2CQ3A

Solution structure of rna binding domain in rna binding motif protein 9
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
103
structure length
103
Chain Sequence
b'GSSGSSGNSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-binding protein 9
publication title solution structure of RNA binding domain in RNA binding motif protein 9
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 14
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cq3A00
3VAGA 2M9KA 2J0SD 2MQNA 2K3KA 5LSLA 5GAHU 2MPUA 1YHQS 1BY9A 2E5IA 5LXYA 2MJUA 1WHWA 2RVJA 1G2EA 1FXLA 4WFAQ 2F9DA 2JVRA 2RU3A 2KXHA 4A8XA 1ZH5A 4WFNQ 3VF0B 5DDOC 2JX2A 3UE2A 2RS8A 2CQBA 2EK1A 2DH7A 2MJNA 5LJ5Y 2QA4S 2OIHA 1H2VZ 1SXLA 1YIJS 2B0GA 4V19X 3IWNC 5GADU 3MD1A 3CCVS 4IOCQ 1WF1A 2VOOA 3ULHA 3SDEB 2MKJA 1W2BR 4OZ0A 4PKDB 2N3OA 1WHYA 3NS6A 3BO2A 2DGXA 1OIAA 1O0PA 2DNZA 1ZZFA 4P6QA 4TLQA 1H2TZ 3J7ZT 2PE8A 2X1FA 2M2BA 2DIVA 1FT8A 3CCMS 1VQ4S 1NO8A 4Y0FA 4UY8T 2NLWA 2ADBA 2KM8B 1FNXH 2LXIA 3NS5A 1VC5A 1U1PA 5DM6Q 1B7FA 1F9FA 4ERDA 5IM0B 1WEYA 2ZJRQ 1WWHA 2J8AA 3MOJB 2CQIA 4QQBA 1UFWA 3G9CA 3TYTA 3G96A 4ZKAA 1OPIA 1VQLS 1JJ2R 2I38A 3EGNA 4CQ1A 2J76E 3CCJS 2HGNA 1UW4A 2DH9A 4EGLA 2KRBA 3N9UC 2DO4A 2X1AA 3G6ES 1M90T 3EX7B 1X4GA 2WBRA 3P5TL 2ERRA 3J7YU 2MGZA 1X4HA 4QPTA 3MUMP 5DM7Q 1VBZA 3CC2S 2EK6A 1X4EA 4CH1A 2KM8C 2XS5A 1VQ7S 2OTLS 3CD6S 1WHXA 1R8HA 2KRRA 2KHCA 3THTA 1K9MT 1VC0A 2AYGA 3UCZP 1WEZA 1X5PA 2PEHA 1N88A 2RQ4A 2CPIA 2LEBA 2MSTA 3SXLA 2L08A 1SJRA 2M0GB 2RS2A 3CC4S 5GAEU 3UCGA 5ITHA 1PO6A 5LSOA 2KYXA 2DNRA 2X1GA 2MB0B 4WCEQ 3NNCA 4Y00A 4QU6A 3VAIA 1Q86T 3MDFA 2N3LA 1Q81T 1Q82T 1CVJA 3VAJA 1WI6A 2MKIA 4U67Q 1HD1A 2QEXS 2CPZA 5IFMA 1WI8A 4TU7A 2ZJPQ 3I56S 3H2VE 4YOEA 1OWXA 1K73T 2FPHX 1UP1A 2CPDA 1X4CA 2JRSA 2YTCA 5MLCV 2O3DA 1VC6A 2DHGA 5CA5A 3CF5Q 2DGVA 2EVZA 3CMAS 1XN9A 2MZRA 2HVZA 2N7CA 2M4MA 1FJ7A 2LA4A 2E5JA 4YUDA 2RUGA 3HHNB 1YI2S 2MKCA 2MXYA 1N52B 1VBXA 2YKAA 2VONA 5EN1A 3P49B 3THPA 5HO4A 3CCSS 2MKHA 4IO9Q 1VQKS 3DXBA 4C0OC 2MGZB 2AD9A 5DETA 5FJ4A 2VOPA 3NMRA 1VQ8S 2MY7A 2MZJA 2MKKA 3CPWR 2DGUA 2MZTA 3P3DA 2LYVA 2SXLA 2J0QD 1IQTA 4CH0S 2V94A 2DNYA 4F26A 2DHSA 1WELA 2AYBA 2DNOA 2XB2D 2KH9A 2DGWA 4IOAQ 2XSFA 5BJRA 4OZ1A 2LECA 4J5OA 2XNQA 1H2UX 1H6KX 3U1LA 2NZ4A 2KG1A 1A9NB 2MQOA 1M5PC 5DDRC 1YJNS 1A7GE 2G1DA 2KI2A 1VQOS 1KD1T 1U1NA 2LEAA 3ZZYA 3MUTP 2BZ2A 2MZ1A 4ED5A 5CYJA 1UAWA 2CQDA 1VQ9S 2OTJS 1P27B 2F3JA 2KU7A 5DDPC 5GMKa 2DNHA 1ZZNA 4WIIA 3B4DA 1VQPS 1JMTA 2CPXA 2BOPA 2XNRA 3G8SA 1N8RT 1X5TA 1FHTA 2ZJQQ 3BS9A 3B4MA 4LMZA 3TO8A 2QFJA 2G4BA 4F25A 3CULA 2CQCA 1WG4A 2U2FA 3BO4A 1WF2A 1N54B 1U1MA 2OSRA 2KG0A 1YITS 4RU2A 5CXTA 3Q2TC 1RKJA 2M8HA 2DNKA 3G8TA 2CPYA 1KOOA 4WKRA 2DISA 2FHOB 2DGTA 2N82B 2X1BA 2GHPA 3RW6A 3MXHP 5GVQA 1HA1A 4QU7A 3NNHA 4LIRA 3Q2SC 1M5KC 3V4MA 4PRFA 1M5VC 2MQMA 4WF9Q 2CQ3A 1WHVA 1U1LA 4CIOA 1DHMA 2MQLA 4F02A 1D9AA 1PGZA 1DZ5A 3LQVA 2I2YA 1U1QA 1U1OA 2YH1A 3CXCR 1R8PA 3DLLQ 3MURP 3S7RA 2CQGA 1U6FA 1QVGR 2E5HA 1X5SA 1AUDA 1OO0B 3CCRS 1L3KA 4Z2XA 2CPFA 1HL6A 2DNPA 2LMIA 2GO9A 2DNQA 3TP2A 3CCLS 2HZCA 3VAKA 2D9OA 5IQQA 3R1LA 3CUNA 2M8DB 2Q79A 2U1AA 2DITA 3H2UB 1SJFA 2MQPA 3US5A 2RT3A 5LJ3Y 2RNEA 3CCES 4M5DB 5H1SV 3UCUP 3OW2R 3D2WA 2L41A 3UWTA 3S01A 3S8SA 3CC7S 3U1MA 3FEXB 2DNLA 4FXVA 2CQPA 1WEXA 4IUFA 2L9WA 1KQSR 2KXFA 2MZSA 1VBYA 3K0JA 1JJ4A 3CMES 3MD3A 1VQNS 2E5GA 1RK8A 1X0FA 1S79A 2MMYA 3P6YC 4BS2A 4TU8A 1URNA 2OSQA 2LA6A 1U6BA 1U1KA 4C7QA 3BEGB 1X4AA 1WG5A 2CPJA 2OJ3A 3S6EA 2DGSA 2DH8A 5LXRA 2HGMA 3FEYB 2CQ0A 3CCUS 2M88A 2A3JA 1M1KT 1Q7YT 1KC8T 2CQ4A 2VODA 2JVOA 2MYFA 1X4DA 1P1TA 3I55S 2DHXA 2DNMA 3RW7A 1VQMS 3VAHA 2RQCA 2AYEA 2KFYA 4UQTA 2LQ5A 1FJCA 2DK2A 3MI7X 5D77A 2DNGA 2HGLA 2AYMA 2G0CA 5GAGU 3PIPQ 1DRZA 1FO1A 2CQ1A 3IRWP 2FC8A 2CQHA 1YJ9S 2E44A 1X4BA 1WF0A 3G71S 5D78A 2MSSA 5JVGQ 1U2FA 2YH0A 3CTRA 1WTBA 2K8GA 4TU9A 1VQ5S 2KXNB 1S72S 3VAMA 2DGOA 2KVIA 2CJKA 2DGQA 3EGZA 4WFBQ 2CQ2A 2MHNA 1SJ3P 1X4FA 3SDEA 3G4SS 2DHAA 2D9PA 4FXWA 2DNNA 1NJIT 1D8ZA 3MUVP 3BO3A 2M7SA 3NNAA 3SMZA 2LKZA 1U1RA 2LXUA 1SJQA 3PIOQ 2M70A 3VALA 1M5OC 2MQQA 1VQ6S 4W92B 3R27A 3JB9k 1KOHA 1X5OA 3CCQS 2MY8A 2MZQA 2M52A 1WG1A 2ADCA 5DDQC 1YWXA 4C4WA 2DO0A 1SJ4P 2UP1A 2MKSA 5IM0A 2CPEA 1DBDA 3L3CA 3ZZZA 2F9JA 1FJEB 2FY1A 4PR6A 3R1HA 4W90B 1QVFR 1NU4A 2CPHA 2D3OR 2XS2A 3VAFA 2DB1A 1YTYA 1JJHA 2DIUA 1HD0A 2KT5A 2HYIB 2RRAA 2YWKA 2RRBA 2KN4A 2LCWA 4YB1P 3UD4P 1K8AT 3UD3P 1YJWS 5HL7Q 1QM9A 2FC9A 3HI9A 5JVHQ 2XS7A 3LPYA 4LJMA 2JWNA
chains in the Genus database with same CATH superfamily
3VAGA 1QAXA 2MQNA 4C6AA 4QIWD 2K3KA 2EFOA 2MJUA 3QSIA 2VFTA 2BRKA 4YMEA 4WFNQ 3TW0A 5J2PB 5HROA 4LFCJ 2OIHA 4FDFA 4HHUA 4M5IA 2MKJA 1CPZA 1S0NA 2H5IB 3KWMA 1G4CA 2RDIA 3DCAA 2XEXA 3BJYA 3R5AA 4IH5A 4LQ9A 3POTA 3AD7C 4FF3A 1AZSA 3FSYA 2LEPA 4A48A 1Y10A 4RW8B 2WTFA 4DSIA 1WEYA 2JEIA 4UT4A 4JI8J 2PA3A 3T1AA 2WVEA 3GFHA 1UW4A 2ZH6A 5J1PA 5K20B 2WHOA 2X1AA 5HK4A 4ECYA 1SUQA 1IR0A 4C48A 2FQQB 4DCOB 4QYRA 4OFZA 2XLIA 1FD8A 2PN6A 1URRA 3MEEB 1WEZA 1RHRB 3PRVA 4QIEA 4NMLA 2XMTA 3CC4S 2M0GB 3DRRA 4NWBA 4K0KF 3CEDA 5F9NA 2VBZA 4RNFA 3VAIA 3QIPB 2P5VA 4ICLA 3PW0A 4GVLA 1JXVA 4URSA 3OV7A 2WONA 2Y9HA 3VZIA 2DGVA 5F8MA 5D15A 2HVHA 2MZRA 1CEZA 1LFWA 1R89A 3GWCA 4AL7A 2WVCA 4QR1A 4DV0J 2HS4A 2VONA 3TA2A 4IO9Q 3CPWR 5T7LA 3QO9A 4B9NA 3ZZRA 4LUBA 4DV7J 1JLQA 2XSFA 3HPOA 4AUKA 2OPPB 3OL9A 2B4PA 3J7A1 4OLOA 1S1TA 5C25A 2RSQA 1EKRA 2CQDA 4X4QA 3PEHA 2VU5A 5CYQA 4J9UE 1X5TA 1UVKA 2ZJQQ 3TUJC 1XIQA 2RF2B 4ZPVR 2U2FA 4DCJB 1LOUA 3H98A 5CXTA 4JI2J 1HNWJ 1EIYB 1WNEA 1JLFB 4EZ9A 1C1CB 2GHPA 1XERA 2YX7A 3PYDA 2X3DA 3IRXB 3ZC4A 1L3UA 1HNIB 2C1EB 2E5LF 3O8WA 1WHVA 1B64A 3FBBA 3C19A 1W25A 1FWLA 3TR5A 5JMNA 3OJSA 2RF2A 3GSIA 1RWWB 3LP1A 4GKJF 4M5NA 4QWDA 3BKUA 4AXIA 4DQSA 4OI4A 2Z4PA 4M5KA 3NGTA 3IRXA 1CS4A 1HNIA 2EFVA 2MZSA 2WBMA 1T7PA 3IN5A 4MJKA 1NBEB 4TU8A 2LXFA 2VKRA 3FSXA 4C7QA 3OPKA 2B43A 3BR8A 3M6WA 1CJTA 3JSRA 2UXCJ 4QW9A 4K4XA 2AQ4A 2DHXA 1R8AA 2Z2MA 4DSLA 1VQMS 1ZM9A 4DV6F 2JFKA 3AFGA 5U47A 4D3HA 1XMOJ 2EBGA 3IAM9 3JQMA 1I94F 2XCAA 5K14A 1MN7A 3WX8A 1RT4B 3BGOP 4U9RA 4ALZA 2PFFB 3C6UA 3R7BB 1T03B 1KBRA 1HI8A 3G6VA 5HVGA 4RNMA 1CC7A 4URGA 1R0BG 3BYPA 4F0MA 1Y5LB 2Y0SD 3CDWA 3DDKA 3I9ZA 1YJWS 2XI2A 1HBUA 4NXMJ 1O5JA 3MR6A 1RBOB 2M9KA 4C9DA 4MIWA 3W66A 2IVFB 2ASDA 4Y2CA 3DLGB 1PYSB 4FYWB 1IKWA 1TKXA 3HT0A 5K8NA 1UEUA 2IA0A 3CCVS 3GR0A 4ED0A 4QWCA 2ZEJA 2R7VA 3D1OA 3T5HA 4M8LA 2F5GA 4RW7B 1FT8A 4JI4F 4OZJA 3NS5A 4ZPCA 4CLKA 2P9EA 2W4DA 5FDLA 3BSAA 4J9SA 1VI7A 2ZJRQ 4Q2LA 4ELVA 4DBQA 4DR2F 2FB0A 2RHQB 4DV2F 1T9UA 1WUUA 4IFYA 1TVRB 2ZDPA 3MMAB 2HFNA 5AXLA 3QIDA 4X84A 3SCJE 2CVIA 4CO4A 1T05B 3BF4A 1WACA 3TRGA 3W1YC 2ZKTA 2V2KA 1FRJA 5K5MA 1RHKB 5FLXU 5K8OA 4QOTA 3C6TB 2VBXA 2DD8S 1NK6A 1UKUA 4IG3A 1SJRA 1IKVB 5H9FJ 3OXLA 1PO6A 2FLLA 2DVIA 4WYLA 2MB0B 4PEOA 1HKAA 1Q86T 4C3KA 2UVRA 3HZGA 2J0XA 4NLDA 2HKEA 4ZK7M 3MMCB 3CB4A 4YOEA 3K5PA 5B0EA 2ZH5A 2JRSA 5MLCV 5CA5A 2W8KA 3VZHA 3RYLA 1QAJA 1U0HA 2AGQA 3VQTA 2UUAF 3PKMA 1GMVA 3GJQB 1F5AA 1IQTA 3TZXA 4CH0S 2AJFE 2HFSA 2F63A 2J5AA 1Q95G 5I3UB 5KFHA 2ZHAA 3JAMU 2DR7A 2G2YA 1LKZA 3FJ2A 3VGSA 3ISNC 2HNYA 1NJYA 4FN5A 4B9SA 8AT1B 1IBMF 2C2MB 4ZP8A 4Y65A 2ZH1A 1JLAA 2DCLA 2LDYA 2PMWA 3NRBA 2V9WA 1C0TB 3BS9A 1VGYA 5LMUF 1VFJA 3AAWB 2JLEA 2CQCA 3MEKA 1M5HA 1Q0NA 2V67A 2CPYA 3CDUA 4MMOA 4TVAB 4E0DA 3ZTOA 3MMJA 3U02A 3NNHA 1P6TA 5ETNA 4CLZA 2MQMA 2V4RA 1HW8A 2OPSA 1B4SA 3RBDA 3EXCX 3N0VA 2XI3A 1QE1A 3O6QA 2B4OA 1PBUA 3QGIA 2R2UA 1TKTA 3Q8QB 1Y11A 4OJHA 5KG4A 4R8UB 3AJ1A 4PPDA 3VVTA 2M8DB 2V8PA 4FP9A 3CJQA 1XBWA 1RADB 2RDJA 3D6HB 4C11B 2CYYA 2AKWB 2JEFA 4TLRA 4K59A 1RT1B 2CUYA 3BDEA 2K3IA 4FKYA 3K17A 1J5OB 5DG7A 4PUOB 1S48A 4NLUA 1T9VA 3C15B 2RKIB 3HULA 1ZA1B 2OJ3A 3PW5A 2DGSA 2DH8A 4CNZA 1HBNA 4ED8A 1NJZA 3BR9A 1REVA 3QAUA 2KFYA 1IWAA 3H42A 1JQGA 1RYSA 4ZHRB 1IKYA 4DR7J 4JYAF 5KFDA 4DS5A 2G0CA 2UUCJ 1IN0A 1FJGJ 4FZVA 1IKXB 3CDEA 5G4DA 2HRUA 1U2FA 1WTBA 2YQ1A 2I6WA 2GO8A 2ZHBA 4WU3A 1QY7A 2IM2A 4DLEA 1C0UB 2DHHA 2Q3PA 1DQ9A 2DRBA 1NSKL 2LXUA 3I96A 4O4GA 4JI5J 3JB9k 3CJKB 3DLHA 2B3TB 4LRBA 1JLEA 4C4WA 4K2XA 2UP1A 3E01A 1KVJA 2XC9A 3R1HA 3FEZA 2P6TA 3W7BA 1KHVA 2DIUA 2K1RB 4YQWA 4MK8A 4R0JA 5HL7Q 2ZHOA 1DLOA 2XS7A 1Q5VA 5KFCA 2JWNA 1RI7A 2EG2A 5LSLA 3KG4A 2C2EA 4IDKB 4U7UD 2RVJA 3ITHA 4HACB 2ASJA 4HTIA 1SCJB 5KT7A 2QO3A 4F4YA 3TZZA 1FFGB 3ULHA 2ZZNA 1KWMA 2MEWA 2R42A 1HBOA 3MTJA 2IHR1 3K59A 1HWLA 1PYOB 4PYAA 5EX3A 5D3GA 2VQFJ 4PZVA 2QLJB 4JI1F 4ELTA 1YKWA 4O3PA 1D3WA 2FGOA 3R5GA 3HMJG 4OX8A 3M2UB 2QLWA 1VQLS 1R8CA 2I38A 4CQ1A 2CDQA 4DUYF 3GU0A 3QRQA 3V4IA 3HHEA 1LK7A 3OFHA 1N48A 5A8WB 4A8KA 4CH1A 2KM8C 1U26A 2XS5A 3OXGA 3JYTA 8RUCA 1N0UA 2VDHA 4LFCF 2ZH7A 1N88A 1XJWB 4C8KA 5DG8A 4C8YA 3EM1A 4JV0A 3W9HA 1FKPB 3V6DB 4QU6A 2N3LA 1Q81T 1TFYA 1Y7PA 1WI6A 5HVFA 2OGUA 3EDRB 1ZETA 4I2QB 2VPWB 2QEXS 5KFSA 5IC6B 4B3OA 2LDIA 1SQFA 3PACA 3CJTA 2W01A 3NP5A 1EB0A 1S4EA 4JI8F 4G1IA 1VDHA 3LPEA 4M5HA 2YNHA 2MTLA 4YUDA 4ZN3A 3DXBA 1EZZB 4M5JA 4FVMA 2DPJA 3EZUA 5FIIA 3HSZA 3AOAA 4C3MA 4J5OA 2XNQA 3TAQA 4NEYA 2KL8A 1H6KX 3A12A 1A0OB 1RT6A 1YJNS 3ENWA 4B3RJ 2EKYA 3Q8SB 4NEZA 1FX2A 1IBKJ 4LSZB 1ULRA 1D1UA 5D0EA 5A76A 1F9HA 2DNHA 4ZLLA 2FDNA 4G1PA 5DZ7A 1NHUA 4EWTA 4OZ2A 3SFGA 3B4MA 3OBIA 1XMQJ 4LMZA 4OHXA 5GMEA 5RUBA 3OL7A 1N0VC 3H40A 2AEJA 1JNZB 2QA2A 4WE1A 4DR6F 4OI2A 3B8HA 4OL8A 2BE2A 2I9SA 3H4BA 2UU9J 2BACA 4DV0F 3A8KA 5HQMA 3Q2SC 1JLGA 2RDDA 2BXJA 2F1FA 1N32J 3L7PA 4DV7F 4ZVGA 3ZZOA 4OYXA 3RUBL 1U6FA 2DXDA 3BQ1A 4F50A 2WK4A 1G3OA 3OSPA 1UVJA 1U48A 4WFYA 1LWXA 2D9OA 3Q22A 1SL1A 5IWAJ 4LT6A 2YNGA 1ZM4A 4A8YA 3OUYA 3LUYA 4H4MA 2X3GA 1E6VA 4UUWA 2COLA 1D09B 1RWMB 5C24A 2J9CA 1SI9A 4FXVA 4CLYA 3HJVA 2L9WA 5L1JA 4JI2F 1K47A 1HNWF 1TKZB 3KOAA 2C42A 3KHGA 4XO0A 3NCRA 5LXRA 1L3TA 3ZNUA 3T1YJ 4LVNP 5CD4H 4KY3A 4HKQA 1BHNA 1FK9B 2VD3A 1VK8A 2VODA 4KPYA 4Y2MA 2JVOA 2VPYB 2XLJA 1T94A 3QSYB 3TA1A 3UO0A 1GXTA 4Y2IA 4FPIA 4DPXA 3RBXA 2ZM6F 2C3OA 2IAJA 1N33J 3CDAA 5L39A 4KGVB 1VQ5S 1CJKA 1KTVA 4CLSA 4ZVUB 3LP2A 5A2QY 2KVIA 2MHNA 3G87A 3SDEA 1NJIT 3BGLA 5IT0A 2R8GA 1VRUB 2XCPA 1FXDA 2YX1A 4ATNA 4NI2B 3NBPA 3FFIB 3FCHA 4DQPA 5KFIA 2KJWA 2VA2A 4L3NA 2DO0A 4KTQA 3CDBA 2B4UA 3ZZZA 1FJEB 2XS2A 2UXCF 2VFUA 3L9ZA 1HD0A 2QT7A 2HYIB 3WC0A 3M30A 1KTQA 3LPYA 3QGHA 1TUGB 4DPOA 4O3RA 1XMOF 4NI2A 2JX2A 3CJ8A 2G9OA 4DWIA 5LJ5Y 1SXLA 3MGJA 1UA1A 1S1UB 3GPAA 2Z30B 1GT8A 4KV8A 4ED2A 2QYGA 3TA0A 3GP9A 4R0EA 1H2TZ 1NEEA 4ZIVA 3OL6A 1BC6A 4WZQA 2UV8G 2VPZB 1S6OA 4EBCA 4PG7A 2F4VJ 3I32A 2FIUA 2QE5A 2OEMA 1MROA 3MOJB 2B6AA 3JSYA 3IS9A 3EGNA 1HYSA 2YKMA 5G0RA 5AXKA 2HGNA 1S0OA 4X66J 4NXMF 1M90T 9ATCB 3M8YA 2JZ5A 1DURA 2NPIA 4FYXB 1ICEB 1HQUA 2FYXA 1VQ7S 1Q53A 2OFGX 3IBCB 3TAMA 2LQ9A 1L3VA 3V6JA 4DI6A 4K4VA 3T6JA 4J9QA 5E3CA 5HMZA 3Q8PB 4KSEB 3KNGA 2R7QA 2W24A 1KONA 1YBTA 1C4AA 2V4QA 1GXUA 3WIVA 1F9EB 4HT5A 1Q82T 4WBFA 3WX4A 3TAPA 4TY8A 4NLSA 2AZ1A 3DN9A 4DFPA 5L1IA 1EETA 4AXJA 5E7OB 2HBZB 1EP4B 4DUTA 1XN9A 3MM9B 2A10A 4Q2MA 3KHLA 2CAJA 3PR5B 1RTIA 3B78A 1B0PA 4LF7F 3PKYA 5J2MA 4LR9A 2APOA 3TJ9A 2KFZA 2ALZA 3KLIA 2QLBB 1UJ4A 1GAOA 2AYBA 3GG0A 3MF5A 3I82A 4KFBA 2ATCB 2FLPA 1ZA2B 4PWUA 2ZUGA 3W64A 1V3RA 1PG5B 2MZ1A 3PEJA 3MAAB 2F3JA 5GMKa 2CPXA 4RR5A 1N5YA 1NK0A 3SQGB 4QPXA 1S59A 3SQOP 2HNZA 3BO4A 3HX9A 3ET6A 2C3UA 2N82B 4I64A 2FHJA 4LSNB 2RHSB 1RWOB 3D1QA 3V4MA 4UZCA 1M1GA 1U09A 5KFNA 5T14A 4DSFA 1AUDA 3JS9A 2BKPA 2F8HA 5F0WA 2GO9A 3TP2A 1T9TA 2HZCA 4QJVA 4CO1A 2XWYA 1NDKA 2MQPA 2E1CA 2MQ8A 1V3ZA 4X4NA 5H1SV 1AT1B 1H7WA 4YHHJ 4RNOA 3VHQA 2VHGA 4CDIA 4RPFA 4DUZJ 4IUFA 3DI6B 3A3PB 3MD3A 5CAAA 1AA1B 1NZ8A 3G86A 5C7PA 1RAEB 3JTPA 1NLKL 1BQXA 2IIHA 3KDOA 2L3MA 2A0FB 1KVIA 2C28A 2VDIA 3H5YA 2NS1B 4NLWA 2V63A 3UNGC 2ZVIA 2EKNA 3DLKB 3VAHA 4CRJA 3ILLA 3DXSX 5J1NA 5GAGU 1T11A 4LRDA 2W2NP 2JH3A 1CG2A 3IRWP 1PSDA 2CJAA 1BMQB 3I0RB 2A18A 1LWFA 3BN4A 4Y6IA 1TK8A 4AYBD 3CCTA 1LW2B 3UVJA 4F3MA 4ZP6A 3BO3A 1HMVB 1ZAVA 2M70A 3VALA 2FZCB 1FESA 4E2FB 4RW6A 3TUIC 4OYPA 3KLFB 2ADCA 2HVDA 3GIIA 2JSXA 4OJGA 3UI3A 4PR6A 1NU4A 2D3OR 2HFUA 2D3UA 3UR0A 3RAQA 3AJDA 2O67A 2YWKA 4I4BA 2LQJA 3K57A 2KN4A 3UD3P 1UZHA 4MYTA 3TX0A 3KJVB 4QZVB 3V2UC 1IR2A 2WB1D 3TVYA 2UUCF 2J0SD 3DOMA 3RR7A 1FJGF 4JI0J 4NCGB 2NUHA 1FXLA 3EXYA 5DDOC 2WW8A 2FZGB 3BH6B 1YRTA 1YLXA 1SV5B 1XR5A 1YIJS 1SKRA 5L9NA 1SL0A 4AD6A 4S0MA 4JI5F 2H54B 4P6QA 4M94A 2BQ3A 3Q8YA 3CCMS 4OIXA 3FC9A 1U2RA 1JK9B 3FNNA 3MM6A 1U7LA 4LQ3A 2WSCC 2VG7B 4DDFA 4ERDA 3CO9A 3VR1A 1WWHA 4NCGA 1P1LA 1UFWA 1KKHA 4NLPA 4DCPB 3NAHA 3DRSB 2PDAA 2KDOA 4P10A 5DM7Q 1BQNB 1CJVA 3MUMP 4ZP7A 1HI1A 1N56A 2WVDA 1LW0A 2OD6A 3J81Y 3JSMB 4DSJA 1TV6B 2BANB 4IG0B 2R7RA 2PT0A 2IM0A 2KO1A 3CD0A 2XM3A 4X4VA 2C2KB 3V81B 3WHIA 1UJ6A 4ED3A 2KYXA 1FDAA 1W2IA 1H38A 2A1BA 5IC4B 4WFXA 2NZCA 4K2JA 2YQ0A 4WYWA 2VQFF 3DRSA 4ZITA 2G0JA 4LR7A 2IMWP 3Q23A 2W2OP 1DQAA 4TYBA 3RRHA 2FPHX 1HNVB 2QTWA 3PYFA 4KO0B 4ZPDA 2B5JA 1MN9A 2N7CA 4U96A 4ZVSB 3DGVA 3C16A 1HHSA 1S6PB 3KG1A 3HZEA 1TL7B 2MKKA 3C14A 3HHLA 3BBCA 4G6VB 2E1PA 1GQEA 5BJRA 3D66A 1R6VA 3M8QA 1TK5A 3PRBA 4G1QA 1ZZNA 2HQ3A 1VQPS 2BOPA 4JV5J 1SKUB 3N01A 1TMMA 4IFVA 1GH8A 1UZDA 3IG1B 4I2PB 2ZBPA 1JXEA 4BLGA 1YITS 5KFEA 3Q2TC 1RKJA 3AT1B 5K8PA 2UVVA 3MPUB 5EDWA 2ZFHA 2DGTA 2NSBA 5I42A 3EVOA 1DTQB 1O51A 1Q8BA 4LF9F 3GB0A 3QWPA 4EFAC 5F3TA 3W60A 1F1BB 5HLFA 4Q7AA 5EWGA 1RT2B 2XWXA 3DLLQ 2GFFA 2HAFA 2E5HA 4X4OA 1U45A 3FBFA 2UXBJ 4OI6A 4B3RF 4CLPA 5CCMA 2RD5C 1IBKF 1N5VA 2VG5A 5J2QA 4PQUB 1I51B 3D2WA 2IMOA 5L9XA 3G82B 2V2ZA 1HNXJ 1MSWD 4DX5A 1FNOA 4LFBF 1QD1A 3MPYA 2ZDOA 1Q5YA 4UOCA 1JJ4A 5DQGA 4LF1A 3DLEB 3P6YC 3EUNA 4IR9A 3GLJA 2UU9F 4QYZJ 4ZVHA 5HP1B 3S6EA 3FK4A 1RHMB 1S1WB 4IKAA 2O1PA 2DR6A 3DOLB 2GIRA 1N32F 1P1TA 2ZH4A 4OHYA 2DK2A 4LF8F 1VBKA 2CWXA 2QZ8A 4M1KA 3PIPQ 4O3NA 4O0IA 3IO1A 2VH7A 5CYMB 1X4BA 5IWAF 4DPYA 5IXUA 1R8BA 3T3FA 4TU9A 3TI0A 2KXNB 2DXFA 4ETZA 2I8EA 2GCFA 4LF5J 1H74A 2CJKA 4JB8B 1RT3A 2DNNA 1E6YA 3NWRA 3KKFA 1NK5A 3VTIA 2GAGC 1DQ8A 1RT5A 2HHSA 2IBKA 2V2QA 4NA3A 5T41A 1HPZA 2M52A 2JL9A 1ZM3A 5F8HA 1EX8A 3T1YF 2J8SA 2HHUA 2W1BA 2GA7A 1JJHA 4HI2A 2YWEA 1OMSA 2QL7B 3H90A 5D4OA 5A8KB 4NLTA 4MFBA 3PG9A 1HR0J 4ZJOA 5DGAA 2R7UA 2CZVC 3UDVA 2ZOMA 1S9GA 1RU2A 1N33F 4Q43A 2FLNA 4WFAQ 4MH8A 2MLYA 4DF4A 2B9XA 3GFXA 2W9CB 3F56A 3D5MA 4NA2A 2R9LA 2RJZA 1ZOTA 3Q0AA 4C8MA 2DH7A 4URQU 2VOOA 4ZIWA 1HARA 4ZVTB 1VYAA 3QGPA 1WHYA 3NS6A 2GQ2A 1OIAA 5ETQA 1O0PA 3R5CA 3J7Z5 3IR5B 2X1FA 5A8RB 2KJVA 2DIVA 2E1RA 3G6YA 3I5CA 2GJIA 3PR4A 3O2IA 1TP7A 2QJ3A 4P2FA 3A8IA 3R5BA 2C2ZB 1H98A 4KGZB 3E51A 4CLLA 4ILMA 2VIHA 2ERRA 4ILLA 5CABA 2FUG9 2EWHA 5HJYA 4Q5VA 2OMLA 1N5SA 4KGXB 3O3LA 2WOMA 4NOHA 1FRHA 2YKNA 3HVTB 3UCZP 1D9FA 3I0SA 4ZS6A 4E8UA 2RQ4A 2LEBA 2V50A 5B09A 2DTJA 2NYHA 4DG1B 1WOOA 5IQ6A 2BM0A 2X51A 3RB0A 3SZ2A 4I67A 4DJBA 3BPSP 4DV6J 5I3PA 3D54A 3QLHB 2F4VF 4LVOP 2Q6BA 4RLEA 1RYRA 2BJ7A 4CYUB 1TR0A 4X4UA 4P2MA 2CWKA 2VB6A 1I94J 5CZXA 3J7AN 4X66F 3EJMA 1YI2S 3RJMB 1RAIB 3FCWA 2E29A 5HO4A 2D7SA 1YSJA 5A0YA 4F26A 2HBRB 8ATCB 5KG7A 3FSIA 1VRQC 2LECA 2W7PA 1HWKA 1S5ZA 3U1LA 3TVKA 2VG6B 5B7WA 1IBLJ 4C0HA 1A7GE 3BM7A 3OL8A 1PIEA 2AEFA 5CYJA 3MWBA 4B9VA 2CNNB 2CJYB 3NY0A 1UPPA 4KKOA 1EAYC 3CW2C 2ZKUA 2QG9B 3CULA 5IS2A 2DNKA 1F0XA 2I5JA 3ZTQA 5E33A 4I7FA 2FHOB 1J5EJ 1Y9OA 3KK2B 2HLUA 3EE3A 1S9EB 3JQKA 4WJBA 1DAXA 2XSJA 4C8OA 2I2YA 2BQRA 2ZBCA 1RTJB 1M0SA 3HKWA 4JI4J 3ZXWA 3V5RA 3ZZPA 5AE3A 1D9DA 1TL3B 1D8YA 4DV2J 3UDCA 4M5GA 3BGRB 4F67A 3K5LA 3GYXB 1S76D 2H9ZA 3R7SB 3JXOA 2I0XA 4IH6A 1ACMB 2KYZA 4K4YA 2AIRB 4JBCA 1KQSR 4GVBA 4DR4J 1C1BA 1SL2A 3CMES 4OHZA 3VWSA 2JC0A 2HGMA 1H7XA 3BGFA 1UVNA 5B0CA 3KK1A 3PFEA 2VASA 4M5MA 3E3XA 2RQCA 2AYEA 3PNIA 1MWYA 5L38A 3KLEB 4LFAJ 3FBCA 3BGRA 1WD6A 4NLYA 4B08A 2HHQA 3IWLA 4KT0C 2K2PA 1YJ9S 3M32A 2OPRB 2QX0A 1ZTTA 1FKOB 1MMNA 4CWBA 1BUXA 1ZTWA 3EGVA 1SIWB 4TQSA 4DUZF 5HQLA 4OYBA 3OR1B 5HMWA 3DMJB 1SJQA 1JLBB 2GGPA 1AB8A 2PD1A 5H9FK 4E98A 2XYPB 2GHVC 4DFJA 1R0CB 3VAFA 2BJ1A 1S97A 2DEIA 2DPIA 2LCWA 3HI9A 3ZTRA 3N5BA 3BPDA 4OZNA 4UW2A 1YBAA 2E5IA 3NG8A 2NXUA 2V4JA 5HANA 3B6BA 1T02A 3CNQP 3VGVA 3PY8A 1BD6A 3O5TB 5C42A 4USIA 1VQSA 1H2VZ 1W2BR 3M6UA 4EK2A 3ENVA 2N3OA 4P74A 2GIQA 5D4PA 5EWFA 4PXBA 1S7HA 2ZITA 4PG4A 4I0WA 2QFIA 2QL9B 3W2WA 3F73A 1YJRA 3PXGa 3UDLA 4Q44A 3G9CA 1RP5A 3TYTA 3IGNA 4ECUA 2GJFA 1NK9A 4NLOA 1WOSA 5J1EB 1Z2LA 3GIRA 1VLYA 1I1GA 2LVWA 3DM2A 4JI0F 1ROFA 2CNOB 4J7CA 4NZ0A 3NGDA 3F0NA 4TQRA 2ZUAA 4MTPA 4PWDB 2NXJA 2ZE2B 3CO0P 4RW9B 1RAHB 1WC6A 2CPIA 2V8HA 3QJJA 4KGMA 1Q8KA 1TMJA 1JKHA 2YWFA 3UCGA 3HHDA 2DT9A 2H4WB 4ID5B 2OO4A 1QLNA 1LXJA 4B3SJ 3VAJA 1U8SA 1K0VA 3MECB 3I87A 5DQHA 1BQMB 3C2PA 2XGQA 4I69A 2XQCA 3OFGA 3D9BA 2J9DE 5HBMA 1X4CA 4RZRA 3OXFA 3NGSA 1PJ7A 5F8LA 1RAFB 3MPWA 4I6AA 3O44A 2YKAA 2MKHA 3CIZA 2MGZB 4C0OC 2FJDB 1HWUA 2DGUA 2MZTA 2HFVA 4YFUA 2RRNA 2IVMA 1RTHA 1YVFA 4PG5A 3SV3A 2ZNYA 2CVEA 1A9NB 2KI2A 1RAOA 1N34J 1AW0A 3HFVA 4MKVA 2OD4A 3UN5A 2NXCA 3CMQA 4GO5X 2KU7A 1KP6A 1S1XA 5KG6A 4M5DA 3FZBA 3SI8A 4H4OB 2HHPA 3OLBA 3EVWA 2Z2ZA 3ISND 4IOBA 2ACYA 4XIUA 3R5JB 1KLMA 2QSWA 3LAKA 3BDPA 5DG9A 2E9RX 1MU2B 2ZWOA 4LR8A 1DTTB 1FEEA 3RW6A 3OSNA 2XYGB 5KAKA 1F2GA 4IQXA 5KFWA 1YG0A 1S6QA 3CXCR 1FXRA 1R8PA 2G13A 3IGVA 4O3SA 4WKYA 1OO0B 4JI1J 4ZVQB 2ZH9A 3M8PA 4ZMMA 4U95A 1NK7A 5LT5A 2PC6A 1WC1A 3OT9A 3FMWA 2W25A 1X60A 4ILRA 9RUBA 5B0FA 1FNMA 1FVSA 3TANA 4LIWA 4N56A 3PX6A 4EU0A 5AE1A 3W65A 4YB7A 1T95A 5KT2A 3FGVA 2WRMA 2OEJA 4DMZA 7AT1B 3NEKA 1RE1B 5DO2A 3W62A 2LA6A 2R4FA 4I68A 2XTJP 2KFNA 1HBMA 2AJ1A 2WW4A 4A47A 2Y8YA 2VJVA 3FEYB 3AH6A 4RO0A 1N6QB 4X2BA 2UUWA 3G8QA 4RBTA 2IJRA 1H3DA 1CQNA 2XYHB 2GX8A 3Q8VA 4HTJA 3LWLA 4DL6A 3HSJA 2GVDB 3B54A 4QIFA 3MAQA 2YNIB 3MI7X 4P75A 4RW4B 1VOMA 2UXBF 3M8ZA 1MMLA 1OY8A 5D78A 5J2PA 3OHAA 4H4KC 1FF2A 3VAMA 2RAQA 2VC1A 1HNXF 2DGQA 3EGZA 2ZBQA 2DHAA 2D9PA 4Y28C 2GV1A 3NXZA 3HM9A 4NLGA 3J81j 2V0NA 3KUGA 3R27A 4DF8A 2MZQA 1SC1B 3CSKA 1S99A 3M2RB 3LP0B 4RW8A 3AHPA 1FE0A 4J9OA 1DY3A 1YJ7A 3AD8C 1FWPA 4DOZA 3T1HJ 3KK3B 1SH0A 2RRBA 2ZVSA 4CM2A 2QLFB 3MM7B 5KT4A 4RNHA 4EYIB 5E3AA 4HDGA 3GIJA 5GAHU 3DGPB 5KOWA 4KR0B 5AJ3J 3AOBA 4XPEA 3AY0A 4DR6J 3MEEA 3UE2A 1B7YB 3D0IE 4LF5F 3LP0A 5GADI 1U47A 3MD1A 3RBEA 1EQMA 2DGXA 2FJWA 4EO6A 3QIPA 3R6GB 2V9KA 2HBQB 5L46A 3J7ZT 4MAKA 3KMSA 3UD5A 5KFLA 4ER8A 1B7FA 2J6SA 1XNQF 2IYGA 1IJFB 5KT5A 3DHWC 1RHQB 4ZKAA 2IRXA 3PDNA 3OR2B 2HW3A 4OZ5A 1HR0F 2QMWA 2H1YA 5D0GA 1FFSB 4B3TJ 5KFQA 5D8HB 3W5XA 4RUCA 1U4BA 5A6PA 2Y1IA 2ZH8A 2OPPA 3MMBB 3AQOA 3H5UA 1Q79A 5HQ8A 1HLWA 3LO3A 4CLWA 3ONQA 5LSOA 5CD4A 1NPKA 4Y00A 3MDFA 1NHVA 1BWVA 3KNAA 4XDDA 1I3OB 2Z56B 1HHTP 1KQKA 1QTNB 3QJLA 4UUXA 2CPZA 1UWBB 5KG0A 2ZM6J 3I56S 3H2VE 3H4DA 2IRYA 1FRMA 1V6HA 2NXEA 3J80Y 1JLFA 1QSSA 4P72A 1C1CA 1KFDA 3CJ4A 3LGMA 2V69A 1QSLA 2C22A 2MLZA 3M1VB 2YY3A 2GVZB 3QPIA 3DNCA 1M5PC 5DLGA 3LGNA 3PJXA 2MKYA 5KFVA 4JI7J 1UAWA 1KRPA 2JOQA 2FJXA 5DRKA 1JJCB 1OJ4A 3K8VA 3G8SA 3TJAA 4J9PA 3CGIA 2K06A 4WP9A 1LFPA 2NR0A 3MCMA 2UUBJ 3UPFA 2RMLA 2M8HA 3G8TA 1T9YA 4A4JA 1RWVB 2ILYA 3DRPB 2XLKA 3QT7A 1CULB 2Z2LA 3ELHA 2LP4A 3ADAC 4H4KA 2JEGA 4L74A 1RCXB 1R31A 3D3CJ 1M5VC 1HQEB 2CQ3A 4MT1A 2MQLA 3LQVA 1U1QA 1FA0A 2AF6A 2CQGA 1QVGR 4CT9A 3IA0A 1IBLF 4O4RA 1FI4A 2CG8A 4PXEA 5EX0A 4YY3J 3QRPA 2Q79A 2GMJA 3H2UB 1SJFA 2DKOB 3HFZB 3UFCX 2RNEA 4ZPWR 3R7NB 3D6MB 4ECXA 3KJNB 2AX1A 3N4WA 3D1HA 1U25A 3S01A 5JJBA 2YKPA 1FCAA 3SV4A 5HATA 1CJUB 4I6WA 4HHHA 1PCAA 1F5CA 1RT4A 2DNLA 1P9QC 2VFVA 1VQNS 1T03A 1RK8A 2W4PA 3DYAB 1LWEB 2OH2A 4I56A 4BS2A 2BW2A 4DHVA 1J5EF 2Y0BB 4DV1J 1PJ6A 3ZZTA 3PJ9A 4YDDB 4ZCKA 3CE8A 1H0HB 1G6BA 1VRTB 2FJBB 3JTOA 4UQTA 2LQ5A 1S0VA 2HGLA 3NGRA 1L3SA 2QRRA 2R2TA 2AZ3A 4DSKA 4DPWA 4LF6J 2KVQE 3DLGA 5HJXA 1B0TA 4NE9C 4Y34A 1XNRJ 1UWAA 1R0AB 3RTVA 1QTMA 2VPXB 2IVYA 4K4ZA 3TNVA 1SJ3P 1Y0HA 3H20A 4LF7J 2H65B 1S4FA 2FHJD 4DR4F 3H59A 3PIOQ 4R5PB 4OQJA 5L1LA 1Z1ZA 4RW7A 1XTZA 1NK4A 5AXMA 4ZLPA 4YDXA 2XZTB 4DR5J 4W90B 4K4WA 3RB6A 2E7XA 4CZCA 3CCWA 2KT5A 1GX6A 5CQGA 4YS2A 3GIKA 1TVRA 3R2DJ 3R6LB 4LF4J 3U27A 4LFAF 3MMAA 4C8LA 4LJMA 2F7VA 3HD1A 2IYIA 1T9XA 4Z7YA 1T05A 3IM9A 1YHQS 1KSPA 3QQCD 1SKWA 3HVRA 4DV3J 2DEJA 5ADZA 4Y2KA 3C6TA 1HIYA 1F3VA 1NZAA 3IWNC 7FD1A 5BYRA 1IKVA 1WF1A 5BYSA 1GFWB 3DU5A 3F41A 2DNZA 1ZZFA 4ZJQA 2PE8A 3SCLE 2VKZG 1KNZA 3JSBA 4UY8T 4NL5A 3AB2B 2B8PA 3MMCA 4CLTA 5BYQA 5DM6Q 4FF1A 5IM0B 4DR1J 1NDCA 1H73A 4QQBA 2YNFB 5KFFA 2GZOA 4NLQA 2R8HA 3GJTB 1TTHB 2JJ4D 2IM3A 3N9UC 4PWWA 4L6V3 2W9BB 1GEHA 1X4GA 3KLGB 3HO1A 1VBZA 5L1KA 3KUEA 2EXUA 5CHCB 3CD6S 3QATA 1WHXA 3FZ2A 2FVCA 5I3UA 1IXKA 5F9LA 3W3SA 1WC5A 4DV4J 1X31C 3AB4B 3KMQA 2XMJA 5GAEU 2V34A 2CNKB 1Y3JA 1R3NA 4DX8H 4AL5A 4U7UK 1RGVA 1C0TA 1DJ0A 1EJ7L 2W9BA 3Q83A 1IVZA 4UQGA 4BCAA 4DFKA 2JC1A 3BYRA 4Q0BB 1V3SA 4F04B 2YTCA 2O3DA 3CD7A 3FUYA 4USTA 2OPQB 3R3TA 3PW4A 4EO8A 2RUGA 4DQIA 1RWUA 2GJ2A 3F44A 1OQ6A 3UDEA 3NMRA 1VQ8S 4CH7A 5ETRA 3GV5B 5E41A 2LYVA 1TL1B 2MLXA 3PHEA 3D3BJ 2HSEB 4QIGA 3AXKA 3M2VB 3QFHA 3MR2A 1LQ9A 1I5OB 3LF0A 4HLBA 1F60B 4R8UA 2V6AA 4DQQA 4MKBA 2LU1A 2E9TA 1IQZA 1JLCB 1UL3A 4B3SF 4PABA 4C11A 4A8MP 2AU0A 3D67A 1PILA 1RT1A 3Q24A 4BHQA 4ED4A 1Y00A 3W8GA 2C2OB 1J5OA 3SCKE 4WIQA 2YWHA 1GK8A 4WKRA 2DISA 3NLCA 4PUOA 4ID8A 3C15A 2RKIA 4N76A 2ZD1B 1M5KC 1FFWB 4M5LA 4A8OA 3MEDB 1TZ0A 1F6TA 1U1OA 4ZHRA 1N36F 2M3DA 4JP8A 2HQDA 4OX7A 4ECRA 4RJVA 2NREA 1N34F 2LMIA 3KXDA 1RJJA 4ZA1A 3CCLS 3HCXA 1RHJB 4UOHA 1IKXA 2U1AA 1WSVA 4F4WA 2CIMA 2UVUA 3ETMA 3UCUP 1BXNA 5ETSA 1U0SA 3UWTA 4CTAB 5KFPA 1C0UA 3S8SA 4N41A 4A8QA 5EHHA 4DU7A 2AP6A 3FEXB 3TQ1A 1UVIA 3VQSA 2FVSA 1S0MA 4F8RA 2HRYA 3BBBA 2MMYA 3CJ5A 2J7UA 4WP8A 3CJKA 3DU6A 2WVBA 3HHLD 5KFBA 2CPJA 1RCOB 2IC3B 2QN6B 3N6MA 1KC8T 2W2PP 5THWA 1NKCA 3QYYA 2CQ4A 2K1RA 3BSCA 4CP5A 3DFEA 3LGHA 3LH2S 3VCDA 1RWPB 2D1CA 4IDKA 2FC8A 2CQHA 4NYZA 2E44A 3ICLA 3GE9A 4PG6A 3NS7B 2PIIA 4HACA 2YH0A 3CTRA 2K8GA 3TJ8A 1S1VB 2B9WA 2YKOA 2CQ2A 1Q8IA 1X9MA 2HNDB 2YWWA 5B0AA 1UJ5A 1Q7LB 1HNZF 1M5OC 4EMDA 1F3FA 2MQQA 3WDOA 4ZPBA 1TUWA 4J9LA 3ZTPA 2D3ZA 1RXOB 2D41A 3P8BB 2CPHA 2BUNA 2JLFA 3M2UA 2EI5A 1KS2A 3MOZA 1UPMB 1DARA 5JVHQ 3T5KA 1AFIA 3LANA 2G0IA 1NPPA 3SSQA 5GMDA 3IMQJ 5A8WA 5J2NB 1KFSA 1ZH5A 1LWCB 1Q78A 1ELOA 3K89A 3EWGA 4JV2A 4A8SA 2RS8A 1WKKA 1TK0A 2ASLA 4LF9J 4X4RA 4OZ0A 3EYZA 1FKPA 2AW0A 5KFOA 4IO1A 3V6DA 4L72B 2IA6A 2M2BA 2JLGA 4I2QA 3P5BP 2A2DA 2C2RA 1CBKA 4NLRA 4K5RA 4X62J 2AEMA 3KYLA 3MFIA 4TY9A 2QV6A 3T1HF 3G96A 5H9EJ 2M5YA 4WU2A 2DR9A 3BSNA 2HQIA 3J7YU 2WAQD 3HFKA 1X0PA 4YB5A 1R43A 2OLWA 4TNOA 1WSRA 4LFBJ 5AJ3F 2OTLS 4DL2A 2XZDB 1VC0A 3LTOA 2FVPA 5KT3A 1XWLA 1Y5IB 5HROB 5E3QA 4QIVA 5KG1A 3GSDA 2ZWPA 5ITHA 1MMDA 4P9SA 1TELA 1NM2A 5KFRA 3WBZA 3HJFA 3W5YA 3K58A 2P2CB 3POTB 4LF8J 1AZSB 5B08A 4KE5A 4FBTA 5HI7A 1K73T 5IV3A 1IBCB 1VK3A 5FLXY 2IDLA 2A2CA 2PI5A 4MKAA 6AT1B 1EARA 3DRXA 2E5JA 2H51B 4B3TF 2MXYA 4CO0A 4O0NA 1SUQB 2MZJA 2J0QD 4ZP9A 4QYZK 2DNYA 4U8VA 1NH8A 3T5JA 4OZ1A 3PCOB 2R2RA 3TQEA 4EUVA 4M95A 2MQOA 1S77D 1FRKA 4WTYA 3DRRB 1U1NA 1IM4A 2E9ZA 1WC0A 2PSZA 1IWGA 3RAMA 2FGCA 1FHTA 4ICLB 5F3ZA 1XEZA 2CRLA 3AA8A 3D4JA 3QMQA 2V2VA 4Z7CA 3EGWB 2CDRB 3SYZA 1WF2A 1AYEA 2KG0A 2KHDA 3K5MA 1KLNA 4DL0C 1TKZA 2FD2A 3JAMY 2WONB 3MXHP 5GVQA 1TFWA 3PZPA 1FK9A 4PRFA 4WF9Q 1OSCA 1B0VA 5T7LB 4F2RA 2ZZTA 3QO9B 1D9AA 4MIBA 2BM1A 2VFSA 1YDLA 1JLQB 2OAUA 3THVA 2W7OA 3QBCA 1X5SA 2R2SA 3CWJA 2BJDA 3RB4A 3ETOA 4Z2XA 2CPFA 3ILOA 1ZAXA 3OTEA 1FEHA 3TZYA 4JOUA 2DNQA 1CC8A 4DX6A 1S1TB 5C25B 4JI7F 3R1LA 3EZ5A 5CYQB 4BWMA 2L41A 5DGBA 2XY5A 5ETOA 2CA9A 3AD9C 3TX8A 4ED6A 4DS4A 2V8VA 3U1MA 1C4CA 2CQPA 4F4XA 2UV8A 1VRUA 2A6MA 4RWXA 4OI3A 2UUBF 3FFIA 2LQ8A 2OSQA 3X3UA 4IQMA 1C2PA 1X4AA 2OMOA 4B9TA 2CQ0A 2HZAA 2E7WA 2A3JA 3CIMA 1X7VA 1LXNA 1M1KT 3QZ7A 2G2ZA 4I1TA 1HW9A 3OFFA 1RKIA 2V8DA 3MM8B 1LV5A 4W98A 2BX6A 2KT3A 4QR2A 3UN3A 2CQ1A 4YY3F 3LP1B 1G7CB 2RQMA 1Q4RA 2W2QP 1YX2A 1S72S 1UEVA 3NWGA 5KFJA 3M9NB 4HEA9 1S1UA 3LOUA 1D8ZA 1A6LA 1U02A 1CS4B 4FYDA 2ZOGA 4FS2A 4KH0B 3MM8A 2POKA 4X64J 1B3TA 4DV1F 3L95X 4OJ3A 1Y3KA 1SJ4P 3GQCA 3C8YA 1DBDA 3L3CA 2HK2A 1HQ2A 4ZPTR 4ZCIA 1CJTB 1YTYA 1JB0C 1K1QA 3UD4P 2B51A 4LRCA 4J9RA 3PX4A 4EZ6A 4ZPAA 3UW1A 1AROP 3FRYA 1PAUB 4OV1A 4LF6F 5C2GA 2MPUA 2HZVA 2FY8A 2E1MC 4TYAA 1XNRF 1FDNA 3M8RA 4OX9J 1Y5NB 1NB7A 2MJNA 3OJUA 2QA4S 4ECQA 5K14B 4WK3A 2DRDA 2JFDA 4USJC 1N5QA 2QSFA 1RDRA 2NQPA 4N8NA 3C6UB 1NJXA 2IDEA 4Y0FA 2ADBA 1UMJA 2L9NA 1FNXH 2BDPA 1YJUA 4DR5F 3M9MB 3BKFA 1EP4A 5HN0A 1VLOA 4LF4F 3MM9A 1CLFA 1HBUB 3U1NA 3FCVA 4WTOB 2FJAB 4TN2A 2GC8A 1OY9A 4MKYA 2UZAA 1X4EA 2EBEA 4KC5A 1WDDA 4LREA 4DV3F 3DOKB 3R9LA 1IKWB 2XO6A 1TKXB 4F4ZA 4WFZA 3NOCA 4B3MF 1TL4A 1OPZA 3K8WA 2RS2A 2OP5A 3CCZA 3MAAA 2YPZA 4LBHA 1GNKA 3RRKA 5KFMA 3MM5B 5C2CA 1RA6A 2ZC4A 4KHPJ 4OYOA 3SQGA 1GMWA 3BSOA 5FDLB 4DR1F 1NCLA 5KFZA 4Q8EA 2D3O1 1FVQA 3CD5A 2JHEA 1OYEA 3N79A 3DOKA 1UFKA 4ZVRB 3CF5Q 3CMAS 4IFYB 2HVZA 4ES1A 2M4MA 4LSNA 3HHLC 1VBXA 2J6UA 2AD9A 3EPGA 4B17A 5CCLA 4DQRA 2EC2A 5DQIA 1O8BA 3MM5A 4DV4F 1OSDA 4C2MA 4BDPA 4IG3B 1U8WA 3R5DA 3BGUA 4KRWA 4C98A 3MAHA 1VS3A 1D0EA 2XNRA 3OFEA 4X4PA 2QFJA 4RWWA 4IYQA 1J27A 3DI6A 3ISZA 4GC7A 4NRUA 3SSRA 1KR4A 3H5XA 4Y3CA 2VA3A 5KOXA 2R7SA 1FERA 1U0HB 4OYZA 4LIRA 1PJ5A 4IRDA 1SC6A 5E5NA 4PPZA 4F4KA 3MTKA 3H0PA 4DZDA 4F02A 1PGZA 3DLKA 1GX5A 5F8NA 1GTEA 2B7BB 5KFXA 3A8JA 3HSDA 2HNYB 2AMCB 4WXOA 5IQQA 3I0RA 2DITA 2DY1A 4RL1A 1VHIA 3CCES 1JLAB 3CJ3A 3OW2R 4Z37A 2BMBA 1LW2A 4ETXA 3EMTA 1HMVA 3O1LA 2HWHA 4F0KA 1WC4A 3TOQA 3KLFA 3FBEA 1KVKA 2WZ1A 1WG5A 4MYUA 4X65J 3QGGA 1NSPA 5E2QA 2PMZD 5A2QU 2UXDJ 5CH7B 4RKUC 1UA0A 2OPSB 4USMA 1B99A 3I55S 4OMFG 3RW7A 4RBVA 1QE1B 3KJVA 4YP3A 1TKTB 2AJ0A 2CFXA 4Y2AA 2ASYA 4DL5A 3PM9A 1NAQA 3G2XA 2NUUG 2LFVA 4P52A 4MIAA 2UUTA 3EVMA 1SV5A 4KQZA 1B70B 4WFBQ 1TKDA 2VC0A 2DYAA 3OVAA 2BQUA 1T8EA 3OLAA 3MUVP 2HQCA 2M7SA 2QA1A 3SMZA 2LKZA 5KFYA 2L48A 2BOAA 4W92B 1KOHA 4GKKJ 1WG1A 1VR6A 1PAEX 2VG7A 2MKSA 4EI2A 2Q6CA 1R6YA 2F9JA 5K9FA 4JI6F 1QVFR 1HBNB 4P73A 3TEHB 3I5BA 2B56A 4OHWA 5LSRA 4WP3A 1K8AT 4XPCA 2XMWA 4HR2A 1REVB 2FC9A 1PBAA 1IKYB 4YR0A 1BQNA 4RBUA 3V6HA 5LXYA 2XMUA 2QMUB 3JSMA 1RACB 1TV6A 2BANA 1TAQA 4IG0A 2P9GA 2B8QA 3M9OB 2FVQA 4RX6A 1HFEL 3P4UB 1J2VA 2YBVA 3V81A 3AODA 1RA7A 4LRFA 4TLQA 4O4GB 1QUPA 3QZ8A 3IBWA 4ECZA 3EPIA 3N6NA 2BKNA 1UEKA 2EFGA 4CO5A 1JLEB 5E3PA 3E01B 2R8IA 3PO5A 1HNVA 2CQIA 4KO0A 3UR3C 3ZFVA 4I6YA 4J37A 2Y3YA 5IOLA 1OPIA 3D28A 2J76E 1NKEA 3AXMA 4CCHA 1DLOB 4P2SA 1TAUA 2DO4A 1V5IB 3EX7B 2WBRA 4O3OA 1S6PA 4FBUA 1TL7A 3CC2S 5JUMA 2CJXB 3W9IA 3ITHB 2AJ2A 1S10A 4AE5A 3OTCA 1X5PA 2PEHA 4DV5J 3CJRA 2JDJA 2H4YB 4K7QA 4OYWA 4MK7A 1QAYA 3RGIA 3W8PA 4WCEQ 3NNCA 1U24A 2KZZA 3M8WA 4USVA 1HBOB 1CVJA 2XHCA 1MWQA 1FRXA 5D3GB 1VQYA 2ABYA 3I4PA 3D6TB 4YR2A 4DPUA 3A3OB 1HD1A 3IG1A 4I2PA 3DKDA 4X62F 5L8RC 5IFMA 3MFHA 5GAHI 1F2HA 4DN9A 2RH3A 2DHGA 3NCQA 2PMHA 1FTRA 1DTQA 5D4LA 1RBAA 1FJ7A 3Q8RB 3GZ7A 2QLXA 1YK9A 2VV5A 1V9OA 3V4IB 3THPA 4FNIA 5DETA 3NCPA 1RHUB 1GTHA 3JYTB 2X7IA 3BBFA 1RT2A 2KH9A 2RILA 3C66A 3KTQA 2KG1A 1YBUA 5DDRC 3TWZA 4ZVOB 2BVZA 2P6SA 3NGUA 3H5SA 1KD1T 4ITSA 3ZZYA 2UVWA 4OYIA 4DR3J 1VQ9S 1XR6A 1P27B 1TL5A 5DDPC 2OTJS 4PQUA 4RUHA 2CNLB 3B4DA 1PC5A 3GYGA 2YPYA 3M05A 1N8RT 1QDUB 2XULA 3G82A 4KHRA 5AXNA 2OI2A 5F8JA 4B3OB 4YB6A 1AFJA 2R8JA 1N54B 4ECVA 4RU2A 3L7UA 4LRAA 1SVDA 2PA8D 3DLEA 2RIJA 3HSGA 1KOOA 2YXLA 2YNHB 4KGKA 5HP1A 2HQGA 1S1WA 4QU7A 1ZM2A 1L5UA 4ES2A 3DOLA 2VQEJ 5DS7A 4HL9A 4F3QA 2IJFA 2FJEB 2MDAA 1AXQA 3TZWA 4DLGA 5IV4A 3LALA 2HK3A 3S7RA 1HHQA 4O23A 1UVLA 3CCRS 2EW9A 5LMNJ 1RT6B 4RUAA 1XNQJ 5CYMA 3VAKA 3U7JA 1NB2A 2RT3A 1YZ7A 3GCXP 3GJSB 2PO4A 2ZOFA 3UQSA 4K8RA 1NUEA 5KFUA 4J9MA 4U6PA 4QCLA 3H2LA 2IY5B 1UETA 3PVXA 3GV7B 4WE1B 1RAGB 2CZ9A 1IUJA 2L9DA 3FKBA 2J0WA 4DPTA 1IM6A 3PW2A 2BE2B 2IJNA 4UF4A 4FYVB 1JLGB 2KZMA 5KT6A 5A8KA 5KG2A 2XBPA 3KG0A 4ZCLA 2DNGA 1AUSL 3AA9A 4ECTA 3PFOA 3V6KA 3D7SB 2VJUA 4KIAA 2Y1JA 2BBEA 1WF0A 1SQGA 3G71S 2YNGB 1JXLA 2MSSA 3SEOA 2W9CA 5JVGQ 3OUYB 1R7IA 6FDRA 1VIXA 4H4MB 1E6VB 4QBUA 1WKJA 2F65A 4ED1A 4G3IA 2WVFA 3K2YA 2BR0A 3G4SS 5C24B 3BV8A 1U1RA 3MHYA 1YRUA 7FDRA 6FD1A 1CQMA 2G1HA 1NJWA 3EDQB 4RNNA 5A8RA 4OZLA 4KAIA 3DHXA 1WORA 2YWGA 5C5JA 3GG1A 5DDQC 2BJ9A 2CPEA 4NCAA 3KDNA 1KQGB 4UOGA 2E1AA 2DY9A 5B0DA 4D3GA 4YB1P 2LLZA 4OI0A 1QM9A 2QMXA 4A46A 1WTFA 4FXDA 3A13A 2P9CA 1PYTA 3CT9A 3M6VA 4CI0B 2WSEC 5I3QA 3PW7A 2IAJB 3A3NB 2KXHA 2LU2A 3RU0A 1SQEA 3HVTA 2HWIA 1RT7B 4PYDA 1CJKB 4ZN1A 2B0GA 3LP2B 5GADU 4DG1A 2BKOA 3SDEB 3FRZA 3BO2A 2F8MA 2XO7A 4B02A 4X64F 4B9LA 3NBPB 3J81U 5ETPA 3GJRB 2KM8B 3QLHA 5BR8J 2O66A 4PXDA 2R7XA 2HHVA 5BXIA 3IAS9 4CYUA 2J8AA 1ZS6A 1RLCL 3A4TA 3H7HB 3M30B 4C0BA 4OJ1A 3CCJS 1RT7A 4NLVA 2HBYB 4F2SA 1F5BA 4NLXA 4WPAA 2OELA 1REGX 3P5TL 3BKTA 3L7OA 2EPIA 3W5ZA 4F3OA 2IM1A 3KJQB 4W4MA 4USWA 4P71A 4OX9F 2V8GA 2AYGA 1EKSA 1KDNA 4XK8C 1TUVA 5IT4A 1VHFA 2VG6A 1FX4A 4KV8B 2QGFB 4YR3A 3NOGA 2BEFA 2MKIA 3WQPA 3MEGB 1JX4A 2ZJPQ 4GC6A 4N77A 2H5EA 4F36A 3WZ0A 2CPDA 1MROB 4C8NA 2B6AB 4OYAA 2ZH3A 3IS9B 5F8IA 1HYSB 2YKMB 5G0RB 4GMKA 3KK2A 3GYNA 5ETVA 1N52B 1S6UA 1LEOA 3P49B 1XC9A 3CCSS 1VQKS 1S9EA 4NYPA 3MR7A 3ILJA 2MY7A 3AOCA 1HQUB 5D6GA 3T9ZA 3GILA 3TAMB 4DXLA 1RTJA 5KG5A 3RG6A 4UZBA 4L75A 2NZ4A 5IT9Y 3MEGA 2CJ9A 3QNWB 5LOQA 3Q86A 4J9NA 1VQOS 2AJ4A 2A6OA 1TL3A 3S1TA 1JMTA 4BWJA 3FQLA 2N7YA 2ROEA 4TY8B 3H25A 4KHPF 2G4BA 1S9FA 1Z4UA 4NRTA 3P96A 2OSRA 4NZ6A 1EETB 4J91A 2B9EA 2BABA 1BWEA 3OTBA 5I4MA 2X1BA 2AV5A 2ZBRA 1HA1A 2EG1A 4PQAA 4K4UA 4KJIA 1RTIB 3WIUA 5GAEI 2MHEA 1X8DA 5J2MB 4NX9A 4J9KA 2R7OA 2IBOA 3KLIB 3ZTSA 3MURP 3KLEA 2HVEA 1NRKA 1I6JA 4ELUA 2GQCA 1M5SA 1XK8A 4JV1A 5ETMA 4ECSA 4KFBB 3QAEA 2HAIA 1SKSA 2OPRA 5M2UA 3DLBA 3US5A 2GQQA 4WK1A 1FKOA 3DC2A 2FTRA 3GFYA 4R25A 1N5YB 3IWXA 1RWXB 2HG4A 2D69A 4MK9A 4DL4A 1KQFB 3OR1A 3C46A 5DJBA 3DMJA 1XQIA 2HNZB 1RABB 2F4FA 1ITPA 5FD1A 1JLBA 2NPFA 5F8GA 2KXFA 1VBYA 4WXWA 1V5VA 3N6LA 3TARA 1S79A 3ET6B 2VUGA 1URNA 3NAIA 2VICA 2R7TA 1U1KA 4LSLB 2M88A 1RAAB 5HVHA 4X4TA 4NASA 2GS8A 4UTGA 3ZZUA 3ILIA 3R2CJ 2C3MA 1TQLA 4UY85 2R3VA 2XMVA 1X9WA 2HHHJ 3DRYA 2NYIA 2IRUA 4OLPA 2PFDA 3M8SA 3RR8A 4ANEA 1YZ6A 3GMGA 3OTDA 1RWKB 4KHMA 2W8LA 2DGOA 4LSLA 3FDSA 3SBMA 1NNDA 3QT5A 2EC0A 5KG3A 4U8YA 1QJHA 3I4HX 2HEKA 1M1HA 1X5OA 2RU9A 3P45B 3CJ0A 1YWXA 4X65F 4HDHA 4BBYA 3SSSA 2XZWA 2XG8A 2W2MP 1FDBA 2UXDF 4GRSA 3NKYA 3KJFB 3T19A 3GFZA 1K0TA 4AQYJ 1G1XA 5J1EA 4PXCA 4JUZA 1OYDA 2O5DA 3DDNA 3IR7B 3DDIA 4PWDA 2QIFA 1LWFB 3TUZC 2ZE2A 4RW9A 3I6PA 4O44B 5LM7E 5B0GA 4V19X 4WZMA 5D0HA 3AJ2A 3UVJB 4JI3J 2Z2YB 4ID5A 4EBEA 4KH1B 3MECA 4GKKF 1BQMA 4RW6B 1VQ4S 1NO8A 2NLWA 1UW9A 2YX4A 1N36J 2LXIA 4YEAA 1NSQA 3VVUA 3MR5A 5KFKA 1F9FA 4IRKA 2Q43A 2C2DA 2E66A 3MPVA 3SCIE 4FVCA 1LK5A 2J6TA 1NMEB 4ZJLA 3JQJA 4O44A 3KLVA 1Q8LA 5ETKA 2KRBA 4P7VA 2AGOA 2W7AA 2MGZA 3GIMA 3GR1A 3DOMB 3HP6A 2HS3A 1HWIA 4X4SA 5HMYA 3JTNA 2L08A 1ZAWA 2OKQA 1SH3A 1QUVA 2DNRA 2ROPA 3BH7B 2RQKA 1VMBA 4H4OA 3HHKA 4U67Q 2VBWA 2BE9B 4DR7F 1SBRA 1UCNA 2XGPA 3MM6B 4AFFA 1FD2A 1OS5A 2OUGA 1WC3A 3T41A 1MU2A 1WKLA 1DTTA 3L4BC 2EVZA 5EWEA 2J7WA 2BA9A 2DR8A 3ENQA 1SPBP 1RTZA 1CJVB 4K4SA 3IP0A 3HVWA 1NDPA 4J90A 3P3DA 1HNZJ 1LW0B 4F0HA 2XMMA 3MPDA 4EEYA 4DV5F 1ZPWX 4HT7A 3QFWA 1RWNB 1JNRB 4G65A 2BZ2A 3A8EA 5MAOA 4OX6A 4ED5A 3N5FA 1R27B 3C3LA 4ENOA 5SUHA 4IR1A 2QL5B 2Z58B 2IFXA 1JWWA 2R8KA 2HHTA 3J7YI 4ZVEA 5B0BA 2PGCA 3BB5A 4DL3A 1FDDA 2AT1B 4FF2A 2B5JB 4ZDNA 4AL6A 3C16B 3RB3A 1N6QA 1RU1A 2KKHA 1RQ0A 1U1LA 1DHMA 3C14B 3HHLB 2GW8A 2GMHA 4K4TA 2K7JA 3OTOJ 2GVDA 2B9YA 3LA0A 1N5TA 2FHKA 5M2RA 4C97A 1NK8A 2YNIA 2HRTA 2CXEA 4RW4A 3M8QB 2F8EX 3PJWA 4USUA 4HH0A 3FMBA 1L3KA 4V1Ak 2DNPA 2JNJA 1NH7A 1QSYA 5JXSA 5IT9U 4L3KA 3OVBA 1VCTA 2E7VA 5D0RA 1UVMA 3VV2B 4G1QB 4DR3F 4ANDA 3PO4A 4NXNJ 3M4XA 4ZLNA 5DZ6A 5LJ3Y 1KN6A 1RTDB 2ZH2A 1RLDA 4IFVB 4A8FA 5KTQA 2N4DA 1Y4ZB 2XHWA 3K0JA 3I31A 1ZPVA 3X1LB 1NKBA 4ZVFA 3M2RA 1Z2ZA 2DBBA 5I42B 2GMLA 2B4VA 3CCUS 3TUPA 2VQEF 2DCUB 3IR6B 3KK3A 2BRLA 3QT8A 3MM7A 5HLFB 5KFGA 3E2EA 1RTDA 4QW8A 2AYMA 3EICA 1WOPA 5LMNF 1DRZA 5E0OA 1FO1A 4QWEA 3DGPA 5H9EK 3NMAA 2ZBIA 2VG5B 5J2QB 1VJQA 3QWUA 4CT8A 3OD2A 1NSAA 1BE4A 2ACMA 2V68A 3ENAA 4N5SA 2H3EB 3PTWA 3K7RA 4U7CA 2DJWA 4FXWA 3QJPA 4ZLJA 1WJ9A 2CJQA 2EFQA 1DFDA 4H54A 3MCSA 2CG4A 2QA4G 2R7WA 2MY8A 2VBYA 2FLOA 1W26A 1O6XA 1JIHA 2AWZA 1YGYA 3W2VB 2FY1A 3WC2A 3HVAA 4DX7A 4BC7A 4F7VA 3R97A 1TU0B 4WWSA 2RE1A 2IPOB 3OR2A 2I1RA 1XMQF 4TKTA 2CKWA 2HIYA 1WHWA 3RRGA 1G2EA 5HAOA 2F9DA 1SIZA 2JVRA 1UTAA 3W9JA 4A8XA 3VF0B 3MMBA 2EK1A 1QAIA 3HLUA 1YJTA 2N4CA 4IOCQ 2F40A 1RT3B 2RUSA 3W2VA 4K0KJ 4PKDB 1E6YB 2KB2A 1RT5B 3D68A 3H8YA 1APSA 1HPZB 4ECWA 2AHOB 3TVZA 1VC5A 1UWBA 4QR0A 3OVSA 3D0HE 4ED7A 3N28A 2HURA 2CZ4A 1JJ2R 3FQKA 1RZMA 1VIOA 3M7VA 2DH9A 4EGLA 4MFBB 3MR3A 1P8GA 1BLUA 1X4HA 4QPTA 4N7TA 1S9GB 1T3NA 2EK6A 1T9WA 1YQHA 3LWMA 2BJ3A 3M1VA 4CO3A 1R8HA 3HXMA 2GVZA 4KB7A 1ZBTA 1WDTA 2HHWA 3G6XA 3SXLA 2BJEA 5KFAA 3GCWP 2OHDA 2WSFC 5F41A 4DEZA 4BC9A 3UNYA 1PC4A 2AGPA 1S49A 3AQPA 4NPOA 1NXIA 4NYOA 5BR8F 3B82A 2QC3A 1OWXA 4OZ3A 3Q8UA 1UP1A 1S12A 1VC6A 3DRPA 2D74B 1CULA 3I5AA 1H72C 5CZVA 2LA4A 3L09A 3NGKA 2ILZA 3HHNB 4HH1A 1T3OA 2GIFA 5EN1A 4FNHA 4B9UA 4EYHB 2NSCA 2VOPA 1HQEA 2E5LJ 2SXLA 3PYGA 4OI1A 2DHSA 1WELA 1MWZA 2WOMB 2YKNB 4LF2A 2DRAA 1H2UX 3I0SB 4DN0A 2G1DA 4DSEA 3OHBA 1N4LA 2BW7A 4GKJJ 5DLFA 2C3YA 1Q16B 3BZQA 4WIIA 1SJ1A 3TO8A 1CJUA 1Q1KA 4F25A 2YVSA 2XY6A 3NL0A 3ZNJ1 2EEYA 4AT1B 4A8WA 3DYAA 1LWEA 4GO7X 4USHA 2HLTA 4HYKA 3VGTA 2EFPA 2J9EA 1PKUA 3T5LA 1K44A 2WB4A 1T0TV 4YN3B 4L73A 2VZ9A 1VRTA 3DLJA 3CJSA 1VJWA 2Z0GA 5A0YB 2XMAA 1HWJA 2YH1A 2PEBA 1RBLA 3GONA 1HL6A 1RISA 3A1YG 1RSCA 1XMBA 1U2CA 3CUNA 1RB0A 2W9AA 2FZKB 1GMWD 4HVZA 5A6WA 1R0AA 1FTCA 3BQ2A 3CVKA 4KKOB 1OY6A 3IM8A 3CC7S 3IXQA 2XMKA 1WEXA 2C3PA 4R5PA 1EQ0A 4PAAA 1HI0P 1YRXA 2I5JB 4I7FB 4QWAA 2GAHC 4B3MJ 1U6BA 4NZ7A 2ROGA 3BEGB 5ETTA 1IJEB 1OQ3A 3M6XA 4P7TA 3W63A 4Q45A 2HVIA 2XSJB 4N47A 2MYFA 1X4DA 4NMXA 3BN7A 4IRCA 1XR7A 1FJCA 5D77A 5GAGI 2OFHX 5HMXA 2AX0A 2Q66A 4QWBA 1NPRA 4FPRA 3VGUA 2VL1A 3W61A 4DU8A 2HS0A 5EGYA 2FJVA 2HMIB 4P2XA 5LL6d 2ZZMA 4TXSA 3NNAA 2ZNZA 3IFEA 4GVBB 1C1BB 3PV8A 1VQ6S 4DZ6A 3KUHA 2XY7A 4Q8FA 3RBZA 2BYCA 5IM0A 4C8ZA 1IR1A 2YQ3A 2YNFA 3Q89A 4DR2J 3KK1B 2HHHF 1NHKL 4FF4A 2NCKL 1W7WA 4PG8A 2HMIA 3HK2A 4KYZA 1X9SA 3KLGA 3K5NA 4DFMA 1MG7A 1SC4B 2ALYB 3BQ0A 1BY9A 2CJBA 3M32B 4N8OA 2O01C 3SFUA 2RU3A 2DXEA 4XTTA 2CQBA 4IH7A 3HD2A 3MCNA 3PHTA 5HSPA 3SIPB 4ES3A 1SC3B 4OV6A 3MZIA 2BV3A 2C2NA 4C3LA 4PCQA 2GGPB 2YKQA 1U1PA 3HKZD 5ETLA 3ZO7A 1FE4A 2DR5A 4Q0BA 1SH2A 2JEJA 3EZOA 2PI4A 3QRRA 2CADA 2B7CB 4AQYF 2OPQA 1KEKA 4YHHF 4V19J 3G6ES 2UUAJ 3KFWX 3KHHA 1TL1A 2Y8WA 4OHVA 2V4JB 1K1SA 2KRRA 2KHCA 3THTA 3M2VA 2V5HG 1K9MT 2LQBA 2J7KA 5C42B 3J80U 2MSTA 5F0UA 1S57A 4JI3F 3FVYA 1U49A 4CNYA 1EHWA 5KFTA 2FVRA 3UN2A 1IBMJ 2X1GA 4RU9A 1JLCA 4J9VA 3KHRA 2QYCA 2EFNA 2J9DA 2ZC3A 1WI8A 5LMUJ 2VF3A 3W2WB 4TU7A 4DL7A 3OQ2A 4UOFA 2HWTA 1FKAF 2GNKA 2MKCA 2ZD1A 3ZZ0A 5FJ4A 2H48B 3DM2B 3E8OA 3MEDA 1CSJA 2V94A 3BREA 4CO2A 2HHXA 3LW5C 2DNOA 2XB2D 4IOAQ 2DGWA 2Z8QA 1MLAA 4CM0A 4XAKA 1FWKA 1JKHB 4JI6J 4NA1A 2LEAA 3MUTP 1NDLA 2OEKA 1GMUA 1LNQA 4CLFA 4CTAA 2Z57B 2Q1LA 3K5OA 4NCBA 2AJQA 1WG4A 1U1MA 4M63A 5HBMB 2KT2A 5M2PA 2NXNA 1UFLA 3LAMA 3TEGA 2GHWA 4FS1A 1MW7A 4HHJA 2Y1LB 2IC3A 3T6BA 2BJ8A 4CIOA 4FKXA 3HF5A 1DZ5A 4LBPA 5D4NA 3MCOA 4ZCMA 3RAXA 1RTHB 5E3RA 3IC1A 2H5JB 4JYAJ 4LBIA 1RUSA 5K8MA 2RB7A 1U6ZA 2HFZA 1S1XB 4M5DB 4USKA 1S1VA 2HFOA 2HNDA 4F4AA 3KLHB 1KLMB 1KHWA 2ATLA 1YJVA 2E5GA 1X0FA 3R8YA 3I9V9 3HT3A 4ZVPB 1VISA 5AT1B 2WCXA 2HIQA 4KBIA 1Q7YT 3OTOF 1BGXT 2DNMA 1S6QB 5SZTA 2K7KA 4HI1A 3KLHA 5IZHA 5J2NA 4EBDA 4O3QA 2W4CA 2P8IA 1LWCA 4NXNF 3M8PB 3CJ2A 2VFRA 2BE7D 1ZYQA 1GXLA 1SB6A 4ZOSA 3D0GE 3HDSA 1X4FA 3PX0A 5EUHA 1RAJA 2FHMA 3GTYX 4ANCA 4XDCA 3CCQS 3PYEA 4K5SA 5AE2A 1P9YA 4L76A 3QT6A 1HBMB 4FYYB 2G2OA 4KPCA 4B9MA 3RZAA 3GV8B 3PRDA 2KTQA 2DB1A 3D6FB 2Y1RI 1MNEA 1FRLA 3IBFB 4RUBA 2RRAA 3T9NA 1FRIA 1S7IA 2HPUA 2HQFA 4OYMA 4JV5F 4DUYJ 4K50A 4CLUA
chains in the Genus database with same CATH topology
1WTFA 3VAGA 3TVYA 4FXDA 2UUCF 1QAXA 2P9CA 2IYIA 2J0SD 3DOMA 2MQNA 3RR7A 4QIWD 2K3KA 1T05A 1YHQS 1FJGF 2EFOA 3CT9A 3M6VA 4CI0B 1KSPA 2WSEC 5I3QA 2MJUA 4NCGB 2NUHA 3PW7A 2IAJB 2VFTA 1FXLA 2BRKA 4YMEA 2KXHA 2LU2A 3EXYA 3RU0A 4WFNQ 3TW0A 1SKWA 5J2PB 3HVRA 5DDOC 1SQEA 2WW8A 5ADZA 3HVTA 2HWIA 1YRTA 5HROA 1RT7B 4Y2KA 3C6TA 1SV5B 2OIHA 1XR5A 1NZAA 2B0GA 3LP2B 1YIJS 5GADU 3IWNC 7FD1A 5BYRA 4DG1A 1IKVA 1WF1A 1SKRA 3SDEB 2MKJA 5BYSA 1CPZA 1S0NA 3FRZA 5L9NA 3KWMA 3BO2A 1SL0A 3DU5A 2F8MA 3F41A 2DNZA 4JI5F 2XO7A 2RDIA 1ZZFA 4P6QA 4B02A 2PE8A 3SCLE 3DCAA 4M94A 2XEXA 4X64F 2VKZG 3BJYA 3JSBA 3R5AA 3NBPB 2BQ3A 3CCMS 4B9LA 4UY8T 1KNZA 4IH5A 4NL5A 4OIXA 4LQ9A 3POTA 3AB2B 2KM8B 4FF3A 1U2RA 3QLHA 3MMCA 1JK9B 2O66A 3FNNA 3MM6A 4PXDA 2HHVA 2R7XA 5BYQA 1U7LA 5DM6Q 3FSYA 2LEPA 4LQ3A 4A48A 2WSCC 2VG7B 4DDFA 5IM0B 4RW8B 4FF1A 4ERDA 2WTFA 4DSIA 3IAS9 3CO9A 3VR1A 1WEYA 1WWHA 2J8AA 4NCGA 2JEIA 4QQBA 1P1LA 1UFWA 2YNFB 5KFFA 4NLQA 2PA3A 3T1AA 4NLPA 3GFHA 3M30B 4C0BA 3NAHA 4OJ1A 2R8HA 3DRSB 3CCJS 1RT7A 1UW4A 4NLVA 2PDAA 2ZH6A 4F2SA 1F5BA 2IM3A 2JJ4D 5J1PA 3N9UC 4NLXA 4L6V3 2W9BB 2WHOA 2X1AA 1X4GA 4ECYA 3P5TL 2KDOA 1SUQA 3KLGB 1IR0A 3HO1A 5DM7Q 1BQNB 3MUMP 1VBZA 5L1KA 4ZP7A 3L7OA 2EPIA 1HI1A 4QYRA 5CHCB 4OFZA 2XLIA 1N56A 1LW0A 3CD6S 4F3OA 1WHXA 2IM1A 2OD6A 3J81Y 3FZ2A 2FVCA 3JSMB 4OX9F 1FD8A 5I3UA 2V8GA 1IXKA 2PN6A 4DSJA 1TV6B 1URRA 2BANB 5F9LA 3W3SA 4IG0B 2AYGA 3MEEB 1WEZA 2R7RA 2PT0A 2IM0A 4XK8C 1TUVA 5IT4A 1VHFA 4QIEA 2VG6A 3AB4B 4NMLA 2KO1A 3CD0A 2XMTA 3KMQA 4X4VA 3CC4S 2M0GB 3DRRA 4NWBA 4K0KF 2XMJA 3V81B 5GAEU 1UJ6A 3CEDA 4ED3A 2KYXA 5F9NA 2VBZA 1FDAA 1W2IA 4KV8B 2A1BA 4RNFA 1H38A 4YR3A 3VAIA 1Y3JA 4WFXA 1R3NA 3QIPB 2P5VA 4DX8H 4AL5A 4WYWA 2MKIA 2VQFF 3DRSA 4U7UK 4ICLA 1RGVA 1C0TA 2IMWP 1DJ0A 2W9BA 3Q23A 3MEGB 1JX4A 4UQGA 3PW0A 4BCAA 1DQAA 2ZJPQ 4GC6A 4DFKA 2JC1A 4TYBA 4N77A 2H5EA 3RRHA 2FPHX 1HNVB 3WZ0A 2CPDA 1MROB 4Q0BB 1V3SA 4KO0B 4C8NA 2B6AB 4ZPDA 2YTCA 4URSA 3OV7A 2ZH3A 2WONA 3IS9B 2O3DA 2B5JA 3VZIA 2DGVA 5F8IA 5F8MA 3CD7A 1HYSB 2HVHA 2YKMB 2MZRA 5G0RB 4GMKA 2OPQB 1LFWA 1CEZA 2N7CA 1R89A 3GWCA 3KK2A 3GYNA 3R3TA 4AL7A 4EO8A 2RUGA 3PW4A 4DQIA 1RWUA 1HHSA 4QR1A 2GJ2A 1N52B 1S6UA 3F44A 2HS4A 2VONA 1OQ6A 1S6PB 3KG1A 3CCSS 3HZEA 3TA2A 4IO9Q 1XC9A 1VQKS 3P49B 1S9EA 4NYPA 3NMRA 1VQ8S 4CH7A 2MY7A 2MKKA 3GV5B 3CPWR 1HQUB 5E41A 5T7LA 3HHLA 3T9ZA 2LYVA 5D6GA 1TL1B 3QO9A 4B9NA 3PHEA 4G6VB 3ZZRA 3GILA 4LUBA 4QIGA 3TAMB 1GQEA 1JLQA 1RTJA 3M2VB 5KG5A 2XSFA 5BJRA 3HPOA 3MR2A 3M8QA 4AUKA 1LQ9A 2NZ4A 3LF0A 1TK5A 2OPPB 3MEGA 5IT9Y 2CJ9A 4HLBA 1F60B 4R8UA 3OL9A 2B4PA 4J9NA 3J7A1 3PRBA 4OLOA 4DQQA 1VQOS 1S1TA 5C25A 4MKBA 2LU1A 2AJ4A 4G1QA 2RSQA 1TL3A 2E9TA 1IQZA 2CQDA 1JLCB 4X4QA 1UL3A 4B3SF 3S1TA 3PEHA 1ZZNA 4C11A 2HQ3A 1JMTA 1VQPS 5CYQA 4BWJA 3FQLA 2BOPA 1X5TA 1UVKA 2N7YA 2ZJQQ 2ROEA 3N01A 4A8MP 2AU0A 4TY8B 3H25A 4IFVA 4KHPF 1GH8A 3TUJC 2G4BA 3IG1B 1S9FA 4I2PB 1Z4UA 2RF2B 4ZPVR 1JXEA 1PILA 1RT1A 4NRTA 3P96A 2U2FA 3Q24A 4BHQA 1LOUA 2OSRA 3H98A 1Y00A 4NZ6A 1YITS 5KFEA 5CXTA 3Q2TC 1RKJA 1EETB 5K8PA 2BABA 2UVVA 1J5OA 3SCKE 5EDWA 2ZFHA 2YWHA 4WKRA 2DISA 3NLCA 2DGTA 4PUOA 1WNEA 4ID8A 1JLFB 1BWEA 2NSBA 3OTBA 4EZ9A 2RKIA 5I42A 1C1CB 1DTQB 5I4MA 2X1BA 4N76A 1O51A 2AV5A 1XERA 2GHPA 1HA1A 1Q8BA 2EG1A 4PQAA 4K4UA 4LF9F 4KJIA 2YX7A 1RTIB 3GB0A 3QWPA 3IRXB 3ZC4A 2ZD1B 4EFAC 5F3TA 1M5KC 5GAEI 1L3UA 2MHEA 1HNIB 1X8DA 2E5LF 5J2MB 3O8WA 4NX9A 1WHVA 4A8OA 4J9KA 1B64A 3MEDB 5HLFA 1TZ0A 2R7OA 2IBOA 4Q7AA 3KLIB 1U1OA 5EWGA 1RT2B 2XWXA 3DLLQ 2GFFA 3MURP 1W25A 3KLEA 4ZHRA 1I6JA 1NRKA 4ELUA 2E5HA 4X4OA 2GQCA 1M5SA 1XK8A 3TR5A 4ECSA 1U45A 1N36F 4JV1A 2M3DA 3OJSA 4KFBB 2RF2A 4OX7A 4ECRA 3QAEA 2HAIA 1SKSA 2NREA 4OI6A 1N34F 2LMIA 4B3RF 1RJJA 4ZA1A 3CCLS 3LP1A 5CCMA 2RD5C 2OPRA 4GKJF 1IBKF 1N5VA 2VG5A 5M2UA 1IKXA 4QWDA 5J2QA 3DLBA 2U1AA 4AXIA 3US5A 2GQQA 4WK1A 4DQSA 4PQUB 4F4WA 1FKOA 2CIMA 2UVUA 3DC2A 4OI4A 2Z4PA 3UCUP 2FTRA 3D2WA 3GFYA 2IMOA 4R25A 3UWTA 1N5YB 5L9XA 4CTAB 5KFPA 1C0UA 3IWXA 3S8SA 4N41A 4A8QA 1MSWD 5EHHA 2HG4A 2AP6A 3FEXB 4MK9A 4DL4A 3TQ1A 3IRXA 1KQFB 3OR1A 3C46A 1UVIA 5DJBA 1HNIA 1FNOA 4LFBF 2EFVA 3DMJA 3VQSA 2FVSA 2HNZB 1S0MA 5FD1A 1JLBA 3MPYA 2NPFA 5F8GA 2KXFA 2MZSA 2ZDOA 4UOCA 1VBYA 2WBMA 4WXWA 1JJ4A 5DQGA 2HRYA 1T7PA 4F8RA 3N6LA 3IN5A 4MJKA 3TARA 1S79A 2MMYA 3CJ5A 2J7UA 3DLEB 3P6YC 4TU8A 2LXFA 3CJKA 2VKRA 2VUGA 1URNA 3NAIA 3DU6A 3FSXA 3EUNA 3HHLD 5KFBA 4IR9A 2UU9F 2R7TA 1U1KA 4C7QA 4QYZJ 4LSLB 2CPJA 4ZVHA 5HP1B 3S6EA 3OPKA 1S1WB 2B43A 2M88A 4IKAA 3BR8A 2IC3B 2O1PA 3M6WA 4X4TA 3JSRA 3N6MA 1KC8T 5THWA 3DOLB 3QYYA 2CQ4A 2K1RA 3ZZUA 4QW9A 3BSCA 1NKCA 2GIRA 4K4XA 2C3MA 1N32F 1P1TA 1TQLA 2ZH4A 2AQ4A 2DHXA 4UY85 2XMVA 1R8AA 2Z2MA 1X9WA 4DSLA 1VQMS 4OHYA 3DRYA 1ZM9A 3DFEA 2NYIA 2DK2A 4DV6F 4LF8F 2JFKA 3LH2S 2IRUA 2QZ8A 4M1KA </