1HPZB

Human immunodeficiency virus type 1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
430
structure length
430
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords POL POLYPROTEIN
publication title The Lys103Asn mutation of HIV-1 RT: a novel mechanism of drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 97
structure length 430
sequence length 430
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hpzB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hpzB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hpzB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hpzB03
3T19A 2AWZA 3RB0A 3GYNA 2R8GA 5KFUA 4RW7A 3JYTB 3BSAA 5F8JA 3M8QB 4ECRA 2YKNB 2HAIA 3T1AA 3TVKA 2QE5A 1LWFA 4ID5B 5CYQA 3V6DA 1MMLA 5KG4A 2V4QA 4X2BA 5KFNA 2C2EA 4ED0A 2JC0A 4NLGA 3KLIA 2AQ4A 1REVB 2OPRB 1S48A 4NLRA 2C2RA 5HROB 2IJNA 2OPPB 2RKIB 1TKXB 1RT7B 3IRXB 2UUWA 3DRRB 2VG6A 1QAIA 4WZMA 1JLQA 4RNNA 1LWCB 3FRZA 2OH2A 2R8HA 4FBUA 1SV5A 5J2PB 3MFHA 5C25B 4JV0A 3QZ8A 4KKOB 1S1XA 5C42A 3I5BA 3DM2B 3Q8PB 4O3RA 2YNGB 3LP0B 5CYMB 5KG5A 2YNHB 4O44A 5L1LA 2ASJA 2YKMB 5DGAA 1RTIA 3TAMA 3QIDA 4MK7A 3CDUA 3ICLA 3IGVA 2RDJA 3H5XA 3OL9A 4Q0BA 3UR0A 1C1BA 1N6QB 4ZMMA 4NLVA 4RW8A 4DL2A 4F4WA 3PVXA 3E01A 1C1CA 5KFWA 5KG2A 2OPSB 2BRLA 1EETA 3IG1B 3H59A 2J6TA 2IC3B 3KLEA 4YQWA 4KFBA 2WRMA 4GC6A 4XO0A 4ZVHA 4M94A 5KFRA 1HNIB 5KFEA 3OLBA 3RAQA 3I5AA 3EPGA 1FK9B 5KFQA 2IM3A 4J9SA 3ITHB 5L9XA 3V6KA 2W9AA 3IS9A 3EZUA 4ED3A 3CJ2A 3DLGA 4WYLA 2W8LA 4WFXA 5HP1A 3KK2A 5I3UA 4WFYA 4Q8FA 5KT3A 4IRDA 4O4GB 4MK9A 3RBDA 1HQUB 1W25A 3ISND 3BQ2A 2W9BB 5KT5A 2E9TA 2CKWA 4MKBA 4DL3A 3CIZA 1HMVA 3HHKA 4IOBA 3KHGA 1S9EB 5J2NA 1JLFB 4WXOA 3MTKA 4WE1A 3BGRA 2ALZA 4G3IA 2AX0A 5KG3A 3PW5A 5KFMA 4NLWA 4IR9A 1SUQA 3CJ4A 4O3PA 1S0OA 5DG8A 2FLPA 4G1QA 4ZPDA 4ZVFA 4DEZA 4RUAA 2JEFA 4RW9A 3QGHA 2VA3A 3KNAA 1C0TB 4K4SA 4ZHRB 4MFBB 2JC1A 2AGPA 2FJVA 1S6QA 1RT5B 3OSNA 3NBPA 4PWDB 1S1UB 3GILA 4IFYB 3FFIB 1TL1A 1IKVB 1JKHA 5KFJA 2UVUA 3LALA 1LW2A 4TQSA 4K4ZA 1ZTTA 1RT4B 3DMJB 4I7FA 4ED1A 3EPIA 2UVVA 5HLFB 1JLCB 3H5SA 5KFXA 4ECVA 1GX5A 3NAHA 2HNDA 4HKQA 3PZPA 3I0SB 2XI2A 2GIQA 4K4UA 5D3GB 4IKAA 4KV8B 1S9GB 1S49A 3H4BA 3DLKB 1J5OA 2B43A 3Q8QB 4XPEA 1HNVA 2BANA 1UWBA 1JLBA 4U6PA 1RT3A 2E9ZA 4IG0A 3KK1A 4IDKB 4B3OA 4KSEB 1HPZA 2BQRA 2ASDA 3KLGA 3NAIA 2DPIA 2XI3A 4LSNA 2AGQA 3DI6A 4URGA 4XPCA 4EBDA 3I0RB 1VRUA 4JV2A 4KHRA 3CO9A 2ILZA 1KHWA 4TY9A 4U7CA 3GV8B 3M9OB 1RT1B 1R0AB 2F8EX 3CJ5A 3D5MA 2V9WA 4KHMA 2OPQB 1S1VB 1T05B 4DG1A 4ZVEA 1RTIB 2R8IA 1DTQA 4NCGA 3RB3A 4YR3A 4TYAA 1NHUA 5KFCA 3JSMB 3RBEA 3LP1B 2JEGA 2R8KA 5KFDA 3QGIA 4ED7A 1EP4A 1TP7A 4RW6A 1RYSA 3PW4A 5I42A 3PR4A 4QWEA 2GIRA 3DRPB 5J1EB 1RTDB 2BRKA 3FDSA 4DL4A 3QIPB 1IKWB 2IAJA 4ECZA 5KFHA 4J9QA 3KLFA 1LW0B 4H4MB 2FLLA 1HQEA 4QW9A 3G6YA 2C22A 3CJ0A 1HYSA 2AGOA 1S6PA 4J9RA 4I2QB 2YNFB 4ZP8A 5T14A 2ASLA 1MU2A 3VQSA 5F8MA 3PR5B 5I3UB 2GC8A 3GV5B 3C6UA 2ZE2B 3H5YA 3H2LA 1RTJA 4NLUA 4Q44A 1D1UA 5DGBA 5F8IA 5KFGA 2RF2A 1RT2B 4ICLA 5F9LA 2R2TA 3QO9B 5K14A 1K1SA 3RB4A 1RT6A 4PQUB 1QE1A 3DLEB 4RW4A 2VG7A 1N48A 4O3QA 3UDLA 1C0UB 3T5JA 2EC0A 1TVRB 1TV6A 4MH8A 4G1QB 1DLOB 2B6AB 4RW9B 4IFVA 5EDWA 5FDLA 3DOKB 3QGGA 4TXSA 3KHRA 4FS2A 4KO0B 2BE2A 2R2SA 5F8HA 2WOMA 4I2PA 3LAMA 2XGPA 1RTHB 4ED2A 1JLGA 3KJVB 2CJQA 3GIJA 1RYRA 3GIMA 4KB7A 1DTTB 1LWEA 1IKYB 3M8PA 4URQU 5EWGA 5EWEA 4NLQA 2IM0A 5HBMB 2UVRA 3OSPA 4IH6A 4ECYA 3KLHB 2YNIA 1IKXA 4YR0A 3FSIA 5J2QB 5DLFA 1NHVA 1KLMA 1S1WB 3H40A 2WONA 4IG3B 4ED6A 1RAJA 1D0EA 4TY8B 1JLEA 2I5JA 4F4YA 4NLXA 2IM2A 1SH3A 4R5PB 1BQNA 1VRTA 3PW0A 4KAIA 5EUHA 5L1IA 3LP2B 3GIKA 2IA6A 3MEGA 4NLTA 4NRUA 5DLGA 3C6TA 3DRSB 3Q8RB 3KLGB 4FBTA 4ECWA 3CWJA 3KK3A 3M9NB 4H4OB 4EO8A 5DG9A 1T03A 2V0NA 5C24B 1K1QA 1FKPA 5KG0A 4EYIB 3V4IA 2B5JB 5JXSA 5KFIA 1BQMA 3MR2A 2HNYA 4LQ9A 1TL3A 4R8UA 5F8LA 2W9CB 3MECA 1WNEA 1FKOB 3UPFA 5KFKA 3QLHA 5KT6A 3GIIA 4QWCA 3V81A 3NKYA 3HVTB 4PUOB 2IJFA 2HMIA 3G6XA 4ECSA 3DOLB 3IN5A 3DYAB 3LAKA 2FVCA 3BSOA 1N5YB 3JYTA 3FQLA 5KFZA 3CDEA 3M8QA 5JUMA 1IM4A 2YKNA 2O5DA 3DDKA 4NLPA 4ID5A 3BJYA 3H98A 4ZPCA 3N6MA 5J2MB 2UUTA 3N6NA 1S1TB 4LSLB 1TKTB 1Z4UA 3MR5A 1REVA 2OPRA 4LQ3A 2D7SA 5HROA 2OPPA 2RKIA 1CSJA 3G86A 3KHHA 4J9NA 3KMSA 1TKXA 1RT7A 3IRXA 4RW7B 3PW2A 1S0NA 3DRRA 4O4RA 2BR0A 2XWYA 3ISNC 4MKAA 1LWFB 5CYQB 4IH5A 3C6UB 3V6DB 5C5JA 1LWCA 2I1RA 4RZRA 5J2PA 3KLIB 5KG7A 2FVQA 4RNFA 5C25A 2W8KA 5DQGA 4OL8A 4KKOA 2IMWP 3DM2A 3SI8A 2YNGA 2FJWA 4ZP9A 3LP0A 5CYMA 2VG6B 2YNHA 5K14B 2YKMA 3SFUA 2ZD1A 1JLQB 2VG7B 1SV5B 4K4WA 4NLYA 3SFGA 2ZKUA 3KOAA 1S1XB 4IFVB 5C42B 3MR6A 4GC7A 5KFLA 1XR5A 4IRCA 4NLDA 2OPSA 3IG1A 4O3OA 2IC3A 4O44B 2AU0A 4RUCA 5KFFA 2QV6A 4Y3CA 3TAMB 3N6LA 1HNIA 3RAXA 4F4XA 2VG5A 4Q0BB 5KFBA 1C1BB 3MEEA 5KG6A 5KT2A 4RW8B 3HVAA 3ITHA 3OHAA 3G6VA 3E01B 1C1CB 2YNIB 1EETB 4Y2AA 3KLEB 1S4FA 4IH7A 4M95A 2XGQA 3TQ1A 4KFBB 5F9NA 3UQSA 2HWHA 4RNOA 4J9OA 4O4GA 1QAJA 3PJXA 4YMEA 2W9BA 3MF5A 2WTFA 5L1KA 1HARA 5F8GA 4EBCA 3IS9B 2BQ3A 1S0MA 3DLGB 1JLAA 1JLFA 4MIAA 3MR3A 5HP1B 3KK2B 4YP3A 2HNZA 4Q45A 4F4ZA 3PW7A 3BR9A 4JUZA 2XC9A 4MIBA 2JEJA 2FLNA 4Y2CA 1S97A 1HMVB 1C0TA 4ZHRA 4MFBA 1SH2A 1RT5A 5J2NB 1T3NA 2UVWA 2HWIA 1S1UA 2XCAA 4WZQA 4WE1B 3BGRB 4IFYA 3FFIA 4F50A 1IKVA 3BREA 3T5HA 2WB4A 2C2DA 2W7OA 3KLVA 1SUQB 1RT4A 3DMJA 4K4YA 2ILYA 3GQCA 4EEYA 5KT4A 5HLFA 1JLCA 1T94A 4EBEA 4JV1A 4WFZA 3OL6A 3I0SA 2R8JA 1S6QB 5D3GA 4QWDA 4IQXA 3NBPB 4KV8A 1S9GA 3NMAA 4URSA 4K50A 3DLKA 1TL1B 1JKHB 1LW2B 4DL5A 4I7FB 2WHOA 2E9RX 4IDKA 4O3SA 1U09A 3KMQA 4H54A 2HNDB 3QZ7A 1S9FA 1ZTWA 1TKZA 4NYZA 2R2RA 1J5OB 3I0RA 2BQUA 4ZVGA 3OL7A 2XCPA 1HNVB 2BANB 1UWBB 1JLBB 4NRTA 1NNDA 1RT3B 4IG0B 1QUVA 3KK1B 1RA6A 4B3OB 5KT7A 1C2PA 1RT1A 1R0AA 4ZPBA 1HPZB 3OLAA 2OPQA 1S1VA 1T05A 5DQHA 2ZD1B 4MK8A 4LSNB 3DI6B 3H4DA 3RB6A 1VRUB 4QPXA 3JSMA 3LP1A 2VA2A 4NZ0A 2J6UA 3HVWA 4J9LA 3E51A 3GV7B 3MEDA 3CVKA 2WCXA 4WYWA 5KFOA 4KBIA 1JIHA 4J9PA 3DRPA 4DG1B 5J1EA 1RTDA 2FVSA 1DTQB 4NCGB 3H5UA 3QIPA 3T5KA 3HKWA 1IKWA 4TLRA 3D28A 2C28A 2VG5B 1LW0A 4H4MA 4QWAA 3MEEB 4K4VA 4Q8EA 4ECTA 1N4LA 2D3UA 4I2QA 2YNFA 1SH0A 5EWFA 1EP4B 4RW6B 5I42B 4HYKA 4O3NA 4R0EA 2ZE2A 3LANA 5KFPA 4ZP7A 2IAJB 3KLFB 2D41A 2AX1A 4J9MA 1HQEB 5DG7A 3BSNA 1HYSB 1S6PB 3OHBA 1RT2A 1MU2B 1JLAB 3QO9A 4NLOA 4PQUA 2FJXA 2HNZB 3DLEA 3I5CA 2JEIA 1KHVA 1RDRA 1RTJB 1I6JA 1JXLA 1C0UA 1ZETA 4WXWA 3CJ3A 1TVRA 3T5LA 4NLSA 2V4RA 1DLOA 3IGNA 2B6AA 3BSCA 4EYHB 3DOKA 1RA7A 5KG1A 2RF2B 4ICLB 4KE5A 4IR1A 2D3ZA 4KO0A 4K4XA 2FVPA 3FQKA 3V6JA 5F8NA 1RT6B 1QE1B 1RTHA 4RW4B 3Q8SB 3KJVA 5DQIA 4FS1A 4ECXA 5KFYA 1DTTA 1IKYA 1N6QA 1TV6B 2ATLA 5HBMA 5FDLB 1GX6A 2JLEA 4DL7A 4QW8A 1TQLA 3KLHA 2IM1A 2BE2B 2WK4A 5J2QA 2WOMB 4I2PB 2RDIA 3CDWA 4RU9A 4TQRA 1S1WA 5L1JA 4RNHA 1XR6A 4IG3A 1JLGB 4TY8A 4ZP6A 5KFTA 2IBKA 1LWEB 3M8PB 1FK9A 4R5PA 1S10A 3LP2A 4QWBA 3M9MB 3DRSA 1IKXB 1TKZB 2J6SA 3OL8A 3BQ1A 2R2UA 1KLMB 3PHEA 4K4TA 4IRKA 3MFIA 2WONB 1YVFA 4H4OA 1JLEB 2I5JB 5C24A 1HQUA 5KFSA 2B5JA 1BQNB 1VRTB 4Y34A 3MEGB 4TYBA 3C6TB 5KFVA 1S9EA 2W9CA 2DPJA 3QYYA 3NL0A 1FKOA 3NGDA 4RNMA 4J9KA 3KK3B 4ECUA 2FVRA 3HVTA 4PUOA 4Q43A 1XR7A 3DOLA 1T03B 3DYAA 3PJWA 1FKPB 3MEDB 3V4IB 2W7PA 4EO6A 1N5YA 1BQMB 3V6HA 3BQ0A 5KFAA 2HNYB 4TN2A 4DL6A 1N56A 1JX4A 1TL3B 4R8UB 1OS5A 3MECB 4PWDA 5J2MA 4ECQA 3QLHB 4YR2A 4ED8A 3V81B 3KHLA 1S1TA 4ZPAA 4LSLA 1TKTA 2HMIB
chains in the Genus database with same CATH superfamily
1P1LA 4CLYA 4OJ3A 3RB0A 1UJ4A 2HAIA 3HSGA 2QFIA 4ID5B 3V6DA 4PZVA 1XNQF 2HLUA 3W3SA 4FNIA 2PD1A 4RUBA 2CQCA 1LWCB 1JMTA 1RHQB 3S8SA 2RILA 1D3WA 3VF0B 4M5DA 4JI7J 3TAMA 2LLZA 4B9UA 3H5XA 2KRBA 2NSCA 3OL9A 3HZEA 4LF8F 3UNYA 1VQ8S 2KFNA 3WQPA 2R4FA 3W2WA 1P8GA 4I6YA 5ETQA 3RBDA 1J2VA 2XMTA 3KHGA 3FSYA 2LQ8A 2CZVC 3VAGA 2DISA 2MLYA 2AGPA 5CQGA 3GILA 3FFIB 2CJXB 3UDEA 2GAHC 1JLCB 4QJVA 2DY1A 5FD1A 2M88A 2HHWA 1UWBA 4B3OA 1Y9OA 3C15A 2XI3A 2E1AA 2QGFB 2RSQA 4KHRA 3OTOJ 3D7SB 2AYEA 3J80Y 3GV8B 2HRUA 2QLJB 2HQDA 1RTIB 1YX2A 3JSMB 2Q79A 2HHQA 4QYZK 4RW6A 3C14B 2GIRA 1F3VA 1BC6A 1ZS6A 2IAJA 4DWIA 1KRPA 3RBZA 5T14A 2ROGA 2YKQA 4PAAA 5DDOC 2AJ2A 4NLUA 2QX0A 1UW9A 1ROFA 4I69A 3NGRA 3DLEB 4RW4A 1KFSA 1N52B 4OI6A 3N28A 4IFVA 2YKAA 3IR7B 2J5AA 5F8HA 5K8MA 2CADA 2HHUA 2DXDA 3GIMA 3QJLA 1IKYB 2FJEB 3FSIA 1YTYA 2YQ0A 2I5JA 4AT1B 3MEGA 5DLGA 5ADZA 4CQ1A 1F1BB 4X4NA 2V0NA 1K1QA 3W2VB 4RU2A 2VFRA 1N54B 5JVGQ 2GMLA 1TK0A 1R7IA 4NYOA 1EZZB 1U47A 3MWBA 2AD9A 2EG1A 2NLWA 2C3OA 2V68A 2UUTA 5K8OA 1ZZFA 3P8BB 3KMSA 4ZPTR 4JI1F 3JSRA 2YX7A 3BBCA 4X64F 4L3KA 1XBWA 5IM0B 2VDIA 3H8YA 4Z2XA 4OV6A 3Q86A 3SFUA 1CJUB 4K7QA 5KFLA 1U6ZA 2LECA 4NLDA 4KJIA 1HA1A 2QEXS 4NA3A 1RAOA 3OHAA 3PYEA 2RVJA 1OYDA 1V3RA 3PX6A 2ZUAA 3DLGB 1NSPA 5H1SV 4YY3F 5DM6Q 5A8KA 1HNWF 3CTRA 1NM2A 1IWGA 2EWHA 3RRGA 3DDNA 1TFYA 5I3QA 5IT4A 1T94A 4WFZA 3OL6A 4X4SA 1XEZA 5HMZA 4LFAF 4WBFA 3VWSA 3W9JA 2EC2A 1NB2A 1TMMA 4NASA 1EQ0A 1PC5A 3AT1B 2ZH6A 1QUVA 5DQHA 2BA9A 2ROEA 3GJSB 3PV8A 2HEKA 2WCXA 4KBIA 4KPYA 2FJAB 2OD4A 4J9PA 3GB0A 2VB6A 4NMXA 5D4PA 3MGJA 1EP4B 5GAHI 4NE9C 5DS7A 1VQPS 2BJ7A 1LFWA 3R1HA 3V5RA 3PYFA 3HO1A 2HZAA 4DPUA 3BSCA 4EYHB 1RA7A 3GYGA 3L7UA 4IR1A 2FVPA 1WDDA 1RWKB 5ETNA 1DTTA 1N6QA 4DUZF 1Q8BA 2XULA 4N76A 2LQJA 3U1NA 3CDWA 2GJFA 4USWA 1XNQJ 3DRSA 2LDIA 3M8SA 5B0CA 1KLMB 2W25A 1FXDA 2QLXA 3AD7C 4QZVB 2HW3A 4DV7F 3K5OA 4X66F 1OSCA 4PUOA 3V4IB 4EO6A 1N5YA 3JTOA 3DFEA 5IV4A 4LF8J 3KUGA 4ED0A 2Y8YA 5THWA 1DJ0A 1SKSA 2YKNB 3WHIA 2ZC3A 4GVBA 2V8DA 4PEOA 4QBUA 1FO1A 2OH2A 3MFHA 2VOOA 4N8NA 1S1XA 2EK1A 4DR5F 5M2RA 2YNGB 1MWQA 9RUBA 4LVNP 4O44A 1G3OA 4F36A 4NOHA 1O51A 2BABA 3ETMA 3KUEA 4C8LA 2XNRA 2CDQA 5KG2A 3H59A 1FKAF 2QA1A 3R97A 4KFBA 4GKKF 3OLBA 2BUNA 1Q8IA 1XWLA 2ZBCA 2FY8A 3M2VA 2KU7A 2Z4PA 3ADAC 4WE1A 2WSEC 2K3IA 2KT3A 3DLHA 2YX1A 5LT5A 3TA0A 4UTGA 3AB4B 4I7FA 4DZ6A 2EFGA 2FB0A 3NAHA 2V8HA 1CULB 1X5PA 5D3GB 4KV8B 2NXUA 4ZPVR 2DRAA 1CC8A 4GO7X 3A12A 3KLGA 3MAQA 4TU9A 4P7VA 1RAIB 3OFEA 5JJBA 3GP9A 5FJ4A 1LXNA 3ET6A 2F8EX 3D6HB 2V9WA 1YBTA 5LJ3Y 1R27B 2Q1LA 5AXMA 3Q22A 3SYZA 2VF3A 2GZOA 4ED7A 3CULA 4ECZA 5KFHA 3I56S 5IT0A 1LOUA 1MWZA 4I2QB 3QFHA 3EXYA 3PEJA 1RTJA 4YUDA 5F8IA 5KFGA 4ICLA 2OD6A 4PQUB 2EFNA 4CH0S 1Y0HA 1U48A 3CDAA 3DOKB 1VQSA 2G0CA 2AP6A 3KHRA 1A7GE 2DNOA 3JXOA 3I6PA 3M8PA 1CQMA 4F25A 1CBKA 2KG1A 3ZZZA 2HVDA 1VRTA 3C6TA 4X64J 2FGOA 3L3CA 5G0RB 3FKBA 3HI9A 2RUGA 2XM3A 2J7WA 1FKOB 3NEKA 3HVTB 3TUIC 4DCOB 4OV1A 2VONA 3MCOA 3BJYA 3ENAA 1REVA 2AMCB 2LFVA 1RKIA 2CJ9A 1X5TA 2XMWA 4O4RA 5HK4A 2XWYA 4QIEA 4IH5A 2KB2A 1NZAA 1SQGA 2QIFA 2RQCA 5L8RC 4A8MP 4OYXA 1SIZA 1N8RT 4YY3J 1HNWJ 3Q8UA 4IRCA 1U0HB 3IG1A 2PI5A 2AU0A 5KFFA 2HK2A 2XY5A 3NWGA 3QPIA 2VG5A 5KG6A 4P73A 1RK8A 4LFAJ 2CVEA 1Q16B 5D15A 2OEMA 4FKYA 1VC6A 2VFTA 3BO4A 1X4BA 2DO4A 4CM0A 3BR9A 4JUZA 4AXIA 4CLTA 1HWIA 1RLDA 4PG6A 2U2FA 3PRVA 4B02A 3R5DA 1IKVA 2XS7A 4P72A 3KLVA 2XLJA 1CJTB 2XZDB 2HLTA 2B51A 4F2SA 2XZWA 2GJ2A 3KMQA 3U1LA 1S9FA 3IP0A 4X4UA 2R2RA 2Y1IA 2OJ3A 5ETRA 5ETVA 2KJVA 3EDQB 4AQYJ 2CQPA 1RT1A 3H4DA 3RB6A 3ZZUA 4NZ0A 1R0CB 1GXTA 3DRPA 4DUZJ 3CE8A 5A2QU 5GAHU 2D3UA 2KZMA 5DDRC 4C8OA 5T41A 1QD1A 1GTEA 2G13A 1U49A 8ATCB 1KHVA 2DH8A 1RU2A 2Q43A 3C8YA 3FEZA 3IC1A 4CLWA 1PIEA 3PYGA 4X66J 1URNA 3V6JA 4NCAA 3T1HF 3TUPA 1R8PA 4YN3B 5HBMA 3ZTSA 2U1AA 2MB0B 3GCXP 2IM1A 1UVMA 2BE2B 4I2PB 2IRXA 1XR6A 3IM8A 1QM9A 2DR9A 2NXNA 1HBMA 4F02A 1IKXB 3FBCA 4CWBA 4IRKA 2FTRA 4U67Q 3IFEA 1REGX 2CPHA 4TYBA 3UD4P 2DXEA 1MMNA 4C8ZA 1B64A 3DYAA 3GR0A 2ZOMA 3V6HA 5KFAA 2HNYB 5LSLA 4YHHF 3EWGA 3V81B 4DSLA 4LSLA 2NREA 3CJTA 3JYTB 4ECRA 4GKKJ 1MMLA 3B4MA 1RADB 3VV2B 2CWKA 3D66A 4OZLA 3CD5A 5A0YA 1RLCL 1W2BR 3HSZA 2QLWA 4UT4A 3Q8PB 2W2NP 3QIDA 1C4AA 5GMEA 1JQGA 3UR0A 4DF8A 3MD3A 5HN0A 1U8WA 1B0VA 1X9SA 3IO1A 4P2SA 2W8LA 5I3UA 4WFYA 1LEOA 1W25A 3ISND 5KT5A 1NLKL 3ILLA 2F9DA 1UVLA 2ZBQA 1EARA 4ZA1A 4ELUA 1FJGF 2XMVA 5KFMA 3K8WA 2F1FA 4UOHA 1BE4A 3TEHB 3OSNA 1YSJA 4DR2F 1JKHA 1FJEB 4K4ZA 2X1GA 1OIAA 3ZTOA 2WBMA 4OYIA 4B3RJ 2PFDA 4HKQA 4ZVUB 1OY9A 2B7CB 3B54A 1S9GB 3NGUA 1NK6A 5U47A 4E98A 1WC0A 3RR7A 3I0RB 3POTB 3FZBA 2X1AA 1HBNB 2R8IA 3AXMA 1LV5A 1ZM3A 4DDFA 3GPAA 2MQLA 4Q5VA 1KR4A 2AYGA 2QRRA 1WEXA 1CLFA 3K8VA 3QIPB 1LW0B 1S6PA 3AOAA 4J9RA 2YNFB 4ZP8A 4Y6IA 4RR5A 2QT7A 5C7PA 4X65F 1BY9A 1NZ8A 2QSFA 2LVWA 3J81Y 1RT2B 2R2TA 1MROA 4MH8A 4RW9B 1Q81T 3OVBA 2PEHA 1Z2ZA 4CT9A 2OMLA 5EWEA 5IQQA 4FF2A 2WZ1A 3BPSP 4FF3A 2W01A 1SC4B 2CJKA 4P74A 2NXCA 5BXIA 3CWJA 4EO8A 2CZ4A 1TL7A 2KRRA 2JFDA 5KFIA 1Q86T 4K59A 4QPTA 4LQ9A 5KT6A 1S57A 2P5VA 1FVSA 4NZ7A 4NLPA 2OEJA 1S1TB 1QTMA 1BXNA 2M70A 2RKIA 4J9NA 3PW2A 1S0NA 3ISNC 3G8QA 4LF5F 1G7CB 2AHOB 5HANA 2D74B 2FVQA 1FDNA 2IMWP 3GFZA 2ROPA 3LP0A 2YNHA 3EZOA 4FPIA 2EVZA 2PE8A 2L9WA 3L7PA 4ELTA 2HHPA 4ZITA 4PR6A 4LFCF 4Q0BB 3S01A 3E01B 2E1CA 2RS8A 4F04B 2KYZA 4O4GA 4P10A 5GAEI 1EIYB 1B0TA 3MF5A 5F8GA 2L08A 4ZVQB 3MR3A 5D78A 5FLXU 5ITHA 2YWFA 1FJ7A 1RT5A 5J2NB 3BPDA 2ZM6J 2NUHA 1IXKA 4QWDA 1NSKL 1XC9A 3LUYA 1U1QA 2FHOB 4NYZA 2DGOA 1FNMA 1GEHA 3OT9A 1NK0A 4IG0B 3KK1B 2CQBA 3M2UA 2D3OR 3NS7B 4MK8A 3UO0A 4E0DA 2ERRA 3MD1A 3HVWA 3EMTA 2EPIA 3CCWA 3T1HJ 4JI0F 4DG1B 5J1EA 2JH3A 1RTZA 5DRKA 3TWZA 1U2CA 2HGLA 4JI6F 3ZNUA 1FNOA 5KFPA 1YITS 1MG7A 1UZHA 4WCEQ 1CS4A 2D41A 2CJYB 3BSNA 2CQ0A 2GX8A 1KC8T 2MMYA 2BE7D 2CQHA 4UOFA 4NLOA 3I5CA 2CWXA 2BM1A 4E2FB 1U1KA 1SI9A 2D69A 1TVRA 2KI2A 4PWUA 2V4RA 1DLOA 3BGOP 2MLXA 3LO3A 1RTHA 3KJVA 2IA0A 2DITA 2PFFB 2ZH2A 2F8HA 4YHHJ 2UZAA 4CNZA 1AB8A 3S1TA 1S10A 4PPDA 2FZKB 5L9NA 2H51B 3BQ1A 4N5SA 2NCKL 3W9IA 5C24A 2YQ3A 3MM5B 2HQFA 4XDDA 3RBXA 3LGMA 4WTOB 5JMNA 3VCDA 2AW0A 5J2MA 3GSIA 3GJTB 7FDRA 1NDPA 3KUHA 5HQ8A 1HI1A 5KFUA 5KAKA 1YJTA 3DU5A 3G9CA 2OHDA 4OI1A 2C2EA 2ZZNA 3KLIA 4WFAQ 5SUHA 4RNNA 4CNYA 4CLFA 3BBFA 4JV0A 4B17A 5LMNF 1WG1A 1FJGJ 2I6WA 2E5HA 4EGLA 2YKMB 4DJBA 4WK3A 2EG2A 3TX0A 4DR4J 1CJKA 4DL2A 3X1LB 2QL5B 2GVDB 4DR2J 1WC3A 4AYBD 3ZFVA 1HNIB 5KFQA 1FF2A 2IM3A 2ZITA 4Z7CA 1X4GA 2DVIA 1NJWA 2DR6A 4YB1P 2V69A 3JAMY 2W9BB 4MKBA 2A10A 3P5BP 3P49B 1S9EB 1RGVA 4CLLA 5HJYA 2DNRA 1M5PC 2F5GA 5K20B 3DMJB 2BEFA 4ED1A 1GX5A 5RUBA 2HNDA 2PA8D 2FC9A 2J9DE 1S49A 2I8EA 3DLKB 3AQOA 4U6PA 4X65J 1CG2A 1U1LA 3FMWA 3NAIA 2UP1A 1VRUA 5HVFA 5D0RA 1E6YA 1S1VB 3MCNA 5KFCA 1KONA 4CO4A 2YY3A 3MMBA 1UZDA 5I42A 3FDSA 1DZ5A 3KLFA 4H4MB 2FHMA 4IO1A 5F8MA 1FE0A 3ZXWA 3MPDA 2VIHA 4Q44A 1RBLA 1D1UA 4EMDA 2YQ1A 1YI2S 4AL7A 4YOEA 3RB4A 3QO9B 2KHCA 2P6TA 3SV4A 3LF0A 2CPEA 2QA4S 4FS2A 2AYMA 2XGPA 3PIPQ 3DOMB 3KG1A 4IG3B 4TY8B 1D0EA 3M1VA 4LF5J 4KAIA 2HIQA 3UWTA 2MJUA 4MAKA 2HFOA 1NJZA 5D4OA 1T03A 2BBEA 4EYIB 2WVFA 1F6TA 3FGVA 5F8LA 3AJDA 1WSRA 5KFKA 1M0SA 4MYTA 1PBAA 4G1IA 2RUSA 1M5SA 4ZIWA 3DDKA 2XZTB 2H1YA 4K2JA 1RAAB 5LOQA 4H4KA 2EBGA 4RPFA 3OFGA 1NKEA 1KSPA 1K47A 1UFKA 1IR1A 4OHWA 3KOAA 1WOOA 3LW5C 2C3YA 1RHKB 1K44A 1YDLA 4RUCA 2AIRB 3QAUA 1C1BB 4DV6F 1HKAA 3PJ9A 1WWHA 2XGQA 5GAEU 3PJXA 1NK8A 5JVHQ 1HARA 2M2BA 4H4KC 4Q2MA 4Y0FA 3PW7A 4MFBA 3VQTA 2JSXA 3DHXA 3R5JB 4K4YA 4JI0J 2ZBIA 1UFWA 3CJSA 2EW9A 2N4CA 1H98A 4UQGA 5T7LB 3OJUA 4JI6J 1M90T 4EZ9A 4H54A 2CYYA 2XCPA 3BH7B 5E3CA 1M1GA 3LGHA 4QPXA 4ZLLA 2RU3A 1FWKA 2CQDA 4PG7A 1H38A 2F40A 3ZZYA 1RTDA 2C28A 1KTVA 1F5AA 1YBAA 2QFJA 5EWFA 3AJ2A 2HVIA 1RP5A 2ZE2A 3LANA 5HO4A 1BMQB 1HBOA 1HQEB 1X4FA 2ZH9A 1KD1T 4HDHA 4A8KA 1IBMF 2XG8A 2JX2A 2G0IA 3PRDA 4HHHA 2YWWA 1RT6B 1QE1B 2FLOA 2QMUB 2N3OA 5ETPA 3CJ8A 1RWXB 4Y2KA 3AA9A 5FDLB 5AXNA 3MZIA 2DRDA 4RNHA 2XYPB 3W8GA 3J80U 4R5PA 3LP2A 2X1BA 3PHEA 2WONB 4H4OA 1JLEB 3OXGA 2N82B 4XTTA 3F73A 4DSFA 1BQNB 1GK8A 1T8EA 5KFVA 1HD0A 4RNMA 2KHDA 4MTPA 3DCAA 2EFOA 4Q43A 5LMNJ 3BQ0A 3M6WA 1RSCA 3KHLA 4ZPAA 1TKTA 2PEBA 3T19A 3TO8A 1T9TA 1JJHA 3MM7A 1YIJS 4NLGA 2Q6BA 1YKWA 3H2VE 2UUWA 1WHVA 1XMOF 3A1YG 1MNEA 1LNQA 4DQSA 5HMWA 2H48B 1TFWA 1XK8A 3IWXA 2XY6A 4K5SA 1RTIA 4MK7A 3IGVA 1NJXA 2YX4A 1HD1A 2L9DA 5HATA 1WF0A 4ZVSB 4GC6A 4DX5A 1Q8LA 1FWPA 1VMBA 2M0GB 5H9EJ 4DQQA 4BBYA 3WIUA 1LXJA 2DYAA 2GA7A 4NLWA 1PJ7A 3K5LA 1RQ0A 1S6QA 2K1RB 1S1UB 2CRLA 2LU2A 4LIRA 2CA9A 1OY8A 4PYDA 1U24A 2IDLA 1DAXA 1JLBA 3GCWP 1HPZA 3H7HB 3M6UA 2KG0A 2BQRA 3DI6A 4ZCIA 4QR0A 2ILZA 2XNQA 3S7RA 4OYAA 4OI0A 4RO0A 2X7IA 2FUG9 2GHVC 4PPZA 4M1KA 4QW9A 1HYSA 1WHYA 3W65A 2FYXA 1SIWB 2V34A 1OSDA 1NHKL 4I67A 2VPWB 2B9YA 3T5JA 1XNRJ 1ELOA 1WF2A 1APSA 3DXSX 4JI2J 4OZNA 3HSDA 2DNGA 3BKUA 5DZ7A 2DT9A 3Q23A 1VQKS 1KQFB 3BV8A 3VAIA 2DR8A 3SIPB 3OFHA 3MMAA 4ECWA 3KK3A 2YWEA 2DB1A 1BQMA 2ZH3A 1TL3A 4R8UA 3QLHA 3M30B 3A8KA 3GIRA 1Y5LB 1RAFB 2GS8A 3D6TB 3MM8B 4FN5A 2M5YA 4DV6J 3MR5A 1DQ8A 2H65B 4J9UE 2DHAA 3C6UB 2P8IA 1WORA 4NZ6A 1F9HA 4CP5A 4TU7A 3DNCA 3TAQA 5E5NA 2VG7B 2ZBPA 3GG1A 5EX0A 2N7YA 4ZJOA 3TP2A 5C42B 3ZZPA 3RAXA 4DLGA 3W64A 4B9LA 3ITHA 2JWNA 1FESA 2GO9A 2MTLA 4OLPA 1QAJA 2RNEA 4AE5A 4OJ1A 3HJVA 3C19A 2FLNA 3QQCD 2XCAA 4IFYA 5H9FK 2W7OA 3AOBA 1RT4A 1T9YA 2COLA 2H54B 1L3KA 1AZSB 1NDCA 4K50A 4JB8B 3R7NB 3BBBA 2R7QA 1H2UX 3FNNA 1J5OB 4JYAJ 3OL7A 2VKRA 2ZHBA 4A48A 1RT3B 1IBMJ 2CUYA 4ZPWR 1LFPA 2GIFA 1SJFA 3KNGA 1URRA 1WJ9A 3BN4A 4IUFA 3D0IE 1SH0A 2GQQA 3UN2A 2BKPA 4C8MA 1IN0A 2J9EA 1MU2B 1X8DA 2FJXA 1I6JA 3A8IA 3I4PA 3FQKA 2LXFA 3SQGB 3UCZP 2DNYA 1Q82T 4QU7A 4F26A 1S1WA 2VKZG 2ZJRQ 2ZWOA 2MKYA 4P52A 4P75A 1N36F 3BGFA 1F5BA 3IRWP 1XMOJ 5KFSA 2VZ9A 3QYYA 1U8SA 2HBRB 4L72B 1VJQA 5LSOA 2UV8A 3M2RB 1DFDA 1LWFA 2HBZB 5KG4A 3VGTA 4W92B 2OPPB 3IRXB 1QAIA 2QA4G 1GQEA 2XYHB 4F67A 2R8HA 1SV5A 3QT8A 2MGZB 1R43A 5C25B 3CO0P 2R9LA 3C16B 5CYMB 5KG5A 3DGPB 5DGAA 1YZ6A 3RTVA 2XQCA 2UXDF 2J6TA 2IC3B 3SSSA 4ZVHA 5KFRA 2N4DA 2W9AA 2AJ4A 3CC4S 3NY0A 4RLEA 2E9TA 2MZRA 3HHKA 3A8EA 4G3IA 2AX0A 3PW5A 3G87A 1TL4A 3FCWA 4K4SA 3QFWA 2UVUA 2ZKTA 4TQSA 4I6AA 5HLFB 3CPWR 2XI2A 2MQMA 3GFHA 1PCAA 2XTJP 3THTA 1Q5YA 4YEAA 4B9TA 4USJC 2DNMA 4IDKB 1WDTA 2CQ3A 2X1FA 4R25A 1TTHB 4LJMA 4LF6J 3E3XA 3BO3A 1Y7PA 1DTQA 3CNQP 4YR3A 1YHQS 3PG9A 4K5RA 3C66A 3K17A 3OTCA 1O5JA 3TVZA 1SJ3P 3GSDA 1DQ9A 3GTYX 2AGOA 4KGXB 3HJFA 2X51A 4F3OA 2Y3YA 3J7YI 2DGWA 3IBCB 1RI7A 2RF2A 1CPZA 3OTDA 3MDFA 3L4BC 1XJWB 3HFKA 1VC0A 3LOUA 2KM8C 2XEXA 1BWVA 2VFSA 2C3MA 4YR0A 5J2QB 5L39A 3SCLE 2VQEF 3CJKB 1SJ1A 4F4YA 1OPIA 3BKFA 2YBVA 2CQIA 4NLTA 4N56A 4OX9F 4YDXA 4OYZA 3OR1A 3JB9k 3A8JA 2B5JB 4L74A 1KVIA 1IBCB 4J91A 1WNEA 1NJYA 3JQJA 3GIIA 4LR8A 3UVJA 4UW2A 4ZVOB 3FQLA 2CNKB 2BJ3A 2O5DA 1CJTA 3LTOA 3N6MA 1CJVB 1S7IA 2CVIA 2XS5A 2QYGA 2VA2A 1TKXA 1RT7A 4CRJA 2V50A 3V6DB 5J2PA 1QY7A 2CQ1A 4KKOA 1OQ6A 1IQTA 4ZP9A 1NPKA 5A8WA 5M2UA 4K4WA 4DV2F 1R8BA 2H5IB 2CPFA 3MAAA 3MR6A 2QLFB 4M5DB 2A2DA 3CMAS 2BYCA 3TAMB 2VQFF 1FEHA 3FBFA 1KFDA 4Y2IA 3MPVA 2DNKA 3SSRA 3H20A 4DV3F 1VQ4S 3PKMA 1NKBA 1F2GA 4C98A 1HW9A 4ZCMA 2MZTA 4YP3A 3G6ES 5LSRA 5D77A 4PYAA 2EXUA 2X3DA 1ITPA 1SH2A 3FEYB 3BREA 3HHEA 4ER8A 1DY3A 1B7FA 2EBEA 3HD2A 2IVMA 3HT3A 1U09A 1VQLS 2MKIA 3GU0A 3F41A 5CCMA 1UWBB 4B3SJ 4L73A 2AJ0A 4B3OB 5LXYA 2J9CA 3C15B 2BV3A 1T05A 2ZD1B 1RAHB 3RU0A 3E51A 1UPPA 4HH1A 2DGTA 4GMKA 4RWWA 4DHVA 4USHA 1N4LA 2ZUGA 2C2MB 4RW6B 1NB7A 2IAJB 4HT5A 3I55S 5K9FA 5BYQA 2XO7A 1N36J 2J7KA 4EZ6A 2JEIA 2ZJQQ 4JI7F 2HIYA 3CCTA 1U7LA 2VDHA 1VCTA 4RW4B 5DQIA 4FS1A 1KKHA 1HW8A 5DJBA 5LMUJ 4HH0A 3PY8A 3KLHA 2G1HA 4OZ0A 4KGZB 1LK5A 2C1EB 2DEIA 4QWBA 2ZNYA 2HS0A 5IXUA 2LEPA 2OMOA 2I5JB 2QJ3A 4NXMF 4DSKA 1RHMB 3MEGB 2CPZA 4ZCLA 5DO2A 3VTIA 1IQZA 2B4VA 3CCQS 4TN2A 3R9LA 4YR2A 3T41A 3J81U 2UXDJ 1W2IA 3O44A 2PMHA 4M5GA 3B8HA 3CCES 3MAHA 2KT2A 4MIWA 3AH6A 3QATA 2HBYB 3OTOF 3W62A 1JLQA 4FXWA 1Z2LA 3NNAA 1RABB 1DURA 8AT1B 3HULA 2QZ8A 2GGPA 1RCOB 3E8OA 1RHJB 3CD7A 1FRIA 2ZBRA 2BVZA 4I68A 1EETA 2E5JA 2HVEA 4FVCA 1GXLA 5L9XA 3BDPA 1HWJA 5IS2A 4Q8FA 1F9EB 1HQUB 3BQ2A 3DC2A 3CIZA 2JFKA 4YS2A 1SUQA 2CDRB 5A8KB 3L9ZA 4CZCA 2JEFA 4RW9A 3MPUB 1ACMB 3NBPA 4PWDB 2OO4A 2J0SD 2IRYA 3EPIA 4B9NA 5B0DA 2J8SA 2FPHX 3PZPA 3N9UC 2VBYA 3M05A 3H4BA 2BMBA 3ETOA 1PKUA 1OPZA 4HI2A 2M8HA 2Z8QA 3ENQA 1TUGB 1KHWA 2OTJS 4DFKA 3R27A 2ZDPA 3ZZOA 3K7RA 5CAAA 2HWTA 4NYPA 2C3UA 3HPOA 4J9QA 2XSJA 2HFZA 2MQ8A 2VQEJ 5CH7B 3QJPA 3DLJA 3SCKE 4KTQA 4OX9J 3NCRA 4S0MA 2Y1RI 3FEXB 2PSZA 2Y0SD 4G1QB 3N4WA 2K06A 1U1RA 1RWOB 1E6VA 1DTTB 1LWEA 2KO1A 2ZH4A 1JB0C 4CYUA 3DRSB 3SQOP 1H6KX 1RHUB 2UUCJ 3UN5A 4JV5F 3TX8A 2KVQE 1K0VA 4FYYB 1X4AA 3H25A 2XMUA 4DV2J 4PUOB 1Q5VA 1N5YB 3M8QA 2VQFJ 4JBCA 1QJHA 3N6NA 2OPRA 3AFGA 3MPYA 5HROA 5CZXA 3KHHA 4DV3J 3PFOA 5D0HA 4RZRA 5KG7A 4U8VA 2ZNZA 4GVBB 3EE3A 4DV0F 2FJWA 2R42A 2EKYA 3CMES 3AD8C 1S1XB 3PX4A 3CMQA 1HQ2A 4O44B 2VFVA 5KT2A 3OR2A 2ZZMA 1PGZA 2DR7A 3QRRA 3FK4A 3ILOA 4KFBB 4RNOA 1FXLA 3K5NA 1VQMS 3M2VB 3CD0A 3P3DA 3R3TA 2CQ2A 4W4MA 2RD5C 4F4ZA 4TLQA 3MMCA 2RRBA 1XERA 4ZHRA 4Y28C 4WE1B 3R5AA 1HBUA 1HI0P 1FD8A 4NCBA 2B7BB 2MZJA 3W66A 2IDEA 5A6WA 2R7XA 2G9OA 3M7VA 4I7FB 1UVKA 3CCMS 3UN3A 2FC8A 1G4CA 2FZCB 1VQOS 2DNZA 2MLZA 4ZKAA 3D2WA 1JK9B 3GV7B 1HNXJ 3ET6B 3JAMU 1IKWA 4QWAA 3MEEB 2CG4A 3PO5A 1IBLF 4USVA 4C7QA 4DUTA 1WHWA 4AL5A 1WELA 4NXMJ 1RTJB 1JXLA 1ZETA 5ETKA 5HAOA 5CA5A 4X84A 4CH1A 1JXEA 2PIIA 4V19X 4ICLB 1XN9A 1UVNA 2J0XA 3BN7A 2FQQB 1UEUA 1QSYA 1KS2A 2RDIA 3D6FB 1YZ7A 2ATCB 3M8PB 2NSBA 4LBIA 2IYIA 2KH9A 4DI6A 3SV3A 2F4VJ 1CQNA 1VRTB 1N32F 3SCIE 3C6TB 1S9EA 2DPJA 3AHPA 4LFBJ 4WU2A 3M6VA 3PM9A 3Q24A 2JLGA 2H3EB 4KR0B 3RGIA 2L9NA 3CDBA 3HDSA 1ZA1B 2AWZA 4QOTA 2QE5A 5CYQA 2V4QA 2JC0A 5E41A 1REVB 2HHHJ 1WC5A 1F5CA 4NLRA 1NK4A 2V2ZA 1G6BA 4OMFG 1HHSA 3LA0A 2LQ5A 4HACA 1UWAA 1PILA 3NNCA 1P9QC 1FFGB 2BRLA 3IG1B 4YQWA 3A3PB 2JL9A 1EKRA 3ILJA 3DKDA 1WI8A 2LCWA 2AZ3A 2ZH8A 4CLKA 3LWLA 1RISA 4AL6A 4DQPA 1HMVA 4QYZJ 2A18A 3HVRA 4X62J 3RW7A 3QGPA 4HHUA 2HG4A 1QAYA 1M5KC 1TL1A 1IKVB 4C2MA 4ALZA 4KPCA 4AUKA 5E3PA 4GVLA 5L38A 1HNVA 2BANA 4C3LA 1U45A 2AGQA 2V9KA 1VLOA 4TY9A 2HFVA 1RT1B 4ELVA 1SKWA 1HR0F 2V2QA 4J9VA 4TYAA 2MKKA 3PTWA 4OZJA 5ETMA 3DRPB 4DL4A 4DUYJ 2QO3A 2C22A 2DHGA 1NAQA 1VLYA 4C11A 4DS4A 1VQ7S 3BZQA 4Q2LA 2RE1A 2ZVSA 2GHPA 4JV5J 2P6SA 1S76D 4FYXB 3N5FA 3R2CJ 2E44A 3IBWA 4U96A 1AFIA 1N5TA 3LAMA 2XY7A 1F0XA 4NA1A 4A8SA 4C0HA 2CJQA 3D68A 3NWRA 4URQU 4NLQA 2FGCA 5HBMB 4WIIA 3O3LA 3AY0A 4Y2MA 1FE4A 3FVYA 5L1IA 1HBMB 1UJ5A 4FBTA 4DV0J 1FKPA 5A2QY 1LKZA 2MQNA 5A8RA 2EFVA 3MECA 2CJBA 3UPFA 1B7YB 5HVGA 1MMDA 3DYAB 1Y5NB 5BYRA 4BC9A 1VHFA 4OYMA 2R3VA 4LSLB 4LUBA 4LQ3A 2FJBB 1NH7A 4F4KA 3DRRA 1WC6A 1UVIA 4AQYF 1JNRB 5C5JA 2I1RA 2LA6A 3UCGA 2R7VA 3DM2A 4DN0A 2CFXA 5A0YB 4NLYA 4HEA9 3SFGA 4WP9A 1KLNA 2CNLB 1BUXA 1X0PA 3UFCX 2I9SA 2H5JB 3NG8A 2A2CA 1YJWS 3AODA 3MM6B 4OZ3A 1HWUA 1UA0A 1VBXA 2E5LJ 2Z57B 4PXBA 2HBQB 1YWXA 2HQ3A 1S0MA 1JLFA 5DDQC 4M63A 3LGNA 4HVZA 1SL1A 2N3LA 2W1BA 4CLSA 5IC4B 2HZCA 4F50A 3HHLD 3NNHA 3QT5A 1NK5A 4EEYA 3IA0A 3R5BA 4E8UA 1VOMA 1RZMA 1JKHB 3QT6A 1IBLJ 2APOA 2WHOA 2E9RX 5F3ZA 2K7KA 3Q89A 2UXBF 1C2PA 4ID8A 2OPQA 1V5IB 5FIIA 5KTQA 4BWMA 3KDNA 2QMWA 1L5UA 2ZDOA 2LQ9A 4ECTA 3ZZRA 2RT3A 1SC6A 3D9BA 4USTA 2P2CB 3I4HX 4ZVTB 1NSAA 2WAQD 2C2OB 1S6PB 2Z2ZA 2RH3A 5HJXA 5GVQA 1N32J 2ZH1A 5IT9Y 1H73A 3K57A 1VI7A 2UUBJ 3NLCA 4NXNJ 5KFYA 2ATLA 5KFTA 3G71S 1UP1A 1RAEB 2R7SA 2J6SA 2KFZA 2FD2A 1A6LA 3HHLA 3HX9A 2ADBA 1TL7B 2R7UA 4LIWA 5AXKA 4B3RF 2K1RA 4BLGA 2W4CA 4RW7A 1TL5A 2V4JA 4PWWA 1X4CA 1JXVA 1S48A 3KTQA 2RKIB 2D9PA 2HHXA 2VG6A 2HGNA 2FDNA 2JNJA 3I5BA 3LP0B 4BC7A 2YNHB 2ASJA 3WC2A 2RDJA 3ICLA 1RWPB 3T9ZA 3MM9A 1C1CA 1P1TA 1YRXA 3CCJS 1Z1ZA 3BM7A 3I5AA 1VR6A 1RWMB 2MEWA 4MJKA 2HSEB 3BB5A 4MKYA 1M5HA 4IRDA 4O4GB 4A8WA 2CKWA 3ZTQA 1Q95G 2MKHA 5IC6B 2OUGA 1GFWB 4RUAA 2JJ4D 3OJSA 1HR0J 4JP8A 1RT5B 4C0OC 1H2TZ 1WOPA 4JI3J 3AOCA 3G82B 5HQLA 6FD1A 5AXLA 2QYCA 1PJ5A 1QSLA 3WC0A 1FFWB 2E9ZA 1UCNA 4KSEB 2DPIA 3I9ZA 3R7SB 3NCPA 4U7CA 3M2UB 4L6V3 4NCGA 3A4TA 4LF2A 3M30A 1O8BA 4KT0C 4NI2A 5J1EB 1C4CA 1R31A 4NEZA 2CAJA 4CH7A 1J5EF 4WF9Q 4LF9F 4LREA 2CXEA 3C6UA 3TANA 1CS4B 2DO0A 4J7CA 1R6VA 2CPDA 3D3CJ 3VVUA 1YJVA 1K1SA 3HM9A 2VG7A 4O3QA 2NXEA 2EC0A 1TVRB 1FD2A 1DLOB 4FXVA 1RTHB 1JLGA 3KJVB 2IHR1 5EWGA 1EB0A 4HT7A 2IM0A 3EGVA 3HLUA 2OFGX 2YXLA 4ETXA 3X3UA 1VK8A 2B8PA 1RAJA 3AD9C 2JVOA 3KJFB 3PW0A 3CCVS 4C9DA 3HD1A 3VAJA 3IAS9 4RBUA 5DG9A 2ZM6F 2UU9F 5C24B 5D0GA 4U7UD 1NMEB 2BX6A 2HMIA 1VQNS 4A8QA 4LBHA 4PKDB 4OI4A 1AZSA 5J2MB 2CPYA 5AE2A 5D6GA 5HI7A 5K5MA 3TUZC 3UR3C 2F63A 2E1PA 1U26A 3EUNA 1UVJA 3KLIB 2YWKA 1Q7YT 4USIA 4OZ1A 2E7VA 5AJ3F 1FRLA 3QWUA 1GT8A 4N7TA 1ULRA 4PABA 4GC7A 2ZH5A 2E66A 3M8ZA 2G4BA 1CJKB 2YTCA 4IH7A 2BJ1A 4FXDA 4MYUA 4K8RA 2BQ3A 2A0FB 1N5QA 4LRBA 2UXBJ 2BJEA 1QAXA 2HKEA 1VDHA 2DNHA 2OSQA 1PAEX 2C2DA 3TZZA 3I0SA 5EN1A 3PCOB 3NMAA 2VPZB 2E1RA 1R0BG 2Y0BB 1ZAWA 2HNDB 1RU1A 3UCUP 2EFPA 1U4BA 2IPOB 3NS5A 5KT7A 3K2YA 1R0AA 1N34F 1F9FA 1VRUB 2EKNA 3LP1A 1U1NA 3UD5A 1JIHA 1E6YB 4JI8J 2VBWA 3RRHA 1KOOA 1S5ZA 2HYIB 4Z37A 1X7VA 4K4VA 5D0EA 4Q8EA 4DF4A 3MMBB 1VFJA 1VS3A 5I42B 1TUWA 3KLFB 5DG7A 4M5JA 3J7AN 2YVSA 1C0UA 4FYWB 3CJ3A 4V19J 2B6AA 4DR4F 3DRYA 2JLEA 1TQLA 3O6QA 2DD8S 5E33A 4G65A 4LMZA 4DPOA 2HFNA 3MXHP 5KOXA 1TKZB 4IOCQ 3BYRA 1ZH5A 1WSVA 3M1VB 3BYPA 2W9CA 3NL0A 2MHEA 3K59A 1T03B 3PJWA 2E5GA 1QVFR 4U7UK 1PC4A 3TRGA 2PMZD 1R89A 3G8TA 3TW0A 4ZJLA 2AQ4A 1FERA 3MHYA 2IJNA 1WUUA 1AA1B 1B0PA 4K0KF 4WZMA 3D54A 3QZ8A 4J5OA 5E0OA 4Y65A 4UUWA 2OI2A 4ZVRB 1UEKA 4RW8A 2O67A 2XMAA 1SL2A 2W2QP 2HURA 4I4BA 3KLEA 4A8XA 3K5MA 1W7WA 1EHWA 1R6YA 4QQBA 1TK5A 4M94A 1VK3A 1WKLA 3V6KA 3HMJG 3IS9A 2VV5A 3NS6A 1FNXH 4WYLA 5HP1A 2VUGA 4XAKA 3F44A 3MTKA 3BGRA 5DG8A 2FLPA 3I31A 2B4OA 4MFBB 2JC1A 2FJVA 2IVFB 4DXLA 3HHNB 4ECVA 2MYFA 2ACMA 5B0BA 2GIQA 1T9UA 1J5EJ 4QR2A 5LM7E 4XPEA 4LF9J 3ZNJ1 1FRHA 1AT1B 2ASDA 3F0NA 1VQYA 3ZTPA 3HXMA 4EBDA 3MUVP 1D8ZA 3CO9A 1RACB 3I96A 4EK2A 4ZVEA 4DN9A 1LWXA 1X4EA 2HPUA 3ENWA 1RYSA 1RTDB 5GADU 1YGYA 2V2VA 4RX6A 3CJ0A 3N01A 1G1XA 3MPWA 2ZE2B 4X4TA 1HBOB 3H90A 4YB5A 4DPYA 2UU9J 2E5IA 4M5IA 2V8VA 4HLBA 3JSBA 3QGGA 4JI4F 2UVRA 1O0PA 1RXOB 4WU3A 3HP6A 4MT1A 4CO2A 4R5PB 3LP2B 2IA6A 3AB2B 4NRUA 2J0WA 3P5TL 3QWPA 2WVEA 3M9NB 4H4OB 3O1LA 5AJ3J 2BOAA 3JQKA 5HVHA 1OY6A 4CO5A 2XLKA 3PKYA 1IM4A 1ZAVA 3EDRB 4WKYA 4NWBA 4OJHA 3W60A 3BEGB 1TKTB 4DBQA 1XMBA 3MM7B 2AKWB 2VD3A 2DGSA 3I32A 4OJGA 2XLIA 5K14B 3H0PA 2ZD1A 4NL5A 4J37A 1X60A 3GR1A 4ZCKA 2OPSA 4LVOP 2XMJA 4EFAC 2W2OP 3CW2C 1VYAA 1D09B 1TR0A 1ZA2B 2YNIB 2W24A 5HMYA 3KXDA 4J9OA 5L1KA 1U2RA 5HMXA 4Q45A 3GFYA 2QA2A 4OYPA 4ZK7M 2JEJA 5GMKa 5C2CA 5CZVA 3EGNA 3SDEA 1C0TA 2VPXB 1N34J 2F4FA 4HI1A 2OSRA 1T3NA 2WB4A 4ZJQA 4YB6A 3GQCA 2D1CA 1B70B 3THPA 2R8JA 1NSQA 1S6QB 2HVHA 4URSA 2DGXA 1U1PA 2KDOA 4I0WA 4DU8A 1JLBB 1OWXA 3OXLA 4USMA 1HPZB 3DI6B 1MSWD 2J6UA 1D9DA 4ZS6A 4WP3A 1U2FA 3ISZA 4PG5A 1CC7A 4R0EA 3GLJA 4ATNA 2MKCA 4J9MA 3PXGa 1HYSB 1YK9A 2GVZB 3TYTA 2AV5A 3H42A 3EVMA 2K7JA 1M1KT 1IVZA 4D3HA 4KO0A 3AJ1A 2VJVA 3Q8SB 4ECXA 1I3OB 1TZ0A 3AXKA 4OHXA 1V9OA 2SXLA 5L1JA 3CCZA 3TOQA 2V67A 2JRSA 2LQBA 4TU8A 3VVTA 3CUNA 3V4MA 1HQUA 3SZ2A 4K0KJ 3MMAB 3SEOA 4TKTA 3KK3B 5E7OB 4ANDA 3DOLA 4F3QA 1VBZA 4LT6A 1BQMB 4CT8A 1TL3B 4R8UB 4PWDA 4X4VA 3QLHB 2BRKA 4DU7A 3IBFB 1FXRA 2R8GA 3BSAA 2HS4A 4WP8A 5CABA 4KC5A 4CTAA 1HHTP 2GMHA 1VRQC 3KFWX 1TAUA 2B9XA 2K3KA 2DCLA 3T9NA 1TU0B 1HNZJ 1BGXT 4Y00A 3D1HA 1WG5A 4X4RA 4HL9A 4OX6A 3O5TB 4DR1F 1SJRA 2M9KA 1WTBA 2CPJA 3VGSA 2XWXA 2VC0A 1MLAA 4J9SA 3ITHB 2ZHOA 2P9GA 2NZCA 1FRXA 3KK2A 1X0FA 5KT3A 2XHCA 2DY9A 4MK9A 2B56A 4DL3A 3HSJA 5ETOA 2C42A 1XNRF 3MUMP 4G1QA 4JI2F 2N7CA 1IJEB 2EEYA 4P7TA 2RAQA 4DSEA 1KQKA 4IFYB 5KFJA 1LW2A 4CIOA 1GH8A 1RT4B 5CYJA 1UAWA 2QN6B 2QG9B 4IKAA 4F0KA 1YRUA 1EJ7L 3RW6A 3T6JA 3KDOA 1SB6A 5HSPA 4LSNA 1FEEA 4XPCA 3VZHA 4JV2A 2KL8A 5GAGI 3C2PA 4MKVA 2H4YB 3RB3A 1NHUA 4NMLA 3NGTA 2JEGA 1V3SA 1NU4A 1KBRA 2K2PA 2ZZTA 3PR4A 4JI4J 3CF5Q 2BXJA 2A6MA 1NXIA 2GC8A 4BHQA 1KQGB 5G4DA 3VAFA 5DGBA 4I6WA 2E29A 4DR3F 4BCAA 3MOJB 3TJ9A 4WTYA 1TV6A 5EDWA 3B78A 3B4DA 1CEZA 2WOMA 4X4OA 1OYEA 2XS2A 3TA2A 3GIJA 1ZYQA 2O1PA 4Z7YA 2DNPA 3FCHA 2Z2YB 2KFYA 1S1WB 2DCUB 1YJUA 2Q6CA 3CCSS 3OUYA 2FZGB 2ZOGA 3FBEA 4N41A 3I9V9 1O6XA 4KGVB 3RG6A 4M5LA 3A13A 1EQMA 2BDPA 4FF1A 3TR5A 4ZDNA 4ID5A 2VJUA 4M5NA 2NR0A 1CSJA 4JYAF 2UXCF 1LWFB 2W4PA 1LWCA 3KG0A 2H4WB 4OL8A 2KVIA 4O0NA 2G1DA 1Y3KA 1SV5B 2ZKUA 4XDCA 4LRFA 2QV6A 2NYHA 3MEEA 2DGQA 3G6VA 1VGYA 3UQSA 2WTFA 4W98A 4EBCA 2DBBA 3WIVA 2B0GA 2B4UA 5CD4H 3FFIA 3ZZ0A 2BE9B 2L41A 3U27A 1JLCA 2BJ8A 2BOPA 4PXDA 2P9CA 4AXJA 1FHTA 2M52A 1GMUA 2CPIA 2MSSA 4JI1J 1NNDA 1V5VA 1I51B 1QLNA 2FHJD 1RWNB 4NPOA 3OLAA 2F7VA 4HTIA 3JSMA 2F9JA 4J9LA 4WYWA 1K9MT 3M4XA 3C14A 2KM8B 1DTQB 1S99A 3HKWA 4TLRA 3W1YC 3VHQA 1KVJA 2OGUA 2H5EA 1VHIA 4P2FA 1FRKA 1SVDA 3PHTA 2HNZB 3DLEA 5E3QA 2R7OA 2W7AA 2MZ1A 2RF2B 2WSCC 2XHWA 4K4XA 3EX7B 1SJ4P 1NDLA 3OFFA 1PBUA 1IKYA 3UW1A 3OTEA 1SXLA 1Q0NA 2DNQA 1FX2A 4UY85 1X9WA 3U7JA 3L95X 1B99A 1JJCB 1K0TA 2WSFC 2DTJA 3MFIA 3VZIA 1NDKA 4DQIA 3W2VA 3A3OB 4MMOA 3K5PA 1WHXA 4R0JA 3OR1B 4FPRA 1NK7A 1OS5A 5ETSA 4L75A 4ED8A 1NJIT 1KOHA 4DR1J 3UVJB 5B0GA 3GYNA 4UQTA 5KFNA 4O23A 1VISA 3LWMA 1NK9A 1PYSB 5IM0A 2HHSA 3G2XA 2FHJA 1NPPA 4C0BA 4LF6F 1BQXA 2RQMA 1FA0A 3OV7A 1TKXB 1RT7B 4QR1A 2KT5A 5B0EA 2BKOA 4FBUA 5J2PB 4DL0C 3Q8VA 2C3PA 2VODA 4KKOB 1CJUA 1ZOTA 4AFFA 5A8WB 3AAWB 3IMQJ 2Y1JA 5I3PA 4WK1A 4ZMMA 3MAAB 5IFMA 3PVXA 1WC1A 4RBTA 1K73T 3LPEA 4CI0B 5KFEA 2AJQA 1RWUA 1NPRA 3BDEA 1WD6A 2IBOA 3DLGA 4DOZA 1EX8A 2HVZA 2RRAA 4DR6F 2MKSA 1U1MA 4DV7J 3ZTRA 5J1PA 3LALA 4XK8C 2JDJA 3NMRA 3DN9A 3EXCX 4RUHA 2EI5A 1P6TA 2XB2D 5SZTA 3DDIA 4OHZA 1NUEA 1KEKA 4PRFA 3OQ2A 2KYXA 4C6AA 1B4SA 4DR3J 2HQGA 5F3TA 5GAGU 3CJ5A 3BKTA 1T05B 3FSXA 3CD6S 3PX0A 2Z2MA 2R8KA 2MZQA 4DR5J 4P2MA 5KFDA 1T11A 1EP4A 1H2VZ 3OD2A 4DV5F 4HDGA 1XTZA 4HTJA 2ZC4A 3VQSA 3AQPA 2AEJA 3MTJA 4ED5A 3R2DJ 3BS9A 3KJQB 5D8HB 1ZM4A 3UDLA 1M5OC 3CJQA 2LXIA 2KXHA 4ZLNA 4KRWA 3OVAA 1RYRA 1UL3A 3VAMA 3MM6A 3KLHB 3W5YA 1KLMA 2HZVA 3O8WA 2UXCJ 7AT1B 1Q53A 2W2MP 1AYEA 4OHVA 1OQ3A 1Y10A 1VQ5S 3V4IA 3D1OA 2KJWA 1UETA 4QWCA 3ONQA 5B08A 4QU6A 3MEKA 3IN5A 2FVCA 4N77A 2V8GA 5JUMA 4RJVA 2YKNA 3H98A 4ZPCA 1N0VC 3FUYA 1Z4UA 4ANEA 5IT9U 2DKOB 1CVJA 2PI4A 4B3SF 3UDVA 4DPWA 2XSFA 5H9FJ 2YNGA 3CJRA 2PGCA 1JLQB 1TELA 4DFMA 1SQFA 2A1BA 2RS2A 3CXCR 4L76A 2LYVA 1H7WA 5K8NA 4Y3CA 3C3LA 3QSYB 2GGPB 2DNNA 2CQ4A 4ILRA 4OI3A 2VL1A 2CPXA 1EETB 5EHHA 3TQ1A 1UPMB 2YKPA 4ILMA 2KXFA 5B0FA 3B6BA 4UY8T 1R8CA 2LU1A 1PYTA 2E7XA 4G1PA 1S0VA 3HHDA 4Y2CA 4A46A 1AW0A 4CO1A 5LMUF 1SUQB 1WTFA 3UE2A 4ANCA 5KT4A 3HF5A 1CULA 2IRUA 5D3GA 2VH7A 4IQXA 3NBPB 4KV8A 2G2ZA 4DSJA 4OX7A 5F0WA 4B3MF 2HFUA 1TK8A 1N5VA 4ED4A 3MMJA 1RAGB 1ZTWA 2V63A 1SPBP 2ZVIA 2F65A 4ERDA 1RA6A 4UOCA 1JWWA 4F4AA 4ZPBA 3WDOA 4OIXA 1N88A 4A8OA 3FRYA 3WZ0A 3IR6B 4B3TF 2V94A 4I2QA 3QNWB 3NGKA 3NP5A 3ZZTA 5LXRA 3I87A 3M32B 2C2NA 3TI0A 2XSJB 3PRBA 3OHBA 1JLAB 5BYSA 4PQUA 2JLFA 1W26A 3GE9A 3DRXA 4ZOSA 3DOKA 2KTQA 5AE3A 2D3ZA 4I56A 4RBVA 1PYOB 5IQ6A 2QMXA 4CDIA 4QIFA 1YG0A 1E6VB 1LWEB 5DETA 1RKJA 2Q3PA 3FBBA 3VAKA 1RUSA 5G0RA 1YVFA 2I0XA 3NOGA 4CYUB 4ZN1A 2WB1D 3O2IA 2BJDA 1FKOA 3HKZD 3NGDA 3HVTA 2OFHX 4OLOA 3W8PA 3I82A 1VQ9S 3MEDB 5M2PA 1SJQA 3EGWB 4NLSA 4DX6A 1BLUA 3G82A 5F8JA 3M8QB 3TZXA 2Y9HA 1ZBTA 3T1YF 3R8YA 3K0JA 2OPRB 1OMSA 5HROB 1TKDA 1YLXA 5F41A 3SBMA 4JOUA 3FRZA 1FI4A 1U0HA 4KQZA 3M8WA 4DR6J 4P6QA 4IQMA 4CLPA 3GWCA 1UFLA 4PG4A 3RAQA 3OR2B 1FK9B 4IOAQ 4FDFA 3CIMA 2NPFA 3UNGC 2HRYA 3Q0AA 1D9AA 5J1NA 4WXOA 3P45B 4B9SA 3CCRS 5KG3A 4W90B 3MMCB 2P9EA 3NRBA 2VA3A 3DU6A 3KNAA 4ZHRB 1HLWA 1WI6A 2GMJA 5F0UA 1HBUB 2PDAA 4F3MA 2ZFHA 3OPKA 4DV5J 4U8YA 3WX8A 4ZVPB 2UUCF 2VASA 1SL0A 3BF4A 2B4PA 4KYZA 4FYVB 4URGA 3U1MA 1LQ9A 5CCLA 3UD3P 3D5MA 4WFNQ 2MZSA 1WACA 1T95A 3NGSA 3RBEA 4F7VA 4GRSA 3FMBA 1KP6A 4QWEA 1IKWB 1EKSA 4DV1F 2FLLA 3W2WB 2DR5A 3GV5B 1B3TA 1A0OB 3CC2S 2DH9A 3THVA 6FDRA 5K8PA 3MR7A 4KIAA 1N48A 1AROP 3RRKA 4JI5F 2HGMA 2BE2A 4OYWA 4I2PA 2V6AA 1IWAA 3OSPA 2BM0A 2Z56B 1IKXA 3J7Z5 3SXLA 4UZBA 4ED6A 4NLXA 2IM2A 1GTHA 4DV4F 1FRJA 1TAQA 3PFEA 2DEJA 1P9YA 5JXSA 2HNYA 3V81A 4F8RA 5KFZA 3JYTA 3TUJC 3P6YC 2J7UA 2L3MA 2D7SA 2GW8A 4A8YA 5CYQB 1OO0B 3W5ZA 3VAHA 4RNFA 2W8KA 4ETZA 3IWNC 2DXFA 1ZM2A 1A9NB 9ATCB 1HNXF 5EGYA 5DM7Q 2VFUA 4IFVB 5LJ5Y 2DHSA 2OELA 4HACB 2AYBA 4U95A 3P96A 4F4XA 2G2OA 3OTBA 4FP9A 5B0AA 2JZ5A 4CO0A 1KTQA 3IR5B 2OLWA 4B3MJ 5F9NA 4L3NA 1Y4ZB 4EUVA 3DHWC 3SCJE 4WPAA 3L09A 2FHKA 1Y3JA 1IR0A 3TJAA 4MIAA 4V1Ak 1NKCA 2OKQA 1FT8A 4NX9A 1HMVB 1FRMA 1G2EA 1R8HA 2MKJA 4P9SA 4A4JA 2ILYA 3F56A 4LRCA 4B3TJ 2VOPA 1S9GA 1TL1B 2G2YA 4O3SA 2Z2LA 2F4VF 2EFQA 1TKZA 2V8PA 3I0RA 4QYRA 3POTA 4LF7F 1HNVB 2BANB 4LFBF 1N5SA 4PG8A 4TNOA 1HBNA 3BR8A 3N79A 4PQAA 1L3TA 4DCJB 2RDDA 3B82A 2DIVA 3R1LA 2FVSA 3H5UA 3QIPA 3D28A 1LW0A 2ZH7A 2YNFA 2HHHF 4B9VA 2ACYA 4LFCJ 3N0VA 2LP4A 4B9MA 2RHSB 5L46A 5EX3A 1RT2A 4C11B 1RDRA 3RAMA 2F3JA 1V6HA 3T5LA 4OYOA 3TARA 2FY1A 5F8NA 1X4DA 2RQKA 1XQIA 5LL6d 1PG5B 1U0SA 2LXUA 2B3TB 2LDYA 5A76A 1HWKA 4RU9A 3KWMA 4DLEA 2AZ1A 4UZCA 4ZP6A 3QJJA 2IBKA 3T1YJ 3T3FA 2AEFA 1HWLA 1UTAA 3OL8A 2B8QA 3R6GB 4N8OA 4X62F 4KH1B 1RB0A 3KKFA 2FVRA 1FKPB 3W7BA 1FWLA 4OHYA 5A8RB 3EICA 3MECB 4ECQA 3NCQA 4M5KA 1S1TA 1Y5IB 3S6EA 1M5VC 4BS2A 3OBIA 2B9WA 3T1AA 1KNZA 1WKJA 4X2BA 4WIQA 3D1QA 2Z30B 1T9WA 3DRRB 3MUTP 2WBRA 1F3FA 3DM2B 4UF4A 3BGLA 4Q0BA 1N6QB 4DUYF 4ES2A 3E01A 1DQAA 2A3JA 4XO0A 4UOGA 3EPGA 4OZ5A 3R5GA 4ED3A 3CJ2A 3DGVA 4DQRA 2O01C 1J27A 3PNIA 4ZIVA 5J2NA 1JLFB 3J7ZT 4HR2A 2ALZA 2J76E 2J8AA 4O3PA 3CJ4A 4EWTA 3M8RA 3QGHA 1K8AT 4LBPA 2HFSA 5KFXA 3H5SA 2X3GA 1FJCA 4IYQA 2C2KB 1DHMA 4DV1J 5B7WA 2B43A 1PO6A 1SBRA 5MLCV 2YWHA 4IG0A 3KK1A 5GMDA 7FD1A 1ICEB 3J81j 1I1GA 3J7A1 5H9EK 1I94F 2OPQB 2ZJPQ 4DG1A 2O66A 4JI5J 2CNNB 1IUJA 2PO4A 1TP7A 2W4DA 5IWAF 1JJ4A 2JVRA 2KN4A 3M6XA 4A8FA 3PR5B 3H5YA 2I2YA 3H2LA 3FZ2A 4DV4J 4OYBA 2M8DB 5F9LA 1MWYA 5K14A 4OX8A 1T7PA 3QRPA 1AXQA 3HCXA 1X4HA 5C2GA 1QTNB 2E5LF 4GKJF 2WVDA 4EU0A 4ECYA 2YNIA 1S6UA 1YJNS 3RZAA 4M5MA 3CB4A 4FNHA 3MM5A 1WG4A 2JHEA 3KLGB 1U6FA 2YPYA 2OP5A 1H74A 4F2RA 2YPZA 3NOCA 3HHLB 2R7WA 3K89A 1UW4A 2Y8WA 3LAKA 2ZEJA 3BSOA 3CDEA 5D4LA 1DRZA 1AUDA 3QRQA 4WJBA 1SC1B 3W5XA 4RW7B 2V4JB 1S59A 3MCSA 3JQMA 4RKUC 3EVOA 5DQGA 2AJFE 3N5BA 3OW2R 2VG6B 2YKMA 1UMJA 1QSSA 2E7WA 3KYLA 4PXCA 2DJWA 1XR5A 2GVDA 2RU9A 1S6OA 4K2XA 1HNIA 2RQ4A 4KGMA 3MM9B 1C1CB 1ZAXA 3V2UC 3FCVA 4YMEA 4LR7A 2W9BA 2GVZA 1XMQF 4LF7J 4X4QA 3LH2S 2UUBF 1NEEA 1Q1KA 2XC9A 1WEYA 4NXNF 2IYGA 4C3KA 3PIOQ 4ZN3A 4WZQA 2XMMA 3OXFA 1S77D 4OQJA 3DMJA 4NA2A 4I1TA 3DLKA 2GFFA 4DL5A 1RBAA 3TAPA 2VC1A 3W63A 2M3DA 1X5OA 1T0TV 1S1VA 4CO3A 2ADCA 4FVMA 3BGUA 1H72C 3TNVA 2C2ZB 1JNZB 1S7HA 3QBCA 2DHHA 3T5KA 4NCGB 4LF4F 2VG5B 4H4MA 2RRNA 4WKRA 5B09A 1BWEA 2NZ4A 4NI2B 2CIMA 4HYKA 1L3VA 3Q8YA 4ZP7A 2AF6A 4C8YA 3QO9A 2PT0A 1H0HB 2POKA 3PYDA 1H3DA 2EK6A 3IGNA 5KG1A 1SCJB 1U1OA 4RWXA 1FTRA 2H9ZA 2QSWA 3DOMA 1YJ9S 1ZZNA 1DARA 1GX6A 3CCUS 4QW8A 4LSZB 3H2UB 3ENVA 4TQRA 4IG3A 1JLGB 4TY8A 3VR1A 4CLZA 4WWSA 2A6OA 1ZPWX 3TZWA 4NEYA 3M9MB 2YWGA 1FTCA 2R2UA 1Y11A 3W9HA 1GXUA 4K4TA 3PACA 1NRKA 1H7XA 3HFZB 3KJNB 4KH0B 1N33F 1HL6A 4ECUA 1KN6A 1TUVA 2DRBA 4JI3F 2MQOA 2GQ2A 3CT9A 1X9MA 2J9DA 2HMIB 5E3RA 2KKHA 3ILIA 1S79A 5CHCB 3TVKA 3EZ5A 2PMWA 2Y1LB 2MQQA 2VHGA 3TVYA 4I64A 5KOWA 2NQPA 1PJ6A 1UEVA 3RJMB 5HQMA 4F0MA 2DH7A 2IMOA 1GAOA 2M4MA 1U02A 4YFUA 1Q79A 3CDUA 3CCLS 1C1BA 1NBEB 4NLVA 2DHXA 5ETLA 2HS3A 2ZWPA 5KFWA 2V2KA 2FJDB 1SKUB 2WRMA 4KHPF 3G4SS 1MW7A 2MXYA 3CSKA 4WFXA 5MAOA 3LQVA 3Q2SC 2OTLS 2LMIA 4IOBA 2VBZA 2AEMA 2QLBB 1YRTA 3C46A 4IR9A 3RYLA 3W61A 2AJ1A 1I94J 5E2QA 4C8KA 4DEZA 4ZVFA 2HQIA 1P27B 2GCFA 1VQ6S 1ZTTA 2WVCA 5T7LA 2BJ9A 5IWAJ 3QMQA 4ITSA 3R5CA 1Q7LB 1L3UA 3I0SB 4DMZA 2B9EA 3UDCA 2NPIA 2CG8A 2V5HG 1L3SA 1RBOB 4PXEA 1YQHA 1FDBA 1R0AB 1IBKF 4KHMA 3Q2TC 2GHWA 1XIQA 3VALA 2CQGA 3LP1B 3QGIA 1AFJA 1PSDA 2ZOFA 3ZO7A 2AT1B 3L7OA 4GKJJ 4Q7AA 1V3ZA 1HQEA 2LEBA 4O0IA 2LKZA 1S4EA 5I3UB 1RJJA 4M5HA 4RL1A 2D9OA 4LF1A 3DLLQ 5D4NA 2F8MA 2IY5B 3MCMA 5CXTA 1RT6A 1QE1A 2ABYA 1C0UB 1VIXA 2B6AB 1FDAA 5FDLA 1S12A 3JS9A 4TXSA 1RHRB 1SKRA 1IR2A 4IH6A 5DLFA 1NHVA 2WONA 3HZGA 2MY7A 2YH0A 1JLEA 4G6VB 1BQNA 2DGVA 1FFSB 4EI2A 4A47A 2NXJA 3ZC4A 2MY8A 3CC7S 2W9CB 2PN6A 5AE1A 1VIOA 2Q66A 1RE1B 4LR9A 4CCHA 3TA1A 3IM9A 3WBZA 1KWMA 1VJWA 2JOQA 2NS1B 1RWWB 3G86A 3SI8A 1HIYA 4ENOA 1YBUA 2Z58B 1MN9A 1XMQJ 1QVGR 1MROB 2BACA 2L48A 4JI8F 4DFJA 2XMKA 1VC5A 4U9RA 1S72S 1F2HA 4O3OA 2VU5A 3BH6B 3N6LA 1VBKA 2PA3A 4GO5X 3GFXA 4RW8B 3HVAA 1SQEA 4Y2AA 3KLEB 1S4FA 3D4JA 3IXQA 2GNKA 1UA1A 2RB7A 1HHQA 3IS9B 5HP1B 2HNZA 4M8LA 5BR8F 3US5A 4MIBA 1S97A 1S1UA 3BGRB 3EM1A 1T3OA 4YDDB 2MSTA 4HHJA 3HK2A 4LF4J 1Q78A 3GYXB 2LEAA 1KVKA 3P4UB 1WC4A 2CJAA 2BW7A 2FIUA 4ZVGA 1X31C 2VICA 4NRTA 1NH8A 1JJ2R 2QL9B 4ZLPA 1Q4RA 3HHLC 1UJ6A 2LA4A 4P71A 3GZ7A 3KG4A 1T9VA 3CVKA 5KFOA 3JSYA 1FVQA 1WOSA 3WX4A 2QC3A 4J90A 1Q8KA 4DR7F 2O3DA 6AT1B 3FJ2A 3D6MB 2CZ9A 2UUAF 1BD6A 4C3MA 1N33J 4KE5A 1KDNA 3E2EA 2HK3A 5BJRA 2WK4A 3T6BA 2MPUA 4KY3A 4DPXA 3HFVA 5DZ6A 2ALYB 3GJQB 1WEZA 1T02A 4N47A 4DS5A 1MN7A 3IWLA 1XR7A 2W7PA 1N56A 3MM8A 3EYZA 3GONA 4BWJA 5CD4A 4BDPA 4CM2A 5GADI 5HL7Q 2HRTA 5FLXY 2BW2A 3D0GE 2GQCA 3GG0A 4KHPJ 4UUXA 4C97A 2WW4A 3MI7X 3EJMA 4DZDA 2C2RA 2BKNA 2R7RA 1ZPVA 5DDPC 5C42A 3QAEA 4O3RA 1T9XA 5L1LA 2RHQB 2NUUG 3A3NB 2XYGB 1PAUB 2ASYA 1D8YA 4F4WA 2RMLA 3CEDA 2OPSB 3DXBA 4FKXA 5IZHA 3G8SA 1YJ7A 2ZHAA 3TEGA 2RIJA 2OIHA 1WF1A 3EZUA 1HI8A 3PEHA 5ETTA 1EAYC 3ULHA 2DK2A 2DGUA 3U02A 4ES3A 1KQSR 3PDNA 1S0OA 2XO6A 1IBKJ 4ZPDA 1FDDA 2MQPA 4DSIA 3SDEB 1C0TB 4B08A 4FF4A 4QIGA 1FX4A 2UVVA 4C48A 4CLUA 3EGZA 1LK7A 5IV3A 4WFBQ 4K4UA 2GO8A 1R3NA 4IO9Q 1J5OA 4DX7A 3Q8QB 1RT3A 1RCXB 1R8AA 2YH1A 2GAGC 2UV8G 3TZYA 4FYDA 2KZZA 5A6PA 3M9OB 3MURP 3OVSA 3GMGA 2R7TA 2HQCA 3R6LB 5I4MA 3QT7A 3PW4A 4DPTA 1GNKA 3G96A 2WW8A 3G6YA 2NYIA 3EVWA 2ASLA 2E1MC 1MU2A 2CNOB 4DX8H 1RWVB 1TMJA 4USKA 4C8NA 3SQGA 3AA8A 8RUCA 2IIHA 4KO0B 2R2SA 3QSIA 1N0UA 1OJ4A 4ED2A 1IJFB 1SC3B 1GMWD 4KB7A 2DIUA 1YJRA 4QIWD 3H40A 4ZLJA 1SH3A 5EUHA 4X4PA 4ILLA 3GIKA 4DFPA 2MHNA 3Q8RB 4OFZA 1GMVA 3JTNA 2MJNA 5IOLA 3Q83A 5KG0A 4C4WA 1I5OB 3MR2A 4KGKA 3RR8A 2OAUA 4QIVA 3R7BB 2DNLA 2IJFA 3M8YA 3G6XA 4ECSA 3DOLB 3M2RA 1DBDA 3HT0A 2HHTA 1WKKA 4F0HA 2VPYB 2OPPA 3IRXA 1ZM9A 3TJ8A 2BR0A 4MKAA 4CTAB 2IJRA 3D67A 2MGZA 4P2XA 5C25A 2GJIA 3C16A 5BR8J 3PO4A 5CYMA 3D3BJ 1HFEL 3DGPA 2IFXA 1NCLA 2YKOA 2IC3A 4OZ2A 3DLBA 4TVAB 5KFBA 3VGVA 3K58A 2J0QD 4M95A 3MOZA 2HWHA 3M32A 3SSQA 4QCLA 2GV1A 4YB7A 1JLAA 3KK2B 2HAFA 1QUPA 3TQEA 3J7YU 1X5SA 3FC9A 3JTPA 1GMWA 4DCPB 2UVWA 1U6BA 2HWIA 5AT1B 1BHNA 3NXZA 3T5HA 3UI3A 4PCQA 2G0JA 4JV1A 5HLFA 4EBEA 1UKUA 4LRAA 1LW2B 1QDUB 5E3AA 4IDKA 3QZ7A 4DR7J 1VBYA 2BQUA 4ES1A 1FCAA 2UUAJ 4LSNB 2RJZA 3BO2A 2M7SA 3CGIA 3MEDA 4USUA 1IM6A 4O3NA 3ELHA 2AX1A 2PC6A 3GJRB 2D3O1 3IAM9 1HNZF 3LPYA 4WXWA 2MDAA 1AUSL 1D9FA 4D3GA 4XIUA 3SMZA 1TV6B 2IVYA 2BZ2A 2W2PP 4LRDA 2OEKA 4DL7A 3VGUA 5J2QA 2WOMB 2XBPA 3CJKA 2I38A 3D0HE 2QL7B 1FK9A 2K8GA 2QTWA 4FZVA 1M1HA 2HHVA 2WVBA 2KXNB 1NO8A 2B5JA 4OI2A 4Y34A 2VBXA 4AD6A 3OUYB 3RUBL 4J9KA 2Z0GA 1Y00A 1F60B 1JX4A 4DL6A 1CJVA 3NKYA 1U25A
chains in the Genus database with same CATH topology
2W4CA 3T19A 1P1LA 3RB0A 4OJ3A 4RW7A 1TL5A 2V4JA 5F8JA 3M8QB 1UJ4A 2HAIA 3TO8A 1ZBTA 3T1YF 4ID5B 1JJHA 3V6DA 1X4CA 3MM7A 1XNQF 1YIJS 2HLUA 4NLGA 2Q6BA 3K0JA 2OPRB 1S48A 3KTQA 5HROB 3H2VE 2RKIB 3W3SA 2D9PA 4FNIA 5F41A 1TKDA 2UUWA 2PD1A 1WHVA 1XMOF 2HHXA 2VG6A 3A1YG 2HGNA 4JOUA 2CQCA 1MNEA 1LWCB 3FRZA 4DQSA 1JMTA 2FDNA 3S8SA 5HMWA 2RILA 1D3WA 3VF0B 1TFWA 3I5BA 1XK8A 3LP0B 4BC7A 3IWXA 2YNHB 4KQZA 4M5DA 2XY6A 2ASJA 4K5SA 4P6QA 1RTIA 3WC2A 3TAMA 2LLZA 4IQMA 3ICLA 3IGVA 4MK7A 2RDJA 2KRBA 2NSCA 4B9UA 3HZEA 3H5XA 3OL9A 1NJXA 2YX4A 3GWCA 3T9ZA 1UFLA 4LF8F 1HD1A 3MM9A 1C1CA 1P1TA 1YRXA 3CCJS 4PG4A 1VQ8S 2L9DA 2KFNA 1Z1ZA 1WF0A 4GC6A 3BM7A 3RAQA 3I5AA 2R4FA 3W2WA 3OR2B 1FK9B 1Q8LA 4IOAQ 1P8GA 4MJKA 1VMBA 3CIMA 2M0GB 5H9EJ 2NPFA 4DQQA 4I6YA 3BB5A 4MKYA 1M5HA 4BBYA 4IRDA 3UNGC 4O4GB 2HRYA 4A8WA 3RBDA 1J2VA 2CKWA 2XMTA 3Q0AA 1D9AA 1LXJA 3KHGA 2MKHA 5J1NA 2GA7A 4WXOA 4B9SA 3CCRS 3FSYA 5KG3A 4W90B 3MMCB 2P9EA 4NLWA 3NRBA 2CZVC 3K5LA 3VAGA 2DISA 2VA3A 1RQ0A 4RUAA 2JJ4D 3DU6A 3OJSA 3KNAA 4ZHRB 2AGPA 5CQGA 1S6QA 1RT5B 2K1RB 3GILA 1S1UB 1WI6A 2GMJA 5F0UA 4C0OC 2CRLA 3FFIB 1H2TZ 2LU2A 1HBUB 4LIRA 2PDAA 4F3MA 2ZFHA 3OPKA 1JLCB 1U24A 6FD1A 4QJVA 5AXLA 2QYCA 5FD1A 1QSLA 2M88A 3WC0A 2HHWA 1DAXA 2UUCF 2VASA 1UWBA 1JLBA 1SL0A 2E9ZA 4B3OA 2B4PA 3BF4A 4KSEB 1Y9OA 1HPZA 2KG0A 3M6UA 2BQRA 2DPIA 3I9ZA 2XI3A 2E1AA 3DI6A 4URGA 4ZCIA 4QR0A 2RSQA 3U1MA 4KHRA 1LQ9A 5CCLA 2ILZA 3NCPA 2AYEA 3J80Y 4U7CA 3UD3P 3GV8B 2XNQA 3D5MA 2HRUA 3S7RA 3M2UB 4WFNQ 4OI0A 4L6V3 2MZSA 1RTIB 1WACA 4NCGA 1T95A 3M30A 3RBEA 3JSMB 2Q79A 2HHQA 1O8BA 3FMBA 4KT0C 2FUG9 4RW6A 2GHVC 4QWEA 2GIRA 5J1EB 1BC6A 1C4CA 1R31A 1IKWB 2IAJA 4DWIA 1KRPA 4CH7A 4DV1F 4PPZA 3W2WB 1J5EF 4M1KA 4QW9A 2FLLA 4WF9Q 1HYSA 1WHYA 5T14A 2ROGA 4LF9F 2YKQA 2DR5A 3GV5B 5DDOC 3C6UA 3TANA 4NLUA 3CC2S 2DO0A 1SIWB 2DH9A 1ROFA 3THVA 1OSDA 2CPDA 4