1EKRA

Moac protein from e. coli
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
146
structure length
143
Chain Sequence
b'GEAHMVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSSGDFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN C
publication title Insights into molybdenum cofactor deficiency provided by the crystal structure of the molybdenum cofactor biosynthesis protein MoaC.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Translation
total genus 35
structure length 143
sequence length 146
ec nomenclature ec 4.6.1.17: Cyclic pyranopterin monophosphate synthase.
pdb deposition date 2000-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01967 MoaC MoaC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Molybdopterin cofactor biosynthesis C (MoaC) domain 1ekrA00
4PYAA 2IDEA 2IIHA 2OHDA 3JQMA 2EEYA 1EKRA 3JQKA 2EKNA 1EKSA 4PYDA 3JQJA 4FDFA
chains in the Genus database with same CATH superfamily
1FEEA 2UUWA 2IHR1 5KT3A 4M5GA 3T41A 4DCJB 1SJ3P 1QE1A 3RTVA 3DLKB 2N7CA 2R2RA 4KB7A 3DLKA 1UTAA 2K3KA 4JI1F 3TNVA 1Y0HA 2R7WA 2KM8C 4F67A 1U1QA 2IVMA 2VPYB 2IM2A 4M8LA 4NYPA 4P52A 4IG3B 1T9UA 5HVHA 4MFBA 3V6JA 1UVMA 4TLRA 4Y2AA 4QIGA 1HNZF 1RA7A 3U1LA 4IG3A 3BZQA 2WOMB 1H0HB 3B4MA 2DD8S 3QPIA 4EWTA 1V3RA 4EBCA 4DSKA 1BHNA 1Y4ZB 2V9WA 4USJC 1HNIB 3CC7S 2WAQD 3R5BA 1PYSB 2LDYA 5HANA 1HNIA 2KN4A 4DF4A 2RUSA 2AMCB 5DQIA 4PUOB 2GO8A 3NAIA 4YR3A 3RW6A 3KK2B 1JNZB 2FC9A 1RAIB 4PUOA 1WJ9A 2PMZD 2CPDA 1L3VA 4I6YA 3KK2A 1FXRA 3GFHA 3QQCD 1FD2A 3WBZA 3VALA 2CPZA 4IDKB 4QIFA 4FS2A 3ZNUA 2NUHA 2DCUB 3MCNA 2YWGA 4J9QA 1J5EF 1NJIT 2ZKUA 1FD8A 4KGMA 3D6HB 4OX6A 2YX4A 4EZ9A 2L3MA 1OMSA 5CZVA 1U4BA 3Q8VA 5BJRA 4R5PB 1S1UA 3ISZA 4KR0B 2MLYA 2VOOA 4R5PA 4LSZB 2KDOA 3HKZD 3DYAA 1V6HA 1AT1B 1NZAA 2DHXA 3JS9A 3MM6B 5GADU 4ZLLA 4LF6J 1WEXA 4HLBA 4OI6A 1FDBA 3MM6A 2YX1A 1SJQA 4O3NA 4N7TA 1IBKF 2KYZA 4JYAF 1EKRA 1HNZJ 1FX2A 2HEKA 2UUCF 2A1BA 3QRRA 4AYBD 1JLFA 5D4NA 2VOPA 1HI8A 1HNWJ 2OPRB 4ED4A 1MG7A 2FVQA 4RPFA 3GILA 3MEGB 2F9DA 3NBPB 2OPRA 3QWUA 2F8EX 3MEGA 3P96A 4G65A 2ZFHA 3NBPA 1F9EB 2RNEA 1N36F 4IUFA 3RAQA 2DGOA 2JH3A 3MPUB 1RT6A 3LA0A 1S59A 3ENWA 4X4QA 2DPIA 2WBMA 2MKSA 5I42B 2J9CA 1WOSA 3M2VA 4ZVSB 3M05A 2WK4A 2HNDB 3CCTA 2FHMA 1OY6A 3QIDA 2FJBB 1SCJB 1XMBA 1ROFA 1SH0A 3FVYA 3VGVA 3RB3A 3HHDA 4JV2A 4K0KJ 3CDAA 3UN3A 2R7QA 2V8HA 3A8JA 3SFUA 1J5EJ 1LWEA 2FJVA 2JHEA 4LRDA 1RCXB 4DV7F 2XCAA 4NLYA 2QX0A 1N52B 3WZ0A 4J9SA 2EVZA 4P2SA 4PXEA 4LF8F 3CD7A 1RU1A 2ZBQA 4EK2A 2Z2MA 2WVCA 2YBVA 3PW4A 4PEOA 1RE1B 1VGYA 2IBOA 2O5DA 1HBOB 5JVHQ 4KIAA 5DS7A 3R7BB 4XDDA 4CLSA 3S6EA 1KKHA 4JV1A 4I6WA 2NZ4A 4NOHA 4DPUA 1PKUA 3TW0A 1YJVA 1TQLA 3LP0A 4ZVFA 4RW9B 3WC2A 1IBKJ 4YB7A 4BC7A 2XTJP 4USIA 4TLQA 4W4MA 2UUCJ 3FSXA 5CYMB 4NA3A 4DV5F 1VS3A 2R8GA 1U25A 2X1AA 2FLPA 4DSJA 1RTJB 5M2RA 2Q3PA 3GJQB 2CZ9A 1N32J 3DLHA 1RTJA 4ED6A 2RRBA 1B0TA 1TKXB 4EGLA 3LPEA 2C2MB 1ZTTA 2XB2D 2EFPA 2AZ3A 1TKXA 1RSCA 2MQLA 2BABA 3EE3A 5IT9U 2CXEA 3D0HE 4ZVQB 5I3QA 5MAOA 4PABA 4OYXA 2K3IA 3PYDA 1K0TA 4ZCKA 1CQMA 1PAEX 4DQIA 1YZ6A 3EZOA 3AA9A 1S48A 4Q43A 1U0HB 4DUZF 2IYGA 2WB1D 4RR5A 1TU0B 2XZWA 4DS4A 2Z2ZA 4DV7J 1U0HA 1ELOA 1FRHA 3A3PB 3I9V9 4GVBB 2R8KA 2AP6A 3M7VA 2XNQA 2EC0A 4WCEQ 2P2CB 2Q66A 3IAS9 4IH7A 2WTFA 5K8NA 4JUZA 4KGVB 2LA6A 3NCPA 1TL1B 3ISNC 2IPOB 4DL3A 4DCPB 4AT1B 2GC8A 1E6YA 1FK9B 2OO4A 4F50A 5U47A 3ENAA 4OI4A 2H5JB 5B09A 2KFYA 2Q79A 1FK9A 2QFIA 3U1MA 4ITSA 2OEKA 4TU9A 2ZKTA 3ILIA 2UVVA 1N0UA 1LOUA 1YRTA 1Q4RA 1H98A 4YN3B 1X4BA 1GNKA 2K7KA 1U24A 1N6QB 2HW3A 2RAQA 1XBWA 5J2MB 2FVSA 1TV6B 3CD0A 5B0BA 4EBEA 4F4AA 1N6QA 3H20A 4C8LA 2RKIB 5HQLA 4EFAC 4X4SA 3H5SA 5CAAA 2EK6A 3U02A 2XI2A 4I2PB 1S1WB 1GFWB 2RKIA 3BF4A 3DHWC 4IRKA 1GTEA 3PZPA 5BYQA 2AX0A 3VAKA 1S1WA 3SXLA 2IC3B 4U7UD 4TQRA 4LIRA 4BDPA 4NLDA 1RZMA 4DUYF 2BDPA 2IC3A 2B7CB 3G6XA 5LJ3Y 3HSJA 4DUZJ 1HWLA 3HT3A 2M9KA 4ECQA 3GTYX 1I1GA 4PZVA 3QGIA 5L46A 3WDOA 1LV5A 2DXDA 2ROPA 3MM7A 3TRGA 1NEEA 4UZCA 1PO6A 2HZCA 2GJIA 4N8NA 2E1PA 2NXUA 2JFDA 5A8KA 3W60A 3I56S 4X4VA 2QA2A 4ZPVR 3QGHA 3QJPA 2BKOA 1NH8A 1M0SA 5D4PA 2BZ2A 3PRVA 5DDQC 4DV0J 2YWFA 3FNNA 4PWDB 5HJYA 4F2SA 3MAQA 3TA2A 4OYAA 2ZH1A 4HT7A 4CH7A 5IV3A 2ZBRA 1HWIA 2WVEA 4WFYA 3DOKB 2PE8A 4YS2A 3L4BC 2DO0A 4PG5A 1QAYA 3DOKA 1KTQA 1G1XA 3BBBA 2B0GA 3QT5A 2VFTA 3W3SA 3AD9C 4R0JA 5IC6B 1S6PB 4G3IA 1SJRA 2KT3A 3L7UA 4PXCA 4RLEA 3W64A 1CC7A 1S6PA 4ZHRB 4K5RA 1TZ0A 1WF1A 2R8JA 2Y1RI 4CCHA 5GMDA 4ZHRA 3IR5B 2IM0A 2HVIA 3BSNA 3CJSA 3UCGA 2WW8A 4P9SA 4JI6J 4DUYJ 1FA0A 2E7VA 4UUWA 1HARA 1H73A 4LF5J 5IS2A 2AJ4A 2XYPB 5L1LA 3MD1A 1VRUA 1VQPS 3H5UA 3GV5B 1L5UA 4LT6A 2HQCA 5HVFA 4DS5A 3RRKA 3W5ZA 3L3CA 2G1HA 3PM9A 1I94F 4DR4F 2DB1A 1Y00A 1RU2A 1Q7YT 1G2EA 1WDTA 3T5LA 3PNIA 1W7WA 3H5XA 1XNQF 1S12A 2NS1B 3PTWA 5A8WA 4ZLNA 1RABB 3X3UA 3A1YG 3H8YA 3SV3A 3MECB 1ZPWX 2ASDA 3CDBA 2DR6A 3SCLE 3DU5A 2A2DA 4E0DA 3PFOA 3ZZTA 3BDPA 1J5OB 3CSKA 3TANA 1L3KA 3TO8A 2L41A 2ZVIA 1YJRA 2OELA 2HVDA 2ZE2B 1J5OA 2J6TA 5C2GA 2F8HA 4DL5A 2R7RA 2RDJA 4QJVA 2ZE2A 3GP9A 3HF5A 4OMFG 3CCES 4KHPF 3PO4A 2XMJA 3EGNA 3TUPA 2F65A 1QD1A 2NUUG 4C0HA 3EXYA 3KJNB 2ZBPA 2OSRA 2ZWPA 2M4MA 3R1LA 3VAGA 2NZCA 3ITHB 4WU3A 2QMUB 1IR1A 2OJ3A 3ITHA 4PQAA 4C8YA 2LEBA 2Y0SD 1GMUA 3MPYA 2C1EB 2D41A 1MN9A 3Q22A 2JJ4D 5ITHA 5CCLA 2OPPA 2ZH5A 3CD6S 3KHGA 2XYGB 5KFNA 5BYRA 3JAMU 3DI6A 3GWCA 2DY9A 3DLEB 3V4IB 1I94J 1NSAA 4DR4J 1YRXA 4DR3F 2DR9A 4OZ0A 1OY8A 1X5OA 3HZGA 4I68A 3HPOA 3MMJA 3V4IA 4F0HA 1XNQJ 1JMTA 2VG5B 2HBZB 3GYXB 4FP9A 2VG5A 2UXDJ 3V6HA 2WVDA 2XWYA 2JEIA 4L6V3 4B9MA 4ETXA 4K59A 2CNLB 4A8MP 4P75A 1UEVA 5GAHU 1OIAA 3E2EA 1CJKB 3LUYA 3W66A 5I4MA 3NL0A 2QYCA 4J9PA 5GAGI 4QCLA 1CJKA 1HBUB 3LGNA 2VIHA 4IR9A 1HBUA 1T02A 2B3TB 2KXHA 4DFKA 4MIBA 3KLEB 3KUHA 2HIYA 3CJ8A 4B3TF 3W61A 4ILRA 3KLEA 3AJDA 3VR1A 4XAKA 2APOA 2J9DA 3LOUA 2HVHA 1VYAA 2DIUA 1VISA 2QLXA 3QAEA 4NCGA 1WG5A 3PCOB 1RWPB 1UWBB 3EVMA 3Q8PB 1VRQC 4MKVA 1V5VA 1D8YA 3CMES 2YNFB 2GO9A 4QWCA 1FRMA 1RAFB 3IMQJ 3AOAA 2RRAA 3O6QA 1MWQA 3D3BJ 1FFSB 3OVBA 1XNRJ 2VD3A 1FDNA 4C4WA 1XC9A 2KJWA 2DITA 5DQHA 1ZM9A 2A3JA 4FZVA 1RWOB 4B08A 3T3FA 4CO3A 3KG0A 4B9TA 3D67A 3IG1A 3BQ2A 2V2ZA 2EEYA 3LWLA 2RDIA 3W7BA 1BQMB 1RAEB 2CFXA 3ADAC 3O44A 5LM7E 2V2KA 3R2DJ 2ZEJA 2G9OA 2IYIA 4Z37A 3QNWB 4Q8FA 3MUVP 2NR0A 4AL6A 2R3VA 2YQ1A 3KK1B 4ECYA 3WX8A 4YY3J 5J2NB 4GC7A 2HYIB 3KK1A 1HD0A 4KH1B 2G0CA 5DJBA 3RB0A 3CB4A 1AXQA 4QYZJ 3B8HA 3HHLD 4B9LA 5EN1A 4RX6A 3HVTA 2FHJD 5KT2A 3DRPB 1WSVA 3ZC4A 3PEJA 3IRXB 3JSYA 3DRPA 3D6FB 3N9UC 4EU0A 2ZBIA 5HN0A 1WC5A 4FYYB 3IRXA 2KRBA 3RBDA 4YFUA 4A8WA 3FK4A 1P8GA 3HSZA 3PRDA 1H38A 1IBCB 5KOXA 4AD6A 1S79A 4DL7A 4ECUA 5E3CA 3V5RA 3MCSA 2IRYA 1OO0B 3G71S 4ECSA 4NLQA 2MXYA 2D3ZA 1RQ0A 1FJCA 4FF2A 4WFXA 1HKAA 5D3GB 5KFZA 1R0BG 1S4EA 2DH8A 2VKZG 2IJRA 2W4PA 4ICLA 3CIZA 1VQLS 1SI9A 4JV0A 5E0OA 3QSIA 3RU0A 2Y1LB 3VZHA 2FD2A 3T6BA 2XMUA 2FVCA 1U1RA 1VQ8S 1SUQB 1GAOA 2YWEA 4AE5A 1OY9A 4XPCA 3KLIB 3F0NA 1SUQA 1R8CA 3SYZA 4FVCA 3ENQA 2R42A 3S7RA 2ASLA 4GKJF 3L95X 3CUNA 5FD1A 2MKJA 4LF1A 5AXLA 3C15A 2P5VA 4YB6A 2PIIA 2YKPA 1EQMA 1RTZA 2GHVC 3TA1A 1UFWA 5HMYA 1HNVA 4ECVA 2OI2A 4ER8A 4AQYF 2ATLA 2DGXA 2RH3A 2JZ5A 2RVJA 4WE1B 1IUJA 4USVA 3ULHA 1FNXH 4AL5A 5KFCA 2UU9F 4WE1A 5HI7A 3CJ5A 1SQEA 4LFBF 1X4FA 3J7A1 1U1LA 2CQDA 1C0UB 2N4DA 4PWUA 1U2RA 2V8DA 3H2LA 3R5JB 2F5GA 2V94A 1VQYA 3O5TB 1NHVA 3N5FA 3ETOA 2LYVA 3BR8A 3PW5A 4OI1A 4ECTA 2A6MA 1RHMB 5T14A 4MKBA 1M5HA 2LKZA 1N5SA 3AXKA 2V63A 3VAMA 1UETA 2LU1A 2CNNB 5AXNA 3BJYA 2HFVA 2J8SA 2CKWA 4TU7A 2VC1A 1TKTA 2Z4PA 2VKRA 2V2VA 3E01A 4URQU 3DRRB 5HO4A 1K44A 4UTGA 5L39A 1UA1A 4C9DA 1TL4A 1DQ9A 2Z57B 3HO1A 2IA6A 3TJ8A 2B5JA 1S9EA 3BO3A 4M5IA 3M2UB 5E3PA 3EWGA 1ZA2B 4Q0BB 4ECWA 3W62A 1VOMA 1RAAB 1VFJA 3BEGB 2BJ7A 4CWBA 4N41A 1Y5IB 4Q0BA 1QDUB 3GQCA 2UV8G 1RT1B 1P27B 1QTNB 4AQYJ 1XIQA 2PC6A 1Y3JA 4USMA 4F04B 2VC0A 3FDSA 1MWZA 1BY9A 3OVAA 2HZAA 4DCOB 3JQMA 1PBAA 3RB4A 5KFEA 3G8SA 5LSOA 4JV5J 1JK9B 5HQ8A 4OV1A 1I3OB 1EJ7L 2JLGA 4B3SJ 4ELTA 2VASA 1ZAVA 1S72S 2ZJPQ 1TKZB 4J37A 1LW2A 3UFCX 1KOHA 1CQNA 1JXEA 2XYHB 2JC1A 3CDUA 1TKZA 2DHHA 1B3TA 2HRUA 4DQQA 4EO6A 2CA9A 3J80Y 1JJ4A 2L48A 2BQRA 4B3OA 4YR2A 3GJTB 3ET6A 3JSRA 4X4UA 5L1KA 2HHSA 2QE5A 3M8PB 4P10A 3VGTA 4P74A 2MZJA 4X4NA 1RHUB 3NLCA 1Y9OA 3M8PA 3HXMA 1FXLA 1K0VA 4P7VA 3CCZA 5DZ6A 3MMCB 3G6YA 5H1SV 2XHWA 5EHHA 2RUGA 2W7OA 2EXUA 3M9OB 2LXFA 3DLJA 2HQIA 4OYBA 1WC1A 2EBGA 5L8RC 5EWGA 5I3UB 5KFXA 1S0NA 2VQEF 5HMXA 3W8GA 4G1PA 5ETKA 4X4OA 3TX8A 3HMJG 5I3UA 3MGJA 4PWWA 4EO8A 3DLBA 2QV6A 1FERA 2FJAB 1WD6A 1R27B 3Q8UA 1DFDA 4B9VA 2JEFA 3PX6A 3Q8YA 2QN6B 3QT8A 2DNNA 2CJAA 5LJ5Y 2Q43A 3J81j 1NRKA 4C97A 4WFAQ 2FDNA 4J5OA 1R3NA 3UDCA 3NNHA 2D69A 2LA4A 2AGQA 3HFVA 4CO0A 1TL7A 5DM7Q 1HNXJ 3KDNA 2QRRA 1CULA 1X0PA 3ZNJ1 1T03B 4K8RA 4C8OA 2VQFF 3UO0A 4RW7A 2MY8A 3LF0A 1T03A 1BQNA 3GCWP 2VJVA 1QUPA 3FSIA 5B0GA 1T3OA 5ETSA 1QAXA 3IBWA 4B9SA 1WF0A 4I69A 1F6TA 1F5CA 4ECXA 4K7QA 2RIJA 3DLGB 2Z56B 5HATA 3F73A 2CWKA 4NASA 3DLGA 4O4RA 3OXLA 4DR6F 4FF1A 2XM3A 3HD2A 1D9FA 2XS2A 3EPGA 3ZO7A 3QGGA 4F7VA 4ED3A 4M5HA 1ZA1B 2MQ8A 2G0JA 1PBUA 2YPZA 1VQ9S 5ETMA 3ZZYA 3BS9A 4F4XA 5A8RA 4O3OA 1LNQA 4RJVA 3T1YF 4DR7J 4CO4A 2FC8A 4Z7YA 4Y28C 1O5JA 1DTQB 2VQEJ 1C1BA 1OQ3A 3M6XA 1DTQA 2JNJA 4PG8A 2CUYA 3RJMB 3HHLB 1C1CA 1UMJA 2BJ3A 3VAIA 4NEYA 5AXKA 3CMQA 4ELUA 1UEUA 3PEHA 4BWJA 3NS5A 3EJMA 1I5OB 1WHYA 5EWFA 5HVGA 4ES2A 4NLUA 1JJCB 5DDPC 1BMQB 1IKXB 3HSGA 3T5KA 2RB7A 3IWLA 2B9EA 3IS9B 3TQ1A 1IKXA 2VQFJ 1SC6A 3VVUA 4MYTA 4U67Q 3HD1A 2UUAJ 3I0SB 3CPWR 1URRA 4RW6B 4URGA 3UR0A 4CIOA 4QW8A 2MZ1A 1FWKA 4F4YA 2FQQB 3QWPA 1YITS 5G0RB 4RW6A 4F4WA 1VJWA 2VBXA 5MLCV 2E1RA 2CAJA 2B4VA 2WVFA 3CULA 4PPZA 4DR5F 2GNKA 2AYBA 2YKNB 2LFVA 3BM7A 4USWA 3I4HX 3M9MB 1UVJA 2LQ9A 2YKNA 3PYEA 3PJXA 3LP2B 2RU9A 4Q7AA 3DXBA 3KLVA 1T94A 1TAQA 3LP2A 2VPXB 1UJ6A 2XMVA 1F1BB 2HMIB 1FX4A 3K0JA 1HQUB 1H3DA 2E9TA 1JJ2R 4NLTA 3GSIA 4MTPA 2RS2A 2HMIA 4QPXA 1T9TA 4W98A 1RYRA 2DGUA 4X66J 3UW1A 1FKPA 2A10A 1LK7A 3MZIA 2WONA 3DLLQ 3RGIA 3WQPA 2KVQE 1D09B 1NSQA 4LBIA 2CPHA 4ZP9A 1ZETA 1HWJA 5CCMA 1NMEB 2XMMA 3JTOA 1B64A 1DY3A 2F3JA 4DSFA 3M8QB 1KONA 1CS4B 5GAGU 1ZM3A 3M8QA 4ZVPB 1SJFA 5H9FJ 1CS4A 2KXFA 2ADCA 4RO0A 3R6LB 1T7PA 3MPVA 2D1CA 5GMKa 1PIEA 3OL8A 4I64A 2R2UA 3OSPA 3RBXA 2QSFA 2NXJA 2HS3A 1KN6A 3DCAA 1GX5A 4ZPDA 3W1YC 2GQCA 1PJ7A 3A3OB 1PGZA 4OHYA 3DM2B 4YHHF 2O1PA 3W2VA 1S1XA 2QLWA 2PDAA 2Z58B 2IY5B 2MLXA 1DURA 4KHRA 3C46A 2FY1A 4Z7CA 2GIFA 3OT9A 3K8WA 1KQSR 2M8HA 4F26A 2VG6B 4CLWA 4P2FA 5H9EJ 4O3RA 2CQHA 1R31A 2BE9B 3KUEA 4NLPA 3E3XA 3R2CJ 1CJVB 3GU0A 1KVJA 5ETTA 3GIMA 2F4VF 1YSJA 4DZDA 4KSEB 2BX6A 1T8EA 1WG4A 4NCBA 2V4JA 3R1HA 1NZ8A 4OZNA 2FLNA 4L3KA 2YKQA 2DTJA 3ETMA 3OV7A 3H42A 1RAHB 1WI8A 4LF9F 4OHVA 2VHGA 5AJ3F 2BW2A 4TYAA 2PSZA 2PFDA 4ZA1A 3JSMB 1VK3A 3KDOA 4CH1A 1IVZA 3OUYA 1LFWA 2AJ1A 2ROEA 1TP7A 3CW2C 3JSMA 2ACYA 2XY6A 4WBFA 1F5AA 1R8BA 3WIVA 1N56A 5C25B 1EETB 4ZK7M 5A6PA 3I82A 3QO9B 1Y3KA 4FVMA 1EETA 2RS8A 2BE7D 3QO9A 4ZPCA 4J9NA 1FTCA 1UPPA 1NJYA 3OTEA 1AYEA 3MAHA 4CLKA 3KG1A 1RTHA 4UQTA 3K17A 4HACB 3HI9A 2H1YA 4C2MA 5KFHA 3ZTQA 3NCQA 4HACA 4DSLA 3RBEA 2KG1A 3OR2B 7FD1A 5F3ZA 3AA8A 1YZ7A 2QEXS 2N3LA 3KMSA 4O44B 5HLFA 4WWSA 1X8DA 1FWPA 4JI4J 2ACMA 2LXUA 1TR0A 3DRYA 2BJ9A 3KHRA 5JXSA 3NS6A 3CGIA 5HROB 3R3TA 1JLCB 2CQ1A 3D28A 4Y2MA 4WP3A 4UOFA 3M1VA 3MEEA 1NK4A 2RT3A 3I4PA 2AYGA 2IVFB 4CLPA 4FN5A 1JLCA 1JLBA 2LQBA 3PW2A 2HQGA 1CEZA 2R8IA 3LGHA 1DHMA 2QMWA 2DJWA 1C0TB 2WW4A 4KPCA 2NSBA 2SXLA 2CPXA 1RADB 4A4JA 3T9NA 4UQGA 1EHWA 4LF9J 2G2OA 4OYOA 5AJ3J 1WHWA 3JXOA 4NA1A 3VAJA 3MFHA 2MQMA 3G86A 3ZTOA 2LLZA 3EDRB 4L74A 3FRYA 1UFLA 3PX0A 4Y2CA 2DHGA 1N88A 3BBFA 1RWKB 2PO4A 1RACB 1TTHB 4U9RA 1AZSB 2OEMA 2KL8A 2DNOA 5KFOA 2UXBJ 5E33A 3DOMA 5D15A 2V50A 1AZSA 1EIYB 3MOZA 3K57A 5CD4H 3OD2A 3OTDA 2LCWA 4FXVA 2CQIA 2NXNA 4QBUA 1ICEB 1BD6A 3TA0A 5EUHA 1DAXA 3TUZC 2QFJA 1YJUA 2QMXA 4OYPA 2DIVA 1S0VA 2GA7A 2V8VA 2GS8A 3VAFA 4GO5X 4Q2LA 4YDXA 1Z1ZA 5IT4A 2WZ1A 1YKWA 3L7OA 3G8QA 2BJDA 4ZIWA 3VAHA 4NXMJ 2MZRA 1TVRA 4M5DB 5DLGA 3KMQA 3TZZA 3SMZA 4KRWA 4FKYA 4ZJOA 1UVKA 4M5DA 4LVNP 4LFCF 1YBUA 3OFHA 3CCVS 4G6VB 1YJ9S 1KD1T 2CQPA 4OV6A 4FPIA 1SKRA 5HK4A 2QA4S 3D6MB 4RBVA 3AQPA 1G6BA 4PQUA 4KT0C 2KT5A 3HHEA 3R7SB 3BN7A 2Y8WA 3M32B 5M2UA 2RF2B 1NJXA 5KFPA 2HFNA 1X9MA 3M32A 3OL7A 1GMWA 2RF2A 1MSWD 1EKSA 5KOWA 2O3DA 1TK5A 4UOHA 1M5OC 3OXFA 2N4CA 2KVIA 3FBCA 1UPMB 3UCZP 1PAUB 1XMOF 2BANB 2YY3A 1SH3A 1TL3B 4R8UB 4HHHA 4YUDA 2CJXB 4J9MA 4DL6A 1HBNB 3QRPA 2YH0A 1TL3A 1OS5A 4ENOA 1Q8KA 2UV8A 2E66A 2BACA 3SEOA 1QAJA 2GMLA 2EG1A 1T3NA 4QU6A 5D78A 2G0IA 5C24B 5BYSA 1T05B 3L09A 4N56A 1HIYA 3VQTA 4MKYA 3QLHA 3OXGA 4YDDB 4X4PA 4O3PA 3JSBA 1KLNA 1ZM4A 2Z8QA 1FRLA 2YPYA 2X3GA 2BVZA 4J91A 1HR0F 1MW7A 2VA2A 1S57A 1RT4A 3OR1B 3D1QA 1RT7B 1U7LA 2KZMA 5J2QB 3N6NA 3H2VE 2IFXA 3KNGA 1U1OA 1RLDA 1FNOA 3OR1A 5KFSA 4F8RA 3DMJA 2YWKA 2FLOA 5J2QA 2BM1A 3QYYA 2BV3A 2CWXA 4WYLA 1P9YA 3PR5B 4PYAA 2YNGB 2VG7A 3D5MA 2AJ2A 1REGX 2XSJB 1D8ZA 1LWXA 3B6BA 2YNGA 1NKBA 2QO3A 2J7UA 4UF4A 2XSJA 2F7VA 3EVOA 4DL2A 3P5BP 2QG9B 3KLGB 3AODA 4QR2A 4DBQA 3FZBA 2HHHF 1FCAA 1RUSA 1RT3B 1DJ0A 3UCUP 3ENVA 3D68A 5G4DA 1RT3A 4KTQA 1S0OA 1D9AA 2YKMB 4C8ZA 3CJ3A 4ALZA 3M8SA 4ED7A 2BUNA 3ZZ0A 2HIQA 1KLMA 3HHKA 1YBAA 1FHTA 2MZQA 2YKMA 5F9LA 1RAJA 3GG1A 5IC4B 3FMWA 1VIOA 5KFKA 1NHKL 2QLJB 3R5AA 1RTIB 4EMDA 2ZH8A 4X84A 3CC4S 2D7SA 4Y65A 2BJ1A 1S6QA 5I3PA 3UN5A 1RTIA 1KQKA 5J1EB 3Q2TC 4W92B 1U48A 4M1KA 4ZOSA 2GCFA 4DV4J 3JQJA 5FLXY 3CO0P 4KE5A 4NLOA 5J1EA 1H2VZ 5FDLA 1WC6A 3MCOA 3OL9A 1BQXA 1F5BA 3ELHA 1L3SA 3CO9A 5K8MA 1FWLA 2OMOA 2ZZTA 1DQ8A 4PXBA 1D1UA 5T7LB 1I51B 5A76A 4ZPAA 4J7CA 3OJSA 4QZVB 1SV5A 2V4QA 1HMVB 5IWAJ 2E7WA 4G1QB 4A8QA 4CLFA 5CD4A 1HMVA 2OAUA 4LRAA 2E44A 2LU2A 3RAXA 4G1QA 1V3ZA 2FZKB 2ZUGA 4CTAA 1TUGB 3FCVA 5CH7B 4OLOA 1RWMB 1VBXA 2YQ0A 2VF3A 3HKWA 2HHHJ 3SQGB 4C11B 4DPXA 3PYGA 1VBYA 1IKWB 1GT8A 3O3LA 3QZ7A 3GB0A 3CJ2A 3SQGA 4QWBA 2RHQB 2KKHA 4IQXA 1IKWA 3GPAA 3K58A 2UXCJ 3MTKA 5DG9A 1HW9A 2KTQA 3BO4A 1Q5VA 3QRQA 2DR5A 2RJZA 1YGYA 4UOCA 4IQMA 2HPUA 3UNGC 3IA0A 2AIRB 4P72A 2HRTA 1W2BR 4YP3A 3LP1B 4LF6F 3MTJA 2IRUA 4EBDA 2WVBA 3UQSA 2OH2A 4GMKA 4C3MA 2IM3A 2DNPA 3LP1A 4WPAA 5CZXA 5F8GA 1L3UA 5D6GA 2AF6A 3GCXP 3FBBA 2B51A 1RB0A 1HNWF 3M6VA 4CZCA 2DNMA 2WOMA 5AE2A 5EDWA 1RWWB 3KUGA 2D3OR 1RWVB 4Q8EA 2V6AA 2FYXA 2FVPA 1KHVA 2RRNA 2C2NA 4OJGA 3TEGA 4IG0B 2XLIA 1YBTA 2E5LF 3G9CA 3MR7A 1UVLA 2HFZA 2B4OA 5IXUA 1Q8BA 3N5BA 4QIVA 1S7HA 1VQ6S 2KB2A 4JI7J 3NGUA 4RW4B 4K0KF 4WXOA 4C3LA 1N54B 2M0GB 4TN2A 1KSPA 4IDKA 3UNYA 1ZM2A 2VB6A 2DR8A 4CT9A 3KHLA 3AOCA 5CYJA 1FT8A 5B0DA 4OHXA 1VLYA 3CJ0A 2DVIA 2PEHA 1BLUA 4USTA 1VQOS 5HSPA 4LRCA 5D0EA 5HQMA 4J9VA 2DY1A 5F41A 2BKNA 4IR1A 4O0IA 3OFEA 1NLKL 5K14B 2M8DB 4ZN1A 4TVAB 2KG0A 4WP9A 1YHQS 2LMIA 2O66A 1T95A 2YWHA 1SBRA 1WACA 1FJ7A 3MCMA 4ES3A 1VQNS 1RGVA 3EZ5A 3MR3A 3UPFA 2J6UA 2G4BA 3THPA 4DMZA 1TFYA 4JI5J 4CM2A 4QIWD 1FE4A 2QYGA 1FVSA 3W63A 2DNKA 2BQUA 4K4UA 4QYZK 4PG4A 1UA0A 1N32F 3TARA 5DDRC 3LH2S 4A8SA 2OP5A 1Q82T 1MU2B 1WC0A 2E5LJ 4CLYA 2OGUA 4JI3J 2BJ8A 1MU2A 1NB7A 4CO2A 1LFPA 2LQ5A 3U1NA 3OTCA 2YKAA 4L75A 1J27A 4LSLB 2HFOA 2E29A 3VWSA 3HDSA 1JNRB 1U1PA 2W2OP 4DX6A 3CCMS 2C3MA 1R0AB 1WF2A 2YQ3A 5I42A 4NXNJ 4TY8B 4BHQA 5C2CA 4WF9Q 5A2QY 4P7TA 3MR6A 2CYYA 2HNDA 1R0AA 2AJFE 2GMJA 2B9WA 4TY8A 3D66A 4DL4A 2JLEA 2EBEA 3ZXWA 3GIKA 4CLUA 3MMAB 4KPYA 2OD6A 3MM5B 2ZNYA 2B6AB 3D6TB 1N33F 2XI3A 2NLWA 3HJFA 2HHWA 3MMAA 2GQ2A 2JWNA 1CG2A 4LF7F 3MM5A 1IKVB 2B6AA 3US5A 5HP1B 4NZ7A 2KFNA 4CRJA 4QQBA 2ZUAA 1PC4A 4PG7A 1XERA 4PKDB 1SC1B 1HBOA 2KM8B 2GZOA 1HPZB 1X31C 2AEFA 3R7NB 2ILZA 1UL3A 4B3RF 1HPZA 2VUGA 4EEYA 4ED2A 1IBMJ 2HVEA 1JKHB 2GAHC 3B82A 1XR6A 4Q2MA 4DG1B 1R8HA 4DR1F 3PJWA 4ES1A 1JKHA 5IOLA 4DG1A 2C28A 4RW9A 1FO1A 1X60A 5DGBA 2UUTA 2YNHB 1WDDA 5CYMA 3W2WB 5K8OA 1L3TA 1Y5LB 4BBYA 2A6OA 4LBPA 2YNHA 3FBEA 4DPYA 3MF5A 4OL8A 4DV6F 2ZDPA 2AGPA 4URSA 1IM6A 1S9GB 4M63A 1OSCA 2DH9A 7AT1B 4ANEA 1S9GA 2MKYA 1ZS6A 3PIOQ 1HHSA 2J6SA 4FXDA 1B7YB 3MR5A 6AT1B 2FGOA 2K1RB 2ZZNA 4ZPBA 4DWIA 2MLZA 5KFRA 1B0PA 2K1RA 2GV1A 2IA0A 1XTZA 4NX9A 4RL1A 1NKEA 4X2BA 5L1IA 3H0PA 2IVYA 3CDWA 4KHMA 2AKWB 3AB4B 2ZJRQ 3D1HA 1N33J 2IMWP 4MKAA 1LK5A 2YH1A 2VBYA 4LF7J 2Q1LA 3OHBA 4F0MA 4GVBA 1MMNA 4IOCQ 1D9DA 3Q86A 3R9LA 1WUUA 3LPYA 4DSIA 1WOPA 5L1JA 3RG6A 1EQ0A 4PG6A 4DLGA 2GHWA 2R2TA 4HTJA 1E6VB 4B3RJ 2AWZA 1TL1A 2FJDB 5CXTA 4DV0F 2MPUA 2GMHA 1TL5A 1P1TA 4ETZA 2OSQA 1E6VA 4DX7A 1T9YA 3N79A 2ZH6A 4DR1J 5ADZA 3FFIB 2I5JB 2CADA 2H4YB 2M70A 2HHXA 4BCAA 1UJ5A 3FFIA 4YOEA 2CIMA 2QA1A 1RXOB 1SC3B 3EXCX 4RNMA 5IT0A 2N82B 3TUJC 3TOQA 1YG0A 5D4OA 2FY8A 1SL0A 5ETVA 5CYQB 4Q45A 4DV6J 5ETPA 3Q23A 5J2MA 1A9NB 1TV6A 3SV4A 3MPWA 3K5MA 4KV8B 2OD4A 2CJBA 3ZFVA 3ZZRA 4I2PA 1ZH5A 4IO1A 4KV8A 4MT1A 4AXIA 3BBCA 3PJ9A 2EWHA 3LO3A 4JI6F 4LRBA 3D9BA 2H54B 2X1FA 2VJUA 2FB0A 2EFGA 4B9NA 3R5CA 4FS1A 4LF5F 1NJZA 3FC9A 1JLGB 2F4FA 2KYXA 5K5MA 1MMDA 3O2IA 3ZZOA 4I7FB 4IYQA 1OYDA 3RRGA 1F2GA 3CF5Q 4FYXB 3PHTA 4O0NA 2Y8YA 3NMAA 4B17A 3GFXA 3RB6A 4DF8A 4F4ZA 4NZ0A 4NLXA 3IP0A 3DDNA 3NMRA 1WWHA 5DDOC 1U2FA 3TEHB 2JVRA 1N5VA 4MIWA 3NRBA 3KHHA 2DNYA 2W2QP 1RISA 1YRUA 3Q24A 4ZCLA 1HQEB 3AXMA 4QW9A 2CNOB 2VONA 3MM8B 1C2PA 1UAWA 4PWDA 4ID8A 2V34A 1HQEA 1VQ4S 2GHPA 2Q6BA 3BV8A 3AD8C 3OBIA 3GONA 4TYBA 2XS7A 4C8MA 3IFEA 2MHEA 2HRYA 1SJ1A 2V9KA 1K47A 5HL7Q 2MGZB 4CH0S 1X9WA 2AJ0A 2VDHA 3BGOP 4DV3F 2HURA 2UP1A 5DG8A 2WHOA 3M6UA 2AGOA 1O8BA 4XPEA 3NGDA 2P8IA 4DFPA 3GYNA 3IC1A 4P2XA 1TKDA 3HK2A 4JOUA 3FRZA 3T9ZA 2VDIA 4S0MA 4UY85 4OZLA 3EX7B 3D2WA 2E5GA 5ETNA 2RSQA 1DTTB 1RCOB 3AQOA 2W24A 4NLRA 1A6LA 2GAGC 1QM9A 2J0SD 1DTTA 5C42B 2CQ0A 3EPIA 1F2HA 4DEZA 3C8YA 5C42A 2JEJA 1AB8A 4USUA 2JL9A 5AT1B 1YJ7A 1JQGA 4ID5B 3H40A 2KHCA 1RAGB 1MMLA 1AW0A 2WBRA 4GC6A 1RTDB 2Z2YB 4ID5A 3DRXA 3GLJA 2VFUA 2IMOA 1RWNB 3EGVA 2UXDF 4V19J 3Q2SC 1RTDA 5KFYA 5DETA 1HFEL 3PACA 1RKJA 3N4WA 5LMUF 4HTIA 3MECA 3KYLA 3PY8A 1DLOB 3A8EA 2FVRA 3V6DB 1NAQA 8RUCA 3CEDA 3UD5A 1VCTA 3K7RA 2QT7A 3V6DA 2ZM6J 1NJWA 1LQ9A 4ZP7A 3MEDB 2UUBF 1NSPA 3MEDA 4LR8A 4C7QA 1HW8A 3TVYA 5KG3A 3AB2B 4OQJA 4DV3J 2W9BB 1R8PA 5B0CA 3PG9A 2FIUA 1VC6A 5HBMB 4U8YA 5KFUA 4OJHA 2XEXA 5F0UA 1EAYC 5HBMA 1SJ4P 4X4TA 4OZ2A 3OPKA 3UE2A 2HBRB 4HH0A 1MLAA 4WZQA 1S1TB 5LT5A 2I8EA 1CJUB 1Q8LA 4RW8B 4NA2A 2F63A 1CVJA 5KG2A 1XNRF 2Y3YA 1CJUA 3OQ2A 1VQMS 4RW8A 5DO2A 2PMWA 1Q79A 3H98A 3H7HB 3KJQB 2HFSA 3POTB 3D0GE 4ZP8A 3K5NA 1VHFA 3DLEA 2RQMA 2B8PA 3J81Y 2DGTA 1IWAA 3KXDA 5B08A 3G4SS 3UDVA 2CVEA 2XNRA 3WX4A 1S99A 5LMUJ 1DQAA 1FXDA 4KH0B 3GIJA 4NMLA 1IBLJ 3ILJA 2X7IA 1S49A 3N6MA 2DK2A 4O4GB 3KTQA 3CCJS 2VA3A 1KQFB 2EFNA 3CCWA 2VZ9A 2VPZB 8ATCB 4YY3F 1HYSB 5ETQA 4AUKA 2FGCA 1PJ5A 4XO0A 2UUBJ 3RW7A 2CJ9A 1TAUA 2XMTA 3VHQA 1YVFA 2PD1A 3J7AN 4TXSA 2ABYA 2MJUA 4WIQA 3CCRS 5IM0B 2CRLA 1YK9A 2HFUA 2XWXA 5IM0A 3D0IE 2V2QA 2DGVA 3ZTSA 3J80U 3NP5A 4FNHA 3FUYA 2HZVA 4G1IA 2HKEA 1RDRA 2C3PA 2D9OA 3FQKA 2E1MC 2W9CB 2EK1A 4DV1F 2B56A 3THVA 1UWBA 5H9FK 3BN4A 3C6UB 2OPQB 2W9CA 3LGMA 5GAEI 2YNFA 1U09A 3L7PA 1WTBA 3BQ1A 2OPQA 4YQWA 2JX2A 4YMEA 3P5TL 2ASJA 2OIHA 4C98A 2MKHA 5J1PA 5T41A 2FHKA 2XC9A 4WU2A 1QE1B 4F25A 4P2MA 2I1RA 4BS2A 1VK8A 1AFJA 4FBTA 2J76E 4HKQA 1T9XA 2EKNA 3J7Z5 1PC5A 1PCAA 2H5EA 1MNEA 1OSDA 2ZH4A 2BW7A 3M9NB 4YB1P 1BQMA 3K59A 3BGRB 2COLA 2W2NP 1WKLA 2CZVC 3SSSA 2WSEC 3MI7X 1YLXA 4MFBB 4X65F 1U49A 2KU7A 3BGRA 1CJTB 1M5SA 3CTRA 1SL2A 2LQ8A 1LKZA 4ZLJA 4OZ5A 1BC6A 3P6YC 5D0GA 1QVGR 1CJTA 1GQEA 2GX8A 5H9EK 3W5YA 1RK8A 2JRSA 4WTOB 2E1AA 1G7CB 1NK9A 2DKOB 5F3TA 2BKPA 1IXKA 5J2NA 3LW5C 1BUXA 1GXUA 1AUSL 1IR0A 2K06A 3MHYA 2OTJS 3HZEA 1HA1A 1M5KC 3H90A 1F3FA 2CG8A 6FD1A 3G2XA 2AT1B 3OTOF 3S01A 1K1SA 3QJLA 2MQOA 2C2ZB 1NB2A 3FMBA 4LFAF 4OI0A 2FHOB 1KVIA 4F36A 4DQRA 4I0WA 4NE9C 3TVKA 2NYIA 1I6JA 3EICA 1XEZA 3P3DA 4DV1J 5F8HA 5DG7A 3K5OA 1F0XA 5KFQA 3MFIA 2MDAA 3OLBA 2B4UA 4OYIA 4WJBA 3Q89A 1RWXB 1X4GA 2B9XA 4E8UA 1S1UB 1N8RT 1QSLA 3DYAB 3DKDA 5D3GA 3I31A 1YI2S 4L76A 1X5SA 1BWVA 4K4ZA 1U0SA 1RT5B 4DDFA 3ILOA 1KQGB 5CA5A 3OW2R 4JI1J 1Q8IA 2H3EB 1RT5A 2W9AA 4CO1A 3SCJE 1UEKA 1KBRA 3LTOA 4X65J 4WP8A 1Q5YA 2YNIB 3GFZA 3K5LA 4MK9A 9ATCB 3KLIA 1NO8A 1JLFB 1W25A 2YNIA 4MAKA 4TNOA 1N5QA 2F40A 4CT8A 4FPRA 4NPOA 4XIUA 4M5LA 1RT6B 3BKUA 2HBYB 3ZZZA 3ZTRA 5JUMA 1Z4UA 2HHTA 3A8IA 3OTBA 4DLEA 1VRTB 3M2VB 4XTTA 3OTOJ 4UY8T 1JXLA 5LSRA 1S6UA 1VRTA 4LFAJ 3QT7A 4IOBA 2ZC4A 3EZUA 3BYRA 1CC8A 2WSFC 5B0EA 4I4BA 4LIWA 3HM9A 4LUBA 1XR7A 4V19X 4JV5F 1B4SA 3LALA 1S10A 2KXNB 1LWEB 1FDAA 3CWJA 4CQ1A 3THTA 1C0UA 4LMZA 5DRKA 1YJWS 4B3SF 3D7SB 4KQZA 2W25A 4HDGA 2OPSB 4Y2IA 1KFSA 1WI6A 1N0VC 3HFKA 3M2RB 1RHJB 4O23A 2OPSA 1GK8A 2OFGX 2YKOA 2C2OB 2YXLA 3M2RA 2ILYA 4BLGA 4RZRA 1X4HA 2CPIA 2NSCA 2E5IA 3BQ0A 4F3MA 5GMEA 3LAMA 4L72B 3H4DA 2EFQA 2V4RA 3LP0B 3UWTA 2VFVA 2C42A 4J9KA 3DRRA 2DBBA 4UOGA 5KG7A 3CXCR 2J9DE 4ECZA 2MQNA 2OTLS 1KP6A 4LJMA 2EC2A 3DN9A 3HP6A 4UUXA 3UD4P 4JYAJ 2Z30B 1FEHA 1RKIA 3IR6B 2MQPA 4JB8B 3Q8SB 3QATA 2ZH9A 2KI2A 3M2UA 4FBUA 5E3RA 3MR2A 4YR0A 3IAM9 3ILLA 1F9FA 3R5GA 4IO9Q 2DNLA 1YIJS 4C8NA 3CMAS 1N36J 1RT1A 2LEPA 2P6TA 4N77A 2X1GA 1CPZA 2DCLA 2KZZA 3NOGA 1X5PA 4K50A 4U7CA 1F60B 3WIUA 2BRLA 1OPZA 4ZVOB 4FYDA 3KJVB 3A13A 1HNXF 4HI2A 1YX2A 2VPWB 1T11A 2R4FA 2HS4A 4HR2A 1W2IA 2DO4A 4DUTA 3KJVA 3VV2B 4ILLA 4N5SA 2JEGA 3C6TB 4J9UE 1NHUA 3C6TA 5CQGA 4LF8J 1QSYA 4ZIVA 1U6FA 2CQCA 3BYPA 5F8MA 3PX4A 3T6JA 4NRUA 4KYZA 4NLWA 4OI2A 2EW9A 2A0FB 1HLWA 3I96A 1E6YB 5LMNF 1LW0B 3UDLA 2HGLA 1NCLA 1EP4B 1KR4A 1LW0A 4ZCMA 5HJXA 4CNZA 2M3DA 3AOBA 4R25A 4ZMMA 1EZZB 4Y3CA 1EP4A 4N8OA 1ZTWA 3RUBL 1X4EA 2M7SA 2LP4A 1RHRB 4NZ6A 2J7KA 4OX8A 3MMCA 2YX7A 2HLUA 4DV5J 4I2QB 4LQ9A 4ANDA 4DR7F 1UZDA 1WNEA 2RE1A 3KKFA 4I2QA 3H2UB 5KFFA 3FCWA 3PO5A 5DQGA 4MJKA 3RZAA 3IM8A 3R5DA 4ZLPA 2M52A 4LSNB 2QL9B 4A48A 4RBUA 1GX6A 3AAWB 4K4WA 1B99A 2CJQA 4LSNA 4NMXA 3O8WA 2ZOGA 1AA1B 1KTVA 4C0OC 1C4CA 3FEXB 2MKKA 3SFGA 2DNHA 3CD5A 3KG4A 5M2PA 3OHAA 1PSDA 2HWTA 1SPBP 4RNHA 3BH6B 2DGQA 5E3QA 4DN0A 2GIRA 1ZBTA 3MM7B 3MURP 5KTQA 4RWXA 2N3OA 4PPDA 2UUAF 4QWDA 4ZKAA 3PV8A 4IRDA 1U45A 2W01A 2DNZA 4GKKF 1GEHA 5A8KB 4NYZA 3IGVA 3J7ZT 1FE0A 3IBCB 4PYDA 2G2YA 1F3VA 2EG2A 1VJQA 4K4YA 3R8YA 4D3HA 2W8KA 3A3NB 4J9LA 2ZHOA 5A0YB 5LMNJ 1LXNA 3G8TA 3FCHA 2NPFA 1FFGB 8AT1B 3OJUA 2B9YA 2V0NA 1PYOB 1WTFA 2ZH2A 2FUG9 5A0YA 3ICLA 2KFZA 1B70B 3P8BB 4WFNQ 2P6SA 4ZITA 4USKA 3HVRA 1RBOB 5EX0A 4F0KA 2XO7A 1H7WA 1RHQB 1HD1A 4QR0A 2AX1A 2HHPA 2PEBA 4OX7A 1RBLA 1X0FA 1B7FA 2NREA 3C14B 4P73A 2B8QA 1R0CB 3GIRA 3A8KA 2DRBA 4Y0FA 1J2VA 2DHSA 3M8ZA 2ASYA 4X66F 2AD9A 3JYTB 3C14A 3HHLA 4K4XA 2FHJA 3JYTA 4RBTA 1UVNA 3HULA 2CVIA 1KNZA 5IZHA 3D4JA 4JP8A 2R9LA 4NLGA 1WG1A 2LQJA 3MXHP 1FJGF 4F02A 3CT9A 2UVUA 2X1BA 3DDIA 3CCQS 1WHXA 1VRUB 1QY7A 3AD7C 2IBKA 3SQOP 1IM4A 3IS9A 4DHVA 3V2UC 3W65A 2GGPB 5SUHA 2MSSA 4HHUA 5IV4A 5DZ7A 3I0SA 2GGPA 4GKKJ 1FDDA 3NGTA 3CJKB 4N76A 4I6AA 3MWBA 1S6OA 5A8WB 1KS2A 2ERRA 3CJKA 3D54A 3BO2A 3SI8A 2W7PA 4F3OA 5G0RA 1T9VA 2JVOA 1ZYQA 2HNYB 1Y11A 2E9ZA 2HNYA 1DARA 2HVZA 1Q81T 3GR1A 4RUBA 2KT2A 4J90A 3DGPB 1NUEA 5DLFA 2RU3A 3DGPA 4ATNA 1ZOTA 1SQFA 5DM6Q 3DOLB 3NEKA 4Q5VA 3CVKA 2I38A 4QWEA 1HI1A 3IRWP 2HBQB 3DOLA 1H72C 2GJ2A 1HQUA 1NK7A 5CHCB 3LANA 1AROP 5ETRA 2DT9A 4DSEA 3NNAA 4X64F 3QAUA 1KC8T 1QAIA 4WXWA 1VI7A 2DH7A 2I9SA 1VC0A 2IAJB 5ETOA 1ACMB 2DGSA 3MUTP 3KFWX 3I32A 2XS5A 2RD5C 4H4OB 2IAJA 7FDRA 2GVZB 1FJGJ 2PMHA 2C2RA 4EYHB 4H4OA 3TR5A 2BOAA 2GVZA 1TK8A 3C16B 2OPPB 9RUBA 4M5MA 2EI5A 1JLAB 3TQEA 3C16A 3DI6B 2W4CA 2HK2A 2C2EA 1JLAA 4K2JA 3N6LA 4ZVGA 3AT1B 5IT9Y 2KH9A 2WCXA 2RHSB 1V9OA 4BWMA 3VGSA 2C3UA 3JB9k 2R7SA 2X51A 2V5HG 3T1HF 2AHOB 3OL6A 1P6TA 2NXCA 4L3NA 1UFKA 2MMYA 4TY9A 3RR8A 3DM2A 4KFBB 5GAEU 1QVFR 1XWLA 4KFBA 4JI4F 1S76D 2MZTA 5L9NA 2MYFA 1SB6A 1FRXA 2W1BA 2AJQA 2CZ4A 2VG6A 3MM9B 2FJEB 4WK3A 2B43A 2CPFA 4GO7X 5FIIA 5IQ6A 4LRFA 3VGUA 4RNOA 3FBFA 2P9EA 3MM9A 4KHPJ 4X64J 2XZTB 2W2PP 3MD3A 2GJFA 2Y9HA 2EFOA 1CJVA 3G87A 3H4BA 2PA3A 3BB5A 2LXIA 1IJEB 1MROB 2XO6A 1RLCL 5F8IA 4NCGB 3TX0A 2FJXA 3BSAA 1GMVA 4WTYA 1O6XA 1MROA 1REVB 1VQSA 4ED8A 4CO5A 1REVA 5FLXU 3MPDA 2ALYB 3NGSA 2ZOMA 3AY0A 4CLTA 4QR1A 5BR8F 4PXDA 2PT0A 3M30B 4DU7A 3RR7A 1TFWA 4XDCA 4A8OA 2HQFA 3EVWA 2NCKL 3M30A 4DFMA 3DNCA 2P9CA 5C7PA 1Q16B 5KFBA 2K8GA 4D3GA 3EGZA 1JWWA 3TUIC 1T0TV 2D9PA 2J9EA 5C25A 3T5JA 2MTLA 4B9UA 4U8VA 3T1AA 3PDNA 5E2QA 2NQPA 3IG1B 4DR3J 3G6ES 2UXBF 2YVSA 5KFAA 2XY5A 2JC0A 3OLAA 1JX4A 3V81B 4U7UK 4ZVUB 5KT6A 3W9JA 3M8RA 4KGKA 3V81A 3HVAA 4QU7A 3T1HJ 3FGVA 3O1LA 2QJ3A 4O3QA 1ZPVA 3I87A 2D74B 3BSCA 4JI8F 4H4KA 3PR4A 1SC4B 1X9SA 4DL0C 1XJWB 3PHEA 1Z2ZA 3OR2A 4DX8H 3IXQA 1UKUA 3RBZA 4AFFA 2L9DA 2ZH3A 2XLKA 2R8HA 2EPIA 4O44A 1NM2A 4NXMF 1WKKA 4FYWB 1WOOA 4IRCA 2H51B 4ZVTB 1QSSA 2OEJA 1UCNA 5KG0A 5AXMA 2QTWA 3HVTB 3L9ZA 1HHQA 5HROA 1CSJA 1XN9A 2IRXA 4B3TJ 4DPTA 5HMWA 3C2PA 4WFBQ 2HK3A 1RWUA 5J2PB 3BDEA 4H54A 5L9XA 2CQBA 1C0TA 1KOOA 1VR6A 2BYCA 2XULA 5J2PA 1NSKL 4Y6IA 3DFEA 2H48B 1VHIA 1N4LA 1NK0A 1FRJA 3U7JA 2MKIA 1C4AA 2XGPA 5FJ4A 1FTRA 3G96A 5BR8J 3I5BA 2ZZMA 1FRKA 3AH6A 1HBMB 2QL5B 2LVWA 3SSRA 4EUVA 4R0EA 1HBMA 4F2RA 2M88A 3CCSS 3OFGA 4UW2A 2XBPA 4ZJLA 2OHDA 4ICLB 2CQ3A 2PA8D 4DX5A 2H4WB 2QA4G 5KFGA 5KT7A 1O51A 3TZWA 3PW0A 3NOCA 2VODA 5LXYA 4EZ6A 1V3SA 5EGYA 2BA9A 4TU8A 2KHDA 1YTYA 3E51A 2CPEA 1JB0C 2K2PA 4JI8J 2FTRA 2AYEA 2CPJA 3TVZA 3C15B 5AE1A 2J0WA 1VMBA 3H25A 2OMLA 2VH7A 1Y7PA 1KDNA 5KG6A 3EYZA 2FLLA 1WC3A 3QFWA 1KEKA 3QMQA 2C2KB 5F8NA 1IJFB 1MWYA 1ZZFA 1HNVB 5LL6d 2JLFA 2MY7A 5IFMA 3RAMA 2OUGA 3M6WA 5F8LA 4QYRA 2JFKA 3VVTA 5C5JA 2M2BA 4XK8C 5GVQA 4LQ3A 3NNCA 4M5JA 4OLPA 4PR6A 4A46A 4HHJA 2BR0A 3N01A 4KJIA 1KFDA 1CBKA 1W26A 3R97A 3I9ZA 3OVSA 2BM0A 4E2FB 4JI0F 3D3CJ 1H74A 2CQ4A 2L9NA 4OIXA 2WSCC 4DZ6A 2HQDA 3KLFB 3FSYA 2ATCB 1RYSA 4ZVRB 3NWGA 3I0RB 2BANA 4R8UA 3KLFA 4N47A 4QWAA 2XLJA 1SKSA 1HBNA 3DGVA 2CDQA 3I0RA 5RUBA 5KFLA 5LSLA 4NYOA 5HMZA 1TKTB 3E01B 2U1AA 3GJRB 5AE3A 2DYAA 3ZZPA 1S9FA 3HVWA 1V5IB 4DV4F 1UWAA 2E5JA 5C24A 2B5JB 1S9EB 1LWFB 1T05A 6FDRA 5A2QU 4L73A 3VTIA 1LWFA 2WRMA 4FKXA 4X4RA 4LREA 4DR2F 4GKJJ 1FKOB 1X4CA 4O3SA 3I55S 3JAMY 1U8SA 1ZZNA 2YTCA 1FKOA 1WORA 2NXEA 4Y2KA 1S1VB 2ZOFA 1X5TA 1RT7A 5LXRA 4MK7A 2ZHAA 5J1NA 5IWAF 1S1VA 2W2MP 3VQSA 1LXJA 3J7YI 3GYGA 2DR7A 2XMWA 1FF2A 3RYLA 4A8XA 4RUCA 4HT5A 3HHLC 3UN2A 3IGNA 1SIZA 1SH2A 2UU9J 2HWIA 1WELA 1FI4A 1YWXA 2HWHA 2KJVA 2ZHBA 4HH1A 4LFBJ 3KLGA 2MZSA 2HNZB 2CDRB 1UP1A 3JTNA 4JI0J 2HNZA 2BMBA 5KFJA 2UXCF 1LW2B 4RU9A 1AUDA 4FYVB 5KT5A 3W5XA 3PYFA 1U1MA 3PKMA 2ROGA 2ZDOA 3TI0A 1D3WA 4PAAA 4C6AA 2AQ4A 4B3OB 3ET6B 4CM0A 3TJ9A 3BSOA 2V69A 3DC2A 4FDFA 1NDPA 1A7GE 1R6YA 1RA6A 4OFZA 2MHNA 1TUWA 2DNRA 1TK0A 1NBEB 1NPPA 2BEFA 2ZJQQ 1WKJA 2JSXA 2QLBB 4ZS6A 4DR2J 3CIMA 1U1KA 1SL1A 3SBMA 5ETLA 3UDEA 1RP5A 2NYHA 2MSTA 4ZDNA 4KO0B 2CNKB 2DXFA 3IM9A 1NDCA 3H59A 3IBFB 3QIPB 4LF4F 5KFIA 4KO0A 4KBIA 4WFZA 4OYWA 5T7LA 2IJNA 3QIPA 3UI3A 2XMAA 2HAIA 3CJTA 2OKQA 3Q8QB 4JI7F 2B7BB 1RAOA 4OJ3A 4WIIA 2E5HA 4HYKA 3KLHB 1AFIA 4MK8A 3TAMB 1SQGA 2FZGB 1WEYA 3CDEA 4FF4A 3RRHA 4I56A 3TAQA 3KLHA 1TL7B 4ECRA 3TAMA 4ILMA 2MEWA 1EARA 1CULB 2U2FA 3SSQA 1WSRA 4C8KA 3SDEB 4C11A 4RW7B 3Q8RB 1BQNB 3JQKA 4RKUC 1NU4A 5HAOA 1N48A 3SDEA 2W8LA 1YQHA 3EDQB 4ED0A 4EI2A 3CCLS 2CPYA 1EB0A 1XK8A 3IO1A 4AXJA 2FZCB 3PKYA 3HX9A 3GMGA 1T9WA 2I0XA 2PGCA 3M8WA 2HHVA 3WC0A 3CJQA 4KKOB 2C22A 5KAKA 4FNIA 2QLFB 2HGMA 1BE4A 4DPWA 1GXLA 3C66A 5EX3A 3BKTA 4KKOA 1VQKS 1U26A 1N5YB 3GJSB 3NKYA 4F3QA 3PRBA 1H7XA 3UR3C 4JI5F 2Q6CA 3IWNC 1ITPA 3IN5A 1N5YA 1H2UX 3FZ2A 5CABA 5A8RB 3MAAB 2V68A 2HHQA 4JI2F 3MAAA 3LWMA 3QGPA 1C1BB 4LF4J 5KG4A 4JI3F 1M5PC 4IG0A 3GIIA 2IIHA 4LF2A 3GZ7A 1C1CB 3CJRA 4IKAA 4BC9A 4X62F 4K5SA 1NH7A 3MEKA 3NGRA 4HEA9 1JLQB 4GVLA 5KG5A 4NXNF 4RU2A 4OYZA 1SVDA 4V1Ak 1JLQA 3WHIA 4JBCA 3GFYA 2M5YA 4DXLA 4M94A 3NWRA 4RW4A 1LEOA 3P45B 2H9ZA 1HWKA 1NK6A 2IDLA 1GMWD 1H6KX 2JOQA 2W4DA 2PI4A 4K4SA 2G13A 1N34F 1NNDA 4ZP6A 2ZD1B 2DNQA 2XCPA 2D3O1 2MQQA 3ISND 4U96A 5F0WA 2J8AA 1SXLA 5K8PA 2ZD1A 2QSWA 4HL9A 1K73T 1YDLA 3F41A 1UZHA 5K14A 2RQ4A 2DPJA 4UZBA 1IBMF 2GW8A 1OQ6A 3VF0B 1B0VA 1PG5B 4WK1A 1GTHA 4DR6J 2E1CA 1QLNA 1OWXA 2BJEA 4U95A 4LR7A 4PCQA 2RQCA 3DHXA 2UVRA 4H4KC 1U02A 1KVKA 4DV2F 3GR0A 5K9FA 4CDIA 4U6PA 3GSDA 4JI2J 3SZ2A 4IOAQ 3HCXA 5B0AA 3T1YJ 2F1FA 3KK3B 3DDKA 4M5NA 1R7IA 1QTMA 2A2CA 3G82B 2L9WA 1Y5NB 1PILA 3KK3A 1FVQA 4C3KA 4KGXB 1JJHA 4X62J 3G82A 2HLTA 3EMTA 1FKPB 4LSLA 2AEMA 2WONB 4LR9A 1HI0P 4NLSA 2C2DA 4ELVA 1XQIA 2HGNA 4PRFA 3PFEA 4WYWA 5GADI 1X4AA 4TKTA 1X7VA 2Y1JA 4ZVHA 2RDDA 4MYUA 1APSA 2EFVA 3VZIA 1CLFA 3BREA 4ED1A 3BGUA 1NK5A 2DRDA 4K4VA 2LDIA 4ERDA 1N34J 3W9IA 1UW9A 3HT0A 5LOQA 1IKVA 5DGAA 2XZDB 5HP1A 3CE8A 1NPRA 3GE9A 4P6QA 3CCUS 3TZXA 4NL5A 2AEJA 1M1GA 2DXEA 1G3OA 1M5VC 2OFHX 3M4XA 2RILA 5A6WA 4DU8A 1FNMA 1EX8A 5KT4A 1U6ZA 2YWWA 3P49B 1IWGA 3I5AA 2UZAA 4DR5J 2RMLA 3B54A 1S1XB 3W2VB 2VFSA 1RT2B 4KY3A 1U8WA 2MJNA 2VBWA 1IR2A 2DEIA 2G1DA 2R7TA 3SCKE 3S8SA 1RT2A 3EM1A 1NXIA 3F56A 4I1TA 4DV2J 1TMJA 3W2WA 3OSNA 2AZ1A 4NI2B 4OHWA 2V8GA 1BXNA 4DN9A 3K2YA 3BR9A 2IJFA 2HSEB 3BKFA 4HVZA 1Q0NA 4NI2A 3E8OA 2BBEA 2A18A 4OZJA 2XMKA 3NY0A 4C0BA 1K8AT 3HJVA 3EUNA 3J81U 3GV7B 2V4JB 3G6VA 2QL7B 3BGLA 2J7WA 4RUHA 2HAFA 4HDHA 4M5KA 2AW0A 2ZITA 3SCIE 3JTPA 1P9QC 3W8PA 2ZC3A 2R2SA 4K2XA 3K5PA 4KAIA 4IH6A 3K8VA 3OUYB 2CJYB 2B4PA 2CJKA 5D8HB 3KOAA 4RNNA 1NK8A 1ZAXA 3NS7B 4NRTA 1IQTA 5D0HA 1G4CA 1IQZA 2R7VA 3HHNB 3I6PA 3R6GB 3ONQA 4CP5A 3AFGA 5E7OB 1XR5A 4RWWA 1TMMA 2RQKA 1RJJA 1DZ5A 4Q44A 5IQQA 4DJBA 2VICA 1RTHB 2C3OA 1Q53A 2ADBA 3FEZA 1A0OB 2BRKA 2XQCA 2QZ8A 3QJJA 1LWCB 2E7XA 4A47A 4CLLA 1NDKA 1WEZA 2V8PA 3AJ1A 1SKWA 1XMQF 4YHHJ 2I5JA 1LWCA 4EYIB 2ZBCA 3U27A 4TQSA 4IFVB 5KFMA 5D4LA 2WB4A 5HLFB 2DGWA 4UT4A 3Q0AA 4IFVA 1VBKA 3IWXA 3CNQP 3FEYB 1H2TZ 5CYQA 2QGFB 4NWBA 1HQ2A 1KRPA 4HI1A 2ZWOA 3GV8B 3V4MA 2K7JA 2F8MA 3M1VB 3MEEB 1JLBB 3QBCA 1SKUB 1FKAF 4RNFA 4DFJA 4CI0B 4OZ3A 3UVJB 4QOTA 2H65B 2F4VJ 3BPSP 1FFWB 3A12A 3M8YA 3UVJA 2XSFA 2H5IB 4OZ1A 4USHA 1Q7LB 2DHAA 2HHUA 3KJFB 1OYEA 3T19A 4P71A 3NCRA 2W7AA 2DEJA 3QFHA 2XHCA 1JLGA 1PYTA 2GFFA 4NCAA 1URNA 3BGFA 2I2YA 2XY7A 4OHZA 4I7FA 4Y34A 3FQLA 3K89A 4DPOA 2ZVSA 4ZPTR 2P9GA 1QUVA 1Q78A 3IR7B 2CQGA 3C19A 4WKYA 4MIAA 1Z2LA 4OI3A 1D0EA 3N0VA 4ZCIA 3DOMB 2XG8A 1U6BA 4A8FA 1R8AA 4A8YA 1YJTA 1F9HA 1IKYB 2Y0BB 5JVGQ 1HHTP 3I5CA 1IKYA 3MM8A 1S77D 1GXTA 1XMQJ 2ZM6F 2L08A 4ZPWR 2HG4A 2FJWA 2UVWA 1FRIA 4GRSA 1X4DA 1TVRB 1VIXA 1O0PA 4DOZA 2AYMA 2DNGA 3PW7A 2ZNZA 1ULRA 2IM1A 2MGZA 1U2CA 2C3YA 4WKRA 4B3MF 1RI7A 4DQPA 5D0RA 5BXIA 5K20B 4QIEA 4PQUB 1KWMA 2X3DA 2CG4A 3V6KA 1BGXT 2HQ3A 4NEZA 4FF3A 5KFWA 3T5HA 3BH7B 1S97A 5E5NA 3TYTA 1DBDA 4RUAA 5KFDA 3QSYB 1M90T 4OYMA 2CQ2A 2ZH7A 5E41A 3HFZB 3Q83A 2O01C 4KC5A 1RHKB 4ANCA 2G2ZA 4YB5A 2OLWA 3J7YU 1DRZA 4IH5A 3NXZA 1WC4A 5F8JA 2V67A 2IDEA 5THWA 4ED5A 1GH8A 4Y00A 2VFRA 2PFFB 1PJ6A 3CC2S 1IBLF 5JJBA 4MH8A 2DISA 3QLHB 2HS0A 1JIHA 3LQVA 3MUMP 3C3LA 2GQQA 1DLOA 2GVDB 2Z2LA 3SIPB 3GG0A 4OX9F 2EKYA 4CLZA 4DQSA 1Q95G 2MB0B 3B78A 1FJEB 1R43A 2GVDA 2VU5A 3N28A 1OJ4A 1YJNS 3EGWB 3CJ4A 4LBHA 2D3UA 4W90B 1S0MA 3QT6A 4B02A 2DRAA 1Y10A 3UD3P 1RT4B 4ZN3A 2Z0GA 2LECA 2J5AA 2PI5A 4ZJQA 4Z2XA 3NGKA 3DMJB 4FXWA 2PN6A 1K1QA 5SZTA 4B3MJ 2W9BA 1K9MT 4LFCJ 5F9NA 4J9OA 1UW4A 2BE2B 2VG7B 2JDJA 4WZMA 5EWEA 2I6WA 4IFYB 2XGQA 3VCDA 3AJ2A 1S4FA 2AV5A 4DI6A 2BE2A 1NKCA 2J0XA 1FESA 4IFYA 2Y1IA 1RBAA 1R89A 3TJAA 5L38A 3KWMA 1OPIA 4NLVA 4YEAA 4E98A 1M1HA 5JMNA 4LVOP 2F9JA 3TP2A 3PIPQ 1VC5A 2LEAA 1S1TA 2QIFA 4K4TA 1P1LA 2BXJA 1MN7A 1VLOA 2BOPA 5KFVA 1VBZA 2AU0A 3FKBA 1KLMB 2O67A 1JXVA 2FPHX 3TZYA 3LAKA 3POTA 4J9RA 3PXGa 3H5YA 1XMOJ 3TAPA 4KGZB 4CNYA 5D77A 1TELA 5E3AA 1HWUA 3HLUA 5B0FA 4CYUB 4ZVEA 1N5TA 1VQ5S 3F44A 1S6QB 1UVIA 1VDHA 2QC3A 3R27A 1Q86T 3DXSX 1WHVA 2R7OA 4CYUA 3W9HA 1UJ4A 3MOJB 4I67A 2VL1A 5B7WA 3DU6A 1QJHA 3QZ8A 3S1TA 1ZAWA 2KRRA 1Q1KA 5FDLB 3B4DA 4O4GA 4OX9J 2J0QD 3X1LB 4C48A 1IN0A 3NAHA 2VBZA 2R7XA 1HYSA 4QPTA 1JLEB 3AHPA 1BWEA 3FJ2A 2KO1A 1JLEA 2N7YA 1S7IA 1M1KT 3KNAA 2POKA 1HR0J 1U47A 3ZZUA 3HSDA 1HL6A 4AL7A 3TWZA 1SV5B 4A8KA 2BQ3A 1R6VA 4MMOA 3P4UB 3ZTPA 4M95A 5KG1A 1U1NA 1NPKA 3MMBB 3BPDA 4H4MB 2R7UA 3OFFA 3MMBA 4CTAB 4H4MA 2MKCA 1VQ7S 2VV5A 1TUVA 3A4TA 3D1OA 3MDFA 2E9RX 1SIWB 3NG8A 4OJ1A 1NDLA 2ALZA 2NPIA 3PVXA 3C6UA 3DRSB 5GAHI 4F4KA 2GIQA 1KHWA 1S5ZA 3DRSA 5KFTA
chains in the Genus database with same CATH topology
4PYAA 2IDEA 2IIHA 2OHDA 3JQMA 2EEYA 1EKRA 3JQKA 2EKNA 1EKSA 4PYDA 3JQJA 4FDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PYA A;  2IDE A;  2IIH A;  2OHD A;  3JQM A;  2EEY A;  1EKR A;  3JQK A;  2EKN A;  1EKS A;  4PYD A;  3JQJ A;  4FDF A; 
#chains in the Genus database with same CATH topology
 1FEE A;  2UUW A;  2IHR 1;  5KT3 A;  4M5G A;  3T41 A;  4DCJ B;  1SJ3 P;  1QE1 A;  3RTV A;  3DLK B;  2N7C A;  2R2R A;  4KB7 A;  3DLK A;  1UTA A;  2K3K A;  4JI1 F;  3TNV A;  1Y0H A;  2R7W A;  2KM8 C;  4F67 A;  1U1Q A;  2IVM A;  2VPY B;  2IM2 A;  4M8L A;  4NYP A;  4P52 A;  4IG3 B;  1T9U A;  5HVH A;  4MFB A;  3V6J A;  1UVM A;  4TLR A;  4Y2A A;  4QIG A;  1HNZ F;  1RA7 A;  3U1L A;  4IG3 A;  3BZQ A;  2WOM B;  1H0H B;  3B4M A;  2DD8 S;  3QPI A;  4EWT A;  1V3R A;  4EBC A;  4DSK A;  1BHN A;  1Y4Z B;  2V9W A;  4USJ C;  1HNI B;  3CC7 S;  2WAQ D;  3R5B A;  1PYS B;  2LDY A;  5HAN A;  1HNI A;  2KN4 A;  4DF4 A;  2RUS A;  2AMC B;  5DQI A;  4PUO B;  2GO8 A;  3NAI A;  4YR3 A;  3RW6 A;  3KK2 B;  1JNZ B;  2FC9 A;  1RAI B;  4PUO A;  1WJ9 A;  2PMZ D;  2CPD A;  1L3V A;  4I6Y A;  3KK2 A;  1FXR A;  3GFH A;  3QQC D;  1FD2 A;  3WBZ A;  3VAL A;  2CPZ A;  4IDK B;  4QIF A;  4FS2 A;  3ZNU A;  2NUH A;  2DCU B;  3MCN A;  2YWG A;  4J9Q A;  1J5E F;  1NJI T;  2ZKU A;  1FD8 A;  4KGM A;  3D6H B;  4OX6 A;  2YX4 A;  4EZ9 A;  2L3M A;  1OMS A;  5CZV A;  1U4B A;  3Q8V A;  5BJR A;  4R5P B;  1S1U A;  3ISZ A;  4KR0 B;  2MLY A;  2VOO A;  4R5P A;  4LSZ B;  2KDO A;  3HKZ D;  3DYA A;  1V6H A;  1AT1 B;  1NZA A;  2DHX A;  3JS9 A;  3MM6 B;  5GAD U;  4ZLL A;  4LF6 J;  1WEX A;  4HLB A;  4OI6 A;  1FDB A;  3MM6 A;  2YX1 A;  1SJQ A;  4O3N A;  4N7T A;  1IBK F;  2KYZ A;  4JYA F;  1EKR A;  1HNZ J;  1FX2 A;  2HEK A;  2UUC F;  2A1B A;  3QRR A;  4AYB D;  1JLF A;  5D4N A;  2VOP A;  1HI8 A;  1HNW J;  2OPR B;  4ED4 A;  1MG7 A;  2FVQ A;  4RPF A;  3GIL A;  3MEG B;  2F9D A;  3NBP B;  2OPR A;  3QWU A;  2F8E X;  3MEG A;  3P96 A;  4G65 A;  2ZFH A;  3NBP A;  1F9E B;  2RNE A;  1N36 F;  4IUF A;  3RAQ A;  2DGO A;  2JH3 A;  3MPU B;  1RT6 A;  3LA0 A;  1S59 A;  3ENW A;  4X4Q A;  2DPI A;  2WBM A;  2MKS A;  5I42 B;  2J9C A;  1WOS A;  3M2V A;  4ZVS B;  3M05 A;  2WK4 A;  2HND B;  3CCT A;  2FHM A;  1OY6 A;  3QID A;  2FJB B;  1SCJ B;  1XMB A;  1ROF A;  1SH0 A;  3FVY A;  3VGV A;  3RB3 A;  3HHD A;  4JV2 A;  4K0K J;  3CDA A;  3UN3 A;  2R7Q A;  2V8H A;  3A8J A;  3SFU A;  1J5E J;  1LWE A;  2FJV A;  2JHE A;  4LRD A;  1RCX B;  4DV7 F;  2XCA A;  4NLY A;  2QX0 A;  1N52 B;  3WZ0 A;  4J9S A;  2EVZ A;  4P2S A;  4PXE A;  4LF8 F;  3CD7 A;  1RU1 A;  2ZBQ A;  4EK2 A;  2Z2M A;  2WVC A;  2YBV A;  3PW4 A;  4PEO A;  1RE1 B;  1VGY A;  2IBO A;  2O5D A;  1HBO B;  5JVH Q;  4KIA A;  5DS7 A;  3R7B B;  4XDD A;  4CLS A;  3S6E A;  1KKH A;  4JV1 A;  4I6W A;  2NZ4 A;  4NOH A;  4DPU A;  1PKU A;  3TW0 A;  1YJV A;  1TQL A;  3LP0 A;  4ZVF A;  4RW9 B;  3WC2 A;  1IBK J;  4YB7 A;  4BC7 A;  2XTJ P;  4USI A;  4TLQ A;  4W4M A;  2UUC J;  3FSX A;  5CYM B;  4NA3 A;  4DV5 F;  1VS3 A;  2R8G A;  1U25 A;  2X1A A;  2FLP A;  4DSJ A;  1RTJ B;  5M2R A;  2Q3P A;  3GJQ B;  2CZ9 A;  1N32 J;  3DLH A;  1RTJ A;  4ED6 A;  2RRB A;  1B0T A;  1TKX B;  4EGL A;  3LPE A;  2C2M B;  1ZTT A;  2XB2 D;  2EFP A;  2AZ3 A;  1TKX A;  1RSC A;  2MQL A;  2BAB A;  3EE3 A;  5IT9 U;  2CXE A;  3D0H E;  4ZVQ B;  5I3Q A;  5MAO A;  4PAB A;  4OYX A;  2K3I A;  3PYD A;  1K0T A;  4ZCK A;  1CQM A;  1PAE X;  4DQI A;  1YZ6 A;  3EZO A;  3AA9 A;  1S48 A;  4Q43 A;  1U0H B;  4DUZ F;  2IYG A;  2WB1 D;  4RR5 A;  1TU0 B;  2XZW A;  4DS4 A;  2Z2Z A;  4DV7 J;  1U0H A;  1ELO A;  1FRH A;  3A3P B;  3I9V 9;  4GVB B;  2R8K A;  2AP6 A;  3M7V A;  2XNQ A;  2EC0 A;  4WCE Q;  2P2C B;  2Q66 A;  3IAS 9;  4IH7 A;  2WTF A;  5K8N A;  4JUZ A;  4KGV B;  2LA6 A;  3NCP A;  1TL1 B;  3ISN C;  2IPO B;  4DL3 A;  4DCP B;  4AT1 B;  2GC8 A;  1E6Y A;  1FK9 B;  2OO4 A;  4F50 A;  5U47 A;  3ENA A;  4OI4 A;  2H5J B;  5B09 A;  2KFY A;  2Q79 A;  1FK9 A;  2QFI A;  3U1M A;  4ITS A;  2OEK A;  4TU9 A;  2ZKT A;  3ILI A;  2UVV A;  1N0U A;  1LOU A;  1YRT A;  1Q4R A;  1H98 A;  4YN3 B;  1X4B A;  1GNK A;  2K7K A;  1U24 A;  1N6Q B;  2HW3 A;  2RAQ A;  1XBW A;  5J2M B;  2FVS A;  1TV6 B;  3CD0 A;  5B0B A;  4EBE A;  4F4A A;  1N6Q A;  3H20 A;  4C8L A;  2RKI B;  5HQL A;  4EFA C;  4X4S A;  3H5S A;  5CAA A;  2EK6 A;  3U02 A;  2XI2 A;  4I2P B;  1S1W B;  1GFW B;  2RKI A;  3BF4 A;  3DHW C;  4IRK A;  1GTE A;  3PZP A;  5BYQ A;  2AX0 A;  3VAK A;  1S1W A;  3SXL A;  2IC3 B;  4U7U D;  4TQR A;  4LIR A;  4BDP A;  4NLD A;  1RZM A;  4DUY F;  2BDP A;  2IC3 A;  2B7C B;  3G6X A;  5LJ3 Y;  3HSJ A;  4DUZ J;  1HWL A;  3HT3 A;  2M9K A;  4ECQ A;  3GTY X;  1I1G A;  4PZV A;  3QGI A;  5L46 A;  3WDO A;  1LV5 A;  2DXD A;  2ROP A;  3MM7 A;  3TRG A;  1NEE A;  4UZC A;  1PO6 A;  2HZC A;  2GJI A;  4N8N A;  2E1P A;  2NXU A;  2JFD A;  5A8K A;  3W60 A;  3I56 S;  4X4V A;  2QA2 A;  4ZPV R;  3QGH A;  3QJP A;  2BKO A;  1NH8 A;  1M0S A;  5D4P A;  2BZ2 A;  3PRV A;  5DDQ C;  4DV0 J;  2YWF A;  3FNN A;  4PWD B;  5HJY A;  4F2S A;  3MAQ A;  3TA2 A;  4OYA A;  2ZH1 A;  4HT7 A;  4CH7 A;  5IV3 A;  2ZBR A;  1HWI A;  2WVE A;  4WFY A;  3DOK B;  2PE8 A;  4YS2 A;  3L4B C;  2DO0 A;  4PG5 A;  1QAY A;  3DOK A;  1KTQ A;  1G1X A;  3BBB A;  2B0G A;  3QT5 A;  2VFT A;  3W3S A;  3AD9 C;  4R0J A;  5IC6 B;  1S6P B;  4G3I A;  1SJR A;  2KT3 A;  3L7U A;  4PXC A;  4RLE A;  3W64 A;  1CC7 A;  1S6P A;  4ZHR B;  4K5R A;  1TZ0 A;  1WF1 A;  2R8J A;  2Y1R I;  4CCH A;  5GMD A;  4ZHR A;  3IR5 B;  2IM0 A;  2HVI A;  3BSN A;  3CJS A;  3UCG A;  2WW8 A;  4P9S A;  4JI6 J;  4DUY J;  1FA0 A;  2E7V A;  4UUW A;  1HAR A;  1H73 A;  4LF5 J;  5IS2 A;  2AJ4 A;  2XYP B;  5L1L A;  3MD1 A;  1VRU A;  1VQP S;  3H5U A;  3GV5 B;  1L5U A;  4LT6 A;  2HQC A;  5HVF A;  4DS5 A;  3RRK A;  3W5Z A;  3L3C A;  2G1H A;  3PM9 A;  1I94 F;  4DR4 F;  2DB1 A;  1Y00 A;  1RU2 A;  1Q7Y T;  1G2E A;  1WDT A;  3T5L A;  3PNI A;  1W7W A;  3H5X A;  1XNQ F;  1S12 A;  2NS1 B;  3PTW A;  5A8W A;  4ZLN A;  1RAB B;  3X3U A;  3A1Y G;  3H8Y A;  3SV3 A;  3MEC B;  1ZPW X;  2ASD A;  3CDB A;  2DR6 A;  3SCL E;  3DU5 A;  2A2D A;  4E0D A;  3PFO A;  3ZZT A;  3BDP A;  1J5O B;  3CSK A;  3TAN A;  1L3K A;  3TO8 A;  2L41 A;  2ZVI A;  1YJR A;  2OEL A;  2HVD A;  2ZE2 B;  1J5O A;  2J6T A;  5C2G A;  2F8H A;  4DL5 A;  2R7R A;  2RDJ A;  4QJV A;  2ZE2 A;  3GP9 A;  3HF5 A;  4OMF G;  3CCE S;  4KHP F;  3PO4 A;  2XMJ A;  3EGN A;  3TUP A;  2F65 A;  1QD1 A;  2NUU G;  4C0H A;  3EXY A;  3KJN B;  2ZBP A;  2OSR A;  2ZWP A;  2M4M A;  3R1L A;  3VAG A;  2NZC A;  3ITH B;  4WU3 A;  2QMU B;  1IR1 A;  2OJ3 A;  3ITH A;  4PQA A;  4C8Y A;  2LEB A;  2Y0S D;  1GMU A;  3MPY A;  2C1E B;  2D41 A;  1MN9 A;  3Q22 A;  2JJ4 D;  5ITH A;  5CCL A;  2OPP A;  2ZH5 A;  3CD6 S;  3KHG A;  2XYG B;  5KFN A;  5BYR A;  3JAM U;  3DI6 A;  3GWC A;  2DY9 A;  3DLE B;  3V4I B;  1I94 J;  1NSA A;  4DR4 J;  1YRX A;  4DR3 F;  2DR9 A;  4OZ0 A;  1OY8 A;  1X5O A;  3HZG A;  4I68 A;  3HPO A;  3MMJ A;  3V4I A;  4F0H A;  1XNQ J;  1JMT A;  2VG5 B;  2HBZ B;  3GYX B;  4FP9 A;  2VG5 A;  2UXD J;  3V6H A;  2WVD A;  2XWY A;  2JEI A;  4L6V 3;  4B9M A;  4ETX A;  4K59 A;  2CNL B;  4A8M P;  4P75 A;  1UEV A;  5GAH U;  1OIA A;  3E2E A;  1CJK B;  3LUY A;  3W66 A;  5I4M A;  3NL0 A;  2QYC A;  4J9P A;  5GAG I;  4QCL A;  1CJK A;  1HBU B;  3LGN A;  2VIH A;  4IR9 A;  1HBU A;  1T02 A;  2B3T B;  2KXH A;  4DFK A;  4MIB A;  3KLE B;  3KUH A;  2HIY A;  3CJ8 A;  4B3T F;  3W61 A;  4ILR A;  3KLE A;  3AJD A;  3VR1 A;  4XAK A;  2APO A;  2J9D A;  3LOU A;  2HVH A;  1VYA A;  2DIU A;  1VIS A;  2QLX A;  3QAE A;  4NCG A;  1WG5 A;  3PCO B;  1RWP B;  1UWB B;  3EVM A;  3Q8P B;  1VRQ C;  4MKV A;  1V5V A;  1D8Y A;  3CME S;  2YNF B;  2GO9 A;  4QWC A;  1FRM A;  1RAF B;  3IMQ J;  3AOA A;  2RRA A;  3O6Q A;  1MWQ A;  3D3B J;  1FFS B;  3OVB A;  1XNR J;  2VD3 A;  1FDN A;  4C4W A;  1XC9 A;  2KJW A;  2DIT A;  5DQH A;  1ZM9 A;  2A3J A;  4FZV A;  1RWO B;  4B08 A;  3T3F A;  4CO3 A;  3KG0 A;  4B9T A;  3D67 A;  3IG1 A;  3BQ2 A;  2V2Z A;  2EEY A;  3LWL A;  2RDI A;  3W7B A;  1BQM B;  1RAE B;  2CFX A;  3ADA C;  3O44 A;  5LM7 E;  2V2K A;  3R2D J;  2ZEJ A;  2G9O A;  2IYI A;  4Z37 A;  3QNW B;  4Q8F A;  3MUV P;  2NR0 A;  4AL6 A;  2R3V A;  2YQ1 A;  3KK1 B;  4ECY A;  3WX8 A;  4YY3 J;  5J2N B;  4GC7 A;  2HYI B;  3KK1 A;  1HD0 A;  4KH1 B;  2G0C A;  5DJB A;  3RB0 A;  3CB4 A;  1AXQ A;  4QYZ J;  3B8H A;  3HHL D;  4B9L A;  5EN1 A;  4RX6 A;  3HVT A;  2FHJ D;  5KT2 A;  3DRP B;  1WSV A;  3ZC4 A;  3PEJ A;  3IRX B;  3JSY A;  3DRP A;  3D6F B;  3N9U C;  4EU0 A;  2ZBI A;  5HN0 A;  1WC5 A;  4FYY B;  3IRX A;  2KRB A;  3RBD A;  4YFU A;  4A8W A;  3FK4 A;  1P8G A;  3HSZ A;  3PRD A;  1H38 A;  1IBC B;  5KOX A;  4AD6 A;  1S79 A;  4DL7 A;  4ECU A;  5E3C A;  3V5R A;  3MCS A;  2IRY A;  1OO0 B;  3G71 S;  4ECS A;  4NLQ A;  2MXY A;  2D3Z A;  1RQ0 A;  1FJC A;  4FF2 A;  4WFX A;  1HKA A;  5D3G B;  5KFZ A;  1R0B G;  1S4E A;  2DH8 A;  2VKZ G;  2IJR A;  2W4P A;  4ICL A;  3CIZ A;  1VQL S;  1SI9 A;  4JV0 A;  5E0O A;  3QSI A;  3RU0 A;  2Y1L B;  3VZH A;  2FD2 A;  3T6B A;  2XMU A;  2FVC A;  1U1R A;  1VQ8 S;  1SUQ B;  1GAO A;  2YWE A;  4AE5 A;  1OY9 A;  4XPC A;  3KLI B;  3F0N A;  1SUQ A;  1R8C A;  3SYZ A;  4FVC A;  3ENQ A;  2R42 A;  3S7R A;  2ASL A;  4GKJ F;  3L95 X;  3CUN A;  5FD1 A;  2MKJ A;  4LF1 A;  5AXL A;  3C15 A;  2P5V A;  4YB6 A;  2PII A;  2YKP A;  1EQM A;  1RTZ A;  2GHV C;  3TA1 A;  1UFW A;  5HMY A;  1HNV A;  4ECV A;  2OI2 A;  4ER8 A;  4AQY F;  2ATL A;  2DGX A;  2RH3 A;  2JZ5 A;  2RVJ A;  4WE1 B;  1IUJ A;  4USV A;  3ULH A;  1FNX H;  4AL5 A;  5KFC A;  2UU9 F;  4WE1 A;  5HI7 A;  3CJ5 A;  1SQE A;  4LFB F;  1X4F A;  3J7A 1;  1U1L A;  2CQD A;  1C0U B;  2N4D A;  4PWU A;  1U2R A;  2V8D A;  3H2L A;  3R5J B;  2F5G A;  2V94 A;  1VQY A;  3O5T B;  1NHV A;  3N5F A;  3ETO A;  2LYV A;  3BR8 A;  3PW5 A;  4OI1 A;  4ECT A;  2A6M A;  1RHM B;  5T14 A;  4MKB A;  1M5H A;  2LKZ A;  1N5S A;  3AXK A;  2V63 A;  3VAM A;  1UET A;  2LU1 A;  2CNN B;  5AXN A;  3BJY A;  2HFV A;  2J8S A;  2CKW A;  4TU7 A;  2VC1 A;  1TKT A;  2Z4P A;  2VKR A;  2V2V A;  3E01 A;  4URQ U;  3DRR B;  5HO4 A;  1K44 A;  4UTG A;  5L39 A;  1UA1 A;  4C9D A;  1TL4 A;  1DQ9 A;  2Z57 B;  3HO1 A;  2IA6 A;  3TJ8 A;  2B5J A;  1S9E A;  3BO3 A;  4M5I A;  3M2U B;  5E3P A;  3EWG A;  1ZA2 B;  4Q0B B;  4ECW A;  3W62 A;  1VOM A;  1RAA B;  1VFJ A;  3BEG B;  2BJ7 A;  4CWB A;  4N41 A;  1Y5I B;  4Q0B A;  1QDU B;  3GQC A;  2UV8 G;  1RT1 B;  1P27 B;  1QTN B;  4AQY J;  1XIQ A;  2PC6 A;  1Y3J A;  4USM A;  4F04 B;  2VC0 A;  3FDS A;  1MWZ A;  1BY9 A;  3OVA A;  2HZA A;  4DCO B;  3JQM A;  1PBA A;  3RB4 A;  5KFE A;  3G8S A;  5LSO A;  4JV5 J;  1JK9 B;  5HQ8 A;  4OV1 A;  1I3O B;  1EJ7 L;  2JLG A;  4B3S J;  4ELT A;  2VAS A;  1ZAV A;  1S72 S;  2ZJP Q;  1TKZ B;  4J37 A;  1LW2 A;  3UFC X;  1KOH A;  1CQN A;  1JXE A;  2XYH B;  2JC1 A;  3CDU A;  1TKZ A;  2DHH A;  1B3T A;  2HRU A;  4DQQ A;  4EO6 A;  2CA9 A;  3J80 Y;  1JJ4 A;  2L48 A;  2BQR A;  4B3O A;  4YR2 A;  3GJT B;  3ET6 A;  3JSR A;  4X4U A;  5L1K A;  2HHS A;  2QE5 A;  3M8P B;  4P10 A;  3VGT A;  4P74 A;  2MZJ A;  4X4N A;  1RHU B;  3NLC A;  1Y9O A;  3M8P A;  3HXM A;  1FXL A;  1K0V A;  4P7V A;  3CCZ A;  5DZ6 A;  3MMC B;  3G6Y A;  5H1S V;  2XHW A;  5EHH A;  2RUG A;  2W7O A;  2EXU A;  3M9O B;  2LXF A;  3DLJ A;  2HQI A;  4OYB A;  1WC1 A;  2EBG A;  5L8R C;  5EWG A;  5I3U B;  5KFX A;  1S0N A;  2VQE F;  5HMX A;  3W8G A;  4G1P A;  5ETK A;  4X4O A;  3TX8 A;  3HMJ G;  5I3U A;  3MGJ A;  4PWW A;  4EO8 A;  3DLB A;  2QV6 A;  1FER A;  2FJA B;  1WD6 A;  1R27 B;  3Q8U A;  1DFD A;  4B9V A;  2JEF A;  3PX6 A;  3Q8Y A;  2QN6 B;  3QT8 A;  2DNN A;  2CJA A;  5LJ5 Y;  2Q43 A;  3J81 j;  1NRK A;  4C97 A;  4WFA Q;  2FDN A;  4J5O A;  1R3N A;  3UDC A;  3NNH A;  2D69 A;  2LA4 A;  2AGQ A;  3HFV A;  4CO0 A;  1TL7 A;  5DM7 Q;  1HNX J;  3KDN A;  2QRR A;  1CUL A;  1X0P A;  3ZNJ 1;  1T03 B;  4K8R A;  4C8O A;  2VQF F;  3UO0 A;  4RW7 A;  2MY8 A;  3LF0 A;  1T03 A;  1BQN A;  3GCW P;  2VJV A;  1QUP A;  3FSI A;  5B0G A;  1T3O A;  5ETS A;  1QAX A;  3IBW A;  4B9S A;  1WF0 A;  4I69 A;  1F6T A;  1F5C A;  4ECX A;  4K7Q A;  2RIJ A;  3DLG B;  2Z56 B;  5HAT A;  3F73 A;  2CWK A;  4NAS A;  3DLG A;  4O4R A;  3OXL A;  4DR6 F;  4FF1 A;  2XM3 A;  3HD2 A;  1D9F A;  2XS2 A;  3EPG A;  3ZO7 A;  3QGG A;  4F7V A;  4ED3 A;  4M5H A;  1ZA1 B;  2MQ8 A;  2G0J A;  1PBU A;  2YPZ A;  1VQ9 S;  5ETM A;  3ZZY A;  3BS9 A;  4F4X A;  5A8R A;  4O3O A;  1LNQ A;  4RJV A;  3T1Y F;  4DR7 J;  4CO4 A;  2FC8 A;  4Z7Y A;  4Y28 C;  1O5J A;  1DTQ B;  2VQE J;  1C1B A;  1OQ3 A;  3M6X A;  1DTQ A;  2JNJ A;  4PG8 A;  2CUY A;  3RJM B;  3HHL B;  1C1C A;  1UMJ A;  2BJ3 A;  3VAI A;  4NEY A;  5AXK A;  3CMQ A;  4ELU A;  1UEU A;  3PEH A;  4BWJ A;  3NS5 A;  3EJM A;  1I5O B;  1WHY A;  5EWF A;  5HVG A;  4ES2 A;  4NLU A;  1JJC B;  5DDP C;  1BMQ B;  1IKX B;  3HSG A;  3T5K A;  2RB7 A;  3IWL A;  2B9E A;  3IS9 B;  3TQ1 A;  1IKX A;  2VQF J;  1SC6 A;  3VVU A;  4MYT A;  4U67 Q;  3HD1 A;  2UUA J;  3I0S B;  3CPW R;  1URR A;  4RW6 B;  4URG A;  3UR0 A;  4CIO A;  4QW8 A;  2MZ1 A;  1FWK A;  4F4Y A;  2FQQ B;  3QWP A;  1YIT S;  5G0R B;  4RW6 A;  4F4W A;  1VJW A;  2VBX A;  5MLC V;  2E1R A;  2CAJ A;  2B4V A;  2WVF A;  3CUL A;  4PPZ A;  4DR5 F;  2GNK A;  2AYB A;  2YKN B;  2LFV A;  3BM7 A;  4USW A;  3I4H X;  3M9M B;  1UVJ A;  2LQ9 A;  2YKN A;  3PYE A;  3PJX A;  3LP2 B;  2RU9 A;  4Q7A A;  3DXB A;  3KLV A;  1T94 A;  1TAQ A;  3LP2 A;  2VPX B;  1UJ6 A;  2XMV A;  1F1B B;  2HMI B;  1FX4 A;  3K0J A;  1HQU B;  1H3D A;  2E9T A;  1JJ2 R;  4NLT A;  3GSI A;  4MTP A;  2RS2 A;  2HMI A;  4QPX A;  1T9T A;  4W98 A;  1RYR A;  2DGU A;  4X66 J;  3UW1 A;  1FKP A;  2A10 A;  1LK7 A;  3MZI A;  2WON A;  3DLL Q;  3RGI A;  3WQP A;  2KVQ E;  1D09 B;  1NSQ A;  4LBI A;  2CPH A;  4ZP9 A;  1ZET A;  1HWJ A;  5CCM A;  1NME B;  2XMM A;  3JTO A;  1B64 A;  1DY3 A;  2F3J A;  4DSF A;  3M8Q B;  1KON A;  1CS4 B;  5GAG U;  1ZM3 A;  3M8Q A;  4ZVP B;  1SJF A;  5H9F J;  1CS4 A;  2KXF A;  2ADC A;  4RO0 A;  3R6L B;  1T7P A;  3MPV A;  2D1C A;  5GMK a;  1PIE A;  3OL8 A;  4I64 A;  2R2U A;  3OSP A;  3RBX A;  2QSF A;  2NXJ A;  2HS3 A;  1KN6 A;  3DCA A;  1GX5 A;  4ZPD A;  3W1Y C;  2GQC A;  1PJ7 A;  3A3O B;  1PGZ A;  4OHY A;  3DM2 B;  4YHH F;  2O1P A;  3W2V A;  1S1X A;  2QLW A;  2PDA A;  2Z58 B;  2IY5 B;  2MLX A;  1DUR A;  4KHR A;  3C46 A;  2FY1 A;  4Z7C A;  2GIF A;  3OT9 A;  3K8W A;  1KQS R;  2M8H A;  4F26 A;  2VG6 B;  4CLW A;  4P2F A;  5H9E J;  4O3R A;  2CQH A;  1R31 A;  2BE9 B;  3KUE A;  4NLP A;  3E3X A;  3R2C J;  1CJV B;  3GU0 A;  1KVJ A;  5ETT A;  3GIM A;  2F4V F;  1YSJ A;  4DZD A;  4KSE B;  2BX6 A;  1T8E A;  1WG4 A;  4NCB A;  2V4J A;  3R1H A;  1NZ8 A;  4OZN A;  2FLN A;  4L3K A;  2YKQ A;  2DTJ A;  3ETM A;  3OV7 A;  3H42 A;  1RAH B;  1WI8 A;  4LF9 F;  4OHV A;  2VHG A;  5AJ3 F;  2BW2 A;  4TYA A;  2PSZ A;  2PFD A;  4ZA1 A;  3JSM B;  1VK3 A;  3KDO A;  4CH1 A;  1IVZ A;  3OUY A;  1LFW A;  2AJ1 A;  2ROE A;  1TP7 A;  3CW2 C;  3JSM A;  2ACY A;  2XY6 A;  4WBF A;  1F5A A;  1R8B A;  3WIV A;  1N56 A;  5C25 B;  1EET B;  4ZK7 M;  5A6P A;  3I82 A;  3QO9 B;  1Y3K A;  4FVM A;  1EET A;  2RS8 A;  2BE7 D;  3QO9 A;  4ZPC A;  4J9N A;  1FTC A;  1UPP A;  1NJY A;  3OTE A;  1AYE A;  3MAH A;  4CLK A;  3KG1 A;  1RTH A;  4UQT A;  3K17 A;  4HAC B;  3HI9 A;  2H1Y A;  4C2M A;  5KFH A;  3ZTQ A;  3NCQ A;  4HAC A;  4DSL A;  3RBE A;  2KG1 A;  3OR2 B;  7FD1 A;  5F3Z A;  3AA8 A;  1YZ7 A;  2QEX S;  2N3L A;  3KMS A;  4O44 B;  5HLF A;  4WWS A;  1X8D A;  1FWP A;  4JI4 J;  2ACM A;  2LXU A;  1TR0 A;  3DRY A;  2BJ9 A;  3KHR A;  5JXS A;  3NS6 A;  3CGI A;  5HRO B;  3R3T A;  1JLC B;  2CQ1 A;  3D28 A;  4Y2M A;  4WP3 A;  4UOF A;  3M1V A;  3MEE A;  1NK4 A;  2RT3 A;  3I4P A;  2AYG A;  2IVF B;  4CLP A;  4FN5 A;  1JLC A;  1JLB A;  2LQB A;  3PW2 A;  2HQG A;  1CEZ A;  2R8I A;  3LGH A;  1DHM A;  2QMW A;  2DJW A;  1C0T B;  2WW4 A;  4KPC A;  2NSB A;  2SXL A;  2CPX A;  1RAD B;  4A4J A;  3T9N A;  4UQG A;  1EHW A;  4LF9 J;  2G2O A;  4OYO A;  5AJ3 J;  1WHW A;  3JXO A;  4NA1 A;  3VAJ A;  3MFH A;  2MQM A;  3G86 A;  3ZTO A;  2LLZ A;  3EDR B;  4L74 A;  3FRY A;  1UFL A;  3PX0 A;  4Y2C A;  2DHG A;  1N88 A;  3BBF A;  1RWK B;  2PO4 A;  1RAC B;  1TTH B;  4U9R A;  1AZS B;  2OEM A;  2KL8 A;  2DNO A;  5KFO A;  2UXB J;  5E33 A;  3DOM A;  5D15 A;  2V50 A;  1AZS A;  1EIY B;  3MOZ A;  3K57 A;  5CD4 H;  3OD2 A;  3OTD A;  2LCW A;  4FXV A;  2CQI A;  2NXN A;  4QBU A;  1ICE B;  1BD6 A;  3TA0 A;  5EUH A;  1DAX A;  3TUZ C;  2QFJ A;  1YJU A;  2QMX A;  4OYP A;  2DIV A;  1S0V A;  2GA7 A;  2V8V A;  2GS8 A;  3VAF A;  4GO5 X;  4Q2L A;  4YDX A;  1Z1Z A;  5IT4 A;  2WZ1 A;  1YKW A;  3L7O A;  3G8Q A;  2BJD A;  4ZIW A;  3VAH A;  4NXM J;  2MZR A;  1TVR A;  4M5D B;  5DLG A;  3KMQ A;  3TZZ A;  3SMZ A;  4KRW A;  4FKY A;  4ZJO A;  1UVK A;  4M5D A;  4LVN P;  4LFC F;  1YBU A;  3OFH A;  3CCV S;  4G6V B;  1YJ9 S;  1KD1 T;  2CQP A;  4OV6 A;  4FPI A;  1SKR A;  5HK4 A;  2QA4 S;  3D6M B;  4RBV A;  3AQP A;  1G6B A;  4PQU A;  4KT0 C;  2KT5 A;  3HHE A;  3R7S B;  3BN7 A;  2Y8W A;  3M32 B;  5M2U A;  2RF2 B;  1NJX A;  5KFP A;  2HFN A;  1X9M A;  3M32 A;  3OL7 A;  1GMW A;  2RF2 A;  1MSW D;  1EKS A;  5KOW A;  2O3D A;  1TK5 A;  4UOH A;  1M5O C;  3OXF A;  2N4C A;  2KVI A;  3FBC A;  1UPM B;  3UCZ P;  1PAU B;  1XMO F;  2BAN B;  2YY3 A;  1SH3 A;  1TL3 B;  4R8U B;  4HHH A;  4YUD A;  2CJX B;  4J9M A;  4DL6 A;  1HBN B;  3QRP A;  2YH0 A;  1TL3 A;  1OS5 A;  4ENO A;  1Q8K A;  2UV8 A;  2E66 A;  2BAC A;  3SEO A;  1QAJ A;  2GML A;  2EG1 A;  1T3N A;  4QU6 A;  5D78 A;  2G0I A;  5C24 B;  5BYS A;  1T05 B;  3L09 A;  4N56 A;  1HIY A;  3VQT A;  4MKY A;  3QLH A;  3OXG A;  4YDD B;  4X4P A;  4O3P A;  3JSB A;  1KLN A;  1ZM4 A;  2Z8Q A;  1FRL A;  2YPY A;  2X3G A;  2BVZ A;  4J91 A;  1HR0 F;  1MW7 A;  2VA2 A;  1S57 A;  1RT4 A;  3OR1 B;  3D1Q A;  1RT7 B;  1U7L A;  2KZM A;  5J2Q B;  3N6N A;  3H2V E;  2IFX A;  3KNG A;  1U1O A;  1RLD A;  1FNO A;  3OR1 A;  5KFS A;  4F8R A;  3DMJ A;  2YWK A;  2FLO A;  5J2Q A;  2BM1 A;  3QYY A;  2BV3 A;  2CWX A;  4WYL A;  1P9Y A;  3PR5 B;  4PYA A;  2YNG B;  2VG7 A;  3D5M A;  2AJ2 A;  1REG X;  2XSJ B;  1D8Z A;  1LWX A;  3B6B A;  2YNG A;  1NKB A;  2QO3 A;  2J7U A;  4UF4 A;  2XSJ A;  2F7V A;  3EVO A;  4DL2 A;  3P5B P;  2QG9 B;  3KLG B;  3AOD A;  4QR2 A;  4DBQ A;  3FZB A;  2HHH F;  1FCA A;  1RUS A;  1RT3 B;  1DJ0 A;  3UCU P;  3ENV A;  3D68 A;  5G4D A;  1RT3 A;  4KTQ A;  1S0O A;  1D9A A;  2YKM B;  4C8Z A;  3CJ3 A;  4ALZ A;  3M8S A;  4ED7 A;  2BUN A;  3ZZ0 A;  2HIQ A;  1KLM A;  3HHK A;  1YBA A;  1FHT A;  2MZQ A;  2YKM A;  5F9L A;  1RAJ A;  3GG1 A;  5IC4 B;  3FMW A;  1VIO A;  5KFK A;  1NHK L;  2QLJ B;  3R5A A;  1RTI B;  4EMD A;  2ZH8 A;  4X84 A;  3CC4 S;  2D7S A;  4Y65 A;  2BJ1 A;  1S6Q A;  5I3P A;  3UN5 A;  1RTI A;  1KQK A;  5J1E B;  3Q2T C;  4W92 B;  1U48 A;  4M1K A;  4ZOS A;  2GCF A;  4DV4 J;  3JQJ A;  5FLX Y;  3CO0 P;  4KE5 A;  4NLO A;  5J1E A;  1H2V Z;  5FDL A;  1WC6 A;  3MCO A;  3OL9 A;  1BQX A;  1F5B A;  3ELH A;  1L3S A;  3CO9 A;  5K8M A;  1FWL A;  2OMO A;  2ZZT A;  1DQ8 A;  4PXB A;  1D1U A;  5T7L B;  1I51 B;  5A76 A;  4ZPA A;  4J7C A;  3OJS A;  4QZV B;  1SV5 A;  2V4Q A;  1HMV B;  5IWA J;  2E7W A;  4G1Q B;  4A8Q A;  4CLF A;  5CD4 A;  1HMV A;  2OAU A;  4LRA A;  2E44 A;  2LU2 A;  3RAX A;  4G1Q A;  1V3Z A;  2FZK B;  2ZUG A;  4CTA A;  1TUG B;  3FCV A;  5CH7 B;  4OLO A;  1RWM B;  1VBX A;  2YQ0 A;  2VF3 A;  3HKW A;  2HHH J;  3SQG B;  4C11 B;  4DPX A;  3PYG A;  1VBY A;  1IKW B;  1GT8 A;  3O3L A;  3QZ7 A;  3GB0 A;  3CJ2 A;  3SQG A;  4QWB A;  2RHQ B;  2KKH A;  4IQX A;  1IKW A;  3GPA A;  3K58 A;  2UXC J;  3MTK A;  5DG9 A;  1HW9 A;  2KTQ A;  3BO4 A;  1Q5V A;  3QRQ A;  2DR5 A;  2RJZ A;  1YGY A;  4UOC A;  4IQM A;  2HPU A;  3UNG C;  3IA0 A;  2AIR B;  4P72 A;  2HRT A;  1W2B R;  4YP3 A;  3LP1 B;  4LF6 F;  3MTJ A;  2IRU A;  4EBD A;  2WVB A;  3UQS A;  2OH2 A;  4GMK A;  4C3M A;  2IM3 A;  2DNP A;  3LP1 A;  4WPA A;  5CZX A;  5F8G A;  1L3U A;  5D6G A;  2AF6 A;  3GCX P;  3FBB A;  2B51 A;  1RB0 A;  1HNW F;  3M6V A;  4CZC A;  2DNM A;  2WOM A;  5AE2 A;  5EDW A;  1RWW B;  3KUG A;  2D3O R;  1RWV B;  4Q8E A;  2V6A A;  2FYX A;  2FVP A;  1KHV A;  2RRN A;  2C2N A;  4OJG A;  3TEG A;  4IG0 B;  2XLI A;  1YBT A;  2E5L F;  3G9C A;  3MR7 A;  1UVL A;  2HFZ A;  2B4O A;  5IXU A;  1Q8B A;  3N5B A;  4QIV A;  1S7H A;  1VQ6 S;  2KB2 A;  4JI7 J;  3NGU A;  4RW4 B;  4K0K F;  4WXO A;  4C3L A;  1N54 B;  2M0G B;  4TN2 A;  1KSP A;  4IDK A;  3UNY A;  1ZM2 A;  2VB6 A;  2DR8 A;  4CT9 A;  3KHL A;  3AOC A;  5CYJ A;  1FT8 A;  5B0D A;  4OHX A;  1VLY A;  3CJ0 A;  2DVI A;  2PEH A;  1BLU A;  4UST A;  1VQO S;  5HSP A;  4LRC A;  5D0E A;  5HQM A;  4J9V A;  2DY1 A;  5F41 A;  2BKN A;  4IR1 A;  4O0I A;  3OFE A;  1NLK L;  5K14 B;  2M8D B;  4ZN1 A;  4TVA B;  2KG0 A;  4WP9 A;  1YHQ S;  2LMI A;  2O66 A;  1T95 A;  2YWH A;  1SBR A;  1WAC A;  1FJ7 A;  3MCM A;  4ES3 A;  1VQN S;  1RGV A;  3EZ5 A;  3MR3 A;  3UPF A;  2J6U A;  2G4B A;  3THP A;  4DMZ A;  1TFY A;  4JI5 J;  4CM2 A;  4QIW D;  1FE4 A;  2QYG A;  1FVS A;  3W63 A;  2DNK A;  2BQU A;  4K4U A;  4QYZ K;  4PG4 A;  1UA0 A;  1N32 F;  3TAR A;  5DDR C;  3LH2 S;  4A8S A;  2OP5 A;  1Q82 T;  1MU2 B;  1WC0 A;  2E5L J;  4CLY A;  2OGU A;  4JI3 J;  2BJ8 A;  1MU2 A;  1NB7 A;  4CO2 A;  1LFP A;  2LQ5 A;  3U1N A;  3OTC A;  2YKA A;  4L75 A;  1J27 A;  4LSL B;  2HFO A;  2E29 A;  3VWS A;  3HDS A;  1JNR B;  1U1P A;  2W2O P;  4DX6 A;  3CCM S;  2C3M A;  1R0A B;  1WF2 A;  2YQ3 A;  5I42 A;  4NXN J;  4TY8 B;  4BHQ A;  5C2C A;  4WF9 Q;  5A2Q Y;  4P7T A;  3MR6 A;  2CYY A;  2HND A;  1R0A A;  2AJF E;  2GMJ A;  2B9W A;  4TY8 A;  3D66 A;  4DL4 A;  2JLE A;  2EBE A;  3ZXW A;  3GIK A;  4CLU A;  3MMA B;  4KPY A;  2OD6 A;  3MM5 B;  2ZNY A;  2B6A B;  3D6T B;  1N33 F;  2XI3 A;  2NLW A;  3HJF A;  2HHW A;  3MMA A;  2GQ2 A;  2JWN A;  1CG2 A;  4LF7 F;  3MM5 A;  1IKV B;  2B6A A;  3US5 A;  5HP1 B;  4NZ7 A;  2KFN A;  4CRJ A;  4QQB A;  2ZUA A;  1PC4 A;  4PG7 A;  1XER A;  4PKD B;  1SC1 B;  1HBO A;  2KM8 B;  2GZO A;  1HPZ B;  1X31 C;  2AEF A;  3R7N B;  2ILZ A;  1UL3 A;  4B3R F;  1HPZ A;  2VUG A;  4EEY A;  4ED2 A;  1IBM J;  2HVE A;  1JKH B;  2GAH C;  3B82 A;  1XR6 A;  4Q2M A;  4DG1 B;  1R8H A;  4DR1 F;  3PJW A;  4ES1 A;  1JKH A;  5IOL A;  4DG1 A;  2C28 A;  4RW9 A;  1FO1 A;  1X60 A;  5DGB A;  2UUT A;  2YNH B;  1WDD A;  5CYM A;  3W2W B;  5K8O A;  1L3T A;  1Y5L B;  4BBY A;  2A6O A;  4LBP A;  2YNH A;  3FBE A;  4DPY A;  3MF5 A;  4OL8 A;  4DV6 F;  2ZDP A;  2AGP A;  4URS A;  1IM6 A;  1S9G B;  4M63 A;  1OSC A;  2DH9 A;  7AT1 B;  4ANE A;  1S9G A;  2MKY A;  1ZS6 A;  3PIO Q;  1HHS A;  2J6S A;  4FXD A;  1B7Y B;  3MR5 A;  6AT1 B;  2FGO A;  2K1R B;  2ZZN A;  4ZPB A;  4DWI A;  2MLZ A;  5KFR A;  1B0P A;  2K1R A;  2GV1 A;  2IA0 A;  1XTZ A;  4NX9 A;  4RL1 A;  1NKE A;  4X2B A;  5L1I A;  3H0P A;  2IVY A;  3CDW A;  4KHM A;  2AKW B;  3AB4 B;  2ZJR Q;  3D1H A;  1N33 J;  2IMW P;  4MKA A;  1LK5 A;  2YH1 A;  2VBY A;  4LF7 J;  2Q1L A;  3OHB A;  4F0M A;  4GVB A;  1MMN A;  4IOC Q;  1D9D A;  3Q86 A;  3R9L A;  1WUU A;  3LPY A;  4DSI A;  1WOP A;  5L1J A;  3RG6 A;  1EQ0 A;  4PG6 A;  4DLG A;  2GHW A;  2R2T A;  4HTJ A;  1E6V B;  4B3R J;  2AWZ A;  1TL1 A;  2FJD B;  5CXT A;  4DV0 F;  2MPU A;  2GMH A;  1TL5 A;  1P1T A;  4ETZ A;  2OSQ A;  1E6V A;  4DX7 A;  1T9Y A;  3N79 A;  2ZH6 A;  4DR1 J;  5ADZ A;  3FFI B;  2I5J B;  2CAD A;  2H4Y B;  2M70 A;  2HHX A;  4BCA A;  1UJ5 A;  3FFI A;  4YOE A;  2CIM A;  2QA1 A;  1RXO B;  1SC3 B;  3EXC X;  4RNM A;  5IT0 A;  2N82 B;  3TUJ C;  3TOQ A;  1YG0 A;  5D4O A;  2FY8 A;  1SL0 A;  5ETV A;  5CYQ B;  4Q45 A;  4DV6 J;  5ETP A;  3Q23 A;  5J2M A;  1A9N B;  1TV6 A;  3SV4 A;  3MPW A;  3K5M A;  4KV8 B;  2OD4 A;  2CJB A;  3ZFV A;  3ZZR A;  4I2P A;  1ZH5 A;  4IO1 A;  4KV8 A;  4MT1 A;  4AXI A;  3BBC A;  3PJ9 A;  2EWH A;  3LO3 A;  4JI6 F;  4LRB A;  3D9B A;  2H54 B;  2X1F A;  2VJU A;  2FB0 A;  2EFG A;  4B9N A;  3R5C A;  4FS1 A;  4LF5 F;  1NJZ A;  3FC9 A;  1JLG B;  2F4F A;  2KYX A;  5K5M A;  1MMD A;  3O2I A;  3ZZO A;  4I7F B;  4IYQ A;  1OYD A;  3RRG A;  1F2G A;  3CF5 Q;  4FYX B;  3PHT A;  4O0N A;  2Y8Y A;  3NMA A;  4B17 A;  3GFX A;  3RB6 A;  4DF8 A;  4F4Z A;  4NZ0 A;  4NLX A;  3IP0 A;  3DDN A;  3NMR A;  1WWH A;  5DDO C;  1U2F A;  3TEH B;  2JVR A;  1N5V A;  4MIW A;  3NRB A;  3KHH A;  2DNY A;  2W2Q P;  1RIS A;  1YRU A;  3Q24 A;  4ZCL A;  1HQE B;  3AXM A;  4QW9 A;  2CNO B;  2VON A;  3MM8 B;  1C2P A;  1UAW A;  4PWD A;  4ID8 A;  2V34 A;  1HQE A;  1VQ4 S;  2GHP A;  2Q6B A;  3BV8 A;  3AD8 C;  3OBI A;  3GON A;  4TYB A;  2XS7 A;  4C8M A;  3IFE A;  2MHE A;  2HRY A;  1SJ1 A;  2V9K A;  1K47 A;  5HL7 Q;  2MGZ B;  4CH0 S;  1X9W A;  2AJ0 A;  2VDH A;  3BGO P;  4DV3 F;  2HUR A;  2UP1 A;  5DG8 A;  2WHO A;  3M6U A;  2AGO A;  1O8B A;  4XPE A;  3NGD A;  2P8I A;  4DFP A;  3GYN A;  3IC1 A;  4P2X A;  1TKD A;  3HK2 A;  4JOU A;  3FRZ A;  3T9Z A;  2VDI A;  4S0M A;  4UY8 5;  4OZL A;  3EX7 B;  3D2W A;  2E5G A;  5ETN A;  2RSQ A;  1DTT B;  1RCO B;  3AQO A;  2W24 A;  4NLR A;  1A6L A;  2GAG C;  1QM9 A;  2J0S D;  1DTT A;  5C42 B;  2CQ0 A;  3EPI A;  1F2H A;  4DEZ A;  3C8Y A;  5C42 A;  2JEJ A;  1AB8 A;  4USU A;  2JL9 A;  5AT1 B;  1YJ7 A;  1JQG A;  4ID5 B;  3H40 A;  2KHC A;  1RAG B;  1MML A;  1AW0 A;  2WBR A;  4GC6 A;  1RTD B;  2Z2Y B;  4ID5 A;  3DRX A;  3GLJ A;  2VFU A;  2IMO A;  1RWN B;  3EGV A;  2UXD F;  4V19 J;  3Q2S C;  1RTD A;  5KFY A;  5DET A;  1HFE L;  3PAC A;  1RKJ A;  3N4W A;  5LMU F;  4HTI A;  3MEC A;  3KYL A;  3PY8 A;  1DLO B;  3A8E A;  2FVR A;  3V6D B;  1NAQ A;  8RUC A;  3CED A;  3UD5 A;  1VCT A;  3K7R A;  2QT7 A;  3V6D A;  2ZM6 J;  1NJW A;  1LQ9 A;  4ZP7 A;  3MED B;  2UUB F;  1NSP A;  3MED A;  4LR8 A;  4C7Q A;  1HW8 A;  3TVY A;  5KG3 A;  3AB2 B;  4OQJ A;  4DV3 J;  2W9B B;  1R8P A;  5B0C A;  3PG9 A;  2FIU A;  1VC6 A;  5HBM B;  4U8Y A;  5KFU A;  4OJH A;  2XEX A;  5F0U A;  1EAY C;  5HBM A;  1SJ4 P;  4X4T A;  4OZ2 A;  3OPK A;  3UE2 A;  2HBR B;  4HH0 A;  1MLA A;  4WZQ A;  1S1T B;  5LT5 A;  2I8E A;  1CJU B;  1Q8L A;  4RW8 B;  4NA2 A;  2F63 A;  1CVJ A;  5KG2 A;  1XNR F;  2Y3Y A;  1CJU A;  3OQ2 A;  1VQM S;  4RW8 A;  5DO2 A;  2PMW A;  1Q79 A;  3H98 A;  3H7H B;  3KJQ B;  2HFS A;  3POT B;  3D0G E;  4ZP8 A;  3K5N A;  1VHF A;  3DLE A;  2RQM A;  2B8P A;  3J81 Y;  2DGT A;  1IWA A;  3KXD A;  5B08 A;  3G4S S;  3UDV A;  2CVE A;  2XNR A;  3WX4 A;  1S99 A;  5LMU J;  1DQA A;  1FXD A;  4KH0 B;  3GIJ A;  4NML A;  1IBL J;  3ILJ A;  2X7I A;  1S49 A;  3N6M A;  2DK2 A;  4O4G B;  3KTQ A;  3CCJ S;  2VA3 A;  1KQF B;  2EFN A;  3CCW A;  2VZ9 A;  2VPZ B;  8ATC B;  4YY3 F;  1HYS B;  5ETQ A;  4AUK A;  2FGC A;  1PJ5 A;  4XO0 A;  2UUB J;  3RW7 A;  2CJ9 A;  1TAU A;  2XMT A;  3VHQ A;  1YVF A;  2PD1 A;  3J7A N;  4TXS A;  2ABY A;  2MJU A;  4WIQ A;  3CCR S;  5IM0 B;  2CRL A;  1YK9 A;  2HFU A;  2XWX A;  5IM0 A;  3D0I E;  2V2Q A;  2DGV A;  3ZTS A;  3J80 U;  3NP5 A;  4FNH A;  3FUY A;  2HZV A;  4G1I A;  2HKE A;  1RDR A;  2C3P A;  2D9O A;  3FQK A;  2E1M C;  2W9C B;  2EK1 A;  4DV1 F;  2B56 A;  3THV A;  1UWB A;  5H9F K;  3BN4 A;  3C6U B;  2OPQ B;  2W9C A;  3LGM A;  5GAE I;  2YNF A;  1U09 A;  3L7P A;  1WTB A;  3BQ1 A;  2OPQ A;  4YQW A;  2JX2 A;  4YME A;  3P5T L;  2ASJ A;  2OIH A;  4C98 A;  2MKH A;  5J1P A;  5T41 A;  2FHK A;  2XC9 A;  4WU2 A;  1QE1 B;  4F25 A;  4P2M A;  2I1R A;  4BS2 A;  1VK8 A;  1AFJ A;  4FBT A;  2J76 E;  4HKQ A;  1T9X A;  2EKN A;  3J7Z 5;  1PC5 A;  1PCA A;  2H5E A;  1MNE A;  1OSD A;  2ZH4 A;  2BW7 A;  3M9N B;  4YB1 P;  1BQM A;  3K59 A;  3BGR B;  2COL A;  2W2N P;  1WKL A;  2CZV C;  3SSS A;  2WSE C;  3MI7 X;  1YLX A;  4MFB B;  4X65 F;  1U49 A;  2KU7 A;  3BGR A;  1CJT B;  1M5S A;  3CTR A;  1SL2 A;  2LQ8 A;  1LKZ A;  4ZLJ A;  4OZ5 A;  1BC6 A;  3P6Y C;  5D0G A;  1QVG R;  1CJT A;  1GQE A;  2GX8 A;  5H9E K;  3W5Y A;  1RK8 A;  2JRS A;  4WTO B;  2E1A A;  1G7C B;  1NK9 A;  2DKO B;  5F3T A;  2BKP A;  1IXK A;  5J2N A;  3LW5 C;  1BUX A;  1GXU A;  1AUS L;  1IR0 A;  2K06 A;  3MHY A;  2OTJ S;  3HZE A;  1HA1 A;  1M5K C;  3H90 A;  1F3F A;  2CG8 A;  6FD1 A;  3G2X A;  2AT1 B;  3OTO F;  3S01 A;  1K1S A;  3QJL A;  2MQO A;  2C2Z B;  1NB2 A;  3FMB A;  4LFA F;  4OI0 A;  2FHO B;  1KVI A;  4F36 A;  4DQR A;  4I0W A;  4NE9 C;  3TVK A;  2NYI A;  1I6J A;  3EIC A;  1XEZ A;  3P3D A;  4DV1 J;  5F8H A;  5DG7 A;  3K5O A;  1F0X A;  5KFQ A;  3MFI A;  2MDA A;  3OLB A;  2B4U A;  4OYI A;  4WJB A;  3Q89 A;  1RWX B;  1X4G A;  2B9X A;  4E8U A;  1S1U B;  1N8R T;  1QSL A;  3DYA B;  3DKD A;  5D3G A;  3I31 A;  1YI2 S;  4L76 A;  1X5S A;  1BWV A;  4K4Z A;  1U0S A;  1RT5 B;  4DDF A;  3ILO A;  1KQG B;  5CA5 A;  3OW2 R;  4JI1 J;  1Q8I A;  2H3E B;  1RT5 A;  2W9A A;  4CO1 A;  3SCJ E;  1UEK A;  1KBR A;  3LTO A;  4X65 J;  4WP8 A;  1Q5Y A;  2YNI B;  3GFZ A;  3K5L A;  4MK9 A;  9ATC B;  3KLI A;  1NO8 A;  1JLF B;  1W25 A;  2YNI A;  4MAK A;  4TNO A;  1N5Q A;  2F40 A;  4CT8 A;  4FPR A;  4NPO A;  4XIU A;  4M5L A;  1RT6 B;  3BKU A;  2HBY B;  3ZZZ A;  3ZTR A;  5JUM A;  1Z4U A;  2HHT A;  3A8I A;  3OTB A;  4DLE A;  1VRT B;  3M2V B;  4XTT A;  3OTO J;  4UY8 T;  1JXL A;  5LSR A;  1S6U A;  1VRT A;  4LFA J;  3QT7 A;  4IOB A;  2ZC4 A;  3EZU A;  3BYR A;  1CC8 A;  2WSF C;  5B0E A;  4I4B A;  4LIW A;  3HM9 A;  4LUB A;  1XR7 A;  4V19 X;  4JV5 F;  1B4S A;  3LAL A;  1S10 A;  2KXN B;  1LWE B;  1FDA A;  3CWJ A;  4CQ1 A;  3THT A;  1C0U A;  4LMZ A;  5DRK A;  1YJW S;  4B3S F;  3D7S B;  4KQZ A;  2W25 A;  4HDG A;  2OPS B;  4Y2I A;  1KFS A;  1WI6 A;  1N0V C;  3HFK A;  3M2R B;  1RHJ B;  4O23 A;  2OPS A;  1GK8 A;  2OFG X;  2YKO A;  2C2O B;  2YXL A;  3M2R A;  2ILY A;  4BLG A;  4RZR A;  1X4H A;  2CPI A;  2NSC A;  2E5I A;  3BQ0 A;  4F3M A;  5GME A;  3LAM A;  4L72 B;  3H4D A;  2EFQ A;  2V4R A;  3LP0 B;  3UWT A;  2VFV A;  2C42 A;  4J9K A;  3DRR A;  2DBB A;  4UOG A;  5KG7 A;  3CXC R;  2J9D E;  4ECZ A;  2MQN A;  2OTL S;  1KP6 A;  4LJM A;  2EC2 A;  3DN9 A;  3HP6 A;  4UUX A;  3UD4 P;  4JYA J;  2Z30 B;  1FEH A;  1RKI A;  3IR6 B;  2MQP A;  4JB8 B;  3Q8S B;  3QAT A;  2ZH9 A;  2KI2 A;  3M2U A;  4FBU A;  5E3R A;  3MR2 A;  4YR0 A;  3IAM 9;  3ILL A;  1F9F A;  3R5G A;  4IO9 Q;  2DNL A;  1YIJ S;  4C8N A;  3CMA S;  1N36 J;  1RT1 A;  2LEP A;  2P6T A;  4N77 A;  2X1G A;  1CPZ A;  2DCL A;  2KZZ A;  3NOG A;  1X5P A;  4K50 A;  4U7C A;  1F60 B;  3WIU A;  2BRL A;  1OPZ A;  4ZVO B;  4FYD A;  3KJV B;  3A13 A;  1HNX F;  4HI2 A;  1YX2 A;  2VPW B;  1T11 A;  2R4F A;  2HS4 A;  4HR2 A;  1W2I A;  2DO4 A;  4DUT A;  3KJV A;  3VV2 B;  4ILL A;  4N5S A;  2JEG A;  3C6T B;  4J9U E;  1NHU A;  3C6T A;  5CQG A;  4LF8 J;  1QSY A;  4ZIV A;  1U6F A;  2CQC A;  3BYP A;  5F8M A;  3PX4 A;  3T6J A;  4NRU A;  4KYZ A;  4NLW A;  4OI2 A;  2EW9 A;  2A0F B;  1HLW A;  3I96 A;  1E6Y B;  5LMN F;  1LW0 B;  3UDL A;  2HGL A;  1NCL A;  1EP4 B;  1KR4 A;  1LW0 A;  4ZCM A;  5HJX A;  4CNZ A;  2M3D A;  3AOB A;  4R25 A;  4ZMM A;  1EZZ B;  4Y3C A;  1EP4 A;  4N8O A;  1ZTW A;  3RUB L;  1X4E A;  2M7S A;  2LP4 A;  1RHR B;  4NZ6 A;  2J7K A;  4OX8 A;  3MMC A;  2YX7 A;  2HLU A;  4DV5 J;  4I2Q B;  4LQ9 A;  4AND A;  4DR7 F;  1UZD A;  1WNE A;  2RE1 A;  3KKF A;  4I2Q A;  3H2U B;  5KFF A;  3FCW A;  3PO5 A;  5DQG A;  4MJK A;  3RZA A;  3IM8 A;  3R5D A;  4ZLP A;  2M52 A;  4LSN B;  2QL9 B;  4A48 A;  4RBU A;  1GX6 A;  3AAW B;  4K4W A;  1B99 A;  2CJQ A;  4LSN A;  4NMX A;  3O8W A;  2ZOG A;  1AA1 B;  1KTV A;  4C0O C;  1C4C A;  3FEX B;  2MKK A;  3SFG A;  2DNH A;  3CD5 A;  3KG4 A;  5M2P A;  3OHA A;  1PSD A;  2HWT A;  1SPB P;  4RNH A;  3BH6 B;  2DGQ A;  5E3Q A;  4DN0 A;  2GIR A;  1ZBT A;  3MM7 B;  3MUR P;  5KTQ A;  4RWX A;  2N3O A;  4PPD A;  2UUA F;  4QWD A;  4ZKA A;  3PV8 A;  4IRD A;  1U45 A;  2W01 A;  2DNZ A;  4GKK F;  1GEH A;  5A8K B;  4NYZ A;  3IGV A;  3J7Z T;  1FE0 A;  3IBC B;  4PYD A;  2G2Y A;  1F3V A;  2EG2 A;  1VJQ A;  4K4Y A;  3R8Y A;  4D3H A;  2W8K A;  3A3N B;  4J9L A;  2ZHO A;  5A0Y B;  5LMN J;  1LXN A;  3G8T A;  3FCH A;  2NPF A;  1FFG B;  8AT1 B;  3OJU A;  2B9Y A;  2V0N A;  1PYO B;  1WTF A;  2ZH2 A;  2FUG 9;  5A0Y A;  3ICL A;  2KFZ A;  1B70 B;  3P8B B;  4WFN Q;  2P6S A;  4ZIT A;  4USK A;  3HVR A;  1RBO B;  5EX0 A;  4F0K A;  2XO7 A;  1H7W A;  1RHQ B;  1HD1 A;  4QR0 A;  2AX1 A;  2HHP A;  2PEB A;  4OX7 A;  1RBL A;  1X0F A;  1B7F A;  2NRE A;  3C14 B;  4P73 A;  2B8Q A;  1R0C B;  3GIR A;  3A8K A;  2DRB A;  4Y0F A;  1J2V A;  2DHS A;  3M8Z A;  2ASY A;  4X66 F;  2AD9 A;  3JYT B;  3C14 A;  3HHL A;  4K4X A;  2FHJ A;  3JYT A;  4RBT A;  1UVN A;  3HUL A;  2CVI A;  1KNZ A;  5IZH A;  3D4J A;  4JP8 A;  2R9L A;  4NLG A;  1WG1 A;  2LQJ A;  3MXH P;  1FJG F;  4F02 A;  3CT9 A;  2UVU A;  2X1B A;  3DDI A;  3CCQ S;  1WHX A;  1VRU B;  1QY7 A;  3AD7 C;  2IBK A;  3SQO P;  1IM4 A;  3IS9 A;  4DHV A;  3V2U C;  3W65 A;  2GGP B;  5SUH A;  2MSS A;  4HHU A;  5IV4 A;  5DZ7 A;  3I0S A;  2GGP A;  4GKK J;  1FDD A;  3NGT A;  3CJK B;  4N76 A;  4I6A A;  3MWB A;  1S6O A;  5A8W B;  1KS2 A;  2ERR A;  3CJK A;  3D54 A;  3BO2 A;  3SI8 A;  2W7P A;  4F3O A;  5G0R A;  1T9V A;  2JVO A;  1ZYQ A;  2HNY B;  1Y11 A;  2E9Z A;  2HNY A;  1DAR A;  2HVZ A;  1Q81 T;  3GR1 A;  4RUB A;  2KT2 A;  4J90 A;  3DGP B;  1NUE A;  5DLF A;  2RU3 A;  3DGP A;  4ATN A;  1ZOT A;  1SQF A;  5DM6 Q;  3DOL B;  3NEK A;  4Q5V A;  3CVK A;  2I38 A;  4QWE A;  1HI1 A;  3IRW P;  2HBQ B;  3DOL A;  1H72 C;  2GJ2 A;  1HQU A;  1NK7 A;  5CHC B;  3LAN A;  1ARO P;  5ETR A;  2DT9 A;  4DSE A;  3NNA A;  4X64 F;  3QAU A;  1KC8 T;  1QAI A;  4WXW A;  1VI7 A;  2DH7 A;  2I9S A;  1VC0 A;  2IAJ B;  5ETO A;  1ACM B;  2DGS A;  3MUT P;  3KFW X;  3I32 A;  2XS5 A;  2RD5 C;  4H4O B;  2IAJ A;  7FDR A;  2GVZ B;  1FJG J;  2PMH A;  2C2R A;  4EYH B;  4H4O A;  3TR5 A;  2BOA A;  2GVZ A;  1TK8 A;  3C16 B;  2OPP B;  9RUB A;  4M5M A;  2EI5 A;  1JLA B;  3TQE A;  3C16 A;  3DI6 B;  2W4C A;  2HK2 A;  2C2E A;  1JLA A;  4K2J A;  3N6L A;  4ZVG A;  3AT1 B;  5IT9 Y;  2KH9 A;  2WCX A;  2RHS B;  1V9O A;  4BWM A;  3VGS A;  2C3U A;  3JB9 k;  2R7S A;  2X51 A;  2V5H G;  3T1H F;  2AHO B;  3OL6 A;  1P6T A;  2NXC A;  4L3N A;  1UFK A;  2MMY A;  4TY9 A;  3RR8 A;  3DM2 A;  4KFB B;  5GAE U;  1QVF R;  1XWL A;  4KFB A;  4JI4 F;  1S76 D;  2MZT A;  5L9N A;  2MYF A;  1SB6 A;  1FRX A;  2W1B A;  2AJQ A;  2CZ4 A;  2VG6 A;  3MM9 B;  2FJE B;  4WK3 A;  2B43 A;  2CPF A;  4GO7 X;  5FII A;  5IQ6 A;  4LRF A;  3VGU A;  4RNO A;  3FBF A;  2P9E A;  3MM9 A;  4KHP J;  4X64 J;  2XZT B;  2W2P P;  3MD3 A;  2GJF A;  2Y9H A;  2EFO A;  1CJV A;  3G87 A;  3H4B A;  2PA3 A;  3BB5 A;  2LXI A;  1IJE B;  1MRO B;  2XO6 A;  1RLC L;  5F8I A;  4NCG B;  3TX0 A;  2FJX A;  3BSA A;  1GMV A;  4WTY A;  1O6X A;  1MRO A;  1REV B;  1VQS A;  4ED8 A;  4CO5 A;  1REV A;  5FLX U;  3MPD A;  2ALY B;  3NGS A;  2ZOM A;  3AY0 A;  4CLT A;  4QR1 A;  5BR8 F;  4PXD A;  2PT0 A;  3M30 B;  4DU7 A;  3RR7 A;  1TFW A;  4XDC A;  4A8O A;  2HQF A;  3EVW A;  2NCK L;  3M30 A;  4DFM A;  3DNC A;  2P9C A;  5C7P A;  1Q16 B;  5KFB A;  2K8G A;  4D3G A;  3EGZ A;  1JWW A;  3TUI C;  1T0T V;  2D9P A;  2J9E A;  5C25 A;  3T5J A;  2MTL A;  4B9U A;  4U8V A;  3T1A A;  3PDN A;  5E2Q A;  2NQP A;  3IG1 B;  4DR3 J;  3G6E S;  2UXB F;  2YVS A;  5KFA A;  2XY5 A;  2JC0 A;  3OLA A;  1JX4 A;  3V81 B;  4U7U K;  4ZVU B;  5KT6 A;  3W9J A;  3M8R A;  4KGK A;  3V81 A;  3HVA A;  4QU7 A;  3T1H J;  3FGV A;  3O1L A;  2QJ3 A;  4O3Q A;  1ZPV A;  3I87 A;  2D74 B;  3BSC A;  4JI8 F;  4H4K A;  3PR4 A;  1SC4 B;  1X9S A;  4DL0 C;  1XJW B;  3PHE A;  1Z2Z A;  3OR2 A;  4DX8 H;  3IXQ A;  1UKU A;  3RBZ A;  4AFF A;  2L9D A;  2ZH3 A;  2XLK A;  2R8H A;  2EPI A;  4O44 A;  1NM2 A;  4NXM F;  1WKK A;  4FYW B;  1WOO A;  4IRC A;  2H51 B;  4ZVT B;  1QSS A;  2OEJ A;  1UCN A;  5KG0 A;  5AXM A;  2QTW A;  3HVT B;  3L9Z A;  1HHQ A;  5HRO A;  1CSJ A;  1XN9 A;  2IRX A;  4B3T J;  4DPT A;  5HMW A;  3C2P A;  4WFB Q;  2HK3 A;  1RWU A;  5J2P B;  3BDE A;  4H54 A;  5L9X A;  2CQB A;  1C0T A;  1KOO A;  1VR6 A;  2BYC A;  2XUL A;  5J2P A;  1NSK L;  4Y6I A;  3DFE A;  2H48 B;  1VHI A;  1N4L A;  1NK0 A;  1FRJ A;  3U7J A;  2MKI A;  1C4A A;  2XGP A;  5FJ4 A;  1FTR A;  3G96 A;  5BR8 J;  3I5B A;  2ZZM A;  1FRK A;  3AH6 A;  1HBM B;  2QL5 B;  2LVW A;  3SSR A;  4EUV A;  4R0E A;  1HBM A;  4F2R A;  2M88 A;  3CCS S;  3OFG A;  4UW2 A;  2XBP A;  4ZJL A;  2OHD A;  4ICL B;  2CQ3 A;  2PA8 D;  4DX5 A;  2H4W B;  2QA4 G;  5KFG A;  5KT7 A;  1O51 A;  3TZW A;  3PW0 A;  3NOC A;  2VOD A;  5LXY A;  4EZ6 A;  1V3S A;  5EGY A;  2BA9 A;  4TU8 A;  2KHD A;  1YTY A;  3E51 A;  2CPE A;  1JB0 C;  2K2P A;  4JI8 J;  2FTR A;  2AYE A;  2CPJ A;  3TVZ A;  3C15 B;  5AE1 A;  2J0W A;  1VMB A;  3H25 A;  2OML A;  2VH7 A;  1Y7P A;  1KDN A;  5KG6 A;  3EYZ A;  2FLL A;  1WC3 A;  3QFW A;  1KEK A;  3QMQ A;  2C2K B;  5F8N A;  1IJF B;  1MWY A;  1ZZF A;  1HNV B;  5LL6 d;  2JLF A;  2MY7 A;  5IFM A;  3RAM A;  2OUG A;  3M6W A;  5F8L A;  4QYR A;  2JFK A;  3VVT A;  5C5J A;  2M2B A;  4XK8 C;  5GVQ A;  4LQ3 A;  3NNC A;  4M5J A;  4OLP A;  4PR6 A;  4A46 A;  4HHJ A;  2BR0 A;  3N01 A;  4KJI A;  1KFD A;  1CBK A;  1W26 A;  3R97 A;  3I9Z A;  3OVS A;  2BM0 A;  4E2F B;  4JI0 F;  3D3C J;  1H74 A;  2CQ4 A;  2L9N A;  4OIX A;  2WSC C;  4DZ6 A;  2HQD A;  3KLF B;  3FSY A;  2ATC B;  1RYS A;  4ZVR B;  3NWG A;  3I0R B;  2BAN A;  4R8U A;  3KLF A;  4N47 A;  4QWA A;  2XLJ A;  1SKS A;  1HBN A;  3DGV A;  2CDQ A;  3I0R A;  5RUB A;  5KFL A;  5LSL A;  4NYO A;  5HMZ A;  1TKT B;  3E01 B;  2U1A A;  3GJR B;  5AE3 A;  2DYA A;  3ZZP A;  1S9F A;  3HVW A;  1V5I B;  4DV4 F;  1UWA A;  2E5J A;  5C24 A;  2B5J B;  1S9E B;  1LWF B;  1T05 A;  6FDR A;  5A2Q U;  4L73 A;  3VTI A;  1LWF A;  2WRM A;  4FKX A;  4X4R A;  4LRE A;  4DR2 F;  4GKJ J;  1FKO B;  1X4C A;  4O3S A;  3I55 S;  3JAM Y;  1U8S A;  1ZZN A;  2YTC A;  1FKO A;  1WOR A;  2NXE A;  4Y2K A;  1S1V B;  2ZOF A;  1X5T A;  1RT7 A;  5LXR A;  4MK7 A;  2ZHA A;  5J1N A;  5IWA F;  1S1V A;  2W2M P;  3VQS A;  1LXJ A;  3J7Y I;  3GYG A;  2DR7 A;  2XMW A;  1FF2 A;  3RYL A;  4A8X A;  4RUC A;  4HT5 A;  3HHL C;  3UN2 A;  3IGN A;  1SIZ A;  1SH2 A;  2UU9 J;  2HWI A;  1WEL A;  1FI4 A;  1YWX A;  2HWH A;  2KJV A;  2ZHB A;  4HH1 A;  4LFB J;  3KLG A;  2MZS A;  2HNZ B;  2CDR B;  1UP1 A;  3JTN A;  4JI0 J;  2HNZ A;  2BMB A;  5KFJ A;  2UXC F;  1LW2 B;  4RU9 A;  1AUD A;  4FYV B;  5KT5 A;  3W5X A;  3PYF A;  1U1M A;  3PKM A;  2ROG A;  2ZDO A;  3TI0 A;  1D3W A;  4PAA A;  4C6A A;  2AQ4 A;  4B3O B;  3ET6 B;  4CM0 A;  3TJ9 A;  3BSO A;  2V69 A;  3DC2 A;  4FDF A;  1NDP A;  1A7G E;  1R6Y A;  1RA6 A;  4OFZ A;  2MHN A;  1TUW A;  2DNR A;  1TK0 A;  1NBE B;  1NPP A;  2BEF A;  2ZJQ Q;  1WKJ A;  2JSX A;  2QLB B;  4ZS6 A;  4DR2 J;  3CIM A;  1U1K A;  1SL1 A;  3SBM A;  5ETL A;  3UDE A;  1RP5 A;  2NYH A;  2MST A;  4ZDN A;  4KO0 B;  2CNK B;  2DXF A;  3IM9 A;  1NDC A;  3H59 A;  3IBF B;  3QIP B;  4LF4 F;  5KFI A;  4KO0 A;  4KBI A;  4WFZ A;  4OYW A;  5T7L A;  2IJN A;  3QIP A;  3UI3 A;  2XMA A;  2HAI A;  3CJT A;  2OKQ A;  3Q8Q B;  4JI7 F;  2B7B B;  1RAO A;  4OJ3 A;  4WII A;  2E5H A;  4HYK A;  3KLH B;  1AFI A;  4MK8 A;  3TAM B;  1SQG A;  2FZG B;  1WEY A;  3CDE A;  4FF4 A;  3RRH A;  4I56 A;  3TAQ A;  3KLH A;  1TL7 B;  4ECR A;  3TAM A;  4ILM A;  2MEW A;  1EAR A;  1CUL B;  2U2F A;  3SSQ A;  1WSR A;  4C8K A;  3SDE B;  4C11 A;  4RW7 B;  3Q8R B;  1BQN B;  3JQK A;  4RKU C;  1NU4 A;  5HAO A;  1N48 A;  3SDE A;  2W8L A;  1YQH A;  3EDQ B;  4ED0 A;  4EI2 A;  3CCL S;  2CPY A;  1EB0 A;  1XK8 A;  3IO1 A;  4AXJ A;  2FZC B;  3PKY A;  3HX9 A;  3GMG A;  1T9W A;  2I0X A;  2PGC A;  3M8W A;  2HHV A;  3WC0 A;  3CJQ A;  4KKO B;  2C22 A;  5KAK A;  4FNI A;  2QLF B;  2HGM A;  1BE4 A;  4DPW A;  1GXL A;  3C66 A;  5EX3 A;  3BKT A;  4KKO A;  1VQK S;  1U26 A;  1N5Y B;  3GJS B;  3NKY A;  4F3Q A;  3PRB A;  1H7X A;  3UR3 C;  4JI5 F;  2Q6C A;  3IWN C;  1ITP A;  3IN5 A;  1N5Y A;  1H2U X;  3FZ2 A;  5CAB A;  5A8R B;  3MAA B;  2V68 A;  2HHQ A;  4JI2 F;  3MAA A;  3LWM A;  3QGP A;  1C1B B;  4LF4 J;  5KG4 A;  4JI3 F;  1M5P C;  4IG0 A;  3GII A;  2IIH A;  4LF2 A;  3GZ7 A;  1C1C B;  3CJR A;  4IKA A;  4BC9 A;  4X62 F;  4K5S A;  1NH7 A;  3MEK A;  3NGR A;  4HEA 9;  1JLQ B;  4GVL A;  5KG5 A;  4NXN F;  4RU2 A;  4OYZ A;  1SVD A;  4V1A k;  1JLQ A;  3WHI A;  4JBC A;  3GFY A;  2M5Y A;  4DXL A;  4M94 A;  3NWR A;  4RW4 A;  1LEO A;  3P45 B;  2H9Z A;  1HWK A;  1NK6 A;  2IDL A;  1GMW D;  1H6K X;  2JOQ A;  2W4D A;  2PI4 A;  4K4S A;  2G13 A;  1N34 F;  1NND A;  4ZP6 A;  2ZD1 B;  2DNQ A;  2XCP A;  2D3O 1;  2MQQ A;  3ISN D;  4U96 A;  5F0W A;  2J8A A;  1SXL A;  5K8P A;  2ZD1 A;  2QSW A;  4HL9 A;  1K73 T;  1YDL A;  3F41 A;  1UZH A;  5K14 A;  2RQ4 A;  2DPJ A;  4UZB A;  1IBM F;  2GW8 A;  1OQ6 A;  3VF0 B;  1B0V A;  1PG5 B;  4WK1 A;  1GTH A;  4DR6 J;  2E1C A;  1QLN A;  1OWX A;  2BJE A;  4U95 A;  4LR7 A;  4PCQ A;  2RQC A;  3DHX A;  2UVR A;  4H4K C;  1U02 A;  1KVK A;  4DV2 F;  3GR0 A;  5K9F A;  4CDI A;  4U6P A;  3GSD A;  4JI2 J;  3SZ2 A;  4IOA Q;  3HCX A;  5B0A A;  3T1Y J;  2F1F A;  3KK3 B;  3DDK A;  4M5N A;  1R7I A;  1QTM A;  2A2C A;  3G82 B;  2L9W A;  1Y5N B;  1PIL A;  3KK3 A;  1FVQ A;  4C3K A;  4KGX B;  1JJH A;  4X62 J;  3G82 A;  2HLT A;  3EMT A;  1FKP B;  4LSL A;  2AEM A;  2WON B;  4LR9 A;  1HI0 P;  4NLS A;  2C2D A;  4ELV A;  1XQI A;  2HGN A;  4PRF A;  3PFE A;  4WYW A;  5GAD I;  1X4A A;  4TKT A;  1X7V A;  2Y1J A;  4ZVH A;  2RDD A;  4MYU A;  1APS A;  2EFV A;  3VZI A;  1CLF A;  3BRE A;  4ED1 A;  3BGU A;  1NK5 A;  2DRD A;  4K4V A;  2LDI A;  4ERD A;  1N34 J;  3W9I A;  1UW9 A;  3HT0 A;  5LOQ A;  1IKV A;  5DGA A;  2XZD B;  5HP1 A;  3CE8 A;  1NPR A;  3GE9 A;  4P6Q A;  3CCU S;  3TZX A;  4NL5 A;  2AEJ A;  1M1G A;  2DXE A;  1G3O A;  1M5V C;  2OFH X;  3M4X A;  2RIL A;  5A6W A;  4DU8 A;  1FNM A;  1EX8 A;  5KT4 A;  1U6Z A;  2YWW A;  3P49 B;  1IWG A;  3I5A A;  2UZA A;  4DR5 J;  2RML A;  3B54 A;  1S1X B;  3W2V B;  2VFS A;  1RT2 B;  4KY3 A;  1U8W A;  2MJN A;  2VBW A;  1IR2 A;  2DEI A;  2G1D A;  2R7T A;  3SCK E;  3S8S A;  1RT2 A;  3EM1 A;  1NXI A;  3F56 A;  4I1T A;  4DV2 J;  1TMJ A;  3W2W A;  3OSN A;  2AZ1 A;  4NI2 B;  4OHW A;  2V8G A;  1BXN A;  4DN9 A;  3K2Y A;  3BR9 A;  2IJF A;  2HSE B;  3BKF A;  4HVZ A;  1Q0N A;  4NI2 A;  3E8O A;  2BBE A;  2A18 A;  4OZJ A;  2XMK A;  3NY0 A;  4C0B A;  1K8A T;  3HJV A;  3EUN A;  3J81 U;  3GV7 B;  2V4J B;  3G6V A;  2QL7 B;  3BGL A;  2J7W A;  4RUH A;  2HAF A;  4HDH A;  4M5K A;  2AW0 A;  2ZIT A;  3SCI E;  3JTP A;  1P9Q C;  3W8P A;  2ZC3 A;  2R2S A;  4K2X A;  3K5P A;  4KAI A;  4IH6 A;  3K8V A;  3OUY B;  2CJY B;  2B4P A;  2CJK A;  5D8H B;  3KOA A;  4RNN A;  1NK8 A;  1ZAX A;  3NS7 B;  4NRT A;  1IQT A;  5D0H A;  1G4C A;  1IQZ A;  2R7V A;  3HHN B;  3I6P A;  3R6G B;  3ONQ A;  4CP5 A;  3AFG A;  5E7O B;  1XR5 A;  4RWW A;  1TMM A;  2RQK A;  1RJJ A;  1DZ5 A;  4Q44 A;  5IQQ A;  4DJB A;  2VIC A;  1RTH B;  2C3O A;  1Q53 A;  2ADB A;  3FEZ A;  1A0O B;  2BRK A;  2XQC A;  2QZ8 A;  3QJJ A;  1LWC B;  2E7X A;  4A47 A;  4CLL A;  1NDK A;  1WEZ A;  2V8P A;  3AJ1 A;  1SKW A;  1XMQ F;  4YHH J;  2I5J A;  1LWC A;  4EYI B;  2ZBC A;  3U27 A;  4TQS A;  4IFV B;  5KFM A;  5D4L A;  2WB4 A;  5HLF B;  2DGW A;  4UT4 A;  3Q0A A;  4IFV A;  1VBK A;  3IWX A;  3CNQ P;  3FEY B;  1H2T Z;  5CYQ A;  2QGF B;  4NWB A;  1HQ2 A;  1KRP A;  4HI1 A;  2ZWO A;  3GV8 B;  3V4M A;  2K7J A;  2F8M A;  3M1V B;  3MEE B;  1JLB B;  3QBC A;  1SKU B;  1FKA F;  4RNF A;  4DFJ A;  4CI0 B;  4OZ3 A;  3UVJ B;  4QOT A;  2H65 B;  2F4V J;  3BPS P;  1FFW B;  3A12 A;  3M8Y A;  3UVJ A;  2XSF A;  2H5I B;  4OZ1 A;  4USH A;  1Q7L B;  2DHA A;  2HHU A;  3KJF B;  1OYE A;  3T19 A;  4P71 A;  3NCR A;  2W7A A;  2DEJ A;  3QFH A;  2XHC A;  1JLG A;  1PYT A;  2GFF A;  4NCA A;  1URN A;  3BGF A;  2I2Y A;  2XY7 A;  4OHZ A;  4I7F A;  4Y34 A;  3FQL A;  3K89 A;  4DPO A;  2ZVS A;  4ZPT R;  2P9G A;  1QUV A;  1Q78 A;  3IR7 B;  2CQG A;  3C19 A;  4WKY A;  4MIA A;  1Z2L A;  4OI3 A;  1D0E A;  3N0V A;  4ZCI A;  3DOM B;  2XG8 A;  1U6B A;  4A8F A;  1R8A A;  4A8Y A;  1YJT A;  1F9H A;  1IKY B;  2Y0B B;  5JVG Q;  1HHT P;  3I5C A;  1IKY A;  3MM8 A;  1S77 D;  1GXT A;  1XMQ J;  2ZM6 F;  2L08 A;  4ZPW R;  2HG4 A;  2FJW A;  2UVW A;  1FRI A;  4GRS A;  1X4D A;  1TVR B;  1VIX A;  1O0P A;  4DOZ A;  2AYM A;  2DNG A;  3PW7 A;  2ZNZ A;  1ULR A;  2IM1 A;  2MGZ A;  1U2C A;  2C3Y A;  4WKR A;  4B3M F;  1RI7 A;  4DQP A;  5D0R A;  5BXI A;  5K20 B;  4QIE A;  4PQU B;  1KWM A;  2X3D A;  2CG4 A;  3V6K A;  1BGX T;  2HQ3 A;  4NEZ A;  4FF3 A;  5KFW A;  3T5H A;  3BH7 B;  1S97 A;  5E5N A;  3TYT A;  1DBD A;  4RUA A;  5KFD A;  3QSY B;  1M90 T;  4OYM A;  2CQ2 A;  2ZH7 A;  5E41 A;  3HFZ B;  3Q83 A;  2O01 C;  4KC5 A;  1RHK B;  4ANC A;  2G2Z A;  4YB5 A;  2OLW A;  3J7Y U;  1DRZ A;  4IH5 A;  3NXZ A;  1WC4 A;  5F8J A;  2V67 A;  2IDE A;  5THW A;  4ED5 A;  1GH8 A;  4Y00 A;  2VFR A;  2PFF B;  1PJ6 A;  3CC2 S;  1IBL F;  5JJB A;  4MH8 A;  2DIS A;  3QLH B;  2HS0 A;  1JIH A;  3LQV A;  3MUM P;  3C3L A;  2GQQ A;  1DLO A;  2GVD B;  2Z2L A;  3SIP B;  3GG0 A;  4OX9 F;  2EKY A;  4CLZ A;  4DQS A;  1Q95 G;  2MB0 B;  3B78 A;  1FJE B;  1R43 A;  2GVD A;  2VU5 A;  3N28 A;  1OJ4 A;  1YJN S;  3EGW B;  3CJ4 A;  4LBH A;  2D3U A;  4W90 B;  1S0M A;  3QT6 A;  4B02 A;  2DRA A;  1Y10 A;  3UD3 P;  1RT4 B;  4ZN3 A;  2Z0G A;  2LEC A;  2J5A A;  2PI5 A;  4ZJQ A;  4Z2X A;  3NGK A;  3DMJ B;  4FXW A;  2PN6 A;  1K1Q A;  5SZT A;  4B3M J;  2W9B A;  1K9M T;  4LFC J;  5F9N A;  4J9O A;  1UW4 A;  2BE2 B;  2VG7 B;  2JDJ A;  4WZM A;  5EWE A;  2I6W A;  4IFY B;  2XGQ A;  3VCD A;  3AJ2 A;  1S4F A;  2AV5 A;  4DI6 A;  2BE2 A;  1NKC A;  2J0X A;  1FES A;  4IFY A;  2Y1I A;  1RBA A;  1R89 A;  3TJA A;  5L38 A;  3KWM A;  1OPI A;  4NLV A;  4YEA A;  4E98 A;  1M1H A;  5JMN A;  4LVO P;  2F9J A;  3TP2 A;  3PIP Q;  1VC5 A;  2LEA A;  1S1T A;  2QIF A;  4K4T A;  1P1L A;  2BXJ A;  1MN7 A;  1VLO A;  2BOP A;  5KFV A;  1VBZ A;  2AU0 A;  3FKB A;  1KLM B;  2O67 A;  1JXV A;  2FPH X;  3TZY A;  3LAK A;  3POT A;  4J9R A;  3PXG a;  3H5Y A;  1XMO J;  3TAP A;  4KGZ B;  4CNY A;  5D77 A;  1TEL A;  5E3A A;  1HWU A;  3HLU A;  5B0F A;  4CYU B;  4ZVE A;  1N5T A;  1VQ5 S;  3F44 A;  1S6Q B;  1UVI A;  1VDH A;  2QC3 A;  3R27 A;  1Q86 T;  3DXS X;  1WHV A;  2R7O A;  4CYU A;  3W9H A;  1UJ4 A;  3MOJ B;  4I67 A;  2VL1 A;  5B7W A;  3DU6 A;  1QJH A;  3QZ8 A;  3S1T A;  1ZAW A;  2KRR A;  1Q1K A;  5FDL B;  3B4D A;  4O4G A;  4OX9 J;  2J0Q D;  3X1L B;  4C48 A;  1IN0 A;  3NAH A;  2VBZ A;  2R7X A;  1HYS A;  4QPT A;  1JLE B;  3AHP A;  1BWE A;  3FJ2 A;  2KO1 A;  1JLE A;  2N7Y A;  1S7I A;  1M1K T;  3KNA A;  2POK A;  1HR0 J;  1U47 A;  3ZZU A;  3HSD A;  1HL6 A;  4AL7 A;  3TWZ A;  1SV5 B;  4A8K A;  2BQ3 A;  1R6V A;  4MMO A;  3P4U B;  3ZTP A;  4M95 A;  5KG1 A;  1U1N A;  1NPK A;  3MMB B;  3BPD A;  4H4M B;  2R7U A;  3OFF A;  3MMB A;  4CTA B;  4H4M A;  2MKC A;  1VQ7 S;  2VV5 A;  1TUV A;  3A4T A;  3D1O A;  3MDF A;  2E9R X;  1SIW B;  3NG8 A;  4OJ1 A;  1NDL A;  2ALZ A;  2NPI A;  3PVX A;  3C6U A;  3DRS B;  5GAH I;  4F4K A;  2GIQ A;  1KHW A;  1S5Z A;  3DRS A;  5KFT A; 
#chains in the Genus database with same CATH homology
 4PYA A;  2IDE A;  2IIH A;  2OHD A;  3JQM A;  2EEY A;  1EKR A;  3JQK A;  2EKN A;  1EKS A;  4PYD A;  3JQJ A;  4FDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...