4DUTA

The structure of nucleoside diphosphate kinase (ndk) from burkholderia thailandensis
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
140
structure length
140
Chain Sequence
ALERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVAARMAHLSRADAEKFYAVHAERPFFKDLVEFMISGPVMIQVLEGEDAILKNRDLMGATDPKKAEKGTIRADFADSIDANAVHGSDAPETARVEIAFFFPEMNVYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
total genus 44
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4dutA00
3FBFA 3VVTA 3FBCA 3FBEA 1PKUA 4C6AA 3EM1A 3EVMA 1B4SA 1S5ZA 2VU5A 3L7UA 3NGRA 3PJ9A 4UOFA 5CAAA 3Q86A 2CWKA 1WKLA 1VYAA 1S59A 1HHQA 4W98A 1EHWA 1NDCA 2B8QA 3GPAA 3FCWA 4HR2A 3DKDA 3EVOA 2BX6A 3Q8YA 3G2XA 3MPDA 2DYAA 1JXVA 2HVDA 3EJMA 4DUTA 4FKXA 1LWXA 4F4AA 3JS9A 1MN9A 4KPCA 2AZ1A 3PRVA 5C7PA 3FCVA 3Q8VA 3EMTA 1XQIA 1U8WA 3NGSA 1BHNA 1NCLA 1NB2A 1HIYA 1NDPA 4ANDA 1XIQA 1W7WA 3DDIA 2DXDA 3BBFA 1F6TA 3VGVA 3VGUA 3ZTOA 4DI6A 2ZUAA 5BXIA 3EVWA 1PAEX 4FKYA 3BBCA 2DY9A 3ZTPA 1MN7A 1NPKA 3ETMA 3R9LA 1LEOA 1BE4A 1NUEA 3NGTA 1NDLA 3VGSA 1B99A 1NDKA 1ZS6A 5IOLA 3ELHA 3Q89A 2HURA 1NSPA 4DZ6A 2NCKL 4WBFA 4EK2A 3Q8UA 3Q83A 1NHKL 2AZ3A 4S0MA 1UCNA 1KDNA 3EE3A 4ANEA 4O0NA 3FKBA 3ZTSA 3B54A 1HLWA 2DXEA 1NLKL 3ZTQA 2DXFA 3B6BA 4UOGA 3GP9A 1WKJA 3VGTA 5CABA 3FC9A 3ENAA 3NGUA 2HVEA 4CP5A 3BBBA 3BH6B 1BUXA 1WKKA 4ANCA 3FBBA 2B8PA 4F36A 3WX8A 3VVUA 1F3FA 1NSKL 2BEFA 3BH7B 4ENOA 1NSQA 3EICA 4UOHA 3ZTRA 1K44A 1S57A
chains in the Genus database with same CATH superfamily
4ECYA 4OYWA 3CJSA 3PYFA 1XR7A 2DHSA 3FBEA 4OLOA 1GX6A 4LF9F 2CIMA 1SVDA 4NLWA 2E5LJ 1FFSB 1KLMA 3IS9A 4MIBA 1TVRA 5K8PA 5U47A 4ZLNA 3CPWR 1GQEA 2V6AA 2C2EA 4UOFA 3CDBA 3PVXA 2A2CA 3EDQB 3G86A 2EBGA 1HPZB 2VG5A 3H8YA 4NL5A 2BA9A 2P9EA 4WPAA 3ZZYA 4DV7F 1IBLF 4ECSA 2YNFB 4ZOSA 2V5HG 1CQMA 3BKFA 3V6DA 3V2UC 1VC6A 2WW8A 1NDCA 2CPIA 2DBBA 5K8MA 2ZITA 4KIAA 2NR0A 1AZSB 1BMQB 2JH3A 2DRDA 3KK3B 4NCBA 3VV2B 2HLUA 2XYHB 2MQLA 3TEGA 2HVHA 2DHGA 1C0UB 3D3CJ 3KJNB 4BC9A 4YR0A 1B64A 4RW9B 2WAQD 2HEKA 1DQAA 3KLIB 1DTQB 4ZPBA 1XNQJ 3MMCB 4CO0A 2XWYA 1VOMA 3ULHA 3HZGA 1RADB 1YRTA 2M4MA 2PN6A 2YY3A 3D6FB 5HK4A 3HSDA 1OYDA 3SQGB 4F4AA 4X65J 2MKIA 3G71S 4ZVGA 4DR5F 1JLEB 2OELA 2AYGA 2ILYA 3HFVA 2FVPA 2E1PA 3MM7A 5K14B 3D28A 3OFEA 1TUGB 2R4FA 3K5PA 1OY9A 1SIZA 3QBCA 4HDHA 4JI0J 3L7PA 3VAIA 4GC6A 2DR7A 4ZP9A 4C8ZA 4M8LA 4DN9A 2JX2A 4DSJA 4MJKA 4XPEA 3CD6S 4F0KA 3VGUA 4DI6A 1PAUB 2J9CA 4CTAA 4J9QA 1EKRA 3H90A 5KFKA 1XN9A 3ZZ0A 1D9AA 1F9EB 1UFLA 2MY7A 4PWUA 4TVAB 2HRYA 4JI4F 3ENQA 4E98A 3IR6B 3TA2A 2HRUA 2OMLA 5D4NA 1RWMB 2GFFA 3R9LA 4OZLA 3I9ZA 3PXGa 1AFJA 1FEEA 4EI2A 1ZH5A 3MM5B 4B9NA 3QATA 3ZFVA 4F0HA 4PXBA 3KUHA 2J8SA 2YTCA 1B99A 3V6JA 3DMJA 4USWA 4RUBA 4C4WA 4LRAA 1KBRA 1NEEA 4YB1P 3IG1A 3K57A 5KFNA 3FUYA 2LDYA 3UD4P 3KG0A 4WTYA 1B7FA 2QV6A 1U02A 5IWAJ 3N4WA 3Q89A 1DARA 2JFDA 2KN4A 2VASA 3D68A 4LF8F 1NSPA 3H4BA 3TOQA 2AJ4A 1CJKB 3FMBA 2AJFE 3VAKA 3M2UA 4IR1A 4J90A 4M5GA 4Q2LA 4WU3A 5HP1A 3I87A 1RHKB 3R7SB 3BSAA 3LGNA 2E5JA 3MHYA 3VHQA 4ZMMA 3OV7A 4IQMA 3T9NA 2VZ9A 2KM8C 1TTHB 1YRUA 3DGPB 3SEOA 5KFGA 5KFQA 4O4GB 3M1VB 3BKUA 2YWHA 1RUSA 4EBDA 5E0OA 4EBCA 2B0GA 1UEVA 3AXKA 2GMJA 4MK9A 3QFHA 2UXCF 3LAKA 1HW8A 1UJ6A 2GJFA 3OR1B 2HS4A 5DQGA 3OLBA 2AGQA 1S9FA 2FQQB 1LWCA 1WKKA 3I4PA 4O44A 2QA4G 1EP4B 4B9TA 2WSCC 4NCGB 3QWPA 1IKVA 1F3FA 2E5IA 4J9VA 5L1KA 4XPCA 2CADA 2CQBA 4IFVB 2FHJA 2V34A 3EICA 3H20A 3PDNA 3HZEA 5HMWA 1K44A 3C6UA 4FP9A 3PEHA 3K5LA 2HQIA 3GILA 2JC1A 3OSPA 3UO0A 3NL0A 3DI6A 1H2TZ 4JI0F 2HMIA 2FDNA 2M7SA 1UWBB 2E44A 4O3OA 1PO6A 4ATNA 5D3GA 4Y3CA 2NYHA 4NXMJ 1OSDA 1FE0A 4FPIA 4LFAJ 3D67A 3D5MA 3I32A 1NRKA 2HZVA 2FVRA 4DCOB 4Z7YA 1N5YA 3U1MA 5I42A 4LSNA 3NEKA 1WKLA 3FDSA 3O8WA 4IO1A 4PYAA 4NZ0A 3GFHA 1TAQA 5ETPA 1R0BG 2CQ0A 3LPYA 1SC6A 3QPIA 3T19A 3W2VB 1R6VA 2JLFA 5HJYA 4A8SA 2ZD1A 4IDKB 2CJYB 2OPPB 5IC6B 2PI4A 1VBXA 2BJ1A 3NGDA 3LAMA 1E6VA 1ZYQA 3R5GA 2KG1A 2OPQB 4A8QA 2VODA 2HNZB 2RU3A 2QLBB 2VDIA 4BHQA 3V6KA 2ZJQQ 5FDLA 2R7QA 4DDFA 4AD6A 5ETKA 3VR1A 3GQCA 5KFUA 4TU9A 2D3OR 3ILJA 2VC0A 2QZ8A 2E7XA 3BQ2A 5A0YB 3IP0A 4ZK7M 2IAJA 2XS2A 2AZ1A 3E8OA 3PRVA 3LQVA 4X4RA 4IO9Q 3BN4A 1SIWB 2E5LF 3ZZRA 4UT4A 2MY8A 4N8NA 4X66F 1FJGF 5THWA 2VPYB 1F1BB 1NDPA 4RJVA 3IM8A 1D3WA 4PR6A 4KAIA 3OUYA 1P9QC 1WNEA 3UW1A 2E1RA 3RYLA 2AHOB 4DUYF 2DEJA 3B78A 1RT5B 3I5AA 2VH7A 1S7HA 4R5PA 1LXNA 2XCAA 2DNNA 2GQQA 4ZN1A 3H25A 2GO8A 3AA8A 3KOAA 3MMBB 3L9ZA 1PAEX 1YI2S 2IA0A 2HQ3A 1HWJA 1SKRA 3ZC4A 1RWKB 1MN7A 1RLCL 2MZSA 3QMQA 5CYQA 3UDEA 1S0VA 1QJHA 3RAQA 2YNFA 4PG4A 2EK6A 2PMZD 3IRWP 2AD9A 2E5HA 4DPOA 4IRCA 3J7AN 2YVSA 4ZVPB 4I64A 2YNGB 1P8GA 1PG5B 3W62A 1QAXA 1URRA 3ICLA 1AZSA 3SFUA 4USKA 2HQDA 3D6MB 3CUNA 3T1HJ 1RYRA 4YB7A 3X1LB 1F3VA 2YWWA 2GHPA 3MFHA 3MI7X 4WIIA 2ZZMA 2ZFHA 3BYRA 3DGVA 1M1KT 4B3MJ 2J6TA 1YJVA 1VS3A 5EHHA 5IV3A 1FKPA 3WIUA 3UPFA 2ZJRQ 2XNRA 3KMQA 5GAEI 4EK2A 4A48A 4YDDB 4CLPA 5KFVA 3NMAA 4AQYF 1DRZA 1RHJB 2H4YB 4JI2F 2DTJA 1N48A 1S76D 1RCXB 2VG5B 2J0XA 2N7YA 3DXSX 5HI7A 5B0CA 4ED3A 2OH2A 3MM7B 4ELUA 2G2YA 2E9ZA 3M8QB 5L9NA 1M5VC 1YQHA 4LRBA 3HVTB 3KK1B 2QLWA 2WSFC 2WVFA 2MQPA 1IKWA 4UTGA 2FY8A 3TAPA 2V8HA 2FHMA 2YKOA 5EGYA 3PV8A 2J7UA 2DITA 2GVZA 3WZ0A 3VCDA 3DOMB 4CTAB 3MAAB 4RW6B 3EUNA 4LIWA 1DTQA 3GIMA 2P5VA 4X4VA 2WBMA 1NKEA 1CULA 1QY7A 3HJVA 2O01C 3DRRA 4IG0B 2ZKUA 2BANA 2HLTA 4N47A 3HHEA 3T5HA 3M8ZA 4F36A 1HHTP 2XY6A 2P6TA 4LFBJ 1F60B 3M32B 3QJJA 1K8AT 2I1RA 1LWEA 4CO2A 1KQKA 3D3BJ 5G4DA 1H3DA 1JLCB 3KHRA 1XMOF 1JKHB 3FBFA 2WSEC 1CS4A 1MW7A 1EIYB 4B3OA 4M5IA 3CC4S 4C8LA 1Q16B 5LL6d 3OTOF 2N4DA 2PIIA 2GAHC 5HROA 3CJ0A 1T3NA 5JVHQ 2CXEA 5I3UB 4M94A 5HLFA 1S5ZA 4O0IA 2ADCA 2KZMA 2ZC3A 3BPSP 2AYMA 2V8DA 1RQ0A 3M7VA 1S48A 3TUPA 1DLOB 2VG7A 1U1LA 3MCOA 3I0SA 4NRUA 5C42A 3VAFA 2DO0A 4K0KJ 1JLGB 3C14A 3QYYA 2VBXA 1PYTA 3GJQB 1VQNS 1G6BA 2JJ4D 3M1VA 2H5IB 1WHYA 3ITHB 1LNQA 1NNDA 1UEUA 3W5XA 3ZZZA 4CNYA 3P6YC 2I2YA 1MMLA 2PGCA 1QVGR 2E1CA 4Z2XA 5ETNA 3OFFA 4K4TA 1RSCA 4P71A 1MROB 2DH7A 3BPDA 1XNRF 2FLNA 1U49A 1XC9A 4QPTA 5IXUA 3HVRA 2QYGA 2BMBA 2W9BA 1HQ2A 2LXIA 4FXVA 5KFMA 1K73T 4M5LA 1XQIA 1U8WA 1U26A 3DOLB 3FJ2A 3N01A 3C6UB 4EO8A 3T1YJ 3VAHA 3JSRA 2YKQA 4ECXA 4ANDA 4KGMA 1X5SA 3AJ2A 4DN0A 3LA0A 3A3PB 1IJFB 3V6DB 2CZVC 2XEXA 3UD3P 4RNFA 2KRRA 1UWBA 4EYIB 4IG3B 4URQU 1NAQA 1F6TA 3CDUA 2C2RA 3MUTP 3DU5A 3TANA 1NJWA 4MAKA 2VICA 3EXYA 1ZAXA 3HSGA 2EFVA 2OIHA 4CCHA 2NS1B 3LGMA 1M1HA 1QD1A 3QO9A 4KGZB 4NLOA 4ETXA 4DV0J 1YIJS 1S0MA 1S6QA 4PKDB 1IXKA 1IN0A 5DQIA 1TAUA 2Q6BA 5I3QA 5D78A 2BJ8A 2CQDA 4IOBA 1S6UA 4C0OC 4NMLA 3HHLD 4KBIA 4NCGA 2ZVSA 5L1IA 1PBAA 4OV1A 1N33F 5DG7A 2AQ4A 2IMWP 2W9CA 4YHHJ 3K0JA 4PG8A 4DWIA 2FJAB 5KT7A 3OTDA 4F8RA 1FDNA 3DRPA 3TX8A 4LF6F 4CLKA 1U1QA 1SKUB 3AT1B 4TXSA 4RNMA 2X1AA 2VOOA 2NZCA 1WC6A 2OSRA 4HHHA 2DHHA 3LOUA 4OLPA 4BCAA 4CM2A 1XJWB 2QFJA 3RR8A 2Y8WA 1WI6A 4HHUA 5CXTA 1NHKL 4ZJLA 4PABA 3EWGA 2W8LA 4EGLA 1O8BA 2PMHA 3TI0A 4RX6A 1N88A 2Z57B 1RTHA 3OQ2A 1OPZA 4ID5A 2R7WA 1N52B 3V4IB 2DNKA 3AH6A 4FYDA 2JOQA 4USHA 3TX0A 1FRMA 1U6FA 1IM6A 1SH3A 4ZP7A 2PDAA 2VA3A 1HQEA 5LMNF 3G8SA 2OEMA 2LEPA 2GHWA 4OI6A 4F0MA 1S9EA 4KHMA 3HLUA 4RUHA 2H51B 3DLGA 4UY85 1IKYA 2C3OA 1WC1A 1CBKA 1TL5A 2HVZA 3F0NA 1H6KX 1J5EF 1WTBA 3V6HA 2KT5A 4CO5A 4DV4J 4F3MA 2WVEA 2CG4A 3ZTRA 5F8HA 4DCJB 2XG8A 5F8IA 1OWXA 1IR0A 3A12A 2HFSA 3IBCB 3MPUB 4M5DB 4BWMA 4PYDA 3VVTA 1V9OA 2M0GB 1N54B 1X4GA 3OW2R 2MB0B 4NXNJ 4OHYA 3ONQA 1LWFB 1RT5A 2FHOB 4I0WA 2D1CA 9RUBA 1KQSR 1FTRA 1W26A 1IR2A 4NLUA 4QU6A 1B4SA 1TKXB 3I0RB 2GQ2A 4H4OA 3EGWB 3L7UA 4A4JA 4M5MA 2D69A 3KJFB 3QT8A 4O23A 2GGPB 2I9SA 4PPDA 3UCZP 3OFGA 1WOOA 3NXZA 4JI6J 2ZNZA 3GG0A 4ZHRA 1VGYA 1VI7A 2DGQA 3C66A 3O1LA 5D4LA 2RS8A 4DSLA 4KHPF 3AA9A 2N4CA 2M2BA 4HYKA 4LFCJ 3UR3C 2XS7A 2DNMA 1SCJB 3W2WA 1TL1B 4ED7A 2BRLA 2IIHA 2Y1JA 1RU2A 1RAEB 1A6LA 4MTPA 4BDPA 3OVBA 3BZQA 4Q7AA 1MU2B 2K7KA 5BR8J 4DX8H 1Q7YT 4DV1J 3GFYA 2RAQA 3Q24A 3KJVB 4DUZJ 1MN9A 1S99A 2HBYB 1GXTA 1RT3B 5C7PA 5SZTA 2EFQA 1JB0C 2RKIB 2JWNA 3FCVA 1QE1B 5I3PA 2G0CA 1IWGA 1JLCA 3MR5A 4ED6A 4G3IA 1URNA 1FNOA 3GR0A 3OVSA 3TUIC 2RF2B 2W7OA 2RMLA 3W2VA 1E6YB 1SI9A 2CJQA 3M4XA 2DXDA 4ZKAA 1Q1KA 3LWLA 3PTWA 2GC8A 3L09A 4DL0C 4OX9J 1WORA 1QVFR 3R2DJ 3H98A 1VQYA 2HIQA 3OFHA 5BXIA 2POKA 4PWDB 4WCEQ 3M2RA 1U1KA 1UTAA 5FD1A 2ASYA 3JQKA 3HO1A 3CDAA 1X9MA 3PKMA 3Q8QB 1CJTA 3NS5A 2KRBA 2VIHA 4C8MA 1TL3B 5KG4A 3A3OB 1L3VA 2VBYA 2DVIA 4KB7A 3NP5A 5E3QA 4R8UA 2VUGA 3BR8A 3H40A 2AX1A 3IS9B 2W4CA 4WZMA 1S4FA 4Q45A 2J9DA 2PD1A 1ZETA 3ZZUA 3SFGA 4RWXA 4I7FB 3IGNA 1KKHA 4QIGA 5F8GA 1QDUB 1XNQF 3OUYB 2QMXA 1R0CB 1RKIA 3KDOA 3CCMS 1WEXA 2CDRB 3MXHP 3CIZA 4TY9A 5E3CA 1UP1A 5IV4A 1SJ4P 2FY1A 1VQPS 1H72C 3MPYA 1HKAA 2X1GA 4R0JA 4TNOA 5CCMA 4J9NA 1APSA 4O0NA 5KFZA 3RBXA 4MFBA 2YQ0A 3QIDA 4PCQA 3ZTSA 2V4JB 3BEGB 3QAEA 2HHVA 3DOLA 1RT1A 1S1UA 3K5OA 4OYZA 3IRXB 2CAJA 1SC4B 2JLEA 1JLGA 3C14B 1M5KC 1RDRA 4RPFA 1A9NB 1LW2A 5D0GA 2LU1A 3M9OB 3G4SS 5B0GA 2K1RB 4AUKA 1N5TA 3TA1A 1YJ9S 1KN6A 1FFGB 3GE9A 4HL9A 2WTFA 3LW5C 1PJ5A 3QNWB 1FVSA 2F63A 2F9JA 3GJSB 3MEEA 3PNIA 4CP5A 3N0VA 1VLYA 2N3OA 4HEA9 1ZA2B 1B7YB 2EEYA 4RBTA 5KFCA 1R3NA 4NLRA 5HL7Q 2VJUA 3PR5B 2NXEA 2BQ3A 4FYYB 2W9BB 1RAJA 1S1XB 3QSIA 1R7IA 4KH1B 3Q22A 1CJVA 4L6V3 2W9CB 4TYAA 1OY6A 1SH2A 1TL7B 2XCPA 4KHRA 4BLGA 4DQPA 5JXSA 1PKUA 2XI2A 2J8AA 1FRLA 3S6EA 3KUGA 1W2BR 2XLJA 3DLKB 4IG3A 1YJTA 5D0EA 3C6TB 3EGNA 2VPWB 4ZJOA 3O5TB 4OZJA 3CD7A 3OSNA 1M5PC 4B9SA 5E3AA 4BS2A 4NEYA 4RU2A 3RG6A 5IFMA 3QO9B 2UUTA 5AJ3F 1K0TA 4JV5F 3I5BA 2YNIA 3PRBA 3CJKA 4QWAA 1YLXA 4NLGA 2VFVA 2HHHF 1S59A 3MCSA 4DCPB 4X62F 3BQ0A 1T9XA 4HKQA 1RAHB 3BR9A 5DM6Q 1EAYC 2D3O1 2JEJA 3TQ1A 2OUGA 4I2QA 1BD6A 1M5SA 2L48A 3M32A 4NA3A 2NPFA 1Y0HA 3GMGA 5KG3A 1LWEB 5KFFA 2MKHA 4A8XA 4QPXA 2MQOA 1EZZB 2HFOA 1QUPA 2Z2MA 3M2UB 2VQFF 1CS4B 4B3OB 2HNDA 1HMVB 3TZWA 4Y00A 3I56S 2DO4A 3P45B 4C0BA 4NEZA 4MK7A 1WC4A 1LWXA 1DAXA 3J80U 1RJJA 3CMES 5T7LA 5CD4H 3TZXA 2EFPA 1JJ4A 1ZZNA 2QLFB 5KT2A 1SV5B 2YKMA 1AA1B 1Q8BA 3NG8A 3PJXA 4X62J 4DSIA 1IBMF 1C1CA 2B4PA 4Y2MA 2L9WA 2UXDJ 3GFXA 3CCES 4DR1J 1L3SA 5AJ3J 2XMVA 2EC2A 2M8HA 1YVFA 1TMJA 2ZKTA 4I1TA 2Z56B 3TJ9A 5CA5A 4QWDA 1B3TA 2QLXA 4ALZA 1LXJA 3KLEB 4DPTA 1HNXJ 2DNPA 1RCOB 6AT1B 2KVQE 1RA7A 2Y9HA 4X2BA 3FSIA 3CMQA 1OQ6A 1YJ7A 2ZJPQ 3DLHA 3ZTPA 3KLGA 3Q8SB 3BS9A 5IT0A 2UUCF 2Y1IA 4ZHRB 2P6SA 5ETRA 2PE8A 3DFEA 2FVCA 4X84A 1FWLA 1C0TA 3D1OA 4GKJF 1X5PA 2V63A 2CJ9A 1JXEA 2GCFA 3CJ3A 2FJWA 1NH8A 3HHLA 2VQFJ 3RBEA 2W2OP 4AXIA 2C2NA 2WONA 4DX6A 3V5RA 4Q44A 1WHXA 3RB0A 4DV3F 2X3DA 4K4YA 2XMUA 2J0SD 2ZH2A 2RU9A 4IR9A 2OEKA 5DLGA 2XMJA 4IH7A 2JEFA 2HHHJ 4LF4F 1U1PA 3UDVA 1JIHA 3GV8B 4G1PA 3MUVP 3BGRA 4K50A 1V5IB 4B17A 4ED5A 2W25A 2CJXB 3R6GB 2L3MA 5M2RA 2R8KA 3ISNC 4RUCA 2WVDA 2WZ1A 4JI5J 1Q0NA 2BJEA 3F44A 3FSXA 5CHCB 3R1LA 1QUVA 2Q79A 3GJTB 5F9NA 2AP6A 4K4ZA 1SL1A 2QLJB 2YX4A 4C98A 2E9RX 3IWLA 1UEKA 2FJXA 3GWCA 2XTJP 4ITSA 2X3GA 1GMWD 1SUQB 4C2MA 1UL3A 3ENAA 4TKTA 1Q78A 3NGUA 3DRPB 5D4PA 3GTYX 2EBEA 4NXNF 2HIYA 5T41A 3BBBA 6FD1A 3E2EA 2R8JA 5IZHA 3THPA 1X5OA 4CNZA 3DLEA 2HHTA 1VBKA 2APOA 1YTYA 4LVOP 5KT6A 2FLLA 2KFZA 1H38A 2MJNA 1NSKL 2MEWA 2H65B 2NSBA 2PC6A 4DPXA 4DL2A 1RWUA 1RXOB 3RGIA 2KFNA 4LSZB 3DYAA 2BJDA 4KH0B 3FBCA 4OHZA 4OJGA 2PT0A 3DM2A 1T0TV 1MLAA 2FD2A 2NXNA 2ZDPA 3NWRA 4MKVA 4TLRA 5HVGA 4KO0A 2YWGA 1F5AA 2IMOA 2RDDA 3BSCA 3W61A 2NUUG 1RAIB 2LXFA 4OHVA 2V8PA 2V2QA 3DOKA 3JQJA 3QT6A 1KQGB 4DMZA 3J81j 4Q5VA 5DDRC 3PKYA 3J7Z5 2RRAA 4DR4J 3EGVA 4B02A 2MZQA 4AL7A 1I3OB 1QAJA 3AJDA 2ASDA 3M9NB 3SSRA 2E1MC 4QIWD 2B8QA 4YUDA 2I5JA 2UXBJ 3NNCA 3BGUA 4HR2A 4O3RA 1KVIA 3H42A 1MWYA 2F3JA 5KFXA 4MKBA 5KFSA 4DU7A 4NI2A 2BX6A 4I7FA 2R7XA 4K7QA 2IRUA 1I1GA 3AHPA 1N4LA 4CDIA 3FVYA 3VQTA 5EUHA 3NNHA 4QYRA 4P10A 4DG1B 2W01A 3R5AA 2W1BA 5EX0A 3HVAA 1RGVA 4D3HA 2D9OA 2Y0SD 3GYGA 4FF3A 1IVZA 2BJ7A 2GA7A 1V3SA 4RW7A 1S79A 3SSSA 4ZITA 5HQMA 3NBPA 1LK7A 3D1HA 3D6TB 2GVZB 4C11B 4MFBB 1S10A 1N33J 1Q8KA 1V5VA 4JI8J 2CNNB 4WU2A 1JQGA 4JI6F 1VQ6S 4Q8EA 1NB2A 2RT3A 1T9WA 2E5GA 3VZHA 1F9HA 1I94J 4HLBA 3E51A 1Y9OA 3BYPA 4IG0A 2BANB 3CJ4A 4HTIA 4F4YA 1S0OA 4IUFA 1BQNB 5KOXA 5LT5A 1EB0A 1H98A 3B82A 2DT9A 1U25A 3GV7B 1U4BA 3DN9A 4J9MA 2N3LA 3EVWA 1AUSL 1M1GA 2F8HA 1S1VB 3AOAA 3BKTA 2YKNA 3MEEB 4DUZF 1RISA 1OPIA 4LF4J 1TK8A 4YOEA 1UZDA 4NX9A 5J2PB 2FC8A 1Y5LB 4K4VA 1EARA 1X7VA 1HYSB 4AXJA 1CVJA 3ZZOA 4KRWA 4NA1A 5HMXA 3CCJS 1T05A 2R7TA 1RWWB 5KFTA 1RI7A 2KJWA 4IOCQ 3BGLA 3CO0P 3ET6A 3GJRB 3KFWX 2EPIA 3WDOA 2R9LA 2FLOA 1SL2A 4ED1A 2C3PA 2V2VA 5DQHA 2D74B 1RT2B 4OI0A 5JVGQ 2DRBA 4LFCF 1SQFA 2R8GA 2NQPA 4I6YA 1D9FA 1VK8A 2DR8A 3MURP 3SV3A 1VC5A 2VG7B 2AGPA 4U7UK 2RD5C 5LMNJ 3PCOB 3PJWA 1H74A 1HNWJ 4WBFA 2KFYA 2ROGA 2M70A 4OI2A 4CLLA 4KTQA 4ANEA 3QZ8A 2EFOA 2LCWA 2VPXB 3D66A 4FYWB 4DBQA 1FJCA 1H2VZ 4PPZA 1B70B 1S9GA 2YKAA 5DRKA 3DNCA 3CCTA 4DX5A 3HHLC 2ZE2B 1CSJA 4Y65A 4ZPTR 4RBVA 2C3YA 4R8UB 5KT3A 1K1SA 1S1TA 3IAS9 4UF4A 4G1QB 3S1TA 2F1FA 4DF4A 1VQ9S 2GIFA 3CJ2A 3MCNA 4TY8B 9ATCB 3OHAA 3OTOJ 2IJNA 2V0NA 4LF6J 4NPOA 1OS5A 4OL8A 1GXUA 2EFNA 3BH6B 2CNLB 4E2FB 2ZM6J 4F4ZA 1UVIA 1VRUA 3H2UB 1JJCB 5LSLA 3FBBA 2B8PA 4OYXA 1FKOB 1U1NA 2XS5A 1NK9A 3HSZA 2B4VA 2DEIA 4WK1A 1JLQB 1SJFA 4UOHA 2GMLA 2CVIA 5J2MA 2VKZG 3O2IA 2M9KA 1YBUA 4L75A 3X3UA 3CDWA 5DG8A 2LEAA 3M30B 4F2RA 1L3KA 2D3UA 4P74A 4KT0C 4NLDA 5DGBA 4ZVRB 3JYTB 4DSKA 3DGPA 4K4SA 2CG8A 1FRHA 2E29A 4LF7J 2GNKA 4CRJA 3VAMA 1YITS 1C0UA 3HT0A 2KJVA 3UI3A 2AKWB 1T94A 1WSVA 2CDQA 4ES3A 1BXNA 3QIPB 5MLCV 1SXLA 2CWKA 3PHEA 2CJKA 1GFWB 2LQBA 5BJRA 4F4KA 1LWCB 4ZVHA 5DM7Q 4JV2A 2UZAA 4DOZA 1T03A 2ACYA 5B0EA 4C9DA 1HBOA 1C0TB 4FN5A 2C2KB 5CCLA 2CQPA 4EZ9A 2V8GA 4JI2J 4Y0FA 3GPAA 3CVKA 3QRRA 2YX7A 2CJAA 3H2VE 3V81B 1VIOA 4YS2A 5KFDA 1DTTA 5ETOA 3Q8YA 1Y00A 1PIEA 1F2GA 2FYXA 3FNNA 2VG6A 2Y0BB 3PRDA 3DLKA 4K5RA 3MTKA 5HJXA 1QAIA 2Q6CA 2DCLA 2WK4A 1GXLA 4ID5B 3AAWB 4J7CA 4HHJA 4USMA 5EWGA 2BW2A 4QW8A 3SXLA 3GIKA 4DV0F 2XSJB 4WFAQ 1ZOTA 3J81U 2BJ9A 4LSNB 4XDDA 1TKTA 2XO6A 2I6WA 2XYPB 3SQOP 4PQAA 1HIYA 4ZPVR 1N0VC 3G9CA 2CYYA 2O1PA 4DZDA 1I94F 1VQLS 4GO5X 4DL3A 5M2UA 1UPMB 2C1EB 4B3SJ 1CQNA 1BWEA 2ZD1B 1DY3A 4IDKA 3GU0A 1WDDA 1PJ7A 3QLHA 4LF7F 1E6VB 1FDBA 2F5GA 2CPDA 2HNZA 1VCTA 2ZEJA 3DC2A 3DOKB 5GMKa 5KFJA 2QO3A 2BE2B 1XMBA 4MIWA 1FWKA 2HGLA 1NPKA 4GO7X 4P72A 3BREA 1N34F 4QOTA 3T6BA 3D54A 3BO2A 4ECTA 3SCKE 2QE5A 2ZOGA 2CWXA 1VHFA 2QGFB 4FVCA 1U8SA 4A8MP 4RLEA 2Z2YB 5ETLA 2DGSA 4ID8A 1FRKA 4ZVSB 1HNIA 1TKXA 4ZDNA 1KHWA 3VGSA 1YK9A 4TQRA 2VJVA 2KXFA 4F4XA 1JXLA 1RWVB 1IJEB 1VBZA 2FZKB 4KC5A 3D4JA 4CT9A 4XK8C 3EZUA 4YDXA 3J7ZT 3SV4A 3PX4A 3DM2B 3O6QA 2BKPA 2FJDB 2HK3A 4J37A 4NLPA 3FFIB 4PXCA 2H4WB 4CLTA 2DNZA 2H1YA 3MGJA 3TVYA 3EPIA 5C2CA 1HQUA 2MGZB 3H5XA 2B4OA 1RLDA 2RNEA 5F0UA 3AQPA 3PM9A 3KLHB 5KG6A 1H0HB 4NWBA 2V2ZA 4CLSA 3FSYA 4B9VA 1WC5A 4M5NA 2CPEA 6FDRA 3TP2A 2U1AA 3P96A 4J5OA 1RAGB 2YPZA 4LF1A 2WVBA 4P52A 1FE4A 1PGZA 2VD3A 2NXJA 5ETTA 1VMBA 2J0QD 2UVRA 3KJVA 2ASJA 3OTCA 5BYSA 2R7VA 1YJUA 1DBDA 1SKWA 2X7IA 4X4TA 1PC5A 1WG4A 1TZ0A 3IMQJ 1OSCA 1U0SA 1Y5IB 2Z8QA 5E5NA 3H2LA 2KG0A 1T9VA 1G7CB 3ENVA 2C2DA 1G3OA 1CC8A 2E1AA 2NYIA 1VDHA 3LWMA 3RW6A 5KFOA 3I55S 2ZBIA 3H0PA 1Q86T 1YJRA 2C22A 2VPZB 4RW4A 3N79A 1JMTA 2GVDB 4FZVA 4QWBA 1YRXA 1Z2LA 3SDEB 2V4RA 5B0DA 3UN2A 1J5OB 5J2QB 5KFLA 4R25A 3QGIA 3HFKA 3NAIA 2CPFA 1JX4A 2NPIA 3HFZB 1U1OA 5B0BA 2BUNA 3FQLA 1B0VA 2OFHX 4R0EA 5EDWA 4N7TA 5I4MA 1FD2A 1FF2A 2ILZA 2OHDA 1WHWA 1VRTB 2AJ2A 2OPQA 3D0HE 1S1VA 3QT7A 3OJSA 2RB7A 4FNHA 4Y2CA 2OJ3A 4KFBB 1KS2A 2QTWA 3AOBA 2UP1A 1CULB 1FX4A 2HGMA 3OTEA 1F9FA 4W98A 4B3MF 1T95A 4CT8A 1ZM4A 5KOWA 1QLNA 2Q66A 3OHBA 2G13A 4QZVB 1U1MA 2KZZA 2CZ9A 1JJ2R 4G1QA 1WF2A 3M2VA 1AT1B 2MKYA 3T1HF 2MKJA 4F50A 4NMXA 3DYAB 5L8RC 3HT3A 1Y10A 3LP1A 4M63A 1FDAA 4UW2A 4USUA 4DQSA 1R0AA 1DQ9A 2V4JA 3KMSA 1NXIA 3EYZA 1R27B 2CPHA 4C7QA 3EPGA 3NCRA 1HNZF 1HA1A 1MG7A 1V6HA 5A8RB 5KG5A 2BKNA 2YWKA 2ROPA 1RT4A 1BWVA 1KHVA 1P1TA 2MZRA 3OXFA 4M1KA 4ZVUB 3KK3A 3K5NA 3HHDA 2J6UA 2HHQA 1DURA 3MR6A 1N5SA 3H59A 1U24A 3GR1A 2L9NA 1KTQA 2Z58B 4OYBA 4JUZA 4YFUA 1HWUA 4DUYJ 3MPVA 4M5HA 3OR1A 1U7LA 3HULA 3MMCA 3TR5A 2YXLA 2ZBQA 3BDEA 5A6PA 1FJGJ 3PYGA 4EMDA 1FRJA 3NS7B 3NS6A 3P49B 3U1LA 2DNHA 3J80Y 3FCHA 3ZO7A 2IJFA 2AW0A 2DK2A 1CJVB 1S6OA 3BBCA 2YWEA 3KLFB 3CMAS 1PSDA 3VALA 3KHLA 3SI8A 2UVUA 4FS2A 2P9GA 2DGXA 4NLVA 1D1UA 4OX8A 2F4VF 5HSPA 5AXMA 2IVYA 5KFIA 4AL5A 1TK0A 2XULA 4JB8B 2RUSA 4JBCA 5KFHA 4F7VA 1NK8A 2XMKA 4DFJA 1FO1A 2I0XA 4RR5A 3V81A 3OL6A 3DDNA 4ZPDA 1L3TA 4ELTA 5IOLA 3LO3A 1EETB 2EI5A 4ZN3A 1HI0P 4AYBD 2OAUA 1FFWB 1RWNB 5E2QA 3AFGA 2DJWA 3PW2A 3T5KA 2D3ZA 2IFXA 3R5DA 3JAMU 4GKJJ 4I2QB 3MM5A 5HAOA 2NREA 2KT3A 2W4DA 3LH2S 3KNGA 3T41A 4CO4A 3Q83A 4KQZA 4S0MA 3WBZA 2J0WA 2DGOA 2W4PA 1S6QB 2ABYA 3W7BA 3MZIA 1O6XA 5HVFA 4NXMF 5B0AA 2QA2A 1IBLJ 1FKAF 3CJRA 4IH5A 3K89A 3J81Y 2QRRA 3SYZA 4OJ1A 3TO8A 3NCQA 2NLWA 4GVBA 3R2CJ 3Q2TC 3W65A 4ZA1A 2DXFA 4J9SA 1FX2A 5T7LB 2M3DA 2QSWA 5A0YA 2KXHA 2BDPA 3W8GA 3BV8A 2B7BB 5IWAF 2DGTA 3P5TL 1HBUB 4DU8A 4WYLA 4O4RA 1W2IA 3U27A 4ZLPA 1MWQA 1KLNA 4QCLA 2BZ2A 4WFXA 2WCXA 3A8JA 2LDIA 4CO3A 4EO6A 1S77D 1NK4A 4DL7A 4H4KA 3M8SA 2BV3A 1X0PA 4WE1B 1Q79A 4LREA 1FK9A 1Q8IA 3BQ1A 3I9V9 1DLOA 1U0HB 2MHNA 3HHNB 1TUVA 5GAHI 3E01B 2QC3A 3CWJA 2WRMA 4RWWA 2IC3A 3LTOA 4C8OA 1S6PA 3KWMA 4C6AA 3EM1A 1EQ0A 1Y4ZB 3DDKA 4JI5F 2L9DA 3EVMA 3TUJC 4OZ2A 4EUVA 3CCUS 1YBTA 2BYCA 1X8DA 1R8CA 1Y3JA 4OZ0A 1N56A 1P27B 1TKDA 4PQUA 2FHKA 3PFOA 3PJ9A 4K2XA 4WF9Q 4J9UE 3CCLS 2OD4A 3DLBA 1S9EB 3KLVA 2WONB 2QN6B 1IBMJ 3L3CA 2P8IA 3HD1A 4HI2A 1RAFB 4ICLA 4CLZA 2HWTA 1H7WA 4QR0A 4CYUB 4LF8J 4WFYA 3PW4A 2FB0A 2PEHA 2RQKA 3MM8A 1FKPB 3FCWA 2CRLA 2A10A 4FBUA 3GSDA 3GLJA 1OO0B 3PZPA 5D0HA 3KK2A 1LQ9A 4X4NA 5J2NA 4B9MA 2ZBRA 1TP7A 2AX0A 3G2XA 4RW8B 1N5YB 5I42B 3FFIA 2HAIA 5LMUJ 1MWZA 2GS8A 4ECWA 4ER8A 5LSRA 2ZHOA 3IC1A 3MTJA 4P2SA 1NM2A 3A8IA 3ADAC 5ADZA 5DDPC 3HX9A 1S97A 3PY8A 1N0UA 4Y2AA 2W2PP 4DR4F 2KB2A 1K0VA 4FXDA 1RACB 5DDQC 3PO5A 5E3PA 2Q43A 2QA4S 2GVDA 1WTFA 2JVRA 2GV1A 4P2MA 4U8VA 4DX7A 1J5OA 1PYSB 3MD1A 4ZCIA 5E41A 1XWLA 1R31A 3C15A 1OYEA 3BF4A 1B0TA 3C3LA 4YN3B 2B5JA 3MR2A 3CTRA 3SIPB 3VZIA 3IWXA 2W8KA 2R2RA 1WELA 5IQQA 1AXQA 2K7JA 1VIXA 4WJBA 3F73A 3TAQA 4PG7A 4AE5A 5HMZA 2R3VA 4DSFA 2D7SA 2HBQB 4UZCA 1RAAB 4DQRA 1AYEA 4G6VB 5KG2A 4N8OA 1S12A 4ELVA 3BJYA 3A1YG 3CD0A 3HCXA 3AQOA 2AEMA 3BM7A 2DRAA 2Y1RI 7FDRA 4MK8A 1QE1A 3US5A 1ZAVA 5ITHA 1KNZA 5DDOC 3OL7A 3QZ7A 3W3SA 4QW9A 2EKNA 1S1WB 1V3RA 2LQJA 3J7YI 1I51B 2LVWA 2O66A 1FWPA 3CJQA 3FZ2A 2ZOMA 4GMKA 1X4CA 4ZVFA 1RWPB 3W5ZA 1PYOB 2IHR1 3JSMB 3R1HA 4DZ6A 3RB6A 2KT2A 2NCKL 4QIFA 4QIVA 3B4DA 3H7HB 4LQ3A 1TU0B 4WK3A 4RL1A 1HBNB 1UAWA 1REVB 3FKBA 2PA8D 1ICEB 3D0GE 3GYNA 4JP8A 2OPRB 4NI2B 4NLXA 3TNVA 3WX4A 4ZVEA 3C19A 3DLGB 1BGXT 1LW0B 1R6YA 2WVCA 3I31A 1MROA 4N56A 1YKWA 2ALZA 4KE5A 2J6SA 2VL1A 1VK3A 4KJIA 4UOGA 3OTBA 2GO9A 1ITPA 2E7WA 2EKYA 2COLA 3FC9A 3HSJA 4WZQA 1HBMA 2JEGA 5EN1A 4JI7F 1M90T 2GQCA 2XYGB 4ILMA 3BGFA 4P2XA 3ZNJ1 1NU4A 1Q8LA 1RWXB 1ZA1B 2HZCA 1TVRB 2KI2A 2MLXA 4NZ7A 5AXNA 4X4QA 4DR2F 4IRKA 3KNAA 4NA2A 5J1NA 2BE9B 3BH7B 4DS5A 2BVZA 1BQNA 1QTNB 1YX2A 3EDRB 2LECA 4B3TF 1IKXA 4F3OA 4C3LA 2E66A 2QMUB 2VFRA 2Z0GA 3CCSS 4DR1F 4DL6A 2MSTA 1X4EA 3M6UA 1HNVA 3N9UC 3CNQP 4LSLA 1EKSA 2IJRA 4WIQA 2VV5A 1HYSA 3M8PB 2A3JA 2CQ2A 5J1PA 5HANA 1ULRA 1F0XA 3GV5B 1TL1A 3IM9A 4U95A 4M5JA 4F02A 1T9TA 3QWUA 2DY1A 3L7OA 2KHDA 3NGRA 4RW9A 1RTJA 3CIMA 7AT1B 1RT2A 3GIRA 5HN0A 2LLZA 4DR3J 1BLUA 1PC4A 1SH0A 3P8BB 3TRGA 1CEZA 3BN7A 3DRSA 1Z1ZA 2MDAA 1NK0A 2NUHA 2XHCA 4WWSA 5D77A 3ZXWA 2RE1A 2RIJA 1YZ7A 1FEHA 3FK4A 5D6GA 4WKRA 2YH1A 5C5JA 1YG0A 1IUJA 2VBWA 4G1IA 4XIUA 5J2QA 3RB3A 4YMEA 1SC3B 2HPUA 1SJRA 2PO4A 1ZAWA 2ZNYA 3TVKA 1Y7PA 3A13A 4OYOA 3L95X 4ZCLA 3UNGC 3CJ8A 1NK5A 1TL4A 4JV5J 2DH8A 1Q53A 3RJMB 3TARA 2CQGA 1BHNA 1RZMA 2HWIA 4TQSA 4DL4A 2NZ4A 5DZ7A 1TL3A 1MNEA 1BQMB 1FCAA 4GVBB 4ERDA 3QAUA 2GJIA 2RS2A 5IT9U 2VBZA 3BBFA 1REGX 4JV0A 1S6PB 2MHEA 4MMOA 3P3DA 4DF8A 3CDEA 2HNYA 2ZUAA 3IN5A 2LQ8A 1DHMA 1HBUA 1XTZA 3CF5Q 1R0AB 1CJUA 5B08A 2RQCA 3CULA 2LYVA 1Q7LB 2JFKA 2UU9F 1VQOS 2DB1A 3TZYA 4ZPCA 2JC0A 1KRPA 3M30A 2W9AA 2CPZA 1X4BA 1BE4A 1LWFA 1KLMB 1HI1A 1NUEA 1L5UA 4RZRA 1NDLA 4WE1A 1UVJA 2CPJA 2RRNA 2JHEA 2P2CB 4OI3A 3QRPA 1TFYA 1A0OB 2HHXA 3KTQA 2IC3B 3T1AA 2G2ZA 4ECVA 3TYTA 4QQBA 1GTHA 1T03B 5B7WA 2BQUA 3H5UA 3C16A 1WEZA 1HBOB 1FERA 3BGOP 3KLEA 3RB4A 2RUGA 4A8KA 2GHVC 4JOUA 2HW3A 4U7UD 4DV2J 2ZBPA 3W2WB 5H9FK 1I5OB 3R7BB 5GADU 4DR6F 4DV5F 4GKKF 4L3NA 5KFRA 1Q5VA 3U7JA 5GAHU 2ZOFA 2NXUA 3DRYA 3MM8B 3TJAA 5JUMA 1GTEA 4K59A 5DLFA 1T8EA 3SQGA 4ED4A 1TKZA 4ZPAA 2R8IA 2OP5A 4YP3A 3D0IE 3TAMA 5CD4A 2OPSB 1JJHA 1N5VA 1WOSA 4Y6IA 2RJZA 4NLQA 1DZ5A 5H9EK 2OD6A 4KPYA 3EZOA 1YBAA 1NJZA 3K8VA 5HATA 4W90B 1BUXA 1F5CA 1G4CA 1ZBTA 2DISA 3C6TA 3G82B 4QR2A 2QG9B 3TQEA 2RHSB 4D3GA 1WI8A 4YHHF 4AL6A 1VBYA 3RBZA 4L73A 1BC6A 3V4IA 5C2GA 4ED8A 1KTVA 2C2MB 2J7KA 3QLHB 2VFTA 2Z2LA 4WXOA 5LSOA 5AT1B 3WC0A 3HHKA 1UA0A 1X9SA 2WOMA 1FXRA 1GK8A 4FKXA 3M05A 4OX9F 1D09B 3TA0A 3NOCA 1BQXA 2J76E 4NYPA 1SBRA 2B6AB 2E7VA 4FNIA 1X4AA 1KOHA 1QM9A 2BABA 3A8EA 2KDOA 4XTTA 3NOGA 1KSPA 2OTLS 2B9WA 2OEJA 2QL5B 2YNHB 4BC7A 4ZP6A 4ZCKA 1LFWA 1TK5A 3IR5B 4J9LA 4K4UA 1R89A 1KONA 4H54A 1RHQB 2B9EA 5F8LA 2IA6A 4TLQA 2W2NP 4TN2A 4NRTA 2OKQA 5IT9Y 4WFBQ 3DLLQ 2J9DE 1NHUA 5BR8F 2OGUA 4DR6J 1C1BB 1K1QA 1QSSA 4GKKJ 5GMEA 4LVNP 2QSFA 4DQIA 3MCMA 4UY8T 3OLAA 1HQUB 2W24A 2MGZA 3RAMA 5L1LA 4P73A 1T3OA 2YKMB 1RTZA 2XY5A 1XNRJ 3RZAA 2UUBF 2H9ZA 2XGPA 2DYAA 3DHXA 2DH9A 3PO4A 4AT1B 3G87A 1O5JA 3R6LB 3G6VA 1D8ZA 1NH7A 2SXLA 2RDJA 4V19X 3G6XA 3JS9A 1LW2B 2IM2A 5E3RA 2R2UA 5KFBA 5GAEU 1IBKF 4N41A 1JNRB 2YPYA 3KG4A 3MMBA 3M9MB 4PQUB 2V8VA 4DPWA 4C48A 3Q8VA 4YEAA 2LU2A 3EZ5A 1NCLA 2V9KA 3ISZA 4OMFG 4HACA 3WQPA 1MU2A 4FYXB 4ETZA 2VA2A 2ZWPA 5KFEA 2PI5A 3A4TA 3T1YF 4L72B 4K4XA 3J7A1 2DNRA 4DV4F 1S1XA 4JI1F 2HKEA 1DFDA 3FEZA 3M6VA 4RW4B 3CCZA 2ATLA 5L1JA 2HMIB 1KOOA 2CQCA 5K14A 1KFSA 3UFCX 5ETMA 2MPUA 4ZIWA 2AJ1A 4KV8A 4DJBA 1HL6A 3DRSB 3MEKA 4LF2A 1E6YA 4IH6A 3PX6A 4Q0BA 1TQLA 3DHWC 4LFBF 2H5EA 3MEGB 3R97A 2MZ1A 4K2JA 5CZVA 1HNXF 2BKOA 4KY3A 1S0NA 5LOQA 2H48B 3DRXA 3G8QA 2AYEA 3ELHA 3MWBA 4MYUA 4WXWA 4KGXB 2YNIB 3CD5A 5FIIA 3JAMY 1FNXH 1OY8A 4LSLB 1CJTB 3PHTA 2M52A 3K5MA 2D41A 2HURA 2G1HA 3UCUP 2HHWA 1IR1A 5E7OB 4NASA 3JTOA 2CPYA 1OIAA 2BJ3A 3W63A 2AZ3A 2MSSA 3EE3A 4LR7A 1DJ0A 1BY9A 1RT7B 2ZBCA 3IXQA 3NAHA 3B4MA 3CB4A 2HS3A 1X4DA 2MKSA 2NXCA 2RVJA 3D1QA 2IM1A 3RTVA 4A8FA 4DR3F 2IBKA 1U45A 1ACMB 1U2FA 1AFIA 1HLWA 2C42A 4LJMA 5IQ6A 3D9BA 3P4UB 3ZTQA 2M8DB 1DQ8A 2IAJB 2R42A 1ZTTA 1XMOJ 1CJKA 2BM0A 2MLZA 2RQMA 4ECRA 1VQSA 2B51A 2UV8A 5CABA 4CQ1A 4RBUA 1FT8A 2EG1A 1TV6A 2HVEA 1LKZA 1S1WA 1TMMA 3FEYB 3LP2A 3OR2B 5D4OA 3U1NA 2JDJA 1UW4A 2R7OA 1R8HA 4ANCA 1PILA 5KFWA 1CPZA 4E0DA 2F4FA 4LF5F 3JTNA 1R8BA 3ILLA 3WX8A 2BEFA 3K58A 2GW8A 2LQ5A 1RTIA 1RAOA 4O4GA 2KVIA 1REVA 4I69A 5K5MA 1V3ZA 2OLWA 4ZLLA 2C3UA 1ZM3A 1S57A 4K5SA 4ZLJA 4JV1A 3MECB 1SC1B 2DPIA 3O3LA 2KL8A 1LW0A 5BYRA 4ZIVA 1UVNA 1VQ8S 1FNMA 1EP4A 2MKCA 3RUBL 1WACA 1WWHA 3D7SB 4TY8A 1KEKA 4LBHA 1N6QA 3PYEA 3MUMP 1U09A 1NO8A 2KO1A 3HHLB 3UCGA 3AODA 1JLEA 3THVA 1FESA 2FC9A 5CZXA 2HS0A 3UVJB 5DG9A 3VAJA 2O5DA 3M6XA 5L9XA 1GMUA 2FJBB 1HHSA 1P6TA 2EVZA 5D3GB 3LF0A 4GRSA 2B7CB 2M88A 3G96A 1FJEB 3TAMB 1HI8A 4A47A 4JYAF 1TR0A 2GMHA 4I2PA 4PG5A 4P9SA 1HARA 2A2DA 5D15A 1YJWS 1XMQF 4K0KF 2K8GA 3CJKB 3DU6A 2XO7A 2ZH6A 3CE8A 1HNVB 3HVTA 4HVZA 5F9LA 1JXVA 4OHXA 1SQEA 3EJMA 3EX7B 1OQ3A 4V1Ak 4HDGA 1XBWA 2HK2A 2HFZA 3K2YA 1NK6A 3QGPA 3HXMA 5CYMB 1RA6A 4FVMA 4Y2IA 2ZHBA 3K8WA 3Q8PB 1RWOB 3MAAA 4KGVB 5AXKA 3W9JA 3THTA 5F8JA 4FPRA 4L3KA 3VF0B 4CLWA 1GNKA 2WOMB 1Q81T 5GVQA 2HNDB 2ERRA 2LP4A 2HYIB 2MJUA 1UZHA 2ZZNA 5DZ6A 3IWNC 4XAKA 1W7WA 4LBPA 3DDIA 2AIRB 4NLYA 4CI0B 2A0FB 5H1SV 3ET6B 2HBZB 2LQ9A 1WF0A 1EQMA 3FRYA 4LFAF 3ZTOA 4U7CA 2KM8B 1N32F 2U2FA 4NLTA 1N8RT 2BW7A 4ECUA 4EWTA 1U6BA 1FK9B 2YX1A 2LA4A 2ZH4A 1U0HA 2UVVA 3MMAA 2CPXA 2IPOB 4UOCA 1LEOA 3E01A 3JB9k 4QYZJ 2FUG9 5HBMB 3AJ1A 3AY0A 5HLFB 2W2QP 2Z2ZA 4OHWA 2JLGA 1SL0A 2KU7A 1F5BA 3HF5A 1UJ4A 4I4BA 1NDKA 1RHRB 1TKTB 4UQTA 1S9GB 3ZNUA 2B6AA 5ETQA 2CQIA 1RTHB 1NJYA 3GCWP 2C2OB 1BQMA 4LIRA 4OIXA 2FJVA 4PEOA 3BSNA 2H5JB 5LMUF 1MSWD 4OI1A 3D6HB 3W1YC 1SJQA 2M5YA 3N6MA 3UNYA 2UUAJ 1H2UX 2LFVA 3DCAA 4W92B 4OYIA 5KG1A 2EG2A 3Q8UA 3PW5A 2GIQA 1U2CA 4FYVB 3S01A 4WYWA 2BACA 2HG4A 4ZVOB 2VOPA 2DR5A 5DS7A 4U67Q 3GIIA 2DNQA 3PG9A 4QBUA 5F8NA 2A6MA 5BYQA 2K3KA 5AE1A 5MAOA 2EK1A 1VRUB 2XWXA 5CYJA 1T05B 3CCWA 4XO0A 2HRTA 2AGOA 3A8KA 4DG1A 1J27A 4NYOA 2DNYA 1HNIB 1YSJA 5EWFA 1JLQA 3B6BA 4UZBA 5J2MB 1RHUB 4LR8A 4C11A 2XB2D 2B43A 3HDSA 1UVKA 3LP0A 2KKHA 4WP3A 5F3TA 2P9CA 4RU9A 2HHSA 4IRDA 3MOJB 2DHAA 4RKUC 3M8QA 4V19J 5HVHA 1UVMA 3C15B 2XMTA 3NWGA 1XERA 4U6PA 2BQRA 4KV8B 1U1RA 1QTMA 5HMYA 3VVUA 1FA0A 2B5JB 2DKOB 2OPPA 4ZJQA 4HH1A 4KKOB 5A8WA 5H9FJ 3AD7C 4NYZA 4RW6A 1NHVA 4U96A 1RE1B 2KYXA 2XHWA 1NKCA 3UDCA 5HQLA 3CEDA 5J2PA 1SQGA 2Y1LB 2ZDOA 3GB0A 1ZM9A 1GAOA 3TWZA 2PFDA 3CW2C 4X66J 2FVQA 4JI8F 4ECQA 3T5LA 1JLAA 5ETSA 2ZH3A 1DTTB 2AJQA 5H9EJ 4F3QA 1UWAA 1FI4A 2QA1A 1C4AA 2WW4A 3MR3A 3Q86A 1VQ7S 2HZAA 4OJ3A 1VYAA 1HWLA 4DPYA 3CC7S 4K8RA 2DR6A 3NY0A 2XMAA 4OZNA 2HFVA 2AF6A 3DKDA 1AROP 1M0SA 2IRYA 2QYCA 4R5PB 1NPRA 1RP5A 4ECZA 1HR0J 4LMZA 5C24B 1Y3KA 2UXBF 4IFYB 3UDLA 4KR0B 4MKAA 2RF2A 2XC9A 1FXDA 1NK7A 1LFPA 2HVDA 2ZH7A 3I0SB 5C42B 2W7AA 2JEIA 5KFYA 3LUYA 2ZH1A 4F4WA 4GC7A 3ENWA 4RO0A 4JI4J 1PJ6A 1XK8A 4KPCA 2HFNA 2YWFA 3AOCA 3M2RB 5K20B 3KHHA 2FJEB 3QRQA 3P5BP 5A8KA 1RU1A 4J9KA 3F41A 3EMTA 3ITHA 2G4BA 2CNOB 4QJVA 2ZHAA 3FEXB 3MPWA 2WB1D 3MFIA 1PBUA 3M8YA 1JLBB 2Y8YA 1XIQA 4B08A 4OYAA 4P2FA 1QAYA 3I4HX 1TFWA 5K9FA 3NKYA 4J9RA 2B3TB 4P7TA 5AXLA 2R7RA 4DR5J 4ED0A 2IM0A 3NBPB 3NGKA 4M5DA 3OR2A 4YR3A 3Q23A 4NOHA 2EFGA 4LT6A 1P9YA 4F04B 1WHVA 2Z30B 3GSIA 3HVWA 4F2SA 2R7SA 4LR9A 3KK1A 2HWHA 2I38A 2UXCJ 4H4KC 4OX7A 2WHOA 3OT9A 3QQCD 1M5HA 4CM0A 5C25B 4K4WA 1YGYA 5KFPA 1SJ3P 1HR0F 2GGPA 2XY7A 1IM4A 1D9DA 2BOAA 1HNZJ 1B0PA 1HPZA 3HKWA 3MM6B 3DOMA 2FZGB 4HACB 1LV5A 3QIPA 1WEYA 5A2QY 2FIUA 1KD1T 2HAFA 1X31C 2X1FA 1UJ5A 2JVOA 3HKZD 1XMQJ 3GZ7A 2E9TA 1JNZB 2KH9A 4J9PA 4IOAQ 3OL8A 1N36J 4OI4A 1YWXA 4Z37A 2IDLA 1KDNA 4DFKA 2DPJA 3KLIA 1K9MT 2XLKA 5KG7A 2QX0A 2PSZA 3B54A 4LQ9A 3T6JA 3CO9A 4BBYA 1NSAA 2F8EX 2FGOA 1X4FA 4Q0BB 3H5SA 4WFZA 5LJ5Y 1EX8A 1RABB 1RHMB 1RT3A 1T7PA 5E33A 4M95A 5I3UA 1K47A 4U9RA 3OVAA 2XSJA 5AE3A 1EETA 1TL7A 4DV6F 1XR6A 3MR7A 3N5BA 2XNQA 1GEHA 3QJLA 4TYBA 1QSYA 1Q95G 2DCUB 3I96A 4A8WA 2NSCA 2UUCJ 3MMAB 1T11A 1WDTA 3PYDA 2G9OA 5CYMA 8AT1B 2QL7B 4GVLA 2RQ4A 2JL9A 5HBMA 1S1TB 3IGVA 1FXLA 1IBCB 1D8YA 2C3MA 3H4DA 1RT7A 1NSQA 5EWEA 4LF5J 4QIEA 4FS1A 1RBOB 1XEZA 2CA9A 2J9EA 2QJ3A 4FXWA 3UE2A 1ZPWX 1A7GE 2QL9B 1O0PA 2VFUA 4J91A 4DR7F 4X4SA 1SPBP 2UXDF 3PX0A 5G0RA 2XLIA 1X0FA 2KTQA 3Q8RB 2F7VA 2R2TA 2VU5A 4L74A 2IYGA 3FQKA 1VLOA 2F9DA 4X65F 3LP2B 1TV6B 1HMVA 3IO1A 4DEZA 2RDIA 3C46A 4LRDA 1G1XA 1VC0A 3RRGA 2UUAF 2FTRA 1AUDA 1U48A 1G2EA 3G6YA 5A8RA 2OSQA 2AU0A 2WBRA 3MM9B 3CCQS 4AFFA 1RTIB 4X4UA 5A76A 2KYZA 4UUXA 1W25A 5IT4A 3MAHA 4CO1A 4DLGA 3E3XA 5F3ZA 3EVOA 2BOPA 3KDNA 2FHJD 4CH7A 4EFAC 4RNOA 1YHQS 3MPDA 3O44A 5KG0A 4M5KA 2EC0A 1NMEB 3W9IA 4HT5A 2VFSA 4MT1A 2PFFB 4DUTA 4RNHA 4H4MA 2N82B 2BE7D 7FD1A 1WJ9A 2R2SA 4DV7J 2IBOA 4IQXA 4MKYA 4JYAJ 3ZZPA 3RR7A 5IM0A 1N6QB 1FRIA 1PCAA 3LPEA 5LJ3Y 4F26A 3K59A 4QWEA 2QMWA 8RUCA 1FJ7A 3DXBA 4KYZA 1N32J 2FZCB 2DD8S 2MYFA 2YQ3A 3NGSA 5RUBA 2CVEA 4ICLB 4KKOA 1WC0A 3UD5A 5A8WB 2IRXA 4O44B 5IC4B 4CYUA 4HH0A 5AE2A 5L46A 1N34J 2LEBA 1D0EA 4LF9J 4FF1A 2VG6B 4ILLA 1UKUA 4B9UA 2ATCB 3IBFB 2EXUA 2XMWA 2YKPA 3MOZA 3BO4A 2BR0A 4DSEA 5GAGI 4USTA 2F4VJ 4B3RJ 1S49A 3VGVA 3N6LA 4B9LA 1VISA 3ILIA 5J2NB 5LXYA 1P1LA 4B3SF 4OZ1A 4WP9A 2F40A 1EJ7L 1YZ6A 4FKYA 3SDEA 4C0HA 2G1DA 2V2KA 4WTOB 3ISND 2H3EB 3TEHB 1Y11A 2MZTA 3NNAA 5LXRA 3Q0AA 4Y34A 2YNHA 1WG1A 1IBKJ 5B0FA 3T3FA 5F0WA 2FVSA 1KP6A 4OFZA 4LRFA 3C8YA 2X1BA 3RAXA 2ZWOA 1UA1A 1HQEB 4PWDA 4IFYA 2AWZA 3CC2S 2Q1LA 2BE2A 2UUWA 4YY3J 4TU8A 3GFZA 2BXJA 2VHGA 1Q82T 5GMDA 2B9YA 3W9HA 2MMYA 1GMWA 3R3TA 4X4OA 2UUBJ 5DGAA 2IYIA 3PIPQ 2YBVA 1ELOA 4I6WA 1C1BA 2A18A 4ZP8A 3BSOA 3W64A 3MEDA 3I82A 3KUEA 2RILA 2AYBA 3M2VB 2DIUA 3IFEA 4U8YA 3I6PA 5HQ8A 1RBLA 5K8OA 2XM3A 3SZ2A 2V9WA 4PWWA 2AEJA 4CLUA 2LA6A 3D2WA 3R5CA 3AB2B 3LP1B 5FDLB 3CJ5A 4C8NA 4IKAA 4PG6A 3R5JB 3NCPA 1RT6A 3RU0A 2DXEA 3UQSA 3LGHA 4KGKA 4CIOA 1HWKA 3I0RA 1WKJA 4H4OB 1H73A 1AB8A 2AMCB 1RT4B 4C3KA 3KYLA 4Q8FA 1SKSA 2A6OA 1RYSA 5FLXU 3JQMA 4OYMA 3U02A 3S7RA 1VQMS 2PEBA 4I6AA 2G0JA 2BRKA 1S1UB 3K17A 4URGA 3CJTA 4X4PA 1S72S 1C2PA 1UMJA 3GG1A 3T9ZA 1T02A 2G2OA 1F2HA 3SMZA 2ASLA 1KFDA 2ALYB 2J7WA 5CYQB 2VQEF 2ZM6F 3KLFA 2B4UA 4RNNA 4N77A 1GT8A 2CZ4A 3N6NA 2DGVA 3JXOA 4X64F 2XMMA 4JI3F 3KK2B 4J9OA 3UN3A 4XDCA 3LP0B 3TW0A 3NRBA 4OZ3A 3SCLE 1GMVA 2RKIA 4A8YA 1HBMB 1YDLA 3A3NB 3POTB 1JLFA 3UN5A 4DV1F 4OYPA 1HHQA 4ZVTB 1KQFB 4PUOB 1C4CA 2IY5B 2VF3A 2EW9A 1RB0A 1EHWA 2WB4A 1UETA 1HFEL 2CQ1A 3BGRB 3OXGA 4G65A 4USIA 2ZVIA 4OV6A 1IKXB 1T9YA 5M2PA 2DGUA 2EWHA 2K06A 2VDHA 3AD9C 2BBEA 1HNWF 5EX3A 3W8PA 4CLYA 3TUZC 2MXYA 2HQFA 4Q43A 1NJIT 1FVQA 4NE9C 4KHPJ 2C2ZB 4ZPWR 1RTDB 3QGHA 1ROFA 2FLPA 1VR6A 3RW7A 5L39A 2XGQA 1RKJA 3K7RA 1X5TA 5CQGA 3VTIA 2ADBA 5GADI 1CLFA 2FPHX 3OXLA 4JI1J 3KJQB 4CH0S 1SUQA 5SUHA 1RTJB 3TJ8A 4HI1A 2MQQA 1U2RA 2MTLA 3UWTA 5ETVA 2I8EA 3W66A 3PFEA 1KVJA 3IG1B 3OL9A 1FHTA 3DRRB 2W7PA 4P7VA 2CQ3A 1VHIA 1MMDA 1ZM2A 5J1EA 2A1BA 2HQCA 5F41A 3PEJA 1VJWA 3MMJA 2O3DA 2XQCA 4WKYA 4X64J 5DJBA 4CLFA 3H5YA 5KAKA 4N76A 3HM9A 1JKHA 3GIJA 1J5EJ 2JNJA 4O3PA 1H7XA 1WOPA 1SV5A 2D9PA 2DY9A 2IDEA 2IM3A 4DQQA 2V67A 3MECA 3S8SA 3JSMA 4CZCA 1ZTWA 5FJ4A 1RT1B 3SSQA 4USVA 2R8HA 3IRXA 4I67A 1J2VA 3LANA 1IWAA 3IR7B 3MD3A 2W2MP 1HWIA 2K1RA 2ZUGA 5A8KB 3NMRA 1VQ5S 1CC7A 4MH8A 2DNGA 4YQWA 2OPRA 5CH7B 3NLCA 4Q2MA 3G6ES 5JJBA 2HHPA 3T5JA 2ZE2A 2CUYA 1N5QA 2CFXA 4ZS6A 4DFPA 4BWJA 2CQHA 1KVKA 3FGVA 1IQTA 3UVJA 1SB6A 2I5JB 4H4MB 1WF1A 4EEYA 4WP8A 4I56A 2HNYB 4O3QA 2OI2A 2KHCA 1CG2A 1LOUA 1RK8A 1WG5A 1TELA 2RHQB 2OTJS 2Z4PA 4IFVA 4A8OA 4I2PB 3SCJE 3IAM9 2Y3YA 5HO4A 3TVZA 5GAGU 4CH1A 3BO3A 3LALA 4FF2A 1X60A 3DI6B 5C25A 4DV2F 1JK9B 4RW7B 1NLKL 2PMWA 3HMJG 1UPPA 2X51A 3CT9A 4Z7CA 3HD2A 4YB5A 2K2PA 1U6ZA 2JSXA 3R27A 4W4MA 5F8MA 4EYHB 2JZ5A 4EBEA 2QT7A 3MM6A 2HBRB 4DPUA 1JWWA 3B8HA 1QSLA 4KSEB 1FD8A 4ILRA 2KXNB 3HPOA 3PW0A 3QJPA 4YY3F 4HTJA 4LBIA 3JYTA 1LK5A 1FTCA 4PAAA 3C16B 3M8PA 4C97A 2MKKA 3MAQA 4B3TJ 5IM0B 1OMSA 2F65A 4LUBA 1RBAA 3BDPA 3MF5A 4PXEA 4OQJA 5A2QU 2C28A 1KR4A 2CKWA 3GONA 1IQZA 3FZBA 3OPKA 4ENOA 2YKNB 2N7CA 4MIAA 2MQNA 5JMNA 4TU7A 1UW9A 1AW0A 3PR4A 3HJFA 3BB5A 5B09A 1WSRA 1TKZB 3R7NB 5KTQA 3DLEB 2UVWA 4F67A 2VONA 2LMIA 2OPSA 3HI9A 2PA3A 4DV5J 2VB6A 4YB6A 2DIVA 3L4BC 3W5YA 1YJNS 3UR0A 3AD8C 3M8RA 1Q5YA 2ROEA 3JTPA 2DR9A 3M8WA 2CNKB 2MQMA 2V69A 3I5CA 3QGGA 4FDFA 1R8PA 1VFJA 3WIVA 5CAAA 2ZH9A 2YH0A 3CSKA 5HP1B 1U47A 1M5OC 1Z4UA 3JSBA 4OZ5A 2DHXA 3QT5A 1C1CB 4CWBA 3C2PA 5D8HB 2VC1A 4NZ6A 2MLYA 2J5AA 1VJQA 2BM1A 1HD1A 2RH3A 2XBPA 1NBEB 2IVMA 4KO0B 4UUWA 4Y28C 3VQSA 1HD0A 4A46A 1Z2ZA 3PIOQ 1NKBA 3DMJB 4Y2KA 3CXCR 1NJXA 4QU7A 2HHUA 3JSYA 2V94A 4NLSA 2V68A 2Q3PA 4HT7A 5A6WA 4O3NA 3VWSA 3WHIA 4PXDA 1GX5A 2YQ1A 3CGIA 1NB7A 2HSEB 3R8YA 3HP6A 5G0RB 4IYQA 3RRKA 3KLGB 4DV3J 4FBTA 2R7UA 3OD2A 2CQ4A 1UFKA 2AJ0A 3PACA 2UU9J 2GAGC 2HVIA 1O51A 2VKRA 2FGCA 4USJC 1X4HA 2F8MA 4OX6A 3QFWA 4E8UA 1IKVB 1WD6A 4UQGA 4JI3J 2XZWA 4L76A 4FF4A 4ES1A 3EGZA 1CJUB 2DNOA 2B9XA 1ZZFA 3KKFA 4B3RF 3KHGA 3KXDA 4QWCA 3RBDA 4RW8A 2QIFA 2RRBA 3Q2SC 5K8NA 4N5SA 3WC2A 1IKYB 3F56A 1Q4RA 1R8AA 1RT6B 2OMOA 2XZDB 3MM9A 4P75A 5KT4A 3QSYB 3J7YU 1FKOA 2UV8G 2VQEJ 4EZ6A 3VAGA 4P6QA 2AV5A 2RSQA 1KWMA 2ZZTA 1L3UA 3AB4B 2DNLA 3W60A 2LKZA 2MQ8A 2HFUA 3MDFA 4O3SA 1VRQC 2GIRA 4QYZK 3GYXB 1GH8A 1HW9A 3DLJA 1I6JA 1FRXA 3V4MA 1VQ4S 4DXLA 4DR7J 1S4EA 3ETMA 1JLFB 4PUOA 1R43A 2G0IA 4DHVA 5DETA 5FLXY 2XI3A 4ZCMA 2GX8A 3SCIE 1IKWB 3NGTA 1FDDA 1NPPA 4OJHA 3KLHA 2HGNA 2ACMA 2IVFB 1JLAB 3R5BA 2L08A 5DO2A 4ZVQB 2L41A 2MZJA 2OO4A 1ZS6A 3N5FA 3SBMA 2OFGX 2DGWA 2ZH5A 5LM7E 3KG1A 3ZZTA 1N36F 4C8KA 4DS4A 2O67A 3HK2A 2ZC4A 5IS2A 3CCRS 4DV6J 4ES2A 1WUUA 1RTDA 1SJ1A 4ED2A 4C3MA 5D0RA 1X9WA 1NZ8A 4AQYJ 2V4QA 4DFMA 1TUWA 2HQGA 1UCNA 4DL5A 1KC8T 4NCAA 1VQKS 4PRFA 2QFIA 3POTA 5C24A 1ZPVA 2B56A 3AXMA 5T14A 2AEFA 3G82A 3N28A 3M6WA 2AT1B 4EU0A 4F25A 5HROB 2K3IA 5KFAA 3OJUA 4QR1A 3FMWA 2ZH8A 2LXUA 2JRSA 2V50A 5J1EB 3MEGA 4DLEA 3PW7A 3RRHA 3GP9A 5L38A 1WC3A 3OBIA 3VGTA 2QEXS 1S7IA 2H54B 2CJBA 3TZZA 1HBNA 1T9UA 1NZAA 4DR2J 2XSFA 3CCVS 1XR5A 2GJ2A 5KT5A 1UVLA 8ATCB 2GZOA 4URSA 4I68A 4JI7J 3FRZA 1JLBA 4PZVA 3G8TA 4MYTA 4LRCA 3GCXP 1OJ4A 4WFNQ 3MEDB 1VRTA 2XZTB 3EXCX 3IA0A 2YNGA 4C8YA 4KFBA 4RUAA 4YR2A 1Y5NB 3ILOA 1UFWA 1MMNA 3ETOA 3IBWA
chains in the Genus database with same CATH topology
3FBFA 3VVTA 3FBCA 3FBEA 1PKUA 4C6AA 3EM1A 3EVMA 1B4SA 1S5ZA 2VU5A 3L7UA 3NGRA 3PJ9A 4UOFA 5CAAA 3Q86A 2CWKA 1WKLA 1VYAA 1S59A 1HHQA 4W98A 1EHWA 1NDCA 2B8QA 3GPAA 3FCWA 4HR2A 3DKDA 3EVOA 2BX6A 3Q8YA 3G2XA 3MPDA 2DYAA 1JXVA 2HVDA 3EJMA 4DUTA 4FKXA 1LWXA 4F4AA 3JS9A 1MN9A 4KPCA 2AZ1A 3PRVA 5C7PA 3FCVA 3Q8VA 3EMTA 1XQIA 1U8WA 3NGSA 1BHNA 1NCLA 1NB2A 1HIYA 1NDPA 4ANDA 1XIQA 1W7WA 3DDIA 2DXDA 3BBFA 1F6TA 3VGVA 3VGUA 3ZTOA 4DI6A 2ZUAA 5BXIA 3EVWA 1PAEX 4FKYA 3BBCA 2DY9A 3ZTPA 1MN7A 1NPKA 3ETMA 3R9LA 1LEOA 1BE4A 1NUEA 3NGTA 1NDLA 3VGSA 1B99A 1NDKA 1ZS6A 5IOLA 3ELHA 3Q89A 2HURA 1NSPA 4DZ6A 2NCKL 4WBFA 4EK2A 3Q8UA 3Q83A 1NHKL 2AZ3A 4S0MA 1UCNA 1KDNA 3EE3A 4ANEA 4O0NA 3FKBA 3ZTSA 3B54A 1HLWA 2DXEA 1NLKL 3ZTQA 2DXFA 3B6BA 4UOGA 3GP9A 1WKJA 3VGTA 5CABA 3FC9A 3ENAA 3NGUA 2HVEA 4CP5A 3BBBA 3BH6B 1BUXA 1WKKA 4ANCA 3FBBA 2B8PA 4F36A 3WX8A 3VVUA 1F3FA 1NSKL 2BEFA 3BH7B 4ENOA 1NSQA 3EICA 4UOHA 3ZTRA 1K44A 1S57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FBF A;  3VVT A;  3FBC A;  3FBE A;  1PKU A;  4C6A A;  3EM1 A;  3EVM A;  1B4S A;  1S5Z A;  2VU5 A;  3L7U A;  3NGR A;  3PJ9 A;  4UOF A;  5CAA A;  3Q86 A;  2CWK A;  1WKL A;  1VYA A;  1S59 A;  1HHQ A;  4W98 A;  1EHW A;  1NDC A;  2B8Q A;  3GPA A;  3FCW A;  4HR2 A;  3DKD A;  3EVO A;  2BX6 A;  3Q8Y A;  3G2X A;  3MPD A;  2DYA A;  1JXV A;  2HVD A;  3EJM A;  4DUT A;  4FKX A;  1LWX A;  4F4A A;  3JS9 A;  1MN9 A;  4KPC A;  2AZ1 A;  3PRV A;  5C7P A;  3FCV A;  3Q8V A;  3EMT A;  1XQI A;  1U8W A;  3NGS A;  1BHN A;  1NCL A;  1NB2 A;  1HIY A;  1NDP A;  4AND A;  1XIQ A;  1W7W A;  3DDI A;  2DXD A;  3BBF A;  1F6T A;  3VGV A;  3VGU A;  3ZTO A;  4DI6 A;  2ZUA A;  5BXI A;  3EVW A;  1PAE X;  4FKY A;  3BBC A;  2DY9 A;  3ZTP A;  1MN7 A;  1NPK A;  3ETM A;  3R9L A;  1LEO A;  1BE4 A;  1NUE A;  3NGT A;  1NDL A;  3VGS A;  1B99 A;  1NDK A;  1ZS6 A;  5IOL A;  3ELH A;  3Q89 A;  2HUR A;  1NSP A;  4DZ6 A;  2NCK L;  4WBF A;  4EK2 A;  3Q8U A;  3Q83 A;  1NHK L;  2AZ3 A;  4S0M A;  1UCN A;  1KDN A;  3EE3 A;  4ANE A;  4O0N A;  3FKB A;  3ZTS A;  3B54 A;  1HLW A;  2DXE A;  1NLK L;  3ZTQ A;  2DXF A;  3B6B A;  4UOG A;  3GP9 A;  1WKJ A;  3VGT A;  5CAB A;  3FC9 A;  3ENA A;  3NGU A;  2HVE A;  4CP5 A;  3BBB A;  3BH6 B;  1BUX A;  1WKK A;  4ANC A;  3FBB A;  2B8P A;  4F36 A;  3WX8 A;  3VVU A;  1F3F A;  1NSK L;  2BEF A;  3BH7 B;  4ENO A;  1NSQ A;  3EIC A;  4UOH A;  3ZTR A;  1K44 A;  1S57 A; 
#chains in the Genus database with same CATH topology
 4ECY A;  4OYW A;  3CJS A;  3PYF A;  1XR7 A;  2DHS A;  3FBE A;  4OLO A;  1GX6 A;  4LF9 F;  2CIM A;  1SVD A;  4NLW A;  2E5L J;  1FFS B;  1KLM A;  3IS9 A;  4MIB A;  1TVR A;  5K8P A;  5U47 A;  4ZLN A;  3CPW R;  1GQE A;  2V6A A;  2C2E A;  4UOF A;  3CDB A;  3PVX A;  2A2C A;  3EDQ B;  3G86 A;  2EBG A;  1HPZ B;  2VG5 A;  3H8Y A;  4NL5 A;  2BA9 A;  2P9E A;  4WPA A;  3ZZY A;  4DV7 F;  1IBL F;  4ECS A;  2YNF B;  4ZOS A;  2V5H G;  1CQM A;  3BKF A;  3V6D A;  3V2U C;  1VC6 A;  2WW8 A;  1NDC A;  2CPI A;  2DBB A;  5K8M A;  2ZIT A;  4KIA A;  2NR0 A;  1AZS B;  1BMQ B;  2JH3 A;  2DRD A;  3KK3 B;  4NCB A;  3VV2 B;  2HLU A;  2XYH B;  2MQL A;  3TEG A;  2HVH A;  2DHG A;  1C0U B;  3D3C J;  3KJN B;  4BC9 A;  4YR0 A;  1B64 A;  4RW9 B;  2WAQ D;  2HEK A;  1DQA A;  3KLI B;  1DTQ B;  4ZPB A;  1XNQ J;  3MMC B;  4CO0 A;  2XWY A;  1VOM A;  3ULH A;  3HZG A;  1RAD B;  1YRT A;  2M4M A;  2PN6 A;  2YY3 A;  3D6F B;  5HK4 A;  3HSD A;  1OYD A;  3SQG B;  4F4A A;  4X65 J;  2MKI A;  3G71 S;  4ZVG A;  4DR5 F;  1JLE B;  2OEL A;  2AYG A;  2ILY A;  3HFV A;  2FVP A;  2E1P A;  3MM7 A;  5K14 B;  3D28 A;  3OFE A;  1TUG B;  2R4F A;  3K5P A;  1OY9 A;  1SIZ A;  3QBC A;  4HDH A;  4JI0 J;  3L7P A;  3VAI A;  4GC6 A;  2DR7 A;  4ZP9 A;  4C8Z A;  4M8L A;  4DN9 A;  2JX2 A;  4DSJ A;  4MJK A;  4XPE A;  3CD6 S;  4F0K A;  3VGU A;  4DI6 A;  1PAU B;  2J9C A;  4CTA A;  4J9Q A;  1EKR A;  3H90 A;  5KFK A;  1XN9 A;  3ZZ0 A;  1D9A A;  1F9E B;  1UFL A;  2MY7 A;  4PWU A;  4TVA B;  2HRY A;  4JI4 F;  3ENQ A;  4E98 A;  3IR6 B;  3TA2 A;  2HRU A;  2OML A;  5D4N A;  1RWM B;  2GFF A;  3R9L A;  4OZL A;  3I9Z A;  3PXG a;  1AFJ A;  1FEE A;  4EI2 A;  1ZH5 A;  3MM5 B;  4B9N A;  3QAT A;  3ZFV A;  4F0H A;  4PXB A;  3KUH A;  2J8S A;  2YTC A;  1B99 A;  3V6J A;  3DMJ A;  4USW A;  4RUB A;  4C4W A;  4LRA A;  1KBR A;  1NEE A;  4YB1 P;  3IG1 A;  3K57 A;  5KFN A;  3FUY A;  2LDY A;  3UD4 P;  3KG0 A;  4WTY A;  1B7F A;  2QV6 A;  1U02 A;  5IWA J;  3N4W A;  3Q89 A;  1DAR A;  2JFD A;  2KN4 A;  2VAS A;  3D68 A;  4LF8 F;  1NSP A;  3H4B A;  3TOQ A;  2AJ4 A;  1CJK B;  3FMB A;  2AJF E;  3VAK A;  3M2U A;  4IR1 A;  4J90 A;  4M5G A;  4Q2L A;  4WU3 A;  5HP1 A;  3I87 A;  1RHK B;  3R7S B;  3BSA A;  3LGN A;  2E5J A;  3MHY A;  3VHQ A;  4ZMM A;  3OV7 A;  4IQM A;  3T9N A;  2VZ9 A;  2KM8 C;  1TTH B;  1YRU A;  3DGP B;  3SEO A;  5KFG A;  5KFQ A;  4O4G B;  3M1V B;  3BKU A;  2YWH A;  1RUS A;  4EBD A;  5E0O A;  4EBC A;  2B0G A;  1UEV A;  3AXK A;  2GMJ A;  4MK9 A;  3QFH A;  2UXC F;  3LAK A;  1HW8 A;  1UJ6 A;  2GJF A;  3OR1 B;  2HS4 A;  5DQG A;  3OLB A;  2AGQ A;  1S9F A;  2FQQ B;  1LWC A;  1WKK A;  3I4P A;  4O44 A;  2QA4 G;  1EP4 B;  4B9T A;  2WSC C;  4NCG B;  3QWP A;  1IKV A;  1F3F A;  2E5I A;  4J9V A;  5L1K A;  4XPC A;  2CAD A;  2CQB A;  4IFV B;  2FHJ A;  2V34 A;  3EIC A;  3H20 A;  3PDN A;  3HZE A;  5HMW A;  1K44 A;  3C6U A;  4FP9 A;  3PEH A;  3K5L A;  2HQI A;  3GIL A;  2JC1 A;  3OSP A;  3UO0 A;  3NL0 A;  3DI6 A;  1H2T Z;  4JI0 F;  2HMI A;  2FDN A;  2M7S A;  1UWB B;  2E44 A;  4O3O A;  1PO6 A;  4ATN A;  5D3G A;  4Y3C A;  2NYH A;  4NXM J;  1OSD A;  1FE0 A;  4FPI A;  4LFA J;  3D67 A;  3D5M A;  3I32 A;  1NRK A;  2HZV A;  2FVR A;  4DCO B;  4Z7Y A;  1N5Y A;  3U1M A;  5I42 A;  4LSN A;  3NEK A;  1WKL A;  3FDS A;  3O8W A;  4IO1 A;  4PYA A;  4NZ0 A;  3GFH A;  1TAQ A;  5ETP A;  1R0B G;  2CQ0 A;  3LPY A;  1SC6 A;  3QPI A;  3T19 A;  3W2V B;  1R6V A;  2JLF A;  5HJY A;  4A8S A;  2ZD1 A;  4IDK B;  2CJY B;  2OPP B;  5IC6 B;  2PI4 A;  1VBX A;  2BJ1 A;  3NGD A;  3LAM A;  1E6V A;  1ZYQ A;  3R5G A;  2KG1 A;  2OPQ B;  4A8Q A;  2VOD A;  2HNZ B;  2RU3 A;  2QLB B;  2VDI A;  4BHQ A;  3V6K A;  2ZJQ Q;  5FDL A;  2R7Q A;  4DDF A;  4AD6 A;  5ETK A;  3VR1 A;  3GQC A;  5KFU A;  4TU9 A;  2D3O R;  3ILJ A;  2VC0 A;  2QZ8 A;  2E7X A;  3BQ2 A;  5A0Y B;  3IP0 A;  4ZK7 M;  2IAJ A;  2XS2 A;  2AZ1 A;  3E8O A;  3PRV A;  3LQV A;  4X4R A;  4IO9 Q;  3BN4 A;  1SIW B;  2E5L F;  3ZZR A;  4UT4 A;  2MY8 A;  4N8N A;  4X66 F;  1FJG F;  5THW A;  2VPY B;  1F1B B;  1NDP A;  4RJV A;  3IM8 A;  1D3W A;  4PR6 A;  4KAI A;  3OUY A;  1P9Q C;  1WNE A;  3UW1 A;  2E1R A;  3RYL A;  2AHO B;  4DUY F;  2DEJ A;  3B78 A;  1RT5 B;  3I5A A;  2VH7 A;  1S7H A;  4R5P A;  1LXN A;  2XCA A;  2DNN A;  2GQQ A;  4ZN1 A;  3H25 A;  2GO8 A;  3AA8 A;  3KOA A;  3MMB B;  3L9Z A;  1PAE X;  1YI2 S;  2IA0 A;  2HQ3 A;  1HWJ A;  1SKR A;  3ZC4 A;  1RWK B;  1MN7 A;  1RLC L;  2MZS A;  3QMQ A;  5CYQ A;  3UDE A;  1S0V A;  1QJH A;  3RAQ A;  2YNF A;  4PG4 A;  2EK6 A;  2PMZ D;  3IRW P;  2AD9 A;  2E5H A;  4DPO A;  4IRC A;  3J7A N;  2YVS A;  4ZVP B;  4I64 A;  2YNG B;  1P8G A;  1PG5 B;  3W62 A;  1QAX A;  1URR A;  3ICL A;  1AZS A;  3SFU A;  4USK A;  2HQD A;  3D6M B;  3CUN A;  3T1H J;  1RYR A;  4YB7 A;  3X1L B;  1F3V A;  2YWW A;  2GHP A;  3MFH A;  3MI7 X;  4WII A;  2ZZM A;  2ZFH A;  3BYR A;  3DGV A;  1M1K T;  4B3M J;  2J6T A;  1YJV A;  1VS3 A;  5EHH A;  5IV3 A;  1FKP A;  3WIU A;  3UPF A;  2ZJR Q;  2XNR A;  3KMQ A;  5GAE I;  4EK2 A;  4A48 A;  4YDD B;  4CLP A;  5KFV A;  3NMA A;  4AQY F;  1DRZ A;  1RHJ B;  2H4Y B;  4JI2 F;  2DTJ A;  1N48 A;  1S76 D;  1RCX B;  2VG5 B;  2J0X A;  2N7Y A;  3DXS X;  5HI7 A;  5B0C A;  4ED3 A;  2OH2 A;  3MM7 B;  4ELU A;  2G2Y A;  2E9Z A;  3M8Q B;  5L9N A;  1M5V C;  1YQH A;  4LRB A;  3HVT B;  3KK1 B;  2QLW A;  2WSF C;  2WVF A;  2MQP A;  1IKW A;  4UTG A;  2FY8 A;  3TAP A;  2V8H A;  2FHM A;  2YKO A;  5EGY A;  3PV8 A;  2J7U A;  2DIT A;  2GVZ A;  3WZ0 A;  3VCD A;  3DOM B;  4CTA B;  3MAA B;  4RW6 B;  3EUN A;  4LIW A;  1DTQ A;  3GIM A;  2P5V A;  4X4V A;  2WBM A;  1NKE A;  1CUL A;  1QY7 A;  3HJV A;  2O01 C;  3DRR A;  4IG0 B;  2ZKU A;  2BAN A;  2HLT A;  4N47 A;  3HHE A;  3T5H A;  3M8Z A;  4F36 A;  1HHT P;  2XY6 A;  2P6T A;  4LFB J;  1F60 B;  3M32 B;  3QJJ A;  1K8A T;  2I1R A;  1LWE A;  4CO2 A;  1KQK A;  3D3B J;  5G4D A;  1H3D A;  1JLC B;  3KHR A;  1XMO F;  1JKH B;  3FBF A;  2WSE C;  1CS4 A;  1MW7 A;  1EIY B;  4B3O A;  4M5I A;  3CC4 S;  4C8L A;  1Q16 B;  5LL6 d;  3OTO F;  2N4D A;  2PII A;  2GAH C;  5HRO A;  3CJ0 A;  1T3N A;  5JVH Q;  2CXE A;  5I3U B;  4M94 A;  5HLF A;  1S5Z A;  4O0I A;  2ADC A;  2KZM A;  2ZC3 A;  3BPS P;  2AYM A;  2V8D A;  1RQ0 A;  3M7V A;  1S48 A;  3TUP A;  1DLO B;  2VG7 A;  1U1L A;  3MCO A;  3I0S A;  4NRU A;  5C42 A;  3VAF A;  2DO0 A;  4K0K J;  1JLG B;  3C14 A;  3QYY A;  2VBX A;  1PYT A;  3GJQ B;  1VQN S;  1G6B A;  2JJ4 D;  3M1V A;  2H5I B;  1WHY A;  3ITH B;  1LNQ A;  1NND A;  1UEU A;  3W5X A;  3ZZZ A;  4CNY A;  3P6Y C;  2I2Y A;  1MML A;  2PGC A;  1QVG R;  2E1C A;  4Z2X A;  5ETN A;  3OFF A;  4K4T A;  1RSC A;  4P71 A;  1MRO B;  2DH7 A;  3BPD A;  1XNR F;  2FLN A;  1U49 A;  1XC9 A;  4QPT A;  5IXU A;  3HVR A;  2QYG A;  2BMB A;  2W9B A;  1HQ2 A;  2LXI A;  4FXV A;  5KFM A;  1K73 T;  4M5L A;  1XQI A;  1U8W A;  1U26 A;  3DOL B;  3FJ2 A;  3N01 A;  3C6U B;  4EO8 A;  3T1Y J;  3VAH A;  3JSR A;  2YKQ A;  4ECX A;  4AND A;  4KGM A;  1X5S A;  3AJ2 A;  4DN0 A;  3LA0 A;  3A3P B;  1IJF B;  3V6D B;  2CZV C;  2XEX A;  3UD3 P;  4RNF A;  2KRR A;  1UWB A;  4EYI B;  4IG3 B;  4URQ U;  1NAQ A;  1F6T A;  3CDU A;  2C2R A;  3MUT P;  3DU5 A;  3TAN A;  1NJW A;  4MAK A;  2VIC A;  3EXY A;  1ZAX A;  3HSG A;  2EFV A;  2OIH A;  4CCH A;  2NS1 B;  3LGM A;  1M1H A;  1QD1 A;  3QO9 A;  4KGZ B;  4NLO A;  4ETX A;  4DV0 J;  1YIJ S;  1S0M A;  1S6Q A;  4PKD B;  1IXK A;  1IN0 A;  5DQI A;  1TAU A;  2Q6B A;  5I3Q A;  5D78 A;  2BJ8 A;  2CQD A;  4IOB A;  1S6U A;  4C0O C;  4NML A;  3HHL D;  4KBI A;  4NCG A;  2ZVS A;  5L1I A;  1PBA A;  4OV1 A;  1N33 F;  5DG7 A;  2AQ4 A;  2IMW P;  2W9C A;  4YHH J;  3K0J A;  4PG8 A;  4DWI A;  2FJA B;  5KT7 A;  3OTD A;  4F8R A;  1FDN A;  3DRP A;  3TX8 A;  4LF6 F;  4CLK A;  1U1Q A;  1SKU B;  3AT1 B;  4TXS A;  4RNM A;  2X1A A;  2VOO A;  2NZC A;  1WC6 A;  2OSR A;  4HHH A;  2DHH A;  3LOU A;  4OLP A;  4BCA A;  4CM2 A;  1XJW B;  2QFJ A;  3RR8 A;  2Y8W A;  1WI6 A;  4HHU A;  5CXT A;  1NHK L;  4ZJL A;  4PAB A;  3EWG A;  2W8L A;  4EGL A;  1O8B A;  2PMH A;  3TI0 A;  4RX6 A;  1N88 A;  2Z57 B;  1RTH A;  3OQ2 A;  1OPZ A;  4ID5 A;  2R7W A;  1N52 B;  3V4I B;  2DNK A;  3AH6 A;  4FYD A;  2JOQ A;  4USH A;  3TX0 A;  1FRM A;  1U6F A;  1IM6 A;  1SH3 A;  4ZP7 A;  2PDA A;  2VA3 A;  1HQE A;  5LMN F;  3G8S A;  2OEM A;  2LEP A;  2GHW A;  4OI6 A;  4F0M A;  1S9E A;  4KHM A;  3HLU A;  4RUH A;  2H51 B;  3DLG A;  4UY8 5;  1IKY A;  2C3O A;  1WC1 A;  1CBK A;  1TL5 A;  2HVZ A;  3F0N A;  1H6K X;  1J5E F;  1WTB A;  3V6H A;  2KT5 A;  4CO5 A;  4DV4 J;  4F3M A;  2WVE A;  2CG4 A;  3ZTR A;  5F8H A;  4DCJ B;  2XG8 A;  5F8I A;  1OWX A;  1IR0 A;  3A12 A;  2HFS A;  3IBC B;  3MPU B;  4M5D B;  4BWM A;  4PYD A;  3VVT A;  1V9O A;  2M0G B;  1N54 B;  1X4G A;  3OW2 R;  2MB0 B;  4NXN J;  4OHY A;  3ONQ A;  1LWF B;  1RT5 A;  2FHO B;  4I0W A;  2D1C A;  9RUB A;  1KQS R;  1FTR A;  1W26 A;  1IR2 A;  4NLU A;  4QU6 A;  1B4S A;  1TKX B;  3I0R B;  2GQ2 A;  4H4O A;  3EGW B;  3L7U A;  4A4J A;  4M5M A;  2D69 A;  3KJF B;  3QT8 A;  4O23 A;  2GGP B;  2I9S A;  4PPD A;  3UCZ P;  3OFG A;  1WOO A;  3NXZ A;  4JI6 J;  2ZNZ A;  3GG0 A;  4ZHR A;  1VGY A;  1VI7 A;  2DGQ A;  3C66 A;  3O1L A;  5D4L A;  2RS8 A;  4DSL A;  4KHP F;  3AA9 A;  2N4C A;  2M2B A;  4HYK A;  4LFC J;  3UR3 C;  2XS7 A;  2DNM A;  1SCJ B;  3W2W A;  1TL1 B;  4ED7 A;  2BRL A;  2IIH A;  2Y1J A;  1RU2 A;  1RAE B;  1A6L A;  4MTP A;  4BDP A;  3OVB A;  3BZQ A;  4Q7A A;  1MU2 B;  2K7K A;  5BR8 J;  4DX8 H;  1Q7Y T;  4DV1 J;  3GFY A;  2RAQ A;  3Q24 A;  3KJV B;  4DUZ J;  1MN9 A;  1S99 A;  2HBY B;  1GXT A;  1RT3 B;  5C7P A;  5SZT A;  2EFQ A;  1JB0 C;  2RKI B;  2JWN A;  3FCV A;  1QE1 B;  5I3P A;  2G0C A;  1IWG A;  1JLC A;  3MR5 A;  4ED6 A;  4G3I A;  1URN A;  1FNO A;  3GR0 A;  3OVS A;  3TUI C;  2RF2 B;  2W7O A;  2RML A;  3W2V A;  1E6Y B;  1SI9 A;  2CJQ A;  3M4X A;  2DXD A;  4ZKA A;  1Q1K A;  3LWL A;  3PTW A;  2GC8 A;  3L09 A;  4DL0 C;  4OX9 J;  1WOR A;  1QVF R;  3R2D J;  3H98 A;  1VQY A;  2HIQ A;  3OFH A;  5BXI A;  2POK A;  4PWD B;  4WCE Q;  3M2R A;  1U1K A;  1UTA A;  5FD1 A;  2ASY A;  3JQK A;  3HO1 A;  3CDA A;  1X9M A;  3PKM A;  3Q8Q B;  1CJT A;  3NS5 A;  2KRB A;  2VIH A;  4C8M A;  1TL3 B;  5KG4 A;  3A3O B;  1L3V A;  2VBY A;  2DVI A;  4KB7 A;  3NP5 A;  5E3Q A;  4R8U A;  2VUG A;  3BR8 A;  3H40 A;  2AX1 A;  3IS9 B;  2W4C A;  4WZM A;  1S4F A;  4Q45 A;  2J9D A;  2PD1 A;  1ZET A;  3ZZU A;  3SFG A;  4RWX A;  4I7F B;  3IGN A;  1KKH A;  4QIG A;  5F8G A;  1QDU B;  1XNQ F;  3OUY B;  2QMX A;  1R0C B;  1RKI A;  3KDO A;  3CCM S;  1WEX A;  2CDR B;  3MXH P;  3CIZ A;  4TY9 A;  5E3C A;  1UP1 A;  5IV4 A;  1SJ4 P;  2FY1 A;  1VQP S;  1H72 C;  3MPY A;  1HKA A;  2X1G A;  4R0J A;  4TNO A;  5CCM A;  4J9N A;  1APS A;  4O0N A;  5KFZ A;  3RBX A;  4MFB A;  2YQ0 A;  3QID A;  4PCQ A;  3ZTS A;  2V4J B;  3BEG B;  3QAE A;  2HHV A;  3DOL A;  1RT1 A;  1S1U A;  3K5O A;  4OYZ A;  3IRX B;  2CAJ A;  1SC4 B;  2JLE A;  1JLG A;  3C14 B;  1M5K C;  1RDR A;  4RPF A;  1A9N B;  1LW2 A;  5D0G A;  2LU1 A;  3M9O B;  3G4S S;  5B0G A;  2K1R B;  4AUK A;  1N5T A;  3TA1 A;  1YJ9 S;  1KN6 A;  1FFG B;  3GE9 A;  4HL9 A;  2WTF A;  3LW5 C;  1PJ5 A;  3QNW B;  1FVS A;  2F63 A;  2F9J A;  3GJS B;  3MEE A;  3PNI A;  4CP5 A;  3N0V A;  1VLY A;  2N3O A;  4HEA 9;  1ZA2 B;  1B7Y B;  2EEY A;  4RBT A;  5KFC A;  1R3N A;  4NLR A;  5HL7 Q;  2VJU A;  3PR5 B;  2NXE A;  2BQ3 A;  4FYY B;  2W9B B;  1RAJ A;  1S1X B;  3QSI A;  1R7I A;  4KH1 B;  3Q22 A;  1CJV A;  4L6V 3;  2W9C B;  4TYA A;  1OY6 A;  1SH2 A;  1TL7 B;  2XCP A;  4KHR A;  4BLG A;  4DQP A;  5JXS A;  1PKU A;  2XI2 A;  2J8A A;  1FRL A;  3S6E A;  3KUG A;  1W2B R;  2XLJ A;  3DLK B;  4IG3 A;  1YJT A;  5D0E A;  3C6T B;  3EGN A;  2VPW B;  4ZJO A;  3O5T B;  4OZJ A;  3CD7 A;  3OSN A;  1M5P C;  4B9S A;  5E3A A;  4BS2 A;  4NEY A;  4RU2 A;  3RG6 A;  5IFM A;  3QO9 B;  2UUT A;  5AJ3 F;  1K0T A;  4JV5 F;  3I5B A;  2YNI A;  3PRB A;  3CJK A;  4QWA A;  1YLX A;  4NLG A;  2VFV A;  2HHH F;  1S59 A;  3MCS A;  4DCP B;  4X62 F;  3BQ0 A;  1T9X A;  4HKQ A;  1RAH B;  3BR9 A;  5DM6 Q;  1EAY C;  2D3O 1;  2JEJ A;  3TQ1 A;  2OUG A;  4I2Q A;  1BD6 A;  1M5S A;  2L48 A;  3M32 A;  4NA3 A;  2NPF A;  1Y0H A;  3GMG A;  5KG3 A;  1LWE B;  5KFF A;  2MKH A;  4A8X A;  4QPX A;  2MQO A;  1EZZ B;  2HFO A;  1QUP A;  2Z2M A;  3M2U B;  2VQF F;  1CS4 B;  4B3O B;  2HND A;  1HMV B;  3TZW A;  4Y00 A;  3I56 S;  2DO4 A;  3P45 B;  4C0B A;  4NEZ A;  4MK7 A;  1WC4 A;  1LWX A;  1DAX A;  3J80 U;  1RJJ A;  3CME S;  5T7L A;  5CD4 H;  3TZX A;  2EFP A;  1JJ4 A;  1ZZN A;  2QLF B;  5KT2 A;  1SV5 B;  2YKM A;  1AA1 B;  1Q8B A;  3NG8 A;  3PJX A;  4X62 J;  4DSI A;  1IBM F;  1C1C A;  2B4P A;  4Y2M A;  2L9W A;  2UXD J;  3GFX A;  3CCE S;  4DR1 J;  1L3S A;  5AJ3 J;  2XMV A;  2EC2 A;  2M8H A;  1YVF A;  1TMJ A;  2ZKT A;  4I1T A;  2Z56 B;  3TJ9 A;  5CA5 A;  4QWD A;  1B3T A;  2QLX A;  4ALZ A;  1LXJ A;  3KLE B;  4DPT A;  1HNX J;  2DNP A;  1RCO B;  6AT1 B;  2KVQ E;  1RA7 A;  2Y9H A;  4X2B A;  3FSI A;  3CMQ A;  1OQ6 A;  1YJ7 A;  2ZJP Q;  3DLH A;  3ZTP A;  3KLG A;  3Q8S B;  3BS9 A;  5IT0 A;  2UUC F;  2Y1I A;  4ZHR B;  2P6S A;  5ETR A;  2PE8 A;  3DFE A;  2FVC A;  4X84 A;  1FWL A;  1C0T A;  3D1O A;  4GKJ F;  1X5P A;  2V63 A;  2CJ9 A;  1JXE A;  2GCF A;  3CJ3 A;  2FJW A;  1NH8 A;  3HHL A;  2VQF J;  3RBE A;  2W2O P;  4AXI A;  2C2N A;  2WON A;  4DX6 A;  3V5R A;  4Q44 A;  1WHX A;  3RB0 A;  4DV3 F;  2X3D A;  4K4Y A;  2XMU A;  2J0S D;  2ZH2 A;  2RU9 A;  4IR9 A;  2OEK A;  5DLG A;  2XMJ A;  4IH7 A;  2JEF A;  2HHH J;  4LF4 F;  1U1P A;  3UDV A;  1JIH A;  3GV8 B;  4G1P A;  3MUV P;  3BGR A;  4K50 A;  1V5I B;  4B17 A;  4ED5 A;  2W25 A;  2CJX B;  3R6G B;  2L3M A;  5M2R A;  2R8K A;  3ISN C;  4RUC A;  2WVD A;  2WZ1 A;  4JI5 J;  1Q0N A;  2BJE A;  3F44 A;  3FSX A;  5CHC B;  3R1L A;  1QUV A;  2Q79 A;  3GJT B;  5F9N A;  2AP6 A;  4K4Z A;  1SL1 A;  2QLJ B;  2YX4 A;  4C98 A;  2E9R X;  3IWL A;  1UEK A;  2FJX A;  3GWC A;  2XTJ P;  4ITS A;  2X3G A;  1GMW D;  1SUQ B;  4C2M A;  1UL3 A;  3ENA A;  4TKT A;  1Q78 A;  3NGU A;  3DRP B;  5D4P A;  3GTY X;  2EBE A;  4NXN F;  2HIY A;  5T41 A;  3BBB A;  6FD1 A;  3E2E A;  2R8J A;  5IZH A;  3THP A;  1X5O A;  4CNZ A;  3DLE A;  2HHT A;  1VBK A;  2APO A;  1YTY A;  4LVO P;  5KT6 A;  2FLL A;  2KFZ A;  1H38 A;  2MJN A;  1NSK L;  2MEW A;  2H65 B;  2NSB A;  2PC6 A;  4DPX A;  4DL2 A;  1RWU A;  1RXO B;  3RGI A;  2KFN A;  4LSZ B;  3DYA A;  2BJD A;  4KH0 B;  3FBC A;  4OHZ A;  4OJG A;  2PT0 A;  3DM2 A;  1T0T V;  1MLA A;  2FD2 A;  2NXN A;  2ZDP A;  3NWR A;  4MKV A;  4TLR A;  5HVG A;  4KO0 A;  2YWG A;  1F5A A;  2IMO A;  2RDD A;  3BSC A;  3W61 A;  2NUU G;  1RAI B;  2LXF A;  4OHV A;  2V8P A;  2V2Q A;  3DOK A;  3JQJ A;  3QT6 A;  1KQG B;  4DMZ A;  3J81 j;  4Q5V A;  5DDR C;  3PKY A;  3J7Z 5;  2RRA A;  4DR4 J;  3EGV A;  4B02 A;  2MZQ A;  4AL7 A;  1I3O B;  1QAJ A;  3AJD A;  2ASD A;  3M9N B;  3SSR A;  2E1M C;  4QIW D;  2B8Q A;  4YUD A;  2I5J A;  2UXB J;  3NNC A;  3BGU A;  4HR2 A;  4O3R A;  1KVI A;  3H42 A;  1MWY A;  2F3J A;  5KFX A;  4MKB A;  5KFS A;  4DU7 A;  4NI2 A;  2BX6 A;  4I7F A;  2R7X A;  4K7Q A;  2IRU A;  1I1G A;  3AHP A;  1N4L A;  4CDI A;  3FVY A;  3VQT A;  5EUH A;  3NNH A;  4QYR A;  4P10 A;  4DG1 B;  2W01 A;  3R5A A;  2W1B A;  5EX0 A;  3HVA A;  1RGV A;  4D3H A;  2D9O A;  2Y0S D;  3GYG A;  4FF3 A;  1IVZ A;  2BJ7 A;  2GA7 A;  1V3S A;  4RW7 A;  1S79 A;  3SSS A;  4ZIT A;  5HQM A;  3NBP A;  1LK7 A;  3D1H A;  3D6T B;  2GVZ B;  4C11 B;  4MFB B;  1S10 A;  1N33 J;  1Q8K A;  1V5V A;  4JI8 J;  2CNN B;  4WU2 A;  1JQG A;  4JI6 F;  1VQ6 S;  4Q8E A;  1NB2 A;  2RT3 A;  1T9W A;  2E5G A;  3VZH A;  1F9H A;  1I94 J;  4HLB A;  3E51 A;  1Y9O A;  3BYP A;  4IG0 A;  2BAN B;  3CJ4 A;  4HTI A;  4F4Y A;  1S0O A;  4IUF A;  1BQN B;  5KOX A;  5LT5 A;  1EB0 A;  1H98 A;  3B82 A;  2DT9 A;  1U25 A;  3GV7 B;  1U4B A;  3DN9 A;  4J9M A;  2N3L A;  3EVW A;  1AUS L;  1M1G A;  2F8H A;  1S1V B;  3AOA A;  3BKT A;  2YKN A;  3MEE B;  4DUZ F;  1RIS A;  1OPI A;  4LF4 J;  1TK8 A;  4YOE A;  1UZD A;  4NX9 A;  5J2P B;  2FC8 A;  1Y5L B;  4K4V A;  1EAR A;  1X7V A;  1HYS B;  4AXJ A;  1CVJ A;  3ZZO A;  4KRW A;  4NA1 A;  5HMX A;  3CCJ S;  1T05 A;  2R7T A;  1RWW B;  5KFT A;  1RI7 A;  2KJW A;  4IOC Q;  3BGL A;  3CO0 P;  3ET6 A;  3GJR B;  3KFW X;  2EPI A;  3WDO A;  2R9L A;  2FLO A;  1SL2 A;  4ED1 A;  2C3P A;  2V2V A;  5DQH A;  2D74 B;  1RT2 B;  4OI0 A;  5JVG Q;  2DRB A;  4LFC F;  1SQF A;  2R8G A;  2NQP A;  4I6Y A;  1D9F A;  1VK8 A;  2DR8 A;  3MUR P;  3SV3 A;  1VC5 A;  2VG7 B;  2AGP A;  4U7U K;  2RD5 C;  5LMN J;  3PCO B;  3PJW A;  1H74 A;  1HNW J;  4WBF A;  2KFY A;  2ROG A;  2M70 A;  4OI2 A;  4CLL A;  4KTQ A;  4ANE A;  3QZ8 A;  2EFO A;  2LCW A;  2VPX B;  3D66 A;  4FYW B;  4DBQ A;  1FJC A;  1H2V Z;  4PPZ A;  1B70 B;  1S9G A;  2YKA A;  5DRK A;  3DNC A;  3CCT A;  4DX5 A;  3HHL C;  2ZE2 B;  1CSJ A;  4Y65 A;  4ZPT R;  4RBV A;  2C3Y A;  4R8U B;  5KT3 A;  1K1S A;  1S1T A;  3IAS 9;  4UF4 A;  4G1Q B;  3S1T A;  2F1F A;  4DF4 A;  1VQ9 S;  2GIF A;  3CJ2 A;  3MCN A;  4TY8 B;  9ATC B;  3OHA A;  3OTO J;  2IJN A;  2V0N A;  4LF6 J;  4NPO A;  1OS5 A;  4OL8 A;  1GXU A;  2EFN A;  3BH6 B;  2CNL B;  4E2F B;  2ZM6 J;  4F4Z A;  1UVI A;  1VRU A;  3H2U B;  1JJC B;  5LSL A;  3FBB A;  2B8P A;  4OYX A;  1FKO B;  1U1N A;  2XS5 A;  1NK9 A;  3HSZ A;  2B4V A;  2DEI A;  4WK1 A;  1JLQ B;  1SJF A;  4UOH A;  2GML A;  2CVI A;  5J2M A;  2VKZ G;  3O2I A;  2M9K A;  1YBU A;  4L75 A;  3X3U A;  3CDW A;  5DG8 A;  2LEA A;  3M30 B;  4F2R A;  1L3K A;  2D3U A;  4P74 A;  4KT0 C;  4NLD A;  5DGB A;  4ZVR B;  3JYT B;  4DSK A;  3DGP A;  4K4S A;  2CG8 A;  1FRH A;  2E29 A;  4LF7 J;  2GNK A;  4CRJ A;  3VAM A;  1YIT S;  1C0U A;  3HT0 A;  2KJV A;  3UI3 A;  2AKW B;  1T94 A;  1WSV A;  2CDQ A;  4ES3 A;  1BXN A;  3QIP B;  5MLC V;  1SXL A;  2CWK A;  3PHE A;  2CJK A;  1GFW B;  2LQB A;  5BJR A;  4F4K A;  1LWC B;  4ZVH A;  5DM7 Q;  4JV2 A;  2UZA A;  4DOZ A;  1T03 A;  2ACY A;  5B0E A;  4C9D A;  1HBO A;  1C0T B;  4FN5 A;  2C2K B;  5CCL A;  2CQP A;  4EZ9 A;  2V8G A;  4JI2 J;  4Y0F A;  3GPA A;  3CVK A;  3QRR A;  2YX7 A;  2CJA A;  3H2V E;  3V81 B;  1VIO A;  4YS2 A;  5KFD A;  1DTT A;  5ETO A;  3Q8Y A;  1Y00 A;  1PIE A;  1F2G A;  2FYX A;  3FNN A;  2VG6 A;  2Y0B B;  3PRD A;  3DLK A;  4K5R A;  3MTK A;  5HJX A;  1QAI A;  2Q6C A;  2DCL A;  2WK4 A;  1GXL A;  4ID5 B;  3AAW B;  4J7C A;  4HHJ A;  4USM A;  5EWG A;  2BW2 A;  4QW8 A;  3SXL A;  3GIK A;  4DV0 F;  2XSJ B;  4WFA Q;  1ZOT A;  3J81 U;  2BJ9 A;  4LSN B;  4XDD A;  1TKT A;  2XO6 A;  2I6W A;  2XYP B;  3SQO P;  4PQA A;  1HIY A;  4ZPV R;  1N0V C;  3G9C A;  2CYY A;  2O1P A;  4DZD A;  1I94 F;  1VQL S;  4GO5 X;  4DL3 A;  5M2U A;  1UPM B;  2C1E B;  4B3S J;  1CQN A;  1BWE A;  2ZD1 B;  1DY3 A;  4IDK A;  3GU0 A;  1WDD A;  1PJ7 A;  3QLH A;  4LF7 F;  1E6V B;  1FDB A;  2F5G A;  2CPD A;  2HNZ A;  1VCT A;  2ZEJ A;  3DC2 A;  3DOK B;  5GMK a;  5KFJ A;  2QO3 A;  2BE2 B;  1XMB A;  4MIW A;  1FWK A;  2HGL A;  1NPK A;  4GO7 X;  4P72 A;  3BRE A;  1N34 F;  4QOT A;  3T6B A;  3D54 A;  3BO2 A;  4ECT A;  3SCK E;  2QE5 A;  2ZOG A;  2CWX A;  1VHF A;  2QGF B;  4FVC A;  1U8S A;  4A8M P;  4RLE A;  2Z2Y B;  5ETL A;  2DGS A;  4ID8 A;  1FRK A;  4ZVS B;  1HNI A;  1TKX A;  4ZDN A;  1KHW A;  3VGS A;  1YK9 A;  4TQR A;  2VJV A;  2KXF A;  4F4X A;  1JXL A;  1RWV B;  1IJE B;  1VBZ A;  2FZK B;  4KC5 A;  3D4J A;  4CT9 A;  4XK8 C;  3EZU A;  4YDX A;  3J7Z T;  3SV4 A;  3PX4 A;  3DM2 B;  3O6Q A;  2BKP A;  2FJD B;  2HK3 A;  4J37 A;  4NLP A;  3FFI B;  4PXC A;  2H4W B;  4CLT A;  2DNZ A;  2H1Y A;  3MGJ A;  3TVY A;  3EPI A;  5C2C A;  1HQU A;  2MGZ B;  3H5X A;  2B4O A;  1RLD A;  2RNE A;  5F0U A;  3AQP A;  3PM9 A;  3KLH B;  5KG6 A;  1H0H B;  4NWB A;  2V2Z A;  4CLS A;  3FSY A;  4B9V A;  1WC5 A;  4M5N A;  2CPE A;  6FDR A;  3TP2 A;  2U1A A;  3P96 A;  4J5O A;  1RAG B;  2YPZ A;  4LF1 A;  2WVB A;  4P52 A;  1FE4 A;  1PGZ A;  2VD3 A;  2NXJ A;  5ETT A;  1VMB A;  2J0Q D;  2UVR A;  3KJV A;  2ASJ A;  3OTC A;  5BYS A;  2R7V A;  1YJU A;  1DBD A;  1SKW A;  2X7I A;  4X4T A;  1PC5 A;  1WG4 A;  1TZ0 A;  3IMQ J;  1OSC A;  1U0S A;  1Y5I B;  2Z8Q A;  5E5N A;  3H2L A;  2KG0 A;  1T9V A;  1G7C B;  3ENV A;  2C2D A;  1G3O A;  1CC8 A;  2E1A A;  2NYI A;  1VDH A;  3LWM A;  3RW6 A;  5KFO A;  3I55 S;  2ZBI A;  3H0P A;  1Q86 T;  1YJR A;  2C22 A;  2VPZ B;  4RW4 A;  3N79 A;  1JMT A;  2GVD B;  4FZV A;  4QWB A;  1YRX A;  1Z2L A;  3SDE B;  2V4R A;  5B0D A;  3UN2 A;  1J5O B;  5J2Q B;  5KFL A;  4R25 A;  3QGI A;  3HFK A;  3NAI A;  2CPF A;  1JX4 A;  2NPI A;  3HFZ B;  1U1O A;  5B0B A;  2BUN A;  3FQL A;  1B0V A;  2OFH X;  4R0E A;  5EDW A;  4N7T A;  5I4M A;  1FD2 A;  1FF2 A;  2ILZ A;  2OHD A;  1WHW A;  1VRT B;  2AJ2 A;  2OPQ A;  3D0H E;  1S1V A;  3QT7 A;  3OJS A;  2RB7 A;  4FNH A;  4Y2C A;  2OJ3 A;  4KFB B;  1KS2 A;  2QTW A;  3AOB A;  2UP1 A;  1CUL B;  1FX4 A;  2HGM A;  3OTE A;  1F9F A;  4W98 A;  4B3M F;  1T95 A;  4CT8 A;  1ZM4 A;  5KOW A;  1QLN A;  2Q66 A;  3OHB A;  2G13 A;  4QZV B;  1U1M A;  2KZZ A;  2CZ9 A;  1JJ2 R;  4G1Q A;  1WF2 A;  3M2V A;  1AT1 B;  2MKY A;  3T1H F;  2MKJ A;  4F50 A;  4NMX A;  3DYA B;  5L8R C;  3HT3 A;  1Y10 A;  3LP1 A;  4M63 A;  1FDA A;  4UW2 A;  4USU A;  4DQS A;  1R0A A;  1DQ9 A;  2V4J A;  3KMS A;  1NXI A;  3EYZ A;  1R27 B;  2CPH A;  4C7Q A;  3EPG A;  3NCR A;  1HNZ F;  1HA1 A;  1MG7 A;  1V6H A;  5A8R B;  5KG5 A;  2BKN A;  2YWK A;  2ROP A;  1RT4 A;  1BWV A;  1KHV A;  1P1T A;  2MZR A;  3OXF A;  4M1K A;  4ZVU B;  3KK3 A;  3K5N A;  3HHD A;  2J6U A;  2HHQ A;  1DUR A;  3MR6 A;  1N5S A;  3H59 A;  1U24 A;  3GR1 A;  2L9N A;  1KTQ A;  2Z58 B;  4OYB A;  4JUZ A;  4YFU A;  1HWU A;  4DUY J;  3MPV A;  4M5H A;  3OR1 A;  1U7L A;  3HUL A;  3MMC A;  3TR5 A;  2YXL A;  2ZBQ A;  3BDE A;  5A6P A;  1FJG J;  3PYG A;  4EMD A;  1FRJ A;  3NS7 B;  3NS6 A;  3P49 B;  3U1L A;  2DNH A;  3J80 Y;  3FCH A;  3ZO7 A;  2IJF A;  2AW0 A;  2DK2 A;  1CJV B;  1S6O A;  3BBC A;  2YWE A;  3KLF B;  3CMA S;  1PSD A;  3VAL A;  3KHL A;  3SI8 A;  2UVU A;  4FS2 A;  2P9G A;  2DGX A;  4NLV A;  1D1U A;  4OX8 A;  2F4V F;  5HSP A;  5AXM A;  2IVY A;  5KFI A;  4AL5 A;  1TK0 A;  2XUL A;  4JB8 B;  2RUS A;  4JBC A;  5KFH A;  4F7V A;  1NK8 A;  2XMK A;  4DFJ A;  1FO1 A;  2I0X A;  4RR5 A;  3V81 A;  3OL6 A;  3DDN A;  4ZPD A;  1L3T A;  4ELT A;  5IOL A;  3LO3 A;  1EET B;  2EI5 A;  4ZN3 A;  1HI0 P;  4AYB D;  2OAU A;  1FFW B;  1RWN B;  5E2Q A;  3AFG A;  2DJW A;  3PW2 A;  3T5K A;  2D3Z A;  2IFX A;  3R5D A;  3JAM U;  4GKJ J;  4I2Q B;  3MM5 A;  5HAO A;  2NRE A;  2KT3 A;  2W4D A;  3LH2 S;  3KNG A;  3T41 A;  4CO4 A;  3Q83 A;  4KQZ A;  4S0M A;  3WBZ A;  2J0W A;  2DGO A;  2W4P A;  1S6Q B;  2ABY A;  3W7B A;  3MZI A;  1O6X A;  5HVF A;  4NXM F;  5B0A A;  2QA2 A;  1IBL J;  1FKA F;  3CJR A;  4IH5 A;  3K89 A;  3J81 Y;  2QRR A;  3SYZ A;  4OJ1 A;  3TO8 A;  3NCQ A;  2NLW A;  4GVB A;  3R2C J;  3Q2T C;  3W65 A;  4ZA1 A;  2DXF A;  4J9S A;  1FX2 A;  5T7L B;  2M3D A;  2QSW A;  5A0Y A;  2KXH A;  2BDP A;  3W8G A;  3BV8 A;  2B7B B;  5IWA F;  2DGT A;  3P5T L;  1HBU B;  4DU8 A;  4WYL A;  4O4R A;  1W2I A;  3U27 A;  4ZLP A;  1MWQ A;  1KLN A;  4QCL A;  2BZ2 A;  4WFX A;  2WCX A;  3A8J A;  2LDI A;  4CO3 A;  4EO6 A;  1S77 D;  1NK4 A;  4DL7 A;  4H4K A;  3M8S A;  2BV3 A;  1X0P A;  4WE1 B;  1Q79 A;  4LRE A;  1FK9 A;  1Q8I A;  3BQ1 A;  3I9V 9;  1DLO A;  1U0H B;  2MHN A;  3HHN B;  1TUV A;  5GAH I;  3E01 B;  2QC3 A;  3CWJ A;  2WRM A;  4RWW A;  2IC3 A;  3LTO A;  4C8O A;  1S6P A;  3KWM A;  4C6A A;  3EM1 A;  1EQ0 A;  1Y4Z B;  3DDK A;  4JI5 F;  2L9D A;  3EVM A;  3TUJ C;  4OZ2 A;  4EUV A;  3CCU S;  1YBT A;  2BYC A;  1X8D A;  1R8C A;  1Y3J A;  4OZ0 A;  1N56 A;  1P27 B;  1TKD A;  4PQU A;  2FHK A;  3PFO A;  3PJ9 A;  4K2X A;  4WF9 Q;  4J9U E;  3CCL S;  2OD4 A;  3DLB A;  1S9E B;  3KLV A;  2WON B;  2QN6 B;  1IBM J;  3L3C A;  2P8I A;  3HD1 A;  4HI2 A;  1RAF B;  4ICL A;  4CLZ A;  2HWT A;  1H7W A;  4QR0 A;  4CYU B;  4LF8 J;  4WFY A;  3PW4 A;  2FB0 A;  2PEH A;  2RQK A;  3MM8 A;  1FKP B;  3FCW A;  2CRL A;  2A10 A;  4FBU A;  3GSD A;  3GLJ A;  1OO0 B;  3PZP A;  5D0H A;  3KK2 A;  1LQ9 A;  4X4N A;  5J2N A;  4B9M A;  2ZBR A;  1TP7 A;  2AX0 A;  3G2X A;  4RW8 B;  1N5Y B;  5I42 B;  3FFI A;  2HAI A;  5LMU J;  1MWZ A;  2GS8 A;  4ECW A;  4ER8 A;  5LSR A;  2ZHO A;  3IC1 A;  3MTJ A;  4P2S A;  1NM2 A;  3A8I A;  3ADA C;  5ADZ A;  5DDP C;  3HX9 A;  1S97 A;  3PY8 A;  1N0U A;  4Y2A A;  2W2P P;  4DR4 F;  2KB2 A;  1K0V A;  4FXD A;  1RAC B;  5DDQ C;  3PO5 A;  5E3P A;  2Q43 A;  2QA4 S;  2GVD A;  1WTF A;  2JVR A;  2GV1 A;  4P2M A;  4U8V A;  4DX7 A;  1J5O A;  1PYS B;  3MD1 A;  4ZCI A;  5E41 A;  1XWL A;  1R31 A;  3C15 A;  1OYE A;  3BF4 A;  1B0T A;  3C3L A;  4YN3 B;  2B5J A;  3MR2 A;  3CTR A;  3SIP B;  3VZI A;  3IWX A;  2W8K A;  2R2R A;  1WEL A;  5IQQ A;  1AXQ A;  2K7J A;  1VIX A;  4WJB A;  3F73 A;  3TAQ A;  4PG7 A;  4AE5 A;  5HMZ A;  2R3V A;  4DSF A;  2D7S A;  2HBQ B;  4UZC A;  1RAA B;  4DQR A;  1AYE A;  4G6V B;  5KG2 A;  4N8O A;  1S12 A;  4ELV A;  3BJY A;  3A1Y G;  3CD0 A;  3HCX A;  3AQO A;  2AEM A;  3BM7 A;  2DRA A;  2Y1R I;  7FDR A;  4MK8 A;  1QE1 A;  3US5 A;  1ZAV A;  5ITH A;  1KNZ A;  5DDO C;  3OL7 A;  3QZ7 A;  3W3S A;  4QW9 A;  2EKN A;  1S1W B;  1V3R A;  2LQJ A;  3J7Y I;  1I51 B;  2LVW A;  2O66 A;  1FWP A;  3CJQ A;  3FZ2 A;  2ZOM A;  4GMK A;  1X4C A;  4ZVF A;  1RWP B;  3W5Z A;  1PYO B;  2IHR 1;  3JSM B;  3R1H A;  4DZ6 A;  3RB6 A;  2KT2 A;  2NCK L;  4QIF A;  4QIV A;  3B4D A;  3H7H B;  4LQ3 A;  1TU0 B;  4WK3 A;  4RL1 A;  1HBN B;  1UAW A;  1REV B;  3FKB A;  2PA8 D;  1ICE B;  3D0G E;  3GYN A;  4JP8 A;  2OPR B;  4NI2 B;  4NLX A;  3TNV A;  3WX4 A;  4ZVE A;  3C19 A;  3DLG B;  1BGX T;  1LW0 B;  1R6Y A;  2WVC A;  3I31 A;  1MRO A;  4N56 A;  1YKW A;  2ALZ A;  4KE5 A;  2J6S A;  2VL1 A;  1VK3 A;  4KJI A;  4UOG A;  3OTB A;  2GO9 A;  1ITP A;  2E7W A;  2EKY A;  2COL A;  3FC9 A;  3HSJ A;  4WZQ A;  1HBM A;  2JEG A;  5EN1 A;  4JI7 F;  1M90 T;  2GQC A;  2XYG B;  4ILM A;  3BGF A;  4P2X A;  3ZNJ 1;  1NU4 A;  1Q8L A;  1RWX B;  1ZA1 B;  2HZC A;  1TVR B;  2KI2 A;  2MLX A;  4NZ7 A;  5AXN A;  4X4Q A;  4DR2 F;  4IRK A;  3KNA A;  4NA2 A;  5J1N A;  2BE9 B;  3BH7 B;  4DS5 A;  2BVZ A;  1BQN A;  1QTN B;  1YX2 A;  3EDR B;  2LEC A;  4B3T F;  1IKX A;  4F3O A;  4C3L A;  2E66 A;  2QMU B;  2VFR A;  2Z0G A;  3CCS S;  4DR1 F;  4DL6 A;  2MST A;  1X4E A;  3M6U A;  1HNV A;  3N9U C;  3CNQ P;  4LSL A;  1EKS A;  2IJR A;  4WIQ A;  2VV5 A;  1HYS A;  3M8P B;  2A3J A;  2CQ2 A;  5J1P A;  5HAN A;  1ULR A;  1F0X A;  3GV5 B;  1TL1 A;  3IM9 A;  4U95 A;  4M5J A;  4F02 A;  1T9T A;  3QWU A;  2DY1 A;  3L7O A;  2KHD A;  3NGR A;  4RW9 A;  1RTJ A;  3CIM A;  7AT1 B;  1RT2 A;  3GIR A;  5HN0 A;  2LLZ A;  4DR3 J;  1BLU A;  1PC4 A;  1SH0 A;  3P8B B;  3TRG A;  1CEZ A;  3BN7 A;  3DRS A;  1Z1Z A;  2MDA A;  1NK0 A;  2NUH A;  2XHC A;  4WWS A;  5D77 A;  3ZXW A;  2RE1 A;  2RIJ A;  1YZ7 A;  1FEH A;  3FK4 A;  5D6G A;  4WKR A;  2YH1 A;  5C5J A;  1YG0 A;  1IUJ A;  2VBW A;  4G1I A;  4XIU A;  5J2Q A;  3RB3 A;  4YME A;  1SC3 B;  2HPU A;  1SJR A;  2PO4 A;  1ZAW A;  2ZNY A;  3TVK A;  1Y7P A;  3A13 A;  4OYO A;  3L95 X;  4ZCL A;  3UNG C;  3CJ8 A;  1NK5 A;  1TL4 A;  4JV5 J;  2DH8 A;  1Q53 A;  3RJM B;  3TAR A;  2CQG A;  1BHN A;  1RZM A;  2HWI A;  4TQS A;  4DL4 A;  2NZ4 A;  5DZ7 A;  1TL3 A;  1MNE A;  1BQM B;  1FCA A;  4GVB B;  4ERD A;  3QAU A;  2GJI A;  2RS2 A;  5IT9 U;  2VBZ A;  3BBF A;  1REG X;  4JV0 A;  1S6P B;  2MHE A;  4MMO A;  3P3D A;  4DF8 A;  3CDE A;  2HNY A;  2ZUA A;  3IN5 A;  2LQ8 A;  1DHM A;  1HBU A;  1XTZ A;  3CF5 Q;  1R0A B;  1CJU A;  5B08 A;  2RQC A;  3CUL A;  2LYV A;  1Q7L B;  2JFK A;  2UU9 F;  1VQO S;  2DB1 A;  3TZY A;  4ZPC A;  2JC0 A;  1KRP A;  3M30 A;  2W9A A;  2CPZ A;  1X4B A;  1BE4 A;  1LWF A;  1KLM B;  1HI1 A;  1NUE A;  1L5U A;  4RZR A;  1NDL A;  4WE1 A;  1UVJ A;  2CPJ A;  2RRN A;  2JHE A;  2P2C B;  4OI3 A;  3QRP A;  1TFY A;  1A0O B;  2HHX A;  3KTQ A;  2IC3 B;  3T1A A;  2G2Z A;  4ECV A;  3TYT A;  4QQB A;  1GTH A;  1T03 B;  5B7W A;  2BQU A;  3H5U A;  3C16 A;  1WEZ A;  1HBO B;  1FER A;  3BGO P;  3KLE A;  3RB4 A;  2RUG A;  4A8K A;  2GHV C;  4JOU A;  2HW3 A;  4U7U D;  4DV2 J;  2ZBP A;  3W2W B;  5H9F K;  1I5O B;  3R7B B;  5GAD U;  4DR6 F;  4DV5 F;  4GKK F;  4L3N A;  5KFR A;  1Q5V A;  3U7J A;  5GAH U;  2ZOF A;  2NXU A;  3DRY A;  3MM8 B;  3TJA A;  5JUM A;  1GTE A;  4K59 A;  5DLF A;  1T8E A;  3SQG A;  4ED4 A;  1TKZ A;  4ZPA A;  2R8I A;  2OP5 A;  4YP3 A;  3D0I E;  3TAM A;  5CD4 A;  2OPS B;  1JJH A;  1N5V A;  1WOS A;  4Y6I A;  2RJZ A;  4NLQ A;  1DZ5 A;  5H9E K;  2OD6 A;  4KPY A;  3EZO A;  1YBA A;  1NJZ A;  3K8V A;  5HAT A;  4W90 B;  1BUX A;  1F5C A;  1G4C A;  1ZBT A;  2DIS A;  3C6T A;  3G82 B;  4QR2 A;  2QG9 B;  3TQE A;  2RHS B;  4D3G A;  1WI8 A;  4YHH F;  4AL6 A;  1VBY A;  3RBZ A;  4L73 A;  1BC6 A;  3V4I A;  5C2G A;  4ED8 A;  1KTV A;  2C2M B;  2J7K A;  3QLH B;  2VFT A;  2Z2L A;  4WXO A;  5LSO A;  5AT1 B;  3WC0 A;  3HHK A;  1UA0 A;  1X9S A;  2WOM A;  1FXR A;  1GK8 A;  4FKX A;  3M05 A;  4OX9 F;  1D09 B;  3TA0 A;  3NOC A;  1BQX A;  2J76 E;  4NYP A;  1SBR A;  2B6A B;  2E7V A;  4FNI A;  1X4A A;  1KOH A;  1QM9 A;  2BAB A;  3A8E A;  2KDO A;  4XTT A;  3NOG A;  1KSP A;  2OTL S;  2B9W A;  2OEJ A;  2QL5 B;  2YNH B;  4BC7 A;  4ZP6 A;  4ZCK A;  1LFW A;  1TK5 A;  3IR5 B;  4J9L A;  4K4U A;  1R89 A;  1KON A;  4H54 A;  1RHQ B;  2B9E A;  5F8L A;  2IA6 A;  4TLQ A;  2W2N P;  4TN2 A;  4NRT A;  2OKQ A;  5IT9 Y;  4WFB Q;  3DLL Q;  2J9D E;  1NHU A;  5BR8 F;  2OGU A;  4DR6 J;  1C1B B;  1K1Q A;  1QSS A;  4GKK J;  5GME A;  4LVN P;  2QSF A;  4DQI A;  3MCM A;  4UY8 T;  3OLA A;  1HQU B;  2W24 A;  2MGZ A;  3RAM A;  5L1L A;  4P73 A;  1T3O A;  2YKM B;  1RTZ A;  2XY5 A;  1XNR J;  3RZA A;  2UUB F;  2H9Z A;  2XGP A;  2DYA A;  3DHX A;  2DH9 A;  3PO4 A;  4AT1 B;  3G87 A;  1O5J A;  3R6L B;  3G6V A;  1D8Z A;  1NH7 A;  2SXL A;  2RDJ A;  4V19 X;  3G6X A;  3JS9 A;  1LW2 B;  2IM2 A;  5E3R A;  2R2U A;  5KFB A;  5GAE U;  1IBK F;  4N41 A;  1JNR B;  2YPY A;  3KG4 A;  3MMB A;  3M9M B;  4PQU B;  2V8V A;  4DPW A;  4C48 A;  3Q8V A;  4YEA A;  2LU2 A;  3EZ5 A;  1NCL A;  2V9K A;  3ISZ A;  4OMF G;  4HAC A;  3WQP A;  1MU2 A;  4FYX B;  4ETZ A;  2VA2 A;  2ZWP A;  5KFE A;  2PI5 A;  3A4T A;  3T1Y F;  4L72 B;  4K4X A;  3J7A 1;  2DNR A;  4DV4 F;  1S1X A;  4JI1 F;  2HKE A;  1DFD A;  3FEZ A;  3M6V A;  4RW4 B;  3CCZ A;  2ATL A;  5L1J A;  2HMI B;  1KOO A;  2CQC A;  5K14 A;  1KFS A;  3UFC X;  5ETM A;  2MPU A;  4ZIW A;  2AJ1 A;  4KV8 A;  4DJB A;  1HL6 A;  3DRS B;  3MEK A;  4LF2 A;  1E6Y A;  4IH6 A;  3PX6 A;  4Q0B A;  1TQL A;  3DHW C;  4LFB F;  2H5E A;  3MEG B;  3R97 A;  2MZ1 A;  4K2J A;  5CZV A;  1HNX F;  2BKO A;  4KY3 A;  1S0N A;  5LOQ A;  2H48 B;  3DRX A;  3G8Q A;  2AYE A;  3ELH A;  3MWB A;  4MYU A;  4WXW A;  4KGX B;  2YNI B;  3CD5 A;  5FII A;  3JAM Y;  1FNX H;  1OY8 A;  4LSL B;  1CJT B;  3PHT A;  2M52 A;  3K5M A;  2D41 A;  2HUR A;  2G1H A;  3UCU P;  2HHW A;  1IR1 A;  5E7O B;  4NAS A;  3JTO A;  2CPY A;  1OIA A;  2BJ3 A;  3W63 A;  2AZ3 A;  2MSS A;  3EE3 A;  4LR7 A;  1DJ0 A;  1BY9 A;  1RT7 B;  2ZBC A;  3IXQ A;  3NAH A;  3B4M A;  3CB4 A;  2HS3 A;  1X4D A;  2MKS A;  2NXC A;  2RVJ A;  3D1Q A;  2IM1 A;  3RTV A;  4A8F A;  4DR3 F;  2IBK A;  1U45 A;  1ACM B;  1U2F A;  1AFI A;  1HLW A;  2C42 A;  4LJM A;  5IQ6 A;  3D9B A;  3P4U B;  3ZTQ A;  2M8D B;  1DQ8 A;  2IAJ B;  2R42 A;  1ZTT A;  1XMO J;  1CJK A;  2BM0 A;  2MLZ A;  2RQM A;  4ECR A;  1VQS A;  2B51 A;  2UV8 A;  5CAB A;  4CQ1 A;  4RBU A;  1FT8 A;  2EG1 A;  1TV6 A;  2HVE A;  1LKZ A;  1S1W A;  1TMM A;  3FEY B;  3LP2 A;  3OR2 B;  5D4O A;  3U1N A;  2JDJ A;  1UW4 A;  2R7O A;  1R8H A;  4ANC A;  1PIL A;  5KFW A;  1CPZ A;  4E0D A;  2F4F A;  4LF5 F;  3JTN A;  1R8B A;  3ILL A;  3WX8 A;  2BEF A;  3K58 A;  2GW8 A;  2LQ5 A;  1RTI A;  1RAO A;  4O4G A;  2KVI A;  1REV A;  4I69 A;  5K5M A;  1V3Z A;  2OLW A;  4ZLL A;  2C3U A;  1ZM3 A;  1S57 A;  4K5S A;  4ZLJ A;  4JV1 A;  3MEC B;  1SC1 B;  2DPI A;  3O3L A;  2KL8 A;  1LW0 A;  5BYR A;  4ZIV A;  1UVN A;  1VQ8 S;  1FNM A;  1EP4 A;  2MKC A;  3RUB L;  1WAC A;  1WWH A;  3D7S B;  4TY8 A;  1KEK A;  4LBH A;  1N6Q A;  3PYE A;  3MUM P;  1U09 A;  1NO8 A;  2KO1 A;  3HHL B;  3UCG A;  3AOD A;  1JLE A;  3THV A;  1FES A;  2FC9 A;  5CZX A;  2HS0 A;  3UVJ B;  5DG9 A;  3VAJ A;  2O5D A;  3M6X A;  5L9X A;  1GMU A;  2FJB B;  1HHS A;  1P6T A;  2EVZ A;  5D3G B;  3LF0 A;  4GRS A;  2B7C B;  2M88 A;  3G96 A;  1FJE B;  3TAM B;  1HI8 A;  4A47 A;  4JYA F;  1TR0 A;  2GMH A;  4I2P A;  4PG5 A;  4P9S A;  1HAR A;  2A2D A;  5D15 A;  1YJW S;  1XMQ F;  4K0K F;  2K8G A;  3CJK B;  3DU6 A;  2XO7 A;  2ZH6 A;  3CE8 A;  1HNV B;  3HVT A;  4HVZ A;  5F9L A;  1JXV A;  4OHX A;  1SQE A;  3EJM A;  3EX7 B;  1OQ3 A;  4V1A k;  4HDG A;  1XBW A;  2HK2 A;  2HFZ A;  3K2Y A;  1NK6 A;  3QGP A;  3HXM A;  5CYM B;  1RA6 A;  4FVM A;  4Y2I A;  2ZHB A;  3K8W A;  3Q8P B;  1RWO B;  3MAA A;  4KGV B;  5AXK A;  3W9J A;  3THT A;  5F8J A;  4FPR A;  4L3K A;  3VF0 B;  4CLW A;  1GNK A;  2WOM B;  1Q81 T;  5GVQ A;  2HND B;  2ERR A;  2LP4 A;  2HYI B;  2MJU A;  1UZH A;  2ZZN A;  5DZ6 A;  3IWN C;  4XAK A;  1W7W A;  4LBP A;  3DDI A;  2AIR B;  4NLY A;  4CI0 B;  2A0F B;  5H1S V;  3ET6 B;  2HBZ B;  2LQ9 A;  1WF0 A;  1EQM A;  3FRY A;  4LFA F;  3ZTO A;  4U7C A;  2KM8 B;  1N32 F;  2U2F A;  4NLT A;  1N8R T;  2BW7 A;  4ECU A;  4EWT A;  1U6B A;  1FK9 B;  2YX1 A;  2LA4 A;  2ZH4 A;  1U0H A;  2UVV A;  3MMA A;  2CPX A;  2IPO B;  4UOC A;  1LEO A;  3E01 A;  3JB9 k;  4QYZ J;  2FUG 9;  5HBM B;  3AJ1 A;  3AY0 A;  5HLF B;  2W2Q P;  2Z2Z A;  4OHW A;  2JLG A;  1SL0 A;  2KU7 A;  1F5B A;  3HF5 A;  1UJ4 A;  4I4B A;  1NDK A;  1RHR B;  1TKT B;  4UQT A;  1S9G B;  3ZNU A;  2B6A A;  5ETQ A;  2CQI A;  1RTH B;  1NJY A;  3GCW P;  2C2O B;  1BQM A;  4LIR A;  4OIX A;  2FJV A;  4PEO A;  3BSN A;  2H5J B;  5LMU F;  1MSW D;  4OI1 A;  3D6H B;  3W1Y C;  1SJQ A;  2M5Y A;  3N6M A;  3UNY A;  2UUA J;  1H2U X;  2LFV A;  3DCA A;  4W92 B;  4OYI A;  5KG1 A;  2EG2 A;  3Q8U A;  3PW5 A;  2GIQ A;  1U2C A;  4FYV B;  3S01 A;  4WYW A;  2BAC A;  2HG4 A;  4ZVO B;  2VOP A;  2DR5 A;  5DS7 A;  4U67 Q;  3GII A;  2DNQ A;  3PG9 A;  4QBU A;  5F8N A;  2A6M A;  5BYQ A;  2K3K A;  5AE1 A;  5MAO A;  2EK1 A;  1VRU B;  2XWX A;  5CYJ A;  1T05 B;  3CCW A;  4XO0 A;  2HRT A;  2AGO A;  3A8K A;  4DG1 A;  1J27 A;  4NYO A;  2DNY A;  1HNI B;  1YSJ A;  5EWF A;  1JLQ A;  3B6B A;  4UZB A;  5J2M B;  1RHU B;  4LR8 A;  4C11 A;  2XB2 D;  2B43 A;  3HDS A;  1UVK A;  3LP0 A;  2KKH A;  4WP3 A;  5F3T A;  2P9C A;  4RU9 A;  2HHS A;  4IRD A;  3MOJ B;  2DHA A;  4RKU C;  3M8Q A;  4V19 J;  5HVH A;  1UVM A;  3C15 B;  2XMT A;  3NWG A;  1XER A;  4U6P A;  2BQR A;  4KV8 B;  1U1R A;  1QTM A;  5HMY A;  3VVU A;  1FA0 A;  2B5J B;  2DKO B;  2OPP A;  4ZJQ A;  4HH1 A;  4KKO B;  5A8W A;  5H9F J;  3AD7 C;  4NYZ A;  4RW6 A;  1NHV A;  4U96 A;  1RE1 B;  2KYX A;  2XHW A;  1NKC A;  3UDC A;  5HQL A;  3CED A;  5J2P A;  1SQG A;  2Y1L B;  2ZDO A;  3GB0 A;  1ZM9 A;  1GAO A;  3TWZ A;  2PFD A;  3CW2 C;  4X66 J;  2FVQ A;  4JI8 F;  4ECQ A;  3T5L A;  1JLA A;  5ETS A;  2ZH3 A;  1DTT B;  2AJQ A;  5H9E J;  4F3Q A;  1UWA A;  1FI4 A;  2QA1 A;  1C4A A;  2WW4 A;  3MR3 A;  3Q86 A;  1VQ7 S;  2HZA A;  4OJ3 A;  1VYA A;  1HWL A;  4DPY A;  3CC7 S;  4K8R A;  2DR6 A;  3NY0 A;  2XMA A;  4OZN A;  2HFV A;  2AF6 A;  3DKD A;  1ARO P;  1M0S A;  2IRY A;  2QYC A;  4R5P B;  1NPR A;  1RP5 A;  4ECZ A;  1HR0 J;  4LMZ A;  5C24 B;  1Y3K A;  2UXB F;  4IFY B;  3UDL A;  4KR0 B;  4MKA A;  2RF2 A;  2XC9 A;  1FXD A;  1NK7 A;  1LFP A;  2HVD A;  2ZH7 A;  3I0S B;  5C42 B;  2W7A A;  2JEI A;  5KFY A;  3LUY A;  2ZH1 A;  4F4W A;  4GC7 A;  3ENW A;  4RO0 A;  4JI4 J;  1PJ6 A;  1XK8 A;  4KPC A;  2HFN A;  2YWF A;  3AOC A;  3M2R B;  5K20 B;  3KHH A;  2FJE B;  3QRQ A;  3P5B P;  5A8K A;  1RU1 A;  4J9K A;  3F41 A;  3EMT A;  3ITH A;  2G4B A;  2CNO B;  4QJV A;  2ZHA A;  3FEX B;  3MPW A;  2WB1 D;  3MFI A;  1PBU A;  3M8Y A;  1JLB B;  2Y8Y A;  1XIQ A;  4B08 A;  4OYA A;  4P2F A;  1QAY A;  3I4H X;  1TFW A;  5K9F A;  3NKY A;  4J9R A;  2B3T B;  4P7T A;  5AXL A;  2R7R A;  4DR5 J;  4ED0 A;  2IM0 A;  3NBP B;  3NGK A;  4M5D A;  3OR2 A;  4YR3 A;  3Q23 A;  4NOH A;  2EFG A;  4LT6 A;  1P9Y A;  4F04 B;  1WHV A;  2Z30 B;  3GSI A;  3HVW A;  4F2S A;  2R7S A;  4LR9 A;  3KK1 A;  2HWH A;  2I38 A;  2UXC J;  4H4K C;  4OX7 A;  2WHO A;  3OT9 A;  3QQC D;  1M5H A;  4CM0 A;  5C25 B;  4K4W A;  1YGY A;  5KFP A;  1SJ3 P;  1HR0 F;  2GGP A;  2XY7 A;  1IM4 A;  1D9D A;  2BOA A;  1HNZ J;  1B0P A;  1HPZ A;  3HKW A;  3MM6 B;  3DOM A;  2FZG B;  4HAC B;  1LV5 A;  3QIP A;  1WEY A;  5A2Q Y;  2FIU A;  1KD1 T;  2HAF A;  1X31 C;  2X1F A;  1UJ5 A;  2JVO A;  3HKZ D;  1XMQ J;  3GZ7 A;  2E9T A;  1JNZ B;  2KH9 A;  4J9P A;  4IOA Q;  3OL8 A;  1N36 J;  4OI4 A;  1YWX A;  4Z37 A;  2IDL A;  1KDN A;  4DFK A;  2DPJ A;  3KLI A;  1K9M T;  2XLK A;  5KG7 A;  2QX0 A;  2PSZ A;  3B54 A;  4LQ9 A;  3T6J A;  3CO9 A;  4BBY A;  1NSA A;  2F8E X;  2FGO A;  1X4F A;  4Q0B B;  3H5S A;  4WFZ A;  5LJ5 Y;  1EX8 A;  1RAB B;  1RHM B;  1RT3 A;  1T7P A;  5E33 A;  4M95 A;  5I3U A;  1K47 A;  4U9R A;  3OVA A;  2XSJ A;  5AE3 A;  1EET A;  1TL7 A;  4DV6 F;  1XR6 A;  3MR7 A;  3N5B A;  2XNQ A;  1GEH A;  3QJL A;  4TYB A;  1QSY A;  1Q95 G;  2DCU B;  3I96 A;  4A8W A;  2NSC A;  2UUC J;  3MMA B;  1T11 A;  1WDT A;  3PYD A;  2G9O A;  5CYM A;  8AT1 B;  2QL7 B;  4GVL A;  2RQ4 A;  2JL9 A;  5HBM A;  1S1T B;  3IGV A;  1FXL A;  1IBC B;  1D8Y A;  2C3M A;  3H4D A;  1RT7 A;  1NSQ A;  5EWE A;  4LF5 J;  4QIE A;  4FS1 A;  1RBO B;  1XEZ A;  2CA9 A;  2J9E A;  2QJ3 A;  4FXW A;  3UE2 A;  1ZPW X;  1A7G E;  2QL9 B;  1O0P A;  2VFU A;  4J91 A;  4DR7 F;  4X4S A;  1SPB P;  2UXD F;  3PX0 A;  5G0R A;  2XLI A;  1X0F A;  2KTQ A;  3Q8R B;  2F7V A;  2R2T A;  2VU5 A;  4L74 A;  2IYG A;  3FQK A;  1VLO A;  2F9D A;  4X65 F;  3LP2 B;  1TV6 B;  1HMV A;  3IO1 A;  4DEZ A;  2RDI A;  3C46 A;  4LRD A;  1G1X A;  1VC0 A;  3RRG A;  2UUA F;  2FTR A;  1AUD A;  1U48 A;  1G2E A;  3G6Y A;  5A8R A;  2OSQ A;  2AU0 A;  2WBR A;  3MM9 B;  3CCQ S;  4AFF A;  1RTI B;  4X4U A;  5A76 A;  2KYZ A;  4UUX A;  1W25 A;  5IT4 A;  3MAH A;  4CO1 A;  4DLG A;  3E3X A;  5F3Z A;  3EVO A;  2BOP A;  3KDN A;  2FHJ D;  4CH7 A;  4EFA C;  4RNO A;  1YHQ S;  3MPD A;  3O44 A;  5KG0 A;  4M5K A;  2EC0 A;  1NME B;  3W9I A;  4HT5 A;  2VFS A;  4MT1 A;  2PFF B;  4DUT A;  4RNH A;  4H4M A;  2N82 B;  2BE7 D;  7FD1 A;  1WJ9 A;  2R2S A;  4DV7 J;  2IBO A;  4IQX A;  4MKY A;  4JYA J;  3ZZP A;  3RR7 A;  5IM0 A;  1N6Q B;  1FRI A;  1PCA A;  3LPE A;  5LJ3 Y;  4F26 A;  3K59 A;  4QWE A;  2QMW A;  8RUC A;  1FJ7 A;  3DXB A;  4KYZ A;  1N32 J;  2FZC B;  2DD8 S;  2MYF A;  2YQ3 A;  3NGS A;  5RUB A;  2CVE A;  4ICL B;  4KKO A;  1WC0 A;  3UD5 A;  5A8W B;  2IRX A;  4O44 B;  5IC4 B;  4CYU A;  4HH0 A;  5AE2 A;  5L46 A;  1N34 J;  2LEB A;  1D0E A;  4LF9 J;  4FF1 A;  2VG6 B;  4ILL A;  1UKU A;  4B9U A;  2ATC B;  3IBF B;  2EXU A;  2XMW A;  2YKP A;  3MOZ A;  3BO4 A;  2BR0 A;  4DSE A;  5GAG I;  4UST A;  2F4V J;  4B3R J;  1S49 A;  3VGV A;  3N6L A;  4B9L A;  1VIS A;  3ILI A;  5J2N B;  5LXY A;  1P1L A;  4B3S F;  4OZ1 A;  4WP9 A;  2F40 A;  1EJ7 L;  1YZ6 A;  4FKY A;  3SDE A;  4C0H A;  2G1D A;  2V2K A;  4WTO B;  3ISN D;  2H3E B;  3TEH B;  1Y11 A;  2MZT A;  3NNA A;  5LXR A;  3Q0A A;  4Y34 A;  2YNH A;  1WG1 A;  1IBK J;  5B0F A;  3T3F A;  5F0W A;  2FVS A;  1KP6 A;  4OFZ A;  4LRF A;  3C8Y A;  2X1B A;  3RAX A;  2ZWO A;  1UA1 A;  1HQE B;  4PWD A;  4IFY A;  2AWZ A;  3CC2 S;  2Q1L A;  2BE2 A;  2UUW A;  4YY3 J;  4TU8 A;  3GFZ A;  2BXJ A;  2VHG A;  1Q82 T;  5GMD A;  2B9Y A;  3W9H A;  2MMY A;  1GMW A;  3R3T A;  4X4O A;  2UUB J;  5DGA A;  2IYI A;  3PIP Q;  2YBV A;  1ELO A;  4I6W A;  1C1B A;  2A18 A;  4ZP8 A;  3BSO A;  3W64 A;  3MED A;  3I82 A;  3KUE A;  2RIL A;  2AYB A;  3M2V B;  2DIU A;  3IFE A;  4U8Y A;  3I6P A;  5HQ8 A;  1RBL A;  5K8O A;  2XM3 A;  3SZ2 A;  2V9W A;  4PWW A;  2AEJ A;  4CLU A;  2LA6 A;  3D2W A;  3R5C A;  3AB2 B;  3LP1 B;  5FDL B;  3CJ5 A;  4C8N A;  4IKA A;  4PG6 A;  3R5J B;  3NCP A;  1RT6 A;  3RU0 A;  2DXE A;  3UQS A;  3LGH A;  4KGK A;  4CIO A;  1HWK A;  3I0R A;  1WKJ A;  4H4O B;  1H73 A;  1AB8 A;  2AMC B;  1RT4 B;  4C3K A;  3KYL A;  4Q8F A;  1SKS A;  2A6O A;  1RYS A;  5FLX U;  3JQM A;  4OYM A;  3U02 A;  3S7R A;  1VQM S;  2PEB A;  4I6A A;  2G0J A;  2BRK A;  1S1U B;  3K17 A;  4URG A;  3CJT A;  4X4P A;  1S72 S;  1C2P A;  1UMJ A;  3GG1 A;  3T9Z A;  1T02 A;  2G2O A;  1F2H A;  3SMZ A;  2ASL A;  1KFD A;  2ALY B;  2J7W A;  5CYQ B;  2VQE F;  2ZM6 F;  3KLF A;  2B4U A;  4RNN A;  4N77 A;  1GT8 A;  2CZ4 A;  3N6N A;  2DGV A;  3JXO A;  4X64 F;  2XMM A;  4JI3 F;  3KK2 B;  4J9O A;  3UN3 A;  4XDC A;  3LP0 B;  3TW0 A;  3NRB A;  4OZ3 A;  3SCL E;  1GMV A;  2RKI A;  4A8Y A;  1HBM B;  1YDL A;  3A3N B;  3POT B;  1JLF A;  3UN5 A;  4DV1 F;  4OYP A;  1HHQ A;  4ZVT B;  1KQF B;  4PUO B;  1C4C A;  2IY5 B;  2VF3 A;  2EW9 A;  1RB0 A;  1EHW A;  2WB4 A;  1UET A;  1HFE L;  2CQ1 A;  3BGR B;  3OXG A;  4G65 A;  4USI A;  2ZVI A;  4OV6 A;  1IKX B;  1T9Y A;  5M2P A;  2DGU A;  2EWH A;  2K06 A;  2VDH A;  3AD9 C;  2BBE A;  1HNW F;  5EX3 A;  3W8P A;  4CLY A;  3TUZ C;  2MXY A;  2HQF A;  4Q43 A;  1NJI T;  1FVQ A;  4NE9 C;  4KHP J;  2C2Z B;  4ZPW R;  1RTD B;  3QGH A;  1ROF A;  2FLP A;  1VR6 A;  3RW7 A;  5L39 A;  2XGQ A;  1RKJ A;  3K7R A;  1X5T A;  5CQG A;  3VTI A;  2ADB A;  5GAD I;  1CLF A;  2FPH X;  3OXL A;  4JI1 J;  3KJQ B;  4CH0 S;  1SUQ A;  5SUH A;  1RTJ B;  3TJ8 A;  4HI1 A;  2MQQ A;  1U2R A;  2MTL A;  3UWT A;  5ETV A;  2I8E A;  3W66 A;  3PFE A;  1KVJ A;  3IG1 B;  3OL9 A;  1FHT A;  3DRR B;  2W7P A;  4P7V A;  2CQ3 A;  1VHI A;  1MMD A;  1ZM2 A;  5J1E A;  2A1B A;  2HQC A;  5F41 A;  3PEJ A;  1VJW A;  3MMJ A;  2O3D A;  2XQC A;  4WKY A;  4X64 J;  5DJB A;  4CLF A;  3H5Y A;  5KAK A;  4N76 A;  3HM9 A;  1JKH A;  3GIJ A;  1J5E J;  2JNJ A;  4O3P A;  1H7X A;  1WOP A;  1SV5 A;  2D9P A;  2DY9 A;  2IDE A;  2IM3 A;  4DQQ A;  2V67 A;  3MEC A;  3S8S A;  3JSM A;  4CZC A;  1ZTW A;  5FJ4 A;  1RT1 B;  3SSQ A;  4USV A;  2R8H A;  3IRX A;  4I67 A;  1J2V A;  3LAN A;  1IWA A;  3IR7 B;  3MD3 A;  2W2M P;  1HWI A;  2K1R A;  2ZUG A;  5A8K B;  3NMR A;  1VQ5 S;  1CC7 A;  4MH8 A;  2DNG A;  4YQW A;  2OPR A;  5CH7 B;  3NLC A;  4Q2M A;  3G6E S;  5JJB A;  2HHP A;  3T5J A;  2ZE2 A;  2CUY A;  1N5Q A;  2CFX A;  4ZS6 A;  4DFP A;  4BWJ A;  2CQH A;  1KVK A;  3FGV A;  1IQT A;  3UVJ A;  1SB6 A;  2I5J B;  4H4M B;  1WF1 A;  4EEY A;  4WP8 A;  4I56 A;  2HNY B;  4O3Q A;  2OI2 A;  2KHC A;  1CG2 A;  1LOU A;  1RK8 A;  1WG5 A;  1TEL A;  2RHQ B;  2OTJ S;  2Z4P A;  4IFV A;  4A8O A;  4I2P B;  3SCJ E;  3IAM 9;  2Y3Y A;  5HO4 A;  3TVZ A;  5GAG U;  4CH1 A;  3BO3 A;  3LAL A;  4FF2 A;  1X60 A;  3DI6 B;  5C25 A;  4DV2 F;  1JK9 B;  4RW7 B;  1NLK L;  2PMW A;  3HMJ G;  1UPP A;  2X51 A;  3CT9 A;  4Z7C A;  3HD2 A;  4YB5 A;  2K2P A;  1U6Z A;  2JSX A;  3R27 A;  4W4M A;  5F8M A;  4EYH B;  2JZ5 A;  4EBE A;  2QT7 A;  3MM6 A;  2HBR B;  4DPU A;  1JWW A;  3B8H A;  1QSL A;  4KSE B;  1FD8 A;  4ILR A;  2KXN B;  3HPO A;  3PW0 A;  3QJP A;  4YY3 F;  4HTJ A;  4LBI A;  3JYT A;  1LK5 A;  1FTC A;  4PAA A;  3C16 B;  3M8P A;  4C97 A;  2MKK A;  3MAQ A;  4B3T J;  5IM0 B;  1OMS A;  2F65 A;  4LUB A;  1RBA A;  3BDP A;  3MF5 A;  4PXE A;  4OQJ A;  5A2Q U;  2C28 A;  1KR4 A;  2CKW A;  3GON A;  1IQZ A;  3FZB A;  3OPK A;  4ENO A;  2YKN B;  2N7C A;  4MIA A;  2MQN A;  5JMN A;  4TU7 A;  1UW9 A;  1AW0 A;  3PR4 A;  3HJF A;  3BB5 A;  5B09 A;  1WSR A;  1TKZ B;  3R7N B;  5KTQ A;  3DLE B;  2UVW A;  4F67 A;  2VON A;  2LMI A;  2OPS A;  3HI9 A;  2PA3 A;  4DV5 J;  2VB6 A;  4YB6 A;  2DIV A;  3L4B C;  3W5Y A;  1YJN S;  3UR0 A;  3AD8 C;  3M8R A;  1Q5Y A;  2ROE A;  3JTP A;  2DR9 A;  3M8W A;  2CNK B;  2MQM A;  2V69 A;  3I5C A;  3QGG A;  4FDF A;  1R8P A;  1VFJ A;  3WIV A;  5CAA A;  2ZH9 A;  2YH0 A;  3CSK A;  5HP1 B;  1U47 A;  1M5O C;  1Z4U A;  3JSB A;  4OZ5 A;  2DHX A;  3QT5 A;  1C1C B;  4CWB A;  3C2P A;  5D8H B;  2VC1 A;  4NZ6 A;  2MLY A;  2J5A A;  1VJQ A;  2BM1 A;  1HD1 A;  2RH3 A;  2XBP A;  1NBE B;  2IVM A;  4KO0 B;  4UUW A;  4Y28 C;  3VQS A;  1HD0 A;  4A46 A;  1Z2Z A;  3PIO Q;  1NKB A;  3DMJ B;  4Y2K A;  3CXC R;  1NJX A;  4QU7 A;  2HHU A;  3JSY A;  2V94 A;  4NLS A;  2V68 A;  2Q3P A;  4HT7 A;  5A6W A;  4O3N A;  3VWS A;  3WHI A;  4PXD A;  1GX5 A;  2YQ1 A;  3CGI A;  1NB7 A;  2HSE B;  3R8Y A;  3HP6 A;  5G0R B;  4IYQ A;  3RRK A;  3KLG B;  4DV3 J;  4FBT A;  2R7U A;  3OD2 A;  2CQ4 A;  1UFK A;  2AJ0 A;  3PAC A;  2UU9 J;  2GAG C;  2HVI A;  1O51 A;  2VKR A;  2FGC A;  4USJ C;  1X4H A;  2F8M A;  4OX6 A;  3QFW A;  4E8U A;  1IKV B;  1WD6 A;  4UQG A;  4JI3 J;  2XZW A;  4L76 A;  4FF4 A;  4ES1 A;  3EGZ A;  1CJU B;  2DNO A;  2B9X A;  1ZZF A;  3KKF A;  4B3R F;  3KHG A;  3KXD A;  4QWC A;  3RBD A;  4RW8 A;  2QIF A;  2RRB A;  3Q2S C;  5K8N A;  4N5S A;  3WC2 A;  1IKY B;  3F56 A;  1Q4R A;  1R8A A;  1RT6 B;  2OMO A;  2XZD B;  3MM9 A;  4P75 A;  5KT4 A;  3QSY B;  3J7Y U;  1FKO A;  2UV8 G;  2VQE J;  4EZ6 A;  3VAG A;  4P6Q A;  2AV5 A;  2RSQ A;  1KWM A;  2ZZT A;  1L3U A;  3AB4 B;  2DNL A;  3W60 A;  2LKZ A;  2MQ8 A;  2HFU A;  3MDF A;  4O3S A;  1VRQ C;  2GIR A;  4QYZ K;  3GYX B;  1GH8 A;  1HW9 A;  3DLJ A;  1I6J A;  1FRX A;  3V4M A;  1VQ4 S;  4DXL A;  4DR7 J;  1S4E A;  3ETM A;  1JLF B;  4PUO A;  1R43 A;  2G0I A;  4DHV A;  5DET A;  5FLX Y;  2XI3 A;  4ZCM A;  2GX8 A;  3SCI E;  1IKW B;  3NGT A;  1FDD A;  1NPP A;  4OJH A;  3KLH A;  2HGN A;  2ACM A;  2IVF B;  1JLA B;  3R5B A;  2L08 A;  5DO2 A;  4ZVQ B;  2L41 A;  2MZJ A;  2OO4 A;  1ZS6 A;  3N5F A;  3SBM A;  2OFG X;  2DGW A;  2ZH5 A;  5LM7 E;  3KG1 A;  3ZZT A;  1N36 F;  4C8K A;  4DS4 A;  2O67 A;  3HK2 A;  2ZC4 A;  5IS2 A;  3CCR S;  4DV6 J;  4ES2 A;  1WUU A;  1RTD A;  1SJ1 A;  4ED2 A;  4C3M A;  5D0R A;  1X9W A;  1NZ8 A;  4AQY J;  2V4Q A;  4DFM A;  1TUW A;  2HQG A;  1UCN A;  4DL5 A;  1KC8 T;  4NCA A;  1VQK S;  4PRF A;  2QFI A;  3POT A;  5C24 A;  1ZPV A;  2B56 A;  3AXM A;  5T14 A;  2AEF A;  3G82 A;  3N28 A;  3M6W A;  2AT1 B;  4EU0 A;  4F25 A;  5HRO B;  2K3I A;  5KFA A;  3OJU A;  4QR1 A;  3FMW A;  2ZH8 A;  2LXU A;  2JRS A;  2V50 A;  5J1E B;  3MEG A;  4DLE A;  3PW7 A;  3RRH A;  3GP9 A;  5L38 A;  1WC3 A;  3OBI A;  3VGT A;  2QEX S;  1S7I A;  2H54 B;  2CJB A;  3TZZ A;  1HBN A;  1T9U A;  1NZA A;  4DR2 J;  2XSF A;  3CCV S;  1XR5 A;  2GJ2 A;  5KT5 A;  1UVL A;  8ATC B;  2GZO A;  4URS A;  4I68 A;  4JI7 J;  3FRZ A;  1JLB A;  4PZV A;  3G8T A;  4MYT A;  4LRC A;  3GCX P;  1OJ4 A;  4WFN Q;  3MED B;  1VRT A;  2XZT B;  3EXC X;  3IA0 A;  2YNG A;  4C8Y A;  4KFB A;  4RUA A;  4YR2 A;  1Y5N B;  3ILO A;  1UFW A;  1MMN A;  3ETO A;  3IBW A; 
#chains in the Genus database with same CATH homology
 3FBF A;  3VVT A;  3FBC A;  3FBE A;  1PKU A;  4C6A A;  3EM1 A;  3EVM A;  1B4S A;  1S5Z A;  2VU5 A;  3L7U A;  3NGR A;  3PJ9 A;  4UOF A;  5CAA A;  3Q86 A;  2CWK A;  1WKL A;  1VYA A;  1S59 A;  1HHQ A;  4W98 A;  1EHW A;  1NDC A;  2B8Q A;  3GPA A;  3FCW A;  4HR2 A;  3DKD A;  3EVO A;  2BX6 A;  3Q8Y A;  3G2X A;  3MPD A;  2DYA A;  1JXV A;  2HVD A;  3EJM A;  4DUT A;  4FKX A;  1LWX A;  4F4A A;  3JS9 A;  1MN9 A;  4KPC A;  2AZ1 A;  3PRV A;  5C7P A;  3FCV A;  3Q8V A;  3EMT A;  1XQI A;  1U8W A;  3NGS A;  1BHN A;  1NCL A;  1NB2 A;  1HIY A;  1NDP A;  4AND A;  1XIQ A;  1W7W A;  3DDI A;  2DXD A;  3BBF A;  1F6T A;  3VGV A;  3VGU A;  3ZTO A;  4DI6 A;  2ZUA A;  5BXI A;  3EVW A;  1PAE X;  4FKY A;  3BBC A;  2DY9 A;  3ZTP A;  1MN7 A;  1NPK A;  3ETM A;  3R9L A;  1LEO A;  1BE4 A;  1NUE A;  3NGT A;  1NDL A;  3VGS A;  1B99 A;  1NDK A;  1ZS6 A;  5IOL A;  3ELH A;  3Q89 A;  2HUR A;  1NSP A;  4DZ6 A;  2NCK L;  4WBF A;  4EK2 A;  3Q8U A;  3Q83 A;  1NHK L;  2AZ3 A;  4S0M A;  1UCN A;  1KDN A;  3EE3 A;  4ANE A;  4O0N A;  3FKB A;  3ZTS A;  3B54 A;  1HLW A;  2DXE A;  1NLK L;  3ZTQ A;  2DXF A;  3B6B A;  4UOG A;  3GP9 A;  1WKJ A;  3VGT A;  5CAB A;  3FC9 A;  3ENA A;  3NGU A;  2HVE A;  4CP5 A;  3BBB A;  3BH6 B;  1BUX A;  1WKK A;  4ANC A;  3FBB A;  2B8P A;  4F36 A;  3WX8 A;  3VVU A;  1F3F A;  1NSK L;  2BEF A;  3BH7 B;  4ENO A;  1NSQ A;  3EIC A;  4UOH A;  3ZTR A;  1K44 A;  1S57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...