4DUTA

The structure of nucleoside diphosphate kinase (ndk) from burkholderia thailandensis
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
140
structure length
140
Chain Sequence
b'ALERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVAARMAHLSRADAEKFYAVHAERPFFKDLVEFMISGPVMIQVLEGEDAILKNRDLMGATDPKKAEKGTIRADFADSIDANAVHGSDAPETARVEIAFFFPEMNVYSR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Transferase
total genus 44
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4dutA00
1K44A 3FBCA 5CABA 1S59A 5BXIA 1BE4A 1JXVA 3BBFA 1NDLA 3WX8A 3MPDA 3Q83A 4FKYA 4W98A 5CAAA 1XQIA 1EHWA 2B8PA 1NPKA 3Q89A 1NLKL 1S5ZA 1NSQA 2HVEA 3VGTA 3FBEA 1HHQA 2HURA 3ZTRA 1VYAA 1NB2A 4UOHA 3R9LA 3ELHA 4DUTA 3Q8VA 3EJMA 4O0NA 2ZUAA 3EMTA 4S0MA 3NGRA 2DYAA 3BH7B 3EVWA 1WKKA 3BBCA 3FBFA 4FKXA 1F3FA 3NGUA 2CWKA 3ZTSA 3FCVA 3BBBA 3Q8YA 2DY9A 1PAEX 3ZTOA 5C7PA 2VU5A 4DI6A 5IOLA 1UCNA 1KDNA 3ENAA 3VGSA 1NDKA 1NUEA 1NDPA 2BX6A 1LEOA 2AZ1A 1NCLA 4DZ6A 1F6TA 1XIQA 1S57A 1NDCA 3VGUA 4KPCA 2DXEA 3VVUA 1NSKL 1PKUA 3ETMA 3DDIA 3VGVA 3FBBA 1BHNA 3Q8UA 3ZTQA 4CP5A 1HIYA 4ANDA 2B8QA 2AZ3A 3EE3A 1HLWA 2DXFA 3PRVA 1B4SA 3GP9A 1WKJA 3GPAA 2HVDA 3Q86A 1MN9A 4EK2A 3FKBA 3ZTPA 3NGTA 3EM1A 4UOFA 3DKDA 3EVOA 4ENOA 1NHKL 2BEFA 3FC9A 1MN7A 3JS9A 3VVTA 4ANEA 4ANCA 3FCWA 1BUXA 1B99A 3BH6B 3EVMA 1W7WA 2DXDA 4F36A 4F4AA 4UOGA 3G2XA 1LWXA 3EICA 3PJ9A 4HR2A 1U8WA 1ZS6A 1WKLA 2NCKL 4C6AA 4WBFA 1NSPA 3B6BA 3B54A 3L7UA 3NGSA
chains in the Genus database with same CATH superfamily
3PO5A 1S0VA 5F9NA 2JVRA 3C16B 2R42A 2MDAA 4J9SA 4FS1A 1Q7YT 1PC5A 4AD6A 2ZOMA 1BMQB 1PIEA 3C6TA 1Z1ZA 4M5GA 2HFZA 5GAHI 1V3ZA 1TL1B 2B9XA 2RRAA 3TUZC 3RTVA 1NHVA 5GAGI 5CZXA 3SBMA 2HSEB 5GAHU 5KG6A 2FJAB 1RTDB 2E9ZA 1CULB 3ZZYA 3AHPA 1VC6A 1S57A 3MEDB 3GFHA 3GG1A 1FTCA 4B02A 4O23A 5E3CA 5GAGU 3M1VB 4LQ9A 2RRNA 2NPIA 2DB1A 4WZQA 2EXUA 3BO2A 2M7SA 1T3OA 3EVMA 2W4DA 3R5BA 3ZZPA 4EGLA 1X5PA 4JI6F 3KNGA 3KLGA 1R0CB 1CJTB 5ADZA 2CPIA 3LGNA 2J7WA 4O4GB 4F4KA 4CCHA 4C3MA 3IGVA 1NK9A 1XQIA 4PR6A 2YKMB 1N0UA 3D9BA 1S5ZA 5L1JA 5KFCA 4IR1A 1A9NB 3C16A 4Q2MA 4UOHA 2R7SA 2DCLA 4YQWA 2XMAA 1G4CA 2RS8A 2GV1A 3I4HX 4ATNA 1VISA 3FNNA 1MROB 4E2FB 3Q8YA 3LH2S 3H2VE 2R4FA 1ZAXA 1TL1A 1R0BG 3FK4A 3QT8A 4DZ6A 1GFWB 4H54A 5KFZA 4TU7A 1BQMB 2PIIA 1AFJA 3ZTQA 1L3TA 1RTDA 1CULA 4Y00A 5CZVA 3MEDA 5A0YA 4GMKA 2KT5A 2YPZA 3M1VA 4WXWA 2KT3A 4J9LA 3C6UB 3PJXA 4P72A 1JWWA 2LLZA 1P1TA 5EUHA 3IAM9 2GW8A 2BZ2A 4MTPA 4FXVA 5KFXA 3JAMY 4IUFA 1SH0A 4F2SA 9RUBA 5BXIA 2IJFA 2WSCC 4X84A 5HVGA 5JXSA 5G4DA 2OTLS 2FHKA 1CJTA 2QL7B 2DISA 1IKVB 5H9FJ 4HKQA 3S01A 5LXRA 2BBEA 4A8KA 1U7LA 3EZ5A 1S9FA 1S49A 1KQFB 1D1UA 2YKMA 2A1BA 3TRGA 2QLWA 1UZDA 2A0FB 2RE1A 1TV6B 3GFYA 4MYUA 2FY8A 4UUWA 4YB1P 4ZJQA 1MROA 5C2CA 1Z2LA 1OQ3A 5EWGA 5EX3A 3QZ7A 1WEZA 4ED1A 2XBPA 3PIOQ 1VK8A 1HNXJ 3PYDA 3K5NA 3GYXB 3R1LA 1D8YA 1BQMA 1PJ6A 3EVOA 1O8BA 3MGJA 4TXSA 3ILJA 4X4QA 3I9ZA 4IG3B 4A8XA 1EX8A 3PIPQ 4DJBA 2X3DA 1RCOB 2N3OA 3M8PB 1I94J 3C6UA 3GLJA 2BQ3A 3NGSA 1FESA 5IQQA 4PYAA 4TVAB 1S0OA 1BLUA 3WC0A 4DL6A 3DHXA 2CDQA 2VFUA 4MKBA 2FB0A 2OHDA 1NK0A 1Q1KA 3MUTP 4ZPTR 3RBEA 2CQPA 4GKJF 3EJMA 4USIA 1IKVA 3MTKA 2RHQB 2MLYA 4DR7F 2LXUA 1WC3A 2E1CA 3JSYA 2MB0B 1RKJA 4YB7A 3C15B 2DIVA 3NWRA 4JV0A 4YY3F 5IV4A 4ZVFA 1S6PB 2NPFA 2JC0A 1TV6A 2W2QP 3MCSA 4ED8A 2HHHF 3T6JA 4OLPA 1HHTP 4ZVQB 4G3IA 2R7VA 3T1AA 4R25A 3CF5Q 4DR5J 3HHKA 3VVTA 4M5MA 1BUXA 2RIJA 2I8EA 4PEOA 4I64A 2F9JA 1UA1A 3VR1A 3N01A 4LVNP 4ZPVR 2NR0A 4RW4A 4IG3A 1M5HA 3L7UA 1U6FA 3HHNB 2ZBQA 2DGQA 3GIMA 1HNIB 4AQYJ 3M8PA 2L3MA 5E3AA 1WI6A 1WACA 4BHQA 2V69A 4P73A 2IRYA 1Y10A 3Q8QB 3LPEA 5KFUA 1HW8A 4PYDA 1SI9A 2Q6BA 3M6WA 1SC1B 4ECUA 1VQ5S 3N6NA 3OXGA 1DQAA 1HQ2A 5E2QA 2Z58B 1S1UB 4ERDA 1DLOB 1L5UA 3HVRA 1SXLA 4ZIWA 2ZH5A 2EK6A 1R89A 3VVUA 2L48A 3C15A 4RNFA 5D6GA 4NPOA 2XSJB 1T9WA 2L41A 1Q86T 1S6PA 1MN9A 4WP8A 3QMQA 1U25A 2FZCB 4G65A 2V8PA 3TEGA 1JLCB 1HA1A 1WC6A 2Y1LB 3R2CJ 1ZA1B 5DLFA 1TKZB 5F8JA 3G6YA 2IRXA 4LQ3A 2BRKA 2OPSB 1R0AB 1FJGF 1X4DA 2KL8A 3DC2A 3I5AA 1IBKJ 2RVJA 2KVQE 4CZCA 4JI3F 1JNZB 3AD9C 1HNIA 3P49B 1BXNA 4M5KA 2E9TA 4QR1A 2R7QA 2XZDB 5K9FA 3KG0A 4Q5VA 3HDSA 3BH7B 2AGQA 2DJWA 3NGUA 2FJEB 4LMZA 1C2PA 4RX6A 3ZO7A 3J7YI 3CTRA 2IM1A 4OI2A 1KDNA 4CO3A 4G1IA 1LEOA 2J7KA 2VKRA 5KFYA 1IR2A 1T03B 1S1UA 2P5VA 4G6VB 3J7YU 1DLOA 2DHHA 2XHWA 5B08A 4ZLLA 1KSPA 2QLXA 2ZH2A 4TYBA 4PG6A 3BGUA 2LVWA 4DPXA 3THPA 4QWDA 2XSJA 4DCJB 2W24A 4WTYA 3RR8A 3IM8A 1GEHA 3W64A 2J9DA 1KKHA 3DNCA 3MAHA 3F41A 2HVIA 1LW2B 4ITSA 4HTIA 1OYEA 3B8HA 1JLCA 3PKMA 2Z4PA 1YBAA 3K2YA 1TKZA 3H25A 1IM6A 2VUGA 4EU0A 1IVZA 4KE5A 3OFGA 4CLYA 2V2QA 2OPSA 3G6XA 2JH3A 5DO2A 4HDHA 2KZMA 3A8EA 1R8BA 2CG8A 5KG5A 5KT3A 2EVZA 3HVTB 3K5LA 2Q66A 2C2RA 3OTDA 2ZH3A 2FD2A 1R6VA 1SB6A 1WDDA 3ZZTA 4KH0B 4URSA 3KLHB 4JI2F 1HBMB 1VJWA 1H7WA 2VZ9A 1S6QB 3NS7B 1X5OA 2ZVIA 2EC2A 3MMAB 3PRDA 1T03A 4XTTA 3QQCD 1QSLA 4KPYA 1IUJA 1XK8A 2DPJA 2KJVA 2FVSA 2UXCJ 2DBBA 5H9EK 3RYLA 2FQQB 5KT5A 2QSFA 4F4WA 2RHSB 2WVDA 1LW2A 1YSJA 4ES1A 5IWAF 4OYMA 1B7FA 1N52B 2DNGA 2HVZA 5RUBA 4ED7A 3T19A 4M5LA 1OMSA 1HBNB 3R9LA 4M1KA 2VPWB 2FJWA 4GKKJ 5DQIA 4PG7A 3R8YA 4WCEQ 4DF8A 2XMKA 2AP6A 1WHWA 2F65A 5HQMA 4F0HA 4RWXA 4F26A 3HVTA 3L4BC 2UUBF 4X4UA 4I6AA 1Y00A 5H1SV 2HK2A 3RB4A 3QSYB 3MM9B 2ZWPA 2H54B 3N0VA 3S8SA 3CJ2A 5MLCV 4FPIA 2GQQA 3KLHA 4EO8A 2OSQA 4UT4A 1HR0J 1HBMA 4Z2XA 1S6QA 4C0BA 1QAJA 4DR6F 3LGMA 3HK2A 4B3SF 4FYVB 3MPUB 3MMAA 4WBFA 1VLYA 3VWSA 1NPKA 4O4RA 1IKWB 3HSGA 1DZ5A 1S6OA 1T11A 4ZPWR 4YR3A 2F8HA 3IFEA 1VJQA 1J27A 1RA7A 1EJ7L 2X3GA 3MTJA 1VI7A 1U26A 4HI2A 4EZ9A 2HG4A 5SZTA 3DRRB 3KJFB 1HBNA 3ZNUA 4OZ5A 4JI1F 3ENAA 3HZGA 4GO5X 2F9DA 3TA0A 3SV3A 3RB3A 3LA0A 2C3YA 5DDRC 3MEGB 4EMDA 3SSSA 4FNHA 3NNCA 1C4AA 1SVDA 3FQLA 2DH7A 1K73T 1YJWS 2EW9A 3MM9A 4U96A 2O67A 2WZ1A 3AA9A 3ET6B 3JSRA 3O6QA 2ABYA 2FJDB 4WXOA 5F8NA 3N4WA 2MQPA 2IM0A 4WF9Q 2JFKA 2MGZB 1YDLA 4ZCLA 1R6YA 2HFOA 3SV4A 4Y2CA 1XC9A 2W2OP 5AXLA 1IKWA 1NMEB 4HH0A 4NLSA 1I51B 2I9SA 3ELHA 5DDPC 5CD4A 4DPOA 3H40A 2PD1A 4ZPCA 3BBBA 1X9WA 1W2IA 1FDDA 2BDPA 2B51A 3BKTA 3I0SB 4DX8H 2LU1A 2GC8A 4NZ7A 3DRRA 2Q79A 1N33F 3I96A 1X60A 3MFIA 3MUMP 3BYPA 1UPPA 1Z2ZA 2HVDA 4K4WA 4YR2A 1LFPA 4OX6A 5F8GA 3MEGA 3M9NB 3G82B 3D5MA 1J2VA 5KAKA 1LFWA 3ISZA 2XTJP 5ETLA 2KN4A 2B43A 4NRTA 3T5HA 4MKAA 2P9GA 3TZYA 3ET6A 2BV3A 2F4VF 4F7VA 2MY8A 2UXDF 2XQCA 3AB4B 1NPPA 4DQIA 1D9DA 2MGZA 3UW1A 5L9XA 1W25A 1Q0NA 4LF1A 4TQSA 3MM6B 1XEZA 1JLEA 3R27A 3MAQA 2GVDB 4LF4F 5HL7Q 1SPBP 5KFLA 2Q6CA 3VF0B 3M6UA 1XERA 4OQJA 5EWFA 7FDRA 2ACMA 4K4UA 1OSDA 3ZZOA 5C24B 4ZP7A 2DIUA 1YJ7A 4LF6J 3Q8UA 5HO4A 3CO9A 2QLJB 3CVKA 2W4PA 1Q78A 3ENQA 4Y2KA 1GMWA 2MY7A 3DI6B 3RBDA 2YH0A 2IMOA 2ZJQQ 4ETXA 1E6VB 4O3RA 1YKWA 5L8RC 1GH8A 4EBDA 2W2MP 4C6AA 3T41A 3W8PA 4A48A 3G82A 2NS1B 1RAFB 5BYRA 4DL4A 2G0IA 2I6WA 2ALZA 1S6UA 2D3OR 1C4CA 3HKWA 3SI8A 2W9CB 2WRMA 2RRBA 2MZQA 1LK7A 3VQTA 1RWWB 4OIXA 2EFGA 4E8UA 1C1BB 3MM6A 2VOPA 2GVDA 3DM2B 1U6BA 4DV2J 2BVZA 2H4WB 4ZVUB 2LEPA 2P8IA 3VAJA 1UJ4A 4WFNQ 1OY6A 4PXDA 2BKOA 5DJBA 1N36F 4C7QA 3CDBA 2W9AA 5C24A 1WEXA 1M1GA 2WVEA 3W62A 2V4RA 2MLZA 3MEKA 1YRTA 2RQCA 2HYIB 5EHHA 4FVMA 1N88A 3CD7A 2GAGC 4F4YA 3HD2A 1XNQJ 3OR2B 3DI6A 1TFWA 3H0PA 1YZ7A 1TL5A 3LGHA 3H5XA 4LREA 4ECZA 1E6VA 5GVQA 1TVRB 3PTWA 4OMFG 5KFAA 3H59A 2QA2A 4U9RA 3D1HA 4C4WA 1RLCL 5LMNF 2BJEA 1Y0HA 3ZC4A 3J7ZT 4ZVOB 1SC6A 4OYZA 2AJ4A 3O44A 2RNEA 4UZCA 1P6TA 3K0JA 3E2EA 4CLKA 2UVWA 1DQ8A 1N5QA 1FXDA 2GX8A 1NKEA 2W9CA 3PR4A 4NXMJ 1RHRB 4QWBA 1U2CA 2SXLA 4KGVB 2XI3A 2LKZA 4DI6A 1FERA 3AOCA 2M4MA 3GWCA 4BCAA 1GXUA 2C28A 4NLDA 3W2VB 3P6YC 1C1BA 4DS4A 1KVIA 2ZDPA 3KWMA 4PG8A 1Q8IA 4NX9A 3DM2A 2APOA 3EE3A 4QPTA 2GJFA 1A7GE 1RT3B 2HZAA 2DNNA 2EBGA 1UFWA 2RF2B 4CT8A 2DXDA 3WQPA 3TAPA 3QIDA 1RU2A 1VQYA 2CQ1A 4DG1B 3HHLC 3ISND 4PUOB 2W01A 2GFFA 3CWJA 4CO4A 4JV5J 4CDIA 3R5CA 1JLQB 1JXVA 3OR2A 4OI0A 5K5MA 1ZOTA 4HHHA 3CJKB 4ZK7M 1TVRA 5HSPA 2ZUGA 3J81Y 4OZ0A 5LMUF 3D66A 4PG4A 3I5BA 4DL0C 4DR2J 1N56A 1SQFA 3RAQA 1Y5LB 1VQPS 2FLPA 3NP5A 2H5IB 5C7PA 4JBCA 1YX2A 4K5RA 1IJFB 5HQ8A 3QIPB 5KG2A 2CJQA 1U1LA 3SQOP 3R2DJ 3M2RB 4Q8EA 3W2VA 2OMLA 4C11B 4YUDA 5C25B 1K8AT 4ED5A 4IOCQ 4KHMA 2PE8A 4A8YA 4HL9A 2A6MA 4JI5F 1U8WA 1VHFA 5B09A 3QAEA 1RT4B 1RT3A 3UR0A 3KLFB 2VBZA 2V2KA 2RF2A 1Q5VA 2CJBA 4UY8T 2KM8C 2G13A 4DG1A 4URQU 2F5GA 2C42A 2AEFA 3KHRA 4PUOA 2DEIA 1REGX 1IBLJ 1FI4A 2JL9A 3T9NA 1JLQA 5D0RA 3KOAA 1RAOA 4MFBB 4DL3A 1B7YB 2C3PA 3SIPB 3CJKA 2EFPA 2XMVA 3WIUA 2JDJA 4AXJA 4GRSA 2H1YA 2GJ2A 2I5JB 3K5PA 1RCXB 3VGUA 2ADBA 3FBBA 4X4RA 2W7AA 4FYYB 2X1FA 2BM0A 2CXEA 1TP7A 3NOCA 2V8DA 1M5PC 4JV2A 3QIPA 4RLEA 1I94F 3IR7B 1DY3A 2YNGB 2HNZB 3T1YF 3CCSS 4ED3A 3QYYA 2VQEJ 4YEAA 2AD9A 2V4JB 3M2RA 1EKRA 3JQKA 5I42B 4ED0A 4C11A 4KIAA 5C25A 2V8GA 3D68A 2NCKL 3SFGA 2YBVA 2C2DA 2ZOGA 2ZWOA 3MR6A 4M95A 2BJ7A 4J9QA 2JVOA 3KLFA 3O5TB 2WVCA 4QWEA 3U02A 1Q95G 2B7CB 5D3GB 3MCNA 1MNEA 2ALYB 2MZTA 2LCWA 4R0EA 1VRQC 1N6QB 2M2BA 1XMOF 4JI8J 1LXJA 5FLXY 4MFBA 4YHHJ 3KK3B 3WDOA 1JLBB 5IT9U 1WG5A 2DXEA 5AJ3F 3CJ5A 4B3RF 4EI2A 4P75A 3OL7A 2RMLA 4USKA 1WEYA 2I5JA 3QT5A 4N56A 4ZHRA 1TU0B 3TX0A 4QPXA 1TTHB 4AQYF 4HTJA 2YNGA 2HNZA 3VQSA 2DO4A 4K4XA 2VFRA 3K8WA 2HRYA 2V4JA 3RW6A 3ZZRA 5LSLA 5I42A 3W66A 4ZP9A 1AFIA 3U1MA 1RUSA 2U2FA 5DZ6A 4J9RA 2K8GA 2AYBA 4NLXA 4AXIA 1ZAVA 1RT5B 4DV7J 1JX4A 2RQMA 4DR4J 3G8SA 1N48A 1UL3A 4BBYA 5A8WB 2B5JB 2OJ3A 2YWKA 5F8IA 2VQFF 3RW7A 2Y8YA 1HARA 1FE4A 5D3GA 3F56A 2KI2A 2DHXA 3ICLA 4ZLPA 3HI9A 3JSBA 1N6QA 5HMXA 1X9MA 2ZH8A 2O01C 2VPYB 5A2QU 3SDEB 3KK3A 4JYAJ 2RS2A 4RBTA 1AUSL 2V2VA 1JLBA 2VA3A 1FRJA 1OSCA 3Q0AA 2DGVA 2XLIA 2QO3A 1B0TA 3QGHA 4QZVB 4QW9A 3BH6B 2R7RA 1IBKF 3C3LA 2FY1A 5B0AA 1ROFA 3CUNA 1WOPA 2LXFA 1UVMA 3MUVP 3ILIA 3QSIA 5IZHA 1WWHA 4GO7X 3IS9B 1V3SA 2H5JB 3RZAA 2PFFB 1N5TA 3CW2C 4CQ1A 2XCPA 1BC6A 5A8KB 1PCAA 2GGPB 2G2YA 2GVZB 1FTRA 1L3UA 3ENVA 3T5KA 1S0NA 4K59A 1F2HA 1O0PA 1G6BA 2X51A 2ILZA 2W1BA 4U7CA 1RT5A 1N5VA 1YVFA 1V9OA 2GIRA 5A8WA 1S12A 2B5JA 4NE9C 4OYPA 2PA8D 3QGIA 4RU9A 2OIHA 2GS8A 1KLMB 2CNKB 3A8IA 2E5IA 2FGCA 2VB6A 1X9SA 3SDEA 2OD6A 3GMGA 1PJ5A 2CQ3A 1VRUB 1SQEA 2OO4A 4ECSA 2YKAA 1Q5YA 1VIOA 5CH7B 3HSJA 4KHPJ 4FBUA 4NL5A 3F73A 4FYDA 1NKBA 3BR9A 3RBZA 2KFNA 2QX0A 1HWJA 1WJ9A 2YX4A 5DS7A 3IS9A 5L1KA 2GQCA 3FBEA 1PG5B 3UNYA 4YR0A 3FQKA 1DHMA 4N41A 2VJVA 4PCQA 3GQCA 5A8KA 1S1TB 2GGPA 4M5NA 3LWLA 4FF2A 1KOOA 4OHZA 4DR1J 3KHLA 4LF8J 1M0SA 2CWKA 3BV8A 1VQ9S 4K4YA 2VICA 3GV7B 3GJRB 1LNQA 1WDTA 3BSOA 5E3PA 1NH7A 5AT1B 4LVOP 2DNLA 2UXCF 1RDRA 1HI8A 3PW2A 3I6PA 3BQ1A 1KLMA 1Y5IB 4B3OB 5JVGQ 3QT7A 3T1HJ 3UI3A 2HMIB 5CA5A 5L46A 2AJFE 3R5DA 3QZ8A 3D6HB 1RT2B 2C2OB 4OI4A 3GCXP 1XN9A 2UZAA 3M2VA 5J2MB 1TAQA 2ROPA 3G87A 1VRUA 1F5BA 1CS4B 4B9MA 5CABA 2XMUA 2EFOA 2ILYA 4GKKF 3SMZA 4FKYA 2XZTB 3I87A 1YGYA 5EX0A 3EGWB 2ZBRA 3DRXA 3UCUP 1RP5A 1GX5A 1OO0B 1G1XA 1UTAA 4V1Ak 4TKTA 3NNAA 1AT1B 1RE1B 3M6VA 2LQ9A 2E1AA 1YRUA 1T8EA 1S1TA 3VGSA 2XSFA 1NDKA 1X4BA 1SL1A 4B9UA 1M90T 7FD1A 3AXMA 2A2DA 4DEZA 3E8OA 3TZWA 4WP3A 4CP5A 5F3TA 3OTOF 2YKPA 1SJ1A 2G0CA 4QIEA 4EUVA 1N34J 3BR8A 2E66A 2GZOA 3KJVB 1T9XA 3SCJE 5IT9Y 2OI2A 2DGTA 1HKAA 4L73A 2XWYA 1NJYA 4B3OA 2KT2A 1PJ7A 2HMIA 4OHYA 4EO6A 2NYIA 2VDIA 1RT2A 5J2MA 2X1AA 2PSZA 3I4PA 1JKHB 3D4JA 4YP3A 1PYTA 1CS4A 1HD0A 3CD6S 2E5HA 3HSZA 3TNVA 4DN0A 3MMCB 3BYRA 2JC1A 3OW2R 3MM7B 3P3DA 2FVPA 1G2EA 4O0NA 2GHPA 3UVJB 2JLEA 1XJWB 4WFYA 4MH8A 3N9UC 2Z2LA 2NZ4A 3TANA 1NCLA 2Z2MA 1XIQA 1T7PA 4C8OA 2QMXA 1VQNS 1FJCA 4C8KA 3BSCA 4DUZF 3UDEA 5H9FK 4OYWA 1VQMS 2XY5A 2YH1A 3EDRB 3IBFB 3PX0A 2GMHA 2LEAA 3I9V9 1JIHA 1HWLA 3M2UB 2KYZA 3MOJB 1LWCB 2DNHA 3T9ZA 1X4GA 3KJVA 4PWWA 3V6JA 2O66A 1ITPA 2IDLA 4LF9J 2P6SA 4W98A 3TAMB 2DNQA 5CHCB 1YJVA 3NNHA 5LJ5Y 2CKWA 1JKHA 2OSRA 4DPUA 4XO0A 3BGOP 2C1EB 1HW9A 2QZ8A 2LP4A 3MMCA 4J7CA 3MM7A 2UUCJ 4EEYA 1TUWA 3UVJA 4P10A 5HVHA 5KFVA 1OYDA 2FZKB 1K0VA 3OL8A 4LT6A 4IH7A 3CCRS 4M94A 1HBUB 1SJQA 5F41A 4TN2A 1PAUB 2CZ9A 2R8HA 2OLWA 3N28A 1X4FA 1Y3KA 5D0HA 1CQNA 3TUJC 1X5SA 3BSNA 2BOPA 2WSEC 1EETB 1JNRB 2VFTA 2NSCA 3CCES 2ZC4A 1QAXA 2F3JA 4DFKA 3LPYA 5DETA 2IRUA 5LSRA 4ECQA 4DFJA 1RT1B 4DUYF 3X1LB 3M2UA 1LWCA 4FS2A 2E7WA 3B78A 2DCUB 3H5UA 1VLOA 4ZMMA 2J8SA 1RAHB 4X4TA 2M5YA 3PDNA 3Q8VA 3ZZZA 3TAMA 4LF6F 3OJSA 2XI2A 5DM7Q 2JEIA 2V8HA 3MD3A 2HGMA 3TAQA 4DL7A 2DITA 1TQLA 1L3KA 3G6ES 4KYZA 2LQ5A 4K2JA 3N5FA 1X8DA 2ASJA 2CUYA 4X2BA 4G1PA 4DQQA 2D74B 3GILA 2AGOA 4ZS6A 2HLUA 2CPDA 3TO8A 3W9JA 1HNZJ 1HBUA 4RL1A 3BGFA 4PPZA 3HFVA 3C8YA 4PG5A 4WIIA 2VG7B 4ZCIA 1VBXA 3MM8B 4OX9J 1EETA 4A8WA 4ILLA 4JI4J 2V5HG 1NB7A 3M8SA 2E7VA 3BPSP 4H4KC 3RAMA 1RT1A 3IC1A 4NZ0A 4DSKA 4W92B 1PO6A 1KTQA 3MDFA 4I69A 4NASA 4CLUA 4FYWB 1M5SA 2HNDB 1HWUA 4Q7AA 4TY8B 2B4UA 3ETOA 3MHYA 2B56A 2DHSA 1IJEB 3CSKA 3W65A 3QRQA 2WBMA 3QRRA 4NLWA 4DBQA 1Q53A 4B9SA 2QA4G 4Y2AA 3PRVA 1XNQF 1WG4A 2LECA 3NKYA 1RT6B 2DD8S 4ENOA 3QFWA 2QGFB 5B0FA 2FPHX 2H51B 5D77A 1H98A 4KFBB 2OFHX 1E6YA 5FD1A 2IVMA 1RB0A 2MEWA 1S79A 4DDFA 3OTBA 1CSJA 1NJWA 1MG7A 1TK8A 2ZBCA 3FBCA 1KVKA 4OI1A 5C42B 3MM8A 4N47A 4KC5A 2K7JA 4IFVB 3BZQA 5HMZA 2IY5B 1H73A 1UZHA 4UQTA 3Q83A 5CAAA 2BMBA 3D67A 1WC0A 2HZVA 3KLIB 2H65B 1XR6A 4Y34A 3G8TA 4X62J 1FT8A 1NB2A 1WOOA 1EP4B 4NLPA 4ZVSB 3C14B 2UU9J 1FFWB 2HGLA 2ZBIA 4X64J 2IYIA 4KKOB 3P8BB 2NXNA 1NUEA 3PZPA 5DDQC 3V6DB 2M0GB 3AXKA 5EGYA 5DG7A 2FGOA 1BY9A 2Y8WA 3CDEA 3OFFA 1JLFB 1Y9OA 4AE5A 1NJXA 4C8LA 3BREA 1MMNA 1RT6A 3MCOA 2RUSA 1T05B 5F8HA 1FXRA 2MJUA 4KFBA 2HQCA 4UZBA 4Y2MA 2MMYA 3G86A 2ACYA 4DR2F 3WX8A 4L74A 1L3SA 4QIGA 5L38A 2Z2YB 5C42A 4FNIA 1UVJA 4RUCA 4IFVA 2N4DA 2OPRB 4OV6A 1VRTA 2MZSA 2K06A 4J5OA 4ZJLA 3PW0A 1XBWA 4ETZA 1T3NA 3PXGa 3G9CA 2D3ZA 1PAEX 1EP4A 2V4QA 3C14A 2MQNA 2RB7A 1U02A 4C0OC 3FMBA 3TZZA 4V19J 4ANDA 4YDDB 3CGIA 5IFMA 2F1FA 2V9KA 1YK9A 4HH1A 5KG0A 4QQBA 3V6DA 3CEDA 4OHWA 3NGDA 2UXBF 3PNIA 4DSEA 2ATCB 3DOMB 1JLFA 4EBCA 4AUKA 4ZP6A 2HQIA 3Q22A 1VQOS 1TKTB 3GYGA 2XS7A 1LKZA 3H98A 3NGKA 3TQ1A 1RBLA 3UN5A 4ZA1A 5D4NA 5U47A 2C22A 1NXIA 1HHQA 3OVBA 3MPYA 3KMSA 2R7TA 1RKIA 4QOTA 4DPTA 4NYZA 1EAYC 1KLNA 3EX7B 1GX6A 4WK3A 1N0VC 3OLAA 1IQZA 2OPRA 2LQBA 1QSSA 1XR5A 2HQGA 2VQEF 4DSFA 4TLQA 4CWBA 1RSCA 2BE2B 2XCAA 1S97A 3MD1A 4P74A 1HQEB 2V6AA 4JUZA 2FC9A 1H3DA 3AA8A 1WKJA 2QTWA 6FDRA 2CVIA 1J5EF 4FZVA 4N5SA 3H5SA 3V6KA 3A12A 2XEXA 2V63A 4M5JA 1SKSA 3CCLS 3B4DA 1NJIT 2C2KB 5LT5A 4O3NA 4FVCA 4DV1F 4I56A 2E1RA 3TWZA 2HW3A 1NSPA 5JMNA 3OVSA 3DOMA 3SZ2A 2FC8A 5KFIA 4J9KA 4K8RA 2ZJRQ 5ITHA 4WFAQ 2ZNYA 1TKTA 4M5HA 3CJQA 1X0PA 1IBCB 1HI1A 2YTCA 3L95X 2DY1A 2MHNA 4OHXA 3SYZA 5KFWA 4YHHF 2MKSA 1BWEA 1PC4A 3VGTA 1IBMJ 4ZVRB 1N5YB 2MQ8A 1S1VB 3QBCA 4YDXA 3PY8A 4MKYA 4QR0A 1NK8A 5D15A 2OPPB 4WE1B 3BS9A 1S10A 2CQ0A 3SFUA 3GFZA 4KGKA 3TOQA 2AQ4A 1F6TA 1CG2A 2J0QD 4LR8A 2VONA 2MHEA 1HIYA 3R5AA 2QYCA 2GAHC 2E29A 1FD2A 1CVJA 2BE2A 1HQEA 3OR1B 2FYXA 2PT0A 3OSPA 2ZHBA 2OH2A 5B0BA 1DBDA 4HR2A 2CQ4A 4DR4F 2V50A 4TQRA 3PO4A 2YWEA 3MEEB 3CDWA 3MWBA 1KD1T 5MAOA 1BWVA 5E33A 3DLJA 2A6OA 2MQLA 5KG7A 1U1PA 5KG1A 2R8JA 2EBEA 3KNAA 1AA1B 3HT0A 4P7TA 3AODA 3H90A 3BO3A 1IR0A 2B6AB 4RR5A 1VS3A 2AX0A 5KFEA 4JYAF 2I1RA 5G0RB 2MXYA 4J9OA 1K47A 1N5YA 4F02A 1Z4UA 3ITHB 4OZJA 1S1VA 1RTHB 1C0UB 2OP5A 2PA3A 5CD4H 1WC4A 1T9YA 5ETMA 2WW8A 2G4BA 2YWWA 5FIIA 2M8DB 2OPPA 4WE1A 4JP8A 1VQ4S 2B3TB 3SXLA 4W4MA 2MZ1A 4KBIA 3JYTB 2OMOA 2QYGA 4KH1B 1VHIA 3B82A 3BF4A 1T9TA 2UVUA 1TZ0A 4GKJJ 4LBHA 3RAXA 4O4GA 2Y1IA 3CE8A 3OR1A 2ZH7A 3IR6B 1UJ5A 3KUHA 4JV1A 2IM3A 4YY3J 5ETQA 4OJ1A 2KJWA 2RU3A 1B0VA 2H5EA 2J6TA 5KFSA 1B0PA 2BJDA 1WTBA 2VASA 1IQTA 2VA2A 2HZCA 3ENWA 2XGPA 3H5YA 3LALA 3MEEA 1FF2A 3DLBA 4OYXA 4RWWA 4C9DA 3OL9A 4GC7A 5HVFA 3NS5A 2BE7D 3GR0A 5KTQA 2AWZA 2DO0A 2PN6A 4J9PA 2B6AA 4J9VA 2DR7A 2KZZA 2AJQA 2EFVA 4M63A 3IAS9 5G0RA 4CRJA 3ONQA 1ZPVA 3ITHA 4DU7A 1RTHA 1C0UA 4WPAA 3NG8A 3IMQJ 1XMQJ 2DH8A 3P96A 2DXFA 4CM0A 3PACA 2AJ2A 4OYBA 2J0SD 1F1BB 3MI7X 2XMMA 4EZ6A 2AT1B 5A76A 3FCWA 1PBUA 3JYTA 2N7CA 3QNWB 4PQUB 1VC0A 3ZFVA 3C2PA 2GHWA 1Y5NB 4NLOA 2CYYA 4QJVA 2E9RX 1HBOB 1J5OB 1Y3JA 3HVWA 4RW9B 3KG4A 3QGPA 2DGSA 4YB5A 2ZFHA 2V68A 4BWMA 3OLBA 1K9MT 4DR1F 1WOSA 4LF8F 4ID8A 1Q7LB 2K2PA 5CQGA 1EQMA 9ATCB 3QAUA 1HWKA 4NEZA 4LFCJ 2HHUA 5J1EB 1QSYA 2PC6A 4C0HA 3UDLA 1YIJS 3ULHA 1HL6A 2YVSA 2Y0BB 2FHJA 4RNMA 3P5TL 3UN2A 3TW0A 1JJ4A 1FJGJ 2ZH1A 3T1HF 1ZETA 3P4UB 3ZZ0A 2DVIA 1WI8A 1T0TV 2NXJA 1HHSA 2YQ3A 3OL6A 2EEYA 5D4OA 4ZLJA 4IFYB 1WHVA 5JVHQ 1KP6A 2R8KA 5AE1A 4OL8A 4B9TA 4P52A 4RNOA 4AFFA 2H3EB 4DV3F 3MZIA 4LF5F 3B6BA 2YWGA 1H2UX 5HATA 1FEEA 2WHOA 2IHR1 4Z7CA 4PQUA 1QD1A 2RDDA 1RWVB 1NDLA 2WBRA 3A3OB 4K2XA 1HBOA 1J5OA 4RW9A 4B17A 1V3RA 3ZZUA 2GA7A 5JJBA 2LEBA 3BGLA 1SC4B 2VIHA 3FMWA 4CO0A 2XYHB 5HLFB 3EMTA 4WK1A 1F5AA 3DMJB 2V67A 3W7BA 5KFGA 2HEKA 3V2UC 3FJ2A 4IOBA 5J1EA 4FYXB 3IWLA 2HIYA 5THWA 3Q2SC 5KFRA 2OEJA 4F3QA 4C3LA 2ZZNA 3AH6A 4KRWA 1O51A 1NZAA 1NNDA 4OZ3A 4XDDA 2JRSA 4FPRA 2C3OA 3LF0A 4X4SA 3BB5A 2ASYA 2RAQA 4IG0B 4IFYA 3VTIA 5J2QB 3AT1B 2BANB 2D3UA 4F0MA 1WKLA 3DLEB 3P5BP 4U7UK 3KJQB 2H48B 2FZGB 1ZA2B 2CPYA 1FVQA 4DU8A 2D41A 4I68A 4JI2J 3OD2A 2IA0A 2KVIA 4F8RA 2HBZB 4PXCA 1EKSA 3HLUA 3EZOA 3ZTRA 1NPRA 2ADCA 3Q24A 3J7AN 3TR5A 3T3FA 2VFSA 1UP1A 4DWIA 3GIKA 2LFVA 4HLBA 4OLOA 5CXTA 1QY7A 3NEKA 3DRPB 5HLFA 4CO5A 4NXNJ 4DPWA 5F0WA 3DMJA 2A10A 3GIRA 4UW2A 1RWOB 2B9EA 2FHOB 2VF3A 3HMJG 1NK5A 3NCPA 2MZRA 1FK9B 4LF9F 3SEOA 1SKWA 3TA2A 2IA6A 2CPJA 2ROEA 1MSWD 5BR8J 1R0AA 2Z2ZA 4RKUC 2CJXB 2RQKA 4B9LA 2Z56B 4IG0A 5J2QA 4HT7A 4Y28C 4C3KA 3DLEA 5CYQB 4Z7YA 2JJ4D 2DNRA 5KFQA 1R8PA 5LXYA 4CH1A 2I2YA 3KJNB 3PM9A 2UUCF 1FCAA 4ECRA 5E3QA 2J9CA 4RU2A 4DOZA 4DUTA 4DR3F 1WSVA 4W90B 1NO8A 4UOCA 4QW8A 2RILA 4EYHB 3CC2S 1WUUA 3BKFA 2G1DA 1YG0A 2D9PA 3LP0B 1YWXA 5KG4A 1NSKL 2AW0A 3CCTA 1FA0A 3DRPA 3R7BB 4CLLA 4PZVA 4H4MB 2K3KA 1LQ9A 2M3DA 2E5GA 5J1NA 1RLDA 3LTOA 3RR7A 2JSXA 4QYRA 2BM1A 2KXFA 4PPDA 4J90A 3PW4A 2VBXA 2BQRA 1ZTTA 3G2XA 2Y3YA 1FK9A 2IYGA 3I32A 3OFEA 3TUIC 1NSAA 2MLXA 4HDGA 2CRLA 1UPMB 3UDCA 4OJGA 4NI2B 1P27B 1ICEB 1A0OB 2CVEA 4QR2A 3BDPA 1IKYB 4ZVGA 3WBZA 5CYQA 3C46A 4DPYA 2OGUA 1IWAA 4WFZA 3SQGB 2DGUA 1S99A 3W3SA 3HZEA 2BJ1A 4KTQA 2VU5A 5A8RB 1HNZF 1HI0P 1FKAF 3IXQA 2BABA 1XTZA 3HD1A 2ZDOA 1JMTA 2ZKUA 1UW4A 4YFUA 3LP0A 2Y9HA 4OX9F 1S48A 3L7PA 1SKUB 2Z8QA 2BEFA 4C97A 1KFDA 3W5XA 4H4MA 4JI4F 2JLFA 1YTYA 2GO8A 2CQCA 1RHUB 2VV5A 4UTGA 4LSNB 4IH5A 4WU3A 2EPIA 3UD5A 2QL5B 1Q81T 3DLLQ 2L9WA 1X7VA 2HKEA 2HHXA 4K4TA 1X4CA 3EXYA 1S0MA 5IV3A 4J37A 4NI2A 3V4MA 3GR1A 4USHA 1SJRA 1ULRA 2B4VA 1YQHA 3LANA 5KFJA 1IKYA 3A4TA 4RPFA 4ED6A 3BN7A 1SJ3P 3SQGA 1S9EB 1BHNA 5A8RA 1VBYA 1RTZA 2GIQA 2VG6B 3EZUA 3J81U 2IPOB 3VZIA 1R8HA 4QWAA 4C2MA 2VBWA 4D3HA 1EARA 2RDJA 4ELVA 2NSBA 3OUYB 2JX2A 2FJVA 1UETA 1RYSA 1URNA 2AJ0A 3R97A 4USJC 3A1YG 4X62F 2ERRA 5DDOC 4RW6B 4CIOA 2I38A 3PYEA 3T5JA 1JLAB 1F0XA 3HVAA 4ZPDA 4IRCA 5KFHA 4IO9Q 4X64F 3Q89A 3GSDA 4YB6A 1JXEA 1KBRA 3M8QB 2P9CA 1U09A 1H38A 5D4PA 3H4DA 4AL5A 2MJNA 4FKXA 1NEEA 2MKKA 4OZ2A 2DR6A 5E0OA 1SJ4P 1YJRA 3R6LB 4NZ6A 3EYZA 4FF4A 5AE2A 2KTQA 1XNRJ 1N32F 1UW9A 1UWAA 3LOUA 4KQZA 2XO6A 4U67Q 2LDYA 1ACMB 5HN0A 4DSJA 2VOOA 1S1WB 1JK9B 4LIRA 4KGMA 1S9EA 1VBKA 2R3VA 5GAEI 2CPZA 4ZLNA 2VG6A 4NOHA 1QAIA 1M5KC 3K57A 2CJ9A 4DCPB 3MF5A 2E1PA 2YKNB 1HNWF 2R2RA 4ZP8A 5GAEU 2IIHA 3CIMA 2LA4A 3OUYA 1R27B 3GSIA 4DSLA 1NM2A 1DRZA 1N36J 1BQNB 3S6EA 2HAIA 4RW6A 4DV0J 1QDUB 3G71S 3OSNA 1JLAA 1OY8A 1QVGR 3K58A 4I2QB 2E44A 1Q8BA 3J7A1 1RJJA 2FVQA 2OD4A 3I0SA 4H4OB 3M9OB 3M8QA 4V19X 2W7OA 2BW7A 5KFMA 1YZ6A 1LW0B 2VJUA 2J5AA 2O3DA 3E51A 3DRSB 2OELA 1G3OA 1N5SA 4RJVA 1DQ9A 3IM9A 3MURP 1Q8KA 2BJ9A 5ETOA 5LMNJ 3FC9A 4CLWA 3L7OA 3GZ7A 5A0YB 3K5MA 5FLXU 4X66F 1RHJB 4DZDA 4PQAA 1S1WA 3KYLA 3HP6A 1QLNA 1FNXH 4DF4A 4DMZA 2LMIA 1WORA 4DHVA 1TL7B 3U7JA 1EB0A 5HK4A 4KR0B 1X4HA 2YKNA 3PX6A 1U47A 3SSQA 3LQVA 1U1NA 3CJTA 5J1PA 2ZJPQ 1RWKB 4QBUA 1VFJA 2VH7A 2W4CA 1BQNA 4ZJOA 3GFXA 3MFHA 1JJ2R 4ELUA 4BDPA 5T7LB 3QJPA 2C2EA 5KFTA 5HMYA 3M8RA 2PI4A 4WTOB 1QE1B 1FFGB 4LFBJ 3L09A 4I2QA 1ZM9A 2QRRA 1NDPA 1YITS 2AZ1A 4A8OA 2VFVA 4H4OA 5KT4A 4I6YA 2VPXB 1RTIB 3CJ8A 3HKZD 1Q16B 5AXNA 1LW0A 2RQ4A 2EFNA 3DRSA 4ES2A 5LMUJ 4R8UB 1UWBB 5LJ3Y 2JLGA 1OY9A 4DS5A 4FXWA 2XY7A 4MIAA 4RW7B 2ZHAA 1RBAA 2BJ3A 4QIVA 3UQSA 1UKUA 2JHEA 2N3LA 3PEHA 3HHLD 4YN3B 1IBMF 2KG1A 3V81B 2DHGA 4ED2A 2CPFA 3HX9A 1K0TA 3TVZA 1X5TA 4O3QA 1TL7A 2QIFA 2A18A 3DGPB 3OFHA 2KXNB 2KH9A 3KLEB 4BC7A 4CT9A 4C8YA 5ETKA 3IRWP 1WHXA 3OBIA 3FBFA 1S7IA 4JI5J 1Y4ZB 4PAAA 1CPZA 4F3OA 3PYGA 5T7LA 4KJIA 2BX6A 2GNKA 3M32B 2HWTA 1QE1A 4ER8A 1RZMA 4JI7J 2HHPA 4ZIVA 1FX2A 2OAUA 2WCXA 1FRHA 1B4SA 4FXDA 1UFKA 3JQJA 3OHBA 2HVHA 1RTIA 3D6MB 2WVBA 2RUGA 3HFZB 2MSTA 1NZ8A 7AT1B 3CCUS 4IO1A 2YQ0A 4R8UA 3AOBA 1UWBA 2V0NA 3UR3C 2HWIA 4P2XA 4RW7A 4WU2A 4RW4B 3TJ8A 3EPGA 2OTJS 1KR4A 2AJ1A 4ZDNA 2KXHA 5KT6A 3V81A 2PGCA 3BN4A 4RUHA 5F3ZA 3T1YJ 1RAGB 4LF7J 3QPIA 3D1OA 4OI6A 2VD3A 3DGPA 4TU8A 1RADB 2WW4A 3KLEA 4B08A 4ZKAA 3BO4A 4P2FA 2GJIA 1M1HA 4DFMA 1VQ8S 1Q82T 3Q8RB 2BRLA 1S76D 2CDRB 4WYLA 2DNKA 1EQ0A 3CIZA 5ETRA 3AOAA 4WWSA 3KHGA 3CMES 4EWTA 5AXKA 3UDVA 3M32A 1DTTB 5KFOA 5D8HB 1FJ7A 1D3WA 3HCXA 3BQ0A 4IRDA 2XM3A 5A6PA 3PW7A 3M6XA 1XMOJ 1U1KA 5DGBA 3CCVS 1TK5A 4Q2LA 1RWXB 2HS4A 4KGZB 2HBYB 4NRUA 3QRPA 1AZSB 2CFXA 1Q4RA 2FTRA 5AJ3J 4B3RJ 3TI0A 4X4NA 1SIWB 3S7RA 2DNZA 5D0GA 4P71A 4Q45A 1HNXF 1TL4A 1T9VA 3NLCA 4OZNA 4EBEA 4QYZJ 2BUNA 1VQKS 4ZPAA 1XMQF 1TMJA 2BE9B 2J0WA 3GG0A 2LXIA 5DM6Q 5T14A 4K4SA 2FJBB 4ID5B 5I3PA 2AEMA 5LL6d 4U8YA 4IQMA 4C48A 4NCAA 1HD1A 4DXLA 1RAEB 2CZ4A 4MK7A 2MQMA 1AROP 1H7XA 1U6ZA 4B9VA 3HFKA 2YNIB 3DU5A 4TY9A 5IC4B 1RT4A 3PRBA 2VQFJ 1DTTA 2XNQA 1PSDA 1RK8A 2N82B 1YI2S 4DFPA 3CDAA 3BDEA 2C3MA 1RHQB 1V5VA 2K7KA 2AIRB 4A47A 2XULA 2GCFA 4LFCF 2NYHA 3C19A 1CC7A 2QEXS 3JTOA 1FRMA 4ECYA 2BR0A 1NK6A 3BEGB 1AZSA 1L3VA 3HF5A 3OTCA 5L9NA 5KOWA 1H74A 4D3GA 5C2GA 4DR5F 3NOGA 2LDIA 1RU1A 3R1HA 3GIIA 2QA1A 1FKOB 1D0EA 2YNFB 3RRKA 2MTLA 3M30B 2MQOA 4ALZA 4F04B 2NXCA 1FX4A 2UV8A 5GMDA 4IDKB 2CAJA 3R5GA 3N5BA 1KNZA 1JJCB 2KRRA 4O44B 1QUVA 1HLWA 3EDQB 3GB0A 3MXHP 3UPFA 3M8ZA 4AL6A 2VDHA 4ID5A 3S1TA 6FD1A 2YWHA 4CLPA 2XWXA 4ILMA 1JXLA 2R8GA 3Q8SB 3OXLA 1P8GA 1UVLA 4CI0B 3W63A 3PJ9A 1P9YA 3SSRA 2CNOB 2OEKA 1UVIA 2YNIA 1FNOA 2QC3A 2LQJA 2DT9A 1PYOB 5KT2A 4CO2A 1O6XA 1S59A 1ZPWX 2BOAA 4LSZB 4PKDB 4J9UE 2R7XA 3IGNA 2D3O1 2PI5A 2L9NA 3EGNA 2KB2A 2B8PA 2KYXA 5C5JA 2HWHA 1U2FA 1T02A 1KEKA 2QFIA 4M5DB 1ELOA 2ZD1B 2UVRA 5KFDA 3CCJS 2AHOB 2P9EA 5F8MA 2FIUA 2ZZMA 3CB4A 2FHJD 1RT7B 1FKOA 5IOLA 2YNFA 1T95A 1YJNS 3M30A 2IJRA 1T94A 2D1CA 1KOHA 3QT6A 1R8CA 4N76A 2XMJA 2JNJA 1OWXA 1TL3B 4IDKA 3Q86A 3BPDA 1REVB 3OHAA 2CJAA 1YJ9S 1YRXA 3D0GE 4IKAA 4O44A 3UCZP 4Z37A 1H6KX 3AY0A 4USWA 3CMAS 4HHUA 2GQ2A 1D9AA 1WF0A 3PJWA 4LF2A 1VK3A 2M8HA 3US5A 3FUYA 2A2CA 2OPQB 1RBOB 5HJXA 1GTEA 1EZZB 4TNOA 2CWXA 5F0UA 4C8ZA 1MWZA 2HK3A 4GC6A 2HURA 4NXNF 4N77A 3DLHA 2HQFA 4L3KA 1JB0C 4E0DA 2ZITA 1ZZFA 2J9DE 1OIAA 4Y6IA 2ZOFA 3EVWA 1U1OA 3GYNA 5K8OA 3BJYA 2H4YB 2XS2A 3NCRA 1WC1A 4WJBA 4M5DA 1VMBA 2ZD1A 2CADA 5DQHA 1BGXT 4WP9A 3O3LA 3UNGC 2WB4A 1PYSB 3NMRA 3D6TB 1RT7A 3AD7C 2BA9A 2P2CB 5BR8F 3CJ4A 3MPVA 3FKBA 1WG1A 3KFWX 2UV8G 4ZVHA 2HNYB 3JS9A 3TYTA 1TL3A 4DL2A 2LYVA 4NLQA 3CCZA 1REVA 5E7OB 3EICA 2LA6A 1PBAA 4L3NA 2ASLA 4CNYA 1ZS6A 5F9LA 1TAUA 2PDAA 3ILOA 1S4FA 4U7UD 2QL9B 1PILA 2ZH4A 4I6WA 1SL2A 3CCQS 2J7UA 2DR8A 1Q79A 2GVZA 4A8FA 1VQ6S 3UFCX 3SCKE 2YY3A 5HBMB 4C98A 2CQDA 3FEYB 2AX1A 3MR3A 3OTOJ 3J81j 1SKRA 3CCWA 4DLGA 3UWTA 3SCIE 1FRLA 2OPQA 2E5LJ 2UP1A 3Q2TC 1TFYA 1U48A 4FDFA 4WFXA 1WELA 3G4SS 1CJUB 1QTNB 5CYMB 4N8NA 3QGGA 1KHWA 4LRAA 4B3TJ 1WD6A 4USTA 2AKWB 3D6FB 5K14B 2LU2A 3I56S 4MYTA 4B9NA 1N54B 3DHWC 2AF6A 1VQLS 2M70A 2HBQB 4Q43A 1FRIA 4KGXB 1B70B 5FDLB 1UFLA 2DNPA 2ZE2B 4ZN1A 3GTYX 3U1NA 2W7PA 4NLYA 4L76A 3J80U 1LWEB 2BXJA 4JI0J 1VC5A 4LR9A 4Y3CA 2ZH6A 2HNYA 4FBTA 3OV7A 3H42A 3LP2B 2YKQA 3HM9A 3W60A 1SJFA 3VHQA 5DRKA 1S4EA 3QJJA 4DV4J 3RG6A 1WNEA 1P1LA 2EC0A 3FZ2A 3M8WA 4ZCKA 3CJRA 4DUZJ 4OHVA 2VL1A 2DGOA 4ILRA 2AYGA 1V5IB 2DRDA 3DLGB 1HR0F 1X0FA 1B64A 2PO4A 4DLEA 3K5OA 2UUAJ 1NJZA 5HBMA 2QJ3A 2GMJA 4IOAQ 4QCLA 1SBRA 3IP0A 1PGZA 1NH8A 2QT7A 1JLEB 1YHQS 3LP1B 3LAKA 1NK7A 4HT5A 3FRZA 3CD5A 3X3UA 2IFXA 3NRBA 2PMWA 1CJUA 1UEVA 5CYMA 3IWNC 3DDIA 1VOMA 2XGQA 2FUG9 1K1QA 3CDUA 5K14A 2YX7A 5J2NB 4WZMA 1ZAWA 1FKPB 4LUBA 2EWHA 4WKRA 4QIFA 3PFOA 3HSDA 8ATCB 4DX5A 2JEGA 5FDLA 4AYBD 1MW7A 2ZE2A 3F44A 3PYFA 1UEUA 3GV8B 1RAJA 4BLGA 2IDEA 3NL0A 1LWEA 1X4EA 4DV5J 2WOMB 3OT9A 1RTJB 3BBFA 4TYAA 3VAIA 3LP2A 4F67A 1RAAB 4CH0S 1QAYA 2B7BB 2WK4A 2CIMA 5HJYA 1DAXA 1OPIA 5BYQA 2CZVC 1I5OB 1M1KT 1B3TA 1F3FA 1TR0A 3DLGA 3KDNA 4TLRA 1RWNB 3W1YC 4F25A 2W9BB 5GMKa 1I6JA 4DUYJ 4LBPA 3DGVA 3LP1A 3R5JB 3OXFA 4ECWA 3DXBA 3ZNJ1 3H2LA 3H20A 1I1GA 3ZTPA 2AV5A 2XLJA 2CNLB 1O5JA 1MN7A 4BWJA 1M5VC 2CPEA 3NXZA 4P2MA 2FJXA 1XR7A 5J2NA 1GXTA 3VCDA 1H0HB 2XG8A 1FKPA 3MCMA 4DCOB 3TEHB 5DQGA 3D0HE 2R7OA 1QM9A 3GV5B 2JFDA 4DQRA 1GNKA 3V6HA 5E3RA 1MU2B 3HHEA 3MM5B 3DRYA 1Y7PA 1YBTA 2HRUA 3ADAC 3IO1A 1BE4A 5SUHA 1YJTA 4CLFA 2ZHOA 1K1SA 2ZEJA 3WHIA 1EHWA 1OJ4A 1UMJA 4XIUA 2W8LA 2WOMA 1SH3A 2Q43A 2DTJA 1RTJA 3SCLE 2MZJA 3N6MA 1XNRF 5LM7E 2OUGA 2YX1A 2IBKA 2NREA 1WF2A 4MK8A 8AT1B 2Y1RI 4K7QA 2DEJA 3FCVA 3TA1A 2QN6B 3CT9A 4A8MP 4Q0BB 1CLFA 1JLGB 2EK1A 3PFEA 2XNRA 3I31A 4CNZA 3PG9A 3HJVA 3G6VA 3VGVA 4ES3A 1XWLA 2W9BA 3TP2A 4C8NA 4B3MJ 2HHSA 4CH7A 2J9EA 1HYSB 2KDOA 3KTQA 2MQQA 4YS2A 4OJHA 3LO3A 3VALA 3M9MB 2DKOB 3D28A 3W5YA 2KRBA 1TKXB 4NA3A 5IXUA 1EIYB 4DV0F 2KHCA 5DG8A 4ECTA 1RWUA 4U8VA 4EFAC 1ZM4A 3CO0P 3WX4A 3KXDA 4LRBA 1NHUA 1M5OC 3FFIB 1MU2A 2R2TA 4M5IA 2L9DA 3MM5A 4BC9A 3DDKA 1KC8T 4NMXA 2ZVSA 4LBIA 1F3VA 4X65J 1RXOB 3NWGA 5LSOA 3O8WA 2IJNA 2F40A 1D8ZA 4AT1B 4YOEA 3D0IE 4XDCA 2NUHA 3DU6A 1FVSA 1KQGB 4KSEB 3OJUA 1OS5A 4Q0BA 1JLGA 2J6UA 4NMLA 1CJKB 1HFEL 1U8SA 4QWCA 4NLVA 1VDHA 1U1MA 4LFAJ 2DRBA 1CBKA 4QU6A 3GJTB 2CQGA 3RU0A 4F36A 3W5ZA 3HHDA 1LWXA 2ZBPA 1BQXA 3ZXWA 1HYSA 4I67A 4LJMA 1H72C 2QMWA 4DV2F 3PCOB 2NXEA 4DN9A 2HS3A 1DFDA 1TKXA 4Q44A 5L39A 2Z30B 5B0GA 3VAFA 1GQEA 5E5NA 3J80Y 2B9YA 3FSIA 4O3SA 4LFBF 5LOQA 4G1QB 2HVEA 2DK2A 3VAHA 3BQ2A 3RGIA 2AEJA 2OFGX 2UUWA 1IM4A 4IYQA 3RB0A 3FFIA 2ZM6J 1LXNA 3L9ZA 1YBUA 3CD0A 2J0XA 4N8OA 3I0RB 4A8SA 4ZVEA 2CJKA 5K20B 2EKNA 2CQIA 2KFYA 3TJAA 3QATA 4IR9A 3K17A 2VHGA 2IMWP 1KTVA 3FVYA 1FWPA 4ICLB 3GJQB 5M2UA 3NBPB 2VG7A 5KFFA 3RB6A 4A8QA 4JOUA 2XC9A 4Y65A 4CLSA 3FEXB 3M8YA 1B99A 3AAWB 3MR2A 3GU0A 1CJKA 2BACA 4NXMF 3BGRB 4OZLA 3D3CJ 2R7WA 1RISA 3ISNC 1RGVA 2CPHA 2NQPA 3OTEA 4UUXA 1WF1A 4DV6J 3N79A 1FEHA 1VQSA 4RUBA 1AW0A 2QFJA 2HNDA 3KDOA 1LWFB 3MR5A 4TY8A 3JXOA 2UXBJ 2EKYA 2IVFB 4DL5A 4G1QA 4JI7F 3C66A 3V4IB 3W9IA 1OPZA 2DY9A 2JZ5A 5EN1A 3HHLB 2YQ1A 3I0RA 4JV5F 3O2IA 4K4ZA 2QG9B 1HMVB 3VZHA 1JQGA 1TUVA 3D54A 5B0CA 3NGTA 2HFUA 1S7HA 4UOFA 1NAQA 2CQ2A 4K0KJ 1WC5A 4C8MA 1NHKL 2XYGB 2N4CA 3EGVA 1U0SA 1FFSB 4ICLA 3MMJA 4ZHRB 1VGYA 3NBPA 4NA2A 1RI7A 5K8MA 2D9OA 1RWMB 5HANA 3DFEA 2Z57B 3THVA 1U1RA 2K3IA 4LF7F 3GIJA 3KLIA 1CC8A 1GK8A 3BGRA 3VAMA 2YNHB 2RD5C 3Q8PB 2R2UA 3UE2A 1F5CA 4DX6A 4HYKA 5K8PA 1ZTWA 1CQMA 1VCTA 1IXKA 5B7WA 1J5EJ 5M2PA 4PWDB 3M7VA 5HAOA 5EDWA 3IRXB 4KKOA 4OX8A 1H2TZ 4J9MA 1LWFA 3R3TA 4FP9A 4OYAA 1NK4A 4I0WA 4DV1J 1JJHA 5H9EJ 4PWUA 2H9ZA 1ZZNA 2YWFA 3V4IA 2BKNA 2VPZB 3OQ2A 2POKA 4OX7A 2KM8B 5I3UB 4LRDA 4USMA 3W9HA 2B8QA 3HHLA 2B4OA 1X31C 4EK2A 1F2GA 1TKDA 1IBLF 6AT1B 1TELA 1UAWA 2RU9A 1HMVA 1Y11A 2GIFA 4ANCA 3UD3P 1T05A 1FO1A 2HAFA 4CO1A 2WONB 3HXMA 2DGXA 5L1LA 2IBOA 4CLTA 1FNMA 3DOLB 5KT7A 2MKCA 1RHKB 3AFGA 1RHMB 3CMQA 4I1TA 3NMAA 2HHWA 3UN3A 1UVNA 2HS0A 4JI6J 1RYRA 3FEZA 1KS2A 3CJ3A 2R9LA 3TZXA 4LR7A 2I0XA 3R7SB 2YNHA 4RW8B 3KHHA 2VODA 3K7RA 3DXSX 4O3OA 2XS5A 4OV1A 3VV2B 2NUUG 1U24A 4PWDA 3CXCR 1VBZA 4DQSA 8RUCA 3IRXA 3IR5B 1UJ6A 4L6V3 1R8AA 3DOKB 2RKIB 1W2BR 2VC1A 2FLOA 1ZM3A 2IAJB 4KAIA 2IC3B 3AB2B 3GP9A 3MECB 2XYPB 3KKFA 5IQ6A 2HIQA 2U1AA 1WSRA 4ZITA 3TARA 5I3UA 3FDSA 2COLA 3RRHA 1RQ0A 4JI8F 2CJYB 2PMHA 4NLUA 3IWXA 5K8NA 4OZ1A 1CEZA 3HPOA 2WONA 2C2ZB 3PHTA 4HEA9 1HPZB 1KFSA 3MPDA 2YXLA 3DOLA 2QV6A 2V94A 2UVVA 3M05A 3AD8C 2GMLA 4I7FB 1FD8A 3HULA 3I55S 2DHAA 3KK1B 1MWQA 1WKKA 4GVLA 1SC3B 4LIWA 4RW8A 2DR5A 3THTA 4WFBQ 3VAGA 2BW2A 2R8IA 1D9FA 3TJ9A 5CYJA 4XPEA 3EXCX 1TMMA 4ZVTB 2Q1LA 1ZH5A 3ILLA 3DOKA 4DV7F 1FWLA 3DDNA 2RKIA 1NKCA 2MKJA 3I82A 5A6WA 3NCQA 2IAJA 2IC3A 3CC7S 3MECA 1YJUA 2IVYA 5GADI 4WKYA 1H2VZ 1GTHA 4OFZA 1KQKA 3LW5C 3PEJA 4U95A 2D69A 2HLTA 3M2VB 3P45B 2DR9A 5GADU 4MIWA 2J76E 1R3NA 2HRTA 5HMWA 4Y0FA 2G9OA 1N4LA 2DPIA 1P9QC 4NCBA 1MLAA 1KRPA 4KT0C 1HPZA 5GMEA 2HGNA 2ZUAA 4F4ZA 3KK2B 2DYAA 3LAMA 2RH3A 4I7FA 1XMBA 3R7NB 4M8LA 2XMWA 2HHVA 1A6LA 3KK1A 2L08A 1FRXA 5FJ4A 3D1QA 1QUPA 2QSWA 4XK8C 4DR7J 2NZCA 3QWPA 3OPKA 3GPAA 2XY6A 4FF1A 2W25A 5DGAA 3H2UB 3GE9A 5HP1B 4FN5A 2EG2A 5J2PB 5CCLA 2OEMA 1DURA 2HPUA 2HHHJ 4F4AA 3FRYA 3T5LA 2WB1D 3E01B 2EFQA 2VKZG 1FE0A 3PV8A 3PR5B 2FVCA 5KFKA 4RBUA 4KB7A 5IC6B 4MT1A 5AXMA 4I4BA 1D09B 2MYFA 2DNMA 1NSQA 3DYAB 4IRKA 4UF4A 4XAKA 5ETVA 4WYWA 3TX8A 2KHDA 1HNVB 1IR1A 1WHYA 4QU7A 2UUTA 4R0JA 1S1XB 3NGRA 3QWUA 1U4BA 4BS2A 4N7TA 5M2RA 3ZTSA 3CJSA 4X4VA 5BYSA 3IN5A 2P6TA 4RUAA 4DV3J 3KK2A 4KHPF 4LF5J 1C0TB 1F9HA 5BJRA 3E3XA 1S77D 4P7VA 3LUYA 2KFZA 2PFDA 3RRGA 2VBYA 4A4JA 2B4PA 5IM0B 1YLXA 3UD4P 2K1RB 2BQUA 2VG5B 1U2RA 1RAIB 2FDNA 3DLKB 1FDBA 4R5PB 3U27A 2M88A 5ETNA 2NLWA 2GHVC 2ASDA 4MJKA 1IWGA 2V8VA 3D3BJ 2EG1A 3N6LA 1VIXA 5HP1A 3MR7A 5J2PA 2CNNB 2X1BA 2J8AA 3KG1A 3EPIA 4ZCMA 1K44A 1HQUB 3FCHA 2E5LF 3A8KA 1KHVA 3E01A 1R31A 3QO9B 4CM2A 1SCJB 2FLLA 4PXEA 4B3TF 4URGA 2HFSA 3NS6A 4NLTA 3TUPA 4F0KA 1FDAA 2CQHA 4MMOA 2YKOA 3MPWA 3IG1B 1FRKA 3A3PB 5I3QA 3DYAA 2XB2D 4F3MA 4JI3J 2WVFA 1HNVA 2MKHA 1ZBTA 1S1XA 2F63A 5T41A 4OYIA 1AB8A 4HI1A 2DNYA 2WSFC 2RDIA 1UEKA 3RJMB 1GAOA 4RNHA 4ZVPB 2E5JA 4JI0F 3MMBB 1IN0A 1C0TA 2HHQA 1QTMA 3DKDA 3H8YA 4HACB 1APSA 4PABA 3GCWP 5IM0A 2ATLA 2AYMA 4DV4F 2Q3PA 2XMTA 2K1RA 5EWEA 2CPXA 2VG5A 5HROB 3DLKA 4R5PA 2W8KA 5KFPA 1LOUA 4QIWD 3HT3A 2X1GA 3B54A 5IT4A 3RUBL 4MIBA 2UUAF 2ZNZA 1V6HA 3AJ1A 2HFNA 1GMUA 2PEHA 5A2QY 4IH6A 3JTNA 1HQUA 5I4MA 4CTAB 3RBXA 4F50A 1VYAA 1N34F 4IQXA 4PRFA 3QO9A 3IBCB 4ECXA 4K5SA 1ZM2A 1SV5B 2JEFA 1AYEA 2ZKTA 2PEBA 3MAAB 4J91A 3CCMS 4MAKA 1N8RT 4F2RA 3EUNA 1X4AA 1UCNA 3A8JA 3QLHB 4CLZA 4OYOA 4KHRA 3IG1A 4A46A 1DARA 1KVJA 2ZC3A 5F8LA 4J9NA 4HHJA 1PKUA 2XLKA 4USUA 1KQSR 1F60B 1R43A 4OJ3A 4O3PA 4EYIB 2HBRB 1DJ0A 2C2MB 3D2WA 2AGPA 4DR3J 4DV5F 3MMBA 1G7CB 1W7WA 1NU4A 4ECVA 4HACA 1LV5A 2CG4A 3NAIA 2QMUB 1QVFR 4LSLB 3F0NA 5CCMA 4O0IA 2RT3A 5AE3A 5HROA 3GONA 3TQEA 1UVKA 3CULA 3M4XA 2DH9A 3I5CA 2Y0SD 1NLKL 4E98A 3TVYA 2MPUA 2XO7A 3WC2A 3EWGA 1I3OB 4CTAA 5IWAJ 3W2WB 4MK9A 2W2PP 3AQPA 2ROGA 2KG0A 1SV5A 3AQOA 3MAAA 1NDCA 1RA6A 3POTB 2G2OA 3QLHA 3W61A 4HVZA 5D4LA 2OKQA 4RZRA 1GMVA 1SUQB 2RJZA 4DX7A 4YMEA 1T9UA 2F8MA 3HO1A 4QYZK 2E7XA 3CPWR 2W2NP 2BANA 3KUGA 4P9SA 2UUBJ 2KO1A 4NWBA 4UOGA 3R6GB 3O1LA 2BKPA 3A13A 2FLNA 4USVA 3NY0A 2MKIA 2F7VA 1U0HB 1F9EB 1E6YB 5B0DA 1RWPB 3PVXA 2F4FA 2V2ZA 4DR6J 4ZPBA 1FXLA 3PHEA 4LSLA 1TK0A 4B3SJ 5ETPA 3G8QA 3IA0A 4LRFA 1FDNA 4RBVA 2XZWA 2YPYA 2E1MC 2LQ8A 3JSMB 1MMDA 2V34A 1Q8LA 3FGVA 1C1CB 5KFBA 2ZZTA 2KU7A 2DRAA 4X4PA 1U49A 2JWNA 2QLBB 5ETSA 3ZTOA 4B3MF 4KPCA 3W2WA 4DQPA 1NRKA 4TU9A 3G96A 4OI3A 4UQGA 4K50A 5B0EA 1AUDA 2R7UA 2MSSA 4JI1J 1VQ7S 2B9WA 5KG3A 3POTA 3BM7A 5IS2A 4Q8FA 4NLGA 3L3CA 2C3UA 2WTFA 2VC0A 1KWMA 2ZH9A 2AU0A 4P6QA 1SUQA 3CNQP 1UA0A 3J7Z5 5KOXA 4GVBB 3T6BA 1RABB 2B0GA 4MKVA 1URRA 2BJ8A 1GMWD 4L75A 2O5DA 1FWKA 4RNNA 4I2PB 2RSQA 3EGZA 1U0HA 3H4BA 4X65F 4Y2IA 2IM2A 3K8VA 3VAKA 2EI5A 1SH2A 3JTPA 1NBEB 4JB8B 3KLVA 4NYPA 2NXUA 2M52A 3JSMA 2D7SA 1VRTB 1C1CA 2N7YA 3CC4S 2MKYA 4LFAF 1R7IA 1W26A 3A3NB 3ETMA 2BYCA 2AYEA 5IT0A 2AZ3A 1HWIA 2CQBA 3WZ0A 3AJ2A 4K4VA 3EM1A 3JAMU 2HQ3A 2V9WA 3OVAA 2HQDA 1N33J 3H7HB 2JEJA 5DZ7A 4L72B 2CA9A 3GJSB 4DSIA 2PMZD 1MWYA 1N32J 1S9GB 4RO0A 2ZM6F 2G1HA 2Y1JA 2DNOA 1IKXB 4GVBA 5ETTA 5HQLA 2J6SA 4ZOSA 4ED4A 2KKHA 4AL7A 4WIQA 2QA4S 3W8GA 1S72S 1CJVB 4I2PA 3LWMA 3K89A 4ELTA 4CYUB 3U1LA 2F4VJ 4S0MA 4PXBA 2UXDJ 3BBCA 4LRCA 1TUGB 3PW5A 3D7SB 1HNWJ 2G2ZA 4NCGB 4KY3A 3FSXA 3AJDA 4LF4J 1F9FA 3DN9A 4KV8B 4XPCA 4NLRA 4FF3A 1U1QA 5KFNA 4UY85 1GT8A 5D0EA 3KMQA 3BKUA 3PKYA 4ANEA 1DTQB 1LK5A 4KO0B 1FJEB 4H4KA 4DV6F 4LSNA 2UU9F 3UCGA 2XHCA 1OQ6A 3KUEA 2F8EX 5HI7A 4NYOA 2Z0GA 2X7IA 2JOQA 2HFVA 4X4OA 5DG9A 1VR6A 2FHMA 4U6PA 1MMLA 1ZYQA 2HHTA 5JUMA 3K59A 3C6TB 1QJHA 5DLGA 1S9GA 3FSYA 2FVRA 1FHTA 1RACB 2AMCB 1IKXA 3QJLA 3BSAA 3V5RA 2QLFB 4ZN3A 2A3JA 4X66J 3QFHA 1CJVA 4NEYA 2GO9A 3UO0A 4CYUA 3FZBA 3JQMA 4K0KF 3PX4A 3NAHA 1AXQA 4P2SA 2M9KA 2QE5A 2G0JA 1SIZA 3CJ0A 2DGWA 2R2SA 1WTFA 4NCGA 5D78A 3B4MA 5E41A 1U45A 2C2NA 1BD6A 4KV8A 3KLGB 3Q23A 3IBWA 1SQGA 4F4XA 4NA1A 3WIVA 2O1PA 2WAQD 3MOZA 1KN6A 1GXLA 3DCAA 3TVKA 3JB9k 1KONA 1SL0A 3HJFA 1DTQA 4KO0A 5L1IA
chains in the Genus database with same CATH topology
1K44A 3FBCA 5CABA 1S59A 5BXIA 1BE4A 1JXVA 3BBFA 1NDLA 3WX8A 3MPDA 3Q83A 4FKYA 4W98A 5CAAA 1XQIA 1EHWA 2B8PA 1NPKA 3Q89A 1NLKL 1S5ZA 1NSQA 2HVEA 3VGTA 3FBEA 1HHQA 2HURA 3ZTRA 1VYAA 1NB2A 4UOHA 3R9LA 3ELHA 4DUTA 3Q8VA 3EJMA 4O0NA 2ZUAA 3EMTA 4S0MA 3NGRA 2DYAA 3BH7B 3EVWA 1WKKA 3BBCA 3FBFA 4FKXA 1F3FA 3NGUA 2CWKA 3ZTSA 3FCVA 3BBBA 3Q8YA 2DY9A 1PAEX 3ZTOA 5C7PA 2VU5A 4DI6A 5IOLA 1UCNA 1KDNA 3ENAA 3VGSA 1NDKA 1NUEA 1NDPA 2BX6A 1LEOA 2AZ1A 1NCLA 4DZ6A 1F6TA 1XIQA 1S57A 1NDCA 3VGUA 4KPCA 2DXEA 3VVUA 1NSKL 1PKUA 3ETMA 3DDIA 3VGVA 3FBBA 1BHNA 3Q8UA 3ZTQA 4CP5A 1HIYA 4ANDA 2B8QA 2AZ3A 3EE3A 1HLWA 2DXFA 3PRVA 1B4SA 3GP9A 1WKJA 3GPAA 2HVDA 3Q86A 1MN9A 4EK2A 3FKBA 3ZTPA 3NGTA 3EM1A 4UOFA 3DKDA 3EVOA 4ENOA 1NHKL 2BEFA 3FC9A 1MN7A 3JS9A 3VVTA 4ANEA 4ANCA 3FCWA 1BUXA 1B99A 3BH6B 3EVMA 1W7WA 2DXDA 4F36A 4F4AA 4UOGA 3G2XA 1LWXA 3EICA 3PJ9A 4HR2A 1U8WA 1ZS6A 1WKLA 2NCKL 4C6AA 4WBFA 1NSPA 3B6BA 3B54A 3L7UA 3NGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K44 A;  3FBC A;  5CAB A;  1S59 A;  5BXI A;  1BE4 A;  1JXV A;  3BBF A;  1NDL A;  3WX8 A;  3MPD A;  3Q83 A;  4FKY A;  4W98 A;  5CAA A;  1XQI A;  1EHW A;  2B8P A;  1NPK A;  3Q89 A;  1NLK L;  1S5Z A;  1NSQ A;  2HVE A;  3VGT A;  3FBE A;  1HHQ A;  2HUR A;  3ZTR A;  1VYA A;  1NB2 A;  4UOH A;  3R9L A;  3ELH A;  4DUT A;  3Q8V A;  3EJM A;  4O0N A;  2ZUA A;  3EMT A;  4S0M A;  3NGR A;  2DYA A;  3BH7 B;  3EVW A;  1WKK A;  3BBC A;  3FBF A;  4FKX A;  1F3F A;  3NGU A;  2CWK A;  3ZTS A;  3FCV A;  3BBB A;  3Q8Y A;  2DY9 A;  1PAE X;  3ZTO A;  5C7P A;  2VU5 A;  4DI6 A;  5IOL A;  1UCN A;  1KDN A;  3ENA A;  3VGS A;  1NDK A;  1NUE A;  1NDP A;  2BX6 A;  1LEO A;  2AZ1 A;  1NCL A;  4DZ6 A;  1F6T A;  1XIQ A;  1S57 A;  1NDC A;  3VGU A;  4KPC A;  2DXE A;  3VVU A;  1NSK L;  1PKU A;  3ETM A;  3DDI A;  3VGV A;  3FBB A;  1BHN A;  3Q8U A;  3ZTQ A;  4CP5 A;  1HIY A;  4AND A;  2B8Q A;  2AZ3 A;  3EE3 A;  1HLW A;  2DXF A;  3PRV A;  1B4S A;  3GP9 A;  1WKJ A;  3GPA A;  2HVD A;  3Q86 A;  1MN9 A;  4EK2 A;  3FKB A;  3ZTP A;  3NGT A;  3EM1 A;  4UOF A;  3DKD A;  3EVO A;  4ENO A;  1NHK L;  2BEF A;  3FC9 A;  1MN7 A;  3JS9 A;  3VVT A;  4ANE A;  4ANC A;  3FCW A;  1BUX A;  1B99 A;  3BH6 B;  3EVM A;  1W7W A;  2DXD A;  4F36 A;  4F4A A;  4UOG A;  3G2X A;  1LWX A;  3EIC A;  3PJ9 A;  4HR2 A;  1U8W A;  1ZS6 A;  1WKL A;  2NCK L;  4C6A A;  4WBF A;  1NSP A;  3B6B A;  3B54 A;  3L7U A;  3NGS A; 
#chains in the Genus database with same CATH topology
 3PO5 A;  1S0V A;  5F9N A;  2JVR A;  3C16 B;  2R42 A;  2MDA A;  4J9S A;  4FS1 A;  1Q7Y T;  1PC5 A;  4AD6 A;  2ZOM A;  1BMQ B;  1PIE A;  3C6T A;  1Z1Z A;  4M5G A;  2HFZ A;  5GAH I;  1V3Z A;  1TL1 B;  2B9X A;  2RRA A;  3TUZ C;  3RTV A;  1NHV A;  5GAG I;  5CZX A;  3SBM A;  2HSE B;  5GAH U;  5KG6 A;  2FJA B;  1RTD B;  2E9Z A;  1CUL B;  3ZZY A;  3AHP A;  1VC6 A;  1S57 A;  3MED B;  3GFH A;  3GG1 A;  1FTC A;  4B02 A;  4O23 A;  5E3C A;  5GAG U;  3M1V B;  4LQ9 A;  2RRN A;  2NPI A;  2DB1 A;  4WZQ A;  2EXU A;  3BO2 A;  2M7S A;  1T3O A;  3EVM A;  2W4D A;  3R5B A;  3ZZP A;  4EGL A;  1X5P A;  4JI6 F;  3KNG A;  3KLG A;  1R0C B;  1CJT B;  5ADZ A;  2CPI A;  3LGN A;  2J7W A;  4O4G B;  4F4K A;  4CCH A;  4C3M A;  3IGV A;  1NK9 A;  1XQI A;  4PR6 A;  2YKM B;  1N0U A;  3D9B A;  1S5Z A;  5L1J A;  5KFC A;  4IR1 A;  1A9N B;  3C16 A;  4Q2M A;  4UOH A;  2R7S A;  2DCL A;  4YQW A;  2XMA A;  1G4C A;  2RS8 A;  2GV1 A;  3I4H X;  4ATN A;  1VIS A;  3FNN A;  1MRO B;  4E2F B;  3Q8Y A;  3LH2 S;  3H2V E;  2R4F A;  1ZAX A;  1TL1 A;  1R0B G;  3FK4 A;  3QT8 A;  4DZ6 A;  1GFW B;  4H54 A;  5KFZ A;  4TU7 A;  1BQM B;  2PII A;  1AFJ A;  3ZTQ A;  1L3T A;  1RTD A;  1CUL A;  4Y00 A;  5CZV A;  3MED A;  5A0Y A;  4GMK A;  2KT5 A;  2YPZ A;  3M1V A;  4WXW A;  2KT3 A;  4J9L A;  3C6U B;  3PJX A;  4P72 A;  1JWW A;  2LLZ A;  1P1T A;  5EUH A;  3IAM 9;  2GW8 A;  2BZ2 A;  4MTP A;  4FXV A;  5KFX A;  3JAM Y;  4IUF A;  1SH0 A;  4F2S A;  9RUB A;  5BXI A;  2IJF A;  2WSC C;  4X84 A;  5HVG A;  5JXS A;  5G4D A;  2OTL S;  2FHK A;  1CJT A;  2QL7 B;  2DIS A;  1IKV B;  5H9F J;  4HKQ A;  3S01 A;  5LXR A;  2BBE A;  4A8K A;  1U7L A;  3EZ5 A;  1S9F A;  1S49 A;  1KQF B;  1D1U A;  2YKM A;  2A1B A;  3TRG A;  2QLW A;  1UZD A;  2A0F B;  2RE1 A;  1TV6 B;  3GFY A;  4MYU A;  2FY8 A;  4UUW A;  4YB1 P;  4ZJQ A;  1MRO A;  5C2C A;  1Z2L A;  1OQ3 A;  5EWG A;  5EX3 A;  3QZ7 A;  1WEZ A;  4ED1 A;  2XBP A;  3PIO Q;  1VK8 A;  1HNX J;  3PYD A;  3K5N A;  3GYX B;  3R1L A;  1D8Y A;  1BQM A;  1PJ6 A;  3EVO A;  1O8B A;  3MGJ A;  4TXS A;  3ILJ A;  4X4Q A;  3I9Z A;  4IG3 B;  4A8X A;  1EX8 A;  3PIP Q;  4DJB A;  2X3D A;  1RCO B;  2N3O A;  3M8P B;  1I94 J;  3C6U A;  3GLJ A;  2BQ3 A;  3NGS A;  1FES A;  5IQQ A;  4PYA A;  4TVA B;  1S0O A;  1BLU A;  3WC0 A;  4DL6 A;  3DHX A;  2CDQ A;  2VFU A;  4MKB A;  2FB0 A;  2OHD A;  1NK0 A;  1Q1K A;  3MUT P;  4ZPT R;  3RBE A;  2CQP A;  4GKJ F;  3EJM A;  4USI A;  1IKV A;  3MTK A;  2RHQ B;  2MLY A;  4DR7 F;  2LXU A;  1WC3 A;  2E1C A;  3JSY A;  2MB0 B;  1RKJ A;  4YB7 A;  3C15 B;  2DIV A;  3NWR A;  4JV0 A;  4YY3 F;  5IV4 A;  4ZVF A;  1S6P B;  2NPF A;  2JC0 A;  1TV6 A;  2W2Q P;  3MCS A;  4ED8 A;  2HHH F;  3T6J A;  4OLP A;  1HHT P;  4ZVQ B;  4G3I A;  2R7V A;  3T1A A;  4R25 A;  3CF5 Q;  4DR5 J;  3HHK A;  3VVT A;  4M5M A;  1BUX A;  2RIJ A;  2I8E A;  4PEO A;  4I64 A;  2F9J A;  1UA1 A;  3VR1 A;  3N01 A;  4LVN P;  4ZPV R;  2NR0 A;  4RW4 A;  4IG3 A;  1M5H A;  3L7U A;  1U6F A;  3HHN B;  2ZBQ A;  2DGQ A;  3GIM A;  1HNI B;  4AQY J;  3M8P A;  2L3M A;  5E3A A;  1WI6 A;  1WAC A;  4BHQ A;  2V69 A;  4P73 A;  2IRY A;  1Y10 A;  3Q8Q B;  3LPE A;  5KFU A;  1HW8 A;  4PYD A;  1SI9 A;  2Q6B A;  3M6W A;  1SC1 B;  4ECU A;  1VQ5 S;  3N6N A;  3OXG A;  1DQA A;  1HQ2 A;  5E2Q A;  2Z58 B;  1S1U B;  4ERD A;  1DLO B;  1L5U A;  3HVR A;  1SXL A;  4ZIW A;  2ZH5 A;  2EK6 A;  1R89 A;  3VVU A;  2L48 A;  3C15 A;  4RNF A;  5D6G A;  4NPO A;  2XSJ B;  1T9W A;  2L41 A;  1Q86 T;  1S6P A;  1MN9 A;  4WP8 A;  3QMQ A;  1U25 A;  2FZC B;  4G65 A;  2V8P A;  3TEG A;  1JLC B;  1HA1 A;  1WC6 A;  2Y1L B;  3R2C J;  1ZA1 B;  5DLF A;  1TKZ B;  5F8J A;  3G6Y A;  2IRX A;  4LQ3 A;  2BRK A;  2OPS B;  1R0A B;  1FJG F;  1X4D A;  2KL8 A;  3DC2 A;  3I5A A;  1IBK J;  2RVJ A;  2KVQ E;  4CZC A;  4JI3 F;  1JNZ B;  3AD9 C;  1HNI A;  3P49 B;  1BXN A;  4M5K A;  2E9T A;  4QR1 A;  2R7Q A;  2XZD B;  5K9F A;  3KG0 A;  4Q5V A;  3HDS A;  3BH7 B;  2AGQ A;  2DJW A;  3NGU A;  2FJE B;  4LMZ A;  1C2P A;  4RX6 A;  3ZO7 A;  3J7Y I;  3CTR A;  2IM1 A;  4OI2 A;  1KDN A;  4CO3 A;  4G1I A;  1LEO A;  2J7K A;  2VKR A;  5KFY A;  1IR2 A;  1T03 B;  1S1U A;  2P5V A;  4G6V B;  3J7Y U;  1DLO A;  2DHH A;  2XHW A;  5B08 A;  4ZLL A;  1KSP A;  2QLX A;  2ZH2 A;  4TYB A;  4PG6 A;  3BGU A;  2LVW A;  4DPX A;  3THP A;  4QWD A;  2XSJ A;  4DCJ B;  2W24 A;  4WTY A;  3RR8 A;  3IM8 A;  1GEH A;  3W64 A;  2J9D A;  1KKH A;  3DNC A;  3MAH A;  3F41 A;  2HVI A;  1LW2 B;  4ITS A;  4HTI A;  1OYE A;  3B8H A;  1JLC A;  3PKM A;  2Z4P A;  1YBA A;  3K2Y A;  1TKZ A;  3H25 A;  1IM6 A;  2VUG A;  4EU0 A;  1IVZ A;  4KE5 A;  3OFG A;  4CLY A;  2V2Q A;  2OPS A;  3G6X A;  2JH3 A;  5DO2 A;  4HDH A;  2KZM A;  3A8E A;  1R8B A;  2CG8 A;  5KG5 A;  5KT3 A;  2EVZ A;  3HVT B;  3K5L A;  2Q66 A;  2C2R A;  3OTD A;  2ZH3 A;  2FD2 A;  1R6V A;  1SB6 A;  1WDD A;  3ZZT A;  4KH0 B;  4URS A;  3KLH B;  4JI2 F;  1HBM B;  1VJW A;  1H7W A;  2VZ9 A;  1S6Q B;  3NS7 B;  1X5O A;  2ZVI A;  2EC2 A;  3MMA B;  3PRD A;  1T03 A;  4XTT A;  3QQC D;  1QSL A;  4KPY A;  1IUJ A;  1XK8 A;  2DPJ A;  2KJV A;  2FVS A;  2UXC J;  2DBB A;  5H9E K;  3RYL A;  2FQQ B;  5KT5 A;  2QSF A;  4F4W A;  2RHS B;  2WVD A;  1LW2 A;  1YSJ A;  4ES1 A;  5IWA F;  4OYM A;  1B7F A;  1N52 B;  2DNG A;  2HVZ A;  5RUB A;  4ED7 A;  3T19 A;  4M5L A;  1OMS A;  1HBN B;  3R9L A;  4M1K A;  2VPW B;  2FJW A;  4GKK J;  5DQI A;  4PG7 A;  3R8Y A;  4WCE Q;  4DF8 A;  2XMK A;  2AP6 A;  1WHW A;  2F65 A;  5HQM A;  4F0H A;  4RWX A;  4F26 A;  3HVT A;  3L4B C;  2UUB F;  4X4U A;  4I6A A;  1Y00 A;  5H1S V;  2HK2 A;  3RB4 A;  3QSY B;  3MM9 B;  2ZWP A;  2H54 B;  3N0V A;  3S8S A;  3CJ2 A;  5MLC V;  4FPI A;  2GQQ A;  3KLH A;  4EO8 A;  2OSQ A;  4UT4 A;  1HR0 J;  1HBM A;  4Z2X A;  1S6Q A;  4C0B A;  1QAJ A;  4DR6 F;  3LGM A;  3HK2 A;  4B3S F;  4FYV B;  3MPU B;  3MMA A;  4WBF A;  1VLY A;  3VWS A;  1NPK A;  4O4R A;  1IKW B;  3HSG A;  1DZ5 A;  1S6O A;  1T11 A;  4ZPW R;  4YR3 A;  2F8H A;  3IFE A;  1VJQ A;  1J27 A;  1RA7 A;  1EJ7 L;  2X3G A;  3MTJ A;  1VI7 A;  1U26 A;  4HI2 A;  4EZ9 A;  2HG4 A;  5SZT A;  3DRR B;  3KJF B;  1HBN A;  3ZNU A;  4OZ5 A;  4JI1 F;  3ENA A;  3HZG A;  4GO5 X;  2F9D A;  3TA0 A;  3SV3 A;  3RB3 A;  3LA0 A;  2C3Y A;  5DDR C;  3MEG B;  4EMD A;  3SSS A;  4FNH A;  3NNC A;  1C4A A;  1SVD A;  3FQL A;  2DH7 A;  1K73 T;  1YJW S;  2EW9 A;  3MM9 A;  4U96 A;  2O67 A;  2WZ1 A;  3AA9 A;  3ET6 B;  3JSR A;  3O6Q A;  2ABY A;  2FJD B;  4WXO A;  5F8N A;  3N4W A;  2MQP A;  2IM0 A;  4WF9 Q;  2JFK A;  2MGZ B;  1YDL A;  4ZCL A;  1R6Y A;  2HFO A;  3SV4 A;  4Y2C A;  1XC9 A;  2W2O P;  5AXL A;  1IKW A;  1NME B;  4HH0 A;  4NLS A;  1I51 B;  2I9S A;  3ELH A;  5DDP C;  5CD4 A;  4DPO A;  3H40 A;  2PD1 A;  4ZPC A;  3BBB A;  1X9W A;  1W2I A;  1FDD A;  2BDP A;  2B51 A;  3BKT A;  3I0S B;  4DX8 H;  2LU1 A;  2GC8 A;  4NZ7 A;  3DRR A;  2Q79 A;  1N33 F;  3I96 A;  1X60 A;  3MFI A;  3MUM P;  3BYP A;  1UPP A;  1Z2Z A;  2HVD A;  4K4W A;  4YR2 A;  1LFP A;  4OX6 A;  5F8G A;  3MEG A;  3M9N B;  3G82 B;  3D5M A;  1J2V A;  5KAK A;  1LFW A;  3ISZ A;  2XTJ P;  5ETL A;  2KN4 A;  2B43 A;  4NRT A;  3T5H A;  4MKA A;  2P9G A;  3TZY A;  3ET6 A;  2BV3 A;  2F4V F;  4F7V A;  2MY8 A;  2UXD F;  2XQC A;  3AB4 B;  1NPP A;  4DQI A;  1D9D A;  2MGZ A;  3UW1 A;  5L9X A;  1W25 A;  1Q0N A;  4LF1 A;  4TQS A;  3MM6 B;  1XEZ A;  1JLE A;  3R27 A;  3MAQ A;  2GVD B;  4LF4 F;  5HL7 Q;  1SPB P;  5KFL A;  2Q6C A;  3VF0 B;  3M6U A;  1XER A;  4OQJ A;  5EWF A;  7FDR A;  2ACM A;  4K4U A;  1OSD A;  3ZZO A;  5C24 B;  4ZP7 A;  2DIU A;  1YJ7 A;  4LF6 J;  3Q8U A;  5HO4 A;  3CO9 A;  2QLJ B;  3CVK A;  2W4P A;  1Q78 A;  3ENQ A;  4Y2K A;  1GMW A;  2MY7 A;  3DI6 B;  3RBD A;  2YH0 A;  2IMO A;  2ZJQ Q;  4ETX A;  1E6V B;  4O3R A;  1YKW A;  5L8R C;  1GH8 A;  4EBD A;  2W2M P;  4C6A A;  3T41 A;  3W8P A;  4A48 A;  3G82 A;  2NS1 B;  1RAF B;  5BYR A;  4DL4 A;  2G0I A;  2I6W A;  2ALZ A;  1S6U A;  2D3O R;  1C4C A;  3HKW A;  3SI8 A;  2W9C B;  2WRM A;  2RRB A;  2MZQ A;  1LK7 A;  3VQT A;  1RWW B;  4OIX A;  2EFG A;  4E8U A;  1C1B B;  3MM6 A;  2VOP A;  2GVD A;  3DM2 B;  1U6B A;  4DV2 J;  2BVZ A;  2H4W B;  4ZVU B;  2LEP A;  2P8I A;  3VAJ A;  1UJ4 A;  4WFN Q;  1OY6 A;  4PXD A;  2BKO A;  5DJB A;  1N36 F;  4C7Q A;  3CDB A;  2W9A A;  5C24 A;  1WEX A;  1M1G A;  2WVE A;  3W62 A;  2V4R A;  2MLZ A;  3MEK A;  1YRT A;  2RQC A;  2HYI B;  5EHH A;  4FVM A;  1N88 A;  3CD7 A;  2GAG C;  4F4Y A;  3HD2 A;  1XNQ J;  3OR2 B;  3DI6 A;  1TFW A;  3H0P A;  1YZ7 A;  1TL5 A;  3LGH A;  3H5X A;  4LRE A;  4ECZ A;  1E6V A;  5GVQ A;  1TVR B;  3PTW A;  4OMF G;  5KFA A;  3H59 A;  2QA2 A;  4U9R A;  3D1H A;  4C4W A;  1RLC L;  5LMN F;  2BJE A;  1Y0H A;  3ZC4 A;  3J7Z T;  4ZVO B;  1SC6 A;  4OYZ A;  2AJ4 A;  3O44 A;  2RNE A;  4UZC A;  1P6T A;  3K0J A;  3E2E A;  4CLK A;  2UVW A;  1DQ8 A;  1N5Q A;  1FXD A;  2GX8 A;  1NKE A;  2W9C A;  3PR4 A;  4NXM J;  1RHR B;  4QWB A;  1U2C A;  2SXL A;  4KGV B;  2XI3 A;  2LKZ A;  4DI6 A;  1FER A;  3AOC A;  2M4M A;  3GWC A;  4BCA A;  1GXU A;  2C28 A;  4NLD A;  3W2V B;  3P6Y C;  1C1B A;  4DS4 A;  1KVI A;  2ZDP A;  3KWM A;  4PG8 A;  1Q8I A;  4NX9 A;  3DM2 A;  2APO A;  3EE3 A;  4QPT A;  2GJF A;  1A7G E;  1RT3 B;  2HZA A;  2DNN A;  2EBG A;  1UFW A;  2RF2 B;  4CT8 A;  2DXD A;  3WQP A;  3TAP A;  3QID A;  1RU2 A;  1VQY A;  2CQ1 A;  4DG1 B;  3HHL C;  3ISN D;  4PUO B;  2W01 A;  2GFF A;  3CWJ A;  4CO4 A;  4JV5 J;  4CDI A;  3R5C A;  1JLQ B;  1JXV A;  3OR2 A;  4OI0 A;  5K5M A;  1ZOT A;  4HHH A;  3CJK B;  4ZK7 M;  1TVR A;  5HSP A;  2ZUG A;  3J81 Y;  4OZ0 A;  5LMU F;  3D66 A;  4PG4 A;  3I5B A;  4DL0 C;  4DR2 J;  1N56 A;  1SQF A;  3RAQ A;  1Y5L B;  1VQP S;  2FLP A;  3NP5 A;  2H5I B;  5C7P A;  4JBC A;  1YX2 A;  4K5R A;  1IJF B;  5HQ8 A;  3QIP B;  5KG2 A;  2CJQ A;  1U1L A;  3SQO P;  3R2D J;  3M2R B;  4Q8E A;  3W2V A;  2OML A;  4C11 B;  4YUD A;  5C25 B;  1K8A T;  4ED5 A;  4IOC Q;  4KHM A;  2PE8 A;  4A8Y A;  4HL9 A;  2A6M A;  4JI5 F;  1U8W A;  1VHF A;  5B09 A;  3QAE A;  1RT4 B;  1RT3 A;  3UR0 A;  3KLF B;  2VBZ A;  2V2K A;  2RF2 A;  1Q5V A;  2CJB A;  4UY8 T;  2KM8 C;  2G13 A;  4DG1 A;  4URQ U;  2F5G A;  2C42 A;  2AEF A;  3KHR A;  4PUO A;  2DEI A;  1REG X;  1IBL J;  1FI4 A;  2JL9 A;  3T9N A;  1JLQ A;  5D0R A;  3KOA A;  1RAO A;  4MFB B;  4DL3 A;  1B7Y B;  2C3P A;  3SIP B;  3CJK A;  2EFP A;  2XMV A;  3WIU A;  2JDJ A;  4AXJ A;  4GRS A;  2H1Y A;  2GJ2 A;  2I5J B;  3K5P A;  1RCX B;  3VGU A;  2ADB A;  3FBB A;  4X4R A;  2W7A A;  4FYY B;  2X1F A;  2BM0 A;  2CXE A;  1TP7 A;  3NOC A;  2V8D A;  1M5P C;  4JV2 A;  3QIP A;  4RLE A;  1I94 F;  3IR7 B;  1DY3 A;  2YNG B;  2HNZ B;  3T1Y F;  3CCS S;  4ED3 A;  3QYY A;  2VQE J;  4YEA A;  2AD9 A;  2V4J B;  3M2R A;  1EKR A;  3JQK A;  5I42 B;  4ED0 A;  4C11 A;  4KIA A;  5C25 A;  2V8G A;  3D68 A;  2NCK L;  3SFG A;  2YBV A;  2C2D A;  2ZOG A;  2ZWO A;  3MR6 A;  4M95 A;  2BJ7 A;  4J9Q A;  2JVO A;  3KLF A;  3O5T B;  2WVC A;  4QWE A;  3U02 A;  1Q95 G;  2B7C B;  5D3G B;  3MCN A;  1MNE A;  2ALY B;  2MZT A;  2LCW A;  4R0E A;  1VRQ C;  1N6Q B;  2M2B A;  1XMO F;  4JI8 J;  1LXJ A;  5FLX Y;  4MFB A;  4YHH J;  3KK3 B;  3WDO A;  1JLB B;  5IT9 U;  1WG5 A;  2DXE A;  5AJ3 F;  3CJ5 A;  4B3R F;  4EI2 A;  4P75 A;  3OL7 A;  2RML A;  4USK A;  1WEY A;  2I5J A;  3QT5 A;  4N56 A;  4ZHR A;  1TU0 B;  3TX0 A;  4QPX A;  1TTH B;  4AQY F;  4HTJ A;  2YNG A;  2HNZ A;  3VQS A;  2DO4 A;  4K4X A;  2VFR A;  3K8W A;  2HRY A;  2V4J A;  3RW6 A;  3ZZR A;  5LSL A;  5I42 A;  3W66 A;  4ZP9 A;  1AFI A;  3U1M A;  1RUS A;  2U2F A;  5DZ6 A;  4J9R A;  2K8G A;  2AYB A;  4NLX A;  4AXI A;  1ZAV A;  1RT5 B;  4DV7 J;  1JX4 A;  2RQM A;  4DR4 J;  3G8S A;  1N48 A;  1UL3 A;  4BBY A;  5A8W B;  2B5J B;  2OJ3 A;  2YWK A;  5F8I A;  2VQF F;  3RW7 A;  2Y8Y A;  1HAR A;  1FE4 A;  5D3G A;  3F56 A;  2KI2 A;  2DHX A;  3ICL A;  4ZLP A;  3HI9 A;  3JSB A;  1N6Q A;  5HMX A;  1X9M A;  2ZH8 A;  2O01 C;  2VPY B;  5A2Q U;  3SDE B;  3KK3 A;  4JYA J;  2RS2 A;  4RBT A;  1AUS L;  2V2V A;  1JLB A;  2VA3 A;  1FRJ A;  1OSC A;  3Q0A A;  2DGV A;  2XLI A;  2QO3 A;  1B0T A;  3QGH A;  4QZV B;  4QW9 A;  3BH6 B;  2R7R A;  1IBK F;  3C3L A;  2FY1 A;  5B0A A;  1ROF A;  3CUN A;  1WOP A;  2LXF A;  1UVM A;  3MUV P;  3ILI A;  3QSI A;  5IZH A;  1WWH A;  4GO7 X;  3IS9 B;  1V3S A;  2H5J B;  3RZA A;  2PFF B;  1N5T A;  3CW2 C;  4CQ1 A;  2XCP A;  1BC6 A;  5A8K B;  1PCA A;  2GGP B;  2G2Y A;  2GVZ B;  1FTR A;  1L3U A;  3ENV A;  3T5K A;  1S0N A;  4K59 A;  1F2H A;  1O0P A;  1G6B A;  2X51 A;  2ILZ A;  2W1B A;  4U7C A;  1RT5 A;  1N5V A;  1YVF A;  1V9O A;  2GIR A;  5A8W A;  1S12 A;  2B5J A;  4NE9 C;  4OYP A;  2PA8 D;  3QGI A;  4RU9 A;  2OIH A;  2GS8 A;  1KLM B;  2CNK B;  3A8I A;  2E5I A;  2FGC A;  2VB6 A;  1X9S A;  3SDE A;  2OD6 A;  3GMG A;  1PJ5 A;  2CQ3 A;  1VRU B;  1SQE A;  2OO4 A;  4ECS A;  2YKA A;  1Q5Y A;  1VIO A;  5CH7 B;  3HSJ A;  4KHP J;  4FBU A;  4NL5 A;  3F73 A;  4FYD A;  1NKB A;  3BR9 A;  3RBZ A;  2KFN A;  2QX0 A;  1HWJ A;  1WJ9 A;  2YX4 A;  5DS7 A;  3IS9 A;  5L1K A;  2GQC A;  3FBE A;  1PG5 B;  3UNY A;  4YR0 A;  3FQK A;  1DHM A;  4N41 A;  2VJV A;  4PCQ A;  3GQC A;  5A8K A;  1S1T B;  2GGP A;  4M5N A;  3LWL A;  4FF2 A;  1KOO A;  4OHZ A;  4DR1 J;  3KHL A;  4LF8 J;  1M0S A;  2CWK A;  3BV8 A;  1VQ9 S;  4K4Y A;  2VIC A;  3GV7 B;  3GJR B;  1LNQ A;  1WDT A;  3BSO A;  5E3P A;  1NH7 A;  5AT1 B;  4LVO P;  2DNL A;  2UXC F;  1RDR A;  1HI8 A;  3PW2 A;  3I6P A;  3BQ1 A;  1KLM A;  1Y5I B;  4B3O B;  5JVG Q;  3QT7 A;  3T1H J;  3UI3 A;  2HMI B;  5CA5 A;  5L46 A;  2AJF E;  3R5D A;  3QZ8 A;  3D6H B;  1RT2 B;  2C2O B;  4OI4 A;  3GCX P;  1XN9 A;  2UZA A;  3M2V A;  5J2M B;  1TAQ A;  2ROP A;  3G87 A;  1VRU A;  1F5B A;  1CS4 B;  4B9M A;  5CAB A;  2XMU A;  2EFO A;  2ILY A;  4GKK F;  3SMZ A;  4FKY A;  2XZT B;  3I87 A;  1YGY A;  5EX0 A;  3EGW B;  2ZBR A;  3DRX A;  3UCU P;  1RP5 A;  1GX5 A;  1OO0 B;  1G1X A;  1UTA A;  4V1A k;  4TKT A;  3NNA A;  1AT1 B;  1RE1 B;  3M6V A;  2LQ9 A;  2E1A A;  1YRU A;  1T8E A;  1S1T A;  3VGS A;  2XSF A;  1NDK A;  1X4B A;  1SL1 A;  4B9U A;  1M90 T;  7FD1 A;  3AXM A;  2A2D A;  4DEZ A;  3E8O A;  3TZW A;  4WP3 A;  4CP5 A;  5F3T A;  3OTO F;  2YKP A;  1SJ1 A;  2G0C A;  4QIE A;  4EUV A;  1N34 J;  3BR8 A;  2E66 A;  2GZO A;  3KJV B;  1T9X A;  3SCJ E;  5IT9 Y;  2OI2 A;  2DGT A;  1HKA A;  4L73 A;  2XWY A;  1NJY A;  4B3O A;  2KT2 A;  1PJ7 A;  2HMI A;  4OHY A;  4EO6 A;  2NYI A;  2VDI A;  1RT2 A;  5J2M A;  2X1A A;  2PSZ A;  3I4P A;  1JKH B;  3D4J A;  4YP3 A;  1PYT A;  1CS4 A;  1HD0 A;  3CD6 S;  2E5H A;  3HSZ A;  3TNV A;  4DN0 A;  3MMC B;  3BYR A;  2JC1 A;  3OW2 R;  3MM7 B;  3P3D A;  2FVP A;  1G2E A;  4O0N A;  2GHP A;  3UVJ B;  2JLE A;  1XJW B;  4WFY A;  4MH8 A;  3N9U C;  2Z2L A;  2NZ4 A;  3TAN A;  1NCL A;  2Z2M A;  1XIQ A;  1T7P A;  4C8O A;  2QMX A;  1VQN S;  1FJC A;  4C8K A;  3BSC A;  4DUZ F;  3UDE A;  5H9F K;  4OYW A;  1VQM S;  2XY5 A;  2YH1 A;  3EDR B;  3IBF B;  3PX0 A;  2GMH A;  2LEA A;  3I9V 9;  1JIH A;  1HWL A;  3M2U B;  2KYZ A;  3MOJ B;  1LWC B;  2DNH A;  3T9Z A;  1X4G A;  3KJV A;  4PWW A;  3V6J A;  2O66 A;  1ITP A;  2IDL A;  4LF9 J;  2P6S A;  4W98 A;  3TAM B;  2DNQ A;  5CHC B;  1YJV A;  3NNH A;  5LJ5 Y;  2CKW A;  1JKH A;  2OSR A;  4DPU A;  4XO0 A;  3BGO P;  2C1E B;  1HW9 A;  2QZ8 A;  2LP4 A;  3MMC A;  4J7C A;  3MM7 A;  2UUC J;  4EEY A;  1TUW A;  3UVJ A;  4P10 A;  5HVH A;  5KFV A;  1OYD A;  2FZK B;  1K0V A;  3OL8 A;  4LT6 A;  4IH7 A;  3CCR S;  4M94 A;  1HBU B;  1SJQ A;  5F41 A;  4TN2 A;  1PAU B;  2CZ9 A;  2R8H A;  2OLW A;  3N28 A;  1X4F A;  1Y3K A;  5D0H A;  1CQN A;  3TUJ C;  1X5S A;  3BSN A;  2BOP A;  2WSE C;  1EET B;  1JNR B;  2VFT A;  2NSC A;  3CCE S;  2ZC4 A;  1QAX A;  2F3J A;  4DFK A;  3LPY A;  5DET A;  2IRU A;  5LSR A;  4ECQ A;  4DFJ A;  1RT1 B;  4DUY F;  3X1L B;  3M2U A;  1LWC A;  4FS2 A;  2E7W A;  3B78 A;  2DCU B;  3H5U A;  1VLO A;  4ZMM A;  2J8S A;  1RAH B;  4X4T A;  2M5Y A;  3PDN A;  3Q8V A;  3ZZZ A;  3TAM A;  4LF6 F;  3OJS A;  2XI2 A;  5DM7 Q;  2JEI A;  2V8H A;  3MD3 A;  2HGM A;  3TAQ A;  4DL7 A;  2DIT A;  1TQL A;  1L3K A;  3G6E S;  4KYZ A;  2LQ5 A;  4K2J A;  3N5F A;  1X8D A;  2ASJ A;  2CUY A;  4X2B A;  4G1P A;  4DQQ A;  2D74 B;  3GIL A;  2AGO A;  4ZS6 A;  2HLU A;  2CPD A;  3TO8 A;  3W9J A;  1HNZ J;  1HBU A;  4RL1 A;  3BGF A;  4PPZ A;  3HFV A;  3C8Y A;  4PG5 A;  4WII A;  2VG7 B;  4ZCI A;  1VBX A;  3MM8 B;  4OX9 J;  1EET A;  4A8W A;  4ILL A;  4JI4 J;  2V5H G;  1NB7 A;  3M8S A;  2E7V A;  3BPS P;  4H4K C;  3RAM A;  1RT1 A;  3IC1 A;  4NZ0 A;  4DSK A;  4W92 B;  1PO6 A;  1KTQ A;  3MDF A;  4I69 A;  4NAS A;  4CLU A;  4FYW B;  1M5S A;  2HND B;  1HWU A;  4Q7A A;  4TY8 B;  2B4U A;  3ETO A;  3MHY A;  2B56 A;  2DHS A;  1IJE B;  3CSK A;  3W65 A;  3QRQ A;  2WBM A;  3QRR A;  4NLW A;  4DBQ A;  1Q53 A;  4B9S A;  2QA4 G;  4Y2A A;  3PRV A;  1XNQ F;  1WG4 A;  2LEC A;  3NKY A;  1RT6 B;  2DD8 S;  4ENO A;  3QFW A;  2QGF B;  5B0F A;  2FPH X;  2H51 B;  5D77 A;  1H98 A;  4KFB B;  2OFH X;  1E6Y A;  5FD1 A;  2IVM A;  1RB0 A;  2MEW A;  1S79 A;  4DDF A;  3OTB A;  1CSJ A;  1NJW A;  1MG7 A;  1TK8 A;  2ZBC A;  3FBC A;  1KVK A;  4OI1 A;  5C42 B;  3MM8 A;  4N47 A;  4KC5 A;  2K7J A;  4IFV B;  3BZQ A;  5HMZ A;  2IY5 B;  1H73 A;  1UZH A;  4UQT A;  3Q83 A;  5CAA A;  2BMB A;  3D67 A;  1WC0 A;  2HZV A;  3KLI B;  2H65 B;  1XR6 A;  4Y34 A;  3G8T A;  4X62 J;  1FT8 A;  1NB2 A;  1WOO A;  1EP4 B;  4NLP A;  4ZVS B;  3C14 B;  2UU9 J;  1FFW B;  2HGL A;  2ZBI A;  4X64 J;  2IYI A;  4KKO B;  3P8B B;  2NXN A;  1NUE A;  3PZP A;  5DDQ C;  3V6D B;  2M0G B;  3AXK A;  5EGY A;  5DG7 A;  2FGO A;  1BY9 A;  2Y8W A;  3CDE A;  3OFF A;  1JLF B;  1Y9O A;  4AE5 A;  1NJX A;  4C8L A;  3BRE A;  1MMN A;  1RT6 A;  3MCO A;  2RUS A;  1T05 B;  5F8H A;  1FXR A;  2MJU A;  4KFB A;  2HQC A;  4UZB A;  4Y2M A;  2MMY A;  3G86 A;  2ACY A;  4DR2 F;  3WX8 A;  4L74 A;  1L3S A;  4QIG A;  5L38 A;  2Z2Y B;  5C42 A;  4FNI A;  1UVJ A;  4RUC A;  4IFV A;  2N4D A;  2OPR B;  4OV6 A;  1VRT A;  2MZS A;  2K06 A;  4J5O A;  4ZJL A;  3PW0 A;  1XBW A;  4ETZ A;  1T3N A;  3PXG a;  3G9C A;  2D3Z A;  1PAE X;  1EP4 A;  2V4Q A;  3C14 A;  2MQN A;  2RB7 A;  1U02 A;  4C0O C;  3FMB A;  3TZZ A;  4V19 J;  4AND A;  4YDD B;  3CGI A;  5IFM A;  2F1F A;  2V9K A;  1YK9 A;  4HH1 A;  5KG0 A;  4QQB A;  3V6D A;  3CED A;  4OHW A;  3NGD A;  2UXB F;  3PNI A;  4DSE A;  2ATC B;  3DOM B;  1JLF A;  4EBC A;  4AUK A;  4ZP6 A;  2HQI A;  3Q22 A;  1VQO S;  1TKT B;  3GYG A;  2XS7 A;  1LKZ A;  3H98 A;  3NGK A;  3TQ1 A;  1RBL A;  3UN5 A;  4ZA1 A;  5D4N A;  5U47 A;  2C22 A;  1NXI A;  1HHQ A;  3OVB A;  3MPY A;  3KMS A;  2R7T A;  1RKI A;  4QOT A;  4DPT A;  4NYZ A;  1EAY C;  1KLN A;  3EX7 B;  1GX6 A;  4WK3 A;  1N0V C;  3OLA A;  1IQZ A;  2OPR A;  2LQB A;  1QSS A;  1XR5 A;  2HQG A;  2VQE F;  4DSF A;  4TLQ A;  4CWB A;  1RSC A;  2BE2 B;  2XCA A;  1S97 A;  3MD1 A;  4P74 A;  1HQE B;  2V6A A;  4JUZ A;  2FC9 A;  1H3D A;  3AA8 A;  1WKJ A;  2QTW A;  6FDR A;  2CVI A;  1J5E F;  4FZV A;  4N5S A;  3H5S A;  3V6K A;  3A12 A;  2XEX A;  2V63 A;  4M5J A;  1SKS A;  3CCL S;  3B4D A;  1NJI T;  2C2K B;  5LT5 A;  4O3N A;  4FVC A;  4DV1 F;  4I56 A;  2E1R A;  3TWZ A;  2HW3 A;  1NSP A;  5JMN A;  3OVS A;  3DOM A;  3SZ2 A;  2FC8 A;  5KFI A;  4J9K A;  4K8R A;  2ZJR Q;  5ITH A;  4WFA Q;  2ZNY A;  1TKT A;  4M5H A;  3CJQ A;  1X0P A;  1IBC B;  1HI1 A;  2YTC A;  3L95 X;  2DY1 A;  2MHN A;  4OHX A;  3SYZ A;  5KFW A;  4YHH F;  2MKS A;  1BWE A;  1PC4 A;  3VGT A;  1IBM J;  4ZVR B;  1N5Y B;  2MQ8 A;  1S1V B;  3QBC A;  4YDX A;  3PY8 A;  4MKY A;  4QR0 A;  1NK8 A;  5D15 A;  2OPP B;  4WE1 B;  3BS9 A;  1S10 A;  2CQ0 A;  3SFU A;  3GFZ A;  4KGK A;  3TOQ A;  2AQ4 A;  1F6T A;  1CG2 A;  2J0Q D;  4LR8 A;  2VON A;  2MHE A;  1HIY A;  3R5A A;  2QYC A;  2GAH C;  2E29 A;  1FD2 A;  1CVJ A;  2BE2 A;  1HQE A;  3OR1 B;  2FYX A;  2PT0 A;  3OSP A;  2ZHB A;  2OH2 A;  5B0B A;  1DBD A;  4HR2 A;  2CQ4 A;  4DR4 F;  2V50 A;  4TQR A;  3PO4 A;  2YWE A;  3MEE B;  3CDW A;  3MWB A;  1KD1 T;  5MAO A;  1BWV A;  5E33 A;  3DLJ A;  2A6O A;  2MQL A;  5KG7 A;  1U1P A;  5KG1 A;  2R8J A;  2EBE A;  3KNA A;  1AA1 B;  3HT0 A;  4P7T A;  3AOD A;  3H90 A;  3BO3 A;  1IR0 A;  2B6A B;  4RR5 A;  1VS3 A;  2AX0 A;  5KFE A;  4JYA F;  2I1R A;  5G0R B;  2MXY A;  4J9O A;  1K47 A;  1N5Y A;  4F02 A;  1Z4U A;  3ITH B;  4OZJ A;  1S1V A;  1RTH B;  1C0U B;  2OP5 A;  2PA3 A;  5CD4 H;  1WC4 A;  1T9Y A;  5ETM A;  2WW8 A;  2G4B A;  2YWW A;  5FII A;  2M8D B;  2OPP A;  4WE1 A;  4JP8 A;  1VQ4 S;  2B3T B;  3SXL A;  4W4M A;  2MZ1 A;  4KBI A;  3JYT B;  2OMO A;  2QYG A;  4KH1 B;  1VHI A;  3B82 A;  3BF4 A;  1T9T A;  2UVU A;  1TZ0 A;  4GKJ J;  4LBH A;  3RAX A;  4O4G A;  2Y1I A;  3CE8 A;  3OR1 A;  2ZH7 A;  3IR6 B;  1UJ5 A;  3KUH A;  4JV1 A;  2IM3 A;  4YY3 J;  5ETQ A;  4OJ1 A;  2KJW A;  2RU3 A;  1B0V A;  2H5E A;  2J6T A;  5KFS A;  1B0P A;  2BJD A;  1WTB A;  2VAS A;  1IQT A;  2VA2 A;  2HZC A;  3ENW A;  2XGP A;  3H5Y A;  3LAL A;  3MEE A;  1FF2 A;  3DLB A;  4OYX A;  4RWW A;  4C9D A;  3OL9 A;  4GC7 A;  5HVF A;  3NS5 A;  2BE7 D;  3GR0 A;  5KTQ A;  2AWZ A;  2DO0 A;  2PN6 A;  4J9P A;  2B6A A;  4J9V A;  2DR7 A;  2KZZ A;  2AJQ A;  2EFV A;  4M63 A;  3IAS 9;  5G0R A;  4CRJ A;  3ONQ A;  1ZPV A;  3ITH A;  4DU7 A;  1RTH A;  1C0U A;  4WPA A;  3NG8 A;  3IMQ J;  1XMQ J;  2DH8 A;  3P96 A;  2DXF A;  4CM0 A;  3PAC A;  2AJ2 A;  4OYB A;  2J0S D;  1F1B B;  3MI7 X;  2XMM A;  4EZ6 A;  2AT1 B;  5A76 A;  3FCW A;  1PBU A;  3JYT A;  2N7C A;  3QNW B;  4PQU B;  1VC0 A;  3ZFV A;  3C2P A;  2GHW A;  1Y5N B;  4NLO A;  2CYY A;  4QJV A;  2E9R X;  1HBO B;  1J5O B;  1Y3J A;  3HVW A;  4RW9 B;  3KG4 A;  3QGP A;  2DGS A;  4YB5 A;  2ZFH A;  2V68 A;  4BWM A;  3OLB A;  1K9M T;  4DR1 F;  1WOS A;  4LF8 F;  4ID8 A;  1Q7L B;  2K2P A;  5CQG A;  1EQM A;  9ATC B;  3QAU A;  1HWK A;  4NEZ A;  4LFC J;  2HHU A;  5J1E B;  1QSY A;  2PC6 A;  4C0H A;  3UDL A;  1YIJ S;  3ULH A;  1HL6 A;  2YVS A;  2Y0B B;  2FHJ A;  4RNM A;  3P5T L;  3UN2 A;  3TW0 A;  1JJ4 A;  1FJG J;  2ZH1 A;  3T1H F;  1ZET A;  3P4U B;  3ZZ0 A;  2DVI A;  1WI8 A;  1T0T V;  2NXJ A;  1HHS A;  2YQ3 A;  3OL6 A;  2EEY A;  5D4O A;  4ZLJ A;  4IFY B;  1WHV A;  5JVH Q;  1KP6 A;  2R8K A;  5AE1 A;  4OL8 A;  4B9T A;  4P52 A;  4RNO A;  4AFF A;  2H3E B;  4DV3 F;  3MZI A;  4LF5 F;  3B6B A;  2YWG A;  1H2U X;  5HAT A;  1FEE A;  2WHO A;  2IHR 1;  4Z7C A;  4PQU A;  1QD1 A;  2RDD A;  1RWV B;  1NDL A;  2WBR A;  3A3O B;  4K2X A;  1HBO A;  1J5O A;  4RW9 A;  4B17 A;  1V3R A;  3ZZU A;  2GA7 A;  5JJB A;  2LEB A;  3BGL A;  1SC4 B;  2VIH A;  3FMW A;  4CO0 A;  2XYH B;  5HLF B;  3EMT A;  4WK1 A;  1F5A A;  3DMJ B;  2V67 A;  3W7B A;  5KFG A;  2HEK A;  3V2U C;  3FJ2 A;  4IOB A;  5J1E A;  4FYX B;  3IWL A;  2HIY A;  5THW A;  3Q2S C;  5KFR A;  2OEJ A;  4F3Q A;  4C3L A;  2ZZN A;  3AH6 A;  4KRW A;  1O51 A;  1NZA A;  1NND A;  4OZ3 A;  4XDD A;  2JRS A;  4FPR A;  2C3O A;  3LF0 A;  4X4S A;  3BB5 A;  2ASY A;  2RAQ A;  4IG0 B;  4IFY A;  3VTI A;  5J2Q B;  3AT1 B;  2BAN B;  2D3U A;  4F0M A;  1WKL A;  3DLE B;  3P5B P;  4U7U K;  3KJQ B;  2H48 B;  2FZG B;  1ZA2 B;  2CPY A;  1FVQ A;  4DU8 A;  2D41 A;  4I68 A;  4JI2 J;  3OD2 A;  2IA0 A;  2KVI A;  4F8R A;  2HBZ B;  4PXC A;  1EKS A;  3HLU A;  3EZO A;  3ZTR A;  1NPR A;  2ADC A;  3Q24 A;  3J7A N;  3TR5 A;  3T3F A;  2VFS A;  1UP1 A;  4DWI A;  3GIK A;  2LFV A;  4HLB A;  4OLO A;  5CXT A;  1QY7 A;  3NEK A;  3DRP B;  5HLF A;  4CO5 A;  4NXN J;  4DPW A;  5F0W A;  3DMJ A;  2A10 A;  3GIR A;  4UW2 A;  1RWO B;  2B9E A;  2FHO B;  2VF3 A;  3HMJ G;  1NK5 A;  3NCP A;  2MZR A;  1FK9 B;  4LF9 F;  3SEO A;  1SKW A;  3TA2 A;  2IA6 A;  2CPJ A;  2ROE A;  1MSW D;  5BR8 J;  1R0A A;  2Z2Z A;  4RKU C;  2CJX B;  2RQK A;  4B9L A;  2Z56 B;  4IG0 A;  5J2Q A;  4HT7 A;  4Y28 C;  4C3K A;  3DLE A;  5CYQ B;  4Z7Y A;  2JJ4 D;  2DNR A;  5KFQ A;  1R8P A;  5LXY A;  4CH1 A;  2I2Y A;  3KJN B;  3PM9 A;  2UUC F;  1FCA A;  4ECR A;  5E3Q A;  2J9C A;  4RU2 A;  4DOZ A;  4DUT A;  4DR3 F;  1WSV A;  4W90 B;  1NO8 A;  4UOC A;  4QW8 A;  2RIL A;  4EYH B;  3CC2 S;  1WUU A;  3BKF A;  2G1D A;  1YG0 A;  2D9P A;  3LP0 B;  1YWX A;  5KG4 A;  1NSK L;  2AW0 A;  3CCT A;  1FA0 A;  3DRP A;  3R7B B;  4CLL A;  4PZV A;  4H4M B;  2K3K A;  1LQ9 A;  2M3D A;  2E5G A;  5J1N A;  1RLD A;  3LTO A;  3RR7 A;  2JSX A;  4QYR A;  2BM1 A;  2KXF A;  4PPD A;  4J90 A;  3PW4 A;  2VBX A;  2BQR A;  1ZTT A;  3G2X A;  2Y3Y A;  1FK9 A;  2IYG A;  3I32 A;  3OFE A;  3TUI C;  1NSA A;  2MLX A;  4HDG A;  2CRL A;  1UPM B;  3UDC A;  4OJG A;  4NI2 B;  1P27 B;  1ICE B;  1A0O B;  2CVE A;  4QR2 A;  3BDP A;  1IKY B;  4ZVG A;  3WBZ A;  5CYQ A;  3C46 A;  4DPY A;  2OGU A;  1IWA A;  4WFZ A;  3SQG B;  2DGU A;  1S99 A;  3W3S A;  3HZE A;  2BJ1 A;  4KTQ A;  2VU5 A;  5A8R B;  1HNZ F;  1HI0 P;  1FKA F;  3IXQ A;  2BAB A;  1XTZ A;  3HD1 A;  2ZDO A;  1JMT A;  2ZKU A;  1UW4 A;  4YFU A;  3LP0 A;  2Y9H A;  4OX9 F;  1S48 A;  3L7P A;  1SKU B;  2Z8Q A;  2BEF A;  4C97 A;  1KFD A;  3W5X A;  4H4M A;  4JI4 F;  2JLF A;  1YTY A;  2GO8 A;  2CQC A;  1RHU B;  2VV5 A;  4UTG A;  4LSN B;  4IH5 A;  4WU3 A;  2EPI A;  3UD5 A;  2QL5 B;  1Q81 T;  3DLL Q;  2L9W A;  1X7V A;  2HKE A;  2HHX A;  4K4T A;  1X4C A;  3EXY A;  1S0M A;  5IV3 A;  4J37 A;  4NI2 A;  3V4M A;  3GR1 A;  4USH A;  1SJR A;  1ULR A;  2B4V A;  1YQH A;  3LAN A;  5KFJ A;  1IKY A;  3A4T A;  4RPF A;  4ED6 A;  3BN7 A;  1SJ3 P;  3SQG A;  1S9E B;  1BHN A;  5A8R A;  1VBY A;  1RTZ A;  2GIQ A;  2VG6 B;  3EZU A;  3J81 U;  2IPO B;  3VZI A;  1R8H A;  4QWA A;  4C2M A;  2VBW A;  4D3H A;  1EAR A;  2RDJ A;  4ELV A;  2NSB A;  3OUY B;  2JX2 A;  2FJV A;  1UET A;  1RYS A;  1URN A;  2AJ0 A;  3R97 A;  4USJ C;  3A1Y G;  4X62 F;  2ERR A;  5DDO C;  4RW6 B;  4CIO A;  2I38 A;  3PYE A;  3T5J A;  1JLA B;  1F0X A;  3HVA A;  4ZPD A;  4IRC A;  5KFH A;  4IO9 Q;  4X64 F;  3Q89 A;  3GSD A;  4YB6 A;  1JXE A;  1KBR A;  3M8Q B;  2P9C A;  1U09 A;  1H38 A;  5D4P A;  3H4D A;  4AL5 A;  2MJN A;  4FKX A;  1NEE A;  2MKK A;  4OZ2 A;  2DR6 A;  5E0O A;  1SJ4 P;  1YJR A;  3R6L B;  4NZ6 A;  3EYZ A;  4FF4 A;  5AE2 A;  2KTQ A;  1XNR J;  1N32 F;  1UW9 A;  1UWA A;  3LOU A;  4KQZ A;  2XO6 A;  4U67 Q;  2LDY A;  1ACM B;  5HN0 A;  4DSJ A;  2VOO A;  1S1W B;  1JK9 B;  4LIR A;  4KGM A;  1S9E A;  1VBK A;  2R3V A;  5GAE I;  2CPZ A;  4ZLN A;  2VG6 A;  4NOH A;  1QAI A;  1M5K C;  3K57 A;  2CJ9 A;  4DCP B;  3MF5 A;  2E1P A;  2YKN B;  1HNW F;  2R2R A;  4ZP8 A;  5GAE U;  2IIH A;  3CIM A;  2LA4 A;  3OUY A;  1R27 B;  3GSI A;  4DSL A;  1NM2 A;  1DRZ A;  1N36 J;  1BQN B;  3S6E A;  2HAI A;  4RW6 A;  4DV0 J;  1QDU B;  3G71 S;  3OSN A;  1JLA A;  1OY8 A;  1QVG R;  3K58 A;  4I2Q B;  2E44 A;  1Q8B A;  3J7A 1;  1RJJ A;  2FVQ A;  2OD4 A;  3I0S A;  4H4O B;  3M9O B;  3M8Q A;  4V19 X;  2W7O A;  2BW7 A;  5KFM A;  1YZ6 A;  1LW0 B;  2VJU A;  2J5A A;  2O3D A;  3E51 A;  3DRS B;  2OEL A;  1G3O A;  1N5S A;  4RJV A;  1DQ9 A;  3IM9 A;  3MUR P;  1Q8K A;  2BJ9 A;  5ETO A;  5LMN J;  3FC9 A;  4CLW A;  3L7O A;  3GZ7 A;  5A0Y B;  3K5M A;  5FLX U;  4X66 F;  1RHJ B;  4DZD A;  4PQA A;  1S1W A;  3KYL A;  3HP6 A;  1QLN A;  1FNX H;  4DF4 A;  4DMZ A;  2LMI A;  1WOR A;  4DHV A;  1TL7 B;  3U7J A;  1EB0 A;  5HK4 A;  4KR0 B;  1X4H A;  2YKN A;  3PX6 A;  1U47 A;  3SSQ A;  3LQV A;  1U1N A;  3CJT A;  5J1P A;  2ZJP Q;  1RWK B;  4QBU A;  1VFJ A;  2VH7 A;  2W4C A;  1BQN A;  4ZJO A;  3GFX A;  3MFH A;  1JJ2 R;  4ELU A;  4BDP A;  5T7L B;  3QJP A;  2C2E A;  5KFT A;  5HMY A;  3M8R A;  2PI4 A;  4WTO B;  1QE1 B;  1FFG B;  4LFB J;  3L09 A;  4I2Q A;  1ZM9 A;  2QRR A;  1NDP A;  1YIT S;  2AZ1 A;  4A8O A;  2VFV A;  4H4O A;  5KT4 A;  4I6Y A;  2VPX B;  1RTI B;  3CJ8 A;  3HKZ D;  1Q16 B;  5AXN A;  1LW0 A;  2RQ4 A;  2EFN A;  3DRS A;  4ES2 A;  5LMU J;  4R8U B;  1UWB B;  5LJ3 Y;  2JLG A;  1OY9 A;  4DS5 A;  4FXW A;  2XY7 A;  4MIA A;  4RW7 B;  2ZHA A;  1RBA A;  2BJ3 A;  4QIV A;  3UQS A;  1UKU A;  2JHE A;  2N3L A;  3PEH A;  3HHL D;  4YN3 B;  1IBM F;  2KG1 A;  3V81 B;  2DHG A;  4ED2 A;  2CPF A;  3HX9 A;  1K0T A;  3TVZ A;  1X5T A;  4O3Q A;  1TL7 A;  2QIF A;  2A18 A;  3DGP B;  3OFH A;  2KXN B;  2KH9 A;  3KLE B;  4BC7 A;  4CT9 A;  4C8Y A;  5ETK A;  3IRW P;  1WHX A;  3OBI A;  3FBF A;  1S7I A;  4JI5 J;  1Y4Z B;  4PAA A;  1CPZ A;  4F3O A;  3PYG A;  5T7L A;  4KJI A;  2BX6 A;  2GNK A;  3M32 B;  2HWT A;  1QE1 A;  4ER8 A;  1RZM A;  4JI7 J;  2HHP A;  4ZIV A;  1FX2 A;  2OAU A;  2WCX A;  1FRH A;  1B4S A;  4FXD A;  1UFK A;  3JQJ A;  3OHB A;  2HVH A;  1RTI A;  3D6M B;  2WVB A;  2RUG A;  3HFZ B;  2MST A;  1NZ8 A;  7AT1 B;  3CCU S;  4IO1 A;  2YQ0 A;  4R8U A;  3AOB A;  1UWB A;  2V0N A;  3UR3 C;  2HWI A;  4P2X A;  4RW7 A;  4WU2 A;  4RW4 B;  3TJ8 A;  3EPG A;  2OTJ S;  1KR4 A;  2AJ1 A;  4ZDN A;  2KXH A;  5KT6 A;  3V81 A;  2PGC A;  3BN4 A;  4RUH A;  5F3Z A;  3T1Y J;  1RAG B;  4LF7 J;  3QPI A;  3D1O A;  4OI6 A;  2VD3 A;  3DGP A;  4TU8 A;  1RAD B;  2WW4 A;  3KLE A;  4B08 A;  4ZKA A;  3BO4 A;  4P2F A;  2GJI A;  1M1H A;  4DFM A;  1VQ8 S;  1Q82 T;  3Q8R B;  2BRL A;  1S76 D;  2CDR B;  4WYL A;  2DNK A;  1EQ0 A;  3CIZ A;  5ETR A;  3AOA A;  4WWS A;  3KHG A;  3CME S;  4EWT A;  5AXK A;  3UDV A;  3M32 A;  1DTT B;  5KFO A;  5D8H B;  1FJ7 A;  1D3W A;  3HCX A;  3BQ0 A;  4IRD A;  2XM3 A;  5A6P A;  3PW7 A;  3M6X A;  1XMO J;  1U1K A;  5DGB A;  3CCV S;  1TK5 A;  4Q2L A;  1RWX B;  2HS4 A;  4KGZ B;  2HBY B;  4NRU A;  3QRP A;  1AZS B;  2CFX A;  1Q4R A;  2FTR A;  5AJ3 J;  4B3R J;  3TI0 A;  4X4N A;  1SIW B;  3S7R A;  2DNZ A;  5D0G A;  4P71 A;  4Q45 A;  1HNX F;  1TL4 A;  1T9V A;  3NLC A;  4OZN A;  4EBE A;  4QYZ J;  2BUN A;  1VQK S;  4ZPA A;  1XMQ F;  1TMJ A;  2BE9 B;  2J0W A;  3GG0 A;  2LXI A;  5DM6 Q;  5T14 A;  4K4S A;  2FJB B;  4ID5 B;  5I3P A;  2AEM A;  5LL6 d;  4U8Y A;  4IQM A;  4C48 A;  4NCA A;  1HD1 A;  4DXL A;  1RAE B;  2CZ4 A;  4MK7 A;  2MQM A;  1ARO P;  1H7X A;  1U6Z A;  4B9V A;  3HFK A;  2YNI B;  3DU5 A;  4TY9 A;  5IC4 B;  1RT4 A;  3PRB A;  2VQF J;  1DTT A;  2XNQ A;  1PSD A;  1RK8 A;  2N82 B;  1YI2 S;  4DFP A;  3CDA A;  3BDE A;  2C3M A;  1RHQ B;  1V5V A;  2K7K A;  2AIR B;  4A47 A;  2XUL A;  2GCF A;  4LFC F;  2NYH A;  3C19 A;  1CC7 A;  2QEX S;  3JTO A;  1FRM A;  4ECY A;  2BR0 A;  1NK6 A;  3BEG B;  1AZS A;  1L3V A;  3HF5 A;  3OTC A;  5L9N A;  5KOW A;  1H74 A;  4D3G A;  5C2G A;  4DR5 F;  3NOG A;  2LDI A;  1RU1 A;  3R1H A;  3GII A;  2QA1 A;  1FKO B;  1D0E A;  2YNF B;  3RRK A;  2MTL A;  3M30 B;  2MQO A;  4ALZ A;  4F04 B;  2NXC A;  1FX4 A;  2UV8 A;  5GMD A;  4IDK B;  2CAJ A;  3R5G A;  3N5B A;  1KNZ A;  1JJC B;  2KRR A;  4O44 B;  1QUV A;  1HLW A;  3EDQ B;  3GB0 A;  3MXH P;  3UPF A;  3M8Z A;  4AL6 A;  2VDH A;  4ID5 A;  3S1T A;  6FD1 A;  2YWH A;  4CLP A;  2XWX A;  4ILM A;  1JXL A;  2R8G A;  3Q8S B;  3OXL A;  1P8G A;  1UVL A;  4CI0 B;  3W63 A;  3PJ9 A;  1P9Y A;  3SSR A;  2CNO B;  2OEK A;  1UVI A;  2YNI A;  1FNO A;  2QC3 A;  2LQJ A;  2DT9 A;  1PYO B;  5KT2 A;  4CO2 A;  1O6X A;  1S59 A;  1ZPW X;  2BOA A;  4LSZ B;  4PKD B;  4J9U E;  2R7X A;  3IGN A;  2D3O 1;  2PI5 A;  2L9N A;  3EGN A;  2KB2 A;  2B8P A;  2KYX A;  5C5J A;  2HWH A;  1U2F A;  1T02 A;  1KEK A;  2QFI A;  4M5D B;  1ELO A;  2ZD1 B;  2UVR A;  5KFD A;  3CCJ S;  2AHO B;  2P9E A;  5F8M A;  2FIU A;  2ZZM A;  3CB4 A;  2FHJ D;  1RT7 B;  1FKO A;  5IOL A;  2YNF A;  1T95 A;  1YJN S;  3M30 A;  2IJR A;  1T94 A;  2D1C A;  1KOH A;  3QT6 A;  1R8C A;  4N76 A;  2XMJ A;  2JNJ A;  1OWX A;  1TL3 B;  4IDK A;  3Q86 A;  3BPD A;  1REV B;  3OHA A;  2CJA A;  1YJ9 S;  1YRX A;  3D0G E;  4IKA A;  4O44 A;  3UCZ P;  4Z37 A;  1H6K X;  3AY0 A;  4USW A;  3CMA S;  4HHU A;  2GQ2 A;  1D9A A;  1WF0 A;  3PJW A;  4LF2 A;  1VK3 A;  2M8H A;  3US5 A;  3FUY A;  2A2C A;  2OPQ B;  1RBO B;  5HJX A;  1GTE A;  1EZZ B;  4TNO A;  2CWX A;  5F0U A;  4C8Z A;  1MWZ A;  2HK3 A;  4GC6 A;  2HUR A;  4NXN F;  4N77 A;  3DLH A;  2HQF A;  4L3K A;  1JB0 C;  4E0D A;  2ZIT A;  1ZZF A;  2J9D E;  1OIA A;  4Y6I A;  2ZOF A;  3EVW A;  1U1O A;  3GYN A;  5K8O A;  3BJY A;  2H4Y B;  2XS2 A;  3NCR A;  1WC1 A;  4WJB A;  4M5D A;  1VMB A;  2ZD1 A;  2CAD A;  5DQH A;  1BGX T;  4WP9 A;  3O3L A;  3UNG C;  2WB4 A;  1PYS B;  3NMR A;  3D6T B;  1RT7 A;  3AD7 C;  2BA9 A;  2P2C B;  5BR8 F;  3CJ4 A;  3MPV A;  3FKB A;  1WG1 A;  3KFW X;  2UV8 G;  4ZVH A;  2HNY B;  3JS9 A;  3TYT A;  1TL3 A;  4DL2 A;  2LYV A;  4NLQ A;  3CCZ A;  1REV A;  5E7O B;  3EIC A;  2LA6 A;  1PBA A;  4L3N A;  2ASL A;  4CNY A;  1ZS6 A;  5F9L A;  1TAU A;  2PDA A;  3ILO A;  1S4F A;  4U7U D;  2QL9 B;  1PIL A;  2ZH4 A;  4I6W A;  1SL2 A;  3CCQ S;  2J7U A;  2DR8 A;  1Q79 A;  2GVZ A;  4A8F A;  1VQ6 S;  3UFC X;  3SCK E;  2YY3 A;  5HBM B;  4C98 A;  2CQD A;  3FEY B;  2AX1 A;  3MR3 A;  3OTO J;  3J81 j;  1SKR A;  3CCW A;  4DLG A;  3UWT A;  3SCI E;  1FRL A;  2OPQ A;  2E5L J;  2UP1 A;  3Q2T C;  1TFY A;  1U48 A;  4FDF A;  4WFX A;  1WEL A;  3G4S S;  1CJU B;  1QTN B;  5CYM B;  4N8N A;  3QGG A;  1KHW A;  4LRA A;  4B3T J;  1WD6 A;  4UST A;  2AKW B;  3D6F B;  5K14 B;  2LU2 A;  3I56 S;  4MYT A;  4B9N A;  1N54 B;  3DHW C;  2AF6 A;  1VQL S;  2M70 A;  2HBQ B;  4Q43 A;  1FRI A;  4KGX B;  1B70 B;  5FDL B;  1UFL A;  2DNP A;  2ZE2 B;  4ZN1 A;  3GTY X;  3U1N A;  2W7P A;  4NLY A;  4L76 A;  3J80 U;  1LWE B;  2BXJ A;  4JI0 J;  1VC5 A;  4LR9 A;  4Y3C A;  2ZH6 A;  2HNY A;  4FBT A;  3OV7 A;  3H42 A;  3LP2 B;  2YKQ A;  3HM9 A;  3W60 A;  1SJF A;  3VHQ A;  5DRK A;  1S4E A;  3QJJ A;  4DV4 J;  3RG6 A;  1WNE A;  1P1L A;  2EC0 A;  3FZ2 A;  3M8W A;  4ZCK A;  3CJR A;  4DUZ J;  4OHV A;  2VL1 A;  2DGO A;  4ILR A;  2AYG A;  1V5I B;  2DRD A;  3DLG B;  1HR0 F;  1X0F A;  1B64 A;  2PO4 A;  4DLE A;  3K5O A;  2UUA J;  1NJZ A;  5HBM A;  2QJ3 A;  2GMJ A;  4IOA Q;  4QCL A;  1SBR A;  3IP0 A;  1PGZ A;  1NH8 A;  2QT7 A;  1JLE B;  1YHQ S;  3LP1 B;  3LAK A;  1NK7 A;  4HT5 A;  3FRZ A;  3CD5 A;  3X3U A;  2IFX A;  3NRB A;  2PMW A;  1CJU A;  1UEV A;  5CYM A;  3IWN C;  3DDI A;  1VOM A;  2XGQ A;  2FUG 9;  1K1Q A;  3CDU A;  5K14 A;  2YX7 A;  5J2N B;  4WZM A;  1ZAW A;  1FKP B;  4LUB A;  2EWH A;  4WKR A;  4QIF A;  3PFO A;  3HSD A;  8ATC B;  4DX5 A;  2JEG A;  5FDL A;  4AYB D;  1MW7 A;  2ZE2 A;  3F44 A;  3PYF A;  1UEU A;  3GV8 B;  1RAJ A;  4BLG A;  2IDE A;  3NL0 A;  1LWE A;  1X4E A;  4DV5 J;  2WOM B;  3OT9 A;  1RTJ B;  3BBF A;  4TYA A;  3VAI A;  3LP2 A;  4F67 A;  1RAA B;  4CH0 S;  1QAY A;  2B7B B;  2WK4 A;  2CIM A;  5HJY A;  1DAX A;  1OPI A;  5BYQ A;  2CZV C;  1I5O B;  1M1K T;  1B3T A;  1F3F A;  1TR0 A;  3DLG A;  3KDN A;  4TLR A;  1RWN B;  3W1Y C;  4F25 A;  2W9B B;  5GMK a;  1I6J A;  4DUY J;  4LBP A;  3DGV A;  3LP1 A;  3R5J B;  3OXF A;  4ECW A;  3DXB A;  3ZNJ 1;  3H2L A;  3H20 A;  1I1G A;  3ZTP A;  2AV5 A;  2XLJ A;  2CNL B;  1O5J A;  1MN7 A;  4BWJ A;  1M5V C;  2CPE A;  3NXZ A;  4P2M A;  2FJX A;  1XR7 A;  5J2N A;  1GXT A;  3VCD A;  1H0H B;  2XG8 A;  1FKP A;  3MCM A;  4DCO B;  3TEH B;  5DQG A;  3D0H E;  2R7O A;  1QM9 A;  3GV5 B;  2JFD A;  4DQR A;  1GNK A;  3V6H A;  5E3R A;  1MU2 B;  3HHE A;  3MM5 B;  3DRY A;  1Y7P A;  1YBT A;  2HRU A;  3ADA C;  3IO1 A;  1BE4 A;  5SUH A;  1YJT A;  4CLF A;  2ZHO A;  1K1S A;  2ZEJ A;  3WHI A;  1EHW A;  1OJ4 A;  1UMJ A;  4XIU A;  2W8L A;  2WOM A;  1SH3 A;  2Q43 A;  2DTJ A;  1RTJ A;  3SCL E;  2MZJ A;  3N6M A;  1XNR F;  5LM7 E;  2OUG A;  2YX1 A;  2IBK A;  2NRE A;  1WF2 A;  4MK8 A;  8AT1 B;  2Y1R I;  4K7Q A;  2DEJ A;  3FCV A;  3TA1 A;  2QN6 B;  3CT9 A;  4A8M P;  4Q0B B;  1CLF A;  1JLG B;  2EK1 A;  3PFE A;  2XNR A;  3I31 A;  4CNZ A;  3PG9 A;  3HJV A;  3G6V A;  3VGV A;  4ES3 A;  1XWL A;  2W9B A;  3TP2 A;  4C8N A;  4B3M J;  2HHS A;  4CH7 A;  2J9E A;  1HYS B;  2KDO A;  3KTQ A;  2MQQ A;  4YS2 A;  4OJH A;  3LO3 A;  3VAL A;  3M9M B;  2DKO B;  3D28 A;  3W5Y A;  2KRB A;  1TKX B;  4NA3 A;  5IXU A;  1EIY B;  4DV0 F;  2KHC A;  5DG8 A;  4ECT A;  1RWU A;  4U8V A;  4EFA C;  1ZM4 A;  3CO0 P;  3WX4 A;  3KXD A;  4LRB A;  1NHU A;  1M5O C;  3FFI B;  1MU2 A;  2R2T A;  4M5I A;  2L9D A;  3MM5 A;  4BC9 A;  3DDK A;  1KC8 T;  4NMX A;  2ZVS A;  4LBI A;  1F3V A;  4X65 J;  1RXO B;  3NWG A;  5LSO A;  3O8W A;  2IJN A;  2F40 A;  1D8Z A;  4AT1 B;  4YOE A;  3D0I E;  4XDC A;  2NUH A;  3DU6 A;  1FVS A;  1KQG B;  4KSE B;  3OJU A;  1OS5 A;  4Q0B A;  1JLG A;  2J6U A;  4NML A;  1CJK B;  1HFE L;  1U8S A;  4QWC A;  4NLV A;  1VDH A;  1U1M A;  4LFA J;  2DRB A;  1CBK A;  4QU6 A;  3GJT B;  2CQG A;  3RU0 A;  4F36 A;  3W5Z A;  3HHD A;  1LWX A;  2ZBP A;  1BQX A;  3ZXW A;  1HYS A;  4I67 A;  4LJM A;  1H72 C;  2QMW A;  4DV2 F;  3PCO B;  2NXE A;  4DN9 A;  2HS3 A;  1DFD A;  1TKX A;  4Q44 A;  5L39 A;  2Z30 B;  5B0G A;  3VAF A;  1GQE A;  5E5N A;  3J80 Y;  2B9Y A;  3FSI A;  4O3S A;  4LFB F;  5LOQ A;  4G1Q B;  2HVE A;  2DK2 A;  3VAH A;  3BQ2 A;  3RGI A;  2AEJ A;  2OFG X;  2UUW A;  1IM4 A;  4IYQ A;  3RB0 A;  3FFI A;  2ZM6 J;  1LXN A;  3L9Z A;  1YBU A;  3CD0 A;  2J0X A;  4N8O A;  3I0R B;  4A8S A;  4ZVE A;  2CJK A;  5K20 B;  2EKN A;  2CQI A;  2KFY A;  3TJA A;  3QAT A;  4IR9 A;  3K17 A;  2VHG A;  2IMW P;  1KTV A;  3FVY A;  1FWP A;  4ICL B;  3GJQ B;  5M2U A;  3NBP B;  2VG7 A;  5KFF A;  3RB6 A;  4A8Q A;  4JOU A;  2XC9 A;  4Y65 A;  4CLS A;  3FEX B;  3M8Y A;  1B99 A;  3AAW B;  3MR2 A;  3GU0 A;  1CJK A;  2BAC A;  4NXM F;  3BGR B;  4OZL A;  3D3C J;  2R7W A;  1RIS A;  3ISN C;  1RGV A;  2CPH A;  2NQP A;  3OTE A;  4UUX A;  1WF1 A;  4DV6 J;  3N79 A;  1FEH A;  1VQS A;  4RUB A;  1AW0 A;  2QFJ A;  2HND A;  3KDO A;  1LWF B;  3MR5 A;  4TY8 A;  3JXO A;  2UXB J;  2EKY A;  2IVF B;  4DL5 A;  4G1Q A;  4JI7 F;  3C66 A;  3V4I B;  3W9I A;  1OPZ A;  2DY9 A;  2JZ5 A;  5EN1 A;  3HHL B;  2YQ1 A;  3I0R A;  4JV5 F;  3O2I A;  4K4Z A;  2QG9 B;  1HMV B;  3VZH A;  1JQG A;  1TUV A;  3D54 A;  5B0C A;  3NGT A;  2HFU A;  1S7H A;  4UOF A;  1NAQ A;  2CQ2 A;  4K0K J;  1WC5 A;  4C8M A;  1NHK L;  2XYG B;  2N4C A;  3EGV A;  1U0S A;  1FFS B;  4ICL A;  3MMJ A;  4ZHR B;  1VGY A;  3NBP A;  4NA2 A;  1RI7 A;  5K8M A;  2D9O A;  1RWM B;  5HAN A;  3DFE A;  2Z57 B;  3THV A;  1U1R A;  2K3I A;  4LF7 F;  3GIJ A;  3KLI A;  1CC8 A;  1GK8 A;  3BGR A;  3VAM A;  2YNH B;  2RD5 C;  3Q8P B;  2R2U A;  3UE2 A;  1F5C A;  4DX6 A;  4HYK A;  5K8P A;  1ZTW A;  1CQM A;  1VCT A;  1IXK A;  5B7W A;  1J5E J;  5M2P A;  4PWD B;  3M7V A;  5HAO A;  5EDW A;  3IRX B;  4KKO A;  4OX8 A;  1H2T Z;  4J9M A;  1LWF A;  3R3T A;  4FP9 A;  4OYA A;  1NK4 A;  4I0W A;  4DV1 J;  1JJH A;  5H9E J;  4PWU A;  2H9Z A;  1ZZN A;  2YWF A;  3V4I A;  2BKN A;  2VPZ B;  3OQ2 A;  2POK A;  4OX7 A;  2KM8 B;  5I3U B;  4LRD A;  4USM A;  3W9H A;  2B8Q A;  3HHL A;  2B4O A;  1X31 C;  4EK2 A;  1F2G A;  1TKD A;  1IBL F;  6AT1 B;  1TEL A;  1UAW A;  2RU9 A;  1HMV A;  1Y11 A;  2GIF A;  4ANC A;  3UD3 P;  1T05 A;  1FO1 A;  2HAF A;  4CO1 A;  2WON B;  3HXM A;  2DGX A;  5L1L A;  2IBO A;  4CLT A;  1FNM A;  3DOL B;  5KT7 A;  2MKC A;  1RHK B;  3AFG A;  1RHM B;  3CMQ A;  4I1T A;  3NMA A;  2HHW A;  3UN3 A;  1UVN A;  2HS0 A;  4JI6 J;  1RYR A;  3FEZ A;  1KS2 A;  3CJ3 A;  2R9L A;  3TZX A;  4LR7 A;  2I0X A;  3R7S B;  2YNH A;  4RW8 B;  3KHH A;  2VOD A;  3K7R A;  3DXS X;  4O3O A;  2XS5 A;  4OV1 A;  3VV2 B;  2NUU G;  1U24 A;  4PWD A;  3CXC R;  1VBZ A;  4DQS A;  8RUC A;  3IRX A;  3IR5 B;  1UJ6 A;  4L6V 3;  1R8A A;  3DOK B;  2RKI B;  1W2B R;  2VC1 A;  2FLO A;  1ZM3 A;  2IAJ B;  4KAI A;  2IC3 B;  3AB2 B;  3GP9 A;  3MEC B;  2XYP B;  3KKF A;  5IQ6 A;  2HIQ A;  2U1A A;  1WSR A;  4ZIT A;  3TAR A;  5I3U A;  3FDS A;  2COL A;  3RRH A;  1RQ0 A;  4JI8 F;  2CJY B;  2PMH A;  4NLU A;  3IWX A;  5K8N A;  4OZ1 A;  1CEZ A;  3HPO A;  2WON A;  2C2Z B;  3PHT A;  4HEA 9;  1HPZ B;  1KFS A;  3MPD A;  2YXL A;  3DOL A;  2QV6 A;  2V94 A;  2UVV A;  3M05 A;  3AD8 C;  2GML A;  4I7F B;  1FD8 A;  3HUL A;  3I55 S;  2DHA A;  3KK1 B;  1MWQ A;  1WKK A;  4GVL A;  1SC3 B;  4LIW A;  4RW8 A;  2DR5 A;  3THT A;  4WFB Q;  3VAG A;  2BW2 A;  2R8I A;  1D9F A;  3TJ9 A;  5CYJ A;  4XPE A;  3EXC X;  1TMM A;  4ZVT B;  2Q1L A;  1ZH5 A;  3ILL A;  3DOK A;  4DV7 F;  1FWL A;  3DDN A;  2RKI A;  1NKC A;  2MKJ A;  3I82 A;  5A6W A;  3NCQ A;  2IAJ A;  2IC3 A;  3CC7 S;  3MEC A;  1YJU A;  2IVY A;  5GAD I;  4WKY A;  1H2V Z;  1GTH A;  4OFZ A;  1KQK A;  3LW5 C;  3PEJ A;  4U95 A;  2D69 A;  2HLT A;  3M2V B;  3P45 B;  2DR9 A;  5GAD U;  4MIW A;  2J76 E;  1R3N A;  2HRT A;  5HMW A;  4Y0F A;  2G9O A;  1N4L A;  2DPI A;  1P9Q C;  4NCB A;  1MLA A;  1KRP A;  4KT0 C;  1HPZ A;  5GME A;  2HGN A;  2ZUA A;  4F4Z A;  3KK2 B;  2DYA A;  3LAM A;  2RH3 A;  4I7F A;  1XMB A;  3R7N B;  4M8L A;  2XMW A;  2HHV A;  1A6L A;  3KK1 A;  2L08 A;  1FRX A;  5FJ4 A;  3D1Q A;  1QUP A;  2QSW A;  4XK8 C;  4DR7 J;  2NZC A;  3QWP A;  3OPK A;  3GPA A;  2XY6 A;  4FF1 A;  2W25 A;  5DGA A;  3H2U B;  3GE9 A;  5HP1 B;  4FN5 A;  2EG2 A;  5J2P B;  5CCL A;  2OEM A;  1DUR A;  2HPU A;  2HHH J;  4F4A A;  3FRY A;  3T5L A;  2WB1 D;  3E01 B;  2EFQ A;  2VKZ G;  1FE0 A;  3PV8 A;  3PR5 B;  2FVC A;  5KFK A;  4RBU A;  4KB7 A;  5IC6 B;  4MT1 A;  5AXM A;  4I4B A;  1D09 B;  2MYF A;  2DNM A;  1NSQ A;  3DYA B;  4IRK A;  4UF4 A;  4XAK A;  5ETV A;  4WYW A;  3TX8 A;  2KHD A;  1HNV B;  1IR1 A;  1WHY A;  4QU7 A;  2UUT A;  4R0J A;  1S1X B;  3NGR A;  3QWU A;  1U4B A;  4BS2 A;  4N7T A;  5M2R A;  3ZTS A;  3CJS A;  4X4V A;  5BYS A;  3IN5 A;  2P6T A;  4RUA A;  4DV3 J;  3KK2 A;  4KHP F;  4LF5 J;  1C0T B;  1F9H A;  5BJR A;  3E3X A;  1S77 D;  4P7V A;  3LUY A;  2KFZ A;  2PFD A;  3RRG A;  2VBY A;  4A4J A;  2B4P A;  5IM0 B;  1YLX A;  3UD4 P;  2K1R B;  2BQU A;  2VG5 B;  1U2R A;  1RAI B;  2FDN A;  3DLK B;  1FDB A;  4R5P B;  3U27 A;  2M88 A;  5ETN A;  2NLW A;  2GHV C;  2ASD A;  4MJK A;  1IWG A;  2V8V A;  3D3B J;  2EG1 A;  3N6L A;  1VIX A;  5HP1 A;  3MR7 A;  5J2P A;  2CNN B;  2X1B A;  2J8A A;  3KG1 A;  3EPI A;  4ZCM A;  1K44 A;  1HQU B;  3FCH A;  2E5L F;  3A8K A;  1KHV A;  3E01 A;  1R31 A;  3QO9 B;  4CM2 A;  1SCJ B;  2FLL A;  4PXE A;  4B3T F;  4URG A;  2HFS A;  3NS6 A;  4NLT A;  3TUP A;  4F0K A;  1FDA A;  2CQH A;  4MMO A;  2YKO A;  3MPW A;  3IG1 B;  1FRK A;  3A3P B;  5I3Q A;  3DYA A;  2XB2 D;  4F3M A;  4JI3 J;  2WVF A;  1HNV A;  2MKH A;  1ZBT A;  1S1X A;  2F63 A;  5T41 A;  4OYI A;  1AB8 A;  4HI1 A;  2DNY A;  2WSF C;  2RDI A;  1UEK A;  3RJM B;  1GAO A;  4RNH A;  4ZVP B;  2E5J A;  4JI0 F;  3MMB B;  1IN0 A;  1C0T A;  2HHQ A;  1QTM A;  3DKD A;  3H8Y A;  4HAC B;  1APS A;  4PAB A;  3GCW P;  5IM0 A;  2ATL A;  2AYM A;  4DV4 F;  2Q3P A;  2XMT A;  2K1R A;  5EWE A;  2CPX A;  2VG5 A;  5HRO B;  3DLK A;  4R5P A;  2W8K A;  5KFP A;  1LOU A;  4QIW D;  3HT3 A;  2X1G A;  3B54 A;  5IT4 A;  3RUB L;  4MIB A;  2UUA F;  2ZNZ A;  1V6H A;  3AJ1 A;  2HFN A;  1GMU A;  2PEH A;  5A2Q Y;  4IH6 A;  3JTN A;  1HQU A;  5I4M A;  4CTA B;  3RBX A;  4F50 A;  1VYA A;  1N34 F;  4IQX A;  4PRF A;  3QO9 A;  3IBC B;  4ECX A;  4K5S A;  1ZM2 A;  1SV5 B;  2JEF A;  1AYE A;  2ZKT A;  2PEB A;  3MAA B;  4J91 A;  3CCM S;  4MAK A;  1N8R T;  4F2R A;  3EUN A;  1X4A A;  1UCN A;  3A8J A;  3QLH B;  4CLZ A;  4OYO A;  4KHR A;  3IG1 A;  4A46 A;  1DAR A;  1KVJ A;  2ZC3 A;  5F8L A;  4J9N A;  4HHJ A;  1PKU A;  2XLK A;  4USU A;  1KQS R;  1F60 B;  1R43 A;  4OJ3 A;  4O3P A;  4EYI B;  2HBR B;  1DJ0 A;  2C2M B;  3D2W A;  2AGP A;  4DR3 J;  4DV5 F;  3MMB A;  1G7C B;  1W7W A;  1NU4 A;  4ECV A;  4HAC A;  1LV5 A;  2CG4 A;  3NAI A;  2QMU B;  1QVF R;  4LSL B;  3F0N A;  5CCM A;  4O0I A;  2RT3 A;  5AE3 A;  5HRO A;  3GON A;  3TQE A;  1UVK A;  3CUL A;  3M4X A;  2DH9 A;  3I5C A;  2Y0S D;  1NLK L;  4E98 A;  3TVY A;  2MPU A;  2XO7 A;  3WC2 A;  3EWG A;  1I3O B;  4CTA A;  5IWA J;  3W2W B;  4MK9 A;  2W2P P;  3AQP A;  2ROG A;  2KG0 A;  1SV5 A;  3AQO A;  3MAA A;  1NDC A;  1RA6 A;  3POT B;  2G2O A;  3QLH A;  3W61 A;  4HVZ A;  5D4L A;  2OKQ A;  4RZR A;  1GMV A;  1SUQ B;  2RJZ A;  4DX7 A;  4YME A;  1T9U A;  2F8M A;  3HO1 A;  4QYZ K;  2E7X A;  3CPW R;  2W2N P;  2BAN A;  3KUG A;  4P9S A;  2UUB J;  2KO1 A;  4NWB A;  4UOG A;  3R6G B;  3O1L A;  2BKP A;  3A13 A;  2FLN A;  4USV A;  3NY0 A;  2MKI A;  2F7V A;  1U0H B;  1F9E B;  1E6Y B;  5B0D A;  1RWP B;  3PVX A;  2F4F A;  2V2Z A;  4DR6 J;  4ZPB A;  1FXL A;  3PHE A;  4LSL A;  1TK0 A;  4B3S J;  5ETP A;  3G8Q A;  3IA0 A;  4LRF A;  1FDN A;  4RBV A;  2XZW A;  2YPY A;  2E1M C;  2LQ8 A;  3JSM B;  1MMD A;  2V34 A;  1Q8L A;  3FGV A;  1C1C B;  5KFB A;  2ZZT A;  2KU7 A;  2DRA A;  4X4P A;  1U49 A;  2JWN A;  2QLB B;  5ETS A;  3ZTO A;  4B3M F;  4KPC A;  3W2W A;  4DQP A;  1NRK A;  4TU9 A;  3G96 A;  4OI3 A;  4UQG A;  4K50 A;  5B0E A;  1AUD A;  2R7U A;  2MSS A;  4JI1 J;  1VQ7 S;  2B9W A;  5KG3 A;  3POT A;  3BM7 A;  5IS2 A;  4Q8F A;  4NLG A;  3L3C A;  2C3U A;  2WTF A;  2VC0 A;  1KWM A;  2ZH9 A;  2AU0 A;  4P6Q A;  1SUQ A;  3CNQ P;  1UA0 A;  3J7Z 5;  5KOX A;  4GVB B;  3T6B A;  1RAB B;  2B0G A;  4MKV A;  1URR A;  2BJ8 A;  1GMW D;  4L75 A;  2O5D A;  1FWK A;  4RNN A;  4I2P B;  2RSQ A;  3EGZ A;  1U0H A;  3H4B A;  4X65 F;  4Y2I A;  2IM2 A;  3K8V A;  3VAK A;  2EI5 A;  1SH2 A;  3JTP A;  1NBE B;  4JB8 B;  3KLV A;  4NYP A;  2NXU A;  2M52 A;  3JSM A;  2D7S A;  1VRT B;  1C1C A;  2N7Y A;  3CC4 S;  2MKY A;  4LFA F;  1R7I A;  1W26 A;  3A3N B;  3ETM A;  2BYC A;  2AYE A;  5IT0 A;  2AZ3 A;  1HWI A;  2CQB A;  3WZ0 A;  3AJ2 A;  4K4V A;  3EM1 A;  3JAM U;  2HQ3 A;  2V9W A;  3OVA A;  2HQD A;  1N33 J;  3H7H B;  2JEJ A;  5DZ7 A;  4L72 B;  2CA9 A;  3GJS B;  4DSI A;  2PMZ D;  1MWY A;  1N32 J;  1S9G B;  4RO0 A;  2ZM6 F;  2G1H A;  2Y1J A;  2DNO A;  1IKX B;  4GVB A;  5ETT A;  5HQL A;  2J6S A;  4ZOS A;  4ED4 A;  2KKH A;  4AL7 A;  4WIQ A;  2QA4 S;  3W8G A;  1S72 S;  1CJV B;  4I2P A;  3LWM A;  3K89 A;  4ELT A;  4CYU B;  3U1L A;  2F4V J;  4S0M A;  4PXB A;  2UXD J;  3BBC A;  4LRC A;  1TUG B;  3PW5 A;  3D7S B;  1HNW J;  2G2Z A;  4NCG B;  4KY3 A;  3FSX A;  3AJD A;  4LF4 J;  1F9F A;  3DN9 A;  4KV8 B;  4XPC A;  4NLR A;  4FF3 A;  1U1Q A;  5KFN A;  4UY8 5;  1GT8 A;  5D0E A;  3KMQ A;  3BKU A;  3PKY A;  4ANE A;  1DTQ B;  1LK5 A;  4KO0 B;  1FJE B;  4H4K A;  4DV6 F;  4LSN A;  2UU9 F;  3UCG A;  2XHC A;  1OQ6 A;  3KUE A;  2F8E X;  5HI7 A;  4NYO A;  2Z0G A;  2X7I A;  2JOQ A;  2HFV A;  4X4O A;  5DG9 A;  1VR6 A;  2FHM A;  4U6P A;  1MML A;  1ZYQ A;  2HHT A;  5JUM A;  3K59 A;  3C6T B;  1QJH A;  5DLG A;  1S9G A;  3FSY A;  2FVR A;  1FHT A;  1RAC B;  2AMC B;  1IKX A;  3QJL A;  3BSA A;  3V5R A;  2QLF B;  4ZN3 A;  2A3J A;  4X66 J;  3QFH A;  1CJV A;  4NEY A;  2GO9 A;  3UO0 A;  4CYU A;  3FZB A;  3JQM A;  4K0K F;  3PX4 A;  3NAH A;  1AXQ A;  4P2S A;  2M9K A;  2QE5 A;  2G0J A;  1SIZ A;  3CJ0 A;  2DGW A;  2R2S A;  1WTF A;  4NCG A;  5D78 A;  3B4M A;  5E41 A;  1U45 A;  2C2N A;  1BD6 A;  4KV8 A;  3KLG B;  3Q23 A;  3IBW A;  1SQG A;  4F4X A;  4NA1 A;  3WIV A;  2O1P A;  2WAQ D;  3MOZ A;  1KN6 A;  1GXL A;  3DCA A;  3TVK A;  3JB9 k;  1KON A;  1SL0 A;  3HJF A;  1DTQ A;  4KO0 A;  5L1I A; 
#chains in the Genus database with same CATH homology
 1K44 A;  3FBC A;  5CAB A;  1S59 A;  5BXI A;  1BE4 A;  1JXV A;  3BBF A;  1NDL A;  3WX8 A;  3MPD A;  3Q83 A;  4FKY A;  4W98 A;  5CAA A;  1XQI A;  1EHW A;  2B8P A;  1NPK A;  3Q89 A;  1NLK L;  1S5Z A;  1NSQ A;  2HVE A;  3VGT A;  3FBE A;  1HHQ A;  2HUR A;  3ZTR A;  1VYA A;  1NB2 A;  4UOH A;  3R9L A;  3ELH A;  4DUT A;  3Q8V A;  3EJM A;  4O0N A;  2ZUA A;  3EMT A;  4S0M A;  3NGR A;  2DYA A;  3BH7 B;  3EVW A;  1WKK A;  3BBC A;  3FBF A;  4FKX A;  1F3F A;  3NGU A;  2CWK A;  3ZTS A;  3FCV A;  3BBB A;  3Q8Y A;  2DY9 A;  1PAE X;  3ZTO A;  5C7P A;  2VU5 A;  4DI6 A;  5IOL A;  1UCN A;  1KDN A;  3ENA A;  3VGS A;  1NDK A;  1NUE A;  1NDP A;  2BX6 A;  1LEO A;  2AZ1 A;  1NCL A;  4DZ6 A;  1F6T A;  1XIQ A;  1S57 A;  1NDC A;  3VGU A;  4KPC A;  2DXE A;  3VVU A;  1NSK L;  1PKU A;  3ETM A;  3DDI A;  3VGV A;  3FBB A;  1BHN A;  3Q8U A;  3ZTQ A;  4CP5 A;  1HIY A;  4AND A;  2B8Q A;  2AZ3 A;  3EE3 A;  1HLW A;  2DXF A;  3PRV A;  1B4S A;  3GP9 A;  1WKJ A;  3GPA A;  2HVD A;  3Q86 A;  1MN9 A;  4EK2 A;  3FKB A;  3ZTP A;  3NGT A;  3EM1 A;  4UOF A;  3DKD A;  3EVO A;  4ENO A;  1NHK L;  2BEF A;  3FC9 A;  1MN7 A;  3JS9 A;  3VVT A;  4ANE A;  4ANC A;  3FCW A;  1BUX A;  1B99 A;  3BH6 B;  3EVM A;  1W7W A;  2DXD A;  4F36 A;  4F4A A;  4UOG A;  3G2X A;  1LWX A;  3EIC A;  3PJ9 A;  4HR2 A;  1U8W A;  1ZS6 A;  1WKL A;  2NCK L;  4C6A A;  4WBF A;  1NSP A;  3B6B A;  3B54 A;  3L7U A;  3NGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...