2CQ3A

Solution structure of rna binding domain in rna binding motif protein 9
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
103
structure length
103
Chain Sequence
GSSGSSGNSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords RNA-binding protein 9
publication title solution structure of RNA binding domain in RNA binding motif protein 9
rcsb
source organism Homo sapiens
total genus 14
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cq3A00
4LMZA 2GHPA 4WCEQ 3J7ZT 2J0QD 3HHNB 2OSRA 4YUDA 2AYEA 1PGZA 2QEXS 3P3DA 2KRRA 3UE2A 2MGZB 2DNOA 4UQTA 2MKKA 2KM8B 1WG4A 4RU2A 2M0GB 2FC9A 2ADCA 1U6FA 1UW4A 2DNZA 1CVJA 1VBXA 1WI6A 2CQGA 3B4DA 1U1QA 2AYBA 3SDEA 2DGSA 1U1LA 5HL7Q 3S7RA 3IRWP 5IFMA 1X5PA 2MPUA 2Q79A 2EVZA 2LA6A 4LJMA 2N3LA 1BY9A 3VAHA 2DNHA 1IQTA 2YTCA 2RQCA 4J5OA 3B4MA 4Y00A 1R8HA 2OSQA 1FJEB 2X1GA 3P5TL 1VQKS 2M9KA 2DNRA 1X4GA 5ITHA 2KN4A 3BO4A 3UCGA 2KI2A 2PEHA 5CYJA 2CQPA 4YOEA 2MSSA 2MQQA 1A7GE 2G0CA 2X1AA 2E5HA 1FT8A 1XN9A 1H2UX 3SMZA 2DO4A 2DGTA 2G4BA 3UCUP 1X4AA 1VQ9S 2MQNA 4U67Q 5JVGQ 3JB9k 2MMYA 2KHCA 3MURP 2O3DA 2DNGA 3NNHA 1FJ7A 3US5A 1U1KA 4WFNQ 3CULA 2HVZA 2CPEA 2XNRA 4CIOA 5GAHU 1U1RA 2U1AA 1YHQS 1VQNS 2M8DB 1VC5A 2CPYA 1VC6A 5DDOC 4IUFA 1JMTA 1VQPS 4WFAQ 3L3CA 2ERRA 3CC7S 3S6EA 2DB1A 2ZJQQ 2XS5A 1X4CA 3ZZZA 3CCJS 2LEBA 2KU7A 3U1MA 1SXLA 1WHYA 4QPTA 2M2BA 2XB2D 1O0PA 1ZH5A 2RVJA 1OO0B 3MI7X 5GADU 3RW7A 3J7YU 3VF0B 1WG5A 2RU3A 2VODA 2J76E 2RUGA 1YIJS 1HL6A 1P1TA 5H1SV 2MB0B 2DIVA 2MQPA 3R1HA 3NNCA 1K8AT 3MDFA 3I55S 1X5TA 2UP1A 3CCQS 2AD9A 2D9OA 1VQLS 1OWXA 3MUTP 2L9WA 2KG0A 2LXIA 3CF5Q 4C4WA 2QA4S 2KM8C 3MD3A 2JRSA 3G6ES 1Q7YT 2RNEA 2U2FA 4ERDA 3UD3P 3SXLA 1URNA 1YJNS 2MZRA 1VBZA 4W92B 2BOPA 2VONA 1H2VZ 3BS9A 4IOCQ 3NS6A 1HA1A 5D77A 1JJ4A 3CD6S 1X4EA 5LXYA 1M5VC 2DHSA 3THPA 2MKHA 4C7QA 1VBYA 2J8AA 4F25A 1WHVA 2JVOA 3CCES 2MJNA 2XNQA 4WFBQ 2CJKA 3VAFA 2CPZA 2KG1A 2FPHX 3CCUS 4TU9A 5EN1A 2DISA 5LSLA 2JVRA 2KXHA 1DZ5A 1L3KA 1WI8A 4P6QA 3H2UB 2I2YA 3VAIA 1H6KX 5BJRA 1Q81T 2MY7A 2CQCA 3CCLS 3MOJB 2DH8A 3IWNC 2A3JA 2K8GA 2DHAA 2MY8A 2MHNA 1K73T 2HZCA 3TP2A 1YJWS 2AYMA 2DITA 3NMRA 1FJCA 2OTJS 2EK1A 5DDRC 1X4HA 2CQ2A 2DNKA 4CQ1A 3G4SS 1YITS 3D2WA 3CCRS 2L41A 2DK2A 2E44A 2OTLS 2M88A 4ZKAA 2CPFA 3EX7B 2E5GA 2FY1A 1U1MA 2KT5A 2CPHA 2LXUA 1N54B 1DRZA 2E5JA 2ZJRQ 1NO8A 2YKAA 2NLWA 2XSFA 2LEAA 1X5OA 5LJ3Y 2K3KA 2MQOA 1N8RT 2OJ3A 4ED5A 1ZZNA 2DNLA 3CC4S 2CPIA 1R8PA 1U1OA 2SXLA 3THTA 3Q2TC 3VAMA 5GVQA 2RRBA 5MLCV 4TU8A 1YWXA 5GAEU 3P6YC 4WF9Q 1S79A 2DIUA 1NJIT 1VQOS 3PIOQ 2HGLA 3BO2A 3VAGA 5D78A 3U1LA 1M1KT 4F02A 2N7CA 1DHMA 5DDQC 2MZQA 3CTRA 3UWTA 3S8SA 1YJ9S 2DGXA 3CC2S 3G9CA 5FJ4A 2CQ1A 2QFJA 3N9UC 1SJFA 1S72S 4M5DB 2DH9A 2X1BA 1WF1A 2E5IA 2YH0A 2PE8A 1P27B 3HI9A 2V94A 1HD0A 1QVGR 2DNNA 4C0OC 5CXTA 3VAJA 5GMKa 2J0SD 3CUNA 4CH1A 4V19X 1M90T 2DHGA 1VQ4S 1SJ3P 4BS2A 1WHXA 3MXHP 2HGMA 3OW2R 2XS2A 4TLQA 1WTBA 3FEXB 5DM6Q 2XS7A 1WELA 2LECA 3FEYB 2CQBA 2EK6A 2VOOA 1WF0A 2M7SA 5IM0B 4PKDB 2CQ0A 3EGZA 3MUVP 1G2EA 1WEXA 1JJ2R 2HYIB 1N88A 2DO0A 2KXNB 1WF2A 2CQHA 4CH0S 1Q86T 1FO1A 3LQVA 2DGQA 1UAWA 1OIAA 2MSTA 5GAGU 2HGNA 4QQBA 4FXVA 2DNQA 1UFWA 3I56S 1VQMS 4F26A 2DGWA 2M52A 3S01A 2G1DA 1WWHA 2DGVA 1X5SA 3H2VE 1FHTA 4OZ0A 2CPJA 1WG1A 3VAKA 3EGNA 1QVFR 1YTYA 4Z2XA 1K9MT 4Y0FA 4UY8T 5DETA 4IOAQ 1D9AA 2RQ4A 1U1NA 1KQSR 4TU7A 2LYVA 2ZJPQ 3Q2SC 1VQ7S 2VOPA 3CPWR 3BEGB 2DHXA 5JVHQ 4WKRA 2M4MA 2OIHA 1W2BR 3CCMS 2CQ4A 3MD1A 2LCWA 3V4MA 2B0GA 4LIRA 2FC8A 4W90B 2AYGA 2MZSA 3TO8A 2DH7A 3CCVS 1RK8A 2M8HA 2CQ3A 1VQ5S 1X0FA 2MKSA 1UP1A 2KYXA 3K0JA 1X4BA 2MKIA 2M70A 3UCZP 2D9PA 4FXWA 1HD1A 2ADBA 4QU6A 2JWNA 3PIPQ 3CMAS 1WHWA 2F9DA 2DGOA 2F3JA 1QM9A 3SDEB 4PR6A 4WIIA 2RRAA 1SJ4P 2RS8A 1YI2S 1M5KC 1M5OC 2MQLA 2LMIA 3NS5A 4YB1P 1U6BA 2MXYA 3VALA 1B7FA 1SJQA 5DM7Q 5IQQA 2MZ1A 2KVIA 3ULHA 4QU7A 2CQDA 2D3OR 5LSOA 2KRBA 2MJUA 5LJ5Y 2I38A 2CPXA 2CPDA 5CA5A 2DNMA 2WBRA 1JJHA 2KFYA 3G8SA 5IM0A 2L08A 1OPIA 4IO9Q 1AUDA 3DLLQ 5HO4A 2LA4A 4A8XA 1H2TZ 2JX2A 3CCSS 3UD4P 3G96A 4PRFA 1NU4A 2YWKA 2YH1A 3RW6A 2X1FA 1X4DA 1KD1T 3BO3A 3P49B 1A9NB 1VQ8S 3CMES 3DXBA 3R1LA 1KC8T 1X4FA 1N52B 1F9FA 1U2FA 2DNPA 3LPYA 1Q82T 1D8ZA 3CXCR 2CQIA 3NNAA 1VQ6S 3G71S 1FNXH 2MZJA 2F9JA 5LXRA 1KOOA 2RT3A 1KOHA 2NZ4A 2DNYA 2BZ2A 5DDPC 1ZZFA 1PO6A 1U1PA 1M5PC 2LKZA 1WEZA 2MKCA 1VC0A 2RS2A 1RKJA 2MQMA 2FHOB 2MYFA 2MGZA 3ZZYA 2KXFA 2DGUA 2MKJA 2N3OA 3TYTA 2MZTA 3R27A 2GO9A 1FXLA 2LQ5A 1SJRA 3MUMP 2N82B 1DBDA 4EGLA 2KH9A 1WEYA 4OZ1A 3G8TA
chains in the Genus database with same CATH superfamily
1EJ7L 3I87A 5CZXA 2KZZA 3LP1A 5DQIA 1GX6A 1TMMA 1S6OA 3HP6A 2J0XA 3N6NA 2HNZA 3B4DA 2ALZA 4ED7A 2WOMB 3H20A 1JXLA 1EHWA 4DMZA 3D0GE 2DNRA 5KFJA 5ETNA 2ZWPA 1RQ0A 1URRA 2E5HA 3R7BB 4TYAA 2DR6A 2ZH1A 2MMYA 2OHDA 4ZPCA 4L75A 1ZAWA 2G0IA 4DX6A 2K1RB 2M8DB 5AXMA 3TEGA 2IRYA 1BQNB 4PPDA 2VG5B 3QPIA 2ZUGA 4ZVPB 2O5DA 4I1TA 1RHKB 1UWAA 3NCQA 2XB2D 2B3TB 1ZH5A 5D4NA 2AIRB 2I5JA 2J76E 1HL6A 2KJWA 2DIVA 3R1HA 5BYSA 1K8AT 4IRKA 5A0YA 3FRZA 4PQUB 5ETKA 1X31C 5L1IA 4K7QA 4C3KA 4URGA 2C3MA 2VKZG 2RNEA 4DR6J 3OSNA 1S6PB 4QWCA 1KTQA 1TTHB 1F5AA 1JLGB 4A8YA 2BRLA 3HDSA 3R3TA 4N76A 5A76A 3HSDA 1PAUB 2QO3A 3DRSA 2FHMA 4X64J 1RAGB 2B9WA 5LSLA 4XIUA 3KHRA 3W9IA 3MECB 4NLWA 1XNRF 2LP4A 4DFMA 1MWZA 4UQGA 5E0OA 4HACB 4X65F 2KL8A 4H4MA 2JNJA 3TP2A 3CT9A 2CG8A 2JC0A 1X4HA 3IFEA 1FTRA 3HVWA 5KT3A 3MZIA 1U1MA 3O1LA 1IKYB 3U27A 3H59A 4ICLA 3GV7B 5LJ3Y 4JV2A 4OL8A 3TQ1A 3FQKA 3R7SB 1H0HB 3IGVA 4V19J 3ZTPA 1JB0C 1HW8A 2CRLA 3DLKB 2H9ZA 1X0PA 2NXJA 2QV6A 5C24B 1SJFA 3PYDA 3CE8A 2E5IA 2XY5A 2BJDA 4NZ0A 1HWJA 3HFVA 3PEHA 2IYGA 2XQCA 1KVIA 3SCIE 3CJRA 3B82A 4O3NA 1I94J 1SIWB 4EBEA 4UF4A 5DM6Q 2XS7A 2JL9A 2DRBA 4G65A 1VDHA 3E2EA 3U7JA 3I6PA 1RHUB 2MDAA 3WX4A 3JQJA 3KK1A 4YHHJ 3RU0A 2NSBA 2QGFB 3AJ2A 1BC6A 1M5SA 2YKQA 5FLXU 2R8KA 4AXIA 5HLFA 4FF3A 2VPWB 2H65B 3EZUA 1VS3A 1CQMA 2XO7A 4CM0A 3MMCB 4DR7F 4ETXA 3Q8YA 4ZVOB 4C8LA 3RBEA 3HHLB 3M1VA 4RL1A 2B0GA 4HYKA 4RUAA 4QR1A 4FNIA 4C8KA 1IM6A 1JLBA 1LWFA 3ZTOA 1GEHA 5K14B 3K57A 2CZ4A 4OI3A 2OD6A 4NI2B 4ED3A 2VFVA 1EKSA 3DDKA 1TL4A 2HQIA 2IC3A 4KC5A 4C11A 2R7UA 3MEDA 1B0TA 4U6PA 5AT1B 2MQLA 2LMIA 3LGHA 5LT5A 1RP5A 4PCQA 2QL9B 5DM7Q 2AF6A 3OL7A 2F8EX 2KRBA 4P7VA 2ZVSA 3A8EA 1LXJA 1APSA 2XYHB 3RB4A 4AL6A 4JI0J 2LA4A 1FDNA 3UD4P 1U4BA 5KFCA 3Q8PB 3FMWA 3Q22A 2ASYA 2ZBCA 3AD7C 4MJKA 2CQIA 1ZTWA 1U02A 4ZVFA 4RBTA 1Q1KA 3PR5B 1VC0A 3KHLA 2XMWA 4ZCLA 4LSNB 1LW2B 1NUEA 1I94F 3V6KA 4ZPAA 2DGUA 2GVZA 3GU0A 2GO9A 4OYIA 4JB8B 1JLQA 3DM2A 4LF7F 1FRLA 3E8OA 4HT7A 5F8MA 4YUDA 5DQHA 3SCKE 2FC9A 3WQPA 3F73A 1VBXA 1N5TA 1CJKB 1HBMB 3IRWP 2BUNA 3KUHA 4KHPF 2OMOA 4Y00A 5HATA 2KN4A 1U25A 2OEJA 4KE5A 5F3ZA 3UDCA 2HG4A 1W26A 1FDDA 1RKIA 2BV3A 4LBIA 3J81j 1FE0A 3SV3A 2U1AA 1YHQS 2HS3A 4CZCA 2DB1A 3ENWA 4USVA 1PKUA 1AB8A 1T03B 2BJ1A 4ILRA 3VF0B 4ZIVA 1RXOB 5F8LA 3QRPA 3N0VA 3P96A 2V8PA 5IQ6A 1R8BA 3TAMB 3MDFA 2IAJB 2HWHA 3H42A 3EYZA 4JI0F 4FYDA 4LQ3A 2YX1A 2HWIA 5IV4A 4MYTA 1OYEA 4HDHA 1P9YA 1SUQB 1NEEA 1R8AA 2UUBJ 4I2PB 3B54A 4BDPA 3BS9A 4P52A 3UD5A 3NS6A 3NAHA 3CIZA 1TL7A 4FKYA 4LRAA 2DHSA 2AZ1A 3THPA 4WFYA 2XNQA 1KN6A 1S1UB 5KFYA 2CPZA 2IJRA 4A48A 3EDRB 1C1BB 1IBLJ 2UXCJ 3KLFA 4ECVA 4WWSA 4K4XA 2MY7A 3SSRA 1S6QA 3DDIA 3IWNC 2R7SA 3QJPA 2VPZB 1C0UA 2XCPA 4CO5A 1RAEB 4FVMA 3NBPA 4O0IA 1YGYA 2DNKA 5HMXA 5FLXY 1TP7A 2VA3A 3TWZA 2C22A 3IC1A 5L1LA 2W2QP 3PYGA 1HNXJ 1KP6A 2CPFA 2GX8A 4KO0A 2AMCB 3M2RB 2LXUA 5KFUA 2CG4A 2D3ZA 4MK8A 1HNWJ 1EZZB 3I96A 4UZBA 1N8RT 3BR9A 2WVFA 1KEKA 3FVYA 5CHCB 3BZQA 5KFSA 1G4CA 2JJ4D 5E3CA 3VAGA 2C2DA 1SQEA 2RKIB 2IBOA 2EPIA 3J80U 2VG6A 4MKVA 2ZD1A 2A0FB 3GIMA 1WHXA 1Y4ZB 4ANCA 2HBRB 1SQGA 1L3UA 4DV5F 1LWCA 3V4IB 1WOPA 3EGZA 1G2EA 4DCJB 3IBWA 2GJFA 1VCTA 4QYZK 4KGXB 4CP5A 3QJJA 3QGIA 1UFWA 1B4SA 1WWHA 2G1HA 1CC8A 2MTLA 1TUWA 3Q83A 5K9FA 4O3SA 1B70B 4O0NA 3PHEA 4Y3CA 5DETA 2YNHA 3OD2A 1AROP 3BSAA 2FLLA 4ED1A 3BKUA 2C3UA 3X1LB 3RBZA 2BQRA 2YKOA 2E7VA 3PJ9A 1N5QA 5HI7A 4NASA 1O51A 1S59A 2FJXA 3RB6A 2AP6A 1SC3B 1PJ7A 5AXNA 4QU6A 3MWBA 4UOHA 4KBIA 2RRAA 3SDEB 2Z2MA 4HT5A 1YRTA 4ZVEA 4EI2A 1FEEA 4DN9A 1HNWF 3TW0A 1UWBA 3C14A 2KFYA 2NREA 1OPIA 2DHHA 1NJZA 2N4CA 5L38A 3OHBA 4HTIA 1WUUA 4RJVA 4E0DA 2ZBQA 4P2MA 4I6AA 3RGIA 1U2FA 5IT9Y 2C2RA 2CJQA 4RUBA 5LXRA 1R31A 4DSIA 1U1PA 3J81U 2LKZA 1BMQB 2MQMA 3ZZYA 2J7WA 4WP9A 4DR1F 3PX4A 3W61A 1ICEB 1WC6A 1S1TA 2KT2A 2ACMA 2LLZA 2WOMA 1RTDA 4DL3A 2O01C 3H5YA 4OYWA 5L8RC 4DJBA 1SPBP 2QA1A 1FA0A 3LAKA 4LF5J 4Q44A 1UEUA 5KT4A 4WYLA 2CJ9A 2J6UA 2X51A 2XWXA 5M2PA 1HW9A 2MPUA 4USKA 2C2ZB 3D3CJ 2X7IA 3G6XA 3C46A 4OLPA 3E01B 5CYMB 4NA2A 1S10A 3C6TB 3OFEA 3UO0A 4U67Q 4E98A 3JB9k 1VBKA 5BYRA 2XY6A 4B3OA 5KG6A 4DLEA 4K4TA 1GTHA 1LOUA 3RR7A 1XBWA 3RW7A 5A8WB 4ED8A 5HROB 1JXEA 2RUGA 1S6PA 1YIJS 1ZYQA 1RJJA 3PRBA 4KFBA 1FFGB 2OI2A 3GIIA 3I0RB 2GW8A 4RLEA 4AE5A 1UETA 2FZCB 3ET6A 5E3AA 3KDNA 1VQLS 2G9OA 3LWLA 1NNDA 1VGYA 2FVPA 2JRSA 4MFBA 3SXLA 3OTEA 4LUBA 1W2IA 1Q16B 3SQOP 1H2VZ 3BF4A 1HA1A 1B3TA 4KV8B 4X62J 1H7XA 1TL3A 3JTOA 2ZITA 1HQ2A 2HZAA 4KYZA 1Y7PA 3K8VA 1TFWA 3BGOP 1ZETA 3CJ3A 3VVTA 4C7QA 1LWEB 3BQ0A 4JV5F 1KHWA 1HI0P 1T9TA 4CH7A 5C7PA 3EVWA 5AJ3J 3RUBL 2ZUAA 4FPRA 4MAKA 1JNRB 1YLXA 1AYEA 5KG4A 2I2YA 4A47A 3WBZA 1MSWD 1TMJA 2HZCA 3WIUA 4LBPA 4WTYA 3CD7A 2V2ZA 3PZPA 2KDOA 2B5JA 5C24A 2V4JB 1NO8A 2GA7A 4KIAA 5KFVA 3MM8B 2CPIA 1U6ZA 4F4ZA 2GZOA 2V0NA 3VAMA 2HVDA 2HVEA 5JUMA 1G1XA 5D0EA 4J9KA 1DHMA 4FF4A 3W2WA 1JWWA 3TVKA 4ETZA 3ZFVA 5FIIA 5HQLA 4OFZA 5CXTA 2EG2A 2F4VF 3R5DA 2FHKA 3AHPA 3IWXA 2IM1A 3Q8QB 3BR8A 1HLWA 3R6LB 3AD8C 2HGMA 2XS2A 2FVQA 1VQSA 5H9FJ 2FVSA 1NPPA 2HQCA 1XERA 1L3VA 1XMOJ 2I1RA 2COLA 3EDQB 2ACYA 1HBOA 3I0SA 3OFHA 1EP4B 2RH3A 3HKWA 5F9LA 1YJVA 1QAJA 4O23A 2WK4A 1UCNA 2HKEA 4HL9A 1QVFR 4GVLA 2AQ4A 3F44A 2K2PA 3J81Y 2ZH9A 3D3BJ 3GE9A 4ZN1A 4Z7YA 4PUOB 1YVFA 5H9EJ 3V4MA 2NXEA 2O1PA 1AW0A 3W8GA 3W2VA 1BD6A 4G3IA 2JH3A 4DV0F 2D9PA 3MCOA 2JWNA 3TARA 1M5KC 1M5OC 4NE9C 2ZZTA 2H1YA 2DRAA 4HVZA 3W66A 2GAHC 3IAM9 3D6TB 1E6VB 2ZFHA 4S0MA 1UL3A 2HK2A 3KUEA 4DSFA 3UN5A 4C8YA 1NU4A 4LSNA 3QLHB 3MCMA 3P49B 3GIKA 4Y28C 3QIPA 1UVNA 3MM6A 3RZAA 2MQ8A 1Y00A 4DR5J 2ZEJA 1CQNA 3CD0A 4EZ9A 2RS2A 4CLTA 1D09B 2BABA 3HF5A 4QJVA 3KG1A 5EHHA 1F3FA 1SJRA 3DOLB 2G2ZA 3DI6A 3PO5A 1DTQA 4ZIWA 4WBFA 1PGZA 3P3DA 7AT1B 4WPAA 3IBFB 4E8UA 3OJSA 4DQQA 2J9EA 1CJTB 3J7A1 4X4TA 4DV6F 3HXMA 4BHQA 3BKFA 1IM4A 1H74A 1VIOA 2M9KA 3BGFA 5KFHA 1ZS6A 1REGX 3N6MA 4NLDA 2E1PA 1W25A 2O66A 1VQ9S 2R2UA 1V5VA 3PX6A 4B3MJ 3CULA 4DQRA 3QBCA 3V5RA 3OTDA 3TAMA 3DN9A 1UVLA 3VGVA 5F8JA 1F2GA 2QTWA 2IRUA 3OVSA 1LW0A 3ZZZA 1HBUA 1L3SA 2Q66A 2ZBPA 3DYAA 1OO0B 5CCMA 3TJ9A 2HFVA 4FXDA 4C9DA 1JIHA 3M30A 5E7OB 2CWKA 2WRMA 4C98A 2PD1A 4GC6A 3ZTRA 4K4ZA 1VOMA 4WYWA 1EETB 3E51A 3UD3P 1QLNA 3ISNC 2KJVA 4M94A 1URNA 3NGTA 2HRUA 5G0RA 1ELOA 2P8IA 4DR5F 4DG1A 1FKPB 3PJXA 1NK4A 1HQEA 2AJ4A 4ZCMA 2J8AA 4AT1B 5CZVA 1YBTA 2DISA 2YKMA 3BREA 5KT6A 1WI8A 3I5AA 2ATCB 1FDBA 2NQPA 2HBZB 2A3JA 1WSRA 2MY8A 3C6UA 1WC0A 3A4TA 3OT9A 3GQCA 4N47A 5ETMA 3T19A 4B3RJ 2Q3PA 3D2WA 1FERA 2PA8D 4ZK7M 3MTJA 4OX9F 4F4XA 2E5GA 2UVWA 3LUYA 1OMSA 2W2MP 2XMMA 3ISND 2Z8QA 2Z30B 4UY85 4ED5A 1U1OA 2XEXA 4B3SF 2HFSA 3SSQA 2RB7A 4DXLA 2EKNA 3MPYA 4PXEA 1Y9OA 2B7BB 2CQ1A 4B3MF 4NXNJ 2PE8A 3BN4A 4WU2A 2AKWB 3VAJA 2B7CB 3H4DA 1G6BA 2DPIA 1D9DA 5LMUJ 3MXHP 1PSDA 4DQPA 4CYUB 3CDWA 1S9EB 5MAOA 3NGDA 3R97A 3HVAA 3KLIB 3M6VA 1YBUA 3GLJA 4Y6IA 5SUHA 1UVIA 5IS2A 5EWGA 3KWMA 3LQVA 4LF9J 1VIXA 4HI2A 3CCTA 4IG3B 5LMNF 4JI7J 1DJ0A 2GQ2A 1BXNA 5D4OA 2X3DA 4TY9A 1HMVA 1PIEA 3ETOA 3I31A 2OP5A 3KHHA 1P8GA 1ZPWX 3ISZA 2AX0A 2MHEA 3BB5A 3WC2A 1WC1A 2R8HA 1SV5A 4XAKA 1W2BR 4AUKA 3FSXA 3C19A 1OYDA 4PG4A 4M5JA 4N5SA 2DH7A 1DQAA 1RK8A 3EXYA 4ZDNA 1FI4A 2HQDA 4WXOA 3BSNA 3QMQA 1RHJB 4CTAA 3AXMA 4M5NA 2RDIA 2QA4G 1DTTB 2GMLA 3GSDA 3KOAA 3BQ2A 3LP2B 1REVA 4CLLA 4R0EA 4IRDA 3HM9A 4LF4F 5EWFA 5CYQB 3GV5B 5KG0A 4CLYA 3IA0A 1YJTA 3GG1A 1M5HA 4KPCA 1XR6A 3KLEB 3D5MA 5HO4A 3KMQA 4JV0A 3VHQA 3QFWA 4GVBA 4IH5A 2BBEA 1IKXB 3PFOA 2HBQB 4NXNF 2KO1A 4OX8A 3FCWA 3LA0A 1RU1A 2MZJA 3W5XA 1KOHA 5A8KB 2DNYA 3GILA 1PO6A 1J5EJ 1OY8A 1F5BA 4CWBA 5LMUF 5GMDA 1FXDA 2N3OA 3W9HA 4TY8A 1S1WB 2NXCA 3AFGA 4ITSA 4EGLA 2KH9A 3DRRB 1RYRA 4GMKA 3G8TA 3AJDA 3FFIB 3J7ZT 2OSRA 4MMOA 4NWBA 4DUZJ 4LF9F 1NB2A 1UA0A 1WG4A 4RU2A 1RT5B 4JI7F 3Q89A 2CQGA 1U1QA 1TKZB 3S7RA 1KRPA 3PKYA 1X5PA 3FDSA 1X8DA 4MIWA 2Y0BB 1R8HA 1IBCB 2CYYA 4UW2A 2PEHA 4L74A 5ETQA 2G0CA 4JYAJ 2P9EA 4OI6A 2E7XA 4BWJA 4Q5VA 2DNGA 1IVZA 3PG9A 1H72C 3US5A 2HVZA 2OGUA 2BMBA 2JEJA 1VC5A 3PFEA 5GAEI 4JUZA 3GFYA 4X84A 4NA3A 3PRVA 4OI1A 1NKEA 2VA2A 4GKJJ 3DC2A 3RRKA 5T7LB 3MPDA 1NB7A 2YBVA 3KJVA 1V6HA 4A8WA 2ZH7A 1RHMB 4ECTA 3NNCA 3A8KA 2UP1A 1RT2A 4WJBA 4O4GB 4OYPA 3EXCX 2BJ3A 2LXIA 2ILYA 4C4WA 3MGJA 2QA4S 4DPUA 5A8RA 4DR2J 3D4JA 1YJNS 4BC9A 3OHAA 1QD1A 3AD9C 4IOCQ 3BGUA 2OPRA 1RT1B 1D8YA 3CD6S 3UNGC 2VBZA 1X4EA 1PBAA 4AQYJ 3EJMA 1J5EF 3EPIA 2UUAJ 3GZ7A 1AXQA 2P9GA 3ZNUA 2KG1A 3CCUS 4W98A 2OPQA 2ZE2B 2J7KA 4P6QA 5BJRA 4DL7A 2W9AA 3MR7A 4USUA 4OYZA 2VFTA 1K73T 1SC6A 5L39A 3ZZPA 1FJCA 2WTFA 2UXDF 1NBEB 4FPIA 3MAAB 2ZOFA 3KLGA 1RWMB 2H3EB 4CLZA 4HH0A 2BE9B 3G6YA 4RW9B 2MLZA 3QWUA 5EUHA 3LANA 1PCAA 4USMA 4F2SA 4LT6A 2VH7A 2XTJP 5GVQA 2WBMA 2WZ1A 5EDWA 4QWBA 4JYAF 4P2SA 1RT6B 4FYXB 2F63A 2DGXA 3M7VA 4QZVB 4ZHRA 2P2CB 3L7OA 1JLEB 5J2MB 3M8PA 3PACA 1BUXA 4C0OC 5KTQA 1TVRA 4GKJF 1VQ4S 5KFDA 3MR5A 4X4OA 3L4BC 2HMIB 1WTBA 2YNIB 1N5SA 1N0UA 1GMWD 3H8YA 2M7SA 2YX7A 5LSRA 3MUVP 1RT3A 1JJ2R 2Q43A 3QRRA 2DO0A 3JSYA 3BGLA 1DLOA 1IBMJ 3OTOJ 3PY8A 4EYIB 5DO2A 4B9VA 4JP8A 3TX8A 1HPZA 2HFZA 4KJIA 2YX4A 1NHVA 2Y1JA 2HIQA 4CLSA 1GX5A 3T6BA 2C3PA 2VG7A 1JXVA 4LSLB 2RQ4A 4AQYF 4PWDA 5K8PA 3RB0A 3HK2A 3M2UA 2UUAF 3CPWR 2GMJA 1U24A 3CCMS 2PFFB 2IYIA 1Q7LB 1RHRB 4W90B 3A12A 5DG8A 3T1HJ 1LV5A 4KH0B 2IVFB 1KQKA 2RDDA 3LP1B 3MCSA 4M5LA 4PAAA 4J91A 4ID5B 4DV7J 4URQU 2HNZB 5CD4A 2DGOA 2V63A 1SJ4P 3EE3A 4YQWA 2MXYA 2J5AA 4FZVA 4YB5A 5LJ5Y 2I38A 3LALA 1PYSB 1T0TV 3BBBA 5IM0A 1CS4A 1VYAA 4DN0A 2VJVA 5DGBA 3NGSA 3D54A 1A9NB 2CDQA 4LF8F 1KQFB 4ECYA 1ITPA 2DNPA 2B4OA 2RT3A 3MAQA 4QIWD 2W8LA 1GTEA 4DR4F 3BSCA 3PM9A 4CO1A 1U26A 3ZC4A 3L9ZA 4NLQA 4OYXA 2XZWA 2FB0A 4UT4A 4QWEA 5KFLA 3GCWP 5A0YB 3N28A 4XPEA 3CGIA 2GQQA 2EG1A 2YVSA 2KRRA 4ECQA 1IBMF 2A1BA 2RUSA 1CULA 3DMJB 2R8GA 2V9KA 2DXDA 1Y3KA 4JI6F 1GNKA 1YZ7A 1NSQA 3D66A 1F9HA 4FDFA 1R43A 4FN5A 1YBAA 1X4GA 3DRSB 4UTGA 3UCGA 3I9V9 5DS7A 3SSSA 2DO4A 1A0OB 1V3RA 3M8SA 4K4UA 3T1HF 3DOMA 2BACA 3H7HB 2A6MA 4H4MB 4CIOA 4RR5A 4PZVA 1EKRA 1SIZA 2GGPA 1RABB 4F50A 2XULA 4KPYA 2XLKA 3MEGA 1O0PA 2KHDA 2XGQA 5I3UA 1PJ5A 4ICLB 4Y2AA 1P1TA 2IM0A 5IXUA 2IBKA 2RHQB 2C28A 1XJWB 3MUTP 1TK8A 4YR2A 3N5BA 1TKXA 3TOQA 4MKBA 2ZC3A 4G6VB 4PYDA 3RR8A 2D69A 1QSYA 4R5PA 2VC1A 4OLOA 2R3VA 1N5YB 4NLVA 2AJQA 1HI8A 4ILMA 3OXLA 4FS1A 5J2PB 2QIFA 5B09A 2V69A 3CEDA 1L3KA 4USWA 3KK1B 1I1GA 2VF3A 2BJ9A 3KK3A 1F3VA 4ALZA 4NEYA 3FRYA 1JQGA 3Q8RB 1FE4A 4KAIA 4U95A 5HLFB 4O44A 4DEZA 5HQ8A 3TJAA 3ILIA 2FTRA 4G1QA 3IR6B 4H4KA 4DL0C 4KHRA 3IR5B 2ZH6A 2CAJA 4OJGA 3H98A 3M1VB 3CO0P 1RTJB 2RRBA 2JEGA 3P6YC 5GAEU 1J5OA 2DIUA 1MN9A 4CO0A 3FCHA 3KUGA 1JLAA 1NH8A 3PW4A 5D78A 4ZJQA 1JLBB 1SKUB 3K5OA 3FK4A 4C3MA 1LWFB 3D28A 9ATCB 4I6YA 3R5JB 1KR4A 4C11B 1QVGR 4DPWA 3PR4A 5GMKa 1SQFA 3MEDB 4R0JA 4IRCA 1ZM2A 3MFHA 3BQ1A 3BH7B 3BGRB 1UTAA 4IG3A 3R8YA 3V6JA 2UV8A 3RAXA 1IJFB 2IMWP 3RRGA 4LFCF 2G2OA 4N8NA 4ZCKA 2CQ0A 3N4WA 3AQPA 1N88A 3BSOA 3MMAA 3W3SA 2BOAA 2GVDA 2BE2A 3QIDA 5KAKA 4F26A 1SH3A 5I42A 2XMVA 5HJYA 3H2VE 2P6TA 2QL7B 3QATA 1SL1A 2VKRA 1K9MT 1RA7A 2ATLA 3QGHA 3IO1A 2KB2A 2GVZB 2ZH5A 3Q24A 3BEGB 2DHXA 3DGPA 4J90A 1RCXB 1RLCL 3V6DB 1JLQB 2QMXA 3DM2B 4LIRA 2FC8A 3TO8A 2OEKA 4JI8J 2YKPA 4F67A 4F0KA 3K5NA 1PC5A 4OMFG 2HHHF 1WHWA 3HFZB 1S7IA 2HNDA 3FZBA 1T05A 4EBCA 1NJXA 3K2YA 8RUCA 3EUNA 4IDKA 4KY3A 2QYGA 1N6QA 1HNZJ 3UDLA 1RAIB 1Q53A 2CPXA 1Q78A 3X3UA 4BWMA 3IXQA 2JX2A 4NRUA 4HDGA 1U2RA 3Q8UA 1RISA 3OXFA 1X4FA 1FFWB 3CJKA 2OPPA 3LP0A 3TX0A 3CXCR 4DSKA 1KOOA 4LF1A 4ZPWR 3W62A 2BZ2A 3DRRA 2R7RA 5KT5A 2HHQA 1IUJA 2AWZA 1BGXT 1CSJA 1WKLA 2YWFA 5LOQA 2HNYA 1F5CA 4DZDA 4FBUA 2EFPA 1UJ4A 1FCAA 3NLCA 3UI3A 3MUMP 2N82B 2R2SA 2XLIA 2UUCJ 4EO6A 2K7KA 1BQMA 2DNOA 4NZ6A 4N77A 3ILLA 1SL2A 2ADCA 1U6FA 2WB4A 2IDLA 2LQ9A 1HI1A 1H98A 4RO0A 2NXUA 5BR8F 5HSPA 3IP0A 2N3LA 5HVGA 5EGYA 1IQTA 2RQCA 2E9TA 3PEJA 4WP3A 5DZ7A 4ZOSA 1KLNA 2FJVA 2HIYA 3KLFB 5T7LA 1RTHA 2GJ2A 3CB4A 5KFKA 1S6QB 4L3KA 1GXUA 3ICLA 4WE1A 4DU7A 1T9UA 3DKDA 1C0UB 4N8OA 2CPYA 4HLBA 3NKYA 4WFAQ 3NBPB 1WDDA 2PT0A 3WIVA 4ECZA 3N5FA 4OZ5A 4KO0B 4C0BA 1HQUA 3U1NA 2L9DA 2J7UA 2BX6A 1RT1A 1CJUA 2V6AA 2WSFC 1H73A 1TQLA 4M5GA 3GYNA 2KM8C 3CDEA 3BBCA 5EX0A 1Q7YT 4L73A 1VJQA 2EC2A 1RCOB 4W92B 4U7UK 2A10A 1FRKA 3GONA 4CCHA 1HWLA 3DRYA 2W7AA 2ZD1B 3HCXA 4LF2A 3RG6A 1HBNA 1LWCB 4ZITA 4XDDA 4OYOA 3RB3A 3VAIA 3HSJA 1NRKA 1IJEB 3OLAA 4JI5F 5E3QA 2UUCF 2JDJA 2K8GA 1AUSL 1R6YA 1NSPA 4HHHA 3UFCX 4P2XA 4K0KJ 1P6TA 5DDRC 4U8VA 1S1VA 3L7PA 5HVHA 2L41A 2E5LJ 2KVQE 2V8HA 2KT5A 2YNHB 5EX3A 2NYHA 1DAXA 1TZ0A 2XSFA 1S49A 2RQMA 1XMBA 4NLGA 1JLEA 4Q2LA 2G13A 1RWWB 3JSBA 3FSIA 3Q0AA 4DSJA 2XMKA 4Y2CA 3M9MB 3U1LA 2KZMA 2CDRB 4ZPVR 2OMLA 2YNIA 3K17A 1ZOTA 2QFJA 3D1HA 4NLRA 5CH7B 1NKCA 2HQGA 2BKPA 3O2IA 4I56A 2BR0A 3HVRA 4DX8H 1S0VA 2B51A 1S9FA 5J1EA 5CCLA 4RW6B 4CO2A 1SJ3P 4B17A 3TI0A 4I6WA 6FDRA 2BRKA 2QLWA 4D3GA 4PWUA 3A13A 3KMSA 4M63A 2CQBA 3QNWB 3QT7A 1UWBB 3C14B 2PMZD 4B9SA 3LGMA 4GKKF 1Q5YA 1WEXA 2Z57B 4DV4F 2KXNB 3CWJA 4ZP7A 1UAWA 3MAHA 3KK2A 4QQBA 3PW5A 1VK3A 2J9CA 5IWAJ 5L46A 1FHTA 4OZ0A 1WG1A 3EZ5A 3FJ2A 1SBRA 3GIJA 3ADAC 2JLFA 4IQMA 4ID5A 1SKRA 4DV3J 3DOKA 1S1TB 4WFZA 2ZOGA 2LCWA 1IR1A 1RTDB 4KR0B 2A6OA 2HLUA 1QY7A 4NA1A 2M8HA 4B3TJ 1OQ6A 3KYLA 2MKIA 2ZM6F 1QM9A 2R42A 1TKTA 2UUWA 1TR0A 2MZ1A 1HWKA 4QPXA 4TQRA 1N0VC 1JLCA 2CPDA 5CA5A 2DNMA 2QLBB 3G8SA 4XO0A 1PAEX 2DVIA 3Q8VA 4DDFA 3O6QA 3P5BP 3BPSP 3ENVA 1FRMA 3QFHA 4B3OB 3GYXB 3CMES 3CCZA 3GJRB 1F9FA 2RIJA 4NRTA 4X4SA 1UZDA 1VQ6S 4YDXA 4UUWA 5DDPC 1S7HA 2MKCA 4RNHA 2LQ8A 2IVMA 1O8BA 3VQTA 4F7VA 2MKJA 3TJ8A 2MZTA 3CW2C 1YX2A 4K4WA 4KFBB 4OV6A 1IWAA 3DMJA 2OUGA 4QW9A 2K7JA 2IJNA 1ACMB 1XMQJ 3CVKA 3HHKA 3ET6B 4WCEQ 3H4BA 1JX4A 2QEXS 2CVEA 1R0BG 1RWUA 4MFBB 2MKKA 2XI2A 4UQTA 1T11A 4NMLA 2M0GB 4OQJA 2OKQA 2AGQA 1OSCA 1R8CA 2EBEA 3D6HB 5IWAF 2I9SA 1TL3B 5KG5A 3KJFB 2MLXA 2ZBIA 1ZA1B 3FMBA 1VQKS 4AL7A 2IVYA 1N36J 5CYJA 3MF5A 4YP3A 2MSSA 1ULRA 1XN9A 2RF2A 4DV3F 1UZHA 2BQUA 2LDIA 4QR0A 3EMTA 3MURP 3OTCA 4WP8A 2F1FA 4J37A 3IRXA 4OYMA 4OJ3A 2MLYA 2AW0A 2RD5C 1Y5NB 5DRKA 4B3TF 3H2LA 2CA9A 3VV2B 1R0CB 2W4PA 2V2KA 3W65A 2Q1LA 5F8HA 3OL6A 2ZJQQ 1H7WA 4O4RA 2FZKB 4QPTA 2RVJA 4AL5A 2B5JB 3O5TB 3ZXWA 4N56A 1VLYA 2JEIA 4J9NA 3A1YG 4HKQA 1YKWA 2VUGA 3CF5Q 3MEKA 1N5YA 1B0PA 3MD3A 1RTIA 3KNAA 2WVDA 1L3TA 1RE1B 3W2WB 5J2PA 2OAUA 2NPFA 4J9QA 4HHUA 5U47A 2V8GA 2IA6A 2LU2A 1IWGA 1NZAA 3TVYA 1Z4UA 2FJDB 1L5UA 4DR6F 4PG5A 1WORA 1EARA 1S76D 4YN3B 3LO3A 5IOLA 4IYQA 2Q6CA 2F40A 1HBOB 3I0SB 3MCNA 2DHAA 3NMRA 1FDAA 1RTJA 4X64F 4FKXA 4WK3A 2DEJA 3IBCB 4WTOB 4DV2J 4H4KC 4PG7A 2YKAA 3ZTSA 2GIRA 1JJCB 1N36F 3F41A 2FUG9 5MLCV 2QMUB 3BGRA 1OY6A 3EZOA 2IM2A 4E2FB 3W2VB 1S4EA 3CC2S 2BKOA 1WDTA 1J2VA 1MNEA 2PI5A 1JLFA 3H5UA 1NZ8A 3RBDA 3HJVA 3K59A 2C1EB 2X3GA 3IN5A 3JXOA 4F04B 3N01A 1Y0HA 1FK9A 3AODA 2P9CA 3MM5A 4X4PA 4NLYA 4RW7B 2R7WA 3KLHA 1GMVA 3FC9A 1R7IA 2ZOMA 3B6BA 3QIPB 1NK8A 3MM6B 3OXGA 2G1DA 4O3PA 3T5LA 2DGVA 2UVVA 2GHVC 3V6DA 4C8MA 2AU0A 4DOZA 1UVKA 3G82A 5D8HB 2DYAA 1KQSR 3TR5A 2RJZA 4YHHF 3DRPA 4EEYA 3GJSB 3H0PA 2PGCA 4WKRA 1NPKA 1F0XA 4A4JA 4FP9A 2XHWA 5HVFA 2IIHA 3DI6B 2D74B 4LQ9A 1R3NA 1DTQB 2MEWA 4ZA1A 2HW3A 1WSVA 3MM7A 2M5YA 1XTZA 3R5CA 2HHUA 3UVJB 3ZO7A 2NXNA 3PIPQ 3M2VA 2F3JA 2YPYA 1N34J 2ZHBA 1B7FA 5HP1A 4DR3J 3GJTB 1RLDA 2WONA 5IT9U 1RB0A 1PG5B 4YR0A 3OVBA 2YH1A 2ZHAA 4O3QA 2X1FA 1FTCA 2FYXA 3G2XA 2IHR1 2D3O1 3M8ZA 2OO4A 1HHSA 3VCDA 1RBAA 3NNAA 5SZTA 2F9JA 4WK1A 1LW0B 1HBUB 3P45B 1ZZFA 5HBMA 3DYAB 3SCLE 1RA6A 4UOGA 1IKWB 3CJ0A 4FNHA 1OJ4A 4X4RA 2ZC4A 4U96A 4F4AA 3FEZA 2EC0A 1KKHA 3M30B 3MTKA 4P71A 2HLTA 3U02A 3HHNB 3QQCD 4YB7A 3MEEA 1RAJA 3TUZC 1TU0B 3DXSX 2Y1IA 3DLJA 3KHGA 4KGMA 2AYBA 3K8WA 3I5BA 5G0RB 1TFYA 4DG1B 2YQ1A 2Q79A 4OHYA 1HQEB 4OHWA 3CJTA 1T9XA 3C16B 3J7Z5 1XR5A 4RNNA 2H5EA 1QJHA 1NK5A 2YKMB 2B8PA 2X1AA 4IR9A 3W5YA 5ADZA 4EBDA 5I4MA 4ZS6A 1MLAA 4ES2A 2CJXB 2CPEA 3C6UB 2R2TA 2YWEA 1N32J 2BANA 1VC6A 5DDOC 1VQPS 2PN6A 1HR0J 8ATCB 3TA2A 1V3ZA 2KU7A 4K50A 1X60A 4KB7A 3MI7X 4QIVA 4DR3F 2RU3A 2OLWA 1FD2A 5B0BA 2AJ1A 1Y10A 1UVMA 4DPYA 2UVUA 4BCAA 2APOA 2AD9A 1O6XA 1KNZA 2IY5B 1CG2A 1M1HA 3R7NB 2KG0A 5IC4B 2HAIA 4PG8A 1PJ6A 4L6V3 4K4YA 5J2QA 2EI5A 1OPZA 2VONA 1TL1A 4IH6A 3QT8A 2DT9A 1KWMA 1TKDA 1S0MA 3Q8SB 2WB1D 1WOSA 3OPKA 2IPOB 1NJWA 4EO8A 1Q8IA 3VAFA 2AJFE 3IM8A 4L72B 2UUBF 1DZ5A 4DUYJ 2V68A 3H2UB 1H6KX 1WJ9A 3P4UB 2CQCA 2G2YA 3CCLS 4FVCA 1PILA 1K44A 4JI1J 2DITA 1T3OA 3NEKA 1HMVB 5KFAA 1U8WA 1YITS 2XCAA 1IBLF 3T9NA 3CCRS 2DK2A 2UXCF 4USIA 4F8RA 8AT1B 3T6JA 5C5JA 4DL4A 1HKAA 1SB6A 3RRHA 4ZLJA 3W8PA 1SV5B 2PMHA 5T14A 1M1GA 3A8IA 2SXLA 4IFYA 3JSMB 4RW6A 3PIOQ 4D3HA 2XZTB 1HNXF 2O67A 2N7CA 3UWTA 3S8SA 4GO5X 1EAYC 4ZVGA 3LOUA 4DS5A 4CTAB 1N32F 1DURA 3TAPA 4CH1A 1REVB 3RAMA 1HNIA 3NRBA 4F3MA 4TLQA 4P72A 3KFWX 2LEPA 1D9FA 4PKDB 4LR8A 1TK5A 4Q0BA 2Z4PA 2OFGX 4GVBB 3ZZUA 1MN7A 4DFJA 1FNMA 2B4UA 4J9MA 2ZDOA 3PW7A 4KGZB 2VQFJ 2YKNA 1WKKA 1U47A 4PXCA 4UY8T 5IC6B 1RACB 2CNNB 5DG7A 1PYTA 2IRXA 2GS8A 5D0HA 4DI6A 2HFNA 2BKNA 1K0VA 3T1YJ 4TY8B 2J8SA 1LK7A 2AYGA 4DUYF 4X4VA 4K2XA 2HHXA 1VQ5S 5F0UA 5JJBA 4ZMMA 1X0FA 1V5IB 2ZZNA 2Y8YA 4M5DA 2VPYB 1HD1A 1PYOB 4LF6J 3OR1A 3ZZRA 1T3NA 3NS5A 3VALA 1OY9A 1RWXB 2ZDPA 4NLTA 3IS9A 1Q8KA 1NDLA 1Q95G 3R9LA 1RWNB 3GMGA 3T5JA 4PYAA 2HZVA 4DWIA 5GADI 4IOBA 1HYSB 1XNQJ 3KKFA 3NS7B 4TQSA 4G1IA 3GYGA 4CI0B 3DLHA 1C4CA 4I0WA 3G71S 3TNVA 2WSEC 2UZAA 5HMYA 1KBRA 2JFDA 3KJVB 2ZH3A 3RBXA 3TYTA 5CABA 1LK5A 2R7VA 4QR2A 1RT2B 4PXBA 3EWGA 1MMNA 1WD6A 1DBDA 4DFKA 3QT6A 5KG7A 3TANA 3VR1A 3NY0A 2V8DA 1VFJA 3H40A 5IZHA 2KM8B 2XZDB 4J9SA 3PXGa 5A8RB 3D7SB 1RBOB 2VQFF 2OPRB 3IM9A 4F4KA 3G86A 5E3PA 1FKAF 2VDIA 3B4MA 2EXUA 2OSQA 2AT1B 4ZCIA 2AV5A 2KI2A 3OFFA 2OPQB 4LF5F 1FT8A 1GXTA 4I2QB 4WKYA 2MQNA 5JVGQ 3M6UA 1M0SA 2XLJA 2E9RX 5C42A 4IG0A 3HPOA 4HR2A 2E1AA 1JMTA 3L3CA 2ERRA 3S6EA 7FDRA 3V2UC 2V8VA 4DFPA 1VQYA 2XS5A 1CJVB 2VBWA 3KLGB 3KJNB 4XDCA 3RTVA 1EIYB 4RKUC 5H1SV 4DPXA 2MB0B 5IT0A 2YNGA 3W9JA 3CCQS 5KFQA 5E3RA 2W9CA 2DD8S 3C15A 3W60A 5IV3A 4K2JA 2GV1A 3HMJG 1CEZA 4ZHRB 1XNQF 4NX9A 1MU2A 2MZRA 2AZ3A 2BOPA 3M8PB 3K5MA 3J7AN 5ETOA 2RAQA 1TVRB 4XTTA 5K8MA 2BJ8A 4PEOA 5GAGI 2R8JA 1JK9B 4MK9A 1MW7A 1Z1ZA 4X65J 5J2NB 2V34A 1S5ZA 1IR2A 2FPHX 5EN1A 4PXDA 1NJYA 3MOZA 1RT3B 2AHOB 3BN7A 1MROA 4X62F 3PKMA 2RQKA 4LRFA 1DLOB 3BBFA 2MHNA 1HPZB 1Z2LA 2J0WA 2R9LA 4CLFA 1WNEA 3TRGA 5AJ3F 1GK8A 2E7WA 2W25A 3KXDA 4I68A 4I64A 2VG7B 2Q6BA 2BJ7A 4YB6A 2FY8A 1DRZA 4PWDB 2HS0A 2LEAA 3LTOA 3M2UB 5IT4A 1ZM9A 2OJ3A 4NCGA 4NEZA 3CC4S 1XWLA 4WF9Q 1VRTA 4ZP9A 1XR7A 2Z2YB 3NP5A 4OZ3A 1M1KT 1N48A 5DDQC 4R25A 5B7WA 2VFUA 1S72S 3MMBA 2DH9A 1WF1A 3TAQA 3HSGA 2V94A 3VTIA 2J0SD 2GFFA 3KDOA 1S57A 2XMUA 1NDCA 4RW7A 2EKYA 1K0TA 1UFKA 5I3QA 4DU8A 1WELA 2J9DA 4JOUA 5DLFA 5KFWA 1U7LA 2QSFA 5IM0B 1CS4B 5KFBA 3R5BA 1EX8A 1CC7A 2B6AA 3POTA 2HYIB 1QUVA 1VRQC 3BPDA 3LAMA 2W9BA 1SKWA 1Y11A 4DR7J 2KFZA 3HZEA 4ZJOA 2NCKL 2IA0A 4ELVA 3GFXA 2QRRA 3QYYA 5A2QU 3EGNA 1QE1A 3CCWA 2ZVIA 2XGPA 4U7UD 1D9AA 3MM9A 1XMOF 3ITHA 4M5IA 1VQ7S 2QL5B 3UVJA 2YQ0A 5A6PA 3ENQA 4IO1A 4XK8C 3TUIC 1U0HA 2YNFA 2UU9J 1S12A 2AJ2A 5C25A 1CULB 5EWEA 1RTZA 3CMAS 5ETRA 3PHTA 4YB1P 3ULHA 2RRNA 4R8UA 1TV6A 1UA1A 1NDKA 3JQKA 2C2EA 3CNQP 4OI0A 2L08A 2ABYA 3QAEA 2DTJA 3QT5A 1CPZA 3J7YI 4UOFA 4RZRA 1NLKL 4IKAA 4Y65A 1Q8BA 3FGVA 1T9WA 1TAQA 1IKWA 1KFSA 1UVJA 3DOMB 1VQ8S 3NGKA 4ECUA 4RW8A 4OJ1A 3LPYA 1Q82T 1S4FA 2AX1A 1FNXH 5AE1A 5FDLA 4F36A 4LF7J 2GGPB 1HNVA 3MEGB 2R7XA 1RWVB 5I3UB 1PBUA 2CFXA 3HT0A 3SQGB 3DU5A 2ILZA 3K7RA 2PI4A 3M32A 1R0AA 4KHPJ 2MGZB 1TKXB 3M8WA 1KVKA 3IGNA 1AA1B 3C16A 1HFEL 1GQEA 1NKBA 3M9NB 4QYZJ 4R5PB 2EVZA 3A3PB 1BY9A 2YTCA 3D6MB 2X1GA 3P5TL 1LEOA 5KOXA 4ZVTB 2CQPA 1F9EB 4I7FA 4IFVA 4CLKA 2CUYA 3UCUP 4ZLNA 3M6XA 3BH6B 1YJRA 2KHCA 1FJ7A 3H25A 4WZMA 3KK3B 2UU9F 1RI7A 4RW4A 3P8BB 4B9MA 5F8NA 2EFQA 2XMAA 1NK9A 4IUFA 2JC1A 3CC7S 5ETTA 4NLSA 5H9FK 1BWEA 1X4CA 5F41A 2LEBA 2XMJA 4O44B 3HO1A 1DQ9A 2M2BA 1N56A 4G1QB 3QO9A 5GADU 1U09A 4P9SA 3K58A 1WC5A 4AD6A 2VL1A 1J5OB 1CBKA 3OL8A 1Y3JA 1JLAB 2BM0A 4ER8A 4MK7A 1I5OB 1VK8A 3BDPA 1VBZA 4F4WA 1C1CA 5D77A 4YEAA 2CKWA 2HAFA 3AOAA 2PO4A 5H9EK 3DRXA 1FRXA 3M8QA 2MKHA 2JVOA 1FKOA 3CCES 2MJNA 4EFAC 3FSYA 1IQZA 4KH1B 3R2DJ 3DNCA 4FYYB 2H51B 3DHWC 1Q81T 2JZ5A 1S0NA 2CJYB 3MMAB 2J9DE 2YXLA 1U8SA 4HEA9 2EFNA 2CVIA 3M8RA 2CZVC 2GVDB 1AFIA 2BE2B 2AYMA 3DLBA 5DGAA 3HHDA 3JSMA 2LQJA 2RMLA 5I42B 4Q2MA 4LBHA 5A2QY 1IKVA 3KTQA 2C2OB 1VRUA 3CSKA 1SL0A 2XC9A 2CADA 2EEYA 3AJ1A 3DGPB 3KNGA 4TU8A 4DZ6A 1NJIT 4M1KA 4B3RF 1YG0A 1S77D 2V2QA 2MZQA 2FJAB 1YRUA 4DV5J 3N9UC 4NCBA 5KG2A 2LDYA 2W2OP 2LXFA 3HI9A 2V5HG 2G0JA 2DNNA 5KG3A 1T05B 2HNDB 2XYGB 1M90T 2DHGA 2VICA 3CDBA 3EVOA 1VMBA 4IDKB 1N6QB 3PVXA 1RZMA 1CLFA 3FEYB 2OPSA 2VOOA 1WF0A 3DLGA 5ETSA 2CNLB 4DS4A 1OIAA 1NM2A 4ES3A 5GAGU 1KLMA 3D0HE 4TYBA 3CJKB 5KFFA 2OPPB 1FX4A 3VGUA 3LP0B 2M52A 4MTPA 3MFIA 1WACA 4NMXA 4ZLPA 4MKAA 3JS9A 3ZZTA 4RNMA 4DSEA 3D1QA 1QTMA 4NYOA 3TUPA 2HNYB 1JKHA 1RWPB 1TK0A 2M4MA 2OD4A 1RT4A 2FJWA 2AJ0A 4U8YA 4FF1A 2DPJA 3GWCA 1VLOA 2XSJA 1BQMB 4A8KA 2GMHA 3D68A 4N41A 1T95A 4YMEA 4WIIA 2RS8A 4JI4J 2VFSA 3HVTB 1ZM4A 3JAMU 1U6BA 2PIIA 2OH2A 1HYSA 3TA0A 2F5GA 2DCLA 2J6TA 4WFXA 4WZQA 7FD1A 3ZZ0A 3NOCA 2GHWA 3G96A 3RW6A 2RSQA 4RX6A 1RTHB 3M8YA 3DLEA 3GV8B 4WE1B 4DR1J 4USJC 1KC8T 1N52B 1UFLA 5KFMA 1J27A 1D8ZA 2LVWA 4RNFA 4OZLA 4K8RA 2POKA 3H5XA 1FFSB 3T5KA 4C97A 1HQUB 2PA3A 3W7BA 2DBBA 4QIGA 3FBEA 1RWKB 1QAXA 3OR2A 4CRJA 1C0TA 4L76A 1CJUB 2RHSB 1RT7A 4LMZA 1I3OB 3TEHB 1R6VA 1UPMB 3QRQA 1S1XA 1CVJA 4I2QA 1U1LA 5HL7Q 5IFMA 2GJIA 2XG8A 3D1OA 1ZA2B 5BXIA 4ID8A 2AEFA 2LA6A 4QYRA 5HQMA 4ED6A 2ZHOA 4QIEA 4DUZF 1FJEB 4V1Ak 3PTWA 4URSA 3BO4A 5L1KA 1HBNB 4YOEA 6FD1A 4PABA 2QJ3A 2H48B 1CJVA 2CZ9A 5KFZA 4M95A 1F6TA 2E1RA 3NNHA 4KHMA 3M9OB 3LPEA 5KFRA 3C8YA 1S1VB 1SXLA 4JI4F 2E1MC 1OSDA 1GT8A 1S9GA 3J7YU 5LL6d 1WG5A 3FQLA 4RUCA 2W24A 4AYBD 1FD8A 2MQPA 1YDLA 4CT9A 4ES1A 4DPOA 1VHFA 3WDOA 3FBCA 2D9OA 4U7CA 1OWXA 4KQZA 1TL5A 4JV5J 5J2NA 5KG1A 3ELHA 2HFUA 2HVIA 2B4VA 3GG0A 5F9NA 4GRSA 4USHA 5J1EB 5KOWA 1DY3A 4FS2A 1LNQA 2BW2A 2ZH4A 1VBYA 3PO4A 2XY7A 1V3SA 2CJBA 4DR2F 1IBKJ 3EICA 3ZTQA 4RWXA 3OL9A 2JVRA 2KXHA 1XC9A 4CO3A 2EBGA 2R7QA 2BA9A 3KK2B 4H54A 3MR3A 2F8HA 2K1RA 4DUTA 3PDNA 1YJWS 4QCLA 3TUJC 2AGPA 2B8QA 1BQNA 2RU9A 2VG5A 4ENOA 5KFOA 4Z37A 5G4DA 4M5HA 2EFOA 3JQMA 1U45A 4DL5A 1N54B 3NL0A 2MQOA 4LR9A 3GR1A 3DOKB 4MH8A 2F4VJ 3Q2TC 3FBBA 4P2FA 1S79A 4PQUA 3BO2A 3MR6A 1EQMA 2ZBRA 4GC7A 1YJUA 1LFWA 1H3DA 3O44A 2FLPA 4A8OA 2WW8A 4A8QA 4YDDB 2W7PA 1VR6A 2GC8A 3MPVA 3Q23A 3AA9A 3KJQB 4J9LA 1HD0A 4ZPDA 1JLGA 3FNNA 3QSYB 2VDHA 3UN2A 1ZAVA 1TKTB 3JAMY 1K1SA 5B0AA 4NZ7A 1KFDA 2L3MA 3GP9A 3FEXB 1JLCB 2VC0A 3J80Y 1ZTTA 5JMNA 1ZPVA 3JYTB 4X4UA 3MECA 5L9NA 2RE1A 1HHQA 2XHCA 2DGQA 1A6LA 4ZVQB 4B02A 4HACA 1AFJA 4Q8EA 2DNQA 5AXKA 1VQMS 4BBYA 5DJBA 2DGWA 4KTQA 3VZHA 1DQ8A 1X5SA 3Q86A 4ZVHA 3BYRA 3R6GB 5DLGA 4OV1A 1YTYA 2QX0A 1IKYA 2Y1LB 3OTOF 1FESA 4ED2A 3Q2SC 1X9WA 3OSPA 2ZH8A 4DV0J 5JVHQ 2HHPA 2LQBA 1IBKF 1GMWA 1FNOA 2MZSA 3BM7A 1U48A 4C8NA 3DLKA 2MKSA 1UP1A 1T02A 1X4BA 4ZPTR 4OZJA 2B9EA 3GFZA 2F9DA 4LVNP 3L95X 3M4XA 4PR6A 1N4LA 1SJQA 1D3WA 5IQQA 5AE3A 2K06A 4CDIA 2D3OR 4OX7A 5LSOA 2MJUA 5DQGA 1N33J 1YSJA 2WBRA 1P9QC 2YQ3A 3G87A 4DV7F 2E9ZA 4X2BA 2RF2B 4KSEB 4WIQA 4JI2J 2DR5A 4AFFA 3IRXB 1AZSB 3CJSA 1UJ6A 3M6WA 3R1LA 4OHZA 1ZBTA 2NR0A 1LXNA 2VBXA 1X9MA 4P10A 3SQGA 3TQEA 2H54B 3OBIA 1AT1B 2QT7A 1ROFA 3GFHA 1YJ7A 3L09A 3MMCA 4DV1J 2MGZA 4XPCA 3MHYA 3UNYA 1FX2A 1KS2A 3HHLA 4ANEA 4DV6J 1YRXA 4LVOP 2EW9A 5K20B 3UR0A 2GHPA 5B0EA 2J0QD 3GPAA 1H38A 3R2CJ 5K14A 1RTIB 2DEIA 2WVBA 4DCOB 4Y2MA 5ETPA 4NI2A 2XI3A 2FQQB 1GMUA 3CDAA 3OQ2A 3CJ5A 5KFIA 5BYQA 5I3PA 2ZNYA 5B08A 2W7OA 1YZ6A 3GIRA 4DX7A 4OHXA 2P6SA 3G8QA 4OIXA 2BYCA 3A8JA 2CJAA 2HRYA 1S99A 1H2UX 1XK8A 2YWGA 1UW9A 5KFTA 2OEMA 2GIQA 1XEZA 5D6GA 3I4HX 3AY0A 1C4AA 3A3OB 4HTJA 3CCJS 3K5PA 4CM2A 4ILLA 1WHYA 2GNKA 2WSCC 1BWVA 2VHGA 1EB0A 1LW2A 2VV5A 1FRIA 3M05A 1N33F 1BHNA 3T41A 2QC3A 4TVAB 4IQXA 3NMAA 2ASJA 4JI2F 2VQEJ 4O3OA 3JTPA 2Y1RI 3CO9A 3SI8A 1CJKA 2VASA 3T1AA 4USTA 2DXFA 1HBMA 1JLFB 4PG6A 1FWKA 1G3OA 5D15A 5LXYA 2VB6A 2C2MB 1W7WA 2DR8A 4DV1F 5HN0A 1FK9B 2QE5A 3MM5B 3FUYA 3PJWA 2R4FA 4OX9J 5LM7E 4B9NA 1V9OA 3KLHB 3R5GA 3UW1A 4B08A 3QWPA 3OVAA 2ROPA 4TLRA 1FF2A 3UR3C 1UJ5A 2UXBJ 3E3XA 4B9TA 4B3SJ 1UMJA 3KG0A 3ZNJ1 5E41A 2E44A 3G82B 1T03A 4ZKAA 3NWRA 2AEMA 3EX7B 2KFNA 2CPHA 3DRPB 2E5JA 2EFGA 2NLWA 2FVRA 4EK2A 4Q8FA 2DNLA 5B0DA 5KT7A 4NOHA 4NLOA 2IAJA 3THTA 1DARA 5M2RA 5F8IA 3UDEA 4Q7AA 2HGLA 4C8ZA 2IDEA 3H5SA 4C3LA 4F02A 2JSXA 3GCXP 2HQFA 4EU0A 1F2HA 3MM7B 3ILJA 1SUQA 2X1BA 2YH0A 3RJMB 4I2PA 1P27B 4KKOB 3M2VB 3HZGA 2VD3A 2CWXA 4V19X 2RDJA 5HP1B 3CJ2A 1S48A 2QA2A 4KRWA 5LMNJ 3OW2R 3T5HA 2WONB 1Z2ZA 1S1UA 1TUVA 1C1BA 3BJYA 4HHJA 3B8HA 3BV8A 3LW5C 2I6WA 2HPUA 3OUYB 4ZP8A 2F8MA 2VQEF 2E66A 3L7UA 4KGKA 4DQSA 2IMOA 2PDAA 2QLFB 1QSSA 1JNZB 5HBMB 2R7TA 3G6VA 2WW4A 2FD2A 2DRDA 3H90A 4ECXA 5FD1A 3M2RA 1U1NA 4C0HA 3PX0A 2YWHA 2HURA 3BYPA 4LFBJ 1C2PA 5KFGA 4DL2A 3TZXA 2CQ4A 4AXJA 2FJBB 3HVTA 1FRHA 4DF8A 1SH2A 3SIPB 2N4DA 3CJ8A 4LF4J 2RKIA 3MEEB 1BE4A 1FEHA 2R8IA 1RYSA 2ADBA 2UXBF 3OTBA 4K5RA 1RDRA 5KFNA 4K4VA 3K5LA 3DHXA 4JV1A 4JI8F 2JFKA 1XIQA 3V4IA 4H4OB 4IO9Q 3D6FB 2VBYA 4A8XA 3MPUB 3KLVA 4P74A 1OQ3A 2VZ9A 1HNZF 4RBVA 4MIAA 2HSEB 2N7YA 2DXEA 2BANB 3PYEA 3AT1B 2H5JB 2ROGA 3HJFA 4A46A 4Q43A 2KTQA 3R5AA 1B0VA 2KXFA 1TAUA 5A6WA 4ECRA 2D41A 1Y5LB 3W1YC 3W64A 4ECWA 5D4LA 2QMWA 2OELA 3VVUA 2C3OA 4KGVB 2AYEA 2KT3A 4PQAA 3AXKA 5J2QB 2DJWA 1FWLA 3T9ZA 3S1TA 1TL1B 2BE7D 3SDEA 2L48A 2PFDA 3SCJE 4JBCA 2V50A 5E5NA 4LJMA 2BEFA 2DNHA 2E29A 4Y34A 5ITHA 4LRCA 3HX9A 4LFBF 4ZLLA 4EYHB 1A7GE 4C6AA 1MMDA 3OFGA 3SMZA 3MPWA 2FLOA 3O8WA 2AGOA 2O3DA 3LF0A 4F3OA 2UUTA 4WFNQ 2Y0SD 1U1RA 2JLGA 3U1MA 1NHKL 4RU9A 4A8SA 3RAQA 1LWXA 3FKBA 5HMZA 2BJEA 1RU2A 4P73A 3HHEA 3HT3A 4DPTA 1GAOA 4IFYB 1E6YB 2RILA 4A8FA 1WKJA 1N5VA 1NMEB 3DFEA 4ANDA 2CNKB 4MIBA 5B0CA 4ERDA 4Y2IA 4W4MA 1UEKA 3GR0A 1MMLA 1RHQB 2UVRA 3OLBA 2CNOB 2W4CA 1RAAB 3QAUA 3ILOA 1HNIB 2VFRA 3CMQA 2I8EA 3AB4B 3SYZA 4NCAA 3F56A 1K47A 4F25A 1WHVA 1NSAA 1EQ0A 1VHIA 2QLJB 2UXDJ 5CAAA 3E01A 5CYMA 3C6TA 2DCUB 1GXLA 2BM1A 6AT1B 4Q0BB 3AOBA 3GJQB 4MT1A 2DH8A 2C2KB 4A8MP 2C3YA 1NHUA 2D1CA 2YKNB 5D3GB 3C3LA 4CQ1A 4CLPA 2V67A 3IG1B 1RWOB 2JLEA 1P1LA 4DSLA 4FBTA 2FY1A 5A8WA 1VI7A 5HROA 2ZJRQ 4FYVB 4MYUA 5ETVA 4OHVA 5GMEA 4K0KF 3LGNA 5B0FA 2E1CA 3UQSA 1Q4RA 3I0RA 2HEKA 2HVHA 1TELA 2VU5A 3TVZA 3CIMA 2HHVA 2E5LF 3ZZOA 1YJ9S 2FHJA 3G9CA 5FJ4A 3FZ2A 3PYFA 4M5DB 4OX6A 2PMWA 2GCFA 4KV8A 2ZH2A 3JYTA 3OR1B 2K3IA 4TXSA 2VJUA 4NXMJ 2ALYB 2B9YA 3IS9B 2XWYA 3V81B 1LWEA 4TKTA 3I9ZA 1D1UA 2LECA 4L3NA 5B0GA 4TN2A 2EK6A 2FDNA 3D9BA 1OS5A 4CH0S 2KYZA 2GAGC 4ATNA 2MSTA 2DKOB 4JI3J 3I56S 2HFOA 2OFHX 3GTYX 3S01A 3ETMA 3TA1A 2CPJA 2H4WB 2HBYB 9RUBA 4IOAQ 4Y2KA 5JXSA 3UN3A 4TU7A 2H5IB 1RBLA 3SZ2A 2V4JA 3TZWA 2KKHA 4LIWA 3MM8A 4DL6A 2OIHA 3AH6A 3MD1A 4FYWB 4DLGA 3PV8A 4F0MA 4ZN3A 3DU6A 2WHOA 1QAYA 1ZM3A 5AXLA 3B78A 4OYAA 2AEJA 1T8EA 3WZ0A 4X4NA 2QN6B 4G1PA 2Z2LA 5GAHI 3V6HA 4LF8J 1AZSA 4QU7A 2FJEB 2CQDA 1DFDA 5J1PA 4J9RA 2QYCA 1JJHA 2GIFA 2W01A 3DLLQ 2I0XA 4DR4J 1SH0A 3W5ZA 4ZVSB 4PRFA 3NCPA 2NYIA 3AB2B 1EP4A 1UPPA 1UKUA 2IJFA 1Q0NA 3DXBA 3K89A 5C42B 4IG0B 3N6LA 2V2VA 1NK7A 2HRTA 1QSLA 4M5KA 2NZ4A 4RNOA 1M5PC 4CNZA 1RKJA 5DG9A 4NXMF 3NG8A 3QGGA 3HHLC 5L9XA 3R27A 2WAQD 2YNGB 4PUOA 2ZKTA 4JI6J 2QSWA 2NZCA 2W9CB 3WX8A 1WEYA 3SFUA 4OZ1A 3C15B 5CD4H 2GQCA 2JHEA 3UE2A 3GSIA 4LRDA 4JI3F 1MU2B 3HSZA 4NYZA 3FCVA 3ONQA 2W8KA 2R2RA 1XMQF 5C2CA 4I67A 3VAHA 1IXKA 1KTVA 1KQGB 3VZIA 2W4DA 1X9SA 1E6VA 4DX5A 4RPFA 4LREA 2MQQA 3NWGA 2G4BA 1MROB 1X4AA 1NPRA 1FRJA 3QLHA 1SJ1A 3HKZD 1U1KA 3RYLA 1RGVA 3HHLD 1VQNS 3ENAA 1R89A 2PC6A 4CLUA 2FZGB 1IR0A 4QOTA 1X7VA 1NK0A 4QWAA 4ZP6A 4OJHA 4J9VA 4NCGB 4RBUA 2ROEA 4NYPA 3WHIA 2CIMA 3DCAA 5C2GA 3DOLA 1VRTB 1SI9A 2B4PA 5F0WA 1HHTP 4RWWA 2I5JB 1T7PA 3MMBB 5L1JA 3PRDA 1CJTA 3CD5A 4C8OA 2QG9B 4B9UA 1JJ4A 3IR7B 2IM3A 2YWWA 4TNOA 1M5VC 1MWQA 2Y3YA 2NS1B 4N7TA 1BQXA 3UDVA 2CJKA 2QZ8A 2WVEA 3QZ7A 5J1NA 4LSZB 2R7OA 5ETLA 2B43A 2Z58B 2BDPA 3DDNA 3QZ8A 3POTB 2B6AB 1T9VA 5CQGA 2YY3A 3IMQJ 2W9BB 4NLUA 4P7TA 1B99A 1NH7A 1FJGJ 2OTJS 3QSIA 1QE1B 1NSKL 3FBFA 2FGOA 1LQ9A 2OTLS 2M88A 3MM9B 3ITHB 3CDUA 3VGTA 1I51B 1RADB 2NPIA 2K3KA 2XBPA 3EVMA 4KKOA 1R8PA 5THWA 1YWXA 5KFPA 1U0HB 2F7VA 4DCPB 2YNFB 4X4QA 4DV2F 4QIFA 4UUXA 3CTRA 1EETA 3EGWB 5C25B 1HWIA 4LFCJ 4ED4A 3BDEA 4NPOA 1B64A 3CUNA 4EMDA 1S6UA 1HIYA 1FKPA 3OUYA 1B7YB 2D3UA 3I32A 2FIUA 4R8UB 1TV6B 4YY3J 1KONA 3N79A 1FXRA 3MR2A 4C2MA 2HK3A 4J9PA 1WF2A 1Q86T 1I6JA 3LWMA 3TZZA 4NLXA 4GO7X 4RW8B 2DR7A 5K8NA 2CXEA 4OZNA 2Y9HA 4PWWA 2Z56B 2B9XA 5FDLB 1HNVB 4OI2A 2C42A 4NLPA 4Y0FA 3C66A 2L9NA 3HFKA 1T94A 1RUSA 2LYVA 2ZJPQ 1UEVA 2VOPA 2QFIA 5E33A 2GO8A 3D0IE 2HHHJ 4YR3A 2D7SA 2HHWA 5KT2A 4NL5A 5K8OA 2PSZA 3W63A 3CCVS 4RUHA 3M32B 1R0AB 1Q5VA 2KYXA 3K0JA 2HQ3A 1NXIA 2BQ3A 4I4BA 2NUUG 2M70A 4H4OA 4OI4A 1GFWB 4FXWA 1FJGF 4DQIA 1QUPA 1HARA 1RAOA 1NCLA 1MG7A 2HWTA 4HI1A 1FWPA 2KVIA 4LRBA 3I4PA 4CYUA 2WCXA 1S9EA 4B9LA 2IC3B 2FGCA 3KLIA 5RUBA 4I7FB 4IFVB 3PCOB 1RAFB 1Y5IB 3CCSS 2Z0GA 1N34F 4BLGA 1NAQA 1SKSA 1K1QA 1FVSA 4F0HA 2Y8WA 4RW4B 4OZ2A 4YFUA 1LFPA 4OYBA 4CLWA 2ASDA 4ZPBA 4P75A 1U49A 2YPZA 4EZ6A 3QO9B 4WXWA 4YY3F 1SVDA 2WVCA 4LFAJ 4K5SA 2J6SA 2JEFA 3AAWB 2M3DA 5BR8J 3QGPA 4U9RA 2BXJA 1UW4A 1MWYA 2DNZA 1WI6A 1C1CB 4I69A 1DTTA 3VWSA 2DGSA 3PNIA 3LP2A 4EWTA 2W2PP 3M8QB 4ZVUB 2B56A 4J5OA 1FVQA 5CYQA 1FKOB 2F4FA 3PW2A 2PEBA 1SCJB 3HULA 3KLEA 3O3LA 2DGTA 4M5MA 2XO6A 1QAIA 5E2QA 1IKXA 3HD2A 2XNRA 5GAHU 3KG4A 4YS2A 1R27B 1E6YA 5A8KA 2C2NA 1BLUA 1IKVB 3NOGA 1VRUB 3JTNA 3VQSA 3PW0A 4J7CA 1T9YA 2LU1A 2VODA 1KDNA 3NXZA 2LFVA 1LKZA 5DZ6A 3EM1A 3I55S 1X5TA 2EWHA 1S1WA 1HR0F 4HH1A 1SC4B 2L9WA 3FFIA 1VJWA 1NK6A 4K59A 5M2UA 3G6ES 3BKTA 2A2DA 1D0EA 2U2FA 2V4QA 1RT5A 2BVZA 4F4YA 3SEOA 1TKZA 5AE2A 5KFEA 4JI5J 1U0SA 2EFVA 4WFBQ 5D0GA 2OPSB 4TU9A 5D3GA 3DLGB 4Q45A 4LFAF 1YQHA 2DY1A 3IG1A 1G7CB 2HHTA 3SV4A 4KT0C 1F60B 4ED0A 1YK9A 3I5CA 1TL7B 3MOJB 2VIHA 1KLMB 4F2RA 3CJ4A 4QW8A 2UV8G 4F3QA 1U2CA 3HD1A 2V9WA 4UZCA 2EK1A 2CQ2A 4BC7A 3G4SS 4UOCA 2XMTA 4ZJLA 2W1BA 3VGSA 2BW7A 2HS4A 3NAIA 1X5OA 4K4SA 5HMWA 3THVA 3JSRA 4JI1F 1JKHB 1ZZNA 1IN0A 1RSCA 1RT4B 4X66J 4IH7A 1S0OA 1VQOS 4O4GA 1VISA 5KFXA 1QDUB 1Q8LA 2XSJB 3V81A 5D4PA 2NUHA 4GKKJ 4QWDA 2H4YB 4DV4J 1WC3A 2QLXA 4BS2A 5HAOA 5D0RA 4C48A 2A2CA 2IFXA 2JOQA 3UPFA 3MMJA 2FLNA 4DF4A 1TUGB 2VG6B 2ZKUA 1XQIA 2XM3A 4CT8A 2ZE2A 4QBUA 3EPGA 2A18A 2CQHA 1FO1A 2DR9A 3DLEB 3AQOA 3TZYA 3HLUA 2HGNA 4O3RA 4FXVA 3OJUA 3AA8A 2ASLA 4J9OA 3DGVA 1F1BB 3NGUA 1KHVA 1ZAXA 4DHVA 3T3FA 3MAAA 3A3NB 3VAKA 4PPZA 1PC4A 4Z2XA 2HHSA 2FHJD 4EUVA 4M8LA 3IWLA 4RW9A 3GB0A 1WOOA 1SC1B 2ZM6J 3QJLA 3OR2B 3OV7A 1C0TB 2NSCA 1RT7B 3C2PA 1RT6A 2CQ3A 1WC4A 4MKYA 4IR1A 1QTNB 2F65A 1WTFA 2FVCA 1S1XB 4ZVRB 3UCZP 2Z2ZA 5J2MA 3T1YF 3D67A 1YI2S 1S97A 3WC0A 4ELUA 5F3TA 1HWUA 4ECSA 2HMIA 5HK4A 2P5VA 4Z7CA 3IAS9 2DY9A 2W2NP 4CO4A 1AUDA 3I82A 1H2TZ 4LF6F 4WU3A 2YWKA 4X66F 1O5JA 3NCRA 3CJQA 4FF2A 1X4DA 2XYPB 1KD1T 3BO3A 2MKYA 1NDPA 3NGRA 3SFGA 3AOCA 3F0NA 4LR7A 2V4RA 1GH8A 5K5MA 4DBQA 5F8GA 2ZZMA 2VPXB 5HANA 1WEZA 4LSLA 1RAHB 2ZNZA 5T41A 2FHOB 1S9GB 2MYFA 1Q79A 4J9UE 1KSPA 1KVJA 3EGVA 2ZWOA 4CNYA 4ELTA 1FXLA 2LQ5A 5HJXA 3SBMA 3LH2S 1XNRJ
chains in the Genus database with same CATH topology
3UR0A 3FFIB 3I87A 2GHPA 5B0EA 3J7ZT 2J0QD 3HHNB 2OSRA 4MMOA 1H38A 4YB7A 4NWBA 3MEEA 5CZXA 1RAJA 1RTIB 5K14A 2KZZA 4LF9F 3TUZC 3LP1A 4Y2MA 5DQIA 1WG4A 1UA0A 4RU2A 1GX6A 2XI3A 1RT5B 3DXSX 4JI7F 1S6OA 3HP6A 2J0XA 3N6NA 3CDAA 2CQGA 2HNZA 3B4DA 2Y1IA 3OQ2A 3DLJA 3KHGA 4KGMA 1U1QA 3CJ5A 5KFIA 2AYBA 1TKZB 5BYQA 2ALZA 3K8WA 3I5BA 5I3PA 5G0RB 3S7RA 2ZNYA 4ED7A 1KRPA 2WOMB 3H20A 3PKYA 1X5PA 3FDSA 1TFYA 5B08A 2W7OA 1JXLA 4DG1B 1X8DA 2Q79A 4OHYA 1HQEB 4OHWA 4MIWA 4DMZA 1R8HA 2CYYA 4OHXA 3D0GE 4UW2A 2P6SA 3G8QA 2DNRA 4OIXA 2BYCA 5KFJA 2CJAA 1RQ0A 2PEHA 1URRA 3J7Z5 1XR5A 2HRYA 2H5EA 4RNNA 1QJHA 1NK5A 2YKMB 2G0CA 2X1AA 2E5HA 1S99A 4TYAA 1H2UX 1XK8A 4IR9A 5ADZA 2YWGA 2P9EA 4OI6A 4EBDA 2E7XA 4BWJA 5I4MA 4Q5VA 4ZS6A 2ZH1A 2MMYA 5KFTA 2DNGA 4ZPCA 2GIQA 1ZAWA 1XEZA 5D6GA 3US5A 2HVZA 4ES2A 2CPEA 3C6UB 2R2TA 2K1RB 3I4HX 2YWEA 2JEJA 2M8DB 1VC5A 3PFEA 2BANA 5AXMA 1VC6A 5GAEI 4JUZA 3GFYA 4X84A 5DDOC 1VQPS 4NA3A 2IRYA 1BQNB 3AY0A 1C4AA 4PPDA 2VG5B 3QPIA 2ZUGA 2PN6A 4OI1A 1NKEA 2O5DA 2VA2A 4I1TA 3TA2A 1V3ZA 3DC2A 4HTJA 3CCJS 3K5PA 2KU7A 4K50A 3NCQA 4KB7A 3RRKA 1WHYA 2GNKA 5T7LB 4ILLA 2WSCC 2XB2D 1NB7A 2B3TB 1ZH5A 3MI7X 5D4NA 1LW2A 4QIVA 4DR3F 2RU3A 2OLWA 3KJVA 2I5JA 2VV5A 1FD2A 1FRIA 2J76E 1HL6A 5B0BA 3M05A 2AJ1A 1V6HA 2KJWA 2ZH7A 4A8WA 1UVMA 1N33F 2DIVA 2UVUA 4ECTA 3R1HA 5BYSA 4BCAA 3NNCA 1K8AT 4IRKA 2APOA 2UP1A 2AD9A 1RT2A 5A0YA 3FRZA 4PQUB 1KNZA 4WJBA 4O4GB 4IQXA 3EXCX 3NMAA 2ASJA 5L1IA 1CG2A 2KG0A 2LXIA 2ILYA 4C4WA 3MGJA 4JI2F 2HAIA 2QA4S 4PG8A 4C3KA 4URGA 4O3OA 2C3MA 3JTPA 4L6V3 2Y1RI 2VKZG 2RNEA 4K4YA 3OSNA 5J2QA 2EI5A 5A8RA 1S6PB 4QWCA 1YJNS 4BC9A 1OPZA 1KTQA 3OHAA 3CO9A 3SI8A 2VONA 4IOCQ 2VASA 1TL1A 1F5AA 1JLGB 4A8YA 2BRLA 3T1AA 4IH6A 3HDSA 1HBMA 1JLFB 3BGUA 2OPRA 3R3TA 4N76A 1RT1B 4PG6A 2DT9A 1G3OA 1D8YA 3CD6S 3UNGC 2VBZA 1X4EA 5LXYA 2VB6A 1J5EF 1TKDA 1S0MA 3Q8SB 2DR8A 2WB1D 3EPIA 3GZ7A 3OPKA 4DV1F 1AXQA 1NJWA 2P9GA 5HN0A 4EO8A 2QO3A 3DRSA 1Q8IA 2FHMA 3VAFA 2AJFE 4L72B 2KG1A 3CCUS 2OPQA 1FK9B 2B9WA 2ZE2B 5LSLA 2UUBF 2QE5A 1DZ5A 2J7KA 4XIUA 3MM5B 3KHRA 4P6QA 3PJWA 2R4FA 3H2UB 1H6KX 5BJRA 2W9AA 4DL7A 3MECB 4B9NA 4NLWA 1XNRF 1V9OA 2CQCA 3KLHB 3CCLS 4FVCA 4DFMA 2VFTA 3UW1A 4B08A 1MWZA 4UQGA 1PILA 5E0OA 4X65F 3QWPA 3OVAA 2ROPA 4H4MA 1K73T 4TLRA 3TP2A 1SC6A 4IOAQ 3CT9A 1FF2A 2DITA 5L39A 3ZZPA 3UR3C 1UJ5A 1FJCA 3E3XA 1T3OA 4B9TA 2WTFA 2JC0A 2UXDF 1HMVB 5KFAA 1X4HA 1UMJA 1YITS 3IFEA 2XCAA 1FTRA 1IBLF 3KG0A 3T9NA 3HVWA 2DK2A 5E41A 3CCRS 2UXCF 5KT3A 2E44A 1T03A 4USIA 4F8RA 4ZKAA 2ZOFA 3T6JA 3KLGA 5C5JA 3MZIA 3EX7B 2KFNA 1U1MA 4HH0A 2CPHA 3O1LA 1IKYB 3U27A 3G6YA 4DL4A 3DRPB 2E5JA 3H59A 4RW9B 2EFGA 1SB6A 3QWUA 5EUHA 3RRHA 2NLWA 3LANA 4ICLA 3GV7B 1SV5B 2FVRA 2PMHA 5LJ3Y 4JV2A 5T14A 4Q8FA 4OL8A 2DNLA 5B0DA 5KT7A 4F2SA 4NOHA 4NLOA 3TQ1A 2IAJA 2SXLA 2VH7A 4IFYA 4LT6A 3THTA 1DARA 3JSMB 3FQKA 5GVQA 5M2RA 2WBMA 5F8IA 4RW6A 1H0HB 5EDWA 4Q7AA 3IGVA 3PIOQ 2HGLA 4D3HA 4QWBA 4JYAF 4C8ZA 3H5SA 4V19J 4P2SA 1JB0C 1HW8A 2CRLA 4C3LA 1HNXF 1RT6B 2O67A 3DLKB 4F02A 2N7CA 2JSXA 3UWTA 2H9ZA 3S8SA 4EU0A 1X0PA 4GO5X 2DGXA 3MM7B 4QZVB 4ZVGA 2QV6A 4ZHRA 5C24B 3LOUA 1SJFA 4DS5A 1SUQA 2X1BA 3CE8A 2E5IA 2YH0A 2BJDA 4NZ0A 4CTAB 1HWJA 3L7OA 1JLEB 2XY5A 1N32F 4I2PA 1P27B 1DURA 3M8PA 5J2MB 4KKOB 3PACA 3PEHA 3M2VB 4C0OC 3HZGA 2IYGA 3TAPA 2VD3A 5KTQA 1TVRA 4CH1A 1KVIA 4V19X 1REVB 3RAMA 2RDJA 3SCIE 4GKJF 1VQ4S 5KFDA 3B82A 4O3NA 1HNIA 3NRBA 3CJ2A 3MR5A 4F3MA 1S48A 5HP1B 2QA2A 1SIWB 4X4OA 4KRWA 3OW2R 2HMIB 3T5HA 4TLQA 4EBEA 1WTBA 2WONB 2YNIB 1N5SA 3KFWX 5DM6Q 2XS7A 1N0UA 1Z2ZA 1S1UA 1TUVA 2JL9A 3P6YC 2DRBA 1C1BA 2LEPA 2M7SA 3H8YA 2YX7A 1D9FA 4PKDB 3BJYA 5LSRA 3MUVP 3E2EA 1RT3A 4HHJA 3U7JA 1JJ2R 3I6PA 1TK5A 4Q0BA 2Q43A 2MDAA 3B8HA 2DO0A 2Z4PA 3LW5C 3JSYA 3WX4A 2HPUA 3BGLA 2OFGX 3OUYB 3KK1A 1DLOA 3ZZUA 3PY8A 4EYIB 4DFJA 1FNMA 4ZP8A 3RU0A 5DO2A 2F8MA 2B4UA 4J9MA 4B9VA 3TX8A 2NSBA 1HPZA 2HFZA 2ZDOA 2VQEF 4KJIA 2E66A 2YX4A 1NHVA 3AJ2A 2Y1JA 1BC6A 3PW7A 1M5SA 2HIQA 2YKQA 2YKNA 4KGKA 4DQSA 2R8KA 2IMOA 1GX5A 4AXIA 3T6BA 5HLFA 2PDAA 1U47A 4FF3A 1QSSA 1JNZB 4PXCA 5HBMB 2C3PA 2VG7A 2VPWB 3G6VA 2R7TA 2FD2A 3EZUA 4LSLB 1VS3A 1CQMA 4UY8T 2XO7A 4ECXA 5FD1A 2RQ4A 3M2RA 1U1NA 4C0HA 3MMCB 5DG7A 4AQYF 4PWDA 5K8PA 3RB0A 3PX0A 2IRXA 2YWHA 3HK2A 3M2UA 4DR7F 4ETXA 2UUAF 3CPWR 2GMJA 4C8LA 1U24A 3RBEA 3HHLB 2HFNA 3M1VA 1C2PA 3CCMS 1K0VA 5KFGA 4DL2A 4TY8B 2CQ4A 2PFFB 4AXJA 2FJBB 2IYIA 1Q7LB 2B0GA 3HVTA 4HYKA 4RUAA 1FRHA 1LK7A 4W90B 4QR1A 4FNIA 4DF8A 2AYGA 4DUYF 4X4VA 1SH2A 4C8KA 5DG8A 4K2XA 2N4DA 1JLBA 1LV5A 2HHXA 1LWFA 1VQ5S 5F0UA 2RKIA 2IVFB 3MEEB 5K14B 4ZMMA 5JJBA 1KQKA 3K57A 1X0FA 2CZ4A 4OI3A 2ZZNA 3LP1B 1FEHA 3MCSA 2OD6A 4M5DA 4ED3A 2VFVA 2R8IA 4ID5B 3DDKA 1TL4A 2HQIA 2IC3A 2VPYB 4KC5A 4URQU 2HNZB 4C11A 1RYSA 1HD1A 2ADBA 2UXBF 3OTBA 4K5RA 2DGOA 1SJ4P