2CQ3A

Solution structure of rna binding domain in rna binding motif protein 9
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
103
structure length
103
Chain Sequence
GSSGSSGNSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title solution structure of RNA binding domain in RNA binding motif protein 9
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords RNA-binding protein 9
total genus 14
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cq3A00
1WEXA 2XS7A 3CXCR 2KRRA 4ZKAA 2JVRA 2MZTA 1NJIT 3P49B 2VODA 1VQOS 2G4BA 2MQMA 1WF2A 1PO6A 1QVFR 1VQ7S 4CQ1A 4IO9Q 1R8PA 2CPZA 2AYBA 2RRAA 4Y0FA 1WHWA 2OSQA 2JWNA 2X1FA 1X5PA 2M2BA 1H2VZ 1YTYA 1VQPS 2K3KA 2YTCA 2GO9A 2LXIA 1X5SA 3P3DA 4UQTA 3VAKA 3VAIA 1X4CA 1U2FA 2K8GA 3IRWP 2FC8A 1U6FA 1OIAA 2MZJA 2AYGA 2MKHA 2YH1A 1IQTA 3LPYA 2L08A 1FNXH 1FJ7A 3UCUP 2DGXA 2HGMA 2VOPA 3R27A 4A8XA 3SDEA 1SXLA 2DGOA 2CQPA 4M5DB 3TO8A 5GAHU 1VQ5S 2FC9A 2M7SA 3BEGB 2ZJPQ 2CQIA 3LQVA 3Q2TC 3CPWR 1DHMA 3CCQS 1WEYA 5ITHA 2L9WA 5DDPC 5DM7Q 1A9NB 2DGUA 5FJ4A 3UCZP 1URNA 2KXHA 2DHSA 5JVGQ 3IWNC 2XSFA 3NS6A 2MSTA 1A7GE 3S8SA 5EN1A 1OWXA 4TU9A 2MGZA 2MPUA 3G9CA 2QEXS 2EVZA 4PR6A 1HL6A 1D8ZA 1WI8A 3EGNA 5JVHQ 4CIOA 1U6BA 5IM0B 2DK2A 3UWTA 2KYXA 3U1MA 3CF5Q 1X4EA 1M5KC 2LYVA 1L3KA 2F9JA 2MKKA 2FHOB 1WF1A 4ED5A 2CQ3A 2QA4S 2YWKA 3BS9A 1NO8A 2L41A 5DETA 3SDEB 2DNKA 1X4HA 2XB2D 5D77A 2A3JA 1KOOA 1VQMS 2LCWA 3G8TA 4WFNQ 1QM9A 4IOCQ 2M8DB 4RU2A 4F02A 1VC6A 1RKJA 2OTJS 1VC5A 1FJCA 3CCES 2CQ1A 2DNNA 1U1LA 2YH0A 4F25A 4WKRA 2N3OA 2DO4A 2LXUA 1S72S 4P6QA 1YIJS 2MSSA 2OJ3A 2X1GA 1ZZNA 1F9FA 2CQ0A 3NS5A 3CD6S 3CCLS 2VONA 2YKAA 3CTRA 1VBXA 1XN9A 2CQHA 1U1NA 4WFBQ 3FEXB 5LJ5Y 2DIVA 2DB1A 3HHNB 2KG1A 2RU3A 2N7CA 2LQ5A 3MURP 4UY8T 3MUTP 1FT8A 1YHQS 3P6YC 1VQ4S 1VQ6S 3VAHA 2DGTA 3VF0B 2ADBA 3H2VE 1U1KA 2BZ2A 1N8RT 1O0PA 4QU6A 1HD0A 1UAWA 2CPEA 2DGSA 1U1RA 2CPJA 1PGZA 3EGZA 2EK1A 3NMRA 2J8AA 3J7ZT 2M52A 2KVIA 2MQPA 5GAEU 2D3OR 2CPIA 2DNOA 4FXWA 2Q79A 4PRFA 4PKDB 3UE2A 5CXTA 2E5IA 4C7QA 3VAFA 2VOOA 4W90B 2KI2A 1BY9A 4BS2A 1VQNS 2AYEA 3J7YU 4C0OC 3MUMP 5BJRA 3VAJA 1WEZA 1X5TA 3CULA 4TU8A 1VQLS 3S01A 2M8HA 2CQBA 3BO2A 3ZZYA 1X4DA 1HA1A 3CCUS 1RK8A 2GHPA 1YWXA 3DXBA 2DIUA 1ZZFA 1YI2S 4IUFA 1KQSR 2MZ1A 2G1DA 3FEYB 2OIHA 2MY8A 3H2UB 3U1LA 3BO4A 2LMIA 2ERRA 1WHVA 2OTLS 1P1TA 2D9OA 4TLQA 1N54B 3UD3P 2KM8B 3R1LA 4FXVA 3TP2A 2DHGA 1M5OC 2ADCA 4CH1A 3MI7X 3G71S 2JVOA 3HI9A 1OO0B 2CQDA 2V94A 2PEHA 3THTA 3G8SA 4W92B 3PIOQ 2NZ4A 1DRZA 2DNRA 2MZSA 2AD9A 2MYFA 3MDFA 3CC4S 2MQQA 1N88A 2FY1A 1YJWS 2M4MA 1H2TZ 2HZCA 3PIPQ 3B4DA 2CQ4A 2RT3A 3CMES 4CH0S 2QFJA 2HYIB 3EX7B 2LEBA 2B0GA 2LKZA 5IM0A 4YUDA 3NNCA 1KD1T 3CC7S 2MQOA 5GAGU 2FPHX 3V4MA 1SJRA 3THPA 1DZ5A 2KN4A 1FJEB 1VBYA 1K8AT 3P5TL 3I55S 2E5HA 2RS2A 3MD1A 2CPFA 1UFWA 4OZ1A 1JJ2R 2CPHA 2CPYA 2LECA 2O3DA 2MZRA 3VALA 5H1SV 1VC0A 1SJ4P 5CA5A 2J0QD 1UP1A 2KU7A 1S79A 2XS5A 2DNMA 2NLWA 4F26A 2CQCA 2DGQA 2OSRA 4WFAQ 4IOAQ 1JJ4A 5DDOC 1KC8T 2MB0B 2KFYA 4C4WA 1UW4A 3N9UC 1WG4A 3B4MA 2U2FA 2CJKA 3S6EA 1X0FA 5LSOA 3CCMS 1M5PC 1U1PA 4OZ0A 4Z2XA 2DNHA 1FXLA 2AYMA 2M70A 3US5A 5MLCV 1R8HA 5CYJA 4WIIA 2KXFA 1OPIA 3MOJB 4ERDA 1VQKS 1FO1A 5DDRC 2KG0A 1VBZA 1K73T 1H6KX 2DH9A 2MHNA 2DISA 3I56S 2DHXA 1Q82T 5IQQA 1B7FA 3CCJS 3D2WA 2CQ2A 2DITA 2DNYA 1WG1A 4U67Q 3CUNA 5DM6Q 3L3CA 2LEAA 2DGVA 1W2BR 1Q86T 2MJUA 2MY7A 2J0SD 4LIRA 2F9DA 2KHCA 2M88A 3VAMA 2DO0A 2DNLA 1JJHA 3NNHA 2KT5A 1YJNS 2MQNA 2DGWA 2RQCA 2KXNB 1WF0A 1ZH5A 5HO4A 3BO3A 5LXRA 2LA4A 4LJMA 1U1OA 2HVZA 2JRSA 5LXYA 2KH9A 3G6ES 1NU4A 2MZQA 2N3LA 3TYTA 1X4FA 2MGZB 3CMAS 1K9MT 2I38A 3SXLA 3CCVS 2ZJQQ 4QPTA 1WHYA 3VAGA 2JX2A 2DNGA 5DDQC 3RW6A 1X4BA 1HD1A 1WHXA 2E5JA 2EK6A 1D9AA 2DHAA 1SJ3P 5HL7Q 2X1BA 2KM8C 1WELA 2MKSA 2LA6A 3MXHP 2MKCA 2F3JA 2SXLA 5D78A 5IFMA 2RQ4A 2M0GB 2BOPA 1JMTA 3UCGA 4Y00A 3MUVP 5GVQA 1X4AA 1U1MA 3NNAA 3UD4P 3SMZA 2UP1A 1SJQA 2DNQA 1P27B 3ZZZA 1DBDA 1YJ9S 2MJNA 4WCEQ 2N82B 1Q81T 2RNEA 2E44A 3MD3A 2MKJA 2I2YA 1KOHA 2M9KA 2PE8A 2G0CA 1M90T 3R1HA 2RRBA 2HGLA 4WF9Q 4EGLA 5GADU 1X5OA 3CCRS 1M1KT 2MKIA 2RVJA 2MQLA 2U1AA 3Q2SC 1WI6A 3K0JA 5LSLA 1WG5A 4J5OA 2DNPA 5LJ3Y 3S7RA 2DH7A 3OW2R 2J76E 2HGNA 1G2EA 2KRBA 2E5GA 2CPXA 1VQ8S 1X4GA 1WWHA 3G4SS 2DNZA 1CVJA 3ULHA 1QVGR 4LMZA 2DH8A 2D9PA 1FHTA 3CC2S 1H2UX 2ZJRQ 3G96A 2XS2A 3RW7A 4QU7A 2MMYA 2MXYA 1U1QA 1VQ9S 1Q7YT 4QQBA 5GMKa 3CCSS 4V19X 1YITS 3DLLQ 4TU7A 1WTBA 1M5VC 2RUGA 3JB9k 4YB1P 2CQGA 2XNQA 2RS8A 4YOEA 1SJFA 1AUDA 1N52B 2CPDA 2WBRA 2X1AA 2XNRA
chains in the Genus database with same CATH superfamily
1HWLA 3BM7A 1KVIA 3C6UB 1ZTWA 3JQMA 2FDNA 1VQPS 3P49B 4AXJA 4O44B 4HYKA 1H72C 1MWYA 1WF2A 4FF3A 3GONA 2KB2A 4DU8A 3ISND 2FLNA 1VQ7S 3KFWX 2LU1A 3OBIA 1NRKA 2YKNA 9ATCB 1R8PA 2CPZA 3FQLA 3M2UB 3SQGA 4IO9Q 3CIMA 4GO5X 4JI3F 2ABYA 4P9SA 4I67A 2AJ4A 5JJBA 4Y0FA 2E1MC 2PEBA 1HBUB 4TQRA 4OZ3A 3HSDA 3HKWA 2X1FA 4QIFA 1WDDA 2M2BA 4JP8A 5HJXA 1YTYA 4C6AA 3W2WA 4F4KA 1UZDA 5ETRA 3BGOP 1RKIA 1S1XA 1GTHA 3UD5A 4NXNJ 3TVKA 3VAKA 4ZS6A 2UXCJ 1QD1A 1X4CA 3JTNA 5G0RA 2WONB 2FC8A 1IBCB 3ITHA 1L3SA 4QWBA 2ZBRA 2Z57B 1PJ6A 1OIAA 2WTFA 4OHWA 5J2QB 3GCWP 5HQMA 2AYGA 2ACMA 4IR9A 2ZHBA 4OI0A 1DFDA 1FNXH 3OSPA 3UCUP 1N48A 1DJ0A 2NSCA 3GU0A 1RHQB 1SKRA 1IUJA 4NZ7A 4DQSA 1YK9A 1XWLA 3HSJA 3M4XA 3CSKA 4CLLA 1TKTB 5KFOA 1TUVA 3I0SA 4ZVHA 1YHQS 2GV1A 2WSCC 1RZMA 2M7SA 3BEGB 2ZJPQ 2RAQA 1D0EA 2JJ4D 3RB6A 3TAPA 2Z0GA 1TK0A 4X4OA 2IYIA 4BC9A 2O5DA 3QGHA 4WK3A 2CZ9A 4HACB 1TKZA 5FJ4A 1GAOA 1LXNA 2OH2A 2DHSA 5KT7A 3LANA 3PRVA 2FZGB 2RDDA 2C2OB 2MSTA 1A7GE 2XSFA 3NS6A 4I1TA 1UVJA 3S8SA 1ZAXA 1NB7A 2XMKA 1OWXA 5ETKA 3ET6B 5C2CA 4PWUA 3OXGA 5C42B 4F0KA 1SPBP 2XMJA 4ZA1A 1NCLA 1EETB 1VRUA 3RRKA 4DQRA 1F1BB 4PR6A 4RNHA 1NK7A 2EC0A 4B3OB 1KDNA 1TL1B 1R31A 3HHLA 2KT2A 4Y2AA 1TL5A 2P6SA 2JDJA 4WPAA 2E1AA 4RLEA 2E7VA 4CM2A 4B3SF 2A6OA 2XZWA 5FIIA 3OUYA 2YWEA 3LH2S 4CIOA 1H7WA 2ZH8A 5J1EB 4A8FA 2KZMA 2DK2A 1YRXA 3UWTA 2I0XA 5C42A 1S6UA 3D1QA 5CCMA 3LAMA 3LP0A 1LNQA 1LWEA 4M5NA 4OI1A 4R8UB 4ZJLA 3TEGA 3OFHA 3LA0A 4OHVA 1SL2A 4HTIA 4CP5A 2VC1A 3PKYA 2R9LA 1CPZA 3KLFB 2XTJP 4TKTA 4BCAA 3W2VA 5IV3A 4Y28C 4ZIVA 3J81Y 1GK8A 2ROGA 4ED5A 4DV4F 1Q16B 5IWAJ 3BR8A 3DRPA 3LOUA 4NI2B 4WU3A 2BABA 5E3AA 2ZM6J 2HHUA 3BS9A 5GMDA 4ZCKA 3SQGB 1TL7B 2HQIA 3DOMA 5DETA 2QC3A 5F0UA 1BQMA 3NCPA 2RU9A 4EU0A 2B56A 5CZXA 1M5HA 2OFHX 4LRCA 1X4HA 3TVYA 4YR2A 2HVIA 1N5QA 2FHJD 2J0XA 5IV4A 3DLEB 2PO4A 3FNNA 5A6PA 1TV6A 3G8TA 1NJWA 5EHHA 3MMCB 1WC0A 2K7KA 1I94F 1P6TA 4ZPAA 4FNIA 2IJRA 3GB0A 1H73A 3NG8A 4ID5A 1YQHA 3R3TA 1RKJA 4F3OA 4F02A 1RWMB 4OZLA 5HQLA 4A47A 5F9LA 3JSRA 2EC2A 3R8YA 2D3ZA 4F25A 2IBKA 4WJBA 4DX7A 2LU2A 5KFWA 1S72S 1SH3A 4DV0J 3BYRA 4U9RA 4IRKA 3KG4A 1FA0A 1F9FA 1FFWB 3NS5A 5L1JA 4KH1B 3GE9A 3CCLS 2ZWOA 5EWFA 1R3NA 1OS5A 1Z4UA 2ROPA 2CQHA 2AT1B 4L3KA 1UWAA 2MTLA 4MKBA 4NRTA 4CZCA 3KUHA 4FNHA 1RLCL 4Q5VA 2DB1A 3RBZA 2VFUA 3HHNB 4LBPA 2UUBF 2RU3A 2YKNB 3K89A 2N7CA 4B9VA 4JI8F 4ZK7M 3KHHA 4UY8T 1HFEL 2GW8A 1T05B 3P6YC 3TUPA 1JLQA 5C24A 2OHDA 2CVIA 2E1RA 3VAHA 3U1NA 4KSEB 3MZIA 3DLKB 3H2VE 4LF8J 3IP0A 1U09A 3KUGA 5ETQA 4K4WA 1LWFB 4LSZB 3BB5A 3DI6B 2C2KB 3M8WA 1BQXA 2QMXA 3E3XA 5E3PA 2VIHA 1QSYA 2WONA 4QYRA 1PGZA 3EVMA 5HMXA 3NMRA 1IKXB 4KT0C 1H98A 1X9SA 2M52A 1GFWB 5L46A 5J2QA 1RT7A 5F8IA 2XZDB 2DNOA 3MECB 5EDWA 1W26A 3BF4A 1C0TB 2ZZNA 4PRFA 2HQGA 2RF2A 1DARA 2O67A 1UEKA 2QX0A 3PRDA 2B9WA 4WYLA 2EFVA 1RAHB 2I5JB 2HHQA 1LK7A 3UE2A 2DEIA 3K17A 4CNZA 4USHA 3FSIA 1KQKA 5CAAA 2E5IA 4OZ5A 3G82A 7FDRA 1JLGB 1HW8A 2KI2A 1IKXA 4N47A 4A8WA 4TXSA 1JX4A 4JUZA 3ETMA 4NLPA 4XPEA 4C0OC 4K4UA 3EZUA 3MTJA 3QMQA 4KKOA 4Y3CA 4YHHF 3M8ZA 2LDIA 4DL6A 1VQLS 3S01A 1TL7A 4GMKA 2V0NA 4YY3J 3MM9B 2XMWA 2WVBA 2H4YB 1MN9A 1N34F 4F2RA 5I42B 5KFEA 5D6GA 1RSCA 4X4SA 2DIUA 1ZZFA 3T6JA 4DG1A 4DUYJ 4FF4A 4IR1A 1S6OA 3AH6A 3ET6A 4OX7A 1KQSR 2HBYB 1Y00A 1Q5YA 3LWLA 4U96A 3FEYB 3P8BB 4B3RF 1BWVA 3AJDA 4HACA 3FK4A 2HQCA 1RHKB 3LP1A 4M5HA 1JLCB 2UUTA 5K20B 2ERRA 1FD2A 6FDRA 2VFTA 2CXEA 2EPIA 3KJVA 2DEJA 3ISZA 4NA3A 3I5AA 2D9OA 1RTJB 3R1LA 1V3RA 5KFZA 3MHYA 3BGRB 2CAJA 2CNNB 1M5OC 1HBOB 5FD1A 1QSSA 3SI8A 5F8JA 4ECYA 2VH7A 3DRSB 3PR4A 5BR8F 2H5IB 3G71S 1NDLA 2JLFA 5L1IA 2YKMB 3PX0A 2V94A 1CLFA 1RAFB 2H48B 2JFKA 4ID8A 1VHIA 3T5JA 4TY8A 4ED6A 3THTA 4PQUB 2QMWA 2WAQD 4RNMA 1NKCA 3G8SA 2FIUA 2PDAA 4WTOB 2QO3A 3D9BA 2VD3A 2AKWB 1WJ9A 2V69A 4J9PA 2LFVA 4HVZA 3PY8A 4DX5A 1DRZA 3BSNA 4QIEA 3C2PA 1OJ4A 3K5PA 4LIWA 2ZD1A 2GJ2A 1XC9A 1XNRJ 4IOBA 4IH6A 1NKBA 3GSDA 4P2FA 3UVJB 2UVUA 2H5JB 3LTOA 2BANA 3W63A 3I0RA 2MQQA 4ECXA 1N0VC 5KG1A 3R2CJ 1YJWS 4QCLA 4DUZF 5I4MA 2VG7B 3MEGA 2M4MA 2RDJA 3T5HA 5DQGA 4NMXA 2NPIA 2HZCA 4YFUA 1S10A 1Z2ZA 3BDEA 1RAOA 1LV5A 3QSYB 4DV6F 2QT7A 3B4DA 3MAHA 5DG9A 1HYSB 2QFJA 1F3FA 2LEBA 3D6FB 4IG0A 4WXWA 1V5VA 4KFBB 3H42A 1WORA 3DLBA 4JV5F 2JHEA 5IM0A 4I2PB 4QBUA 3NNCA 1KD1T 3N28A 2WSFC 1RT3B 1WC5A 2LVWA 3DM2A 4YB7A 4S0MA 2FPHX 2ADCA 4LF7J 2BJ3A 5K14A 2CG8A 3QLHA 4I68A 4N7TA 1NSKL 4X84A 1FJEB 1VBYA 1RU2A 5KT4A 4D3GA 2I1RA 4X65F 4ATNA 4B9SA 4RUHA 2IVMA 3QGPA 2CPHA 3QO9B 3RYLA 1R7IA 5J2MB 2LECA 3CJ0A 1XK8A 4J9KA 2UUBJ 5H1SV 5AXKA 2V2QA 1SJ4P 4NLSA 3IR5B 5B0AA 4NCAA 2XS5A 4CDIA 2EXUA 3UFCX 2ZH7A 2CADA 2DNMA 2CQCA 1AA1B 3EICA 1U48A 3MPVA 2UUCF 1AFIA 2BBEA 1B0TA 1Q95G 1FTCA 3BREA 1HPZA 1JXEA 2POKA 5D8HB 5K9FA 1N56A 5KFTA 5K8OA 4IFYB 1SH0A 4KHPJ 2FGCA 2HVEA 4OI2A 3OL9A 1CULA 1S57A 2NS1B 1DY3A 1WOPA 2U2FA 4DV3J 3DMJB 1RADB 3KLIB 2AX1A 1X0FA 2PI4A 1RTIA 3CJSA 3CCMS 2VICA 3OV7A 5ETLA 4C8YA 2F63A 4OLPA 5CYQB 1G7CB 1HNZF 4ECSA 1SB6A 1EB0A 1Y11A 4Z7YA 1RTDB 4Y2MA 2XY7A 1I94J 2IM2A 3AAWB 3US5A 4ZPTR 1XMOF 1T8EA 1YBAA 4ZVRB 3UR0A 4P74A 1JLGA 2NXCA 3M8YA 1NXIA 2C3PA 4IO1A 4WIIA 5U47A 3SSSA 1REVA 3O2IA 3Q23A 5DDRC 2HURA 4ZVPB 5EWGA 1RHJB 2G2OA 3OR2B 1WNEA 2FZCB 2W2QP 1Q79A 2C42A 3KNAA 3HFZB 3OL7A 3I56S 5HVHA 1RWOB 2EWHA 3M1VB 3DGPB 1Q82T 2V34A 4X62J 2CQ2A 2N7YA 4E98A 5BXIA 2AJ2A 1MU2B 2UZAA 3W66A 3ZXWA 4DPYA 2JH3A 1SQGA 1K44A 3E01A 3M32B 3CUNA 3KLGB 4A48A 3K5LA 1T3OA 4DFJA 2BV3A 5DM6Q 3RG6A 2MY7A 1U7LA 3JTPA 1YJ7A 1JLCA 4PYDA 3KMSA 3FFIA 3TANA 3M1VA 4LIRA 1GXUA 1VOMA 2XM3A 2F9DA 4MKAA 3DLGB 4ZP9A 4PG5A 3CEDA 1CQNA 1T7PA 3QJJA 2DNLA 4I64A 3NNHA 1U8SA 3K5OA 4WIQA 2MQNA 1E6YA 1V3ZA 3MR2A 2KXNB 2CJXB 1HQUB 2YY3A 1FRKA 2VUGA 3M2UA 1V6HA 4O4RA 5FDLA 2FJBB 1DTQA 1S6QB 4QZVB 5CYMB 4H4OA 2D69A 3DOKA 2G9OA 4LJMA 1U1OA 1X31C 3MEDB 4ECZA 1GMUA 2JRSA 1F5BA 1NH8A 4TY8B 4JV1A 3D1HA 2ZUAA 4Q7AA 5LXYA 2EFQA 2KH9A 2OAUA 1UMJA 2ZHOA 1NU4A 3G6ES 2OP5A 4LF5F 1Q0NA 1VIXA 1X4FA 2AJFE 4DWIA 2ZFHA 4A4JA 3QGIA 5A0YA 4FS2A 1K9MT 1O8BA 1G6BA 2I38A 1VK3A 2DR7A 4K0KJ 4QPTA 2QA4S 1HI1A 1WHYA 2GIRA 4M5MA 1VFJA 4JI7F 4K7QA 1M1HA 4MYTA 1U6ZA 4JV2A 3SYZA 3FDSA 4LSNB 3QATA 3C8YA 4NEYA 4PXEA 3TJ8A 3GIRA 4ZVEA 3AA9A 3I0RB 4D3HA 3POTB 2J9CA 3C16B 2E5JA 4F0HA 2EK6A 2FVPA 4DCOB 4Q43A 2EG1A 3H0PA 2XBPA 3TUJC 2B4VA 4ZPCA 4N41A 5HL7Q 1GQEA 1TZ0A 1S0MA 3CD5A 1UVKA 3L4BC 3KDNA 2DJWA 2G0JA 4OL8A 4LVOP 2IMWP 2VG5B 1A0OB 3ZFVA 4PXCA 5HBMB 1CJUB 1PG5B 2RKIA 3UCGA 2J6UA 4B9TA 2J5AA 2W8KA 1SC6A 4MJKA 4GKJJ 4Y00A 3MUVP 4B17A 3UDCA 2E1PA 2F65A 3M2RA 4J9QA 1TK5A 5E5NA 1X4AA 5GVQA 2ZH6A 3IR7B 1SV5A 2VA2A 2UP1A 2AJQA 3JAMU 3KWMA 1DBDA 3CGIA 2OPRB 3DN9A 4HDGA 4WCEQ 3QAEA 1KLMB 2DXEA 1R8BA 2E44A 2DBBA 4DJBA 2NXUA 2YXLA 3X3UA 3SQOP 3CB4A 4TN2A 5KFUA 1RISA 4FVCA 3D0IE 3ISNC 1BD6A 4DS4A 4GRSA 2PE8A 2G0CA 3WX4A 1F5CA 3ZTSA 1S97A 3T3FA 3OPKA 3MR5A 1NDKA 2CJQA 3C19A 4B3OA 4LBIA 3BPDA 5ETMA 4O0IA 4OFZA 4ZIWA 2HWHA 3LO3A 5KFMA 3OT9A 3CCRS 1HWIA 1Y7PA 3D0GE 2BW2A 2XCAA 1S9FA 3E2EA 4JI0J 2R7VA 3Q86A 2Y8WA 3FBBA 5F3ZA 4AL7A 3VQTA 2YNGA 4FYDA 2J6TA 4Y65A 2MQLA 2U1AA 1WI6A 3IG1B 3U27A 1SIZA 3J80U 1WG5A 2H9ZA 4I56A 2VPXB 3VZIA 1FKOA 2CDRB 3GFXA 5CYQA 2J76E 1RWKB 4EYIB 2RQMA 3BGLA 2ZEJA 1XQIA 2KRBA 4HL9A 2IRYA 1RACB 3FVYA 1YDLA 4RW8A 1T94A 4WTYA 3VV2B 2WW4A 4F4AA 3OJSA 2HHHF 4HHUA 3PW5A 2R7WA 4MK8A 2XYPB 1NK0A 2MHEA 2BYCA 3W3SA 2W2NP 4UW2A 3ICLA 1YJRA 3TQEA 2AIRB 2DH8A 2XCPA 4TLRA 5AJ3F 4C11B 1ELOA 1T9UA 2CRLA 4NLDA 2Y0BB 3KK3A 3LP2A 1FHTA 3RBDA 1S5ZA 5F0WA 3RW7A 5HATA 3ZZTA 2IIHA 1VQ9S 4HH1A 1FCAA 2ZNYA 2YKOA 2MLZA 2Q6CA 4YR3A 4FF2A 4KJIA 4O23A 2CUYA 1GX6A 1YKWA 4UUWA 3QNWB 3UQSA 4DV6J 4YB5A 4X4TA 1WTBA 1CSJA 1HMVB 2CQGA 2V2VA 3OR1B 5HROA 4C11A 1XEZA 3MECA 1WTFA 1S0OA 4JI6J 1S9GA 1N52B 2JC0A 2LXFA 3RAXA 2R7XA 2WBRA 1DQAA 3D28A 4LRFA 5LMUF 1FJGJ 1F60B 1F2HA 3WC2A 4RBTA 4ZVGA 4RR5A 3ENVA 4LBHA 5GMEA 3GQCA 1PYSB 3J7A1 2JVRA 2MZTA 5J2PA 2GAGC 5K8MA 4YQWA 2MQMA 5CHCB 1UFKA 2V63A 3E01B 3OTEA 4WBFA 1PO6A 2QFIA 3DHXA 3PXGa 1QVFR 4C3LA 3K8VA 1ZAWA 1EETA 2AYBA 4UQGA 2FVCA 3HJVA 1LQ9A 3DOKB 2RRAA 4NYPA 1U0HB 2HRUA 1X5PA 2H5EA 3N0VA 3NBPB 3PRBA 2VV5A 4CTAA 1TU0B 2D1CA 3D6TB 4ZVFA 4KGZB 5JXSA 1H2VZ 3O8WA 3AY0A 2HNDA 3DDNA 4PZVA 5KG4A 4CO4A 4R25A 5DG8A 2ALYB 5J1EA 1CBKA 2F1FA 3K7RA 1KKHA 2GO9A 2KO1A 2LXIA 3RB3A 1FDBA 3MAAB 4AQYF 1C0UA 3NAHA 5DG7A 2G2YA 2W4CA 1JXVA 5FDLB 1NSQA 2UUAF 1AW0A 3IRWP 3PKMA 3AJ1A 2R2SA 1TKTA 1TR0A 2NUUG 3H98A 3PCOB 1C2PA 1RWWB 1ZAVA 2MKYA 3UN2A 2R8GA 1RT1A 3LPYA 2VC0A 5D0EA 4KRWA 2YKPA 5J2NA 5IT9Y 1UVLA 3K57A 2XMTA 4ZP6A 3CJ4A 3WBZA 1D8YA 4ZLPA 2VOPA 2QL9B 2E9ZA 3UW1A 2AZ1A 3IG1A 1HI8A 2V6AA 3LF0A 2GZOA 2EG2A 2VU5A 1IR2A 3UDLA 2XGPA 3T1YF 2Y9HA 2J6SA 5GAHU 2R7UA 3FC9A 2BM1A 3K59A 3Q2TC 1REGX 3LQVA 4UZBA 2Q3PA 1B70B 1DHMA 3Q8QB 3T1AA 1FKPA 1WEYA 3C46A 1NDPA 2ZBIA 2L9WA 2EKNA 4MK7A 4X4RA 5DM7Q 1Q4RA 2UV8G 3D67A 2WRMA 3UCZP 2JEGA 1URNA 1OSCA 1V5IB 2BE2A 2LQBA 4OMFG 2JEJA 3HVRA 3IWNC 4OX9F 4RW6B 3U7JA 1JKHA 1NNDA 3QSIA 2R42A 4DI6A 4B3TF 3BBBA 3LP2B 5DLGA 2EBEA 3I5BA 4PABA 4TU9A 1J5EF 1LXJA 3SFGA 1RA6A 4L73A 1U26A 5F8GA 2MPUA 1VIOA 4L3NA 2B51A 4CLUA 3FZ2A 2ZZTA 4GKKF 1ZM2A 5T7LB 2QYGA 1WI8A 4HI2A 3EVOA 5A8KB 3A8JA 3GTYX 2RHSB 3BQ1A 1JXLA 3R97A 4K4VA 3RZAA 3C6TA 4RNNA 4AL5A 3CD7A 5D4LA 4DFPA 3ADAC 1JB0C 3PHTA 3VGVA 1GH8A 1JNZB 5KFDA 2KYXA 3U1MA 5EUHA 1RT6B 1YJTA 2R4FA 3MMBB 4RJVA 3RBXA 3T5KA 1M5KC 4X4VA 2W4PA 3CO9A 3RB0A 2F9JA 4GO7X 1HNXF 1B64A 2P9GA 3BSAA 3I9V9 3BZQA 3V4IB 4DHVA 1UVIA 3CIZA 1WF1A 4LRBA 4ETXA 2UU9F 5EGYA 1U25A 2CQ3A 4NA1A 3NWGA 3MM8A 3PHEA 4V1Ak 1EJ7L 2UXDJ 1WACA 3PACA 1I5OB 2L41A 1MN7A 1RT6A 4UY85 4K2XA 3TAMB 4URSA 1GEHA 2D3O1 3FJ2A 3MTKA 5D77A 3IBWA 3TEHB 1KOOA 4Q8EA 2V8DA 1VQMS 3AB4B 4K4XA 1AB8A 2HKEA 3P5BP 4NWBA 4UOCA 1LK5A 3X1LB 4EEYA 6AT1B 4RW8B 3JQJA 4ED3A 2OTJS 3IBCB 1NUEA 4M5JA 1FJCA 4XO0A 1FRHA 2IDEA 3TAMA 2BJ9A 3TJ9A 1OY9A 3L95X 2YH0A 3MPUB 4P73A 3VWSA 2UU9J 3ONQA 1CC8A 4ELVA 1IKWB 2WB4A 5L9XA 2LXUA 5HVGA 4DR7J 3HHLC 4K50A 4EO8A 2PI5A 2OJ3A 4J9SA 5F8NA 3KLEB 2CQ0A 5I42A 2FJWA 3FBEA 1SCJB 1MWZA 2V68A 3W5ZA 1R0AB 4IFVA 1RTZA 4HT7A 4OIXA 2C2MB 1XN9A 4I6AA 3J7Z5 1U1NA 1NZAA 5IWAF 1YGYA 5LJ5Y 2AEMA 3EMTA 2J7UA 5KFHA 2KG1A 1LOUA 4ILMA 4ER8A 3MUTP 4DL4A 1FT8A 2VFRA 2A2DA 1BLUA 4G1PA 4IQMA 4N5SA 5EX3A 3BKTA 4XIUA 3PR5B 1VQ4S 1NK4A 1VQ6S 2NQPA 2DGTA 1AT1B 3EPIA 2HSEB 2ASDA 2BZ2A 2V8GA 5HLFA 1O0PA 5IOLA 2YX7A 1HD0A 3OXLA 1WC6A 4HHJA 3GV5B 2DPJA 1XR5A 3R5BA 1HWKA 2DGSA 2C2RA 3BQ2A 1S1VA 2QN6B 1VK8A 4QW8A 4JI8J 3KOAA 2EK1A 1VHFA 2P2CB 4DL5A 1IKYB 3GSIA 4L72B 3BGFA 3J7ZT 5D0GA 2MQPA 1EP4A 3H59A 4JBCA 4WFXA 5GAEU 3TX8A 4ICLB 4FXWA 3G86A 3KJQB 2IRUA 3GYXB 3Q0AA 2EW9A 4B3SJ 2Y8YA 3JXOA 1F5AA 2N4DA 3PM9A 1XTZA 1DTTA 1MLAA 1HQUA 3OHAA 5L38A 4CLZA 2VOOA 2COLA 1IKYA 4DR2F 4BS2A 4XDDA 1KQFB 3ENWA 3HHLB 4FF1A 3PEHA 4M8LA 3J7YU 2YNHB 4DG1B 4EZ6A 1WEZA 4WWSA 3M9NB 1ZETA 2RE1A 3EYZA 1VLOA 4U6PA 1F3VA 1LKZA 4TU8A 2FHMA 3HVWA 2FGOA 2W7AA 2DVIA 2DHHA 1WOOA 3PNIA 1NBEB 3RAQA 2B6AA 4ZDNA 3BO2A 1QSLA 1T9WA 3BJYA 1X4DA 1SL0A 3KJVB 1HA1A 5I3UA 4M1KA 1MNEA 4LRAA 2GHPA 1YWXA 3M7VA 4BLGA 1FEHA 3TARA 2CJYB 5IS2A 2FVQA 1VISA 4MAKA 3B6BA 1RJJA 2MZ1A 3CDUA 1PKUA 3D4JA 3WZ0A 4YMEA 1MMNA 2QYCA 3QLHB 3BO4A 1T03A 3A8EA 3W9JA 1EIYB 1K1QA 2WZ1A 3HZGA 3GCXP 4J9RA 2E66A 1P1TA 3AXMA 4PUOB 2IY5B 1RAEB 3DRRB 1N54B 2ZHAA 2J9DA 1EKRA 1UVMA 1Q8IA 2WVDA 1HWJA 4FXVA 3HVAA 4YDDB 1VGYA 2ZE2A 3Q8RB 1EARA 2CZVC 1OYDA 1FJGF 2K2PA 1S6PB 2JOQA 4ANDA 1RYSA 1UPPA 2HK3A 3GIMA 3HI9A 2HQ3A 2PEHA 3QPIA 4G1IA 4F8RA 5KG2A 4MH8A 4NPOA 5HK4A 5DZ7A 1Q7LB 1JNRB 4DR7F 5GAEI 9RUBA 2FVRA 1FVSA 3LGNA 4N8NA 1OQ3A 1T9XA 3NWRA 4DR4J 2UVRA 2VPZB 2V9KA 4OYOA 3CJKA 2G2ZA 1TKDA 2YWGA 1YLXA 4ZPBA 3HP6A 2DNRA 1RT4B 4CO3A 1O5JA 2MZSA 3PO4A 4DR5J 4CH7A 1MW7A 1N5YB 2DXDA 5HMWA 4J7CA 4LSNA 1UKUA 2CYYA 3CJ8A 3MDFA 5DGBA 3AOBA 1TVRB 4IDKA 1N88A 5KFGA 2YPYA 3MM8B 1KHWA 4USTA 5DO2A 3TUIC 4M5LA 1S1VB 1GNKA 3N5BA 2AEFA 3PIPQ 1MROB 2GVZA 3TRGA 4Y2IA 1XERA 2V5HG 5HSPA 1JLQB 1G4CA 4C8NA 1HNXJ 2HYIB 2GC8A 3C14B 3PJ9A 4O44A 2LKZA 3I31A 1PCAA 5A8RB 4YUDA 4Q45A 3W61A 4ZPDA 3KHLA 2AJ1A 4JV0A 5GAGU 3I9ZA 2A18A 5KG3A 5K5MA 5T14A 2FD2A 2OPQB 3I5CA 4ZP8A 4DPXA 3HHEA 2GGPA 3V81B 1DZ5A 3GWCA 1NJYA 1UPMB 2A1BA 1GX5A 3P5TL 4UUXA 4FDFA 1RGVA 3MD1A 3I87A 4PWWA 4UOGA 1LWCB 4DN0A 5F9NA 4U95A 3H5XA 4WP3A 2MZRA 2E7WA 3M6XA 5LMUJ 3W5XA 4CT8A 4C8OA 4J91A 1QJHA 1OQ6A 2AX0A 3NGDA 2UXCF 1Q8KA 2HHWA 1IVZA 2OPQA 3V81A 4ECVA 4NLUA 2FJAB 2FY8A 5CCLA 2XC9A 1KONA 2GQCA 2KYZA 4RW7A 1IBMJ 3E51A 1HWUA 5KT5A 4QW9A 4F26A 2OSRA 2YVSA 1VQYA 1DAXA 4WFAQ 4LQ3A 2IC3A 3VZHA 1PC4A 2V8VA 3W8GA 1JJ4A 1YRUA 2CJAA 4NXMJ 1XNQF 4IOAQ 3TVZA 4RW9A 4O0NA 2P9CA 4PPZA 3VVUA 3MAQA 4QWAA 2MB0B 4ED2A 2XWXA 2XWYA 4DR3J 4C4WA 3AD9C 2OLWA 3N9UC 1WG4A 2KJVA 2VBZA 3KLHB 4DV1F 3F41A 2CJKA 5AE1A 1BMQB 4PUOA 1RB0A 5AJ3J 1M5PC 1U1PA 4MIBA 3PW7A 4OZ0A 4ALZA 4EZ9A 3BGRA 1CEZA 3H20A 5HMZA 1FXLA 2GQ2A 2YWFA 3Q89A 4I0WA 4LSLA 2HHPA 2M70A 2O01C 2HRYA 2L9NA 3H5SA 3HFVA 4Y6IA 3RAMA 4ZITA 2VHGA 3H5UA 4DQQA 5KTQA 1R8HA 1N36J 4BDPA 1N0UA 2KXFA 1F6TA 2Z2MA 3DC2A 1CC7A 4P7TA 5KT3A 4ERDA 4PG8A 3W2VB 2PIIA 3W9HA 2LQJA 2DH9A 1AXQA 1LFWA 1HI0P 3FKBA 2JEIA 1UEVA 3KG0A 1FRMA 2DISA 3I96A 4USVA 1BWEA 2QL5B 1BHNA 2Y0SD 5H9FJ 3FFIB 1IJEB 2FJEB 2BUNA 3ELHA 1S9EB 1QAYA 1TL1A 2ZDPA 3AT1B 4F3QA 2DNYA 3O5TB 1RHRB 2AV5A 3K5NA 4A8KA 4ZLJA 5KFIA 1T9TA 2BVZA 3DFEA 2AJ0A 4H4KC 4DZ6A 3M9OB 1TMJA 4V19J 3JAMY 1VCTA 4KIAA 4KKOB 1RDRA 1YBTA 4CT9A 4DMZA 1Q86T 2OPSA 3D6HB 1MROA 2GVZB 3RRHA 2HLTA 1C1CB 2QZ8A 1HYSA 1Q8LA 5ADZA 1FEEA 3NXZA 4F3MA 1YX2A 2ATLA 3TR5A 2HVDA 1U47A 5C2GA 2UXBF 1HR0J 2BE9B 3DDIA 1JJHA 3DRXA 5KFAA 3BGUA 2KFNA 1FI4A 1FKPB 2DGWA 3BBCA 4DUZJ 2BXJA 3OFFA 2RQCA 4XK8C 4FPIA 4X4QA 2R7RA 1NLKL 1WF0A 1VMBA 1KLNA 3PX4A 4KE5A 5LXRA 1JQGA 2LA4A 3KXDA 3FGVA 3SZ2A 4O4GB 1C1BA 2HPUA 2IM3A 2NXEA 4OI4A 2RSQA 4QJVA 4CNYA 2R8KA 2UUWA 3FZBA 4FYYB 4YEAA 4PAAA 4DX6A 1NZ8A 4K4TA 2ALZA 1SUQA 2MZQA 2N3LA 2OGUA 4LQ9A 1JWWA 1RAJA 3AB2B 3MMAA 4KC5A 3Q22A 4GKJF 1HBOA 3J7YI 3CMAS 1LWXA 3H40A 3IR6B 4F4XA 2EKYA 3VAGA 5E3CA 2JX2A 4RW7B 2XLKA 4LRDA 2PN6A 2DNGA 1ZM9A 2ZBPA 4LF6F 1FERA 2IRXA 5EX0A 3QZ7A 3R9LA 3RW6A 3L7PA 4K5SA 4Z37A 3FRYA 3MCSA 3PV8A 1ACMB 1KN6A 2DT9A 2QLWA 3LAKA 3NCQA 1N5SA 4LF4F 4L6V3 4RNOA 4ES2A 2X1BA 3P4UB 5KFLA 3EXCX 2DRBA 1HBUA 4DR2J 3HF5A 2X51A 1FK9A 3OFGA 4WU2A 2MKCA 2PD1A 4RUCA 3A12A 4KHMA 3KK3B 2BOPA 2F8EX 2YWWA 1HIYA 1JMTA 3ENQA 1UFLA 4RWWA 2HAFA 2W9BA 4DR1F 1KFSA 3F73A 3PO5A 2IA6A 4P10A 4GVBB 4J9UE 2CIMA 1S0NA 3DLJA 1PC5A 3GJRB 1QLNA 2IPOB 1U1MA 4C97A 2FVSA 3NNAA 3UD4P 2GGPB 3GR0A 2E29A 5F3TA 1T05A 2XZTB 2DNQA 1P27B 3LW5C 3FCHA 3SBMA 4IG0B 3SFUA 2RNEA 4ENOA 1HHSA 4L76A 2J9DE 2J7WA 3DLEA 2W9CA 3OTCA 2Q66A 1LEOA 5FLXY 4ZHRA 2HQDA 3MMCA 2W9BB 1VLYA 2AMCB 1P8GA 2MKJA 5B08A 4N77A 1KOHA 3T1HJ 2HAIA 5HANA 1YJUA 2VBYA 1J2VA 1M90T 3DXSX 4WFYA 4KV8A 4ZVQB 1AFJA 2LQ9A 4NCGB 3VGUA 4H54A 1QDUB 2C28A 4B9MA 5DJBA 1RT7B 1ZOTA 1Y10A 4YR0A 2ASJA 2PFDA 1M1KT 4JI6F 3KTQA 2GHVC 1FX2A 4QR1A 3IGNA 3EGWB 2B43A 3UNGC 3MR6A 2BQ3A 2MKIA 4HI1A 1FXDA 4X4PA 1U49A 5MAOA 1RLDA 3S1TA 3VCDA 4X4UA 3GMGA 3R6LB 1HHTP 5LSLA 1W25A 3M9MB 3CDBA 3GJSB 2C3MA 3S7RA 3NGKA 2W25A 4HT5A 3OW2R 3NY0A 2IC3B 1G2EA 5IT4A 4NE9C 1FDAA 1VQ8S 1B7YB 1SIWB 2IA0A 2DNZA 2XGQA 1TUGB 3ULHA 2E9RX 2Z4PA 4DPUA 4JB8B 1FVQA 3QFWA 4JI7J 2CKWA 4ZCMA 1F2GA 2WVCA 3BSCA 4C48A 1JIHA 3M8PA 4ZN1A 2BMBA 2ZJRQ 3NAIA 1WD6A 3HLUA 3IS9A 1VRTB 1S1TB 2MMYA 3OTDA 2A6MA 2IYGA 2MXYA 4C2MA 1U1QA 3VHQA 2FJVA 4JI1J 2YPZA 5D3GB 4KHPF 3CCSS 4V19X 4FYWB 4A8SA 3LP1B 3VGTA 2RUGA 4DPTA 3JB9k 3HCXA 4DF8A 3R5CA 4PG4A 3O44A 4ES1A 1WC4A 3CW2C 2VBXA 3HFKA 2Z56B 1QE1B 2XULA 1SJFA 1IKWA 4YOEA 2J7KA 4LF5J 2NZCA 1GMVA 2HFUA 3L7OA 2Z2LA 1S7HA 2CPDA 1NJXA 2XYHB 2BKNA 1FNOA 2B8PA 4LR7A 1X60A 1WEXA 2XS7A 4C98A 3VGSA 2KRRA 4ZKAA 1K1SA 3P45B 5T41A 5ETVA 3R5AA 4X65J 2V2KA 3CDAA 4F67A 1CS4B 1VQOS 3UI3A 1QE1A 1FWKA 4OV1A 1R6VA 3OVAA 3O1LA 4CQ1A 5GADI 4E0DA 3MAAA 4LF2A 1U24A 3N6MA 3M2RB 2VJVA 3O3LA 4OHYA 2W7OA 3EWGA 2ZBCA 3SV4A 4CCHA 2VQEJ 1DQ8A 3H25A 1HBMB 4EK2A 1KVJA 4IG3A 3R7BB 5C5JA 3Q83A 2B4PA 2B5JA 1YRTA 4USUA 2K3KA 4ILLA 3P3DA 3GR1A 4OZ2A 2GNKA 1GMWA 4WXOA 4FPRA 4MTPA 1HARA 3RGIA 3VAIA 4F0MA 3DGVA 4DV1J 4OX9J 1U6FA 4DUTA 3T1YJ 1XBWA 4DV7F 5E0OA 4I2QA 1KLMA 2V4JA 4KH0B 4CLFA 1HR0F 4NXMF 1IQTA 5BYQA 1SL1A 1SUQB 2DGXA 2HGMA 2APOA 4ED8A 5IT9U 2V8HA 3NOGA 1B4SA 4JOUA 5A0YB 1IBKJ 4LFAJ 4WKYA 2KTQA 1KHVA 4DSJA 1IM4A 4I6YA 1IR1A 3TO8A 2ILZA 3VQSA 1XNRF 2ZNZA 2CQIA 4ED7A 1ULRA 3I4HX 4WP8A 3CPWR 4KBIA 3CCQS 2NSBA 2DTJA 2KT3A 4NYZA 1H74A 5KFFA 3IM9A 5DDPC 4JI3J 3CJTA 3PYFA 4HH0A 2DGUA 5KG7A 1A9NB 2FZKB 4A8QA 5KG5A 2ZDOA 4HLBA 1TL3B 1D09B 5G4DA 3HM9A 3BH7B 2Y1RI 1EHWA 4UT4A 5I3UB 2HFOA 2AF6A 1PIEA 1G1XA 2AW0A 4NOHA 2HNZB 4K4SA 4C0HA 2HS3A 5KT6A 3PW4A 2VODA 7AT1B 4OYBA 4NA2A 5KFKA 2HHHJ 4R5PA 3I4PA 4OJGA 5LT5A 4DLEA 5D3GA 4IFYA 2B9XA 3TNVA 2QEXS 1RCOB 3G9CA 2YNIB 1HL6A 1RP5A 3G87A 1YJVA 2R2TA 1RWVB 3M30A 4Y34A 3EGNA 2BJ8A 3KLIA 5L1KA 3RTVA 3D0HE 4DCJB 1OY6A 3U02A 3BKUA 5IM0B 2R2RA 1N5TA 1JLFB 3A3NB 2WSEC 4RBUA 2VB6A 3CF5Q 4JYAJ 2FLPA 1S76D 4NASA 1RT5A 5HP1A 2CFXA 3MGJA 4O3NA 4GKKJ 2BQRA 4FXDA 3KMQA 3DLGA 1S7IA 3MCNA 1HMVA 2MKKA 2OMOA 1PJ7A 5KFYA 2J9EA 3PX6A 1KNZA 1PAEX 3TUZC 3AODA 3N01A 2BOAA 3M8QA 2CWXA 4O3RA 4JV5J 2YWKA 4NXNF 3PW0A 3OLAA 4DSEA 2ZVSA 3ZZUA 1K0TA 2B9EA 3NKYA 4FN5A 1SI9A 3SDEB 2R8IA 2A2CA 2FLOA 4DFMA 4OJ1A 1WOSA 2A3JA 1URRA 3H7HB 3NL0A 4LFBJ 3M8PB 2LCWA 4P71A 2GFFA 3B78A 4WFNQ 1NPKA 1QM9A 3PYGA 3UDEA 2VFSA 3ZZOA 4QWEA 4IOCQ 4JYAF 2D7SA 5KFCA 2VA3A 1EQMA 2YQ0A 3CT9A 4BWJA 3R6GB 1VC6A 2M5YA 4RU2A 5HVFA 2EEYA 3WIUA 1GMWD 1HNVB 1FRJA 1VDHA 4CLTA 2W7PA 2YKMA 3CCES 2CQ1A 4OZJA 1F0XA 1MWQA 2AHOB 5KFSA 1VJWA 1U1LA 1PILA 2YNHA 1M0SA 1RHUB 1UJ6A 2NYHA 3EM1A 3C14A 3NGRA 3QT7A 2N3OA 5DLFA 3MPWA 1RAIB 2UUCJ 2HQFA 1SQFA 2HFVA 5B0FA 2HK2A 4ZVSB 1XR7A 1B3TA 1L3TA 1YIJS 2MSSA 2X1GA 4CLKA 5BYSA 1ZZNA 1TKXA 2YKQA 5H9FK 5KFXA 3BKFA 4H4OB 4WZQA 3CMQA 4B9UA 2ZVIA 4MK9A 5AXNA 1XMQJ 1VBXA 3IA0A 1V9OA 4C3MA 5HLFB 3FEXB 4LF9F 2DIVA 3BV8A 3D66A 2H65B 8AT1B 5GAHI 3KHGA 2CNLB 3Q24A 1PBAA 3G8QA 5KFJA 4J9LA 3MURP 2YBVA 5C25A 1SV5B 4DV5F 1FF2A 3AQPA 4H4KA 1V3SA 4C0BA 2OI2A 2RH3A 5L39A 2ADBA 1U1KA 4U7UK 4XDCA 1DQ9A 3A3PB 1UL3A 4QU6A 5HAOA 1R6YA 2P5VA 1E6VB 1SC3B 1UAWA 2CPEA 4TYBA 4QYZJ 1ZYQA 4ECQA 1S6PA 3OJUA 2XMMA 1U02A 2Y1LB 1DLOB 2ZWPA 3AD7C 3MPYA 3JYTB 3EGZA 1BE4A 1Q1KA 4O3QA 5KFBA 3AFGA 5KFVA 1U0HA 2D3OR 2KVIA 5LMNJ 4FVMA 3GIIA 1H0HB 1GXLA 1TELA 2AWZA 2CPIA 2GQQA 4DV7J 3BPSP 2D41A 2WVEA 3FSXA 5ETPA 5DQIA 5A8WA 1TTHB 1OY8A 1FNMA 4YHHJ 4PKDB 3LGMA 4URGA 4B3MJ 1BGXT 2D3UA 5D4NA 1VBKA 1SH2A 4I4BA 2YX1A 4MFBB 1KFDA 4P7VA 2G0IA 2XEXA 5T7LA 4C7QA 3VAFA 5CXTA 4W90B 1BY9A 2AYEA 4YB6A 4ZCLA 3DKDA 4A8OA 3HZEA 1LW2A 2VDIA 2OPRA 3KUEA 3MR7A 1RE1B 2C3YA 3QIPA 2ASLA 4I2QB 3V6DA 3CULA 4RX6A 3PVXA 1YVFA 2W4DA 2XQCA 4IKAA 2WCXA 4NZ0A 3SIPB 4F4YA 4Q2LA 3G6YA 1U8WA 2W2OP 5BR8J 2C2DA 2C2NA 3B54A 5IT0A 1EQ0A 2G13A 4DBQA 3GIKA 4BC7A 4H4MA 1RK8A 1C4AA 3HHLD 1TAUA 3DXBA 1NEEA 3NGSA 1YI2S 2B8QA 2QA1A 5E2QA 2XY5A 1I3OB 3JSMB 1HNIB 3POTA 4EBCA 4DS5A 4IUFA 3HK2A 4DQPA 1VRQC 1IKVB 2OIHA 2MY8A 3H8YA 3H2UB 3T1HF 3IWLA 1RXOB 1TMMA 1CJKA 5D0HA 5KG0A 3U1LA 2B3TB 1WHVA 1REVB 2IVYA 5LL6d 2B4OA 2DR8A 4NLRA 4C8ZA 3IFEA 2OTLS 4DX8H 4H4MB 4TLQA 3W8PA 4C3KA 2KM8B 2R8JA 1U45A 3K58A 3W9IA 3GV7B 4OYMA 4DV0F 5AE3A 2DHGA 4Q8FA 4M5GA 1QAXA 2BM0A 2VDHA 3W1YC 3QJLA 3EVWA 4ZLLA 3ZO7A 3DGPA 5KG6A 3M05A 1Y9OA 2UV8A 3UO0A 2HLUA 3C6UA 2JVOA 1RA7A 4RKUC 1OO0B 2CQDA 3TZZA 1NK5A 2VKRA 4O4GA 4UF4A 3IN5A 2F4VJ 3ZTPA 2DRAA 4WP9A 2B7BB 5DGAA 3GV8B 1JLBA 3UN3A 1ZM3A 4HHHA 3LWMA 4W92B 1WDTA 2BJ7A 4QIGA 3FSYA 3LUYA 2BEFA 5H9EK 2NZ4A 3GLJA 3QRQA 3J7AN 2HNYB 3M6WA 1WKJA 1O51A 3DNCA 4KGXB 5A2QY 1D3WA 1RABB 2GA7A 4NZ6A 3N5FA 3HX9A 4QOTA 5HMYA 4X62F 4PXBA 1VYAA 2DPIA 1NSAA 2RIJA 3OL8A 1KRPA 2MYFA 2AGPA 2FUG9 2FHKA 1E6VA 5M2UA 4KPYA 4P52A 3H4DA 3M8QB 2DR9A 4WE1A 3AXKA 3JSBA 1S99A 3MM9A 1DLOA 1HNVA 1RAAB 3ILLA 2WVFA 1LW0A 4K5RA 4TNOA 3TAQA 2GS8A 2CQ4A 2BX6A 2DRDA 1MMDA 2XMUA 4NYOA 2CNOB 5CH7B 4BHQA 4CH0S 3HXMA 3A8KA 2RHQB 4IH7A 1QAIA 3W60A 1RT1B 2MLYA 2VZ9A 2UXBJ 4KQZA 1J5EJ 1FRIA 3OR2A 1FFGB 1HLWA 1RQ0A 2OKQA 3IBFB 4WE1B 3HULA 2MQOA 3CC7S 2F7VA 4DU7A 1GTEA 4MFBA 3V4MA 3GIJA 4FBUA 3CCTA 2KN4A 4O3PA 1K8AT 2DCUB 4L74A 1JLAA 2E5HA 1Y3KA 3AOCA 3NGTA 4J9NA 2RS2A 1UFWA 2AP6A 4OZ1A 1T02A 8ATCB 1JJ2R 2HIYA 3KNGA 2O3DA 2G1HA 1DTTB 4F36A 4ECTA 2Z2ZA 3M6VA 1HHQA 4NRUA 2R8HA 3GJTB 5L9NA 2NREA 1TKXB 2R7OA 4HDHA 4DV3F 1Q78A 2PMZD 3EZ5A 2NLWA 5AXLA 1TFYA 2DGQA 1QAJA 4PG7A 4DN9A 3JSMA 1Z1ZA 5DDOC 3P96A 2NXJA 4NLTA 1F9HA 2IHR1 3ILIA 2IVFB 4Q0BB 3EUNA 3NEKA 4AUKA 3G6XA 4M5IA 2KFYA 1NPPA 3MEEA 3B4MA 1IJFB 2A0FB 1HKAA 5LSOA 3HT0A 2HMIB 1FTRA 1ICEB 2B9YA 3PFOA 4BBYA 4N56A 2QSWA 3MMAB 4OJ3A 2MEWA 1SQEA 4PEOA 1L3VA 2R3VA 1M5SA 2DYAA 3FUYA 3I82A 5DRKA 5CYJA 5MLCV 2X3GA 4HEA9 1ROFA 5KT2A 3PJXA 4M5KA 1OPIA 2RD5C 3RB4A 4B9NA 1YG0A 1FO1A 4LR9A 4RW6A 3QRRA 3HDSA 3NOCA 4YP3A 4FBTA 4USKA 1JLBB 1H6KX 2QMUB 3MOZA 1UA1A 1RYRA 3C66A 3D5MA 4HKQA 2QJ3A 3TWZA 2V4RA 1VQKS 3BN4A 2XSJA 1IBKF 4ED4A 1Z2LA 2OPSB 3DM2B 5EWEA 2QRRA 1N33J 3EE3A 2DHXA 4X66F 5K14B 3I32A 3DRSA 1FESA 5IQQA 1B7FA 3D2WA 1MMLA 3C15B 5ETNA 1S12A 4G65A 3RU0A 1RUSA 3IO1A 4CM0A 3IXQA 3MR3A 1HNZJ 4U67Q 1IM6A 2KFZA 3G2XA 5KFQA 3D68A 5M2RA 2HW3A 3A13A 3KDOA 2HFSA 1W2BR 1PBUA 2H3EB 2LEAA 3OSNA 2MJUA 2PA8D 1HBNB 3SEOA 1ZPWX 4RUAA 4MIWA 1RAGB 3Q8YA 4DV5J 2IJNA 2M88A 4LVNP 3GILA 3M2VA 1Q5VA 4ZP7A 5A2QU 1N5YA 4CYUB 2GVDB 2KT5A 4LF9J 4K8RA 5ETSA 3VTIA 3HVTA 4MYUA 4QYZK 4PG6A 1T95A 5CQGA 1Y5IB 4QWDA 4Z7CA 4JI5F 1VJQA 1ZH5A 1U2RA 3IRXA 3JS9A 3CE8A 4BWMA 1HBMA 3N4WA 2X7IA 2WW8A 4RNFA 4DF4A 2EFNA 3F56A 2I9SA 2QE5A 2L48A 2K3IA 1QTNB 3KK1B 3MM7A 3TYTA 1TFWA 2ZE2B 4PXDA 2OD4A 1P9YA 4IH5A 5SUHA 3SXLA 4XTTA 2ZJQQ 1FX4A 3K2YA 1QTMA 3UR3C 4JI5J 2VL1A 5C24B 4FYVB 4Q44A 1BQNB 2I6WA 2EFPA 4HTJA 2Z58B 1AZSA 1HQEA 2OEMA 2V4JB 3CJ2A 3QBCA 3VVTA 3WHIA 2HVHA 2DKOB 4GVBA 4NLOA 3RJMB 4NLQA 2Z8QA 1KR4A 4DXLA 3OVBA 1BC6A 2GJFA 3D7SB 1NKEA 4U7UD 4MMOA 4A46A 2DHAA 1SJ3P 1JJCB 4B9LA 3ILOA 4IRDA 2KM8C 1PJ5A 2MKSA 1XJWB 3NBPA 5CABA 1N34J 2B4UA 2LA6A 3MXHP 2YNFA 4B3TJ 1RBOB 2SXLA 5D78A 2KHDA 4KTQA 2M0GB 3WX8A 1LFPA 3CCWA 3IAM9 3OL6A 4FKXA 3W2WB 3N6NA 3KLGA 5IC6B 1HNWF 2L9DA 2QLFB 3T19A 1EZZB 4QIWD 4K4ZA 4X66J 4NCBA 3SMZA 4FZVA 3OVSA 1DURA 1TAQA 2FHJA 1Y5LB 1JLEB 3NS7B 1S77D 1RTIB 5JMNA 3EDRB 2N82B 3RR8A 2ZH3A 4L75A 2HHSA 5D0RA 2JZ5A 1S1UA 2OO4A 2O66A 1N32F 1D1UA 5KAKA 4ED0A 4XPCA 4F4WA 2QGFB 4P72A 2KL8A 2I2YA 5A76A 1C4CA 3CO0P 2BJDA 1RBAA 2M9KA 2OPPB 2XHCA 4F04B 4DFKA 3GG0A 1DTQB 1S6QA 4Y2KA 2RRBA 4LR8A 2HGLA 3T9ZA 3DU6A 4WF9Q 3V5RA 4EGLA 5AE2A 5IXUA 2OMLA 2BANB 5ETTA 3EXYA 5L1LA 1RWPB 4OQJA 1Y0HA 3CJRA 3V2UC 4C9DA 2BJ1A 2RVJA 5H9EJ 3ETOA 1IWGA 3Q2SC 2AQ4A 3N6LA 2DNPA 2DD8S 2ZITA 1RWUA 2YX4A 3K5MA 5LJ3Y 3BH6B 4DR5F 4CYUA 2IAJA 3TI0A 2HMIA 2VG6B 2HGNA 3PJWA 2CPXA 3LALA 4RW9B 5E41A 1WWHA 2KDOA 3DOLB 3EGVA 3MM5B 5C25B 2CWKA 4FS1A 1TQLA 3FCVA 4LF1A 1QVGR 4AE5A 1C1BB 3J81j 5A6WA 3QRPA 4C8MA 3QZ8A 3GPAA 1H2UX 3CC2S 2W8LA 3G96A 4F4ZA 2UVVA 3DLHA 2XS2A 1CJUA 2RKIB 2K06A 4O3OA 4QU7A 2W2PP 1L3UA 3R5JB 1T9VA 3F44A 1I51B 4EMDA 1N33F 2GIQA 1M5VC 1T03B 2QLJB 1RT4A 2R7TA 4ZVUB 1IXKA 4KPCA 5F41A 4YB1P 3DHWC 3KLFA 3T41A 4CRJA 2VJUA 2W1BA 4J9MA 3CD0A 2XNQA 4LF6J 3IC1A 1I1GA 1ZM4A 1AUDA 4R8UA 1BXNA 3AA8A 4AL6A 2GMJA 4J9OA 3R5DA 4CO1A 1OYEA 1ZS6A 1HBNA 5K8PA 2XNRA 2PA3A 2HHTA 1NHKL 1NDCA 1P9QC 1X8DA 3CXCR 2QA2A 2JFDA 1NJIT 4DSFA 3HT3A 2EFGA 1SKSA 4R0EA 4USJC 5A8RA 2G4BA 1TV6B 3BR9A 4DR6F 3QAUA 2MDAA 2ZM6F 4R5PB 4A8MP 4ED1A 1FKAF 2NXNA 4OV6A 2YNGB 5L8RC 2BR0A 1H38A 3F0NA 2ZH1A 2BDPA 4E2FB 3MF5A 2ROEA 1WHWA 2OSQA 1H7XA 2JWNA 2VPYB 4MIAA 3IWXA 3MEKA 4RUBA 4NLYA 1NSPA 2HBRB 1NM2A 2LP4A 3AJ2A 2RF2B 1TUWA 4HR2A 2YTCA 3O6QA 4IDKB 1HNIA 3QQCD 4RO0A 4UQTA 1X5SA 3HVTB 3MFHA 2P8IA 2LQ8A 4DV2J 1T3NA 2JEFA 2OPPA 1RT2A 4OX8A 1YZ7A 4DSLA 1U2FA 2K8GA 4KV8B 2I8EA 4M5DA 5KFRA 2MZJA 2AU0A 5F8HA 3A3OB 2W24A 2MKHA 1IBLJ 3TJAA 2YH1A 1S1WA 4NMLA 3T5LA 2ZH9A 2L08A 4CO5A 3TA0A 1FJ7A 2Y3YA 3KK1A 4AYBD 1X9WA 4P75A 4QR0A 4ES3A 1TP7A 4AT1B 1UCNA 4DV2F 2AGOA 3VR1A 1S0VA 5IZHA 1HQ2A 3R27A 4A8XA 1KP6A 5G0RB 1Q8BA 3SDEA 1SXLA 2DGOA 2CQPA 3PW2A 4M5DB 3KG1A 1T11A 5E3QA 1U4BA 1VQ5S 4IRCA 2FC9A 3R2DJ 2QLBB 2UVWA 3D1OA 3QO9A 4XAKA 1S9GB 5ITHA 5J2MA 1YBUA 4LF4J 2CJ9A 5HQ8A 4NL5A 2ACYA 2AGQA 2K1RA 4ITSA 3THVA 3CNQP 1J5OB 1ZPVA 2KXHA 2R2UA 5JVGQ 3JTOA 1PSDA 4OLOA 4EO6A 2YNFB 4CO2A 2VQFJ 1NB2A 3I0SB 3D6MB 5EN1A 4P2SA 4M95A 1S1UB 1NAQA 2HG4A 5C7PA 2Y1JA 1LWFA 2MGZA 3CJ3A 2HWTA 4QR2A 4X64J 2X3DA 4ZPVR 2H54B 1Y4ZB 2EVZA 1D8ZA 2XYGB 3G82B 3ILJA 2VBWA 1CULB 1QY7A 1LW0B 1S9EA 2C3UA 2OEKA 2RB7A 5E33A 3W62A 3M8SA 3DMJA 3JQKA 4TYAA 2ZC3A 1KTQA 4NX9A 2R7QA 4DOZA 5JVHQ 2DR6A 5LM7E 3Q8SB 2F4VF 2VF3A 1C0TA 4ECRA 2Y1IA 5D4OA 4QWCA 1U6BA 3OD2A 4MT1A 1N5VA 1RTHA 3ENAA 5ETOA 4USWA 1NHVA 3H90A 4ZJOA 1X4EA 3TZYA 1XMOJ 1OSDA 1UJ4A 1L3KA 1VRUB 2LYVA 1XR6A 2ZD1B 3V6DB 4OI3A 5I3PA 3I6PA 3PDNA 4N8OA 5F8LA 2FHOB 2IAJB 2VG5A 2OFGX 1KTVA 2H51B 2QLXA 3NLCA 2GCFA 2NPFA 1NO8A 4J37A 4OYIA 4DQIA 4J9VA 5IQ6A 1RBLA 1GT8A 3M8RA 3FMWA 3MM6A 1WC1A 4PQAA 4DEZA 4G3IA 2DNKA 4OHZA 3KJFB 3HHDA 2XB2D 2MLXA 2DCLA 5J2PB 1M1GA 1R89A 1AYEA 4EBEA 2QIFA 1ITPA 4DR1J 2RQKA 3TA2A 2HIQA 1UZHA 3D54A 4B08A 3HHKA 8RUCA 2M8DB 4AQYJ 1UETA 2UUAJ 4Q0BA 3DOLA 3LPEA 3MM5A 4AXIA 4EFAC 1VC5A 3GFHA 1S48A 2HS0A 2DNNA 3DYAA 3R5GA 1CJVB 3WQPA 2IBOA 1D9DA 3H5YA 4WKRA 2OELA 3UN5A 1G3OA 2VPWB 4ECUA 2DO4A 1OPZA 3BN7A 3NP5A 4U8VA 1VRTA 3BQ0A 4P6QA 1U0SA 2V67A 1VI7A 2ZUGA 4ILRA 2WHOA 4LSLB 3CJKB 4DR4F 2R7SA 3AHPA 5B0DA 4E8UA 3SSRA 2AEJA 2BA9A 2HBQB 4ZMMA 3CD6S 4OZNA 1B99A 3DYAB 5E3RA 1IBMF 2YKAA 2HZAA 3GG1A 3CTRA 3OXFA 5B7WA 4I6WA 2LDYA 3UVJA 1RHMB 1SVDA 3TZXA 4M94A 2GMHA 1J27A 1KS2A 4WFBQ 2BKPA 3ZTOA 3BBFA 2BE7D 3HMJG 2E5LJ 1NH7A 4KGVB 2H4WB 2WBMA 3KLVA 2LQ5A 2V4QA 2C3OA 4X64F 4CO0A 1YZ6A 5M2PA 3PFEA 1UTAA 2ZBQA 2IMOA 5KOWA 2FTRA 4JI2F 2FYXA 1NPRA 3VF0B 3DRRA 5IC4B 2D74B 1N8RT 4RW4A 1CS4A 1ZA1B 1P1LA 1R27B 4P2XA 5A8WB 1NMEB 1UWBA 1S1XB 2QTWA 4OYPA 2F8MA 1R0CB 4A8YA 2VG7A 1RT2B 1U1RA 5CD4H 1SC4B 4RWXA 2K7JA 2CPJA 2HRTA 1KSPA 4DL3A 1UVNA 3CJ5A 2XHWA 3OHBA 4G6VB 3N79A 4JI4F 2J8AA 4TVAB 1R8CA 3A8IA 3HD2A 1FK9B 2JL9A 3OR1A 3ZTRA 2IM1A 4DL7A 1JKHB 1R0BG 3RBEA 5D15A 2GVDA 1WSRA 2Q79A 1LWCA 2B5JB 1FD8A 3WC0A 4MKYA 2XMVA 2UXDF 1JLFA 3SCIE 5FLXU 1SJ1A 4EUVA 2GMLA 1K47A 4U8YA 2L3MA 5HI7A 2YWHA 1U2CA 2BRLA 1K0VA 4B02A 5I3QA 1L5UA 3ZNUA 4ZJQA 1VQNS 1WC3A 1X9MA 4KY3A 2XI2A 3MUMP 5BJRA 3VAJA 3FBFA 1IBLF 1X5TA 3UDVA 2PMHA 3B8HA 5J1NA 2ZC4A 4CLSA 3HSZA 2J0WA 2WOMB 1FDNA 5BYRA 3A4TA 1SKWA 2M8HA 2V8PA 4K2JA 5CZVA 2CQBA 3CDWA 2M3DA 2JLGA 3ZZYA 1EX8A 4JI4J 3J80Y 4IFVB 3CCUS 1N6QA 2HFZA 2VONA 2HNDB 4UZCA 3PG9A 3TX0A 4RZRA 3IGVA 4UOFA 2IJFA 3HKZD 3KK2A 1C0UB 2G1DA 3QT6A 5CYMA 2K1RB 2W01A 2FJDB 2LMIA 3CWJA 3H2LA 3PTWA 4MKVA 1MG7A 1R8AA 2F5GA 2YQ1A 3GFZA 3QWUA 4IQXA 1IWAA 5DZ6A 4ZVTB 3FMBA 1FFSB 1S49A 1N6QB 3GJQB 3OUYB 3HPOA 3UD3P 1XNQJ 2JSXA 7FD1A 4DPOA 5B0BA 5LOQA 3TP2A 3TA1A 2RDIA 2FLLA 3ZZRA 3BSOA 2E1CA 2BKOA 3JSYA 3LP0B 3TZWA 2PMWA 4F7VA 1QUVA 2BW7A 4CWBA 1SKUB 4P2MA 4RPFA 3RUBL 3QT8A 2VQEF 3MI7X 2H1YA 1JLEA 4CLPA 3M32A 2GAHC 1S59A 3W5YA 2W9CB 4KGKA 3FBCA 4OYXA 5D4PA 3DRPB 4DV4J 2V9WA 4DDFA 4KYZA 4OX6A 1IQZA 1VS3A 2I5JA 3A1YG 4USMA 3PIOQ 4KO0B 1BQMB 4KB7A 1QUPA 1C1CA 2HZVA 4CTAB 4NCGA 2AD9A 1R0AA 2BACA 3OTBA 5F8MA 4EI2A 3J81U 1AZSB 3SSQA 4LF8F 2XG8A 2GJIA 1JK9B 1FXRA 4K59A 2QG9B 1UWBB 3CC4S 4X2BA 1E6YB 4OYWA 2FY1A 4ANEA 2CG4A 2Q1LA 1NK8A 1H2TZ 2AZ3A 3QT5A 3KHRA 2LLZA 4UTGA 2OEJA 3RR7A 1FE0A 4YS2A 2RT3A 2ZOFA 1CJVA 3CMES 1FWLA 2IM0A 4OHXA 3GP9A 1JLAB 2A10A 2B0GA 3EX7B 2ZZMA 3DU5A 2Q43A 3ZTQA 5HJYA 4NLGA 2VG6A 4CLWA 4R0JA 2OUGA 1FRXA 5AXMA 2C1EB 1PAUB 1FDDA 4WK1A 3H4BA 4JI0F 1GXTA 2ASYA 4O3SA 4DL0C 4WYWA 4YY3F 4LFAF 4NLXA 5B09A 1SJRA 1WKLA 3THPA 1SC1B 3C15A 4OYZA 2QA4G 4NEZA 3AOAA 3MEDA 2Z2YB 3I55S 3FRZA 4DR6J 3ZZPA 2RMLA 4ICLA 4I7FB 2CPFA 3TW0A 3IAS9 3RRGA 2CPYA 2HWIA 2GIFA 3CDEA 2PGCA 2V50A 3VALA 1R43A 2P6TA 3M6UA 1WSVA 1S4EA 1VC0A 4OYAA 1ZA2B 4ANCA 4ELUA 1VR6A 5CA5A 1UP1A 2KU7A 1S79A 2VFVA 4CI0B 2J0QD 1Y5NB 4ZOSA 5RUBA 4AD6A 1T9YA 2XO6A 1EAYC 3V6KA 3L09A 3ZC4A 4RW4B 1W2IA 3D3CJ 4PQUA 3HO1A 1FWPA 2E7XA 3PYDA 5HN0A 2GO8A 4LUBA 2KJWA 4DL2A 2NYIA 3SV3A 3DI6A 4USIA 4ID5B 4Y2CA 3W7BA 1KC8T 4DSIA 4KGMA 1XMBA 1Q53A 3MMJA 4KAIA 2PFFB 1A6LA 1CJTB 1B0PA 1UW4A 3SCLE 3T6BA 3S6EA 3Q8VA 1APSA 2CA9A 3IMQJ 3W64A 1EKSA 3WIVA 4Z2XA 2DNHA 2OD6A 1I6JA 2RUSA 2Z30B 1HPZB 2AYMA 2XSJB 4PCQA 1MSWD 1RCXB 3HD1A 1TL3A 3GYNA 4NLWA 3MOJB 3CJQA 2ZOGA 4OJHA 2PSZA 3BYPA 2KG0A 1VBZA 3GFYA 4F50A 1NK9A 2MQ8A 3KYLA 2HNZA 1K73T 3Q8UA 5AT1B 2MHNA 2ZH4A 2RRNA 1AROP 4DZDA 2WOMA 2HHXA 1RTDA 1RT3A 1KVKA 4KO0A 4PWDA 2HNYA 4K4YA 3NCRA 1BUXA 3K8WA 3DCAA 3V6JA 2XY6A 3CCJS 2F40A 5THWA 3PYEA 3UNYA 3BDPA 3M2VB 3D3BJ 1OMSA 2DITA 1FKOB 3LGHA 3DLKA 4N76A 1WG1A 1SBRA 3TQ1A 2DXFA 1FE4A 3T9NA 2ATCB 3L3CA 2DGVA 2DY9A 1PYTA 4IYQA 4LT6A 2XLJA 5CD4A 2J0SD 4RBVA 2PC6A 4G1QB 4M63A 3IRXB 5B0CA 4UOHA 1NK6A 1N32J 2KHCA 1MU2A 1UW9A 5K8NA 3VAMA 2NCKL 1S4FA 2DO0A 1RTJA 3SCJE 3GYGA 5KFPA 1S1TA 3WDOA 5J1PA 2GX8A 1YJNS 2C22A 3L7UA 3KK2B 4F2SA 2LEPA 3QGGA 4KHRA 4X4NA 4DCPB 6FD1A 5HO4A 4TQSA 3BO3A 4EWTA 4DLGA 4ECWA 1J5OA 2N4CA 1RU1A 2DY1A 2B7CB 2JNJA 2W2MP 4W4MA 1BQNA 4ZVOB 2WK4A 4U7CA 2HVZA 3KLHA 2IFXA 2RJZA 1X0PA 4JI2J 1HQEB 5GAGI 4I7FA 4ELTA 3QFHA 3R7NB 5J2NB 4GVLA 2Q6BA 2MGZB 5KFNA 4J90A 1AUSL 3CVKA 3CCVS 1HW9A 3NGUA 1H3DA 3QJPA 3FEZA 2CVEA 2WB1D 3AD8C 3ITHB 1O6XA 4YN3B 3W65A 5DDQC 4EYHB 4QPXA 5HROB 1KBRA 2EFOA 1S1WB 1X4BA 2CJBA 2HBZB 4GC6A 1WHXA 3HJFA 1HD1A 1RWNB 2XO7A 2EI5A 3MEGB 3NRBA 3PEJA 2E9TA 1D9AA 3B82A 1TKZB 4ETZA 2KKHA 2W9AA 1RT5B 2F8HA 3OTOJ 3JYTA 3FQKA 1WELA 3QWPA 4RU9A 5HP1B 2CNKB 5SZTA 3SCKE 1EP4B 2XI3A 2F3JA 1UEUA 2CDQA 2ILYA 2RQ4A 5IFMA 1T0TV 2C2EA 3IS9B 2C2ZB 3MPDA 3HSGA 1RI7A 3MWBA 4PPDA 4OI6A 2FB0A 3C3LA 2XMAA 4B3RJ 1UJ5A 2DR5A 1CQMA 5A8KA 3EDQB 2HS4A 1SJQA 5B0EA 3ZZZA 3FCWA 1LW2B 4DPWA 1IN0A 2MJNA 1YJ9S 2BRKA 1XMQF 5B0GA 1Q81T 4DSKA 4FKYA 3UPFA 2EBGA 2HFNA 3DDKA 3E8OA 3EZOA 3L9ZA 1WUUA 3MD3A 3OQ2A 4YDXA 2V2ZA 2P9EA 4LREA 2ZKTA 2XLIA 2JC1A 2NUHA 4W98A 3PZPA 3NMAA 3MFIA 3GZ7A 4LFCJ 4CLYA 3R1HA 3OTOF 4LF7F 3OFEA 1IR0A 2JLEA 2YQ3A 2O1PA 4TY9A 3TOQA 4FP9A 3V4IA 5GADU 2FQQB 4DUYF 4LFBF 2F4FA 1X5OA 1KEKA 1RWXB 1TVRA 1X7VA 4I69A 4NI2A 2KZZA 2E5LF 3QYYA 1HNWJ 1NJZA 4B3MF 4EBDA 1RTHB 3DOMB 1F9EB 1XIQA 4ZPWR 1TL4A 1CJTA 4DR3F 2BE2B 1ZTTA 4JI1F 3K0JA 2VASA 4J5OA 5LMNF 2KVQE 4IG3B 4Q2MA 4CH1A 2GHWA 2ZKUA 3OLBA 2DH7A 2ZH5A 3QIPB 4KFBA 3AQOA 2VKZG 1VQSA 1UA0A 2J8SA 3KKFA 2PT0A 3DRYA 4I2PA 3C16A 2E5GA 2BJEA 4NLVA 3V6HA 1FRLA 2BQUA 4QIVA 4FYXB 1X4GA 4ZN3A 3G4SS 1WKKA 3R7SB 2YNIA 5JUMA 4LFCF 2B6AB 3MCOA 4RL1A 1CVJA 3MM6B 3CCZA 1NHUA 3M30B 1B0VA 3MEEB 1KWMA 2RILA 4KR0B 4URQU 5DS7A 5E7OB 3ZNJ1 5DQHA 2VQFF 2NR0A 1PYOB 4LMZA 2D9PA 2CZ4A 4ZLNA 3IM8A 3ZZ0A 4PYAA 4WZMA 2ZH2A 1W7WA 3G6VA 4WFZA 5HBMA 2ZOMA 3MM7B 5KOXA 1Q7YT 1CG2A 4QQBA 1KQGB 4AFFA 5GMKa 1IKVA 4PWDB 1YITS 1TK8A 3DLLQ 3KLEA 4GC7A 1YSJA 3MCMA 1CJKB 4TU7A 3EPGA 2QV6A 1N4LA 2HHVA 3QIDA 3Q8PB 3KJNB 1ZBTA 2RS8A 4C8KA 2QSFA 2HEKA 1Y3JA 2IDLA 1D9FA 3C6TB 4C8LA 2FJXA 4ZHRB 4ZCIA 2QL7B 4K0KF 2X1AA 1N36F 3EJMA 3MMBA 4G1QA 1LWEB 5LSRA
chains in the Genus database with same CATH topology
1HWLA 3BM7A 1KVIA 3C6UB 1ZTWA 2FDNA 3P49B 4AXJA 4O44B 4HYKA 1MWYA 1WF2A 4FF3A 2KB2A 3ISND 2FLNA 1VQ7S 3KFWX 2LU1A 3OBIA 1NRKA 2YKNA 4IO9Q 1R8PA 2CPZA 3FQLA 3M2UB 3SQGA 4JI3F 3CIMA 4GO5X 4I67A 2ABYA 2AJ4A 5JJBA 4Y0FA 2E1MC 4TQRA 1HBUB 2X1FA 3HKWA 4QIFA 2M2BA 1YTYA 3W2WA 4F4KA 1RKIA 1S1XA 1GTHA 3TVKA 3VAKA 4ZS6A 1X4CA 3JTNA 5G0RA 2WONB 2FC8A 3ITHA 1L3SA 4QWBA 1OIAA 2WTFA 4OHWA 5J2QB 2AYGA 4IR9A 2ZHBA 4OI0A 1DFDA 1FNXH 3OSPA 3UCUP 1N48A 1DJ0A 2NSCA 1SKRA 1IUJA 4NZ7A 4DQSA 1XWLA 3M4XA 3CSKA 1TKTB 5KFOA 1TUVA 3I0SA 4ZVHA 1YHQS 2GV1A 2WSCC 2M7SA 2ZJPQ 3BEGB 1D0EA 2JJ4D 3RB6A 3TAPA 2Z0GA 1TK0A 4X4OA 2IYIA 4BC9A 2O5DA 3QGHA 4WK3A 5FJ4A 1TKZA 1GAOA 1LXNA 2OH2A 2DHSA 5KT7A 3LANA 2XSFA 3NS6A 4I1TA 2MSTA 1A7GE 1UVJA 3S8SA 1ZAXA 1NB7A 2XMKA 1OWXA 4PWUA 3OXGA 5C42B 2XMJA 4ZA1A 4DQRA 1EETB 1VRUA 3RRKA 1NK7A 4PR6A 4RNHA 2EC0A 4B3OB 1TL1B 1R31A 3HHLA 2KT2A 4Y2AA 1TL5A 2P6SA 2JDJA 2E1AA 4RLEA 4B3SF 2XZWA 5FIIA 3OUYA 2YWEA 3LH2S 4CIOA 1H7WA 2ZH8A 5J1EB 4A8FA 2KZMA 2DK2A 1YRXA 3UWTA 2I0XA 5C42A 1S6UA 3D1QA 5CCMA 3LAMA 3LP0A 1LWEA 4R8UB 3SV4A 4OI1A 3OFHA 4OHVA 1SL2A 4HTIA 3PKYA 2VC1A 2R9LA 1CPZA 3KLFB 4BCAA 4TKTA 3J81Y 3W2VA 4Y28C 2ROGA 4ED5A 4DV4F 1Q16B 2QA4S 3BR8A 3DRPA 3LOUA 4WU3A 2BABA 5E3AA 2HHUA 3BS9A 4ZCKA 3SQGB 2HQIA 3DOMA 5DETA 5F0UA 1BQMA 3NCPA 2RU9A 4EU0A 2B56A 5CZXA 1M5HA 2OFHX 3TVYA 1X4HA 4YR2A 2HVIA 1N5QA 2FHJD 2J0XA 3DLEB 2PO4A 3FNNA 5A6PA 1TV6A 3G8TA 1NJWA 5EHHA 3MMCB 2K7KA 1I94F 1P6TA 4ZPAA 4FNIA 4ID5A 3GB0A 3NG8A 4F02A 1YQHA 3R3TA 1RKJA 4F3OA 4OZLA 4A47A 5F9LA 3JSRA 2D3ZA 4F25A 2IBKA 4WJBA 2LU2A 5KFWA 1S72S 1SH3A 4U9RA 4IRKA 3KG4A 1FA0A 1F9FA 3NS5A 5L1JA 3GE9A 3CCLS 5EWFA 1R3NA 1OS5A 1Z4UA 2ROPA 2CQHA 4MKBA 4NRTA 4CZCA 4FNHA 4Q5VA 2DB1A 2VFUA 3HHNB 2UUBF 2RU3A 2YKNB 2N7CA 4B9VA 4JI8F 4ZK7M 3KHHA 4UY8T 1HFEL 2GW8A 1T05B 3P6YC 1JLQA 5C24A 2CVIA 2E1RA 3VAHA 3U1NA 4KSEB 3MZIA 3DLKB 3H2VE 1U09A 4K4WA 1LWFB 3BB5A 3DI6B 1BQXA 2QMXA 3E3XA 5E3PA 1QSYA 2WONA 4QYRA 1PGZA 5HMXA 3NMRA 1IKXB 4KT0C 1H98A 1X9SA 2M52A 5J2QA 1RT7A 5F8IA 2DNOA 3MECB 5EDWA 3BF4A 1C0TB 2ZZNA 4PRFA 2RF2A 1DARA 2O67A 3PRDA 4WYLA 2EFVA 2B9WA 2I5JB 2HHQA 1LK7A 3UE2A 4CNZA 3FSIA 4USHA 1KQKA 7FDRA 2E5IA 4OZ5A 1JLGB 1HW8A 2KI2A 1IKXA 4N47A 4A8WA 4TXSA 1JX4A 4JUZA 4NLPA 4XPEA 4K4UA 4C0OC 3EZUA 3MTJA 3QMQA 4KKOA 4Y3CA 4YHHF 4DL6A 2LDIA 1VQLS 3S01A 4GMKA 2V0NA 3MM9B 2XMWA 1N34F 4F2RA 5I42B 5KFEA 5D6GA 4X4SA 2DIUA 1ZZFA 3T6JA 4DG1A 4FF4A 4IR1A 1S6OA 3AH6A 4OX7A 1KQSR 1Y00A 3LWLA 3FEYB 4B3RF 5H9FJ 1NJYA 3LP1A 2ERRA 1JLCB 2UUTA 1FD2A 6FDRA 2VFTA 3KJVA 2EPIA 3ISZA 4NA3A 3I5AA 2D9OA 1RTJB 3R1LA 1V3RA 5KFZA 3MHYA 3BGRB 1M5OC 1HBOB 5FD1A 1QSSA 3SI8A 4ECYA 2VH7A 3DRSB 3PR4A 5BR8F 3G71S 2JLFA 5L1IA 2YKMB 2V94A 2JFKA 4ID8A 3T5JA 4TY8A 4ED6A 3THTA 4PQUB 2QMWA 2WAQD 4RNMA 1NKCA 3G8SA 2FIUA 2PDAA 2QO3A 2VD3A 3PY8A 4HVZA 3C2PA 1DRZA 3BSNA 4QIEA 3K5PA 4LIWA 2ZD1A 2GJ2A 1XC9A 4IOBA 4IH6A 1NKBA 3GSDA 2UVUA 2BANA 3I0RA 2MQQA 4ECXA 1N0VC 5KG1A 4QCLA 1YJWS 4DUZF 5I4MA 2VG7B 3MEGA 2M4MA 2RDJA 3T5HA 5DQGA 2NPIA 2HZCA 4YFUA 1S10A 1Z2ZA 3BDEA 1LV5A 4DV6F 2QT7A 3B4DA 3MAHA 5DG9A 1HYSB 2QFJA 2LEBA 4IG0A 4WXWA 4KFBB 3DLBA 4JV5F 2JHEA 5IM0A 4I2PB 4QBUA 3NNCA 1KD1T 3N28A 2WSFC 1RT3B 2LVWA 3DM2A 4YB7A 2FPHX 5K14A 3QLHA 4I68A 4X84A 1FJEB 1VBYA 5KT4A 4D3GA 2I1RA 4X65F 4ATNA 4B9SA 4RUHA 2IVMA 3QGPA 2CPHA 3QO9B 3RYLA 1R7IA 5J2MB 2LECA 3CJ0A 1XK8A 4J9KA 5H1SV 5AXKA 1SJ4P 4NLSA 3IR5B 5B0AA 4NCAA 2XS5A 2ZH7A 3UFCX 2DNMA 2CQCA 1U48A 3MPVA 2UUCF 1AFIA 3BREA 1B0TA 2BBEA 1FTCA 1HPZA 1JXEA 2POKA 5D8HB 5K9FA 1N56A 5KFTA 5K8OA 4IFYB 1SH0A 2FGCA 4OI2A 3OL9A 2NS1B 2U2FA 3DMJB 3KLIB 2AX1A 1X0FA 2PI4A 1RTIA 4C8YA 3CCMS 3OV7A 4OLPA 5CYQB 1G7CB 1HNZF 4ECSA 1SB6A 1RTDB 4Y2MA 2XY7A 2IM2A 3AAWB 3US5A 4ZPTR 1XMOF 1T8EA 1YBAA 3UR0A 1JLGA 4WIIA 5U47A 2C3PA 4IO1A 3SSSA 1REVA 3O2IA 3Q23A 5DDRC 5EWGA 3OR2B 1WNEA 1Q79A 2C42A 3KNAA 3OL7A 3I56S 1Q82T 2EWHA 3M1VB 2CQ2A 2N7YA 4E98A 2UZAA 1MU2B 2JH3A 3E01A 3M32B 3CUNA 3KLGB 4A48A 3K5LA 1T3OA 4DFJA 2BV3A 5DM6Q 2MY7A 1U7LA 3JTPA 1JLCA 3TANA 3KMSA 3FFIA 3M1VA 4LIRA 1GXUA 1VOMA 2F9DA 4MKAA 3DLGB 4ZP9A 4PG5A 3CEDA 1CQNA 1T7PA 3QJJA 2DNLA 4I64A 3NNHA 1U8SA 3K5OA 2MQNA 1E6YA 1V3ZA 3MR2A 2KXNB 1HQUB 2YY3A 1FRKA 2VUGA 3M2UA 1V6HA 4O4RA 5FDLA 2FJBB 1DTQA 1S6QB 4QZVB 5CYMB 4H4OA 3DOKA 2G9OA 4LJMA 1U1OA 3MEDB 4ECZA 4TY8B 2JRSA 1F5BA 1NH8A 4JV1A 3D1HA 4Q7AA 5LXYA 2EFQA 2KH9A 2OAUA 1UMJA 2ZHOA 1NU4A 3G6ES 2OP5A 4LF5F 1VIXA 1X4FA 2AJFE 4DWIA 2ZFHA 4A4JA 3QGIA 5A0YA 4FS2A 1K9MT 1O8BA 1G6BA 2I38A 1VK3A 2DR7A 4QPTA 1HI1A 1WHYA 2GIRA 1VFJA 4JI7F 4MYTA 1U6ZA 4JV2A 3SYZA 3FDSA 4LSNB 3C8YA 4PXEA 4ZVEA 3AA9A 3I0RB 4D3HA 3POTB 2J9CA 2E5JA 2EK6A 2FVPA 4Q43A 2EG1A 3TUJC 2XBPA 2B4VA 4ZPCA 4N41A 5HL7Q 1GQEA 1TZ0A 1S0MA 3CD5A 1UVKA 2DJWA 4OL8A 4LVOP 2IMWP 2VG5B