1AUDA

U1a-utrrna, nmr, 31 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords RNA 3UTR
publication title Structural basis of the RNA-binding specificity of human U1A protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 1997-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1audA00
2CQGA 3UD3P 2DGVA 1X4BA 2X1GA 1M90T 2CQ3A 2MKIA 3IWNC 3G4SS 3MUMP 1X5TA 2DGSA 1WF0A 2CPYA 2CQ2A 3VAMA 3S7RA 4CH1A 1URNA 2KHCA 3HI9A 4ED5A 1WF2A 1FJCA 4WFNQ 5FJ4A 5D78A 4CQ1A 2EVZA 2CQIA 1K8AT 2M9KA 4F25A 3RW6A 2LXUA 1R8PA 5GMKa 2CQ1A 2KM8B 2DNYA 2MZ1A 2N3OA 4TU7A 1JJ2R 1WHXA 1FNXH 3I56S 3UWTA 2G4BA 4YB1P 2ERRA 2AYEA 3TO8A 2D3OR 3G71S 2DNQA 2LEAA 3LPYA 1A9NB 5BJRA 1VQNS 2RQ4A 3ZZZA 2MZJA 1B7FA 2GHPA 3NNAA 2RU3A 2CPIA 2DGWA 3MUVP 2KRRA 1YHQS 1NO8A 5CXTA 2I38A 2QA4S 2D9PA 3BEGB 3BO3A 1U1MA 2X1BA 4IOAQ 2LMIA 2DHXA 3PIOQ 1UFWA 3CC7S 1VQMS 2E5JA 2MKCA 1S72S 1YJWS 2CQPA 3P5TL 2OTJS 4V19X 1FJEB 4F02A 2J8AA 2M4MA 2DGQA 1N88A 2VODA 2M7SA 2DNPA 3H2UB 1PO6A 2KVIA 3UCGA 3G8SA 1VBYA 5IM0B 1DZ5A 2PEHA 2RUGA 4YOEA 3EGZA 1OWXA 2YKAA 1YITS 3LQVA 1A7GE 2L08A 2KH9A 4TU9A 2M52A 1VQ6S 2ADBA 1H6KX 5ITHA 2AYMA 2DH9A 3V4MA 3K0JA 4WFAQ 2RNEA 1NJIT 2FHOB 3P49B 1UP1A 1U1QA 2CJKA 2M8HA 4YUDA 3CC4S 2M88A 3CUNA 1WHVA 1WG4A 4F26A 1WWHA 2DIVA 2KG1A 2LEBA 5IQQA 4IUFA 3VAHA 1U6BA 3VAFA 4WF9Q 1WEYA 3TP2A 1VC0A 2KXHA 4IO9Q 2MXYA 2CQ0A 3UD4P 2DO4A 1W2BR 2X1AA 5LSLA 4W92B 2DIUA 2DNMA 2E5IA 5HO4A 2FC9A 4W90B 1X4EA 1DRZA 2KU7A 3NS5A 2OSRA 2DGXA 2KI2A 2QEXS 4PR6A 3G8TA 2RRAA 2MHNA 4QPTA 1KOHA 2MPUA 3G96A 5LSOA 3UCUP 2J0SD 2KXFA 2MSSA 1ZZFA 2JVRA 2XS2A 3CCRS 4ZKAA 3OW2R 4LJMA 2D9OA 3ZZYA 5DDOC 1WI6A 3VAIA 5GAEU 2YTCA 2MZSA 5GAGU 4CIOA 4QU6A 4Y00A 2YWKA 2MKHA 2N3LA 2MGZA 2LKZA 2U2FA 3P6YC 2BOPA 2LXIA 5DDRC 2CQHA 2V94A 5LXYA 2I2YA 2DNOA 1VQ7S 3G9CA 2DHGA 5DETA 3CCQS 2VOPA 1F9FA 2DNHA 4A8XA 1UAWA 2K8GA 2G1DA 2LQ5A 2MSTA 2UP1A 2CPJA 3L3CA 2AYBA 5JVGQ 4FXWA 1YJNS 3JB9k 2CQ4A 1O0PA 3U1LA 2N7CA 2ZJPQ 3CCMS 1U1OA 1L3KA 2XS5A 3CF5Q 2ZJQQ 1G2EA 2LECA 5GAHU 5D77A 3B4MA 3THTA 3S8SA 1AUDA 3G6ES 2DH8A 1U1PA 2VONA 3UCZP 3R1LA 3VF0B 2MMYA 3H2VE 2E5HA 5CYJA 2YH0A 3B4DA 3CMES 4WCEQ 1N52B 3CCUS 2XB2D 1KC8T 2WBRA 2KN4A 1WEZA 3J7ZT 2CQBA 2KM8C 2MQNA 1WG5A 3MI7X 1U6FA 3CCES 5H1SV 2X1FA 5EN1A 1Q86T 2F9JA 2LA4A 3CTRA 2FPHX 1FJ7A 1DHMA 1WELA 3CXCR 1FXLA 2DNLA 2DHAA 4LMZA 3CMAS 1NU4A 3FEYB 2DHSA 4ERDA 4FXVA 2KRBA 2CPEA 1R8HA 4J5OA 2CPXA 2J0QD 4M5DB 3J7YU 3Q2TC 1HD0A 5MLCV 2JWNA 1SJQA 1Q81T 2RQCA 2KYXA 2MJNA 1M5PC 2Q79A 3Q2SC 3VALA 1Q7YT 1P27B 3PIPQ 1U1KA 2RS8A 1VC6A 4UQTA 1VQOS 2QFJA 1QVFR 1YI2S 3CPWR 3RW7A 3D2WA 3CULA 2NLWA 1K73T 2DK2A 1YTYA 1U1RA 1YWXA 2KXNB 1U1NA 2MKSA 1DBDA 2E44A 2MB0B 2BZ2A 3MUTP 4P6QA 1YJ9S 1XN9A 1H2VZ 2L41A 1WEXA 1SJ4P 1WG1A 1FT8A 1S79A 2MY8A 1WHWA 3BO4A 5DM6Q 1VQ8S 3I55S 1D9AA 1N54B 2M70A 2LA6A 2JVOA 2KFYA 1BY9A 4EGLA 2DO0A 3IRWP 3FEXB 3N9UC 2OTLS 2OJ3A 3BS9A 1VQLS 2OIHA 2RRBA 1X4AA 3S01A 2JRSA 2N82B 3S6EA 1RKJA 2VOOA 5DDPC 1X4GA 2AD9A 3MD3A 1Q82T 2CPZA 1OPIA 2CPFA 4Z2XA 1QVGR 1X4DA 1VQ4S 3CCSS 2HGNA 2DNGA 2XS7A 1CVJA 1RK8A 2JX2A 4OZ0A 1ZZNA 2FY1A 4QU7A 1JJHA 1M1KT 2AYGA 3VAKA 2DH7A 5DDQC 2DNZA 2DB1A 2ADCA 3SXLA 2DITA 2KT5A 5LXRA 5GADU 2M2BA 3UE2A 2NZ4A 1WHYA 1OO0B 2U1AA 1KD1T 2DGOA 1M5OC 2HVZA 2EK6A 2DNKA 1H2TZ 1HA1A 1JJ4A 1SXLA 3NNCA 3P3DA 2F3JA 2HGLA 4C4WA 5GVQA 2YH1A 1X5PA 2MGZB 1YIJS 3CCLS 3US5A 2FC8A 1X5SA 1ZH5A 5IFMA 5IM0A 2F9DA 1X5OA 2SXLA 4IOCQ 1VQKS 2OSQA 2RT3A 3U1MA 3SDEA 1VBXA 1X4HA 2HZCA 2MKKA 3MD1A 4OZ1A 5LJ5Y 4BS2A 3NS6A 2K3KA 2CPDA 4Y0FA 3DXBA 2XNQA 4CH0S 2ZJRQ 2HYIB 2XSFA 1X4FA 2MKJA 3SMZA 4C0OC 4RU2A 3DLLQ 2L9WA 1U2FA 1M5VC 1PGZA 1VQPS 4WKRA 4WIIA 2O3DA 4LIRA 2DGTA 1UW4A 2HGMA 2MJUA 2MQMA 3EX7B 1HD1A 1FO1A 1WF1A 4TLQA 1D8ZA 3VAGA 1VBZA 2MQLA 2DNNA 4PKDB 3MDFA 1K9MT 5HL7Q 1OIAA 2B0GA 2EK1A 2MY7A 3SDEB 1VC5A 4UY8T 2MYFA 2XNRA 2M8DB 3MOJB 1M5KC 2MQQA 1SJRA 5LJ3Y 2MZQA 2RVJA 2GO9A 1JMTA 3R1HA 2CQCA 2RS2A 2CQDA 2M0GB 3CC2S 3BO2A 1P1TA 2LYVA 3CCJS 4WFBQ 2E5GA 3CCVS 2CPHA 3CD6S 2DGUA 3TYTA 1SJ3P 1VQ5S 1VQ9S 3EGNA 5DM7Q 1WTBA 3MXHP 2DNRA 3NMRA 2MZTA 2KG0A 1U1LA 1N8RT 1HL6A 2DISA 2LCWA 1KQSR 3THPA 4PRFA 1X0FA 3MURP 2G0CA 4QQBA 1QM9A 1WI8A 1SJFA 4U67Q 2MQPA 3ULHA 1H2UX 2MZRA 5CA5A 3NNHA 1FHTA 1X4CA 3VAJA 4C7QA 5JVHQ 2PE8A 1KOOA 3HHNB 2MQOA 2A3JA 2J76E 4TU8A 3R27A 1IQTA
chains in the Genus database with same CATH superfamily
2X1GA 4RBVA 3EE3A 3S7RA 4CH1A 3EDRB 1FJCA 1C1BA 4ECYA 3F73A 2B3TB 4DUZJ 3IG1B 2OH2A 2MZ1A 2N3OA 2I1RA 1CLFA 4DBQA 2OPRB 5L38A 2D3OR 5HI7A 3SQOP 1Y5LB 4Y2IA 4OZJA 1VQNS 1MG7A 5BR8J 1WKLA 4DPOA 4C6AA 4USUA 1Q7LB 1C0UB 2IMWP 3KJNB 3T1HF 1HMVB 4XDCA 3UR3C 4V19X 1SPBP 4RJVA 3DLJA 1EQ0A 1HWJA 4WZMA 1KLMB 1FVSA 4Y28C 2HWIA 3FQKA 2I8EA 4OV1A 2JL9A 3FK4A 4DUYF 4I1TA 4ILMA 1V3ZA 2AYMA 3W2VA 1YLXA 3AH6A 4LFCF 3C6TB 1U1QA 4E8UA 4DV3F 3KJQB 2CNKB 4NLPA 4O3SA 4P7VA 1X7VA 2J9CA 2XG8A 1S1TB 1S6OA 2LQ8A 2LEBA 4DCPB 3OUYA 4ZIWA 1FNMA 2H51B 4IO9Q 1WTFA 2HBQB 4Y2CA 2ZHBA 3DGPB 4DLEA 5HLFA 1PSDA 4LT6A 1RHKB 4PR6A 4B3RF 4BBYA 4ZMMA 4QIFA 4TNOA 3ZZYA 3EXYA 3TANA 2BVZA 1MMNA 2MKHA 4USMA 3TZZA 4TY8A 5LXYA 4NXMJ 4F4ZA 1ZM9A 1S1VB 4ELUA 2LQBA 3TEHB 2R42A 4F8RA 3U1LA 5M2RA 3LP2B 1V6HA 4DJBA 2R7TA 3AOCA 4NLSA 3ZTOA 4ZPCA 1JJCB 2ZH2A 3S1TA 3G6ES 4NA2A 1HNIB 2GAHC 5C2GA 2DXEA 1KDNA 1BQNA 5FD1A 3OR2A 2W7PA 4JBCA 3O44A 5CCLA 1FJ7A 4ATNA 2E1PA 4UOGA 4HH0A 2OD6A 2GS8A 3QGIA 4OX9F 4B9VA 3Q2TC 2JEGA 2MJNA 4ZITA 1RWOB 2VFVA 1QAJA 1Q1KA 1K73T 4RKUC 1T05B 2KXNB 2D74B 2C2ZB 1WJ9A 4YEAA 3C19A 1WHWA 1LWEB 3RAQA 4P2FA 1VQ8S 4DF8A 3TJ9A 4DV4J 1UPPA 3N9UC 2OTLS 1Q8KA 2OJ3A 3G82B 5MAOA 3S01A 3HDSA 3B54A 2CPZA 3FVYA 1GMWD 2BUNA 4FF2A 2GW8A 1P9QC 1X4DA 1TUVA 2YKMB 2E9ZA 1DJ0A 3RRHA 2VPWB 2BKOA 4U6PA 4IRDA 2XC9A 2KT5A 2NYHA 4BWMA 2MLXA 3ZTPA 1S76D 3PACA 3QIPB 4A4JA 3LP0B 1H7XA 2HGLA 2AWZA 2YWFA 2BM1A 3W8GA 4L75A 1H74A 1VCTA 3N6MA 4BC7A 4OYIA 3IR5B 1XR5A 1RAHB 4DS5A 1ZS6A 2OKQA 4QIGA 4OYPA 2OFHX 2L9WA 1QUPA 2L9NA 1SQEA 2HGMA 1CJUB 3W5XA 3VAGA 2JFKA 1EETB 4DU8A 3GYNA 2V2VA 3KHHA 1OIAA 5KFUA 1D09B 1GTEA 2MZQA 1OY8A 3LGNA 2QA2A 2Z4PA 1RBOB 2YKNA 2ZOMA 3LW5C 2WOMB 2H65B 3JTOA 1X9MA 1R8AA 3Q8YA 4DV0J 1ZBTA 4CNYA 5KFYA 4K5SA 4PRFA 1PIEA 3MF5A 4Z7YA 4W4MA 2DR9A 2COLA 1X4CA 5GMDA 4DR3F 2XLKA 3PCOB 4Q5VA 1JWWA 3M2VB 2MKIA 4DL4A 1JLBB 3CDAA 1XMBA 2NXNA 3VV2B 2KHCA 1SC1B 1KEKA 3T5JA 2WSCC 2RD5C 5CYQB 2M9KA 3DRSB 5IZHA 1JJ2R 2YPYA 2PT0A 1MN7A 3M6UA 2DNQA 2LEAA 5KTQA 1S99A 2ZDPA 1B7FA 1SV5A 2DGWA 1T94A 3UVJA 4P74A 3BQ2A 2W25A 1G3OA 2I38A 1KQGB 2HRUA 2B9EA 5D6GA 2XM3A 3CC7S 4DR6F 1EP4B 1W25A 2XO7A 4J9RA 2AP6A 3W62A 1S1UA 2HNYA 3P5TL 1KRPA 2QYGA 4ETXA 4DV2F 5HMXA 5EUHA 2DNPA 3PVXA 3R9LA 3RB6A 3J7Z5 2QMWA 3LPEA 2IYIA 1YITS 1DURA 3JQJA 4DI6A 4M8LA 3EZ5A 3EYZA 3Q23A 1PYOB 2OI2A 3PO5A 3PFOA 1YBAA 4M5KA 2CJKA 1R43A 5ETSA 1UZDA 2V2ZA 5L1KA 4G65A 2CRLA 3I0RA 1Q0NA 1CSJA 4J37A 1Q95G 1RT1A 5KFVA 3H7HB 3KYLA 1R6VA 1ZM2A 2UXDF 3QWUA 1QSSA 3GFYA 4WU2A 4DSEA 2VUGA 4X65F 3VAIA 2YTCA 2AMCB 1OMSA 2YWKA 3JYTA 4Z7CA 3ICLA 1RBAA 3AJ2A 3G9CA 2DR5A 2DNHA 5CD4H 4W98A 2CPJA 3ZZTA 4B3SJ 3JB9k 1X9SA 4DUZF 1HHSA 5I3UB 1RT4A 1UWAA 3OTEA 2A2DA 2W9BA 3GONA 4ZOSA 9ATCB 4H4KC 3HZEA 4X4PA 1DY3A 4DL7A 2YKOA 5BR8F 2VZ9A 4J9UE 2XLIA 4NXNJ 1ZAVA 4CO5A 4HR2A 1Y7PA 1AW0A 5L1JA 4JOUA 3W9IA 1K47A 5KFSA 2DJWA 1J27A 2LA4A 1MLAA 1UETA 2J0QD 1M0SA 4JI6J 1CBKA 4RX6A 2IDLA 2IC3B 5LM7E 4F36A 1M5PC 3Q2SC 1P27B 2RS8A 1VQOS 3MAHA 2B4PA 2B7BB 1X9WA 2CWKA 1ZYQA 4LF5J 2HK3A 4IG0A 2B5JB 1TUWA 1WEXA 4OHYA 2A10A 1SC6A 4TYBA 5E3PA 2DO0A 3GV8B 5KFIA 1C1CB 4L73A 2E1MC 4IRCA 4XIUA 1DAXA 3S6EA 5KOXA 3HCXA 1RCXB 5CZXA 3MD3A 1J5EJ 4HVZA 2HGNA 3F41A 4L74A 2OPSA 4PPDA 2AYGA 2DH7A 4ZVGA 3CE8A 1REGX 3KMQA 1S1XA 3NL0A 4JYAF 1FRHA 2B7CB 2XMAA 4PG8A 4JI8J 3PRVA 3AY0A 4NXMF 1OYEA 3E01B 5THWA 2NUUG 4LSLA 2QA1A 1XNQF 3MM8A 4DX6A 3TAQA 4QYZK 2JEIA 4ZVOB 1K0VA 3H5XA 3KLGB 1HNXF 3BGLA 1IBMJ 3GIKA 5D4NA 2XSFA 3DOMA 3GJRB 5KT3A 1M5VC 4DMZA 3KLEA 1U47A 3GFZA 2VG7A 3V6DA 2JLFA 3GSDA 1HFEL 1VBZA 2DNNA 1S9EA 3MM7B 3ENWA 3IRXB 2B0GA 2KJWA 4G1QB 3PYFA 4ELVA 2C3PA 4KQZA 4KE5A 4FPRA 3DOKB 1TFYA 2PD1A 3M6WA 4DL3A 3DLKB 3CJKA 2R7SA 3ILIA 3MHYA 1RT2B 3UQSA 2GGPA 1IR0A 1HL6A 1H2UX 2BYCA 5K8MA 4HI1A 2AJQA 4FVMA 2HURA 3DI6A 2R7RA 2AGPA 5ETMA 1S9GB 4ZA1A 1IBKJ 2MQOA 1K8AT 4DV4F 4WU3A 2CQ3A 2IRYA 2IA0A 4HDHA 2BBEA 1XWLA 1NLKL 2E1CA 3NGDA 5B0AA 3DXSX 4OHWA 2B4VA 2FTRA 2HW3A 4D3HA 3FSXA 2PC6A 2LXUA 2ZH7A 5L1LA 4G1IA 2VPYB 4TU7A 1AFIA 3MM9A 4M5IA 5E3AA 1PBUA 1W7WA 2HAFA 4J9KA 1NXIA 3DCAA 1SL0A 3NGTA 1VJWA 1XC9A 3FFIB 4ILLA 4J9MA 5IS2A 1TAUA 3R3TA 2ASDA 3HPOA 4JB8B 2CJYB 2GVZB 2DHXA 2ZFHA 3WDOA 3DLEB 4N5SA 1F0XA 1HYSB 4HACB 4OI1A 2LU2A 2YNFA 1S49A 1Y9OA 2CG8A 3QGHA 3Q8UA 2E5LJ 3IP0A 3FZ2A 1U09A 3MFIA 1G4CA 1ZTTA 3RAMA 1H6KX 5F8IA 2DH9A 4JI1J 1PJ5A 3PW5A 1YDLA 2FJAB 1RAGB 3NY0A 4NYZA 3NG8A 2NPFA 2O1PA 1WHVA 2XI3A 4C11A 1VHIA 3TP2A 3OVBA 3CIMA 4O23A 1CJVB 3HHLB 1TAQA 2L3MA 4UQGA 3TNVA 8AT1B 1TK0A 4DV0F 2V4QA 5HO4A 3DDIA 3R7NB 1DTTA 1EX8A 2QEXS 2KI2A 3O6QA 4N77A 3QPIA 3AD7C 4QWAA 1CULB 1MU2A 2ZVIA 1JXLA 4DL2A 1GX6A 5AXMA 4O3OA 4HLBA 3ZNUA 3ITHA 2HLUA 2LXIA 1JXEA 1UEKA 2V94A 2DNOA 4CNZA 4WE1A 3CCQS 2RDJA 1U02A 4FXWA 2HK2A 2YQ1A 4P10A 3BGRB 3T5LA 1V5VA 1RI7A 2V8VA 4MTPA 2FJDB 5HK4A 3QSIA 3IBCB 1R27B 1RUSA 3ZTSA 3HSDA 1GNKA 3CO9A 3VF0B 4K4SA 3M8YA 2NSBA 3VTIA 5CYJA 4JI2J 3AD8C 3CCUS 2XB2D 1WEZA 5KT6A 2NXUA 4A8WA 1NHKL 3QQCD 1KFSA 3IR7B 4LSZB 5HMZA 2UUAJ 3CXCR 1FXLA 3A4TA 2DHAA 1ELOA 2HKEA 5AXLA 2IVFB 4RUAA 4M5DB 5DLGA 2WCXA 3J7YU 2RAQA 1HD0A 2CG4A 5F8JA 3GIIA 1S0NA 2BKNA 2KYXA 4IR9A 4KH1B 1ZETA 5A2QU 4NLVA 4ZP8A 4JI4J 3CULA 4NMLA 4ER8A 3AQPA 2FGOA 3OR1B 3BGFA 2XQCA 3OTCA 4NRUA 3NCPA 2V4JB 3M9OB 3MZIA 2NUHA 3H5UA 3OTDA 3D28A 3W64A 1RKJA 1QAIA 3M2UB 1HKAA 3GE9A 4I56A 4HYKA 2JEJA 2XZTB 3UD5A 3EJMA 4LF1A 4YR3A 1D9DA 5LXRA 3DU5A 5GADU 3UE2A 4LF7J 1TKXA 5IC6B 4NASA 4G1PA 2C3UA 2FHJA 2KT2A 3QO9B 4P7TA 2ZWOA 4Y2KA 4YY3J 1S48A 4C4WA 2PA8D 5EWEA 2X7IA 3M30B 4B3SF 4AD6A 1VFJA 5C5JA 2R7UA 5ETQA 3TAPA 3RBDA 3SCKE 2P5VA 4NLRA 4DZDA 2HYIB 4NXNF 1OSDA 5LSRA 2H48B 4IH5A 5KG5A 2ZM6J 2VBZA 2DGTA 5K14A 4P52A 1FO1A 4DG1B 3EMTA 3UN2A 4DFJA 2HHPA 4JI6F 1M5KC 5A8WB 1VIOA 5KFCA 1Y3JA 3IN5A 2QC3A 4P75A 3HMJG 1DTQA 2B6AA 4KTQA 5DG8A 1VQ5S 1RT7B 1BQMB 7AT1B 3CJ8A 4CT8A 1B0VA 4LF5F 2MLZA 3IA0A 1HQUB 2LP4A 3NLCA 3BDPA 4I4BA 4I2PB 3FSYA 1KONA 5HSPA 1KOOA 3CJ4A 4JUZA 4CT9A 3AB2B 1HBUB 4LF9J 3BGOP 4O4GB 1YZ7A 1VRTA 4A8MP 5HMYA 1HLWA 3WQPA 3V4IB 2GO8A 2CPYA 3OXLA 4DXLA 3ENVA 5CYMB 4ES3A 1J5EF 3CD0A 1ZM3A 1IQZA 2AZ1A 2ATCB 2OMOA 2BJ3A 2V8PA 2H5EA 3CVKA 1FE0A 2BW7A 5DG9A 2QL5B 3TRGA 3MEDB 4YB1P 3JSYA 1NJZA 2JSXA 3H5YA 2W24A 5A8RB 3OSPA 3J81Y 2KFNA 2Z56B 4O44A 4M5GA 4JI8F 3QZ8A 5ETKA 3M9MB 4QIWD 2F4VF 3M8QA 1HQEB 1RADB 3PG9A 3O1LA 1P6TA 3AHPA 4WP9A 2D3O1 2UZAA 3GWCA 3T9NA 3C6TA 3UDLA 2RILA 2FVQA 1PO6A 3FBEA 1IBMF 3G8SA 4QWEA 3U1NA 2VIHA 3BN4A 2YKAA 1VR6A 2NCKL 1WDTA 2C2NA 2I9SA 2RNEA 4A8OA 4RBTA 4I2QB 4B9LA 4KR0B 5IQQA 4DV7J 3VAHA 1WEYA 3PW4A 3OT9A 2CQ0A 2DO4A 4NYOA 1X4EA 3GCWP 2ZOFA 4PG5A 3VGUA 1KN6A 2FY8A 3HKZD 2PEBA 3CJ3A 1UMJA 3G2XA 1WI6A 2BANA 1YRUA 2MZSA 5J2NB 4EMDA 3EPIA 1SC4B 1O6XA 1NH7A 3PTWA 1RWWB 2GMHA 5G0RA 3TUPA 5E7OB 2BR0A 3NGKA 1O0PA 2ZDOA 4L3NA 4K4ZA 4KGXB 2YXLA 3CF5Q 2WVFA 3UDCA 3A8EA 2IPOB 4K4TA 4XK8C 1O8BA 4B9NA 1ULRA 1V5IB 2QSFA 3T3FA 4PWDA 1KQFB 3MAAB 2AEMA 2V8DA 4I6AA 3PJWA 1FRMA 3FRYA 1FRJA 2F9JA 1QD1A 4F3OA 1BQXA 4K8RA 1CQMA 3Q8QB 4NZ6A 3DLHA 3D1OA 4NLGA 1Q81T 2N7YA 4K2JA 2WVCA 4WKYA 1XQIA 3G82A 2QFJA 4R0EA 2WW4A 1YTYA 1U1RA 2XSJA 4JI1F 2LDYA 2E44A 3PZPA 2ZE2B 1C0TB 2YKMA 1FT8A 3BO4A 5CZVA 4L72B 2WB1D 2F63A 1FERA 4MKVA 4M5JA 2LA6A 2KFYA 1BE4A 1XMOJ 2EFGA 2JJ4D 2R7WA 3TVZA 2VL1A 4GMKA 1VLOA 2ZH9A 1W26A 4Q45A 3N28A 4YHHJ 4B9TA 3DNCA 2XS7A 3QT5A 2VC0A 1U48A 2A2CA 5JUMA 3HHLC 2AV5A 2M2BA 1WHYA 1OO0B 3G87A 1KD1T 2Y8WA 1FFWB 1RTIB 2DNKA 3IMQJ 1YX2A 3D1HA 1QDUB 1VDHA 5DQGA 2YH1A 2CZ9A 2YVSA 3CCLS 4NLWA 3C15B 2ZC3A 4DR1J 5KFZA 5F0UA 4KKOB 1CJUA 1APSA 3AA9A 2F9DA 2SXLA 3FCWA 2WZ1A 1TQLA 2OSQA 3H40A 3HHLD 1EZZB 3ISNC 3TARA 3NXZA 3HO1A 4CO4A 4IO1A 2QLFB 3PEJA 4CO1A 4WXOA 4EFAC 3DXBA 4JI2F 1UEUA 5D0RA 3M6XA 1UW4A 3M7VA 2UUAF 4MMOA 5E3CA 3OL8A 1VC5A 5C25B 2UVUA 3MOJB 1N34J 4GVBB 4YMEA 4WTYA 5T41A 2CQCA 2CQDA 3TAMB 4B3MJ 3SV3A 3M2VA 3ZZOA 4AUKA 3OTBA 1U45A 4I6WA 2AZ3A 3TJAA 1OY6A 3JSMA 1QSYA 4FF3A 3KK3A 5SZTA 4NMXA 3TYTA 3D6HB 2DNRA 1JLEB 3MFHA 5CYQA 3SSQA 2YNGB 3ULHA 2FHJD 1KHVA 5CA5A 3N5FA 3VAJA 4RLEA 1JLGB 4TU8A 1IQTA 2C1EB 3F44A 5M2PA 1MN9A 1DFDA 2W9AA 1NK5A 2DGSA 1NK4A 2CQ2A 4R8UB 1ZA1B 2HQ3A 4OIXA 3HP6A 2RMLA 2O67A 2IM2A 1B3TA 3IWLA 2XHCA 1TL3B 4LF7F 4FYVB 3QATA 4KB7A 5HATA 4YN3B 4USVA 1N0VC 3BEGB 5J2MB 2IBKA 1Y5IB 4YY3F 3WHIA 4OI3A 2Z30B 2AEJA 2AJ4A 5L8RC 3V81A 4NZ0A 4WPAA 3ADAC 1T9XA 4FPIA 2VQFF 1IKVA 1JLAB 1HNVB 4B02A 2JLGA 5IM0B 1EHWA 1RHUB 3KLFB 4LF4F 1UJ5A 5ITHA 3NKYA 4YDXA 1H73A 3NEKA 2M8HA 3CC4S 1V3SA 4KPYA 1U26A 2YBVA 2DIVA 5I3PA 4IUFA 5B7WA 4O3PA 2Z2MA 3MMAA 5KFXA 5F3TA 4MAKA 2E5IA 4XO0A 4K7QA 4C3LA 4TN2A 3G96A 2GZOA 4USIA 4UW2A 2R8IA 3CCRS 2POKA 2D9OA 3CD7A 2W9CA 1R0AA 3P8BB 4WYWA 4DWIA 1RWVB 2MDAA 3L7OA 3BH7B 4LF9F 2CQHA 2F8MA 3MEKA 4NLXA 2I2YA 2DHGA 4RWXA 4QZVB 3RAXA 1S59A 4ZPBA 2W8KA 4EYHB 1T3OA 1UZHA 3CCMS 2V0NA 3CJ5A 3T6BA 3L95X 2QRRA 1VMBA 3AJ1A 3HVAA 2E5HA 4EUVA 2IC3A 4PZVA 4EI2A 4ZJOA 4XTTA 2KN4A 5AJ3J 4V19J 4YR0A 3MPYA 5DZ7A 2XWYA 1JLQB 1WELA 5KG2A 2B5JA 5KFQA 4J5OA 4I64A 3BQ0A 1SCJB 1AZSA 1C1CA 4MIBA 4UQTA 2IHR1 1M5SA 3CPWR 1NK8A 3RR8A 1IBLF 5IXUA 2HBZB 1RWKB 1LFWA 1OSCA 3MUTP 2BOAA 1FKPB 2ZZMA 2VB6A 2J0WA 4X4NA 2RRNA 1IJEB 1D9AA 1N54B 3ONQA 2M70A 3M8WA 3C46A 4F0MA 3D68A 3RGIA 1XMQJ 1UTAA 1IR2A 3D54A 2CKWA 3HT0A 2R2UA 4M5NA 2FZCB 3MMCA 5D3GA 2DHHA 4YDDB 3QAEA 4WBFA 1QVGR 4IR1A 4ZVQB 3CCSS 3NRBA 4QU7A 1JJHA 4OYAA 1RTHB 2R2TA 4ZK7M 3KLGA 1AUSL 1PKUA 3ENQA 3I0SB 3IBFB 1M5OC 3L7UA 3MMBB 2EK6A 5HQLA 5AE2A 2IDEA 4YP3A 3NNCA 5D0EA 2L48A 1PYSB 2HWHA 2W01A 2BE2B 1BD6A 3QZ7A 1X5SA 4ZCMA 3CGIA 2ZH6A 2RHSB 1NKEA 3UNYA 3J7A1 4FBUA 2K3KA 4P2SA 3NOGA 2VG5A 2XNQA 4PWUA 3GQCA 1X4FA 2UUTA 3SMZA 3PHEA 5I42B 3DLKA 1IJFB 1RT2A 4YB6A 1XBWA 4I68A 4MKAA 1HD1A 1PJ7A 1E6VB 4ANCA 3CJ0A 4LR9A 5L39A 2MYFA 4GC7A 1RYRA 4ZVUB 4DFPA 4ZPTR 1RA7A 2VQEJ 3OXFA 1VHFA 1WOSA 3HSJA 3PV8A 1S9GA 3I4PA 3H98A 4JP8A 5D4LA 2IMOA 4WFBQ 1HNZJ 1RTJB 4EYIB 3MM6A 3QGGA 5L9XA 4K0KJ 3EGNA 2HFSA 1C4CA 3QMQA 1M5HA 2KG0A 1IBCB 1N8RT 5KT5A 4DX5A 4DPYA 1SJFA 3I32A 2ZITA 1SUQB 2ZH5A 2C2EA 1URRA 1Q5VA 2HZVA 4ZVPB 2W7AA 1K1QA 1XMOF 3HT3A 2MKYA 4TQSA 2VKZG 3FFIA 4PG4A 4IG3B 1VRQC 3GG1A 1QUVA 1LV5A 2LXFA 2C28A 3GSIA 3MPUB 3I82A 3KG4A 1R8PA 5GMKa 4YHHF 5AT1B 3SCJE 1VIXA 4KV8B 4WP8A 5KG6A 3G86A 1HYSA 4HACA 3CB4A 1F2HA 3AD9C 2RU9A 3THVA 3QRPA 1S10A 1NK6A 2B8QA 3RZAA 2CPIA 1VJQA 1JLCA 3MR3A 4H4OA 3K57A 4HHUA 1K0TA 2ZZNA 3PIOQ 1J5OA 1VQMS 4IFVB 1S72S 4WIQA 4K50A 4DR1F 2VBYA 1Q5YA 4F02A 4YFUA 3BBCA 3DOLB 4PQUA 4L6V3 3EGZA 1NZ8A 3D0GE 3A8JA 4TU9A 1J2VA 4FS1A 2WRMA 3I6PA 3W63A 5F8MA 5E3QA 5EX0A 3BSNA 3ENAA 3MECB 3KHGA 3H5SA 5ADZA 1UP1A 3P45B 4YUDA 4C2MA 4NEZA 2UXBF 1CULA 3KK1B 1WG4A 8ATCB 2KG1A 1N34F 3TUZC 3IAM9 2LQ9A 4QOTA 2Y8YA 2XLJA 4B3MF 3G6XA 4F0KA 2G2YA 1D0EA 3EZOA 5KT4A 4QR1A 3G8TA 1N5YB 5RUBA 2MHNA 1TV6B 3NAHA 2VF3A 4PPZA 4KO0A 2CJBA 5JJBA 2FLPA 4LBHA 2BJ1A 1PAUB 3ZZRA 5J2QA 4MYUA 2MGZA 3GTYX 2YNHA 2EFPA 2OEKA 1NMEB 3C14B 3N0VA 3EGWB 1F9FA 3KNAA 5JVGQ 5CABA 2RKIA 2CQ4A 4F4AA 4DSLA 1A6LA 1YRXA 2W2MP 2ZJQQ 1IKXA 5KFRA 3RBZA 2YX1A 1I1GA 2HFUA 3R1LA 4UF4A 2MMYA 1TU0B 1T9WA 3GR0A 1BGXT 4C0BA 3E8OA 2PFDA 2CQBA 1WC0A 2GMLA 2VFRA 5H1SV 4F2RA 4LRFA 4C48A 3CMAS 3WZ0A 1U0HB 4ERDA 1XK8A 4CLPA 2D7SA 1FD2A 4C9DA 3SV4A 3D4JA 2D3UA 4ES2A 1UWBA 1I5OB 3QT7A 2Q79A 3VALA 1FXRA 2G0JA 1T11A 3A8KA 1EKSA 3D2WA 2IVYA 4KSEB 2AGQA 2DK2A 2A0FB 2H9ZA 4P6QA 2AX0A 3R5DA 1QAXA 1S97A 3DRYA 1YRTA 3GJQB 2Y1JA 4R5PB 2B8PA 5H9EJ 4LUBA 4LF8J 3ET6B 2K1RB 3QO9A 2AD9A 1Q82T 3AJDA 1FDBA 2KO1A 2Z0GA 4NI2A 3KNGA 5A8KB 2J7KA 1N32J 2DY9A 4LBPA 2CJQA 1CVJA 4FBTA 3LUYA 1U6ZA 3SBMA 1RCOB 2O01C 4KRWA 5LMNJ 2HVZA 3FJ2A 1S6PB 2YWHA 1FDAA 1MNEA 4EZ9A 1JJ4A 4ED1A 2DRAA 5AXKA 1S0OA 1B64A 1R3NA 4PG6A 4K4UA 4H54A 4DG1A 1TKZB 4IOCQ 2HSEB 4AQYJ 4DV5J 1JKHA 4OZ1A 3M2RA 3C3LA 4EEYA 2JHEA 1PGZA 5AJ3F 4DFMA 1RT7A 3QFWA 1BQMA 5IV3A 2CIMA 1HQUA 3IBWA 4MK8A 4NX9A 3N4WA 1KS2A 3LP1B 1F6TA 3TUIC 2RHQB 1VI7A 3CCJS 5HROB 4O4GA 1S7IA 2H54B 3V4IA 3TWZA 4URQU 2OELA 1T03B 3KG1A 5CYMA 3T9ZA 1X0FA 2MQPA 3M4XA 3HJFA 1REVB 3BV8A 3R6LB 5JXSA 1Y0HA 3MEDA 5H9FJ 2PE8A 1HBNB 2CQGA 3MTKA 2WONA 3IWNC 3G4SS 5DO2A 2AIRB 3Q8PB 3CD5A 3LWLA 3VAMA 1XMQF 3HI9A 2PFFB 4NCGB 2CQIA 4X4TA 5IOLA 2QA4G 1QAYA 1HQEA 1UFLA 4DR7J 4PEOA 3OVSA 5KFLA 2K2PA 7FD1A 2W8LA 1PCAA 1MROA 5BJRA 3ZZZA 3NGSA 2MZJA 3ZTRA 3NNAA 3MUVP 1F1BB 1SKWA 3G8QA 1NKBA 5CQGA 1PG5B 3L4BC 1LW0B 2E5JA 1LFPA 1RU2A 1YJWS 2OTJS 1KWMA 3UI3A 2Q1LA 2BRKA 2C42A 3U27A 2DGQA 1NPKA 1S12A 1N88A 1R89A 2QYCA 4GO5X 2HNDB 1CPZA 1RKIA 2RUGA 3UNGC 3IS9A 4LIWA 5B0FA 5EHHA 4OZ5A 2Y1RI 5J1PA 4N7TA 2IM1A 1UJ4A 4ELTA 2FGCA 1VK3A 4RW6A 4ED6A 1WWHA 4CLSA 3BDEA 3D9BA 4ZHRB 3HHDA 2VQEF 2ILZA 2H1YA 2HS4A 5LL6d 2OO4A 1W2BR 3GYXB 1PJ6A 1HNZF 1EJ7L 4WK3A 4K0KF 1RBLA 3RG6A 3H42A 3NOCA 1NB7A 3HVTB 2KB2A 2GIRA 2QV6A 2XGPA 4CTAA 1KFDA 3L09A 1RLCL 4JV0A 1ZZFA 1IVZA 3WC2A 1TKTA 3T1YF 1SKUB 1FX2A 4LR8A 3MCMA 4IKAA 3SFGA 4F50A 4MIWA 2CVIA 4QU6A 3JAMU 2W2OP 5J2PA 3FCHA 5DDRC 4J7CA 3FMBA 2PMHA 2QTWA 3BKTA 2J6SA 2UP1A 3L3CA 2GQ2A 1YJNS 2YX4A 1FRKA 2HRTA 1FK9A 1RWXB 2VV5A 3S8SA 3UPFA 2HLTA 1WOPA 1XERA 3HJVA 3PEHA 2E7VA 4WCEQ 1N52B 4WWSA 4RUHA 3KLHA 2R3VA 4E0DA 3CJTA 1FE4A 2CPEA 2XYPB 2BDPA 1R8HA 1C0TA 4QYRA 3QRRA 5DLFA 1S77D 2EBGA 2BV3A 2BQ3A 2JWNA 2NXCA 3P96A 3POTA 4K4VA 2QMUB 1YI2S 2R8GA 2DRBA 1U0SA 1N5QA 3GLJA 7FDRA 4X66J 2M5YA 2L41A 3FC9A 3TA0A 5DM6Q 3M32B 3W2VB 1RHRB 4QWDA 2CZVC 2VC1A 2K3IA 4LSNA 1IM6A 4LBIA 1AT1B 1RTIA 2VOOA 3OUYB 2HPUA 2E7XA 3PKMA 1NJYA 4DR4J 2GHVC 2BJ8A 5FDLB 4OZ0A 1M1KT 4KKOA 4ZVRB 2DB1A 2X51A 1RTZA 3VGVA 3SXLA 3FBBA 4DV6J 1UJ6A 3GIMA 4ZPDA 4CO0A 1TP7A 1FCAA 2XMMA 1QE1B 2GVDA 2XYHB 3TEGA 3ZZUA 1H3DA 4F3MA 4A8FA 4M1KA 4OI0A 2CVEA 4MIAA 4DX7A 2ZBRA 1TK8A 2J5AA 2FHMA 3UDVA 3R5GA 5KG4A 2ZH8A 1FXDA 3EDQB 2EPIA 4AT1B 4LRBA 1Q78A 2HQDA 3OLAA 3QLHA 5LT5A 1BQNB 4MFBA 4TLQA 5HAOA 1H98A 1MWZA 1GFWB 4PKDB 2PIIA 3M8RA 3BREA 2DVIA 2XNRA 1RT5A 1NPRA 2DEJA 2AX1A 3DFEA 4N47A 2D41A 5GAHI 3QAUA 1OY9A 3GFHA 2IJNA 1CG2A 4KHMA 1WOOA 4PCQA 1PC4A 3T6JA 4MK7A 5KOWA 3W2WB 1LWCA 2G2OA 3FNNA 4ZIVA 1QM9A 4ANEA 4YB7A 5KFPA 2XO6A 5JVHQ 1DARA 3R27A 2YWEA 2DGVA 1TL3A 3N5BA 1X5TA 2OFGX 1WSVA 2GA7A 2F40A 4DDFA 3K8VA 1S7HA 3HF5A 2NR0A 3ZO7A 3KLIA 1G1XA 4C8YA 2FQQB 2MTLA 1N32F 1TVRA 3I9V9 1SQFA 4ZVHA 2NSCA 2EG2A 2WTFA 5A2QY 5FLXU 4LFAJ 3I56S 3JTPA 2MEWA 2Q6BA 4A8KA 4P2MA 4Y2MA 5LMNF 3QJPA 3B78A 4OLPA 3BO3A 2RF2A 2XMVA 2GNKA 2W2PP 1LXNA 2RQKA 2VG6A 5GAGI 3WX8A 4NOHA 4OHZA 3PM9A 2R8JA 4AQYF 2XEXA 4DV5F 2Z2LA 2J9EA 1FEEA 4USWA 1VQ6S 4OX6A 3VVTA 5KFHA 3H0PA 4Q0BA 4EU0A 1ZAXA 4WF9Q 1GAOA 2BJDA 2YKPA 3R5CA 2A6OA 1Q8LA 3OBIA 4P9SA 5LOQA 2KU7A 2YKNB 3MEGB 4WFYA 4OMFG 2QX0A 2RRAA 2R7VA 2DYAA 4JV5J 5SUHA 2RB7A 1EB0A 1FRXA 2QL7B 3DRRA 4KY3A 3VQTA 4A8XA 2OPQA 3KHRA 2NQPA 3N79A 1WNEA 4DR7F 3Q83A 1YJUA 2XS5A 4X4OA 3CJSA 2LECA 3D6MB 1NDPA 5D8HB 5D77A 2XTJP 3B4MA 4ZPVR 4DSFA 3RRGA 1AUDA 3TX0A 3DYAA 4TXSA 4M5LA 3I4HX 4O3RA 1FRIA 3CMES 2FJWA 1MWQA 3DMJA 1KC8T 2MQNA 2P9EA 4Y65A 4ED0A 3MI7X 1FKOB 3CCES 2V68A 1L3TA 3RTVA 4DV1J 3UVJB 5T14A 1NU4A 4FXVA 3AXKA 3EXCX 1FKPA 3DC2A 3GG0A 2CNNB 2J9DA 2UUCJ 5MLCV 4K4YA 1S1UB 2HNYB 2V4RA 4JI7J 4FYXB 1NAQA 1RAFB 4IDKA 3BPSP 2FD2A 3VQSA 4NLDA 1JB0C 3BF4A 2VICA 2VFUA 3ZXWA 1YQHA 1IN0A 2QO3A 2R7XA 4CDIA 4ITSA 4IFYB 5D4PA 4CRJA 1L3VA 1HNWJ 2JVOA 1BY9A 5C24A 2FJEB 2EG1A 1LK5A 2RRBA 2V63A 3T5HA 5K8NA 4N76A 5KG0A 1C4AA 2OLWA 3I0RB 4DEZA 1ZPWX 2JNJA 2B9WA 2CAJA 3Q8SB 3MPWA 2DNGA 2XWXA 1RT1B 1VISA 3FCVA 4K4WA 5EWFA 2F5GA 2UV8A 4OI6A 5K20B 5F8HA 1JK9B 5U47A 3W65A 4QR0A 5D4OA 3OSNA 1FF2A 2HS0A 1T9VA 3HFVA 1RT3A 5I42A 4J9QA 1NB2A 2R7OA 1TMJA 4USHA 4LR7A 4ID5A 5B0BA 2RT3A 3HFZB 3K89A 1VLYA 2IVMA 1RT4B 2W9BB 4J9NA 2K7KA 5AXNA 3IM9A 1ZPVA 3QT6A 3OJSA 2EFQA 2CWXA 2F8EX 2MJUA 3DU6A 4KFBA 3RB3A 3K58A 3EPGA 4UY8T 4LF2A 4CLUA 2W2NP 2P9CA 1N48A 4RUCA 1I6JA 1JMTA 4JV2A 1XR6A 2LYVA 4RNNA 4M5MA 1FRLA 4FYYB 5DM7Q 3C66A 4UTGA 1KQSR 4IOBA 3MURP 2G0CA 1WACA 4X66F 4H4MA 2C2KB 1LXJA 3SQGA 5DGBA 5AE3A 1E6YA 3I5CA 3TJ8A 2ZEJA 2P8IA 5HJXA 3MUMP 1VRUA 2ACMA 3SI8A 2EVZA 4QR2A 2DPJA 2Z57B 1JNZB 3RW6A 4DR4F 1TL7A 5KFMA 1EARA 2HNZA 4ZLPA 4I69A 4QIEA 1ICEB 3TO8A 5DZ6A 3P5BP 4ZPAA 2FIUA 4BCAA 4DPTA 2OPPA 3OJUA 4DV6F 2OPSB 2RQ4A 1WC5A 3N6NA 3NBPA 4YB5A 1CS4A 1EKRA 1JLFA 1S1XB 4L3KA 4IOAQ 2Y3YA 4ZJQA 1IKWB 3ISZA 2MKCA 3MECA 3UN3A 2XMUA 1FJEB 1RAJA 3FSIA 4DUYJ 4LSLB 2PA3A 3M05A 3MM8B 3LALA 2AF6A 2EI5A 2ZH4A 1UW9A 3UCGA 4ANDA 3LWMA 1DZ5A 3PRDA 4DV3J 1T95A 1OWXA 4OX7A 2D3ZA 2KH9A 3PNIA 1FTCA 1BHNA 1RZMA 3OL9A 1NBEB 4ZCIA 1WC6A 3DOMB 4WK1A 3KLEB 2VG7B 2DCLA 1H7WA 3FGVA 3V6DB 4B3OA 4QWBA 3WC0A 2DRDA 3J81j 3SSRA 3IR6B 4ZN3A 4DPWA 2CDRB 3VVUA 3C14A 1K1SA 2FC9A 2B51A 3L9ZA 4ICLA 1H38A 1IKYA 5DS7A 2VA3A 2OSRA 3NS5A 1SH3A 2JDJA 2V6AA 3Q86A 3CJKB 3PW7A 5J1EB 2GGPB 4CIOA 3MTJA 2W2QP 2LKZA 2U2FA 3P6YC 1FFSB 3SEOA 1TZ0A 3DI6B 3W9HA 2HQFA 4O0IA 3A3PB 1R0BG 1UVJA 2V2QA 4NLYA 4DQRA 5GAHU 4LFAF 4BDPA 2ZBPA 2HAIA 3MM9B 4ED4A 3CMQA 4DLGA 2F65A 2WBRA 2BJEA 1RHJB 1WG5A 3U7JA 4M94A 5E5NA 3K2YA 3R5BA 5K8PA 3C2PA 2CZ4A 4ID8A 4JI0J 1SI9A 5D15A 4AFFA 1OQ6A 4ZVEA 1SJQA 2B9YA 3X3UA 4ECRA 1VC6A 2YNFB 1U25A 2ABYA 4DL6A 1FJGJ 4Y2AA 5J1NA 1WKJA 2V8HA 4RO0A 2MHEA 2KHDA 2NPIA 2WVDA 1ZTWA 2WVEA 5T7LA 3I55S 1RA6A 4FNIA 3DDKA 4ECVA 1VQLS 1F9EB 1GMUA 1T8EA 4C11B 1OPIA 4S0MA 4ALZA 3LGHA 1HWUA 4Q8FA 1IR1A 1GEHA 3TX8A 1ZZNA 2XZWA 4JV5F 4X2BA 1TKZA 1DTTB 5DDQC 1WD6A 2DITA 2NZ4A 5DG7A 3EVWA 5IC4B 3M1VA 4O4RA 1F5AA 3WIUA 4PABA 3IFEA 5F9LA 2F3JA 1GMWA 5GVQA 1VQYA 3PRBA 2R4FA 1JIHA 1LK7A 5B0CA 3WIVA 1X5OA 1HI1A 1KQKA 1WC4A 2BX6A 3RUBL 4EO6A 2GJFA 3MD1A 3AOBA 3NS6A 2CXEA 4Y0FA 4CH0S 2EC2A 2HS3A 4F2SA 2N4DA 5HROA 3PXGa 4Q43A 2Z2YB 2UUWA 2ZD1B 5IQ6A 3FMWA 3HZGA 3HSZA 2QL9B 4OI2A 1I51B 1HPZB 2MQQA 1GXUA 3QT8A 4CLTA 2ZZTA 2FHKA 4JI7F 2H5JB 4LQ9A 3EUNA 4CZCA 1M1GA 1HBNA 3PJXA 3T19A 3CD6S 1SJ3P 2CDQA 2ROGA 1U1LA 5HP1A 3FZBA 5F9NA 3KJVB 4Q7AA 2MZRA 3EICA 5L9NA 1RQ0A 4C7QA 2J76E 1HNWF 3UD3P 2BEFA 2F4FA 2NS1B 3SFUA 4R0JA 1WF0A 2VPZB 1OS5A 1WF2A 1HW8A 2C3OA 1FNOA 2Y0BB 2CADA 4G6VB 4F25A 2KM8B 1Q53A 3VGTA 1SIZA 4CI0B 1YBTA 5F41A 4PQAA 4FDFA 1S1WB 1RP5A 2AYEA 3DLGA 1B4SA 3H4DA 3F56A 3M8PA 2HNDA 5JMNA 4DV2J 3I5AA 3TZYA 2R8KA 1KTQA 1TKXB 3OL6A 2LMIA 5C2CA 4RW8B 2QLBB 2LU1A 1WUUA 3UN5A 2KVQE 2XI2A 1RT6A 3R5AA 1FESA 2W4CA 4UZCA 2VODA 2HQIA 2L9DA 1VBYA 4ZHRA 1HW9A 2RUSA 4URGA 1V3RA 2ZHAA 3C16A 4NLUA 3V4MA 1FVQA 2HBYB 2HFZA 2FHOB 3HVTA 4KGMA 2IBOA 2VDIA 4DF4A 3MWBA 5HVFA 2PN6A 2VJVA 5CHCB 5K14B 2UXDJ 3QJJA 4IQXA 3NP5A 4NCAA 2V8GA 4Q8EA 2X1AA 5LSLA 1FA0A 4ZPWR 3KK2A 2DGXA 4GVLA 2YNIA 2MPUA 1DTQB 3BSCA 2B6AB 4FF4A 3LGMA 3UCUP 2MSSA 3GU0A 3R2CJ 3A8IA 1DQ8A 4CLLA 5DDOC 2VH7A 4DSJA 2J6UA 2V9WA 4RW9A 2AQ4A 3MPDA 4A8QA 3BJYA 4U96A 2JC1A 1GT8A 5A6PA 2EEYA 4RW4A 4HT7A 1VRTB 1N5SA 1HBMA 1GMVA 3KKFA 3R8YA 4N56A 1LKZA 3QWPA 3DRPB 2VONA 1N6QA 5HQMA 3RJMB 4UZBA 1HWLA 2YH0A 2HRYA 3ZNJ1 2ROEA 1U6FA 2XGQA 3K17A 1TL4A 4F67A 4O44B 3HX9A 1DHMA 2N4CA 4PWWA 1HARA 3C6UA 3M8QB 4A8YA 2E1RA 3M32A 5ETVA 1MWYA 2RQCA 1NHVA 4TLRA 3AA8A 3CIZA 3KOAA 1U49A 1O5JA 1F9HA 3BM7A 3GV7B 1QVFR 2NLWA 5I4MA 2PI4A 4DN0A 4N41A 1YWXA 1AFJA 4GRSA 1PAEX 4V1Ak 2MB0B 1XN9A 3MEEB 5FDLA 3UDEA 1S79A 4H4KA 2MY8A 2ZWPA 4LQ3A 1CEZA 4WJBA 2ZKUA 3CJQA 1S5ZA 4EGLA 1DQAA 2PMWA 3IG1A 1RXOB 5IT0A 1IXKA 2OIHA 2GIFA 1X4GA 4YS2A 2BXJA 4LRDA 4LF6J 1N5VA 2HIYA 4NLOA 2OPRA 1QE1A 4PG7A 4JYAJ 4DPXA 1UA0A 3M6VA 2QJ3A 4LRAA 2ZBQA 2AEFA 1XNQJ 1C0UA 5KAKA 2U1AA 2BACA 4A8SA 3I96A 2HHHJ 2E66A 5CD4A 4GC6A 1HMVA 3HXMA 2BANB 1HNXJ 4P71A 3KXDA 1UKUA 5KFTA 2JH3A 4NLQA 1KLMA 2C2OB 4ZDNA 2XMJA 2W4PA 2OEMA 5G0RB 1YGYA 3EZUA 4RZRA 2VJUA 3G6YA 4ZCLA 3U02A 3MM5B 1TK5A 5KG1A 3ELHA 2MKJA 2NXEA 4FKYA 4USTA 1S1TA 2CNOB 3W2WA 4PWDB 3SIPB 4ZVTB 3WX4A 3MDFA 3RB0A 2BW2A 4JI0F 2Z2ZA 3Q0AA 2NREA 3DGPA 3BQ1A 1Y5NB 3CW2C 1P1TA 1NDLA 1FJGF 2ASYA 4RW7B 5HN0A 2GAGC 2DISA 4B9SA 2JFDA 2FJBB 1GX5A 2XSJB 1GXTA 1S1VA 4DQIA 1TL1B 1X4BA 3KWMA 3LP2A 4OYWA 3RRKA 1XEZA 1URNA 6FD1A 2HMIB 5ETLA 1IBKF 3V2UC 1HNIA 2CQ1A 1KLNA 2AJ1A 1RLDA 1F5BA 4DCJB 4FN5A 4B08A 3ZC4A 2FVPA 2BRLA 3OV7A 4HI2A 2UVWA 1KVIA 4C8MA 3NCQA 1D3WA 2B56A 3CEDA 4NPOA 2QA4S 3CJ2A 2D9PA 3A3NB 3TVYA 2ZHOA 1UFWA 4C8NA 1VYAA 3LH2S 4CM2A 4DUTA 2DR6A 2M4MA 2M3DA 2M7SA 1B0PA 1NK0A 5D0HA 1KBRA 1UA1A 1SQGA 1GK8A 1T05A 4NCBA 1AB8A 2F7VA 4KGZB 4YQWA 5K5MA 3OPKA 5KFGA 3MR7A 4NEYA 1Y00A 1RAIB 3OD2A 3PHTA 2ADBA 2LEPA 1LWEA 2YPZA 3MEGA 1OYDA 4RBUA 1UVKA 2E5LF 3BZQA 3I5BA 3CUNA 1P9YA 4J9LA 3OFHA 3J80Y 3KUHA 2BKPA 4NRTA 3W9JA 2FDNA 2MXYA 3JTNA 2DNMA 4GKJJ 1S9FA 4U7UD 2A18A 2FLNA 3CDEA 3BKFA 2A6MA 2E29A 4PXDA 4CYUB 3RB4A 2APOA 1BWEA 2BQRA 3J7YI 2ZKTA 3JSMB 2FVSA 3KK3B 1I3OB 4LJMA 4DR5J 2QLWA 5B09A 3QIPA 3LP0A 2VBWA 2GV1A 1YBUA 2N3LA 5HBMB 2BOPA 1N33J 1R6YA 1VQSA 3BSAA 1UAWA 2LQ5A 4KYZA 2IA6A 4O0NA 1FKOA 4AL7A 2ZJPQ 2IYGA 2VBXA 1XTZA 4PXBA 5BYSA 3HKWA 2X3GA 2KDOA 2GC8A 1LEOA 1S0MA 2YY3A 3UCZP 1UL3A 1LWFB 4RNFA 2UVRA 2VFTA 3H25A 2F8HA 3V6JA 3I31A 2UXCJ 2FB0A 2KM8C 3J7ZT 4NA3A 1EETA 4Z37A 5EN1A 1RSCA 3HHEA 4CLKA 3GMGA 1YSJA 5GADI 2RQMA 3RU0A 2KRBA 4USJC 2WOMA 5B0DA 5E33A 3VR1A 3WBZA 1N5TA 3FBFA 4UOCA 2DY1A 4IFYA 3V81B 2AU0A 3SCLE 4QJVA 1X8DA 1RHQB 3PIPQ 4ZP9A 4PUOB 1IKVB 4RPFA 1QTMA 1JLBA 4MKBA 4B9MA 3KUGA 4JI4F 2BMBA 4KJIA 1B7YB 5ETPA 3FEXB 3DRSA 5KFEA 2XMKA 1X4AA 2EW9A 4TKTA 3PX0A 4Z2XA 3MMAB 4FYWB 3EVMA 1SKRA 1FDDA 4OJ3A 1UEVA 3V6KA 2RDDA 2J7WA 3K5PA 2Z8QA 2DCUB 5LMUJ 4ECTA 1UPMB 1EP4A 3M9NB 3IC1A 4DX8H 2W9CB 2B4OA 4DSKA 4HTJA 1R0AB 3MR2A 1YIJS 2QFIA 3H2LA 5IV4A 3K5OA 1VQKS 1NJXA 1S57A 1NSAA 1NK9A 3F0NA 3FQLA 4M63A 1VBXA 2Y9HA 4X64J 2BJ7A 2ZH1A 2FYXA 3CT9A 3CO0P 1NH8A 2B4UA 2QLJB 3PYGA 1H0HB 2O3DA 3NAIA 3JAMY 4PYDA 3Q89A 5KFOA 1N36J 3OFFA 2Q43A 2XHWA 1ZM4A 2MY7A 2M8DB 1WC1A 3VZHA 2ZM6F 2RVJA 2GO9A 3R1HA 3KUEA 4X62J 1NRKA 3K59A 1GXLA 5BYQA 2MZTA 1T3NA 1AZSB 4QQBA 1L3SA 1KVKA 4C0HA 4U7CA 4TVAB 2W7OA 2WHOA 2IFXA 1HWKA 2ZUGA 1M90T 4NL5A 1GQEA 5I3UA 3NWGA 2KL8A 4LF6F 3OXGA 3PR4A 1XNRJ 1IWGA 1IKWA 4J91A 5HQ8A 1NHUA 4DN9A 1WHXA 4BC9A 2YKQA 3MMCB 3BN7A 2F4VJ 5D3GB 5EDWA 1IWAA 5F3ZA 1A9NB 2GHPA 2HHHF 3O5TB 4F04B 4KHPJ 3LAKA 4DOZA 2X1BA 2GFFA 2AJFE 4ECXA 1VS3A 3PX4A 4ILRA 4DHVA 3TR5A 2A1BA 3KLVA 2QMXA 2J8AA 1N0UA 3KTQA 1NPPA 3D0IE 1R31A 3L7PA 2RDIA 4CO3A 4J9OA 2P2CB 2VG5B 3Q8VA 4WFAQ 1NJIT 3TQ1A 1RE1B 1T9TA 2Z58B 2FZKB 3MCOA 1SC3B 3N01A 5J1EA 3FDSA 3VAFA 2VHGA 2AJ2A 2ZBIA 1HR0J 1VC0A 2PGCA 4F4WA 4QYZJ 1MW7A 4KHRA 2WK4A 4DV7F 3PYEA 3MM6B 2J0SD 2KXFA 2R2RA 3VWSA 3E01A 4TYAA 2YQ3A 3CDBA 4HT5A 2G1DA 2IM0A 3ILOA 2N7CA 3VHQA 1Q4RA 5IT9U 2V34A 2G9OA 2ZNYA 4MKYA 2RE1A 1TMMA 3EM1A 1AYEA 4TY9A 1U2CA 1HQ2A 3MM7A 3IRXA 2X3DA 5A0YB 4HKQA 3VZIA 3CTRA 4G1QA 2FVRA 4HHHA 1JLCB 4LMZA 2DHSA 4H4OB 3DOKA 3GP9A 3R97A 2JZ5A 1J5OB 3JXOA 1RDRA 1UVLA 3QNWB 2FJXA 2DD8S 2CJAA 2C3YA 5FLXY 1DLOB 4F3QA 4A46A 1N4LA 1QLNA 3RW7A 4PQUB 1WORA 3O8WA 2IRXA 3TA2A 1HBOB 3NGUA 1LW2B 1U1NA 2B43A 2MKSA 1RGVA 4C3KA 2H4YB 4P73A 4DS4A 4RR5A 3BGUA 3BR9A 3D3CJ 2P9GA 2GJ2A 1D9FA 1KKHA 3K5LA 1TUGB 2HBRB 2DXDA 3AXMA 2KYZA 4GKJF 1YK9A 4XPEA 2VKRA 1NNDA 4X4QA 2DR8A 1VQ4S 4I7FB 2GCFA 4JV1A 2JX2A 1FWKA 2Y0SD 3CWJA 4FXDA 2DNZA 1QSLA 4DR5F 1CC8A 1NSPA 3KJFB 2GVZA 4KO0B 3DLEA 4ECUA 2C3MA 1YKWA 1N33F 1H2TZ 1HA1A 5J2QB 3SZ2A 2MGZB 3OTOJ 2PSZA 2WAQD 2GQQA 3US5A 1KHWA 2YNHB 4ZLNA 2QT7A 2HHUA 2ZD1A 1RB0A 1KP6A 3U1MA 2RKIB 1PYTA 2MKKA 2HFOA 1HPZA 5LJ5Y 3A3OB 5CAAA 2CPDA 2FUG9 1IKXB 4RWWA 4A47A 5GAEI 2UXCF 3DLLQ 1BMQB 1IUJA 2FJVA 2EFVA 4I67A 3OFEA 3EX7B 2P6TA 4KH0B 2EKNA 2MQLA 5AE1A 1CJVA 3HHLA 2ACYA 3SDEB 4NWBA 2EK1A 3KJVA 5GMEA 1BUXA 1RWNB 5LJ3Y 4X84A 1VBKA 2M0GB 1Y4ZB 3HULA 4WTOB 2HQCA 4GKKJ 2XCAA 4X4VA 1ZA2B 3BKUA 2V5HG 1T0TV 1MMDA 3EWGA 5HVHA 2DGUA 1UWBB 3DM2B 3MXHP 4DL0C 3V6HA 1WI8A 2RSQA 3PO4A 4DR2J 2IRUA 1S1WA 4J90A 3HHNB 2NZCA 3NWRA 3BGRA 4C98A 4F7VA 1SH2A 1SKSA 3R2DJ 3A13A 2H4WB 4WFNQ 2R7QA 1BXNA 3C8YA 2IAJB 4RW8A 2DNYA 3OHAA 2Q66A 1B0TA 4N8OA 3NS7B 3T5KA 1VK8A 4XPCA 2YQ0A 2HVHA 4IQMA 1FX4A 2G4BA 2ERRA 4NI2B 4FVCA 2IY5B 2J9DE 5LMUF 2LFVA 4KC5A 2HFNA 4R25A 1F5CA 2R2SA 1FKAF 8RUCA 1CJKB 2VQFJ 4TQRA 4ZP7A 2FLOA 2K7JA 1G6BA 5H9EK 4M5DA 4FS2A 4ECWA 3EVOA 4LF4J 4MYTA 4ENOA 5DGAA 2UVVA 5KT2A 1F3VA 4ECQA 4EZ6A 4X64F 4URSA 4LFBJ 2ILYA 2AW0A 3OR1A 1JKHB 3M2RB 4RNOA 2V4JA 1N36F 3P49B 3TI0A 3VGSA 3IO1A 2M88A 4YR2A 4ED8A 1RU1A 2KZMA 4CLYA 2J8SA 3M2UA 1U6BA 1YG0A 4A48A 4Y3CA 4X62F 1YJTA 4FNHA 2HQGA 2DIUA 1DRZA 3LOUA 3GIJA 2HVEA 2V69A 4OZLA 1KOHA 2R8HA 5LSOA 2G13A 2XS2A 1LWXA 3UO0A 5I3QA 1S4EA 2I5JB 3DRPA 4DCOB 5F8NA 2GMJA 3M30A 3QFHA 3HD2A 2K8GA 2HHVA 2AYBA 5HVGA 3K8WA 1XNRF 2WONB 3A12A 1L3KA 1G2EA 1SL1A 2ZUAA 3MR5A 2HIQA 4DSIA 2QGFB 3PDNA 4EBDA 4FZVA 1T9YA 1VOMA 4E98A 3B4DA 3MCNA 5H9FK 2F1FA 2GQCA 3IAS9 2BA9A 4KHPF 1MROB 3VCDA 3JQKA 1RISA 5A8WA 3I87A 3Q8RB 3AODA 1T9UA 2HWTA 6FDRA 4OX8A 2CPXA 3MEEA 1IBLJ 3LA0A 2MLYA 4X4RA 3HVRA 1FDNA 5G4DA 1HHTP 4CO2A 4CH7A 3R6GB 4ED3A 2WVBA 4O3NA 4I2PA 1UCNA 2W4DA 3IS9B 3PX6A 2O5DA 4KGVB 2HFVA 3CSKA 1HBUA 4CLFA 4IH7A 4QIVA 2LVWA 4ED2A 3BBBA 1Z2ZA 3TQEA 2UV8G 4JI5J 3DKDA 3QIDA 1FEHA 4RW6B 1HR0F 2AJ0A 3BS9A 2N82B 2ZBCA 5KFDA 2XZDB 4UOFA 1WSRA 5A8RA 1H72C 1RK8A 3AAWB 4HHJA 1QY7A 2XY5A 3GB0A 2CJ9A 4CTAB 1WKKA 3MM5A 4WXWA 1TKTB 4NE9C 3FKBA 1NCLA 1R0CB 3RR7A 4PYAA 5HMWA 5J2PB 2XCPA 1SL2A 1S6QB 2FC8A 3LAMA 4NA1A 3KMSA 4KT0C 4M95A 2CFXA 3CJRA 3H20A 1EQMA 1FK9B 4KIAA 3DHXA 4XDDA 5KFWA 2ZJRQ 4C0OC 3GYGA 1NM2A 4WIIA 4I2QA 3TUJC 4ZN1A 5L46A 2MQMA 1CJTB 4RW7A 1Q16B 4DFKA 5KFAA 3KLHB 4Q2LA 1Z2LA 2IJRA 1IM4A 4B3TJ 5ETOA 5C42B 3ZFVA 5KG3A 4CLZA 3EGVA 1SJRA 3W8PA 3LANA 4AL5A 3HM9A 1TL1A 2Q3PA 3H8YA 2HHXA 2E5GA 4HDGA 4QBUA 6AT1B 2J6TA 3POTB 5KFNA 3D6FB 2HMIA 1V9OA 3BR8A 3NMRA 5J2NA 1AXQA 2LCWA 1QJHA 1RTDB 5FIIA 5KFJA 3QBCA 1ROFA 3O2IA 4BWJA 1FHTA 2O66A 2VDHA 3PW2A 1NDKA 3N6LA 4F4XA 5C7PA 5IT4A 1JQGA 5FJ4A 5IWAJ 3D1QA 4RL1A 2IJFA 1MSWD 2XMWA 4LSNB 1P8GA 1LQ9A 2ASJA 5E41A 2OMLA 3MAAA 1TKDA 1D8YA 2CJXB 1KNZA 1NO8A 5CXTA 1Z1ZA 2I6WA 1C1BB 3BBFA 3JQMA 2GHWA 3OTOF 2DT9A 1Q79A 2H5IB 3TVKA 2FVCA 2HHTA 2CQPA 4DPUA 3TA1A 3B82A 3HK2A 3BPDA 2GVDB 1A0OB 1RAOA 3PYDA 4ZLJA 2KVIA 4C8KA 1O51A 2UXBJ 4YOEA 2ALYB 3LQVA 1A7GE 2L08A 2KTQA 2ZE2A 3ISND 1D1UA 4QW8A 2PMZD 2OHDA 4U7UK 3BH6B 4I0WA 4OJHA 4CYUA 2V2KA 3AQOA 1RWUA 4NZ7A 3IM8A 3QLHB 4MFBB 1HI0P 1C2PA 2G2ZA 3LO3A 5HBMA 3GJTB 3QGPA 3UD4P 3PY8A 4GKKF 1RT5B 4ZVSB 1XR7A 2MQ8A 4DQSA 5EGYA 4WP3A 4DU7A 2JVRA 1LWCB 4DR2F 3NCRA 2OD4A 5GAEU 4Y00A 4AYBD 3C15A 4Y34A 1AA1B 1LWFA 5A76A 4UOHA 3IXQA 2YWGA 5HLFB 4ZJLA 5B08A 1UVMA 1X60A 3W7BA 2WBMA 3QYYA 4N8NA 4C3MA 3V5RA 1SVDA 3KLIB 2C2MB 3TOQA 5KFFA 1TVRB 2AHOB 4TY8B 3D6TB 2H3EB 2DPIA 1ITPA 3B8HA 3KDOA 2DR7A 4PUOA 5CH7B 5C25A 3UFCX 4GVBA 3I9ZA 3TAMA 4C8ZA 4J9SA 2RF2B 4OHVA 3D5MA 1JNRB 2FLLA 2ATLA 2VG6B 4LFBF 3OR2B 5F8LA 1YJVA 3RBXA 3E51A 1JLEA 1U1KA 3K5MA 4P72A 3HLUA 2YNGA 4BLGA 2EWHA 1M1HA 2OUGA 4ZP6A 5B0EA 3NMAA 1JLGA 2OEJA 4F0HA 2BZ2A 2WW8A 1ACMB 3CCTA 1NSKL 4J9PA 1SJ4P 4M5HA 3A1YG 3MMJA 2VPXB 4R8UA 3IRWP 3H90A 4OYXA 2DBBA 2C22A 2HHSA 4MJKA 1U8WA 4Q0BB 2JRSA 2XY6A 2CPFA 2XYGB 4ECZA 4J9VA 2R9LA 4AE5A 1HWIA 3D3BJ 4DL5A 4LF8F 3VAKA 4GO7X 2EKYA 5KT7A 2LDIA 5J2MA 1SIWB 1PC5A 3SCIE 2QZ8A 2DKOB 1TR0A 3GR1A 2IM3A 2QSWA 3DRRB 1JLAA 1HNVA 5IM0A 2HZAA 5IFMA 3ZZ0A 4HH1A 2OPQB 2EFNA 3KLFA 2DEIA 3AOAA 3KFWX 4OYBA 2UUBJ 3QJLA 2VU5A 3CCZA 3TZXA 1B99A 4LREA 1U2FA 3DYAB 1P1LA 4WKRA 3Q24A 1NUEA 4Y6IA 2I0XA 1RJJA 3DMJB 1GH8A 4ES1A 1UVIA 5HL7Q 4MT1A 4U95A 1RYSA 1TFWA 2KFZA 4PAAA 4ZS6A 5DRKA 2KJVA 3GPAA 3IWXA 3R5JB 3CCVS 4HEA9 3SYZA 1NJWA 2GX8A 2K06A 4E2FB 4OL8A 2XMTA 3THPA 3HHKA 4IDKB 2QIFA 4EO8A 4MK9A 4EK2A 2JLEA 4G3IA 4AL6A 4QWCA 4QW9A 4PXCA 2OP5A 1S6UA 4I6YA 2A3JA 3W60A 4JI5F 4K59A 3DDNA 2NYIA 2RH3A 2E9RX 2HVDA 3LF0A 4ED5A 4OLOA 4CQ1A 5C24B 4OFZA 3X1LB 4OYOA 3CDWA 1HI8A 3UWTA 3K5NA 3QSYB 3G71S 3JS9A 3ETOA 3PFEA 4LVNP 1JLQA 2KRRA 4DQQA 2XBPA 1T7PA 1U1MA 1F2GA 3H59A 5HJYA 2VA2A 4FF1A 2VD3A 4OQJA 2JC0A 4UUXA 1RT3B 4B9UA 1Q8BA 1Z4UA 3CDUA 1JXVA 2PO4A 3E2EA 1G7CB 3W5ZA 1SV5B 3D0HE 1U7LA 3MAQA 4ID5B 3DLBA 3T41A 3ZZPA 2M52A 3OQ2A 3TW0A 1I94J 1W2IA 3K0JA 2ZH3A 4ZCKA 3GIRA 1QTNB 5KFKA 5E2QA 3AB4B 2ZOGA 3OL7A 4B3TF 4F26A 3TZWA 4HTIA 4KFBB 1FWLA 1NK7A 4UUWA 4ZLLA 4OZNA 2KXHA 5KG7A 1HIYA 3T1YJ 1SJ1A 2HG4A 2FZGB 1TL5A 4MH8A 1RTHA 3I0SA 1U8SA 2CUYA 3DN9A 3MMBA 1X31C 3OW2R 1RWPB 2BE2A 4H4MB 3ILJA 1Y11A 3SQGB 3O3LA 3BSOA 2VOPA 1JX4A 4X4UA 1E6YB 2MSTA 5IWAF 5A0YA 1VRUB 4RUBA 1U1OA 2P6SA 2XULA 1CC7A 2DH8A 1U1PA 4C8OA 3JYTB 1TL7B 4P2XA 2QN6B 3H2VE 3P4UB 3D67A 2HNZB 2D69A 3AT1B 5D0GA 1E6VA 4OI4A 1SBRA 1DLOA 2OPPB 3PW0A 4ED7A 2VFSA 2X1FA 2HVIA 3UR0A 4O3QA 2FPHX 1HBOA 1LW2A 3NBPB 1CS4B 3FEYB 1JLFB 4JI3J 3PR5B 1RTJA 3UW1A 3OHBA 1UVNA 5K8OA 1OJ4A 2KKHA 1NKCA 2UU9J 1SUQA 4U8VA 2AKWB 4LRCA 4UY85 3J81U 3AFGA 4ZVFA 1H2VZ 4I7FA 4ECSA 1WG1A 4OYZA 4IG3A 5DQHA 3NGRA 3T1AA 1RHMB 2PDAA 2YWWA 5EX3A 2G1HA 1R7IA 1YVFA 2LLZA 4LVOP 4UT4A 1KSPA 4B3OB 5F8GA 2E9TA 4KV8A 4IG0B 2EBEA 3OVAA 3BYPA 1OPZA 5M2UA 3E3XA 4ICLB 1IKYB 4DQPA 1SB6A 3KDNA 2AGOA 1GTHA 1RACB 2CNLB 4DZ6A 4OZ3A 3CCWA 4IFVA 1ZOTA 3P3DA 1X5PA 2J0XA 3T1HJ 4F4YA 1Y10A 3DOLA 1ZH5A 2BABA 3K7RA 4K4XA 4U9RA 5BYRA 2IIHA 4CWBA 3SDEA 2HZCA 5K9FA 3JSRA 1EAYC 2G0IA 1BLUA 5CCMA 1Y3KA 1U4BA 1TELA 1EIYB 4LIRA 3KK1A 3J7AN 5DJBA 4LFCJ 1WF1A 3DM2A 1D8ZA 2V9KA 2BJ9A 5L1IA 1YZ6A 1U2RA 1KR4A 4FP9A 3IGNA 1X0PA 1LNQA 4C8LA 5HANA 4FYDA 1RABB 3CC2S 5BXIA 5DQIA 3BO2A 1N5YA 2HEKA 1TV6A 1PILA 1FI4A 2CPHA 1AROP 4OZ2A 4B3RJ 4WFXA 2BM0A 1S9EB 3MOZA 3Q22A 2IAJA 4U67Q 2AT1B 5ETNA 2OGUA 1XIQA 1RAAB 4IH6A 1VQ9S 4OHXA 3DGVA 4NLTA 3GV5B 5T7LB 1VGYA 1CJKA 5D78A 4HL9A 3GFXA 4QPXA 1FNXH 4OJ1A 3KHLA 3LPYA 3PJ9A 3J80U 3W66A 4WYLA 5ETTA 2RU3A 3BYRA 4EWTA 1YHQS 1U0HA 5KFBA 2CYYA 1TTHB 3FRZA 1U24A 1WC3A 1NZAA 4BHQA 3M1VB 2EXUA 3R7SB 2RJZA 3ZTQA 5E3RA 1L5UA 4OX9J 1Q8IA 3IGVA 1HHQA 2DTJA 1OQ3A 3M8ZA 4OJGA 4B17A 3H2UB 2PI5A 4Q2MA 2D1CA 1K44A 2UUBF 2YX7A 2PEHA 1T02A 3RBEA 3PKYA 1BWVA 1ZAWA 1L3UA 4CLWA 1CQNA 3DRXA 3OFGA 3MPVA 5EWGA 1FD8A 3H4BA 1S0VA 4KBIA 2BE7D 2BQUA 3BB5A 4R5PA 3ILLA 2ASLA 4KAIA 4OYMA 2VASA 3ET6A 2K1RA 4IRKA 4CM0A 3W1YC 2KZZA 2I5JA 2EFOA 2QG9B 5A8KA 3MCSA 2JEFA 3R7BB 2CA9A 4W92B 5F0WA 2J7UA 4W90B 3G6VA 2C2DA 2Q6CA 4USKA 4IYQA 4QPTA 3W61A 2E7WA 3M8SA 4ZKAA 1S6PA 3GILA 2C2RA 2LQJA 1SH0A 2BE9B 5GAGU 9RUBA 5HP1B 4CP5A 1MMLA 4RU9A 1VQ7S 5E0OA 5DETA 4EBEA 4ETZA 1FWPA 4KPCA 2GJIA 1N56A 1MU2B 1RWMB 2EC0A 2RIJA 1KTVA 3HFKA 3THTA 3ITHB 2HHQA 3CNQP 2QLXA 4OV6A 4WE1B 3DLGB 3HVWA 3M8PB 2HHWA 1WDDA 1Q86T 3LP1A 2B9XA 4AXIA 2DNLA 1B70B 4QCLA 3QRQA 1S4FA 2ZVSA 3HD1A 2GIQA 1RT6B 4DV1F 2ZNZA 1T03A 4K2XA 1Q7YT 3OLBA 2WSEC 1KVJA 3SSSA 1REVA 2ALZA 2UUCF 1I94F 4F4KA 4XAKA 4X4SA 1DBDA 4L76A 2DXFA 2QE5A 1YJ9S 3C16B 1UFKA 4RNMA 1YJRA 4Q44A 4DR3J 4K5RA 3FEZA 4EBCA 4NCGA 3DHWC 4RNHA 5A6WA 1NDCA 5DDPC 4C97A 3GZ7A 2W1BA 1FTRA 2XY7A 5ETRA 3D66A 1S6QA 2FY1A 3KK2B 1F3FA 2ADCA 3W5YA 2YNIB 5B0GA 1LW0A 2WSFC 1NSQA 2DGOA 3FBCA 3KG0A 3MR6A 3W3SA 1SXLA 2V50A 4D3GA 4DR6J 1R8BA 4RW9B 4PXEA 2KT3A 2V67A 1YJ7A 1CJTA 1F60B 1R8CA 1DQ9A 4U8YA 1RAEB 4RW4B 3RYLA 5C42A 1X4HA 4WFZA 3JSBA 4BS2A 1HBMB 1XJWB 4CCHA 2JOQA 4RU2A 2Y1LB 1N6QB 1VQPS 3ETMA 4FKXA 4NYPA 3GJSB 3FUYA 3D7SB 1K9MT 1RTDA 4JI3F 2Y1IA 2OAUA 3HSGA 2NXJA 2ROPA 3GCXP 1BC6A 2RS2A 2WB4A 4KGKA 5IT9Y 1NEEA 3C6UB 1PBAA 2ZC4A 1LOUA 2UU9F 4AXJA 1WTBA 3MGJA 3LTOA 2E1AA 3B6BA 1FFGB 4X65J 3NNHA 4WZQA
chains in the Genus database with same CATH topology
3I5CA 2X1GA 3F44A 5M2PA 4RBVA 3BGRA 1DFDA 4C98A 1VRUA 3MUMP 1SH2A 2W9AA 1NK5A 2DGSA 1NK4A 2CQ2A 1SKSA 3S7RA 4CH1A 3SI8A 1FJCA 4R8UB 1C1BA 4WFNQ 4ECYA 2EVZA 2R7QA 3F73A 2B3TB 4QR2A 2DPJA 1JNZB 3IG1B 3RW6A 3C8YA 4DR4F 2IAJB 2HQ3A 2DNYA 4RW8A 3OHAA 2OH2A 5KFMA 2Q66A 1B0TA 2N3OA 2MZ1A 4N8OA 4OIXA 2I1RA 2HNZA 3HP6A 3T5KA 1VK8A 2RMLA 4XPCA 2HVHA 1CLFA 2O67A 2IM2A 4IQMA 4I69A 4QIEA 4ZLPA 3IWLA 2G4BA 2ERRA 4FVCA 4DBQA 2OPRB 5L38A 3TO8A 5HI7A 2D3OR 4ZPAA 2J9DE 2FIUA 4BCAA 1Y5LB 4Y2IA 2OPPA 4OZJA 4KC5A 5LMUF 1TL3B 3OJUA 4DV6F 4LF7F 1VQNS 2OPSB 2RQ4A 2HFNA 4DPOA 4R25A 1F5CA 4KB7A 2R2SA 3N6NA 3NBPA 1Q7LB 4YB5A 1FKAF 1C0UB 1JLFA 1N0VC 3BEGB 5J2MB 1S1XB 4TQRA 2IMWP 2IBKA 4ZP7A 1Y5IB 2FLOA 4YY3F 4IOAQ 2K7JA 4OI3A 1G6BA 1IKWB 3ISZA 4M5DA 2MKCA 2AJ4A 5L8RC 1HMVB 3T1HF 3V81A 4FS2A 3MECA 4NZ0A 4XDCA 3UR3C 4ECWA 2XMUA 1FJEB 4V19X 1RAJA 4MYTA 3FSIA 4LSLB 3DLJA 5DGAA 2PA3A 1HWJA 2VQFF 2UVVA 3M05A 3MM8B 3LALA 5KT2A 1IKVA 1JLAB 2AF6A 4ECQA 4WZMA 4EZ6A 2EI5A 1KLMB 3UCGA 1FVSA 1HNVB 4B02A 4X64F 2JLGA 2ZH4A 4URSA 3LWMA 4Y28C 5IM0B 1DZ5A 2ILYA 3PRDA 2AW0A 2HWIA 1T95A 1OWXA 3KLFB 3OR1A 3FQKA 2I8EA 4OX7A 4OV1A 2D3ZA 2JL9A 2KH9A 3PNIA 4LF4F 1UJ5A 4DUYF 1FTCA 1JKHB 4I1TA 4ILMA 3M2RB 1V3ZA 3OL9A 5ITHA 2AYMA 4RNOA 2V4JA 3W2VA 3NKYA 1N36F 3AH6A 4ZCIA 4LFCF 3TI0A 3P49B 4YDXA 3C6TB 1U1QA 4E8UA 4WK1A 4DV3F 2M8HA 3IO1A 3CC4S 2M88A 4NLPA 3KLEB 1V3SA 4YR2A 4ED8A 4O3SA 4P7VA 2VG7B 2KZMA 2DCLA 1X7VA 1H7WA 4KPYA 2J9CA 2XG8A 3FGVA 3V6DB 1S1TB 1U26A 1S6OA 2DIVA 2LEBA 4B3OA 5I3PA 4IUFA 4QWBA 4O3PA 5B7WA 3M2UA 3WC0A 3OUYA 1U6BA 2Z2MA 1YG0A 3MMAA 1FNMA 3SSRA 4A48A 4Y3CA 3IR6B 5KFXA 4IO9Q 5F3TA 4X62F 1YJTA 4FNHA 4MAKA 1WTFA 2DIUA 1K1SA 4Y2CA 2E5IA 2FC9A 2ZHBA 2B51A 4DLEA 4ICLA 3LOUA 5HLFA 1H38A 3GIJA 1IKYA 5DS7A 4XO0A 1DRZA 2OSRA 1PSDA 3NS5A 4LT6A 2VA3A 1SH3A 4PR6A 2JDJA 4OZLA 4C3LA 4B3RF 4BBYA 1KOHA 4TN2A 3G96A 2R8HA 5LSOA 2G13A 3CJKB 4USIA 4ZMMA 2XS2A 4UW2A 2R8IA 3CCRS 3PW7A 4QIFA 2POKA 5I3QA 5J1EB 2D9OA 3CD7A 4TNOA 2W9CA 3ZZYA 2GGPB 3EXYA 2I5JB 3TANA 1R0AA 4CIOA 3MTJA 3DRPA 2BVZA 4WYWA 1MMNA 2MKHA 4DWIA 5F8NA 2GMJA 2LKZA 2MDAA 2U2FA 3P6YC 3M30A 3L7OA 3SEOA 1TZ0A 3DI6B 2CQHA 4LF9F 4TY8A 2F8MA 3MEKA 4NLXA 5LXYA 2I2YA 4F4ZA 1ZM9A 2DHGA 1S1VB 4RWXA 4QZVB 3RAXA 4O0IA 4ZPBA 2W8KA 2K8GA 4ELUA 4EYHB 2HHVA 1T3OA 2LQBA 2AYBA 3K8WA 1XNRF 2WONB 4F8RA 1UVJA 3U1LA 5M2RA 4NLYA 3CCMS 2V0NA 3LP2B 1L3KA 1G2EA 1V6HA 3CJ5A 1SL1A 4DJBA 2R7TA 4DQRA 5GAHU 3T6BA 4NLSA 4LFAF 4BDPA 4ZPCA 2ZH2A 3S1TA 3G6ES 3MR5A 2HIQA 3L95X 2QRRA 2HAIA 4NA2A 4DSIA 1HNIB 1VMBA 3PDNA 4EBDA 4FZVA 1VOMA 3AJ1A 3HVAA 2E5HA 4EUVA 3MM9B 4E98A 2IC3A 4DLGA 3B4DA 1BQNA 5FD1A 3OR2A 2W7PA 2F1FA 2WBRA 2BJEA 2GQCA 2KN4A 3IAS9 2BA9A 4JBCA 4KHPF 1WG5A 4V19J 1MROB 3O44A 3U7JA 4YR0A 4M94A 3VCDA 5E5NA 5CCLA 3K2YA 3MPYA 2XWYA 1RISA 3R5BA 1JLQB 5A8WA 1FJ7A 4ATNA 1WELA 5K8PA 3C2PA 2CZ4A 3I87A 3Q8RB 4HH0A 4ID8A 2OD6A 3QGIA 2HWTA 5KG2A 2B5JA 1SI9A 6FDRA 4OX8A 4J5OA 2CPXA 3MEEA 4OX9F 5KFQA 4B9VA 3Q2TC 4AFFA 4I64A 1OQ6A 4ZVEA 1SJQA 2JEGA 4X4RA 2B9YA 3HVRA 3BQ0A 1FDNA 2MJNA 5G4DA 1HHTP 3X3UA 4CO2A 4CH7A 4ECRA 2VFVA 1VC6A 1C1CA 4MIBA 4UQTA 2IHR1 4ED3A 1QAJA 1M5SA 2YNFB 3CPWR 1NK8A 1U25A 2ABYA 1Q1KA 4O3NA 4DL6A 3RR8A 1K73T 4RKUC 1IBLF 4I2PA 1T05B 2W4DA 3IS9B 5IXUA 2KXNB 2D74B 3PX6A 1LFWA 2O5DA 1OSCA 3MUTP 4Y2AA 1FKPB 3CSKA 4YEAA 5J1NA 1HBUA 2V8HA 2ZZMA 4IH7A 2MHEA 2VB6A 2KHDA 2J0WA 2NPIA 1WHWA 4QIVA 1ZTWA 2LVWA 4ED2A 5T7LA 1LWEB 3RAQA 3I55S 1VQ8S 2RRNA 1RA6A 4X4NA 1IJEB 1Z2ZA 3DDKA 4FNIA 1D9AA 1N54B 3ONQA 4DF8A 2UV8G 2M70A 3C46A 3QIDA 1FEHA 4ECVA 3N9UC 4RW6B 1HR0F 2OTLS 2OJ3A 2AJ0A 3BS9A 1VQLS 5MAOA 3S01A 2N82B 3D54A 3HDSA 2CKWA 2ZBCA 2R2UA 1T8EA 2CPZA 4C11B 1OPIA 3MMCA 3FVYA 4ALZA 2BUNA 5KFDA 4FF2A 5D3GA 4YDDB 3QAEA 2GW8A 1HWUA 1QVGR 1P9QC 4IR1A 4Q8FA 1X4DA 1TUVA 5A8RA 3TX8A 3CCSS 1RK8A 3NRBA 1ZZNA 2YKMB 4QU7A 1JJHA 2E9ZA 2XZWA 3AAWB 1DJ0A 4JV5F 4X2BA 3RRHA 2VPWB 4HHJA 1QY7A 2XY5A 1TKZA 1DTTB 4U6PA 4IRDA 5DDQC 2XC9A 1RTHB 3GB0A 1WD6A 2R2TA 2DITA 2KT5A 4ZK7M 3KLGA 2NZ4A 2CJ9A 5DG7A 4CTAB 3MM5A 3I0SB 3ENQA 3M1VA 4BWMA 4WXWA 1M5OC 3MMBB 1TKTB 2EK6A 4O4RA 1F5AA 5AE2A 1S76D 4YP3A 3PACA 3QIPB 4A4JA 3IFEA 3LP0B 3NNCA 2L48A 1H7XA 2F3JA 5F9LA 2HGLA 2AWZA 3RR7A 2HWHA 2YWFA 5GVQA 5HMWA 5J2PB 2XCPA 2BM1A 2BE2B 1BD6A 1VQYA 3QZ7A 1SL2A 1S6QB 2R4FA 2FC8A 1X5SA 3PRBA 3LAMA 4NA1A 3CGIA 4ZCMA 1JIHA 2ZH6A 1LK7A 3N6MA 5B0CA 1X5OA 4BC7A 1HI1A 1KQKA 3KMSA 4KT0C 1NKEA 3IR5B 4M95A 2CFXA 3H20A 1XR5A 4EO6A 1FK9B 3J7A1 3MD1A 4KIAA 3NS6A 4FBUA 2K3KA 4P2SA 3DHXA 2VG5A 4Y0FA 4XDDA 5KFWA 4CH0S 2XNQA 2OKQA 4QIGA 2ZJRQ 4DS5A 4PWUA 3GQCA 1X4FA 2HS3A 2UUTA 4C0OC 3SMZA 4F2SA 2OFHX 3PHEA 2N4DA 2L9WA 1QUPA 5I42B 5HROA 3PXGa 3DLKA