4DUTA

The structure of nucleoside diphosphate kinase (ndk) from burkholderia thailandensis
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
140
structure length
140
Chain Sequence
ALERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVAARMAHLSRADAEKFYAVHAERPFFKDLVEFMISGPVMIQVLEGEDAILKNRDLMGATDPKKAEKGTIRADFADSIDANAVHGSDAPETARVEIAFFFPEMNVYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 44
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4dutA00
1NDLA 3EM1A 1LWXA 4O0NA 1NPKA 1BE4A 1XIQA 3G2XA 1WKJA 3JS9A 1HIYA 4ANCA 3ZTQA 1NUEA 4FKXA 3ZTPA 3ELHA 1MN7A 3NGRA 3Q86A 1NDCA 3BBCA 4W98A 1UCNA 3BBFA 2DYAA 4CP5A 3ZTOA 2HVEA 1HHQA 3Q8UA 2HVDA 2B8QA 3NGUA 1NHKL 1NLKL 2AZ3A 4F36A 3Q89A 1EHWA 4FKYA 3VGSA 4DUTA 1WKKA 3BH6B 3VGUA 4ANEA 4F4AA 3EICA 1W7WA 1K44A 4S0MA 3EMTA 3MPDA 2DXEA 3FBFA 2NCKL 4EK2A 3FCVA 3DKDA 3ZTSA 1BHNA 2CWKA 3FBEA 3Q8YA 3VGVA 3FBCA 1BUXA 1NDPA 3EE3A 5CABA 1U8WA 4C6AA 1PKUA 3EVWA 4WBFA 3WX8A 3EVOA 1B99A 3BH7B 1XQIA 2DY9A 1JXVA 1WKLA 3NGSA 3FCWA 3ENAA 2ZUAA 1B4SA 2DXFA 5CAAA 3Q8VA 2DXDA 1VYAA 1NSPA 3Q83A 1NCLA 1HLWA 2BEFA 1ZS6A 1NDKA 1S5ZA 1NSKL 1LEOA 3B6BA 4KPCA 3NGTA 1F3FA 1S57A 3VGTA 3B54A 3FBBA 4UOHA 4DI6A 3GP9A 5BXIA 4DZ6A 3DDIA 3PJ9A 4UOFA 3BBBA 3ZTRA 3EVMA 3GPAA 1MN9A 2BX6A 1S59A 1NSQA 1PAEX 4UOGA 2B8PA 1KDNA 3EJMA 3VVUA 2HURA 4ANDA 3R9LA 2AZ1A 4ENOA 2VU5A 3FC9A 3VVTA 3L7UA 3ETMA 1F6TA 4HR2A 5IOLA 3PRVA 3FKBA 5C7PA 1NB2A
chains in the Genus database with same CATH superfamily
1LK5A 2GJFA 2QL5B 1KQFB 1ZH5A 3EM1A 3VAMA 3NCRA 2V8GA 4P75A 3KLFB 2MLYA 4B17A 3TARA 2WVEA 2E29A 3IMQJ 1S6PB 1VQMS 3GYGA 1Y7PA 1SKUB 3AFGA 1LWFB 2XMMA 4WIQA 4YB6A 3G96A 4OYZA 3TAQA 2JEGA 4WFBQ 4LQ3A 2IMOA 2UVVA 2JJ4D 2HS4A 1F2GA 4KSEB 4DCPB 4IOBA 2Q66A 4M94A 2QT7A 3ELHA 2PFDA 2AMCB 3VTIA 3L4BC 3K57A 3OL8A 2FJWA 3QFWA 3KKFA 4ZCLA 1VIXA 3BBFA 4A8KA 1BLUA 2CQ4A 1Q8LA 1EQMA 3C14A 5AE1A 1NK5A 4C8NA 2B9XA 3OJUA 2ERRA 1ZTWA 2W4PA 4PPZA 3E51A 3W1YC 1EHWA 1TU0B 2N4CA 2XNQA 4JI3F 1ACMB 4XK8C 4KQZA 3W65A 2V67A 4DUTA 4AE5A 4FYWB 3NL0A 5T14A 2UV8A 2P9EA 3K5PA 2G0JA 3EZUA 1HBNA 4WPAA 3DOLA 5MAOA 2MKCA 2ZE2B 3MPDA 3G6XA 3IGVA 2UUBF 3GZ7A 1EETA 2MGZB 5HMXA 1IQTA 3AHPA 3LP2B 4K2JA 4ALZA 3KLVA 4JI1J 2GIQA 5AXNA 4U7UK 4ED8A 3H5XA 1RWVB 1UW9A 3RBEA 1ZPWX 2CQPA 2DEIA 2J9CA 4AL6A 1UVJA 4TVAB 4LRDA 2XB2D 3KHGA 2BW2A 2K06A 5KFFA 3AXKA 1R27B 4IQMA 4DQIA 4M63A 2B3TB 2IJFA 1C1CA 1APSA 4LVOP 1MSWD 4ZCKA 3GFHA 3TAMB 3GILA 4WE1B 1Y3JA 3MTKA 1B0VA 2C2NA 1C1BB 4O23A 4KH0B 5ETVA 5KFWA 2PT0A 2O5DA 1E6VB 2WOMA 3DRPB 3EVOA 2AYGA 3QJLA 1D9DA 2DGOA 2OMLA 3G82A 2WVFA 3CW2C 3M6XA 5LSLA 2R8GA 4KB7A 1HW8A 1WELA 2RE1A 1SH2A 2UXCJ 5EWEA 1T05B 2OTLS 3SZ2A 1IUJA 1YSJA 5IC6B 1FX2A 1VMBA 1WF0A 5CAAA 3M6UA 1SJRA 4KJIA 2PEHA 1Y3KA 1NSPA 2J7WA 2QX0A 2YNFB 2E9TA 4F4WA 1WHWA 2EC0A 2WBMA 5J2MA 1NDKA 1KTVA 4MAKA 2QE5A 4XIUA 2C28A 1S9GB 2Y8YA 3TQEA 1KN6A 1KHVA 4NLRA 2W2NP 4F7VA 2R8HA 3OR1A 3H5SA 1QE1A 2FZGB 3D0HE 3R97A 4J9PA 4FXDA 3D1QA 1MNEA 3V4IA 1W25A 2CFXA 1OWXA 1M90T 3SXLA 2HWIA 4ZN3A 3IFEA 3R7BB 4ZJQA 5M2RA 3CIMA 2UXBJ 2OI2A 5IM0A 3FGVA 4OHWA 2LEPA 3HDSA 3GQCA 3MEEA 4LR8A 2EW9A 4NL5A 4TQSA 1LFPA 1WNEA 4M1KA 3RG6A 5CZXA 2R7UA 3U27A 2FHOB 3S6EA 2HNZA 4DV2J 2W7PA 3BV8A 4B9TA 3DRSB 4UUWA 1U09A 3ISNC 1YJNS 4WP8A 4YN3B 5E3RA 1NAQA 2Y8WA 2VOOA 3QGIA 4USWA 2FZKB 4K0KJ 3UDCA 2VU5A 1S48A 2OFHX 4EGLA 2RDIA 4KGKA 1D0EA 2PMHA 4PUOB 2KHDA 4ED1A 3W60A 1N5VA 2ILZA 2Z56B 2W9BA 5AT1B 3TI0A 2ZEJA 4ECVA 2LMIA 3PRVA 4DR2F 4KHRA 1FDAA 1S6QB 2XI3A 4QWDA 2M2BA 2HZCA 1R0BG 1P1TA 3N6LA 3DRRA 3QWUA 4LT6A 1P8GA 1RAOA 2V6AA 5AJ3F 2DGVA 1QVGR 2IJNA 4I2QB 4USIA 4NZ7A 5EDWA 4Y2KA 4HACA 3P49B 2HHUA 4HT7A 2ZC4A 4QWEA 2KFNA 2D1CA 1WDTA 1K8AT 4RBVA 2APOA 2HBRB 2DKOB 3QT5A 2E7VA 1IJFB 2QO3A 1BQXA 1NEEA 5HI7A 3W7BA 4HYKA 1B64A 3KG4A 3D1OA 1AB8A 3AJDA 3TW0A 2XS2A 2B8QA 1GTEA 1NHKL 2ZD1A 1NLKL 2VKRA 4OHZA 3CJ0A 1BXNA 3IRXB 4FNHA 5DQGA 5KFDA 4B3SF 4FBUA 1LWFA 4ILRA 3TOQA 4MTPA 5K8NA 3CF5Q 3GV7B 1KOHA 3Q24A 5ETPA 4KO0B 2E1CA 2RQCA 3I5AA 2CQBA 1R0CB 3VHQA 5B0FA 3K0JA 1NKBA 4USUA 4YOEA 2QFIA 4F26A 3EMTA 4DL4A 4FBTA 3BYRA 1Y9OA 2CQ0A 2ZOMA 2HHTA 5A8RB 3LP2A 4J9NA 5FDLA 3ZZ0A 2D3UA 1U1RA 1GH8A 3BPSP 2HYIB 1G7CB 2ATCB 1BHNA 2MEWA 3SCKE 3BN7A 3T6JA 3CC7S 4B3TJ 5E2QA 3R7NB 5AJ3J 1P9QC 3Q8YA 2YWWA 4QQBA 3VZIA 5KG5A 4EZ9A 5ETSA 1N56A 1KSPA 1FK9B 3ZXWA 3TAMA 4EEYA 3CMAS 2OPPB 1HHTP 2NR0A 1UFLA 3R5BA 3ZZOA 2DNZA 2GAGC 2XYHB 1PILA 3KLIB 4OI6A 3HX9A 5E3QA 4GKJJ 1UWAA 4LF4J 5HJYA 5DDPC 1ZZFA 2IAJA 4RR5A 4USHA 1A7GE 1JXVA 2YWGA 5KFXA 1XK8A 2OHDA 5F8MA 5DG9A 2HQDA 3FCWA 5G0RB 4OJGA 2R2SA 1WI8A 2BQ3A 2C2EA 2OJ3A 2YKAA 3RYLA 2BYCA 1HQEA 3OR2B 3IM8A 3KK1A 1OY6A 2A3JA 3ZZUA 4O4GB 2VPZB 1KVIA 1RXOB 3MOZA 4LR9A 1WC3A 5J2MB 1RTHA 1Y5NB 2AX0A 2DIVA 2Q6BA 2DNKA 3PFEA 1V3ZA 5B0BA 3KK2A 2J6TA 1URNA 4IH5A 1HBOB 1VCTA 2KG1A 4AT1B 2YH0A 1SJ1A 2X1AA 2WOMB 1NBEB 3QAEA 4KPCA 2WONA 3ILLA 1KS2A 2VQFJ 2IJRA 4USTA 5A2QU 2C2DA 3NGDA 1RWUA 2A2DA 4P2MA 3R5AA 3LF0A 4DPUA 4CH1A 2B7CB 2D9OA 1FJ7A 1ZA2B 5B0CA 2BQRA 1SQEA 1YX2A 4DUZF 1CULA 4PR6A 4BWJA 4OX6A 5B0EA 1AROP 2B4UA 3BBBA 3OUYB 1SJ3P 3EVMA 4WTOB 3GPAA 5L9XA 3VR1A 3PW7A 5D0EA 1S9GA 4C48A 4JI5J 4UOGA 2XY5A 4V19J 1BWEA 2I0XA 1KDNA 4MT1A 1W2BR 5IWAF 2B9EA 1ZA1B 4DX7A 4JI1F 4AL5A 2POKA 4Q8FA 2E9RX 3I4HX 3RAMA 4TU9A 3OXGA 4NEYA 5CYQB 5J1NA 2W9BB 1L3UA 2DEJA 3NS6A 4DR7F 1KWMA 4L75A 2W9CA 2KYXA 1TL3B 1VHIA 2AF6A 3D6FB 1VOMA 3CNQP 4HI1A 4PQUA 9ATCB 4ECZA 1TZ0A 2ZWPA 2HZVA 1AT1B 3U1MA 3PR4A 3KOAA 3TJAA 3FSIA 4FYXB 1MU2A 3EUNA 1RAIB 4M5NA 3IXQA 4G1PA 3EXYA 1LW2A 2RRAA 2H4YB 2VDIA 3G2XA 1VRTB 1HL6A 2AKWB 4PYDA 4JV0A 2RT3A 1SKSA 2VPXB 2CPDA 3W5XA 4WIIA 3SQGB 5A6PA 5BYQA 2HFZA 1NB7A 1Y00A 1TL1B 3CGIA 3BQ2A 2BUNA 3CJKB 3TAPA 4C11B 4M95A 4KPYA 1HBMA 1GXUA 3PYDA 1S6QA 2V94A 3JTNA 5DS7A 3CXCR 3CVKA 4FXWA 4B3RJ 2DPIA 3IRXA 1WI6A 3KLHA 2C2KB 2OEJA 1UFWA 2C1EB 2ZVIA 4B9VA 3Q89A 2AEFA 3I0SA 3MM6B 5A8KA 3SFUA 4JUZA 4KYZA 5JVGQ 4PWDA 3X1LB 1SV5B 2CDQA 5J2QA 1NK9A 4N76A 4NLOA 1Q7LB 2LA6A 3D6MB 3G9CA 3EICA 4YR3A 1HYSA 3DN9A 5AXLA 4MIAA 2FIUA 3PYEA 2DRBA 3FBFA 1F5BA 1X4DA 1GMUA 1A6LA 1HQUB 5E3CA 2JVOA 5HVGA 2XO6A 3KNAA 2R7TA 3TVYA 3SQOP 2IC3B 4KBIA 2WRMA 4NEZA 1O51A 4AQYJ 2V2KA 4ECWA 1RWOB 1MMDA 3THTA 3PCOB 1YLXA 3M8WA 4BC9A 1UZDA 3IBFB 3T6BA 5HQMA 1VC6A 4C97A 4TLRA 1BUXA 1NJZA 4DS5A 2CPYA 4ZVGA 3H5UA 4FF4A 2JSXA 1C0UB 3BM7A 2HNYB 3C2PA 2FY8A 4CYUA 3HSJA 4LF8J 2XEXA 1SL2A 2HHXA 2HIYA 1PCAA 3U1LA 5FD1A 4LJMA 4ID8A 4DSKA 1WF2A 2QL9B 2AYMA 4NYPA 2ADBA 4Y65A 1P9YA 2V9KA 3D9BA 2W7AA 1WKLA 2KRRA 1HBUB 3LAMA 3LGNA 4DLGA 4B3RF 4CLKA 5KFVA 4C4WA 2LEAA 1HQEB 3OR2A 3B82A 4NXNJ 1Q5YA 2UUWA 3D54A 8ATCB 4ZPWR 2VA3A 1T11A 2XWXA 1WOOA 1N4LA 1RTHB 2H65B 3ETOA 3OFEA 4EI2A 4NLVA 2WAQD 5KFNA 4LRCA 1CJKA 4FF3A 3M4XA 1NSKL 4XPEA 4DU7A 3JQKA 1Q79A 4NCGB 1SC1B 3C15B 5KFSA 4RW6A 2CVIA 1FXDA 2EK6A 4DLEA 1KLMA 4MKBA 1B70B 2A1BA 3G6VA 3LANA 4O3SA 5EWFA 3FBBA 3O8WA 3P3DA 1HWJA 3IBCB 4TLQA 4NOHA 1LKZA 4N56A 3BYPA 2DTJA 3QWPA 2OD4A 4UOHA 2HHHF 3PKMA 1IKWB 3DRYA 2LXFA 4GO5X 2FYXA 3BGRA 3GP9A 1S77D 3KMQA 1D9AA 2YPYA 4NX9A 2F9JA 5CD4H 1U26A 1TV6A 4PXDA 1FCAA 3PFOA 1KHWA 3OLBA 1OS5A 3A1YG 3TWZA 3ZZZA 3BJYA 2XZDB 3ET6A 1YJRA 2VFTA 1BMQB 4U96A 1N6QA 3M8YA 5IT4A 5L38A 5JVHQ 3NOGA 1Q8IA 4WFXA 4D3GA 2BR0A 4LMZA 1REVA 4NRUA 2N3LA 1HR0J 2W2OP 1O5JA 2BQUA 3MM8B 4H4KC 3BSAA 2W9CB 2QA2A 4JI3J 2XG8A 2N4DA 3MXHP 3W2VB 5C7PA 1YBTA 1F9HA 3MECB 4IFVA 2MPUA 4IH6A 1IBCB 1RGVA 1HPZA 3SMZA 1S0NA 4KHMA 1WHVA 4O0NA 1S0VA 2YVSA 4CO2A 2WVCA 3KUGA 1DHMA 2AJ1A 2Z2LA 1NPKA 1RHQB 4OZ5A 5LL6d 1YJ9S 2VODA 4DBQA 1E6VA 2Z8QA 3TZWA 2QSWA 1RAEB 3B78A 4P2FA 1FRMA 3FRZA 3SQGA 2V9WA 1XMQJ 2HSEB 4Q0BB 1QD1A 5F8JA 2E5LJ 1QSLA 3DM2B 2QLJB 4PXBA 2K1RA 2RJZA 4KY3A 1R6VA 5C42B 1JLGB 4YR2A 1LWEA 1RU1A 4FDFA 3S7RA 3DDKA 2XQCA 1NK8A 3DGPA 4WTYA 3HP6A 3TANA 2VD3A 2KT5A 2H5EA 1H6KX 1CS4A 2OSRA 4YP3A 3J7Z5 1UJ4A 2P9GA 3C16A 4Q43A 2VIHA 1Q95G 2M70A 3SI8A 1YTYA 1YIJS 1LW2B 4C7QA 1REGX 1ZTTA 2UP1A 2G0IA 1FJGF 2K2PA 1KRPA 3BZQA 3IR7B 4J9QA 5DG7A 3EGNA 1PBAA 1XWLA 1X4HA 4KFBB 4DSLA 2JLFA 4DG1A 5F8HA 3H90A 1N0UA 1QAXA 4NLDA 4F0KA 3CJKA 2RU3A 4USJC 2VASA 4NA1A 1TKXB 4A8WA 1HKAA 2YH1A 3MMBB 3T5JA 1UPPA 3EGWB 1UVNA 4C3LA 1S4FA 3NKYA 2C2RA 1OJ4A 4Z7YA 3H42A 4ZMMA 1U49A 2R42A 3RR8A 2F8MA 2ALZA 3N5FA 3GYNA 1DQ8A 1HWKA 1DFDA 2LXUA 5HMZA 7FD1A 1PC4A 5H1SV 1NPPA 4USMA 2BJDA 2KKHA 3I0RB 4M5MA 2FTRA 3D2WA 4MIWA 2IVFB 2ZH8A 2ZITA 1SV5A 3ADAC 2GJ2A 3K59A 2DHSA 3GWCA 3TA2A 1S6UA 3BDEA 1J5EF 4RX6A 4I69A 2JZ5A 3W9JA 2BANA 2XHWA 3I31A 4MKAA 2V8HA 2OPQA 1VK3A 4ZVFA 1VQ6S 3CCQS 2KJWA 1WEZA 1YJ7A 4OJHA 2JFKA 2KG0A 2HQCA 2RB7A 2PO4A 3KNGA 2FY1A 1NJWA 2AIRB 4JI7F 5D0GA 2ZUAA 2CJKA 1T9TA 5D15A 3CCWA 1RYSA 2FVRA 1SXLA 5BR8J 1S1WB 3TZXA 2Z2YB 1VYAA 4LF9F 3C14B 2VL1A 3NY0A 3DOMA 1HLWA 5M2UA 3ZZTA 5DQIA 3GIRA 3KLFA 5D4LA 2VG5B 2DISA 1RACB 3KJFB 5A0YB 3MPWA 2HRYA 3TJ9A 1FEHA 1MWZA 1NXIA 4RW6B 3LWMA 2UVWA 4CNZA 3RB0A 2HHSA 2H5IB 2E44A 1KR4A 1DQ9A 1JLFA 4LSZB 5EHHA 3PYGA 1U0HA 2HK2A 4LBHA 3OTBA 1HBUA 4WU2A 3VV2B 2VPWB 5ADZA 4YB5A 4DL7A 1M5HA 3FQLA 3MCMA 4AUKA 1GX5A 2IIHA 4ECUA 3T5KA 5HROA 1U1KA 5AXKA 3BGRB 1HNZJ 4ZVQB 1U6ZA 2RQMA 3UN2A 4DZ6A 2ASLA 3T41A 3OHAA 1U47A 2BE7D 4GVBA 1ICEB 1RHRB 1X4AA 4C2MA 3Q8SB 1JJ4A 1U48A 2Y3YA 4N8NA 3K2YA 1UKUA 3L09A 4OMFG 2ZH7A 3TZZA 4WZQA 4XAKA 5ITHA 1W2IA 1CJUB 5C25A 4ZLJA 4ED3A 5EWGA 4PQAA 2C2OB 1JQGA 2FUG9 2V34A 1RT7B 2ZM6J 4IG0A 3QO9A 2V4JB 4Q7AA 3RB4A 2A6OA 2ASDA 5IC4B 4LF5J 3CMQA 2QRRA 3I82A 1TV6B 2VZ9A 4NA3A 3J7ZT 4ED5A 2AV5A 2ZKTA 3FCHA 3U1NA 5LMUJ 2A2CA 2PGCA 3NNHA 1XMOF 5B08A 1Q78A 2KRBA 2VBWA 3CE8A 3DMJB 2VJUA 4ZJLA 4ZIWA 4ER8A 2BW7A 2LQJA 3UFCX 4PABA 1HNZF 5EX3A 1M5VC 1T0TV 3M2RB 1VQ8S 2GAHC 2L41A 3ZO7A 4CO0A 1QJHA 3JSRA 3ZTQA 4WKYA 4Q0BA 3MM9B 1Y0HA 4CLLA 4J5OA 1P6TA 2OMOA 4CLWA 1NZ8A 4LSNA 3ZC4A 3HZGA 3UCGA 4I56A 5J1PA 4P10A 3GONA 4OYOA 3DLLQ 3DGPB 4CP5A 2GJIA 6FD1A 1RT5A 2GNKA 5F8IA 1C4AA 2B43A 1M1KT 3BKTA 4CRJA 3C16B 3NGUA 1IQZA 4MKVA 1VISA 2EFOA 2IRUA 2AHOB 3AJ1A 2H48B 3V2UC 2RDJA 1FD2A 2DR8A 2DNHA 3UNYA 1EARA 1U6FA 2VFVA 2VG6B 4ZVOB 2Y9HA 4U7UD 1YJVA 3CCES 4E98A 5HMYA 2NS1B 3KFWX 3DDNA 3TZYA 3NP5A 1B0PA 3Q8RB 3K17A 1IBLJ 4FYDA 4YB7A 3WIUA 1CQMA 2DNGA 3DRSA 3FFIA 3MMBA 3EGZA 3KK3B 4P7VA 3DLBA 3BREA 2C42A 3HKZD 3J81Y 2NSCA 1JJHA 3KUEA 2DY1A 3PIOQ 1TFYA 1PJ6A 2OELA 4J7CA 5F41A 2FJXA 1S1XB 2CYYA 2EFGA 2JVRA 3VAHA 4EBDA 3T1HJ 3I0RA 4GKKJ 1S99A 2CWKA 3C6UA 1WEYA 4BCAA 1UZHA 2DB1A 2FLNA 2U1AA 3FBCA 2IM1A 4LRAA 2IM2A 4DR1F 2QZ8A 4MYTA 1MLAA 4DL5A 2XZWA 2RF2B 3OLAA 4DQSA 3V6KA 1U1MA 2CZ4A 4JI0F 2X3DA 1JNZB 1PKUA 1U2CA 2IDEA 4GRSA 5DG8A 4DR4J 3CCMS 1HA1A 4DFMA 3NBPA 4LVNP 3D3BJ 3CJ5A 1YGYA 4PXCA 5HQLA 1N36J 4U95A 2JEFA 1TELA 4JI2F 5KG6A 1RT3B 1X7VA 4YB1P 5IQQA 1XR7A 2HRUA 2KXHA 3B4MA 3OL9A 3J7A1 2LDIA 1GXLA 3SFGA 3Q0AA 2Y1LB 3L95X 4MIBA 2NXEA 5GAGU 1IM4A 4NRTA 4P71A 2KFYA 2CJ9A 3EX7B 1UP1A 1WD6A 4XO0A 2NZ4A 4RW9B 3CC2S 3GJTB 3JSYA 2NUHA 4RW8A 3AXMA 4XDCA 1X0FA 2RILA 1YI2S 2AX1A 4YHHF 4HACB 3HVRA 1KNZA 1TTHB 2DR6A 1QTNB 2BRKA 3LA0A 2HVHA 1HFEL 4P74A 3M2UB 2PI4A 3TRGA 2M88A 1FFWB 2MJUA 2J5AA 1HWIA 4UY85 2HFSA 4OYMA 2MQNA 4FYVB 3WDOA 4DXLA 4ZCMA 5DDOC 4QWAA 5A8KB 3RB6A 4OLOA 5KT7A 4C3MA 4DFJA 4F0MA 3ZTRA 2RKIB 4H4OA 3DLJA 2ZD1B 1MN9A 4DV0J 2UU9J 1XNQJ 2QA4G 1R0AA 2R7XA 1WWHA 3OVSA 2X1FA 3P6YC 3HFVA 4ED6A 5B0AA 3EJMA 1VQNS 2R7VA 1G3OA 2V2QA 3CCJS 1CJUA 5C25B 4ZPVR 2DCUB 4EO6A 2R9LA 3MZIA 4J9MA 3VAJA 2L08A 1TKTA 4HVZA 5LMUF 1JNRB 4A8XA 5H9EJ 4Q2LA 3R2DJ 2HQFA 3HJVA 1P1LA 4ELVA 5ETTA 4DL3A 2C3OA 1F2HA 4DPXA 3C3LA 2FB0A 2IAJB 3HHLD 1X60A 4CQ1A 4NA2A 1CEZA 1DQAA 3QIDA 4DV4F 1HNWJ 1X4EA 4OZ2A 2B0GA 4RWXA 2KM8B 3W8PA 4BC7A 2XLIA 2IHR1 2UXDF 5FIIA 2ZBRA 2VDHA 2OO4A 2Q3PA 3R27A 4U7CA 3JS9A 2MHEA 1YJWS 3MR2A 3CEDA 2LP4A 2V63A 1SCJB 2J0XA 4X4SA 4JI5F 4OJ1A 1ITPA 1N48A 1T9YA 4FNIA 3K58A 2G2ZA 2ZBPA 3GMGA 3M8QA 2QMWA 4P2XA 1U02A 5BR8F 1T7PA 2XNRA 1ZAWA 4IOAQ 5KT6A 4PZVA 3QZ7A 1VC5A 4OV6A 1RTIB 2KO1A 1X8DA 2CNOB 2YX4A 5AE3A 3MM5B 4IDKA 4BDPA 2XCPA 4L73A 5F9NA 4LSLB 3OQ2A 5J1EB 1CJKB 3KLEA 2D7SA 1YVFA 1CULB 3FQKA 3JQMA 2IFXA 4NCGA 4ZA1A 3IAM9 2H3EB 1OIAA 1D1UA 2MXYA 4ANEA 3RU0A 2GW8A 2ZDOA 4EYHB 3MR3A 1F1BB 2QJ3A 5T41A 1Z1ZA 5C24B 4J9LA 3Q23A 3WIVA 5ETNA 5KG0A 2CNKB 4CO1A 4DR5F 2WONB 3DI6B 1KD1T 9RUBA 3ZFVA 2GZOA 4KAIA 1R89A 2OKQA 3M8PB 4UQTA 2W8KA 2H4WB 2RIJA 5HLFB 2HMIB 3SIPB 2L9WA 3UO0A 1U1QA 2PDAA 4LF6F 1N33J 6FDRA 3POTB 1NDPA 4O3NA 2VG7A 4DFKA 1RCOB 1PYOB 3D5MA 3K5OA 5H9FK 4EWTA 4Y28C 2UZAA 4Y0FA 2UUBJ 1KQSR 3R5CA 3QJPA 3DRPA 3MAQA 1Q86T 2JFDA 3HHDA 1S1XA 3GCXP 1LK7A 5CD4A 1TR0A 2DNLA 1VRQC 1IBMF 4UY8T 2DXFA 1X5TA 1DLOA 3OTOF 1R3NA 2GMJA 1M1HA 2GIRA 2RHSB 2ADCA 2Y0SD 1WSVA 2DNPA 5KFZA 4KHPJ 2B9WA 3E3XA 3NG8A 4TYBA 3PHEA 1ZS6A 1LQ9A 3TEHB 4IG3A 4MJKA 2CJXB 4DV7J 2L9NA 4OQJA 4YDXA 4C0OC 2WW8A 5LJ3Y 5GAHI 2QGFB 2RQ4A 3OR1B 1F60B 3TR5A 2W25A 4FPRA 1O8BA 1SVDA 4CLPA 3KYLA 1RKJA 1KVJA 4AQYF 1BC6A 1XNQF 2IM0A 1FRIA 3HSZA 3IA0A 4UZBA 3ENQA 4IR9A 3TA1A 3IWLA 2DHGA 3MMCA 2ZOGA 2R7WA 2Q6CA 1FXRA 2IC3A 1N34J 4JB8B 1M5OC 2NYIA 4R0EA 2AJ0A 2ZVSA 1IBLF 3I5CA 3HHLA 3EZOA 2CRLA 3LP1B 3ULHA 2HLTA 3HPOA 4DR6F 2CPFA 2XGPA 2H1YA 4WYLA 3E01A 4U9RA 2FC9A 4ZVSB 3KJVA 4DF8A 2AZ1A 2Z58B 2N82B 1S7IA 4NMXA 1RA6A 4O0IA 3GFZA 3BPDA 4YY3F 2ZOFA 1FWKA 4G6VB 4DPTA 3T5LA 1VLOA 3O44A 4F67A 5LXRA 3A3OB 2GA7A 2XYPB 1IBMJ 2Z2MA 5D4OA 2CNLB 5D0HA 1NK0A 1G2EA 4C8LA 3QRRA 2BBEA 1X5OA 2RKIA 1NDLA 5CQGA 3H2VE 4OLPA 4Z37A 3SV4A 3DRRB 1FTCA 1R8CA 2CG4A 3HJFA 4DV7F 5KG1A 4JI4F 1WUUA 3R7SB 4DFPA 4IH7A 1FA0A 1T3OA 1WKJA 2HBYB 3AOAA 4P9SA 5CHCB 4QW8A 3SDEB 4E8UA 2VV5A 3JAMY 1RWPB 5K8PA 4RNOA 2JEIA 2BV3A 2MKIA 3ZTPA 1XMOJ 3T1AA 1YRXA 2GMHA 3M8QB 2D3ZA 3EDQB 1IWGA 2ZZMA 4GO7X 3FK4A 1RAJA 4G1QB 1OPIA 3GG0A 4OYIA 4RPFA 2EXUA 3AAWB 2Q43A 1HHQA 5DM7Q 3NNCA 3DOMB 3HT0A 4AFFA 2CADA 2CQHA 3CULA 1RWNB 1KEKA 2XLJA 1F9EB 1XNRF 1F5CA 3D6TB 4L3KA 1N88A 1K9MT 5KFAA 1CBKA 2M52A 1D3WA 1HNIB 4HL9A 2BM1A 2XSJB 1FKPB 3GFXA 5GAEI 3HK2A 1C0TB 1NH7A 3CC4S 4NCAA 1QDUB 5KFJA 2CPZA 4TY8B 3J80Y 2HFOA 3QNWB 1JXEA 1NRKA 2CKWA 4CM0A 4RO0A 2OEKA 2FGCA 2D74B 3MM5A 4RBUA 4GVBB 1MWQA 1DZ5A 2MQ8A 2AGOA 4NXMF 2OTJS 3CJ8A 2EEYA 3VF0B 3W2VA 3VGVA 5C5JA 3CCSS 3WZ0A 2QEXS 4ECXA 2I5JA 1YQHA 4WXOA 3CD5A 5A8WB 5LJ5Y 4QIFA 1JWWA 1VQ4S 1UVLA 1YJUA 4ZITA 1NK7A 1VBKA 1G1XA 2VFUA 4XTTA 3CCRS 1UEUA 1DTTA 1UWBB 1RT7A 1M5PC 1JK9B 4ITSA 3V81B 3PX4A 1N6QB 2Z57B 1KOOA 5FLXY 2W9AA 1RP5A 1REVB 2P9CA 4F0HA 5KFOA 2G1DA 3G6ES 4ZJOA 1J27A 4JI0J 3JXOA 2GC8A 5J2NB 3QIPA 1DLOB 2BJ1A 1B4SA 3N01A 5GADI 5DLGA 5KFYA 3LGHA 2BM0A 3DHXA 2F3JA 2VG7B 3LQVA 4M5HA 3OL6A 1R43A 4OZJA 1IR2A 4K4UA 1RAHB 2YWHA 2BEFA 2DBBA 1GEHA 1J5OA 2G2YA 2BE2B 3NRBA 4UF4A 1TUWA 1CC7A 2KT2A 4MFBB 3KK2B 4K5SA 3M9NB 3DLEA 3PW0A 1YHQS 3DOKB 2LCWA 2UUAF 4MMOA 1EETB 4CT9A 4L6V3 4XPCA 5H9EK 4F4XA 2RUGA 2DCLA 1I5OB 3V6DA 3W2WB 2QIFA 3MPYA 1NJYA 3CPWR 2EFVA 5C42A 1XERA 2GHWA 1GMWD 2KVIA 2VBXA 4QWBA 1CJTB 4H4KA 4PWWA 4CDIA 2ACYA 1E6YA 1WOPA 5C2GA 2VA2A 4Y00A 3RW6A 3QFHA 4JI7J 2A10A 3D6HB 3LP1A 1RZMA 1T03B 1OY8A 4OV1A 4URSA 2EBGA 2KZZA 3OFHA 4K4TA 8RUCA 3J7YU 2XGQA 2C22A 2KL8A 2V2VA 3THVA 3A3NB 2IVMA 4LF4F 3M6WA 2NXNA 5HP1A 2QC3A 3TUZC 2VQEF 2XSFA 3RGIA 4M5DA 2ASJA 1TVRB 1F6TA 1WJ9A 3QATA 4URGA 4X4TA 5FJ4A 1PAUB 4LF9J 4J9SA 1U25A 1VS3A 4HTJA 2YWKA 3WC0A 1QVFR 2WB1D 2YNFA 1FKAF 1U7LA 3NS7B 1H74A 1HNXJ 1LWXA 3QQCD 1W26A 5IWAJ 3K5LA 4JV5J 4Z2XA 1ZZNA 4PKDB 3LP0B 5M2PA 5BYRA 2WCXA 4QZVB 4I64A 3NNAA 5F3ZA 1RT3A 4I7FA 4F4KA 2V2ZA 5AE2A 3MMJA 3H40A 2FVSA 2DNMA 1RLCL 1FRJA 1S4EA 2NXUA 2W2MP 3ILJA 4ZLLA 5CCLA 1I3OB 4EBEA 1HWUA 1OY9A 1UJ6A 2BABA 3FVYA 3H5YA 3EGVA 1TQLA 2BXJA 2HVZA 3KG0A 3O1LA 4OZLA 5HROB 2XYGB 4CLUA 2YX1A 3G86A 1UETA 8AT1B 1N5QA 4CT8A 3LW5C 1NZAA 2N3OA 4RW9A 4NMLA 1DBDA 4URQU 1UVKA 4RLEA 5GMDA 3L9ZA 3QBCA 4CO4A 1SIWB 1T9XA 1IKXB 4A8OA 1FKPA 3AODA 3NXZA 3W3SA 3NMRA 3F0NA 4A4JA 4F4AA 1U2FA 5J2QB 1TKZB 2VG5A 2YX7A 3FSYA 4FS1A 4N47A 4YR0A 2JLEA 1RT1B 3M32B 5CCMA 4HH0A 3QSYB 2ZWOA 3A8EA 2YKNB 3DLHA 1Y11A 3DYAB 4MK9A 4TY8A 1YRTA 2F1FA 1JLFB 2H51B 5GVQA 1PO6A 1Q16B 1VQ9S 1FJCA 3UNGC 1MG7A 4C98A 1WG1A 2CAJA 2KXFA 4EK2A 2OEMA 4ZPAA 3R5DA 2KHCA 3MR6A 2J7KA 1FVSA 1Q81T 1N32J 1YG0A 2EG1A 3AB2B 3K5MA 4RUAA 4DR5J 2UUCF 1SC3B 2DIUA 5I42B 3C66A 2IA0A 4ECQA 4KV8A 1Z2ZA 5F0WA 2X1GA 3JTOA 3BGFA 5F3TA 3UD3P 3N79A 4DX5A 1CJVB 1HBNB 2YNGA 2YTCA 2HNDA 3DOLB 5T7LA 4RNMA 5GAHU 1FTRA 2PD1A 5LMNJ 1VLYA 1RADB 1G4CA 1XQIA 1UA0A 1BGXT 5EX0A 3RAQA 3GR0A 3JYTB 4V19X 3H25A 5KFGA 4LSNB 3VWSA 1IKYB 2JDJA 4EZ6A 5SUHA 3RW7A 3ZZRA 2V4JA 4RJVA 1UEKA 2MKYA 2OGUA 1WC4A 2WVDA 1MMNA 1RT5B 2F8EX 3JSBA 1BQNB 1C2PA 3MEDB 2AJFE 4M5GA 3V5RA 5I3QA 1N8RT 3A4TA 3QGHA 5HANA 1TAUA 4KO0A 1PJ7A 1RBLA 2UUCJ 4BWMA 2DNQA 1HWLA 3DLGB 3OXFA 4E2FB 3V6DB 4ERDA 4QYZJ 5A2QY 4DV6F 1HNWF 4A8QA 2OP5A 4F4YA 3T1HF 1NKCA 4ZVPB 4JI8F 3RRKA 2MSSA 5BJRA 1BD6A 2W4DA 3KLEB 2ZC3A 1U0SA 2LQ8A 1I1GA 2YBVA 4UOFA 1GT8A 4QR0A 5F9LA 2V4RA 4IO9Q 2E5JA 1T03A 1F0XA 1UTAA 3EXCX 4R25A 3HFZB 1RWWB 1TL7B 2ZDPA 1RT4B 2ZUGA 4MFBA 2MLZA 3MTJA 5IFMA 5FLXU 2DR5A 3DOKA 5E0OA 3KTQA 4NLUA 1VIOA 3CJSA 1JLQA 4Q8EA 3HVWA 4LIWA 4TN2A 2X7IA 4OYAA 2E1AA 4ENOA 1N36F 1DJ0A 1UPMB 3W63A 3CD7A 1ZAXA 1TUVA 3BR8A 3C8YA 3FMWA 2BJEA 3P96A 3UDLA 4A8YA 2BOPA 1RTDB 1U1OA 3CTRA 3ETMA 3RRHA 3P4UB 1EAYC 3FKBA 1JX4A 3GTYX 3MR5A 3SSSA 3FUYA 1FKOA 2L3MA 2LKZA 3FEXB 2RSQA 4F50A 1BE4A 3AJ2A 3HO1A 3GJQB 1NJXA 3UVJA 4FVMA 2R7OA 2ZJRQ 1ROFA 4PG6A 1HIYA 2JX2A 2QLBB 1T9WA 1HR0F 4DV6J 1K1QA 2BJ9A 3I87A 4DV0F 2FVPA 4Y6IA 2UU9F 3PACA 3GIIA 1F5AA 3KDOA 4J9OA 4JYAJ 3D67A 3LPYA 3QT7A 4DPYA 4RL1A 5A6WA 1RTJB 2B6AB 3DM2A 4ZP9A 4ZOSA 3CJTA 1FXLA 4ZLPA 1FNMA 1FWLA 2CVEA 3AQOA 4QOTA 1K47A 1ULRA 3F41A 4LF7F 2HVEA 2AYEA 4ZVTB 4I2PB 2RMLA 3N28A 3OUYA 1XMQF 2UVUA 2UUTA 4ILMA 2Q1LA 2B7BB 2R2UA 1RHUB 2B51A 2E66A 1EKRA 1JJCB 3KLGB 1RUSA 3N6NA 4NE9C 5CYJA 1WACA 5LOQA 1FERA 3EWGA 3ZNJ1 3HHNB 2AQ4A 3W9HA 2NPFA 3N4WA 4I7FB 2GO9A 4NXNF 2O67A 4B3MJ 4RW8B 1X4BA 3UR3C 2IRXA 3OHBA 1D8YA 1X4FA 2NCKL 2P6TA 1RT2B 3MMCB 4LRFA 1S1VB 4ZLNA 2DNOA 3G8SA 2DGWA 2MKHA 1H38A 3ZTSA 1KC8T 1U1PA 1VQ5S 5IT9U 2CIMA 3M7VA 3PM9A 4B9MA 2VF3A 2ALYB 2U2FA 2MQLA 3T9ZA 2HBQB 4FXVA 2EPIA 2NSBA 3QAUA 4DPWA 2E1PA 3EE3A 4H54A 1NHVA 2VC0A 4PG5A 1U8WA 3IR6B 3UCZP 4A8FA 4DV5J 4WK1A 1CJVA 2YNGB 5GMEA 4DN9A 2G1HA 2AYBA 3OT9A 3EVWA 3UWTA 1VI7A 2HPUA 4R8UA 5HAOA 4MH8A 2FJVA 4RZRA 3JSMB 3BH7B 1HBMB 3K8WA 1RAFB 2BANB 5DGBA 2DNYA 4ECSA 1GMWA 3KJQB 4IOCQ 4LF2A 2VC1A 3MD1A 2I38A 5E3AA 2CQIA 4CLFA 3PZPA 4JOUA 2ROPA 3CJ2A 5E33A 2ZJPQ 3PV8A 2QL7B 3IR5B 3C6TB 1HMVB 2R7SA 4F8RA 4HT5A 2LVWA 2HWTA 1JXLA 4JV1A 3PHTA 4WYWA 4O3OA 4Q5VA 5DGAA 2G4BA 2IY5B 5JUMA 4ZPTR 2G13A 2DH8A 3PR5B 1F3FA 1C4CA 2XWYA 3DRXA 2BE9B 2HKEA 3B54A 4HHJA 4PEOA 2PMWA 4PPDA 5G0RA 5K9FA 2WZ1A 2FLLA 4QYZK 2E7XA 3AD7C 3UN3A 1Y10A 5KG7A 4QIEA 2F4FA 2KXNB 1LFWA 3GSDA 1M5KC 2MKKA 3QPIA 4ICLB 4G3IA 2GVDA 2HQ3A 2ZKUA 2FLOA 5EUHA 4CWBA 4NI2B 1H7WA 4C0HA 1UVIA 1AFIA 1OPZA 2HNYA 4UOCA 5KFPA 2XO7A 3F73A 3DHWC 2YNHA 1QAIA 3BN4A 3POTA 1S6PA 1FI4A 3PJXA 4LRBA 4C8MA 2PE8A 3DC2A 1H72C 3VVTA 3PO5A 4P73A 2UXBF 1JLCB 4WFNQ 4ECTA 2D41A 2DR9A 4AL7A 2GVZB 5KT3A 2J9DE 2QA1A 3DI6A 3I4PA 4PYAA 2BJ8A 2M7SA 5IOLA 4ES1A 3L3CA 4DS4A 2DGSA 4QCLA 4F4ZA 4YUDA 1NB2A 4P7TA 1Q8KA 2DGTA 4CI0B 5JMNA 3M8PA 5HLFA 2WHOA 1CG2A 4OI1A 1QAYA 4DR4F 4GMKA 5GMKa 3TUPA 2YKMB 1LOUA 5E7OB 4ZVUB 4KKOB 5K14A 2XC9A 1LW0A 3Q8QB 2R8JA 3CD6S 3GV8B 3SSRA 1X31C 2JC1A 2ROEA 1IR0A 4F3QA 4ZVRB 2QA4S 1HNXF 3HI9A 1RTDA 3VALA 3Q86A 1HQ2A 2LECA 3OFGA 3F44A 2DYAA 2HS3A 2WSFC 4YY3J 2NQPA 3KXDA 4JP8A 4RBTA 3P45B 3Q8UA 2XMAA 3D4JA 1Y4ZB 3CCLS 3GFYA 3O6QA 1L5UA 1UMJA 3PEJA 4EFAC 5B09A 3CDAA 5H9FJ 1NO8A 4BHQA 1WTBA 1H2VZ 4LFCF 1XBWA 2Y0BB 3VGSA 2FVCA 3N9UC 3FRYA 1EIYB 2QMUB 3KG1A 1IJEB 2FLPA 2OPSA 3W2WA 4ZKAA 1K44A 1IM6A 1RTJA 1RISA 1WC0A 4MYUA 4PCQA 3E8OA 1Y5IB 1H0HB 3DCAA 3KK3A 1S1VA 3R1LA 2K3IA 4I0WA 3TX8A 4P6QA 3F56A 2EC2A 3KJNB 1IBKJ 3THPA 3I5BA 4F3MA 1I51B 2ZH3A 2MTLA 4J9VA 4U67Q 2RS2A 2BKOA 1FX4A 4DUZJ 1U1LA 2ZZTA 4NCBA 1TMJA 3LH2S 5CABA 3MFHA 1ZETA 2MLXA 1B3TA 1B0TA 2HW3A 2B4PA 2EFNA 3PRDA 5DLFA 1FNOA 1H98A 1RBOB 2RF2A 2AJ4A 1KP6A 2CQ2A 2F5GA 2YNIB 3MD3A 4DOZA 4I6YA 5L1KA 1WC6A 1EZZB 2R2RA 2FHJA 3BEGB 3SYZA 4LFCJ 2R7QA 4PXEA 3AD8C 3NBPB 3RBXA 3S8SA 1VK8A 1S1TA 2RAQA 4PAAA 3VQTA 2VPYB 4A47A 1KQGB 5KFIA 2VJVA 2HLUA 4KE5A 3SV3A 5L8RC 4DR7J 4OYWA 5HO4A 2GQCA 2QN6B 3AQPA 1H2UX 3GLJA 3GIKA 5LMNF 3I9ZA 3IG1B 2NUUG 1HD1A 2MZJA 3FSXA 1QM9A 4R5PA 1G6BA 3ITHB 2EKNA 3LP0A 3GJSB 1SIZA 2M3DA 3MEEB 3OFFA 3BO2A 4PRFA 1TAQA 3M1VB 2MZTA 3HF5A 3HVTB 5HATA 1NHUA 2HNZB 3Q2TC 4W90B 4X4PA 5EN1A 1PG5B 1RCXB 3DLKA 5K5MA 5B0DA 2FVQA 4OI4A 3NAIA 3S01A 2IRYA 3H0PA 5F0UA 5IT0A 1IBKF 1QAJA 5D3GA 4HKQA 1CPZA 1WF1A 3OTEA 1VC0A 2C2MB 5LM7E 2H5JB 3KHHA 2CPJA 3A8KA 3LOUA 2EK1A 4W92B 2ZBQA 4H4MB 1X4CA 1JLEA 4X4OA 4X64J 2LQ5A 2F65A 4WK3A 3M05A 4IR1A 2CPXA 4K4XA 4H4OB 1ZPVA 4YEAA 3W64A 4P52A 2IA6A 2HEKA 2K7JA 3D28A 5F8LA 3HHEA 2PA3A 4I2QA 4MK7A 1GNKA 1U45A 2CXEA 2XSJA 1NK6A 1L3SA 3D66A 2AGQA 3CJQA 5G4DA 3TA0A 4DPOA 4ELTA 2MJNA 2E1RA 2ZBIA 4X65J 3N5BA 5F8NA 3TVZA 3CSKA 3I56S 2UVRA 1Q53A 1WC5A 2RVJA 3AOBA 5KFQA 4F2SA 4OYXA 4K4ZA 5HQ8A 4ED4A 2DR7A 4WZMA 1T94A 2KB2A 5SZTA 2VUGA 3SCJE 3ET6B 5AXMA 2J8SA 1OSDA 5T7LB 3J81U 2F63A 2ZBCA 2FDNA 2KM8C 4O4RA 2AU0A 1C1CB 2ACMA 4DWIA 4RU9A 1L3VA 2VQFF 4CTAB 3I6PA 3PTWA 4RNFA 1MN7A 2QLXA 3GYXB 3MM8A 4DR3F 2CJQA 1N32F 3CCVS 1JMTA 2GGPA 4ETZA 3BBCA 1KTQA 1BY9A 3K8VA 3PX0A 2AWZA 2J76E 2PN6A 3FEYB 5FDLB 1RLDA 2WVBA 3HHKA 3W5YA 3KMSA 2IDLA 4IDKB 2DPJA 3ISZA 5JJBA 4DV1F 1S9EB 4IKAA 2XHCA 4KKOA 4KTQA 2MZSA 2A0FB 2MKSA 3HHLC 3CCUS 4DDFA 3RBDA 4G1IA 3I96A 4NLYA 2J9DA 2YKPA 4F2RA 2XI2A 4YQWA 2D3OR 3IWNC 1MWYA 3OXLA 1W7WA 2K1RB 3IN5A 2RNEA 3ENWA 1K0TA 2DXEA 2QTWA 1J2VA 4WU3A 4ID5B 4PWUA 1FRXA 4WJBA 1CS4B 2DNRA 3MCSA 4I68A 1IN0A 1RTZA 2FHJD 1VQYA 4DCJB 4DSJA 5D0RA 4NLPA 2MKJA 3PNIA 1N0VC 3PKYA 1LNQA 2FQQB 1D09B 2VBYA 3EYZA 3HXMA 2J0WA 1UAWA 4LBPA 1AA1B 3CIZA 3VZHA 5DQHA 5L1JA 3PW5A 4FS2A 1KFSA 3PY8A 3MM9A 3AB4B 4WWSA 1I6JA 1QLNA 2BOAA 2VFRA 2XZTB 1GFWB 1X9SA 2OPRA 1WSRA 2I2YA 5KT5A 4DHVA 1Q8BA 1LXNA 2GCFA 4IO1A 4K8RA 4RW4A 1QY7A 5ETOA 2MY7A 5IV4A 1CLFA 3IO1A 4ZVEA 2MQMA 3IG1A 3I32A 1TVRA 2HFNA 2CZ9A 2XS7A 4F25A 4I67A 1S1UB 4QPTA 3A12A 3Q83A 1NCLA 3NGKA 7FDRA 3R2CJ 2LU1A 2EKYA 2GQQA 2GHPA 3CB4A 2I8EA 1VBZA 2HAFA 1N5YB 4O3PA 1R8AA 4B9SA 4A8SA 2MZRA 2AGPA 1YZ7A 3PDNA 4O3QA 4L76A 2RQKA 3B8HA 1SJQA 1SJFA 4OZ1A 1RT1A 3M32A 4RUCA 3L7OA 3MEGA 3OTCA 3QT8A 4X4RA 1PYSB 3MUVP 5CYQA 2K7KA 4DI6A 4DUYF 4M8LA 4DL0C 1U4BA 5D77A 4QIWD 3J80U 1URRA 3J7YI 3KLGA 3OV7A 5DO2A 4ZHRA 2C3PA 4I6AA 3VAIA 1RWMB 4OJ3A 2W8LA 2QLFB 1DTQB 4OL8A 2CPEA 5I42A 3MUMP 3VVUA 1IKXA 2DGUA 2HAIA 1TKZA 1U8SA 4K7QA 3Q8PB 2MSTA 2PEBA 3HT3A 2HNDB 3CJ4A 4BBYA 1R6YA 4QIGA 1H7XA 2JOQA 1V3RA 1T95A 1WHXA 3MGJA 2XM3A 2XCAA 2QFJA 3T5HA 1JLAB 1TKDA 2HFVA 2R4FA 3AY0A 4B9UA 1RAAB 2VHGA 1ZBTA 2LXIA 3HD1A 2IBOA 4TKTA 3MEDA 3SBMA 1MROB 4ATNA 1F9FA 2B5JA 3CJRA 3HD2A 3HKWA 2HRTA 5THWA 3M9OB 1FJGJ 2CNNB 1WTFA 2DH7A 3MR7A 3SDEA 3HM9A 4DV3J 1HI0P 1VQKS 2RS8A 4NLGA 4FKXA 2R8IA 3D3CJ 5CH7B 2CA9A 3R5GA 1VQPS 1ELOA 3W8GA 4ECYA 1WC1A 3EDRB 1WHYA 3VAGA 2Z4PA 1SB6A 3GR1A 3SEOA 3CMES 4IUFA 4ZPDA 1M0SA 1X5SA 3C6TA 1HMVA 3CDWA 2QLWA 3ENVA 4CLTA 1IKYA 1N34F 1S9EA 3P5TL 2OLWA 4UT4A 3TX0A 3M2RA 3G8QA 3ISND 3UDVA 1KBRA 2X1BA 4KGVB 5IS2A 1RA7A 3VGUA 1HNIA 2DGXA 1B7FA 4CTAA 2E5LF 2SXLA 1LWCA 1MW7A 1RT4A 3H4DA 1C0UA 2VOPA 3PEHA 2GGPB 3UPFA 1RU2A 2MGZA 2DT9A 1K73T 1SKWA 4P72A 2KDOA 3IM9A 3MPVA 3NLCA 4NLWA 5D4PA 2P8IA 4DQRA 4B3OA 2NPIA 1ZM4A 4OHVA 2ZH5A 2JHEA 3GCWP 4O3RA 3K89A 3RTVA 5K8MA 3W9IA 2CQGA 1S7HA 2IPOB 3BS9A 3GB0A 3PW2A 1PYTA 3A13A 3M30A 1H73A 4OZ0A 4OYBA 4C6AA 5RUBA 4EYIB 4TYAA 4Y2AA 4JI6F 2VKZG 2HK3A 3NMAA 1TL7A 2B56A 2DRDA 3PO4A 3FFIB 2HHPA 2O01C 4HTIA 4WBFA 2GIFA 2WSEC 3E2EA 4LREA 4KGXB 1UWBA 3G82B 5HVFA 2X51A 2AW0A 4TNOA 3W66A 3V81A 4K0KF 4NLXA 4RW7B 3UDEA 3NWGA 4KC5A 1ZM2A 2KJVA 3H98A 3LWLA 2H54B 3ENAA 3EPIA 3OSPA 4OIXA 5J2NA 2QV6A 1RQ0A 2ZNYA 4YDDB 1XNRJ 3UD4P 2CQCA 1JLBA 4OHYA 4E0DA 1LW0B 1YKWA 4QJVA 4TU7A 2JEJA 5CYMB 1RYRA 1XMBA 2P6SA 4LUBA 1QUVA 3NWRA 4OHXA 4BS2A 1NH8A 2J7UA 2O3DA 2J6SA 1FVQA 4ELUA 3Q22A 3DU6A 2XBPA 5DDRC 1VRTA 2KZMA 4ES3A 2HFUA 4UUXA 1NM2A 3TEGA 1IR1A 4YHHJ 1I94F 3MAAB 4WP9A 4QYRA 2BZ2A 4HDHA 1S6OA 2RRNA 3HSDA 5KTQA 2B4OA 1R8HA 1S0OA 5IM0B 2KTQA 3QGPA 1Q5VA 4RKUC 1OO0B 2NYHA 5CZVA 5KFRA 4DZDA 3ILIA 2MQOA 4ZP8A 3J81j 1S10A 3PJ9A 3IS9A 5KFKA 4KHPF 1VJQA 3MECA 2GV1A 4JBCA 3D1HA 5E3PA 2C3UA 1VHFA 1X0PA 3HZEA 2MZ1A 3BSNA 3HVAA 1FNXH 4WF9Q 2B8PA 2OPSB 3MWBA 4CLSA 4BLGA 2QMXA 3ICLA 2YKQA 4ANDA 3AA8A 3MCOA 2MQQA 4X64F 4CO3A 1RT6B 1RWKB 4QWCA 3OW2R 3QRPA 3ZNUA 3HFKA 1SH3A 2F4VF 3MEGB 1HW9A 1ZAVA 4FN5A 5K20B 3V6HA 4O44B 1TK0A 1EP4A 2IM3A 4KGZB 4OX9J 2HHQA 1YZ6A 2E9ZA 4HR2A 1Q4RA 1S76D 3UW1A 1RT2A 4WP3A 3KHLA 5L39A 4UTGA 4ZS6A 4Z7CA 2OIHA 1TK8A 1NU4A 1O6XA 4WFYA 1BQMA 3OVBA 3UQSA 4X2BA 4IG3B 2GQ2A 4N7TA 3JB9k 4CH7A 1U6BA 3G71S 3RAXA 2OD6A 2V8DA 2FHKA 2AJ2A 2VBZA 2Y1RI 4EUVA 1EKSA 1QUPA 3C46A 1Q1KA 1TKTB 1FDDA 1WG5A 4K4SA 5DZ6A 5IT9Y 3MCNA 1DRZA 3KWMA 1N54B 3ZZPA 1NDCA 2CPIA 2N7CA 3RUBL 2FHMA 4QW9A 2NREA 4C8YA 2RDDA 3ZTOA 5HBMB 5IXUA 1ZYQA 2XTJP 5KG2A 1YJTA 1GXTA 2EG2A 3TYTA 4F36A 3HHLB 3HMJG 1MROA 1RB0A 3CO0P 4FKYA 3UCUP 3VAKA 4ICLA 3KJVB 2FPHX 3U02A 1S49A 3BSCA 3K5NA 3BH6B 4C0BA 2JWNA 4CM2A 4DL6A 4IFYB 1CQNA 1T02A 1WG4A 4FP9A 1FFGB 1XEZA 1HI8A 4NLQA 1JB0C 2YNHB 3WX4A 5D3GB 1V5VA 2LQBA 1H3DA 2WTFA 4CO5A 5GAEU 4K59A 5A8RA 2YKNA 2CZVC 1PC5A 2XMVA 5KFUA 3QGGA 5HVHA 5DZ7A 3BQ1A 4H4MA 1RTIA 4R0JA 2KI2A 4ZDNA 3OD2A 3QYYA 4OZ3A 4DSFA 4JI2J 2ZHOA 4ZIVA 2J6UA 4LF1A 4LF6J 2VONA 1FFSB 3TQ1A 3MI7X 4X66F 4B9LA 1B7YB 1R7IA 1FDNA 1UJ5A 3G87A 3AH6A 4DV5F 2OPPA 2Z0GA 2YWEA 4KV8B 4Y3CA 1SQGA 1YRUA 5C24A 2CG8A 4PG4A 1VJWA 2FD2A 3RZAA 4HEA9 2V8PA 2YKMA 5A0YA 5LSOA 3DFEA 5HN0A 1B99A 3G4SS 5KFCA 3AOCA 2OFGX 3LGMA 3CDUA 3PYFA 1U0HB 4GKKF 3NGSA 1HNVB 4DU8A 4X4QA 3T9NA 2ASYA 3BR9A 3QMQA 1CC8A 2W7OA 2ROGA 2GHVC 2WK4A 1VGYA 4DR1J 2AD9A 3R6LB 2A6MA 1I94J 3W61A 1N5SA 5CYMA 4DV4J 4U8VA 1SL0A 1JKHA 1KKHA 2J9EA 4X65F 5LT5A 3NCPA 2R8KA 2EFPA 4LFBF 4X66J 1OSCA 5DETA 3RJMB 1T9UA 3CO9A 1DURA 3FZ2A 2LU2A 3NEKA 4EU0A 2KYZA 3DLGA 4NZ0A 4HH1A 2LA4A 3BKUA 4USKA 2RHQB 3SCIE 1OMSA 1CSJA 2K3KA 2M4MA 2BA9A 1X9MA 2DH9A 4JV5F 4QBUA 4CNYA 2I1RA 3TJ8A 3IWXA 3Q2SC 3TUIC 1FESA 3QT6A 4UZCA 2BX6A 4HI2A 3VAFA 1PJ5A 1S59A 2FJEB 1FD8A 2FJAB 1S9FA 1RKIA 2WW4A 4DV2F 4DUYJ 4N77A 3MURP 1N52B 2FJBB 1RT6A 2YQ0A 4KFBA 3R9LA 1OYDA 3CUNA 4Y2IA 3RBZA 2ZH2A 3G8TA 4AXJA 5KOXA 1L3KA 2BRLA 2A18A 2J0QD 3MFIA 1SC6A 2V69A 3R5JB 1AFJA 3U7JA 2C2ZB 1TKXA 5I4MA 1Y5LB 4Q44A 2LYVA 3UE2A 4N8OA 1FRKA 5BYSA 3T3FA 3LAKA 3M2VB 4NLTA 1U24A 3IS9B 4QPXA 3PIPQ 2V5HG 1GX6A 3HCXA 5HSPA 3VCDA 2RH3A 1FKOB 1MU2B 3GE9A 3LPEA 4KR0B 5ETRA 3A3PB 2CPHA 2WSCC 2L9DA 4L3NA 1J5OB 2FJDB 4JI4J 4FYYB 2CQ1A 2HHHJ 1V9OA 4MK8A 4ZPCA 3NOCA 1XIQA 2EWHA 2DK2A 3A8JA 4C3KA 4R5PB 5GADU 3MM7A 5GAGI 3IAS9 4ANCA 2PI5A 2MHNA 4PG7A 2K8GA 3CCTA 2YNIA 3H4BA 3V4IB 1AZSB 4FF1A 1NSAA 3BGUA 1KFDA 3NGRA 3ILOA 4NYOA 4C11A 1T05A 1S79A 4W98A 4JI8J 4WCEQ 2OUGA 1UCNA 2B6AA 3BDPA 3IGNA 4X62J 2FC8A 2R7RA 3QJJA 1S1UA 4F02A 4LQ9A 3R3TA 3CDEA 1Z4UA 4ED0A 2IBKA 4D3HA 2AEMA 4I2PA 3KLHB 2AEJA 1EQ0A 2PSZA 4WFAQ 1LV5A 3T19A 1OQ3A 1R8BA 2QG9B 1JLEB 1GAOA 4K2XA 4DSIA 2YXLA 1O0PA 1NPRA 2DHHA 5HJXA 3FDSA 1GMVA 4IFYA 1HYSB 1S0MA 2CQ3A 3HVTA 4ZP7A 3V4MA 3LALA 2VB6A 1HQUA 3BO3A 2D9PA 4M5LA 4ETXA 4N41A 4CLZA 3LUYA 1VBXA 3AA9A 1AUSL 3FZBA 2M5YA 4FZVA 4USVA 4TXSA 5I3UB 3DKDA 1X5PA 2BKNA 3JQJA 4M5KA 4IQXA 4ZN1A 1FE0A 4OI3A 4J90A 1SBRA 2OSQA 3M8ZA 4AD6A 5KG3A 1DTQA 2PIIA 3OTOJ 3D68A 5E5NA 1HARA 1L3TA 2ZFHA 1A9NB 3MUTP 1A0OB 3MPUB 4CYUB 5A76A 4A48A 1P27B 4QU6A 1YBUA 3MMAA 2O1PA 2AT1B 4Y2CA 1LXJA 2LFVA 2H9ZA 4LBIA 3O3LA 2RD5C 4QU7A 3GSIA 2MY8A 3WBZA 3JSMA 2F7VA 4JV2A 1JJ2R 5KFMA 1XTZA 4CZCA 1JLAA 3D7SB 5CA5A 4ED7A 1SQFA 4WKRA 3GIMA 3N6MA 4OI0A 2B4VA 1U1NA 1PSDA 4IG0B 2W24A 4LFBJ 1XR6A 2M9KA 4ES2A 3MDFA 1RWXB 4M5JA 4DV1J 1NNDA 1AUDA 3OPKA 3OVAA 4J9RA 2V68A 3JAMU 5LXYA 2QYGA 4J9KA 2V0NA 1RAGB 5CXTA 4KH1B 2YKOA 4DQPA 3H2LA 4J91A 2W4CA 2R2TA 1R0AB 3IBWA 1DY3A 2VICA 1IKVA 4XDDA 1LEOA 2XS5A 3DYAA 2ZH4A 2NLWA 1YDLA 3CDBA 3NGTA 2CQDA 2DD8S 3DXBA 4X4VA 2HGLA 2M8HA 4J9UE 5KFBA 3QIPB 3V6JA 1V5IB 1VQ7S 1GTHA 2ZE2A 3T1YF 2XY7A 1NKEA 1IWAA 1IKWA 4GC7A 2L48A 1N33F 2HVIA 3FMBA 2N7YA 1HI1A 5BXIA 3FJ2A 3OSNA 1JKHB 1PBUA 4DV3F 1QSYA 3BGOP 1FT8A 1D8ZA 2GVDB 3OTDA 4NPOA 2D3O1 2HGNA 3DLEB 4IYQA 1NK4A 3DU5A 1QTMA 2VG6A 3M8SA 3CT9A 2V8VA 2BACA 1RDRA 2YWFA 3JYTA 2M0GB 4KGMA 2KT3A 4WE1A 4DX6A 2JL9A 3FC9A 1BWVA 1C1BA 1WEXA 4LF8F 2IYIA 3D0GE 1JLCA 3P5BP 1RABB 3M2VA 2GVZA 4CIOA 2IMWP 4ID5A 2HGMA 4F3OA 1E6YB 4EO8A 4RW4B 1FK9A 1S72S 4HDGA 1SUQA 1HPZB 4LR7A 2HBZB 1IVZA 5C2CA 5L1IA 1FJEB 3C6UB 3IP0A 4NXMJ 1JIHA 1X4GA 1FF2A 1GQEA 4LSLA 3W5ZA 5J1EA 3SCLE 2D69A 3ZZYA 5E41A 1FEEA 3KLIA 3MM7B 5HMWA 1TP7A 4TU8A 1Q7YT 5K14B 3R6GB 2JLGA 5ETMA 1NJIT 2PA8D 1AZSA 5HP1B 2JC0A 1N5YA 5KOWA 4M5DB 3HSGA 4ZPBA 2DITA 4B3TF 2F8HA 3I55S 5DJBA 1LWEB 5KT2A 1SI9A 2J0SD 1UFKA 5J2PB 2XLKA 2DJWA 2CUYA 4CLYA 2HIQA 3B4DA 3OBIA 4NYZA 4O4GA 4JI6J 1RHMB 3PRBA 4C8ZA 1RSCA 1V6HA 3GG1A 4QR2A 1RBAA 1VBYA 2YPZA 4K4VA 2ZH1A 1VR6A 1HBOA 4M5IA 3US5A 2WB4A 2J8AA 3BO4A 3J7AN 2PMZD 1K1SA 1VRUB 2HZAA 3D0IE 5KFHA 4ZHRB 1JLQB 2JRSA 5EGYA 5KFEA 4IRKA 2ZJQQ 5ETKA 4LF5F 3TVKA 3UD5A 3DNCA 3H7HB 3WHIA 3G6YA 1WOSA 2HHWA 3NAHA 1VQSA 2EFQA 2W2QP 4DQQA 2XMJA 3GU0A 2E5GA 2ILYA 3H8YA 4S0MA 1K0VA 5KG4A 5D4NA 4EMDA 5HK4A 1R31A 4DSEA 2IVYA 3L7PA 3ONQA 1TMMA 4GC6A 2O66A 3DXSX 4PUOA 4P2SA 2DHXA 3M2UA 4I1TA 3QLHB 4DF4A 2MDAA 1RK8A 4TQRA 3AT1B 5KT4A 1XN9A 2ZNZA 1EB0A 3MEKA 2DNNA 5KAKA 5DM6Q 2F40A 1FHTA 2YQ3A 3WC2A 2MQPA 3LTOA 5LSRA 2UXCF 4HLBA 1N5TA 1F3VA 7AT1B 2YY3A 2UV8G 3GIJA 1XR5A 4DJBA 4AYBD 2F9DA 3PVXA 4B3SJ 1AW0A 3EZ5A 4LF7J 4IRCA 2ZHBA 2OPQB 2VH7A 2C3YA 1T9VA 5I3UA 2DY9A 2E7WA 1SH0A 3PW4A 2HQGA 1SPBP 3R1HA 4ZP6A 2M8DB 4PQUB 4X4NA 4TY9A 2I9SA 5KFLA 2LDYA 3NS5A 5HL7Q 2AJQA 1S1WA 2G0CA 5IV3A 2HS0A 1OYEA 4ECRA 1FWPA 1VFJA 2G9OA 2EI5A 2CJAA 1H2TZ 2OAUA 4LIRA 3BF4A 3H2UB 3ITHA 2ATLA 4B02A 5B0GA 4OX9F 1TL5A 4QR1A 1TL4A 1X9WA 2NXCA 3M1VA 3MMAB 4YS2A 2LQ9A 3T1YJ 1EJ7L 1TL1A 3RR7A 2XMUA 4B08A 1FDBA 4DCOB 2BKPA 2B5JB 3B6BA 4Q45A 1OQ6A 4RNNA 3DLKB 5HBMA 1LWCB 3I9V9 5D6GA 2E5IA 2NZCA 5IQ6A 2BMBA 1T3NA 3X3UA 2UUAJ 2ZHAA 4IRDA 4I6WA 2W01A 4DN0A 2XULA 1VQOS 1ZOTA 1RI7A 2ZM6F 2B9YA 1BQNA 3C19A 3CD0A 5JXSA 2ZH6A 4GKJF 3DDIA 4ZVHA 2JH3A 2E5HA 4B3OB 4PWDB 1IXKA 4RNHA 4W4MA 4DEZA 1XC9A 2V50A 3M6VA 1V3SA 1NSQA 1KONA 1IKVB 1VDHA 1WDDA 3KDNA 3N0VA 4U6PA 2KU7A 4N5SA 4DR6J 2HURA 2WBRA 1FRLA 1UEVA 4WXWA 1UA1A 4L72B 4MKYA 2GFFA 4RU2A 5D8HB 1HHSA 5ETLA 5D78A 4OX7A 3VGTA 4UQGA 1J5EJ 3BGLA 2AP6A 2DO4A 3L7UA 3QO9B 1Q0NA 3VQSA 3PX6A 4OZNA 1T8EA 3DGVA 3QRQA 4RW7A 2PFFB 3FNNA 1CVJA 1RHJB 2GMLA 3MF5A 3MHYA 4EBCA 5F8GA 5U47A 1QSSA 1FO1A 3DMJA 3O5TB 5K8OA 2DHAA 4FVCA 1HD0A 3GJRB 4K5RA 4QIVA 3S1TA 2BDPA 3OL7A 3KK1B 2HMIA 3QSIA 3K7RA 4ZK7M 4OX8A 2C3MA 2DGQA 1JLBB 1FE4A 2HQIA 3IRWP 3C15A 2P2CB 3M30B 1U2RA 1Z2LA 4FPIA 1TK5A 5ETQA 2ABYA 4ZCIA 2Y1IA 1KLMB 2CJYB 2G2OA 1AYEA 1NUEA 4KIAA 2EVZA 3QZ8A 3R8YA 4ED2A 2DO0A 2MYFA 2BJ7A 3PJWA 2XMWA 2HG4A 3H20A 5J2PA 4NZ6A 4G65A 4OFZA 3KUHA 2PC6A 1SJ4P 3MAAA 1SUQB 4WFZA 2HWHA 2Z2ZA 2MB0B 3TNVA 2HVDA 3O2IA 2XMTA 1DAXA 4NI2A 4DMZA 2AZ3A 2MZQA 2XY6A 4L74A 3IC1A 4KT0C 3UVJB 4U8YA 2E1MC 3RRGA 4X62F 2NXJA 2I5JB 5A8WA 4A8MP 2FZCB 1WKKA 2CJBA 4LFAJ 2F4VJ 3M8RA 2COLA 2YQ1A 4B3MF 4X84A 2VQEJ 1DTTB 4K4WA 4FF2A 3SSQA 1TFWA 4CCHA 1GK8A 3FCVA 2MMYA 3QLHA 4O44A 1TUGB 2P5VA 3W62A 5B7WA 3TP2A 4DL2A 3WQPA 1D9FA 3FBEA 4C9DA 1UVMA 3CWJA 1R8PA 1RE1B 1TL3A 1VRUA 2R3VA 2W1BA 4HHUA 1Q82T 2KFZA 3UR0A 4DR2J 3MOJB 4OI2A 4RWWA 3EPGA 1KLNA 4OYPA 2KN4A 1ZM3A 2LEBA 5L46A 2Y1JA 4YMEA 3PG9A 4CH0S 2BE2A 2CDRB 4C8OA 2DVIA 1RJJA 4NASA 2RU9A 2BVZA 2QYCA 2VFSA 3CJ3A 3E01B 3FEZA 3PXGa 2OPRB 3WX8A 1JLGA 4DR3J 4ILLA 6AT1B 4PG8A 1UW4A 1DARA 2GS8A 1YBAA 1VQLS 4NWBA 4IFVB 1ZM9A 1EP4B 1FRHA 1KVKA 1KQKA 3BQ0A 1SL1A 3CCZA 3Q8VA 3NCQA 2BJ3A 1SKRA 2DXDA 3A8IA 4I4BA 3UI3A 1CJTA 3UN5A 4X4UA 4F04B 3AD9C 4LFAF 4KRWA 1S12A 1BQMB 2QSFA 2RUSA 2Z30B 3JTPA 4Y2MA 5I3PA 2CWXA 4DG1B 1S5ZA 5IZHA 3GV5B 4R8UB 1XJWB 3I0SB 3MM6A 2W2PP 3RB3A 1M5SA 3LO3A 4YFUA 3P8BB 5MLCV 1S57A 2FGOA 1QE1B 1YK9A 2LLZA 4RUBA 3TUJC 1YITS 4JYAF 4GVLA 2JNJA 1M1GA 2ZH9A 4HHHA 5L1LA 4V1Ak 4DX8H 4A46A 2RRBA 3OJSA 1WORA 4G1QA 2KVQE 2IYGA 4AXIA 3M9MB 1NMEB 2I6WA 3BSOA 2GO8A 5DDQC 3BB5A 2ZZNA 1SC4B 1PAEX 1YWXA 4K50A 3MAHA 1EX8A 4J37A 4C8KA 2DRAA 2UXDJ 3H59A 3KHRA 4NLSA 1MMLA 1S1TB 1C0TA 3TO8A 1PGZA 4B9NA 2OH2A 4Y34A 1UL3A 5DRKA 1PIEA 2V4QA 1RHKB 3HLUA 3HULA 2KH9A 2X3GA 2HHVA 4Q2MA 4UW2A 5L9NA 2GX8A 2XMKA 5KFTA 1S97A 3BKFA 2Q79A 1AXQA 2EBEA 4RUHA 4K4YA 1HNVA
chains in the Genus database with same CATH topology
1NDLA 3EM1A 1LWXA 4O0NA 1NPKA 1BE4A 1XIQA 3G2XA 1WKJA 3JS9A 1HIYA 4ANCA 3ZTQA 1NUEA 4FKXA 3ZTPA 3ELHA 1MN7A 3NGRA 3Q86A 1NDCA 3BBCA 4W98A 1UCNA 3BBFA 2DYAA 4CP5A 3ZTOA 2HVEA 1HHQA 3Q8UA 2HVDA 2B8QA 3NGUA 1NHKL 1NLKL 2AZ3A 4F36A 3Q89A 1EHWA 4FKYA 3VGSA 4DUTA 1WKKA 3BH6B 3VGUA 4ANEA 4F4AA 3EICA 1W7WA 1K44A 4S0MA 3EMTA 3MPDA 2DXEA 3FBFA 2NCKL 4EK2A 3FCVA 3DKDA 3ZTSA 1BHNA 2CWKA 3FBEA 3Q8YA 3VGVA 3FBCA 1BUXA 1NDPA 3EE3A 5CABA 1U8WA 4C6AA 1PKUA 3EVWA 4WBFA 3WX8A 3EVOA 1B99A 3BH7B 1XQIA 2DY9A 1JXVA 1WKLA 3NGSA 3FCWA 3ENAA 2ZUAA 1B4SA 2DXFA 5CAAA 3Q8VA 2DXDA 1VYAA 1NSPA 3Q83A 1NCLA 1HLWA 2BEFA 1ZS6A 1NDKA 1S5ZA 1NSKL 1LEOA 3B6BA 4KPCA 3NGTA 1F3FA 1S57A 3VGTA 3B54A 3FBBA 4UOHA 4DI6A 3GP9A 5BXIA 4DZ6A 3DDIA 3PJ9A 4UOFA 3BBBA 3ZTRA 3EVMA 3GPAA 1MN9A 2BX6A 1S59A 1NSQA 1PAEX 4UOGA 2B8PA 1KDNA 3EJMA 3VVUA 2HURA 4ANDA 3R9LA 2AZ1A 4ENOA 2VU5A 3FC9A 3VVTA 3L7UA 3ETMA 1F6TA 4HR2A 5IOLA 3PRVA 3FKBA 5C7PA 1NB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NDL A;  3EM1 A;  1LWX A;  4O0N A;  1NPK A;  1BE4 A;  1XIQ A;  3G2X A;  1WKJ A;  3JS9 A;  1HIY A;  4ANC A;  3ZTQ A;  1NUE A;  4FKX A;  3ZTP A;  3ELH A;  1MN7 A;  3NGR A;  3Q86 A;  1NDC A;  3BBC A;  4W98 A;  1UCN A;  3BBF A;  2DYA A;  4CP5 A;  3ZTO A;  2HVE A;  1HHQ A;  3Q8U A;  2HVD A;  2B8Q A;  3NGU A;  1NHK L;  1NLK L;  2AZ3 A;  4F36 A;  3Q89 A;  1EHW A;  4FKY A;  3VGS A;  4DUT A;  1WKK A;  3BH6 B;  3VGU A;  4ANE A;  4F4A A;  3EIC A;  1W7W A;  1K44 A;  4S0M A;  3EMT A;  3MPD A;  2DXE A;  3FBF A;  2NCK L;  4EK2 A;  3FCV A;  3DKD A;  3ZTS A;  1BHN A;  2CWK A;  3FBE A;  3Q8Y A;  3VGV A;  3FBC A;  1BUX A;  1NDP A;  3EE3 A;  5CAB A;  1U8W A;  4C6A A;  1PKU A;  3EVW A;  4WBF A;  3WX8 A;  3EVO A;  1B99 A;  3BH7 B;  1XQI A;  2DY9 A;  1JXV A;  1WKL A;  3NGS A;  3FCW A;  3ENA A;  2ZUA A;  1B4S A;  2DXF A;  5CAA A;  3Q8V A;  2DXD A;  1VYA A;  1NSP A;  3Q83 A;  1NCL A;  1HLW A;  2BEF A;  1ZS6 A;  1NDK A;  1S5Z A;  1NSK L;  1LEO A;  3B6B A;  4KPC A;  3NGT A;  1F3F A;  1S57 A;  3VGT A;  3B54 A;  3FBB A;  4UOH A;  4DI6 A;  3GP9 A;  5BXI A;  4DZ6 A;  3DDI A;  3PJ9 A;  4UOF A;  3BBB A;  3ZTR A;  3EVM A;  3GPA A;  1MN9 A;  2BX6 A;  1S59 A;  1NSQ A;  1PAE X;  4UOG A;  2B8P A;  1KDN A;  3EJM A;  3VVU A;  2HUR A;  4AND A;  3R9L A;  2AZ1 A;  4ENO A;  2VU5 A;  3FC9 A;  3VVT A;  3L7U A;  3ETM A;  1F6T A;  4HR2 A;  5IOL A;  3PRV A;  3FKB A;  5C7P A;  1NB2 A; 
#chains in the Genus database with same CATH topology
 1LK5 A;  2GJF A;  2QL5 B;  1KQF B;  1ZH5 A;  3EM1 A;  3VAM A;  3NCR A;  2V8G A;  4P75 A;  3KLF B;  2MLY A;  4B17 A;  3TAR A;  2WVE A;  2E29 A;  3IMQ J;  1S6P B;  1VQM S;  3GYG A;  1Y7P A;  1SKU B;  3AFG A;  1LWF B;  2XMM A;  4WIQ A;  4YB6 A;  3G96 A;  4OYZ A;  3TAQ A;  2JEG A;  4WFB Q;  4LQ3 A;  2IMO A;  2UVV A;  2JJ4 D;  2HS4 A;  1F2G A;  4KSE B;  4DCP B;  4IOB A;  2Q66 A;  4M94 A;  2QT7 A;  3ELH A;  2PFD A;  2AMC B;  3VTI A;  3L4B C;  3K57 A;  3OL8 A;  2FJW A;  3QFW A;  3KKF A;  4ZCL A;  1VIX A;  3BBF A;  4A8K A;  1BLU A;  2CQ4 A;  1Q8L A;  1EQM A;  3C14 A;  5AE1 A;  1NK5 A;  4C8N A;  2B9X A;  3OJU A;  2ERR A;  1ZTW A;  2W4P A;  4PPZ A;  3E51 A;  3W1Y C;  1EHW A;  1TU0 B;  2N4C A;  2XNQ A;  4JI3 F;  1ACM B;  4XK8 C;  4KQZ A;  3W65 A;  2V67 A;  4DUT A;  4AE5 A;  4FYW B;  3NL0 A;  5T14 A;  2UV8 A;  2P9E A;  3K5P A;  2G0J A;  3EZU A;  1HBN A;  4WPA A;  3DOL A;  5MAO A;  2MKC A;  2ZE2 B;  3MPD A;  3G6X A;  3IGV A;  2UUB F;  3GZ7 A;  1EET A;  2MGZ B;  5HMX A;  1IQT A;  3AHP A;  3LP2 B;  4K2J A;  4ALZ A;  3KLV A;  4JI1 J;  2GIQ A;  5AXN A;  4U7U K;  4ED8 A;  3H5X A;  1RWV B;  1UW9 A;  3RBE A;  1ZPW X;  2CQP A;  2DEI A;  2J9C A;  4AL6 A;  1UVJ A;  4TVA B;  4LRD A;  2XB2 D;  3KHG A;  2BW2 A;  2K06 A;  5KFF A;  3AXK A;  1R27 B;  4IQM A;  4DQI A;  4M63 A;  2B3T B;  2IJF A;  1C1C A;  1APS A;  4LVO P;  1MSW D;  4ZCK A;  3GFH A;  3TAM B;  3GIL A;  4WE1 B;  1Y3J A;  3MTK A;  1B0V A;  2C2N A;  1C1B B;  4O23 A;  4KH0 B;  5ETV A;  5KFW A;  2PT0 A;  2O5D A;  1E6V B;  2WOM A;  3DRP B;  3EVO A;  2AYG A;  3QJL A;  1D9D A;  2DGO A;  2OML A;  3G82 A;  2WVF A;  3CW2 C;  3M6X A;  5LSL A;  2R8G A;  4KB7 A;  1HW8 A;  1WEL A;  2RE1 A;  1SH2 A;  2UXC J;  5EWE A;  1T05 B;  2OTL S;  3SZ2 A;  1IUJ A;  1YSJ A;  5IC6 B;  1FX2 A;  1VMB A;  1WF0 A;  5CAA A;  3M6U A;  1SJR A;  4KJI A;  2PEH A;  1Y3K A;  1NSP A;  2J7W A;  2QX0 A;  2YNF B;  2E9T A;  4F4W A;  1WHW A;  2EC0 A;  2WBM A;  5J2M A;  1NDK A;  1KTV A;  4MAK A;  2QE5 A;  4XIU A;  2C28 A;  1S9G B;  2Y8Y A;  3TQE A;  1KN6 A;  1KHV A;  4NLR A;  2W2N P;  4F7V A;  2R8H A;  3OR1 A;  3H5S A;  1QE1 A;  2FZG B;  3D0H E;  3R97 A;  4J9P A;  4FXD A;  3D1Q A;  1MNE A;  3V4I A;  1W25 A;  2CFX A;  1OWX A;  1M90 T;  3SXL A;  2HWI A;  4ZN3 A;  3IFE A;  3R7B B;  4ZJQ A;  5M2R A;  3CIM A;  2UXB J;  2OI2 A;  5IM0 A;  3FGV A;  4OHW A;  2LEP A;  3HDS A;  3GQC A;  3MEE A;  4LR8 A;  2EW9 A;  4NL5 A;  4TQS A;  1LFP A;  1WNE A;  4M1K A;  3RG6 A;  5CZX A;  2R7U A;  3U27 A;  2FHO B;  3S6E A;  2HNZ A;  4DV2 J;  2W7P A;  3BV8 A;  4B9T A;  3DRS B;  4UUW A;  1U09 A;  3ISN C;  1YJN S;  4WP8 A;  4YN3 B;  5E3R A;  1NAQ A;  2Y8W A;  2VOO A;  3QGI A;  4USW A;  2FZK B;  4K0K J;  3UDC A;  2VU5 A;  1S48 A;  2OFH X;  4EGL A;  2RDI A;  4KGK A;  1D0E A;  2PMH A;  4PUO B;  2KHD A;  4ED1 A;  3W60 A;  1N5V A;  2ILZ A;  2Z56 B;  2W9B A;  5AT1 B;  3TI0 A;  2ZEJ A;  4ECV A;  2LMI A;  3PRV A;  4DR2 F;  4KHR A;  1FDA A;  1S6Q B;  2XI3 A;  4QWD A;  2M2B A;  2HZC A;  1R0B G;  1P1T A;  3N6L A;  3DRR A;  3QWU A;  4LT6 A;  1P8G A;  1RAO A;  2V6A A;  5AJ3 F;  2DGV A;  1QVG R;  2IJN A;  4I2Q B;  4USI A;  4NZ7 A;  5EDW A;  4Y2K A;  4HAC A;  3P49 B;  2HHU A;  4HT7 A;  2ZC4 A;  4QWE A;  2KFN A;  2D1C A;  1WDT A;  1K8A T;  4RBV A;  2APO A;  2HBR B;  2DKO B;  3QT5 A;  2E7V A;  1IJF B;  2QO3 A;  1BQX A;  1NEE A;  5HI7 A;  3W7B A;  4HYK A;  1B64 A;  3KG4 A;  3D1O A;  1AB8 A;  3AJD A;  3TW0 A;  2XS2 A;  2B8Q A;  1GTE A;  1NHK L;  2ZD1 A;  1NLK L;  2VKR A;  4OHZ A;  3CJ0 A;  1BXN A;  3IRX B;  4FNH A;  5DQG A;  5KFD A;  4B3S F;  4FBU A;  1LWF A;  4ILR A;  3TOQ A;  4MTP A;  5K8N A;  3CF5 Q;  3GV7 B;  1KOH A;  3Q24 A;  5ETP A;  4KO0 B;  2E1C A;  2RQC A;  3I5A A;  2CQB A;  1R0C B;  3VHQ A;  5B0F A;  3K0J A;  1NKB A;  4USU A;  4YOE A;  2QFI A;  4F26 A;  3EMT A;  4DL4 A;  4FBT A;  3BYR A;  1Y9O A;  2CQ0 A;  2ZOM A;  2HHT A;  5A8R B;  3LP2 A;  4J9N A;  5FDL A;  3ZZ0 A;  2D3U A;  1U1R A;  1GH8 A;  3BPS P;  2HYI B;  1G7C B;  2ATC B;  1BHN A;  2MEW A;  3SCK E;  3BN7 A;  3T6J A;  3CC7 S;  4B3T J;  5E2Q A;  3R7N B;  5AJ3 J;  1P9Q C;  3Q8Y A;  2YWW A;  4QQB A;  3VZI A;  5KG5 A;  4EZ9 A;  5ETS A;  1N56 A;  1KSP A;  1FK9 B;  3ZXW A;  3TAM A;  4EEY A;  3CMA S;  2OPP B;  1HHT P;  2NR0 A;  1UFL A;  3R5B A;  3ZZO A;  2DNZ A;  2GAG C;  2XYH B;  1PIL A;  3KLI B;  4OI6 A;  3HX9 A;  5E3Q A;  4GKJ J;  1UWA A;  4LF4 J;  5HJY A;  5DDP C;  1ZZF A;  2IAJ A;  4RR5 A;  4USH A;  1A7G E;  1JXV A;  2YWG A;  5KFX A;  1XK8 A;  2OHD A;  5F8M A;  5DG9 A;  2HQD A;  3FCW A;  5G0R B;  4OJG A;  2R2S A;  1WI8 A;  2BQ3 A;  2C2E A;  2OJ3 A;  2YKA A;  3RYL A;  2BYC A;  1HQE A;  3OR2 B;  3IM8 A;  3KK1 A;  1OY6 A;  2A3J A;  3ZZU A;  4O4G B;  2VPZ B;  1KVI A;  1RXO B;  3MOZ A;  4LR9 A;  1WC3 A;  5J2M B;  1RTH A;  1Y5N B;  2AX0 A;  2DIV A;  2Q6B A;  2DNK A;  3PFE A;  1V3Z A;  5B0B A;  3KK2 A;  2J6T A;  1URN A;  4IH5 A;  1HBO B;  1VCT A;  2KG1 A;  4AT1 B;  2YH0 A;  1SJ1 A;  2X1A A;  2WOM B;  1NBE B;  3QAE A;  4KPC A;  2WON A;  3ILL A;  1KS2 A;  2VQF J;  2IJR A;  4UST A;  5A2Q U;  2C2D A;  3NGD A;  1RWU A;  2A2D A;  4P2M A;  3R5A A;  3LF0 A;  4DPU A;  4CH1 A;  2B7C B;  2D9O A;  1FJ7 A;  1ZA2 B;  5B0C A;  2BQR A;  1SQE A;  1YX2 A;  4DUZ F;  1CUL A;  4PR6 A;  4BWJ A;  4OX6 A;  5B0E A;  1ARO P;  2B4U A;  3BBB A;  3OUY B;  1SJ3 P;  3EVM A;  4WTO B;  3GPA A;  5L9X A;  3VR1 A;  3PW7 A;  5D0E A;  1S9G A;  4C48 A;  4JI5 J;  4UOG A;  2XY5 A;  4V19 J;  1BWE A;  2I0X A;  1KDN A;  4MT1 A;  1W2B R;  5IWA F;  2B9E A;  1ZA1 B;  4DX7 A;  4JI1 F;  4AL5 A;  2POK A;  4Q8F A;  2E9R X;  3I4H X;  3RAM A;  4TU9 A;  3OXG A;  4NEY A;  5CYQ B;  5J1N A;  2W9B B;  1L3U A;  2DEJ A;  3NS6 A;  4DR7 F;  1KWM A;  4L75 A;  2W9C A;  2KYX A;  1TL3 B;  1VHI A;  2AF6 A;  3D6F B;  1VOM A;  3CNQ P;  4HI1 A;  4PQU A;  9ATC B;  4ECZ A;  1TZ0 A;  2ZWP A;  2HZV A;  1AT1 B;  3U1M A;  3PR4 A;  3KOA A;  3TJA A;  3FSI A;  4FYX B;  1MU2 A;  3EUN A;  1RAI B;  4M5N A;  3IXQ A;  4G1P A;  3EXY A;  1LW2 A;  2RRA A;  2H4Y B;  2VDI A;  3G2X A;  1VRT B;  1HL6 A;  2AKW B;  4PYD A;  4JV0 A;  2RT3 A;  1SKS A;  2VPX B;  2CPD A;  3W5X A;  4WII A;  3SQG B;  5A6P A;  5BYQ A;  2HFZ A;  1NB7 A;  1Y00 A;  1TL1 B;  3CGI A;  3BQ2 A;  2BUN A;  3CJK B;  3TAP A;  4C11 B;  4M95 A;  4KPY A;  1HBM A;  1GXU A;  3PYD A;  1S6Q A;  2V94 A;  3JTN A;  5DS7 A;  3CXC R;  3CVK A;  4FXW A;  4B3R J;  2DPI A;  3IRX A;  1WI6 A;  3KLH A;  2C2K B;  2OEJ A;  1UFW A;  2C1E B;  2ZVI A;  4B9V A;  3Q89 A;  2AEF A;  3I0S A;  3MM6 B;  5A8K A;  3SFU A;  4JUZ A;  4KYZ A;  5JVG Q;  4PWD A;  3X1L B;  1SV5 B;  2CDQ A;  5J2Q A;  1NK9 A;  4N76 A;  4NLO A;  1Q7L B;  2LA6 A;  3D6M B;  3G9C A;  3EIC A;  4YR3 A;  1HYS A;  3DN9 A;  5AXL A;  4MIA A;  2FIU A;  3PYE A;  2DRB A;  3FBF A;  1F5B A;  1X4D A;  1GMU A;  1A6L A;  1HQU B;  5E3C A;  2JVO A;  5HVG A;  2XO6 A;  3KNA A;  2R7T A;  3TVY A;  3SQO P;  2IC3 B;  4KBI A;  2WRM A;  4NEZ A;  1O51 A;  4AQY J;  2V2K A;  4ECW A;  1RWO B;  1MMD A;  3THT A;  3PCO B;  1YLX A;  3M8W A;  4BC9 A;  1UZD A;  3IBF B;  3T6B A;  5HQM A;  1VC6 A;  4C97 A;  4TLR A;  1BUX A;  1NJZ A;  4DS5 A;  2CPY A;  4ZVG A;  3H5U A;  4FF4 A;  2JSX A;  1C0U B;  3BM7 A;  2HNY B;  3C2P A;  2FY8 A;  4CYU A;  3HSJ A;  4LF8 J;  2XEX A;  1SL2 A;  2HHX A;  2HIY A;  1PCA A;  3U1L A;  5FD1 A;  4LJM A;  4ID8 A;  4DSK A;  1WF2 A;  2QL9 B;  2AYM A;  4NYP A;  2ADB A;  4Y65 A;  1P9Y A;  2V9K A;  3D9B A;  2W7A A;  1WKL A;  2KRR A;  1HBU B;  3LAM A;  3LGN A;  4DLG A;  4B3R F;  4CLK A;  5KFV A;  4C4W A;  2LEA A;  1HQE B;  3OR2 A;  3B82 A;  4NXN J;  1Q5Y A;  2UUW A;  3D54 A;  8ATC B;  4ZPW R;  2VA3 A;  1T11 A;  2XWX A;  1WOO A;  1N4L A;  1RTH B;  2H65 B;  3ETO A;  3OFE A;  4EI2 A;  4NLV A;  2WAQ D;  5KFN A;  4LRC A;  1CJK A;  4FF3 A;  3M4X A;  1NSK L;  4XPE A;  4DU7 A;  3JQK A;  1Q79 A;  4NCG B;  1SC1 B;  3C15 B;  5KFS A;  4RW6 A;  2CVI A;  1FXD A;  2EK6 A;  4DLE A;  1KLM A;  4MKB A;  1B70 B;  2A1B A;  3G6V A;  3LAN A;  4O3S A;  5EWF A;  3FBB A;  3O8W A;  3P3D A;  1HWJ A;  3IBC B;  4TLQ A;  4NOH A;  1LKZ A;  4N56 A;  3BYP A;  2DTJ A;  3QWP A;  2OD4 A;  4UOH A;  2HHH F;  3PKM A;  1IKW B;  3DRY A;  2LXF A;  4GO5 X;  2FYX A;  3BGR A;  3GP9 A;  1S77 D;  3KMQ A;  1D9A A;  2YPY A;  4NX9 A;  2F9J A;  5CD4 H;  1U26 A;  1TV6 A;  4PXD A;  1FCA A;  3PFO A;  1KHW A;  3OLB A;  1OS5 A;  3A1Y G;  3TWZ A;  3ZZZ A;  3BJY A;  2XZD B;  3ET6 A;  1YJR A;  2VFT A;  1BMQ B;  4U96 A;  1N6Q A;  3M8Y A;  5IT4 A;  5L38 A;  5JVH Q;  3NOG A;  1Q8I A;  4WFX A;  4D3G A;  2BR0 A;  4LMZ A;  1REV A;  4NRU A;  2N3L A;  1HR0 J;  2W2O P;  1O5J A;  2BQU A;  3MM8 B;  4H4K C;  3BSA A;  2W9C B;  2QA2 A;  4JI3 J;  2XG8 A;  2N4D A;  3MXH P;  3W2V B;  5C7P A;  1YBT A;  1F9H A;  3MEC B;  4IFV A;  2MPU A;  4IH6 A;  1IBC B;  1RGV A;  1HPZ A;  3SMZ A;  1S0N A;  4KHM A;  1WHV A;  4O0N A;  1S0V A;  2YVS A;  4CO2 A;  2WVC A;  3KUG A;  1DHM A;  2AJ1 A;  2Z2L A;  1NPK A;  1RHQ B;  4OZ5 A;  5LL6 d;  1YJ9 S;  2VOD A;  4DBQ A;  1E6V A;  2Z8Q A;  3TZW A;  2QSW A;  1RAE B;  3B78 A;  4P2F A;  1FRM A;  3FRZ A;  3SQG A;  2V9W A;  1XMQ J;  2HSE B;  4Q0B B;  1QD1 A;  5F8J A;  2E5L J;  1QSL A;  3DM2 B;  2QLJ B;  4PXB A;  2K1R A;  2RJZ A;  4KY3 A;  1R6V A;  5C42 B;  1JLG B;  4YR2 A;  1LWE A;  1RU1 A;  4FDF A;  3S7R A;  3DDK A;  2XQC A;  1NK8 A;  3DGP A;  4WTY A;  3HP6 A;  3TAN A;  2VD3 A;  2KT5 A;  2H5E A;  1H6K X;  1CS4 A;  2OSR A;  4YP3 A;  3J7Z 5;  1UJ4 A;  2P9G A;  3C16 A;  4Q43 A;  2VIH A;  1Q95 G;  2M70 A;  3SI8 A;  1YTY A;  1YIJ S;  1LW2 B;  4C7Q A;  1REG X;  1ZTT A;  2UP1 A;  2G0I A;  1FJG F;  2K2P A;  1KRP A;  3BZQ A;  3IR7 B;  4J9Q A;  5DG7 A;  3EGN A;  1PBA A;  1XWL A;  1X4H A;  4KFB B;  4DSL A;  2JLF A;  4DG1 A;  5F8H A;  3H90 A;  1N0U A;  1QAX A;  4NLD A;  4F0K A;  3CJK A;  2RU3 A;  4USJ C;  2VAS A;  4NA1 A;  1TKX B;  4A8W A;  1HKA A;  2YH1 A;  3MMB B;  3T5J A;  1UPP A;  3EGW B;  1UVN A;  4C3L A;  1S4F A;  3NKY A;  2C2R A;  1OJ4 A;  4Z7Y A;  3H42 A;  4ZMM A;  1U49 A;  2R42 A;  3RR8 A;  2F8M A;  2ALZ A;  3N5F A;  3GYN A;  1DQ8 A;  1HWK A;  1DFD A;  2LXU A;  5HMZ A;  7FD1 A;  1PC4 A;  5H1S V;  1NPP A;  4USM A;  2BJD A;  2KKH A;  3I0R B;  4M5M A;  2FTR A;  3D2W A;  4MIW A;  2IVF B;  2ZH8 A;  2ZIT A;  1SV5 A;  3ADA C;  2GJ2 A;  3K59 A;  2DHS A;  3GWC A;  3TA2 A;  1S6U A;  3BDE A;  1J5E F;  4RX6 A;  4I69 A;  2JZ5 A;  3W9J A;  2BAN A;  2XHW A;  3I31 A;  4MKA A;  2V8H A;  2OPQ A;  1VK3 A;  4ZVF A;  1VQ6 S;  3CCQ S;  2KJW A;  1WEZ A;  1YJ7 A;  4OJH A;  2JFK A;  2KG0 A;  2HQC A;  2RB7 A;  2PO4 A;  3KNG A;  2FY1 A;  1NJW A;  2AIR B;  4JI7 F;  5D0G A;  2ZUA A;  2CJK A;  1T9T A;  5D15 A;  3CCW A;  1RYS A;  2FVR A;  1SXL A;  5BR8 J;  1S1W B;  3TZX A;  2Z2Y B;  1VYA A;  4LF9 F;  3C14 B;  2VL1 A;  3NY0 A;  3DOM A;  1HLW A;  5M2U A;  3ZZT A;  5DQI A;  3GIR A;  3KLF A;  5D4L A;  2VG5 B;  2DIS A;  1RAC B;  3KJF B;  5A0Y B;  3MPW A;  2HRY A;  3TJ9 A;  1FEH A;  1MWZ A;  1NXI A;  4RW6 B;  3LWM A;  2UVW A;  4CNZ A;  3RB0 A;  2HHS A;  2H5I B;  2E44 A;  1KR4 A;  1DQ9 A;  1JLF A;  4LSZ B;  5EHH A;  3PYG A;  1U0H A;  2HK2 A;  4LBH A;  3OTB A;  1HBU A;  4WU2 A;  3VV2 B;  2VPW B;  5ADZ A;  4YB5 A;  4DL7 A;  1M5H A;  3FQL A;  3MCM A;  4AUK A;  1GX5 A;  2IIH A;  4ECU A;  3T5K A;  5HRO A;  1U1K A;  5AXK A;  3BGR B;  1HNZ J;  4ZVQ B;  1U6Z A;  2RQM A;  3UN2 A;  4DZ6 A;  2ASL A;  3T41 A;  3OHA A;  1U47 A;  2BE7 D;  4GVB A;  1ICE B;  1RHR B;  1X4A A;  4C2M A;  3Q8S B;  1JJ4 A;  1U48 A;  2Y3Y A;  4N8N A;  3K2Y A;  1UKU A;  3L09 A;  4OMF G;  2ZH7 A;  3TZZ A;  4WZQ A;  4XAK A;  5ITH A;  1W2I A;  1CJU B;  5C25 A;  4ZLJ A;  4ED3 A;  5EWG A;  4PQA A;  2C2O B;  1JQG A;  2FUG 9;  2V34 A;  1RT7 B;  2ZM6 J;  4IG0 A;  3QO9 A;  2V4J B;  4Q7A A;  3RB4 A;  2A6O A;  2ASD A;  5IC4 B;  4LF5 J;  3CMQ A;  2QRR A;  3I82 A;  1TV6 B;  2VZ9 A;  4NA3 A;  3J7Z T;  4ED5 A;  2AV5 A;  2ZKT A;  3FCH A;  3U1N A;  5LMU J;  2A2C A;  2PGC A;  3NNH A;  1XMO F;  5B08 A;  1Q78 A;  2KRB A;  2VBW A;  3CE8 A;  3DMJ B;  2VJU A;  4ZJL A;  4ZIW A;  4ER8 A;  2BW7 A;  2LQJ A;  3UFC X;  4PAB A;  1HNZ F;  5EX3 A;  1M5V C;  1T0T V;  3M2R B;  1VQ8 S;  2GAH C;  2L41 A;  3ZO7 A;  4CO0 A;  1QJH A;  3JSR A;  3ZTQ A;  4WKY A;  4Q0B A;  3MM9 B;  1Y0H A;  4CLL A;  4J5O A;  1P6T A;  2OMO A;  4CLW A;  1NZ8 A;  4LSN A;  3ZC4 A;  3HZG A;  3UCG A;  4I56 A;  5J1P A;  4P10 A;  3GON A;  4OYO A;  3DLL Q;  3DGP B;  4CP5 A;  2GJI A;  6FD1 A;  1RT5 A;  2GNK A;  5F8I A;  1C4A A;  2B43 A;  1M1K T;  3BKT A;  4CRJ A;  3C16 B;  3NGU A;  1IQZ A;  4MKV A;  1VIS A;  2EFO A;  2IRU A;  2AHO B;  3AJ1 A;  2H48 B;  3V2U C;  2RDJ A;  1FD2 A;  2DR8 A;  2DNH A;  3UNY A;  1EAR A;  1U6F A;  2VFV A;  2VG6 B;  4ZVO B;  2Y9H A;  4U7U D;  1YJV A;  3CCE S;  4E98 A;  5HMY A;  2NS1 B;  3KFW X;  3DDN A;  3TZY A;  3NP5 A;  1B0P A;  3Q8R B;  3K17 A;  1IBL J;  4FYD A;  4YB7 A;  3WIU A;  1CQM A;  2DNG A;  3DRS A;  3FFI A;  3MMB A;  3EGZ A;  3KK3 B;  4P7V A;  3DLB A;  3BRE A;  2C42 A;  3HKZ D;  3J81 Y;  2NSC A;  1JJH A;  3KUE A;  2DY1 A;  3PIO Q;  1TFY A;  1PJ6 A;  2OEL A;  4J7C A;  5F41 A;  2FJX A;  1S1X B;  2CYY A;  2EFG A;  2JVR A;  3VAH A;  4EBD A;  3T1H J;  3I0R A;  4GKK J;  1S99 A;  2CWK A;  3C6U A;  1WEY A;  4BCA A;  1UZH A;  2DB1 A;  2FLN A;  2U1A A;  3FBC A;  2IM1 A;  4LRA A;  2IM2 A;  4DR1 F;  2QZ8 A;  4MYT A;  1MLA A;  4DL5 A;  2XZW A;  2RF2 B;  3OLA A;  4DQS A;  3V6K A;  1U1M A;  2CZ4 A;  4JI0 F;  2X3D A;  1JNZ B;  1PKU A;  1U2C A;  2IDE A;  4GRS A;  5DG8 A;  4DR4 J;  3CCM S;  1HA1 A;  4DFM A;  3NBP A;  4LVN P;  3D3B J;  3CJ5 A;  1YGY A;  4PXC A;  5HQL A;  1N36 J;  4U95 A;  2JEF A;  1TEL A;  4JI2 F;  5KG6 A;  1RT3 B;  1X7V A;  4YB1 P;  5IQQ A;  1XR7 A;  2HRU A;  2KXH A;  3B4M A;  3OL9 A;  3J7A 1;  2LDI A;  1GXL A;  3SFG A;  3Q0A A;  2Y1L B;  3L95 X;  4MIB A;  2NXE A;  5GAG U;  1IM4 A;  4NRT A;  4P71 A;  2KFY A;  2CJ9 A;  3EX7 B;  1UP1 A;  1WD6 A;  4XO0 A;  2NZ4 A;  4RW9 B;  3CC2 S;  3GJT B;  3JSY A;  2NUH A;  4RW8 A;  3AXM A;  4XDC A;  1X0F A;  2RIL A;  1YI2 S;  2AX1 A;  4YHH F;  4HAC B;  3HVR A;  1KNZ A;  1TTH B;  2DR6 A;  1QTN B;  2BRK A;  3LA0 A;  2HVH A;  1HFE L;  4P74 A;  3M2U B;  2PI4 A;  3TRG A;  2M88 A;  1FFW B;  2MJU A;  2J5A A;  1HWI A;  4UY8 5;  2HFS A;  4OYM A;  2MQN A;  4FYV B;  3WDO A;  4DXL A;  4ZCM A;  5DDO C;  4QWA A;  5A8K B;  3RB6 A;  4OLO A;  5KT7 A;  4C3M A;  4DFJ A;  4F0M A;  3ZTR A;  2RKI B;  4H4O A;  3DLJ A;  2ZD1 B;  1MN9 A;  4DV0 J;  2UU9 J;  1XNQ J;  2QA4 G;  1R0A A;  2R7X A;  1WWH A;  3OVS A;  2X1F A;  3P6Y C;  3HFV A;  4ED6 A;  5B0A A;  3EJM A;  1VQN S;  2R7V A;  1G3O A;  2V2Q A;  3CCJ S;  1CJU A;  5C25 B;  4ZPV R;  2DCU B;  4EO6 A;  2R9L A;  3MZI A;  4J9M A;  3VAJ A;  2L08 A;  1TKT A;  4HVZ A;  5LMU F;  1JNR B;  4A8X A;  5H9E J;  4Q2L A;  3R2D J;  2HQF A;  3HJV A;  1P1L A;  4ELV A;  5ETT A;  4DL3 A;  2C3O A;  1F2H A;  4DPX A;  3C3L A;  2FB0 A;  2IAJ B;  3HHL D;  1X60 A;  4CQ1 A;  4NA2 A;  1CEZ A;  1DQA A;  3QID A;  4DV4 F;  1HNW J;  1X4E A;  4OZ2 A;  2B0G A;  4RWX A;  2KM8 B;  3W8P A;  4BC7 A;  2XLI A;  2IHR 1;  2UXD F;  5FII A;  2ZBR A;  2VDH A;  2OO4 A;  2Q3P A;  3R27 A;  4U7C A;  3JS9 A;  2MHE A;  1YJW S;  3MR2 A;  3CED A;  2LP4 A;  2V63 A;  1SCJ B;  2J0X A;  4X4S A;  4JI5 F;  4OJ1 A;  1ITP A;  1N48 A;  1T9Y A;  4FNI A;  3K58 A;  2G2Z A;  2ZBP A;  3GMG A;  3M8Q A;  2QMW A;  4P2X A;  1U02 A;  5BR8 F;  1T7P A;  2XNR A;  1ZAW A;  4IOA Q;  5KT6 A;  4PZV A;  3QZ7 A;  1VC5 A;  4OV6 A;  1RTI B;  2KO1 A;  1X8D A;  2CNO B;  2YX4 A;  5AE3 A;  3MM5 B;  4IDK A;  4BDP A;  2XCP A;  4L73 A;  5F9N A;  4LSL B;  3OQ2 A;  5J1E B;  1CJK B;  3KLE A;  2D7S A;  1YVF A;  1CUL B;  3FQK A;  3JQM A;  2IFX A;  4NCG A;  4ZA1 A;  3IAM 9;  2H3E B;  1OIA A;  1D1U A;  2MXY A;  4ANE A;  3RU0 A;  2GW8 A;  2ZDO A;  4EYH B;  3MR3 A;  1F1B B;  2QJ3 A;  5T41 A;  1Z1Z A;  5C24 B;  4J9L A;  3Q23 A;  3WIV A;  5ETN A;  5KG0 A;  2CNK B;  4CO1 A;  4DR5 F;  2WON B;  3DI6 B;  1KD1 T;  9RUB A;  3ZFV A;  2GZO A;  4KAI A;  1R89 A;  2OKQ A;  3M8P B;  4UQT A;  2W8K A;  2H4W B;  2RIJ A;  5HLF B;  2HMI B;  3SIP B;  2L9W A;  3UO0 A;  1U1Q A;  2PDA A;  4LF6 F;  1N33 J;  6FDR A;  3POT B;  1NDP A;  4O3N A;  2VG7 A;  4DFK A;  1RCO B;  1PYO B;  3D5M A;  3K5O A;  5H9F K;  4EWT A;  4Y28 C;  2UZA A;  4Y0F A;  2UUB J;  1KQS R;  3R5C A;  3QJP A;  3DRP A;  3MAQ A;  1Q86 T;  2JFD A;  3HHD A;  1S1X A;  3GCX P;  1LK7 A;  5CD4 A;  1TR0 A;  2DNL A;  1VRQ C;  1IBM F;  4UY8 T;  2DXF A;  1X5T A;  1DLO A;  3OTO F;  1R3N A;  2GMJ A;  1M1H A;  2GIR A;  2RHS B;  2ADC A;  2Y0S D;  1WSV A;  2DNP A;  5KFZ A;  4KHP J;  2B9W A;  3E3X A;  3NG8 A;  4TYB A;  3PHE A;  1ZS6 A;  1LQ9 A;  3TEH B;  4IG3 A;  4MJK A;  2CJX B;  4DV7 J;  2L9N A;  4OQJ A;  4YDX A;  4C0O C;  2WW8 A;  5LJ3 Y;  5GAH I;  2QGF B;  2RQ4 A;  3OR1 B;  1F60 B;  3TR5 A;  2W25 A;  4FPR A;  1O8B A;  1SVD A;  4CLP A;  3KYL A;  1RKJ A;  1KVJ A;  4AQY F;  1BC6 A;  1XNQ F;  2IM0 A;  1FRI A;  3HSZ A;  3IA0 A;  4UZB A;  3ENQ A;  4IR9 A;  3TA1 A;  3IWL A;  2DHG A;  3MMC A;  2ZOG A;  2R7W A;  2Q6C A;  1FXR A;  2IC3 A;  1N34 J;  4JB8 B;  1M5O C;  2NYI A;  4R0E A;  2AJ0 A;  2ZVS A;  1IBL F;  3I5C A;  3HHL A;  3EZO A;  2CRL A;  3LP1 B;  3ULH A;  2HLT A;  3HPO A;  4DR6 F;  2CPF A;  2XGP A;  2H1Y A;  4WYL A;  3E01 A;  4U9R A;  2FC9 A;  4ZVS B;  3KJV A;  4DF8 A;  2AZ1 A;  2Z58 B;  2N82 B;  1S7I A;  4NMX A;  1RA6 A;  4O0I A;  3GFZ A;  3BPD A;  4YY3 F;  2ZOF A;  1FWK A;  4G6V B;  4DPT A;  3T5L A;  1VLO A;  3O44 A;  4F67 A;  5LXR A;  3A3O B;  2GA7 A;  2XYP B;  1IBM J;  2Z2M A;  5D4O A;  2CNL B;  5D0H A;  1NK0 A;  1G2E A;  4C8L A;  3QRR A;  2BBE A;  1X5O A;  2RKI A;  1NDL A;  5CQG A;  3H2V E;  4OLP A;  4Z37 A;  3SV4 A;  3DRR B;  1FTC A;  1R8C A;  2CG4 A;  3HJF A;  4DV7 F;  5KG1 A;  4JI4 F;  1WUU A;  3R7S B;  4DFP A;  4IH7 A;  1FA0 A;  1T3O A;  1WKJ A;  2HBY B;  3AOA A;  4P9S A;  5CHC B;  4QW8 A;  3SDE B;  4E8U A;  2VV5 A;  3JAM Y;  1RWP B;  5K8P A;  4RNO A;  2JEI A;  2BV3 A;  2MKI A;  3ZTP A;  1XMO J;  3T1A A;  1YRX A;  2GMH A;  3M8Q B;  2D3Z A;  3EDQ B;  1IWG A;  2ZZM A;  4GO7 X;  3FK4 A;  1RAJ A;  4G1Q B;  1OPI A;  3GG0 A;  4OYI A;  4RPF A;  2EXU A;  3AAW B;  2Q43 A;  1HHQ A;  5DM7 Q;  3NNC A;  3DOM B;  3HT0 A;  4AFF A;  2CAD A;  2CQH A;  3CUL A;  1RWN B;  1KEK A;  2XLJ A;  1F9E B;  1XNR F;  1F5C A;  3D6T B;  4L3K A;  1N88 A;  1K9M T;  5KFA A;  1CBK A;  2M52 A;  1D3W A;  1HNI B;  4HL9 A;  2BM1 A;  2XSJ B;  1FKP B;  3GFX A;  5GAE I;  3HK2 A;  1C0T B;  1NH7 A;  3CC4 S;  4NCA A;  1QDU B;  5KFJ A;  2CPZ A;  4TY8 B;  3J80 Y;  2HFO A;  3QNW B;  1JXE A;  1NRK A;  2CKW A;  4CM0 A;  4RO0 A;  2OEK A;  2FGC A;  2D74 B;  3MM5 A;  4RBU A;  4GVB B;  1MWQ A;  1DZ5 A;  2MQ8 A;  2AGO A;  4NXM F;  2OTJ S;  3CJ8 A;  2EEY A;  3VF0 B;  3W2V A;  3VGV A;  5C5J A;  3CCS S;  3WZ0 A;  2QEX S;  4ECX A;  2I5J A;  1YQH A;  4WXO A;  3CD5 A;  5A8W B;  5LJ5 Y;  4QIF A;  1JWW A;  1VQ4 S;  1UVL A;  1YJU A;  4ZIT A;  1NK7 A;  1VBK A;  1G1X A;  2VFU A;  4XTT A;  3CCR S;  1UEU A;  1DTT A;  1UWB B;  1RT7 A;  1M5P C;  1JK9 B;  4ITS A;  3V81 B;  3PX4 A;  1N6Q B;  2Z57 B;  1KOO A;  5FLX Y;  2W9A A;  1RP5 A;  1REV B;  2P9C A;  4F0H A;  5KFO A;  2G1D A;  3G6E S;  4ZJO A;  1J27 A;  4JI0 J;  3JXO A;  2GC8 A;  5J2N B;  3QIP A;  1DLO B;  2BJ1 A;  1B4S A;  3N01 A;  5GAD I;  5DLG A;  5KFY A;  3LGH A;  2BM0 A;  3DHX A;  2F3J A;  2VG7 B;  3LQV A;  4M5H A;  3OL6 A;  1R43 A;  4OZJ A;  1IR2 A;  4K4U A;  1RAH B;  2YWH A;  2BEF A;  2DBB A;  1GEH A;  1J5O A;  2G2Y A;  2BE2 B;  3NRB A;  4UF4 A;  1TUW A;  1CC7 A;  2KT2 A;  4MFB B;  3KK2 B;  4K5S A;  3M9N B;  3DLE A;  3PW0 A;  1YHQ S;  3DOK B;  2LCW A;  2UUA F;  4MMO A;  1EET B;  4CT9 A;  4L6V 3;  4XPC A;  5H9E K;  4F4X A;  2RUG A;  2DCL A;  1I5O B;  3V6D A;  3W2W B;  2QIF A;  3MPY A;  1NJY A;  3CPW R;  2EFV A;  5C42 A;  1XER A;  2GHW A;  1GMW D;  2KVI A;  2VBX A;  4QWB A;  1CJT B;  4H4K A;  4PWW A;  4CDI A;  2ACY A;  1E6Y A;  1WOP A;  5C2G A;  2VA2 A;  4Y00 A;  3RW6 A;  3QFH A;  4JI7 J;  2A10 A;  3D6H B;  3LP1 A;  1RZM A;  1T03 B;  1OY8 A;  4OV1 A;  4URS A;  2EBG A;  2KZZ A;  3OFH A;  4K4T A;  8RUC A;  3J7Y U;  2XGQ A;  2C22 A;  2KL8 A;  2V2V A;  3THV A;  3A3N B;  2IVM A;  4LF4 F;  3M6W A;  2NXN A;  5HP1 A;  2QC3 A;  3TUZ C;  2VQE F;  2XSF A;  3RGI A;  4M5D A;  2ASJ A;  1TVR B;  1F6T A;  1WJ9 A;  3QAT A;  4URG A;  4X4T A;  5FJ4 A;  1PAU B;  4LF9 J;  4J9S A;  1U25 A;  1VS3 A;  4HTJ A;  2YWK A;  3WC0 A;  1QVF R;  2WB1 D;  2YNF A;  1FKA F;  1U7L A;  3NS7 B;  1H74 A;  1HNX J;  1LWX A;  3QQC D;  1W26 A;  5IWA J;  3K5L A;  4JV5 J;  4Z2X A;  1ZZN A;  4PKD B;  3LP0 B;  5M2P A;  5BYR A;  2WCX A;  4QZV B;  4I64 A;  3NNA A;  5F3Z A;  1RT3 A;  4I7F A;  4F4K A;  2V2Z A;  5AE2 A;  3MMJ A;  3H40 A;  2FVS A;  2DNM A;  1RLC L;  1FRJ A;  1S4E A;  2NXU A;  2W2M P;  3ILJ A;  4ZLL A;  5CCL A;  1I3O B;  4EBE A;  1HWU A;  1OY9 A;  1UJ6 A;  2BAB A;  3FVY A;  3H5Y A;  3EGV A;  1TQL A;  2BXJ A;  2HVZ A;  3KG0 A;  3O1L A;  4OZL A;  5HRO B;  2XYG B;  4CLU A;  2YX1 A;  3G86 A;  1UET A;  8AT1 B;  1N5Q A;  4CT8 A;  3LW5 C;  1NZA A;  2N3O A;  4RW9 A;  4NML A;  1DBD A;  4URQ U;  1UVK A;  4RLE A;  5GMD A;  3L9Z A;  3QBC A;  4CO4 A;  1SIW B;  1T9X A;  1IKX B;  4A8O A;  1FKP A;  3AOD A;  3NXZ A;  3W3S A;  3NMR A;  3F0N A;  4A4J A;  4F4A A;  1U2F A;  5J2Q B;  1TKZ B;  2VG5 A;  2YX7 A;  3FSY A;  4FS1 A;  4N47 A;  4YR0 A;  2JLE A;  1RT1 B;  3M32 B;  5CCM A;  4HH0 A;  3QSY B;  2ZWO A;  3A8E A;  2YKN B;  3DLH A;  1Y11 A;  3DYA B;  4MK9 A;  4TY8 A;  1YRT A;  2F1F A;  1JLF B;  2H51 B;  5GVQ A;  1PO6 A;  1Q16 B;  1VQ9 S;  1FJC A;  3UNG C;  1MG7 A;  4C98 A;  1WG1 A;  2CAJ A;  2KXF A;  4EK2 A;  2OEM A;  4ZPA A;  3R5D A;  2KHC A;  3MR6 A;  2J7K A;  1FVS A;  1Q81 T;  1N32 J;  1YG0 A;  2EG1 A;  3AB2 B;  3K5M A;  4RUA A;  4DR5 J;  2UUC F;  1SC3 B;  2DIU A;  5I42 B;  3C66 A;  2IA0 A;  4ECQ A;  4KV8 A;  1Z2Z A;  5F0W A;  2X1G A;  3JTO A;  3BGF A;  5F3T A;  3UD3 P;  3N79 A;  4DX5 A;  1CJV B;  1HBN B;  2YNG A;  2YTC A;  2HND A;  3DOL B;  5T7L A;  4RNM A;  5GAH U;  1FTR A;  2PD1 A;  5LMN J;  1VLY A;  1RAD B;  1G4C A;  1XQI A;  1UA0 A;  1BGX T;  5EX0 A;  3RAQ A;  3GR0 A;  3JYT B;  4V19 X;  3H25 A;  5KFG A;  4LSN B;  3VWS A;  1IKY B;  2JDJ A;  4EZ6 A;  5SUH A;  3RW7 A;  3ZZR A;  2V4J A;  4RJV A;  1UEK A;  2MKY A;  2OGU A;  1WC4 A;  2WVD A;  1MMN A;  1RT5 B;  2F8E X;  3JSB A;  1BQN B;  1C2P A;  3MED B;  2AJF E;  4M5G A;  3V5R A;  5I3Q A;  1N8R T;  3A4T A;  3QGH A;  5HAN A;  1TAU A;  4KO0 A;  1PJ7 A;  1RBL A;  2UUC J;  4BWM A;  2DNQ A;  1HWL A;  3DLG B;  3OXF A;  4E2F B;  3V6D B;  4ERD A;  4QYZ J;  5A2Q Y;  4DV6 F;  1HNW F;  4A8Q A;  2OP5 A;  4F4Y A;  3T1H F;  1NKC A;  4ZVP B;  4JI8 F;  3RRK A;  2MSS A;  5BJR A;  1BD6 A;  2W4D A;  3KLE B;  2ZC3 A;  1U0S A;  2LQ8 A;  1I1G A;  2YBV A;  4UOF A;  1GT8 A;  4QR0 A;  5F9L A;  2V4R A;  4IO9 Q;  2E5J A;  1T03 A;  1F0X A;  1UTA A;  3EXC X;  4R25 A;  3HFZ B;  1RWW B;  1TL7 B;  2ZDP A;  1RT4 B;  2ZUG A;  4MFB A;  2MLZ A;  3MTJ A;  5IFM A;  5FLX U;  2DR5 A;  3DOK A;  5E0O A;  3KTQ A;  4NLU A;  1VIO A;  3CJS A;  1JLQ A;  4Q8E A;  3HVW A;  4LIW A;  4TN2 A;  2X7I A;  4OYA A;  2E1A A;  4ENO A;  1N36 F;  1DJ0 A;  1UPM B;  3W63 A;  3CD7 A;  1ZAX A;  1TUV A;  3BR8 A;  3C8Y A;  3FMW A;  2BJE A;  3P96 A;  3UDL A;  4A8Y A;  2BOP A;  1RTD B;  1U1O A;  3CTR A;  3ETM A;  3RRH A;  3P4U B;  1EAY C;  3FKB A;  1JX4 A;  3GTY X;  3MR5 A;  3SSS A;  3FUY A;  1FKO A;  2L3M A;  2LKZ A;  3FEX B;  2RSQ A;  4F50 A;  1BE4 A;  3AJ2 A;  3HO1 A;  3GJQ B;  1NJX A;  3UVJ A;  4FVM A;  2R7O A;  2ZJR Q;  1ROF A;  4PG6 A;  1HIY A;  2JX2 A;  2QLB B;  1T9W A;  1HR0 F;  4DV6 J;  1K1Q A;  2BJ9 A;  3I87 A;  4DV0 F;  2FVP A;  4Y6I A;  2UU9 F;  3PAC A;  3GII A;  1F5A A;  3KDO A;  4J9O A;  4JYA J;  3D67 A;  3LPY A;  3QT7 A;  4DPY A;  4RL1 A;  5A6W A;  1RTJ B;  2B6A B;  3DM2 A;  4ZP9 A;  4ZOS A;  3CJT A;  1FXL A;  4ZLP A;  1FNM A;  1FWL A;  2CVE A;  3AQO A;  4QOT A;  1K47 A;  1ULR A;  3F41 A;  4LF7 F;  2HVE A;  2AYE A;  4ZVT B;  4I2P B;  2RML A;  3N28 A;  3OUY A;  1XMQ F;  2UVU A;  2UUT A;  4ILM A;  2Q1L A;  2B7B B;  2R2U A;  1RHU B;  2B51 A;  2E66 A;  1EKR A;  1JJC B;  3KLG B;  1RUS A;  3N6N A;  4NE9 C;  5CYJ A;  1WAC A;  5LOQ A;  1FER A;  3EWG A;  3ZNJ 1;  3HHN B;  2AQ4 A;  3W9H A;  2NPF A;  3N4W A;  4I7F B;  2GO9 A;  4NXN F;  2O67 A;  4B3M J;  4RW8 B;  1X4B A;  3UR3 C;  2IRX A;  3OHB A;  1D8Y A;  1X4F A;  2NCK L;  2P6T A;  1RT2 B;  3MMC B;  4LRF A;  1S1V B;  4ZLN A;  2DNO A;  3G8S A;  2DGW A;  2MKH A;  1H38 A;  3ZTS A;  1KC8 T;  1U1P A;  1VQ5 S;  5IT9 U;  2CIM A;  3M7V A;  3PM9 A;  4B9M A;  2VF3 A;  2ALY B;  2U2F A;  2MQL A;  3T9Z A;  2HBQ B;  4FXV A;  2EPI A;  2NSB A;  3QAU A;  4DPW A;  2E1P A;  3EE3 A;  4H54 A;  1NHV A;  2VC0 A;  4PG5 A;  1U8W A;  3IR6 B;  3UCZ P;  4A8F A;  4DV5 J;  4WK1 A;  1CJV A;  2YNG B;  5GME A;  4DN9 A;  2G1H A;  2AYB A;  3OT9 A;  3EVW A;  3UWT A;  1VI7 A;  2HPU A;  4R8U A;  5HAO A;  4MH8 A;  2FJV A;  4RZR A;  3JSM B;  3BH7 B;  1HBM B;  3K8W A;  1RAF B;  2BAN B;  5DGB A;  2DNY A;  4ECS A;  1GMW A;  3KJQ B;  4IOC Q;  4LF2 A;  2VC1 A;  3MD1 A;  2I38 A;  5E3A A;  2CQI A;  4CLF A;  3PZP A;  4JOU A;  2ROP A;  3CJ2 A;  5E33 A;  2ZJP Q;  3PV8 A;  2QL7 B;  3IR5 B;  3C6T B;  1HMV B;  2R7S A;  4F8R A;  4HT5 A;  2LVW A;  2HWT A;  1JXL A;  4JV1 A;  3PHT A;  4WYW A;  4O3O A;  4Q5V A;  5DGA A;  2G4B A;  2IY5 B;  5JUM A;  4ZPT R;  2G13 A;  2DH8 A;  3PR5 B;  1F3F A;  1C4C A;  2XWY A;  3DRX A;  2BE9 B;  2HKE A;  3B54 A;  4HHJ A;  4PEO A;  2PMW A;  4PPD A;  5G0R A;  5K9F A;  2WZ1 A;  2FLL A;  4QYZ K;  2E7X A;  3AD7 C;  3UN3 A;  1Y10 A;  5KG7 A;  4QIE A;  2F4F A;  2KXN B;  1LFW A;  3GSD A;  1M5K C;  2MKK A;  3QPI A;  4ICL B;  4G3I A;  2GVD A;  2HQ3 A;  2ZKU A;  2FLO A;  5EUH A;  4CWB A;  4NI2 B;  1H7W A;  4C0H A;  1UVI A;  1AFI A;  1OPZ A;  2HNY A;  4UOC A;  5KFP A;  2XO7 A;  3F73 A;  3DHW C;  2YNH A;  1QAI A;  3BN4 A;  3POT A;  1S6P A;  1FI4 A;  3PJX A;  4LRB A;  4C8M A;  2PE8 A;  3DC2 A;  1H72 C;  3VVT A;  3PO5 A;  4P73 A;  2UXB F;  1JLC B;  4WFN Q;  4ECT A;  2D41 A;  2DR9 A;  4AL7 A;  2GVZ B;  5KT3 A;  2J9D E;  2QA1 A;  3DI6 A;  3I4P A;  4PYA A;  2BJ8 A;  2M7S A;  5IOL A;  4ES1 A;  3L3C A;  4DS4 A;  2DGS A;  4QCL A;  4F4Z A;  4YUD A;  1NB2 A;  4P7T A;  1Q8K A;  2DGT A;  4CI0 B;  5JMN A;  3M8P A;  5HLF A;  2WHO A;  1CG2 A;  4OI1 A;  1QAY A;  4DR4 F;  4GMK A;  5GMK a;  3TUP A;  2YKM B;  1LOU A;  5E7O B;  4ZVU B;  4KKO B;  5K14 A;  2XC9 A;  1LW0 A;  3Q8Q B;  2R8J A;  3CD6 S;  3GV8 B;  3SSR A;  1X31 C;  2JC1 A;  2ROE A;  1IR0 A;  4F3Q A;  4ZVR B;  2QA4 S;  1HNX F;  3HI9 A;  1RTD A;  3VAL A;  3Q86 A;  1HQ2 A;  2LEC A;  3OFG A;  3F44 A;  2DYA A;  2HS3 A;  2WSF C;  4YY3 J;  2NQP A;  3KXD A;  4JP8 A;  4RBT A;  3P45 B;  3Q8U A;  2XMA A;  3D4J A;  1Y4Z B;  3CCL S;  3GFY A;  3O6Q A;  1L5U A;  1UMJ A;  3PEJ A;  4EFA C;  5B09 A;  3CDA A;  5H9F J;  1NO8 A;  4BHQ A;  1WTB A;  1H2V Z;  4LFC F;  1XBW A;  2Y0B B;  3VGS A;  2FVC A;  3N9U C;  3FRY A;  1EIY B;  2QMU B;  3KG1 A;  1IJE B;  2FLP A;  2OPS A;  3W2W A;  4ZKA A;  1K44 A;  1IM6 A;  1RTJ A;  1RIS A;  1WC0 A;  4MYU A;  4PCQ A;  3E8O A;  1Y5I B;  1H0H B;  3DCA A;  3KK3 A;  1S1V A;  3R1L A;  2K3I A;  4I0W A;  3TX8 A;  4P6Q A;  3F56 A;  2EC2 A;  3KJN B;  1IBK J;  3THP A;  3I5B A;  4F3M A;  1I51 B;  2ZH3 A;  2MTL A;  4J9V A;  4U67 Q;  2RS2 A;  2BKO A;  1FX4 A;  4DUZ J;  1U1L A;  2ZZT A;  4NCB A;  1TMJ A;  3LH2 S;  5CAB A;  3MFH A;  1ZET A;  2MLX A;  1B3T A;  1B0T A;  2HW3 A;  2B4P A;  2EFN A;  3PRD A;  5DLF A;  1FNO A;  1H98 A;  1RBO B;  2RF2 A;  2AJ4 A;  1KP6 A;  2CQ2 A;  2F5G A;  2YNI B;  3MD3 A;  4DOZ A;  4I6Y A;  5L1K A;  1WC6 A;  1EZZ B;  2R2R A;  2FHJ A;  3BEG B;  3SYZ A;  4LFC J;  2R7Q A;  4PXE A;  3AD8 C;  3NBP B;  3RBX A;  3S8S A;  1VK8 A;  1S1T A;  2RAQ A;  4PAA A;  3VQT A;  2VPY B;  4A47 A;  1KQG B;  5KFI A;  2VJV A;  2HLU A;  4KE5 A;  3SV3 A;  5L8R C;  4DR7 J;  4OYW A;  5HO4 A;  2GQC A;  2QN6 B;  3AQP A;  1H2U X;  3GLJ A;  3GIK A;  5LMN F;  3I9Z A;  3IG1 B;  2NUU G;  1HD1 A;  2MZJ A;  3FSX A;  1QM9 A;  4R5P A;  1G6B A;  3ITH B;  2EKN A;  3LP0 A;  3GJS B;  1SIZ A;  2M3D A;  3MEE B;  3OFF A;  3BO2 A;  4PRF A;  1TAQ A;  3M1V B;  2MZT A;  3HF5 A;  3HVT B;  5HAT A;  1NHU A;  2HNZ B;  3Q2T C;  4W90 B;  4X4P A;  5EN1 A;  1PG5 B;  1RCX B;  3DLK A;  5K5M A;  5B0D A;  2FVQ A;  4OI4 A;  3NAI A;  3S01 A;  2IRY A;  3H0P A;  5F0U A;  5IT0 A;  1IBK F;  1QAJ A;  5D3G A;  4HKQ A;  1CPZ A;  1WF1 A;  3OTE A;  1VC0 A;  2C2M B;  5LM7 E;  2H5J B;  3KHH A;  2CPJ A;  3A8K A;  3LOU A;  2EK1 A;  4W92 B;  2ZBQ A;  4H4M B;  1X4C A;  1JLE A;  4X4O A;  4X64 J;  2LQ5 A;  2F65 A;  4WK3 A;  3M05 A;  4IR1 A;  2CPX A;  4K4X A;  4H4O B;  1ZPV A;  4YEA A;  3W64 A;  4P52 A;  2IA6 A;  2HEK A;  2K7J A;  3D28 A;  5F8L A;  3HHE A;  2PA3 A;  4I2Q A;  4MK7 A;  1GNK A;  1U45 A;  2CXE A;  2XSJ A;  1NK6 A;  1L3S A;  3D66 A;  2AGQ A;  3CJQ A;  5G4D A;  3TA0 A;  4DPO A;  4ELT A;  2MJN A;  2E1R A;  2ZBI A;  4X65 J;  3N5B A;  5F8N A;  3TVZ A;  3CSK A;  3I56 S;  2UVR A;  1Q53 A;  1WC5 A;  2RVJ A;  3AOB A;  5KFQ A;  4F2S A;  4OYX A;  4K4Z A;  5HQ8 A;  4ED4 A;  2DR7 A;  4WZM A;  1T94 A;  2KB2 A;  5SZT A;  2VUG A;  3SCJ E;  3ET6 B;  5AXM A;  2J8S A;  1OSD A;  5T7L B;  3J81 U;  2F63 A;  2ZBC A;  2FDN A;  2KM8 C;  4O4R A;  2AU0 A;  1C1C B;  2ACM A;  4DWI A;  4RU9 A;  1L3V A;  2VQF F;  4CTA B;  3I6P A;  3PTW A;  4RNF A;  1MN7 A;  2QLX A;  3GYX B;  3MM8 A;  4DR3 F;  2CJQ A;  1N32 F;  3CCV S;  1JMT A;  2GGP A;  4ETZ A;  3BBC A;  1KTQ A;  1BY9 A;  3K8V A;  3PX0 A;  2AWZ A;  2J76 E;  2PN6 A;  3FEY B;  5FDL B;  1RLD A;  2WVB A;  3HHK A;  3W5Y A;  3KMS A;  2IDL A;  4IDK B;  2DPJ A;  3ISZ A;  5JJB A;  4DV1 F;  1S9E B;  4IKA A;  2XHC A;  4KKO A;  4KTQ A;  2MZS A;  2A0F B;  2MKS A;  3HHL C;  3CCU S;  4DDF A;  3RBD A;  4G1I A;  3I96 A;  4NLY A;  2J9D A;  2YKP A;  4F2R A;  2XI2 A;  4YQW A;  2D3O R;  3IWN C;  1MWY A;  3OXL A;  1W7W A;  2K1R B;  3IN5 A;  2RNE A;  3ENW A;  1K0T A;  2DXE A;  2QTW A;  1J2V A;  4WU3 A;  4ID5 B;  4PWU A;  1FRX A;  4WJB A;  1CS4 B;  2DNR A;  3MCS A;  4I68 A;  1IN0 A;  1RTZ A;  2FHJ D;  1VQY A;  4DCJ B;  4DSJ A;  5D0R A;  4NLP A;  2MKJ A;  3PNI A;  1N0V C;  3PKY A;  1LNQ A;  2FQQ B;  1D09 B;  2VBY A;  3EYZ A;  3HXM A;  2J0W A;  1UAW A;  4LBP A;  1AA1 B;  3CIZ A;  3VZH A;  5DQH A;  5L1J A;  3PW5 A;  4FS2 A;  1KFS A;  3PY8 A;  3MM9 A;  3AB4 B;  4WWS A;  1I6J A;  1QLN A;  2BOA A;  2VFR A;  2XZT B;  1GFW B;  1X9S A;  2OPR A;  1WSR A;  2I2Y A;  5KT5 A;  4DHV A;  1Q8B A;  1LXN A;  2GCF A;  4IO1 A;  4K8R A;  4RW4 A;  1QY7 A;  5ETO A;  2MY7 A;  5IV4 A;  1CLF A;  3IO1 A;  4ZVE A;  2MQM A;  3IG1 A;  3I32 A;  1TVR A;  2HFN A;  2CZ9 A;  2XS7 A;  4F25 A;  4I67 A;  1S1U B;  4QPT A;  3A12 A;  3Q83 A;  1NCL A;  3NGK A;  7FDR A;  3R2C J;  2LU1 A;  2EKY A;  2GQQ A;  2GHP A;  3CB4 A;  2I8E A;  1VBZ A;  2HAF A;  1N5Y B;  4O3P A;  1R8A A;  4B9S A;  4A8S A;  2MZR A;  2AGP A;  1YZ7 A;  3PDN A;  4O3Q A;  4L76 A;  2RQK A;  3B8H A;  1SJQ A;  1SJF A;  4OZ1 A;  1RT1 A;  3M32 A;  4RUC A;  3L7O A;  3MEG A;  3OTC A;  3QT8 A;  4X4R A;  1PYS B;  3MUV P;  5CYQ A;  2K7K A;  4DI6 A;  4DUY F;  4M8L A;  4DL0 C;  1U4B A;  5D77 A;  4QIW D;  3J80 U;  1URR A;  3J7Y I;  3KLG A;  3OV7 A;  5DO2 A;  4ZHR A;  2C3P A;  4I6A A;  3VAI A;  1RWM B;  4OJ3 A;  2W8L A;  2QLF B;  1DTQ B;  4OL8 A;  2CPE A;  5I42 A;  3MUM P;  3VVU A;  1IKX A;  2DGU A;  2HAI A;  1TKZ A;  1U8S A;  4K7Q A;  3Q8P B;  2MST A;  2PEB A;  3HT3 A;  2HND B;  3CJ4 A;  4BBY A;  1R6Y A;  4QIG A;  1H7X A;  2JOQ A;  1V3R A;  1T95 A;  1WHX A;  3MGJ A;  2XM3 A;  2XCA A;  2QFJ A;  3T5H A;  1JLA B;  1TKD A;  2HFV A;  2R4F A;  3AY0 A;  4B9U A;  1RAA B;  2VHG A;  1ZBT A;  2LXI A;  3HD1 A;  2IBO A;  4TKT A;  3MED A;  3SBM A;  1MRO B;  4ATN A;  1F9F A;  2B5J A;  3CJR A;  3HD2 A;  3HKW A;  2HRT A;  5THW A;  3M9O B;  1FJG J;  2CNN B;  1WTF A;  2DH7 A;  3MR7 A;  3SDE A;  3HM9 A;  4DV3 J;  1HI0 P;  1VQK S;  2RS8 A;  4NLG A;  4FKX A;  2R8I A;  3D3C J;  5CH7 B;  2CA9 A;  3R5G A;  1VQP S;  1ELO A;  3W8G A;  4ECY A;  1WC1 A;  3EDR B;  1WHY A;  3VAG A;  2Z4P A;  1SB6 A;  3GR1 A;  3SEO A;  3CME S;  4IUF A;  4ZPD A;  1M0S A;  1X5S A;  3C6T A;  1HMV A;  3CDW A;  2QLW A;  3ENV A;  4CLT A;  1IKY A;  1N34 F;  1S9E A;  3P5T L;  2OLW A;  4UT4 A;  3TX0 A;  3M2R A;  3G8Q A;  3ISN D;  3UDV A;  1KBR A;  2X1B A;  4KGV B;  5IS2 A;  1RA7 A;  3VGU A;  1HNI A;  2DGX A;  1B7F A;  4CTA A;  2E5L F;  2SXL A;  1LWC A;  1MW7 A;  1RT4 A;  3H4D A;  1C0U A;  2VOP A;  3PEH A;  2GGP B;  3UPF A;  1RU2 A;  2MGZ A;  2DT9 A;  1K73 T;  1SKW A;  4P72 A;  2KDO A;  3IM9 A;  3MPV A;  3NLC A;  4NLW A;  5D4P A;  2P8I A;  4DQR A;  4B3O A;  2NPI A;  1ZM4 A;  4OHV A;  2ZH5 A;  2JHE A;  3GCW P;  4O3R A;  3K89 A;  3RTV A;  5K8M A;  3W9I A;  2CQG A;  1S7H A;  2IPO B;  3BS9 A;  3GB0 A;  3PW2 A;  1PYT A;  3A13 A;  3M30 A;  1H73 A;  4OZ0 A;  4OYB A;  4C6A A;  5RUB A;  4EYI B;  4TYA A;  4Y2A A;  4JI6 F;  2VKZ G;  2HK3 A;  3NMA A;  1TL7 A;  2B56 A;  2DRD A;  3PO4 A;  3FFI B;  2HHP A;  2O01 C;  4HTI A;  4WBF A;  2GIF A;  2WSE C;  3E2E A;  4LRE A;  4KGX B;  1UWB A;  3G82 B;  5HVF A;  2X51 A;  2AW0 A;  4TNO A;  3W66 A;  3V81 A;  4K0K F;  4NLX A;  4RW7 B;  3UDE A;  3NWG A;  4KC5 A;  1ZM2 A;  2KJV A;  3H98 A;  3LWL A;  2H54 B;  3ENA A;  3EPI A;  3OSP A;  4OIX A;  5J2N A;  2QV6 A;  1RQ0 A;  2ZNY A;  4YDD B;  1XNR J;  3UD4 P;  2CQC A;  1JLB A;  4OHY A;  4E0D A;  1LW0 B;  1YKW A;  4QJV A;  4TU7 A;  2JEJ A;  5CYM B;  1RYR A;  1XMB A;  2P6S A;  4LUB A;  1QUV A;  3NWR A;  4OHX A;  4BS2 A;  1NH8 A;  2J7U A;  2O3D A;  2J6S A;  1FVQ A;  4ELU A;  3Q22 A;  3DU6 A;  2XBP A;  5DDR C;  1VRT A;  2KZM A;  4ES3 A;  2HFU A;  4UUX A;  1NM2 A;  3TEG A;  1IR1 A;  4YHH J;  1I94 F;  3MAA B;  4WP9 A;  4QYR A;  2BZ2 A;  4HDH A;  1S6O A;  2RRN A;  3HSD A;  5KTQ A;  2B4O A;  1R8H A;  1S0O A;  5IM0 B;  2KTQ A;  3QGP A;  1Q5V A;  4RKU C;  1OO0 B;  2NYH A;  5CZV A;  5KFR A;  4DZD A;  3ILI A;  2MQO A;  4ZP8 A;  3J81 j;  1S10 A;  3PJ9 A;  3IS9 A;  5KFK A;  4KHP F;  1VJQ A;  3MEC A;  2GV1 A;  4JBC A;  3D1H A;  5E3P A;  2C3U A;  1VHF A;  1X0P A;  3HZE A;  2MZ1 A;  3BSN A;  3HVA A;  1FNX H;  4WF9 Q;  2B8P A;  2OPS B;  3MWB A;  4CLS A;  4BLG A;  2QMX A;  3ICL A;  2YKQ A;  4AND A;  3AA8 A;  3MCO A;  2MQQ A;  4X64 F;  4CO3 A;  1RT6 B;  1RWK B;  4QWC A;  3OW2 R;  3QRP A;  3ZNU A;  3HFK A;  1SH3 A;  2F4V F;  3MEG B;  1HW9 A;  1ZAV A;  4FN5 A;  5K20 B;  3V6H A;  4O44 B;  1TK0 A;  1EP4 A;  2IM3 A;  4KGZ B;  4OX9 J;  2HHQ A;  1YZ6 A;  2E9Z A;  4HR2 A;  1Q4R A;  1S76 D;  3UW1 A;  1RT2 A;  4WP3 A;  3KHL A;  5L39 A;  4UTG A;  4ZS6 A;  4Z7C A;  2OIH A;  1TK8 A;  1NU4 A;  1O6X A;  4WFY A;  1BQM A;  3OVB A;  3UQS A;  4X2B A;  4IG3 B;  2GQ2 A;  4N7T A;  3JB9 k;  4CH7 A;  1U6B A;  3G71 S;  3RAX A;  2OD6 A;  2V8D A;  2FHK A;  2AJ2 A;  2VBZ A;  2Y1R I;  4EUV A;  1EKS A;  1QUP A;  3C46 A;  1Q1K A;  1TKT B;  1FDD A;  1WG5 A;  4K4S A;  5DZ6 A;  5IT9 Y;  3MCN A;  1DRZ A;  3KWM A;  1N54 B;  3ZZP A;  1NDC A;  2CPI A;  2N7C A;  3RUB L;  2FHM A;  4QW9 A;  2NRE A;  4C8Y A;  2RDD A;  3ZTO A;  5HBM B;  5IXU A;  1ZYQ A;  2XTJ P;  5KG2 A;  1YJT A;  1GXT A;  2EG2 A;  3TYT A;  4F36 A;  3HHL B;  3HMJ G;  1MRO A;  1RB0 A;  3CO0 P;  4FKY A;  3UCU P;  3VAK A;  4ICL A;  3KJV B;  2FPH X;  3U02 A;  1S49 A;  3BSC A;  3K5N A;  3BH6 B;  4C0B A;  2JWN A;  4CM2 A;  4DL6 A;  4IFY B;  1CQN A;  1T02 A;  1WG4 A;  4FP9 A;  1FFG B;  1XEZ A;  1HI8 A;  4NLQ A;  1JB0 C;  2YNH B;  3WX4 A;  5D3G B;  1V5V A;  2LQB A;  1H3D A;  2WTF A;  4CO5 A;  5GAE U;  4K59 A;  5A8R A;  2YKN A;  2CZV C;  1PC5 A;  2XMV A;  5KFU A;  3QGG A;  5HVH A;  5DZ7 A;  3BQ1 A;  4H4M A;  1RTI A;  4R0J A;  2KI2 A;  4ZDN A;  3OD2 A;  3QYY A;  4OZ3 A;  4DSF A;  4JI2 J;  2ZHO A;  4ZIV A;  2J6U A;  4LF1 A;  4LF6 J;  2VON A;  1FFS B;  3TQ1 A;  3MI7 X;  4X66 F;  4B9L A;  1B7Y B;  1R7I A;  1FDN A;  1UJ5 A;  3G87 A;  3AH6 A;  4DV5 F;  2OPP A;  2Z0G A;  2YWE A;  4KV8 B;  4Y3C A;  1SQG A;  1YRU A;  5C24 A;  2CG8 A;  4PG4 A;  1VJW A;  2FD2 A;  3RZA A;  4HEA 9;  2V8P A;  2YKM A;  5A0Y A;  5LSO A;  3DFE A;  5HN0 A;  1B99 A;  3G4S S;  5KFC A;  3AOC A;  2OFG X;  3LGM A;  3CDU A;  3PYF A;  1U0H B;  4GKK F;  3NGS A;  1HNV B;  4DU8 A;  4X4Q A;  3T9N A;  2ASY A;  3BR9 A;  3QMQ A;  1CC8 A;  2W7O A;  2ROG A;  2GHV C;  2WK4 A;  1VGY A;  4DR1 J;  2AD9 A;  3R6L B;  2A6M A;  1I94 J;  3W61 A;  1N5S A;  5CYM A;  4DV4 J;  4U8V A;  1SL0 A;  1JKH A;  1KKH A;  2J9E A;  4X65 F;  5LT5 A;  3NCP A;  2R8K A;  2EFP A;  4LFB F;  4X66 J;  1OSC A;  5DET A;  3RJM B;  1T9U A;  3CO9 A;  1DUR A;  3FZ2 A;  2LU2 A;  3NEK A;  4EU0 A;  2KYZ A;  3DLG A;  4NZ0 A;  4HH1 A;  2LA4 A;  3BKU A;  4USK A;  2RHQ B;  3SCI E;  1OMS A;  1CSJ A;  2K3K A;  2M4M A;  2BA9 A;  1X9M A;  2DH9 A;  4JV5 F;  4QBU A;  4CNY A;  2I1R A;  3TJ8 A;  3IWX A;  3Q2S C;  3TUI C;  1FES A;  3QT6 A;  4UZC A;  2BX6 A;  4HI2 A;  3VAF A;  1PJ5 A;  1S59 A;  2FJE B;  1FD8 A;  2FJA B;  1S9F A;  1RKI A;  2WW4 A;  4DV2 F;  4DUY J;  4N77 A;  3MUR P;  1N52 B;  2FJB B;  1RT6 A;  2YQ0 A;  4KFB A;  3R9L A;  1OYD A;  3CUN A;  4Y2I A;  3RBZ A;  2ZH2 A;  3G8T A;  4AXJ A;  5KOX A;  1L3K A;  2BRL A;  2A18 A;  2J0Q D;  3MFI A;  1SC6 A;  2V69 A;  3R5J B;  1AFJ A;  3U7J A;  2C2Z B;  1TKX A;  5I4M A;  1Y5L B;  4Q44 A;  2LYV A;  3UE2 A;  4N8O A;  1FRK A;  5BYS A;  3T3F A;  3LAK A;  3M2V B;  4NLT A;  1U24 A;  3IS9 B;  4QPX A;  3PIP Q;  2V5H G;  1GX6 A;  3HCX A;  5HSP A;  3VCD A;  2RH3 A;  1FKO B;  1MU2 B;  3GE9 A;  3LPE A;  4KR0 B;  5ETR A;  3A3P B;  2CPH A;  2WSC C;  2L9D A;  4L3N A;  1J5O B;  2FJD B;  4JI4 J;  4FYY B;  2CQ1 A;  2HHH J;  1V9O A;  4MK8 A;  4ZPC A;  3NOC A;  1XIQ A;  2EWH A;  2DK2 A;  3A8J A;  4C3K A;  4R5P B;  5GAD U;  3MM7 A;  5GAG I;  3IAS 9;  4ANC A;  2PI5 A;  2MHN A;  4PG7 A;  2K8G A;  3CCT A;  2YNI A;  3H4B A;  3V4I B;  1AZS B;  4FF1 A;  1NSA A;  3BGU A;  1KFD A;  3NGR A;  3ILO A;  4NYO A;  4C11 A;  1T05 A;  1S79 A;  4W98 A;  4JI8 J;  4WCE Q;  2OUG A;  1UCN A;  2B6A A;  3BDP A;  3IGN A;  4X62 J;  2FC8 A;  2R7R A;  3QJJ A;  1S1U A;  4F02 A;  4LQ9 A;  3R3T A;  3CDE A;  1Z4U A;  4ED0 A;  2IBK A;  4D3H A;  2AEM A;  4I2P A;  3KLH B;  2AEJ A;  1EQ0 A;  2PSZ A;  4WFA Q;  1LV5 A;  3T19 A;  1OQ3 A;  1R8B A;  2QG9 B;  1JLE B;  1GAO A;  4K2X A;  4DSI A;  2YXL A;  1O0P A;  1NPR A;  2DHH A;  5HJX A;  3FDS A;  1GMV A;  4IFY A;  1HYS B;  1S0M A;  2CQ3 A;  3HVT A;  4ZP7 A;  3V4M A;  3LAL A;  2VB6 A;  1HQU A;  3BO3 A;  2D9P A;  4M5L A;  4ETX A;  4N41 A;  4CLZ A;  3LUY A;  1VBX A;  3AA9 A;  1AUS L;  3FZB A;  2M5Y A;  4FZV A;  4USV A;  4TXS A;  5I3U B;  3DKD A;  1X5P A;  2BKN A;  3JQJ A;  4M5K A;  4IQX A;  4ZN1 A;  1FE0 A;  4OI3 A;  4J90 A;  1SBR A;  2OSQ A;  3M8Z A;  4AD6 A;  5KG3 A;  1DTQ A;  2PII A;  3OTO J;  3D68 A;  5E5N A;  1HAR A;  1L3T A;  2ZFH A;  1A9N B;  3MUT P;  1A0O B;  3MPU B;  4CYU B;  5A76 A;  4A48 A;  1P27 B;  4QU6 A;  1YBU A;  3MMA A;  2O1P A;  2AT1 B;  4Y2C A;  1LXJ A;  2LFV A;  2H9Z A;  4LBI A;  3O3L A;  2RD5 C;  4QU7 A;  3GSI A;  2MY8 A;  3WBZ A;  3JSM A;  2F7V A;  4JV2 A;  1JJ2 R;  5KFM A;  1XTZ A;  4CZC A;  1JLA A;  3D7S B;  5CA5 A;  4ED7 A;  1SQF A;  4WKR A;  3GIM A;  3N6M A;  4OI0 A;  2B4V A;  1U1N A;  1PSD A;  4IG0 B;  2W24 A;  4LFB J;  1XR6 A;  2M9K A;  4ES2 A;  3MDF A;  1RWX B;  4M5J A;  4DV1 J;  1NND A;  1AUD A;  3OPK A;  3OVA A;  4J9R A;  2V68 A;  3JAM U;  5LXY A;  2QYG A;  4J9K A;  2V0N A;  1RAG B;  5CXT A;  4KH1 B;  2YKO A;  4DQP A;  3H2L A;  4J91 A;  2W4C A;  2R2T A;  1R0A B;  3IBW A;  1DY3 A;  2VIC A;  1IKV A;  4XDD A;  1LEO A;  2XS5 A;  3DYA A;  2ZH4 A;  2NLW A;  1YDL A;  3CDB A;  3NGT A;  2CQD A;  2DD8 S;  3DXB A;  4X4V A;  2HGL A;  2M8H A;  4J9U E;  5KFB A;  3QIP B;  3V6J A;  1V5I B;  1VQ7 S;  1GTH A;  2ZE2 A;  3T1Y F;  2XY7 A;  1NKE A;  1IWA A;  1IKW A;  4GC7 A;  2L48 A;  1N33 F;  2HVI A;  3FMB A;  2N7Y A;  1HI1 A;  5BXI A;  3FJ2 A;  3OSN A;  1JKH B;  1PBU A;  4DV3 F;  1QSY A;  3BGO P;  1FT8 A;  1D8Z A;  2GVD B;  3OTD A;  4NPO A;  2D3O 1;  2HGN A;  3DLE B;  4IYQ A;  1NK4 A;  3DU5 A;  1QTM A;  2VG6 A;  3M8S A;  3CT9 A;  2V8V A;  2BAC A;  1RDR A;  2YWF A;  3JYT A;  2M0G B;  4KGM A;  2KT3 A;  4WE1 A;  4DX6 A;  2JL9 A;  3FC9 A;  1BWV A;  1C1B A;  1WEX A;  4LF8 F;  2IYI A;  3D0G E;  1JLC A;  3P5B P;  1RAB B;  3M2V A;  2GVZ A;  4CIO A;  2IMW P;  4ID5 A;  2HGM A;  4F3O A;  1E6Y B;  4EO8 A;  4RW4 B;  1FK9 A;  1S72 S;  4HDG A;  1SUQ A;  1HPZ B;  4LR7 A;  2HBZ B;  1IVZ A;  5C2C A;  5L1I A;  1FJE B;  3C6U B;  3IP0 A;  4NXM J;  1JIH A;  1X4G A;  1FF2 A;  1GQE A;  4LSL A;  3W5Z A;  5J1E A;  3SCL E;  2D69 A;  3ZZY A;  5E41 A;  1FEE A;  3KLI A;  3MM7 B;  5HMW A;  1TP7 A;  4TU8 A;  1Q7Y T;  5K14 B;  3R6G B;  2JLG A;  5ETM A;  1NJI T;  2PA8 D;  1AZS A;  5HP1 B;  2JC0 A;  1N5Y A;  5KOW A;  4M5D B;  3HSG A;  4ZPB A;  2DIT A;  4B3T F;  2F8H A;  3I55 S;  5DJB A;  1LWE B;  5KT2 A;  1SI9 A;  2J0S D;  1UFK A;  5J2P B;  2XLK A;  2DJW A;  2CUY A;  4CLY A;  2HIQ A;  3B4D A;  3OBI A;  4NYZ A;  4O4G A;  4JI6 J;  1RHM B;  3PRB A;  4C8Z A;  1RSC A;  1V6H A;  3GG1 A;  4QR2 A;  1RBA A;  1VBY A;  2YPZ A;  4K4V A;  2ZH1 A;  1VR6 A;  1HBO A;  4M5I A;  3US5 A;  2WB4 A;  2J8A A;  3BO4 A;  3J7A N;  2PMZ D;  1K1S A;  1VRU B;  2HZA A;  3D0I E;  5KFH A;  4ZHR B;  1JLQ B;  2JRS A;  5EGY A;  5KFE A;  4IRK A;  2ZJQ Q;  5ETK A;  4LF5 F;  3TVK A;  3UD5 A;  3DNC A;  3H7H B;  3WHI A;  3G6Y A;  1WOS A;  2HHW A;  3NAH A;  1VQS A;  2EFQ A;  2W2Q P;  4DQQ A;  2XMJ A;  3GU0 A;  2E5G A;  2ILY A;  3H8Y A;  4S0M A;  1K0V A;  5KG4 A;  5D4N A;  4EMD A;  5HK4 A;  1R31 A;  4DSE A;  2IVY A;  3L7P A;  3ONQ A;  1TMM A;  4GC6 A;  2O66 A;  3DXS X;  4PUO A;  4P2S A;  2DHX A;  3M2U A;  4I1T A;  3QLH B;  4DF4 A;  2MDA A;  1RK8 A;  4TQR A;  3AT1 B;  5KT4 A;  1XN9 A;  2ZNZ A;  1EB0 A;  3MEK A;  2DNN A;  5KAK A;  5DM6 Q;  2F40 A;  1FHT A;  2YQ3 A;  3WC2 A;  2MQP A;  3LTO A;  5LSR A;  2UXC F;  4HLB A;  1N5T A;  1F3V A;  7AT1 B;  2YY3 A;  2UV8 G;  3GIJ A;  1XR5 A;  4DJB A;  4AYB D;  2F9D A;  3PVX A;  4B3S J;  1AW0 A;  3EZ5 A;  4LF7 J;  4IRC A;  2ZHB A;  2OPQ B;  2VH7 A;  2C3Y A;  1T9V A;  5I3U A;  2DY9 A;  2E7W A;  1SH0 A;  3PW4 A;  2HQG A;  1SPB P;  3R1H A;  4ZP6 A;  2M8D B;  4PQU B;  4X4N A;  4TY9 A;  2I9S A;  5KFL A;  2LDY A;  3NS5 A;  5HL7 Q;  2AJQ A;  1S1W A;  2G0C A;  5IV3 A;  2HS0 A;  1OYE A;  4ECR A;  1FWP A;  1VFJ A;  2G9O A;  2EI5 A;  2CJA A;  1H2T Z;  2OAU A;  4LIR A;  3BF4 A;  3H2U B;  3ITH A;  2ATL A;  4B02 A;  5B0G A;  4OX9 F;  1TL5 A;  4QR1 A;  1TL4 A;  1X9W A;  2NXC A;  3M1V A;  3MMA B;  4YS2 A;  2LQ9 A;  3T1Y J;  1EJ7 L;  1TL1 A;  3RR7 A;  2XMU A;  4B08 A;  1FDB A;  4DCO B;  2BKP A;  2B5J B;  3B6B A;  4Q45 A;  1OQ6 A;  4RNN A;  3DLK B;  5HBM A;  1LWC B;  3I9V 9;  5D6G A;  2E5I A;  2NZC A;  5IQ6 A;  2BMB A;  1T3N A;  3X3U A;  2UUA J;  2ZHA A;  4IRD A;  4I6W A;  2W01 A;  4DN0 A;  2XUL A;  1VQO S;  1ZOT A;  1RI7 A;  2ZM6 F;  2B9Y A;  1BQN A;  3C19 A;  3CD0 A;  5JXS A;  2ZH6 A;  4GKJ F;  3DDI A;  4ZVH A;  2JH3 A;  2E5H A;  4B3O B;  4PWD B;  1IXK A;  4RNH A;  4W4M A;  4DEZ A;  1XC9 A;  2V50 A;  3M6V A;  1V3S A;  1NSQ A;  1KON A;  1IKV B;  1VDH A;  1WDD A;  3KDN A;  3N0V A;  4U6P A;  2KU7 A;  4N5S A;  4DR6 J;  2HUR A;  2WBR A;  1FRL A;  1UEV A;  4WXW A;  1UA1 A;  4L72 B;  4MKY A;  2GFF A;  4RU2 A;  5D8H B;  1HHS A;  5ETL A;  5D78 A;  4OX7 A;  3VGT A;  4UQG A;  1J5E J;  3BGL A;  2AP6 A;  2DO4 A;  3L7U A;  3QO9 B;  1Q0N A;  3VQS A;  3PX6 A;  4OZN A;  1T8E A;  3DGV A;  3QRQ A;  4RW7 A;  2PFF B;  3FNN A;  1CVJ A;  1RHJ B;  2GML A;  3MF5 A;  3MHY A;  4EBC A;  5F8G A;  5U47 A;  1QSS A;  1FO1 A;  3DMJ A;  3O5T B;  5K8O A;  2DHA A;  4FVC A;  1HD0 A;  3GJR B;  4K5R A;  4QIV A;  3S1T A;  2BDP A;  3OL7 A;  3KK1 B;  2HMI A;  3QSI A;  3K7R A;  4ZK7 M;  4OX8 A;  2C3M A;  2DGQ A;  1JLB B;  1FE4 A;  2HQI A;  3IRW P;  3C15 A;  2P2C B;  3M30 B;  1U2R A;  1Z2L A;  4FPI A;  1TK5 A;  5ETQ A;  2ABY A;  4ZCI A;  2Y1I A;  1KLM B;  2CJY B;  2G2O A;  1AYE A;  1NUE A;  4KIA A;  2EVZ A;  3QZ8 A;  3R8Y A;  4ED2 A;  2DO0 A;  2MYF A;  2BJ7 A;  3PJW A;  2XMW A;  2HG4 A;  3H20 A;  5J2P A;  4NZ6 A;  4G65 A;  4OFZ A;  3KUH A;  2PC6 A;  1SJ4 P;  3MAA A;  1SUQ B;  4WFZ A;  2HWH A;  2Z2Z A;  2MB0 B;  3TNV A;  2HVD A;  3O2I A;  2XMT A;  1DAX A;  4NI2 A;  4DMZ A;  2AZ3 A;  2MZQ A;  2XY6 A;  4L74 A;  3IC1 A;  4KT0 C;  3UVJ B;  4U8Y A;  2E1M C;  3RRG A;  4X62 F;  2NXJ A;  2I5J B;  5A8W A;  4A8M P;  2FZC B;  1WKK A;  2CJB A;  4LFA J;  2F4V J;  3M8R A;  2COL A;  2YQ1 A;  4B3M F;  4X84 A;  2VQE J;  1DTT B;  4K4W A;  4FF2 A;  3SSQ A;  1TFW A;  4CCH A;  1GK8 A;  3FCV A;  2MMY A;  3QLH A;  4O44 A;  1TUG B;  2P5V A;  3W62 A;  5B7W A;  3TP2 A;  4DL2 A;  3WQP A;  1D9F A;  3FBE A;  4C9D A;  1UVM A;  3CWJ A;  1R8P A;  1RE1 B;  1TL3 A;  1VRU A;  2R3V A;  2W1B A;  4HHU A;  1Q82 T;  2KFZ A;  3UR0 A;  4DR2 J;  3MOJ B;  4OI2 A;  4RWW A;  3EPG A;  1KLN A;  4OYP A;  2KN4 A;  1ZM3 A;  2LEB A;  5L46 A;  2Y1J A;  4YME A;  3PG9 A;  4CH0 S;  2BE2 A;  2CDR B;  4C8O A;  2DVI A;  1RJJ A;  4NAS A;  2RU9 A;  2BVZ A;  2QYC A;  2VFS A;  3CJ3 A;  3E01 B;  3FEZ A;  3PXG a;  2OPR B;  3WX8 A;  1JLG A;  4DR3 J;  4ILL A;  6AT1 B;  4PG8 A;  1UW4 A;  1DAR A;  2GS8 A;  1YBA A;  1VQL S;  4NWB A;  4IFV B;  1ZM9 A;  1EP4 B;  1FRH A;  1KVK A;  1KQK A;  3BQ0 A;  1SL1 A;  3CCZ A;  3Q8V A;  3NCQ A;  2BJ3 A;  1SKR A;  2DXD A;  3A8I A;  4I4B A;  3UI3 A;  1CJT A;  3UN5 A;  4X4U A;  4F04 B;  3AD9 C;  4LFA F;  4KRW A;  1S12 A;  1BQM B;  2QSF A;  2RUS A;  2Z30 B;  3JTP A;  4Y2M A;  5I3P A;  2CWX A;  4DG1 B;  1S5Z A;  5IZH A;  3GV5 B;  4R8U B;  1XJW B;  3I0S B;  3MM6 A;  2W2P P;  3RB3 A;  1M5S A;  3LO3 A;  4YFU A;  3P8B B;  5MLC V;  1S57 A;  2FGO A;  1QE1 B;  1YK9 A;  2LLZ A;  4RUB A;  3TUJ C;  1YIT S;  4JYA F;  4GVL A;  2JNJ A;  1M1G A;  2ZH9 A;  4HHH A;  5L1L A;  4V1A k;  4DX8 H;  4A46 A;  2RRB A;  3OJS A;  1WOR A;  4G1Q A;  2KVQ E;  2IYG A;  4AXI A;  3M9M B;  1NME B;  2I6W A;  3BSO A;  2GO8 A;  5DDQ C;  3BB5 A;  2ZZN A;  1SC4 B;  1PAE X;  1YWX A;  4K50 A;  3MAH A;  1EX8 A;  4J37 A;  4C8K A;  2DRA A;  2UXD J;  3H59 A;  3KHR A;  4NLS A;  1MML A;  1S1T B;  1C0T A;  3TO8 A;  1PGZ A;  4B9N A;  2OH2 A;  4Y34 A;  1UL3 A;  5DRK A;  1PIE A;  2V4Q A;  1RHK B;  3HLU A;  3HUL A;  2KH9 A;  2X3G A;  2HHV A;  4Q2M A;  4UW2 A;  5L9N A;  2GX8 A;  2XMK A;  5KFT A;  1S97 A;  3BKF A;  2Q79 A;  1AXQ A;  2EBE A;  4RUH A;  4K4Y A;  1HNV A; 
#chains in the Genus database with same CATH homology
 1NDL A;  3EM1 A;  1LWX A;  4O0N A;  1NPK A;  1BE4 A;  1XIQ A;  3G2X A;  1WKJ A;  3JS9 A;  1HIY A;  4ANC A;  3ZTQ A;  1NUE A;  4FKX A;  3ZTP A;  3ELH A;  1MN7 A;  3NGR A;  3Q86 A;  1NDC A;  3BBC A;  4W98 A;  1UCN A;  3BBF A;  2DYA A;  4CP5 A;  3ZTO A;  2HVE A;  1HHQ A;  3Q8U A;  2HVD A;  2B8Q A;  3NGU A;  1NHK L;  1NLK L;  2AZ3 A;  4F36 A;  3Q89 A;  1EHW A;  4FKY A;  3VGS A;  4DUT A;  1WKK A;  3BH6 B;  3VGU A;  4ANE A;  4F4A A;  3EIC A;  1W7W A;  1K44 A;  4S0M A;  3EMT A;  3MPD A;  2DXE A;  3FBF A;  2NCK L;  4EK2 A;  3FCV A;  3DKD A;  3ZTS A;  1BHN A;  2CWK A;  3FBE A;  3Q8Y A;  3VGV A;  3FBC A;  1BUX A;  1NDP A;  3EE3 A;  5CAB A;  1U8W A;  4C6A A;  1PKU A;  3EVW A;  4WBF A;  3WX8 A;  3EVO A;  1B99 A;  3BH7 B;  1XQI A;  2DY9 A;  1JXV A;  1WKL A;  3NGS A;  3FCW A;  3ENA A;  2ZUA A;  1B4S A;  2DXF A;  5CAA A;  3Q8V A;  2DXD A;  1VYA A;  1NSP A;  3Q83 A;  1NCL A;  1HLW A;  2BEF A;  1ZS6 A;  1NDK A;  1S5Z A;  1NSK L;  1LEO A;  3B6B A;  4KPC A;  3NGT A;  1F3F A;  1S57 A;  3VGT A;  3B54 A;  3FBB A;  4UOH A;  4DI6 A;  3GP9 A;  5BXI A;  4DZ6 A;  3DDI A;  3PJ9 A;  4UOF A;  3BBB A;  3ZTR A;  3EVM A;  3GPA A;  1MN9 A;  2BX6 A;  1S59 A;  1NSQ A;  1PAE X;  4UOG A;  2B8P A;  1KDN A;  3EJM A;  3VVU A;  2HUR A;  4AND A;  3R9L A;  2AZ1 A;  4ENO A;  2VU5 A;  3FC9 A;  3VVT A;  3L7U A;  3ETM A;  1F6T A;  4HR2 A;  5IOL A;  3PRV A;  3FKB A;  5C7P A;  1NB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...