4DUTA

The structure of nucleoside diphosphate kinase (ndk) from burkholderia thailandensis
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
140
structure length
140
Chain Sequence
ALERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVAARMAHLSRADAEKFYAVHAERPFFKDLVEFMISGPVMIQVLEGEDAILKNRDLMGATDPKKAEKGTIRADFADSIDANAVHGSDAPETARVEIAFFFPEMNVYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
total genus 44
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4dutA00
5BXIA 4ANEA 1WKKA 2HVDA 4ENOA 1JXVA 1NSPA 4O0NA 3PRVA 3Q8YA 3VGTA 3Q8VA 4CP5A 3BBFA 1NDCA 3B54A 2DXEA 1KDNA 3EE3A 1WKJA 4UOGA 1NDLA 1S57A 3ZTQA 3ZTPA 1BHNA 3EVOA 1PAEX 1B99A 1HHQA 4ANCA 4EK2A 4F36A 3FCVA 3VGVA 1WKLA 3VGUA 3EMTA 4C6AA 3GP9A 1LEOA 3ELHA 1NCLA 3ZTOA 1LWXA 5C7PA 3FCWA 3G2XA 1K44A 1F6TA 3BH7B 3NGRA 3DDIA 2HVEA 1NSQA 2AZ3A 1NHKL 2AZ1A 3GPAA 4HR2A 2ZUAA 2DY9A 1W7WA 5CABA 5IOLA 1VYAA 4FKXA 4F4AA 1NDPA 2BX6A 3ZTRA 3NGUA 1XQIA 3FBCA 2BEFA 1EHWA 3EVMA 4UOFA 3EJMA 1NLKL 3PJ9A 2B8QA 1U8WA 3R9LA 1MN7A 4WBFA 4ANDA 4DI6A 1S5ZA 1NB2A 1NPKA 1ZS6A 3ENAA 3FBFA 3DKDA 2VU5A 3B6BA 3ZTSA 3VVTA 1MN9A 1HIYA 3L7UA 3NGTA 1HLWA 2NCKL 3Q83A 1PKUA 3WX8A 3FKBA 3VGSA 1F3FA 4S0MA 2HURA 3ETMA 4DUTA 3NGSA 3FBBA 1BUXA 3MPDA 2B8PA 3Q89A 1NSKL 3FC9A 4W98A 4UOHA 3EICA 3VVUA 1NDKA 3FBEA 3Q8UA 4DZ6A 2DXFA 1BE4A 1S59A 2DXDA 2DYAA 1NUEA 1UCNA 1XIQA 3Q86A 4FKYA 5CAAA 1B4SA 3BBBA 3EVWA 4KPCA 3EM1A 2CWKA 3JS9A 3BH6B 3BBCA
chains in the Genus database with same CATH superfamily
4CM0A 5LOQA 3S6EA 1M5OC 4I7FA 4F0MA 2WW8A 4KGZB 3FCHA 1CS4B 3EWGA 4DR6J 2R42A 5HROB 1WKJA 1UJ5A 2HEKA 2QLXA 1N5VA 1YI2S 2HBQB 2D3O1 4B9UA 1X5SA 4KGKA 2AIRB 5KOWA 1NSAA 4CZCA 1K73T 3KG0A 3LPYA 2DO0A 3I87A 1N36F 1K1SA 3NGUA 3H2LA 3KLEB 1RYSA 1NZ8A 2DHXA 2HG4A 2NREA 3PW0A 2B8QA 4E2FB 2OH2A 4M5HA 2H51B 4F4KA 3QFWA 3ADAC 2NCKL 1YBUA 1Y5IB 5HVFA 4EO8A 1UA1A 2K7KA 2Y1JA 1IKXA 3JSBA 2UV8A 3N6LA 4LF8J 5EGYA 2MQNA 4ECRA 1O0PA 5KT6A 2W2NP 2YKMB 2YQ1A 3M2RA 3QGHA 1RBOB 4LSLA 1JLCA 3J7YU 4ZDNA 3TRGA 4AUKA 2HHXA 1X4AA 2OD6A 3B82A 2JZ5A 2HVDA 3LQVA 3VHQA 3ZZYA 4X65F 2ATLA 1GX5A 4M63A 1N5QA 1FD2A 4DL2A 3TUIC 2EFQA 5J2NA 2HZCA 5B0EA 3R1LA 3N0VA 3ENQA 3CIZA 2JDJA 1HR0F 1RTDA 3D6HB 2UUCF 1F1BB 2OPSB 2N3OA 1BY9A 1NH8A 1SI9A 3IBFB 1RHMB 1T03A 5M2UA 4BHQA 1FE0A 1Y3KA 1BQXA 3BGFA 3O5TB 1FEHA 3A8JA 2ACYA 4EO6A 3W65A 1FE4A 4U7UD 1M5KC 3R6GB 4WFYA 4BCAA 4KIAA 2EFPA 4WYWA 1U0HA 2AKWB 1JLFA 5K20B 2C42A 1DTQB 2KG0A 1XBWA 1XTZA 2PO4A 3HP6A 3JXOA 4X4QA 4X65J 4WXWA 4ECYA 2CPFA 1TL1B 2COLA 3J7Z5 4DQPA 1V3ZA 5K14B 2FUG9 4NLSA 1YIJS 1WG5A 2JWNA 1ZPVA 2UUCJ 1NKCA 2VKRA 1N56A 2C2ZB 5AE2A 5KFRA 2VF3A 1K47A 4RWWA 1LKZA 2VJUA 1R27B 3LWMA 2QLJB 1IQZA 2QT7A 1FX4A 3M30B 1I6JA 4GMKA 1R6VA 3AQPA 5K9FA 1FTCA 2R7WA 4NPOA 2WBRA 3PO5A 2WRMA 4KHMA 1PYTA 1TL7B 2R3VA 1XERA 3D28A 5J1EB 2FHJA 2RKIB 2QMWA 2YXLA 2WOMB 1FXDA 2XZDB 3IRXA 4OJHA 1UW9A 3BQ2A 2DR8A 1F3FA 2XHCA 2P9CA 2LU2A 5BYRA 3PW7A 5DQGA 2GVZA 1KD1T 2UXDF 1WC5A 1FNXH 3JB9k 1FJCA 4K59A 4DV2F 3B4DA 4QR1A 3H2VE 1S1VA 5L46A 5GAEU 3NCQA 1X60A 4DMZA 1VBZA 2C2OB 2DISA 1AFJA 4EWTA 2IM1A 3ISNC 2H5JB 1HWIA 3OFGA 1C0UA 2HIQA 3M2UB 1KOHA 2FC8A 1NJIT 2VA3A 3C66A 9ATCB 2KHCA 2OMLA 2VG6B 3IXQA 4YB6A 1JMTA 4WTYA 3PIOQ 3DLBA 3ENWA 3GPAA 3H7HB 5D77A 5F8JA 1EQ0A 2Y3YA 2DVIA 4FVMA 2DHSA 3AY0A 3M4XA 1NH7A 2HMIB 1U47A 3HD2A 3VWSA 1P1TA 3UFCX 2HGNA 2UXDJ 5B0AA 2X1GA 4OJ3A 3MUTP 5EN1A 1LQ9A 1QUVA 3CCES 3Q89A 1RT7B 1OSDA 2Z2MA 1Q95G 2NZ4A 4B3OA 3SV3A 4YR3A 1FFSB 3L09A 2WSCC 2WCXA 4WKRA 4WP3A 1S7HA 1I51B 5ETPA 3TZXA 1DZ5A 2WONA 3LWLA 3MEDB 3RBDA 4ZP9A 3V2UC 4ED3A 2BDPA 3EMTA 5KFCA 4IH6A 1GMWD 2DGOA 2FLPA 2J6SA 3D1QA 1RWPB 4ZCKA 3MM8B 4UTGA 1U1MA 1ELOA 2FD2A 4F2SA 3D6MB 3BGLA 2Q43A 2HFZA 2VBWA 3DLKA 3OFHA 3FFIB 2OD4A 1IKWB 4CDIA 1C4AA 2R2RA 1FK9A 3QSIA 4BWMA 2DY1A 4IH5A 3MTKA 2XYGB 1BUXA 2ZVIA 1AA1B 2ZWOA 1LW2B 3SQOP 1WOSA 5CXTA 3TNVA 4OL8A 3S1TA 3QJPA 4MYTA 1HYSA 2O3DA 4JP8A 3BR8A 1UCNA 1PYSB 2HNYB 2KM8B 4K4UA 3BH6B 2KXFA 3H5UA 3BDPA 1T94A 4ECZA 2VFTA 2HHWA 1S57A 4H4MB 2IYIA 3CJQA 1LEOA 1YTYA 3V6DA 1IBKJ 2KVQE 1IXKA 2CJQA 2VA2A 1WEXA 3MPYA 4DX8H 1S6QA 3M1VA 4URGA 3C6UB 1A7GE 1Q5YA 1N5TA 2OLWA 4DPUA 4HT5A 1KN6A 3PYFA 4LF6F 2W9CB 1OMSA 4F25A 1H7XA 1NKBA 4AL6A 4J9MA 1REGX 1S1WB 2CZ4A 1JKHA 1M5SA 1FVQA 1FRJA 1GK8A 2ZKUA 2CQGA 3KLHB 4C8MA 2DBBA 2R2TA 5C42B 1FI4A 3DRRB 3I55S 1VHFA 2U2FA 4YB7A 2NSCA 4A8WA 1B0PA 2XHWA 2CPXA 3THTA 4TVAB 4CT8A 4LF5F 3PJXA 1KHWA 1RAGB 4YR2A 3Q8VA 3QRPA 1WWHA 3KJVA 4DG1B 3CCJS 4ZJQA 3W2VA 2H3EB 2IM3A 2RUGA 3VALA 4C6AA 3GP9A 1BQNA 2JLEA 2BANA 3TEHB 2D41A 1TKTA 1T3NA 2RS2A 3M2VB 2VG5B 2RDJA 1IN0A 2IJFA 5L39A 4LF6J 2DGWA 3CSKA 3EX7B 3ETOA 2BJ7A 2BA9A 4QIFA 3IAM9 4NCGB 4CO2A 5ITHA 2DGVA 1S76D 4HT7A 4KKOA 4RWXA 4OI3A 4A4JA 2QA2A 1MWQA 2ZE2A 4JI2F 2QG9B 2RS8A 4C48A 4MK9A 2ATCB 3HVTB 3UD3P 3MGJA 2B9WA 2CNKB 4LQ9A 1OPZA 3ZO7A 2CPHA 3H90A 1S97A 3MEGA 4RL1A 5ETNA 4RBVA 2PDAA 3KUGA 4OZNA 3VAJA 3LP2A 3MCSA 4OYPA 3A8EA 2RILA 2G2OA 1RTIA 2DCLA 3MD1A 4JI7J 3NAIA 3PR4A 1L3TA 1CJKA 5KFZA 3CC4S 4CT9A 4QIGA 1SJQA 4KHRA 3OFEA 5CYMB 1VMBA 3W9HA 1K44A 3O44A 3GFZA 1U6ZA 2BRLA 4JV0A 3CJ0A 3HKZD 3FEYB 4RLEA 3D67A 2JHEA 2KHDA 2B4VA 4L74A 3KNAA 2Z0GA 2POKA 2RVJA 3ZNJ1 2PFDA 3QMQA 3UNGC 2IY5B 1ZH5A 4Q0BA 1S6PB 4DUYF 4JI2J 3CIMA 1QSLA 4I6WA 4D3HA 3TWZA 1RWMB 1HMVB 2GV1A 4P75A 1OSCA 1RUSA 1Q7YT 4ID5A 1BMQB 2M7SA 1WTFA 2XMVA 5JMNA 3U7JA 3WX4A 2A18A 4CYUB 4LRCA 1PC5A 2E9ZA 3BBCA 1MROA 3F0NA 4ECXA 2VQEF 3DM2A 2B9YA 2ZUGA 2NPIA 3ILOA 3CMQA 2IBOA 3CCQS 3UCZP 3MM9A 4LFAF 4ED6A 2LQBA 2UUWA 4M5IA 3R97A 1FO1A 1VJWA 3MEEB 4F4XA 1CQMA 3E01B 2AX0A 4QIWD 3UWTA 1MWYA 2ZHBA 2BV3A 3CGIA 2V8PA 4P6QA 2YBVA 3GMGA 3FK4A 3EJMA 1IWGA 1ZM3A 4MKYA 5FDLB 2CPJA 4WBFA 2ZH7A 1TU0B 3BSAA 3DGPA 4Y00A 2Z2YB 3KWMA 2IA6A 2ZC3A 5SZTA 5KFPA 1HLWA 2DR5A 3NP5A 2V4JA 4ID8A 1PIEA 2AYMA 1HNIB 2R7XA 5IT4A 4J9KA 1VK8A 3KG1A 3BGUA 3K5NA 3U02A 5LXRA 2OFHX 1RACB 1U2RA 4JI5J 3LOUA 2JLFA 2L48A 5IWAJ 3D0IE 3W7BA 4EEYA 4LFAJ 1JLQB 4Y2KA 4YMEA 3UNYA 1U6BA 3M8ZA 2ZJQQ 4DS5A 4HHHA 1S79A 3BH7B 3QBCA 4MIWA 2MY7A 2ZBQA 5E3CA 4JI1F 2AZ1A 2DCUB 3I82A 4ECWA 5CYQB 4ZPTR 4B9TA 4ED4A 3T6JA 3PJWA 3PJ9A 2FB0A 2KYXA 3OL8A 2IDEA 1S1UB 2ZFHA 3VTIA 3ZTSA 2BW2A 3BN4A 1NAQA 2HBZB 1SJ4P 1SC3B 3NEKA 3G8SA 3IP0A 3VGSA 2DRDA 4PEOA 2MLXA 2HHTA 3TW0A 4PG4A 3HT0A 3ZC4A 1AFIA 4I7FB 3LALA 2C3UA 3PYEA 4LF4F 2DYAA 1S0NA 4K4TA 4QR0A 2HHPA 2FZCB 5E2QA 4CNYA 4O0NA 2AEMA 4JOUA 4UOCA 4V19J 1NDCA 1FRHA 3SI8A 2RH3A 1RT2A 3CD0A 2JVRA 5F9LA 4ZPCA 1CJTA 4ZP7A 3HZGA 4EBDA 4BLGA 4B9VA 3A8KA 3D7SB 3NWRA 2LQ5A 2DNOA 4K0KF 2Z56B 2E9RX 2XS2A 3OSNA 2ZZNA 1IKXB 3IR5B 3VR1A 1Z4UA 3G87A 4EGLA 2V4QA 2BJ8A 4QU7A 5A2QU 5IXUA 4FBTA 2CJXB 4A8QA 3M2RB 4LSLB 3MR6A 1JLCB 2M9KA 3NGSA 2LDIA 1VQ4S 5T7LA 5BJRA 2ILYA 1UVIA 2W01A 4LF4J 4L3KA 1EZZB 2UVWA 4TYBA 1IKYA 1RISA 1TTHB 4K4VA 1Q79A 3EGZA 2HS3A 3UD4P 5J2NB 2KDOA 4Y2AA 2D9PA 2QL9B 1RTDB 5DDQC 4DCPB 4YFUA 2M5YA 1KFDA 1QSYA 3B54A 2CVEA 2VOPA 4X2BA 4DUZF 2W7OA 2NS1B 4C9DA 2YH0A 1D3WA 4ILMA 2DNRA 4Q7AA 3VF0B 1T03B 4K0KJ 1RT3A 2YY3A 3MUMP 2ZHOA 3V81A 3UE2A 3L4BC 1RA6A 1SKRA 3BKFA 3PY8A 4LBIA 2UVUA 2UVRA 3OHAA 3CJRA 2XLIA 2V2QA 1YJWS 1U0HB 8ATCB 5DM6Q 1JLFB 1PKUA 1Q8IA 1UEVA 1L5UA 4Y2MA 1N0VC 5IV3A 3SFGA 2VFVA 1UA0A 3G8TA 3AOAA 1LFWA 4PRFA 3OBIA 3M8RA 4UUXA 1J2VA 3UI3A 3JAMY 3RR8A 4X4VA 1C1BA 3P5BP 2RDDA 3N79A 2ZDPA 2MKKA 4NLYA 4DUZJ 1BLUA 1DQ9A 1VQNS 2J0SD 4O3OA 1HHQA 2UV8G 3FCVA 1R0AA 2XMWA 5K8OA 4K2XA 1RTHA 4G65A 4OYZA 4CLPA 1PAUB 1F6TA 1RBAA 2HHVA 3B8HA 2VFRA 4AQYJ 2R4FA 4ZVEA 4JI6J 4A8XA 1I5OB 3IRXB 1UFKA 1Y11A 4MJKA 4ZLJA 3PNIA 1EHWA 2CQBA 2HFVA 2OPQA 3HLUA 4P72A 1WC4A 2GVZB 3HSGA 3BYPA 2W25A 1S1VB 1U26A 5D8HB 2CVIA 4RW9A 3JTPA 3OXLA 1X9SA 1TUVA 3TVZA 3OHBA 4I4BA 2DH7A 4QJVA 4DV6F 4DZ6A 2MKCA 3PEJA 2QGFB 2B6AA 2CIMA 4DV0F 2LXIA 1UWBA 2K8GA 3OJSA 1YJRA 3CCUS 1GMVA 1IJEB 3E3XA 1R8PA 2WVBA 3IRWP 4ALZA 2R2UA 3QIDA 1RWXB 2LLZA 4ECUA 1SIZA 2HSEB 3T5HA 3C8YA 1YJ7A 3GJTB 4GVBA 1CLFA 4AT1B 1KEKA 4I2QA 4WCEQ 2RF2A 3MOJB 2WAQD 3FEZA 3PDNA 2C22A 3LAMA 4B3OB 3IM8A 4RBUA 1GT8A 4DV6J 2A2CA 3G8QA 2UUAF 3BM7A 3NNHA 4PQUA 3SCLE 3GG0A 5A0YA 2WONB 3FDSA 1R43A 4E98A 2HNDA 4X4OA 2DTJA 4K8RA 2ZH2A 2KVIA 3DYAA 3A13A 1OQ6A 2F63A 4OIXA 3MCMA 2UUBJ 3PRVA 4IOBA 3W8PA 2NLWA 4ED5A 3DI6A 2IVFB 1VC5A 4IOAQ 2FHJD 4K5SA 3QAEA 2EK1A 1ZAXA 2QX0A 1CG2A 5L1KA 5IQQA 1PJ6A 4YN3B 5DQIA 3DLKB 3GILA 2YX7A 3BO4A 3TAPA 1R89A 5D3GA 2PIIA 3GG1A 1RJJA 4GKJF 1FK9B 2B51A 1UZHA 5K8NA 1Y10A 3I9ZA 4NI2A 4HI2A 1KQSR 4DF4A 1KFSA 2B4OA 3CJKA 4EBCA 4DL4A 5L9NA 3Q0AA 1K1QA 4PXCA 1HYSB 3N5FA 1RTZA 5C25A 4NLRA 1XJWB 2UUAJ 2D3OR 4XO0A 4ZVSB 3O6QA 1NSKL 4DR4F 2IM0A 5D6GA 3P49B 1FRXA 1X9MA 1U0SA 5LMNF 1OO0B 4WU3A 2DNNA 4FXWA 2C3MA 3HFKA 4GC6A 2C1EB 4LFCJ 4DV7J 2MQLA 2V67A 3V6DB 2BQUA 4MH8A 2DH8A 2LEBA 3PVXA 5E5NA 3NNAA 1S6QB 3M1VB 2AP6A 5F9NA 2DPIA 4I64A 2R8GA 3C3LA 2Z8QA 4NLXA 2C28A 1REVA 1VQLS 2VFUA 2X3GA 4U7UK 4X4RA 2AW0A 3CWJA 1J5OA 4IRDA 4F7VA 4A8OA 2OO4A 3R7SB 1JKHB 1VIOA 4NYOA 1KQGB 2DGTA 3PACA 2KJWA 2A6OA 1WDTA 2D9OA 2ACMA 2APOA 2XS7A 2VQFF 3KDOA 2G2ZA 2KFYA 1XNQJ 4PUOA 2RHQB 1RAIB 4J90A 4O3PA 4ZN3A 2ROEA 2MQMA 1HARA 3Q2SC 3CD7A 4DR1J 2LP4A 4CH7A 4I2PA 2KT2A 1WDDA 1RT6A 2UZAA 4RW7A 3KJVB 4OZJA 3RU0A 3W2VB 1FNOA 2QFJA 2P6TA 2VC1A 4JI4F 1D9AA 4ZCIA 1BQNB 5B09A 2GHPA 2BANB 1SPBP 1TKTB 1RAOA 2OTLS 3WBZA 2W4PA 1RU2A 1U1NA 2QYGA 3W5YA 4P2SA 2YWHA 2GFFA 1O6XA 4KKOB 3HK2A 5B7WA 4NEYA 3RYLA 5CABA 2GMHA 1NJXA 4NA2A 3HT3A 1DLOA 4AYBD 2ZE2B 4U67Q 3GTYX 5EX3A 4RU2A 2VASA 2VQFJ 4IKAA 4O44A 1S5ZA 1HD1A 3JYTA 3ENAA 4NZ0A 1VK3A 1YLXA 1AUSL 1CULA 1QY7A 5ETSA 3HO1A 1C4CA 3MEGB 5KFEA 5E33A 4NL5A 1N8RT 2CPDA 4JI0F 1SJ1A 3LP2B 2DGQA 1HNZF 3QT8A 1YG0A 1RTIB 1AUDA 2OKQA 3GFHA 2QLFB 2AYGA 3GZ7A 4JI4J 2CXEA 2H48B 1R8BA 3PYDA 5ETTA 3EGWB 1GH8A 2HQFA 3HHEA 1IBMJ 4JV5F 1CJKB 2VBZA 1CJUA 1JXVA 5DO2A 1XK8A 4IR1A 4J9VA 4RUAA 2R8HA 1RZMA 1X4BA 3FMBA 3VV2B 4AXIA 2AJQA 2VKZG 1BXNA 4YR0A 3MF5A 1RTJA 5IFMA 3CMAS 3HMJG 1MMNA 2BKNA 4A8FA 4PZVA 2YH1A 4Q0BB 2FTRA 1H2VZ 5L1IA 3GYXB 3TA1A 3EXCX 3EVMA 2KI2A 3KUHA 3SQGA 2FPHX 1M90T 1NB2A 1NB7A 1L3KA 2VZ9A 4ID5B 2R8IA 4IFYA 1M5PC 2IRYA 1FRIA 2ZWPA 4CLKA 4JI0J 1OWXA 2RB7A 2G1HA 1MROB 4DPXA 3GONA 2B9EA 2MSTA 1F3VA 1YKWA 4DN9A 3DM2B 1SBRA 1FDAA 4JV5J 4NX9A 4C4WA 5ETVA 3MM9B 2HKEA 3US5A 4ILRA 5E3AA 5BXIA 3TZYA 2FYXA 3PW5A 3MEKA 2AT1B 2M8DB 2ROPA 4LIWA 5K8MA 2XMJA 2XO6A 3I4PA 2W8KA 4LR8A 2RRNA 1RHQB 1YGYA 1NCLA 2BABA 2VC0A 4HEA9 2O5DA 5CCLA 1VBXA 4LF7F 4P9SA 3DGPB 1AYEA 1MNEA 2K1RA 2A2DA 1VQMS 5HMZA 1RHKB 3ZTRA 3W1YC 5DZ6A 4IG3A 2JX2A 2V4JB 1YBAA 3NXZA 3UQSA 2RQMA 3UR0A 2XO7A 3EPIA 1SCJB 4FXVA 2ZBIA 3FGVA 2XG8A 3IG1A 1KNZA 4TQSA 3GFYA 2V2KA 4UOHA 1K9MT 3KLIA 1LV5A 1BE4A 5KFBA 3NCPA 1PC4A 5F8IA 1ZZNA 3DHXA 1F9HA 2O01C 1UP1A 4R8UA 1TK0A 4Y28C 2DNZA 3GIJA 1IUJA 4QBUA 3HSZA 5C5JA 5E3RA 3CO9A 1VRUA 2H9ZA 4NMXA 2RSQA 3H2UB 4LF7J 2FHMA 3V6KA 3X1LB 1QTNB 4DEZA 4HLBA 4XPCA 3ULHA 4B3RF 2DNHA 1TP7A 3HFVA 3R7BB 1GMWA 1VYAA 4AE5A 4DX5A 4EYIB 4OHXA 4WJBA 2VPZB 2VBXA 4UW2A 2Q6BA 2NPFA 4NXMJ 2V8VA 2ZM6F 3EPGA 4UZCA 1Q16B 3QGIA 3T41A 2XYPB 4UQGA 2DNQA 3NGKA 3EZUA 5CD4A 2EBEA 1MU2A 2KRRA 3ILLA 3CJSA 4L6V3 1SH3A 1LK7A 1CPZA 3JTOA 4OI2A 3VAHA 3PKYA 1RADB 1D0EA 4DPYA 4USWA 1S48A 4YDDB 1N48A 1FDDA 3MAAA 4ECSA 3V4IA 1RT2B 3QYYA 3DDKA 1CJTB 3SDEA 4EI2A 2GZOA 4DQQA 4B3SJ 3SZ2A 3TUZC 5DGAA 5F8LA 1RBLA 1YJUA 3OLBA 3CMES 2I38A 4PYAA 5KFMA 2AYEA 3RZAA 3AB2B 4EFAC 4ED1A 4ZVHA 4MMOA 3H5XA 1JIHA 3MPUB 2G2YA 4LRBA 3CD6S 2RIJA 1IR0A 1NK4A 3VQTA 1IVZA 1R3NA 1BQMA 3R2DJ 5T7LB 3OTEA 4PG7A 3W61A 1OS5A 4QYZK 4F3MA 4DX7A 1IKYB 3CUNA 3GR0A 3VVTA 1JNZB 1TVRA 4N56A 1NK8A 4USHA 2NXEA 2JJ4D 3TVYA 4BDPA 3W62A 3Q8UA 4MFBA 1Q8BA 5J2QA 4F4ZA 1YDLA 4KYZA 3QLHA 5KFUA 3Q8QB 1VQ8S 3RJMB 5J2MA 1DHMA 3NBPA 1RT3B 1LNQA 3HZEA 4HHJA 3V81B 5D0RA 4OYIA 3J7YI 4KAIA 1H0HB 3I5BA 4ZJOA 1LWXA 5CYJA 1TL4A 1DFDA 1HHSA 4J91A 3MECA 3NY0A 2DIUA 2YQ3A 5AE1A 3DOMA 3M6UA 5E7OB 1R8AA 4G6VB 1NDPA 4NA1A 3PV8A 1G2EA 4N77A 3RB6A 1U1QA 4QOTA 3RBXA 3SBMA 4ED2A 1LXNA 2PEBA 3KOAA 1VQ6S 5KFVA 3W8GA 3T9ZA 2JNJA 3OUYA 1VR6A 3J7ZT 3PKMA 1A6LA 2BMBA 1HPZA 1N5YA 2HURA 3PFEA 5GMKa 4GO7X 4F50A 1PG5B 4Q8FA 1C1BB 3EICA 2XMKA 3WQPA 2EK6A 1S12A 1X8DA 3AQOA 1U1PA 1GXLA 5B0CA 5CA5A 2MKJA 1MSWD 1R0AB 1S49A 1RTHB 4BBYA 3LF0A 1WJ9A 2BOPA 1SKUB 2RHSB 3W9JA 4DL7A 3N28A 2Q6CA 1B99A 3I9V9 1U1LA 3HKWA 3DXSX 2OPQB 2IIHA 2MZQA 2KT5A 5KFFA 2H5EA 4N76A 2JL9A 2E1PA 3MCOA 2LFVA 1DQ8A 5IOLA 1HWLA 4IR9A 2ALZA 4RW9B 4X4SA 1S0MA 1YBTA 4EMDA 1YVFA 1N0UA 5GVQA 4N5SA 5KFQA 3L9ZA 4IG0A 3HVRA 2F7VA 5JXSA 4ZVGA 4DHVA 2L3MA 3PFOA 3W60A 2OHDA 2XY7A 3ETMA 4WK1A 4P2MA 3G9CA 2DJWA 4PG8A 2B6AB 1UWBB 4HI1A 1H2TZ 3CDWA 1T11A 5A2QY 1Q81T 3JTNA 2CNOB 2MEWA 3R6LB 2X7IA 3FZBA 3M6VA 3TO8A 3CDEA 4FS2A 2ALYB 4NWBA 2EPIA 3VQSA 2VG7A 1O51A 3AJ1A 3DGVA 4TY8A 4WP9A 1HA1A 3MZIA 5FD1A 2XNRA 5E41A 2HS4A 3CJ2A 4NE9C 4MK7A 3ICLA 1BHNA 5LXYA 4P7TA 2PA8D 1N52B 2CG8A 4GVBB 4CI0B 4WWSA 1P9YA 5GAEI 4I2QB 2RF2B 5F3ZA 3EDQB 2EKNA 2FC9A 2W9BA 1NHKL 2W8LA 3TQ1A 2FJWA 2DNKA 5U47A 4J9PA 1H73A 2XCPA 3AHPA 4F02A 4KTQA 2HGMA 1ZS6A 4PQUB 1HI0P 2QA1A 1X4CA 3B78A 1QVGR 5A0YB 2PEHA 1RWKB 2YNFA 2O67A 4AL7A 2HNDB 2FGOA 4U8YA 2Y0SD 3DYAB 3ZZ0A 2P6SA 5BYSA 3B4MA 5KG4A 4QPXA 2C2KB 2HRUA 1S4FA 2E5GA 5KT3A 3DI6B 4CWBA 1EARA 2KFNA 4LRDA 2GX8A 5LSRA 1C2PA 3OW2R 5EWFA 2E1MC 2IJNA 2XWYA 2CJYB 3IGVA 3OTOF 5D3GB 2EEYA 1DARA 1XMBA 4ES1A 1YRXA 4NI2B 2RQCA 2KTQA 2VFSA 1G7CB 3H20A 3CJKB 2GA7A 3ZXWA 5KG1A 3D3CJ 4J9SA 5C25B 4IO9Q 2GHWA 2GQCA 2IVYA 2VUGA 4ZVQB 3HFZB 3MM7A 1X4DA 3B6BA 3L7UA 3IS9A 5KFOA 1D8ZA 3BEGB 3Q83A 3OJUA 3BYRA 2FY8A 5EWGA 3E8OA 4OI1A 5LMUF 3M8WA 4ZP6A 3FMWA 2H5IB 1K8AT 1W25A 4B17A 2EWHA 4YY3F 4USTA 2GO8A 4FPIA 4HVZA 3H4BA 4RNHA 3KHGA 4CLSA 3PW2A 4NLDA 2HBRB 1REVB 5JJBA 1KTVA 3TA0A 1J5OB 4C98A 1X4FA 3QPIA 4UZBA 4X4NA 3HSJA 1T05A 1NU4A 2GVDA 1VRQC 1Y3JA 4HR2A 4B3MF 1TUWA 4DJBA 5HO4A 4F4AA 3DLHA 3DXBA 4O4RA 4PUOB 2HRTA 3LP1A 3BSOA 4I2PB 2YWEA 1K0VA 1RT6B 4RW7B 5LMUJ 4I0WA 2ZBRA 2I5JA 1ROFA 1ZETA 3DLEA 1NK9A 4KO0A 3RTVA 5KFNA 1T0TV 2DNGA 2BM1A 2FLNA 1TELA 4QPTA 1FTRA 2YVSA 2V69A 1TL3A 3QZ7A 6AT1B 4ER8A 1T3OA 3Q8PB 2M3DA 2DHHA 3EE3A 3OR1A 4IOCQ 4ZVFA 1SUQA 3EYZA 1DLOB 2ZBCA 3AT1B 5H9FJ 3DMJA 2X3DA 2OELA 2LXUA 4LBPA 2DNLA 1DY3A 4O44B 2CZVC 1FEEA 3JYTB 6FDRA 1S7IA 1HBUA 1O8BA 3FSIA 2CUYA 4M8LA 1CULB 5DZ7A 2Q3PA 3CCTA 2VPXB 1FKAF 1UVLA 3PTWA 4DI6A 4KGMA 1T9YA 4JB8B 1CC8A 4QCLA 2ZD1A 1NHVA 3MMJA 3OL9A 1T9XA 2IVMA 2H1YA 2DGSA 1LWCA 2M52A 1XC9A 3CDUA 2F40A 2YKOA 4F0HA 3CCLS 5JVGQ 1G1XA 2ERRA 1CJUB 1O5JA 3NNCA 2J9DE 2BJ3A 3O1LA 2UUTA 4ZS6A 2YKQA 1RAAB 5BR8J 4XDDA 4J7CA 4DR5F 1JLAA 1RTJB 3TX8A 2KKHA 2GQQA 5EWEA 1OYEA 4CP5A 2DHAA 5HMXA 5DDRC 5LSOA 5THWA 4QWCA 1FT8A 1E6VA 2CQ2A 3QT7A 3PRDA 3TVKA 3SQGB 3U27A 1QE1A 3PZPA 3MFHA 5IQ6A 4B3TJ 5HMWA 4I1TA 1N33F 2XSJA 4IFYB 3MFIA 4ZPBA 4Y2IA 3IN5A 1U8WA 1MN7A 3PCOB 2XGPA 2HHUA 2FY1A 4KHPF 1WC1A 5F0UA 1A9NB 1KVJA 3GU0A 1DJ0A 2KL8A 1R0CB 2JSXA 3OVAA 1RB0A 4GRSA 3FBEA 4AL5A 2DXFA 1AXQA 2OJ3A 1R6YA 2YNGA 4DR5J 5LJ5Y 1VC0A 4IDKA 1N36J 4X66F 3H0PA 1QAIA 4O3RA 2KB2A 4A8YA 1RT1A 3OL6A 3C6TA 3EVOA 2K1RB 1CEZA 3HD1A 4H4OA 4IG3B 1MWZA 3DLLQ 1N33J 2HVEA 4CNZA 4DFPA 5HP1A 5KTQA 4ZPVR 2HQIA 2I0XA 2GAHC 3IG1B 4OYBA 4UT4A 1Q0NA 1TR0A 2BRKA 4OZ5A 3PO4A 1HNWF 2HZVA 3KLIB 4A8KA 4K4YA 1TKXA 1IBLF 1NBEB 4L75A 3CD5A 1C0TA 1YJVA 3D4JA 3TARA 3VZIA 3MPDA 4R8UB 1BWVA 2OEKA 4WYLA 4ZHRA 4M1KA 2AJFE 2ZVSA 2HHSA 4HHUA 2AGQA 1HR0J 1AROP 3MD3A 1VRUB 4BWJA 3DHWC 1PCAA 5KAKA 2PMWA 2VIHA 2AGPA 3MXHP 2HFOA 3VGTA 4G1QA 4DX6A 3BPDA 1Y5LB 1LXJA 4WZMA 4UOGA 1IM4A 1K0TA 3VGUA 2X1FA 5C7PA 4WE1A 1EB0A 2BACA 2I1RA 2V94A 2FVRA 3RRHA 1DTQA 4C8ZA 2PT0A 2GMJA 1RWNB 3V6JA 2XYHB 3I96A 1GQEA 1M1HA 1HD0A 1MU2B 3HHLD 4NLQA 2CPZA 3FBFA 3FVYA 4OFZA 3V6HA 3MAAB 1H7WA 3V4IB 1RWWB 4C3LA 4NYZA 4RZRA 2M8HA 5MLCV 3SDEB 4DSIA 3NMRA 4J9RA 4Q44A 4FKYA 3FSYA 3H40A 4X4TA 2W4CA 4NLTA 4NCAA 1F9EB 3UD5A 3G4SS 4PPZA 3ZZOA 1B3TA 3ITHA 4Q2MA 2YNHA 5K8PA 1EETA 3L95X 1HQUA 5I3UA 1T8EA 3ISND 3GJSB 2FDNA 4DR2F 5A6WA 1BQMB 2J6TA 1IKVA 3O3LA 3CE8A 1X5OA 3KJNB 2JC0A 4FKXA 2CFXA 2JOQA 4G3IA 1TVRB 3FBCA 4DV2J 4CO3A 2QLBB 2XWXA 4M5KA 4RJVA 2HYIB 2I2YA 4A47A 3HHNB 2YX1A 4H54A 1MN9A 1KC8T 2F9DA 4LBHA 1Q86T 4XIUA 3GV7B 3PW4A 2B43A 2ZC4A 2RRAA 4MFBB 2R7VA 2E1AA 1VDHA 1WEZA 5KG3A 2QIFA 1WG1A 3QLHB 4F4YA 1A0OB 2XSFA 5J2MB 3NBPB 4ATNA 3M9MB 2EG2A 2QMXA 1F60B 2OTJS 5CH7B 5HJXA 1GMUA 3EGNA 4DV4F 1VOMA 4LR7A 3K2YA 4PWUA 4DR2J 4DV3F 4DZDA 3MECB 3U1MA 5D4OA 4OI4A 3DOMB 3LGNA 2AWZA 5CHCB 2FJDB 2Z58B 2DRAA 2HRYA 1Z1ZA 3MTJA 3MPVA 1DURA 3QATA 2NQPA 4EU0A 3OUYB 3GJQB 4OYOA 1Q53A 1HPZB 2MPUA 3KJQB 1X0FA 1N5YB 1CVJA 2RJZA 2DT9A 2PMHA 2LU1A 1U24A 3R27A 1ZTTA 2Y8WA 4RUHA 3TANA 4CH1A 3QT5A 4B02A 1B0TA 2E5LF 1KBRA 4ZJLA 4U96A 2B3TB 2EXUA 4DV4J 1Q8KA 5I3PA 4F8RA 3UDEA 1JWWA 2AX1A 1D8YA 3JS9A 3GE9A 3MMCA 1RAFB 4ANEA 3W2WA 3KUEA 3RB4A 2WVDA 1TV6A 2VOOA 5C24A 1DRZA 5I42A 1UVJA 4LR9A 2ZEJA 2NYIA 2FHOB 2RT3A 1QD1A 1RSCA 3LANA 3MDFA 3BQ1A 2KZMA 3CF5Q 4J37A 4LVOP 1JJ4A 3GIIA 3K0JA 4IG0B 3TQEA 3KHRA 2DK2A 5M2PA 2XS5A 3RW6A 5B0DA 2BJDA 3NG8A 3SCIE 1NM2A 2VPYB 2NR0A 4DPTA 2MTLA 2IYGA 2BE9B 2VU5A 3KK2A 4ZPWR 1UAWA 2P2CB 4KY3A 3A12A 2MJNA 3BSNA 3K5OA 1FRMA 4E0DA 4DCOB 2VG7B 3QWUA 4FNHA 4TY8B 1B0VA 3THPA 3TEGA 4DR3F 2IAJB 2ZJRQ 4OLOA 2VICA 4ENOA 4CLYA 2WBMA 5T14A 2MZRA 2LCWA 2W9BB 3N5BA 4O3QA 1T9WA 3D54A 2RU9A 4WF9Q 2AHOB 3RGIA 2C2RA 1D9DA 4RPFA 3GV5B 3IBWA 3CNQP 1RCXB 3G2XA 2CG4A 3U1NA 4ETZA 5GAHU 4LSZB 1NZAA 2XMUA 2IM2A 5KG0A 1RI7A 1RWVB 2YNFB 4UOFA 1TAUA 4KGXB 1OY9A 4N41A 1W2IA 1FERA 5KT2A 3NL0A 2W1BA 4ZLNA 3HHDA 2CQPA 2R7QA 1P8GA 4LF5J 1NMEB 4P73A 4PABA 3WZ0A 3UDCA 2FJEB 1RGVA 1LK5A 3MAQA 4NCBA 1FHTA 1YWXA 3I5CA 3KJFB 2QRRA 2GAGC 3TI0A 4P7VA 3BGOP 2OEMA 3IWNC 2RQ4A 2N82B 3MMBA 2W7PA 4TU7A 5A8WA 3KNGA 1URRA 3A3NB 4O23A 4PWDA 2W2OP 1KLMA 1QAYA 3ZZPA 4CO1A 2HAFA 2QFIA 4C2MA 3GIKA 4YS2A 2E1CA 4OX8A 1PBAA 2F8HA 3CDAA 3MM7B 5CZVA 3IWLA 3IS9B 1EKSA 4LVNP 3RRGA 2L9WA 3I0RA 1RWUA 4DL6A 2J0QD 3H25A 4PXBA 4U6PA 3T5JA 2P5VA 1F9FA 1JQGA 3NKYA 5KT4A 2RUSA 4JBCA 2CZ9A 4B08A 3K59A 4KE5A 1E6YA 2JEJA 2BJ1A 1RHUB 5KFLA 1TK5A 2V5HG 5L8RC 1SL1A 4H4KA 3RUBL 3M6WA 1YSJA 3A1YG 2LEAA 5KFXA 3BZQA 3HX9A 1ZM4A 1S59A 3SYZA 4OHWA 3T1HF 5LM7E 1T05B 4C8LA 2GVDB 3AD8C 2MDAA 3TOQA 4DPOA 2JH3A 2LMIA 5DDPC 2HFNA 2EFGA 5LL6d 3Q8SB 1YJNS 3M9OB 4DUYJ 5F0WA 2MKHA 4EZ6A 3LA0A 3LP1B 6FD1A 3CO0P 2V8DA 3GJRB 2H4WB 2ZJPQ 3PHEA 1SQGA 2Q66A 1UVNA 1YZ6A 3AH6A 4OV1A 2I5JB 2Z2ZA 3DLEB 1FD8A 4LF9F 4KO0B 1I3OB 1UPMB 2VL1A 1RAHB 1JXLA 1JNRB 3MR7A 4WKYA 3NWGA 2HAIA 4I69A 2VQEJ 1OPIA 4HACA 4IQMA 4UQTA 2DHGA 1FFGB 1TL3B 1X5PA 1HI8A 3LH2S 3KLFA 3OR1B 4J9OA 3CTRA 2O66A 2DNYA 2XM3A 2UXCF 1SUQB 3QO9A 4OYWA 2QSWA 3L7PA 2EBGA 5HBMA 3DMJB 2OFGX 3OR2A 4RW4A 1F2GA 1FDNA 2D3UA 2Z30B 2XCAA 1FX2A 2AJ2A 1VIXA 1HBUB 5L9XA 4OI0A 2DR9A 3H42A 2ZD1B 3N6MA 4D3GA 3CJTA 2R7UA 4LF9J 1N88A 4DR6F 1LWCB 3PM9A 4FS1A 3LAKA 4KB7A 1SH2A 1VBYA 1RT4A 2MGZA 4QWDA 2XGQA 2AU0A 5AXLA 5IC4B 3P4UB 2HLTA 1I1GA 2BE2A 1JK9B 1D9FA 1D1UA 4ICLA 2DR6A 1FKPA 3PX6A 4DFMA 2ASJA 2CA9A 1JLAB 4X4UA 3GLJA 2KH9A 2MZJA 2UVVA 5IV4A 3JQKA 1YJTA 2DO4A 3AD9C 1E6VB 3O8WA 4JI1J 4FP9A 3DRXA 3J7AN 2UU9F 2XLKA 1QE1B 5FLXY 2HQDA 1V6HA 5HQLA 5E3PA 4LF8F 5J1PA 2FVPA 3I56S 4R5PA 4XDCA 2XSJB 4Y2CA 2HHHF 2GIFA 2CQHA 1VQ7S 2MKIA 1WORA 3P8BB 2DEIA 1NSQA 3HM9A 2GIQA 4FN5A 2EFVA 3D0GE 2MMYA 2Z57B 2IA0A 3WHIA 3D68A 2DNPA 1B70B 2QL7B 3KXDA 4NEZA 3EZOA 1YZ7A 5G0RA 2W2MP 2YQ0A 3F41A 3FKBA 4K4WA 2YNGB 3Q23A 4F3OA 4FF2A 1F5AA 4C8NA 2B8PA 4K5RA 4IDKB 1H2UX 1ZBTA 5J1NA 5F8MA 4ZCLA 2RU3A 4IRKA 1TKZA 2ZZTA 3NS5A 1LFPA 1OIAA 1RT1B 4KQZA 2DITA 3C6TB 3K57A 4LIRA 2UU9J 4F67A 3C46A 1VFJA 4H4OB 1Q1KA 2QE5A 4X84A 1SXLA 2JEFA 2V34A 3GCWP 4DBQA 2K3KA 2HHHJ 2L9NA 5HP1B 4I6AA 1SC1B 4UY85 1L3UA 1QAXA 1UPPA 2N4CA 2D7SA 2DGUA 4NZ7A 3OFFA 4ZP8A 3HJFA 3RAXA 5BYQA 3NS7B 4IFVA 1TKXB 2V0NA 1SIWB 1C0TB 4NLVA 2VONA 1KTQA 1MMDA 3G82A 2K3IA 5RUBA 3R1HA 4ZHRB 3QRRA 4BS2A 3DRSA 2XB2D 3WX8A 5DJBA 1G3OA 4S0MA 4PXDA 2G4BA 4CLWA 1FWKA 2CJ9A 1LW0A 1ACMB 2PGCA 5ETRA 4G1QB 1UTAA 5JVHQ 5ADZA 1WF2A 2XZWA 3HF5A 2CAJA 1HBNA 4P2XA 2RAQA 4TN2A 2XI3A 4J9LA 1KVIA 3TJ8A 1XR5A 3W9IA 1X5TA 4KJIA 1U48A 4WE1B 3VAKA 1ZA1B 4DU8A 4XK8C 3VAGA 3GSDA 2A0FB 4ZVUB 4RNOA 1FJGF 4HTJA 3OTCA 3R5CA 2Y1RI 4HL9A 3JQMA 2VBYA 1ITPA 4USKA 2CWXA 5F8GA 1HHTP 1U1KA 3OLAA 5DGBA 2ZHAA 4C11A 1KHVA 3PHTA 3ENVA 2HPUA 2WVCA 3HVAA 4LRFA 1EAYC 1C0UB 1N54B 5I4MA 3MMAA 4K4XA 2KZZA 1XWLA 3HHLC 2EFNA 2NUHA 1HQEA 4ZPDA 2MZSA 3TYTA 4X4PA 3ITHB 2YNHB 5E0OA 2VD3A 5HI7A 2R7SA 2AEJA 4FYXB 1EETB 2IRUA 1HQUB 4P52A 5I3UB 4WIQA 1CJVA 1YITS 1F0XA 4PKDB 1YJ9S 4NZ6A 1RHJB 2MHEA 3Q8YA 2IFXA 4RNMA 1IKVB 2JC1A 4NLWA 5DG9A 1FJGJ 3KMQA 5L1JA 2EI5A 1WG4A 2LQJA 1VRTA 3M8PA 3MM5A 4CM2A 1FDBA 3BF4A 4ETXA 5B0FA 1RAEB 4ZVRB 3D1HA 3EUNA 3DRYA 1HWJA 3CXCR 1YRUA 3S01A 4QWEA 4QWBA 5SUHA 3HHKA 5IS2A 4Y0FA 4NASA 4WTOB 4GO5X 1F2HA 3TJAA 1B64A 2CPYA 2EKYA 1CC7A 1WF1A 2PC6A 4BC7A 1XN9A 4MIBA 4F04B 5A8RA 1H98A 2IDLA 4K7QA 3K89A 1SH0A 4QW9A 4DV0J 3SV4A 1NEEA 3C14A 4USIA 2BQRA 1UEKA 1RAJA 3J81Y 4F2RA 3J81j 5DG8A 2G0JA 4L72B 4MKBA 2V6AA 3OPKA 4QIVA 4W4MA 1XIQA 3MAHA 3CB4A 1R0BG 4LUBA 2FJVA 2CDRB 2BYCA 2Y1IA 4PWWA 1RYRA 4K50A 2GIRA 3G6XA 2UP1A 5KFAA 2FLLA 1XEZA 2L08A 4K4SA 3GIRA 3PXGa 4OYMA 3TA2A 3ZTOA 3C15A 3NGRA 2LVWA 2CQDA 3UCGA 3LUYA 2ZBPA 3ZFVA 2FZKB 3MI7X 4O3SA 4URSA 1T9TA 2EC2A 1VGYA 1DQAA 1QVFR 1RP5A 5JUMA 4CTAA 4FYVB 3TJ9A 4U9RA 3JQJA 3M9NB 3THVA 1XMQF 3AB4B 3GR1A 1VLYA 2V9KA 3EGVA 1IBKF 1MG7A 3JSYA 5IT9Y 3LGHA 2VODA 2WVEA 4CQ1A 4CLFA 4DU7A 5H1SV 4OLPA 3MMCB 3PIPQ 4PG6A 3A4TA 3W2WB 2GC8A 1TV6B 2CQ4A 2KYZA 1YHQS 4TXSA 2CNLB 4EBEA 5C24B 5I42B 4KH1B 2PN6A 3ZZRA 1V9OA 2OIHA 3OSPA 2V68A 3TAQA 2FQQB 2J9CA 2MLZA 1RK8A 4OZ0A 4GKJJ 3FRZA 3RAQA 3D0HE 3VGVA 2X51A 4P74A 3NGDA 2J5AA 1FA0A 3MCNA 1RWOB 4DFJA 2YKNA 3HCXA 2AV5A 4CLTA 3ZZTA 1WTBA 3DLGA 3TP2A 3QQCD 3KK2B 4DR4J 1ULRA 4C0BA 4DLGA 5KG6A 2HQGA 4IO1A 1WC3A 5HQMA 1XMQJ 5LMNJ 3VAFA 4KBIA 3OD2A 4ZVPB 3K8VA 2CPEA 4MT1A 2XNQA 4GKKF 1SV5A 2FVSA 3UVJA 1NK6A 2XQCA 3RG6A 2ASDA 1NDKA 3W5ZA 3LGMA 2MQ8A 1Q5VA 2F1FA 2PSZA 4UF4A 1PGZA 3QRQA 1NK0A 5KFHA 3Q86A 4NLUA 2D1CA 3WC0A 2DB1A 1JB0C 2G13A 4ES3A 1S1XA 4WU2A 2QJ3A 3MR5A 1URNA 1HBMA 5HN0A 3CCSS 2CKWA 2NYHA 1EJ7L 4CO0A 2BE7D 4DXLA 2WB1D 1J5EF 5L1LA 4DOZA 3K5PA 1HNVA 1ZOTA 5AXKA 3TUPA 2B4PA 2W24A 3KK3A 2IC3A 1M1KT 2M2BA 3PR5B 4DWIA 3M8QA 1Y0HA 4K4ZA 4MIAA 4JI7F 3CC7S 4GKKJ 4O3NA 4WP8A 3K5LA 2C2MB 3DNCA 1FF2A 1WSVA 4PAAA 3CCRS 3MMBB 3UN3A 1Z2ZA 5A8WB 4PWDB 2N3LA 2PE8A 1S9EA 1KLMB 3KK1A 1JJCB 4M5NA 1FNMA 3V5RA 2CQ0A 3I31A 2AGOA 1VLOA 2KO1A 3NMAA 2MY8A 2BQ3A 4PCQA 2WTFA 3G86A 1IR2A 2BKPA 1VC6A 3GFXA 3M7VA 1J5EJ 4FXDA 4OZ1A 4ES2A 2LA6A 1Q82T 1RLCL 3I0RB 1S4EA 1P1LA 4F3QA 4YOEA 4Q45A 1VQOS 3QNWB 3N6NA 4OQJA 2VH7A 1HW8A 3G96A 1JLBA 1AT1B 3ZZUA 1E6YB 2CQCA 1Q4RA 3MM6A 1NLKL 3DOLA 4KV8A 4XAKA 1HNZJ 3RAMA 3HXMA 2CJAA 3TZWA 1SB6A 1T95A 2N4DA 1VI7A 2GJFA 3P96A 1S9GA 2FZGB 5HATA 1SJRA 3HJVA 3HHLA 3FQLA 3BQ0A 2R8KA 3HI9A 5C2CA 3BKTA 4WFBQ 4FF4A 2FVQA 3D9BA 4ZMMA 4ELTA 4OHYA 5B08A 1NKEA 2SXLA 1NJZA 4MYUA 2IPOB 2F8MA 3K7RA 2OPPA 4ZLPA 3M8SA 5DG7A 4CO4A 1N6QA 2AZ3A 4JI5F 3K5MA 2J0WA 3SEOA 5IWAF 4J9NA 2WVFA 2OGUA 3LTOA 2BEFA 3POTA 2R8JA 4RO0A 2C3PA 3LPEA 4HACB 1WHVA 2Y0BB 4QYRA 1AZSA 4OYXA 1GTEA 3I0SA 1S10A 2CPIA 3RRKA 3HVWA 3L7OA 4RW8A 3BO3A 1KR4A 1NK7A 3KLFB 2AD9A 5HQ8A 3OXGA 3AOBA 1TAQA 3D5MA 5D4PA 1UJ6A 1FXRA 3QO9B 2VPWB 4HDGA 4KFBA 3VVUA 3HDSA 4ED0A 5HBMB 1EX8A 3OR2B 4RW4B 4YQWA 1UVKA 1NXIA 3R3TA 2R9LA 3GCXP 2PI5A 4TNOA 3MURP 1PO6A 4ECTA 5F8NA 1U49A 2HZAA 3ZNUA 3R5DA 2YWWA 3SFUA 3X3UA 5HVGA 3MWBA 3DRPA 1G6BA 2DXEA 2A6MA 1X9WA 3UW1A 1EP4A 4NRTA 2MXYA 1WKLA 2K2PA 5AXMA 5KFSA 2AYBA 1CSJA 2XMMA 1WUUA 3FCWA 4DL5A 3KFWX 8RUCA 2YNIA 1RT4B 2MGZB 1JJHA 1HWUA 1U2FA 1DBDA 3FNNA 2YWKA 1XQIA 2KJVA 2AJ4A 2BE2B 1LOUA 1ZA2B 1XR6A 4JI3F 1SC4B 4ICLB 1V5VA 4LF2A 4ZKAA 3FSXA 1RT5A 3BGRA 1FKPB 2ABYA 1RE1B 3AODA 2E5IA 3H98A 2DEJA 3D1OA 2YTCA 1JLEA 1RABB 1V3RA 3D2WA 2WHOA 1TFYA 4KT0C 2MZTA 2XULA 1W2BR 2XZTB 1GAOA 4CIOA 2BBEA 2CQ3A 1TMJA 2I6WA 3T9NA 3MHYA 2E44A 4OHZA 1DTTA 4NLPA 1KS2A 3JSMA 3CCZA 1QLNA 2EW9A 4YP3A 3AAWB 4R5PB 4KPYA 4B3RJ 2E5HA 2QV6A 1BD6A 3ILJA 2RQKA 3NS6A 4RW6A 4OX6A 2HFSA 3CC2S 5KG7A 1MMLA 3ZTQA 2GMLA 3T19A 2ZM6J 2C3OA 3MR2A 2MHNA 2E1RA 1FRKA 2I9SA 1VBKA 3K58A 4JV1A 2NXUA 2CADA 2ZH6A 1WHYA 1U8SA 2ZUAA 5D78A 4HYKA 2HGLA 3Q22A 3QJJA 4JI3J 5G0RB 2P9EA 2GGPA 5AJ3F 3H5YA 2J76E 3KDNA 2ZNZA 2PI4A 1QDUB 1U45A 2RMLA 5F8HA 4ZVOB 3OT9A 5F41A 2JFDA 4C97A 1TKZB 1L3VA 2HLUA 2DPJA 2XEXA 4ILLA 3TAMA 4I68A 3UDVA 2YWGA 3GWCA 4M5DA 4DLEA 5AXNA 5ETMA 3DOKA 1TUGB 1WHWA 2ZH5A 3SCJE 1GNKA 2M0GB 4IUFA 3GYNA 1APSA 2E7XA 1XR7A 2R7TA 5MAOA 5CCMA 3IAS9 2BXJA 2OAUA 1B7YB 5I3QA 4M5LA 2V63A 2NXJA 2E7VA 3IFEA 2L9DA 3OTBA 3I4HX 1T9UA 2BM0A 4LQ3A 1NJYA 3BN7A 1ICEB 4U8VA 4IFVB 1RU1A 2J7UA 1FJ7A 4C0HA 4A46A 3CJ5A 2J8SA 2WZ1A 3RW7A 3DDIA 2IRXA 3G82B 5AJ3J 1KKHA 1SQEA 2K06A 1SVDA 5CD4H 5H9EK 3DRSB 3BKUA 4U7CA 3BS9A 1W26A 4NYPA 2E5JA 5A8KA 5HAOA 3GIMA 2EVZA 3IGNA 1KQKA 4ZCMA 3M32A 1TMMA 1LW0B 4ECVA 1WC6A 3QJLA 4M5MA 2VDHA 1U7LA 3P45B 3IA0A 4AQYF 4JI6F 1UW4A 1LWEA 1HBNB 5GADI 3RB0A 1F5BA 1V5IB 4Y65A 2OI2A 3J80Y 4XTTA 1FJEB 4RX6A 3CJ4A 4F0KA 1KSPA 3T6BA 5HL7Q 3QAUA 1WKKA 2MKYA 1TQLA 3GB0A 4MKVA 2N7YA 2ZITA 1OYDA 2W2QP 3FEXB 4OJ1A 4C11B 4N8NA 4I6YA 1NPPA 4O4GA 2PMZD 3FRYA 2QMUB 2GO9A 5D0EA 3PX0A 1UETA 4KH0B 2J7WA 1SJ3P 3IO1A 3MMAB 2L41A 1U25A 2BJ9A 4PQAA 1VJQA 2EG1A 2QN6B 1HQEB 5KFJA 4CO5A 1NJWA 4RBTA 3R9LA 1BC6A 2R2SA 2LXFA 5KFWA 4FYDA 4LF1A 2U1AA 2XI2A 1JXEA 3R7NB 2OP5A 5H9FK 1CJVB 1SC6A 2IHR1 3FC9A 5B0GA 1UEUA 1H72C 2KRBA 2IMWP 4KGVB 1RDRA 4WFXA 5DLGA 4TYAA 1S0VA 2JFKA 2EFOA 4G1PA 4L3NA 1EIYB 2K7JA 3M8PB 1VRTB 3MM5B 2C2DA 5LSLA 1UMJA 1NRKA 2HVIA 1PBUA 2P9GA 3AXKA 4N47A 1X4GA 1WOPA 2QL5B 1MW7A 2QC3A 1TZ0A 2V50A 3VAMA 1LWFA 2Y1LB 4YEAA 1SKWA 3IMQJ 5J2PA 1N4LA 2XY6A 1VQKS 1GEHA 2V2ZA 5HLFA 2C2NA 5A8RB 2DNMA 4W92B 1X0PA 4O0IA 2UUBF 5LT5A 4FNIA 4UUWA 3DFEA 1S1TA 3R2CJ 4RKUC 3C14B 3R5JB 3RB3A 2KXHA 3R5AA 2HW3A 3DCAA 3DDNA 2HQ3A 4C8OA 4USMA 4F4WA 1FCAA 2ZH8A 1JX4A 1ZTWA 1Y7PA 4N7TA 2MQQA 4ED8A 3KLGA 1CQNA 4OX9F 3C16A 3W63A 1KVKA 2HVZA 1WHXA 4X64F 4JV2A 3NLCA 4W98A 1S6OA 4MTPA 1T02A 3D6TB 4OYAA 2B0GA 3QIPA 4NLOA 4LT6A 2E29A 2UXBF 2JVOA 3OL7A 3C15B 3OVBA 2A1BA 4LFBF 2PD1A 4DV1F 4R25A 4ZIWA 2D69A 2WSEC 2MZ1A 1OJ4A 4Y3CA 4LJMA 1Y00A 5KFKA 2D74B 2OEJA 5C2GA 1CBKA 2HQCA 2ZZMA 1FRLA 4CTAB 3BO2A 1FFWB 4LFCF 4DV7F 1KQFB 4M94A 5KOXA 5ETQA 5FJ4A 3BREA 4A8MP 2HK2A 5FLXU 2ZH9A 1X7VA 4WIIA 3QGGA 4OX9J 3KKFA 1UZDA 4X64J 1GXUA 3RR7A 2GCFA 5H9EJ 3M05A 4TQRA 3P5TL 5IM0A 2B5JA 4YDXA 4Q5VA 1FKOA 3OTOJ 3I5AA 2ILZA 2DXDA 2UXBJ 1WNEA 2RE1A 4KRWA 2BUNA 3EM1A 2OUGA 3H5SA 7AT1B 3P3DA 4LFBJ 4KR0B 1N5SA 4DV1J 1XNQF 1XMOF 3ISZA 1KP6A 4DL3A 3RBZA 2BR0A 4OHVA 4PPDA 2OPRA 2G0IA 4KSEB 2AMCB 4ZIVA 2YKNB 4DR1F 3LO3A 4QZVB 3DLGB 4DN0A 1Q8LA 3NCRA 3ELHA 2C2EA 1S9FA 4TLQA 2RRBA 2LYVA 1WEYA 2OSQA 2MKSA 2H65B 2BJEA 1PYOB 1SV5B 3UVJB 1HI1A 2I8EA 4ZVTB 4Y6IA 2QYCA 2FJBB 4YY3J 2ZH4A 4EUVA 3W5XA 1EKRA 1VS3A 5IC6B 3TUJC 3JSRA 4DQIA 2ROGA 1R31A 1Z2LA 4HH1A 3M6XA 3ONQA 1U1RA 1N32F 2E9TA 4DPWA 3AOCA 2P8IA 5D4LA 2J9EA 4Y34A 1S1XB 4PXEA 1HBMB 2MLYA 4TLRA 1HBOA 1RXOB 2GHVC 1XMOJ 3T5KA 2Y9HA 2CWKA 2PA3A 2A3JA 2LDYA 4B3MJ 4L76A 4DQRA 3SSSA 1HNVB 2HFUA 3V4MA 2F4VF 9RUBA 3KK3B 2IC3B 1FWLA 2NSBA 4ECQA 1UVMA 2HNZA 3O2IA 5FIIA 2AEFA 3M8QB 1UKUA 3N4WA 4FDFA 1L3SA 2HBYB 2KN4A 5D0HA 1S77D 2GQ2A 2W7AA 4FVCA 1RHRB 1IBMF 1FXLA 2QTWA 4Z7YA 3KYLA 4HH0A 4ZN1A 4M5GA 2F3JA 1TL5A 1U1OA 4BC9A 4ZITA 3QFHA 3SXLA 1YQHA 5IT0A 3N01A 3SMZA 5CQGA 2C3YA 1HFEL 1N32J 1S0OA 3IR7B 1AB8A 1S9EB 3KK1B 3L3CA 5GAHI 1WD6A 3ET6A 2KXNB 2QSFA 2BW7A 2VV5A 4AD6A 1M5VC 1NNDA 2MSSA 2YX4A 1BWEA 4AFFA 2YPYA 2F9JA 3BBBA 3BPSP 2F4VJ 4QWAA 3LP0A 3AJDA 3KMSA 2KM8C 4Z37A 1Y4ZB 3UN2A 3EZ5A 3NRBA 1JLGA 2VJVA 4LSNA 3AD7C 1C1CA 1JLBB 2AF6A 5LJ3Y 1WOOA 3MM6B 3R5GA 1RKIA 3DOLB 4KV8B 4PR6A 1CS4A 2ADCA 4ELVA 4CLUA 5HROA 2GW8A 1P9QC 2DY9A 4WFNQ 4X62F 1WI6A 2X1AA 3CEDA 1S9GB 3EXYA 2ZNYA 3CW2C 3HHLB 5KFYA 3T3FA 3W64A 2J9DA 2YWFA 2QA4G 1UJ4A 4ERDA 3D6FB 3UR3C 3KLEA 4DSFA 3UCUP 5EDWA 2HVHA 4JYAF 4A48A 2MJUA 4XPEA 1S6UA 1NK5A 1NUEA 4CLZA 4FF3A 4PG5A 4J9QA 4AXJA 1SQFA 4KPCA 2OPPB 3WIVA 4NA3A 3AFGA 2BOAA 5KFIA 3WDOA 4KC5A 2YKMA 2B7BB 2QZ8A 2YKPA 4WZQA 1N6QB 5GADU 1QTMA 1RCOB 2B56A 2ZOFA 1DAXA 3AJ2A 1S72S 3J81U 3POTB 3BV8A 2DIVA 4L73A 3UO0A 4KHPJ 4CH0S 4YHHF 4X62J 2GJ2A 4JUZA 1AZSB 3FZ2A 3I0SB 1F5CA 1S99A 4OZ3A 4CCHA 2V4RA 1YK9A 2G1DA 4RW8B 3DC2A 5ETKA 2OPSA 3S7RA 3H8YA 5GMDA 4KFBB 3KLVA 3ZZZA 1IBCB 4X66J 2NZCA 4JYAJ 3TZZA 1VQSA 4U95A 3EDRB 5HSPA 3OV7A 3MPWA 3AXMA 4NXMF 1D09B 1Y5NB 3DRPB 4WFAQ 2MB0B 1EP4B 2OMOA 4FYWB 4OX7A 4MKAA 1RQ0A 3BBFA 3IM9A 1MLAA 2YNIB 2BZ2A 1N34F 3SCKE 3D3BJ 5GMEA 2LECA 4F26A 3CPWR 4EZ9A 1R7IA 5IT9U 3QT6A 2W2PP 2YKAA 4YHHJ 4DFKA 1JJ2R 1HNWJ 3AA8A 3P6YC 8AT1B 2NXNA 1TL1A 1IBLJ 5K14A 1RT5B 3BGRB 2G0CA 4ZPAA 3T5LA 1R8HA 5KG2A 2J8AA 4TY9A 4NXNF 3MR3A 1JLEB 4JI8F 4RNFA 1GFWB 3HPOA 4H4KC 3Q24A 4B3SF 2O1PA 3NOCA 2RNEA 1DTTB 2VDIA 4NOHA 1ZZFA 2DKOB 3NGTA 3M30A 5HANA 3JSMB 1VHIA 4QQBA 4Q8EA 3PX4A 3G6ES 1HKAA 2FIUA 2F65A 4DUTA 4WK3A 4DQSA 1KWMA 3FBBA 1TL7A 2CRLA 4GVLA 2H4YB 4V1Ak 5J1EA 3CULA 2RKIA 4FPRA 2HIYA 4Z7CA 4RW6B 2WOMA 4TU8A 3E2EA 1UL3A 2WSFC 4USUA 3CJ3A 3HULA 4I67A 4DS4A 3CCWA 2JEIA 3K8WA 1WACA 4QW8A 4C7QA 1N34J 1J27A 4C3MA 4B9MA 3ZTPA 2CDQA 1UFWA 1ZM9A 2GGPB 4F36A 3TR5A 1Q7LB 1VQYA 3QZ8A 3MUVP 4NXNJ 3M2UA 4JI8J 4IRCA 5GAGI 2XMTA 4LMZA 2VG6A 3TAMB 4P2FA 2CJKA 1HQ2A 4M5DB 5J2QB 3DOKB 2R7RA 4ANDA 3NAHA 3MOZA 4C8YA 4FZVA 2FHKA 3PYGA 3W3SA 1M5HA 2V8GA 1QJHA 3H59A 2DH9A 5DRKA 2QLWA 3F44A 3GQCA 1GXTA 4J5OA 3BJYA 2HMIA 4UY8T 3WIUA 5F3TA 5DLFA 3A3OB 2ZH3A 5DQHA 1RT7A 2FVCA 1PJ7A 2E7WA 1SL2A 3IWXA 2MYFA 4Q2LA 5KFDA 1H74A 1SJFA 4OI6A 1NDLA 4TU9A 5K5MA 3Q2TC 3PRBA 2JLGA 5A8KB 1KRPA 3BR9A 2ASLA 4YB1P 3M32B 2CNNB 3MEDA 5KFTA 4M5JA 5HVHA 1UWAA 1ZPWX 2WB4A 2AJ1A 3G6VA 2Y8YA 1LWEB 2J6UA 1R8CA 2W9AA 1NPKA 4Q43A 2MQOA 2XC9A 3CT9A 5L38A 3MM8A 3FJ2A 3ILIA 4NLGA 1V3SA 2CYYA 3I6PA 1I94F 4DV3J 1X4HA 3FFIA 4DSKA 1IKWA 4DF8A 1T7PA 3J7A1 3VCDA 2ADBA 4QIEA 5KT7A 3DU6A 5B0BA 1YRTA 3EVWA 1WF0A 4Z2XA 1IJFB 3CCMS 4O4GB 1NHUA 1LW2A 2HS0A 2PFFB 2JRSA 5DM7Q 3QSYB 1U4BA 4MAKA 2KU7A 2LKZA 1HWKA 2HNYA 1YX2A 3QGPA 2ASYA 2FGCA 4EK2A 4IYQA 2A10A 4DV5F 1EQMA 3WC2A 2D3ZA 3SSRA 3D66A 2KG1A 4H4MA 3BB5A 4WFZA 2DD8S 4ZK7M 2E5LJ 4J9UE 4WXOA 3CJ8A 3CVKA 3GSIA 2WW4A 3UDLA 2H54B 4YUDA 2B4UA 5HMYA 5DDOC 3IC1A 1M1GA 5DETA 3C6UA 1Q78A 3DLJA 1I94J 4RR5A 2LQ8A 3UPFA 1TFWA 2W9CA 2BKOA 4P71A 1U6FA 4W90B 1IWAA 3F56A 3SSQA 1G4CA 2KT3A 1S1WA 2Q1LA 3HSDA 3BDEA 5CAAA 1H3DA 4DSLA 1KOOA 3KLHA 2ZOGA 3U1LA 2F4FA 5C42A 4IQXA 1LWFB 3DRRA 3W66A 4RUCA 2LA4A 2IBKA 5J2PB 2V9WA 3PG9A 1IR1A 5HLFB 1ZAVA 4R0EA 4DV5J 4MK8A 4B9NA 5D4NA 3RBEA 1S1TB 7FD1A 4ELUA 1IQTA 2EC0A 2N7CA 4ZLLA 5D0GA 4DG1A 4DL0C 1VQ9S 1U09A 3FUYA 1W7WA 3GYGA 2IAJA 1QM9A 1AW0A 3KLGB 1KONA 3C16B 2B7CB 2MQPA 1FESA 5A6PA 4FBUA 4DR3J 4OV6A 3M2VA 5EUHA 2VG5A 1P27B 4RNNA 2CQ1A 2XMAA 2XLJA 2IMOA 1H38A 3T1YF 2CJBA 4B9SA 3QIPB 5G4DA 4NCGA 4QR2A 4YB5A 5EHHA 1HNXF 2W4DA 3IBCB 4IH7A 4FYYB 4WPAA 2VB6A 1NO8A 4ED7A 3HVTA 4OZ2A 1IM6A 3CDBA 4USJC 4QYZJ 1ZAWA 3K17A 5HK4A 1VQPS 4HTIA 3NOGA 3A3PB 3UN5A 4GC7A 1U02A 1BGXT 4G1IA 2FJAB 1KLNA 2KFZA 3DU5A 3QWPA 3R8YA 4DCJB 3F73A 2HWHA 2GNKA 4DDFA 4DR7F 5CYMA 2IJRA 2Q79A 4HDHA 2YPZA 5T41A 1GTHA 5IM0B 4NRUA 7FDRA 3KHHA 3E51A 2B5JB 3OTDA 2LEPA 3T1YJ 2QO3A 3DKDA 1GX6A 1HIYA 1FKOB 3KHLA 1VISA 3CCVS 4TKTA 3SIPB 1T9VA 3KG4A 1RLDA 1VCTA 3C19A 1RA7A 1HNXJ 1QAJA 1PSDA 3LW5C 2DGXA 1S6PA 4EYHB 4M95A 4ZA1A 2HHQA 1B7FA 2OPRB 1HW9A 1TK8A 5EX0A 3GV8B 4LREA 5KT5A 2AJ0A 2HWIA 1XNRF 2XTJP 1HMVA 1OY8A 4C3KA 2BVZA 2HWTA 3G6YA 3Q8RB 1NSPA 2GS8A 2V2VA 1UFLA 3I32A 2ZH1A 2XBPA 2CQIA 5IZHA 4CYUA 2FLOA 2NXCA 1VQ5S 2G9OA 3N9UC 5AE3A 4FF1A 1SL0A 3A8IA 4E8UA 1NPRA 5ETLA 2NUUG 3IR6B 2Z4PA 4DR7J 1HL6A 4RU9A 2XY5A 3R5BA 1SKSA 3TX0A 4OZLA 3MEEA 3E01A 5A76A 4LRAA 2OSRA 5E3QA 4I56A 2M88A 4NMLA 4R0JA 3T1HJ 4USVA 1WSRA 3T1AA 2J0XA 2QEXS 5KG5A 3C2PA 4URQU 1QSSA 4OJGA 2VHGA 1HBOB 3S8SA 2WK4A 4PYDA 5DS7A 4HKQA 2AQ4A 5FDLA 2RD5C 3BSCA 1WELA 1XNRJ 4QU6A 2B9XA 4ZOSA 1ZM2A 3VAIA 1H6KX 5KFGA 2RDIA 4A8SA 2FJXA 5ETOA 1HNIA 1B4SA 2HNZB 2DRBA 4C8KA 2F8EX 5D15A 2ZOMA 2QA4S 4CLLA 4B9LA 3G71S 1WC0A 1U2CA 1Y9OA 4N8OA 5HJYA 1KDNA 2Z2LA 4ITSA 2DR7A 1PAEX 1X31C 2ZDOA 4ANCA 3AA9A 1PJ5A 4C0OC 2M4MA 1X4EA 3J80U 1JLQA 5BR8F 1FWPA 4RUBA 2JEGA 4DSJA 4P10A 5M2RA 2BX6A 1ZYQA 4OMFG 1RKJA 3KTQA 1P6TA 1WI8A 1OY6A 3M8YA 3ET6B 1FVSA 3VZHA 4DSEA 4K2JA 5AT1B 3FQKA 5CYQA 2F5GA 3OQ2A 2UXCJ 4B3TF 2V8HA 2E66A 3JAMU 2M70A 2HK3A 2R7OA 1OQ3A 4V19X 1QUPA 2GJIA 2J7KA 5GAGU 1TKDA 1M0SA 1S1UA 5CZXA 3LP0B 3OXFA 4CRJA 3OVSA 2LQ9A 3H4DA 1PILA 1JLGB 3PEHA 2X1BA 4LSNB 2ZKTA 1C1CB 3DN9A
chains in the Genus database with same CATH topology
5BXIA 4ANEA 1WKKA 2HVDA 4ENOA 1JXVA 1NSPA 4O0NA 3PRVA 3Q8YA 3VGTA 3Q8VA 4CP5A 3BBFA 1NDCA 3B54A 2DXEA 1KDNA 3EE3A 1WKJA 4UOGA 1NDLA 1S57A 3ZTQA 3ZTPA 1BHNA 3EVOA 1PAEX 1B99A 1HHQA 4ANCA 4EK2A 4F36A 3FCVA 3VGVA 1WKLA 3VGUA 3EMTA 4C6AA 3GP9A 1LEOA 3ELHA 1NCLA 3ZTOA 1LWXA 5C7PA 3FCWA 3G2XA 1K44A 1F6TA 3BH7B 3NGRA 3DDIA 2HVEA 1NSQA 2AZ3A 1NHKL 2AZ1A 3GPAA 4HR2A 2ZUAA 2DY9A 1W7WA 5CABA 5IOLA 1VYAA 4FKXA 4F4AA 1NDPA 2BX6A 3ZTRA 3NGUA 1XQIA 3FBCA 2BEFA 1EHWA 3EVMA 4UOFA 3EJMA 1NLKL 3PJ9A 2B8QA 1U8WA 3R9LA 1MN7A 4WBFA 4ANDA 4DI6A 1S5ZA 1NB2A 1NPKA 1ZS6A 3ENAA 3FBFA 3DKDA 2VU5A 3B6BA 3ZTSA 3VVTA 1MN9A 1HIYA 3L7UA 3NGTA 1HLWA 2NCKL 3Q83A 1PKUA 3WX8A 3FKBA 3VGSA 1F3FA 4S0MA 2HURA 3ETMA 4DUTA 3NGSA 3FBBA 1BUXA 3MPDA 2B8PA 3Q89A 1NSKL 3FC9A 4W98A 4UOHA 3EICA 3VVUA 1NDKA 3FBEA 3Q8UA 4DZ6A 2DXFA 1BE4A 1S59A 2DXDA 2DYAA 1NUEA 1UCNA 1XIQA 3Q86A 4FKYA 5CAAA 1B4SA 3BBBA 3EVWA 4KPCA 3EM1A 2CWKA 3JS9A 3BH6B 3BBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BXI A;  4ANE A;  1WKK A;  2HVD A;  4ENO A;  1JXV A;  1NSP A;  4O0N A;  3PRV A;  3Q8Y A;  3VGT A;  3Q8V A;  4CP5 A;  3BBF A;  1NDC A;  3B54 A;  2DXE A;  1KDN A;  3EE3 A;  1WKJ A;  4UOG A;  1NDL A;  1S57 A;  3ZTQ A;  3ZTP A;  1BHN A;  3EVO A;  1PAE X;  1B99 A;  1HHQ A;  4ANC A;  4EK2 A;  4F36 A;  3FCV A;  3VGV A;  1WKL A;  3VGU A;  3EMT A;  4C6A A;  3GP9 A;  1LEO A;  3ELH A;  1NCL A;  3ZTO A;  1LWX A;  5C7P A;  3FCW A;  3G2X A;  1K44 A;  1F6T A;  3BH7 B;  3NGR A;  3DDI A;  2HVE A;  1NSQ A;  2AZ3 A;  1NHK L;  2AZ1 A;  3GPA A;  4HR2 A;  2ZUA A;  2DY9 A;  1W7W A;  5CAB A;  5IOL A;  1VYA A;  4FKX A;  4F4A A;  1NDP A;  2BX6 A;  3ZTR A;  3NGU A;  1XQI A;  3FBC A;  2BEF A;  1EHW A;  3EVM A;  4UOF A;  3EJM A;  1NLK L;  3PJ9 A;  2B8Q A;  1U8W A;  3R9L A;  1MN7 A;  4WBF A;  4AND A;  4DI6 A;  1S5Z A;  1NB2 A;  1NPK A;  1ZS6 A;  3ENA A;  3FBF A;  3DKD A;  2VU5 A;  3B6B A;  3ZTS A;  3VVT A;  1MN9 A;  1HIY A;  3L7U A;  3NGT A;  1HLW A;  2NCK L;  3Q83 A;  1PKU A;  3WX8 A;  3FKB A;  3VGS A;  1F3F A;  4S0M A;  2HUR A;  3ETM A;  4DUT A;  3NGS A;  3FBB A;  1BUX A;  3MPD A;  2B8P A;  3Q89 A;  1NSK L;  3FC9 A;  4W98 A;  4UOH A;  3EIC A;  3VVU A;  1NDK A;  3FBE A;  3Q8U A;  4DZ6 A;  2DXF A;  1BE4 A;  1S59 A;  2DXD A;  2DYA A;  1NUE A;  1UCN A;  1XIQ A;  3Q86 A;  4FKY A;  5CAA A;  1B4S A;  3BBB A;  3EVW A;  4KPC A;  3EM1 A;  2CWK A;  3JS9 A;  3BH6 B;  3BBC A; 
#chains in the Genus database with same CATH topology
 4CM0 A;  5LOQ A;  3S6E A;  1M5O C;  4I7F A;  4F0M A;  2WW8 A;  4KGZ B;  3FCH A;  1CS4 B;  3EWG A;  4DR6 J;  2R42 A;  5HRO B;  1WKJ A;  1UJ5 A;  2HEK A;  2QLX A;  1N5V A;  1YI2 S;  2HBQ B;  2D3O 1;  4B9U A;  1X5S A;  4KGK A;  2AIR B;  5KOW A;  1NSA A;  4CZC A;  1K73 T;  3KG0 A;  3LPY A;  2DO0 A;  3I87 A;  1N36 F;  1K1S A;  3NGU A;  3H2L A;  3KLE B;  1RYS A;  1NZ8 A;  2DHX A;  2HG4 A;  2NRE A;  3PW0 A;  2B8Q A;  4E2F B;  2OH2 A;  4M5H A;  2H51 B;  4F4K A;  3QFW A;  3ADA C;  2NCK L;  1YBU A;  1Y5I B;  5HVF A;  4EO8 A;  1UA1 A;  2K7K A;  2Y1J A;  1IKX A;  3JSB A;  2UV8 A;  3N6L A;  4LF8 J;  5EGY A;  2MQN A;  4ECR A;  1O0P A;  5KT6 A;  2W2N P;  2YKM B;  2YQ1 A;  3M2R A;  3QGH A;  1RBO B;  4LSL A;  1JLC A;  3J7Y U;  4ZDN A;  3TRG A;  4AUK A;  2HHX A;  1X4A A;  2OD6 A;  3B82 A;  2JZ5 A;  2HVD A;  3LQV A;  3VHQ A;  3ZZY A;  4X65 F;  2ATL A;  1GX5 A;  4M63 A;  1N5Q A;  1FD2 A;  4DL2 A;  3TUI C;  2EFQ A;  5J2N A;  2HZC A;  5B0E A;  3R1L A;  3N0V A;  3ENQ A;  3CIZ A;  2JDJ A;  1HR0 F;  1RTD A;  3D6H B;  2UUC F;  1F1B B;  2OPS B;  2N3O A;  1BY9 A;  1NH8 A;  1SI9 A;  3IBF B;  1RHM B;  1T03 A;  5M2U A;  4BHQ A;  1FE0 A;  1Y3K A;  1BQX A;  3BGF A;  3O5T B;  1FEH A;  3A8J A;  2ACY A;  4EO6 A;  3W65 A;  1FE4 A;  4U7U D;  1M5K C;  3R6G B;  4WFY A;  4BCA A;  4KIA A;  2EFP A;  4WYW A;  1U0H A;  2AKW B;  1JLF A;  5K20 B;  2C42 A;  1DTQ B;  2KG0 A;  1XBW A;  1XTZ A;  2PO4 A;  3HP6 A;  3JXO A;  4X4Q A;  4X65 J;  4WXW A;  4ECY A;  2CPF A;  1TL1 B;  2COL A;  3J7Z 5;  4DQP A;  1V3Z A;  5K14 B;  2FUG 9;  4NLS A;  1YIJ S;  1WG5 A;  2JWN A;  1ZPV A;  2UUC J;  1NKC A;  2VKR A;  1N56 A;  2C2Z B;  5AE2 A;  5KFR A;  2VF3 A;  1K47 A;  4RWW A;  1LKZ A;  2VJU A;  1R27 B;  3LWM A;  2QLJ B;  1IQZ A;  2QT7 A;  1FX4 A;  3M30 B;  1I6J A;  4GMK A;  1R6V A;  3AQP A;  5K9F A;  1FTC A;  2R7W A;  4NPO A;  2WBR A;  3PO5 A;  2WRM A;  4KHM A;  1PYT A;  1TL7 B;  2R3V A;  1XER A;  3D28 A;  5J1E B;  2FHJ A;  2RKI B;  2QMW A;  2YXL A;  2WOM B;  1FXD A;  2XZD B;  3IRX A;  4OJH A;  1UW9 A;  3BQ2 A;  2DR8 A;  1F3F A;  2XHC A;  2P9C A;  2LU2 A;  5BYR A;  3PW7 A;  5DQG A;  2GVZ A;  1KD1 T;  2UXD F;  1WC5 A;  1FNX H;  3JB9 k;  1FJC A;  4K59 A;  4DV2 F;  3B4D A;  4QR1 A;  3H2V E;  1S1V A;  5L46 A;  5GAE U;  3NCQ A;  1X60 A;  4DMZ A;  1VBZ A;  2C2O B;  2DIS A;  1AFJ A;  4EWT A;  2IM1 A;  3ISN C;  2H5J B;  1HWI A;  3OFG A;  1C0U A;  2HIQ A;  3M2U B;  1KOH A;  2FC8 A;  1NJI T;  2VA3 A;  3C66 A;  9ATC B;  2KHC A;  2OML A;  2VG6 B;  3IXQ A;  4YB6 A;  1JMT A;  4WTY A;  3PIO Q;  3DLB A;  3ENW A;  3GPA A;  3H7H B;  5D77 A;  5F8J A;  1EQ0 A;  2Y3Y A;  2DVI A;  4FVM A;  2DHS A;  3AY0 A;  3M4X A;  1NH7 A;  2HMI B;  1U47 A;  3HD2 A;  3VWS A;  1P1T A;  3UFC X;  2HGN A;  2UXD J;  5B0A A;  2X1G A;  4OJ3 A;  3MUT P;  5EN1 A;  1LQ9 A;  1QUV A;  3CCE S;  3Q89 A;  1RT7 B;  1OSD A;  2Z2M A;  1Q95 G;  2NZ4 A;  4B3O A;  3SV3 A;  4YR3 A;  1FFS B;  3L09 A;  2WSC C;  2WCX A;  4WKR A;  4WP3 A;  1S7H A;  1I51 B;  5ETP A;  3TZX A;  1DZ5 A;  2WON A;  3LWL A;  3MED B;  3RBD A;  4ZP9 A;  3V2U C;  4ED3 A;  2BDP A;  3EMT A;  5KFC A;  4IH6 A;  1GMW D;  2DGO A;  2FLP A;  2J6S A;  3D1Q A;  1RWP B;  4ZCK A;  3MM8 B;  4UTG A;  1U1M A;  1ELO A;  2FD2 A;  4F2S A;  3D6M B;  3BGL A;  2Q43 A;  2HFZ A;  2VBW A;  3DLK A;  3OFH A;  3FFI B;  2OD4 A;  1IKW B;  4CDI A;  1C4A A;  2R2R A;  1FK9 A;  3QSI A;  4BWM A;  2DY1 A;  4IH5 A;  3MTK A;  2XYG B;  1BUX A;  2ZVI A;  1AA1 B;  2ZWO A;  1LW2 B;  3SQO P;  1WOS A;  5CXT A;  3TNV A;  4OL8 A;  3S1T A;  3QJP A;  4MYT A;  1HYS A;  2O3D A;  4JP8 A;  3BR8 A;  1UCN A;  1PYS B;  2HNY B;  2KM8 B;  4K4U A;  3BH6 B;  2KXF A;  3H5U A;  3BDP A;  1T94 A;  4ECZ A;  2VFT A;  2HHW A;  1S57 A;  4H4M B;  2IYI A;  3CJQ A;  1LEO A;  1YTY A;  3V6D A;  1IBK J;  2KVQ E;  1IXK A;  2CJQ A;  2VA2 A;  1WEX A;  3MPY A;  4DX8 H;  1S6Q A;  3M1V A;  4URG A;  3C6U B;  1A7G E;  1Q5Y A;  1N5T A;  2OLW A;  4DPU A;  4HT5 A;  1KN6 A;  3PYF A;  4LF6 F;  2W9C B;  1OMS A;  4F25 A;  1H7X A;  1NKB A;  4AL6 A;  4J9M A;  1REG X;  1S1W B;  2CZ4 A;  1JKH A;  1M5S A;  1FVQ A;  1FRJ A;  1GK8 A;  2ZKU A;  2CQG A;  3KLH B;  4C8M A;  2DBB A;  2R2T A;  5C42 B;  1FI4 A;  3DRR B;  3I55 S;  1VHF A;  2U2F A;  4YB7 A;  2NSC A;  4A8W A;  1B0P A;  2XHW A;  2CPX A;  3THT A;  4TVA B;  4CT8 A;  4LF5 F;  3PJX A;  1KHW A;  1RAG B;  4YR2 A;  3Q8V A;  3QRP A;  1WWH A;  3KJV A;  4DG1 B;  3CCJ S;  4ZJQ A;  3W2V A;  2H3E B;  2IM3 A;  2RUG A;  3VAL A;  4C6A A;  3GP9 A;  1BQN A;  2JLE A;  2BAN A;  3TEH B;  2D41 A;  1TKT A;  1T3N A;  2RS2 A;  3M2V B;  2VG5 B;  2RDJ A;  1IN0 A;  2IJF A;  5L39 A;  4LF6 J;  2DGW A;  3CSK A;  3EX7 B;  3ETO A;  2BJ7 A;  2BA9 A;  4QIF A;  3IAM 9;  4NCG B;  4CO2 A;  5ITH A;  2DGV A;  1S76 D;  4HT7 A;  4KKO A;  4RWX A;  4OI3 A;  4A4J A;  2QA2 A;  1MWQ A;  2ZE2 A;  4JI2 F;  2QG9 B;  2RS8 A;  4C48 A;  4MK9 A;  2ATC B;  3HVT B;  3UD3 P;  3MGJ A;  2B9W A;  2CNK B;  4LQ9 A;  1OPZ A;  3ZO7 A;  2CPH A;  3H90 A;  1S97 A;  3MEG A;  4RL1 A;  5ETN A;  4RBV A;  2PDA A;  3KUG A;  4OZN A;  3VAJ A;  3LP2 A;  3MCS A;  4OYP A;  3A8E A;  2RIL A;  2G2O A;  1RTI A;  2DCL A;  3MD1 A;  4JI7 J;  3NAI A;  3PR4 A;  1L3T A;  1CJK A;  5KFZ A;  3CC4 S;  4CT9 A;  4QIG A;  1SJQ A;  4KHR A;  3OFE A;  5CYM B;  1VMB A;  3W9H A;  1K44 A;  3O44 A;  3GFZ A;  1U6Z A;  2BRL A;  4JV0 A;  3CJ0 A;  3HKZ D;  3FEY B;  4RLE A;  3D67 A;  2JHE A;  2KHD A;  2B4V A;  4L74 A;  3KNA A;  2Z0G A;  2POK A;  2RVJ A;  3ZNJ 1;  2PFD A;  3QMQ A;  3UNG C;  2IY5 B;  1ZH5 A;  4Q0B A;  1S6P B;  4DUY F;  4JI2 J;  3CIM A;  1QSL A;  4I6W A;  4D3H A;  3TWZ A;  1RWM B;  1HMV B;  2GV1 A;  4P75 A;  1OSC A;  1RUS A;  1Q7Y T;  4ID5 A;  1BMQ B;  2M7S A;  1WTF A;  2XMV A;  5JMN A;  3U7J A;  3WX4 A;  2A18 A;  4CYU B;  4LRC A;  1PC5 A;  2E9Z A;  3BBC A;  1MRO A;  3F0N A;  4ECX A;  2VQE F;  3DM2 A;  2B9Y A;  2ZUG A;  2NPI A;  3ILO A;  3CMQ A;  2IBO A;  3CCQ S;  3UCZ P;  3MM9 A;  4LFA F;  4ED6 A;  2LQB A;  2UUW A;  4M5I A;  3R97 A;  1FO1 A;  1VJW A;  3MEE B;  4F4X A;  1CQM A;  3E01 B;  2AX0 A;  4QIW D;  3UWT A;  1MWY A;  2ZHB A;  2BV3 A;  3CGI A;  2V8P A;  4P6Q A;  2YBV A;  3GMG A;  3FK4 A;  3EJM A;  1IWG A;  1ZM3 A;  4MKY A;  5FDL B;  2CPJ A;  4WBF A;  2ZH7 A;  1TU0 B;  3BSA A;  3DGP A;  4Y00 A;  2Z2Y B;  3KWM A;  2IA6 A;  2ZC3 A;  5SZT A;  5KFP A;  1HLW A;  2DR5 A;  3NP5 A;  2V4J A;  4ID8 A;  1PIE A;  2AYM A;  1HNI B;  2R7X A;  5IT4 A;  4J9K A;  1VK8 A;  3KG1 A;  3BGU A;  3K5N A;  3U02 A;  5LXR A;  2OFH X;  1RAC B;  1U2R A;  4JI5 J;  3LOU A;  2JLF A;  2L48 A;  5IWA J;  3D0I E;  3W7B A;  4EEY A;  4LFA J;  1JLQ B;  4Y2K A;  4YME A;  3UNY A;  1U6B A;  3M8Z A;  2ZJQ Q;  4DS5 A;  4HHH A;  1S79 A;  3BH7 B;  3QBC A;  4MIW A;  2MY7 A;  2ZBQ A;  5E3C A;  4JI1 F;  2AZ1 A;  2DCU B;  3I82 A;  4ECW A;  5CYQ B;  4ZPT R;  4B9T A;  4ED4 A;  3T6J A;  3PJW A;  3PJ9 A;  2FB0 A;  2KYX A;  3OL8 A;  2IDE A;  1S1U B;  2ZFH A;  3VTI A;  3ZTS A;  2BW2 A;  3BN4 A;  1NAQ A;  2HBZ B;  1SJ4 P;  1SC3 B;  3NEK A;  3G8S A;  3IP0 A;  3VGS A;  2DRD A;  4PEO A;  2MLX A;  2HHT A;  3TW0 A;  4PG4 A;  3HT0 A;  3ZC4 A;  1AFI A;  4I7F B;  3LAL A;  2C3U A;  3PYE A;  4LF4 F;  2DYA A;  1S0N A;  4K4T A;  4QR0 A;  2HHP A;  2FZC B;  5E2Q A;  4CNY A;  4O0N A;  2AEM A;  4JOU A;  4UOC A;  4V19 J;  1NDC A;  1FRH A;  3SI8 A;  2RH3 A;  1RT2 A;  3CD0 A;  2JVR A;  5F9L A;  4ZPC A;  1CJT A;  4ZP7 A;  3HZG A;  4EBD A;  4BLG A;  4B9V A;  3A8K A;  3D7S B;  3NWR A;  2LQ5 A;  2DNO A;  4K0K F;  2Z56 B;  2E9R X;  2XS2 A;  3OSN A;  2ZZN A;  1IKX B;  3IR5 B;  3VR1 A;  1Z4U A;  3G87 A;  4EGL A;  2V4Q A;  2BJ8 A;  4QU7 A;  5A2Q U;  5IXU A;  4FBT A;  2CJX B;  4A8Q A;  3M2R B;  4LSL B;  3MR6 A;  1JLC B;  2M9K A;  3NGS A;  2LDI A;  1VQ4 S;  5T7L A;  5BJR A;  2ILY A;  1UVI A;  2W01 A;  4LF4 J;  4L3K A;  1EZZ B;  2UVW A;  4TYB A;  1IKY A;  1RIS A;  1TTH B;  4K4V A;  1Q79 A;  3EGZ A;  2HS3 A;  3UD4 P;  5J2N B;  2KDO A;  4Y2A A;  2D9P A;  2QL9 B;  1RTD B;  5DDQ C;  4DCP B;  4YFU A;  2M5Y A;  1KFD A;  1QSY A;  3B54 A;  2CVE A;  2VOP A;  4X2B A;  4DUZ F;  2W7O A;  2NS1 B;  4C9D A;  2YH0 A;  1D3W A;  4ILM A;  2DNR A;  4Q7A A;  3VF0 B;  1T03 B;  4K0K J;  1RT3 A;  2YY3 A;  3MUM P;  2ZHO A;  3V81 A;  3UE2 A;  3L4B C;  1RA6 A;  1SKR A;  3BKF A;  3PY8 A;  4LBI A;  2UVU A;  2UVR A;  3OHA A;  3CJR A;  2XLI A;  2V2Q A;  1YJW S;  1U0H B;  8ATC B;  5DM6 Q;  1JLF B;  1PKU A;  1Q8I A;  1UEV A;  1L5U A;  4Y2M A;  1N0V C;  5IV3 A;  3SFG A;  2VFV A;  1UA0 A;  3G8T A;  3AOA A;  1LFW A;  4PRF A;  3OBI A;  3M8R A;  4UUX A;  1J2V A;  3UI3 A;  3JAM Y;  3RR8 A;  4X4V A;  1C1B A;  3P5B P;  2RDD A;  3N79 A;  2ZDP A;  2MKK A;  4NLY A;  4DUZ J;  1BLU A;  1DQ9 A;  1VQN S;  2J0S D;  4O3O A;  1HHQ A;  2UV8 G;  3FCV A;  1R0A A;  2XMW A;  5K8O A;  4K2X A;  1RTH A;  4G65 A;  4OYZ A;  4CLP A;  1PAU B;  1F6T A;  1RBA A;  2HHV A;  3B8H A;  2VFR A;  4AQY J;  2R4F A;  4ZVE A;  4JI6 J;  4A8X A;  1I5O B;  3IRX B;  1UFK A;  1Y11 A;  4MJK A;  4ZLJ A;  3PNI A;  1EHW A;  2CQB A;  2HFV A;  2OPQ A;  3HLU A;  4P72 A;  1WC4 A;  2GVZ B;  3HSG A;  3BYP A;  2W25 A;  1S1V B;  1U26 A;  5D8H B;  2CVI A;  4RW9 A;  3JTP A;  3OXL A;  1X9S A;  1TUV A;  3TVZ A;  3OHB A;  4I4B A;  2DH7 A;  4QJV A;  4DV6 F;  4DZ6 A;  2MKC A;  3PEJ A;  2QGF B;  2B6A A;  2CIM A;  4DV0 F;  2LXI A;  1UWB A;  2K8G A;  3OJS A;  1YJR A;  3CCU S;  1GMV A;  1IJE B;  3E3X A;  1R8P A;  2WVB A;  3IRW P;  4ALZ A;  2R2U A;  3QID A;  1RWX B;  2LLZ A;  4ECU A;  1SIZ A;  2HSE B;  3T5H A;  3C8Y A;  1YJ7 A;  3GJT B;  4GVB A;  1CLF A;  4AT1 B;  1KEK A;  4I2Q A;  4WCE Q;  2RF2 A;  3MOJ B;  2WAQ D;  3FEZ A;  3PDN A;  2C22 A;  3LAM A;  4B3O B;  3IM8 A;  4RBU A;  1GT8 A;  4DV6 J;  2A2C A;  3G8Q A;  2UUA F;  3BM7 A;  3NNH A;  4PQU A;  3SCL E;  3GG0 A;  5A0Y A;  2WON B;  3FDS A;  1R43 A;  4E98 A;  2HND A;  4X4O A;  2DTJ A;  4K8R A;  2ZH2 A;  2KVI A;  3DYA A;  3A13 A;  1OQ6 A;  2F63 A;  4OIX A;  3MCM A;  2UUB J;  3PRV A;  4IOB A;  3W8P A;  2NLW A;  4ED5 A;  3DI6 A;  2IVF B;  1VC5 A;  4IOA Q;  2FHJ D;  4K5S A;  3QAE A;  2EK1 A;  1ZAX A;  2QX0 A;  1CG2 A;  5L1K A;  5IQQ A;  1PJ6 A;  4YN3 B;  5DQI A;  3DLK B;  3GIL A;  2YX7 A;  3BO4 A;  3TAP A;  1R89 A;  5D3G A;  2PII A;  3GG1 A;  1RJJ A;  4GKJ F;  1FK9 B;  2B51 A;  1UZH A;  5K8N A;  1Y10 A;  3I9Z A;  4NI2 A;  4HI2 A;  1KQS R;  4DF4 A;  1KFS A;  2B4O A;  3CJK A;  4EBC A;  4DL4 A;  5L9N A;  3Q0A A;  1K1Q A;  4PXC A;  1HYS B;  3N5F A;  1RTZ A;  5C25 A;  4NLR A;  1XJW B;  2UUA J;  2D3O R;  4XO0 A;  4ZVS B;  3O6Q A;  1NSK L;  4DR4 F;  2IM0 A;  5D6G A;  3P49 B;  1FRX A;  1X9M A;  1U0S A;  5LMN F;  1OO0 B;  4WU3 A;  2DNN A;  4FXW A;  2C3M A;  3HFK A;  4GC6 A;  2C1E B;  4LFC J;  4DV7 J;  2MQL A;  2V67 A;  3V6D B;  2BQU A;  4MH8 A;  2DH8 A;  2LEB A;  3PVX A;  5E5N A;  3NNA A;  1S6Q B;  3M1V B;  2AP6 A;  5F9N A;  2DPI A;  4I64 A;  2R8G A;  3C3L A;  2Z8Q A;  4NLX A;  2C28 A;  1REV A;  1VQL S;  2VFU A;  2X3G A;  4U7U K;  4X4R A;  2AW0 A;  3CWJ A;  1J5O A;  4IRD A;  4F7V A;  4A8O A;  2OO4 A;  3R7S B;  1JKH B;  1VIO A;  4NYO A;  1KQG B;  2DGT A;  3PAC A;  2KJW A;  2A6O A;  1WDT A;  2D9O A;  2ACM A;  2APO A;  2XS7 A;  2VQF F;  3KDO A;  2G2Z A;  2KFY A;  1XNQ J;  4PUO A;  2RHQ B;  1RAI B;  4J90 A;  4O3P A;  4ZN3 A;  2ROE A;  2MQM A;  1HAR A;  3Q2S C;  3CD7 A;  4DR1 J;  2LP4 A;  4CH7 A;  4I2P A;  2KT2 A;  1WDD A;  1RT6 A;  2UZA A;  4RW7 A;  3KJV B;  4OZJ A;  3RU0 A;  3W2V B;  1FNO A;  2QFJ A;  2P6T A;  2VC1 A;  4JI4 F;  1D9A A;  4ZCI A;  1BQN B;  5B09 A;  2GHP A;  2BAN B;  1SPB P;  1TKT B;  1RAO A;  2OTL S;  3WBZ A;  2W4P A;  1RU2 A;  1U1N A;  2QYG A;  3W5Y A;  4P2S A;  2YWH A;  2GFF A;  1O6X A;  4KKO B;  3HK2 A;  5B7W A;  4NEY A;  3RYL A;  5CAB A;  2GMH A;  1NJX A;  4NA2 A;  3HT3 A;  1DLO A;  4AYB D;  2ZE2 B;  4U67 Q;  3GTY X;  5EX3 A;  4RU2 A;  2VAS A;  2VQF J;  4IKA A;  4O44 A;  1S5Z A;  1HD1 A;  3JYT A;  3ENA A;  4NZ0 A;  1VK3 A;  1YLX A;  1AUS L;  1CUL A;  1QY7 A;  5ETS A;  3HO1 A;  1C4C A;  3MEG B;  5KFE A;  5E33 A;  4NL5 A;  1N8R T;  2CPD A;  4JI0 F;  1SJ1 A;  3LP2 B;  2DGQ A;  1HNZ F;  3QT8 A;  1YG0 A;  1RTI B;  1AUD A;  2OKQ A;  3GFH A;  2QLF B;  2AYG A;  3GZ7 A;  4JI4 J;  2CXE A;  2H48 B;  1R8B A;  3PYD A;  5ETT A;  3EGW B;  1GH8 A;  2HQF A;  3HHE A;  1IBM J;  4JV5 F;  1CJK B;  2VBZ A;  1CJU A;  1JXV A;  5DO2 A;  1XK8 A;  4IR1 A;  4J9V A;  4RUA A;  2R8H A;  1RZM A;  1X4B A;  3FMB A;  3VV2 B;  4AXI A;  2AJQ A;  2VKZ G;  1BXN A;  4YR0 A;  3MF5 A;  1RTJ A;  5IFM A;  3CMA S;  3HMJ G;  1MMN A;  2BKN A;  4A8F A;  4PZV A;  2YH1 A;  4Q0B B;  2FTR A;  1H2V Z;  5L1I A;  3GYX B;  3TA1 A;  3EXC X;  3EVM A;  2KI2 A;  3KUH A;  3SQG A;  2FPH X;  1M90 T;  1NB2 A;  1NB7 A;  1L3K A;  2VZ9 A;  4ID5 B;  2R8I A;  4IFY A;  1M5P C;  2IRY A;  1FRI A;  2ZWP A;  4CLK A;  4JI0 J;  1OWX A;  2RB7 A;  2G1H A;  1MRO B;  4DPX A;  3GON A;  2B9E A;  2MST A;  1F3V A;  1YKW A;  4DN9 A;  3DM2 B;  1SBR A;  1FDA A;  4JV5 J;  4NX9 A;  4C4W A;  5ETV A;  3MM9 B;  2HKE A;  3US5 A;  4ILR A;  5E3A A;  5BXI A;  3TZY A;  2FYX A;  3PW5 A;  3MEK A;  2AT1 B;  2M8D B;  2ROP A;  4LIW A;  5K8M A;  2XMJ A;  2XO6 A;  3I4P A;  2W8K A;  4LR8 A;  2RRN A;  1RHQ B;  1YGY A;  1NCL A;  2BAB A;  2VC0 A;  4HEA 9;  2O5D A;  5CCL A;  1VBX A;  4LF7 F;  4P9S A;  3DGP B;  1AYE A;  1MNE A;  2K1R A;  2A2D A;  1VQM S;  5HMZ A;  1RHK B;  3ZTR A;  3W1Y C;  5DZ6 A;  4IG3 A;  2JX2 A;  2V4J B;  1YBA A;  3NXZ A;  3UQS A;  2RQM A;  3UR0 A;  2XO7 A;  3EPI A;  1SCJ B;  4FXV A;  2ZBI A;  3FGV A;  2XG8 A;  3IG1 A;  1KNZ A;  4TQS A;  3GFY A;  2V2K A;  4UOH A;  1K9M T;  3KLI A;  1LV5 A;  1BE4 A;  5KFB A;  3NCP A;  1PC4 A;  5F8I A;  1ZZN A;  3DHX A;  1F9H A;  2O01 C;  1UP1 A;  4R8U A;  1TK0 A;  4Y28 C;  2DNZ A;  3GIJ A;  1IUJ A;  4QBU A;  3HSZ A;  5C5J A;  5E3R A;  3CO9 A;  1VRU A;  2H9Z A;  4NMX A;  2RSQ A;  3H2U B;  4LF7 J;  2FHM A;  3V6K A;  3X1L B;  1QTN B;  4DEZ A;  4HLB A;  4XPC A;  3ULH A;  4B3R F;  2DNH A;  1TP7 A;  3HFV A;  3R7B B;  1GMW A;  1VYA A;  4AE5 A;  4DX5 A;  4EYI B;  4OHX A;  4WJB A;  2VPZ B;  2VBX A;  4UW2 A;  2Q6B A;  2NPF A;  4NXM J;  2V8V A;  2ZM6 F;  3EPG A;  4UZC A;  1Q16 B;  3QGI A;  3T41 A;  2XYP B;  4UQG A;  2DNQ A;  3NGK A;  3EZU A;  5CD4 A;  2EBE A;  1MU2 A;  2KRR A;  3ILL A;  3CJS A;  4L6V 3;  1SH3 A;  1LK7 A;  1CPZ A;  3JTO A;  4OI2 A;  3VAH A;  3PKY A;  1RAD B;  1D0E A;  4DPY A;  4USW A;  1S48 A;  4YDD B;  1N48 A;  1FDD A;  3MAA A;  4ECS A;  3V4I A;  1RT2 B;  3QYY A;  3DDK A;  1CJT B;  3SDE A;  4EI2 A;  2GZO A;  4DQQ A;  4B3S J;  3SZ2 A;  3TUZ C;  5DGA A;  5F8L A;  1RBL A;  1YJU A;  3OLB A;  3CME S;  2I38 A;  4PYA A;  5KFM A;  2AYE A;  3RZA A;  3AB2 B;  4EFA C;  4ED1 A;  4ZVH A;  4MMO A;  3H5X A;  1JIH A;  3MPU B;  2G2Y A;  4LRB A;  3CD6 S;  2RIJ A;  1IR0 A;  1NK4 A;  3VQT A;  1IVZ A;  1R3N A;  1BQM A;  3R2D J;  5T7L B;  3OTE A;  4PG7 A;  3W61 A;  1OS5 A;  4QYZ K;  4F3M A;  4DX7 A;  1IKY B;  3CUN A;  3GR0 A;  3VVT A;  1JNZ B;  1TVR A;  4N56 A;  1NK8 A;  4USH A;  2NXE A;  2JJ4 D;  3TVY A;  4BDP A;  3W62 A;  3Q8U A;  4MFB A;  1Q8B A;  5J2Q A;  4F4Z A;  1YDL A;  4KYZ A;  3QLH A;  5KFU A;  3Q8Q B;  1VQ8 S;  3RJM B;  5J2M A;  1DHM A;  3NBP A;  1RT3 B;  1LNQ A;  3HZE A;  4HHJ A;  3V81 B;  5D0R A;  4OYI A;  3J7Y I;  4KAI A;  1H0H B;  3I5B A;  4ZJO A;  1LWX A;  5CYJ A;  1TL4 A;  1DFD A;  1HHS A;  4J91 A;  3MEC A;  3NY0 A;  2DIU A;  2YQ3 A;  5AE1 A;  3DOM A;  3M6U A;  5E7O B;  1R8A A;  4G6V B;  1NDP A;  4NA1 A;  3PV8 A;  1G2E A;  4N77 A;  3RB6 A;  1U1Q A;  4QOT A;  3RBX A;  3SBM A;  4ED2 A;  1LXN A;  2PEB A;  3KOA A;  1VQ6 S;  5KFV A;  3W8G A;  3T9Z A;  2JNJ A;  3OUY A;  1VR6 A;  3J7Z T;  3PKM A;  1A6L A;  2BMB A;  1HPZ A;  1N5Y A;  2HUR A;  3PFE A;  5GMK a;  4GO7 X;  4F50 A;  1PG5 B;  4Q8F A;  1C1B B;  3EIC A;  2XMK A;  3WQP A;  2EK6 A;  1S12 A;  1X8D A;  3AQO A;  1U1P A;  1GXL A;  5B0C A;  5CA5 A;  2MKJ A;  1MSW D;  1R0A B;  1S49 A;  1RTH B;  4BBY A;  3LF0 A;  1WJ9 A;  2BOP A;  1SKU B;  2RHS B;  3W9J A;  4DL7 A;  3N28 A;  2Q6C A;  1B99 A;  3I9V 9;  1U1L A;  3HKW A;  3DXS X;  2OPQ B;  2IIH A;  2MZQ A;  2KT5 A;  5KFF A;  2H5E A;  4N76 A;  2JL9 A;  2E1P A;  3MCO A;  2LFV A;  1DQ8 A;  5IOL A;  1HWL A;  4IR9 A;  2ALZ A;  4RW9 B;  4X4S A;  1S0M A;  1YBT A;  4EMD A;  1YVF A;  1N0U A;  5GVQ A;  4N5S A;  5KFQ A;  3L9Z A;  4IG0 A;  3HVR A;  2F7V A;  5JXS A;  4ZVG A;  4DHV A;  2L3M A;  3PFO A;  3W60 A;  2OHD A;  2XY7 A;  3ETM A;  4WK1 A;  4P2M A;  3G9C A;  2DJW A;  4PG8 A;  2B6A B;  1UWB B;  4HI1 A;  1H2T Z;  3CDW A;  1T11 A;  5A2Q Y;  1Q81 T;  3JTN A;  2CNO B;  2MEW A;  3R6L B;  2X7I A;  3FZB A;  3M6V A;  3TO8 A;  3CDE A;  4FS2 A;  2ALY B;  4NWB A;  2EPI A;  3VQS A;  2VG7 A;  1O51 A;  3AJ1 A;  3DGV A;  4TY8 A;  4WP9 A;  1HA1 A;  3MZI A;  5FD1 A;  2XNR A;  5E41 A;  2HS4 A;  3CJ2 A;  4NE9 C;  4MK7 A;  3ICL A;  1BHN A;  5LXY A;  4P7T A;  2PA8 D;  1N52 B;  2CG8 A;  4GVB B;  4CI0 B;  4WWS A;  1P9Y A;  5GAE I;  4I2Q B;  2RF2 B;  5F3Z A;  3EDQ B;  2EKN A;  2FC9 A;  2W9B A;  1NHK L;  2W8L A;  3TQ1 A;  2FJW A;  2DNK A;  5U47 A;  4J9P A;  1H73 A;  2XCP A;  3AHP A;  4F02 A;  4KTQ A;  2HGM A;  1ZS6 A;  4PQU B;  1HI0 P;  2QA1 A;  1X4C A;  3B78 A;  1QVG R;  5A0Y B;  2PEH A;  1RWK B;  2YNF A;  2O67 A;  4AL7 A;  2HND B;  2FGO A;  4U8Y A;  2Y0S D;  3DYA B;  3ZZ0 A;  2P6S A;  5BYS A;  3B4M A;  5KG4 A;  4QPX A;  2C2K B;  2HRU A;  1S4F A;  2E5G A;  5KT3 A;  3DI6 B;  4CWB A;  1EAR A;  2KFN A;  4LRD A;  2GX8 A;  5LSR A;  1C2P A;  3OW2 R;  5EWF A;  2E1M C;  2IJN A;  2XWY A;  2CJY B;  3IGV A;  3OTO F;  5D3G B;  2EEY A;  1DAR A;  1XMB A;  4ES1 A;  1YRX A;  4NI2 B;  2RQC A;  2KTQ A;  2VFS A;  1G7C B;  3H20 A;  3CJK B;  2GA7 A;  3ZXW A;  5KG1 A;  3D3C J;  4J9S A;  5C25 B;  4IO9 Q;  2GHW A;  2GQC A;  2IVY A;  2VUG A;  4ZVQ B;  3HFZ B;  3MM7 A;  1X4D A;  3B6B A;  3L7U A;  3IS9 A;  5KFO A;  1D8Z A;  3BEG B;  3Q83 A;  3OJU A;  3BYR A;  2FY8 A;  5EWG A;  3E8O A;  4OI1 A;  5LMU F;  3M8W A;  4ZP6 A;  3FMW A;  2H5I B;  1K8A T;  1W25 A;  4B17 A;  2EWH A;  4YY3 F;  4UST A;  2GO8 A;  4FPI A;  4HVZ A;  3H4B A;  4RNH A;  3KHG A;  4CLS A;  3PW2 A;  4NLD A;  2HBR B;  1REV B;  5JJB A;  1KTV A;  3TA0 A;  1J5O B;  4C98 A;  1X4F A;  3QPI A;  4UZB A;  4X4N A;  3HSJ A;  1T05 A;  1NU4 A;  2GVD A;  1VRQ C;  1Y3J A;  4HR2 A;  4B3M F;  1TUW A;  4DJB A;  5HO4 A;  4F4A A;  3DLH A;  3DXB A;  4O4R A;  4PUO B;  2HRT A;  3LP1 A;  3BSO A;  4I2P B;  2YWE A;  1K0V A;  1RT6 B;  4RW7 B;  5LMU J;  4I0W A;  2ZBR A;  2I5J A;  1ROF A;  1ZET A;  3DLE A;  1NK9 A;  4KO0 A;  3RTV A;  5KFN A;  1T0T V;  2DNG A;  2BM1 A;  2FLN A;  1TEL A;  4QPT A;  1FTR A;  2YVS A;  2V69 A;  1TL3 A;  3QZ7 A;  6AT1 B;  4ER8 A;  1T3O A;  3Q8P B;  2M3D A;  2DHH A;  3EE3 A;  3OR1 A;  4IOC Q;  4ZVF A;  1SUQ A;  3EYZ A;  1DLO B;  2ZBC A;  3AT1 B;  5H9F J;  3DMJ A;  2X3D A;  2OEL A;  2LXU A;  4LBP A;  2DNL A;  1DY3 A;  4O44 B;  2CZV C;  1FEE A;  3JYT B;  6FDR A;  1S7I A;  1HBU A;  1O8B A;  3FSI A;  2CUY A;  4M8L A;  1CUL B;  5DZ7 A;  2Q3P A;  3CCT A;  2VPX B;  1FKA F;  1UVL A;  3PTW A;  4DI6 A;  4KGM A;  1T9Y A;  4JB8 B;  1CC8 A;  4QCL A;  2ZD1 A;  1NHV A;  3MMJ A;  3OL9 A;  1T9X A;  2IVM A;  2H1Y A;  2DGS A;  1LWC A;  2M52 A;  1XC9 A;  3CDU A;  2F40 A;  2YKO A;  4F0H A;  3CCL S;  5JVG Q;  1G1X A;  2ERR A;  1CJU B;  1O5J A;  3NNC A;  2J9D E;  2BJ3 A;  3O1L A;  2UUT A;  4ZS6 A;  2YKQ A;  1RAA B;  5BR8 J;  4XDD A;  4J7C A;  4DR5 F;  1JLA A;  1RTJ B;  3TX8 A;  2KKH A;  2GQQ A;  5EWE A;  1OYE A;  4CP5 A;  2DHA A;  5HMX A;  5DDR C;  5LSO A;  5THW A;  4QWC A;  1FT8 A;  1E6V A;  2CQ2 A;  3QT7 A;  3PRD A;  3TVK A;  3SQG B;  3U27 A;  1QE1 A;  3PZP A;  3MFH A;  5IQ6 A;  4B3T J;  5HMW A;  4I1T A;  1N33 F;  2XSJ A;  4IFY B;  3MFI A;  4ZPB A;  4Y2I A;  3IN5 A;  1U8W A;  1MN7 A;  3PCO B;  2XGP A;  2HHU A;  2FY1 A;  4KHP F;  1WC1 A;  5F0U A;  1A9N B;  1KVJ A;  3GU0 A;  1DJ0 A;  2KL8 A;  1R0C B;  2JSX A;  3OVA A;  1RB0 A;  4GRS A;  3FBE A;  4AL5 A;  2DXF A;  1AXQ A;  2OJ3 A;  1R6Y A;  2YNG A;  4DR5 J;  5LJ5 Y;  1VC0 A;  4IDK A;  1N36 J;  4X66 F;  3H0P A;  1QAI A;  4O3R A;  2KB2 A;  4A8Y A;  1RT1 A;  3OL6 A;  3C6T A;  3EVO A;  2K1R B;  1CEZ A;  3HD1 A;  4H4O A;  4IG3 B;  1MWZ A;  3DLL Q;  1N33 J;  2HVE A;  4CNZ A;  4DFP A;  5HP1 A;  5KTQ A;  4ZPV R;  2HQI A;  2I0X A;  2GAH C;  3IG1 B;  4OYB A;  4UT4 A;  1Q0N A;  1TR0 A;  2BRK A;  4OZ5 A;  3PO4 A;  1HNW F;  2HZV A;  3KLI B;  4A8K A;  4K4Y A;  1TKX A;  1IBL F;  1NBE B;  4L75 A;  3CD5 A;  1C0T A;  1YJV A;  3D4J A;  3TAR A;  3VZI A;  3MPD A;  4R8U B;  1BWV A;  2OEK A;  4WYL A;  4ZHR A;  4M1K A;  2AJF E;  2ZVS A;  2HHS A;  4HHU A;  2AGQ A;  1HR0 J;  1ARO P;  3MD3 A;  1VRU B;  4BWJ A;  3DHW C;  1PCA A;  5KAK A;  2PMW A;  2VIH A;  2AGP A;  3MXH P;  2HFO A;  3VGT A;  4G1Q A;  4DX6 A;  3BPD A;  1Y5L B;  1LXJ A;  4WZM A;  4UOG A;  1IM4 A;  1K0T A;  3VGU A;  2X1F A;  5C7P A;  4WE1 A;  1EB0 A;  2BAC A;  2I1R A;  2V94 A;  2FVR A;  3RRH A;  1DTQ A;  4C8Z A;  2PT0 A;  2GMJ A;  1RWN B;  3V6J A;  2XYH B;  3I96 A;  1GQE A;  1M1H A;  1HD0 A;  1MU2 B;  3HHL D;  4NLQ A;  2CPZ A;  3FBF A;  3FVY A;  4OFZ A;  3V6H A;  3MAA B;  1H7W A;  3V4I B;  1RWW B;  4C3L A;  4NYZ A;  4RZR A;  2M8H A;  5MLC V;  3SDE B;  4DSI A;  3NMR A;  4J9R A;  4Q44 A;  4FKY A;  3FSY A;  3H40 A;  4X4T A;  2W4C A;  4NLT A;  4NCA A;  1F9E B;  3UD5 A;  3G4S S;  4PPZ A;  3ZZO A;  1B3T A;  3ITH A;  4Q2M A;  2YNH A;  5K8P A;  1EET A;  3L95 X;  1HQU A;  5I3U A;  1T8E A;  3ISN D;  3GJS B;  2FDN A;  4DR2 F;  5A6W A;  1BQM B;  2J6T A;  1IKV A;  3O3L A;  3CE8 A;  1X5O A;  3KJN B;  2JC0 A;  4FKX A;  2CFX A;  2JOQ A;  4G3I A;  1TVR B;  3FBC A;  4DV2 J;  4CO3 A;  2QLB B;  2XWX A;  4M5K A;  4RJV A;  2HYI B;  2I2Y A;  4A47 A;  3HHN B;  2YX1 A;  4H54 A;  1MN9 A;  1KC8 T;  2F9D A;  4LBH A;  1Q86 T;  4XIU A;  3GV7 B;  3PW4 A;  2B43 A;  2ZC4 A;  2RRA A;  4MFB B;  2R7V A;  2E1A A;  1VDH A;  1WEZ A;  5KG3 A;  2QIF A;  1WG1 A;  3QLH B;  4F4Y A;  1A0O B;  2XSF A;  5J2M B;  3NBP B;  4ATN A;  3M9M B;  2EG2 A;  2QMX A;  1F60 B;  2OTJ S;  5CH7 B;  5HJX A;  1GMU A;  3EGN A;  4DV4 F;  1VOM A;  4LR7 A;  3K2Y A;  4PWU A;  4DR2 J;  4DV3 F;  4DZD A;  3MEC B;  3U1M A;  5D4O A;  4OI4 A;  3DOM B;  3LGN A;  2AWZ A;  5CHC B;  2FJD B;  2Z58 B;  2DRA A;  2HRY A;  1Z1Z A;  3MTJ A;  3MPV A;  1DUR A;  3QAT A;  2NQP A;  4EU0 A;  3OUY B;  3GJQ B;  4OYO A;  1Q53 A;  1HPZ B;  2MPU A;  3KJQ B;  1X0F A;  1N5Y B;  1CVJ A;  2RJZ A;  2DT9 A;  2PMH A;  2LU1 A;  1U24 A;  3R27 A;  1ZTT A;  2Y8W A;  4RUH A;  3TAN A;  4CH1 A;  3QT5 A;  4B02 A;  1B0T A;  2E5L F;  1KBR A;  4ZJL A;  4U96 A;  2B3T B;  2EXU A;  4DV4 J;  1Q8K A;  5I3P A;  4F8R A;  3UDE A;  1JWW A;  2AX1 A;  1D8Y A;  3JS9 A;  3GE9 A;  3MMC A;  1RAF B;  4ANE A;  3W2W A;  3KUE A;  3RB4 A;  2WVD A;  1TV6 A;  2VOO A;  5C24 A;  1DRZ A;  5I42 A;  1UVJ A;  4LR9 A;  2ZEJ A;  2NYI A;  2FHO B;  2RT3 A;  1QD1 A;  1RSC A;  3LAN A;  3MDF A;  3BQ1 A;  2KZM A;  3CF5 Q;  4J37 A;  4LVO P;  1JJ4 A;  3GII A;  3K0J A;  4IG0 B;  3TQE A;  3KHR A;  2DK2 A;  5M2P A;  2XS5 A;  3RW6 A;  5B0D A;  2BJD A;  3NG8 A;  3SCI E;  1NM2 A;  2VPY B;  2NR0 A;  4DPT A;  2MTL A;  2IYG A;  2BE9 B;  2VU5 A;  3KK2 A;  4ZPW R;  1UAW A;  2P2C B;  4KY3 A;  3A12 A;  2MJN A;  3BSN A;  3K5O A;  1FRM A;  4E0D A;  4DCO B;  2VG7 B;  3QWU A;  4FNH A;  4TY8 B;  1B0V A;  3THP A;  3TEG A;  4DR3 F;  2IAJ B;  2ZJR Q;  4OLO A;  2VIC A;  4ENO A;  4CLY A;  2WBM A;  5T14 A;  2MZR A;  2LCW A;  2W9B B;  3N5B A;  4O3Q A;  1T9W A;  3D54 A;  2RU9 A;  4WF9 Q;  2AHO B;  3RGI A;  2C2R A;  1D9D A;  4RPF A;  3GV5 B;  3IBW A;  3CNQ P;  1RCX B;  3G2X A;  2CG4 A;  3U1N A;  4ETZ A;  5GAH U;  4LSZ B;  1NZA A;  2XMU A;  2IM2 A;  5KG0 A;  1RI7 A;  1RWV B;  2YNF B;  4UOF A;  1TAU A;  4KGX B;  1OY9 A;  4N41 A;  1W2I A;  1FER A;  5KT2 A;  3NL0 A;  2W1B A;  4ZLN A;  3HHD A;  2CQP A;  2R7Q A;  1P8G A;  4LF5 J;  1NME B;  4P73 A;  4PAB A;  3WZ0 A;  3UDC A;  2FJE B;  1RGV A;  1LK5 A;  3MAQ A;  4NCB A;  1FHT A;  1YWX A;  3I5C A;  3KJF B;  2QRR A;  2GAG C;  3TI0 A;  4P7V A;  3BGO P;  2OEM A;  3IWN C;  2RQ4 A;  2N82 B;  3MMB A;  2W7P A;  4TU7 A;  5A8W A;  3KNG A;  1URR A;  3A3N B;  4O23 A;  4PWD A;  2W2O P;  1KLM A;  1QAY A;  3ZZP A;  4CO1 A;  2HAF A;  2QFI A;  4C2M A;  3GIK A;  4YS2 A;  2E1C A;  4OX8 A;  1PBA A;  2F8H A;  3CDA A;  3MM7 B;  5CZV A;  3IWL A;  3IS9 B;  1EKS A;  4LVN P;  3RRG A;  2L9W A;  3I0R A;  1RWU A;  4DL6 A;  2J0Q D;  3H25 A;  4PXB A;  4U6P A;  3T5J A;  2P5V A;  1F9F A;  1JQG A;  3NKY A;  5KT4 A;  2RUS A;  4JBC A;  2CZ9 A;  4B08 A;  3K59 A;  4KE5 A;  1E6Y A;  2JEJ A;  2BJ1 A;  1RHU B;  5KFL A;  1TK5 A;  2V5H G;  5L8R C;  1SL1 A;  4H4K A;  3RUB L;  3M6W A;  1YSJ A;  3A1Y G;  2LEA A;  5KFX A;  3BZQ A;  3HX9 A;  1ZM4 A;  1S59 A;  3SYZ A;  4OHW A;  3T1H F;  5LM7 E;  1T05 B;  4C8L A;  2GVD B;  3AD8 C;  2MDA A;  3TOQ A;  4DPO A;  2JH3 A;  2LMI A;  5DDP C;  2HFN A;  2EFG A;  5LL6 d;  3Q8S B;  1YJN S;  3M9O B;  4DUY J;  5F0W A;  2MKH A;  4EZ6 A;  3LA0 A;  3LP1 B;  6FD1 A;  3CO0 P;  2V8D A;  3GJR B;  2H4W B;  2ZJP Q;  3PHE A;  1SQG A;  2Q66 A;  1UVN A;  1YZ6 A;  3AH6 A;  4OV1 A;  2I5J B;  2Z2Z A;  3DLE B;  1FD8 A;  4LF9 F;  4KO0 B;  1I3O B;  1UPM B;  2VL1 A;  1RAH B;  1JXL A;  1JNR B;  3MR7 A;  4WKY A;  3NWG A;  2HAI A;  4I69 A;  2VQE J;  1OPI A;  4HAC A;  4IQM A;  4UQT A;  2DHG A;  1FFG B;  1TL3 B;  1X5P A;  1HI8 A;  3LH2 S;  3KLF A;  3OR1 B;  4J9O A;  3CTR A;  2O66 A;  2DNY A;  2XM3 A;  2UXC F;  1SUQ B;  3QO9 A;  4OYW A;  2QSW A;  3L7P A;  2EBG A;  5HBM A;  3DMJ B;  2OFG X;  3OR2 A;  4RW4 A;  1F2G A;  1FDN A;  2D3U A;  2Z30 B;  2XCA A;  1FX2 A;  2AJ2 A;  1VIX A;  1HBU B;  5L9X A;  4OI0 A;  2DR9 A;  3H42 A;  2ZD1 B;  3N6M A;  4D3G A;  3CJT A;  2R7U A;  4LF9 J;  1N88 A;  4DR6 F;  1LWC B;  3PM9 A;  4FS1 A;  3LAK A;  4KB7 A;  1SH2 A;  1VBY A;  1RT4 A;  2MGZ A;  4QWD A;  2XGQ A;  2AU0 A;  5AXL A;  5IC4 B;  3P4U B;  2HLT A;  1I1G A;  2BE2 A;  1JK9 B;  1D9F A;  1D1U A;  4ICL A;  2DR6 A;  1FKP A;  3PX6 A;  4DFM A;  2ASJ A;  2CA9 A;  1JLA B;  4X4U A;  3GLJ A;  2KH9 A;  2MZJ A;  2UVV A;  5IV4 A;  3JQK A;  1YJT A;  2DO4 A;  3AD9 C;  1E6V B;  3O8W A;  4JI1 J;  4FP9 A;  3DRX A;  3J7A N;  2UU9 F;  2XLK A;  1QE1 B;  5FLX Y;  2HQD A;  1V6H A;  5HQL A;  5E3P A;  4LF8 F;  5J1P A;  2FVP A;  3I56 S;  4R5P A;  4XDC A;  2XSJ B;  4Y2C A;  2HHH F;  2GIF A;  2CQH A;  1VQ7 S;  2MKI A;  1WOR A;  3P8B B;  2DEI A;  1NSQ A;  3HM9 A;  2GIQ A;  4FN5 A;  2EFV A;  3D0G E;  2MMY A;  2Z57 B;  2IA0 A;  3WHI A;  3D68 A;  2DNP A;  1B70 B;  2QL7 B;  3KXD A;  4NEZ A;  3EZO A;  1YZ7 A;  5G0R A;  2W2M P;  2YQ0 A;  3F41 A;  3FKB A;  4K4W A;  2YNG B;  3Q23 A;  4F3O A;  4FF2 A;  1F5A A;  4C8N A;  2B8P A;  4K5R A;  4IDK B;  1H2U X;  1ZBT A;  5J1N A;  5F8M A;  4ZCL A;  2RU3 A;  4IRK A;  1TKZ A;  2ZZT A;  3NS5 A;  1LFP A;  1OIA A;  1RT1 B;  4KQZ A;  2DIT A;  3C6T B;  3K57 A;  4LIR A;  2UU9 J;  4F67 A;  3C46 A;  1VFJ A;  4H4O B;  1Q1K A;  2QE5 A;  4X84 A;  1SXL A;  2JEF A;  2V34 A;  3GCW P;  4DBQ A;  2K3K A;  2HHH J;  2L9N A;  5HP1 B;  4I6A A;  1SC1 B;  4UY8 5;  1L3U A;  1QAX A;  1UPP A;  2N4C A;  2D7S A;  2DGU A;  4NZ7 A;  3OFF A;  4ZP8 A;  3HJF A;  3RAX A;  5BYQ A;  3NS7 B;  4IFV A;  1TKX B;  2V0N A;  1SIW B;  1C0T B;  4NLV A;  2VON A;  1KTQ A;  1MMD A;  3G82 A;  2K3I A;  5RUB A;  3R1H A;  4ZHR B;  3QRR A;  4BS2 A;  3DRS A;  2XB2 D;  3WX8 A;  5DJB A;  1G3O A;  4S0M A;  4PXD A;  2G4B A;  4CLW A;  1FWK A;  2CJ9 A;  1LW0 A;  1ACM B;  2PGC A;  5ETR A;  4G1Q B;  1UTA A;  5JVH Q;  5ADZ A;  1WF2 A;  2XZW A;  3HF5 A;  2CAJ A;  1HBN A;  4P2X A;  2RAQ A;  4TN2 A;  2XI3 A;  4J9L A;  1KVI A;  3TJ8 A;  1XR5 A;  3W9I A;  1X5T A;  4KJI A;  1U48 A;  4WE1 B;  3VAK A;  1ZA1 B;  4DU8 A;  4XK8 C;  3VAG A;  3GSD A;  2A0F B;  4ZVU B;  4RNO A;  1FJG F;  4HTJ A;  3OTC A;  3R5C A;  2Y1R I;  4HL9 A;  3JQM A;  2VBY A;  1ITP A;  4USK A;  2CWX A;  5F8G A;  1HHT P;  1U1K A;  3OLA A;  5DGB A;  2ZHA A;  4C11 A;  1KHV A;  3PHT A;  3ENV A;  2HPU A;  2WVC A;  3HVA A;  4LRF A;  1EAY C;  1C0U B;  1N54 B;  5I4M A;  3MMA A;  4K4X A;  2KZZ A;  1XWL A;  3HHL C;  2EFN A;  2NUH A;  1HQE A;  4ZPD A;  2MZS A;  3TYT A;  4X4P A;  3ITH B;  2YNH B;  5E0O A;  2VD3 A;  5HI7 A;  2R7S A;  2AEJ A;  4FYX B;  1EET B;  2IRU A;  1HQU B;  4P52 A;  5I3U B;  4WIQ A;  1CJV A;  1YIT S;  1F0X A;  4PKD B;  1YJ9 S;  4NZ6 A;  1RHJ B;  2MHE A;  3Q8Y A;  2IFX A;  4RNM A;  1IKV B;  2JC1 A;  4NLW A;  5DG9 A;  1FJG J;  3KMQ A;  5L1J A;  2EI5 A;  1WG4 A;  2LQJ A;  1VRT A;  3M8P A;  3MM5 A;  4CM2 A;  1FDB A;  3BF4 A;  4ETX A;  5B0F A;  1RAE B;  4ZVR B;  3D1H A;  3EUN A;  3DRY A;  1HWJ A;  3CXC R;  1YRU A;  3S01 A;  4QWE A;  4QWB A;  5SUH A;  3HHK A;  5IS2 A;  4Y0F A;  4NAS A;  4WTO B;  4GO5 X;  1F2H A;  3TJA A;  1B64 A;  2CPY A;  2EKY A;  1CC7 A;  1WF1 A;  2PC6 A;  4BC7 A;  1XN9 A;  4MIB A;  4F04 B;  5A8R A;  1H98 A;  2IDL A;  4K7Q A;  3K89 A;  1SH0 A;  4QW9 A;  4DV0 J;  3SV4 A;  1NEE A;  3C14 A;  4USI A;  2BQR A;  1UEK A;  1RAJ A;  3J81 Y;  4F2R A;  3J81 j;  5DG8 A;  2G0J A;  4L72 B;  4MKB A;  2V6A A;  3OPK A;  4QIV A;  4W4M A;  1XIQ A;  3MAH A;  3CB4 A;  1R0B G;  4LUB A;  2FJV A;  2CDR B;  2BYC A;  2Y1I A;  4PWW A;  1RYR A;  4K50 A;  2GIR A;  3G6X A;  2UP1 A;  5KFA A;  2FLL A;  1XEZ A;  2L08 A;  4K4S A;  3GIR A;  3PXG a;  4OYM A;  3TA2 A;  3ZTO A;  3C15 A;  3NGR A;  2LVW A;  2CQD A;  3UCG A;  3LUY A;  2ZBP A;  3ZFV A;  2FZK B;  3MI7 X;  4O3S A;  4URS A;  1T9T A;  2EC2 A;  1VGY A;  1DQA A;  1QVF R;  1RP5 A;  5JUM A;  4CTA A;  4FYV B;  3TJ9 A;  4U9R A;  3JQJ A;  3M9N B;  3THV A;  1XMQ F;  3AB4 B;  3GR1 A;  1VLY A;  2V9K A;  3EGV A;  1IBK F;  1MG7 A;  3JSY A;  5IT9 Y;  3LGH A;  2VOD A;  2WVE A;  4CQ1 A;  4CLF A;  4DU7 A;  5H1S V;  4OLP A;  3MMC B;  3PIP Q;  4PG6 A;  3A4T A;  3W2W B;  2GC8 A;  1TV6 B;  2CQ4 A;  2KYZ A;  1YHQ S;  4TXS A;  2CNL B;  4EBE A;  5C24 B;  5I42 B;  4KH1 B;  2PN6 A;  3ZZR A;  1V9O A;  2OIH A;  3OSP A;  2V68 A;  3TAQ A;  2FQQ B;  2J9C A;  2MLZ A;  1RK8 A;  4OZ0 A;  4GKJ J;  3FRZ A;  3RAQ A;  3D0H E;  3VGV A;  2X51 A;  4P74 A;  3NGD A;  2J5A A;  1FA0 A;  3MCN A;  1RWO B;  4DFJ A;  2YKN A;  3HCX A;  2AV5 A;  4CLT A;  3ZZT A;  1WTB A;  3DLG A;  3TP2 A;  3QQC D;  3KK2 B;  4DR4 J;  1ULR A;  4C0B A;  4DLG A;  5KG6 A;  2HQG A;  4IO1 A;  1WC3 A;  5HQM A;  1XMQ J;  5LMN J;  3VAF A;  4KBI A;  3OD2 A;  4ZVP B;  3K8V A;  2CPE A;  4MT1 A;  2XNQ A;  4GKK F;  1SV5 A;  2FVS A;  3UVJ A;  1NK6 A;  2XQC A;  3RG6 A;  2ASD A;  1NDK A;  3W5Z A;  3LGM A;  2MQ8 A;  1Q5V A;  2F1F A;  2PSZ A;  4UF4 A;  1PGZ A;  3QRQ A;  1NK0 A;  5KFH A;  3Q86 A;  4NLU A;  2D1C A;  3WC0 A;  2DB1 A;  1JB0 C;  2G13 A;  4ES3 A;  1S1X A;  4WU2 A;  2QJ3 A;  3MR5 A;  1URN A;  1HBM A;  5HN0 A;  3CCS S;  2CKW A;  2NYH A;  1EJ7 L;  4CO0 A;  2BE7 D;  4DXL A;  2WB1 D;  1J5E F;  5L1L A;  4DOZ A;  3K5P A;  1HNV A;  1ZOT A;  5AXK A;  3TUP A;  2B4P A;  2W24 A;  3KK3 A;  2IC3 A;  1M1K T;  2M2B A;  3PR5 B;  4DWI A;  3M8Q A;  1Y0H A;  4K4Z A;  4MIA A;  4JI7 F;  3CC7 S;  4GKK J;  4O3N A;  4WP8 A;  3K5L A;  2C2M B;  3DNC A;  1FF2 A;  1WSV A;  4PAA A;  3CCR S;  3MMB B;  3UN3 A;  1Z2Z A;  5A8W B;  4PWD B;  2N3L A;  2PE8 A;  1S9E A;  1KLM B;  3KK1 A;  1JJC B;  4M5N A;  1FNM A;  3V5R A;  2CQ0 A;  3I31 A;  2AGO A;  1VLO A;  2KO1 A;  3NMA A;  2MY8 A;  2BQ3 A;  4PCQ A;  2WTF A;  3G86 A;  1IR2 A;  2BKP A;  1VC6 A;  3GFX A;  3M7V A;  1J5E J;  4FXD A;  4OZ1 A;  4ES2 A;  2LA6 A;  1Q82 T;  1RLC L;  3I0R B;  1S4E A;  1P1L A;  4F3Q A;  4YOE A;  4Q45 A;  1VQO S;  3QNW B;  3N6N A;  4OQJ A;  2VH7 A;  1HW8 A;  3G96 A;  1JLB A;  1AT1 B;  3ZZU A;  1E6Y B;  2CQC A;  1Q4R A;  3MM6 A;  1NLK L;  3DOL A;  4KV8 A;  4XAK A;  1HNZ J;  3RAM A;  3HXM A;  2CJA A;  3TZW A;  1SB6 A;  1T95 A;  2N4D A;  1VI7 A;  2GJF A;  3P96 A;  1S9G A;  2FZG B;  5HAT A;  1SJR A;  3HJV A;  3HHL A;  3FQL A;  3BQ0 A;  2R8K A;  3HI9 A;  5C2C A;  3BKT A;  4WFB Q;  4FF4 A;  2FVQ A;  3D9B A;  4ZMM A;  4ELT A;  4OHY A;  5B08 A;  1NKE A;  2SXL A;  1NJZ A;  4MYU A;  2IPO B;  2F8M A;  3K7R A;  2OPP A;  4ZLP A;  3M8S A;  5DG7 A;  4CO4 A;  1N6Q A;  2AZ3 A;  4JI5 F;  3K5M A;  2J0W A;  3SEO A;  5IWA F;  4J9N A;  2WVF A;  2OGU A;  3LTO A;  2BEF A;  3POT A;  2R8J A;  4RO0 A;  2C3P A;  3LPE A;  4HAC B;  1WHV A;  2Y0B B;  4QYR A;  1AZS A;  4OYX A;  1GTE A;  3I0S A;  1S10 A;  2CPI A;  3RRK A;  3HVW A;  3L7O A;  4RW8 A;  3BO3 A;  1KR4 A;  1NK7 A;  3KLF B;  2AD9 A;  5HQ8 A;  3OXG A;  3AOB A;  1TAQ A;  3D5M A;  5D4P A;  1UJ6 A;  1FXR A;  3QO9 B;  2VPW B;  4HDG A;  4KFB A;  3VVU A;  3HDS A;  4ED0 A;  5HBM B;  1EX8 A;  3OR2 B;  4RW4 B;  4YQW A;  1UVK A;  1NXI A;  3R3T A;  2R9L A;  3GCX P;  2PI5 A;  4TNO A;  3MUR P;  1PO6 A;  4ECT A;  5F8N A;  1U49 A;  2HZA A;  3ZNU A;  3R5D A;  2YWW A;  3SFU A;  3X3U A;  5HVG A;  3MWB A;  3DRP A;  1G6B A;  2DXE A;  2A6M A;  1X9W A;  3UW1 A;  1EP4 A;  4NRT A;  2MXY A;  1WKL A;  2K2P A;  5AXM A;  5KFS A;  2AYB A;  1CSJ A;  2XMM A;  1WUU A;  3FCW A;  4DL5 A;  3KFW X;  8RUC A;  2YNI A;  1RT4 B;  2MGZ B;  1JJH A;  1HWU A;  1U2F A;  1DBD A;  3FNN A;  2YWK A;  1XQI A;  2KJV A;  2AJ4 A;  2BE2 B;  1LOU A;  1ZA2 B;  1XR6 A;  4JI3 F;  1SC4 B;  4ICL B;  1V5V A;  4LF2 A;  4ZKA A;  3FSX A;  1RT5 A;  3BGR A;  1FKP B;  2ABY A;  1RE1 B;  3AOD A;  2E5I A;  3H98 A;  2DEJ A;  3D1O A;  2YTC A;  1JLE A;  1RAB B;  1V3R A;  3D2W A;  2WHO A;  1TFY A;  4KT0 C;  2MZT A;  2XUL A;  1W2B R;  2XZT B;  1GAO A;  4CIO A;  2BBE A;  2CQ3 A;  1TMJ A;  2I6W A;  3T9N A;  3MHY A;  2E44 A;  4OHZ A;  1DTT A;  4NLP A;  1KS2 A;  3JSM A;  3CCZ A;  1QLN A;  2EW9 A;  4YP3 A;  3AAW B;  4R5P B;  4KPY A;  4B3R J;  2E5H A;  2QV6 A;  1BD6 A;  3ILJ A;  2RQK A;  3NS6 A;  4RW6 A;  4OX6 A;  2HFS A;  3CC2 S;  5KG7 A;  1MML A;  3ZTQ A;  2GML A;  3T19 A;  2ZM6 J;  2C3O A;  3MR2 A;  2MHN A;  2E1R A;  1FRK A;  2I9S A;  1VBK A;  3K58 A;  4JV1 A;  2NXU A;  2CAD A;  2ZH6 A;  1WHY A;  1U8S A;  2ZUA A;  5D78 A;  4HYK A;  2HGL A;  3Q22 A;  3QJJ A;  4JI3 J;  5G0R B;  2P9E A;  2GGP A;  5AJ3 F;  3H5Y A;  2J76 E;  3KDN A;  2ZNZ A;  2PI4 A;  1QDU B;  1U45 A;  2RML A;  5F8H A;  4ZVO B;  3OT9 A;  5F41 A;  2JFD A;  4C97 A;  1TKZ B;  1L3V A;  2HLU A;  2DPJ A;  2XEX A;  4ILL A;  3TAM A;  4I68 A;  3UDV A;  2YWG A;  3GWC A;  4M5D A;  4DLE A;  5AXN A;  5ETM A;  3DOK A;  1TUG B;  1WHW A;  2ZH5 A;  3SCJ E;  1GNK A;  2M0G B;  4IUF A;  3GYN A;  1APS A;  2E7X A;  1XR7 A;  2R7T A;  5MAO A;  5CCM A;  3IAS 9;  2BXJ A;  2OAU A;  1B7Y B;  5I3Q A;  4M5L A;  2V63 A;  2NXJ A;  2E7V A;  3IFE A;  2L9D A;  3OTB A;  3I4H X;  1T9U A;  2BM0 A;  4LQ3 A;  1NJY A;  3BN7 A;  1ICE B;  4U8V A;  4IFV B;  1RU1 A;  2J7U A;  1FJ7 A;  4C0H A;  4A46 A;  3CJ5 A;  2J8S A;  2WZ1 A;  3RW7 A;  3DDI A;  2IRX A;  3G82 B;  5AJ3 J;  1KKH A;  1SQE A;  2K06 A;  1SVD A;  5CD4 H;  5H9E K;  3DRS B;  3BKU A;  4U7C A;  3BS9 A;  1W26 A;  4NYP A;  2E5J A;  5A8K A;  5HAO A;  3GIM A;  2EVZ A;  3IGN A;  1KQK A;  4ZCM A;  3M32 A;  1TMM A;  1LW0 B;  4ECV A;  1WC6 A;  3QJL A;  4M5M A;  2VDH A;  1U7L A;  3P45 B;  3IA0 A;  4AQY F;  4JI6 F;  1UW4 A;  1LWE A;  1HBN B;  5GAD I;  3RB0 A;  1F5B A;  1V5I B;  4Y65 A;  2OI2 A;  3J80 Y;  4XTT A;  1FJE B;  4RX6 A;  3CJ4 A;  4F0K A;  1KSP A;  3T6B A;  5HL7 Q;  3QAU A;  1WKK A;  2MKY A;  1TQL A;  3GB0 A;  4MKV A;  2N7Y A;  2ZIT A;  1OYD A;  2W2Q P;  3FEX B;  4OJ1 A;  4C11 B;  4N8N A;  4I6Y A;  1NPP A;  4O4G A;  2PMZ D;  3FRY A;  2QMU B;  2GO9 A;  5D0E A;  3PX0 A;  1UET A;  4KH0 B;  2J7W A;  1SJ3 P;  3IO1 A;  3MMA B;  2L41 A;  1U25 A;  2BJ9 A;  4PQA A;  1VJQ A;  2EG1 A;  2QN6 B;  1HQE B;  5KFJ A;  4CO5 A;  1NJW A;  4RBT A;  3R9L A;  1BC6 A;  2R2S A;  2LXF A;  5KFW A;  4FYD A;  4LF1 A;  2U1A A;  2XI2 A;  1JXE A;  3R7N B;  2OP5 A;  5H9F K;  1CJV B;  1SC6 A;  2IHR 1;  3FC9 A;  5B0G A;  1UEU A;  1H72 C;  2KRB A;  2IMW P;  4KGV B;  1RDR A;  4WFX A;  5DLG A;  4TYA A;  1S0V A;  2JFK A;  2EFO A;  4G1P A;  4L3N A;  1EIY B;  2K7J A;  3M8P B;  1VRT B;  3MM5 B;  2C2D A;  5LSL A;  1UMJ A;  1NRK A;  2HVI A;  1PBU A;  2P9G A;  3AXK A;  4N47 A;  1X4G A;  1WOP A;  2QL5 B;  1MW7 A;  2QC3 A;  1TZ0 A;  2V50 A;  3VAM A;  1LWF A;  2Y1L B;  4YEA A;  1SKW A;  3IMQ J;  5J2P A;  1N4L A;  2XY6 A;  1VQK S;  1GEH A;  2V2Z A;  5HLF A;  2C2N A;  5A8R B;  2DNM A;  4W92 B;  1X0P A;  4O0I A;  2UUB F;  5LT5 A;  4FNI A;  4UUW A;  3DFE A;  1S1T A;  3R2C J;  4RKU C;  3C14 B;  3R5J B;  3RB3 A;  2KXH A;  3R5A A;  2HW3 A;  3DCA A;  3DDN A;  2HQ3 A;  4C8O A;  4USM A;  4F4W A;  1FCA A;  2ZH8 A;  1JX4 A;  1ZTW A;  1Y7P A;  4N7T A;  2MQQ A;  4ED8 A;  3KLG A;  1CQN A;  4OX9 F;  3C16 A;  3W63 A;  1KVK A;  2HVZ A;  1WHX A;  4X64 F;  4JV2 A;  3NLC A;  4W98 A;  1S6O A;  4MTP A;  1T02 A;  3D6T B;  4OYA A;  2B0G A;  3QIP A;  4NLO A;  4LT6 A;  2E29 A;  2UXB F;  2JVO A;  3OL7 A;  3C15 B;  3OVB A;  2A1B A;  4LFB F;  2PD1 A;  4DV1 F;  4R25 A;  4ZIW A;  2D69 A;  2WSE C;  2MZ1 A;  1OJ4 A;  4Y3C A;  4LJM A;  1Y00 A;  5KFK A;  2D74 B;  2OEJ A;  5C2G A;  1CBK A;  2HQC A;  2ZZM A;  1FRL A;  4CTA B;  3BO2 A;  1FFW B;  4LFC F;  4DV7 F;  1KQF B;  4M94 A;  5KOX A;  5ETQ A;  5FJ4 A;  3BRE A;  4A8M P;  2HK2 A;  5FLX U;  2ZH9 A;  1X7V A;  4WII A;  3QGG A;  4OX9 J;  3KKF A;  1UZD A;  4X64 J;  1GXU A;  3RR7 A;  2GCF A;  5H9E J;  3M05 A;  4TQR A;  3P5T L;  5IM0 A;  2B5J A;  4YDX A;  4Q5V A;  1FKO A;  3OTO J;  3I5A A;  2ILZ A;  2DXD A;  2UXB J;  1WNE A;  2RE1 A;  4KRW A;  2BUN A;  3EM1 A;  2OUG A;  3H5S A;  7AT1 B;  3P3D A;  4LFB J;  4KR0 B;  1N5S A;  4DV1 J;  1XNQ F;  1XMO F;  3ISZ A;  1KP6 A;  4DL3 A;  3RBZ A;  2BR0 A;  4OHV A;  4PPD A;  2OPR A;  2G0I A;  4KSE B;  2AMC B;  4ZIV A;  2YKN B;  4DR1 F;  3LO3 A;  4QZV B;  3DLG B;  4DN0 A;  1Q8L A;  3NCR A;  3ELH A;  2C2E A;  1S9F A;  4TLQ A;  2RRB A;  2LYV A;  1WEY A;  2OSQ A;  2MKS A;  2H65 B;  2BJE A;  1PYO B;  1SV5 B;  3UVJ B;  1HI1 A;  2I8E A;  4ZVT B;  4Y6I A;  2QYC A;  2FJB B;  4YY3 J;  2ZH4 A;  4EUV A;  3W5X A;  1EKR A;  1VS3 A;  5IC6 B;  3TUJ C;  3JSR A;  4DQI A;  2ROG A;  1R31 A;  1Z2L A;  4HH1 A;  3M6X A;  3ONQ A;  1U1R A;  1N32 F;  2E9T A;  4DPW A;  3AOC A;  2P8I A;  5D4L A;  2J9E A;  4Y34 A;  1S1X B;  4PXE A;  1HBM B;  2MLY A;  4TLR A;  1HBO A;  1RXO B;  2GHV C;  1XMO J;  3T5K A;  2Y9H A;  2CWK A;  2PA3 A;  2A3J A;  2LDY A;  4B3M J;  4L76 A;  4DQR A;  3SSS A;  1HNV B;  2HFU A;  3V4M A;  2F4V F;  9RUB A;  3KK3 B;  2IC3 B;  1FWL A;  2NSB A;  4ECQ A;  1UVM A;  2HNZ A;  3O2I A;  5FII A;  2AEF A;  3M8Q B;  1UKU A;  3N4W A;  4FDF A;  1L3S A;  2HBY B;  2KN4 A;  5D0H A;  1S77 D;  2GQ2 A;  2W7A A;  4FVC A;  1RHR B;  1IBM F;  1FXL A;  2QTW A;  4Z7Y A;  3KYL A;  4HH0 A;  4ZN1 A;  4M5G A;  2F3J A;  1TL5 A;  1U1O A;  4BC9 A;  4ZIT A;  3QFH A;  3SXL A;  1YQH A;  5IT0 A;  3N01 A;  3SMZ A;  5CQG A;  2C3Y A;  1HFE L;  1N32 J;  1S0O A;  3IR7 B;  1AB8 A;  1S9E B;  3KK1 B;  3L3C A;  5GAH I;  1WD6 A;  3ET6 A;  2KXN B;  2QSF A;  2BW7 A;  2VV5 A;  4AD6 A;  1M5V C;  1NND A;  2MSS A;  2YX4 A;  1BWE A;  4AFF A;  2YPY A;  2F9J A;  3BBB A;  3BPS P;  2F4V J;  4QWA A;  3LP0 A;  3AJD A;  3KMS A;  2KM8 C;  4Z37 A;  1Y4Z B;  3UN2 A;  3EZ5 A;  3NRB A;  1JLG A;  2VJV A;  4LSN A;  3AD7 C;  1C1C A;  1JLB B;  2AF6 A;  5LJ3 Y;  1WOO A;  3MM6 B;  3R5G A;  1RKI A;  3DOL B;  4KV8 B;  4PR6 A;  1CS4 A;  2ADC A;  4ELV A;  4CLU A;  5HRO A;  2GW8 A;  1P9Q C;  2DY9 A;  4WFN Q;  4X62 F;  1WI6 A;  2X1A A;  3CED A;  1S9G B;  3EXY A;  2ZNY A;  3CW2 C;  3HHL B;  5KFY A;  3T3F A;  3W64 A;  2J9D A;  2YWF A;  2QA4 G;  1UJ4 A;  4ERD A;  3D6F B;  3UR3 C;  3KLE A;  4DSF A;  3UCU P;  5EDW A;  2HVH A;  4JYA F;  4A48 A;  2MJU A;  4XPE A;  1S6U A;  1NK5 A;  1NUE A;  4CLZ A;  4FF3 A;  4PG5 A;  4J9Q A;  4AXJ A;  1SQF A;  4KPC A;  2OPP B;  3WIV A;  4NA3 A;  3AFG A;  2BOA A;  5KFI A;  3WDO A;  4KC5 A;  2YKM A;  2B7B B;  2QZ8 A;  2YKP A;  4WZQ A;  1N6Q B;  5GAD U;  1QTM A;  1RCO B;  2B56 A;  2ZOF A;  1DAX A;  3AJ2 A;  1S72 S;  3J81 U;  3POT B;  3BV8 A;  2DIV A;  4L73 A;  3UO0 A;  4KHP J;  4CH0 S;  4YHH F;  4X62 J;  2GJ2 A;  4JUZ A;  1AZS B;  3FZ2 A;  3I0S B;  1F5C A;  1S99 A;  4OZ3 A;  4CCH A;  2V4R A;  1YK9 A;  2G1D A;  4RW8 B;  3DC2 A;  5ETK A;  2OPS A;  3S7R A;  3H8Y A;  5GMD A;  4KFB B;  3KLV A;  3ZZZ A;  1IBC B;  4X66 J;  2NZC A;  4JYA J;  3TZZ A;  1VQS A;  4U95 A;  3EDR B;  5HSP A;  3OV7 A;  3MPW A;  3AXM A;  4NXM F;  1D09 B;  1Y5N B;  3DRP B;  4WFA Q;  2MB0 B;  1EP4 B;  2OMO A;  4FYW B;  4OX7 A;  4MKA A;  1RQ0 A;  3BBF A;  3IM9 A;  1MLA A;  2YNI B;  2BZ2 A;  1N34 F;  3SCK E;  3D3B J;  5GME A;  2LEC A;  4F26 A;  3CPW R;  4EZ9 A;  1R7I A;  5IT9 U;  3QT6 A;  2W2P P;  2YKA A;  4YHH J;  4DFK A;  1JJ2 R;  1HNW J;  3AA8 A;  3P6Y C;  8AT1 B;  2NXN A;  1TL1 A;  1IBL J;  5K14 A;  1RT5 B;  3BGR B;  2G0C A;  4ZPA A;  3T5L A;  1R8H A;  5KG2 A;  2J8A A;  4TY9 A;  4NXN F;  3MR3 A;  1JLE B;  4JI8 F;  4RNF A;  1GFW B;  3HPO A;  4H4K C;  3Q24 A;  4B3S F;  2O1P A;  3NOC A;  2RNE A;  1DTT B;  2VDI A;  4NOH A;  1ZZF A;  2DKO B;  3NGT A;  3M30 A;  5HAN A;  3JSM B;  1VHI A;  4QQB A;  4Q8E A;  3PX4 A;  3G6E S;  1HKA A;  2FIU A;  2F65 A;  4DUT A;  4WK3 A;  4DQS A;  1KWM A;  3FBB A;  1TL7 A;  2CRL A;  4GVL A;  2H4Y B;  4V1A k;  5J1E A;  3CUL A;  2RKI A;  4FPR A;  2HIY A;  4Z7C A;  4RW6 B;  2WOM A;  4TU8 A;  3E2E A;  1UL3 A;  2WSF C;  4USU A;  3CJ3 A;  3HUL A;  4I67 A;  4DS4 A;  3CCW A;  2JEI A;  3K8W A;  1WAC A;  4QW8 A;  4C7Q A;  1N34 J;  1J27 A;  4C3M A;  4B9M A;  3ZTP A;  2CDQ A;  1UFW A;  1ZM9 A;  2GGP B;  4F36 A;  3TR5 A;  1Q7L B;  1VQY A;  3QZ8 A;  3MUV P;  4NXN J;  3M2U A;  4JI8 J;  4IRC A;  5GAG I;  2XMT A;  4LMZ A;  2VG6 A;  3TAM B;  4P2F A;  2CJK A;  1HQ2 A;  4M5D B;  5J2Q B;  3DOK B;  2R7R A;  4AND A;  3NAH A;  3MOZ A;  4C8Y A;  4FZV A;  2FHK A;  3PYG A;  3W3S A;  1M5H A;  2V8G A;  1QJH A;  3H59 A;  2DH9 A;  5DRK A;  2QLW A;  3F44 A;  3GQC A;  1GXT A;  4J5O A;  3BJY A;  2HMI A;  4UY8 T;  3WIU A;  5F3T A;  5DLF A;  3A3O B;  2ZH3 A;  5DQH A;  1RT7 A;  2FVC A;  1PJ7 A;  2E7W A;  1SL2 A;  3IWX A;  2MYF A;  4Q2L A;  5KFD A;  1H74 A;  1SJF A;  4OI6 A;  1NDL A;  4TU9 A;  5K5M A;  3Q2T C;  3PRB A;  2JLG A;  5A8K B;  1KRP A;  3BR9 A;  2ASL A;  4YB1 P;  3M32 B;  2CNN B;  3MED A;  5KFT A;  4M5J A;  5HVH A;  1UWA A;  1ZPW X;  2WB4 A;  2AJ1 A;  3G6V A;  2Y8Y A;  1LWE B;  2J6U A;  1R8C A;  2W9A A;  1NPK A;  4Q43 A;  2MQO A;  2XC9 A;  3CT9 A;  5L38 A;  3MM8 A;  3FJ2 A;  3ILI A;  4NLG A;  1V3S A;  2CYY A;  3I6P A;  1I94 F;  4DV3 J;  1X4H A;  3FFI A;  4DSK A;  1IKW A;  4DF8 A;  1T7P A;  3J7A 1;  3VCD A;  2ADB A;  4QIE A;  5KT7 A;  3DU6 A;  5B0B A;  1YRT A;  3EVW A;  1WF0 A;  4Z2X A;  1IJF B;  3CCM S;  4O4G B;  1NHU A;  1LW2 A;  2HS0 A;  2PFF B;  2JRS A;  5DM7 Q;  3QSY B;  1U4B A;  4MAK A;  2KU7 A;  2LKZ A;  1HWK A;  2HNY A;  1YX2 A;  3QGP A;  2ASY A;  2FGC A;  4EK2 A;  4IYQ A;  2A10 A;  4DV5 F;  1EQM A;  3WC2 A;  2D3Z A;  3SSR A;  3D66 A;  2KG1 A;  4H4M A;  3BB5 A;  4WFZ A;  2DD8 S;  4ZK7 M;  2E5L J;  4J9U E;  4WXO A;  3CJ8 A;  3CVK A;  3GSI A;  2WW4 A;  3UDL A;  2H54 B;  4YUD A;  2B4U A;  5HMY A;  5DDO C;  3IC1 A;  1M1G A;  5DET A;  3C6U A;  1Q78 A;  3DLJ A;  1I94 J;  4RR5 A;  2LQ8 A;  3UPF A;  1TFW A;  2W9C A;  2BKO A;  4P71 A;  1U6F A;  4W90 B;  1IWA A;  3F56 A;  3SSQ A;  1G4C A;  2KT3 A;  1S1W A;  2Q1L A;  3HSD A;  3BDE A;  5CAA A;  1H3D A;  4DSL A;  1KOO A;  3KLH A;  2ZOG A;  3U1L A;  2F4F A;  5C42 A;  4IQX A;  1LWF B;  3DRR A;  3W66 A;  4RUC A;  2LA4 A;  2IBK A;  5J2P B;  2V9W A;  3PG9 A;  1IR1 A;  5HLF B;  1ZAV A;  4R0E A;  4DV5 J;  4MK8 A;  4B9N A;  5D4N A;  3RBE A;  1S1T B;  7FD1 A;  4ELU A;  1IQT A;  2EC0 A;  2N7C A;  4ZLL A;  5D0G A;  4DG1 A;  4DL0 C;  1VQ9 S;  1U09 A;  3FUY A;  1W7W A;  3GYG A;  2IAJ A;  1QM9 A;  1AW0 A;  3KLG B;  1KON A;  3C16 B;  2B7C B;  2MQP A;  1FES A;  5A6P A;  4FBU A;  4DR3 J;  4OV6 A;  3M2V A;  5EUH A;  2VG5 A;  1P27 B;  4RNN A;  2CQ1 A;  2XMA A;  2XLJ A;  2IMO A;  1H38 A;  3T1Y F;  2CJB A;  4B9S A;  3QIP B;  5G4D A;  4NCG A;  4QR2 A;  4YB5 A;  5EHH A;  1HNX F;  2W4D A;  3IBC B;  4IH7 A;  4FYY B;  4WPA A;  2VB6 A;  1NO8 A;  4ED7 A;  3HVT A;  4OZ2 A;  1IM6 A;  3CDB A;  4USJ C;  4QYZ J;  1ZAW A;  3K17 A;  5HK4 A;  1VQP S;  4HTI A;  3NOG A;  3A3P B;  3UN5 A;  4GC7 A;  1U02 A;  1BGX T;  4G1I A;  2FJA B;  1KLN A;  2KFZ A;  3DU5 A;  3QWP A;  3R8Y A;  4DCJ B;  3F73 A;  2HWH A;  2GNK A;  4DDF A;  4DR7 F;  5CYM A;  2IJR A;  2Q79 A;  4HDH A;  2YPZ A;  5T41 A;  1GTH A;  5IM0 B;  4NRU A;  7FDR A;  3KHH A;  3E51 A;  2B5J B;  3OTD A;  2LEP A;  3T1Y J;  2QO3 A;  3DKD A;  1GX6 A;  1HIY A;  1FKO B;  3KHL A;  1VIS A;  3CCV S;  4TKT A;  3SIP B;  1T9V A;  3KG4 A;  1RLD A;  1VCT A;  3C19 A;  1RA7 A;  1HNX J;  1QAJ A;  1PSD A;  3LW5 C;  2DGX A;  1S6P A;  4EYH B;  4M95 A;  4ZA1 A;  2HHQ A;  1B7F A;  2OPR B;  1HW9 A;  1TK8 A;  5EX0 A;  3GV8 B;  4LRE A;  5KT5 A;  2AJ0 A;  2HWI A;  1XNR F;  2XTJ P;  1HMV A;  1OY8 A;  4C3K A;  2BVZ A;  2HWT A;  3G6Y A;  3Q8R B;  1NSP A;  2GS8 A;  2V2V A;  1UFL A;  3I32 A;  2ZH1 A;  2XBP A;  2CQI A;  5IZH A;  4CYU A;  2FLO A;  2NXC A;  1VQ5 S;  2G9O A;  3N9U C;  5AE3 A;  4FF1 A;  1SL0 A;  3A8I A;  4E8U A;  1NPR A;  5ETL A;  2NUU G;  3IR6 B;  2Z4P A;  4DR7 J;  1HL6 A;  4RU9 A;  2XY5 A;  3R5B A;  1SKS A;  3TX0 A;  4OZL A;  3MEE A;  3E01 A;  5A76 A;  4LRA A;  2OSR A;  5E3Q A;  4I56 A;  2M88 A;  4NML A;  4R0J A;  3T1H J;  4USV A;  1WSR A;  3T1A A;  2J0X A;  2QEX S;  5KG5 A;  3C2P A;  4URQ U;  1QSS A;  4OJG A;  2VHG A;  1HBO B;  3S8S A;  2WK4 A;  4PYD A;  5DS7 A;  4HKQ A;  2AQ4 A;  5FDL A;  2RD5 C;  3BSC A;  1WEL A;  1XNR J;  4QU6 A;  2B9X A;  4ZOS A;  1ZM2 A;  3VAI A;  1H6K X;  5KFG A;  2RDI A;  4A8S A;  2FJX A;  5ETO A;  1HNI A;  1B4S A;  2HNZ B;  2DRB A;  4C8K A;  2F8E X;  5D15 A;  2ZOM A;  2QA4 S;  4CLL A;  4B9L A;  3G71 S;  1WC0 A;  1U2C A;  1Y9O A;  4N8O A;  5HJY A;  1KDN A;  2Z2L A;  4ITS A;  2DR7 A;  1PAE X;  1X31 C;  2ZDO A;  4ANC A;  3AA9 A;  1PJ5 A;  4C0O C;  2M4M A;  1X4E A;  3J80 U;  1JLQ A;  5BR8 F;  1FWP A;  4RUB A;  2JEG A;  4DSJ A;  4P10 A;  5M2R A;  2BX6 A;  1ZYQ A;  4OMF G;  1RKJ A;  3KTQ A;  1P6T A;  1WI8 A;  1OY6 A;  3M8Y A;  3ET6 B;  1FVS A;  3VZH A;  4DSE A;  4K2J A;  5AT1 B;  3FQK A;  5CYQ A;  2F5G A;  3OQ2 A;  2UXC J;  4B3T F;  2V8H A;  2E66 A;  3JAM U;  2M70 A;  2HK3 A;  2R7O A;  1OQ3 A;  4V19 X;  1QUP A;  2GJI A;  2J7K A;  5GAG U;  1TKD A;  1M0S A;  1S1U A;  5CZX A;  3LP0 B;  3OXF A;  4CRJ A;  3OVS A;  2LQ9 A;  3H4D A;  1PIL A;  1JLG B;  3PEH A;  2X1B A;  4LSN B;  2ZKT A;  1C1C B;  3DN9 A; 
#chains in the Genus database with same CATH homology
 5BXI A;  4ANE A;  1WKK A;  2HVD A;  4ENO A;  1JXV A;  1NSP A;  4O0N A;  3PRV A;  3Q8Y A;  3VGT A;  3Q8V A;  4CP5 A;  3BBF A;  1NDC A;  3B54 A;  2DXE A;  1KDN A;  3EE3 A;  1WKJ A;  4UOG A;  1NDL A;  1S57 A;  3ZTQ A;  3ZTP A;  1BHN A;  3EVO A;  1PAE X;  1B99 A;  1HHQ A;  4ANC A;  4EK2 A;  4F36 A;  3FCV A;  3VGV A;  1WKL A;  3VGU A;  3EMT A;  4C6A A;  3GP9 A;  1LEO A;  3ELH A;  1NCL A;  3ZTO A;  1LWX A;  5C7P A;  3FCW A;  3G2X A;  1K44 A;  1F6T A;  3BH7 B;  3NGR A;  3DDI A;  2HVE A;  1NSQ A;  2AZ3 A;  1NHK L;  2AZ1 A;  3GPA A;  4HR2 A;  2ZUA A;  2DY9 A;  1W7W A;  5CAB A;  5IOL A;  1VYA A;  4FKX A;  4F4A A;  1NDP A;  2BX6 A;  3ZTR A;  3NGU A;  1XQI A;  3FBC A;  2BEF A;  1EHW A;  3EVM A;  4UOF A;  3EJM A;  1NLK L;  3PJ9 A;  2B8Q A;  1U8W A;  3R9L A;  1MN7 A;  4WBF A;  4AND A;  4DI6 A;  1S5Z A;  1NB2 A;  1NPK A;  1ZS6 A;  3ENA A;  3FBF A;  3DKD A;  2VU5 A;  3B6B A;  3ZTS A;  3VVT A;  1MN9 A;  1HIY A;  3L7U A;  3NGT A;  1HLW A;  2NCK L;  3Q83 A;  1PKU A;  3WX8 A;  3FKB A;  3VGS A;  1F3F A;  4S0M A;  2HUR A;  3ETM A;  4DUT A;  3NGS A;  3FBB A;  1BUX A;  3MPD A;  2B8P A;  3Q89 A;  1NSK L;  3FC9 A;  4W98 A;  4UOH A;  3EIC A;  3VVU A;  1NDK A;  3FBE A;  3Q8U A;  4DZ6 A;  2DXF A;  1BE4 A;  1S59 A;  2DXD A;  2DYA A;  1NUE A;  1UCN A;  1XIQ A;  3Q86 A;  4FKY A;  5CAA A;  1B4S A;  3BBB A;  3EVW A;  4KPC A;  3EM1 A;  2CWK A;  3JS9 A;  3BH6 B;  3BBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...