1EKRA

Moac protein from e. coli
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
146
structure length
143
Chain Sequence
GEAHMVDVSAKAETVREARAEAFVTMRSETLAMIIDGRHHKGDVFATARIAGIQAAKRTWDLIPLCHPLMLSKVEVNLQAEPEHNRVRIETLCRLTGKTGVEMEALTAASVAALTIYDMCKAVQKDMVIGPVRLLAKSSGDFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords MOLYBDENUM COFACTOR BIOSYNTHESIS PROTEIN C
publication title Insights into molybdenum cofactor deficiency provided by the crystal structure of the molybdenum cofactor biosynthesis protein MoaC.
pubmed doi rcsb
source organism Escherichia coli
total genus 35
structure length 143
sequence length 146
ec nomenclature ec 4.6.1.17: Cyclic pyranopterin monophosphate synthase.
pdb deposition date 2000-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01967 MoaC MoaC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Molybdopterin cofactor biosynthesis C (MoaC) domain 1ekrA00
4PYAA 2IDEA 2EEYA 2OHDA 1EKSA 2EKNA 3JQKA 4FDFA 3JQJA 4PYDA 1EKRA 3JQMA 2IIHA
chains in the Genus database with same CATH superfamily
2VQFF 3ZO7A 5ETRA 1NH8A 2NPIA 1U8SA 1ZS6A 4USUA 4I2PB 3FDSA 2AJ0A 1X9MA 3K0JA 3C6TB 3MPUB 3QIPB 1F2GA 4I2QB 2WK4A 2WSFC 4IOAQ 4EBEA 4I7FB 4GVLA 3FQKA 3GJRB 1P9QC 2BABA 4PUOB 3MEKA 3W9HA 5I3UB 4R5PA 2JX2A 1HWKA 1URRA 4DSFA 2JVOA 3OR1A 4ZVRB 4JV1A 3OSNA 1KVJA 4LRAA 2A2CA 5D8HB 2YQ3A 4BHQA 1B7FA 4WTOB 2BKPA 4EGLA 1HI8A 2FPHX 3RR7A 3M8SA 1YJWS 2HLUA 4GKKJ 4DSJA 4FS1A 2XG8A 1PIEA 4DPYA 4ID5B 2D7SA 2GCFA 4DQRA 4XTTA 1VS3A 3TVYA 2IDLA 1SC4B 4ZDNA 2VG5B 2N3LA 3D68A 3PW2A 3OFGA 1HI0P 1CC8A 2ZH9A 5EX0A 2J0XA 2I1RA 1OS5A 2IM3A 2V2QA 3D1HA 1ZYQA 4O0NA 3LW5C 4C0BA 2XM3A 1B64A 1T9UA 3W62A 2N3OA 2DGTA 3CMES 2FIUA 1SKRA 3QWPA 3N0VA 5L8RC 5L1JA 3AXMA 2D3O1 2LXIA 2HHUA 1C0UB 1JKHB 3MECA 4RPFA 4WWSA 2QSFA 4R0EA 4J9QA 4X62F 3KK2A 3T5JA 1JLFA 2DNZA 3QAUA 3I87A 3HHLD 2GMHA 3KLGA 1FDAA 1ZPVA 2WVDA 4ZCKA 4LF4J 2IHR1 1RT4A 3JSMA 3BQ2A 4IO9Q 1SC6A 3IGNA 2MZTA 1SJQA 2CFXA 1NDLA 4N5SA 2DGSA 2GMJA 2V8DA 1LW0A 1SVDA 3UWTA 3GCXP 3CD7A 2AZ1A 3ILJA 3MTJA 2QA4G 1GX6A 1U2CA 4R5PB 2ZH6A 2WOMA 4OX9F 3OR1B 2QC3A 2UXDF 1YBTA 2CDRB 5M2RA 1UEVA 1S7IA 1WUUA 1JLGA 4AL6A 4YUDA 3KDOA 5CXTA 3T41A 3R5AA 4DV1J 2K7JA 3K7RA 3OVBA 4QR1A 2PA3A 5JVGQ 1NDPA 2BJ3A 2KXHA 1N33J 2DK2A 2EPIA 3PX4A 1VRTA 3BDEA 1AYEA 4FKXA 5A8RA 2E29A 3W8PA 1Q7LB 4F4XA 1S99A 5HBMB 2B9WA 3N6LA 4LF2A 1L3VA 2AD9A 2F65A 5KG1A 3OVAA 2MQMA 4FXDA 3NWRA 1R8CA 1RT1A 2GQCA 1IR2A 3PW7A 2XO7A 2HGNA 4FYYB 2OFHX 4TN2A 3MEEA 1NZ8A 3WC0A 3DDIA 1RT2A 4L74A 1XMBA 3ITHB 3KK2B 2CIMA 3N6MA 5LSLA 4MKAA 1JLFB 2HBYB 1Q8BA 2BOAA 4RW9A 5ETNA 3TVKA 1RKJA 1I51B 3G6ES 1XC9A 1WORA 3R6GB 1A0OB 1U2RA 4LF4F 5RUBA 4DZ6A 1RT4B 3UNYA 1TKDA 2ZBCA 3JSMB 2LCWA 2WAQD 1XJWB 4PRFA 3OXLA 1V3SA 4NRUA 4F36A 1XBWA 4RW6A 2KXNB 3DRSB 3SFGA 3DC2A 2OPSA 3TZXA 4KSEB 2MYFA 2NUHA 2RUSA 1NLKL 4E2FB 4DUYJ 2LFVA 1U8WA 3BJYA 1BHNA 3EGWB 3RYLA 1RU1A 2AGOA 4P9SA 3I9ZA 3UVJA 1M90T 1JLGB 1K8AT 3RW7A 3BO3A 4OLOA 3TO8A 5FD1A 2KJWA 1MWQA 2FC9A 3Q8SB 2IY5B 1HWJA 2IBOA 3QQCD 3BEGB 2CNOB 6FDRA 2AX0A 2RDDA 2EWHA 5HLFA 1M1HA 1CVJA 1K0VA 3S6EA 1VRTB 1N33F 1WG5A 2EFVA 2F4FA 1ZH5A 4DR7F 5A8RB 1F2HA 5KFWA 1FO1A 2Q6CA 5KFLA 3KNGA 5KFBA 3BH7B 3DMJB 4P2MA 1CJVB 2ASYA 2OFGX 2MKSA 2YH1A 2G1DA 3NS6A 1JXLA 2CZ9A 3DHXA 4MT1A 1IKVB 2RDJA 2LDIA 4YB5A 2QL7B 4TKTA 4KYZA 1RT1B 3H40A 4Q2MA 4ZP9A 4UW2A 4M8LA 3D6FB 1IM6A 2C3YA 4I67A 3PIPQ 4NL5A 2OTJS 2RKIA 1HMVA 1WKKA 2VQEF 3QWUA 4O0IA 5BYQA 1AROP 1LXNA 2FC8A 1H7WA 3BF4A 4DG1B 4RW9B 3HHLA 4GMKA 4QU7A 3LALA 3OTOJ 4KGVB 3Q8UA 4CIOA 3W3SA 2BDPA 4FYDA 2AJ4A 2F63A 2OPQA 4DR4J 2HBQB 3VVUA 2DXDA 3RJMB 2QO3A 1U6ZA 3J7A1 4UY8T 4QIWD 2PFDA 1N5SA 2G2ZA 5KFPA 2UVWA 1I3OB 2HNZA 2HPUA 4ATNA 1TKTB 2GVZA 4N56A 2Y1JA 3WBZA 4KFBA 3UVJB 2E1CA 1F0XA 1PBUA 1S48A 4NLYA 3NEKA 2OO4A 4Y34A 2OSRA 4DUZJ 3JSYA 4BC7A 3NGTA 1R0AA 1IWAA 4BWJA 4LF5F 4WKRA 1JLBB 4QW9A 2M5YA 2MQOA 1WSRA 4PG7A 2PE8A 1IKWA 4C2MA 1D9AA 1X31C 4H4OA 2Q6BA 1FWKA 2LP4A 3IGVA 3PHEA 5KFEA 4B9NA 2DTJA 3S1TA 4HI1A 4A4JA 4CO1A 2IRXA 3BH6B 4G1QA 3UCUP 4FBUA 4K4UA 3T1YJ 1GNKA 2RKIB 2MDAA 1HMVB 1FJ7A 5KFDA 4C11A 2DR7A 2QV6A 3GSDA 3RRGA 2OUGA 4ED0A 2I9SA 2I2YA 3ZTPA 1BQNA 2V6AA 3US5A 4FBTA 3KG4A 3MEDA 5KFRA 4E98A 2AYMA 2XCPA 4NE9C 2C2RA 3DRPB 1P1TA 2OPQB 2LQBA 2ILZA 1UAWA 2YWEA 2ASLA 1X8DA 1SKUB 2E9RX 2VA3A 1HLWA 3PYFA 3RAQA 3RB0A 3RBEA 2GMLA 4KO0A 1G3OA 1NSAA 1BXNA 2ZEJA 1KVIA 2HNZB 2HFNA 5G0RA 1DLOA 4ECYA 5HMYA 3NGRA 4CLPA 4EMDA 2KZZA 4NPOA 2IPOB 4KFBB 3I4PA 2E7WA 3F73A 3M8QA 4WPAA 3JSBA 3NMRA 1R0AB 2HQDA 3KMQA 4OYPA 1WC0A 4LT6A 1FKAF 4B3MF 3MMBA 3RB4A 3SEOA 2BE9B 1G1XA 2W1BA 3JYTA 4LUBA 5ETOA 1SKSA 4O44B 3C14A 1RGVA 3T1HJ 1KFSA 4ZOSA 4QZVB 3KYLA 1VQ9S 4H4OB 3VHQA 5DZ6A 1RP5A 2N7YA 2C3MA 3AQPA 4ECVA 2DH7A 3J7YI 1FCAA 3BV8A 2BKOA 2YH0A 2JSXA 1NJZA 3OR2B 1YVFA 5KFCA 4G1QB 5J2PA 1U7LA 3LOUA 3T1YF 2RT3A 2BZ2A 4WZQA 2V4JB 2B4OA 2F9JA 2FZKB 1T9TA 4NWBA 3MUMP 3SV3A 4JYAJ 1EKRA 4UUWA 2AZ3A 3RG6A 1L3KA 2IAJA 1EQ0A 3VAJA 2FLLA 1RAAB 2D41A 2CPEA 4TLQA 2JFKA 2W9AA 3MEDB 2XSJB 1TK8A 2JLFA 4GKJF 5AJ3J 3PZPA 4WP8A 1ULRA 3TR5A 4WIIA 5CAAA 3CMQA 2XMVA 2XMUA 3M9OB 3HJFA 2R8KA 1X0FA 3CDWA 4KO0B 1NPRA 5DLGA 2VBYA 3F44A 2N7CA 2B9YA 5G0RB 1B3TA 4DXLA 4YHHF 4C3LA 1KEKA 4IQMA 1S77D 3QGPA 2W8LA 3ZZPA 4WK3A 1UVLA 2JEGA 1Y5LB 4WP9A 3N5FA 4WKYA 2MSSA 3M8QB 4TVAB 1N0VC 1U1KA 1OMSA 1T95A 2KHDA 3F56A 4B3OA 2DB1A 4WU3A 2XNQA 1XMQJ 2R7RA 2G13A 1Q8KA 3UE2A 3MMBB 1UTAA 1IXKA 5AXLA 3JYTB 2VPWB 3D0GE 1RBLA 2F40A 4ZA1A 3C14B 1QM9A 3EICA 1HBNA 4G1PA 1RA6A 1AFJA 4OYZA 2NYIA 4JI6J 1T9YA 1RCOB 1TK5A 5DJBA 3OHBA 1N32J 2RNEA 4LBIA 3PVXA 3KK3B 2ALYB 1TL3A 1VBZA 1YRUA 3PM9A 3ENAA 1GFWB 4K0KJ 2YPZA 3M2VB 4PCQA 2VODA 3NL0A 1KVKA 5KG3A 2HRUA 2IAJB 2ZH8A 1S6UA 1JLQA 2DGVA 3PIOQ 1AUSL 4PABA 1SJFA 3UFCX 2RHSB 4TYBA 1C1BA 4V19J 3R8YA 5AJ3F 3K17A 4OYBA 3CJTA 2J9CA 2UXCF 5KT4A 1PG5B 4NZ7A 5J2MA 3CJ5A 3MM5B 4NA3A 2Y0BB 4Q2LA 1T11A 5C25A 4DSLA 1R89A 4M5HA 3R5DA 1AUDA 1VIOA 2WB4A 1RT5A 3R2DJ 4YN3B 4YY3J 5L9XA 1JNRB 3CDUA 2YQ1A 2KJVA 3MAQA 5IQQA 4ZPWR 3AOBA 2DD8S 1XMQF 3NWGA 4WTYA 1U4BA 3PACA 3CW2C 4ECUA 1G2EA 4O3RA 1SL1A 4H4KC 2ASJA 4B3TJ 2UVVA 4QWEA 4USIA 2B8PA 4OMFG 4PWWA 1UETA 2RF2A 1HBNB 3M8WA 5J1NA 3NGUA 1FE4A 3C2PA 2EI5A 2A3JA 2HYIB 3BR9A 3DLKA 4RUHA 2KG0A 3PXGa 2UU9J 4ZLJA 1FVSA 5K8PA 3ZZOA 2SXLA 4ZPVR 3LWLA 3MI7X 2ALZA 2YTCA 1S7HA 2B9XA 2FB0A 4QOTA 4PR6A 3AD8C 1TMMA 4FF1A 3HJVA 2VOOA 1YWXA 4K4YA 1WTFA 5HP1A 4B9SA 4OI0A 3PO5A 3LQVA 3KUEA 3QJLA 2NXJA 2YKQA 4K0KF 1F3FA 3P45B 3CIZA 1MROA 2ZHBA 4DL3A 2H4YB 3M8PA 4ALZA 1FRJA 2VONA 1JLQB 3M8ZA 4IG0B 2ZKUA 3EPIA 1LWFA 5BYSA 2A10A 1RB0A 4PAAA 4LF6J 3CJ4A 2RE1A 4NYPA 2Y8WA 2X7IA 4ITSA 4PQAA 5M2PA 1AZSA 1NEEA 2CPDA 4B3SJ 4O3SA 5J2MB 3R5GA 5C25B 2B6AA 5KAKA 5B0GA 1TUVA 4AE5A 2ZBQA 1S0NA 1KD1T 3LP2A 2CWKA 2APOA 2G0IA 3H5YA 2Y1LB 4UOGA 3EUNA 1Q4RA 1RT5B 1BC6A 5ETQA 2YNGA 3AQOA 4OHYA 3BBFA 2XGQA 1R43A 1VQLS 5IC6B 1CBKA 3D1OA 2M2BA 3DLLQ 1ZA1B 2L9NA 5KG2A 2HIQA 3AA9A 1NNDA 1HIYA 3SQGB 3BREA 3D1QA 1VBXA 1T9VA 2I5JB 1NHUA 4L6V3 2LU2A 2RF2B 2HWIA 2JZ5A 3RRHA 2XC9A 4LRCA 3KHGA 1TL5A 2DRBA 4A8FA 1TL1A 3IWLA 2BRLA 4K5RA 2XI2A 1VQ8S 1REVA 3PRDA 8AT1B 2RJZA 4G6VB 4AQYJ 1Q8IA 4ECQA 1HR0F 5THWA 5CCMA 3KJVA 4DR3J 5HP1B 1J27A 2IA0A 2CKWA 3HZEA 4F2SA 3AT1B 4F67A 1X4EA 3M8PB 3H2UB 2R2TA 3R9LA 1HW9A 5C5JA 1QD1A 1EQMA 1LWFB 4KGMA 3VAKA 4OJHA 5ADZA 1QTNB 3HP6A 3GFZA 1HWIA 2D3OR 2DNPA 4ED1A 1NK5A 2H5EA 4QYRA 3HVWA 3TZWA 1VI7A 4KV8A 1EETA 5C42A 3I0SB 2Y3YA 1HNXJ 2DNYA 1ZM3A 4Y2AA 4JI2J 3BSCA 4WP3A 4TQSA 4X4NA 2BUNA 2C2OB 1UVKA 1XEZA 3D67A 1DQAA 4NASA 1FFSB 3C15A 2YNGB 4OQJA 1QAJA 2XGPA 1VMBA 3HKWA 4MJKA 1Y11A 3V4MA 4DCJB 4X4PA 4LVOP 4M5JA 2IFXA 4X64F 4LBPA 1IKXA 3U27A 5LT5A 1HBOB 3M2UA 3EGVA 2H48B 1Z1ZA 4Q7AA 2D74B 1DZ5A 4UT4A 4KB7A 1YX2A 2J9DE 1KOOA 2V0NA 3UN5A 1REVB 5E3CA 1S6PB 2PMHA 3HCXA 5J1EA 3UW1A 5L46A 4MH8A 3WIVA 2E9ZA 5L1KA 3KJVB 2K1RB 2HZVA 4DR3F 2OMOA 4N47A 1NU4A 2IM2A 4U7UK 2ZOGA 5I3PA 1L3UA 1SIWB 1SH0A 1R6YA 3A12A 4HHUA 3DFEA 3BBCA 4Q0BA 2EC0A 5LSOA 3H59A 4ANDA 2CZVC 3DXSX 4TY9A 1KTVA 3VZIA 4JI3F 5CA5A 4XPCA 1I6JA 1UA0A 5B0FA 3KNAA 4KV8B 2DGQA 2R9LA 1P8GA 5DGAA 3EVWA 1GQEA 1QSYA 4HR2A 4DL2A 3DOKB 4F4ZA 4EO6A 2GS8A 3RU0A 2MKHA 2J6UA 3HT3A 1RWVB 3C15B 1S76D 1S59A 3H0PA 1U1NA 2XMMA 3RR8A 3KLVA 3DLBA 3GG0A 5KT6A 3ISNC 5HROA 1UZDA 1T3OA 1UEKA 4CI0B 4X84A 1IKXB 3QRPA 2RB7A 1X60A 4QYZJ 2O3DA 3TWZA 1A6LA 3GFXA 4TNOA 2XULA 4LSNA 4ICLB 1UJ6A 3FBCA 2C42A 1QUPA 1HPZB 1W2BR 1RAJA 5KG7A 3G82A 2FJVA 2CJQA 5LXYA 4LF8F 4F2RA 1SJ1A 5J2NA 2FVCA 3GSIA 5IT4A 4A8OA 2ZC3A 1XQIA 3I5BA 4JI7F 1N5TA 3M32B 1FTCA 3PY8A 3MAAA 4UQTA 3J81j 1NSKL 2OPRB 3UD3P 2HAFA 4Q0BB 3TX0A 3OW2R 2O67A 3FMBA 2LKZA 2B5JA 2UXBJ 1TUGB 4PG4A 3CXCR 1ZBTA 4O4GB 3D6TB 5C2CA 5H9FJ 4AL5A 2XHWA 5SUHA 2WB1D 1Q53A 2YKNB 3FFIB 4KHMA 1M1KT 2JC0A 2JLGA 3GB0A 1WHVA 2XLKA 3A1YG 3AHPA 5C24A 1HKAA 1HNWJ 4AXJA 3B82A 2LQJA 2DRDA 2UUWA 3RBZA 3TUJC 2QZ8A 5MAOA 2RAQA 5HROB 4YOEA 1HI1A 4PQUA 2CQDA 1DTTA 4B3RJ 1K1SA 3IR5B 1RAEB 2UUCJ 1WG1A 2FZCB 4KH0B 5GMDA 2CRLA 4LSNB 2HFUA 2YQ0A 2XLIA 4DUTA 4M1KA 1W7WA 3L7UA 4IFYA 2VG6B 2BM0A 5IV4A 2XHCA 3Q83A 3BKTA 4KT0C 1DBDA 2ZITA 4NLPA 5J2NB 5KFFA 2JEFA 1U1QA 1UW9A 2B4VA 4X4SA 4EYHB 1FRLA 2QLJB 3VVTA 1C0TA 1CS4A 2DJWA 1WDDA 2QA4S 1CSJA 4CH1A 4HLBA 4NA2A 4ES3A 3A3PB 3MAHA 1VQ6S 2CADA 2YNHA 4LREA 1IN0A 4WZMA 4Y2MA 1X9SA 4G1IA 1R8HA 2XWYA 1NDKA 2WRMA 4DX7A 2B5JB 1EZZB 3TZYA 1U6BA 2UXBF 1NRKA 2VV5A 2HWHA 5E3AA 3C6UA 4MK7A 4DV3J 1QSLA 2VG7A 2E5LF 3MR7A 4UZBA 1P27B 2CQ4A 1F5AA 4RWWA 2IYIA 1YJTA 4LBHA 2YX4A 4EBCA 3K57A 3KUGA 2GJFA 2UVRA 2VASA 2M9KA 5E3QA 1A9NB 1FDNA 2C3UA 1KFDA 5D0GA 1TZ0A 1U45A 1IR0A 1HNZJ 3LH2S 1UPMB 4IOBA 3X3UA 3GTYX 3E2EA 4KBIA 3SCKE 2DNMA 1WSVA 1HNWF 2EFOA 3UI3A 1GK8A 4RNMA 4A48A 3DOLA 4ZVQB 3PV8A 2WBRA 2DGXA 2V4QA 3ZTOA 4DR1F 3BPSP 2EKNA 4PQUB 2HW3A 1DTTB 4NXNF 2E1RA 4M5MA 4TU8A 5B0CA 2UP1A 1J5EJ 2MXYA 4KIAA 2IA6A 5F9NA 4NYOA 4IFYB 2ZUAA 2IC3A 1PYTA 1S1VA 4DL5A 2VPZB 1X5TA 3THVA 4A8KA 4X4QA 2V8VA 2IM0A 3N79A 5F8MA 1RXOB 5D3GA 3ULHA 3BGFA 3I82A 1WTBA 4I69A 1VQ5S 1F1BB 3MXHP 2FJXA 1JB0C 4PYAA 4DL4A 2H65B 1UVIA 3KJNB 1XR6A 1CS4B 4MKYA 3ILOA 3TRGA 1H7XA 3PRVA 1BLUA 2V94A 1TFYA 4MFBA 4ZCIA 5HVHA 4LRBA 3NRBA 3D3CJ 3I9V9 3HF5A 3DGPB 2A0FB 5HVFA 5DQIA 3BO2A 2R8GA 5J1PA 3KOAA 3QSIA 2KFNA 2CZ4A 1RBAA 2M70A 1WC6A 4EI2A 3ELHA 1GXLA 2HVIA 3QFWA 5EGYA 3I32A 4GC7A 4DV3F 2FTRA 2C2DA 1P6TA 1RWKB 5DDRC 2ADBA 4Q8FA 4QWBA 1FK9B 4OHWA 2QYGA 1JXEA 3S01A 1WEYA 4NLRA 1D0EA 4J9LA 2HRTA 1WELA 1LK5A 2YWGA 4RU9A 4ZVUB 4ZVHA 4BC9A 1RTIA 1FKPA 2CNKB 3RRKA 4F4YA 2DNKA 3LP0A 1R0BG 4OV1A 3CD0A 4LQ9A 1QAYA 2R7WA 5D6GA 3SDEA 4KR0B 3RUBL 4ZITA 3J81Y 1NAQA 2AT1B 1T03A 3DOLB 4YB1P 2HHVA 3ISZA 3LPEA 4UOHA 3IP0A 3OFEA 3MCNA 4KHPJ 3MD3A 1RT7A 3GQCA 4XIUA 1M5KC 1X4CA 1ACMB 4O3OA 1HHQA 2LMIA 2LEBA 1Q79A 3KMSA 4JI4F 1S1VB 2ZHAA 3T5KA 3AJDA 4CLTA 2D3UA 3MR5A 3UN2A 5IWAF 2VB6A 4KRWA 2CYYA 3GIRA 4PYDA 4O23A 4WFNQ 2HHSA 3MPDA 4NLSA 4EZ6A 1PYOB 4LFCF 5EWEA 1KTQA 5ETVA 3H7HB 1VC0A 1RWUA 4P52A 2Y1IA 2DNGA 8ATCB 3R7SB 3CF5Q 2CQBA 4NLXA 3BS9A 3DM2A 4WFYA 2DNQA 3V4IA 1CG2A 2KRRA 2G0JA 3R7BB 2GIQA 2NYHA 3IM8A 3HZGA 2XQCA 2R2SA 3DDKA 4LRDA 2MKYA 2GHWA 5D4NA 4J9PA 2OKQA 4ZN3A 1RUSA 1EX8A 2QYCA 4GRSA 2ASDA 3IA0A 4TYAA 2P2CB 4N8OA 3V2UC 2OPPA 2XMAA 4ED3A 3NCRA 1N36F 3R1HA 4XO0A 2DEJA 3DLEB 1NK7A 3ENWA 3CC4S 1FHTA 2MKCA 1VHFA 4OZNA 2XWXA 3SDEB 3D3BJ 1SJRA 2LEPA 1T03B 5IT9U 4A8YA 5E3PA 2HRYA 3ADAC 3IM9A 3I0RA 2FHJD 1RT7B 2FVRA 4USJC 3GIMA 4JI0J 2QLFB 1T05A 3CULA 1U1OA 2EBGA 5IXUA 4ED4A 3P8BB 3HVTB 3KHHA 5H1SV 1C1CA 1VHIA 4I1TA 1UJ4A 1U2FA 4PEOA 4CYUB 1CJKA 4HTJA 3KUHA 2P8IA 1PILA 2NS1B 2CUYA 1U0HA 3GP9A 1PCAA 1NK0A 3NMAA 3CE8A 4ZVPB 4Y65A 1SV5B 3B54A 4P10A 2PC6A 2CQ1A 2LQ8A 1RAFB 3V6DA 4C7QA 1GAOA 2EEYA 2C2MB 3W65A 3EGZA 1RHKB 4IYQA 2CQIA 2J7KA 1RYSA 1ROFA 3TA2A 2YNIA 2ROGA 4Y6IA 1Y3JA 2GHVC 4NCBA 3MR3A 4ELVA 2VA2A 2FJAB 4C8NA 4LSLA 2V50A 5KTQA 2J76E 2B4UA 2IIHA 3RBDA 3TVZA 4J9MA 3QO9A 5B0AA 2FJDB 2XY6A 1FXLA 4TY8A 4LFBJ 3A8KA 1W26A 3A8JA 4ILRA 1LFWA 1UVNA 5HQ8A 4ECXA 3GG1A 2P6SA 4JI8J 4CZCA 1KDNA 2KFZA 4ZPDA 3O2IA 1CQMA 2MZJA 1HHSA 4MIBA 3ENQA 2OGUA 1M5OC 1T05B 2HK3A 2AYBA 3KLFA 3ZFVA 2FJWA 1RACB 2VHGA 1RAOA 1YBUA 3VAIA 1LQ9A 4DCOB 3QZ8A 1C1CB 4J91A 3EWGA 5KFHA 3VGTA 4PWDB 4IFVA 3ET6A 1F9FA 3V6KA 4ECRA 5HANA 3DI6A 4ZN1A 3SYZA 2QEXS 4LFAF 1D8ZA 1TVRA 1I94J 3CJKB 2JWNA 3CJ2A 1S6QB 3HX9A 1WHWA 1SL2A 5HAOA 2A6OA 4P7VA 4C4WA 3Q8VA 2QN6B 2WHOA 2PT0A 7FD1A 2J5AA 3IG1B 4IG3A 4Y2CA 2YNIB 3W61A 2NQPA 2YNFA 1NK6A 4J37A 2V9WA 1IKYA 2QJ3A 3GR1A 4NXMF 3D28A 1HBMA 2Z2MA 2P9GA 3EPGA 1HL6A 4LSLB 4YS2A 2MQ8A 3DOMA 4W98A 1R7IA 4DV5J 4IR9A 3QO9B 1LEOA 3FK4A 4DOZA 2HVEA 3MTKA 4U95A 4TY8B 4U7CA 2Y1RI 1S79A 1V5IB 3BYRA 2DH9A 3CWJA 2IBKA 4OI3A 1O51A 5HMWA 3SFUA 1IUJA 1Y3KA 2ZWOA 1KRPA 1OPIA 2AJ1A 2ZJRQ 4JI8F 1VQOS 1IWGA 2HGMA 2YWHA 5F41A 4OI1A 2FHJA 4X65J 4OJ3A 4WU2A 3W9IA 1KLNA 1IJEB 4HHJA 1YGYA 4USHA 3OLAA 1HFEL 3KLFB 4I6AA 1X7VA 2W2PP 1RHRB 1C2PA 3AFGA 1PAUB 2AEFA 2ZBRA 4C8OA 2DY1A 3ETOA 1LK7A 2KM8C 2J8AA 5ETSA 4ZHRA 5B0EA 1U6FA 3DI6B 2XMKA 3H25A 3D6MB 2MZRA 3VAMA 1S1WA 4F25A 1HD1A 2DHGA 1I94F 2IVYA 5HL7Q 1CEZA 5LMNJ 2OEJA 4JI1J 3T19A 1OYEA 3U02A 4DFKA 4DV6J 1MG7A 2GQ2A 4DL0C 4MAKA 2NXUA 4O3QA 2MQLA 3M30B 3OL9A 4H4KA 2J0WA 4CQ1A 5DG8A 4P75A 4QIEA 4I2PA 4IG3B 2WW4A 4FNHA 2YNFB 1P9YA 2NR0A 4IOCQ 2UVUA 1IKYB 3QIPA 3FCVA 4Q45A 1JK9B 3B6BA 1IBKJ 1VLYA 5I4MA 1VC5A 2L08A 2RUGA 5K8MA 1D1UA 1MSWD 5JJBA 4I7FA 3FQLA 4AL7A 5DGBA 4PUOA 4QW8A 1QY7A 3G6YA 1NM2A 3FCWA 3EDRB 3KLIA 2V69A 4P73A 4OYAA 3FCHA 4CO3A 4B9TA 1T0TV 3R6LB 4NLVA 1VQKS 3VALA 4ANCA 2Z0GA 2ZZMA 3I31A 3TANA 2HSEB 4J5OA 3MZIA 3HULA 3W66A 5DDOC 1ICEB 2HFVA 1UPPA 3TJ8A 2KXFA 4D3GA 3PYGA 1U26A 1N5QA 4IDKB 2HHXA 1NK9A 4OIXA 3VGVA 4K4XA 4LSZB 4WYWA 4BS2A 4HT5A 2WTFA 4X65F 3DRYA 2CDQA 1WOSA 1DJ0A 3CCQS 3CD5A 5GAEI 1RTDB 4XPEA 1FDBA 1OIAA 1H73A 2JOQA 1SC1B 2Y9HA 2Q43A 2H1YA 4DL6A 3VAHA 3MOJB 3PR4A 4ZHRB 1SC3B 4ZVTB 3UCGA 2HHHJ 5L38A 1B7YB 3SCLE 4NRTA 2V63A 4MK9A 1X5OA 2Z2ZA 3ISND 5HSPA 4R25A 1WOPA 2VDHA 5LMNF 4MK8A 3GFHA 1FWPA 1Q95G 1CULA 3AOCA 3KKFA 2WVFA 1JNZB 1K47A 4DWIA 1HA1A 2ZM6J 2E1PA 2VBXA 4CTAB 3T6BA 1ELOA 2L48A 3PTWA 5AT1B 2XO6A 3GPAA 3HSGA 1RHUB 1RYRA 2HQCA 5GADI 2OD6A 2J0SD 4DBQA 3GIKA 3L7OA 2V2VA 2DCLA 3KLIB 1WHXA 2JLEA 3VTIA 3H5XA 1NJXA 4F4AA 3GIIA 4XK8C 5KFVA 2DO0A 4DQSA 1EHWA 2Z56B 2GO9A 1RTZA 2R8IA 2JDJA 2JHEA 4F3MA 3R27A 3K5MA 1P1LA 1G6BA 1Q8LA 1IBMF 2BEFA 4LF7F 2KT2A 2BACA 4ID8A 5SZTA 5KFSA 2QA1A 2EC2A 4J90A 3GZ7A 2KVQE 5HBMA 4CLWA 4QR0A 5GMEA 2LECA 2CQCA 2GA7A 3MFIA 2R2RA 1DQ8A 2MEWA 4PWUA 1FJGF 1FD2A 1O6XA 5LXRA 4FPRA 1MMNA 3PR5B 3C16B 3OL6A 2YKAA 5U47A 2QL9B 1D09B 3ITHA 2DH8A 3QJJA 1CULB 3EYZA 3L4BC 2R7QA 1KOHA 2VDIA 2PFFB 5DM6Q 5K14A 2R8HA 2RH3A 2YPYA 4QWAA 1RWWB 4QR2A 2ZM6F 2CQ3A 3IFEA 1J5OA 1KHWA 1NDCA 3EJMA 4ETZA 1KC8T 4KPYA 1FRHA 1RT3B 2EK6A 3DRXA 3DRSA 4CH0S 3D0IE 5CYMA 1FERA 5B0DA 1U0SA 4X4RA 4OI4A 2R7UA 2KT3A 5EX3A 4RU2A 3S8SA 3M7VA 4JV2A 1IR1A 4JBCA 1DRZA 2LEAA 4DV2J 2BKNA 2OEKA 2CNNB 2VU5A 3VQTA 1R31A 1AXQA 4L3NA 3UDEA 3M05A 1U09A 1RWPB 5D78A 4GKKF 1S72S 1TL7B 2BOPA 1UEUA 4ZLLA 3BGOP 4K4TA 4BBYA 4PG8A 3HHEA 1T7PA 4O4RA 3I6PA 1UZHA 1NCLA 3PYDA 1FFGB 1XIQA 2FY8A 2RRAA 2P5VA 1NJWA 3EZ5A 3DMJA 1CJVA 3L95X 3S7RA 2ILYA 3QGHA 5H9EJ 4NMLA 2MZ1A 4LMZA 2XMJA 1IKVA 1PBAA 3MMJA 2QLXA 1HHTP 2E1MC 3BGRB 5ETLA 1EKSA 1FX4A 2RQ4A 2IRUA 4K50A 2E7VA 2W7AA 1FDDA 3QT7A 3PFEA 5F0UA 3CTRA 1S0MA 3V81B 3TX8A 3G4SS 1REGX 5ETTA 2KYZA 4HYKA 4DG1A 1RLCL 1WNEA 2Z2YB 5K14B 1QAIA 1X4DA 2IYGA 1W25A 2CJ9A 4QPXA 1NKBA 3MM9A 4PKDB 1J5OB 2K2PA 2WVEA 3W7BA 1QAXA 3HFVA 4DV7J 2M8HA 2DR5A 1H98A 1NMEB 3N9UC 2KT5A 5CYMB 3E3XA 3OVSA 5A6PA 4P7TA 5K8OA 4RWXA 4KPCA 2G1HA 2LXUA 3SZ2A 1N54B 2MB0B 3LGHA 2NXEA 4PPZA 1TKTA 3PEJA 2BYCA 1U49A 4CM0A 2UV8A 1T9XA 3LF0A 4FYVB 3MMAA 2E5IA 3MGJA 4QU6A 2Z8QA 3NCPA 3QZ7A 4UTGA 1VK3A 3UNGC 1RAGB 4DV1F 3G6XA 3OTDA 2DR6A 2CPXA 1MN9A 3M1VB 2QTWA 1YZ6A 4DPXA 1JLBA 4ZLNA 1MW7A 3THPA 2RRBA 4QWCA 5KFNA 4NLDA 1S6OA 3QGGA 1HW8A 1YDLA 4LQ3A 2HS0A 1LFPA 3Q8QB 1BMQB 3OJUA 2HZAA 3R5JB 2KO1A 3J7YU 3GYNA 3BGLA 3FNNA 3AJ1A 4CNZA 5AXNA 1JMTA 1X4BA 3GJQB 4EU0A 1EARA 1GTEA 1UWBA 4DN9A 3LAMA 2R3VA 3WQPA 4QCLA 2VKRA 5F3ZA 1WI6A 3NGDA 1HQUA 3HDSA 5KFAA 3G8TA 1NKCA 2RSQA 1DY3A 3J80Y 4F0MA 1M5SA 4C8MA 2GO8A 3CDBA 3VV2B 5KFJA 3MM9B 5LL6d 1S9GA 1UCNA 3CD6S 1NPPA 1JWWA 4H54A 3DRPA 2G9OA 4P6QA 4DR2J 3GFYA 1JJ2R 5B7WA 4RUCA 2H3EB 2LA4A 1XNQJ 4LVNP 3PO4A 1URNA 4DUYF 4N41A 4B02A 5CD4H 4YB7A 1N0UA 3IMQJ 1SBRA 4OHVA 4JV5J 3GIJA 4U7UD 3MMAB 3POTA 5FDLB 1WI8A 3K8WA 3G87A 3F41A 1S0VA 2VKZG 5T7LA 3OL7A 5JXSA 1EP4A 5I42B 5F8GA 2DPJA 4HEA9 4DFJA 4TLRA 2XCAA 2V9KA 3QYYA 3DLHA 5ETMA 4ZPBA 3V6JA 4O44A 2M4MA 3IAM9 3TYTA 2CXEA 2ZOFA 2VFUA 1CQNA 1IQZA 1PKUA 2VBWA 3TQEA 4YMEA 2DNLA 2R7SA 2HG4A 1S1XA 2KYXA 3P3DA 4YEAA 1MMLA 4DI6A 4LR7A 3OR2A 3TJAA 4JI5J 3OSPA 2W4PA 5JVHQ 3ZZ0A 3HFKA 2V4JA 3GYGA 5E33A 4ED8A 1BWEA 1UWBB 4PXCA 3H90A 4LIRA 2KKHA 1HQUB 3TNVA 4OHXA 2FD2A 3MR2A 4I4BA 2GVDA 1LOUA 3JSRA 3O6QA 3OTOF 2HAIA 2XSJA 1TV6B 1S9GB 4KQZA 1N34J 2HEKA 4DQPA 2NSCA 5KFUA 1L3TA 1GMWD 1KBRA 3ILLA 2DRAA 4DR4F 2M8DB 3OTEA 3HMJG 4KC5A 4CLSA 2FYXA 2MGZA 1XNQF 3NY0A 2F9DA 2XEXA 4WYLA 3AY0A 4NLQA 4ECZA 1QUVA 1EIYB 2EG1A 3POTB 3VQSA 1SUQB 4DUZF 4BWMA 3R2CJ 3GONA 5T7LB 1AT1B 1EP4B 1RAHB 4M95A 3X1LB 4HKQA 1CJUB 1FNOA 1XN9A 3G6VA 5A8KB 1G7CB 2EG2A 2XI3A 5F8LA 1ZZNA 3OXFA 3CO9A 2EK1A 1Q7YT 1WC1A 3M6WA 1IVZA 1S5ZA 1S1XB 4CWBA 3NNHA 2VC1A 2B56A 2ATLA 4YQWA 4X2BA 1X9WA 1SKWA 2QSWA 2M52A 4DZDA 1K44A 2K06A 2VBZA 3TQ1A 3KK3A 4JI5F 3FVYA 3TAQA 1UVMA 2LVWA 1FX2A 3H98A 2ZDPA 5KT2A 2ZBPA 5A76A 3K58A 1U47A 2W25A 1MWYA 4WJBA 4KGZB 3M2VA 1UA1A 2GVDB 4H4MA 4F8RA 4A46A 3IO1A 2RVJA 3G86A 1N34F 2CPJA 2M0GB 2ZH4A 2MJNA 1R6VA 2A1BA 2GZOA 2DGUA 3ZZTA 5KT3A 1Y10A 1UWAA 3KDNA 2MGZB 1U1MA 4F0HA 1TMJA 3MM5A 3C3LA 3Q89A 1CJTA 2AHOB 4CRJA 2FHMA 2F8HA 3QT6A 1QTMA 2E5JA 4ZCMA 2CWXA 2DY9A 3CIMA 4QIVA 5HI7A 1ZA2B 4USWA 4DX6A 3CJ0A 2XZTB 3CMAS 2VFSA 2VICA 1VK8A 3WC2A 4OX7A 2DO4A 2KVIA 4P72A 4X66J 4NA1A 2V8PA 3N28A 2FGCA 1OY6A 2DISA 4DX8H 3W5ZA 3T6JA 3CCJS 4FF4A 4NCGA 3UDVA 2OAUA 2NSBA 4AT1B 3T1HF 4C6AA 4WFBQ 2G2OA 1NK4A 3UCZP 2CQHA 3IWXA 1NSQA 2R42A 5LJ3Y 4J7CA 2HVZA 1OQ6A 2MLZA 2BXJA 2J7WA 3SI8A 2AGPA 3W64A 1TTHB 4OJ1A 1HNVB 3NOGA 3CNQP 2PN6A 2QX0A 2X1BA 4RBUA 2JH3A 4JYAF 1KWMA 2UZAA 2GFFA 3VGSA 3LPYA 4H4MB 4IG0A 3CCES 1FT8A 3QT8A 3PW4A 2RHQB 4DSEA 1XK8A 4C0OC 2V5HG 1HARA 4YFUA 1DURA 2KI2A 2RQMA 4X4OA 1WD6A 4YDDB 2QRRA 4IH7A 1GMWA 2RS8A 2HNYA 5KFIA 2HWTA 2XY5A 3A8IA 3M8RA 2CAJA 4ZIWA 1CJTB 2Z4PA 1BQXA 3FZ2A 2IMWP 2ZFHA 2DT9A 2C3PA 3T5HA 1NXIA 3OJSA 5DQGA 1SH2A 2ZH2A 3DN9A 1LWXA 4ECSA 2XY7A 1TKZA 3UQSA 3KXDA 4X66F 3MCMA 1R8AA 3W2VA 4N8NA 4P2SA 2N4DA 3DNCA 3E01B 3K5NA 3SQGA 1NB7A 2COLA 2IDEA 1LKZA 1GX5A 3HSJA 4KJIA 4U6PA 4X62J 2I5JA 3I56S 2MHNA 4NCGB 3QIDA 2MTLA 4GO7X 3WZ0A 2W2OP 1LV5A 2BJ1A 2WVCA 3UD5A 4ES1A 3QFHA 2X1AA 4CO4A 3C19A 4KKOA 4JI6F 1XMOJ 2FHOB 2HMIB 1N32F 1CPZA 1N88A 5KG6A 2HHPA 2J9EA 4ZVEA 2X3DA 4OJGA 2ZH7A 4UOFA 3P6YC 3SV4A 3NXZA 2HQIA 5DG9A 1R8BA 4DLEA 3A3OB 4OX9J 1S1TB 2PEBA 4RNFA 2UXDJ 3Q8YA 2YY3A 1DARA 4RW7A 4WXWA 2JC1A 1PO6A 2A18A 4WK1A 4ZKAA 1O8BA 1SQFA 4AXIA 4W4MA 2YWKA 2VZ9A 3QATA 1ZTWA 4ZPCA 5DETA 3P4UB 4ZJOA 4F04B 1WF0A 1Q5VA 1RTJB 2BJDA 4R0JA 5I3QA 4P2FA 1QE1B 3I0SA 1OSCA 2HNYB 2R7VA 3PYEA 1JJCB 3O3LA 4K4SA 3JTPA 1T8EA 2B43A 5A8WB 4FF3A 4OV6A 4TXSA 1ZAWA 1YJRA 2FLNA 3NLCA 5DO2A 2D9PA 3BYPA 2FVSA 3ILIA 4LRFA 2R8JA 2GW8A 4J9OA 4V19X 4WIQA 1DAXA 3TUZC 3UPFA 1KNZA 4RLEA 2NXCA 4DS5A 1EAYC 3NNAA 2ZD1A 2ZVIA 4YY3F 1AA1B 1TKZB 2DXFA 1KN6A 2GQQA 4EZ9A 1F5CA 3W2VB 4E0DA 3DDNA 3FSYA 5DM7Q 1FFWB 2ACYA 3D4JA 2X51A 3RGIA 1EJ7L 5D4OA 4OZ1A 4RNNA 5ETPA 2QMXA 2ROEA 1WC5A 1RABB 1E6YB 3BN7A 3CCWA 4B3TF 3P49B 2HHTA 3THTA 2VFTA 3ZTSA 1HBOA 1FEEA 4DEZA 3W2WA 2HVHA 2JRSA 2W7OA 2JEIA 1UFWA 4ZP6A 2K7KA 3R5BA 3L7PA 2UU9F 4KAIA 5E5NA 3MM7A 4KKOB 4Y0FA 1S6PA 1XMOF 2H4WB 1RWXB 2PMZD 4OYWA 3MOZA 1YTYA 1X4HA 2K1RA 5GAGI 1TAQA 4O3NA 2W4CA 5KFGA 4ELUA 2RIJA 3AOAA 3TUPA 2H54B 2YKPA 3QNWB 4MIWA 4OZLA 3KWMA 3T9ZA 1WC4A 4ZLPA 4RW7B 3KJFB 4NZ6A 1D9FA 5IOLA 3H2VE 2P6TA 1S9FA 2YBVA 3EZUA 3U1LA 1JJHA 4LF9J 1E6VA 4LF6F 3HVRA 2JEJA 3K8VA 2MMYA 3M2RA 5KFTA 3I5AA 1FA0A 1FRXA 4OI2A 1X4AA 4B3SF 2DR9A 4DR7J 2I8EA 3R97A 4NX9A 1YI2S 2ATCB 2X3GA 3QGIA 3DOKA 4NCAA 2OD4A 3OTBA 5HMXA 2J8SA 3AXKA 4QYZK 3SCJE 3M4XA 3IBWA 4M5LA 4M5DA 1DTQA 4OYOA 1SXLA 1Q78A 2J7UA 2ZD1B 3BSAA 3O5TB 3H8YA 5F9LA 1BE4A 2MSTA 5CHCB 4WBFA 2CJKA 2HFSA 1D9DA 3MR6A 2B7CB 2LU1A 1RJJA 3CCZA 4FXVA 3UN3A 3MECB 4DPTA 5GAHI 4ED6A 5CABA 3IS9A 1VJQA 2VQEJ 5CH7B 3A13A 2ZBIA 5IFMA 2MKJA 2DCUB 4ICLA 1RISA 1LXJA 2D3ZA 5DS7A 3SSQA 3W2WB 3KLGB 1HPZA 3ICLA 2XS2A 4I0WA 3FSIA 4L72B 4YP3A 2AIRB 3MM7B 3U1MA 1ZAVA 2VH7A 1CLFA 1U1RA 5F8HA 2ZWPA 4MKVA 4CO0A 4AQYF 2VFVA 3OT9A 4ZVSB 3M32A 1LW0B 3ZZRA 3LTOA 5H9FK 2BV3A 2WOMB 4MKBA 5A2QU 2DNHA 1HD0A 1IM4A 2OPRA 5D0RA 2YX1A 2O01C 1FEHA 1WACA 3JQJA 2XNRA 1APSA 2BW2A 5KG0A 3TUIC 1E6VB 4LF9F 1YRXA 1RHQB 3ENVA 2FJBB 3IAS9 5FIIA 2B8QA 4O4GA 3M2RB 2M3DA 3T1AA 2KM8B 5A0YA 2F8EX 2NREA 2YWFA 4LF5J 3TP2A 2G4BA 1HNXF 2AGQA 2AQ4A 2YKNA 3FFIA 2GAHC 1YZ7A 2WONA 9RUBA 1OQ3A 4HDHA 3TA0A 2I38A 4JI2F 1HWUA 1Y4ZB 5E2QA 3MWBA 2MY8A 4M5DB 1UVJA 1DTQB 2PEHA 2NZCA 5F3TA 1X4FA 1J2VA 4RW8A 4QJVA 4DHVA 1PAEX 4KTQA 3SIPB 3UDLA 1XNRJ 3MEEB 4NEYA 2OLWA 3T9NA 1YIJS 1U1LA 3QT5A 2WSCC 2I6WA 1RT2B 3IS9B 2B3TB 2FLPA 3AB4B 4OYMA 1RBOB 4U8VA 4CT8A 3AJ2A 4ZJQA 3I55S 3CCVS 3PJ9A 2P9CA 4ZCLA 2HBZB 4RL1A 4C0HA 4IRDA 2VG6A 1UP1A 4FVCA 1HYSA 5CZXA 4ZVGA 4K7QA 5DDPC 5AXMA 3NBPA 3CJRA 2DNRA 3MURP 3CT9A 3GV7B 3D5MA 2CPZA 2V8HA 1QLNA 3MM8A 4RW6B 2VF3A 2CVEA 1FJEB 2OPSB 5L1LA 4FF2A 3QJPA 4ZP7A 2PIIA 3WX4A 3UDCA 1T94A 3N01A 2XTJP 4EYIB 2XYPB 4WE1A 1GT8A 2CPFA 2KH9A 3CCUS 3B78A 3SQOP 4CLFA 4CT9A 3OV7A 2R7OA 3BDPA 4X4UA 1WOOA 5K5MA 1H72C 1TQLA 2QT7A 2HBRB 3UR3C 3FBBA 2BANA 2QA2A 4F50A 4JB8B 1NH7A 3MD1A 4NEZA 3HM9A 3KHRA 1PYSB 2ZH1A 3IR6B 2VPXB 2MQNA 1RWNB 4AFFA 2W2QP 3TA1A 1IQTA 5D15A 1RKIA 1NJYA 3O44A 5E3RA 5HLFB 3NOCA 2HFOA 2RMLA 4RUBA 5A0YB 5KFOA 4A8SA 4B3MJ 4Z7YA 3Q8PB 2OEMA 1Y5IB 1H3DA 4ES2A 5FJ4A 1N5VA 4X4TA 2WONB 2ERRA 2ADCA 5KG5A 3MHYA 1FESA 2FVPA 2HVDA 2NZ4A 4HL9A 3V5RA 1BD6A 5HMZA 2IVFB 1ZTTA 2LYVA 1RT6A 3D9BA 2WVBA 4RW8B 1GH8A 4KGKA 5KFXA 4V1Ak 2OHDA 3TAPA 1XNRF 2EKYA 3BZQA 3GYXB 3O8WA 1A7GE 3FKBA 2M88A 2ZDOA 2R7XA 4DQQA 1O0PA 1RADB 8RUCA 1UMJA 3JB9k 1Q5YA 5DDQC 3TI0A 3MFHA 2ZNZA 3HHLB 1F9EB 1H2UX 1HYSB 3BB5A 4TQRA 3NBPB 2PD1A 1TELA 3DRRA 2QIFA 4GKJJ 2GGPA 3KJQB 3G2XA 6FD1A 4A8MP 3MM8B 4EWTA 2C2KB 3DGVA 3ONQA 1L5UA 1T9WA 4DPUA 2MHEA 4HH1A 1GXTA 1SJ3P 3ZXWA 5JMNA 4WE1B 4YHHJ 3SXLA 2VIHA 1SIZA 1X5SA 2QL5B 2VL1A 3LWMA 2GVZB 9ATCB 1N52B 2EBEA 2AJ2A 2BANB 1U1PA 3M6XA 3DGPA 5D0HA 3AA8A 4HH0A 1JLCA 3ZTQA 4ERDA 3LUYA 2MKIA 5GMKa 2UUAJ 4OX6A 3P5TL 3CC2S 4CO5A 4DFPA 2ZJPQ 3FRZA 1S97A 2UV8G 1JX4A 2FDNA 1RU2A 3GCWP 1FK9A 4P2XA 1RWMB 4KE5A 2CJXB 3UD4P 2HQ3A 2KG1A 5KOXA 3DXBA 1YJ7A 2AX1A 1YJUA 1IKWB 4FN5A 3CCSS 4K2JA 1XERA 1KR4A 5HK4A 2MZQA 2PDAA 4NLGA 4HDGA 1RT6B 3HO1A 2Y0SD 1NZAA 3P5BP 2EFGA 3G8SA 2MPUA 4M5GA 1YJNS 1T02A 3GU0A 2Z30B 5IT0A 4LF1A 4B3RF 3W63A 1SQEA 5HO4A 2VD3A 4C11B 2BQ3A 2UUCF 2HHQA 3BKFA 1HQEA 1FJCA 1M5HA 4J9VA 5KFMA 3FEYB 3J7Z5 1BQNB 4YR0A 3DRRB 2Q66A 4C3KA 2GGPB 3GWCA 4CLYA 2MLXA 3AD9C 1FNXH 3DLGA 4J9UE 4O3PA 2UXCJ 3Q24A 2VOPA 4RNOA 3CCMS 5KT5A 4M5NA 1RK8A 1DLOB 2E1AA 1V9OA 1JIHA 4DMZA 1Q82T 3D54A 5HN0A 4JOUA 4XDCA 3B4DA 3Q0AA 2E66A 1JLCB 4USTA 3M9NB 2UUAF 3MUTP 3GILA 4FZVA 1TU0B 1Y9OA 4UOCA 1KQSR 2G0CA 5MLCV 3W60A 3GV8B 1SCJB 3PRBA 2ZHOA 1I1GA 4K4WA 4Y2IA 1FTRA 2Q1LA 3D0HE 3CDAA 3HHNB 2GIFA 1NKEA 3DLEA 4L73A 3FUYA 1HNZF 4CDIA 3R5CA 3JTNA 2CPHA 2DGOA 4KY3A 4UUXA 3HKZD 5J2PB 3PG9A 3A3NB 3GJTB 4B9UA 1X5PA 3I4HX 2W24A 2XBPA 3OPKA 3EVMA 1VQPS 4FPIA 3Q2TC 3UR0A 1J5EF 2NCKL 1HQEB 1SPBP 1JJ4A 3HVTA 3RBXA 2HKEA 1VQMS 3SBMA 5IV3A 1AFIA 2LQ9A 3LANA 2QE5A 1OPZA 4ZIVA 3ZZYA 4CYUA 2HNDA 2QMWA 3DLGB 3BQ0A 1KSPA 2DEIA 3HHKA 4I6YA 3MDFA 3W5YA 2GJ2A 4R8UA 4QPTA 1SV5A 5K9FA 2CNLB 2EVZA 2BVZA 4K59A 1GTHA 4QIGA 3PW0A 5KFKA 4N76A 4NLOA 2W9CA 4J9RA 4DPOA 3ZZZA 3M9MB 2YX7A 5A2QY 4ECTA 2AEMA 5HATA 1VBYA 2MKKA 1NJIT 3PX0A 4RR5A 3LA0A 1XWLA 2DBBA 2AMCB 5D0EA 3SMZA 4DFMA 1S49A 5D77A 2BM1A 4B3OB 2JL9A 2AW0A 3AODA 2PO4A 2A6MA 2AYGA 2HGLA 3MMCA 3CEDA 2E5GA 1RTHA 3W5XA 4TU9A 2B51A 3HD1A 4Z7CA 3AAWB 3VWSA 4GC6A 3GMGA 2QMUB 2BE7D 4URGA 2R7TA 1V3RA 2X1FA 1MMDA 5IC4B 1C4AA 2AYEA 4PG5A 4MYUA 2C22A 3CJQA 1KS2A 3EX7B 5LJ5Y 1YLXA 1SB6A 4TU7A 4N7TA 1Q81T 2RQCA 1NBEB 5GVQA 2XB2D 4IH6A 2H9ZA 1WHYA 3Q22A 3TJ9A 1HR0J 3BQ1A 1TL3B 5T14A 4KHPF 3D6HB 3K59A 1H2TZ 3H4DA 2FQQB 1Z2LA 2AWZA 3GV5B 2A2DA 5CYQA 2L9DA 4ENOA 3A4TA 4EO8A 1UFLA 1FXDA 4Q5VA 2OELA 4DU7A 1DHMA 3FZBA 5LM7E 3E8OA 4Y2KA 3Q86A 4PWDA 1C1BB 1VBKA 1WC3A 2HNDB 2RS2A 3K89A 2HK2A 4DN0A 1BGXT 1M1GA 3IBFB 4I68A 1KHVA 3CJKA 7AT1B 1YJ9S 1U24A 3AH6A 2ZZTA 1WWHA 1S6QA 4R8UB 3W9JA 2AF6A 1KONA 4B17A 5F8IA 3QSYB 1YSJA 2BRKA 2HQGA 2W9CB 4Y3CA 4LJMA 4M5IA 3CC7S 2KU7A 3VF0B 3IG1A 2FY1A 1NB2A 1YK9A 1GMUA 1VQ4S 5BYRA 4UZCA 1MNEA 1KQKA 2HS4A 5CD4A 2CJBA 5BXIA 5ETKA 4RNHA 1UL3A 3CPWR 2EXUA 4RBVA 3MMCB 3EZOA 2C2EA 4X64J 1RTHB 4DF8A 4DU8A 2FHKA 2EW9A 3MUVP 2C2NA 2YVSA 1FD8A 2D1CA 4A8QA 3EGNA 3DLKB 1XR5A 5HJXA 3TAMA 1N8RT 2RU3A 2PMWA 3OFHA 5BJRA 1PC5A 3AB2B 2DPIA 4MIAA 3H2LA 4OZJA 2AEJA 4OZ2A 2MQQA 2E5HA 2U2FA 4FKYA 4JV0A 3JQKA 2K3KA 4WFXA 3C8YA 2C28A 3ZNJ1 2OH2A 3PDNA 4NLTA 4JI0F 4NZ0A 1F9HA 1C4CA 1MROB 4N77A 2MY7A 5CYQB 1Y5NB 2POKA 3IBCB 3KLHA 3TEHB 5GAEU 2QG9B 2CVIA 1KLMA 2BW7A 3H5UA 5L9NA 3DHWC 4JI3J 1WEXA 4CLLA 2EFQA 2L3MA 3P96A 4F02A 1JLAA 4ER8A 3HFZB 3EVOA 1AZSB 1H0HB 3M6VA 3WHIA 1XR7A 1RI7A 1WG4A 4XAKA 2B6AB 5KT7A 3FC9A 2CJAA 2WCXA 3M30A 1Y7PA 3NCQA 2RU9A 3LP2B 4A47A 3WIUA 4L76A 3J81U 4EBDA 3VR1A 2F8MA 1B70B 2IJRA 2J9DA 3CVKA 4IH5A 1RLDA 3M8YA 5GADU 3W1YC 1W2IA 1OYDA 3OQ2A 2JNJA 1HWLA 4QIFA 4FVMA 5D4LA 2D69A 1DFDA 1MU2A 1F5BA 1VRQC 4BLGA 4LFBF 3NGSA 2CJYB 4DS4A 4C8YA 2IJFA 2IVMA 3TAMB 3CJ3A 5J2QA 4ZPAA 2DHAA 4LF8J 1TL1B 1LW2A 1U02A 3G9CA 4NMXA 2XS7A 2MLYA 4LR9A 3B4MA 4ILLA 4IDKA 3BR8A 4JI7J 2N4CA 4UQGA 1LWCA 1KQGB 2V68A 4Q44A 4KGXB 1BUXA 3CUNA 3KG1A 5IZHA 2BBEA 2H5IB 3KLHB 3BGUA 2NXNA 3I96A 1RTDA 3R3TA 1WF1A 2F1FA 5IS2A 2MJUA 2KZMA 1KLMB 3VGUA 4Y00A 2PI5A 2JVRA 5EDWA 4CO2A 2LDYA 3GE9A 4U9RA 1D3WA 1RDRA 5LOQA 3EMTA 1JLAB 3K2YA 3G71S 3BSOA 3VAFA 1EETB 5C42B 2BX6A 2X1GA 4FP9A 5DG7A 4X4VA 2C2ZB 3ZZUA 4LIWA 3NS7B 3V6HA 4W92B 1FRMA 2V34A 4ANEA 3CDEA 3PCOB 2ZH5A 4MYTA 1WF2A 4CTAA 3BSNA 2KN4A 1H2VZ 3OD2A 4ILMA 4IQXA 1BWVA 2VUGA 1YBAA 1GXUA 3IWNC 4RBTA 4ETXA 4C3MA 2H51B 4IRCA 2O66A 2V67A 1NPKA 5F8NA 4OZ3A 1N5YA 3D66A 4CLKA 3MPVA 4DV5F 4C48A 4HT7A 5FLXU 4DCPB 1MU2B 3T3FA 4OZ0A 1VC6A 3J7AN 2LXFA 3M2UB 1B0PA 5E7OB 1GEHA 2VPYB 4DDFA 2NPFA 3CCTA 5J2QB 3H20A 4DQIA 2QFJA 2Z58B 4A8WA 1LW2B 2K3IA 4JP8A 3MCSA 3WX8A 4UF4A 4YB6A 2RRNA 5J1EB 2AKWB 3CJ8A 3RAXA 4OI6A 3RTVA 2IRYA 2WSEC 2FZGB 3B8HA 3JXOA 1LWEA 2WBMA 1V5VA 1LWCB 3JQMA 2KRBA 2O5DA 4ED5A 2VC0A 1Y00A 1QVGR 1YJVA 4L75A 1KQFB 2GIRA 2VJVA 5KFYA 2QLBB 1PJ7A 1OY9A 3BKUA 2B4PA 4URSA 3C16A 2HURA 5EUHA 4IKAA 1TR0A 5D4PA 2PSZA 2HFZA 2E5LJ 3PX6A 2BQRA 2GHPA 3TEGA 3QRRA 1S9EA 4JI1F 4AUKA 3PFOA 4DV6F 5EWFA 3FJ2A 3IR7B 2YWWA 2OIHA 3H5SA 1RQ0A 4CP5A 3OHAA 4GO5X 1F6TA 2W01A 1QSSA 4F0KA 2Y8YA 2LA6A 2AU0A 4RX6A 3WDOA 1H6KX 2XSFA 4CM2A 3IXQA 1M0SA 1RT3A 5HJYA 1MLAA 1IBKF 4BCAA 4DF4A 3ZTRA 2Z57B 1VISA 1N5YB 2ZKTA 4DR1J 4B08A 3MCOA 2WZ1A 4NXNJ 1H38A 5AXKA 3HHLC 1LNQA 3GLJA 4CLZA 1FRKA 4OYXA 2IMOA 2BJ8A 3JAMU 1WEZA 3OUYA 5AE2A 2GV1A 3C66A 2OP5A 1IJFB 5HQMA 3G82B 3QRQA 2XLJA 5H9EK 4DR5J 2CPIA 2OMLA 4RW4A 1TL7A 2DVIA 2W9BA 4DR6J 3O1LA 3OTCA 3SCIE 1VQ7S 3K5OA 3PHTA 3PKYA 4AD6A 5LSRA 5LMUJ 3CSKA 3KLEA 2GX8A 3FRYA 3ETMA 5IT9Y 5K20B 3L3CA 1B4SA 1LWEB 3MAAB 2FVQA 3IRXA 2KFYA 1FWLA 4I56A 2JFDA 2BJ9A 4NOHA 3IRWP 4ECWA 1HQ2A 2Q79A 4C9DA 3QPIA 1ZM2A 1AW0A 4I64A 3BGRA 5E0OA 1OY8A 4K4VA 5F0WA 1FF2A 3LP1A 2CA9A 2C3OA 2P9EA 2EFNA 3EM1A 2DIVA 3C46A 4C8ZA 2F4VJ 1OWXA 2HHHF 1TP7A 1YITS 5C7PA 1RE1B 3EDQB 4EUVA 1S9EB 4Z37A 3V81A 3NAIA 4DV4J 4FDFA 4USMA 3NGKA 2BJEA 1SL0A 2HS3A 1N48A 1B0VA 2KHCA 4CLUA 1UJ5A 2B7BB 1X0PA 1K0TA 4EK2A 2IJNA 1YKWA 4HVZA 4L3KA 5C24B 1UW4A 2J0QD 4QWDA 4ZP8A 4WXOA 4GVBA 1O5JA 3HK2A 3R7NB 2ZC4A 3CO0P 4KH1B 3CGIA 1OJ4A 1OO0B 5ITHA 4IUFA 2XS5A 1JQGA 1N6QA 3OUYB 4DJBA 1VLOA 1G4CA 4C97A 4IO1A 4JI4J 2QLWA 3N5BA 2N82B 3GJSB 3MEGA 1VGYA 3VZHA 4DR5F 3KFWX 3TZZA 4RW4B 4FYWB 2W9BB 5IWAJ 2W2NP 4DR6F 4WFZA 3NS5A 3RW6A 4RZRA 3KLEB 3M1VA 5LMUF 4QBUA 3HSDA 4LFCJ 1C0TB 2XZWA 1M5VC 5A6WA 1B0TA 4OX8A 2BMBA 3IRXB 2M7SA 3J7ZT 1S4FA 1VJWA 5KG4A 5K8NA 2L9WA 4MTPA 1NUEA 5M2UA 2YNHB 2ZH3A 3K5PA 2ACMA 3HHDA 2FJEB 3L09A 4ZS6A 2KL8A 3LP1B 4XDDA 1S1UA 1PGZA 1QDUB 1ZM4A 2F5GA 4HACA 2AV5A 2BJ7A 5T41A 2MZSA 2F4VF 3PJWA 3C6UB 1FNMA 4KHRA 2VG7B 3QBCA 4DSKA 5L39A 4G3IA 1AB8A 4DV4F 2CQ2A 2DXEA 2CG8A 4YR2A 2V8GA 3KTQA 5HVGA 1N36J 2E9TA 4F7VA 4F4KA 4B9LA 3LAKA 4PPDA 2ZJQQ 2YKMA 3VAGA 1VQNS 4U67Q 1Y0HA 1FKOA 4M94A 3FGVA 1S4EA 3G8QA 4A8XA 3CCLS 1B99A 3BO4A 4GVBB 2GC8A 3Q23A 3RZAA 1H74A 4PG6A 2NLWA 3TARA 1S57A 4U8YA 5IQ6A 2F3JA 4PZVA 3EE3A 4DV2F 2DGWA 2ABYA 1N6QB 1K73T 1VRUA 5FDLA 2IC3B 2W2MP 3FEZA 1TKXA 3MEGB 2UUTA 2L41A 4NI2A 4ED7A 3JTOA 2B9EA 2OI2A 4YR3A 5D3GB 1ZETA 4URQU 5I42A 1L3SA 1MWZA 2ZNYA 1R0CB 2HZCA 3W8GA 3MF5A 3NP5A 3EXYA 4ELTA 4C8KA 2DYAA 4ZK7M 2XMTA 3I5CA 3PKMA 7FDRA 3R1LA 1FXRA 4MFBB 1RHMB 3F0NA 2R2UA 2RD5C 2CG4A 1R3NA 1N56A 4RKUC 4JUZA 2DNNA 1S10A 1RHJB 4USKA 3OXGA 3AD7C 1S1UB 4HACB 3KHLA 1IBLJ 3A8EA 4USVA 1K1QA 1X4GA 4FNIA 3DYAA 5EWGA 4B9VA 4AYBD 2PGCA 4FYXB 1HNIA 4UY85 3D2WA 1ZAXA 4HHHA 3RB6A 2UUBJ 1T3NA 3UO0A 1F60B 1RTIB 2YKMB 4CCHA 1FKPB 1FKOB 1TV6A 2DHSA 3LP0B 2HIYA 2B0GA 2GAGC 2U1AA 1VCTA 4DV7F 1DQ9A 1R27B 4K4ZA 3FBEA 3OLBA 4PXEA 4DL7A 4ZMMA 4CH7A 2FGOA 3DU6A 2Q3PA 1TK0A 1XTZA 3N4WA 1RWOB 1MN7A 1Q1KA 2W8KA 1TFWA 4K5SA 3HVAA 2CQ0A 2C1EB 5DQHA 5FLXY 4WFAQ 2DIUA 4S0MA 1VRUB 3PJXA 3DLJA 4D3HA 5KFZA 5AE1A 1OSDA 1TKXB 3ZNUA 3NNCA 4NI2B 5JUMA 1SUQA 2DKOB 1YRTA 2HLTA 1Z2ZA 3OBIA 5DLFA 1RSCA 4LFAJ 2G2YA 1CJUA 2QGFB 4EFAC 5A8KA 5BR8J 1M5PC 4F3OA 4C98A 4Y28C 1WKJA 4IR1A 2ZOMA 1VQYA 5B08A 3U7JA 1SQGA 1TUWA 3D7SB 1Z4UA 4DLGA 1EB0A 3DM2B 3NG8A 3V4IB 1PJ6A 3EXCX 5EN1A 1PSDA 3FSXA 4NXMJ 3ZC4A 4NYZA 2DHHA 1N4LA 4Q8EA 4J9NA 4PXDA 3TOQA 1IBLF 3DYAB 2BE2A 3FBFA 4RO0A 2RDIA 1TL4A 1HNIB 2GNKA 4ZVFA 1YQHA 4OL8A 5CQGA 2LLZA 2OPPB 3FMWA 4FXWA 1SH3A 2ZE2A 5DZ7A 2UUBF 3NAHA 3FEXB 4QQBA 4RJVA 2CQGA 1WKLA 1RAIB 4G65A 4MMOA 3QLHA 2GJIA 2F7VA 1F3VA 3HSZA 1NHVA 2D9OA 4ZJLA 2EFPA 4CNYA 4DR2F 3PW5A 4NLUA 4NLWA 2V2ZA 3K5LA 4E8UA 3I0RB 1QVFR 2RQKA 4J9SA 1V3ZA 1HBUA 2JJ4D 4DV0J 3H4BA 4DSIA 3H42A 4OZ5A 2OSQA 4JV5F 3OFFA 5C2GA 4OHZA 3JAMY 2BR0A 4Z2XA 2VFRA 4M63A 1Q86T 4ZVOB 1GMVA 2FLOA 1CJKB 4W90B 1WDTA 3DU5A 1U0HB 1VR6A 5BR8F 2BA9A 2E44A 3VCDA 2NUUG 1RZMA 1BQMA 3V6DB 2W4DA 1RA7A 3Q8RB 4K2XA 2DITA 1S12A 2XMWA 4PXBA 3U1NA 2HHWA 2E7XA 3QMQA 4U96A 2PI4A 4YDXA 1HNVA 3KK1A 1NO8A 1K9MT 1PJ5A 2BE2B 4ZPTR 4F4WA 1KKHA 1KP6A 3G96A 3RAMA 5CZVA 4LR8A 2BQUA 5AE3A 1NK8A 1JLEA 1VOMA 4FS2A 2ZE2B 3NKYA 1ZPWX 1NHKL 2OTLS 2K8GA 3L9ZA 3MPYA 2LQ5A 3MPWA 3BN4A 5IM0A 1PC4A 3QLHB 5G4DA 3BBBA 2MQPA 1NSPA 3PNIA 2XYHB 4IRKA 1VYAA 5EHHA 3Q2SC 3SSRA 3HXMA 1UFKA 1RCXB 2DNOA 4F26A 2FUG9 1HBUB 1FRIA 3OL8A 3LGNA 4DV0F 5CYJA 4P71A 2V4RA 4WF9Q 2RILA 3IN5A 3DKDA 1IBCB 1JXVA 3E51A 1WJ9A 1VIXA 4DPWA 2AJFE 2VJUA 1TAUA 3MM6A 5L1IA 3SSSA 2YXLA 4IFVB 3ET6B 1Q0NA 5DRKA 2CQPA 3E01A 3KG0A 4K8RA 2I0XA 4EEYA 1CC7A 1TVRB 4I6WA 4Q43A 3LGMA 2KDOA 1QJHA 4OYIA 3N6NA 3GR0A 2W7PA 2KB2A 3QAEA 2ZZNA 3J80U 1VDHA 1V6HA 2CPYA 2VQFJ 2ZUGA 2O1PA 3CB4A 5HQLA 1BQMB 3CCRS 1UKUA 1R8PA 5E41A 4M5KA 2XYGB 2J6SA 3C6TA 2AP6A 3DCAA 4C8LA 2HMIA 1YHQS 4OLPA 1HBMB 4I2QA 1SI9A 2QFIA 3M6UA 3KK1B 3DOMB 5GAGU 2R4FA 2DHXA 4BDPA 4ED2A 1ZOTA 4F3QA 5I3UA 1S1TA 5KFQA 1BY9A 1JLEB 4WCEQ 2DR8A 4P74A 2OJ3A 5B09A 4DX5A 3LO3A 1FE0A 5IM0B 6AT1B 3T5LA 2WW8A 1ZZFA 2J6TA 3PEHA 1U48A 4J9KA 2HQFA 1ZM9A 2YKOA 1RTJA 2Z2LA 1QE1A 1IBMJ 4ID5A 4LF7J 2PA8D 1SJ4P 1VQSA 5CCLA 2ZVSA 3HT0A 5A8WA 2XZDB 1FI4A 4OFZA 1ITPA 3IC1A 2VG5A 3HI9A 1U25A 3JS9A 3BPDA 3BM7A 2KTQA 3HPOA 1D8YA 2IM1A 1FJGJ 1Q16B 5F8JA 4HTIA 3HLUA 3MM6B 1YG0A 4RUAA 1FVQA 2AJQA 1I5OB 5B0BA 1VFJA 1S0OA 1C0UA 1JKHA 3CJSA 1S1WB 5GAHU 3TW0A 4B9MA 5KOWA 4HI2A 2H5JB 2V2KA 1E6YA 3HD2A 3RB3A 2ROPA
chains in the Genus database with same CATH topology
4PYAA 2IDEA 2EEYA 2OHDA 1EKSA 2EKNA 3JQKA 4FDFA 3JQJA 4PYDA 1EKRA 3JQMA 2IIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PYA A;  2IDE A;  2EEY A;  2OHD A;  1EKS A;  2EKN A;  3JQK A;  4FDF A;  3JQJ A;  4PYD A;  1EKR A;  3JQM A;  2IIH A; 
#chains in the Genus database with same CATH topology
 2VQF F;  3ZO7 A;  5ETR A;  1NH8 A;  2NPI A;  1U8S A;  1ZS6 A;  4USU A;  4I2P B;  3FDS A;  2AJ0 A;  1X9M A;  3K0J A;  3C6T B;  3MPU B;  3QIP B;  1F2G A;  4I2Q B;  2WK4 A;  2WSF C;  4IOA Q;  4EBE A;  4I7F B;  4GVL A;  3FQK A;  3GJR B;  1P9Q C;  2BAB A;  4PUO B;  3MEK A;  3W9H A;  5I3U B;  4R5P A;  2JX2 A;  1HWK A;  1URR A;  4DSF A;  2JVO A;  3OR1 A;  4ZVR B;  4JV1 A;  3OSN A;  1KVJ A;  4LRA A;  2A2C A;  5D8H B;  2YQ3 A;  4BHQ A;  1B7F A;  4WTO B;  2BKP A;  4EGL A;  1HI8 A;  2FPH X;  3RR7 A;  3M8S A;  1YJW S;  2HLU A;  4GKK J;  4DSJ A;  4FS1 A;  2XG8 A;  1PIE A;  4DPY A;  4ID5 B;  2D7S A;  2GCF A;  4DQR A;  4XTT A;  1VS3 A;  3TVY A;  2IDL A;  1SC4 B;  4ZDN A;  2VG5 B;  2N3L A;  3D68 A;  3PW2 A;  3OFG A;  1HI0 P;  1CC8 A;  2ZH9 A;  5EX0 A;  2J0X A;  2I1R A;  1OS5 A;  2IM3 A;  2V2Q A;  3D1H A;  1ZYQ A;  4O0N A;  3LW5 C;  4C0B A;  2XM3 A;  1B64 A;  1T9U A;  3W62 A;  2N3O A;  2DGT A;  3CME S;  2FIU A;  1SKR A;  3QWP A;  3N0V A;  5L8R C;  5L1J A;  3AXM A;  2D3O 1;  2LXI A;  2HHU A;  1C0U B;  1JKH B;  3MEC A;  4RPF A;  4WWS A;  2QSF A;  4R0E A;  4J9Q A;  4X62 F;  3KK2 A;  3T5J A;  1JLF A;  2DNZ A;  3QAU A;  3I87 A;  3HHL D;  2GMH A;  3KLG A;  1FDA A;  1ZPV A;  2WVD A;  4ZCK A;  4LF4 J;  2IHR 1;  1RT4 A;  3JSM A;  3BQ2 A;  4IO9 Q;  1SC6 A;  3IGN A;  2MZT A;  1SJQ A;  2CFX A;  1NDL A;  4N5S A;  2DGS A;  2GMJ A;  2V8D A;  1LW0 A;  1SVD A;  3UWT A;  3GCX P;  3CD7 A;  2AZ1 A;  3ILJ A;  3MTJ A;  2QA4 G;  1GX6 A;  1U2C A;  4R5P B;  2ZH6 A;  2WOM A;  4OX9 F;  3OR1 B;  2QC3 A;  2UXD F;  1YBT A;  2CDR B;  5M2R A;  1UEV A;  1S7I A;  1WUU A;  1JLG A;  4AL6 A;  4YUD A;  3KDO A;  5CXT A;  3T41 A;  3R5A A;  4DV1 J;  2K7J A;  3K7R A;  3OVB A;  4QR1 A;  2PA3 A;  5JVG Q;  1NDP A;  2BJ3 A;  2KXH A;  1N33 J;  2DK2 A;  2EPI A;  3PX4 A;  1VRT A;  3BDE A;  1AYE A;  4FKX A;  5A8R A;  2E29 A;  3W8P A;  1Q7L B;  4F4X A;  1S99 A;  5HBM B;  2B9W A;  3N6L A;  4LF2 A;  1L3V A;  2AD9 A;  2F65 A;  5KG1 A;  3OVA A;  2MQM A;  4FXD A;  3NWR A;  1R8C A;  1RT1 A;  2GQC A;  1IR2 A;  3PW7 A;  2XO7 A;  2HGN A;  4FYY B;  2OFH X;  4TN2 A;  3MEE A;  1NZ8 A;  3WC0 A;  3DDI A;  1RT2 A;  4L74 A;  1XMB A;  3ITH B;  3KK2 B;  2CIM A;  3N6M A;  5LSL A;  4MKA A;  1JLF B;  2HBY B;  1Q8B A;  2BOA A;  4RW9 A;  5ETN A;  3TVK A;  1RKJ A;  1I51 B;  3G6E S;  1XC9 A;  1WOR A;  3R6G B;  1A0O B;  1U2R A;  4LF4 F;  5RUB A;  4DZ6 A;  1RT4 B;  3UNY A;  1TKD A;  2ZBC A;  3JSM B;  2LCW A;  2WAQ D;  1XJW B;  4PRF A;  3OXL A;  1V3S A;  4NRU A;  4F36 A;  1XBW A;  4RW6 A;  2KXN B;  3DRS B;  3SFG A;  3DC2 A;  2OPS A;  3TZX A;  4KSE B;  2MYF A;  2NUH A;  2RUS A;  1NLK L;  4E2F B;  4DUY J;  2LFV A;  1U8W A;  3BJY A;  1BHN A;  3EGW B;  3RYL A;  1RU1 A;  2AGO A;  4P9S A;  3I9Z A;  3UVJ A;  1M90 T;  1JLG B;  1K8A T;  3RW7 A;  3BO3 A;  4OLO A;  3TO8 A;  5FD1 A;  2KJW A;  1MWQ A;  2FC9 A;  3Q8S B;  2IY5 B;  1HWJ A;  2IBO A;  3QQC D;  3BEG B;  2CNO B;  6FDR A;  2AX0 A;  2RDD A;  2EWH A;  5HLF A;  1M1H A;  1CVJ A;  1K0V A;  3S6E A;  1VRT B;  1N33 F;  1WG5 A;  2EFV A;  2F4F A;  1ZH5 A;  4DR7 F;  5A8R B;  1F2H A;  5KFW A;  1FO1 A;  2Q6C A;  5KFL A;  3KNG A;  5KFB A;  3BH7 B;  3DMJ B;  4P2M A;  1CJV B;  2ASY A;  2OFG X;  2MKS A;  2YH1 A;  2G1D A;  3NS6 A;  1JXL A;  2CZ9 A;  3DHX A;  4MT1 A;  1IKV B;  2RDJ A;  2LDI A;  4YB5 A;  2QL7 B;  4TKT A;  4KYZ A;  1RT1 B;  3H40 A;  4Q2M A;  4ZP9 A;  4UW2 A;  4M8L A;  3D6F B;  1IM6 A;  2C3Y A;  4I67 A;  3PIP Q;  4NL5 A;  2OTJ S;  2RKI A;  1HMV A;  1WKK A;  2VQE F;  3QWU A;  4O0I A;  5BYQ A;  1ARO P;  1LXN A;  2FC8 A;  1H7W A;  3BF4 A;  4DG1 B;  4RW9 B;  3HHL A;  4GMK A;  4QU7 A;  3LAL A;  3OTO J;  4KGV B;  3Q8U A;  4CIO A;  3W3S A;  2BDP A;  4FYD A;  2AJ4 A;  2F63 A;  2OPQ A;  4DR4 J;  2HBQ B;  3VVU A;  2DXD A;  3RJM B;  2QO3 A;  1U6Z A;  3J7A 1;  4UY8 T;  4QIW D;  2PFD A;  1N5S A;  2G2Z A;  5KFP A;  2UVW A;  1I3O B;  2HNZ A;  2HPU A;  4ATN A;  1TKT B;  2GVZ A;  4N56 A;  2Y1J A;  3WBZ A;  4KFB A;  3UVJ B;  2E1C A;  1F0X A;  1PBU A;  1S48 A;  4NLY A;  3NEK A;  2OO4 A;  4Y34 A;  2OSR A;  4DUZ J;  3JSY A;  4BC7 A;  3NGT A;  1R0A A;  1IWA A;  4BWJ A;  4LF5 F;  4WKR A;  1JLB B;  4QW9 A;  2M5Y A;  2MQO A;  1WSR A;  4PG7 A;  2PE8 A;  1IKW A;  4C2M A;  1D9A A;  1X31 C;  4H4O A;  2Q6B A;  1FWK A;  2LP4 A;  3IGV A;  3PHE A;  5KFE A;  4B9N A;  2DTJ A;  3S1T A;  4HI1 A;  4A4J A;  4CO1 A;  2IRX A;  3BH6 B;  4G1Q A;  3UCU P;  4FBU A;  4K4U A;  3T1Y J;  1GNK A;  2RKI B;  2MDA A;  1HMV B;  1FJ7 A;  5KFD A;  4C11 A;  2DR7 A;  2QV6 A;  3GSD A;  3RRG A;  2OUG A;  4ED0 A;  2I9S A;  2I2Y A;  3ZTP A;  1BQN A;  2V6A A;  3US5 A;  4FBT A;  3KG4 A;  3MED A;  5KFR A;  4E98 A;  2AYM A;  2XCP A;  4NE9 C;  2C2R A;  3DRP B;  1P1T A;  2OPQ B;  2LQB A;  2ILZ A;  1UAW A;  2YWE A;  2ASL A;  1X8D A;  1SKU B;  2E9R X;  2VA3 A;  1HLW A;  3PYF A;  3RAQ A;  3RB0 A;  3RBE A;  2GML A;  4KO0 A;  1G3O A;  1NSA A;  1BXN A;  2ZEJ A;  1KVI A;  2HNZ B;  2HFN A;  5G0R A;  1DLO A;  4ECY A;  5HMY A;  3NGR A;  4CLP A;  4EMD A;  2KZZ A;  4NPO A;  2IPO B;  4KFB B;  3I4P A;  2E7W A;  3F73 A;  3M8Q A;  4WPA A;  3JSB A;  3NMR A;  1R0A B;  2HQD A;  3KMQ A;  4OYP A;  1WC0 A;  4LT6 A;  1FKA F;  4B3M F;  3MMB A;  3RB4 A;  3SEO A;  2BE9 B;  1G1X A;  2W1B A;  3JYT A;  4LUB A;  5ETO A;  1SKS A;  4O44 B;  3C14 A;  1RGV A;  3T1H J;  1KFS A;  4ZOS A;  4QZV B;  3KYL A;  1VQ9 S;  4H4O B;  3VHQ A;  5DZ6 A;  1RP5 A;  2N7Y A;  2C3M A;  3AQP A;  4ECV A;  2DH7 A;  3J7Y I;  1FCA A;  3BV8 A;  2BKO A;  2YH0 A;  2JSX A;  1NJZ A;  3OR2 B;  1YVF A;  5KFC A;  4G1Q B;  5J2P A;  1U7L A;  3LOU A;  3T1Y F;  2RT3 A;  2BZ2 A;  4WZQ A;  2V4J B;  2B4O A;  2F9J A;  2FZK B;  1T9T A;  4NWB A;  3MUM P;  3SV3 A;  4JYA J;  1EKR A;  4UUW A;  2AZ3 A;  3RG6 A;  1L3K A;  2IAJ A;  1EQ0 A;  3VAJ A;  2FLL A;  1RAA B;  2D41 A;  2CPE A;  4TLQ A;  2JFK A;  2W9A A;  3MED B;  2XSJ B;  1TK8 A;  2JLF A;  4GKJ F;  5AJ3 J;  3PZP A;  4WP8 A;  1ULR A;  3TR5 A;  4WII A;  5CAA A;  3CMQ A;  2XMV A;  2XMU A;  3M9O B;  3HJF A;  2R8K A;  1X0F A;  3CDW A;  4KO0 B;  1NPR A;  5DLG A;  2VBY A;  3F44 A;  2N7C A;  2B9Y A;  5G0R B;  1B3T A;  4DXL A;  4YHH F;  4C3L A;  1KEK A;  4IQM A;  1S77 D;  3QGP A;  2W8L A;  3ZZP A;  4WK3 A;  1UVL A;  2JEG A;  1Y5L B;  4WP9 A;  3N5F A;  4WKY A;  2MSS A;  3M8Q B;  4TVA B;  1N0V C;  1U1K A;  1OMS A;  1T95 A;  2KHD A;  3F56 A;  4B3O A;  2DB1 A;  4WU3 A;  2XNQ A;  1XMQ J;  2R7R A;  2G13 A;  1Q8K A;  3UE2 A;  3MMB B;  1UTA A;  1IXK A;  5AXL A;  3JYT B;  2VPW B;  3D0G E;  1RBL A;  2F40 A;  4ZA1 A;  3C14 B;  1QM9 A;  3EIC A;  1HBN A;  4G1P A;  1RA6 A;  1AFJ A;  4OYZ A;  2NYI A;  4JI6 J;  1T9Y A;  1RCO B;  1TK5 A;  5DJB A;  3OHB A;  1N32 J;  2RNE A;  4LBI A;  3PVX A;  3KK3 B;  2ALY B;  1TL3 A;  1VBZ A;  1YRU A;  3PM9 A;  3ENA A;  1GFW B;  4K0K J;  2YPZ A;  3M2V B;  4PCQ A;  2VOD A;  3NL0 A;  1KVK A;  5KG3 A;  2HRU A;  2IAJ B;  2ZH8 A;  1S6U A;  1JLQ A;  2DGV A;  3PIO Q;  1AUS L;  4PAB A;  1SJF A;  3UFC X;  2RHS B;  4TYB A;  1C1B A;  4V19 J;  3R8Y A;  5AJ3 F;  3K17 A;  4OYB A;  3CJT A;  2J9C A;  2UXC F;  5KT4 A;  1PG5 B;  4NZ7 A;  5J2M A;  3CJ5 A;  3MM5 B;  4NA3 A;  2Y0B B;  4Q2L A;  1T11 A;  5C25 A;  4DSL A;  1R89 A;  4M5H A;  3R5D A;  1AUD A;  1VIO A;  2WB4 A;  1RT5 A;  3R2D J;  4YN3 B;  4YY3 J;  5L9X A;  1JNR B;  3CDU A;  2YQ1 A;  2KJV A;  3MAQ A;  5IQQ A;  4ZPW R;  3AOB A;  2DD8 S;  1XMQ F;  3NWG A;  4WTY A;  1U4B A;  3PAC A;  3CW2 C;  4ECU A;  1G2E A;  4O3R A;  1SL1 A;  4H4K C;  2ASJ A;  4B3T J;  2UVV A;  4QWE A;  4USI A;  2B8P A;  4OMF G;  4PWW A;  1UET A;  2RF2 A;  1HBN B;  3M8W A;  5J1N A;  3NGU A;  1FE4 A;  3C2P A;  2EI5 A;  2A3J A;  2HYI B;  3BR9 A;  3DLK A;  4RUH A;  2KG0 A;  3PXG a;  2UU9 J;  4ZLJ A;  1FVS A;  5K8P A;  3ZZO A;  2SXL A;  4ZPV R;  3LWL A;  3MI7 X;  2ALZ A;  2YTC A;  1S7H A;  2B9X A;  2FB0 A;  4QOT A;  4PR6 A;  3AD8 C;  1TMM A;  4FF1 A;  3HJV A;  2VOO A;  1YWX A;  4K4Y A;  1WTF A;  5HP1 A;  4B9S A;  4OI0 A;  3PO5 A;  3LQV A;  3KUE A;  3QJL A;  2NXJ A;  2YKQ A;  4K0K F;  1F3F A;  3P45 B;  3CIZ A;  1MRO A;  2ZHB A;  4DL3 A;  2H4Y B;  3M8P A;  4ALZ A;  1FRJ A;  2VON A;  1JLQ B;  3M8Z A;  4IG0 B;  2ZKU A;  3EPI A;  1LWF A;  5BYS A;  2A10 A;  1RB0 A;  4PAA A;  4LF6 J;  3CJ4 A;  2RE1 A;  4NYP A;  2Y8W A;  2X7I A;  4ITS A;  4PQA A;  5M2P A;  1AZS A;  1NEE A;  2CPD A;  4B3S J;  4O3S A;  5J2M B;  3R5G A;  5C25 B;  2B6A A;  5KAK A;  5B0G A;  1TUV A;  4AE5 A;  2ZBQ A;  1S0N A;  1KD1 T;  3LP2 A;  2CWK A;  2APO A;  2G0I A;  3H5Y A;  2Y1L B;  4UOG A;  3EUN A;  1Q4R A;  1RT5 B;  1BC6 A;  5ETQ A;  2YNG A;  3AQO A;  4OHY A;  3BBF A;  2XGQ A;  1R43 A;  1VQL S;  5IC6 B;  1CBK A;  3D1O A;  2M2B A;  3DLL Q;  1ZA1 B;  2L9N A;  5KG2 A;  2HIQ A;  3AA9 A;  1NND A;  1HIY A;  3SQG B;  3BRE A;  3D1Q A;  1VBX A;  1T9V A;  2I5J B;  1NHU A;  4L6V 3;  2LU2 A;  2RF2 B;  2HWI A;  2JZ5 A;  3RRH A;  2XC9 A;  4LRC A;  3KHG A;  1TL5 A;  2DRB A;  4A8F A;  1TL1 A;  3IWL A;  2BRL A;  4K5R A;  2XI2 A;  1VQ8 S;  1REV A;  3PRD A;  8AT1 B;  2RJZ A;  4G6V B;  4AQY J;  1Q8I A;  4ECQ A;  1HR0 F;  5THW A;  5CCM A;  3KJV A;  4DR3 J;  5HP1 B;  1J27 A;  2IA0 A;  2CKW A;  3HZE A;  4F2S A;  3AT1 B;  4F67 A;  1X4E A;  3M8P B;  3H2U B;  2R2T A;  3R9L A;  1HW9 A;  5C5J A;  1QD1 A;  1EQM A;  1LWF B;  4KGM A;  3VAK A;  4OJH A;  5ADZ A;  1QTN B;  3HP6 A;  3GFZ A;  1HWI A;  2D3O R;  2DNP A;  4ED1 A;  1NK5 A;  2H5E A;  4QYR A;  3HVW A;  3TZW A;  1VI7 A;  4KV8 A;  1EET A;  5C42 A;  3I0S B;  2Y3Y A;  1HNX J;  2DNY A;  1ZM3 A;  4Y2A A;  4JI2 J;  3BSC A;  4WP3 A;  4TQS A;  4X4N A;  2BUN A;  2C2O B;  1UVK A;  1XEZ A;  3D67 A;  1DQA A;  4NAS A;  1FFS B;  3C15 A;  2YNG B;  4OQJ A;  1QAJ A;  2XGP A;  1VMB A;  3HKW A;  4MJK A;  1Y11 A;  3V4M A;  4DCJ B;  4X4P A;  4LVO P;  4M5J A;  2IFX A;  4X64 F;  4LBP A;  1IKX A;  3U27 A;  5LT5 A;  1HBO B;  3M2U A;  3EGV A;  2H48 B;  1Z1Z A;  4Q7A A;  2D74 B;  1DZ5 A;  4UT4 A;  4KB7 A;  1YX2 A;  2J9D E;  1KOO A;  2V0N A;  3UN5 A;  1REV B;  5E3C A;  1S6P B;  2PMH A;  3HCX A;  5J1E A;  3UW1 A;  5L46 A;  4MH8 A;  3WIV A;  2E9Z A;  5L1K A;  3KJV B;  2K1R B;  2HZV A;  4DR3 F;  2OMO A;  4N47 A;  1NU4 A;  2IM2 A;  4U7U K;  2ZOG A;  5I3P A;  1L3U A;  1SIW B;  1SH0 A;  1R6Y A;  3A12 A;  4HHU A;  3DFE A;  3BBC A;  4Q0B A;  2EC0 A;  5LSO A;  3H59 A;  4AND A;  2CZV C;  3DXS X;  4TY9 A;  1KTV A;  3VZI A;  4JI3 F;  5CA5 A;  4XPC A;  1I6J A;  1UA0 A;  5B0F A;  3KNA A;  4KV8 B;  2DGQ A;  2R9L A;  1P8G A;  5DGA A;  3EVW A;  1GQE A;  1QSY A;  4HR2 A;  4DL2 A;  3DOK B;  4F4Z A;  4EO6 A;  2GS8 A;  3RU0 A;  2MKH A;  2J6U A;  3HT3 A;  1RWV B;  3C15 B;  1S76 D;  1S59 A;  3H0P A;  1U1N A;  2XMM A;  3RR8 A;  3KLV A;  3DLB A;  3GG0 A;  5KT6 A;  3ISN C;  5HRO A;  1UZD A;  1T3O A;  1UEK A;  4CI0 B;  4X84 A;  1IKX B;  3QRP A;  2RB7 A;  1X60 A;  4QYZ J;  2O3D A;  3TWZ A;  1A6L A;  3GFX A;  4TNO A;  2XUL A;  4LSN A;  4ICL B;  1UJ6 A;  3FBC A;  2C42 A;  1QUP A;  1HPZ B;  1W2B R;  1RAJ A;  5KG7 A;  3G82 A;  2FJV A;  2CJQ A;  5LXY A;  4LF8 F;  4F2R A;  1SJ1 A;  5J2N A;  2FVC A;  3GSI A;  5IT4 A;  4A8O A;  2ZC3 A;  1XQI A;  3I5B A;  4JI7 F;  1N5T A;  3M32 B;  1FTC A;  3PY8 A;  3MAA A;  4UQT A;  3J81 j;  1NSK L;  2OPR B;  3UD3 P;  2HAF A;  4Q0B B;  3TX0 A;  3OW2 R;  2O67 A;  3FMB A;  2LKZ A;  2B5J A;  2UXB J;  1TUG B;  4PG4 A;  3CXC R;  1ZBT A;  4O4G B;  3D6T B;  5C2C A;  5H9F J;  4AL5 A;  2XHW A;  5SUH A;  2WB1 D;  1Q53 A;  2YKN B;  3FFI B;  4KHM A;  1M1K T;  2JC0 A;  2JLG A;  3GB0 A;  1WHV A;  2XLK A;  3A1Y G;  3AHP A;  5C24 A;  1HKA A;  1HNW J;  4AXJ A;  3B82 A;  2LQJ A;  2DRD A;  2UUW A;  3RBZ A;  3TUJ C;  2QZ8 A;  5MAO A;  2RAQ A;  5HRO B;  4YOE A;  1HI1 A;  4PQU A;  2CQD A;  1DTT A;  4B3R J;  1K1S A;  3IR5 B;  1RAE B;  2UUC J;  1WG1 A;  2FZC B;  4KH0 B;  5GMD A;  2CRL A;  4LSN B;  2HFU A;  2YQ0 A;  2XLI A;  4DUT A;  4M1K A;  1W7W A;  3L7U A;  4IFY A;  2VG6 B;  2BM0 A;  5IV4 A;  2XHC A;  3Q83 A;  3BKT A;  4KT0 C;  1DBD A;  2ZIT A;  4NLP A;  5J2N B;  5KFF A;  2JEF A;  1U1Q A;  1UW9 A;  2B4V A;  4X4S A;  4EYH B;  1FRL A;  2QLJ B;  3VVT A;  1C0T A;  1CS4 A;  2DJW A;  1WDD A;  2QA4 S;  1CSJ A;  4CH1 A;  4HLB A;  4NA2 A;  4ES3 A;  3A3P B;  3MAH A;  1VQ6 S;  2CAD A;  2YNH A;  4LRE A;  1IN0 A;  4WZM A;  4Y2M A;  1X9S A;  4G1I A;  1R8H A;  2XWY A;  1NDK A;  2WRM A;  4DX7 A;  2B5J B;  1EZZ B;  3TZY A;  1U6B A;  2UXB F;  1NRK A;  2VV5 A;  2HWH A;  5E3A A;  3C6U A;  4MK7 A;  4DV3 J;  1QSL A;  2VG7 A;  2E5L F;  3MR7 A;  4UZB A;  1P27 B;  2CQ4 A;  1F5A A;  4RWW A;  2IYI A;  1YJT A;  4LBH A;  2YX4 A;  4EBC A;  3K57 A;  3KUG A;  2GJF A;  2UVR A;  2VAS A;  2M9K A;  5E3Q A;  1A9N B;  1FDN A;  2C3U A;  1KFD A;  5D0G A;  1TZ0 A;  1U45 A;  1IR0 A;  1HNZ J;  3LH2 S;  1UPM B;  4IOB A;  3X3U A;  3GTY X;  3E2E A;  4KBI A;  3SCK E;  2DNM A;  1WSV A;  1HNW F;  2EFO A;  3UI3 A;  1GK8 A;  4RNM A;  4A48 A;  3DOL A;  4ZVQ B;  3PV8 A;  2WBR A;  2DGX A;  2V4Q A;  3ZTO A;  4DR1 F;  3BPS P;  2EKN A;  4PQU B;  2HW3 A;  1DTT B;  4NXN F;  2E1R A;  4M5M A;  4TU8 A;  5B0C A;  2UP1 A;  1J5E J;  2MXY A;  4KIA A;  2IA6 A;  5F9N A;  4NYO A;  4IFY B;  2ZUA A;  2IC3 A;  1PYT A;  1S1V A;  4DL5 A;  2VPZ B;  1X5T A;  3THV A;  4A8K A;  4X4Q A;  2V8V A;  2IM0 A;  3N79 A;  5F8M A;  1RXO B;  5D3G A;  3ULH A;  3BGF A;  3I82 A;  1WTB A;  4I69 A;  1VQ5 S;  1F1B B;  3MXH P;  2FJX A;  1JB0 C;  4PYA A;  4DL4 A;  2H65 B;  1UVI A;  3KJN B;  1XR6 A;  1CS4 B;  4MKY A;  3ILO A;  3TRG A;  1H7X A;  3PRV A;  1BLU A;  2V94 A;  1TFY A;  4MFB A;  4ZCI A;  5HVH A;  4LRB A;  3NRB A;  3D3C J;  3I9V 9;  3HF5 A;  3DGP B;  2A0F B;  5HVF A;  5DQI A;  3BO2 A;  2R8G A;  5J1P A;  3KOA A;  3QSI A;  2KFN A;  2CZ4 A;  1RBA A;  2M70 A;  1WC6 A;  4EI2 A;  3ELH A;  1GXL A;  2HVI A;  3QFW A;  5EGY A;  3I32 A;  4GC7 A;  4DV3 F;  2FTR A;  2C2D A;  1P6T A;  1RWK B;  5DDR C;  2ADB A;  4Q8F A;  4QWB A;  1FK9 B;  4OHW A;  2QYG A;  1JXE A;  3S01 A;  1WEY A;  4NLR A;  1D0E A;  4J9L A;  2HRT A;  1WEL A;  1LK5 A;  2YWG A;  4RU9 A;  4ZVU B;  4ZVH A;  4BC9 A;  1RTI A;  1FKP A;  2CNK B;  3RRK A;  4F4Y A;  2DNK A;  3LP0 A;  1R0B G;  4OV1 A;  3CD0 A;  4LQ9 A;  1QAY A;  2R7W A;  5D6G A;  3SDE A;  4KR0 B;  3RUB L;  4ZIT A;  3J81 Y;  1NAQ A;  2AT1 B;  1T03 A;  3DOL B;  4YB1 P;  2HHV A;  3ISZ A;  3LPE A;  4UOH A;  3IP0 A;  3OFE A;  3MCN A;  4KHP J;  3MD3 A;  1RT7 A;  3GQC A;  4XIU A;  1M5K C;  1X4C A;  1ACM B;  4O3O A;  1HHQ A;  2LMI A;  2LEB A;  1Q79 A;  3KMS A;  4JI4 F;  1S1V B;  2ZHA A;  3T5K A;  3AJD A;  4CLT A;  2D3U A;  3MR5 A;  3UN2 A;  5IWA F;  2VB6 A;  4KRW A;  2CYY A;  3GIR A;  4PYD A;  4O23 A;  4WFN Q;  2HHS A;  3MPD A;  4NLS A;  4EZ6 A;  1PYO B;  4LFC F;  5EWE A;  1KTQ A;  5ETV A;  3H7H B;  1VC0 A;  1RWU A;  4P52 A;  2Y1I A;  2DNG A;  8ATC B;  3R7S B;  3CF5 Q;  2CQB A;  4NLX A;  3BS9 A;  3DM2 A;  4WFY A;  2DNQ A;  3V4I A;  1CG2 A;  2KRR A;  2G0J A;  3R7B B;  2GIQ A;  2NYH A;  3IM8 A;  3HZG A;  2XQC A;  2R2S A;  3DDK A;  4LRD A;  2MKY A;  2GHW A;  5D4N A;  4J9P A;  2OKQ A;  4ZN3 A;  1RUS A;  1EX8 A;  2QYC A;  4GRS A;  2ASD A;  3IA0 A;  4TYA A;  2P2C B;  4N8O A;  3V2U C;  2OPP A;  2XMA A;  4ED3 A;  3NCR A;  1N36 F;  3R1H A;  4XO0 A;  2DEJ A;  3DLE B;  1NK7 A;  3ENW A;  3CC4 S;  1FHT A;  2MKC A;  1VHF A;  4OZN A;  2XWX A;  3SDE B;  3D3B J;  1SJR A;  2LEP A;  1T03 B;  5IT9 U;  4A8Y A;  5E3P A;  2HRY A;  3ADA C;  3IM9 A;  3I0R A;  2FHJ D;  1RT7 B;  2FVR A;  4USJ C;  3GIM A;  4JI0 J;  2QLF B;  1T05 A;  3CUL A;  1U1O A;  2EBG A;  5IXU A;  4ED4 A;  3P8B B;  3HVT B;  3KHH A;  5H1S V;  1C1C A;  1VHI A;  4I1T A;  1UJ4 A;  1U2F A;  4PEO A;  4CYU B;  1CJK A;  4HTJ A;  3KUH A;  2P8I A;  1PIL A;  2NS1 B;  2CUY A;  1U0H A;  3GP9 A;  1PCA A;  1NK0 A;  3NMA A;  3CE8 A;  4ZVP B;  4Y65 A;  1SV5 B;  3B54 A;  4P10 A;  2PC6 A;  2CQ1 A;  2LQ8 A;  1RAF B;  3V6D A;  4C7Q A;  1GAO A;  2EEY A;  2C2M B;  3W65 A;  3EGZ A;  1RHK B;  4IYQ A;  2CQI A;  2J7K A;  1RYS A;  1ROF A;  3TA2 A;  2YNI A;  2ROG A;  4Y6I A;  1Y3J A;  2GHV C;  4NCB A;  3MR3 A;  4ELV A;  2VA2 A;  2FJA B;  4C8N A;  4LSL A;  2V50 A;  5KTQ A;  2J76 E;  2B4U A;  2IIH A;  3RBD A;  3TVZ A;  4J9M A;  3QO9 A;  5B0A A;  2FJD B;  2XY6 A;  1FXL A;  4TY8 A;  4LFB J;  3A8K A;  1W26 A;  3A8J A;  4ILR A;  1LFW A;  1UVN A;  5HQ8 A;  4ECX A;  3GG1 A;  2P6S A;  4JI8 J;  4CZC A;  1KDN A;  2KFZ A;  4ZPD A;  3O2I A;  1CQM A;  2MZJ A;  1HHS A;  4MIB A;  3ENQ A;  2OGU A;  1M5O C;  1T05 B;  2HK3 A;  2AYB A;  3KLF A;  3ZFV A;  2FJW A;  1RAC B;  2VHG A;  1RAO A;  1YBU A;  3VAI A;  1LQ9 A;  4DCO B;  3QZ8 A;  1C1C B;  4J91 A;  3EWG A;  5KFH A;  3VGT A;  4PWD B;  4IFV A;  3ET6 A;  1F9F A;  3V6K A;  4ECR A;  5HAN A;  3DI6 A;  4ZN1 A;  3SYZ A;  2QEX S;  4LFA F;  1D8Z A;  1TVR A;  1I94 J;  3CJK B;  2JWN A;  3CJ2 A;  1S6Q B;  3HX9 A;  1WHW A;  1SL2 A;  5HAO A;  2A6O A;  4P7V A;  4C4W A;  3Q8V A;  2QN6 B;  2WHO A;  2PT0 A;  7FD1 A;  2J5A A;  3IG1 B;  4IG3 A;  4Y2C A;  2YNI B;  3W61 A;  2NQP A;  2YNF A;  1NK6 A;  4J37 A;  2V9W A;  1IKY A;  2QJ3 A;  3GR1 A;  4NXM F;  3D28 A;  1HBM A;  2Z2M A;  2P9G A;  3EPG A;  1HL6 A;  4LSL B;  4YS2 A;  2MQ8 A;  3DOM A;  4W98 A;  1R7I A;  4DV5 J;  4IR9 A;  3QO9 B;  1LEO A;  3FK4 A;  4DOZ A;  2HVE A;  3MTK A;  4U95 A;  4TY8 B;  4U7C A;  2Y1R I;  1S79 A;  1V5I B;  3BYR A;  2DH9 A;  3CWJ A;  2IBK A;  4OI3 A;  1O51 A;  5HMW A;  3SFU A;  1IUJ A;  1Y3K A;  2ZWO A;  1KRP A;  1OPI A;  2AJ1 A;  2ZJR Q;  4JI8 F;  1VQO S;  1IWG A;  2HGM A;  2YWH A;  5F41 A;  4OI1 A;  2FHJ A;  4X65 J;  4OJ3 A;  4WU2 A;  3W9I A;  1KLN A;  1IJE B;  4HHJ A;  1YGY A;  4USH A;  3OLA A;  1HFE L;  3KLF B;  4I6A A;  1X7V A;  2W2P P;  1RHR B;  1C2P A;  3AFG A;  1PAU B;  2AEF A;  2ZBR A;  4C8O A;  2DY1 A;  3ETO A;  1LK7 A;  2KM8 C;  2J8A A;  5ETS A;  4ZHR A;  5B0E A;  1U6F A;  3DI6 B;  2XMK A;  3H25 A;  3D6M B;  2MZR A;  3VAM A;  1S1W A;  4F25 A;  1HD1 A;  2DHG A;  1I94 F;  2IVY A;  5HL7 Q;  1CEZ A;  5LMN J;  2OEJ A;  4JI1 J;  3T19 A;  1OYE A;  3U02 A;  4DFK A;  4DV6 J;  1MG7 A;  2GQ2 A;  4DL0 C;  4MAK A;  2NXU A;  4O3Q A;  2MQL A;  3M30 B;  3OL9 A;  4H4K A;  2J0W A;  4CQ1 A;  5DG8 A;  4P75 A;  4QIE A;  4I2P A;  4IG3 B;  2WW4 A;  4FNH A;  2YNF B;  1P9Y A;  2NR0 A;  4IOC Q;  2UVU A;  1IKY B;  3QIP A;  3FCV A;  4Q45 A;  1JK9 B;  3B6B A;  1IBK J;  1VLY A;  5I4M A;  1VC5 A;  2L08 A;  2RUG A;  5K8M A;  1D1U A;  1MSW D;  5JJB A;  4I7F A;  3FQL A;  4AL7 A;  5DGB A;  4PUO A;  4QW8 A;  1QY7 A;  3G6Y A;  1NM2 A;  3FCW A;  3EDR B;  3KLI A;  2V69 A;  4P73 A;  4OYA A;  3FCH A;  4CO3 A;  4B9T A;  1T0T V;  3R6L B;  4NLV A;  1VQK S;  3VAL A;  4ANC A;  2Z0G A;  2ZZM A;  3I31 A;  3TAN A;  2HSE B;  4J5O A;  3MZI A;  3HUL A;  3W66 A;  5DDO C;  1ICE B;  2HFV A;  1UPP A;  3TJ8 A;  2KXF A;  4D3G A;  3PYG A;  1U26 A;  1N5Q A;  4IDK B;  2HHX A;  1NK9 A;  4OIX A;  3VGV A;  4K4X A;  4LSZ B;  4WYW A;  4BS2 A;  4HT5 A;  2WTF A;  4X65 F;  3DRY A;  2CDQ A;  1WOS A;  1DJ0 A;  3CCQ S;  3CD5 A;  5GAE I;  1RTD B;  4XPE A;  1FDB A;  1OIA A;  1H73 A;  2JOQ A;  1SC1 B;  2Y9H A;  2Q43 A;  2H1Y A;  4DL6 A;  3VAH A;  3MOJ B;  3PR4 A;  4ZHR B;  1SC3 B;  4ZVT B;  3UCG A;  2HHH J;  5L38 A;  1B7Y B;  3SCL E;  4NRT A;  2V63 A;  4MK9 A;  1X5O A;  2Z2Z A;  3ISN D;  5HSP A;  4R25 A;  1WOP A;  2VDH A;  5LMN F;  4MK8 A;  3GFH A;  1FWP A;  1Q95 G;  1CUL A;  3AOC A;  3KKF A;  2WVF A;  1JNZ B;  1K47 A;  4DWI A;  1HA1 A;  2ZM6 J;  2E1P A;  2VBX A;  4CTA B;  3T6B A;  1ELO A;  2L48 A;  3PTW A;  5AT1 B;  2XO6 A;  3GPA A;  3HSG A;  1RHU B;  1RYR A;  2HQC A;  5GAD I;  2OD6 A;  2J0S D;  4DBQ A;  3GIK A;  3L7O A;  2V2V A;  2DCL A;  3KLI B;  1WHX A;  2JLE A;  3VTI A;  3H5X A;  1NJX A;  4F4A A;  3GII A;  4XK8 C;  5KFV A;  2DO0 A;  4DQS A;  1EHW A;  2Z56 B;  2GO9 A;  1RTZ A;  2R8I A;  2JDJ A;  2JHE A;  4F3M A;  3R27 A;  3K5M A;  1P1L A;  1G6B A;  1Q8L A;  1IBM F;  2BEF A;  4LF7 F;  2KT2 A;  2BAC A;  4ID8 A;  5SZT A;  5KFS A;  2QA1 A;  2EC2 A;  4J90 A;  3GZ7 A;  2KVQ E;  5HBM A;  4CLW A;  4QR0 A;  5GME A;  2LEC A;  2CQC A;  2GA7 A;  3MFI A;  2R2R A;  1DQ8 A;  2MEW A;  4PWU A;  1FJG F;  1FD2 A;  1O6X A;  5LXR A;  4FPR A;  1MMN A;  3PR5 B;  3C16 B;  3OL6 A;  2YKA A;  5U47 A;  2QL9 B;  1D09 B;  3ITH A;  2DH8 A;  3QJJ A;  1CUL B;  3EYZ A;  3L4B C;  2R7Q A;  1KOH A;  2VDI A;  2PFF B;  5DM6 Q;  5K14 A;  2R8H A;  2RH3 A;  2YPY A;  4QWA A;  1RWW B;  4QR2 A;  2ZM6 F;  2CQ3 A;  3IFE A;  1J5O A;  1KHW A;  1NDC A;  3EJM A;  4ETZ A;  1KC8 T;  4KPY A;  1FRH A;  1RT3 B;  2EK6 A;  3DRX A;  3DRS A;  4CH0 S;  3D0I E;  5CYM A;  1FER A;  5B0D A;  1U0S A;  4X4R A;  4OI4 A;  2R7U A;  2KT3 A;  5EX3 A;  4RU2 A;  3S8S A;  3M7V A;  4JV2 A;  1IR1 A;  4JBC A;  1DRZ A;  2LEA A;  4DV2 J;  2BKN A;  2OEK A;  2CNN B;  2VU5 A;  3VQT A;  1R31 A;  1AXQ A;  4L3N A;  3UDE A;  3M05 A;  1U09 A;  1RWP B;  5D78 A;  4GKK F;  1S72 S;  1TL7 B;  2BOP A;  1UEU A;  4ZLL A;  3BGO P;  4K4T A;  4BBY A;  4PG8 A;  3HHE A;  1T7P A;  4O4R A;  3I6P A;  1UZH A;  1NCL A;  3PYD A;  1FFG B;  1XIQ A;  2FY8 A;  2RRA A;  2P5V A;  1NJW A;  3EZ5 A;  3DMJ A;  1CJV A;  3L95 X;  3S7R A;  2ILY A;  3QGH A;  5H9E J;  4NML A;  2MZ1 A;  4LMZ A;  2XMJ A;  1IKV A;  1PBA A;  3MMJ A;  2QLX A;  1HHT P;  2E1M C;  3BGR B;  5ETL A;  1EKS A;  1FX4 A;  2RQ4 A;  2IRU A;  4K50 A;  2E7V A;  2W7A A;  1FDD A;  3QT7 A;  3PFE A;  5F0U A;  3CTR A;  1S0M A;  3V81 B;  3TX8 A;  3G4S S;  1REG X;  5ETT A;  2KYZ A;  4HYK A;  4DG1 A;  1RLC L;  1WNE A;  2Z2Y B;  5K14 B;  1QAI A;  1X4D A;  2IYG A;  1W25 A;  2CJ9 A;  4QPX A;  1NKB A;  3MM9 A;  4PKD B;  1J5O B;  2K2P A;  2WVE A;  3W7B A;  1QAX A;  3HFV A;  4DV7 J;  2M8H A;  2DR5 A;  1H98 A;  1NME B;  3N9U C;  2KT5 A;  5CYM B;  3E3X A;  3OVS A;  5A6P A;  4P7T A;  5K8O A;  4RWX A;  4KPC A;  2G1H A;  2LXU A;  3SZ2 A;  1N54 B;  2MB0 B;  3LGH A;  2NXE A;  4PPZ A;  1TKT A;  3PEJ A;  2BYC A;  1U49 A;  4CM0 A;  2UV8 A;  1T9X A;  3LF0 A;  4FYV B;  3MMA A;  2E5I A;  3MGJ A;  4QU6 A;  2Z8Q A;  3NCP A;  3QZ7 A;  4UTG A;  1VK3 A;  3UNG C;  1RAG B;  4DV1 F;  3G6X A;  3OTD A;  2DR6 A;  2CPX A;  1MN9 A;  3M1V B;  2QTW A;  1YZ6 A;  4DPX A;  1JLB A;  4ZLN A;  1MW7 A;  3THP A;  2RRB A;  4QWC A;  5KFN A;  4NLD A;  1S6O A;  3QGG A;  1HW8 A;  1YDL A;  4LQ3 A;  2HS0 A;  1LFP A;  3Q8Q B;  1BMQ B;  3OJU A;  2HZA A;  3R5J B;  2KO1 A;  3J7Y U;  3GYN A;  3BGL A;  3FNN A;  3AJ1 A;  4CNZ A;  5AXN A;  1JMT A;  1X4B A;  3GJQ B;  4EU0 A;  1EAR A;  1GTE A;  1UWB A;  4DN9 A;  3LAM A;  2R3V A;  3WQP A;  4QCL A;  2VKR A;  5F3Z A;  1WI6 A;  3NGD A;  1HQU A;  3HDS A;  5KFA A;  3G8T A;  1NKC A;  2RSQ A;  1DY3 A;  3J80 Y;  4F0M A;  1M5S A;  4C8M A;  2GO8 A;  3CDB A;  3VV2 B;  5KFJ A;  3MM9 B;  5LL6 d;  1S9G A;  1UCN A;  3CD6 S;  1NPP A;  1JWW A;  4H54 A;  3DRP A;  2G9O A;  4P6Q A;  4DR2 J;  3GFY A;  1JJ2 R;  5B7W A;  4RUC A;  2H3E B;  2LA4 A;  1XNQ J;  4LVN P;  3PO4 A;  1URN A;  4DUY F;  4N41 A;  4B02 A;  5CD4 H;  4YB7 A;  1N0U A;  3IMQ J;  1SBR A;  4OHV A;  4JV5 J;  3GIJ A;  4U7U D;  3MMA B;  3POT A;  5FDL B;  1WI8 A;  3K8W A;  3G87 A;  3F41 A;  1S0V A;  2VKZ G;  5T7L A;  3OL7 A;  5JXS A;  1EP4 A;  5I42 B;  5F8G A;  2DPJ A;  4HEA 9;  4DFJ A;  4TLR A;  2XCA A;  2V9K A;  3QYY A;  3DLH A;  5ETM A;  4ZPB A;  3V6J A;  4O44 A;  2M4M A;  3IAM 9;  3TYT A;  2CXE A;  2ZOF A;  2VFU A;  1CQN A;  1IQZ A;  1PKU A;  2VBW A;  3TQE A;  4YME A;  2DNL A;  2R7S A;  2HG4 A;  1S1X A;  2KYX A;  3P3D A;  4YEA A;  1MML A;  4DI6 A;  4LR7 A;  3OR2 A;  3TJA A;  4JI5 J;  3OSP A;  2W4P A;  5JVH Q;  3ZZ0 A;  3HFK A;  2V4J A;  3GYG A;  5E33 A;  4ED8 A;  1BWE A;  1UWB B;  4PXC A;  3H90 A;  4LIR A;  2KKH A;  1HQU B;  3TNV A;  4OHX A;  2FD2 A;  3MR2 A;  4I4B A;  2GVD A;  1LOU A;  3JSR A;  3O6Q A;  3OTO F;  2HAI A;  2XSJ A;  1TV6 B;  1S9G B;  4KQZ A;  1N34 J;  2HEK A;  4DQP A;  2NSC A;  5KFU A;  1L3T A;  1GMW D;  1KBR A;  3ILL A;  2DRA A;  4DR4 F;  2M8D B;  3OTE A;  3HMJ G;  4KC5 A;  4CLS A;  2FYX A;  2MGZ A;  1XNQ F;  3NY0 A;  2F9D A;  2XEX A;  4WYL A;  3AY0 A;  4NLQ A;  4ECZ A;  1QUV A;  1EIY B;  2EG1 A;  3POT B;  3VQS A;  1SUQ B;  4DUZ F;  4BWM A;  3R2C J;  3GON A;  5T7L B;  1AT1 B;  1EP4 B;  1RAH B;  4M95 A;  3X1L B;  4HKQ A;  1CJU B;  1FNO A;  1XN9 A;  3G6V A;  5A8K B;  1G7C B;  2EG2 A;  2XI3 A;  5F8L A;  1ZZN A;  3OXF A;  3CO9 A;  2EK1 A;  1Q7Y T;  1WC1 A;  3M6W A;  1IVZ A;  1S5Z A;  1S1X B;  4CWB A;  3NNH A;  2VC1 A;  2B56 A;  2ATL A;  4YQW A;  4X2B A;  1X9W A;  1SKW A;  2QSW A;  2M52 A;  4DZD A;  1K44 A;  2K06 A;  2VBZ A;  3TQ1 A;  3KK3 A;  4JI5 F;  3FVY A;  3TAQ A;  1UVM A;  2LVW A;  1FX2 A;  3H98 A;  2ZDP A;  5KT2 A;  2ZBP A;  5A76 A;  3K58 A;  1U47 A;  2W25 A;  1MWY A;  4WJB A;  4KGZ B;  3M2V A;  1UA1 A;  2GVD B;  4H4M A;  4F8R A;  4A46 A;  3IO1 A;  2RVJ A;  3G86 A;  1N34 F;  2CPJ A;  2M0G B;  2ZH4 A;  2MJN A;  1R6V A;  2A1B A;  2GZO A;  2DGU A;  3ZZT A;  5KT3 A;  1Y10 A;  1UWA A;  3KDN A;  2MGZ B;  1U1M A;  4F0H A;  1TMJ A;  3MM5 A;  3C3L A;  3Q89 A;  1CJT A;  2AHO B;  4CRJ A;  2FHM A;  2F8H A;  3QT6 A;  1QTM A;  2E5J A;  4ZCM A;  2CWX A;  2DY9 A;  3CIM A;  4QIV A;  5HI7 A;  1ZA2 B;  4USW A;  4DX6 A;  3CJ0 A;  2XZT B;  3CMA S;  2VFS A;  2VIC A;  1VK8 A;  3WC2 A;  4OX7 A;  2DO4 A;  2KVI A;  4P72 A;  4X66 J;  4NA1 A;  2V8P A;  3N28 A;  2FGC A;  1OY6 A;  2DIS A;  4DX8 H;  3W5Z A;  3T6J A;  3CCJ S;  4FF4 A;  4NCG A;  3UDV A;  2OAU A;  2NSB A;  4AT1 B;  3T1H F;  4C6A A;  4WFB Q;  2G2O A;  1NK4 A;  3UCZ P;  2CQH A;  3IWX A;  1NSQ A;  2R42 A;  5LJ3 Y;  4J7C A;  2HVZ A;  1OQ6 A;  2MLZ A;  2BXJ A;  2J7W A;  3SI8 A;  2AGP A;  3W64 A;  1TTH B;  4OJ1 A;  1HNV B;  3NOG A;  3CNQ P;  2PN6 A;  2QX0 A;  2X1B A;  4RBU A;  2JH3 A;  4JYA F;  1KWM A;  2UZA A;  2GFF A;  3VGS A;  3LPY A;  4H4M B;  4IG0 A;  3CCE S;  1FT8 A;  3QT8 A;  3PW4 A;  2RHQ B;  4DSE A;  1XK8 A;  4C0O C;  2V5H G;  1HAR A;  4YFU A;  1DUR A;  2KI2 A;  2RQM A;  4X4O A;  1WD6 A;  4YDD B;  2QRR A;  4IH7 A;  1GMW A;  2RS8 A;  2HNY A;  5KFI A;  2HWT A;  2XY5 A;  3A8I A;  3M8R A;  2CAJ A;  4ZIW A;  1CJT B;  2Z4P A;  1BQX A;  3FZ2 A;  2IMW P;  2ZFH A;  2DT9 A;  2C3P A;  3T5H A;  1NXI A;  3OJS A;  5DQG A;  1SH2 A;  2ZH2 A;  3DN9 A;  1LWX A;  4ECS A;  2XY7 A;  1TKZ A;  3UQS A;  3KXD A;  4X66 F;  3MCM A;  1R8A A;  3W2V A;  4N8N A;  4P2S A;  2N4D A;  3DNC A;  3E01 B;  3K5N A;  3SQG A;  1NB7 A;  2COL A;  2IDE A;  1LKZ A;  1GX5 A;  3HSJ A;  4KJI A;  4U6P A;  4X62 J;  2I5J A;  3I56 S;  2MHN A;  4NCG B;  3QID A;  2MTL A;  4GO7 X;  3WZ0 A;  2W2O P;  1LV5 A;  2BJ1 A;  2WVC A;  3UD5 A;  4ES1 A;  3QFH A;  2X1A A;  4CO4 A;  3C19 A;  4KKO A;  4JI6 F;  1XMO J;  2FHO B;  2HMI B;  1N32 F;  1CPZ A;  1N88 A;  5KG6 A;  2HHP A;  2J9E A;  4ZVE A;  2X3D A;  4OJG A;  2ZH7 A;  4UOF A;  3P6Y C;  3SV4 A;  3NXZ A;  2HQI A;  5DG9 A;  1R8B A;  4DLE A;  3A3O B;  4OX9 J;  1S1T B;  2PEB A;  4RNF A;  2UXD J;  3Q8Y A;  2YY3 A;  1DAR A;  4RW7 A;  4WXW A;  2JC1 A;  1PO6 A;  2A18 A;  4WK1 A;  4ZKA A;  1O8B A;  1SQF A;  4AXI A;  4W4M A;  2YWK A;  2VZ9 A;  3QAT A;  1ZTW A;  4ZPC A;  5DET A;  3P4U B;  4ZJO A;  4F04 B;  1WF0 A;  1Q5V A;  1RTJ B;  2BJD A;  4R0J A;  5I3Q A;  4P2F A;  1QE1 B;  3I0S A;  1OSC A;  2HNY B;  2R7V A;  3PYE A;  1JJC B;  3O3L A;  4K4S A;  3JTP A;  1T8E A;  2B43 A;  5A8W B;  4FF3 A;  4OV6 A;  4TXS A;  1ZAW A;  1YJR A;  2FLN A;  3NLC A;  5DO2 A;  2D9P A;  3BYP A;  2FVS A;  3ILI A;  4LRF A;  2R8J A;  2GW8 A;  4J9O A;  4V19 X;  4WIQ A;  1DAX A;  3TUZ C;  3UPF A;  1KNZ A;  4RLE A;  2NXC A;  4DS5 A;  1EAY C;  3NNA A;  2ZD1 A;  2ZVI A;  4YY3 F;  1AA1 B;  1TKZ B;  2DXF A;  1KN6 A;  2GQQ A;  4EZ9 A;  1F5C A;  3W2V B;  4E0D A;  3DDN A;  3FSY A;  5DM7 Q;  1FFW B;  2ACY A;  3D4J A;  2X51 A;  3RGI A;  1EJ7 L;  5D4O A;  4OZ1 A;  4RNN A;  5ETP A;  2QMX A;  2ROE A;  1WC5 A;  1RAB B;  1E6Y B;  3BN7 A;  3CCW A;  4B3T F;  3P49 B;  2HHT A;  3THT A;  2VFT A;  3ZTS A;  1HBO A;  1FEE A;  4DEZ A;  3W2W A;  2HVH A;  2JRS A;  2W7O A;  2JEI A;  1UFW A;  4ZP6 A;  2K7K A;  3R5B A;  3L7P A;  2UU9 F;  4KAI A;  5E5N A;  3MM7 A;  4KKO B;  4Y0F A;  1S6P A;  1XMO F;  2H4W B;  1RWX B;  2PMZ D;  4OYW A;  3MOZ A;  1YTY A;  1X4H A;  2K1R A;  5GAG I;  1TAQ A;  4O3N A;  2W4C A;  5KFG A;  4ELU A;  2RIJ A;  3AOA A;  3TUP A;  2H54 B;  2YKP A;  3QNW B;  4MIW A;  4OZL A;  3KWM A;  3T9Z A;  1WC4 A;  4ZLP A;  4RW7 B;  3KJF B;  4NZ6 A;  1D9F A;  5IOL A;  3H2V E;  2P6T A;  1S9F A;  2YBV A;  3EZU A;  3U1L A;  1JJH A;  4LF9 J;  1E6V A;  4LF6 F;  3HVR A;  2JEJ A;  3K8V A;  2MMY A;  3M2R A;  5KFT A;  3I5A A;  1FA0 A;  1FRX A;  4OI2 A;  1X4A A;  4B3S F;  2DR9 A;  4DR7 J;  2I8E A;  3R97 A;  4NX9 A;  1YI2 S;  2ATC B;  2X3G A;  3QGI A;  3DOK A;  4NCA A;  2OD4 A;  3OTB A;  5HMX A;  2J8S A;  3AXK A;  4QYZ K;  3SCJ E;  3M4X A;  3IBW A;  4M5L A;  4M5D A;  1DTQ A;  4OYO A;  1SXL A;  1Q78 A;  2J7U A;  2ZD1 B;  3BSA A;  3O5T B;  3H8Y A;  5F9L A;  1BE4 A;  2MST A;  5CHC B;  4WBF A;  2CJK A;  2HFS A;  1D9D A;  3MR6 A;  2B7C B;  2LU1 A;  1RJJ A;  3CCZ A;  4FXV A;  3UN3 A;  3MEC B;  4DPT A;  5GAH I;  4ED6 A;  5CAB A;  3IS9 A;  1VJQ A;  2VQE J;  5CH7 B;  3A13 A;  2ZBI A;  5IFM A;  2MKJ A;  2DCU B;  4ICL A;  1RIS A;  1LXJ A;  2D3Z A;  5DS7 A;  3SSQ A;  3W2W B;  3KLG B;  1HPZ A;  3ICL A;  2XS2 A;  4I0W A;  3FSI A;  4L72 B;  4YP3 A;  2AIR B;  3MM7 B;  3U1M A;  1ZAV A;  2VH7 A;  1CLF A;  1U1R A;  5F8H A;  2ZWP A;  4MKV A;  4CO0 A;  4AQY F;  2VFV A;  3OT9 A;  4ZVS B;  3M32 A;  1LW0 B;  3ZZR A;  3LTO A;  5H9F K;  2BV3 A;  2WOM B;  4MKB A;  5A2Q U;  2DNH A;  1HD0 A;  1IM4 A;  2OPR A;  5D0R A;  2YX1 A;  2O01 C;  1FEH A;  1WAC A;  3JQJ A;  2XNR A;  1APS A;  2BW2 A;  5KG0 A;  3TUI C;  1E6V B;  4LF9 F;  1YRX A;  1RHQ B;  3ENV A;  2FJB B;  3IAS 9;  5FII A;  2B8Q A;  4O4G A;  3M2R B;  2M3D A;  3T1A A;  2KM8 B;  5A0Y A;  2F8E X;  2NRE A;  2YWF A;  4LF5 J;  3TP2 A;  2G4B A;  1HNX F;  2AGQ A;  2AQ4 A;  2YKN A;  3FFI A;  2GAH C;  1YZ7 A;  2WON A;  9RUB A;  1OQ3 A;  4HDH A;  3TA0 A;  2I38 A;  4JI2 F;  1HWU A;  1Y4Z B;  5E2Q A;  3MWB A;  2MY8 A;  4M5D B;  1UVJ A;  1DTQ B;  2PEH A;  2NZC A;  5F3T A;  1X4F A;  1J2V A;  4RW8 A;  4QJV A;  4DHV A;  1PAE X;  4KTQ A;  3SIP B;  3UDL A;  1XNR J;  3MEE B;  4NEY A;  2OLW A;  3T9N A;  1YIJ S;  1U1L A;  3QT5 A;  2WSC C;  2I6W A;  1RT2 B;  3IS9 B;  2B3T B;  2FLP A;  3AB4 B;  4OYM A;  1RBO B;  4U8V A;  4CT8 A;  3AJ2 A;  4ZJQ A;  3I55 S;  3CCV S;  3PJ9 A;  2P9C A;  4ZCL A;  2HBZ B;  4RL1 A;  4C0H A;  4IRD A;  2VG6 A;  1UP1 A;  4FVC A;  1HYS A;  5CZX A;  4ZVG A;  4K7Q A;  5DDP C;  5AXM A;  3NBP A;  3CJR A;  2DNR A;  3MUR P;  3CT9 A;  3GV7 B;  3D5M A;  2CPZ A;  2V8H A;  1QLN A;  3MM8 A;  4RW6 B;  2VF3 A;  2CVE A;  1FJE B;  2OPS B;  5L1L A;  4FF2 A;  3QJP A;  4ZP7 A;  2PII A;  3WX4 A;  3UDC A;  1T94 A;  3N01 A;  2XTJ P;  4EYI B;  2XYP B;  4WE1 A;  1GT8 A;  2CPF A;  2KH9 A;  3CCU S;  3B78 A;  3SQO P;  4CLF A;  4CT9 A;  3OV7 A;  2R7O A;  3BDP A;  4X4U A;  1WOO A;  5K5M A;  1H72 C;  1TQL A;  2QT7 A;  2HBR B;  3UR3 C;  3FBB A;  2BAN A;  2QA2 A;  4F50 A;  4JB8 B;  1NH7 A;  3MD1 A;  4NEZ A;  3HM9 A;  3KHR A;  1PYS B;  2ZH1 A;  3IR6 B;  2VPX B;  2MQN A;  1RWN B;  4AFF A;  2W2Q P;  3TA1 A;  1IQT A;  5D15 A;  1RKI A;  1NJY A;  3O44 A;  5E3R A;  5HLF B;  3NOC A;  2HFO A;  2RML A;  4RUB A;  5A0Y B;  5KFO A;  4A8S A;  4B3M J;  4Z7Y A;  3Q8P B;  2OEM A;  1Y5I B;  1H3D A;  4ES2 A;  5FJ4 A;  1N5V A;  4X4T A;  2WON B;  2ERR A;  2ADC A;  5KG5 A;  3MHY A;  1FES A;  2FVP A;  2HVD A;  2NZ4 A;  4HL9 A;  3V5R A;  1BD6 A;  5HMZ A;  2IVF B;  1ZTT A;  2LYV A;  1RT6 A;  3D9B A;  2WVB A;  4RW8 B;  1GH8 A;  4KGK A;  5KFX A;  4V1A k;  2OHD A;  3TAP A;  1XNR F;  2EKY A;  3BZQ A;  3GYX B;  3O8W A;  1A7G E;  3FKB A;  2M88 A;  2ZDO A;  2R7X A;  4DQQ A;  1O0P A;  1RAD B;  8RUC A;  1UMJ A;  3JB9 k;  1Q5Y A;  5DDQ C;  3TI0 A;  3MFH A;  2ZNZ A;  3HHL B;  1F9E B;  1H2U X;  1HYS B;  3BB5 A;  4TQR A;  3NBP B;  2PD1 A;  1TEL A;  3DRR A;  2QIF A;  4GKJ J;  2GGP A;  3KJQ B;  3G2X A;  6FD1 A;  4A8M P;  3MM8 B;  4EWT A;  2C2K B;  3DGV A;  3ONQ A;  1L5U A;  1T9W A;  4DPU A;  2MHE A;  4HH1 A;  1GXT A;  1SJ3 P;  3ZXW A;  5JMN A;  4WE1 B;  4YHH J;  3SXL A;  2VIH A;  1SIZ A;  1X5S A;  2QL5 B;  2VL1 A;  3LWM A;  2GVZ B;  9ATC B;  1N52 B;  2EBE A;  2AJ2 A;  2BAN B;  1U1P A;  3M6X A;  3DGP A;  5D0H A;  3AA8 A;  4HH0 A;  1JLC A;  3ZTQ A;  4ERD A;  3LUY A;  2MKI A;  5GMK a;  2UUA J;  4OX6 A;  3P5T L;  3CC2 S;  4CO5 A;  4DFP A;  2ZJP Q;  3FRZ A;  1S97 A;  2UV8 G;  1JX4 A;  2FDN A;  1RU2 A;  3GCW P;  1FK9 A;  4P2X A;  1RWM B;  4KE5 A;  2CJX B;  3UD4 P;  2HQ3 A;  2KG1 A;  5KOX A;  3DXB A;  1YJ7 A;  2AX1 A;  1YJU A;  1IKW B;  4FN5 A;  3CCS S;  4K2J A;  1XER A;  1KR4 A;  5HK4 A;  2MZQ A;  2PDA A;  4NLG A;  4HDG A;  1RT6 B;  3HO1 A;  2Y0S D;  1NZA A;  3P5B P;  2EFG A;  3G8S A;  2MPU A;  4M5G A;  1YJN S;  1T02 A;  3GU0 A;  2Z30 B;  5IT0 A;  4LF1 A;  4B3R F;  3W63 A;  1SQE A;  5HO4 A;  2VD3 A;  4C11 B;  2BQ3 A;  2UUC F;  2HHQ A;  3BKF A;  1HQE A;  1FJC A;  1M5H A;  4J9V A;  5KFM A;  3FEY B;  3J7Z 5;  1BQN B;  4YR0 A;  3DRR B;  2Q66 A;  4C3K A;  2GGP B;  3GWC A;  4CLY A;  2MLX A;  3AD9 C;  1FNX H;  3DLG A;  4J9U E;  4O3P A;  2UXC J;  3Q24 A;  2VOP A;  4RNO A;  3CCM S;  5KT5 A;  4M5N A;  1RK8 A;  1DLO B;  2E1A A;  1V9O A;  1JIH A;  4DMZ A;  1Q82 T;  3D54 A;  5HN0 A;  4JOU A;  4XDC A;  3B4D A;  3Q0A A;  2E66 A;  1JLC B;  4UST A;  3M9N B;  2UUA F;  3MUT P;  3GIL A;  4FZV A;  1TU0 B;  1Y9O A;  4UOC A;  1KQS R;  2G0C A;  5MLC V;  3W60 A;  3GV8 B;  1SCJ B;  3PRB A;  2ZHO A;  1I1G A;  4K4W A;  4Y2I A;  1FTR A;  2Q1L A;  3D0H E;  3CDA A;  3HHN B;  2GIF A;  1NKE A;  3DLE A;  4L73 A;  3FUY A;  1HNZ F;  4CDI A;  3R5C A;  3JTN A;  2CPH A;  2DGO A;  4KY3 A;  4UUX A;  3HKZ D;  5J2P B;  3PG9 A;  3A3N B;  3GJT B;  4B9U A;  1X5P A;  3I4H X;  2W24 A;  2XBP A;  3OPK A;  3EVM A;  1VQP S;  4FPI A;  3Q2T C;  3UR0 A;  1J5E F;  2NCK L;  1HQE B;  1SPB P;  1JJ4 A;  3HVT A;  3RBX A;  2HKE A;  1VQM S;  3SBM A;  5IV3 A;  1AFI A;  2LQ9 A;  3LAN A;  2QE5 A;  1OPZ A;  4ZIV A;  3ZZY A;  4CYU A;  2HND A;  2QMW A;  3DLG B;  3BQ0 A;  1KSP A;  2DEI A;  3HHK A;  4I6Y A;  3MDF A;  3W5Y A;  2GJ2 A;  4R8U A;  4QPT A;  1SV5 A;  5K9F A;  2CNL B;  2EVZ A;  2BVZ A;  4K59 A;  1GTH A;  4QIG A;  3PW0 A;  5KFK A;  4N76 A;  4NLO A;  2W9C A;  4J9R A;  4DPO A;  3ZZZ A;  3M9M B;  2YX7 A;  5A2Q Y;  4ECT A;  2AEM A;  5HAT A;  1VBY A;  2MKK A;  1NJI T;  3PX0 A;  4RR5 A;  3LA0 A;  1XWL A;  2DBB A;  2AMC B;  5D0E A;  3SMZ A;  4DFM A;  1S49 A;  5D77 A;  2BM1 A;  4B3O B;  2JL9 A;  2AW0 A;  3AOD A;  2PO4 A;  2A6M A;  2AYG A;  2HGL A;  3MMC A;  3CED A;  2E5G A;  1RTH A;  3W5X A;  4TU9 A;  2B51 A;  3HD1 A;  4Z7C A;  3AAW B;  3VWS A;  4GC6 A;  3GMG A;  2QMU B;  2BE7 D;  4URG A;  2R7T A;  1V3R A;  2X1F A;  1MMD A;  5IC4 B;  1C4A A;  2AYE A;  4PG5 A;  4MYU A;  2C22 A;  3CJQ A;  1KS2 A;  3EX7 B;  5LJ5 Y;  1YLX A;  1SB6 A;  4TU7 A;  4N7T A;  1Q81 T;  2RQC A;  1NBE B;  5GVQ A;  2XB2 D;  4IH6 A;  2H9Z A;  1WHY A;  3Q22 A;  3TJ9 A;  1HR0 J;  3BQ1 A;  1TL3 B;  5T14 A;  4KHP F;  3D6H B;  3K59 A;  1H2T Z;  3H4D A;  2FQQ B;  1Z2L A;  2AWZ A;  3GV5 B;  2A2D A;  5CYQ A;  2L9D A;  4ENO A;  3A4T A;  4EO8 A;  1UFL A;  1FXD A;  4Q5V A;  2OEL A;  4DU7 A;  1DHM A;  3FZB A;  5LM7 E;  3E8O A;  4Y2K A;  3Q86 A;  4PWD A;  1C1B B;  1VBK A;  1WC3 A;  2HND B;  2RS2 A;  3K89 A;  2HK2 A;  4DN0 A;  1BGX T;  1M1G A;  3IBF B;  4I68 A;  1KHV A;  3CJK A;  7AT1 B;  1YJ9 S;  1U24 A;  3AH6 A;  2ZZT A;  1WWH A;  1S6Q A;  4R8U B;  3W9J A;  2AF6 A;  1KON A;  4B17 A;  5F8I A;  3QSY B;  1YSJ A;  2BRK A;  2HQG A;  2W9C B;  4Y3C A;  4LJM A;  4M5I A;  3CC7 S;  2KU7 A;  3VF0 B;  3IG1 A;  2FY1 A;  1NB2 A;  1YK9 A;  1GMU A;  1VQ4 S;  5BYR A;  4UZC A;  1MNE A;  1KQK A;  2HS4 A;  5CD4 A;  2CJB A;  5BXI A;  5ETK A;  4RNH A;  1UL3 A;  3CPW R;  2EXU A;  4RBV A;  3MMC B;  3EZO A;  2C2E A;  4X64 J;  1RTH B;  4DF8 A;  4DU8 A;  2FHK A;  2EW9 A;  3MUV P;  2C2N A;  2YVS A;  1FD8 A;  2D1C A;  4A8Q A;  3EGN A;  3DLK B;  1XR5 A;  5HJX A;  3TAM A;  1N8R T;  2RU3 A;  2PMW A;  3OFH A;  5BJR A;  1PC5 A;  3AB2 B;  2DPI A;  4MIA A;  3H2L A;  4OZJ A;  2AEJ A;  4OZ2 A;  2MQQ A;  2E5H A;  2U2F A;  4FKY A;  4JV0 A;  3JQK A;  2K3K A;  4WFX A;  3C8Y A;  2C28 A;  3ZNJ 1;  2OH2 A;  3PDN A;  4NLT A;  4JI0 F;  4NZ0 A;  1F9H A;  1C4C A;  1MRO B;  4N77 A;  2MY7 A;  5CYQ B;  1Y5N B;  2POK A;  3IBC B;  3KLH A;  3TEH B;  5GAE U;  2QG9 B;  2CVI A;  1KLM A;  2BW7 A;  3H5U A;  5L9N A;  3DHW C;  4JI3 J;  1WEX A;  4CLL A;  2EFQ A;  2L3M A;  3P96 A;  4F02 A;  1JLA A;  4ER8 A;  3HFZ B;  3EVO A;  1AZS B;  1H0H B;  3M6V A;  3WHI A;  1XR7 A;  1RI7 A;  1WG4 A;  4XAK A;  2B6A B;  5KT7 A;  3FC9 A;  2CJA A;  2WCX A;  3M30 A;  1Y7P A;  3NCQ A;  2RU9 A;  3LP2 B;  4A47 A;  3WIU A;  4L76 A;  3J81 U;  4EBD A;  3VR1 A;  2F8M A;  1B70 B;  2IJR A;  2J9D A;  3CVK A;  4IH5 A;  1RLD A;  3M8Y A;  5GAD U;  3W1Y C;  1W2I A;  1OYD A;  3OQ2 A;  2JNJ A;  1HWL A;  4QIF A;  4FVM A;  5D4L A;  2D69 A;  1DFD A;  1MU2 A;  1F5B A;  1VRQ C;  4BLG A;  4LFB F;  3NGS A;  2CJY B;  4DS4 A;  4C8Y A;  2IJF A;  2IVM A;  3TAM B;  3CJ3 A;  5J2Q A;  4ZPA A;  2DHA A;  4LF8 J;  1TL1 B;  1LW2 A;  1U02 A;  3G9C A;  4NMX A;  2XS7 A;  2MLY A;  4LR9 A;  3B4M A;  4ILL A;  4IDK A;  3BR8 A;  4JI7 J;  2N4C A;  4UQG A;  1LWC A;  1KQG B;  2V68 A;  4Q44 A;  4KGX B;  1BUX A;  3CUN A;  3KG1 A;  5IZH A;  2BBE A;  2H5I B;  3KLH B;  3BGU A;  2NXN A;  3I96 A;  1RTD A;  3R3T A;  1WF1 A;  2F1F A;  5IS2 A;  2MJU A;  2KZM A;  1KLM B;  3VGU A;  4Y00 A;  2PI5 A;  2JVR A;  5EDW A;  4CO2 A;  2LDY A;  3GE9 A;  4U9R A;  1D3W A;  1RDR A;  5LOQ A;  3EMT A;  1JLA B;  3K2Y A;  3G71 S;  3BSO A;  3VAF A;  1EET B;  5C42 B;  2BX6 A;  2X1G A;  4FP9 A;  5DG7 A;  4X4V A;  2C2Z B;  3ZZU A;  4LIW A;  3NS7 B;  3V6H A;  4W92 B;  1FRM A;  2V34 A;  4ANE A;  3CDE A;  3PCO B;  2ZH5 A;  4MYT A;  1WF2 A;  4CTA A;  3BSN A;  2KN4 A;  1H2V Z;  3OD2 A;  4ILM A;  4IQX A;  1BWV A;  2VUG A;  1YBA A;  1GXU A;  3IWN C;  4RBT A;  4ETX A;  4C3M A;  2H51 B;  4IRC A;  2O66 A;  2V67 A;  1NPK A;  5F8N A;  4OZ3 A;  1N5Y A;  3D66 A;  4CLK A;  3MPV A;  4DV5 F;  4C48 A;  4HT7 A;  5FLX U;  4DCP B;  1MU2 B;  3T3F A;  4OZ0 A;  1VC6 A;  3J7A N;  2LXF A;  3M2U B;  1B0P A;  5E7O B;  1GEH A;  2VPY B;  4DDF A;  2NPF A;  3CCT A;  5J2Q B;  3H20 A;  4DQI A;  2QFJ A;  2Z58 B;  4A8W A;  1LW2 B;  2K3I A;  4JP8 A;  3MCS A;  3WX8 A;  4UF4 A;  4YB6 A;  2RRN A;  5J1E B;  2AKW B;  3CJ8 A;  3RAX A;  4OI6 A;  3RTV A;  2IRY A;  2WSE C;  2FZG B;  3B8H A;  3JXO A;  1LWE A;  2WBM A;  1V5V A;  1LWC B;  3JQM A;  2KRB A;  2O5D A;  4ED5 A;  2VC0 A;  1Y00 A;  1QVG R;  1YJV A;  4L75 A;  1KQF B;  2GIR A;  2VJV A;  5KFY A;  2QLB B;  1PJ7 A;  1OY9 A;  3BKU A;  2B4P A;  4URS A;  3C16 A;  2HUR A;  5EUH A;  4IKA A;  1TR0 A;  5D4P A;  2PSZ A;  2HFZ A;  2E5L J;  3PX6 A;  2BQR A;  2GHP A;  3TEG A;  3QRR A;  1S9E A;  4JI1 F;  4AUK A;  3PFO A;  4DV6 F;  5EWF A;  3FJ2 A;  3IR7 B;  2YWW A;  2OIH A;  3H5S A;  1RQ0 A;  4CP5 A;  3OHA A;  4GO5 X;  1F6T A;  2W01 A;  1QSS A;  4F0K A;  2Y8Y A;  2LA6 A;  2AU0 A;  4RX6 A;  3WDO A;  1H6K X;  2XSF A;  4CM2 A;  3IXQ A;  1M0S A;  1RT3 A;  5HJY A;  1MLA A;  1IBK F;  4BCA A;  4DF4 A;  3ZTR A;  2Z57 B;  1VIS A;  1N5Y B;  2ZKT A;  4DR1 J;  4B08 A;  3MCO A;  2WZ1 A;  4NXN J;  1H38 A;  5AXK A;  3HHL C;  1LNQ A;  3GLJ A;  4CLZ A;  1FRK A;  4OYX A;  2IMO A;  2BJ8 A;  3JAM U;  1WEZ A;  3OUY A;  5AE2 A;  2GV1 A;  3C66 A;  2OP5 A;  1IJF B;  5HQM A;  3G82 B;  3QRQ A;  2XLJ A;  5H9E K;  4DR5 J;  2CPI A;  2OML A;  4RW4 A;  1TL7 A;  2DVI A;  2W9B A;  4DR6 J;  3O1L A;  3OTC A;  3SCI E;  1VQ7 S;  3K5O A;  3PHT A;  3PKY A;  4AD6 A;  5LSR A;  5LMU J;  3CSK A;  3KLE A;  2GX8 A;  3FRY A;  3ETM A;  5IT9 Y;  5K20 B;  3L3C A;  1B4S A;  1LWE B;  3MAA B;  2FVQ A;  3IRX A;  2KFY A;  1FWL A;  4I56 A;  2JFD A;  2BJ9 A;  4NOH A;  3IRW P;  4ECW A;  1HQ2 A;  2Q79 A;  4C9D A;  3QPI A;  1ZM2 A;  1AW0 A;  4I64 A;  3BGR A;  5E0O A;  1OY8 A;  4K4V A;  5F0W A;  1FF2 A;  3LP1 A;  2CA9 A;  2C3O A;  2P9E A;  2EFN A;  3EM1 A;  2DIV A;  3C46 A;  4C8Z A;  2F4V J;  1OWX A;  2HHH F;  1TP7 A;  1YIT S;  5C7P A;  1RE1 B;  3EDQ B;  4EUV A;  1S9E B;  4Z37 A;  3V81 A;  3NAI A;  4DV4 J;  4FDF A;  4USM A;  3NGK A;  2BJE A;  1SL0 A;  2HS3 A;  1N48 A;  1B0V A;  2KHC A;  4CLU A;  1UJ5 A;  2B7B B;  1X0P A;  1K0T A;  4EK2 A;  2IJN A;  1YKW A;  4HVZ A;  4L3K A;  5C24 B;  1UW4 A;  2J0Q D;  4QWD A;  4ZP8 A;  4WXO A;  4GVB A;  1O5J A;  3HK2 A;  3R7N B;  2ZC4 A;  3CO0 P;  4KH1 B;  3CGI A;  1OJ4 A;  1OO0 B;  5ITH A;  4IUF A;  2XS5 A;  1JQG A;  1N6Q A;  3OUY B;  4DJB A;  1VLO A;  1G4C A;  4C97 A;  4IO1 A;  4JI4 J;  2QLW A;  3N5B A;  2N82 B;  3GJS B;  3MEG A;  1VGY A;  3VZH A;  4DR5 F;  3KFW X;  3TZZ A;  4RW4 B;  4FYW B;  2W9B B;  5IWA J;  2W2N P;  4DR6 F;  4WFZ A;  3NS5 A;  3RW6 A;  4RZR A;  3KLE B;  3M1V A;  5LMU F;  4QBU A;  3HSD A;  4LFC J;  1C0T B;  2XZW A;  1M5V C;  5A6W A;  1B0T A;  4OX8 A;  2BMB A;  3IRX B;  2M7S A;  3J7Z T;  1S4F A;  1VJW A;  5KG4 A;  5K8N A;  2L9W A;  4MTP A;  1NUE A;  5M2U A;  2YNH B;  2ZH3 A;  3K5P A;  2ACM A;  3HHD A;  2FJE B;  3L09 A;  4ZS6 A;  2KL8 A;  3LP1 B;  4XDD A;  1S1U A;  1PGZ A;  1QDU B;  1ZM4 A;  2F5G A;  4HAC A;  2AV5 A;  2BJ7 A;  5T41 A;  2MZS A;  2F4V F;  3PJW A;  3C6U B;  1FNM A;  4KHR A;  2VG7 B;  3QBC A;  4DSK A;  5L39 A;  4G3I A;  1AB8 A;  4DV4 F;  2CQ2 A;  2DXE A;  2CG8 A;  4YR2 A;  2V8G A;  3KTQ A;  5HVG A;  1N36 J;  2E9T A;  4F7V A;  4F4K A;  4B9L A;  3LAK A;  4PPD A;  2ZJQ Q;  2YKM A;  3VAG A;  1VQN S;  4U67 Q;  1Y0H A;  1FKO A;  4M94 A;  3FGV A;  1S4E A;  3G8Q A;  4A8X A;  3CCL S;  1B99 A;  3BO4 A;  4GVB B;  2GC8 A;  3Q23 A;  3RZA A;  1H74 A;  4PG6 A;  2NLW A;  3TAR A;  1S57 A;  4U8Y A;  5IQ6 A;  2F3J A;  4PZV A;  3EE3 A;  4DV2 F;  2DGW A;  2ABY A;  1N6Q B;  1K73 T;  1VRU A;  5FDL A;  2IC3 B;  2W2M P;  3FEZ A;  1TKX A;  3MEG B;  2UUT A;  2L41 A;  4NI2 A;  4ED7 A;  3JTO A;  2B9E A;  2OI2 A;  4YR3 A;  5D3G B;  1ZET A;  4URQ U;  5I42 A;  1L3S A;  1MWZ A;  2ZNY A;  1R0C B;  2HZC A;  3W8G A;  3MF5 A;  3NP5 A;  3EXY A;  4ELT A;  4C8K A;  2DYA A;  4ZK7 M;  2XMT A;  3I5C A;  3PKM A;  7FDR A;  3R1L A;  1FXR A;  4MFB B;  1RHM B;  3F0N A;  2R2U A;  2RD5 C;  2CG4 A;  1R3N A;  1N56 A;  4RKU C;  4JUZ A;  2DNN A;  1S10 A;  1RHJ B;  4USK A;  3OXG A;  3AD7 C;  1S1U B;  4HAC B;  3KHL A;  1IBL J;  3A8E A;  4USV A;  1K1Q A;  1X4G A;  4FNI A;  3DYA A;  5EWG A;  4B9V A;  4AYB D;  2PGC A;  4FYX B;  1HNI A;  4UY8 5;  3D2W A;  1ZAX A;  4HHH A;  3RB6 A;  2UUB J;  1T3N A;  3UO0 A;  1F60 B;  1RTI B;  2YKM B;  4CCH A;  1FKP B;  1FKO B;  1TV6 A;  2DHS A;  3LP0 B;  2HIY A;  2B0G A;  2GAG C;  2U1A A;  1VCT A;  4DV7 F;  1DQ9 A;  1R27 B;  4K4Z A;  3FBE A;  3OLB A;  4PXE A;  4DL7 A;  4ZMM A;  4CH7 A;  2FGO A;  3DU6 A;  2Q3P A;  1TK0 A;  1XTZ A;  3N4W A;  1RWO B;  1MN7 A;  1Q1K A;  2W8K A;  1TFW A;  4K5S A;  3HVA A;  2CQ0 A;  2C1E B;  5DQH A;  5FLX Y;  4WFA Q;  2DIU A;  4S0M A;  1VRU B;  3PJX A;  3DLJ A;  4D3H A;  5KFZ A;  5AE1 A;  1OSD A;  1TKX B;  3ZNU A;  3NNC A;  4NI2 B;  5JUM A;  1SUQ A;  2DKO B;  1YRT A;  2HLT A;  1Z2Z A;  3OBI A;  5DLF A;  1RSC A;  4LFA J;  2G2Y A;  1CJU A;  2QGF B;  4EFA C;  5A8K A;  5BR8 J;  1M5P C;  4F3O A;  4C98 A;  4Y28 C;  1WKJ A;  4IR1 A;  2ZOM A;  1VQY A;  5B08 A;  3U7J A;  1SQG A;  1TUW A;  3D7S B;  1Z4U A;  4DLG A;  1EB0 A;  3DM2 B;  3NG8 A;  3V4I B;  1PJ6 A;  3EXC X;  5EN1 A;  1PSD A;  3FSX A;  4NXM J;  3ZC4 A;  4NYZ A;  2DHH A;  1N4L A;  4Q8E A;  4J9N A;  4PXD A;  3TOQ A;  1IBL F;  3DYA B;  2BE2 A;  3FBF A;  4RO0 A;  2RDI A;  1TL4 A;  1HNI B;  2GNK A;  4ZVF A;  1YQH A;  4OL8 A;  5CQG A;  2LLZ A;  2OPP B;  3FMW A;  4FXW A;  1SH3 A;  2ZE2 A;  5DZ7 A;  2UUB F;  3NAH A;  3FEX B;  4QQB A;  4RJV A;  2CQG A;  1WKL A;  1RAI B;  4G65 A;  4MMO A;  3QLH A;  2GJI A;  2F7V A;  1F3V A;  3HSZ A;  1NHV A;  2D9O A;  4ZJL A;  2EFP A;  4CNY A;  4DR2 F;  3PW5 A;  4NLU A;  4NLW A;  2V2Z A;  3K5L A;  4E8U A;  3I0R B;  1QVF R;  2RQK A;  4J9S A;  1V3Z A;  1HBU A;  2JJ4 D;  4DV0 J;  3H4B A;  4DSI A;  3H42 A;  4OZ5 A;  2OSQ A;  4JV5 F;  3OFF A;  5C2G A;  4OHZ A;  3JAM Y;  2BR0 A;  4Z2X A;  2VFR A;  4M63 A;  1Q86 T;  4ZVO B;  1GMV A;  2FLO A;  1CJK B;  4W90 B;  1WDT A;  3DU5 A;  1U0H B;  1VR6 A;  5BR8 F;  2BA9 A;  2E44 A;  3VCD A;  2NUU G;  1RZM A;  1BQM A;  3V6D B;  2W4D A;  1RA7 A;  3Q8R B;  4K2X A;  2DIT A;  1S12 A;  2XMW A;  4PXB A;  3U1N A;  2HHW A;  2E7X A;  3QMQ A;  4U96 A;  2PI4 A;  4YDX A;  1HNV A;  3KK1 A;  1NO8 A;  1K9M T;  1PJ5 A;  2BE2 B;  4ZPT R;  4F4W A;  1KKH A;  1KP6 A;  3G96 A;  3RAM A;  5CZV A;  4LR8 A;  2BQU A;  5AE3 A;  1NK8 A;  1JLE A;  1VOM A;  4FS2 A;  2ZE2 B;  3NKY A;  1ZPW X;  1NHK L;  2OTL S;  2K8G A;  3L9Z A;  3MPY A;  2LQ5 A;  3MPW A;  3BN4 A;  5IM0 A;  1PC4 A;  3QLH B;  5G4D A;  3BBB A;  2MQP A;  1NSP A;  3PNI A;  2XYH B;  4IRK A;  1VYA A;  5EHH A;  3Q2S C;  3SSR A;  3HXM A;  1UFK A;  1RCX B;  2DNO A;  4F26 A;  2FUG 9;  1HBU B;  1FRI A;  3OL8 A;  3LGN A;  4DV0 F;  5CYJ A;  4P71 A;  2V4R A;  4WF9 Q;  2RIL A;  3IN5 A;  3DKD A;  1IBC B;  1JXV A;  3E51 A;  1WJ9 A;  1VIX A;  4DPW A;  2AJF E;  2VJU A;  1TAU A;  3MM6 A;  5L1I A;  3SSS A;  2YXL A;  4IFV B;  3ET6 B;  1Q0N A;  5DRK A;  2CQP A;  3E01 A;  3KG0 A;  4K8R A;  2I0X A;  4EEY A;  1CC7 A;  1TVR B;  4I6W A;  4Q43 A;  3LGM A;  2KDO A;  1QJH A;  4OYI A;  3N6N A;  3GR0 A;  2W7P A;  2KB2 A;  3QAE A;  2ZZN A;  3J80 U;  1VDH A;  1V6H A;  2CPY A;  2VQF J;  2ZUG A;  2O1P A;  3CB4 A;  5HQL A;  1BQM B;  3CCR S;  1UKU A;  1R8P A;  5E41 A;  4M5K A;  2XYG B;  2J6S A;  3C6T A;  2AP6 A;  3DCA A;  4C8L A;  2HMI A;  1YHQ S;  4OLP A;  1HBM B;  4I2Q A;  1SI9 A;  2QFI A;  3M6U A;  3KK1 B;  3DOM B;  5GAG U;  2R4F A;  2DHX A;  4BDP A;  4ED2 A;  1ZOT A;  4F3Q A;  5I3U A;  1S1T A;  5KFQ A;  1BY9 A;  1JLE B;  4WCE Q;  2DR8 A;  4P74 A;  2OJ3 A;  5B09 A;  4DX5 A;  3LO3 A;  1FE0 A;  5IM0 B;  6AT1 B;  3T5L A;  2WW8 A;  1ZZF A;  2J6T A;  3PEH A;  1U48 A;  4J9K A;  2HQF A;  1ZM9 A;  2YKO A;  1RTJ A;  2Z2L A;  1QE1 A;  1IBM J;  4ID5 A;  4LF7 J;  2PA8 D;  1SJ4 P;  1VQS A;  5CCL A;  2ZVS A;  3HT0 A;  5A8W A;  2XZD B;  1FI4 A;  4OFZ A;  1ITP A;  3IC1 A;  2VG5 A;  3HI9 A;  1U25 A;  3JS9 A;  3BPD A;  3BM7 A;  2KTQ A;  3HPO A;  1D8Y A;  2IM1 A;  1FJG J;  1Q16 B;  5F8J A;  4HTI A;  3HLU A;  3MM6 B;  1YG0 A;  4RUA A;  1FVQ A;  2AJQ A;  1I5O B;  5B0B A;  1VFJ A;  1S0O A;  1C0U A;  1JKH A;  3CJS A;  1S1W B;  5GAH U;  3TW0 A;  4B9M A;  5KOW A;  4HI2 A;  2H5J B;  2V2K A;  1E6Y A;  3HD2 A;  3RB3 A;  2ROP A; 
#chains in the Genus database with same CATH homology
 4PYA A;  2IDE A;  2EEY A;  2OHD A;  1EKS A;  2EKN A;  3JQK A;  4FDF A;  3JQJ A;  4PYD A;  1EKR A;  3JQM A;  2IIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...