4DUTA

The structure of nucleoside diphosphate kinase (ndk) from burkholderia thailandensis
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
140
structure length
140
Chain Sequence
ALERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVAARMAHLSRADAEKFYAVHAERPFFKDLVEFMISGPVMIQVLEGEDAILKNRDLMGATDPKKAEKGTIRADFADSIDANAVHGSDAPETARVEIAFFFPEMNVYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Transferase
total genus 44
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4dutA00
2HVDA 1NB2A 4S0MA 1XQIA 3Q83A 3BBCA 2DXEA 3ELHA 1NHKL 1U8WA 3ZTPA 4DUTA 3VGVA 3BH7B 4FKYA 3L7UA 3FBBA 3PRVA 4C6AA 3Q86A 1PAEX 1W7WA 4ANDA 1B99A 2DXFA 4EK2A 5C7PA 3GPAA 2B8PA 1B4SA 1KDNA 3ENAA 2BX6A 1NLKL 1LEOA 3Q8VA 4O0NA 4WBFA 1HLWA 3BBFA 3EVOA 3FBEA 4F4AA 1NSKL 2CWKA 1ZS6A 4ANCA 3B54A 4DI6A 3FC9A 1EHWA 3FBFA 3PJ9A 1XIQA 3EVWA 1NDLA 4F36A 1K44A 1MN9A 1NUEA 3EE3A 3VGTA 1NCLA 3B6BA 1BE4A 4KPCA 5IOLA 1WKLA 3DDIA 3Q89A 2BEFA 3GP9A 4HR2A 1PKUA 3ETMA 1S57A 2DY9A 4FKXA 4UOGA 3EMTA 2ZUAA 3FCWA 3VVTA 1S5ZA 4UOFA 1NSQA 3WX8A 1NPKA 3VVUA 1BUXA 3NGUA 3ZTRA 4ENOA 1F3FA 2DXDA 2HURA 2B8QA 4UOHA 4ANEA 3EVMA 1VYAA 2AZ1A 3JS9A 3Q8YA 1WKKA 5BXIA 4DZ6A 2NCKL 5CAAA 3EJMA 3VGUA 1NDPA 3EICA 3FKBA 3NGSA 3NGTA 3BH6B 3ZTOA 1MN7A 2VU5A 3ZTQA 1NDKA 1S59A 3MPDA 3DKDA 1F6TA 3FBCA 1BHNA 3R9LA 3NGRA 1WKJA 3VGSA 4W98A 4CP5A 1HIYA 3G2XA 1LWXA 1UCNA 3Q8UA 2DYAA 1HHQA 3EM1A 3FCVA 1NSPA 5CABA 3ZTSA 1NDCA 3BBBA 2HVEA 2AZ3A 1JXVA
chains in the Genus database with same CATH superfamily
3MOZA 1QSSA 4J9NA 2KRRA 4DR4F 3B82A 4DV1F 4HKQA 4RW4A 1YG0A 2MQLA 2CJYB 5CYQA 1T9VA 2BE2A 4TQSA 3C15A 1EHWA 3MM8B 1SIWB 1WC1A 3JYTB 1B70B 1I5OB 1WHXA 1G6BA 3WQPA 3A8IA 1MG7A 3CIMA 5HVGA 1TKZA 3O6QA 5IOLA 4CRJA 4DV5J 4I2QB 2WVBA 3MM6A 2D3OR 1OY8A 3T19A 1PKUA 4K5SA 3RBXA 4O0IA 3FDSA 3GR0A 5AE3A 4ZPVR 4B3SJ 1A7GE 1SBRA 1JLQA 1RAJA 1OJ4A 1Q86T 3QZ8A 1T9WA 3DLKB 1S6QA 2HNYA 3I56S 4RU2A 4LF5J 4Q5VA 1RKIA 3HO1A 2XMVA 4OZ3A 2LMIA 2PGCA 4CLLA 1RTHB 3RB6A 5CCMA 4ZVUB 4X4OA 4OJ1A 2DD8S 2Q43A 2ZBCA 2CPZA 3P49B 3IS9A 1TFWA 2AJFE 5LM7E 5KFXA 4JV5F 3CIZA 1H6KX 1U1LA 3SV4A 2JEIA 9ATCB 4J9SA 3GE9A 2ZOFA 4BLGA 4DLGA 4KIAA 1HI8A 1SCJB 5D0HA 2CPXA 2FHMA 3RG6A 4NA2A 4C3LA 2OPPA 2ZFHA 1CJTB 3Q0AA 2GX8A 4KFBB 2CPDA 3D2WA 5LSOA 4WZQA 4J9LA 4FPRA 1M1HA 2DNZA 1X5OA 2FY1A 4ZN1A 3J80Y 3PW5A 4IFYB 1LW0B 1J27A 3CB4A 1JLBB 3DRPB 5HATA 4QZVB 4DZ6A 4KSEB 1CSJA 3PYDA 4QIFA 3TVZA 2HVIA 5IS2A 5DQHA 4UQGA 3PW2A 2XTJP 1DQ9A 1X31C 2QV6A 2RHQB 3M2VA 4OX9F 1C2PA 3M2RB 1KOOA 2NZ4A 5AE2A 3U1NA 5C42B 3WBZA 1QVGR 3HT3A 4G1QB 3N0VA 3RRKA 2ZVIA 3PX4A 3HJVA 4EUVA 5EX3A 3TUZC 2RS2A 4IG3B 1KP6A 1SV5B 4NLVA 5JVGQ 2RQMA 4OL8A 4MK7A 2NYHA 1FDBA 1FVSA 4CNZA 3M8RA 1WTBA 1IKVB 1U45A 3RB4A 3IBFB 1VRUB 2ZM6J 1WELA 5LXYA 3I0SA 2V4QA 2R7QA 4LR9A 4FS1A 4RJVA 1QAJA 1Q7YT 1VBZA 3KMSA 2YXLA 3CJSA 3PRDA 4NX9A 5BYSA 1EB0A 4QWBA 1RK8A 1R0AB 3FNNA 1UZHA 4LRDA 1NK4A 2PMZD 1RCXB 2QSWA 4FYYB 2DGUA 3E51A 1RAIB 3C2PA 4HLBA 4IR9A 1CG2A 1BQMA 4FYXB 5A6PA 1RWKB 4ZLNA 2QC3A 1FK9A 4PKDB 2HHPA 2RQ4A 5HSPA 1YITS 2K3KA 2YQ3A 2PMHA 3QJJA 2DRAA 4P73A 3V6DA 1CULA 3OUYB 1RT4B 5G4DA 2EFQA 5SZTA 1FDNA 3KG4A 4TU7A 1PYOB 2KHCA 3UN5A 5LMNJ 4C48A 3PTWA 2CQ3A 1VHFA 3TAMA 3ZZPA 3T9ZA 3OLAA 5J2PA 1YWXA 4J9QA 4CLFA 5CCLA 3UNGC 1X5PA 2XG8A 1JLAA 2VDIA 2H5JB 5SUHA 2YTCA 1IWGA 4ILMA 3TZYA 3QAEA 5GMDA 2DR6A 2PE8A 1FRMA 2WBMA 3MEDA 1LWEA 1ZPWX 2C3YA 3BDEA 3V2UC 4PWDB 4X4SA 4R5PA 3D6FB 2MQQA 4DJBA 4CO0A 2IA0A 5J2NB 4F04B 3MAAB 3L7UA 2QT7A 1WDDA 3FQLA 1RHKB 2LYVA 3UR3C 2HVZA 1NBEB 3GPAA 3VHQA 5ETQA 4CTAB 3DGPA 1HNZJ 3BJYA 2CWKA 4RW9A 1QAXA 4YMEA 3A3NB 3BYRA 2DJWA 5CH7B 4PYAA 2HBZB 1IKYA 3AJ1A 1N32F 1WSRA 2R7XA 2E5LF 2WZ1A 2WK4A 3AD9C 4C8YA 3EZUA 1AB8A 4A48A 3BPSP 4IH6A 1DURA 1CJVA 1FE4A 3CCVS 1O5JA 3OFEA 3TVKA 3UDCA 1WEYA 2K7KA 3RU0A 3VALA 1JX4A 4IRCA 3PZPA 5ETKA 3ILLA 3R1LA 3IRWP 2V4JB 1S77D 3SCJE 1N54B 2BOPA 2GNKA 1VQ8S 2V8HA 3T1HF 1XERA 4KKOA 3L3CA 4ED4A 4RUHA 3J81Y 2VJVA 1NZAA 2FD2A 3Q8PB 3GONA 2OTLS 2MQNA 3TJ8A 4DPUA 4F4KA 1URNA 4LRFA 4MKBA 3TUIC 1T03B 5KG2A 4I7FB 3ZZUA 2GQ2A 3AFGA 1VJQA 1URRA 2DB1A 4JI0J 2C2ZB 4DX7A 2MLZA 3W5YA 1N52B 1TL3B 4DU7A 5KG3A 3EE3A 3HM9A 3MURP 3RW6A 1FFGB 2SXLA 4MKVA 3TZZA 2JOQA 1HWJA 1VQ7S 1MLAA 2JNJA 3O3LA 2PI5A 2QLXA 4YDDB 3ILIA 3MR5A 3D54A 4ZVFA 3R5JB 2UVWA 2XWXA 2R2UA 2NXNA 4OX8A 4ZLJA 3I5BA 2PFDA 2ZE2B 2I0XA 4QU7A 1HIYA 2LP4A 3MM5A 4Q0BB 2VBXA 1GX5A 4HI1A 3KYLA 2RT3A 2CPIA 1BQXA 1L3KA 2ZH4A 4B3TF 3TO8A 3VGVA 3FBBA 1B99A 2M52A 4DR1J 2V2KA 3F73A 1B4SA 4NYZA 4DL2A 1X4AA 2AYMA 2CPFA 4WBFA 2VHGA 1RQ0A 2LECA 2IRXA 4PXEA 3UN2A 2N4CA 1H74A 2UXCJ 2BE9B 1DQAA 2K06A 4MFBB 4X4PA 1R27B 4RUAA 3VF0B 3NLCA 3I96A 3G87A 4K7QA 1F3VA 2EKYA 3ISNC 3FSXA 3TRGA 4CIOA 3FRZA 4WPAA 3Q8YA 3W63A 1Q95G 1RWWB 4IDKB 1UEKA 5KOXA 3US5A 4ECZA 2XY5A 3J7AN 4WFXA 5IXUA 3G9CA 4H4KA 2E44A 2FJBB 3NBPB 3H20A 4QPXA 1YLXA 5EN1A 2DBBA 2ATLA 4X65F 3ZZRA 5KFBA 5CABA 3ZTSA 2J0SD 2DCLA 2LA6A 1C1CA 5E41A 1HW8A 3K57A 2LQ5A 3AQOA 1NNDA 2FDNA 4HH1A 4Q43A 5MLCV 2XYPB 1X9WA 2QA1A 1Y5IB 1HBUA 2CQGA 1Q0NA 2BW2A 1VK3A 1FEHA 3CMAS 3ZZ0A 1JLEA 2H5IB 3KUHA 4IOBA 4PG8A 1IBCB 4NLWA 4DSEA 2CVEA 3P96A 2PI4A 1VR6A 5B7WA 1UWBB 4F4YA 2A1BA 2OSQA 4TU9A 3MCOA 4DUYF 2JX2A 2KVQE 4NLTA 3MAHA 1V3ZA 2MZ1A 1S49A 4V19X 1RT3B 4CYUB 1YKWA 3GU0A 1Q5VA 4K59A 4NRUA 2QX0A 3HDSA 3BGOP 3Q23A 1NJYA 1XNQF 2JLEA 2KFZA 4WIIA 1R0CB 4CLKA 4EO6A 1P9QC 3UDEA 3DNCA 2FHKA 2F3JA 3TEGA 1Q82T 4WFNQ 3CO0P 3ETOA 2QFIA 4RR5A 2IAJA 4OZNA 5CHCB 2RJZA 3IM8A 4J9PA 4FKYA 2VONA 3AY0A 2GMLA 2BQRA 5GAHU 3VAGA 3UO0A 4DL4A 5KFVA 2KYZA 4P72A 4DR4J 4DV1J 1N33F 2EW9A 3G82A 1SI9A 2FC8A 2P2CB 2V68A 4F67A 3DLGA 4I67A 5GAGU 3G86A 2R7VA 1FCAA 3NCPA 3MI7X 2R9LA 4DSIA 4ZP6A 4DMZA 2ROEA 3EYZA 1SH2A 1S5ZA 2WVFA 2DNPA 3KHLA 4DV3F 3MM7B 3OQ2A 2MKIA 2AYEA 2ZZMA 1NJXA 3TVYA 4OYOA 3HX9A 4ZVSB 4QU6A 5BYQA 4PPDA 3JSRA 1M90T 1RZMA 3KLVA 1S6UA 1CLFA 4USIA 3ZZTA 4F2RA 2ZBQA 1TELA 2KTQA 1F2GA 5KFNA 3QYYA 5IT0A 2IC3B 3G4SS 1B7FA 1KVKA 3SQGA 2LVWA 4A47A 3KHRA 2HVDA 3MCMA 4C0HA 4ZMMA 3QT8A 3QAUA 4ATNA 4P2SA 1SPBP 2KDOA 4WYLA 1F0XA 1UA0A 4JV5J 2RF2B 2QIFA 2OP5A 2B4UA 2ASLA 4MK8A 4C97A 3PJ9A 2HHHF 2M88A 4ZN3A 4DSKA 3CEDA 3Q2SC 1WOPA 2CG4A 2UXBF 2MKHA 4NXMF 2LQBA 3QIDA 4Q45A 3KLIA 4LRAA 3AH6A 5IC6B 3IRXA 2OEMA 3TJAA 1VCTA 2RD5C 2W2NP 3W8GA 3RZAA 2O5DA 1SL0A 3NGRA 3MPUB 1YBAA 2B6AB 2VC1A 1S6PA 2CQPA 2MKSA 3DLBA 4DUZF 4I4BA 4OX9J 4LVOP 1CPZA 1PC5A 1B7YB 1N88A 3GSDA 3H4BA 1UFWA 3CCZA 6AT1B 4C3KA 5H9FJ 2R7RA 4B3RF 5T41A 2A6MA 4NRTA 3MMBA 1D9AA 4LIWA 2UUCF 1QE1A 1GAOA 1YQHA 4A8XA 3TX8A 1CJKB 2CWXA 2IHR1 1SL2A 3JTNA 2OEJA 2KN4A 4BBYA 4O3QA 1S1VB 3ZNJ1 1U1NA 4IFYA 1W2BR 1S1TB 5KAKA 3G8SA 3A8KA 4CO5A 3DRPA 2XGQA 4USHA 2NZCA 1F60B 2ERRA 2DNQA 1H2VZ 1G7CB 4LF6F 5DDRC 3GIRA 5F0WA 4XTTA 1D1UA 3QMQA 2GJIA 4HDGA 4UTGA 3FEZA 1V3SA 3MEEB 3M2RA 4I2PA 2Z4PA 3W65A 1B0PA 2DNYA 4LJMA 2KH9A 5C42A 3GV8B 1SUQA 2BJEA 5H9FK 3Q86A 3OL9A 3D0GE 2CZ4A 3MMAA 1SV5A 3OFFA 4AT1B 1LEOA 1KBRA 1IR0A 2CADA 2I5JA 1NK8A 3OR2A 2HZVA 3FC9A 2QG9B 1IKVA 3BB5A 1GTEA 2HSEB 4KH1B 4Q7AA 4KC5A 1TUWA 3RBEA 4URQU 3TX0A 1FX2A 3MEGA 4F7VA 2M3DA 1RGVA 3Q2TC 3GP9A 4I56A 1ELOA 3ISZA 5JXSA 4FKXA 1EETB 4KO0B 4UOFA 4NCAA 1R0AA 2ABYA 4NYOA 3T1AA 2KI2A 3WZ0A 4AL7A 1OO0B 3EWGA 5MAOA 4XDCA 3BH6B 4ZLLA 2XMJA 1OS5A 2VG7A 3KK1B 1X7VA 3GFZA 2V6AA 3MMCA 1WACA 4K4ZA 5U47A 1NJZA 2DR5A 2N82B 3O2IA 4QR1A 3OUYA 1RT4A 4B3OB 1IBMF 5ETSA 1VQ4S 5C2GA 1RT6A 4ZVOB 4DFJA 2HAFA 3AJDA 1Q79A 1FJGF 4MMOA 1R0BG 2FQQB 3TW0A 4CO2A 1EX8A 2DGWA 2LXIA 1TK8A 2DIUA 4WTYA 1Y3KA 2OD4A 1N32J 3EMTA 2E5LJ 2BE7D 1ROFA 1WUUA 3KHGA 1CS4A 4MTPA 4UOHA 4EO8A 2B56A 4YHHF 1WNEA 3ENQA 4Y28C 4TLQA 1H73A 3OXFA 4NL5A 4F8RA 1UEUA 3AJ2A 2GJ2A 1RWNB 4IKAA 1TL4A 1AROP 1E6YA 3SXLA 1ZM3A 4NEZA 2GO9A 2XHWA 3N79A 3AODA 3AA8A 1HPZA 3T1HJ 4S0MA 3DOLB 2GHPA 2HQFA 1SQGA 2XMUA 1NJIT 3W5XA 5L9NA 1RAOA 4RZRA 4K4UA 2V2ZA 2DGSA 1YX2A 1FKPB 1GMUA 5I4MA 2DNHA 2HGNA 4ZHRB 2F40A 1XR5A 3RUBL 5I42B 2JHEA 2U2FA 1NDLA 2YY3A 2KJVA 3ISND 5F9LA 1WKLA 2YKPA 3HK2A 3DLEA 3L9ZA 2YX4A 4WP3A 4L3KA 3OTEA 1N5YA 2JWNA 3W3SA 4OZJA 3CVKA 1QDUB 1RAFB 2Q79A 1HD1A 2QLWA 2F4VF 3FK4A 5CAAA 2C3OA 1ZYQA 2VFRA 3OVSA 3KK2A 4LBIA 4I6AA 2DGQA 2J7WA 3DGVA 4TYBA 1U7LA 2V4JA 1DTQA 4AQYF 3WHIA 2KU7A 2DNNA 5J2QA 1FT8A 2HBQB 5DZ6A 3BF4A 2D74B 2GQQA 2YQ1A 1R8HA 3QJPA 5F3TA 2HHUA 4B3TJ 2E5GA 2EK1A 1GTHA 3S6EA 7FD1A 4X64F 3GFYA 2KXFA 2GGPA 1HHTP 2EBGA 4CO3A 3W2VB 4IG0A 2MQOA 5A0YA 1SQFA 2B0GA 1XN9A 3HHKA 3MEKA 2ILYA 1NJWA 3GJQB 1L5UA 2M0GB 4L6V3 3GSIA 3F41A 3H90A 1RCOB 4LFAF 4ZCLA 2AJ1A 1NSQA 1ZH5A 2RU9A 4HEA9 3N6MA 1HWUA 2R7UA 2CXEA 2XS2A 3WDOA 2RAQA 3RRGA 2MHEA 4UW2A 1NMEB 4TVAB 3H42A 5T14A 3W7BA 5DG7A 4PXDA 1T7PA 4KGXB 3DYAB 1N8RT 1HYSB 2FYXA 2DGTA 4USWA 3GV5B 3POTB 4Q0BA 3CCRS 4C2MA 2BJDA 2CPHA 2J9CA 4OYXA 3QIPB 2DHAA 4TQRA 2OH2A 2AZ3A 3HLUA 4X65J 3BQ0A 2NPIA 4EMDA 2M9KA 3PVXA 2B5JB 3EGNA 2AGOA 2N3LA 2CIMA 5CQGA 1ZZNA 4ANDA 2OPSA 3NY0A 1YHQS 2YKQA 1TP7A 4H54A 2W7PA 1ACMB 1HWKA 3K5PA 5A8RA 4QIVA 4DPWA 4URSA 1R8AA 3J81j 1MWYA 2CVIA 4ANCA 4NZ7A 4ES2A 4Q2LA 3PX0A 1FTCA 4HYKA 4NLQA 1KEKA 3O8WA 2W4PA 4FVCA 5LMUF 2P5VA 1F1BB 4DUYJ 2R7TA 5GMKa 4KQZA 3TYTA 3U7JA 4H4MB 4PG6A 1EKSA 1VRTB 4DCOB 4YDXA 4X4QA 2B7BB 4FVMA 1I6JA 1UJ6A 2WSCC 4OHVA 4IDKA 1NDPA 4ID5A 5ITHA 4KHRA 3TWZA 3K58A 3OHAA 4CCHA 4FP9A 4KB7A 4QWEA 1XNQJ 5F8HA 4OI0A 3ZO7A 3CCUS 2AJ4A 5HVHA 3BQ1A 3CJTA 1LQ9A 4NLDA 2DH8A 3W60A 1FNXH 1RI7A 1FX4A 3CCJS 3CCMS 4LSZB 5H9EJ 1BC6A 2H48B 1XMOF 3W62A 2ZBRA 3G8QA 1U4BA 4ELVA 2W9CB 2FLLA 4B9LA 4RNMA 4K2XA 1N33J 5DDPC 5C5JA 4JI2F 2GJFA 2ADCA 2FVSA 2NSCA 3KLGB 3CJ3A 2E9RX 3NKYA 3HHLB 3IR7B 4CLWA 3OHBA 2JC0A 4UOGA 4NLUA 2DCUB 2MQ8A 1RT3A 3LPYA 4OZLA 2RHSB 2BACA 4QCLA 2ZD1B 4DV3J 2JVOA 6FDRA 1OYEA 1QY7A 3NRBA 3LP0A 3WC2A 3PO4A 1R43A 3DKDA 3M6UA 1NM2A 4W98A 2VJUA 1UZDA 2RUSA 4C3MA 1NK0A 4B9UA 4OV1A 3OJSA 4J5OA 5HL7Q 4OYZA 4P71A 2JC1A 3NOCA 3KJFB 2J8AA 4IQMA 1RYSA 3HD2A 2UUBF 1GX6A 4O44B 3UCGA 5B0CA 3LO3A 3SV3A 2NUUG 5D77A 3IMQJ 2HS0A 5LOQA 3D28A 3GCXP 1UW4A 2NLWA 1B3TA 3IBCB 2HHHJ 3O44A 1JXEA 1WTFA 3UQSA 2E7WA 4Y6IA 4U8VA 4DX6A 5CYJA 3KLHB 8ATCB 4PPZA 1S9GB 2DNMA 2P6SA 2CJ9A 1EJ7L 2C22A 2UXBJ 2HHVA 2EXUA 4L74A 3D0HE 2BUNA 4E0DA 4LFCF 3E8OA 3QO9B 4RBUA 3VZIA 2C2OB 1FRJA 3DLHA 1S1UB 2IM0A 3M6WA 2J6UA 4ZVHA 1HBOB 3BR8A 5G0RB 3BO2A 3BN4A 2OO4A 2HVHA 2BKPA 5C24B 2VA2A 3Q24A 5AE1A 3GJRB 3MR3A 4DUZJ 4ZP7A 2HFUA 3HSJA 5KT5A 1OPIA 1TL1B 2FLPA 1OIAA 2C28A 1KKHA 1NH7A 4J37A 4WJBA 1X60A 1AFJA 3OTOF 1MNEA 5RUBA 3I9ZA 1VISA 4RW7B 4NOHA 3BQ2A 3HVTB 4LT6A 2XLIA 2BOAA 4B3RJ 2ZH6A 5IV3A 2V63A 2VL1A 2VFSA 1DTTB 4MJKA 2UUCJ 3IM9A 5A8WB 4TLRA 5L1LA 4QOTA 1BE4A 1WC6A 4TU8A 3WX8A 3AD7C 1IM4A 1RDRA 2BKNA 2KXNB 2AV5A 2YKOA 4NMXA 5A8KB 2E9ZA 3KFWX 5DRKA 3KUGA 2IVFB 2BVZA 2HNZB 2B6AA 4LF6J 1NH8A 5KT7A 2R42A 4DF8A 2RQKA 1IBKF 2IMWP 1M5OC 2VA3A 4V19J 2JEFA 1BGXT 2ZH5A 2KO1A 2G0IA 2WSEC 1U0SA 3C16B 2NXCA 2VG6B 2DY1A 2CJXB 4YFUA 1NK9A 4FPIA 2HBYB 3CJRA 2XGPA 2M7SA 1G4CA 2WW4A 3PYFA 5HLFB 2MPUA 3GV7B 4ED8A 1KHVA 3IN5A 1PYTA 1HNVB 2UVUA 2WOMA 2JLFA 2PC6A 5KT2A 2RKIA 2EC2A 4IOAQ 2AGQA 5E3AA 2K1RB 1S1TA 2V0NA 3RB3A 4JOUA 2VODA 2AYGA 3H2LA 4U9RA 4EYHB 5H1SV 2GCFA 1VBKA 3C8YA 3ULHA 1RSCA 3GIKA 3K8WA 3C6UB 2OMOA 1SJ3P 1EARA 2OI2A 3V4IB 5JMNA 3CDEA 1FDAA 2GA7A 1K0TA 1HMVB 1T05A 2R7WA 3DRSB 3Q83A 2DXEA 2HIYA 1Z1ZA 2J9DA 3LP1B 2X3DA 4J91A 3KG1A 1ZM2A 1YSJA 3FZ2A 1IBMJ 2K2PA 1ZM4A 3BBFA 4JI1F 4JUZA 1JNZB 1TQLA 4ZVPB 3WIVA 1FJGJ 3K5NA 4RNHA 5D4PA 3NCRA 3MWBA 1ITPA 4BWJA 1VDHA 4GVBB 5EDWA 1EETA 1HKAA 2MY7A 2OKQA 3TEHB 2D1CA 1WD6A 4YHHJ 2GVDA 4F4ZA 4ZJLA 4FYDA 3MPDA 1OY6A 1IBLF 4ELTA 2XM3A 4PXBA 3KK1A 3QFHA 3AOBA 2E5HA 3MUTP 2XYGB 4PUOA 5F0UA 5KFSA 2KG0A 3JTPA 4UT4A 1J2VA 3SFUA 4U7UK 4ZPWR 3MR2A 4ZVEA 3FMWA 3ELHA 2G2ZA 1RT5A 2CDRB 3U1MA 3KUEA 4B3OA 2KRBA 4HHHA 5FDLB 1TL7B 2A2DA 3UVJA 1RACB 1D3WA 1C0TA 4OQJA 4OI1A 1HWLA 4PZVA 3O5TB 2B4PA 2D3ZA 2BYCA 5HBMB 1O6XA 4OYWA 3DU6A 2IJRA 2V2QA 4HTIA 5IWAF 2L9WA 3X3UA 2EVZA 3VVTA 1DFDA 4A8MP 1SC6A 3LA0A 2J0QD 1IQZA 2MDAA 3CD0A 1WORA 3EPIA 4XO0A 2YWKA 1QTNB 1V3RA 1KQGB 2UXDF 2Y1RI 1L3UA 3TA0A 2F4VJ 5FD1A 2CNKB 4CLUA 2J7UA 4GKKF 4B02A 2V8GA 3TI0A 4DV4F 2VG5B 3R7NB 1JJ2R 2E9TA 3CWJA 1NAQA 2DRDA 5KG4A 4F50A 1N5TA 2FJWA 2EFVA 1J5EF 2R2TA 3JQMA 3ZTPA 3KLEA 4C6AA 4M1KA 2JFKA 4R0JA 3MD1A 1PILA 3D1QA 3T5KA 4MK9A 1WHYA 1MROB 4FNHA 3FBEA 4JI6J 1M5PC 2RRNA 1DAXA 4ZHRA 1TKXA 4X64J 2DPJA 4DL6A 3S8SA 3I31A 2H65B 2WVCA 4X4VA 2PMWA 4DV6F 3H2VE 1MMNA 3DI6A 3IGVA 4XK8C 4WE1A 2R7OA 1QLNA 3PIPQ 4RW8B 4WFBQ 2ZUGA 4LFAJ 1G2EA 2IJNA 2DRBA 2ZKUA 1UP1A 4O3RA 2ASJA 1U6BA 2RVJA 3CC4S 1NXIA 1E6VB 4PXCA 4U95A 4A8FA 4USVA 1S76D 3BDPA 1S59A 1TKTA 1YJTA 1RKJA 2W9BB 3I87A 3PEJA 3B4DA 1T95A 2DYAA 1NSPA 3D6MB 4R8UB 3BSAA 4MIAA 1PCAA 2XSFA 5DLFA 3FCHA 1PAEX 1V5IB 2HRTA 4MIWA 5B0GA 1NSKL 2O1PA 3OLBA 1ICEB 3W2VA 3OD2A 5HMXA 2R8GA 1MSWD 4JI4F 5C2CA 1IVZA 1FRKA 2HWHA 2FIUA 2RILA 2XI3A 3M8SA 2GQCA 1FJ7A 4DQQA 1FJEB 1WC3A 5LMUJ 2VZ9A 2HURA 4F2SA 3VAHA 2K8GA 2C1EB 5AT1B 4QWAA 1DLOA 1LKZA 4A8SA 3FEYB 1C0UB 2QL9B 1MU2B 4ID8A 1HQEB 5D8HB 4F3MA 1RWXB 1M5KC 2UUWA 1TMMA 3FGVA 1NPRA 3DYAA 5K14A 3BEGB 3D66A 3QIPA 2HZCA 1PAUB 4MYTA 3B4MA 1TK5A 3P45B 1U1PA 1FKOA 1S48A 2W1BA 4QQBA 4YN3B 3ET6B 4PG5A 2GVZB 4ZVRB 3W2WB 4C4WA 3PACA 2CQ2A 1XMOJ 5J1EA 3K5MA 1JKHB 4DFMA 1RTJB 1S79A 2ZNYA 2Y8YA 4K4WA 1S9EA 1SVDA 3DM2B 3B54A 1V6HA 5A2QU 4KV8A 2D7SA 2KXHA 5ETOA 2GHWA 3GG1A 2XMWA 2L08A 3H8YA 2XSJB 1VS3A 5J1NA 4GRSA 4JI2J 1P1TA 4C0BA 1JLCB 3W61A 4PQUB 2LEPA 3OFHA 1SJQA 1Q78A 5DQIA 1JQGA 4K4TA 4UOCA 3VAJA 3JS9A 4H4MA 1VRTA 1Q8KA 4Q2MA 3PDNA 3P8BB 3H5SA 4WFYA 1HFEL 1LW2B 3IFEA 4FF2A 1UVMA 2QGFB 3T1YF 2EG2A 1KLMA 2DR9A 1K1SA 2FGCA 1PJ6A 2YPYA 3BO4A 1TV6A 2HQCA 3AXMA 3CJKA 3UW1A 2DH7A 4IO1A 2V67A 1U8WA 4G65A 1I1GA 4X4TA 3M8ZA 4KBIA 2DHSA 3C19A 2QE5A 4LSLB 2UUBJ 2JEJA 3EXYA 4RNOA 4ZLPA 5LXRA 1IJEB 5E3PA 5HVFA 3T3FA 2E1AA 1YDLA 5EWGA 3KLGA 1IM6A 1Q1KA 3D67A 4B9NA 3KJQB 1XMQF 2HWTA 3HHLA 4ZCKA 2DIVA 2E5JA 5JJBA 3LAMA 4QYZJ 3FRYA 4JYAJ 5DM7Q 2PN6A 3GYNA 2HGLA 2HMIB 4DR2F 4LFCJ 2VFTA 3KJVA 3HT0A 3M30B 4NCGA 1I94J 1Y4ZB 3AAWB 1S1XB 4C9DA 3B78A 4ECYA 1S7HA 1TUVA 1KHWA 4YB5A 4P75A 1J5OB 3D3BJ 4YB1P 2KYXA 4QIWD 2GIRA 1LWFB 4E8UA 2W2PP 4E98A 4DUTA 1HI0P 3CJ8A 2CAJA 2BW7A 3D5MA 5FJ4A 2JVRA 1W25A 4O44A 1Y5NB 2KT2A 5L1JA 1WHVA 1OSDA 4N8NA 5F8GA 3DLLQ 4ZVGA 5IM0B 3U1LA 1LFPA 2I8EA 3R8YA 1JWWA 1ZETA 4M8LA 1SQEA 2HGMA 1TKDA 2DNKA 4ICLA 1Y0HA 2XMMA 1YJWS 3VAIA 1D9FA 2ZHOA 3G71S 4J9MA 4M63A 2MSTA 1K47A 2PT0A 1RWOB 1Y00A 2XNRA 1M0SA 1VQ6S 4RW6B 4QR0A 1KD1T 4LR7A 1S9GA 2EFOA 3M8QB 5LJ5Y 2BKOA 1SB6A 1SC4B 2DGXA 2DNRA 4FXVA 2DGVA 1D0EA 4LIRA 3MAQA 1S1UA 5DQGA 4YQWA 3IBWA 2OD6A 4O3NA 3MOJB 1FXLA 5G0RA 1WKJA 4CP5A 2ZEJA 5EUHA 2L9DA 4NLOA 2JRSA 3HVRA 5IV4A 1VQ9S 5C24A 1LV5A 2H4YB 1IBKJ 1UPPA 1EKRA 5CYMB 2IDEA 2J0XA 2ZITA 4YS2A 1T9TA 2EFPA 5AXLA 1N0VC 5GAEU 5ETVA 4RW7A 1RTZA 2LQ8A 2L9NA 4CM0A 1U1MA 2QYGA 4ECTA 2LCWA 1QAYA 1GXTA 4X62F 1AZSB 1MWZA 1XMBA 1BY9A 1DTTA 1KVJA 4CM2A 3UWTA 3LGHA 2YWFA 1RT2A 3B6BA 2J5AA 2HQIA 4CLSA 2CYYA 2RRBA 3H0PA 2GC8A 4YR3A 5HANA 3D3CJ 1HNIA 3GZ7A 3RTVA 2JH3A 3GJTB 2LXFA 2ZH2A 5HQMA 3M2UB 4UZCA 1VBYA 1ZAWA 2CPJA 1Y3JA 2IPOB 3EICA 1HD0A 3GQCA 1OY9A 5BJRA 3KTQA 1NU4A 1HBMB 1X4BA 4JP8A 3HPOA 3KLFB 3IG1B 5C25B 2HNZA 5FIIA 4NLXA 5FLXU 1H72C 2IYIA 2NSBA 1TVRA 3R5GA 3I4PA 1RLDA 3SSQA 4LF4F 5C7PA 4WP8A 4RLEA 1UETA 3M7VA 1DQ8A 5AXMA 3UCZP 1YJVA 5F9NA 3K59A 5E3RA 1LWCB 4ZDNA 1KN6A 1HA1A 1WEXA 4C8OA 2MJNA 4JI1J 2W7OA 4NASA 1G1XA 1TFYA 3ZNUA 5T7LB 2CJKA 5KFAA 1F2HA 4N8OA 4RW4B 3M8WA 1X5SA 4NCBA 2W25A 1V9OA 4U96A 1Q5YA 4FDFA 2Z2ZA 5CYQB 3SCLE 2X1BA 2BE2B 3C15B 3LWMA 1U0HA 3MF5A 4MT1A 4BWMA 2MGZB 2K1RA 2MZTA 2XWYA 4KHMA 4K4SA 2GIFA 4P10A 3F0NA 2IYGA 5IT9U 3MM6B 1U6ZA 5KT3A 3MPYA 2VPWB 1R31A 5CA5A 4DEZA 1CJUA 3CTRA 2HHXA 2DGOA 4CLPA 3FBCA 2G4BA 2FVPA 1FRLA 1SC1B 1SXLA 2U1AA 3DDNA 1M5HA 1ULRA 1IBLJ 1JLQB 1EP4B 3IA0A 2QSFA 4C7QA 4LQ9A 3IGNA 1R7IA 1HMVA 5D3GA 4DXLA 2MQPA 2ZVSA 2DTJA 2OGUA 3M32B 3LP1A 1FFSB 1ZBTA 3CCTA 2ZH3A 2FVCA 2ZJQQ 3IS9B 2HHSA 4ECQA 4LSNB 1XIQA 1YRXA 2A0FB 1X9SA 3KK3A 4KPCA 4ZPTR 2J6TA 1IQTA 3AOAA 1FKAF 1HBNA 5LT5A 2AJ0A 1U1KA 4HT7A 4XPCA 2FZGB 1KWMA 1FRXA 2V8VA 1IKXA 4DX5A 2J6SA 1WC5A 1RYRA 5CD4H 2YKMB 4DFPA 2UXDJ 1BXNA 3GIMA 1UA1A 5D15A 5K8OA 2IRYA 1C1BB 4UQTA 3NP5A 5DGBA 5GADU 4GKKJ 3R5DA 2H3EB 4B3MF 1PG5B 3G2XA 4DV4J 2OTJS 4DFKA 4W92B 4JV1A 1RP5A 1T3NA 4I0WA 3UCUP 1FRHA 1R6YA 1J5EJ 3QSYB 2CNOB 1LK7A 2WB4A 1TL7A 2VD3A 3H98A 3LTOA 1PC4A 4FZVA 2F63A 4FXDA 4WK3A 4NMLA 2IM2A 1UFKA 2R2SA 2F65A 1KSPA 3CT9A 3ZXWA 1VQSA 3CMQA 3PYGA 2P9GA 3MCNA 4DV6J 2MZJA 4OI3A 1N5VA 2BR0A 1XJWB 1NHUA 4ECUA 4OX6A 1K9MT 3I0SB 4O3SA 5GAHI 2DXDA 2IM1A 2V69A 3GB0A 4M5KA 4ES3A 4YR2A 1WC4A 1NRKA 3PHTA 1VMBA 4MAKA 3NWRA 4OZ0A 5KOWA 1RE1B 1TAUA 2N7YA 2CDQA 5GAGI 1S4FA 1HHQA 1MWQA 4CZCA 4X66F 2HVEA 2VB6A 4DPXA 4ELUA 1FEEA 1FK9B 3MM9A 2B9XA 4ZIWA 2KKHA 3NNAA 4F25A 3Q8VA 5A2QY 3QQCD 1N48A 2E1MC 2YX1A 2Q66A 4FBTA 2ZNZA 3R3TA 3AD8C 5DZ7A 1RHRB 4RBVA 3VGTA 4K8RA 2AQ4A 4JI4J 4CT9A 3DU5A 2GV1A 4YEAA 2EK6A 5HO4A 3MTJA 7FDRA 3NMRA 4QBUA 4DPOA 1YZ6A 2GZOA 4K4XA 4X4NA 5E0OA 3DRRA 2AF6A 3JSYA 3J7A1 1X0PA 4LF8J 3U02A 2XULA 3FSYA 4NA1A 1PSDA 4DV2F 2ZBIA 3VGUA 2FJAB 3CD6S 2MEWA 3GMGA 1E6VA 2VU5A 2YWGA 4FF3A 2HAIA 4JI8J 3NNCA 2QTWA 3UD5A 3K8VA 2WB1D 4F26A 5GMEA 3MEDB 1XQIA 1LWEB 1A0OB 2XZTB 1U6FA 1PBAA 5KFHA 4C0OC 4AXJA 4TY8B 4R5PB 2QFJA 1RLCL 5IFMA 2MLXA 1VGYA 1FWKA 2HKEA 1GMWD 5D6GA 5ADZA 2LU1A 1HR0J 2MY8A 5DLGA 3JSMB 5KFOA 5B0BA 3A8EA 3UDLA 4WFZA 2R8HA 4HTJA 2BJ9A 4HACB 3DGPB 1D8ZA 2UUAF 4HR2A 2GAHC 3PHEA 4DSFA 2HWIA 3I6PA 1LOUA 3PO5A 3HI9A 4OZ5A 3EVMA 1IKYB 1RBLA 2MTLA 3QNWB 4L72B 2V5HG 4ETZA 4RO0A 3A3OB 3NGSA 1NPPA 3A3PB 4ED0A 4C8KA 2G13A 5KFUA 4I64A 1CJVB 1HQEA 2XY7A 3T1YJ 2HW3A 2BDPA 3J7Z5 2G1HA 3OPKA 4X84A 1ZAVA 3BBBA 1QVFR 1RT7A 3H40A 3MUMP 2C3PA 3AA9A 2YNIA 1CEZA 3M9MB 1Q53A 3TQEA 1HQ2A 5D4LA 3KWMA 1X8DA 2B9YA 5IQQA 4JI7F 4DPYA 2EWHA 4LR8A 3W2WA 2GVZA 5D78A 4M94A 3SYZA 5DJBA 5HJYA 4KKOB 1S4EA 1RTJA 4TYAA 4F4AA 5F8JA 2KM8B 3S7RA 4EBCA 2PD1A 3DXBA 3HD1A 2OPQA 3LALA 3LF0A 4NZ0A 3R7BB 1VIOA 3LANA 4ALZA 3EUNA 4PQUA 5BYRA 1TTHB 3I0RA 4CDIA 2KHDA 1XMQJ 3MFHA 2X51A 2MHNA 1REVA 2CNLB 1RBAA 3NNHA 5I3UA 2CUYA 4QPTA 2Q1LA 1LW2A 4DR2J 5HP1B 3MECA 2AX0A 2MMYA 1UJ4A 4LRBA 1GK8A 2QA2A 4IFVB 2WAQD 3Q8SB 3FCVA 3M8YA 4HHUA 3JTOA 3BGLA 3PW0A 3RRHA 3M05A 4OYPA 3DC2A 2OPRB 3MM5B 1GMWA 2MZSA 3T6BA 3I5AA 4DQIA 4OJGA 1U1RA 3UD3P 5B08A 1SJ4P 4F0MA 2F8MA 4RKUC 2ASDA 2BQ3A 3OBIA 5KFKA 3OSNA 3AQPA 1KOHA 4DR5J 3T5HA 3QLHA 1RT1B 1GH8A 4AL6A 1H2TZ 4O23A 3OSPA 2DITA 2QEXS 5KFGA 3PV8A 4J9UE 4EWTA 5ETNA 4BCAA 5DS7A 4WYWA 1GEHA 3PCOB 2AX1A 2VKRA 2R7SA 1NEEA 4Y2IA 3R5AA 4OMFG 4HI2A 4A8OA 2WTFA 3DOMA 1YRTA 2DNOA 2D3O1 4V1Ak 5FLXY 2ZDPA 1GQEA 3QZ7A 2H9ZA 2MKJA 2X1GA 5CXTA 1RBOB 3RB0A 3IWXA 3SQOP 4ZK7M 2YKNB 4C11A 4MKAA 1RA6A 1VHIA 3PJXA 5EGYA 1P8GA 3NWGA 2DEJA 2DISA 5D0EA 2Y8WA 2IM3A 3LW5C 3TUPA 3R2CJ 3THPA 4M5HA 2EFGA 2HHQA 1K0VA 3PG9A 5L1IA 2NXJA 4X62J 1HBUB 1JLGB 2YNHB 5DETA 2MZQA 1CC7A 1JLEB 2FTRA 2Z2LA 2YWHA 3ILJA 4WWSA 4ZP8A 1BUXA 2ASYA 5IT9Y 4ENOA 1IR1A 3N01A 5CZXA 3GFHA 3VR1A 2A2CA 2CA9A 4A8WA 4H4OA 1B0VA 4A46A 4A8KA 2UZAA 2YWWA 1O8BA 3IAS9 2H54B 3BKFA 3HFVA 3C6TB 5KG7A 2IA6A 3I9V9 1ZA2B 5L9XA 5HMZA 1UCNA 2CQIA 3EM1A 1U24A 2YNGB 3BO3A 1JB0C 2W24A 3LQVA 3J7ZT 4LF7F 1BMQB 3CPWR 3EZOA 3MM8A 1F5BA 4WFAQ 5B09A 5L8RC 4PQAA 2DO4A 2QMUB 1H2UX 4EK2A 3JYTA 2AIRB 4DL5A 3GYGA 4IOCQ 1YGYA 4LF4J 4I2QA 2IAJB 1RUSA 2CQCA 2LLZA 3V4MA 1QUVA 3MCSA 1S0NA 4YB7A 4AD6A 1QSLA 2IIHA 1KR4A 3G82B 2J0WA 3D9BA 4XIUA 3DLKA 3N5BA 4QIEA 2XC9A 3HF5A 2HQ3A 3DLGB 3H5UA 1UVJA 4OFZA 2ZKTA 1REGX 5EX0A 3M2UA 2D69A 5EWFA 2VPZB 1RTHA 1VI7A 3L95X 1GXLA 2C2DA 2YWEA 4QYRA 1KVIA 1AFIA 4K50A 2BANB 1SH3A 1MN7A 3J7YI 1HBMA 4LRCA 5IT4A 2G0CA 1Y5LB 1HW9A 1NKBA 1VQNS 2VH7A 4Y65A 3KLFA 1X4FA 1YJUA 5C25A 4LF9F 2JSXA 2HS3A 3VQSA 3QT7A 4DV7F 1NDCA 1X9MA 4USMA 2Z2MA 3C3LA 2RNEA 3JB9k 1RHJB 4YB6A 2IBOA 3LOUA 4U7UD 2ALYB 5K9FA 5KFLA 1CJTA 4FYVB 1RHUB 4KFBA 2HPUA 3HSZA 2AU0A 1NLKL 3SQGB 2FJVA 5KG5A 3MPVA 1UTAA 4QW9A 1S7IA 1RB0A 1ZTTA 4Q8FA 1CC8A 4TNOA 1ZAXA 3CMES 2RQCA 5EWEA 1LW0A 5T7LA 1JLBA 3D4JA 4ED3A 5KT4A 1VC6A 1UEVA 4PABA 4FYWB 2JEGA 3W9HA 3H25A 2HRYA 2MGZA 3GG0A 3SMZA 3BGRB 4RWXA 4L75A 4DU8A 2ZC4A 4CQ1A 4G1QA 1OMSA 4GO5X 2D9OA 1NKCA 2XO6A 3RJMB 3R97A 1WJ9A 3KLIB 1WG5A 2QMXA 4IG3A 1EP4A 1JJCB 3IRXB 4KH0B 3TJ9A 4B3MJ 4FS2A 2BZ2A 4DL3A 1UJ5A 2FJEB 2A3JA 2XZDB 4IRDA 3ADAC 1LXNA 2MB0B 1VRUA 4M5MA 4WIQA 5AXKA 4EI2A 3V5RA 1S6PB 3M32A 4ECRA 4PG7A 3AB2B 3DOKB 1D09B 2DHXA 3VQTA 1XTZA 2WHOA 4LSNA 1BQNB 3EVWA 2NYIA 4DF4A 4JV0A 1PO6A 4PEOA 1RAGB 4OI6A 3DCAA 3DDIA 3MMBB 2QYCA 1WG4A 3HMJG 2UVRA 1S57A 4B9VA 2ZUAA 3CF5Q 2L48A 2AW0A 1Z4UA 1QE1B 1NK6A 1YJ7A 3HZGA 4MH8A 2HYIB 3SI8A 2M70A 4B9MA 3CUNA 2PA3A 4HH0A 1PIEA 2LA4A 2YKMA 1FFWB 1ZM9A 1F6TA 5I3PA 2AKWB 5HAOA 4CNYA 1I51B 4WKYA 1C1BA 2POKA 4KR0B 2HIQA 4PYDA 2BRLA 1PBUA 1M5SA 1W26A 4EYIB 1G3OA 1FXDA 1VC5A 4DV0F 4F3OA 4IRKA 4X66J 2GFFA 3P3DA 3ENAA 4I2PB 2CQ0A 2H4WB 2FLOA 2C2NA 4BS2A 4DDFA 1SUQB 3K5OA 3K5LA 3HFKA 2RB7A 3TA2A 1PJ5A 1ZOTA 3MMAB 4F02A 4P9SA 3IXQA 3PW7A 1N34F 2OFGX 2I5JB 1RHMB 2ACYA 3EDQB 3MFIA 3OR2B 3MD3A 5E5NA 2Q6CA 2VFUA 1VYAA 3MEGB 2C42A 4DG1B 1H0HB 4PWDA 3VTIA 1Q8LA 1P27B 1DZ5A 2HEKA 1VLOA 4DV2J 5J2NA 3MAAA 1FE0A 4DX8H 2LU2A 4CTAA 3L09A 2QL5B 3DFEA 4GO7X 2CKWA 2VG7B 3MMCB 3PRVA 4LBHA 5E33A 5HQ8A 3VCDA 2RDDA 2H5EA 4J9VA 1S0VA 2JLGA 1X0FA 4WCEQ 4N7TA 3NS5A 3K2YA 1GNKA 1X4DA 4C8NA 4A8QA 3VAKA 3FJ2A 3CO9A 4GC6A 1RT6B 4OJHA 3HULA 2ROGA 4NXNF 4JI3F 2IVYA 3W9IA 2XY6A 2UUAJ 3JQJA 3CXCR 1N0UA 3C66A 3KKFA 3AXKA 3OVBA 3GWCA 1YBTA 2ZHAA 4LQ3A 1R8PA 1CS4B 4Z7YA 2Q6BA 2NXUA 3HHNB 1SH0A 1T03A 2LDIA 4I7FA 3J7YU 1U2FA 2W2OP 3DXSX 2G9OA 3MTKA 4J7CA 4LREA 2IVMA 4AL5A 2KVIA 1TL3A 1E6YB 1WI8A 2B8PA 3BSCA 3HHEA 4USTA 2MSSA 4JI7J 4TY8A 1SKWA 3T41A 3EVOA 2JFDA 4P6QA 4K0KF 1HPZB 2WVDA 2NS1B 4M5DB 4ZITA 2HLTA 2VBZA 1OSCA 3JSMA 3OL6A 1QAIA 4HACA 2ZE2A 1KQKA 2K3IA 3C14B 2F5GA 4U6PA 8RUCA 2JJ4D 3SSRA 2VPYB 3TR5A 2ZWOA 2NUHA 2W9AA 4N5SA 3NXZA 3DLEB 3IAM9 5HN0A 4OYBA 2WONB 2XYHB 1N5YB 3PFOA 3IWLA 3LAKA 2R2RA 4M5IA 2V9KA 5KFWA 5KFFA 3NS6A 1HI1A 2XLKA 1H7WA 4CLYA 3KK2B 4QW8A 2OMLA 3NS7B 1NB2A 1UW9A 3BSNA 1U47A 4F3QA 1DTQB 1VIXA 4WK1A 1Q8IA 1ZPVA 4MFBA 5J2QB 3NEKA 1ZS6A 4DQPA 1S0MA 3GFXA 2P8IA 2BABA 4K5RA 3IO1A 2C3UA 1V5VA 2ZH1A 1W2IA 2GGPB 2W4DA 3BZQA 4IG0B 1QD1A 4TY9A 4F0HA 3NGUA 1KLNA 2GMJA 5A0YB 3NBPA 1UFLA 3KHHA 5KFPA 2R3VA 4OHZA 4O4RA 3SEOA 1B0TA 4DL0C 2IMOA 2M2BA 1C4CA 2GAGC 4BHQA 5HP1A 4YY3F 2HFZA 1R89A 2XMAA 1VQKS 4J90A 4IO9Q 4IFVA 2O67A 4NEYA 5AJ3F 3TZWA 3GLJA 3EX7B 3GIJA 2X7IA 1XC9A 3LPEA 3L4BC 5K20B 2NQPA 1WSVA 2C2EA 1VK8A 3PFEA 9RUBA 4ZVTB 4Z2XA 2OPRA 3DHXA 1L3TA 1H98A 1UWBA 2PDAA 1QTMA 2ZJPQ 3M6XA 3CDAA 1S72S 1XK8A 5J2MB 1XEZA 1SKUB 2B43A 2LFVA 4CYUA 4EEYA 2OPSB 2QLFB 1YBUA 2YX7A 2I1RA 1XNRF 2E29A 3HSGA 2QA4G 3M8PB 3HHLC 2XO7A 5A8RB 2Z2YB 1RT1A 2OEKA 4DR6F 1LNQA 3N6LA 2OAUA 4KTQA 4P52A 4RUCA 3TAPA 1WOSA 1EQMA 2EPIA 2ZOGA 4USUA 1Q8BA 4Y0FA 2NCKL 4LF2A 3B8HA 3I5CA 3W64A 1NDKA 3LGNA 4DHVA 1WG1A 4R0EA 2HHWA 3HSDA 2LEBA 4IH5A 4HT5A 2ZH7A 2BM0A 4KPYA 3UFCX 4ID5B 3W8PA 3T9NA 1M1KT 3KMQA 3FQKA 2YKNA 1S1WB 2YKAA 1YI2S 3WX4A 4LF7J 3CJ0A 2APOA 5K5MA 2VOPA 4PWWA 1DHMA 2WRMA 2YVSA 3MM7A 2LKZA 3PYEA 4NXMJ 4C98A 3BREA 3CDUA 2RSQA 1JLGA 4NLPA 2YNHA 3M4XA 3ETMA 4M5LA 3QGPA 3CSKA 2CFXA 1F3FA 2HFSA 3VV2B 1NSAA 4RNFA 4ANEA 5THWA 4O4GB 1U49A 2IC3A 1SJRA 1FNOA 4ZJOA 3UE2A 2HQGA 5CZVA 1KRPA 5ETPA 4HHJA 3C6TA 2ZZNA 3H2UB 1YZ7A 2G2OA 1HNWF 5KFRA 1U26A 2C2MB 1T11A 4B9SA 2YNGA 2RF2A 2HHTA 4LF9J 5KFTA 2WVEA 4RX6A 4DV7J 1Y7PA 2CRLA 3LP0B 2ATCB 3HP6A 2MKYA 3QPIA 4LBPA 3PM9A 2RE1A 4KHPF 4ECXA 2XCPA 3AOCA 3RR7A 4IR1A 2AMCB 4L73A 4QWDA 2IRUA 2ACMA 3CGIA 2HNDB 1TR0A 4OIXA 3QWUA 4K4VA 2Y3YA 4ZVQB 1KQSR 1S99A 2ZH9A 2QZ8A 4Y2KA 3X1LB 2QMWA 4E2FB 2YNFB 2FZCB 3E01B 4Y00A 2D41A 2W7AA 3ZFVA 2FZKB 2ZOMA 2GIQA 2W2QP 3UR0A 1FHTA 2Z58B 4I6WA 2BANA 5LJ3Y 2VICA 4EGLA 3BGUA 2V50A 2IDLA 5KFEA 3PX6A 1Z2ZA 2HQDA 1K73T 3FSIA 1D8YA 3OTDA 1DY3A 1QJHA 2FUG9 2ZDOA 2HG4A 2CQHA 4PRFA 2EEYA 5EHHA 1NO8A 1CJKA 1U1QA 1LK5A 3D68A 4Y2AA 2FJDB 1BWVA 2VQFF 4I69A 4P2XA 2FGOA 4P74A 3FBFA 1WF1A 1S1VA 5ETLA 4NI2B 1R8CA 3CJQA 4PR6A 4YP3A 3LP2B 3KJNB 1YRUA 1HQUB 4USJC 3BGFA 1OYDA 3TA1A 3I82A 3N6NA 2KG1A 1S12A 3BGRA 2XMKA 2AZ1A 4LVNP 3MEEA 4OLOA 2YBVA 2Z8QA 4PWUA 2VOOA 3PRBA 4USKA 4X4RA 2UUTA 2PEBA 3JAMU 2OIHA 1F9HA 3PIOQ 2CPYA 2M4MA 4JI5F 4LUBA 4ERDA 3RBZA 4L76A 4DV0J 5KFYA 3S01A 3R27A 2NXEA 2O01C 1S10A 3M6VA 3Q8RB 4UZBA 3EZ5A 2RRAA 3SSSA 4O0NA 2RS8A 4EU0A 2VKZG 3SFGA 1APSA 4KO0A 4B08A 3DOKA 4D3GA 2YPZA 1N6QB 3CJ4A 1BQNA 1FXRA 1XR6A 1N56A 3CCSS 1HARA 1RTIB 3P5TL 4UUXA 3G6VA 1HNXF 4BC9A 3KG0A 5B0DA 3EXCX 1NPKA 1N34J 1TU0B 2GMHA 2KT5A 3Q8QB 3PY8A 2KFNA 1T9YA 1FD2A 2UVVA 2WOMB 4FF4A 2K7JA 2RKIB 1K8AT 4QWCA 4X4UA 2W01A 4NLSA 4NWBA 2LDYA 4XAKA 1YJ9S 4OI2A 4ETXA 1ZA1B 3OXLA 4ECVA 2NPFA 1VLYA 4CH7A 3OVAA 3D0IE 5AXNA 3DMJB 1VFJA 3HJFA 2Z57B 3OT9A 2B4OA 2G0JA 1RABB 2DNGA 3BPDA 3BH7B 5HROB 1KC8T 2XLJA 4WXWA 1A9NB 4AYBD 3F44A 2Y0BB 4UUWA 1T05B 3E2EA 1KNZA 5KFZA 5LSRA 3G8TA 1N5QA 2D3UA 1IJFB 5E3QA 1AUSL 2UV8G 3CC2S 2R8JA 1KQFB 2DEIA 1HL6A 2J7KA 3HFZB 3FCWA 5KG1A 2UU9F 4B9TA 4KGVB 1RAAB 4NXNJ 4JI3J 4ED7A 1UAWA 1NB7A 3R1HA 2MJUA 4P2FA 4DG1A 3V6HA 2XS7A 3FMBA 3GR1A 4AQYJ 4ILLA 5M2PA 2DT9A 1PGZA 3NGKA 4TKTA 4OLPA 3DOLA 2QLBB 4L3NA 1L3VA 1IR2A 2B3TB 1B64A 4FF1A 5IZHA 1FKPA 3HKWA 3R7SB 2BRKA 2AYBA 2GVDB 2RDJA 3IR6B 2VV5A 4JBCA 5I42A 5KFQA 5B0FA 2FLNA 2C3MA 2ZZTA 2RH3A 3CJ5A 3G6XA 3S1TA 5F8MA 1LFWA 3N4WA 4PUOB 2X1FA 2Y1JA 1S9FA 1T3OA 4ZJQA 2OUGA 1HLWA 2AD9A 1RT5B 5HI7A 4K0KJ 1IKWB 2DK2A 4WZMA 1AA1B 3FFIB 2EI5A 4G1IA 2NR0A 1U25A 3UVJB 4DLEA 1C0TB 2GHVC 4PAAA 2KL8A 4P7TA 3CD5A 1WWHA 5ETTA 1RISA 2WCXA 2MKCA 4U67Q 3V81B 1QM9A 2M5YA 1YIJS 4QR2A 3I32A 1Q16B 4BDPA 1DJ0A 2KZZA 2MYFA 7AT1B 5GAEI 3PXGa 3DLJA 3RAQA 3SZ2A 2E7XA 3ENWA 4Q8EA 2R8KA 1OWXA 2XCAA 3DN9A 3G6YA 2XBPA 2DO0A 2VDHA 2MQMA 1YK9A 3OTCA 4GVLA 2DR7A 5KT6A 1X4GA 3ICLA 3QRQA 2MZRA 2RUGA 2AEMA 4QIGA 3SDEB 2DPIA 4OHWA 1WDTA 4YOEA 2A18A 3OR1B 1RADB 5F41A 2XNQA 2CG8A 3JXOA 5HQLA 2ZH8A 3RW7A 3KLEB 1JLFB 3HHLD 4M5DA 3QFWA 3K7RA 4DR3F 2VUGA 3PJWA 3BS9A 1WOOA 4DR7F 4CO4A 4ZP9A 2RU3A 3C14A 4OV6A 4G6VB 1TKXB 3ZTRA 2LXUA 1HYSA 3POTA 3DI6B 2EBEA 4WE1B 4WF9Q 1KFDA 4U8YA 2GW8A 2B5JA 2WONA 2W2MP 2A10A 4F0KA 3A12A 4YY3J 5E7OB 4J9RA 5AJ3J 1RXOB 1TKTB 2VF3A 3MXHP 4DS5A 3EDRB 1RU2A 4OI4A 3UPFA 4U7CA 1RWUA 3CDWA 1WC0A 2R4FA 2Z56B 2WW8A 2FJXA 1Q4RA 2WBRA 2DHGA 3ILOA 2DVIA 3QSIA 3PKMA 3ITHB 2D9PA 1AUDA 3W9JA 4JI6F 4UF4A 5HMYA 1XNRJ 3MDFA 5LL6d 4DZDA 2VQEF 4DR6J 4DL7A 1GXUA 4OZ1A 4MIBA 3ZC4A 1UMJA 4OYIA 2YH1A 1JMTA 1BD6A 3EJMA 3VAFA 3MZIA 3CJ2A 3EGVA 2EC0A 4KT0C 5JVHQ 1X4CA 2AP6A 2L3MA 1M5VC 2C2RA 1LWXA 2O66A 1QSYA 1YJNS 3L7OA 2W9CA 1DLOB 2E7VA 1X4HA 4O3OA 2Z0GA 3P5BP 4WXOA 4KRWA 2RDIA 3NAHA 2XS5A 4AE5A 5K14B 3CC7S 4IYQA 4DN0A 1PJ7A 5J2MA 1S0OA 1FKOB 4KYZA 4AXIA 5GADI 2AJQA 1U02A 2ZD1A 4A8YA 1FI4A 5D0RA 5J1EB 4XPEA 3M8PA 2OJ3A 1S9EB 3LGMA 1VC0A 4KV8B 1RAEB 4N56A 2MKKA 3LH2S 2E1RA 2JL9A 4G3IA 3RAMA 3QRRA 4HVZA 1C4AA 3AB4B 4I6YA 3IR5B 2ZC3A 4RWWA 5F8NA 3QT6A 4OZ2A 1FO1A 1OQ3A 4D3HA 3OTOJ 1HNWJ 5ETRA 3CCLS 2FC9A 2Y0SD 3PW4A 3EGZA 1NHKL 1KLMB 2O3DA 2VBWA 4WU2A 1S1WA 1XWLA 1TV6B 1EQ0A 1CQMA 2BJ1A 3CJKB 3D6HB 2BBEA 3KLHA 1A6LA 3QATA 3NG8A 3CNQP 3UNYA 1MMLA 3DRYA 2E1CA 4KHPJ 2F9DA 4DCPB 2HBRB 1UKUA 2B7CB 5K8NA 2CNNB 3A13A 4OYMA 3QO9A 3P4UB 3TZXA 2MXYA 4N47A 3CCES 1P9YA 4XDDA 2DR8A 2BMBA 5GVQA 4RUBA 3TP2A 1IUJA 3PEHA 2BM1A 1HBOA 4J9KA 2OELA 4ZOSA 4KAIA 2PFFB 3HZEA 4O4GA 1SJFA 2P9CA 2W8KA 5J1PA 1UL3A 4KGMA 2FY8A 3T5LA 2V2VA 4HL9A 3R6LB 2QL7B 1TL1A 4N76A 5K8MA 3JAMY 2KJWA 1WF2A 2KFYA 2F8HA 3T5JA 2F8EX 4GKJF 1AW0A 4ILRA 3T6JA 3KJVB 3HVTA 4M5JA 4NCGB 4ECWA 1KONA 5I3QA 1PYSB 4O3PA 2YH0A 3THVA 2Y1IA 3TQ1A 4N77A 5A8WA 2G1DA 2BV3A 4NYPA 3OJUA 5H9EK 1WEZA 4ZA1A 1L3SA 2EKNA 2HZAA 5HK4A 2F9JA 3I4HX 3M1VB 3O1LA 4DWIA 3A8JA 3WIUA 4DI6A 2VC0A 1OQ6A 3OXGA 2VQFJ 2RMLA 4IH7A 1KTVA 5A8KA 5DDOC 2PSZA 3MMJA 1NCLA 2QJ3A 3OFGA 2HNDA 4WTOB 4G1PA 3GCWP 3WC0A 2CQ4A 3BM7A 4ED2A 4Y3CA 3D6TB 1DARA 2H1YA 1X4EA 1JJ4A 4B17A 2X3GA 5HMWA 3CCWA 3NCQA 1D9DA 3BKUA 4ICLB 3OW2R 2YNFA 4LFBF 3E01A 1VQOS 1IN0A 3ZZZA 4JV2A 4ZPCA 3FKBA 2J9DE 3BKTA 4JYAF 2F1FA 4EBEA 1VJWA 3JSBA 4IQXA 3C16A 5IC4B 1RTDB 1SIZA 3GIIA 2VG6A 4YUDA 3PR4A 1I94F 3CW2C 3MGJA 4Y34A 4ZIVA 1FWLA 4M5GA 3HXMA 2DHHA 2ZBPA 4JI5J 1TK0A 4NPOA 2FPHX 3JQKA 5HLFA 2HFNA 3QRPA 4KGZB 1F5AA 3K17A 2Q3PA 2HS4A 1HNVA 5D4NA 5KFJA 1N5SA 5KFIA 3RAXA 1N36F 3PR5B 4ZPBA 1FF2A 4ED1A 2FHOB 4NI2A 1VBXA 3GJSB 2HRUA 2PIIA 3CULA 4PG4A 1TKZB 1U48A 1HHSA 3LP2A 1JK9B 2F4FA 1HQUA 1OPZA 1ZZFA 2DY9A 3BR9A 1XR7A 4PCQA 1VOMA 2Y9HA 2ZHBA 4ZPDA 1VQYA 5BR8F 3C6UA 1HNXJ 1LXJA 1RHQB 3M9OB 4Y2MA 3W1YC 2HK3A 1RT2B 3D1OA 4IUFA 1CBKA 3V4IA 1SKSA 2CQ1A 4ED6A 2ALZA 1S6QB 2VBYA 2HNYB 1I3OB 1HNIB 1IXKA 3DRSA 4JB8B 2FHJD 5D0GA 4DS4A 1BHNA 1CQNA 2QLJB 2R8IA 2I38A 5LSLA 2W8LA 3KDNA 1VQ5S 4EZ9A 2BQUA 1UVNA 3HVAA 3P6YC 1RWPB 2G2YA 4ZCIA 2B51A 2CJAA 2AWZA 3L7PA 1UWAA 2ADBA 4DN9A 1U09A 4UY85 1TVRB 1MW7A 4FBUA 1FJCA 4GVBA 4P2MA 5IWAJ 4CLTA 4NE9C 3NOGA 3H5XA 3QBCA 3KNAA 1N6QA 2OPPB 4DV5F 3N28A 1NUEA 4DCJB 3QGIA 1RTIA 4B3SF 2V8PA 2CJQA 1T0TV 1YVFA 3LWLA 1TAQA 3G6ES 2UU9J 3E3XA 4CLZA 2W4CA 1WKKA 5BXIA 1TZ0A 2BA9A 4LF5F 5CD4A 3TANA 5F8IA 1U0HB 3ZTOA 4CT8A 1T9UA 2V9WA 1U8SA 1Y10A 3M2VB 3R5CA 5FDLA 2I6WA 3ZZYA 3M9NB 2AEJA 3QGGA 5KG6A 4DBQA 3DMJA 1DBDA 4K2JA 1CJUB 1AYEA 1GMVA 3TARA 1Q81T 5HROA 2RIJA 2AGPA 5HBMA 1WF0A 2PEHA 2XEXA 4AFFA 3MR6A 2YQ0A 2X1AA 5D3GB 4ER8A 1TL5A 3NMAA 5JUMA 1EIYB 1S6OA 1N4LA 1T94A 2AEFA 4M95A 3Q89A 2CQDA 4AUKA 5B0AA 4URGA 2IJFA 2GO8A 3H5YA 2FVRA 2J9EA 4TXSA 2BJ7A 2E5IA 3QT5A 2AHOB 2VG5A 5D4OA 1JIHA 1O51A 3KK3B 2ZJRQ 3RR8A 4RL1A 2FHJA 1BQMB 1HBNB 4NA3A 3R6GB 4CI0B 3ZTQA 2P6TA 4KGKA 4QJVA 3TUJC 2IY5B 1R8BA 4KY3A 3CE8A 4EZ6A 3IP0A 4OJ3A 5DG8A 1IKXB 2H51B 3CCQS 1T02A 1MROA 4ZCMA 3V6DB 1UPMB 1CULB 5L1KA 3A4TA 3CD7A 2A6OA 3OL7A 3NL0A 3DHWC 1FDDA 3H59A 1P6TA 3W5ZA 4LMZA 1T9XA 2KZMA 2BXJA 1VQPS 4RW8A 2C2KB 2ZM6F 1QUPA 3UDVA 3TAMB 5L38A 1R3NA 2VASA 1Y11A 1IKWA 1Y9OA 3K89A 5J2PB 2AT1B 1AXQA 4WP9A 2OSRA 2N4DA 3FFIA 1FERA 2V34A 2E66A 2VPXB 2BEFA 1CVJA 4DR3J 1JLAB 1NKEA 3ONQA 4X2BA 4DR7J 2HFVA 3V81A 3J80U 3F56A 2W9BA 1BWEA 3A1YG 3H4DA 4EBDA 1S97A 4R8UA 3GYXB 3SCIE 3VZHA 4GMKA 4OYAA 1GFWB 1RJJA 4CWBA 1F9FA 1RAHB 4N41A 3R5BA 1NZ8A 2BJ3A 4EFAC 2VFVA 1NHVA 4I1TA 4ES1A 3RGIA 4GC7A 3H7HB 4NLYA 5B0EA 4MKYA 4F4XA 3FUYA 1ZTWA 3RYLA 3SDEA 5LMNF 3V6JA 3OR1A 2Z30B 4RW9B 1NK7A 4FNIA 3VWSA 1JLFA 4UY8T 3MM9B 3SCKE 2CQBA 5ETMA 2CZVC 3UD4P 2XHCA 4Z7CA 4DPTA 4DSJA 1O0PA 2B9WA 1C0UA 3VVUA 8AT1B 3FEXB 1MU2A 2COLA 2VQEJ 2CZ9A 2WSFC 4OX7A 1VQMS 2LEAA 3GILA 5DGAA 3HCXA 1RA7A 1FD8A 2L41A 1FVQA 3DRRB 5F3ZA 4CH1A 1SKRA 3N5FA 2EFNA 4FXWA 3ET6A 2HK2A 1RU1A 1JKHA 5DDQC 1JXVA 3VAMA 3DM2A 3BBCA 2MLYA 4KJIA 4J9OA 2P9EA 3HVWA 2QN6B 2XSJA 1TUGB 2LQJA 1HNZF 3OL8A 1JLCA 3U27A 5KFMA 2KB2A 3KDOA 2IFXA 1KS2A 1SC3B 2V8DA 4Y2CA 2KM8C 2IBKA 2HLUA 1SL1A 1U2RA 2OLWA 3G96A 2J8SA 4I68A 4DQRA 1KFSA 3ITHA 4RPFA 1UVKA 5KTQA 1U2CA 1VRQC 2DNLA 1XBWA 4Q44A 2DKOB 2DH9A 3AHPA 2PA8D 2UV8A 1UVIA 2M8HA 2N7CA 3C46A 4DOZA 4LF8F 4CO1A 5E3CA 1UVLA 4DSLA 3FVYA 3KXDA 5DG9A 1T8EA 4LSLA 2OHDA 3GTYX 3FZBA 4P7VA 4A4JA 4C8ZA 1HWIA 1FNMA 3BSOA 1F9EB 2XZWA 2V4RA 5F8LA 4JI8F 2I9SA 3BYPA 1KTQA 3HHDA 3MUVP 3D1HA 2BX6A 1RT7B 4JI0F 4F4WA 1TMJA 3R2DJ 2N3OA 2YNIB 4LF1A 3QJLA 2EG1A 3MPWA 4F36A 4C8LA 1K44A 2FB0A 1MN9A 3DRXA 3LUYA 2V94A 3PNIA 2HMIA 4TN2A 2LQ9A 4ZPAA 1F5CA 1HR0F 2VIHA 3M30A 3I55S 4R25A 3NGDA 1S1XA 3K0JA 2OPQB 4ITSA 4RBTA 1FA0A 5IQ6A 2XI2A 3EPGA 3IWNC 4MYUA 2JDJA 4WU3A 1J5OA 3HKZD 3I0RB 2B4VA 3ZZOA 3QWPA 1LWFA 4NZ6A 5A76A 1FRIA 1JXLA 1REVB 2CJBA 3IC1A 5I3UB 4NLRA 3Q8UA 4KE5A 1H38A 1C1CB 2QRRA 5L46A 1MMDA 5IM0A 3MECB 4GKJJ 4DR1F 3PKYA 3THTA 4H4KC 3KOAA 4W4MA 3MR7A 3OTBA 4RNNA 1WI6A 3UN3A 2DXFA 3KNGA 1YJRA 3J81U 1KDNA 1Z2LA 2QO3A 2BJ8A 1P1LA 1VQLS 2CPEA 4RW6A 4C8MA 1GT8A 3QGHA 2UXCF 2GS8A 3M8QA 5K8PA 4W90B 2ROPA 5HJXA 1M1GA 1BLUA 1FWPA 4OHXA 1SJ1A 3TOQA 3N9UC 5KFDA 4BC7A 4NLGA 2E1PA 4RU9A 2B8QA 4ECSA 3QLHB 2PO4A 1R6VA 1U1OA 2QA4S 5KG0A 4LFBJ 1RWMB 1X5TA 6FD1A 3BN7A 5CYMA 4Z37A 2I2YA 1K1QA 3VGSA 4ED5A 2XB2D 3MHYA 2KT3A 3DOMB 2Y1LB 5E2QA 3UI3A 4DQSA 4ZKAA 5KFCA 3Q22A 3SIPB 1IWAA 1AZSA 1W7WA 2ZWPA 4FN5A 3SBMA 2B9EA 1H3DA 3DDKA 1JNRB 2ILZA 4M5NA 5L39A 1Q7LB 3V6KA 4WKRA 2HFOA 1FTRA 3M1VA 4C11B 1N36J 3TNVA 5DM6Q 5DO2A 1FESA 3W66A 4CH0S 1JJHA 1RWVB 2AJ2A 3D7SB 3OV7A 3RBDA 2FVQA 4HDHA 2OFHX 4DR5F 1EZZB 4ZS6A 2NREA 3EGWB 3ENVA 2M8DB 3IG1A 5BR8J 5M2UA 3AT1B 1EAYC 1YTYA 1DRZA 2J76E 3CDBA 2UP1A 2XQCA 5A6WA 1H7XA 4YR0A 4QYZK 3NGTA 1NK5A 2XMTA 3TAQA 5M2RA 3R9LA 1WHWA 3BV8A 4OHYA 1AT1B 4H4OB 3NAIA 1RTDA 2F7VA 1LWCA 4K4YA 2JZ5A
chains in the Genus database with same CATH topology
2HVDA 1NB2A 4S0MA 1XQIA 3Q83A 3BBCA 2DXEA 3ELHA 1NHKL 1U8WA 3ZTPA 4DUTA 3VGVA 3BH7B 4FKYA 3L7UA 3FBBA 3PRVA 4C6AA 3Q86A 1PAEX 1W7WA 4ANDA 1B99A 2DXFA 4EK2A 5C7PA 3GPAA 2B8PA 1B4SA 1KDNA 3ENAA 2BX6A 1NLKL 1LEOA 3Q8VA 4O0NA 4WBFA 1HLWA 3BBFA 3EVOA 3FBEA 4F4AA 1NSKL 2CWKA 1ZS6A 4ANCA 3B54A 4DI6A 3FC9A 1EHWA 3FBFA 3PJ9A 1XIQA 3EVWA 1NDLA 4F36A 1K44A 1MN9A 1NUEA 3EE3A 3VGTA 1NCLA 3B6BA 1BE4A 4KPCA 5IOLA 1WKLA 3DDIA 3Q89A 2BEFA 3GP9A 4HR2A 1PKUA 3ETMA 1S57A 2DY9A 4FKXA 4UOGA 3EMTA 2ZUAA 3FCWA 3VVTA 1S5ZA 4UOFA 1NSQA 3WX8A 1NPKA 3VVUA 1BUXA 3NGUA 3ZTRA 4ENOA 1F3FA 2DXDA 2HURA 2B8QA 4UOHA 4ANEA 3EVMA 1VYAA 2AZ1A 3JS9A 3Q8YA 1WKKA 5BXIA 4DZ6A 2NCKL 5CAAA 3EJMA 3VGUA 1NDPA 3EICA 3FKBA 3NGSA 3NGTA 3BH6B 3ZTOA 1MN7A 2VU5A 3ZTQA 1NDKA 1S59A 3MPDA 3DKDA 1F6TA 3FBCA 1BHNA 3R9LA 3NGRA 1WKJA 3VGSA 4W98A 4CP5A 1HIYA 3G2XA 1LWXA 1UCNA 3Q8UA 2DYAA 1HHQA 3EM1A 3FCVA 1NSPA 5CABA 3ZTSA 1NDCA 3BBBA 2HVEA 2AZ3A 1JXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HVD A;  1NB2 A;  4S0M A;  1XQI A;  3Q83 A;  3BBC A;  2DXE A;  3ELH A;  1NHK L;  1U8W A;  3ZTP A;  4DUT A;  3VGV A;  3BH7 B;  4FKY A;  3L7U A;  3FBB A;  3PRV A;  4C6A A;  3Q86 A;  1PAE X;  1W7W A;  4AND A;  1B99 A;  2DXF A;  4EK2 A;  5C7P A;  3GPA A;  2B8P A;  1B4S A;  1KDN A;  3ENA A;  2BX6 A;  1NLK L;  1LEO A;  3Q8V A;  4O0N A;  4WBF A;  1HLW A;  3BBF A;  3EVO A;  3FBE A;  4F4A A;  1NSK L;  2CWK A;  1ZS6 A;  4ANC A;  3B54 A;  4DI6 A;  3FC9 A;  1EHW A;  3FBF A;  3PJ9 A;  1XIQ A;  3EVW A;  1NDL A;  4F36 A;  1K44 A;  1MN9 A;  1NUE A;  3EE3 A;  3VGT A;  1NCL A;  3B6B A;  1BE4 A;  4KPC A;  5IOL A;  1WKL A;  3DDI A;  3Q89 A;  2BEF A;  3GP9 A;  4HR2 A;  1PKU A;  3ETM A;  1S57 A;  2DY9 A;  4FKX A;  4UOG A;  3EMT A;  2ZUA A;  3FCW A;  3VVT A;  1S5Z A;  4UOF A;  1NSQ A;  3WX8 A;  1NPK A;  3VVU A;  1BUX A;  3NGU A;  3ZTR A;  4ENO A;  1F3F A;  2DXD A;  2HUR A;  2B8Q A;  4UOH A;  4ANE A;  3EVM A;  1VYA A;  2AZ1 A;  3JS9 A;  3Q8Y A;  1WKK A;  5BXI A;  4DZ6 A;  2NCK L;  5CAA A;  3EJM A;  3VGU A;  1NDP A;  3EIC A;  3FKB A;  3NGS A;  3NGT A;  3BH6 B;  3ZTO A;  1MN7 A;  2VU5 A;  3ZTQ A;  1NDK A;  1S59 A;  3MPD A;  3DKD A;  1F6T A;  3FBC A;  1BHN A;  3R9L A;  3NGR A;  1WKJ A;  3VGS A;  4W98 A;  4CP5 A;  1HIY A;  3G2X A;  1LWX A;  1UCN A;  3Q8U A;  2DYA A;  1HHQ A;  3EM1 A;  3FCV A;  1NSP A;  5CAB A;  3ZTS A;  1NDC A;  3BBB A;  2HVE A;  2AZ3 A;  1JXV A; 
#chains in the Genus database with same CATH topology
 3MOZ A;  1QSS A;  4J9N A;  2KRR A;  4DR4 F;  3B82 A;  4DV1 F;  4HKQ A;  4RW4 A;  1YG0 A;  2MQL A;  2CJY B;  5CYQ A;  1T9V A;  2BE2 A;  4TQS A;  3C15 A;  1EHW A;  3MM8 B;  1SIW B;  1WC1 A;  3JYT B;  1B70 B;  1I5O B;  1WHX A;  1G6B A;  3WQP A;  3A8I A;  1MG7 A;  3CIM A;  5HVG A;  1TKZ A;  3O6Q A;  5IOL A;  4CRJ A;  4DV5 J;  4I2Q B;  2WVB A;  3MM6 A;  2D3O R;  1OY8 A;  3T19 A;  1PKU A;  4K5S A;  3RBX A;  4O0I A;  3FDS A;  3GR0 A;  5AE3 A;  4ZPV R;  4B3S J;  1A7G E;  1SBR A;  1JLQ A;  1RAJ A;  1OJ4 A;  1Q86 T;  3QZ8 A;  1T9W A;  3DLK B;  1S6Q A;  2HNY A;  3I56 S;  4RU2 A;  4LF5 J;  4Q5V A;  1RKI A;  3HO1 A;  2XMV A;  4OZ3 A;  2LMI A;  2PGC A;  4CLL A;  1RTH B;  3RB6 A;  5CCM A;  4ZVU B;  4X4O A;  4OJ1 A;  2DD8 S;  2Q43 A;  2ZBC A;  2CPZ A;  3P49 B;  3IS9 A;  1TFW A;  2AJF E;  5LM7 E;  5KFX A;  4JV5 F;  3CIZ A;  1H6K X;  1U1L A;  3SV4 A;  2JEI A;  9ATC B;  4J9S A;  3GE9 A;  2ZOF A;  4BLG A;  4DLG A;  4KIA A;  1HI8 A;  1SCJ B;  5D0H A;  2CPX A;  2FHM A;  3RG6 A;  4NA2 A;  4C3L A;  2OPP A;  2ZFH A;  1CJT B;  3Q0A A;  2GX8 A;  4KFB B;  2CPD A;  3D2W A;  5LSO A;  4WZQ A;  4J9L A;  4FPR A;  1M1H A;  2DNZ A;  1X5O A;  2FY1 A;  4ZN1 A;  3J80 Y;  3PW5 A;  4IFY B;  1LW0 B;  1J27 A;  3CB4 A;  1JLB B;  3DRP B;  5HAT A;  4QZV B;  4DZ6 A;  4KSE B;  1CSJ A;  3PYD A;  4QIF A;  3TVZ A;  2HVI A;  5IS2 A;  5DQH A;  4UQG A;  3PW2 A;  2XTJ P;  1DQ9 A;  1X31 C;  2QV6 A;  2RHQ B;  3M2V A;  4OX9 F;  1C2P A;  3M2R B;  1KOO A;  2NZ4 A;  5AE2 A;  3U1N A;  5C42 B;  3WBZ A;  1QVG R;  3HT3 A;  4G1Q B;  3N0V A;  3RRK A;  2ZVI A;  3PX4 A;  3HJV A;  4EUV A;  5EX3 A;  3TUZ C;  2RS2 A;  4IG3 B;  1KP6 A;  1SV5 B;  4NLV A;  5JVG Q;  2RQM A;  4OL8 A;  4MK7 A;  2NYH A;  1FDB A;  1FVS A;  4CNZ A;  3M8R A;  1WTB A;  1IKV B;  1U45 A;  3RB4 A;  3IBF B;  1VRU B;  2ZM6 J;  1WEL A;  5LXY A;  3I0S A;  2V4Q A;  2R7Q A;  4LR9 A;  4FS1 A;  4RJV A;  1QAJ A;  1Q7Y T;  1VBZ A;  3KMS A;  2YXL A;  3CJS A;  3PRD A;  4NX9 A;  5BYS A;  1EB0 A;  4QWB A;  1RK8 A;  1R0A B;  3FNN A;  1UZH A;  4LRD A;  1NK4 A;  2PMZ D;  1RCX B;  2QSW A;  4FYY B;  2DGU A;  3E51 A;  1RAI B;  3C2P A;  4HLB A;  4IR9 A;  1CG2 A;  1BQM A;  4FYX B;  5A6P A;  1RWK B;  4ZLN A;  2QC3 A;  1FK9 A;  4PKD B;  2HHP A;  2RQ4 A;  5HSP A;  1YIT S;  2K3K A;  2YQ3 A;  2PMH A;  3QJJ A;  2DRA A;  4P73 A;  3V6D A;  1CUL A;  3OUY B;  1RT4 B;  5G4D A;  2EFQ A;  5SZT A;  1FDN A;  3KG4 A;  4TU7 A;  1PYO B;  2KHC A;  3UN5 A;  5LMN J;  4C48 A;  3PTW A;  2CQ3 A;  1VHF A;  3TAM A;  3ZZP A;  3T9Z A;  3OLA A;  5J2P A;  1YWX A;  4J9Q A;  4CLF A;  5CCL A;  3UNG C;  1X5P A;  2XG8 A;  1JLA A;  2VDI A;  2H5J B;  5SUH A;  2YTC A;  1IWG A;  4ILM A;  3TZY A;  3QAE A;  5GMD A;  2DR6 A;  2PE8 A;  1FRM A;  2WBM A;  3MED A;  1LWE A;  1ZPW X;  2C3Y A;  3BDE A;  3V2U C;  4PWD B;  4X4S A;  4R5P A;  3D6F B;  2MQQ A;  4DJB A;  4CO0 A;  2IA0 A;  5J2N B;  4F04 B;  3MAA B;  3L7U A;  2QT7 A;  1WDD A;  3FQL A;  1RHK B;  2LYV A;  3UR3 C;  2HVZ A;  1NBE B;  3GPA A;  3VHQ A;  5ETQ A;  4CTA B;  3DGP A;  1HNZ J;  3BJY A;  2CWK A;  4RW9 A;  1QAX A;  4YME A;  3A3N B;  3BYR A;  2DJW A;  5CH7 B;  4PYA A;  2HBZ B;  1IKY A;  3AJ1 A;  1N32 F;  1WSR A;  2R7X A;  2E5L F;  2WZ1 A;  2WK4 A;  3AD9 C;  4C8Y A;  3EZU A;  1AB8 A;  4A48 A;  3BPS P;  4IH6 A;  1DUR A;  1CJV A;  1FE4 A;  3CCV S;  1O5J A;  3OFE A;  3TVK A;  3UDC A;  1WEY A;  2K7K A;  3RU0 A;  3VAL A;  1JX4 A;  4IRC A;  3PZP A;  5ETK A;  3ILL A;  3R1L A;  3IRW P;  2V4J B;  1S77 D;  3SCJ E;  1N54 B;  2BOP A;  2GNK A;  1VQ8 S;  2V8H A;  3T1H F;  1XER A;  4KKO A;  3L3C A;  4ED4 A;  4RUH A;  3J81 Y;  2VJV A;  1NZA A;  2FD2 A;  3Q8P B;  3GON A;  2OTL S;  2MQN A;  3TJ8 A;  4DPU A;  4F4K A;  1URN A;  4LRF A;  4MKB A;  3TUI C;  1T03 B;  5KG2 A;  4I7F B;  3ZZU A;  2GQ2 A;  3AFG A;  1VJQ A;  1URR A;  2DB1 A;  4JI0 J;  2C2Z B;  4DX7 A;  2MLZ A;  3W5Y A;  1N52 B;  1TL3 B;  4DU7 A;  5KG3 A;  3EE3 A;  3HM9 A;  3MUR P;  3RW6 A;  1FFG B;  2SXL A;  4MKV A;  3TZZ A;  2JOQ A;  1HWJ A;  1VQ7 S;  1MLA A;  2JNJ A;  3O3L A;  2PI5 A;  2QLX A;  4YDD B;  3ILI A;  3MR5 A;  3D54 A;  4ZVF A;  3R5J B;  2UVW A;  2XWX A;  2R2U A;  2NXN A;  4OX8 A;  4ZLJ A;  3I5B A;  2PFD A;  2ZE2 B;  2I0X A;  4QU7 A;  1HIY A;  2LP4 A;  3MM5 A;  4Q0B B;  2VBX A;  1GX5 A;  4HI1 A;  3KYL A;  2RT3 A;  2CPI A;  1BQX A;  1L3K A;  2ZH4 A;  4B3T F;  3TO8 A;  3VGV A;  3FBB A;  1B99 A;  2M52 A;  4DR1 J;  2V2K A;  3F73 A;  1B4S A;  4NYZ A;  4DL2 A;  1X4A A;  2AYM A;  2CPF A;  4WBF A;  2VHG A;  1RQ0 A;  2LEC A;  2IRX A;  4PXE A;  3UN2 A;  2N4C A;  1H74 A;  2UXC J;  2BE9 B;  1DQA A;  2K06 A;  4MFB B;  4X4P A;  1R27 B;  4RUA A;  3VF0 B;  3NLC A;  3I96 A;  3G87 A;  4K7Q A;  1F3V A;  2EKY A;  3ISN C;  3FSX A;  3TRG A;  4CIO A;  3FRZ A;  4WPA A;  3Q8Y A;  3W63 A;  1Q95 G;  1RWW B;  4IDK B;  1UEK A;  5KOX A;  3US5 A;  4ECZ A;  2XY5 A;  3J7A N;  4WFX A;  5IXU A;  3G9C A;  4H4K A;  2E44 A;  2FJB B;  3NBP B;  3H20 A;  4QPX A;  1YLX A;  5EN1 A;  2DBB A;  2ATL A;  4X65 F;  3ZZR A;  5KFB A;  5CAB A;  3ZTS A;  2J0S D;  2DCL A;  2LA6 A;  1C1C A;  5E41 A;  1HW8 A;  3K57 A;  2LQ5 A;  3AQO A;  1NND A;  2FDN A;  4HH1 A;  4Q43 A;  5MLC V;  2XYP B;  1X9W A;  2QA1 A;  1Y5I B;  1HBU A;  2CQG A;  1Q0N A;  2BW2 A;  1VK3 A;  1FEH A;  3CMA S;  3ZZ0 A;  1JLE A;  2H5I B;  3KUH A;  4IOB A;  4PG8 A;  1IBC B;  4NLW A;  4DSE A;  2CVE A;  3P96 A;  2PI4 A;  1VR6 A;  5B7W A;  1UWB B;  4F4Y A;  2A1B A;  2OSQ A;  4TU9 A;  3MCO A;  4DUY F;  2JX2 A;  2KVQ E;  4NLT A;  3MAH A;  1V3Z A;  2MZ1 A;  1S49 A;  4V19 X;  1RT3 B;  4CYU B;  1YKW A;  3GU0 A;  1Q5V A;  4K59 A;  4NRU A;  2QX0 A;  3HDS A;  3BGO P;  3Q23 A;  1NJY A;  1XNQ F;  2JLE A;  2KFZ A;  4WII A;  1R0C B;  4CLK A;  4EO6 A;  1P9Q C;  3UDE A;  3DNC A;  2FHK A;  2F3J A;  3TEG A;  1Q82 T;  4WFN Q;  3CO0 P;  3ETO A;  2QFI A;  4RR5 A;  2IAJ A;  4OZN A;  5CHC B;  2RJZ A;  3IM8 A;  4J9P A;  4FKY A;  2VON A;  3AY0 A;  2GML A;  2BQR A;  5GAH U;  3VAG A;  3UO0 A;  4DL4 A;  5KFV A;  2KYZ A;  4P72 A;  4DR4 J;  4DV1 J;  1N33 F;  2EW9 A;  3G82 A;  1SI9 A;  2FC8 A;  2P2C B;  2V68 A;  4F67 A;  3DLG A;  4I67 A;  5GAG U;  3G86 A;  2R7V A;  1FCA A;  3NCP A;  3MI7 X;  2R9L A;  4DSI A;  4ZP6 A;  4DMZ A;  2ROE A;  3EYZ A;  1SH2 A;  1S5Z A;  2WVF A;  2DNP A;  3KHL A;  4DV3 F;  3MM7 B;  3OQ2 A;  2MKI A;  2AYE A;  2ZZM A;  1NJX A;  3TVY A;  4OYO A;  3HX9 A;  4ZVS B;  4QU6 A;  5BYQ A;  4PPD A;  3JSR A;  1M90 T;  1RZM A;  3KLV A;  1S6U A;  1CLF A;  4USI A;  3ZZT A;  4F2R A;  2ZBQ A;  1TEL A;  2KTQ A;  1F2G A;  5KFN A;  3QYY A;  5IT0 A;  2IC3 B;  3G4S S;  1B7F A;  1KVK A;  3SQG A;  2LVW A;  4A47 A;  3KHR A;  2HVD A;  3MCM A;  4C0H A;  4ZMM A;  3QT8 A;  3QAU A;  4ATN A;  4P2S A;  1SPB P;  2KDO A;  4WYL A;  1F0X A;  1UA0 A;  4JV5 J;  2RF2 B;  2QIF A;  2OP5 A;  2B4U A;  2ASL A;  4MK8 A;  4C97 A;  3PJ9 A;  2HHH F;  2M88 A;  4ZN3 A;  4DSK A;  3CED A;  3Q2S C;  1WOP A;  2CG4 A;  2UXB F;  2MKH A;  4NXM F;  2LQB A;  3QID A;  4Q45 A;  3KLI A;  4LRA A;  3AH6 A;  5IC6 B;  3IRX A;  2OEM A;  3TJA A;  1VCT A;  2RD5 C;  2W2N P;  3W8G A;  3RZA A;  2O5D A;  1SL0 A;  3NGR A;  3MPU B;  1YBA A;  2B6A B;  2VC1 A;  1S6P A;  2CQP A;  2MKS A;  3DLB A;  4DUZ F;  4I4B A;  4OX9 J;  4LVO P;  1CPZ A;  1PC5 A;  1B7Y B;  1N88 A;  3GSD A;  3H4B A;  1UFW A;  3CCZ A;  6AT1 B;  4C3K A;  5H9F J;  2R7R A;  4B3R F;  5T41 A;  2A6M A;  4NRT A;  3MMB A;  1D9A A;  4LIW A;  2UUC F;  1QE1 A;  1GAO A;  1YQH A;  4A8X A;  3TX8 A;  1CJK B;  2CWX A;  2IHR 1;  1SL2 A;  3JTN A;  2OEJ A;  2KN4 A;  4BBY A;  4O3Q A;  1S1V B;  3ZNJ 1;  1U1N A;  4IFY A;  1W2B R;  1S1T B;  5KAK A;  3G8S A;  3A8K A;  4CO5 A;  3DRP A;  2XGQ A;  4USH A;  2NZC A;  1F60 B;  2ERR A;  2DNQ A;  1H2V Z;  1G7C B;  4LF6 F;  5DDR C;  3GIR A;  5F0W A;  4XTT A;  1D1U A;  3QMQ A;  2GJI A;  4HDG A;  4UTG A;  3FEZ A;  1V3S A;  3MEE B;  3M2R A;  4I2P A;  2Z4P A;  3W65 A;  1B0P A;  2DNY A;  4LJM A;  2KH9 A;  5C42 A;  3GV8 B;  1SUQ A;  2BJE A;  5H9F K;  3Q86 A;  3OL9 A;  3D0G E;  2CZ4 A;  3MMA A;  1SV5 A;  3OFF A;  4AT1 B;  1LEO A;  1KBR A;  1IR0 A;  2CAD A;  2I5J A;  1NK8 A;  3OR2 A;  2HZV A;  3FC9 A;  2QG9 B;  1IKV A;  3BB5 A;  1GTE A;  2HSE B;  4KH1 B;  4Q7A A;  4KC5 A;  1TUW A;  3RBE A;  4URQ U;  3TX0 A;  1FX2 A;  3MEG A;  4F7V A;  2M3D A;  1RGV A;  3Q2T C;  3GP9 A;  4I56 A;  1ELO A;  3ISZ A;  5JXS A;  4FKX A;  1EET B;  4KO0 B;  4UOF A;  4NCA A;  1R0A A;  2ABY A;  4NYO A;  3T1A A;  2KI2 A;  3WZ0 A;  4AL7 A;  1OO0 B;  3EWG A;  5MAO A;  4XDC A;  3BH6 B;  4ZLL A;  2XMJ A;  1OS5 A;  2VG7 A;  3KK1 B;  1X7V A;  3GFZ A;  2V6A A;  3MMC A;  1WAC A;  4K4Z A;  5U47 A;  1NJZ A;  2DR5 A;  2N82 B;  3O2I A;  4QR1 A;  3OUY A;  1RT4 A;  4B3O B;  1IBM F;  5ETS A;  1VQ4 S;  5C2G A;  1RT6 A;  4ZVO B;  4DFJ A;  2HAF A;  3AJD A;  1Q79 A;  1FJG F;  4MMO A;  1R0B G;  2FQQ B;  3TW0 A;  4CO2 A;  1EX8 A;  2DGW A;  2LXI A;  1TK8 A;  2DIU A;  4WTY A;  1Y3K A;  2OD4 A;  1N32 J;  3EMT A;  2E5L J;  2BE7 D;  1ROF A;  1WUU A;  3KHG A;  1CS4 A;  4MTP A;  4UOH A;  4EO8 A;  2B56 A;  4YHH F;  1WNE A;  3ENQ A;  4Y28 C;  4TLQ A;  1H73 A;  3OXF A;  4NL5 A;  4F8R A;  1UEU A;  3AJ2 A;  2GJ2 A;  1RWN B;  4IKA A;  1TL4 A;  1ARO P;  1E6Y A;  3SXL A;  1ZM3 A;  4NEZ A;  2GO9 A;  2XHW A;  3N79 A;  3AOD A;  3AA8 A;  1HPZ A;  3T1H J;  4S0M A;  3DOL B;  2GHP A;  2HQF A;  1SQG A;  2XMU A;  1NJI T;  3W5X A;  5L9N A;  1RAO A;  4RZR A;  4K4U A;  2V2Z A;  2DGS A;  1YX2 A;  1FKP B;  1GMU A;  5I4M A;  2DNH A;  2HGN A;  4ZHR B;  2F40 A;  1XR5 A;  3RUB L;  5I42 B;  2JHE A;  2U2F A;  1NDL A;  2YY3 A;  2KJV A;  3ISN D;  5F9L A;  1WKL A;  2YKP A;  3HK2 A;  3DLE A;  3L9Z A;  2YX4 A;  4WP3 A;  4L3K A;  3OTE A;  1N5Y A;  2JWN A;  3W3S A;  4OZJ A;  3CVK A;  1QDU B;  1RAF B;  2Q79 A;  1HD1 A;  2QLW A;  2F4V F;  3FK4 A;  5CAA A;  2C3O A;  1ZYQ A;  2VFR A;  3OVS A;  3KK2 A;  4LBI A;  4I6A A;  2DGQ A;  2J7W A;  3DGV A;  4TYB A;  1U7L A;  2V4J A;  1DTQ A;  4AQY F;  3WHI A;  2KU7 A;  2DNN A;  5J2Q A;  1FT8 A;  2HBQ B;  5DZ6 A;  3BF4 A;  2D74 B;  2GQQ A;  2YQ1 A;  1R8H A;  3QJP A;  5F3T A;  2HHU A;  4B3T J;  2E5G A;  2EK1 A;  1GTH A;  3S6E A;  7FD1 A;  4X64 F;  3GFY A;  2KXF A;  2GGP A;  1HHT P;  2EBG A;  4CO3 A;  3W2V B;  4IG0 A;  2MQO A;  5A0Y A;  1SQF A;  2B0G A;  1XN9 A;  3HHK A;  3MEK A;  2ILY A;  1NJW A;  3GJQ B;  1L5U A;  2M0G B;  4L6V 3;  3GSI A;  3F41 A;  3H90 A;  1RCO B;  4LFA F;  4ZCL A;  2AJ1 A;  1NSQ A;  1ZH5 A;  2RU9 A;  4HEA 9;  3N6M A;  1HWU A;  2R7U A;  2CXE A;  2XS2 A;  3WDO A;  2RAQ A;  3RRG A;  2MHE A;  4UW2 A;  1NME B;  4TVA B;  3H42 A;  5T14 A;  3W7B A;  5DG7 A;  4PXD A;  1T7P A;  4KGX B;  3DYA B;  1N8R T;  1HYS B;  2FYX A;  2DGT A;  4USW A;  3GV5 B;  3POT B;  4Q0B A;  3CCR S;  4C2M A;  2BJD A;  2CPH A;  2J9C A;  4OYX A;  3QIP B;  2DHA A;  4TQR A;  2OH2 A;  2AZ3 A;  3HLU A;  4X65 J;  3BQ0 A;  2NPI A;  4EMD A;  2M9K A;  3PVX A;  2B5J B;  3EGN A;  2AGO A;  2N3L A;  2CIM A;  5CQG A;  1ZZN A;  4AND A;  2OPS A;  3NY0 A;  1YHQ S;  2YKQ A;  1TP7 A;  4H54 A;  2W7P A;  1ACM B;  1HWK A;  3K5P A;  5A8R A;  4QIV A;  4DPW A;  4URS A;  1R8A A;  3J81 j;  1MWY A;  2CVI A;  4ANC A;  4NZ7 A;  4ES2 A;  4Q2L A;  3PX0 A;  1FTC A;  4HYK A;  4NLQ A;  1KEK A;  3O8W A;  2W4P A;  4FVC A;  5LMU F;  2P5V A;  1F1B B;  4DUY J;  2R7T A;  5GMK a;  4KQZ A;  3TYT A;  3U7J A;  4H4M B;  4PG6 A;  1EKS A;  1VRT B;  4DCO B;  4YDX A;  4X4Q A;  2B7B B;  4FVM A;  1I6J A;  1UJ6 A;  2WSC C;  4OHV A;  4IDK A;  1NDP A;  4ID5 A;  5ITH A;  4KHR A;  3TWZ A;  3K58 A;  3OHA A;  4CCH A;  4FP9 A;  4KB7 A;  4QWE A;  1XNQ J;  5F8H A;  4OI0 A;  3ZO7 A;  3CCU S;  2AJ4 A;  5HVH A;  3BQ1 A;  3CJT A;  1LQ9 A;  4NLD A;  2DH8 A;  3W60 A;  1FNX H;  1RI7 A;  1FX4 A;  3CCJ S;  3CCM S;  4LSZ B;  5H9E J;  1BC6 A;  2H48 B;  1XMO F;  3W62 A;  2ZBR A;  3G8Q A;  1U4B A;  4ELV A;  2W9C B;  2FLL A;  4B9L A;  4RNM A;  4K2X A;  1N33 J;  5DDP C;  5C5J A;  4JI2 F;  2GJF A;  2ADC A;  2FVS A;  2NSC A;  3KLG B;  3CJ3 A;  2E9R X;  3NKY A;  3HHL B;  3IR7 B;  4CLW A;  3OHB A;  2JC0 A;  4UOG A;  4NLU A;  2DCU B;  2MQ8 A;  1RT3 A;  3LPY A;  4OZL A;  2RHS B;  2BAC A;  4QCL A;  2ZD1 B;  4DV3 J;  2JVO A;  6FDR A;  1OYE A;  1QY7 A;  3NRB A;  3LP0 A;  3WC2 A;  3PO4 A;  1R43 A;  3DKD A;  3M6U A;  1NM2 A;  4W98 A;  2VJU A;  1UZD A;  2RUS A;  4C3M A;  1NK0 A;  4B9U A;  4OV1 A;  3OJS A;  4J5O A;  5HL7 Q;  4OYZ A;  4P71 A;  2JC1 A;  3NOC A;  3KJF B;  2J8A A;  4IQM A;  1RYS A;  3HD2 A;  2UUB F;  1GX6 A;  4O44 B;  3UCG A;  5B0C A;  3LO3 A;  3SV3 A;  2NUU G;  5D77 A;  3IMQ J;  2HS0 A;  5LOQ A;  3D28 A;  3GCX P;  1UW4 A;  2NLW A;  1B3T A;  3IBC B;  2HHH J;  3O44 A;  1JXE A;  1WTF A;  3UQS A;  2E7W A;  4Y6I A;  4U8V A;  4DX6 A;  5CYJ A;  3KLH B;  8ATC B;  4PPZ A;  1S9G B;  2DNM A;  2P6S A;  2CJ9 A;  1EJ7 L;  2C22 A;  2UXB J;  2HHV A;  2EXU A;  4L74 A;  3D0H E;  2BUN A;  4E0D A;  4LFC F;  3E8O A;  3QO9 B;  4RBU A;  3VZI A;  2C2O B;  1FRJ A;  3DLH A;  1S1U B;  2IM0 A;  3M6W A;  2J6U A;  4ZVH A;  1HBO B;  3BR8 A;  5G0R B;  3BO2 A;  3BN4 A;  2OO4 A;  2HVH A;  2BKP A;  5C24 B;  2VA2 A;  3Q24 A;  5AE1 A;  3GJR B;  3MR3 A;  4DUZ J;  4ZP7 A;  2HFU A;  3HSJ A;  5KT5 A;  1OPI A;  1TL1 B;  2FLP A;  1OIA A;  2C28 A;  1KKH A;  1NH7 A;  4J37 A;  4WJB A;  1X60 A;  1AFJ A;  3OTO F;  1MNE A;  5RUB A;  3I9Z A;  1VIS A;  4RW7 B;  4NOH A;  3BQ2 A;  3HVT B;  4LT6 A;  2XLI A;  2BOA A;  4B3R J;  2ZH6 A;  5IV3 A;  2V63 A;  2VL1 A;  2VFS A;  1DTT B;  4MJK A;  2UUC J;  3IM9 A;  5A8W B;  4TLR A;  5L1L A;  4QOT A;  1BE4 A;  1WC6 A;  4TU8 A;  3WX8 A;  3AD7 C;  1IM4 A;  1RDR A;  2BKN A;  2KXN B;  2AV5 A;  2YKO A;  4NMX A;  5A8K B;  2E9Z A;  3KFW X;  5DRK A;  3KUG A;  2IVF B;  2BVZ A;  2HNZ B;  2B6A A;  4LF6 J;  1NH8 A;  5KT7 A;  2R42 A;  4DF8 A;  2RQK A;  1IBK F;  2IMW P;  1M5O C;  2VA3 A;  4V19 J;  2JEF A;  1BGX T;  2ZH5 A;  2KO1 A;  2G0I A;  2WSE C;  1U0S A;  3C16 B;  2NXC A;  2VG6 B;  2DY1 A;  2CJX B;  4YFU A;  1NK9 A;  4FPI A;  2HBY B;  3CJR A;  2XGP A;  2M7S A;  1G4C A;  2WW4 A;  3PYF A;  5HLF B;  2MPU A;  3GV7 B;  4ED8 A;  1KHV A;  3IN5 A;  1PYT A;  1HNV B;  2UVU A;  2WOM A;  2JLF A;  2PC6 A;  5KT2 A;  2RKI A;  2EC2 A;  4IOA Q;  2AGQ A;  5E3A A;  2K1R B;  1S1T A;  2V0N A;  3RB3 A;  4JOU A;  2VOD A;  2AYG A;  3H2L A;  4U9R A;  4EYH B;  5H1S V;  2GCF A;  1VBK A;  3C8Y A;  3ULH A;  1RSC A;  3GIK A;  3K8W A;  3C6U B;  2OMO A;  1SJ3 P;  1EAR A;  2OI2 A;  3V4I B;  5JMN A;  3CDE A;  1FDA A;  2GA7 A;  1K0T A;  1HMV B;  1T05 A;  2R7W A;  3DRS B;  3Q83 A;  2DXE A;  2HIY A;  1Z1Z A;  2J9D A;  3LP1 B;  2X3D A;  4J91 A;  3KG1 A;  1ZM2 A;  1YSJ A;  3FZ2 A;  1IBM J;  2K2P A;  1ZM4 A;  3BBF A;  4JI1 F;  4JUZ A;  1JNZ B;  1TQL A;  4ZVP B;  3WIV A;  1FJG J;  3K5N A;  4RNH A;  5D4P A;  3NCR A;  3MWB A;  1ITP A;  4BWJ A;  1VDH A;  4GVB B;  5EDW A;  1EET A;  1HKA A;  2MY7 A;  2OKQ A;  3TEH B;  2D1C A;  1WD6 A;  4YHH J;  2GVD A;  4F4Z A;  4ZJL A;  4FYD A;  3MPD A;  1OY6 A;  1IBL F;  4ELT A;  2XM3 A;  4PXB A;  3KK1 A;  3QFH A;  3AOB A;  2E5H A;  3MUT P;  2XYG B;  4PUO A;  5F0U A;  5KFS A;  2KG0 A;  3JTP A;  4UT4 A;  1J2V A;  3SFU A;  4U7U K;  4ZPW R;  3MR2 A;  4ZVE A;  3FMW A;  3ELH A;  2G2Z A;  1RT5 A;  2CDR B;  3U1M A;  3KUE A;  4B3O A;  2KRB A;  4HHH A;  5FDL B;  1TL7 B;  2A2D A;  3UVJ A;  1RAC B;  1D3W A;  1C0T A;  4OQJ A;  4OI1 A;  1HWL A;  4PZV A;  3O5T B;  2B4P A;  2D3Z A;  2BYC A;  5HBM B;  1O6X A;  4OYW A;  3DU6 A;  2IJR A;  2V2Q A;  4HTI A;  5IWA F;  2L9W A;  3X3U A;  2EVZ A;  3VVT A;  1DFD A;  4A8M P;  1SC6 A;  3LA0 A;  2J0Q D;  1IQZ A;  2MDA A;  3CD0 A;  1WOR A;  3EPI A;  4XO0 A;  2YWK A;  1QTN B;  1V3R A;  1KQG B;  2UXD F;  2Y1R I;  1L3U A;  3TA0 A;  2F4V J;  5FD1 A;  2CNK B;  4CLU A;  2J7U A;  4GKK F;  4B02 A;  2V8G A;  3TI0 A;  4DV4 F;  2VG5 B;  3R7N B;  1JJ2 R;  2E9T A;  3CWJ A;  1NAQ A;  2DRD A;  5KG4 A;  4F50 A;  1N5T A;  2FJW A;  2EFV A;  1J5E F;  2R2T A;  3JQM A;  3ZTP A;  3KLE A;  4C6A A;  4M1K A;  2JFK A;  4R0J A;  3MD1 A;  1PIL A;  3D1Q A;  3T5K A;  4MK9 A;  1WHY A;  1MRO B;  4FNH A;  3FBE A;  4JI6 J;  1M5P C;  2RRN A;  1DAX A;  4ZHR A;  1TKX A;  4X64 J;  2DPJ A;  4DL6 A;  3S8S A;  3I31 A;  2H65 B;  2WVC A;  4X4V A;  2PMW A;  4DV6 F;  3H2V E;  1MMN A;  3DI6 A;  3IGV A;  4XK8 C;  4WE1 A;  2R7O A;  1QLN A;  3PIP Q;  4RW8 B;  4WFB Q;  2ZUG A;  4LFA J;  1G2E A;  2IJN A;  2DRB A;  2ZKU A;  1UP1 A;  4O3R A;  2ASJ A;  1U6B A;  2RVJ A;  3CC4 S;  1NXI A;  1E6V B;  4PXC A;  4U95 A;  4A8F A;  4USV A;  1S76 D;  3BDP A;  1S59 A;  1TKT A;  1YJT A;  1RKJ A;  2W9B B;  3I87 A;  3PEJ A;  3B4D A;  1T95 A;  2DYA A;  1NSP A;  3D6M B;  4R8U B;  3BSA A;  4MIA A;  1PCA A;  2XSF A;  5DLF A;  3FCH A;  1PAE X;  1V5I B;  2HRT A;  4MIW A;  5B0G A;  1NSK L;  2O1P A;  3OLB A;  1ICE B;  3W2V A;  3OD2 A;  5HMX A;  2R8G A;  1MSW D;  4JI4 F;  5C2C A;  1IVZ A;  1FRK A;  2HWH A;  2FIU A;  2RIL A;  2XI3 A;  3M8S A;  2GQC A;  1FJ7 A;  4DQQ A;  1FJE B;  1WC3 A;  5LMU J;  2VZ9 A;  2HUR A;  4F2S A;  3VAH A;  2K8G A;  2C1E B;  5AT1 B;  4QWA A;  1DLO A;  1LKZ A;  4A8S A;  3FEY B;  1C0U B;  2QL9 B;  1MU2 B;  4ID8 A;  1HQE B;  5D8H B;  4F3M A;  1RWX B;  1M5K C;  2UUW A;  1TMM A;  3FGV A;  1NPR A;  3DYA A;  5K14 A;  3BEG B;  3D66 A;  3QIP A;  2HZC A;  1PAU B;  4MYT A;  3B4M A;  1TK5 A;  3P45 B;  1U1P A;  1FKO A;  1S48 A;  2W1B A;  4QQB A;  4YN3 B;  3ET6 B;  4PG5 A;  2GVZ B;  4ZVR B;  3W2W B;  4C4W A;  3PAC A;  2CQ2 A;  1XMO J;  5J1E A;  3K5M A;  1JKH B;  4DFM A;  1RTJ B;  1S79 A;  2ZNY A;  2Y8Y A;  4K4W A;  1S9E A;  1SVD A;  3DM2 B;  3B54 A;  1V6H A;  5A2Q U;  4KV8 A;  2D7S A;  2KXH A;  5ETO A;  2GHW A;  3GG1 A;  2XMW A;  2L08 A;  3H8Y A;  2XSJ B;  1VS3 A;  5J1N A;  4GRS A;  4JI2 J;  1P1T A;  4C0B A;  1JLC B;  3W61 A;  4PQU B;  2LEP A;  3OFH A;  1SJQ A;  1Q78 A;  5DQI A;  1JQG A;  4K4T A;  4UOC A;  3VAJ A;  3JS9 A;  4H4M A;  1VRT A;  1Q8K A;  4Q2M A;  3PDN A;  3P8B B;  3H5S A;  4WFY A;  1HFE L;  1LW2 B;  3IFE A;  4FF2 A;  1UVM A;  2QGF B;  3T1Y F;  2EG2 A;  1KLM A;  2DR9 A;  1K1S A;  2FGC A;  1PJ6 A;  2YPY A;  3BO4 A;  1TV6 A;  2HQC A;  3AXM A;  3CJK A;  3UW1 A;  2DH7 A;  4IO1 A;  2V67 A;  1U8W A;  4G65 A;  1I1G A;  4X4T A;  3M8Z A;  4KBI A;  2DHS A;  3C19 A;  2QE5 A;  4LSL B;  2UUB J;  2JEJ A;  3EXY A;  4RNO A;  4ZLP A;  5LXR A;  1IJE B;  5E3P A;  5HVF A;  3T3F A;  2E1A A;  1YDL A;  5EWG A;  3KLG A;  1IM6 A;  1Q1K A;  3D67 A;  4B9N A;  3KJQ B;  1XMQ F;  2HWT A;  3HHL A;  4ZCK A;  2DIV A;  2E5J A;  5JJB A;  3LAM A;  4QYZ J;  3FRY A;  4JYA J;  5DM7 Q;  2PN6 A;  3GYN A;  2HGL A;  2HMI B;  4DR2 F;  4LFC J;  2VFT A;  3KJV A;  3HT0 A;  3M30 B;  4NCG A;  1I94 J;  1Y4Z B;  3AAW B;  1S1X B;  4C9D A;  3B78 A;  4ECY A;  1S7H A;  1TUV A;  1KHW A;  4YB5 A;  4P75 A;  1J5O B;  3D3B J;  4YB1 P;  2KYX A;  4QIW D;  2GIR A;  1LWF B;  4E8U A;  2W2P P;  4E98 A;  4DUT A;  1HI0 P;  3CJ8 A;  2CAJ A;  2BW7 A;  3D5M A;  5FJ4 A;  2JVR A;  1W25 A;  4O44 A;  1Y5N B;  2KT2 A;  5L1J A;  1WHV A;  1OSD A;  4N8N A;  5F8G A;  3DLL Q;  4ZVG A;  5IM0 B;  3U1L A;  1LFP A;  2I8E A;  3R8Y A;  1JWW A;  1ZET A;  4M8L A;  1SQE A;  2HGM A;  1TKD A;  2DNK A;  4ICL A;  1Y0H A;  2XMM A;  1YJW S;  3VAI A;  1D9F A;  2ZHO A;  3G71 S;  4J9M A;  4M63 A;  2MST A;  1K47 A;  2PT0 A;  1RWO B;  1Y00 A;  2XNR A;  1M0S A;  1VQ6 S;  4RW6 B;  4QR0 A;  1KD1 T;  4LR7 A;  1S9G A;  2EFO A;  3M8Q B;  5LJ5 Y;  2BKO A;  1SB6 A;  1SC4 B;  2DGX A;  2DNR A;  4FXV A;  2DGV A;  1D0E A;  4LIR A;  3MAQ A;  1S1U A;  5DQG A;  4YQW A;  3IBW A;  2OD6 A;  4O3N A;  3MOJ B;  1FXL A;  5G0R A;  1WKJ A;  4CP5 A;  2ZEJ A;  5EUH A;  2L9D A;  4NLO A;  2JRS A;  3HVR A;  5IV4 A;  1VQ9 S;  5C24 A;  1LV5 A;  2H4Y B;  1IBK J;  1UPP A;  1EKR A;  5CYM B;  2IDE A;  2J0X A;  2ZIT A;  4YS2 A;  1T9T A;  2EFP A;  5AXL A;  1N0V C;  5GAE U;  5ETV A;  4RW7 A;  1RTZ A;  2LQ8 A;  2L9N A;  4CM0 A;  1U1M A;  2QYG A;  4ECT A;  2LCW A;  1QAY A;  1GXT A;  4X62 F;  1AZS B;  1MWZ A;  1XMB A;  1BY9 A;  1DTT A;  1KVJ A;  4CM2 A;  3UWT A;  3LGH A;  2YWF A;  1RT2 A;  3B6B A;  2J5A A;  2HQI A;  4CLS A;  2CYY A;  2RRB A;  3H0P A;  2GC8 A;  4YR3 A;  5HAN A;  3D3C J;  1HNI A;  3GZ7 A;  3RTV A;  2JH3 A;  3GJT B;  2LXF A;  2ZH2 A;  5HQM A;  3M2U B;  4UZC A;  1VBY A;  1ZAW A;  2CPJ A;  1Y3J A;  2IPO B;  3EIC A;  1HD0 A;  3GQC A;  1OY9 A;  5BJR A;  3KTQ A;  1NU4 A;  1HBM B;  1X4B A;  4JP8 A;  3HPO A;  3KLF B;  3IG1 B;  5C25 B;  2HNZ A;  5FII A;  4NLX A;  5FLX U;  1H72 C;  2IYI A;  2NSB A;  1TVR A;  3R5G A;  3I4P A;  1RLD A;  3SSQ A;  4LF4 F;  5C7P A;  4WP8 A;  4RLE A;  1UET A;  3M7V A;  1DQ8 A;  5AXM A;  3UCZ P;  1YJV A;  5F9N A;  3K59 A;  5E3R A;  1LWC B;  4ZDN A;  1KN6 A;  1HA1 A;  1WEX A;  4C8O A;  2MJN A;  4JI1 J;  2W7O A;  4NAS A;  1G1X A;  1TFY A;  3ZNU A;  5T7L B;  2CJK A;  5KFA A;  1F2H A;  4N8O A;  4RW4 B;  3M8W A;  1X5S A;  4NCB A;  2W25 A;  1V9O A;  4U96 A;  1Q5Y A;  4FDF A;  2Z2Z A;  5CYQ B;  3SCL E;  2X1B A;  2BE2 B;  3C15 B;  3LWM A;  1U0H A;  3MF5 A;  4MT1 A;  4BWM A;  2MGZ B;  2K1R A;  2MZT A;  2XWY A;  4KHM A;  4K4S A;  2GIF A;  4P10 A;  3F0N A;  2IYG A;  5IT9 U;  3MM6 B;  1U6Z A;  5KT3 A;  3MPY A;  2VPW B;  1R31 A;  5CA5 A;  4DEZ A;  1CJU A;  3CTR A;  2HHX A;  2DGO A;  4CLP A;  3FBC A;  2G4B A;  2FVP A;  1FRL A;  1SC1 B;  1SXL A;  2U1A A;  3DDN A;  1M5H A;  1ULR A;  1IBL J;  1JLQ B;  1EP4 B;  3IA0 A;  2QSF A;  4C7Q A;  4LQ9 A;  3IGN A;  1R7I A;  1HMV A;  5D3G A;  4DXL A;  2MQP A;  2ZVS A;  2DTJ A;  2OGU A;  3M32 B;  3LP1 A;  1FFS B;  1ZBT A;  3CCT A;  2ZH3 A;  2FVC A;  2ZJQ Q;  3IS9 B;  2HHS A;  4ECQ A;  4LSN B;  1XIQ A;  1YRX A;  2A0F B;  1X9S A;  3KK3 A;  4KPC A;  4ZPT R;  2J6T A;  1IQT A;  3AOA A;  1FKA F;  1HBN A;  5LT5 A;  2AJ0 A;  1U1K A;  4HT7 A;  4XPC A;  2FZG B;  1KWM A;  1FRX A;  2V8V A;  1IKX A;  4DX5 A;  2J6S A;  1WC5 A;  1RYR A;  5CD4 H;  2YKM B;  4DFP A;  2UXD J;  1BXN A;  3GIM A;  1UA1 A;  5D15 A;  5K8O A;  2IRY A;  1C1B B;  4UQT A;  3NP5 A;  5DGB A;  5GAD U;  4GKK J;  3R5D A;  2H3E B;  4B3M F;  1PG5 B;  3G2X A;  4DV4 J;  2OTJ S;  4DFK A;  4W92 B;  4JV1 A;  1RP5 A;  1T3N A;  4I0W A;  3UCU P;  1FRH A;  1R6Y A;  1J5E J;  3QSY B;  2CNO B;  1LK7 A;  2WB4 A;  1TL7 A;  2VD3 A;  3H98 A;  3LTO A;  1PC4 A;  4FZV A;  2F63 A;  4FXD A;  4WK3 A;  4NML A;  2IM2 A;  1UFK A;  2R2S A;  2F65 A;  1KSP A;  3CT9 A;  3ZXW A;  1VQS A;  3CMQ A;  3PYG A;  2P9G A;  3MCN A;  4DV6 J;  2MZJ A;  4OI3 A;  1N5V A;  2BR0 A;  1XJW B;  1NHU A;  4ECU A;  4OX6 A;  1K9M T;  3I0S B;  4O3S A;  5GAH I;  2DXD A;  2IM1 A;  2V69 A;  3GB0 A;  4M5K A;  4ES3 A;  4YR2 A;  1WC4 A;  1NRK A;  3PHT A;  1VMB A;  4MAK A;  3NWR A;  4OZ0 A;  5KOW A;  1RE1 B;  1TAU A;  2N7Y A;  2CDQ A;  5GAG I;  1S4F A;  1HHQ A;  1MWQ A;  4CZC A;  4X66 F;  2HVE A;  2VB6 A;  4DPX A;  4ELU A;  1FEE A;  1FK9 B;  3MM9 A;  2B9X A;  4ZIW A;  2KKH A;  3NNA A;  4F25 A;  3Q8V A;  5A2Q Y;  3QQC D;  1N48 A;  2E1M C;  2YX1 A;  2Q66 A;  4FBT A;  2ZNZ A;  3R3T A;  3AD8 C;  5DZ7 A;  1RHR B;  4RBV A;  3VGT A;  4K8R A;  2AQ4 A;  4JI4 J;  4CT9 A;  3DU5 A;  2GV1 A;  4YEA A;  2EK6 A;  5HO4 A;  3MTJ A;  7FDR A;  3NMR A;  4QBU A;  4DPO A;  1YZ6 A;  2GZO A;  4K4X A;  4X4N A;  5E0O A;  3DRR A;  2AF6 A;  3JSY A;  3J7A 1;  1X0P A;  4LF8 J;  3U02 A;  2XUL A;  3FSY A;  4NA1 A;  1PSD A;  4DV2 F;  2ZBI A;  3VGU A;  2FJA B;  3CD6 S;  2MEW A;  3GMG A;  1E6V A;  2VU5 A;  2YWG A;  4FF3 A;  2HAI A;  4JI8 J;  3NNC A;  2QTW A;  3UD5 A;  3K8V A;  2WB1 D;  4F26 A;  5GME A;  3MED B;  1XQI A;  1LWE B;  1A0O B;  2XZT B;  1U6F A;  1PBA A;  5KFH A;  4C0O C;  4AXJ A;  4TY8 B;  4R5P B;  2QFJ A;  1RLC L;  5IFM A;  2MLX A;  1VGY A;  1FWK A;  2HKE A;  1GMW D;  5D6G A;  5ADZ A;  2LU1 A;  1HR0 J;  2MY8 A;  5DLG A;  3JSM B;  5KFO A;  5B0B A;  3A8E A;  3UDL A;  4WFZ A;  2R8H A;  4HTJ A;  2BJ9 A;  4HAC B;  3DGP B;  1D8Z A;  2UUA F;  4HR2 A;  2GAH C;  3PHE A;  4DSF A;  2HWI A;  3I6P A;  1LOU A;  3PO5 A;  3HI9 A;  4OZ5 A;  3EVM A;  1IKY B;  1RBL A;  2MTL A;  3QNW B;  4L72 B;  2V5H G;  4ETZ A;  4RO0 A;  3A3O B;  3NGS A;  1NPP A;  3A3P B;  4ED0 A;  4C8K A;  2G13 A;  5KFU A;  4I64 A;  1CJV B;  1HQE A;  2XY7 A;  3T1Y J;  2HW3 A;  2BDP A;  3J7Z 5;  2G1H A;  3OPK A;  4X84 A;  1ZAV A;  3BBB A;  1QVF R;  1RT7 A;  3H40 A;  3MUM P;  2C3P A;  3AA9 A;  2YNI A;  1CEZ A;  3M9M B;  1Q53 A;  3TQE A;  1HQ2 A;  5D4L A;  3KWM A;  1X8D A;  2B9Y A;  5IQQ A;  4JI7 F;  4DPY A;  2EWH A;  4LR8 A;  3W2W A;  2GVZ A;  5D78 A;  4M94 A;  3SYZ A;  5DJB A;  5HJY A;  4KKO B;  1S4E A;  1RTJ A;  4TYA A;  4F4A A;  5F8J A;  2KM8 B;  3S7R A;  4EBC A;  2PD1 A;  3DXB A;  3HD1 A;  2OPQ A;  3LAL A;  3LF0 A;  4NZ0 A;  3R7B B;  1VIO A;  3LAN A;  4ALZ A;  3EUN A;  4PQU A;  5BYR A;  1TTH B;  3I0R A;  4CDI A;  2KHD A;  1XMQ J;  3MFH A;  2X51 A;  2MHN A;  1REV A;  2CNL B;  1RBA A;  3NNH A;  5I3U A;  2CUY A;  4QPT A;  2Q1L A;  1LW2 A;  4DR2 J;  5HP1 B;  3MEC A;  2AX0 A;  2MMY A;  1UJ4 A;  4LRB A;  1GK8 A;  2QA2 A;  4IFV B;  2WAQ D;  3Q8S B;  3FCV A;  3M8Y A;  4HHU A;  3JTO A;  3BGL A;  3PW0 A;  3RRH A;  3M05 A;  4OYP A;  3DC2 A;  2OPR B;  3MM5 B;  1GMW A;  2MZS A;  3T6B A;  3I5A A;  4DQI A;  4OJG A;  1U1R A;  3UD3 P;  5B08 A;  1SJ4 P;  4F0M A;  2F8M A;  4RKU C;  2ASD A;  2BQ3 A;  3OBI A;  5KFK A;  3OSN A;  3AQP A;  1KOH A;  4DR5 J;  3T5H A;  3QLH A;  1RT1 B;  1GH8 A;  4AL6 A;  1H2T Z;  4O23 A;  3OSP A;  2DIT A;  2QEX S;  5KFG A;  3PV8 A;  4J9U E;  4EWT A;  5ETN A;  4BCA A;  5DS7 A;  4WYW A;  1GEH A;  3PCO B;  2AX1 A;  2VKR A;  2R7S A;  1NEE A;  4Y2I A;  3R5A A;  4OMF G;  4HI2 A;  4A8O A;  2WTF A;  3DOM A;  1YRT A;  2DNO A;  2D3O 1;  4V1A k;  5FLX Y;  2ZDP A;  1GQE A;  3QZ7 A;  2H9Z A;  2MKJ A;  2X1G A;  5CXT A;  1RBO B;  3RB0 A;  3IWX A;  3SQO P;  4ZK7 M;  2YKN B;  4C11 A;  4MKA A;  1RA6 A;  1VHI A;  3PJX A;  5EGY A;  1P8G A;  3NWG A;  2DEJ A;  2DIS A;  5D0E A;  2Y8W A;  2IM3 A;  3LW5 C;  3TUP A;  3R2C J;  3THP A;  4M5H A;  2EFG A;  2HHQ A;  1K0V A;  3PG9 A;  5L1I A;  2NXJ A;  4X62 J;  1HBU B;  1JLG B;  2YNH B;  5DET A;  2MZQ A;  1CC7 A;  1JLE B;  2FTR A;  2Z2L A;  2YWH A;  3ILJ A;  4WWS A;  4ZP8 A;  1BUX A;  2ASY A;  5IT9 Y;  4ENO A;  1IR1 A;  3N01 A;  5CZX A;  3GFH A;  3VR1 A;  2A2C A;  2CA9 A;  4A8W A;  4H4O A;  1B0V A;  4A46 A;  4A8K A;  2UZA A;  2YWW A;  1O8B A;  3IAS 9;  2H54 B;  3BKF A;  3HFV A;  3C6T B;  5KG7 A;  2IA6 A;  3I9V 9;  1ZA2 B;  5L9X A;  5HMZ A;  1UCN A;  2CQI A;  3EM1 A;  1U24 A;  2YNG B;  3BO3 A;  1JB0 C;  2W24 A;  3LQV A;  3J7Z T;  4LF7 F;  1BMQ B;  3CPW R;  3EZO A;  3MM8 A;  1F5B A;  4WFA Q;  5B09 A;  5L8R C;  4PQA A;  2DO4 A;  2QMU B;  1H2U X;  4EK2 A;  3JYT A;  2AIR B;  4DL5 A;  3GYG A;  4IOC Q;  1YGY A;  4LF4 J;  4I2Q A;  2IAJ B;  1RUS A;  2CQC A;  2LLZ A;  3V4M A;  1QUV A;  3MCS A;  1S0N A;  4YB7 A;  4AD6 A;  1QSL A;  2IIH A;  1KR4 A;  3G82 B;  2J0W A;  3D9B A;  4XIU A;  3DLK A;  3N5B A;  4QIE A;  2XC9 A;  3HF5 A;  2HQ3 A;  3DLG B;  3H5U A;  1UVJ A;  4OFZ A;  2ZKT A;  1REG X;  5EX0 A;  3M2U A;  2D69 A;  5EWF A;  2VPZ B;  1RTH A;  1VI7 A;  3L95 X;  1GXL A;  2C2D A;  2YWE A;  4QYR A;  1KVI A;  1AFI A;  4K50 A;  2BAN B;  1SH3 A;  1MN7 A;  3J7Y I;  1HBM A;  4LRC A;  5IT4 A;  2G0C A;  1Y5L B;  1HW9 A;  1NKB A;  1VQN S;  2VH7 A;  4Y65 A;  3KLF A;  1X4F A;  1YJU A;  5C25 A;  4LF9 F;  2JSX A;  2HS3 A;  3VQS A;  3QT7 A;  4DV7 F;  1NDC A;  1X9M A;  4USM A;  2Z2M A;  3C3L A;  2RNE A;  3JB9 k;  1RHJ B;  4YB6 A;  2IBO A;  3LOU A;  4U7U D;  2ALY B;  5K9F A;  5KFL A;  1CJT A;  4FYV B;  1RHU B;  4KFB A;  2HPU A;  3HSZ A;  2AU0 A;  1NLK L;  3SQG B;  2FJV A;  5KG5 A;  3MPV A;  1UTA A;  4QW9 A;  1S7I A;  1RB0 A;  1ZTT A;  4Q8F A;  1CC8 A;  4TNO A;  1ZAX A;  3CME S;  2RQC A;  5EWE A;  1LW0 A;  5T7L A;  1JLB A;  3D4J A;  4ED3 A;  5KT4 A;  1VC6 A;  1UEV A;  4PAB A;  4FYW B;  2JEG A;  3W9H A;  3H25 A;  2HRY A;  2MGZ A;  3GG0 A;  3SMZ A;  3BGR B;  4RWX A;  4L75 A;  4DU8 A;  2ZC4 A;  4CQ1 A;  4G1Q A;  1OMS A;  4GO5 X;  2D9O A;  1NKC A;  2XO6 A;  3RJM B;  3R97 A;  1WJ9 A;  3KLI B;  1WG5 A;  2QMX A;  4IG3 A;  1EP4 A;  1JJC B;  3IRX B;  4KH0 B;  3TJ9 A;  4B3M J;  4FS2 A;  2BZ2 A;  4DL3 A;  1UJ5 A;  2FJE B;  2A3J A;  2XZD B;  4IRD A;  3ADA C;  1LXN A;  2MB0 B;  1VRU A;  4M5M A;  4WIQ A;  5AXK A;  4EI2 A;  3V5R A;  1S6P B;  3M32 A;  4ECR A;  4PG7 A;  3AB2 B;  3DOK B;  1D09 B;  2DHX A;  3VQT A;  1XTZ A;  2WHO A;  4LSN A;  1BQN B;  3EVW A;  2NYI A;  4DF4 A;  4JV0 A;  1PO6 A;  4PEO A;  1RAG B;  4OI6 A;  3DCA A;  3DDI A;  3MMB B;  2QYC A;  1WG4 A;  3HMJ G;  2UVR A;  1S57 A;  4B9V A;  2ZUA A;  3CF5 Q;  2L48 A;  2AW0 A;  1Z4U A;  1QE1 B;  1NK6 A;  1YJ7 A;  3HZG A;  4MH8 A;  2HYI B;  3SI8 A;  2M70 A;  4B9M A;  3CUN A;  2PA3 A;  4HH0 A;  1PIE A;  2LA4 A;  2YKM A;  1FFW B;  1ZM9 A;  1F6T A;  5I3P A;  2AKW B;  5HAO A;  4CNY A;  1I51 B;  4WKY A;  1C1B A;  2POK A;  4KR0 B;  2HIQ A;  4PYD A;  2BRL A;  1PBU A;  1M5S A;  1W26 A;  4EYI B;  1G3O A;  1FXD A;  1VC5 A;  4DV0 F;  4F3O A;  4IRK A;  4X66 J;  2GFF A;  3P3D A;  3ENA A;  4I2P B;  2CQ0 A;  2H4W B;  2FLO A;  2C2N A;  4BS2 A;  4DDF A;  1SUQ B;  3K5O A;  3K5L A;  3HFK A;  2RB7 A;  3TA2 A;  1PJ5 A;  1ZOT A;  3MMA B;  4F02 A;  4P9S A;  3IXQ A;  3PW7 A;  1N34 F;  2OFG X;  2I5J B;  1RHM B;  2ACY A;  3EDQ B;  3MFI A;  3OR2 B;  3MD3 A;  5E5N A;  2Q6C A;  2VFU A;  1VYA A;  3MEG B;  2C42 A;  4DG1 B;  1H0H B;  4PWD A;  3VTI A;  1Q8L A;  1P27 B;  1DZ5 A;  2HEK A;  1VLO A;  4DV2 J;  5J2N A;  3MAA A;  1FE0 A;  4DX8 H;  2LU2 A;  4CTA A;  3L09 A;  2QL5 B;  3DFE A;  4GO7 X;  2CKW A;  2VG7 B;  3MMC B;  3PRV A;  4LBH A;  5E33 A;  5HQ8 A;  3VCD A;  2RDD A;  2H5E A;  4J9V A;  1S0V A;  2JLG A;  1X0F A;  4WCE Q;  4N7T A;  3NS5 A;  3K2Y A;  1GNK A;  1X4D A;  4C8N A;  4A8Q A;  3VAK A;  3FJ2 A;  3CO9 A;  4GC6 A;  1RT6 B;  4OJH A;  3HUL A;  2ROG A;  4NXN F;  4JI3 F;  2IVY A;  3W9I A;  2XY6 A;  2UUA J;  3JQJ A;  3CXC R;  1N0U A;  3C66 A;  3KKF A;  3AXK A;  3OVB A;  3GWC A;  1YBT A;  2ZHA A;  4LQ3 A;  1R8P A;  1CS4 B;  4Z7Y A;  2Q6B A;  2NXU A;  3HHN B;  1SH0 A;  1T03 A;  2LDI A;  4I7F A;  3J7Y U;  1U2F A;  2W2O P;  3DXS X;  2G9O A;  3MTK A;  4J7C A;  4LRE A;  2IVM A;  4AL5 A;  2KVI A;  1TL3 A;  1E6Y B;  1WI8 A;  2B8P A;  3BSC A;  3HHE A;  4UST A;  2MSS A;  4JI7 J;  4TY8 A;  1SKW A;  3T41 A;  3EVO A;  2JFD A;  4P6Q A;  4K0K F;  1HPZ B;  2WVD A;  2NS1 B;  4M5D B;  4ZIT A;  2HLT A;  2VBZ A;  1OSC A;  3JSM A;  3OL6 A;  1QAI A;  4HAC A;  2ZE2 A;  1KQK A;  2K3I A;  3C14 B;  2F5G A;  4U6P A;  8RUC A;  2JJ4 D;  3SSR A;  2VPY B;  3TR5 A;  2ZWO A;  2NUH A;  2W9A A;  4N5S A;  3NXZ A;  3DLE B;  3IAM 9;  5HN0 A;  4OYB A;  2WON B;  2XYH B;  1N5Y B;  3PFO A;  3IWL A;  3LAK A;  2R2R A;  4M5I A;  2V9K A;  5KFW A;  5KFF A;  3NS6 A;  1HI1 A;  2XLK A;  1H7W A;  4CLY A;  3KK2 B;  4QW8 A;  2OML A;  3NS7 B;  1NB2 A;  1UW9 A;  3BSN A;  1U47 A;  4F3Q A;  1DTQ B;  1VIX A;  4WK1 A;  1Q8I A;  1ZPV A;  4MFB A;  5J2Q B;  3NEK A;  1ZS6 A;  4DQP A;  1S0M A;  3GFX A;  2P8I A;  2BAB A;  4K5R A;  3IO1 A;  2C3U A;  1V5V A;  2ZH1 A;  1W2I A;  2GGP B;  2W4D A;  3BZQ A;  4IG0 B;  1QD1 A;  4TY9 A;  4F0H A;  3NGU A;  1KLN A;  2GMJ A;  5A0Y B;  3NBP A;  1UFL A;  3KHH A;  5KFP A;  2R3V A;  4OHZ A;  4O4R A;  3SEO A;  1B0T A;  4DL0 C;  2IMO A;  2M2B A;  1C4C A;  2GAG C;  4BHQ A;  5HP1 A;  4YY3 F;  2HFZ A;  1R89 A;  2XMA A;  1VQK S;  4J90 A;  4IO9 Q;  4IFV A;  2O67 A;  4NEY A;  5AJ3 F;  3TZW A;  3GLJ A;  3EX7 B;  3GIJ A;  2X7I A;  1XC9 A;  3LPE A;  3L4B C;  5K20 B;  2NQP A;  1WSV A;  2C2E A;  1VK8 A;  3PFE A;  9RUB A;  4ZVT B;  4Z2X A;  2OPR A;  3DHX A;  1L3T A;  1H98 A;  1UWB A;  2PDA A;  1QTM A;  2ZJP Q;  3M6X A;  3CDA A;  1S72 S;  1XK8 A;  5J2M B;  1XEZ A;  1SKU B;  2B43 A;  2LFV A;  4CYU A;  4EEY A;  2OPS B;  2QLF B;  1YBU A;  2YX7 A;  2I1R A;  1XNR F;  2E29 A;  3HSG A;  2QA4 G;  3M8P B;  3HHL C;  2XO7 A;  5A8R B;  2Z2Y B;  1RT1 A;  2OEK A;  4DR6 F;  1LNQ A;  3N6L A;  2OAU A;  4KTQ A;  4P52 A;  4RUC A;  3TAP A;  1WOS A;  1EQM A;  2EPI A;  2ZOG A;  4USU A;  1Q8B A;  4Y0F A;  2NCK L;  4LF2 A;  3B8H A;  3I5C A;  3W64 A;  1NDK A;  3LGN A;  4DHV A;  1WG1 A;  4R0E A;  2HHW A;  3HSD A;  2LEB A;  4IH5 A;  4HT5 A;  2ZH7 A;  2BM0 A;  4KPY A;  3UFC X;  4ID5 B;  3W8P A;  3T9N A;  1M1K T;  3KMQ A;  3FQK A;  2YKN A;  1S1W B;  2YKA A;  1YI2 S;  3WX4 A;  4LF7 J;  3CJ0 A;  2APO A;  5K5M A;  2VOP A;  4PWW A;  1DHM A;  2WRM A;  2YVS A;  3MM7 A;  2LKZ A;  3PYE A;  4NXM J;  4C98 A;  3BRE A;  3CDU A;  2RSQ A;  1JLG A;  4NLP A;  2YNH A;  3M4X A;  3ETM A;  4M5L A;  3QGP A;  3CSK A;  2CFX A;  1F3F A;  2HFS A;  3VV2 B;  1NSA A;  4RNF A;  4ANE A;  5THW A;  4O4G B;  1U49 A;  2IC3 A;  1SJR A;  1FNO A;  4ZJO A;  3UE2 A;  2HQG A;  5CZV A;  1KRP A;  5ETP A;  4HHJ A;  3C6T A;  2ZZN A;  3H2U B;  1YZ7 A;  2G2O A;  1HNW F;  5KFR A;  1U26 A;  2C2M B;  1T11 A;  4B9S A;  2YNG A;  2RF2 A;  2HHT A;  4LF9 J;  5KFT A;  2WVE A;  4RX6 A;  4DV7 J;  1Y7P A;  2CRL A;  3LP0 B;  2ATC B;  3HP6 A;  2MKY A;  3QPI A;  4LBP A;  3PM9 A;  2RE1 A;  4KHP F;  4ECX A;  2XCP A;  3AOC A;  3RR7 A;  4IR1 A;  2AMC B;  4L73 A;  4QWD A;  2IRU A;  2ACM A;  3CGI A;  2HND B;  1TR0 A;  4OIX A;  3QWU A;  4K4V A;  2Y3Y A;  4ZVQ B;  1KQS R;  1S99 A;  2ZH9 A;  2QZ8 A;  4Y2K A;  3X1L B;  2QMW A;  4E2F B;  2YNF B;  2FZC B;  3E01 B;  4Y00 A;  2D41 A;  2W7A A;  3ZFV A;  2FZK B;  2ZOM A;  2GIQ A;  2W2Q P;  3UR0 A;  1FHT A;  2Z58 B;  4I6W A;  2BAN A;  5LJ3 Y;  2VIC A;  4EGL A;  3BGU A;  2V50 A;  2IDL A;  5KFE A;  3PX6 A;  1Z2Z A;  2HQD A;  1K73 T;  3FSI A;  1D8Y A;  3OTD A;  1DY3 A;  1QJH A;  2FUG 9;  2ZDO A;  2HG4 A;  2CQH A;  4PRF A;  2EEY A;  5EHH A;  1NO8 A;  1CJK A;  1U1Q A;  1LK5 A;  3D68 A;  4Y2A A;  2FJD B;  1BWV A;  2VQF F;  4I69 A;  4P2X A;  2FGO A;  4P74 A;  3FBF A;  1WF1 A;  1S1V A;  5ETL A;  4NI2 B;  1R8C A;  3CJQ A;  4PR6 A;  4YP3 A;  3LP2 B;  3KJN B;  1YRU A;  1HQU B;  4USJ C;  3BGF A;  1OYD A;  3TA1 A;  3I82 A;  3N6N A;  2KG1 A;  1S12 A;  3BGR A;  2XMK A;  2AZ1 A;  4LVN P;  3MEE A;  4OLO A;  2YBV A;  2Z8Q A;  4PWU A;  2VOO A;  3PRB A;  4USK A;  4X4R A;  2UUT A;  2PEB A;  3JAM U;  2OIH A;  1F9H A;  3PIO Q;  2CPY A;  2M4M A;  4JI5 F;  4LUB A;  4ERD A;  3RBZ A;  4L76 A;  4DV0 J;  5KFY A;  3S01 A;  3R27 A;  2NXE A;  2O01 C;  1S10 A;  3M6V A;  3Q8R B;  4UZB A;  3EZ5 A;  2RRA A;  3SSS A;  4O0N A;  2RS8 A;  4EU0 A;  2VKZ G;  3SFG A;  1APS A;  4KO0 A;  4B08 A;  3DOK A;  4D3G A;  2YPZ A;  1N6Q B;  3CJ4 A;  1BQN A;  1FXR A;  1XR6 A;  1N56 A;  3CCS S;  1HAR A;  1RTI B;  3P5T L;  4UUX A;  3G6V A;  1HNX F;  4BC9 A;  3KG0 A;  5B0D A;  3EXC X;  1NPK A;  1N34 J;  1TU0 B;  2GMH A;  2KT5 A;  3Q8Q B;  3PY8 A;  2KFN A;  1T9Y A;  1FD2 A;  2UVV A;  2WOM B;  4FF4 A;  2K7J A;  2RKI B;  1K8A T;  4QWC A;  4X4U A;  2W01 A;  4NLS A;  4NWB A;  2LDY A;  4XAK A;  1YJ9 S;  4OI2 A;  4ETX A;  1ZA1 B;  3OXL A;  4ECV A;  2NPF A;  1VLY A;  4CH7 A;  3OVA A;  3D0I E;  5AXN A;  3DMJ B;  1VFJ A;  3HJF A;  2Z57 B;  3OT9 A;  2B4O A;  2G0J A;  1RAB B;  2DNG A;  3BPD A;  3BH7 B;  5HRO B;  1KC8 T;  2XLJ A;  4WXW A;  1A9N B;  4AYB D;  3F44 A;  2Y0B B;  4UUW A;  1T05 B;  3E2E A;  1KNZ A;  5KFZ A;  5LSR A;  3G8T A;  1N5Q A;  2D3U A;  1IJF B;  5E3Q A;  1AUS L;  2UV8 G;  3CC2 S;  2R8J A;  1KQF B;  2DEI A;  1HL6 A;  2J7K A;  3HFZ B;  3FCW A;  5KG1 A;  2UU9 F;  4B9T A;  4KGV B;  1RAA B;  4NXN J;  4JI3 J;  4ED7 A;  1UAW A;  1NB7 A;  3R1H A;  2MJU A;  4P2F A;  4DG1 A;  3V6H A;  2XS7 A;  3FMB A;  3GR1 A;  4AQY J;  4ILL A;  5M2P A;  2DT9 A;  1PGZ A;  3NGK A;  4TKT A;  4OLP A;  3DOL A;  2QLB B;  4L3N A;  1L3V A;  1IR2 A;  2B3T B;  1B64 A;  4FF1 A;  5IZH A;  1FKP A;  3HKW A;  3R7S B;  2BRK A;  2AYB A;  2GVD B;  2RDJ A;  3IR6 B;  2VV5 A;  4JBC A;  5I42 A;  5KFQ A;  5B0F A;  2FLN A;  2C3M A;  2ZZT A;  2RH3 A;  3CJ5 A;  3G6X A;  3S1T A;  5F8M A;  1LFW A;  3N4W A;  4PUO B;  2X1F A;  2Y1J A;  1S9F A;  1T3O A;  4ZJQ A;  2OUG A;  1HLW A;  2AD9 A;  1RT5 B;  5HI7 A;  4K0K J;  1IKW B;  2DK2 A;  4WZM A;  1AA1 B;  3FFI B;  2EI5 A;  4G1I A;  2NR0 A;  1U25 A;  3UVJ B;  4DLE A;  1C0T B;  2GHV C;  4PAA A;  2KL8 A;  4P7T A;  3CD5 A;  1WWH A;  5ETT A;  1RIS A;  2WCX A;  2MKC A;  4U67 Q;  3V81 B;  1QM9 A;  2M5Y A;  1YIJ S;  4QR2 A;  3I32 A;  1Q16 B;  4BDP A;  1DJ0 A;  2KZZ A;  2MYF A;  7AT1 B;  5GAE I;  3PXG a;  3DLJ A;  3RAQ A;  3SZ2 A;  2E7X A;  3ENW A;  4Q8E A;  2R8K A;  1OWX A;  2XCA A;  3DN9 A;  3G6Y A;  2XBP A;  2DO0 A;  2VDH A;  2MQM A;  1YK9 A;  3OTC A;  4GVL A;  2DR7 A;  5KT6 A;  1X4G A;  3ICL A;  3QRQ A;  2MZR A;  2RUG A;  2AEM A;  4QIG A;  3SDE B;  2DPI A;  4OHW A;  1WDT A;  4YOE A;  2A18 A;  3OR1 B;  1RAD B;  5F41 A;  2XNQ A;  2CG8 A;  3JXO A;  5HQL A;  2ZH8 A;  3RW7 A;  3KLE B;  1JLF B;  3HHL D;  4M5D A;  3QFW A;  3K7R A;  4DR3 F;  2VUG A;  3PJW A;  3BS9 A;  1WOO A;  4DR7 F;  4CO4 A;  4ZP9 A;  2RU3 A;  3C14 A;  4OV6 A;  4G6V B;  1TKX B;  3ZTR A;  2LXU A;  1HYS A;  3POT A;  3DI6 B;  2EBE A;  4WE1 B;  4WF9 Q;  1KFD A;  4U8Y A;  2GW8 A;  2B5J A;  2WON A;  2W2M P;  2A10 A;  4F0K A;  3A12 A;  4YY3 J;  5E7O B;  4J9R A;  5AJ3 J;  1RXO B;  1TKT B;  2VF3 A;  3MXH P;  4DS5 A;  3EDR B;  1RU2 A;  4OI4 A;  3UPF A;  4U7C A;  1RWU A;  3CDW A;  1WC0 A;  2R4F A;  2Z56 B;  2WW8 A;  2FJX A;  1Q4R A;  2WBR A;  2DHG A;  3ILO A;  2DVI A;  3QSI A;  3PKM A;  3ITH B;  2D9P A;  1AUD A;  3W9J A;  4JI6 F;  4UF4 A;  5HMY A;  1XNR J;  3MDF A;  5LL6 d;  4DZD A;  2VQE F;  4DR6 J;  4DL7 A;  1GXU A;  4OZ1 A;  4MIB A;  3ZC4 A;  1UMJ A;  4OYI A;  2YH1 A;  1JMT A;  1BD6 A;  3EJM A;  3VAF A;  3MZI A;  3CJ2 A;  3EGV A;  2EC0 A;  4KT0 C;  5JVH Q;  1X4C A;  2AP6 A;  2L3M A;  1M5V C;  2C2R A;  1LWX A;  2O66 A;  1QSY A;  1YJN S;  3L7O A;  2W9C A;  1DLO B;  2E7V A;  1X4H A;  4O3O A;  2Z0G A;  3P5B P;  4WXO A;  4KRW A;  2RDI A;  3NAH A;  2XS5 A;  4AE5 A;  5K14 B;  3CC7 S;  4IYQ A;  4DN0 A;  1PJ7 A;  5J2M A;  1S0O A;  1FKO B;  4KYZ A;  4AXI A;  5GAD I;  2AJQ A;  1U02 A;  2ZD1 A;  4A8Y A;  1FI4 A;  5D0R A;  5J1E B;  4XPE A;  3M8P A;  2OJ3 A;  1S9E B;  3LGM A;  1VC0 A;  4KV8 B;  1RAE B;  4N56 A;  2MKK A;  3LH2 S;  2E1R A;  2JL9 A;  4G3I A;  3RAM A;  3QRR A;  4HVZ A;  1C4A A;  3AB4 B;  4I6Y A;  3IR5 B;  2ZC3 A;  4RWW A;  5F8N A;  3QT6 A;  4OZ2 A;  1FO1 A;  1OQ3 A;  4D3H A;  3OTO J;  1HNW J;  5ETR A;  3CCL S;  2FC9 A;  2Y0S D;  3PW4 A;  3EGZ A;  1NHK L;  1KLM B;  2O3D A;  2VBW A;  4WU2 A;  1S1W A;  1XWL A;  1TV6 B;  1EQ0 A;  1CQM A;  2BJ1 A;  3CJK B;  3D6H B;  2BBE A;  3KLH A;  1A6L A;  3QAT A;  3NG8 A;  3CNQ P;  3UNY A;  1MML A;  3DRY A;  2E1C A;  4KHP J;  2F9D A;  4DCP B;  2HBR B;  1UKU A;  2B7C B;  5K8N A;  2CNN B;  3A13 A;  4OYM A;  3QO9 A;  3P4U B;  3TZX A;  2MXY A;  4N47 A;  3CCE S;  1P9Y A;  4XDD A;  2DR8 A;  2BMB A;  5GVQ A;  4RUB A;  3TP2 A;  1IUJ A;  3PEH A;  2BM1 A;  1HBO A;  4J9K A;  2OEL A;  4ZOS A;  4KAI A;  2PFF B;  3HZE A;  4O4G A;  1SJF A;  2P9C A;  2W8K A;  5J1P A;  1UL3 A;  4KGM A;  2FY8 A;  3T5L A;  2V2V A;  4HL9 A;  3R6L B;  2QL7 B;  1TL1 A;  4N76 A;  5K8M A;  3JAM Y;  2KJW A;  1WF2 A;  2KFY A;  2F8H A;  3T5J A;  2F8E X;  4GKJ F;  1AW0 A;  4ILR A;  3T6J A;  3KJV B;  3HVT A;  4M5J A;  4NCG B;  4ECW A;  1KON A;  5I3Q A;  1PYS B;  4O3P A;  2YH0 A;  3THV A;  2Y1I A;  3TQ1 A;  4N77 A;  5A8W A;  2G1D A;  2BV3 A;  4NYP A;  3OJU A;  5H9E K;  1WEZ A;  4ZA1 A;  1L3S A;  2EKN A;  2HZA A;  5HK4 A;  2F9J A;  3I4H X;  3M1V B;  3O1L A;  4DWI A;  3A8J A;  3WIU A;  4DI6 A;  2VC0 A;  1OQ6 A;  3OXG A;  2VQF J;  2RML A;  4IH7 A;  1KTV A;  5A8K A;  5DDO C;  2PSZ A;  3MMJ A;  1NCL A;  2QJ3 A;  3OFG A;  2HND A;  4WTO B;  4G1P A;  3GCW P;  3WC0 A;  2CQ4 A;  3BM7 A;  4ED2 A;  4Y3C A;  3D6T B;  1DAR A;  2H1Y A;  1X4E A;  1JJ4 A;  4B17 A;  2X3G A;  5HMW A;  3CCW A;  3NCQ A;  1D9D A;  3BKU A;  4ICL B;  3OW2 R;  2YNF A;  4LFB F;  3E01 A;  1VQO S;  1IN0 A;  3ZZZ A;  4JV2 A;  4ZPC A;  3FKB A;  2J9D E;  3BKT A;  4JYA F;  2F1F A;  4EBE A;  1VJW A;  3JSB A;  4IQX A;  3C16 A;  5IC4 B;  1RTD B;  1SIZ A;  3GII A;  2VG6 A;  4YUD A;  3PR4 A;  1I94 F;  3CW2 C;  3MGJ A;  4Y34 A;  4ZIV A;  1FWL A;  4M5G A;  3HXM A;  2DHH A;  2ZBP A;  4JI5 J;  1TK0 A;  4NPO A;  2FPH X;  3JQK A;  5HLF A;  2HFN A;  3QRP A;  4KGZ B;  1F5A A;  3K17 A;  2Q3P A;  2HS4 A;  1HNV A;  5D4N A;  5KFJ A;  1N5S A;  5KFI A;  3RAX A;  1N36 F;  3PR5 B;  4ZPB A;  1FF2 A;  4ED1 A;  2FHO B;  4NI2 A;  1VBX A;  3GJS B;  2HRU A;  2PII A;  3CUL A;  4PG4 A;  1TKZ B;  1U48 A;  1HHS A;  3LP2 A;  1JK9 B;  2F4F A;  1HQU A;  1OPZ A;  1ZZF A;  2DY9 A;  3BR9 A;  1XR7 A;  4PCQ A;  1VOM A;  2Y9H A;  2ZHB A;  4ZPD A;  1VQY A;  5BR8 F;  3C6U A;  1HNX J;  1LXJ A;  1RHQ B;  3M9O B;  4Y2M A;  3W1Y C;  2HK3 A;  1RT2 B;  3D1O A;  4IUF A;  1CBK A;  3V4I A;  1SKS A;  2CQ1 A;  4ED6 A;  2ALZ A;  1S6Q B;  2VBY A;  2HNY B;  1I3O B;  1HNI B;  1IXK A;  3DRS A;  4JB8 B;  2FHJ D;  5D0G A;  4DS4 A;  1BHN A;  1CQN A;  2QLJ B;  2R8I A;  2I38 A;  5LSL A;  2W8L A;  3KDN A;  1VQ5 S;  4EZ9 A;  2BQU A;  1UVN A;  3HVA A;  3P6Y C;  1RWP B;  2G2Y A;  4ZCI A;  2B51 A;  2CJA A;  2AWZ A;  3L7P A;  1UWA A;  2ADB A;  4DN9 A;  1U09 A;  4UY8 5;  1TVR B;  1MW7 A;  4FBU A;  1FJC A;  4GVB A;  4P2M A;  5IWA J;  4CLT A;  4NE9 C;  3NOG A;  3H5X A;  3QBC A;  3KNA A;  1N6Q A;  2OPP B;  4DV5 F;  3N28 A;  1NUE A;  4DCJ B;  3QGI A;  1RTI A;  4B3S F;  2V8P A;  2CJQ A;  1T0T V;  1YVF A;  3LWL A;  1TAQ A;  3G6E S;  2UU9 J;  3E3X A;  4CLZ A;  2W4C A;  1WKK A;  5BXI A;  1TZ0 A;  2BA9 A;  4LF5 F;  5CD4 A;  3TAN A;  5F8I A;  1U0H B;  3ZTO A;  4CT8 A;  1T9U A;  2V9W A;  1U8S A;  1Y10 A;  3M2V B;  3R5C A;  5FDL A;  2I6W A;  3ZZY A;  3M9N B;  2AEJ A;  3QGG A;  5KG6 A;  4DBQ A;  3DMJ A;  1DBD A;  4K2J A;  1CJU B;  1AYE A;  1GMV A;  3TAR A;  1Q81 T;  5HRO A;  2RIJ A;  2AGP A;  5HBM A;  1WF0 A;  2PEH A;  2XEX A;  4AFF A;  3MR6 A;  2YQ0 A;  2X1A A;  5D3G B;  4ER8 A;  1TL5 A;  3NMA A;  5JUM A;  1EIY B;  1S6O A;  1N4L A;  1T94 A;  2AEF A;  4M95 A;  3Q89 A;  2CQD A;  4AUK A;  5B0A A;  4URG A;  2IJF A;  2GO8 A;  3H5Y A;  2FVR A;  2J9E A;  4TXS A;  2BJ7 A;  2E5I A;  3QT5 A;  2AHO B;  2VG5 A;  5D4O A;  1JIH A;  1O51 A;  3KK3 B;  2ZJR Q;  3RR8 A;  4RL1 A;  2FHJ A;  1BQM B;  1HBN B;  4NA3 A;  3R6G B;  4CI0 B;  3ZTQ A;  2P6T A;  4KGK A;  4QJV A;  3TUJ C;  2IY5 B;  1R8B A;  4KY3 A;  3CE8 A;  4EZ6 A;  3IP0 A;  4OJ3 A;  5DG8 A;  1IKX B;  2H51 B;  3CCQ S;  1T02 A;  1MRO A;  4ZCM A;  3V6D B;  1UPM B;  1CUL B;  5L1K A;  3A4T A;  3CD7 A;  2A6O A;  3OL7 A;  3NL0 A;  3DHW C;  1FDD A;  3H59 A;  1P6T A;  3W5Z A;  4LMZ A;  1T9X A;  2KZM A;  2BXJ A;  1VQP S;  4RW8 A;  2C2K B;  2ZM6 F;  1QUP A;  3UDV A;  3TAM B;  5L38 A;  1R3N A;  2VAS A;  1Y11 A;  1IKW A;  1Y9O A;  3K89 A;  5J2P B;  2AT1 B;  1AXQ A;  4WP9 A;  2OSR A;  2N4D A;  3FFI A;  1FER A;  2V34 A;  2E66 A;  2VPX B;  2BEF A;  1CVJ A;  4DR3 J;  1JLA B;  1NKE A;  3ONQ A;  4X2B A;  4DR7 J;  2HFV A;  3V81 A;  3J80 U;  3F56 A;  2W9B A;  1BWE A;  3A1Y G;  3H4D A;  4EBD A;  1S97 A;  4R8U A;  3GYX B;  3SCI E;  3VZH A;  4GMK A;  4OYA A;  1GFW B;  1RJJ A;  4CWB A;  1F9F A;  1RAH B;  4N41 A;  3R5B A;  1NZ8 A;  2BJ3 A;  4EFA C;  2VFV A;  1NHV A;  4I1T A;  4ES1 A;  3RGI A;  4GC7 A;  3H7H B;  4NLY A;  5B0E A;  4MKY A;  4F4X A;  3FUY A;  1ZTW A;  3RYL A;  3SDE A;  5LMN F;  3V6J A;  3OR1 A;  2Z30 B;  4RW9 B;  1NK7 A;  4FNI A;  3VWS A;  1JLF A;  4UY8 T;  3MM9 B;  3SCK E;  2CQB A;  5ETM A;  2CZV C;  3UD4 P;  2XHC A;  4Z7C A;  4DPT A;  4DSJ A;  1O0P A;  2B9W A;  1C0U A;  3VVU A;  8AT1 B;  3FEX B;  1MU2 A;  2COL A;  2VQE J;  2CZ9 A;  2WSF C;  4OX7 A;  1VQM S;  2LEA A;  3GIL A;  5DGA A;  3HCX A;  1RA7 A;  1FD8 A;  2L41 A;  1FVQ A;  3DRR B;  5F3Z A;  4CH1 A;  1SKR A;  3N5F A;  2EFN A;  4FXW A;  3ET6 A;  2HK2 A;  1RU1 A;  1JKH A;  5DDQ C;  1JXV A;  3VAM A;  3DM2 A;  3BBC A;  2MLY A;  4KJI A;  4J9O A;  2P9E A;  3HVW A;  2QN6 B;  2XSJ A;  1TUG B;  2LQJ A;  1HNZ F;  3OL8 A;  1JLC A;  3U27 A;  5KFM A;  2KB2 A;  3KDO A;  2IFX A;  1KS2 A;  1SC3 B;  2V8D A;  4Y2C A;  2KM8 C;  2IBK A;  2HLU A;  1SL1 A;  1U2R A;  2OLW A;  3G96 A;  2J8S A;  4I68 A;  4DQR A;  1KFS A;  3ITH A;  4RPF A;  1UVK A;  5KTQ A;  1U2C A;  1VRQ C;  2DNL A;  1XBW A;  4Q44 A;  2DKO B;  2DH9 A;  3AHP A;  2PA8 D;  2UV8 A;  1UVI A;  2M8H A;  2N7C A;  3C46 A;  4DOZ A;  4LF8 F;  4CO1 A;  5E3C A;  1UVL A;  4DSL A;  3FVY A;  3KXD A;  5DG9 A;  1T8E A;  4LSL A;  2OHD A;  3GTY X;  3FZB A;  4P7V A;  4A4J A;  4C8Z A;  1HWI A;  1FNM A;  3BSO A;  1F9E B;  2XZW A;  2V4R A;  5F8L A;  4JI8 F;  2I9S A;  3BYP A;  1KTQ A;  3HHD A;  3MUV P;  3D1H A;  2BX6 A;  1RT7 B;  4JI0 F;  4F4W A;  1TMJ A;  3R2D J;  2N3O A;  2YNI B;  4LF1 A;  3QJL A;  2EG1 A;  3MPW A;  4F36 A;  4C8L A;  1K44 A;  2FB0 A;  1MN9 A;  3DRX A;  3LUY A;  2V94 A;  3PNI A;  2HMI A;  4TN2 A;  2LQ9 A;  4ZPA A;  1F5C A;  1HR0 F;  2VIH A;  3M30 A;  3I55 S;  4R25 A;  3NGD A;  1S1X A;  3K0J A;  2OPQ B;  4ITS A;  4RBT A;  1FA0 A;  5IQ6 A;  2XI2 A;  3EPG A;  3IWN C;  4MYU A;  2JDJ A;  4WU3 A;  1J5O A;  3HKZ D;  3I0R B;  2B4V A;  3ZZO A;  3QWP A;  1LWF A;  4NZ6 A;  5A76 A;  1FRI A;  1JXL A;  1REV B;  2CJB A;  3IC1 A;  5I3U B;  4NLR A;  3Q8U A;  4KE5 A;  1H38 A;  1C1C B;  2QRR A;  5L46 A;  1MMD A;  5IM0 A;  3MEC B;  4GKJ J;  4DR1 F;  3PKY A;  3THT A;  4H4K C;  3KOA A;  4W4M A;  3MR7 A;  3OTB A;  4RNN A;  1WI6 A;  3UN3 A;  2DXF A;  3KNG A;  1YJR A;  3J81 U;  1KDN A;  1Z2L A;  2QO3 A;  2BJ8 A;  1P1L A;  1VQL S;  2CPE A;  4RW6 A;  4C8M A;  1GT8 A;  3QGH A;  2UXC F;  2GS8 A;  3M8Q A;  5K8P A;  4W90 B;  2ROP A;  5HJX A;  1M1G A;  1BLU A;  1FWP A;  4OHX A;  1SJ1 A;  3TOQ A;  3N9U C;  5KFD A;  4BC7 A;  4NLG A;  2E1P A;  4RU9 A;  2B8Q A;  4ECS A;  3QLH B;  2PO4 A;  1R6V A;  1U1O A;  2QA4 S;  5KG0 A;  4LFB J;  1RWM B;  1X5T A;  6FD1 A;  3BN7 A;  5CYM A;  4Z37 A;  2I2Y A;  1K1Q A;  3VGS A;  4ED5 A;  2XB2 D;  3MHY A;  2KT3 A;  3DOM B;  2Y1L B;  5E2Q A;  3UI3 A;  4DQS A;  4ZKA A;  5KFC A;  3Q22 A;  3SIP B;  1IWA A;  1AZS A;  1W7W A;  2ZWP A;  4FN5 A;  3SBM A;  2B9E A;  1H3D A;  3DDK A;  1JNR B;  2ILZ A;  4M5N A;  5L39 A;  1Q7L B;  3V6K A;  4WKR A;  2HFO A;  1FTR A;  3M1V A;  4C11 B;  1N36 J;  3TNV A;  5DM6 Q;  5DO2 A;  1FES A;  3W66 A;  4CH0 S;  1JJH A;  1RWV B;  2AJ2 A;  3D7S B;  3OV7 A;  3RBD A;  2FVQ A;  4HDH A;  2OFH X;  4DR5 F;  1EZZ B;  4ZS6 A;  2NRE A;  3EGW B;  3ENV A;  2M8D B;  3IG1 A;  5BR8 J;  5M2U A;  3AT1 B;  1EAY C;  1YTY A;  1DRZ A;  2J76 E;  3CDB A;  2UP1 A;  2XQC A;  5A6W A;  1H7X A;  4YR0 A;  4QYZ K;  3NGT A;  1NK5 A;  2XMT A;  3TAQ A;  5M2R A;  3R9L A;  1WHW A;  3BV8 A;  4OHY A;  1AT1 B;  4H4O B;  3NAI A;  1RTD A;  2F7V A;  1LWC A;  4K4Y A;  2JZ5 A; 
#chains in the Genus database with same CATH homology
 2HVD A;  1NB2 A;  4S0M A;  1XQI A;  3Q83 A;  3BBC A;  2DXE A;  3ELH A;  1NHK L;  1U8W A;  3ZTP A;  4DUT A;  3VGV A;  3BH7 B;  4FKY A;  3L7U A;  3FBB A;  3PRV A;  4C6A A;  3Q86 A;  1PAE X;  1W7W A;  4AND A;  1B99 A;  2DXF A;  4EK2 A;  5C7P A;  3GPA A;  2B8P A;  1B4S A;  1KDN A;  3ENA A;  2BX6 A;  1NLK L;  1LEO A;  3Q8V A;  4O0N A;  4WBF A;  1HLW A;  3BBF A;  3EVO A;  3FBE A;  4F4A A;  1NSK L;  2CWK A;  1ZS6 A;  4ANC A;  3B54 A;  4DI6 A;  3FC9 A;  1EHW A;  3FBF A;  3PJ9 A;  1XIQ A;  3EVW A;  1NDL A;  4F36 A;  1K44 A;  1MN9 A;  1NUE A;  3EE3 A;  3VGT A;  1NCL A;  3B6B A;  1BE4 A;  4KPC A;  5IOL A;  1WKL A;  3DDI A;  3Q89 A;  2BEF A;  3GP9 A;  4HR2 A;  1PKU A;  3ETM A;  1S57 A;  2DY9 A;  4FKX A;  4UOG A;  3EMT A;  2ZUA A;  3FCW A;  3VVT A;  1S5Z A;  4UOF A;  1NSQ A;  3WX8 A;  1NPK A;  3VVU A;  1BUX A;  3NGU A;  3ZTR A;  4ENO A;  1F3F A;  2DXD A;  2HUR A;  2B8Q A;  4UOH A;  4ANE A;  3EVM A;  1VYA A;  2AZ1 A;  3JS9 A;  3Q8Y A;  1WKK A;  5BXI A;  4DZ6 A;  2NCK L;  5CAA A;  3EJM A;  3VGU A;  1NDP A;  3EIC A;  3FKB A;  3NGS A;  3NGT A;  3BH6 B;  3ZTO A;  1MN7 A;  2VU5 A;  3ZTQ A;  1NDK A;  1S59 A;  3MPD A;  3DKD A;  1F6T A;  3FBC A;  1BHN A;  3R9L A;  3NGR A;  1WKJ A;  3VGS A;  4W98 A;  4CP5 A;  1HIY A;  3G2X A;  1LWX A;  1UCN A;  3Q8U A;  2DYA A;  1HHQ A;  3EM1 A;  3FCV A;  1NSP A;  5CAB A;  3ZTS A;  1NDC A;  3BBB A;  2HVE A;  2AZ3 A;  1JXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...