4JI4J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4ji4J00
4YHHJ 4DUYJ 2KVQE 4NEZA 4LF9J 4JI1J 4X62J 3J81U 4DV1J 1XNRJ 4JYAJ 4LFCJ 4V1Ak 4DV4J 4JI3J 4YY3J 4KHPJ 4JV5J 4LF8J 4JI5J 4RJVA 4GKKJ 5BR8J 4DV3J 4B3RJ 2UXBJ 4DV6J 4LF7J 4NXMJ 4DUZJ 4DR7J 1N32J 4KYZA 3T1HJ 4JI4J 2MEWA 3D3CJ 4LFAJ 2UUAJ 2UXDJ 2UXCJ 4LF5J 5AJ3J 1N33J 2MQ8A 4X65J 3T1YJ 5LM7E 4JI0J 4DV5J 4B3SJ 2F4VJ 4DR1J 4DR6J 4DV2J 4X66J 1I94J 4GKJJ 1J5EJ 2ZM6J 4KY3A 4PWWA 2KL8A 2UU9J 3R2DJ 2VQEJ 4DV7J 1XNQJ 5IT9U 4AQYJ 4LFBJ 4DR5J 2E5LJ 4JI8J 5FLXU 2VQFJ 4DV0J 4HHUA 4NEYA 2MTLA 4DR2J 3D3BJ 4K0KJ 1HNWJ 1N34J 4LF4J 1HR0J 1IBKJ 3IMQJ 1XMQJ 4DR3J 2UUCJ 4JI7J 1HNXJ 1IBLJ 5A2QU 1IBMJ 5IWAJ 1FJGJ 3W1YC 2UUBJ 4OX9J 3R2CJ 5LMNJ 3JAMU 2HHHJ 4JI2J 3J80U 1HNZJ 4JI6J 4DR4J 1XMOJ 4B3TJ 3OTOJ 4X64J 4NXNJ 4B3MJ 4LF6J 5LMUJ 3J7AN 1N36J
chains in the Genus database with same CATH superfamily
1N0UA 2MY7A 2ZKTA 2XULA 2FQQB 3R7NB 2XSJA 4DV3F 1H38A 3BSNA 1N33F 3W9JA 2B4PA 4LT6A 4WK3A 2XNRA 5THWA 1UW4A 2HLUA 1IJEB 3HVAA 2JLEA 1CJUA 1B99A 3FCVA 3SQOP 1SH0A 3I32A 5F3TA 4DL2A 4KHPJ 1K1QA 2BKPA 1XMQF 1FNOA 4WTYA 5KFPA 4YR2A 3N9UC 3VTIA 4FBUA 1CC7A 1SQEA 3O6QA 2A2DA 2FHMA 3CDUA 1RAOA 2J6SA 2BKNA 3DOKB 4NWBA 4GKKJ 4OYZA 3V2UC 1MWYA 1RAHB 3C6UB 1FERA 2IA0A 4RU9A 3TANA 2JH3A 1N4LA 3BZQA 4DV6J 3OXLA 2VASA 2MPUA 2WB4A 2IVFB 3SCJE 1AA1B 3EMTA 1YZ6A 2DR6A 3DNCA 3UDEA 4Q5VA 4YS2A 3ZTRA 2YX4A 3UD3P 1ZM2A 1VBYA 5KFBA 3SV4A 2GJFA 4LFAJ 4FVCA 2B9XA 2KHDA 3HHEA 4YMEA 3NMRA 2KFZA 3LAMA 3KJNB 3GYXB 4CM0A 1LW0A 2CQPA 1VI7A 2CQGA 4XO0A 3GV5B 1KLNA 4X65F 1KFDA 2DJWA 3SFUA 2KKHA 4UOFA 2LMIA 5A8KB 1NSAA 4ZP7A 4JV5F 1QJHA 1RI7A 4MTPA 4B3SJ 2XZTB 3RR7A 1GMWD 4MT1A 3QYYA 4JB8B 4O44B 3SBMA 3DHWC 2WRMA 2VG5A 3MM9A 3HM9A 5BXIA 4Q45A 3BR8A 2DNPA 2D3OR 5HMZA 4ECVA 1HQEB 5I4MA 5F8MA 1RYRA 4FF3A 3H90A 3CCVS 1YQHA 3QZ8A 1HI0P 1T03B 4LRCA 4CO4A 1HHTP 2QX0A 1RWXB 2EEYA 3BGRA 4N8NA 4ZHRB 7FD1A 3HT0A 1X60A 1BMQB 2VC1A 1FEHA 3CB4A 3IBCB 4DJBA 2VDHA 1WSVA 1ZS6A 3HKWA 3Q8RB 1NHUA 5MAOA 4DV0J 3H42A 3A12A 1UZDA 2FJBB 1K9MT 3ENWA 1Q16B 3SI8A 1S48A 3UQSA 5KFTA 2AD9A 3KFWX 1KP6A 3G6XA 3TVZA 1H7XA 1O5JA 1MWZA 3DRPB 1TL7A 2BJEA 2P8IA 3I5BA 1HR0J 3BN7A 4RUCA 4A8WA 1XK8A 2YKPA 3D67A 2ZVIA 6AT1B 1HWUA 4MK7A 5KFQA 3CTRA 3PIPQ 3G2XA 5F0WA 4Q43A 2DBBA 2K8GA 1FJ7A 3DDIA 2IIHA 4IKAA 4F2RA 3THVA 3CMQA 3WQPA 3IWNC 3X3UA 2HS4A 5KFLA 1YJNS 2FZCB 3TAPA 2NREA 1NK7A 1FVQA 2RRNA 5GMEA 3EVMA 2MQOA 4DL3A 3VAHA 1U0HA 2NZCA 1FFWB 2ZBQA 3I96A 2Y1RI 3NGRA 4DV5F 3KJQB 3P4UB 1XTZA 2M2BA 4CI0B 3M8WA 5J2PA 2J7KA 1HBMB 1NCLA 3AOAA 1VBZA 3DDNA 3BN4A 3EE3A 2VJVA 4OZ0A 4WTOB 3H5SA 3QLHB 2XG8A 4B3TJ 3PXGa 2LA6A 1TFYA 2P9EA 1OQ3A 4PWDB 3DLKB 5KT5A 1GMUA 2CKWA 1HMVB 1RP5A 2GJ2A 5ETMA 3TAMA 1XC9A 4M1KA 5K8MA 2YVSA 4CTAB 4ED4A 1ZM9A 3ZTSA 1VQ4S 2E5LF 4OHVA 1WC4A 5KFGA 2XLJA 5A0YB 3PO4A 1FD8A 2HKEA 4IFVB 2WVCA 2MHNA 3PX4A 3IR6B 4ZVUB 2PE8A 2VOPA 2FJXA 5KFYA 3M1VA 3A4TA 3ZXWA 4N8OA 2RAQA 3DM2A 3BQ2A 4FYDA 3W62A 2KZMA 1VRQC 1XNRJ 2ZFHA 1SC4B 2B4VA 3HO1A 2GVZA 3L9ZA 2DHHA 2Z58B 2FB0A 2DITA 3BF4A 3DKDA 2B8PA 2O67A 4NE9C 4G1IA 5DO2A 3W3SA 2Q43A 2RILA 3HCXA 2BXJA 2V63A 3C15B 3CJTA 4D3HA 2HVHA 1AW0A 4B3RJ 4DXLA 1HYSA 1RXOB 1RBOB 5L1IA 2D69A 1RT1B 1RAJA 1NJXA 3TJ8A 4C3LA 5IQ6A 1WF1A 2P9GA 1IKWA 3VVUA 2R8IA 1SV5B 2RF2A 2QSFA 1TP7A 4ECWA 4H4MA 2MY8A 1S1VA 3PACA 5EX0A 1HQ2A 1K8AT 1R0AB 1D0EA 3TJAA 3KNAA 4OI6A 5K5MA 4QIFA 4LBIA 2UXCJ 3DOLA 2QLBB 3BB5A 3JTNA 3T1YJ 2CNOB 1FFGB 3V81B 2CG8A 2GMJA 5EUHA 4JI8F 1WTBA 2KB2A 3DLGB 1X8DA 4EFAC 3SV3A 1H0HB 1X9MA 2PMHA 1RTJA 1FRXA 3TZWA 1WJ9A 3UPFA 1WSRA 2AGQA 3NS5A 1NU4A 4AUKA 1NK8A 5CXTA 1P27B 1J5EJ 3R3TA 1W7WA 1MG7A 1UCNA 4CO0A 5DG9A 2WVBA 3H2UB 3RRGA 5A76A 4UY8T 2QA4S 2XO7A 2R9LA 2AYEA 4HHHA 3IG1A 4KKOB 4O3SA 1XMBA 1YG0A 1TKXA 4LF4F 2X1GA 2VODA 2WOMA 2WK4A 3JQJA 2OLWA 3P8BB 3W65A 2ASLA 3DOMB 3GR1A 3FK4A 1V3SA 1QE1A 3I0SA 1X7VA 3UCUP 4IRCA 2FJAB 3UW1A 1IQTA 2OMLA 4U96A 4IFYA 3TO8A 2AKWB 4IG0B 3IBFB 4OJHA 2DEIA 1QDUB 2K3KA 5F8IA 2IJNA 4O3QA 4LF4J 3B4MA 4Y65A 2MJUA 2C42A 3H7HB 2ZDOA 3O3LA 5F0UA 3SCIE 4OZLA 3UD5A 4JV2A 4KGVB 3LO3A 5D0EA 2E5GA 2W2QP 4R5PB 4P2FA 5HBMA 3QT7A 1F6TA 4NLDA 1PYTA 3VQTA 1IBMJ 1OY6A 1S76D 2FC8A 2ZWPA 4GVBA 1R3NA 3DRSA 4A47A 1PJ5A 4NA3A 3T19A 3VF0B 5HROB 1UVNA 3FQKA 4RWWA 3J7YI 1ZZFA 1UETA 2OJ3A 1LWCA 5KT4A 1LW2B 3QJPA 3TNVA 1SKUB 5IT0A 3EVOA 4F04B 1KSPA 2JL9A 3WX4A 3TUPA 3ENAA 2ZH8A 4FYXB 2BZ2A 3A8IA 2YX1A 3OFFA 5D4OA 1HL6A 1VC6A 1O6XA 1PILA 4B3TF 1H2TZ 3QMQA 1BXNA 4YB6A 1VDHA 1OS5A 1DURA 3CE8A 5HVGA 2YWGA 4ZPVR 2IMOA 2W2MP 2AEMA 1ZM3A 2AIRB 2FTRA 2H5IB 4I2PA 4MKVA 5E41A 1YTYA 3KLGA 1KNZA 2L08A 2DPJA 4RUHA 2UUCF 4F2SA 2CPXA 1TK8A 2KVQE 4DX5A 3P3DA 4WBFA 1FXLA 3PJ9A 4C3KA 5C2CA 2V8HA 1RT5A 1CBKA 1EX8A 2ZBPA 1U1QA 2BDPA 4FS2A 2W9AA 2JEGA 4P72A 2AWZA 3UNGC 1AXQA 1CJVA 4WIIA 2XYHB 3OXFA 4CLPA 4DMZA 2PO4A 1RUSA 1BUXA 1AB8A 1ZA1B 2YBVA 3M32B 4NXNF 2J7WA 3T6JA 2DNHA 3PYFA 3CMAS 1EETA 2HQ3A 2J8SA 3ZZYA 1RABB 2ZD1B 3CCMS 2DCLA 4MK8A 3PYDA 3D28A 5IC6B 4GC6A 4JI5J 4LF8J 2Y8YA 2ZE2B 5C42B 3KK2A 5E3PA 3BBFA 2FJDB 2PMZD 2CDQA 4YFUA 2AQ4A 2HEKA 5KT3A 3TEHB 4EBEA 1OPZA 3QSYB 2HG4A 1M5VC 4H4KA 4DUZJ 3IGVA 2WVEA 3NNAA 4GKKF 1J5OB 4FYYB 2R8KA 2ZZTA 4TY9A 1N6QA 3K58A 4O3OA 1EARA 5L1LA 2Q1LA 3DGPA 5J1NA 2QYCA 2LXFA 4M5HA 3EJMA 4ZK7M 5GADU 5IC4B 2DNZA 3QT8A 5HL7Q 1KOHA 2CJAA 1PKUA 2R7VA 2JOQA 1KWMA 3DI6B 4NZ0A 2F8EX 4P6QA 1LNQA 4TU8A 3UCGA 4UQGA 2OPPB 3AD8C 2HQIA 4P2SA 4JI0J 2HHSA 4HL9A 4DR1J 4FP9A 2NCKL 3PRVA 2FY8A 2JFKA 4G1QA 4RW8B 4E2FB 3MM6B 2HNYA 3T5LA 3PFEA 3NOCA 4PEOA 4LRDA 4OJGA 1TKTA 3KG0A 1IR0A 1FRIA 3NBPA 4CLTA 3DC2A 5K8PA 5FDLB 3TVKA 2LQJA 3V4IB 2VQEJ 1ZETA 3G6VA 2C2EA 1NSKL 1N5VA 2KH9A 3JSMB 1N0VC 2J7UA 3U1NA 1JLAA 5HK4A 4CLWA 2RQMA 4CLKA 3PKYA 1UA1A 2GZOA 3EPGA 4DDFA 2H5EA 1VQ6S 2PSZA 1EZZB 2GVDA 2DNLA 4L6V3 3OQ2A 5U47A 3OXGA 4DCOB 1U1RA 2MTLA 1SJQA 1AZSA 3GJSB 2C3MA 5C25A 2FGCA 1S57A 4WIQA 3MMCB 2MGZA 5D78A 3KK3A 2ZOMA 3D0GE 2IM3A 2DXDA 2AYGA 3MM5A 3ZZOA 1EP4A 1HARA 5ETVA 1RBLA 5D0GA 4PPZA 1HNZF 1E6YA 3PDNA 2Y3YA 1RT4A 4MIAA 2XI2A 1RHMB 3MEGB 4C2MA 4EWTA 2UUCJ 4QYZK 2ZH5A 2LU1A 5ETNA 2CA9A 1B0PA 2YWWA 1TELA 4OI2A 4LFAF 1WWHA 2GX8A 1UTAA 3EM1A 3NCQA 2IYIA 3J81Y 1FTRA 2ZBIA 1VQPS 3W5XA 3MFIA 4NCBA 3K5MA 4O3PA 2DR7A 2ADCA 5IT9Y 2C3PA 1SKRA 3VQSA 2DGWA 5BJRA 1N5YA 4JI1F 1H98A 2R2RA 5E0OA 4DL7A 2Y8WA 4ECSA 2QIFA 2J6TA 5DDRC 4URSA 1KR4A 5AXNA 3GFHA 4I64A 4DFKA 1CQNA 1HHSA 5HSPA 1DTQB 4ES1A 2NR0A 2UV8G 5ETLA 2Z56B 1NPPA 1U24A 2ZHOA 3OL7A 4R8UA 5LOQA 4DL0C 3MCOA 5CQGA 4FPRA 1N36F 1FDBA 2G1HA 2QG9B 4PAAA 2VOOA 1JLBB 4KH1B 2VA3A 1JKHB 3M6XA 1CPZA 3CCES 3HVTA 1UJ5A 1KQSR 2WSEC 2P5VA 4BWJA 1FK9A 4NEZA 3ZC4A 1UVMA 4LSZB 1AFIA 4ILLA 4OLOA 1RWUA 1UWBA 4K7QA 2RDJA 3G82B 3E01A 3KHHA 1ZZNA 2VPZB 4DV1F 3TW0A 4DV1J 3RRHA 3H98A 3OLAA 2B56A 4ED2A 3R7SB 1X5SA 2LDYA 3MPWA 2PI4A 3CO0P 5C2GA 4QOTA 3A3NB 5M2UA 2DCUB 2L48A 1S4EA 2LEPA 4RUBA 4BC9A 2FHJA 2HMIA 2J0SD 1NPRA 1FX4A 1TMMA 2ZBRA 4OI3A 2UXBJ 2NXCA 2W7AA 1Y10A 3RYLA 4ER8A 4OX8A 2E1CA 6FD1A 3MR3A 4C9DA 1IKVB 3U7JA 4X4OA 4DR7J 4RPFA 1WOOA 5GVQA 1J5EF 1J27A 2HWTA 2RKIB 4C8KA 2C28A 4QIVA 2XCAA 4KGMA 2WTFA 3GIJA 2V2QA 1L5UA 3FGVA 3OTBA 5AJ3J 2R7SA 3NEKA 3TUZC 1SIWB 2CG4A 2VFUA 1IR1A 4HACB 3CJRA 3GIRA 3RUBL 1LW0B 2I38A 3MHYA 4HEA9 3BYRA 4KT0C 4DFJA 4C8LA 1UVJA 2H48B 4WZQA 4Y00A 1CJKA 2GAGC 1V3ZA 2H51B 1M0SA 1NJZA 1WHYA 1U2CA 3IM8A 3PRBA 4N7TA 2M8HA 3CIZA 4KPYA 1HLWA 2CPYA 1JIHA 1JNZB 1JLEA 1FRKA 2O66A 1I51B 2WSFC 4I4BA 4MIBA 1RKJA 1WNEA 4EUVA 2XMVA 1UVIA 3TX0A 1K1SA 4MAKA 2G2OA 2XMUA 1MNEA 5J2MA 4A8MP 1SH2A 2FVSA 3M9MB 5IT9U 1F9FA 1WHVA 5D15A 4FDFA 2ROGA 1F9EB 2CQ4A 3GLJA 4RNNA 1FDDA 2CQ2A 4ZLLA 1S1UA 2PA8D 5H9FK 1R0CB 2V6AA 3MF5A 3N6NA 3MEEB 3M9NB 1BQNA 5K9FA 4AL6A 4F4AA 2FD2A 4NLGA 5CYMA 2EG2A 3BO2A 2HNDA 2H5JB 2W8KA 2F65A 3IM9A 4MYTA 3WC2A 1FKPA 2V8DA 3ET6A 2HHXA 2E9RX 2ZOFA 2RMLA 1LEOA 3HKZD 1S6UA 1S1XA 4FXWA 2B9EA 5HJYA 5DQIA 4A8OA 3PO5A 2FYXA 4IOAQ 3G8TA 4GC7A 3IBWA 3TRGA 2M5YA 4EEYA 5T7LB 2YKMA 4UUXA 4P73A 2V69A 4IYQA 1UZHA 5SZTA 2SXLA 5ITHA 4TU9A 2VPWB 2EFOA 2EKYA 2HIYA 3A8KA 3BEGB 1U47A 3KXDA 4X4QA 3J80U 4X4RA 1WC0A 3QAEA 4MK9A 2RHSB 4WXOA 2ZNZA 5J2PB 3CD0A 5IS2A 4ZKAA 3QWPA 2MQMA 3VGTA 1BWVA 4ILRA 1X4BA 3EZUA 2CDRB 3ITHB 5HVHA 3HVRA 3KUHA 1NDCA 1ZAXA 5D3GB 5GMKa 2QMWA 3FC9A 3KWMA 2KM8B 2RD5C 5DZ6A 1FJCA 2F63A 3CNQP 3I0RA 4CH1A 3MECB 2BOAA 4IO1A 2QE5A 4PXDA 1T9WA 4CQ1A 2UVWA 3J7AN 5D8HB 3E8OA 5KT2A 5IOLA 4CTAA 3OJSA 5IM0A 2YH0A 2DD8S 3CD5A 3U1LA 2R2TA 1L3UA 2F4FA 4KSEB 4E8UA 4IFVA 2J0WA 4I7FA 5DZ7A 1HR0F 3PHEA 4NLQA 4ZVEA 5ADZA 3SZ2A 3KK1B 1VQNS 3GPAA 2GV1A 4JYAJ 2VFSA 4TU7A 1UW9A 4RU2A 1R89A 5E7OB 2XMAA 2W4PA 3TZYA 1HFEL 2H9ZA 4ECRA 5CZVA 3I56S 4O44A 3EZOA 5ETKA 2BRKA 5E3CA 1YBUA 1U6BA 4K4WA 4L3KA 4RLEA 5BR8J 5KG5A 4QWCA 2PEHA 3VAIA 4OI0A 2ZUAA 1OY9A 2UUTA 4XPCA 2FUG9 1VHIA 4DZDA 4U95A 1YX2A 4URGA 2HS0A 3G8SA 2ZJRQ 2OIHA 3A8JA 2XC9A 1IKWB 4WKYA 1A0OB 4KGXB 5CZXA 5E33A 3GR0A 1M5PC 4H4MB 4B3MF 2HVEA 3AY0A 4RNHA 1R0AA 4WJBA 4JV1A 3LAKA 1D3WA 1H3DA 1RZMA 1PJ6A 3C14B 3M8YA 1S1WA 1Q79A 1Y3JA 3TZZA 2HHVA 2MKSA 3FBFA 2HRYA 1LK7A 2A6MA 4JOUA 1B7YB 1WC1A 3C8YA 3MI7X 3NWGA 4TQRA 4WP3A 4IRKA 4X4VA 1BWEA 2Q79A 2MDAA 3DOKA 1GT8A 2Z2ZA 1ACMB 1LFPA 1FD2A 2V9KA 3DHXA 1G4CA 4H54A 4AD6A 3BGFA 1RWMB 1NJWA 1YRUA 2J9EA 4DN9A 4ZDNA 4DOZA 3L7OA 3MM7A 4DSEA 1NB7A 1NHKL 2X51A 5ETTA 2OMOA 1RWKB 3DRRB 4JI7F 2NSBA 1FFSB 3TR5A 1Q8LA 2JEFA 3OVBA 1XBWA 1NZAA 4KKOA 2GHWA 2EWHA 1P6TA 2XHWA 3FBEA 8AT1B 1TKXB 4AQYJ 2R8JA 4LFBJ 5F8NA 4CCHA 2ADBA 2PGCA 3P5TL 2WOMB 4ETXA 1YJRA 1RTHA 5DGBA 1U1NA 1WDTA 1S1TB 2MQQA 5A8KA 4A8QA 5M2PA 2EC2A 1O0PA 1NK0A 1IXKA 5LL6d 4XAKA 5MLCV 2X3DA 1JLQA 2B7CB 3RBXA 2QA2A 1IM4A 2XSFA 4MKAA 3T9ZA 4ELUA 2G9OA 3DLKA 2GCFA 2H4YB 2X1AA 2I2YA 3GONA 4NLRA 4HVZA 2ZH4A 4ZIVA 2CNLB 2FVRA 4A8KA 2XMTA 4CT9A 2M8DB 5CYJA 4DQRA 1IBLJ 2X7IA 1IKXB 2BQUA 5KFVA 4ZHRA 2VG7A 5IWAF 4L73A 5JVGQ 3OUYA 1OMSA 2WSCC 2VKZG 2NPFA 5KFWA 5CA5A 2VICA 1UEVA 4DG1A 3HF5A 1CG2A 1Q86T 4ZN3A 2EK6A 3KDOA 1PIEA 2YKNB 1FE0A 3WC0A 3RJMB 1NK4A 2I0XA 2KYXA 2DR5A 4OYOA 4JI2J 1H74A 1FESA 1VQ7S 2IA6A 1RT6A 1DY3A 2HPUA 3MOZA 3CJKB 4F26A 3IAM9 5SUHA 2ZH9A 4M63A 1FNXH 1UEUA 5KG0A 1U09A 1EJ7L 4B3MJ 1Q1KA 1RU1A 2LXIA 3MAAB 4PABA 3CCUS 2EI5A 3THPA 1VJQA 2XBPA 1O51A 5CD4H 2KJVA 1TUGB 3NXZA 4ZVPB 4J9RA 3T5KA 4ELTA 2H1YA 2QGFB 3TZXA 1Z2ZA 1OPIA 2VD3A 2BM0A 3AOBA 3LWLA 4X4TA 4P2MA 4ZOSA 4DFMA 1TQLA 1UL3A 1FKAF 5B0CA 4FF4A 1AYEA 4M5IA 4OFZA 4PCQA 3MXHP 1DQ8A 1T9XA 3NY0A 3JQKA 4KRWA 1IQZA 4K0KF 2ACYA 5B0GA 1ZPWX 2XY5A 4P74A 2MSSA 2JLGA 4QR0A 2B0GA 3PFOA 4ERDA 2B7BB 1D9DA 5J1EB 3D1HA 4G1PA 4PWDA 1DQ9A 1DTTA 1HIYA 1HMVA 3TAMB 1N5TA 1N5QA 3C6UA 3ZNUA 4FKYA 3J7Z5 2L41A 3K57A 2FIUA 4NLSA 3UR3C 5T14A 3CXCR 3OTDA 5LSLA 3MUTP 1N32J 3Q23A 3AXMA 5EX3A 1HBOA 2VL1A 2YPYA 4Y2CA 3OR2B 4ES2A 1KVIA 4JI4J 1K47A 3MOJB 3D7SB 2PC6A 1SJ3P 1RLCL 3DGPB 4OX7A 4JP8A 1N33J 4MFBB 3RZAA 1KVJA 1S9GA 3IS9B 3N5BA 2J8AA 2W4DA 4FNHA 4HH1A 2Q66A 2CZ9A 4CH0S 4JI5F 3I0SB 3MMAA 4BHQA 1TL4A 1RLDA 4Q8EA 5LM7E 1URRA 1FVSA 2VDIA 4DHVA 2DNOA 2Z57B 4IFYB 1KBRA 3DGVA 4TQSA 1AUDA 3Q8YA 2G2YA 1OSCA 2YNHB 2CZ4A 1WF2A 3EICA 4MKBA 3D1QA 3FDSA 1B0TA 3LGNA 2CVIA 1L3KA 4ZPWR 2XCPA 3OJUA 2QFJA 4KQZA 4ZA1A 1KDNA 3I5CA 1S5ZA 2FGOA 2DTJA 2MLYA 1E6VA 2MLZA 3MAHA 1T03A 3R2DJ 5J2NA 1LKZA 3G9CA 2RVJA 1S4FA 3AA9A 3G86A 3V4IA 3ZZUA 2R3VA 5HBMB 3KYLA 1U1LA 3QQCD 1TVRA 3QO9A 3MFHA 1S1VB 3ISND 4OYAA 2A6OA 4WWSA 4J9NA 3D6FB 1OY8A 2YQ3A 3MD3A 4RNOA 2FLLA 2HGLA 3OFHA 4USVA 3TQEA 1T0TV 5B0DA 2V94A 4C8MA 4P7TA 4WE1A 4UZBA 1LWCB 3MR5A 4S0MA 1FHTA 2GVDB 4F0MA 4DR2J 4ANCA 1D1UA 3SSRA 3W66A 1S9EA 3V5RA 2GGPA 2ZITA 5C25B 4DL4A 1C4AA 2HHWA 3QFHA 3HVWA 5B08A 1U0SA 4F7VA 3BO3A 4DS4A 2NYHA 3KUGA 3O44A 5ETSA 4IH6A 3C6TB 1IBKJ 5A2QY 3CCZA 3H8YA 4I68A 4NMXA 1XMQJ 1N48A 3EGZA 4MJKA 2FY1A 4NLWA 1LWFA 2F8HA 4WP8A 4ED3A 3KG1A 4KE5A 1LOUA 4I6WA 1RTDB 3HSZA 2CPDA 5L9NA 2M70A 1SJ1A 1I3OB 5LMUF 5IWAJ 1U49A 1IBMF 3NCRA 3LP0B 2GHPA 1N56A 3VAJA 2HFNA 4J5OA 1R43A 4PG6A 2VA2A 2IM2A 1BQMA 4DR4F 3ZTPA 5H1SV 2MHEA 1SUQA 5DRKA 1NAQA 4JI6J 3DYAA 1VQYA 2DHSA 3QFWA 4QPTA 2KFNA 5ETPA 1JJ4A 1IM6A 3TEGA 2ALZA 2COLA 1WD6A 3PRDA 5D4PA 3NNCA 3AB2B 2GA7A 4RWXA 5F8GA 3GU0A 1KVKA 3CJ4A 1JMTA 1S79A 2RB7A 3M6WA 4KHRA 4TYAA 4ANEA 1QUPA 4DZ6A 1REGX 3HFZB 3V4MA 4DCPB 3IP0A 3CCWA 5A0YA 2A0FB 4OX9F 4CWBA 2D41A 3MURP 4AQYF 1Y9OA 1JLBA 1FA0A 4OYXA 2KXHA 2N82B 4KGZB 2FHKA 5GAHI 3P49B 4X2BA 3I87A 1GQEA 5GAEI 4USJC 2DGQA 4N5SA 2XMKA 1A7GE 2RJZA 2YXLA 1S59A 3IRXB 5CAAA 1XR7A 3M1VB 4KIAA 4HDGA 1RISA 4HT5A 1NO8A 3DM2B 1D09B 2F9JA 1YBAA 4L76A 4QR2A 2K3IA 4YR0A 1F3FA 3J81U 2FHOB 1W2BR 2GVZB 1TAQA 2D74B 1PO6A 2OPPA 3F73A 1QY7A 1NJYA 1FXDA 2KVIA 1JLFA 3W61A 1MU2B 2OPSB 3O5TB 3VV2B 4CLUA 5IZHA 1NK6A 2AZ3A 1CQMA 2AMCB 3C15A 3EXYA 2XMMA 2IC3A 2J9CA 1HYSB 3BH6B 4UOCA 4DV3J 4L74A 1EQMA 4LF9F 3ICLA 2HFSA 3VGUA 2XLIA 1A6LA 1VBKA 2HFZA 1AROP 2XWYA 5GADI 1GX6A 2EBEA 4CO2A 1R27B 3R6GB 2WVFA 4LREA 2CPFA 4NCGA 4F0KA 1FF2A 4F4YA 4IOCQ 3US5A 3H4BA 3Q8PB 4FNIA 4E98A 2VV5A 3HMJG 3Q8QB 4MKYA 3DOLB 4NZ7A 4URQU 2RU3A 1SI9A 2XEXA 2AEFA 4M5MA 3M32A 1VQ5S 1YJWS 2P6TA 3VVTA 3RBEA 1RTIB 2N3LA 4QIEA 4DV0F 3DLGA 2FVCA 3VCDA 1VK8A 2D7SA 1VQSA 3MMCA 4HHJA 3RRKA 2WONB 1WORA 2MGZB 4FF1A 4DV2F 4C48A 4FXVA 3J7YU 3HX9A 2ZE2A 3GP9A 5C42A 1NKBA 5I3UA 1E6YB 3FEZA 4K2JA 1RT4B 2MJNA 4QW8A 3ZFVA 2FVPA 2HHQA 1SC3B 2YX7A 3TUJC 1VQ8S 4TY8B 1WG1A 5K14A 5KTQA 4ZVTB 1UEKA 1QTNB 2LQ9A 2GS8A 4KO0B 2DH9A 1XNQJ 3RB3A 1HW9A 4KV8B 3FKBA 2JNJA 4OI4A 5DJBA 4FKXA 2HQCA 2U2FA 3MR7A 2KG0A 3CUNA 2RIJA 3FCWA 5HATA 2W9BB 1AT1B 3WIVA 5FLXU 3OW2R 2B4UA 3LQVA 1FWLA 3HZEA 1OO0B 4HHUA 4I0WA 2IY5B 3CT9A 1H2VZ 2N4DA 4WYLA 3W5ZA 2OPQA 3QIPB 3B78A 2EXUA 2V4RA 4K4XA 2Z2YB 4F4WA 1Q8IA 1NEEA 3QAUA 2HVIA 4G1QB 4DR1F 2XHCA 4NOHA 5CYMB 1W25A 3D5MA 3M30B 4R25A 1U8SA 1NUEA 1DTQA 3HK2A 2IRXA 1LFWA 1G2EA 4PPDA 1BQXA 3SDEB 4LIWA 1NK9A 5BYQA 3QJLA 4R5PA 2MKIA 2PFFB 2BE7D 3BSCA 3GJQB 3L7PA 1TV6A 4ZJLA 4PKDB 3FQLA 3W9IA 4Z7YA 5DG7A 2KYZA 4NLUA 5LXYA 1SPBP 2YKMB 4QYZJ 1EB0A 2C3UA 3QJJA 4ED5A 2ZH7A 2AT1B 1YJVA 4DEZA 4YDXA 1LW2A 3I4PA 1CVJA 2AX1A 2IVYA 2QRRA 4WFAQ 3E01B 3OFGA 3UDVA 2XYGB 2DY9A 1WOSA 1R6VA 2F40A 4EBDA 1U25A 4KB7A 1S6QA 3DLEA 1B7FA 5C24B 4QZVB 5BYRA 2OFGX 5HP1B 3OTOF 1EP4B 1XMOJ 1VQ9S 2HSEB 4WPAA 2CPZA 1KTVA 2JDJA 3LP1A 1SL1A 1NJIT 2HYIB 1MROB 1HNVA 1HWJA 5D3GA 4OYPA 1TUVA 3SSQA 1SL0A 4QWBA 1TL5A 4F25A 2VG6B 5L46A 4CM2A 4LIRA 7AT1B 2LDIA 2QN6B 4A48A 3M2RA 3CC2S 3RAMA 3K5OA 3NCPA 2GQQA 2PEBA 2HQDA 3CJQA 4JUZA 4I7FB 4BBYA 3CCSS 1FWPA 2HK3A 2BX6A 2HVZA 1R0BG 3KK1A 3EXCX 4TXSA 1C1CB 3K7RA 3T41A 4DX8H 3MTJA 5KOXA 2B43A 3J81j 2Y1JA 1B3TA 4O3RA 2F3JA 4QU7A 2C2KB 4NRTA 2UXDF 1L3SA 4TLRA 4PQUB 4HYKA 1F60B 5KFZA 4YY3F 3G71S 3BKUA 1TR0A 2CPEA 4HTIA 4YY3J 1P9QC 2Z4PA 3KOAA 3RBDA 4HR2A 1F2GA 2R7RA 2GO9A 5D0RA 5DETA 1VC0A 2YWHA 1TMJA 4ZLJA 1JLEB 4OI1A 2R7TA 3FVYA 2W24A 2YH1A 3AA8A 4OIXA 2MKKA 2LLZA 4LSNA 2ZHAA 4QPXA 1SKSA 3OL6A 3ZTQA 3NLCA 4DSLA 4IQXA 2JX2A 3M7VA 3BSOA 2V4JA 4PUOA 5IV4A 5DM6Q 3G4SS 1N34F 2GO8A 1HD0A 4ZMMA 4FS1A 4LSLB 1RHUB 1HW8A 3GMGA 3CJ5A 3QT6A 2R4FA 3G82A 2AP6A 1WI8A 1AUSL 2IRUA 4DQSA 3H5YA 4C8ZA 4X65J 3QATA 1DZ5A 4NLPA 1HQUA 1XQIA 3EGNA 2LYVA 1U8WA 3R6LB 2DR9A 1VMBA 4L3NA 4DR6J 3MEDB 1G7CB 4J90A 2EKNA 1CLFA 2C2MB 4AL7A 1I94J 2HMIB 3T1HF 4K5SA 1YJ7A 3SCKE 3TOQA 3R1LA 3UDCA 2FHJD 3ET6B 2ZKUA 1FT8A 4A8XA 8ATCB 3MWBA 5DDOC 1QVFR 5LJ5Y 3JSMA 1SJRA 2BJ9A 3BBBA 2AF6A 2C2OB 4OHZA 2OI2A 4C7QA 1PJ7A 4PXEA 4WCEQ 2CNKB 5DQGA 1QUVA 4I69A 3W5YA 2KHCA 1NKCA 2MSTA 2PFDA 2OO4A 3NWRA 2X3GA 3BDEA 3PTWA 4QCLA 1FE4A 1IR2A 2O1PA 1WACA 3AODA 4NLYA 4Y2KA 3HHLA 4DN0A 3UNYA 1PBAA 1V3RA 4J9UE 4J9PA 1RCXB 1U1OA 4M5DA 3ENQA 1XR6A 2E1RA 3MPVA 4UZCA 5CYQA 4CLFA 2V4QA 1HNWJ 1HHQA 4JI6F 3TJ9A 1P1TA 4USHA 2XYPB 3WX8A 3HT3A 3JQMA 2AHOB 3HPOA 3TQ1A 1X5TA 2R8GA 2IM1A 3DCAA 3I0RB 4MH8A 4O23A 4DR3J 2JEJA 4EYIB 4QW9A 1VBXA 3UVJA 4DR3F 2KO1A 5KFMA 2B8QA 2WBMA 3BSAA 3KLVA 3DLLQ 2O3DA 4P2XA 1KC8T 2UVVA 4JI7J 4PZVA 5JXSA 2JLFA 1VC5A 4ZP8A 1RAIB 5IFMA 2HWIA 3OUYB 4ED7A 3TI0A 5RUBA 1M1KT 3IFEA 2PMWA 3NS7B 1NSPA 5K20B 4X4NA 3JAMU 4RW9A 3NMAA 2HRTA 3MCMA 1UP1A 2LCWA 2W2OP 3D2WA 1SC1B 3LALA 2R2UA 1KD1T 4C8NA 4WFZA 5EGYA 1T7PA 2BA9A 1QVGR 4C8OA 4DR4J 3CJKA 3QWUA 1U4BA 3OPKA 3MDFA 4XTTA 3DXBA 3FRYA 2E7VA 4QQBA 2M7SA 2IM0A 2CQ3A 1Q5VA 2F8MA 1ZYQA 2BBEA 1S1XB 4A8YA 2DHXA 4OV6A 4JV0A 2D9OA 1RT7A 1VHFA 2H4WB 2KDOA 4ID5A 3PIOQ 3HVTB 1UWAA 4USMA 4F3QA 2CJXB 1URNA 1GX5A 5F8LA 5B0BA 2OD4A 3PG9A 3RR8A 1VK3A 4CO5A 3NOGA 5D77A 4C11A 1EAYC 4B9MA 1SQFA 1B70B 5GAHU 1VISA 2BJDA 3M6VA 1C0TA 2DH7A 3M9OB 2J6UA 1I1GA 1IWAA 3LANA 4WP9A 4DPOA 3IRWP 2ILZA 2RDDA 4LFCJ 1GMVA 3QIDA 1SBRA 1P8GA 2MLXA 3ITHA 3ZTOA 2NPIA 3QRPA 2RQKA 2DGVA 4FN5A 2HFUA 3C46A 1WEYA 3D9BA 1VGYA 1NMEB 1UMJA 3MECA 3PYGA 2DGUA 3KLIA 2WW4A 2BR0A 1RGVA 5B7WA 3MM7B 2OAUA 2N7CA 4Y28C 2ZJPQ 3ETMA 5IM0B 2L9WA 2XGPA 3BJYA 3MPYA 2WVDA 1SL2A 2V2VA 2YPZA 2DGSA 2YNIA 2E66A 4OMFG 1HBOB 1S99A 2PD1A 1BGXT 2RKIA 3GJRB 3IXQA 3ULHA 2JVRA 3SFGA 3ZZZA 5EDWA 2E1PA 4NCAA 2VONA 3PNIA 5KFIA 2UXDJ 4J7CA 3W8PA 1M5HA 2DXFA 2DYAA 5AXLA 4O4GA 4DSJA 3V6KA 2KT3A 4AYBD 3AD9C 1RTHB 5EN1A 1Q82T 3IS9A 3OV7A 4Q0BB 1MWQA 1RTZA 3UO0A 2ZBCA 3CWJA 2F4VJ 4CLYA 1XR5A 3M8QA 1RDRA 3R5JB 3MM8B 1UJ4A 2BJ3A 4DR6F 2E9TA 1JLQB 1Q7LB 2GMLA 3GE9A 3K2YA 1HBUA 2RNEA 3M2UA 3T9NA 1F3VA 3V6DA 4EYHB 3CJ3A 4USWA 5KFEA 2CXEA 1IUJA 2QFIA 4X4PA 4ECUA 2HZVA 4NYOA 3K5PA 1F2HA 3I31A 3BPSP 1KQFB 2BABA 3LA0A 1MSWD 3NAIA 4F0HA 1IKXA 4KC5A 3W2VA 4IRDA 4XDDA 1YZ7A 2DK2A 3ZZTA 2B9YA 3W2WA 1QAJA 4KTQA 2B5JB 1HNXF 1PC4A 1S1UB 3UR0A 5E2QA 3OHBA 3NGTA 4WE1B 2DNRA 1BQNB 3GIKA 1U6FA 3CF5Q 4QU6A 4NL5A 3PM9A 4F3OA 2GGPB 2W4CA 4CRJA 2HNDB 1FRHA 3CVKA 2YKAA 4AL5A 9ATCB 4AE5A 4J9OA 2MMYA 1XN9A 2RU9A 4Y2MA 1ZA2B 3WHIA 2DNYA 2Q3PA 3VAKA 4CH7A 4V19X 4W4MA 2GIFA 3VGVA 1RTDA 2VH7A 3FFIA 1GK8A 4CYUA 1RA6A 2CQHA 2CIMA 2Z2MA 3VAGA 4WYWA 2XY7A 1MMDA 2ZWOA 4YHHF 4NYPA 4M5LA 1JLGB 2LXUA 1GTHA 3FCHA 4J9QA 1BQMB 1S1TA 3KLFA 4Y2AA 1S9FA 1X31C 2H54B 3EDQB 1M1HA 1NDLA 1T9UA 2HS3A 4P71A 4B08A 1HPZA 5F9LA 3GIMA 3CDWA 1REVA 1QAYA 2V8VA 3HJVA 1GTEA 2BMBA 2M9KA 1DTTB 3M2VB 3KJVA 1U1KA 2GQCA 3AJDA 3N4WA 4CLLA 4KFBA 2Z2LA 3T1AA 4PG5A 1Y00A 3DDKA 2ALYB 3T3FA 3GB0A 3RAQA 2CQIA 1RSCA 1V9OA 3JS9A 2HLTA 1JK9B 3R27A 4ID8A 2VG7B 1L3VA 2GAHC 3E3XA 5E5NA 2W7OA 2N4CA 5DQHA 4TYBA 3OR2A 2IDEA 2H3EB 2DGXA 2WBRA 1JNRB 2YKNA 4M5NA 5HMXA 5LXRA 1XJWB 4ED6A 2IRYA 3LP2A 4N41A 4K4UA 5HLFB 2BUNA 1SKWA 5D4NA 4F4KA 2ASYA 3DLJA 2DR8A 2ROPA 1UVLA 2QL9B 1SJFA 4ZCIA 5J1PA 3OVAA 1C1BA 2XZDB 2XZWA 4U9RA 1VJWA 3MAAA 1WG4A 2XNQA 2V9WA 4LFBF 2M4MA 2VBYA 1S72S 5DS7A 3M6UA 4C97A 4K4VA 1KOOA 5D0HA 2KG1A 2W9CB 3PW0A 3LPEA 3VAFA 2RRAA 1LQ9A 2BVZA 5HQMA 2ASDA 3UWTA 2CJ9A 2MZRA 3K8VA 2CJKA 2VIHA 4XIUA 1S10A 3IR5B 1H72C 2WCXA 2DO0A 4A4JA 1M90T 1F5CA 1KHVA 3BREA 3MMBB 2D3O1 1TVRB 4DBQA 3PW4A 3W64A 3CCTA 1EQ0A 2C2DA 3C14A 4XK8C 2KM8C 4ED0A 4DQPA 3C66A 4EK2A 5KG4A 3IWXA 2OPRB 3PR4A 2C2ZB 2HIQA 1RT3A 3PX0A 4B3RF 2OTLS 3ISZA 4J91A 4RW7B 4ZP6A 1R8HA 3N6MA 2KRBA 3MR2A 1S9EB 3G6YA 1YVFA 2WZ1A 3PJWA 2MZJA 5LT5A 2BE2A 5A8WB 1JB0C 4OZ1A 5LJ3Y 2GIQA 1IJFB 2UVUA 1IWGA 1WC3A 1S0OA 5I3UB 4EZ9A 1JJHA 1DARA 1F5AA 3R5DA 1JLCB 2ZEJA 1KQGB 1TL3A 5DDPC 1VRTB 1O8BA 4DV7J 2DHGA 2RS2A 2V68A 4B17A 1OJ4A 4KO0A 3IR7B 1Y11A 4QR1A 4ZITA 3ILOA 3FSIA 3BYPA 4DR5J 2YNGB 3TAQA 3ADAC 3UN2A 2W9BA 4OQJA 4MFBA 2HGNA 2QMXA 4NEYA 2V8PA 3FSXA 3M8PA 5KG3A 4EI2A 1Q4RA 2K1RB 1KTQA 4OYBA 4NPOA 2UVRA 4QWDA 1LWEA 1YITS 2E9ZA 4ETZA 4B3OA 4NLTA 4XPEA 1TAUA 1WF0A 3JAMY 1FWKA 3D3BJ 4NMLA 5I42B 4B9LA 3C16B 2W01A 2YNHA 2XM3A 3OSNA 4ED1A 4UY85 5KG2A 3BO4A 3IGNA 3HD2A 3MTKA 2N3OA 4AXIA 3M30A 5CD4A 4DR5F 3V6JA 4HKQA 1B64A 1MLAA 2W2PP 1CJTA 2FLPA 2VB6A 1ELOA 1P9YA 3OD2A 3Q89A 2UUWA 4LQ9A 4WK1A 4YP3A 3H5XA 4CT8A 1KFSA 4RNFA 3QPIA 2MQPA 2I9SA 4BC7A 5L1KA 1Q5YA 3QO9B 1SJ4P 1X4CA 1KQKA 3UN5A 3AHPA 3G6ES 2FZKB 4DG1B 3MAQA 1IVZA 4NX9A 3W1YC 1YLXA 3DU6A 5B0FA 5GMDA 3B6BA 2AGOA 2UUBJ 2AX0A 3UE2A 4HH0A 3P96A 4L75A 4EO6A 1LXNA 5LMNJ 4LF2A 4E0DA 2CUYA 3QRQA 1RT6B 4B9VA 3KLEB 4K4TA 5KFJA 2OGUA 3QT5A 5ETQA 1M5SA 2JC1A 3F41A 1T9TA 3R7BB 4YEAA 1NB2A 3C6TA 1MU2A 4X4UA 3LP1B 1HI1A 2V0NA 5D4LA 2HQGA 1ULRA 1NNDA 1LXJA 4DFPA 4U7UD 1LWFB 2RSQA 4ECXA 2FLNA 1R7IA 1KHWA 2EFPA 2RUSA 1KEKA 3LTOA 4YHHJ 2VFRA 3PV8A 4I67A 4NZ6A 2HHPA 3HFKA 3LP0A 2Z8QA 3NGKA 1NZ8A 3A3PB 4OLPA 1U1PA 3M2RB 4DPWA 2L9NA 3HZGA 2KN4A 2WW8A 4LF8F 2M3DA 2GJIA 2FJEB 1SUQB 1Q8BA 1R31A 5KFFA 4KBIA 4ZIWA 5L8RC 2YWKA 4IR1A 1AFJA 1XEZA 3LOUA 2EK1A 1T3NA 2UUAF 1T94A 4JBCA 2EFGA 2RUGA 2DKOB 5J1EA 3EZ5A 4IR9A 3JSRA 4TVAB 4V19J 1OYDA 2FC9A 2Y1LB 3K8WA 2RQ4A 4DL5A 4JV5J 3GYNA 2LQ5A 1GEHA 2YNFB 2BRLA 5HMWA 4U67Q 5KFNA 5DLFA 1U45A 3CULA 4JYAF 2KXNB 1NBEB 4Y6IA 4H4OA 1DQAA 4U8VA 2EPIA 1Y5IB 1P1LA 1NXIA 3TWZA 3K89A 4CNYA 5IV3A 3MUVP 3CCJS 5C5JA 2FJVA 3QRRA 1C0UB 3HHDA 4LSNB 1RADB 2M88A 2VFVA 3CDEA 2FDNA 3LPYA 2MEWA 3IRXA 3OR1B 4L72B 4RL1A 4WU3A 2W8LA 2AU0A 2DO4A 3H4DA 4LSLA 1UPPA 2QL7B 3RTVA 2AW0A 1S9GB 2LKZA 5FLXY 1W26A 2MQ8A 2K2PA 2IBOA 3MMAB 1YRXA 2OPQB 4OYMA 1FRLA 1CSJA 3UFCX 4DX6A 2DGOA 1VQMS 3JXOA 2Q6CA 1CS4B 1ITPA 2OSQA 1JLFB 2OPSA 2DHAA 4CNZA 1NRKA 4TLQA 2XY6A 2VPXB 5DM7Q 1S12A 4J9VA 2IC3B 4M8LA 5G0RA 3LH2S 1SB6A 3EDRB 2ZM6J 3R5AA 3W60A 1E6VB 2ZH6A 3SDEA 1DLOA 1HNIB 4DX7A 5J2NB 4AXJA 3ZNJ1 1S97A 1K44A 1TV6B 2IHR1 4EU0A 3GQCA 2UV8A 2NXUA 3FNNA 3KDNA 1RHJB 1LV5A 2F1FA 3KLHB 7FDRA 1TL1A 3CSKA 1VQKS 2OTJS 4ATNA 1YIJS 3M8SA 1RYSA 2DNNA 5G4DA 2NLWA 1NDPA 1KS2A 3A8EA 3SQGB 2BANB 4DV4F 2FJWA 1HWLA 2A18A 3G87A 3HFVA 4LR7A 1VYAA 3HI9A 1C2PA 3H59A 3P45B 1I94F 3NNHA 1BD6A 1S49A 2WONA 4YB7A 3LGMA 3KG4A 2VZ9A 4K8RA 2ILYA 3UD4P 2EW9A 4K4SA 1BLUA 3GG1A 4ZVSB 1HNVB 2FZGB 4J9SA 2KTQA 4C6AA 4M94A 2L3MA 2IAJA 4TY8A 3S01A 1ZTTA 4LJMA 2JHEA 3UVJB 5JJBA 4ZS6A 3R5CA 1G3OA 2O5DA 4KV8A 2CAJA 1PG5B 3MMJA 4NLXA 1RAGB 1KLMB 1FJGJ 3GSIA 4KR0B 3GV7B 2YQ0A 2D3ZA 3X1LB 4NI2B 2F4VF 1YI2S 3RAXA 2R7XA 3QIPA 4UOHA 2ACMA 1FKOB 2I5JB 4QJVA 5KFDA 1C1CA 2PT0A 1RACB 3DYAB 1IBKF 4G3IA 4DPYA 1IKYA 2UXCF 3BM7A 2JSXA 1KONA 1FDAA 2PA3A 2QA1A 2MQNA 3B82A 3PEJA 4OHWA 5AE2A 5HQ8A 3KHRA 2XMJA 2HHUA 4MMOA 3DMJB 1U1MA 6FDRA 1KN6A 1RHRB 3B4DA 1JXVA 1YDLA 3RW7A 2C1EB 3T5JA 5HVFA 1R8CA 2DXEA 4PR6A 2BQRA 2HNZA 2IBKA 1WC6A 3CCRS 1GH8A 4YB1P 4DUTA 4XDCA 4DL6A 2AYMA 3N79A 1N5YB 4LUBA 4B9SA 3FEXB 2AJ2A 4C11B 3IC1A 1WI6A 3THTA 3D0IE 3U1MA 3ZZPA 3DXSX 4RW4B 5AXMA 1GAOA 2XQCA 4JI1J 1U6ZA 1S6QB 3DLEB 2X1BA 5KT7A 1RBAA 3D6TB 5HP1A 1RT2B 4A46A 2LVWA 4I6YA 4NLOA 3KMSA 2DNGA 1YJ9S 4JI3J 1F5BA 1MROA 3QGIA 5HI7A 2RT3A 1PGZA 3CC4S 2CJBA 3BGOP 3ILIA 2XMWA 2DT9A 5F41A 2MZQA 1SVDA 2VG6A 3QGPA 4RZRA 1L3TA 4IDKB 3JYTA 2VQEF 1FDNA 3Q83A 2RS8A 3CJ0A 4BS2A 1PBUA 1XIQA 3HHKA 4CO1A 3VWSA 3N28A 4NCGB 3SEOA 3DU5A 4O0NA 4LRAA 3VALA 1WDDA 1S6PA 1X5OA 1VLYA 2OD6A 3D3CJ 4PRFA 3FMBA 2Z30B 2A10A 4ECYA 2UUAJ 4LF5J 1TKZB 3BGLA 1X5PA 1U02A 2YKQA 3WBZA 3HHLD 1RTIA 2IVMA 1CULB 1NM2A 4J37A 4P10A 2XS7A 3GYGA 2AEJA 3HHLB 1ZOTA 4Y3CA 4Z37A 4DV5J 3PW5A 2CPHA 3J7ZT 1Q53A 1RA7A 5CCMA 3ILLA 4K2XA 5KG6A 4QYRA 1EKRA 2D3UA 5CYQB 4C4WA 3M8ZA 1U26A 3CDBA 3GSDA 4UOGA 3OVSA 1HBUB 2NSCA 2CPJA 4DSFA 2K06A 4RBVA 5AT1B 3ETOA 3POTB 3R9LA 2QO3A 3BH7B 2MKJA 5FD1A 2OSRA 2MZSA 5K14B 2EFNA 4RBTA 2UU9J 1KRPA 3CD7A 3K17A 2V4JB 4PUOB 1BE4A 1LWXA 3L95X 3UCZP 2AJFE 2NXEA 4Q2LA 4F02A 5KFHA 5CABA 3S7RA 5J2QA 1X4GA 1VRUA 4OZ5A 4JI0F 4X4SA 1Q81T 2QLFB 4PG4A 2B5JA 2DH8A 1F9HA 2E44A 3LUYA 4I2QB 3Q0AA 3TARA 1HQUB 1FTCA 1ZPVA 5BYSA 5LMNF 3ZO7A 1RB0A 1JXEA 4IG3A 3J7A1 4J9KA 3MEDA 4B3SF 3BPDA 1NPKA 3DRPA 4EMDA 4U6PA 3MCNA 1QM9A 3D6MB 2FLOA 1WHWA 2B6AB 3OTEA 2XTJP 5T41A 3MM6A 3FBBA 4ZCMA 3KHLA 5L1JA 3KKFA 5AE1A 1D9FA 3FFIB 1WEZA 2A2CA 4C98A 4CYUB 4ZLPA 3GV8B 4K5RA 3LGHA 4ICLB 5LSRA 3TA0A 3MUMP 3R2CJ 2HGMA 2A3JA 1HWIA 1R8AA 2XGQA 1HWKA 1T9VA 4W92B 1CJUB 4GMKA 2HHHJ 3KLFB 2LQ8A 2VBWA 2IJFA 2HHHF 5C24A 5I3PA 5L9XA 4BWMA 2BEFA 3TX8A 4M5DB 4TKTA 4R0EA 5KFCA 2IDLA 3PVXA 1HPZB 4CLSA 4F50A 4EZ6A 1T8EA 3AQOA 1REVB 2KT5A 3CJSA 4LF6J 2V2KA 3CO9A 1S0VA 3I5AA 2ZH3A 2CQ0A 1H6KX 2VF3A 2E7WA 1N88A 3N01A 3VAMA 1HI8A 3D6HB 2BW7A 2F7VA 2YNIB 3PKMA 3M4XA 2EBGA 2M0GB 4U8YA 4RW6B 4ZPCA 5A8RB 3Q22A 1K73T 1EKSA 2HBRB 3RBZA 4NA2A 1YHQS 5AE3A 4RW9B 3W8GA 4C3MA 3PJXA 2HBYB 3WDOA 4DF8A 4ECTA 1WOPA 3LP2B 3RU0A 1G1XA 5HLFA 3ELHA 2JZ5A 3MGJA 3NG8A 2MZTA 4PQUA 1WTFA 2Q6BA 4USTA 5KG1A 4F4XA 1H2UX 2YKOA 4AT1B 2MKCA 1ROFA 3AD7C 3HSDA 4G6VB 1Q8KA 2G0IA 4OJ1A 3HULA 2VG5B 4F8RA 4TN2A 4PXBA 3PY8A 3V6HA 1ZH5A 3M2UB 4DCJB 1DAXA 1UA0A 1WUUA 4R0JA 4RX6A 4X84A 4ZJQA 1X4HA 2GQ2A 3D4JA 3V6DB 1VCTA 3F56A 4EO8A 4NXMJ 3RB4A 3R8YA 5KFAA 2E1MC 3RG6A 2J0QD 4KYZA 2RHQB 4ZCLA 5I3QA 3W2VB 2RF2B 1JQGA 4C0BA 5D6GA 1FEEA 3K59A 1BHNA 1HBNB 1X0PA 3WIUA 4LF7F 2NYIA 4USKA 3P5BP 1WKKA 4CP5A 3EYZA 1C0TB 2HBZB 3GZ7A 1GNKA 4DPUA 5BR8F 4A8SA 2IJRA 3TUIC 3ILJA 2OPRA 2G4BA 1DRZA 1DFDA 1RT3B 2PN6A 3T1YF 2WHOA 1WELA 4P7VA 2VKRA 2MKHA 3DRXA 4O4RA 2BW2A 1D8ZA 1UPMB 3S1TA 2Y0SD 2HFVA 3AJ1A 1M1GA 1U7LA 2L9DA 3FSYA 4IQMA 1T3OA 3I6PA 4X66J 3CPWR 1QSYA 3DLHA 1TL7B 4M95A 4Q8FA 4IOBA 3C19A 2G0CA 2ZUGA 3IWLA 5IT4A 1T95A 4DSKA 3CD6S 3PHTA 2HZAA 2MZ1A 2V34A 4WZMA 1XWLA 2ROEA 4DS5A 3UI3A 2KXFA 2I8EA 3NP5A 1N52B 2CQDA 2ZDPA 4IUFA 4Q0BA 5FJ4A 3C3LA 3F44A 5HANA 3IG1B 4ZPTR 1Z4UA 3ZZRA 1UKUA 2V2ZA 3AJ2A 3GTYX 3H5UA 3I4HX 2CJQA 4GO7X 4OX6A 5E3QA 4YN3B 2G0JA 4LRBA 1NKEA 1FXRA 2CZVC 3IA0A 4O4GB 3EPIA 2Y9HA 3AH6A 2J9DA 2ZC3A 3NRBA 4N47A 1HD1A 3DOMA 2G13A 1QAXA 3BKFA 2K1RA 3NL0A 4Q44A 1VS3A 3U02A 2HK2A 2NUUG 3M8QB 1HBMA 3PEHA 2HAIA 3I55S 1X9WA 4U7UK 4NASA 1N54B 2PDAA 2AJ1A 3CEDA 2UZAA 3MM9B 1R8PA 1Z2LA 1RAFB 3IMQJ 1RQ0A 2RE1A 2V5HG 4KHMA 3DRYA 1NH7A 2K7JA 2RRBA 4Y2IA 3N6LA 4ZVGA 3LW5C 3Q8VA 1YJUA 4KFBB 1TUWA 1WC5A 3OLBA 3OFEA 3CMES 3EGWB 2AYBA 1YK9A 4WFXA 1X4DA 1LK5A 4KH0B 3MCSA 4FVMA 1GMWA 1T05B 4HI2A 2M52A 1B0VA 3QGGA 4DUZF 3KMQA 3Q2TC 4PG8A 3E51A 4X66F 2MXYA 2EC0A 4HT7A 3TYTA 3BV8A 3NKYA 2ZJQQ 5HROA 1R8BA 4OX9J 3PW7A 4LRFA 1X4AA 4F67A 3K0JA 1RHQB 3FBCA 3T5HA 1A9NB 3D66A 1Q78A 4YR3A 4YOEA 4DI6A 4ZP9A 3LF0A 3G8QA 1C1BB 5DDQC 2R2SA 4X64J 1TU0B 4YQWA 3IN5A 4WFBQ 4O0IA 2DPIA 1ICEB 1RAAB 2JEIA 1RAEB 2CNNB 3AFGA 1CEZA 1V5VA 4NXMF 2ZNYA 2I1RA 1RT7B 1G6BA 4ID5B 4OHXA 3AAWB 2XSJB 1UFLA 4ZLNA 2ZH1A 4FZVA 4DUYJ 2G1DA 4UF4A 2XI3A 1FO1A 1FX2A 1CC8A 3H20A 4QIGA 3PR5B 3HXMA 4MIWA 2MB0B 2N7YA 4RUAA 4JI3F 1U0HB 4UW2A 3CCLS 1HNWF 1VFJA 4I56A 1FJGF 5DG8A 1W2IA 5GAGU 2OH2A 2ERRA 2PIIA 1MMNA 4RW7A 4LF6F 2C2RA 3FMWA 3GFXA 3OL9A 2IYGA 5HQLA 4OHYA 4DV4J 1EETB 1T02A 3EX7B 4JI4F 5A8WA 1JJCB 2OELA 4LBHA 1WHXA 4OL8A 5EWEA 2YNFA 3KLIB 2P2CB 1M5KC 5KFXA 4DR2F 4K50A 2DIVA 4CDIA 1IBCB 2CVEA 2JJ4D 3JSYA 1NLKL 2JFDA 3FEYB 3NGSA 5EHHA 5KFOA 4RKUC 4IO9Q 2CWKA 3R97A 4DQQA 4LQ3A 1KKHA 1RE1B 2ZZNA 3HHNB 2IPOB 3T1HJ 5DGAA 3OT9A 5KOWA 1UFKA 2Y1IA 3BBCA 4NYZA 4CLZA 1YWXA 1ZAWA 4RNMA 4DPXA 2DGTA 2BQ3A 1YGYA 4KGKA 3VZIA 3NGUA 1ZM4A 2LEBA 4B3OB 1K0VA 3AQPA 2ATCB 3BQ1A 3EUNA 3UDLA 3MM8A 2CQBA 2VBZA 1C4CA 4CO3A 4IG0A 2LQBA 1WKLA 3AXKA 3Q8UA 2YQ1A 2BJ1A 2LP4A 2NS1B 1ZAVA 4ITSA 1QLNA 2R7UA 1HQEA 3O8WA 1YSJA 2W9CA 4DLEA 2DRDA 1TKTB 1VR6A 5B0AA 4Y34A 1CJTB 3QSIA 1RT1A 1OQ6A 3SSSA 1DLOB 2OEMA 1TFWA 1VIOA 1RJJA 3BGRB 3FUYA 2CFXA 1SV5A 2BACA 2LU2A 3TVYA 1PC5A 3MMBA 3FZBA 1DHMA 5E3AA 1PCAA 5KFRA 1UVKA 1JLAB 1VOMA 3W2WB 4NA1A 1T11A 2B4OA 2EVZA 3GJTB 5F8HA 4F4ZA 2MYFA 1S0NA 2GMHA 1K0TA 2ZOGA 1V6HA 1Y7PA 1GXTA 1OWXA 1Q95G 2ZC4A 1Y0HA 2YTCA 2LFVA 3HLUA 3NS6A 4JI2F 5KG7A 2BANA 2O01C 2RQCA 1D8YA 1FRMA 4ZJOA 1Z1ZA 5IXUA 4GKJF 2DNKA 5K8NA 4G65A 4CZCA 5F9NA 4RR5A 2BE2B 1H7WA 2XLKA 3KK3B 2AJQA 1F1BB 4YUDA 4QWAA 3AB4B 4OZJA 1PAEX 2HZCA 2BJ8A 4QBUA 4FXDA 3B54A 2QSWA 1JXLA 4UT4A 3HSGA 2MQLA 2YY3A 3JTOA 4ZVHA 4LFCF 4DR7F 2HVDA 2CJYB 2OEKA 5KFKA 2X1FA 2ASJA 1JLCA 4I2PB 3L4BC 3CC7S 1F0XA 1ZBTA 3Q24A 3KNGA 4I6AA 1VRTA 5KFUA 2VHGA 2IMWP 1Y5NB 1S77D 2F5GA 4C8YA 4F36A 3GFZA 1XNQF 4LBPA 1QSSA 2AJ4A 3OHAA 1JLGA 2DNMA 1DJ0A 3M8PB 1CJVB 4N77A 3SIPB 2P6SA 4BDPA 3N5FA 3IO1A 3PCOB 1SCJB 3JSBA 4OV1A 4K4ZA 2HBQB 1EIYB 1HNZJ 2YWEA 2RDIA 4W98A 3C16A 1NH8A 1TZ0A 4YDDB 1JX4A 5L39A 3H40A 5M2RA 2CQ1A 2B9WA 3QLHA 2V50A 4M5KA 2VJUA 2EG1A 2GIRA 1YRTA 4HLBA 3M2VA 1VLOA 4OYIA 1PYSB 3KJVB 2W7PA 3DMJA 4DQIA 1XNRF 2MKYA 4KJIA 2KFYA 4LR8A 3QNWB 2AGPA 2DY1A 1VQLS 2J0XA 3KJFB 1FRJA 1N36J 2XO6A 3PX6A 3OTCA 2JVOA 4GVBB 3T6BA 2BKOA 3DRSB 3H2VE 1JKHA 1C0UA 1RWVB 5ETOA 4ED8A 2NZ4A 2QLJB 2EFVA 2V8GA 3O1LA 4OYWA 4ILMA 4PQAA 2KT2A 3RB0A 1PYOB 2QC3A 2ATLA 1FJEB 3HD1A 5HO4A 3RW6A 3B8HA 4OZ2A 3CIMA 1UWBB 4LF9J 3KLEA 2QT7A 4QIWD 4BLGA 4DLGA 2BM1A 2VFTA 2ABYA 3D0HE 3R5GA 4ECQA 1QAIA 5F3ZA 4LMZA 4GVLA 1YBTA 1CS4A 3AT1B 1UJ6A 2VC0A 2UP1A 4DF4A 1I5OB 1U2FA 3I82A 1N8RT 5G0RB 2E7XA 4Q7AA 4PWUA 3KLGB 3NBPB 2LEAA 2R42A 2WB1D 4FPIA 4MYUA 2VUGA 9RUBA 2C22A 4LF7J 2NXNA 2QMUB 2WAQD 2XB2D 1YJTA 3VGSA 5GAEU 2APOA 4OZNA 4ZVFA 2IFXA 3SCLE 5CH7B 1RHKB 4DSIA 4PG7A 1RWPB 1BY9A 1S6PB 3DLBA 2JWNA 1TL1B 4KAIA 2R7OA 4GRSA 3IAS9 4ENOA 2E5JA 4P75A 5JVHQ 2BV3A 1TKZA 1NK5A 2AJ0A 3FZ2A 3V81A 1AZSB 4YB5A 1CULA 3HDSA 2BOPA 1RTJB 2VBXA 1CJKB 3L3CA 3D1OA 3MEKA 4GKJJ 3EGVA 3ONQA 3DFEA 2LA4A 3A3OB 2XS2A 1GXUA 3H2LA 4H4OB 1YKWA 1N5SA 5HJXA 4PXCA 3KTQA 4PWWA 4KPCA 4ZVOB 1V5IB 2W25A 4PYDA 2QJ3A 1VQOS 1TL3B 4I1TA 3POTA 1PSDA 3L7UA 4FF2A 5J2MB 3FJ2A 3CCQS 1N6QB 1M5OC 4RO0A 3CGIA 3GILA 2YNGA 1XMOF 5A6WA 1T9YA 2E5IA 1SIZA 2GW8A 4HI1A 5GAGI 5J2QB 1X9SA 2VQFJ 4KHPF 1J2VA 5LSOA 5CHCB 2ZM6F 4UQTA 1QE1B 2LECA 1LWEB 4K59A 2E29A 4I2QA 4B02A 2BJ7A 2QZ8A 1WKJA 3EVWA 3W9HA 1FCAA 3N0VA 4LF1A 5I42A 2QEXS 2HWHA 3BR9A 4H4KC 3M05A 4IG3B 2ZVSA 3BKTA 3DN9A 4M5JA 4NLVA 4RW8A 1WG5A 2HNYB 2CQCA 1MN9A 3W7BA 4ZPDA 2OP5A 3CDAA 4C0HA 3NGDA 4F3MA 4ZPAA 3I9ZA 1FKPB 1RKIA 4HTJA 1RWWB 4USUA 2OHDA 2A1BA 5FDLA 4ES3A 4WFNQ 5AJ3F 1Y3KA 2B6AA 1B4SA 3K5NA 1OIAA 1HKAA 2C3OA 4N56A 4UTGA 1RWOB 3QZ7A 1U48A 1HNXJ 1NHVA 2HAFA 1SQGA 4NRUA 4Z2XA 5A2QU 2QLXA 4WFYA 1NSQA 2CPIA 2QYGA 4D3GA 3A1YG 2JC0A 2KRRA 3MZIA 4DWIA 2ZZMA 2QV6A 4A8FA 2XS5A 3H25A 2QLWA 4WF9Q 3HJFA 3SQGA 4ICLA 4ZN1A 3KHGA 3K5LA 3G96A 2UXBF 3CW2C 4O3NA 2KZZA 3O2IA 4P52A 2G2ZA 5FIIA 4RW4A 3ISNC 4P9SA 3H0PA 4WXWA 2XWXA 2I6WA 3VR1A 5DLGA 3GG0A 2AV5A 3S8SA 4ZCKA 3P6YC 5EWGA 3GIIA 3OTOJ 3L09A 4J9MA 3AOCA 3GFYA 2KI2A 2K7KA 3S6EA 2JRSA 3TA2A 4C0OC 3HP6A 5HN0A 5HMYA 3MEGA 1RU2A 4USIA 5LMUJ 1VIXA 3PYEA 1H73A 1UFWA 4PYAA 3JTPA 3GWCA 2GHVC 5JUMA 3OBIA 5HAOA 2D1CA 5K8OA 1GXLA 3Q8SB 4K4YA 1IKVA 2UUBF 1S6OA 4WU2A 1RT5B 2W2NP 1JJ2R 2F9DA 2D9PA 2YWFA 3SYZA 1QTMA 2NQPA 3VHQA 4RW6A 5A8RA 3A13A 1N32F 3U27A 1ZTWA 2Z0GA 1FKOA 3BQ0A 1X0FA 5C7PA 4EGLA 3CJ2A 3I9V9 2J5AA 4HACA 4X62J 4DU7A 4X64F 1TTHB 2KU7A 4V1Ak 8RUCA 1Y4ZB 1S7IA 2ZD1A 1OSDA 2DNQA 2E1AA 2E5HA 5H9FJ 3OL8A 1S7HA 4N76A 2CRLA 2J9DE 2C3YA 4HDHA 3KK2B 2HHTA 4RJVA 4R8UB 2GC8A 4FYVB 2FPHX 3JB9k 1OYEA 3D68A 4LF5F 1WEXA 2HNZB 5L38A 2GNKA 2UU9F 2HRUA 3M8RA 4ZPBA 1QSLA 2POKA 2KJWA 4GO5X 1J5OA 2QL5B 1Q0NA 4ANDA 3UN3A 3OR1A 1FK9B 2RH3A 2NXJA 4Q2MA 3GCXP 2Y0BB 4FYWB 1FI4A 4RBUA 1APSA 1GFWB 5JMNA 1HBNA 1NDKA 3WZ0A 2OUGA 4LR9A 2PI5A 4OZ3A 1FNMA 3DI6A 1S1WB 3BGUA 3MPUB 1IN0A 3LWMA 2HURA 3MEEA 2ZHBA 5A6PA 1RT2A 2VQFF 2CYYA 2W1BA 1I6JA 1JWWA 2FVQA 1X4EA 4DV2J 1DBDA 3HHLC 5AXKA 3R5BA 2H65B 2P9CA 2HFOA 1SH3A 1X4FA 3QGHA 2R7WA 4B9NA 4DUYF 2CWXA 1RWNB 1RK8A 2VU5A 4IDKA 4LVOP 2V67A 4KY3A 1HNIA 3VZHA 3JYTB 2DRBA 4DPTA 2KL8A 4DU8A 2C2NA 1RCOB 5EWFA 3DRRA 1TK5A 3J80Y 3C2PA 1D9AA 3RGIA 3PZPA 3PW2A 5B0EA 3SMZA 1EHWA 2DISA 5IQQA 5T7LA 3KLHA 4U7CA 4ELVA 4OJ3A 4TNOA 3GCWP 2E5LJ 4W90B 1R6YA 2BE9B 3E2EA 4JI8J 1IBLF 4UUWA 2DIUA 2CADA 2NUHA 4BCAA 3MR6A 2QA4G 1S0MA 2HW3A 3TP2A 1SXLA 5KFSA 5B09A 4Y0FA 4DV6F 4B9TA 2BYCA 3FRZA 2U1AA 3OSPA 4K0KJ 3MM5B 2R8HA 3MPDA 2HQFA 4QWEA 1N34J 5CCLA 5KT6A 3HSJA 2AZ1A 1TKDA 4LVNP 4M5GA 1PAUB 2DB1A 2DVIA 1MN7A 4DV7F 2IAJB 3W63A 3ZZ0A 1MW7A 5H9EK 3NAHA 2J76E 2OKQA 1BC6A 1XERA 4ECZA 5F8JA 1MMLA 4ALZA 1KLMA 1UAWA 1T05A 2OFHX 3MD1A 3CJ8A 4IH5A 5H9EJ 2QTWA 1VRUB 1TK0A 3QBCA 2DEJA 4NI2A 3ENVA 4Z7CA 1QD1A 4IH7A 3D54A 5ETRA 2ZH2A 2EFQA 2B3TB 4AFFA 1SC6A 2I5JA 3BS9A 5KAKA 4J9LA 3BDPA 3R1HA 1IKYB 3SXLA 4WKRA 3KUEA 2GFFA 2B51A 3TA1A 3Q86A 4CIOA 2DRAA 3F0NA 2OEJA 4FBTA 4ZVRB 4ZVQB 3RB6A 1Q7YT 4NXNJ 4X62F 3EWGA 2VPYB 1HA1A 3Q2SC 2R7QA 5E3RA 1Y5LB 4EBCA 4B9UA 1U2RA
chains in the Genus database with same CATH topology
4YHHJ 4DUYJ 2KVQE 4NEZA 4LF9J 4JI1J 4X62J 3J81U 4DV1J 1XNRJ 4JYAJ 4LFCJ 4V1Ak 4DV4J 4JI3J 4YY3J 4KHPJ 4JV5J 4LF8J 4JI5J 4RJVA 4GKKJ 5BR8J 4DV3J 4B3RJ 2UXBJ 4DV6J 4LF7J 4NXMJ 4DUZJ 4DR7J 1N32J 4KYZA 3T1HJ 4JI4J 2MEWA 3D3CJ 4LFAJ 2UUAJ 2UXDJ 2UXCJ 4LF5J 5AJ3J 1N33J 2MQ8A 4X65J 3T1YJ 5LM7E 4JI0J 4DV5J 4B3SJ 2F4VJ 4DR1J 4DR6J 4DV2J 4X66J 1I94J 4GKJJ 1J5EJ 2ZM6J 4KY3A 4PWWA 2KL8A 2UU9J 3R2DJ 2VQEJ 4DV7J 1XNQJ 5IT9U 4AQYJ 4LFBJ 4DR5J 2E5LJ 4JI8J 5FLXU 2VQFJ 4DV0J 4HHUA 4NEYA 2MTLA 4DR2J 3D3BJ 4K0KJ 1HNWJ 1N34J 4LF4J 1HR0J 1IBKJ 3IMQJ 1XMQJ 4DR3J 2UUCJ 4JI7J 1HNXJ 1IBLJ 5A2QU 1IBMJ 5IWAJ 1FJGJ 3W1YC 2UUBJ 4OX9J 3R2CJ 5LMNJ 3JAMU 2HHHJ 4JI2J 3J80U 1HNZJ 4JI6J 4DR4J 1XMOJ 4B3TJ 3OTOJ 4X64J 4NXNJ 4B3MJ 4LF6J 5LMUJ 3J7AN 1N36J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH J;  4DUY J;  2KVQ E;  4NEZ A;  4LF9 J;  4JI1 J;  4X62 J;  3J81 U;  4DV1 J;  1XNR J;  4JYA J;  4LFC J;  4V1A k;  4DV4 J;  4JI3 J;  4YY3 J;  4KHP J;  4JV5 J;  4LF8 J;  4JI5 J;  4RJV A;  4GKK J;  5BR8 J;  4DV3 J;  4B3R J;  2UXB J;  4DV6 J;  4LF7 J;  4NXM J;  4DUZ J;  4DR7 J;  1N32 J;  4KYZ A;  3T1H J;  4JI4 J;  2MEW A;  3D3C J;  4LFA J;  2UUA J;  2UXD J;  2UXC J;  4LF5 J;  5AJ3 J;  1N33 J;  2MQ8 A;  4X65 J;  3T1Y J;  5LM7 E;  4JI0 J;  4DV5 J;  4B3S J;  2F4V J;  4DR1 J;  4DR6 J;  4DV2 J;  4X66 J;  1I94 J;  4GKJ J;  1J5E J;  2ZM6 J;  4KY3 A;  4PWW A;  2KL8 A;  2UU9 J;  3R2D J;  2VQE J;  4DV7 J;  1XNQ J;  5IT9 U;  4AQY J;  4LFB J;  4DR5 J;  2E5L J;  4JI8 J;  5FLX U;  2VQF J;  4DV0 J;  4HHU A;  4NEY A;  2MTL A;  4DR2 J;  3D3B J;  4K0K J;  1HNW J;  1N34 J;  4LF4 J;  1HR0 J;  1IBK J;  3IMQ J;  1XMQ J;  4DR3 J;  2UUC J;  4JI7 J;  1HNX J;  1IBL J;  5A2Q U;  1IBM J;  5IWA J;  1FJG J;  3W1Y C;  2UUB J;  4OX9 J;  3R2C J;  5LMN J;  3JAM U;  2HHH J;  4JI2 J;  3J80 U;  1HNZ J;  4JI6 J;  4DR4 J;  1XMO J;  4B3T J;  3OTO J;  4X64 J;  4NXN J;  4B3M J;  4LF6 J;  5LMU J;  3J7A N;  1N36 J; 
#chains in the Genus database with same CATH topology
 1N0U A;  2MY7 A;  2ZKT A;  2XUL A;  2FQQ B;  3R7N B;  2XSJ A;  4DV3 F;  1H38 A;  3BSN A;  1N33 F;  3W9J A;  2B4P A;  4LT6 A;  4WK3 A;  2XNR A;  5THW A;  1UW4 A;  2HLU A;  1IJE B;  3HVA A;  2JLE A;  1CJU A;  1B99 A;  3FCV A;  3SQO P;  1SH0 A;  3I32 A;  5F3T A;  4DL2 A;  4KHP J;  1K1Q A;  2BKP A;  1XMQ F;  1FNO A;  4WTY A;  5KFP A;  4YR2 A;  3N9U C;  3VTI A;  4FBU A;  1CC7 A;  1SQE A;  3O6Q A;  2A2D A;  2FHM A;  3CDU A;  1RAO A;  2J6S A;  2BKN A;  3DOK B;  4NWB A;  4GKK J;  4OYZ A;  3V2U C;  1MWY A;  1RAH B;  3C6U B;  1FER A;  2IA0 A;  4RU9 A;  3TAN A;  2JH3 A;  1N4L A;  3BZQ A;  4DV6 J;  3OXL A;  2VAS A;  2MPU A;  2WB4 A;  2IVF B;  3SCJ E;  1AA1 B;  3EMT A;  1YZ6 A;  2DR6 A;  3DNC A;  3UDE A;  4Q5V A;  4YS2 A;  3ZTR A;  2YX4 A;  3UD3 P;  1ZM2 A;  1VBY A;  5KFB A;  3SV4 A;  2GJF A;  4LFA J;  4FVC A;  2B9X A;  2KHD A;  3HHE A;  4YME A;  3NMR A;  2KFZ A;  3LAM A;  3KJN B;  3GYX B;  4CM0 A;  1LW0 A;  2CQP A;  1VI7 A;  2CQG A;  4XO0 A;  3GV5 B;  1KLN A;  4X65 F;  1KFD A;  2DJW A;  3SFU A;  2KKH A;  4UOF A;  2LMI A;  5A8K B;  1NSA A;  4ZP7 A;  4JV5 F;  1QJH A;  1RI7 A;  4MTP A;  4B3S J;  2XZT B;  3RR7 A;  1GMW D;  4MT1 A;  3QYY A;  4JB8 B;  4O44 B;  3SBM A;  3DHW C;  2WRM A;  2VG5 A;  3MM9 A;  3HM9 A;  5BXI A;  4Q45 A;  3BR8 A;  2DNP A;  2D3O R;  5HMZ A;  4ECV A;  1HQE B;  5I4M A;  5F8M A;  1RYR A;  4FF3 A;  3H90 A;  3CCV S;  1YQH A;  3QZ8 A;  1HI0 P;  1T03 B;  4LRC A;  4CO4 A;  1HHT P;  2QX0 A;  1RWX B;  2EEY A;  3BGR A;  4N8N A;  4ZHR B;  7FD1 A;  3HT0 A;  1X60 A;  1BMQ B;  2VC1 A;  1FEH A;  3CB4 A;  3IBC B;  4DJB A;  2VDH A;  1WSV A;  1ZS6 A;  3HKW A;  3Q8R B;  1NHU A;  5MAO A;  4DV0 J;  3H42 A;  3A12 A;  1UZD A;  2FJB B;  1K9M T;  3ENW A;  1Q16 B;  3SI8 A;  1S48 A;  3UQS A;  5KFT A;  2AD9 A;  3KFW X;  1KP6 A;  3G6X A;  3TVZ A;  1H7X A;  1O5J A;  1MWZ A;  3DRP B;  1TL7 A;  2BJE A;  2P8I A;  3I5B A;  1HR0 J;  3BN7 A;  4RUC A;  4A8W A;  1XK8 A;  2YKP A;  3D67 A;  2ZVI A;  6AT1 B;  1HWU A;  4MK7 A;  5KFQ A;  3CTR A;  3PIP Q;  3G2X A;  5F0W A;  4Q43 A;  2DBB A;  2K8G A;  1FJ7 A;  3DDI A;  2IIH A;  4IKA A;  4F2R A;  3THV A;  3CMQ A;  3WQP A;  3IWN C;  3X3U A;  2HS4 A;  5KFL A;  1YJN S;  2FZC B;  3TAP A;  2NRE A;  1NK7 A;  1FVQ A;  2RRN A;  5GME A;  3EVM A;  2MQO A;  4DL3 A;  3VAH A;  1U0H A;  2NZC A;  1FFW B;  2ZBQ A;  3I96 A;  2Y1R I;  3NGR A;  4DV5 F;  3KJQ B;  3P4U B;  1XTZ A;  2M2B A;  4CI0 B;  3M8W A;  5J2P A;  2J7K A;  1HBM B;  1NCL A;  3AOA A;  1VBZ A;  3DDN A;  3BN4 A;  3EE3 A;  2VJV A;  4OZ0 A;  4WTO B;  3H5S A;  3QLH B;  2XG8 A;  4B3T J;  3PXG a;  2LA6 A;  1TFY A;  2P9E A;  1OQ3 A;  4PWD B;  3DLK B;  5KT5 A;  1GMU A;  2CKW A;  1HMV B;  1RP5 A;  2GJ2 A;  5ETM A;  3TAM A;  1XC9 A;  4M1K A;  5K8M A;  2YVS A;  4CTA B;  4ED4 A;  1ZM9 A;  3ZTS A;  1VQ4 S;  2E5L F;  4OHV A;  1WC4 A;  5KFG A;  2XLJ A;  5A0Y B;  3PO4 A;  1FD8 A;  2HKE A;  4IFV B;  2WVC A;  2MHN A;  3PX4 A;  3IR6 B;  4ZVU B;  2PE8 A;  2VOP A;  2FJX A;  5KFY A;  3M1V A;  3A4T A;  3ZXW A;  4N8O A;  2RAQ A;  3DM2 A;  3BQ2 A;  4FYD A;  3W62 A;  2KZM A;  1VRQ C;  1XNR J;  2ZFH A;  1SC4 B;  2B4V A;  3HO1 A;  2GVZ A;  3L9Z A;  2DHH A;  2Z58 B;  2FB0 A;  2DIT A;  3BF4 A;  3DKD A;  2B8P A;  2O67 A;  4NE9 C;  4G1I A;  5DO2 A;  3W3S A;  2Q43 A;  2RIL A;  3HCX A;  2BXJ A;  2V63 A;  3C15 B;  3CJT A;  4D3H A;  2HVH A;  1AW0 A;  4B3R J;  4DXL A;  1HYS A;  1RXO B;  1RBO B;  5L1I A;  2D69 A;  1RT1 B;  1RAJ A;  1NJX A;  3TJ8 A;  4C3L A;  5IQ6 A;  1WF1 A;  2P9G A;  1IKW A;  3VVU A;  2R8I A;  1SV5 B;  2RF2 A;  2QSF A;  1TP7 A;  4ECW A;  4H4M A;  2MY8 A;  1S1V A;  3PAC A;  5EX0 A;  1HQ2 A;  1K8A T;  1R0A B;  1D0E A;  3TJA A;  3KNA A;  4OI6 A;  5K5M A;  4QIF A;  4LBI A;  2UXC J;  3DOL A;  2QLB B;  3BB5 A;  3JTN A;  3T1Y J;  2CNO B;  1FFG B;  3V81 B;  2CG8 A;  2GMJ A;  5EUH A;  4JI8 F;  1WTB A;  2KB2 A;  3DLG B;  1X8D A;  4EFA C;  3SV3 A;  1H0H B;  1X9M A;  2PMH A;  1RTJ A;  1FRX A;  3TZW A;  1WJ9 A;  3UPF A;  1WSR A;  2AGQ A;  3NS5 A;  1NU4 A;  4AUK A;  1NK8 A;  5CXT A;  1P27 B;  1J5E J;  3R3T A;  1W7W A;  1MG7 A;  1UCN A;  4CO0 A;  5DG9 A;  2WVB A;  3H2U B;  3RRG A;  5A76 A;  4UY8 T;  2QA4 S;  2XO7 A;  2R9L A;  2AYE A;  4HHH A;  3IG1 A;  4KKO B;  4O3S A;  1XMB A;  1YG0 A;  1TKX A;  4LF4 F;  2X1G A;  2VOD A;  2WOM A;  2WK4 A;  3JQJ A;  2OLW A;  3P8B B;  3W65 A;  2ASL A;  3DOM B;  3GR1 A;  3FK4 A;  1V3S A;  1QE1 A;  3I0S A;  1X7V A;  3UCU P;  4IRC A;  2FJA B;  3UW1 A;  1IQT A;  2OML A;  4U96 A;  4IFY A;  3TO8 A;  2AKW B;  4IG0 B;  3IBF B;  4OJH A;  2DEI A;  1QDU B;  2K3K A;  5F8I A;  2IJN A;  4O3Q A;  4LF4 J;  3B4M A;  4Y65 A;  2MJU A;  2C42 A;  3H7H B;  2ZDO A;  3O3L A;  5F0U A;  3SCI E;  4OZL A;  3UD5 A;  4JV2 A;  4KGV B;  3LO3 A;  5D0E A;  2E5G A;  2W2Q P;  4R5P B;  4P2F A;  5HBM A;  3QT7 A;  1F6T A;  4NLD A;  1PYT A;  3VQT A;  1IBM J;  1OY6 A;  1S76 D;  2FC8 A;  2ZWP A;  4GVB A;  1R3N A;  3DRS A;  4A47 A;  1PJ5 A;  4NA3 A;  3T19 A;  3VF0 B;  5HRO B;  1UVN A;  3FQK A;  4RWW A;  3J7Y I;  1ZZF A;  1UET A;  2OJ3 A;  1LWC A;  5KT4 A;  1LW2 B;  3QJP A;  3TNV A;  1SKU B;  5IT0 A;  3EVO A;  4F04 B;  1KSP A;  2JL9 A;  3WX4 A;  3TUP A;  3ENA A;  2ZH8 A;  4FYX B;  2BZ2 A;  3A8I A;  2YX1 A;  3OFF A;  5D4O A;  1HL6 A;  1VC6 A;  1O6X A;  1PIL A;  4B3T F;  1H2T Z;  3QMQ A;  1BXN A;  4YB6 A;  1VDH A;  1OS5 A;  1DUR A;  3CE8 A;  5HVG A;  2YWG A;  4ZPV R;  2IMO A;  2W2M P;  2AEM A;  1ZM3 A;  2AIR B;  2FTR A;  2H5I B;  4I2P A;  4MKV A;  5E41 A;  1YTY A;  3KLG A;  1KNZ A;  2L08 A;  2DPJ A;  4RUH A;  2UUC F;  4F2S A;  2CPX A;  1TK8 A;  2KVQ E;  4DX5 A;  3P3D A;  4WBF A;  1FXL A;  3PJ9 A;  4C3K A;  5C2C A;  2V8H A;  1RT5 A;  1CBK A;  1EX8 A;  2ZBP A;  1U1Q A;  2BDP A;  4FS2 A;  2W9A A;  2JEG A;  4P72 A;  2AWZ A;  3UNG C;  1AXQ A;  1CJV A;  4WII A;  2XYH B;  3OXF A;  4CLP A;  4DMZ A;  2PO4 A;  1RUS A;  1BUX A;  1AB8 A;  1ZA1 B;  2YBV A;  3M32 B;  4NXN F;  2J7W A;  3T6J A;  2DNH A;  3PYF A;  3CMA S;  1EET A;  2HQ3 A;  2J8S A;  3ZZY A;  1RAB B;  2ZD1 B;  3CCM S;  2DCL A;  4MK8 A;  3PYD A;  3D28 A;  5IC6 B;  4GC6 A;  4JI5 J;  4LF8 J;  2Y8Y A;  2ZE2 B;  5C42 B;  3KK2 A;  5E3P A;  3BBF A;  2FJD B;  2PMZ D;  2CDQ A;  4YFU A;  2AQ4 A;  2HEK A;  5KT3 A;  3TEH B;  4EBE A;  1OPZ A;  3QSY B;  2HG4 A;  1M5V C;  4H4K A;  4DUZ J;  3IGV A;  2WVE A;  3NNA A;  4GKK F;  1J5O B;  4FYY B;  2R8K A;  2ZZT A;  4TY9 A;  1N6Q A;  3K58 A;  4O3O A;  1EAR A;  5L1L A;  2Q1L A;  3DGP A;  5J1N A;  2QYC A;  2LXF A;  4M5H A;  3EJM A;  4ZK7 M;  5GAD U;  5IC4 B;  2DNZ A;  3QT8 A;  5HL7 Q;  1KOH A;  2CJA A;  1PKU A;  2R7V A;  2JOQ A;  1KWM A;  3DI6 B;  4NZ0 A;  2F8E X;  4P6Q A;  1LNQ A;  4TU8 A;  3UCG A;  4UQG A;  2OPP B;  3AD8 C;  2HQI A;  4P2S A;  4JI0 J;  2HHS A;  4HL9 A;  4DR1 J;  4FP9 A;  2NCK L;  3PRV A;  2FY8 A;  2JFK A;  4G1Q A;  4RW8 B;  4E2F B;  3MM6 B;  2HNY A;  3T5L A;  3PFE A;  3NOC A;  4PEO A;  4LRD A;  4OJG A;  1TKT A;  3KG0 A;  1IR0 A;  1FRI A;  3NBP A;  4CLT A;  3DC2 A;  5K8P A;  5FDL B;  3TVK A;  2LQJ A;  3V4I B;  2VQE J;  1ZET A;  3G6V A;  2C2E A;  1NSK L;  1N5V A;  2KH9 A;  3JSM B;  1N0V C;  2J7U A;  3U1N A;  1JLA A;  5HK4 A;  4CLW A;  2RQM A;  4CLK A;  3PKY A;  1UA1 A;  2GZO A;  3EPG A;  4DDF A;  2H5E A;  1VQ6 S;  2PSZ A;  1EZZ B;  2GVD A;  2DNL A;  4L6V 3;  3OQ2 A;  5U47 A;  3OXG A;  4DCO B;  1U1R A;  2MTL A;  1SJQ A;  1AZS A;  3GJS B;  2C3M A;  5C25 A;  2FGC A;  1S57 A;  4WIQ A;  3MMC B;  2MGZ A;  5D78 A;  3KK3 A;  2ZOM A;  3D0G E;  2IM3 A;  2DXD A;  2AYG A;  3MM5 A;  3ZZO A;  1EP4 A;  1HAR A;  5ETV A;  1RBL A;  5D0G A;  4PPZ A;  1HNZ F;  1E6Y A;  3PDN A;  2Y3Y A;  1RT4 A;  4MIA A;  2XI2 A;  1RHM B;  3MEG B;  4C2M A;  4EWT A;  2UUC J;  4QYZ K;  2ZH5 A;  2LU1 A;  5ETN A;  2CA9 A;  1B0P A;  2YWW A;  1TEL A;  4OI2 A;  4LFA F;  1WWH A;  2GX8 A;  1UTA A;  3EM1 A;  3NCQ A;  2IYI A;  3J81 Y;  1FTR A;  2ZBI A;  1VQP S;  3W5X A;  3MFI A;  4NCB A;  3K5M A;  4O3P A;  2DR7 A;  2ADC A;  5IT9 Y;  2C3P A;  1SKR A;  3VQS A;  2DGW A;  5BJR A;  1N5Y A;  4JI1 F;  1H98 A;  2R2R A;  5E0O A;  4DL7 A;  2Y8W A;  4ECS A;  2QIF A;  2J6T A;  5DDR C;  4URS A;  1KR4 A;  5AXN A;  3GFH A;  4I64 A;  4DFK A;  1CQN A;  1HHS A;  5HSP A;  1DTQ B;  4ES1 A;  2NR0 A;  2UV8 G;  5ETL A;  2Z56 B;  1NPP A;  1U24 A;  2ZHO A;  3OL7 A;  4R8U A;  5LOQ A;  4DL0 C;  3MCO A;  5CQG A;  4FPR A;  1N36 F;  1FDB A;  2G1H A;  2QG9 B;  4PAA A;  2VOO A;  1JLB B;  4KH1 B;  2VA3 A;  1JKH B;  3M6X A;  1CPZ A;  3CCE S;  3HVT A;  1UJ5 A;  1KQS R;  2WSE C;  2P5V A;  4BWJ A;  1FK9 A;  4NEZ A;  3ZC4 A;  1UVM A;  4LSZ B;  1AFI A;  4ILL A;  4OLO A;  1RWU A;  1UWB A;  4K7Q A;  2RDJ A;  3G82 B;  3E01 A;  3KHH A;  1ZZN A;  2VPZ B;  4DV1 F;  3TW0 A;  4DV1 J;  3RRH A;  3H98 A;  3OLA A;  2B56 A;  4ED2 A;  3R7S B;  1X5S A;  2LDY A;  3MPW A;  2PI4 A;  3CO0 P;  5C2G A;  4QOT A;  3A3N B;  5M2U A;  2DCU B;  2L48 A;  1S4E A;  2LEP A;  4RUB A;  4BC9 A;  2FHJ A;  2HMI A;  2J0S D;  1NPR A;  1FX4 A;  1TMM A;  2ZBR A;  4OI3 A;  2UXB J;  2NXC A;  2W7A A;  1Y10 A;  3RYL A;  4ER8 A;  4OX8 A;  2E1C A;  6FD1 A;  3MR3 A;  4C9D A;  1IKV B;  3U7J A;  4X4O A;  4DR7 J;  4RPF A;  1WOO A;  5GVQ A;  1J5E F;  1J27 A;  2HWT A;  2RKI B;  4C8K A;  2C28 A;  4QIV A;  2XCA A;  4KGM A;  2WTF A;  3GIJ A;  2V2Q A;  1L5U A;  3FGV A;  3OTB A;  5AJ3 J;  2R7S A;  3NEK A;  3TUZ C;  1SIW B;  2CG4 A;  2VFU A;  1IR1 A;  4HAC B;  3CJR A;  3GIR A;  3RUB L;  1LW0 B;  2I38 A;  3MHY A;  4HEA 9;  3BYR A;  4KT0 C;  4DFJ A;  4C8L A;  1UVJ A;  2H48 B;  4WZQ A;  4Y00 A;  1CJK A;  2GAG C;  1V3Z A;  2H51 B;  1M0S A;  1NJZ A;  1WHY A;  1U2C A;  3IM8 A;  3PRB A;  4N7T A;  2M8H A;  3CIZ A;  4KPY A;  1HLW A;  2CPY A;  1JIH A;  1JNZ B;  1JLE A;  1FRK A;  2O66 A;  1I51 B;  2WSF C;  4I4B A;  4MIB A;  1RKJ A;  1WNE A;  4EUV A;  2XMV A;  1UVI A;  3TX0 A;  1K1S A;  4MAK A;  2G2O A;  2XMU A;  1MNE A;  5J2M A;  4A8M P;  1SH2 A;  2FVS A;  3M9M B;  5IT9 U;  1F9F A;  1WHV A;  5D15 A;  4FDF A;  2ROG A;  1F9E B;  2CQ4 A;  3GLJ A;  4RNN A;  1FDD A;  2CQ2 A;  4ZLL A;  1S1U A;  2PA8 D;  5H9F K;  1R0C B;  2V6A A;  3MF5 A;  3N6N A;  3MEE B;  3M9N B;  1BQN A;  5K9F A;  4AL6 A;  4F4A A;  2FD2 A;  4NLG A;  5CYM A;  2EG2 A;  3BO2 A;  2HND A;  2H5J B;  2W8K A;  2F65 A;  3IM9 A;  4MYT A;  3WC2 A;  1FKP A;  2V8D A;  3ET6 A;  2HHX A;  2E9R X;  2ZOF A;  2RML A;  1LEO A;  3HKZ D;  1S6U A;  1S1X A;  4FXW A;  2B9E A;  5HJY A;  5DQI A;  4A8O A;  3PO5 A;  2FYX A;  4IOA Q;  3G8T A;  4GC7 A;  3IBW A;  3TRG A;  2M5Y A;  4EEY A;  5T7L B;  2YKM A;  4UUX A;  4P73 A;  2V69 A;  4IYQ A;  1UZH A;  5SZT A;  2SXL A;  5ITH A;  4TU9 A;  2VPW B;  2EFO A;  2EKY A;  2HIY A;  3A8K A;  3BEG B;  1U47 A;  3KXD A;  4X4Q A;  3J80 U;  4X4R A;  1WC0 A;  3QAE A;  4MK9 A;  2RHS B;  4WXO A;  2ZNZ A;  5J2P B;  3CD0 A;  5IS2 A;  4ZKA A;  3QWP A;  2MQM A;  3VGT A;  1BWV A;  4ILR A;  1X4B A;  3EZU A;  2CDR B;  3ITH B;  5HVH A;  3HVR A;  3KUH A;  1NDC A;  1ZAX A;  5D3G B;  5GMK a;  2QMW A;  3FC9 A;  3KWM A;  2KM8 B;  2RD5 C;  5DZ6 A;  1FJC A;  2F63 A;  3CNQ P;  3I0R A;  4CH1 A;  3MEC B;  2BOA A;  4IO1 A;  2QE5 A;  4PXD A;  1T9W A;  4CQ1 A;  2UVW A;  3J7A N;  5D8H B;  3E8O A;  5KT2 A;  5IOL A;  4CTA A;  3OJS A;  5IM0 A;  2YH0 A;  2DD8 S;  3CD5 A;  3U1L A;  2R2T A;  1L3U A;  2F4F A;  4KSE B;  4E8U A;  4IFV A;  2J0W A;  4I7F A;  5DZ7 A;  1HR0 F;  3PHE A;  4NLQ A;  4ZVE A;  5ADZ A;  3SZ2 A;  3KK1 B;  1VQN S;  3GPA A;  2GV1 A;  4JYA J;  2VFS A;  4TU7 A;  1UW9 A;  4RU2 A;  1R89 A;  5E7O B;  2XMA A;  2W4P A;  3TZY A;  1HFE L;  2H9Z A;  4ECR A;  5CZV A;  3I56 S;  4O44 A;  3EZO A;  5ETK A;  2BRK A;  5E3C A;  1YBU A;  1U6B A;  4K4W A;  4L3K A;  4RLE A;  5BR8 J;  5KG5 A;  4QWC A;  2PEH A;  3VAI A;  4OI0 A;  2ZUA A;  1OY9 A;  2UUT A;  4XPC A;  2FUG 9;  1VHI A;  4DZD A;  4U95 A;  1YX2 A;  4URG A;  2HS0 A;  3G8S A;  2ZJR Q;  2OIH A;  3A8J A;  2XC9 A;  1IKW B;  4WKY A;  1A0O B;  4KGX B;  5CZX A;  5E33 A;  3GR0 A;  1M5P C;  4H4M B;  4B3M F;  2HVE A;  3AY0 A;  4RNH A;  1R0A A;  4WJB A;  4JV1 A;  3LAK A;  1D3W A;  1H3D A;  1RZM A;  1PJ6 A;  3C14 B;  3M8Y A;  1S1W A;  1Q79 A;  1Y3J A;  3TZZ A;  2HHV A;  2MKS A;  3FBF A;  2HRY A;  1LK7 A;  2A6M A;  4JOU A;  1B7Y B;  1WC1 A;  3C8Y A;  3MI7 X;  3NWG A;  4TQR A;  4WP3 A;  4IRK A;  4X4V A;  1BWE A;  2Q79 A;  2MDA A;  3DOK A;  1GT8 A;  2Z2Z A;  1ACM B;  1LFP A;  1FD2 A;  2V9K A;  3DHX A;  1G4C A;  4H54 A;  4AD6 A;  3BGF A;  1RWM B;  1NJW A;  1YRU A;  2J9E A;  4DN9 A;  4ZDN A;  4DOZ A;  3L7O A;  3MM7 A;  4DSE A;  1NB7 A;  1NHK L;  2X51 A;  5ETT A;  2OMO A;  1RWK B;  3DRR B;  4JI7 F;  2NSB A;  1FFS B;  3TR5 A;  1Q8L A;  2JEF A;  3OVB A;  1XBW A;  1NZA A;  4KKO A;  2GHW A;  2EWH A;  1P6T A;  2XHW A;  3FBE A;  8AT1 B;  1TKX B;  4AQY J;  2R8J A;  4LFB J;  5F8N A;  4CCH A;  2ADB A;  2PGC A;  3P5T L;  2WOM B;  4ETX A;  1YJR A;  1RTH A;  5DGB A;  1U1N A;  1WDT A;  1S1T B;  2MQQ A;  5A8K A;  4A8Q A;  5M2P A;  2EC2 A;  1O0P A;  1NK0 A;  1IXK A;  5LL6 d;  4XAK A;  5MLC V;  2X3D A;  1JLQ A;  2B7C B;  3RBX A;  2QA2 A;  1IM4 A;  2XSF A;  4MKA A;  3T9Z A;  4ELU A;  2G9O A;  3DLK A;  2GCF A;  2H4Y B;  2X1A A;  2I2Y A;  3GON A;  4NLR A;  4HVZ A;  2ZH4 A;  4ZIV A;  2CNL B;  2FVR A;  4A8K A;  2XMT A;  4CT9 A;  2M8D B;  5CYJ A;  4DQR A;  1IBL J;  2X7I A;  1IKX B;  2BQU A;  5KFV A;  4ZHR A;  2VG7 A;  5IWA F;  4L73 A;  5JVG Q;  3OUY A;  1OMS A;  2WSC C;  2VKZ G;  2NPF A;  5KFW A;  5CA5 A;  2VIC A;  1UEV A;  4DG1 A;  3HF5 A;  1CG2 A;  1Q86 T;  4ZN3 A;  2EK6 A;  3KDO A;  1PIE A;  2YKN B;  1FE0 A;  3WC0 A;  3RJM B;  1NK4 A;  2I0X A;  2KYX A;  2DR5 A;  4OYO A;  4JI2 J;  1H74 A;  1FES A;  1VQ7 S;  2IA6 A;  1RT6 A;  1DY3 A;  2HPU A;  3MOZ A;  3CJK B;  4F26 A;  3IAM 9;  5SUH A;  2ZH9 A;  4M63 A;  1FNX H;  1UEU A;  5KG0 A;  1U09 A;  1EJ7 L;  4B3M J;  1Q1K A;  1RU1 A;  2LXI A;  3MAA B;  4PAB A;  3CCU S;  2EI5 A;  3THP A;  1VJQ A;  2XBP A;  1O51 A;  5CD4 H;  2KJV A;  1TUG B;  3NXZ A;  4ZVP B;  4J9R A;  3T5K A;  4ELT A;  2H1Y A;  2QGF B;  3TZX A;  1Z2Z A;  1OPI A;  2VD3 A;  2BM0 A;  3AOB A;  3LWL A;  4X4T A;  4P2M A;  4ZOS A;  4DFM A;  1TQL A;  1UL3 A;  1FKA F;  5B0C A;  4FF4 A;  1AYE A;  4M5I A;  4OFZ A;  4PCQ A;  3MXH P;  1DQ8 A;  1T9X A;  3NY0 A;  3JQK A;  4KRW A;  1IQZ A;  4K0K F;  2ACY A;  5B0G A;  1ZPW X;  2XY5 A;  4P74 A;  2MSS A;  2JLG A;  4QR0 A;  2B0G A;  3PFO A;  4ERD A;  2B7B B;  1D9D A;  5J1E B;  3D1H A;  4G1P A;  4PWD A;  1DQ9 A;  1DTT A;  1HIY A;  1HMV A;  3TAM B;  1N5T A;  1N5Q A;  3C6U A;  3ZNU A;  4FKY A;  3J7Z 5;  2L41 A;  3K57 A;  2FIU A;  4NLS A;  3UR3 C;  5T14 A;  3CXC R;  3OTD A;  5LSL A;  3MUT P;  1N32 J;  3Q23 A;  3AXM A;  5EX3 A;  1HBO A;  2VL1 A;  2YPY A;  4Y2C A;  3OR2 B;  4ES2 A;  1KVI A;  4JI4 J;  1K47 A;  3MOJ B;  3D7S B;  2PC6 A;  1SJ3 P;  1RLC L;  3DGP B;  4OX7 A;  4JP8 A;  1N33 J;  4MFB B;  3RZA A;  1KVJ A;  1S9G A;  3IS9 B;  3N5B A;  2J8A A;  2W4D A;  4FNH A;  4HH1 A;  2Q66 A;  2CZ9 A;  4CH0 S;  4JI5 F;  3I0S B;  3MMA A;  4BHQ A;  1TL4 A;  1RLD A;  4Q8E A;  5LM7 E;  1URR A;  1FVS A;  2VDI A;  4DHV A;  2DNO A;  2Z57 B;  4IFY B;  1KBR A;  3DGV A;  4TQS A;  1AUD A;  3Q8Y A;  2G2Y A;  1OSC A;  2YNH B;  2CZ4 A;  1WF2 A;  3EIC A;  4MKB A;  3D1Q A;  3FDS A;  1B0T A;  3LGN A;  2CVI A;  1L3K A;  4ZPW R;  2XCP A;  3OJU A;  2QFJ A;  4KQZ A;  4ZA1 A;  1KDN A;  3I5C A;  1S5Z A;  2FGO A;  2DTJ A;  2MLY A;  1E6V A;  2MLZ A;  3MAH A;  1T03 A;  3R2D J;  5J2N A;  1LKZ A;  3G9C A;  2RVJ A;  1S4F A;  3AA9 A;  3G86 A;  3V4I A;  3ZZU A;  2R3V A;  5HBM B;  3KYL A;  1U1L A;  3QQC D;  1TVR A;  3QO9 A;  3MFH A;  1S1V B;  3ISN D;  4OYA A;  2A6O A;  4WWS A;  4J9N A;  3D6F B;  1OY8 A;  2YQ3 A;  3MD3 A;  4RNO A;  2FLL A;  2HGL A;  3OFH A;  4USV A;  3TQE A;  1T0T V;  5B0D A;  2V94 A;  4C8M A;  4P7T A;  4WE1 A;  4UZB A;  1LWC B;  3MR5 A;  4S0M A;  1FHT A;  2GVD B;  4F0M A;  4DR2 J;  4ANC A;  1D1U A;  3SSR A;  3W66 A;  1S9E A;  3V5R A;  2GGP A;  2ZIT A;  5C25 B;  4DL4 A;  1C4A A;  2HHW A;  3QFH A;  3HVW A;  5B08 A;  1U0S A;  4F7V A;  3BO3 A;  4DS4 A;  2NYH A;  3KUG A;  3O44 A;  5ETS A;  4IH6 A;  3C6T B;  1IBK J;  5A2Q Y;  3CCZ A;  3H8Y A;  4I68 A;  4NMX A;  1XMQ J;  1N48 A;  3EGZ A;  4MJK A;  2FY1 A;  4NLW A;  1LWF A;  2F8H A;  4WP8 A;  4ED3 A;  3KG1 A;  4KE5 A;  1LOU A;  4I6W A;  1RTD B;  3HSZ A;  2CPD A;  5L9N A;  2M70 A;  1SJ1 A;  1I3O B;  5LMU F;  5IWA J;  1U49 A;  1IBM F;  3NCR A;  3LP0 B;  2GHP A;  1N56 A;  3VAJ A;  2HFN A;  4J5O A;  1R43 A;  4PG6 A;  2VA2 A;  2IM2 A;  1BQM A;  4DR4 F;  3ZTP A;  5H1S V;  2MHE A;  1SUQ A;  5DRK A;  1NAQ A;  4JI6 J;  3DYA A;  1VQY A;  2DHS A;  3QFW A;  4QPT A;  2KFN A;  5ETP A;  1JJ4 A;  1IM6 A;  3TEG A;  2ALZ A;  2COL A;  1WD6 A;  3PRD A;  5D4P A;  3NNC A;  3AB2 B;  2GA7 A;  4RWX A;  5F8G A;  3GU0 A;  1KVK A;  3CJ4 A;  1JMT A;  1S79 A;  2RB7 A;  3M6W A;  4KHR A;  4TYA A;  4ANE A;  1QUP A;  4DZ6 A;  1REG X;  3HFZ B;  3V4M A;  4DCP B;  3IP0 A;  3CCW A;  5A0Y A;  2A0F B;  4OX9 F;  4CWB A;  2D41 A;  3MUR P;  4AQY F;  1Y9O A;  1JLB A;  1FA0 A;  4OYX A;  2KXH A;  2N82 B;  4KGZ B;  2FHK A;  5GAH I;  3P49 B;  4X2B A;  3I87 A;  1GQE A;  5GAE I;  4USJ C;  2DGQ A;  4N5S A;  2XMK A;  1A7G E;  2RJZ A;  2YXL A;  1S59 A;  3IRX B;  5CAA A;  1XR7 A;  3M1V B;  4KIA A;  4HDG A;  1RIS A;  4HT5 A;  1NO8 A;  3DM2 B;  1D09 B;  2F9J A;  1YBA A;  4L76 A;  4QR2 A;  2K3I A;  4YR0 A;  1F3F A;  3J81 U;  2FHO B;  1W2B R;  2GVZ B;  1TAQ A;  2D74 B;  1PO6 A;  2OPP A;  3F73 A;  1QY7 A;  1NJY A;  1FXD A;  2KVI A;  1JLF A;  3W61 A;  1MU2 B;  2OPS B;  3O5T B;  3VV2 B;  4CLU A;  5IZH A;  1NK6 A;  2AZ3 A;  1CQM A;  2AMC B;  3C15 A;  3EXY A;  2XMM A;  2IC3 A;  2J9C A;  1HYS B;  3BH6 B;  4UOC A;  4DV3 J;  4L74 A;  1EQM A;  4LF9 F;  3ICL A;  2HFS A;  3VGU A;  2XLI A;  1A6L A;  1VBK A;  2HFZ A;  1ARO P;  2XWY A;  5GAD I;  1GX6 A;  2EBE A;  4CO2 A;  1R27 B;  3R6G B;  2WVF A;  4LRE A;  2CPF A;  4NCG A;  4F0K A;  1FF2 A;  4F4Y A;  4IOC Q;  3US5 A;  3H4B A;  3Q8P B;  4FNI A;  4E98 A;  2VV5 A;  3HMJ G;  3Q8Q B;  4MKY A;  3DOL B;  4NZ7 A;  4URQ U;  2RU3 A;  1SI9 A;  2XEX A;  2AEF A;  4M5M A;  3M32 A;  1VQ5 S;  1YJW S;  2P6T A;  3VVT A;  3RBE A;  1RTI B;  2N3L A;  4QIE A;  4DV0 F;  3DLG A;  2FVC A;  3VCD A;  1VK8 A;  2D7S A;  1VQS A;  3MMC A;  4HHJ A;  3RRK A;  2WON B;  1WOR A;  2MGZ B;  4FF1 A;  4DV2 F;  4C48 A;  4FXV A;  3J7Y U;  3HX9 A;  2ZE2 A;  3GP9 A;  5C42 A;  1NKB A;  5I3U A;  1E6Y B;  3FEZ A;  4K2J A;  1RT4 B;  2MJN A;  4QW8 A;  3ZFV A;  2FVP A;  2HHQ A;  1SC3 B;  2YX7 A;  3TUJ C;  1VQ8 S;  4TY8 B;  1WG1 A;  5K14 A;  5KTQ A;  4ZVT B;  1UEK A;  1QTN B;  2LQ9 A;  2GS8 A;  4KO0 B;  2DH9 A;  1XNQ J;  3RB3 A;  1HW9 A;  4KV8 B;  3FKB A;  2JNJ A;  4OI4 A;  5DJB A;  4FKX A;  2HQC A;  2U2F A;  3MR7 A;  2KG0 A;  3CUN A;  2RIJ A;  3FCW A;  5HAT A;  2W9B B;  1AT1 B;  3WIV A;  5FLX U;  3OW2 R;  2B4U A;  3LQV A;  1FWL A;  3HZE A;  1OO0 B;  4HHU A;  4I0W A;  2IY5 B;  3CT9 A;  1H2V Z;  2N4D A;  4WYL A;  3W5Z A;  2OPQ A;  3QIP B;  3B78 A;  2EXU A;  2V4R A;  4K4X A;  2Z2Y B;  4F4W A;  1Q8I A;  1NEE A;  3QAU A;  2HVI A;  4G1Q B;  4DR1 F;  2XHC A;  4NOH A;  5CYM B;  1W25 A;  3D5M A;  3M30 B;  4R25 A;  1U8S A;  1NUE A;  1DTQ A;  3HK2 A;  2IRX A;  1LFW A;  1G2E A;  4PPD A;  1BQX A;  3SDE B;  4LIW A;  1NK9 A;  5BYQ A;  3QJL A;  4R5P A;  2MKI A;  2PFF B;  2BE7 D;  3BSC A;  3GJQ B;  3L7P A;  1TV6 A;  4ZJL A;  4PKD B;  3FQL A;  3W9I A;  4Z7Y A;  5DG7 A;  2KYZ A;  4NLU A;  5LXY A;  1SPB P;  2YKM B;  4QYZ J;  1EB0 A;  2C3U A;  3QJJ A;  4ED5 A;  2ZH7 A;  2AT1 B;  1YJV A;  4DEZ A;  4YDX A;  1LW2 A;  3I4P A;  1CVJ A;  2AX1 A;  2IVY A;  2QRR A;  4WFA Q;  3E01 B;  3OFG A;  3UDV A;  2XYG B;  2DY9 A;  1WOS A;  1R6V A;  2F40 A;  4EBD A;  1U25 A;  4KB7 A;  1S6Q A;  3DLE A;  1B7F A;  5C24 B;  4QZV B;  5BYR A;  2OFG X;  5HP1 B;  3OTO F;  1EP4 B;  1XMO J;  1VQ9 S;  2HSE B;  4WPA A;  2CPZ A;  1KTV A;  2JDJ A;  3LP1 A;  1SL1 A;  1NJI T;  2HYI B;  1MRO B;  1HNV A;  1HWJ A;  5D3G A;  4OYP A;  1TUV A;  3SSQ A;  1SL0 A;  4QWB A;  1TL5 A;  4F25 A;  2VG6 B;  5L46 A;  4CM2 A;  4LIR A;  7AT1 B;  2LDI A;  2QN6 B;  4A48 A;  3M2R A;  3CC2 S;  3RAM A;  3K5O A;  3NCP A;  2GQQ A;  2PEB A;  2HQD A;  3CJQ A;  4JUZ A;  4I7F B;  4BBY A;  3CCS S;  1FWP A;  2HK3 A;  2BX6 A;  2HVZ A;  1R0B G;  3KK1 A;  3EXC X;  4TXS A;  1C1C B;  3K7R A;  3T41 A;  4DX8 H;  3MTJ A;  5KOX A;  2B43 A;  3J81 j;  2Y1J A;  1B3T A;  4O3R A;  2F3J A;  4QU7 A;  2C2K B;  4NRT A;  2UXD F;  1L3S A;  4TLR A;  4PQU B;  4HYK A;  1F60 B;  5KFZ A;  4YY3 F;  3G71 S;  3BKU A;  1TR0 A;  2CPE A;  4HTI A;  4YY3 J;  1P9Q C;  2Z4P A;  3KOA A;  3RBD A;  4HR2 A;  1F2G A;  2R7R A;  2GO9 A;  5D0R A;  5DET A;  1VC0 A;  2YWH A;  1TMJ A;  4ZLJ A;  1JLE B;  4OI1 A;  2R7T A;  3FVY A;  2W24 A;  2YH1 A;  3AA8 A;  4OIX A;  2MKK A;  2LLZ A;  4LSN A;  2ZHA A;  4QPX A;  1SKS A;  3OL6 A;  3ZTQ A;  3NLC A;  4DSL A;  4IQX A;  2JX2 A;  3M7V A;  3BSO A;  2V4J A;  4PUO A;  5IV4 A;  5DM6 Q;  3G4S S;  1N34 F;  2GO8 A;  1HD0 A;  4ZMM A;  4FS1 A;  4LSL B;  1RHU B;  1HW8 A;  3GMG A;  3CJ5 A;  3QT6 A;  2R4F A;  3G82 A;  2AP6 A;  1WI8 A;  1AUS L;  2IRU A;  4DQS A;  3H5Y A;  4C8Z A;  4X65 J;  3QAT A;  1DZ5 A;  4NLP A;  1HQU A;  1XQI A;  3EGN A;  2LYV A;  1U8W A;  3R6L B;  2DR9 A;  1VMB A;  4L3N A;  4DR6 J;  3MED B;  1G7C B;  4J90 A;  2EKN A;  1CLF A;  2C2M B;  4AL7 A;  1I94 J;  2HMI B;  3T1H F;  4K5S A;  1YJ7 A;  3SCK E;  3TOQ A;  3R1L A;  3UDC A;  2FHJ D;  3ET6 B;  2ZKU A;  1FT8 A;  4A8X A;  8ATC B;  3MWB A;  5DDO C;  1QVF R;  5LJ5 Y;  3JSM A;  1SJR A;  2BJ9 A;  3BBB A;  2AF6 A;  2C2O B;  4OHZ A;  2OI2 A;  4C7Q A;  1PJ7 A;  4PXE A;  4WCE Q;  2CNK B;  5DQG A;  1QUV A;  4I69 A;  3W5Y A;  2KHC A;  1NKC A;  2MST A;  2PFD A;  2OO4 A;  3NWR A;  2X3G A;  3BDE A;  3PTW A;  4QCL A;  1FE4 A;  1IR2 A;  2O1P A;  1WAC A;  3AOD A;  4NLY A;  4Y2K A;  3HHL A;  4DN0 A;  3UNY A;  1PBA A;  1V3R A;  4J9U E;  4J9P A;  1RCX B;  1U1O A;  4M5D A;  3ENQ A;  1XR6 A;  2E1R A;  3MPV A;  4UZC A;  5CYQ A;  4CLF A;  2V4Q A;  1HNW J;  1HHQ A;  4JI6 F;  3TJ9 A;  1P1T A;  4USH A;  2XYP B;  3WX8 A;  3HT3 A;  3JQM A;  2AHO B;  3HPO A;  3TQ1 A;  1X5T A;  2R8G A;  2IM1 A;  3DCA A;  3I0R B;  4MH8 A;  4O23 A;  4DR3 J;  2JEJ A;  4EYI B;  4QW9 A;  1VBX A;  3UVJ A;  4DR3 F;  2KO1 A;  5KFM A;  2B8Q A;  2WBM A;  3BSA A;  3KLV A;  3DLL Q;  2O3D A;  4P2X A;  1KC8 T;  2UVV A;  4JI7 J;  4PZV A;  5JXS A;  2JLF A;  1VC5 A;  4ZP8 A;  1RAI B;  5IFM A;  2HWI A;  3OUY B;  4ED7 A;  3TI0 A;  5RUB A;  1M1K T;  3IFE A;  2PMW A;  3NS7 B;  1NSP A;  5K20 B;  4X4N A;  3JAM U;  4RW9 A;  3NMA A;  2HRT A;  3MCM A;  1UP1 A;  2LCW A;  2W2O P;  3D2W A;  1SC1 B;  3LAL A;  2R2U A;  1KD1 T;  4C8N A;  4WFZ A;  5EGY A;  1T7P A;  2BA9 A;  1QVG R;  4C8O A;  4DR4 J;  3CJK A;  3QWU A;  1U4B A;  3OPK A;  3MDF A;  4XTT A;  3DXB A;  3FRY A;  2E7V A;  4QQB A;  2M7S A;  2IM0 A;  2CQ3 A;  1Q5V A;  2F8M A;  1ZYQ A;  2BBE A;  1S1X B;  4A8Y A;  2DHX A;  4OV6 A;  4JV0 A;  2D9O A;  1RT7 A;  1VHF A;  2H4W B;  2KDO A;  4ID5 A;  3PIO Q;  3HVT B;  1UWA A;  4USM A;  4F3Q A;  2CJX B;  1URN A;  1GX5 A;  5F8L A;  5B0B A;  2OD4 A;  3PG9 A;  3RR8 A;  1VK3 A;  4CO5 A;  3NOG A;  5D77 A;  4C11 A;  1EAY C;  4B9M A;  1SQF A;  1B70 B;  5GAH U;  1VIS A;  2BJD A;  3M6V A;  1C0T A;  2DH7 A;  3M9O B;  2J6U A;  1I1G A;  1IWA A;  3LAN A;  4WP9 A;  4DPO A;  3IRW P;  2ILZ A;  2RDD A;  4LFC J;  1GMV A;  3QID A;  1SBR A;  1P8G A;  2MLX A;  3ITH A;  3ZTO A;  2NPI A;  3QRP A;  2RQK A;  2DGV A;  4FN5 A;  2HFU A;  3C46 A;  1WEY A;  3D9B A;  1VGY A;  1NME B;  1UMJ A;  3MEC A;  3PYG A;  2DGU A;  3KLI A;  2WW4 A;  2BR0 A;  1RGV A;  5B7W A;  3MM7 B;  2OAU A;  2N7C A;  4Y28 C;  2ZJP Q;  3ETM A;  5IM0 B;  2L9W A;  2XGP A;  3BJY A;  3MPY A;  2WVD A;  1SL2 A;  2V2V A;  2YPZ A;  2DGS A;  2YNI A;  2E66 A;  4OMF G;  1HBO B;  1S99 A;  2PD1 A;  1BGX T;  2RKI A;  3GJR B;  3IXQ A;  3ULH A;  2JVR A;  3SFG A;  3ZZZ A;  5EDW A;  2E1P A;  4NCA A;  2VON A;  3PNI A;  5KFI A;  2UXD J;  4J7C A;  3W8P A;  1M5H A;  2DXF A;  2DYA A;  5AXL A;  4O4G A;  4DSJ A;  3V6K A;  2KT3 A;  4AYB D;  3AD9 C;  1RTH B;  5EN1 A;  1Q82 T;  3IS9 A;  3OV7 A;  4Q0B B;  1MWQ A;  1RTZ A;  3UO0 A;  2ZBC A;  3CWJ A;  2F4V J;  4CLY A;  1XR5 A;  3M8Q A;  1RDR A;  3R5J B;  3MM8 B;  1UJ4 A;  2BJ3 A;  4DR6 F;  2E9T A;  1JLQ B;  1Q7L B;  2GML A;  3GE9 A;  3K2Y A;  1HBU A;  2RNE A;  3M2U A;  3T9N A;  1F3V A;  3V6D A;  4EYH B;  3CJ3 A;  4USW A;  5KFE A;  2CXE A;  1IUJ A;  2QFI A;  4X4P A;  4ECU A;  2HZV A;  4NYO A;  3K5P A;  1F2H A;  3I31 A;  3BPS P;  1KQF B;  2BAB A;  3LA0 A;  1MSW D;  3NAI A;  4F0H A;  1IKX A;  4KC5 A;  3W2V A;  4IRD A;  4XDD A;  1YZ7 A;  2DK2 A;  3ZZT A;  2B9Y A;  3W2W A;  1QAJ A;  4KTQ A;  2B5J B;  1HNX F;  1PC4 A;  1S1U B;  3UR0 A;  5E2Q A;  3OHB A;  3NGT A;  4WE1 B;  2DNR A;  1BQN B;  3GIK A;  1U6F A;  3CF5 Q;  4QU6 A;  4NL5 A;  3PM9 A;  4F3O A;  2GGP B;  2W4C A;  4CRJ A;  2HND B;  1FRH A;  3CVK A;  2YKA A;  4AL5 A;  9ATC B;  4AE5 A;  4J9O A;  2MMY A;  1XN9 A;  2RU9 A;  4Y2M A;  1ZA2 B;  3WHI A;  2DNY A;  2Q3P A;  3VAK A;  4CH7 A;  4V19 X;  4W4M A;  2GIF A;  3VGV A;  1RTD A;  2VH7 A;  3FFI A;  1GK8 A;  4CYU A;  1RA6 A;  2CQH A;  2CIM A;  2Z2M A;  3VAG A;  4WYW A;  2XY7 A;  1MMD A;  2ZWO A;  4YHH F;  4NYP A;  4M5L A;  1JLG B;  2LXU A;  1GTH A;  3FCH A;  4J9Q A;  1BQM B;  1S1T A;  3KLF A;  4Y2A A;  1S9F A;  1X31 C;  2H54 B;  3EDQ B;  1M1H A;  1NDL A;  1T9U A;  2HS3 A;  4P71 A;  4B08 A;  1HPZ A;  5F9L A;  3GIM A;  3CDW A;  1REV A;  1QAY A;  2V8V A;  3HJV A;  1GTE A;  2BMB A;  2M9K A;  1DTT B;  3M2V B;  3KJV A;  1U1K A;  2GQC A;  3AJD A;  3N4W A;  4CLL A;  4KFB A;  2Z2L A;  3T1A A;  4PG5 A;  1Y00 A;  3DDK A;  2ALY B;  3T3F A;  3GB0 A;  3RAQ A;  2CQI A;  1RSC A;  1V9O A;  3JS9 A;  2HLT A;  1JK9 B;  3R27 A;  4ID8 A;  2VG7 B;  1L3V A;  2GAH C;  3E3X A;  5E5N A;  2W7O A;  2N4C A;  5DQH A;  4TYB A;  3OR2 A;  2IDE A;  2H3E B;  2DGX A;  2WBR A;  1JNR B;  2YKN A;  4M5N A;  5HMX A;  5LXR A;  1XJW B;  4ED6 A;  2IRY A;  3LP2 A;  4N41 A;  4K4U A;  5HLF B;  2BUN A;  1SKW A;  5D4N A;  4F4K A;  2ASY A;  3DLJ A;  2DR8 A;  2ROP A;  1UVL A;  2QL9 B;  1SJF A;  4ZCI A;  5J1P A;  3OVA A;  1C1B A;  2XZD B;  2XZW A;  4U9R A;  1VJW A;  3MAA A;  1WG4 A;  2XNQ A;  2V9W A;  4LFB F;  2M4M A;  2VBY A;  1S72 S;  5DS7 A;  3M6U A;  4C97 A;  4K4V A;  1KOO A;  5D0H A;  2KG1 A;  2W9C B;  3PW0 A;  3LPE A;  3VAF A;  2RRA A;  1LQ9 A;  2BVZ A;  5HQM A;  2ASD A;  3UWT A;  2CJ9 A;  2MZR A;  3K8V A;  2CJK A;  2VIH A;  4XIU A;  1S10 A;  3IR5 B;  1H72 C;  2WCX A;  2DO0 A;  4A4J A;  1M90 T;  1F5C A;  1KHV A;  3BRE A;  3MMB B;  2D3O 1;  1TVR B;  4DBQ A;  3PW4 A;  3W64 A;  3CCT A;  1EQ0 A;  2C2D A;  3C14 A;  4XK8 C;  2KM8 C;  4ED0 A;  4DQP A;  3C66 A;  4EK2 A;  5KG4 A;  3IWX A;  2OPR B;  3PR4 A;  2C2Z B;  2HIQ A;  1RT3 A;  3PX0 A;  4B3R F;  2OTL S;  3ISZ A;  4J91 A;  4RW7 B;  4ZP6 A;  1R8H A;  3N6M A;  2KRB A;  3MR2 A;  1S9E B;  3G6Y A;  1YVF A;  2WZ1 A;  3PJW A;  2MZJ A;  5LT5 A;  2BE2 A;  5A8W B;  1JB0 C;  4OZ1 A;  5LJ3 Y;  2GIQ A;  1IJF B;  2UVU A;  1IWG A;  1WC3 A;  1S0O A;  5I3U B;  4EZ9 A;  1JJH A;  1DAR A;  1F5A A;  3R5D A;  1JLC B;  2ZEJ A;  1KQG B;  1TL3 A;  5DDP C;  1VRT B;  1O8B A;  4DV7 J;  2DHG A;  2RS2 A;  2V68 A;  4B17 A;  1OJ4 A;  4KO0 A;  3IR7 B;  1Y11 A;  4QR1 A;  4ZIT A;  3ILO A;  3FSI A;  3BYP A;  4DR5 J;  2YNG B;  3TAQ A;  3ADA C;  3UN2 A;  2W9B A;  4OQJ A;  4MFB A;  2HGN A;  2QMX A;  4NEY A;  2V8P A;  3FSX A;  3M8P A;  5KG3 A;  4EI2 A;  1Q4R A;  2K1R B;  1KTQ A;  4OYB A;  4NPO A;  2UVR A;  4QWD A;  1LWE A;  1YIT S;  2E9Z A;  4ETZ A;  4B3O A;  4NLT A;  4XPE A;  1TAU A;  1WF0 A;  3JAM Y;  1FWK A;  3D3B J;  4NML A;  5I42 B;  4B9L A;  3C16 B;  2W01 A;  2YNH A;  2XM3 A;  3OSN A;  4ED1 A;  4UY8 5;  5KG2 A;  3BO4 A;  3IGN A;  3HD2 A;  3MTK A;  2N3O A;  4AXI A;  3M30 A;  5CD4 A;  4DR5 F;  3V6J A;  4HKQ A;  1B64 A;  1MLA A;  2W2P P;  1CJT A;  2FLP A;  2VB6 A;  1ELO A;  1P9Y A;  3OD2 A;  3Q89 A;  2UUW A;  4LQ9 A;  4WK1 A;  4YP3 A;  3H5X A;  4CT8 A;  1KFS A;  4RNF A;  3QPI A;  2MQP A;  2I9S A;  4BC7 A;  5L1K A;  1Q5Y A;  3QO9 B;  1SJ4 P;  1X4C A;  1KQK A;  3UN5 A;  3AHP A;  3G6E S;  2FZK B;  4DG1 B;  3MAQ A;  1IVZ A;  4NX9 A;  3W1Y C;  1YLX A;  3DU6 A;  5B0F A;  5GMD A;  3B6B A;  2AGO A;  2UUB J;  2AX0 A;  3UE2 A;  4HH0 A;  3P96 A;  4L75 A;  4EO6 A;  1LXN A;  5LMN J;  4LF2 A;  4E0D A;  2CUY A;  3QRQ A;  1RT6 B;  4B9V A;  3KLE B;  4K4T A;  5KFJ A;  2OGU A;  3QT5 A;  5ETQ A;  1M5S A;  2JC1 A;  3F41 A;  1T9T A;  3R7B B;  4YEA A;  1NB2 A;  3C6T A;  1MU2 A;  4X4U A;  3LP1 B;  1HI1 A;  2V0N A;  5D4L A;  2HQG A;  1ULR A;  1NND A;  1LXJ A;  4DFP A;  4U7U D;  1LWF B;  2RSQ A;  4ECX A;  2FLN A;  1R7I A;  1KHW A;  2EFP A;  2RUS A;  1KEK A;  3LTO A;  4YHH J;  2VFR A;  3PV8 A;  4I67 A;  4NZ6 A;  2HHP A;  3HFK A;  3LP0 A;  2Z8Q A;  3NGK A;  1NZ8 A;  3A3P B;  4OLP A;  1U1P A;  3M2R B;  4DPW A;  2L9N A;  3HZG A;  2KN4 A;  2WW8 A;  4LF8 F;  2M3D A;  2GJI A;  2FJE B;  1SUQ B;  1Q8B A;  1R31 A;  5KFF A;  4KBI A;  4ZIW A;  5L8R C;  2YWK A;  4IR1 A;  1AFJ A;  1XEZ A;  3LOU A;  2EK1 A;  1T3N A;  2UUA F;  1T94 A;  4JBC A;  2EFG A;  2RUG A;  2DKO B;  5J1E A;  3EZ5 A;  4IR9 A;  3JSR A;  4TVA B;  4V19 J;  1OYD A;  2FC9 A;  2Y1L B;  3K8W A;  2RQ4 A;  4DL5 A;  4JV5 J;  3GYN A;  2LQ5 A;  1GEH A;  2YNF B;  2BRL A;  5HMW A;  4U67 Q;  5KFN A;  5DLF A;  1U45 A;  3CUL A;  4JYA F;  2KXN B;  1NBE B;  4Y6I A;  4H4O A;  1DQA A;  4U8V A;  2EPI A;  1Y5I B;  1P1L A;  1NXI A;  3TWZ A;  3K89 A;  4CNY A;  5IV3 A;  3MUV P;  3CCJ S;  5C5J A;  2FJV A;  3QRR A;  1C0U B;  3HHD A;  4LSN B;  1RAD B;  2M88 A;  2VFV A;  3CDE A;  2FDN A;  3LPY A;  2MEW A;  3IRX A;  3OR1 B;  4L72 B;  4RL1 A;  4WU3 A;  2W8L A;  2AU0 A;  2DO4 A;  3H4D A;  4LSL A;  1UPP A;  2QL7 B;  3RTV A;  2AW0 A;  1S9G B;  2LKZ A;  5FLX Y;  1W26 A;  2MQ8 A;  2K2P A;  2IBO A;  3MMA B;  1YRX A;  2OPQ B;  4OYM A;  1FRL A;  1CSJ A;  3UFC X;  4DX6 A;  2DGO A;  1VQM S;  3JXO A;  2Q6C A;  1CS4 B;  1ITP A;  2OSQ A;  1JLF B;  2OPS A;  2DHA A;  4CNZ A;  1NRK A;  4TLQ A;  2XY6 A;  2VPX B;  5DM7 Q;  1S12 A;  4J9V A;  2IC3 B;  4M8L A;  5G0R A;  3LH2 S;  1SB6 A;  3EDR B;  2ZM6 J;  3R5A A;  3W60 A;  1E6V B;  2ZH6 A;  3SDE A;  1DLO A;  1HNI B;  4DX7 A;  5J2N B;  4AXJ A;  3ZNJ 1;  1S97 A;  1K44 A;  1TV6 B;  2IHR 1;  4EU0 A;  3GQC A;  2UV8 A;  2NXU A;  3FNN A;  3KDN A;  1RHJ B;  1LV5 A;  2F1F A;  3KLH B;  7FDR A;  1TL1 A;  3CSK A;  1VQK S;  2OTJ S;  4ATN A;  1YIJ S;  3M8S A;  1RYS A;  2DNN A;  5G4D A;  2NLW A;  1NDP A;  1KS2 A;  3A8E A;  3SQG B;  2BAN B;  4DV4 F;  2FJW A;  1HWL A;  2A18 A;  3G87 A;  3HFV A;  4LR7 A;  1VYA A;  3HI9 A;  1C2P A;  3H59 A;  3P45 B;  1I94 F;  3NNH A;  1BD6 A;  1S49 A;  2WON A;  4YB7 A;  3LGM A;  3KG4 A;  2VZ9 A;  4K8R A;  2ILY A;  3UD4 P;  2EW9 A;  4K4S A;  1BLU A;  3GG1 A;  4ZVS B;  1HNV B;  2FZG B;  4J9S A;  2KTQ A;  4C6A A;  4M94 A;  2L3M A;  2IAJ A;  4TY8 A;  3S01 A;  1ZTT A;  4LJM A;  2JHE A;  3UVJ B;  5JJB A;  4ZS6 A;  3R5C A;  1G3O A;  2O5D A;  4KV8 A;  2CAJ A;  1PG5 B;  3MMJ A;  4NLX A;  1RAG B;  1KLM B;  1FJG J;  3GSI A;  4KR0 B;  3GV7 B;  2YQ0 A;  2D3Z A;  3X1L B;  4NI2 B;  2F4V F;  1YI2 S;  3RAX A;  2R7X A;  3QIP A;  4UOH A;  2ACM A;  1FKO B;  2I5J B;  4QJV A;  5KFD A;  1C1C A;  2PT0 A;  1RAC B;  3DYA B;  1IBK F;  4G3I A;  4DPY A;  1IKY A;  2UXC F;  3BM7 A;  2JSX A;  1KON A;  1FDA A;  2PA3 A;  2QA1 A;  2MQN A;  3B82 A;  3PEJ A;  4OHW A;  5AE2 A;  5HQ8 A;  3KHR A;  2XMJ A;  2HHU A;  4MMO A;  3DMJ B;  1U1M A;  6FDR A;  1KN6 A;  1RHR B;  3B4D A;  1JXV A;  1YDL A;  3RW7 A;  2C1E B;  3T5J A;  5HVF A;  1R8C A;  2DXE A;  4PR6 A;  2BQR A;  2HNZ A;  2IBK A;  1WC6 A;  3CCR S;  1GH8 A;  4YB1 P;  4DUT A;  4XDC A;  4DL6 A;  2AYM A;  3N79 A;  1N5Y B;  4LUB A;  4B9S A;  3FEX B;  2AJ2 A;  4C11 B;  3IC1 A;  1WI6 A;  3THT A;  3D0I E;  3U1M A;  3ZZP A;  3DXS X;  4RW4 B;  5AXM A;  1GAO A;  2XQC A;  4JI1 J;  1U6Z A;  1S6Q B;  3DLE B;  2X1B A;  5KT7 A;  1RBA A;  3D6T B;  5HP1 A;  1RT2 B;  4A46 A;  2LVW A;  4I6Y A;  4NLO A;  3KMS A;  2DNG A;  1YJ9 S;  4JI3 J;  1F5B A;  1MRO A;  3QGI A;  5HI7 A;  2RT3 A;  1PGZ A;  3CC4 S;  2CJB A;  3BGO P;  3ILI A;  2XMW A;  2DT9 A;  5F41 A;  2MZQ A;  1SVD A;  2VG6 A;  3QGP A;  4RZR A;  1L3T A;  4IDK B;  3JYT A;  2VQE F;  1FDN A;  3Q83 A;  2RS8 A;  3CJ0 A;  4BS2 A;  1PBU A;  1XIQ A;  3HHK A;  4CO1 A;  3VWS A;  3N28 A;  4NCG B;  3SEO A;  3DU5 A;  4O0N A;  4LRA A;  3VAL A;  1WDD A;  1S6P A;  1X5O A;  1VLY A;  2OD6 A;  3D3C J;  4PRF A;  3FMB A;  2Z30 B;  2A10 A;  4ECY A;  2UUA J;  4LF5 J;  1TKZ B;  3BGL A;  1X5P A;  1U02 A;  2YKQ A;  3WBZ A;  3HHL D;  1RTI A;  2IVM A;  1CUL B;  1NM2 A;  4J37 A;  4P10 A;  2XS7 A;  3GYG A;  2AEJ A;  3HHL B;  1ZOT A;  4Y3C A;  4Z37 A;  4DV5 J;  3PW5 A;  2CPH A;  3J7Z T;  1Q53 A;  1RA7 A;  5CCM A;  3ILL A;  4K2X A;  5KG6 A;  4QYR A;  1EKR A;  2D3U A;  5CYQ B;  4C4W A;  3M8Z A;  1U26 A;  3CDB A;  3GSD A;  4UOG A;  3OVS A;  1HBU B;  2NSC A;  2CPJ A;  4DSF A;  2K06 A;  4RBV A;  5AT1 B;  3ETO A;  3POT B;  3R9L A;  2QO3 A;  3BH7 B;  2MKJ A;  5FD1 A;  2OSR A;  2MZS A;  5K14 B;  2EFN A;  4RBT A;  2UU9 J;  1KRP A;  3CD7 A;  3K17 A;  2V4J B;  4PUO B;  1BE4 A;  1LWX A;  3L95 X;  3UCZ P;  2AJF E;  2NXE A;  4Q2L A;  4F02 A;  5KFH A;  5CAB A;  3S7R A;  5J2Q A;  1X4G A;  1VRU A;  4OZ5 A;  4JI0 F;  4X4S A;  1Q81 T;  2QLF B;  4PG4 A;  2B5J A;  2DH8 A;  1F9H A;  2E44 A;  3LUY A;  4I2Q B;  3Q0A A;  3TAR A;  1HQU B;  1FTC A;  1ZPV A;  5BYS A;  5LMN F;  3ZO7 A;  1RB0 A;  1JXE A;  4IG3 A;  3J7A 1;  4J9K A;  3MED A;  4B3S F;  3BPD A;  1NPK A;  3DRP A;  4EMD A;  4U6P A;  3MCN A;  1QM9 A;  3D6M B;  2FLO A;  1WHW A;  2B6A B;  3OTE A;  2XTJ P;  5T41 A;  3MM6 A;  3FBB A;  4ZCM A;  3KHL A;  5L1J A;  3KKF A;  5AE1 A;  1D9F A;  3FFI B;  1WEZ A;  2A2C A;  4C98 A;  4CYU B;  4ZLP A;  3GV8 B;  4K5R A;  3LGH A;  4ICL B;  5LSR A;  3TA0 A;  3MUM P;  3R2C J;  2HGM A;  2A3J A;  1HWI A;  1R8A A;  2XGQ A;  1HWK A;  1T9V A;  4W92 B;  1CJU B;  4GMK A;  2HHH J;  3KLF B;  2LQ8 A;  2VBW A;  2IJF A;  2HHH F;  5C24 A;  5I3P A;  5L9X A;  4BWM A;  2BEF A;  3TX8 A;  4M5D B;  4TKT A;  4R0E A;  5KFC A;  2IDL A;  3PVX A;  1HPZ B;  4CLS A;  4F50 A;  4EZ6 A;  1T8E A;  3AQO A;  1REV B;  2KT5 A;  3CJS A;  4LF6 J;  2V2K A;  3CO9 A;  1S0V A;  3I5A A;  2ZH3 A;  2CQ0 A;  1H6K X;  2VF3 A;  2E7W A;  1N88 A;  3N01 A;  3VAM A;  1HI8 A;  3D6H B;  2BW7 A;  2F7V A;  2YNI B;  3PKM A;  3M4X A;  2EBG A;  2M0G B;  4U8Y A;  4RW6 B;  4ZPC A;  5A8R B;  3Q22 A;  1K73 T;  1EKS A;  2HBR B;  3RBZ A;  4NA2 A;  1YHQ S;  5AE3 A;  4RW9 B;  3W8G A;  4C3M A;  3PJX A;  2HBY B;  3WDO A;  4DF8 A;  4ECT A;  1WOP A;  3LP2 B;  3RU0 A;  1G1X A;  5HLF A;  3ELH A;  2JZ5 A;  3MGJ A;  3NG8 A;  2MZT A;  4PQU A;  1WTF A;  2Q6B A;  4UST A;  5KG1 A;  4F4X A;  1H2U X;  2YKO A;  4AT1 B;  2MKC A;  1ROF A;  3AD7 C;  3HSD A;  4G6V B;  1Q8K A;  2G0I A;  4OJ1 A;  3HUL A;  2VG5 B;  4F8R A;  4TN2 A;  4PXB A;  3PY8 A;  3V6H A;  1ZH5 A;  3M2U B;  4DCJ B;  1DAX A;  1UA0 A;  1WUU A;  4R0J A;  4RX6 A;  4X84 A;  4ZJQ A;  1X4H A;  2GQ2 A;  3D4J A;  3V6D B;  1VCT A;  3F56 A;  4EO8 A;  4NXM J;  3RB4 A;  3R8Y A;  5KFA A;  2E1M C;  3RG6 A;  2J0Q D;  4KYZ A;  2RHQ B;  4ZCL A;  5I3Q A;  3W2V B;  2RF2 B;  1JQG A;  4C0B A;  5D6G A;  1FEE A;  3K59 A;  1BHN A;  1HBN B;  1X0P A;  3WIU A;  4LF7 F;  2NYI A;  4USK A;  3P5B P;  1WKK A;  4CP5 A;  3EYZ A;  1C0T B;  2HBZ B;  3GZ7 A;  1GNK A;  4DPU A;  5BR8 F;  4A8S A;  2IJR A;  3TUI C;  3ILJ A;  2OPR A;  2G4B A;  1DRZ A;  1DFD A;  1RT3 B;  2PN6 A;  3T1Y F;  2WHO A;  1WEL A;  4P7V A;  2VKR A;  2MKH A;  3DRX A;  4O4R A;  2BW2 A;  1D8Z A;  1UPM B;  3S1T A;  2Y0S D;  2HFV A;  3AJ1 A;  1M1G A;  1U7L A;  2L9D A;  3FSY A;  4IQM A;  1T3O A;  3I6P A;  4X66 J;  3CPW R;  1QSY A;  3DLH A;  1TL7 B;  4M95 A;  4Q8F A;  4IOB A;  3C19 A;  2G0C A;  2ZUG A;  3IWL A;  5IT4 A;  1T95 A;  4DSK A;  3CD6 S;  3PHT A;  2HZA A;  2MZ1 A;  2V34 A;  4WZM A;  1XWL A;  2ROE A;  4DS5 A;  3UI3 A;  2KXF A;  2I8E A;  3NP5 A;  1N52 B;  2CQD A;  2ZDP A;  4IUF A;  4Q0B A;  5FJ4 A;  3C3L A;  3F44 A;  5HAN A;  3IG1 B;  4ZPT R;  1Z4U A;  3ZZR A;  1UKU A;  2V2Z A;  3AJ2 A;  3GTY X;  3H5U A;  3I4H X;  2CJQ A;  4GO7 X;  4OX6 A;  5E3Q A;  4YN3 B;  2G0J A;  4LRB A;  1NKE A;  1FXR A;  2CZV C;  3IA0 A;  4O4G B;  3EPI A;  2Y9H A;  3AH6 A;  2J9D A;  2ZC3 A;  3NRB A;  4N47 A;  1HD1 A;  3DOM A;  2G13 A;  1QAX A;  3BKF A;  2K1R A;  3NL0 A;  4Q44 A;  1VS3 A;  3U02 A;  2HK2 A;  2NUU G;  3M8Q B;  1HBM A;  3PEH A;  2HAI A;  3I55 S;  1X9W A;  4U7U K;  4NAS A;  1N54 B;  2PDA A;  2AJ1 A;  3CED A;  2UZA A;  3MM9 B;  1R8P A;  1Z2L A;  1RAF B;  3IMQ J;  1RQ0 A;  2RE1 A;  2V5H G;  4KHM A;  3DRY A;  1NH7 A;  2K7J A;  2RRB A;  4Y2I A;  3N6L A;  4ZVG A;  3LW5 C;  3Q8V A;  1YJU A;  4KFB B;  1TUW A;  1WC5 A;  3OLB A;  3OFE A;  3CME S;  3EGW B;  2AYB A;  1YK9 A;  4WFX A;  1X4D A;  1LK5 A;  4KH0 B;  3MCS A;  4FVM A;  1GMW A;  1T05 B;  4HI2 A;  2M52 A;  1B0V A;  3QGG A;  4DUZ F;  3KMQ A;  3Q2T C;  4PG8 A;  3E51 A;  4X66 F;  2MXY A;  2EC0 A;  4HT7 A;  3TYT A;  3BV8 A;  3NKY A;  2ZJQ Q;  5HRO A;  1R8B A;  4OX9 J;  3PW7 A;  4LRF A;  1X4A A;  4F67 A;  3K0J A;  1RHQ B;  3FBC A;  3T5H A;  1A9N B;  3D66 A;  1Q78 A;  4YR3 A;  4YOE A;  4DI6 A;  4ZP9 A;  3LF0 A;  3G8Q A;  1C1B B;  5DDQ C;  2R2S A;  4X64 J;  1TU0 B;  4YQW A;  3IN5 A;  4WFB Q;  4O0I A;  2DPI A;  1ICE B;  1RAA B;  2JEI A;  1RAE B;  2CNN B;  3AFG A;  1CEZ A;  1V5V A;  4NXM F;  2ZNY A;  2I1R A;  1RT7 B;  1G6B A;  4ID5 B;  4OHX A;  3AAW B;  2XSJ B;  1UFL A;  4ZLN A;  2ZH1 A;  4FZV A;  4DUY J;  2G1D A;  4UF4 A;  2XI3 A;  1FO1 A;  1FX2 A;  1CC8 A;  3H20 A;  4QIG A;  3PR5 B;  3HXM A;  4MIW A;  2MB0 B;  2N7Y A;  4RUA A;  4JI3 F;  1U0H B;  4UW2 A;  3CCL S;  1HNW F;  1VFJ A;  4I56 A;  1FJG F;  5DG8 A;  1W2I A;  5GAG U;  2OH2 A;  2ERR A;  2PII A;  1MMN A;  4RW7 A;  4LF6 F;  2C2R A;  3FMW A;  3GFX A;  3OL9 A;  2IYG A;  5HQL A;  4OHY A;  4DV4 J;  1EET B;  1T02 A;  3EX7 B;  4JI4 F;  5A8W A;  1JJC B;  2OEL A;  4LBH A;  1WHX A;  4OL8 A;  5EWE A;  2YNF A;  3KLI B;  2P2C B;  1M5K C;  5KFX A;  4DR2 F;  4K50 A;  2DIV A;  4CDI A;  1IBC B;  2CVE A;  2JJ4 D;  3JSY A;  1NLK L;  2JFD A;  3FEY B;  3NGS A;  5EHH A;  5KFO A;  4RKU C;  4IO9 Q;  2CWK A;  3R97 A;  4DQQ A;  4LQ3 A;  1KKH A;  1RE1 B;  2ZZN A;  3HHN B;  2IPO B;  3T1H J;  5DGA A;  3OT9 A;  5KOW A;  1UFK A;  2Y1I A;  3BBC A;  4NYZ A;  4CLZ A;  1YWX A;  1ZAW A;  4RNM A;  4DPX A;  2DGT A;  2BQ3 A;  1YGY A;  4KGK A;  3VZI A;  3NGU A;  1ZM4 A;  2LEB A;  4B3O B;  1K0V A;  3AQP A;  2ATC B;  3BQ1 A;  3EUN A;  3UDL A;  3MM8 A;  2CQB A;  2VBZ A;  1C4C A;  4CO3 A;  4IG0 A;  2LQB A;  1WKL A;  3AXK A;  3Q8U A;  2YQ1 A;  2BJ1 A;  2LP4 A;  2NS1 B;  1ZAV A;  4ITS A;  1QLN A;  2R7U A;  1HQE A;  3O8W A;  1YSJ A;  2W9C A;  4DLE A;  2DRD A;  1TKT B;  1VR6 A;  5B0A A;  4Y34 A;  1CJT B;  3QSI A;  1RT1 A;  1OQ6 A;  3SSS A;  1DLO B;  2OEM A;  1TFW A;  1VIO A;  1RJJ A;  3BGR B;  3FUY A;  2CFX A;  1SV5 A;  2BAC A;  2LU2 A;  3TVY A;  1PC5 A;  3MMB A;  3FZB A;  1DHM A;  5E3A A;  1PCA A;  5KFR A;  1UVK A;  1JLA B;  1VOM A;  3W2W B;  4NA1 A;  1T11 A;  2B4O A;  2EVZ A;  3GJT B;  5F8H A;  4F4Z A;  2MYF A;  1S0N A;  2GMH A;  1K0T A;  2ZOG A;  1V6H A;  1Y7P A;  1GXT A;  1OWX A;  1Q95 G;  2ZC4 A;  1Y0H A;  2YTC A;  2LFV A;  3HLU A;  3NS6 A;  4JI2 F;  5KG7 A;  2BAN A;  2O01 C;  2RQC A;  1D8Y A;  1FRM A;  4ZJO A;  1Z1Z A;  5IXU A;  4GKJ F;  2DNK A;  5K8N A;  4G65 A;  4CZC A;  5F9N A;  4RR5 A;  2BE2 B;  1H7W A;  2XLK A;  3KK3 B;  2AJQ A;  1F1B B;  4YUD A;  4QWA A;  3AB4 B;  4OZJ A;  1PAE X;  2HZC A;  2BJ8 A;  4QBU A;  4FXD A;  3B54 A;  2QSW A;  1JXL A;  4UT4 A;  3HSG A;  2MQL A;  2YY3 A;  3JTO A;  4ZVH A;  4LFC F;  4DR7 F;  2HVD A;  2CJY B;  2OEK A;  5KFK A;  2X1F A;  2ASJ A;  1JLC A;  4I2P B;  3L4B C;  3CC7 S;  1F0X A;  1ZBT A;  3Q24 A;  3KNG A;  4I6A A;  1VRT A;  5KFU A;  2VHG A;  2IMW P;  1Y5N B;  1S77 D;  2F5G A;  4C8Y A;  4F36 A;  3GFZ A;  1XNQ F;  4LBP A;  1QSS A;  2AJ4 A;  3OHA A;  1JLG A;  2DNM A;  1DJ0 A;  3M8P B;  1CJV B;  4N77 A;  3SIP B;  2P6S A;  4BDP A;  3N5F A;  3IO1 A;  3PCO B;  1SCJ B;  3JSB A;  4OV1 A;  4K4Z A;  2HBQ B;  1EIY B;  1HNZ J;  2YWE A;  2RDI A;  4W98 A;  3C16 A;  1NH8 A;  1TZ0 A;  4YDD B;  1JX4 A;  5L39 A;  3H40 A;  5M2R A;  2CQ1 A;  2B9W A;  3QLH A;  2V50 A;  4M5K A;  2VJU A;  2EG1 A;  2GIR A;  1YRT A;  4HLB A;  3M2V A;  1VLO A;  4OYI A;  1PYS B;  3KJV B;  2W7P A;  3DMJ A;  4DQI A;  1XNR F;  2MKY A;  4KJI A;  2KFY A;  4LR8 A;  3QNW B;  2AGP A;  2DY1 A;  1VQL S;  2J0X A;  3KJF B;  1FRJ A;  1N36 J;  2XO6 A;  3PX6 A;  3OTC A;  2JVO A;  4GVB B;  3T6B A;  2BKO A;  3DRS B;  3H2V E;  1JKH A;  1C0U A;  1RWV B;  5ETO A;  4ED8 A;  2NZ4 A;  2QLJ B;  2EFV A;  2V8G A;  3O1L A;  4OYW A;  4ILM A;  4PQA A;  2KT2 A;  3RB0 A;  1PYO B;  2QC3 A;  2ATL A;  1FJE B;  3HD1 A;  5HO4 A;  3RW6 A;  3B8H A;  4OZ2 A;  3CIM A;  1UWB B;  4LF9 J;  3KLE A;  2QT7 A;  4QIW D;  4BLG A;  4DLG A;  2BM1 A;  2VFT A;  2ABY A;  3D0H E;  3R5G A;  4ECQ A;  1QAI A;  5F3Z A;  4LMZ A;  4GVL A;  1YBT A;  1CS4 A;  3AT1 B;  1UJ6 A;  2VC0 A;  2UP1 A;  4DF4 A;  1I5O B;  1U2F A;  3I82 A;  1N8R T;  5G0R B;  2E7X A;  4Q7A A;  4PWU A;  3KLG B;  3NBP B;  2LEA A;  2R42 A;  2WB1 D;  4FPI A;  4MYU A;  2VUG A;  9RUB A;  2C22 A;  4LF7 J;  2NXN A;  2QMU B;  2WAQ D;  2XB2 D;  1YJT A;  3VGS A;  5GAE U;  2APO A;  4OZN A;  4ZVF A;  2IFX A;  3SCL E;  5CH7 B;  1RHK B;  4DSI A;  4PG7 A;  1RWP B;  1BY9 A;  1S6P B;  3DLB A;  2JWN A;  1TL1 B;  4KAI A;  2R7O A;  4GRS A;  3IAS 9;  4ENO A;  2E5J A;  4P75 A;  5JVH Q;  2BV3 A;  1TKZ A;  1NK5 A;  2AJ0 A;  3FZ2 A;  3V81 A;  1AZS B;  4YB5 A;  1CUL A;  3HDS A;  2BOP A;  1RTJ B;  2VBX A;  1CJK B;  3L3C A;  3D1O A;  3MEK A;  4GKJ J;  3EGV A;  3ONQ A;  3DFE A;  2LA4 A;  3A3O B;  2XS2 A;  1GXU A;  3H2L A;  4H4O B;  1YKW A;  1N5S A;  5HJX A;  4PXC A;  3KTQ A;  4PWW A;  4KPC A;  4ZVO B;  1V5I B;  2W25 A;  4PYD A;  2QJ3 A;  1VQO S;  1TL3 B;  4I1T A;  3POT A;  1PSD A;  3L7U A;  4FF2 A;  5J2M B;  3FJ2 A;  3CCQ S;  1N6Q B;  1M5O C;  4RO0 A;  3CGI A;  3GIL A;  2YNG A;  1XMO F;  5A6W A;  1T9Y A;  2E5I A;  1SIZ A;  2GW8 A;  4HI1 A;  5GAG I;  5J2Q B;  1X9S A;  2VQF J;  4KHP F;  1J2V A;  5LSO A;  5CHC B;  2ZM6 F;  4UQT A;  1QE1 B;  2LEC A;  1LWE B;  4K59 A;  2E29 A;  4I2Q A;  4B02 A;  2BJ7 A;  2QZ8 A;  1WKJ A;  3EVW A;  3W9H A;  1FCA A;  3N0V A;  4LF1 A;  5I42 A;  2QEX S;  2HWH A;  3BR9 A;  4H4K C;  3M05 A;  4IG3 B;  2ZVS A;  3BKT A;  3DN9 A;  4M5J A;  4NLV A;  4RW8 A;  1WG5 A;  2HNY B;  2CQC A;  1MN9 A;  3W7B A;  4ZPD A;  2OP5 A;  3CDA A;  4C0H A;  3NGD A;  4F3M A;  4ZPA A;  3I9Z A;  1FKP B;  1RKI A;  4HTJ A;  1RWW B;  4USU A;  2OHD A;  2A1B A;  5FDL A;  4ES3 A;  4WFN Q;  5AJ3 F;  1Y3K A;  2B6A A;  1B4S A;  3K5N A;  1OIA A;  1HKA A;  2C3O A;  4N56 A;  4UTG A;  1RWO B;  3QZ7 A;  1U48 A;  1HNX J;  1NHV A;  2HAF A;  1SQG A;  4NRU A;  4Z2X A;  5A2Q U;  2QLX A;  4WFY A;  1NSQ A;  2CPI A;  2QYG A;  4D3G A;  3A1Y G;  2JC0 A;  2KRR A;  3MZI A;  4DWI A;  2ZZM A;  2QV6 A;  4A8F A;  2XS5 A;  3H25 A;  2QLW A;  4WF9 Q;  3HJF A;  3SQG A;  4ICL A;  4ZN1 A;  3KHG A;  3K5L A;  3G96 A;  2UXB F;  3CW2 C;  4O3N A;  2KZZ A;  3O2I A;  4P52 A;  2G2Z A;  5FII A;  4RW4 A;  3ISN C;  4P9S A;  3H0P A;  4WXW A;  2XWX A;  2I6W A;  3VR1 A;  5DLG A;  3GG0 A;  2AV5 A;  3S8S A;  4ZCK A;  3P6Y C;  5EWG A;  3GII A;  3OTO J;  3L09 A;  4J9M A;  3AOC A;  3GFY A;  2KI2 A;  2K7K A;  3S6E A;  2JRS A;  3TA2 A;  4C0O C;  3HP6 A;  5HN0 A;  5HMY A;  3MEG A;  1RU2 A;  4USI A;  5LMU J;  1VIX A;  3PYE A;  1H73 A;  1UFW A;  4PYA A;  3JTP A;  3GWC A;  2GHV C;  5JUM A;  3OBI A;  5HAO A;  2D1C A;  5K8O A;  1GXL A;  3Q8S B;  4K4Y A;  1IKV A;  2UUB F;  1S6O A;  4WU2 A;  1RT5 B;  2W2N P;  1JJ2 R;  2F9D A;  2D9P A;  2YWF A;  3SYZ A;  1QTM A;  2NQP A;  3VHQ A;  4RW6 A;  5A8R A;  3A13 A;  1N32 F;  3U27 A;  1ZTW A;  2Z0G A;  1FKO A;  3BQ0 A;  1X0F A;  5C7P A;  4EGL A;  3CJ2 A;  3I9V 9;  2J5A A;  4HAC A;  4X62 J;  4DU7 A;  4X64 F;  1TTH B;  2KU7 A;  4V1A k;  8RUC A;  1Y4Z B;  1S7I A;  2ZD1 A;  1OSD A;  2DNQ A;  2E1A A;  2E5H A;  5H9F J;  3OL8 A;  1S7H A;  4N76 A;  2CRL A;  2J9D E;  2C3Y A;  4HDH A;  3KK2 B;  2HHT A;  4RJV A;  4R8U B;  2GC8 A;  4FYV B;  2FPH X;  3JB9 k;  1OYE A;  3D68 A;  4LF5 F;  1WEX A;  2HNZ B;  5L38 A;  2GNK A;  2UU9 F;  2HRU A;  3M8R A;  4ZPB A;  1QSL A;  2POK A;  2KJW A;  4GO5 X;  1J5O A;  2QL5 B;  1Q0N A;  4AND A;  3UN3 A;  3OR1 A;  1FK9 B;  2RH3 A;  2NXJ A;  4Q2M A;  3GCX P;  2Y0B B;  4FYW B;  1FI4 A;  4RBU A;  1APS A;  1GFW B;  5JMN A;  1HBN A;  1NDK A;  3WZ0 A;  2OUG A;  4LR9 A;  2PI5 A;  4OZ3 A;  1FNM A;  3DI6 A;  1S1W B;  3BGU A;  3MPU B;  1IN0 A;  3LWM A;  2HUR A;  3MEE A;  2ZHB A;  5A6P A;  1RT2 A;  2VQF F;  2CYY A;  2W1B A;  1I6J A;  1JWW A;  2FVQ A;  1X4E A;  4DV2 J;  1DBD A;  3HHL C;  5AXK A;  3R5B A;  2H65 B;  2P9C A;  2HFO A;  1SH3 A;  1X4F A;  3QGH A;  2R7W A;  4B9N A;  4DUY F;  2CWX A;  1RWN B;  1RK8 A;  2VU5 A;  4IDK A;  4LVO P;  2V67 A;  4KY3 A;  1HNI A;  3VZH A;  3JYT B;  2DRB A;  4DPT A;  2KL8 A;  4DU8 A;  2C2N A;  1RCO B;  5EWF A;  3DRR A;  1TK5 A;  3J80 Y;  3C2P A;  1D9A A;  3RGI A;  3PZP A;  3PW2 A;  5B0E A;  3SMZ A;  1EHW A;  2DIS A;  5IQQ A;  5T7L A;  3KLH A;  4U7C A;  4ELV A;  4OJ3 A;  4TNO A;  3GCW P;  2E5L J;  4W90 B;  1R6Y A;  2BE9 B;  3E2E A;  4JI8 J;  1IBL F;  4UUW A;  2DIU A;  2CAD A;  2NUH A;  4BCA A;  3MR6 A;  2QA4 G;  1S0M A;  2HW3 A;  3TP2 A;  1SXL A;  5KFS A;  5B09 A;  4Y0F A;  4DV6 F;  4B9T A;  2BYC A;  3FRZ A;  2U1A A;  3OSP A;  4K0K J;  3MM5 B;  2R8H A;  3MPD A;  2HQF A;  4QWE A;  1N34 J;  5CCL A;  5KT6 A;  3HSJ A;  2AZ1 A;  1TKD A;  4LVN P;  4M5G A;  1PAU B;  2DB1 A;  2DVI A;  1MN7 A;  4DV7 F;  2IAJ B;  3W63 A;  3ZZ0 A;  1MW7 A;  5H9E K;  3NAH A;  2J76 E;  2OKQ A;  1BC6 A;  1XER A;  4ECZ A;  5F8J A;  1MML A;  4ALZ A;  1KLM A;  1UAW A;  1T05 A;  2OFH X;  3MD1 A;  3CJ8 A;  4IH5 A;  5H9E J;  2QTW A;  1VRU B;  1TK0 A;  3QBC A;  2DEJ A;  4NI2 A;  3ENV A;  4Z7C A;  1QD1 A;  4IH7 A;  3D54 A;  5ETR A;  2ZH2 A;  2EFQ A;  2B3T B;  4AFF A;  1SC6 A;  2I5J A;  3BS9 A;  5KAK A;  4J9L A;  3BDP A;  3R1H A;  1IKY B;  3SXL A;  4WKR A;  3KUE A;  2GFF A;  2B51 A;  3TA1 A;  3Q86 A;  4CIO A;  2DRA A;  3F0N A;  2OEJ A;  4FBT A;  4ZVR B;  4ZVQ B;  3RB6 A;  1Q7Y T;  4NXN J;  4X62 F;  3EWG A;  2VPY B;  1HA1 A;  3Q2S C;  2R7Q A;  5E3R A;  1Y5L B;  4EBC A;  4B9U A;  1U2R A; 
#chains in the Genus database with same CATH homology
 4YHH J;  4DUY J;  2KVQ E;  4NEZ A;  4LF9 J;  4JI1 J;  4X62 J;  3J81 U;  4DV1 J;  1XNR J;  4JYA J;  4LFC J;  4V1A k;  4DV4 J;  4JI3 J;  4YY3 J;  4KHP J;  4JV5 J;  4LF8 J;  4JI5 J;  4RJV A;  4GKK J;  5BR8 J;  4DV3 J;  4B3R J;  2UXB J;  4DV6 J;  4LF7 J;  4NXM J;  4DUZ J;  4DR7 J;  1N32 J;  4KYZ A;  3T1H J;  4JI4 J;  2MEW A;  3D3C J;  4LFA J;  2UUA J;  2UXD J;  2UXC J;  4LF5 J;  5AJ3 J;  1N33 J;  2MQ8 A;  4X65 J;  3T1Y J;  5LM7 E;  4JI0 J;  4DV5 J;  4B3S J;  2F4V J;  4DR1 J;  4DR6 J;  4DV2 J;  4X66 J;  1I94 J;  4GKJ J;  1J5E J;  2ZM6 J;  4KY3 A;  4PWW A;  2KL8 A;  2UU9 J;  3R2D J;  2VQE J;  4DV7 J;  1XNQ J;  5IT9 U;  4AQY J;  4LFB J;  4DR5 J;  2E5L J;  4JI8 J;  5FLX U;  2VQF J;  4DV0 J;  4HHU A;  4NEY A;  2MTL A;  4DR2 J;  3D3B J;  4K0K J;  1HNW J;  1N34 J;  4LF4 J;  1HR0 J;  1IBK J;  3IMQ J;  1XMQ J;  4DR3 J;  2UUC J;  4JI7 J;  1HNX J;  1IBL J;  5A2Q U;  1IBM J;  5IWA J;  1FJG J;  3W1Y C;  2UUB J;  4OX9 J;  3R2C J;  5LMN J;  3JAM U;  2HHH J;  4JI2 J;  3J80 U;  1HNZ J;  4JI6 J;  4DR4 J;  1XMO J;  4B3T J;  3OTO J;  4X64 J;  4NXN J;  4B3M J;  4LF6 J;  5LMU J;  3J7A N;  1N36 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...