1E6VB 4NOHA 4EFAC 3CCVS 3MMAB 2HHXA 4CTAB 3WX4A 1DARA 1KONA 1LKZA 1KHVA 4ZPWR 2VL1A 2PDAA 1IXKA 3DCAA 1SIZA 2DR8A 1FRJA 2EBGA 4E98A 2FLLA 1NK7A 4BDPA 4AYBD 2PE8A 2YNHA 2K8GA 4ID5B 2MHEA 3I5AA 5E2QA 4TLQA 2O67A 1HW8A 5L1JA 4R5PB 2VH7A 3H98A 3R5DA 3GYXB 4G1QB 2PT0A 2JEGA 1RTDA 1U1NA 1DJ0A 5AE2A 1VIXA 2C3YA 2ZNYA 2BV3A 4IG3B 3ITHA 4HDHA 1JLAA 5CQGA 4AFFA 3CXCR 4K4UA 2RF2B 1FKOA 1R8BA 4F4YA 2UUWA 2WONB 2CKWA 2ROPA 4LF5F 4MK9A 3HPOA 4ED6A 3HDSA 1ZM3A 2GCFA 2L9NA 3OVAA 4RW9A 2C28A 2V4RA 2QYCA 2BW2A 2LXFA 1H3DA 1Y9OA 1UJ4A 4I2QA 1DRZA 2EG2A 4KQZA 3IRXB 1JKHB 1XWLA 3C2PA 3CDWA 2M2BA 3FZ2A 2I9SA 4HI1A 5BYQA 3GIMA 2J6TA 5GMKa 2MKHA 4B3OA 2XWYA 3AH6A 4OZLA 3T5KA 2NZ4A 3VALA 4IFYB 3DU6A 2J7WA 4K4SA 4DG1A 4TU7A 2OKQA 3U7JA 2VG7B 3LH2S 1NAQA 5F8HA 1T03B 3HZGA 3CJ3A 1P8GA 2RRBA 1H7WA 3MEDA 2ZH2A 2P6TA 3G9CA 2F3JA 3S8SA 3BDEA 4IR9A 4JUZA 2QSFA 4CNYA 1JMTA 4O3RA 1RJJA 4KIAA 4YDXA 4NCAA 1D9FA 2R7OA 2W9BA 3MXHP 4NYPA 1HI1A 3EYZA 2OO4A 1QAJA 1R3NA 1ZAXA 2MKIA 3N28A 3QIDA 2VA2A 4CO5A 4GO5X 4J9MA 3BGFA 5GVQA 2R2TA 4ED3A 1RQ0A 2W7AA 3DM2A 4QR2A 2ADCA 1GTEA 3NP5A 3PACA 1S99A 1HBMA 3UFCX 2FUG9 3X3UA 4EGLA 4YY3F 2CQPA 2ZOFA 1LWFB 3PDNA 1N5QA 4KAIA 2W24A 2KB2A 2AX0A 1X9SA 2YQ3A 4YDDB 4DV5F 5FIIA 4ECVA 4QIVA 1OS5A 2CDQA 3M4XA 3DOLB 2FTRA 1O5JA 4BBYA 3NKYA 2HWTA 2BZ2A 1U1LA 1VQ6S 3Q8PB 3M05A 2HG4A 1FRXA 4DN9A 1APSA 3CGIA 1YJ9S 1M5OC 4RNHA 1XR7A 2IBOA 1CQNA 1S9GB 1VS3A 4PQAA 4C98A 3CUNA 3K59A 2UUBF 4P7TA 1AFIA 4YR3A 1RT6A 2V9WA 4YMEA 4DV3F 3RB4A 2DO4A 5JJBA 4RW7A 1J5EF 2YNIB 2IRYA 2CQ3A 2ZH8A 1TKTA 4K50A 2UXBF 2W9CA 4LFCF 2V8DA 2XULA 5K9FA 5KFKA 4TY8B 2LKZA 2R8IA 1SL0A 4IRCA 1N56A 1BY9A 1DTTA 2ZH7A 1TL1B 4AE5A 1SQEA 1UVJA 2C3MA 3MHYA 1QJHA 2C3OA 3TAMB 1TKXB 3U1MA 3H4DA 1RYSA 1DLOA 5KFFA 3CPWR 4J9KA 1KLMA 1YJNS 2WK4A 5HI7A 1XK8A 2ALZA 1DQ8A 2V8GA 2FVQA 1ZM9A 4PWDA 3FNNA 3D1QA 3FEXB 2ERRA 4DSKA 3M2RB 4X4OA 2DK2A 2LEPA 2OLWA 3KYLA 3BR9A 2XGPA 4ZVFA 4LIRA 2LQBA 4C8ZA 3HXMA 5CCLA 2OPPA 2M3DA 5DS7A 3CJKA 5KG6A 3U1LA 4EZ9A 1S1UA 1HBOA 5DDOC 1FHTA 3JSMA 3HHLA 3VAHA 1JLGB 2BE2A 2DNNA 2P5VA 4O44A 1SH3A 2RB7A 1X0FA 1T8EA 2WOMA 4ES3A 2VOPA 1HPZB 1LXJA 1NB7A 5J2PA 4J9NA 3P96A 1FNMA 2XMKA 1N52B 1C1BA 1SBRA 2NLWA 4N8OA 5I3QA 5KFIA 2V4JB 1IKWA 2EI5A 4KKOA 4AUKA 3MM7A 2CPJA 4PR6A 3TYTA 4B3SF 1NJZA 4EO6A 1YVFA 2J7KA 1BQNA 1Q4RA 3KLHB 1KFSA 4FVMA 2MZ1A 4XAKA 1X9MA 4JV1A 1UEUA 3T5HA 3DYAB 3ZZ0A 3VTIA 4K4YA 4NA2A 2A10A 3KLGA 4MAKA 5HLFB 2ADBA 2YWEA 3DLJA 3HZEA 4KTQA 3KG1A 1IBMF 3QJPA 5LJ3Y 5CYMA 3CCQS 5HMXA 1HWUA 2J9EA 1FCAA 2MY8A 4J9PA 3NG8A 4Y00A 1V9OA 1SKSA 3E8OA 3QWPA 2ZBIA 4ZVHA 3CCZA 2V5HG 5CZVA 1WI8A 2E1MC 4PQUA 3MMCB 1S72S 1VC0A 3I0RA 4R8UA 3CIMA 4PXCA 1X8DA 2DNYA 2MZTA 4NLTA 2XG8A 4Y6IA 4ZPVR 3KMSA 1U47A 2YH1A 3D0GE 3KHHA 2HLTA 3HF5A 4F4KA 3JYTB 2J0XA 4KFBA 4YB5A 2X1BA 3JAMY 3W2VB 4HH0A 4H4OB 2DNQA 3RW7A 4FF3A 5B0FA 4F4XA 2HS4A 3I6PA 4OJGA 2HWHA 2XBPA 3KJVA 2KJWA 4RLEA 3HHKA 1HNVB 5DM7Q 1FRIA 1S1XB 1ZAWA 1RT5B 4UY8T 1BQMA 3RR8A 1KHWA 1QM9A 3DGPA 4DL4A 2V0NA 2ZD1A 3QWUA 4A8XA 2CG4A 5L1KA 3NBPB 3TRGA 2YX4A 3O3LA 3V4IB 1JLQA 2R2RA 2NYIA 2DGUA 3DI6A 1LWCA 4E8UA 3OL8A 1FRHA 1RTJA 1FDDA 2OMOA 5KFYA 1G1XA 1S76D 3HJFA 2HAIA 1ZBTA 1C1CB 4H4MA 4QIGA 2ZH5A 4B9TA 3EZUA 3DMJB 4NLOA 2BBEA 2RS2A 1CEZA 2GMJA 4JI8F 4URGA 3UCZP 2HZCA 1S48A 1S0OA 3QLHA 2R7TA 3QPIA 3M8PA 3G4SS 5E3CA 3TX8A 3ZZYA 4I1TA 3O2IA 4LF6F 5IWAF 3RB6A 2AYBA 2HNZB 1QE1B 3N6NA 4Y2KA 3M2UA 3UD4P 3VF0B 1Z4UA 4C11A 3BDPA 4GO7X 1W2BR 4NMLA 4DS5A 1C0UA 2R7SA 1Q81T 2QRRA 3TI0A 1NRKA 2MHNA 4ZOSA 3CCMS 4BWMA 2J9DA 2F8EX 2XMUA 3LGNA 3SFGA 3BZQA 3OHAA 1Q79A 4KJIA 3N4WA 4QPTA 4YR2A 2QLWA 3EUNA 1RKIA 3UW1A 3LAMA 4I4BA 5A6WA 3J7Z5 1IKVB 4V19X 1P6TA 4RUAA 3BO2A 1VQ7S 2HMIB 4HYKA 1NK0A 5D8HB 3MUMP 3FFIA 5HP1A 1V6HA 1U1QA 3VAMA 3SSQA 2XS5A 3FQLA 2N3OA 1CVJA 3PM9A 2NXUA 4L72B 2W4DA 2J8AA 2O01C 1WHWA 2MXYA 4H4KC 2CQHA 1PGZA 2LVWA 1N8RT 2DNLA 2EWHA 2HWIA 4JI0F 3OVBA 1Z1ZA 4LSLB 3LQVA 5C5JA 4DX8H 4Q43A 1C2PA 3GR1A 4WTYA 3I4HX 3DRRA 4NLYA 5KG7A 2UXDF 3M9NB 3Q2SC 1RT7A 4YR0A 3IG1B 4UQTA 2HFOA 1RT3A 1GT8A 2WAQD 1G6BA 1REVB 3FSYA 5B0BA 2O5DA 2HNYB 5T14A 2R4FA 3QJJA 1XR5A 3BGRA 3HFKA 2JEFA 1S6QA 1VOMA 7FD1A 3BSAA 5FDLB 1KRPA 1X4DA 4PG7A 4C2MA 4DSJA 1T94A 2HS3A 2DVIA 1YITS 4YFUA 4EBEA 2Q6BA 3VWSA 2I38A 2YKPA 4ECRA 2E5LF 4MKAA 2PGCA 4A8SA 3TAPA 4B9LA 1K1QA 1HMVB 2PN6A 1UA0A 1HBUB 1U1OA 4E0DA 3DRPA 5L9XA 3T1HF 1TK5A 2VG6B 1TFYA 4FNIA 1R8PA 3VQTA 1QSYA 4HT5A 1X4BA 2V2KA 1BLUA 2GJ2A 4N56A 3FEYB 3ULHA 3VZIA 2VC0A 3MMBB 4RW8B 5EN1A 2RQ4A 5IT4A 3QIPA 3CE8A 4CZCA 3WBZA 5L1IA 2E9TA 1F5AA 5BR8F 3GV7B 3M32A 4OX8A 3KNAA 4LSNB 4ZP6A 5DRKA 3T6JA 4X4NA 3BSNA 1JLCA 3MM5A 4UUXA 4B9UA 4EYHB 1Q53A 2CPXA 5D4NA 3F73A 4NCGA 3FZBA 2FDNA 1FT8A 3LP2B 4Y34A 3BQ2A 1SJFA 1PILA 3OTEA 2EPIA 2GHWA 4RW4B 2SXLA 4DV7F 1YQHA 2QMXA 3RB0A 3E01B 4MFBA 4ATNA 1TKZA 2RJZA 3ICLA 1XMQF 3OQ2A 4TU8A 2O1PA 1DBDA 2E1CA 1U09A 3KLFA 2D7SA 2M8HA 2M70A 1SXLA 3NCQA 2ZBCA 2P9CA 3MD1A 4DL3A 1O8BA 2I1RA 2XMTA 3I9ZA 3RR7A 2AGPA 3KNGA 1UAWA 3L09A 1U8SA 3J7A1 2HNDA 4JI5F 1N88A 4KPYA 1WEYA 1QVFR 4IO9Q 4JI6F 3EPGA 2HS0A 4ZP7A 2VFRA 2YWFA 2RDIA 2LYVA 2OFHX 4NA3A 5F0WA 1FRMA 3MTJA 5EHHA 2FVSA 2BUNA 4OJ1A 4DQQA 1A7GE 3HVTA 3RRHA 4LVOP 3RU0A 5L39A 2VBYA 2J7UA 3OR1A 4OI6A 1X5PA 2A2CA 4QOTA 3S01A 1DURA 4B3TF 4A8FA 2C42A 2E66A 2GIQA 1IKYB 2G1DA 4I64A 2EFGA 1BC6A 2K3KA 1ZAVA 4F3MA 2OPRB 2ABYA 1RTIA 4HEA9 1T05B 3EGZA 4I68A 3V6HA 3ETOA 2L9DA 4WJBA 1SJQA 2RT3A 3DOKA 2RRNA 4ZPCA 5GAEI 5B09A 2GC8A 2YKOA 3BGUA 3FGVA 3F41A 1WHYA 2R7RA 4WXOA 5KFLA 4WE1A 4IQXA 3HI9A 3IC1A 1HWLA 4DS4A 5HBMA 1OO0B 2OPQB 2PD1A 3JTNA 2FHJD 1HBNA 1QSLA 2AU0A 4A8KA 4XDCA 4DSIA 4DHVA 2VPYB 3O44A 2UV8G 2PSZA 3ZZTA 4CO1A 3BM7A 3BQ0A 4CT8A 3G96A 4C8OA 1WF1A 2KN4A 4TYAA 5C24B 4PXEA 4LF9F 5KFVA 4BCAA 2MSTA 2XLJA 4RU9A 4W90B 1HQUA 2M9KA 3G86A 1TK8A 5CZXA 3IS9A 4J9OA 4KHMA 3C6TA 3OLAA 3R1HA 4N5SA 4DLEA 4W92B 3M30A 1KQFB 2YNFA 1CSJA 3MM9B 4Q0BB 5F0UA 1MMLA 1FVSA 2GQ2A 5KTQA 5K8MA 1FRLA 2AF6A 3KTQA 2JX2A 2CPIA 1K1SA 5C25B 2BQ3A 2C3UA 2FPHX 4OX6A 1VHFA 2LDIA 4PUOA 3L3CA 3HHNB 5J2NA 4IH7A 2RU3A 4G3IA 2ZH4A 3OSPA 3CIZA 4IO1A 3K8WA 1FE4A