1EKRA

Moac protein from e. coli
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
146
structure length
143
Chain Sequence
GEAHMVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSSGDFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN C
publication title Insights into molybdenum cofactor deficiency provided by the crystal structure of the molybdenum cofactor biosynthesis protein MoaC.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation
total genus 35
structure length 143
sequence length 146
ec nomenclature ec 4.6.1.17: Cyclic pyranopterin monophosphate synthase.
pdb deposition date 2000-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01967 MoaC MoaC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Molybdopterin cofactor biosynthesis C (MoaC) domain 1ekrA00
2IIHA 4FDFA 2EEYA 1EKRA 2IDEA 3JQKA 2EKNA 4PYAA 3JQMA 4PYDA 2OHDA 1EKSA 3JQJA
chains in the Genus database with same CATH superfamily
3DDNA 4DL0C 1NPKA 1S0OA 3CJQA 2PI4A 4X84A 3AAWB 3P4UB 3LP0A 4CLLA 3OT9A 1KVJA 5FD1A 4DWIA 4UY8T 2NUUG 1GMUA 1FRIA 1GXUA 2CNOB 2XY5A 4CI0B 1TAQA 3MM5B 4UTGA 3KLFB 2M88A 4PABA 1LWFA 1X4CA 2CDRB 1HPZA 2HKEA 4CO4A 1NSPA 4A47A 2NZ4A 2I8EA 3NCQA 4QZVB 3M9OB 2R7WA 2ASJA 2NXJA 3BF4A 1RAOA 2JLEA 2J9CA 4PG5A 3D68A 2CQ0A 1GEHA 3D6MB 4ZVSB 3A12A 1XK8A 1TMJA 4TXSA 3VWSA 4IO1A 4YN3B 3UDEA 1JJ2R 2UVUA 2DO0A 1UCNA 2LU2A 1WEYA 2MGZB 2E9TA 1B0PA 1X4FA 3QLHB 1IKYA 5LXYA 2CQDA 3ZNJ1 2F4FA 2Y1LB 2CPHA 2Z0GA 3ILLA 1RHJB 2EFNA 2O5DA 1YJNS 1WEZA 3UN3A 4M5JA 3OFFA 1TKZA 2N3LA 2IVMA 2P9EA 1ZM4A 4BBYA 4O3QA 3GJRB 1FESA 1FWKA 2MLYA 3S1TA 3LF0A 1R7IA 2ROGA 3CJ4A 3DXBA 1SPBP 1U1RA 4YR3A 2HLUA 1DQ9A 2EFPA 5HQLA 3ITHA 3QRRA 2ZJQQ 3S7RA 5KFRA 3TUJC 3UD4P 2UU9F 1TL3A 3N6NA 2CVIA 1S79A 2RU9A 4GO5X 3MM8B 4ZCMA 3DRXA 1WC0A 2MLZA 4IDKB 4Y34A 3VVUA 2WZ1A 3K57A 2F3JA 2P9GA 4N47A 2MEWA 4QU7A 4J91A 5KFHA 1U0HA 1OO0B 3QJJA 2V9KA 1YJUA 2EBEA 5M2UA 1MROB 2MZSA 5DETA 5B0AA 3W62A 2KN4A 1UEUA 1WI6A 5CYMB 5ETPA 1HWKA 3MPDA 1GXLA 1VJQA 4F8RA 2NZCA 7AT1B 4ZP9A 1VYAA 3DLEA 4F02A 4AYBD 1FRXA 1HA1A 3KLGA 3CC7S 1U09A 2KT2A 1PBUA 3O3LA 2XB2D 5AJ3J 3KK1B 3T1HF 2BW7A 5J2NB 3RB6A 5D0RA 2QL9B 3NY0A 3G6VA 1RT2A 3LTOA 5K8PA 4B3MJ 3L9ZA 2AGOA 4WCEQ 2DRBA 1NHUA 4NXNF 1XR7A 4KKOA 1HARA 2L9DA 3HVTA 5EUHA 1N8RT 2RF2B 1ZM9A 1CJKB 1UTAA 4F25A 2W9AA 2HS3A 5I3UB 1X4EA 1YQHA 4EWTA 1S9GB 5CZXA 5DZ7A 3GYGA 5RUBA 2E7XA 1YJTA 2IFXA 2BJ3A 5SZTA 1FCAA 4XO0A 2DGXA 1X9MA 3GB0A 2A0FB 3DRRB 3D28A 1H7XA 2A6MA 3G96A 4LF2A 3A13A 1AW0A 2QEXS 2WVDA 3R8YA 1UVNA 3ELHA 4ECXA 2VA2A 2P9CA 4Y3CA 1PSDA 1VMBA 1T9WA 5IV3A 2GQCA 1JJHA 2FUG9 3MMBA 1JLCB 4BWJA 4XTTA 3R5CA 1RKIA 1RT3B 4NXMF 1SJ4P 2HFSA 4JI2F 3GPAA 3KUEA 3KYLA 3ZTRA 1HNIB 1R31A 4FPRA 1F9HA 2F8MA 1PAUB 1X8DA 4LF5J 3PJWA 5DS7A 2RS2A 3PG9A 3HD2A 2XMTA 1L3KA 3CJ5A 1TZ0A 2MQPA 4N7TA 4AT1B 2W01A 1KQFB 1Y10A 1T9TA 1EX8A 2VZ9A 3UCGA 4KFBA 2OPQA 5C42A 4R0EA 3IS9B 2DR7A 4IRCA 1R89A 1YX2A 1FA0A 2CAJA 2E44A 1FEHA 1NSKL 2WW8A 2N3OA 1KOHA 4YOEA 2H65B 1ZH5A 2DNGA 3G6ES 1TFWA 4O4GA 4EI2A 4CO5A 1UETA 2YNIB 4UQTA 3AFGA 1R6YA 4ERDA 1RWVB 1HI1A 4NRUA 3LGMA 1T0TV 5B09A 4CLPA 4TU7A 3SQGB 1PJ6A 2D3OR 2WVFA 1R0BG 5IXUA 3WZ0A 3M1VA 2AJ0A 2FC8A 3N28A 1UFKA 1IKXA 4IFVB 1FXRA 4NPOA 1O5JA 3OTCA 2WVEA 3LPYA 4ZVHA 2J5AA 1LW0B 2DR6A 2RAQA 3IC1A 3IM9A 1GK8A 4CDIA 3NLCA 2XMWA 4FP9A 2W7PA 3QIDA 3RAXA 2R7QA 4J9OA 3HJVA 2HZCA 3D9BA 2F9JA 3OVBA 2JZ5A 4JB8B 2BM0A 3M30A 4QIFA 3CDAA 2LDYA 4TQRA 1D8YA 4FYDA 2CADA 2AGQA 1SJ3P 3Q8YA 4Q0BA 5CD4H 2DXFA 1SC6A 1JX4A 4YEAA 1LWEB 3ZC4A 1O8BA 1YZ7A 2C3MA 3R6GB 3KNGA 1CSJA 3OVSA 4K4VA 3GCWP 2B8PA 2E5IA 3PV8A 3ENWA 3T3FA 1ELOA 3VQSA 2Z57B 1KSPA 1FFSB 2LQ9A 3AQPA 2VFUA 4DZ6A 3R2CJ 5H9FJ 2HIQA 2JEGA 3C66A 2RRBA 5CQGA 2ZBRA 2F1FA 5GAGU 3TUPA 2VU5A 3ICLA 3GIJA 4M5IA 4B9VA 2V4RA 3QZ7A 4WJBA 1RWUA 1ZETA 1KHVA 1RTHA 3SEOA 1IQZA 2VQFF 2CPFA 2RHQB 2J0SD 1RT5A 4F0KA 4NA2A 4P75A 2CVEA 1NDKA 3QATA 2I5JB 4N8OA 2XHCA 1K44A 4KHRA 1P6TA 3CCLS 3H40A 3OL6A 5KT5A 2H54B 2DHXA 2C1EB 2Y8YA 1BQNB 1V5VA 1RAJA 4DQIA 1IVZA 1TK0A 2XG8A 3DXSX 1XR5A 1RZMA 2GJFA 1J5EJ 2UXCF 5D77A 4DR7F 4ZN3A 5CAAA 1UJ6A 3F56A 1KTQA 1HLWA 2MQMA 2RIJA 1RTDA 1Z2ZA 3M2RB 5DDPC 2IAJB 1HYSB 3FGVA 2GIRA 3ZNUA 4K59A 1N5VA 5B0EA 2DKOB 2PO4A 1UEVA 5I42A 5I3QA 1N5TA 3MEGA 2W9CB 2RH3A 1HQEB 4NYZA 2JJ4D 2VG6A 2WTFA 5H9EK 2X7IA 3W2VA 4DF8A 2HVDA 3TAMA 2Y3YA 1Y7PA 1S1WB 2A1BA 4NEZA 2FYXA 3M7VA 5L1IA 3W5XA 1CJTA 2HBZB 2MQOA 3GYNA 2LP4A 5KT3A 2KI2A 3OD2A 3K0JA 2K8GA 1UJ5A 5DZ6A 3UN2A 2XO6A 4C8ZA 1NJIT 3DLBA 3LPEA 3KLIB 2ZC3A 1RYSA 4KH0B 3CD7A 2RILA 2RT3A 2Q66A 1IJEB 3MM6A 2YNGB 3T5JA 3F73A 1T9UA 2QSWA 3EDRB 4YB1P 3US5A 3P6YC 4F0HA 1QLNA 1DBDA 3M8WA 2WBMA 5AXMA 1P8GA 1K9MT 5EGYA 2W9BA 3C16B 3IWLA 5HROA 1QE1B 2KTQA 4JI5F 2AT1B 3A3OB 5LMNJ 1BMQB 3HHLB 1KVIA 2YTCA 2BM1A 4X64F 2JLFA 1VHIA 1EHWA 5JJBA 3WHIA 1IM4A 3OVAA 3PKMA 3MUTP 1RT1B 1M5VC 2KVIA 1K1QA 2FVPA 5ETVA 2M2BA 4YB5A 2BOPA 2VDHA 3HHKA 5D4OA 4DR6F 4N77A 4QR1A 3QIPA 1IBCB 5KFGA 1SI9A 4P9SA 3ZO7A 4ZMMA 1SQGA 5IT9Y 4L72B 5ETKA 1RA6A 2AW0A 2HWTA 2RU3A 5DDOC 1NNDA 3MZIA 4F4YA 5D15A 3FCWA 4KO0B 4IOAQ 3UCUP 3CD6S 5EX3A 4DV3J 1N33F 3F44A 4ZLJA 4OYZA 4CLZA 1MNEA 3CJKB 4DCJB 1KFSA 3AJDA 1S1VB 1Q8IA 2ALZA 1PYOB 5BR8F 1KDNA 1IBMJ 2KRRA 5CHCB 2CZ9A 3CCSS 3IR7B 3C6UB 5HP1A 1GX6A 3QYYA 2ZM6J 4KGZB 4O23A 3M6WA 1DFDA 5IWAJ 1X0FA 1CVJA 1NH8A 4USVA 1B7FA 1TP7A 1RT4B 1VS3A 1JLFB 2ZH1A 2O3DA 2J6TA 2VL1A 2HS4A 4C3MA 4LFCJ 1T3OA 3HSDA 3UDCA 3MMAA 3MR2A 2VKZG 1WKKA 5KFPA 2A6OA 4K4SA 4TLQA 5BYSA 3KK2A 4LBHA 1NXIA 1FJ7A 4ED1A 3I9V9 4J9LA 2XO7A 4TVAB 4DEZA 5AXLA 2GO9A 2YVSA 5T7LB 1RAGB 2YNHA 1WDDA 3K5OA 1H98A 1RHQB 2M0GB 4RUAA 2F9DA 5KG1A 4RO0A 1G2EA 3MPUB 4U67Q 4LF4J 3R5BA 2ACMA 5A8RB 2WK4A 2CJKA 1WC3A 2YNFB 4XDDA 3AQOA 6FD1A 2ZZTA 3VAFA 3FEYB 3TZWA 4IQMA 3D0GE 4M8LA 2L41A 4Q2MA 5DG9A 1HNWF 3RBZA 4LFAJ 2E9ZA 1FRMA 1WKJA 1LW2B 1KEKA 2MQNA 1OY9A 4MFBB 3KLHB 3U27A 3T41A 4MTPA 1TL1B 3GR0A 3FSYA 4PYDA 3M2UB 3LAMA 9ATCB 4ED3A 4DSJA 5CD4A 5IOLA 2IDLA 5THWA 1MMLA 1NHVA 2XTJP 5CYJA 4Q45A 3BO3A 3OR1A 3KUGA 2MYFA 1TU0B 3EWGA 4I1TA 3DHXA 2B4VA 5J1NA 2LYVA 4DR1F 3THVA 3POTB 3C6TA 4WE1A 1T95A 3A3PB 1N5SA 3DOMA 3DOLB 3L95X 4PXCA 4Y2AA 5KFBA 4HI2A 1TAUA 3BBBA 5LXRA 3OFEA 1AZSA 3G6XA 3GV8B 4J5OA 2QN6B 3TO8A 3VALA 5E7OB 1HIYA 2HZVA 3MOZA 2MXYA 1HI8A 2XZWA 1HQ2A 4QJVA 2J0QD 3LP2A 2ZBQA 4TLRA 1RISA 3MAAB 2NYIA 1RTIB 3FBEA 2ZWPA 2ZKUA 1N34J 5HBMB 3RUBL 1MMDA 5A8WA 3KOAA 2M70A 2DO4A 2OPRB 4DUYJ 2QGFB 2FJVA 2B3TB 2HVIA 4KYZA 4AD6A 4NEYA 3EVMA 5G0RB 2BANA 1WOOA 4EU0A 4QIWD 4RBVA 2QLBB 4CO2A 4UQGA 2JNJA 2CQPA 3CJRA 3F41A 1VRUB 3A8IA 2QLFB 3PYEA 4C0OC 3MFIA 4KIAA 2DGWA 3BGRA 5EN1A 3TZXA 3J7YI 1IBLF 3SCKE 3ULHA 2XSJA 2K7JA 1K1SA 1ULRA 1SQFA 3DMJA 1M5HA 2ZOFA 4CTAA 3FZ2A 2XBPA 2DNZA 4DN0A 2PA3A 2W2OP 5GADU 1X31C 1Y00A 4LF9F 2FIUA 3QGGA 3PRBA 2V67A 4DSIA 2FJXA 3TVYA 1S97A 4XDCA 3RAMA 2OPSB 1XNRJ 4QQBA 1I1GA 1N36J 4MIBA 1FNXH 3WDOA 1RTJB 1SBRA 4Q8FA 2ZE2B 4IG0A 2QO3A 3KHLA 4EEYA 1XMOJ 1U2FA 1FFGB 4M5KA 5J2QA 3BPDA 1FKPB 2HRYA 1WOPA 3C15B 4LBPA 4F4ZA 1RT6B 2R2RA 3PYDA 5F0UA 1NDLA 1OYEA 1ZTTA 2DH7A 3M6VA 5KFLA 2BR0A 5K14A 3CCQS 2HW3A 3TVZA 1TQLA 4DR2J 1Q8LA 3TA0A 3MTJA 2P6TA 1QUPA 2B4UA 2RDIA 3PY8A 1SH3A 3TA1A 2KFNA 2DIUA 3T6JA 2QA4G 4W92B 3VGSA 3B54A 2LFVA 4IO9Q 4ED0A 2ASDA 2G2ZA 3WX8A 2W8LA 1S1XA 4WYWA 4N76A 4YB7A 1NK8A 2CJQA 1HBMA 4L73A 3C8YA 1U6BA 2FVSA 1X9WA 2G0JA 2W2PP 1MN7A 1TL7A 3D6HB 3CIZA 4BHQA 5BXIA 2DK2A 1VRTA 2VASA 2DNRA 3TR5A 3GE9A 1REVA 3MEKA 4TY8A 3HK2A 1VQ7S 4LMZA 5HO4A 3W8PA 2P2CB 5E5NA 1C4CA 1CEZA 2DVIA 1Y3KA 2VA3A 2VUGA 3KLEB 4PYAA 1SL1A 4C4WA 2UXBF 2DYAA 3PJ9A 4P7VA 4ZVQB 3PR5B 4DG1B 2QJ3A 2VOPA 4RL1A 1X60A 4ZVOB 1JLEA 3H25A 1EB0A 3PW2A 2C3PA 1X5TA 5IC4B 2M8DB 2DR8A 5A6WA 1UVIA 1E6VB 2MMYA 2PD1A 4X4TA 2DISA 3N0VA 2IC3A 5HVHA 3CD5A 4J9SA 3AOBA 2G0CA 3D66A 4ATNA 1OYDA 1HNZJ 4RX6A 1JXEA 1VQKS 3FBCA 1R0CB 4FKXA 1ZM3A 3UR3C 1NZAA 3QWPA 3MTKA 5J1EB 4RW9B 2GHWA 1CJUB 3GIMA 2B6AA 1H2VZ 4ANDA 1FJEB 3F0NA 1YRXA 4JBCA 4PCQA 2CUYA 2AHOB 2MZJA 3G8QA 2ZEJA 1FNOA 5J1PA 3LH2S 4RUBA 2WONA 2MPUA 5KG7A 1LWCA 3V6JA 2XWYA 5KOXA 1T05A 4ITSA 4A8OA 3LAKA 5DDQC 3PZPA 2XCPA 1YJ9S 1OSDA 1HI0P 3QWUA 3DHWC 4RWXA 3W5YA 3EVWA 4ILMA 3D0IE 3H4DA 4F4WA 1M1KT 2I0XA 1BHNA 1TUGB 2VKRA 4Q8EA 1L5UA 5H9FK 1FRHA 4DJBA 4O44B 3V6KA 2LLZA 3M2VA 3EM1A 5CXTA 3GILA 2QMWA 1HWIA 4HTIA 4LF8F 3CE8A 3G82B 4ZHRB 1T03A 1YI2S 2J8SA 4ZP7A 3CT9A 1P9YA 2VJVA 5CH7B 1T9VA 1NAQA 2RJZA 3V4MA 1KTVA 1QAIA 1DY3A 2B5JB 1G6BA 1ROFA 2UU9J 2C2EA 2ZOGA 4ZLLA 3PIPQ 2V94A 2KVQE 9RUBA 2M3DA 1A0OB 1TK5A 1NZ8A 1DTTB 3OSPA 4NCAA 4X4UA 3I5BA 3DM2A 2QLXA 2DCUB 2Q3PA 3L7PA 4HH1A 3KJVA 2MZRA 3B4DA 3JQMA 2HBQB 3QO9B 4DV7F 5LSOA 4ZIVA 4ED5A 4ZPVR 4RUCA 1PO6A 3MCMA 1QAXA 4Y2KA 3RTVA 3RAQA 2VPWB 4X4SA 1WJ9A 1SL2A 2C28A 1SC4B 4DUZF 4DX8H 3NWGA 2IMWP 3QZ8A 3FUYA 4LR9A 2DTJA 3T1HJ 3BV8A 4KTQA 1VBYA 2ZITA 5LSRA 5KT4A 3Q8RB 3K89A 4NXNJ 3O44A 1NJWA 3OXLA 4CH0S 3LQVA 3WIUA 3UQSA 3QGPA 4DF4A 4ILLA 2DHHA 3LOUA 1H74A 5BYQA 2AYEA 3M6UA 5C25A 5A2QY 1XMQJ 5A0YB 1YLXA 2P8IA 3KKFA 2LXFA 1K73T 2B9XA 3CC4S 1S1UA 4RWWA 5B0GA 1IQTA 3EE3A 2R9LA 1JLCA 1RT3A 3U02A 4OYBA 4OYWA 1RWKB 4ZS6A 3A3NB 3MEEB 5M2RA 4K0KF 2VPYB 4Y0FA 1DLOB 2XMAA 1S6OA 4O3SA 3ZZYA 2ATLA 4EYHB 2FHOB 4NXMJ 1HBOA 4ZPWR 1FNMA 3C14A 4A8KA 4HH0A 5ETOA 3MPVA 4A8FA 3W7BA 3VAJA 1FDAA 4JV1A 5LMUJ 2V8GA 4ZVPB 3HHLD 4DV6F 4OZ2A 2IRUA 5AXKA 1DZ5A 1B4SA 4RW4B 5KFKA 1JLQA 4Y28C 5CYQB 1HR0F 3PFOA 3LA0A 2H3EB 2KL8A 1YRTA 1YSJA 3UE2A 1RLCL 2WHOA 2KHCA 2POKA 1FXLA 2HQCA 2HGMA 3CO0P 2CPJA 3FZBA 4PG7A 3K5PA 2ZH5A 4OYMA 4J9RA 3JAMY 3RU0A 1GNKA 1H2TZ 2C3OA 4Z37A 4ILRA 2JVRA 3P5TL 1X4BA 7FDRA 5F8IA 2OSQA 2UUWA 4RR5A 3M32A 2DGTA 3VZIA 3EUNA 3MEDB 4OX8A 5J2PA 1JLBB 1NKEA 3ISND 5U47A 4AE5A 5A6PA 4FXWA 3BGFA 4LQ3A 2GX8A 4ALZA 4RLEA 2VQEF 3N4WA 3BKUA 4DPOA 5KFOA 3I55S 2BX6A 4M5DB 1N5YB 3J7Z5 2EFQA 1RYRA 3BJYA 2KXHA 1U45A 2DRAA 1IKWB 2PEHA 1TL5A 3ZZOA 4PWDB 4IR9A 4BWMA 4R5PB 3D1OA 2KG0A 1NPPA 3JTPA 4W4MA 2PMZD 1AB8A 2KZZA 2D9PA 2DHAA 4PEOA 2VPZB 2RQKA 4WFAQ 4NE9C 2A2CA 3V81B 1B99A 2VBZA 4IRKA 2CXEA 4ZVRB 2R2TA 4NMXA 3QQCD 4Y00A 3OXGA 3DLLQ 3ZTOA 1RT7A 3T1YF 3CMES 2RDJA 1HD1A 1VC5A 3I0SA 1C0TA 8RUCA 4F3MA 4UF4A 2MDAA 2X1AA 3BZQA 1NKBA 1N88A 1FI4A 1W26A 2W8KA 2JC1A 4I6AA 2XI2A 4ZLNA 3P45B 2FHJA 4M94A 2AJQA 3QT6A 3BYPA 4HACB 3HHLC 5KFNA 3TX0A 2VQFJ 2DNKA 3U1MA 3LW5C 1PG5B 1JLAA 4L3NA 5AXNA 4DR5F 4DL6A 1TVRB 1FRJA 4C97A 1K0VA 4KPYA 1RCXB 1YGYA 1EQMA 1J5OB 5LSLA 3GTYX 4WK3A 3SDEA 1R0AB 3D2WA 2IY5B 4I2PB 2WSFC 3M8SA 1S72S 3HHDA 3H98A 5KFDA 4RW8A 4HKQA 2AZ3A 1JNZB 1O6XA 2QV6A 2B8QA 2XSFA 1ZA2B 2IJFA 2IJNA 3TX8A 1X4HA 4QIVA 1WG4A 4ZVGA 2BRKA 1KBRA 3P3DA 2XI3A 5LJ5Y 2PGCA 3MMCB 1EJ7L 4CLWA 1CS4B 1HWLA 3HPOA 2BZ2A 2WOMB 3PIOQ 2WAQD 2K1RA 3BGUA 3ISNC 4NLOA 5E33A 2LEPA 4H54A 1RHKB 3OUYA 2Y1IA 2F8EX 4OI6A 3OTOF 1H3DA 1Q79A 1CJVB 2FZGB 3J80U 1YBTA 1YRUA 2NLWA 3SCLE 1S0MA 3I31A 5HQ8A 4C8LA 4NASA 1N32J 1JNRB 1SIWB 2GJ2A 2HRUA 3VAMA 3DGPA 1KRPA 1KQKA 1RU1A 2E29A 2HAFA 1PBAA 5HJXA 1R8CA 3T9NA 4X4PA 5HLFB 1J2VA 2Z56B 1TL4A 4RU2A 1IJFB 2C22A 4NL5A 3QT8A 3R27A 1WACA 3Q22A 2FZCB 1LEOA 5F41A 1UKUA 4JI5J 3H59A 1S7HA 2JFKA 2NUHA 4X66F 1AT1B 3KHHA 4M5NA 5C24B 3AB4B 2XY7A 2HVZA 4M95A 3X1LB 2DRDA 2RD5C 3KK3B 2GIQA 3CSKA 1IKVB 4RNOA 3EDQB 3IR5B 3HFVA 2M5YA 2Y9HA 2UXDJ 4B9TA 3JQKA 4W90B 4FF4A 1MU2B 1OQ6A 4WKRA 4EMDA 2AYBA 4KC5A 4DR6J 3FNNA 2J0XA 2HMIA 2IA6A 5IM0A 4WKYA 4IFYB 3MF5A 3HD1A 2OMLA 3PRVA 2AJ2A 2BE2A 3C3LA 5ETTA 3I4PA 5KFFA 4KO0A 3MECA 3NS7B 1AFJA 1HBUB 3NWRA 4IQXA 4PQUB 2AF6A 5K8MA 2BA9A 4R8UB 5KFSA 4USTA 3D1QA 1S57A 3RB3A 3LALA 3FKBA 3KUHA 3UN5A 2H4YB 3UVJB 5L39A 3LP1B 4B3OA 1XC9A 3N5BA 2ATCB 2NSCA 2GGPB 2OSRA 2BJ9A 2F8HA 3K8WA 2ZOMA 4JI6F 4DL5A 3EGZA 1U1QA 2AJ1A 1JK9B 2E66A 1C0UA 3NCRA 5BR8J 5GMDA 1NSQA 3TUZC 4OJ1A 3MM7A 3D6TB 2YKMA 2V50A 4CO3A 2X51A 3CJ2A 2LDIA 2EEYA 1MMNA 3KFWX 4E98A 4B3TF 3TJAA 2ERRA 3GFXA 3PR4A 4H4MB 1VLYA 1N5QA 4L3KA 4ZJQA 4C3LA 3OW2R 4N56A 2KKHA 2HHUA 2EKNA 1PILA 3Q2TC 1H2UX 3NNAA 3B6BA 3JSMA 3JB9k 4FYWB 4I2QA 1UW4A 4HT7A 1FVSA 4ECWA 4F4AA 1ZZNA 4ZN1A 1LOUA 2CPDA 4YQWA 4UW2A 2DGVA 2ZZMA 5K8NA 4X4OA 3MD3A 1GT8A 3HKWA 3HHNB 3V6DB 2DNMA 2G1HA 4DLEA 3NG8A 1UFWA 5IV4A 2EW9A 4RBTA 1MSWD 1REGX 3UCZP 3FSIA 4PZVA 1SUQA 1S6UA 2IPOB 1FD8A 2PA8D 2JOQA 1UPMB 4DL7A 1UA1A 1S76D 4DSFA 2OH2A 3VGTA 5KG5A 3OL8A 5L1JA 2GMJA 4R0JA 2I9SA 3IM8A 2PE8A 4RW6B 2LA4A 2QA2A 5GAGI 2VC1A 1RSCA 3QSYB 2XMJA 2IM1A 1TV6B 5D0HA 2DNQA 3PX0A 2VONA 5HK4A 2X3DA 2XQCA 2VPXB 3MCOA 2G9OA 2DGQA 2V2KA 4P10A 3LP0B 3A8JA 5KG0A 1EETA 2YWEA 2HNZB 1IR2A 5F8MA 5A2QU 2CQ2A 4I64A 3DOKA 1Q0NA 3Q8SB 4N8NA 3ET6A 1WHYA 1PYSB 4P73A 1LWFB 3CDUA 3AA8A 1W25A 5DGBA 1FD2A 3UR0A 2XGQA 4USUA 2OO4A 3T5KA 4LJMA 3Q89A 3CJSA 1RACB 3GIRA 2JDJA 2RQ4A 4QR2A 4F0MA 5KFVA 4C8OA 3U1LA 4FBTA 1F3VA 4NYPA 4LRCA 2UVVA 3W65A 3H5SA 4QYZJ 4J7CA 5DJBA 3FFIA 3IA0A 2HHXA 1GMVA 4QW9A 2D3ZA 2GVZA 1O51A 2OUGA 1IN0A 2YPYA 1QVGR 2WSCC 4A4JA 4ECRA 3E2EA 3OFHA 2HIYA 2OFHX 2YXLA 3MPWA 2BKPA 3AT1B 1WSVA 1TKZB 3O5TB 8ATCB 2DITA 3BKFA 3DKDA 2MB0B 3BH6B 4J9VA 4TKTA 4NLSA 3HLUA 5DG7A 2DEJA 2HYIB 2C2KB 3Q8VA 2IDEA 2ZDPA 1F9EB 5ETLA 1GAOA 1L3SA 4C0BA 1XIQA 2GFFA 4QWBA 3ITHB 1JLGA 4K8RA 4LF1A 1TL3B 4JYAF 3E01A 2YX1A 3V5RA 2ZUAA 1EKRA 3DLJA 3FCHA 1K47A 4FNIA 1BC6A 4LF7F 2ZWOA 2YWWA 2XGPA 2JH3A 1IWAA 2DCLA 4URGA 1SH0A 2X1BA 4QBUA 2J0WA 4RNNA 1U0HB 5F8HA 1CQMA 2R8HA 3HXMA 3FMWA 3A8EA 3C2PA 3RG6A 2EFGA 5HAOA 2V63A 2UUBJ 3IBFB 5F8GA 5AJ3F 4NX9A 2Q6BA 2VF3A 2DR5A 2G2OA 1M1GA 4XPEA 2K06A 3SI8A 3IRWP 2FHKA 3DLEB 4KV8A 2M8HA 2Z2YB 1YBUA 4WTYA 3KLGB 4DOZA 1VC0A 1C4AA 4DV1J 3DYAA 2ZHAA 2QC3A 2BOAA 4ZVEA 1RT2B 3W64A 5JUMA 4KKOB 2KXNB 4WP3A 4QWAA 1JXLA 3HVTB 1VQLS 1AROP 2DHGA 3PJXA 3I82A 2FZKB 2GCFA 2DNYA 3EXCX 5HQMA 1ZAXA 4J37A 5L1LA 3SSSA 1PCAA 1TK8A 4C7QA 1NK0A 3W8GA 4ES1A 1EZZB 3OTBA 2HHHF 2QFIA 4C98A 3TUIC 3I96A 4TU9A 3UNGC 4HTJA 3T5LA 3VTIA 3HVRA 2V68A 4KHPJ 2QMUB 3EZOA 5DQHA 1ZAWA 2XMMA 3ONQA 4LF5F 4I68A 2CKWA 3G8SA 2MQLA 3GLJA 3H5UA 3LUYA 1XERA 3MMBB 1L3TA 3KTQA 2XMUA 2C2NA 3MAHA 4NLUA 4LF6F 4PQAA 4C11A 2CZVC 2JHEA 4F4XA 4HR2A 4WXOA 4DS4A 3J7ZT 2CQIA 1R6VA 2V2ZA 1ZTWA 2LCWA 1ZYQA 1WC1A 2ZHOA 2BQRA 2PDAA 2A18A 1BLUA 1XBWA 4UOGA 4LQ9A 1S10A 4LSNA 2GMLA 4KFBB 2YQ0A 2OPQB 5GAHI 5C42B 4DV5J 1GH8A 2HHSA 1WSRA 4ZPCA 4Y2MA 5KFCA 2VODA 2YWGA 2UUCJ 1EP4A 2HGNA 3KWMA 2VFRA 2N4DA 1S48A 3R5GA 4BLGA 2OAUA 3H7HB 4O4GB 4MYUA 1Q7YT 4XPCA 4OYPA 2OTJS 3ZZZA 4RZRA 2BBEA 2L9NA 4NA1A 3M9MB 4G3IA 3SBMA 2DIVA 4PG4A 3D1HA 3D7SB 5A8KA 3WC2A 3H2UB 1X9SA 1IKXB 1FVQA 1HHSA 4X4VA 2H4WB 1VQ9S 1SKRA 4YUDA 3HKZD 2Q6CA 4GKJJ 4WU3A 1RHUB 2I38A 2K3IA 1R8PA 4ICLA 3H4BA 1NLKL 3ZFVA 1FERA 2PI5A 1GMWD 4LREA 3OJSA 2HGLA 2KG1A 2GIFA 5DGAA 1TKXB 4Z2XA 4KGMA 3CDBA 2OJ3A 1Z4UA 2QA1A 3M30B 3NNCA 1VIXA 2HQGA 1IR0A 4LT6A 4WTOB 4Y65A 1HKAA 1TKTA 3BEGB 4Q0BB 3BN7A 3U7JA 2NS1B 2XYPB 1Q1KA 4FN5A 2FGCA 2B5JA 2I6WA 3HO1A 4O3NA 1SCJB 4DV0F 4DN9A 4W98A 4KT0C 1NUEA 3BREA 2R2UA 4OZ1A 3MM9A 3V2UC 1Z1ZA 1RAAB 3HJFA 1OS5A 1HD0A 2HNYA 3QBCA 4OX9J 1B70B 1VJWA 5T14A 4OYXA 2H51B 3IGVA 3QRPA 2COLA 2MSTA 1SQEA 5MAOA 4O3RA 3FDSA 4OHWA 4B3RJ 2OEMA 2D41A 5KFWA 1SJQA 4DV7J 2KT3A 1RA7A 2ILZA 4IG3A 4P71A 4YDDB 1HMVA 2CZ4A 2LEBA 4NZ7A 2YX4A 2DNLA 3I9ZA 4NZ6A 3KG0A 2LXIA 3GONA 4NMLA 1U2CA 1RTHB 2CQHA 3S8SA 4DBQA 1NEEA 3AB2B 1RT5B 3I87A 4ELUA 3P8BB 4QCLA 3IAM9 4DUZJ 2OIHA 2V8PA 1G4CA 1J5EF 3OJUA 3RW7A 4OJGA 2VBWA 1N0UA 2NPIA 1Y11A 3NGDA 2AYMA 2GVDA 1LFPA 1SC1B 2RB7A 1M1HA 4QWEA 4QWCA 1E6YA 4PWUA 3O1LA 1RAEB 3W60A 2R7TA 4MK8A 4LRDA 3AA9A 2FJEB 2Z2ZA 1RTDB 4MMOA 5HSPA 1YWXA 1CULA 1UWBA 5GADI 2XS5A 1RE1B 4DQSA 3RGIA 1YHQS 2RMLA 3AODA 4ZIWA 1H72C 4H4OA 4M5LA 2OLWA 3MEGB 3OLAA 2CWXA 2VG6B 4TU8A 4K4WA 4ES2A 3W2VB 2HNDA 3TAMB 4C2MA 2R8KA 1S0VA 3QGHA 2GA7A 2PFDA 3P5BP 1VGYA 1X4AA 2ADCA 4K0KJ 3R1HA 3T5HA 2U2FA 1CJTB 2X3GA 2G0IA 4ZJLA 2AIRB 2CQCA 4MK9A 1H6KX 2UUTA 4PXBA 1G1XA 2CG8A 3GP9A 1VQ6S 2R2SA 4ANEA 1NB2A 3CNQP 3CB4A 2QYCA 4WP8A 2AJFE 2Y1RI 3JS9A 3NP5A 1XNQF 3TEHB 4ECZA 8AT1B 4UZBA 1ZPWX 1Q95G 3MM6B 2V4JA 4L75A 3I32A 4MIAA 2RDDA 4KGXB 2LU1A 4WU2A 4CH7A 3TOQA 3IG1A 2EVZA 4NLDA 3H90A 3O6QA 4FKYA 3CCUS 5HROB 3K59A 5G4DA 1QY7A 2CFXA 1TELA 3NGUA 3VVTA 4N41A 3OR2A 1SKUB 5GVQA 4OIXA 3DDIA 3PEJA 4Y2IA 2E5GA 1BQMA 5D4LA 4Q43A 1LK7A 5DM7Q 2XEXA 3G6YA 3A4TA 5EHHA 4ZK7M 4RUHA 1JKHA 1F3FA 5KAKA 4F36A 2RQMA 4NLRA 2CPZA 4TYBA 3M8YA 1I94J 2EWHA 2O01C 3PKYA 2Q1LA 2QRRA 3DRPA 4WBFA 2OPPA 2BDPA 2QFJA 5DO2A 4WK1A 1BQXA 3J7A1 1RHRB 2VG5A 2KJWA 1I6JA 1PAEX 2JC0A 4KGKA 3EX7B 1ZOTA 2F4VF 1UEKA 1S9EA 5I3PA 3QIPB 2VG7A 5K20B 3SYZA 1KN6A 3IBWA 4C3KA 1HWJA 1QM9A 1GMWA 2N7CA 4DPTA 2DNNA 3PNIA 4R5PA 3QMQA 2MQ8A 1LV5A 2CQ4A 3PCOB 5JVGQ 4K4TA 2YKAA 1RDRA 1IBMF 4LIWA 3MR7A 3DLKA 5JVHQ 2MY8A 3M05A 2PFFB 5HJYA 4LSLA 3E3XA 2E5LF 1DQAA 1CC8A 3RR7A 1N54B 1IBKF 2BJEA 3HULA 1KP6A 1J27A 1R8HA 1C1BA 1T9YA 5HP1B 1CQNA 2F5GA 3V4IA 2NXNA 4IUFA 2UZAA 4ED6A 4LFCF 1IM6A 4WPAA 4UZCA 1VOMA 4H4KC 2KO1A 4B9NA 4LRFA 1GX5A 4PPDA 2AZ1A 3HVAA 2CQGA 1N56A 4ZVFA 3EPGA 5KFMA 2DGOA 2PIIA 3LO3A 3GJTB 2KFZA 4DU8A 2CJAA 3BM7A 2DY9A 2GS8A 4JP8A 1HQUA 1U4BA 1R8BA 2HFZA 4FZVA 1EQ0A 1S6PA 4M5GA 4JV5F 1QSLA 3KK2B 4ZP6A 5KFQA 2UP1A 4V19J 4NCGA 2CPYA 4LF4F 4OZ3A 1NBEB 4DV4F 3CCZA 5FLXU 1RHMB 3BSAA 2HQIA 4AQYF 2YNHB 3HCXA 1KQGB 1FDNA 4X4QA 4CO0A 3CCRS 5D3GA 4J9PA 4YY3J 2W4PA 1LXNA 2C3YA 5AE1A 3CXCR 3ILOA 1QD1A 4LFAF 1CS4A 2J6UA 5CCLA 2J7UA 2RUGA 3X3UA 2HBRB 4JI3J 3IRXA 3NNHA 3MCSA 3J7AN 1U2RA 2FVRA 2BQ3A 2DT9A 3GIKA 1ACMB 2L08A 4U7UK 1XMBA 1U1PA 4OZLA 3JYTA 5B0BA 3R7SB 4ETXA 4DPYA 2QTWA 2V34A 2Y0BB 3DI6A 3PX6A 3KNAA 4K4YA 2N82B 1R43A 3AY0A 4QYZK 4K5RA 3RRGA 1U25A 4AUKA 4KHMA 1UWAA 3OTOJ 3OR1B 4H4KA 3UD3P 3RBDA 3BS9A 2LMIA 1OY6A 4ZP8A 3CDEA 1WI8A 3LWLA 3C6TB 4WE1B 4K7QA 3DOMB 4WZQA 4M1KA 3DGVA 3T9ZA 2E1MC 1Q81T 2XS2A 5IC6B 2HHVA 4J90A 4IR1A 1U02A 4OI4A 3TANA 1AZSB 1U1NA 3AOAA 4DX5A 5D0EA 2HFNA 1N34F 1FRLA 2CJYB 1QUVA 2CQ3A 1RUSA 2EBGA 3A1YG 2ZH2A 4DUYF 2ZKTA 1ITPA 2E1RA 3LP2B 4CLYA 3EZ5A 1LNQA 4OLOA 3UWTA 1HW9A 3SSRA 1W7WA 3W2WA 3G8TA 1KVKA 4RW7A 1N48A 3KJQB 2H5JB 5A76A 2VFSA 2DR9A 2R8GA 4DMZA 2DGUA 4AXJA 1YIJS 2W2NP 4IFYA 2W1BA 4DL3A 4N5SA 3W9JA 2OTLS 2LQBA 2BANB 4DDFA 3HSGA 4K5SA 4D3GA 1V9OA 3GFYA 1HNVA 2MQQA 1T7PA 2CNNB 1WHWA 1MLAA 1OY8A 3BGRB 3WX4A 2BABA 2OD4A 4NI2B 1XNRF 2AJ4A 4KBIA 4ZPDA 3DMJB 2D74B 2MJUA 4OV1A 3KG1A 4CTAB 2VV5A 3OFGA 1NO8A 3MPYA 2UUAJ 1S9FA 3PXGa 5FDLA 3GIIA 1NH7A 1UW9A 4PG8A 4LIRA 2H1YA 2IM3A 2IIHA 4URQU 3OTEA 5E3PA 4GKKF 3GQCA 1KLNA 5L9XA 4CNYA 4OL8A 4JUZA 2KM8C 5F9LA 4ZA1A 2JSXA 4IG0B 4JI6J 1TKDA 5J2QB 3TP2A 4G1QA 2I1RA 3LWMA 2QL7B 3IBCB 3W66A 1VQ5S 3GJQB 4NOHA 4QPTA 5D0GA 3MWBA 1VQ8S 4B3TJ 5GAEU 1KWMA 4A8XA 2HEKA 5K14B 3L7UA 2D9OA 1WF2A 3QJLA 1M5SA 3I0RA 5KT7A 3VZHA 4F67A 4WFYA 4P2SA 4MKVA 1HBNB 2MHNA 3DRSA 2HFUA 3EJMA 1C2PA 1M0SA 4P2FA 4RNHA 1EAYC 4F3QA 4JI7F 3GG1A 4YHHF 4NLYA 2RKIA 3TJ9A 1S1XB 1SJFA 4ED2A 3NGRA 3ZTSA 4PPZA 5IFMA 1HBMB 4USJC 5K9FA 3BB5A 4G1PA 1VDHA 3NCPA 4KJIA 1T11A 1TL7B 1D0EA 4MH8A 5EWEA 1VRTB 4MIWA 3T1AA 3ENVA 4JI0J 5MLCV 1REVB 1WF0A 2CJXB 3FBBA 4TY8B 1KNZA 1GTHA 1LWXA 2IVFB 1OWXA 1H73A 2E7VA 2BE9B 4DCOB 4B9LA 1KR4A 3BDEA 1G3OA 4WP9A 4EUVA 3RBXA 2FC9A 1TUWA 4DR4J 1H38A 1LQ9A 2W7AA 2ZHBA 4KQZA 4DPWA 1CC7A 3PW4A 4FPIA 4B9UA 1HNZF 4QR0A 1JLEB 4QIGA 2HNZA 4ID5A 1U47A 3UI3A 3Q8QB 4FS2A 3KJFB 1VIOA 4GC6A 4OI3A 5KG4A 4TNOA 1I3OB 4HHJA 1V3ZA 4K50A 3M8ZA 3S6EA 1UVMA 2IC3B 3UFCX 4LUBA 3PTWA 5CABA 2UVWA 3N5FA 3PO5A 1S77D 2XC9A 4G65A 4LFBF 3NBPA 2HZAA 4S0MA 1NB7A 1S1TA 2B6AB 1RU2A 4P7TA 3PYFA 1FFWB 2R7SA 2GQQA 1FJGJ 2VIHA 1F5CA 3GJSB 2LEAA 1WWHA 1ZS6A 3J81U 2WONB 2FY1A 2CQ1A 3CC2S 1LWCB 4F2RA 4HL9A 2IJRA 4EZ6A 1T05B 2DNOA 2J7WA 4MKYA 3J81j 1VLOA 2O67A 4PUOA 3TI0A 4JI1J 3MR6A 3VCDA 3D5MA 3HMJG 4KPCA 5KT2A 3CCJS 2KDOA 1OQ3A 1I51B 1DHMA 4PRFA 2RRAA 1CPZA 2FLPA 3M2VB 2FPHX 4I4BA 2RHSB 2HBYB 2ZD1A 2W2MP 1T03B 3MD1A 3SFGA 2E1CA 3EGWB 5KFXA 2GAHC 2CG4A 1MN9A 3PRDA 3MI7X 2LQ8A 3SQOP 1F0XA 4JYAJ 2JEIA 4LF7J 1KLMA 5KFIA 2B43A 1ZPVA 1VQ4S 1FK9A 3BSOA 3ENQA 2M9KA 3DM2B 1AA1B 4NA3A 4ECVA 4FXDA 3KJVB 1SJRA 4ZDNA 2NPFA 1JJ4A 2P6SA 4J9UE 1B0TA 1N6QA 2B4PA 2RNEA 3I6PA 3DLGA 1UPPA 1D1UA 3DU6A 5L38A 3THPA 2HVEA 4CYUA 1GFWB 1UAWA 2Z30B 2KH9A 2JEJA 3KMQA 4DFJA 1S4FA 1PC4A 3J80Y 4K4UA 1I5OB 4D3HA 3IP0A 4HHUA 1VI7A 1X5OA 1B0VA 4I69A 2ZH7A 3BR9A 4QOTA 1PIEA 4YMEA 4HEA9 3PO4A 3CCWA 3M4XA 4F2SA 1XMQF 1DTQA 4DSEA 1VQMS 1AUDA 3WIVA 4XIUA 3CTRA 4I7FA 3CCTA 3EGVA 1SKWA 4XK8C 4OHYA 1CBKA 1U24A 2VC0A 5C25B 2VB6A 1WTBA 3IGNA 3VAGA 2UV8A 1QTMA 4X65J 4U7CA 3FRZA 1TUVA 1NJYA 2CPXA 1RBLA 3QSIA 2XHWA 3MXHP 2Z58B 2EI5A 5M2PA 1SXLA 4OHZA 4PWWA 4DCPB 1S1UB 1VISA 1RAFB 3CMAS 2HHHJ 4IH7A 3DFEA 2ZC4A 2CIMA 2D3O1 4X62J 3MM5A 3KLFA 4DFMA 4HYKA 1DQ8A 1ICEB 2QX0A 4X4NA 1RXOB 1S6QB 5LMUF 4Z7YA 2W24A 4A46A 1JB0C 1HBOB 4LF6J 2F63A 4Z7CA 2B9WA 1U48A 2DNPA 1U8WA 3NGTA 1JJCB 2UV8G 1VRQC 2IBKA 5H1SV 3K58A 1Z2LA 3C14B 1VQSA 2WB4A 1Y5IB 1OMSA 2APOA 1YDLA 4OMFG 2MGZA 1RADB 1WG1A 1YK9A 3QLHA 1KKHA 1S7IA 2YPZA 4KAIA 2FLNA 4K4ZA 1V6HA 3Q23A 1JLQB 2WVCA 3PEHA 3NKYA 3GFZA 3THTA 3I5AA 1U7LA 4I56A 1T8EA 1FKOB 1IUJA 4OJ3A 4KSEB 4ES3A 5LOQA 1XQIA 1FDBA 2B7CB 1FDDA 2BKOA 3PM9A 1NK7A 5DQGA 2C3UA 4M63A 4J9NA 2HHQA 5L9NA 3UDLA 3N9UC 1WKLA 1WOSA 3BPSP 2L9WA 3FSXA 2DXDA 2RVJA 2E9RX 5E2QA 3M8RA 1QAYA 3MM8A 3RB4A 2HVHA 3DNCA 1NU4A 3VHQA 4OZNA 5F3ZA 1RABB 4IDKA 4NLQA 1TKXA 2C2RA 2GC8A 3M32B 3R2DJ 2GJIA 5T41A 1VQOS 3C46A 1X7VA 5J2PB 2DH9A 1MROA 4DFPA 3PHTA 4GVBB 3GU0A 3G2XA 4HI1A 2BJ8A 2BKNA 3M8QB 3AXKA 2LKZA 5CYMA 2EXUA 3Q24A 4RU9A 1SH2A 1SC3B 6FDRA 3EYZA 3AOCA 2EG2A 2NYHA 1JXVA 4QWDA 4YDXA 1Q8KA 1R27B 2ZH9A 3GV5B 1HWUA 2D69A 3GZ7A 2BACA 3KK1A 5J2NA 5D4NA 4J9MA 2RUSA 2YX7A 5F8JA 1XTZA 2D7SA 4DV0J 2HWIA 2ZJPQ 4CCHA 1VBKA 5ADZA 3KDNA 4K4XA 2RF2A 1CJKA 1WDTA 1NPRA 4NLVA 5I3UA 1HL6A 1S9GA 2E1AA 1YJVA 3JXOA 2Y1JA 4PKDB 1B64A 4IOBA 2HAIA 4DR3F 4DL4A 1D9AA 5J2MB 1WHVA 3ILJA 4OZ0A 2LECA 1RT7B 3NEKA 5KFYA 3DRRA 3TNVA 3I0SB 5C2GA 1C0TB 1YJRA 3H42A 2CDQA 1RWPB 1IWGA 3UDVA 2WRMA 3HX9A 3GSIA 2XY6A 3VR1A 1P9QC 2XS7A 4UUXA 1JLAB 2FJBB 3RRKA 3MURP 2XWXA 1A6LA 1BXNA 4ZPBA 4U96A 1Q5VA 3SCJE 2GHVC 3HZEA 1HNIA 1NHKL 2DB1A 3P96A 4CLKA 3BBCA 3R5JB 2MKIA 4K2XA 5L46A 3SDEB 3DDKA 1PYTA 4EO6A 1UVJA 4CT9A 1H0HB 2HPUA 4JI2J 4JI4F 4RW8B 3DN9A 2KXFA 3I5CA 3W3SA 2WB1D 3BDPA 2HK2A 4WFXA 2FGOA 1P1LA 1M5OC 1Q78A 3IS9A 2MJNA 3VF0B 2IVYA 1Q5YA 2NXCA 4DPUA 1D3WA 3H2VE 5B08A 1UMJA 4DX6A 2XMKA 3FCVA 1HNXF 3E8OA 2K1RB 2Z2MA 4AXIA 2CWKA 4UOHA 2ZH3A 4JV2A 4B3SF 2YNIA 1VQYA 3BKTA 1N32F 2NXUA 3OUYB 2JL9A 5HL7Q 4CZCA 3QFHA 3IFEA 1S5ZA 1RBOB 3TYTA 1WORA 3SQGA 2WBRA 4EBDA 5BYRA 2HHTA 3SFUA 4ZLPA 4IFVA 1GXTA 4QPXA 3S01A 2YH1A 2HHWA 1XNQJ 1XJWB 3DGPB 1LW0A 2HQDA 2CPEA 1Q4RA 4ECSA 2EPIA 4FDFA 4ED4A 4HHHA 4F04B 3CIMA 3K5MA 3L3CA 4UOCA 4EK2A 1D09B 2FTRA 2FD2A 4IYQA 1CLFA 4ZVUB 4A8MP 3QGIA 3AJ2A 1NK9A 4YP3A 1SV5B 1YTYA 2FJAB 3QNWB 4BC9A 2UXDF 4DL2A 1LWEA 2AV5A 4ZPTR 1YJWS 3CJTA 1URNA 2AMCB 3AD8C 4CH1A 1XWLA 4HDGA 5C2CA 3A8KA 5B0FA 2J6SA 1DAXA 3CPWR 3M8PB 4J9KA 3FRYA 3FQKA 3RBEA 3TQEA 4FF1A 2XZDB 1SJ1A 2FLLA 2W7OA 1F6TA 2JWNA 2VFTA 4JI8F 5KFJA 3KHGA 3HDSA 5IT0A 1PKUA 3E51A 2HMIB 2F4VJ 1RI7A 5IM0B 4C8NA 4V1Ak 2R8IA 2BE2B 3JSYA 2DY1A 3P49B 3MECB 4EGLA 2HSEB 3OSNA 5E41A 5CA5A 3VQTA 1SL0A 1FEEA 2MKHA 5DLFA 5F8LA 2YY3A 4B3OB 1GQEA 3SMZA 5CCMA 1OSCA 3PDNA 2J9DE 2DEIA 2VD3A 1RAIB 2FDNA 4NLWA 2I5JA 1S59A 4DFKA 2E5LJ 2CNKB 2GMHA 1C0UB 1BQNA 3K7RA 1T3NA 2B56A 3MM7B 2YKMB 2OFGX 1IBKJ 3IAS9 3PFEA 3HZGA 1NK5A 2H48B 4MKBA 3B78A 1TTHB 4ZKAA 1K8AT 3DU5A 5DDRC 1Q7LB 2NREA 3N6MA 5GAHU 2QYGA 5IQQA 1DARA 1ZBTA 3H5XA 3M2RA 2IAJA 4CQ1A 1U49A 1HYSA 1FX2A 1FE4A 2AQ4A 1Y0HA 2B9YA 3HI9A 2CYYA 4JOUA 2CJ9A 2UXCJ 4DR7J 2W9CA 4F50A 2DD8S 1HQEA 4ID8A 4TQSA 3JSMB 3N79A 3OV7A 3BO4A 3ISZA 1Q16B 4I2QB 2J8AA 1T02A 1UJ4A 2KYXA 1UL3A 1S1WA 4O0NA 1UZDA 2ABYA 2ROPA 2AYGA 2HG4A 2JRSA 4RPFA 4JV5J 3W5ZA 2ACYA 3SIPB 4CM0A 5I4MA 3QAUA 2GAGC 4CM2A 2B7BB 3ZZRA 5CZVA 1NMEB 1Q8BA 2WCXA 4O4RA 3KLIA 1SUQB 4GRSA 4DV4J 4PXDA 4ZOSA 2XLIA 4KRWA 4AQYJ 4CRJA 2YNGA 1U26A 3IMQJ 2JLGA 2JFDA 2ASYA 2YKNB 3NAIA 4QIEA 3TEGA 1P27B 2OD6A 4WIQA 2FY8A 2DH8A 4OJHA 4RJVA 4ELVA 3C16A 1QE1A 1AYEA 3I4HX 1F2GA 3CW2C 4NRTA 2BJ7A 2AEJA 2NSBA 4B02A 3JTNA 3NOGA 4USWA 3HHLA 2L48A 1EIYB 2BW2A 1QDUB 2JX2A 3UNYA 2YKPA 2VJUA 5ETMA 1RWNB 2IA0A 1KONA 4KR0B 1EETB 3HM9A 1RT1A 2BRLA 5KG6A 3G9CA 3DOKB 3HSZA 1FHTA 5D8HB 3ET6B 2IM2A 3CDWA 2MKCA 4X64J 2GW8A 3EMTA 2QLWA 3CVKA 3GV7B 1LK5A 5E3QA 3GR1A 1NM2A 2D3UA 4FVMA 3RJMB 1MW7A 1H7WA 1S4EA 2B9EA 4U9RA 1VBXA 2F65A 1F2HA 2ZZNA 3FFIB 2GVZB 2G2YA 1V3SA 4X2BA 3QFWA 4AL5A 4BC7A 1N4LA 2A3JA 1ZM2A 1N52B 4G6VB 4O3PA 4OZJA 3HHEA 4LR8A 3WQPA 4U7UD 3WC0A 4F7VA 3CJ3A 2AWZA 2ZNYA 4OYAA 5C5JA 3CJKA 4G1IA 1S1VA 1JQGA 2QLJB 1D9DA 2Y8WA 4FF2A 2M52A 2MHEA 2KYZA 2FLOA 4LBIA 4NI2A 5BJRA 4PAAA 4DPXA 2PSZA 1DURA 2YWHA 4USIA 4GC7A 1N33J 3C6UA 2KB2A 1JLGB 4C6AA 4ZCKA 2O66A 2PMWA 1U6FA 3E01B 3KMSA 5ETRA 2YBVA 3R9LA 5ETSA 5KFZA 1WF1A 3EVOA 2UUBF 5B0DA 1NJXA 4A48A 2DGSA 1RT4A 2ZVSA 2R7VA 4P6QA 4NLTA 4USKA 2DBBA 4IRDA 1L3VA 1FRKA 1WELA 1JLFA 5L8RC 1Q53A 2YQ1A 4ETZA 1WC5A 2YWFA 2AEMA 3AHPA 3BQ2A 3EICA 3MGJA 4WIIA 2CQBA 1F5AA 3NRBA 1FXDA 4DV1F 1XEZA 1FWPA 4GKKJ 4ZPAA 2EC0A 2BJ1A 2NCKL 2IM0A 4KV8B 3L09A 3BYRA 1M5KC 1B7YB 3HSJA 5AE3A 2GHPA 2Q79A 3CO9A 4URSA 1RB0A 5T7LA 2HFVA 3DYAB 4DV2F 1WHXA 3VV2B 5IZHA 1C1CB 5C7PA 4LVOP 2ZH8A 4E0DA 2LQ5A 4MK7A 1FWLA 2Y0SD 3DLHA 1HBNA 5A8RA 3RW6A 1OJ4A 5DQIA 3WBZA 2MZTA 3TQ1A 4FS1A 3N6LA 2YNFA 1BY9A 1U1KA 5GMKa 4A8QA 1N0VC 1YVFA 5IQ6A 4KHPF 1B3TA 1LW2A 5D6GA 4MFBA 3KLHA 1V3RA 5HVGA 1VR6A 1TL1A 1Y3JA 4JI7J 3M2UA 4PR6A 4YHHJ 2XLJA 2HQFA 4MJKA 1Y4ZB 1ZAVA 4ZCLA 4YR0A 2QG9B 1HNWJ 2OHDA 5KFAA 1S49A 3H20A 1OPIA 5GMEA 4L74A 2QA4S 4U8VA 4C8YA 2V9WA 3LANA 3KHRA 3POTA 3C19A 4C11B 3DOLA 4DV5F 3VGVA 3B8HA 2EK6A 1WUUA 3VGUA 1HPZB 3D3CJ 3RZAA 3FBFA 4ED7A 3PX4A 4OLPA 4DR1J 4OV6A 2EKYA 2UUCF 2QSFA 4YS2A 4LSNB 3RR8A 4CLFA 2Z4PA 1SIZA 1QVFR 1VQNS 1NJZA 3BSCA 2A10A 2BV3A 2OGUA 4USMA 5F9NA 1IKYB 3ZTQA 1X5PA 1EP4B 3MAAA 4I67A 1YITS 1UZHA 1RTIA 2J9DA 4DSKA 4F4KA 3D54A 5K5MA 2U1AA 5HBMA 4P2XA 4DQPA 7FD1A 3IWXA 2OPRA 2AX0A 4MKAA 1BUXA 2DNHA 4GKJF 3AXMA 5G0RA 2ADBA 1KOOA 4LFBJ 3PHEA 4O0IA 5DM6Q 2HHPA 4P2MA 2ZVIA 4BDPA 2H9ZA 3HF5A 1VRUA 2O1PA 2B0GA 3TWZA 2XYGB 5A8KB 2H5IB 2R7RA 3GMGA 3K2YA 4USHA 4O3OA 3OHBA 4UUWA 4IH6A 4ZCIA 3MUMP 4CT8A 4ICLB 4WFBQ 4RBUA 5LM7E 2J7KA 1NRKA 3W9IA 4ECQA 4DSLA 1RQ0A 3ZZTA 3HVWA 3M6XA 3TARA 1IBLJ 2OPSA 3W1YC 2UVRA 1X5SA 3K5NA 2XNQA 2HRTA 5HMYA 1TKTB 3SXLA 2XCAA 3CULA 1RTJA 1W2IA 2RE1A 4LF9J 2ZE2A 1WC6A 5FLXY 2KU7A 4OX9F 2Z8QA 1Y5LB 3R1LA 1VK3A 3PACA 4M5HA 1FKPA 2PN6A 3C15A 3Q83A 4B3MF 1RT6A 2MY7A 4DS5A 2OEJA 1FX4A 3MM9B 2DPIA 4B3RF 4FYXB 1D8ZA 2V6AA 4EBEA 4K2JA 2HNYB 5IT4A 1F9FA 4C9DA 4A8WA 1JIHA 2PEBA 4OFZA 2FJWA 4DX7A 1X4GA 4AL6A 4J9QA 3JSRA 2C2MB 2VFVA 2VICA 2FHJD 2JVOA 2M7SA 1RLDA 5IT9U 4IG3B 1SB6A 4NLXA 1HMVB 1Q86T 2VBYA 3EZUA 1GTEA 2CA9A 3AJ1A 2C2OB 1KQSR 4FNHA 1A7GE 2K7KA 3PW5A 3BO2A 4QYRA 2R42A 1RP5A 4I6YA 4E8UA 1KC8T 3R7NB 4OI1A 3D4JA 2GVDB 2R8JA 2XULA 2ZH6A 2J76E 3KLEA 1E6YB 1KHWA 5E0OA 2OMOA 4DG1A 2ALYB 2D1CA 4YR2A 4FYYB 2ZFHA 2AGPA 5ETNA 3T19A 3BGLA 4DQQA 1CULB 3B4MA 1UWBB 2BYCA 3Q0AA 1VBZA 2R7UA 1U0SA 1RWOB 3EXYA 4HT5A 1F1BB 2CJBA 4C48A 1BWEA 4H4OB 2UXBJ 1E6VA 2W2QP 3G71S 4DLGA 2YQ3A 4FBUA 3TAQA 2B4OA 3VAKA 1S6QA 2HNDB 4NZ0A 4OX6A 4BCAA 3D67A 5HMWA 2AP6A 3O2IA 3MFHA 2BXJA 4CP5A 2C2DA 3DCAA 2ILYA 4GO7X 1MWZA 2DHSA 5J1EA 4RW9A 4RNFA 1NCLA 1CJUA 1PC5A 3OPKA 3SSQA 3SV4A 3NL0A 1A9NB 2DJWA 3IR6B 4UOFA 5GAEI 3R5DA 2ROEA 1NKCA 2R7OA 4ZITA 2QMXA 3CCES 1SVDA 2YWKA 5EWFA 2FB0A 2V4JB 2BJDA 3CJ8A 4Y6IA 1FKOA 3MCNA 3L4BC 3BGOP 3M1VB 3IG1B 1F60B 4ECUA 5HATA 4AL7A 2HS0A 5B7WA 3OR2B 4P72A 1HHTP 1VHFA 2AEFA 3R3TA 2KZMA 3K17A 1I94F 2AX1A 1RJJA 1BQMB 3CF5Q 2C2ZB 1W2BR 4O44A 1UVKA 3V6HA 2OKQA 1O0PA 1JKHB 1FTRA 1X0PA 1RCOB 1DJ0A 2MKSA 3HFZB 3G82A 5JXSA 3ILIA 4ZHRA 3MR5A 3W63A 5KG3A 3ZZPA 3SZ2A 3DRPB 3HFKA 2OPPB 1U1OA 2MKJA 2LA6A 4CLUA 4TY9A 4UY85 2VG5B 4GVBA 1P1TA 3D0HE 4EFAC 3N01A 3QJPA 5D78A 4LF8J 3M8QA 1S9EB 1YBAA 4ANCA 5HMZA 1DTTA 1EKSA 2VG7B 1FKAF 2EFVA 3GWCA 4NLPA 4CLSA 3QO9A 4EBCA 3KDOA 1FO1A 2OEKA 3H8YA 3CWJA 3KJNB 3TAPA 4ED8A 4HDHA 1M5PC 2E7WA 4JV0A 3GG0A 1RK8A 3ETOA 1M90T 2XNRA 4LR7A 2GV1A 1IXKA 3DLKB 3TZYA 3U1NA 4C0HA 4CO1A 4LSLB 3JTOA 5KT6A 4TYAA 4WF9Q 1S0NA 4X4RA 2GQ2A 4DUTA 2I2YA 2VDIA 4LVNP 5J2MA 1WG5A 1C1BB 4BS2A 3TJ8A 2E5JA 3V4IB 1LKZA 3EGNA 5HN0A 2PC6A 2HFOA 2AU0A 2QT7A 4MYTA 1NK4A 3L7OA 1RKJA 3DRYA 5A0YA 1AXQA 1URRA 1ZZFA 2V8VA 5HVFA 4ECTA 4DR3J 3TVKA 1MWYA 3SV3A 3OTDA 2OI2A 3ZZ0A 1KFDA 5F8NA 5KG2A 4FXVA 4WFNQ 4CIOA 2SXLA 3OL7A 2XYHB 3D3BJ 3GYXB 5B0CA 4WWSA 3MEEA 1HQUB 5I42B 4KGVB 2N7YA 2WSEC 1DLOA 5LT5A 3LGHA 1S6PB 2J9EA 3Q2SC 4F26A 1D9FA 4YY3F 3CGIA 4L6V3 5KOWA 4MAKA 5FIIA 4NCGB 2IYIA 2ZBIA 1WC4A 2E5HA 1TR0A 3QT5A 4Q5VA 4LSZB 3CUNA 5IS2A 2MLXA 4KB7A 4U95A 4ENOA 2W4CA 4R25A 2FVQA 5SUHA 3J81Y 2V2QA 2IHR1 2FQQB 4JI3F 1G7CB 3OHAA 2HQ3A 2MZQA 3MHYA 5E3CA 5D3GB 1L3UA 2HK3A 1VQPS 2VH7A 2N4CA 3J7YU 4JI4J 1R8AA 3ENAA 4DI6A 2BVZA 4RW4A 3FEZA 5ETQA 3NMRA 5CYQA 4V19X 2OP5A 3QRQA 3NOCA 2ZDOA 1VCTA 1NSAA 3IRXB 3EPIA 5LMNF 3FC9A 2PMHA 3MMJA 1Q82T 2ZBPA 1AUSL 1SKSA 1VFJA 4WYLA 1FJCA 4DV6J 1VK8A 5AE2A 4KE5A 2W9BB 2F7VA 2YH0A 1HNXJ 5KFTA 3NGSA 3CEDA 1HR0J 5L1KA 3K8VA 4B3SJ 3JYTB 3DI6B 3BH7B 4Q44A 2V2VA 3OBIA 3HT3A 4OYOA 4DXLA 2FVCA 1UP1A 4CLTA 3BSNA 4OQJA 3HP6A 1QJHA 3G86A 4OHXA 5HMXA 4RKUC 3MEDA 2L3MA 1JLBA 3M9NB 4A8YA 1XR6A 4NLGA 4WFZA 4ER8A 1U6ZA 1SV5A 1V5IB 2CNLB 1CG2A 3UPFA 2K2PA 4M5DA 2YKOA 2VHGA 1N5YA 2EFOA 3RYLA 3PW7A 3FK4A 1PJ7A 1IKWA 4Q7AA 1ZA1B 1RAHB 3GCXP 4PWDA 3M8PA 4LRBA 2MTLA 4QU6A 2H5EA 4DV3F 3BQ0A 2VQEJ 3NAHA 4P52A 2GZOA 3G87A 3W2WB 3T6BA 1IR1A 2V0NA 3CCMS 4RW7B 3OLBA 5JMNA 2F40A 3DC2A 3MR3A 5EWGA 2W4DA 4EO8A 4YFUA 4EZ9A 2E1PA 4C8KA 1APSA 4OX7A 3D6FB 1UA0A 4HLBA 2ZM6F 3KG4A 5IWAF 1NDPA 3V81A 1VC6A 4JI8J 2UUAF 1BE4A 1HNVB 4Y2CA 3QAEA 5LL6d 1AFIA 5F0WA 3TZZA 1FTCA 3AH6A 1RGVA 1XN9A 3FEXB 2HLTA 2VOOA 2GO8A 1UFLA 1WEXA 2BMBA 1RWMB 1F5BA 4ELTA 2EC2A 2QIFA 2ZUGA 4OI0A 5KFUA 3G4SS 5FDLB 2BEFA 4FYVB 2G4BA 3T1YJ 3MUVP 2ZH4A 4HACA 2JEFA 5EDWA 3JQJA 2R7XA 2QE5A 3KXDA 2LVWA 4U6PA 2G13A 1TVRA 3MDFA 2M4MA 4OZ5A 2HWHA 1S99A 2W25A 3QPIA 1EARA 4CWBA 3IN5A 3MMAB 4NYOA 2FHMA 1J5OA 2IMOA 1R0AA 4G1QB 5K8OA 1YG0A 4I2PA 3UW1A 2XM3A 2IRYA 2LQJA 2KFYA 4DR5J 1U1LA 5ITHA 2RS8A 3Q8PB 3H5YA 1RTZA 3BQ1A 3I0RB 1KS2A 3CCVS 3NS6A 3MMCA 2HURA 4F3OA 1DRZA 1RWXB 3BR8A 3DRSB 2ZNZA 3H2LA 4A8SA 2WOMA 4IOCQ 2EG1A 1RWWB 3CD0A 1Y5NB 1TMMA 3UD5A 1X4DA 2RKIB 3LGNA 4JI0F 3TW0A 2NR0A 1WTFA 4XAKA 5HANA 2YKQA 2MKYA 2LXUA 3PW0A 5EX0A 3Q86A 1S12A 1CJVA 2YKNA 1TFYA 1BWVA 1YKWA 2IYGA 4DR4F 5H9EJ 3VAHA 3HT0A 5DLGA 2Z2LA 4PG6A 2Q43A 1UVLA 1T94A 3FMBA 2R4FA 5E3AA 4NWBA 3PYGA 4ZVTB 2KHDA 4DQRA 4L76A 4TN2A 3B82A 4B17A 5HLFA 2V5HG 2AD9A 4WZMA 3R5AA 1PJ5A 2KM8B 3ETMA 1FF2A 4DZDA 3CJ0A 2A2DA 1FE0A 2KT5A 4ID5B 4B9SA 1BGXT 2WVBA 1FT8A 5DRKA 1LXJA 5AT1B 4I0WA 6AT1B 5C24A 3ADAC 2NXEA 4KY3A 3VAIA 1MG7A 4OYIA 1BD6A 1WNEA 2V8HA 3NXZA 3R6LB 3KK3A 2XMVA 2OELA 3FVYA 3OL9A 1IKVA 3ZZUA 3IO1A 3R97A 3AD9C 5LJ3Y 2VBXA 1FJGF 4X66J 3IXQA 2FJDB 3NBPB 5F3TA 4U8YA 4E2FB 3ZTPA 1S1TB 3CMQA 4RNMA 4HVZA 4WXWA 1MU2A 1U8SA 4NCBA 3BBFA 3R7BB 1MWQA 1JMTA 5A8WB 1HW8A 1QTNB 1YJ7A 4PXEA 5FJ4A 3NGKA 4OI2A 3KLVA 4FVCA 3PVXA 4JI1F 5E3RA 5DG8A 1OIAA 2EK1A 3AD7C 1QSSA 1T9XA 1HBUA 4LRAA 4PQUA 3GSDA 4R8UA 2R3VA 3RRHA 3MAQA 4B08A 1NK6A 2XSJB 4PUOB 1YZ6A 4CNZA 2XLKA 3UVJA 3LP1A 2GNKA 2V4QA 4QW8A 1N36F 2NQPA 1KD1T 4I6WA 3GFHA 3K5LA 3OQ2A 1K0TA 2GGPA 2V8DA 1XMOF 4EYIB 2AKWB 4UT4A 3OXFA 2BUNA 2MSSA 3Q8UA 2ZD1B 3JAMU 5KTQA 3IWNC 5HI7A 2QZ8A 3QT7A 4FF3A 4H4MA 2C42A 1HFEL 3W9HA 3BN4A 1R3NA 4GMKA 4DR2F 5KFEA 1KLMB 2X1GA 4ECYA 3H0PA 3I56S 1FK9B 2DXEA 1WD6A 1Y9OA 2X1FA 3FJ2A 3RB0A 1RBAA 4GVLA 4C8MA 3UO0A 4MT1A 2XZTB 2RRNA 1N6QB 4ZJOA 4IKAA 2QL5B 3DLGB 2P5VA 2G1DA 4CYUB 3O8WA 4IH5A 1U1MA 2ZJRQ 4B9MA 2ZBCA 5D4PA 1OPZA 3TA2A 1LFWA 2ASLA 3NMAA 2WW4A 1C1CA 1QSYA 3V6DA 4P74A 2PT0A 2KJVA 2B51A 2V69A 1QAJA 4YB6A 4KH1B 4AFFA 3NS5A 2CRLA 3MOJB 4DV2J 2MZ1A 2KRBA 3FQLA 1DTQB 4M5MA 2DPJA 4X65F 4DHVA 2RSQA 1HHQA 2MKKA 3JSBA 1JWWA 2RQCA 3SCIE 1PGZA 4RW6A 2IBOA 4I7FB 4OHVA 2K3KA 2BQUA 1NDCA 4DU7A 3ZXWA 1TV6A 2IRXA 3TRGA 2BE7D 3W61A 4X62F 2CPIA 4Q2LA
chains in the Genus database with same CATH topology
2IIHA 4FDFA 2EEYA 1EKRA 2IDEA 3JQKA 2EKNA 4PYAA 3JQMA 4PYDA 2OHDA 1EKSA 3JQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IIH A;  4FDF A;  2EEY A;  1EKR A;  2IDE A;  3JQK A;  2EKN A;  4PYA A;  3JQM A;  4PYD A;  2OHD A;  1EKS A;  3JQJ A; 
#chains in the Genus database with same CATH topology
 3DDN A;  4DL0 C;  1NPK A;  1S0O A;  3CJQ A;  2PI4 A;  4X84 A;  3AAW B;  3P4U B;  3LP0 A;  4CLL A;  3OT9 A;  1KVJ A;  5FD1 A;  4DWI A;  4UY8 T;  2NUU G;  1GMU A;  1FRI A;  1GXU A;  2CNO B;  2XY5 A;  4CI0 B;  1TAQ A;  3MM5 B;  4UTG A;  3KLF B;  2M88 A;  4PAB A;  1LWF A;  1X4C A;  2CDR B;  1HPZ A;  2HKE A;  4CO4 A;  1NSP A;  4A47 A;  2NZ4 A;  2I8E A;  3NCQ A;  4QZV B;  3M9O B;  2R7W A;  2ASJ A;  2NXJ A;  3BF4 A;  1RAO A;  2JLE A;  2J9C A;  4PG5 A;  3D68 A;  2CQ0 A;  1GEH A;  3D6M B;  4ZVS B;  3A12 A;  1XK8 A;  1TMJ A;  4TXS A;  3VWS A;  4IO1 A;  4YN3 B;  3UDE A;  1JJ2 R;  2UVU A;  2DO0 A;  1UCN A;  2LU2 A;  1WEY A;  2MGZ B;  2E9T A;  1B0P A;  1X4F A;  3QLH B;  1IKY A;  5LXY A;  2CQD A;  3ZNJ 1;  2F4F A;  2Y1L B;  2CPH A;  2Z0G A;  3ILL A;  1RHJ B;  2EFN A;  2O5D A;  1YJN S;  1WEZ A;  3UN3 A;  4M5J A;  3OFF A;  1TKZ A;  2N3L A;  2IVM A;  2P9E A;  1ZM4 A;  4BBY A;  4O3Q A;  3GJR B;  1FES A;  1FWK A;  2MLY A;  3S1T A;  3LF0 A;  1R7I A;  2ROG A;  3CJ4 A;  3DXB A;  1SPB P;  1U1R A;  4YR3 A;  2HLU A;  1DQ9 A;  2EFP A;  5HQL A;  3ITH A;  3QRR A;  2ZJQ Q;  3S7R A;  5KFR A;  3TUJ C;  3UD4 P;  2UU9 F;  1TL3 A;  3N6N A;  2CVI A;  1S79 A;  2RU9 A;  4GO5 X;  3MM8 B;  4ZCM A;  3DRX A;  1WC0 A;  2MLZ A;  4IDK B;  4Y34 A;  3VVU A;  2WZ1 A;  3K57 A;  2F3J A;  2P9G A;  4N47 A;  2MEW A;  4QU7 A;  4J91 A;  5KFH A;  1U0H A;  1OO0 B;  3QJJ A;  2V9K A;  1YJU A;  2EBE A;  5M2U A;  1MRO B;  2MZS A;  5DET A;  5B0A A;  3W62 A;  2KN4 A;  1UEU A;  1WI6 A;  5CYM B;  5ETP A;  1HWK A;  3MPD A;  1GXL A;  1VJQ A;  4F8R A;  2NZC A;  7AT1 B;  4ZP9 A;  1VYA A;  3DLE A;  4F02 A;  4AYB D;  1FRX A;  1HA1 A;  3KLG A;  3CC7 S;  1U09 A;  2KT2 A;  1PBU A;  3O3L A;  2XB2 D;  5AJ3 J;  3KK1 B;  3T1H F;  2BW7 A;  5J2N B;  3RB6 A;  5D0R A;  2QL9 B;  3NY0 A;  3G6V A;  1RT2 A;  3LTO A;  5K8P A;  4B3M J;  3L9Z A;  2AGO A;  4WCE Q;  2DRB A;  1NHU A;  4NXN F;  1XR7 A;  4KKO A;  1HAR A;  2L9D A;  3HVT A;  5EUH A;  1N8R T;  2RF2 B;  1ZM9 A;  1CJK B;  1UTA A;  4F25 A;  2W9A A;  2HS3 A;  5I3U B;  1X4E A;  1YQH A;  4EWT A;  1S9G B;  5CZX A;  5DZ7 A;  3GYG A;  5RUB A;  2E7X A;  1YJT A;  2IFX A;  2BJ3 A;  5SZT A;  1FCA A;  4XO0 A;  2DGX A;  1X9M A;  3GB0 A;  2A0F B;  3DRR B;  3D28 A;  1H7X A;  2A6M A;  3G96 A;  4LF2 A;  3A13 A;  1AW0 A;  2QEX S;  2WVD A;  3R8Y A;  1UVN A;  3ELH A;  4ECX A;  2VA2 A;  2P9C A;  4Y3C A;  1PSD A;  1VMB A;  1T9W A;  5IV3 A;  2GQC A;  1JJH A;  2FUG 9;  3MMB A;  1JLC B;  4BWJ A;  4XTT A;  3R5C A;  1RKI A;  1RT3 B;  4NXM F;  1SJ4 P;  2HFS A;  4JI2 F;  3GPA A;  3KUE A;  3KYL A;  3ZTR A;  1HNI B;  1R31 A;  4FPR A;  1F9H A;  2F8M A;  1PAU B;  1X8D A;  4LF5 J;  3PJW A;  5DS7 A;  2RS2 A;  3PG9 A;  3HD2 A;  2XMT A;  1L3K A;  3CJ5 A;  1TZ0 A;  2MQP A;  4N7T A;  4AT1 B;  2W01 A;  1KQF B;  1Y10 A;  1T9T A;  1EX8 A;  2VZ9 A;  3UCG A;  4KFB A;  2OPQ A;  5C42 A;  4R0E A;  3IS9 B;  2DR7 A;  4IRC A;  1R89 A;  1YX2 A;  1FA0 A;  2CAJ A;  2E44 A;  1FEH A;  1NSK L;  2WW8 A;  2N3O A;  1KOH A;  4YOE A;  2H65 B;  1ZH5 A;  2DNG A;  3G6E S;  1TFW A;  4O4G A;  4EI2 A;  4CO5 A;  1UET A;  2YNI B;  4UQT A;  3AFG A;  1R6Y A;  4ERD A;  1RWV B;  1HI1 A;  4NRU A;  3LGM A;  1T0T V;  5B09 A;  4CLP A;  4TU7 A;  3SQG B;  1PJ6 A;  2D3O R;  2WVF A;  1R0B G;  5IXU A;  3WZ0 A;  3M1V A;  2AJ0 A;  2FC8 A;  3N28 A;  1UFK A;  1IKX A;  4IFV B;  1FXR A;  4NPO A;  1O5J A;  3OTC A;  2WVE A;  3LPY A;  4ZVH A;  2J5A A;  1LW0 B;  2DR6 A;  2RAQ A;  3IC1 A;  3IM9 A;  1GK8 A;  4CDI A;  3NLC A;  2XMW A;  4FP9 A;  2W7P A;  3QID A;  3RAX A;  2R7Q A;  4J9O A;  3HJV A;  2HZC A;  3D9B A;  2F9J A;  3OVB A;  2JZ5 A;  4JB8 B;  2BM0 A;  3M30 A;  4QIF A;  3CDA A;  2LDY A;  4TQR A;  1D8Y A;  4FYD A;  2CAD A;  2AGQ A;  1SJ3 P;  3Q8Y A;  4Q0B A;  5CD4 H;  2DXF A;  1SC6 A;  1JX4 A;  4YEA A;  1LWE B;  3ZC4 A;  1O8B A;  1YZ7 A;  2C3M A;  3R6G B;  3KNG A;  1CSJ A;  3OVS A;  4K4V A;  3GCW P;  2B8P A;  2E5I A;  3PV8 A;  3ENW A;  3T3F A;  1ELO A;  3VQS A;  2Z57 B;  1KSP A;  1FFS B;  2LQ9 A;  3AQP A;  2VFU A;  4DZ6 A;  3R2C J;  5H9F J;  2HIQ A;  2JEG A;  3C66 A;  2RRB A;  5CQG A;  2ZBR A;  2F1F A;  5GAG U;  3TUP A;  2VU5 A;  3ICL A;  3GIJ A;  4M5I A;  4B9V A;  2V4R A;  3QZ7 A;  4WJB A;  1RWU A;  1ZET A;  1KHV A;  1RTH A;  3SEO A;  1IQZ A;  2VQF F;  2CPF A;  2RHQ B;  2J0S D;  1RT5 A;  4F0K A;  4NA2 A;  4P75 A;  2CVE A;  1NDK A;  3QAT A;  2I5J B;  4N8O A;  2XHC A;  1K44 A;  4KHR A;  1P6T A;  3CCL S;  3H40 A;  3OL6 A;  5KT5 A;  2H54 B;  2DHX A;  2C1E B;  2Y8Y A;  1BQN B;  1V5V A;  1RAJ A;  4DQI A;  1IVZ A;  1TK0 A;  2XG8 A;  3DXS X;  1XR5 A;  1RZM A;  2GJF A;  1J5E J;  2UXC F;  5D77 A;  4DR7 F;  4ZN3 A;  5CAA A;  1UJ6 A;  3F56 A;  1KTQ A;  1HLW A;  2MQM A;  2RIJ A;  1RTD A;  1Z2Z A;  3M2R B;  5DDP C;  2IAJ B;  1HYS B;  3FGV A;  2GIR A;  3ZNU A;  4K59 A;  1N5V A;  5B0E A;  2DKO B;  2PO4 A;  1UEV A;  5I42 A;  5I3Q A;  1N5T A;  3MEG A;  2W9C B;  2RH3 A;  1HQE B;  4NYZ A;  2JJ4 D;  2VG6 A;  2WTF A;  5H9E K;  2X7I A;  3W2V A;  4DF8 A;  2HVD A;  3TAM A;  2Y3Y A;  1Y7P A;  1S1W B;  2A1B A;  4NEZ A;  2FYX A;  3M7V A;  5L1I A;  3W5X A;  1CJT A;  2HBZ B;  2MQO A;  3GYN A;  2LP4 A;  5KT3 A;  2KI2 A;  3OD2 A;  3K0J A;  2K8G A;  1UJ5 A;  5DZ6 A;  3UN2 A;  2XO6 A;  4C8Z A;  1NJI T;  3DLB A;  3LPE A;  3KLI B;  2ZC3 A;  1RYS A;  4KH0 B;  3CD7 A;  2RIL A;  2RT3 A;  2Q66 A;  1IJE B;  3MM6 A;  2YNG B;  3T5J A;  3F73 A;  1T9U A;  2QSW A;  3EDR B;  4YB1 P;  3US5 A;  3P6Y C;  4F0H A;  1QLN A;  1DBD A;  3M8W A;  2WBM A;  5AXM A;  1P8G A;  1K9M T;  5EGY A;  2W9B A;  3C16 B;  3IWL A;  5HRO A;  1QE1 B;  2KTQ A;  4JI5 F;  2AT1 B;  3A3O B;  5LMN J;  1BMQ B;  3HHL B;  1KVI A;  2YTC A;  2BM1 A;  4X64 F;  2JLF A;  1VHI A;  1EHW A;  5JJB A;  3WHI A;  1IM4 A;  3OVA A;  3PKM A;  3MUT P;  1RT1 B;  1M5V C;  2KVI A;  1K1Q A;  2FVP A;  5ETV A;  2M2B A;  4YB5 A;  2BOP A;  2VDH A;  3HHK A;  5D4O A;  4DR6 F;  4N77 A;  4QR1 A;  3QIP A;  1IBC B;  5KFG A;  1SI9 A;  4P9S A;  3ZO7 A;  4ZMM A;  1SQG A;  5IT9 Y;  4L72 B;  5ETK A;  1RA6 A;  2AW0 A;  2HWT A;  2RU3 A;  5DDO C;  1NND A;  3MZI A;  4F4Y A;  5D15 A;  3FCW A;  4KO0 B;  4IOA Q;  3UCU P;  3CD6 S;  5EX3 A;  4DV3 J;  1N33 F;  3F44 A;  4ZLJ A;  4OYZ A;  4CLZ A;  1MNE A;  3CJK B;  4DCJ B;  1KFS A;  3AJD A;  1S1V B;  1Q8I A;  2ALZ A;  1PYO B;  5BR8 F;  1KDN A;  1IBM J;  2KRR A;  5CHC B;  2CZ9 A;  3CCS S;  3IR7 B;  3C6U B;  5HP1 A;  1GX6 A;  3QYY A;  2ZM6 J;  4KGZ B;  4O23 A;  3M6W A;  1DFD A;  5IWA J;  1X0F A;  1CVJ A;  1NH8 A;  4USV A;  1B7F A;  1TP7 A;  1RT4 B;  1VS3 A;  1JLF B;  2ZH1 A;  2O3D A;  2J6T A;  2VL1 A;  2HS4 A;  4C3M A;  4LFC J;  1T3O A;  3HSD A;  3UDC A;  3MMA A;  3MR2 A;  2VKZ G;  1WKK A;  5KFP A;  2A6O A;  4K4S A;  4TLQ A;  5BYS A;  3KK2 A;  4LBH A;  1NXI A;  1FJ7 A;  4ED1 A;  3I9V 9;  4J9L A;  2XO7 A;  4TVA B;  4DEZ A;  5AXL A;  2GO9 A;  2YVS A;  5T7L B;  1RAG B;  2YNH A;  1WDD A;  3K5O A;  1H98 A;  1RHQ B;  2M0G B;  4RUA A;  2F9D A;  5KG1 A;  4RO0 A;  1G2E A;  3MPU B;  4U67 Q;  4LF4 J;  3R5B A;  2ACM A;  5A8R B;  2WK4 A;  2CJK A;  1WC3 A;  2YNF B;  4XDD A;  3AQO A;  6FD1 A;  2ZZT A;  3VAF A;  3FEY B;  3TZW A;  4IQM A;  3D0G E;  4M8L A;  2L41 A;  4Q2M A;  5DG9 A;  1HNW F;  3RBZ A;  4LFA J;  2E9Z A;  1FRM A;  1WKJ A;  1LW2 B;  1KEK A;  2MQN A;  1OY9 A;  4MFB B;  3KLH B;  3U27 A;  3T41 A;  4MTP A;  1TL1 B;  3GR0 A;  3FSY A;  4PYD A;  3M2U B;  3LAM A;  9ATC B;  4ED3 A;  4DSJ A;  5CD4 A;  5IOL A;  2IDL A;  5THW A;  1MML A;  1NHV A;  2XTJ P;  5CYJ A;  4Q45 A;  3BO3 A;  3OR1 A;  3KUG A;  2MYF A;  1TU0 B;  3EWG A;  4I1T A;  3DHX A;  2B4V A;  5J1N A;  2LYV A;  4DR1 F;  3THV A;  3POT B;  3C6T A;  4WE1 A;  1T95 A;  3A3P B;  1N5S A;  3DOM A;  3DOL B;  3L95 X;  4PXC A;  4Y2A A;  5KFB A;  4HI2 A;  1TAU A;  3BBB A;  5LXR A;  3OFE A;  1AZS A;  3G6X A;  3GV8 B;  4J5O A;  2QN6 B;  3TO8 A;  3VAL A;  5E7O B;  1HIY A;  2HZV A;  3MOZ A;  2MXY A;  1HI8 A;  2XZW A;  1HQ2 A;  4QJV A;  2J0Q D;  3LP2 A;  2ZBQ A;  4TLR A;  1RIS A;  3MAA B;  2NYI A;  1RTI B;  3FBE A;  2ZWP A;  2ZKU A;  1N34 J;  5HBM B;  3RUB L;  1MMD A;  5A8W A;  3KOA A;  2M70 A;  2DO4 A;  2OPR B;  4DUY J;  2QGF B;  2FJV A;  2B3T B;  2HVI A;  4KYZ A;  4AD6 A;  4NEY A;  3EVM A;  5G0R B;  2BAN A;  1WOO A;  4EU0 A;  4QIW D;  4RBV A;  2QLB B;  4CO2 A;  4UQG A;  2JNJ A;  2CQP A;  3CJR A;  3F41 A;  1VRU B;  3A8I A;  2QLF B;  3PYE A;  4C0O C;  3MFI A;  4KIA A;  2DGW A;  3BGR A;  5EN1 A;  3TZX A;  3J7Y I;  1IBL F;  3SCK E;  3ULH A;  2XSJ A;  2K7J A;  1K1S A;  1ULR A;  1SQF A;  3DMJ A;  1M5H A;  2ZOF A;  4CTA A;  3FZ2 A;  2XBP A;  2DNZ A;  4DN0 A;  2PA3 A;  2W2O P;  5GAD U;  1X31 C;  1Y00 A;  4LF9 F;  2FIU A;  3QGG A;  3PRB A;  2V67 A;  4DSI A;  2FJX A;  3TVY A;  1S97 A;  4XDC A;  3RAM A;  2OPS B;  1XNR J;  4QQB A;  1I1G A;  1N36 J;  4MIB A;  1FNX H;  3WDO A;  1RTJ B;  1SBR A;  4Q8F A;  2ZE2 B;  4IG0 A;  2QO3 A;  3KHL A;  4EEY A;  1XMO J;  1U2F A;  1FFG B;  4M5K A;  5J2Q A;  3BPD A;  1FKP B;  2HRY A;  1WOP A;  3C15 B;  4LBP A;  4F4Z A;  1RT6 B;  2R2R A;  3PYD A;  5F0U A;  1NDL A;  1OYE A;  1ZTT A;  2DH7 A;  3M6V A;  5KFL A;  2BR0 A;  5K14 A;  3CCQ S;  2HW3 A;  3TVZ A;  1TQL A;  4DR2 J;  1Q8L A;  3TA0 A;  3MTJ A;  2P6T A;  1QUP A;  2B4U A;  2RDI A;  3PY8 A;  1SH3 A;  3TA1 A;  2KFN A;  2DIU A;  3T6J A;  2QA4 G;  4W92 B;  3VGS A;  3B54 A;  2LFV A;  4IO9 Q;  4ED0 A;  2ASD A;  2G2Z A;  3WX8 A;  2W8L A;  1S1X A;  4WYW A;  4N76 A;  4YB7 A;  1NK8 A;  2CJQ A;  1HBM A;  4L73 A;  3C8Y A;  1U6B A;  2FVS A;  1X9W A;  2G0J A;  2W2P P;  1MN7 A;  1TL7 A;  3D6H B;  3CIZ A;  4BHQ A;  5BXI A;  2DK2 A;  1VRT A;  2VAS A;  2DNR A;  3TR5 A;  3GE9 A;  1REV A;  3MEK A;  4TY8 A;  3HK2 A;  1VQ7 S;  4LMZ A;  5HO4 A;  3W8P A;  2P2C B;  5E5N A;  1C4C A;  1CEZ A;  2DVI A;  1Y3K A;  2VA3 A;  2VUG A;  3KLE B;  4PYA A;  1SL1 A;  4C4W A;  2UXB F;  2DYA A;  3PJ9 A;  4P7V A;  4ZVQ B;  3PR5 B;  4DG1 B;  2QJ3 A;  2VOP A;  4RL1 A;  1X60 A;  4ZVO B;  1JLE A;  3H25 A;  1EB0 A;  3PW2 A;  2C3P A;  1X5T A;  5IC4 B;  2M8D B;  2DR8 A;  5A6W A;  1UVI A;  1E6V B;  2MMY A;  2PD1 A;  4X4T A;  2DIS A;  3N0V A;  2IC3 A;  5HVH A;  3CD5 A;  4J9S A;  3AOB A;  2G0C A;  3D66 A;  4ATN A;  1OYD A;  1HNZ J;  4RX6 A;  1JXE A;  1VQK S;  3FBC A;  1R0C B;  4FKX A;  1ZM3 A;  3UR3 C;  1NZA A;  3QWP A;  3MTK A;  5J1E B;  4RW9 B;  2GHW A;  1CJU B;  3GIM A;  2B6A A;  1H2V Z;  4AND A;  1FJE B;  3F0N A;  1YRX A;  4JBC A;  4PCQ A;  2CUY A;  2AHO B;  2MZJ A;  3G8Q A;  2ZEJ A;  1FNO A;  5J1P A;  3LH2 S;  4RUB A;  2WON A;  2MPU A;  5KG7 A;  1LWC A;  3V6J A;  2XWY A;  5KOX A;  1T05 A;  4ITS A;  4A8O A;  3LAK A;  5DDQ C;  3PZP A;  2XCP A;  1YJ9 S;  1OSD A;  1HI0 P;  3QWU A;  3DHW C;  4RWX A;  3W5Y A;  3EVW A;  4ILM A;  3D0I E;  3H4D A;  4F4W A;  1M1K T;  2I0X A;  1BHN A;  1TUG B;  2VKR A;  4Q8E A;  1L5U A;  5H9F K;  1FRH A;  4DJB A;  4O44 B;  3V6K A;  2LLZ A;  3M2V A;  3EM1 A;  5CXT A;  3GIL A;  2QMW A;  1HWI A;  4HTI A;  4LF8 F;  3CE8 A;  3G82 B;  4ZHR B;  1T03 A;  1YI2 S;  2J8S A;  4ZP7 A;  3CT9 A;  1P9Y A;  2VJV A;  5CH7 B;  1T9V A;  1NAQ A;  2RJZ A;  3V4M A;  1KTV A;  1QAI A;  1DY3 A;  2B5J B;  1G6B A;  1ROF A;  2UU9 J;  2C2E A;  2ZOG A;  4ZLL A;  3PIP Q;  2V94 A;  2KVQ E;  9RUB A;  2M3D A;  1A0O B;  1TK5 A;  1NZ8 A;  1DTT B;  3OSP A;  4NCA A;  4X4U A;  3I5B A;  3DM2 A;  2QLX A;  2DCU B;  2Q3P A;  3L7P A;  4HH1 A;  3KJV A;  2MZR A;  3B4D A;  3JQM A;  2HBQ B;  3QO9 B;  4DV7 F;  5LSO A;  4ZIV A;  4ED5 A;  4ZPV R;  4RUC A;  1PO6 A;  3MCM A;  1QAX A;  4Y2K A;  3RTV A;  3RAQ A;  2VPW B;  4X4S A;  1WJ9 A;  1SL2 A;  2C28 A;  1SC4 B;  4DUZ F;  4DX8 H;  3NWG A;  2IMW P;  3QZ8 A;  3FUY A;  4LR9 A;  2DTJ A;  3T1H J;  3BV8 A;  4KTQ A;  1VBY A;  2ZIT A;  5LSR A;  5KT4 A;  3Q8R B;  3K89 A;  4NXN J;  3O44 A;  1NJW A;  3OXL A;  4CH0 S;  3LQV A;  3WIU A;  3UQS A;  3QGP A;  4DF4 A;  4ILL A;  2DHH A;  3LOU A;  1H74 A;  5BYQ A;  2AYE A;  3M6U A;  5C25 A;  5A2Q Y;  1XMQ J;  5A0Y B;  1YLX A;  2P8I A;  3KKF A;  2LXF A;  1K73 T;  2B9X A;  3CC4 S;  1S1U A;  4RWW A;  5B0G A;  1IQT A;  3EE3 A;  2R9L A;  1JLC A;  1RT3 A;  3U02 A;  4OYB A;  4OYW A;  1RWK B;  4ZS6 A;  3A3N B;  3MEE B;  5M2R A;  4K0K F;  2VPY B;  4Y0F A;  1DLO B;  2XMA A;  1S6O A;  4O3S A;  3ZZY A;  2ATL A;  4EYH B;  2FHO B;  4NXM J;  1HBO A;  4ZPW R;  1FNM A;  3C14 A;  4A8K A;  4HH0 A;  5ETO A;  3MPV A;  4A8F A;  3W7B A;  3VAJ A;  1FDA A;  4JV1 A;  5LMU J;  2V8G A;  4ZVP B;  3HHL D;  4DV6 F;  4OZ2 A;  2IRU A;  5AXK A;  1DZ5 A;  1B4S A;  4RW4 B;  5KFK A;  1JLQ A;  4Y28 C;  5CYQ B;  1HR0 F;  3PFO A;  3LA0 A;  2H3E B;  2KL8 A;  1YRT A;  1YSJ A;  3UE2 A;  1RLC L;  2WHO A;  2KHC A;  2POK A;  1FXL A;  2HQC A;  2HGM A;  3CO0 P;  2CPJ A;  3FZB A;  4PG7 A;  3K5P A;  2ZH5 A;  4OYM A;  4J9R A;  3JAM Y;  3RU0 A;  1GNK A;  1H2T Z;  2C3O A;  4Z37 A;  4ILR A;  2JVR A;  3P5T L;  1X4B A;  7FDR A;  5F8I A;  2OSQ A;  2UUW A;  4RR5 A;  3M32 A;  2DGT A;  3VZI A;  3EUN A;  3MED B;  4OX8 A;  5J2P A;  1JLB B;  1NKE A;  3ISN D;  5U47 A;  4AE5 A;  5A6P A;  4FXW A;  3BGF A;  4LQ3 A;  2GX8 A;  4ALZ A;  4RLE A;  2VQE F;  3N4W A;  3BKU A;  4DPO A;  5KFO A;  3I55 S;  2BX6 A;  4M5D B;  1N5Y B;  3J7Z 5;  2EFQ A;  1RYR A;  3BJY A;  2KXH A;  1U45 A;  2DRA A;  1IKW B;  2PEH A;  1TL5 A;  3ZZO A;  4PWD B;  4IR9 A;  4BWM A;  4R5P B;  3D1O A;  2KG0 A;  1NPP A;  3JTP A;  4W4M A;  2PMZ D;  1AB8 A;  2KZZ A;  2D9P A;  2DHA A;  4PEO A;  2VPZ B;  2RQK A;  4WFA Q;  4NE9 C;  2A2C A;  3V81 B;  1B99 A;  2VBZ A;  4IRK A;  2CXE A;  4ZVR B;  2R2T A;  4NMX A;  3QQC D;  4Y00 A;  3OXG A;  3DLL Q;  3ZTO A;  1RT7 A;  3T1Y F;  3CME S;  2RDJ A;  1HD1 A;  1VC5 A;  3I0S A;  1C0T A;  8RUC A;  4F3M A;  4UF4 A;  2MDA A;  2X1A A;  3BZQ A;  1NKB A;  1N88 A;  1FI4 A;  1W26 A;  2W8K A;  2JC1 A;  4I6A A;  2XI2 A;  4ZLN A;  3P45 B;  2FHJ A;  4M94 A;  2AJQ A;  3QT6 A;  3BYP A;  4HAC B;  3HHL C;  5KFN A;  3TX0 A;  2VQF J;  2DNK A;  3U1M A;  3LW5 C;  1PG5 B;  1JLA A;  4L3N A;  5AXN A;  4DR5 F;  4DL6 A;  1TVR B;  1FRJ A;  4C97 A;  1K0V A;  4KPY A;  1RCX B;  1YGY A;  1EQM A;  1J5O B;  5LSL A;  3GTY X;  4WK3 A;  3SDE A;  1R0A B;  3D2W A;  2IY5 B;  4I2P B;  2WSF C;  3M8S A;  1S72 S;  3HHD A;  3H98 A;  5KFD A;  4RW8 A;  4HKQ A;  2AZ3 A;  1JNZ B;  1O6X A;  2QV6 A;  2B8Q A;  2XSF A;  1ZA2 B;  2IJF A;  2IJN A;  3TX8 A;  1X4H A;  4QIV A;  1WG4 A;  4ZVG A;  2BRK A;  1KBR A;  3P3D A;  2XI3 A;  5LJ5 Y;  2PGC A;  3MMC B;  1EJ7 L;  4CLW A;  1CS4 B;  1HWL A;  3HPO A;  2BZ2 A;  2WOM B;  3PIO Q;  2WAQ D;  2K1R A;  3BGU A;  3ISN C;  4NLO A;  5E33 A;  2LEP A;  4H54 A;  1RHK B;  3OUY A;  2Y1I A;  2F8E X;  4OI6 A;  3OTO F;  1H3D A;  1Q79 A;  1CJV B;  2FZG B;  3J80 U;  1YBT A;  1YRU A;  2NLW A;  3SCL E;  1S0M A;  3I31 A;  5HQ8 A;  4C8L A;  4NAS A;  1N32 J;  1JNR B;  1SIW B;  2GJ2 A;  2HRU A;  3VAM A;  3DGP A;  1KRP A;  1KQK A;  1RU1 A;  2E29 A;  2HAF A;  1PBA A;  5HJX A;  1R8C A;  3T9N A;  4X4P A;  5HLF B;  1J2V A;  2Z56 B;  1TL4 A;  4RU2 A;  1IJF B;  2C22 A;  4NL5 A;  3QT8 A;  3R27 A;  1WAC A;  3Q22 A;  2FZC B;  1LEO A;  5F41 A;  1UKU A;  4JI5 J;  3H59 A;  1S7H A;  2JFK A;  2NUH A;  4X66 F;  1AT1 B;  3KHH A;  4M5N A;  5C24 B;  3AB4 B;  2XY7 A;  2HVZ A;  4M95 A;  3X1L B;  2DRD A;  2RD5 C;  3KK3 B;  2GIQ A;  3CSK A;  1IKV B;  4RNO A;  3EDQ B;  3IR5 B;  3HFV A;  2M5Y A;  2Y9H A;  2UXD J;  4B9T A;  3JQK A;  4W90 B;  4FF4 A;  1MU2 B;  1OQ6 A;  4WKR A;  4EMD A;  2AYB A;  4KC5 A;  4DR6 J;  3FNN A;  2J0X A;  2HMI A;  2IA6 A;  5IM0 A;  4WKY A;  4IFY B;  3MF5 A;  3HD1 A;  2OML A;  3PRV A;  2AJ2 A;  2BE2 A;  3C3L A;  5ETT A;  3I4P A;  5KFF A;  4KO0 A;  3MEC A;  3NS7 B;  1AFJ A;  1HBU B;  3NWR A;  4IQX A;  4PQU B;  2AF6 A;  5K8M A;  2BA9 A;  4R8U B;  5KFS A;  4UST A;  3D1Q A;  1S57 A;  3RB3 A;  3LAL A;  3FKB A;  3KUH A;  3UN5 A;  2H4Y B;  3UVJ B;  5L39 A;  3LP1 B;  4B3O A;  1XC9 A;  3N5B A;  2ATC B;  2NSC A;  2GGP B;  2OSR A;  2BJ9 A;  2F8H A;  3K8W A;  2ZOM A;  4JI6 F;  4DL5 A;  3EGZ A;  1U1Q A;  2AJ1 A;  1JK9 B;  2E66 A;  1C0U A;  3NCR A;  5BR8 J;  5GMD A;  1NSQ A;  3TUZ C;  4OJ1 A;  3MM7 A;  3D6T B;  2YKM A;  2V50 A;  4CO3 A;  2X51 A;  3CJ2 A;  2LDI A;  2EEY A;  1MMN A;  3KFW X;  4E98 A;  4B3T F;  3TJA A;  2ERR A;  3GFX A;  3PR4 A;  4H4M B;  1VLY A;  1N5Q A;  4L3K A;  4ZJQ A;  4C3L A;  3OW2 R;  4N56 A;  2KKH A;  2HHU A;  2EKN A;  1PIL A;  3Q2T C;  1H2U X;  3NNA A;  3B6B A;  3JSM A;  3JB9 k;  4FYW B;  4I2Q A;  1UW4 A;  4HT7 A;  1FVS A;  4ECW A;  4F4A A;  1ZZN A;  4ZN1 A;  1LOU A;  2CPD A;  4YQW A;  4UW2 A;  2DGV A;  2ZZM A;  5K8N A;  4X4O A;  3MD3 A;  1GT8 A;  3HKW A;  3HHN B;  3V6D B;  2DNM A;  2G1H A;  4DLE A;  3NG8 A;  1UFW A;  5IV4 A;  2EW9 A;  4RBT A;  1MSW D;  1REG X;  3UCZ P;  3FSI A;  4PZV A;  1SUQ A;  1S6U A;  2IPO B;  1FD8 A;  2PA8 D;  2JOQ A;  1UPM B;  4DL7 A;  1UA1 A;  1S76 D;  4DSF A;  2OH2 A;  3VGT A;  5KG5 A;  3OL8 A;  5L1J A;  2GMJ A;  4R0J A;  2I9S A;  3IM8 A;  2PE8 A;  4RW6 B;  2LA4 A;  2QA2 A;  5GAG I;  2VC1 A;  1RSC A;  3QSY B;  2XMJ A;  2IM1 A;  1TV6 B;  5D0H A;  2DNQ A;  3PX0 A;  2VON A;  5HK4 A;  2X3D A;  2XQC A;  2VPX B;  3MCO A;  2G9O A;  2DGQ A;  2V2K A;  4P10 A;  3LP0 B;  3A8J A;  5KG0 A;  1EET A;  2YWE A;  2HNZ B;  1IR2 A;  5F8M A;  5A2Q U;  2CQ2 A;  4I64 A;  3DOK A;  1Q0N A;  3Q8S B;  4N8N A;  3ET6 A;  1WHY A;  1PYS B;  4P73 A;  1LWF B;  3CDU A;  3AA8 A;  1W25 A;  5DGB A;  1FD2 A;  3UR0 A;  2XGQ A;  4USU A;  2OO4 A;  3T5K A;  4LJM A;  3Q89 A;  3CJS A;  1RAC B;  3GIR A;  2JDJ A;  2RQ4 A;  4QR2 A;  4F0M A;  5KFV A;  4C8O A;  3U1L A;  4FBT A;  1F3V A;  4NYP A;  4LRC A;  2UVV A;  3W65 A;  3H5S A;  4QYZ J;  4J7C A;  5DJB A;  3FFI A;  3IA0 A;  2HHX A;  1GMV A;  4QW9 A;  2D3Z A;  2GVZ A;  1O51 A;  2OUG A;  1IN0 A;  2YPY A;  1QVG R;  2WSC C;  4A4J A;  4ECR A;  3E2E A;  3OFH A;  2HIY A;  2OFH X;  2YXL A;  3MPW A;  2BKP A;  3AT1 B;  1WSV A;  1TKZ B;  3O5T B;  8ATC B;  2DIT A;  3BKF A;  3DKD A;  2MB0 B;  3BH6 B;  4J9V A;  4TKT A;  4NLS A;  3HLU A;  5DG7 A;  2DEJ A;  2HYI B;  2C2K B;  3Q8V A;  2IDE A;  2ZDP A;  1F9E B;  5ETL A;  1GAO A;  1L3S A;  4C0B A;  1XIQ A;  2GFF A;  4QWB A;  3ITH B;  1JLG A;  4K8R A;  4LF1 A;  1TL3 B;  4JYA F;  3E01 A;  2YX1 A;  3V5R A;  2ZUA A;  1EKR A;  3DLJ A;  3FCH A;  1K47 A;  4FNI A;  1BC6 A;  4LF7 F;  2ZWO A;  2YWW A;  2XGP A;  2JH3 A;  1IWA A;  2DCL A;  4URG A;  1SH0 A;  2X1B A;  4QBU A;  2J0W A;  4RNN A;  1U0H B;  5F8H A;  1CQM A;  2R8H A;  3HXM A;  3FMW A;  3A8E A;  3C2P A;  3RG6 A;  2EFG A;  5HAO A;  2V63 A;  2UUB J;  3IBF B;  5F8G A;  5AJ3 F;  4NX9 A;  2Q6B A;  2VF3 A;  2DR5 A;  2G2O A;  1M1G A;  4XPE A;  2K06 A;  3SI8 A;  3IRW P;  2FHK A;  3DLE B;  4KV8 A;  2M8H A;  2Z2Y B;  1YBU A;  4WTY A;  3KLG B;  4DOZ A;  1VC0 A;  1C4A A;  4DV1 J;  3DYA A;  2ZHA A;  2QC3 A;  2BOA A;  4ZVE A;  1RT2 B;  3W64 A;  5JUM A;  4KKO B;  2KXN B;  4WP3 A;  4QWA A;  1JXL A;  3HVT B;  1VQL S;  1ARO P;  2DHG A;  3PJX A;  3I82 A;  2FZK B;  2GCF A;  2DNY A;  3EXC X;  5HQM A;  1ZAX A;  4J37 A;  5L1L A;  3SSS A;  1PCA A;  1TK8 A;  4C7Q A;  1NK0 A;  3W8G A;  4ES1 A;  1EZZ B;  3OTB A;  2HHH F;  2QFI A;  4C98 A;  3TUI C;  3I96 A;  4TU9 A;  3UNG C;  4HTJ A;  3T5L A;  3VTI A;  3HVR A;  2V68 A;  4KHP J;  2QMU B;  3EZO A;  5DQH A;  1ZAW A;  2XMM A;  3ONQ A;  4LF5 F;  4I68 A;  2CKW A;  3G8S A;  2MQL A;  3GLJ A;  3H5U A;  3LUY A;  1XER A;  3MMB B;  1L3T A;  3KTQ A;  2XMU A;  2C2N A;  3MAH A;  4NLU A;  4LF6 F;  4PQA A;  4C11 A;  2CZV C;  2JHE A;  4F4X A;  4HR2 A;  4WXO A;  4DS4 A;  3J7Z T;  2CQI A;  1R6V A;  2V2Z A;  1ZTW A;  2LCW A;  1ZYQ A;  1WC1 A;  2ZHO A;  2BQR A;  2PDA A;  2A18 A;  1BLU A;  1XBW A;  4UOG A;  4LQ9 A;  1S10 A;  4LSN A;  2GML A;  4KFB B;  2YQ0 A;  2OPQ B;  5GAH I;  5C42 B;  4DV5 J;  1GH8 A;  2HHS A;  1WSR A;  4ZPC A;  4Y2M A;  5KFC A;  2VOD A;  2YWG A;  2UUC J;  1EP4 A;  2HGN A;  3KWM A;  2VFR A;  2N4D A;  1S48 A;  3R5G A;  4BLG A;  2OAU A;  3H7H B;  4O4G B;  4MYU A;  1Q7Y T;  4XPC A;  4OYP A;  2OTJ S;  3ZZZ A;  4RZR A;  2BBE A;  2L9N A;  4NA1 A;  3M9M B;  4G3I A;  3SBM A;  2DIV A;  4PG4 A;  3D1H A;  3D7S B;  5A8K A;  3WC2 A;  3H2U B;  1X9S A;  1IKX B;  1FVQ A;  1HHS A;  4X4V A;  2H4W B;  1VQ9 S;  1SKR A;  4YUD A;  3HKZ D;  2Q6C A;  4GKJ J;  4WU3 A;  1RHU B;  2I38 A;  2K3I A;  1R8P A;  4ICL A;  3H4B A;  1NLK L;  3ZFV A;  1FER A;  2PI5 A;  1GMW D;  4LRE A;  3OJS A;  2HGL A;  2KG1 A;  2GIF A;  5DGA A;  1TKX B;  4Z2X A;  4KGM A;  3CDB A;  2OJ3 A;  1Z4U A;  2QA1 A;  3M30 B;  3NNC A;  1VIX A;  2HQG A;  1IR0 A;  4LT6 A;  4WTO B;  4Y65 A;  1HKA A;  1TKT A;  3BEG B;  4Q0B B;  3BN7 A;  3U7J A;  2NS1 B;  2XYP B;  1Q1K A;  4FN5 A;  2FGC A;  2B5J A;  2I6W A;  3HO1 A;  4O3N A;  1SCJ B;  4DV0 F;  4DN9 A;  4W98 A;  4KT0 C;  1NUE A;  3BRE A;  2R2U A;  4OZ1 A;  3MM9 A;  3V2U C;  1Z1Z A;  1RAA B;  3HJF A;  1OS5 A;  1HD0 A;  2HNY A;  3QBC A;  4OX9 J;  1B70 B;  1VJW A;  5T14 A;  4OYX A;  2H51 B;  3IGV A;  3QRP A;  2COL A;  2MST A;  1SQE A;  5MAO A;  4O3R A;  3FDS A;  4OHW A;  4B3R J;  2OEM A;  2D41 A;  5KFW A;  1SJQ A;  4DV7 J;  2KT3 A;  1RA7 A;  2ILZ A;  4IG3 A;  4P71 A;  4YDD B;  1HMV A;  2CZ4 A;  2LEB A;  4NZ7 A;  2YX4 A;  2DNL A;  3I9Z A;  4NZ6 A;  3KG0 A;  2LXI A;  3GON A;  4NML A;  1U2C A;  1RTH B;  2CQH A;  3S8S A;  4DBQ A;  1NEE A;  3AB2 B;  1RT5 B;  3I87 A;  4ELU A;  3P8B B;  4QCL A;  3IAM 9;  4DUZ J;  2OIH A;  2V8P A;  1G4C A;  1J5E F;  3OJU A;  3RW7 A;  4OJG A;  2VBW A;  1N0U A;  2NPI A;  1Y11 A;  3NGD A;  2AYM A;  2GVD A;  1LFP A;  1SC1 B;  2RB7 A;  1M1H A;  4QWE A;  4QWC A;  1E6Y A;  4PWU A;  3O1L A;  1RAE B;  3W60 A;  2R7T A;  4MK8 A;  4LRD A;  3AA9 A;  2FJE B;  2Z2Z A;  1RTD B;  4MMO A;  5HSP A;  1YWX A;  1CUL A;  1UWB A;  5GAD I;  2XS5 A;  1RE1 B;  4DQS A;  3RGI A;  1YHQ S;  2RML A;  3AOD A;  4ZIW A;  1H72 C;  4H4O A;  4M5L A;  2OLW A;  3MEG B;  3OLA A;  2CWX A;  2VG6 B;  4TU8 A;  4K4W A;  4ES2 A;  3W2V B;  2HND A;  3TAM B;  4C2M A;  2R8K A;  1S0V A;  3QGH A;  2GA7 A;  2PFD A;  3P5B P;  1VGY A;  1X4A A;  2ADC A;  4K0K J;  3R1H A;  3T5H A;  2U2F A;  1CJT B;  2X3G A;  2G0I A;  4ZJL A;  2AIR B;  2CQC A;  4MK9 A;  1H6K X;  2UUT A;  4PXB A;  1G1X A;  2CG8 A;  3GP9 A;  1VQ6 S;  2R2S A;  4ANE A;  1NB2 A;  3CNQ P;  3CB4 A;  2QYC A;  4WP8 A;  2AJF E;  2Y1R I;  3JS9 A;  3NP5 A;  1XNQ F;  3TEH B;  4ECZ A;  8AT1 B;  4UZB A;  1ZPW X;  1Q95 G;  3MM6 B;  2V4J A;  4L75 A;  3I32 A;  4MIA A;  2RDD A;  4KGX B;  2LU1 A;  4WU2 A;  4CH7 A;  3TOQ A;  3IG1 A;  2EVZ A;  4NLD A;  3H90 A;  3O6Q A;  4FKY A;  3CCU S;  5HRO B;  3K59 A;  5G4D A;  1QY7 A;  2CFX A;  1TEL A;  3NGU A;  3VVT A;  4N41 A;  3OR2 A;  1SKU B;  5GVQ A;  4OIX A;  3DDI A;  3PEJ A;  4Y2I A;  2E5G A;  1BQM A;  5D4L A;  4Q43 A;  1LK7 A;  5DM7 Q;  2XEX A;  3G6Y A;  3A4T A;  5EHH A;  4ZK7 M;  4RUH A;  1JKH A;  1F3F A;  5KAK A;  4F36 A;  2RQM A;  4NLR A;  2CPZ A;  4TYB A;  3M8Y A;  1I94 J;  2EWH A;  2O01 C;  3PKY A;  2Q1L A;  2QRR A;  3DRP A;  4WBF A;  2OPP A;  2BDP A;  2QFJ A;  5DO2 A;  4WK1 A;  1BQX A;  3J7A 1;  1RHR B;  2VG5 A;  2KJW A;  1I6J A;  1PAE X;  2JC0 A;  4KGK A;  3EX7 B;  1ZOT A;  2F4V F;  1UEK A;  1S9E A;  5I3P A;  3QIP B;  2VG7 A;  5K20 B;  3SYZ A;  1KN6 A;  3IBW A;  4C3K A;  1HWJ A;  1QM9 A;  1GMW A;  2N7C A;  4DPT A;  2DNN A;  3PNI A;  4R5P A;  3QMQ A;  2MQ8 A;  1LV5 A;  2CQ4 A;  3PCO B;  5JVG Q;  4K4T A;  2YKA A;  1RDR A;  1IBM F;  4LIW A;  3MR7 A;  3DLK A;  5JVH Q;  2MY8 A;  3M05 A;  2PFF B;  5HJY A;  4LSL A;  3E3X A;  2E5L F;  1DQA A;  1CC8 A;  3RR7 A;  1N54 B;  1IBK F;  2BJE A;  3HUL A;  1KP6 A;  1J27 A;  1R8H A;  1C1B A;  1T9Y A;  5HP1 B;  1CQN A;  2F5G A;  3V4I A;  2NXN A;  4IUF A;  2UZA A;  4ED6 A;  4LFC F;  1IM6 A;  4WPA A;  4UZC A;  1VOM A;  4H4K C;  2KO1 A;  4B9N A;  4LRF A;  1GX5 A;  4PPD A;  2AZ1 A;  3HVA A;  2CQG A;  1N56 A;  4ZVF A;  3EPG A;  5KFM A;  2DGO A;  2PII A;  3LO3 A;  3GJT B;  2KFZ A;  4DU8 A;  2CJA A;  3BM7 A;  2DY9 A;  2GS8 A;  4JP8 A;  1HQU A;  1U4B A;  1R8B A;  2HFZ A;  4FZV A;  1EQ0 A;  1S6P A;  4M5G A;  4JV5 F;  1QSL A;  3KK2 B;  4ZP6 A;  5KFQ A;  2UP1 A;  4V19 J;  4NCG A;  2CPY A;  4LF4 F;  4OZ3 A;  1NBE B;  4DV4 F;  3CCZ A;  5FLX U;  1RHM B;  3BSA A;  2HQI A;  4AQY F;  2YNH B;  3HCX A;  1KQG B;  1FDN A;  4X4Q A;  4CO0 A;  3CCR S;  5D3G A;  4J9P A;  4YY3 J;  2W4P A;  1LXN A;  2C3Y A;  5AE1 A;  3CXC R;  3ILO A;  1QD1 A;  4LFA F;  1CS4 A;  2J6U A;  5CCL A;  2J7U A;  2RUG A;  3X3U A;  2HBR B;  4JI3 J;  3IRX A;  3NNH A;  3MCS A;  3J7A N;  1U2R A;  2FVR A;  2BQ3 A;  2DT9 A;  3GIK A;  1ACM B;  2L08 A;  4U7U K;  1XMB A;  1U1P A;  4OZL A;  3JYT A;  5B0B A;  3R7S B;  4ETX A;  4DPY A;  2QTW A;  2V34 A;  2Y0B B;  3DI6 A;  3PX6 A;  3KNA A;  4K4Y A;  2N82 B;  1R43 A;  3AY0 A;  4QYZ K;  4K5R A;  3RRG A;  1U25 A;  4AUK A;  4KHM A;  1UWA A;  3OTO J;  3OR1 B;  4H4K A;  3UD3 P;  3RBD A;  3BS9 A;  2LMI A;  1OY6 A;  4ZP8 A;  3CDE A;  1WI8 A;  3LWL A;  3C6T B;  4WE1 B;  4K7Q A;  3DOM B;  4WZQ A;  4M1K A;  3DGV A;  3T9Z A;  2E1M C;  1Q81 T;  2XS2 A;  5IC6 B;  2HHV A;  4J90 A;  4IR1 A;  1U02 A;  4OI4 A;  3TAN A;  1AZS B;  1U1N A;  3AOA A;  4DX5 A;  5D0E A;  2HFN A;  1N34 F;  1FRL A;  2CJY B;  1QUV A;  2CQ3 A;  1RUS A;  2EBG A;  3A1Y G;  2ZH2 A;  4DUY F;  2ZKT A;  1ITP A;  2E1R A;  3LP2 B;  4CLY A;  3EZ5 A;  1LNQ A;  4OLO A;  3UWT A;  1HW9 A;  3SSR A;  1W7W A;  3W2W A;  3G8T A;  1KVK A;  4RW7 A;  1N48 A;  3KJQ B;  2H5J B;  5A76 A;  2VFS A;  2DR9 A;  2R8G A;  4DMZ A;  2DGU A;  4AXJ A;  1YIJ S;  2W2N P;  4IFY A;  2W1B A;  4DL3 A;  4N5S A;  3W9J A;  2OTL S;  2LQB A;  2BAN B;  4DDF A;  3HSG A;  4K5S A;  4D3G A;  1V9O A;  3GFY A;  1HNV A;  2MQQ A;  1T7P A;  2CNN B;  1WHW A;  1MLA A;  1OY8 A;  3BGR B;  3WX4 A;  2BAB A;  2OD4 A;  4NI2 B;  1XNR F;  2AJ4 A;  4KBI A;  4ZPD A;  3DMJ B;  2D74 B;  2MJU A;  4OV1 A;  3KG1 A;  4CTA B;  2VV5 A;  3OFG A;  1NO8 A;  3MPY A;  2UUA J;  1S9F A;  3PXG a;  5FDL A;  3GII A;  1NH7 A;  1UW9 A;  4PG8 A;  4LIR A;  2H1Y A;  2IM3 A;  2IIH A;  4URQ U;  3OTE A;  5E3P A;  4GKK F;  3GQC A;  1KLN A;  5L9X A;  4CNY A;  4OL8 A;  4JUZ A;  2KM8 C;  5F9L A;  4ZA1 A;  2JSX A;  4IG0 B;  4JI6 J;  1TKD A;  5J2Q B;  3TP2 A;  4G1Q A;  2I1R A;  3LWM A;  2QL7 B;  3IBC B;  3W66 A;  1VQ5 S;  3GJQ B;  4NOH A;  4QPT A;  5D0G A;  3MWB A;  1VQ8 S;  4B3T J;  5GAE U;  1KWM A;  4A8X A;  2HEK A;  5K14 B;  3L7U A;  2D9O A;  1WF2 A;  3QJL A;  1M5S A;  3I0R A;  5KT7 A;  3VZH A;  4F67 A;  4WFY A;  4P2S A;  4MKV A;  1HBN B;  2MHN A;  3DRS A;  2HFU A;  3EJM A;  1C2P A;  1M0S A;  4P2F A;  4RNH A;  1EAY C;  4F3Q A;  4JI7 F;  3GG1 A;  4YHH F;  4NLY A;  2RKI A;  3TJ9 A;  1S1X B;  1SJF A;  4ED2 A;  3NGR A;  3ZTS A;  4PPZ A;  5IFM A;  1HBM B;  4USJ C;  5K9F A;  3BB5 A;  4G1P A;  1VDH A;  3NCP A;  4KJI A;  1T11 A;  1TL7 B;  1D0E A;  4MH8 A;  5EWE A;  1VRT B;  4MIW A;  3T1A A;  3ENV A;  4JI0 J;  5MLC V;  1REV B;  1WF0 A;  2CJX B;  3FBB A;  4TY8 B;  1KNZ A;  1GTH A;  1LWX A;  2IVF B;  1OWX A;  1H73 A;  2E7V A;  2BE9 B;  4DCO B;  4B9L A;  1KR4 A;  3BDE A;  1G3O A;  4WP9 A;  4EUV A;  3RBX A;  2FC9 A;  1TUW A;  4DR4 J;  1H38 A;  1LQ9 A;  2W7A A;  2ZHB A;  4KQZ A;  4DPW A;  1CC7 A;  3PW4 A;  4FPI A;  4B9U A;  1HNZ F;  4QR0 A;  1JLE B;  4QIG A;  2HNZ A;  4ID5 A;  1U47 A;  3UI3 A;  3Q8Q B;  4FS2 A;  3KJF B;  1VIO A;  4GC6 A;  4OI3 A;  5KG4 A;  4TNO A;  1I3O B;  4HHJ A;  1V3Z A;  4K50 A;  3M8Z A;  3S6E A;  1UVM A;  2IC3 B;  3UFC X;  4LUB A;  3PTW A;  5CAB A;  2UVW A;  3N5F A;  3PO5 A;  1S77 D;  2XC9 A;  4G65 A;  4LFB F;  3NBP A;  2HZA A;  4S0M A;  1NB7 A;  1S1T A;  2B6A B;  1RU2 A;  4P7T A;  3PYF A;  1FFW B;  2R7S A;  2GQQ A;  1FJG J;  2VIH A;  1F5C A;  3GJS B;  2LEA A;  1WWH A;  1ZS6 A;  3J81 U;  2WON B;  2FY1 A;  2CQ1 A;  3CC2 S;  1LWC B;  4F2R A;  4HL9 A;  2IJR A;  4EZ6 A;  1T05 B;  2DNO A;  2J7W A;  4MKY A;  3J81 j;  1VLO A;  2O67 A;  4PUO A;  3TI0 A;  4JI1 J;  3MR6 A;  3VCD A;  3D5M A;  3HMJ G;  4KPC A;  5KT2 A;  3CCJ S;  2KDO A;  1OQ3 A;  1I51 B;  1DHM A;  4PRF A;  2RRA A;  1CPZ A;  2FLP A;  3M2V B;  2FPH X;  4I4B A;  2RHS B;  2HBY B;  2ZD1 A;  2W2M P;  1T03 B;  3MD1 A;  3SFG A;  2E1C A;  3EGW B;  5KFX A;  2GAH C;  2CG4 A;  1MN9 A;  3PRD A;  3MI7 X;  2LQ8 A;  3SQO P;  1F0X A;  4JYA J;  2JEI A;  4LF7 J;  1KLM A;  5KFI A;  2B43 A;  1ZPV A;  1VQ4 S;  1FK9 A;  3BSO A;  3ENQ A;  2M9K A;  3DM2 B;  1AA1 B;  4NA3 A;  4ECV A;  4FXD A;  3KJV B;  1SJR A;  4ZDN A;  2NPF A;  1JJ4 A;  2P6S A;  4J9U E;  1B0T A;  1N6Q A;  2B4P A;  2RNE A;  3I6P A;  3DLG A;  1UPP A;  1D1U A;  3DU6 A;  5L38 A;  3THP A;  2HVE A;  4CYU A;  1GFW B;  1UAW A;  2Z30 B;  2KH9 A;  2JEJ A;  3KMQ A;  4DFJ A;  1S4F A;  1PC4 A;  3J80 Y;  4K4U A;  1I5O B;  4D3H A;  3IP0 A;  4HHU A;  1VI7 A;  1X5O A;  1B0V A;  4I69 A;  2ZH7 A;  3BR9 A;  4QOT A;  1PIE A;  4YME A;  4HEA 9;  3PO4 A;  3CCW A;  3M4X A;  4F2S A;  1XMQ F;  1DTQ A;  4DSE A;  1VQM S;  1AUD A;  3WIV A;  4XIU A;  3CTR A;  4I7F A;  3CCT A;  3EGV A;  1SKW A;  4XK8 C;  4OHY A;  1CBK A;  1U24 A;  2VC0 A;  5C25 B;  2VB6 A;  1WTB A;  3IGN A;  3VAG A;  2UV8 A;  1QTM A;  4X65 J;  4U7C A;  3FRZ A;  1TUV A;  1NJY A;  2CPX A;  1RBL A;  3QSI A;  2XHW A;  3MXH P;  2Z58 B;  2EI5 A;  5M2P A;  1SXL A;  4OHZ A;  4PWW A;  4DCP B;  1S1U B;  1VIS A;  1RAF B;  3CMA S;  2HHH J;  4IH7 A;  3DFE A;  2ZC4 A;  2CIM A;  2D3O 1;  4X62 J;  3MM5 A;  3KLF A;  4DFM A;  4HYK A;  1DQ8 A;  1ICE B;  2QX0 A;  4X4N A;  1RXO B;  1S6Q B;  5LMU F;  4Z7Y A;  2W24 A;  4A46 A;  1JB0 C;  1HBO B;  4LF6 J;  2F63 A;  4Z7C A;  2B9W A;  1U48 A;  2DNP A;  1U8W A;  3NGT A;  1JJC B;  2UV8 G;  1VRQ C;  2IBK A;  5H1S V;  3K58 A;  1Z2L A;  3C14 B;  1VQS A;  2WB4 A;  1Y5I B;  1OMS A;  2APO A;  1YDL A;  4OMF G;  2MGZ A;  1RAD B;  1WG1 A;  1YK9 A;  3QLH A;  1KKH A;  1S7I A;  2YPZ A;  4KAI A;  2FLN A;  4K4Z A;  1V6H A;  3Q23 A;  1JLQ B;  2WVC A;  3PEH A;  3NKY A;  3GFZ A;  3THT A;  3I5A A;  1U7L A;  4I56 A;  1T8E A;  1FKO B;  1IUJ A;  4OJ3 A;  4KSE B;  4ES3 A;  5LOQ A;  1XQI A;  1FDB A;  2B7C B;  1FDD A;  2BKO A;  3PM9 A;  1NK7 A;  5DQG A;  2C3U A;  4M63 A;  4J9N A;  2HHQ A;  5L9N A;  3UDL A;  3N9U C;  1WKL A;  1WOS A;  3BPS P;  2L9W A;  3FSX A;  2DXD A;  2RVJ A;  2E9R X;  5E2Q A;  3M8R A;  1QAY A;  3MM8 A;  3RB4 A;  2HVH A;  3DNC A;  1NU4 A;  3VHQ A;  4OZN A;  5F3Z A;  1RAB B;  4IDK A;  4NLQ A;  1TKX A;  2C2R A;  2GC8 A;  3M32 B;  3R2D J;  2GJI A;  5T41 A;  1VQO S;  3C46 A;  1X7V A;  5J2P B;  2DH9 A;  1MRO A;  4DFP A;  3PHT A;  4GVB B;  3GU0 A;  3G2X A;  4HI1 A;  2BJ8 A;  2BKN A;  3M8Q B;  3AXK A;  2LKZ A;  5CYM A;  2EXU A;  3Q24 A;  4RU9 A;  1SH2 A;  1SC3 B;  6FDR A;  3EYZ A;  3AOC A;  2EG2 A;  2NYH A;  1JXV A;  4QWD A;  4YDX A;  1Q8K A;  1R27 B;  2ZH9 A;  3GV5 B;  1HWU A;  2D69 A;  3GZ7 A;  2BAC A;  3KK1 A;  5J2N A;  5D4N A;  4J9M A;  2RUS A;  2YX7 A;  5F8J A;  1XTZ A;  2D7S A;  4DV0 J;  2HWI A;  2ZJP Q;  4CCH A;  1VBK A;  5ADZ A;  3KDN A;  4K4X A;  2RF2 A;  1CJK A;  1WDT A;  1NPR A;  4NLV A;  5I3U A;  1HL6 A;  1S9G A;  2E1A A;  1YJV A;  3JXO A;  2Y1J A;  4PKD B;  1B64 A;  4IOB A;  2HAI A;  4DR3 F;  4DL4 A;  1D9A A;  5J2M B;  1WHV A;  3ILJ A;  4OZ0 A;  2LEC A;  1RT7 B;  3NEK A;  5KFY A;  3DRR A;  3TNV A;  3I0S B;  5C2G A;  1C0T B;  1YJR A;  3H42 A;  2CDQ A;  1RWP B;  1IWG A;  3UDV A;  2WRM A;  3HX9 A;  3GSI A;  2XY6 A;  3VR1 A;  1P9Q C;  2XS7 A;  4UUX A;  1JLA B;  2FJB B;  3RRK A;  3MUR P;  2XWX A;  1A6L A;  1BXN A;  4ZPB A;  4U96 A;  1Q5V A;  3SCJ E;  2GHV C;  3HZE A;  1HNI A;  1NHK L;  2DB1 A;  3P96 A;  4CLK A;  3BBC A;  3R5J B;  2MKI A;  4K2X A;  5L46 A;  3SDE B;  3DDK A;  1PYT A;  4EO6 A;  1UVJ A;  4CT9 A;  1H0H B;  2HPU A;  4JI2 J;  4JI4 F;  4RW8 B;  3DN9 A;  2KXF A;  3I5C A;  3W3S A;  2WB1 D;  3BDP A;  2HK2 A;  4WFX A;  2FGO A;  1P1L A;  1M5O C;  1Q78 A;  3IS9 A;  2MJN A;  3VF0 B;  2IVY A;  1Q5Y A;  2NXC A;  4DPU A;  1D3W A;  3H2V E;  5B08 A;  1UMJ A;  4DX6 A;  2XMK A;  3FCV A;  1HNX F;  3E8O A;  2K1R B;  2Z2M A;  4AXI A;  2CWK A;  4UOH A;  2ZH3 A;  4JV2 A;  4B3S F;  2YNI A;  1VQY A;  3BKT A;  1N32 F;  2NXU A;  3OUY B;  2JL9 A;  5HL7 Q;  4CZC A;  3QFH A;  3IFE A;  1S5Z A;  1RBO B;  3TYT A;  1WOR A;  3SQG A;  2WBR A;  4EBD A;  5BYR A;  2HHT A;  3SFU A;  4ZLP A;  4IFV A;  1GXT A;  4QPX A;  3S01 A;  2YH1 A;  2HHW A;  1XNQ J;  1XJW B;  3DGP B;  1LW0 A;  2HQD A;  2CPE A;  1Q4R A;  4ECS A;  2EPI A;  4FDF A;  4ED4 A;  4HHH A;  4F04 B;  3CIM A;  3K5M A;  3L3C A;  4UOC A;  4EK2 A;  1D09 B;  2FTR A;  2FD2 A;  4IYQ A;  1CLF A;  4ZVU B;  4A8M P;  3QGI A;  3AJ2 A;  1NK9 A;  4YP3 A;  1SV5 B;  1YTY A;  2FJA B;  3QNW B;  4BC9 A;  2UXD F;  4DL2 A;  1LWE A;  2AV5 A;  4ZPT R;  1YJW S;  3CJT A;  1URN A;  2AMC B;  3AD8 C;  4CH1 A;  1XWL A;  4HDG A;  5C2C A;  3A8K A;  5B0F A;  2J6S A;  1DAX A;  3CPW R;  3M8P B;  4J9K A;  3FRY A;  3FQK A;  3RBE A;  3TQE A;  4FF1 A;  2XZD B;  1SJ1 A;  2FLL A;  2W7O A;  1F6T A;  2JWN A;  2VFT A;  4JI8 F;  5KFJ A;  3KHG A;  3HDS A;  5IT0 A;  1PKU A;  3E51 A;  2HMI B;  2F4V J;  1RI7 A;  5IM0 B;  4C8N A;  4V1A k;  2R8I A;  2BE2 B;  3JSY A;  2DY1 A;  3P49 B;  3MEC B;  4EGL A;  2HSE B;  3OSN A;  5E41 A;  5CA5 A;  3VQT A;  1SL0 A;  1FEE A;  2MKH A;  5DLF A;  5F8L A;  2YY3 A;  4B3O B;  1GQE A;  3SMZ A;  5CCM A;  1OSC A;  3PDN A;  2J9D E;  2DEI A;  2VD3 A;  1RAI B;  2FDN A;  4NLW A;  2I5J A;  1S59 A;  4DFK A;  2E5L J;  2CNK B;  2GMH A;  1C0U B;  1BQN A;  3K7R A;  1T3N A;  2B56 A;  3MM7 B;  2YKM B;  2OFG X;  1IBK J;  3IAS 9;  3PFE A;  3HZG A;  1NK5 A;  2H48 B;  4MKB A;  3B78 A;  1TTH B;  4ZKA A;  1K8A T;  3DU5 A;  5DDR C;  1Q7L B;  2NRE A;  3N6M A;  5GAH U;  2QYG A;  5IQQ A;  1DAR A;  1ZBT A;  3H5X A;  3M2R A;  2IAJ A;  4CQ1 A;  1U49 A;  1HYS A;  1FX2 A;  1FE4 A;  2AQ4 A;  1Y0H A;  2B9Y A;  3HI9 A;  2CYY A;  4JOU A;  2CJ9 A;  2UXC J;  4DR7 J;  2W9C A;  4F50 A;  2DD8 S;  1HQE A;  4ID8 A;  4TQS A;  3JSM B;  3N79 A;  3OV7 A;  3BO4 A;  3ISZ A;  1Q16 B;  4I2Q B;  2J8A A;  1T02 A;  1UJ4 A;  2KYX A;  1UL3 A;  1S1W A;  4O0N A;  1UZD A;  2ABY A;  2ROP A;  2AYG A;  2HG4 A;  2JRS A;  4RPF A;  4JV5 J;  3W5Z A;  2ACY A;  3SIP B;  4CM0 A;  5I4M A;  3QAU A;  2GAG C;  4CM2 A;  2B7B B;  3ZZR A;  5CZV A;  1NME B;  1Q8B A;  2WCX A;  4O4R A;  3KLI A;  1SUQ B;  4GRS A;  4DV4 J;  4PXD A;  4ZOS A;  2XLI A;  4KRW A;  4AQY J;  4CRJ A;  2YNG A;  1U26 A;  3IMQ J;  2JLG A;  2JFD A;  2ASY A;  2YKN B;  3NAI A;  4QIE A;  3TEG A;  1P27 B;  2OD6 A;  4WIQ A;  2FY8 A;  2DH8 A;  4OJH A;  4RJV A;  4ELV A;  3C16 A;  1QE1 A;  1AYE A;  3I4H X;  1F2G A;  3CW2 C;  4NRT A;  2BJ7 A;  2AEJ A;  2NSB A;  4B02 A;  3JTN A;  3NOG A;  4USW A;  3HHL A;  2L48 A;  1EIY B;  2BW2 A;  1QDU B;  2JX2 A;  3UNY A;  2YKP A;  2VJU A;  5ETM A;  1RWN B;  2IA0 A;  1KON A;  4KR0 B;  1EET B;  3HM9 A;  1RT1 A;  2BRL A;  5KG6 A;  3G9C A;  3DOK B;  3HSZ A;  1FHT A;  5D8H B;  3ET6 B;  2IM2 A;  3CDW A;  2MKC A;  4X64 J;  2GW8 A;  3EMT A;  2QLW A;  3CVK A;  3GV7 B;  1LK5 A;  5E3Q A;  3GR1 A;  1NM2 A;  2D3U A;  4FVM A;  3RJM B;  1MW7 A;  1H7W A;  1S4E A;  2B9E A;  4U9R A;  1VBX A;  2F65 A;  1F2H A;  2ZZN A;  3FFI B;  2GVZ B;  2G2Y A;  1V3S A;  4X2B A;  3QFW A;  4AL5 A;  4BC7 A;  1N4L A;  2A3J A;  1ZM2 A;  1N52 B;  4G6V B;  4O3P A;  4OZJ A;  3HHE A;  4LR8 A;  3WQP A;  4U7U D;  3WC0 A;  4F7V A;  3CJ3 A;  2AWZ A;  2ZNY A;  4OYA A;  5C5J A;  3CJK A;  4G1I A;  1S1V A;  1JQG A;  2QLJ B;  1D9D A;  2Y8W A;  4FF2 A;  2M52 A;  2MHE A;  2KYZ A;  2FLO A;  4LBI A;  4NI2 A;  5BJR A;  4PAA A;  4DPX A;  2PSZ A;  1DUR A;  2YWH A;  4USI A;  4GC7 A;  1N33 J;  3C6U A;  2KB2 A;  1JLG B;  4C6A A;  4ZCK A;  2O66 A;  2PMW A;  1U6F A;  3E01 B;  3KMS A;  5ETR A;  2YBV A;  3R9L A;  5ETS A;  5KFZ A;  1WF1 A;  3EVO A;  2UUB F;  5B0D A;  1NJX A;  4A48 A;  2DGS A;  1RT4 A;  2ZVS A;  2R7V A;  4P6Q A;  4NLT A;  4USK A;  2DBB A;  4IRD A;  1L3V A;  1FRK A;  1WEL A;  1JLF A;  5L8R C;  1Q53 A;  2YQ1 A;  4ETZ A;  1WC5 A;  2YWF A;  2AEM A;  3AHP A;  3BQ2 A;  3EIC A;  3MGJ A;  4WII A;  2CQB A;  1F5A A;  3NRB A;  1FXD A;  4DV1 F;  1XEZ A;  1FWP A;  4GKK J;  4ZPA A;  2EC0 A;  2BJ1 A;  2NCK L;  2IM0 A;  4KV8 B;  3L09 A;  3BYR A;  1M5K C;  1B7Y B;  3HSJ A;  5AE3 A;  2GHP A;  2Q79 A;  3CO9 A;  4URS A;  1RB0 A;  5T7L A;  2HFV A;  3DYA B;  4DV2 F;  1WHX A;  3VV2 B;  5IZH A;  1C1C B;  5C7P A;  4LVO P;  2ZH8 A;  4E0D A;  2LQ5 A;  4MK7 A;  1FWL A;  2Y0S D;  3DLH A;  1HBN A;  5A8R A;  3RW6 A;  1OJ4 A;  5DQI A;  3WBZ A;  2MZT A;  3TQ1 A;  4FS1 A;  3N6L A;  2YNF A;  1BY9 A;  1U1K A;  5GMK a;  4A8Q A;  1N0V C;  1YVF A;  5IQ6 A;  4KHP F;  1B3T A;  1LW2 A;  5D6G A;  4MFB A;  3KLH A;  1V3R A;  5HVG A;  1VR6 A;  1TL1 A;  1Y3J A;  4JI7 J;  3M2U A;  4PR6 A;  4YHH J;  2XLJ A;  2HQF A;  4MJK A;  1Y4Z B;  1ZAV A;  4ZCL A;  4YR0 A;  2QG9 B;  1HNW J;  2OHD A;  5KFA A;  1S49 A;  3H20 A;  1OPI A;  5GME A;  4L74 A;  2QA4 S;  4U8V A;  4C8Y A;  2V9W A;  3LAN A;  3KHR A;  3POT A;  3C19 A;  4C11 B;  3DOL A;  4DV5 F;  3VGV A;  3B8H A;  2EK6 A;  1WUU A;  3VGU A;  1HPZ B;  3D3C J;  3RZA A;  3FBF A;  4ED7 A;  3PX4 A;  4OLP A;  4DR1 J;  4OV6 A;  2EKY A;  2UUC F;  2QSF A;  4YS2 A;  4LSN B;  3RR8 A;  4CLF A;  2Z4P A;  1SIZ A;  1QVF R;  1VQN S;  1NJZ A;  3BSC A;  2A10 A;  2BV3 A;  2OGU A;  4USM A;  5F9N A;  1IKY B;  3ZTQ A;  1X5P A;  1EP4 B;  3MAA A;  4I67 A;  1YIT S;  1UZH A;  1RTI A;  2J9D A;  4DSK A;  4F4K A;  3D54 A;  5K5M A;  2U1A A;  5HBM A;  4P2X A;  4DQP A;  7FD1 A;  3IWX A;  2OPR A;  2AX0 A;  4MKA A;  1BUX A;  2DNH A;  4GKJ F;  3AXM A;  5G0R A;  2ADB A;  1KOO A;  4LFB J;  3PHE A;  4O0I A;  5DM6 Q;  2HHP A;  4P2M A;  2ZVI A;  4BDP A;  2H9Z A;  3HF5 A;  1VRU A;  2O1P A;  2B0G A;  3TWZ A;  2XYG B;  5A8K B;  2H5I B;  2R7R A;  3GMG A;  3K2Y A;  4USH A;  4O3O A;  3OHB A;  4UUW A;  4IH6 A;  4ZCI A;  3MUM P;  4CT8 A;  4ICL B;  4WFB Q;  4RBU A;  5LM7 E;  2J7K A;  1NRK A;  3W9I A;  4ECQ A;  4DSL A;  1RQ0 A;  3ZZT A;  3HVW A;  3M6X A;  3TAR A;  1IBL J;  2OPS A;  3W1Y C;  2UVR A;  1X5S A;  3K5N A;  2XNQ A;  2HRT A;  5HMY A;  1TKT B;  3SXL A;  2XCA A;  3CUL A;  1RTJ A;  1W2I A;  2RE1 A;  4LF9 J;  2ZE2 A;  1WC6 A;  5FLX Y;  2KU7 A;  4OX9 F;  2Z8Q A;  1Y5L B;  3R1L A;  1VK3 A;  3PAC A;  4M5H A;  1FKP A;  2PN6 A;  3C15 A;  3Q83 A;  4B3M F;  1RT6 A;  2MY7 A;  4DS5 A;  2OEJ A;  1FX4 A;  3MM9 B;  2DPI A;  4B3R F;  4FYX B;  1D8Z A;  2V6A A;  4EBE A;  4K2J A;  2HNY B;  5IT4 A;  1F9F A;  4C9D A;  4A8W A;  1JIH A;  2PEB A;  4OFZ A;  2FJW A;  4DX7 A;  1X4G A;  4AL6 A;  4J9Q A;  3JSR A;  2C2M B;  2VFV A;  2VIC A;  2FHJ D;  2JVO A;  2M7S A;  1RLD A;  5IT9 U;  4IG3 B;  1SB6 A;  4NLX A;  1HMV B;  1Q86 T;  2VBY A;  3EZU A;  1GTE A;  2CA9 A;  3AJ1 A;  2C2O B;  1KQS R;  4FNH A;  1A7G E;  2K7K A;  3PW5 A;  3BO2 A;  4QYR A;  2R42 A;  1RP5 A;  4I6Y A;  4E8U A;  1KC8 T;  3R7N B;  4OI1 A;  3D4J A;  2GVD B;  2R8J A;  2XUL A;  2ZH6 A;  2J76 E;  3KLE A;  1E6Y B;  1KHW A;  5E0O A;  2OMO A;  4DG1 A;  2ALY B;  2D1C A;  4YR2 A;  4FYY B;  2ZFH A;  2AGP A;  5ETN A;  3T19 A;  3BGL A;  4DQQ A;  1CUL B;  3B4M A;  1UWB B;  2BYC A;  3Q0A A;  1VBZ A;  2R7U A;  1U0S A;  1RWO B;  3EXY A;  4HT5 A;  1F1B B;  2CJB A;  4C48 A;  1BWE A;  4H4O B;  2UXB J;  1E6V A;  2W2Q P;  3G71 S;  4DLG A;  2YQ3 A;  4FBU A;  3TAQ A;  2B4O A;  3VAK A;  1S6Q A;  2HND B;  4NZ0 A;  4OX6 A;  4BCA A;  3D67 A;  5HMW A;  2AP6 A;  3O2I A;  3MFH A;  2BXJ A;  4CP5 A;  2C2D A;  3DCA A;  2ILY A;  4GO7 X;  1MWZ A;  2DHS A;  5J1E A;  4RW9 A;  4RNF A;  1NCL A;  1CJU A;  1PC5 A;  3OPK A;  3SSQ A;  3SV4 A;  3NL0 A;  1A9N B;  2DJW A;  3IR6 B;  4UOF A;  5GAE I;  3R5D A;  2ROE A;  1NKC A;  2R7O A;  4ZIT A;  2QMX A;  3CCE S;  1SVD A;  2YWK A;  5EWF A;  2FB0 A;  2V4J B;  2BJD A;  3CJ8 A;  4Y6I A;  1FKO A;  3MCN A;  3L4B C;  3BGO P;  3M1V B;  3IG1 B;  1F60 B;  4ECU A;  5HAT A;  4AL7 A;  2HS0 A;  5B7W A;  3OR2 B;  4P72 A;  1HHT P;  1VHF A;  2AEF A;  3R3T A;  2KZM A;  3K17 A;  1I94 F;  2AX1 A;  1RJJ A;  1BQM B;  3CF5 Q;  2C2Z B;  1W2B R;  4O44 A;  1UVK A;  3V6H A;  2OKQ A;  1O0P A;  1JKH B;  1FTR A;  1X0P A;  1RCO B;  1DJ0 A;  2MKS A;  3HFZ B;  3G82 A;  5JXS A;  3ILI A;  4ZHR A;  3MR5 A;  3W63 A;  5KG3 A;  3ZZP A;  3SZ2 A;  3DRP B;  3HFK A;  2OPP B;  1U1O A;  2MKJ A;  2LA6 A;  4CLU A;  4TY9 A;  4UY8 5;  2VG5 B;  4GVB A;  1P1T A;  3D0H E;  4EFA C;  3N01 A;  3QJP A;  5D78 A;  4LF8 J;  3M8Q A;  1S9E B;  1YBA A;  4ANC A;  5HMZ A;  1DTT A;  1EKS A;  2VG7 B;  1FKA F;  2EFV A;  3GWC A;  4NLP A;  4CLS A;  3QO9 A;  4EBC A;  3KDO A;  1FO1 A;  2OEK A;  3H8Y A;  3CWJ A;  3KJN B;  3TAP A;  4ED8 A;  4HDH A;  1M5P C;  2E7W A;  4JV0 A;  3GG0 A;  1RK8 A;  3ETO A;  1M90 T;  2XNR A;  4LR7 A;  2GV1 A;  1IXK A;  3DLK B;  3TZY A;  3U1N A;  4C0H A;  4CO1 A;  4LSL B;  3JTO A;  5KT6 A;  4TYA A;  4WF9 Q;  1S0N A;  4X4R A;  2GQ2 A;  4DUT A;  2I2Y A;  2VDI A;  4LVN P;  5J2M A;  1WG5 A;  1C1B B;  4BS2 A;  3TJ8 A;  2E5J A;  3V4I B;  1LKZ A;  3EGN A;  5HN0 A;  2PC6 A;  2HFO A;  2AU0 A;  2QT7 A;  4MYT A;  1NK4 A;  3L7O A;  1RKJ A;  3DRY A;  5A0Y A;  1AXQ A;  1URR A;  1ZZF A;  2V8V A;  5HVF A;  4ECT A;  4DR3 J;  3TVK A;  1MWY A;  3SV3 A;  3OTD A;  2OI2 A;  3ZZ0 A;  1KFD A;  5F8N A;  5KG2 A;  4FXV A;  4WFN Q;  4CIO A;  2SXL A;  3OL7 A;  2XYH B;  3D3B J;  3GYX B;  5B0C A;  4WWS A;  3MEE A;  1HQU B;  5I42 B;  4KGV B;  2N7Y A;  2WSE C;  1DLO A;  5LT5 A;  3LGH A;  1S6P B;  2J9E A;  3Q2S C;  4F26 A;  1D9F A;  4YY3 F;  3CGI A;  4L6V 3;  5KOW A;  4MAK A;  5FII A;  4NCG B;  2IYI A;  2ZBI A;  1WC4 A;  2E5H A;  1TR0 A;  3QT5 A;  4Q5V A;  4LSZ B;  3CUN A;  5IS2 A;  2MLX A;  4KB7 A;  4U95 A;  4ENO A;  2W4C A;  4R25 A;  2FVQ A;  5SUH A;  3J81 Y;  2V2Q A;  2IHR 1;  2FQQ B;  4JI3 F;  1G7C B;  3OHA A;  2HQ3 A;  2MZQ A;  3MHY A;  5E3C A;  5D3G B;  1L3U A;  2HK3 A;  1VQP S;  2VH7 A;  2N4C A;  3J7Y U;  4JI4 J;  1R8A A;  3ENA A;  4DI6 A;  2BVZ A;  4RW4 A;  3FEZ A;  5ETQ A;  3NMR A;  5CYQ A;  4V19 X;  2OP5 A;  3QRQ A;  3NOC A;  2ZDO A;  1VCT A;  1NSA A;  3IRX B;  3EPI A;  5LMN F;  3FC9 A;  2PMH A;  3MMJ A;  1Q82 T;  2ZBP A;  1AUS L;  1SKS A;  1VFJ A;  4WYL A;  1FJC A;  4DV6 J;  1VK8 A;  5AE2 A;  4KE5 A;  2W9B B;  2F7V A;  2YH0 A;  1HNX J;  5KFT A;  3NGS A;  3CED A;  1HR0 J;  5L1K A;  3K8V A;  4B3S J;  3JYT B;  3DI6 B;  3BH7 B;  4Q44 A;  2V2V A;  3OBI A;  3HT3 A;  4OYO A;  4DXL A;  2FVC A;  1UP1 A;  4CLT A;  3BSN A;  4OQJ A;  3HP6 A;  1QJH A;  3G86 A;  4OHX A;  5HMX A;  4RKU C;  3MED A;  2L3M A;  1JLB A;  3M9N B;  4A8Y A;  1XR6 A;  4NLG A;  4WFZ A;  4ER8 A;  1U6Z A;  1SV5 A;  1V5I B;  2CNL B;  1CG2 A;  3UPF A;  2K2P A;  4M5D A;  2YKO A;  2VHG A;  1N5Y A;  2EFO A;  3RYL A;  3PW7 A;  3FK4 A;  1PJ7 A;  1IKW A;  4Q7A A;  1ZA1 B;  1RAH B;  3GCX P;  4PWD A;  3M8P A;  4LRB A;  2MTL A;  4QU6 A;  2H5E A;  4DV3 F;  3BQ0 A;  2VQE J;  3NAH A;  4P52 A;  2GZO A;  3G87 A;  3W2W B;  3T6B A;  1IR1 A;  2V0N A;  3CCM S;  4RW7 B;  3OLB A;  5JMN A;  2F40 A;  3DC2 A;  3MR3 A;  5EWG A;  2W4D A;  4EO8 A;  4YFU A;  4EZ9 A;  2E1P A;  4C8K A;  1APS A;  4OX7 A;  3D6F B;  1UA0 A;  4HLB A;  2ZM6 F;  3KG4 A;  5IWA F;  1NDP A;  3V81 A;  1VC6 A;  4JI8 J;  2UUA F;  1BE4 A;  1HNV B;  4Y2C A;  3QAE A;  5LL6 d;  1AFI A;  5F0W A;  3TZZ A;  1FTC A;  3AH6 A;  1RGV A;  1XN9 A;  3FEX B;  2HLT A;  2VOO A;  2GO8 A;  1UFL A;  1WEX A;  2BMB A;  1RWM B;  1F5B A;  4ELT A;  2EC2 A;  2QIF A;  2ZUG A;  4OI0 A;  5KFU A;  3G4S S;  5FDL B;  2BEF A;  4FYV B;  2G4B A;  3T1Y J;  3MUV P;  2ZH4 A;  4HAC A;  2JEF A;  5EDW A;  3JQJ A;  2R7X A;  2QE5 A;  3KXD A;  2LVW A;  4U6P A;  2G13 A;  1TVR A;  3MDF A;  2M4M A;  4OZ5 A;  2HWH A;  1S99 A;  2W25 A;  3QPI A;  1EAR A;  4CWB A;  3IN5 A;  3MMA B;  4NYO A;  2FHM A;  1J5O A;  2IMO A;  1R0A A;  4G1Q B;  5K8O A;  1YG0 A;  4I2P A;  3UW1 A;  2XM3 A;  2IRY A;  2LQJ A;  2KFY A;  4DR5 J;  1U1L A;  5ITH A;  2RS8 A;  3Q8P B;  3H5Y A;  1RTZ A;  3BQ1 A;  3I0R B;  1KS2 A;  3CCV S;  3NS6 A;  3MMC A;  2HUR A;  4F3O A;  1DRZ A;  1RWX B;  3BR8 A;  3DRS B;  2ZNZ A;  3H2L A;  4A8S A;  2WOM A;  4IOC Q;  2EG1 A;  1RWW B;  3CD0 A;  1Y5N B;  1TMM A;  3UD5 A;  1X4D A;  2RKI B;  3LGN A;  4JI0 F;  3TW0 A;  2NR0 A;  1WTF A;  4XAK A;  5HAN A;  2YKQ A;  2MKY A;  2LXU A;  3PW0 A;  5EX0 A;  3Q86 A;  1S12 A;  1CJV A;  2YKN A;  1TFY A;  1BWV A;  1YKW A;  2IYG A;  4DR4 F;  5H9E J;  3VAH A;  3HT0 A;  5DLG A;  2Z2L A;  4PG6 A;  2Q43 A;  1UVL A;  1T94 A;  3FMB A;  2R4F A;  5E3A A;  4NWB A;  3PYG A;  4ZVT B;  2KHD A;  4DQR A;  4L76 A;  4TN2 A;  3B82 A;  4B17 A;  5HLF A;  2V5H G;  2AD9 A;  4WZM A;  3R5A A;  1PJ5 A;  2KM8 B;  3ETM A;  1FF2 A;  4DZD A;  3CJ0 A;  2A2D A;  1FE0 A;  2KT5 A;  4ID5 B;  4B9S A;  1BGX T;  2WVB A;  1FT8 A;  5DRK A;  1LXJ A;  5AT1 B;  4I0W A;  6AT1 B;  5C24 A;  3ADA C;  2NXE A;  4KY3 A;  3VAI A;  1MG7 A;  4OYI A;  1BD6 A;  1WNE A;  2V8H A;  3NXZ A;  3R6L B;  3KK3 A;  2XMV A;  2OEL A;  3FVY A;  3OL9 A;  1IKV A;  3ZZU A;  3IO1 A;  3R97 A;  3AD9 C;  5LJ3 Y;  2VBX A;  1FJG F;  4X66 J;  3IXQ A;  2FJD B;  3NBP B;  5F3T A;  4U8Y A;  4E2F B;  3ZTP A;  1S1T B;  3CMQ A;  4RNM A;  4HVZ A;  4WXW A;  1MU2 A;  1U8S A;  4NCB A;  3BBF A;  3R7B B;  1MWQ A;  1JMT A;  5A8W B;  1HW8 A;  1QTN B;  1YJ7 A;  4PXE A;  5FJ4 A;  3NGK A;  4OI2 A;  3KLV A;  4FVC A;  3PVX A;  4JI1 F;  5E3R A;  5DG8 A;  1OIA A;  2EK1 A;  3AD7 C;  1QSS A;  1T9X A;  1HBU A;  4LRA A;  4PQU A;  3GSD A;  4R8U A;  2R3V A;  3RRH A;  3MAQ A;  4B08 A;  1NK6 A;  2XSJ B;  4PUO B;  1YZ6 A;  4CNZ A;  2XLK A;  3UVJ A;  3LP1 A;  2GNK A;  2V4Q A;  4QW8 A;  1N36 F;  2NQP A;  1KD1 T;  4I6W A;  3GFH A;  3K5L A;  3OQ2 A;  1K0T A;  2GGP A;  2V8D A;  1XMO F;  4EYI B;  2AKW B;  4UT4 A;  3OXF A;  2BUN A;  2MSS A;  3Q8U A;  2ZD1 B;  3JAM U;  5KTQ A;  3IWN C;  5HI7 A;  2QZ8 A;  3QT7 A;  4FF3 A;  4H4M A;  2C42 A;  1HFE L;  3W9H A;  3BN4 A;  1R3N A;  4GMK A;  4DR2 F;  5KFE A;  1KLM B;  2X1G A;  4ECY A;  3H0P A;  3I56 S;  1FK9 B;  2DXE A;  1WD6 A;  1Y9O A;  2X1F A;  3FJ2 A;  3RB0 A;  1RBA A;  4GVL A;  4C8M A;  3UO0 A;  4MT1 A;  2XZT B;  2RRN A;  1N6Q B;  4ZJO A;  4IKA A;  2QL5 B;  3DLG B;  2P5V A;  2G1D A;  4CYU B;  3O8W A;  4IH5 A;  1U1M A;  2ZJR Q;  4B9M A;  2ZBC A;  5D4P A;  1OPZ A;  3TA2 A;  1LFW A;  2ASL A;  3NMA A;  2WW4 A;  1C1C A;  1QSY A;  3V6D A;  4P74 A;  2PT0 A;  2KJV A;  2B51 A;  2V69 A;  1QAJ A;  4YB6 A;  4KH1 B;  4AFF A;  3NS5 A;  2CRL A;  3MOJ B;  4DV2 J;  2MZ1 A;  2KRB A;  3FQL A;  1DTQ B;  4M5M A;  2DPJ A;  4X65 F;  4DHV A;  2RSQ A;  1HHQ A;  2MKK A;  3JSB A;  1JWW A;  2RQC A;  3SCI E;  1PGZ A;  4RW6 A;  2IBO A;  4I7F B;  4OHV A;  2K3K A;  2BQU A;  1NDC A;  4DU7 A;  3ZXW A;  1TV6 A;  2IRX A;  3TRG A;  2BE7 D;  3W61 A;  4X62 F;  2CPI A;  4Q2L A; 
#chains in the Genus database with same CATH homology
 2IIH A;  4FDF A;  2EEY A;  1EKR A;  2IDE A;  3JQK A;  2EKN A;  4PYA A;  3JQM A;  4PYD A;  2OHD A;  1EKS A;  3JQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...