1AUDA

U1a-utrrna, nmr, 31 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the RNA-binding specificity of human U1A protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
molecule keywords RNA 3UTR
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 1997-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1audA00
3U1LA 3UE2A 4LJMA 1IQTA 2DHXA 3L3CA 2MGZB 1FJ7A 1RK8A 3B4MA 1X4EA 2CPZA 3MXHP 1M5PC 3SDEB 1WF1A 3IRWP 3D2WA 2JVOA 2CPYA 2L41A 3SMZA 2A3JA 1YIJS 2RT3A 1U6BA 1O0PA 2I2YA 5DDPC 5EN1A 3MUVP 2DHSA 4ED5A 2MQQA 1HL6A 3K0JA 1WELA 3G96A 2VOOA 1G2EA 1Q86T 2HGNA 1VQ9S 4TLQA 2YTCA 5CA5A 1N54B 3G8SA 1SJ4P 3CC2S 2U2FA 2X1BA 3J7YU 1Q7YT 2KXHA 1WTBA 1UP1A 2MSSA 3UCGA 2DNGA 3EX7B 4YB1P 1KC8T 1QVGR 3HHNB 2VODA 1KD1T 4LIRA 2MKCA 1WF0A 2EVZA 3G6ES 3BEGB 2CPIA 2YKAA 3B4DA 1FT8A 1X5TA 2X1FA 3SDEA 2CPFA 1OWXA 3CMAS 3LQVA 2DGWA 3CULA 1H6KX 3DXBA 4U67Q 1XN9A 4CH0S 1FO1A 1SJRA 1U1QA 4IOCQ 1D9AA 1U6FA 2M9KA 4QU6A 4UQTA 2KYXA 2AYBA 1KOHA 2DH9A 2MQLA 2PE8A 2MKHA 2K3KA 1P27B 1U1RA 4V19X 1WHVA 2M4MA 2DNLA 3LPYA 2XNQA 4UY8T 1WHXA 2I38A 3MUTP 2MY7A 2DGSA 4BS2A 1VQ7S 4IUFA 2CPDA 1VBXA 4EGLA 2JVRA 1JJ4A 4ERDA 1FNXH 5IM0A 1M5VC 4LMZA 2L9WA 2G0CA 3CTRA 2DNMA 4CQ1A 2DHAA 1F9FA 2LEAA 1VQMS 1VC0A 2DO0A 3P6YC 3P5TL 2NZ4A 2J8AA 2J0QD 3S8SA 2MZRA 1P1TA 1HD1A 2DISA 3H2VE 1SJQA 2CQ1A 4W92B 2WBRA 2D9OA 2DNQA 2UP1A 2DB1A 2KVIA 2KXNB 3US5A 1Q82T 2M52A 3R1LA 2AD9A 1X0FA 3U1MA 1QM9A 2MJUA 2OIHA 2MSTA 3CCRS 1X4AA 1JJHA 3VAFA 2MZTA 2DGQA 2KRRA 3MI7X 1X4HA 3CCQS 5GAEU 2BZ2A 2MMYA 1QVFR 2DH8A 1M1KT 1N88A 2RQ4A 1PGZA 3MUMP 2D9PA 3CXCR 2RU3A 4PRFA 2KN4A 2DGTA 2DH7A 2RNEA 5GAGU 1K73T 1HD0A 1UFWA 3H2UB 5DDRC 3HI9A 2ZJQQ 2CQPA 1SJ3P 2LCWA 1M90T 3FEYB 2RUGA 3MURP 3G71S 4RU2A 2EK1A 2DO4A 3CMES 4J5OA 2M88A 1JJ2R 1CVJA 2MKJA 2HGMA 3MD1A 1KQSR 2MXYA 2KT5A 1DRZA 1URNA 2LEBA 2E5HA 3CD6S 3CCJS 4A8XA 2FY1A 4C4WA 4YOEA 4Y0FA 2E44A 3VAJA 2MB0B 1YJ9S 1R8HA 5CYJA 1VBZA 3JB9k 3NNAA 2N7CA 1WEXA 4CH1A 1K8AT 1WEYA 3IWNC 1WF2A 1WG4A 2FC8A 1VQ6S 1YTYA 2HZCA 2XS2A 2VONA 1WI8A 3THTA 2HYIB 2MZ1A 1U1NA 1VQLS 1AUDA 2L08A 3G8TA 5D78A 3CC4S 2DGUA 4Y00A 2LXIA 2ERRA 1X4DA 2CPHA 2F9JA 2MKKA 1H2TZ 2M2BA 2MZSA 2DK2A 5GADU 2DNYA 2MQMA 2DNOA 3UCUP 2CQBA 2YWKA 2CPEA 5DDOC 2HGLA 2B0GA 1RKJA 1UAWA 3DLLQ 3FEXB 1A7GE 3CC7S 1WI6A 1FJCA 1VQOS 3I55S 1BY9A 2N82B 2MPUA 5LSLA 1NO8A 2CJKA 3CCES 1U1KA 2M8HA 2MKIA 1W2BR 2MQOA 1S79A 2XNRA 2KRBA 3P3DA 4C7QA 1NJIT 4WIIA 3V4MA 2DGXA 4F02A 2JX2A 2LECA 2ADCA 5GAHU 1WWHA 2F3JA 4WFAQ 2M7SA 2KU7A 2XSFA 3S7RA 2LA6A 2QEXS 3PIPQ 2OSQA 2DHGA 1PO6A 3Q2TC 5ITHA 2KG1A 2ZJRQ 3SXLA 5LJ5Y 2DNPA 2CQ4A 3UWTA 2LXUA 3J7ZT 3UCZP 1DZ5A 3NNHA 2KM8B 2N3OA 3NS6A 1U1LA 1DHMA 2KFYA 1R8PA 1X5SA 2CQHA 2K8GA 3ZZZA 3G4SS 1YHQS 3THPA 4ZKAA 3NS5A 5BJRA 2CQCA 2KM8C 2ADBA 2DNHA 1OPIA 2RRBA 1ZZFA 2OJ3A 4IO9Q 5DM7Q 2SXLA 5H1SV 2MZQA 2E5JA 3VALA 2X1AA 2YH1A 3BO4A 3VAKA 3Q2SC 1VQ5S 3EGZA 4OZ1A 4Z2XA 3CUNA 4WF9Q 3BS9A 1VBYA 1WHWA 4F26A 5D77A 3S01A 3MDFA 1B7FA 2VOPA 2LQ5A 3CCVS 1OIAA 1YWXA 2MQPA 3CCMS 1VQKS 3EGNA 2JRSA 2M8DB 2MZJA 3TO8A 3TYTA 3R27A 3CCUS 1WEZA 2DIVA 2V94A 1X4FA 3MD3A 3VAGA 1U1PA 2GHPA 4PKDB 3BO2A 1OO0B 2PEHA 2DNNA 1D8ZA 1WG1A 2RRAA 2DNRA 4TU9A 1WG5A 2KH9A 1WHYA 4FXWA 2FC9A 1YJNS 3VAIA 2MKSA 2DGOA 4QQBA 1HA1A 1ZH5A 2F9DA 5LJ3Y 3R1HA 1S72S 5LSOA 1X5OA 3VF0B 4F25A 3CF5Q 4WKRA 5DDQC 1YJWS 1M5OC 5MLCV 2RS8A 1H2UX 3NMRA 1FHTA 2RVJA 1YI2S 1L3KA 1KOOA 2CQIA 2OTLS 2MGZA 2CQ3A 4TU7A 3VAHA 5DETA 1VQ8S 2DITA 2KG0A 2E5IA 3UD4P 3CCLS 3BO3A 4WCEQ 5HO4A 3UD3P 3N9UC 2DIUA 2MJNA 1UW4A 2DNKA 2LKZA 5LXYA 4WFBQ 2HVZA 2J76E 1N8RT 2G1DA 3VAMA 5DM6Q 2D3OR 2RQCA 4PR6A 2AYMA 3CPWR 4CIOA 3TP2A 2N3LA 1FJEB 2QA4S 1NU4A 2MYFA 2OTJS 1VC5A 2CPXA 2XB2D 2O3DA 3ULHA 2DNZA 1U1MA 4OZ0A 2KHCA 5JVGQ 2U1AA 3RW6A 4FXVA 2MQNA 1YITS 2XS7A 5JVHQ 2YH0A 1X4CA 4TU8A 2EK6A 1H2VZ 2XS5A 2DGVA 5CXTA 1SXLA 2E5GA 1FXLA 1X4GA 2AYGA 2CQDA 1K9MT 2G4BA 5GMKa 2M70A 5IFMA 3CCSS 3P49B 4IOAQ 1VQPS 4W90B 2CPJA 2BOPA 2OSRA 2KXFA 2M0GB 1JMTA 2CQGA 4QPTA 2ZJPQ 2LA4A 2CQ0A 1X5PA 5HL7Q 1N52B 2FPHX 2Q79A 2AYEA 3S6EA 2QFJA 1X4BA 5IM0B 4QU7A 5FJ4A 5IQQA 5GVQA 1VQNS 1ZZNA 4WFNQ 1Q81T 2X1GA 2LMIA 2NLWA 2MY8A 3ZZYA 2MHNA 1A9NB 2JWNA 3PIOQ 1U2FA 1M5KC 3NNCA 3MOJB 2FHOB 4P6QA 1VC6A 3RW7A 3I56S 3G9CA 3OW2R 4M5DB 1SJFA 2KI2A 2LYVA 1VQ4S 2J0SD 4C0OC 2GO9A 4YUDA 5LXRA 2RS2A 1U1OA 2CQ2A 1DBDA
chains in the Genus database with same CATH superfamily
1YJTA 2YWFA 1VYAA 2VG7B 2ZH3A 1F3VA 2L3MA 4WYWA 3QT6A 4N7TA 1SL2A 4A47A 4URQU 3PR5B 3L3CA 2AV5A 3R5CA 2MGZB 1BLUA 2XLJA 3VQTA 1WJ9A 1S12A 2F40A 3PDNA 1RK8A 1FJ7A 5L1IA 4YDXA 3B4MA 1X4EA 1RADB 2B43A 5LL6d 2UVWA 2J6UA 3X1LB 2XEXA 2MTLA 2OELA 3SDEB 2C2RA 2YNGA 4FF3A 5D3GA 2BXJA 1FE0A 4RUBA 2R7OA 5T7LB 4PWWA 4HACA 4LIWA 4NL5A 4CLKA 1N34J 2VBWA 4TN2A 3ETOA 1G7CB 1KFDA 3G2XA 3QIDA 1MWQA 2FLPA 2P8IA 2Z2ZA 2A3JA 1BE4A 1SQFA 3HHEA 3V81B 3BH7B 2YKQA 4LRAA 3CD0A 5E3QA 2GQ2A 4AUKA 4RBUA 3QT7A 1RTDA 2OLWA 3H7HB 5E33A 2DHSA 5B0DA 4OMFG 2MQQA 3O2IA 3FRZA 3UPFA 1Q86T 1I51B 1XMOF 1CS4B 4IKAA 1NNDA 1MN7A 1DY3A 1SJ4P 4GKJJ 2U2FA 2YKPA 1WACA 3MR2A 3HM9A 1WTBA 4Z37A 1PILA 3UCGA 4HACB 4C11A 4PWUA 2JSXA 4YB1P 4GKKF 3KFWX 2HRUA 2PEBA 2Z30B 1S97A 1QVGR 3DOKA 2JEFA 2Z8QA 4C8MA 1W26A 3OL9A 3AT1B 1RBLA 4XPEA 3SZ2A 4J9RA 3HVAA 3PW5A 1FA0A 2YKAA 3FJ2A 3B4DA 4AFFA 4ILMA 2HHXA 3G6VA 1HI8A 1VOMA 2A2CA 3MPDA 3QBCA 4HTJA 1RAHB 3EXYA 1X5TA 3PKMA 4YHHJ 1NH8A 4WJBA 3ZO7A 2CPFA 3HKWA 4J9UE 3LQVA 1XMQF 4DL5A 1U2CA 4CLTA 1Q5YA 4TYAA 4AE5A 4TLRA 1RHJB 5KT5A 2CJBA 4U67Q 2V4QA 3ZZUA 4Q7AA 2AP6A 5KT7A 5HROA 1T9YA 2VFUA 5KTQA 1XN9A 3DXSX 1EP4A 2C1EB 4PXBA 2H5EA 3EM1A 4CH0S 3UDVA 4DV3F 2K2PA 4ATNA 1FO1A 3MAAA 4X4QA 1NK0A 1UVLA 3VGVA 2NUHA 2NUUG 3IN5A 2R9LA 3QJLA 1PYTA 1IWAA 4GVBA 3SQGB 1CS4A 1KONA 3CDUA 1D9AA 3GFZA 4IOCQ 1GMWD 4L72B 3FBBA 2WSFC 3D5MA 3RBZA 3OJSA 1CLFA 3BGLA 4DV4J 4RW7A 4DV4F 3NGUA 5A8RB 3ETMA 2H3EB 2DH9A 2MQLA 1S4FA 3GONA 2F8HA 2OGUA 2QV6A 3GYNA 3M1VB 4ZP6A 4C8NA 4RW6A 3UVJB 2K3KA 3BBCA 3DLGB 1FX2A 3EDQB 3R5JB 1YJ7A 4M5DA 3D0GE 3TZWA 2M4MA 2R7UA 4TXSA 3CJ0A 4F2SA 1RTHA 4K4TA 4UY8T 2Y1LB 2XO7A 1KRPA 4OZ5A 3FMBA 3TQ1A 2HHQA 5EX0A 3MUTP 5KT2A 1HBMA 1Q53A 5DG8A 2IMOA 1LWFA 3L95X 2ZWOA 4Q8FA 2OEMA 3LOUA 2MHEA 4OX6A 1ZTTA 4R0EA 1N56A 1OY8A 2FQQB 1IBLF 4ERDA 3CJ4A 4MFBA 4A8FA 5B09A 3OXFA 1GH8A 5KFHA 5L46A 1M5VC 3BQ2A 2HNYA 2G0CA 3ET6B 1S6PA 1NH7A 2ZD1B 1IBMJ 3MEDB 4X4OA 1T03A 5HATA 2DO0A 2FHJA 2RIJA 2GZOA 3P5TL 4NLOA 4TNOA 1IBKJ 2OH2A 3I5CA 3QRRA 3S8SA 1E6YA 1HD1A 2YNHA 2DISA 3RAQA 1TL7B 2GQQA 4USHA 5J2PA 1YRTA 2DKOB 1HW8A 2F4FA 3DRRA 2V2KA 1JXVA 1ZPWX 3EUNA 3CE8A 3FSYA 3IFEA 5IT0A 5KFJA 1S6QB 1R0BG 2BDPA 3F73A 3I4HX 3ZZTA 2DB1A 2V67A 3AFGA 3KTQA 3GMGA 4DEZA 3MM7B 2E5LF 3DMJB 3KK3A 1QM9A 2MJUA 1RT4B 2IAJB 4YR0A 4RLEA 1D0EA 2IPOB 1JJHA 1HHSA 2MZTA 4ZPAA 2DGQA 2KRRA 5KFZA 3MI7X 2FJWA 2GNKA 1IJFB 1X4HA 5HI7A 4CI0B 5GAEU 2ZVIA 1RT5B 2FZGB 3RAXA 3AHPA 2ALZA 1QVFR 2IAJA 2WZ1A 3CDWA 4DL0C 3MUMP 2QLXA 1U02A 3CJQA 4LVOP 3U27A 4ED0A 1I94J 2QIFA 1J2VA 3MM5A 1U09A 3W62A 5L1LA 1KHVA 3HI9A 2CNLB 4MTPA 5HLFB 3NCRA 2D3O1 3J7AN 2LCWA 1KVJA 3LALA 2QA1A 3FEYB 3T1YF 3O5TB 4C6AA 1S1WB 2L48A 1HNZJ 1PBAA 2PT0A 5K20B 1NAQA 3OBIA 1MMNA 3CCWA 4KSEB 4J5OA 3RBDA 1M1HA 1JJ2R 1E6YB 1FRIA 2FLNA 1XEZA 3D6HB 2UXDF 4L3NA 2YKMA 3PRBA 4Q2LA 5KFNA 2F7VA 2KT5A 2D41A 5KT4A 1S6QA 4FKXA 1YGYA 3GCWP 3ET6A 2Z58B 5KFFA 3DLEB 4QR2A 2QZ8A 3MTJA 5LMUF 1O51A 4ZCIA 5KFQA 3EYZA 3RR7A 3QJPA 3EMTA 2YWEA 3MPWA 3DKDA 4ED4A 4ILRA 2I0XA 2XY5A 2W4DA 2N7CA 2ZJQQ 4CM0A 1T9XA 1TAUA 4DV7J 4CTAB 1EETA 3MPUB 4X65J 1HR0J 1T7PA 2E9ZA 4CNZA 2FC8A 1VQ6S 2BEFA 3IBFB 1ICEB 1NLKL 2HZCA 6FDRA 4CO5A 1YTYA 3I82A 1SQGA 4DV0F 2HYIB 1Q16B 1PYSB 3PEHA 3ILJA 3C14B 5G0RB 5J2MA 3CVKA 4KO0B 2DGUA 4N8OA 3IP0A 2I9SA 4Y00A 1V5VA 3VV2B 3CC4S 1X4DA 1N6QA 1Q0NA 2DR9A 3DM2A 4DR4F 2YNFA 1RWOB 2CNKB 2DNYA 4GRSA 1BQNA 1PYOB 4GMKA 1RKJA 2HGLA 3T5LA 4C8OA 3L4BC 2QFIA 3UNGC 2FGOA 2VQFJ 2AKWB 2VQFF 3TNVA 3ISNC 2D3OR 2ZH9A 1CJKB 2FJAB 5DO2A 5IC4B 3BSOA 2Z2MA 2VHGA 3DCAA 1RAEB 1T9WA 1YZ6A 2WK4A 1FKOA 2V9KA 3IG1A 4ZP7A 3I96A 2N82B 4TKTA 4LF4J 1AT1B 1JLAA 3NWGA 1FE4A 3RU0A 1AFIA 2J8SA 4OHWA 4DV5F 1W2BR 1HHTP 2MQOA 2XNRA 4FYWB 4OI2A 2KRBA 1MU2B 3FFIA 3FMWA 3T5HA 2AW0A 2KDOA 2PA3A 3D66A 4DJBA 3HHLC 3V4MA 5KT3A 2DGXA 5KOWA 1HWUA 3SI8A 8AT1B 1R0CB 3LAKA 5BXIA 3JSMA 3KMQA 2CVIA 1NK6A 4M5KA 2DEJA 2GGPB 2XI3A 4OZJA 3T6BA 2J7WA 4XDDA 1FK9B 1WWHA 2OPPB 2VFTA 3JSMB 3S7RA 4NLPA 1HIYA 2WHOA 1VLYA 2QEXS 3CDEA 4CLPA 4A8QA 1YX2A 2E5LJ 1GK8A 4RPFA 4JI0J 1GX5A 3OL7A 4RWXA 4MIAA 1PO6A 2UVVA 3WHIA 2X3DA 5K5MA 1UMJA 3F56A 3SXLA 3G82B 9RUBA 2W8KA 5D4LA 3SSSA 4F4XA 2VASA 4DR6F 2P9GA 1U6ZA 2E1AA 4PCQA 3H25A 4EWTA 3GR0A 4QW9A 4M8LA 1WTFA 4O4RA 1TR0A 4ED8A 3E01A 5J1NA 3GIKA 1CJKA 3W5ZA 4C11B 3TJAA 3OVSA 5J1EA 2V2QA 4KB7A 4NCGA 2N3OA 5AJ3F 3O44A 4H4KA 1U1LA 2GVZB 2H48B 2QMWA 3DRYA 3THPA 7FD1A 5D15A 1WC0A 4WWSA 3TVKA 2KM8C 4Q5VA 1L5UA 3FBCA 4FBTA 1RWUA 3Q8SB 1L3UA 1OPIA 1FD8A 3R5AA 2GMLA 2HS0A 2GHWA 4GC6A 1RTDB 4USWA 4OX9F 2OPQA 3TANA 5CZXA 3SV4A 1NM2A 4IO9Q 3D3BJ 5HQ8A 4P2MA 1T9UA 2UXBF 2NXCA 3KUEA 3G82A 1UJ6A 3UDLA 3UR0A 5I3UB 2R8HA 2AJ2A 4IH6A 4A48A 2XQCA 3VAKA 1VQ5S 4A8KA 1XTZA 3OD2A 5T7LA 2FJDB 3OLAA 3IO1A 4WF9Q 2YWWA 2A10A 5D3GB 2VQEF 2EEYA 5CYMA 4DQQA 4PQAA 1NK7A 4JI7J 3W3SA 2JFDA 3MPYA 3QWPA 1OJ4A 5ETMA 5D77A 4USTA 1KQFB 3S01A 2F8MA 4F26A 2VFRA 2E1MC 1RACB 3VQSA 1CULB 1W25A 3DGVA 4EO8A 4DV7F 2MQPA 3CCMS 3B78A 3UR3C 2HIQA 1NPPA 1UCNA 2JRSA 2Z0GA 4UUWA 1ELOA 3UDCA 4O3SA 3POTA 4X66F 5ETVA 1HPZA 4DL3A 5GADI 3TYTA 3CCUS 4OYZA 3PW0A 4JI8F 5ETLA 2BQUA 2OI2A 1R8BA 3M6VA 3BQ1A 1YDLA 2A1BA 2YPZA 4M5GA 2QMXA 3MECB 4ZVSB 3RUBL 1U1PA 2R7VA 1WORA 4WP3A 3K8VA 3QO9A 7FDRA 3MFHA 3HK2A 1D8ZA 2FJXA 1JK9B 4JV5F 4ANEA 1FI4A 2KH9A 4DV6J 1N4LA 1WHYA 2V2ZA 2UVRA 2J6SA 2V2VA 2DRAA 4CYUB 3GPAA 3VAIA 4OHZA 5ETSA 4R8UB 3QJJA 3DDIA 1KDNA 4CDIA 1UJ4A 3IGVA 1HA1A 2F9DA 2QSFA 5LJ3Y 3RTVA 1FF2A 4QIVA 3R1HA 1WOSA 4URSA 4RBVA 2WVBA 3GZ7A 5LSOA 3EZ5A 1F2HA 3EXCX 4P75A 3MMAA 5DDQC 1S1VB 1M5OC 2BBEA 3DLKB 1RZMA 1W7WA 2A6MA 2V8DA 2NCKL 4ECYA 2HAIA 1TK0A 2FHKA 5LT5A 3CWJA 4NCAA 1IKXA 2CRLA 3NMRA 1YI2S 1ZTWA 2G2ZA 4DN0A 1FD2A 2B8PA 3R6LB 2OTLS 3DU5A 5KFRA 3BKFA 3RGIA 3OSPA 1LKZA 2QMUB 4I2PA 4GVLA 3OSNA 4TU7A 3M6XA 3PJWA 3C15B 1RHKB 1AA1B 2Y0SD 4Y2CA 2F5GA 1VIOA 1VJQA 2E5IA 3G86A 4U8VA 1LXNA 4QWBA 2NQPA 4JI1F 4IG0B 1UFLA 2HWIA 1RAJA 2W25A 5EX3A 4LR7A 3GIMA 4IO1A 2ZD1A 5A76A 3OUYA 3V6KA 3RR8A 4NYZA 1FEEA 2JDJA 5KFXA 2FZKB 4RW9A 4YHHF 5KFUA 2QGFB 2WOMA 3B54A 4C97A 4F04B 4RUHA 4B3TF 3MCNA 1HI1A 4DPOA 3DGPB 2J76E 3CJKB 3DYAB 1NK8A 5E3PA 2H5IB 1H7WA 3VAMA 1S1VA 1S1WA 2LQJA 1FRKA 2HHTA 4TVAB 4F3MA 1UPMB 4DG1A 2CG4A 3CJ8A 4ALZA 4M5JA 2ZNYA 4GO7X 2ZOMA 3TP2A 5DG9A 4CIOA 1FJEB 1NU4A 5C24B 2MYFA 4I67A 2HNDA 3QWUA 2XB2D 2GW8A 3I5BA 3MF5A 2YWHA 4JB8B 3ULHA 4F67A 2HHVA 2XC9A 3MOZA 1DJ0A 3K17A 2GJ2A 3I32A 1HNWJ 5D0RA 5A8RA 3T9NA 3LGHA 1OMSA 2VU5A 3MM9A 2IYIA 1SCJB 2PFDA 2QTWA 3TW0A 5JVHQ 1YITS 3AH6A 3M05A 4FYYB 1WOPA 2HFVA 2YNIB 5FLXY 4TQSA 4B9NA 3LP1A 1CG2A 2ACMA 3JSYA 4ZVUB 1RWNB 4FNHA 4DV2J 1LWXA 1ZS6A 2B4OA 3Q8UA 1SXLA 3HF5A 3J7YI 2AEFA 1FXLA 2CNOB 5BYQA 3JAMU 2E1PA 3Q83A 2AYGA 3DLJA 1HQEB 1XWLA 2CQDA 1WKLA 3FBFA 4KYZA 1IR1A 4JI5F 4LF4F 2XBPA 2COLA 4V1Ak 2G4BA 1RABB 5GMKa 5IFMA 1IBKF 3QQCD 1VQYA 3THVA 4UUXA 4BC9A 3P49B 3J80Y 4W90B 4Y28C 2GVDA 2JC1A 5A2QY 5H9EK 3G6XA 1LW2B 2OSRA 4RUAA 2VBXA 3MM9B 1OS5A 2Z57B 4OZ2A 3Q8VA 1J5OA 4J90A 3IXQA 2ZJPQ 2G2YA 5EWFA 1NDPA 2J9EA 1X5PA 3O6QA 1N52B 2FPHX 2JNJA 2Q79A 1S77D 2RF2B 2OMLA 5A0YA 3S6EA 1X4BA 4WTYA 3Q24A 1GTEA 1XQIA 4K59A 1NMEB 2XWYA 3V4IB 4HT5A 1NK4A 2R7TA 2HQ3A 4IDKA 3SSRA 2NLWA 4KHRA 3LP0B 1RT2A 2MY8A 3TJ9A 4DPXA 2VJUA 4O3NA 3W63A 2XMVA 2MHNA 1FVSA 2RRNA 1WOOA 4E2FB 5F8GA 3Q8RB 5GMEA 3EVMA 1UL3A 3TEHB 4IRCA 1KHWA 5JJBA 3UO0A 1S1UA 4FBUA 2FHOB 3MOJB 1H98A 4I4BA 3JTNA 1RTHB 2H4WB 2QYCA 2YKNB 3BYPA 4I64A 4XTTA 4P6QA 2Y9HA 4NPOA 2KL8A 3I56S 2YWGA 3G9CA 1NDCA 4IG3A 1TL3B 4P52A 3PW7A 5GAHI 1SJFA 2XHWA 1S10A 1LFPA 4OHVA 2PI4A 2J0SD 2R4FA 1A0OB 3DOLA 4C0OC 3H4DA 2R2SA 1GFWB 4YUDA 2WONA 2WVDA 1IBMF 5LXRA 4EZ9A 4TQRA 1I1GA 1HNVB 3NY0A 2CQ2A 1LQ9A 2N4CA 4M5HA 3ADAC 3TZZA 3U1LA 1JNZB 4RX6A 4G1QA 3NG8A 4NA2A 3BGUA 3RRKA 3VGSA 1I3OB 3A8KA 4DOZA 1AROP 4AXJA 4DR3F 4DWIA 1HARA 1TL1B 2JLEA 3G87A 3MWBA 2CWKA 5LSRA 3DRPA 1ZYQA 1D9FA 1SUQA 4B9TA 3ONQA 4IH5A 4JI2J 4L6V3 2R7XA 4DSFA 2XG8A 2OPPA 2HVHA 2VC1A 1IN0A 1OY9A 1XJWB 2ZE2A 3ILIA 2ZWPA 1G4CA 4OJGA 3ZC4A 4TY8A 4AQYF 1M5PC 2RU9A 1N34F 2F8EX 1N5SA 1WSVA 2VBZA 2XI2A 3KHGA 1VRTA 3TQEA 2F4VF 1NB2A 4KKOA 2BW7A 4U95A 4DU8A 5C42B 3D1QA 4OV6A 2CPYA 3MM8B 3FFIB 1WSRA 3QMQA 2H65B 2JEJA 3CCTA 3C8YA 2RT3A 4USUA 4OYXA 1UWBB 2DCUB 1FWPA 3DOKB 1N32J 5E2QA 5DDPC 4OYWA 3CMQA 5EN1A 2DY9A 2UUBF 4YY3J 3CJ5A 3F44A 3M30A 4CO1A 3G96A 2IIHA 2V0NA 1KVKA 3GIRA 5K8PA 1VQ9S 4TLQA 2PFFB 2YTCA 3QO9B 3L9ZA 4C3LA 1UPPA 1F9HA 1KVIA 3MECA 1K47A 1VCTA 3AA9A 3AD7C 3AJ1A 3DHXA 3G8SA 3CDAA 1Q7YT 5DZ7A 3AB2B 4N5SA 4WFXA 4KPYA 3W65A 4RZRA 2MSSA 2A6OA 5BYRA 3Q8YA 5C42A 3NEKA 4ANDA 2UUTA 5KG7A 1VRTB 2QLFB 3SBMA 3J81U 1KC8T 2IC3B 4Z7YA 5JUMA 1QSSA 3V5RA 2PD1A 1CULA 2Z56B 1DFDA 2D1CA 2EVZA 2ZE2B 5KG0A 4ZN1A 1T05B 3RRGA 4B9LA 2G0JA 4O4GB 1JB0C 2W9BB 3G6ES 5CYMB 2CPIA 4R25A 2W2PP 1Y4ZB 3AXMA 4P7VA 5KAKA 2VICA 3PO4A 1FFSB 2FVQA 4KC5A 2HBZB 4MYUA 2GO8A 3A8IA 1B70B 1DQAA 4LSNB 3ISND 4NZ6A 2XMKA 1QUPA 4ECXA 1Y0HA 1YJUA 2YQ0A 2R8GA 1G6BA 3CMAS 1BWEA 3H2LA 1HMVB 2W4PA 4EYIB 3CULA 3QSYB 6FD1A 3D1OA 2CZVC 3DXBA 4D3GA 3K5NA 4GKJF 2KT2A 3TX8A 3SIPB 3OFGA 2A2DA 1XIQA 3M8SA 1LW0A 4F4WA 4KJIA 5EHHA 1RTZA 5HN0A 3ENVA 1Q8LA 1TFWA 1SJRA 2IBOA 2W24A 3BDEA 2JH3A 1KR4A 4USMA 2HW3A 2GVZA 2OKQA 2FIUA 4K2JA 4X4TA 2AYBA 1DURA 4HHUA 1TUVA 1C0UB 1RHUB 5HK4A 5RUBA 2FJVA 1B7YB 2HZVA 3BF4A 2NPFA 1J27A 3EZUA 1D8YA 1V5IB 6AT1B 3C46A 4G6VB 3LP0A 2ZUGA 3A3PB 3PFOA 4CT9A 5E41A 1C2PA 1RKIA 3HD2A 1U1RA 2K7KA 1VFJA 1WHVA 2LEPA 4HHJA 2P5VA 2DNLA 1V3SA 3QT5A 1X8DA 3LPYA 3NGRA 2NYIA 3BSAA 2HAFA 2I38A 5A2QU 3BN4A 1RP5A 4ZVEA 4R5PB 3M2VB 3LWLA 2LDYA 3WX8A 1KLMA 4KGVB 2ZZMA 2IY5B 1C1BA 1EKSA 1TVRB 2G9OA 3U7JA 3UNYA 2HZAA 3H59A 2IA0A 1PBUA 1VQ7S 1HNXF 3HULA 1Y5NB 5CHCB 3EGWB 5HP1A 2CG8A 1JJ4A 2BE2B 3A3OB 1R8AA 2RQMA 1TV6B 3C6UA 1F0XA 3N5BA 4UOFA 4LMZA 2AF6A 4M94A 3QNWB 3CTRA 4O44B 4HDHA 3TJ8A 3Q0AA 4CO2A 1S6UA 2HHHJ 1F9FA 4LUBA 3PXGa 1QJHA 2H54B 1JLGB 4LSLA 1MU2A 1TMJA 2J8AA 2WVFA 1TL7A 3O3LA 4A8YA 2J0QD 3KLEA 1U1KA 1DARA 1R43A 3D6TB 3H2VE 1IKWA 3GCXP 2CQ1A 3IM8A 3OFHA 4B9MA 1UA0A 4WFZA 1O8BA 3IG1B 3L7OA 1F3FA 3GP9A 3N6LA 3C2PA 1AW0A 4O3RA 4RNMA 2C2KB 3DLHA 2W1BA 2R8IA 3US5A 5F8HA 2QN6B 1BWVA 1EB0A 2V8VA 3GV7B 3HHLB 3R1LA 2AD9A 3N5FA 3U1MA 4C48A 2HHWA 2UUBJ 1P8GA 2OIHA 4W4MA 1B64A 2MSTA 1FKPA 3VAFA 3V6DB 1N5YA 1LWFB 3W5YA 3KUHA 4E8UA 2ZBRA 1HBMB 2BA9A 2MMYA 4NZ7A 2YQ1A 1FKPB 4J91A 4DQPA 2I5JA 3SCLE 4OX9J 1LXJA 1N88A 1TMMA 2BJ9A 3D9BA 5H9FJ 2D9PA 2JL9A 4ECSA 3DGPA 3QFWA 2QLJB 4O3OA 3CJKA 2BANA 4DL7A 4U8YA 3RG6A 4PRFA 4NE9C 1JIHA 2DTJA 3H2UB 2EG2A 4RW6B 2QJ3A 2CQPA 5F3TA 4I0WA 3M1VA 3UVJA 5EGYA 2VG5B 1WC4A 1SJ3P 1DTQA 4LF5J 4CM2A 2FJEB 3CB4A 1HW9A 1PC4A 3G71S 5AJ3J 4RU2A 4HH0A 3CMES 4JV0A 4I6WA 4GKKJ 2M88A 3O1LA 4NYPA 3TA1A 1TAQA 4ZS6A 4X62F 2KO1A 4NXNF 1RWXB 1KQSR 1FERA 2ZM6J 2VA3A 4DV6F 1X7VA 2LFVA 1DRZA 1Y3JA 3GJQB 4ZK7M 2LEBA 2NR0A 3CCJS 1S1TB 4A8XA 5DLGA 1RTIA 3VAJA 1ZM4A 4USIA 1KEKA 2MB0B 2IVFB 1C1CB 3KLEB 3HSZA 2C3YA 3UD5A 2RHQB 3SYZA 1NBEB 4OHYA 1VK3A 2UUCJ 4GC7A 4ZCLA 3NNAA 4OYAA 1WEXA 4CH1A 4N56A 5H9EJ 3GB0A 1S0VA 1S7IA 5J1PA 4NCBA 3FCWA 2XLKA 3SCIE 3J81Y 2BQRA 2XHCA 4H54A 3PNIA 4N47A 3DLBA 3KJNB 2VONA 1R27B 2MZ1A 3H5UA 3CW2C 3MTKA 1VQLS 1RWMB 1QD1A 2E66A 2RDIA 3PRVA 1EHWA 3HZGA 3L7PA 4YB5A 3WIVA 4CYUA 4B3TJ 3I5AA 4OYBA 5K9FA 2ERRA 2CPHA 3ZZOA 1F5BA 4LFBF 1H2TZ 1SC3B 2RKIA 3M32A 2M2BA 2MZSA 4R5PA 3SV3A 5B0CA 1XNQJ 3H5XA 4ES3A 2MQMA 3EPIA 3UCUP 1UA1A 5HVGA 4O0NA 2CPEA 1RUSA 1TUWA 2B0GA 2GQCA 1RTJB 2WOMB 1GX6A 1UAWA 3M8RA 2W2NP 3DLLQ 1A7GE 1Q79A 2V50A 2ZDOA 3C66A 4NLTA 4DQRA 4EBDA 2AWZA 3U02A 4LF6J 2BJEA 2IMWP 4F36A 4DQSA 3I55S 2A18A 2MPUA 4PABA 4JUZA 3PJXA 3ZFVA 4EO6A 1NO8A 1HLWA 1RA7A 2M8HA 3IR6B 4QIWD 2MKIA 3RB0A 2MLXA 2OHDA 2VG6B 3GFYA 3T9ZA 5B08A 4NXMJ 2VBYA 4WIIA 4WU3A 1T3OA 3KDNA 2RDJA 4Q0BB 4I2PB 1LW0B 1S9EB 4HTIA 3TX0A 1MROA 2OPRB 1AZSB 1KKHA 3D1HA 1EJ7L 3QAEA 3R7BB 2LECA 3W1YC 1OSDA 4O4GA 1CJVB 1Y5LB 1GTHA 2V68A 4K7QA 5K8NA 4E0DA 3QRQA 4DQIA 2BM1A 4CLYA 4A4JA 5GAHU 2M7SA 2KU7A 2XSFA 4AD6A 3TI0A 3D54A 1Q8IA 1YLXA 1H3DA 3K8WA 4PYAA 3OJUA 4RU9A 3KJVB 1FRMA 2E7WA 3FUYA 4L75A 4ZLLA 2J6TA 4WE1B 1BGXT 4NYOA 2X7IA 2Q66A 4CLSA 3ISZA 5LJ5Y 4JI4J 4M5MA 4F0MA 1RA6A 2CQ4A 4U9RA 2R7SA 3J7ZT 1F2GA 2J0XA 1F5AA 3BZQA 1T02A 1XC9A 3A3NB 3DFEA 1DAXA 4RL1A 1FJGF 2PA8D 2HQDA 1FXRA 2ASDA 4M5IA 3OR1A 1RU2A 2XSJB 4IOBA 1U45A 4DR7J 3BM7A 2FGCA 2JLFA 4RBTA 2EFOA 3FC9A 1D3WA 1DHMA 1ZA2B 4KAIA 5FIIA 3UI3A 1R8PA 2HWTA 2CQHA 4G1PA 3ZZZA 3WX4A 1YHQS 2EFQA 4X4NA 5CCMA 3NS5A 2ZBCA 1JJCB 1QUVA 2ADBA 1FJGJ 3I4PA 4LT6A 1Q1KA 2E29A 3PV8A 2QA4G 2EPIA 3CJTA 4ECVA 1ZZFA 2NXEA 4DBQA 1FTCA 3KWMA 2OJ3A 3HFKA 1HQUB 3HT0A 4WP8A 4DUZF 3QIPB 5H1SV 4WU2A 3VALA 3RAMA 4WE1A 4PPZA 4BWMA 1RWVB 2HLTA 2XMAA 4KKOB 4P2XA 4Z2XA 1FNOA 4UTGA 3FZBA 3VWSA 3M7VA 4DHVA 3CUNA 4A8SA 2DR8A 3E51A 3H20A 3T5KA 1KN6A 2ZDPA 3H5SA 1WHWA 2NXNA 1B7FA 4LFAJ 2VOPA 3CCVS 1CJVA 5AXNA 1NHVA 1YWXA 3MAHA 1RTIB 3ZZ0A 2BV3A 5A8KA 1U8SA 2JLGA 2XO6A 1VQKS 2GHVC 3W5XA 5D8HB 2WONB 4HH1A 4WYLA 2UVUA 3ITHB 2V9WA 1S76D 5HAOA 3R27A 3E2EA 3Q8QB 3G6YA 4UT4A 2GHPA 3DC2A 3PYFA 4PKDB 3BH6B 1CJTA 1JKHA 2CZ9A 2IFXA 2O01C 2XMMA 3BKTA 2YNFB 3TRGA 4KGXB 2W7PA 2YX7A 2DNRA 3ZTPA 2RRAA 1NK5A 1EIYB 3MEEA 4F4AA 4LRCA 3TAPA 4CO4A 2FC9A 3LGNA 2AZ3A 3NBPB 4MIWA 4Q43A 4A46A 3HJVA 1HBOA 1S48A 4LSZB 3M2UB 5HMYA 2DGOA 4QQBA 1ZH5A 3TUPA 1RWWB 1SKWA 3H90A 1S72S 2AJ4A 3JTPA 3RYLA 4ECTA 2UU9J 2XS5A 1X5OA 3VF0B 4F25A 3CF5Q 2O5DA 1I94F 2ZH6A 1YJWS 1N5YB 2YNGB 1U24A 3FZ2A 4UOCA 5IT9Y 1M5SA 1S6OA 3HLUA 3OTDA 5MLCV 1N5TA 4QWAA 3FBEA 3R5DA 3EPGA 4DZDA 2RVJA 5KFLA 3V4IA 4M5LA 2E7XA 1ZAWA 2CQIA 2ILYA 1QAYA 3K7RA 2UUCF 4MH8A 1BXNA 4TY9A 1PG5B 4CNYA 4C2MA 1D1UA 2K1RB 4NRTA 4U96A 2GFFA 4I7FB 1RJJA 2UU9F 2VG7A 2YBVA 1GEHA 4QWCA 4DFJA 4O0IA 1UVNA 1S4EA 1M0SA 2H1YA 2UXDJ 1ZM2A 1FX4A 4ZCKA 2D69A 2ROEA 5GAGI 2ZH1A 3CCLS 3C6TA 2JFKA 3LW5C 5GAEI 2DIUA 1HBUB 1KQKA 4KV8A 4K5RA 2PMZD 5KFAA 5K8OA 4B9UA 4P10A 2MJNA 1R6VA 2Z2YB 3HD1A 2CFXA 1LV5A 3VR1A 2LKZA 3HSGA 4WFBQ 2BE2A 4IH7A 2F65A 5IS2A 3W2WB 1FRJA 2UZAA 2ROGA 3M6UA 1UEVA 2Z2LA 1RT5A 1VGYA 4C3MA 5KFDA 5DM6Q 4YQWA 3W9IA 1U25A 3BGRB 1TVRA 4EEYA 5IC6B 1R6YA 2XMWA 3UN2A 1SIZA 5D4OA 5G0RA 5J2MB 2PGCA 1VMBA 2AYMA 4RW4A 2R8KA 1H7XA 2VC0A 4HVZA 3CPWR 2HMIB 2N3LA 1UZDA 1X60A 2GMHA 3M2UA 2Y1RI 2VUGA 2V34A 4QYZK 2IA6A 1NUEA 1UFKA 3RB6A 1HNXJ 4OZ0A 1VDHA 2R42A 1C0UA 4FXVA 2FZCB 3MCSA 3VZHA 1SV5A 2HFNA 3MHYA 4DN9A 2ZZTA 3J7Z5 1M1GA 1YK9A 1X4CA 3ZXWA 4TU8A 4MAKA 4P7TA 1VR6A 1MW7A 4YB6A 4ZPVR 4LQ3A 1UVJA 4PQUB 2BJ7A 1QLNA 1JLQA 1NZAA 1HWJA 3GILA 1SIWB 2V8HA 2ZH2A 4ID8A 4DV5J 4ZPWR 2XY7A 3QT8A 2QLBB 3WZ0A 2LQBA 1HNZF 2DVIA 2VIHA 1K9MT 3CGIA 4MKVA 4Q8EA 1PJ5A 1CSJA 1RWKB 1YRXA 2FHMA 2M70A 5A8WB 4XIUA 3CCSS 4IOAQ 1VQPS 5KFSA 1MLAA 1SJ1A 3PJ9A 3QATA 4A8WA 1IVZA 3BYRA 2CPJA 2EXUA 1UETA 2DD8S 4NZ0A 5G4DA 2OPSA 2GIQA 1JMTA 2CQGA 2KJVA 3FCHA 2GJIA 3NAIA 4M5NA 3RBEA 4Y2MA 4CWBA 5I3QA 5HMXA 4K4SA 5F8JA 1RBOB 2AYEA 3ZNJ1 3TA0A 2W9BA 1U0HA 1SVDA 2M3DA 5GVQA 5D6GA 2WTFA 4DR3J 1Q81T 4ECUA 2HPUA 4DL2A 1SB6A 4R8UA 1HBNB 4OX8A 5IV3A 3K57A 3KG0A 3ZZYA 5ETQA 2XZWA 3HVTA 2AGPA 4U7UD 2VH7A 3OTBA 2JWNA 3PIOQ 1U2FA 1JNRB 4DUTA 4NI2A 3R2CJ 3KLHB 3NNCA 3PW2A 2M5YA 3TZYA 3HPOA 1IQZA 4J9QA 3HO1A 3A12A 4LVNP 5KG6A 3PYDA 4Y2KA 4CLWA 5DQGA 1VC6A 5KFVA 1JLCB 1NKBA 3AOBA 2EW9A 1SH2A 2HFUA 2NXJA 1S1XA 4EYHB 4ECQA 4DSIA 2OEJA 5L39A 3OR1B 5H9FK 3KLIA 3MMCA 3WBZA 4FDFA 3MFIA 4D3HA 3OT9A 4F4KA 3JAMY 2B9WA 4ZITA 4Q45A 4B3OB 3H98A 4FS1A 5ETRA 4JV2A 2N4DA 2D74B 2C22A 1CC8A 4LF1A 4B02A 4EI2A 1Y11A 4I7FA 5EUHA 1RT3B 3UE2A 4LJMA 4PXEA 3HJFA 4C8YA 4I69A 1IQTA 3IR5B 3VZIA 1RBAA 1S6PB 3I0RB 5LOQA 2B9YA 2HVDA 2W2OP 4CP5A 2JEIA 1Y10A 2OO4A 1QAJA 1APSA 5KG2A 3MXHP 5D0EA 3NXZA 4JI3F 1V3ZA 3LUYA 2LQ9A 2E7VA 2IJRA 4FF4A 2ZNZA 1WF1A 4P9SA 1KQGB 1JXEA 3D2WA 2JVOA 1TK5A 3PYGA 4UQGA 1R8CA 3NGDA 2JEGA 2IJFA 2L41A 4LF9J 1DTTA 1E6VB 3PKYA 3SMZA 1U7LA 2IVMA 2VPWB 3ZTRA 3TZXA 1YIJS 4B3SJ 1U1NA 1BQMB 1DQ8A 4PG5A 2HIYA 3UQSA 4EU0A 4ED6A 2IC3A 1O0PA 3DOMA 4HL9A 4NCGB 4UY85 1VBKA 4DZ6A 3MUVP 1XK8A 3MEEB 5AE3A 3K0JA 1WELA 3DOMB 2VKZG 4B3MJ 2VOOA 1G2EA 2HGNA 1H73A 2PDAA 5HMZA 4DCPB 2CJAA 1OYDA 3IS9B 5ETPA 2C2EA 3N79A 1SKSA 3CC2S 1HYSA 1REVB 1VRUB 2KXHA 2NPIA 4QIFA 3RRHA 1S0NA 1SI9A 2FYXA 1UP1A 3M30B 5EWEA 3PFEA 3WQPA 1FKAF 4NXNJ 2J7KA 5ADZA 3CT9A 4Y6IA 3E01B 3JS9A 2Q6BA 3P4UB 4QZVB 1FDDA 5E7OB 4KH0B 4WK1A 3KNAA 5HSPA 2OUGA 4F7VA 1JXLA 4LIRA 2RILA 3D6MB 4C0HA 4DFMA 2MKCA 1UWBA 1JLBB 1V9OA 3TEGA 4ITSA 4AL5A 2YVSA 3FSIA 3LP2B 3BEGB 2RF2A 2O67A 2BJ3A 2EKNA 4JOUA 4LRDA 5ETNA 1RHRB 2MDAA 3CO9A 3RB4A 1UVMA 2W8LA 4HHHA 3GV8B 1FT8A 5F9LA 2FTRA 4LFCJ 2C3PA 4KGMA 4XK8C 2X1FA 1FK9A 2JJ4D 3IC1A 3LP2A 1UW9A 1S57A 2AGQA 2Q6CA 3KUGA 1HQUA 3PX6A 2GS8A 1NDKA 3SSQA 4ZIWA 2CA9A 3OFEA 3TAQA 2HHPA 1SUQB 3TOQA 4A8MP 1HQEA 2ZHBA 1AB8A 4MKBA 4LRBA 5HBMB 5F8MA 1TTHB 4YN3B 2EKYA 2AZ1A 4QJVA 5FDLA 3AAWB 3NL0A 1RCXB 2XMTA 2M9KA 1BUXA 3K5LA 3OR2B 3M6WA 1QTNB 2IBKA 2KYXA 2R2TA 2ZITA 1EX8A 1FKOB 1N33F 1ITPA 3AB4B 4JBCA 1DTQB 3DOLB 4LBHA 3GG0A 3KNGA 3W7BA 4DX7A 1Q78A 1U47A 4K4VA 3Q89A 3CD5A 1P27B 1PAUB 4IG3B 1ZETA 4WZQA 4ELUA 3W2VB 2PN6A 4ZVGA 2QL9B 3PG9A 3HCXA 2B9XA 1BQNB 3PYEA 1LFWA 4B17A 4FF2A 1HNWF 5I42B 3LTOA 2UUAJ 1UKUA 2I5JB 2VV5A 4A8OA 3FQLA 1PJ7A 1T9TA 2CNNB 4LREA 5I4MA 2AX0A 2VZ9A 3ELHA 4EK2A 2DGSA 4KO0A 2UV8A 4HR2A 1UEUA 4NLSA 5HANA 4IUFA 5FLXU 4ZVRB 2BJ1A 3I9ZA 1FNXH 1FVQA 5A8WA 2BW2A 1URRA 2L9WA 3QGHA 1MROB 2OPRA 2IYGA 4KTQA 4O23A 1T0TV 3PM9A 3SCKE 4CQ1A 2QA2A 2IDLA 4N77A 4DX5A 4QWEA 1X9SA 3A8JA 2I6WA 1VC0A 3P6YC 4AT1B 2UXCF 2NZ4A 2QO3A 4FYXB 1FRHA 3LWMA 1P1TA 3EZOA 1D9DA 2PI5A 2DHHA 3P45B 2WCXA 3A1YG 4DV2F 3OTEA 4H4MA 4ECZA 1IJEB 1WD6A 1RWPB 2D9OA 2UP1A 2FDNA 2KVIA 4UF4A 1HFEL 2OAUA 3R5GA 1ROFA 2XCPA 4KE5A 4J9SA 4NX9A 1Q82T 1RB0A 2M52A 4YEAA 2CUYA 2BMBA 3N6MA 3EJMA 3FNNA 3MEGB 1IKYB 3HVWA 3GLJA 5JXSA 1TZ0A 2BJDA 3BKUA 4FPIA 2HBQB 5CQGA 4I2QB 4RO0A 3CCQS 4I2QA 1KLMB 3CO0P 4ER8A 1S49A 3A13A 3LANA 2JC0A 4ZHRA 1FDNA 1Q95G 3GIJA 1M1KT 3IRXB 3I87A 2C2OB 2HNDB 1BHNA 1TL5A 2C2DA 4PAAA 2ACYA 1N36F 1YBTA 3KJQB 4QPXA 4RWWA 5GAGU 1U0HB 2RNEA 2XZDB 1IXKA 2J9DA 2HHSA 1UFWA 5DDRC 4X64F 3JXOA 3NP5A 4X4VA 1M90T 5KG1A 4G65A 3ZNUA 4QIEA 2RUGA 5ETTA 4OZNA 1IM6A 3DRRB 2EK1A 3TWZA 1F1BB 4WIQA 2HSEB 3EWGA 4OJHA 1IKYA 1Z2ZA 1EARA 1RI7A 2L9DA 5E5NA 3SCJE 1N48A 4LF6F 2YNHB 2YY3A 1WC3A 3FDSA 2Q1LA 2FD2A 3TUIC 3MMBB 1XNRJ 1Q8BA 2HGMA 5ETOA 3M9OB 3MD1A 5KFBA 4N76A 2MXYA 2YPYA 4OX7A 4DPUA 4ZIVA 1F9EB 4ES1A 4ED3A 4M63A 1URNA 3N0VA 2HBRB 3QGIA 2BRKA 2HK2A 4C4WA 3X3UA 4NLVA 4K4XA 2LU1A 4YOEA 2AGOA 4WFYA 5IT4A 5DQHA 4Y0FA 1RT7A 2V6AA 5CAAA 3CJ2A 3E3XA 4MFBB 4CZCA 2GV1A 2C3OA 2QC3A 4L3KA 5IWAJ 4ECRA 1NJZA 5AE1A 2ZBPA 2CJXB 4K8RA 4NMXA 5IQ6A 3BGFA 3C15A 3PX4A 1SL0A 3JB9k 1T03B 5DQIA 4ZMMA 3Q23A 5IT9U 4YR3A 1XR6A 4XO0A 2FJBB 2VG5A 5KFOA 3MR5A 1WF2A 1XR5A 1B99A 1WC6A 5GMDA 4FVMA 5AXMA 1WI8A 4YB7A 2BANB 1T05A 1IKXB 3BDPA 3PRDA 4FNIA 1ULRA 1RAIB 2Y8YA 3MM6A 4Q44A 3DLKA 3CJRA 1AUDA 4L73A 4U7UK 3T1AA 5D78A 4F3QA 5KFMA 3G8TA 3MMAB 5IWAF 3FCVA 4DUYJ 2F9JA 2P9EA 2MKKA 4IRKA 4R0JA 3F0NA 4K4UA 2DK2A 2HK3A 1GMVA 1C0TA 3GJTB 4OJ3A 4ETXA 5GADU 1F5CA 2CQBA 2NXUA 3R9LA 2APOA 2IM3A 1PSDA 2WBMA 2CKWA 1CQNA 2Y1IA 1LOUA 3L09A 3VHQA 3CC7S 2DT9A 2RAQA 5IV4A 4JV5J 2WSCC 1NDLA 2E9TA 1EP4B 2BJ8A 1VQ8S 2ROPA 4FYVB 1NJYA 1FJCA 1YG0A 4F50A 1VQOS 1BY9A 1FCAA 4RW7B 3HHDA 5JMNA 4BC7A 2ZH8A 3AQPA 3IMQJ 3PX0A 2Y0BB 3UFCX 4DUYF 3SQGA 4K0KJ 4I56A 3D4JA 3LGMA 4C7QA 5HVHA 2ZKUA 1RLDA 2XGQA 1NJIT 1R89A 4FYDA 2HQFA 3CIMA 4H4OB 5E3RA 2G13A 1B3TA 3POTB 4WKYA 2DXDA 5KFYA 1CJUB 2AEJA 1NJXA 4KFBB 2EBGA 4OI0A 2Z4PA 1CEZA 4JI7F 2HS3A 2PO4A 3C6UB 4TYBA 4ZCMA 4RNNA 5HP1B 2E1RA 4WFAQ 2F3JA 2H51B 5KFPA 4J9KA 3HVRA 4ZVQB 3OV7A 4JYAJ 3H5YA 1RGVA 1VK8A 1FTRA 2PIIA 1OQ6A 2FVCA 2OSQA 4FKYA 5F41A 3W64A 3PIPQ 3R5BA 4AYBD 1I6JA 1KS2A 3QLHB 2DR5A 2V63A 5ITHA 5I3UA 2W01A 2B4UA 5C2GA 1HYSB 1FDAA 1CBKA 3IBWA 4PWDB 2VB6A 3BPDA 4ANCA 3HMJG 3B6BA 3EICA 3M8YA 2LXUA 3B82A 2WB1D 3QPIA 3UWTA 3UCZP 2OPQB 3NNHA 2KM8B 1WUUA 2XLIA 4Y2AA 1C4CA 2V5HG 5J2QA 3NS6A 1UTAA 1P9QC 2B4VA 3ZTQA 2DJWA 1REVA 1VRUA 1FWLA 2ZEJA 2YX4A 2CXEA 2HWHA 2ZOGA 2KFYA 2K8GA 4LR8A 5J2NB 3G4SS 3T1YJ 4DLEA 3VVUA 2B4PA 5BJRA 2WVEA 1RT6B 5B0GA 5J2QB 2O66A 5C25B 2HURA 3KJVA 4IQMA 4ZDNA 2GCFA 2RRBA 3MCOA 4P74A 2RDDA 1HKAA 3BSCA 2VJVA 3HHLD 5A8KB 4QYRA 1GAOA 5DM7Q 3D67A 2K06A 1BQMA 2SXLA 4LRFA 4J9NA 4H4KC 2HG4A 2MZQA 2E5JA 2C3MA 4LFBJ 1AFJA 4J9MA 1JQGA 3QLHA 1EETB 4MIBA 3R7NB 1MMLA 4Q0BA 4C8ZA 5KFGA 2B6AB 4RW8A 4DFKA 5KFKA 4JV1A 2HQGA 3QIPA 4P2SA 1TKZB 4MK7A 4X65F 4C9DA 1OIAA 1NJWA 1HNIB 2YQ3A 3FSXA 4KFBA 4X84A 2AX1A 3QZ7A 4ZPCA 2DEIA 3D28A 4B3OA 4ZLNA 2XGPA 2BUNA 2AMCB 3GQCA 2UXCJ 1WEZA 2DIVA 1RT3A 2B56A 3QFHA 4XPCA 2ATLA 1RLCL 1RU1A 1RTJA 3K89A 1PCAA 4NLXA 1X9WA 1JLEB 3DRSB 2HRTA 2RSQA 1O6XA 2YNIA 4IFVB 1EQMA 3KLHA 3M32B 4X2BA 1WG5A 3V6HA 1FESA 3CSKA 4NLWA 5D4PA 4ZJLA 2G2OA 3OTOJ 1VLOA 2RB7A 4FXWA 4UZBA 3HVTB 4DS5A 2DR6A 3TAMB 4DMZA 1O5JA 1YRUA 3DNCA 3M2RA 4NLYA 3UW1A 4U7CA 5EWGA 3MM5B 5HLFA 4OI6A 2MKSA 1EQ0A 3CIZA 1XNQF 3KKFA 1RT1A 4G3IA 1N5VA 1C0TB 1SH0A 3MM8A 2J0WA 4J7CA 2IRYA 4NI2B 4DG1B 1U48A 2GAHC 3NGSA 2XWXA 2V4JA 3VGTA 4CLUA 2DRDA 2OFHX 4O3QA 1FRLA 2CIMA 4NLDA 1KTQA 1RT4A 4KR0B 2ASLA 1FHTA 3KK3B 3GJRB 1HR0F 4LF8F 2IM0A 5DZ6A 3NLCA 5HVFA 2R7WA 5F0UA 3T41A 2K7JA 3CDBA 3KLFB 3GV5B 4OL8A 3DRPB 2HS4A 2R2UA 2UXBJ 5A6WA 3OUYB 4DL6A 4AL7A 4X4RA 1MMDA 3AXKA 5DETA 1YQHA 2LQ8A 3IAM9 4NASA 2DITA 5M2RA 4DX6A 3H8YA 4YY3F 2KG0A 1RT7B 1HNVA 2B5JA 1YSJA 3UD4P 2HRYA 5SZTA 4DR2J 1AXQA 4ZVPB 1YVFA 4WCEQ 2ZM6F 2WAQD 3N9UC 5KG3A 1NSQA 4DSLA 4NWBA 1NXIA 3D6FB 1X31C 3KDOA 3RBXA 4B08A 3N28A 4PQUA 2XM3A 1ZOTA 2DNKA 4NMLA 4LFCF 3ILOA 5THWA 1H38A 4CCHA 4K5SA 1P6TA 5LXYA 1BMQB 2F1FA 2F4VJ 3MEKA 3VGUA 1ZBTA 3ZZRA 1KLNA 1N8RT 4F0HA 4QR0A 1OYEA 3DI6B 1YBUA 2KJWA 1PAEX 3HP6A 1VQSA 1RXOB 3PCOB 2DYAA 2EI5A 2CVEA 3W2WA 3TARA 4UZCA 1QAXA 4EBCA 1Q5VA 3IWLA 3HHLA 2AEMA 1V3RA 1VC5A 2HMIA 3A4TA 1FDBA 3M2RB 2O3DA 3LPEA 5MAOA 4HEA9 1TKDA 1TUGB 2DNZA 3WC2A 1U1MA 4KV8B 4DPWA 3KHRA 3AOCA 1S9FA 3AODA 3C6TB 2J9CA 2U1AA 3D68A 4RKUC 2MQNA 2C28A 3RW6A 1WDTA 2LXFA 2CDQA 4KT0C 4OLPA 2YH0A 1T11A 2CADA 1T94A 4GVBB 2GAGC 3RZAA 4DPTA 3DU6A 3MM7A 2AHOB 2EK6A 2RUSA 1H2VZ 4DDFA 7AT1B 2FLOA 4ZVOB 3W60A 5ETKA 2FVRA 4C8LA 1T3NA 1S1TA 2E5GA 1UVIA 1N32F 1HPZB 1X4GA 1HBUA 3HT3A 5CD4A 1R31A 5AXKA 1RAAB 4UW2A 4DX8H 2W4CA 2VF3A 4C3KA 3R8YA 4P71A 4DV1F 3KLVA 1YBAA 4OQJA 4CH7A 5J2PB 2MQ8A 2CAJA 2DY1A 3QYYA 2OFGX 2WB4A 4NLQA 1B4SA 2WW4A 3F41A 2K1RA 2OMOA 4K4WA 2UV8G 5DS7A 4G1IA 3KHLA 4UOGA 4X4UA 1FFGB 2FLLA 1AUSL 1C1BB 2CQ0A 4XDCA 2ZOFA 4QOTA 1J5EF 4WP9A 4DXLA 1ZA1B 3HFZB 4URGA 3V6JA 3KK2B 5IQQA 2PMHA 2CJYB 5C24A 1NKCA 1ZZNA 1VQNS 1RHMB 2F63A 3GTYX 5KFCA 1IKVA 4KIAA 1NK9A 5HQMA 3NBPA 2HHUA 3LH2S 2W7OA 2YKOA 2BE9B 5KG4A 4ZPTR 4DV0J 3DI6A 2ALYB 3OXLA 5C25A 3K5MA 4X4SA 3V6DA 2NREA 2ZKTA 5C7PA 1M5KC 3GIIA 2CJ9A 4K50A 3KHHA 3IS9A 5HJYA 3M8PB 4KH1B 1N5QA 4KRWA 3DLGA 4M5DB 3PZPA 4YP3A 2BKOA 3DDNA 3QGGA 2LYVA 4S0MA 2K3IA 3CJSA 4NXMF 4KHPJ 3NRBA 1NHUA 1HWKA 3K5PA 1TKZA 1RYSA 4ECWA 2RS2A 2ZZNA 4FN5A 1U49A 2ZBQA 2HEKA 3OR2A 1U1OA 1QTMA 4IR9A 1XERA 1VHFA 1FFWB 2B8QA 1HMVA 5FDLB 4DV3J 5K8MA 4K2XA 1HWIA 1VIXA 3J81j 1Y5IB 4IFYB 2RMLA 3IWXA 3C3LA 2NS1B 3ITHA 1JLFB 2DHXA 1EAYC 4OYIA 2HVEA 5CH7B 5CCLA 4LF7F 4DR4J 2KZMA 4I6AA 5K14A 3VCDA 2MLZA 3EE3A 4EZ6A 1RHQB 3PEJA 4HI1A 2CPZA 2GGPA 1GNKA 1WKJA 2WRMA 2R7QA 3OL8A 1UZHA 3FGVA 3FEZA 4OIXA 4X64J 4FS2A 1MN9A 3LO3A 2V4JB 3KK1A 3IRWP 3PY8A 5DJBA 4H4OA 4JI3J 4J9VA 5L38A 3M2VA 4JI5J 3CEDA 1RT1B 3CNQP 4MKAA 3I0SA 2W9AA 2J5AA 1U6BA 2H9ZA 3NGTA 3TVZA 1MSWD 1P1LA 1LWEA 2AJ1A 1GXLA 2BKNA 2ZC3A 4PG8A 1L3VA 1KFSA 1XMOJ 2I2YA 4MKYA 2HVIA 1HI0P 1X9MA 5BR8J 4F3OA 4ED5A 5U47A 4ZP9A 3PVXA 1AYEA 1HL6A 3V2UC 1OY6A 2QL7B 4QYZJ 3K5OA 2YX1A 1SL1A 3D0IE 3HZEA 1N0UA 2ZHOA 1N54B 4P72A 5B0EA 4ZA1A 2FB0A 2JOQA 5CA5A 1SC6A 1JLEA 3AY0A 3DRSA 1S99A 4ELVA 4BCAA 9ATCB 2X1BA 5EDWA 3J7YU 2KZZA 5F8NA 4HDGA 3DM2B 1XNRF 5D0GA 2DCLA 3EDRB 4PG6A 1NEEA 2DNGA 1U8WA 3CCZA 3EX7B 4ED1A 3KK1B 1CC7A 2Q3PA 1NPRA 2N7YA 3HHNB 2VPXB 2W9CA 3MM6B 1KD1T 1HNIA 2VODA 2BQ3A 2XZTB 4K4YA 1LK5A 1WF0A 4WBFA 3KYLA 1SBRA 1TFYA 4DSKA 4X4PA 4LF5F 1RYRA 3P5BP 2B6AA 4RW8B 1Y7PA 3IGNA 1N36J 4PXCA 4YMEA 2HFOA 3GYGA 4JI2F 1IWGA 4ETZA 3EGVA 4QIGA 3SDEA 3R2DJ 1OWXA 2QG9B 5F9NA 3PHEA 1MWZA 4LBPA 2DGWA 5F8IA 2AJQA 3H42A 4NA3A 3BBFA 1H6KX 3N4WA 3W8GA 3TA2A 2ZH5A 3KOAA 3MR3A 2MEWA 4DR2F 2VFVA 1AZSA 2ZH7A 1UWAA 5BYSA 4GO5X 3I9V9 2ZC4A 4V19J 4B3MF 4CT8A 4I1TA 1WC5A 4OJ1A 2YKMB 3OXGA 4JI8J 4ID5A 4LF2A 5B7WA 2LP4A 3OQ2A 2VG6A 4I6YA 4DSEA 1U1QA 1U6FA 1Z4UA 2IRUA 4QU6A 4UQTA 1OPZA 4JP8A 1K1QA 5J1EB 2EFPA 2R2RA 2B9EA 1KOHA 5CD4H 4DR5J 5KFIA 4B9VA 2IJNA 3KLIB 3MMCB 4ED7A 2PE8A 4DI6A 4PYDA 2MKHA 1Y00A 1S1XB 3C19A 1EZZB 2VQEJ 4ED2A 3T3FA 2P6SA 5DLFA 1U26A 1UEKA 5AE2A 1R0AB 1VS3A 4ZVTB 4C8KA 4V19X 2HHHF 2CYYA 2QRRA 3I0SB 1PKUA 1ZM3A 2XNQA 1WHXA 1RAFB 1PIEA 3MR6A 1L3SA 4ZHRB 1L3TA 3KJFB 1VRQC 2RKIB 4CO0A 3MZIA 2MY7A 1RAOA 5A6PA 2B51A 2POKA 1TL4A 4BS2A 1QE1A 3NOGA 1LW2A 4DLGA 2CPDA 2VD3A 5M2UA 4EGLA 4TY8B 3V81A 2BR0A 2JVRA 2AT1B 1VBXA 1C1CA 2IM2A 3R97A 4YDDB 3GE9A 5IM0A 1J5EJ 4F2RA 1F60B 3C16A 3JQMA 3L7UA 3OFFA 2RQKA 4DCOB 4PUOB 3H4BA 2MLYA 2RH3A 1YKWA 5T14A 2KFNA 2DNMA 3NKYA 3GJSB 5C5JA 5DG7A 5B0FA 4BHQA 2DBBA 1QY7A 2DHAA 2LEAA 1VQMS 2KHDA 2OPSB 4ILLA 1V6HA 4JI6J 4FP9A 2HNZB 3S1TA 1CPZA 1SQEA 2MZRA 4X66J 2W2QP 1KSPA 1JLAB 1SJQA 3GG1A 3NMAA 4W92B 2WBRA 2XYHB 4L76A 4CLZA 4LF9F 5D4NA 2D3ZA 1BD6A 1FRXA 1NSKL 1ZPVA 1Y3KA 3NCPA 2AIRB 2DNQA 1JLQB 2OD6A 4J9OA 1TP7A 2KXNB 3SFUA 4Y34A 4Y65A 4OI4A 2QSWA 1R7IA 1KBRA 3QSIA 4WTOB 5KOXA 3NCQA 1X0FA 3LAMA 3ENQA 3Q86A 2KT3A 1SKUB 3MCMA 2FVSA 4JYAF 1KP6A 1S1UB 3CCRS 2FY8A 1X4AA 1Q8KA 2QYGA 3K59A 1IBCB 3M8QA 4RNFA 1FXDA 4OLOA 3HX9A 1N6QB 2FVPA 2H5JB 3HFVA 1XMQJ 2BZ2A 2XTJP 3MGJA 1N33J 1T8EA 2DH8A 2EWHA 4MMOA 4RUCA 2RQ4A 2QT7A 4F4YA 1PGZA 1S0MA 3R3TA 1QSLA 3CXCR 1Y9OA 3GFHA 4OFZA 4P2FA 4QR1A 2RU3A 5CABA 4ZP8A 4DCJB 3KK2A 2KN4A 2DH7A 1GMWA 2DGTA 1GQEA 1K73T 1HD0A 1SPBP 5A0YB 2AJ0A 4AQYJ 2R8JA 2HQIA 1HQ2A 1G3OA 3BGRA 1IUJA 1U2RA 3R7SB 4YS2A 3LF0A 3BGOP 3MURP 4FF1A 1YJVA 2DO4A 4F8RA 4BWJA 4LF7J 4DR7F 1CJTB 1JKHB 2ASYA 2GVDB 2QE5A 1CVJA 2MKJA 5E3CA 4ZJOA 4JI1J 1TQLA 1T9VA 1YZ7A 2G1HA 2XMJA 1H74A 2DXEA 3DLEA 2R3VA 5HBMA 3KLGB 3MAQA 4RJVA 2NSCA 1GT8A 4FXDA 4EMDA 3ENAA 2C2MB 2E5HA 5LMNF 2AU0A 1NB7A 2FY1A 3CD6S 1WDDA 2NZCA 2VL1A 4AXIA 2E44A 3MMBA 3IA0A 5E3AA 3T19A 4KHMA 3M8ZA 4KHPF 2P9CA 4WXWA 2HFZA 4OZLA 5AT1B 5BR8F 1R8HA 5CYJA 1YJ9S 1VBZA 1I5OB 2HKEA 3BN7A 1BC6A 1LWCA 2X51A 3CD7A 3IWNC 2ZJRQ 1K8AT 1WEYA 2HLUA 3FQKA 2FHJD 5F8LA 4B3SF 4B9SA 4DF8A 1WG4A 2JZ5A 2V8GA 1X0PA 4WXOA 2XS2A 1TV6A 3N6NA 2QX0A 4HI2A 3THTA 3EVWA 4HYKA 3HSJA 3IRXA 2A0FB 2ABYA 3D7SB 3QGPA 5SUHA 3RJMB 4DL4A 3B8HA 1QE1B 3MMJA 4E98A 1R0AA 1VISA 2L08A 1P9YA 1K0TA 2LDIA 1Q7LB 2LXIA 4ZVFA 1REGX 3AD9C 3KG1A 1XR7A 8RUCA 3T6JA 3VTIA 4I68A 2PSZA 4IFVA 2DNOA 3DYAA 3MEGA 2YWKA 1C4AA 5DDOC 2QLWA 1HBOB 4DF4A 3H40A 3Q8PB 1F6TA 3H0PA 5L8RC 2BACA 5FD1A 3AA8A 3FVYA 3AJ2A 2KB2A 2XSJA 1WI6A 2GC8A 3FEXB 4PG7A 3T5JA 1DLOA 2BVZA 5HJXA 5M2PA 2XY6A 1S7HA 1EKRA 3EVOA 1OQ3A 2EFNA 4MK8A 3ILLA 3W66A 2X3GA 5LSLA 4IG0A 4YR2A 4F0KA 3WIUA 2CJKA 4N41A 3CCES 3I31A 3W9HA 1S79A 3BSNA 1WC1A 3P3DA 1RDRA 1ACMB 3NS7B 4IRDA 2VDIA 3M4XA 1NSAA 1RCOB 4LSNA 4NEYA 1N0VC 3DHWC 4IR1A 2ZVSA 2JX2A 3NGKA 3W61A 4KGKA 5HMWA 4F02A 2HNYB 3O8WA 2C3UA 5L9NA 2ADCA 2I8EA 5IXUA 1S0OA 2NSBA 4DR6J 4K4ZA 2CWXA 2XYGB 3J80U 4OYMA 3GSIA 3PO5A 1MWYA 1JX4A 4BDPA 3TVYA 2DPIA 3SFGA 5IOLA 4EUVA 1D09B 2LA6A 2NYHA 5IZHA 3HXMA 3JYTA 4CLFA 2DHGA 1RT6A 3I6PA 3UN3A 4ZPBA 2OD4A 2AQ4A 3Q2TC 2KG1A 2VDHA 4YFUA 3ICLA 3IAS9 4W98A 2C2ZB 1G1XA 2DNPA 2LU2A 3BREA 1KNZA 1K44A 2IHR1 2RD5C 3WC0A 5KFWA 1SKRA 3W2VA 4M1KA 2AJFE 2I1RA 1UVKA 2BX6A 2W9CB 1DZ5A 4KQZA 2B7BB 4CLLA 3IR7B 1DLOB 3W9JA 1U0SA 3OVAA 2E1CA 3OVBA 4ELTA 2JHEA 4DV1J 1JLCA 2VKRA 4N8NA 1PJ6A 4USKA 1X5SA 5I3PA 1K1SA 4PXDA 2V4RA 5DGAA 4EFAC 3BQ0A 2PMWA 4ZKAA 2B7CB 4PPDA 2UUWA 2CQCA 2E9RX 4FPRA 1UJ5A 5LM7E 4C0BA 2DNHA 4U6PA 3HDSA 1SC1B 4OYPA 1R3NA 2EC2A 5CYQA 1VHIA 2C2NA 2KKHA 1WNEA 5HROB 2IVYA 2P2CB 2BM0A 2BKPA 3QAUA 4PG4A 4J9LA 3U1NA 3OTCA 4DS4A 3JSBA 1IM4A 2V8PA 4BLGA 3GFXA 3M9NB 2X1AA 2ZHAA 2YH1A 3BO4A 3Q2SC 2XMUA 3AD8C 4LF8J 2H4YB 3PACA 1JLFA 4OZ1A 3JYTB 2D7SA 3EGZA 1M5HA 3MR7A 1LWCB 3BS9A 4ZLPA 4G1QB 1VBYA 2VPZB 2WSEC 4MT1A 5DRKA 1RAGB 3MDFA 3IM9A 2LQ5A 1JLBA 3OHBA 1KWMA 3JQKA 5K14B 3BJYA 2XCAA 2Y8WA 1Z1ZA 3EGNA 2M8DB 3TUZC 1S9EA 1ZM9A 2MZJA 2D3UA 4DPYA 1YJRA 2L9NA 4MJKA 1TL1A 1H72C 3GU0A 2BYCA 4IFYA 4KPCA 4PEOA 4JI6F 3TO8A 1LK7A 2V94A 1X4FA 1TL3A 3FRYA 3MD3A 3IBCB 5B0AA 4CO3A 3WDOA 3OL6A 3VAGA 1LEOA 3BO2A 2ZH4A 1H0HB 1OO0B 5J2NA 2BOAA 2PEHA 2YKNA 4USJC 3OTOF 1VJWA 1ZAXA 3E8OA 2DNNA 3KG4A 1WG1A 2HFSA 1TELA 5KFEA 4TU9A 4LR9A 2ASJA 5AXLA 4JI4F 2KFZA 1JWWA 4HKQA 2PC6A 4XAKA 1K0VA 4Q2MA 1NHKL 3UN5A 1YJNS 1RT2B 3C14A 4ICLB 2IM1A 4IDKB 1Q4RA 2WW8A 2GJFA 2XULA 3HKZD 3M8PA 4KBIA 1IR2A 2B3TB 4OZ3A 1QAIA 3PHTA 4HLBA 4B3RF 4PWDA 3AJDA 4Y2IA 1DTTB 1E6VA 3VVTA 2ZFHA 8ATCB 1ZAVA 2UUAF 1BQXA 2KYZA 4CTAA 5C2CA 3M8WA 1GXUA 4NLUA 1GXTA 4LFAF 2RE1A 5KT6A 1TKTB 3M8QB 5KG5A 1QSYA 4QCLA 4WKRA 2CZ4A 1FEHA 1FNMA 4FVCA 2J7UA 1IKVB 2RS8A 1B0VA 2Y1JA 1H2UX 3CJ3A 3DN9A 4DU7A 4DR5F 2GIFA 4WK3A 1L3KA 3QRPA 1KOOA 1Z2LA 2VPYB 4NLGA 1RSCA 3GSDA 1HWLA 1CJUA 5CZVA 2G0IA 4CRJA 5F3ZA 2MGZA 3I0RA 2O1PA 1KTVA 5L1KA 2VA2A 1XMBA 4B3RJ 2IRXA 4FZVA 2CQ3A 2ZUAA 3KXDA 3JQJA 2OP5A 4NEZA 3QZ8A 5LMNJ 3P8BB 1J5OB 3VAHA 3FKBA 2QL5B 1NCLA 4DFPA 2XYPB 2ZBIA 3LP1B 2CJQA 4MYTA 4ZLJA 2C42A 2BABA 1JLGA 4LSLB 4BBYA 3J7A1 3BO3A 2EFGA 2MKYA 2GX8A 5HO4A 1B0PA 3K58A 3UD3P 5F0WA 4NLRA 3ZZPA 4O44A 1OSCA 3D3CJ 3KLGA 2DR7A 3G8QA 1UW4A 3BR9A 3C16B 2GMJA 2YXLA 4PUOA 3DRXA 3BB5A 2CDRB 4O3PA 2HVZA 2LLZA 3R6GB 5E0OA 4J37A 4J9PA 3FK4A 2W2MP 2G1DA 2OEKA 3JTOA 4KY3A 3TUJC 2GA7A 1TKTA 4LBIA 2W7AA 1S59A 4UOHA 4QBUA 2RQCA 1T95A 3GR1A 3Q22A 1U4BA 2RJZA 4WZMA 1TK8A 3D0HE 4PR6A 3RB3A 1HBNA 3W8PA 2HBYB 3PR4A 1NPKA 4HT7A 1B0TA 3KMSA 2QA4S 3AQOA 2J9DE 4MK9A 3T1HF 3BPSP 1SH3A 2OTJS 2BE7D 2CPXA 4IQXA 4ICLA 1MNEA 3HSDA 5KFTA 4IYQA 2FUG9 2KHCA 2WVCA 3OLBA 5JVGQ 4DUZJ 3M9MB 5T41A 2XS7A 4NOHA 3GYXB 5D0HA 2B5JB 3ZTSA 4OI3A 1WKKA 4NRUA 2VFSA 4P73A 1MG7A 4LQ9A 4X62J 1TKXA 4ID5B 2DGVA 5CXTA 4RW9B 1CQMA 4Z7CA 4DSJA 3MEDA 1S9GB 3ENWA 5HQLA 1LNQA 1NKEA 4K0KF 2EBEA 1S9GA 4RR5A 1S5ZA 3AOAA 4ZJQA 4RNOA 2P6TA 3DDKA 4QW8A 3K2YA 1IKWB 1TKXB 3NWRA 4WPAA 1GMUA 3NAHA 3SQOP 3NOCA 3N01A 2HNZA 2RHSB 2BOPA 1SV5B 2KXFA 2M0GB 2V69A 4QPTA 4DR1J 4RNHA 4L74A 1IBLJ 1RQ0A 1RE1B 1W2IA 2LA4A 3OHAA 2HQCA 5HL7Q 1DQ9A 3KLFA 3T1HJ 4M95A 2DXFA 4AL6A 2QFJA 5I42A 2ILZA 4OHXA 2IDEA 5IM0B 4QU7A 4OI1A 4JI0F 3JSRA 5FJ4A 3A8EA 4ENOA 4WFNQ 2KVQE 2Y3YA 4ZVHA 2GIRA 5DGBA 4DR1F 2X1GA 3OPKA 2LMIA 2BRLA 1A6LA 4RW4B 3TR5A 3TAMA 3PTWA 4Y3CA 3BV8A 4C98A 1HHQA 5L1JA 3BR8A 3UDEA 3PW4A 5CYQB 2DPJA 2DRBA 1A9NB 1NRKA 4QWDA 1SC4B 1QDUB 4USVA 1PC5A 1NSPA 3SEOA 1FWKA 5L9XA 1VI7A 2Q43A 4ES2A 2R7RA 2ATCB 3DMJA 3RW7A 1TU0B 4NA1A 3OW2R 3LA0A 4OYOA 2KI2A 3GWCA 3MAAB 4KGZB 5B0BA 4EBEA 1VQ4S 4H4MB 2GO9A 4OV1A 3HHKA 2LVWA 4ZPDA 2EFVA 3BBBA 1IR0A 1RISA 1LWEB 3P96A 2EG1A 4ZN3A 5LMUJ 4ZOSA 2EC0A 2KTQA 3ZTOA 4F4ZA 4PZVA 3MPVA 1DBDA 1NZ8A 1XBWA
chains in the Genus database with same CATH topology
1YJTA 2YWFA 2VG7B 2ZH3A 2L3MA 4WYWA 1SL2A 4A47A 4URQU 3PR5B 3L3CA 2AV5A 3R5CA 2MGZB 1BLUA 2XLJA 3VQTA 2F40A 3PDNA 1FJ7A 1RK8A 5L1IA 4YDXA 3B4MA 1X4EA 2B43A 5LL6d 2J6UA 3X1LB 2XEXA 3SDEB 2C2RA 5D3GA 4FF3A 2YNGA 2BXJA 1FE0A 2R7OA 5T7LB 4LIWA 4NL5A 2VBWA 4TN2A 3ETOA 1G7CB 1KFDA 3QIDA 2FLPA 2A3JA 3HHEA 2YKQA 3CD0A 5E3QA 2GQ2A 4AUKA 4RBUA 1RTDA 2OLWA 5E33A 2DHSA 5B0DA 4OMFG 2MQQA 3O2IA 3FRZA 3UPFA 1Q86T 1XMOF 4IKAA 1NNDA 1SJ4P 2U2FA 2YKPA 1WACA 3MR2A 3HM9A 1WTBA 4Z37A 1PILA 3UCGA 4C11A 4PWUA 2JSXA 4YB1P 4GKKF 3KFWX 2HRUA 1S97A 1QVGR 3DOKA 2JEFA 2Z8QA 4C8MA 3OL9A 4XPEA 3SZ2A 4J9RA 3HVAA 3PW5A 1FA0A 2YKAA 3FJ2A 3B4DA 4AFFA 4ILMA 3G6VA 1HI8A 1VOMA 2A2CA 4HTJA 3EXYA 1X5TA 3PKMA 1NH8A 4WJBA 2CPFA 3HKWA 3LQVA 1XMQF 4DL5A 4TYAA 4AE5A 4TLRA 5KT5A 2CJBA 4U67Q 2V4QA 3ZZUA 4Q7AA 2AP6A 5KT7A 5HROA 2VFUA 5KTQA 1XN9A 3DXSX 1EP4A 4PXBA 4CH0S 2H5EA 4DV3F 2K2PA 4ATNA 1FO1A 1NK0A 4X4QA 1UVLA 2NUHA 2NUUG 3IN5A 2R9LA 3SQGB 3CDUA 1KONA 4IOCQ 1D9AA 3GFZA 4L72B 2WSFC 3D5MA 3OJSA 1CLFA 3BGLA 4DV4F 4RW7A 5A8RB 2DH9A 2MQLA 1S4FA 2F8HA 2QV6A 3GYNA 3M1VB 4ZP6A 4C8NA 4RW6A 2K3KA 5KFWA 3DLGB 4M5DA 2R7UA 3D0GE 2M4MA 4TXSA 3CJ0A 4F2SA 1RTHA 4K4TA 4UY8T 2XO7A 1KRPA 4OZ5A 3FMBA 3TQ1A 2HHQA 5EX0A 3MUTP 5KT2A 1HBMA 1Q53A 5DG8A 2IMOA 1LWFA 3L95X 4Q8FA 3LOUA 2MHEA 4OX6A 1ZTTA 4R0EA 1N56A 1IBLF 4ERDA 3CJ4A 4MFBA 4A8FA 5B09A 3OXFA 1GH8A 5KFHA 1M5VC 3BQ2A 2HNYA 2G0CA 1S6PA 1NH7A 2ZD1B 3MEDB 4X4OA 1T03A 2DO0A 2FHJA 2RIJA 2OH2A 3P5TL 4NLOA 4TNOA 3I5CA 3S8SA 1E6YA 1HD1A 2YNHA 2DISA 3RAQA 2GQQA 4USHA 5J2PA 1YRTA 1HW8A 3DRRA 3EUNA 2V2KA 1ZPWX 3FSYA 3IFEA 3CE8A 5IT0A 5KFJA 1TK8A 1S6QB 3F73A 3I4HX 3ZZTA 2DB1A 3KTQA 3GMGA 4DEZA 3MM7B 2E5LF 3DMJB 3KK3A 1QM9A 2MJUA 1RT4B 2IAJB 4YR0A 4RLEA 1D0EA 1JJHA 1HHSA 2MZTA 4ZPAA 2DGQA 2KRRA 5KFZA 3MI7X 2FJWA 2GNKA 1IJFB 1X4HA 5HI7A 4CI0B 5GAEU 1RT5B 3RAXA 2ALZA 3AHPA 1QVFR 2IAJA 3CDWA 3MUMP 4DL0C 2QLXA 4LVOP 3U27A 4ED0A 2QIFA 1J2VA 3MM5A 1U09A 2HHXA 5L1LA 1KHVA 3HI9A 4MTPA 5HLFB 3NCRA 2LCWA 1KVJA 3LALA 2QA1A 3FEYB 3T1YF 3O5TB 1S1WB 2L48A 2PT0A 1NAQA 3OBIA 1MMNA 3CCWA 4KSEB 4J5OA 3RBDA 1JJ2R 2FLNA 1E6YB 1FRIA 1XEZA 2UXDF 4L3NA 2YKMA 3PRBA 4Q2LA 5KFNA 2F7VA 2KT5A 2D41A 5KT4A 1S6QA 1YGYA 5KFFA 3DLEB 4QR2A 2QZ8A 3MTJA 5LMUF 1O51A 4ZCIA 5KFQA 3EYZA 3RR7A 2YWEA 3MPWA 4ILRA 2I0XA 2XY5A 2W4DA 2N7CA 1TAUA 4CTAB 1EETA 1T7PA 2E9ZA 4CNZA 2FC8A 1VQ6S 1YTYA 2NQPA 2HZCA 6FDRA 4CO5A 3I82A 4DV0F 2HYIB 1Q16B 3PEHA 5G0RB 5J2MA 3CVKA 4KO0B 2DGUA 4N8OA 4Y00A 2I9SA 3CC4S 1X4DA 1N6QA 2DR9A 3DM2A 4DR4F 2YNFA 2DNYA 1BQNA 4GMKA 1RKJA 2HGLA 3T5LA 3UNGC 2FGOA 2VQFF 3TNVA 3ISNC 2ZH9A 2FJAB 5DO2A 3BSOA 2Z2MA 3DCAA 3IG1A 2WK4A 1FKOA 2V9KA 4ZP7A 2N82B 3I96A 4TKTA 1JLAA 3NWGA 1FE4A 3RU0A 1AFIA 4OHWA 4DV5F 1W2BR 1HHTP 2MQOA 2XNRA 4OI2A 2KRBA 1MU2B 3FFIA 3FMWA 3T5HA 2AW0A 2KDOA 2PA3A 4DJBA 3HHLC 3V4MA 5KT3A 2DGXA 5KOWA 1HWUA 3SI8A 3LAKA 3JSMA 3KMQA 2CVIA 1NK6A 2XI3A 2GGPB 4OZJA 3T6BA 2J7WA 4XDDA 1FK9B 1WWHA 2OPPB 2VFTA 3JSMB 3S7RA 4NLPA 2WHOA 1VLYA 2QEXS 3CDEA 4A8QA 1GX5A 3OL7A 4RWXA 4MIAA 1PO6A 2UVVA 2ZJRQ 5K5MA 2BDPA 1UMJA 3F56A 3SXLA 2W8KA 4F4XA 4DR6F 5D4LA 3SSSA 2VASA 2P9GA 1U6ZA 2E1AA 4PCQA 3H25A 4EWTA 3GR0A 4QW9A 4M8LA 1WTFA 4O4RA 1TR0A 4ED8A 3E01A 5J1NA 3GIKA 4C11B 3OVSA 5J1EA 4NCGA 4KB7A 2N3OA 5AJ3F 3O44A 4H4KA 1U1LA 2QMWA 3DRYA 3THPA 7FD1A 3TVKA 2KM8C 4Q5VA 1L5UA 4FBTA 1RWUA 1L3UA 1OPIA 1FD8A 3R5AA 2GMLA 2HS0A 2GHWA 1RTDB 4OX9F 2OPQA 3TANA 5CZXA 3SV4A 4IO9Q 5HQ8A 2UXBF 1UJ6A 3UDLA 3UR0A 5I3UB 2R8HA 4A48A 4IH6A 3VAKA 1VQ5S 4A8KA 1XTZA 5T7LA 2FJDB 3OLAA 3IO1A 4WF9Q 2A10A 5D3GB 2VQEF 5CYMA 1NK7A 4PQAA 3W3SA 2JFDA 3MPYA 3QWPA 1KQFB 4F26A 5D77A 3S01A 2F8MA 2VFRA 2E1MC 3VQSA 4EO8A 1W25A 4DV7F 2MQPA 3CCMS 3B78A 3UR3C 2HIQA 4UUWA 2JRSA 2Z0GA 3UDCA 2UVRA 1ELOA 4O3SA 3POTA 4X66F 1HPZA 4DL3A 5GADI 3TYTA 3CCUS 3PW0A 4JI8F 2BQUA 1R8BA 3M6VA 3BQ1A 1U1PA 2A1BA 2QMXA 3MECB 2R7VA 3K8VA 3QO9A 7FDRA 3MFHA 3HK2A 1D8ZA 2FJXA 1JK9B 4JV5F 2KH9A 1N4LA 1WHYA 2J6SA 2DRAA 3VAIA 4OHZA 4R8UB 3QJJA 1UJ4A 3IGVA 1HA1A 2F9DA 2QSFA 5LJ3Y 3RTVA 1FF2A 4QIVA 3R1HA 4URSA 4RBVA 3GZ7A 5LSOA 3EZ5A 3EXCX 3MMAA 5DDQC 1S1VB 1M5OC 2BBEA 3DLKB 2V8DA 4ECYA 2HAIA 1TK0A 2FHKA 5LT5A 3CWJA 4NCAA 1IKXA 2CRLA 3NMRA 1YI2S 1ZTWA 4DN0A 1FD2A 2OTLS 3DU5A 5KFRA 3OSPA 1LKZA 4I2PA 3OSNA 4TU7A 3M6XA 3PJWA 2Y0SD 4Y2CA 1VIOA 2E5IA 3G86A 1LXNA 4QWBA 4JI1F 4IG0B 1UFLA 2HWIA 1RAJA 2W25A 5EX3A 3GIMA 3V6KA 4IO1A 2ZD1A 3OUYA 3RR8A 4NYZA 1FEEA 2JDJA 5KFXA 4RW9A 4YHHF 5KFUA 4C97A 2WOMA 4RUHA 4B3TF 1HI1A 4DPOA 3CJKB 2J76E 3DYAB 1NK8A 5E3PA 1H7WA 3VAMA 1S1VA 1S1WA 2LQJA 1FRKA 2HHTA 4F3MA 4DG1A 2CG4A 4ALZA 2ZNYA 4GO7X 2ZOMA 3TP2A 5DG9A 4CIOA 1FJEB 1NU4A 5C24B 2MYFA 4I67A 2HNDA 3QWUA 2XB2D