4DUTA

The structure of nucleoside diphosphate kinase (ndk) from burkholderia thailandensis
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
140
structure length
140
Chain Sequence
ALERTLSIIKPDAVAKNVIGQIYSRFENAGLKIVAARMAHLSRADAEKFYAVHAERPFFKDLVEFMISGPVMIQVLEGEDAILKNRDLMGATDPKKAEKGTIRADFADSIDANAVHGSDAPETARVEIAFFFPEMNVYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia thailandensis
molecule tags Transferase
total genus 44
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4dutA00
3NGTA 3MPDA 4ANDA 1B4SA 3ZTPA 2DY9A 3NGRA 1HLWA 3BH7B 3BBCA 3BBFA 1NSKL 3VVUA 4HR2A 1UCNA 1S59A 3Q8YA 3FC9A 3PRVA 4C6AA 2HURA 1B99A 3DKDA 3VVTA 2VU5A 3ENAA 2B8QA 1WKKA 4EK2A 3L7UA 3GP9A 3ZTRA 4S0MA 4F4AA 2HVEA 1NSPA 5C7PA 5CAAA 3BBBA 4DI6A 3FCWA 3PJ9A 5BXIA 3DDIA 2AZ3A 1BUXA 3ELHA 3Q89A 3EJMA 3VGTA 4FKYA 4KPCA 1K44A 3EMTA 2BX6A 1NHKL 4O0NA 1BE4A 4F36A 1HIYA 3Q8UA 3R9LA 1LEOA 3FBBA 1XIQA 1MN7A 1WKLA 4UOHA 5CABA 1NPKA 1HHQA 4UOFA 1PAEX 1WKJA 2DYAA 3ETMA 2AZ1A 3EVMA 3Q86A 4ENOA 1BHNA 1PKUA 2CWKA 3FCVA 3VGUA 4ANEA 1NDKA 3EICA 1NDCA 1ZS6A 2DXEA 1S57A 4DZ6A 1MN9A 3Q8VA 3GPAA 1NDPA 3ZTOA 2ZUAA 2DXFA 3B6BA 4ANCA 3EVOA 3VGSA 3EVWA 4DUTA 2BEFA 3NGSA 1F3FA 1NLKL 4CP5A 1F6TA 3ZTSA 2HVDA 5IOLA 3VGVA 2B8PA 1U8WA 2DXDA 1NCLA 1NSQA 3EM1A 3FBFA 1NUEA 1NB2A 3WX8A 3FBEA 1W7WA 4FKXA 3NGUA 3FBCA 3B54A 1NDLA 1JXVA 1LWXA 3G2XA 3JS9A 1VYAA 1S5ZA 3FKBA 1XQIA 3Q83A 4UOGA 2NCKL 4W98A 4WBFA 3EE3A 1KDNA 1EHWA 3ZTQA 3BH6B
chains in the Genus database with same CATH superfamily
4JV2A 2EWHA 5CYQA 3KLEA 3M2UB 1NPPA 2CJBA 3Q8QB 3FRYA 1BLUA 2EFVA 2DGWA 4NCGB 5BXIA 3CWJA 1KC8T 5L9XA 4GC6A 1OO0B 5IC4B 2FJBB 5E7OB 5U47A 3W9HA 1XNQF 4FBUA 2QFIA 4PG4A 4IRDA 1P1LA 1ZZFA 1RYSA 1IBCB 1BXNA 4U7CA 2EEYA 1JMTA 3TOQA 2EG2A 1HYSA 1GTHA 1U7LA 2UUWA 3IWLA 1F2GA 2ZH1A 4LRBA 2W9CB 3QSIA 2KH9A 3D1QA 3S6EA 1CEZA 3DLEB 4JV1A 4Q0BA 5D3GA 1T9XA 1SKRA 2C3UA 1RBAA 4FF1A 4DR6F 4ZKAA 4Q43A 4ED8A 1URNA 2XNRA 1NDLA 2M8HA 3MZIA 3JS9A 1QSYA 3EDQB 2DRDA 2BJ8A 3VALA 4WBFA 5EWFA 3EWGA 3OLBA 4EZ6A 2YKNA 4DV3F 1JLAB 4WXOA 2B6AA 5D77A 1AUSL 4YDXA 1NJIT 4OMFG 1IBLJ 2AEJA 1TL1A 1HWIA 3PKYA 2AJ0A 3GR0A 1KFDA 2FZCB 3MM6B 1Q8KA 3AD7C 1I94F 3Q89A 2CA9A 4YR2A 2RQKA 3LTOA 4R5PA 3H4BA 4RKUC 2JDJA 5KFIA 3V6JA 3US5A 2UVVA 1H6KX 2QMXA 4JI6J 1HNVB 1W2IA 5AE2A 1FWLA 2B5JB 1S57A 1VIXA 3N28A 3Q8VA 2DNZA 5CYJA 2HNZA 3KJQB 1F6TA 5CYQB 5C5JA 3KLEB 4QOTA 3QAUA 1NB2A 4NLUA 3WX8A 1VRUA 3TJAA 3K58A 2IYIA 3CJ8A 2V50A 2CKWA 3I31A 5K8NA 3DMJA 4M5NA 2VOPA 2RSQA 2E5IA 4CM0A 2QL7B 4RUBA 1U1QA 3PO5A 2ZVIA 2XGQA 1Q53A 1CC8A 2P5VA 4DPTA 4RNHA 1HYSB 1RK8A 2BE7D 3D4JA 2HRTA 4O44B 1MROA 3TZWA 1A6LA 1RU1A 2KXHA 1VJWA 4DX5A 3N6MA 4Q0BB 5D3GB 3HHDA 3M9NB 3EX7B 1KVIA 3NNAA 2YKAA 5L38A 2GCFA 1FFWB 4EI2A 2ZZTA 3CVKA 1M5PC 5BR8F 2DNNA 5CXTA 4U96A 2N4CA 3GU0A 2HHSA 2VPZB 2YKNB 2QLJB 1REGX 2B6AB 4DQIA 1FESA 1TL1B 2IHR1 2YX4A 3JXOA 1AXQA 4OHWA 3UD5A 2ASDA 3HI9A 3F44A 5DDQC 2XMMA 2E9TA 2GHPA 4YEAA 4WZMA 2W4CA 2IAJA 1RKJA 5KFVA 3UE2A 1UA1A 4DI6A 4DV6J 2DHHA 2RE1A 2DNLA 3QZ7A 4KIAA 3MFHA 1VHFA 4YB5A 1AW0A 2OI2A 4DOZA 1F1BB 1MN7A 1VHIA 3NLCA 2HNZB 2J0SD 2F1FA 3AOBA 3TR5A 1VRUB 1RAJA 3T5HA 2W24A 1R6VA 4DPWA 2GHVC 3V6DA 2D7SA 1Q78A 5B0BA 4OIXA 1TUGB 2RDDA 5ETQA 2BM1A 1UEVA 6FD1A 2J7UA 3CE8A 3NCPA 4UOGA 4ELVA 3N01A 1WOSA 1VC5A 3PY8A 2J7KA 3GIJA 3BJYA 2Q79A 3QYYA 1NMEB 3FSXA 2PDAA 1P9YA 2Y0SD 1MROB 3L09A 2WSFC 2QE5A 2R7OA 4U7UK 3WIUA 3QFHA 2I5JA 1GFWB 4UZCA 3NG8A 3R5CA 5L46A 2P2CB 5EX3A 2JVRA 2K7KA 1TKZA 4CZCA 5SZTA 5KT7A 4DR7J 1YZ6A 1RWMB 2CJXB 3FNNA 5D4LA 2W2MP 2VC0A 4I0WA 3IR6B 2HKEA 3O8WA 2PGCA 3ZO7A 4ELUA 3R7NB 3B6BA 2D69A 2M70A 1S9GA 1NK5A 2D74B 2QTWA 3GFYA 4HLBA 3EM1A 2KYZA 3PIPQ 1Q82T 2YWKA 4YN3B 4X4PA 3NGUA 2HRYA 2M3DA 1WI6A 1S5ZA 4JV5J 4BC7A 2W4PA 3TYTA 3PYDA 1KDNA 2CQ2A 5H9EK 1KQKA 3ZTPA 2VPWB 4DR2F 3AHPA 3O6QA 4K4TA 3J7AN 4X2BA 3PRDA 3M7VA 3HF5A 1T9VA 4LUBA 3JTOA 5GVQA 1S1TA 1Y4ZB 3A8EA 3M1VA 2IDEA 4ZVHA 1TKXA 5J2MB 1U45A 1CS4A 1RYRA 1S9EA 2H4YB 3LQVA 1HHQA 4I6WA 1PAEX 3UN2A 4DUZJ 3H7HB 2P9EA 2V69A 1UPPA 4QQBA 4R8UA 2ZOMA 2VONA 1R8CA 3FEYB 3KLVA 4ILMA 1HWKA 2C3MA 2D3ZA 4F4ZA 4JI0J 3VAHA 1ZTTA 2RF2A 3D3CJ 4U95A 2W1BA 3CJRA 1RADB 4J9RA 1FXLA 4A8WA 1N54B 4C0HA 2UUAJ 2E7WA 2KG0A 4C8ZA 3LALA 5FJ4A 2G1HA 1R0CB 5JVGQ 2YX1A 2Z57B 1WACA 3I82A 2GS8A 1D9AA 4PPZA 1IKXA 4NXMF 3POTA 4L74A 2BJ3A 2GW8A 3BKTA 1TKZB 4B9UA 3OTCA 2CZ9A 4DU8A 2VBZA 1IM6A 3E51A 2MZJA 3DXSX 3PYGA 5ETOA 4WF9Q 2BX6A 3RR8A 3QMQA 1N33J 4NOHA 2ADBA 3MOJB 3DHXA 4NXNF 1FJEB 1KQGB 2AMCB 3ETMA 5HVFA 2F8HA 3SXLA 1R3NA 4Z7CA 4TLRA 2BACA 1H38A 3GJSB 3BGOP 4DHVA 3J80Y 2ATCB 3NGDA 3DRYA 2CVEA 4C8MA 4Q7AA 3WDOA 2G4BA 1RAFB 3W2VA 2AJ4A 5GAGU 1WC6A 3J7A1 1S1TB 3M1VB 3ZFVA 3JB9k 1TKXB 2JFKA 4EFAC 4FBTA 1C1BA 3H59A 1RA6A 4W4MA 2KZMA 5CYMA 3ETOA 3PVXA 2QA1A 4USHA 5C2CA 1CS4B 1Z2ZA 4WFZA 4RUHA 4F4YA 2GVDA 3FCWA 2CQ3A 3G6ES 4DR5F 4R8UB 2BBEA 1ACMB 1MWYA 3AXKA 4DZDA 5IWAJ 3PEJA 2FHOB 1WJ9A 1TMJA 2JFDA 2NSBA 1RTDA 1DY3A 3OXFA 3LP2A 5CQGA 4CO4A 2A2DA 1FT8A 5KFKA 2RF2B 3DFEA 5KFAA 2W2OP 4AT1B 2IJFA 2VFTA 4AYBD 3KUGA 4NMLA 2DYAA 4L72B 4H54A 3FK4A 2BR0A 3M6XA 1KFSA 4USVA 1E6YA 3K5OA 5CZXA 1MN9A 5IT4A 3KG4A 4N41A 2BJ9A 2CPIA 4QYZK 1M1GA 2KYXA 1JLGA 1IKXB 5B0FA 5E3RA 3OFFA 3POTB 2CPYA 4PG5A 2OMLA 1X4DA 3HMJG 4NRUA 4BWMA 3D7SB 3W5XA 3EE3A 1PBAA 5KFXA 1Y3KA 1DQ8A 2UVWA 4P73A 3RZAA 2ZH9A 4H4OA 4RBTA 1RWVB 5KFFA 4WIQA 1JQGA 2ZBRA 2FJDB 2PMZD 4FXVA 2YH1A 1YLXA 4JV0A 2OELA 4K7QA 1N88A 5FIIA 2PI4A 1S10A 1JLFA 1RT1B 3MURP 3CCMS 2J9DE 3SQGA 5DGBA 3R3TA 3PM9A 2PT0A 4DQPA 4NL5A 3WQPA 5IM0A 2MSTA 4IQMA 2G13A 2BRLA 2CJAA 1LWEA 3TZXA 3W9IA 5FLXU 2D41A 1IBLF 2EW9A 3VAMA 2E1RA 3HHLA 3MUTP 2BQ3A 1JLCA 4ECRA 2ZH7A 4P2FA 3NKYA 3ZZTA 3H25A 3G6XA 5CYMB 3MR5A 1IR2A 2GVDB 1K73T 4ED3A 4B02A 1KD1T 5BYQA 2GJFA 2DNHA 3RW7A 3KUEA 4CO1A 3Q22A 2IVFB 3CD0A 3SZ2A 1RTDB 3LP2B 4JI6F 1RWNB 1VQ8S 1U2FA 5G4DA 4GKKJ 2UU9J 1X4EA 1RAEB 1RT5A 2W2NP 3PG9A 4DMZA 5KFCA 4XIUA 2QZ8A 1E6YB 3FFIA 2NPIA 1TV6A 1NHUA 3PHEA 4TQRA 4CT9A 5E33A 3PTWA 2B4PA 2R4FA 1JLGB 2DO0A 4DR1J 1GMWA 5JJBA 5HJXA 3TQEA 1TTHB 1MU2A 2R7WA 2U2FA 1K0TA 2VKRA 4I1TA 2BE2A 2E9RX 4Q2LA 3GCWP 5DS7A 2ZWOA 5E3AA 1U1PA 1KBRA 2OEKA 4H4OB 1JJ2R 1C2PA 1B0PA 3D1HA 1EKRA 4OJ3A 2IM2A 2AT1B 1RCXB 1S1UA 1U0SA 4TU8A 4AD6A 2LMIA 1FI4A 4JP8A 4OYOA 4WE1B 1T8EA 3B4MA 2W25A 3Q8SB 2VD3A 4J9VA 1JLFB 1A0OB 6AT1B 2LKZA 4PQAA 3V4MA 3SQGB 1HBUA 1X4AA 2DNKA 3MR3A 3GLJA 1H2UX 4CIOA 4TU9A 2CADA 4NYOA 5IM0B 5A2QY 5DETA 1WSVA 4FPRA 4MTPA 3G8TA 2GGPA 3QT6A 2ZBQA 2HRUA 4KY3A 5HMXA 1IJEB 2VPXB 3HHLB 4TNOA 1HMVA 1JLCB 3H4DA 1BQMA 3ZZZA 2CPZA 2G1DA 4MMOA 2RU3A 2QX0A 1WUUA 3KJNB 3QIPA 2LXUA 3N79A 2ZHAA 3CDWA 2YXLA 4LR9A 4IH6A 4EBCA 3C19A 4KH1B 3C6TA 1NEEA 4DV6F 3IM8A 2OD4A 1FKOA 2NCKL 2FJAB 5K20B 1S7IA 3FFIB 5ITHA 4NLWA 4LFBJ 5D6GA 1SBRA 1TV6B 4DR4J 2M52A 2VASA 4J37A 4DS4A 1MW7A 2EFGA 1VS3A 2J8SA 3DRSA 1TU0B 3LANA 2WHOA 2A6MA 3FMWA 1GXUA 4LIWA 3M30A 1MU2B 3HSDA 1TK8A 1R0AA 3HFVA 5F0WA 2CJYB 1TL4A 1HQEA 3W1YC 2BE2B 1YI2S 2X1FA 5J1EA 1NRKA 2C3OA 2KDOA 3EVMA 3NOCA 3DLGA 2MPUA 1WG5A 3U1MA 2X1BA 2RD5C 3HHLD 1ZETA 3R1HA 1O0PA 5HANA 1HR0J 3EVOA 1VQYA 1S1UB 2LDIA 2R42A 1A7GE 2AEFA 3MCSA 4A8YA 2RMLA 4B3SJ 3IRWP 3C46A 2JX2A 2MXYA 1P6TA 3SDEA 4HEA9 4WTOB 1HBUB 3Q8PB 4YB1P 1GK8A 3THTA 1U8SA 3K8WA 1VQMS 3T9NA 3NL0A 4U8VA 4DR7F 1CPZA 2GMHA 3GFZA 3SCIE 9RUBA 3RRHA 2GGPB 3F56A 3Q24A 4QCLA 3AB4B 2ZITA 1FHTA 1UWBA 2MLZA 3H90A 3BM7A 1HMVB 2H5IB 4RW4A 1BQMB 2HQIA 2ZC4A 3ZZYA 3WX4A 3H8YA 3QIPB 1QE1A 4CLKA 2AGQA 4LVNP 4ZPTR 3I56S 1NNDA 5IC6B 1RT6A 4NZ6A 3TX8A 2B9YA 3IGNA 2X3DA 1TK0A 2V5HG 4MAKA 4C8OA 4JV5F 2ACMA 3T1HJ 2MLXA 1FE0A 3MAQA 2F5GA 3C6TB 4P10A 1WF0A 2CJQA 4P74A 1F3FA 5K8MA 2V8GA 3MDFA 1U1RA 2OEMA 1NCLA 3I9ZA 3I5BA 3R5DA 3GYXB 3BPDA 4HH1A 4FF2A 3PYEA 2FVCA 1VQSA 2OPPA 1BWEA 5ETKA 3BS9A 2EFPA 2K8GA 2ZJPQ 2KRBA 3DRSB 4LF7F 2FJVA 3DDKA 4ANDA 1JNZB 2PEHA 2BW7A 1S59A 2ZE2A 4DLEA 4DUZF 3IBCB 3L7UA 3FEXB 1R0AB 2BW2A 3GP9A 1TKDA 2GMLA 1VQLS 2MGZA 1HQEB 1P1TA 1DARA 2C22A 2ZJRQ 2V4QA 2NREA 2BKNA 3THVA 1C1CA 4JI0F 3RRGA 2G0IA 1IBMJ 5RUBA 5BJRA 4YB7A 3K0JA 1Y5NB 5HATA 3WIVA 2ZNZA 3CEDA 3JQJA 4NEYA 1AT1B 4E2FB 5D0RA 5DJBA 3FEZA 5HMWA 5DDPC 2VG6A 5E3QA 2UUAF 5I3UA 4DU7A 1PSDA 4UTGA 4BLGA 4ZN1A 3SDEB 2QSWA 4ECTA 4CTAA 4R0EA 3ZTSA 5F3ZA 3CCJS 1FXDA 2JEJA 1C0UA 1XMQJ 5KG2A 5KFEA 1RBOB 5LJ5Y 3EGNA 2DBBA 2P6SA 3OL9A 5J2NB 3G6YA 1UWBB 4C11B 1B0TA 1Q5VA 2XSJA 4ES3A 1N33F 2AYGA 2ASJA 4RW4B 2I2YA 4UZBA 1XNRJ 3NWRA 2E1AA 1XMOJ 1QE1B 3HK2A 1RT6B 2YNHA 2VFVA 3MPWA 3VAJA 2AGPA 1SJFA 4BCAA 1VISA 5GAGI 4H4KA 3HT3A 3JSMB 2DH8A 1F9HA 1OPIA 1FDDA 1NK0A 1NKCA 4HH0A 2H5EA 5HQ8A 1OY8A 3GJRB 4WU2A 5HI7A 2FUG9 1FVSA 1LFPA 3DLLQ 3KFWX 2A18A 1WI8A 3DU5A 4N77A 2N4DA 2BEFA 3KK1A 3Q0AA 4QPTA 2Z2LA 3HD2A 2X3GA 3SV3A 2G2ZA 1Z2LA 2ZHOA 1TUVA 3E8OA 5IWAF 2MGZB 2OGUA 1V3SA 2VDIA 4WWSA 1C1CB 1DBDA 1IJFB 4CH7A 4DV1J 2HURA 4X65J 1S48A 2R2SA 4DWIA 4N8NA 5I3PA 5BYRA 3H2LA 4MIAA 2VDHA 3H0PA 4DL6A 2VG6B 5L1LA 1ELOA 5I3UB 2DIUA 4J9MA 5H9EJ 4A48A 2YY3A 4O23A 2WW4A 1UTAA 2MTLA 1T9UA 2RIJA 3WC2A 3M8RA 3RBZA 4F26A 1XIQA 3OVBA 4D3HA 2F3JA 4TU7A 2XO6A 4CTAB 2CQ1A 3A8JA 3CJKA 1XEZA 4CLPA 1T95A 2ZH6A 2JOQA 1QAJA 4RZRA 5A0YA 3CW2C 5IZHA 2KM8B 2YKQA 2QT7A 2XSJB 4I2PA 1HKAA 2VF3A 3V2UC 1O51A 3JTPA 2XLIA 3RB3A 2DCLA 3CC2S 1JNRB 2YNHB 3TUZC 3KJVA 2AWZA 1ULRA 5A6PA 2XZDB 3VR1A 4K4VA 4OYBA 2HHQA 2IA0A 2RQ4A 4I69A 2FGOA 4CRJA 2B4VA 2K7JA 4NA3A 1ZTWA 2IBKA 4RNOA 2G9OA 2B7BB 2D9PA 2MZQA 3BF4A 3DLBA 1S79A 3KK1B 3AD8C 5KG4A 3TVKA 4IRKA 2XLKA 1FERA 2Y1LB 1P9QC 3NNCA 5B7WA 3M8QA 1X31C 4CNYA 2COLA 2YTCA 1WG1A 1OY9A 1H98A 1RUSA 4ZLNA 2BVZA 3HT0A 2GAGC 1FWPA 4MIWA 2VFUA 1S7HA 3T1AA 4UF4A 4GKKF 2UU9F 3O5TB 1H0HB 2OMOA 3P45B 4A46A 3RGIA 2J6UA 2BXJA 1YK9A 1IKWB 1V5VA 1F9FA 4YDDB 1DLOA 4AUKA 2C2KB 2MDAA 2VV5A 1YX2A 4GMKA 2HLTA 5AJ3J 2VBXA 4NLQA 3ZZRA 4J9UE 4DR1F 5IT9U 4YHHJ 3Q8RB 2KTQA 2ZVSA 3PX4A 1JB0C 3HFKA 3CJKB 2C2DA 4NYZA 4OZ1A 3MI7X 3C8YA 5JUMA 4CH0S 3QPIA 5A0YB 4KB7A 4LR8A 4MKVA 2MQOA 3V6KA 5CABA 2Z2YB 3W8PA 1PAUB 2ILYA 2BQUA 2ACYA 1IVZA 5ETVA 3T9ZA 4I2PB 2KN4A 4WKRA 1OIAA 1ZM2A 5DO2A 5E3CA 4DX8H 4ELTA 3MM7A 4MK8A 2YQ1A 2GQCA 1EQMA 2YWGA 4DSKA 3IGVA 2VG7A 1T11A 3KJVB 4DG1A 2VODA 2PD1A 4DL2A 2B9WA 1L3VA 4RWXA 1X5OA 5KFTA 3HSGA 1S1VA 3W5ZA 4DFPA 1XQIA 2JC1A 2OD6A 3BYPA 1UW9A 1B7YB 2YKPA 2J7WA 2ZJQQ 4X66J 3AODA 2HWIA 2GAHC 4ZS6A 2UXBF 4QYZJ 1FRMA 3ZZ0A 5GMKa 1RB0A 3LAMA 3W3SA 3DGVA 2I1RA 1WOPA 1KN6A 2QLBB 3SCLE 4UY8T 3IBWA 3M8QB 1PO6A 1V6HA 4B9NA 4F2RA 1J5OA 4YS2A 3QQCD 1HW8A 1MG7A 2RAQA 1KKHA 1IXKA 2FY8A 5F8LA 4DXLA 2E7XA 1R27B 2V0NA 5F3TA 4LFBF 3BDPA 2OTLS 4E0DA 1NUEA 2BV3A 1FKAF 4HDHA 4FKXA 2GQQA 2OTJS 2XMUA 5T7LA 3UD3P 2O3DA 1EHWA 3C16A 1QLNA 1YBAA 1M1HA 2V8DA 3OL7A 1U02A 2QL9B 1BD6A 3SV4A 3RRKA 3AXMA 2KRRA 1WEXA 4NLVA 3CJ3A 1RWPB 4V19J 3K5MA 2XULA 1AROP 1FD2A 1RCOB 2CYYA 1RWXB 4F3QA 2U1AA 1HR0F 2XYGB 1VRQC 3K17A 1RWOB 2GZOA 2IJRA 5KFRA 2CPEA 3LAKA 3MM7B 3UDEA 2PI5A 4C0OC 4QJVA 4A4JA 1XK8A 4ECZA 2VG7B 4A8KA 4NZ7A 3G8QA 2CZVC 2HYIB 4RR5A 5GAEU 3UQSA 1CJTA 2V34A 4DG1B 2QLFB 3VGUA 3PJXA 4RWWA 3ET6A 1S1VB 2HAFA 2D3O1 4EUVA 3ILIA 2CPJA 4NLOA 2RT3A 3IA0A 3DC2A 3CULA 1HNIA 2XNQA 3B54A 4CDIA 1PCAA 5DQGA 1NM2A 4HT5A 4DSEA 1R8AA 1N0UA 4ECYA 2K1RA 2K06A 2HMIA 5B0GA 4B3OA 2M4MA 4HTIA 4J90A 1NKEA 1WD6A 3BBCA 2F9DA 4HT7A 3PFEA 1RT4A 1WTFA 4ZCLA 3D5MA 5FLXY 2HZAA 3AJ1A 3N5FA 3TUPA 3BSNA 2W8LA 1C0TA 4LBPA 1RT3A 3T1HF 2XLJA 3HCXA 3ELHA 3ITHA 3WHIA 4Z2XA 3B4DA 5MLCV 4LBIA 3EMTA 1S9FA 3BGRA 4DPUA 2BANA 4FP9A 2QLXA 1ZM9A 1LK7A 5AXNA 3C6UA 2HNDA 4URGA 1EAYC 2ZZNA 4GVLA 2KFYA 1VC6A 3SI8A 3TA0A 4GO7X 1RTZA 3I6PA 2XI3A 3ZTOA 2FY1A 5T7LB 3KMSA 4ED1A 2W2PP 1CULA 5E0OA 3C16B 3V5RA 3KG0A 5AXKA 1VLOA 2PE8A 2D9OA 3HDSA 1S72S 2UV8A 1NKBA 3D0IE 2XSFA 2YWHA 3P5TL 2YWWA 5I3QA 2Q43A 1IBMF 2FVSA 3QJJA 2R9LA 4O3QA 2JVOA 3C2PA 1W2BR 2FLNA 3CMQA 2DGTA 1PJ5A 4O4RA 1AA1B 3CD7A 3UN3A 4KT0C 5KFUA 3IC1A 2AIRB 4DQSA 1QSLA 3GE9A 1N5VA 3A12A 1CJTB 1SJ4P 4NE9C 2Y3YA 4GC7A 4B9MA 1O8BA 3ET6B 2HHWA 1UW4A 4UT4A 2CXEA 2I6WA 1XMQF 2C2NA 4JI2J 1HWUA 4USMA 2J9CA 1HNIB 1SH2A 1ZS6A 2EXUA 4KO0A 4LRDA 3PXGa 4X62F 3ONQA 3IS9B 4AQYJ 3HJVA 2K1RB 2H5JB 2HMIB 4OYIA 5IOLA 2FC8A 1XMOF 2WVDA 1G3OA 1HNZJ 2HGNA 1RT4B 1TFWA 4QR0A 4WK3A 1TKTA 2I8EA 3DRRA 1CQMA 4LR7A 1R43A 1EKSA 1C0TB 1RT3B 2LYVA 4IO1A 5LL6d 1QD1A 3HVRA 1S1WA 1XR5A 2WOMA 1SH0A 5DQHA 2AV5A 5LMNF 4X4SA 4DCOB 5AT1B 1Z1ZA 4DJBA 3RJMB 2BANB 3BBBA 5KTQA 3C6UB 1EARA 2HNDB 1NB7A 2IBOA 3LWMA 2PO4A 1TL7A 4YY3J 3BR9A 2H54B 3MPYA 1TP7A 2CIMA 2RRBA 3TJ8A 1FO1A 4YFUA 4DPYA 4K8RA 4NLTA 1CULB 4CQ1A 1UFWA 4MFBA 1Q8LA 1G7CB 1UJ5A 2RB7A 2G0JA 1NBEB 1WC5A 4QWDA 1UMJA 1VQKS 1FFSB 4USIA 1YSJA 2PFFB 4DV1F 1ZAWA 3MXHP 4X65F 3EDRB 2AU0A 3OLAA 4MIBA 3QJPA 1Y11A 1B7FA 2RVJA 4NA1A 3D0GE 4PEOA 2LP4A 5H9FK 1VI7A 2BKOA 1FVQA 1H2VZ 5K9FA 2WONA 3MPUB 2NUUG 3HKWA 3VAGA 4XDDA 5L1KA 3LPYA 4DV0J 3Q8YA 4HI2A 8RUCA 2LLZA 2W8KA 4ZPBA 3HO1A 4PQUA 1NSPA 5CHCB 1S1XA 4M94A 3BPSP 4MYUA 3KLGA 1YTYA 1M5SA 5FDLA 5F9LA 1VCTA 3R6LB 5J1PA 4KO0B 1X5SA 4LF2A 2C2RA 3W60A 2DEIA 3R5BA 4HL9A 1FRHA 2C3YA 3MOZA 3RB6A 2GO8A 2A3JA 4I68A 1TKTB 2EFOA 3I0SA 4IDKA 1LWCA 4ICLA 3RBDA 2KVIA 3SMZA 5KT3A 3G82A 1YRXA 4CWBA 4EU0A 3HZEA 1RAOA 1S1WB 2R7SA 3B8HA 2MJUA 2DHXA 4KRWA 2ZOFA 2NZ4A 3HXMA 2LXFA 2K3IA 4HHJA 2YPYA 1MLAA 2MLYA 1TL7B 1WDTA 1SIZA 2EI5A 1IWAA 1GMUA 1X4GA 3R5GA 5A8KA 4WPAA 1NSKL 2VFSA 2ZDPA 1FF2A 1RHRB 3MEKA 3GSIA 4HDGA 1FD8A 2VL1A 2WZ1A 3CCTA 4S0MA 5M2PA 4P6QA 3N4WA 2ZD1A 1UL3A 5LT5A 3IBFB 4RBUA 1RU2A 3VTIA 1Q7LB 2RS8A 1IKVB 2BKPA 4NA2A 4FKYA 1Q86T 2HFNA 4O4GA 5A6WA 4DFKA 3CPWR 5CD4A 4PWDA 1H73A 4DX6A 4QIGA 3UD4P 3NOGA 3ZNJ1 1H72C 3W64A 2DPJA 3TEGA 1M1KT 3B82A 1Q8BA 1PKUA 2HQFA 1RBLA 5ETTA 1VBYA 1FTRA 3WC0A 4DV5J 3P5BP 3RR7A 4MKAA 3NS7B 3NRBA 2ZUAA 2XHCA 3D3BJ 1S0OA 4DX7A 2CVIA 4DUTA 1KP6A 2XS2A 2RQMA 3EZ5A 4Y2AA 3D6MB 2IRUA 1OJ4A 1RAGB 5AJ3F 3TWZA 4ZK7M 2V4RA 4JI5J 2UVUA 1W7WA 4YHHF 2XMAA 2FZGB 1N32F 2UXDJ 3RBEA 4KGMA 4PQUB 4KGZB 4WFAQ 4FYXB 3CJSA 3M8ZA 3AOAA 1TFYA 2QC3A 1C4AA 4OQJA 3KLGB 5FDLB 4IG0A 4FS1A 4HI1A 5D4OA 2L9WA 3PX6A 2HHXA 1AB8A 1AZSA 4EWTA 3OSPA 4OZJA 1I3OB 1JLEA 3V6HA 1SQGA 3W8GA 4P2XA 3I4HX 3EZUA 4PXDA 1PJ6A 2J9EA 2DHAA 5HN0A 5DDOC 1IQZA 3T19A 1S97A 1FRIA 2FDNA 3I0SB 2ZH5A 4IDKB 3V4IA 1LWCB 4ICLB 4I67A 3MHYA 1V3RA 2F8EX 4ED0A 3Q2SC 3G82B 4RBVA 1B64A 2JZ5A 2RHQB 3R8YA 5EWGA 2AKWB 2CFXA 2ZNYA 5JVHQ 4DCPB 3CJQA 3PR5B 3CCZA 1AUDA 2Y8YA 3MAAA 1RAHB 4YUDA 1G1XA 1ZAXA 4TQSA 4F25A 4X66F 1D9FA 2WRMA 3JSYA 2R7RA 2QMWA 1RHUB 2ADCA 5A8KB 3CNQP 2ROPA 4R0JA 4CLTA 1P8GA 4FZVA 4Y2MA 1OY6A 2ZD1B 4Y65A 2HHHJ 2JJ4D 3M8SA 3BYRA 2KM8C 3BH6B 5D4PA 3MPDA 2JEIA 4K4UA 4DL4A 1RABB 4Y2IA 2D3OR 4DFJA 4USWA 4O4GB 2EC0A 3HM9A 4PUOA 3G9CA 4PWDB 2DNYA 2KZZA 4ZVSB 3UPFA 3PCOB 3I96A 4CH1A 3NS6A 5KFDA 4LSZB 5HLFB 4PAAA 2WAQD 1Z4UA 3ZZOA 1M90T 2FJWA 3NY0A 3RU0A 4P7VA 3RG6A 3FRZA 2ZWPA 4OJHA 2MZTA 4QR2A 4B9LA 1MNEA 1RTJA 3I4PA 2VG5A 4NI2A 2CPDA 5T14A 1TELA 1X0FA 2HGLA 4UUXA 4USTA 1FJ7A 5D78A 4QYRA 3SYZA 2BJ7A 3J7YU 1IWGA 2XY5A 4IG0B 4Y0FA 5HBMA 3T3FA 1AZSB 5GAEI 1Q7YT 2E5LJ 1JLEB 1FNXH 4LQ9A 2HFZA 3PO4A 2ASYA 2MHEA 1VQPS 2XC9A 2L08A 3TVZA 4CLLA 1UZHA 3V4IB 3JAMU 2UUTA 1SC4B 4M5KA 4QU6A 2W9BA 4XPEA 2BYCA 2DISA 2RDJA 2VZ9A 1QJHA 3PKMA 4LFCJ 3D67A 1PC5A 3TO8A 1SL0A 3LGHA 4FYYB 2AJFE 1Y5IB 1BQNA 2AF6A 4ZOSA 2KT2A 1N48A 2MKHA 4PG8A 3TX0A 2KFZA 2FPHX 4NWBA 4C4WA 2WSEC 4K4ZA 1D1UA 1UVIA 4X4NA 1EP4B 4O3SA 2HBZB 3KLIA 4M8LA 1YHQS 2OFGX 1VQ4S 2NXUA 4CO2A 3TVYA 5HAOA 1KR4A 3ILJA 3G87A 2FTRA 3TRGA 3IWNC 3HHKA 1JXVA 4PUOB 3DCAA 3MCOA 3MTJA 3MMAA 5HROA 3QWUA 3TEHB 3BQ2A 2M88A 1G2EA 2FLOA 4NLYA 3OL6A 2HFVA 4USJC 5A76A 2E1PA 5D4NA 2LEBA 2JEGA 4NLGA 1RTJB 2R7TA 2VG5B 2CQ0A 1NH7A 4X4TA 4ECUA 2XQCA 2IVMA 4NI2B 1XMBA 5IQ6A 2DHGA 1VQNS 2LDYA 3G8SA 2I9SA 1MSWD 1EZZB 2HVZA 1HQ2A 2HBRB 3E2EA 1XJWB 3M8YA 3SBMA 2N3OA 2VH7A 2F65A 4K5RA 2BABA 3NEKA 2OH2A 1QUVA 3FUYA 4XAKA 2OPSA 3GIKA 5HBMB 1MWZA 4OZ3A 5D15A 5IT9Y 1N36F 2XZWA 3M2VA 2CQPA 4A8XA 4J9KA 3R2DJ 3ZC4A 3KHGA 3T6JA 2AYBA 3PNIA 3T1YJ 2OKQA 4NASA 4DCJB 2HZCA 4KC5A 4IOCQ 2XS5A 4PR6A 2W9BB 1RLDA 1RTHA 4NEZA 2HK3A 4J5OA 2ZKUA 2JC0A 1U1OA 4ZVPB 1KS2A 2IFXA 4UUWA 1VQOS 4MKYA 4JI2F 3W66A 1RWWB 1BQNB 1BY9A 3MEDA 5CCLA 1OS5A 4U6PA 1HFEL 1CJKA 3OTOJ 3J7ZT 4TN2A 3IO1A 4AQYF 3PW4A 2XYPB 4H4MA 1RP5A 1LEOA 2DNRA 1HNZF 3CGIA 2R2UA 1WF1A 3KLIB 2OSRA 4G1IA 4DEZA 3DYAA 4TLQA 3BB5A 3EGZA 4ITSA 1RT2A 3TI0A 3CJ4A 1IQTA 2BM0A 5IQQA 1CVJA 3MMAB 5HROB 4IRCA 2GNKA 2DRBA 4M5DA 2OEJA 4R5PB 1BMQB 2J8AA 4MKBA 3DGPA 4YY3F 4JBCA 2WB1D 3KNAA 4C3MA 3R97A 4W98A 2ZH3A 2IA6A 1OQ3A 2R2TA 1B4SA 3BGLA 2PFDA 3PR4A 1KSPA 1WEYA 2MEWA 5EDWA 5DLFA 2B51A 3BV8A 4LRAA 3MR2A 2QEXS 5C24A 2Q1LA 4ZVQB 4OX7A 2O1PA 4CO5A 4M5JA 4KBIA 2ZM6J 4OHYA 2FGCA 3GYNA 3HVTA 2CJ9A 3S01A 4XPCA 4QIFA 2IYGA 5KFPA 2R7QA 3OSNA 4B9VA 2RU9A 4O3OA 1HI1A 3M2VB 3CJ0A 4QIVA 2EK1A 2HK2A 1LW0A 3DMJB 3I0RA 5KFMA 3PW5A 2V2VA 3NCRA 3ISND 4DZ6A 1NO8A 4K50A 1DTQA 1FX4A 3I55S 4X64J 4ANCA 4IQXA 2RH3A 4DV0F 1OSDA 3OT9A 2Y0BB 3H98A 1RTHB 4XK8C 2C2OB 1Y00A 2FHMA 1EIYB 3A3NB 2BE9B 2CPFA 4C3KA 2H1YA 2Q66A 4FF4A 1JKHA 3MEDB 2RUGA 1CJKB 4DV7J 4BC9A 4HHUA 3MAHA 2KXNB 1S0NA 4W92B 2DH9A 4ZVFA 4DLGA 3IR7B 1I51B 2CZ4A 3VAFA 2BRKA 4H4MB 4RNFA 1HNWJ 4PG6A 3ZTRA 4OLOA 4DF4A 4KFBA 1YG0A 4X4QA 5HSPA 2AZ3A 2HG4A 3DYAB 1FCAA 3HSJA 2XMJA 2XCPA 4PWWA 1RT2B 4N56A 1SKUB 5E3PA 4YR0A 1WC4A 3NMRA 4PRFA 1BE4A 1XN9A 1JK9B 1UEUA 2K2PA 5CD4H 2NXEA 2W7OA 2B43A 5IT0A 4M5DB 4LF4J 4WFYA 3H2VE 5K14A 4NLRA 1YBTA 2IAJB 3DGPB 5LXRA 4QR1A 3UCGA 5E41A 2HFSA 2V6AA 4F50A 3QFWA 3D66A 4QWCA 1FRJA 5DG9A 2HZVA 2ALYB 3C15A 4N7TA 3GIRA 2H48B 5LMUJ 2AP6A 3HP6A 4NZ0A 3ZNUA 2NXNA 1U47A 4DV4J 3HVTB 3TA2A 2IVYA 2MYFA 2QYCA 4LF7J 4B3TJ 1B99A 3GIMA 4HACA 1RJJA 4P2SA 4CI0B 4RJVA 5DRKA 1Q95G 2PA8D 4DV5F 1LW0B 4Y6IA 4OI4A 3CCLS 3V6DB 1KTVA 2KU7A 1X4BA 1K44A 4DL3A 3ILOA 5C25A 1DTQB 4L6V3 4OYAA 5K8PA 4A8MP 1X8DA 4JI5F 4NMXA 2UXDF 1ROFA 4NPOA 3DI6A 3HPOA 2YH0A 4OZNA 1CJUA 4UQTA 4N76A 1KOOA 3N5BA 4ZITA 1IN0A 4K0KJ 1K8AT 1IM4A 2I5JB 4X4RA 1SUQA 3OUYA 1NH8A 2N7CA 1X4FA 1UP1A 3T6BA 4KGKA 3FJ2A 2BMBA 3THPA 5LOQA 3MGJA 1QSSA 5EGYA 4KFBB 3NGTA 1HPZA 3SQOP 1K1SA 1D8YA 4DPOA 4I2QA 4ES1A 1OQ6A 1OYDA 4CLSA 3TAMA 4IR9A 1S9GB 4ED5A 4C3LA 1Y10A 3VQSA 4L3KA 3MM5A 1HNXJ 5H9FJ 3HHNB 4ZDNA 4ERDA 2L48A 4ZP6A 3CJ2A 4ECWA 2R8KA 2VFRA 5K14B 1J2VA 3GV5B 2CDRB 3R9LA 5F8IA 2R8HA 3CT9A 4X4OA 1L5UA 2E66A 4EZ9A 2Z2MA 4ZVRB 2H9ZA 1RACB 3C15B 2V9WA 3UW1A 4RPFA 3EXYA 2HHHF 2V2ZA 2E9ZA 1D8ZA 4M95A 2B9EA 2WSCC 2OSQA 1RZMA 1K0VA 2O5DA 2IM1A 1GAOA 2DR7A 3ICLA 4JYAJ 2JL9A 2XEXA 4HACB 4UY85 1S9EB 2Q6CA 4ED6A 5HQMA 4OX6A 1M5KC 2LQ9A 2AEMA 1Q5YA 2Y8WA 2QMUB 5EN1A 1OPZA 1UCNA 4MT1A 4C6AA 3NXZA 5LJ3Y 5C25B 4YP3A 3J7YI 3R6GB 5L9NA 1F9EB 1QTNB 3D1OA 3HZGA 3LGMA 2DB1A 1SL2A 2EC2A 3D6FB 2XMTA 2MQNA 2XG8A 3DI6B 2P9GA 4C0BA 4OV1A 1TL3A 4J9SA 1CJUB 1HBOA 3MF5A 1YJ7A 2EKYA 4FVMA 1SUQB 3OUYB 2E5LF 4TXSA 3TQ1A 2HHTA 1QUPA 1VDHA 2UV8G 2KKHA 3U27A 3CCVS 3IXQA 4USKA 3NCQA 1RI7A 3GFXA 4J91A 4I2QB 2V4JA 4P2MA 4PYAA 1JJHA 3TAMB 2KJWA 2W01A 3M6UA 4LFCF 3BREA 2QA2A 3MM5B 1SV5A 5F8GA 4FYWB 4WCEQ 4WTYA 2VJVA 3K5LA 5J2QA 4F67A 3AOCA 1UVKA 1VK3A 3AQOA 1B3TA 1UAWA 5B0EA 4EO8A 3GJQB 4K4YA 1WHVA 3HJFA 2E1MC 1SH3A 1BWVA 4WP3A 1JLBA 3W2VB 1SI9A 1UEKA 4OFZA 4J9PA 4QU7A 2XO7A 2DCUB 1C1BB 3IMQJ 3M2UA 3G6VA 3E3XA 4KHPJ 1UETA 2UUBJ 2CNLB 1NK7A 4OYPA 1REVA 2DNGA 2FIUA 1S0MA 3MMBA 3RBXA 3FZBA 2AD9A 3KK2A 2OUGA 1GT8A 1CG2A 3GV7B 5DG8A 2H4WB 2P6TA 2XBPA 5DM7Q 1DRZA 4MK9A 4TY8A 1ICEB 3SFUA 3PJWA 1TL3B 2HW3A 3FC9A 2LA6A 1M5HA 3R27A 2ZKTA 4FF3A 4F0KA 2W9CA 1XERA 2QJ3A 1FNMA 3IP0A 1KRPA 1IR0A 1V9OA 3LO3A 3MTKA 4ZCMA 3DLHA 2YNGA 4F3MA 1Q81T 4DFMA 1RXOB 1Y7PA 2BUNA 2FLPA 3TZZA 1H7WA 2WVCA 5DG7A 3D0HE 2FJEB 4RW6A 3T1YF 3OFHA 2FC9A 3MCMA 2V4JB 4QW9A 5A8WA 4OHXA 1NK8A 1UZDA 3G86A 4EGLA 3BGUA 3RB0A 1SV5B 2N7YA 2GVZA 2OP5A 1Y9OA 3M4XA 3C3LA 3N0VA 2OFHX 2F40A 2CG8A 3OTOF 3KG1A 5J2QB 5CH7B 4EYHB 7AT1B 2R7XA 1GMVA 3X1LB 3IN5A 3CC4S 1CQNA 2V8PA 4B3RJ 2F7VA 2AJ2A 3K5PA 3OJSA 5T41A 4XO0A 4OX8A 4Z7YA 2ERRA 1LWEB 5DM6Q 1N8RT 2NZCA 2XMKA 1JLBB 3PJ9A 2GIQA 2UXBJ 4ZP7A 2CPHA 1ZM4A 3TZYA 4J7CA 4P71A 3GSDA 3BQ1A 1ZH5A 4K59A 1ZAVA 1E6VA 1EB0A 1Y0HA 2RILA 5KAKA 3LPEA 3NAHA 2WVBA 1REVB 1DAXA 1QAYA 3MMBB 3UN5A 3GG0A 3AAWB 3L7OA 2LCWA 5GAHU 3KK2B 3D68A 2EKNA 2VA3A 4F2SA 3GPAA 3SCJE 3VZIA 5IFMA 2M5YA 1RT5B 4O3NA 5CZVA 2XGPA 5DDRC 2ZHBA 2HBQB 4LF8J 4TY8B 1Q0NA 3QT7A 3MFIA 4QPXA 3BSAA 3QSYB 2W2QP 2ZM6F 4O44A 1FE4A 2I0XA 3R5JB 2NYHA 5B0CA 1U09A 4KGVB 1K47A 2VA2A 2LVWA 2WVEA 1OMSA 4N8OA 5B0AA 1YVFA 2YNGB 4RU2A 3RAMA 1R7IA 3CIMA 3ENAA 2MY8A 4MYTA 2QFJA 4LT6A 3D6HB 4ETXA 2E1CA 4RW6B 4WYLA 1YKWA 3JQKA 2VC1A 4JI7J 4OI0A 3UVJA 4X64F 2R8JA 5A8WB 3UI3A 1F60B 1ZM3A 2PSZA 3H5YA 1RKIA 2O66A 1GQEA 2A0FB 4FVCA 1UFLA 4QBUA 2DTJA 2GVZB 2BZ2A 1OYEA 3TNVA 4ZJLA 3E01A 2CQIA 4DV7F 3JAMY 3M6VA 2E5GA 3ZXWA 1RDRA 2OJ3A 2HFOA 1YDLA 1HNWF 1VFJA 2VQEJ 4NRTA 3BO3A 4JI4J 3NP5A 5J2PA 4OZ0A 3R1LA 5F8JA 3IAM9 1WDDA 3AD9C 1SIWB 2AJ1A 3ZTQA 2ZH2A 1FK9A 4FS2A 3GMGA 1FDNA 5GMDA 3R7BB 4AL6A 2XCAA 4NX9A 2QIFA 5KG1A 5IV4A 4FPIA 1E6VB 3S8SA 2VHGA 2LU1A 4B9SA 4LF4F 4F4AA 2UUCJ 3DXBA 5F8NA 1L3KA 2O01C 5CA5A 2F9JA 3BO2A 2IMWP 1J5EJ 4KPCA 2VBWA 2B4OA 2XYHB 1U6FA 1T05A 3O44A 1FJGJ 1FKOB 2HHUA 4RUCA 2GHWA 4IUFA 3MUVP 1ZPVA 1FRKA 4ZLPA 1W25A 4PKDB 5LMUF 4NCBA 1WKJA 4JUZA 1R6YA 2AZ1A 1PG5B 2ROEA 2OIHA 2HVHA 2H3EB 1X4CA 3Q86A 2YNIA 3L9ZA 2IRXA 3KJFB 3CCSS 2DXEA 4PG7A 1LV5A 4DV4F 3BSCA 4DSIA 4K4XA 2L9DA 4MJKA 2VOOA 3KNGA 4LF6J 5JXSA 4B3TF 4L73A 3O1LA 4B08A 2LA4A 1FRXA 1NSQA 4M5GA 3LH2S 3M30B 2UZAA 3ISNC 5IV3A 2P8IA 1FEHA 2WBRA 2RRAA 2EFQA 4CT8A 1N34J 3CDBA 3KTQA 5J1EB 3J81j 2DNMA 3DLGB 1U1KA 3UVJB 1YJNS 1PYTA 8ATCB 4IKAA 4TYBA 4I6AA 1B70B 1FTCA 4B3MJ 3L95X 3M8PA 2JLFA 3BO4A 3EPGA 4EO6A 4F4WA 2FB0A 4LREA 3LGNA 2C2ZB 4FXWA 4K0KF 2DR8A 4IR1A 4AFFA 1UVJA 3E01B 3TW0A 1HIYA 3PW0A 4YMEA 1IBKJ 1H2TZ 3CCES 5EWEA 5KFZA 4BS2A 2ASLA 3IM9A 4LF9J 3BZQA 1R89A 2GO9A 3K5NA 4PCQA 2DGOA 1NPRA 4BBYA 4EBDA 5J2PB 1VQ7S 1SKSA 1FK9B 2IM3A 4URSA 3KXDA 4W90B 2OLWA 4X62J 4Y2KA 1U8WA 2ZOGA 1VQ5S 3PHTA 4YB6A 1F0XA 3KYLA 3GILA 1CLFA 5J2MA 2XTJP 1JLQA 1HNXF 1GX5A 1FDAA 4ZCKA 1SL1A 2IY5B 4KQZA 4WFNQ 3CJTA 1AFIA 1FDBA 2HFUA 1T05B 5HL7Q 1U48A 2ALZA 2HVEA 4ZVOB 5LMNJ 2BA9A 4P75A 3ZZPA 1SQEA 3D28A 4KAIA 5AE3A 1XTZA 2YNIB 2HLUA 3FSYA 4WFXA 2OPPB 4ZMMA 2DO4A 2DRAA 4JYAF 4NLSA 3QRRA 3RW6A 4IH7A 1S4EA 3A8IA 2ZE2B 1RTIA 2GV1A 1MMNA 3VAIA 3DLKA 4QZVB 2C2EA 4ZP8A 3DOKA 4O3RA 2DPIA 3EPIA 3OHBA 2GIRA 2XWXA 3DDNA 1NLKL 3VF0B 5FD1A 2DGQA 3LA0A 1N56A 2F4FA 2OAUA 2IDLA 3DRXA 3LP0A 4ED7A 4WIIA 4HTJA 3C14A 4ZPAA 3M8PB 3P6YC 5F8MA 3MM8A 3HSZA 2J0QD 1XBWA 5KG0A 3OL8A 3VVUA 2G0CA 4EK2A 3JSRA 4PPDA 1UVMA 4DUYJ 2KHCA 4KYZA 2YVSA 4L75A 1UWAA 3DN9A 3H2UB 1D09B 3J81U 1C0UB 1N5TA 3UFCX 2YKMA 1L3TA 4MH8A 4CLZA 4DQRA 5J1NA 2CWXA 2KXFA 4RW9A 4ZJQA 3PW2A 1NZ8A 4AL7A 1NDKA 3TP2A 5K5MA 1NSAA 2X7IA 4C8KA 1JLQB 3VGSA 1U1MA 3P49B 3OR1A 4U67Q 4DF8A 1H3DA 3FZ2A 5HO4A 2ZUGA 4P72A 4OI3A 4RX6A 3VWSA 3W9JA 3G2XA 5ETSA 1XWLA 3Q23A 1FA0A 4ID8A 5L1IA 3F0NA 2LFVA 1RGVA 1N52B 3QBCA 3H5SA 3BBFA 4FYVB 1S6QA 3PW7A 3QRPA 4G65A 3JYTA 1QDUB 1FEEA 5DZ6A 1YWXA 5ETNA 2BJ1A 4ZVGA 5GADU 4KHPF 1WORA 1X5TA 2UUBF 4FDFA 1S6PA 3DOMA 1RTIB 3DLKB 5I42A 1TQLA 3DOKB 4C8YA 4OZLA 4F0HA 3A1YG 5E5NA 4OL8A 1U49A 3DOLA 2FD2A 2FVPA 2GQ2A 2CWKA 4PXEA 4KE5A 1YRTA 3SSQA 2NXJA 3LP0B 3C14B 3DM2A 4CM2A 3MM8B 1YJTA 3H42A 3W62A 4DV2J 3VCDA 3L7PA 4ED2A 3MCNA 2FLLA 3HKZD 2NQPA 2ZH4A 2DGSA 1RT1A 2PMWA 3QGIA 2C1EB 1T9YA 1N32J 3QLHA 1C4CA 3Q2TC 3PV8A 4QIWD 2YKMB 4F4XA 4K4WA 5B08A 2QYGA 3GONA 1WNEA 1DHMA 2W4DA 4Q2MA 2AX0A 4RW9B 2NYIA 3VGTA 2CQHA 3FDSA 1T94A 3KWMA 4OHZA 2R8GA 5F0UA 3GJTB 2CG4A 1ITPA 2XY7A 2J5AA 3QGHA 2RQCA 3RAQA 3OR1B 3SFGA 1YGYA 1JIHA 2EFNA 2KG1A 2FHJA 2KJVA 1KNZA 2VIHA 2N82B 4B3RF 1RE1B 2LQ8A 5D0EA 1SC3B 1IKYA 3J7Z5 1S6QB 3LW5C 1Q16B 4U7UD 2FHKA 3P4UB 2MHNA 4F7VA 2YPZA 3JYTB 3W61A 5IS2A 1VQ9S 1D9DA 5GAHI 2ILZA 1V3ZA 4E8UA 4Y34A 1S6PB 2FJXA 1YIJS 3R2CJ 2DEJA 5KFBA 4GKJJ 2ROGA 2UP1A 3DOMB 4TVAB 5I42B 1WKKA 1VR6A 3RYLA 2VUGA 3QATA 1I6JA 1NU4A 5KT6A 1O5JA 2QO3A 3DOLB 2EG1A 2V67A 2DNOA 4IFVA 1WF2A 2D3UA 2A10A 4LF8F 3DM2B 2DD8S 4IOAQ 1SXLA 1X5PA 1WSRA 4A8SA 2HGMA 5L39A 1DLOB 4LSLA 4ZVEA 2B9XA 1SJ1A 1X9SA 3MEEA 4WE1A 3UNYA 2R7UA 4Y3CA 3K57A 2XZTB 5HJYA 2HQDA 2RJZA 4OYWA 3CCQS 3QLHB 1S12A 1GX6A 3UWTA 3G96A 3HVWA 2PEBA 1JXLA 4JI7F 3FKBA 4C8LA 2C42A 4YOEA 2YX7A 2WB4A 1RA7A 2NR0A 2AJQA 4KKOA 2H65B 3UDLA 3F73A 1RAAB 4A8FA 1I1GA 4ZJOA 4NYPA 3CDAA 4CO3A 1JJ4A 4OI6A 1QAXA 1F3VA 1Q8IA 5C7PA 2UXCJ 3DHWC 3CF5Q 3EXCX 4C97A 4F02A 2MQMA 2OPRA 1VIOA 2F8MA 2HIQA 5HP1A 4OYXA 3I87A 4PXBA 4WU3A 3MPVA 4O0NA 3A8KA 3P96A 4UOHA 1NPKA 2VQEF 4O0IA 3CIZA 4JI4F 3VAKA 4JI8J 2QN6B 5AXLA 1IKYB 4LRCA 4ENOA 2HQ3A 1QVGR 2ZDOA 4N47A 4X4UA 3U7JA 1ZOTA 3L4BC 3UO0A 1NDPA 1TAUA 3O3LA 5ETMA 3PFOA 1VGYA 2E7VA 3NAIA 1LOUA 5C42A 2UUCF 1EX8A 2Z4PA 1T03A 3QJLA 1B0VA 1J5EF 4IYQA 1TAQA 1J5OB 1CJVA 1R31A 5D0GA 2DGVA 1UVNA 1FJGF 2VPYB 1PIEA 3PRVA 4ECVA 4KJIA 1WC3A 5EX0A 1S4FA 4IFVB 2X51A 4E98A 2ZFHA 4PZVA 4U9RA 4RUAA 1YQHA 1YJUA 4HYKA 2DIVA 4LSLB 3WBZA 3KLHA 3ISZA 2ZH8A 1UVLA 2JH3A 3TAPA 3MEEB 2Y1RI 4LF6F 5HVHA 2AHOB 3KHRA 2FHJD 4G1QA 2GIFA 1U1NA 3CO9A 2HAIA 4F04B 3NBPA 2ZZMA 3HHLC 1N34F 1HI8A 3OQ2A 3LP1A 1NHVA 1U0HA 5DZ7A 3NNHA 3UR3C 1S99A 4CP5A 1N36J 4WYWA 4KKOB 4WKYA 2E29A 1WEZA 4B3MF 1FXRA 1VBXA 3IG1A 1S49A 4M1KA 1KVJA 5MAOA 4AE5A 3GV8B 1NZAA 2HEKA 7FDRA 1OWXA 1HLWA 2OPRB 3AA9A 2BOPA 1KVKA 1IBKF 1U1LA 5ETPA 5HP1B 3RB4A 1F5AA 2HWHA 3TA1A 4LF9F 3PX0A 2LEPA 2XI2A 4C8NA 4KPYA 1NK6A 2OHDA 1JX4A 1AFJA 3NWGA 3A13A 2C3PA 1KQSR 1DJ0A 4UW2A 2MQLA 1WWHA 1SKWA 1UPMB 5IXUA 2L9NA 3FBBA 1SC1B 4B3OB 2IJNA 3S1TA 5F8HA 1LFWA 1WTBA 2MKKA 4FN5A 5C42B 2Z56B 2BJDA 1JXEA 1APSA 1T03B 5HQLA 5EUHA 2GFFA 3F41A 4OV6A 3R7SB 2RNEA 1HA1A 4KV8A 1S77D 1CJVB 4V19X 3ITHB 2DJWA 2W7AA 2APOA 1U2RA 2AGOA 4BWJA 5D8HB 4QWBA 4Y00A 3FBEA 2XMVA 2YWFA 3BGRB 4CLUA 2AYEA 4OHVA 3QT8A 1TUWA 1U6BA 3N9UC 3MD1A 3KLHB 3CCRS 2GC8A 5HVGA 3BN7A 1SJ3P 1SCJB 2B8QA 1WHYA 2PA3A 4G1QB 3UNGC 5F9NA 4DS5A 3OVAA 2QSFA 3KMQA 4BHQA 4C2MA 3NBPB 4P52A 2DR5A 1PYOB 2E44A 3LP1B 1U0HB 3A3OB 1XC9A 3HX9A 4G1PA 1FX2A 2B3TB 4BDPA 3ADAC 3ZZUA 2X1AA 3FVYA 5J2NA 2K3KA 4MK7A 4C11A 3CDEA 2Q6BA 1UA0A 4CNZA 2ZC3A 3IG1B 3GG1A 2GJIA 1F5CA 1GMWD 2WK4A 3H40A 2CRLA 4RLEA 1RWKB 1HWLA 2O67A 4M5IA 3M32A 3I9V9 5L8RC 4DUYF 3HULA 3AJDA 2NUHA 2PC6A 4WXWA 2M8DB 2EBGA 4ZVUB 3JSMA 1WELA 4OLPA 3JSBA 2KFNA 1T3OA 1N0VC 1NJWA 1ZYQA 3WZ0A 4ZPCA 3W65A 3K7RA 1S0VA 4JI1J 4WFBQ 2KVQE 3MMCA 4DSFA 3CB4A 1CSJA 4C48A 3KHHA 4G3IA 4KGXB 1LQ9A 3OVSA 1GXTA 3DRRB 1PGZA 5KFYA 1U24A 3I32A 4ZIVA 2BOAA 4KV8B 1N4LA 4OX9J 1X9WA 2KHDA 3KDOA 2MKJA 2WOMB 1TVRA 1NDCA 5GADI 4OZ5A 3T5LA 2YQ0A 2F4VJ 1JWWA 1FKPA 4URQU 2W7PA 3M8WA 4DSLA 4NLXA 4ZVTB 2PIIA 1HL6A 4WP9A 4MFBB 3KDNA 3MMJA 1YZ7A 2GMJA 1RQ0A 4AXJA 3MUMP 3BSOA 2LQBA 3SCKE 4K4SA 3EYZA 2NXCA 1K9MT 1U4BA 2HHVA 2Z58B 1BGXT 3DNCA 1YRUA 5I4MA 5KFQA 2WONB 2XWYA 1XR7A 2WW8A 4DV2F 3CD5A 3U02A 1LXJA 3KLFA 1X60A 3HD1A 5KG5A 2POKA 1GH8A 3M32B 2LXIA 3CO0P 4ANEA 3QT5A 2VJUA 3TARA 4YR3A 4L76A 4B9TA 4IOBA 1S1XB 1T02A 5ADZA 2N3LA 5KG7A 1M5VC 2CQ4A 3AFGA 2V94A 2YWEA 4ECXA 5DQIA 4M5MA 2QA4S 2EVZA 3GIIA 4ZP9A 2MKCA 2CNOB 2ATLA 3MMCB 1Q4RA 2MKSA 1YBUA 3TAQA 5KT4A 2IC3A 1HBMA 2LU2A 4CLYA 2M9KA 1S76D 4UQGA 1Q1KA 1KHWA 2GA7A 2HS0A 4WJBA 1TVRB 4HVZA 2J9DA 1U25A 3QGGA 3MEGA 5SUHA 4P7TA 1FKPB 3MM9A 3KK3A 1U6ZA 1RHQB 1VK8A 1IKWA 2ZBCA 1RHJB 1SB6A 3FCVA 3EICA 1BC6A 3GQCA 1YITS 3R5AA 1LW2A 3GYGA 7FD1A 2ZBPA 1J27A 3SEOA 2DXFA 3W63A 3EVWA 4KR0B 1DQAA 3CSKA 4GKJF 2QRRA 3IWXA 1DZ5A 1F2HA 1BQXA 2DK2A 2WCXA 2HVDA 4Q8FA 1WHXA 1WC0A 3K89A 4ZCIA 1LWXA 4GVBA 3GR1A 3H20A 3H5XA 3Q83A 3N6LA 2HIYA 1RLCL 5BYSA 1YJWS 2EPIA 2VU5A 2HBYB 3RAXA 3PDNA 2C28A 4H4KC 1VC0A 3KLFB 1S6OA 2XB2D 3GB0A 3VQTA 2V63A 1ZZNA 1NHKL 3G71S 2PMHA 2J0XA 3GFHA 3CUNA 3UDVA 3LUYA 4RU9A 3EZOA 3OXGA 4PXCA 2CQCA 5KFGA 2LECA 1T3NA 5K8OA 3KOAA 2XMWA 3CXCR 4LBHA 1O6XA 3JTNA 4CLWA 1TL5A 4F4KA 3MR7A 5THWA 3NGSA 1LXNA 2Z30B 2AYMA 4IG3A 3J81Y 1MMLA 3OBIA 2UXCF 1VMBA 4WP8A 2IC3B 1HBMB 2DNQA 2OPQA 2KI2A 1L3UA 4I64A 1KLNA 1NJZA 4Q8EA 5KFNA 8AT1B 2HHPA 2RKIA 2SXLA 3PZPA 4QW8A 1LWFA 4JI8F 2KT5A 2M0GB 1KHVA 1QTMA 3NGKA 3MEGB 3MAAB 3T5KA 2JSXA 2YKOA 3MM9B 3KK3B 1N5YA 2MB0B 3BKFA 1KWMA 4ED4A 4OJ1A 1HQUA 1FNOA 1MWQA 1PBUA 4LF5J 1SJRA 5L1JA 2CAJA 4OJGA 2YBVA 2DVIA 4LJMA 2Y9HA 1LW2B 2MMYA 1RAIB 3N6NA 2CQGA 1NJYA 1OSCA 3MR6A 4KHRA 5KFJA 3HFZB 4ZHRA 1WC1A 3MECA 2FZKB 4O3PA 4OI1A 3QNWB 2J6SA 3BQ0A 1RT7A 2Z8QA 1UFKA 4GVBB 1CC7A 4DSJA 2W9AA 4M5HA 1H7XA 3QZ8A 2HS4A 1N6QA 1VBZA 2V9KA 3EGWB 3PYFA 1R0BG 1ZPWX 5M2UA 2V8VA 3PIOQ 1TK5A 2XM3A 1T7PA 3M6WA 5E2QA 5A8RA 2Y1JA 5KFHA 2DY1A 3BKUA 4FYDA 4C98A 2DY9A 5KFWA 2X1GA 1R8PA 1RISA 1NK9A 4LFAJ 1HW9A 3UDCA 1UJ4A 4LMZA 1GXLA 2EBEA 3LOUA 4DR3J 3L3CA 1LKZA 1TZ0A 3G4SS 3MD3A 2NPFA 4CYUA 5HMZA 2JLGA 2QL5B 2R7VA 4IG3B 2V2QA 4ALZA 4DBQA 2CNNB 5DLGA 1T9WA 3D54A 6FDRA 4M5LA 3BGFA 3DLJA 2FQQB 2VQFJ 2OPQB 2YQ3A 2JLEA 1X9MA 2JEFA 3FMBA 3TUJC 1U2CA 4EMDA 1KQFB 3SSSA 4JI3J 3A3PB 3RUBL 2RKIB 2IMOA 1H74A 4Q45A 1LWFB 4K2XA 3BEGB 5KG6A 1N5YB 2J6TA 2AX1A 3AY0A 3CJ5A 4RNMA 4DR4F 1HQUB 2HNYA 2DITA 1TR0A 3OR2A 1FRLA 4PYDA 3OD2A 1ZBTA 4ZPWR 2M2BA 1N5QA 4ZHRB 3MECB 1X0PA 2H51B 3QO9A 1VQ6S 1SPBP 3T5JA 4J9LA 3JQMA 4ZPVR 1RT7B 2FYXA 1VBKA 4V1Ak 4I4BA 3K2YA 2DT9A 2V8HA 1N6QB 3W2WA 4C9DA 4JB8B 9ATCB 2Q3PA 2CPXA 2IM0A 5A8RB 4CLFA 4JOUA 1XNQJ 2F63A 3VZHA 5KG3A 3ENWA 3I5AA 2IPOB 4B3SF 2HSEB 3GWCA 2MSSA 4AXIA 2DR6A 5KOXA 2RRNA 3M2RA 1EQ0A 2Y1IA 3CDUA 4ER8A 4RL1A 5ETLA 1WOOA 3ULHA 3OFGA 4GO5X 4NLDA 3QAEA 4DPXA 3NGRA 2ZEJA 3BH7B 4KTQA 1NK4A 2OPSB 2LQ5A 2MZSA 4CYUB 1FFGB 3IS9A 1SJQA 4DR6J 3UR0A 4CO0A 4LSNA 1DTTA 2G2YA 3SSRA 4TY9A 1PC4A 2NSCA 4ID5A 4DV3J 3UCZP 4Z37A 1DURA 4OI2A 4R25A 1IUJA 1X7VA 1GNKA 3S7RA 4FNIA 4USUA 2QLWA 5KFLA 4ECQA 2QV6A 5G0RA 1QY7A 1U26A 2I38A 2QG9B 4D3GA 3B78A 2NLWA 1I94J 3HHEA 3OTEA 1IR1A 2DXDA 2KT3A 5M2RA 2HNYB 3V81A 4JI1F 3FBFA 4I7FA 2XY6A 4ZN3A 3OR2B 4DDFA 4LF1A 3AA8A 3GCXP 5ETRA 3H5UA 5DGAA 4I6YA 1NJXA 2B4UA 4ZPDA 2HPUA 1HHTP 3MWBA 2WVFA 1VRTA 3EUNA 2BJEA 2B56A 1PILA 1W26A 3QO9B 2LEAA 3VVTA 4OX9F 1T0TV 3M9OB 4EYIB 2HVIA 5EHHA 3W2WB 2HWTA 1VLYA 3KHLA 1DQ9A 2IRYA 3A4TA 2F4VF 2P9CA 2FVQA 1RHKB 4QWEA 1WKLA 3RTVA 2DNPA 1HI0P 4UOFA 5LSRA 4A47A 2Z0GA 3CD6S 5D0HA 2RHSB 1Q79A 2VICA 2BDPA 4KSEB 3M2RB 1NXIA 2JNJA 2JRSA 4LIRA 2DKOB 4LQ3A 4F8RA 2MY7A 5C24B 4RW7A 3O2IA 4X84A 2CJKA 4PWUA 1PJ7A 2E5HA 4HKQA 4A8OA 3W7BA 4CCHA 1RSCA 2DGUA 1PYSB 4DL5A 4ETZA 1EETA 2A6OA 2CNKB 5AE1A 2MJNA 1DFDA 5BR8J 4LSNB 1XNRF 1DTTB 2RS2A 1SVDA 3I0RB 1YJVA 1M0SA 2EK6A 1AYEA 4ID5B 2KB2A 2E5JA 2Z2ZA 5CAAA 1F5BA 1XR6A 3D2WA 4Q5VA 2UVRA 3ENVA 5G0RB 3J80U 3DU6A 3TJ9A 1N5SA 4NCAA 1ZA1B 2B0GA 1JKHB 1M5OC 1HD0A 3AJ2A 4IO9Q 1VJQA 4DL0C 3PRBA 4F3OA 4DN9A 4XTTA 3V81B 4I7FB 4IFYA 3X3UA 3TANA 2M7SA 5GMEA 1KEKA 4LRFA 2NS1B 2D1CA 3HLUA 1VOMA 1TMMA 3CTRA 4P9SA 1Y3JA 2RUSA 4XDCA 5LM7E 1VRTB 4ATNA 2VKZG 1IKVA 2J76E 1FJCA 1D3WA 4QWAA 2RDIA 2ZBIA 3PEHA 5AXMA 4DN0A 3GZ7A 4ILRA 5JMNA 2IIHA 3CC7S 2MZRA 1YJRA 2FVRA 3OFEA 2B7CB 4WK1A 3IRXA 3W5YA 4HHHA 2HQGA 2R8IA 3DDIA 1X4HA 3QRQA 3D9BA 1LK5A 3TUIC 5H1SV 2KO1A 4YQWA 1FWKA 3U1NA 2G2OA 2GJ2A 1NAQA 2J0WA 3Q8UA 4RW7B 1GTEA 4OYZA 2CUYA 4IH5A 3FQLA 2CQBA 4U8YA 1BHNA 3NS5A 1EETB 1KOHA 1T9TA 4ES2A 2WTFA 1G4CA 3FCHA 3CCUS 3VHQA 5HK4A 3VGVA 4RW8A 3BR8A 2OO4A 1KLMA 1LNQA 2A1BA 1VYAA 4J9NA 4UOCA 2YNFA 2QA4G 3QGPA 2R3VA 5F41A 3T41A 4EEYA 2R2RA 2QGFB 3IR5B 2L3MA 1V5IB 2ABYA 4A8QA 5B09A 3FQKA 3AQPA 2GX8A 5CCMA 3LWLA 3DRPA 3K8VA 4EBEA 4Y2CA 3VV2B 1URRA 3EJMA 2C2MB 2MZ1A 2JHEA 1HBNA 4IFYB 4DR2J 3K59A 3IAS9 4F36A 3BDEA 4DQQA 4KH0B 1HPZB 1RWUA 1CBKA 1WG4A 4K2JA 2VB6A 3FSIA 3ILLA 1A9NB 4L3NA 1ZA2B 5C2GA 5HLFA 1D0EA 3M9MB 3CMAS 2V2KA 1L3SA 1R8HA 4RNNA 3OW2R 2AW0A 4K5SA 2CQDA 2MKIA 3M05A 4G6VB 3IRXB 4WZQA 1HHSA 1HARA 4LF5F 5HMYA 1GEHA 4TYAA 3AB2B 5LSLA 1UJ6A 2CDQA 3DKDA 4FXDA 3OTBA 3C66A 1KONA 5KOWA 3OXLA 4GRSA 2HS3A 2PN6A 2DR9A 2VBYA 3U1LA 1BUXA 4ZLJA 5KT5A 4AL5A 1HD1A 3KKFA 2DGXA 3ENQA 4NCGA 4NXMJ 4DL7A 2HQCA 1RHMB 4RW8B 4X4VA 1KLMB 4ECSA 4QIEA 3UCUP 1HWJA 3LF0A 2YNFB 1K1QA 2XS7A 4ZIWA 4LFAF 4NXNJ 3CMES 2B8PA 4PABA 2L41A 4J9QA 4NLPA 1HBOB 3IFEA 3FBCA 4DR3F 5A2QU 4OYMA 3CCWA 3BN4A 1SC6A 4OZ2A 4RO0A 3OPKA 4Y28C 3DRPB 3DLEA 4J9OA 4C7QA 2AQ4A 2A2CA 1Y5LB 4HR2A 1HBNB 3P3DA 4ILLA 3SIPB 5KT2A 5LSOA 4TKTA 1EP4A 1JJCB 1SQFA 3QIDA 2V68A 1JLAA 2DH7A 2BQRA 4N5SA 2JWNA 2XHWA 2VQFF 4Q44A 1MMDA 1QAIA 3FGVA 4ZA1A 4F0MA 1QM9A 3NMAA 3OTDA 3OV7A 2MKYA 3HVAA 4I56A 4JI3F 2KL8A 3MM6A 1G6BA 3QWPA 3KUHA 4LVOP 2MQQA 2MQPA 3P8BB 1P27B 5KFOA 1R8BA 2LQJA 3I5CA 4DR5J 3AH6A 1KTQA 3PACA 3D6TB 3EGVA 1HNVA 1I5OB 1YJ9S 1EJ7L 1WHWA 5LXYA 4ZLLA 1S6UA 2WBMA 3GTYX 3OJUA 2B5JA 1QVFR 1UKUA 3AT1B 3OHAA 4FNHA 4B17A 2MQ8A 2DHSA 5KFSA 4KHMA 5B0DA 4M63A
chains in the Genus database with same CATH topology
3NGTA 3MPDA 4ANDA 1B4SA 3ZTPA 2DY9A 3NGRA 1HLWA 3BH7B 3BBCA 3BBFA 1NSKL 3VVUA 4HR2A 1UCNA 1S59A 3Q8YA 3FC9A 3PRVA 4C6AA 2HURA 1B99A 3DKDA 3VVTA 2VU5A 3ENAA 2B8QA 1WKKA 4EK2A 3L7UA 3GP9A 3ZTRA 4S0MA 4F4AA 2HVEA 1NSPA 5C7PA 5CAAA 3BBBA 4DI6A 3FCWA 3PJ9A 5BXIA 3DDIA 2AZ3A 1BUXA 3ELHA 3Q89A 3EJMA 3VGTA 4FKYA 4KPCA 1K44A 3EMTA 2BX6A 1NHKL 4O0NA 1BE4A 4F36A 1HIYA 3Q8UA 3R9LA 1LEOA 3FBBA 1XIQA 1MN7A 1WKLA 4UOHA 5CABA 1NPKA 1HHQA 4UOFA 1PAEX 1WKJA 2DYAA 3ETMA 2AZ1A 3EVMA 3Q86A 4ENOA 1BHNA 1PKUA 2CWKA 3FCVA 3VGUA 4ANEA 1NDKA 3EICA 1NDCA 1ZS6A 2DXEA 1S57A 4DZ6A 1MN9A 3Q8VA 3GPAA 1NDPA 3ZTOA 2ZUAA 2DXFA 3B6BA 4ANCA 3EVOA 3VGSA 3EVWA 4DUTA 2BEFA 3NGSA 1F3FA 1NLKL 4CP5A 1F6TA 3ZTSA 2HVDA 5IOLA 3VGVA 2B8PA 1U8WA 2DXDA 1NCLA 1NSQA 3EM1A 3FBFA 1NUEA 1NB2A 3WX8A 3FBEA 1W7WA 4FKXA 3NGUA 3FBCA 3B54A 1NDLA 1JXVA 1LWXA 3G2XA 3JS9A 1VYAA 1S5ZA 3FKBA 1XQIA 3Q83A 4UOGA 2NCKL 4W98A 4WBFA 3EE3A 1KDNA 1EHWA 3ZTQA 3BH6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGT A;  3MPD A;  4AND A;  1B4S A;  3ZTP A;  2DY9 A;  3NGR A;  1HLW A;  3BH7 B;  3BBC A;  3BBF A;  1NSK L;  3VVU A;  4HR2 A;  1UCN A;  1S59 A;  3Q8Y A;  3FC9 A;  3PRV A;  4C6A A;  2HUR A;  1B99 A;  3DKD A;  3VVT A;  2VU5 A;  3ENA A;  2B8Q A;  1WKK A;  4EK2 A;  3L7U A;  3GP9 A;  3ZTR A;  4S0M A;  4F4A A;  2HVE A;  1NSP A;  5C7P A;  5CAA A;  3BBB A;  4DI6 A;  3FCW A;  3PJ9 A;  5BXI A;  3DDI A;  2AZ3 A;  1BUX A;  3ELH A;  3Q89 A;  3EJM A;  3VGT A;  4FKY A;  4KPC A;  1K44 A;  3EMT A;  2BX6 A;  1NHK L;  4O0N A;  1BE4 A;  4F36 A;  1HIY A;  3Q8U A;  3R9L A;  1LEO A;  3FBB A;  1XIQ A;  1MN7 A;  1WKL A;  4UOH A;  5CAB A;  1NPK A;  1HHQ A;  4UOF A;  1PAE X;  1WKJ A;  2DYA A;  3ETM A;  2AZ1 A;  3EVM A;  3Q86 A;  4ENO A;  1BHN A;  1PKU A;  2CWK A;  3FCV A;  3VGU A;  4ANE A;  1NDK A;  3EIC A;  1NDC A;  1ZS6 A;  2DXE A;  1S57 A;  4DZ6 A;  1MN9 A;  3Q8V A;  3GPA A;  1NDP A;  3ZTO A;  2ZUA A;  2DXF A;  3B6B A;  4ANC A;  3EVO A;  3VGS A;  3EVW A;  4DUT A;  2BEF A;  3NGS A;  1F3F A;  1NLK L;  4CP5 A;  1F6T A;  3ZTS A;  2HVD A;  5IOL A;  3VGV A;  2B8P A;  1U8W A;  2DXD A;  1NCL A;  1NSQ A;  3EM1 A;  3FBF A;  1NUE A;  1NB2 A;  3WX8 A;  3FBE A;  1W7W A;  4FKX A;  3NGU A;  3FBC A;  3B54 A;  1NDL A;  1JXV A;  1LWX A;  3G2X A;  3JS9 A;  1VYA A;  1S5Z A;  3FKB A;  1XQI A;  3Q83 A;  4UOG A;  2NCK L;  4W98 A;  4WBF A;  3EE3 A;  1KDN A;  1EHW A;  3ZTQ A;  3BH6 B; 
#chains in the Genus database with same CATH topology
 4JV2 A;  2EWH A;  5CYQ A;  3KLE A;  3M2U B;  1NPP A;  2CJB A;  3Q8Q B;  3FRY A;  1BLU A;  2EFV A;  2DGW A;  4NCG B;  5BXI A;  3CWJ A;  1KC8 T;  5L9X A;  4GC6 A;  1OO0 B;  5IC4 B;  2FJB B;  5E7O B;  5U47 A;  3W9H A;  1XNQ F;  4FBU A;  2QFI A;  4PG4 A;  4IRD A;  1P1L A;  1ZZF A;  1RYS A;  1IBC B;  1BXN A;  4U7C A;  2EEY A;  1JMT A;  3TOQ A;  2EG2 A;  1HYS A;  1GTH A;  1U7L A;  2UUW A;  3IWL A;  1F2G A;  2ZH1 A;  4LRB A;  2W9C B;  3QSI A;  2KH9 A;  3D1Q A;  3S6E A;  1CEZ A;  3DLE B;  4JV1 A;  4Q0B A;  5D3G A;  1T9X A;  1SKR A;  2C3U A;  1RBA A;  4FF1 A;  4DR6 F;  4ZKA A;  4Q43 A;  4ED8 A;  1URN A;  2XNR A;  1NDL A;  2M8H A;  3MZI A;  3JS9 A;  1QSY A;  3EDQ B;  2DRD A;  2BJ8 A;  3VAL A;  4WBF A;  5EWF A;  3EWG A;  3OLB A;  4EZ6 A;  2YKN A;  4DV3 F;  1JLA B;  4WXO A;  2B6A A;  5D77 A;  1AUS L;  4YDX A;  1NJI T;  4OMF G;  1IBL J;  2AEJ A;  1TL1 A;  1HWI A;  3PKY A;  2AJ0 A;  3GR0 A;  1KFD A;  2FZC B;  3MM6 B;  1Q8K A;  3AD7 C;  1I94 F;  3Q89 A;  2CA9 A;  4YR2 A;  2RQK A;  3LTO A;  4R5P A;  3H4B A;  4RKU C;  2JDJ A;  5KFI A;  3V6J A;  3US5 A;  2UVV A;  1H6K X;  2QMX A;  4JI6 J;  1HNV B;  1W2I A;  5AE2 A;  1FWL A;  2B5J B;  1S57 A;  1VIX A;  3N28 A;  3Q8V A;  2DNZ A;  5CYJ A;  2HNZ A;  3KJQ B;  1F6T A;  5CYQ B;  5C5J A;  3KLE B;  4QOT A;  3QAU A;  1NB2 A;  4NLU A;  3WX8 A;  1VRU A;  3TJA A;  3K58 A;  2IYI A;  3CJ8 A;  2V50 A;  2CKW A;  3I31 A;  5K8N A;  3DMJ A;  4M5N A;  2VOP A;  2RSQ A;  2E5I A;  4CM0 A;  2QL7 B;  4RUB A;  1U1Q A;  3PO5 A;  2ZVI A;  2XGQ A;  1Q53 A;  1CC8 A;  2P5V A;  4DPT A;  4RNH A;  1HYS B;  1RK8 A;  2BE7 D;  3D4J A;  2HRT A;  4O44 B;  1MRO A;  3TZW A;  1A6L A;  1RU1 A;  2KXH A;  1VJW A;  4DX5 A;  3N6M A;  4Q0B B;  5D3G B;  3HHD A;  3M9N B;  3EX7 B;  1KVI A;  3NNA A;  2YKA A;  5L38 A;  2GCF A;  1FFW B;  4EI2 A;  2ZZT A;  3CVK A;  1M5P C;  5BR8 F;  2DNN A;  5CXT A;  4U96 A;  2N4C A;  3GU0 A;  2HHS A;  2VPZ B;  2YKN B;  2QLJ B;  1REG X;  2B6A B;  4DQI A;  1FES A;  1TL1 B;  2IHR 1;  2YX4 A;  3JXO A;  1AXQ A;  4OHW A;  3UD5 A;  2ASD A;  3HI9 A;  3F44 A;  5DDQ C;  2XMM A;  2E9T A;  2GHP A;  4YEA A;  4WZM A;  2W4C A;  2IAJ A;  1RKJ A;  5KFV A;  3UE2 A;  1UA1 A;  4DI6 A;  4DV6 J;  2DHH A;  2RE1 A;  2DNL A;  3QZ7 A;  4KIA A;  3MFH A;  1VHF A;  4YB5 A;  1AW0 A;  2OI2 A;  4DOZ A;  1F1B B;  1MN7 A;  1VHI A;  3NLC A;  2HNZ B;  2J0S D;  2F1F A;  3AOB A;  3TR5 A;  1VRU B;  1RAJ A;  3T5H A;  2W24 A;  1R6V A;  4DPW A;  2GHV C;  3V6D A;  2D7S A;  1Q78 A;  5B0B A;  4OIX A;  1TUG B;  2RDD A;  5ETQ A;  2BM1 A;  1UEV A;  6FD1 A;  2J7U A;  3CE8 A;  3NCP A;  4UOG A;  4ELV A;  3N01 A;  1WOS A;  1VC5 A;  3PY8 A;  2J7K A;  3GIJ A;  3BJY A;  2Q79 A;  3QYY A;  1NME B;  3FSX A;  2PDA A;  1P9Y A;  2Y0S D;  1MRO B;  3L09 A;  2WSF C;  2QE5 A;  2R7O A;  4U7U K;  3WIU A;  3QFH A;  2I5J A;  1GFW B;  4UZC A;  3NG8 A;  3R5C A;  5L46 A;  2P2C B;  5EX3 A;  2JVR A;  2K7K A;  1TKZ A;  4CZC A;  5SZT A;  5KT7 A;  4DR7 J;  1YZ6 A;  1RWM B;  2CJX B;  3FNN A;  5D4L A;  2W2M P;  2VC0 A;  4I0W A;  3IR6 B;  2HKE A;  3O8W A;  2PGC A;  3ZO7 A;  4ELU A;  3R7N B;  3B6B A;  2D69 A;  2M70 A;  1S9G A;  1NK5 A;  2D74 B;  2QTW A;  3GFY A;  4HLB A;  3EM1 A;  2KYZ A;  3PIP Q;  1Q82 T;  2YWK A;  4YN3 B;  4X4P A;  3NGU A;  2HRY A;  2M3D A;  1WI6 A;  1S5Z A;  4JV5 J;  4BC7 A;  2W4P A;  3TYT A;  3PYD A;  1KDN A;  2CQ2 A;  5H9E K;  1KQK A;  3ZTP A;  2VPW B;  4DR2 F;  3AHP A;  3O6Q A;  4K4T A;  3J7A N;  4X2B A;  3PRD A;  3M7V A;  3HF5 A;  1T9V A;  4LUB A;  3JTO A;  5GVQ A;  1S1T A;  1Y4Z B;  3A8E A;  3M1V A;  2IDE A;  4ZVH A;  1TKX A;  5J2M B;  1U45 A;  1CS4 A;  1RYR A;  1S9E A;  2H4Y B;  3LQV A;  1HHQ A;  4I6W A;  1PAE X;  3UN2 A;  4DUZ J;  3H7H B;  2P9E A;  2V69 A;  1UPP A;  4QQB A;  4R8U A;  2ZOM A;  2VON A;  1R8C A;  3FEY B;  3KLV A;  4ILM A;  1HWK A;  2C3M A;  2D3Z A;  4F4Z A;  4JI0 J;  3VAH A;  1ZTT A;  2RF2 A;  3D3C J;  4U95 A;  2W1B A;  3CJR A;  1RAD B;  4J9R A;  1FXL A;  4A8W A;  1N54 B;  4C0H A;  2UUA J;  2E7W A;  2KG0 A;  4C8Z A;  3LAL A;  5FJ4 A;  2G1H A;  1R0C B;  5JVG Q;  2YX1 A;  2Z57 B;  1WAC A;  3I82 A;  2GS8 A;  1D9A A;  4PPZ A;  1IKX A;  4NXM F;  3POT A;  4L74 A;  2BJ3 A;  2GW8 A;  3BKT A;  1TKZ B;  4B9U A;  3OTC A;  2CZ9 A;  4DU8 A;  2VBZ A;  1IM6 A;  3E51 A;  2MZJ A;  3DXS X;  3PYG A;  5ETO A;  4WF9 Q;  2BX6 A;  3RR8 A;  3QMQ A;  1N33 J;  4NOH A;  2ADB A;  3MOJ B;  3DHX A;  4NXN F;  1FJE B;  1KQG B;  2AMC B;  3ETM A;  5HVF A;  2F8H A;  3SXL A;  1R3N A;  4Z7C A;  4TLR A;  2BAC A;  1H38 A;  3GJS B;  3BGO P;  4DHV A;  3J80 Y;  2ATC B;  3NGD A;  3DRY A;  2CVE A;  4C8M A;  4Q7A A;  3WDO A;  2G4B A;  1RAF B;  3W2V A;  2AJ4 A;  5GAG U;  1WC6 A;  3J7A 1;  1S1T B;  3M1V B;  3ZFV A;  3JB9 k;  1TKX B;  2JFK A;  4EFA C;  4FBT A;  1C1B A;  3H59 A;  1RA6 A;  4W4M A;  2KZM A;  5CYM A;  3ETO A;  3PVX A;  2QA1 A;  4USH A;  5C2C A;  1CS4 B;  1Z2Z A;  4WFZ A;  4RUH A;  4F4Y A;  2GVD A;  3FCW A;  2CQ3 A;  3G6E S;  4DR5 F;  4R8U B;  2BBE A;  1ACM B;  1MWY A;  3AXK A;  4DZD A;  5IWA J;  3PEJ A;  2FHO B;  1WJ9 A;  1TMJ A;  2JFD A;  2NSB A;  1RTD A;  1DY3 A;  3OXF A;  3LP2 A;  5CQG A;  4CO4 A;  2A2D A;  1FT8 A;  5KFK A;  2RF2 B;  3DFE A;  5KFA A;  2W2O P;  4AT1 B;  2IJF A;  2VFT A;  4AYB D;  3KUG A;  4NML A;  2DYA A;  4L72 B;  4H54 A;  3FK4 A;  2BR0 A;  3M6X A;  1KFS A;  4USV A;  1E6Y A;  3K5O A;  5CZX A;  1MN9 A;  5IT4 A;  3KG4 A;  4N41 A;  2BJ9 A;  2CPI A;  4QYZ K;  1M1G A;  2KYX A;  1JLG A;  1IKX B;  5B0F A;  5E3R A;  3OFF A;  3POT B;  2CPY A;  4PG5 A;  2OML A;  1X4D A;  3HMJ G;  4NRU A;  4BWM A;  3D7S B;  3W5X A;  3EE3 A;  1PBA A;  5KFX A;  1Y3K A;  1DQ8 A;  2UVW A;  4P73 A;  3RZA A;  2ZH9 A;  4H4O A;  4RBT A;  1RWV B;  5KFF A;  4WIQ A;  1JQG A;  2ZBR A;  2FJD B;  2PMZ D;  4FXV A;  2YH1 A;  1YLX A;  4JV0 A;  2OEL A;  4K7Q A;  1N88 A;  5FII A;  2PI4 A;  1S10 A;  1JLF A;  1RT1 B;  3MUR P;  3CCM S;  2J9D E;  3SQG A;  5DGB A;  3R3T A;  3PM9 A;  2PT0 A;  4DQP A;  4NL5 A;  3WQP A;  5IM0 A;  2MST A;  4IQM A;  2G13 A;  2BRL A;  2CJA A;  1LWE A;  3TZX A;  3W9I A;  5FLX U;  2D41 A;  1IBL F;  2EW9 A;  3VAM A;  2E1R A;  3HHL A;  3MUT P;  2BQ3 A;  1JLC A;  4ECR A;  2ZH7 A;  4P2F A;  3NKY A;  3ZZT A;  3H25 A;  3G6X A;  5CYM B;  3MR5 A;  1IR2 A;  2GVD B;  1K73 T;  4ED3 A;  4B02 A;  1KD1 T;  5BYQ A;  2GJF A;  2DNH A;  3RW7 A;  3KUE A;  4CO1 A;  3Q22 A;  2IVF B;  3CD0 A;  3SZ2 A;  1RTD B;  3LP2 B;  4JI6 F;  1RWN B;  1VQ8 S;  1U2F A;  5G4D A;  4GKK J;  2UU9 J;  1X4E A;  1RAE B;  1RT5 A;  2W2N P;  3PG9 A;  4DMZ A;  5KFC A;  4XIU A;  2QZ8 A;  1E6Y B;  3FFI A;  2NPI A;  1TV6 A;  1NHU A;  3PHE A;  4TQR A;  4CT9 A;  5E33 A;  3PTW A;  2B4P A;  2R4F A;  1JLG B;  2DO0 A;  4DR1 J;  1GMW A;  5JJB A;  5HJX A;  3TQE A;  1TTH B;  1MU2 A;  2R7W A;  2U2F A;  1K0T A;  2VKR A;  4I1T A;  2BE2 A;  2E9R X;  4Q2L A;  3GCW P;  5DS7 A;  2ZWO A;  5E3A A;  1U1P A;  1KBR A;  2OEK A;  4H4O B;  1JJ2 R;  1C2P A;  1B0P A;  3D1H A;  1EKR A;  4OJ3 A;  2IM2 A;  2AT1 B;  1RCX B;  1S1U A;  1U0S A;  4TU8 A;  4AD6 A;  2LMI A;  1FI4 A;  4JP8 A;  4OYO A;  4WE1 B;  1T8E A;  3B4M A;  2W25 A;  3Q8S B;  2VD3 A;  4J9V A;  1JLF B;  1A0O B;  6AT1 B;  2LKZ A;  4PQA A;  3V4M A;  3SQG B;  1HBU A;  1X4A A;  2DNK A;  3MR3 A;  3GLJ A;  1H2U X;  4CIO A;  4TU9 A;  2CAD A;  4NYO A;  5IM0 B;  5A2Q Y;  5DET A;  1WSV A;  4FPR A;  4MTP A;  3G8T A;  2GGP A;  3QT6 A;  2ZBQ A;  2HRU A;  4KY3 A;  5HMX A;  1IJE B;  2VPX B;  3HHL B;  4TNO A;  1HMV A;  1JLC B;  3H4D A;  1BQM A;  3ZZZ A;  2CPZ A;  2G1D A;  4MMO A;  2RU3 A;  2QX0 A;  1WUU A;  3KJN B;  3QIP A;  2LXU A;  3N79 A;  2ZHA A;  3CDW A;  2YXL A;  4LR9 A;  4IH6 A;  4EBC A;  3C19 A;  4KH1 B;  3C6T A;  1NEE A;  4DV6 F;  3IM8 A;  2OD4 A;  1FKO A;  2NCK L;  2FJA B;  5K20 B;  1S7I A;  3FFI B;  5ITH A;  4NLW A;  4LFB J;  5D6G A;  1SBR A;  1TV6 B;  4DR4 J;  2M52 A;  2VAS A;  4J37 A;  4DS4 A;  1MW7 A;  2EFG A;  1VS3 A;  2J8S A;  3DRS A;  1TU0 B;  3LAN A;  2WHO A;  2A6M A;  3FMW A;  1GXU A;  4LIW A;  3M30 A;  1MU2 B;  3HSD A;  1TK8 A;  1R0A A;  3HFV A;  5F0W A;  2CJY B;  1TL4 A;  1HQE A;  3W1Y C;  2BE2 B;  1YI2 S;  2X1F A;  5J1E A;  1NRK A;  2C3O A;  2KDO A;  3EVM A;  3NOC A;  3DLG A;  2MPU A;  1WG5 A;  3U1M A;  2X1B A;  2RD5 C;  3HHL D;  1ZET A;  3R1H A;  1O0P A;  5HAN A;  1HR0 J;  3EVO A;  1VQY A;  1S1U B;  2LDI A;  2R42 A;  1A7G E;  2AEF A;  3MCS A;  4A8Y A;  2RML A;  4B3S J;  3IRW P;  3C46 A;  2JX2 A;  2MXY A;  1P6T A;  3SDE A;  4HEA 9;  4WTO B;  1HBU B;  3Q8P B;  4YB1 P;  1GK8 A;  3THT A;  1U8S A;  3K8W A;  1VQM S;  3T9N A;  3NL0 A;  4U8V A;  4DR7 F;  1CPZ A;  2GMH A;  3GFZ A;  3SCI E;  9RUB A;  3RRH A;  2GGP B;  3F56 A;  3Q24 A;  4QCL A;  3AB4 B;  2ZIT A;  1FHT A;  1UWB A;  2MLZ A;  3H90 A;  3BM7 A;  1HMV B;  2H5I B;  4RW4 A;  1BQM B;  2HQI A;  2ZC4 A;  3ZZY A;  3WX4 A;  3H8Y A;  3QIP B;  1QE1 A;  4CLK A;  2AGQ A;  4LVN P;  4ZPT R;  3I56 S;  1NND A;  5IC6 B;  1RT6 A;  4NZ6 A;  3TX8 A;  2B9Y A;  3IGN A;  2X3D A;  1TK0 A;  2V5H G;  4MAK A;  4C8O A;  4JV5 F;  2ACM A;  3T1H J;  2MLX A;  1FE0 A;  3MAQ A;  2F5G A;  3C6T B;  4P10 A;  1WF0 A;  2CJQ A;  4P74 A;  1F3F A;  5K8M A;  2V8G A;  3MDF A;  1U1R A;  2OEM A;  1NCL A;  3I9Z A;  3I5B A;  3R5D A;  3GYX B;  3BPD A;  4HH1 A;  4FF2 A;  3PYE A;  2FVC A;  1VQS A;  2OPP A;  1BWE A;  5ETK A;  3BS9 A;  2EFP A;  2K8G A;  2ZJP Q;  2KRB A;  3DRS B;  4LF7 F;  2FJV A;  3DDK A;  4AND A;  1JNZ B;  2PEH A;  2BW7 A;  1S59 A;  2ZE2 A;  4DLE A;  4DUZ F;  3IBC B;  3L7U A;  3FEX B;  1R0A B;  2BW2 A;  3GP9 A;  1TKD A;  2GML A;  1VQL S;  2MGZ A;  1HQE B;  1P1T A;  1DAR A;  2C22 A;  2ZJR Q;  2V4Q A;  2NRE A;  2BKN A;  3THV A;  1C1C A;  4JI0 F;  3RRG A;  2G0I A;  1IBM J;  5RUB A;  5BJR A;  4YB7 A;  3K0J A;  1Y5N B;  5HAT A;  3WIV A;  2ZNZ A;  3CED A;  3JQJ A;  4NEY A;  1AT1 B;  4E2F B;  5D0R A;  5DJB A;  3FEZ A;  5HMW A;  5DDP C;  2VG6 A;  5E3Q A;  2UUA F;  5I3U A;  4DU7 A;  1PSD A;  4UTG A;  4BLG A;  4ZN1 A;  3SDE B;  2QSW A;  4ECT A;  4CTA A;  4R0E A;  3ZTS A;  5F3Z A;  3CCJ S;  1FXD A;  2JEJ A;  1C0U A;  1XMQ J;  5KG2 A;  5KFE A;  1RBO B;  5LJ5 Y;  3EGN A;  2DBB A;  2P6S A;  3OL9 A;  5J2N B;  3G6Y A;  1UWB B;  4C11 B;  1B0T A;  1Q5V A;  2XSJ A;  4ES3 A;  1N33 F;  2AYG A;  2ASJ A;  4RW4 B;  2I2Y A;  4UZB A;  1XNR J;  3NWR A;  2E1A A;  1XMO J;  1QE1 B;  3HK2 A;  1RT6 B;  2YNH A;  2VFV A;  3MPW A;  3VAJ A;  2AGP A;  1SJF A;  4BCA A;  1VIS A;  5GAG I;  4H4K A;  3HT3 A;  3JSM B;  2DH8 A;  1F9H A;  1OPI A;  1FDD A;  1NK0 A;  1NKC A;  4HH0 A;  2H5E A;  5HQ8 A;  1OY8 A;  3GJR B;  4WU2 A;  5HI7 A;  2FUG 9;  1FVS A;  1LFP A;  3DLL Q;  3KFW X;  2A18 A;  1WI8 A;  3DU5 A;  4N77 A;  2N4D A;  2BEF A;  3KK1 A;  3Q0A A;  4QPT A;  2Z2L A;  3HD2 A;  2X3G A;  3SV3 A;  2G2Z A;  1Z2L A;  2ZHO A;  1TUV A;  3E8O A;  5IWA F;  2MGZ B;  2OGU A;  1V3S A;  2VDI A;  4WWS A;  1C1C B;  1DBD A;  1IJF B;  4CH7 A;  4DV1 J;  2HUR A;  4X65 J;  1S48 A;  2R2S A;  4DWI A;  4N8N A;  5I3P A;  5BYR A;  3H2L A;  4MIA A;  2VDH A;  3H0P A;  4DL6 A;  2VG6 B;  5L1L A;  1ELO A;  5I3U B;  2DIU A;  4J9M A;  5H9E J;  4A48 A;  2YY3 A;  4O23 A;  2WW4 A;  1UTA A;  2MTL A;  1T9U A;  2RIJ A;  3WC2 A;  3M8R A;  3RBZ A;  4F26 A;  1XIQ A;  3OVB A;  4D3H A;  2F3J A;  4TU7 A;  2XO6 A;  4CTA B;  2CQ1 A;  3A8J A;  3CJK A;  1XEZ A;  4CLP A;  1T95 A;  2ZH6 A;  2JOQ A;  1QAJ A;  4RZR A;  5A0Y A;  3CW2 C;  5IZH A;  2KM8 B;  2YKQ A;  2QT7 A;  2XSJ B;  4I2P A;  1HKA A;  2VF3 A;  3V2U C;  1O51 A;  3JTP A;  2XLI A;  3RB3 A;  2DCL A;  3CC2 S;  1JNR B;  2YNH B;  3TUZ C;  3KJV A;  2AWZ A;  1ULR A;  5A6P A;  2XZD B;  3VR1 A;  4K4V A;  4OYB A;  2HHQ A;  2IA0 A;  2RQ4 A;  4I69 A;  2FGO A;  4CRJ A;  2B4V A;  2K7J A;  4NA3 A;  1ZTW A;  2IBK A;  4RNO A;  2G9O A;  2B7B B;  2D9P A;  2MZQ A;  3BF4 A;  3DLB A;  1S79 A;  3KK1 B;  3AD8 C;  5KG4 A;  3TVK A;  4IRK A;  2XLK A;  1FER A;  2Y1L B;  1P9Q C;  3NNC A;  5B7W A;  3M8Q A;  1X31 C;  4CNY A;  2COL A;  2YTC A;  1WG1 A;  1OY9 A;  1H98 A;  1RUS A;  4ZLN A;  2BVZ A;  3HT0 A;  2GAG C;  1FWP A;  4MIW A;  2VFU A;  1S7H A;  3T1A A;  4UF4 A;  4GKK F;  2UU9 F;  3O5T B;  1H0H B;  2OMO A;  3P45 B;  4A46 A;  3RGI A;  2J6U A;  2BXJ A;  1YK9 A;  1IKW B;  1V5V A;  1F9F A;  4YDD B;  1DLO A;  4AUK A;  2C2K B;  2MDA A;  2VV5 A;  1YX2 A;  4GMK A;  2HLT A;  5AJ3 J;  2VBX A;  4NLQ A;  3ZZR A;  4J9U E;  4DR1 F;  5IT9 U;  4YHH J;  3Q8R B;  2KTQ A;  2ZVS A;  3PX4 A;  1JB0 C;  3HFK A;  3CJK B;  2C2D A;  4NYZ A;  4OZ1 A;  3MI7 X;  3C8Y A;  5JUM A;  4CH0 S;  3QPI A;  5A0Y B;  4KB7 A;  4LR8 A;  4MKV A;  2MQO A;  3V6K A;  5CAB A;  2Z2Y B;  3W8P A;  1PAU B;  2ILY A;  2BQU A;  2ACY A;  1IVZ A;  5ETV A;  3T9Z A;  4I2P B;  2KN4 A;  4WKR A;  1OIA A;  1ZM2 A;  5DO2 A;  5E3C A;  4DX8 H;  4ELT A;  3MM7 A;  4MK8 A;  2YQ1 A;  2GQC A;  1EQM A;  2YWG A;  4DSK A;  3IGV A;  2VG7 A;  1T11 A;  3KJV B;  4DG1 A;  2VOD A;  2PD1 A;  4DL2 A;  2B9W A;  1L3V A;  4RWX A;  1X5O A;  5KFT A;  3HSG A;  1S1V A;  3W5Z A;  4DFP A;  1XQI A;  2JC1 A;  2OD6 A;  3BYP A;  1UW9 A;  1B7Y B;  2YKP A;  2J7W A;  2ZJQ Q;  4X66 J;  3AOD A;  2HWI A;  2GAH C;  4ZS6 A;  2UXB F;  4QYZ J;  1FRM A;  3ZZ0 A;  5GMK a;  1RB0 A;  3LAM A;  3W3S A;  3DGV A;  2I1R A;  1WOP A;  1KN6 A;  2QLB B;  3SCL E;  4UY8 T;  3IBW A;  3M8Q B;  1PO6 A;  1V6H A;  4B9N A;  4F2R A;  1J5O A;  4YS2 A;  3QQC D;  1HW8 A;  1MG7 A;  2RAQ A;  1KKH A;  1IXK A;  2FY8 A;  5F8L A;  4DXL A;  2E7X A;  1R27 B;  2V0N A;  5F3T A;  4LFB F;  3BDP A;  2OTL S;  4E0D A;  1NUE A;  2BV3 A;  1FKA F;  4HDH A;  4FKX A;  2GQQ A;  2OTJ S;  2XMU A;  5T7L A;  3UD3 P;  2O3D A;  1EHW A;  3C16 A;  1QLN A;  1YBA A;  1M1H A;  2V8D A;  3OL7 A;  1U02 A;  2QL9 B;  1BD6 A;  3SV4 A;  3RRK A;  3AXM A;  2KRR A;  1WEX A;  4NLV A;  3CJ3 A;  1RWP B;  4V19 J;  3K5M A;  2XUL A;  1ARO P;  1FD2 A;  1RCO B;  2CYY A;  1RWX B;  4F3Q A;  2U1A A;  1HR0 F;  2XYG B;  1VRQ C;  3K17 A;  1RWO B;  2GZO A;  2IJR A;  5KFR A;  2CPE A;  3LAK A;  3MM7 B;  3UDE A;  2PI5 A;  4C0O C;  4QJV A;  4A4J A;  1XK8 A;  4ECZ A;  2VG7 B;  4A8K A;  4NZ7 A;  3G8Q A;  2CZV C;  2HYI B;  4RR5 A;  5GAE U;  3UQS A;  1CJT A;  2V34 A;  4DG1 B;  2QLF B;  3VGU A;  3PJX A;  4RWW A;  3ET6 A;  1S1V B;  2HAF A;  2D3O 1;  4EUV A;  3ILI A;  2CPJ A;  4NLO A;  2RT3 A;  3IA0 A;  3DC2 A;  3CUL A;  1HNI A;  2XNQ A;  3B54 A;  4CDI A;  1PCA A;  5DQG A;  1NM2 A;  4HT5 A;  4DSE A;  1R8A A;  1N0U A;  4ECY A;  2K1R A;  2K06 A;  2HMI A;  5B0G A;  4B3O A;  2M4M A;  4HTI A;  4J90 A;  1NKE A;  1WD6 A;  3BBC A;  2F9D A;  4HT7 A;  3PFE A;  1RT4 A;  1WTF A;  4ZCL A;  3D5M A;  5FLX Y;  2HZA A;  3AJ1 A;  3N5F A;  3TUP A;  3BSN A;  2W8L A;  1C0T A;  4LBP A;  1RT3 A;  3T1H F;  2XLJ A;  3HCX A;  3ELH A;  3ITH A;  3WHI A;  4Z2X A;  3B4D A;  5MLC V;  4LBI A;  3EMT A;  1S9F A;  3BGR A;  4DPU A;  2BAN A;  4FP9 A;  2QLX A;  1ZM9 A;  1LK7 A;  5AXN A;  3C6U A;  2HND A;  4URG A;  1EAY C;  2ZZN A;  4GVL A;  2KFY A;  1VC6 A;  3SI8 A;  3TA0 A;  4GO7 X;  1RTZ A;  3I6P A;  2XI3 A;  3ZTO A;  2FY1 A;  5T7L B;  3KMS A;  4ED1 A;  2W2P P;  1CUL A;  5E0O A;  3C16 B;  3V5R A;  3KG0 A;  5AXK A;  1VLO A;  2PE8 A;  2D9O A;  3HDS A;  1S72 S;  2UV8 A;  1NKB A;  3D0I E;  2XSF A;  2YWH A;  3P5T L;  2YWW A;  5I3Q A;  2Q43 A;  1IBM F;  2FVS A;  3QJJ A;  2R9L A;  4O3Q A;  2JVO A;  3C2P A;  1W2B R;  2FLN A;  3CMQ A;  2DGT A;  1PJ5 A;  4O4R A;  1AA1 B;  3CD7 A;  3UN3 A;  4KT0 C;  5KFU A;  3IC1 A;  2AIR B;  4DQS A;  1QSL A;  3GE9 A;  1N5V A;  3A12 A;  1CJT B;  1SJ4 P;  4NE9 C;  2Y3Y A;  4GC7 A;  4B9M A;  1O8B A;  3ET6 B;  2HHW A;  1UW4 A;  4UT4 A;  2CXE A;  2I6W A;  1XMQ F;  2C2N A;  4JI2 J;  1HWU A;  4USM A;  2J9C A;  1HNI B;  1SH2 A;  1ZS6 A;  2EXU A;  4KO0 A;  4LRD A;  3PXG a;  4X62 F;  3ONQ A;  3IS9 B;  4AQY J;  3HJV A;  2K1R B;  2H5J B;  2HMI B;  4OYI A;  5IOL A;  2FC8 A;  1XMO F;  2WVD A;  1G3O A;  1HNZ J;  2HGN A;  1RT4 B;  1TFW A;  4QR0 A;  4WK3 A;  1TKT A;  2I8E A;  3DRR A;  1CQM A;  4LR7 A;  1R43 A;  1EKS A;  1C0T B;  1RT3 B;  2LYV A;  4IO1 A;  5LL6 d;  1QD1 A;  3HVR A;  1S1W A;  1XR5 A;  2WOM A;  1SH0 A;  5DQH A;  2AV5 A;  5LMN F;  4X4S A;  4DCO B;  5AT1 B;  1Z1Z A;  4DJB A;  3RJM B;  2BAN B;  3BBB A;  5KTQ A;  3C6U B;  1EAR A;  2HND B;  1NB7 A;  2IBO A;  3LWM A;  2PO4 A;  1TL7 A;  4YY3 J;  3BR9 A;  2H54 B;  3MPY A;  1TP7 A;  2CIM A;  2RRB A;  3TJ8 A;  1FO1 A;  4YFU A;  4DPY A;  4K8R A;  4NLT A;  1CUL B;  4CQ1 A;  1UFW A;  4MFB A;  1Q8L A;  1G7C B;  1UJ5 A;  2RB7 A;  2G0J A;  1NBE B;  1WC5 A;  4QWD A;  1UMJ A;  1VQK S;  1FFS B;  4USI A;  1YSJ A;  2PFF B;  4DV1 F;  1ZAW A;  3MXH P;  4X65 F;  3EDR B;  2AU0 A;  3OLA A;  4MIB A;  3QJP A;  1Y11 A;  1B7F A;  2RVJ A;  4NA1 A;  3D0G E;  4PEO A;  2LP4 A;  5H9F K;  1VI7 A;  2BKO A;  1FVQ A;  1H2V Z;  5K9F A;  2WON A;  3MPU B;  2NUU G;  3HKW A;  3VAG A;  4XDD A;  5L1K A;  3LPY A;  4DV0 J;  3Q8Y A;  4HI2 A;  8RUC A;  2LLZ A;  2W8K A;  4ZPB A;  3HO1 A;  4PQU A;  1NSP A;  5CHC B;  1S1X A;  4M94 A;  3BPS P;  4MYU A;  3KLG A;  1YTY A;  1M5S A;  5FDL A;  5F9L A;  1VCT A;  3R6L B;  5J1P A;  4KO0 B;  1X5S A;  4LF2 A;  2C2R A;  3W60 A;  2DEI A;  3R5B A;  4HL9 A;  1FRH A;  2C3Y A;  3MOZ A;  3RB6 A;  2GO8 A;  2A3J A;  4I68 A;  1TKT B;  2EFO A;  3I0S A;  4IDK A;  1LWC A;  4ICL A;  3RBD A;  2KVI A;  3SMZ A;  5KT3 A;  3G82 A;  1YRX A;  4CWB A;  4EU0 A;  3HZE A;  1RAO A;  1S1W B;  2R7S A;  3B8H A;  2MJU A;  2DHX A;  4KRW A;  2ZOF A;  2NZ4 A;  3HXM A;  2LXF A;  2K3I A;  4HHJ A;  2YPY A;  1MLA A;  2MLY A;  1TL7 B;  1WDT A;  1SIZ A;  2EI5 A;  1IWA A;  1GMU A;  1X4G A;  3R5G A;  5A8K A;  4WPA A;  1NSK L;  2VFS A;  2ZDP A;  1FF2 A;  1RHR B;  3MEK A;  3GSI A;  4HDG A;  1FD8 A;  2VL1 A;  2WZ1 A;  3CCT A;  4S0M A;  5M2P A;  4P6Q A;  3N4W A;  2ZD1 A;  1UL3 A;  5LT5 A;  3IBF B;  4RBU A;  1RU2 A;  3VTI A;  1Q7L B;  2RS8 A;  1IKV B;  2BKP A;  4NA2 A;  4FKY A;  1Q86 T;  2HFN A;  4O4G A;  5A6W A;  4DFK A;  3CPW R;  5CD4 A;  4PWD A;  1H73 A;  4DX6 A;  4QIG A;  3UD4 P;  3NOG A;  3ZNJ 1;  1H72 C;  3W64 A;  2DPJ A;  3TEG A;  1M1K T;  3B82 A;  1Q8B A;  1PKU A;  2HQF A;  1RBL A;  5ETT A;  1VBY A;  1FTR A;  3WC0 A;  4DV5 J;  3P5B P;  3RR7 A;  4MKA A;  3NS7 B;  3NRB A;  2ZUA A;  2XHC A;  3D3B J;  1S0O A;  4DX7 A;  2CVI A;  4DUT A;  1KP6 A;  2XS2 A;  2RQM A;  3EZ5 A;  4Y2A A;  3D6M B;  2IRU A;  1OJ4 A;  1RAG B;  5AJ3 F;  3TWZ A;  4ZK7 M;  2V4R A;  4JI5 J;  2UVU A;  1W7W A;  4YHH F;  2XMA A;  2FZG B;  1N32 F;  2UXD J;  3RBE A;  4KGM A;  4PQU B;  4KGZ B;  4WFA Q;  4FYX B;  3CJS A;  3M8Z A;  3AOA A;  1TFY A;  2QC3 A;  1C4A A;  4OQJ A;  3KLG B;  5FDL B;  4IG0 A;  4FS1 A;  4HI1 A;  5D4O A;  2L9W A;  3PX6 A;  2HHX A;  1AB8 A;  1AZS A;  4EWT A;  3OSP A;  4OZJ A;  1I3O B;  1JLE A;  3V6H A;  1SQG A;  3W8G A;  4P2X A;  3I4H X;  3EZU A;  4PXD A;  1PJ6 A;  2J9E A;  2DHA A;  5HN0 A;  5DDO C;  1IQZ A;  3T19 A;  1S97 A;  1FRI A;  2FDN A;  3I0S B;  2ZH5 A;  4IDK B;  3V4I A;  1LWC B;  4ICL B;  4I67 A;  3MHY A;  1V3R A;  2F8E X;  4ED0 A;  3Q2S C;  3G82 B;  4RBV A;  1B64 A;  2JZ5 A;  2RHQ B;  3R8Y A;  5EWG A;  2AKW B;  2CFX A;  2ZNY A;  5JVH Q;  4DCP B;  3CJQ A;  3PR5 B;  3CCZ A;  1AUD A;  2Y8Y A;  3MAA A;  1RAH B;  4YUD A;  1G1X A;  1ZAX A;  4TQS A;  4F25 A;  4X66 F;  1D9F A;  2WRM A;  3JSY A;  2R7R A;  2QMW A;  1RHU B;  2ADC A;  5A8K B;  3CNQ P;  2ROP A;  4R0J A;  4CLT A;  1P8G A;  4FZV A;  4Y2M A;  1OY6 A;  2ZD1 B;  4Y65 A;  2HHH J;  2JJ4 D;  3M8S A;  3BYR A;  2KM8 C;  3BH6 B;  5D4P A;  3MPD A;  2JEI A;  4K4U A;  4DL4 A;  1RAB B;  4Y2I A;  2D3O R;  4DFJ A;  4USW A;  4O4G B;  2EC0 A;  3HM9 A;  4PUO A;  3G9C A;  4PWD B;  2DNY A;  2KZZ A;  4ZVS B;  3UPF A;  3PCO B;  3I96 A;  4CH1 A;  3NS6 A;  5KFD A;  4LSZ B;  5HLF B;  4PAA A;  2WAQ D;  1Z4U A;  3ZZO A;  1M90 T;  2FJW A;  3NY0 A;  3RU0 A;  4P7V A;  3RG6 A;  3FRZ A;  2ZWP A;  4OJH A;  2MZT A;  4QR2 A;  4B9L A;  1MNE A;  1RTJ A;  3I4P A;  2VG5 A;  4NI2 A;  2CPD A;  5T14 A;  1TEL A;  1X0F A;  2HGL A;  4UUX A;  4UST A;  1FJ7 A;  5D78 A;  4QYR A;  3SYZ A;  2BJ7 A;  3J7Y U;  1IWG A;  2XY5 A;  4IG0 B;  4Y0F A;  5HBM A;  3T3F A;  1AZS B;  5GAE I;  1Q7Y T;  2E5L J;  1JLE B;  1FNX H;  4LQ9 A;  2HFZ A;  3PO4 A;  2ASY A;  2MHE A;  1VQP S;  2XC9 A;  2L08 A;  3TVZ A;  4CLL A;  1UZH A;  3V4I B;  3JAM U;  2UUT A;  1SC4 B;  4M5K A;  4QU6 A;  2W9B A;  4XPE A;  2BYC A;  2DIS A;  2RDJ A;  2VZ9 A;  1QJH A;  3PKM A;  4LFC J;  3D67 A;  1PC5 A;  3TO8 A;  1SL0 A;  3LGH A;  4FYY B;  2AJF E;  1Y5I B;  1BQN A;  2AF6 A;  4ZOS A;  2KT2 A;  1N48 A;  2MKH A;  4PG8 A;  3TX0 A;  2KFZ A;  2FPH X;  4NWB A;  4C4W A;  2WSE C;  4K4Z A;  1D1U A;  1UVI A;  4X4N A;  1EP4 B;  4O3S A;  2HBZ B;  3KLI A;  4M8L A;  1YHQ S;  2OFG X;  1VQ4 S;  2NXU A;  4CO2 A;  3TVY A;  5HAO A;  1KR4 A;  3ILJ A;  3G87 A;  2FTR A;  3TRG A;  3IWN C;  3HHK A;  1JXV A;  4PUO B;  3DCA A;  3MCO A;  3MTJ A;  3MMA A;  5HRO A;  3QWU A;  3TEH B;  3BQ2 A;  2M88 A;  1G2E A;  2FLO A;  4NLY A;  3OL6 A;  2HFV A;  4USJ C;  5A76 A;  2E1P A;  5D4N A;  2LEB A;  2JEG A;  4NLG A;  1RTJ B;  2R7T A;  2VG5 B;  2CQ0 A;  1NH7 A;  4X4T A;  4ECU A;  2XQC A;  2IVM A;  4NI2 B;  1XMB A;  5IQ6 A;  2DHG A;  1VQN S;  2LDY A;  3G8S A;  2I9S A;  1MSW D;  1EZZ B;  2HVZ A;  1HQ2 A;  2HBR B;  3E2E A;  1XJW B;  3M8Y A;  3SBM A;  2N3O A;  2VH7 A;  2F65 A;  4K5R A;  2BAB A;  3NEK A;  2OH2 A;  1QUV A;  3FUY A;  4XAK A;  2OPS A;  3GIK A;  5HBM B;  1MWZ A;  4OZ3 A;  5D15 A;  5IT9 Y;  1N36 F;  2XZW A;  3M2V A;  2CQP A;  4A8X A;  4J9K A;  3R2D J;  3ZC4 A;  3KHG A;  3T6J A;  2AYB A;  3PNI A;  3T1Y J;  2OKQ A;  4NAS A;  4DCJ B;  2HZC A;  4KC5 A;  4IOC Q;  2XS5 A;  4PR6 A;  2W9B B;  1RLD A;  1RTH A;  4NEZ A;  2HK3 A;  4J5O A;  2ZKU A;  2JC0 A;  1U1O A;  4ZVP B;  1KS2 A;  2IFX A;  4UUW A;  1VQO S;  4MKY A;  4JI2 F;  3W66 A;  1RWW B;  1BQN B;  1BY9 A;  3MED A;  5CCL A;  1OS5 A;  4U6P A;  1HFE L;  1CJK A;  3OTO J;  3J7Z T;  4TN2 A;  3IO1 A;  4AQY F;  3PW4 A;  2XYP B;  4H4M A;  1RP5 A;  1LEO A;  2DNR A;  1HNZ F;  3CGI A;  2R2U A;  1WF1 A;  3KLI B;  2OSR A;  4G1I A;  4DEZ A;  3DYA A;  4TLQ A;  3BB5 A;  3EGZ A;  4ITS A;  1RT2 A;  3TI0 A;  3CJ4 A;  1IQT A;  2BM0 A;  5IQQ A;  1CVJ A;  3MMA B;  5HRO B;  4IRC A;  2GNK A;  2DRB A;  4M5D A;  2OEJ A;  4R5P B;  1BMQ B;  2J8A A;  4MKB A;  3DGP A;  4YY3 F;  4JBC A;  2WB1 D;  3KNA A;  4C3M A;  3R97 A;  4W98 A;  2ZH3 A;  2IA6 A;  1OQ3 A;  2R2T A;  1B4S A;  3BGL A;  2PFD A;  3PR4 A;  1KSP A;  1WEY A;  2MEW A;  5EDW A;  5DLF A;  2B51 A;  3BV8 A;  4LRA A;  3MR2 A;  2QEX S;  5C24 A;  2Q1L A;  4ZVQ B;  4OX7 A;  2O1P A;  4CO5 A;  4M5J A;  4KBI A;  2ZM6 J;  4OHY A;  2FGC A;  3GYN A;  3HVT A;  2CJ9 A;  3S01 A;  4XPC A;  4QIF A;  2IYG A;  5KFP A;  2R7Q A;  3OSN A;  4B9V A;  2RU9 A;  4O3O A;  1HI1 A;  3M2V B;  3CJ0 A;  4QIV A;  2EK1 A;  2HK2 A;  1LW0 A;  3DMJ B;  3I0R A;  5KFM A;  3PW5 A;  2V2V A;  3NCR A;  3ISN D;  4DZ6 A;  1NO8 A;  4K50 A;  1DTQ A;  1FX4 A;  3I55 S;  4X64 J;  4ANC A;  4IQX A;  2RH3 A;  4DV0 F;  1OSD A;  3OT9 A;  2Y0B B;  3H98 A;  1RTH B;  4XK8 C;  2C2O B;  1Y00 A;  2FHM A;  1EIY B;  3A3N B;  2BE9 B;  2CPF A;  4C3K A;  2H1Y A;  2Q66 A;  4FF4 A;  1JKH A;  3MED B;  2RUG A;  1CJK B;  4DV7 J;  4BC9 A;  4HHU A;  3MAH A;  2KXN B;  1S0N A;  4W92 B;  2DH9 A;  4ZVF A;  4DLG A;  3IR7 B;  1I51 B;  2CZ4 A;  3VAF A;  2BRK A;  4H4M B;  4RNF A;  1HNW J;  4PG6 A;  3ZTR A;  4OLO A;  4DF4 A;  4KFB A;  1YG0 A;  4X4Q A;  5HSP A;  2AZ3 A;  2HG4 A;  3DYA B;  1FCA A;  3HSJ A;  2XMJ A;  2XCP A;  4PWW A;  1RT2 B;  4N56 A;  1SKU B;  5E3P A;  4YR0 A;  1WC4 A;  3NMR A;  4PRF A;  1BE4 A;  1XN9 A;  1JK9 B;  1UEU A;  2K2P A;  5CD4 H;  2NXE A;  2W7O A;  2B43 A;  5IT0 A;  4M5D B;  4LF4 J;  4WFY A;  3H2V E;  5K14 A;  4NLR A;  1YBT A;  2IAJ B;  3DGP B;  5LXR A;  4QR1 A;  3UCG A;  5E41 A;  2HFS A;  2V6A A;  4F50 A;  3QFW A;  3D66 A;  4QWC A;  1FRJ A;  5DG9 A;  2HZV A;  2ALY B;  3C15 A;  4N7T A;  3GIR A;  2H48 B;  5LMU J;  2AP6 A;  3HP6 A;  4NZ0 A;  3ZNU A;  2NXN A;  1U47 A;  4DV4 J;  3HVT B;  3TA2 A;  2IVY A;  2MYF A;  2QYC A;  4LF7 J;  4B3T J;  1B99 A;  3GIM A;  4HAC A;  1RJJ A;  4P2S A;  4CI0 B;  4RJV A;  5DRK A;  1Q95 G;  2PA8 D;  4DV5 F;  1LW0 B;  4Y6I A;  4OI4 A;  3CCL S;  3V6D B;  1KTV A;  2KU7 A;  1X4B A;  1K44 A;  4DL3 A;  3ILO A;  5C25 A;  1DTQ B;  4L6V 3;  4OYA A;  5K8P A;  4A8M P;  1X8D A;  4JI5 F;  4NMX A;  2UXD F;  1ROF A;  4NPO A;  3DI6 A;  3HPO A;  2YH0 A;  4OZN A;  1CJU A;  4UQT A;  4N76 A;  1KOO A;  3N5B A;  4ZIT A;  1IN0 A;  4K0K J;  1K8A T;  1IM4 A;  2I5J B;  4X4R A;  1SUQ A;  3OUY A;  1NH8 A;  2N7C A;  1X4F A;  1UP1 A;  3T6B A;  4KGK A;  3FJ2 A;  2BMB A;  3THP A;  5LOQ A;  3MGJ A;  1QSS A;  5EGY A;  4KFB B;  3NGT A;  1HPZ A;  3SQO P;  1K1S A;  1D8Y A;  4DPO A;  4I2Q A;  4ES1 A;  1OQ6 A;  1OYD A;  4CLS A;  3TAM A;  4IR9 A;  1S9G B;  4ED5 A;  4C3L A;  1Y10 A;  3VQS A;  4L3K A;  3MM5 A;  1HNX J;  5H9F J;  3HHN B;  4ZDN A;  4ERD A;  2L48 A;  4ZP6 A;  3CJ2 A;  4ECW A;  2R8K A;  2VFR A;  5K14 B;  1J2V A;  3GV5 B;  2CDR B;  3R9L A;  5F8I A;  2R8H A;  3CT9 A;  4X4O A;  1L5U A;  2E66 A;  4EZ9 A;  2Z2M A;  4ZVR B;  2H9Z A;  1RAC B;  3C15 B;  2V9W A;  3UW1 A;  4RPF A;  3EXY A;  2HHH F;  2V2Z A;  2E9Z A;  1D8Z A;  4M95 A;  2B9E A;  2WSC C;  2OSQ A;  1RZM A;  1K0V A;  2O5D A;  2IM1 A;  1GAO A;  2DR7 A;  3ICL A;  4JYA J;  2JL9 A;  2XEX A;  4HAC B;  4UY8 5;  1S9E B;  2Q6C A;  4ED6 A;  5HQM A;  4OX6 A;  1M5K C;  2LQ9 A;  2AEM A;  1Q5Y A;  2Y8W A;  2QMU B;  5EN1 A;  1OPZ A;  1UCN A;  4MT1 A;  4C6A A;  3NXZ A;  5LJ3 Y;  5C25 B;  4YP3 A;  3J7Y I;  3R6G B;  5L9N A;  1F9E B;  1QTN B;  3D1O A;  3HZG A;  3LGM A;  2DB1 A;  1SL2 A;  2EC2 A;  3D6F B;  2XMT A;  2MQN A;  2XG8 A;  3DI6 B;  2P9G A;  4C0B A;  4OV1 A;  1TL3 A;  4J9S A;  1CJU B;  1HBO A;  3MF5 A;  1YJ7 A;  2EKY A;  4FVM A;  1SUQ B;  3OUY B;  2E5L F;  4TXS A;  3TQ1 A;  2HHT A;  1QUP A;  1VDH A;  2UV8 G;  2KKH A;  3U27 A;  3CCV S;  3IXQ A;  4USK A;  3NCQ A;  1RI7 A;  3GFX A;  4J91 A;  4I2Q B;  2V4J A;  4P2M A;  4PYA A;  1JJH A;  3TAM B;  2KJW A;  2W01 A;  3M6U A;  4LFC F;  3BRE A;  2QA2 A;  3MM5 B;  1SV5 A;  5F8G A;  4FYW B;  4WCE Q;  4WTY A;  2VJV A;  3K5L A;  5J2Q A;  4F67 A;  3AOC A;  1UVK A;  1VK3 A;  3AQO A;  1B3T A;  1UAW A;  5B0E A;  4EO8 A;  3GJQ B;  4K4Y A;  1WHV A;  3HJF A;  2E1M C;  1SH3 A;  1BWV A;  4WP3 A;  1JLB A;  3W2V B;  1SI9 A;  1UEK A;  4OFZ A;  4J9P A;  4QU7 A;  2XO7 A;  2DCU B;  1C1B B;  3IMQ J;  3M2U A;  3G6V A;  3E3X A;  4KHP J;  1UET A;  2UUB J;  2CNL B;  1NK7 A;  4OYP A;  1REV A;  2DNG A;  2FIU A;  1S0M A;  3MMB A;  3RBX A;  3FZB A;  2AD9 A;  3KK2 A;  2OUG A;  1GT8 A;  1CG2 A;  3GV7 B;  5DG8 A;  2H4W B;  2P6T A;  2XBP A;  5DM7 Q;  1DRZ A;  4MK9 A;  4TY8 A;  1ICE B;  3SFU A;  3PJW A;  1TL3 B;  2HW3 A;  3FC9 A;  2LA6 A;  1M5H A;  3R27 A;  2ZKT A;  4FF3 A;  4F0K A;  2W9C A;  1XER A;  2QJ3 A;  1FNM A;  3IP0 A;  1KRP A;  1IR0 A;  1V9O A;  3LO3 A;  3MTK A;  4ZCM A;  3DLH A;  2YNG A;  4F3M A;  1Q81 T;  4DFM A;  1RXO B;  1Y7P A;  2BUN A;  2FLP A;  3TZZ A;  1H7W A;  2WVC A;  5DG7 A;  3D0H E;  2FJE B;  4RW6 A;  3T1Y F;  3OFH A;  2FC9 A;  3MCM A;  2V4J B;  4QW9 A;  5A8W A;  4OHX A;  1NK8 A;  1UZD A;  3G86 A;  4EGL A;  3BGU A;  3RB0 A;  1SV5 B;  2N7Y A;  2GVZ A;  2OP5 A;  1Y9O A;  3M4X A;  3C3L A;  3N0V A;  2OFH X;  2F40 A;  2CG8 A;  3OTO F;  3KG1 A;  5J2Q B;  5CH7 B;  4EYH B;  7AT1 B;  2R7X A;  1GMV A;  3X1L B;  3IN5 A;  3CC4 S;  1CQN A;  2V8P A;  4B3R J;  2F7V A;  2AJ2 A;  3K5P A;  3OJS A;  5T41 A;  4XO0 A;  4OX8 A;  4Z7Y A;  2ERR A;  1LWE B;  5DM6 Q;  1N8R T;  2NZC A;  2XMK A;  1JLB B;  3PJ9 A;  2GIQ A;  2UXB J;  4ZP7 A;  2CPH A;  1ZM4 A;  3TZY A;  4J7C A;  4P71 A;  3GSD A;  3BQ1 A;  1ZH5 A;  4K59 A;  1ZAV A;  1E6V A;  1EB0 A;  1Y0H A;  2RIL A;  5KAK A;  3LPE A;  3NAH A;  2WVB A;  1REV B;  1DAX A;  1QAY A;  3MMB B;  3UN5 A;  3GG0 A;  3AAW B;  3L7O A;  2LCW A;  5GAH U;  3KK2 B;  3D68 A;  2EKN A;  2VA3 A;  4F2S A;  3GPA A;  3SCJ E;  3VZI A;  5IFM A;  2M5Y A;  1RT5 B;  4O3N A;  5CZV A;  2XGP A;  5DDR C;  2ZHB A;  2HBQ B;  4LF8 J;  4TY8 B;  1Q0N A;  3QT7 A;  3MFI A;  4QPX A;  3BSA A;  3QSY B;  2W2Q P;  2ZM6 F;  4O44 A;  1FE4 A;  2I0X A;  3R5J B;  2NYH A;  5B0C A;  1U09 A;  4KGV B;  1K47 A;  2VA2 A;  2LVW A;  2WVE A;  1OMS A;  4N8O A;  5B0A A;  1YVF A;  2YNG B;  4RU2 A;  3RAM A;  1R7I A;  3CIM A;  3ENA A;  2MY8 A;  4MYT A;  2QFJ A;  4LT6 A;  3D6H B;  4ETX A;  2E1C A;  4RW6 B;  4WYL A;  1YKW A;  3JQK A;  2VC1 A;  4JI7 J;  4OI0 A;  3UVJ A;  4X64 F;  2R8J A;  5A8W B;  3UI3 A;  1F60 B;  1ZM3 A;  2PSZ A;  3H5Y A;  1RKI A;  2O66 A;  1GQE A;  2A0F B;  4FVC A;  1UFL A;  4QBU A;  2DTJ A;  2GVZ B;  2BZ2 A;  1OYE A;  3TNV A;  4ZJL A;  3E01 A;  2CQI A;  4DV7 F;  3JAM Y;  3M6V A;  2E5G A;  3ZXW A;  1RDR A;  2OJ3 A;  2HFO A;  1YDL A;  1HNW F;  1VFJ A;  2VQE J;  4NRT A;  3BO3 A;  4JI4 J;  3NP5 A;  5J2P A;  4OZ0 A;  3R1L A;  5F8J A;  3IAM 9;  1WDD A;  3AD9 C;  1SIW B;  2AJ1 A;  3ZTQ A;  2ZH2 A;  1FK9 A;  4FS2 A;  3GMG A;  1FDN A;  5GMD A;  3R7B B;  4AL6 A;  2XCA A;  4NX9 A;  2QIF A;  5KG1 A;  5IV4 A;  4FPI A;  1E6V B;  3S8S A;  2VHG A;  2LU1 A;  4B9S A;  4LF4 F;  4F4A A;  2UUC J;  3DXB A;  5F8N A;  1L3K A;  2O01 C;  5CA5 A;  2F9J A;  3BO2 A;  2IMW P;  1J5E J;  4KPC A;  2VBW A;  2B4O A;  2XYH B;  1U6F A;  1T05 A;  3O44 A;  1FJG J;  1FKO B;  2HHU A;  4RUC A;  2GHW A;  4IUF A;  3MUV P;  1ZPV A;  1FRK A;  4ZLP A;  1W25 A;  4PKD B;  5LMU F;  4NCB A;  1WKJ A;  4JUZ A;  1R6Y A;  2AZ1 A;  1PG5 B;  2ROE A;  2OIH A;  2HVH A;  2H3E B;  1X4C A;  3Q86 A;  2YNI A;  3L9Z A;  2IRX A;  3KJF B;  3CCS S;  2DXE A;  4PG7 A;  1LV5 A;  4DV4 F;  3BSC A;  4DSI A;  4K4X A;  2L9D A;  4MJK A;  2VOO A;  3KNG A;  4LF6 J;  5JXS A;  4B3T F;  4L73 A;  3O1L A;  4B08 A;  2LA4 A;  1FRX A;  1NSQ A;  4M5G A;  3LH2 S;  3M30 B;  2UZA A;  3ISN C;  5IV3 A;  2P8I A;  1FEH A;  2WBR A;  2RRA A;  2EFQ A;  4CT8 A;  1N34 J;  3CDB A;  3KTQ A;  5J1E B;  3J81 j;  2DNM A;  3DLG B;  1U1K A;  3UVJ B;  1YJN S;  1PYT A;  8ATC B;  4IKA A;  4TYB A;  4I6A A;  1B70 B;  1FTC A;  4B3M J;  3L95 X;  3M8P A;  2JLF A;  3BO4 A;  3EPG A;  4EO6 A;  4F4W A;  2FB0 A;  4LRE A;  3LGN A;  2C2Z B;  4FXW A;  4K0K F;  2DR8 A;  4IR1 A;  4AFF A;  1UVJ A;  3E01 B;  3TW0 A;  1HIY A;  3PW0 A;  4YME A;  1IBK J;  1H2T Z;  3CCE S;  5EWE A;  5KFZ A;  4BS2 A;  2ASL A;  3IM9 A;  4LF9 J;  3BZQ A;  1R89 A;  2GO9 A;  3K5N A;  4PCQ A;  2DGO A;  1NPR A;  4BBY A;  4EBD A;  5J2P B;  1VQ7 S;  1SKS A;  1FK9 B;  2IM3 A;  4URS A;  3KXD A;  4W90 B;  2OLW A;  4X62 J;  4Y2K A;  1U8W A;  2ZOG A;  1VQ5 S;  3PHT A;  4YB6 A;  1F0X A;  3KYL A;  3GIL A;  1CLF A;  5J2M A;  2XTJ P;  1JLQ A;  1HNX F;  1GX5 A;  1FDA A;  4ZCK A;  1SL1 A;  2IY5 B;  4KQZ A;  4WFN Q;  3CJT A;  1AFI A;  1FDB A;  2HFU A;  1T05 B;  5HL7 Q;  1U48 A;  2ALZ A;  2HVE A;  4ZVO B;  5LMN J;  2BA9 A;  4P75 A;  3ZZP A;  1SQE A;  3D28 A;  4KAI A;  5AE3 A;  1XTZ A;  2YNI B;  2HLU A;  3FSY A;  4WFX A;  2OPP B;  4ZMM A;  2DO4 A;  2DRA A;  4JYA F;  4NLS A;  3QRR A;  3RW6 A;  4IH7 A;  1S4E A;  3A8I A;  2ZE2 B;  1RTI A;  2GV1 A;  1MMN A;  3VAI A;  3DLK A;  4QZV B;  2C2E A;  4ZP8 A;  3DOK A;  4O3R A;  2DPI A;  3EPI A;  3OHB A;  2GIR A;  2XWX A;  3DDN A;  1NLK L;  3VF0 B;  5FD1 A;  2DGQ A;  3LA0 A;  1N56 A;  2F4F A;  2OAU A;  2IDL A;  3DRX A;  3LP0 A;  4ED7 A;  4WII A;  4HTJ A;  3C14 A;  4ZPA A;  3M8P B;  3P6Y C;  5F8M A;  3MM8 A;  3HSZ A;  2J0Q D;  1XBW A;  5KG0 A;  3OL8 A;  3VVU A;  2G0C A;  4EK2 A;  3JSR A;  4PPD A;  1UVM A;  4DUY J;  2KHC A;  4KYZ A;  2YVS A;  4L75 A;  1UWA A;  3DN9 A;  3H2U B;  1D09 B;  3J81 U;  1C0U B;  1N5T A;  3UFC X;  2YKM A;  1L3T A;  4MH8 A;  4CLZ A;  4DQR A;  5J1N A;  2CWX A;  2KXF A;  4RW9 A;  4ZJQ A;  3PW2 A;  1NZ8 A;  4AL7 A;  1NDK A;  3TP2 A;  5K5M A;  1NSA A;  2X7I A;  4C8K A;  1JLQ B;  3VGS A;  1U1M A;  3P49 B;  3OR1 A;  4U67 Q;  4DF8 A;  1H3D A;  3FZ2 A;  5HO4 A;  2ZUG A;  4P72 A;  4OI3 A;  4RX6 A;  3VWS A;  3W9J A;  3G2X A;  5ETS A;  1XWL A;  3Q23 A;  1FA0 A;  4ID8 A;  5L1I A;  3F0N A;  2LFV A;  1RGV A;  1N52 B;  3QBC A;  3H5S A;  3BBF A;  4FYV B;  1S6Q A;  3PW7 A;  3QRP A;  4G65 A;  3JYT A;  1QDU B;  1FEE A;  5DZ6 A;  1YWX A;  5ETN A;  2BJ1 A;  4ZVG A;  5GAD U;  4KHP F;  1WOR A;  1X5T A;  2UUB F;  4FDF A;  1S6P A;  3DOM A;  1RTI B;  3DLK B;  5I42 A;  1TQL A;  3DOK B;  4C8Y A;  4OZL A;  4F0H A;  3A1Y G;  5E5N A;  4OL8 A;  1U49 A;  3DOL A;  2FD2 A;  2FVP A;  2GQ2 A;  2CWK A;  4PXE A;  4KE5 A;  1YRT A;  3SSQ A;  2NXJ A;  3LP0 B;  3C14 B;  3DM2 A;  4CM2 A;  3MM8 B;  1YJT A;  3H42 A;  3W62 A;  4DV2 J;  3VCD A;  3L7P A;  4ED2 A;  3MCN A;  2FLL A;  3HKZ D;  2NQP A;  2ZH4 A;  2DGS A;  1RT1 A;  2PMW A;  3QGI A;  2C1E B;  1T9Y A;  1N32 J;  3QLH A;  1C4C A;  3Q2T C;  3PV8 A;  4QIW D;  2YKM B;  4F4X A;  4K4W A;  5B08 A;  2QYG A;  3GON A;  1WNE A;  1DHM A;  2W4D A;  4Q2M A;  2AX0 A;  4RW9 B;  2NYI A;  3VGT A;  2CQH A;  3FDS A;  1T94 A;  3KWM A;  4OHZ A;  2R8G A;  5F0U A;  3GJT B;  2CG4 A;  1ITP A;  2XY7 A;  2J5A A;  3QGH A;  2RQC A;  3RAQ A;  3OR1 B;  3SFG A;  1YGY A;  1JIH A;  2EFN A;  2KG1 A;  2FHJ A;  2KJV A;  1KNZ A;  2VIH A;  2N82 B;  4B3R F;  1RE1 B;  2LQ8 A;  5D0E A;  1SC3 B;  1IKY A;  3J7Z 5;  1S6Q B;  3LW5 C;  1Q16 B;  4U7U D;  2FHK A;  3P4U B;  2MHN A;  4F7V A;  2YPZ A;  3JYT B;  3W61 A;  5IS2 A;  1VQ9 S;  1D9D A;  5GAH I;  2ILZ A;  1V3Z A;  4E8U A;  4Y34 A;  1S6P B;  2FJX A;  1YIJ S;  3R2C J;  2DEJ A;  5KFB A;  4GKJ J;  2ROG A;  2UP1 A;  3DOM B;  4TVA B;  5I42 B;  1WKK A;  1VR6 A;  3RYL A;  2VUG A;  3QAT A;  1I6J A;  1NU4 A;  5KT6 A;  1O5J A;  2QO3 A;  3DOL B;  2EG1 A;  2V67 A;  2DNO A;  4IFV A;  1WF2 A;  2D3U A;  2A10 A;  4LF8 F;  3DM2 B;  2DD8 S;  4IOA Q;  1SXL A;  1X5P A;  1WSR A;  4A8S A;  2HGM A;  5L39 A;  1DLO B;  4LSL A;  4ZVE A;  2B9X A;  1SJ1 A;  1X9S A;  3MEE A;  4WE1 A;  3UNY A;  2R7U A;  4Y3C A;  3K57 A;  2XZT B;  5HJY A;  2HQD A;  2RJZ A;  4OYW A;  3CCQ S;  3QLH B;  1S12 A;  1GX6 A;  3UWT A;  3G96 A;  3HVW A;  2PEB A;  1JXL A;  4JI7 F;  3FKB A;  4C8L A;  2C42 A;  4YOE A;  2YX7 A;  2WB4 A;  1RA7 A;  2NR0 A;  2AJQ A;  4KKO A;  2H65 B;  3UDL A;  3F73 A;  1RAA B;  4A8F A;  1I1G A;  4ZJO A;  4NYP A;  3CDA A;  4CO3 A;  1JJ4 A;  4OI6 A;  1QAX A;  1F3V A;  1Q8I A;  5C7P A;  2UXC J;  3DHW C;  3CF5 Q;  3EXC X;  4C97 A;  4F02 A;  2MQM A;  2OPR A;  1VIO A;  2F8M A;  2HIQ A;  5HP1 A;  4OYX A;  3I87 A;  4PXB A;  4WU3 A;  3MPV A;  4O0N A;  3A8K A;  3P96 A;  4UOH A;  1NPK A;  2VQE F;  4O0I A;  3CIZ A;  4JI4 F;  3VAK A;  4JI8 J;  2QN6 B;  5AXL A;  1IKY B;  4LRC A;  4ENO A;  2HQ3 A;  1QVG R;  2ZDO A;  4N47 A;  4X4U A;  3U7J A;  1ZOT A;  3L4B C;  3UO0 A;  1NDP A;  1TAU A;  3O3L A;  5ETM A;  3PFO A;  1VGY A;  2E7V A;  3NAI A;  1LOU A;  5C42 A;  2UUC F;  1EX8 A;  2Z4P A;  1T03 A;  3QJL A;  1B0V A;  1J5E F;  4IYQ A;  1TAQ A;  1J5O B;  1CJV A;  1R31 A;  5D0G A;  2DGV A;  1UVN A;  1FJG F;  2VPY B;  1PIE A;  3PRV A;  4ECV A;  4KJI A;  1WC3 A;  5EX0 A;  1S4F A;  4IFV B;  2X51 A;  4E98 A;  2ZFH A;  4PZV A;  4U9R A;  4RUA A;  1YQH A;  1YJU A;  4HYK A;  2DIV A;  4LSL B;  3WBZ A;  3KLH A;  3ISZ A;  2ZH8 A;  1UVL A;  2JH3 A;  3TAP A;  3MEE B;  2Y1R I;  4LF6 F;  5HVH A;  2AHO B;  3KHR A;  2FHJ D;  4G1Q A;  2GIF A;  1U1N A;  3CO9 A;  2HAI A;  4F04 B;  3NBP A;  2ZZM A;  3HHL C;  1N34 F;  1HI8 A;  3OQ2 A;  3LP1 A;  1NHV A;  1U0H A;  5DZ7 A;  3NNH A;  3UR3 C;  1S99 A;  4CP5 A;  1N36 J;  4WYW A;  4KKO B;  4WKY A;  2E29 A;  1WEZ A;  4B3M F;  1FXR A;  1VBX A;  3IG1 A;  1S49 A;  4M1K A;  1KVJ A;  5MAO A;  4AE5 A;  3GV8 B;  1NZA A;  2HEK A;  7FDR A;  1OWX A;  1HLW A;  2OPR B;  3AA9 A;  2BOP A;  1KVK A;  1IBK F;  1U1L A;  5ETP A;  5HP1 B;  3RB4 A;  1F5A A;  2HWH A;  3TA1 A;  4LF9 F;  3PX0 A;  2LEP A;  2XI2 A;  4C8N A;  4KPY A;  1NK6 A;  2OHD A;  1JX4 A;  1AFJ A;  3NWG A;  3A13 A;  2C3P A;  1KQS R;  1DJ0 A;  4UW2 A;  2MQL A;  1WWH A;  1SKW A;  1UPM B;  5IXU A;  2L9N A;  3FBB A;  1SC1 B;  4B3O B;  2IJN A;  3S1T A;  5F8H A;  1LFW A;  1WTB A;  2MKK A;  4FN5 A;  5C42 B;  2Z56 B;  2BJD A;  1JXE A;  1APS A;  1T03 B;  5HQL A;  5EUH A;  2GFF A;  3F41 A;  4OV6 A;  3R7S B;  2RNE A;  1HA1 A;  4KV8 A;  1S77 D;  1CJV B;  4V19 X;  3ITH B;  2DJW A;  2W7A A;  2APO A;  1U2R A;  2AGO A;  4BWJ A;  5D8H B;  4QWB A;  4Y00 A;  3FBE A;  2XMV A;  2YWF A;  3BGR B;  4CLU A;  2AYE A;  4OHV A;  3QT8 A;  1TUW A;  1U6B A;  3N9U C;  3MD1 A;  3KLH B;  3CCR S;  2GC8 A;  5HVG A;  3BN7 A;  1SJ3 P;  1SCJ B;  2B8Q A;  1WHY A;  2PA3 A;  4G1Q B;  3UNG C;  5F9N A;  4DS5 A;  3OVA A;  2QSF A;  3KMQ A;  4BHQ A;  4C2M A;  3NBP B;  4P52 A;  2DR5 A;  1PYO B;  2E44 A;  3LP1 B;  1U0H B;  3A3O B;  1XC9 A;  3HX9 A;  4G1P A;  1FX2 A;  2B3T B;  4BDP A;  3ADA C;  3ZZU A;  2X1A A;  3FVY A;  5J2N A;  2K3K A;  4MK7 A;  4C11 A;  3CDE A;  2Q6B A;  1UA0 A;  4CNZ A;  2ZC3 A;  3IG1 B;  3GG1 A;  2GJI A;  1F5C A;  1GMW D;  2WK4 A;  3H40 A;  2CRL A;  4RLE A;  1RWK B;  1HWL A;  2O67 A;  4M5I A;  3M32 A;  3I9V 9;  5L8R C;  4DUY F;  3HUL A;  3AJD A;  2NUH A;  2PC6 A;  4WXW A;  2M8D B;  2EBG A;  4ZVU B;  3JSM A;  1WEL A;  4OLP A;  3JSB A;  2KFN A;  1T3O A;  1N0V C;  1NJW A;  1ZYQ A;  3WZ0 A;  4ZPC A;  3W65 A;  3K7R A;  1S0V A;  4JI1 J;  4WFB Q;  2KVQ E;  3MMC A;  4DSF A;  3CB4 A;  1CSJ A;  4C48 A;  3KHH A;  4G3I A;  4KGX B;  1LQ9 A;  3OVS A;  1GXT A;  3DRR B;  1PGZ A;  5KFY A;  1U24 A;  3I32 A;  4ZIV A;  2BOA A;  4KV8 B;  1N4L A;  4OX9 J;  1X9W A;  2KHD A;  3KDO A;  2MKJ A;  2WOM B;  1TVR A;  1NDC A;  5GAD I;  4OZ5 A;  3T5L A;  2YQ0 A;  2F4V J;  1JWW A;  1FKP A;  4URQ U;  2W7P A;  3M8W A;  4DSL A;  4NLX A;  4ZVT B;  2PII A;  1HL6 A;  4WP9 A;  4MFB B;  3KDN A;  3MMJ A;  1YZ7 A;  2GMJ A;  1RQ0 A;  4AXJ A;  3MUM P;  3BSO A;  2LQB A;  3SCK E;  4K4S A;  3EYZ A;  2NXC A;  1K9M T;  1U4B A;  2HHV A;  2Z58 B;  1BGX T;  3DNC A;  1YRU A;  5I4M A;  5KFQ A;  2WON B;  2XWY A;  1XR7 A;  2WW8 A;  4DV2 F;  3CD5 A;  3U02 A;  1LXJ A;  3KLF A;  1X60 A;  3HD1 A;  5KG5 A;  2POK A;  1GH8 A;  3M32 B;  2LXI A;  3CO0 P;  4ANE A;  3QT5 A;  2VJU A;  3TAR A;  4YR3 A;  4L76 A;  4B9T A;  4IOB A;  1S1X B;  1T02 A;  5ADZ A;  2N3L A;  5KG7 A;  1M5V C;  2CQ4 A;  3AFG A;  2V94 A;  2YWE A;  4ECX A;  5DQI A;  4M5M A;  2QA4 S;  2EVZ A;  3GII A;  4ZP9 A;  2MKC A;  2CNO B;  2ATL A;  3MMC B;  1Q4R A;  2MKS A;  1YBU A;  3TAQ A;  5KT4 A;  2IC3 A;  1HBM A;  2LU2 A;  4CLY A;  2M9K A;  1S76 D;  4UQG A;  1Q1K A;  1KHW A;  2GA7 A;  2HS0 A;  4WJB A;  1TVR B;  4HVZ A;  2J9D A;  1U25 A;  3QGG A;  3MEG A;  5SUH A;  4P7T A;  1FKP B;  3MM9 A;  3KK3 A;  1U6Z A;  1RHQ B;  1VK8 A;  1IKW A;  2ZBC A;  1RHJ B;  1SB6 A;  3FCV A;  3EIC A;  1BC6 A;  3GQC A;  1YIT S;  3R5A A;  1LW2 A;  3GYG A;  7FD1 A;  2ZBP A;  1J27 A;  3SEO A;  2DXF A;  3W63 A;  3EVW A;  4KR0 B;  1DQA A;  3CSK A;  4GKJ F;  2QRR A;  3IWX A;  1DZ5 A;  1F2H A;  1BQX A;  2DK2 A;  2WCX A;  2HVD A;  4Q8F A;  1WHX A;  1WC0 A;  3K89 A;  4ZCI A;  1LWX A;  4GVB A;  3GR1 A;  3H20 A;  3H5X A;  3Q83 A;  3N6L A;  2HIY A;  1RLC L;  5BYS A;  1YJW S;  2EPI A;  2VU5 A;  2HBY B;  3RAX A;  3PDN A;  2C28 A;  4H4K C;  1VC0 A;  3KLF B;  1S6O A;  2XB2 D;  3GB0 A;  3VQT A;  2V63 A;  1ZZN A;  1NHK L;  3G71 S;  2PMH A;  2J0X A;  3GFH A;  3CUN A;  3UDV A;  3LUY A;  4RU9 A;  3EZO A;  3OXG A;  4PXC A;  2CQC A;  5KFG A;  2LEC A;  1T3N A;  5K8O A;  3KOA A;  2XMW A;  3CXC R;  4LBH A;  1O6X A;  3JTN A;  4CLW A;  1TL5 A;  4F4K A;  3MR7 A;  5THW A;  3NGS A;  1LXN A;  2Z30 B;  2AYM A;  4IG3 A;  3J81 Y;  1MML A;  3OBI A;  2UXC F;  1VMB A;  4WP8 A;  2IC3 B;  1HBM B;  2DNQ A;  2OPQ A;  2KI2 A;  1L3U A;  4I64 A;  1KLN A;  1NJZ A;  4Q8E A;  5KFN A;  8AT1 B;  2HHP A;  2RKI A;  2SXL A;  3PZP A;  4QW8 A;  1LWF A;  4JI8 F;  2KT5 A;  2M0G B;  1KHV A;  1QTM A;  3NGK A;  3MEG B;  3MAA B;  3T5K A;  2JSX A;  2YKO A;  3MM9 B;  3KK3 B;  1N5Y A;  2MB0 B;  3BKF A;  1KWM A;  4ED4 A;  4OJ1 A;  1HQU A;  1FNO A;  1MWQ A;  1PBU A;  4LF5 J;  1SJR A;  5L1J A;  2CAJ A;  4OJG A;  2YBV A;  2DVI A;  4LJM A;  2Y9H A;  1LW2 B;  2MMY A;  1RAI B;  3N6N A;  2CQG A;  1NJY A;  1OSC A;  3MR6 A;  4KHR A;  5KFJ A;  3HFZ B;  4ZHR A;  1WC1 A;  3MEC A;  2FZK B;  4O3P A;  4OI1 A;  3QNW B;  2J6S A;  3BQ0 A;  1RT7 A;  2Z8Q A;  1UFK A;  4GVB B;  1CC7 A;  4DSJ A;  2W9A A;  4M5H A;  1H7X A;  3QZ8 A;  2HS4 A;  1N6Q A;  1VBZ A;  2V9K A;  3EGW B;  3PYF A;  1R0B G;  1ZPW X;  5M2U A;  2V8V A;  3PIO Q;  1TK5 A;  2XM3 A;  1T7P A;  3M6W A;  5E2Q A;  5A8R A;  2Y1J A;  5KFH A;  2DY1 A;  3BKU A;  4FYD A;  4C98 A;  2DY9 A;  5KFW A;  2X1G A;  1R8P A;  1RIS A;  1NK9 A;  4LFA J;  1HW9 A;  3UDC A;  1UJ4 A;  4LMZ A;  1GXL A;  2EBE A;  3LOU A;  4DR3 J;  3L3C A;  1LKZ A;  1TZ0 A;  3G4S S;  3MD3 A;  2NPF A;  4CYU A;  5HMZ A;  2JLG A;  2QL5 B;  2R7V A;  4IG3 B;  2V2Q A;  4ALZ A;  4DBQ A;  2CNN B;  5DLG A;  1T9W A;  3D54 A;  6FDR A;  4M5L A;  3BGF A;  3DLJ A;  2FQQ B;  2VQF J;  2OPQ B;  2YQ3 A;  2JLE A;  1X9M A;  2JEF A;  3FMB A;  3TUJ C;  1U2C A;  4EMD A;  1KQF B;  3SSS A;  4JI3 J;  3A3P B;  3RUB L;  2RKI B;  2IMO A;  1H74 A;  4Q45 A;  1LWF B;  4K2X A;  3BEG B;  5KG6 A;  1N5Y B;  2J6T A;  2AX1 A;  3AY0 A;  3CJ5 A;  4RNM A;  4DR4 F;  1HQU B;  2HNY A;  2DIT A;  1TR0 A;  3OR2 A;  1FRL A;  4PYD A;  3OD2 A;  1ZBT A;  4ZPW R;  2M2B A;  1N5Q A;  4ZHR B;  3MEC B;  1X0P A;  2H51 B;  3QO9 A;  1VQ6 S;  1SPB P;  3T5J A;  4J9L A;  3JQM A;  4ZPV R;  1RT7 B;  2FYX A;  1VBK A;  4V1A k;  4I4B A;  3K2Y A;  2DT9 A;  2V8H A;  1N6Q B;  3W2W A;  4C9D A;  4JB8 B;  9ATC B;  2Q3P A;  2CPX A;  2IM0 A;  5A8R B;  4CLF A;  4JOU A;  1XNQ J;  2F63 A;  3VZH A;  5KG3 A;  3ENW A;  3I5A A;  2IPO B;  4B3S F;  2HSE B;  3GWC A;  2MSS A;  4AXI A;  2DR6 A;  5KOX A;  2RRN A;  3M2R A;  1EQ0 A;  2Y1I A;  3CDU A;  4ER8 A;  4RL1 A;  5ETL A;  1WOO A;  3ULH A;  3OFG A;  4GO5 X;  4NLD A;  3QAE A;  4DPX A;  3NGR A;  2ZEJ A;  3BH7 B;  4KTQ A;  1NK4 A;  2OPS B;  2LQ5 A;  2MZS A;  4CYU B;  1FFG B;  3IS9 A;  1SJQ A;  4DR6 J;  3UR0 A;  4CO0 A;  4LSN A;  1DTT A;  2G2Y A;  3SSR A;  4TY9 A;  1PC4 A;  2NSC A;  4ID5 A;  4DV3 J;  3UCZ P;  4Z37 A;  1DUR A;  4OI2 A;  4R25 A;  1IUJ A;  1X7V A;  1GNK A;  3S7R A;  4FNI A;  4USU A;  2QLW A;  5KFL A;  4ECQ A;  2QV6 A;  5G0R A;  1QY7 A;  1U26 A;  2I38 A;  2QG9 B;  4D3G A;  3B78 A;  2NLW A;  1I94 J;  3HHE A;  3OTE A;  1IR1 A;  2DXD A;  2KT3 A;  5M2R A;  2HNY B;  3V81 A;  4JI1 F;  3FBF A;  4I7F A;  2XY6 A;  4ZN3 A;  3OR2 B;  4DDF A;  4LF1 A;  3AA8 A;  3GCX P;  5ETR A;  3H5U A;  5DGA A;  4I6Y A;  1NJX A;  2B4U A;  4ZPD A;  2HPU A;  1HHT P;  3MWB A;  2WVF A;  1VRT A;  3EUN A;  2BJE A;  2B56 A;  1PIL A;  1W26 A;  3QO9 B;  2LEA A;  3VVT A;  4OX9 F;  1T0T V;  3M9O B;  4EYI B;  2HVI A;  5EHH A;  3W2W B;  2HWT A;  1VLY A;  3KHL A;  1DQ9 A;  2IRY A;  3A4T A;  2F4V F;  2P9C A;  2FVQ A;  1RHK B;  4QWE A;  1WKL A;  3RTV A;  2DNP A;  1HI0 P;  4UOF A;  5LSR A;  4A47 A;  2Z0G A;  3CD6 S;  5D0H A;  2RHS B;  1Q79 A;  2VIC A;  2BDP A;  4KSE B;  3M2R B;  1NXI A;  2JNJ A;  2JRS A;  4LIR A;  2DKO B;  4LQ3 A;  4F8R A;  2MY7 A;  5C24 B;  4RW7 A;  3O2I A;  4X84 A;  2CJK A;  4PWU A;  1PJ7 A;  2E5H A;  4HKQ A;  4A8O A;  3W7B A;  4CCH A;  1RSC A;  2DGU A;  1PYS B;  4DL5 A;  4ETZ A;  1EET A;  2A6O A;  2CNK B;  5AE1 A;  2MJN A;  1DFD A;  5BR8 J;  4LSN B;  1XNR F;  1DTT B;  2RS2 A;  1SVD A;  3I0R B;  1YJV A;  1M0S A;  2EK6 A;  1AYE A;  4ID5 B;  2KB2 A;  2E5J A;  2Z2Z A;  5CAA A;  1F5B A;  1XR6 A;  3D2W A;  4Q5V A;  2UVR A;  3ENV A;  5G0R B;  3J80 U;  3DU6 A;  3TJ9 A;  1N5S A;  4NCA A;  1ZA1 B;  2B0G A;  1JKH B;  1M5O C;  1HD0 A;  3AJ2 A;  4IO9 Q;  1VJQ A;  4DL0 C;  3PRB A;  4F3O A;  4DN9 A;  4XTT A;  3V81 B;  4I7F B;  4IFY A;  3X3U A;  3TAN A;  2M7S A;  5GME A;  1KEK A;  4LRF A;  2NS1 B;  2D1C A;  3HLU A;  1VOM A;  1TMM A;  3CTR A;  4P9S A;  1Y3J A;  2RUS A;  4XDC A;  5LM7 E;  1VRT B;  4ATN A;  2VKZ G;  1IKV A;  2J76 E;  1FJC A;  1D3W A;  4QWA A;  2RDI A;  2ZBI A;  3PEH A;  5AXM A;  4DN0 A;  3GZ7 A;  4ILR A;  5JMN A;  2IIH A;  3CC7 S;  2MZR A;  1YJR A;  2FVR A;  3OFE A;  2B7C B;  4WK1 A;  3IRX A;  3W5Y A;  4HHH A;  2HQG A;  2R8I A;  3DDI A;  1X4H A;  3QRQ A;  3D9B A;  1LK5 A;  3TUI C;  5H1S V;  2KO1 A;  4YQW A;  1FWK A;  3U1N A;  2G2O A;  2GJ2 A;  1NAQ A;  2J0W A;  3Q8U A;  4RW7 B;  1GTE A;  4OYZ A;  2CUY A;  4IH5 A;  3FQL A;  2CQB A;  4U8Y A;  1BHN A;  3NS5 A;  1EET B;  1KOH A;  1T9T A;  4ES2 A;  2WTF A;  1G4C A;  3FCH A;  3CCU S;  3VHQ A;  5HK4 A;  3VGV A;  4RW8 A;  3BR8 A;  2OO4 A;  1KLM A;  1LNQ A;  2A1B A;  1VYA A;  4J9N A;  4UOC A;  2YNF A;  2QA4 G;  3QGP A;  2R3V A;  5F41 A;  3T41 A;  4EEY A;  2R2R A;  2QGF B;  3IR5 B;  2L3M A;  1V5I B;  2ABY A;  4A8Q A;  5B09 A;  3FQK A;  3AQP A;  2GX8 A;  5CCM A;  3LWL A;  3DRP A;  3K8V A;  4EBE A;  4Y2C A;  3VV2 B;  1URR A;  3EJM A;  2C2M B;  2MZ1 A;  2JHE A;  1HBN A;  4IFY B;  4DR2 J;  3K59 A;  3IAS 9;  4F36 A;  3BDE A;  4DQQ A;  4KH0 B;  1HPZ B;  1RWU A;  1CBK A;  1WG4 A;  4K2J A;  2VB6 A;  3FSI A;  3ILL A;  1A9N B;  4L3N A;  1ZA2 B;  5C2G A;  5HLF A;  1D0E A;  3M9M B;  3CMA S;  2V2K A;  1L3S A;  1R8H A;  4RNN A;  3OW2 R;  2AW0 A;  4K5S A;  2CQD A;  2MKI A;  3M05 A;  4G6V B;  3IRX B;  4WZQ A;  1HHS A;  1HAR A;  4LF5 F;  5HMY A;  1GEH A;  4TYA A;  3AB2 B;  5LSL A;  1UJ6 A;  2CDQ A;  3DKD A;  4FXD A;  3OTB A;  3C66 A;  1KON A;  5KOW A;  3OXL A;  4GRS A;  2HS3 A;  2PN6 A;  2DR9 A;  2VBY A;  3U1L A;  1BUX A;  4ZLJ A;  5KT5 A;  4AL5 A;  1HD1 A;  3KKF A;  2DGX A;  3ENQ A;  4NCG A;  4NXM J;  4DL7 A;  2HQC A;  1RHM B;  4RW8 B;  4X4V A;  1KLM B;  4ECS A;  4QIE A;  3UCU P;  1HWJ A;  3LF0 A;  2YNF B;  1K1Q A;  2XS7 A;  4ZIW A;  4LFA F;  4NXN J;  3CME S;  2B8P A;  4PAB A;  2L41 A;  4J9Q A;  4NLP A;  1HBO B;  3IFE A;  3FBC A;  4DR3 F;  5A2Q U;  4OYM A;  3CCW A;  3BN4 A;  1SC6 A;  4OZ2 A;  4RO0 A;  3OPK A;  4Y28 C;  3DRP B;  3DLE A;  4J9O A;  4C7Q A;  2AQ4 A;  2A2C A;  1Y5L B;  4HR2 A;  1HBN B;  3P3D A;  4ILL A;  3SIP B;  5KT2 A;  5LSO A;  4TKT A;  1EP4 A;  1JJC B;  1SQF A;  3QID A;  2V68 A;  1JLA A;  2DH7 A;  2BQR A;  4N5S A;  2JWN A;  2XHW A;  2VQF F;  4Q44 A;  1MMD A;  1QAI A;  3FGV A;  4ZA1 A;  4F0M A;  1QM9 A;  3NMA A;  3OTD A;  3OV7 A;  2MKY A;  3HVA A;  4I56 A;  4JI3 F;  2KL8 A;  3MM6 A;  1G6B A;  3QWP A;  3KUH A;  4LVO P;  2MQQ A;  2MQP A;  3P8B B;  1P27 B;  5KFO A;  1R8B A;  2LQJ A;  3I5C A;  4DR5 J;  3AH6 A;  1KTQ A;  3PAC A;  3D6T B;  3EGV A;  1HNV A;  1I5O B;  1YJ9 S;  1EJ7 L;  1WHW A;  5LXY A;  4ZLL A;  1S6U A;  2WBM A;  3GTY X;  3OJU A;  2B5J A;  1QVF R;  1UKU A;  3AT1 B;  3OHA A;  4FNH A;  4B17 A;  2MQ8 A;  2DHS A;  5KFS A;  4KHM A;  5B0D A;  4M63 A; 
#chains in the Genus database with same CATH homology
 3NGT A;  3MPD A;  4AND A;  1B4S A;  3ZTP A;  2DY9 A;  3NGR A;  1HLW A;  3BH7 B;  3BBC A;  3BBF A;  1NSK L;  3VVU A;  4HR2 A;  1UCN A;  1S59 A;  3Q8Y A;  3FC9 A;  3PRV A;  4C6A A;  2HUR A;  1B99 A;  3DKD A;  3VVT A;  2VU5 A;  3ENA A;  2B8Q A;  1WKK A;  4EK2 A;  3L7U A;  3GP9 A;  3ZTR A;  4S0M A;  4F4A A;  2HVE A;  1NSP A;  5C7P A;  5CAA A;  3BBB A;  4DI6 A;  3FCW A;  3PJ9 A;  5BXI A;  3DDI A;  2AZ3 A;  1BUX A;  3ELH A;  3Q89 A;  3EJM A;  3VGT A;  4FKY A;  4KPC A;  1K44 A;  3EMT A;  2BX6 A;  1NHK L;  4O0N A;  1BE4 A;  4F36 A;  1HIY A;  3Q8U A;  3R9L A;  1LEO A;  3FBB A;  1XIQ A;  1MN7 A;  1WKL A;  4UOH A;  5CAB A;  1NPK A;  1HHQ A;  4UOF A;  1PAE X;  1WKJ A;  2DYA A;  3ETM A;  2AZ1 A;  3EVM A;  3Q86 A;  4ENO A;  1BHN A;  1PKU A;  2CWK A;  3FCV A;  3VGU A;  4ANE A;  1NDK A;  3EIC A;  1NDC A;  1ZS6 A;  2DXE A;  1S57 A;  4DZ6 A;  1MN9 A;  3Q8V A;  3GPA A;  1NDP A;  3ZTO A;  2ZUA A;  2DXF A;  3B6B A;  4ANC A;  3EVO A;  3VGS A;  3EVW A;  4DUT A;  2BEF A;  3NGS A;  1F3F A;  1NLK L;  4CP5 A;  1F6T A;  3ZTS A;  2HVD A;  5IOL A;  3VGV A;  2B8P A;  1U8W A;  2DXD A;  1NCL A;  1NSQ A;  3EM1 A;  3FBF A;  1NUE A;  1NB2 A;  3WX8 A;  3FBE A;  1W7W A;  4FKX A;  3NGU A;  3FBC A;  3B54 A;  1NDL A;  1JXV A;  1LWX A;  3G2X A;  3JS9 A;  1VYA A;  1S5Z A;  3FKB A;  1XQI A;  3Q83 A;  4UOG A;  2NCK L;  4W98 A;  4WBF A;  3EE3 A;  1KDN A;  1EHW A;  3ZTQ A;  3BH6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...