1HPZB

Human immunodeficiency virus type 1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
430
structure length
430
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Lys103Asn mutation of HIV-1 RT: a novel mechanism of drug resistance.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords POL POLYPROTEIN
total genus 97
structure length 430
sequence length 430
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2000-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hpzB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hpzB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hpzB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hpzB03
4TQSA 3QLHB 4WFYA 1JLBA 3DMJB 4K4XA 5J1EA 1S1VB 4R5PA 5KFCA 1JLFB 2XCAA 3V6JA 4F4XA 2ATLA 4EO6A 3H5XA 3IG1A 4R8UA 3QZ8A 3OLAA 3E51A 5KG7A 1LWFA 3V6DB 4RNOA 4F4WA 4I2QA 1R0AB 4TY9A 1C2PA 5KFOA 2YNIB 4GC6A 2OH2A 1MU2B 2YNFB 3T1AA 2HNYB 5C42A 2FJXA 4RUAA 3BSNA 1TP7A 5KG2A 2BE2A 4KAIA 2R2RA 4XPEA 5KT4A 2FVPA 1JLGA 3DRPB 3QIPA 3PR4A 3I0RB 4KKOB 1TL3A 3D28A 4Q43A 3Q8QB 2R8HA 4GC7A 2JC1A 3BGRB 2XI2A 3JYTB 4DL2A 2UVWA 3KOAA 2RKIA 1J5OB 5KG6A 1RTJB 4QWAA 3DLKA 2E9ZA 4H4OA 3IRXB 2V4QA 2W7OA 1HPZB 2QE5A 2R8IA 3DLEA 3V4IA 1JLQB 2AU0A 2VG6A 1ZTTA 2AGPA 3KLEB 5FDLB 3LP2A 5K14A 3RB4A 4M95A 4RW6A 4PQUA 5KFFA 2VG5B 1HNIA 1TL1B 3LAMA 5KG0A 1JLFA 2UUTA 5I3UA 4IFVA 5DQIA 4Q44A 5F8MA 4YMEA 5KG5A 4Q45A 4RW4B 3PJXA 3QZ7A 1BQMA 4QWCA 3H5YA 2OPQB 4KV8A 5EWEA 1CSJA 4RNMA 4WFZA 5DGAA 1QE1B 2J6SA 1MU2A 1SV5A 4LSNB 1REVB 2YNFA 1RT1B 5I42B 3GILA 2V0NA 3LP1B 2B5JA 1UWBB 4HKQA 4IKAA 4RW8A 3ISNC 3DRSB 5L1IA 5L9XA 5J2PA 1FK9A 1JKHB 3M8QA 4WYLA 3MECA 2R2TA 3JYTA 4HYKA 4MFBB 3H5SA 1I6JA 4U7CA 1LW0B 2OPRB 1N6QA 3H4BA 4K4UA 3KK2B 5HROB 1HPZA 3SFGA 5KG1A 3CJ4A 4EBEA 4KB7A 4ZP6A 4K50A 3GIKA 4H54A 1T94A 1S0OA 4WZMA 5CYQA 3Q8RB 5DLGA 5C5JA 3PR5B 1S10A 1JX4A 1S1TA 1VRTB 1DLOB 2FVQA 4ECZA 5J1EB 2VG5A 3DOLB 1S4FA 1MMLA 2HNDA 1WNEA 2XGQA 2YKNB 2OPSA 3EPIA 3RB6A 2WOMB 2ZD1B 4DG1A 3DRRA 1BQMB 4URGA 2C2EA 2C28A 4URQU 1N48A 5CYMB 2ZE2A 3MTKA 4ZP7A 4RUCA 5DG8A 4RZRA 4ED7A 1SV5B 1REVA 4LSNA 3KJVB 4B3OB 1JLGB 2R2SA 3BJYA 2RF2A 4K4WA 2W8LA 3I0RA 1DTQB 1D0EA 2E9RX 5KFEA 3KMQA 4ZVEA 1JLCB 1LWEA 3TVKA 3DOKA 5DQHA 5C24A 1EETB 1LWCA 4O4GA 4ZHRA 2IM2A 3ITHB 4NYZA 4NLXA 3Q8PB 1RTHB 1FKOA 2IM0A 1S9EA 2WONB 2YKMB 5FDLA 4U6PA 5KFUA 3H2LA 3DLGB 3MFHA 3DI6B 4RW6B 4MKAA 2HMIA 1QUVA 1JXLA 4QWEA 4I2PA 4Q0BB 2CJQA 4Y3CA 5JUMA 4K4YA 3DOLA 3GV5B 3PW4A 4NLOA 5I3UB 3PW0A 5F8JA 3BSAA 3NKYA 3BSOA 4RW4A 1S0MA 3VQSA 1HMVB 4NLDA 4ECWA 3HVTB 4J9LA 3CJ5A 3PW7A 4QWDA 2R2UA 1T05B 5DQGA 2ASDA 3IS9B 5HP1A 4FS1A 2YNGA 1UWBA 5F8IA 4RW8B 4B3OA 1IKVB 1RTIA 4ICLB 2F8EX 2V9WA 3LAKA 3RBDA 2D41A 3UDLA 5KFZA 3MECB 1JLCA 1S1WB 4ZPAA 3IGNA 3MR5A 2BANA 4R8UB 1RT3A 3OSPA 5KG3A 4ZHRB 4JV1A 4ED8A 5F8GA 5T14A 3ITHA 4O44A 3CWJA 1LWFB 1HQEA 4ED0A 4IG0A 2R8GA 4Q8EA 1R0AA 5F8NA 3KK2A 2IM3A 2WTFA 4KSEB 1RT7B 5KG4A 4ED6A 1S9EB 1S48A 5KT2A 2HNYA 5C42B 2BRLA 3H5UA 5HLFA 4FBUA 3KLVA 3DRPA 1TVRB 1RTDA 2OPPA 5HBMA 4KKOA 4JV0A 4KBIA 4EYIB 1IKWB 3H40A 3KHLA 2WRMA 2OPSB 4J9OA 1S1XA 3NAHA 4K4VA 2WOMA 2YNHA 3KK3A 3IRXA 5KFRA 2IJNA 2FJVA 3QYYA 1JLQA 3N6MA 4G1QA 2RDIA 3IS9A 1C0UB 3LP2B 4DL6A 5K14B 1RDRA 1DTTA 1S1UA 4JUZA 5F9NA 3FQKA 4LSLB 1TL1A 1LWEB 4WXWA 1C0TB 2XWYA 4MKBA 3V6KA 2C2DA 2FJWA 3I0SB 5F8HA 4FBTA 3HVWA 3DYAB 4LQ3A 3KNAA 1S6PA 3KK1A 4FS2A 1RTHA 1SH2A 2B6AB 1FKOB 3UR0A 2JEIA 4EBCA 4KV8B 1LW2B 2YKMA 3SFUA 2ALZA 1C1CA 2IAJA 4WYWA 4PWDB 1RT1A 2FVRA 1W25A 4ZPCA 1S6QB 4ED1A 4ECSA 1JIHA 2IJFA 5HBMB 3FSIA 1FK9B 3M8QB 4KFBA 2VG7B 4NCGA 2GIQA 3I5AA 3KHGA 4IRDA 1NNDA 4ZVFA 4PUOA 1RT6A 5KFBA 3RB3A 1RYSA 1S1XB 4IDKA 2AGOA 1JLAB 2JC0A 2BQ3A 2FLPA 2WK4A 1T05A 3MF5A 1QAIA 4RNFA 3GIIA 3CVKA 5HP1B 4O3RA 1SUQB 1RT5B 4MH8A 3PHEA 1EP4A 3MR2A 4G1QB 3FFIB 3MR6A 3ISND 3I5BA 4K4TA 1C0UA 4TYAA 4IG3A 4RW9B 1DLOA 3TAMB 2AGQA 4M94A 4Y34A 3KLFB 4IH7A 3G6YA 5KFKA 1RYRA 3KLGA 1JLBB 3DMJA 3CO9A 1ZETA 1C1BA 3OHAA 3PZPA 1OS5A 4G3IA 3CJ0A 2ZD1A 4DG1B 1JLEB 3LP0B 3CDWA 4QW8A 3EZUA 5EDWA 2B6AA 1XR7A 1TV6A 2FVSA 2IM1A 1RT7A 3V6DA 5CYMA 4NRUA 3D5MA 3MEDB 4ECRA 5HLFB 3KLIB 4J9KA 4IRKA 1N56A 2BE2B 1NHUA 3Q8SB 1S6QA 3QO9B 3JSMB 3OSNA 4NLQA 3QIPB 3DOKB 1TKZA 1TL3B 1EETA 2VG7A 4NCGB 2IC3B 3FQLA 3NMAA 2RKIB 1J5OA 1KLMA 1RT6B 3V81B 4IDKB 3LALA 2HNZB 2GC8A 4WZQA 2WONA 4NLGA 3MR3A 3PVXA 2QV6A 1S9FA 4NLVA 3BQ0A 3CIZA 2D3ZA 4RU9A 5KT3A 5F9LA 2JEGA 1QAJA 4IH5A 2XI3A 1HARA 4WFXA 4QW9A 3I0SA 5KFMA 4KHMA 3T19A 1C1BB 1IKYA 1IKXA 3QIDA 1RT4B 3M8PB 2AX0A 1N5YB 3T5KA 3RBEA 1TV6B 2O5DA 1C1CB 2IAJB 4IFYB 3GYNA 3LANA 4EEYA 2DPJA 5EUHA 2YNGB 3IGVA 4K4SA 1SH3A 3GV7B 2W9BA 3M9MB 3T5HA 4ICLA 3I5CA 4WE1A 2D7SA 4RNHA 4KFBB 1TKXB 2IMWP 2UVUA 1IM4A 3CDUA 3QGIA 1RT3B 4DL4A 4QWBA 3E01B 1YVFA 4MIAA 4MFBA 1HQEB 3V81A 5KT7A 5J2NB 4F50A 4KO0A 1T03B 4NLPA 1N6QB 4TLRA 2FVCA 2VG6B 4IQXA 3T5JA 4URSA 1S49A 2I5JB 4IR1A 3GV8B 4ZP8A 1TVRA 2BR0A 4ZVGA 5CYQB 3KLFA 4ZPDA 4F4ZA 3SI8A 1K1QA 2UUWA 2HNDB 3DDKA 3KHHA 2YKNA 4ZP9A 1IKXB 1IKYB 3GQCA 4H4MB 2AQ4A 3M8PA 2HWIA 4TY8B 1S97A 2J6UA 2FLLA 1N5YA 1TQLA 2XC9A 4K4ZA 3C6TB 3H98A 3MEDA 4IFYA 1RA7A 3LP1A 2D3UA 4TN2A 1DTTB 5F8LA 4NLSA 3M9NB 4J9QA 3QO9A 3JSMA 5L1LA 3DRSA 4WXOA 2RF2B 4O3OA 5KT5A 4DL3A 1DTQA 4NRTA 3CJ2A 2IC3A 2CKWA 2UVVA 1S6PB 1LWCB 4O4GB 2B43A 1NHVA 2W8KA 3FDSA 4O3SA 5KFYA 5C25B 2HNZA 1LW0A 2OPRA 2ILYA 2JLEA 4Y2AA 4J9RA 4RNNA 1LW2A 1TKTB 4KO0B 3GIMA 5KFGA 3IN5A 2JEFA 3BQ1A 5KFLA 2I5JA 1S1TB 3DI6A 4ED2A 1K1SA 4O3NA 4YR0A 4YR3A 4I7FA 4J9PA 3QLHA 2AX1A 4Q0BA 4EYHB 3BR9A 4J9MA 1ZTWA 4RW7B 2W9CB 1Z4UA 4NLYA 5EWFA 3IG1B 3DRRB 4TY8A 2RDJA 1HMVA 4I2QB 1EP4B 3MEEB 4ECQA 2W9BB 3KJVA 3NL0A 3KHRA 4JV2A 1HYSA 4O3PA 4ZMMA 1TKXA 2E9TA 3KLHB 3OL8A 5C24B 4OL8A 1FKPA 1RA6A 1XR5A 2C2RA 1JLEA 3LP0A 5KFNA 2V4RA 4KE5A 5J2NA 4Y2CA 2BQUA 1KHVA 4IG0B 1BQNA 5KFTA 2C22A 5J2QA 4IOBA 3DLEB 3V4IB 3NGDA 3PW2A 1S9GB 4O3QA 3G6XA 3FRZA 2R8KA 4MK7A 4IR9A 2ASLA 3OL7A 4I2PB 1RTDB 5D3GB 4PQUB 3DM2B 2DPIA 5KFAA 4ZVHA 1KLMB 4RW7A 3HVAA 5JXSA 2VA3A 4H4MA 4IFVB 4J9SA 1S0NA 1XR6A 3UQSA 5KFPA 4ECYA 4ECUA 2I1RA 3N6LA 4EO8A 3C6TA 2IBKA 4DL7A 2OPQA 3G86A 3BREA 3C6UA 3NBPB 3MEGA 5I42A 1IKVA 1RTIB 4ECXA 3ICLA 2B5JB 2ZKUA 2XCPA 1S1UB 4TYBA 4TQRA 3T5LA 1HYSB 3RAXA 5J2MB 2HAIA 3KLHA 1S1WA 1C0TA 1KHWA 4IH6A 2EC0A 5J2PB 2BANB 1FKPB 4XO0A 5DG7A 1S1VA 4R5PB 5KFWA 4EBDA 1VRUA 1RT4A 5C25A 4O44B 2ILZA 5L1KA 5KT6A 4YQWA 3OHBA 4DL5A 1HQUB 2HWHA 1TKTA 5DG9A 1GX6A 5KFSA 4J9NA 4QPXA 2R8JA 4YP3A 2ASJA 5J2QB 1HNVB 4R0EA 2YNIA 3CDEA 4Q8FA 3CJ3A 4F4YA 4WE1B 4LQ9A 2OPPB 1S9GA 3UPFA 4I7FB 3BSCA 1N4LA 1VRTA 1IKWA 2IA6A 3DM2A 1T3NA 3OL9A 3GIJA 3H59A 2W9CA 4MIBA 5L1JA 3E01A 2WB4A 2YNHB 3KK3B 4X2BA 4NLWA 3DLKB 1T03A 1U09A 5KFHA 4YR2A 2FLNA 3MEEA 2JEJA 3HKWA 4KHRA 4ECTA 4XPCA 1GX5A 4NLTA 2ZE2B 3QGGA 4ID5A 2UVRA 1RT2B 2WHOA 2AWZA 4LSLA 3OLBA 4IG3B 4RW9A 2BRKA 3PJWA 3M9OB 4ED3A 3H4DA 1HNIB 3EPGA 2BQRA 3DYAA 4MK8A 3KLGB 4O4RA 5EWGA 5DGBA 3KK1B 3HHKA 5KFDA 1VRUB 1SH0A 5KFVA 5KFXA 1BQNB 1HQUA 3RAQA 5KFIA 3NAIA 4PWDA 3V6HA 3PW5A 4NLRA 1HNVA 5DLFA 1QE1A 3N6NA 3KLIA 3DLGA 2W7PA 4NLUA 4DEZA 2VA2A 5KFJA 5D3GA 2HMIB 3BGRA 1D1UA 2WCXA 1TKZB 3RB0A 4ECVA 1JKHA 4PUOB 1RTJA 4TXSA 4IRCA 4H4OB 2GIRA 1JLAA 3TQ1A 3G6VA 4MK9A 4ZPBA 3QGHA 3BQ2A 3HVTA 1SUQA 1RT5A 1RAJA 2XGPA 5KFQA 5HROA 3C6UB 3FFIA 3NBPA 3OL6A 3KLEA 2W9AA 3MEGB 3KMSA 3MFIA 3TAMA 4ID5B 4NZ0A 2J6TA 1RT2A 5J2MA
chains in the Genus database with same CATH superfamily
1QJHA 1DZ5A 2VDIA 3J81j 1HNXJ 2R3VA 3CXCR 4K4XA 5J1EA 3JXOA 2WVEA 3MGJA 3V6JA 1VR6A 1CJUB 4EO6A 3IA0A 3A8JA 1CC7A 3B78A 2PIIA 3JSBA 4NWBA 1OPZA 2CDRB 2G0JA 3E51A 1LWFA 3V6DB 4LFAJ 2E1PA 1EAYC 3UNGC 1FA0A 1PC4A 1X9WA 1RHMB 2CPIA 3NEKA 4BC9A 2BOPA 2DIVA 3QT8A 2MB0B 3T1AA 4HR2A 2HNYB 4P2SA 3BSNA 1NKEA 1KTQA 2RNEA 3GJQB 1AXQA 2MZRA 5A8RA 2B4UA 3BBFA 4YY3J 2MDAA 3Q8QB 3VVUA 3D28A 3R5AA 5HQLA 4DL2A 3HFVA 2JC1A 3BGRB 3KOAA 4DPOA 5HO4A 2CNKB 3NGTA 3PX0A 2RKIA 1LKZA 5KG6A 5CD4H 2AJ0A 2ZJPQ 4DV7F 1SL1A 4DWIA 2D9PA 3GMGA 4QWAA 4LF8J 2VODA 4H4OA 4DX5A 3QRPA 4F04B 2XO7A 2DNRA 1GAOA 2DR9A 1VDHA 1H74A 1WJ9A 1WOPA 2V4QA 4B3TJ 1N32F 2OO4A 2QE5A 4QR1A 3HHLC 2A0FB 2W4PA 3KLEB 5FDLB 2CPHA 1KEKA 3SMZA 3LTOA 3BO2A 2OIHA 4DSIA 3IR5B 1RCOB 3RB4A 2ZZMA 2G2ZA 4ZVPB 3F0NA 1YJ7A 2A6MA 3OXLA 2B9WA 1JLFA 2RHQB 2BABA 4PZVA 4RBTA 5F8MA 2VOPA 3HZGA 2XHCA 1HI0P 4ENOA 3QZ7A 2Q79A 1RLCL 3EE3A 2QA1A 3H5YA 3NOGA 5IM0B 3ILLA 3JSRA 4RNMA 3GFYA 1MU2A 1SV5A 1REVB 2DNYA 3W9JA 1RT1B 3ILOA 3GILA 2V0NA 3LP1B 2B5JA 2VFSA 5A2QU 3PX4A 2YH1A 1O51A 3DRSB 5L1IA 2KJWA 1FD8A 1JKHB 4A48A 4DX7A 3CMQA 3MECA 1NXIA 1U2FA 4M5DA 2PI5A 4CM2A 1Y4ZB 4MFBB 1RU2A 3C16B 3CTRA 5HVGA 5A76A 1B0TA 1H73A 4X62F 1JJ2R 1U0HB 2OKQA 2L41A 3CPWR 1LNQA 3NP5A 4DU8A 4ZP6A 3MDFA 3GIKA 3EM1A 1RWXB 1FRXA 4H54A 3LGNA 4WCEQ 1SXLA 3L95X 5DLGA 1HWJA 3Q8RB 4ZIWA 1D9DA 4ECZA 1DLOB 3DDNA 4EK2A 5J1EB 1FE4A 3TQEA 3L7UA 2UUBJ 2IVFB 4CZCA 4ZIVA 3FC9A 1AUDA 5H9FK 2WOMB 4J91A 4F02A 3DRRA 3GYGA 4KGVB 4ZJOA 2LQBA 2I2YA 1KQKA 4CM0A 1NK5A 3OW2R 2C2EA 4QIGA 4URQU 1JJCB 5CYMB 1ELOA 2ZE2A 3I82A 4QYZK 2QLXA 5ETTA 4FVCA 5DG8A 4RZRA 2MY7A 1RAGB 5DO2A 2R2SA 4LRCA 1J5EJ 1TFWA 9RUBA 1BQXA 4C9DA 1PBUA 2X3GA 2RS2A 5I4MA 4ZVEA 2VQFF 4FYDA 3KDOA 5DQHA 5C24A 1VQNS 3CCZA 4ZHRA 2RQ4A 1X9SA 2HQ3A 3DOMB 4MIWA 4X4VA 4XDCA 3PACA 4C0HA 1FKOA 1K47A 2IM0A 3P4UB 4OI2A 2NCKL 1NK9A 2KL8A 2FHJD 5CCMA 6AT1B 1CULA 5FDLA 2P5VA 5KFUA 4NASA 1A9NB 3H2LA 1NKBA 1R3NA 4M5KA 3I9ZA 4RW6B 1X5PA 3MAHA 1VC5A 1IR0A 3LPYA 4ES1A 2GQ2A 4QWEA 4I2PA 1KKHA 2KRBA 4Y3CA 1IQTA 1N34F 1H7WA 4TVAB 1L3TA 2VU5A 3FBCA 1X5OA 3I31A 2XMAA 3JTNA 1RB0A 4DF8A 3PKMA 1B0VA 3M2RB 3NKYA 1FX4A 3QAEA 3HI9A 1PAEX 2YQ0A 3A13A 4NLDA 3HVTB 4J9LA 3CJ5A 2R2UA 2O3DA 4PXDA 4DV6F 2ASDA 3MMCA 5HP1A 2AJQA 3D68A 5HATA 4ATNA 1QAYA 3RRGA 4AL5A 1UWBA 4NYPA 2FZKB 2JL9A 4O0NA 4ICLB 2F8EX 4XIUA 3LAKA 5A6PA 2D41A 3GE9A 3MECB 1JLCA 4E2FB 5GADI 2CNLB 4L75A 1UEVA 3IGNA 2UUAF 1WACA 3OSPA 4DUYJ 2WVCA 4HT7A 5E33A 5T14A 3ITHA 2RDDA 3PNIA 4ED0A 3AB4B 1Q1KA 4Y2MA 1NMEB 3ZZ0A 1QSLA 3MI7X 3PTWA 2BZ2A 5K9FA 3UN5A 4CLLA 4OYAA 2QLBB 2R7TA 1APSA 2ZH5A 1S57A 1LFPA 2NXUA 5HLFA 3JQMA 3LGMA 4DPYA 2VICA 2CQ1A 1WTFA 2CRLA 4A8FA 1RTDA 1FEHA 4KKOA 1T95A 4JV0A 3ZZRA 1IKWB 1WD6A 2M5YA 2HG4A 1YBUA 2E1RA 2QMXA 3MTJA 4UZCA 4F26A 3UD3P 2WOMA 1MSWD 2YNHA 2AHOB 2BKNA 2FJVA 4WP3A 3N0VA 3FJ2A 2RE1A 4OI6A 2M3DA 1PJ6A 1N0UA 3IS9A 1C0UB 2EVZA 1Q82T 6FD1A 4DL6A 2PE8A 1VOMA 3C15B 2AD9A 1HNXF 2IDEA 4P2XA 1S1UA 4ZN3A 2HRUA 2E44A 5LM7E 2E29A 4LSLB 4PRFA 3HT3A 2ACMA 2PD1A 3G82A 3I0SB 4V19J 4OYZA 3KK1A 3S8SA 1R8AA 3QWPA 1SH2A 2B6AB 2F1FA 4K5RA 1NDKA 4DQSA 2V67A 2CJKA 2UU9F 5CZXA 1VQLS 3FZ2A 3WX8A 3U1MA 2NUUG 4P73A 4Y00A 2ALZA 3C66A 4NX9A 3SFUA 2UXBJ 2IAJA 2JSXA 1WHWA 4NZ6A 4PWDB 4C97A 2M0GB 2MY8A 1KSPA 5E3PA 1CJKA 3UFCX 1RWWB 4C8ZA 4MYTA 3L7PA 2ZH4A 4NCGA 2JFKA 4IRDA 4DR3J 2XY5A 4AQYF 1P9QC 3SQGB 3TANA 2CZ9A 1RT6A 2PMHA 3RB3A 3W65A 1S1XB 4UOHA 2AGOA 2BJ3A 4MAKA 3KFWX 3G8QA 3CW2C 4MT1A 1W7WA 4ZPVR 4O3RA 5HP1B 3H0PA 2QN6B 2DCUB 1AFIA 3PHEA 5KOWA 4G1QB 3BH6B 1GQEA 2EK6A 3ET6B 2GVZA 1GXTA 3LA0A 1F6TA 2E1CA 5LMUJ 3CD6S 4RW9B 4DR1J 1TMJA 1Y7PA 4FYYB 5KFKA 2CQHA 4KPCA 1RYRA 3DMJA 2DNQA 3R7SB 1ZETA 4GVBB 1HNZJ 3CJ0A 4DG1B 2B4VA 5EDWA 3H8YA 2IM1A 1TV6A 1D3WA 1YITS 5D78A 2EFQA 2FD2A 1DHMA 2CWXA 2XG8A 1I94J 2UV8G 2ZDOA 1AA1B 3A1YG 2VD3A 3Q8SB 1S6QA 3QO9B 3JSMB 4DJBA 3BDPA 3QIPB 1Q5YA 1TKZA 2XLIA 1GFWB 2ZKTA 1EETA 2NXNA 4OYPA 2VG7A 1KFSA 1IXKA 3Q89A 1M5KC 3P49B 4UW2A 2HZVA 3LOUA 4NXNF 1PAUB 2HNZB 3UI3A 3R6GB 4PYAA 2P9CA 3BBBA 2XY7A 4JI2J 4B9SA 4NLGA 3N01A 2BA9A 4DFJA 4XDDA 3PVXA 1A6LA 4NLVA 1NHKL 4MTPA 3CIZA 4WP8A 3S01A 5KT3A 4RU9A 2YX1A 2AP6A 3BDEA 2LU1A 3GZ7A 4HLBA 4RL1A 4AQYJ 3Q2SC 1S5ZA 2SXLA 4WFXA 3KWMA 4KHMA 1SQGA 3T19A 8RUCA 1XEZA 1C1BB 1P1TA 3P45B 4JI0F 1WC0A 2DNZA 3M8PB 3OJSA 2AX0A 1FX2A 2N3OA 3T5KA 2IAJB 2VB6A 2H5EA 1NPKA 2BJ9A 2YY3A 2ZFHA 4ZVTB 4DPTA 2C42A 2YNGB 3H42A 3ZTPA 1X4BA 2GMHA 5F41A 2QT7A 1DJ0A 1KTVA 2APOA 5A8RB 1R8CA 3I5CA 3EX7B 2D7SA 3PO5A 3R2DJ 1U7LA 2WZ1A 4KFBB 3L7OA 4RNHA 1TKXB 3QJPA 2UVUA 3L4BC 1KWMA 1RT3B 3QGIA 1F5CA 4KIAA 2EFVA 4HTIA 3E01B 3VV2B 1HQEB 2CJYB 5C2CA 2VKRA 2LCWA 4F50A 1IBMJ 2VBZA 3POTA 3QFHA 3HPOA 1N6QB 4TLRA 4A8YA 3PX6A 2FVCA 4U67Q 3T5JA 4URSA 4M5MA 1HI1A 4IR1A 2L9WA 2Z2YB 3GV8B 1TVRA 1Q95G 3CCMS 3GYXB 2NQPA 3BV8A 4LRFA 1WORA 2GAHC 4OYWA 1NZ8A 4ZPDA 3SI8A 1K1QA 2FQQB 2ZH6A 3NNAA 3WQPA 4X66J 1RHJB 3T9NA 5HVFA 3J81U 4V1Ak 1SC6A 3DDKA 3PV8A 2YKNA 3BYPA 1IKXB 4LR9A 4H4MB 4F7VA 2HWIA 4G1IA 4TY8B 3UD4P 2J6UA 2IBOA 2FLLA 2CFXA 3B6BA 2W25A 4NXMJ 1NSPA 3C6TB 3K7RA 4K4ZA 5CHCB 5DZ7A 2HLTA 1RA7A 2XY6A 3LP1A 5F8LA 2B4OA 1GT8A 3QGPA 3QO9A 3JSMA 1F9HA 3DRSA 4WXOA 1R8PA 4PYDA 3KYLA 4JI8F 5AXMA 4UZBA 3AQOA 4NRTA 4ELTA 2JX2A 4ALZA 3CJ2A 4DCOB 4KY3A 1AT1B 2BKPA 3BR8A 3GPAA 4USKA 4CT9A 2NYHA 2HVIA 3FBFA 3N28A 4FN5A 2PO4A 4X4PA 1NHVA 2OELA 4O3SA 4NCBA 2HNZA 2XYPB 1LW0A 1HBMA 2RJZA 4P2MA 3TR5A 1F1BB 1U0HA 1TR0A 1LW2A 2BMBA 2LVWA 3BN7A 4KO0B 3LO3A 1CQNA 3MZIA 2CPXA 3JQKA 2ZM6J 1UZDA 1SL2A 4LF6F 3HX9A 4AD6A 5DM6Q 5H9EK 2H9ZA 2JEFA 2I5JA 3DRYA 1M1GA 2MSTA 4YB5A 3J81Y 4E98A 4IOCQ 1BWVA 2AJ2A 5E3CA 2VPWB 2XMKA 2LLZA 3DLJA 2VIHA 4J9PA 3QLHA 4Q0BA 1V3RA 3K0JA 2W9CB 2EWHA 4NLYA 3CMAS 1CS4A 2DHGA 2UZAA 1R43A 3MMBB 3DRRB 4PG8A 4DUZJ 2J7UA 3ELHA 4NEZA 3OTOJ 2QGFB 4JI0J 4I2QB 4NOHA 4A8KA 4OHZA 3T9ZA 3OXGA 5BR8F 3KHRA 3D6FB 2WSFC 1MG7A 4LJMA 4JV2A 4KHPJ 2AJFE 1TKXA 1RBAA 3B4DA 2XLJA 5HL7Q 5C24B 1RA6A 4DSEA 3O44A 4A47A 2WW8A 4Q2MA 3LP0A 4FYVB 2MHEA 1PC5A 2V4RA 2BVZA 1QLNA 4KE5A 2XTJP 5DZ6A 4BBYA 2DRBA 2LQ8A 2WBRA 2OEJA 5KFTA 4Y2KA 1GMVA 2GJIA 4CO0A 4HT5A 5CA5A 4DX8H 4JOUA 1WC4A 3DLEB 3V4IB 3NGDA 2I0XA 3C19A 4Y0FA 4YB1P 3U02A 1UW9A 3OVBA 5ETNA 4I2PB 2OFGX 1URRA 2YWKA 3DHXA 4DCJB 5KFAA 5K8OA 1N5VA 2RSQA 4ZVOB 2JJ4D 1RZMA 2PDAA 3W5XA 5HAOA 1KLMB 2W2PP 4LBIA 4ZVQB 3PM9A 1H72C 1RBOB 2GCFA 4RU2A 4H4MA 4LR7A 2VA3A 1PO6A 1NSAA 5A0YB 4C8NA 4ECUA 2I1RA 2DXDA 3N6LA 3C6TA 1UW4A 2GQCA 1FVSA 2ZC4A 2WW4A 2ZEJA 2OPQA 4M5GA 1U1QA 3G86A 4DPWA 2IBKA 4USIA 1VJQA 1FKAF 3MEGA 3OUYB 1IM6A 2KG0A 2GHWA 3ICLA 1HHTP 2XYHB 3IO1A 1HYSB 1LOUA 1TK8A 3BN4A 2HAIA 1KHWA 1C0TA 5J2PB 5E3RA 2YKOA 4R5PB 3NXZA 3OFGA 3EZOA 5IT4A 4EBDA 3IAS9 5C25A 2F4VF 3MM7A 1NAQA 5L1KA 5KT6A 1Y3KA 5LSLA 3GG0A 4YQWA 2HWHA 3VAMA 4DL5A 4N41A 1UVMA 3M8RA 3T1YF 2WB1D 3IFEA 3HHEA 3K5PA 2HHWA 5J2QB 3MHYA 1HLWA 3PIOQ 1VYAA 5D6GA 3CJ3A 1EARA 3N5BA 2PGCA 4Q8FA 1WG5A 3HHLB 3JTPA 4PG7A 1SKUB 4J9VA 3MEKA 2Q6CA 1IKWA 4OJGA 1BXNA 1T3NA 2HYIB 1NJIT 2F5GA 3BKTA 3VF0B 3BEGB 3MMAA 4PR6A 2KYXA 4M5IA 4OZLA 3UNYA 1U48A 5JJBA 5K8NA 2DVIA 3OTDA 1U09A 5F3ZA 1NJZA 5B0FA 3NMRA 2Y0BB 1Z1ZA 1SQFA 1BUXA 1OYDA 4CO5A 1BHNA 4PWUA 5B0EA 1S6UA 1KQFB 2WHOA 4D3GA 3DXBA 4LSLA 3HSJA 4IG3B 4DZDA 3K58A 4DV7J 2B8QA 1FRKA 2BRKA 3PJWA 4F0HA 4CLTA 1EIYB 5IT0A 4NE9C 3TJ9A 3I56S 3H4DA 1AFJA 2D3OR 3DYAA 4BDPA 4O4RA 1KOHA 1B7FA 4V19X 1JQGA 3AXKA 2V4JB 1VRUB 5KFXA 4CLKA 1NSQA 5FJ4A 1KD1T 1SVDA 4NMXA 2ZH2A 4G65A 4PWDA 1WWHA 1NK4A 4NLRA 1QE1A 4B3SJ 2FUG9 3UCUP 3TZZA 3KLIA 3DLGA 2FJEB 3CB4A 2DR8A 1VLOA 1OY6A 4WP9A 2E7XA 1S72S 1NJYA 3FMBA 3PRVA 2CVEA 4OX6A 4PXBA 4TXSA 4LF5F 1FRLA 2LXIA 4H4OB 2GIRA 3LH2S 3VGUA 3J7A1 3TWZA 2K8GA 5HSPA 4ZPBA 2ZM6F 1OQ6A 3HD1A 3LWLA 3BQ2A 1SUQA 1FRMA 1RAJA 3O2IA 3F44A 1HIYA 2IRYA 4B17A 4DZ6A 5KFQA 4F3QA 3MEGB 3HSDA 3M2UA 3TUZC 3SBMA 3D1HA 1YQHA 4NZ0A 2DK2A 1S7HA 5LXYA 4X65F 4USMA 1WTBA 2GVDA 2E1AA 3F41A 4DV2J 2P2CB 2BKOA 3OT9A 4DF4A 3DMJB 2XEXA 3E2EA 2MHNA 1S1VB 4K2XA 2XCAA 1JLFB 2X1AA 2ATLA 2CPEA 3H5XA 2HKEA 4R8UA 2C1EB 3NG8A 4WIQA 2BW2A 4LRDA 3CCTA 5ETPA 5KG7A 4DQRA 4WKYA 4F4WA 2KZMA 1R0AB 4BC7A 4OX9J 4ZPWR 5KFOA 1MU2B 3EMTA 2ZBIA 1N34J 1T9XA 4ERDA 2HS0A 2HWTA 1X5SA 5KG2A 4KAIA 2FVPA 1RAFB 2A2DA 1JLGA 2OSRA 2PN6A 2ZOGA 1V3ZA 2V6AA 4GC7A 4M5LA 4RWXA 3JYTB 3W2WB 5K20B 3JS9A 2R7WA 1Y3JA 5IQQA 1RTJB 2E9ZA 4FF3A 4D3HA 1ZZFA 1OYEA 4KH0B 1I1GA 3CEDA 2W7OA 5ETMA 2QC3A 3MPYA 3R27A 4BWMA 3TAPA 2IRUA 2N4DA 4M63A 1JLQB 5G4DA 2AGPA 2MJNA 3GLJA 5BYSA 2ASYA 5ADZA 3LP2A 3ENQA 3OBIA 4M95A 5KFFA 2DKOB 3GJRB 2VG5B 1VS3A 1KLNA 5EX3A 1TL1B 4RJVA 3LAMA 1U8SA 2ZVIA 2Z0GA 5G0RB 5KG0A 4JI4J 4IFVA 2H3EB 4OX9F 5IT9Y 4FZVA 2XO6A 3R2CJ 2BBEA 5A8WA 4RW4B 4N5SA 4U95A 2LXFA 1BQMA 4QWCA 3R6LB 3ZNUA 4CT8A 2DHHA 4KV8A 1R7IA 5LJ5Y 5EWEA 1QE1B 3RR8A 5RUBA 5I42B 3O3LA 4KR0B 2Y3YA 1WUUA 1TK5A 2UP1A 1TMMA 1YRUA 4RW8A 2P6SA 2ROPA 3FKBA 2IVMA 1F60B 4DV4J 5L9XA 4WJBA 3M8QA 2QL9B 4WYLA 5A8KB 5GAHI 1ZZNA 1NK8A 3BO3A 3I4PA 4NL5A 4PKDB 3C8YA 3H5SA 1I6JA 4U7CA 3GCXP 4LFBJ 1B3TA 2OPRB 1N6QA 1FTRA 4K4UA 1PKUA 3KK2B 3RYLA 3HP6A 1HPZA 3SFGA 1YJ9S 2UUCJ 3IWNC 3CJ4A 5GVQA 2XZDB 4NA2A 1UWAA 3EZ5A 1U1NA 1N36J 4OV1A 4K50A 1IBCB 5CYQA 3EXYA 1RK8A 1RKJA 2KTQA 1S1TA 4ER8A 4IOAQ 5BYRA 2VASA 2DGWA 3HF5A 4FNIA 1S4FA 1HI8A 1MN9A 3SSRA 1MMLA 2HNDA 5D8HB 4CNYA 4CLUA 2YKNB 4DV1J 2PA8D 2OPSA 3EPIA 3TP2A 3RB6A 5E3AA 4HL9A 1FHTA 4UUWA 4MKVA 1RUSA 2CAJA 2RU3A 1NZAA 1DBDA 2DH7A 3MTKA 2YBVA 2QJ3A 3NGKA 1JLGB 2IMOA 3HJVA 3OD2A 3S1TA 3MD3A 3ZO7A 2W8LA 2VONA 5KFEA 1RWUA 1SQEA 1JLCB 1B99A 1Y5LB 3TVKA 3DOKA 1RSCA 5T41A 2UXBF 3CCES 4O4GA 1FFGB 1SL0A 1FO1A 3G4SS 3EYZA 1MW7A 1RTHB 4A8XA 3Q8PB 2MZTA 4JI1J 2YXLA 3R7BB 3JSYA 3GJTB 4CO2A 5GAGU 2YKMB 5K5MA 1HKAA 1GH8A 3W8GA 4OJ1A 1YWXA 2ZWOA 1UAWA 4YY3F 1QUVA 1KN6A 3MM6A 2KN4A 4N56A 4GKJJ 1DY3A 1WKJA 2HQCA 4UUXA 4K4YA 3DOLA 3KKFA 3GV5B 3CC2S 4NLOA 3PW0A 1H38A 2ZH8A 3VZIA 1F5BA 3BSAA 3BSOA 4OYOA 1V6HA 4RW4A 3U27A 1T9YA 1F3FA 2X3DA 4RBUA 2RH3A 3B8HA 5JMNA 1S0MA 3MCNA 4F2RA 5D4NA 3A8KA 2J0WA 1D8ZA 4QWDA 4TU9A 4UY85 2F4VJ 1T05B 1HD0A 5DQGA 1UVKA 3IS9B 2N7YA 3A4TA 2UU9J 1G2EA 2GJ2A 1FNOA 1M1HA 3W61A 5C2GA 2AEJA 5F8IA 2GX8A 4RW8B 4B3OA 4WWSA 1U02A 1BC6A 3BH7B 1A7GE 2I38A 2MQ8A 1S1WB 4USHA 1FERA 5D15A 2BANA 4WU3A 3RRKA 5KG3A 3BB5A 4CLSA 1F0XA 2EFPA 4O44A 2F40A 1LWFB 1Q0NA 2IJRA 1Q8KA 1KOOA 2HGNA 3M8YA 4OZ5A 5LOQA 1W26A 2IM3A 4KSEB 2PMWA 1RT7B 3AQPA 2DNKA 1S9EB 1E6YB 1S48A 5KG4A 2HNYA 4ZK7M 1ZPWX 4HVZA 3TNVA 2HHHF 3ETMA 3H5UA 3CJKA 4RWWA 1RQ0A 3DRPA 1H98A 1NK6A 2DGOA 2OPPA 2H65B 2VL1A 4K59A 3W3SA 5E3QA 3GR0A 1B70B 1Q78A 3H40A 4X66F 4J9OA 2HURA 4IUFA 3KK3A 3IRXA 2CQIA 4DXLA 1EZZB 1OY8A 2IJNA 3C14B 3VALA 1W2BR 3VAFA 2HK2A 5B7WA 4DCPB 3N6MA 2HHUA 1T9UA 2RDIA 1XTZA 5E41A 1VQSA 2GVZB 2Y8YA 3Q23A 1L3SA 4JUZA 2UUAJ 1S77D 1UP1A 1VC0A 1VBYA 3A3NB 3V6KA 2XWYA 2YVSA 4MKBA 5BR8J 2C2DA 2FJWA 2GO8A 3TEHB 4LFCF 4CTAB 3GSIA 4LQ3A 4P7VA 3M2VA 1IR2A 4QJVA 4AT1B 1CQMA 1RTHA 1FKOB 3TW0A 1L3VA 1WOSA 2YQ1A 3QPIA 2DEJA 1M1KT 2DH8A 1X0FA 1HHSA 2B9XA 2L3MA 1RT1A 3GWCA 1HBOA 3H25A 2I8EA 3SV3A 2KYZA 3QSIA 3DU5A 1JIHA 4YB7A 2IJFA 2MQMA 5HBMB 1NSKL 1FK9B 1RCXB 2NXCA 2EG1A 3D3BJ 1GTEA 2GIQA 4JYAF 1U24A 4PPZA 4HI1A 2UXCF 4PUOA 5KFBA 4PXCA 1FRHA 2GQQA 1RYSA 1BMQB 1JLAB 3EWGA 2WK4A 1T05A 4RNFA 1QAIA 3GIIA 1RT5B 3MR2A 2PEBA 3VQTA 3FSYA 3OVAA 2YPYA 4TYAA 4IG3A 3TAMB 4ETZA 2ZH9A 2AGQA 3VAKA 4EI2A 2RQKA 1V3SA 1SKSA 2X1GA 4PABA 2DCLA 1WI6A 1C1BA 2EXUA 4AE5A 2CXEA 4Y28C 4Q8EA 4ILLA 1JLEB 1WEYA 3CDWA 4QW8A 1XWLA 4HHJA 1RT7A 5H9FJ 2Z2ZA 5GADU 4X4SA 1L5UA 1TAUA 2HPUA 1ZS6A 5HLFB 2GZOA 3KLIB 2MKSA 2RVJA 4B3SF 1VK8A 2BE2B 2B4PA 1NHUA 1G7CB 2COLA 1WEXA 2LYVA 5LL6d 3ZTOA 3SZ2A 3TZYA 1R31A 1TL3B 2DHXA 2HFNA 4ZCKA 3S7RA 2HW3A 1NJWA 4FF4A 2GGPA 2IC3B 1U6BA 2QA4G 3EGVA 2QIFA 2ZUGA 3DXSX 4I56A 4DDFA 3V81B 3ZZYA 1TAQA 5HJXA 3RRHA 4IDKB 2R7SA 1QVGR 1FDDA 2XMWA 2LDIA 4MYUA 3B82A 1QTNB 3D66A 4OX8A 4P2FA 2BM0A 2QV6A 3ENVA 1JB0C 1RLDA 4I6YA 2CQPA 2D3ZA 1Q16B 2YQ3A 4EWTA 4UOGA 2NR0A 4WF9Q 2FY8A 4IH5A 3GFHA 3DRXA 1U0SA 2L9NA 4QW9A 3I0SA 2K7JA 5FIIA 2HGLA 1FEEA 5ETKA 4YOEA 2KFNA 1IKXA 2P8IA 1NDLA 4ZJLA 1RT4B 3VWSA 1KVIA 1RWMB 3K8WA 1S79A 2EBGA 1V5IB 1VMBA 2O5DA 3ENAA 3GONA 3VZHA 1NDCA 3LANA 4F67A 3W1YC 2GHVC 5J1PA 1RGVA 3GV7B 2W9BA 2FIUA 3G6ES 1VQ6S 2XM3A 5HMYA 2XS5A 4WE1A 2H51B 1Z2LA 3V5RA 3T1YJ 2AJ4A 1RABB 1LV5A 2IMWP 3CDUA 5EX0A 4JP8A 4USWA 1IBKF 4DPUA 2XNQA 3HHNB 3NCRA 4MIAA 2VJUA 2U1AA 2Z57B 3L09A 3MUTP 1SKRA 1ZM4A 4KO0A 1N32J 1T03B 5D4LA 3W7BA 4IQXA 2KXHA 2OMLA 3ET6A 1O6XA 2BV3A 2I5JB 4WKRA 2X1BA 2KZZA 2KT5A 2YKQA 1UMJA 2Z2LA 4N7TA 4PPDA 1TL5A 4ZLPA 1JJHA 4WFAQ 2DNHA 4DR5F 3Q8YA 4J9UE 2MKIA 2XYGB 1VQOS 1MROA 4F25A 1P9YA 4ZP9A 1LFWA 3EGWB 4LIWA 4W4MA 3O8WA 1HNZF 3EICA 4PQAA 3QAUA 2J76E 4IFYA 4CRJA 3MAAB 1U26A 2CIMA 2D3UA 3QFWA 1DTTB 1TL7B 2GW8A 3I6PA 4J7CA 2E1MC 2KDOA 4TN2A 4DR1F 4NYOA 2RF2B 2FHMA 8ATCB 1DTQA 2A18A 2HLUA 1HBUB 1RE1B 4DUYF 2UUCF 2CKWA 3A12A 1UZHA 1R6VA 5E0OA 1LWCB 2C2NA 3FDSA 5KFYA 3H90A 1NEEA 3VVTA 5FLXY 3PXGa 2U2FA 3DFEA 3IXQA 4YDDB 5B0CA 1HWKA 3PFOA 5A2QY 2GIFA 4RLEA 3AJDA 3AY0A 4C0OC 2KXNB 3IN5A 2I6WA 1RWOB 2KT2A 5BYQA 2RS8A 3DI6A 2HBRB 1R89A 2EG2A 3OR1B 3OV7A 2VUGA 4YR0A 2QFJA 4ED2A 1M90T 2JDJA 4UQGA 4OZJA 1Q8BA 4CLWA 3BR9A 4ES3A 1ZTWA 2HFVA 3KXDA 3UD5A 4ZKAA 4J9MA 3PHTA 5EWFA 4DV1F 3IG1B 5L9NA 4HDGA 1FI4A 2CZ4A 1ULRA 1WF0A 3SCIE 1VHFA 1HMVA 2HK3A 3PJ9A 1N5SA 3KTQA 2UV8A 1AW0A 3MEEB 2MGZB 4Z7CA 3PRDA 4L6V3 2W9BB 2QLFB 3NL0A 4ZPTR 4CYUA 4YS2A 4B3RJ 1URNA 2E9TA 3EGZA 4OYIA 3FUYA 1S59A 4ZA1A 2D1CA 5T7LB 3CMES 1M5SA 1HL6A 1WKKA 4BS2A 1N5QA 1KR4A 3ULHA 5J1NA 1ROFA 4AXJA 2OD4A 2KKHA 2FC8A 1TUWA 2DY9A 1KHVA 1ZAVA 2AZ1A 3K8VA 1RHKB 4OQJA 4IG0B 4P74A 1UJ6A 3H20A 1E6VA 3A8EA 3AD9C 1IWAA 1VK3A 4IOBA 4LR8A 3M32B 4XK8C 4O23A 3PW2A 1S0VA 3G6XA 4MK7A 5CQGA 1REGX 1J27A 5D3GB 5DJBA 5GMKa 2ACYA 2F8MA 3C46A 4YB6A 4RW7A 2MLYA 2CDQA 3IMQJ 2F8HA 3UQSA 4U7UK 5M2PA 5KFPA 2A3JA 2N82B 4YHHF 2ZH7A 4ECYA 2Y9HA 3HT0A 1NH8A 1HBNA 3J7AN 3M7VA 3NGUA 2AYBA 5CH7B 2VQFJ 3BREA 3QT7A 2A2CA 2DB1A 2PI4A 2CPZA 2DR6A 3IBWA 3TOQA 2Z4PA 2O66A 3UDVA 2B5JB 2OLWA 2ZKUA 2XCPA 3US5A 4RNNA 3VAHA 3TVZA 5J2MB 3D0IE 3VGTA 1B4SA 4IH6A 2BANB 1FKPB 4XO0A 2MQNA 1CJTB 4QOTA 4DPXA 5AE1A 5DG7A 1VRUA 3GFXA 2HFUA 4QQBA 4O44B 3D0GE 3Q8UA 1VIXA 1YX2A 2A10A 2RUSA 4B9MA 2ZHBA 1YJUA 4RO0A 1GX6A 2FZCB 5KFSA 1NH7A 5HJYA 4J9NA 2HQDA 4C3MA 2ASJA 1UA0A 2R8JA 4NCAA 1S6OA 2YNIA 3KNGA 2ZWPA 4CO3A 3Q22A 3AOCA 3R8YA 1K0VA 2OPPB 1S9GA 1FXRA 1JXVA 2O67A 1C4AA 2GHPA 3HULA 3OR2B 3UPFA 2ZHAA 3W66A 1VRTA 1DAXA 3OFEA 2V8VA 2W9CA 2EK1A 5FD1A 4MIBA 3E01A 3V4MA 1RAHB 2YNHB 1ZM2A 3HM9A 4X2BA 2K3IA 3DLKB 4ELVA 1M5VC 3POTB 3SDEA 2C2OB 3MEEA 4GO7X 2MGZA 2JEJA 2MKCA 2HGMA 2KVIA 4ECTA 1U6ZA 3MM5A 2DGUA 4NLTA 3QGGA 3UN2A 5AJ3J 1B64A 1VIOA 2UXDF 2N7CA 2CNNB 4KTQA 2KHDA 5IWAJ 3SEOA 3R5CA 3M9OB 4LF8F 5LSOA 4DN0A 2LDYA 1HNIB 1YSJA 3EGNA 3VR1A 2BQRA 3KLGB 1UFKA 3HLUA 1RADB 3KK1B 1S4EA 2C2MB 4DV5F 3M4XA 4OHVA 5KFDA 3NOCA 1SH0A 4LF5J 2VZ9A 2B3TB 3UVJB 3TX8A 4DL0C 1QSYA 1T3OA 1HQUA 1DARA 2D69A 1E6VB 4F3MA 2HSEB 1U47A 2D9OA 3PEHA 3P5TL 3FK4A 2W7PA 2VA2A 2C3YA 2RD5C 3Q0AA 5CCLA 3TO8A 3CCVS 2VFTA 3BGRA 1D1UA 1TU0B 4PUOB 4JBCA 1XBWA 1RTJA 5BJRA 3OQ2A 4OYXA 1RI7A 4QIEA 2HRYA 1JLAA 2ZITA 4FF1A 4I67A 3CGIA 4OLOA 4GRSA 2R42A 2KI2A 3UCZP 1RJJA 3HVTA 2CG8A 3FBEA 5F0WA 2XGPA 4GKKF 5HROA 2EW9A 1H3DA 2M7SA 5DDPC 3KLEA 2W9AA 3VAJA 1IVZA 4DFPA 1UJ5A 3TAMA 4ID5B 2EBEA 3FCWA 3Q86A 4QR0A 5D0EA 3MFIA 2IFXA 4ZVFA 2KG1A 3CULA 4DI6A 5CABA 1U25A 2OI2A 4TQSA 1ZPVA 4R5PA 3EJMA 3MMJA 4F4XA 5ETSA 2MQQA 4CI0B 3MMBA 3SSSA 4RUHA 3D2WA 3OLAA 2M52A 4FXDA 2CJXB 4DR2J 4A8MP 1FJEB 1SJ4P 4DQIA 4TY9A 2YNIB 2OD6A 4HTJA 1PGZA 3AFGA 5C42A 2FJXA 1IWGA 4RUAA 2FHJA 5BXIA 4B9TA 2R2RA 3HHLD 1CLFA 2JOQA 1UVIA 3BPSP 3QIPA 2CJBA 2X7IA 3ISZA 3I0RB 3KJFB 3PR4A 2JLGA 2R8HA 4GC6A 4F4KA 2XI2A 4HEA9 5ETQA 4JI1F 4BLGA 3SIPB 2XMTA 3EDRB 3DLKA 1O8BA 1IN0A 1HPZB 3H7HB 5EGYA 5D77A 2R8IA 3P3DA 3DLEA 3V4IA 1SB6A 4N76A 2VG6A 2AYEA 3W63A 3A8IA 1A0OB 3BO4A 2P9GA 2DNOA 1XMOF 4K0KF 4DOZA 2B7BB 2IY5B 5K14A 2XMJA 3D6MB 4JI5F 2Y8WA 4PQUA 4LT6A 3P6YC 1HNIA 3F56A 1T8EA 1U1KA 2QRRA 3UW1A 2LQ5A 1Z2ZA 3R9LA 2UUTA 4J90A 5DQIA 4X4UA 2W4CA 1RHUB 2AZ3A 1YBAA 3BKUA 4JI3F 1X31C 3SSQA 1TFYA 1KNZA 1BGXT 2OPQB 4DFKA 1R8BA 5D0RA 5DGAA 2CWKA 4KGMA 2J6SA 2YNFA 4R0JA 4IO9Q 3W9IA 3G8TA 3E3XA 1EX8A 4UQTA 4IKAA 1TL4A 3AB2B 3PY8A 4PXEA 3QJLA 1HWUA 1PJ5A 1I3OB 3CO0P 2QSWA 2G0CA 4I0WA 5J2PA 1F5AA 2R2TA 2NSBA 3OPKA 2DGXA 1N36F 2EC2A 3K5NA 2EFOA 1NB7A 3CCSS 2I9SA 2DNLA 4OFZA 1L3KA 4JI6J 2HBQB 4P75A 3RBZA 4MMOA 2LXUA 3T1HJ 5HROB 4OV6A 2BJ1A 5KG1A 1YTYA 3R1LA 1X4DA 2V34A 1T94A 2DXEA 2WVDA 3WC0A 2PMZD 1WF2A 3MUVP 2QEXS 4WPAA 4PCQA 2OAUA 1UJ4A 3PR5B 2E66A 3CDBA 1JX4A 3NS6A 3Q83A 2PA3A 4X64F 2F9JA 2NLWA 5ETOA 4C4WA 2IPOB 1FVQA 5KTQA 1PILA 2XGQA 3DLBA 2E5JA 1MROB 1WNEA 3M2RA 1U1OA 4X84A 1SC1B 3MM8A 2ZD1B 2ZBPA 2D74B 4UT4A 2C28A 2J0XA 2F7VA 2ZOMA 4DR6F 4ZP7A 2O1PA 3BPDA 4ED7A 1SV5B 4LSNA 1WC6A 3KJVB 5LJ3Y 3BJYA 2RF2A 2ZDPA 3I0RA 1DTQB 1D0EA 2RT3A 3CCWA 3IR6B 4J5OA 4PWWA 5CYJA 4LF4J 2KFYA 1B0PA 2Z58B 1EETB 2J9EA 3QMQA 2IM2A 2XULA 2DD8S 1VQMS 3ITHB 2CZVC 4NYZA 3T1HF 1HBMB 3M05A 2DTJA 1V9OA 1NPRA 1AYEA 1FRIA 1UEKA 3FVYA 3MCSA 2NYIA 2WONB 3G71S 1U4BA 4DR6J 2MZSA 1VISA 3CJKB 1WC5A 4U6PA 3J7ZT 3MFHA 4U9RA 3DI6B 4JYAJ 3M8WA 1FNMA 2HMIA 2NZCA 2HFSA 5JVGQ 2NXJA 1TKDA 4Q0BB 2C2KB 2CJQA 2AT1B 4QPTA 3H2VE 4RR5A 5B0GA 3THPA 5JUMA 2WVBA 3M6WA 2KXFA 2V2KA 3G8SA 1YIJS 3VAIA 4F0KA 4P52A 4WK1A 2LFVA 3W5YA 3VQSA 1HMVB 4KH1B 3LF0A 5LT5A 3NCPA 3L3CA 3PW7A 4PG6A 4QIWD 4C3LA 2DR5A 4FS1A 1SBRA 2QYGA 2MXYA 2AIRB 2YNGA 2RIJA 4ES2A 2E5LF 1X4HA 1NBEB 1PCAA 2E5IA 3TJAA 1YJNS 2V9WA 1YLXA 2QTWA 4FNHA 1KRPA 4JI5J 3RBDA 4O0IA 4Q7AA 4RUBA 4N47A 4CTAA 2LMIA 3PCOB 4ZPAA 3MR5A 1F2GA 2FZGB 1RT3A 2MLZA 4JB8B 1EQMA 4JV1A 2AW0A 3K89A 3DOMA 5DDQC 5F8GA 2CPJA 3CWJA 1HQEA 3OJUA 2R8GA 1JNRB 2MEWA 1R0AA 2E5GA 3KK2A 5D4OA 4Y2IA 5F8NA 5F0UA 1EB0A 2BRLA 4NZ7A 3UDEA 1D8YA 3QBCA 1UVNA 2IYGA 1CULB 1PYOB 2MZ1A 1KDNA 1DQ9A 4FBUA 2G13A 3QATA 1AUSL 1OY9A 2FPHX 3EDQB 3HFZB 3IR7B 4B08A 1KQSR 3KHLA 3M30B 1CVJA 1XNRJ 2UXCJ 2OPSB 1S1XA 4K4VA 1KVKA 5IXUA 4EZ9A 4K0KJ 4LF2A 5KFRA 2GJFA 1FD2A 1WF1A 2JWNA 1X4AA 3D9BA 2YWFA 3PKYA 1HFEL 3BGLA 3MPVA 1L3UA 4G1QA 5L8RC 4ID8A 4DV2F 1VRQC 2ZBRA 3BBCA 1S99A 4I69A 1RDRA 3TUPA 3G2XA 1F2HA 1QUPA 4JI6F 3MURP 4OI0A 2ZUAA 1TL1A 4FYWB 1C0TB 1Y5NB 3D4JA 3O6QA 3Q8VA 4HDHA 4M1KA 2QO3A 3OXFA 1GXUA 4QBUA 1DRZA 2CPDA 3TRGA 3KNAA 3HVWA 4GVBA 4LF4F 1S6PA 3ETOA 1G6BA 2XSJA 4OJHA 4FS2A 2AMCB 1J2VA 4IYQA 3HVRA 1YHQS 3P96A 1ZAWA 4LVNP 3MOJB 2JEIA 4EBCA 4KV8B 3R5GA 1LW2B 2YKMA 2XBPA 3B54A 4DR3F 1C1CA 5ETLA 3FMWA 1EHWA 1W25A 4C8YA 3AH6A 1JXEA 4A8WA 3UR3C 3C2PA 4OI3A 2B7CB 1S6QB 4ECSA 1T9VA 3Q2TC 4DHVA 5B0AA 3M6XA 2VG7B 3I5AA 2DEIA 2MMYA 2F63A 3LGHA 1NNDA 4I6AA 4BCAA 3HFKA 4P71A 3KHGA 1NK7A 3MMAB 1KVJA 2CPYA 2V8DA 3ZZOA 4TU7A 4IDKA 1GNKA 2YX4A 2JC0A 3RTVA 2BQ3A 5L39A 2FLPA 1LK7A 2V50A 2XLKA 4ZDNA 3MF5A 1XC9A 4IO1A 4ZVRB 4C98A 4MH8A 1OJ4A 3CD5A 3OTCA 1EP4A 4ITSA 3MR6A 3FFIB 3ISND 4QR2A 4B3TF 1YGYA 3JAMY 1DQAA 1DLOA 2MKYA 1CJVA 2W1BA 2ALYB 1R8HA 2JH3A 1HHQA 1JLBB 3VCDA 3AOBA 4JV5J 1FDAA 9ATCB 3QT5A 4G3IA 1G4CA 1OS5A 1XIQA 3W5ZA 5KOXA 1CJUA 3FRYA 4KJIA 3EZUA 1WC1A 2XS7A 2B6AA 1XR7A 2FVSA 3QNWB 1FDBA 1N54B 3V6DA 3A3PB 5CYMA 3PYEA 1K44A 2V94A 2YH0A 4ECRA 3UWTA 4ZCIA 2FGOA 3ZZUA 1X8DA 4LUBA 2YTCA 3EVWA 3HJFA 2CYYA 2J7KA 1VQ4S 4NLQA 3T6BA 2PT0A 2MLXA 4LFBF 4GMKA 4NCGB 4FPRA 5IOLA 3FQLA 4LRBA 1FRJA 2RKIB 1J5OA 5M2RA 5DDOC 2PEHA 3CCQS 4DV3F 2O01C 2M8HA 3AD8C 2IVYA 3C14A 2A6OA 3LALA 2GC8A 4N8NA 2JVOA 2MZJA 5A0YA 1IBLJ 3CE8A 2Y1LB 1Q8IA 4DR4F 5IWAF 1RAIB 1H2TZ 4OJ3A 3K59A 1S9FA 3O5TB 5AE2A 1LK5A 1N5TA 3VGSA 5F9LA 1FXLA 1KQGB 3DKDA 1HARA 2NXEA 4NEYA 3SCLE 4DUZF 4DV6J 1FCAA 2JLFA 3TARA 2FC9A 1OSCA 3CJ8A 2KU7A 2BDPA 3IBFB 2J8SA 1TV6B 4U8YA 4X4OA 1C1CB 1SJ3P 4IFYB 2W2QP 3KG1A 4OIXA 4TKTA 2CQ2A 1KFDA 2G1HA 5EUHA 4F0MA 3QJJA 4K4SA 1OWXA 1FJ7A 3M9MB 2W7AA 4ICLA 1QY7A 3HHLA 1YJWS 4ZLNA 4Z7YA 2FHKA 1C4CA 3FGVA 1WDTA 1IM4A 2G9OA 3HXMA 4OYMA 3FZBA 2X1FA 2HQGA 2AYGA 2J0SD 3FBBA 4DL4A 4QWBA 1H2VZ 4MFBA 2R7OA 2RRAA 2OUGA 2HVHA 5KT7A 5J2NB 4ELUA 2YPZA 3THVA 3R5BA 3CNQP 4OZ2A 2V68A 1ITPA 4I4BA 2YKAA 3CCUS 1S49A 2XB2D 2CJAA 2MPUA 4OYBA 4DQPA 1Q4RA 1JK9B 4ZVGA 2CVIA 2EKYA 2G2YA 4HHUA 1WDDA 1NB2A 5E7OB 4JI8J 4F4ZA 4QCLA 4B3RF 3L9ZA 3I4HX 4KPYA 4KQZA 1VBKA 4J37A 4DMZA 5B09A 4MKYA 2HHSA 3KHHA 5L46A 2AQ4A 1IKYB 2AJ1A 4PG5A 4XAKA 3CCRS 1M5HA 3M8PA 2FJBB 2K7KA 2QG9B 3D6HB 2VC0A 3IBCB 2QZ8A 1N5YA 3RW7A 1RBLA 1P6TA 3MUMP 4X64J 4OZ1A 5GMDA 2ZVSA 2UUBF 2ZNYA 3VTIA 2MSSA 3MWBA 1TZ0A 3C15A 2QLJB 2ZH3A 4NLSA 1PG5B 4J9QA 4C8LA 3NS7B 1ICEB 2W2OP 3I9V9 5L1LA 5KT5A 3U1LA 4LF9F 5ETVA 1YJTA 4CNZA 2R7QA 2IA0A 4X65J 2IC3A 2LEBA 1NJXA 2R7VA 2HQFA 3M2VB 3DU6A 5SZTA 1P27B 2B43A 3G9CA 2ATCB 1VLYA 2QYCA 1IR1A 2OPRA 1Q79A 2ILYA 2JLEA 2XZTB 3BKFA 3N79A 4QYRA 1FFWB 3FCVA 1TKTB 1RWNB 2HBYB 3IC1A 1K73T 3IWLA 2HQIA 4ZJQA 5KFGA 2J0QD 3NGRA 3J80Y 5KFLA 1S7IA 1MWYA 4C11A 3WIUA 1DFDA 2XHWA 3M2UB 2V2QA 1S1TB 2W01A 3KDNA 1AB8A 5ETRA 4C6AA 5GAGI 4C0BA 2HZAA 2YWHA 1I51B 3BGOP 4DV0F 4EYHB 2K2PA 2XMUA 3SQGA 4E8UA 2YWGA 4N77A 3M1VA 4DR2F 1SC3B 1UTAA 5FLXU 3CUNA 1WELA 3B4MA 4TY8A 2WVFA 2RDJA 3H2UB 4G6VB 2P6TA 2KH9A 4ECQA 3ZXWA 3TZXA 4WFNQ 4P10A 4AFFA 4DR5J 3X1LB 2HHVA 1HYSA 2HVEA 3PYGA 4ZMMA 1O5JA 4DUTA 3PYDA 4OL8A 1MN7A 2V9KA 1GEHA 3K5OA 2AEMA 5AXKA 1Q7YT 4LVOP 1KBRA 1CC8A 4CLZA 2DHSA 1JLEA 4ZS6A 1CBKA 3NLCA 1X0PA 4OMFG 3FEZA 4Y2CA 5KFNA 2BQUA 1IBLF 3Q24A 3IWXA 1S12A 1UFWA 3BM7A 2V5HG 1BQNA 3UDCA 2QL7B 4C3KA 5IQ6A 5J2QA 4RBVA 2C22A 3OTBA 3R5JB 2GS8A 1IJEB 4IQMA 3QSYB 1X5TA 1X4GA 4O3QA 3FRZA 1MNEA 4C2MA 3OR2A 2FY1A 2R8KA 4A4JA 3OL7A 1MWQA 1T02A 1AZSA 2MYFA 5IC6B 3SV4A 3MPWA 1Q53A 1FFSB 4ZVHA 2HHXA 5C7PA 3HVAA 4ZVUB 4IFVB 4J9SA 1S0NA 4ZCLA 4JI3J 2KJVA 5GMEA 1XN9A 1X4EA 1LEOA 2CQGA 2ZOFA 4DL7A 2H5IB 3MM9A 3VGVA 3C6UA 3NBPB 4K2JA 3G96A 2VV5A 4L76A 3ZTSA 1WHXA 2EEYA 5I42A 3M6UA 3UE2A 2G2OA 1K9MT 1ZBTA 1S1UB 4TYBA 4UY8T 1HNWJ 2DRDA 4H4KA 4ILMA 3RAXA 4C8KA 2IDLA 1WHVA 3KLHA 1PBAA 1S1WA 1OIAA 2ROGA 3CJSA 3G82B 3JQJA 5LMUF 2GV1A 5KFWA 1JJ4A 4JI2F 1BD6A 1FE0A 2V4JA 1FJGJ 4X4RA 1RKIA 2ILZA 3FNNA 4RKUC 1HQUB 2N4CA 2R7XA 2W24A 1Q5VA 4CH0S 1TUGB 3DDIA 3GJSB 3RZAA 2KB2A 4DX6A 5IS2A 3T3FA 4C11B 4A8OA 2XZWA 3NWGA 4FDFA 1WSVA 1JMTA 3R5DA 4F4YA 4LQ9A 1SC4B 4CWBA 5B0BA 1GMWD 3BSCA 2C2ZB 1CJKB 2IYIA 3K57A 2RUGA 3DM2A 7FD1A 3H59A 1SJQA 3SCJE 3JAMU 5L1JA 2R7UA 3KK3B 1TUVA 2DO4A 2NZ4A 4DBQA 4K7QA 2NREA 3QQCD 1WHYA 4KYZA 1T03A 1BY9A 1JNZB 3LQVA 7FDRA 2FJDB 1ZM3A 5KFHA 3AA9A 2ADBA 2J8AA 4XTTA 1U45A 4XPCA 2XMMA 3TUJC 2KFZA 4F36A 2ZE2B 3PDNA 2DITA 2MKJA 2EI5A 2AWZA 1UPPA 4TU8A 3JB9k 5HI7A 4B9LA 4USVA 3HSZA 2C3PA 5IFMA 4OLPA 3EPGA 2XMVA 2RQCA 2CQ3A 3ZZZA 5EWGA 5DGBA 1RTZA 3HHKA 4G1PA 2AV5A 5KFVA 2X51A 2IHR1 1BQNB 3OTOF 4DLGA 2HS4A 3GTYX 3OTEA 2CQDA 3RAQA 1R0BG 5KFIA 4NXMF 3V6HA 3MAAA 4KRWA 1FWKA 1HNVA 2Z56B 3N6NA 4QU7A 5HQMA 4NLUA 1N33F 2CJ9A 5D3GA 2RILA 1NLKL 5KFJA 3WDOA 5MLCV 1TKZB 3DGPB 4ECVA 1JKHA 4RPFA 4CO1A 5HQ8A 3RB0A 4M5DB 4IRCA 3P5BP 3TQ1A 1UETA 4MK9A 1HBNB 5I3PA 3CF5Q 5KAKA 3QGHA 4DS4A 2UXDJ 1RT5A 1H7XA 2VF3A 3FFIA 4AUKA 1NRKA 1Y0HA 2OFHX 1U49A 1PSDA 2RQMA 2J6TA 1K1SA 1RT2A 1YDLA 2JVRA 5J2MA 3CIMA 2VDHA 2DT9A 2M2BA 3QLHB 3N9UC 4L3KA 1JLBA 1N0VC 2IRXA 2W2MP 3KJQB 1OPIA 1CJTA 4WFYA 5KFCA 4NA1A 3GFZA 3IG1A 2CADA 4W90B 1VQ7S 3QZ8A 5AXNA 5CD4A 5DRKA 2BE7D 4LMZA 2M4MA 4RNOA 4I2QA 4K8RA 4DLEA 2RRNA 2VQEJ 2C3OA 1C2PA 2OH2A 2YNFB 1M0SA 3NRBA 1SJFA 4CYUB 1TP7A 2BE2A 2GA7A 5KT4A 4XPEA 2K1RB 3CC4S 3DRPB 2HAFA 4DV5J 5T7LA 4KKOB 1TL3A 5IZHA 4Q43A 5A8KA 4ZVSB 3WC2A 2GGPB 1LXNA 4FXVA 3W9HA 4EU0A 1OQ3A 5HVHA 1J5OB 1QM9A 5IT9U 1WEZA 3HSGA 4PAAA 4LRAA 1NK0A 1RP5A 1NPPA 4YFUA 5I3QA 2MQPA 3IRXB 1YK9A 2KVQE 4QZVB 5HMXA 3CC7S 4LFCJ 1LWXA 2IIHA 1KP6A 2LP4A 3MCMA 3M32A 2AU0A 1ZTTA 1YKWA 3M6VA 2LU2A 2QA4S 2FTRA 2JNJA 2CQBA 1HW9A 3HD2A 4RW6A 1WSRA 5HANA 4YHHJ 1VBXA 4DV3J 1IQZA 5HN0A 1J5EF 2HRTA 2VPZB 1UFLA 5I3UA 4OHXA 4Q44A 2VQEF 4YMEA 2ERRA 5KG5A 2DRAA 1K0TA 5HMWA 4Q45A 3PJXA 3BS9A 3I87A 1I94F 3TI0A 2DNNA 2DGQA 4WBFA 2OTJS 1CSJA 2DR7A 4WFZA 3LPEA 3PO4A 4LSNB 5U47A 2UVWA 2UVVA 2QFIA 1JWWA 3GR1A 4HKQA 3M8ZA 1UWBB 1UPMB 1RWVB 3NY0A 4HH0A 3GSDA 4GKJF 3ISNC 2GFFA 4USUA 1FWPA 4NMLA 1FK9A 4CP5A 1RACB 4QIFA 2HHTA 3JYTA 3W2WA 1WKLA 7AT1B 3K5MA 4HYKA 1GXLA 2RAQA 3KJNB 1VHIA 1RWPB 2VPYB 1HWIA 1LW0B 1YBTA 3H4BA 1F9FA 1LQ9A 3BZQA 2J5AA 4C48A 2OGUA 2ADCA 4EBEA 3R3TA 4KB7A 4WZMA 4DN9A 1S0OA 1XJWB 2J9DA 4A8QA 2M88A 3HMJG 5C5JA 5CZVA 4X4NA 1S10A 2FVQA 1VRTB 1VCTA 2PC6A 2VG5A 3DOLB 2J9DE 2Q43A 3IP0A 2BJDA 1Q8LA 4KGXB 4DR7F 4QU6A 2H5JB 3MXHP 2XWXA 4DR4J 1CS4B 4B02A 4DG1A 1OSDA 2WSEC 3J7Z5 1M5OC 3RW6A 1N33J 2XQCA 3EUNA 1BQMB 1TELA 4URGA 1N48A 4B9NA 2KHCA 2F65A 4RUCA 4LFAF 1Y10A 2K1RA 4L74A 1REVA 4B3OB 2CA9A 1YI2S 2FJAB 2L9DA 2J9CA 3MR7A 3TA0A 4K4WA 1X4FA 4B9UA 4JI7F 2E9RX 3KMQA 1XMOJ 2ZZNA 1HQ2A 1LWEA 1Y11A 1ZOTA 4A46A 4CLYA 3TZWA 4C8MA 1LWCA 4KGKA 1RHRB 4P72A 2W4DA 1RWKB 4NLXA 4P9SA 2B9YA 3W60A 4NXNJ 3V2UC 5D4PA 1HWLA 2BJ7A 1U1MA 2BEFA 2FYXA 4CCHA 2RRBA 1S9EA 1FT8A 2ZHOA 4M5JA 4ZITA 1G1XA 1FTCA 2LEPA 3W62A 3NS5A 3DLGB 1BLUA 2GAGC 5AE3A 4MKAA 3DGVA 1JXLA 1FNXH 1MWZA 3PW4A 1X7VA 5I3UB 4R25A 1UVLA 5F8JA 5K8MA 5F3TA 5LSRA 2HHQA 2KM8C 2ZBQA 2VJVA 2VC1A 3BGUA 2B9EA 4M5HA 3T41A 5SUHA 4ECWA 4HACB 2M70A 3W2VB 4W98A 4C8OA 5A6WA 1BWEA 1YJVA 1U2CA 2HEKA 1I5OB 1KONA 2HVZA 1VC6A 1P1LA 1IKVB 1RTIA 3QWUA 5D0HA 4FP9A 4ZLLA 2B8PA 4OHWA 4S0MA 1HNWF 2AEFA 3EXCX 1Y00A 5B0DA 3UDLA 5KFZA 1QDUB 4ZCMA 1GK8A 4ANDA 1T0TV 4R8UB 4X62J 4LF9J 4ZHRB 2BUNA 2KT3A 2W2NP 4NI2A 1PYSB 4ED8A 2MQLA 2EPIA 3RUBL 1S97A 3HO1A 4IG0A 1H6KX 4QIVA 3MD1A 3NCQA 3W8PA 3WX4A 4Q5VA 3HZEA 2WTFA 3D54A 1QAXA 2HVDA 4ED6A 5KT2A 4B9VA 5C42B 1IBKJ 1KS2A 4NPOA 4BHQA 1HR0J 3UO0A 1OO0B 1F9EB 2DJWA 1UL3A 3KLVA 3D1OA 1U1PA 1TVRB 1AZSB 2Z2MA 3K17A 5HBMA 2MKHA 1RAAB 3SYZA 2XNRA 1RAEB 3MM6B 1T9WA 4KBIA 4YEAA 2ZH1A 4EYIB 3GCWP 3DLLQ 4FKYA 4ANCA 2WRMA 5GAEI 5GAEU 3NAHA 2DY1A 2V2VA 2YWWA 3D6TB 4ED4A 4OI1A 4EZ6A 5H9EJ 1DQ8A 2FHOB 3P8BB 2YKPA 2EKNA 3FEYB 3QYYA 4P6QA 4Z2XA 5HK4A 1SI9A 1JLQA 3CJQA 1X4CA 4P7TA 3WHIA 5H1SV 5GAHU 1TTHB 4DSKA 2HS3A 3MMCB 2OTLS 1Y5IB 3LP2B 1RAOA 3MCOA 3R1HA 3CD0A 5K14B 1D9AA 1DTTA 1TL7A 5CAAA 2YWEA 1CJVB 5F9NA 1FJCA 3FQKA 3AODA 4WXWA 1LWEB 5LMNF 3J7YI 2FGCA 3AOAA 3R7NB 3J80U 4EUVA 2LKZA 3TAQA 3HKZD 4ETXA 5F8HA 3DYAB 3TA1A 4FBTA 2KRRA 2V63A 1GMWA 3AA8A 4LBHA 3KG4A 5HMZA 4TLQA 3UR0A 2LA6A 1EKRA 2V69A 4WYWA 2P9EA 2AF6A 4ZPCA 2FVRA 4EFAC 2CG4A 1UKUA 1SJ1A 2BE9B 4ED1A 1M5PC 3NNCA 3FSIA 3M8QB 4KFBA 1N52B 2NSCA 2LECA 2G1DA 2OMOA 4DV0J 1RU1A 2HHPA 4RX6A 2CPFA 3BYRA 1GMUA 2V8HA 3PIPQ 3AHPA 2MZQA 3AJ1A 4UF4A 4HI2A 4ZOSA 3SDEB 4GVLA 3W2VA 3BF4A 1FESA 3CVKA 3TJ8A 1SUQB 2XS2A 3PFEA 1XQIA 4K4TA 1VQ5S 1ZM9A 1VI7A 2BACA 1C0UA 2NUHA 2YX7A 3I5BA 5E2QA 2H54B 1D9FA 4GKKJ 4WIIA 1MMDA 1RXOB 4M94A 4Y34A 1SCJB 3FSXA 3KLFB 1T11A 3CT9A 4GO5X 4IH7A 3G6YA 2HIYA 3KLGA 2V8PA 2BM1A 2E7WA 3CO9A 3EVMA 3M8SA 3OHAA 3PZPA 2Q66A 4NI2B 3UVJA 2ZD1A 1VJWA 3LP0B 2F3JA 4L3NA 2HIQA 4PG4A 5LXRA 4CIOA 4A8SA 3KUHA 1N8RT 2Q1LA 3ILJA 3CD7A 3TUIC 2CQCA 4AL7A 2QA2A 2VHGA 3C3LA 3QRQA 1P8GA 1U2RA 2OHDA 3I96A 4LREA 3D5MA 3MEDB 4NRUA 3PG9A 5DDRC 3D1QA 4J9KA 4IRKA 2A1BA 1N56A 2E5HA 3AXMA 2V8GA 1YZ7A 5ITHA 4LSZB 3TVYA 3OSNA 1VQPS 1HR0F 2HHHJ 3DOKB 2VFRA 3DGPA 2H1YA 2GO9A 4MJKA 3ZZTA 1XERA 3WZ0A 3CCJS 3ADAC 4JV5F 3SQOP 3NMAA 4U8VA 4M8LA 1F3VA 1KLMA 2R4FA 1RT6B 4WK3A 2EFNA 3W64A 3BGFA 3J7YU 4CQ1A 3MAQA 3HK2A 4WZQA 2WONA 2JZ5A 1O0PA 3R97A 3RBXA 2DH9A 1H0HB 2G0IA 3MPUB 4C7QA 3MR3A 3CJRA 1YRTA 2QSFA 4Z37A 4U7UD 2OEKA 2EC0A 3BQ0A 2JEGA 1QAJA 1KC8T 1QSSA 2OSQA 2XI3A 4WTYA 5K8PA 1UVJA 2DHAA 5KFMA 3DCAA 3TEGA 3GU0A 1VFJA 2B0GA 2ZNZA 4F4AA 1IKYA 3QIDA 3RR7A 3I55S 5A8WB 1N5YB 1DURA 5DETA 3RBEA 3HHDA 3CDAA 3RU0A 2ABYA 3GYNA 3U7JA 4UOFA 4EEYA 1NU4A 2DPJA 2JFDA 4Y65A 1SIZA 3IGVA 1ZA1B 1SH3A 5IM0A 3TYTA 3T5HA 1SJRA 4UOCA 2PSZA 1Q7LB 3PYFA 4I1TA 2NPFA 1WG4A 3KUGA 2POKA 3ZZPA 3G87A 3FCHA 3VAGA 2BW7A 3RAMA 4CH1A 2EFGA 1FXDA 1YVFA 4EGLA 3V81A 4FKXA 1HA1A 3LUYA 2BOAA 4KGZB 3QRRA 4NLPA 3K5LA 2ROEA 3K2YA 4Y6IA 2VG6B 2QMUB 1XMQF 1XNQJ 2F9DA 3HCXA 3MM5B 1EJ7L 5EHHA 4ZP8A 1H2UX 2BR0A 3DLHA 2G4BA 5CYQB 3KLFA 2LEAA 4FXWA 2OJ3A 2Q6BA 1PYTA 2JRSA 4AYBD 3RJMB 5IC4B 2UUWA 2HNDB 1CEZA 4LBPA 1EQ0A 2OP5A 2MQOA 3QT6A 2J7WA 1YG0A 3M1VB 3GQCA 2R7RA 1G3OA 1XK8A 2ZBCA 5MAOA 3TA2A 1TQLA 2XC9A 4F3OA 3H98A 1XMBA 3MEDA 2BXJA 1QTMA 3IAM9 3THTA 4F2SA 1NKCA 2LA4A 3HDSA 3N5FA 3M9NB 3OUYA 4DL3A 4F8RA 2HFOA 1Y9OA 2HFZA 4O3OA 2K3KA 2VKZG 2Y0SD 4TNOA 1FJGF 2DNPA 3ILIA 3A3OB 2AKWB 5L38A 1S6PB 2QL5B 1ACMB 3CJTA 2C3MA 4O4GB 2W8KA 5C25B 4ED5A 4Y2AA 2RB7A 2AYMA 4OZ0A 4J9RA 3RGIA 1Q81T 2BJ8A 5AXLA 2R9LA 3GIMA 3KG0A 4AL6A 1SPBP 4DV4F 2MJUA 4CO4A 3BQ1A 3AJ2A 3N4WA 1MMNA 3IRWP 2GNKA 2L08A 2RU9A 1FF2A 1CG2A 3PRBA 4O3NA 4YR3A 1XNRF 4I7FA 2AX1A 1R27B 3O1LA 4NA3A 2LQ9A 1VQ8S 4RW7B 5IV4A 1Z4UA 2Z8QA 3JTOA 3MM8B 1UA1A 2DPIA 3NNHA 1PJ7A 4USTA 5B08A 4OHYA 4FF2A 1R0CB 3D7SB 3MPDA 2BJEA 2H4YB 2NPIA 4EMDA 6FDRA 4B3MJ 1ZH5A 3ZTRA 2ZJRQ 4LF6J 3MM9B 1EP4B 3FEXB 4KC5A 3OFHA 4CLPA 5AT1B 4FVMA 3KJVA 1OMSA 4ILRA 4Q2LA 2FB0A 1AROP 4O3PA 2V2ZA 2BX6A 1TK0A 3KLHB 2GMLA 3OL8A 2M9KA 1FKPA 1XR5A 2B56A 4BWJA 2C2RA 1VQYA 2NS1B 2VFUA 2E5LJ 4DSFA 1SIWB 4WU2A 5J2NA 1LXJA 4UTGA 4WTOB 4KHPF 1ZAXA 3UN3A 5DM7Q 3DN9A 4ZLJA 3ENWA 4ANEA 1E6YA 1NO8A 4CDIA 1HW8A 1QVFR 1RISA 3U1NA 2DYAA 3DHWC 1S9GB 2WBMA 3PEJA 4PEOA 1VQKS 4OI4A 4IR9A 4N8OA 3AT1B 2ASLA 2OEMA 1RTDB 2DBBA 1PIEA 2PFDA 4PQUB 2RMLA 3CSKA 4CLFA 3DM2B 1T9TA 2F4FA 1NCLA 1IJFB 1X60A 2RHSB 2MKKA 1SKWA 5M2UA 3OVSA 4JI4F 1U1LA 5G0RA 2Y1JA 1WI8A 2DIUA 4LF1A 3GG1A 4OZNA 2DXFA 2K06A 4I68A 1VGYA 1XR6A 4YN3B 5JXSA 2VOOA 1X9MA 4U96A 4LF7F 4HACA 4X4QA 3GIRA 2VFVA 4EO8A 1Q86T 3ZFVA 2JHEA 1S76D 2L48A 3X3UA 1IKVA 1RTIB 1WOOA 1ZA2B 2QMWA 5IV3A 4ECXA 3T5LA 4TQRA 2M8DB 1YJRA 4FYXB 3IM9A 1WC3A 2GVDB 3KUEA 2Y1RI 5AJ3F 4DQQA 1FDNA 2H4WB 3UCGA 1S1VA 1N88A 1ZYQA 3GP9A 1RT4A 4HHHA 2DGVA 2DGTA 3AD7C 2Z30B 3OFFA 2B51A 2CNOB 3OHBA 3D0HE 2WSCC 1YZ6A 1TKTA 2ZJQQ 1U1RA 4LF7J 5THWA 3RG6A 5DG9A 4QYZJ 4QPXA 4YP3A 1VQ9S 4R0EA 1HNVB 2KM8B 4B3MF 3CDEA 2HBZB 3D3CJ 3MOZA 2FDNA 2DO0A 2QLWA 4X4TA 1HBOB 4WE1B 3F73A 2XSFA 2Y1IA 1FWLA 2CQ0A 2CQ4A 4I7FB 2C3UA 1N4LA 3E8OA 1IUJA 5E5NA 3I32A 2IA6A 2VPXB 3M30A 2DNMA 1RHQB 4DSLA 1R6YA 3GIJA 1WG1A 2LQJA 3OL9A 2WB4A 4DR7J 4K5SA 3ZC4A 1K8AT 4NLWA 1VBZA 1NM2A 2ZZTA 3DC2A 3NWRA 4L73A 1V5VA 1B7YB 2ZC3A 3DNCA 4M5NA 5D0GA 4YUDA 1BE4A 4YR2A 2FLNA 3SXLA 3HKWA 4KHRA 5DS7A 1GX5A 2KO1A 2VBYA 4HH1A 4USJC 4ID5A 3TX0A 3CCLS 2UVRA 1U6FA 1RT2B 4OX7A 3OLBA 4RW9A 2Q3PA 1UEUA 4ED3A 2DNGA 1U8WA 4MK8A 3VHQA 1NDPA 4WFBQ 2XSJB 1UCNA 5JVHQ 2FLOA 4I6WA 3ZTQA 3LWMA 2N3LA 3MM7B 3LW5C 1T7PA 5EN1A 3NAIA 1D09B 4AXIA 2E7VA 4E0DA 3PW5A 2DISA 3T6JA 5DLFA 2BYCA 1W2IA 3AAWB 1QD1A 1CPZA 3EVOA 4DEZA 8AT1B 2H48B 4H4KC 4KT0C 4I64A 1HBUA 1HD1A 2HMIB 4W92B 4DS5A 2WCXA 1YRXA 3D67A 4DSJA 2GMJA 2WAQD 1GTHA 2VH7A 4OZ3A 2PFFB 5CXTA 2HZCA 2CUYA 2VBXA 4L72B 2MTLA 2DGSA 2VBWA 4LIRA 3WIVA 3SCKE 3G6VA 3C16A 1XMQJ 1XNQF 2QX0A 3IM8A 1EKSA 3NGSA 4CH7A 3OL6A 3C6UB 3NBPA 1NUEA 4YDXA 2D3O1 3ZNJ1 4DU7A 3KMSA 5LMNJ 1IBMF 1MLAA 4ZN1A 3ONQA 3OR1A 4FPIA 3S6EA 4JI7J 4DFMA 3GB0A 3WBZA
chains in the Genus database with same CATH topology
1QJHA 1DZ5A 3CXCR 4K4XA 5J1EA 3MGJA 3V6JA 4EO6A 3IA0A 3B78A 1CC7A 3JSBA 2PIIA 4NWBA 1OPZA 3E51A 1LWFA 3V6DB 3UNGC 1FA0A 1PC4A 1X9WA 2BOPA 2CPIA 4BC9A 2MB0B 2DIVA 3T1AA 4P2SA 2HNYB 3BSNA 1NKEA 1KTQA 2RNEA 1AXQA 2MZRA 5A8RA 2B4UA 2MDAA 3Q8QB 3D28A 3R5AA 4DL2A 2JC1A 3BGRB 3KOAA 4DPOA 5HO4A 3PX0A 2RKIA 1LKZA 5KG6A 5CD4H 2AJ0A 2ZJPQ 4DV7F 1SL1A 4DWIA 2D9PA 3GMGA 4QWAA 2VODA 4H4OA 2XO7A 2DR9A 2DNRA 1GAOA 2V4QA 1N32F 2OO4A 2QE5A 4QR1A 3HHLC 2W4PA 3KLEB 5FDLB 2CPHA 1KEKA 3SMZA 3BO2A 2OIHA 4DSIA 3IR5B 3RB4A 2ZZMA 3OXLA 2B9WA 1JLFA 2BABA 4RBTA 5F8MA 2VOPA 3HZGA 1HI0P 3QZ7A 2Q79A 2QA1A 3H5YA 5IM0B 4RNMA 3JSRA 3GFYA 1MU2A 1SV5A 1REVB 2DNYA 1RT1B 3GILA 2V0NA 3LP1B 2B5JA 2VFSA 3PX4A 1O51A 3DRSB 5L1IA 2KJWA 1FD8A 1JKHB 4A48A 2PI5A 3MECA 1U2FA 4M5DA 1Y4ZB 4MFBB 3CTRA 1JJ2R 1B0TA 2OKQA 2L41A 3CPWR 3NP5A 4ZP6A 3MDFA 3GIKA 4H54A 1FRXA 3LGNA 4WCEQ 1SXLA 3L95X 5DLGA 1HWJA 3Q8RB 1D9DA 4ECZA 1DLOB 3DDNA 5J1EB 1FE4A 2IVFB 4CZCA 1AUDA 2WOMB 4F02A 3DRRA 2I2YA 2LQBA 1KQKA 1NK5A 2C2EA 4QIGA 4URQU 5CYMB 1ELOA 2ZE2A 3I82A 2QLXA 4FVCA 5DG8A 4RZRA 2MY7A 5DO2A 2R2SA 1TFWA 1BQXA 4C9DA 2X3GA 2RS2A 5I4MA 4ZVEA 2VQFF 4FYDA 5DQHA 5C24A 1VQNS 3CCZA 4ZHRA 2RQ4A 1X9SA 2HQ3A 4MIWA 4X4VA 4XDCA 3PACA 4C0HA 1FKOA 4OI2A 2IM0A 1NK9A 2FHJD 5CCMA 5FDLA 2P5VA 5KFUA 1A9NB 3H2LA 1NKBA 1R3NA 3I9ZA 4RW6B 1X5PA 3MAHA 1VC5A 1IR0A 3LPYA 4ES1A 2GQ2A 4QWEA 4I2PA 2KRBA 4Y3CA 1IQTA 1N34F 1H7WA 1L3TA 3I31A 1X5OA 3JTNA 4DF8A 3PKMA 1B0VA 3M2RB 3NKYA 3QAEA 3HI9A 4NLDA 3HVTB 4J9LA 3CJ5A 2R2UA 2O3DA 4PXDA 4DV6F 2ASDA 3MMCA 5HP1A 2AJQA 4ATNA 1QAYA 3RRGA 4AL5A 1UWBA 4NYPA 2JL9A 4XIUA 4ICLB 2F8EX 3LAKA 5A6PA 2D41A 3GE9A 3MECB 1JLCA 5GADI 2UUAF 1UEVA 3IGNA 1WACA 3OSPA 4HT7A 5E33A 5T14A 3ITHA 3PNIA 4ED0A 3AB4B 1Q1KA 4Y2MA 3ZZ0A 1QSLA 3MI7X 2BZ2A 5K9FA 1APSA 2R7TA 2ZH5A 3LGMA 1LFPA 2NXUA 5HLFA 4A8FA 2CQ1A 2CRLA 1WTFA 1RTDA