1AUDA

U1a-utrrna, nmr, 31 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the RNA-binding specificity of human U1A protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords RNA 3UTR
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 1997-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1audA00
3SDEB 1U1NA 1X4GA 3Q2SC 2EK1A 1WHVA 3BO2A 2CPEA 2M70A 3S8SA 2XNQA 1KC8T 2ZJQQ 2RRBA 1WF0A 4LMZA 2XS2A 2KXHA 3CCUS 1B7FA 3R27A 2MQPA 2X1GA 2KH9A 2DNOA 1VQLS 2KG1A 1VC6A 1FHTA 1WI8A 2KRRA 1WG4A 3MUMP 1FT8A 1X4BA 2MB0B 2XS7A 1M90T 2QA4S 1X4DA 2DK2A 2HZCA 1FJ7A 3NS6A 3G71S 3B4DA 1X5SA 1URNA 1YTYA 3RW7A 2MJNA 2KN4A 5BJRA 1VQ6S 2DH9A 1H2TZ 4TU8A 2M0GB 2YKAA 1WEXA 3G96A 3U1MA 3J7YU 1SJ4P 1OWXA 4BS2A 2CQ1A 3CCQS 3BO4A 3CCSS 2DGUA 1S79A 1KD1T 4WCEQ 4CH0S 2MSSA 1A9NB 3V4MA 5IFMA 2KI2A 2MKHA 4LIRA 2OJ3A 1W2BR 1WHYA 3CD6S 2M9KA 2MPUA 3EX7B 2RT3A 2MKSA 3CCRS 2LA6A 4ERDA 2E44A 2M7SA 2DHXA 2OIHA 1H2VZ 2DISA 2MQLA 4J5OA 3G8SA 2EVZA 2VONA 1UFWA 1VQNS 2HGMA 2E5GA 3UCZP 2RS2A 2M2BA 3HHNB 1R8PA 1FNXH 4IOCQ 1VBYA 2J0QD 3CUNA 2CQPA 5JVGQ 3S6EA 2DNRA 1QM9A 2CJKA 4ED5A 3VAMA 5DDRC 3H2VE 2M52A 3DXBA 2CQ4A 3BO3A 2CPYA 2MXYA 1P27B 3VAIA 2VOPA 1WHWA 2KM8C 2M88A 1OPIA 2M4MA 1Q82T 3CCMS 2MKJA 1VQ7S 2N3OA 3K0JA 2N7CA 4P6QA 1FJCA 2KYXA 2PEHA 2KXFA 2FY1A 2DNPA 2CQIA 2G0CA 2CPXA 2MSTA 1VQ8S 2SXLA 3BEGB 1YJWS 1WEZA 4C4WA 3CC2S 5DM6Q 1JMTA 2LQ5A 4Z2XA 1QVFR 1U1OA 2ZJRQ 2LEBA 2DGWA 2J76E 3I55S 5GAHU 1WG5A 5DM7Q 1YJNS 3B4MA 3PIPQ 3VAGA 2N82B 2D3OR 2DO0A 2BZ2A 3SXLA 3UE2A 1WWHA 2DHAA 1AUDA 2MGZB 5D77A 2DITA 2RQ4A 4FXVA 3MOJB 2J0SD 4Y00A 1VQPS 1KOOA 2F9DA 1N88A 2VODA 2BOPA 3S7RA 1FO1A 4PRFA 2CPZA 1VQMS 3VAKA 5EN1A 1YWXA 1WF2A 2F9JA 4OZ0A 4WFAQ 4YB1P 1ZZFA 3G6ES 3P3DA 3MDFA 2MZJA 3UD3P 1X5PA 3D2WA 1PO6A 2MQOA 2NZ4A 2F3JA 3L3CA 2XS5A 4V19X 2LKZA 3ZZYA 5CA5A 1WI6A 3CCES 1HD0A 2ERRA 2L41A 2LXIA 2LECA 1VQKS 4IO9Q 4QU6A 2AYEA 5FJ4A 2E5HA 2OTLS 5IM0A 3CCVS 2YWKA 2RQCA 1WF1A 1P1TA 1WEYA 3P5TL 3CULA 4F26A 1JJ2R 2JWNA 5LJ5Y 5MLCV 1SJRA 3OW2R 2DNGA 2JVRA 4UY8T 2FC8A 4W90B 1U1QA 2YH1A 3J7ZT 3I56S 2E5JA 2VOOA 2ADBA 2X1BA 1N52B 2L9WA 2LCWA 1WTBA 4WIIA 1VC5A 1ZZNA 2MGZA 2AYMA 2K3KA 3FEXB 1YJ9S 1L3KA 1OO0B 2UP1A 3US5A 3NNAA 1U2FA 2CQCA 2HGLA 3RW6A 3MUTP 2XNRA 1FJEB 2DIVA 3CC7S 2ZJPQ 1VQ4S 4CQ1A 2KHCA 2RS8A 2CQ0A 3CMES 4TU7A 4CH1A 3VF0B 1DRZA 2JVOA 1VBXA 4IOAQ 1K73T 5HL7Q 3ULHA 1ZH5A 2GHPA 2Q79A 3PIOQ 2D9OA 3G9CA 2KU7A 4PR6A 4RU2A 1H2UX 2DGOA 1SJQA 1HL6A 1JJ4A 1G2EA 1UP1A 1N54B 4WFNQ 1R8HA 3LQVA 2RRAA 2DNHA 2MQQA 2KM8B 1DBDA 4QPTA 4PKDB 1UAWA 1DZ5A 1BY9A 3R1HA 3MD1A 3MXHP 1U6FA 4TLQA 4QU7A 2QEXS 2CQ3A 1RKJA 1X4AA 2AYGA 5CXTA 1M1KT 1OIAA 1X0FA 2KRBA 4IUFA 2MY8A 1U1KA 2DO4A 1NO8A 2G4BA 2CQ2A 2JX2A 3MD3A 2MQMA 2MHNA 3NNCA 3VAFA 1X4EA 2QFJA 2DNNA 2M8DB 2GO9A 2CPDA 1JJHA 3VAJA 3TO8A 2KT5A 1VC0A 4Y0FA 3NMRA 5D78A 3THTA 1S72S 2G1DA 5DDPC 2N3LA 3LPYA 1M5VC 3CTRA 1Q86T 4QQBA 1QVGR 1H6KX 3SMZA 2LA4A 1X4CA 2DGQA 1HA1A 1NJIT 1N8RT 3Q2TC 3VAHA 2I38A 1YITS 1YIJS 2DH8A 2E5IA 4FXWA 2CPIA 3P49B 3G4SS 2MQNA 2CPJA 5DDQC 2HGNA 2KXNB 2DHGA 3UCUP 2RVJA 1K8AT 2DGVA 1U6BA 3CC4S 2DGTA 3CMAS 4WKRA 2DB1A 3UWTA 1IQTA 5IM0B 2OSRA 1NU4A 2KFYA 1YI2S 1M5OC 2EK6A 5GVQA 2YH0A 4A8XA 3MUVP 1KQSR 3SDEA 2KVIA 2DNLA 3MURP 1Q7YT 2K8GA 2FHOB 4U67Q 1F9FA 2LEAA 1X5TA 2LMIA 2L08A 1VQ9S 1K9MT 3TP2A 1RK8A 1VQOS 5GADU 2DHSA 4CIOA 3UD4P 2NLWA 2CPHA 3P6YC 3NS5A 2YTCA 2DGSA 5CYJA 2ADCA 2MZRA 3DLLQ 1U1LA 5IQQA 2HVZA 2FC9A 2J8AA 4C0OC 4WFBQ 2MYFA 1U1RA 1SJFA 2DNKA 2AD9A 2X1FA 2CQBA 2JRSA 2CPFA 3TYTA 4F25A 1U1PA 3ZZZA 3CF5Q 3S01A 2CQDA 1M5KC 2WBRA 4TU9A 3CXCR 3N9UC 4ZKAA 3MI7X 4YUDA 1YHQS 4YOEA 1XN9A 1X4FA 1FXLA 1D9AA 2V94A 2MMYA 1DHMA 3U1LA 2MZSA 1KOHA 1O0PA 4WF9Q 2B0GA 2MZQA 5LXRA 4C7QA 3FEYB 3IRWP 2U1AA 1D8ZA 3R1LA 2DNMA 2CQHA 1WG1A 2RU3A 1U1MA 3CPWR 1A7GE 5LXYA 2DNQA 2DNZA 2M8HA 1WHXA 3EGNA 4F02A 3THPA 2PE8A 2MZ1A 1Q81T 2KG0A 5LSOA 2RUGA 2OTJS 2XB2D 2DGXA 2X1AA 4W92B 2CQGA 2A3JA 1X5OA 5GMKa 1M5PC 4OZ1A 5LJ3Y 5DETA 2XSFA 2LXUA 4EGLA 1VBZA 4M5DB 1UW4A 3JB9k 3IWNC 5GAEU 5HO4A 2MY7A 3H2UB 2DH7A 3BS9A 5LSLA 3VALA 2MJUA 1HD1A 1X4HA 2O3DA 5H1SV 2DIUA 5JVHQ 2MZTA 2RNEA 4UQTA 1VQ5S 1SJ3P 3EGZA 2U2FA 3CCJS 3CCLS 2I2YA 1PGZA 2FPHX 3HI9A 2HYIB 2MKKA 3UCGA 1CVJA 2OSQA 3G8TA 5GAGU 2MKIA 2AYBA 1SXLA 2D9PA 1WELA 2DNYA 5DDOC 3NNHA 2MKCA 4LJMA 2LYVA 5ITHA
chains in the Genus database with same CATH superfamily
3SDEB 1UFKA 2BABA 1U1NA 3K5PA 4B9NA 3Q2SC 5HJXA 4HKQA 3MHYA 3BO2A 1FRHA 2CPEA 2ZOFA 3OD2A 2BJ3A 4G1IA 5KG2A 1IKYA 1HBNA 4KO0A 3TWZA 1KC8T 4MH8A 3K7RA 2YPYA 3LP0B 3RU0A 3GB0A 4ZDNA 4EI2A 4ES1A 1JJCB 4DF4A 4LMZA 2K1RA 2CNOB 2GZOA 2KXHA 3KLIA 3QAUA 5B0AA 4DG1B 2ZBRA 2YQ3A 3EZOA 5LOQA 4YY3J 5KT2A 3PKMA 2MQPA 2K3IA 3DDIA 5HBMA 4JI6J 3BYRA 1OPZA 1Q8IA 1VCTA 4JOUA 5KG7A 2Y0SD 4HACA 2KRRA 4QIVA 4PWDB 2XS7A 1X4BA 4LIWA 5E2QA 2A2DA 3CEDA 1NEEA 5L9XA 3VQTA 3VZIA 2QA4S 1T05A 1M90T 2GQQA 2MKYA 1X4DA 3KK3B 4CLUA 2B56A 5BYRA 1KSPA 1FKAF 1FJ7A 4YDXA 3G71S 2IJFA 1VRTA 4JI1J 2A6OA 3BGRB 1RU2A 4OJ1A 4F67A 1DTTB 3K5MA 1QD1A 3PR5B 5DQGA 1YTYA 2HNYB 4PPZA 5C25A 2XY7A 3DKDA 3M6WA 2HAFA 1H2TZ 1KEKA 1GTEA 1R8AA 2M0GB 2VG6B 2YKAA 1VBKA 2YWWA 2AF6A 4TU8A 3MPUB 1EKSA 1Y00A 1ZAWA 2CQ1A 3CCQS 3BO4A 3RAQA 1LW0B 2WW4A 2ZM6J 1KFDA 5K8OA 2HMIB 1KP6A 3I4PA 4DF8A 2OAUA 3MEDB 2C42A 3FZ2A 3BV8A 4CO2A 1K44A 3FKBA 1N5QA 4USHA 4CM0A 5IFMA 4XPCA 1U45A 1PYTA 2IRYA 1YLXA 3DI6A 3ENWA 4LIRA 3UDCA 5DG7A 4YHHJ 3OVAA 1W2BR 1X9WA 2VH7A 2M9KA 2J0XA 4M5IA 1HI8A 2ABYA 2FHJA 3R6LB 4F04B 2APOA 5F8IA 3OLBA 8AT1B 5CYQB 1OYEA 3K58A 1AT1B 1FRMA 2M7SA 4IH6A 3UO0A 5BR8F 2OIHA 4OL8A 1RWKB 4OYOA 1FX2A 5J1NA 6FD1A 3J81Y 4NEZA 1XR6A 1YKWA 2H4YB 5D3GB 1VQNS 1WD6A 5KAKA 4GKKJ 3A8IA 4U7UD 2XSJA 1TMJA 2RS2A 1IKVB 3R5BA 2B5JB 4M5NA 4JI4F 3HHNB 1SC3B 5I3PA 3QGIA 1RCOB 2OP5A 1R8PA 4ID5A 1O51A 4OI0A 3ILOA 1UVMA 2YKNA 4Y65A 1MSWD 4DXLA 4NZ0A 2DXFA 1XNQF 2IHR1 2K7JA 3CUNA 2CQPA 2GIFA 4ANEA 3ZZTA 2CJKA 4ED5A 2J9EA 1W2IA 1NKBA 5DDRC 4KRWA 1KVKA 1PAEX 2AJFE 3FRYA 4PPDA 2KKHA 2R8JA 2VOPA 2I0XA 1WHWA 4Q8FA 1FDNA 3FCWA 5DZ7A 1S5ZA 2ZVSA 2R8HA 4WFXA 4HHJA 2IJRA 3V81B 3CCMS 4ECQA 1Q82T 3NGUA 3QAEA 3ENAA 2N3OA 1RABB 2N7CA 2CDRB 2EKYA 4EUVA 4LREA 4B3SF 2FY1A 1JNRB 1Q7LB 2KXFA 2PEHA 5KFOA 3BJYA 2YBVA 2G0CA 2VL1A 3NOCA 3QQCD 4C8MA 1YSJA 1T9YA 2OPPA 4IQXA 2MSTA 2BW2A 3VCDA 2BJ1A 1FKPA 1UZDA 3PEHA 4E98A 4CYUA 2SXLA 3BEGB 3M6UA 1HWIA 4ZJLA 1RI7A 1XNRJ 2VDHA 2W2MP 3EM1A 3I82A 2ZFHA 2LQ5A 2VG6A 4DR2J 1V3ZA 1Y7PA 1MWQA 1PAUB 3CDUA 1E6VB 3BH7B 2DGWA 3ZFVA 4B08A 1RT4B 1P6TA 2RD5C 1CS4B 3K17A 3MEKA 2XMWA 4NYPA 4YB5A 5GAHU 1D9DA 1UVIA 1RHMB 2PD1A 2PMWA 4C0HA 2VASA 3BQ0A 5HP1B 5DM7Q 1YJNS 2Q1LA 3B4MA 4RL1A 3QRQA 2WZ1A 1NBEB 2NCKL 4FF1A 1PJ7A 1M0SA 2QGFB 2BZ2A 3IR7B 2HQ3A 3C16A 2W1BA 4USIA 4ZVRB 3PX4A 5D77A 1P1LA 2DT9A 3V81A 2QA1A 3GQCA 3CJ2A 1J5OB 2N7YA 1WKKA 4WYLA 3SFUA 4ZITA 2J0SD 4Y00A 3I5AA 1ELOA 2ZD1A 3RAXA 2C2RA 1VQPS 3DRSB 1KOOA 3DLJA 1NPRA 2JEIA 2HK2A 5KG0A 3RR8A 2QLFB 1RWPB 3SFGA 3G6XA 4P2SA 4Y2KA 1HWKA 4PRFA 1ZM2A 3PKYA 1VQMS 3L7PA 3VAKA 1H7WA 2W4CA 1DLOA 2ZHOA 4PWWA 5DO2A 5BR8J 4JYAJ 2YNGB 2RIJA 4I68A 4WFAQ 2F8MA 3P3DA 3MDFA 4OV1A 2YY3A 3W2WA 4LFBF 3EICA 4OYPA 4I1TA 1HNXJ 3L09A 3C15B 3D2WA 7FD1A 4KT0C 2MQOA 3M8QB 1XMBA 1NLKL 2F3JA 2GVZA 2QX0A 2QYGA 5BYQA 1N34F 2YKQA 4KH0B 1YJTA 4EBEA 3TARA 4QR2A 4F0KA 1C2PA 3OTDA 2VG7B 2LXIA 1FKOB 2QN6B 2M3DA 1OQ3A 2JZ5A 2WVEA 1ZETA 1DY3A 3TJ8A 1HQ2A 4CNYA 3PW7A 3BGUA 3MEGA 2AYEA 2CVEA 2CWKA 5I42B 2OPRB 4UTGA 4QU6A 3W64A 4K50A 5FJ4A 5IM0A 3CCVS 2YWKA 2UV8A 1HBOB 3GIRA 2HHPA 3D5MA 4U8YA 5B08A 1WF1A 4C3LA 5JUMA 2VV5A 5FLXU 2UUBF 5ETSA 2OEJA 5KFQA 2BKPA 4WZQA 1WACA 3CGIA 3HK2A 1RZMA 3ZZPA 3ZXWA 1JLQA 1VK3A 1RA7A 4TLRA 1JJ2R 2BX6A 2GCFA 5CQGA 4CLFA 3GV7B 1IN0A 1SJRA 4WK1A 2FLNA 2UXCF 2C3YA 1P9YA 1REGX 3Q8RB 4AT1B 4A8YA 4W90B 1HI1A 1TL7A 1JKHB 1H74A 1HHQA 2JOQA 5L39A 4GVBB 4MKYA 3AFGA 5GMEA 4NPOA 2JFDA 3J7ZT 3ICLA 1J27A 3H0PA 2KYZA 3U02A 4DQSA 1H7XA 2VOOA 2X1BA 2B6AB 1TKTB 1N52B 2QFIA 3V4IA 2C2NA 2J9CA 2XHCA 2E7XA 2WHOA 4WIIA 4TY8A 2RE1A 3OTOF 2BJ8A 1K1QA 5DGBA 2AYMA 2K3KA 1EETB 2BVZA 4J37A 5I4MA 4PWDA 1WSVA 3J81U 4HACB 2UVRA 3R8YA 4DSLA 3GYGA 4DV2J 4K5SA 1XC9A 2K06A 2YXLA 1FCAA 3HHLA 3G82B 5B7WA 2VA2A 1XWLA 2ZBCA 3DC2A 4DFJA 2BQUA 2UVUA 4RW7B 3CMES 2FJVA 1JQGA 3QO9A 3D0HE 2L3MA 4FDFA 4XTTA 2UU9F 2HW3A 1XJWB 3N79A 3HM9A 1VJWA 1NXIA 5CCLA 3SSSA 3OJUA 1ZH5A 1ZM4A 2YNHB 1FWKA 1TU0B 3KJFB 1FD8A 2Y1LB 3NAHA 3VVUA 5IWAF 2D1CA 2D9OA 2HVEA 3DDKA 2UXCJ 5IC4B 3OJSA 5KT5A 3PW0A 2DGOA 1AYEA 1R8BA 4M5JA 2LQ9A 3C8YA 3OQ2A 1T9UA 3WHIA 1JJ4A 3E3XA 1G2EA 1UP1A 3LP2B 1N34J 3VV2B 2C2ZB 3CJTA 1QSYA 3ZTOA 1TKZA 2HK3A 5ETMA 2V4JB 4QPTA 3TAQA 2UUBJ 4RW8A 2BQRA 1BY9A 3R1HA 4RU2A 3BGFA 4K4UA 5K8PA 3MD1A 4JI5J 1S1TA 1U6FA 4LRBA 4ZPCA 4QU7A 1DJ0A 1NM2A 4I6YA 4J9OA 1ROFA 1RKJA 4LSZB 5KG4A 4KHPJ 5EHHA 1X4AA 2GVDA 3PFOA 4J90A 5I3QA 3AA9A 2WAQD 4DJBA 1RTIA 5KFIA 1HIYA 1FKPB 2MY8A 2XY6A 5DZ6A 1DLOB 2RSQA 3MR7A 4R0JA 3GV8B 2DO4A 3DLKA 1D9FA 3R2CJ 3CE8A 2B9EA 4QR0A 3FC9A 1S6UA 4JV5J 3DLGB 1QAXA 1X31C 2Z2ZA 2O01C 5DS7A 1IBMJ 2HRUA 3OR2A 2CYYA 3I31A 1U0SA 4ZVPB 3KUGA 2OEMA 2VFRA 4MYUA 3O1LA 5LMUJ 5D8HB 3QGPA 4Z7YA 2HHUA 3V5RA 3KLEB 3NMRA 2W7OA 2GNKA 1S72S 4FF2A 1S9GB 1Y4ZB 4OYZA 2N3LA 4HT5A 5A8WA 3M2VA 4KKOB 5AJ3J 1M5VC 1BC6A 1KONA 4PG8A 3DU5A 3QBCA 1I6JA 1DARA 4X4RA 4J9KA 1Q86T 1QVGR 1H6KX 1SC4B 3BBBA 4Q5VA 5LL6d 3Q8SB 1IXKA 4DSJA 1VRUB 2DGQA 2HS0A 3BYPA 4NLXA 4YS2A 3RTVA 4EEYA 3EGWB 5HROA 3QWUA 1YIJS 3KUEA 3PTWA 3MPDA 2EG1A 1WKJA 4B9SA 2YNIA 1CULB 1Z1ZA 4FXWA 5DRKA 3RBZA 3W2VB 5B0DA 4GC6A 3N0VA 2AGQA 3P49B 2MQNA 4DL3A 2CPJA 2FJBB 4KV8B 5D15A 4RW9B 1SKWA 3FVYA 2QE5A 1XNQJ 2VG7A 7FDRA 5EWFA 2HS4A 1YG0A 3DI6B 1RSCA 3EXCX 4WTOB 3T5KA 2DGTA 5D4NA 3J7AN 4O3PA 3MEGB 4NA3A 3DOMA 1IQTA 1OS5A 4K4SA 2OLWA 1FI4A 4ED8A 4C8KA 1PC4A 3TR5A 3GONA 4DV4F 1NU4A 3MPYA 3TZYA 5I3UB 5THWA 4ZJQA 1X9SA 4LF4J 3FRZA 2KT2A 4USKA 1UL3A 2YH0A 2AKWB 2G2YA 3KDNA 1YRXA 3D7SB 3NAIA 2V8VA 3NGRA 4BWJA 1T02A 5G4DA 2XSJB 5IOLA 4DI6A 2IFXA 4UZBA 1C0UA 4OX7A 3MURP 2ZH7A 1YK9A 4ECUA 1GXUA 4ZPDA 3GWCA 3TA2A 5KFRA 3MAHA 2LEAA 4KHRA 2LMIA 2I1RA 5CAAA 2X3GA 4OI2A 4YHHF 2VBWA 1LOUA 3TW0A 3W8GA 3O5TB 1VGYA 4DV5J 2B4OA 1MWZA 1S1XA 5B0BA 3DGPB 4TNOA 3CJ5A 2K2PA 1RLDA 1Q5YA 1S12A 2F4FA 1CJVB 4CLPA 4DL5A 1VQOS 1DQAA 4O0NA 3M1VA 4WFYA 1R0CB 1G4CA 2HQIA 4GKKF 4RUCA 3QZ8A 3K57A 4LSNA 2XMKA 3DXSX 2FDNA 3Q22A 4DUZF 1W26A 1QAYA 4WP8A 2HS3A 1FRJA 5FDLA 2QLXA 4GMKA 3V4IB 1FKOA 1FF2A 4NYOA 3RBXA 4KY3A 1NHKL 2HVZA 3D4JA 1F9EB 4OHXA 4C0OC 4WE1B 4C48A 1GMWA 1VLYA 2CIMA 4FNIA 2ROEA 3BGLA 4FYXB 1SJFA 3M9MB 3CSKA 5B0CA 2C28A 2QLJB 2MQ8A 2X1FA 5D4LA 3KG4A 3THVA 2NZCA 1SVDA 4W4MA 3G82A 4HH1A 3TYTA 4C98A 2B5JA 1Q16B 4QIEA 3BDPA 4OHVA 4DV6J 2E5LJ 4DMZA 3S01A 4C97A 4EMDA 5HQLA 2FJWA 2F8HA 2CQDA 2WBRA 2CADA 4ZVFA 2ZOGA 1N32F 2B8PA 1KFSA 3VHQA 3LGMA 3N9UC 5SUHA 2X3DA 4N8OA 4ECVA 2A1BA 2W9CB 4YUDA 1RXOB 2R7TA 4YEAA 1CC7A 4AQYJ 2B3TB 3UPFA 1S6QB 1Z4UA 4MIWA 4DQPA 1CPZA 2MMYA 1XR7A 3BN7A 3P96A 3PRVA 1JNZB 4NL5A 3OVSA 1UJ5A 2DBBA 5AT1B 4M63A 3T19A 1WC4A 1KOHA 2A18A 3EYZA 4DS4A 3LANA 3OSPA 2CNNB 2LQJA 5K9FA 4F36A 2QL7B 2ZBIA 2HWHA 2XYGB 4O4RA 3PV8A 2ZE2B 2UU9J 1U47A 2QA4G 3BSAA 4UUXA 3UVJB 5LXRA 4C7QA 4FVMA 5M2UA 3N4WA 3DLHA 1KWMA 2D7SA 3BPDA 4P52A 4CT8A 2VJUA 1B3TA 1K0VA 2HNYA 5CH7B 3R2DJ 2RQKA 3HF5A 5LXYA 1ZTTA 1RTIB 3IXQA 4AL5A 1MU2A 2PE8A 4AL6A 5DGAA 2HURA 5LSOA 1RP5A 3GE9A 3HSGA 4ES2A 4I0WA 2X1AA 2ZHBA 2IPOB 4JI2J 3KNAA 2C2EA 3CJKB 3PHTA 4WYWA 1Q8KA 2ZH1A 1NMEB 2VUGA 3KLGB 1S0VA 5JJBA 2C1EB 2VBXA 3A1YG 4OZ1A 1MLAA 4RW9A 5LJ3Y 3C16B 3IGNA 3OR1A 3SEOA 3TANA 2V4JA 2EFVA 1X60A 2CFXA 2LXUA 3AXMA 2YQ0A 1RT6B 3CB4A 4R5PA 4DLEA 1QE1A 4EGLA 1GXLA 4N7TA 3BGOP 4Y2CA 2V8DA 4OI6A 1REVB 1YQHA 2MY7A 3C6TB 3CJ8A 3H2UB 3MAAA 3BS9A 1KQFB 4UOCA 3UVJA 4URSA 2EWHA 2MJUA 1IWAA 4B02A 5LSLA 3NG8A 1AFIA 1ZTWA 2RJZA 4ZP7A 5HMYA 1GQEA 4LFBJ 1YZ6A 4NLWA 1GX6A 2O3DA 2O1PA 2ZNZA 3NCRA 4ID8A 5C5JA 1NPPA 2ALYB 2ZZMA 3R5JB 5HLFB 4F2SA 4B9UA 2DIUA 1C1CB 1UETA 3KK2B 3RG6A 4DV7F 3QIDA 2CWXA 4Q2MA 4TYBA 4H54A 4USWA 2C3MA 2RNEA 2IAJA 1DAXA 1O6XA 4DR4F 2PMZD 1SJ3P 2H9ZA 1T11A 2UUCF 3CCJS 1WC1A 1B99A 5HMXA 4BWMA 2DR8A 1RWVB 4BC7A 1PSDA 4LT6A 1LEOA 2MKKA 3BM7A 4ED3A 3UCGA 3EJMA 1SPBP 4OI3A 5M2PA 3CMQA 2OSQA 4GKJF 3PW4A 5T14A 2E1CA 4X2BA 3AB4B 1KHWA 4URGA 3F73A 4QOTA 3JTPA 3V6DA 1HMVA 2B4UA 3HZEA 4B3RF 7AT1B 2DNYA 1LWEB 5DDOC 3ZTPA 1FESA 4LJMA 4K4WA 3HHLC 4P7VA 1L5UA 3QATA 2PO4A 4LF8F 5C25B 1IKVA 4CYUB 2QZ8A 2QC3A 2F5GA 2YX1A 5KFFA 1O5JA 3HCXA 3KLHB 1NK8A 1GTHA 3JS9A 3DNCA 4LF1A 4OX6A 3JAMY 4X4NA 4RW4A 1C0TA 3M30A 5JMNA 1F3VA 1S1UA 2AQ4A 4K4VA 2AEFA 4OYIA 3QMQA 2UVWA 3KJQB 1RTZA 3EXYA 1JLFA 1WF0A 1KTVA 1NH8A 4R0EA 3HT0A 2E1RA 2FHKA 1U7LA 2V63A 3AHPA 4HDGA 3CJKA 4ECZA 3ZZOA 2Y3YA 2B6AA 3CCUS 2O5DA 1B7FA 2X1GA 2B4PA 3C6UA 3HZGA 2KH9A 1S57A 2DNOA 4WP3A 3QFHA 3T5HA 5EWEA 2XC9A 1GXTA 3TAMB 2C2KB 2KFZA 1NZAA 2GJ2A 2KZZA 2J7WA 2DXDA 2LLZA 2K7KA 3U1NA 2YWFA 2H1YA 4J9RA 2XTJP 2MB0B 4PCQA 4DV0F 3D1OA 4WPAA 5HMZA 3C46A 3AA8A 3ZZ0A 3CCWA 4ANDA 3QT8A 3NKYA 2GHVC 2GAHC 2BACA 4ZLPA 1JXLA 1X5SA 4JV5F 4NXNJ 4LRDA 1CBKA 1PJ6A 3RW7A 2MJNA 2ZH4A 1I94J 1GEHA 1PYSB 2KN4A 3GZ7A 3W63A 1HI0P 1HYSB 1VQ6S 2HHVA 1EX8A 2YNFB 4X4OA 2VPXB 4BS2A 4OHYA 1WJ9A 5A0YA 2CJ9A 2G0IA 3ONQA 4O0IA 4C6AA 4OFZA 2B7BB 3P4UB 3DOKA 2DGUA 1YBTA 1KD1T 4I67A 1TKTA 3IN5A 4KAIA 1A9NB 1VJQA 3V4MA 2MKHA 2GA7A 5FD1A 2HRTA 3HVWA 3J80U 1RACB 2FHJD 3MM7B 4LVOP 4QYRA 4YQWA 3KHRA 3BSNA 4V19J 2VKRA 3PM9A 4DUYJ 4K0KJ 4UW2A 2C3OA 2MKSA 4JI2F 3CCRS 3IBFB 2EPIA 2IA0A 2E44A 1C1BA 1P9QC 1SKRA 1UPPA 3GFXA 1DTTA 2MQLA 2KO1A 3KYLA 1M1HA 5F9NA 2HBZB 2XHWA 1VRUA 4ZPBA 4DEZA 3JQJA 1GX5A 2JHEA 2WVBA 6FDRA 2MHEA 5D0EA 1YJRA 3OV7A 3MAQA 1U09A 1UVJA 1VK8A 3MFHA 1VIXA 3A8KA 1FTRA 5B09A 3JAMU 1QAJA 3MMAA 2J0QD 1NK9A 3QJLA 5JVGQ 4OHZA 4DU7A 2E66A 2ZKUA 3FCVA 3M1VB 4J9UE 2K1RB 2O67A 3LP2A 1NSPA 2WSFC 2CA9A 2RQMA 4AFFA 2G13A 1HWJA 1GH8A 1EJ7L 2BUNA 5HBMB 3C14B 4ZLNA 1N0VC 3SYZA 3AB2B 4O23A 1OPIA 1N4LA 3NL0A 4DV3F 4Q44A 3U27A 3M2RB 4HYKA 2OO4A 4MFBA 3GIMA 3LF0A 3O8WA 5IV3A 1NHUA 4P6QA 4ZA1A 5L46A 3V6JA 1S9FA 3H42A 3RB0A 3KFWX 1QAIA 2CQIA 2VQFJ 1ULRA 4WP9A 1FWPA 1RHQB 3C19A 3H40A 4DV6F 3RRHA 1SCJB 5A8KA 3I4HX 4HI1A 4LBHA 4QW8A 1JIHA 2HQCA 3GU0A 4ED4A 3K2YA 1Q78A 5DM6Q 4LRCA 1QVFR 1K47A 2F4VJ 3W3SA 1RT2A 1U1OA 1SH0A 2J6TA 2QT7A 3LGHA 4PUOA 3UQSA 2Z4PA 3G6YA 4USJC 4DS5A 4LFAJ 2R8IA 2AWZA 4EZ9A 4J9VA 1RHUB 3NLCA 2BXJA 1TKZB 3G86A 3SQGB 3SIPB 3SXLA 4DHVA 1FJGJ 2LDYA 1RHJB 4OYAA 2Z2MA 1AUDA 2MGZB 4ZJOA 4IR9A 3OHAA 4IQMA 2GIQA 3T1HF 4NA2A 4DR7F 2VF3A 5HN0A 4JV0A 3S1TA 2F9DA 1FA0A 3PRBA 2HYIB 4LRFA 5KG1A 5KFEA 2VODA 1RBLA 2BOPA 2IBOA 4DPTA 2WB1D 4ICLB 1D09B 4RW7A 2CPZA 3BBFA 3TRGA 1YWXA 5HQ8A 5HMWA 4DFMA 2V4QA 4DV0J 4Y6IA 2BE7D 4BDPA 1JXEA 1YBUA 2DHHA 2AV5A 1R7IA 3FGVA 1X5PA 2F63A 3K59A 4XO0A 1UJ6A 4NCGA 5KFPA 2KVQE 2QTWA 4I7FA 3L3CA 1R31A 1B7YB 2XS5A 5FIIA 3R9LA 1JLCB 5IXUA 3Q0AA 2DEIA 4JI3J 3EPIA 1S6QA 1HD0A 2Z57B 4QW9A 5B0GA 4C11B 2LECA 4CLKA 4USTA 4IFVB 5KFYA 3CD5A 2B9YA 3D68A 4AXIA 4PQUB 5AE3A 1DFDA 2BANA 3OL8A 2BMBA 2Q66A 4QIFA 3MPVA 2ZHAA 2GV1A 4QIGA 3W5ZA 2W2OP 1UWAA 2DCLA 2OKQA 2RF2A 1VMBA 1HW8A 1BUXA 1WEYA 4M94A 4P9SA 4IH7A 3W60A 2EC0A 2ZH3A 1BXNA 2HBQB 3BKFA 3OFEA 1LW2A 3WDOA 3CO9A 4CNZA 4ZCMA 5AE2A 3EPGA 1XMQF 1VR6A 3OW2R 4UY85 2Z56B 4I6WA 2JVRA 2LP4A 3AQPA 1V5IB 4UF4A 4LR9A 3TVKA 1V6HA 2R7QA 5EGYA 2VIHA 2OUGA 1TL3B 1U1QA 3QT6A 2I8EA 1NZ8A 1N6QA 1CJVA 1SUQB 1TMMA 5J2PA 3I56S 2ASYA 2CXEA 4NLTA 2DR9A 5KFDA 3O6QA 5E3CA 4DV1F 1KQKA 2OHDA 5HVFA 5H9EJ 4USUA 2L9WA 2QA2A 4IYQA 3WC2A 3MEEA 3QJPA 1BQMA 2EC2A 3GSIA 2QMUB 1ZZNA 1EIYB 4EU0A 2XLIA 4MIAA 2UP1A 1L3KA 1NCLA 4H4MA 2JFKA 3QWPA 3US5A 4D3HA 3JQKA 4A8QA 3A12A 2RILA 1PIEA 2CQCA 3H5UA 2IMOA 2HGLA 3T3FA 2C22A 4DOZA 1FJEB 3MCSA 4XPEA 3L9ZA 1YGYA 2FLOA 1KQGB 1VQ4S 4RWWA 2RS8A 3HHLD 3UW1A 1PG5B 2HEKA 2AJ1A 1RTHA 3AAWB 3MM5B 5G0RA 4CH1A 3OFGA 4I69A 4P71A 1VBXA 3SCKE 1K73T 5T41A 3PY8A 4IOAQ 1T0TV 1RAAB 3ULHA 4B3TF 2A0FB 3CD0A 4B3TJ 2GHPA 5H9EK 3CIZA 2HKEA 4DX7A 5KT6A 2IAJB 4MK8A 5AXLA 2KU7A 3FCHA 4PR6A 1JLFB 3DOKB 1H2UX 1JXVA 2V9KA 1HL6A 4XDCA 3ZTQA 3D0IE 2VZ9A 4ZCLA 5C24B 4DG1A 5HP1A 3HD2A 3Q24A 3LP1A 3LQVA 3ZTRA 2IA6A 1KKHA 2DNHA 2LEPA 5D4OA 2PFFB 4DX5A 4PKDB 2I5JA 1DZ5A 3HT3A 1BGXT 3CIMA 4NLOA 1D1UA 1B0TA 2IJNA 3E51A 3IS9B 4A48A 1LK5A 4URQU 4ZK7M 4LSLA 4M5DA 2M5YA 1NDLA 4UQGA 3C6TA 1UCNA 2V67A 3MAAB 2WCXA 2UV8G 3TJ9A 1FVSA 5A8WB 2QEXS 2VA3A 1RYSA 4EYHB 2FTRA 5KG5A 1NK4A 4F0HA 3IWXA 3UI3A 2H5JB 3OFHA 4DUTA 5E3AA 1RTDB 3B6BA 5HQMA 5D3GA 2OPPB 2J6UA 4Q0BA 2W2PP 2ACYA 2RMLA 5E3QA 3F44A 2IY5B 2V0NA 2AMCB 1CVJA 1NJWA 2BJDA 2DRDA 2ZH6A 2RHSB 2CJXB 3TUJC 1KR4A 1LXNA 3BR8A 2HQGA 3ELHA 3IR5B 2JX2A 1F5CA 1TL4A 2W7AA 2Q3PA 3QNWB 2KTQA 2HVHA 4ELUA 4CI0B 5D0GA 4J91A 2ZNYA 5KFHA 3T9NA 5GAHI 2DNNA 2E1AA 5KFWA 2GO9A 4LSNB 4ECRA 1KLNA 4KFBB 2M8DB 2CPDA 1JJHA 4CO1A 1U02A 4ILRA 2KT5A 3MM6B 3QSIA 4OJ3A 2HHWA 2FIUA 3VR1A 2RAQA 4WWSA 3THTA 2YWEA 2WONB 1JLEA 1RADB 3DHWC 3KG1A 4H4MB 5DDPC 4RU9A 4U96A 2JLGA 1P8GA 2RF2B 3NGSA 5EUHA 1LWEA 1FXRA 4CO5A 3BKTA 9RUBA 2CDQA 4QQBA 1U1LA 3SMZA 4YR0A 4DZDA 4R8UB 3G2XA 1HA1A 1NJIT 5HJYA 1N8RT 4B3MF 3Q2TC 2I38A 1MMDA 2OFGX 4MK9A 2P2CB 5KFNA 2DH8A 2IDLA 4DX6A 4WJBA 4FS1A 2NPIA 4M8LA 5J2MA 4BBYA 3AOBA 2BJ9A 1BLUA 2CPIA 4NCGB 4ZPTR 3G4SS 3KLGA 5J1PA 3X1LB 2HGNA 1N6QB 3JTOA 2AHOB 3NEKA 2HIYA 4RNHA 5A2QU 1KLMA 2DGVA 4DL7A 3N5FA 4I2PB 1U6BA 5J1EA 2RDDA 1SQFA 3RZAA 3HO1A 3CMAS 4HTIA 1KRPA 3UWTA 1MW7A 4QCLA 2ZZTA 4OYMA 4X4QA 3DMJA 4DR7J 2HFVA 2F1FA 1UJ4A 3W9HA 1UTAA 1ZBTA 1LXJA 1YI2S 1HNXF 4G3IA 4C8ZA 2Z2LA 5GVQA 1PO6A 2WW8A 1IBKF 3MUVP 3CDBA 4DR3F 4NI2B 3SDEA 2DNLA 1WDDA 3HHLB 5KFUA 3G6VA 4YR2A 1Q8BA 3AJ2A 1R0AA 3W65A 1QTMA 1HQUB 4U67Q 2HFOA 4NZ6A 4LF4F 1LWCA 4ZN1A 3E01B 2CKWA 4KTQA 2NSCA 3IC1A 1Y0HA 4TQRA 1TFYA 1WTFA 1VQ9S 4GO5X 1OY6A 2ZVIA 3HSDA 3LH2S 2R7WA 5GADU 2OH2A 3KMSA 2E9TA 4A8SA 4DR5J 2NXNA 2HBYB 3D6MB 4NLRA 2NLWA 1FX4A 3MEDA 4ZLLA 4CIOA 2BQ3A 1RHKB 2FY8A 2FVQA 2CPHA 2JEJA 3H20A 3P6YC 2YTCA 1HQEB 5H9FJ 4F50A 4OZLA 4DR1J 2XI2A 2R3VA 4K4YA 3DLLQ 2FC9A 2J8AA 3FSYA 4DLGA 3JSMB 4W98A 3HJFA 4DCPB 4EO6A 2HHTA 3JTNA 4HT7A 3UNGC 2MYFA 3H25A 1CQNA 1J2VA 2LU2A 4O3OA 1U25A 1FE4A 2OD4A 2DPJA 2CQBA 4K4ZA 3NOGA 5I3UA 1VRTB 1XNRF 2XWYA 3AT1B 1W7WA 2CPFA 3AD7C 3CT9A 2XM3A 2GVDB 3NGKA 4F25A 1CJTB 1U1PA 4HR2A 3KK1A 4ED0A 1HNVA 3CDEA 4KGKA 2EFQA 3H2LA 1M5KC 1QJHA 5IT0A 2R4FA 2ZEJA 3LWLA 4PUOB 4TU9A 1TL3A 1DTQB 4F4KA 1EQ0A 3CXCR 4L3NA 1RJJA 1IBLJ 2XMMA 4UOFA 4FYVB 2RDIA 1AROP 4FN5A 1Q1KA 3KDOA 2HHQA 2UUWA 5E41A 1D9AA 2V94A 1RTJA 2AZ1A 2Z30B 5LMUF 3W7BA 3N5BA 1HNIB 3LUYA 1F5AA 3QGHA 1T94A 4P2XA 2YPZA 4PG4A 4JB8B 4ZP8A 2XO7A 1O0PA 1B4SA 2DRAA 3PYGA 4MAKA 3B82A 1CC8A 1C1BB 1VS3A 1YZ7A 1IJFB 3ISNC 3M6XA 4YB7A 2Y8YA 3MR6A 2NSBA 3FEYB 3IRWP 3DU6A 3R5CA 4FPIA 2LXFA 2HPUA 2H54B 1C4AA 1PJ5A 3D28A 2CQHA 1ZPVA 5F41A 3VQSA 2AX1A 2GX8A 2NS1B 3RAMA 1UWBB 2RU3A 2ILYA 1L3UA 2R8GA 3LWMA 2DNZA 1OY8A 4FYYB 2HRYA 2OPSA 3GP9A 1SIZA 2JC1A 3THPA 2VFTA 3D3BJ 3MM8B 2MZ1A 4L72B 4WXWA 3M9NB 4PABA 2XBPA 2W9CA 3HHEA 2RB7A 5F8MA 4W92B 2NR0A 1H98A 1OSCA 1RISA 1JLCA 1UEKA 2CQGA 5ETVA 3AY0A 2IVFB 4XIUA 3D6TB 4EYIB 3M8RA 1RWUA 3E8OA 1NPKA 2AJ2A 2PFDA 4M5GA 4PQAA 4DU8A 3H4BA 3I0RA 1M5PC 2YWHA 2CG8A 1XMOF 2FVRA 3NBPB 3FDSA 2J9DA 4A47A 2VFSA 3QYYA 3KTQA 1S9EA 3ITHB 2FVCA 1G6BA 2OELA 3BSOA 3AJDA 1T3OA 4LSLB 1HARA 4M5DB 3FZBA 3I6PA 1QUVA 1HMVB 4EBCA 3BGRA 1U26A 1NAQA 2ZC3A 1TTHB 1ZOTA 4ED6A 1X4HA 3AOCA 4A46A 2BR0A 1MN9A 4A8WA 3RB4A 3DLBA 2CZ4A 4DV2F 4QYZJ 4WZMA 4JI1F 3HKZD 4ZPAA 3RRKA 1B64A 2D41A 1QUPA 4YR3A 2AZ3A 1I51B 4I6AA 4WU2A 4ZVEA 2MLXA 2WVDA 3FBBA 2VBYA 3HFZB 3GJQB 5J2MB 4N56A 3L95X 3OTOJ 2XLJA 4KC5A 4FBUA 1GMUA 1S99A 2X51A 2U2FA 2CZVC 1RA6A 2Y0BB 3NY0A 4K5RA 4OQJA 4MT1A 3ZO7A 3KHGA 1IR2A 4L73A 4TXSA 2VG5B 3WQPA 4B9LA 4LF5J 2QJ3A 3QRPA 4RNOA 1FEEA 3DRPB 1RT5B 3IGVA 4CTAB 3KHLA 2C3PA 1Z2LA 1XERA 2NYHA 4DR3J 2P6TA 4M5KA 1VI7A 4KJIA 4X4TA 4PZVA 3ENQA 3HX9A 2AYBA 3ITHA 4MTPA 3SCIE 1REVA 1T9VA 2QL5B 1WELA 3CDWA 3PR4A 2B9XA 3IA0A 1R8CA 1Y3KA 3W9JA 3OXLA 2LYVA 2IRUA 1KS2A 4OIXA 4OZ5A 5ITHA 4NCAA 4JP8A 1NSAA 1VQKS 5F8GA 3DYAB 3H59A 4EO8A 4ED7A 3PYFA 2B7CB 1TV6A 2EK1A 1WHVA 3N6MA 4LUBA 3NCPA 1NB7A 3MCNA 2XNQA 3KJNB 4ATNA 1SUQA 3ILLA 2VFUA 1B0PA 5J2PB 3FSXA 2COLA 3FMBA 1VQSA 2Y9HA 3FK4A 2RRBA 4MK7A 3MR3A 3PJWA 3QIPB 1VFJA 2HZAA 2JNJA 4QWBA 5IV4A 3GPAA 3VGSA 3CCTA 3MMCB 3FFIB 4NYZA 2AP6A 2RDJA 1L3VA 2W9AA 3R27A 3KXDA 1D8YA 1U2RA 2R9LA 2XMVA 3IRXA 2VPZB 2KG1A 1SIWB 1U24A 1S97A 1VC6A 3D66A 4ZVSB 2FGOA 1IM4A 2RRNA 3MMBA 5DG9A 3MUMP 2NYIA 1TQLA 2FVPA 2BW7A 2J9DE 3P45B 1YRTA 2DY1A 2GC8A 3KKFA 3B54A 1TAUA 1KVIA 2HZCA 2PA3A 4N5SA 3OTEA 2NQPA 1H3DA 1Y5NB 4O3NA 2DJWA 4ILLA 1URNA 1Y3JA 3DOLB 3JYTA 3QT5A 1IWGA 2HNZA 5BJRA 1J5EF 3BPSP 2VC1A 1M5HA 2XZDB 5KFGA 2E9RX 3RB6A 3AXKA 4F8RA 3U1MA 1S59A 3F41A 4I7FB 3GJRB 4FYWB 4BLGA 3HSZA 3I5CA 2HVDA 4ZPWR 4A4JA 5B0FA 3CCSS 3V6HA 5DQHA 1S79A 4XAKA 4E8UA 5D6GA 8ATCB 4WCEQ 5LT5A 1HNZJ 3M2UA 4Y2IA 2MSSA 3MCOA 3GV5B 2VFVA 2XQCA 2QG9B 2KI2A 1RT7A 2HQFA 3DM2B 4F3MA 3TZZA 4X4PA 1F9HA 4B9TA 2YKPA 3AD9C 2LDIA 1EZZB 2V50A 3DRPA 4OLOA 2MPUA 5D0RA 3EX7B 1SL2A 5A6WA 1A0OB 1VISA 4C8LA 2V2KA 1M5SA 4DR2F 2O66A 3JQMA 1RAIB 4ERDA 1ZAVA 2V8HA 3UD5A 1S77D 4Q45A 2FJDB 2GJIA 5J2QB 2DISA 4J5OA 3G8SA 2W01A 2ZWOA 1UFWA 1RT3A 2B51A 2HGMA 1MN7A 4HHUA 3I0SA 4NMXA 1IM6A 4P75A 2XMAA 4AQYF 4CLSA 3LALA 3UCZP 2G1HA 1FTCA 4QWDA 1NHVA 2M2BA 4F3OA 1NJZA 4B3SJ 4HI2A 1OY9A 2IBKA 1WNEA 5LSRA 4K2JA 3RJMB 2Z8QA 4IOCQ 1VBYA 4AXJA 4LQ3A 2JL9A 3TZXA 1F2HA 1NUEA 2W24A 1RWNB 3R5GA 3FSIA 3S6EA 4Y3CA 5C2CA 4CWBA 1HFEL 2H3EB 3Q89A 2OGUA 1MMLA 3H7HB 2RKIB 2DNRA 1JLAB 4NZ7A 3HPOA 5L1JA 3V6KA 2CNKB 3CD7A 3DXBA 1CQMA 3BO3A 1AZSB 2CPYA 2LU1A 2MXYA 1P27B 4Y34A 2UUAF 4BCAA 3GCXP 2BJ7A 3D1HA 4DN9A 4QZVB 3ETOA 4FPRA 1U2CA 4U6PA 2BANB 3TX0A 3P5BP 3WIVA 2MEWA 3BBCA 2WSEC 4GRSA 2CRLA 4NLGA 4GVLA 3OLAA 3M2VB 2GMHA 4KKOA 5B0EA 3K0JA 4JI4J 1NK5A 3PO5A 4RBTA 1FJCA 4RW6B 4WK3A 2DNPA 1S1WA 3J7Z5 3IG1A 3DRRB 4G1QA 2C2DA 3QZ7A 1T9WA 4J9PA 1R43A 3DOLA 4O44B 5T7LA 1IKXA 4KQZA 4JI0F 5KT4A 3VGVA 3TJAA 1CJKB 1WEZA 5HI7A 1RAEB 2VHGA 1TV6B 3TVYA 4Z2XA 5L1KA 1N36F 2ZJRQ 3G87A 3KK2A 2J76E 2LEBA 2CG4A 4JV2A 4KV8A 2ZKTA 1SBRA 2AJ4A 2CZ9A 2QO3A 2XMUA 1OMSA 4P73A 3PIPQ 2BJEA 3M8PB 4DPOA 2N82B 3VAGA 2DO0A 2WTFA 3AODA 1JLGA 1WWHA 2DHAA 3UE2A 2ZM6F 4X84A 1AZSA 4P7TA 2RQ4A 4FXVA 1RT5A 4YN3B 4CTAA 3WX8A 4K4XA 3IM8A 3MOJB 3VGTA 2R2TA 3DMJB 4MKVA 2NXJA 1RE1B 2EFGA 5KFKA 3M2RA 4RR5A 3UDLA 1JLQB 4N41A 1IJEB 4BHQA 1N88A 1VQYA 1LFWA 1JLBB 1FWLA 1SV5B 2ZH2A 4JI8F 5K14A 2J7UA 4MIBA 3TVZA 4DCOB 4A8FA 1CJKA 3FBCA 3OL9A 2YKMB 2F9JA 1WF2A 3CO0P 2KDOA 2XS2A 1RT2B 4NLVA 4OZ0A 1ZZFA 4OI1A 4YB1P 3PX6A 1SL1A 1X7VA 1S1XB 3GFYA 3ZZRA 1PILA 3ZTSA 2DY9A 1C0TB 1GK8A 3M30B 4DL0C 3HKWA 2OD6A 2YVSA 1OJ4A 2LKZA 4V19X 2OMOA 2FZGB 3HVTB 3ZZYA 3J7YI 3NRBA 5GADI 3CCES 4IDKA 4ZVQB 3GCWP 4YY3F 3T6JA 4O4GB 4M95A 1S6PA 1XR5A 3T6BA 3R3TA 3ILJA 2E29A 4F7VA 1UA1A 2OTLS 2VD3A 1N0UA 2UXBJ 2QMXA 2RQCA 3M6VA 3Q23A 2J0WA 2JC0A 2Q6CA 3IMQJ 1UA0A 2WRMA 2JEGA 4LRAA 3KK3A 3GG1A 4C8YA 1RWWB 2HFNA 2ILZA 3EMTA 3P5TL 4JV1A 5GAGI 4IFYA 4JI0J 5KFZA 3NWRA 1XEZA 2QMWA 3H90A 4YB6A 4F26A 2JWNA 5LJ5Y 2BE2B 5JXSA 5MLCV 5ETKA 3VVTA 5KOXA 4DV7J 1HBMA 1CLFA 5T7LB 1RT1A 2J8SA 3MECB 3MM8A 4NWBA 2DNGA 2GHWA 1IBMF 2P9EA 2QV6A 5LMNJ 2YNIB 2FC8A 4UY8T 1SC6A 1S0OA 1V3RA 4RO0A 2WSCC 2WB4A 5A0YB 4U95A 3T5LA 5ADZA 4LF7J 3F0NA 3DHXA 4USVA 2ASDA 3G8QA 1T3NA 4FNHA 4EWTA 2HMIA 2VPYB 2OEKA 2J6SA 3IBWA 4OI4A 5KFBA 1B0VA 2DR5A 1J5EJ 4E0DA 3OXGA 2LCWA 1T9TA 3NBPA 4C0BA 4LF7F 1VHIA 1VC5A 1T03A 1LFPA 2CVIA 1APSA 3A4TA 3MMBB 1OO0B 3CVKA 2Y1RI 5KG3A 3NNAA 4PYDA 4UOGA 2R7UA 4JI5F 1ITPA 1CEZA 2PT0A 3V6DB 1XK8A 3EVMA 3P8BB 4V1Ak 4O3RA 1HBOA 1NK0A 1SL0A 3MTJA 1BMQB 3ET6A 3CJQA 4N8NA 4Y2AA 3VZHA 3CC7S 2XNRA 2GGPA 4UZCA 1Y5IB 2ZJPQ 2VC0A 2ROGA 4OYBA 3ETMA 3H4DA 2ZH8A 2D74B 3AQOA 2CQ0A 4IFYB 5L8RC 2HHHF 3PDNA 2JEFA 2YKMA 3VF0B 5IWAJ 1XMQJ 3SQOP 4O44A 4DSKA 1HBMB 3DGPA 5IT9Y 2IDEA 4K59A 2Q79A 4Z7CA 1DQ8A 4OZ2A 1RAFB 2JLFA 5IT9U 1BWEA 4JI6F 3T1AA 3T41A 1HHTP 2DVIA 1RT4A 1QDUB 2OFHX 3OSNA 5DQIA 3T1YJ 4QBUA 5U47A 1U49A 5C7PA 1N54B 5IT4A 4WFNQ 5KFSA 4HLBA 1SKSA 1R8HA 1TUGB 2EXUA 2MQQA 2KM8B 2H5EA 4RNMA 3K5NA 4DL6A 2RRAA 2AGPA 1RT7B 1UAWA 4RUHA 2FHMA 4ECTA 3I32A 3I9ZA 1S9EB 1NH7A 3DDNA 3KMQA 3MXHP 2UXBF 1RAJA 3BQ2A 5CYQA 3OL7A 4RX6A 4TLQA 3HLUA 1HR0F 2DR6A 4PG7A 2D3O1 4QIWD 2AEJA 1U48A 4ZN3A 1IQZA 4M1KA 1RYRA 4IUFA 2FD2A 2HNZB 3AH6A 3D0GE 2EFNA 2GW8A 1ACMB 1TK0A 2YX7A 1AFJA 1CULA 3W2VA 4YFUA 3RRGA 3AJ1A 3PW2A 1WC5A 2E5LF 1KVJA 3A3OB 1TR0A 3H8YA 3LA0A 3JSBA 3BKUA 1TKXB 3TQ1A 3NNCA 3VAFA 5F8NA 4NXMF 3RBDA 3DFEA 4HVZA 4OX9J 3W9IA 5IQ6A 2VU5A 2A2CA 4YP3A 1SKUB 2LVWA 1FFGB 2W4PA 3O2IA 4HL9A 4O4GA 3UDVA 3HMJG 4KIAA 2PDAA 1EAYC 4P72A 1FRKA 3CW2C 3JSMA 4DFKA 4K7QA 1FDBA 4TY9A 2ZOMA 2G1DA 5E33A 3AOAA 5F8LA 3LPYA 2QLBB 4ZP6A 2PI5A 4ITSA 5AE1A 4FYDA 4MKBA 4WKYA 3IAS9 5EDWA 2B43A 1BQNB 1Z2ZA 3J81j 3A3PB 2LA4A 4G65A 2OPSB 1Y5LB 3IG1B 4G1QB 4PG5A 1WC6A 1XMOJ 1T8EA 1UKUA 3VAHA 3I96A 2ASJA 4DZ6A 3RUBL 2HSEB 1RT1B 1AA1B 1S7IA 1F3FA 2DTJA 1KHVA 3VTIA 1SC1B 3LP0A 1N36J 1URRA 5ETLA 4AL7A 3RB3A 3QSYB 3OR2B 4Q8EA 2W9BA 1FRXA 4JYAF 1CS4A 3KLIB 2KXNB 3DLGA 1S7HA 4QR1A 3WC0A 3MM9B 1K8AT 5KFMA 2YKOA 1LWFA 2H48B 4M5LA 4PXCA 1JLGB 2P8IA 4PXBA 3D9BA 3MZIA 4H4KA 1LV5A 1D0EA 3UFCX 1NK7A 4R5PB 4RLEA 3H5XA 4WKRA 1FDDA 2DB1A 1ZS6A 2PN6A 5IM0B 2EKNA 2ZE2A 1IBCB 3OT9A 4PXEA 4CT9A 2OSRA 5KFCA 2KFYA 4ELTA 4J9QA 1TFWA 5ETNA 4IRKA 3MR5A 3NCQA 4K2XA 2VQEJ 4IG3B 2B8QA 5A8RB 1Q7YT 2E9ZA 3DLEB 2FHOB 1RWMB 2RHQB 4C9DA 4HEA9 2JLEA 5RUBA 1DTQA 2PEBA 1H38A 3Q8YA 3A8JA 4X62J 4OJGA 3SCJE 3W2WB 1K9MT 4AE5A 4ETXA 3BF4A 1LW0A 1RK8A 4J9LA 2Y1JA 1UPMB 2FUG9 4B3OB 1FK9A 2BEFA 3PJXA 1RWXB 2DHSA 2PC6A 3TEHB 1SH3A 8RUCA 1HNZF 4B9VA 1CSJA 3HJVA 4RUAA 1HBUB 3RBEA 5AJ3F 4J9NA 1BHNA 3NWGA 2HVIA 3M8ZA 5CYJA 4DR5F 2FYXA 2ZBPA 3RYLA 2ADCA 3ENVA 2MZRA 4M5MA 5IQQA 2EI5A 4ZCIA 2L9NA 2NXCA 2H5IB 1U1RA 2L48A 2VDIA 2G2OA 3R5DA 5GAEI 3JSRA 3PZPA 2R7XA 2IM1A 4KPCA 4UOHA 4DL4A 4U7CA 4C8OA 1F6TA 4N47A 4PAAA 4F3QA 5L9NA 4FXDA 1S10A 5KFVA 2BE2A 3BSCA 5D4PA 3CF5Q 4HTJA 4CH7A 3SV3A 3NS7B 1WOPA 5FLXY 1RBAA 2W4DA 4DSFA 1FE0A 1TP7A 3SCLE 4L3KA 2V4RA 1S1UB 4MMOA 3MMAB 3PRDA 1JK9B 4FP9A 4RWXA 1IVZA 2D69A 2QYCA 1T95A 2YNHA 1DQ9A 2UVVA 1XIQA 3EE3A 1WC0A 3OHBA 4A8MP 3Q8PB 4KHPF 1I3OB 4L6V3 4OZNA 1XN9A 1G7CB 2ACMA 1QSSA 3FBEA 4ALZA 2V34A 2XY5A 3LP1B 1M1GA 2MZSA 2IVMA 2E7VA 2IRXA 3IM9A 4I56A 3CJ3A 3TUIC 3R6GB 5F3ZA 4X64F 4LF9F 1HLWA 2LQBA 1KN6A 3QGGA 4OV6A 1S1TB 1N5TA 2HNDA 2B0GA 4KH1B 2MZQA 3X3UA 3N28A 4CLLA 1WDTA 2GO8A 3U7JA 1U0HA 2RH3A 2ATLA 2P9GA 2X7IA 2ZC4A 3K89A 3R1LA 1Q53A 2H4WB 2DNMA 5KOWA 2IYGA 1WG1A 3Q83A 1IKXB 1A7GE 5HAOA 3CPWR 4DFPA 2R8KA 1VRQC 2M8HA 3EGNA 1WHXA 3M8WA 4R8UA 3HP6A 3GJTB 1C4CA 4RW4B 1S4FA 2H65B 5CCMA 2AIRB 2RUGA 2OTJS 2XB2D 4K4TA 2DGXA 4LF5F 2CJAA 2HLTA 1G1XA 2A3JA 3SI8A 4EFAC 1GT8A 3PHEA 5GMKa 5ETQA 3DM2A 4B3MJ 1AUSL 3MM9A 4NMLA 1HBUA 2FLPA 3HD1A 4ZMMA 4LBPA 5DETA 2IIHA 5CABA 3EUNA 4KPYA 2DXEA 2R7VA 3PG9A 1VIOA 2A6MA 1JLEB 2ZDOA 4X66F 2GQ2A 4RJVA 4OZ3A 4O3QA 3TNVA 2ZUAA 2E1MC 4E2FB 3QLHA 4LF2A 3RR7A 3IWNC 5C42A 5GAEU 1WUUA 1ZM9A 1OQ6A 3PYEA 3Q8UA 5K14B 2DH7A 3VALA 1JLBA 1UW9A 2ZZNA 1HWLA 1Q95G 4U8VA 5D0HA 4ZVHA 4CO3A 4DV1J 4QWCA 1XTZA 1R6YA 1TL5A 2W2QP 3MOZA 3BZQA 3KLVA 3T9ZA 3QJJA 2QL9B 1HNVB 1YJVA 2KFNA 5ETPA 1Q5VA 4J9SA 3M8QA 5SZTA 4DWIA 3BDEA 1EB0A 3L7UA 2GQCA 3KNGA 1UFLA 2MZTA 1MMNA 3UNYA 1NNDA 3WX4A 3ISZA 1RAHB 3KJVA 3SV4A 1VQ5S 1GMVA 4JI8J 3EGZA 3CCLS 1PGZA 2FPHX 2XEXA 5KT3A 3OL6A 3HI9A 3PYDA 5BXIA 3FFIA 4F4WA 3ZC4A 3PVXA 1T03B 3HFKA 1HHSA 3TA1A 1HNIA 5J1EB 3UN2A 3MM6A 2ZH5A 4DSIA 4ZIWA 1QE1B 3L4BC 3IRXB 3IS9A 4KB7A 4C3MA 2BV3A 4H4KC 5GAGU 2MKIA 1SXLA 2FZCB 3EDRB 3O44A 1N5VA 4LFCF 3CULA 4HHHA 1IKWA 3NNHA 3PNIA 1VOMA 2P9CA 5C2GA 5F0UA 4CLZA 4Q2LA 4DR6F 5E5NA 4MYTA 4X65F 3FMWA 3LTOA 4IG3A 4IH5A 1X4GA 1BQNA 3MECA 1RTHB 3B78A 1RWOB 2BOAA 4KGMA 1NJYA 4TYAA 3KK1B 3FBFA 2Z58B 2AEMA 1LK7A 1FNMA 2M70A 2N4CA 2FB0A 2Q6BA 3C15A 4NA1A 3S8SA 3GIKA 1HNWF 1R3NA 3DN9A 1FRLA 2AJQA 1LQ9A 1MROB 1TAQA 3HXMA 2ZJQQ 1EP4B 2WOMA 2VKZG 4ER8A 1JX4A 1TL1A 3GTYX 2FQQB 1S0NA 1CJUA 2YQ1A 1LWFB 3IBCB 2MDAA 3MF5A 3K5LA 3MWBA 1IBLF 2AJ0A 3MEEB 4OLPA 2F40A 3GIIA 1VQLS 2JJ4D 2Q43A 3EZUA 1QSLA 3W1YC 2XCAA 1WI8A 2KHDA 4DPWA 3GYXB 3POTB 2UXDJ 1AB8A 1WG4A 3D1QA 3MM7A 1FT8A 1RKIA 1S9GA 2WBMA 2RU9A 3DRSA 4KBIA 3OTCA 4ZHRB 1NKCA 4D3GA 2DK2A 4LQ9A 3C2PA 4N77A 4NLUA 2V2ZA 4BC9A 1S6OA 3BN4A 3NS6A 3OPKA 1UEUA 3B4DA 1U0HB 1NSKL 2BRLA 2YWGA 2WVFA 3O3LA 4RBUA 2G9OA 2AX0A 2PA8D 1X0PA 4L75A 4LVNP 5A8RA 3KHHA 1X9MA 1FHTA 1LWCB 5F8HA 4IOBA 2DH9A 3FJ2A 4ZIVA 1BWVA 2XZTB 1WEXA 4I64A 1DURA 3DLKB 3J7YU 3G96A 1EARA 1SJ4P 1OWXA 2GVZB 1YJUA 4FKXA 4RBVA 3Q8VA 4C8NA 3NXZA 5A2QY 1F2GA 1F1BB 1TK8A 1KBRA 1S4EA 2XMTA 1MWYA 2C2OB 2V9WA 3HVRA 4F2RA 4CH0S 4ECSA 3LW5C 3BQ1A 1NDCA 4OX8A 2PMHA 2I5JB 4FS2A 2FZKB 2E1PA 2PIIA 1UVLA 2OJ3A 1RAGB 1WHYA 4WXOA 3CD6S 3D54A 4OYXA 5EX3A 2CJQA 2RT3A 4QWEA 4L74A 2LA6A 2XO6A 3LOUA 4ZLJA 2DHXA 3OUYA 1SQGA 4DR1F 3H5SA 4WFZA 1LNQA 5K5MA 2ALZA 2FJAB 2AU0A 1H2VZ 3R7SB 3W5YA 1IBKJ 1NRKA 1Q8LA 2EVZA 3AD8C 3WZ0A 3W8PA 2VONA 2HQDA 2E5GA 4ANCA 4RW6A 4YDDB 2LFVA 3DYAA 5E3PA 2QIFA 4QYZK 2YX4A 2R7RA 1TL7B 3E01A 3LPEA 5HSPA 4MKAA 1H0HB 5KFTA 3GFHA 1L3SA 2PGCA 1FNXH 3KWMA 3B8HA 3MR2A 3T1HJ 1O8BA 1C1CA 1R89A 3MPWA 4I2QB 1T9XA 1E6VA 5HATA 5M2RA 2JDJA 1Q0NA 3GFZA 3K5OA 4DQQA 3MMJA 1QM9A 3FNNA 1KDNA 3VAMA 4X64J 1RQ0A 3H2VE 2M52A 3ISND 3PEJA 3R7BB 2R2RA 2CQ4A 2ZWPA 1EKRA 2WVCA 2FVSA 3VAIA 4LFAF 5BYSA 1RUSA 2HG4A 2M88A 2KM8C 4FBTA 2XLKA 2M4MA 2EG2A 2MKJA 4RKUC 1VQ7S 1T05B 1ZAXA 1S1VA 1TUWA 2N4DA 4ILMA 2KYXA 4H4OB 3TQEA 2IC3B 3N01A 4QWAA 3OUYB 1HKAA 1NDKA 3I9V9 4IKAA 4OZJA 2CPXA 2VQFF 2IM2A 3UDEA 2EBGA 1R27B 2V8GA 4CO0A 2UUTA 3GR1A 1VQ8S 1MU2B 3SSQA 1IR0A 4WU3A 1YJWS 4C4WA 1XBWA 5ETOA 3CC2S 1JMTA 3PX0A 4IRDA 1VYAA 2P5VA 2VPWB 2YNGA 4ZS6A 1S76D 2CJYB 3TUPA 3T5JA 2GJFA 1IKYB 1HBNB 3K8WA 3PACA 1E6YB 1WG5A 4KO0B 4ZOSA 5E7OB 3M4XA 4DN0A 5L1LA 1MROA 3WBZA 4ECXA 4I2QA 3C3LA 2F4VF 4FVCA 2D3OR 4NOHA 3ZNUA 2FGCA 2HLUA 2XYPB 1I1GA 3CJSA 5KTQA 3QRRA 2DITA 4MFBB 4NX9A 3BH6B 1GMWD 3TAMA 1HPZA 1XQIA 5J2NA 5CYMA 4CLWA 3EWGA 4NLYA 2XI3A 2J7KA 3QPIA 4X62F 5AXKA 4DV3J 2XMJA 2EBEA 4NLSA 5KG6A 2QSWA 2I6WA 3S7RA 1FO1A 4KSEB 1JB0C 3TX8A 5AXNA 1R0AB 2R7OA 4NEYA 4DL2A 4LR8A 1R0BG 2BKOA 2GS8A 2V5HG 2Z2YB 4KR0B 2Y8WA 3BR9A 2FJXA 1MG7A 3G6ES 3M05A 1RDRA 4ZP9A 1RHRB 2OPQB 2MZJA 5IC6B 5KFJA 3UD3P 4DUYF 2R7SA 2W25A 5DLFA 2NZ4A 4ETZA 3H5YA 2Z0GA 4CCHA 3UN5A 4J7CA 3LAMA 1E6YA 2HAIA 1WI6A 5CA5A 1NK6A 2ERRA 3TEGA 1FERA 2IVYA 2L41A 1IR1A 2DRBA 4ZVOB 3M8PA 2W2NP 1FXDA 4KGZB 4OHWA 2BM1A 4IO9Q 1QLNA 1OYDA 4P74A 2E5HA 1EHWA 4RUBA 5IS2A 4U9RA 1BQXA 4RNFA 4NCBA 1TVRA 4ECYA 1TKDA 4O3SA 1BD6A 1TELA 4PEOA 1TK5A 3QLHB 1P1TA 2BM0A 3CCZA 1IKWB 4Q43A 5KT7A 4Y2MA 3N6NA 3D6HB 4U7UK 3W5XA 5A6PA 1RAOA 4X65J 3I55S 1SV5A 5CZXA 4RZRA 3J7A1 1HYSA 3UN3A 4ES3A 4CP5A 5DJBA 2BBEA 2FJEB 1YJ7A 2V2QA 3IFEA 3MM5A 1W25A 5HLFA 2D3UA 2YNFA 4DPXA 4WBFA 3EVWA 1Y11A 1N5YA 2YH1A 2HBRB 1WSRA 2GIRA 1FFSB 1GAOA 4IDKB 1WKLA 4USMA 2E5JA 3CDAA 2ADBA 2NPFA 1GNKA 2CNLB 3M8YA 2I9SA 2DKOB 1HQEA 4ZPVR 1I94F 3MGJA 4J9MA 1WTBA 4PQUA 3BREA 3JXOA 1I5OB 3DRXA 3NGTA 4KE5A 3W61A 1ICEB 2WONA 4IFVA 2MGZA 3UR0A 4NXMJ 3FEXB 1YJ9S 4OYWA 2L9DA 2EW9A 1FRIA 2UZAA 3NP5A 2KJWA 3ADAC 3FQKA 1U2FA 4FZVA 1A6LA 4DPUA 3E2EA 3NMAA 1T7PA 4NLQA 2LQ8A 4JI7J 1TVRB 2CUYA 3MUTP 3RW6A 4LR7A 4AYBD 4B17A 5EN1A 3EDQB 1Q4RA 2DIVA 1LW2B 3KUHA 5HK4A 2W7PA 2V68A 1HQUA 4CM2A 4CQ1A 2KHCA 3GJSB 1SQEA 3I0SB 3W66A 1RTDA 4TU7A 2W8LA 2CAJA 4M5HA 5L1IA 1DRZA 3LAKA 4Z37A 2JVOA 3GSDA 4GVBA 1UEVA 5HL7Q 5E0OA 4X66J 2XGQA 4MJKA 2W9BB 1CG2A 3PIOQ 2XZWA 3KJVB 2XCPA 1G3OA 3G9CA 3M9OB 1UVKA 4ZVUB 2QLWA 2PI4A 4JI3F 1SJQA 1FVQA 1N5SA 1H72C 3MMCA 5IZHA 1U4BA 4QPXA 2DEJA 1S49A 4P10A 5HVHA 1EETA 1RB0A 2W8KA 1DBDA 3EZ5A 4JI7F 3C14A 1F5BA 3DOMB 3T1YF 4TY8B 3N6LA 3KLEA 4FF3A 1WOSA 4NRTA 1N33J 1J5OA 3WIUA 3OFFA 4NLPA 2HZVA 2RUSA 2CQ3A 2DPIA 4DQRA 4GKJJ 3R7NB 3LO3A 4DSEA 1L3TA 4GO7X 2AYGA 5CXTA 3FUYA 2FLLA 1M1KT 2DD8S 3C66A 3GMGA 2HHHJ 1OIAA 2NXUA 2EFPA 2KRBA 3D3CJ 5HVGA 1X0FA 3HDSA 2I2YA 3DCAA 5K20B 5F8JA 1U1KA 1S0MA 4NLDA 3MTKA 3BB5A 4DR4J 2YKNB 3TZWA 3M32B 2XWXA 1NO8A 2BRKA 4KGVB 2G4BA 1V5VA 1JKHA 2CQ2A 4F0MA 4F4YA 3KG0A 4LF9J 4ZVGA 3OBIA 1FK9B 4JUZA 3MD3A 2MQMA 2MHNA 2VJVA 1NDPA 1TL1B 4GC7A 2RKIA 2ZH9A 2DYAA 2BDPA 4X4VA 1X4EA 3IR6B 4XDDA 1OSDA 2QFJA 4ED1A 1HWUA 2G2ZA 1NSQA 1QTNB 2HFUA 3TO8A 4C3KA 4NRUA 5MAOA 4FKYA 4Y0FA 3VAJA 1PC5A 2Y1IA 3IO1A 5D78A 1VC0A 4AUKA 4WE1A 2MLZA 1RGVA 2B9WA 1RU1A 1B70B 2BYCA 5F9LA 1MNEA 2C3UA 3CTRA 4RPFA 2A10A 2CJBA 2XG8A 5J2QA 3DLEA 3CJRA 3GR0A 1UWBA 3GYNA 3PJ9A 4Y28C 6AT1B 1JWWA 3GLJA 4ZVTB 1X4CA 3HHDA 9ATCB 2P6SA 3DGVA 4OJHA 4DQIA 4KGXB 4Q7AA 2HIQA 2MTLA 1YITS 1PYOB 1U6ZA 3QO9B 2ZUGA 3J80Y 5KFAA 2XGPA 2WK4A 1PBUA 2E5IA 3I87A 3M32A 3PO4A 4N76A 4YMEA 2HFZA 2NXEA 1CJUB 3CNQP 5DDQC 4IRCA 2DHGA 2F7VA 1WOOA 3SSRA 3UCUP 3H98A 1JLAA 2RVJA 3A13A 2F65A 1RTJB 4PWUA 4ZCKA 1Y10A 1FEHA 1WORA 1H73A 4C11A 3SQGA 3CC4S 4L76A 5H9FK 4RW8B 2V69A 1N32J 2ZD1B 1VHFA 3DRYA 4ENOA 3KLFB 4A8KA 4B9MA 4IO1A 1M5OC 2XYHB 5CYMB 1EQMA 2VICA 3PW5A 3R97A 2R42A 2EK6A 5CZVA 4A8XA 2AGOA 1CJTA 1KQSR 1FFWB 2VQEF 3ZNJ1 2KVIA 2GGPB 3JYTB 4LF6F 2KZMA 1V3SA 2K8GA 4P2MA 4EZ6A 3L7OA 4ICLA 4C2MA 1F9FA 4Q0BB 4S0MA 4CLYA 1RCXB 3CJ0A 1X5TA 2G0JA 2IM3A 3TOQA 4DPYA 3M8SA 4K0KF 2L08A 4K8RA 3OTBA 5KFLA 2OPQA 2V6AA 4G1PA 4P2FA 3TP2A 3MCMA 3A3NB 1K1SA 1KLMB 3UD4P 5CD4A 4NASA 2VG5A 5F0WA 1YBAA 4EK2A 2OI2A 3GILA 3HULA 3I0RB 1NB2A 3IAM9 1S48A 3NS5A 3PXGa 2DGSA 1YDLA 2J5AA 2R2UA 4XK8C 3ZZUA 5ETRA 4I2PA 5I42A 2GAGC 5HANA 4WFBQ 5EX0A 4DDFA 4TVAB 3D67A 4DV5F 2PSZA 5KFXA 4A8OA 4NXNF 3KLFA 2DNKA 2AD9A 1NJXA 4UUWA 2VB6A 1AXQA 3W62A 2HHXA 3QT7A 3R5AA 1S1WB 2HWIA 4CLTA 3ILIA 2JRSA 2ATCB 2MLYA 4TKTA 3SZ2A 1N48A 2NUHA 2E7WA 1R6VA 1ZA1B 3QFWA 3ZZZA 3KLHA 4F4XA 2AW0A 4DUZJ 1C0UB 1VLOA 2DCUB 5CHCB 4ED2A 4IG0B 2BE9B 1NKEA 2NREA 3GG0A 3HSJA 2JSXA 4QJVA 3K8VA 1SJ1A 1EP4A 2WOMB 4CZCA 4IR1A 1D3WA 3A8EA 1UVNA 2NUUG 4ZKAA 3MI7X 5DLGA 1YHQS 1SH2A 3HFVA 4B3OA 4YOEA 1X4FA 4OX9F 1Y9OA 3Q86A 1FXLA 2UUAJ 1UMJA 1DHMA 2QSFA 2POKA 3IWLA 3SBMA 3U1LA 1ZYQA 1FJGF 1U8SA 1N33F 4LF6J 4CO4A 4I4BA 3I5BA 1SB6A 4WF9Q 3F56A 3TAPA 5A76A 5C42B 2IYIA 4DV4J 4F4AA 4H4OA 1S1VB 1ZM3A 2U1AA 3NGDA 4EBDA 1RT3B 4UT4A 1D8ZA 1LWXA 3HVAA 1F0XA 2V2VA 4AD6A 1U1MA 5A8KB 4X4UA 1YVFA 1GFWB 1VDHA 2DNQA 2VBZA 3EGVA 4WTYA 4F02A 1HR0J 2HHSA 1Q81T 1UZHA 3M7VA 5E3RA 2KG0A 3OXFA 4RNNA 1IUJA 2JH3A 1N5YB 2XULA 3EVOA 5DG8A 1X5OA 1BE4A 3GIJA 4HDHA 1SI9A 5GMDA 5EWGA 2C2MB 2ZBQA 3MFIA 4LF8J 4X4SA 2V8PA 3IP0A 3Q8QB 3VWSA 3C6UB 1AW0A 3V2UC 2XSFA 1FD2A 5CD4H 5FDLB 4B3RJ 2KT3A 3OVBA 4PXDA 4G6VB 2ROPA 1KNZA 1N56A 3RGIA 1RBOB 1HPZB 2QRRA 1F60B 1VBZA 1UW4A 5AXMA 3JB9k 2UXDF 2EFOA 2HFSA 4DBQA 4FF4A 1FDAA 3TA0A 5HO4A 2R2SA 1PCAA 4CDIA 2DR7A 2IMWP 2AT1B 4LBIA 4TQSA 3DRRA 4PYAA 1WC3A 2UUCJ 1HD1A 5ETTA 5L38A 1Q79A 2D3ZA 4KHMA 4NI2A 5K8MA 4ID5B 5G0RB 2ZITA 5HROB 2EEYA 4DCJB 2GMLA 2GFFA 3KOAA 5H1SV 1RLCL 3PCOB 5LM7E 4ECWA 1YX2A 2HWTA 4IG0A 2BA9A 1HNWJ 1KTQA 5JVHQ 1HW9A 1TZ0A 2KB2A 3HVTA 2ZDPA 4JBCA 4DX8H 1K0TA 1V9OA 4UQTA 3M2UB 3D6FB 1TKXA 1S6PB 3JSYA 3TUZC 1FNOA 1ZPWX 3HHKA 3OR1B 4KFBA 2BKNA 2KJVA 3QIPA 2KL8A 4TN2A 5C24A 4CRJA 1TUVA 1X8DA 4PG6A 3UR3C 1PBAA 2ASLA 1BQMB 1RT6A 2H51B 4WIQA 4DR6J 1PKUA 3CWJA 4LFCJ 1QY7A 3FEZA 4HH0A 4ZHRA 2OPRA 3CJ4A 3PFEA 4OMFG 3G8TA 2OMLA 3LGNA 2GMJA 4NE9C 2F8EX 5J2NB 3POTA 3FQLA 5LMNF 1LKZA 1U8WA 2D9PA 4R25A 2HNDB 2IC3A 5K8NA 3ET6B 3VGUA 1ZA2B 4KYZA 4ELVA 3TI0A 2MKCA 5F3TA 2IM0A 4F4ZA 2B4VA 1YRUA
chains in the Genus database with same CATH topology
3SDEB 2BABA 1U1NA 3K5PA 4B9NA 3Q2SC 4HKQA 3MHYA 3BO2A 1FRHA 2CPEA 2ZOFA 4G1IA 5KG2A 1IKYA 1HBNA 4KO0A 1KC8T 4MH8A 3K7RA 3LP0B 3RU0A 3GB0A 4ZDNA 4ES1A 4DF4A 4LMZA 2K1RA 2KXHA 4DV1F 3KLIA 3QAUA 5B0AA 4DG1B 5KT2A 2YQ3A 3PKMA 2MQPA 2K3IA 5HBMA 1OPZA 1Q8IA 4JOUA 5KG7A 2Y0SD 2KRRA 4QIVA 4PWDB 2XS7A 1X4BA 4LIWA 5E2QA 2A2DA 3CEDA 1NEEA 5L9XA 3VQTA 3VZIA 2QA4S 1T05A 1M90T 2GQQA 1X4DA 3KK3B 2B56A 5BYRA 1KSPA 1FKAF 1FJ7A 4YDXA 3G71S 2IJFA 1VRTA 3BGRB 3K5MA 4OJ1A 4F67A 1DTTB 3PR5B 5DQGA 1YTYA 2HNYB 4PPZA 5C25A 2XY7A 3M6WA 1KEKA 1H2TZ 4TU8A 1GTEA 1R8AA 2M0GB 2VG6B 2YKAA 2FVPA 2AF6A 1Y00A 1ZAWA 2CQ1A 3CCQS 3BO4A 3RAQA 1LW0B 1KFDA 5K8OA 2HMIB 3I4PA 4DF8A 2OAUA 3MEDB 2C42A 3FZ2A 5IFMA 1U45A 1N5QA 4USHA 2IRYA 5DG7A 3DI6A 3ENWA 4LIRA 3UDCA 3OVAA 1W2BR 1X9WA 2VH7A 2M9KA 2J0XA 5F8IA 1HI8A 2ABYA 2FHJA 3OLBA 2R9LA 2APOA 3K58A 5CYQB 1FRMA 2M7SA 4IH6A 5BR8F 2OIHA 4OL8A 6FD1A 5J1NA 3J81Y 1XR6A 5D3GB 1VQNS 1WD6A 5KAKA 2XSJA 2RS2A 1IKVB 3R5BA 2B5JB 4JI4F 3HHNB 5I3PA 3QGIA 2OP5A 1R8PA 4ID5A 1O51A 4OI0A 1UVMA 2YKNA 4Y65A 1MSWD 4NZ0A 1XNQF 2IHR1 2K7JA 3CUNA 2CQPA 3ZZTA 2CJKA 4ED5A 2J9EA 1W2IA 1NKBA 5DDRC 4KRWA 2AJFE 3FRYA 4PPDA 2KKHA 2R8JA 2VOPA 2I0XA 1WHWA 4Q8FA 1FDNA 2ZVSA 2R8HA 4WFXA 4HHJA 3V81B 1Q82T 3CCMS 4ECQA 3QAEA 2N3OA 2N7CA 2EKYA 4EUVA 4B3SF 2FY1A 1JNRB 1Q7LB 2KXFA 2PEHA 5KFOA 3BJYA 2G0CA 2VL1A 4C8MA 1YSJA 2OPPA 4IQXA 2MSTA 2BW2A 3VCDA 4E98A 1FKPA 3PEHA 2SXLA 3BEGB 3M6UA 1HWIA 1RI7A 3I82A 2ZFHA 2LQ5A 2VG6A 1V3ZA 3CDUA 1Y7PA 1E6VB 4B08A 2DGWA 3ZFVA 4ZCMA 1RT4B 1P6TA 2RD5C 3MEKA 4NYPA 4YB5A 2XMWA 5GAHU 1D9DA 1UVIA 4C0HA 2PD1A 5HP1B 2VASA 5DM7Q 1YJNS 2Q1LA 3B4MA 1M0SA 3IR7B 2BZ2A 2HQ3A 4USIA 3PX4A 5D77A 1P1LA 2DT9A 3V81A 2QA1A 3GQCA 3CJ2A 1J5OB 2N7YA 4WYLA 3SFUA 2J0SD 4Y00A 3I5AA 1ELOA 2ZD1A 3RAXA 2C2RA 1VQPS 3DRSB 1KOOA 3DLJA 2JEIA 5KG0A 3RR8A 3SFGA 3G6XA 4P2SA 4Y2KA 1HWKA 4PRFA 1ZM2A 3PKYA 1VQMS 3L7PA 3VAKA 1H7WA 2W4CA 1DLOA 2ZHOA 5DO2A 5EN1A 2YNGB 2RIJA 4I68A 4WFAQ 2F8MA 3P3DA 3MDFA 4OV1A 2YY3A 3W2WA 4LFBF 4I1TA 3L09A 3D2WA 2MQOA 4KT0C 3M8QB 1XMBA 2F3JA 5BYQA 1N34F 2YKQA 3TARA 1YJTA 4EBEA 4QR2A 1C2PA 3OTDA 2VG7B 2LXIA 1FKOB 1ZETA 2M3DA 1OQ3A 2JZ5A 1VQKS 4CNYA 3PW7A 3BGUA 3MEGA 2AYEA 2CVEA 5I42B 4QU6A 2OPRB 5FJ4A 4K50A 5IM0A 3CCVS 2YWKA 2UV8A 1HBOB 2HHPA 3D5MA 5B08A 1WF1A 4C3LA 5JUMA 2VV5A 2UUBF 5KFQA 4WZQA 1WACA 3CGIA 3HK2A 3ZZPA 1JLQA 1VK3A 1RA7A 4TLRA 1JJ2R 2GCFA 5CQGA 3GV7B 1IN0A 1SJRA 4WK1A 2FLNA 2UXCF 2C3YA 3Q8RB 4A8YA 4W90B 1HI1A 4FF1A 1JKHB 2JOQA 5L39A 4MKYA 4NPOA 2JFDA 3J7ZT 3ICLA 2VOOA 3U02A 2KYZA 4DQSA 1H7XA 2X1BA 2B6AB 1TKTB 1N52B 3V4IA 2J9CA 2E7XA 2WHOA 4WIIA 4TY8A 2RE1A 3OTOF 1K1QA 5DGBA 2AYMA 2K3KA 1EETB 2BVZA 4J37A 5I4MA 4PWDA 2UVRA 4DSLA 1XC9A 4K5SA 1FCAA 3HHLA 5B7WA 2VA2A 1XWLA 2ZBCA 3DC2A 4DFJA 2BQUA 2UVUA 4RW7B 3CMES 2FJVA 3QO9A 3D0HE 2L3MA 2HW3A 3N79A 3HM9A 1VJWA 3OJUA 5CCLA 3SSSA 1ZH5A 1ZM4A 2YNHB 1FD8A 3NAHA 5IWAF 2D1CA 2D9OA 3DDKA 3OJSA 5KT5A 3PW0A 2DGOA 1R8BA 2LQ9A 3C8YA 3OQ2A 1JJ4A 3E3XA 1G2EA 1UP1A 3LP2B 1QSYA 1TKZA 2V4JB 4QPTA 3TAQA 4RW8A 2BQRA 1BY9A 3R1HA 3BGFA 4K4UA 5K8PA 3MD1A 1S1TA 1U6FA 4ZPCA 4QU7A 1DJ0A 4I6YA 4J9OA 1ROFA 1RKJA 5KG4A 5EHHA 1X4AA 3PFOA 5I3QA 3AA9A 2WAQD 4DJBA 1RTIA 5KFIA 1FKPB 2MY8A 2XY6A 1DLOB 2RSQA 4R0JA 3GV8B 2DO4A 3DLKA 1D9FA 3CE8A 4QR0A 1S6UA 3DLGB 1QAXA 2O01C 5DS7A 2HRUA 3OR2A 2CYYA 3I31A 5D8HB 2VFRA 4MYUA 3O1LA 3QGPA 2HHUA 3V5RA 3KLEB 3NMRA 2W7OA 2GNKA 1S72S 4FF2A 1S9GB 1Y4ZB 2N3LA 4HT5A 5A8WA 3M2VA 4KKOB 1M5VC 1BC6A 1KONA 4PG8A 3DU5A 1I6JA 1DARA 4X4RA 4J9KA 1Q86T 1QVGR 1H6KX 4Q5VA 3Q8SB 5LL6d 1IXKA 4DSJA 1VRUB 2DGQA 2HS0A 4NLXA 4EEYA 3RTVA 3EGWB 5HROA 3QWUA 1YIJS 2EG1A 4B9SA 2YNIA 1Z1ZA 4FXWA 3W2VB 5DRKA 3P49B 5B0DA 4GC6A 3N0VA 2AGQA 2MQNA 4DL3A 2CPJA 2FJBB 4KV8B 4RW9B 1SKWA 3FVYA 2QE5A 2VG7A 7FDRA 5EWFA 2HS4A 1YG0A 3DI6B 3EXCX 3T5KA 2DGTA 5D4NA 4O3PA 3MEGB 4NA3A 3DOMA 1IQTA 1OS5A 4K4SA 2OLWA 4ED8A 4C8KA 1PC4A 3TR5A 4DV4F 1NU4A 3MPYA 5I3UB 5THWA 1X9SA 3FRZA 2KT2A 1UL3A 2YH0A 3NAIA 4BWJA 7FD1A 1YRXA 2V8VA 1T02A 5G4DA 2XSJB 3MURP 2ZH7A 2IFXA 4ECUA 1C0UA 4OX7A 1GXUA 4ZPDA 3GWCA 3TA2A 5KFRA 3MAHA 2LEAA 4KHRA 2LMIA 2I1RA 2X3GA 4OI2A 4YHHF 2VBWA 1LOUA 3TW0A 3O5TB 1VGYA 2B4OA 1MWZA 1S1XA 5B0BA 4TNOA 3CJ5A 2K2PA 1VQOS 4DL5A 1DQAA 3M1VA 4WFYA 2HQIA 4GKKF 4RUCA 3QZ8A 3K57A 4LSNA 2XMKA 3DXSX 2FDNA 3Q22A 4DUZF 1FJGF 1QAYA 2R7TA 2HS3A 1FRJA 5FDLA 2QLXA 4GMKA 3V4IB 1FKOA 1FF2A 4NYOA 1U1LA 2HVZA 4OHXA 4C0OC 4WE1B 1VLYA 2CIMA 4FNIA 2ROEA 3BGLA 1SJFA 3M9MB 3CSKA 5B0CA 2C28A 2X1FA 5D4LA 3KG4A 3THVA 4HH1A 3TYTA 4C98A 2B5JA 1Q16B 4QIEA 3BDPA 4OHVA 4DMZA 3S01A 4C97A 2FJWA 2F8HA 2CQDA 2WBRA 4ZVFA 2ZOGA 1N32F 1KFSA 3LGMA 3N9UC 5SUHA 4ECVA 4N8OA 2A1BA 2W9CB 4YUDA