2MZRA

Nmr structure of the rrm1 domain of hrb1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
GSARELDSTYEEKVNRNYSNSIFVGNLTYDSTPEDLTEFFSQIGKVVRADIITSRGHHRGMGTVEFTNSDDVDRAIRQYDGAFFMDRKIFVRQDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Protein HRB1
publication title Gbp2 interacts with THO/TREX through a novel type of RRM domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2015-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mzrA00
3UWTA 2MY7A 2ADCA 1Q81T 1VQ6S 2VODA 5HL7Q 3UD3P 1H2UX 3EGNA 4QPTA 1DZ5A 4W90B 3NS5A 3OW2R 2DISA 1FHTA 2CJKA 4C4WA 1WEZA 2MZQA 2RVJA 2KHCA 1X5SA 2CPXA 2X1GA 1ZZNA 2LQ5A 1M5VC 2MJUA 3CTRA 3CCRS 2AYGA 2ZJRQ 1VQ5S 3RW6A 3SDEA 5DDPC 1VQ9S 3P49B 2XNQA 4WKRA 2XS2A 2RNEA 5BJRA 1NJIT 1X4DA 2DNPA 1BY9A 1VQ7S 4ED5A 2CPZA 1WEYA 1VBZA 1WTBA 2MZTA 5DDOC 1VQKS 2CQBA 2N3LA 3G8SA 2G4BA 3S01A 1WG4A 1SJ3P 1H2VZ 3THPA 2KRRA 2MZJA 3U1MA 1AUDA 4QU7A 2MKHA 2DNYA 4ZKAA 3IWNC 1YJNS 3R27A 3G71S 4ERDA 2MSTA 3CC7S 2KXFA 1KOOA 1VQOS 5GAEU 2U1AA 2Q79A 2CPFA 2KH9A 1WHWA 1FNXH 2OTJS 2CPDA 4FXWA 4M5DB 2M4MA 3H2VE 2CQCA 2ERRA 1DRZA 2N82B 1YI2S 1U1QA 2MKJA 1NU4A 3U1LA 1WWHA 2K3KA 4EGLA 3TP2A 3SXLA 2LYVA 2M8DB 5GAGU 4Z2XA 2CQPA 4A8XA 3MI7X 3NS6A 2ZJQQ 1FJEB 3LQVA 1KC8T 1WF2A 2V94A 1L3KA 2SXLA 2CQIA 2U2FA 3BO2A 4OZ0A 2KG0A 1U1PA 2M8HA 1YITS 3CPWR 1WG5A 2M88A 4U67Q 2L41A 1WHXA 2KXHA 1WEXA 4TU7A 2DGSA 2X1FA 2HGLA 2EVZA 4IOCQ 1VC5A 3B4DA 2HVZA 3BS9A 1M5PC 1B7FA 3ULHA 4WF9Q 1HD1A 2MQLA 4LIRA 1H2TZ 2J76E 2MKKA 1QVGR 2DGVA 2E44A 1PO6A 1VC6A 1WI6A 3BO4A 2LECA 4J5OA 3MD1A 1YWXA 2LCWA 5JVHQ 2LEAA 3L3CA 3G4SS 4YOEA 2DNOA 2CQDA 2GHPA 3EGZA 1NO8A 2OJ3A 2XSFA 4WFBQ 4WIIA 2GO9A 1JJHA 2XS5A 5IM0B 1ZZFA 1OIAA 1Q86T 2KXNB 2DNLA 1R8PA 2JVOA 2YKAA 1VBXA 2G1DA 3CCSS 2MGZA 1U1NA 3CMAS 1VQMS 1VQ8S 4F02A 3PIPQ 4UY8T 2QFJA 2YH1A 2CQ3A 1Q7YT 2QA4S 1HA1A 2J8AA 3CMES 2DGQA 1Q82T 2CQ4A 4F25A 1A7GE 1X4AA 2N7CA 2DO4A 2MYFA 2DNGA 2X1AA 2DGUA 5LSOA 2F3JA 2YTCA 2MPUA 5GAHU 1K73T 3NMRA 3DLLQ 1RK8A 2L08A 2MQMA 3TYTA 3P6YC 2D3OR 2L9WA 5LJ5Y 1X5OA 2M0GB 2DIVA 1URNA 1SJRA 5IQQA 3J7ZT 3MDFA 5H1SV 5DDQC 3ZZYA 1PGZA 4QU6A 3UCZP 2MB0B 1N8RT 2DNQA 4IUFA 2A3JA 3VAMA 1DHMA 5IM0A 2LXIA 2MZRA 2BOPA 3N9UC 3CCVS 2NLWA 2DB1A 2HYIB 1VQLS 4PKDB 3J7YU 3VAFA 3JB9k 2RRBA 4LMZA 4W92B 2AYBA 3CCMS 3FEXB 2VONA 1KQSR 2VOOA 3MUMP 1X4EA 3LPYA 4CIOA 1D8ZA 2D9OA 4PRFA 4QQBA 2J0SD 2DNNA 3UCGA 1YTYA 1SXLA 1SJFA 1FXLA 2MMYA 1M1KT 2ZJPQ 2RU3A 2DH7A 3G6ES 3CULA 2DNKA 2MQNA 1OPIA 3MOJB 2E5IA 3MD3A 3S6EA 2OIHA 5EN1A 4F26A 3G9CA 2DITA 2DGTA 2M70A 2DNHA 2MQQA 4FXVA 1JJ4A 2E5JA 3P3DA 5HO4A 2QEXS 2DO0A 1N88A 1S72S 1OWXA 1WF1A 1O0PA 3V4MA 1M5KC 2XS7A 3RW7A 5IFMA 2CQ1A 2YH0A 5CXTA 1HL6A 3THTA 2RUGA 1WF0A 1DBDA 2DIUA 2LXUA 3R1HA 4PR6A 1UAWA 2YWKA 2J0QD 3HHNB 1A9NB 5DDRC 1W2BR 2DGWA 1ZH5A 2DNRA 3UCUP 2WBRA 1UP1A 1UW4A 1XN9A 2LMIA 3R1LA 2DGOA 2DGXA 1FJCA 1N54B 4C0OC 3VAGA 5DETA 2LA4A 3SDEB 2MKCA 3I55S 1U6BA 1P27B 4CQ1A 3UE2A 1M90T 5D77A 4UQTA 3CCLS 2CQ0A 1JMTA 2LA6A 1YHQS 3P5TL 1JJ2R 4BS2A 2D9PA 2RT3A 2DHAA 4RU2A 1U1MA 2JRSA 1K9MT 1CVJA 2LKZA 3MUTP 2N3OA 3CD6S 3CCJS 2MY8A 3UD4P 2KFYA 2MKIA 3EX7B 2VOPA 3VAJA 2CPHA 2KU7A 5LSLA 1KOHA 2X1BA 3CF5Q 2CPYA 2MSSA 1SJQA 2XB2D 4WFAQ 3MUVP 1SJ4P 2CQGA 4C7QA 2UP1A 2JWNA 2OSRA 3CUNA 3DXBA 1U1RA 2KN4A 2KM8B 2RQCA 1X0FA 1QM9A 2HZCA 3S7RA 5JVGQ 1D9AA 2MJNA 5GMKa 2AYMA 2RS8A 1VQNS 2F9DA 2NZ4A 2I38A 3NNCA 3VF0B 3PIOQ 2AD9A 4CH0S 2CPIA 2CQHA 4LJMA 5FJ4A 1FO1A 2EK1A 1UFWA 2DH8A 5DM7Q 2RS2A 2MHNA 1N52B 2FPHX 2KRBA 2PEHA 2RRAA 1U1OA 4P6QA 1YJ9S 1WHYA 3CCUS 1R8HA 3VALA 5GADU 1HD0A 2EK6A 1WI8A 2KM8C 1KD1T 4IOAQ 4YB1P 3BEGB 2DHXA 1P1TA 1F9FA 1S79A 1H6KX 1M5OC 1K8AT 1U1LA 4YUDA 3G96A 2DHSA 3MURP 2DHGA 2MQPA 3BO3A 1VQ4S 3B4MA 1U2FA 4TU8A 1YJWS 1X4HA 2KT5A 2I2YA 1X4CA 3K0JA 2OSQA 2CPJA 2XNRA 2JVRA 3H2UB 5MLCV 2DH9A 3NNHA 1WG1A 1WHVA 5LXRA 3CCES 2O3DA 1IQTA 2FHOB 5D78A 1U6FA 2DNMA 2FC8A 5ITHA 1X5TA 2B0GA 2FC9A 1OO0B 1X4BA 2K8GA 1VQPS 2CPEA 1G2EA 3G8TA 2DK2A 2MZSA 4TLQA 3SMZA 2ADBA 3NNAA 4OZ1A 3IRWP 2MGZB 2M9KA 3Q2SC 5LXYA 1VC0A 3ZZZA 1U1KA 2HGNA 3D2WA 2MQOA 2M2BA 4IO9Q 1RKJA 1VBYA 3Q2TC 2JX2A 4Y00A 1QVFR 1FT8A 2M52A 3CC2S 3VAHA 2M7SA 3MXHP 4WCEQ 3US5A 2MXYA 2KG1A 2OTLS 3CXCR 2HGMA 2F9JA 3TO8A 3VAKA 3CC4S 5DM6Q 2KYXA 2E5HA 2LEBA 2AYEA 1X4GA 3I56S 3S8SA 2KVIA 5GVQA 2G0CA 1X4FA 2MKSA 1YIJS 4Y0FA 2RQ4A 2MZ1A 2DNZA 2FY1A 1X5PA 1FJ7A 3HI9A 3CCQS 2BZ2A 1WELA 4TU9A 2PE8A 5LJ3Y 5CYJA 4WFNQ 2CQ2A 4CH1A 5CA5A 3VAIA 3FEYB 2E5GA 2KI2A 4V19X
chains in the Genus database with same CATH superfamily
3PG9A 4RUHA 2GW8A 4HACB 2Z0GA 4FXDA 1IKYA 2XMTA 2DBBA 2W2PP 1CJKB 4PXEA 2BJ9A 4BLGA 1S4FA 2MJUA 4PZVA 4ID5B 3UO0A 1SH2A 1NJIT 1VQ7S 4B3OB 5J2NA 4KTQA 3QYYA 4ZVGA 3Q89A 4KHPF 3IMQJ 3THPA 2KRRA 4QU7A 4LREA 3MHYA 4RBVA 1KR4A 2V2VA 1OPZA 3OV7A 3EE3A 2Q79A 2DJWA 2D1CA 4J37A 3W5YA 2WVBA 4MKYA 5I3UB 2JFKA 1SIZA 1T9XA 4Z2XA 2B51A 4L73A 2NUUG 3JTNA 1FVQA 2U2FA 4F04B 4RO0A 2M8HA 3GV8B 4HLBA 4KV8B 2M88A 3DYAA 2HAIA 1RT7B 2J7KA 1NHVA 3WHIA 1SL1A 2X1FA 3HVAA 1VC5A 5A6PA 1HD1A 2DCUB 1Q53A 2F4FA 2J76E 3D3CJ 5EWGA 5A8RA 2BE7D 2VPWB 2E66A 4JB8B 3U7JA 4I4BA 3POTA 1NSKL 1DJ0A 5DQHA 2XS5A 3NY0A 1TL7B 2HBZB 2KXNB 3JYTB 1R8PA 2RSQA 2LDIA 2IA6A 2FIUA 4DQQA 1VQ8S 3W1YC 3W64A 3F73A 3QRPA 2YPYA 4KT0C 3JQMA 3NMAA 2FHJA 2DGUA 4LQ3A 2WVCA 3HD1A 4RWWA 2L9WA 1Q78A 2EPIA 2E5LF 1FF2A 1HPZB 1EARA 2A2CA 3A4TA 2HFOA 3DLHA 3NCPA 1HLWA 3LTOA 2JLEA 4I7FA 4IUFA 2DR9A 1G4CA 1H7XA 2MZRA 2BOPA 2QLXA 2YWEA 2HVDA 3GYXB 2VKRA 2HQCA 1Y10A 4AFFA 4PCQA 1T9WA 4GVBA 2WZ1A 4D3GA 4ILLA 4MYUA 3N28A 3PFOA 4B17A 4ZVEA 1S1WB 1KLMA 3OTCA 3VR1A 3VVTA 4HYKA 1Y11A 5AXKA 2AMCB 4RNFA 5K5MA 4B3TJ 2DGTA 5HO4A 3P4UB 2RUSA 4L72B 2V67A 5ADZA 1S6QB 4CO1A 1UW9A 3KUEA 3RB4A 4FNIA 2DIUA 4KFBB 1FEHA 3HHNB 1Y5IB 2XCAA 3M7VA 2ZM6F 1M1HA 2UUBJ 3JTOA 3L95X 2R7OA 1A0OB 3H0PA 1RTDB 1H73A 3MECB 4RL1A 2G0JA 2CQ0A 2VU5A 3D6TB 1ZYQA 1U1MA 2DXEA 1FJGF 1EJ7L 5DS7A 4EFAC 5C2GA 1VIXA 4RUCA 1LXJA 1SJQA 2FD2A 2V8PA 5BYRA 4O23A 2KT3A 3DXBA 2KN4A 1JLEA 1V5IB 4OYAA 1HR0J 4OZNA 3NRBA 1NLKL 3BN4A 1PYSB 3ELHA 1S0VA 1GXTA 4LF5J 5C2CA 1UFWA 4TQSA 4DR2F 2ROPA 1SQFA 5C42A 3T1YJ 5IC6B 3DCAA 1LQ9A 1N34J 1IKXA 4RW7B 1WI8A 1KD1T 2B4OA 2E1RA 4URQU 1Q4RA 4UOCA 1NH7A 3U02A 1WC1A 1SC1B 3NEKA 3A12A 3QO9B 2XHWA 4KKOA 3MM8B 4OL8A 5IT0A 4DUZF 3SI8A 2GVDB 2N4DA 1NDPA 4ED0A 3Q2SC 2E9RX 2H9ZA 5AE3A 4EBDA 4YHHJ 4QIWD 1VOMA 1VBYA 2JX2A 3OTDA 4P7VA 2MXYA 2OTLS 4LFCF 2ZE2B 2ROEA 1HKAA 3AJDA 3QGGA 3S8SA 4RNOA 1XMQF 1HYSB 1BQXA 1WUUA 3KUHA 1RTJB 4UY85 2YKOA 2DNZA 2C3OA 1WELA 1UVJA 1U6ZA 2RJZA 3FEYB 2XC9A 1M5HA 1MW7A 4NEZA 5KFMA 3EGNA 1F3FA 4DS4A 2KZMA 2HZAA 2FQQB 2BOAA 2QG9B 3CDEA 5DDPC 2P8IA 4NCGB 5K14B 2VQEF 1X4DA 3FMBA 4OI1A 2DNYA 3DRPB 3FQKA 3R7SB 3BH7B 2RAQA 1Q7LB 2CPFA 2WW8A 3KOAA 1GH8A 4L3NA 3DRSB 4ZPWR 1KHVA 2EG2A 2EFQA 2NXUA 2YNGB 5B0DA 2OPQA 4DZDA 1B0VA 4PQUA 4IOBA 4KPCA 2NXNA 4X62J 4R5PA 5KFZA 3D68A 1S9FA 1WG5A 5DZ6A 2L9DA 4ELUA 1JJCB 1XJWB 2ZBRA 5D4PA 1YSJA 1N33J 4UTGA 1BWEA 3CEDA 5IV3A 2HNZB 5F9LA 3QNWB 4YS2A 3E01B 2DNOA 2V8VA 4Q0BB 4IG3B 3GTYX 3CW2C 4J9NA 3T6BA 1FDBA 2HNDA 2NCKL 2LVWA 3GR1A 4TN2A 2BABA 2GS8A 5L1IA 2C2EA 1HHQA 1I1GA 3QIPA 4K4TA 1W2IA 1BHNA 3O44A 4FYXB 5H9FK 1FRLA 4KHMA 4B9MA 4ECRA 4ECTA 2HS3A 1IBKF 2MB0B 4IQXA 2AIRB 3QT6A 4OJGA 3HSJA 1BWVA 3CE8A 4UQGA 1RYRA 2Q6BA 4Y2MA 4DV6F 3C15B 4NLVA 3JB9k 2E1PA 3HVTA 3C2PA 4JYAF 1KLNA 3MUMP 2UVUA 3MMCB 3FDSA 4C6AA 1DFDA 1SQGA 1FDAA 3PTWA 2AX0A 5E2QA 2JLFA 1KEKA 4NI2A 3QJJA 3DLKA 2HURA 4F2RA 3QFWA 4O4GB 3DGPA 2WONA 3MPUB 4NOHA 2CVIA 4DL4A 1IKYB 2FGOA 4ZPTR 3DGVA 2L9NA 5KFXA 2QZ8A 4DN0A 2W2NP 1LEOA 5K8MA 4AT1B 3CT9A 5DG9A 1FJCA 3LO3A 1NK6A 3RBDA 3QMQA 1V3RA 5J2NB 3KYLA 4RU2A 1K9MT 2L3MA 2FJVA 1IR1A 1ZM3A 3D4JA 4Q44A 4WFAQ 2IM3A 3GP9A 4YMEA 2IVMA 2HHPA 2FLNA 2V8GA 3N6LA 4JI6J 4P2XA 1HIYA 1U2CA 3NNCA 2BRLA 1FO1A 3HSDA 2BJ3A 2HAFA 1NZ8A 3PO5A 2NQPA 3DYAB 1BQMA 3W3SA 4NZ7A 2O01C 3FBBA 5GADU 4NZ0A 1N32J 2UUAJ 2CUYA 3MZIA 3D66A 1S79A 4P2FA 1K8AT 2VG7A 4OYMA 2KT5A 2I2YA 4Y2IA 4FP9A 5A8RB 3SV3A 4I67A 3NNHA 1FKOA 3JSMA 5D78A 1YZ6A 3J81U 3T19A 3POTB 4EEYA 2P9GA 2ZVIA 1YKWA 1U26A 3H2LA 4DFKA 4DSKA 3PACA 4LF6J 5KOWA 4NX9A 4LFBJ 5HVFA 1RKJA 2UUCJ 3H59A 2HQ3A 2ROGA 1G3OA 2ACMA 2N4CA 1JLAA 4LIWA 1RAHB 2AYEA 1IBLF 4Y0FA 5E3QA 5ETSA 4TY8A 1TELA 3KDNA 4I7FB 1XMBA 4JI0J 2PMZD 1FFGB 5LM7E 4XDCA 2ASJA 3KLGA 4OI3A 1U24A 4ECUA 1HNXF 2YWHA 4WKYA 4GVBB 3DLGA 1S48A 1JQGA 1L3SA 4FF4A 2K06A 4RZRA 1ZZNA 3IR5B 1KLMB 2AW0A 3ZC4A 1GNKA 2DR5A 4OQJA 3D1OA 1Q8LA 3W66A 1WTBA 2MZTA 3AXKA 1PJ6A 1SL2A 2MZJA 3U1MA 5IT9U 3CC7S 1TQLA 4EZ9A 3H2VE 3AOAA 2ERRA 4LF2A 1U1QA 1D9FA 1EZZB 2H4YB 2ZH5A 2CQPA 3NS6A 1RLDA 4ED7A 4CDIA 1KC8T 4CLFA 3DDKA 2KG0A 1U48A 4NLPA 4QIVA 3PYFA 3MM9A 2F1FA 4XTTA 3PY8A 5L1KA 1H2TZ 1Y0HA 1TVRA 3MR2A 1AT1B 1HHSA 2PN6A 1JLEB 2RDDA 4K4XA 2GHPA 4I6YA 2Y0BB 4OYBA 2GA7A 3ZTQA 3GIMA 2MGZA 1TL3A 1VQMS 4F02A 4OZ2A 5C42B 3G87A 3LF0A 1ZM2A 2Y9HA 3MCMA 4NMLA 1UVLA 1IKXB 1TMJA 1YRXA 2MYFA 3OD2A 3AOBA 4K50A 1NJYA 5HJXA 2ASYA 1NAQA 2R8GA 4KKOB 3M2VA 1CEZA 1X9SA 5HMWA 3OFHA 3RU0A 1KDNA 3SZ2A 3N9UC 4HTIA 2ZH4A 4Y6IA 3T6JA 3T1YF 3VHQA 4DR1F 3T3FA 2R42A 2AYBA 2DEJA 1NK4A 4B3SJ 5KTQA 4KIAA 2IM0A 4AL6A 5C24A 2J0SD 1M1KT 2R7UA 2RU3A 4DR5J 2DNKA 3LOUA 4OLOA 4ZVQB 2QLFB 1TUWA 4NLSA 5M2PA 1SV5A 2XI2A 1CJVA 2E5JA 2ILZA 2G2OA 4ZVUB 1LXNA 2V9WA 3THTA 1NJWA 3R7BB 4DR3F 4HEA9 3D28A 3SSQA 1W2BR 2IMWP 4IO1A 2YXLA 5CCMA 3K8WA 2BQ3A 3RBEA 2LA4A 3M32A 2XYHB 2HQGA 2B43A 2D9PA 2GMLA 3FZBA 4Z7CA 2OUGA 3IBWA 3F0NA 2KFYA 8ATCB 4IG0A 4JI4J 2KU7A 2WK4A 4J90A 3CF5Q 2CA9A 4GVLA 2YKMA 3ET6A 1B0TA 2A6MA 3ILIA 3L9ZA 4LQ9A 4LF1A 4NPOA 4NMXA 3NS7B 1EKSA 4LF9F 4WJBA 2D7SA 2KJWA 4LF4J 4X84A 3S7RA 2OPQB 4PQUB 2BRKA 3GZ7A 2MEWA 1GMWA 4R5PB 2RQMA 5FJ4A 1U49A 4KGVB 1B70B 4KGMA 1IBMJ 2E1CA 2VUGA 2IBOA 3TA2A 3H20A 3CCUS 1IXKA 4NXMF 1R43A 4I1TA 2EK6A 5FLXY 3IRXA 3GU0A 4FF2A 3HMJG 4C3LA 2CPJA 2DXFA 5MLCV 2LQBA 2HNYA 2BW7A 5IWAJ 4ELVA 2FC8A 5EUHA 4X62F 2K8GA 1H72C 2CPEA 2BJ8A 3V6KA 2AGPA 1ACMB 3K8VA 4OZ1A 3VV2B 2NREA 2YKQA 1YVFA 2HGNA 2HNDB 2EKNA 3UI3A 3OPKA 4YR2A 1GAOA 5U47A 3CC2S 1UEVA 3VQSA 2BUNA 3MOZA 3QIPB 2RH3A 3CJQA 5E3AA 4BWJA 5KFJA 1HWUA 4ILRA 4O0NA 3KLIA 5K9FA 2W2QP 3BBFA 3NGDA 2V8HA 2OFGX 4A8YA 1YK9A 5EGYA 3GIJA 1TMMA 2DHHA 3BYPA 5A0YA 3UN5A 4PXCA 3HVTB 2OEJA 1TP7A 4V1Ak 3OXLA 2JH3A 3QRRA 4DV0F 4LRFA 2XMVA 2J8SA 2ZBPA 3UPFA 1U0HA 3NCQA 2OH2A 4N77A 3WBZA 4DR4J 4FS2A 3ENAA 1VHIA 3DLKB 4W4MA 1ROFA 2ZOMA 3OL7A 1K0TA 3G8SA 3CB4A 4GKJF 5IQ6A 1Q95G 2MKHA 2OPSA 4HTJA 3DGPB 4U8YA 2WONB 1S49A 1RWUA 2JOQA 3OVBA 4JI3F 2D74B 1TL5A 2YKNA 3SXLA 3MMBA 2FTRA 1B4SA 4IH6A 3TUIC 3T1HJ 2JC1A 1IKVB 2AJ2A 2VIHA 3C14A 3TA1A 2MTLA 4M5LA 1D9DA 4OZ0A 6FD1A 1PYOB 3CPWR 4QWDA 4DQPA 1WEXA 3KUGA 4DSJA 1TKTA 3BKFA 3PRVA 5GAEI 3UQSA 1CG2A 1B7FA 3KHLA 4E0DA 2NSBA 5D8HB 4DF4A 1R31A 1U47A 2LECA 5IOLA 5CZXA 3HDSA 4JV1A 3ZTSA 1D1UA 4LSZB 5EX0A 3P96A 5A6WA 4UT4A 2XULA 5IM0B 4IYQA 1IJFB 4USJC 1JLFB 3W63A 1C0TA 2F8MA 3PW2A 1BQMB 1Q7YT 1OJ4A 3UDCA 1I94F 1SKUB 2C2RA 4LRBA 3LP1A 2W9BA 2VG7B 5GAHU 5AJ3J 3LW5C 2AT1B 1V3SA 2HHUA 1URNA 1FKOB 2XLIA 3QAUA 3Q86A 2QJ3A 4CT8A 4RKUC 3VAMA 4V19J 1WC0A 3HD2A 3DOLA 2KT2A 1R0CB 4IQMA 3IWLA 1FFSB 1PSDA 2UUAF 3DOMA 4H4OA 3SCKE 1UCNA 1HW9A 2ZFHA 3KHGA 4USWA 1JLAB 2DH7A 2ASDA 4JI2J 3AXMA 3VQTA 2W8LA 5E5NA 4UUXA 5EN1A 2HVIA 4TY8B 3W8GA 2QEXS 3NBPA 2DO0A 4C8NA 5KFWA 1WNEA 1T03A 2CQ1A 5E0OA 3D6HB 3CO0P 3I6PA 1UAWA 3U27A 1NK8A 3DLGB 3G8QA 2WSFC 3WX8A 2QC3A 4DV3J 3EUNA 2NPIA 3R7NB 4H4KC 2BMBA 3A8KA 4JI1J 1F2HA 2R7QA 3PV8A 3Q8PB 1DQAA 3CCLS 5L8RC 1N5TA 2J7WA 3FBFA 2Y0SD 4NYZA 2MKIA 5KAKA 1UZDA 4J9KA 2J6SA 4OI6A 3G6VA 2C2DA 1FRXA 2ZHOA 3QSIA 3AA9A 4DPUA 4WU3A 1S9GA 5F8IA 4DQRA 2HHWA 6AT1B 1X0FA 5KG0A 1N6QA 2AYMA 3G6YA 3SV4A 2W7PA 5K8PA 2AJ4A 1IWAA 3FBEA 2KHDA 1RWKB 1MNEA 4K0KJ 2KRBA 3ETMA 4ECXA 2PEHA 3MM9B 4HHJA 1U1OA 5KFFA 1SIWB 3DKDA 2V8DA 3RR7A 2R2RA 3O6QA 5F9NA 4ZIWA 2CADA 3RRHA 2DHXA 1TVRB 1RISA 3LAKA 3MURP 1YJWS 2F4VJ 3PM9A 1P8GA 2JL9A 1CJUA 2XNRA 2ZNYA 4ZJLA 5LXRA 3SQGB 5B0BA 3HHLA 3NCRA 4NCBA 2BW2A 1FRJA 4DX8H 1ZOTA 1NDCA 2FC9A 2VPZB 1LW2A 1G2EA 5LMNF 1QTMA 3B78A 1RA7A 4QWBA 4YB7A 2MGZB 4EU0A 1TL3B 1EKRA 5C7PA 2MDAA 4IO9Q 2QT7A 1XBWA 4A8QA 5I42A 2M52A 3VAHA 3EGWB 4I6WA 5AXMA 3CC4S 3K58A 1FE0A 2B5JA 3L7PA 3M2VB 3LWMA 2DEIA 2W2OP 2NSCA 3UFCX 3PX0A 3CWJA 5LJ3Y 4WFNQ 5DG8A 1RHKB 4MFBA 3UWTA 3OJUA 1NK7A 1OYEA 1Q81T 5KT2A 3H4BA 2EEYA 1AW0A 2DISA 3J7Z5 4X66J 2LQ5A 5C24B 3DN9A 4ZPAA 3AD7C 4FZVA 3HLUA 1UVIA 4BHQA 1RI7A 1VBZA 1UA1A 5DDOC 2PFFB 2HKEA 1SV5B 1C2PA 1CJVB 1HI1A 3CSKA 1YJ7A 4BCAA 2ZKUA 5T14A 2QYCA 4UZBA 1FNXH 2OTJS 2M4MA 5BXIA 1YQHA 4B3SF 1YI2S 4X4TA 1SI9A 1JNRB 4EGLA 2XSJB 4CLSA 3PYDA 1XERA 1NEEA 3M32B 4ECVA 5H9FJ 4GO7X 2C22A 1U1PA 1G7CB 4NASA 3HHEA 5B0FA 4PXBA 3HZGA 3OVSA 2DCLA 1JNZB 3B4DA 3BS9A 1T05A 4IG0B 3FEZA 4LIRA 2YKMB 1DQ8A 3ET6B 4G65A 3JSRA 3E51A 1RSCA 2XMKA 3G4SS 1LV5A 1N48A 3TZZA 4Q7AA 2YQ3A 4WIIA 1Z2ZA 2YKAA 1S0MA 1FE4A 1VRUA 2XO7A 4LBPA 2P2CB 4JI4F 2Q1LA 4C11A 1UWAA 1X4AA 2IMOA 3IRXB 4O44A 2W01A 4ZA1A 2F65A 4WXWA 2UVWA 3TYTA 4UOFA 3P6YC 3K5LA 4RW8A 1X5OA 2QIFA 5DRKA 2HNYB 4DJBA 5B0CA 3M9OB 2HVEA 1T11A 4P52A 2DNQA 1U09A 3PCOB 3MPVA 1Y5NB 1BE4A 5L1JA 4PKDB 2WW4A 4QZVB 2RRBA 2PEBA 1IM6A 4RUAA 1P9QC 4K59A 3MOJB 1IKWA 2E5IA 5IWAF 2QO3A 3KLIB 2OIHA 3A3PB 2IJFA 1TAUA 1WOSA 1F9EB 3MAAA 1S72S 1AUSL 5CXTA 2RUGA 5A0YB 4DPTA 4M5DA 3B82A 2HPUA 5D6GA 1A9NB 1YJVA 5EDWA 1NK9A 4ETXA 1FD8A 1D0EA 1C4CA 3IC1A 2DGXA 2QA4G 1J2VA 2CNOB 2J9EA 1U0HB 1M90T 4UQTA 5KFSA 2VG6A 3CD7A 2RQKA 4WYLA 1CVJA 2J0XA 4ALZA 2BE9B 2V6AA 3UD4P 2OPSB 4CRJA 2XZDB 1FXRA 4Q43A 4CO0A 4RJVA 2OMOA 3IXQA 2R2UA 4C2MA 3OTOF 4HL9A 2GAGC 1YZ7A 2YKNB 3VTIA 4PG8A 1URRA 2ILYA 2I38A 3C14B 3QBCA 4ZVHA 3CVKA 4P6QA 5AT1B 3DC2A 4ED4A 1WHYA 2OI2A 4ZP6A 3L09A 3W60A 1TKTB 3LP2A 1YGYA 2KM8C 3E2EA 1P1TA 2W7OA 3BO3A 3DU6A 3V4IA 2R3VA 1AXQA 4AD6A 1YRUA 2V2QA 5DGBA 1TU0B 4M1KA 4KJIA 3HHDA 3KDOA 3M8QA 2AF6A 1OO0B 2HRYA 1HHTP 3J7YI 1C0TB 1UA0A 1OMSA 5I3PA 4IH5A 4USMA 5B0EA 4F4ZA 1UPPA 2DT9A 4WXOA 4CH7A 4DV1J 3LP1B 2W9BB 2NXCA 5DM6Q 4FS1A 2NS1B 1RTIA 1YJTA 2A0FB 3VCDA 4S0MA 3MM7A 5FIIA 4GO5X 3OL6A 1S5ZA 2XLJA 3Q0AA 3DOLB 4DCPB 1S76D 3DOMB 4H4OB 4J7CA 3GFHA 2MZQA 2RVJA 3DXSX 2CPXA 1GMVA 1PAEX 3CTRA 3SDEA 2XNQA 4JI7F 4O3RA 3EICA 2CNKB 3NBPB 4KHPJ 2V69A 3CNQP 4ZKAA 4MH8A 1T03B 3T41A 4MT1A 1BD6A 2XCPA 1OYDA 2KKHA 5KG6A 3NGTA 1KN6A 5E41A 3NXZA 2Z2ZA 4TKTA 1WWHA 4DPYA 1XK8A 1B64A 5GAGU 2YNIA 4J9VA 4X4SA 4R8UA 4HVZA 3GB0A 3LQVA 1WKKA 2SXLA 1OY9A 4EZ6A 1ICEB 4ZPVR 3ZTOA 4FYWB 2DGSA 4YFUA 1T0TV 5CHCB 5M2RA 4USHA 4OYWA 3C8YA 2HMIA 3RJMB 1WI6A 4JOUA 2CKWA 1S9GB 4KPYA 4NLUA 4PWWA 4C48A 1IM4A 4CZCA 2WSEC 1T3NA 1UWBA 3EGZA 1N6QB 5ETKA 4MIBA 3Q8VA 4ZLLA 2W24A 1FDNA 4OHXA 4DEZA 1GFWB 3PIPQ 3R5JB 2CQ3A 4B3RJ 4DFJA 4PWUA 2OGUA 4J9MA 1W7WA 5KG1A 4NWBA 2BXJA 4J9SA 2IRYA 4CLYA 1CJUB 4LSLA 5K8NA 3M9NB 4OLPA 2E5LJ 4L75A 3HHLB 4L3KA 4F3OA 2UXBF 2WCXA 3KK1A 2HFVA 4WU2A 1LW2B 1U8SA 1FNMA 4ZP9A 3TAQA 2HYIB 3IO1A 4K0KF 4Y3CA 4X2BA 1F5BA 3AAWB 3FEXB 4QWCA 1FWLA 5I42B 5D0GA 3LPEA 2X3DA 2LP4A 4DFPA 1SJFA 2KDOA 2ZC4A 4WIQA 3I96A 1QAXA 4USKA 2B5JB 3F44A 3BSAA 3S6EA 1RAIB 2CZVC 1PG5B 2ATCB 3BKTA 4J9UE 2EWHA 3EWGA 2FHJD 4DF8A 4MFBB 4MKVA 2H51B 2VB6A 1Y00A 2MLXA 1R0AA 3EVOA 2HBYB 1ZETA 5RUBA 1VRTA 1RHMB 2EC0A 2VFSA 4C8LA 4YY3F 2HZVA 3R8YA 2ZM6J 4N8OA 5F8MA 1AYEA 4UF4A 2Y8WA 4X4OA 1ZM4A 1P27B 2I9SA 3BGOP 1JJ2R 3P5TL 2WAQD 3GILA 2QL5B 5EWEA 1QY7A 2RU9A 3PHEA 1PAUB 4ZCMA 1RT5A 3AJ1A 5K8OA 1BLUA 2B56A 1BQNA 1LFWA 2FJEB 5LMUF 2XZWA 5LSLA 2OELA 3R6GB 4KFBA 2CQGA 1PYTA 1N56A 3TI0A 3FZ2A 1MMDA 3GLJA 1RB0A 2FVRA 2EK1A 3GYNA 4F7VA 3JSBA 2RHQB 3P45B 4DR2J 4LFAJ 2G13A 1C1BA 2HHTA 1ELOA 3TZWA 2HHXA 1T05B 3I5BA 3ILLA 3AFGA 2Y8YA 2CG8A 1U2FA 4TU8A 3H98A 3PJ9A 2FJXA 3GFXA 3I5AA 2DNMA 3DM2A 2B0GA 4A8WA 5IS2A 7FDRA 2FY8A 1B3TA 1QSLA 2HFSA 4DUZJ 3Q22A 4YDXA 2M9KA 3ZZZA 4JUZA 1U1KA 1VRUB 3QAEA 4USTA 3OFGA 1OSDA 5DLGA 2M7SA 4C11B 2ACYA 3KNAA 1WSVA 4O44B 4LFCJ 4AUKA 4CWBA 5J2MA 1MLAA 1OQ6A 4RW8B 2ZBCA 1XMQJ 1TZ0A 2MZ1A 2IIHA 3VGSA 2OKQA 3FC9A 1C0UA 3AY0A 3TX0A 5FLXU 1SKSA 1NRKA 9ATCB 5BR8J 3EYZA 2R2TA 3PW0A 1VQYA 4DV7J 5CAAA 5HBMA 2XI3A 3UD3P 3O3LA 4NYPA 4WWSA 4J9RA 2IFXA 1QTNB 3MR5A 2X1GA 5HLFA 2IYGA 3ZXWA 5T7LB 1RTHA 1NSQA 1OY8A 3RBXA 2DPIA 2CPZA 1IKWB 2VQEJ 3OUYA 4R25A 2PD1A 2BA9A 3MAAB 1FTRA 4YB5A 3R27A 1JXLA 4OZ5A 2UVVA 1KOOA 2KH9A 1CQMA 2HLTA 4FXWA 4M5DB 3FKBA 3KHHA 2UZAA 3X1LB 5HQ8A 2R2SA 4PQAA 3ADAC 2HEKA 3IR6B 1L5UA 3RRGA 3AB2B 2XM3A 2VG6B 2ATLA 4KB7A 2IJNA 3TEGA 3MTJA 1M5PC 1XWLA 3H25A 4K4SA 2MKKA 2VH7A 4I6AA 3FGVA 4M5MA 1PO6A 2WHOA 2WSCC 3GYGA 3T9NA 3TVKA 1TL4A 1YBTA 2Z4PA 1JLCA 3RUBL 3MEDA 2GV1A 2CQDA 2YNGA 2QLBB 1JJHA 1MWQA 2HIQA 2R7VA 4ZCKA 3H5XA 5ETNA 5J1PA 2QA4S 1HA1A 5LOQA 1NPKA 2ZH8A 3Q24A 4PUOA 2VHGA 1RUSA 3LP2B 2N7CA 4F4YA 4RNHA 4B9TA 3G2XA 3N4WA 4F67A 3V4IB 3DMJA 2C3PA 2HRTA 1XIQA 1NNDA 1RAAB 3M05A 5H1SV 4MJKA 2YQ0A 3BGRA 3M8QB 3PXGa 3R2DJ 1DHMA 1IBKJ 1S1UA 3KMQA 3FCWA 1D8YA 4C3MA 1VR6A 2CDQA 4U6PA 4DV6J 2XTJP 2AGQA 2IAJA 2BANA 2AEMA 2GO8A 4JYAJ 2UV8G 3M8YA 4NLYA 4AQYF 1X60A 2B9XA 1S7IA 1SQEA 4RW9A 1HARA 1RTIB 2IA0A 4ZPDA 2MQNA 5KFAA 2YX1A 4KH1B 3H90A 4U7CA 4FDFA 3MM7B 2C3MA 2PT0A 4ED1A 1JJ4A 3HT3A 5H9EK 1RTZA 3V4MA 1MU2A 1HBNA 2YH0A 1ZM9A 2OFHX 3TR5A 4ER8A 2ASLA 2XWYA 5J2QA 4N7TA 4QOTA 5HK4A 2LU2A 4AE5A 3HHKA 4TXSA 2HS0A 3SDEB 1PBAA 3KJNB 2CNLB 3R9LA 2V50A 4ED6A 4A48A 2PDAA 4MIAA 1YHQS 2DRAA 4U95A 1X9MA 4RR5A 5IV4A 3DRXA 2JRSA 3FCHA 2AX1A 3CJ4A 1DTQA 5HVGA 3MPDA 1R8AA 3OR2A 1P6TA 2MSSA 2IVYA 2QRRA 1FX4A 3OFFA 3QRQA 4DXLA 3M2RA 2YNIB 4R8UB 1RWXB 1KTQA 4ZJQA 3FFIA 3Q8RB 1HWLA 1XR7A 2BM0A 3LWLA 4OI0A 1EQ0A 1VS3A 3HULA 1N5VA 2CWKA 4IDKA 2XMWA 2CJAA 4XDDA 3EMTA 5D4OA 3BR9A 2IC3A 2XLKA 1HD0A 3EDRB 4X64F 4JV5F 4YB1P 1H6KX 1WOPA 2J9CA 1L3VA 2BQUA 5A8WA 2HMIB 3HSGA 2OPPA 2ZH2A 2JVRA 4P7TA 1WG1A 2K7JA 2O3DA 2FHKA 3QT5A 1U6FA 1UWBB 2GHVC 2CWXA 2EFPA 1VQPS 5EHHA 4ZN1A 5CYQA 1RBLA 2ZHBA 3KLEA 3D2WA 3PX6A 3CJ5A 2GQCA 1Q5VA 2VA3A 4DR7F 4Y00A 1U0SA 1IQZA 3DRRA 2HBRB 4B9LA 2EI5A 3LH2S 2HHHF 1RAOA 3I5CA 4W98A 3CDAA 1IBLJ 4LSLB 1Y3KA 2ZNZA 3FVYA 3KK1B 3I4HX 1LK7A 2NPFA 2CQ2A 3VAIA 1XQIA 2KI2A 3IGVA 2H5IB 4JI8F 4B3RF 1H2UX 1HNXJ 4IH7A 4W90B 3BM7A 2WVDA 4C8ZA 3QJPA 4OHWA 4YEAA 5CZVA 2AYGA 3NAIA 4DV2F 3RW6A 2A6OA 4X4PA 1BY9A 3M6WA 3WIVA 1MMNA 1U2RA 1ZAXA 7FD1A 3EPGA 2FZKB 1R27B 3BBCA 2E7WA 3N6MA 5MAOA 4EI2A 3VZHA 2R9LA 1HNZF 1J5OA 3TW0A 5GAEU 3EM1A 3QZ7A 1R0AB 1KTVA 3QIDA 3KG0A 1S77D 4FKYA 4EO8A 1VRTB 3D6FB 3Q8YA 3A3NB 3BGUA 4NA2A 2RIJA 2IYIA 1TFWA 1TKXA 4MK8A 2M8DB 4EK2A 4DUTA 3UDVA 4A8XA 2IDEA 5DQIA 2OMLA 2VKZG 4PWDA 4ZPCA 5HMZA 5KG7A 3V6DA 5IC4B 1AZSA 1WHXA 5GADI 3OR1A 1FFWB 4PABA 2FZGB 4ANEA 1RT5B 4IOCQ 5CABA 1ZS6A 1BQNB 1RU1A 3AH6A 2CAJA 4LSNA 3ZTPA 3I4PA 1ZA2B 2HQDA 4L6V3 3TUJC 2R8KA 4EUVA 3PRDA 3L3CA 3R3TA 4CO4A 1UMJA 2G2ZA 1OIAA 1NK5A 1RWVB 1VCTA 1Q86T 3W65A 5L9NA 5ETRA 4TYAA 2HK2A 2QMUB 4OI2A 3S1TA 1GTHA 2CZ9A 1Z4UA 1C1BB 1UETA 2CQ4A 1KVIA 2E29A 4G1PA 1RT1A 2RE1A 4C8KA 2D3OR 2NXJA 1DQ9A 3CMQA 5LJ5Y 3NGSA 3GJQB 1QUPA 4RWXA 1U8WA 3DM2B 2YWWA 2GAHC 3KHRA 2I5JA 2LXIA 3NKYA 1VGYA 4LFAF 4YQWA 1D3WA 2J5AA 4DR1J 3I82A 1UVKA 2VFTA 1NH8A 5J2PB 4G3IA 3UCGA 4TY9A 5J2MB 2QTWA 3HZEA 4OX8A 5HI7A 2EFGA 2XHCA 1YLXA 2BVZA 2DITA 3AODA 1C0UB 2OPRA 4R0JA 3GE9A 2KJVA 1OWXA 1WF1A 4KH0B 2DVIA 1PIEA 1O51A 4C8YA 1VK3A 1NBEB 2LXUA 5HBMB 3P5BP 2YWKA 2J0QD 2V9KA 4DR3J 4A8KA 5KT4A 5F8LA 2OO4A 3IR7B 5HLFB 1XMOF 1RTHB 2R7XA 1WOOA 3V81A 1LW0A 4A8SA 2EFNA 3WDOA 1VBKA 3DHWC 3OUYB 1SVDA 3HM9A 2B4PA 1X0PA 5BR8F 3EX7B 4OZJA 1MN9A 1UEUA 2JC0A 2YY3A 4DV7F 3MPYA 1KHWA 3EZ5A 2JWNA 4IFVA 3CUNA 4AL5A 4OX7A 2KM8B 2RQCA 5D4NA 5B0GA 1QAJA 4LF9J 2HQFA 3VF0B 1RADB 4NLXA 5DJBA 4WTYA 2MHNA 4QBUA 3W5XA 3O2IA 4X4QA 3HPOA 3MR3A 2G2YA 2WB1D 1DTTA 1RA6A 5SZTA 4NXMJ 1SUQA 1ZA1B 2OHDA 4YUDA 3D9BA 1VQ4S 1EHWA 3IG1A 2QE5A 2HSEB 1UFLA 2RHSB 1F1BB 3ZZOA 3CJKA 3CCES 3LP0A 2D69A 4LBHA 5F3TA 1JLCB 1AB8A 3MEDB 3L4BC 4K7QA 2W9AA 3AJ2A 4TLRA 1I3OB 3M2UA 2KFNA 5KG5A 3NNAA 1K1SA 1AFIA 2B8QA 3K5OA 2FVPA 4GKKJ 1LKZA 4FVMA 1CC8A 8AT1B 3Q2TC 1QVFR 3IM9A 1FT8A 4PUOB 2MLYA 2KG1A 4DV5F 2DR7A 1VJQA 2F9JA 4DU8A 1LFPA 3ISZA 1GMWD 3F41A 1MMLA 2E5HA 4K5SA 3DMJB 1HWKA 1TTHB 3D0GE 1NSPA 1X5PA 3V2UC 5KG3A 5L1LA 3HI9A 3BGRB 5E7OB 3AHPA 1NKBA 3R5GA 1S1UB 4UUWA 4KSEB 1Y4ZB 2E5GA 5HP1A 4N8NA 3ITHA 3GPAA 4OJHA 1SC3B 3W9JA 4TYBA 4JI5J 5HL7Q 3NP5A 4FYVB 2IAJB 2RKIA 2BANB 1RWMB 3PHTA 1CPZA 3DLJA 3G82A 1T8EA 4DV0J 3GONA 4L74A 4RW9B 3CCZA 2VJVA 5CD4H 3TNVA 3W8PA 1XTZA 5E3RA 2C2KB 4QR0A 1QE1A 1HI0P 2ZUGA 1AUDA 4GKJJ 5KFEA 3IWNC 3TA0A 3PJWA 4OYIA 4FPRA 1MU2B 1X31C 2MSTA 1RWWB 1HBNB 3T5KA 4OZLA 2U1AA 3I31A 2A2DA 4M5NA 2H5EA 2D3ZA 1S99A 2GMJA 3EVMA 2LQ8A 4GMKA 2DRDA 5J2QB 4JI3J 2HRUA 1F6TA 3BO2A 4FBUA 4DR6J 4B08A 3GJTB 3PJXA 3C46A 4NLWA 3VWSA 2L41A 2XMMA 1GEHA 5CCLA 1DTQB 3BQ0A 3DLEA 5KFPA 4OV6A 3G6XA 3OR2B 3A3OB 2UU9J 4NCAA 4XK8C 2CFXA 5HROA 1VC6A 2PI4A 4IFYA 1FEEA 1YRTA 2BEFA 1TR0A 2HVHA 2GC8A 3M2RB 4P2MA 5HAOA 3WX4A 1WDDA 4DPXA 2NYIA 3TAPA 3LAMA 4YN3B 2XSFA 2OJ3A 1VYAA 3FFIB 1IKVA 3TVZA 2YNFA 4C0HA 1U25A 1VBXA 4DFMA 2YX4A 1MWYA 2R7SA 4YR0A 4N56A 4IDKB 2W4PA 1VK8A 3ZZRA 2IC3B 3C66A 5F0WA 3MEGA 1I94J 2MPUA 1RK8A 2MQMA 5A8WB 4NRUA 2OPPB 2V4RA 2DIVA 5A2QY 3MDFA 2OAUA 4F3MA 3W9HA 4I0WA 3ENWA 4X4NA 2BKOA 3FUYA 1V6HA 4I2PA 5IM0A 1JLFA 4CP5A 1F3VA 2Q43A 3O5TB 5CYQB 3KLEB 4CCHA 4WP3A 2BM1A 4F4KA 1WC4A 1HI8A 4GC6A 3PVXA 3TJAA 4DLEA 1X4EA 3DRRB 4MAKA 4BC7A 3CD5A 3AQPA 4CLUA 2MMYA 4NE9C 2H48B 3Q8QB 3G6ES 1PJ7A 1WD6A 2ZWOA 2CJYB 5DGAA 3MD3A 4DU7A 4F26A 1KVJA 1TKZA 3I32A 4FXVA 2GNKA 3MAHA 4CM0A 3GJRB 4P72A 2W4DA 2BJEA 1HL6A 2VD3A 3VZIA 4I64A 1WF0A 4H54A 1RBOB 4RBUA 3DDIA 3DI6A 1FK9A 1R7IA 4OMFG 4C0OC 5DETA 3O8WA 2OD6A 4CQ1A 3QWUA 2YBVA 2V0NA 2C2ZB 2RDJA 2KVQE 2ZZNA 1RCOB 1EP4A 4NLTA 2O5DA 3CD6S 2MY8A 2VC1A 1Q8BA 3TWZA 2XYPB 3VAJA 1TKDA 1J5OB 3CD0A 2CPYA 4LF8F 4DPOA 4WYWA 3AOCA 3R5DA 1TKXB 4XPEA 1FKAF 4FKXA 5KFLA 5D15A 3ZFVA 4A4JA 2NZ4A 4PWDB 3MPWA 3FRZA 3V6DB 3E8OA 4OYPA 2NZCA 1OQ3A 1Z2LA 1AZSB 4AXIA 3TZYA 3OR1B 5GAHI 1JK9B 5G4DA 4LSNB 4HI2A 1J5EF 1RJJA 1MN7A 1PILA 4DDFA 3LUYA 3EJMA 3CO9A 2HIYA 4JV2A 3VGVA 4A8OA 5LMNJ 2O1PA 3IRWP 4PG5A 5B09A 3CDUA 2MQOA 1I51B 3M6VA 4U8VA 4LR7A 3BSNA 1RT1B 4K5RA 4J9PA 3AB4B 3D5MA 2B9EA 2OD4A 2LEBA 1X4GA 2C28A 3CJRA 3CIZA 4NEYA 3SQGA 2RQ4A 1NSAA 1T9YA 4D3HA 2I5JB 3CDWA 3MEKA 3RB3A 1EX8A 4UOHA 2JJ4D 3K89A 3C16A 4B9SA 3MM5A 1ZTTA 3JQJA 3HHLD 3OW2R 1WEZA 5I4MA 1X5SA 2XMUA 2A10A 3CCRS 2XS2A 3DRYA 3QGIA 1S97A 1XEZA 1WEYA 1KQKA 1JWWA 2IRXA 1KRPA 3FJ2A 2HS4A 2OPRB 2ZZTA 1YJNS 1KBRA 3G71S 2VJUA 1UL3A 3Q83A 4F0HA 1WHWA 2OEKA 1LWEA 4WK1A 2AJFE 3HSZA 5I3QA 2XMJA 1F0XA 2YVSA 2V2KA 3NGRA 4ICLA 4JP8A 2ZOFA 4XO0A 3V81B 1LW0B 2F63A 2P6TA 1VQSA 4DV4F 4F50A 4B3MF 2QX0A 2IHR1 5E3PA 2Z2MA 5KFNA 2EXUA 2RD5C 1Q1KA 4FN5A 4DX7A 4G1IA 3KK2A 3AD8C 4RNMA 1O8BA 2DGVA 4F4XA 1WJ9A 3HJVA 2VQFF 3M1VA 2OLWA 4IFVB 2RF2A 1F2GA 3ISNC 1YG0A 3OXFA 2XSJA 3SFUA 2Q3PA 5D4LA 3QJLA 3I9V9 2GO9A 5HMYA 2IM2A 4BBYA 2JLGA 2FLLA 2AWZA 3TUZC 3H8YA 2BX6A 2FB0A 4WP8A 3V6HA 2P9CA 3PR4A 2H3EB 5H9EJ 4ZVTB 2VASA 3CMES 1CJTA 3OTEA 4F25A 1RGVA 1DTTB 1WACA 3GV7B 2WB4A 2DNGA 1SUQB 4TNOA 2B8PA 1IR0A 2FDNA 2CZ4A 1K73T 2L08A 3IG1B 2FVQA 2M0GB 4NA1A 3CJKB 3LP0B 5DDQC 1S59A 2ZITA 3D0HE 3CCVS 3M2UB 1Q8IA 3LGMA 4TVAB 1M1GA 1Z1ZA 2QGFB 3N0VA 2LXFA 3CCMS 3D3BJ 2VONA 3BB5A 1VISA 3LPYA 4CIOA 3N01A 1H0HB 1KWMA 3M8SA 1N36J 3BGFA 4ZOSA 1R8BA 4OX9F 3QGHA 2AV5A 2J6TA 3BSCA 1W26A 3G9CA 4EYHB 5D3GA 2QMWA 3A13A 1VDHA 3OQ2A 4P75A 1O0PA 3CJ3A 4WE1A 2Y1IA 5HP1B 1M5KC 3A8IA 4HHHA 3ITHB 4GKKF 1DAXA 3EPIA 1F60B 1RT2A 3KLHA 2RKIB 1XNQF 3H5SA 1KSPA 5HATA 2WBRA 2LMIA 3G82B 3ZTRA 3GQCA 1JX4A 1U6BA 2XY7A 4HDGA 1PCAA 3QLHA 4NLGA 3H4DA 3PR5B 3OHBA 1QE1B 1NM2A 3OL8A 2YPZA 2R4FA 2KZZA 3KXDA 1T7PA 3OBIA 1H74A 2EC2A 3QT7A 2R7WA 4JI5F 2BR0A 1SJ4P 4AL7A 5HSPA 1N0UA 5EWFA 2QMXA 4OI4A 3NOCA 5F0UA 3OTOJ 1Q5YA 3T5HA 2EW9A 4KR0B 4NLRA 2HZCA 3BGLA 5KT3A 3QFHA 1NJXA 4KO0A 5SUHA 3SSSA 6FDRA 2C2MB 1NPPA 1S0OA 4QR2A 4K8RA 2QL7B 4O3QA 3DLEB 2B7BB 3QSYB 4J91A 3OSPA 4QYZK 2DHGA 1WKJA 3B4MA 5HROB 2XY6A 1X4HA 4QW9A 3FQLA 2ZH7A 1HBOA 4IFYB 3H2UB 1WHVA 2E9ZA 1IQTA 1C4AA 3UDLA 1OS5A 4DR6F 2YNFB 1R89A 4WTOB 2V4JA 2JEIA 3M6XA 3RBZA 1JLBA 3R97A 3SFGA 4K4VA 3T5LA 3BJYA 2H1YA 5HANA 2CJBA 3KTQA 3US5A 2L48A 3MEGB 2UU9F 2DRBA 2UXCF 3MAQA 2VFVA 4N41A 4BDPA 4MK7A 4M5JA 4G1QA 4DSFA 1VHFA 2G0CA 1BMQB 4RLEA 3DNCA 3C6TA 1DLOA 4ECWA 2OEMA 3I0SB 3PW4A 1C1CA 2BJDA 4I2PB 4UOGA 4I69A 1Q0NA 1WC3A 1H7WA 1DZ5A 4QPTA 3NS5A 1FHTA 4DX5A 5B08A 2B4UA 5AE1A 4YDDB 4ZHRA 2F5GA 2CIMA 3FCVA 1VQ9S 2RNEA 1PJ5A 1HBMA 2DNPA 1CULA 4USVA 4JI7J 1TKZB 5D0RA 1H2VZ 1JB0C 4CO3A 3NG8A 3K17A 4ERDA 5KT5A 2VPXB 2M5YA 4CO2A 2Z58B 2MKJA 5KFOA 3DI6B 1FK9B 1I6JA 2VBZA 1KFSA 3MI7X 3FK4A 2ZJQQ 4CLTA 1L3KA 1VRQC 1CC7A 1YDLA 2CQIA 2CRLA 4NLQA 4AYBD 2V34A 2GQQA 4O4RA 1EP4B 4U67Q 4L76A 3TQEA 3W2WA 4RU9A 4DL2A 4WZQA 2D41A 1DARA 4ES2A 4TQRA 2FHMA 3K5PA 3BO4A 4OX6A 1S9EA 3PW7A 2FJDB 5JVHQ 4ZPBA 3TVYA 4DQIA 3TJ8A 5ETTA 2G1DA 4QWAA 1PC5A 2ALZA 1RAJA 1KQGB 5L46A 2UXDJ 2YH1A 4NXNF 2X3GA 1NHKL 3KLVA 4M5KA 1A7GE 2X1AA 2XMAA 3GSIA 5LSOA 1BC6A 2I6WA 4E8UA 2B9YA 1SH3A 2UXBJ 1TV6A 3D7SB 2ZDOA 4LMZA 3SSRA 4W92B 1RBAA 2JZ5A 1NB2A 1PKUA 3UDEA 2F8EX 1IVZA 2CJQA 3N6NA 1KS2A 3L7OA 3C6UA 3GMGA 2PO4A 2M70A 4CM2A 1NDLA 2P9EA 2E9TA 4ZN3A 1O6XA 3FSYA 3DDNA 2XS7A 3RW7A 1FVSA 3C16B 3MM5B 3LALA 2V4QA 5GAGI 1LNQA 1JXVA 3U1NA 4HHUA 1UP1A 1E6YA 2ZZMA 2R7RA 1Y3JA 4YY3J 1EQMA 4ECZA 3THVA 3F56A 1RYSA 3GWCA 2AZ1A 2ZWPA 3IP0A 4A47A 2N3OA 2JDJA 5KFQA 4WK3A 3B8HA 4EO6A 3M8ZA 2X1BA 4P73A 2VICA 3BSOA 5LMUJ 3MUVP 1LWEB 5HQMA 4ECYA 3WQPA 2OSRA 2XG8A 5HN0A 2WBMA 4EWTA 5L39A 1QM9A 4O3SA 4ICLB 3RAMA 2EFOA 1NKEA 2GVZA 4LJMA 1ZPVA 4EYIB 2FPHX 3I9ZA 4XIUA 3M30A 3K7RA 3NWRA 3KK2B 2E1MC 1M5OC 1JLQA 4URSA 3M1VB 1S1TA 2RF2B 2RB7A 3HK2A 2VA2A 5ITHA 2PFDA 2AHOB 3G8TA 2DK2A 4MTPA 4TLQA 3HKWA 3W7BA 3IAS9 3Q23A 4P71A 3NAHA 3FRYA 1CS4A 1CJTB 4WFYA 3OTBA 1GXLA 3CXCR 3EGVA 4FF3A 2CYYA 4WP9A 1ZTWA 4OFZA 3H5UA 1FJ7A 4TU9A 2HHVA 4DOZA 3JS9A 3MR6A 1QLNA 2ZOGA 3BDPA 2ADCA 3IN5A 1GX6A 4Y34A 1TL1A 2CJKA 3UN3A 2KHCA 1MWZA 1YBAA 4EMDA 2Q6CA 2ZJRQ 1VQ5S 3MCNA 4E2FB 1FRHA 1FESA 3ZNUA 4EBCA 1I5OB 1REVA 2BACA 5D3GB 4F4WA 1FRKA 4ES1A 4LR8A 4IR1A 4WE1B 4A8MP 1QDUB 2KXFA 4WZMA 5HVHA 2CPDA 3OJSA 3PRBA 2PC6A 2N7YA 3DU5A 1RT2B 3TAMA 2N82B 3KLHB 3U1LA 5KOXA 3TP2A 1N36F 2BJ7A 2LYVA 2IVFB 4OZ3A 5T7LA 1LK5A 4DZ6A 4ZVOB 3R2CJ 2PA3A 2ZEJA 1ZAWA 1AROP 3QLHB 1S1VA 1YITS 1MG7A 5A76A 4CNZA 5M2UA 1S6UA 1K1QA 2HVZA 2G1HA 1NDKA 4ZVSB 4WPAA 2LEPA 2E44A 3FBCA 1XR5A 2BBEA 1A6LA 2M3DA 2LEAA 2PI5A 4I56A 2PIIA 4DHVA 3QZ8A 4WFBQ 3TARA 4OHYA 2AJQA 4N47A 1RU2A 2ZH1A 2VPYB 4KO0B 3HVRA 2JVOA 1HQ2A 3CCSS 1U1NA 1RXOB 2Y3YA 3OLBA 2DD8S 4IRDA 1JKHA 2EFVA 2WVFA 4HR2A 4ZCIA 2Q66A 1YJUA 1RHUB 1SJ1A 1HBOB 1N4LA 1OY6A 4ZITA 1HQEA 3V5RA 3BYRA 4DPWA 1S7HA 4P9SA 2NLWA 1XC9A 2V4JB 4NZ6A 3UR0A 2MHEA 2POKA 2XEXA 4LF7J 4MK9A 1JLBB 4FYDA 1RT4A 2X7IA 4CTAA 3PEHA 1FCAA 3TOQA 3R6LB 2XBPA 1K44A 2D9OA 3ILJA 4RBTA 3PO4A 1HBUA 4RPFA 1YTYA 1SXLA 3R5CA 4PG7A 4QR1A 4AQYJ 2UVRA 1T95A 3CDBA 4G1QB 3CULA 1QAIA 1RAGB 4UZCA 4B3TF 1KFDA 4K2XA 1BUXA 4MIWA 3C6TB 1DLOB 8RUCA 2DNHA 5J1EA 1N5YA 3M4XA 1C1CB 3MFIA 2BDPA 2I0XA 1FA0A 5HJYA 1RDRA 1ZBTA 5KT7A 2K2PA 4PR6A 5A2QU 1HFEL 1ZH5A 1WSRA 2R8IA 4ZHRB 2UUBF 1UW4A 2WVEA 1S6PA 3BQ2A 1BGXT 4RW6A 1RT3A 4WFXA 3DLBA 3MGJA 2GJIA 1NZAA 3ZZUA 1HBMB 5D77A 4NL5A 1T94A 1CULB 2LA6A 3GIRA 5KFHA 1NB7A 2COLA 4DSLA 4H4KA 5ETQA 2H5JB 2J6UA 2V5HG 4M95A 3MEEA 3RTVA 1FD2A 2Z8QA 4KE5A 2XB2D 3M8RA 1WC6A 3OFEA 2CJ9A 3B54A 2VDIA 3M8PA 4PAAA 4CLKA 1HR0F 2BKNA 1HNVA 4Q45A 5EX3A 1D9AA 4LF5F 4F8RA 2UUTA 2HG4A 1GQEA 4KAIA 1MSWD 5DM7Q 1ZAVA 4F36A 2KFZA 2RRAA 3O1LA 3ETOA 1N34F 4LR9A 2W7AA 3UD5A 5D0HA 2PA8D 3W2WB 3HHLC 4X64J 4Q5VA 5KFRA 3H40A 4QPXA 3WC2A 4JV5J 2K1RA 4AXJA 1X9WA 4IKAA 2CXEA 2OSQA 1S9EB 3ZZPA 2JSXA 4OIXA 2OP5A 4KBIA 3RB0A 2ZKTA 3GSDA 4CLZA 1X4BA 2W9CA 1QUVA 4ZVPB 4YHHF 1VC0A 2O66A 5KFUA 3NWGA 1HQUA 1RZMA 4WCEQ 4DR7J 4RX6A 4HDHA 3VAKA 2ZH6A 1N5QA 2IY5B 4LRAA 1IJEB 2HHHJ 1XR6A 2C1EB 4WBFA 4M94A 2FVCA 3N5BA 3IFEA 4JBCA 2BZ2A 3RZAA 4QCLA 2F8HA 1TV6B 3JSYA 5E3CA 1UFKA 2UXDF 1IWGA 2DPJA 2ZH9A 4H4MA 4JI8J 5AXLA 3FSIA 2JFDA 3VGTA 3DFEA 1M5VC 1HMVA 2K3IA 3P49B 1SKWA 4Q8EA 1RE1B 1N0VC 4DV2J 3PEJA 4DSEA 3JAMY 3C6UB 1UJ4A 2CQBA 2N3LA 2G4BA 1WG4A 1SJ3P 4ZS6A 1QAYA 3W2VA 1HNZJ 5DZ7A 2ZDPA 4HT7A 4LVNP 4B9VA 2AJ0A 2W8KA 1SL0A 1V5VA 2FLPA 2K3KA 1S10A 1YJRA 1E6YB 1F5AA 3J7A1 3GG0A 1WF2A 5BYSA 2V94A 3HO1A 3PYGA 3PZPA 4C8MA 2A1BA 4U96A 1NJZA 4TU7A 4LRCA 2XGQA 2HGLA 2ZHAA 2LQJA 1HWIA 2EVZA 1N33F 1LWCA 5LT5A 1UJ5A 3RAXA 1SBRA 2FUG9 1WTFA 3QQCD 2VFRA 1QVGR 2QLWA 1ITPA 1UJ6A 1M5SA 5B7WA 2GZOA 3GIKA 4U9RA 3K59A 4PPZA 2C2NA 3KK3A 1DURA 2DR6A 3UVJA 5KFCA 3MMJA 5ETLA 1RP5A 2GVZB 4QIEA 1U4BA 4X65J 4DI6A 1S6OA 4KQZA 1KQFB 3CMAS 1LWXA 4UY8T 4K4YA 4RW4A 3VVUA 2W25A 1Q82T 4DG1A 3M30B 3MFHA 2H54B 4GRSA 1NPRA 4DSIA 1JLQB 3DLLQ 4M5IA 5GMDA 1S1TB 4Z37A 1SJRA 4NI2B 5AXNA 3SCJE 1PBUA 2DXDA 1N8RT 3PKYA 3X3UA 5IXUA 1VQLS 3K57A 3BBBA 1CS4B 4JV0A 3KLFA 4IRKA 2AEJA 4QIFA 2DR8A 5F8NA 1FXLA 3KJQB 4NA3A 4DMZA 2YWFA 3CJ0A 1RAEB 2MQQA 1N88A 1O5JA 3J80Y 4B02A 5IFMA 3AT1B 4DL7A 1H38A 2EBGA 3I0RA 4CLWA 1TL1B 2DNRA 1VIOA 4FVCA 4QYZJ 1VMBA 3R1LA 1XN9A 1T02A 5J2PA 4CNYA 4G6VB 1XMOJ 2APOA 3HCXA 4ZCLA 3W61A 3UE2A 3IWXA 1REVB 2FLOA 3BQ1A 3Q8SB 4DL0C 3GCWP 4UW2A 2CPHA 3NL0A 4QYRA 1KOHA 3WIUA 1YX2A 3BPSP 3ONQA 2V68A 1CSJA 2J9DA 3TAMB 2B7CB 3IA0A 3JXOA 3KMSA 3JSMB 2JNJA 5JXSA 1TUGB 2UUWA 2B6AA 4JI6F 1U45A 7AT1B 3PIOQ 3KG4A 2AQ4A 5L38A 4CH0S 2CQHA 3EZOA 4DUYJ 2RS2A 1S1VB 4M5HA 4XAKA 3I87A 2GHWA 1N32F 1RQ0A 2VFUA 3UW1A 2RILA 3EDQB 3G96A 2IM1A 1X4CA 1R8CA 2D3O1 2FHOB 2ALYB 3W9IA 4K4UA 1GX5A 1QD1A 2ADBA 1TFYA 4LF6F 3KLGB 4LFBF 2BJ1A 3RGIA 4PG4A 4LT6A 3ZO7A 1FTCA 2UUCF 5K20B 3FNNA 1JKHB 4DL6A 3EXCX 2YQ1A 2F40A 1FXDA 2JEJA 4MKAA 4DV5J 3IS9A 2Z57B 3WC0A 2R8JA 5GVQA 4KC5A 3HT0A 1YIJS 4QIGA 4DBQA 5KFDA 3CJ8A 1CBKA 1HQEB 3MCOA 4JI0F 5F8JA 1RWNB 2PE8A 5CYJA 5CA5A 4HH0A 1IN0A 2MY7A 3HFVA 1VQ6S 1DY3A 2G9OA 2P5VA 1RT4B 3PYEA 4CTAB 2I1RA 3PW5A 4C4WA 5ETPA 2W2MP 3N5FA 1ULRA 1HBUB 4QJVA 2YNHA 3PKMA 3UNYA 1RHRB 1APSA 1CLFA 4YB6A 3CGIA 2YKPA 3GR0A 4F4AA 5J1EB 1N5YB 2XO6A 2WOMA 2VC0A 4RNNA 4BWMA 1H98A 1RCXB 3K5MA 3GJSB 5KFIA 4LF7F 3OLAA 2HFUA 2JEGA 1NU4A 3A8EA 3KNGA 5F8GA 1S6PB 4MYTA 2QSFA 2X51A 1JLGA 1R6VA 4RW6B 1RT3B 2Z2YB 3NGUA 2KL8A 2R8HA 1TK0A 1T3OA 2HQIA 3D54A 2E7XA 2GIFA 5JMNA 4OJ3A 4X4RA 2GIQA 4X4UA 4DN9A 4WFZA 1LWFA 3J81j 3MEEB 3NLCA 4U7UK 3P8BB 4ZLPA 3CJTA 2VBYA 3M8PB 1YWXA 2O67A 4O3PA 1HNVB 4YOEA 4LBIA 4Q8FA 4N76A 1S4EA 2W4CA 1RAFB 1UTAA 1X8DA 1KKHA 4Q2MA 2B3TB 4Y2KA 1U02A 5KFVA 3DOKA 3ENQA 1LOUA 4CLLA 4MKBA 1FRIA 4C97A 5KFYA 4LVOP 2A18A 3EZUA 5ETMA 2BYCA 2K1RB 4P2SA 1G6BA 3HKZD 4BC9A 1IR2A 1HWJA 1RKIA 3N79A 3QPIA 1T9VA 2W9CB 2DB1A 4ED8A 3MMAA 2EKYA 3BREA 4NLDA 4FNHA 2P6SA 1HQUB 2HFZA 2AGOA 2DNNA 5D0EA 4DQSA 1F9HA 4DR5F 4ZLNA 2HW3A 2C2OB 4QWEA 1L3UA 2ZJPQ 2ZC3A 4ETZA 2BE2A 4ED3A 1KONA 4HI1A 1FI4A 4LRDA 5LSRA 4J9OA 3HFKA 5G0RA 1DBDA 3R1HA 2V63A 3AA8A 4H4MB 4DCJB 5DDRC 2DGWA 3WZ0A 3UCUP 2GJ2A 1SKRA 1HMVB 1Y9OA 1FX2A 2AP6A 4KY3A 2DYAA 1VJWA 4BS2A 3M6UA 3MCSA 1RACB 2MKYA 3GIIA 2XYGB 3QGPA 5KG4A 3CCTA 3PDNA 2FJWA 1EETA 2E7VA 2VOPA 1V3ZA 4KGKA 4MMOA 5A8KA 3OSNA 2Y1RI 3W2VB 1T9UA 2QSWA 5DG7A 1E6VA 3BPDA 4P74A 2VBWA 2DTJA 2YWGA 2UP1A 4LF8J 1U1RA 4M5GA 3L7UA 4LF4F 2QL9B 3TJ9A 5GMKa 3PX4A 3BZQA 1P1LA 2RS8A 2AZ3A 3MR7A 5E33A 1IBMF 1UVMA 2C3UA 2QFIA 4PXDA 5DQGA 1UKUA 4DS5A 4P10A 2KB2A 5ETOA 1LWCB 4ZDNA 3BEGB 4ZVFA 1F9FA 5THWA 4R0EA 2PSZA 1J5EJ 4B9UA 3JTPA 2DH9A 3D6MB 3QWPA 3KK3B 3UVJB 4OYOA 1Q16B 2HLUA 3SMZA 3SEOA 3ICLA 1EIYB 1K0VA 2LU1A 3ILOA 1R3NA 3MM6A 4FF1A 4RW4B 2QV6A 1RT6A 1FRMA 5F8HA 4DG1B 3MXHP 1UEKA 3AQOA 1TK8A 3TO8A 2KYXA 1M0SA 4HH1A 3HJFA 2C3YA 5CYMA 5FDLA 2GCFA 4DWIA 2VBXA 3CCQS 1J27A 1REGX 1SH0A 3DHXA 4X65F 4CH1A 5DLFA 2VDHA 3B6BA 2J0WA 4V19X 5JJBA 2C42A 3KJFB 4YR3A 4I2QA 1XNRJ 2VODA 1UZHA 1HNIA 3HXMA 3MMBB 1ZPWX 5FD1A 3KLFB 3NOGA 4WKRA 4CYUA 4DR4F 1KP6A 3M8WA 4ED5A 3IBCB 1VLOA 2AKWB 1B99A 1VQKS 4Y2AA 4PG6A 2F7VA 3T9ZA 1MROA 4ECSA 4Q2LA 2FJAB 2XZTB 2J7UA 2VG5A 3GFZA 5HMXA 2PGCA 2WTFA 3I0RB 3KFWX 1DRZA 3LGHA 2Z2LA 5KFKA 4C0BA 3TX8A 4C9DA 3JQKA 3T1HF 5KFBA 1NMEB 4OV1A 1GTEA 3TZXA 1FKPA 1QSYA 5L9XA 1S0NA 3FSXA 3RAQA 1NXIA 4ZIVA 1RWOB 4KGXB 4DV4J 3LA0A 4B3MJ 2MQ8A 5KFTA 2KXHA 1HNWJ 3SBMA 4OHZA 5C25A 2FVSA 3BKUA 3ULHA 3GV5B 5CH7B 2ZD1A 1B0PA 2QA2A 4PPDA 5JUMA 4ES3A 4J5OA 3MD1A 2XY5A 1KNZA 2LQ9A 2LCWA 2VQFJ 4X4VA 2B6AB 1NO8A 1KVKA 2VV5A 3CIMA 2DNLA 4OHVA 5F41A 2PMWA 1HW8A 3H5YA 4CLPA 2GGPA 2QFJA 3KJVA 2LLZA 2DGQA 3ENVA 2D3UA 4CI0B 1SCJB 3ZZTA 5AJ3F 4KYZA 2Z30B 4CO5A 2F3JA 2YTCA 4PYDA 4C8OA 4A46A 2QN6B 3ZZYA 1JIHA 1PGZA 1S1XA 4GC7A 4DUYF 3BN7A 3RRKA 4C3KA 3VAFA 4HACA 2DKOB 2HWTA 4USUA 3QATA 2VOOA 1VLYA 3BR8A 1CJKA 2HHQA 3IS9B 2GIRA 4ID5A 4JI2F 3VGUA 3PNIA 4OX9J 3TANA 1OPIA 4B3OA 3IM8A 1WKLA 1NUEA 5KG2A 2CJXB 3P3DA 3HP6A 1RABB 2RDIA 3D1QA 1SPBP 2B9WA 2HFNA 1SC4B 1P9YA 3D1HA 1X7VA 2IDLA 4DV3F 2KTQA 5I3UA 1XNQJ 4JI1F 1N54B 2YNHB 3T5JA 2XGPA 2NXEA 4A8FA 1GK8A 2J9DE 1FDDA 5LL6d 2GX8A 2R7TA 2RT3A 5CD4A 4KV8A 3H42A 1RT7A 4ELTA 3SQOP 3IBFB 3MUTP 2WOMB 3J81Y 2CG4A 2K7KA 3Q8UA 3W5ZA 2FYXA 4ITSA 2WRMA 4C7QA 2BQRA 3SIPB 3TRGA 1N5SA 5JVGQ 4K4ZA 1JLGB 2HK3A 2UV8A 1TL7A 3JYTA 4NRTA 1H3DA 2XQCA 2AD9A 3RYLA 2DH8A 3M9MB 4HT5A 1WORA 1N52B 4ANDA 3RR8A 3UN2A 1YJ9S 1R8HA 1LWFB 3GG1A 4K4WA 1U1LA 2F4VF 3CJSA 2QLJB 3K0JA 1F5CA 1HPZA 3RG6A 1FNOA 2ZBIA 4OJ1A 3BF4A 2CVEA 2PMHA 1TUVA 3HF5A 2MZSA 2NYHA 4J9LA 4K2JA 2Y1JA 1D09B 2IJRA 2M2BA 4PYAA 3DOKB 3MF5A 1UVNA 4FBTA 2HBQB 3BDEA 1AFJA 1S1WA 2HGMA 5IT9Y 2UXCJ 5IZHA 3HX9A 2GJFA 3I56S 1RLCL 1QSSA 1X4FA 2MKSA 3KWMA 4PEOA 2FY1A 5DO2A 3R5AA 4LUBA 4ECQA 4F0MA 1FWKA 1S6QA 1FJGJ 2CDRB 1GXUA 5KFGA 3MMAB 3MTKA 2GMHA 3ZZ0A 4X66F 2GQ2A 2JHEA 1K47A 2IPOB 2VF3A 2XWXA 1GMUA 2I8EA 3MWBA 4F2SA 1RTDA 5BJRA 3MECA 2VZ9A 3C19A 4QW8A 2BE2B 3OL9A 2RRNA 3UR3C 4ED2A 4IRCA 3I0SA 3S01A 3CJ2A 5AE2A 2E1AA 2Z56B 5G0RB 1NK0A 1VQOS 1AA1B 2CQCA 1U7LA 4I68A 2V2ZA 2G0IA 3A8JA 3HVWA 3KG1A 3BV8A 1FJEB 2H65B 2AJ1A 1JXEA 2ZH3A 2DY9A 4Y65A 2VL1A 4ZK7M 1EETB 3T1AA 3EVWA 5T41A 4ENOA 4RW7A 1S12A 5B0AA 4WF9Q 3QT8A 5A8KB 2MQLA 3OXGA 1E6VB 4NLOA 3JAMU 4ZVRB 4IR9A 3QO9A 3MM8A 4ZP7A 3IAM9 1V9OA 3OT9A 4O0IA 4HKQA 2KO1A 4ANCA 1ZZFA 2GVDA 2IRUA 3GCXP 3A1YG 3GFYA 4NYOA 1Q79A 3K5NA 3AD9C 4RUBA 2H4WB 2J8AA 3KKFA 2Y1LB 4NXNJ 3SCLE 1IBCB 4DCOB 2ZE2A 2NUHA 2DO4A 4ILMA 1R6YA 3NMRA 4M63A 2HWIA 1HYSA 1WC5A 1CQNA 1RTJA 4B9NA 5IQQA 3J7ZT 4ZLJA 5BYQA 4QU6A 4YP3A 3IGNA 3UCZP 1QJHA 1Y7PA 2ZVSA 4DLGA 2A3JA 1TAQA 2LFVA 4E98A 1Q8KA 4KHRA 3J7YU 9RUBA 1NCLA 5IT4A 1B7YB 4ATNA 2YX7A 3MM6B 1RHJB 4F0KA 1RT6B 1KQSR 5C5JA 3NGKA 4FPIA 1D8ZA 2JEFA 4PRFA 4QQBA 4NCGA 5K14A 3G86A 2GFFA 2DY1A 2FGCA 3TUPA 5CYMB 1R0BG 5FDLB 4KGZB 1RWPB 2BV3A 3OVAA 2BKPA 1G1XA 3DRPA 2EBEA 2LDYA 2QYGA 3TQ1A 4ID8A 3C3LA 4I2QB 4ZP8A 2ZUAA 4N5SA 1EB0A 3DRSA 2KYZA 1HNIB 3J7AN 1SC6A 2DGOA 4URGA 3VAGA 2MKCA 4OYXA 2HHSA 1PC4A 1BXNA 2B4VA 3I55S 4CYUB 4C98A 1SB6A 3FMWA 1VFJA 4USIA 1JMTA 4XPCA 2DHAA 3LGNA 4ZJOA 2LKZA 1MROB 3CCJS 4DL3A 1Y5LB 3D0IE 1XNRF 2VG5B 3R5BA 3H7HB 5CQGA 3RB6A 2FZCB 1VI7A 4F3QA 1WDTA 2HNZA 3SYZA 1OSCA 3E01A 2ZBQA 5KT6A 4KRWA 5ETVA 2MJNA 3J80U 1NKCA 1FWPA 1VQNS 2F9DA 3LANA 4Z7YA 4Q0BA 4IG3A 1FKPB 4Y28C 3W62A 2CPIA 3D67A 1IUJA 1UPMB 2W1BA 3OHAA 5J1NA 4OYZA 5C25B 3VALA 1TK5A 3HFZB 4IOAQ 4FYYB 4EBEA 4U7UD 3ZNJ1 2FJBB 3SCIE 4DL5A 4M8LA 2ZD1B 2DHSA 2HWHA 3E3XA 2MQPA 1YBUA 2QA1A 3ISND 3UNGC 4J9QA 1RHQB 2AU0A 3V6JA 4ZMMA 5GMEA 1X5TA 4Y2CA 1L3TA 1EAYC 4O3NA 3C15A 1T9TA 3PFEA 5LXYA 1HNWF 1W25A 2GGPB 2AEFA 1GT8A 1S57A 2IBKA 3KJVB 2NR0A 4CT9A 2RMLA 3MMCA 3BH6B 4DV1F 4DX6A 1FERA 2EG1A 3TEHB 2KVIA 3EXYA 1NHUA 2MLZA 3CCWA 2ABYA 2CNNB 4O3OA 1S1XB 5HQLA 3K2YA 4O4GA 5F3ZA
chains in the Genus database with same CATH topology
3UWTA 3ITHA 4RUHA 4OJHA 2GW8A 3OJUA 1NK7A 2UXDF 2Z0GA 4TYBA 1Q81T 2DPJA 2ZH9A 4FXDA 1IKYA 5KT2A 3H4BA 5HL7Q 1AW0A 4H4MA 3NP5A 2IAJB 2RKIA 2XMTA 2BANB 2DBBA 2DISA 5AXLA 3J7Z5 3FSIA 2JFDA 3DFEA 4PXEA 2LQ5A 1M5VC 1CPZA 3DLJA 1S4FA 3DN9A 5C24B 1HMVA 2MJUA 4ZPAA 2K3IA 1T8EA 4FZVA 3P49B 3HLUA 1UVIA 1SKWA 4Q8EA 1N0VC 4ID5B 4RW9B 3CCZA 1SH2A 3PEJA 1NJIT 1VQ7S 4BHQA 5CD4H 4DSEA 3TNVA 1RI7A 3JAMY 5J2NA 4B3OB 1VBZA 1UA1A 4KTQA 3C6UB 1XTZA 3QYYA 5DDOC 4ZVGA 2PFFB 1UJ4A 2CQBA 4KHPF 1SV5B 2N3LA 1C2PA 5E3RA 4QR0A 1WG4A 1HI1A 1QE1A 3CSKA 1SJ3P 1HI0P 3THPA 2KRRA 2ZUGA 4BCAA 1AUDA 4ZS6A 2ZKUA 4QU7A 5KFEA 3IWNC 3TA0A 3PJWA 4FPRA 3MHYA 1QAYA 4RBVA 1MU2B 2MSTA 3W2VA 1HBNB 5T14A 1KR4A 2QYCA 1OPZA 3T5KA 3OV7A 4OZLA 2U1AA 2Q79A 2ZDPA 2DJWA 2D1CA 3I31A 2A2DA 4J37A 1FNXH 2OTJS 4HT7A 2H5EA 2M4MA 4LVNP 2D3ZA 4B9VA 1S99A 2AJ0A 1YQHA 2W8KA 4B3SF 2GMJA 1YI2S 1SL0A 4GMKA 4X4TA 1SI9A 2FLPA 4MKYA 2K3KA 1JNRB 4EGLA 5I3UB 1S10A 1YJRA 2XSJB 2JFKA 1SIZA 5J2QB 1XERA 1E6YB 1F5AA 2HRUA 4Z2XA 1NEEA 2B51A 2NUUG 3J7A1 3M32B 3JTNA 3GG0A 1WF2A 5BYSA 4ECVA 2V94A 1FVQA 5H9FJ 4GO7X 3HO1A 2U2FA 3BO2A 4FBUA 4B08A 3PJXA 3PZPA 3C46A 2C22A 4NLWA 2M8HA 2A1BA 4C8MA 1U1PA 3GV8B 1G7CB 4HLBA 1NJZA 4KV8B 2M88A 3DYAA 3HHEA 3VWSA 2HAIA 1RT7B 2J7KA 2XMMA 2L41A 5B0FA 4TU7A 1NHVA 3HZGA 4PXBA 1DTQB 5CCLA 3BQ0A 3OVSA 2DCLA 1SL1A 3HVAA 2XGQA 2X1FA 2HGLA 2ZHAA 2LQJA 1JNZB 1HWIA 2EVZA 1VC5A 1N33F 3B4DA 3DLEA 3BS9A 5KFPA 1LWCA 1T05A 4IG0B 5LT5A 1UJ5A 3FEZA 3RAXA 3G6XA 1SBRA 5A6PA 1HD1A 2DCUB 2FUG9 3OR2B 1WTFA 4LIRA 1Q53A 4NCAA 2J76E 2VFRA 1QVGR 4XK8C 2QLWA 2CFXA 1DQ8A 2YKMB 5HROA 1VC6A 5EWGA 5A8RA 3JSRA 2PI4A 4IFYA 1UJ6A 1FEEA 3E51A 1M5SA 5B7WA 1YRTA 2XMKA 2VPWB 1TR0A 3GIKA 3G4SS 1LV5A 1N48A 2HVHA 4U9RA 2GC8A 3M2RB 3K59A 2E66A 4PPZA 3WX4A 3KK3A 1DURA 4Q7AA 2NYIA 3U7JA 3TAPA 2YQ3A 3LAMA 2OJ3A 2XSFA 4I4BA 3POTA 4WIIA 5KFCA 1DJ0A 1Z2ZA 3MMJA 5DQHA 2XS5A 3FFIB 1IKVA 3TVZA 2YNFA 1RP5A 2KXNB 3JYTB 4QIEA 4C0HA 1R8PA 1U4BA 1U25A 1S6OA 2YKAA 4KQZA 1VBXA 1S0MA 2RSQA 4DFMA 2LDIA 2IA6A 2YX4A 1MWYA 2R7SA 1FE4A 1KQFB 3CMAS 2FIUA 4YR0A 4DQQA 1VQ8S 1VRUA 4IDKB 4N56A 2XO7A 4UY8T 4K4YA 4RW4A 2W4PA 1VK8A 3F73A 3ZZRA 2W25A 1Q82T 2IC3B 4DG1A 3C66A 2Q1LA 4JI4F 4KT0C 3M30B 5F0WA 4C11A 3MFHA 3NMAA 3MEGA 1X4AA 2IMOA 3IRXB 4O44A 2FHJA 2DGUA 4DSIA 4ZA1A 1JLQB 4LQ3A 4WXWA 2MPUA 2UVWA 3DLLQ 1RK8A 4RWWA 2MQMA 3TYTA 5A8WB 3P6YC 4NRUA 2OPPB 3K5LA 2L9WA 1Q78A 2EPIA 4RW8A 2E5LF 1X5OA 2V4RA 1FF2A 1S1TB 4Z37A 2DIVA 5A2QY 1HPZB 2A2CA 2QIFA 1SJRA 5DRKA 3MDFA 2HNYB 2OAUA 2HFOA 5AXNA 3DLHA 3SCJE 4DJBA 3NCPA 4F3MA 5B0CA 4I0WA 3M9OB 3ENWA 2JLEA 4X4NA 1V6HA 1N8RT 2DNQA 4I7FA 4IUFA 3PKYA 3X3UA 1U09A 2DR9A 4I2PA 1H7XA 5IM0A 3MPVA 1Y5NB 2MZRA 5IXUA 1JLFA 2BOPA 2QLXA 2YWEA 3GYXB 2Q43A 3O5TB 5CYQB 5L1JA 2VKRA 1VQLS 4PKDB 4QZVB 4AFFA 3K57A 4PCQA 2RRBA 3KLEB 4CCHA 4D3GA 2BM1A 4F4KA 4ILLA 1HI8A 4MYUA 4GC6A 3N28A 3PVXA 3PFOA 4B17A 4DLEA 1X4EA 3DRRB 4JV0A 4ZVEA 1S1WB 4MAKA 4BC7A 1KLMA 3CD5A 3OTCA 3KLFA 4IRKA 4QIFA 3VR1A 2DR8A 5F8NA 3AQPA 4RUAA 1P9QC 1FXLA 4HYKA 4NA3A 2MMYA 5AXKA 4DMZA 2YWFA 4K59A 3Q8QB 3G6ES 1WD6A 3MOJB 3CJ0A 1IKWA 2E5IA 5DGAA 5IWAF 2QO3A 3KLIB 3MD3A 2OIHA 4RNFA 5K5MA 4F26A 2DGTA 1TKZA 2IJFA 2MQQA 1TAUA 3I32A 4FXVA 1KVJA 5HO4A 2GNKA 3MAHA 4L72B 1N88A 1O5JA 5ADZA 1S6QB 3J80Y 4B02A 1S72S 4CO1A 2W4DA 5IFMA 2BJEA 4DL7A 1H38A 5CXTA 1HL6A 2VD3A 3RB4A 2EBGA 3VZIA 4I64A 2RUGA 1WF0A 3I0RA 4FNIA 2DIUA 5A0YB 4KFBB 4M5DA 3B82A 2HPUA 5D6GA 4H54A 1FEHA 3HHNB 1A9NB 1YJVA 5EDWA 1NK9A 4ETXA 4RBUA 1TL1B 1Y5IB 1FD8A 1D0EA 2XCAA 1C4CA 3IC1A 3DI6A 2DNRA 1FK9A 1VIOA 4FVCA 2ZM6F 4QYZJ 1VMBA 3R1LA 1XN9A 1T02A 5J2PA 1R7IA 2DGXA 4OMFG 2QA4G 4CNYA 1J2VA 4G6VB 4C0OC 5DETA 3JTOA 3L95X 3O8WA 2OD6A 2J9EA 2APOA 4ZCLA 2R7OA 4CQ1A 1RTDB 3QWUA 2V0NA 3MECB 3UE2A 2RDJA 1M90T 4UQTA 5KFSA 2ZZNA 2CQ0A 3IWXA 2VG6A 1EP4A 1ZYQA 3CD7A 4NLTA 1REVB 2FLOA 2RQKA 2O5DA 4WYLA 1U1MA 1CVJA 3CD6S 2J0XA 4ALZA 1FJGF 2MY8A 2VC1A 5DS7A 3BQ1A 3UD4P 4EFAC 1VIXA 3Q8SB 4RUCA 4DL0C 2OPSB 1Q8BA 1LXJA 4UW2A 3VAJA 2CPHA 1TKDA 1J5OB 3CD0A 3NL0A 4QYRA 1KOHA 2CPYA 1SJQA 4LF8F 2FD2A 3ONQA 1FXRA 5BYRA 4Q43A 4O23A 4CO0A 1CSJA 2J9DA 3TAMB 4DPOA 2R2UA 2OMOA 2B7CB 3IXQA 4C2MA 3OTOF 2KT3A 3IA0A 3DXBA 4HL9A 4WYWA 3KMSA 2KN4A 3JSMB 1JLEA 2YKNB 3R5DA 5JXSA 1TKXB 4OZNA 2UUWA 4XPEA 3VTIA 2B6AA 3NRBA 4JI6F 1FKAF 3BN4A 4PG8A 1U45A 1S0VA 5KFLA 1URRA 2ILYA 3ZFVA 4A4JA 2NZ4A 1GXTA 2I38A 3PIOQ 3KG4A 3MPWA 4PWDB 2AQ4A 3FRZA 5L38A 4CH0S 2CQHA 1UFWA 3E8OA 4ZVHA 3V6DB 1OQ3A 3CVKA 4TQSA 4DR2F 2RS2A 1S1VB 2ROPA 1Z2LA 5C42A 4XAKA 3I87A 2GHWA 4P6QA 1N32F 3DC2A 4AXIA 3OR1B 1WHYA 3DCAA 1LQ9A 4ZP6A 3L09A 1TKTB 1RQ0A 1IKXA 4RW7B 1WI8A 2VFUA 3LP2A 1YGYA 3UW1A 5GAHI 2B4OA 2KM8C 1KD1T 3E2EA 2RILA 2E1RA 4URQU 1Q4RA 1JK9B 1P1TA 4UOCA 5G4DA 4LSNB 4HI2A 2W7OA