1AUDA

U1a-utrrna, nmr, 31 structures
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
b'AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA 3UTR
publication title Structural basis of the RNA-binding specificity of human U1A protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 20
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 1997-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1audA00
2DK2A 1HL6A 3DXBA 2DHSA 2MXYA 2RQCA 1JJ2R 4F02A 2XNRA 2G0CA 5LXRA 1OPIA 2FC8A 1NJIT 4Y0FA 1U6BA 3HI9A 1UFWA 2DO0A 3BEGB 4Y00A 4WCEQ 2OSQA 2PE8A 2ZJPQ 2F9JA 2LXIA 4QU6A 1FO1A 5DDRC 2HGNA 1VQ7S 2JX2A 5DETA 2N82B 3UCZP 1FNXH 3VAHA 2AD9A 1FJCA 3CTRA 2MKKA 5GVQA 2MKHA 3BS9A 1M5KC 2LA6A 2KVIA 3UD4P 2MYFA 3RW7A 2B0GA 2KRBA 3UD3P 1YTYA 2M4MA 3U1MA 1M5OC 4ERDA 2UP1A 3CCQS 5JVHQ 2CPZA 3G8SA 3JB9k 1VQNS 4BS2A 3VAFA 1N52B 1U2FA 2WBRA 4UY8T 1YHQS 4RU2A 4YOEA 2MQOA 3TYTA 3MD1A 5LJ3Y 2DNKA 2ERRA 2MSSA 2MZQA 2HGMA 2X1FA 4LJMA 3ULHA 2X1BA 2DH7A 3Q2SC 1VQLS 1Q82T 2LEBA 1FXLA 5ITHA 3CC2S 3MD3A 1X5SA 1VQKS 1JJHA 2CQDA 4IUFA 2DGSA 4TU8A 2KU7A 3EGZA 4ED5A 3VAMA 5DM6Q 3MOJB 2L08A 2M2BA 1VBXA 1KD1T 1WHWA 5D78A 3IRWP 2FHOB 2RS2A 1FHTA 3G6ES 4WFAQ 2J0QD 2OJ3A 3MUMP 2AYBA 1XN9A 3CF5Q 5GAGU 2DGUA 1H6KX 2CQ3A 2MGZA 4TU7A 5LSOA 1SJ4P 4CIOA 2GHPA 2ADBA 3NNAA 1DBDA 2ADCA 3RW6A 3SMZA 2G4BA 2KG1A 3CMAS 3S01A 3R27A 3CCES 2EVZA 3B4MA 2MMYA 2MPUA 2KYXA 1P27B 2DNGA 4CH0S 1D8ZA 1W2BR 2U2FA 2YTCA 2DGVA 4IOCQ 5IFMA 1K9MT 2QEXS 4OZ1A 2M88A 2M52A 2RS8A 2E5IA 3P6YC 3BO4A 2CQBA 1FJ7A 5DDQC 5H1SV 2FY1A 2DGQA 2MKJA 3TP2A 2KM8C 3S6EA 1WF0A 1DHMA 3CMES 1VC6A 3CCMS 2LKZA 1H2UX 3V4MA 5IM0A 2D9PA 1WI6A 2DHXA 4QQBA 3FEYB 1UP1A 3IWNC 1UAWA 1U1RA 1WG1A 2FC9A 1U1KA 2EK6A 2MQMA 2VONA 2CQIA 1WF2A 3S8SA 1HD0A 2DGWA 2MZSA 2LECA 2L41A 1KOHA 5LSLA 2MB0B 1JMTA 2CPIA 4F26A 1X4FA 3P49B 1QVGR 1A7GE 2O3DA 5HO4A 4IO9Q 4P6QA 2JWNA 1F9FA 4UQTA 3CCUS 4IOAQ 3EX7B 1OO0B 3CPWR 1X4DA 4YUDA 3SDEA 4J5OA 3UCUP 1B7FA 2CPEA 3BO2A 3ZZYA 1L3KA 3G96A 2LQ5A 4CH1A 1VQPS 2ZJQQ 3Q2TC 2OSRA 3PIPQ 1AUDA 2CPXA 5GADU 1S72S 1UW4A 2K3KA 4OZ0A 3G4SS 1YJ9S 4M5DB 1ZZFA 2VOPA 1X4GA 2FPHX 5HL7Q 2MZ1A 1HD1A 3R1LA 2OIHA 1O0PA 3OW2R 2CPFA 4C7QA 1WHVA 4A8XA 1M5PC 2KXFA 1FJEB 2BZ2A 3UE2A 2MSTA 2DGOA 2YH0A 2XB2D 2DHAA 3MUVP 4WKRA 3CC7S 2E44A 2GO9A 2XNQA 2YKAA 4PKDB 3CCJS 1PO6A 2F9DA 1R8PA 2HZCA 2MY8A 1YIJS 1SJRA 1VBYA 3P5TL 3NNHA 3J7ZT 2XS7A 2KXNB 1SJQA 2MQNA 3CXCR 1KC8T 5LXYA 2LMIA 2OTJS 5LJ5Y 2DHGA 2G1DA 1M90T 1U1PA 1QVFR 2DIVA 1X5OA 1VQ4S 2N3OA 2XS5A 2NZ4A 1WEXA 2DNQA 2CQHA 1R8HA 1JJ4A 2SXLA 4C4WA 3CULA 2XS2A 2A3JA 5CYJA 1SJ3P 2CQCA 4TU9A 2MKIA 2AYMA 4QPTA 4PRFA 1HA1A 3CCLS 3VAJA 3J7YU 2DITA 2MJUA 4ZKAA 1YI2S 4CQ1A 2RNEA 2DH9A 2BOPA 1OWXA 2DNZA 3D2WA 3K0JA 1YJWS 1WEYA 1VBZA 2AYGA 2I38A 1RK8A 2DNNA 3MDFA 2JRSA 2VODA 1U1OA 3P3DA 1D9AA 2V94A 2DNHA 4PR6A 2LA4A 2DNYA 4EGLA 2RUGA 2DNOA 1SJFA 3G9CA 5DDPC 1ZH5A 1SXLA 1YWXA 2DISA 3TO8A 1WEZA 3VAIA 2D9OA 3SDEB 3NS6A 3VAKA 2MHNA 2HGLA 2KG0A 5GAHU 1K8AT 2AYEA 1KQSR 2MJNA 1VC5A 1WI8A 4V19X 2RQ4A 2CQGA 2MY7A 2N3LA 4F25A 1DRZA 2U1AA 1NO8A 1WHXA 2DGXA 5BJRA 5DDOC 1CVJA 2DB1A 2MKSA 2D3OR 3NNCA 1VQ8S 2M0GB 1IQTA 2LXUA 2DIUA 4WFBQ 1YJNS 1VC0A 3MUTP 5GMKa 3CUNA 2MKCA 3VALA 2N7CA 1U1MA 2M7SA 2KRRA 4FXVA 5MLCV 4LMZA 3NMRA 1URNA 2CJKA 3US5A 2MZTA 3B4DA 2KHCA 2KXHA 4FXWA 4QU7A 1WELA 2KT5A 4LIRA 2QFJA 2MQLA 2CQ2A 1DZ5A 1X0FA 2HYIB 2I2YA 1WG4A 2CPYA 4Z2XA 3DLLQ 1Q81T 2KFYA 4W90B 3R1HA 5IQQA 5GAEU 1U6FA 5FJ4A 2XSFA 1VQ5S 2DGTA 1H2TZ 2JVOA 4C0OC 2MGZB 2OTLS 2CPJA 2RU3A 1X5PA 4WF9Q 2M8HA 3L3CA 1U1QA 1M1KT 3H2UB 3G71S 3VAGA 1S79A 3FEXB 3N9UC 2ZJRQ 2KI2A 2L9WA 2J8AA 2LEAA 1OIAA 2CQPA 2K8GA 5JVGQ 4U67Q 2HVZA 2J0SD 3CCRS 1G2EA 4WIIA 2JVRA 3MURP 5D77A 2MQPA 1Q86T 2M9KA 1WHYA 5DM7Q 1N54B 3UCGA 2LYVA 2MZJA 1X5TA 1WTBA 2YWKA 2QA4S 2NLWA 1Q7YT 3BO3A 2KH9A 1M5VC 1NU4A 2CQ1A 1P1TA 1X4EA 2EK1A 2MQQA 1VQOS 1YITS 2F3JA 3LPYA 4YB1P 5CA5A 2M8DB 2X1AA 2E5GA 3UWTA 2MZRA 3THTA 2X1GA 3VF0B 3CCVS 3MI7X 3HHNB 5IM0B 3NS5A 4WFNQ 1PGZA 2J76E 1K73T 1H2VZ 2RVJA 3ZZZA 3H2VE 2VOOA 4W92B 1U1LA 5CXTA 3PIOQ 1WF1A 3CC4S 5EN1A 2DNPA 1VQ6S 2E5JA 1X4BA 1N8RT 1WG5A 3CD6S 1BY9A 1X4AA 3G8TA 2RRAA 3U1LA 3EGNA 1N88A 1VQ9S 2Q79A 1QM9A 1WWHA 2RT3A 2DNMA 3MXHP 2E5HA 1RKJA 2DO4A 1KOOA 2DNRA 2CQ4A 2CPDA 2CQ0A 1FT8A 2DNLA 1ZZNA 2CPHA 2PEHA 2KN4A 3I55S 1X4HA 3LQVA 1A9NB 4TLQA 3I56S 2RRBA 2LCWA 3SXLA 2KM8B 3S7RA 1VQMS 2DH8A 1X4CA 3THPA 2YH1A 3CCSS 1U1NA 2M70A
chains in the Genus database with same CATH superfamily
1HL6A 4ZVTB 5EWFA 4OJHA 1JJ2R 1JLCB 1FA0A 4CRJA 4RW9B 1NUEA 1ZBTA 3MR5A 2RF2B 1UVKA 3OR2A 1N5YB 2DO0A 3FUYA 4Y2MA 1F1BB 3KK3A 3CT9A 3H8YA 3NAHA 1FERA 2FQQB 3QMQA 3ZZRA 4CWBA 3JYTB 3ADAC 2Q66A 3MR7A 3UD3P 3U1MA 2UP1A 1S9EB 3G8SA 4BS2A 3IS9A 2AJQA 4UY8T 2VIHA 1RHQB 4KPYA 1R0AA 4QW9A 2EC2A 3ULHA 2O66A 1JLEA 1FX2A 2UUAJ 1YBAA 3AFGA 3BQ2A 3EZUA 1AZSB 4DPXA 2FHJA 1KD1T 3AA8A 2FLPA 3G6ES 3BGRA 3CF5Q 2R42A 1H6KX 2DTJA 3CDWA 1SJ4P 3R5CA 4ED4A 3QIPB 2HNYA 3CMAS 1EZZB 4FN5A 3JQMA 4K0KF 2AGQA 2ZH9A 3ZNUA 2E5IA 4LIWA 2O67A 2E7XA 3CMES 1DTTB 2BXJA 2KL8A 4DHVA 3IWNC 2BJ3A 3VGUA 4B3MF 2CNOB 1YDLA 4C8OA 2VBXA 2ZWPA 4JB8B 1BQNB 2R7XA 3BSNA 1A7GE 2XI3A 4HACA 1OY6A 3PACA 1IKXB 1LXNA 3KG4A 2V8HA 1ELOA 4FPRA 4YUDA 1TL1A 1RAAB 3SYZA 3DDIA 4KO0B 2ZJQQ 4B9UA 4HH1A 4ZK7M 1E6VB 2GQCA 3AJ1A 4B3RF 2VOPA 3W63A 1O0PA 5C7PA 1WHVA 1P9YA 2EEYA 2OPPA 5HK4A 5SUHA 2KTQA 3FBCA 3M2RB 2IY5B 5AXKA 1ULRA 1RU2A 2ZH3A 3KLGB 4LRFA 2QT7A 2V8VA 5A0YB 4K0KJ 3TI0A 4JP8A 4EI2A 2AJFE 3C14A 3CWJA 4QWAA 1PYOB 1YJWS 4MFBB 1F6TA 4WFZA 4O44A 2V94A 4L74A 4F4YA 1R6VA 4F2RA 1LOUA 2HBRB 2D9OA 3UNYA 1PAEX 1YJ7A 3D9BA 4B3MJ 1NPPA 2ZH8A 2MJNA 1VRQC 2V2ZA 2PN6A 3GJTB 2X7IA 1JLAB 4O0IA 2ZWOA 3OL6A 1ZAWA 4HT7A 4QIFA 4UUXA 5H9FK 3D4JA 2RD5C 1VQ8S 3MM8A 4U6PA 1J2VA 3KJVB 1FRHA 4CP5A 3MAQA 1U1MA 3QO9B 3FRYA 2PIIA 2N4CA 1RISA 2DEIA 5HQ8A 4I6YA 4B3RJ 2DVIA 1MNEA 5IQQA 4C8YA 4P75A 2JVOA 4YP3A 2M8HA 3RAMA 1TFYA 3M8WA 3HJVA 2Q6BA 4EBDA 1RAFB 3TJ9A 2K8GA 1R8BA 3KLHA 1DQ8A 2C2ZB 4LBIA 1F2GA 2V5HG 2YWKA 4JI4J 3UFCX 1U2RA 1RWXB 4P74A 2X1AA 4ZVUB 4BCAA 4H4OB 3VF0B 5BR8F 5E3AA 1U02A 2XHWA 4G1QA 1Q79A 1SL1A 4CTAB 4Y65A 5ETNA 2OP5A 3SSQA 2XO6A 2J7WA 3GU0A 6FDRA 1BY9A 1NAQA 1YKWA 4KFBA 2D3UA 1QSSA 3OXLA 3SQGA 4U96A 5CZXA 3BBBA 5T7LA 1N33F 3DYAA 2GA7A 3MWBA 2BJEA 2R8HA 1MN9A 3C46A 3B54A 4KKOA 4PABA 1NJIT 4OYIA 4DL3A 2OSQA 4QYRA 3TQEA 3AA9A 4MH8A 2GGPA 2LXIA 1FO1A 3FQKA 4UY85 4ETZA 3GV8B 5B0EA 3R7BB 4CLSA 4WTYA 5KFGA 2AZ1A 2HFZA 2D74B 3FEZA 3D0HE 2KVIA 1ZS6A 3NGSA 2HS3A 2ZBIA 2ZH5A 3NEKA 3G86A 2B3TB 2WBRA 1LW0B 1S9FA 3NAIA 3MZIA 4USHA 3S1TA 3RU0A 1U47A 4QIWD 3E2EA 3QGIA 4YS2A 4RW6A 1FKAF 5J2PA 4ZLLA 5C42B 4OJ3A 5BR8J 2WTFA 3W5ZA 2BABA 3V6HA 4DCOB 1SBRA 2OJ3A 3MUMP 3SFUA 5GAGU 1VRUA 2PFFB 2I5JA 3R6GB 3C15B 4ECUA 4C9DA 5KG2A 4NCGB 5IT0A 1B70B 1NBEB 4QWBA 3TW0A 1WUUA 1JXVA 3MTJA 5GAEI 3AJDA 5K8PA 3IM8A 1NJYA 3TP2A 2YQ0A 4NRTA 1ZM3A 1KRPA 1O51A 3VV2B 5DO2A 2W9BA 3A13A 2AT1B 4DX5A 1UAWA 3CJ3A 2MQMA 5F8MA 3OPKA 4NLTA 1H0HB 2LECA 5EGYA 4RR5A 5HQLA 3W9HA 1REVA 2W01A 4NZ6A 3W2VA 5KFWA 1HW9A 1F9FA 4DV3J 2KO1A 1LXJA 1OO0B 3GE9A 4RKUC 2JJ4D 1MMNA 1RT4A 1XR6A 5L9NA 2RIJA 3PIPQ 1QSLA 1UW4A 4OZ0A 4BC9A 1YJ9S 5A6WA 1ZZFA 2H51B 1JLCA 2OIHA 2XMWA 4RW9A 3TZWA 1VCTA 2Z0GA 3KG1A 1ZAVA 3TZXA 2J6UA 1RQ0A 2LU1A 2YBVA 3GONA 4YDDB 2E44A 3MMCB 3A4TA 4WP3A 1Q4RA 2MY8A 3P5TL 3PW2A 3TVKA 4KGZB 2K1RB 3JYTA 2P5VA 2GC8A 4DR7F 3HHKA 1R43A 4DUZJ 1M90T 1RTHB 1WEXA 4FBTA 3E01A 1SH3A 3BREA 2BKPA 3CCLS 3VAJA 1IKYB 3V4IA 3BQ0A 2BOPA 7FD1A 2IFXA 2R8IA 4WK3A 5DG7A 1EQMA 4LSZB 4J9QA 1AZSA 2HMIB 3H5SA 2MHEA 2QA2A 2DJWA 3VAKA 3OV7A 1RAJA 4JI5F 3PO5A 3H59A 3M05A 1T9UA 1YG0A 4EMDA 5KFUA 2DGXA 3MEGA 5DDOC 2RSQA 4ID5B 2OEKA 4NA2A 3DRRA 3L7UA 3CUNA 4F8RA 2G2ZA 3PYGA 2KXHA 2FLLA 2ZD1A 4Q8FA 2HYIB 1WG4A 3M9OB 4W90B 2E1CA 1DTTA 1LV5A 3W62A 1TKDA 2FVRA 1BE4A 3M4XA 3MEEB 5AE3A 5L46A 4P2SA 1H3DA 4RU9A 2AV5A 4DF8A 3DRPB 2M9KA 3AOCA 1BQNA 3UCGA 1S1XB 2Y1LB 4ECZA 1S7IA 1UKUA 2QL9B 2MLXA 3NXZA 3BO3A 1M5VC 1IKXA 1YITS 2OAUA 4WFYA 9ATCB 4DU7A 4XO0A 3F41A 4QR2A 2E5GA 2ZOMA 3I5AA 3MI7X 2Q1LA 1E6VA 1SB6A 2OPSB 4WXOA 1FE0A 4DX7A 3PIOQ 3HSJA 1G6BA 3OFEA 3W3SA 5K5MA 4X4NA 2PT0A 3CCTA 1WWHA 4OYPA 3LO3A 1ICEB 2PSZA 2CPDA 2CQ0A 4JI5J 3JTOA 1NDPA 1NDCA 5KFOA 2QYGA 1SQEA 1WORA 3RJMB 1T9WA 1HI0P 2DK2A 2ZITA 5A0YA 1YRXA 4DXLA 3ZZTA 1RWPB 1F0XA 1VGYA 2VB6A 3DKDA 1L3TA 1U6BA 4WWSA 4MFBA 1HBMB 3VHQA 3UCZP 5KG4A 4X62F 2VPZB 4OX8A 2M4MA 1T0TV 2ACYA 3GLJA 3FSYA 3H40A 4LF9F 2MDAA 1JLAA 1S0OA 1N52B 2UXDF 1U2FA 3PEJA 4RU2A 3EGWB 2VKRA 1RT7A 3OJUA 2X1FA 1IKVA 2WOMB 3M1VB 4LSNA 2AKWB 1IBKF 4J37A 2B5JB 3KJVA 2IA0A 4TY8B 1V3RA 3QO9A 2DGSA 4F0MA 3D67A 4CDIA 4LFAF 4Q2LA 3DGPB 3ZTSA 4IQXA 3RB3A 3V6DB 4I1TA 2YNIB 2CFXA 3HD1A 3WIVA 2UUCF 1NH8A 1LWEB 3CCES 4X4QA 3B4MA 4YHHF 2MPUA 1UZDA 1JQGA 3OSNA 4QIGA 1VIOA 2F8EX 4PXCA 1NSQA 2FJEB 3VTIA 5DDQC 2FY1A 2V8DA 1U7LA 4Q8EA 4IH6A 1H7XA 4H4OA 2H4WB 2RU9A 1V5IB 1YZ6A 2B9XA 1BMQB 1NDKA 2DD8S 4CTAA 1G3OA 2ASYA 3Q22A 1RTZA 3A8EA 5HBMA 1J5OB 1KOHA 4X62J 1UPMB 5A2QU 3RRKA 4RWWA 5B7WA 3GYXB 3CDUA 3HKWA 3SDEA 4CO3A 4J5OA 4LF9J 2FLOA 3BO2A 2UXDJ 1GMUA 3Q2TC 5GADU 4P9SA 5F8NA 3TA0A 4U7CA 3G4SS 1TL5A 2DY1A 2FPHX 3R1LA 4P7TA 3TA2A 1IBKJ 2D1CA 2KJVA 2XB2D 5A76A 4B9LA 1R89A 1VJWA 4LFAJ 1YJUA 1KVJA 4ELVA 1SH2A 2QTWA 1RHMB 4LR9A 2OGUA 5K8OA 1HNXF 2YPZA 2FJVA 5A2QY 2V2KA 5HMYA 1Z2LA 3HDSA 1U1PA 4FNHA 3RGIA 2QJ3A 2A3JA 1SIWB 2R7RA 3SIPB 4OX9F 2KZMA 1LW0A 2DPIA 1YRTA 4YHHJ 2A6OA 3IMQJ 3J7YU 3LUYA 2DNZA 4OHXA 1ACMB 4DDFA 2V2QA 1D9DA 3GZ7A 4X4RA 1CJKA 3HZEA 5DDPC 1U48A 2KFZA 4ES1A 3IN5A 2AYEA 2EKNA 3C15A 2IA6A 3TUZC 2X3DA 1WHXA 3E51A 2HQGA 3DLEA 4I56A 2F4FA 4TXSA 2XZTB 4L75A 4ZHRA 4AD6A 3F44A 4RO0A 2CJKA 2XY7A 1XMQF 3DLHA 2DYAA 4MKBA 4Z2XA 2XMKA 3BGLA 3LA0A 3M9MB 5FJ4A 3ZTRA 1MROB 4IDKB 4C0OC 2MGZB 2WONB 4DS4A 2IRYA 2A10A 3IGVA 1F2HA 2EFNA 1F9EB 5D77A 2UXCF 3M8PB 4JI7F 4KIAA 5RUBA 2ZHAA 3GCWP 2NUUG 5E3CA 4FKXA 3L7PA 4A46A 3IAM9 4OX9J 2VFSA 4J7CA 3NS5A 2WSEC 1RAIB 2ZDPA 3RB4A 2A2DA 5I4MA 5KFZA 3WX8A 5ETMA 5F9LA 1MWZA 3QT8A 2B8QA 1NLKL 4PXEA 1N88A 2VU5A 3CJ5A 2B4UA 2RT3A 2DNMA 5GMEA 4YB6A 3FQLA 2C3YA 3I55S 3N28A 2C1EB 4UZBA 2LDIA 1X4CA 3THPA 1AUSL 4PUOA 1RTHA 3J80U 2XLKA 4KH1B 5HN0A 4J9KA 2J8SA 4ZCKA 2ZVIA 1YJTA 2JEGA 3CD0A 2HIYA 3M6UA 1HQUB 2ZOFA 2N82B 2QA1A 2MKHA 4F4ZA 2IJNA 3OTBA 2HMIA 4F7VA 1OSCA 4IFYB 2PEBA 4TNOA 2OFGX 4UOHA 2WHOA 3UO0A 4ID5A 4KT0C 3FK4A 2HS4A 1Q82T 1QUVA 4RW8B 1AFJA 1T3NA 2PO4A 5F3TA 3KFWX 4ELTA 1X5SA 4K2XA 4G1IA 2KU7A 2BQUA 3VAMA 4DV4F 3BSCA 3RTVA 4M5DA 4PZVA 2QA4G 3K5NA 3RG6A 1CC7A 1N56A 1CJTB 3PG9A 2CVEA 4HDGA 3U1NA 3P45B 1Y3JA 2VICA 1RI7A 4E98A 3DRPA 4ID8A 1S1XA 4Y2IA 3T1AA 4WP9A 1I94J 4B17A 1S12A 3T5JA 1XJWB 2GFFA 2PI5A 3H5UA 1Y5NB 3I5BA 4NLPA 4KBIA 3BSOA 3BBFA 1H2UX 4PPDA 2XHCA 3AD9C 4RPFA 1K0VA 2OPSA 1K0TA 2VONA 3KHGA 1H98A 5K8MA 1T02A 2H1YA 3PDNA 2BA9A 4K4WA 2KDOA 4ZJQA 2IM2A 4P6QA 3QFWA 4UQTA 2J7KA 2D3ZA 4ES2A 4YQWA 2BX6A 1J27A 2B9WA 3G87A 4IG3B 4OZ5A 2CJAA 2EFQA 1FRLA 2R8JA 2MEWA 2MZ1A 2ALZA 1NPRA 1JX4A 2EPIA 4FDFA 1L3SA 2W25A 4DQRA 1KHWA 3HSGA 2ZH4A 1TU0B 4J90A 1RWNB 1YIJS 1SJRA 3NCRA 3D0GE 5U47A 2MQNA 5KFHA 4M8LA 1Q8KA 2DHGA 4M5LA 1O5JA 1P9QC 2AP6A 3NGRA 4DLGA 1SJ1A 3BR8A 1UEKA 5AT1B 3WX4A 1OYDA 1TKTB 4PG6A 4J9UE 4ZKAA 1PBAA 1HNIB 2ZHOA 1RAOA 2RNEA 2DH9A 2WOMA 3M1VA 1WEYA 2AYGA 3LAMA 3OQ2A 3AB2B 4TY8A 5D6GA 1NK9A 4ZA1A 2NZCA 4AE5A 2RUGA 2W2PP 1YWXA 3TO8A 2G13A 3VAIA 2ZUAA 3NS6A 3H25A 1K8AT 1RTIB 4J9MA 1WI8A 3MAAB 1KP6A 4IR9A 4J9VA 2XYHB 1CVJA 2B43A 1PBUA 1LWEA 1UVMA 5KFPA 5K9FA 5HSPA 3QRRA 1MU2B 1Z4UA 4WJBA 2RDJA 5GAGI 1S97A 3MMBA 2RKIB 3ENWA 3RBZA 3AJ2A 4OL8A 4X2BA 2ZEJA 4I7FB 4FP9A 3R2CJ 4JV2A 3GIJA 2HNZB 1CJVB 5KFIA 2BV3A 4NASA 1J5OA 2YNHA 4WIIA 2UUBJ 3NGUA 2YWEA 1WSVA 1FXRA 4IO1A 3GYNA 4DI6A 4WPAA 4LBPA 3FCWA 5HLFA 5GAHI 2B6AB 4KY3A 2CZ4A 5KFMA 5AXLA 4DQPA 4ED8A 3L95X 3FBBA 1U1LA 5KT7A 3ZXWA 2DNPA 1Y4ZB 1T11A 1VJQA 3MMAB 2B7BB 2HQCA 3TEHB 5C25B 2VPYB 3SBMA 1X4AA 4LFBF 3LOUA 2VFUA 2AEFA 4ZMMA 2DNLA 2ZVSA 3HHLD 3PJWA 1KFSA 5DQIA 3TRGA 1XNRJ 4E8UA 2DH8A 3A8KA 4H4MB 4R5PB 2C22A 2JEFA 3KYLA 3EPGA 2DHSA 3HVRA 2ZZMA 3DM2B 2G0CA 1FRKA 4FS2A 3LGNA 3HI9A 2IAJA 4ZDNA 4CYUB 4WCEQ 2BM0A 4NA3A 4NL5A 2M3DA 3TVYA 4QW8A 4AQYJ 3TR5A 2JC1A 4H54A 2UZAA 4OHYA 3E3XA 4C2MA 2MQOA 2DNKA 2MSSA 3IG1B 4QBUA 1FD2A 1GFWB 3V81B 1C0UB 4C97A 4IG0B 1FXLA 2BE9B 4JUZA 4AL6A 3JSBA 4F4KA 1FESA 2BE2B 2CA9A 4C3MA 1WHWA 2FHOB 1FHTA 1LW2B 2P9EA 2MGZA 3HT3A 3Q86A 2WONA 2AHOB 4NLXA 1V6HA 2HVHA 2DT9A 4MT1A 4CO0A 2Z4PA 3JXOA 2HSEB 3KTQA 3TUPA 2MMYA 1P27B 3OHBA 2JSXA 4IOCQ 5E3PA 4TKTA 1YQHA 2OD4A 2WSFC 2OEJA 4IYQA 1WF0A 3ZNJ1 3WDOA 1GQEA 5HMWA 5J1EB 2C28A 2EK6A 2CQIA 2X3GA 2WSCC 1S57A 2L41A 5ETLA 4F26A 1S76D 3HO1A 4A8WA 3TZZA 1DARA 1R31A 1N36F 1L3VA 1LFPA 4EWTA 1FEHA 3CDBA 1B7FA 1GMVA 1D09B 4YFUA 3DMJA 1OYEA 1HBOB 2OSRA 3NS7B 3OJSA 4IRKA 4FBUA 1QTMA 1Y3KA 1HD1A 5E3RA 4LR8A 1W25A 2CPFA 2LP4A 1HNVB 2Z57B 3C16A 5FIIA 5D0HA 2FJDB 4X64F 4WKRA 4ZPWR 1R0CB 4DR5F 3DFEA 2F4VF 1IR0A 4GC7A 2GVZB 1VFJA 2DBBA 4XTTA 1BXNA 3D5MA 1RT6B 4IFYA 2N3OA 1Q8LA 2CQHA 4GVLA 1WOSA 2CJYB 3TEGA 2MJUA 3POTB 3JAMU 1ZTWA 4I69A 2RMLA 1D9AA 3LF0A 4IH7A 3CJKB 3C19A 2OPQB 3G8QA 1RT3B 3A8JA 5DG8A 4JV0A 1YBUA 3NLCA 1TL3A 4GVBB 1OPZA 1AYEA 1JNRB 4C11B 5KOWA 4QZVB 5KG5A 2AX1A 1QSYA 4I2PA 1DRZA 5F3ZA 3D3BJ 4ENOA 3OVAA 3ILJA 1XWLA 1IQTA 1U0HA 1WC4A 4WFBQ 5GMKa 1J5EF 4GKKF 1PJ5A 4LMZA 3US5A 3JAMY 1XR5A 2GVDB 2WVBA 2PDAA 1S9GB 5IS2A 2PD1A 2QL5B 4B9VA 1RAGB 4AXJA 3OL9A 2E9ZA 1S4EA 2CJXB 2LEAA 3IP0A 1S6UA 5JVGQ 4TVAB 1QAIA 4DR5J 5LMNF 3TA1A 4LF6F 2RDDA 2MQPA 3H42A 1HFEL 1ZTTA 2P9GA 3UN5A 5C2GA 1X9MA 4PG8A 1RP5A 2E1AA 2CQ1A 2F3JA 3BN4A 3Q8PB 4YB1P 1KR4A 2RRNA 1QLNA 2M8DB 2Z2LA 3MCMA 2ABYA 3SV3A 2FDNA 1O6XA 5J2MA 1GAOA 3QJLA 4XDCA 4LF4F 5ETPA 5I3PA 4DL7A 2EFVA 3ENAA 5KFCA 5KFRA 1FDBA 4KGVB 2IC3A 5E7OB 3K5MA 5KTQA 4K8RA 2EBGA 2O1PA 1MLAA 3W9JA 1KOOA 5BYSA 3W9IA 1LNQA 4DFKA 4DV7F 5GADI 4NWBA 1X4HA 3SEOA 1PYTA 3HVTB 3CNQP 2OKQA 3BYRA 1WC3A 1XC9A 4RBTA 2RQCA 4ILLA 3DOMB 3OVSA 4GKKJ 1J5EJ 4NZ7A 1HNIA 1OJ4A 2LEPA 3SCLE 2WB4A 1FDNA 3B6BA 5KG7A 1JLFA 4K50A 2HRUA 1S5ZA 4ECQA 3DLGB 3EZ5A 3ICLA 1C1BB 2LA6A 3M8ZA 3J81U 5D0GA 4OZJA 5K14A 1RT5A 3D6MB 3NG8A 3R6LB 3J7YI 4LF8F 1N0VC 1N48A 5LMNJ 1EKRA 2A1BA 3R2DJ 3TYTA 2VG5B 2CG4A 2WW4A 4OX7A 4YB5A 1UWBB 3MD3A 4JYAF 3M8SA 1MU2A 4IUFA 2EWHA 4P7VA 1V5VA 3MOJB 3NKYA 3NOCA 3ZTPA 4N5SA 2R2SA 3AT1B 2A0FB 3SQOP 2DGUA 2XM3A 2HHHF 4I7FA 1H73A 4ZVSB 5B0BA 2ADBA 4RUCA 1S1WB 3NNAA 4KAIA 2GHWA 3VQSA 1K44A 1CJVA 3J81Y 3PY8A 2VHGA 3GTYX 3OR2B 4C8MA 1A6LA 1IR2A 1XQIA 2DNGA 3CJ8A 3KK3B 5CH7B 2HHVA 4USWA 2B4OA 3D6HB 2BKNA 2B51A 5ETOA 3I9ZA 3X1LB 1RHJB 4RUBA 4NXMF 4A48A 3HMJG 4QIEA 5IC6B 2B6AA 3O44A 4ELUA 1KHVA 1N6QB 3S8SA 1Y5IB 3GG1A 3IS9B 2GX8A 4YY3F 3UVJB 2GMHA 4CLUA 3T1YF 1IBMJ 2CPIA 1R0AB 2B4PA 2POKA 3QIDA 4N8NA 4D3GA 1HNZF 3TARA 3IM9A 2V69A 3EX7B 4LF8J 4LVOP 3MEDB 2WVFA 3HVWA 3G96A 1JLQB 4YR0A 4C6AA 3HT0A 5EWGA 5LMUF 2HAIA 1X4GA 3DLBA 1NH7A 1RHUB 3EXCX 4RJVA 3SCIE 4JYAJ 1VISA 2BZ2A 4J91A 1G1XA 3NWRA 2HNYB 1D3WA 1FXDA 3PW7A 4NCAA 5KFTA 2ATCB 1D9FA 3K8VA 1P1LA 5AJ3F 1ZA1B 3HCXA 2HHHJ 2YQ3A 3UDCA 1UFKA 2OTJS 2W2NP 4OHZA 1IVZA 3KUGA 1QVFR 5ETQA 3QGPA 1R8HA 3IFEA 5CYJA 3KNGA 2QE5A 2EFPA 2BQRA 1HA1A 2BYCA 3V6JA 4ZLPA 1C0UA 2GJ2A 1TL7B 2YY3A 4IG0A 2DNNA 1U1OA 4NXMJ 3D1QA 1QAJA 4EGLA 1BQXA 4C48A 2RUSA 2EBEA 4DUTA 1YX2A 2HGLA 2Y1RI 4L3NA 4DQIA 2W7OA 4F25A 4UQGA 1RA6A 2V8PA 4DSIA 2IBKA 1RGVA 3NNCA 2F1FA 4I0WA 4ECRA 2NQPA 1Q53A 4DLEA 3ZZOA 2J9CA 1F9HA 5EX0A 3EYZA 2MZTA 2QIFA 2HURA 3FNNA 3EVWA 3HLUA 1XTZA 3A8IA 5LMUJ 3TZYA 2UU9F 5J1EA 2HZAA 2K7JA 1S79A 2HPUA 4DR6J 1JIHA 3QAEA 4B9TA 5IZHA 2CQPA 4PQUB 2XI2A 2JVRA 4EZ9A 4GKJF 4J9LA 2ZH2A 4PG5A 1WTBA 3C14B 1U25A 1MMDA 2HHWA 5L38A 1G4CA 1P1TA 2VF3A 2OI2A 3EDRB 4O44B 5KT5A 2HHSA 1S10A 1XIQA 1CG2A 2DR5A 3UWTA 2MZRA 4HI1A 3MEKA 2XZDB 1HBOA 2JDJA 5M2UA 1KQKA 3ZZZA 3DRSA 4B3SJ 2VOOA 2W24A 2VQFF 4DJBA 1UETA 3NOGA 3PEHA 2JLGA 4OI1A 1BWEA 3PR4A 2MLZA 4FS1A 4A4JA 5HVGA 5L1KA 1X8DA 5DRKA 2PEHA 3RBEA 2GVZA 4ECXA 2WVCA 2LCWA 2VC0A 2YH1A 3CCSS 1N34J 1M1GA 2ZOGA 5DZ7A 1SH0A 4DV6F 1B4SA 3GSIA 1N5QA 1TTHB 4Y0FA 4PYDA 3KLHB 5I42B 4MIWA 1DQ9A 2DCUB 3ENQA 1LEOA 3CJKA 2MKKA 2OPQA 1RT3A 3KOAA 1M5KC 3PYDA 3OR1B 1UJ4A 2MYFA 2B0GA 2FZGB 3FBEA 2GS8A 4ERDA 2XYPB 4OYOA 4C11A 3CW2C 2HZVA 1HI1A 3VAFA 4N8OA 1LWCA 4JV5F 4RBUA 4Q43A 2ERRA 5KFYA 4LF7F 1VQLS 3DI6A 3KJQB 2LEBA 2C2NA 3QBCA 4WKYA 1M0SA 4KFBB 2CQDA 2IBOA 1CQMA 3A3NB 1KWMA 3EGZA 2YKOA 1B3TA 2L08A 2CJQA 2CNNB 1TMMA 5T7LB 1S9GA 1Q5YA 4WFAQ 1LWXA 3DYAB 1HPZA 2WVDA 1RHKB 3OFHA 4OMFG 4LSLA 2KYZA 4UF4A 1DBDA 2ADCA 1VHIA 1O8BA 4ZN1A 1XEZA 4KKOB 2CJ9A 1I51B 3JSYA 4PXDA 1TK0A 4Y28C 5A8KB 2F65A 4FYVB 2AZ3A 4OHWA 1D8ZA 4K5RA 1VK8A 1W2BR 3HXMA 3KXDA 2GGPB 4OZ1A 5KFNA 2ZM6F 2HEKA 1RT2A 1HMVA 3H4BA 4DV6J 4DL5A 1GEHA 1KVIA 5KG1A 3UR0A 1U49A 4ED1A 3OTDA 1HHQA 4BBYA 3HF5A 2Y0BB 1KSPA 2KHDA 4R8UA 2ILYA 1T05A 1NSAA 5F8IA 5J2PB 3AY0A 4UOCA 2R7QA 2GIRA 4JV5J 3HVTA 3H2LA 3CJ0A 2F5GA 3KMQA 4BDPA 1VRUB 5HL7Q 3D1HA 3QSIA 3DOMA 4R0JA 3GIMA 1M5PC 5KFJA 1SL2A 2BJDA 3CC7S 1RBOB 2GO9A 3HSDA 4HR2A 4RUAA 5DLFA 4ZPVR 3G2XA 2BRLA 2CJBA 5LXYA 2QSWA 3DLGA 4K4SA 1RT1A 1F5CA 1VQ4S 2WB1D 4UT4A 1JXLA 3G6VA 4ZPCA 3FKBA 2W9BB 4ZIVA 4TU9A 1Y11A 1VQYA 2VG5A 3BYPA 1HQ2A 3K0JA 3ILIA 4DSKA 4I67A 2HRTA 1ZPWX 1UWBA 2I38A 2LQJA 4ZVEA 4DWIA 3QT6A 3W2VB 4D3HA 4LRCA 1JWWA 1NJZA 3GFZA 5G4DA 2MY7A 2HW3A 5KAKA 4WE1A 1N5TA 1SC3B 3Q8QB 3HFKA 4I6AA 5MLCV 1R27B 1URNA 4BWMA 2Z2ZA 2AJ0A 4FXWA 2KJWA 2KT5A 4KGKA 2QFJA 2HS0A 2IJFA 2YKMA 1X31C 4DL6A 2KFYA 2MTLA 2XSFA 5L1IA 5E5NA 1U1QA 2FVCA 1N6QA 3N9UC 1E6YB 5LSRA 4RNNA 3FGVA 3E01B 4U67Q 3UVJA 1GMWD 1KQGB 3GJQB 4JOUA 1N54B 3V4IB 2DPJA 3P8BB 3PV8A 3CVKA 3EE3A 3MR3A 2FJWA 3MF5A 2D69A 4QCLA 3PCOB 2C2MB 2H5EA 4B3OB 5FLXU 5CA5A 2GAGC 4LREA 8ATCB 3MEDA 5F8HA 3CCVS 1SI9A 1JLQA 1XMOF 5KFVA 3RRGA 5THWA 2W2OP 4ED6A 2A6MA 3MEGB 1PIEA 4JI8F 1GXTA 3PHEA 3BF4A 4CLYA 1MSWD 3DRRB 4DSEA 2DO4A 1UFLA 3GSDA 1AB8A 3QSYB 2XBPA 1DLOA 3FCHA 1UMJA 1TK8A 2FD2A 2ZD1B 4M95A 2IRXA 2NSCA 2V4QA 2DR8A 1FWPA 5IOLA 1U8SA 2M70A 5FLXY 4QWCA 2MXYA 1Q16B 2R8GA 1WC0A 1CC8A 4IKAA 7FDRA 3QPIA 2PE8A 1UVNA 2ZJPQ 3JSMA 1TL7A 4QU6A 2YKNB 5DDRC 3AD8C 4KHRA 2W1BA 3GJSB 2JC0A 1RB0A 3CTRA 1DQAA 2KT3A 2F8MA 3CSKA 3G6YA 4F3MA 3DDNA 4DN0A 4OYZA 3CCQS 5DQGA 4KHMA 1C0TB 4USKA 2EG1A 3ILOA 3WBZA 4LJMA 1MW7A 3MM6B 3W60A 5IT9U 4R0EA 5CCLA 1SKRA 1EETA 1UL3A 3DCAA 1Z2ZA 2Y1IA 5M2RA 3MCNA 4KJIA 3ITHA 5DM6Q 1XMOJ 1RA7A 1RXOB 1UPPA 4PYAA 1SVDA 1VBXA 1WKKA 3IRWP 3QWUA 3M30A 3L4BC 5B0CA 1RTJB 4KQZA 4JI4F 4TU7A 3QLHB 3QRQA 4M5HA 5LSOA 4JI8J 1XNQF 2G4BA 7AT1B 3O2IA 4PQUA 2HHXA 4MK9A 3ZC4A 4CH0S 2B56A 3UQSA 4HVZA 4DN9A 1S6OA 5H9FJ 1HIYA 2RS8A 2V68A 3FC9A 4USJC 3JQKA 5IT9Y 2ZNYA 3PFOA 2DRDA 3S6EA 1VC6A 1BQMA 4URGA 2LKZA 1RCOB 1FJGF 2D9PA 4YN3B 3BKFA 5KT2A 3N4WA 1T3OA 2CNLB 5J2QA 2HVEA 3DXSX 4C0BA 1RT7B 1IKVB 2IVFB 3T6JA 1QVGR 2NR0A 4LSNB 3O3LA 3BKUA 3Q23A 5CAAA 3QJJA 5A8RA 6FD1A 5IT4A 2C2RA 3VGSA 5JMNA 3EWGA 2WZ1A 5FDLB 3VZIA 3AOAA 2FB0A 2CPXA 1UWAA 4E0DA 5F9NA 2B9YA 4ZPBA 1UA0A 4FPIA 4FVMA 3EZOA 1FK9B 4K4ZA 3RR8A 1CQNA 1DTQA 5I42A 4ILMA 5SZTA 2CNKB 3T19A 2VQEJ 3EICA 1LKZA 3WHIA 2ZC4A 4LBHA 5D4LA 4QYZK 4P73A 1NJXA 3OR1A 2NUHA 1XNQJ 3L09A 4ED0A 4OLPA 1KN6A 2K7KA 2YWWA 3W8GA 4PRFA 5HBMB 2C3PA 2O01C 2UXBJ 1VBZA 2FJBB 1Q1KA 4B9NA 3OFGA 3QZ7A 3P3DA 3BGOP 1KLMA 4DR1J 1RBLA 1K47A 5EX3A 1FJGJ 1ZYQA 1SPBP 1P6TA 4KTQA 4RWXA 3SDEB 3I6PA 1NKEA 5KFEA 2N3LA 4WYLA 3UD5A 5HJYA 5KFKA 2W4CA 5D8HB 4GC6A 3QYYA 5A8KA 4YDXA 3VALA 3PJ9A 4S0MA 3Q0AA 1JXEA 1TP7A 3B4DA 4QU7A 4PQAA 3DDKA 4MJKA 4WU3A 4NMLA 1VK3A 2DGTA 2OELA 4CZCA 1PC4A 4DV3F 3TAMB 2HK3A 3MAHA 3HVAA 2NXEA 3MURP 2ZDOA 1T03B 2BW7A 3FZ2A 2V63A 5I3UB 3HFVA 1CJKB 1UVJA 1K1QA 3KLIA 3M8YA 8RUCA 3ISND 1Q5VA 3SV4A 4DUZF 1N8RT 2RRAA 3DLEB 4ZJOA 1FVSA 2XO7A 4ZHRB 2VPWB 2CQ4A 3BDEA 4TLRA 2QGFB 4X4SA 2GO8A 4TLQA 1VQMS 1EP4A 2YNGA 1YBTA 2JEIA 3N5FA 1BD6A 4HKQA 3EDQB 4Y2CA 3BH7B 1NK5A 1S59A 1KTQA 3SZ2A 2IVMA 1UFWA 2BQ3A 2AX0A 2NYIA 3FMWA 2NSBA 2BKOA 3OUYB 2G2OA 2BVZA 3KDNA 3IWLA 1S1VB 4OI3A 1U26A 2K2PA 1KNZA 1XMBA 4ZCLA 4M5JA 2V9WA 2FHJD 1SCJB 4WTOB 2VG6B 5HAOA 3R3TA 2DH7A 1FRXA 3W7BA 1KS2A 3BV8A 3UI3A 3BB5A 4EZ6A 3M7VA 2AGPA 5IV3A 4ECSA 4FYYB 4YB7A 4ZCIA 2XY6A 3CO0P 2J0QD 3UPFA 2CQ3A 4X84A 4MK7A 3Q8SB 2D3O1 4PUOB 5LL6d 1E6YA 2FHMA 2KG1A 3NGTA 2YKQA 4TQSA 4DR3F 3CJTA 2F40A 1RE1B 5J1PA 1RWOB 2KYXA 5DLGA 1X60A 1FDDA 2DGVA 2DEJA 1MWYA 2E66A 4M5GA 2PFDA 4B3OA 1RLCL 4QR1A 2XMVA 3MM7B 2AEMA 2DHXA 4QQBA 3NP5A 1RKIA 1WG1A 2WK4A 4USTA 4DQSA 4MKAA 3WIUA 5BXIA 2DGWA 2FGCA 4ZJLA 2MZSA 2NREA 4DV2J 1UJ5A 3EVMA 2GQ2A 2BJ9A 1FKOB 5IQ6A 2E5LF 3BJYA 2R7SA 4OI0A 1B0PA 3CPWR 3CD7A 4GRSA 3SFGA 1UW9A 3EUNA 3GR1A 3UCUP 5AE1A 4JI0J 1VQPS 1EAYC 4HI2A 4NLOA 2PI4A 4PWDA 2K3KA 1S77D 4CM2A 4M5DB 3J7AN 4IH5A 2VC1A 2VA2A 1VR6A 2G0JA 4NZ0A 4PAAA 4OV1A 2AJ4A 2KXFA 3UE2A 3EPIA 3D28A 2YKNA 2XNQA 2IM0A 1NSPA 1C4AA 3IR5B 1T7PA 3QFHA 1WC6A 1UTAA 1S0MA 3LAKA 3P4UB 4K7QA 1P8GA 1OY9A 3AB4B 1UJ6A 2XYGB 4DR3J 4C4WA 3CULA 3KLEB 3MPWA 3RBXA 3WC0A 1C0TA 2W7PA 5CD4A 2DITA 4NMXA 3MM6A 3W65A 4FF4A 4RW4B 2ZBCA 5F0UA 2B9EA 2CDQA 3OXFA 4U7UK 3IBWA 1NHVA 3VQTA 3ZO7A 1IJEB 3KG0A 2KG0A 1U0SA 1RTJA 1U2CA 2VL1A 3QLHA 2U1AA 1RACB 5CABA 3CGIA 1F5AA 2E5LJ 2MKSA 1R0BG 2I6WA 4XPCA 4NLUA 4C8KA 1FD8A 4MMOA 1UVIA 3MPDA 2ZZTA 4I2QB 4EU0A 1EQ0A 2KHCA 2W4PA 3N5BA 4MIAA 1HNWF 2NXNA 2IM1A 3OL7A 1VQ5S 2RU3A 4NA1A 2AGOA 3PR5B 2Q6CA 3H2UB 3RAQA 2QYCA 3C2PA 3N6LA 5CYQB 1NZ8A 4C8NA 4DSJA 1RTDA 2J6SA 4TY9A 4ED7A 3GIRA 5HVFA 5DM7Q 1WHYA 4HT5A 3U27A 3OHAA 3O6QA 3Q89A 2KH9A 2XSJA 4WP8A 1FTRA 1TMJA 3LP0B 3TVZA 1F3FA 4RX6A 1URRA 3DOKB 3THTA 4OI4A 5FDLA 3EGVA 4B3TF 1V3ZA 2CKWA 3M8QA 1T9YA 4X66F 3M6WA 3CC4S 5EN1A 3FVYA 1FK9A 2E9RX 1S4FA 1HWJA 4MIBA 4PCQA 4LUBA 5CD4H 3CMQA 2CZVC 3HX9A 5KFQA 2ACMA 2VJUA 4CLPA 3I56S 3MMBB 1B99A 3CEDA 5HQMA 4NLRA 4F3OA 1TR0A 1WDDA 2BUNA 4OJ1A 4RNOA 4O4GB 2J9DA 2LQ9A 3J7A1 5LXRA 4TYAA 5E2QA 2OMLA 2R2UA 2JFDA 3BEGB 3HHEA 1RHRB 3KHLA 1X9WA 3O5TB 2V8GA 2YNHB 1U09A 3T5HA 1HNWJ 1RWUA 4N7TA 1LFWA 3L9ZA 2HHPA 1FNXH 2CRLA 2VFRA 5L39A 4X4PA 2VKZG 1SKWA 3MTKA 3KUEA 1RUSA 3UD4P 5HLFB 4UZCA 5BYRA 2WAQD 4YOEA 4RZRA 1S6QA 2GCFA 4N56A 3PKMA 2HQDA 3CJ2A 4Q2MA 4OYMA 3JSRA 2XLIA 4B3TJ 4O0NA 2VFTA 4X66J 3K7RA 4DUYJ 3SI8A 2HFVA 3BH6B 3CB4A 3TAMA 3HULA 2E1RA 2RJZA 2XMAA 4DV1F 4DQQA 1S48A 3S01A 4ZLNA 2C3OA 3W66A 5LT5A 2YXLA 3V5RA 3KK2B 2QMWA 2VG7B 2IAJB 1PKUA 1T03A 2U2FA 1S49A 1K9MT 2HLTA 3P5BP 4DPYA 4G1PA 3V2UC 3QAUA 2DGQA 4ALZA 5I3UA 2G9OA 4NX9A 3BZQA 3MECA 3CCMS 2CIMA 4FF3A 1WI6A 1H74A 4ZCMA 4ES3A 3FEYB 2IDLA 3UDEA 1ZOTA 4I64A 1HD0A 3IGNA 1UCNA 1KTVA 5CZVA 2R7WA 1NZAA 2BANB 5KFFA 4KE5A 1RAHB 2E7WA 4PG4A 4OQJA 4OV6A 2VBWA 2LQ5A 4DSLA 1JLGB 1RWVB 4N76A 2HWIA 4ITSA 4DR2F 3F0NA 4CM0A 3OTEA 2XY5A 3PZPA 1FJEB 5E33A 3IBFB 3TAPA 4HHJA 2DRAA 2J6TA 2DGOA 2YH0A 3QJPA 3MUVP 1QDUB 1WD6A 1PC5A 1LWFA 2C42A 5KFDA 3OUYA 3GCXP 1IWGA 3KUHA 4ZLJA 1S1VA 3ETMA 2IYGA 1VHFA 2EXUA 3PRDA 2FIUA 4K59A 1TKXA 5D0EA 4DV1J 1R8CA 2NZ4A 2IJRA 1RSCA 1KEKA 4DL2A 1TV6B 5MAOA 2OEMA 2R9LA 3M8RA 4M5NA 3MM9B 2AJ2A 1YI2S 1HW8A 2VG6A 4N77A 3D2WA 1TUVA 5CHCB 1RK8A 2DY9A 3QNWB 5J2NB 5E41A 2LA4A 4F36A 2Q3PA 3CD5A 3RB6A 3G9CA 4OYAA 1ROFA 4Y34A 3DMJB 2XZWA 5HROA 1I94F 1F5BA 1U4BA 1UEVA 2BE7D 2CQGA 2PMWA 1KONA 4O3PA 3R5BA 3B8HA 2C3UA 4J9PA 4LVNP 3C16B 4Q0BA 3TUJC 2MKCA 4I6WA 5L1JA 2N7CA 4LT6A 2R7TA 1Y5LB 4DEZA 3JS9A 2CQ2A 2ZH6A 5DJBA 4ZS6A 3PKYA 5KG3A 6AT1B 3W2WA 4KR0B 4DR2J 4USVA 3J7Z5 2AJ1A 2YWFA 1H2TZ 4DCJB 2OTLS 2CPJA 2ROPA 3MM7A 5T41A 1Z1ZA 2UVWA 5IXUA 4NYZA 1WDTA 4WU2A 4L3KA 1Y0HA 3PVXA 2FUG9 2ZBRA 3ILLA 4OZ2A 2XTJP 4MAKA 1FKOA 3J80Y 2MKYA 3R8YA 3M32A 2HQ3A 4XDDA 3FZBA 4FKYA 2I1RA 3PYEA 5CYMB 3I87A 3I96A 3T9ZA 3D7SB 1TL3B 4WFNQ 3MM5B 1FDAA 4V1Ak 4I2PB 2BDPA 4L76A 4PXBA 1WG5A 1KLNA 1NHUA 1U0HB 3A3OB 3D3CJ 2YX7A 5F0WA 4M5KA 4F04B 4U9RA 2DRBA 2PA8D 1U1NA 3I0RA 3PNIA 4FYDA 3KLEA 5JXSA 2XNRA 2I0XA 2HVIA 5HVHA 1NXIA 1REGX 2AU0A 4O3SA 2G2YA 2CZ9A 4RW4A 4ZIWA 1S99A 2LQ8A 1RU1A 3VAHA 4LF2A 1Q7LB 3N0VA 2R2RA 1RZMA 2BJ7A 3BS9A 2V4RA 4G3IA 5C24B 2Y8YA 2KRBA 1W7WA 2X51A 5CCMA 1YRUA 3MFIA 3IR6B 2G0IA 4KV8A 5J2MB 1RWWB 2ZNZA 2OLWA 3AQOA 4EO8A 2CDRB 4N47A 5A8WB 3J81j 1VOMA 4DPTA 1NNDA 3ETOA 3QQCD 3W8PA 2IC3B 1T9VA 1VQKS 4I2QA 3D54A 3KJNB 2EKYA 2M2BA 2FLNA 2UUBF 4KHPF 1KVKA 3GFYA 1FE4A 2QMUB 2FZKB 2XQCA 2QMXA 3MGJA 2B7CB 5CYQA 1K1SA 1VDHA 4U8YA 2RILA 1FRMA 1VRTA 3HJFA 1JKHB 1Y7PA 4Q5VA 4U95A 3BO4A 1JLFB 4IRCA 2CADA 1WNEA 2AQ4A 3LP0A 2MKJA 4JI2F 5D0RA 1X7VA 3DOKA 4KGMA 2YWHA 5K14B 1RT5B 1UP1A 3C6TA 1ZPVA 3T5KA 1XNRF 1SUQB 2P9CA 4MK8A 1HYSB 3OL8A 2NCKL 3GJRB 3D1OA 2HLUA 2MQ8A 3I31A 1ZA2B 1L3UA 5EWEA 3CCUS 3IRXA 1IKWA 1GNKA 4ZVFA 2NPIA 2ROEA 1DURA 2GIFA 2RHQB 1GK8A 4IFVB 4DG1B 4ZP8A 4UW2A 2HBZB 2Y3YA 3DU6A 5H9EJ 2JLFA 4AQYF 3KKFA 4O4GA 5HP1A 1F3VA 3BN7A 3AODA 3ELHA 1Q78A 3LGMA 3PX4A 2YKAA 4PKDB 4KHPJ 3HSZA 2F9DA 1FF2A 3L7OA 4W4MA 1W2IA 3PW5A 3N6NA 2ZC3A 4OFZA 2KXNB 1OQ3A 1U8WA 1X0PA 1FTCA 3DOLA 4ZPTR 4P2FA 5L9XA 3I0SB 2EG2A 2SXLA 1VS3A 1R6YA 1SJ3P 2N4DA 1B0VA 1V9OA 4C8ZA 4H4KC 3HHLB 1N33J 5HMXA 2OPRA 2W4DA 2ZKUA 5C2CA 1KBRA 1QE1B 4C8LA 4XK8C 2UUWA 3MDFA 4JI2J 3OLAA 1S1TA 3QRPA 2DNYA 2JOQA 1SJFA 1GT8A 1MN7A 3TJAA 5GAHU 4CLLA 1S6PB 2Z58B 4NEZA 2BW2A 4CLZA 4K5SA 5L8RC 3DNCA 1APSA 2VPXB 3GIIA 4DBQA 3MUTP 3KK2A 2E7VA 2VG7A 3QGHA 1H72C 4ANCA 3PFEA 5ETSA 3KLFA 1WELA 2LQBA 2CPYA 2XGPA 2JZ5A 2V9KA 4ICLB 1Y00A 3I9V9 4CLWA 4M63A 1X5PA 2ZUGA 2Z8QA 2RF2A 3FFIB 1N5YA 1NK6A 2QSFA 2H5IB 4B9MA 3CIZA 4QJVA 1M1HA 4MKYA 2C2EA 2FHKA 1XBWA 2QN6B 2QLJB 2BANA 4ETXA 1X4EA 2MQQA 2RAQA 3UR3C 3NGDA 2AWZA 1S9EA 1JLGA 2M5YA 3WZ0A 3C8YA 1NDLA 2F63A 5DGAA 1H2VZ 1FVQA 3RUBL 1DJ0A 4R25A 2RH3A 4J9RA 4PEOA 4NRUA 4Z7CA 2AMCB 4J9OA 3CJRA 4V19J 2GMJA 1R7IA 2DNRA 3K8WA 4XPEA 4X4TA 3ET6B 2ZH7A 2D41A 3PX0A 1A9NB 4O3OA 1EX8A 1QJHA 2NS1B 3PRVA 3NBPB 5F8LA 3QIPA 2R4FA 1TV6A 2QG9B 1IM4A 3MM9A 4WIQA 4Y2AA 2XCPA 1GXLA 3G82B 3NCQA 1VQ7S 5J2NA 1FJCA 3RB0A 4IQMA 1SKUB 4NLSA 2ZFHA 1YTYA 4NLWA 5AE2A 1SV5B 2CPZA 2HNDB 3JB9k 5F8JA 1AT1B 4CLFA 3I4HX 4BHQA 3Q8UA 3DRSB 1T94A 4QIVA 3Q2SC 4U7UD 3CJ4A 4DR7J 2ZKTA 3CC2S 1PYSB 3TANA 3LPEA 3PYFA 4UTGA 4KO0A 2DR7A 2B8PA 1VIXA 2P6TA 3LTOA 3M9NB 4HLBA 4OHVA 4DV5F 1PCAA 4F3QA 1TL4A 2HG4A 3BPDA 1YLXA 3GV5B 3RW6A 4DSFA 4F0HA 2A18A 3BR9A 3OTCA 3R27A 3DU5A 1ZM2A 5M2PA 3BKTA 2UV8A 3RRHA 3PO4A 4JBCA 4CH7A 3M2RA 4WZMA 3X3UA 3BGFA 1UEUA 3B82A 2AEJA 2WW8A 2M88A 2M52A 4G65A 2C2KB 3KMSA 2CQBA 3KLGA 4OI6A 2KM8C 1N4LA 5CYMA 1DHMA 1HKAA 2Y1JA 3MM5A 3IBCB 2C2DA 5B08A 2BRKA 1U1RA 5HATA 2YVSA 1Q8BA 1SC4B 3EMTA 5B0DA 3FMBA 1LWCB 5LSLA 3RZAA 2MB0B 3GR0A 4ECWA 1JMTA 1IXKA 4MYUA 1IQZA 3P49B 4O3QA 4FXDA 3HD2A 3DI6B 4WFXA 4PG7A 2H4YB 3NY0A 4IOAQ 4RL1A 1X4DA 1TAUA 2NXJA 2J0XA 2BBEA 2CPEA 2NXUA 1MWQA 3BQ1A 3MHYA 1BWVA 1AUDA 1YVFA 1RBAA 4AFFA 1HPZB 1KDNA 1NMEB 2E1PA 4LSLB 2HWTA 4C7QA 1PAUB 2MSTA 2V50A 1C2PA 2DHAA 3BSAA 4FYWB 5E3QA 2JLEA 2IHR1 2UVVA 5E0OA 1VBYA 4PWUA 3KK1B 4DV5J 1S0VA 2N7YA 1JK9B 4ANEA 4ZP6A 4DCPB 4PWWA 5C24A 2HHUA 1RT2B 1HMVB 2XS5A 1FNMA 2YQ1A 2CQCA 2MKIA 2AYMA 3CDEA 3N79A 4P2XA 2L9NA 2HIQA 4CQ1A 4LQ9A 5A8WA 1CSJA 1HBNB 2BACA 4DPWA 4XIUA 2F7VA 4C3LA 4R8UB 2DNHA 1T05B 2EI5A 2FY8A 4ATNA 4J9NA 2J0WA 4DL4A 1VC5A 2KKHA 4NYPA 4A8MP 2ALYB 2VBZA 1T95A 4QWEA 2M0GB 1Y9OA 3BPSP 2D7SA 3QZ8A 1JB0C 1JKHA 2HAFA 1NCLA 3AXMA 3LGHA 3TUIC 4LIRA 2QX0A 4ANDA 4NLDA 3K57A 1IBMF 1MMLA 2QLBB 4OX6A 3DLLQ 4CO5A 3R1HA 2W8LA 3WC2A 2NPFA 1RT1B 3FEXB 2ZBPA 3OXGA 2LFVA 3RAXA 2IIHA 4LRBA 4UOFA 1AW0A 1SUQA 2HVZA 1HYSA 2LU2A 1NB7A 2VZ9A 1G2EA 3OT9A 1Q86T 4OYXA 2LYVA 3QT7A 4NI2B 1CBKA 4DX6A 2UUCJ 3LPYA 3GWCA 1NK4A 4ZVPB 2XMUA 2X1GA 3F73A 4IFVA 3GMGA 4DG1A 1FX4A 2UVRA 2J76E 1QAXA 1D8YA 4W92B 4OYBA 4OZNA 1VQ6S 2GJIA 3CCZA 4K4YA 5DS7A 5C42A 3U1LA 4WE1B 3EGNA 5B09A 4P52A 1CULB 1EB0A 2DR6A 2L9DA 2CPHA 5DQHA 2QL7B 2YKMB 1YK9A 3I0SA 4NCGA 2KB2A 5D4PA 1HBUB 4E2FB 2FC8A 1PILA 2V2VA 3HHLA 2Q43A 1EIYB 2JHEA 1QE1A 1LK7A 5HI7A 3Q8VA 2JX2A 4NPOA 3FCVA 2HFNA 3AOBA 4FVCA 5DGBA 2QFIA 1M5OC 5BYQA 5KG6A 5JVHQ 4X4VA 1S6PA 1G7CB 2RE1A 2A2CA 3U7JA 5LJ3Y 4CI0B 3DRYA 1HNXJ 1FEEA 2HFSA 1HQEB 1TVRB 1RJJA 4DR6F 1JJHA 1H38A 1YJVA 4ED5A 1NKBA 1GX5A 4HYKA 1A0OB 4Q45A 5D4OA 1NJWA 2HVDA 2RS2A 1EJ7L 2C2OB 1DLOB 4ICLA 2Y8WA 2RQMA 1EHWA 1VI7A 5EDWA 2ASLA 2QLWA 1HHTP 3FFIA 1QUPA 3KNAA 4LQ3A 4OJGA 3MMCA 3DHXA 4B3SF 3JSMB 3CCWA 2LDYA 2K1RA 2FJAB 4EBEA 3H0PA 4X65F 5DG9A 1SQFA 1FJ7A 2FJXA 4RW7B 4ZVRB 2YKPA 2QRRA 2R3VA 3PHTA 1IKYA 2FZCB 1XMQJ 2ZE2B 4ECYA 4JI6F 2P6SA 2YX1A 1N34F 4DV0F 3CDAA 1Q0NA 4CT8A 3K5PA 3Q83A 2JWNA 4A8FA 1RDRA 1ZAXA 1TELA 4ZITA 1EETB 3GV7B 3RYLA 2V6AA 2HQFA 3ET6A 4A47A 4FYXB 3D0IE 3ITHB 4M1KA 4Q7AA 1NHKL 4CH1A 4TQRA 1DFDA 4CCHA 3M30B 2UXCJ 3NBPA 4JI7J 1QD1A 2J7UA 2JFKA 4A8XA 1FNOA 2DR9A 2W8KA 3KHRA 1T8EA 2VA3A 3G82A 1RWMB 3W5YA 2Z2YB 1PO6A 1IJFB 2EW9A 5DZ6A 3ONQA 4RNHA 2XS7A 1KQFB 2HKEA 1SJQA 3DGVA 1KC8T 8AT1B 3OVBA 1M5SA 5HMZA 2XCAA 2E9TA 4Y6IA 3MEEA 1SV5A 1BQMB 4RLEA 2HNDA 5B0FA 3G6XA 4OI2A 2HHQA 1OWXA 4ZVOB 4AUKA 4X65J 5J2QB 4CO1A 1HARA 1T9TA 3UW1A 3OSPA 1RWKB 3MPUB 1CS4B 2XMMA 5A8RB 1QAYA 1IM6A 1VMBA 4LFCF 3TOQA 4V19X 4JI6J 1RAEB 2JNJA 4RUHA 3LANA 4DV0J 3K89A 2DB1A 1OMSA 2D3OR 3VGVA 2HFUA 4NLVA 4WYWA 3PW4A 4X4UA 1DTQB 2H9ZA 1S0NA 3H5XA 3K17A 1I6JA 1DZ5A 1NK0A 3RR7A 1JLBB 3A3PB 4I4BA 1T9XA 2JL9A 4O3RA 1U6FA 1RABB 3UN2A 4WF9Q 2ZHBA 2COLA 1UVLA 3G71S 4OZ3A 2IRUA 3AD7C 3EVOA 4F4WA 4DPOA 3MR2A 2V4JB 3VVUA 2QO3A 3CCRS 1HBMA 3HM9A 4DV4J 2NLWA 2J9DE 3OTOF 3ISNC 3CIMA 1VQOS 1TK5A 2RQKA 3N6MA 1KLMB 1QY7A 1HR0F 3T9NA 2HBQB 2FVPA 2VASA 3W64A 3VCDA 2IM3A 2RVJA 1TAQA 3R7SB 3SSSA 4OYWA 3O1LA 4B02A 2B5JA 4URQU 3Q8YA 2HWHA 1ZETA 1OS5A 2J5AA 4ILRA 2BMBA 1VQ9S 3AXKA 2UVUA 1RADB 5JUMA 3DGPA 4Y3CA 5F8GA 2GW8A 3C66A 4LFCJ 3KK1A 3V6DA 3LQVA 3HPOA 4OLOA 2YNIA 2KM8B 4DZDA 1PG5B 1FFWB 1I3OB 1HWLA 3DXBA 3KJFB 2IVYA 4F02A 4ED3A 1NPKA 1NK7A 4AT1B 1OPIA 4I68A 2QV6A 4ED2A 1FWKA 4KH0B 2KT2A 2CWXA 1XK8A 1HBNA 3R5AA 3M6VA 3NRBA 5GMDA 5DETA 4CT9A 2ZH1A 2VDIA 2AD9A 2H65B 1LQ9A 2W2QP 1GTEA 3NCPA 2PC6A 4RNFA 1GXUA 4ZVQB 1YHQS 1BGXT 4M94A 4FF2A 3KLIB 3QGGA 3MD1A 2HGMA 3SSRA 2XWXA 3T6BA 2R7VA 3FRZA 2Z30B 3Q24A 2X1BA 3OTOJ 1VLYA 4KPCA 1IBLF 1TKZB 4EYIB 4QPXA 1M5HA 2XC9A 5H9EK 1HR0J 3TX0A 2CXEA 4C98A 1FCAA 1U6ZA 2OH2A 5D78A 2GIQA 3K59A 3MR6A 5EHHA 1SIZA 4Z37A 1U24A 1ZM4A 3VR1A 1BC6A 1EP4B 2YNGB 3NWGA 1AA1B 9RUBA 3DN9A 1WC5A 4P71A 1YZ7A 4HL9A 1SC1B 2K3IA 2KVQE 2PA3A 4ZPDA 5AXMA 3GYGA 3DC2A 2I9SA 1S1UB 2W7AA 2VH7A 2NYHA 2QEXS 2OUGA 4NI2A 3K58A 3BGUA 3V4MA 4WXWA 4P72A 1JNZB 4G6VB 4W98A 4LF5F 1B64A 2BJ1A 1ZM9A 2W9AA 2DHHA 4L6V3 2FTRA 2LVWA 1X4FA 2ILZA 2DXEA 4UUWA 1Q95G 4OIXA 1CULA 4USIA 4YMEA 5D15A 4LRDA 1CJUB 3EM1A 4DR4F 4F2SA 4J9SA 4AXIA 4NYOA 1S72S 3ENVA 3LWMA 1FKPB 1OSDA 3T41A 1HBUA 3F56A 1IBLJ 4HEA9 1UA1A 3IAS9 2BM1A 3CCJS 2VUGA 4DU8A 4ECVA 1R8PA 2HZCA 3PRBA 1FFGB 2W2MP 1FRJA 3CXCR 1TUGB 4M5IA 4DZ6A 4DX8H 2LMIA 5LJ5Y 1MROA 4IDKA 2G1DA 2CYYA 1LK5A 1X5OA 4EEYA 4GO5X 2DNQA 4LFBJ 1AFIA 3LWLA 3M8PA 1X9SA 4C0HA 2H3EB 3W61A 3UN3A 1HHSA 1HQEA 4F50A 1TVRA 2HQIA 2JRSA 3FSXA 3PXGa 2AF6A 3MFHA 2NXCA 2QC3A 1H7WA 3AH6A 4LF5J 3H5YA 5KT3A 4PWDB 3QATA 1NO8A 2CAJA 2CUYA 4KC5A 4IOBA 2LXUA 2I8EA 1YJNS 1VC0A 4H4KA 2GJFA 2PMHA 4HHUA 2KRRA 4FXVA 3NMRA 4DR4J 1SQGA 3OD2A 1BHNA 3GIKA 4RW7A 4EUVA 2OMOA 4YR2A 1V3SA 4BC7A 2APOA 1FFSB 2EFOA 3M2VB 2ZJRQ 4NXNF 3TWZA 2FVQA 2J8AA 4WZQA 2YNFB 2ZE2A 3A12A 2UV8G 3FBFA 2XGQA 2J0SD 2XMJA 3HP6A 1HQUA 2RB7A 1QTNB 1WJ9A 3GFXA 3LP1B 2FVSA 3WQPA 3ZZPA 4U8VA 4AL5A 2YPYA 2GHVC 1NM2A 2VQEF 3R5JB 5IM0B 4K4XA 4USMA 1RCXB 2ROGA 3H2VE 4N41A 3M2UB 4RW8A 4A8OA 3GP9A 3PTWA 2HK2A 3H20A 1AROP 3AAWB 2Q79A 2AIRB 1QM9A 3MXHP 2E5HA 1RKJA 1N5VA 5IV4A 1FT8A 3HK2A 4EK2A 4DFMA 5EUHA 1C4CA 4M5MA 2OHDA 2UXBF 2VDHA 5I3QA 2ZZNA 1CJTA 3H4DA 4DR1F 4NCBA 3C6UB 1BUXA 3VZHA 1N36J 3R9LA 2R2TA 1WOPA 4Y00A 1RTDB 5LOQA 5D4NA 3KWMA 2HGNA 4HHHA 4EBCA 4P2MA 3ZZ0A 3H98A 1NRKA 2P2CB 4OZLA 5B0AA 2XSJB 4O23A 1CS4A 5ETKA 3RW7A 2JH3A 3MPVA 1WKLA 2WVEA 4NXNJ 3K2YA 4K4VA 4X64J 3IR7B 2GZOA 4QYZJ 2R7OA 1VQNS 1N5SA 5K8NA 3M8QB 2WCXA 4B08A 1TUWA 2F4VJ 4CO2A 3TNVA 4DF4A 5ITHA 3DLKB 4ZVHA 1WKJA 4L73A 4TU8A 2CG8A 2P8IA 5IWAF 1PJ6A 4ZP9A 4X4OA 2JEJA 4IG3A 1JLBA 2GNKA 4NE9C 3PW0A 3IWXA 1WTFA 1XN9A 4RNMA 3SCKE 3PJXA 3CO9A 4LF1A 5AXNA 4DS5A 3SMZA 5D3GB 1N32F 4KGXB 2V4JA 2IYIA 1WOOA 5KG0A 2XLJA 3KHHA 3I4PA 2YTCA 3MCSA 3P6YC 4ZP7A 3R97A 2UUTA 1TKTA 1CLFA 1C1CB 2R7UA 1RLDA 4DPUA 4K4TA 2AW0A 3H7HB 2ZBQA 1HWIA 1S6QB 2HFOA 3UDVA 2DXDA 4L72B 5L1LA 4ZOSA 2O3DA 2Y0SD 4IO9Q 3DHWC 1FRIA 5G0RB 2XMTA 3I32A 1RTIA 4O4RA 3ZZYA 4CLKA 4F0KA 1CEZA 2EC0A 1L3KA 5IC4B 3D6FB 3JTNA 3MAAA 4GMKA 3O8WA 4LF6J 1R8AA 1U45A 3MMJA 2XEXA 1IUJA 2XWYA 1SL0A 3IC1A 2IMOA 3A1YG 3TJ8A 3N01A 4EFAC 1VBKA 3OW2R 5B0GA 1KFDA 5HANA 3LP2B 4F4XA 1R3NA 4A8YA 5IWAJ 2MLYA 1JJCB 1FWLA 4HTIA 2V0NA 2W9CB 1B7YB 2BOAA 2RKIA 4KSEB 1I1GA 4JI1F 4CNZA 4LF4J 4QWDA 3C3LA 1KKHA 3LALA 2LLZA 2DKOB 4AYBD 2HNZA 3MECB 1JJ4A 1N32J 2RHSB 3CJQA 5KFBA 1W26A 4WK1A 3M6XA 3OBIA 4DV7J 1ITPA 2Z56B 3BM7A 3QT5A 2BEFA 4WBFA 3AQPA 1TKZA 3TAQA 3PM9A 1TQLA 4PR6A 3K5LA 2FYXA 1IN0A 1SXLA 2DISA 3GG0A 4NOHA 3VVTA 2MHNA 3V6KA 1KQSR 2GQQA 2LXFA 2L48A 2RQ4A 4URSA 3W1YC 3MMAA 5C25A 1UZHA 5KFAA 2FGOA 4IR1A 2DIUA 1XR7A 4KRWA 4CNYA 1MG7A 4KB7A 1JLEB 1LWFB 4A8QA 1S1UA 1VQSA 4P10A 4DV2F 4QOTA 4K4UA 2VBYA 3MPYA 4H4MA 4R5PA 5ETVA 4NLYA 5GAEU 3BGRB 4CLTA 3RBDA 1TKXB 3GPAA 1VLOA 3DM2A 1M1KT 5F41A 2L9WA 4LRAA 5CQGA 5K20B 4CYUA 3THVA 2V67A 4JI0F 2BR0A 4JI1J 1IBCB 2MZJA 2QA4S 1NU4A 2EK1A 2KFNA 4Y2KA 3TX8A 5ETRA 5J1NA 1CJUA 1IR1A 3MOZA 1GMWA 4GO7X 4JV1A 1PGZA 1OQ6A 2RDIA 1Y10A 1S7HA 1FKPA 3IG1A 1RYRA 3V81A 5HROB 1HLWA 1GH8A 5FD1A 5ETTA 2E5JA 1X4BA 3CD6S 2YWGA 5LM7E 3G8TA 4HACB 5C5JA 3I82A 4Q0BB 4DMZA 2BE2A 2VD3A 3D68A 1ZZNA 3KDOA 4O3NA 1LW2A 2E1MC 2KN4A 1TL1B 3IO1A 2EFGA 2RRBA 3SXLA 4YY3J 3S7RA 4HH0A 2VJVA 2WBMA 3T1YJ 4CO4A 3W2WB 1I5OB 1NEEA 1HNZJ 4MYTA 3EXYA 4ECTA 2OPPB 3R5DA 2F8HA 2QLFB 4YR3A 2F9JA 1DY3A 1PSDA 4ZN3A 3JQJA 3M32B 3H90A 4TN2A 5GVQA 3Q8RB 4TYBA 3FJ2A 3MCOA 1IWAA 5AJ3J 2MZQA 3GQCA 3NGKA 1BLUA 4QR0A 1NKCA 4MKVA 2HBYB 4Z7YA 1EKSA 4BLGA 1NSKL 2O5DA 3NMAA 2WRMA 1TZ0A 2K06A 3UNGC 4FNIA 2AYBA 2Z2MA 3GB0A 4CIOA 2GHPA 1DAXA 5A6PA 1HNVA 3M2VA 2H48B 2IPOB 3I0RB 3GFHA 2B4VA 1RYSA 5T14A 3OFFA 3MM8B 2YNFA 5JJBA 2EVZA 1YSJA 2HHTA 5HJXA 2R8KA 4DFPA 3HFZB 3DRXA 5IFMA 3R5GA 3LP1A 2DXFA 5H1SV 3DLJA 3IXQA 4KYZA 2ASDA 1TFWA 3NL0A 4Q44A 1RT6A 3SCJE 1HWKA 3ZFVA 5IM0A 4LR7A 2FC9A 1U1KA 2L3MA 1WF2A 3POTA 3BDPA 2H54B 4MTPA 3ZTOA 4KV8B 3M2UA 4AL7A 2C3MA 2H5JB 3VWSA 2UU9J 3ZTQA 5HO4A 3T1HF 2OFHX 4B9SA 4GVBA 3ISZA 4HDHA 2XG8A 4PPZA 4ER8A 4NLQA 1D1UA 4G1QB 2PMZD 4GKJJ 2CWKA 1PJ7A 4FZVA 2BJ8A 3C6UA 3UDLA 4DOZA 3R7NB 4DFJA 2ASJA 1SC6A 1VRTB 4ZVGA 5KFSA 1NK8A 3SQGB 5KT6A 2DCLA 2ATLA 3NNHA 3FDSA 2GVDA 3J7ZT 2OO4A 2QZ8A 4RBVA 1WC1A 4EO6A 2VQFJ 2DIVA 4A8SA 1B0TA 1VYAA 5ADZA 1L5UA 2XS2A 2VFVA 1D0EA 2V34A 4QPTA 3FSIA 3W5XA 3C6TB 1XERA 3AHPA 3HHDA 4DUYF 1Q8IA 4DL0C 3HHLC 1HWUA 3LW5C 3DLKA 3ZZUA 3I5CA 2VODA 3OLBA 2DNOA 3PX6A 3IRXB 3D66A 4JI3F 1IKWB 3K5OA 1ZH5A 1WEZA 5KFLA 4K2JA 3HZGA 3P96A 4FF1A 3EJMA 3BBCA 1F60B 4NLGA 5BJRA 2GV1A 3QWPA 2E29A 5D3GA 3T1HJ 5HP1B 2GAHC 4EYHB 4RW6B 2M7SA 2IDEA 4YEAA 3LH2S 3CE8A 2QLXA 4IRDA 2MQLA 3KLVA 1X0FA 2I2YA 2IMWP 1Q81T 3HKZD 1AXQA 3IA0A 2YX4A 2XULA 3DOLB 2I5JB 4LF7J 3L3CA 1WSRA 3JTPA 4UOGA 3VAGA 1C1CA 2KI2A 2OD6A 1SKSA 4ZPAA 1OIAA 2PGCA 2HRYA 3U02A 1X5TA 5KFXA 3B78A 2VV5A 2OPRB 3E8OA 1Q7YT 1C1BA 5KOXA 2GMLA 5G0RA 1HI8A 1YGYA 3T3FA 1S1TB 2UUAF 5KT4A 2J9EA 3D6TB 1GTHA 3HHNB 1K73T 1YJRA 1GX6A 1EARA 3VGTA 1NB2A 5CXTA 1WF1A 3LP2A 4F4AA 1FI4A 1N0UA 4C3KA 2CVIA 4NEYA 4HTJA 4A8KA 4XAKA 2ZM6J 4F67A 2G1HA 3TQ1A 1WACA 4JI3J 1REVB 3T5LA 2W9CA 4USUA 1CPZA 3GILA 3KLFB 1RT4B 2KZZA 1OY8A 3CJSA 2Y9HA 4BWJA 1S1WA
chains in the Genus database with same CATH topology
1HL6A 4NCGA 3EPGA 5EWFA 2DHSA 4OJHA 2KB2A 1JJ2R 4HKQA 1JLCB 1FA0A 3HVRA 4RW9B 4Y2CA 5D4PA 2ZZMA 1ZBTA 1HBUB 3MR5A 2RF2B 3DM2B 2G0CA 1UVKA 1NK5A 2FC8A 1FRKA 3OR2A 1KTQA 1PILA 3LGNA 2IVMA 4FS2A 3SZ2A 3HI9A 1N5YB 1UFWA 2IAJA 2DO0A 2BQ3A 2AX0A 2NYIA 4ZDNA 3FMWA 2NSBA 3HHLA 4Y2MA 4WCEQ 3KK3A 2Q43A 2JHEA 2BM0A 3OUYB 3CT9A 1QE1A 3H8YA 3NAHA 4NA3A 1FERA 1LK7A 4NL5A 5HI7A 2M3DA 2BVZA 3IWLA 2JX2A 3QMQA 3ZZRA 3TVYA 4NPOA 1S1VB 4QW8A 2HFNA 3JYTB 3TR5A 2JC1A 4FVCA 4H54A 5DGBA 4OI3A 2Q66A 1U26A 2K2PA 2UZAA 3UD3P 3U1MA 1KNZA 1M5OC 1XMBA 4ZCLA 2UP1A 5BYQA 5KG6A 1S9EB 5JVHQ 4X4VA 1S6PA 1G7CB 2V9WA 3G8SA 2RE1A 4BS2A 4OHYA 3IS9A 2AJQA 2FHJD 4UY8T 3E3XA 4C2MA 2MQOA 2A2CA 3U7JA 5LJ3Y 2DNKA 2MSSA 3DRYA 3IG1B 4CI0B 4QBUA 4KPYA 2VG6B 1R0AA 4QW9A 1FD2A 3V81B 1C0UB 3ULHA 1FEEA 3R3TA 2DH7A 1FRXA 1HQEB 3W7BA 1KS2A 4C97A 1TVRB 4IG0B 1FXLA 1RJJA 4DR6F 2O66A 1JLEA 4JUZA 3UI3A 4AL6A 3BB5A 1JJHA 1YBAA 1H38A 1YJVA 3JSBA 4EZ6A 4ED5A 4F4KA 1NKBA 1GX5A 4HYKA 3BQ2A 3EZUA 2FHJA 2AGPA 4Q45A 1FESA 2BE2B 1KD1T 5D4OA 3AA8A 4C3MA 1NJWA 1WHWA 4ECSA 2FLPA 2FHOB 4YB7A 2RS2A 1FHTA 1LW2B 4ZCIA 3G6ES 2XY6A 2J0QD 1DLOB 4ICLA 2P9EA 3UPFA 3BGRA 2RQMA 3CF5Q 1H6KX 2CQ3A 2DTJA 2MGZA 3CDWA 4X84A 3HT3A 1VI7A 4MK7A 5EDWA 1SJ4P 3Q8SB 2ASLA 2QLWA 4PUOB 2WONA 3R5CA 1HHTP 5LL6d 3FFIA 1E6YA 1QUPA 2FHMA 4NLXA 3QIPB 2KG1A 1V6HA 3KNAA 2HNYA 3CMAS 2HVHA 4LQ3A 2YKQA 4OJGA 4TQSA 4FN5A 4DR3F 2DT9A 3MMCA 4CO0A 2F40A 2Z4PA 5J1PA 4K0KF 3KTQA 2AGQA 2MMYA 2KYXA 1P27B 5DLGA 3OHBA 2JSXA 3DHXA 4B3SF 3JSMB 1FDDA 3CCWA 2DGVA 2LDYA 4IOCQ 2K1RA 1MWYA 2FJAB 5E3PA 4EBEA 2ZH9A 4TKTA 4X65F 1YQHA 2E66A 2E5IA 2OD4A 5DG9A 1FJ7A 2WSFC 2FJXA 4B3OA 4RW7B 4IYQA 4LIWA 4QR1A 1WF0A 2O67A 2E7XA 2XMVA 3CMES 2YKPA 3WDOA 1GQEA 2QRRA 5HMWA 1DTTB 2BXJA 3MM7B 5J1EB 4DHVA 2DHXA 4QQBA 2C28A 3NP5A 3IWNC 1RKIA 1WG1A 2WK4A 4DQSA 4MKAA 2EK6A 1IKYA 2CQIA 4B3MF 2DGWA 2FGCA 2X3GA 2MZSA 2NREA 2WSCC 2ZE2B 1UJ5A 4ECYA 2L41A 4C8OA 2VBXA 4JI6F 2P6SA 2YX1A 2GQ2A 1N34F 4F26A 1FKOB 1BQNB 5IQ6A 4DV0F 2R7XA 3BSNA 3CDAA 2E5LF 4CT8A 1S76D 1A7GE 3HO1A 2XI3A 3K5PA 4A8WA 3BJYA 1DARA 1R31A 2JWNA 1RDRA 1ZAXA 1N36F 3PACA 1IKXB 1LXNA 3KG4A 4A8FA 4OI0A 2R7SA 1EETB 1L3VA 3GV7B 2V8HA 1LFPA 4EWTA 1ELOA 4FPRA 1B0PA 1FEHA 3RYLA 3CD7A 3CPWR 3SFGA 4A47A 4YUDA 1TL1A 3EUNA 3CDBA 3D0IE 3GR1A 3UCUP 1B7FA 5AE1A 3SYZA 4KO0B 3ITHB 4M1KA 4Q7AA 3DMJA 4YFUA 4CH1A 1VQPS 2ZJQQ 4B9UA 4TQRA 1DFDA 1HBOB 4CCHA 4HH1A 2OSRA 4HI2A 4NLOA 4ZK7M 2PI4A 1E6VB 2GQCA 4PWDA 3AJ1A 2K3KA 3OJSA 4IRKA 1S77D 3M30B 3NBPA 4FBUA 4M5DB 4B3RF 4IH5A 2VOPA 1QTMA 1Y3KA 4BDPA 1HD1A 2VC1A 2VA2A 5E3RA 1O0PA 2J7UA 1W25A 2JFKA 2CPFA 1WHVA 4A8XA 1FNOA 4NZ0A 2DR9A 4OV1A 2AJ4A 2KXFA 1HNVB 3UE2A 2OPPA 5FIIA 3EPIA 2W8KA 2FJDB 5SUHA 2KTQA 3KHRA 4X64F 4WKRA 4ZPWR 1T8EA 3D28A 2YKNA 2XNQA 2VA3A 2IM0A 3M2RB 4DR5F 1PO6A 1IJFB 2EW9A 1C4AA 1ULRA 3DFEA 5AXKA 3ONQA 4RNHA 3IR5B 2F4VF 2XS7A 1KQFB 1T7PA 1IR0A 1SJQA 4GC7A 2ZH3A 1KC8T 1VFJA 2DBBA 3OVBA 3KLGB 1S0MA 1M5SA 3LAKA 5HMZA 2XCAA 2E9TA 3D5MA 1P8GA 1RT6B 4Y6IA 4IFYA 2QT7A 3AB4B 3MEEA 1UJ6A 2N3OA 1SV5A 1Q8LA 2V8VA 2CQHA 1BQMB 4C4WA 3CULA 5A0YB 4RLEA 3KLEB 2HNDA 3MPWA 3WC0A 2W7PA 1C0TA 5B0FA 3TI0A 3G6XA 4OI2A 2DITA 2MJUA 2HHQA 2AJFE 3POTB 1OWXA 1ZTWA 4AUKA 3CWJA 5J2QB 4QWAA 3MM6A 1YJWS 4FF4A 4MFBB 4RW4B 4I69A 4CO1A 4WFZA 1HARA 3UW1A 4O44A 2RMLA 2ZBCA 5F0UA 3OSPA 1D9AA 2V94A 3LF0A 4IH7A 4F4YA 2CDQA 3CJKB 2OPQB 3G8QA 3OXFA 1RT3B 4U7UK 4F2RA 3IBWA 1LOUA 5DG8A 4JV0A 1NHVA 3NLCA 1TL3A 2XMMA 5A8RB 3VQTA 1OPZA 1QAYA 1IJEB 2D9OA 3KG0A 1VMBA 2KG0A 4LFCF 2ZH8A 1JNRB 1RTJA 2MJNA 4C11B 2PN6A 3TOQA 2VL1A 1JLAB 3QLHA 4QZVB 5KOWA 5KG5A 4V19X 2AX1A 4O0IA 1QSYA 4I2PA 1DRZA 3OL6A 2U1AA 5F3ZA 1ZAWA 4HT7A 4RUHA 3CGIA 3LANA 1F5AA 4QIFA 2DB1A 4UUXA 2MKSA 3OVAA 2D3OR 2RD5C 1VQ8S 1XWLA 1IQTA 3MM8A 4WFBQ 4U6PA 4NLVA 4WYWA 4XPCA 1J2VA 3PW4A 4NLUA 5GMKa 1J5EF 4GKKF 3KJVB 4C8KA 1FD8A 1FRHA 4X4UA 3MAQA 1U1MA 4MMOA 1UVIA 1DTQB 2H9ZA 4LMZA 1S0NA 3QO9B 4I2QB 3FRYA 3US5A 4EU0A 2PIIA 3H5XA 3JAMY 2KHCA 2N4CA 1XR5A 1I6JA 1RISA 5HQ8A 1DZ5A 2W4PA 3N5BA 1NK0A 3RR7A 4MIAA 1JLBB 4I6YA 1HNWF 2PDAA 2IM1A 4I4BA 1S9GB 2DVIA 1MNEA 2JL9A 4O3RA 5IQQA 1U6FA 4C8YA 5IS2A 2PD1A 3OL7A 1VQ5S 2JVOA 4B9VA 4YP3A 2RU3A 4WF9Q 2M8HA 2ZHBA 2COLA 4NA1A 3RAMA 2AGOA 3PR5B 2Q6CA 3H2UB 3RAQA 3G71S 4AXJA 1TFYA 1UVLA 2QYCA 3OL9A 3C2PA 2IRUA 2Q6BA 3N6LA 5CYQB 2E9ZA 4EBDA 4F4WA 4DPOA 2LEAA 4C8NA 3MR2A 4DSJA 1S6UA 2K8GA 1R8BA 5JVGQ 3KLHA 1RTDA 2J6SA 2V4JB 1DQ8A 1QAIA 4TY9A 5LMNF 4ED7A 2QO3A 3CCRS 3TA1A 4LF6F 2MQPA 1HBMA 5DM7Q 1WHYA 4HT5A 3HM9A 3U27A 1HFEL 1ZTTA 2P9GA 1F2GA 3OHAA 2V5HG 2YWKA 1X9MA 2NLWA 3UFCX 4PG8A 3O6QA 1RP5A 2J9DE 2KH9A 2E1AA 1U2RA 2XSJA 3OTOF 2CQ1A 3ISNC 3CIMA 1VQOS 1TK5A