2D74B

Crystal structure of translation initiation factor aif2betagamma heterodimer
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
137
structure length
137
Chain Sequence
IDYYDYEKLLEKAYQELPENVKHHKSRFEVPGALVTIEGNKTIIENFKDIADALNRDPQHLLKFLLREIATAGTLEGRRVVLQGRFTPYLIANKLKKYIKEYVICPVCGSPDTKIIKRDRFHFLKCEACGAETPIQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor 2 gamma subunit
publication title Structure of archaeal translational initiation factor 2 betagamma-GDP reveals significant conformational change of the beta-subunit and switch 1 region.
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 22
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2005-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01873 eIF-5_eIF-2B Domain found in IF2B/IF5
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.3150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2d74B01
2D74B 1NEEA 2NXUA 2DCUB
chains in the Genus database with same CATH superfamily
3OTCA 5D4NA 1N0VC 4DEZA 3ZZYA 3MURP 4NRUA 2K7JA 4AFFA 3IO1A 2PEBA 1UEKA 2GVDB 3DRSB 3KOAA 4ZP9A 2O1PA 3CD7A 4ES3A 5IQ6A 1XNQF 5KFZA 4K7QA 3NCQA 2DNNA 3OTOJ 1E6YB 2C2KB 1OS5A 4F67A 3PJ9A 3GP9A 4DCJB 3C3LA 2DY1A 1RBAA 3ETOA 2OTJS 3KXDA 2C28A 3FDSA 1MWQA 2HVZA 4FYXB 1UFLA 2GAHC 4DQIA 2FLPA 3AD7C 1V6HA 3MXHP 1OIAA 1NRKA 2W4CA 2N7CA 1SB6A 3IBWA 5KT2A 4TQSA 2GMLA 1SH3A 3DLGA 5C25A 1NPKA 1RKIA 1U48A 2FB0A 3GIJA 3C19A 3C6UA 1S7HA 3DXSX 3CJ5A 1PKUA 3CDBA 2DBBA 3W62A 3MPYA 3L09A 3K89A 3J80U 2Y8WA 4ED1A 4DF8A 1VBYA 3TEGA 4E98A 5HJYA 4RKUC 4NLSA 4LRBA 4PXEA 2QO3A 2Q43A 5HQ8A 3FSXA 3HSJA 4A8KA 2ZZMA 2R8GA 5JMNA 2F9DA 3T6BA 3L4BC 5J2PB 3CTRA 3K5OA 3ENVA 3D4JA 4CRJA 3Q23A 4RWXA 3J81Y 2HWTA 2OEMA 4DL5A 1H2TZ 5HJXA 2WK4A 4NYOA 3KLFB 1FFWB 1TKTA 3JAMY 3EICA 1RP5A 2R7TA 4KBIA 3HK2A 4ZVGA 1UA1A 1VRTB 1HPZA 2XI2A 2ZZNA 3VAGA 4DQSA 4LFBJ 3L7UA 2BANB 5J2QA 3BQ1A 5KT6A 4CO0A 1RT5A 1T8EA 4B3SJ 3DDNA 4DLEA 1UEVA 1ELOA 1BMQB 1UZHA 3SEOA 1RB0A 5D0EA 3R7BB 5KFBA 4IO1A 4Q0BA 2R7QA 3UCUP 4F4XA 1MU2B 4DL4A 3B6BA 4CT9A 4KO0A 5HMWA 3HDSA 4WE1B 4HEA9 5HBMA 5KFEA 1HKAA 1CC8A 3G82A 4F36A 2OKQA 2LXFA 2DGUA 5G4DA 4YY3J 3EJMA 4ZVSB 1VJWA 1L3TA 2FVSA 2HFNA 4ZPWR 4DN9A 1FD2A 4OYIA 1IWGA 1OQ6A 2ZH4A 1Q8KA 1HWKA 3IC1A 3QRRA 2EXUA 5F9LA 3CJ0A 3IM8A 2XMMA 4OYXA 3O3LA 4TU9A 2UXDF 1RWVB 5E3CA 1LWFB 3ZNJ1 4F8RA 4DFPA 1Q53A 2GGPA 3I55S 1UZDA 4J7CA 3V4IA 2AX1A 4YP3A 1PO6A 1Q1KA 1RLDA 4G1IA 2MGZA 4K4SA 1LNQA 3J81j 3BKFA 1NPRA 4Y2KA 5F8MA 4NLTA 3RU0A 5JJBA 3AQPA 1GNKA 4NEYA 3N01A 3FEXB 1B4SA 1NAQA 1Q8LA 1VBXA 2J7UA 1U0SA 3RAMA 2VFUA 2GHVC 5ETTA 2LA4A 2W9BA 4FS2A 2GHWA 2E5IA 3QT7A 1PJ7A 1FFGB 4O3SA 5IWAJ 2LEPA 3AH6A 4U9RA 1S12A 3RB4A 4R8UA 5LMUJ 2IRUA 2HS3A 5KG2A 3PM9A 1WC1A 1N52B 5D77A 3DHXA 2OEJA 5DLGA 3MTJA 2FHOB 3DXBA 4UOGA 3CXCR 3TVKA 1QTNB 3CCQS 2EKNA 1RAOA 3THTA 1FERA 3SQGA 4NLPA 4QYRA 5D4LA 2GX8A 2EEYA 4F2SA 5DDPC 4UZBA 3SMZA 3NBPA 5KFPA 3KK2A 1I94J 4F4KA 4UUXA 3CVKA 5C24B 3DDIA 2DT9A 1HQEA 5AXKA 1NDPA 2CPZA 4HHJA 1EQMA 3NGDA 1CVJA 2E5GA 2R7SA 5CYJA 5CXTA 2V8GA 1DHMA 2WTFA 3RB3A 1FXDA 2L48A 3GPAA 3E3XA 1G7CB 3AA8A 1XMOJ 4DR2J 5JUMA 4L6V3 1BC6A 2AKWB 1RT2A 4QQBA 5M2PA 1XK8A 3HKZD 4ERDA 1O0PA 1X5SA 3HSZA 1S59A 2CNLB 3R6LB 1IKYA 1YJTA 5CYQB 2R7UA 3LP0B 1N5SA 2MQNA 5A6PA 3MMAB 3V2UC 3VAIA 3IGVA 1QDUB 3W9HA 3VAKA 2AZ1A 2FJBB 3AT1B 1UVNA 4NL5A 2MLXA 4M5MA 2LVWA 2IJRA 4CO1A 3OR2B 2VG5B 4ZP7A 3LGMA 2MQ8A 3FBBA 1VQ6S 2ZBQA 4GKKF 3WC2A 3H59A 1HI8A 3D3BJ 3H4DA 1HYSA 3Q83A 2PFFB 2M0GB 1T05A 1FDBA 4H4OA 5E7OB 2BJEA 3H2LA 3HHKA 1YVFA 4CO3A 1FJ7A 3CW2C 1WF0A 2ZBCA 4P52A 2LP4A 4CTAB 1VOMA 3GJRB 3DOMB 2QE5A 3R7SB 1ZA2B 4WZMA 1BQXA 2DEJA 1U45A 3AY0A 1RA6A 1TL4A 1C1BB 1RWXB 3BV8A 1CJUB 3CO0P 2RVJA 3RUBL 2G4BA 2CYYA 4LFBF 1S6QA 1EX8A 4EMDA 2RMLA 1X4GA 2G1DA 2KJWA 3AB2B 4A8MP 4XPCA 3VAFA 1TFYA 3I0SB 4B3SF 1FFSB 5EX0A 4LREA 2HFSA 4YB6A 4WFYA 1DBDA 4DPWA 4B9VA 3FC9A 3PO4A 2IBOA 4RW7B 3MOZA 2HZCA 2DKOB 3GFHA 1EAYC 4F0KA 2Q66A 3MR5A 2BJDA 2OPPB 2J6UA 2V69A 1UW4A 4QIFA 1KONA 3GJQB 3Q2TC 5F3TA 2A10A 2U2FA 3PW4A 3LP1A 3M8YA 2AEMA 2VZ9A 5E3PA 2VC1A 5D78A 1N54B 1X4HA 4N76A 1WTBA 4YY3F 1FHTA 2IVYA 1FTRA 3A8KA 4KJIA 4F3MA 3KJVA 2FZKB 1XERA 2CKWA 2AQ4A 1CSJA 1N88A 1T9WA 4C0BA 2GW8A 2GC8A 4LBPA 2VKRA 1TVRB 3V4MA 2FY8A 1RI7A 4H4MA 2PFDA 2FQQB 1D09B 3SBMA 2K06A 1QUPA 3W66A 4F2RA 3SDEA 2V4QA 4FXDA 1UFKA 2YWGA 4QU7A 5E3RA 2QFJA 2HVIA 1FJEB 1KLNA 3D2WA 4YOEA 1XMBA 3UDVA 4UOHA 1Y7PA 5DG9A 1H98A 1TAQA 2QMXA 2L41A 2NZCA 1JNRB 2XZDB 5M2UA 5I42A 2AJ1A 1NLKL 3T9NA 4W92B 4OYZA 2RAQA 2VPZB 4C11A 1DARA 4ID5A 2CPFA 2DNHA 3CDEA 4NCGB 5BXIA 5J1PA 4C8YA 1RABB 3ONQA 2OI2A 3QO9B 3PYDA 4Y28C 3W64A 5KFXA 5CA5A 4DLGA 3KG1A 4DXLA 5HMYA 4KFBA 5IWAF 3MHYA 2HAIA 4ES2A 2HBRB 3E8OA 3TANA 3MMBB 2QFIA 2WSFC 1HMVA 1MNEA 1M5KC 5D3GB 3PHEA 5ETNA 2FHKA 2ROPA 1BQMB 4DPXA 2PSZA 3MM6B 1DTTA 3M7VA 1Y5IB 3CJQA 2J0XA 3MOJB 3C66A 3A8EA 3NNCA 4A8WA 1RJJA 1TK8A 1WSRA 1HBUB 4WJBA 5J2MA 1KEKA 4AUKA 1XR7A 3IRXA 3QFHA 1UWBA 2Z2LA 4I67A 3OSNA 1OSCA 1T95A 2BUNA 2YPYA 3DOLA 3T5LA 1I94F 5KFRA 3NG8A 4JV0A 3FBEA 1WI6A 3CDUA 1FESA 3FCHA 4KB7A 5CAAA 3TAQA 1ZM4A 3RRHA 2R8HA 3NEKA 1KSPA 2DXEA 4ID8A 1FVSA 2CG8A 3OXGA 3VALA 3EXYA 1EB0A 2KB2A 1HWIA 1XMOF 2MY7A 3IN5A 2CQ2A 1FNOA 2HRUA 5DM7Q 4DR2F 3X1LB 4MK8A 2AF6A 3CMAS 4AQYF 4C4WA 4F50A 4C8NA 1V3ZA 3C6TA 3ZZOA 1UTAA 2XHWA 3L3CA 2M9KA 1D0EA 4NLQA 3DM2B 3FEZA 3GCXP 1U0HA 1J5EF 1Q95G 2CQDA 4CQ1A 4CM0A 2RF2B 4ZMMA 1JLEB 1YZ7A 1H7XA 4RUCA 5SUHA 1T03A 3HZEA 4UY85 3E51A 3US5A 4LRAA 5B0AA 3MUMP 4RU2A 2DIUA 4WFNQ 2ADBA 1LW0B 2B0GA 4G1QB 4WP8A 4Y3CA 2QA2A 2DR8A 3QRQA 5RUBA 2WW4A 4PRFA 3PVXA 3D9BA 4FDFA 4WZQA 2NXJA 1IR1A 4QPXA 3Q22A 4K2JA 2H48B 3AA9A 4NEZA 5B0BA 3D28A 4KT0C 2G2ZA 1YIJS 2XCPA 2J9DE 2DNRA 1TR0A 2R2TA 2V8VA 2HGNA 4IFVB 1KN6A 3D1OA 3A8IA 3DI6A 2WVFA 1U1OA 3LTOA 3Q89A 5C2CA 2PGCA 2R8KA 4JI3J 2W9CA 4GO5X 4M1KA 3J7A1 4OLPA 3EVMA 3FSYA 1WEZA 2LMIA 2HURA 3U1NA 2XNRA 5H9EK 4NYZA 2RQMA 3E01A 3EGVA 2BQRA 4LQ3A 3HD2A 2VA2A 2HWIA 5EX3A 3JQMA 2HIYA 4WTYA 4NWBA 1RT6B 3MEGB 3OUYA 3HXMA 4RW6B 2WB1D 2KVIA 2I38A 5B08A 3UFCX 2GMHA 2RQ4A 2YWEA 4WKYA 4B3OA 5D8HB 2IVFB 3MAAA 2X3DA 2N3LA 4I68A 1S9GB 3UW1A 3X3UA 4DQRA 2FYXA 4QYZJ 5DO2A 4IFYB 2DNZA 4IOAQ 4RNMA 1RT7A 4A8FA 1QJHA 3M6VA 2UUBJ 1KHWA 4N7TA 3QGGA 4DCOB 3UD5A 4UQGA 2DCUB 1H0HB 4HDHA 5DGBA 2HKEA 1E6VB 1N5VA 4ZVOB 4JI0J 2UXCJ 3POTB 4RW4B 4CLWA 4RNFA 4P2SA 3M2VA 5CZXA 2VBXA 3AJ2A 2W7PA 1DTQA 1IKVB 1GMWA 2LKZA 1SKRA 2MJNA 3EGZA 2KI2A 5A8WA 2NXNA 3EPGA 2E44A 5IT9U 1JIHA 4J9NA 1IKWA 2MJUA 4PPZA 2KH9A 3CCUS 3T41A 2D3ZA 3SV3A 1T9VA 1AZSA 5CCLA 3R1LA 3N9UC 2B9WA 2VU5A 1NDCA 3IG1B 1U1NA 4WYLA 1TK0A 3ZZZA 4OYBA 5L38A 3JB9k 2GJIA 2FUG9 4NLVA 1QSYA 3KLGA 1TKZB 2MHNA 1VK3A 1U47A 3PZPA 2AHOB 3MM5A 1H74A 2BKNA 5DQHA 1TMJA 1EQ0A 4DSJA 4MIAA 2ZH9A 2OPQB 2HVHA 4LSNA 3D5MA 4GC7A 3HVTA 4X64J 2QJ3A 1AYEA 3ISZA 4Z7YA 1HL6A 4F3QA 3UWTA 3KLHB 4NA1A 2IM1A 4KY3A 4MFBB 2XI3A 2J0SD 2G2YA 2KXNB 2PO4A 2B8QA 5E0OA 1HNXJ 3DLKA 2E66A 1JX4A 1VGYA 3KJNB 2UP1A 3W9JA 3ISND 3EZOA 1W7WA 3HT0A 3C14A 2B9XA 3MEKA 5F3ZA 4O3OA 6AT1B 4HHUA 4LF2A 1GMWD 3B4DA 4QIGA 1S9EB 2PC6A 4OI2A 1OPZA 2UUCJ 4V1Ak 4WFZA 2MYFA 1REVB 3QZ7A 2P9EA 3PTWA 3V5RA 3M32A 3PIOQ 4PQUB 2MKYA 4NZ6A 3OFFA 1RXOB 3I6PA 1WEYA 5HSPA 2DNLA 3NS6A 2YNFA 4Z37A 2I9SA 2N82B 3MM9A 3NAHA 5LJ5Y 5FIIA 2NZ4A 5J2NA 4KGMA 2LCWA 2EFGA 2I8EA 1VK8A 1FO1A 3AQOA 2LU2A 2O5DA 1VQ7S 5A0YA 5I3UA 3I56S 1N5YA 1R7IA 1D8ZA 5HVGA 1WDTA 1LV5A 4KKOA 2KKHA 1GQEA 4QWAA 3TYTA 2I5JA 2QSWA 3HZGA 4X84A 3DRRA 2CRLA 3KHHA 4NLUA 2H5JB 4DL6A 1S77D 2BM1A 4LRDA 4UOCA 5CCMA 2AV5A 2OPRB 4J9OA 1HW9A 2XMUA 1G2EA 2NYIA 5IV3A 2HBYB 4O44B 2ILYA 2DIVA 3RYLA 1X5TA 2IDLA 4M63A 1RT3B 4JI3F 3AOAA 3FRZA 1QUVA 5HK4A 3HP6A 1SUQB 1RAIB 4ANCA 3R2CJ 1JXEA 2K3IA 4EYIB 4C0HA 3NOCA 4ELVA 1YRTA 2E29A 3MR7A 4RBVA 1OQ3A 3M05A 3R97A 2MKJA 4WK3A 2F7VA 1EP4A 4V19X 4OLOA 1GEHA 5MAOA 4LF8J 1WEXA 3VV2B 4JI1J 2R9LA 1U25A 4G3IA 5GADU 4M8LA 4FKYA 4GMKA 4ES1A 5A2QU 3T1HJ 2QLJB 4QBUA 4WF9Q 5A8RA 1VQYA 4DZDA 4DX6A 1ROFA 1Y3KA 1KNZA 3W63A 2DNQA 1T9TA 4MIBA 3C8YA 1NJZA 1K9MT 1S10A 1YHQS 1HBMA 1UVIA 1XR6A 3VAJA 4IG3A 2UXCF 5DLFA 2XZTB 4OL8A 2HHSA 3QWUA 5HP1A 1HBNA 4M5IA 4K8RA 2AWZA 2YWWA 4TXSA 4NA2A 2HK3A 3FSIA 4ECQA 2HRYA 1NB2A 4P6QA 5FDLA 4NLWA 4KHPJ 1UKUA 4ZVTB 2N4CA 2ZM6J 2MSSA 4DV5J 4M5DB 2XG8A 4URQU 4JI8F 2ZFHA 3T6JA 2HS4A 3GFYA 3IXQA 2F4FA 3MPUB 4J9MA 4PCQA 2BR0A 1U7LA 4YR0A 2MKIA 3CDAA 3S1TA 2H4WB 4LR7A 3LUYA 1X0FA 2ZDOA 3ET6B 3UCZP 4JUZA 2UUAJ 1LQ9A 1S1WB 2W9AA 3PRDA 2Q1LA 1QE1B 4LIWA 1VQOS 1Y3JA 3M8PB 5IT0A 3D7SB 4DPOA 3LAKA 4NLXA 5I3QA 1DQ8A 5EGYA 1WORA 1YBAA 3MR2A 3LP2B 1DLOB 1TL7A 5EUHA 3WIVA 2HS0A 4O3QA 1ZH5A 2JLFA 2DEIA 2G0JA 2B9YA 4X64F 5L1KA 1VHIA 5DQIA 1JXVA 4KHRA 3M6XA 3OD2A 1JJ4A 1YG0A 3W60A 2V94A 4LFAJ 2R42A 1JLAB 2C42A 3OFGA 1RBLA 1PYOB 1Y9OA 4U8YA 1UPMB 1N36J 4WFAQ 4OI0A 2OGUA 1NB7A 3SSSA 3MDFA 2BEFA 4NRTA 5KG0A 3CEDA 1XN9A 3MD3A 2YNGA 4R0JA 1LKZA 4N8OA 2KXHA 2CQPA 2AX0A 4KH0B 3KNAA 5KT7A 2Y1LB 4WP9A 2R2SA 3F41A 1BY9A 1S4EA 3DRPB 2ZHBA 1U02A 5IS2A 4BDPA 2BJ1A 1TMMA 4DR4J 1M1HA 2QN6B 1F2HA 3A3OB 1KWMA 4RW9A 4PR6A 3I87A 2NXCA 1BD6A 3P4UB 5FLXU 2CJ9A 2XYHB 4A48A 3KMSA 3LH2S 2JWNA 1LK5A 4QCLA 2UVUA 1XMQJ 4C8ZA 3AAWB 1I3OB 4IOCQ 2GAGC 5IC6B 2KT3A 4M5LA 4OYMA 4RBTA 4K4ZA 3V81A 3MWBA 2OO4A 1SH2A 4USIA 3W9IA 3W7BA 3IGNA 4Y2CA 3NCRA 3TR5A 4IRCA 3MTKA 4K2XA 1ZPWX 2L9DA 5ETKA 3BKUA 1VRUB 2WVBA 2UV8A 1WELA 2KN4A 1HQUB 3TAMB 1FKPB 2D3OR 3H90A 5IOLA 3NAIA 3QLHB 2AJFE 1SC3B 5B0EA 3NOGA 4RL1A 3KDOA 2B6AB 2X51A 1HNVB 3Q8UA 4DQQA 1F3FA 1IBCB 2PN6A 1QY7A 5DM6Q 3D68A 1U1RA 1HR0J 1WKLA 2PI5A 3G9CA 3PDNA 4NA3A 2XSJA 3KK3B 2ERRA 4FNIA 1ZAXA 2EKYA 1R3NA 3H4BA 2DH8A 5A8WB 3MAQA 3VF0B 1DJ0A 3F44A 4NYPA 3QT5A 4I2QA 4X66J 2EFOA 5J1EB 3AJDA 5GADI 1U1QA 5THWA 2ZWPA 4OI6A 3NLCA 1SCJB 1PAEX 1U2CA 3WZ0A 5L1IA 4JI1F 2RU9A 2ZC3A 1LXNA 2JEJA 2KFZA 2VPWB 3L7OA 4QWEA 3T1HF 1QD1A 1U6ZA 4DU8A 3RB6A 3UNGC 2CJAA 2KJVA 2EWHA 4ILLA 1KTQA 2IC3A 3RTVA 1F1BB 3IAS9 2VQFF 2WHOA 4CYUB 4F02A 3G8QA 4DPUA 1C0UB 1MMNA 4ZLPA 4HT7A 5K20B 3R5GA 2N3OA 3NS7B 1KVJA 1QAIA 3DOKA 1M5OC 2GQ2A 3NMRA 4C9DA 2ZKTA 2DGOA 2BABA 4ZHRA 3CD6S 4FF2A 1Q7LB 1OSDA 4PG6A 3FZ2A 1FJCA 5KOWA 1IVZA 4LF5J 1OMSA 4ZP6A 1LWCB 3LANA 4KHPF 1UPPA 3BM7A 2HLTA 2HWHA 2H9ZA 4DV5F 3GFXA 2UZAA 2FZCB 2O67A 2RRNA 2FVQA 1QAYA 3OHBA 3SFUA 4MKAA 1RWMB 1R8BA 4WPAA 2DB1A 4DHVA 2QX0A 4K0KJ 1LFPA 2VJUA 1HD1A 2AMCB 2UUAF 4OZLA 4OHZA 4W98A 4DCPB 2HNYB 1UVMA 5ETOA 3QSIA 5L1LA 4K4VA 5EN1A 4ICLB 2OFGX 2ZH6A 2HHHJ 3M8SA 2ZNZA 2HMIA 5K8OA 1Q78A 3HF5A 3GLJA 1U1MA 3U1MA 3N6MA 3PY8A 3JAMU 3GG1A 4PABA 2CPDA 3OFHA 1RT1A 1VLOA 1L3SA 4OHVA 4RW8A 4L75A 1MROB 2HRTA 2CQBA 2W8LA 3MUVP 3HHDA 1EZZB 4LFAF 1JLGA 1HFEL 1W2IA 2BJ8A 3A12A 3H5UA 2Z2YB 2IM2A 1N36F 4YEAA 3OHAA 3KDNA 5D4PA 4F4AA 1YWXA 3SSRA 4FZVA 4JYAJ 3F56A 3CD5A 4ZCMA 1X7VA 2DGXA 3AFGA 2GVDA 4OQJA 1PJ5A 2IRYA 3DRSA 2FHJA 2NYHA 2XS7A 2R7XA 3EDRB 1Q81T 3HHLD 1PG5B 4EEYA 2COLA 1E6YA 2XS5A 1U1LA 2NSCA 1CJTB 2QZ8A 4DR4F 2YY3A 3R5CA 3O5TB 3BBCA 4DX8H 2MXYA 1HA1A 1XBWA 2R7WA 1G6BA 2KRBA 3MCOA 4ALZA 3UR0A 3MM8B 1JLFB 5ETMA 2YWKA 2KHCA 5D6GA 2D9PA 1IXKA 1T3NA 2NUUG 1CC7A 3EVOA 1XJWB 5GAEU 4NCBA 4YB1P 1NMEB 2FY1A 4X4NA 4QWBA 4ITSA 2CQ1A 3I5CA 3KHRA 1NXIA 4QIEA 1SV5B 4HI1A 4P72A 1RTHB 3BGRB 3QJPA 5KFWA 4PWDB 1S49A 1RTJB 3ZTQA 2LU1A 3QAEA 4DUZJ 1FRMA 2FIUA 4YB7A 2NS1B 2RS2A 1PYTA 2HNZB 3BBFA 4EZ6A 2HZAA 3OJUA 3BSAA 3PJWA 5DETA 5J2PA 4OYAA 3S01A 1HR0F 3EPIA 4C3MA 5LSRA 2E9TA 2DYAA 4PPDA 1O5JA 3KLFA 2RU3A 3FKBA 4ECSA 2JVOA 5CQGA 4FYYB 1VRTA 2HZVA 4X66F 3R8YA 4C2MA 4WTOB 4PWUA 5KFLA 2VG6B 1Q8BA 3THVA 2FTRA 3CJ4A 4URGA 1QVGR 1GX5A 5F8GA 1NSKL 2BANA 1IUJA 4DL3A 3BN4A 2YQ3A 4TLQA 3K5NA 2V4JB 3BR9A 4L76A 4M5NA 3IWLA 2B4UA 4LF9J 3TUPA 1RHRB 2D41A 4Y00A 3O44A 1MU2A 4ECYA 4J91A 4WE1A 3W3SA 2HHQA 4TY8B 2W24A 2IIHA 2MQPA 2B7BB 4P71A 3D0GE 2OJ3A 2X3GA 4CP5A 3MEDB 1VDHA 1KDNA 3C46A 5DZ7A 3SXLA 3HJFA 2Z30B 3LWLA 3UI3A 1FX4A 2CJYB 4ELTA 2WONB 3NP5A 1D3WA 3D6HB 3D54A 3W8GA 4LF5F 5A6WA 3LO3A 3UDCA 2HIQA 4FVMA 2R7VA 3W65A 4Q2LA 3TJ9A 2AZ3A 1UW9A 3AD8C 2IA0A 2ZOGA 4F0HA 4TU8A 5A2QY 4J37A 5KFUA 1HW8A 1YRXA 3IS9A 1LWFA 2HQDA 3GYNA 3VAHA 4XPEA 1MG7A 2CDRB 1NKEA 3FFIA 3ICLA 1SKWA 2QRRA 4BWMA 4K0KF 4PQAA 4X4RA 3ENAA 1NSAA 2QV6A 5KFSA 3GR1A 2XBPA 3MR6A 1WKJA 9ATCB 1S72S 1P1LA 4IDKB 2KT5A 2ALZA 3K5LA 2W4PA 3NS5A 2HHHF 2RJZA 3KUEA 2E1MC 2B5JA 2XULA 4I1TA 2HK2A 2NCKL 2PE8A 4GRSA 2VA3A 3HI9A 2W7OA 2CAJA 2J0QD 5E3QA 2HHPA 2QLWA 3H5XA 4HT5A 4LSZB 3SI8A 2P5VA 2HBZB 4PKDB 1RTZA 1RHKB 3K5PA 3QIPB 2FHMA 4I2PB 1FRJA 1X4DA 5IC4B 5HVHA 4LBIA 2Y1JA 4OYOA 2XSFA 4KR0B 1U6FA 1YGYA 4FF4A 4JYAF 3Q86A 2KRRA 1IKXB 3M8ZA 3DLBA 1GTHA 4X4SA 2CNOB 3NCPA 2FLLA 2VASA 4LQ9A 1ZETA 5T41A 1ZM2A 4IQXA 5C24A 2PA3A 1HBOB 4B3RJ 2EW9A 2XLKA 5HROB 1U49A 2B4PA 3ZTRA 1IR2A 4X4VA 2YH1A 2CQ4A 1OY9A 3MFIA 3GMGA 2IY5B 4K5RA 1G4CA 1NPPA 4QR1A 2IVMA 3T1AA 2DR5A 1KBRA 5AXLA 4RUBA 5I4MA 3NMAA 2BJ9A 4MYUA 3P6YC 4H4KC 5GAEI 2WB4A 3M2RB 2JRSA 1HHSA 2HSEB 1CBKA 3OPKA 5CABA 5CYQA 1KC8T 3LP0A 1SL0A 3MMAA 2V0NA 1UMJA 1HNWJ 4F04B 3EZUA 4AXJA 2DK2A 1OWXA 3M30B 1TL3B 2PI4A 2RQCA 2CVIA 2YPZA 3HFVA 1FE4A 2BBEA 4ZPCA 1N5TA 3OR2A 1NK9A 2VG5A 1S76D 1YDLA 4DUZF 3DMJB 2VFRA 2CPJA 3UD4P 1N6QB 4IR1A 2BKOA 1WF2A 4K4TA 3RBDA 3QZ8A 2NLWA 3HVWA 4O0IA 2BACA 2XO6A 2LQBA 4OJ3A 2GO8A 3TX8A 3HFKA 3MEEB 3GQCA 4OX8A 3V6DB 1WG5A 5FLXY 2HFUA 1S0MA 2DGSA 2D69A 2EFNA 2B3TB 4CTAA 1RTDB 1VR6A 3DOMA 1FX2A 1IM6A 4OHYA 4B9TA 5B0CA 4ZLLA 2IYIA 1C1BA 3JSYA 2P6SA 3M8WA 2Z56B 4WCEQ 4GVBB 2MY8A 5F8NA 5IZHA 3N6LA 1CJUA 1NKCA 4DSFA 4USMA 2D9OA 1CLFA 3GV7B 3MAHA 3JYTB 2OEKA 3DKDA 1RACB 2OH2A 4C8MA 3U1LA 3I0SA 5HVFA 4F3OA 1JLBB 1LWXA 3TZXA 1RISA 4L3NA 4DUYJ 2RHQB 5LXRA 4RR5A 2OPPA 3C2PA 4QIWD 4RWWA 2LEAA 2M5YA 1TFWA 1F9FA 4DL7A 2DXFA 4KGZB 5ITHA 4QR0A 1SJFA 2DNPA 4U95A 3QFWA 2HGLA 3BQ2A 4F26A 4M94A 3B4MA 2HMIB 4EU0A 4JI4J 4QWDA 4IH5A 1NH8A 1VCTA 1G3OA 1RYSA 1YJNS 2CXEA 2OSRA 1KVKA 4IH6A 5AXNA 2C3MA 4HHHA 1TVRA 4Y65A 1R0AB 2LQ5A 4OZ5A 2CADA 1DQ9A 4PG8A 4LVNP 1KOHA 1V3RA 4PUOB 5HMZA 4O4GB 3R7NB 2CPXA 4LR8A 3GWCA 2ASDA 1YJRA 1UETA 5GAHU 4EBEA 2YQ1A 5KFYA 3N5FA 3CE8A 1T0TV 4V19J 4MTPA 4JB8B 2KVQE 2FJDB 4RNNA 2ZH5A 3BPSP 2Y8YA 3CULA 2YH0A 2CWXA 4Y34A 2IM3A 2YBVA 2YVSA 3HT3A 2A0FB 3PIPQ 2XZWA 3TARA 4O3RA 2M70A 3R3TA 3G2XA 4NCGA 3BO4A 2VOPA 4JV2A 2R7RA 4CLSA 1RU1A 3AXMA 2Y1IA 3QO9A 1FEEA 1MWZA 1N5QA 1WSVA 5AJ3J 2WW8A 3DFEA 3D0HE 4NI2B 1RK8A 4CT8A 1GMUA 1EKRA 1CULB 3MMBA 2PEHA 2NXUA 3C15B 4LR9A 2XMKA 5D3GA 1IJEB 3N0VA 1BQMA 1TZ0A 3MM6A 1RHMB 2F1FA 3BSCA 1Q7YT 1HBUA 2VL1A 1KFDA 5L8RC 3FRYA 2GQCA 3W61A 2G13A 2MQOA 1YJVA 2DTJA 5C42B 2UUTA 3MM7B 1LOUA 4FF3A 4PG7A 5AT1B 1TV6B 1VMBA 2BOAA 3GCWP 2CPIA 1OY8A 4GKKJ 3OLAA 1L3UA 4QU6A 4J9PA 2UUWA 1OYDA 2GZOA 4YDXA 2EBEA 1CEZA 3RBEA 1V5IB 4B3RF 2FLNA 5H9FJ 1OO0B 1CJKB 1URRA 4LFCJ 4K5SA 3HMJG 3ZC4A 4PYAA 2XLIA 4IKAA 2C2ZB 2BQ3A 3PYGA 3HJVA 1RHUB 3MMCB 4N56A 4R5PB 2I1RA 2XWYA 1UJ6A 4RLEA 2AD9A 3OW2R 1VIXA 2F3JA 1PGZA 3K2YA 3B82A 3NY0A 3DM2A 2XTJP 3EM1A 2YKPA 5KFJA 2DITA 1UVJA 3EGNA 2JX2A 1HNWF 1L3KA 2RF2A 1JLEA 3T1YJ 3VVUA 1VBKA 4RJVA 3R2DJ 2RKIB 4ZPTR 3ZZRA 3JTPA 1M0SA 3WQPA 2WSEC 3TZWA 4KPCA 2M52A 2RDIA 3ZZUA 1RAHB 2E9RX 4AL7A 3IRWP 2FJWA 3MCSA 2AJ0A 1LW0A 4G1QA 1FA0A 1UFWA 3SIPB 2JZ5A 4ECXA 1P9YA 2H1YA 4YB5A 1HHTP 3TZZA 2C2MB 3AOCA 3G6ES 3CCMS 2DGTA 4TKTA 3PX0A 1WDDA 2UVVA 5BJRA 1OJ4A 4LT6A 3TOQA 5HN0A 2DNMA 3Q8YA 4AL6A 4DSEA 3HFZB 5EWGA 4C3KA 3BH6B 3FQLA 1OY6A 3OTEA 4IFVA 4HI2A 4A8QA 2AJ4A 4Y0FA 1YITS 2V63A 1TP7A 1RT4B 4W4MA 4YS2A 2DHHA 4I56A 3BF4A 3J7YU 4ED5A 2NXEA 3IS9B 3PYFA 1WG4A 1VC6A 1ZYQA 3OL9A 3U7JA 3FFIB 4P10A 2XGPA 4NLDA 2F8EX 5H1SV 1S5ZA 5D0HA 3B78A 3G71S 1VQNS 4DUYF 1U24A 4U96A 1FDDA 2E5LJ 3SCKE 2HQIA 3TJ8A 1P1TA 3GFZA 4EUVA 2A2DA 1B70B 2HW3A 1RT6A 3MEGA 2J9DA 1YI2S 3I32A 3BO2A 3VTIA 4LJMA 4RW6A 1NNDA 4X4QA 4KV8B 2B5JB 2ATLA 4MIWA 4JI4F 3CJ3A 1S9GA 1RKJA 3P8BB 4OJHA 4IFYA 3M2UB 1U1PA 1UP1A 2EG1A 5KFQA 2VFTA 1T9UA 2BVZA 2DNKA 1VISA 3J7ZT 2RRAA 1NDKA 5T7LB 5DRKA 1YJWS 3H2UB 4NXMF 1E6VA 1T11A 3FEYB 3KG0A 2G0CA 3POTA 4RW4A 4Y2AA 5AE2A 2XEXA 3DLLQ 3TUIC 4U7UK 2F5GA 4B3TF 1WOOA 3CC7S 5C5JA 2R8JA 2WSCC 1IKVA 4IH7A 2R2UA 1AROP 3W5YA 4A8XA 3RAQA 2XMWA 4XK8C 3CCWA 1RGVA 4JI7F 5A8KB 3PG9A 5ETQA 1S6PB 3CSKA 2FJXA 4OIXA 3ZXWA 2CPHA 4JI2J 3CJSA 3KJFB 2LDIA 1RYRA 2UU9J 1T94A 1PYSB 2P2CB 3IG1A 5IQQA 3N28A 5AJ3F 1LEOA 1V5VA 4OI1A 4ZITA 3DLHA 2AJQA 2DNGA 1C4AA 1V3SA 1TKZA 2OIHA 3RW6A 5KFNA 2ZOFA 3AODA 3CCVS 4DZ6A 1RWKB 2KM8B 2VDIA 4AQYJ 1CQNA 3JSMB 2HPUA 2C1EB 2AYEA 4OX6A 4DFJA 1RHJB 4ECZA 4AXIA 3GJTB 3CIMA 1BWEA 3UR3C 3BDPA 2OPQA 1J5EJ 2KO1A 1R8AA 3F73A 2FLOA 3UD3P 1X60A 4IG0B 1JXLA 5DJBA 3KLHA 2BE2B 2E1AA 1HNZJ 4MFBA 2Y0SD 2LXIA 4KHMA 3CDWA 3T5JA 3RRKA 1GK8A 2V34A 4WU3A 3PRVA 2A3JA 3LOUA 3ULHA 3MD1A 3GYXB 2ASLA 3VAMA 4LFCF 2KYXA 4F4YA 4AD6A 3H0PA 2CZ4A 1AFIA 3TW0A 2V9KA 1S9EA 2BOPA 2LQ8A 3IWNC 3DDKA 3VGUA 3TAPA 4ZA1A 3KMQA 3DGPB 1REVA 1JB0C 4PQUA 3T5HA 4YQWA 1KQKA 1FK9B 2ATCB 3A1YG 1JKHB 2BJ3A 2YKQA 3WC0A 3IFEA 4U67Q 2EK1A 2N7YA 1S6UA 4JV5F 2A1BA 4TYBA 2L08A 5KOXA 3T1YF 3H5YA 2GO9A 1CQMA 2IAJB 1TL1B 5IXUA 1B99A 2VDHA 2DH7A 5KG1A 2JHEA 3LW5C 1AUSL 2D3UA 3WBZA 3L9ZA 3GIRA 3QRPA 2FZGB 5LMNF 2PMWA 5D4OA 2JEFA 5C7PA 3RJMB 3DLJA 4NOHA 5KFHA 5DG8A 1FKAF 1PIEA 4ZJOA 2VQEF 2JLEA 2EI5A 2ZH8A 2ZH1A 1U8WA 1D1UA 3VQTA 3R5DA 4UW2A 3PW7A 3DRYA 4CLTA 5HLFB 2OPRA 1KR4A 3FBCA 1PJ6A 3QIDA 5CH7B 3MECB 4E2FB 3Q24A 2XY7A 4O44A 2OD6A 4WXOA 1JLQB 1C4CA 4ER8A 3B54A 2AGQA 1RT3A 4ECTA 1UA0A 4DOZA 1C1CB 2XQCA 1SUQA 5LXYA 2MPUA 3AOBA 1HQ2A 4DV2J 4CO5A 3KUHA 1JLCB 1FXLA 2E5LF 1U2RA 1CJVB 4AYBD 1VQSA 1FNXH 3K0JA 5DDOC 3TQEA 2Y3YA 1YLXA 2BRLA 4WFXA 4LUBA 4O3PA 2F8HA 4WBFA 2AYBA 3AHPA 3MUTP 1XEZA 5E41A 1FRHA 4ED8A 4YFUA 1VQMS 2HNDB 1BXNA 5HO4A 4CH0S 2YNIB 3PO5A 1FTCA 1RDRA 1S97A 1JJCB 3CJKB 4UTGA 3MPDA 3TUJC 3Q8PB 1UCNA 3PR5B 2CZ9A 4ANDA 1SJ1A 3RR8A 1M5PC 4NXNJ 1TL5A 1B7YB 5DDQC 2DNOA 4LSLB 3QGPA 3H5SA 3CCJS 4M5DA 1HNIB 4G6VB 3OTBA 2ABYA 2DVIA 4NMXA 4OZJA 4KTQA 2C3UA 1W2BR 2CQ0A 4WKRA 2ZJRQ 1QVFR 3PRBA 4C8KA 4JI2F 2ZDPA 2ZE2B 2ZZTA 3BYPA 2UU9F 4P9SA 2YKMB 1ZM9A 2ZD1B 3ET6A 2RE1A 2HHVA 2HGMA 4O3NA 1LK7A 2Z2ZA 3LQVA 2IMWP 2XY6A 1S1WA 1S1UB 2QL7B 4QWCA 4WWSA 1RAAB 1X8DA 3M9NB 1QAJA 3AJ1A 1QE1A 3M8PA 3OXLA 4BC7A 4DDFA 1YSJA 3OXFA 4MK9A 1WF1A 5B7WA 1APSA 1U2FA 4M5HA 4FF1A 1A9NB 3LP2A 1DLOA 3OR1B 3BYRA 2R8IA 2BQUA 3UE2A 4L3KA 2HQ3A 2GCFA 4F7VA 3K58A 3IAM9 2MZQA 3DRXA 3QT8A 1X4EA 3UN2A 1NKBA 2XMVA 2FDNA 1JLAA 2P6TA 1HNZF 3FUYA 2Z8QA 2KT2A 2CJBA 1J5OB 2C2DA 3HHLB 2VONA 4MMOA 4ECVA 4QW9A 4A47A 3HHNB 2YWHA 1RHQB 4ZP8A 4DSKA 2KFNA 4ZCKA 4JI5J 4NLYA 3V6HA 1UWAA 3BGOP 2JFKA 2CJKA 3KG4A 3CMES 2BV3A 1N33J 3GU0A 3DRPA 4CLLA 2AEFA 4IO9Q 1AUDA 4CO4A 3T19A 1JJHA 2DJWA 3DLEB 2BE7D 1X5OA 2CQHA 3PW5A 2B7CB 2WOMB 2ZHOA 5FD1A 4X4PA 2DXDA 3SCIE 4A4JA 2V67A 4CZCA 1FWLA 2B4OA 3FMBA 4P2XA 2L3MA 2FJAB 1S0NA 1ZZFA 1PCAA 3UVJB 4OV1A 2RB7A 2OHDA 4IYQA 5EWFA 5F8JA 1WTFA 4DR6J 4UQTA 1PAUB 1O6XA 1VRUA 3CC4S 4H4KA 4MJKA 1H3DA 1HQUA 1N56A 3TAMA 3FJ2A 1FKPA 4YR3A 1S57A 1WC0A 4GO7X 3QLHA 1Q4RA 2PIIA 2B6AA 1B64A 1HNVA 4OYPA 2YX4A 5DG7A 1KQFB 2QT7A 1JQGA 4DWIA 1T7PA 2YTCA 3KK3A 3CUNA 2NR0A 3GIKA 4LMZA 2M8HA 2VC0A 4PXCA 1K0TA 1IBLJ 4CLYA 2NSBA 1NCLA 1JMTA 1VYAA 4DS5A 2IPOB 2LXUA 2RS8A 5J1EA 4DV2F 4JI8J 2JVRA 4F25A 1K73T 3I0RB 4PXBA 1WD6A 2XM3A 4DV6J 3BGFA 1KKHA 2FVCA 1YBTA 2KU7A 2GS8A 4B9NA 1WG1A 5KFFA 1H2UX 2ZH7A 1SPBP 1NEEA 4N41A 1BE4A 4OYWA 2V68A 3HSDA 4QZVB 1M5HA 3TA2A 2R4FA 4CYUA 3KK1B 5HQMA 1R8PA 3Q0AA 1C0UA 1NK6A 2H54B 1PSDA 2HHXA 5KG6A 5JVGQ 1XWLA 3NGRA 4DN0A 9RUBA 3ZNUA 2V9WA 1S1VB 2IFXA 3FGVA 3KLIB 2VOOA 2ZNYA 3DYAB 2XGQA 1RU2A 3TVZA 4A46A 1F5BA 3CB4A 3Q8SB 1URNA 3VCDA 4EZ9A 4NXNF 1LWCA 3MCNA 3FVYA 5EWEA 5KFGA 4FP9A 1P9QC 3SCLE 1KTVA 2WBRA 4ZVRB 1NZ8A 2IA6A 2KDOA 3HX9A 5ADZA 2RUGA 2CVEA 2I6WA 2XY5A 4X65J 4PWWA 2KM8C 2BXJA 5D15A 1GAOA 2E1RA 3ZZPA 5K8PA 1V9OA 2B8PA 1KLMB 2HNYA 2YKAA 8ATCB 4FPIA 2DO0A 2XYGB 1LWEB 4DPTA 3CGIA 4ZVFA 4ICLA 3EYZA 3D1QA 4J9KA 3W2VB 4CO2A 3QT6A 1REGX 1TUVA 3I5AA 4HYKA 3BR8A 1H72C 3F0NA 5KG3A 3D6MB 3OV7A 1RCXB 4Q2MA 3ZZTA 4DG1B 1GH8A 3W2WB 3K59A 3K17A 4EYHB 1MROA 3CCRS 5DS7A 5M2RA 1SC1B 1HI0P 4S0MA 3KLEB 5DGAA 4DV1J 4XO0A 3QGIA 3GJSB 1KFSA 1WC4A 2ROGA 3M1VB 2DRDA 2K2PA 2WRMA 4RZRA 4MT1A 3I5BA 1S0VA 4J5OA 3BJYA 2X1AA 4UUWA 2YQ0A 4HACB 1SIZA 5D0GA 4KE5A 2B43A 3ADAC 1N8RT 3C16B 4JI5F 4W90B 4PG4A 4OHWA 4EFAC 5KFVA 3S7RA 3QAUA 1N33F 3DN9A 3UQSA 2XLJA 3RG6A 4ECWA 2DISA 1TU0B 1UJ4A 2YKNB 3BQ0A 4I7FB 4ELUA 4C97A 3MMJA 4FBUA 4DU7A 1CJTA 3D1HA 4USWA 1EETB 3I31A 1VS3A 4KGVB 4QJVA 4X4OA 1SH0A 3UDEA 4B9UA 3JTNA 2QSFA 2XC9A 3WIUA 1AW0A 5GAGU 4P7TA 3MM8A 3W8PA 3IP0A 1JLFA 1N32J 1MMDA 3CF5Q 3H98A 4B02A 2PMHA 4CH7A 4DFMA 4DV4J 5K14B 1P8GA 2BX6A 1ZOTA 4ILRA 4DR6F 4R25A 2Z58B 1SJQA 4ZVHA 4GVLA 1X9SA 3Q8QB 1SV5A 2V8DA 1ZBTA 4AT1B 1RTHA 2VQFJ 3BGRA 2E7VA 5H9EJ 1TQLA 5CYMB 2ZWOA 4PWDA 4PG5A 2LQ9A 5CZVA 1RTJA 2V2ZA 4P2FA 3SZ2A 2PD1A 4I6AA 2C3OA 2VUGA 2HNZA 1YZ6A 1FE0A 2W2MP 1CS4B 3OVAA 4LBHA 2NREA 1DRZA 1SC4B 2RDJA 1NK4A 5KAKA 4ECRA 1RWOB 4KIAA 2RD5C 4ZJLA 4DBQA 3KJQB 4WIQA 2MZTA 1IBLF 3OTOF 2C3YA 2VG7A 2RUSA 4QIVA 4ANEA 2JFDA 3H20A 4DV7J 3PR4A 2Q79A 2V8HA 2VG6A 1C0TB 2C2OB 4Y2IA 5KT5A 4YN3B 2OELA 4DV6F 4MKVA 4U7UD 1H2VZ 2CZVC 2E5HA 3HCXA 2V4JA 1FCAA 1HD0A 4EK2A 2HG4A 2ZJPQ 1FRLA 3PCOB 3DHWC 1AT1B 3KHLA 3PW2A 3DNCA 2YNHB 4X62J 1KS2A 3JQJA 4OZNA 1ZTTA 1K1QA 2Y1RI 2IHR1 3EDQB 3EX7B 3U02A 2UVWA 3G6VA 4Z2XA 2VJVA 2O66A 4TY8A 1NZAA 4OI4A 3RR7A 3ZTPA 7AT1B 3S6EA 3MPVA 3LWMA 4M5KA 3FNNA 1VQKS 3MEDA 3TRGA 2EFPA 4ED2A 1S1XB 2GVZB 2WONA 3TVYA 3M8QB 4ED7A 2MZSA 2MZRA 1Q86T 2FGOA 1IN0A 4UF4A 1NHUA 4XIUA 1VFJA 1TKXB 1H38A 1K0VA 3SV4A 2AGPA 1S1TB 3ITHB 5L9XA 4NLOA 3BZQA 5G0RB 1FKOA 4MH8A 4X65F 3G8TA 4BBYA 3CCLS 5HAOA 2GHPA 3H2VE 1EHWA 2F9JA 1BQNA 2B4VA 2WCXA 3NL0A 1R8HA 1OPIA 4IDKA 2HFZA 4QYZK 2PT0A 1QSLA 5F0UA 1LW2B 1Q79A 1DURA 1KVIA 2M4MA 2GV1A 1RWNB 2AP6A 2GQQA 3LGHA 3HD1A 3I82A 2YWFA 4EBCA 1I5OB 3A8JA 4FPRA 3BN7A 1R8CA 2ZBRA 3K5MA 3HHLC 3VGSA 2PA8D 4OZ1A 5KFDA 5AE1A 7FD1A 3KYLA 1L5UA 4DV1F 4Y2MA 1N34J 3SFGA 3MFHA 3QIPA 3CWJA 4C98A 5IM0B 4I2PA 4CM2A 4FYWB 2MZJA 4Q7AA 2FJVA 1FVQA 4DL2A 3CJTA 1WWHA 5K9FA 1IKXA 4URSA 4USVA 6FD1A 2G1HA 4OJGA 3LPEA 4AL5A 1BUXA 1NJWA 1T9XA 2WVEA 4M95A 3SSQA 4U7CA 3VVTA 2EC0A 1CG2A 1WC3A 1HBOA 1WC5A 5HROA 3GV5B 3AD9C 4HH0A 2FC8A 3KHGA 2J9EA 5GAGI 3D6TB 5F8IA 1IWAA 4DF4A 4J9QA 1IQTA 1ICEB 4P2MA 3MF5A 1NJYA 3TEHB 4N8NA 1AXQA 4RNHA 4H54A 1S79A 2J8AA 1O51A 3J7Z5 2XWXA 3M9MB 1MN7A 2F4VJ 1N32F 1J27A 2BM0A 3V6JA 1TUGB 3VQSA 4ZPVR 1RCOB 4DV4F 3M2RA 1RAEB 1RAGB 2FPHX 4EO6A 1F60B 3ILOA 3DC2A 3A3NB 2MKHA 3CC2S 2RILA 4DQPA 5LMUF 3DGVA 2QL9B 3DLGB 4FKXA 5C25B 3JSRA 2B51A 3CPWR 3M30A 4OV6A 1TL3A 1FRIA 5JVHQ 2LLZA 1ACMB 2OPSA 4NLRA 1U1KA 2HYIB 3UCGA 3C6UB 3QWPA 1F5CA 3M8RA 4OZ2A 3DMJA 2MEWA 3TX0A 3GB0A 1N6QA 1U6BA 1RAJA 4LF1A 1FNMA 5D0RA 2H5EA 1RQ0A 3GONA 3NNHA 1HHQA 5KG7A 1G1XA 4Q5VA 3MEEA 3V6DA 3PW0A 3ZFVA 4HTIA 4DR1J 4A8OA 1RTDA 1JK9B 2ACMA 5LL6d 1Y4ZB 1R0BG 1TELA 1M90T 4DV7F 1PC5A 4EBDA 4GVBA 3CCZA 1A6LA 1D9AA 3A13A 3S8SA 2O3DA 1F0XA 3A4TA 1NM2A 1VJQA 1TKTB 1TKDA 5ETLA 3JYTA 1RE1B 2QLFB 2W4DA 3B8HA 2BMBA 2J7KA 2R3VA 2AYGA 1HWJA 1HPZB 2DD8S 3R6GB 1SL1A 2X1BA 1JLBA 2GIQA 4KQZA 3Q8VA 1R6VA 4X62F 5B09A 2ZUGA 3GTYX 5J2QB 3M6UA 1B7FA 3TZYA 1RT5B 1F6TA 1R89A 2JSXA 1RUSA 2LA6A 5AXMA 4HR2A 3O6QA 5BYQA 4DV0J 1VQLS 4Q0BB 2J7WA 4ZCIA 3SQOP 3CNQP 3NGSA 4KO0B 2AYMA 5HBMB 1MLAA 1JNZB 3G82B 3P3DA 1R0AA 2WZ1A 3TQ1A 2F40A 1LXJA 2QMUB 1WHYA 3NNAA 1U26A 3GV8B 3H8YA 4PUOA 4O4GA 4MKBA 4TYAA 4ZVPB 2QYGA 4FYDA 2HLUA 1DY3A 3NGKA 3GIMA 2AU0A 2Y0BB 3ILIA 1PBAA 4O23A 4U8VA 3VGTA 2JDJA 3R27A 2VD3A 2K7KA 3I4HX 1KRPA 1SQFA 4I6WA 3FCWA 4KRWA 2D7SA 1QTMA 3CT9A 1NK8A 1VLYA 3DU6A 4CLUA 2ROEA 2GGPB 4KAIA 2HHUA 3T3FA 1IM4A 3V4IB 4QPTA 2DH9A 3J80Y 4DR7J 5CD4A 2MGZB 3UNYA 2ZKUA 2V8PA 1Z4UA 1NK5A 2G2OA 2CJQA 1UVKA 4FN5A 5CD4H 1SC6A 1GTEA 4NI2A 4LRCA 2MB0B 4GC6A 1CULA 3K8WA 1FXRA 1F9EB 2GNKA 1FDNA 1XQIA 1RWUA 3C15A 2KXFA 2W9BB 1Y00A 3LA0A 2BA9A 3H7HB 4N77A 4LVOP 4A8YA 1N34F 4OFZA 5E3AA 3L95X 4R8UB 3KLVA 4B9LA 1D9DA 1K47A 1ULRA 4E0DA 1X9MA 3GSIA 2DR7A 5C42A 3MM7A 4ZVUB 4USHA 1B0PA 2CUYA 3D67A 2J0WA 1H7WA 3THPA 3WHIA 1TV6A 1VIOA 1QAXA 1RWPB 3SQGB 4B17A 3IM9A 1HARA 4X4TA 3IR7B 1X31C 1CJKA 1QM9A 3NBPB 2OMLA 3OVBA 4HL9A 2VPYB 4AE5A 3KK2B 3N5BA 1KP6A 2AEJA 2L9WA 3MMCA 3D3CJ 5BYSA 4TY9A 2VODA 2HVEA 3P5TL 4R5PA 2YX1A 2ZEJA 2VG7B 4USTA 1HQEB 3O2IA 4B08A 4HDGA 4Y6IA 3M6WA 2F4VF 2FHJD 4J9LA 4G1PA 3K7RA 2E5JA 4KYZA 4J9VA 2J6TA 3TJAA 3TI0A 2RDDA 4FS1A 1FF2A 3J7AN 4QR2A 2XS2A 1KHVA 5KFAA 4OX9J 2JLGA 2IYGA 5ETVA 1RTIA 1RT2B 2RKIA 2EC2A 3TP2A 1F5AA 3RZAA 2V6AA 1IKYB 3CCSS 2A6OA 2MLZA 2VIHA 2C2RA 2CG4A 5HANA 3R5JB 1NJIT 4CLPA 3Q2SC 1PC4A 1BGXT 4NE9C 2CFXA 2QA4S 2JEGA 2D1CA 3CO9A 2ZC4A 5LOQA 4M5JA 2M7SA 2BW2A 3ZTSA 4K4YA 4DR1F 3ENQA 1DZ5A 3VZHA 2HFVA 1Z1ZA 2G0IA 4XTTA 1HYSB 3PFEA 2VBWA 2QMWA 3HPOA 1T05B 1RT4A 3EE3A 4H4OB 2YXLA 4WYWA 5I3PA 4C3LA 1IBMJ 2JH3A 4B9SA 1FKOB 3A3PB 2VV5A 3G8SA 3GYGA 1N4LA 4N5SA 3OL6A 5GMDA 3BO3A 2KTQA 1IQZA 1X4BA 2R7OA 1BQNB 2AIRB 3JQKA 2EPIA 1Y10A 1S6QB 2VBZA 2DGWA 3CJ8A 4FYVB 3UO0A 2EFVA 1XIQA 4ED4A 2HQGA 2QLXA 2KG1A 2Q3PA 2ILZA 4J90A 1BWVA 2ZHAA 1PILA 2P9GA 3OT9A 4I4BA 2WVCA 4KV8A 4ZCLA 1JWWA 2CQ3A 3EZ5A 2BRKA 3N6NA 5F8HA 4A8SA 3CMQA 4DV0F 1B0VA 3IR6B 6FDRA 4C48A 3HULA 3M2UA 1NDLA 3LP1B 4ILMA 1WHVA 4J9UE 1QLNA 3PHTA 2W1BA 3DU5A 2GA7A 4TNOA 5T7LA 2X1FA 4ETZA 2XO7A 2VKZG 4B3MJ 2W2NP 1YJ7A 3KJVB 3EXCX 5EHHA 5GVQA 1P27B 2FD2A 3K8VA 4H4MB 4ZLNA 2DNYA 4UZCA 1KD1T 1YKWA 3SDEB 4KSEB 1H73A 4ZOSA 2E9ZA 4DMZA 4WU2A 4DS4A 4J9SA 3IBCB 5A8KA 4XDDA 4LF7J 2W2OP 2NPIA 2LEBA 1S6PA 2CQGA 1ZS6A 3PEHA 4OZ3A 2V5HG 2O01C 3PEJA 3P45B 5I42B 2J5AA 4DR7F 3GE9A 2CDQA 4NX9A 4BWJA 4C11B 3T5KA 4ID5B 3HVAA 5L1JA 3RBZA 5E5NA 3ELHA 4RBUA 1FRXA 3ZTOA 2NUHA 8AT1B 1M1KT 1X9WA 2RIJA 4DX7A 2ZUAA 1X5PA 2CA9A 4M5GA 3JSMA 3RBXA 2A6MA 4KFBB 5KFOA 1I6JA 2CQCA 2K1RA 5E2QA 2V2VA 1MMLA 2MMYA 3DCAA 1YTYA 3MZIA 4OZ0A 1HMVB 4I6YA 4IG0A 2GJFA 1HIYA 2VHGA 2WAQD 2UUBF 2RH3A 1HLWA 1WNEA 1NK0A 4RUAA 3H25A 1AFJA 3N79A 4DR3J 2OPSB 1DTTB 3PXGa 3FQKA 5K8NA 3OLBA 3SYZA 2BE2A 3KFWX 3LF0A 1T02A 4JI0F 1FWKA 2IM0A 1TK5A 5J2MB 2FVRA 1RBOB 4J9RA 1Q16B 5KFTA 2E1PA 2JC0A 5F8LA 3UN5A 3I9V9 3IRXB 3I96A 4I69A 1UWBB 1MWYA 3V6KA 4YR2A 4YDDB 3ILJA 1DFDA 3CD0A 4JI6J 2Q6BA 3KNGA 2RSQA 3PNIA 3R9LA 1RLCL 4ED6A 1H6KX 3DOLB 4IOBA 2DPIA 1SJ4P 2CPYA 5F9NA 2FGCA 2HQCA 1VRQC 4LF6J 2VF3A 3W1YC 3MR3A 4OHXA 4RU9A 4ZIVA 3DGPA 3D0IE 3GG0A 2YKOA 2M2BA 2DY9A 4E8UA 2XMJA 4DUTA 3CJ2A 2DR9A 2V2QA 3NXZA 5KG5A 1FK9A 1JKHA 3PX4A 3H40A 1ZA1B 2MZ1A 4O0NA 5LM7E 4CLZA 3P49B 1XR5A 3VHQA 1KQGB 4KGKA 4OX9F 4OJ1A 4Q8EA 3Q8RB 5LT5A 5L39A 2P8IA 3QGHA 5HI7A 2IAJA 3C6TB 1TL1A 2EVZA 1R0CB 3PX6A 1ZTWA 4FXVA 1ZAWA 1U0HB 3LGNA 4NASA 1F3VA 3AXKA 2AW0A 1T03B 1FI4A 1FDAA 4ZDNA 3TUZC 2B56A 5T14A 5A76A 2B9EA 3OFEA 3G4SS 2KZZA 2E1CA 2NPFA 2MLYA 2CNNB 4CCHA 1HNXF 2PMZD 3BBBA 3TA0A 2RRBA 5HLFA 4BS2A 4NXMJ 3OL7A 1Z2ZA 3MECA 5KT3A 5L9NA 1F9HA 4B3TJ 1JLQA 3QPIA 1A7GE 4K4UA 3JXOA 4YUDA 4N47A 1IBMF 1C1CA 4ZPDA 3FZBA 1WI8A 2CNKB 3DI6B 2UUCF 5HQLA 1YBUA 1Q82T 2H65B 4JI7J 4CI0B 5BR8J 2EG2A 2W9CB 4KH1B 1JLCA 1SJRA 1YJ9S 4KPYA 1CJVA 2V2KA 3LAMA 2MKSA 2F63A 2RNEA 3I4PA 3NWRA 3UN3A 2ZITA 5LJ3Y 3E01B 2EBGA 5B0FA 2W2QP 3CCES 4R0EA 2OFHX 2LYVA 3OUYB 2MTLA 4USUA 4IR9A 5FJ4A 2HNDA 4B3OB 2CQIA 1NSPA 1UAWA 1ZZNA 4FBTA 3MAAB 1I51B 2GFFA 2IJNA 1X0PA 2AT1B 2YNIA 4B3MF 2UV8G 4ZVEA 2BDPA 3CJKA 2QIFA 5DDRC 1VI7A 2W2PP 1RT7B 5K5MA 3GR0A 4DSLA 2IBKA 3GZ7A 2KZMA 3HM9A 3KWMA 3MCMA 1W25A 1CPZA 1U4BA 3IWXA 1R27B 5B0DA 2KFYA 4LSLA 4LRFA 2DGQA 1RZMA 1Z2LA 3FCVA 2VB6A 1HNIA 3IR5B 1S7IA 3M2VB 4LF7F 1IJFB 1DTQB 3TWZA 2M8DB 2GMJA 3BDEA 4WK1A 4JOUA 2H3EB 2ZE2A 2YKMA 1IKWB 3N4WA 2XMTA 2ZD1A 2UXBJ 4C8LA 1EJ7L 4CNZA 1KOOA 2P9CA 1NH7A 4PEOA 1WJ9A 2DHSA 3VZIA 1VC0A 1AZSB 4LF8F 1A0OB 1S1UA 3PYEA 2HEKA 1N48A 1S0OA 4RX6A 4ZN1A 3R5AA 1WOSA 2DRAA 2BYCA 3BSOA 3QBCA 1GMVA 4CLKA 4DPYA 1XNRJ 1HWUA 2XNQA 4DV3J 5ETSA 1NUEA 2APOA 3G86A 2DHXA 1R31A 3OR1A 3KLGB 2QTWA 2F8MA 4ZK7M 5KFCA 3BREA 3MM5B 1MW7A 2POKA 4JV5J 1RTIB 2MQQA 5KFKA 2UVRA 4JV1A 1RAFB 2QGFB 2Z0GA 5AE3A 4DR3F 1F2GA 1IBKJ 3RB0A 3BKTA 1IR0A 2FJEB 4LSNB 3OTDA 2SXLA 5LMNJ 2A18A 1M1GA 3HVTB 3LALA 4ZKAA 1J5OA 1TTHB 2KG0A 1K44A 3EMTA 4IQMA 3HHLA 1NJXA 1MSWD 4PAAA 3OVSA 2VQEJ 2KYZA 3W5ZA 2ZM6F 5MLCV 4JI6F 3QJJA 2RQKA 3DLKB 3BGLA 4HVZA 1D9FA 5ETPA 2ZOMA 4ZVQB 2QA1A 1C2PA 4C7QA 4LF6F 4ZIWA 1HI1A 2IJFA 2QA4G 4HH1A 3C14B 3PJXA 5GMKa 3DLEA 4WXWA 2XCAA 2W7AA 1NK7A 2Z2MA 5IFMA 7FDRA 1XTZA 2QEXS 4HTJA 2H5IB 2WOMA 2JC1A 1HWLA 3LPYA 2FC9A 4CNYA 4RO0A 4YMEA 4UT4A 2OMOA 2VFSA 3M32B 1O8BA 3U27A 2K8GA 3HHEA 3EVWA 3UVJA 3UPFA 3J81U 3RGIA 1P6TA 2YNFB 1DAXA 4ED3A 4LF4J 2M88A 2I0XA 5LSLA 1SKUB 3FBFA 3MM9B 2A2CA 2ADCA 1YX2A 4YHHJ 5J2NB 2DPJA 4Z7CA 2OP5A 1EARA 2LECA 4NLGA 5IT9Y 1WKKA 4HKQA 2HHWA 2OSQA 1RWWB 2KHDA 5A0YB 3CJRA 5I3UB 1N5YB 4RNOA 3VWSA 1VQ8S 3FMWA 4NPOA 3IBFB 2MKCA 5J1NA 4KKOB 3HVRA 1NHVA 5GAHI 1VQPS 1FEHA 2I5JB 1VQ5S 1M5VC 3QJLA 2OD4A 3DRRB 4KGXB 2EFQA 1GXTA 4K4WA 3QSYB 1RADB 2CWKA 5KFMA 1DQAA 1B3TA 2MQLA 4TU7A 3FK4A 3I9ZA 3PACA 1AB8A 4DX5A 4WP3A 4NCAA 4ZS6A 2ASYA 4DSIA 5BR8F 1SQEA 3I0RA 1X4CA 1QSSA 2CIMA 4C6AA 4ATNA 3EGWB 1UEUA 2QG9B 2ZH3A 2MSTA 2DCLA 1WUUA 2RHSB 3IA0A 1T3OA 2M3DA 1GXLA 4U6PA 4P7VA 3BSNA 1NO8A 2BE9B 1XMQF 2J6SA 1EP4B 1UJ5A 1ZAVA 5HMXA 2ZBIA 4ZLJA 3KK1A 2Q6CA 5IT4A 5HL7Q 2H4YB 3WDOA 1SKSA 4L73A 3RRGA 4LIRA 2VICA 3GILA 2V4RA 5A8RB 2CJXB 2U1AA 1YRUA 1EIYB 4RUHA 2K1RB 5C2GA 1Y11A 3HO1A 3VGVA 4EO8A 2G9OA 3RW7A 1S1VA 2X1GA 1GFWB 1TAUA 2QL5B 3KLIA 5DQGA 5F0WA 4BCAA 5DZ6A 3DYAA 1HBMB 2ACYA 1FWPA 1FJGJ 2RT3A 4P73A 3M9OB 4DL0C 3WX8A 3RAXA 4IG3B 4PXDA 5ETRA 4NMLA 3ENWA 5HP1B 1HBNB 5IV4A 1I1GA 2YX7A 2J8SA 1X4AA 5FDLB 4UY8T 1SBRA 2LQJA 2V50A 2ASJA 5F41A 4CH1A 3AB4B 4K59A 5L46A 3QMQA 2HAFA 1Q5VA 4F0MA 3R5BA 4FXWA 2UXBF 3H42A 2ZBPA 4Q8FA 2DR6A 1WHXA 3HKWA 1L3VA 5E33A 2MQMA 1KLMA 4OMFG 1AA1B 2DO4A 1LWEA 3NGUA 3ZZ0A 3KUGA 3M4XA 1XNRF 4DJBA 4DV3F 1YK9A 2DHAA 3W2VA 1N0UA 2ZJQQ 2BZ2A 4DR5J 4CLFA 3ZO7A 2K3KA 2VPXB 4EGLA 4JP8A 1Y0HA 2OAUA 4ZPBA 4DG1A 3W2WA 4C0OC 1OYEA 2C2EA 2CPEA 2L9NA 2QLBB 1EKSA 1SQGA 4CDIA 3KLEA 3KKFA 1IBKF 1TL7B 3TO8A 5KG4A 3UDLA 2AJ2A 4XAKA 3M1VA 1SJ3P 2XB2D 1JJ2R 2MDAA 2WBMA 3PFOA 4BC9A 4F4WA 1TUWA 3CCTA 1B0TA 4HACA 3P5BP 4P75A 1BHNA 3NKYA 4GKJJ 3G6XA 1FD8A 5KTQA 3T9ZA 3C16A 3OBIA 4CWBA 1T9YA 2J76E 3J7YI 4K4XA 2ZVSA 2YNGB 4FNHA 4ZPAA 2YKNA 4I7FA 4EWTA 1X4FA 2FVPA 1VC5A 2WVDA 1Q5YA 3EWGA 1EETA 4BHQA 3PKMA 4Q45A 3D66A 2W01A 5CHCB 3OL8A 3W5XA 1XNQJ 1K1SA 4ZN3A 3JTOA 4MAKA 2C3PA 1GT8A 3IMQJ 2LDYA 1SL2A 1W26A 2DGVA 4QOTA 3BPDA 4RPFA 4RW9B 2C2NA 3G87A 4OX7A 5K14A 3PKYA 2XHCA 1U8SA 2BKPA 4LF4F 3D6FB 3GIIA 1K8AT 2R2RA 2IDEA 5EDWA 1SIWB 4XDCA 4YHHF 3R1HA 4I64A 4K50A 4ETXA 1MN9A 3JSBA 1WHWA 5B0GA 3V81B 4DI6A 3WX4A 5CYMA 5SZTA 5GMEA 5H9FK 2D74B 1WACA 4TN2A 1S9FA 3TNVA 4ENOA 4TVAB 5U47A 2OLWA 2NQPA 3G6YA 1UVLA 2PDAA 3P96A 1CS4A 4HLBA 3MGJA 4USKA 3HSGA 1FRKA 2J9CA 1RSCA 2ALYB 5HATA 5KT4A 1R43A 2AGOA 1SVDA 2GIRA 4QW8A 4USJC 2GIFA 2VFVA 1M5SA 1VHFA 1GX6A 2LFVA 1ZPVA 4WIIA 3O8WA 4IRKA 2DHGA 1SI9A 2C22A 2XSJB 2HQFA 2VBYA 4G65A 4IRDA 2E7XA 1C0TA 4D3GA 3SCJE 1Y5NB 1KQSR 3E2EA 4X2BA 1J2VA 4MKYA 3BGUA 3QYYA 5BYRA 2HHTA 4ECUA 3BB5A 1NU4A 4I2QB 3NRBA 4X4UA 2BJ7A 3ILLA 2ZVIA 3NWGA 2JL9A 2OTLS 2YNHA 1S6OA 4Q43A 1NBEB 2Z4PA 2MKKA 2E7WA 4F4ZA 4IUFA 1WOPA 3OJSA 4CIOA 2IC3B 1U09A 3ISNC 1S4FA 3OQ2A 3OSPA 4WFBQ 3CIZA 2N4DA 1Q8IA 2MHEA 1VQ9S 1XC9A 1S1XA 5JXSA 2GVZA 1Q0NA 3M8QA 1FT8A 4D3HA 4L72B 3DOKB 1FJGF 2XMAA 3VR1A 2I2YA 2H51B 3PV8A 2JOQA 1BLUA 4L74A 2HFOA 4O4RA 1TKXA 1NSQA 4ZHRB 4NZ0A 4PZVA 1S1TA 3L7PA 3ITHA 1ZM3A 2ZH2A 4I0WA 2BW7A 2QYCA 5G0RA 2JJ4D 1R6YA 3BEGB 3QQCD 4UOFA 3BH7B 4TLRA 2W8KA 1LFWA 4OI3A 2F65A 2EK6A 4NZ7A 1S99A 3O1LA 2UXDJ 1D8YA 1YQHA 3MPWA 1GXUA 4P74A 2Z57B 4KC5A 1YJUA 4B9MA 2OUGA 3ETMA 2XYPB 1ITPA 4FVCA 1UL3A 1RA7A 1LW2A 1WC6A 5K8MA 2GJ2A 4RW7A 4LF9F 2DRBA 4ZJQA 4MYTA 4DR5F 3NGTA 4ED0A 3MI7X 3GSDA 4BLGA 3JS9A 1S48A 4MK7A 4JBCA 4C8OA 1PBUA 2QC3A 5LSOA 2JNJA 3KTQA 2IRXA 2X7IA 3BS9A 2D3O1 1Y5LB 1NHKL 2VH7A 4Q44A 4PYDA 2HVDA 3QATA 5IM0A 3EUNA 3TA1A 2IMOA 3G96A 1RT1B 2W25A 4RW8B 2KL8A 4EI2A 4TQRA 1SXLA 1VBZA 2HBQB 8RUCA 2Y9HA 3QNWB 4DFKA 1VQ4S 3HLUA 1JLGB 5KFIA 2JEIA 4GKJF 3K57A
chains in the Genus database with same CATH topology
3T5JA 4OI0A 1NB7A 3OTCA 5D4NA 3RRKA 1QAXA 1N0VC 4DEZA 3SSSA 3MDFA 3ZZYA 3SQGB 3MURP 4WU3A 4B17A 4NRUA 4NRTA 2K7JA 1HARA 2A3JA 1XN9A 3CEDA 3LOUA 3MD3A 5KG0A 3ULHA 2YNGA 4X4TA 4R0JA 1LKZA 4AFFA 3MD1A 4N8OA 2KXHA 3IO1A 3GYXB 3IR7B 2ASLA 2CQPA 2AX0A 3VAMA 1QM9A 4LFCF 3KNAA 3NBPB 2KYXA 5KT7A 2OMLA 3OVBA 4HL9A 4F4YA 3DRSB 2VPYB 4AE5A 3KK2B 3N5BA 3KOAA 2R2SA 3F41A 4ZP9A 2O1PA 2CZ4A 3CD7A 2L9WA 3TW0A 3MMCA 1BY9A 4ES3A 1AFIA 5BYSA 5IQ6A 1XNQF 4TY9A 2V9KA 3DRPB 5KFZA 2VODA 3NCQA 3P5TL 2DNNA 4R5PA 2ZHBA 1S9EA 5IS2A 2BOPA 2YX1A 1E6YB 2VG7B 1OS5A 4F67A 3IWNC 1HQEB 3O2IA 3DDKA 4B08A 4BDPA 4HDGA 3TAPA 4ZA1A 3C3LA 3KMQA 1REVA 3ETOA 4Y6IA 3M6WA 2F4VF 2FHJD 2OTJS 1JB0C 4G1PA 4J9LA 2C28A 4PQUA 3K7RA 3FDSA 2E5JA 3T5HA 2HVZA 4RW9A 1KQKA 4YQWA 2J6TA 1FK9B 3A1YG 1JKHB 1UFLA 2YKQA 4DQIA 4PR6A 3I87A 2FLPA 1BD6A 3TI0A 1V6HA 3MXHP 4FS1A 3WC0A 1FF2A 3IFEA 4U67Q 2CJ9A 2EK1A 1OIAA 4QR2A 4A48A 3KMSA 2XS2A 3LH2S 2JWNA 1KHVA 1NRKA 2W4CA 1LK5A 2N7YA 5KFAA 2N7CA 4QCLA 2UVUA 1S6UA 2JLGA 4JV5F 1SB6A 4C8ZA 3AAWB 2A1BA 3IBWA 5KT2A 4TYBA 2L08A 4TQSA 2IYGA 5KOXA 3T1YF 3H5YA 2GMLA 4IOCQ 1RTIA 1SH3A 2GO9A 1CQMA 2KT3A 1RT2B 2IAJB 1TL1B 3DLGA 5IXUA 4RBTA 5C25A 1RKIA 2RKIA 4K4ZA 1U48A 3TP2A 2DH7A 3V81A 5KG1A 2FB0A 1F5AA 2JHEA 3GIJA 3MWBA 3RZAA 2OO4A 1SH2A 3LW5C 4USIA 1IKYB 3W7BA 3CCSS 3IGNA 2D3UA 3C6UA 4Y2CA 1S7HA 3WBZA 3NCRA 3TR5A 3DXSX 3CJ5A 4IRCA 3CDBA 3MTKA 4K2XA 5LMNF 2DBBA 5D4OA 2JEFA 1ZPWX 3MPYA 2C2RA 2L9DA 3L09A 2CG4A 1VRUB 3DLJA 4NOHA 4ED1A 1NJIT 5KFHA 2UV8A 4DF8A 1WELA 3Q2SC 5DG8A 1FKAF 1PC4A 1BGXT 2KN4A 1HQUB 3TAMB 2CFXA 2QA4S 1VBYA 2JEGA 2VQEF 2D1CA 2JLEA 3CO9A 2ZC4A 2EI5A 1FKPB 4E98A 4RKUC 4NLSA 2ZH8A 2D3OR 4PXEA 2ZH1A 2QO3A 2M7SA 2Q43A 2BW2A 3NAIA 3QLHB 5HQ8A 1D1UA 2AJFE 3VQTA 5B0EA 3R5DA 3FSXA 4K4YA 4DR1F 4UW2A 3PW7A 2B6AB 3ENQA 1DZ5A 3VZHA 2X51A 1Z1ZA 1HNVB 3DRYA 4A8KA 5HLFB 2OPRA 1KR4A 4DQQA 2R8GA 2ZZMA 2F9DA 3T6BA 1HYSB 5CH7B 2PN6A 3PFEA 3QIDA 5J2PB 3CTRA 1QY7A 3K5OA 5DM6Q 3MECB 2VBWA 1U1RA 3ENVA 2QMWA 3Q23A 3HPOA 4RWXA 3J81Y 3Q24A 1T05B 1RT4A 2PI5A 2XY7A 3G9CA 4H4OB 4O44A 3PDNA 2OD6A 2HWTA 4DL5A 4NA3A 4WXOA 2XSJA 1JLQB 1C4CA 3KK3B 1H2TZ 2WK4A 4NYOA 2ERRA 4FNIA 2AGQA 1RT3A 4WYWA 4ECTA 5I3PA 3KLFB 4C3LA 4B9SA 2JH3A 1UA0A 1ZAXA 1FKOB 4DOZA 1C1CB 1TKTA 3JAMY 2EKYA 1SUQA 5LXYA 2MPUA 1R3NA 3H4BA 2VV5A 2DH8A 3G8SA 1RP5A 5A8WB 3MAQA 3VF0B 2R7TA 1N4LA 1DJ0A 4N5SA 3F44A 4KBIA 3OL6A 3HK2A 4ZVGA 4NYPA 3BO3A 1UA1A 2KTQA 1VRTB 1HPZA 1IQZA 1X4BA 2EFOA 4I2QA 5J1EB 2XI2A 2ZZNA 2R7OA 4CO5A 5GADI 3VAGA 4DQSA 1U1QA 5THWA 1BQNB 1JLCB 2EPIA 1S6QB 2VBZA 2DGWA 1FXLA 2EFVA 4OI6A 1U2RA 3NLCA 2E5LF 3WZ0A 2QLXA 5L1IA 4AYBD 2KG1A 4JI1F 2BANB 2Q3PA 1VQSA 5J2QA 3BQ1A 5KT6A 2ILZA 2RU9A 2ZC3A 1LXNA 2ZHAA 2JEJA 2KFZA 2VPWB 3L7OA 4CO0A 1RT5A 4QWEA 1T8EA 3T1HF 1FNXH 1U6ZA 3RB6A 3UNGC 2CJAA 2KJVA 3DDNA 5DDOC 2EWHA 3K0JA 4DLEA 4ILLA 1PILA 2P9GA 2BRLA 1UEVA 1KTQA 4I4BA 4WFXA 4KV8A 4ZCLA 4LUBA 1JWWA 2CQ3A 4O3PA 1ELOA 2IC3A 3RTVA 2F8HA 3SEOA 3EZ5A 3IAS9 2BRKA 3N6NA 5F8HA 5KFBA 4A8SA 4IO1A 4DV0F 2VQFF 1B0VA 2R7QA 4Q0BA 2WHOA 3IR6B 3UCUP 6FDRA 4F4XA 2AYBA 4F02A 3G8QA 1MU2B 3AHPA 3M2UA 4DL4A 4CT9A 3LP1B 4KO0A 4ILMA 1WHVA 5HMWA 1C0UB 1MMNA 3HDSA 1XEZA 4WE1B 4HEA9 4ZLPA 4HT7A 5E41A 5HBMA 3MUTP 1FRHA 5KFEA 4ED8A 1CC8A 1QLNA 2N3OA 4YFUA 2OKQA 1VQMS 1KVJA 2HNDB 2LXFA 5HO4A 2DGUA 1QAIA 3DU5A 4CH0S 2GA7A 4TNOA 5G4DA 5T7LA 2X1FA 3DOKA 1M5OC 2GQ2A 4ETZA 1VJWA 2VKZG 2XO7A 3NMRA 2YNIB 1L3TA 2FVSA 3PO5A 1FTCA 2HFNA 4C9DA 4ZPWR 1RDRA 4DN9A 1FD2A 1S97A 3KJVB 2ZKTA 2DGOA 2BABA 3EXCX 3CJKB 4ZHRA 5EHHA 1OQ6A 2ZH4A 3CD6S 4FF2A 1Q7LB 1OSDA 5GVQA 4PG6A 1P27B 3FZ2A 1HWKA 2FD2A 3TUJC 3K8VA 4H4MB 3IC1A 2DNYA 3Q8PB 3PR5B 1FJCA 5KOWA 5F9LA 1SJ1A 3CJ0A 1KD1T 3RR8A 3SDEB 4ZP6A 1M5PC 1LWCB 1TL5A 3LANA 4KSEB 4KHPF 4ZOSA 5DDQC 2DNOA 3BM7A 2HLTA 4LSLB 2XMMA 3QGPA 2HWHA 3H5SA 2H9ZA 3O3LA 4DV5F 3CCJS 3GFXA 2UZAA 4M5DA 2E9ZA 4DMZA 1HNIB 2O67A 4WU2A 4DS4A 4TU9A 4J9SA 2UXDF 5A8KA 4XDDA 4G6VB 3OTBA 5E3CA 2ABYA 2RRNA 2DVIA 2FVQA 1LWFB 2NPIA 1QAYA 3OHBA 4OZJA 2LEBA 1S6PA 4F8RA 2CQGA 4KTQA 3SFUA 4DFPA 1Q53A 2C3UA 2GGPA 1W2BR 3PEHA 4MKAA 2CQ0A 4WKRA 2ZJRQ 2V5HG 3PRBA 3I55S 1QVFR 1R8BA 2O01C 4C8KA 4JI2F 3V4IA 2ZDPA 2AX1A 2DB1A 3PEJA 2ZE2B 4YP3A 4DHVA 5I42B 1PO6A 2UU9F 1Q1KA 2J5AA 4DR7F 4G1IA 2MGZA 2YKMB 1ZM9A 4K4SA 3GE9A 2CDQA 2ZD1B 1LFPA 2RE1A 4NX9A 1HD1A 4BWJA 4C11B 4Y2KA 5F8MA 2UUAF 2HHVA 4NLTA 3RU0A 3T5KA 4ID5B 2HGMA 3HVAA 4O3NA 4OZLA 5JJBA 5L1JA 3AQPA 1GNKA 1LK7A 3LQVA 2IMWP 2XY6A 1S1WA 4OHZA 5E5NA 1S1UB 2HNYB 3N01A 4QWCA 3FEXB 1NAQA 1X8DA 4RBUA 3M9NB 3AJ1A 1QAJA 1UVMA 1Q8LA 1VBXA 1QE1A 2J7UA 5L1LA 4K4VA 3M8PA 5EN1A 1FRXA 3OXLA 2NUHA 4ICLB 2OFGX 3RAMA 4BC7A 4DDFA 1YSJA 2VFUA 2ZH6A 1M1KT 2GHVC 1X9WA 2RIJA 2LA4A 3M8SA 1X5PA 3OXFA 2W9BA 4MK9A 2ZNZA 2GHWA 2E5IA 1WF1A 5B7WA 3JSMA 4FS2A 1APSA 2HMIA 1U2FA 4KFBB 5KFOA 4O3SA 1I6JA 2CQCA 2K1RA 5E2QA 2LEPA 5K8OA 4FF1A 1A9NB 1MMLA 2MMYA 3LP2A 1DLOA 1Q78A 3HF5A 3OR1B 3AH6A 1U1MA 2R8IA 3U1MA 3DCAA 1YTYA 3MZIA 4OZ0A 3N6MA 4U9RA 1HMVB 2BQUA 3PY8A 3UE2A 3RB4A 4R8UA 2IRUA 4I6YA 3GG1A 2HQ3A 2HS3A 3PM9A 2CPDA 3OFHA 4IG0A 5KG2A 1RT1A 2GCFA 1N52B 5D77A 1L3SA 4OHVA 2WAQD 4RW8A 2UUBF 2RH3A 3DHXA 1WNEA 1MROB 3K58A 1NK0A 2CQBA 3IAM9 2MZQA 3DRXA 5DLGA 4RUAA 3MTJA 2FHOB 3H25A 1AFJA 3N79A 2W8LA 3MUVP 1X4EA 3HHDA 1NKBA 2OPSB 3DXBA 1DTTB 3PXGa 2XMVA 3FQKA 5K8NA 3OLBA 3SYZA 2FDNA 2BE2A 3KFWX 1JLGA 3CXCR 4LFAF 3TVKA 1JLAA 2P6TA 1HFEL 1HNZF 1W2IA 3LF0A 1T02A 4JI0F 3H5UA 3CCQS 2IM2A 2Z8QA 2KT2A 1N36F 2IM0A 1TK5A 5J2MB 4YEAA 2FVRA 4J9RA 2CJBA 3OHAA 3THTA 5D4PA 1Q16B 5KFTA 1FERA 1J5OB 2JC0A 5F8LA 1YWXA 3I9V9 3IRXB 3I96A 3SQGA 3SSRA 4I69A 4FZVA 4NLPA 1UWBB 4QYRA 5D4LA 2GX8A 2C2DA 3HHLB 2VONA 4MMOA 3F56A 4F2SA 4ECVA 1MWYA 3CD5A 4QW9A 4YR2A 3V6KA 4YDDB 4ZCMA 5DDPC 4A47A 3HHNB 1X7VA 2YWHA 4ZP8A 2DGXA 4DSKA 1DFDA 3SMZA 3NBPA 3CD0A 2KFNA 4ZCKA 2Q6BA 3KNGA 4NLYA 4OQJA 3V6HA 2IRYA 2RSQA 3DRSA 3PNIA 2JFKA 5KFPA 2CJKA 2FHJA 4ED6A 1H6KX 3DOLB 4IOBA 3KK2A 3KG4A 3CMES 2BV3A 2DPIA 4F4KA 2XS7A 2R7XA 1Q81T 4UUXA 1SJ4P 3CVKA 2CPYA 3HHLD 3DRPA 4EEYA 5C24B 5F9NA 2FGCA 4IO9Q 1AUDA 2COLA 1E6YA 2DT9A 4CO4A 1HQEA 2XS5A 3MR3A 3T19A 1U1LA 4OHXA 5AXKA 2NSCA 4RU9A 1JJHA 2CPZA 2DJWA 3DGPA 3D0IE 2QZ8A 4HHJA 4DR4F 3GG0A 2YKOA 2YY3A 3DLEB 3R5CA 2M2BA 1X5OA 3O5TB 4DX8H 2MXYA 4E8UA 2CQHA 2XMJA 3NGDA 1CVJA 3CJ2A 2E5GA 2DR9A 1HA1A 3PW5A 5KG5A 1XBWA 1FK9A 2R7SA 1JKHA 5CYJA 3PX4A 2B7CB 5CXTA 2V8GA 2R7WA 1DHMA 2WOMB 2WTFA 2ZHOA 3RB3A 3H40A 1FXDA 1G6BA 2KRBA 5FD1A 2L48A 4X4PA 4ALZA 2MZ1A 3UR0A 3E3XA 3SCIE 1G7CB 3AA8A 3MM8B 3P49B 1XR5A 4A4JA 1KQGB 4KGKA 4OX9F 4OJ1A 5JUMA 1JLFB 4L6V3 4CZCA 1BC6A 4Q8EA 2YWKA 2B4OA 2KHCA 5D6GA 3FMBA 5LT5A 5L39A 3Q8RB 2L3MA 2D9PA 1IXKA 2FJAB 1ZZFA 1T3NA 1S0NA 1RT2A 3QGHA 5HI7A 2IAJA 3C6TB 4QQBA 1TL1A 5M2PA 2EVZA 1XK8A 2NUUG 3HKZD 4ERDA 1O0PA 4OV1A 2RB7A 3PX6A 1CC7A 1X5SA 1ZTWA 4FXVA 1ZAWA 4IYQA 5EWFA 1IKYA 5F8JA 1YJTA 5GAEU 5CYQB 1WTFA 4NCBA 3LP0B 1N5SA 2MQNA 5A6PA 4UQTA 4YB1P 2FY1A 3MMAB 2R7UA 4X4NA 3LGNA 3V2UC 3VAIA 4QWBA 3IGVA 4ITSA 2CQ1A 3I5CA 2AW0A 3VAKA 3KHRA 1T03B 1FDAA 4QIEA 4ZDNA 3TUZC 2B56A 5T14A 1SV5B 2FJBB 1VRUA 4HI1A 3CC4S 1RTHB 3BGRB 4H4KA 1UVNA 4MJKA 3OFEA 3G4SS 4NL5A 3QJPA 1H3DA 5KFWA 2KZZA 1HQUA 1N56A 3TAMA 3FJ2A 2LVWA 4PWDB 1S49A 4CO1A 1RTJB 3OR2B 1FKPA 2E1CA 2NPFA 2VG5B 2LU1A 3QAEA 4ZP7A 3LGMA 4YR3A 4CCHA 1FRMA 2FIUA 4YB7A 1VQ6S 4GO7X 3QLHA 1Q4RA 1HNXF 2NS1B 2PMZD 2RS2A 4GKKF 2HNZB 3WC2A 3TA0A 2PIIA 3H59A 2B6AA 2RRBA 1B64A 1HI8A 1HNVA 4EZ6A 3OJUA 5HLFA 3BSAA 3PJWA 4BS2A 2YX4A 3H4DA 1HYSA 5DETA 3OL7A 1Z2ZA 5J2PA 2PFFB 3MECA 1KQFB 5KT3A 5DG7A 2QT7A 3S01A 1HR0F 5L9NA 3EPIA 4C3MA 4DWIA 2M0GB 1T05A 1FDBA 5LSRA 4H4OA 5E7OB 2BJEA 3H2LA 2E9TA 1T7PA 3HHKA 1JLQA 2YTCA 3QPIA 1A7GE 1YVFA 4CO3A 3KK3A 4K4UA 4PPDA 1FJ7A 1O5JA 4YUDA 1WF0A 2ZBCA 4N47A 3CUNA 2NR0A 3GIKA 3KLFA 4LMZA 2RU3A 1IBMF 4CTAB 2M8HA 2VC0A 1VOMA 1C1CA 4PXCA 4ZPDA 4ECSA 3FZBA 1K0TA 1WI8A 2QE5A 4WZMA 1BQXA 2NSBA 2JVOA 5CQGA 1U45A 1JMTA 3AY0A 3DI6B 4DS5A 2UUCF 1RA6A 1TL4A 1VRTA 1C1BB 2LXUA 2RS8A 4X66F 4C2MA 5J1EA 1Q82T 4PWUA 5KFLA 4DV2F 2JVRA 2VG6B 4F25A 4CI0B 1Q8BA 2EG2A 2W9CB 2RVJA 2G4BA 2CYYA 4LFBF 1JLCA 1K73T 3I0RB 4PXBA 1S6QA 3THVA 2FTRA 1SJRA 1YJ9S 3CJ4A 4URGA 1WD6A 4KPYA 1QVGR 1GX5A 5F8GA 2V2KA 3LAMA 2BANA 2RMLA 1X4GA 1IUJA 2G1DA 2KJWA 3AB2B 3BGFA 4DL3A 4A8MP 2MKSA 3BN4A 2YQ3A 4XPCA 2RNEA 3I4PA 3VAFA 2ZITA 1TFYA 5LJ3Y 2FVCA 3I0SB 2KU7A 3E01B 5EX0A 4B3SF 4TLQA 3K5NA 4YB6A 4WFYA 2V4JB 4B9NA 3BR9A 1DBDA 4B9VA 1WG1A 3PO4A 5KFFA 1H2UX 2IBOA 2ZH7A 3IWLA 2EBGA 4RW7B 3MOZA 2HZCA 3GFHA 5B0FA 2B4UA 2Q66A 1NEEA 4N41A 3MR5A 2BJDA 2OPPB 2J6UA 4QZVB 1UW4A 1M5HA 3CCES 2D41A 4QIFA 4R0EA 3TA2A 2R4FA 4Y00A 1KONA 3KK1B