2CQ3A

Solution structure of rna binding domain in rna binding motif protein 9
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
103
structure length
103
Chain Sequence
GSSGSSGNSESKSTPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA-binding protein 9
publication title solution structure of RNA binding domain in RNA binding motif protein 9
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 14
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cq3A00
5GAHU 2KYXA 4QU6A 1UW4A 2D9PA 4Y0FA 1O0PA 3N9UC 1X4FA 2MQNA 2CQ1A 1WWHA 3R1LA 3G9CA 4W92B 3I55S 2GHPA 2OTJS 3CCLS 1M5OC 5GAGU 1YWXA 3FEYB 1HL6A 3EX7B 3VAGA 2E5JA 2LYVA 2OIHA 4LMZA 2M52A 1NJIT 2YWKA 1WEZA 4QU7A 1X4DA 5GAEU 2MKSA 2DHGA 4UQTA 3MOJB 2CQGA 1VQOS 1WELA 4EGLA 2CPDA 1QVGR 2ERRA 2ADBA 1VC5A 2D3OR 1AUDA 3VAKA 4J5OA 3TP2A 2DGTA 1JJ4A 3ULHA 3PIPQ 4FXWA 2MKIA 1NU4A 4LIRA 1VQ6S 2CQCA 1K8AT 1H6KX 2KRBA 1W2BR 3MXHP 1X5TA 3DXBA 3LQVA 3NNHA 3CTRA 3UCGA 2FHOB 1X0FA 1WG5A 4PKDB 2CPHA 5CYJA 2DGSA 3CCUS 2OTLS 5GMKa 4WCEQ 2RU3A 3J7ZT 1QVFR 3Q2TC 2CJKA 1M90T 1WHVA 2QFJA 2L9WA 1U2FA 1WHYA 1VQ8S 3G6ES 2XB2D 4ED5A 1B7FA 1SXLA 3EGZA 4F25A 2M8DB 2OSRA 2RS8A 4W90B 1WI6A 2X1FA 4C0OC 1NO8A 2U2FA 4PR6A 4WF9Q 2NZ4A 1KOHA 3H2VE 2DGUA 2NLWA 5H1SV 4YOEA 1HD0A 1U1NA 1X4GA 1UAWA 2DHXA 1IQTA 3B4MA 1VQKS 2DGWA 2CPFA 3CC7S 2KT5A 2DNPA 4WKRA 1OIAA 2DGOA 1KD1T 3H2UB 2L08A 2N3LA 1JMTA 2XNRA 4BS2A 5LXRA 3CCRS 2V94A 2AYGA 2VOOA 2KRRA 1UP1A 2CQ4A 2A3JA 2B0GA 1RK8A 2CQPA 3ZZYA 2PEHA 1QM9A 2PE8A 2MYFA 1Q81T 2RUGA 5MLCV 3RW7A 2DNGA 2AYMA 2AYEA 2M2BA 1YHQS 5JVGQ 2LQ5A 4YUDA 5LSOA 2MY7A 2DO0A 1D8ZA 5DETA 3HI9A 3B4DA 2M7SA 3CF5Q 2VOPA 1BY9A 3CCES 2KHCA 2RT3A 3VAJA 2DB1A 2MXYA 3FEXB 1WG4A 2E5HA 5ITHA 1S72S 4WFAQ 3P6YC 2RS2A 2CQ2A 1DHMA 1N8RT 1VBXA 1M5KC 2LXUA 1YIJS 1PGZA 2LMIA 1P1TA 1M5PC 5IQQA 2K3KA 2FY1A 2WBRA 2G0CA 3BEGB 3NS6A 3BO4A 4WIIA 2HGMA 2RQ4A 1DZ5A 2I2YA 2G4BA 4IOAQ 5D78A 3I56S 3VF0B 5LXYA 2KG1A 1WF1A 1SJ4P 2KXFA 1FJ7A 1KQSR 2MJUA 2KM8B 2E5IA 3PIOQ 2DK2A 3MUMP 2JWNA 1OWXA 2MQPA 3NS5A 1YJWS 5FJ4A 3MI7X 2DNNA 3CC4S 2MZ1A 2MGZA 3OW2R 1VQNS 4WFBQ 2M0GB 5BJRA 5LJ5Y 2KFYA 1U1MA 4ZKAA 1M1KT 2M4MA 5JVHQ 3UWTA 2MB0B 3NNCA 2K8GA 2MZRA 3J7YU 4UY8T 4P6QA 2MHNA 2F9DA 4IUFA 2LEBA 2LECA 2VONA 2N7CA 2AYBA 2MKHA 3S6EA 1U1PA 4Y00A 2ZJQQ 2KU7A 3CULA 2E5GA 1Q82T 1CVJA 3P49B 2RRBA 1FHTA 2OJ3A 1WF2A 2FC9A 1FJCA 2QEXS 2MZJA 2YKAA 2MMYA 3VAHA 3R1HA 2CPEA 4PRFA 3L3CA 2LA6A 2RVJA 2LEAA 2MJNA 2DNMA 3S01A 3G4SS 1G2EA 2MSSA 2DNOA 4M5DB 2DO4A 3V4MA 2MZQA 1A7GE 3CCMS 3THTA 4A8XA 2KM8C 2KXHA 4FXVA 3K0JA 4V19X 1WF0A 2JX2A 2F9JA 1X4BA 5IM0A 2X1GA 3CD6S 2DH9A 2RQCA 1U1RA 3CCSS 4OZ0A 1VC0A 3IWNC 1U1KA 1P27B 2EK6A 3EGNA 1SJQA 2I38A 2M9KA 4CQ1A 3CCQS 3VAMA 1VQ7S 2L41A 2DNKA 2CQDA 4RU2A 1K73T 2G1DA 2GO9A 3THPA 3U1LA 1YTYA 4TLQA 5CA5A 3G8TA 2DITA 2DHAA 2DGXA 2MKCA 3UD3P 2N82B 1YITS 3IRWP 1SJRA 2X1AA 4CH1A 2CQ3A 2XS5A 1F9FA 1X5SA 2FC8A 1ZH5A 1VC6A 2LXIA 2M70A 5GVQA 4YB1P 3CMAS 2HVZA 4TU7A 3LPYA 1RKJA 1VQMS 3JB9k 1Q86T 5CXTA 5GADU 2LCWA 2XSFA 2KH9A 2MY8A 2DNYA 3RW6A 3MD1A 1U1QA 1FJEB 2ZJPQ 1VQ5S 2CPIA 2MPUA 2XS2A 3SMZA 3MURP 1HA1A 5DM6Q 2KN4A 3U1MA 3VAIA 2MQLA 5DM7Q 1FXLA 2KI2A 3TO8A 2DNRA 4CH0S 1X4CA 1X5PA 2D9OA 2FPHX 1JJ2R 2BZ2A 2MKKA 2CQBA 1N88A 2YTCA 2KG0A 2KVIA 3BO2A 1OPIA 2UP1A 1N52B 3G8SA 2F3JA 3Q2SC 1XN9A 2DH8A 4C7QA 3G71S 1FO1A 2SXLA 2DGQA 2DH7A 3TYTA 3ZZZA 2DIUA 2DNZA 2X1BA 1YJ9S 1URNA 4OZ1A 3CPWR 2HGLA 1X4AA 3R27A 3CXCR 1L3KA 2MQOA 2VODA 1U1OA 3S8SA 1WHWA 3VAFA 1SJ3P 3CUNA 2M8HA 2RRAA 1K9MT 5HO4A 1SJFA 2J76E 1H2VZ 2CPYA 2LKZA 5D77A 4TU8A 2CPZA 2J0SD 2HZCA 1H2UX 1R8PA 5HL7Q 1A9NB 3CCJS 2DHSA 1HD1A 1DRZA 1U1LA 1ZZFA 1ZZNA 1KOOA 1KC8T 4F02A 2DISA 2O3DA 3UD4P 1VQPS 1X4EA 3BO3A 3MUVP 2HGNA 3D2WA 2HYIB 2MKJA 2U1AA 4QQBA 5LJ3Y 2QA4S 1PO6A 1VQ9S 1WHXA 1VBZA 1X4HA 5DDPC 4QPTA 2DIVA 4WFNQ 3HHNB 2M88A 2CQIA 3SDEA 2MGZB 2DGVA 1S79A 1R8HA 2E44A 5LSLA 2XS7A 1D9AA 2JRSA 1WEXA 3CMES 1WEYA 4C4WA 3NNAA 2LA4A 3US5A 3SXLA 2CPJA 1N54B 3MUTP 1Q7YT 3CC2S 1M5VC 4F26A 3G96A 2YH1A 1VBYA 1JJHA 2EK1A 4ERDA 1H2TZ 2MZTA 4Z2XA 3P5TL 1WG1A 2J8AA 1FNXH 2AD9A 3NMRA 1OO0B 2RNEA 4IOCQ 2MQQA 4TU9A 5IFMA 2JVRA 2DNQA 2BOPA 2XNQA 3DLLQ 1UFWA 3UE2A 1DBDA 3BS9A 1WTBA 3P3DA 1VQLS 3VALA 2CQHA 2DNHA 4CIOA 2OSQA 1VQ4S 1WI8A 2JVOA 3MDFA 2N3OA 2ZJRQ 5EN1A 1X5OA 2DNLA 5DDRC 1U6BA 3UCUP 2MZSA 4U67Q 2YH0A 3S7RA 2EVZA 3CCVS 3UCZP 3MD3A 2CQ0A 5DDOC 1FT8A 2KXNB 3SDEB 2CPXA 2Q79A 1YI2S 5DDQC 1U6FA 1YJNS 2MQMA 2MSTA 5IM0B 4LJMA 4IO9Q 2J0QD 2ADCA
chains in the Genus database with same CATH superfamily
1HBNB 3DC2A 4X4NA 4DV4J 2NXEA 3KLEB 3EUNA 3VAGA 4HEA9 4K4YA 3SBMA 4FKXA 1RWKB 4OI3A 3K5OA 2GIQA 2W7AA 1QVGR 4U8VA 4HH1A 3BQ2A 1I3OB 1K44A 2OFGX 2B6AA 2DBBA 3IFEA 1S59A 1FX2A 2IMOA 1IJFB 3M8PB 1QAJA 2BKNA 4NLUA 4NRUA 2R7OA 1HNWJ 3NGTA 5KOWA 1TL1A 1RTDB 2V6AA 4GMKA 2DGSA 5F0UA 3AAWB 4B3SJ 2L9WA 1IBCB 3R8YA 3P8BB 2HHSA 3LOUA 3EGZA 4F50A 1F0XA 5DGBA 4Q2LA 2LU1A 1OYEA 4CLSA 1ACMB 4O0NA 3OUYA 2XYPB 3FDSA 4JI8J 2BKPA 1TK0A 5KFKA 5IT9U 2HNYB 5B08A 4I69A 1TKZB 3M1VA 1U0SA 1AZSA 3ZZYA 1JLAA 2W7PA 2Y1RI 1FVQA 3GJRB 2PI4A 3QT6A 1BQXA 5D0EA 1N6QA 3KK1A 4M5JA 3BPDA 4WFAQ 1NH8A 4J90A 1VHFA 4DR1F 3IAM9 2YPZA 1GXUA 5IQQA 2G0CA 2HNDA 3ISZA 3FKBA 5HATA 3IA0A 4P75A 2GMJA 1NAQA 2R2RA 3QQCD 1V3ZA 2JL9A 2JWNA 3ISNC 4PCQA 2DNNA 1YZ7A 3D0HE 1VJQA 2QLJB 4JBCA 2C1EB 5C42A 1U1MA 4FF4A 1NJWA 1MU2B 2MZRA 2HKEA 4P10A 1V3RA 4X4RA 5M2PA 4FF2A 3O1LA 4B3RJ 3D6MB 1SBRA 2WW4A 2W4CA 4O3SA 3OTEA 1FERA 1WOSA 4FS1A 1JNRB 3TZXA 3BREA 5HQLA 3TOQA 3IS9B 2ASLA 2ZNZA 9ATCB 3IBCB 3QRQA 4USUA 2YNGA 1ZAWA 2XO6A 3VQSA 3HVAA 3RBZA 4NLXA 2EK6A 3ILJA 3BJYA 2M9KA 2I38A 2GJ2A 4CO3A 3IN5A 3U1LA 4F3MA 2ATCB 3G8TA 1QSLA 3MM5A 1P9YA 2DHAA 5IQ6A 2W9BA 3RRGA 3FRYA 4F8RA 3M6VA 2GGPA 2MPUA 3IWXA 2VG5A 1HWJA 5LMUJ 4LT6A 3NCRA 1O51A 1GXTA 4DV2F 2CQBA 3NXZA 5K8MA 2XM3A 2IVYA 3MMCA 2DGQA 3FSYA 3WX8A 2FYXA 3H8YA 1URNA 4YHHJ 1Q7LB 1R6YA 1U1OA 1VI7A 3S8SA 4WFYA 4ZPCA 1JQGA 2EKNA 5HO4A 3SEOA 1SJFA 2AJ2A 1TL5A 5ETOA 3W64A 3M7VA 2YPYA 4QWAA 2BW2A 1MNEA 2CVIA 2GVZB 3PKYA 3QJJA 4K8RA 1JLFA 5J2NB 2V8PA 3TARA 1X4EA 2FY8A 5B0CA 3IAS9 2JEJA 4WFNQ 3A4TA 4LR8A 2RDDA 1LWXA 2MGZB 3WIUA 3ILLA 4LF6J 4OI6A 3LGHA 2BDPA 3SXLA 2CPJA 2V2VA 2DD8S 2WVDA 4X66J 3QIPA 3TUJC 5K14B 4OI4A 2HFOA 5C7PA 2KB2A 3MECA 2Q1LA 4TQRA 1NK6A 1SH3A 2IAJA 5HLFB 3PFOA 5A8KA 2N3OA 4ANEA 3TUPA 3GV8B 4G65A 3KK3B 2KDOA 1HNZJ 2CQ0A 2J0XA 2V4JB 2ZZNA 2PA8D 1Z2ZA 4PG8A 4EBDA 5HANA 2X3GA 1VRQC 1QAXA 3O3LA 4ER8A 4C3MA 4WTYA 1T0TV 1RWMB 1U0HA 2BJ3A 4JI0F 5IZHA 4Q44A 4EBEA 2RILA 2RH3A 1WELA 2VG6A 3L9ZA 5EWFA 3DOMB 2ERRA 4G1PA 2W9AA 3J7A1 4JI6J 4P7VA 2YNFA 1PYSB 4J9RA 2GAGC 1F3FA 3OTBA 3PEHA 4WTOB 3ULHA 5ETSA 1NU4A 1FJGJ 1S6QB 2A0FB 3GSIA 1X5TA 2YQ1A 4DI6A 2C2KB 1RHMB 2GQ2A 5KFTA 3UCGA 1X0FA 4QIVA 2CPHA 1Q95G 5EWGA 4I1TA 4FZVA 2H65B 3Q8VA 1WHYA 4TY9A 5DS7A 4LF7J 4PUOB 3WDOA 3ZZ0A 4DV1J 1F60B 3EDQB 4Q0BB 4C0OC 2ZH4A 2C3UA 1UAWA 3R5BA 5KFDA 2UUBJ 3W8GA 2XSJA 3W2WB 4LF9J 2A1BA 4TQSA 1C0UB 2VOOA 1QM9A 2PE8A 2DR8A 1KRPA 3DRSA 4URQU 1YHQS 3KG1A 1KLMA 4U9RA 5F8IA 3MR5A 3RB4A 1CLFA 1CS4B 3DLGB 4ANCA 2UUAJ 5DZ7A 3OSPA 2GFFA 3PW5A 3NBPA 3GYGA 4Z7CA 4XO0A 1IKWB 3FUYA 2FY1A 3BO4A 2WB4A 4RBUA 2RQ4A 1KBRA 2BRLA 4CI0B 4CLTA 3CJTA 4F2RA 3LP0A 4DPTA 3MMAA 1R8AA 2E1CA 3LTOA 2XY5A 2G1HA 1KVKA 4K4UA 1UVIA 2F5GA 4P2SA 3C46A 4CLYA 2RE1A 2K8GA 4J37A 1XMQJ 4CP5A 2AT1B 1S7HA 1Y00A 3TJ8A 1Q82T 1ZS6A 5KG2A 2FC9A 2R42A 2YKAA 3R1HA 1NSQA 4JI2J 2EEYA 4YDDB 2K1RA 3BBCA 1HPZB 2BEFA 2Z2YB 3CJQA 1V6HA 5J2QB 2G2OA 4I56A 4OX9F 2GZOA 4NA1A 4M5MA 3ADAC 3DXSX 1JB0C 3OFEA 5KFLA 3Q8QB 1YGYA 1LEOA 5THWA 4N56A 3JYTA 3FBBA 4QOTA 2LDYA 3D66A 1TV6B 3J80Y 3IR6B 4PG4A 4EBCA 1Y10A 2XSFA 3LF0A 3OD2A 5ETPA 3VAIA 1OY8A 2JEFA 2IJNA 4RUBA 2EFOA 1WUUA 2AX1A 4TN2A 2ZH9A 3N6NA 1H7XA 4ZS6A 3BO2A 2X7IA 2ZM6J 1RAAB 2ACMA 4C7QA 1FWKA 2DIUA 1FEHA 4GRSA 3R27A 3CXCR 1S9GB 1HR0F 2WSEC 3CDUA 1WORA 4R0EA 1D8YA 2LDIA 3PYDA 1OJ4A 4NCGB 3SSQA 2XQCA 1ZYQA 1VRUA 4GVBA 4OX8A 4FXDA 2V69A 1HD1A 3KWMA 3D54A 2IYGA 3H42A 1RTHB 2WVCA 5EDWA 1BGXT 4GKKF 1OYDA 4HTJA 2O3DA 2W2PP 4MFBB 3H5XA 1WHXA 2M88A 1SKWA 2EFGA 1S79A 3H5YA 2LA4A 1N54B 4ZVRB 3T1AA 3QATA 3GR1A 3SYZA 4DCPB 4F3OA 1U26A 1FNXH 3MPYA 8RUCA 3NMRA 1PIEA 4K7QA 1VFJA 1UVLA 3P3DA 5J2MB 2JVOA 4WP9A 2DNLA 4U96A 2BE7D 3CCVS 1IKVB 4HVZA 5KG6A 5J2PA 2V2KA 3HM9A 4LR9A 4QWBA 4A8QA 2ADCA 5K8PA 3EVOA 1UW4A 2OEMA 2E5LJ 2ILZA 5I3PA 3KNAA 3W9JA 3BGRB 3JAMY 5J1PA 2ZH2A 2LYVA 2QE5A 2HSEB 4I7FA 2HHPA 1M1GA 3HSZA 1PAEX 5F0WA 4IG0A 4ED0A 3I4HX 5KT2A 3A3OB 4XDCA 4RBVA 3IMQJ 1PSDA 1JX4A 3MM6A 2F8HA 3SIPB 3VAKA 2C2NA 3N0VA 2GJIA 1I94F 2VQEJ 1OSDA 2CQCA 5U47A 4DUTA 2Q3PA 1OPZA 4RW8B 3OVBA 4ED1A 4JI7J 2GW8A 2D3O1 2XMUA 3MEGB 5B0EA 1YJTA 2UU9F 1XNQJ 4A8KA 2HBRB 1KVJA 2XB2D 1NPPA 2ASYA 3J81Y 1WI6A 2G2ZA 1NO8A 1UZDA 1UA1A 5MAOA 1NM2A 5HVFA 3BGOP 3DI6A 4X4QA 1R89A 2VFVA 2CPFA 3KKFA 2GCFA 1OIAA 1TUVA 5ETVA 4USHA 4P52A 4X62J 4LR7A 2AYMA 2H4YB 2LQ5A 5BR8F 2ZWOA 4FNIA 1SKRA 1UJ4A 3QT7A 2PDAA 5HMYA 1R31A 5ETTA 5KFAA 2MXYA 5ITHA 5ADZA 2ZEJA 3QGGA 3OUYB 5AJ3F 4K4VA 2V8DA 2K3KA 1DTQA 1YSJA 3GILA 1FE0A 2LQBA 3M1VB 2AQ4A 4DLEA 5I3UA 3R6GB 2FGCA 4OFZA 2ZH8A 2IMWP 2NZCA 3ZZTA 3I5AA 5F8HA 3HVTA 2GIRA 1QUVA 2C42A 2QZ8A 4HDHA 2M0GB 2K3IA 2KYZA 3L7OA 3UN5A 1RT7B 3AB2B 1IKXB 3QSYB 5D6GA 1Q53A 2HZAA 4AQYF 5JUMA 2ATLA 3Q8SB 3P49B 2H3EB 1AA1B 4NCBA 4N7TA 2A18A 4KIAA 4PRFA 4H54A 4F4YA 1RTIA 3D9BA 5L1LA 3THTA 3VGTA 2FZKB 3ZC4A 1K1QA 1X4BA 5A8WB 2CG4A 3M2VB 1VC0A 3ET6A 1B70B 1WC0A 3T9NA 4OMFG 2BJEA 3DFEA 3EGNA 4DPOA 4ECXA 3KHLA 3VAMA 2GHWA 3IR5B 4TLQA 5CA5A 1DTTB 4HR2A 1S4FA 5F41A 5I42A 2UXCF 1ZH5A 2LXIA 1XJWB 3ELHA 2E9ZA 1SIWB 5AXLA 1WD6A 4D3HA 3CIZA 1WKJA 2XS2A 3MURP 3DDIA 1GMWD 3DYAA 4ZA1A 4L72B 1HHQA 2DR9A 2PD1A 3BQ1A 1FXLA 2H5JB 4DR1J 6FD1A 2VFTA 4ZCLA 4HT7A 1JIHA 3OR1A 1NKCA 4DPXA 1HYSB 2VODA 4O4GB 3D67A 5DG7A 4MKYA 1WHWA 3DU5A 1GAOA 2RRAA 1QLNA 3I31A 3OJSA 1EP4B 2UXBF 3LGMA 1IWAA 2Y1LB 1R8PA 2HQDA 3DOKA 4C48A 3B6BA 1A9NB 2RMLA 4OI2A 4ATNA 3ONQA 4CO5A 4FS2A 1O5JA 1SC6A 2HBZB 4DR3F 2CJAA 4LFBF 2VG7A 2KTQA 3HHNB 4AL6A 4NASA 1QTMA 3D3BJ 4PXDA 2B51A 3TJ9A 1N5YA 2PC6A 2VC1A 4KH1B 1MMDA 1M5VC 1XMOF 1IWGA 1CQNA 2WZ1A 4OZ5A 3LP2A 3TEHB 2XMMA 1FD2A 2ZVIA 2RNEA 4F4XA 4DV6F 3WQPA 2XTJP 5HMZA 2CNLB 2GS8A 2ZUAA 1HMVA 1JLGA 1ICEB 4NZ7A 2HAFA 2Z30B 1BHNA 3IRXA 5DDRC 3UO0A 4RW7B 1U2CA 1LW2A 4YB7A 2CPXA 1PILA 1YKWA 3D28A 3SZ2A 2J0QD 2E9RX 3C6TB 1IJEB 2K06A 4DR6F 1N5QA 1DQ9A 1O0PA 3GE9A 3QIPB 4B9UA 4QZVB 4DV2J 5CYQB 3E51A 4DPUA 4LMZA 3R6LB 5F3TA 3DRRB 1NJIT 2MKSA 1AB8A 4DL6A 2NCKL 4O3NA 5B7WA 2HMIA 1VQOS 1QJHA 1Y4ZB 3DRYA 5A76A 3L4BC 4XPCA 2BUNA 2BQUA 4ZOSA 4RNFA 1AUDA 3OXLA 3CCWA 2VU5A 1KQKA 3EXYA 2DGTA 1U7LA 1UETA 2J8SA 2MKIA 3VR1A 4PYDA 4OHVA 3OFFA 2KRBA 1N0VC 1W2BR 3FRZA 4ID5A 5HQ8A 3UNYA 5KFUA 1WG5A 3R3TA 2NQPA 1U49A 2VASA 4PKDB 3JSMB 3KMSA 4ZVTB 2RU3A 1U0HB 3C14B 1S6UA 2QFJA 3CEDA 3K59A 1U2FA 4PG7A 1SXLA 4L75A 3PRBA 1DJ0A 1N4LA 1CC7A 2QMWA 2NLWA 2AJFE 4AYBD 4BLGA 3J81j 3CT9A 2DGOA 2BX6A 3CWJA 3QJLA 2W2QP 1CJVA 2N4DA 3D0IE 4PZVA 4M8LA 4RLEA 1W7WA 5BYRA 3V5RA 3WIVA 3ZZOA 1RT4A 4ZHRA 3GIRA 1RWNB 1HWIA 2XCAA 1O8BA 4WIQA 2AF6A 4C11A 3RG6A 2BABA 2E5HA 1OQ6A 4ZVHA 3GFYA 1VK3A 2CQ2A 1RAFB 3FCHA 1RBLA 2R2SA 2R3VA 4NLOA 2XSJB 2V0NA 2GHVC 1FRJA 4FF1A 3SQGB 3DDNA 1NK7A 1MN7A 3MM7B 3VF0B 3HDSA 3V6DA 5H9FJ 4KAIA 4NLTA 1FRKA 4CRJA 2NS1B 4JI0J 1XC9A 5L1IA 2OGUA 2VA2A 4C8LA 5ETMA 3M8QB 4WFBQ 1GFWB 4MKBA 2IHR1 1JXLA 5GAGI 4C6AA 3ZTOA 3W5XA 2HS3A 4AE5A 3D7SB 2L48A 3UN2A 3WC2A 4IUFA 2WOMB 3PHTA 2KU7A 3I0SB 4B9VA 3I32A 4J9SA 5DG9A 1WF2A 4UOFA 2RRNA 1FFGB 5A8RA 1S1UA 2I6WA 2J5AA 2BKOA 5KT3A 2J0WA 4ICLB 5A0YA 3D6HB 4L3NA 1RT6A 3UN3A 2IVFB 5IM0A 4C8ZA 3CCSS 2FHMA 4NZ0A 4OI0A 4KPCA 1AUSL 1P9QC 4CQ1A 2R7TA 4C9DA 2XLJA 1K73T 2EW9A 3CGIA 1B0VA 4X64F 3V4IA 4LQ3A 4LBIA 5GVQA 2E29A 2M3DA 2FUG9 3T9ZA 1VQMS 4OZ3A 4CCHA 2MKYA 1UJ5A 2NUUG 1S1TA 1HA1A 2JC1A 1TTHB 5DM7Q 4OHYA 3C15B 3HHLB 2C2RA 1RLCL 1JJ2R 4PEOA 2PIIA 1IKYA 2LLZA 5KFSA 4X4TA 3HZEA 4DJBA 2NPFA 2QA4G 2GA7A 4JI3F 3AXMA 5LMNF 2MEWA 2AJQA 3LAKA 3KLIB 2RHQB 1L3KA 4HHHA 1WKLA 2YWHA 3W8PA 3KMQA 1WC1A 1HIYA 1F1BB 1UVJA 4XK8C 1QAYA 4JI4F 5HBMB 2DHSA 1Q8IA 2HWHA 5D0RA 3MEDA 1ZZNA 4OLPA 1KN6A 2IC3B 5G0RA 3KHGA 5HVHA 3PY8A 4ZLNA 3HKWA 2OUGA 5DDPC 4Y2MA 1KTVA 1JK9B 4AL7A 2RJZA 2P8IA 4OX9J 5HMWA 3MR3A 1SV5B 3H0PA 1FE4A 1FKPB 3BF4A 3OV7A 3TZZA 3PJWA 4J9UE 2BOPA 2FQQB 5KG3A 3KK2A 4OYAA 3BS9A 4Y65A 2ZUGA 1T8EA 1RHQB 2P2CB 3QO9A 4CDIA 4RW9B 3UCUP 1TL4A 1DAXA 2CRLA 3T5LA 1T9WA 2ZHAA 4JV2A 2XGQA 1E6VB 5E3CA 3ENQA 3D3CJ 2JEGA 3M9NB 2F1FA 5L8RC 3HX9A 2YWKA 4QU7A 1S9FA 2IM3A 3EZUA 2DPIA 3PM9A 4QCLA 3AA8A 3MAAA 1HR0J 1FKOA 2APOA 4ZPDA 4UOHA 2MTLA 3TP2A 3E3XA 2ZNYA 3HJFA 3C3LA 1W25A 3B8HA 4OJ3A 4GKKJ 2HVDA 3Q23A 1RLDA 4DS4A 4WE1A 2AHOB 2FVSA 4R5PA 2U2FA 1NDPA 3H2VE 4PXBA 2JLFA 2B5JA 1EAYC 1X4GA 3DLEB 4DSKA 3UW1A 4F0KA 3D6FB 2KT5A 3R7SB 2AGPA 2ABYA 4E98A 1KD1T 2W1BA 4CM0A 5HI7A 2CQPA 1F3VA 1ZAVA 2YWEA 2AYEA 2MY7A 1TZ0A 1S1XA 1HW8A 2OEJA 1D09B 3NWRA 4DSJA 4B9SA 2V34A 2NSBA 2KZZA 4Y2AA 3DI6B 4WK1A 1MN9A 4S0MA 1LWCB 5KFJA 1DHMA 4AFFA 1ZA1B 1RUSA 4FDFA 4WIIA 2RB7A 5CQGA 3VZHA 1NB2A 4Z7YA 4N5SA 1JLBA 2NPIA 5DG8A 2Y9HA 1PJ7A 2B4UA 4UQGA 3M32A 2HW3A 5GAHI 2ZBPA 4ETZA 3DNCA 3MPUB 4WZMA 3IWLA 3OW2R 3BSCA 1APSA 4X4VA 4ZKAA 3OPKA 4N8OA 2A6OA 4QW8A 4UUWA 1I94J 2HLTA 1HNIB 2WAQD 3NY0A 2ZD1A 1U1PA 3CULA 3M8SA 4H4KC 1L3UA 4OHXA 2B9EA 4Z37A 3EYZA 2UU9J 5C24A 1YBTA 3N4WA 3L3CA 2LA6A 3VQTA 4B08A 4I6YA 2DNOA 3KG4A 1FA0A 3V4MA 2H4WB 1ZPWX 5E41A 1AYEA 1ZTTA 4GKJF 3K0JA 2HRTA 5C25A 4RPFA 1U8WA 3CJSA 1AROP 5J1EB 2HHXA 4X4SA 1SPBP 3MFHA 1XR5A 5AE1A 4FYWB 2HWTA 2WONB 1HBNA 4WU2A 4DX7A 2G9OA 4DWIA 1JWWA 2G1DA 3KLEA 4B3OA 1T9XA 2DGXA 1URRA 3ICLA 3IRWP 1YBAA 2CQ3A 4ED4A 3L7UA 1VC6A 2IJFA 2UUTA 5BR8J 1RWWB 4KE5A 4PYAA 4USMA 2KJWA 4JV5F 2Y8YA 3WX4A 3RW6A 2WW8A 5IV4A 3SMZA 2MQLA 4CWBA 3MR7A 3M8PA 4WBFA 5AJ3J 3DLJA 1IBKF 1CPZA 2R8IA 3ET6B 3PX4A 2MKKA 5IC4B 2YTCA 4BBYA 4ELUA 4CYUB 3BBBA 4HI2A 1RTDA 4DZDA 2W01A 3ZZZA 3N79A 2W24A 3NGKA 4MKVA 2MQOA 4GVLA 4FVCA 2M8HA 4RNOA 2FLNA 1F2HA 3BPSP 4A8FA 3I5BA 1S48A 1RT2B 1PBUA 2XMTA 3NOCA 2MDAA 2CFXA 2KT2A 4F0HA 1DRZA 2IRYA 1T9VA 1ZZFA 3ZO7A 4AQYJ 1TKZA 1BWEA 5HQMA 3MPDA 1RBOB 1VQ9S 3TI0A 1OS5A 1RQ0A 2IA6A 3JSRA 1N56A 3LUYA 3H4BA 2OI2A 2BE9B 2E1AA 2OPQA 1AXQA 4F26A 1JLQA 3PEJA 3W2VB 3ZZRA 3MR2A 4ZLLA 2ZBCA 3FCVA 3O5TB 1YRTA 2AMCB 1SUQB 5KFZA 2LEPA 4Y34A 1HBUB 1QUPA 3TAMB 1X8DA 4ZJOA 2DNHA 2OSQA 1YRUA 2UXCJ 4KSEB 3AHPA 4IR9A 3RAMA 3S7RA 1T02A 1V3SA 2D3UA 4DQQA 3KNGA 2MSTA 1N5YB 4NMXA 4NCAA 1MU2A 1FNMA 2MHEA 3HVRA 2B3TB 2D9PA 4Y0FA 3CJ2A 3CJKB 3R1LA 3I55S 1M5OC 4F36A 2V2ZA 1YG0A 2CNOB 1RE1B 4NYOA 3T1YF 1AFJA 2HBYB 4KC5A 4CLPA 1FDNA 3HULA 3OHAA 1TAUA 3IS9A 5EX3A 4X4PA 2P5VA 2ADBA 4NXMF 4UW2A 1LW2B 2UXBJ 4QYZK 5E7OB 2E1MC 1FD8A 4PAAA 2VBZA 3E2EA 1HQEB 3TJAA 2AKWB 5L1KA 3MMJA 4WK3A 3NNHA 3BZQA 4DR3J 2ZH1A 2DR7A 1CJUB 2NXJA 4LFBJ 1FCAA 4UUXA 3K7RA 4RBTA 2Y1JA 1WHVA 4ZJLA 2ZZMA 5IV3A 3LALA 2NZ4A 4YOEA 3BH7B 1U1NA 1XMOJ 1S4EA 5D3GB 2BJDA 3OTOF 3BSAA 1LK7A 2GAHC 2L08A 1EKRA 4H4OB 1C4AA 1NZ8A 4DV6J 1VQYA 3TZWA 5AT1B 2QX0A 3H2LA 1S1WA 4A8MP 1VJWA 2HHWA 2RF2B 5DETA 1T9UA 3B4DA 4K4TA 2VOPA 1BY9A 3SCIE 4ANDA 2VKZG 4ZVPB 1C1BB 2VH7A 1PKUA 1YJRA 4DL3A 1NK8A 4DR6J 2ZH3A 3IM8A 3QGIA 3N5BA 3GFHA 2P6SA 4DQPA 5J2NA 4R0JA 4IRDA 3GPAA 2IA0A 2HRYA 2GO8A 2PFDA 1KQSR 3AJ1A 1OMSA 2IPOB 4KY3A 1EQ0A 3W5ZA 4NI2B 4LRBA 2R7QA 3SI8A 3PO5A 1HI1A 2MGZA 1FVSA 3QRPA 3PZPA 4X84A 2XY6A 1F2GA 4XTTA 3GTYX 2YKPA 2V5HG 4C11B 3NNCA 5K14A 2ZC3A 2YWFA 2LEBA 2KL8A 4TYBA 2ZBQA 2B8QA 3VHQA 2CJ9A 2AEJA 1T3OA 1CC8A 3P45B 5HLFA 3R9LA 1SCJB 4I2QB 2CPEA 2LEAA 2HLUA 3KK3A 4WYWA 3I96A 2V4JA 4A8XA 1XERA 2ZE2A 2DH9A 3M8RA 4O4RA 1D1UA 1RCXB 1TR0A 3P5BP 3CD7A 3CCQS 2LQ9A 3W7BA 2YKQA 4ZJQA 4LIWA 3LPEA 3GSDA 1SJRA 3PR4A 2RIJA 3CMAS 1MG7A 4WP3A 2OAUA 4ZLJA 1F5BA 3MD1A 3GB0A 4C8YA 4JUZA 3M2UB 5BXIA 2XHCA 3CO9A 3K2YA 2E7VA 1RABB 4X4UA 3MMBB 4CH0S 1X5PA 1S6QA 2FPHX 1NJZA 2KG0A 3TUIC 3G6VA 4EI2A 2NREA 2HZVA 2FDNA 3G71S 3QFWA 2X1BA 1RAOA 3U27A 3BKTA 4PUOA 2JSXA 4ZVUB 4Q0BA 1H2VZ 2VPYB 4YMEA 2CPZA 3GJQB 1EHWA 3J80U 4EWTA 1T03B 3FEZA 1TAQA 3CCJS 2IYIA 3A1YG 2IDEA 2FJXA 4YDXA 1K47A 3W2WA 3LA0A 2C28A 2DISA 1C0UA 3UDCA 5A2QY 5KG5A 3O2IA 2K2PA 3D2WA 4RX6A 3B78A 5H9EK 1G6BA 4DV5F 1NK9A 2FHJD 1BE4A 3C16B 3R5GA 5EX0A 1CS4A 3DLGA 5LSLA 3D5MA 2UV8A 3V6JA 3OR2A 4AL5A 1SH2A 1IKWA 4DQSA 3P5TL 1S97A 4TU9A 2FJEB 3H20A 3WBZA 7FDRA 4RNHA 4X64J 4OYWA 2EWHA 3ZZPA 1IM4A 2R4FA 1WI8A 4NRTA 1R6VA 3N5FA 2MZSA 4Q8EA 4DCJB 3X3UA 1VIOA 4M5NA 2Q79A 4ENOA 3DGPB 3KJVB 2KYXA 1K0TA 4FP9A 3CCZA 3HZGA 5GADI 4NLVA 4JI3J 5LMNJ 2OIHA 5AXNA 1KHVA 2XZDB 2WCXA 5ETLA 5IC6B 2RKIB 2E9TA 2VA3A 5J2QA 2BJ7A 4A48A 4LFAF 2FJBB 3SV4A 4JI4J 3EE3A 4LIRA 1VQ6S 1NKBA 3GV7B 4MT1A 1JLCB 1WOOA 3CTRA 1N34F 2YX7A 2W25A 4UF4A 2BBEA 3L09A 1S5ZA 4LF8F 5GMKa 2HHHF 1QVFR 1GTEA 2HK2A 3JAMU 1M5SA 5L46A 5H1SV 1D3WA 3PJ9A 3MWBA 2AIRB 2RUSA 4WKRA 4ES3A 1GX6A 2IFXA 4P2XA 4A8YA 1SJ1A 2CKWA 4NA2A 2P9CA 2B9WA 2ZBRA 1FESA 1R43A 3KDOA 2G0IA 1T05B 2B7BB 4ZN1A 4FYXB 1S9GA 2IRXA 4MIBA 3OTDA 3PR5B 3VAJA 2Z2LA 3R2CJ 3G2XA 3KLGB 2VPZB 1WG4A 4U7UD 1H73A 4NCGA 4DFJA 1UWBB 1S72S 3POTB 2RS2A 2XMWA 1VS3A 4OL8A 3V6KA 2D3ZA 3V2UC 4C8OA 3J81U 3TR5A 5AXMA 1N0UA 1RTHA 1HNXF 4DL2A 5LXYA 2ZVSA 1NKEA 2ZZTA 4FVMA 2E5IA 4MFBA 1NH7A 1WKKA 3CDBA 3TNVA 1OWXA 6FDRA 3G6YA 3FVYA 1LXJA 2B4VA 2YQ3A 1MSWD 4N41A 3CNQP 3ZFVA 1WC4A 4RZRA 1VISA 1LXNA 3NAHA 5JVHQ 2FLPA 2MB0B 3BB5A 3DKDA 4KFBB 4DG1B 3V6HA 1M1HA 2N7CA 1RT1B 4ECTA 4P72A 1TL7B 2JLGA 1FJCA 1S7IA 5J2MA 3DOLB 3IM9A 3VV2B 3G82B 4J9PA 3S01A 4M1KA 1A7GE 1U6ZA 1IKVA 2KM8C 4MYUA 1Q0NA 3BR9A 2QRRA 3UVJB 5IS2A 4UZBA 5E5NA 5K5MA 3CD0A 2RQCA 4OZ0A 1N5SA 4C8NA 1B0TA 3QAEA 1NEEA 1QE1B 4RU2A 2OH2A 4CO4A 4CLZA 2V2QA 4DR2F 2N82B 3BGRA 4HYKA 2IVMA 3C8YA 4USKA 2XS5A 3PKMA 4C0HA 4J7CA 1HARA 3VVTA 1RKJA 1GXLA 3TA1A 5CXTA 3QRRA 3H5UA 1SC4B 2G2YA 1EARA 1R0CB 3QYYA 2KT3A 2KI2A 1SL2A 5CAAA 2DYAA 1REVA 2ZOFA 1VRTA 4RW8A 4K0KF 4NWBA 4B3OB 3PDNA 4IFVB 2SXLA 3MEGA 1HNVB 4C0BA 5JXSA 1YJ9S 3VCDA 2EC2A 3FSIA 5HN0A 1FDBA 2CPYA 5D77A 4MIAA 3VVUA 2UVRA 2OD6A 3OTCA 2B8PA 2NXNA 2ZDPA 4YFUA 5HMXA 1LWFB 5HP1B 3A3PB 2R7WA 1SC3B 1DLOB 3KG0A 3T5KA 1Y11A 3HSGA 4NLRA 1G3OA 4O3QA 5LJ3Y 2J9DE 1X4HA 5L9XA 4DR7F 4QPTA 1FDDA 3SDEA 3HT0A 3BBFA 4GKJJ 3NNAA 4IR1A 1Y5NB 3Q89A 1RDRA 3NS7B 1JJHA 4PWUA 2C2ZB 3OFGA 2UUCF 1K1SA 4KHPF 3RBXA 1C0TB 2J6TA 5EWEA 2AD9A 5IFMA 1HWLA 2XG8A 3QMQA 5KT4A 3BGFA 1VQLS 3R2DJ 2W7OA 2XZTB 2YWGA 2ZJRQ 3R7BB 4IRCA 2XLKA 1QAIA 3N6MA 1NRKA 4JV5J 4GO5X 1HQ2A 2R8HA 1VCTA 2HIQA 1IM6A 1X9WA 1C4CA 2FVRA 3TVKA 5KG1A 3TUZC 4MIWA 2OPQB 1RT7A 1FRHA 1NNDA 1IKXA 1JLQB 1W2IA 1IBKJ 1FWLA 4DUZF 4EZ9A 2FVPA 4TYAA 2B4OA 3E01B 1NXIA 4RW6B 2DCUB 2JFDA 1VLYA 4PWDB 4QBUA 4UQTA 3PYGA 5LM7E 4WKYA 3CDWA 2MQ8A 1VC5A 2D3OR 4NE9C 2AWZA 2CNNB 4O23A 2EKYA 5A8WA 3M2VA 2CJBA 2OPSB 5I3QA 2Q66A 2FJAB 4G1QB 2A2CA 1H98A 1I5OB 4FYVB 1DTTA 2PSZA 1EZZB 2CDQA 4K59A 1VQ8S 2JOQA 1CJTB 5K9FA 1RA6A 2K7KA 3TRGA 4ECVA 4WP8A 4KQZA 1XR6A 2DJWA 2XYGB 1TVRB 4H4KA 3M30B 3N28A 3B4MA 4ZVSB 3EMTA 2JH3A 3FNNA 3SCKE 1RHJB 1JMTA 1B4SA 1S57A 4K5RA 1FTRA 2B0GA 2PEHA 4XIUA 4ZDNA 4NLYA 2V67A 5JVGQ 2QGFB 2ASDA 5CD4A 3CF5Q 1HYSA 5DGAA 4DX6A 4O4GA 1EKSA 4DHVA 4B9LA 4DMZA 1EP4A 2CG8A 3NKYA 1VBXA 4ECRA 5E3RA 2LMIA 2WBRA 1S6PB 3Q22A 3MAQA 5D78A 2KG1A 1U25A 1FJ7A 4UOCA 3T1YJ 1DFDA 3PIOQ 4M5KA 2HS4A 1UEKA 1VOMA 1S1WB 3FBEA 1YJWS 4Y6IA 5E0OA 4DFKA 4TY8B 4CZCA 4H4MB 1Q5YA 3EVMA 3JS9A 4NXMJ 3BR8A 2OP5A 3MPWA 4USJC 1HHTP 2F9DA 3MEEB 4BCAA 5IT4A 1F9HA 1RWXB 2VV5A 2R8KA 1UEUA 3HXMA 2R8GA 1FDAA 2JFKA 2MZJA 2Y8WA 4IRKA 2FLLA 3GQCA 2RVJA 3TX8A 2XWYA 3PHEA 4RW7A 4M5DB 1KWMA 2H48B 2X1GA 2YX4A 2OMLA 5G4DA 3C6TA 3PG9A 1P27B 3OTOJ 1N5VA 4FYDA 1RWUA 2H5IB 2BANB 1VQ7S 5KFQA 2DNKA 1FWPA 2AGQA 4OV6A 1F5AA 5CYQA 3ZTPA 3K5MA 2CWXA 3PACA 3A12A 8ATCB 1B3TA 3DRRA 1VK8A 1F9FA 2DKOB 4TU7A 3T3FA 4KV8B 3I0RA 3OBIA 2FGOA 1VMBA 1BLUA 2I9SA 2ZE2B 2L3MA 3QJPA 4NL5A 2QLBB 1QD1A 4TVAB 4QR2A 4DV0F 4UOGA 3G8SA 3N01A 2NYHA 1XN9A 3JSMA 2RQMA 4M5GA 4L3KA 2DR6A 3C14A 1YVFA 4LF4F 1P1LA 1TKTB 2E7WA 1R27B 3VAFA 1BQNB 1E6YB 4JB8B 2DR5A 1MWQA 1FXDA 3MHYA 4WZQA 4MAKA 1FI4A 4OHWA 4CTAB 4IH6A 4G1IA 2VICA 4KH0B 4R8UB 3R7NB 2QA4S 2HHUA 2PA3A 1TL3B 3LWLA 4DU7A 1HHSA 2LQJA 4CNYA 1WEXA 3US5A 3GZ7A 3JSYA 1RJJA 1Q8LA 1HWUA 4NPOA 4Z2XA 2J8AA 1BXNA 3FQLA 3C66A 3OJUA 2QYCA 5B0DA 2XNQA 3SQGA 3MM7A 2LFVA 1DURA 3W3SA 5L9NA 4A8OA 1X5OA 1RU2A 3AJ2A 4CLLA 2YH0A 1S76D 2XGPA 3M8QA 1NPRA 1NK0A 2PI5A 9RUBA 3DHWC 4Y2CA 2ALZA 1B7YB 4MK9A 4HACB 4ITSA 3GWCA 4DV7F 1RKIA 4ZPVR 2NXCA 1RTJB 3OR2B 4USVA 3M2RB 3CCLS 1IR0A 2WOMA 3I0SA 5DQGA 3DGVA 1ULRA 1KEKA 1TKXA 1X4DA 4NEZA 3EICA 1WC6A 1ZETA 2QN6B 1LWEB 3TA2A 3NL0A 4YEAA 4WU3A 1ZM2A 4ICLA 4KR0B 4NZ6A 4Q2MA 5KFYA 1KQGB 1V5VA 4CM2A 3SCLE 2B43A 4ZP9A 3PIPQ 1S49A 4FXWA 3J7AN 3H40A 3DXBA 3EJMA 4QIEA 3PCOB 3QIDA 4LSLB 1RWPB 1T9YA 2V8HA 2WRMA 4M94A 1P8GA 3T41A 1NUEA 3J7ZT 1NDCA 3GMGA 4DV5J 4WXWA 2M8DB 4PR6A 4DOZA 5D15A 1PYOB 3LP1B 2Z58B 2DHXA 3NCQA 4DSEA 3NMAA 4A46A 3K5NA 2XO7A 2CJQA 2DNPA 4RUCA 3C15A 3EGVA 3HHLA 3VZIA 2N3LA 2XNRA 5LXRA 2OMOA 3I5CA 2AYGA 2KRRA 2A3JA 3QT5A 5KFRA 2RUGA 3C19A 3FGVA 3GV5B 2DT9A 2H54B 3KLIA 4OJ1A 5A6WA 1H3DA 1RGVA 3T6BA 3Q8YA 3PRVA 2V63A 4DUYF 3TX0A 5T14A 2W2NP 4RR5A 5HBMA 2UUWA 1N8RT 1H0HB 4ECUA 2IC3A 5KFOA 4A8WA 3I56S 2F65A 2KXFA 4ED6A 1UZHA 2D41A 1NDKA 1JKHB 4PPZA 2NSCA 1KVIA 1SVDA 2QYGA 1S9EB 4HTIA 2W2OP 1BQMB 4DFMA 2KFYA 5LL6d 2UXDF 4LFAJ 2EXUA 1SV5A 5GAEI 1AFIA 1CJKB 1FKPA 2YWWA 1RTZA 4RO0A 2ZHOA 2PFFB 5CHCB 2VONA 3S6EA 3VGVA 3VGSA 4O44B 2E5GA 1N34J 4LF8J 1JLEB 2QEXS 2HHHJ 2YY3A 4DL7A 3BGUA 4RW9A 1RWOB 2HFNA 2OELA 4XPEA 2AEMA 3OLAA 2EFPA 3CD6S 2WB1D 1E6VA 2C2OB 3EM1A 3IWNC 2A6MA 1OSCA 1MROB 2FTRA 4ZCMA 3VTIA 3Q8PB 2CQDA 2GO9A 1BD6A 4NMLA 3F0NA 3PX6A 3UD3P 2RU9A 2FLOA 2LVWA 5CCMA 3OL8A 3LPYA 5KFWA 3DCAA 2DNYA 1WC5A 4K4XA 1VQ5S 2CJXB 3L7PA 2HBQB 2JHEA 3PW0A 3TO8A 5I4MA 4C97A 4RUAA 1OQ3A 3M8WA 2CZVC 5L1JA 1UFKA 4NLPA 3QGHA 4QIWD 1HNXJ 2Z2MA 2BACA 1DARA 2UVUA 1XMBA 3KJFB 4ZN3A 2F4VF 4P73A 1MW7A 3KUEA 2HGLA 1GQEA 3BGLA 1SJ3P 3RTVA 1FFSB 5F8LA 3TWZA 2DY1A 1TK5A 4J9KA 3AD8C 3TW0A 1Q79A 3KJNB 3DLEA 2QLWA 4ECQA 4MJKA 2J9CA 2WBMA 2BV3A 2I8EA 2PT0A 4ZIVA 2NUHA 4EK2A 1REVB 4CH7A 1VRTB 1S77D 2QO3A 1PO6A 1PBAA 2QSWA 4QR0A 3FZ2A 3J7YI 3Q0AA 2HHTA 2XS7A 5KG4A 3CMES 2XY7A 4GO7X 1QDUB 2IDLA 3BM7A 2FHJA 1LWCA 3GIKA 3KFWX 1N5TA 4IOCQ 3C6UB 3I82A 5EUHA 4DR2J 4LQ9A 4CIOA 4DPWA 1VQ4S 1RHRB 1GMVA 2V50A 3RR8A 2XBPA 2VD3A 3FC9A 2DCLA 3PTWA 4O3PA 5DDOC 3GFXA 1LW0B 3SDEB 5C2CA 1XTZA 5IT0A 1FRIA 1YI2S 1NLKL 1YJNS 5K20B 2VBYA 4YQWA 1J5OB 1SQGA 2C22A 2HQCA 2HPUA 1S1VB 2WHOA 1ZA2B 1EJ7L 1P6TA 5E2QA 1HNIA 3GU0A 2YKMB 4K0KJ 1NDLA 4B17A 4JI5F 4L6V3 1S0VA 3DN9A 4QWCA 3RB3A 1IBMF 3A8EA 4DU8A 4QJVA 2ZH6A 3D6TB 1R0AB 4LF1A 2VIHA 3IG1B 5A6PA 3Q8UA 5J1EA 3W66A 4BWMA 2ROGA 1R3NA 2QC3A 2WONA 2WSFC 5CYMB 5KFMA 2QG9B 2Q43A 4ECSA 4K4SA 4EZ6A 2I1RA 2CJKA 4DR7J 3CO0P 2VJVA 4O3RA 4B9TA 3RUBL 3ZZUA 2OSRA 3D1HA 4B9NA 2C3OA 4WFXA 4USTA 2HFZA 1RT5B 1XR7A 3DLKB 1UMJA 1IQTA 2DGWA 2UUCJ 3BYPA 5BYQA 4KHPJ 1XWLA 3CCRS 1UP1A 4CYUA 5MLCV 3OQ2A 2DO0A 1JJCB 3AB4B 3IGVA 3RZAA 4EMDA 1VR6A 3CCES 3QBCA 1UTAA 1NHKL 2JJ4D 4DF4A 1Y0HA 2BR0A 1LKZA 3OSNA 4CLUA 2OPRB 4GC7A 3QZ8A 1JXEA 3P6YC 1RT2A 5KFNA 4DL4A 1S0NA 2B9XA 2AX0A 1ZM9A 1U09A 3MPVA 4DUZJ 3NOGA 2KHDA 2GQQA 2YNIB 3A13A 2N7YA 2CVEA 4QYZJ 5T7LB 4P71A 6AT1B 2GMLA 2DK2A 3OXGA 4OYZA 4L76A 3KLFB 4PXEA 3ISND 3T5JA 1ITPA 4F0MA 3K5LA 2COLA 5LJ5Y 4JP8A 2K7JA 4B02A 3GIMA 3W2VA 5CD4H 4WFZA 3UWTA 1SUQA 4Y00A 4KTQA 2ROPA 1HBUA 2EPIA 3TAMA 2XZWA 3PFEA 3SSRA 3MCSA 3HFVA 3R5CA 3TAQA 2AJ4A 3WC0A 1AT1B 4ZCIA 3G4SS 1G2EA 2MSSA 3EGWB 1UEVA 2YQ0A 4OZJA 3FJ2A 3H5SA 4L74A 2BVZA 3DDKA 3CJKA 4LVOP 4Y2KA 1X7VA 1YITS 4FF3A 4ZP6A 3D1OA 2HVZA 3CSKA 3OLBA 1HQUB 5T41A 4E0DA 3CD5A 4ZPBA 1EIYB 4DQIA 1V9OA 2OEKA 3FFIA 3K89A 1H7WA 5FLXY 1HQEA 5ETRA 4M5LA 3KXDA 2UP1A 4V19J 1N52B 2F3JA 3Q2SC 4XAKA 1CJUA 1FO1A 3D68A 2VDHA 1TUWA 2Z8QA 2YVSA 4NLWA 1SQFA 3NWGA 3DM2B 3OL6A 1K9MT 3C2PA 1RSCA 3I0RB 3UPFA 2HZCA 1S10A 2DXEA 2HFVA 5D3GA 4PPDA 4OX7A 2J7WA 2OKQA 2XI2A 1B0PA 4H4OA 4RWWA 2W8KA 1VBZA 2RF2A 2ZDOA 2CQIA 4RKUC 3CJ0A 3AFGA 1R8HA 2E44A 2JRSA 2UZAA 2ZHBA 1C1BA 4Q7AA 2LQ8A 2R7XA 1NB7A 2EK1A 3MF5A 4EYIB 2MZTA 3MCNA 4NLDA 4I6WA 1OO0B 3X1LB 2PN6A 1RWVB 4BC7A 3DLLQ 1WTBA 3HCXA 2QMUB 2J6UA 4NI2A 1U6BA 1RADB 1R7IA 2DY9A 2FJDB 1RACB 4A4JA 5A2QU 1Q5VA 2HG4A 3KUHA 4IO9Q 1FEEA 2FJVA 2PO4A 5FDLB 4QU6A 2D7SA 2HEKA 3PV8A 3MR6A 2MQNA 2XLIA 3ETOA 2NR0A 3NGSA 5GAGU 3FEYB 3W5YA 2GX8A 4DV0J 3G86A 5M2UA 3K5PA 3HHDA 4LF4J 2C3YA 1T9TA 4I2QA 3MOJB 2WVEA 2CPDA 3MM8B 4KKOA 2VL1A 2EBEA 4ZLPA 1CULB 3TAPA 1UFLA 4LRDA 2ZBIA 5H9EJ 4P9SA 1I6JA 1TQLA 2B7CB 4IQXA 1X0PA 5E3AA 3H59A 3BDPA 3UDLA 5KFGA 2E1RA 5AE2A 5CYJA 3DMJB 1LFPA 4DEZA 2YNHB 4N47A 2P9GA 2XCPA 1TKXB 1B7FA 2C3PA 4F25A 2OFHX 2GVDA 3AXKA 3LWMA 1KOHA 3Q83A 3M2UA 4KGVB 4MKAA 5E3PA 3MMBA 4AUKA 2WVBA 2Z57B 4BS2A 2EG1A 1RK8A 2VDIA 1HBOB 3HFKA 4MTPA 2AEFA 5FD1A 1TUGB 2D1CA 2J6SA 3HI9A 1VBKA 5HROB 1BMQB 1PC5A 5DQIA 2W9CB 4ZVGA 1FNOA 3LAMA 5DO2A 5HK4A 3CMQA 4IFYB 5HJYA 1T03A 4DV7J 3LGNA 1SQEA 2LXUA 1PGZA 3D4JA 3NS6A 1FF2A 2HGMA 3SQOP 3K58A 2I2YA 1DZ5A 2F4FA 4LBPA 1ZM3A 3OVSA 2E7XA 4LUBA 3MI7X 3C16A 4B9MA 3Q8RB 5BJRA 3AT1B 1RT3B 4U8YA 4PWWA 4AD6A 1KLNA 2EI5A 3I4PA 1KQFB 2B56A 1NJYA 3OVAA 2OJ3A 1RYSA 4NEYA 5C2GA 3KLHB 2FVCA 4CO2A 2ZKUA 3M9OB 1VLOA 3DGPA 3GCWP 1U1KA 4LSNB 3KJVA 3MCMA 4KO0B 3CDEA 5CZXA 2HNZB 3V81B 2HK3A 4J91A 5IWAF 1Y3KA 2CWKA 4E8UA 2L9DA 2PGCA 2DRBA 3M9MB 5KFBA 2RKIA 2KH9A 2MY8A 4EO8A 3DRXA 3GJTB 4DUYJ 2OPPB 3EZOA 5LT5A 4YB5A 3U1MA 3TZYA 2DNRA 3O6QA 1GNKA 1JLCA 3GYNA 1Y5IB 4KB7A 2CZ9A 2XI3A 2ZWPA 2DH8A 3QLHA 1IBLF 4IYQA 2DNZA 2MLZA 2DRDA 2BJ1A 4YY3F 1XK8A 1RAIB 1VDHA 1B64A 4LSZB 4I4BA 4PQUB 2ZC4A 2KO1A 3BDEA 1Q16B 3HJVA 2UXDJ 1ELOA 2O66A 1H2UX 3DU6A 3GP9A 3JQJA 2CDRB 3FMWA 2DXDA 3RAXA 2QL5B 3GONA 3EDRB 4RNMA 3BO3A 1ZPVA 3MM9B 1Y5LB 1FK9B 2ZITA 2I5JB 2IRUA 1T05A 3WHIA 3KLGA 3QNWB 3EZ5A 4ILLA 1Q7YT 1VYAA 1NSAA 2J7KA 1UWBA 2EG2A 1VBYA 3POTA 1D9FA 3KTQA 1JNZB 4ILMA 7FD1A 4ELVA 1UFWA 4YN3B 3AQPA 4RW4B 1GMUA 3UR3C 4DSIA 4I6AA 2IBOA 2AJ1A 2JZ5A 3ZTQA 2EVZA 2AGOA 3UCZP 4YR3A 1T3NA 1Q8BA 2GQCA 1Q78A 1UPPA 4V1Ak 2FB0A 1XEZA 3SCJE 5GAHU 2W4PA 4DN9A 1PCAA 1H38A 4KFBA 1KSPA 4DG1A 1EETB 2GHPA 2OTJS 1RT1A 1TL7A 4OIXA 3OFHA 3MAHA 2F4VJ 5D4NA 5KG7A 2IJRA 4PXCA 3DRPB 3DOLA 3OXFA 3G82A 3FQKA 2CQGA 3IO1A 4YB6A 5F8JA 2BE2B 3H90A 3UVJA 2RDIA 1C1CB 4Q8FA 1VHIA 1JJ4A 1WDTA 1D9DA 2VFSA 1YDLA 1QE1A 2FHOB 5SZTA 1XQIA 2VQFF 1A6LA 2ZOMA 1J27A 4DL0C 3GIIA 2YKNB 5LSRA 4ILRA 1U02A 4U7UK 2WSCC 2BA9A 5K8OA 4IDKB 4P7TA 3BN7A 3EPGA 4YR0A 2QL9B 3CC7S 3H2UB 3LO3A 4ED8A 3HVWA 5L38A 4OQJA 2V94A 4DQRA 4KT0C 2KVQE 4HLBA 1W26A 1SC1B 3NGDA 4IG3B 5K8NA 1RBAA 4IFVA 4P2MA 2BMBA 1HNVA 4D3GA 2IBKA 3NRBA 1FRLA 1R8BA 3MFIA 1NHVA 5DQHA 1LFWA 2YXLA 3CJ8A 1NK5A 5KTQA 4QIFA 5LOQA 1LWFA 1RAJA 5HP1A 1TKDA 3AY0A 4ZVQB 2ZFHA 1DLOA 3ZTRA 2EC0A 4ZITA 2KM8B 4JI5J 3MCOA 3QZ7A 2MQPA 1IBMJ 3CC4S 1HBMB 3DHXA 4TNOA 3IC1A 2FJWA 2W2MP 5DLGA 1LK5A 4Q45A 1IUJA 2FD2A 2M4MA 2AV5A 1VGYA 4UY8T 4KRWA 1C0TA 2XMAA 4W4MA 2LECA 3RR7A 3BQ0A 2RRBA 2MMYA 1ZBTA 3T19A 2MJNA 4LF5F 2DNMA 4DL5A 2X51A 3PRDA 4ZP7A 2B6AB 2HVHA 1IN0A 4ZCKA 4OJHA 3BSNA 1L3VA 1TL1B 1RCOB 3E01A 1KKHA 4RW6A 3GJSB 3ENVA 3ITHA 2UV8G 4PWDA 4P2FA 1UL3A 3DLBA 3SV3A 4OV1A 2CZ4A 2ZJPQ 4X4OA 4K50A 1GK8A 5DM6Q 3LW5C 4R25A 3H25A 3A8IA 2C2EA 2J9DA 2PMHA 1AZSB 1M0SA 2OPSA 3N6LA 1N88A 1RISA 2KVIA 1JLAB 2OD4A 4G1QA 4KJIA 3RYLA 2V4QA 5DLFA 4F04B 2DH7A 2BRKA 2CYYA 3RBDA 2VKRA 3ILOA 4M5IA 3CPWR 3S1TA 1X4AA 3AOAA 2RAQA 1XIQA 1CJTA 3W61A 3KHRA 1RAHB 4OZLA 1N6QB 3HSJA 3KK1B 1SI9A 1TVRA 3AD9C 3M30A 1U4BA 2CXEA 3UDVA 4EYHB 3FFIB 2HNDB 2V8GA 2VPWB 3RB6A 1VQPS 1S99A 3JTNA 4IKAA 1JXVA 3J7Z5 1YLXA 1B99A 5D0GA 3LH2S 3AD7C 3EWGA 4DXLA 3W9HA 2IIHA 5C42B 3MOZA 2WTFA 1GTHA 3AQOA 4DLGA 1G1XA 3CC2S 3G96A 3R97A 1IR1A 4WXOA 3AH6A 4YS2A 3L95X 2XYHB 2DNQA 4KGZB 4LBHA 3ZNJ1 4AXIA 4FPRA 1S6PA 2FIUA 5EN1A 1ZAXA 1RHKB 4ID8A 3ZNUA 5KOXA 4URGA 3AA9A 2VHGA 1VIXA 4TY8A 1FT8A 4EU0A 2KXNB 4H4MA 2YNGB 1U6FA 3K17A 3RGIA 2R7SA 2O67A 2R8JA 4C2MA 2CUYA 2CQ1A 1WWHA 3MEEA 4HT5A 3MM5B 1RB0A 1HL6A 1T94A 1WEZA 2W9BB 5IT9Y 1WDDA 4EGLA 4M5DA 4NYZA 2GGPB 4DSLA 5L39A 2E66A 3IP0A 2VG5B 4A47A 4K4WA 2JEIA 3UNGC 4KBIA 4LFCF 2GIFA 2BANA 1LNQA 5KFEA 2F63A 4KGXB 3NGRA 1QY7A 3MMCB 2LXFA 3HSDA 3FZBA 4DR5F 4WJBA 3W1YC 5DJBA 2QFIA 3IBFB 4IH7A 2RS8A 1HFEL 4KV8A 2HFSA 3F73A 4OYPA 3U7JA 2DGUA 2KFNA 4KKOB 5E3QA 3PNIA 3CW2C 4LRAA 1IVZA 3KUGA 1JLFB 2GMHA 4ELTA 3G8QA 3CJ4A 2CQ4A 4RU9A 3M05A 1UKUA 4CO1A 4C8MA 2QLXA 5LSOA 2R2UA 1UVMA 3AODA 4ED7A 4BC9A 4USWA 1TKTA 2RT3A 2XMVA 1BQNA 2CIMA 2R7RA 1E6YA 4C8KA 3OL7A 2AU0A 1KFDA 1J5EF 2GVDB 2PEBA 4CTAA 4OZ2A 3VWSA 1BWVA 1YZ6A 5JMNA 4G6VB 3M8ZA 4HI1A 5EHHA 3JTOA 4J9NA 3MECB 4ZMMA 2IAJB 1XNRF 4HKQA 2MJUA 4NYPA 4R8UA 5A8KB 4MMOA 1GMWA 1RHUB 3NS5A 2ASJA 1TL3A 5FJ4A 4NLGA 2VBWA 2F8EX 1V5IB 4MK7A 5GMDA 2GV1A 2R7UA 1GX5A 4DN0A 2AYBA 2MKHA 4JOUA 3ILIA 2O01C 3PXGa 1F6TA 2VG6B 3AOBA 5HJXA 2XEXA 1KNZA 1N32F 2KXHA 2YNFB 1H72C 1WF0A 4I67A 4NLQA 3BKFA 2I0XA 4HACA 1RP5A 1CSJA 1RTJA 1NSPA 1PJ5A 3M2RA 3AOCA 4YR2A 4I0WA 2X1AA 4CH1A 5F8GA 1X5SA 2P9EA 4YB1P 2V8VA 4B3MF 4OYOA 3PO4A 2AZ3A 1LWEA 5GADU 4DDFA 3T1HF 3I9ZA 2DEJA 2VFRA 2ILYA 2KN4A 4FPIA 2D9OA 4LF2A 2DPJA 2DTJA 4LSLA 1C2PA 4W98A 3DRSB 1UA0A 2LU2A 4DR4F 3H4DA 4C3LA 1KLMB 2HS0A 2HVEA 4F67A 4I2PA 4I64A 3MTKA 1X9MA 1UCNA 1A0OB 3CUNA 2J76E 2BJ9A 3NG8A 3NBPB 4P74A 3LP1A 3PYEA 2Z2ZA 5HL7Q 5HAOA 2QJ3A 2BOAA 4JYAF 1RA7A 4RJVA 3UD4P 3CE8A 2HGNA 1YJUA 2FZGB 1U45A 2MKJA 4QQBA 3LP0B 4J9QA 3MMAB 2DIVA 3QLHB 3P96A 4ECWA 2A2DA 2D69A 3HKZD 3CVKA 4RUHA 3MUTP 2QV6A 3EVWA 2YH1A 2PMWA 3M6XA 1MWZA 3Q24A 1UVKA 5IWAJ 1M5HA 3UE2A 1U24A 3VALA 2CQHA 2JNJA 4NA3A 1JKHA 3QGPA 5D0HA 2VB6A 1HLWA 2K1RB 3THVA 3JTPA 1S9EA 5HVGA 3OT9A 3BSOA 2V4RA 4CNZA 2GJFA 1BQMA 2C3MA 4Q43A 1U47A 1N33F 1NZAA 2YX1A 3B82A 5KFXA 1CJKA 1CQMA 3PX0A 2AP6A 4ES2A 3JYTB 3BKUA 1TU0B 4HL9A 4O44A 3NLCA 2E5JA 2OLWA 1IBLJ 2M52A 1JLEA 2HWIA 4YY3J 4ED2A 1DQ8A 1EQMA 4RWXA 5B0FA 3Q86A 5BYSA 2BM1A 4PG6A 1NBEB 1MROA 3CCTA 4U6PA 1N36F 1Y3JA 1H6KX 3MXHP 3TANA 1S12A 1DQAA 2HURA 4F4ZA 2Z56B 1WTFA 3OHBA 2CA9A 2WK4A 2OTLS 4DF8A 2HQIA 4F4KA 3G6ES 3WZ0A 2RDJA 2X1FA 1RZMA 4C3KA 4WF9Q 2POKA 1IR2A 4LREA 3FSXA 1HD0A 4B3TF 1VRUB 4GVBB 4BHQA 3QFHA 4X65F 4IOBA 1SH0A 5KG0A 3LANA 4JI1F 4K4ZA 2YBVA 5JJBA 4ED3A 2P6TA 1SL0A 4BWJA 4PABA 4Q5VA 4TKTA 2DXFA 2FHKA 3NEKA 3CB4A 2C2DA 2KJVA 5DRKA 2PMZD 2VBXA 1YIJS 1M5PC 1U2RA 3BEGB 4IOAQ 4UZCA 2HHQA 1WF1A 4CLWA 2OO4A 4G3IA 3MUMP 4F3QA 4ZPWR 5B0GA 2F7VA 4IO1A 4CLFA 2CNKB 1ZM4A 2J9EA 4IH5A 5J2PB 3F56A 1TFYA 1FFWB 1PAUB 4XDDA 5KT7A 2UVVA 4DCOB 4EEYA 4ZPAA 3I87A 1KR4A 4KHRA 3GR0A 3C6UA 2GNKA 3F41A 3QWUA 2QA1A 3M8YA 4I7FB 2VQFJ 1IQZA 4BDPA 3BV8A 1LOUA 4IG0B 4LRFA 5F3ZA 1UVNA 2DO4A 4DV3F 1QTNB 1LW0A 4V19X 3IBWA 3MM6B 2QL7B 2JX2A 1L3TA 1J5OA 5B09A 1SB6A 1S1VA 4PG5A 1XBWA 2QT7A 4JV1A 2YKMA 2DITA 4J9VA 1G4CA 1Q1KA 3VGUA 3JQKA 2QSFA 4NXNF 1RI7A 2M70A 3HT3A 4CO0A 4QIGA 1Q86T 1R0AA 4OLOA 3IG1A 4MK8A 1U1QA 1FJEB 3W62A 2ZH7A 2Y0BB 2MLYA 2DEIA 1X4CA 2BZ2A 1FRMA 5CYMA 1FTCA 4DV4F 1O6XA 4FBTA 1OPIA 2VZ9A 2CJYB 2HFUA 4OI1A 1G7CB 2R2TA 2Q6CA 3QPIA 1ZOTA 3ITHB 1VQSA 3G87A 1HKAA 1KHWA 1CBKA 2JDJA 4TU8A 2VJUA 1RT5A 2J0SD 2V68A 2B4PA 3DLKA 2BYCA 1KP6A 4DZ6A 3FBCA 3R5DA 1UPMB 3K57A 1TFWA 4QYRA 3PYFA 1HNWF 1DTQB 4ECZA 1WC3A 3TQEA 1YQHA 4URSA 4QWDA 4HH0A 5DZ6A 4TLRA 5I3UB 3HF5A 4B3SF 5FLXU 2XHWA 4LF5J 3HVTB 1D9AA 1KTQA 2AJ0A 2OPRA 1X31C 4JI8F 2XC9A 3CIMA 4ERDA 2R9LA 1H2TZ 5F8MA 4RNNA 3HO1A 5IXUA 3JXOA 5KT5A 4ZP8A 4KYZA 1DBDA 2YNIA 3U1NA 3UFCX 2L9NA 5T7LA 3KLFA 5F8NA 1RTIB 4QPXA 3RB0A 2M5YA 5KFHA 5C5JA 2MQMA 2BXJA 3QAUA 4GC6A 1K0VA 3EXCX 1TP7A 1H74A 2CADA 3N9UC 4X2BA 3PW4A 4W92B 3FCWA 1YWXA 1R8CA 2UVWA 3EX7B 2DRAA 5I42B 3KYLA 1PYTA 2DHGA 1PJ6A 3W9IA 1Q8KA 3GCXP 1YRXA 4JV0A 1UJ6A 1QSYA 3ETMA 3DYAB 2EFNA 3ZTSA 2HNYA 3D1QA 5KFIA 2HVIA 4EUVA 4KGMA 3LQVA 3GG0A 4B3RF 4AXJA 4UTGA 4ZIWA 3KHHA 3O44A 5FIIA 3JSBA 3OR1B 4WCEQ 1YX2A 3Q2TC 4DBQA 4FN5A 2FZCB 3HMJG 2IY5B 3CJ5A 2QTWA 4O0IA 1HQUA 1Z4UA 1U8SA 4CLKA 3PW2A 2J7UA 2IM1A 4YP3A 1GEHA 4J9MA 3DOKB 4DS5A 2AZ1A 2AW0A 1SL1A 3TVYA 4OYBA 3NAIA 4J9OA 5AE3A 1OY9A 2MYFA 3RW7A 2M2BA 2VG7B 4YUDA 4FBUA 2M7SA 4U95A 3ZXWA 1R0BG 5GMEA 3DM2A 1DY3A 2DB1A 1NHUA 5LMUF 4LRCA 2HAIA 3SFGA 3LP2B 3FMBA 1M5KC 1P1TA 3SFUA 2O1PA 3DLHA 3BH6B 3A8JA 1REGX 5F9NA 1HMVB 1SJ4P 3PJXA 1JLGB 2JC0A 3IRXB 5KFPA 4YHHF 2EBGA 1YBUA 5KFCA 1MLAA 2MZ1A 1F5CA 2HHVA 1VQNS 1EB0A 2F40A 1FRXA 4Y2IA 1KFSA 1L3SA 5EGYA 4ETXA 3HK2A 4LFCJ 4P6QA 2MHNA 3FK4A 1EX8A 5HSPA 2HRUA 1Z2LA 4J9LA 3HHKA 3QWPA 1X9SA 4DR5J 3VAHA 3HHLD 4F4WA 2HMIB 5D8HB 4OYMA 3SSSA 4N8NA 1Q4RA 2MZQA 4LF6F 4MH8A 1WACA 1KONA 3M6UA 3HHEA 1LQ9A 3KOAA 3I6PA 1WJ9A 1U1RA 4X66F 2QIFA 4K5SA 5FDLA 1FX4A 4USIA 1SJQA 3HLUA 4ID5B 2L41A 2QMXA 4OYIA 3HPOA 3THPA 3F44A 1N48A 4DX5A 1IXKA 4N77A 2FC8A 1NJXA 1HNZF 3JB9k 3G6XA 3MM8A 3MZIA 3QT8A 1WOPA 1J5EJ 1UWAA 2CPIA 4E2FB 3PVXA 1TMJA 2R7VA 1CULA 2GVZA 2W8LA 2G13A 2XWXA 1CJVB 1U48A 1XNRJ 4OX6A 1RT4B 3DMJA 3TYTA 5J1NA 2YNHA 3RJMB 4ZHRB 3O8WA 1BUXA 3BN4A 2Y3YA 2V9KA 2VUGA 5M2RA 3K8WA 1KS2A 1S0MA 3AJDA 3TEGA 4JI6F 3JQMA 2C2MB 3IXQA 2O5DA 3NP5A 1FJGF 1UW9A 3W63A 2X3DA 4M95A 4TXSA 1KC8T 4F02A 5KFVA 3A8KA 3ENAA 1RYRA 4FYYB 1HBOA 3V6DB 3R5AA 1MMLA 3HHLC 3CDAA 2W4DA 1HWKA 5AXKA 2KZMA 2EFQA 5IOLA 4LF7F 4FNHA 5HROA 3B54A 4DV1F 2W9CA 1HW9A 3RRHA 4I2PB 3BYRA 1N32J 5ETQA 4LVNP 1WEYA 8AT1B 3HFZB 4IFYA 2ROEA 2ZKTA 2UUBF 1NK4A 2HQ3A 4KGKA 1QSSA 4LF9F 1FKAF 1WSVA 2MQQA 2JVRA 2QA2A 1KDNA 2VC0A 4M63A 4F7VA 4EO6A 4I68A 5A8RB 1S1UB 5CCLA 4B3MJ 3DOMA 4U67Q 5A0YB 1RAEB 2CAJA 2UUAF 2BM0A 2BJ8A 4WPAA 1RT6B 5D4LA 2E1PA 3T1HJ 4C98A 5IM0B 4LJMA 1NSKL 1RT3A 3UD5A 3HD2A 1GH8A 1CG2A 1X4FA 3NGUA 2HQFA 3PW7A 3G9CA 1MWYA 4MYTA 3V4IB 3GLJA 2VFUA 4DR4J 2H9ZA 3HD1A 3RBEA 5GAEU 3T6JA 4ZVFA 4DFPA 1OY6A 4QW9A 1J2VA 1SKSA 4HHUA 3MGJA 2YKOA 3KLHA 1T7PA 2LP4A 2ACYA 2XMKA 5H9FK 5B0AA 1HI8A 1S1TB 4J5OA 4KHMA 1NPKA 4LSNA 4UY85 4KO0A 1K8AT 1XMQF 1Z1ZA 1RAGB 1IKYB 2HNZA 3V81A 4ZVEA 4JYAJ 3M6WA 3CCUS 1RU1A 1S0OA 1M90T 4JI2F 4ED5A 3KLVA 2MLXA 3TVZA 4OHZA 4KPYA 2KFZA 4W90B 4M5HA 1TELA 7AT1B 4NOHA 2ALYB 4Y28C 1ZTWA 4F2SA 2OPPA 1VQKS 2Y1IA 4F4AA 1F9EB 4ECYA 3MEDB 3UQSA 5CZVA 3K8VA 2Q6BA 5G0RB 5D4OA 1SIZA 2G0JA 1Q81T 5SUHA 2XMJA 2JLEA 4WYLA 2DNGA 4DSFA 1D8ZA 1HI0P 4FKYA 4QR1A 4DPYA 2HQGA 3KDNA 2KHCA 4Y3CA 5D4PA 4PQUA 1BC6A 3FEXB 4U7CA 1N33J 1I1GA 4CT9A 5KAKA 2DHHA 2Y0SD 1MMNA 1GT8A 4A8SA 3IGNA 3RAQA 3KK2B 2G4BA 3UR0A 2DVIA 2ZM6F 3MM9A 4DX8H 3CJ3A 1T95A 3QO9B 1HPZA 2IM2A 1FK9A 2I5JA 2VPXB 3OL9A 4PQAA 1YJVA 2QLFB 3H7HB 4NX9A 1RXOB 1TK8A 2Z4PA 1S6OA 3HP6A 1AW0A 1YK9A 1M1KT 2BW7A 1N36J 1TMMA 3J7YU 4HHJA 5F9LA 1WNEA 2KKHA 4O3OA 2ZJQQ 3TQ1A 5ETNA 4ALZA 1CVJA 1TV6A 2B9YA 1FHTA 4RW4A 4K2XA 3I9V9 4IQMA 2BQRA 3A3NB 3D0GE 3MAAB 1FKOB 3W60A 3CCMS 4FXVA 2F9JA 2IM0A 4B3TJ 4OYXA 1Y9OA 4X65J 3UDEA 2NXUA 3U02A 3ENWA 3H98A 3GG1A 1YTYA 1WSRA 1EETA 4JI1J 5KT6A 2RHSB 3MEKA 2MKCA 3T5HA 1PG5B 5CABA 1NMEB 5KFFA 4WE1B 3P4UB 3NCPA 5B0BA 3DRPA 4QWEA 3GYXB 4OJGA 5CH7B 4R5PB 4N76A 2LCWA 4EFAC 5ETKA 1Y7PA 2B5JB 2D74B 2BE2A 3EPIA 1C1CA 2E5LF 3MTJA 2RD5C 2OHDA 4OZNA 4UT4A 2V9WA 2ZH5A 2A10A 1NCLA 1X60A 1ROFA 2F8MA 3GFZA 1L5UA 4OZ1A 4HDGA 1T11A 1S1XB 2YKNA 4RL1A 2RQKA 4ZVOB 2HIYA 4WWSA 2FVQA 1SKUB 2LKZA 4IDKA 3UI3A 3QSIA 3CJRA 3W65A 2VQEF 2BQ3A 1U1LA 2EFVA 1KOOA 2H1YA 4ES1A 4JI7F 3R5JB 1JLBB 3MUVP 2XULA 3TA0A 1LV5A 2HYIB 2GC8A 2U1AA 4IG3A 2Z0GA 3RRKA 3M32B 3M4XA 1XNQF 4L73A 2DGVA 3FBFA 2VF3A 4DV3J 4C4WA 2N4CA 1PC4A 5RUBA 2WVFA 2ZOGA 1D0EA 2RSQA 1WG1A 2ZD1B 4ZPTR 4X62F 2NYIA 3MDFA 5C24B 1YJ7A 5E33A 4NXNJ 4K2JA 3E8OA 4CT8A 4NLSA 2H51B 3MD3A 3KJQB 1I51B 1HBMA 1CEZA 4AT1B 5C25B 5DDQC 3GIJA 3RU0A 4ZK7M 2H5EA 1FXRA 3IR7B
chains in the Genus database with same CATH topology
3GWCA 3ENQA 4DV7F 2O67A 1RKIA 4ZPVR 1HBNB 1RTJB 2R8JA 3DC2A 4C2MA 2JEGA 3OR2B 4X4NA 3M9NB 2CQ1A 2F1FA 1WWHA 3MEEA 4HT5A 3KLEB 3M2RB 3CCLS 1IR0A 2WOMA 3EUNA 3MM5B 3I0SA 5DQGA 5L8RC 1HL6A 3VAGA 3HX9A 4HEA9 1T94A 4K4YA 1ULRA 1KEKA 1TKXA 1WEZA 2YWKA 4QU7A 1X4DA 4OI3A 2W9BB 1ZETA 1S9FA 2IM3A 3EZUA 2DPIA 3PM9A 4QCLA 5IT9Y 3AA8A 3K5OA 1LWEB 3TA2A 1FKOA 4EGLA 3NL0A 4YEAA 2GIQA 4WU3A 1ZM2A 2W7AA 4M5DA 2APOA 1QVGR 4NYZA 4ICLA 4ZPDA 4HH1A 2GGPB 4KR0B 3BQ2A 4NZ6A 4DSLA 4Q2MA 5L39A 2E66A 5KFYA 2OFGX 2B6AA 2DBBA 2VG5B 4A47A 4K4WA 3IFEA 1KQGB 3TP2A 3SCLE 2JEIA 2IMOA 3E3XA 2B43A 4ZP9A 1IJFB 3M8PB 3PIPQ 1S49A 4FXWA 1QAJA 4NLUA 3UNGC 2ZNYA 4KBIA 4LFCF 4NRUA 3HJFA 2R7OA 3C3LA 1W25A 3B8HA 2BANA 3H40A 3DXBA 4QIEA 3QIDA 4LSLB 5KFEA 4OJ3A 2V8HA 2WRMA 4M94A 5KOWA 1TL1A 1P8GA 1RTDB 1QY7A 3MMCB 4GMKA 2LXFA 2DGSA 3J7ZT 3GMGA 3Q23A 4DS4A 5F0UA 3AAWB 3FZBA 4DR5F 4WE1A 4WJBA 2L9WA 5DJBA 2FVSA 2HHSA 3LOUA 3EGZA 4IH7A 4WXWA 2RS8A 4F50A 2M8DB 4R5PA 1HFEL 4KV8A 1F0XA 3F73A 2U2FA 4Q2LA 4PR6A 5DGBA 4DOZA 3H2VE 4PXBA 2LU1A 3U7JA 2DGUA 2KFNA 2JLFA 2B5JA 4KKOB 5E3QA 3LP1B 3PNIA 1X4GA 2DHXA 3DLEB 3NCQA 3OUYA 4DSEA 4DSKA 3NMAA 3UW1A 3FDSA 4A46A 3K5NA 2XO7A 2KT5A 1TK0A 2CJQA 5KFKA 2DNPA 2HNYB 5B08A 4RUCA 2ABYA 3HHLA 2AGPA 4E98A 1KD1T 3VZIA 2N3LA 1JLFB 2GMHA 4ELTA 2XNRA 4I69A 5LXRA 1TKZB 2OMOA 3M1VA 3I5CA 2AYGA 2KRRA 3G8QA 3CJ4A 5HI7A 2CQ4A 2A3JA 2CQPA 3ZZYA 1JLAA 4RU9A 5KFRA 2RUGA 3M05A 1UKUA 1ZAVA 2W7PA 2YWEA 4CO1A 2AYEA 4C8MA 2QLXA 5LSOA 2R2UA 2MY7A 2Y1RI 1FVQA 2PI4A 1UVMA 3FGVA 3GV5B 4ED7A 1TZ0A 1BQXA 2DT9A 4BC9A 3KLIA 1TKTA 4OJ1A 1S1XA 1HW8A 5A6WA 2RT3A 2XMVA 1H3DA 1BQNA 4DSJA 2CIMA 1RGVA 3T6BA 2R7RA 4B9SA 1E6YA 4C8KA 3OL7A 2AU0A 1N6QA 1KFDA 1J5EF 2NSBA 3KK1A 4DUYF 2KZZA 5T14A 4Y2AA 3DI6B 4WFAQ 4WK1A 4CTAA 1NH8A 3VWSA 5HBMA 1LWCB 2UUWA 5KFJA 1DHMA 1VHFA 4DR1F 1N8RT 3IAM9 4AFFA 1H0HB 4G6VB 1GXUA 5IQQA 2G0CA 4ECUA 4HI1A 2IC3A 4WIIA 5EHHA 2HNDA 2RB7A 3ISZA 3JTOA 5KFOA 4J9NA 3MECB 3IA0A 5CQGA 3VZHA 4ZMMA 2IAJB 4A8WA 1XNRF 2GMJA 3I56S 4N5SA 2KXFA 1JLBA 1NAQA 2NPIA 2MJUA 4HKQA 4NYPA 4ED6A 5DG8A 2R2RA 4R8UA 5A8KB 2D41A 4MMOA 1JKHB 1V3ZA 2B4UA 4PPZA 4UQGA 2NSCA 3M32A 2JL9A 1KVIA 2JWNA 3NS5A 2HW3A 5GAHI 2ASJA 4ETZA 1TL3A 3DNCA 3ISNC 5FJ4A 4WZMA 3IWLA 1S9EB 4PCQA 2DNNA 4NLGA 4HTIA 3OW2R 3BSCA 3D0HE 1APSA 2VBWA 1BQMB 2F8EX 4DFMA 4X4VA 4JBCA 2KFYA 5C42A 5LL6d 1U1MA 4FF4A 2UXDF 1NJWA 4ZKAA 1MU2B 3OPKA 4N8OA 4QW8A 1SV5A 5GAEI 4MK7A 4UUWA 1AFIA 2GV1A 2MZRA 1FKPA 2R7UA 2HLTA 1V3RA 4X4RA 1HNIB 2ZHOA 2PFFB 5M2PA 1GX5A 2WAQD 5CHCB 3O1LA 4FF2A 2VONA 4DN0A 2AYBA 2MKHA 2ZD1A 3S6EA 1U1PA 4JOUA 1SBRA 3CULA 2W4CA 4O44B 3M8SA 2E5GA 4O3SA 2O01C 3OTEA 4H4KC 1L3UA 1FERA 4FS1A 4OHXA 1JNRB 1JLEB 3BREA 2QEXS 4Z37A 3PXGa 3EYZA 2YY3A 5C24A 3N4WA 3TOQA 4DL7A 3L3CA 2LA6A 3IS9B 3BGUA 4RW9A 2VG6B 3VQTA 4B08A 2XEXA 4I6YA 2ASLA 2DNOA 2ZNZA 3KG4A 2HFNA 1FA0A 3V4MA 1KNZA 1ZPWX 5E41A 1ZTTA 4GKJF 1N32F 2KXHA 3K0JA 2YNFB 5C25A 2YNGA 1WF0A 1ZAWA 4XPEA 4I67A 1AROP 3VQSA 3OLAA 2EFPA 5J1EB 3CD6S 2WB1D 4NLQA 1E6VA 2I0XA 3IWNC 2HHXA 4X4SA 1OSCA 3HVAA 1MROB 2FTRA 3MFHA 1RP5A 1XR5A 4NLXA 5AE1A 2EK6A 3BJYA 2HWTA 2WONB 1CSJA 1HBNA 4WU2A 1RTJA 2M9KA 2I38A 2GJ2A 4ZCMA 3VTIA 2G9OA 4DWIA 3Q8PB 4CO3A 2CQDA 3IN5A 1JWWA 2G1DA 2GO9A 3U1LA 3KLEA 1BD6A 4F3MA 3G8TA 4B3OA 3M2RA 1QSLA 4YR2A 3MM5A 4NMLA 2DHAA 2DGXA 1URRA 3PX6A 4I0WA 3UD3P 3ICLA 5IQ6A 3IRWP 2RU9A 2X1AA 1YBAA 4CH1A 2FLOA 2LVWA 5CCMA 2CQ3A 5F8GA 1X5SA 2P9EA 1VC6A 2IJFA 4YB1P 2V8VA 2UUTA 4B3MF 2W9BA 4KE5A 3OL8A 3PO4A 2KJWA 3LPYA 3RRGA 4JV5F 1LWEA 5KFWA 3DCAA 5GADU 3FRYA 4F8RA 3WX4A 4DDFA 2DNYA 3RW6A 3M6VA 3T1HF 2GGPA 4K4XA 2WW8A 1VQ5S 2MPUA 3I9ZA 3SMZA 3IWXA 2VG5A 1HWJA 2VFRA 3L7PA 2ILYA 4LT6A 3NCRA 2KN4A 1O51A 2MQLA 2JHEA 3M8PA 3PW0A 3DLJA 1GXTA 3TO8A 2R8IA 1IBKF 5I4MA 1CPZA 3PX4A 4C97A 2D9OA 4DV2F 4RUAA 1OQ3A 2MKKA 2CQBA 2CZVC 2YTCA 4BBYA 4NLPA 3QGHA 5L1JA 4QIWD 2DPJA 2DTJA 4ELUA 4LSLA 1C2PA 4HI2A 2Z2MA 2BACA 5K8MA 1RTDA 3DRSB 1UA0A 2LU2A 2IVYA 1DARA 3MMCA 4DR4F 2UVUA 1XMBA 2DGQA 3ZZZA 3FSYA 3N79A 2W24A 4C3LA 3H4DA 2F4VF 3NGKA 3H8YA 1KLMB 1MW7A 1URNA 2HGLA 2HS0A 1GQEA 1Q7LB 2MQOA 1R6YA 4F67A 1VI7A 4I2PA 1U1OA 3S8SA 4I64A 4WFYA 4ZPCA 3MTKA 1X9MA 3BGLA 1SJ3P 4FVCA 3CUNA 2M8HA 5HO4A 4RNOA 2FLNA 3SEOA 2J76E 1SJFA 3RTVA 1TL5A 5F8LA 3NG8A 1TK5A 4J9KA 4A8FA 3I5BA 3NBPB 4QWAA 3TW0A 1Q79A 1S48A 3LP1A 1RT2B 2BW2A 3DLEA 2QLWA 5HL7Q 2XMTA 4ECQA 1MNEA 2MDAA 2CFXA 2KT2A 2CVIA 4MJKA 2J9CA 1DRZA 3PKYA 2IRYA 2WBMA 2BV3A 3QJJA 1ZZFA 2I8EA 1JLFA 5J2NB 1TKZA 3TARA 4JYAF 1RA7A 2PT0A 1BWEA 2NUHA 3UD4P 1REVB 1X4EA 3CE8A 4CH7A 1VRTB 1S77D 2HGNA 1YJUA 1U45A 2MKJA 4QQBA 5B0CA 2QO3A 3LP0B 4J9QA 1PO6A 1VQ9S 3MMAB 3TI0A 3IAS9 2QSWA 2DIVA 2JEJA 3QLHB 3P96A 4WFNQ 1OS5A 1RQ0A 2IA6A 4QR0A 3FZ2A 3J7YI 4ECWA 3JSRA 1N56A 2MGZB 3Q0AA 2HHTA 3LUY