4JI4J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 11
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4ji4J00
5LMUJ 1HR0J 5IWAJ 4DV2J 4NXMJ 3D3CJ 3T1YJ 4KHPJ 4GKKJ 2MTLA 4DR7J 1IBLJ 4LF4J 4NEYA 4DUZJ 2KVQE 4DR2J 1N36J 4AQYJ 1N32J 2UXDJ 4V1Ak 4LF5J 4JV5J 4YHHJ 4DR3J 4DV0J 4DR4J 4NXNJ 4B3SJ 4DV7J 3R2DJ 2VQEJ 4X64J 4B3MJ 2UU9J 1HNXJ 4LF9J 2ZM6J 2UUBJ 3R2CJ 2UUAJ 4YY3J 4LFBJ 4B3TJ 2UXBJ 2MEWA 1N33J 4JI8J 5LMNJ 1HNWJ 1IBMJ 4JYAJ 2HHHJ 3J81U 1J5EJ 4DR6J 4JI0J 2KL8A 2UUCJ 3OTOJ 1XMOJ 4LFAJ 4OX9J 4LF8J 4DV6J 3J80U 4DUYJ 1IBKJ 4K0KJ 4LF6J 4KYZA 4JI2J 4JI1J 5FLXU 4DV1J 2VQFJ 1N34J 4DV5J 4X65J 1XMQJ 4HHUA 4JI3J 3IMQJ 4LF7J 5BR8J 4JI6J 2E5LJ 4X66J 1HNZJ 4KY3A 4DV4J 4DR5J 3W1YC 1XNQJ 3T1HJ 1XNRJ 4LFCJ 4RJVA 4JI4J 4DR1J 2MQ8A 5A2QU 4JI5J 3D3BJ 4NEZA 2F4VJ 4DV3J 3J7AN 4X62J 5IT9U 1FJGJ 4PWWA 4JI7J 1I94J 3JAMU 4GKJJ 5LM7E 4B3RJ 5AJ3J 2UXCJ
chains in the Genus database with same CATH superfamily
1TMJA 2R4FA 4A8MP 4DL7A 1YJNS 4ES1A 5KFXA 3OJUA 3KLHB 2JZ5A 1EJ7L 3NBPB 1FXRA 4BS2A 2XYPB 2O5DA 1TKXB 4CQ1A 1KD1T 1IWGA 3IWXA 1TUGB 2FHJD 2Z58B 5CZXA 2V2QA 3KTQA 2F8HA 1NLKL 5E3PA 3RB4A 4FF1A 3Q22A 3QQCD 5M2UA 2CPHA 2QIFA 4NPOA 1M5VC 2ALZA 3Q2TC 3NGKA 3CJ4A 1G7CB 2RHSB 1H6KX 4QJVA 3NNCA 4USUA 4HEA9 1LK7A 2W2QP 5KG7A 4BDPA 3QRPA 3I0SA 4LF1A 1VRUB 4MJKA 4C0OC 3UD3P 1IQTA 3RUBL 8RUCA 3PEHA 4HT5A 3B4MA 2JEFA 3U1LA 3TEGA 2CQ3A 2R2TA 4L3NA 2YNHB 3UNGC 1MMNA 2E1RA 1V5IB 4FP9A 1HW9A 2CG8A 3CNQP 1H2UX 1VOMA 5L46A 4ANDA 2C28A 3HZGA 2CQ0A 1U0SA 8ATCB 5I3UA 4LFCF 3QGIA 4FVMA 2IFXA 5KFLA 1F9EB 2EBEA 4HR2A 1RHJB 4YY3J 2XZTB 2ACYA 3IGNA 5LJ5Y 4BLGA 2XS7A 4CNYA 2BE9B 4AT1B 4KHMA 1DAXA 2MLYA 2WOMB 1BHNA 4OI4A 3CGIA 3D66A 3PKMA 5KT3A 4QR2A 4YHHF 2J6SA 3RW6A 4XTTA 4MKVA 1WKLA 4G3IA 4LRCA 3TQEA 4MKYA 3KNGA 4YN3B 1BMQB 2M70A 3CCLS 1RUSA 4LFAF 4A8WA 2MKKA 2I5JB 1RA7A 1DY3A 1BXNA 1LW0B 4P72A 1FRJA 4DV3F 4CO4A 4CLYA 2W1BA 4KTQA 2K06A 2BW2A 1RDRA 1FJGF 2IDLA 3I4PA 4WF9Q 4M5NA 1HBUA 1XJWB 1CPZA 2CNNB 2W2PP 1HNIB 4QU7A 2LLZA 4GC7A 1B99A 2IYGA 3G8SA 3IBFB 5KOWA 2AF6A 2L9NA 2YWEA 5A0YB 3GCWP 2AJQA 4QBUA 2G2OA 3GZ7A 4N77A 2YNIB 5L1KA 4C2MA 3IWNC 1XC9A 2BJ1A 1V3ZA 4OX6A 5DS7A 1X9SA 4X64F 5ETPA 3UVJB 1S0VA 4O3QA 3KK2A 4KR0B 2XTJP 3M8RA 1Q7LB 3X3UA 5A76A 5ETSA 5C25B 4CM0A 5CXTA 5KFTA 3IWLA 4ECWA 5K20B 2GHVC 4JI2F 2E9TA 2OEJA 4ZDNA 4KSEB 5IC6B 3DLGA 1DJ0A 2ZDPA 4A4JA 3BH7B 1MROA 3G8QA 3MF5A 1M5PC 3FK4A 1FNOA 2VG6A 1NSPA 2HK2A 2R7SA 3PR4A 2B51A 2LQBA 4ED8A 4NYOA 2X3GA 5E2QA 4DV7J 4N7TA 4EI2A 2FJAB 1G4CA 5A8RB 1TMMA 2HLTA 5EWFA 2V8VA 3EVWA 3JS9A 1VRQC 3N6NA 4NLYA 2DHHA 5B0BA 4ZPDA 2RKIA 3GIKA 2IJFA 1NB7A 1U2FA 3EVOA 4ZVFA 5U47A 1T11A 3J80U 4PQUA 5HQLA 1UFKA 4PQAA 5DRKA 1RGVA 5L39A 2DRDA 4PXBA 3BM7A 1TU0B 3BJYA 3R6LB 1Q79A 1TK0A 2DGTA 2OPRA 2MQOA 3G6YA 3O5TB 4C7QA 1DTTB 3MI7X 2KN4A 5AXKA 3GG0A 1SC6A 3JQMA 1NPKA 3MD3A 4JI5J 1WTFA 3H2VE 3M6XA 1PAEX 2VG7B 3KJVB 5HMWA 1RAOA 1WF0A 5RUBA 5F8HA 2F1FA 3OL6A 4M1KA 4KAIA 5G0RA 3M9MB 3QWUA 4N76A 2NXUA 3AAWB 3BH6B 2BKOA 2YNGB 3R7NB 3D9BA 2C22A 3MEGB 2FGOA 3NGTA 1S1TA 1F2HA 2XMAA 1LXJA 3DGVA 4OHXA 3KLEA 2DGUA 2DY1A 2UUWA 3QPIA 3EZ5A 1L3SA 1H2TZ 3HPOA 2KVIA 2I6WA 4PXEA 1OMSA 1N36F 3GV8B 1VC6A 1P6TA 4NA2A 5CCMA 3EUNA 1MMDA 4B3SF 1TFWA 1FFSB 1VQNS 3R5JB 5KFWA 5HN0A 1CG2A 3C46A 4EUVA 4F0KA 1O0PA 3CIZA 1AXQA 1SXLA 3ITHA 2F4VJ 2W25A 1GQEA 3OL8A 2VU5A 2A2CA 1JJ2R 3EGZA 5KG0A 4ED3A 3G6ES 2GW8A 2VPYB 4ZVGA 1S9EA 3S7RA 1RWMB 3B8HA 5KFOA 4FPIA 3V81B 2GIFA 1NDKA 2HZCA 3QZ7A 1WC6A 4WIIA 1WACA 5IZHA 1UW4A 1TKTB 4ZCLA 5KFDA 5KFEA 4DR3F 1T95A 4UY85 5FIIA 2CJKA 3JSBA 2LU1A 1YVFA 2VV5A 3PRVA 3A8EA 3HD2A 3AJ2A 2RD5C 1H3DA 1T7PA 4ELUA 3L9ZA 4DS5A 2CRLA 1S7HA 3D7SB 2GHPA 2CPIA 4QPXA 2HVEA 2LEPA 1C4CA 3S6EA 1TV6B 3UDEA 2C3PA 1KLNA 4FBUA 2B8PA 5HQMA 5J2PB 1RTDB 4B9SA 2RB7A 1PKUA 5F8JA 1FT8A 1WI6A 1F0XA 1EKSA 4TY8B 1IKWA 2D3O1 2MZJA 3D3CJ 4B9UA 5LSOA 2KVQE 3ZO7A 5KFCA 4DV4F 3ZZYA 4F02A 2NREA 4WIQA 3RW7A 2ZH5A 3Q0AA 1NAQA 2QLBB 4CNZA 4JI4F 1SH3A 3IM9A 1LFPA 2BVZA 2LP4A 2VA3A 4LR7A 4YEAA 3PJ9A 2ZHOA 2KL8A 2BQRA 4OYZA 1XMOJ 1U0HA 5C2GA 1RBAA 4DV6J 2KKHA 3KNAA 1S1XB 3M2VA 5F41A 3OT9A 3Q8QB 1WHWA 3HXMA 2E29A 2YBVA 1R89A 1HLWA 2H3EB 2G2YA 2N3OA 4ED7A 2PC6A 2D7SA 5DLGA 5A6PA 3VTIA 2WONA 1T9VA 2YNFB 1H7WA 2H1YA 2YKMA 4M5KA 3MM8B 4B08A 3MMJA 4JI7J 3OL7A 4OX9F 2LEAA 4PUOA 4USMA 1SL1A 1X0FA 4ECSA 1V3SA 4J9NA 2VQFF 1C4AA 3V6JA 1RHUB 4KV8B 1JB0C 2DNRA 1OY6A 2VG5B 3CDWA 4DF4A 2FYXA 2R7WA 5D0GA 2A0FB 3F0NA 2GVZB 2AYEA 3C6UB 5BYRA 3WZ0A 3GIMA 3WDOA 2MHEA 2RQKA 2W24A 3V6KA 1YZ7A 5KG3A 2G1DA 1PSDA 3AB2B 1YRXA 1JK9B 3IRWP 4HH1A 3I87A 3W5ZA 3K2YA 2UXDF 1KP6A 1RAGB 2JLEA 1UZHA 4CO3A 3LANA 2MQPA 1OWXA 4LSNB 2ZEJA 1GAOA 3ENWA 1UVMA 1DLOA 4CLTA 2ASLA 4CP5A 2UUBF 1IM6A 5JJBA 3FZ2A 2HS3A 2YX4A 4CCHA 1D9DA 3DHWC 3BKUA 1IBMF 2GQQA 1RWKB 1VQ9S 3T5KA 2ZJPQ 5H9FK 3R97A 2IJRA 4ZP8A 4LQ9A 4MKBA 2GVDA 5DZ6A 1KR4A 4A8XA 2FGCA 3J7Z5 1S6PA 1Y5IB 1NSQA 4IRCA 2LQ9A 1HKAA 1DQ8A 4WKYA 4F4KA 1RT4B 3RRHA 2ZBQA 3BGRA 4HHJA 3MWBA 3PG9A 3W61A 1TVRA 1WC3A 3BO3A 1LNQA 2NXJA 3KLGA 2HFZA 1IQZA 1C1BB 3RZAA 5L38A 1R0AB 2XMJA 3DOLA 3JSMB 2PN6A 3DYAA 4QWEA 2AMCB 2W9BB 1HBUB 3TP2A 2BV3A 2Z2ZA 3G6XA 1MU2B 4HL9A 3R8YA 4MK8A 2EI5A 3ZZRA 4C3LA 2DNPA 2ZNZA 4P74A 1V9OA 1RT3B 1FDBA 4WP9A 3ZXWA 2FJWA 4C8ZA 1ACMB 2XS2A 4LT6A 1UVNA 1JLBA 4F2SA 4ECVA 1S76D 2ZZMA 5KFKA 3JSYA 3MTKA 1J5OB 5L1LA 3BSCA 2GO8A 3VAMA 2P9CA 2VFSA 1UJ5A 2V4JA 3M2UB 1T3NA 1PCAA 1IKYB 3OUYB 3OFGA 4K4SA 3IFEA 3IG1A 1D09B 2Y1IA 2B9WA 2NZ4A 3M2RA 2BANA 4ZITA 3DOMA 3JQKA 4NASA 1T05A 3VGTA 3UCGA 3R2CJ 4YDXA 2V5HG 1YJUA 4JV0A 4ZHRA 2XI3A 2FLPA 2XMTA 2XWYA 2GFFA 2NR0A 1U49A 4KH1B 1KQKA 2B9XA 1AFJA 3PO4A 2ZM6F 4NA3A 3EICA 1S48A 4MFBB 1U8SA 1TZ0A 4KGZB 4HYKA 1QVGR 3E01A 2ABYA 4Q5VA 3HDSA 3IMQJ 3L7PA 2J8AA 3AD8C 2RDDA 1NJWA 1GXLA 3KYLA 3K5LA 2C1EB 4YY3F 3Q2SC 1N5QA 2IBKA 1Y11A 1RLDA 2CJQA 3A8KA 3SQGB 2OPRB 3DCAA 3LF0A 2WVBA 4PWWA 3CDAA 3BN7A 2DGXA 4PG5A 5GADI 3IP0A 3MECA 2ZWOA 2AZ1A 1U1PA 1FXDA 1JLCB 2EFVA 5J2QA 2R7VA 2ZC4A 4FNIA 5C24A 1SI9A 1KNZA 1RTHA 5A2QY 2DT9A 5LSLA 3O8WA 3GFHA 3R1LA 4CH7A 5KFHA 4O3PA 4B9MA 3MFIA 4ED6A 2GHWA 3DGPB 1EX8A 2YX7A 1JKHB 1B0PA 3MAAB 1C0UA 1QUVA 3QO9A 2QLFB 3K5PA 3NY0A 4I6AA 4WFXA 1FRHA 3L7UA 4CLUA 4O0IA 3DRYA 5FLXY 3DMJB 2HVDA 5IM0B 1NEEA 4M5GA 2MKHA 3ZZPA 4ZPAA 4RKUC 2OPSB 2KRRA 3RGIA 1RA6A 1FKAF 2C2KB 2RS8A 4ZN3A 2CVEA 4B3RJ 2PEHA 4C8NA 3GU0A 3SSRA 4QPTA 5F8NA 2LXIA 5HL7Q 2D41A 4I64A 2QX0A 3HSDA 4USVA 3DRSB 2IAJB 4L72B 1XBWA 4YB5A 2D3OR 3BBFA 2YKNA 3JSRA 2Z57B 1RYRA 1JLEA 3K7RA 2DNKA 3BEGB 1RAJA 3KUEA 3AFGA 4OMFG 1URNA 1HNXF 2IC3B 1CS4B 5HLFA 4E98A 1SH0A 4LBPA 1RAIB 3PW0A 1UCNA 4B3TF 2YPYA 1C0TB 4RBUA 3HK2A 2DISA 4BWJA 1U8WA 2GQ2A 4ILMA 1HBNA 1ZPWX 2V34A 3FGVA 4DV7F 2GJFA 1FA0A 2BACA 4CRJA 2DXEA 2W9CA 2JFKA 1ZOTA 3G82A 4O23A 4MH8A 3BSNA 2VJVA 2KFYA 3NGDA 1BQXA 4KO0B 4TXSA 5BR8F 2R7QA 2CVIA 2V6AA 4NCAA 2OD4A 4DI6A 3KUGA 2MSTA 1X31C 1NPPA 5BJRA 3H5XA 4ID8A 1YDLA 3QJLA 2NXCA 3MUVP 3G4SS 4HKQA 1RT6B 2VFTA 4J9QA 4I67A 4N8OA 4RPFA 2BE2B 5B08A 1KQGB 3VCDA 2HQFA 5AXNA 2IIHA 2UU9J 4NXMF 4LF9J 1JLGB 4JI5F 4TVAB 3QLHB 2C2NA 4WFZA 5HVGA 4C6AA 5CYMA 1KQFB 4XDDA 2OAUA 2UUCJ 1EARA 1VBYA 1HQUA 1SL2A 2HNZB 2DGVA 1U0HB 5HQ8A 1QAYA 4J9KA 3CCMS 5IQ6A 3MCMA 1S97A 2M7SA 2A6OA 3C16B 2NPFA 5KFYA 2OJ3A 2MDAA 2DNHA 3G2XA 1J2VA 4GKJJ 1NH8A 2J9CA 1Q8BA 3ZTOA 4C3KA 4A8YA 4RW8A 1Z2LA 1WNEA 2BKPA 2MLXA 1FTRA 5SUHA 2M3DA 1FDDA 1HWUA 3FSYA 3U1NA 2DHAA 3OR1B 4HLBA 1VYAA 5HMZA 1FK9B 5EWGA 2XMWA 5AT1B 3RBZA 3I0RA 2UVRA 3KFWX 2Q79A 2AYGA 2AP6A 3W5YA 2YH1A 2ZD1A 1FO1A 3QYYA 1I5OB 3MPUB 1FKOB 5KFMA 1OO0B 3H40A 3VAGA 1X5TA 2KH9A 2RH3A 2NS1B 1OY8A 1P1LA 1H74A 2ZVIA 2CJBA 4XPCA 4Q0BA 3WIUA 1RT7B 4OYMA 2IMOA 1PILA 3EXYA 2UZAA 4UT4A 4MKAA 3H20A 3CF5Q 4ECRA 1NHVA 3I5CA 3KJFB 4OYXA 2BJ3A 2AD9A 1UWBB 5DQGA 1GNKA 3N5FA 1UVJA 7FDRA 1VQ7S 1BLUA 2MSSA 5LJ3Y 5HJXA 2GMHA 2DPJA 2JDJA 1VIOA 2E1CA 4X4NA 4IG3B 4KBIA 4DFKA 1DZ5A 2H5EA 1VQ4S 2GVDB 3MM6A 5C42B 3D0GE 1UJ6A 2DNYA 4CH1A 4ZVPB 2HURA 1CJVB 3AXKA 2ALYB 2MKCA 3GIRA 4KGXB 4RUHA 3V4MA 1TAUA 1TVRB 3AQPA 2JJ4D 2J8SA 3KLGB 1RT5A 5CYQA 3TO8A 3GLJA 3M32B 2ZVSA 1F6TA 2MJUA 4AL7A 3LPYA 4F26A 3KHRA 2RHQB 4A8FA 3MEDA 4CO2A 1S0MA 1LWCA 3MR6A 2Q6CA 2CQ1A 1PJ7A 4H4OA 3KG4A 3VQTA 5E3RA 3ZTRA 1FE0A 4X66J 2ATLA 4B3OB 1WOSA 1XMQF 3D6HB 4J9VA 4EU0A 2V68A 2W4DA 5D15A 4EO8A 4DV6F 3NS6A 1LWFB 5DJBA 2KHCA 5B0EA 3CJ5A 5IT0A 2IDEA 2XBPA 2W8LA 1F60B 1HNVA 5D4NA 4LF5J 1M5OC 1HQEB 2PE8A 4DPOA 1NZAA 2EFQA 1IKVA 1I51B 3S1TA 1WJ9A 4DR2F 1M90T 2DR5A 5D3GB 4P9SA 1BE4A 2BANB 1M1HA 3W2WA 3R7BB 2W7OA 3GR1A 1T05B 3H42A 4JI7F 2KJWA 3RBXA 2ZBPA 4I2PA 3TARA 4PZVA 1WHXA 1XK8A 3WBZA 2OSQA 4K0KJ 3QIDA 2HIYA 4KFBA 4OYAA 5ETNA 3I55S 2QLWA 2WK4A 1YX2A 4IO9Q 2A3JA 1U6FA 3SXLA 1B7FA 1HW8A 4DZDA 2XYHB 4YR2A 3E01B 5ETLA 1HWKA 5M2PA 1VI7A 4IQXA 4Y2IA 3UDLA 1FVQA 3PRDA 3SDEB 1Y5NB 2OKQA 4NWBA 3POTA 4IH7A 3NGRA 1NJIT 1ULRA 3CTRA 1VQOS 1HI8A 1BQNB 2R7OA 4FS1A 1KONA 2V8DA 4F0HA 4L75A 2AGPA 4DSJA 3PJWA 1ZAXA 1Q16B 1HR0F 2HFOA 4DR7F 2IMWP 4MTPA 3KHGA 4X4VA 2APOA 4Q2MA 4Q44A 3BGFA 4NXNF 2B0GA 1RTJA 1UTAA 4P2FA 2E9RX 4FBTA 3M4XA 1HI1A 4WZQA 4DV1J 4ED1A 4U95A 3DDNA 4OX8A 2EG2A 2VFUA 1WD6A 1K47A 3EVMA 2K1RA 3BR9A 2RF2B 1R8PA 5CHCB 2RMLA 2M0GB 4O3SA 2MQQA 3MXHP 3DOKB 1RHKB 4MK9A 1I94J 1FWPA 4EBEA 2FC9A 2MGZB 4XO0A 2VOOA 2PEBA 1S49A 1OPZA 2CDQA 1VQ8S 4KHPJ 3OPKA 3W62A 4TYAA 4OYBA 1NKCA 3SBMA 5I42A 3QIPA 2OD6A 1LK5A 1MMLA 3KLFB 4HI2A 3WIVA 1NKBA 4F4AA 3QNWB 3DLEB 3I6PA 2ZZTA 4PXDA 3T3FA 4O4GB 5EHHA 1GXTA 4LF8J 5J1EA 1IKXB 2DXFA 4PG4A 2CZ9A 3FNNA 2VPWB 3FMBA 1D9AA 2DK2A 1RWXB 3UN3A 5IFMA 8AT1B 4OJHA 3I31A 3AHPA 3R1HA 4QR0A 4Y65A 4IH5A 1C1CB 4Y00A 3MDFA 2LDIA 2HSEB 3CCUS 4HACB 3KG0A 3UDCA 3PW4A 3HHLA 3MMCA 4DL2A 3EX7B 1XR6A 1F9HA 1V3RA 4B9VA 3VALA 2RU9A 5J2NA 3CT9A 3DLKA 1NDLA 2A1BA 2XY5A 2C2EA 4IFVA 3QMQA 3CJKB 1FKPA 1WEXA 3QGHA 4ERDA 3A3PB 2LCWA 4OV1A 4ENOA 3NAIA 2I2YA 3UO0A 4LF4F 4WFNQ 1VBXA 3ISND 1D3WA 3B54A 2BOPA 2UXBJ 1WI8A 5F3ZA 4TU7A 2M5YA 2KG0A 2XGPA 2QFJA 1QM9A 2Q6BA 4P7VA 1IBKJ 1YIJS 3L4BC 5FLXU 1U26A 1YITS 1JNZB 2PSZA 1HQUB 5KFPA 2I9SA 2QA1A 4R5PB 5I3PA 4UY8T 4I7FA 4ZCKA 4M5LA 2AJ1A 4CTAB 2XM3A 4DQSA 4WU3A 2JH3A 3R5DA 3TR5A 1N6QB 1S1UA 1VDHA 4HVZA 2GMLA 4F3QA 5HI7A 4J37A 3T1HF 3GIJA 4JOUA 2OP5A 3QJPA 4J5OA 2N3LA 1LWEA 4URQU 3OHAA 3TOQA 4K50A 2QT7A 1AW0A 1HWLA 1FFGB 4ALZA 3CC4S 2DO4A 4WWSA 3OFHA 5KFFA 1SQGA 4KHRA 3QSIA 3S01A 3EZOA 4B17A 4XAKA 2YKOA 1F2GA 3Q8VA 2QMWA 3ISNC 5DO2A 5E3CA 4C8KA 2OPQB 4B3RF 2ZBIA 2FHOB 2MB0B 3DNCA 1KOHA 2YWFA 1SUQB 2V69A 2CQ4A 4AXJA 1ZA2B 2RU3A 5ADZA 4CI0B 3IRXA 3M8QA 3FQKA 3ETMA 2ZD1B 2ZE2A 2C2OB 3N0VA 3TNVA 4NLSA 1N54B 2B6AA 4C9DA 4DG1A 3OHBA 1GMWA 4OL8A 4NRUA 1Y00A 3ICLA 2Z2YB 3TA0A 3BDEA 3PW7A 3OTBA 1DARA 1MNEA 4PXCA 1ZH5A 1TL7A 3BQ0A 1IR2A 2QYCA 1KDNA 2DEIA 3MR7A 2WAQD 1X4EA 1S59A 1BY9A 1UA0A 5KFVA 4FF4A 2AIRB 2N4CA 1GEHA 2W4PA 4CLZA 4KQZA 4AQYJ 2HKEA 4LIRA 3PVXA 3EMTA 1RWWB 2POKA 2NQPA 2DNQA 1U25A 3NWGA 3T1YF 2ZHAA 3BGOP 3FFIA 2ZJRQ 2ZH2A 3V4IA 2DNNA 3Q24A 2DXDA 3W8GA 2V2ZA 4A48A 4FXDA 4DR6J 1X5SA 2X1BA 1DQAA 3H5YA 1VLYA 3TA1A 5HP1B 1OS5A 1W25A 3KLHA 3QRRA 1S57A 3NBPA 2UU9F 3PX0A 1TKXA 1NK6A 4K4ZA 3A3NB 4ZIVA 3FDSA 1VIXA 1RAHB 3CCJS 5DZ7A 5THWA 4C98A 3VAKA 5IT4A 4DF8A 2FJDB 4MMOA 2FVCA 3LA0A 2L9DA 4NEYA 2HMIB 2ZITA 2YQ1A 1EQ0A 4WXWA 4DV0J 3ENAA 4NZ0A 1TP7A 4K59A 3N79A 3KLIB 1KTVA 3J7ZT 2EG1A 1S77D 1N32F 4X4UA 2HYIB 2OH2A 3EWGA 3QFWA 2VDHA 4GKJF 1VRUA 1Y3JA 2EXUA 4PR6A 4LBHA 5KTQA 2ZH6A 2K3IA 4F8RA 1JMTA 1RAFB 4DUYJ 1JLAB 2PGCA 1E6YB 2YNHA 1WDTA 3OVSA 4I68A 1R8HA 3G9CA 2CADA 3K5MA 4X4OA 2HQCA 3PFOA 3D68A 4UW2A 3RRGA 4ECXA 3D5MA 1HHSA 3C3LA 4CM2A 3W3SA 4YB7A 1S79A 1Y9OA 2WVFA 2KM8C 3DI6B 4RW7B 5E7OB 3MFHA 2B5JB 1EP4B 1GMWD 2WOMA 2BDPA 2QE5A 3MUMP 4KH0B 5DDPC 2ROPA 4UF4A 1RXOB 1CC7A 4NYPA 1S9GB 1CLFA 4QWCA 3QBCA 3AOCA 2X1FA 1HWIA 3LWLA 2BMBA 3HULA 1HMVA 5BYSA 2ZC3A 4AFFA 4CYUB 2JC1A 2HGMA 1PYTA 2I5JA 3LALA 2EC2A 2IA0A 1RTJB 3RR8A 1LW0A 3W9IA 3SEOA 3KK1B 4DLGA 1KFSA 3JTNA 2QN6B 2XMKA 1QAXA 4LR9A 1S99A 5ETMA 2L48A 4KRWA 2K1RB 1HNIA 1HNZF 2L3MA 4I0WA 3MCSA 3ENVA 1RKIA 4MIWA 1QE1B 5HROB 5IWAJ 4DV2J 5A0YA 4GKKJ 2IM3A 4C8OA 4X66F 4TQRA 2V9WA 2YNIA 2YWGA 3FBBA 2O67A 3BGUA 4ECTA 2KT5A 4KC5A 2HHPA 1FFWB 1Y0HA 2DIUA 4W92B 5C25A 2FY8A 4RZRA 2V0NA 2R8KA 4DV5J 1BQMB 4LF5F 2ADBA 5EN1A 2GMJA 4WKRA 5D4OA 3SYZA 1U6ZA 2KG1A 4JV2A 5F8IA 3MR5A 2AJ4A 5A8RA 1U1QA 3PYGA 4UUWA 3P49B 4RWXA 2ILYA 2BJ7A 1VGYA 1HBOB 1R43A 5DM7Q 1U02A 4E2FB 1NZ8A 3MPDA 2FJVA 3LH2S 1UJ4A 4V1Ak 2KXNB 1HBMB 1P27B 5LMUF 4D3HA 3RAMA 3ILLA 3OR2B 4NZ7A 1X4AA 1DTTA 1QSSA 2HFVA 3NMRA 1Y7PA 2HHSA 1YRUA 3D6TB 5FDLB 2XMMA 1X4FA 2EFPA 2VG7A 3KJVA 2RE1A 3M30B 1KVIA 1QY7A 4ICLB 4OI0A 4Q8FA 2G4BA 4X65J 3JB9k 2KM8B 3F73A 4P73A 3C14B 2DY9A 3FRYA 3EYZA 4OZJA 3W63A 3PHTA 1GX5A 2YNGA 4DPYA 1SKWA 2GZOA 3MEGA 2WB4A 3HSGA 1S6QB 1U45A 2HFNA 3DKDA 4DV1F 5AXLA 4V19J 1M5KC 2YWHA 3DRRB 4ZCIA 1A7GE 1MG7A 4DU8A 4I2QB 3HVRA 2RNEA 3PW5A 5IT9Y 1F5AA 4RNMA 3LTOA 1RJJA 3HP6A 4ZPCA 2W2NP 3U02A 3HKZD 1I94F 2HHHJ 2B8QA 1SKUB 4OZ2A 2XCAA 4WJBA 1K0VA 5K5MA 3SV3A 3HHEA 4KHPF 2D74B 3KK3A 1LW2B 3CE8A 5KAKA 4FZVA 1KN6A 1FI4A 1FD2A 4X4RA 3DHXA 2BJDA 2JVOA 3NXZA 3V81A 2LDYA 4PWUA 2W9AA 2NSCA 4IOBA 3IBWA 2YWKA 2EKYA 2Z56B 1TKTA 2QRRA 1CJUB 2ZZNA 2HHUA 3N6LA 4B9LA 1RZMA 3FVYA 1FJEB 2EEYA 4RR5A 4NL5A 4F25A 1MSWD 3DU5A 3NOCA 2H48B 1IJEB 1NM2A 1RACB 3GFXA 4P2MA 2W7AA 3ZNUA 3HF5A 3PXGa 3W66A 1TV6A 4W90B 4AE5A 1S9FA 3Q8YA 2CA9A 2BRKA 4FYWB 2BX6A 1CULB 5J2PA 1CJKB 1RTDA 3G96A 4ID5B 3RG6A 3CDBA 4NA1A 3LP0B 3UPFA 5A8KB 4TY8A 4AL5A 2BM1A 2VPXB 3D6MB 2EBGA 3GONA 4OHWA 2KXFA 2P2CB 3C15B 4RX6A 2R2UA 3C19A 3FBEA 3OSPA 2BR0A 1IR1A 1XNRJ 2Y3YA 2DNGA 3AOBA 2JVRA 2UXBF 5K14B 4LRAA 4ECUA 1XR5A 3MAHA 4RO0A 1M5HA 4RW9B 2BBEA 2CIMA 5DLFA 4LJMA 3FBCA 1YZ6A 2E44A 2HK3A 3CCZA 3CD0A 1HARA 4O4RA 2DNLA 1N8RT 5HJYA 3SV4A 3CD5A 4J9SA 1S1XA 4UQGA 5MAOA 5KG4A 4EBCA 1R6VA 3ET6A 1TL3B 3IO1A 4ZVRB 2HQIA 3IN5A 2RS2A 4C97A 3CUNA 2X3DA 1Q53A 4RNFA 4O3RA 2ACMA 1KS2A 2DKOB 3J7YU 3NOGA 2YNFA 5D8HB 4IH6A 4DXLA 1KHVA 2E66A 4FYDA 3MM8A 4QR1A 2HS4A 4R8UB 3C66A 3UD4P 4LFBF 2BZ2A 2QLXA 3G8TA 4CO1A 2MPUA 3DXSX 4CT9A 1TKZB 3HI9A 3Q8PB 1NSKL 4KV8A 1EETB 2WSEC 2VG5A 2Z4PA 1TK8A 3OQ2A 4PYAA 3CD6S 5BXIA 4CLPA 4DL5A 3HMJG 5E41A 2GVZA 1VQLS 3DRXA 2RQCA 3C6UA 1GX6A 3W2VB 4C48A 1AUSL 3PR5B 3BSOA 1SPBP 1FE4A 4DCJB 3CJQA 4CLWA 4KPCA 2UVVA 2HRUA 4RBVA 2LXUA 3DFEA 1VK3A 4OZ3A 2N82B 2FB0A 3CXCR 3VAIA 1QD1A 2HVIA 1EKRA 2MZTA 5DG8A 2GS8A 2YY3A 2C2RA 4NMLA 1FDAA 3J7YI 2VQEJ 2HG4A 4LSNA 3UN5A 3UE2A 2NUUG 3D67A 1PAUB 3H4BA 1X4DA 1K0TA 1WC0A 2R7TA 3H5SA 1ZM2A 2RAQA 4DUTA 1N0UA 2VKRA 1T9YA 1HMVB 3OJSA 2OI2A 3MPVA 1RHMB 4LF7J 1JLQA 3GSIA 1NHUA 1RT4A 4FNHA 4LVNP 3RBDA 1KLMB 2RQMA 5B09A 4NCGB 3HO1A 1C1BA 3ZZOA 3T6BA 1R0AA 3J7AN 4FVCA 3JSMA 2W9BA 1R3NA 2DGSA 3IAS9 3WQPA 5ETKA 4L74A 2V8GA 2E1MC 1MU2A 3DN9A 2XYGB 1PYOB 3H0PA 1M0SA 4DUZJ 3HFZB 1RT3A 4X4SA 1UETA 2DH9A 1HD0A 3G86A 3G71S 3E8OA 1EZZB 3P5BP 3M1VB 3V6DA 4TU9A 3AA8A 2I1RA 3JYTB 4OI2A 3TJ8A 1RT1A 2GGPB 1J5OA 4C8LA 4R25A 4IRKA 4FYVB 2QL7B 2HBYB 3V6HA 2OO4A 4G1QB 2HNDB 2QSWA 2OTLS 1AZSA 1NJXA 2MZQA 4DL6A 1S0OA 4IOAQ 3M2UA 4USHA 1IKYA 1G3OA 3OUYA 3O2IA 2EFOA 4OV6A 1T94A 3MEEB 5IV3A 3DLLQ 2HW3A 1FEHA 2LECA 2VDIA 2VB6A 4M95A 4QZVB 4DUYF 5IXUA 2ILZA 2IVMA 1JXLA 3WHIA 2RDJA 1B70B 4WTYA 2R2RA 3MM9B 4RUAA 3IA0A 4ZPTR 1XEZA 1N88A 4MFBA 3PACA 1Q5VA 3MMBB 1E6VB 1M1KT 2DH7A 3TAMB 2GO9A 5GVQA 4FYYB 4JBCA 3T5JA 5CYJA 3BYPA 2Y0BB 4ELVA 4MAKA 1SJRA 2FTRA 3M8PA 4K4XA 1UPMB 2CG4A 1TFYA 3K57A 1SL0A 3BKTA 1W26A 3SQGA 2AV5A 4IFYA 3M6UA 4USTA 2CKWA 3J81Y 1TAQA 2XHWA 2F40A 2QA2A 3TEHB 3W5XA 3OTCA 3LWMA 2DPIA 2CQIA 4OYWA 1N34J 3HZEA 1NK8A 3FCWA 1JLCA 4ZOSA 4ZPBA 4URGA 3OTDA 2I8EA 1NKEA 2EC0A 2JHEA 3SMZA 3LP1B 2Q43A 5E3AA 4DSIA 7AT1B 3IC1A 5AXMA 1GH8A 4ZPWR 4U8YA 3DGPA 3PDNA 1TL5A 1U2CA 2XGQA 4DV3J 2KTQA 3VZIA 1FJGJ 1JKHA 3R3TA 3MAAA 6FD1A 2OELA 1U1KA 3DC2A 2E5HA 2WVCA 2WRMA 1L3VA 3M6WA 4ANCA 3DMJA 1DTQB 2ZH1A 5IM0A 4LVOP 1RADB 1HHQA 3F44A 2CNOB 2IA6A 4WE1B 2J9DA 3EGWB 2OPSA 3ILIA 2LQ8A 1XMBA 3KJNB 2U1AA 5E3QA 2Y1JA 2FZKB 4HDHA 4P2SA 5IWAF 3BQ1A 4E0DA 4DV2F 2DYAA 2C2MB 4CH0S 4CLSA 2IJNA 2E1AA 1R6YA 2DHXA 3UW1A 5C7PA 3NEKA 4WBFA 4F4YA 1NMEB 1TKDA 3DRSA 4LF6F 1H0HB 2WCXA 3KK3B 4P10A 2K2PA 2IAJA 1LFWA 2J5AA 1YK9A 3U7JA 1SCJB 3DLJA 6FDRA 5F8GA 4BC9A 3SCKE 4NE9C 2V9KA 2V2KA 2Y9HA 2QFIA 3PZPA 4DN9A 1WWHA 3R5CA 3Q8UA 2SXLA 1QAJA 3SCIE 1B4SA 2IC3A 4RW6B 1CS4A 3TZYA 2LFVA 4ZK7M 4QWDA 2VZ9A 1C0TA 2KFZA 1Y10A 2QMUB 4DL4A 3JXOA 1ZYQA 2FUG9 2CQPA 3ENQA 4OJ3A 2WVDA 3MM5B 1NB2A 2HPUA 3D0IE 2DR8A 4WPAA 2OLWA 3M8SA 3IR7B 1OPIA 3NCPA 1T9UA 3LAMA 9RUBA 2KDOA 4PG8A 4KO0A 3H2LA 3HVWA 4OHYA 1UA1A 3PIOQ 1HFEL 2LVWA 3MOJB 4PCQA 1NK9A 3AY0A 2Y8YA 2JSXA 1H38A 3U1MA 3ZZZA 1SV5B 2C3OA 2X7IA 4U8VA 4CZCA 3T1AA 1PBUA 4ZJOA 3QT7A 2DNMA 4ZLJA 4XIUA 4DLEA 4ELTA 3B4DA 1R31A 1JNRB 1RT6A 2NCKL 2FLOA 2GAGC 2VC0A 2JFDA 1CSJA 2BE2A 2IM0A 4FXWA 2YKAA 3J80Y 2KB2A 3UCZP 1UP1A 3TI0A 1NXIA 1MN9A 1JLGA 1Q86T 2WTFA 1WC4A 1HWJA 3QLHA 2QZ8A 4X4TA 3NRBA 3BV8A 3TVZA 1WOOA 2UUTA 3UWTA 1RCXB 1S0NA 2B4PA 4X65F 2HQ3A 3CJRA 2HNZA 3KJQB 4ZP9A 3GV7B 4K4YA 2CPJA 4FF3A 3TZWA 2E7XA 5E33A 2RDIA 2XO7A 3ET6B 3C16A 1RTIB 2PMZD 1B0VA 3R27A 1YI2S 2Z30B 5GAEU 1N5SA 1C2PA 2QL9B 1DFDA 4DHVA 2ZH3A 1MLAA 2VBWA 3THTA 1HL6A 2NLWA 1KVKA 3BSAA 5HBMB 4HHUA 1FX4A 2Y8WA 1UW9A 4WFAQ 3N01A 3AD9C 1M1GA 3OR1A 2IM2A 3PYFA 3L09A 5KOXA 3A4TA 2MQ8A 3UI3A 2MKIA 2U2FA 1FK9A 2HHHF 3CPWR 3MM7B 3G87A 4FYXB 1X9WA 5HVFA 2PI5A 4ZVOB 4TYBA 4F50A 4Z37A 1FKOA 5SZTA 1HQ2A 3FRZA 1WHVA 1NRKA 3W9HA 3LP2B 5DQIA 4DR3J 3M8YA 4OYIA 3R2DJ 1S1WB 1RT7A 1OYEA 5GAEI 4C0BA 2L08A 1WEYA 3KMSA 1REVB 3JTPA 1SIWB 4WU2A 2DGOA 5LMNJ 1CC8A 1UWBA 4JUZA 4K4TA 2X1AA 1DURA 4NLDA 2XY6A 1N56A 4W4MA 1WF2A 2LMIA 3FZBA 2XLIA 4F67A 4IG3A 1Q8LA 3E2EA 5C42A 1HPZB 1N4LA 4K4VA 3EGVA 1JLQB 1EB0A 1CJVA 4ED0A 4NEZA 2Q3PA 1MW7A 1H98A 2X51A 4QIVA 2GIRA 2P9EA 3QATA 3M32A 4U6PA 1P9YA 3CCES 4OYOA 3IS9B 5B0GA 3FSXA 2XULA 5FJ4A 4X62F 4C11B 1X9MA 2IVFB 4NLOA 3V5RA 5A8WA 1XNRF 4ER8A 5DG7A 1MWYA 4ZJLA 3QFHA 1NUEA 1S12A 4ZVHA 1HYSB 1U48A 3WC0A 4H54A 3GG1A 2QA4G 4B3OA 1N33J 3GJRB 1HNWJ 2XMVA 2E5JA 1NHKL 1UFWA 2HZAA 3V6DB 3OV7A 5JMNA 3CCSS 4YUDA 1RT1B 2H65B 1LWFA 4AD6A 1AFIA 4DPUA 4HHHA 3OXLA 4HH0A 3DRPB 1RYSA 2VFVA 1AZSB 5ETRA 1HQEA 3IAM9 4PABA 2AU0A 4IYQA 2ASDA 3SSSA 4G1PA 4OHZA 2HHWA 5LSRA 3HVTB 5D3GA 2WHOA 5JUMA 2LA4A 1UKUA 4ECQA 5D77A 4LSLB 3P45B 2R2SA 2MY7A 4GVBB 3SZ2A 1VLOA 4IO1A 4NI2B 2OGUA 1WG4A 3N9UC 2O3DA 4Z7CA 3CJ3A 4NLRA 2J6TA 4DMZA 4HTJA 4B3MJ 3GJSB 3HJVA 3NP5A 5L9NA 4IOCQ 3RAQA 4NZ6A 4FF2A 4YR0A 4O3OA 1IR0A 4WTOB 2ATCB 2ZUGA 2CPYA 3TVYA 2PMHA 3M8PB 4DPTA 1AB8A 1YJ9S 1SC4B 1KRPA 3SDEA 3VAJA 1XTZA 2VBXA 3LO3A 4IFYB 3CDUA 4OHVA 2CDRB 4USJC 1X4BA 1BQNA 5KT2A 2BABA 2OPPB 2QMXA 2ROEA 2VQEF 2KO1A 3RBEA 5KT7A 1PIEA 3VAHA 1NH7A 5KFQA 1S10A 3PV8A 4F36A 3AD7C 1VCTA 1N5VA 2R42A 2AEJA 5CA5A 1IJFB 2FLNA 5J2MB 2D9PA 5GMDA 4DX7A 4Z7YA 2XHCA 1GMVA 2MLZA 1XN9A 4HT7A 3GSDA 2G0IA 4NMXA 5GMKa 4DQRA 2DR9A 4L73A 4X4PA 3LGHA 2MZSA 4LF7F 4RUBA 1F3VA 1QDUB 3R5BA 5IOLA 3ELHA 4XK8C 1L3UA 2HGNA 1FEEA 4OZNA 3C6TB 2AHOB 3I5BA 2J6UA 2QV6A 5MLCV 2J7WA 4M5JA 3R9LA 2RF2A 3C8YA 1YJRA 2CJAA 2AYBA 3NG8A 3CC7S 3DOKA 3DM2B 5L9XA 3A12A 5D0HA 4WFBQ 2KRBA 3FSIA 1FVSA 1FTCA 1KHWA 4DUZF 2L41A 2VIHA 5FD1A 3HSZA 4J7CA 2MGZA 3Q89A 1R0BG 1QAIA 2QYGA 3QAEA 2IHR1 2QC3A 1AA1B 1RLCL 3M8WA 4DBQA 3CULA 2QJ3A 4LSZB 4KGMA 5B0AA 4ETXA 3MMAB 3CC2S 3KLFA 2XLJA 1VQ5S 3I5AA 2C2DA 3CCTA 4Q7AA 3DLEA 5HANA 2GJ2A 4UZCA 3F41A 2HRTA 4O4GA 9ATCB 2EFGA 1PBAA 4N41A 1ZETA 5EX3A 1IKXA 5T41A 1NK0A 4DDFA 2J9EA 3EZUA 1RWPB 4DQQA 3RB0A 3GYGA 4IKAA 4D3GA 4DR4J 4WK1A 1NPRA 1FWLA 1SJ4P 2CYYA 3MOZA 2ZM6J 2M52A 2PD1A 4DQIA 4RW4B 2DO0A 1U1LA 1EQMA 1VC5A 3D0HE 4TLRA 3K8WA 1C1CA 1B0TA 4HACA 3J81U 2KU7A 1U6BA 3PEJA 4B9TA 5CH7B 1JX4A 4LBIA 3N6MA 1T02A 4KYZA 4OLPA 5KT5A 2G1HA 1U7LA 4CDIA 1RK8A 2N7CA 3L95X 3QT6A 1S72S 2HNYB 1WKJA 4LMZA 2Y1LB 4CLKA 1MWQA 2H9ZA 5IS2A 3CJKA 1JIHA 2XSJB 1NJZA 4PKDB 4NYZA 2EPIA 2EFNA 2JOQA 4ES2A 2YH0A 2YXLA 3JTOA 3PYDA 5DGBA 3GV5B 1V6HA 1BD6A 4DSKA 4ZCMA 5L1JA 1N34F 1R8CA 3T9NA 4H4MA 1IBLJ 1Q81T 4NX9A 4UUXA 3HT0A 2QEXS 2FVPA 3HFKA 1AYEA 1IVZA 4WYWA 2FIUA 4QQBA 4ANEA 2ZKUA 2KZMA 1V5VA 3FEZA 1D8YA 4R5PA 3ETOA 1IUJA 1TL1B 4CTAA 2MEWA 3K0JA 3OSNA 1GFWB 2IRXA 1N6QA 3CJTA 2CPZA 4EGLA 2MXYA 2UVUA 1RKJA 1X60A 2CQDA 1QVFR 1VHIA 1S4FA 3RRKA 4NLVA 4KGVB 4NLTA 5HMYA 1BWVA 1YKWA 1S1VA 2XSFA 3KMQA 4GO7X 1FCAA 2OHDA 2LEBA 3CDEA 2RT3A 5LT5A 2ZH7A 1WC5A 2D3ZA 1VQ6S 2HHXA 4IDKB 4DR1J 1XR7A 3HJFA 1RSCA 1RAEB 1VHFA 1W2BR 3NKYA 1PC4A 3HVAA 1KEKA 2Z2MA 2GV1A 3W9JA 3THPA 2OPQA 2PI4A 3J81j 3OVBA 4Y2KA 2AGOA 3TQ1A 4DSEA 1H73A 1SUQA 4K2XA 2F4VF 1YG0A 4YP3A 2EK1A 2M2BA 3MR3A 2HWHA 5DQHA 3TX0A 2JNJA 4UOFA 5CAAA 1YJTA 1HNXJ 2BQUA 4K4UA 5F8MA 3QAUA 3QSYB 4B3TJ 2XNQA 2DBBA 3BDPA 5LOQA 2AJ2A 1H72C 4KKOB 1J5EJ 1RT2B 4QCLA 5A6WA 3TWZA 1FNMA 1XWLA 3SIPB 1T8EA 2K7JA 3KKFA 3CMES 2OFHX 2W7PA 4K5SA 5D0EA 4OZ1A 4JI3J 4IUFA 5BR8J 1YHQS 1T3OA 1Y4ZB 2E5LJ 5IC4B 2CJXB 3N4WA 2R8IA 2J0XA 3ZNJ1 1Z2ZA 3DU6A 3CMQA 2DVIA 1D9FA 4X84A 2WW8A 4Y28C 4P2XA 4CT8A 5F9LA 3NS5A 2CPFA 4CO5A 1O5JA 1B3TA 1CEZA 4X4QA 2AX0A 3LGMA 1WC1A 1SJ3P 3MPWA 4QW9A 4NXMJ 3D2WA 1FNXH 5I4MA 4PYDA 3GFZA 5HP1A 1DHMA 1CVJA 1FF2A 2BOAA 2HVZA 2R7UA 4EZ9A 3D28A 1KBRA 1OSDA 4ECYA 4EO6A 5CCLA 1IBCB 5A8WB 4C4WA 4JYAJ 1ZAWA 3GTYX 3M05A 4IR1A 2HFUA 4FKXA 3EPGA 4U67Q 1FDNA 4DN0A 3GP9A 2VOPA 3UN2A 4RU9A 1RISA 4TU8A 3SCJE 3LUYA 3ZTSA 1G1XA 2W8KA 4ED4A 2CAJA 2HMIA 1XMOF 1OYDA 3AH6A 1N5YB 4F2RA 1APSA 3W1YC 1T03B 3FEXB 2NZCA 3KLIA 4NLGA 1RB0A 1Q5YA 2EKNA 3GQCA 2O1PA 4M5MA 3Q8RB 3PJXA 3RYLA 4ATNA 2C3UA 1PC5A 4IG0B 4J9MA 3O3LA 1JLAA 2CPXA 4TQSA 1DBDA 1E6YA 1IXKA 4C3MA 3VGSA 2J0QD 3SCLE 3FC9A 1JJHA 1TUWA 3TX8A 2VBYA 3D1HA 2KHDA 5K9FA 4U7CA 1VK8A 3VHQA 2VA2A 1YTYA 3W8PA 1OIAA 1PG5B 4ZVUB 1WF1A 1ZA1B 2HHQA 2LXFA 1RE1B 2HS0A 4O44B 1KOOA 3FMWA 1W7WA 3D4JA 2PO4A 1WSRA 3DI6A 4RW7A 1REGX 3PX4A 2XZDB 2B5JA 2XQCA 1EP4A 2CXEA 3NL0A 3HT3A 3I9ZA 4PEOA 1KQSR 5LMNF 1S9GA 1A0OB 4XDCA 1BUXA 4M5DB 1JXVA 2F3JA 1X5OA 2QLJB 2DTJA 4Q8EA 5HK4A 1Q7YT 4LRDA 1HHTP 1A6LA 4DQPA 4CYUA 4TN2A 1FWKA 3CWJA 1SJQA 3LOUA 4PWDB 1N52B 3BPDA 2P5VA 1VRTB 3DDKA 3UQSA 4QYZJ 4USKA 3KK1A 1N5TA 1EAYC 2YX1A 5J1PA 5EDWA 1EIYB 2BE7D 4ZVSB 3TUIC 4UQTA 1X4HA 2HWTA 1K9MT 3K5NA 5HROA 1QE1A 4PAAA 2KFNA 1XMQJ 2E5IA 3E3XA 2ZBCA 1R27B 1QTMA 4ZVEA 3K17A 1ZTWA 2F4FA 2Y1RI 5KFSA 2PA8D 1N33F 1NDCA 1YJVA 1HNWF 2P8IA 3AA9A 4TY9A 2M8DB 2AKWB 1FX2A 3PYEA 1VQMS 5HVHA 1XIQA 1Q95G 5AJ3J 2F7VA 5DDQC 2FHMA 1VC0A 1NCLA 2MTLA 3N5BA 4DR2J 1LEOA 3KG1A 3I4HX 2H5IB 2K8GA 3I0SB 1BQMA 5LXRA 3TA2A 1CQNA 3GPAA 5GAGU 3M6VA 3PIPQ 4P52A 1ROFA 1AROP 3CO9A 4QWAA 3NCRA 1RQ0A 1U4BA 3FQLA 2E7VA 2JL9A 2CJ9A 2FD2A 4OIXA 2G2ZA 3KHLA 1D8ZA 1VQKS 2DB1A 2LYVA 2A2DA 3PTWA 1Y3KA 2ERRA 4A8SA 2B9EA 4JV1A 1HBOA 3T6JA 4I56A 4BWMA 1VBKA 5I3UB 4DPWA 4B3MF 3FJ2A 3K89A 2NUHA 4J9RA 1HBMA 2HIQA 1Q0NA 4N56A 5A2QU 3SI8A 1Y5LB 4GMKA 2HBQB 3GYNA 3OR2A 3C2PA 2CQ2A 2AWZA 2R8JA 2HEKA 4MYTA 1WKKA 3SSQA 4CIOA 5FDLA 1KTQA 1HR0J 1F5CA 3GB0A 3M30A 5GAGI 2D9OA 1SC1B 4DR7J 4ICLA 2N7YA 4NXNJ 4H4MB 4OI6A 3KWMA 3WC2A 3C14A 4TKTA 3MAQA 4FN5A 3BR8A 2OIHA 2ZH9A 4LREA 4Q43A 1YJ7A 3P96A 4KIAA 4ILLA 1ITPA 1K44A 1S6QA 3T5LA 1VFJA 4HTIA 2XZWA 3H8YA 3HX9A 4C0HA 1IN0A 2ZHBA 1RHQB 3HLUA 2O66A 3DRRA 1OY9A 4DCPB 2AEMA 2DITA 1S1VB 4I2QA 3O44A 1NSAA 3ILJA 2E9ZA 3PCOB 3TVKA 3R6GB 2LA6A 3D3BJ 3PO5A 2ZWPA 2L9WA 5ETOA 2C42A 1VBZA 4DSFA 3CD7A 3DDIA 1YJWS 2V50A 2I38A 5T7LA 2O01C 3I32A 1KVJA 2K3KA 3OXGA 2YQ3A 3UDVA 2RUSA 3KK2B 4A8KA 1LW2A 2HAFA 5HMXA 2XCPA 3ZZ0A 4FXVA 4CLLA 5K8OA 4NRTA 1F1BB 1ZM9A 2VL1A 5ETVA 4ZPVR 1UFLA 1QSYA 1UVKA 2AW0A 4KE5A 3RU0A 4JI8J 3BB5A 5GADU 3VGUA 1UVLA 3DLGB 2VC1A 3OTOJ 4AL6A 2JRSA 1MROB 1CJUA 5HO4A 4GO5X 2VPZB 2VG6B 3OFEA 1K73T 2VD3A 5D4LA 3R5GA 3QRQA 2B4VA 4DR4F 2OUGA 4RNOA 3EGNA 5F9NA 2RKIB 2VODA 3CVKA 2WSFC 3VR1A 4HDGA 5DM6Q 3Q83A 2ZUAA 4XPEA 3TW0A 4PQUB 2DCUB 4AXIA 2FJBB 1YBUA 1CULA 5F3TA 1CJKA 4N8NA 4LF4J 4IR9A 4ID5A 4O0NA 2R3VA 4JV5J 3LP0A 4G65A 4J91A 5A8KA 4DSLA 4PG7A 1U1OA 2ZFHA 4L3KA 3MZIA 4H4KA 5CZVA 3C15A 2KYZA 2CQGA 1RWOB 2GC8A 4DX5A 2R7XA 1XERA 3CO0P 1ZAVA 3E51A 4EK2A 2G0CA 5KT6A 3W60A 2UV8G 5K14A 4F04B 4LQ3A 3BQ2A 4WYLA 3CSKA 4LF9F 3PHEA 2G9OA 4RW9A 2HLUA 3SFGA 3US5A 2HAIA 5G0RB 1OQ3A 1IBLF 3P5TL 4EEYA 2KYXA 2P6TA 2B4OA 2OMOA 4F3OA 4ZMMA 3THVA 2BUNA 1Q8KA 2UUCF 4DR5J 1QUPA 1S1TB 3H59A 3T1HJ 3AJ1A 1IWAA 1UEKA 3KLEB 3DXBA 3O6QA 1TL3A 1GT8A 3P8BB 2MKJA 1X5PA 4EYIB 3HHDA 5B0FA 4P71A 3BREA 3WX4A 5D78A 2QSFA 1VS3A 4C8YA 2F65A 4R8UA 3H2UB 2Z0GA 4PRFA 2OSRA 3A13A 4NLQA 1O6XA 3BBBA 3PW2A 3OL9A 3ZTQA 1FRLA 3H4DA 3MEKA 4QIGA 3ITHB 1TKZA 4DR1F 2UUAJ 2QG9B 1EETA 1BC6A 2V94A 3Q23A 1RTZA 2B7BB 3GCXP 4M94A 1GK8A 1O8BA 3Q8SB 5B0DA 3W2VA 5GMEA 1S9EB 2QL5B 2HHTA 1F9FA 2VH7A 3FCVA 3R7SB 2DNZA 3I56S 4ZA1A 3VWSA 3NGSA 4JI6J 2RUGA 2PDAA 2M8HA 4KY3A 3VZHA 1KKHA 4IRDA 4USIA 2FVQA 3KXDA 5F0UA 3TUJC 3MCNA 2YWWA 4DEZA 2ASJA 4M63A 5KG1A 2WZ1A 2IPOB 2JX2A 4WP3A 1U24A 2MJNA 1J5EF 2Z8QA 4KT0C 4KPYA 1HD1A 2BYCA 4QOTA 2ZH4A 4M8LA 3T1YJ 4KB7A 3RB6A 3W7BA 5IQQA 4JI3F 4QYRA 3D6FB 1XQIA 2E5LF 2R9LA 3ZFVA 4QU6A 1FJ7A 1L3KA 1L5UA 5KFNA 2ZKTA 4EMDA 1YWXA 2HRYA 4A8OA 2B9YA 1KLMA 2R8GA 1AUDA 2JEIA 5F0WA 4NCGA 1IKWB 1ZM3A 2V2VA 4WXOA 4U7UK 3EPIA 4RL1A 3T41A 4URSA 1JXEA 3D1OA 2V8HA 3GE9A 1ZZFA 4RBTA 2XO6A 3NWRA 3AB4B 2IM1A 4M5HA 1SQFA 2NXNA 1PO6A 2CWXA 4M5IA 4B9NA 3A3OB 3NS7B 3ZZUA 4PPDA 1ZM4A 2HVHA 3QGGA 2BJ9A 1WEZA 4JYAF 3M1VA 3B6BA 2RILA 3M2VB 3JYTA 2GGPA 2XC9A 1TQLA 5H1SV 3OLAA 3HFVA 1PYSB 4NLWA 3MR2A 4EYHB 1N32J 4G1QA 2HNDA 1ICEB 4Y3CA 2B7CB 2WONB 2AX1A 3UNYA 1MWZA 4MIBA 4OLOA 2YKMB 3FCHA 3A8IA 4DJBA 3MEEA 4ZVTB 4PUOB 3DLHA 2KXHA 3ZZTA 5CQGA 4JI0J 3RTVA 2DRBA 2DRAA 2VONA 1YSJA 4YMEA 4DX6A 4JI1J 2NSBA 2XLKA 4DPXA 2CJYB 4ETZA 2X1GA 1UEUA 1GMUA 3MM9A 2FZCB 3K5OA 2WSCC 4K0KF 2DHSA 2BRLA 4H4KC 3MMBA 1E6VA 3TAMA 1K1SA 3OFFA 4LRBA 4RJVA 3TAPA 4ZJQA 3TZXA 3IGVA 2AJ0A 3BBCA 4DX8H 5H9EK 1QTNB 2VHGA 1UPPA 2ZDOA 1H2VZ 1S5ZA 2WB1D 3JAMY 1HA1A 2FY1A 4A46A 3BPSP 2UXCJ 2GQCA 1SB6A 4A8QA 1SQEA 2J0SD 2ZJQQ 2HQDA 2CUYA 1BWEA 1OJ4A 1DLOB 3BO4A 4Y0FA 1WDDA 1RAAB 2CPDA 3CJ2A 3LP1A 2MKYA 2HZVA 3F56A 3ZC4A 2H4WB 3O1LA 3A8JA 3KDNA 4CWBA 3OTEA 1S6PB 1X7VA 3VF0B 1URRA 1B64A 4QIWD 1S6UA 3UFCX 2DNOA 3BGRB 2VJUA 4CO0A 4P6QA 3D54A 3LW5C 3WX8A 4OZ5A 1RBOB 2MQLA 1UVIA 4NOHA 2FVSA 1HNZJ 2HQGA 4L6V3 4KJIA 3DOLB 1XNQJ 3DYAB 2OFGX 2GX8A 1I1GA 3BKFA 2MMYA 2GCFA 1DTQA 4Y6IA 2G0JA 1NK7A 2R8HA 3SQOP 4WE1A 3KHHA 5HSPA 1RWVB 2WW4A 3VGVA 3GMGA 1MN7A 4EBDA 5EX0A 2EVZA 4U96A 3MD1A 1QJHA 2HWIA 3GIIA 1JLBB 1DRZA 4FDFA 5L8RC 5T7LB 2HBRB 1SJ1A 4EFAC 1GTHA 3PM9A 3TUPA 1NO8A 3NGUA 2VICA 2V4JB 1N48A 5AJ3F 1CJTA 2DD8S 1G6BA 3ILOA 3IG1B 3BS9A 3NNAA 4NCBA 4I1TA 2B3TB 3M2RB 1W2IA 3UR0A 2WBRA 3DOMB 3GJQB 4J9OA 5KG6A 4RW6A 3AJDA 4WK3A 4LF8F 3BF4A 1WELA 5DDRC 4DS4A 3BN4A 4ZHRB 2CZVC 4K4WA 3TUZC 3J7A1 3MM5A 3BZQA 3NAHA 5HAOA 3HHKA 2W2MP 4DL0C 3LQVA 5LMUJ 3ULHA 3V2UC 2UV8A 1RBLA 2HGLA 4K8RA 4P7TA 3CCVS 4UOCA 1RU2A 2C2ZB 1SV5A 4Y34A 1Q78A 3EXCX 5KG5A 1UZDA 4Y2CA 1K8AT 3LPEA 3QZ8A 4OJGA 3RR7A 2C3YA 2CQCA 3B82A 2H54B 3EDRB 1RWUA 1ZPVA 3MECB 4YB6A 4YOEA 4DL3A 1PJ5A 5J2QB 4DZ6A 2D69A 5C24B 2H51B 1RTHB 1NK5A 1D1UA 3GJTB 3BYRA 5BYQA 2MYFA 2MKSA 1U2RA 2WBMA 3G6VA 2FVRA 3R5AA 1IBKF 2PFFB 5I3QA 5J1NA 5GAHU 4RWWA 3VAFA 1C0UB 4YQWA 3QO9B 5KFIA 3VV2B 3OLBA 4WP8A 1CBKA 1RP5A 2W01A 1AT1B 2KI2A 4UOHA 2Q1LA 1RTIA 1PGZA 2YKQA 5JXSA 2CPEA 2V8PA 3TJAA 4G1IA 3AXMA 4ZP7A 4UZBA 4QW8A 1ZBTA 3FUYA 2ZBRA 5HBMA 1SKRA 2B4UA 1VR6A 3PRBA 2A6MA 2R7RA 3T19A 4E8UA 1U47A 2DR7A 2FC8A 3OD2A 5KFAA 3UD5A 1G2EA 1FRIA 4OI3A 5C5JA 1VMBA 1F3FA 1CQMA 3MM7A 1TK5A 5KFBA 3MUTP 2NXEA 4DOZA 3RAXA 5GAHI 1LQ9A 4MK7A 2V63A 5KFZA 4RNNA 3EJMA 2YKNB 1JLEB 2Y0SD 3LP2A 3AOAA 5D0RA 2KZZA 4LF2A 1S1WA 4JI8F 1T9WA 2KT2A 1I6JA 1REVA 1NNDA 3CJ0A 2YPZA 3TZZA 2F8MA 5HLFB 3OTOF 5EWEA 4QIEA 1ZZNA 3HHNB 5LL6d 1HBNB 2AYMA 2JLGA 5B0CA 1UEVA 5H9FJ 2IRYA 4Z2XA 4F3MA 2W9CB 3HD1A 3G82B 2RJZA 3S8SA 1LKZA 3VQSA 4AQYF 1HPZA 2ASYA 2IVYA 2D3UA 3OBIA 2ADCA 1RHRB 4ZIWA 2FQQB 3CCWA 1FERA 4P75A 2HHVA 2BM0A 4ZLPA 2FPHX 5C2CA 2DEJA 2FLLA 3IS9A 4FPRA 1Z1ZA 4Y2MA 4JV5F 2IRUA 3GR0A 4LIWA 2FJEB 1NDPA 4DR6F 2CQHA 4ZN1A 2GIQA 2DJWA 4W98A 2VASA 2AT1B 4C11A 1SIZA 1YRTA 2B56A 3HCXA 2KT3A 5L1IA 5CYMB 1LXNA 2MQNA 4OFZA 1LWXA 1HYSA 2M4MA 1WORA 3RJMB 2V4QA 5LM7E 1U1MA 4I69A 3NNHA 1P1TA 2ZOFA 2XI2A 3CEDA 2DCLA 3MHYA 4DR5F 2UVWA 2XNRA 1A9NB 1FXLA 2VFRA 2UP1A 2BW7A 3CCQS 2VUGA 5D6GA 3DRPA 4OZLA 2YQ0A 3P3DA 2PT0A 4LFBJ 1RWNB 1TL4A 4LRFA 4DV0F 5DETA 1WOPA 1R7IA 4RW8B 3HVTA 1YLXA 2VKZG 2PMWA 4LSLA 2I0XA 2RQ4A 2H4YB 3EE3A 1VQSA 1D0EA 4GVBA 4YR3A 3TJ9A 4RUCA 1S4EA 4NI2A 3I0RB 1FRMA 2A18A 5B7WA 2LU2A 2UUAF 1Q1KA 5KT4A 4LFCJ 4PPZA 4J90A 4DFMA 2XY7A 4LR8A 3LGNA 1JJCB 2BXJA 3X1LB 4ZLLA 2DGWA 3DLBA 3PFEA 3TYTA 4Q0BB 2JWNA 4NLPA 3KLVA 1GXUA 4JI6F 2YTCA 4YHHJ 4FKYA 2KJVA 1VJQA 2QTWA 2FJXA 1OSCA 2J7UA 3IR6B 2OPPA 3PNIA 1ELOA 1JLFA 3W65A 2A10A 2MZ1A 1B7YB 4DWIA 2QGFB 1KFDA 2JEGA 2F9DA 1O51A 4F0MA 4LFAJ 5J2MA 1NBEB 4ITSA 3QT5A 2LKZA 4ZP6A 2N4DA 3MM6B 1SH2A 3SFUA 3CIMA 1UL3A 4GVLA 1Q4RA 1X0PA 1KSPA 3GILA 3W64A 4BC7A 3U27A 1BGXT 2VBZA 3HHLD 3QT8A 2YVSA 4YFUA 1RT5B 5CYQB 3HSJA 2CNLB 4RLEA 2AJFE 3C6TA 1UWAA 3JQJA 2BKNA 1TUVA 4OJ1A 4J9LA 3MEDB 1LWCB 5KG2A 3BO2A 2W4CA 3AQOA 3OXFA 3DM2A 4O3NA 3K8VA 1VJWA 4K7QA 1ZS6A 4H4OB 5T14A 4I4BA 5AE3A 1HI0P 4A47A 2ZNYA 2PIIA 2NPIA 1PJ6A 4X64J 1S6OA 1RI7A 4GKKF 3P4UB 1T0TV 2XEXA 2DHGA 2ZOGA 5ITHA 4EZ6A 1SKSA 1DQ9A 3ZTPA 2E1PA 3MMAA 3M7VA 5IV4A 1JJ4A 3CJ8A 2JLFA 4ILRA 3AODA 3T9ZA 1HNVB 2OTJS 4JI2J 4TLQA 5ETQA 2XMUA 1CJTB 1RU1A 1U1RA 2EW9A 2Z2LA 1IKVB 5F8LA 1VQYA 2COLA 3ISZA 2OEKA 1SC3B 3PY8A 1WUUA 3W2WB 1FJCA 1GTEA 2E7WA 3VVUA 4DV5F 3HHLC 4ZKAA 4TNOA 2J9DE 3MCOA 4I2PB 3H98A 4L76A 4RW4A 1KWMA 4JI0F 3A1YG 4KFBB 3JAMU 4QIFA 2F63A 4JI1F 3FKBA 2J0WA 1YBAA 3CCRS 1P8GA 4MIAA 3IXQA 1NJYA 1OQ6A 1I3OB 2CZ4A 5KFUA 2HNYA 4YB1P 2CWKA 4RNHA 4AUKA 3K58A 3T5HA 4ZLNA 2XSJA 3H5UA 1ZTTA 4N5SA 2DR6A 3POTB 3N28A 2RRBA 4I6WA 2UXCF 2RRAA 3MPYA 4HI1A 3CB4A 4PG6A 3FBFA 1LOUA 5ETTA 2VF3A 4F4ZA 4OYPA 3CJSA 2DGQA 3BGLA 2P9GA 3FEYB 1WSVA 5CD4H 2M9KA 2RVJA 1FD8A 4WFYA 1Z4UA 1TR0A 2NYHA 4Y2AA 1NK4A 4ES3A 4YDDB 2J7KA 1Q8IA 2LQ5A 4DCOB 3EDQB 3M9OB 2MY8A 4BBYA 5IT9U 2F5GA 1TL1A 1U1NA 1T9XA 3OW2R 3OVAA 2XS5A 4B02A 5HATA 4DU7A 4QYZK 2MZRA 1N36J 2RIJA 2GAHC 4U7UD 2XG8A 4F4XA 1XNQF 1T9TA 4FS2A 4UTGA 5E5NA 4B3SJ 3GWCA 2BA9A 3RB3A 2MHNA 3AT1B 1WG1A 3D1QA 4C8MA 1K1QA 2W2OP 4Q45A 2M88A 4IDKA 3NCQA 2BEFA 4DFPA 2QO3A 3QJJA 4J9UE 4YS2A 3M8ZA 3GFYA 4N47A 4LF6J 3VVTA 3NLCA 3UVJA 3P6YC 3MURP 3LAKA 2DH8A 1VQPS 1H7XA 3L7OA 5I42B 3QIPB 2AZ3A 4OI1A 4DFJA 2P6SA 4ED2A 4J9PA 4MT1A 3IM8A 5H9EJ 2F8EX 2K7KA 1F5BA 1EHWA 2FDNA 1SBRA 1KC8T 5K8MA 4I6YA 3MTJA 5J1EB 2EK6A 4LUBA 4EWTA 3H7HB 4OQJA 2CNKB 3CW2C 3MGJA 4KKOA 1X4CA 1RT2A 5CABA 3I96A 2V67A 5KFRA 3KDOA 1WG5A 4OZ0A 3PKYA 2J76E 2IYIA 2EWHA 2H5JB 4ED5A 2GJIA 2BQ3A 4NLXA 4R0EA 4MYUA 1X8DA 2HBZB 3TRGA 1QSLA 1R0CB 3Q86A 1L3TA 3HHLB 3MMCB 1YGYA 4RU2A 4ZVQB 5JVHQ 4Q2LA 2GA7A 5J2NB 3DLKB 1FRXA 4IFVB 4IQMA 1FKPB 2FHKA 4BCAA 4JB8B 2V4RA 2AEFA 2B43A 2ZOMA 5EGYA 4KGKA 4DV4J 4K5RA 4GRSA 3K59A 3PX6A 1SVDA 1WTBA 3UCUP 2FHJA 4R0JA 4JI4J 5AE2A 1P9QC 4UOGA 5K8NA 2AGQA 2OEMA 2DIVA 2G13A 4QWBA 4CLFA 2OMLA 3KOAA 2PFDA 7FD1A 4ECZA 4I7FB 1JQGA 3ONQA 3HKWA 3QWPA 2MQMA 4USWA 1S1UB 3NMAA 1N5YA 3IBCB 5DGAA 1T03A 2XWXA 4K2JA 4S0MA 3TANA 1U09A 5JVGQ 2RSQA 2JEJA 1LWEB 3IR5B 3ADAC 3B78A 2FZGB 4OX9J 2F9JA 5CD4A 2D1CA 1RABB 4WZMA 2VQFJ 1TELA 1LV5A 4IG0A 1IM4A 3L3CA 1M5SA 1UMJA 4AYBD 1FESA 1JWWA 1R8AA 5EUHA 1X4GA 5M2RA 4GC6A 1Q82T 4X2BA 3TAQA 3CMAS 3QGPA 2QA4S 1J27A 3IRXB 3M8QB 5K8PA 2ZE2B 1TTHB 2B6AB 4DG1B 5G4DA 2HFSA 5KFJA 3H25A 4WCEQ 4JP8A 1VISA 4G6VB 4O44A 1SJFA 4F7VA 2XB2D 5AE1A 2IY5B 2UXDJ 5DG9A 1FRKA 5DDOC 3KUHA 2WVEA 1UAWA 4NLUA 2BJ8A 1HIYA 1R8BA 3UR3C 5LXYA 6AT1B 2UUBJ 1TL7B 4BHQA 1NU4A 1YBTA 3HM9A 5E0OA 2E5GA 3I9V9 1IBMJ 2PA3A 4OX7A 1RCOB 1JLFB 4V19X 1S7IA 1YQHA 2YKPA 2NYIA 4M5DA 2GNKA 2Q66A 3H90A 5D4PA 2JC0A 2CFXA 2ROGA 5KFGA 4ZS6A 2CQBA 2AQ4A 2RRNA 2ZH8A 1WHYA 3I82A 2IBOA 2LQJA 3FFIB 4PWDA 3GYXB 3V4IB 1VRTA 3EM1A 4F4WA 1FHTA 4U9RA 4X62J 2C3MA 1N0VC 2BJEA 3M9NB 1QLNA
chains in the Genus database with same CATH topology
5LMUJ 1HR0J 5IWAJ 4DV2J 4NXMJ 3D3CJ 3T1YJ 4KHPJ 4GKKJ 2MTLA 4DR7J 1IBLJ 4LF4J 4NEYA 4DUZJ 2KVQE 4DR2J 1N36J 4AQYJ 1N32J 2UXDJ 4V1Ak 4LF5J 4JV5J 4YHHJ 4DR3J 4DV0J 4DR4J 4NXNJ 4B3SJ 4DV7J 3R2DJ 2VQEJ 4X64J 4B3MJ 2UU9J 1HNXJ 4LF9J 2ZM6J 2UUBJ 3R2CJ 2UUAJ 4YY3J 4LFBJ 4B3TJ 2UXBJ 2MEWA 1N33J 4JI8J 5LMNJ 1HNWJ 1IBMJ 4JYAJ 2HHHJ 3J81U 1J5EJ 4DR6J 4JI0J 2KL8A 2UUCJ 3OTOJ 1XMOJ 4LFAJ 4OX9J 4LF8J 4DV6J 3J80U 4DUYJ 1IBKJ 4K0KJ 4LF6J 4KYZA 4JI2J 4JI1J 5FLXU 4DV1J 2VQFJ 1N34J 4DV5J 4X65J 1XMQJ 4HHUA 4JI3J 3IMQJ 4LF7J 5BR8J 4JI6J 2E5LJ 4X66J 1HNZJ 4KY3A 4DV4J 4DR5J 3W1YC 1XNQJ 3T1HJ 1XNRJ 4LFCJ 4RJVA 4JI4J 4DR1J 2MQ8A 5A2QU 4JI5J 3D3BJ 4NEZA 2F4VJ 4DV3J 3J7AN 4X62J 5IT9U 1FJGJ 4PWWA 4JI7J 1I94J 3JAMU 4GKJJ 5LM7E 4B3RJ 5AJ3J 2UXCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU J;  1HR0 J;  5IWA J;  4DV2 J;  4NXM J;  3D3C J;  3T1Y J;  4KHP J;  4GKK J;  2MTL A;  4DR7 J;  1IBL J;  4LF4 J;  4NEY A;  4DUZ J;  2KVQ E;  4DR2 J;  1N36 J;  4AQY J;  1N32 J;  2UXD J;  4V1A k;  4LF5 J;  4JV5 J;  4YHH J;  4DR3 J;  4DV0 J;  4DR4 J;  4NXN J;  4B3S J;  4DV7 J;  3R2D J;  2VQE J;  4X64 J;  4B3M J;  2UU9 J;  1HNX J;  4LF9 J;  2ZM6 J;  2UUB J;  3R2C J;  2UUA J;  4YY3 J;  4LFB J;  4B3T J;  2UXB J;  2MEW A;  1N33 J;  4JI8 J;  5LMN J;  1HNW J;  1IBM J;  4JYA J;  2HHH J;  3J81 U;  1J5E J;  4DR6 J;  4JI0 J;  2KL8 A;  2UUC J;  3OTO J;  1XMO J;  4LFA J;  4OX9 J;  4LF8 J;  4DV6 J;  3J80 U;  4DUY J;  1IBK J;  4K0K J;  4LF6 J;  4KYZ A;  4JI2 J;  4JI1 J;  5FLX U;  4DV1 J;  2VQF J;  1N34 J;  4DV5 J;  4X65 J;  1XMQ J;  4HHU A;  4JI3 J;  3IMQ J;  4LF7 J;  5BR8 J;  4JI6 J;  2E5L J;  4X66 J;  1HNZ J;  4KY3 A;  4DV4 J;  4DR5 J;  3W1Y C;  1XNQ J;  3T1H J;  1XNR J;  4LFC J;  4RJV A;  4JI4 J;  4DR1 J;  2MQ8 A;  5A2Q U;  4JI5 J;  3D3B J;  4NEZ A;  2F4V J;  4DV3 J;  3J7A N;  4X62 J;  5IT9 U;  1FJG J;  4PWW A;  4JI7 J;  1I94 J;  3JAM U;  4GKJ J;  5LM7 E;  4B3R J;  5AJ3 J;  2UXC J; 
#chains in the Genus database with same CATH topology
 1TMJ A;  2R4F A;  4A8M P;  4DL7 A;  1YJN S;  4ES1 A;  5KFX A;  3OJU A;  3KLH B;  2JZ5 A;  1EJ7 L;  3NBP B;  1FXR A;  4BS2 A;  2XYP B;  2O5D A;  1TKX B;  4CQ1 A;  1KD1 T;  1IWG A;  3IWX A;  1TUG B;  2FHJ D;  2Z58 B;  5CZX A;  2V2Q A;  3KTQ A;  2F8H A;  1NLK L;  5E3P A;  3RB4 A;  4FF1 A;  3Q22 A;  3QQC D;  5M2U A;  2CPH A;  2QIF A;  4NPO A;  1M5V C;  2ALZ A;  3Q2T C;  3NGK A;  3CJ4 A;  1G7C B;  2RHS B;  1H6K X;  4QJV A;  3NNC A;  4USU A;  4HEA 9;  1LK7 A;  2W2Q P;  5KG7 A;  4BDP A;  3QRP A;  3I0S A;  4LF1 A;  1VRU B;  4MJK A;  4C0O C;  3UD3 P;  1IQT A;  3RUB L;  8RUC A;  3PEH A;  4HT5 A;  3B4M A;  2JEF A;  3U1L A;  3TEG A;  2CQ3 A;  2R2T A;  4L3N A;  2YNH B;  3UNG C;  1MMN A;  2E1R A;  1V5I B;  4FP9 A;  1HW9 A;  2CG8 A;  3CNQ P;  1H2U X;  1VOM A;  5L46 A;  4AND A;  2C28 A;  3HZG A;  2CQ0 A;  1U0S A;  8ATC B;  5I3U A;  4LFC F;  3QGI A;  4FVM A;  2IFX A;  5KFL A;  1F9E B;  2EBE A;  4HR2 A;  1RHJ B;  4YY3 J;  2XZT B;  2ACY A;  3IGN A;  5LJ5 Y;  4BLG A;  2XS7 A;  4CNY A;  2BE9 B;  4AT1 B;  4KHM A;  1DAX A;  2MLY A;  2WOM B;  1BHN A;  4OI4 A;  3CGI A;  3D66 A;  3PKM A;  5KT3 A;  4QR2 A;  4YHH F;  2J6S A;  3RW6 A;  4XTT A;  4MKV A;  1WKL A;  4G3I A;  4LRC A;  3TQE A;  4MKY A;  3KNG A;  4YN3 B;  1BMQ B;  2M70 A;  3CCL S;  1RUS A;  4LFA F;  4A8W A;  2MKK A;  2I5J B;  1RA7 A;  1DY3 A;  1BXN A;  1LW0 B;  4P72 A;  1FRJ A;  4DV3 F;  4CO4 A;  4CLY A;  2W1B A;  4KTQ A;  2K06 A;  2BW2 A;  1RDR A;  1FJG F;  2IDL A;  3I4P A;  4WF9 Q;  4M5N A;  1HBU A;  1XJW B;  1CPZ A;  2CNN B;  2W2P P;  1HNI B;  4QU7 A;  2LLZ A;  4GC7 A;  1B99 A;  2IYG A;  3G8S A;  3IBF B;  5KOW A;  2AF6 A;  2L9N A;  2YWE A;  5A0Y B;  3GCW P;  2AJQ A;  4QBU A;  2G2O A;  3GZ7 A;  4N77 A;  2YNI B;  5L1K A;  4C2M A;  3IWN C;  1XC9 A;  2BJ1 A;  1V3Z A;  4OX6 A;  5DS7 A;  1X9S A;  4X64 F;  5ETP A;  3UVJ B;  1S0V A;  4O3Q A;  3KK2 A;  4KR0 B;  2XTJ P;  3M8R A;  1Q7L B;  3X3U A;  5A76 A;  5ETS A;  5C25 B;  4CM0 A;  5CXT A;  5KFT A;  3IWL A;  4ECW A;  5K20 B;  2GHV C;  4JI2 F;  2E9T A;  2OEJ A;  4ZDN A;  4KSE B;  5IC6 B;  3DLG A;  1DJ0 A;  2ZDP A;  4A4J A;  3BH7 B;  1MRO A;  3G8Q A;  3MF5 A;  1M5P C;  3FK4 A;  1FNO A;  2VG6 A;  1NSP A;  2HK2 A;  2R7S A;  3PR4 A;  2B51 A;  2LQB A;  4ED8 A;  4NYO A;  2X3G A;  5E2Q A;  4DV7 J;  4N7T A;  4EI2 A;  2FJA B;  1G4C A;  5A8R B;  1TMM A;  2HLT A;  5EWF A;  2V8V A;  3EVW A;  3JS9 A;  1VRQ C;  3N6N A;  4NLY A;  2DHH A;  5B0B A;  4ZPD A;  2RKI A;  3GIK A;  2IJF A;  1NB7 A;  1U2F A;  3EVO A;  4ZVF A;  5U47 A;  1T11 A;  3J80 U;  4PQU A;  5HQL A;  1UFK A;  4PQA A;  5DRK A;  1RGV A;  5L39 A;  2DRD A;  4PXB A;  3BM7 A;  1TU0 B;  3BJY A;  3R6L B;  1Q79 A;  1TK0 A;  2DGT A;  2OPR A;  2MQO A;  3G6Y A;  3O5T B;  4C7Q A;  1DTT B;  3MI7 X;  2KN4 A;  5AXK A;  3GG0 A;  1SC6 A;  3JQM A;  1NPK A;  3MD3 A;  4JI5 J;  1WTF A;  3H2V E;  3M6X A;  1PAE X;  2VG7 B;  3KJV B;  5HMW A;  1RAO A;  1WF0 A;  5RUB A;  5F8H A;  2F1F A;  3OL6 A;  4M1K A;  4KAI A;  5G0R A;  3M9M B;  3QWU A;  4N76 A;  2NXU A;  3AAW B;  3BH6 B;  2BKO A;  2YNG B;  3R7N B;  3D9B A;  2C22 A;  3MEG B;  2FGO A;  3NGT A;  1S1T A;  1F2H A;  2XMA A;  1LXJ A;  3DGV A;  4OHX A;  3KLE A;  2DGU A;  2DY1 A;  2UUW A;  3QPI A;  3EZ5 A;  1L3S A;  1H2T Z;  3HPO A;  2KVI A;  2I6W A;  4PXE A;  1OMS A;  1N36 F;  3GV8 B;  1VC6 A;  1P6T A;  4NA2 A;  5CCM A;  3EUN A;  1MMD A;  4B3S F;  1TFW A;  1FFS B;  1VQN S;  3R5J B;  5KFW A;  5HN0 A;  1CG2 A;  3C46 A;  4EUV A;  4F0K A;  1O0P A;  3CIZ A;  1AXQ A;  1SXL A;  3ITH A;  2F4V J;  2W25 A;  1GQE A;  3OL8 A;  2VU5 A;  2A2C A;  1JJ2 R;  3EGZ A;  5KG0 A;  4ED3 A;  3G6E S;  2GW8 A;  2VPY B;  4ZVG A;  1S9E A;  3S7R A;  1RWM B;  3B8H A;  5KFO A;  4FPI A;  3V81 B;  2GIF A;  1NDK A;  2HZC A;  3QZ7 A;  1WC6 A;  4WII A;  1WAC A;  5IZH A;  1UW4 A;  1TKT B;  4ZCL A;  5KFD A;  5KFE A;  4DR3 F;  1T95 A;  4UY8 5;  5FII A;  2CJK A;  3JSB A;  2LU1 A;  1YVF A;  2VV5 A;  3PRV A;  3A8E A;  3HD2 A;  3AJ2 A;  2RD5 C;  1H3D A;  1T7P A;  4ELU A;  3L9Z A;  4DS5 A;  2CRL A;  1S7H A;  3D7S B;  2GHP A;  2CPI A;  4QPX A;  2HVE A;  2LEP A;  1C4C A;  3S6E A;  1TV6 B;  3UDE A;  2C3P A;  1KLN A;  4FBU A;  2B8P A;  5HQM A;  5J2P B;  1RTD B;  4B9S A;  2RB7 A;  1PKU A;  5F8J A;  1FT8 A;  1WI6 A;  1F0X A;  1EKS A;  4TY8 B;  1IKW A;  2D3O 1;  2MZJ A;  3D3C J;  4B9U A;  5LSO A;  2KVQ E;  3ZO7 A;  5KFC A;  4DV4 F;  3ZZY A;  4F02 A;  2NRE A;  4WIQ A;  3RW7 A;  2ZH5 A;  3Q0A A;  1NAQ A;  2QLB B;  4CNZ A;  4JI4 F;  1SH3 A;  3IM9 A;  1LFP A;  2BVZ A;  2LP4 A;  2VA3 A;  4LR7 A;  4YEA A;  3PJ9 A;  2ZHO A;  2KL8 A;  2BQR A;  4OYZ A;  1XMO J;  1U0H A;  5C2G A;  1RBA A;  4DV6 J;  2KKH A;  3KNA A;  1S1X B;  3M2V A;  5F41 A;  3OT9 A;  3Q8Q B;  1WHW A;  3HXM A;  2E29 A;  2YBV A;  1R89 A;  1HLW A;  2H3E B;  2G2Y A;  2N3O A;  4ED7 A;  2PC6 A;  2D7S A;  5DLG A;  5A6P A;  3VTI A;  2WON A;  1T9V A;  2YNF B;  1H7W A;  2H1Y A;  2YKM A;  4M5K A;  3MM8 B;  4B08 A;  3MMJ A;  4JI7 J;  3OL7 A;  4OX9 F;  2LEA A;  4PUO A;  4USM A;  1SL1 A;  1X0F A;  4ECS A;  1V3S A;  4J9N A;  2VQF F;  1C4A A;  3V6J A;  1RHU B;  4KV8 B;  1JB0 C;  2DNR A;  1OY6 A;  2VG5 B;  3CDW A;  4DF4 A;  2FYX A;  2R7W A;  5D0G A;  2A0F B;  3F0N A;  2GVZ B;  2AYE A;  3C6U B;  5BYR A;  3WZ0 A;  3GIM A;  3WDO A;  2MHE A;  2RQK A;  2W24 A;  3V6K A;  1YZ7 A;  5KG3 A;  2G1D A;  1PSD A;  3AB2 B;  1YRX A;  1JK9 B;  3IRW P;  4HH1 A;  3I87 A;  3W5Z A;  3K2Y A;  2UXD F;  1KP6 A;  1RAG B;  2JLE A;  1UZH A;  4CO3 A;  3LAN A;  2MQP A;  1OWX A;  4LSN B;  2ZEJ A;  1GAO A;  3ENW A;  1UVM A;  1DLO A;  4CLT A;  2ASL A;  4CP5 A;  2UUB F;  1IM6 A;  5JJB A;  3FZ2 A;  2HS3 A;  2YX4 A;  4CCH A;  1D9D A;  3DHW C;  3BKU A;  1IBM F;  2GQQ A;  1RWK B;  1VQ9 S;  3T5K A;  2ZJP Q;  5H9F K;  3R97 A;  2IJR A;  4ZP8 A;  4LQ9 A;  4MKB A;  2GVD A;  5DZ6 A;  1KR4 A;  4A8X A;  2FGC A;  3J7Z 5;  1S6P A;  1Y5I B;  1NSQ A;  4IRC A;  2LQ9 A;  1HKA A;  1DQ8 A;  4WKY A;  4F4K A;  1RT4 B;  3RRH A;  2ZBQ A;  3BGR A;  4HHJ A;  3MWB A;  3PG9 A;  3W61 A;  1TVR A;  1WC3 A;  3BO3 A;  1LNQ A;  2NXJ A;  3KLG A;  2HFZ A;  1IQZ A;  1C1B B;  3RZA A;  5L38 A;  1R0A B;  2XMJ A;  3DOL A;  3JSM B;  2PN6 A;  3DYA A;  4QWE A;  2AMC B;  2W9B B;  1HBU B;  3TP2 A;  2BV3 A;  2Z2Z A;  3G6X A;  1MU2 B;  4HL9 A;  3R8Y A;  4MK8 A;  2EI5 A;  3ZZR A;  4C3L A;  2DNP A;  2ZNZ A;  4P74 A;  1V9O A;  1RT3 B;  1FDB A;  4WP9 A;  3ZXW A;  2FJW A;  4C8Z A;  1ACM B;  2XS2 A;  4LT6 A;  1UVN A;  1JLB A;  4F2S A;  4ECV A;  1S76 D;  2ZZM A;  5KFK A;  3JSY A;  3MTK A;  1J5O B;  5L1L A;  3BSC A;  2GO8 A;  3VAM A;  2P9C A;  2VFS A;  1UJ5 A;  2V4J A;  3M2U B;  1T3N A;  1PCA A;  1IKY B;  3OUY B;  3OFG A;  4K4S A;  3IFE A;  3IG1 A;  1D09 B;  2Y1I A;  2B9W A;  2NZ4 A;  3M2R A;  2BAN A;  4ZIT A;  3DOM A;  3JQK A;  4NAS A;  1T05 A;  3VGT A;  3UCG A;  3R2C J;  4YDX A;  2V5H G;  1YJU A;  4JV0 A;  4ZHR A;  2XI3 A;  2FLP A;  2XMT A;  2XWY A;  2GFF A;  2NR0 A;  1U49 A;  4KH1 B;  1KQK A;  2B9X A;  1AFJ A;  3PO4 A;  2ZM6 F;  4NA3 A;  3EIC A;  1S48 A;  4MFB B;  1U8S A;  1TZ0 A;  4KGZ B;  4HYK A;  1QVG R;  3E01 A;  2ABY A;  4Q5V A;  3HDS A;  3IMQ J;  3L7P A;  2J8A A;  3AD8 C;  2RDD A;  1NJW A;  1GXL A;  3KYL A;  3K5L A;  2C1E B;  4YY3 F;  3Q2S C;  1N5Q A;  2IBK A;  1Y11 A;  1RLD A;  2CJQ A;  3A8K A;  3SQG B;  2OPR B;  3DCA A;  3LF0 A;  2WVB A;  4PWW A;  3CDA A;  3BN7 A;  2DGX A;  4PG5 A;  5GAD I;  3IP0 A;  3MEC A;  2ZWO A;  2AZ1 A;  1U1P A;  1FXD A;  1JLC B;  2EFV A;  5J2Q A;  2R7V A;  2ZC4 A;  4FNI A;  5C24 A;  1SI9 A;  1KNZ A;  1RTH A;  5A2Q Y;  2DT9 A;  5LSL A;  3O8W A;  3GFH A;  3R1L A;  4CH7 A;  5KFH A;  4O3P A;  4B9M A;  3MFI A;  4ED6 A;  2GHW A;  3DGP B;  1EX8 A;  2YX7 A;  1JKH B;  1B0P A;  3MAA B;  1C0U A;  1QUV A;  3QO9 A;  2QLF B;  3K5P A;  3NY0 A;  4I6A A;  4WFX A;  1FRH A;  3L7U A;  4CLU A;  4O0I A;  3DRY A;  5FLX Y;  3DMJ B;  2HVD A;  5IM0 B;  1NEE A;  4M5G A;  2MKH A;  3ZZP A;  4ZPA A;  4RKU C;  2OPS B;  2KRR A;  3RGI A;  1RA6 A;  1FKA F;  2C2K B;  2RS8 A;  4ZN3 A;  2CVE A;  4B3R J;  2PEH A;  4C8N A;  3GU0 A;  3SSR A;  4QPT A;  5F8N A;  2LXI A;  5HL7 Q;  2D41 A;  4I64 A;  2QX0 A;  3HSD A;  4USV A;  3DRS B;  2IAJ B;  4L72 B;  1XBW A;  4YB5 A;  2D3O R;  3BBF A;  2YKN A;  3JSR A;  2Z57 B;  1RYR A;  1JLE A;  3K7R A;  2DNK A;  3BEG B;  1RAJ A;  3KUE A;  3AFG A;  4OMF G;  1URN A;  1HNX F;  2IC3 B;  1CS4 B;  5HLF A;  4E98 A;  1SH0 A;  4LBP A;  1RAI B;  3PW0 A;  1UCN A;  4B3T F;  2YPY A;  1C0T B;  4RBU A;  3HK2 A;  2DIS A;  4BWJ A;  1U8W A;  2GQ2 A;  4ILM A;  1HBN A;  1ZPW X;  2V34 A;  3FGV A;  4DV7 F;  2GJF A;  1FA0 A;  2BAC A;  4CRJ A;  2DXE A;  2W9C A;  2JFK A;  1ZOT A;  3G82 A;  4O23 A;  4MH8 A;  3BSN A;  2VJV A;  2KFY A;  3NGD A;  1BQX A;  4KO0 B;  4TXS A;  5BR8 F;  2R7Q A;  2CVI A;  2V6A A;  4NCA A;  2OD4 A;  4DI6 A;  3KUG A;  2MST A;  1X31 C;  1NPP A;  5BJR A;  3H5X A;  4ID8 A;  1YDL A;  3QJL A;  2NXC A;  3MUV P;  3G4S S;  4HKQ A;  1RT6 B;  2VFT A;  4J9Q A;  4I67 A;  4N8O A;  4RPF A;  2BE2 B;  5B08 A;  1KQG B;  3VCD A;  2HQF A;  5AXN A;  2IIH A;  2UU9 J;  4NXM F;  4LF9 J;  1JLG B;  4JI5 F;  4TVA B;  3QLH B;  2C2N A;  4WFZ A;  5HVG A;  4C6A A;  5CYM A;  1KQF B;  4XDD A;  2OAU A;  2UUC J;  1EAR A;  1VBY A;  1HQU A;  1SL2 A;  2HNZ B;  2DGV A;  1U0H B;  5HQ8 A;  1QAY A;  4J9K A;  3CCM S;  5IQ6 A;  3MCM A;  1S97 A;  2M7S A;  2A6O A;  3C16 B;  2NPF A;  5KFY A;  2OJ3 A;  2MDA A;  2DNH A;  3G2X A;  1J2V A;  4GKJ J;  1NH8 A;  2J9C A;  1Q8B A;  3ZTO A;  4C3K A;  4A8Y A;  4RW8 A;  1Z2L A;  1WNE A;  2BKP A;  2MLX A;  1FTR A;  5SUH A;  2M3D A;  1FDD A;  1HWU A;  3FSY A;  3U1N A;  2DHA A;  3OR1 B;  4HLB A;  1VYA A;  5HMZ A;  1FK9 B;  5EWG A;  2XMW A;  5AT1 B;  3RBZ A;  3I0R A;  2UVR A;  3KFW X;  2Q79 A;  2AYG A;  2AP6 A;  3W5Y A;  2YH1 A;  2ZD1 A;  1FO1 A;  3QYY A;  1I5O B;  3MPU B;  1FKO B;  5KFM A;  1OO0 B;  3H40 A;  3VAG A;  1X5T A;  2KH9 A;  2RH3 A;  2NS1 B;  1OY8 A;  1P1L A;  1H74 A;  2ZVI A;  2CJB A;  4XPC A;  4Q0B A;  3WIU A;  1RT7 B;  4OYM A;  2IMO A;  1PIL A;  3EXY A;  2UZA A;  4UT4 A;  4MKA A;  3H20 A;  3CF5 Q;  4ECR A;  1NHV A;  3I5C A;  3KJF B;  4OYX A;  2BJ3 A;  2AD9 A;  1UWB B;  5DQG A;  1GNK A;  3N5F A;  1UVJ A;  7FDR A;  1VQ7 S;  1BLU A;  2MSS A;  5LJ3 Y;  5HJX A;  2GMH A;  2DPJ A;  2JDJ A;  1VIO A;  2E1C A;  4X4N A;  4IG3 B;  4KBI A;  4DFK A;  1DZ5 A;  2H5E A;  1VQ4 S;  2GVD B;  3MM6 A;  5C42 B;  3D0G E;  1UJ6 A;  2DNY A;  4CH1 A;  4ZVP B;  2HUR A;  1CJV B;  3AXK A;  2ALY B;  2MKC A;  3GIR A;  4KGX B;  4RUH A;  3V4M A;  1TAU A;  1TVR B;  3AQP A;  2JJ4 D;  2J8S A;  3KLG B;  1RT5 A;  5CYQ A;  3TO8 A;  3GLJ A;  3M32 B;  2ZVS A;  1F6T A;  2MJU A;  4AL7 A;  3LPY A;  4F26 A;  3KHR A;  2RHQ B;  4A8F A;  3MED A;  4CO2 A;  1S0M A;  1LWC A;  3MR6 A;  2Q6C A;  2CQ1 A;  1PJ7 A;  4H4O A;  3KG4 A;  3VQT A;  5E3R A;  3ZTR A;  1FE0 A;  4X66 J;  2ATL A;  4B3O B;  1WOS A;  1XMQ F;  3D6H B;  4J9V A;  4EU0 A;  2V68 A;  2W4D A;  5D15 A;  4EO8 A;  4DV6 F;  3NS6 A;  1LWF B;  5DJB A;  2KHC A;  5B0E A;  3CJ5 A;  5IT0 A;  2IDE A;  2XBP A;  2W8L A;  1F60 B;  1HNV A;  5D4N A;  4LF5 J;  1M5O C;  1HQE B;  2PE8 A;  4DPO A;  1NZA A;  2EFQ A;  1IKV A;  1I51 B;  3S1T A;  1WJ9 A;  4DR2 F;  1M90 T;  2DR5 A;  5D3G B;  4P9S A;  1BE4 A;  2BAN B;  1M1H A;  3W2W A;  3R7B B;  2W7O A;  3GR1 A;  1T05 B;  3H42 A;  4JI7 F;  2KJW A;  3RBX A;  2ZBP A;  4I2P A;  3TAR A;  4PZV A;  1WHX A;  1XK8 A;  3WBZ A;  2OSQ A;  4K0K J;  3QID A;  2HIY A;  4KFB A;  4OYA A;  5ETN A;  3I55 S;  2QLW A;  2WK4 A;  1YX2 A;  4IO9 Q;  2A3J A;  1U6F A;  3SXL A;  1B7F A;  1HW8 A;  4DZD A;  2XYH B;  4YR2 A;  3E01 B;  5ETL A;  1HWK A;  5M2P A;  1VI7 A;  4IQX A;  4Y2I A;  3UDL A;  1FVQ A;  3PRD A;  3SDE B;  1Y5N B;  2OKQ A;  4NWB A;  3POT A;  4IH7 A;  3NGR A;  1NJI T;  1ULR A;  3CTR A;  1VQO S;  1HI8 A;  1BQN B;  2R7O A;  4FS1 A;  1KON A;  2V8D A;  4F0H A;  4L75 A;  2AGP A;  4DSJ A;  3PJW A;  1ZAX A;  1Q16 B;  1HR0 F;  2HFO A;  4DR7 F;  2IMW P;  4MTP A;  3KHG A;  4X4V A;  2APO A;  4Q2M A;  4Q44 A;  3BGF A;  4NXN F;  2B0G A;  1RTJ A;  1UTA A;  4P2F A;  2E9R X;  4FBT A;  3M4X A;  1HI1 A;  4WZQ A;  4DV1 J;  4ED1 A;  4U95 A;  3DDN A;  4OX8 A;  2EG2 A;  2VFU A;  1WD6 A;  1K47 A;  3EVM A;  2K1R A;  3BR9 A;  2RF2 B;  1R8P A;  5CHC B;  2RML A;  2M0G B;  4O3S A;  2MQQ A;  3MXH P;  3DOK B;  1RHK B;  4MK9 A;  1I94 J;  1FWP A;  4EBE A;  2FC9 A;  2MGZ B;  4XO0 A;  2VOO A;  2PEB A;  1S49 A;  1OPZ A;  2CDQ A;  1VQ8 S;  4KHP J;  3OPK A;  3W62 A;  4TYA A;  4OYB A;  1NKC A;  3SBM A;  5I42 A;  3QIP A;  2OD6 A;  1LK5 A;  1MML A;  3KLF B;  4HI2 A;  3WIV A;  1NKB A;  4F4A A;  3QNW B;  3DLE B;  3I6P A;  2ZZT A;  4PXD A;  3T3F A;  4O4G B;  5EHH A;  1GXT A;  4LF8 J;  5J1E A;  1IKX B;  2DXF A;  4PG4 A;  2CZ9 A;  3FNN A;  2VPW B;  3FMB A;  1D9A A;  2DK2 A;  1RWX B;  3UN3 A;  5IFM A;  8AT1 B;  4OJH A;  3I31 A;  3AHP A;  3R1H A;  4QR0 A;  4Y65 A;  4IH5 A;  1C1C B;  4Y00 A;  3MDF A;  2LDI A;  2HSE B;  3CCU S;  4HAC B;  3KG0 A;  3UDC A;  3PW4 A;  3HHL A;  3MMC A;  4DL2 A;  3EX7 B;  1XR6 A;  1F9H A;  1V3R A;  4B9V A;  3VAL A;  2RU9 A;  5J2N A;  3CT9 A;  3DLK A;  1NDL A;  2A1B A;  2XY5 A;  2C2E A;  4IFV A;  3QMQ A;  3CJK B;  1FKP A;  1WEX A;  3QGH A;  4ERD A;  3A3P B;  2LCW A;  4OV1 A;  4ENO A;  3NAI A;  2I2Y A;  3UO0 A;  4LF4 F;  4WFN Q;  1VBX A;  3ISN D;  1D3W A;  3B54 A;  2BOP A;  2UXB J;  1WI8 A;  5F3Z A;  4TU7 A;  2M5Y A;  2KG0 A;  2XGP A;  2QFJ A;  1QM9 A;  2Q6B A;  4P7V A;  1IBK J;  1YIJ S;  3L4B C;  5FLX U;  1U26 A;  1YIT S;  1JNZ B;  2PSZ A;  1HQU B;  5KFP A;  2I9S A;  2QA1 A;  4R5P B;  5I3P A;  4UY8 T;  4I7F A;  4ZCK A;  4M5L A;  2AJ1 A;  4CTA B;  2XM3 A;  4DQS A;  4WU3 A;  2JH3 A;  3R5D A;  3TR5 A;  1N6Q B;  1S1U A;  1VDH A;  4HVZ A;  2GML A;  4F3Q A;  5HI7 A;  4J37 A;  3T1H F;  3GIJ A;  4JOU A;  2OP5 A;  3QJP A;  4J5O A;  2N3L A;  1LWE A;  4URQ U;  3OHA A;  3TOQ A;  4K50 A;  2QT7 A;  1AW0 A;  1HWL A;  1FFG B;  4ALZ A;  3CC4 S;  2DO4 A;  4WWS A;  3OFH A;  5KFF A;  1SQG A;  4KHR A;  3QSI A;  3S01 A;  3EZO A;  4B17 A;  4XAK A;  2YKO A;  1F2G A;  3Q8V A;  2QMW A;  3ISN C;  5DO2 A;  5E3C A;  4C8K A;  2OPQ B;  4B3R F;  2ZBI A;  2FHO B;  2MB0 B;  3DNC A;  1KOH A;  2YWF A;  1SUQ B;  2V69 A;  2CQ4 A;  4AXJ A;  1ZA2 B;  2RU3 A;  5ADZ A;  4CI0 B;  3IRX A;  3M8Q A;  3FQK A;  3ETM A;  2ZD1 B;  2ZE2 A;  2C2O B;  3N0V A;  3TNV A;  4NLS A;  1N54 B;  2B6A A;  4C9D A;  4DG1 A;  3OHB A;  1GMW A;  4OL8 A;  4NRU A;  1Y00 A;  3ICL A;  2Z2Y B;  3TA0 A;  3BDE A;  3PW7 A;  3OTB A;  1DAR A;  1MNE A;  4PXC A;  1ZH5 A;  1TL7 A;  3BQ0 A;  1IR2 A;  2QYC A;  1KDN A;  2DEI A;  3MR7 A;  2WAQ D;  1X4E A;  1S59 A;  1BY9 A;  1UA0 A;  5KFV A;  4FF4 A;  2AIR B;  2N4C A;  1GEH A;  2W4P A;  4CLZ A;  4KQZ A;  4AQY J;  2HKE A;  4LIR A;  3PVX A;  3EMT A;  1RWW B;  2POK A;  2NQP A;  2DNQ A;  1U25 A;  3NWG A;  3T1Y F;  2ZHA A;  3BGO P;  3FFI A;  2ZJR Q;  2ZH2 A;  3V4I A;  2DNN A;  3Q24 A;  2DXD A;  3W8G A;  2V2Z A;  4A48 A;  4FXD A;  4DR6 J;  1X5S A;  2X1B A;  1DQA A;  3H5Y A;  1VLY A;  3TA1 A;  5HP1 B;  1OS5 A;  1W25 A;  3KLH A;  3QRR A;  1S57 A;  3NBP A;  2UU9 F;  3PX0 A;  1TKX A;  1NK6 A;  4K4Z A;  3A3N B;  4ZIV A;  3FDS A;  1VIX A;  1RAH B;  3CCJ S;  5DZ7 A;  5THW A;  4C98 A;  3VAK A;  5IT4 A;  4DF8 A;  2FJD B;  4MMO A;  2FVC A;  3LA0 A;  2L9D A;  4NEY A;  2HMI B;  2ZIT A;  2YQ1 A;  1EQ0 A;  4WXW A;  4DV0 J;  3ENA A;  4NZ0 A;  1TP7 A;  4K59 A;  3N79 A;  3KLI B;  1KTV A;  3J7Z T;  2EG1 A;  1S77 D;  1N32 F;  4X4U A;  2HYI B;  2OH2 A;  3EWG A;  3QFW A;  2VDH A;  4GKJ F;  1VRU A;  1Y3J A;  2EXU A;  4PR6 A;  4LBH A;  5KTQ A;  2ZH6 A;  2K3I A;  4F8R A;  1JMT A;  1RAF B;  4DUY J;  1JLA B;  2PGC A;  1E6Y B;  2YNH A;  1WDT A;  3OVS A;  4I68 A;  1R8H A;  3G9C A;  2CAD A;  3K5M A;  4X4O A;  2HQC A;  3PFO A;  3D68 A;  4UW2 A;  3RRG A;  4ECX A;  3D5M A;  1HHS A;  3C3L A;  4CM2 A;  3W3S A;  4YB7 A;  1S79 A;  1Y9O A;  2WVF A;  2KM8 C;  3DI6 B;  4RW7 B;  5E7O B;  3MFH A;  2B5J B;  1EP4 B;  1GMW D;  2WOM A;  2BDP A;  2QE5 A;  3MUM P;  4KH0 B;  5DDP C;  2ROP A;  4UF4 A;  1RXO B;  1CC7 A;  4NYP A;  1S9G B;  1CLF A;  4QWC A;  3QBC A;  3AOC A;  2X1F A;  1HWI A;  3LWL A;  2BMB A;  3HUL A;  1HMV A;  5BYS A;  2ZC3 A;  4AFF A;  4CYU B;  2JC1 A;  2HGM A;  1PYT A;  2I5J A;  3LAL A;  2EC2 A;  2IA0 A;  1RTJ B;  3RR8 A;  1LW0 A;  3W9I A;  3SEO A;  3KK1 B;  4DLG A;  1KFS A;  3JTN A;  2QN6 B;  2XMK A;  1QAX A;  4LR9 A;  1S99 A;  5ETM A;  2L48 A;  4KRW A;  2K1R B;  1HNI A;  1HNZ F;  2L3M A;  4I0W A;  3MCS A;  3ENV A;  1RKI A;  4MIW A;  1QE1 B;  5HRO B;  5IWA J;  4DV2 J;  5A0Y A;  4GKK J;  2IM3 A;  4C8O A;  4X66 F;  4TQR A;  2V9W A;  2YNI A;  2YWG A;  3FBB A;  2O67 A;  3BGU A;  4ECT A;  2KT5 A;  4KC5 A;  2HHP A;  1FFW B;  1Y0H A;  2DIU A;  4W92 B;  5C25 A;  2FY8 A;  4RZR A;  2V0N A;  2R8K A;  4DV5 J;  1BQM B;  4LF5 F;  2ADB A;  5EN1 A;  2GMJ A;  4WKR A;  5D4O A;  3SYZ A;  1U6Z A;  2KG1 A;  4JV2 A;  5F8I A;  3MR5 A;  2AJ4 A;  5A8R A;  1U1Q A;  3PYG A;  4UUW A;  3P49 B;  4RWX A;  2ILY A;  2BJ7 A;  1VGY A;  1HBO B;  1R43 A;  5DM7 Q;  1U02 A;  4E2F B;  1NZ8 A;  3MPD A;  2FJV A;  3LH2 S;  1UJ4 A;  4V1A k;  2KXN B;  1HBM B;  1P27 B;  5LMU F;  4D3H A;  3RAM A;  3ILL A;  3OR2 B;  4NZ7 A;  1X4A A;  1DTT A;  1QSS A;  2HFV A;  3NMR A;  1Y7P A;  2HHS A;  1YRU A;  3D6T B;  5FDL B;  2XMM A;  1X4F A;  2EFP A;  2VG7 A;  3KJV A;  2RE1 A;  3M30 B;  1KVI A;  1QY7 A;  4ICL B;  4OI0 A;  4Q8F A;  2G4B A;  4X65 J;  3JB9 k;  2KM8 B;  3F73 A;  4P73 A;  3C14 B;  2DY9 A;  3FRY A;  3EYZ A;  4OZJ A;  3W63 A;  3PHT A;  1GX5 A;  2YNG A;  4DPY A;  1SKW A;  2GZO A;  3MEG A;  2WB4 A;  3HSG A;  1S6Q B;  1U45 A;  2HFN A;  3DKD A;  4DV1 F;  5AXL A;  4V19 J;  1M5K C;  2YWH A;  3DRR B;  4ZCI A;  1A7G E;  1MG7 A;  4DU8 A;  4I2Q B;  3HVR A;  2RNE A;  3PW5 A;  5IT9 Y;  1F5A A;  4RNM A;  3LTO A;  1RJJ A;  3HP6 A;  4ZPC A;  2W2N P;  3U02 A;  3HKZ D;  1I94 F;  2HHH J;  2B8Q A;  1SKU B;  4OZ2 A;  2XCA A;  4WJB A;  1K0V A;  5K5M A;  3SV3 A;  3HHE A;  4KHP F;  2D74 B;  3KK3 A;  1LW2 B;  3CE8 A;  5KAK A;  4FZV A;  1KN6 A;  1FI4 A;  1FD2 A;  4X4R A;  3DHX A;  2BJD A;  2JVO A;  3NXZ A;  3V81 A;  2LDY A;  4PWU A;  2W9A A;  2NSC A;  4IOB A;  3IBW A;  2YWK A;  2EKY A;  2Z56 B;  1TKT A;  2QRR A;  1CJU B;  2ZZN A;  2HHU A;  3N6L A;  4B9L A;  1RZM A;  3FVY A;  1FJE B;  2EEY A;  4RR5 A;  4NL5 A;  4F25 A;  1MSW D;  3DU5 A;  3NOC A;  2H48 B;  1IJE B;  1NM2 A;  1RAC B;  3GFX A;  4P2M A;  2W7A A;  3ZNU A;  3HF5 A;  3PXG a;  3W66 A;  1TV6 A;  4W90 B;  4AE5 A;  1S9F A;  3Q8Y A;  2CA9 A;  2BRK A;  4FYW B;  2BX6 A;  1CUL B;  5J2P A;  1CJK B;  1RTD A;  3G96 A;  4ID5 B;  3RG6 A;  3CDB A;  4NA1 A;  3LP0 B;  3UPF A;  5A8K B;  4TY8 A;  4AL5 A;  2BM1 A;  2VPX B;  3D6M B;  2EBG A;  3GON A;  4OHW A;  2KXF A;  2P2C B;  3C15 B;  4RX6 A;  2R2U A;  3C19 A;  3FBE A;  3OSP A;  2BR0 A;  1IR1 A;  1XNR J;  2Y3Y A;  2DNG A;  3AOB A;  2JVR A;  2UXB F;  5K14 B;  4LRA A;  4ECU A;  1XR5 A;  3MAH A;  4RO0 A;  1M5H A;  4RW9 B;  2BBE A;  2CIM A;  5DLF A;  4LJM A;  3FBC A;  1YZ6 A;  2E44 A;  2HK3 A;  3CCZ A;  3CD0 A;  1HAR A;  4O4R A;  2DNL A;  1N8R T;  5HJY A;  3SV4 A;  3CD5 A;  4J9S A;  1S1X A;  4UQG A;  5MAO A;  5KG4 A;  4EBC A;  1R6V A;  3ET6 A;  1TL3 B;  3IO1 A;  4ZVR B;  2HQI A;  3IN5 A;  2RS2 A;  4C97 A;  3CUN A;  2X3D A;  1Q53 A;  4RNF A;  4O3R A;  2ACM A;  1KS2 A;  2DKO B;  3J7Y U;  3NOG A;  2YNF A;  5D8H B;  4IH6 A;  4DXL A;  1KHV A;  2E66 A;  4FYD A;  3MM8 A;  4QR1 A;  2HS4 A;  4R8U B;  3C66 A;  3UD4 P;  4LFB F;  2BZ2 A;  2QLX A;  3G8T A;  4CO1 A;  2MPU A;  3DXS X;  4CT9 A;  1TKZ B;  3HI9 A;  3Q8P B;  1NSK L;  4KV8 A;  1EET B;  2WSE C;  2VG5 A;  2Z4P A;  1TK8 A;  3OQ2 A;  4PYA A;  3CD6 S;  5BXI A;  4CLP A;  4DL5 A;  3HMJ G;  5E41 A;  2GVZ A;  1VQL S;  3DRX A;  2RQC A;  3C6U A;  1GX6 A;  3W2V B;  4C48 A;  1AUS L;  3PR5 B;  3BSO A;  1SPB P;  1FE4 A;  4DCJ B;  3CJQ A;  4CLW A;  4KPC A;  2UVV A;  2HRU A;  4RBV A;  2LXU A;  3DFE A;  1VK3 A;  4OZ3 A;  2N82 B;  2FB0 A;  3CXC R;  3VAI A;  1QD1 A;  2HVI A;  1EKR A;  2MZT A;  5DG8 A;  2GS8 A;  2YY3 A;  2C2R A;  4NML A;  1FDA A;  3J7Y I;  2VQE J;  2HG4 A;  4LSN A;  3UN5 A;  3UE2 A;  2NUU G;  3D67 A;  1PAU B;  3H4B A;  1X4D A;  1K0T A;  1WC0 A;  2R7T A;  3H5S A;  1ZM2 A;  2RAQ A;  4DUT A;  1N0U A;  2VKR A;  1T9Y A;  1HMV B;  3OJS A;  2OI2 A;  3MPV A;  1RHM B;  4LF7 J;  1JLQ A;  3GSI A;  1NHU A;  1RT4 A;  4FNH A;  4LVN P;  3RBD A;  1KLM B;  2RQM A;  5B09 A;  4NCG B;  3HO1 A;  1C1B A;  3ZZO A;  3T6B A;  1R0A A;  3J7A N;  4FVC A;  3JSM A;  2W9B A;  1R3N A;  2DGS A;  3IAS 9;  3WQP A;  5ETK A;  4L74 A;  2V8G A;  2E1M C;  1MU2 A;  3DN9 A;  2XYG B;  1PYO B;  3H0P A;  1M0S A;  4DUZ J;  3HFZ B;  1RT3 A;  4X4S A;  1UET A;  2DH9 A;  1HD0 A;  3G86 A;  3G71 S;  3E8O A;  1EZZ B;  3P5B P;  3M1V B;  3V6D A;  4TU9 A;  3AA8 A;  2I1R A;  3JYT B;  4OI2 A;  3TJ8 A;  1RT1 A;  2GGP B;  1J5O A;  4C8L A;  4R25 A;  4IRK A;  4FYV B;  2QL7 B;  2HBY B;  3V6H A;  2OO4 A;  4G1Q B;  2HND B;  2QSW A;  2OTL S;  1AZS A;  1NJX A;  2MZQ A;  4DL6 A;  1S0O A;  4IOA Q;  3M2U A;  4USH A;  1IKY A;  1G3O A;  3OUY A;  3O2I A;  2EFO A;  4OV6 A;  1T94 A;  3MEE B;  5IV3 A;  3DLL Q;  2HW3 A;  1FEH A;  2LEC A;  2VDI A;  2VB6 A;  4M95 A;  4QZV B;  4DUY F;  5IXU A;  2ILZ A;  2IVM A;  1JXL A;  3WHI A;  2RDJ A;  1B70 B;  4WTY A;  2R2R A;  3MM9 B;  4RUA A;  3IA0 A;  4ZPT R;  1XEZ A;  1N88 A;  4MFB A;  3PAC A;  1Q5V A;  3MMB B;  1E6V B;  1M1K T;  2DH7 A;  3TAM B;  2GO9 A;  5GVQ A;  4FYY B;  4JBC A;  3T5J A;  5CYJ A;  3BYP A;  2Y0B B;  4ELV A;  4MAK A;  1SJR A;  2FTR A;  3M8P A;  4K4X A;  1UPM B;  2CG4 A;  1TFY A;  3K57 A;  1SL0 A;  3BKT A;  1W26 A;  3SQG A;  2AV5 A;  4IFY A;  3M6U A;  4UST A;  2CKW A;  3J81 Y;  1TAQ A;  2XHW A;  2F40 A;  2QA2 A;  3TEH B;  3W5X A;  3OTC A;  3LWM A;  2DPI A;  2CQI A;  4OYW A;  1N34 J;  3HZE A;  1NK8 A;  3FCW A;  1JLC A;  4ZOS A;  4ZPB A;  4URG A;  3OTD A;  2I8E A;  1NKE A;  2EC0 A;  2JHE A;  3SMZ A;  3LP1 B;  2Q43 A;  5E3A A;  4DSI A;  7AT1 B;  3IC1 A;  5AXM A;  1GH8 A;  4ZPW R;  4U8Y A;  3DGP A;  3PDN A;  1TL5 A;  1U2C A;  2XGQ A;  4DV3 J;  2KTQ A;  3VZI A;  1FJG J;  1JKH A;  3R3T A;  3MAA A;  6FD1 A;  2OEL A;  1U1K A;  3DC2 A;  2E5H A;  2WVC A;  2WRM A;  1L3V A;  3M6W A;  4ANC A;  3DMJ A;  1DTQ B;  2ZH1 A;  5IM0 A;  4LVO P;  1RAD B;  1HHQ A;  3F44 A;  2CNO B;  2IA6 A;  4WE1 B;  2J9D A;  3EGW B;  2OPS A;  3ILI A;  2LQ8 A;  1XMB A;  3KJN B;  2U1A A;  5E3Q A;  2Y1J A;  2FZK B;  4HDH A;  4P2S A;  5IWA F;  3BQ1 A;  4E0D A;  4DV2 F;  2DYA A;  2C2M B;  4CH0 S;  4CLS A;  2IJN A;  2E1A A;  1R6Y A;  2DHX A;  3UW1 A;  5C7P A;  3NEK A;  4WBF A;  4F4Y A;  1NME B;  1TKD A;  3DRS A;  4LF6 F;  1H0H B;  2WCX A;  3KK3 B;  4P10 A;  2K2P A;  2IAJ A;  1LFW A;  2J5A A;  1YK9 A;  3U7J A;  1SCJ B;  3DLJ A;  6FDR A;  5F8G A;  4BC9 A;  3SCK E;  4NE9 C;  2V9K A;  2V2K A;  2Y9H A;  2QFI A;  3PZP A;  4DN9 A;  1WWH A;  3R5C A;  3Q8U A;  2SXL A;  1QAJ A;  3SCI E;  1B4S A;  2IC3 A;  4RW6 B;  1CS4 A;  3TZY A;  2LFV A;  4ZK7 M;  4QWD A;  2VZ9 A;  1C0T A;  2KFZ A;  1Y10 A;  2QMU B;  4DL4 A;  3JXO A;  1ZYQ A;  2FUG 9;  2CQP A;  3ENQ A;  4OJ3 A;  2WVD A;  3MM5 B;  1NB2 A;  2HPU A;  3D0I E;  2DR8 A;  4WPA A;  2OLW A;  3M8S A;  3IR7 B;  1OPI A;  3NCP A;  1T9U A;  3LAM A;  9RUB A;  2KDO A;  4PG8 A;  4KO0 A;  3H2L A;  3HVW A;  4OHY A;  1UA1 A;  3PIO Q;  1HFE L;  2LVW A;  3MOJ B;  4PCQ A;  1NK9 A;  3AY0 A;  2Y8Y A;  2JSX A;  1H38 A;  3U1M A;  3ZZZ A;  1SV5 B;  2C3O A;  2X7I A;  4U8V A;  4CZC A;  3T1A A;  1PBU A;  4ZJO A;  3QT7 A;  2DNM A;  4ZLJ A;  4XIU A;  4DLE A;  4ELT A;  3B4D A;  1R31 A;  1JNR B;  1RT6 A;  2NCK L;  2FLO A;  2GAG C;  2VC0 A;  2JFD A;  1CSJ A;  2BE2 A;  2IM0 A;  4FXW A;  2YKA A;  3J80 Y;  2KB2 A;  3UCZ P;  1UP1 A;  3TI0 A;  1NXI A;  1MN9 A;  1JLG A;  1Q86 T;  2WTF A;  1WC4 A;  1HWJ A;  3QLH A;  2QZ8 A;  4X4T A;  3NRB A;  3BV8 A;  3TVZ A;  1WOO A;  2UUT A;  3UWT A;  1RCX B;  1S0N A;  2B4P A;  4X65 F;  2HQ3 A;  3CJR A;  2HNZ A;  3KJQ B;  4ZP9 A;  3GV7 B;  4K4Y A;  2CPJ A;  4FF3 A;  3TZW A;  2E7X A;  5E33 A;  2RDI A;  2XO7 A;  3ET6 B;  3C16 A;  1RTI B;  2PMZ D;  1B0V A;  3R27 A;  1YI2 S;  2Z30 B;  5GAE U;  1N5S A;  1C2P A;  2QL9 B;  1DFD A;  4DHV A;  2ZH3 A;  1MLA A;  2VBW A;  3THT A;  1HL6 A;  2NLW A;  1KVK A;  3BSA A;  5HBM B;  4HHU A;  1FX4 A;  2Y8W A;  1UW9 A;  4WFA Q;  3N01 A;  3AD9 C;  1M1G A;  3OR1 A;  2IM2 A;  3PYF A;  3L09 A;  5KOX A;  3A4T A;  2MQ8 A;  3UI3 A;  2MKI A;  2U2F A;  1FK9 A;  2HHH F;  3CPW R;  3MM7 B;  3G87 A;  4FYX B;  1X9W A;  5HVF A;  2PI5 A;  4ZVO B;  4TYB A;  4F50 A;  4Z37 A;  1FKO A;  5SZT A;  1HQ2 A;  3FRZ A;  1WHV A;  1NRK A;  3W9H A;  3LP2 B;  5DQI A;  4DR3 J;  3M8Y A;  4OYI A;  3R2D J;  1S1W B;  1RT7 A;  1OYE A;  5GAE I;  4C0B A;  2L08 A;  1WEY A;  3KMS A;  1REV B;  3JTP A;  1SIW B;  4WU2 A;  2DGO A;  5LMN J;  1CC8 A;  1UWB A;  4JUZ A;  4K4T A;  2X1A A;  1DUR A;  4NLD A;  2XY6 A;  1N56 A;  4W4M A;  1WF2 A;  2LMI A;  3FZB A;  2XLI A;  4F67 A;  4IG3 A;  1Q8L A;  3E2E A;  5C42 A;  1HPZ B;  1N4L A;  4K4V A;  3EGV A;  1JLQ B;  1EB0 A;  1CJV A;  4ED0 A;  4NEZ A;  2Q3P A;  1MW7 A;  1H98 A;  2X51 A;  4QIV A;  2GIR A;  2P9E A;  3QAT A;  3M32 A;  4U6P A;  1P9Y A;  3CCE S;  4OYO A;  3IS9 B;  5B0G A;  3FSX A;  2XUL A;  5FJ4 A;  4X62 F;  4C11 B;  1X9M A;  2IVF B;  4NLO A;  3V5R A;  5A8W A;  1XNR F;  4ER8 A;  5DG7 A;  1MWY A;  4ZJL A;  3QFH A;  1NUE A;  1S12 A;  4ZVH A;  1HYS B;  1U48 A;  3WC0 A;  4H54 A;  3GG1 A;  2QA4 G;  4B3O A;  1N33 J;  3GJR B;  1HNW J;  2XMV A;  2E5J A;  1NHK L;  1UFW A;  2HZA A;  3V6D B;  3OV7 A;  5JMN A;  3CCS S;  4YUD A;  1RT1 B;  2H65 B;  1LWF A;  4AD6 A;  1AFI A;  4DPU A;  4HHH A;  3OXL A;  4HH0 A;  3DRP B;  1RYS A;  2VFV A;  1AZS B;  5ETR A;  1HQE A;  3IAM 9;  4PAB A;  2AU0 A;  4IYQ A;  2ASD A;  3SSS A;  4G1P A;  4OHZ A;  2HHW A;  5LSR A;  3HVT B;  5D3G A;  2WHO A;  5JUM A;  2LA4 A;  1UKU A;  4ECQ A;  5D77 A;  4LSL B;  3P45 B;  2R2S A;  2MY7 A;  4GVB B;  3SZ2 A;  1VLO A;  4IO1 A;  4NI2 B;  2OGU A;  1WG4 A;  3N9U C;  2O3D A;  4Z7C A;  3CJ3 A;  4NLR A;  2J6T A;  4DMZ A;  4HTJ A;  4B3M J;  3GJS B;  3HJV A;  3NP5 A;  5L9N A;  4IOC Q;  3RAQ A;  4NZ6 A;  4FF2 A;  4YR0 A;  4O3O A;  1IR0 A;  4WTO B;  2ATC B;  2ZUG A;  2CPY A;  3TVY A;  2PMH A;  3M8P B;  4DPT A;  1AB8 A;  1YJ9 S;  1SC4 B;  1KRP A;  3SDE A;  3VAJ A;  1XTZ A;  2VBX A;  3LO3 A;  4IFY B;  3CDU A;  4OHV A;  2CDR B;  4USJ C;  1X4B A;  1BQN A;  5KT2 A;  2BAB A;  2OPP B;  2QMX A;  2ROE A;  2VQE F;  2KO1 A;  3RBE A;  5KT7 A;  1PIE A;  3VAH A;  1NH7 A;  5KFQ A;  1S10 A;  3PV8 A;  4F36 A;  3AD7 C;  1VCT A;  1N5V A;  2R42 A;  2AEJ A;  5CA5 A;  1IJF B;  2FLN A;  5J2M B;  2D9P A;  5GMD A;  4DX7 A;  4Z7Y A;  2XHC A;  1GMV A;  2MLZ A;  1XN9 A;  4HT7 A;  3GSD A;  2G0I A;  4NMX A;  5GMK a;  4DQR A;  2DR9 A;  4L73 A;  4X4P A;  3LGH A;  2MZS A;  4LF7 F;  4RUB A;  1F3V A;  1QDU B;  3R5B A;  5IOL A;  3ELH A;  4XK8 C;  1L3U A;  2HGN A;  1FEE A;  4OZN A;  3C6T B;  2AHO B;  3I5B A;  2J6U A;  2QV6 A;  5MLC V;  2J7W A;  4M5J A;  3R9L A;  2RF2 A;  3C8Y A;  1YJR A;  2CJA A;  2AYB A;  3NG8 A;  3CC7 S;  3DOK A;  3DM2 B;  5L9X A;  3A12 A;  5D0H A;  4WFB Q;  2KRB A;  3FSI A;  1FVS A;  1FTC A;  1KHW A;  4DUZ F;  2L41 A;  2VIH A;  5FD1 A;  3HSZ A;  4J7C A;  2MGZ A;  3Q89 A;  1R0B G;  1QAI A;  2QYG A;  3QAE A;  2IHR 1;  2QC3 A;  1AA1 B;  1RLC L;  3M8W A;  4DBQ A;  3CUL A;  2QJ3 A;  4LSZ B;  4KGM A;  5B0A A;  4ETX A;  3MMA B;  3CC2 S;  3KLF A;  2XLJ A;  1VQ5 S;  3I5A A;  2C2D A;  3CCT A;  4Q7A A;  3DLE A;  5HAN A;  2GJ2 A;  4UZC A;  3F41 A;  2HRT A;  4O4G A;  9ATC B;  2EFG A;  1PBA A;  4N41 A;  1ZET A;  5EX3 A;  1IKX A;  5T41 A;  1NK0 A;  4DDF A;  2J9E A;  3EZU A;  1RWP B;  4DQQ A;  3RB0 A;  3GYG A;  4IKA A;  4D3G A;  4DR4 J;  4WK1 A;  1NPR A;  1FWL A;  1SJ4 P;  2CYY A;  3MOZ A;  2ZM6 J;  2M52 A;  2PD1 A;  4DQI A;  4RW4 B;  2DO0 A;  1U1L A;  1EQM A;  1VC5 A;  3D0H E;  4TLR A;  3K8W A;  1C1C A;  1B0T A;  4HAC A;  3J81 U;  2KU7 A;  1U6B A;  3PEJ A;  4B9T A;  5CH7 B;  1JX4 A;  4LBI A;  3N6M A;  1T02 A;  4KYZ A;  4OLP A;  5KT5 A;  2G1H A;  1U7L A;  4CDI A;  1RK8 A;  2N7C A;  3L95 X;  3QT6 A;  1S72 S;  2HNY B;  1WKJ A;  4LMZ A;  2Y1L B;  4CLK A;  1MWQ A;  2H9Z A;  5IS2 A;  3CJK A;  1JIH A;  2XSJ B;  1NJZ A;  4PKD B;  4NYZ A;  2EPI A;  2EFN A;  2JOQ A;  4ES2 A;  2YH0 A;  2YXL A;  3JTO A;  3PYD A;  5DGB A;  3GV5 B;  1V6H A;  1BD6 A;  4DSK A;  4ZCM A;  5L1J A;  1N34 F;  1R8C A;  3T9N A;  4H4M A;  1IBL J;  1Q81 T;  4NX9 A;  4UUX A;  3HT0 A;  2QEX S;  2FVP A;  3HFK A;  1AYE A;  1IVZ A;  4WYW A;  2FIU A;  4QQB A;  4ANE A;  2ZKU A;  2KZM A;  1V5V A;  3FEZ A;  1D8Y A;  4R5P A;  3ETO A;  1IUJ A;  1TL1 B;  4CTA A;  2MEW A;  3K0J A;  3OSN A;  1GFW B;  2IRX A;  1N6Q A;  3CJT A;  2CPZ A;  4EGL A;  2MXY A;  2UVU A;  1RKJ A;  1X60 A;  2CQD A;  1QVF R;  1VHI A;  1S4F A;  3RRK A;  4NLV A;  4KGV B;  4NLT A;  5HMY A;  1BWV A;  1YKW A;  1S1V A;  2XSF A;  3KMQ A;  4GO7 X;  1FCA A;  2OHD A;  2LEB A;  3CDE A;  2RT3 A;  5LT5 A;  2ZH7 A;  1WC5 A;  2D3Z A;  1VQ6 S;  2HHX A;  4IDK B;  4DR1 J;  1XR7 A;  3HJF A;  1RSC A;  1RAE B;  1VHF A;  1W2B R;  3NKY A;  1PC4 A;  3HVA A;  1KEK A;  2Z2M A;  2GV1 A;  3W9J A;  3THP A;  2OPQ A;  2PI4 A;  3J81 j;  3OVB A;  4Y2K A;  2AGO A;  3TQ1 A;  4DSE A;  1H73 A;  1SUQ A;  4K2X A;  2F4V F;  1YG0 A;  4YP3 A;  2EK1 A;  2M2B A;  3MR3 A;  2HWH A;  5DQH A;  3TX0 A;  2JNJ A;  4UOF A;  5CAA A;  1YJT A;  1HNX J;  2BQU A;  4K4U A;  5F8M A;  3QAU A;  3QSY B;  4B3T J;  2XNQ A;  2DBB A;  3BDP A;  5LOQ A;  2AJ2 A;  1H72 C;  4KKO B;  1J5E J;  1RT2 B;  4QCL A;  5A6W A;  3TWZ A;  1FNM A;  1XWL A;  3SIP B;  1T8E A;  2K7J A;  3KKF A;  3CME S;  2OFH X;  2W7P A;  4K5S A;  5D0E A;  4OZ1 A;  4JI3 J;  4IUF A;  5BR8 J;  1YHQ S;  1T3O A;  1Y4Z B;  2E5L J;  5IC4 B;  2CJX B;  3N4W A;  2R8I A;  2J0X A;  3ZNJ 1;  1Z2Z A;  3DU6 A;  3CMQ A;  2DVI A;  1D9F A;  4X84 A;  2WW8 A;  4Y28 C;  4P2X A;  4CT8 A;  5F9L A;  3NS5 A;  2CPF A;  4CO5 A;  1O5J A;  1B3T A;  1CEZ A;  4X4Q A;  2AX0 A;  3LGM A;  1WC1 A;  1SJ3 P;  3MPW A;  4QW9 A;  4NXM J;  3D2W A;  1FNX H;  5I4M A;  4PYD A;  3GFZ A;  5HP1 A;  1DHM A;  1CVJ A;  1FF2 A;  2BOA A;  2HVZ A;  2R7U A;  4EZ9 A;  3D28 A;  1KBR A;  1OSD A;  4ECY A;  4EO6 A;  5CCL A;  1IBC B;  5A8W B;  4C4W A;  4JYA J;  1ZAW A;  3GTY X;  3M05 A;  4IR1 A;  2HFU A;  4FKX A;  3EPG A;  4U67 Q;  1FDN A;  4DN0 A;  3GP9 A;  2VOP A;  3UN2 A;  4RU9 A;  1RIS A;  4TU8 A;  3SCJ E;  3LUY A;  3ZTS A;  1G1X A;  2W8K A;  4ED4 A;  2CAJ A;  2HMI A;  1XMO F;  1OYD A;  3AH6 A;  1N5Y B;  4F2R A;  1APS A;  3W1Y C;  1T03 B;  3FEX B;  2NZC A;  3KLI A;  4NLG A;  1RB0 A;  1Q5Y A;  2EKN A;  3GQC A;  2O1P A;  4M5M A;  3Q8R B;  3PJX A;  3RYL A;  4ATN A;  2C3U A;  1PC5 A;  4IG0 B;  4J9M A;  3O3L A;  1JLA A;  2CPX A;  4TQS A;  1DBD A;  1E6Y A;  1IXK A;  4C3M A;  3VGS A;  2J0Q D;  3SCL E;  3FC9 A;  1JJH A;  1TUW A;  3TX8 A;  2VBY A;  3D1H A;  2KHD A;  5K9F A;  4U7C A;  1VK8 A;  3VHQ A;  2VA2 A;  1YTY A;  3W8P A;  1OIA A;  1PG5 B;  4ZVU B;  1WF1 A;  1ZA1 B;  2HHQ A;  2LXF A;  1RE1 B;  2HS0 A;  4O44 B;  1KOO A;  3FMW A;  1W7W A;  3D4J A;  2PO4 A;  1WSR A;  3DI6 A;  4RW7 A;  1REG X;  3PX4 A;  2XZD B;  2B5J A;  2XQC A;  1EP4 A;  2CXE A;  3NL0 A;  3HT3 A;  3I9Z A;  4PEO A;  1KQS R;  5LMN F;  1S9G A;  1A0O B;  4XDC A;  1BUX A;  4M5D B;  1JXV A;  2F3J A;  1X5O A;  2QLJ B;  2DTJ A;  4Q8E A;  5HK4 A;  1Q7Y T;  4LRD A;  1HHT P;  1A6L A;  4DQP A;  4CYU A;  4TN2 A;  1FWK A;  3CWJ A;  1SJQ A;  3LOU A;  4PWD B;  1N52 B;  3BPD A;  2P5V A;  1VRT B;  3DDK A;  3UQS A;  4QYZ J;  4USK A;  3KK1 A;  1N5T A;  1EAY C;  2YX1 A;  5J1P A;  5EDW A;  1EIY B;  2BE7 D;  4ZVS B;  3TUI C;  4UQT A;  1X4H A;  2HWT A;  1K9M T;  3K5N A;  5HRO A;  1QE1 A;  4PAA A;  2KFN A;  1XMQ J;  2E5I A;  3E3X A;  2ZBC A;  1R27 B;  1QTM A;  4ZVE A;  3K17 A;  1ZTW A;  2F4F A;  2Y1R I;  5KFS A;  2PA8 D;  1N33 F;  1NDC A;  1YJV A;  1HNW F;  2P8I A;  3AA9 A;  4TY9 A;  2M8D B;  2AKW B;  1FX2 A;  3PYE A;  1VQM S;  5HVH A;  1XIQ A;  1Q95 G;  5AJ3 J;  2F7V A;  5DDQ C;  2FHM A;  1VC0 A;  1NCL A;  2MTL A;  3N5B A;  4DR2 J;  1LEO A;  3KG1 A;  3I4H X;  2H5I B;  2K8G A;  3I0S B;  1BQM A;  5LXR A;  3TA2 A;  1CQN A;  3GPA A;  5GAG U;  3M6V A;  3PIP Q;  4P52 A;  1ROF A;  1ARO P;  3CO9 A;  4QWA A;  3NCR A;  1RQ0 A;  1U4B A;  3FQL A;  2E7V A;  2JL9 A;  2CJ9 A;  2FD2 A;  4OIX A;  2G2Z A;  3KHL A;  1D8Z A;  1VQK S;  2DB1 A;  2LYV A;  2A2D A;  3PTW A;  1Y3K A;  2ERR A;  4A8S A;  2B9E A;  4JV1 A;  1HBO A;  3T6J A;  4I56 A;  4BWM A;  1VBK A;  5I3U B;  4DPW A;  4B3M F;  3FJ2 A;  3K89 A;  2NUH A;  4J9R A;  1HBM A;  2HIQ A;  1Q0N A;  4N56 A;  5A2Q U;  3SI8 A;  1Y5L B;  4GMK A;  2HBQ B;  3GYN A;  3OR2 A;  3C2P A;  2CQ2 A;  2AWZ A;  2R8J A;  2HEK A;  4MYT A;  1WKK A;  3SSQ A;  4CIO A;  5FDL A;  1KTQ A;  1HR0 J;  1F5C A;  3GB0 A;  3M30 A;  5GAG I;  2D9O A;  1SC1 B;  4DR7 J;  4ICL A;  2N7Y A;  4NXN J;  4H4M B;  4OI6 A;  3KWM A;  3WC2 A;  3C14 A;  4TKT A;  3MAQ A;  4FN5 A;  3BR8 A;  2OIH A;  2ZH9 A;  4LRE A;  4Q43 A;  1YJ7 A;  3P96 A;  4KIA A;  4ILL A;  1ITP A;  1K44 A;  1S6Q A;  3T5L A;  1VFJ A;  4HTI A;  2XZW A;  3H8Y A;  3HX9 A;  4C0H A;  1IN0 A;  2ZHB A;  1RHQ B;  3HLU A;  2O66 A;  3DRR A;  1OY9 A;  4DCP B;  2AEM A;  2DIT A;  1S1V B;  4I2Q A;  3O44 A;  1NSA A;  3ILJ A;  2E9Z A;  3PCO B;  3TVK A;  3R6G B;  2LA6 A;  3D3B J;  3PO5 A;  2ZWP A;  2L9W A;  5ETO A;  2C42 A;  1VBZ A;  4DSF A;  3CD7 A;  3DDI A;  1YJW S;  2V50 A;  2I38 A;  5T7L A;  2O01 C;  3I32 A;  1KVJ A;  2K3K A;  3OXG A;  2YQ3 A;  3UDV A;  2RUS A;  3KK2 B;  4A8K A;  1LW2 A;  2HAF A;  5HMX A;  2XCP A;  3ZZ0 A;  4FXV A;  4CLL A;  5K8O A;  4NRT A;  1F1B B;  1ZM9 A;  2VL1 A;  5ETV A;  4ZPV R;  1UFL A;  1QSY A;  1UVK A;  2AW0 A;  4KE5 A;  3RU0 A;  4JI8 J;  3BB5 A;  5GAD U;  3VGU A;  1UVL A;  3DLG B;  2VC1 A;  3OTO J;  4AL6 A;  2JRS A;  1MRO B;  1CJU A;  5HO4 A;  4GO5 X;  2VPZ B;  2VG6 B;  3OFE A;  1K73 T;  2VD3 A;  5D4L A;  3R5G A;  3QRQ A;  2B4V A;  4DR4 F;  2OUG A;  4RNO A;  3EGN A;  5F9N A;  2RKI B;  2VOD A;  3CVK A;  2WSF C;  3VR1 A;  4HDG A;  5DM6 Q;  3Q83 A;  2ZUA A;  4XPE A;  3TW0 A;  4PQU B;  2DCU B;  4AXI A;  2FJB B;  1YBU A;  1CUL A;  5F3T A;  1CJK A;  4N8N A;  4LF4 J;  4IR9 A;  4ID5 A;  4O0N A;  2R3V A;  4JV5 J;  3LP0 A;  4G65 A;  4J91 A;  5A8K A;  4DSL A;  4PG7 A;  1U1O A;  2ZFH A;  4L3K A;  3MZI A;  4H4K A;  5CZV A;  3C15 A;  2KYZ A;  2CQG A;  1RWO B;  2GC8 A;  4DX5 A;  2R7X A;  1XER A;  3CO0 P;  1ZAV A;  3E51 A;  4EK2 A;  2G0C A;  5KT6 A;  3W60 A;  2UV8 G;  5K14 A;  4F04 B;  4LQ3 A;  3BQ2 A;  4WYL A;  3CSK A;  4LF9 F;  3PHE A;  2G9O A;  4RW9 A;  2HLU A;  3SFG A;  3US5 A;  2HAI A;  5G0R B;  1OQ3 A;  1IBL F;  3P5T L;  4EEY A;  2KYX A;  2P6T A;  2B4O A;  2OMO A;  4F3O A;  4ZMM A;  3THV A;  2BUN A;  1Q8K A;  2UUC F;  4DR5 J;  1QUP A;  1S1T B;  3H59 A;  3T1H J;  3AJ1 A;  1IWA A;  1UEK A;  3KLE B;  3DXB A;  3O6Q A;  1TL3 A;  1GT8 A;  3P8B B;  2MKJ A;  1X5P A;  4EYI B;  3HHD A;  5B0F A;  4P71 A;  3BRE A;  3WX4 A;  5D78 A;  2QSF A;  1VS3 A;  4C8Y A;  2F65 A;  4R8U A;  3H2U B;  2Z0G A;  4PRF A;  2OSR A;  3A13 A;  4NLQ A;  1O6X A;  3BBB A;  3PW2 A;  3OL9 A;  3ZTQ A;  1FRL A;  3H4D A;  3MEK A;  4QIG A;  3ITH B;  1TKZ A;  4DR1 F;  2UUA J;  2QG9 B;  1EET A;  1BC6 A;  2V94 A;  3Q23 A;  1RTZ A;  2B7B B;  3GCX P;  4M94 A;  1GK8 A;  1O8B A;  3Q8S B;  5B0D A;  3W2V A;  5GME A;  1S9E B;  2QL5 B;  2HHT A;  1F9F A;  2VH7 A;  3FCV A;  3R7S B;  2DNZ A;  3I56 S;  4ZA1 A;  3VWS A;  3NGS A;  4JI6 J;  2RUG A;  2PDA A;  2M8H A;  4KY3 A;  3VZH A;  1KKH A;  4IRD A;  4USI A;  2FVQ A;  3KXD A;  5F0U A;  3TUJ C;  3MCN A;  2YWW A;  4DEZ A;  2ASJ A;  4M63 A;  5KG1 A;  2WZ1 A;  2IPO B;  2JX2 A;  4WP3 A;  1U24 A;  2MJN A;  1J5E F;  2Z8Q A;  4KT0 C;  4KPY A;  1HD1 A;  2BYC A;  4QOT A;  2ZH4 A;  4M8L A;  3T1Y J;  4KB7 A;  3RB6 A;  3W7B A;  5IQQ A;  4JI3 F;  4QYR A;  3D6F B;  1XQI A;  2E5L F;  2R9L A;  3ZFV A;  4QU6 A;  1FJ7 A;  1L3K A;  1L5U A;  5KFN A;  2ZKT A;  4EMD A;  1YWX A;  2HRY A;  4A8O A;  2B9Y A;  1KLM A;  2R8G A;  1AUD A;  2JEI A;  5F0W A;  4NCG A;  1IKW B;  1ZM3 A;  2V2V A;  4WXO A;  4U7U K;  3EPI A;  4RL1 A;  3T41 A;  4URS A;  1JXE A;  3D1O A;  2V8H A;  3GE9 A;  1ZZF A;  4RBT A;  2XO6 A;  3NWR A;  3AB4 B;  2IM1 A;  4M5H A;  1SQF A;  2NXN A;  1PO6 A;  2CWX A;  4M5I A;  4B9N A;  3A3O B;  3NS7 B;  3ZZU A;  4PPD A;  1ZM4 A;  2HVH A;  3QGG A;  2BJ9 A;  1WEZ A;  4JYA F;  3M1V A;  3B6B A;  2RIL A;  3M2V B;  3JYT A;  2GGP A;  2XC9 A;  1TQL A;  5H1S V;  3OLA A;  3HFV A;  1PYS B;  4NLW A;  3MR2 A;  4EYH B;  1N32 J;  4G1Q A;  2HND A;  1ICE B;  4Y3C A;  2B7C B;  2WON B;  2AX1 A;  3UNY A;  1MWZ A;  4MIB A;  4OLO A;  2YKM B;  3FCH A;  3A8I A;  4DJB A;  3MEE A;  4ZVT B;  4PUO B;  3DLH A;  2KXH A;  3ZZT A;  5CQG A;  4JI0 J;  3RTV A;  2DRB A;  2DRA A;  2VON A;  1YSJ A;  4YME A;  4DX6 A;  4JI1 J;  2NSB A;  2XLK A;  4DPX A;  2CJY B;  4ETZ A;  2X1G A;  1UEU A;  1GMU A;  3MM9 A;  2FZC B;  3K5O A;  2WSC C;  4K0K F;  2DHS A;  2BRL A;  4H4K C;  3MMB A;  1E6V A;  3TAM A;  1K1S A;  3OFF A;  4LRB A;  4RJV A;  3TAP A;  4ZJQ A;  3TZX A;  3IGV A;  2AJ0 A;  3BBC A;  4DX8 H;  5H9E K;  1QTN B;  2VHG A;  1UPP A;  2ZDO A;  1H2V Z;  1S5Z A;  2WB1 D;  3JAM Y;  1HA1 A;  2FY1 A;  4A46 A;  3BPS P;  2UXC J;  2GQC A;  1SB6 A;  4A8Q A;  1SQE A;  2J0S D;  2ZJQ Q;  2HQD A;  2CUY A;  1BWE A;  1OJ4 A;  1DLO B;  3BO4 A;  4Y0F A;  1WDD A;  1RAA B;  2CPD A;  3CJ2 A;  3LP1 A;  2MKY A;  2HZV A;  3F56 A;  3ZC4 A;  2H4W B;  3O1L A;  3A8J A;  3KDN A;  4CWB A;  3OTE A;  1S6P B;  1X7V A;  3VF0 B;  1URR A;  1B64 A;  4QIW D;  1S6U A;  3UFC X;  2DNO A;  3BGR B;  2VJU A;  4CO0 A;  4P6Q A;  3D54 A;  3LW5 C;  3WX8 A;  4OZ5 A;  1RBO B;  2MQL A;  1UVI A;  4NOH A;  2FVS A;  1HNZ J;  2HQG A;  4L6V 3;  4KJI A;  3DOL B;  1XNQ J;  3DYA B;  2OFG X;  2GX8 A;  1I1G A;  3BKF A;  2MMY A;  2GCF A;  1DTQ A;  4Y6I A;  2G0J A;  1NK7 A;  2R8H A;  3SQO P;  4WE1 A;  3KHH A;  5HSP A;  1RWV B;  2WW4 A;  3VGV A;  3GMG A;  1MN7 A;  4EBD A;  5EX0 A;  2EVZ A;  4U96 A;  3MD1 A;  1QJH A;  2HWI A;  3GII A;  1JLB B;  1DRZ A;  4FDF A;  5L8R C;  5T7L B;  2HBR B;  1SJ1 A;  4EFA C;  1GTH A;  3PM9 A;  3TUP A;  1NO8 A;  3NGU A;  2VIC A;  2V4J B;  1N48 A;  5AJ3 F;  1CJT A;  2DD8 S;  1G6B A;  3ILO A;  3IG1 B;  3BS9 A;  3NNA A;  4NCB A;  4I1T A;  2B3T B;  3M2R B;  1W2I A;  3UR0 A;  2WBR A;  3DOM B;  3GJQ B;  4J9O A;  5KG6 A;  4RW6 A;  3AJD A;  4WK3 A;  4LF8 F;  3BF4 A;  1WEL A;  5DDR C;  4DS4 A;  3BN4 A;  4ZHR B;  2CZV C;  4K4W A;  3TUZ C;  3J7A 1;  3MM5 A;  3BZQ A;  3NAH A;  5HAO A;  3HHK A;  2W2M P;  4DL0 C;  3LQV A;  5LMU J;  3ULH A;  3V2U C;  2UV8 A;  1RBL A;  2HGL A;  4K8R A;  4P7T A;  3CCV S;  4UOC A;  1RU2 A;  2C2Z B;  1SV5 A;  4Y34 A;  1Q78 A;  3EXC X;  5KG5 A;  1UZD A;  4Y2C A;  1K8A T;  3LPE A;  3QZ8 A;  4OJG A;  3RR7 A;  2C3Y A;  2CQC A;  3B82 A;  2H54 B;  3EDR B;  1RWU A;  1ZPV A;  3MEC B;  4YB6 A;  4YOE A;  4DL3 A;  1PJ5 A;  5J2Q B;  4DZ6 A;  2D69 A;  5C24 B;  2H51 B;  1RTH B;  1NK5 A;  1D1U A;  3GJT B;  3BYR A;  5BYQ A;  2MYF A;  2MKS A;  1U2R A;  2WBM A;  3G6V A;  2FVR A;  3R5A A;  1IBK F;  2PFF B;  5I3Q A;  5J1N A;  5GAH U;  4RWW A;  3VAF A;  1C0U B;  4YQW A;  3QO9 B;  5KFI A;  3VV2 B;  3OLB A;  4WP8 A;  1CBK A;  1RP5 A;  2W01 A;  1AT1 B;  2KI2 A;  4UOH A;  2Q1L A;  1RTI A;  1PGZ A;  2YKQ A;  5JXS A;  2CPE A;  2V8P A;  3TJA A;  4G1I A;  3AXM A;  4ZP7 A;  4UZB A;  4QW8 A;  1ZBT A;  3FUY A;  2ZBR A;  5HBM A;  1SKR A;  2B4U A;  1VR6 A;  3PRB A;  2A6M A;  2R7R A;  3T19 A;  4E8U A;  1U47 A;  2DR7 A;  2FC8 A;  3OD2 A;  5KFA A;  3UD5 A;  1G2E A;  1FRI A;  4OI3 A;  5C5J A;  1VMB A;  1F3F A;  1CQM A;  3MM7 A;  1TK5 A;  5KFB A;  3MUT P;  2NXE A;  4DOZ A;  3RAX A;  5GAH I;  1LQ9 A;  4MK7 A;  2V63 A;  5KFZ A;  4RNN A;  3EJM A;  2YKN B;  1JLE B;  2Y0S D;  3LP2 A;  3AOA A;  5D0R A;  2KZZ A;  4LF2 A;  1S1W A;  4JI8 F;  1T9W A;  2KT2 A;  1I6J A;  1REV A;  1NND A;  3CJ0 A;  2YPZ A;  3TZZ A;  2F8M A;  5HLF B;  3OTO F;  5EWE A;  4QIE A;  1ZZN A;  3HHN B;  5LL6 d;  1HBN B;  2AYM A;  2JLG A;  5B0C A;  1UEV A;  5H9F J;  2IRY A;  4Z2X A;  4F3M A;  2W9C B;  3HD1 A;  3G82 B;  2RJZ A;  3S8S A;  1LKZ A;  3VQS A;  4AQY F;  1HPZ A;  2ASY A;  2IVY A;  2D3U A;  3OBI A;  2ADC A;  1RHR B;  4ZIW A;  2FQQ B;  3CCW A;  1FER A;  4P75 A;  2HHV A;  2BM0 A;  4ZLP A;  2FPH X;  5C2C A;  2DEJ A;  2FLL A;  3IS9 A;  4FPR A;  1Z1Z A;  4Y2M A;  4JV5 F;  2IRU A;  3GR0 A;  4LIW A;  2FJE B;  1NDP A;  4DR6 F;  2CQH A;  4ZN1 A;  2GIQ A;  2DJW A;  4W98 A;  2VAS A;  2AT1 B;  4C11 A;  1SIZ A;  1YRT A;  2B56 A;  3HCX A;  2KT3 A;  5L1I A;  5CYM B;  1LXN A;  2MQN A;  4OFZ A;  1LWX A;  1HYS A;  2M4M A;  1WOR A;  3RJM B;  2V4Q A;  5LM7 E;  1U1M A;  4I69 A;  3NNH A;  1P1T A;  2ZOF A;  2XI2 A;  3CED A;  2DCL A;  3MHY A;  4DR5 F;  2UVW A;  2XNR A;  1A9N B;  1FXL A;  2VFR A;  2UP1 A;  2BW7 A;  3CCQ S;  2VUG A;  5D6G A;  3DRP A;  4OZL A;  2YQ0 A;  3P3D A;  2PT0 A;  4LFB J;  1RWN B;  1TL4 A;  4LRF A;  4DV0 F;  5DET A;  1WOP A;  1R7I A;  4RW8 B;  3HVT A;  1YLX A;  2VKZ G;  2PMW A;  4LSL A;  2I0X A;  2RQ4 A;  2H4Y B;  3EE3 A;  1VQS A;  1D0E A;  4GVB A;  4YR3 A;  3TJ9 A;  4RUC A;  1S4E A;  4NI2 A;  3I0R B;  1FRM A;  2A18 A;  5B7W A;  2LU2 A;  2UUA F;  1Q1K A;  5KT4 A;  4LFC J;  4PPZ A;  4J90 A;  4DFM A;  2XY7 A;  4LR8 A;  3LGN A;  1JJC B;  2BXJ A;  3X1L B;  4ZLL A;  2DGW A;  3DLB A;  3PFE A;  3TYT A;  4Q0B B;  2JWN A;  4NLP A;  3KLV A;  1GXU A;  4JI6 F;  2YTC A;  4YHH J;  4FKY A;  2KJV A;  1VJQ A;  2QTW A;  2FJX A;  1OSC A;  2J7U A;  3IR6 B;  2OPP A;  3PNI A;  1ELO A;  1JLF A;  3W65 A;  2A10 A;  2MZ1 A;  1B7Y B;  4DWI A;  2QGF B;  1KFD A;  2JEG A;  2F9D A;  1O51 A;  4F0M A;  4LFA J;  5J2M A;  1NBE B;  4ITS A;  3QT5 A;  2LKZ A;  4ZP6 A;  2N4D A;  3MM6 B;  1SH2 A;  3SFU A;  3CIM A;  1UL3 A;  4GVL A;  1Q4R A;  1X0P A;  1KSP A;  3GIL A;  3W64 A;  4BC7 A;  3U27 A;  1BGX T;  2VBZ A;  3HHL D;  3QT8 A;  2YVS A;  4YFU A;  1RT5 B;  5CYQ B;  3HSJ A;  2CNL B;  4RLE A;  2AJF E;  3C6T A;  1UWA A;  3JQJ A;  2BKN A;  1TUV A;  4OJ1 A;  4J9L A;  3MED B;  1LWC B;  5KG2 A;  3BO2 A;  2W4C A;  3AQO A;  3OXF A;  3DM2 A;  4O3N A;  3K8V A;  1VJW A;  4K7Q A;  1ZS6 A;  4H4O B;  5T14 A;  4I4B A;  5AE3 A;  1HI0 P;  4A47 A;  2ZNY A;  2PII A;  2NPI A;  1PJ6 A;  4X64 J;  1S6O A;  1RI7 A;  4GKK F;  3P4U B;  1T0T V;  2XEX A;  2DHG A;  2ZOG A;  5ITH A;  4EZ6 A;  1SKS A;  1DQ9 A;  3ZTP A;  2E1P A;  3MMA A;  3M7V A;  5IV4 A;  1JJ4 A;  3CJ8 A;  2JLF A;  4ILR A;  3AOD A;  3T9Z A;  1HNV B;  2OTJ S;  4JI2 J;  4TLQ A;  5ETQ A;  2XMU A;  1CJT B;  1RU1 A;  1U1R A;  2EW9 A;  2Z2L A;  1IKV B;  5F8L A;  1VQY A;  2COL A;  3ISZ A;  2OEK A;  1SC3 B;  3PY8 A;  1WUU A;  3W2W B;  1FJC A;  1GTE A;  2E7W A;  3VVU A;  4DV5 F;  3HHL C;  4ZKA A;  4TNO A;  2J9D E;  3MCO A;  4I2P B;  3H98 A;  4L76 A;  4RW4 A;  1KWM A;  4JI0 F;  3A1Y G;  4KFB B;  3JAM U;  4QIF A;  2F63 A;  4JI1 F;  3FKB A;  2J0W A;  1YBA A;  3CCR S;  1P8G A;  4MIA A;  3IXQ A;  1NJY A;  1OQ6 A;  1I3O B;  2CZ4 A;  5KFU A;  2HNY A;  4YB1 P;  2CWK A;  4RNH A;  4AUK A;  3K58 A;  3T5H A;  4ZLN A;  2XSJ A;  3H5U A;  1ZTT A;  4N5S A;  2DR6 A;  3POT B;  3N28 A;  2RRB A;  4I6W A;  2UXC F;  2RRA A;  3MPY A;  4HI1 A;  3CB4 A;  4PG6 A;  3FBF A;  1LOU A;  5ETT A;  2VF3 A;  4F4Z A;  4OYP A;  3CJS A;  2DGQ A;  3BGL A;  2P9G A;  3FEY B;  1WSV A;  5CD4 H;  2M9K A;  2RVJ A;  1FD8 A;  4WFY A;  1Z4U A;  1TR0 A;  2NYH A;  4Y2A A;  1NK4 A;  4ES3 A;  4YDD B;  2J7K A;  1Q8I A;  2LQ5 A;  4DCO B;  3EDQ B;  3M9O B;  2MY8 A;  4BBY A;  5IT9 U;  2F5G A;  1TL1 A;  1U1N A;  1T9X A;  3OW2 R;  3OVA A;  2XS5 A;  4B02 A;  5HAT A;  4DU7 A;  4QYZ K;  2MZR A;  1N36 J;  2RIJ A;  2GAH C;  4U7U D;  2XG8 A;  4F4X A;  1XNQ F;  1T9T A;  4FS2 A;  4UTG A;  5E5N A;  4B3S J;  3GWC A;  2BA9 A;  3RB3 A;  2MHN A;  3AT1 B;  1WG1 A;  3D1Q A;  4C8M A;  1K1Q A;  2W2O P;  4Q45 A;  2M88 A;  4IDK A;  3NCQ A;  2BEF A;  4DFP A;  2QO3 A;  3QJJ A;  4J9U E;  4YS2 A;  3M8Z A;  3GFY A;  4N47 A;  4LF6 J;  3VVT A;  3NLC A;  3UVJ A;  3P6Y C;  3MUR P;  3LAK A;  2DH8 A;  1VQP S;  1H7X A;  3L7O A;  5I42 B;  3QIP B;  2AZ3 A;  4OI1 A;  4DFJ A;  2P6S A;  4ED2 A;  4J9P A;  4MT1 A;  3IM8 A;  5H9E J;  2F8E X;  2K7K A;  1F5B A;  1EHW A;  2FDN A;  1SBR A;  1KC8 T;  5K8M A;  4I6Y A;  3MTJ A;  5J1E B;  2EK6 A;  4LUB A;  4EWT A;  3H7H B;  4OQJ A;  2CNK B;  3CW2 C;  3MGJ A;  4KKO A;  1X4C A;  1RT2 A;  5CAB A;  3I96 A;  2V67 A;  5KFR A;  3KDO A;  1WG5 A;  4OZ0 A;  3PKY A;  2J76 E;  2IYI A;  2EWH A;  2H5J B;  4ED5 A;  2GJI A;  2BQ3 A;  4NLX A;  4R0E A;  4MYU A;  1X8D A;  2HBZ B;  3TRG A;  1QSL A;  1R0C B;  3Q86 A;  1L3T A;  3HHL B;  3MMC B;  1YGY A;  4RU2 A;  4ZVQ B;  5JVH Q;  4Q2L A;  2GA7 A;  5J2N B;  3DLK B;  1FRX A;  4IFV B;  4IQM A;  1FKP B;  2FHK A;  4BCA A;  4JB8 B;  2V4R A;  2AEF A;  2B43 A;  2ZOM A;  5EGY A;  4KGK A;  4DV4 J;  4K5R A;  4GRS A;  3K59 A;  3PX6 A;  1SVD A;  1WTB A;  3UCU P;  2FHJ A;  4R0J A;  4JI4 J;  5AE2 A;  1P9Q C;  4UOG A;  5K8N A;  2AGQ A;  2OEM A;  2DIV A;  2G13 A;  4QWB A;  4CLF A;  2OML A;  3KOA A;  2PFD A;  7FD1 A;  4ECZ A;  4I7F B;  1JQG A;  3ONQ A;  3HKW A;  3QWP A;  2MQM A;  4USW A;  1S1U B;  3NMA A;  1N5Y A;  3IBC B;  5DGA A;  1T03 A;  2XWX A;  4K2J A;  4S0M A;  3TAN A;  1U09 A;  5JVG Q;  2RSQ A;  2JEJ A;  1LWE B;  3IR5 B;  3ADA C;  3B78 A;  2FZG B;  4OX9 J;  2F9J A;  5CD4 A;  2D1C A;  1RAB B;  4WZM A;  2VQF J;  1TEL A;  1LV5 A;  4IG0 A;  1IM4 A;  3L3C A;  1M5S A;  1UMJ A;  4AYB D;  1FES A;  1JWW A;  1R8A A;  5EUH A;  1X4G A;  5M2R A;  4GC6 A;  1Q82 T;  4X2B A;  3TAQ A;  3CMA S;  3QGP A;  2QA4 S;  1J27 A;  3IRX B;  3M8Q B;  5K8P A;  2ZE2 B;  1TTH B;  2B6A B;  4DG1 B;  5G4D A;  2HFS A;  5KFJ A;  3H25 A;  4WCE Q;  4JP8 A;  1VIS A;  4G6V B;  4O44 A;  1SJF A;  4F7V A;  2XB2 D;  5AE1 A;  2IY5 B;  2UXD J;  5DG9 A;  1FRK A;  5DDO C;  3KUH A;  2WVE A;  1UAW A;  4NLU A;  2BJ8 A;  1HIY A;  1R8B A;  3UR3 C;  5LXY A;  6AT1 B;  2UUB J;  1TL7 B;  4BHQ A;  1NU4 A;  1YBT A;  3HM9 A;  5E0O A;  2E5G A;  3I9V 9;  1IBM J;  2PA3 A;  4OX7 A;  1RCO B;  1JLF B;  4V19 X;  1S7I A;  1YQH A;  2YKP A;  2NYI A;  4M5D A;  2GNK A;  2Q66 A;  3H90 A;  5D4P A;  2JC0 A;  2CFX A;  2ROG A;  5KFG A;  4ZS6 A;  2CQB A;  2AQ4 A;  2RRN A;  2ZH8 A;  1WHY A;  3I82 A;  2IBO A;  2LQJ A;  3FFI B;  4PWD A;  3GYX B;  3V4I B;  1VRT A;  3EM1 A;  4F4W A;  1FHT A;  4U9R A;  4X62 J;  2C3M A;  1N0V C;  2BJE A;  3M9N B;  1QLN A; 
#chains in the Genus database with same CATH homology
 5LMU J;  1HR0 J;  5IWA J;  4DV2 J;  4NXM J;  3D3C J;  3T1Y J;  4KHP J;  4GKK J;  2MTL A;  4DR7 J;  1IBL J;  4LF4 J;  4NEY A;  4DUZ J;  2KVQ E;  4DR2 J;  1N36 J;  4AQY J;  1N32 J;  2UXD J;  4V1A k;  4LF5 J;  4JV5 J;  4YHH J;  4DR3 J;  4DV0 J;  4DR4 J;  4NXN J;  4B3S J;  4DV7 J;  3R2D J;  2VQE J;  4X64 J;  4B3M J;  2UU9 J;  1HNX J;  4LF9 J;  2ZM6 J;  2UUB J;  3R2C J;  2UUA J;  4YY3 J;  4LFB J;  4B3T J;  2UXB J;  2MEW A;  1N33 J;  4JI8 J;  5LMN J;  1HNW J;  1IBM J;  4JYA J;  2HHH J;  3J81 U;  1J5E J;  4DR6 J;  4JI0 J;  2KL8 A;  2UUC J;  3OTO J;  1XMO J;  4LFA J;  4OX9 J;  4LF8 J;  4DV6 J;  3J80 U;  4DUY J;  1IBK J;  4K0K J;  4LF6 J;  4KYZ A;  4JI2 J;  4JI1 J;  5FLX U;  4DV1 J;  2VQF J;  1N34 J;  4DV5 J;  4X65 J;  1XMQ J;  4HHU A;  4JI3 J;  3IMQ J;  4LF7 J;  5BR8 J;  4JI6 J;  2E5L J;  4X66 J;  1HNZ J;  4KY3 A;  4DV4 J;  4DR5 J;  3W1Y C;  1XNQ J;  3T1H J;  1XNR J;  4LFC J;  4RJV A;  4JI4 J;  4DR1 J;  2MQ8 A;  5A2Q U;  4JI5 J;  3D3B J;  4NEZ A;  2F4V J;  4DV3 J;  3J7A N;  4X62 J;  5IT9 U;  1FJG J;  4PWW A;  4JI7 J;  1I94 J;  3JAM U;  4GKJ J;  5LM7 E;  4B3R J;  5AJ3 J;  2UXC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...