2D74B

Crystal structure of translation initiation factor aif2betagamma heterodimer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
137
structure length
137
Chain Sequence
IDYYDYEKLLEKAYQELPENVKHHKSRFEVPGALVTIEGNKTIIENFKDIADALNRDPQHLLKFLLREIATAGTLEGRRVVLQGRFTPYLIANKLKKYIKEYVICPVCGSPDTKIIKRDRFHFLKCEACGAETPIQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Translation
total genus 22
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2005-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01873 eIF-5_eIF-2B Domain found in IF2B/IF5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2d74B01
2DCUB 1NEEA 2D74B 2NXUA
chains in the Genus database with same CATH superfamily
1L3TA 1SH0A 3HKZD 4YDDB 3VAIA 3OFGA 4FF2A 5GMDA 4K0KJ 4RW7B 1D8ZA 2GA7A 1Q8KA 1BQXA 3WC2A 2IDLA 3FRZA 3W61A 2XGPA 5HROA 4N76A 2IYGA 2HAIA 2VPZB 1SV5A 3MMJA 4Q45A 4HHUA 3N6NA 3C6TA 2RH3A 2PE8A 4Y2MA 4NL5A 2IPOB 2GZOA 3FGVA 1AUSL 1SI9A 1IUJA 2FVPA 2HVEA 2ZOMA 5HSPA 3JSMB 3ZTQA 3FQLA 5KG2A 1FJCA 3G2XA 3EGVA 2MQMA 3MM9B 4RNMA 4R5PA 2P2CB 3LA0A 3GP9A 1JMTA 4C4WA 3H4DA 4LFCF 3VAHA 3CMQA 3G6XA 4K2XA 2H5JB 2QT7A 5K5MA 3UQSA 3D6FB 3ZC4A 3GMGA 1F0XA 2KVQE 2QA2A 3PCOB 5T41A 1TELA 2HNYA 1KOOA 2PEBA 4K4YA 4IO9Q 1S9GA 3K0JA 1WC3A 2VC1A 1VS3A 2RS2A 2GAGC 1SL1A 4FF1A 4FXWA 4OZLA 3J7AN 1HQEB 5KFDA 3MD3A 1CJTB 2R8JA 2EI5A 1NDCA 2GS8A 1H7WA 3JXOA 3CE8A 2XLIA 5F3ZA 5KT5A 3M9OB 4KPCA 3Q2TC 4LF4J 4MYTA 2W2OP 3K5OA 1T05A 4ID5A 5IFMA 3OTOJ 1RXOB 2KXHA 3MM5B 2UXDJ 3KKFA 1N48A 4JYAJ 2NXEA 4FF3A 2I8EA 2CNLB 1AZSB 3O44A 2ZKUA 3HHDA 5LOQA 4DV0F 5HQ8A 1HBMA 2F8EX 3VTIA 3T1YJ 1GX5A 3D9BA 4C8KA 4ED8A 4EEYA 1Y00A 5H9FJ 2EBGA 4OJ3A 2RB7A 5L46A 4IRDA 1UPMB 4OJGA 4L76A 3KXDA 3Q8PB 1N5QA 4CT8A 2ZE2A 5ETVA 4IDKB 1K47A 1VC5A 4RBTA 3DLKA 2DISA 4WYLA 1KWMA 4ED3A 1AFJA 2XHCA 5C42B 2JHEA 3MM7A 2VV5A 1HW8A 1IKXA 2ZFHA 5B0FA 4O4GB 1S76D 1YDLA 3NRBA 1XBWA 4J9MA 2F9DA 1DY3A 2DGTA 1U0SA 2JLFA 3PRDA 1MWYA 2H65B 2MZJA 4DN9A 1KR4A 2PSZA 2GJFA 1EAYC 1KQSR 2IRUA 4AUKA 1I5OB 2NREA 5J1EA 1FRLA 1H0HB 5GMEA 4OYWA 1GH8A 4WKRA 3Q8YA 3NAIA 3H5XA 1B7YB 2AEFA 2QO3A 2Q43A 3EMTA 3PW0A 4K5SA 2GIFA 1RHRB 3VQSA 2VQFJ 2RQMA 4ECRA 3CCUS 3LGHA 2QMXA 2VASA 1IJFB 1GMUA 3KLHA 1NHUA 2ZH9A 2W24A 4FPIA 3QIPA 4WFXA 3KUEA 3W2WB 4K4SA 1FVSA 2CPZA 4J9NA 1WG4A 2LA6A 1UZHA 3T9NA 1GTHA 2VG6B 3PXGa 5J2NB 6FD1A 3EX7B 2O01C 3M2UA 1K0TA 3MR5A 1FJGJ 3JQMA 4QIEA 3KJVB 2MY7A 4DV5J 2VONA 1T94A 1WEYA 2I5JB 5MLCV 3U1MA 2UUCF 2HZCA 2C1EB 4IR9A 1TL1B 2B5JB 3AHPA 1N32F 2DTJA 3AOAA 1N36J 3CULA 3R5GA 3A13A 5HBMB 1FX2A 1RWKB 4H4MA 4USKA 4P10A 3MEEB 3GG1A 4ECWA 1XMQF 4BC7A 5LXRA 2AJFE 2RUSA 3TUJC 2HHVA 2A3JA 4O23A 3JYTB 2D9PA 2FD2A 4NI2B 5H1SV 1FJEB 2W9BB 4MYUA 1GMWD 4ZVSB 2V94A 4KGZB 5IM0B 3TVZA 1JLGB 1S6QA 3E3XA 4I0WA 4F4XA 3SXLA 2BYCA 2HWTA 1UTAA 5IOLA 3ENWA 3C16B 2HNZA 5JMNA 3TAQA 4ZMMA 4JV2A 2KJWA 4U7UK 3EDRB 5DS7A 3MDFA 4CYUB 1KKHA 3W5YA 3HMJG 3TANA 4ZS6A 2X7IA 4CM2A 1F2GA 2Q79A 5J2MB 3D6TB 4KGMA 4E98A 2JOQA 1S1XA 2AJ2A 5FDLA 2CAJA 2MLXA 3J7YI 3AD7C 1Q86T 4XTTA 3PV8A 1CULA 3D66A 3ET6B 3QRPA 5RUBA 4LSLB 3BBFA 1TMMA 4CI0B 1Q0NA 3EYZA 3GV5B 2QLXA 2DNMA 1R7IA 1NRKA 2VJUA 1UZDA 2BACA 4PG6A 1LW2A 3GE9A 2E5HA 4DOZA 4X4NA 4K59A 4HI1A 4ED4A 1RZMA 3UR3C 4FNHA 2R7TA 1VRUB 2RRAA 1OJ4A 1YJNS 1RACB 2VJVA 3HD1A 2FJDB 3M30B 3BEGB 2DH8A 2ZUGA 3KHLA 4B3MJ 4B3TF 1LFWA 2VKRA 1DTQA 2G2ZA 2CQGA 3KUGA 1PYSB 4P73A 2WVCA 3M6WA 4P2XA 5DETA 4MIWA 5A6WA 5KG5A 3BSNA 5HAOA 4MJKA 4DR6J 1OYDA 4M5IA 5FLXU 1N4LA 4Q0BA 3TJAA 1UAWA 2OKQA 4XDCA 2QSFA 2HMIA 3KK2B 2GMLA 2DCLA 2XM3A 1NK7A 1QVGR 1YJWS 1KNZA 4ZK7M 4F67A 4C3KA 3O5TB 5FJ4A 1LWEA 2E9RX 3E01B 1N5YA 2ASYA 2OUGA 1CJKB 5E33A 2HIYA 1U0HB 1N5TA 3W1YC 4KGVB 4RUBA 1IXKA 3MPDA 4DF4A 4ZP9A 5IV3A 4DQQA 3MPUB 1U24A 2R2TA 3X3UA 3AA8A 2I38A 1K9MT 1XQIA 3HDSA 4BBYA 5E3CA 4YB6A 2R7VA 3IG1A 3NL0A 5KG7A 1UVJA 1FD2A 5EX0A 4URGA 3E2EA 3TAMB 1RWPB 3DOLA 2XMMA 2OEJA 2VIHA 4DHVA 4HTJA 1T3OA 3ZTOA 1N56A 1CJUA 2E9ZA 5A8RB 2XZDB 4Y2CA 2LFVA 2XWYA 2NZ4A 2FC8A 2XMUA 4KJIA 2KYXA 3D2WA 4ECYA 2KXNB 4OLOA 4RUCA 3AXMA 4KGKA 4NLRA 1V3RA 2MKIA 2RF2A 1URRA 2XMJA 3DLGA 4PWUA 3VAFA 2IMOA 1MU2B 3R1LA 2CQBA 2CNNB 3G8QA 1PIEA 4L6V3 4X66J 4J9VA 4C0OC 5A8KB 2ROEA 1RT7B 2Z56B 2UVUA 3DN9A 3TUIC 1Q53A 1U6ZA 3LPYA 1N88A 4OX8A 2XNRA 4BC9A 3P45B 1JKHA 2B4VA 3EDQB 2Z4PA 2FZGB 1RU1A 2CA9A 5KFSA 5E3PA 1YZ7A 5L1LA 2ZOGA 4K7QA 1RDRA 4JI7J 4ETXA 2BUNA 3GONA 2FVCA 2HHHJ 2UUBF 4DPYA 2CVEA 2HNDA 2UXBJ 1NK9A 3H5UA 1XNRJ 1OPIA 3ILIA 5MAOA 2NXUA 1KFDA 2H5EA 4EBDA 4MMOA 2VFTA 2UU9J 2VG5A 1KVKA 5CYMB 3BGRA 1S9EB 1IM4A 2HURA 1XJWB 2YQ3A 2IVFB 4PQUB 5G4DA 2DHGA 1RT5A 3A8IA 3TZYA 1NUEA 2GGPA 3DU5A 5DDQC 5C25B 2OFHX 2QIFA 5F8LA 3F73A 4OZ1A 2B4UA 3CD0A 1NSPA 3EWGA 2BBEA 2YWWA 2H1YA 1T3NA 1VHFA 2ACMA 2E1PA 4BHQA 1U26A 4EUVA 5CYQB 3VZHA 4LR7A 4EWTA 4JI0F 4J9OA 1FRIA 1YRUA 3QRRA 8AT1B 4EZ6A 3GIKA 3V5RA 4DL3A 1U1NA 3OXGA 1FKOA 2SXLA 2VL1A 4CM0A 5E0OA 5I42B 3HX9A 1VQYA 1D3WA 4UUWA 1R6YA 3MUTP 4F7VA 1DLOA 2BW7A 4CO1A 4CH1A 2DIVA 1WG1A 3CPWR 2O66A 1JLBB 2BJ8A 3C15B 1QLNA 3Q8VA 3MM8A 3KMQA 2W4CA 3RAXA 4DV6J 2OO4A 2WOMA 3Q89A 1NJWA 2MKSA 1U25A 1M0SA 1RT4B 2AYGA 2ZEJA 4DUTA 2HS4A 4FVCA 2YPZA 1VDHA 2YNGB 1VQ4S 4NLYA 2DB1A 1LV5A 3RBDA 5A8WB 1H74A 1ZA1B 2RSQA 4TLRA 3HI9A 1TKDA 1JNRB 4NLVA 1WOPA 4D3GA 2JEIA 4TYBA 1L5UA 4AYBD 3M1VB 2BE2B 2F7VA 4DL5A 3VGSA 3OR1A 3MI7X 1A0OB 2DH9A 1VC0A 4X4PA 1WG5A 2WZ1A 3R8YA 1T03A 3U7JA 4DFJA 1ZPWX 2V4QA 5LMUJ 1JJCB 4HYKA 1U6BA 3QWUA 1NJYA 2DPJA 2RNEA 4WFNQ 5IWAF 3FEXB 5F0WA 4ZHRA 1FT8A 1BMQB 3IGVA 2GQQA 4I2QA 4CO5A 2ZUAA 8RUCA 1SKSA 2HVZA 3LP0A 3QQCD 4TY8B 3KLVA 1CC8A 4Y3CA 1KONA 3M8SA 3BN7A 1MSWD 1TKXA 5I3UA 4EZ9A 4J9UE 2HHWA 1VJWA 3SCJE 3WIUA 3JSYA 4DX8H 2VD3A 3VAJA 1RWNB 1RTHA 3DYAA 3S6EA 3MAAA 1MWZA 2DR7A 4NLDA 3IBCB 3OJSA 1B3TA 5KG3A 4WK3A 2BEFA 2WVEA 3NCRA 1RTIA 2AF6A 3KLEA 1D9FA 5ETTA 2AQ4A 2DXDA 5F41A 4E2FB 3BYPA 1JLEB 4CLTA 2D1CA 4M1KA 4F4WA 1H3DA 4K5RA 1FFSB 1XR5A 4A8YA 3ITHA 2X3DA 1OY8A 3QT5A 2J76E 4Q5VA 4UOGA 2BZ2A 1TUVA 2OLWA 1Q7YT 4FYVB 2EFVA 1RBLA 2DEIA 4ZVOB 2CQHA 4QIFA 1EX8A 1H2VZ 2BE7D 3CDWA 3T19A 1OSDA 1X60A 4WP3A 3A1YG 3KG0A 2YY3A 4WU2A 1L3UA 3IS9A 2A18A 1VBKA 3IR5B 5K8OA 3BPDA 4OYMA 2YNIA 3HHLC 5J2QB 1NH7A 1QSSA 3CNQP 5KT3A 4BDPA 3VCDA 2CZ9A 1HNIB 2IC3B 4HT7A 2DR6A 3W8PA 2Y9HA 2VF3A 2XG8A 3CCLS 4C8MA 2G1DA 1H2TZ 5DZ6A 4C8OA 1DHMA 5A6PA 4OX9J 2GVZB 2Z0GA 2B7BB 1JLAB 3VGTA 3GJTB 4YDXA 3CMES 3ETOA 3T41A 1S12A 1EKRA 3VQTA 4FKYA 5GAEU 3QSYB 5BXIA 3N0VA 1CS4B 3FSYA 1I51B 3TEGA 2C3MA 4TU7A 4URSA 1YJTA 4PXBA 4RX6A 2ATLA 1WTBA 2J0XA 2LQ9A 4U7CA 3PR4A 2ASJA 3TJ9A 2KB2A 1RWXB 2CPIA 1JLCA 4H4KC 1ROFA 1U4BA 2HQGA 2DPIA 4RW9A 2KHCA 1SJQA 3KLIA 3VHQA 1URNA 3GFHA 4GKKF 1IBKJ 3LP2A 2ZH5A 4TXSA 3S01A 1C1CB 5CD4A 3DHWC 1SIWB 2HRUA 3R2CJ 4CIOA 4KY3A 1HIYA 3QT8A 1RWUA 1NPPA 3WX8A 1R0BG 3KK1A 2XO6A 4V19J 4IG3A 4DR3J 4F04B 3UPFA 2CJ9A 2P6SA 1T11A 2Q3PA 2MJUA 3L9ZA 5BR8F 3M8QA 2XI2A 2J9CA 2G0JA 4KKOA 2DO0A 1JXVA 3W2VA 2M0GB 1IR2A 1RISA 1A9NB 1GXLA 3ENQA 1FKPA 3ZNUA 4L73A 2VBWA 2X3GA 2O1PA 2AYEA 1UWBA 2FLNA 5IS2A 2VQEJ 2DEJA 5D77A 4O4RA 1TUWA 4ZVGA 1FDDA 2RJZA 1CPZA 4DFPA 5DDRC 3PEJA 3OUYA 3G4SS 1FK9B 3IR7B 3CD7A 2YKAA 3MF5A 2FQQB 1U6FA 5T14A 2QRRA 2XS7A 4OHZA 2OD4A 3M2VA 4CT9A 4HDGA 4J9LA 1XN9A 1NKEA 3EGZA 4WYWA 3C46A 4OX6A 1NJXA 1VQ8S 1B7FA 5CCLA 2WSEC 2R7RA 3L09A 4X62J 3R5DA 4DL2A 4C97A 4A8XA 4J9RA 4YY3J 2GHVC 5HVHA 3W66A 3TOQA 3KDNA 5HVFA 4DSEA 5KFJA 3R5BA 4CLKA 5KOXA 3U27A 5GAHI 2OMOA 3KHRA 3BBCA 1P8GA 1YQHA 4BWJA 5JVGQ 1ZS6A 3MECA 4GVBA 4DV1J 1TFYA 2QE5A 3G6ES 1WKLA 3HSZA 5D78A 2QA1A 5E3RA 2G9OA 4RW4A 4RL1A 1LXJA 2EXUA 5DG8A 4E8UA 3RAMA 2H4YB 3WQPA 4DV2J 4BCAA 1RA7A 4ZVTB 1S49A 1KS2A 1BD6A 1HYSA 2JH3A 3PRVA 3PKYA 1WSVA 2YKMA 4F8RA 1X4FA 4OI4A 1RT3B 2NPFA 4F0KA 4NXNJ 1FWKA 1NHKL 2BQ3A 1NSQA 1GMWA 1VQMS 1I94F 3GSDA 4AL6A 1IBMF 1KQGB 4NXMF 4JI4J 1X9SA 4OHVA 2AD9A 2J0QD 2DHAA 1VR6A 1ZPVA 1V3ZA 3PW5A 5JUMA 1FDNA 5KFMA 1RSCA 2MZRA 3EGNA 4A46A 3UD4P 3MEDA 4ZPTR 2DIUA 1S1VB 4B9MA 3HSJA 2VG7B 5C5JA 2WONB 2YKQA 1NEEA 1X0PA 4UW2A 4F4AA 1HNWF 1HA1A 1R8CA 3KK3B 3GFZA 5J1PA 3A4TA 1Y5IB 4O44A 3UN2A 2PN6A 3OR2A 4BLGA 1WC4A 3N6MA 1TTHB 3IWNC 2B8QA 1VQNS 2Y1JA 2FJVA 1CQNA 5E7OB 4FYYB 4WP8A 4PXEA 2CXEA 3SYZA 1SXLA 4JB8B 2FJEB 3TJ8A 1HL6A 3N01A 3TP2A 1TK8A 3BF4A 3MZIA 2WW4A 3A3NB 1V3SA 2JEFA 4UOHA 2BRLA 3LO3A 5EHHA 3FKBA 2HBZB 2YBVA 3IR6B 1RWWB 1S1TA 3IBWA 2YNHB 4DJBA 3KYLA 3GJRB 1P9QC 3A8JA 5K8PA 3BGFA 2K7KA 3AOBA 3K89A 1C4AA 3SSRA 5HQLA 4FS2A 1LK7A 1UEUA 2QLJB 1HBUB 2LEAA 2JLGA 1HD0A 2FZKB 2DNKA 4FYDA 4KFBB 1IN0A 5ETOA 4LT6A 4LF6F 1PYTA 1EP4B 1XR7A 1LWCA 2JNJA 1HQUB 1WUUA 3CJKB 2JRSA 4QW8A 3HPOA 3CO0P 3QGPA 2A2CA 2MMYA 2BMBA 7FD1A 2HZAA 4OI0A 4EO8A 1NMEB 2DD8S 5KFXA 4QJVA 3A3OB 3IRXA 1QJHA 1NKCA 1BWEA 4FN5A 4HACA 4JBCA 1KEKA 1VYAA 2GNKA 3F0NA 5EWGA 5G0RA 4TQSA 5HANA 2J9DE 1IKYA 1W7WA 4LSNB 2V67A 1SC6A 2ZVSA 3CJ3A 1Q8LA 3PIOQ 2P8IA 2DNGA 3LOUA 2AGPA 5HMWA 2P9CA 5FLXY 2XQCA 1U1LA 1UP1A 2Y8WA 1B0TA 5L1JA 2XYGB 4U8VA 3UVJB 3K5LA 1T9WA 3OL6A 3PTWA 3TX0A 3RJMB 4IFYA 1HWIA 3SI8A 5KFHA 3T5LA 3CJTA 1WTFA 3C6UB 3US5A 1PSDA 4X65F 4H4OA 1NDLA 5K14A 2EPIA 4M5DA 1U8SA 1RLDA 2YXLA 2ALYB 5SZTA 1S5ZA 3E8OA 4RW7A 3MMBA 5KFIA 3B6BA 2MXYA 5JJBA 3OTDA 2XLKA 3F41A 2AX0A 1RKJA 3NG8A 3FSIA 4KHPF 2DK2A 1TZ0A 2V8HA 3U1NA 4YOEA 3T1HJ 1WC5A 4U6PA 1P1TA 4RW6B 3A12A 4NWBA 3BO3A 2ASLA 1RI7A 2E5LF 1WHXA 5DZ7A 2L08A 1EETB 4OHXA 2FJAB 3OPKA 1KP6A 2QA4G 1B4SA 1KOHA 3VZIA 3MM9A 1F6TA 4OX7A 1S48A 1REVA 2CDQA 5A76A 8ATCB 4MIAA 3DRYA 2Z2ZA 2HVIA 4HHHA 1FEEA 3CCJS 3V81B 3FVYA 3BGUA 1IBCB 1U45A 4DSLA 5DQIA 1HFEL 1K1SA 2CJXB 3I0SB 4J91A 3W9JA 1K1QA 1T9XA 1I3OB 2MQQA 1RHMB 1HWJA 3GFXA 4LFCJ 3K8VA 3SBMA 4MK9A 4DS4A 3ONQA 1NB2A 4I7FB 4RU2A 2BJDA 2HGNA 2DGVA 4I6WA 3DDNA 3CJRA 4AD6A 4XK8C 1GXUA 3I31A 1TQLA 2DRBA 1MROB 2WW8A 1NPKA 3SFUA 2IM1A 3PYDA 1UWAA 2BKNA 2RS8A 1SC1B 4YP3A 4CO3A 1R8AA 3EZUA 4LIRA 4N77A 2XMWA 3DGVA 1H98A 1JIHA 3BSAA 3BV8A 2LQJA 4M5KA 3I9V9 1PC4A 3RB3A 4ZVUB 2YVSA 3GFYA 4HH1A 3MXHP 3GJQB 3HXMA 3JQJA 4ZPBA 1XNQF 2G0IA 1HWKA 3CC4S 4DS5A 3NMAA 2DGWA 1BQNA 1YHQS 1RAFB 1XK8A 3OTEA 4ELUA 2W4PA 2W4DA 1YBAA 2OH2A 4DV0J 4OI2A 1VQKS 3MFHA 3HHLB 2W2NP 5IT0A 2ZH2A 5CXTA 3NGRA 1M5KC 4ZCLA 4USUA 2BM0A 3S1TA 3RB0A 1YKWA 2C42A 2R7XA 1JLFB 4L74A 3J80Y 4PRFA 4WFYA 3SV3A 2FGOA 3NEKA 4O4GA 1HI8A 1LNQA 2W8KA 1MN9A 4AT1B 4PWDB 1VISA 4MKYA 3DLLQ 2NXCA 4J9KA 4R25A 1R0CB 1S9FA 2KT3A 1TK5A 4B17A 1IVZA 1NO8A 4ZJQA 3DGPB 2JWNA 2MQNA 3NWGA 3THVA 3ZZOA 2F4VF 2ZJQQ 1KD1T 5FIIA 2V9KA 4LQ9A 3H7HB 5K20B 1Q5YA 2AWZA 4WXWA 3DM2B 1NNDA 2R3VA 2VBXA 4B02A 2HG4A 2OIHA 4URQU 4NOHA 1RTDA 3BN4A 2XMAA 1R43A 1H38A 3FCWA 2VICA 3DLHA 1AXQA 4G3IA 2XSJB 4CLPA 2G0CA 1JXEA 1R8HA 5AXNA 2V8VA 2BKPA 4FYWB 2VG6A 1O8BA 2HBQB 2AZ3A 3NGUA 5DLFA 1F9EB 4OJ1A 2RDJA 1PAEX 3D68A 2GV1A 3LH2S 4B3RF 3PKMA 1QTNB 4C48A 2I5JA 1RHUB 2CWKA 3NCPA 4LF9F 2B5JA 3VWSA 1FX4A 2CUYA 5HP1B 3P6YC 3QJPA 1LW0B 2M70A 4LR8A 3MEEA 4UT4A 2J7WA 3ZZYA 2KYZA 4ELTA 4UF4A 4OZNA 3DCAA 1SVDA 4P2FA 3UE2A 3KMSA 4WE1A 1C1BA 1QAIA 4QR2A 4IOAQ 1DRZA 2U1AA 2UUCJ 2A1BA 2VDIA 1N32J 1RGVA 3HO1A 4RJVA 1QSLA 1JLGA 1O5JA 1Y5LB 1XMQJ 3SDEB 3H0PA 2B4OA 4YB7A 1WC0A 5KT7A 4ECVA 4QR1A 5HROB 2ADBA 5KFNA 3O3LA 4X64F 4R0JA 4NYZA 1M1GA 1T9YA 3LANA 4CH0S 1R6VA 3I0RA 5J2MA 3C6TB 2KVIA 4HVZA 1LWFA 4DL6A 2Z58B 4ILRA 3O1LA 4ZJLA 4KQZA 3HZEA 3A8KA 5KFTA 3SQOP 4MT1A 5GVQA 2HK3A 4OYPA 3DI6B 3H2UB 4U7UD 3GB0A 4R0EA 4ETZA 1JQGA 2P9GA 3HLUA 2NPIA 2AEMA 2WAQD 2HK2A 1RT1A 2HPUA 2A2DA 1OQ6A 2M2BA 3OVAA 2B6AA 4DWIA 3DRXA 1FE4A 1RQ0A 2H51B 4QIVA 2ACYA 2HWHA 3JTNA 2U2FA 5ETKA 5F8HA 5H9EK 2DH7A 1HBNA 5KT4A 2KT2A 2R7UA 1N34F 2D41A 2VUGA 1S9GB 5D4PA 3NGSA 3RG6A 1S99A 1T7PA 4JI3F 4NZ0A 4RLEA 1HLWA 3PYGA 2BJ3A 4HEA9 1F60B 4KIAA 4OHYA 2X1GA 3H25A 3ETMA 2GAHC 2O67A 4DCPB 4BS2A 5L9XA 4DU8A 3GYXB 1H6KX 1WNEA 5AE1A 3HVRA 3D0GE 4NASA 3MEKA 2OMLA 4B3TJ 1OMSA 2OTJS 3KK2A 1X9MA 2LCWA 4U95A 4OHWA 4LF2A 2BDPA 4USJC 4DPWA 2IYIA 1UA0A 4W98A 3DKDA 1HBMB 4N5SA 3E01A 4DX6A 2UXCF 1N33F 1U0HA 3SMZA 4RBUA 4ILLA 1BC6A 2MHEA 2WVDA 1TP7A 2QFJA 3VGVA 5I3QA 2PA3A 3RTVA 4OYBA 1HMVB 4LF7F 1PBAA 2V8DA 4WXOA 4YB5A 1UCNA 3BM7A 1S4FA 2ALZA 3DLKB 3G82B 2JC0A 1UVMA 1RA6A 2KT5A 4K50A 4ED1A 3RU0A 1RAJA 4OZ2A 4ED7A 4HI2A 3M6XA 4RO0A 3MM7B 1KBRA 1C2PA 4U67Q 5A8RA 2ZHAA 5ETLA 1IKXB 3SSQA 2CFXA 1AROP 2FJXA 3NOCA 5GADU 2CPXA 4HTIA 1SKRA 1NLKL 2MZ1A 3GG0A 4DEZA 4A8SA 3ZXWA 3LGNA 4QBUA 3OV7A 3D0HE 3BGLA 2AU0A 3MMAA 2OPQA 4U8YA 3KTQA 1OO0B 2C3OA 4I67A 3HVAA 3KOAA 4LF1A 1T9TA 5J1EB 1MU2A 5D0RA 2P9EA 4K4TA 2E29A 3AFGA 4CLLA 1HQ2A 2V2VA 2IJFA 4RWWA 5A8KA 1R0AA 1RT7A 4CNZA 3FC9A 4CP5A 4LFBF 1YK9A 3DOKB 3M32B 4LVNP 3KLHB 2B9WA 2L3MA 1JXLA 4FXDA 4NA2A 2GVDB 2EWHA 1UW4A 4C3MA 5IC6B 4C9DA 1RWOB 2NUHA 4OQJA 4PPZA 4LREA 2ZOFA 4ZLLA 2HBYB 1NSAA 1WORA 2J6UA 2HHTA 1NK6A 4X4VA 3CJ8A 2N4CA 5CYJA 3M2UB 3UDVA 1ZYQA 4MKBA 1T02A 1RJJA 3KNAA 4RKUC 5LSLA 4KPYA 3IM9A 2D74B 4Q8EA 1PO6A 1QAXA 3NMRA 2LU1A 4DR2F 1NKBA 1TV6B 4RW8A 3OXLA 2V4JA 5C25A 2UUBJ 2NXJA 1J5OA 4QWEA 4WFBQ 4DPTA 1NXIA 5C24A 2QGFB 3PO4A 2X1FA 1FWPA 1FVQA 1DFDA 2BA9A 2XY7A 3UD3P 5L8RC 2DYAA 4QWBA 2H3EB 4WKYA 1OSCA 7AT1B 2V2QA 4JI8F 1ITPA 1NPRA 1WWHA 5KFWA 2VPWB 2HGLA 1S6QB 4NLGA 1KVJA 3RW7A 2B9XA 1SJFA 3MR7A 3R1HA 1X9WA 4YFUA 2KFNA 1L3VA 5F8IA 2MJNA 5I42A 2JDJA 1RU2A 4Z7CA 2PD1A 3PM9A 3M2RA 2LU2A 3MURP 4WCEQ 2PIIA 3M8PA 2CYYA 5KFYA 4IOBA 2K7JA 3BQ1A 2R7SA 4JI0J 1RTJB 4ZVQB 1S1XB 1VIXA 2FHJD 3VV2B 2XCAA 3OFEA 2IBOA 2ROPA 4G1PA 4S0MA 1Q16B 3TNVA 3G71S 3QLHA 1UKUA 1FKAF 2VFSA 5GAEI 2QL7B 3HHLD 5A8WA 3CCVS 2J0WA 1FDBA 4RUAA 4ZCIA 1LW2B 2MZSA 3M1VA 4CLSA 2CKWA 2FYXA 2LDYA 3EUNA 1RWVB 4CTAB 2KU7A 1Q79A 3TR5A 2G2OA 2HYIB 2CADA 3A8EA 3M05A 4WTOB 1UA1A 1R3NA 3KWMA 1F9HA 2KZZA 2R7QA 2OPSA 1DTQB 2R2SA 3SCLE 3N5BA 2C2RA 1BHNA 1GQEA 1NCLA 3PX4A 4F3MA 3K59A 4MK8A 5LT5A 3G96A 2C3YA 1FHTA 3I5BA 4QU6A 1VI7A 3UDEA 4TY8A 2YKOA 2HHSA 2CJKA 5EWFA 4F4YA 3G6YA 1WKKA 2HMIB 4NLQA 2CJYB 2QC3A 3EXYA 3OL8A 2XB2D 3UNGC 4Y34A 5IT9U 4HL9A 3DMJA 1S7IA 5IWAJ 3UNYA 1HNZF 2WB4A 1P6TA 3LQVA 1Y3JA 1LWEB 5AXMA 4HHJA 3D1OA 2I6WA 4LQ3A 1VQ5S 4QQBA 3BZQA 1UVKA 1VBXA 4MKAA 2O3DA 1LWXA 2YH1A 2AKWB 3EGWB 1JLEA 2EFGA 1NZAA 2E7VA 3OD2A 3QWPA 2HFSA 1QD1A 5H9EJ 2ZH1A 3BBBA 3TYTA 2R2UA 1SQEA 2JLEA 4PG4A 4NX9A 1XMOF 4KTQA 5IQ6A 1CJUB 3QRQA 1Y3KA 4DV7F 2Z8QA 2FZCB 2DR5A 3W65A 1M1HA 4DFKA 2C22A 2ZNZA 2ADCA 2W8LA 2NYIA 4WFZA 4DCOB 3DLGB 5GAGU 2WSFC 2RKIB 5B0AA 4C0BA 1NU4A 1PKUA 2ATCB 1G2EA 4V19X 2Q6CA 2RQ4A 3CSKA 3BSOA 4WIIA 2YH0A 3JAMU 2RDIA 1FNOA 3IGNA 3QJJA 1XMBA 4EFAC 2RIJA 1VJQA 4FP9A 4JUZA 1GAOA 2XS2A 1KN6A 5L9NA 1K73T 5LMNF 3J7YU 4A8WA 4MAKA 4NA1A 1KLMA 1SPBP 1MG7A 1EZZB 3TRGA 2BOAA 2F8MA 5EWEA 2GQ2A 2RE1A 5HLFA 4O0IA 3CDBA 2JX2A 1R89A 4PYAA 5ETRA 4IFVA 2VDHA 2VHGA 4U9RA 5CZXA 2HNDB 4DQSA 3PW7A 1X8DA 4KAIA 4AXIA 2VG5B 3BGRB 4NRTA 2B7CB 5EN1A 2CQ3A 3BQ0A 2J7UA 4C2MA 1MWQA 1MMLA 1RT5B 1RAOA 1HW9A 2GGPB 4IG0A 2DBBA 3C66A 4WU3A 3C3LA 4J9QA 4QWAA 2QYGA 2R42A 5IXUA 2AZ1A 4OZ0A 2F4FA 1KFSA 2RUGA 1E6VB 2BKOA 1S4EA 4WTYA 3NGKA 4B3OA 2QA4S 1TL7A 4QCLA 2G1HA 2X1AA 4ERDA 1S77D 4GKKJ 1FKOB 2IJRA 3CDEA 4KGXB 2FC9A 2MKHA 2CQ1A 4Q44A 3R5CA 1X7VA 2CQPA 4KC5A 2VFUA 2RAQA 1DLOB 2N3OA 3D54A 3B78A 5ETPA 2R2RA 3WX4A 4NEYA 4A8MP 1N8RT 1EIYB 5E5NA 5AJ3F 4AL5A 5BR8J 4M5HA 3KHGA 1M1KT 1C4CA 1JLQA 1FTRA 1EB0A 2YX1A 1N0VC 2CIMA 5D4NA 1GMVA 1CSJA 2K06A 2GJIA 3TUPA 4DUZF 1QE1B 4OV1A 3GV8B 4DPOA 4TN2A 1Q5VA 4IH5A 2JVOA 1TVRA 2CQ4A 3TO8A 1YGYA 1AFIA 1GX6A 3OR1B 4B9SA 2VH7A 3DRRA 4QU7A 4ZVFA 2BXJA 2PO4A 4DF8A 3QATA 2EK6A 1T03B 2H54B 3QO9B 4B9LA 1YJUA 4A8OA 4C11B 2GFFA 1SH3A 3BKUA 1MMDA 2GX8A 3HVWA 5HJYA 5D4OA 4JI5F 4J7CA 4OYIA 4ZHRB 4I2QB 3AJ1A 5DG9A 2BJ9A 1U1MA 2L41A 4I64A 2VC0A 3PR5B 2HFZA 1LEOA 1TKXB 3BSCA 1YBUA 4PZVA 4F2RA 1RE1B 5DM6Q 4GKJF 1BLUA 9ATCB 2W9CA 2Z2MA 4PEOA 2MLYA 1RTHB 3DYAB 3MAAB 4ECXA 2MTLA 3BYRA 1VQLS 3H98A 4FZVA 1RTIB 3KLEB 4IUFA 4DU7A 1KLNA 1C0UA 1RK8A 1IWAA 4B3SF 4X4UA 4DQRA 2N7YA 2K3KA 3BPSP 4ZPVR 1I94J 5B0EA 2OI2A 2ZITA 3SSSA 1IBMJ 1ELOA 1MLAA 4USVA 4NXMJ 1DQAA 4YR2A 3FNNA 1SJ3P 2FIUA 4GC7A 1OWXA 1YITS 5ITHA 2Y8YA 1I6JA 1CVJA 1CQMA 1YJ9S 3DLEA 1LFPA 5U47A 4ES2A 2NZCA 1HNWJ 2XY5A 3NBPA 2E44A 2LYVA 2DNYA 3TA2A 1IKVB 3IS9B 4KV8B 4OI3A 5KFPA 3VVTA 1TU0B 3UCGA 4D3HA 2CQDA 2IM2A 2W7AA 4JI2F 4NLXA 2D69A 3EVWA 2B51A 2YNIB 4XAKA 2HIQA 5B0CA 4PR6A 1X4CA 1RKIA 3JSRA 3L7PA 1ZM9A 5M2RA 4RR5A 2MZTA 4M5LA 2OSQA 4ELVA 2ZH7A 1FD8A 2M7SA 3BH6B 4ZVPB 3MTJA 3MHYA 5F8MA 4KFBA 4WK1A 3T5KA 1GTEA 1N52B 5I3PA 3CJQA 1YJ7A 4ZP6A 4NCBA 3L7OA 4YB1P 2FTRA 1EP4A 4TLQA 2D3UA 4DG1A 4WIQA 2MDAA 3G87A 3T5HA 5K8MA 2HHUA 3FBEA 4HLBA 4E0DA 3MM6A 2WBMA 3D6MB 1DZ5A 1RT2B 3BO2A 4PWWA 4ALZA 3TQ1A 2RU3A 4O3PA 5LM7E 3Q8SB 2PMWA 3WC0A 1JLCB 2JVRA 4ZP7A 3CIZA 1Q8BA 3KUHA 4LF6J 4RW9B 2ASDA 1WEZA 1VQ6S 5D4LA 4ILMA 3LP2B 3C2PA 1ZAWA 1U1QA 1S6PB 3IBFB 3W63A 2XMKA 5KFBA 4XPEA 5D3GA 3GIJA 2RHSB 4I56A 3BQ2A 2B4PA 3LWMA 1S1WB 3KK1B 4ED0A 4IG3B 1QAJA 4PXDA 5B0BA 1RYRA 3UVJA 2MQOA 2XLJA 1S1UB 4LF5F 1FEHA 2RHQB 5CCMA 2PI5A 4C8LA 2DT9A 2F40A 4KKOB 1GFWB 3L7UA 2QFIA 3W2VB 5L1KA 1M5VC 5KFVA 3CCQS 3FCHA 1FKPB 2JFKA 5ETSA 2ZD1A 3CJ2A 4RNOA 3IAM9 1RBAA 4DLEA 3IWXA 4C8ZA 2EFOA 2KTQA 2FGCA 4Q2LA 1R27B 1FWLA 2YNFA 2YWFA 3W7BA 3M9NB 3UCUP 4U96A 1TMJA 1N6QA 1J5EF 4EYIB 3JB9k 5F8GA 3KLFB 4NCAA 1EARA 4ZP8A 5KG4A 1Q4RA 3N9UC 2KN4A 3GLJA 2RU9A 1HBOA 2H4WB 4X65J 2MSTA 2OAUA 1SC4B 3C14B 3FEZA 3CJ5A 3TZZA 3PHEA 2WCXA 1T95A 4DUYF 5J1NA 4ZIWA 5LJ5Y 1YWXA 4RW6A 1VQPS 2ZNYA 2K2PA 3WZ0A 2DNOA 2IM0A 5KFRA 1EETA 1X5PA 2FB0A 1YRXA 1TKTA 4LRFA 1VBZA 3Q8UA 4YHHF 4KHPJ 4HKQA 4I4BA 2MY8A 2EFPA 2M8DB 1VRTA 1FI4A 2IY5B 2E1RA 4J5OA 2L9DA 2MLZA 4ED6A 1H7XA 2UV8G 2IA6A 2V34A 4N8OA 3OW2R 3K2YA 4FPRA 1YBTA 5BYSA 1A7GE 3MECB 2DY1A 3PY8A 3OHBA 1WACA 3MWBA 2ZC4A 1DURA 4YQWA 2ZHBA 3H2LA 2E5LJ 3C8YA 2UUAF 4KSEB 1U2RA 2J6TA 2FDNA 1OQ3A 5B7WA 4YUDA 1RUSA 3FZ2A 2CPYA 4PUOA 1Z2ZA 4ED2A 1AUDA 3QMQA 2YKMB 2HBRB 3W60A 4QYRA 2G4BA 4DX7A 4I7FA 3M6VA 3PX0A 2ZHOA 1RT6A 5HQMA 1B0PA 2FVSA 2DO4A 2HHXA 4G65A 3B4DA 2CVIA 2LVWA 1MROA 4ECQA 3RRHA 4DMZA 1B0VA 3PJ9A 2IAJA 2VOPA 2IDEA 4UOFA 1OY9A 2WB1D 2DGOA 1X5OA 1KQFB 4A48A 2V4RA 4FBUA 4Q2MA 2XTJP 3SV4A 1Z2LA 2ZM6F 3J80U 1L3SA 4WPAA 2LP4A 4O44B 3L3CA 3OR2B 2FHJA 5KFFA 1N0UA 4P74A 3Q83A 1NHVA 4ZA1A 1X4BA 1RAHB 4EO6A 1S6OA 5A2QU 3QAEA 2H5IB 3ENVA 5KFKA 2DXFA 4Y65A 1BXNA 3HHLA 4O0NA 3MUVP 4DR1F 3I55S 3CDAA 5KG1A 3EVOA 2UVVA 2IJNA 2XO7A 4RPFA 2HGMA 3V6KA 3WIVA 5CABA 5IT4A 1S1TB 1XNQJ 2BABA 1S59A 3MFIA 2CPEA 2A10A 2LEPA 2F65A 4PWDA 4A8QA 5M2PA 4GRSA 3CJ0A 4DPXA 4XIUA 3VR1A 3DDIA 1HKAA 1SC3B 5A0YB 7FDRA 1WOOA 2C2OB 3DGPA 4G1QB 3E51A 1PJ5A 3OQ2A 1G3OA 4TNOA 5F3TA 2CPHA 5E3QA 5BJRA 1M5HA 2AT1B 2IHR1 2MEWA 1H73A 1FNXH 1DTTA 3RRGA 1LWCB 4ES3A 2BV3A 4DV3F 3M6UA 2P6TA 1N54B 3HFZB 3N79A 3PJXA 4IH6A 4OFZA 4DV4F 4H4KA 2EK1A 2YQ1A 4HT5A 2BQRA 3D6HB 4PPDA 5KFCA 3OBIA 4DBQA 4ZN1A 3HFKA 2F4VJ 4XPCA 3G86A 1YRTA 2L9WA 2NXNA 3NY0A 4ZPWR 2GJ2A 2M3DA 3NLCA 3V4IA 3IRXB 4MTPA 3NNCA 1YX2A 1BUXA 3MEGA 1HI0P 1W25A 4JI6F 3CMAS 3Q23A 5G0RB 4IRKA 1IQZA 1IKYB 1Y0HA 5HVGA 3PX6A 4LMZA 4X4RA 2BANA 1X4GA 2COLA 2YX7A 1QSYA 1P27B 3UI3A 2DR9A 1HWUA 4QWDA 3SZ2A 2PMZD 1NK0A 1Y4ZB 1RTZA 5F9NA 1LW0A 1WJ9A 4W4MA 1Y11A 1W2BR 5L38A 2VZ9A 2W7PA 3Q2SC 1LKZA 1TL3A 3QFHA 5IT9Y 2Z30B 4B3RJ 2ZH4A 3K5NA 1FNMA 2AYMA 2RD5C 1I1GA 2MSSA 3PRBA 4IO1A 4USMA 4LF9J 3RR7A 4H4OB 2POKA 4YR0A 5K14B 4M5DB 3WDOA 2JZ5A 3FSXA 2E1MC 4I1TA 3AD8C 4N41A 3MMBB 1IM6A 2D7SA 2IFXA 3SDEA 6FDRA 3CXCR 2VPYB 4F4ZA 3MCSA 3UN3A 1RHQB 1WSRA 1V9OA 2XGQA 4LSZB 3B82A 4KH0B 3K8WA 2HSEB 2VB6A 3NS7B 1XWLA 3HSDA 2BR0A 4N47A 2AYBA 3I4PA 2IIHA 1YLXA 1LK5A 3WHIA 2ZC3A 1U2FA 2DGXA 3DI6A 3O6QA 1IKWA 1VRQC 2KM8B 2KKHA 1REVB 3W5XA 4X64J 5D0EA 4M94A 3QJLA 2R9LA 1QUPA 2FHOB 3NGTA 2DKOB 4G1IA 3M9MB 4C98A 3GCXP 2LQ5A 4AE5A 1M90T 5K8NA 2PEHA 3BDPA 3JAMY 2LKZA 1CC7A 4CDIA 2DNQA 2EKNA 4FVMA 2Q1LA 2CRLA 4O3RA 2C2ZB 1APSA 2LMIA 3HD2A 1S6UA 3ISND 2MGZA 5KFEA 2YQ0A 1S10A 1OY6A 5KT6A 3GIRA 4DQIA 3MR3A 4TVAB 1N34J 2HQIA 1WDDA 2N7CA 1WHWA 3HHNB 4QOTA 4M63A 3BKFA 3D1QA 1O51A 1ZA2B 1S0MA 4X84A 1SL2A 2NSCA 2DXEA 4ZVRB 4JI3J 1X5TA 2KJVA 5KFZA 5CHCB 2IVYA 2CJAA 4DR4F 1WF1A 2VFVA 4UQGA 4HR2A 3LUYA 3D67A 4QR0A 2VBYA 5HJXA 4Z7YA 2O5DA 4B9TA 3CTRA 3W3SA 4OYZA 1HPZB 2XZWA 1BQNB 1D9DA 4NLUA 4NA3A 3AA9A 1HMVA 2JFDA 1CJVB 3IC1A 3RBXA 2H9ZA 3LW5C 4R8UA 3QNWB 3G82A 2UXCJ 4V1Ak 1N33J 3RB6A 4OZ5A 2IA0A 4DR5F 4N8NA 1H2UX 1PC5A 2OEMA 3JS9A 4F0HA 5CD4H 4NRUA 3J81U 1ZM3A 2HFNA 3HZGA 3MPYA 3ILOA 4M5MA 1WF0A 3PNIA 1SJ4P 1PG5B 2ILYA 2AGOA 5F9LA 4LF7J 2B56A 1YG0A 2C28A 5DRKA 4N7TA 2CJQA 3NS6A 3R7BB 2XCPA 4DCJB 3TQEA 5T7LA 1E6YB 2E5JA 4F36A 4IQMA 2B0GA 1IQTA 3DDKA 2CWXA 4USIA 5ETNA 2ZVIA 2I9SA 3PYEA 3BS9A 3VALA 2CG8A 4MFBA 1U8WA 1SKUB 1RTDB 3DOKA 3M32A 3A3PB 3GIIA 3CO9A 1M5PC 2GVDA 3I6PA 2W1BA 1X4HA 1AW0A 1D1UA 1K8AT 4ANEA 4CH7A 4KR0B 2MQ8A 4IQXA 3R6GB 1SIZA 3HFVA 4NLOA 2E7XA 3LP1A 2XYHB 5KFQA 4F02A 4EBEA 4LFBJ 2ZBCA 4P72A 3LAMA 3SIPB 2ABYA 4C3LA 1UETA 1XR6A 1U2CA 3VVUA 2Q66A 2V63A 3DOMB 3IO1A 2ZZMA 3O8WA 3ZFVA 2CQ2A 2EVZA 3FZBA 4RBVA 2F1FA 4DPUA 1ZM2A 3EZOA 1RABB 1TV6A 3CWJA 5L39A 3NCQA 5ADZA 3AQOA 3AQPA 2GMHA 3DHXA 3R97A 2XC9A 3CJSA 4JI1F 4OYXA 4WE1B 2LXUA 3D3CJ 1C1BB 2WK4A 1NZ8A 4AL7A 4LFAF 3GPAA 2J5AA 3IAS9 2ZWOA 1N5VA 1P1LA 2WHOA 4TU9A 4DR2J 2W2QP 3CF5Q 4KO0A 3J7A1 2FY1A 1RCOB 3H40A 4Q43A 5GAGI 4GO7X 3QZ8A 1JJ2R 2OPRA 3GTYX 4PXCA 4NLSA 4X4QA 3FMBA 2R8IA 2LDIA 1VLYA 3ISZA 4H54A 2D3ZA 2KL8A 3I0RB 2HRYA 5BYQA 4DR7F 1NB7A 2C2EA 4JI8J 1LWFB 1RTJA 2BRKA 1SJRA 2DHXA 1C0TB 5HI7A 4NMLA 2HAFA 1Q78A 3LGMA 3ENAA 1S0VA 2IM3A 2KO1A 1X4EA 2DRDA 1RT1B 1D8YA 3ILJA 1ZH5A 2B6AB 4ES1A 3FFIA 4USTA 2K1RB 2QMWA 1MW7A 4CTAA 5D8HB 4DDFA 3AB2B 3Q24A 3QGHA 4WP9A 1HBNB 4QZVB 2CPFA 3W8GA 4ATNA 1R8PA 3HVTA 1EQ0A 2ZH8A 4FF4A 4OYOA 1SUQB 1HHTP 3V6JA 1LQ9A 1TKZB 3DC2A 4A47A 3T5JA 4YEAA 1HNXJ 2YKNB 4CZCA 2XYPB 2OPPA 4X4TA 3DU6A 4FXVA 1JB0C 2V9WA 3OFHA 4QYZK 2AGQA 1BQMA 2ZZNA 5FD1A 4OIXA 2VA3A 2OFGX 2R8KA 2W2MP 3DRPA 2ZWPA 4Z37A 5EX3A 4CLYA 2DNNA 1G6BA 3PG9A 1O0PA 1TL4A 2J8SA 2XBPA 3POTB 2KXFA 2W7OA 3NNAA 3AODA 2Q6BA 2A0FB 4GO5X 2FVQA 3FBBA 4ICLB 4QPXA 4YN3B 3V6DA 3SQGB 3TARA 1QM9A 5L1IA 2J0SD 4TYAA 2N4DA 3B54A 1KHWA 2FLOA 2EKYA 1CEZA 1U1KA 1HNZJ 2RT3A 4ANCA 3K7RA 5DO2A 1RHKB 3VAKA 2MKCA 3L4BC 4DQPA 1T0TV 3W62A 3FEYB 4CO4A 4GMKA 2KH9A 2FLLA 4RU9A 5JVHQ 5J2PB 1FERA 1PGZA 4CLZA 4KE5A 3JSMA 3FQKA 3PW4A 2B8PA 3BKTA 4ECZA 2BJEA 4ZKAA 3ZZZA 3MMAB 2OPQB 3QFWA 3P49B 3EVMA 5EUHA 5F8JA 1HNVB 4K4VA 3T1AA 1XMOJ 2BQUA 4J90A 1FRHA 2RKIA 1Q95G 1Y5NB 3MR2A 2W9AA 2JEJA 4DV7J 4Y2KA 3OL9A 4NEZA 4A8KA 4NCGB 4C8YA 2J6SA 1R0AB 2N3LA 3CCTA 2EFQA 4Y00A 3ADAC 1WD6A 1RAGB 3UCZP 1VLOA 2YPYA 2DNRA 4I68A 1UL3A 3MMCB 3MR6A 1F1BB 1J2VA 1F5BA 2RDDA 4FS1A 2KG0A 1VGYA 2GW8A 1VQOS 1HQEA 2Z2YB 2ZZTA 1CJTA 5HN0A 2HS3A 3D1HA 3J7ZT 3DRSB 1SJ1A 4JV5F 3Q8QB 4QIWD 2HQ3A 3MD1A 4B08A 5LMNJ 3K17A 1QY7A 1TL5A 5HMZA 3MM5A 2J9DA 4ZPDA 5AXKA 2EEYA 1AZSA 4RW8B 3OVSA 3IWLA 2IVMA 2V4JB 4FYXB 1J5OB 4WF9Q 1TUGB 3CCRS 5C24B 3AT1B 2AP6A 5DJBA 3GSIA 4JV1A 3WBZA 1A6LA 2DHSA 4M5NA 3V6HA 2PFFB 2GIRA 3PHTA 1E6VA 4EYHB 5F8NA 1ZTWA 1VOMA 4L75A 2ERRA 5M2UA 3HP6A 4XO0A 2RVJA 3FCVA 2D3OR 2QSWA 2DRAA 1CLFA 5AT1B 3RGIA 1RLCL 1ZBTA 2IRYA 4IDKA 3TZXA 1AT1B 3Q86A 4UZCA 1ZTTA 2X51A 3IM8A 3VGUA 4ZLPA 2HFUA 2LEBA 2QJ3A 1FE0A 5C42A 3QSIA 3M2RB 4LRDA 1GEHA 3G8TA 3M8PB 2QN6B 3RUBL 2MYFA 3GR0A 3ZTRA 4OMFG 3HT0A 4F2SA 1JWWA 1JK9B 1BGXT 3TVKA 1HR0F 2AV5A 2ZKTA 3GR1A 2E9TA 2Y1RI 3QT6A 5A2QY 1NBEB 6AT1B 1YVFA 4I2PB 3I5CA 3QLHB 4UQTA 1VFJA 3K5MA 3HT3A 1QE1A 5E2QA 4F3QA 2K3IA 3CCES 3C19A 1VBYA 2Y1IA 2KFYA 5AJ3J 5IZHA 2VPXB 4QPTA 5HMYA 1RAAB 3MGJA 1MMNA 3P8BB 2GO9A 2D3O1 3MUMP 4Z2XA 1FRMA 2UP1A 1WC1A 1QVFR 3VAMA 3W2WA 4PG5A 1X4AA 3QO9A 2RILA 1UFLA 4LF8F 4DUZJ 4C11A 2OPSB 3GV7B 1JJ4A 5KT2A 1U1OA 5J2NA 1ZZFA 1B64A 2GQCA 3RYLA 4NYOA 3K5PA 3KJVA 3ILLA 1IBLF 2M5YA 3KLGB 2W01A 1TL1A 2QMUB 3GZ7A 1NK8A 1VCTA 2BOPA 2CPDA 2DNHA 3H90A 5HBMA 4K0KF 4X4SA 3DMJB 4CLWA 3EJMA 4F4KA 4JI5J 2NYHA 4RUHA 2E5GA 3LTOA 5KTQA 1GK8A 3AOCA 1Q7LB 4B9UA 2I2YA 1AB8A 3M8WA 3JYTA 4NI2A 4AFFA 3CGIA 2W9BA 3QZ7A 1S0OA 1KRPA 2JJ4D 2YWEA 5IM0A 2JEGA 2VU5A 1PAUB 3CCWA 3Q0AA 1P9YA 5B08A 4ED5A 4JP8A 1CBKA 4P7TA 4GKJJ 1S0NA 3P5BP 1B99A 3C16A 1T8EA 4DL7A 5DGBA 4CCHA 4K4UA 2J8AA 3JTPA 3UDCA 1FJ7A 4CYUA 1NK4A 4X2BA 1SV5B 1V5VA 3IP0A 4N56A 4LIWA 3OXFA 3H2VE 3M7VA 4B3SJ 1U49A 3ELHA 3ET6A 2C2DA 2HQCA 4LSLA 1IKVA 4KV8A 1RCXB 2ZBPA 2IRXA 1S79A 3HK2A 4R5PB 4QYZJ 3CJ4A 3ZZUA 3UFCX 3UW1A 2FY8A 1YSJA 2RQKA 4UUXA 3UR0A 2L9NA 3NS5A 3T3FA 2ROGA 4OI1A 1PJ7A 4DLGA 3OT9A 4ECTA 4LF4F 2XWXA 3P3DA 1R31A 3R7NB 1VRUA 1UVIA 2HNYB 2V69A 3KFWX 4UOCA 3OTOF 3M30A 2BW2A 1XC9A 1KLMB 2UXDF 4JI2J 3MCNA 2CPJA 4JYAF 3UN5A 4WJBA 2XY6A 2V50A 4Y2IA 4EK2A 3PEHA 5HLFB 1F3FA 3R7SB 4NLTA 1RAIB 1Y7PA 4NPOA 4IFVB 5CA5A 4DL0C 4I69A 3PACA 2A6MA 5BYRA 2MKJA 4WFAQ 2OELA 1IWGA 2CNOB 1NSKL 4ER8A 3T1YF 1RT2A 1T05B 4ID5B 2Y3YA 4LUBA 4HDHA 4IR1A 3TX8A 2APOA 3OTCA 3CEDA 1BWVA 3FK4A 1VQSA 4ITSA 3KG1A 4IG0B 3KJNB 3ZTSA 2WTFA 3H42A 2CG4A 4EGLA 3UD5A 2J9EA 3IA0A 2QLBB 4L72B 2HWIA 1CJKA 4L3NA 2QG9B 1S6PA 1WDTA 4OLPA 1S1WA 4MKVA 4B3OB 2VKZG 1IR0A 1TL7B 4PKDB 5KFLA 3RBZA 4I6AA 2PT0A 2ZE2B 2MQPA 1S1UA 4M5JA 2OJ3A 1FXDA 3OHAA 3TAMA 3U1LA 4FDFA 3THTA 2HHPA 4GC6A 2DNLA 5DQGA 2HQDA 3D28A 4DSKA 1F5AA 2VQFF 4F3OA 3KG4A 1T9UA 2C2NA 4OI6A 2B9YA 2JSXA 4LF5J 1D9AA 1JLQB 4KB7A 2WVFA 1UVNA 4RNNA 3KLFA 3OTBA 1HARA 1VC6A 3V4MA 3C14A 3MAHA 4ZJOA 3TUZC 3L95X 2GIQA 3J81Y 2PI4A 1TVRB 1FJGF 3DLBA 3CB4A 1N5SA 2KZMA 4DV5F 1S57A 4EI2A 1LXNA 2VA2A 3DRRB 1FA0A 1J5EJ 3QIPB 4LBPA 1DQ8A 2KFZA 3I5AA 1G7CB 1NM2A 2DNPA 4P71A 1N36F 4KH1B 3P96A 3GJSB 4DUYJ 3T6BA 4J9SA 4LR9A 3ZTPA 1QUVA 3R5AA 2OSRA 3I87A 4YHHJ 1UFKA 2ZDOA 3MPWA 2CZ4A 4IYQA 5CYMA 5CH7B 1S9EA 4PQUA 1DARA 4O3SA 2UVWA 5I4MA 4H4MB 4J37A 1KSPA 2R4FA 3AJDA 2BVZA 4BWMA 1Z4UA 2W9CB 3AH6A 3M4XA 2MHNA 2E1CA 2ZDPA 2UUAJ 2RRNA 4LRCA 3N4WA 2NS1B 3HHKA 4AQYJ 2LXIA 3HM9A 3N5FA 2W2PP 3RRKA 3EM1A 5CYQA 1Q8IA 3I32A 1C0UB 3THPA 4TKTA 3BH7B 4QWCA 3P4UB 2AW0A 2RRBA 5AXLA 2XSFA 1FXLA 2HNZB 3CCZA 4W92B 1ZM4A 2PFDA 4NZ7A 2KI2A 5LL6d 2UV8A 4KYZA 2HRTA 1KVIA 1NK5A 5DLGA 3AB4B 2CQIA 3S8SA 3H5YA 1RADB 2R7OA 4TU8A 1JLBA 3C15A 3TI0A 3DLEB 2E1AA 2DJWA 5FDLB 5IC4B 1F3VA 4UY85 1CULB 3NBPB 4EMDA 4X4OA 4WBFA 2L48A 2ZM6J 1RT4A 4K4XA 4LBIA 2FJBB 1REGX 3ZNJ1 2YNGA 1PBUA 4CWBA 4B3MF 4ZLJA 1IJEB 4YMEA 2WSCC 3B4MA 4K4ZA 2E5IA 3Q22A 3MAQA 3R6LB 2UVRA 4DX5A 1HNXF 3QGGA 2BE2A 4ZCMA 3SFGA 5EGYA 4KT0C 2AMCB 4DR6F 3HULA 1YTYA 5A0YA 4DR1J 4G1QA 1FRJA 2OGUA 2AEJA 2KHDA 4OZ3A 3CDUA 3DLJA 2V2ZA 5HATA 4IH7A 2ZBQA 1FESA 3ZZPA 4DI6A 1TAUA 1ICEB 1NJZA 4DG1B 4DSIA 2I0XA 4Q8FA 4A8FA 3UO0A 1SL0A 4O3OA 5D15A 2MKYA 2YWHA 4NE9C 4A4JA 1G4CA 2FHMA 3MM6B 4KHRA 2DHHA 5DG7A 3I82A 2DY9A 4Q0BB 1VK3A 1FRKA 2CQCA 2FVRA 3W9HA 1YJVA 3M8ZA 3OL7A 3QBCA 1CG2A 1H72C 4LRBA 2OD6A 2FLPA 2DR8A 4CNYA 4DV3J 2DITA 1N5YB 3R27A 4DV4J 5HK4A 4LVOP 2AJ0A 3GILA 1PILA 4OYAA 1ZETA 2PMHA 3DXBA 5D3GB 3QYYA 3GQCA 3KNGA 1SKWA 5KFUA 1KDNA 2G13A 1HI1A 4JI6J 1UW9A 3IG1B 4FNIA 4YS2A 4C7QA 3DOLB 1NJIT 2ZD1B 1J27A 2EBEA 1YZ6A 5DDPC 5JXSA 2OHDA 4O3NA 2UZAA 5E3AA 4X66F 4CLUA 3ZZTA 2AJQA 1Q81T 5DQHA 3HJFA 3FRYA 4ZLNA 2C3UA 2YNFB 1W26A 4USHA 4ANDA 1F2HA 2HKEA 2N82B 1N6QB 3LALA 2BJ7A 1NH8A 1WI6A 3FMWA 1DJ0A 3U02A 4CO0A 3HJVA 1HWLA 2QL9B 2RF2B 3IXQA 2V5HG 2DGUA 2NLWA 4AXJA 3AJ2A 3TA1A 3ZZRA 1FTCA 1HBOB 2AX1A 4RNHA 5J2QA 4JI7F 4MIBA 3EE3A 2HHHF 3CD5A 3K57A 2P5VA 5KFOA 1HNIA 2IC3A 5IV4A 1FFGB 2UXBF 1XNRF 4OZJA 1KTVA 2EW9A 2HS0A 2XEXA 1TKTB 1JKHB 3GU0A 3VF0B 3AY0A 3CVKA 2UU9F 1B70B 1VRTB 2GVZA 1FXRA 4KRWA 4W90B 2PGCA 3FJ2A 1JLAA 3CIMA 1X31C 5B09A 5GMKa 2NQPA 4DFMA 2G2YA 2HQFA 5CZVA 1CS4A 3R2DJ 4P6QA 2HFOA 4QIGA 4ID8A 1ZOTA 4PCQA 3KHHA 3SCKE 1NDPA 3PIPQ 4C6AA 4PUOB 5CQGA 1KHVA 1LOUA 2PDAA 4UZBA 1MNEA 3HF5A 1VHIA 3QIDA 1D0EA 3MCOA 1RT6B 4TY9A 1OPZA 1C1CA 2R8GA 2EFNA 1SCJB 1WOSA 5KFGA 3CUNA 2V0NA 3PFOA 3N28A 2IAJB 1R8BA 2M52A 2GMJA 3GCWP 1SB6A 4KBIA 3CC7S 2B43A 4ZPCA 1X0FA 4DV6F 4IRCA 2ILZA 1RHJB 5KG6A 4EBCA 1YIJS 4DL4A 1HPZA 2QLWA 1KTQA 3HHEA 4Y6IA 4WWSA 1UPPA 2LLZA 4PYDA 5K9FA 4I6YA 3W64A 5D0HA 3MM8B 2E66A 1U02A 4NLWA 4UTGA 1XIQA 1CJVA 1ZAXA 2F8HA 4ZPAA 3PDNA 4DR4J 2WOMB 3VAGA 1FK9A 3PFEA 2NR0A 3DXSX 4P7VA 5LMUF 3KJFB 5HO4A 1TAQA 1DQ9A 2PA8D 3UWTA 1KC8T 1WF2A 4G6VB 3T6JA 2M4MA 2UUTA 1HD1A 3AAWB 4DR5J 1WHYA 5B0DA 1E6YA 2QL5B 3RR8A 1ZZNA 3MOZA 3LPEA 1KQKA 4Y0FA 2WBRA 2KM8C 3CCMS 3TAPA 3D7SB 1DTTB 4GVLA 3CC2S 2YWKA 1XEZA 3TEHB 2V68A 4Q7AA 1WEXA 5HMXA 1OYEA 1FCAA 3OVBA 2ZH3A 1VQ7S 3LP0B 2OP5A 5SUHA 3EPGA 1U48A 1O6XA 4M95A 2MKKA 3V4IB 3BB5A 5I3UB 1OS5A 3TA0A 2VODA 3MEGB 1RT3A 1JNZB 2V8PA 1S97A 3QT7A 3H20A 2MPUA 2YX4A 1SH2A 3MPVA 2IMWP 2XMTA 3DOMA 5ETMA 2BANB 1EQMA 4LJMA 3IMQJ 4K8RA 4OL8A 1X4DA 4CLFA 1S1VA 2B3TB 2VG7A 2M9KA 2NUUG 4JOUA 1UEKA 2WONA 3OSNA 1F9FA 1V6HA 1BE4A 2GHPA 4IOCQ 2LXFA 4B9VA 5B0GA 3KK3A 1TL3B 3P5TL 3EICA 4ECUA 3ITHB 3G9CA 3BDEA 3R3TA 3IFEA 1QTMA 1MN7A 1ULRA 2GC8A 3TZWA 3ULHA 3DFEA 2YKPA 3HCXA 1M5OC 3N6LA 4DZ6A 1PJ6A 4QW9A 2HVHA 3MOJB 3FBCA 3HKWA 2W25A 2LQ8A 1SQGA 4JI1J 4OX9F 1JJHA 2JL9A 3I4HX 2MQLA 4NYPA 4LFAJ 1SQFA 2XMVA 3OSPA 2YNHA 5D0GA 1UEVA 2BM1A 2XNQA 2OEKA 1Y9OA 1FFWB 5KOWA 3JTOA 1C0TA 3LF0A 3NGDA 3NNHA 1RP5A 4CQ1A 3BR9A 2E7WA 1U1RA 3NKYA 1HBUA 4OV6A 3GYGA 1IKWB 3J81j 2GO8A 1XERA 2HLUA 5C2GA 2VBZA 2C2MB 5KAKA 3W5ZA 2QX0A 2ZJPQ 4DR7J 1YJRA 2F3JA 1U47A 4RWXA 4ZDNA 2VOOA 2KRBA 2AHOB 2CDRB 5KFAA 3RAQA 1IBKF 4PAAA 3OJUA 3GYNA 1HQUA 3SCIE 2K1RA 2RMLA 4P2SA 3CJKA 1OIAA 4F0MA 5LSRA 5DM7Q 3KDOA 2XI3A 4RZRA 1FO1A 2EC2A 3SEOA 3G8SA 1UMJA 2C3PA 2YWGA 3H8YA 4C0HA 2R7WA 3OLAA 2XZTB 3AXKA 4P52A 2HHQA 5KG0A 2CJBA 2XULA 3I56S 2V2KA 1SUQA 4EU0A 4DR3F 2F63A 2VFRA 3F44A 2DGQA 1WKJA 1TKZA 4J9PA 5THWA 4ZVHA 3KLIB 2H48B 2MGZB 3IN5A 2LA4A 1VQ9S 1L3KA 2YKNA 3V2UC 2F9JA 2GCFA 3Q8RB 2HVDA 4LSNA 4ZIVA 2QEXS 3I9ZA 1G1XA 4MH8A 4K2JA 1VMBA 3B8HA 4PABA 1S7HA 2PC6A 5C7PA 1QDUB 4O3QA 3TWZA 1TR0A 1WELA 2VQEF 1F5CA 1UVLA 4OJHA 4LBHA 1DAXA 5LJ3Y 4USWA 2XS5A 1UJ4A 3M8QB 3H59A 3ZZ0A 4WZQA 2Y0SD 3KJQB 3POTA 3MCMA 4P75A 1AA1B 1BY9A 4CRJA 3C6UA 2HW3A 3MTKA 4P9SA 4ICLA 1GNKA 1EJ7L 4RNFA 3D4JA 4JV0A 3CW2C 1UWBB 3EZ5A 3SQGA 2F5GA 3NXZA 4L3KA 2NCKL 3CD6S 1EKSA 2Z57B 3PO5A 4ZVEA 2HFVA 2ZBRA 4DSFA 4X62F 1FRXA 4R8UB 4YY3F 3OUYB 3R9LA 2EG2A 3NWRA 3OLBA 3BJYA 2HZVA 3AD9C 1RB0A 2B9EA 2DNZA 2DCUB 3M2VB 2DVIA 1FDAA 5D6GA 4ZOSA 3ZO7A 2BX6A 2FPHX 2QZ8A 4MK7A 1RYSA 4DV1F 3PW2A 5J2PA 3JQKA 4ENOA 4YR3A 3BGOP 2RQCA 1HHQA 5HL7Q 2K8GA 3LWLA 4DV2F 1HNVA 5T7LB 3O2IA 2WVBA 4M5GA 4DXLA 5LSOA 5H9FK 2CZVC 4FKXA 3RZAA 2QV6A 4NCGA 4NXNF 3HSGA 1X5SA 2AJ4A 2C2KB 4GVBB 4MFBB 3V81A 1V5IB 4C8NA 4PG8A 2NSBA 4F26A 4P2MA 4RW4B 2AJ1A 3I0SA 4AQYF 1TK0A 3RW6A 4JI4F 3T9ZA 2OTLS 3MMCA 4XDDA 3G6VA 4TQRA 1RBOB 3RBEA 4UY8T 1HYSB 3BO4A 3EXCX 2QYCA 1IR1A 3LP1B 5LXYA 5DGAA 3ISNC 1UJ5A 3DRSA 2EG1A 5IQQA 4KHMA 3OFFA 1XTZA 3NAHA 4DSJA 1ACMB 1RAEB 2JC1A 4F50A 3QAUA 2KG1A 3FDSA 3LAKA 2GHWA 3JSBA 4FBTA 2CQ0A 3DNCA 3QPIA 3MEDB 1K44A 4DN0A 2FUG9 1ZAVA 3UDLA 1U7LA 1M5SA 9RUBA 1QAYA 2V6AA 3RB4A 3PYFA 1TFWA 2WRMA 3GIMA 2CNKB 4JV5J 2X1BA 5AE2A 4K4WA 2R8HA 1U1PA 2Z2LA 2FJWA 3M8RA 1W2IA 5C2CA 2MZQA 2HEKA 2I1RA 4NLPA 3FUYA 4CO2A 2UUWA 1D09B 1NAQA 2XHWA 3ICLA 4KO0B 2BJ1A 4B9NA 4ECSA 4Y2AA 2ZBIA 3F56A 1K0VA 2HLTA 5EDWA 2OPRB 4LRAA 3J7Z5 2YTCA 3CCSS 2LECA 1JLFA 3NP5A 3W9IA 2Y1LB 1AYEA 4WZMA 3NOGA 2LQBA 3TW0A 2KRRA 1FF2A 1JX4A 4ZITA 3IRWP 2A6OA 5ETQA 3TVYA 2DGSA 4I2PA 3M8YA 1SBRA 5DDOC 3BREA 3D3BJ 3D5MA 4ZN3A 2FHKA 2MB0B 1U09A 1GT8A 1WI8A 3DM2A 3FFIB 1EHWA 4F25A 1HR0J 3QGIA 1NDKA 1Q1KA 1WC6A 3PVXA 2EC0A 4Y28C 3EPIA 2QLFB 2XSJA 1UJ6A 3HVTB 3X1LB 3BR8A 3H5SA 4NMXA 2M8HA 3GWCA 4ZCKA 3PJWA 5F0UA 3R5JB 3I96A 4HACB 2J7KA 1Q82T 5GAHU 2D9OA 2ZH6A 1T9VA 1Z1ZA 2OPPB 4M8LA 3K58A 3CT9A 2V8GA 3S7RA 5E41A 5AE3A 3KLGA 1DBDA 5CAAA 1VK8A 3H4BA 1UFWA 1BQMB 2AIRB 4DZDA 2BE9B 1HHSA 1Y10A 1GXTA 4IKAA 5HP1A 4LF8J 4PQAA 2M88A 4PG7A 3PZPA 3DRPB 2KDOA 1PCAA 3FBFA 1YI2S 1PYOB 1VIOA 1S72S 2Y0BB 4IFYB 2ZJRQ 3D0IE 5GADI 1IBLJ 1WHVA 4HH0A 4NZ6A 2IBKA 1RWMB 3T1HF 2QTWA 3V6DB
chains in the Genus database with same CATH topology
1L3TA 1SH0A 4LSLA 3HKZD 4ZP6A 4LSNB 1IKVA 4YDDB 4KV8A 3VAIA 4NCBA 3OFGA 3L7OA 4FF2A 4YB1P 1SC6A 2FTRA 1EP4A 4TLQA 2D3UA 2IRXA 4RW7B 1S79A 4DG1A 3HK2A 4R5PB 4QYZJ 2MDAA 2ZVSA 3CJ4A 3CJ3A 3UFCX 3ZZUA 3UW1A 1D8ZA 2GA7A 1Q8LA 3PIOQ 3T5HA 1BQXA 2DNGA 3LOUA 2AGPA 5K8MA 5HMWA 3WC2A 2P9CA 3FRZA 5FLXY 1YSJA 2RQKA 4UUXA 2XGPA 1U1LA 2HHUA 3UR0A 1UP1A 2L9NA 4HLBA 3NS5A 3T3FA 1B0TA 2ROGA 5HROA 4N76A 2IYGA 4E0DA 3MM6A 2HAIA 2WBMA 4OI1A 5L1JA 2VPZB 1DZ5A 1RT2B 3BO2A 4DLGA 3K5LA 4ALZA 4ECTA 2RU3A 3TQ1A 3OL6A 4LF4F 2XWXA 1SV5A 4O3PA 3MMJA 4Q45A 3Q8SB 3N6NA 3P3DA 1R31A 3WC0A 1VRUA 1JLCB 1UVIA 2JVRA 4ZP7A 3C6TA 4IFYA 1HWIA 3SI8A 3CIZA 2RH3A 1Q8BA 5KFHA 3T5LA 2HNYB 2PE8A 4Y2MA 1WTFA 3C6UB 4NL5A 3US5A 3KFWX 1PSDA 4UOCA 4RW9B 3OTOF 3M30A 2BW2A 3FGVA 1SI9A 1IUJA 2ASDA 1XC9A 1KLMB 2UXDF 1WEZA 1VQ6S 2FVPA 4X65F 5D4LA 2CPJA 2ZOMA 3JSMB 4JYAF 4ILMA 4WJBA 4H4OA 2XY6A 3LP2B 4Y2IA 3FQLA 5KG2A 1FJCA 3PEHA 5K14A 2EPIA 4M5DA 3C2PA 1U8SA 5HLFB 1ZAWA 2MQMA 3MM9B 4NLTA 1U1QA 5SZTA 1S6PB 1Y7PA 4NPOA 3E8OA 4IFVB 5CA5A 4RW7A 3MMBA 5KFIA 4DL0C 4RNMA 4R5PA 2MXYA 2XMKA 4I69A 5JJBA 5KFBA 3PACA 4XPEA 5D3GA 3GIJA 4I56A 3BQ2A 2B4PA 3OTDA 5BYRA 2XLKA 1JMTA 4C4WA 2MKJA 3H4DA 4WFAQ 3F41A 2AX0A 3LWMA 1S1WB 3KK1B 1RKJA 4LFCF 4ED0A 3NG8A 3VAHA 4IG3B 4K2XA 3G6XA 3FSIA 4KHPF 2QT7A 2DK2A 5K5MA 3UQSA 1QAJA 1TZ0A 3ZC4A 4PXDA 3T1YF 5B0BA 1RT2A 1T05B 4ID5B 1RYRA 3GMGA 2MQOA 2XLJA 2V8HA 3U1NA 4LUBA 1S1UB 4LF5F 1F0XA 1FEHA 2PI5A 4HDHA 2QA2A 5CCMA 4C8LA 4YOEA 5T41A 2DT9A 4IR1A 3TX8A 2F40A 2APOA 4KKOB 3OTCA 3CEDA 3W2VB 2HNYA 5L1KA 1M5VC 1VQSA 1KOOA 4U6PA 1P1TA 5KFVA 4RW6B 4K4YA 4IO9Q 4ITSA 3CCQS 3KG1A 3FCHA 1FKPB 4IG0B 1S9GA 2JFKA 3K0JA 2WTFA 4NWBA 2ZD1A 2VC1A 1VS3A 3BO3A 2RS2A 2ASLA 1RI7A 2E5LF 2CG4A 1WHXA 4EGLA 2L08A 1SL1A 1EETB 2J9EA 4FF1A 3IA0A 4OHXA 4L72B 2HWIA 2FJAB 3OPKA 3CJ2A 4RNOA 2QA4G 4L3NA 4FXWA 3IAM9 4OZLA 1KOHA 3VZIA 3MM9A 4DLEA 1HQEB 5KFDA 3MD3A 1S6PA 3IWXA 4C8ZA 2EFOA 4OX7A 2KTQA 1S48A 2EI5A 2R8JA 1REVA 2FGCA 2CDQA 1H7WA 4MIAA 3CE8A 4Q2LA 1R27B 5F3ZA 5KT5A 2XLIA 4OLPA 3M9OB 2YNFA 2YWFA 3Q2TC 3W7BA 3DRYA 3M9NB 4MYTA 3UCUP 1S1WA 2HVIA 4B3OB 1N6QA 2VKZG 1J5EF 4EYIB 1IR0A 3JB9k 4PKDB 3K5OA 5KFLA 1FEEA 5F8GA 3KLFB 4NCAA 1T05A 4ID5A 4I6AA 5IFMA 3CCJS 4ZP8A 5KG4A 1Q4RA 2PT0A 2ZE2B 2MQPA 3N9UC 3V81B 1S1UA 3FVYA 2KN4A 2KXHA 3BGUA 3MM5B 2RU9A 3KKFA 1N48A 1HBOA 1U45A 4DSLA 2MSTA 2OAUA 5DQIA 2OJ3A 1HFEL 3FEZA 1FXDA 3CJ5A 4FF3A 2I8EA 1K1SA 3PHEA 2WCXA 1T95A 3I0SB 3OHAA 4DUYF 5J1NA 5LJ5Y 1YWXA 3TAMA 3O44A 2ZKUA 4RW6A 3U1LA 3HHDA 1VQPS 2ZNYA 4DV0F 2K2PA 1K1QA 3WZ0A 3THTA 2DNOA 2HHPA 2IM0A 5KFRA 5HQ8A 1EETA 1HBMA 1X5PA 4GC6A 2DNLA 2FB0A 5DQGA 1YRXA 2MQQA 1TKTA 3D28A 1HWJA 1VBZA 4DSKA 1F5AA 3GFXA 4YHHF 3K8VA 2F8EX 4HKQA 4MK9A 2VQFF 4DS4A 4F3OA 3ONQA 3VTIA 3KG4A 4I7FB 4I4BA 4RU2A 2BJDA 2MY8A 1GX5A 2EFPA 2DGVA 2HGNA 2B9YA 4I6WA 1VRTA 4OI6A 2M8DB 2JSXA 4ED8A 3DDNA 4C8KA 4EEYA 1D9AA 4XK8C 1GXUA 1Y00A 2E1RA 3I31A 4J5OA 5H9FJ 2L9DA 4ED6A 1H7XA 2EBGA 4OJ3A 2UV8G 1JLQB 2IA6A 4KB7A 1TQLA 2RB7A 4N8OA 2DRBA 3OW2R 4IRDA 1UVNA 4OJGA 4RNNA 3K2YA 4FPRA 1MROB 3KLFA 5BYSA 1A7GE 2WW8A 3MECB 3PY8A 3Q8PB 1N5QA 4CT8A 3OHBA 3SFUA 1WACA 2ZE2A 3OTBA 3MWBA 2ZC4A 1DURA 1HARA 2IM1A 4IDKB 4YQWA 2ZHBA 2RS8A 3H2LA 3C8YA 1VC5A 2UUAF 1VC6A 4KSEB 4YP3A 4RBTA 3DLKA 3V4MA 2DISA 4CO3A 1R8AA 1U2RA 2J6TA 4WYLA 3EZUA 4LIRA 3MAHA 2FDNA 4ED3A 1OQ3A 4N77A 3TUZC 1AFJA 2XMWA 1H98A 3L95X 1JIHA 2GIQA 3BSAA 5B7WA 2LQJA 5C42B 3J81Y 4YUDA 2PI4A 1TVRB 2JHEA 3MM7A 3FZ2A 2VV5A 1HW8A 1FJGF 3DLBA 2CPYA 1IKXA 3CB4A 3I9V9 1N5SA 2KZMA 4DV5F 4PUOA 1Z2ZA 1PC4A 2ZFHA 3RB3A 5B0FA 4O4GB 4ED2A 1AUDA 1LXNA 1S76D 2VA2A 3QMQA 3DRRB 1FA0A 2YKMB 2YVSA 3NRBA 1XBWA 3GFYA 4HH1A 3QIPB 4QYRA 2G4BA 3MXHP 4J9MA 4I7FA 2F9DA 1DQ8A 2DGTA 2KFZA 3M6VA 3HXMA 3PX0A 2JLFA 2ZHOA 3I5AA 3PRDA 4ZPBA 1MWYA 1XNQF 1RT6A 1HWKA 3CC4S 2MZJA 4DN9A 1B0PA 4DS5A 3NMAA 1G7CB 2DGWA 2FVSA 1BQNA 2DO4A 1YHQS 2DNPA 1N36F 2HHXA 1XK8A 3OTEA 3P96A 4ELUA 3B4DA 1KR4A 2CVIA 2W4PA 2LVWA 2PSZA 1MROA 4ECQA 3RRHA 3T6BA 4DMZA 4J9SA 2W4DA 1YBAA 2OH2A 1B0VA 2IRUA 1KQSR 1QUVA 3R5AA 4AUKA 2IAJA 2OSRA 2VOPA 4OI2A 1VQKS 2NREA 5J1EA 3MFHA 2WB1D 1FRLA 1H0HB 3HHLB 5IT0A 2DGOA 1X5OA 1GH8A 4WKRA 1KQFB 3NAIA 2ZH2A 5CXTA 3I87A 3H5XA 4A48A 2V4RA 1M5KC 2QO3A 2Q43A 3PW0A 4ZCLA 4K5SA 4FBUA 2ZDOA 3VQSA 2BM0A 3S1TA 3RB0A 2RQMA 2C42A 3MPWA 4ECRA 2CZ4A 3CCUS 4IYQA 2R7XA 1JLFB 5CYMA 3J80Y 5CH7B 1S9EA 2QMXA 4Q2MA 3SV4A 2VASA 1IJFB 1Z2LA 4PRFA 4WFYA 3KLHA 3SV3A 4PQUA 1DARA 2FGOA 4O3SA 2ZM6F 2UVWA 1NHUA 2ZH9A 4O4GA 1L3SA 5I4MA 2W24A 1HI8A 2W8KA 4O44B 3QIPA 3L3CA 4H4MB 3OR2B 4J37A 2FHJA 5KFFA 4WFXA 1KSPA 2R4FA 3W2WB 4PWDB 1N0UA 4MKYA 4BWMA 2BVZA 1Z4UA 3DLLQ 4K4SA 2W9CB 3AH6A 1FVSA 4J9KA 1NHVA 2CPZA 3M4XA 4ZA1A 4J9NA 1X4BA 1WG4A 2MHNA 4R25A 2ZDPA 2E1CA 2RRNA 1S9FA 2LA6A 4EO6A 2KT3A 3N4WA 1TK5A 2NS1B 3HHKA 4B17A 1S6OA 2LXIA 1NO8A 3HM9A 3T9NA 1GTHA 3QAEA 2JWNA 3ENVA 5KFKA 2MQNA 3NWGA 3THVA 2VG6B 3N5FA 3ZZOA 3PXGa 2ZJQQ 2F4VF 4Y65A 5J2NB 6FD1A 1KD1T 3RRKA 5FIIA 5CYQA 2V9KA 4LQ9A 1Q8IA 3HHLA 3I32A 3EX7B 2O01C 3M2UA 1K0TA 3MR5A 1C0UB 4QIEA 3THPA 3MUVP 3KJVB 2MY7A 4DR1F 3I55S 2AWZA 2VONA 1T94A 1WEYA 3CDAA 4TKTA 4WXWA 5KG1A 2I5JB 3DM2B 1NNDA 4QWCA 2UVVA 2VBXA 2AW0A 2RRBA 2HG4A 2IJNA 3U1MA 4B02A 5MLCV 2XO7A 2OIHA 5AXLA 2UUCF 4URQU 2HGMA 4NOHA 3V6KA 2HZCA 4IR9A 1RTDA 1TL1B 2B5JB 5IT4A 1S1TB 3AHPA 2XSFA 1N32F 3BN4A 2DTJA 1FXLA 2BABA 2HNZB 3MFIA 3CCZA 4W92B 1R43A 1ZM4A 2CPEA 1H38A 4NZ7A 2KI2A 5LL6d 2UV8A 2A10A 3CULA 3DLHA 5HBMB 1AXQA 2LEPA 4H4MA 3MEEB 3GG1A 4G3IA 2XSJB 4ECWA 4PWDA 1KVIA 1NK5A 4A8QA 5M2PA 3CJ0A 1XMQF 2G0CA 4BC7A 5DLGA 1JXEA 1R8HA 3AB4B 4XIUA 5LXRA 2AJFE 3VR1A 5AXNA 2CQIA 3TUJC 3S8SA 3H5YA 2HHVA 2R7OA 4TU8A 2A3JA 1JLBA 5A0YB 2V8VA 4O23A 7FDRA 3DGPA 3TI0A 3JYTB 3DLEB 2D9PA 2E1AA 2FD2A 3E51A 3OQ2A 4G1QB 2DJWA 1G3OA 4TNOA 5FDLB 5F3TA 2VG6A 1O8BA 5H1SV 1FJEB 2W9BB 4UY85 5DLFA 4MYUA 4OJ1A 2CPHA 3NBPB 4X4OA 5E3QA 5BJRA 2V94A 2RDJA 2L48A 5IM0B 2GV1A 1M5HA 3LH2S 4B3RF 2IHR1 3PKMA 3TVZA 1RT4A 4K4XA 1FNXH 2FJBB 2I5JA 1DTTA 3RRGA 1LWCB 4ES3A 1JLGB 1S6QA 3E3XA 4I0WA 2BV3A 4DV3F 4F4XA 3M6UA 2BYCA 2P6TA 3SXLA 1N54B 2HWTA 2YNGA 3NCPA 4LF9F 2B5JA 4B3MF 3N79A 3PJXA 1IJEB 4IH6A 3ENWA 3VWSA 4OFZA 2HNZA 4DV4F 4YMEA 2WSCC 4H4KA 5HP1B 3B4MA 3TAQA 2EK1A 4HT5A 4K4ZA 2BQRA 3P6YC 2E5IA 3Q22A 3MAQA 3QJPA 4PPDA 1LW0B 4ZMMA 2M70A 4JV2A 2KJWA 3MEEA 3OBIA 4U7UK 2J7WA 5KFCA 2UVRA 5DS7A 3MDFA 3TANA 1HNXF 4DBQA 3HMJG 3HFKA 3QGGA 3ZZYA 4ZS6A 4XPCA 3G86A 2KYZA 2BE2A 4ELTA 1YRTA 1F2GA 2Q79A 2L9WA 4ZCMA 5J2MB 3SFGA 4OZNA 5EGYA 4ZPWR 2GJ2A 4KT0C 2M3DA 3DCAA 4DR6F 3NLCA 3V4IA 3IRXB 4MTPA 3NNCA 1YTYA 5A0YA 3MEGA 3UE2A 4KGMA 3KMSA 4WE1A 4E98A 2JOQA 4G1QA 1S1XA 1W25A 1HI0P 5FDLA 1C1BA 1QAIA 4QR2A 4JI6F 1FRJA 3J7YI 4IOAQ 1DRZA 2U1AA 3CMAS 3Q23A 5G0RB 2A1BA 1Q86T 2KHDA 3PV8A 4IRKA 3CDUA 1IQZA 3DLJA 1IKYB 1Y0HA 4IH7A 3PX6A 4LMZA 4LSLB 1RGVA 3HO1A 1FESA 4X4RA 2BANA 4CI0B 1QSLA 3ZZPA 1X4GA 2COLA 2YX7A 1JLGA 3EYZA 1TAUA 3GV5B 2QLXA 1NJZA 1QSYA 2DNMA 1O5JA 4DG1B 4DSIA 1P27B 1R7IA 3UI3A 2I0XA 2DR9A 4Q8FA 4A8FA 1Y5LB 1SL0A 4O3OA 4YB7A 1NRKA 2B4OA 3SDEB 1HWUA 4QWDA 5KT7A 2YWHA 4ECVA 3SZ2A 4QR1A 2PMZD 1NK0A 2BACA 1Y4ZB 4A4JA 5HROB 2ADBA 5F9NA 2FHMA 4PG6A 3MM6B 1LW0A 4KHRA 1LW2A 3GE9A 5KFNA 2E5HA 4DOZA 4X4NA 1W2BR 5L38A 3O3LA 5DG7A 3I82A 4X64F 4R0JA 4Q0BB 4K59A 1VK3A 4NYZA 1FRKA 2VZ9A 2CQCA 3LANA 4HI1A 2FVRA 4CH0S 1YJVA 3OL7A 3UR3C 3I0RA 4FNHA 2W7PA 5J2MA 2R7TA 3Q2SC 1LKZA 1CG2A 1VRUB 2RRAA 1TL3A 3C6TB 2KVIA 1YJNS 4HVZA 5IT9Y 2OD6A 1LWFA 4DL6A 2FJDB 2ZH4A 2FLPA 3K5NA 4ILRA 3O1LA 1FNMA 2AYMA 3M30B 2DR8A 4KQZA 4CNYA 3BEGB 2RD5C 1I1GA 2DH8A 2MSSA 2ZUGA 3HZEA 3PRBA 2DITA 3KHLA 4IO1A 5KFTA 3RR7A 4B3TF 4H4OB 1N5YB 3R27A 2POKA 4YR0A 1LFWA 2VKRA 5GVQA 5K14B 4LVOP 4M5DB 3WDOA 2JZ5A 1DTQA 2AJ0A 3FSXA 3DI6B 2E1MC 3H2UB 4I1TA 3GILA 1PILA 4N41A 3MMBB 2CQGA 3GB0A 4R0EA 1ZETA 2PMHA 2D7SA 3DXBA 5D3GB 2IFXA 3M6WA 5DETA 3SDEA 4MIWA 3QYYA 4ETZA 5A6WA 2P9GA 5KG5A 3HLUA 3GQCA 3KNGA 3BSNA 6FDRA 2NPIA 3CXCR 2WAQD 2VPYB 4MJKA 4F4ZA 3MCSA 1RT1A 1V9OA 1SKWA 1N4LA 2HPUA 2A2DA 1OQ6A 2M2BA 5KFUA 2XGQA 3OVAA 2B6AA 4DWIA 3DRXA 4Q0BA 2G13A 1HI1A 1FE4A 3B82A 1UAWA 2OKQA 4XDCA 1RQ0A 3K8WA 3IG1B 2QSFA 4QIVA 2ACYA 4FNIA 2VB6A 2HMIA 3KK2B 2HWHA 2GMLA 3JTNA 2DCLA 2U2FA 1XWLA 5F8HA 2DH7A 1HBNA 4C7QA 2BR0A 5KT4A 1NK7A 2KT2A 1QVGR 3DOLB 1YJWS 4N47A 2R7UA 1N34F 2D41A 1KNZA 2VUGA 1S9GB 5D4PA 4ZK7M 4F67A 1NJIT 2ZD1B 2AYBA 2EBEA 3I4PA 4C3KA 3O5TB 1S99A 5FJ4A 5DDPC 1LWEA 5JXSA 2E9RX 3E01B 1N5YA 1T7PA 1LK5A 2ASYA 4JI3F 4O3NA 2UZAA 2ZC3A 5E33A 1U2FA 2DGXA 4NZ0A 4RLEA 5E3AA 3DI6A 3O6QA 4X66F 1IKWA 2KM8B 2KKHA 3ZZTA 1N5TA 1REVB 1IXKA 2AJQA 4DF4A 4ZP9A 4HEA9 1Q81T 1F60B 5DQHA