2MZRA

Nmr structure of the rrm1 domain of hrb1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
GSARELDSTYEEKVNRNYSNSIFVGNLTYDSTPEDLTEFFSQIGKVVRADIITSRGHHRGMGTVEFTNSDDVDRAIRQYDGAFFMDRKIFVRQDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein HRB1
publication title Gbp2 interacts with THO/TREX through a novel type of RRM domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2015-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2mzrA00
1W2BR 1H2UX 3NNHA 1URNA 3NMRA 3G8TA 2MZJA 2DIVA 1B7FA 2LEAA 2LCWA 3IWNC 2KHCA 2GO9A 3H2UB 4WCEQ 2RQCA 1U1OA 1VBYA 2CQ3A 2V94A 5CXTA 1UW4A 1KC8T 2OTLS 3N9UC 4CQ1A 2MQOA 1H2TZ 2CPIA 3G71S 3THTA 3G96A 1VQMS 3UWTA 1JMTA 1WEZA 3G9CA 4PR6A 1XN9A 4CH1A 3CCMS 2MKKA 1Q81T 2CPXA 3RW7A 2MQQA 2MMYA 2OSQA 3U1LA 4TU8A 1WELA 1VQ8S 4BS2A 2KVIA 3CULA 2JVOA 1FJ7A 3B4DA 2CPEA 2KN4A 2MB0B 4YUDA 2DGVA 1CVJA 2LKZA 2MQMA 4IOAQ 2YH0A 3FEYB 1HD1A 4P6QA 1R8HA 2MZ1A 1H6KX 1VBZA 2OIHA 1M1KT 2DNNA 1WI6A 2U1AA 3VAJA 1X4HA 1WG1A 1YITS 2FPHX 3BS9A 3V4MA 1RKJA 1N88A 2HVZA 1S72S 5H1SV 2DO4A 2RRBA 3MUTP 1YJNS 3NNAA 1NU4A 2DGTA 2PEHA 3UCZP 3MD3A 3S01A 3DXBA 2J0QD 1F9FA 2LQ5A 2MY8A 3TP2A 3ULHA 1U1PA 3UD4P 5FJ4A 3VAFA 5CA5A 2J0SD 2CPJA 2KXFA 2MQPA 4W90B 2CQHA 2DGXA 2DNLA 5BJRA 2XNRA 1KOOA 2KFYA 2LXUA 2PE8A 3CCJS 1WHVA 1M5VC 1D9AA 2MYFA 5ITHA 2DISA 2CPZA 3UD3P 1VQKS 3LPYA 1RK8A 3PIOQ 3S7RA 2M9KA 2CQ0A 2CQIA 5IFMA 2EVZA 5IQQA 1FXLA 1X4EA 2AD9A 4UY8T 4FXVA 2LXIA 1K9MT 1YHQS 4W92B 1X4DA 2F9JA 2HGMA 2KT5A 2MKIA 5GMKa 2BOPA 2DH7A 1Q7YT 2DGQA 3S6EA 1FT8A 4QQBA 4WKRA 5D78A 4J5OA 1FHTA 3VAHA 2DH9A 3Q2TC 2CQBA 3J7ZT 2FHOB 3CC7S 2X1AA 3MUMP 4C7QA 1PO6A 4YB1P 3ZZZA 2MKJA 3TO8A 1X4CA 2KRBA 3HI9A 5LSOA 1WG4A 2MSTA 3Q2SC 4Y0FA 2MZSA 1KOHA 2E5GA 2AYBA 1VQ4S 3CXCR 2CQCA 2M7SA 1Q86T 2KG0A 2DGSA 2DNYA 2DNOA 2I2YA 3CF5Q 2L41A 2MQLA 3BO4A 2ADBA 4IOCQ 4YOEA 1U1NA 2XS5A 3CD6S 2DGWA 3SDEA 2CQGA 2MKSA 2LEBA 2MZQA 1VQLS 2DHSA 2EK1A 1KD1T 4QU6A 1JJ4A 2A3JA 2M8HA 1WEYA 2MGZA 1UP1A 4WIIA 5LSLA 1OPIA 2DNRA 2OTJS 1X4GA 2J8AA 2RS8A 3CCVS 2MXYA 3P6YC 1X5PA 5DDRC 1DZ5A 1VQOS 2XS2A 2DNPA 1VQ9S 2YH1A 1JJHA 3CPWR 2N3OA 3UCGA 1M90T 4ZKAA 4ERDA 2JWNA 3UCUP 1A7GE 2LA6A 2QA4S 1FNXH 2HZCA 3U1MA 2DNZA 5LJ5Y 1U1QA 1VQNS 2MKHA 3VAIA 1X5TA 2DNGA 1OIAA 2CQ1A 1SXLA 4LIRA 2YKAA 4WF9Q 2YWKA 4UQTA 2RVJA 2SXLA 5JVHQ 4Z2XA 2ZJQQ 3SMZA 2JX2A 1WF1A 2E5JA 1VBXA 2KRRA 4CIOA 5MLCV 1NO8A 1SJFA 2RQ4A 2E5HA 5LJ3Y 2DNMA 2HGLA 4TU9A 2HGNA 4F25A 2EK6A 2YTCA 1DHMA 3S8SA 1U1KA 2RT3A 2KXHA 2L08A 2RNEA 3US5A 2CQDA 1AUDA 3CCQS 1D8ZA 1L3KA 2MJUA 3I55S 1YIJS 2DIUA 2I38A 3UE2A 5IM0A 2OJ3A 3L3CA 4WFAQ 3CC4S 1PGZA 5HL7Q 4U67Q 4RU2A 2O3DA 1SJ4P 1G2EA 1SJQA 3EX7B 3MOJB 2CPFA 5HO4A 1P27B 3R1LA 2FC9A 4QPTA 5LXYA 3MUVP 1U1LA 2DNHA 4QU7A 3D2WA 4C4WA 4OZ0A 3CTRA 1YTYA 3P3DA 2CJKA 1X0FA 2E44A 2RUGA 1VC5A 1K8AT 4LMZA 4CH0S 2KH9A 1KQSR 1UAWA 1FJEB 4TLQA 3OW2R 2DK2A 4FXWA 3I56S 3FEXB 3CCUS 4OZ1A 4M5DB 2LMIA 4F26A 1ZZFA 2DNQA 2DHGA 1H2VZ 3VAGA 2F9DA 2NZ4A 1M5KC 1M5OC 2ADCA 3G6ES 2N3LA 3J7YU 1JJ2R 1VQ5S 4EGLA 2X1GA 3IRWP 2RS2A 3H2VE 2RRAA 1VQ7S 2AYMA 1X4BA 5D77A 3NNCA 2ZJRQ 2XB2D 1YI2S 1SJ3P 1P1TA 2WBRA 5GAGU 2AYGA 2MQNA 1N8RT 4TU7A 3DLLQ 1QM9A 3MXHP 4PRFA 2ZJPQ 2DHAA 2ERRA 1FO1A 2DH8A 3MD1A 5JVGQ 1VQPS 3CMES 3HHNB 2G1DA 2MPUA 3SXLA 1WG5A 5DM6Q 1WHYA 2JVRA 2CQPA 5GVQA 3R27A 1WEXA 1U1MA 3P49B 2KYXA 2X1FA 1WI8A 3CUNA 1VC6A 2M70A 2XNQA 4ED5A 3CC2S 2MZRA 3LQVA 3BO3A 2G0CA 2D3OR 2J76E 2DB1A 3VF0B 2MZTA 2KU7A 4IUFA 3PIPQ 3RW6A 2D9OA 5LXRA 5GAEU 2JRSA 2RU3A 1HA1A 2DHXA 2U2FA 1QVFR 1WTBA 2VONA 2LA4A 2G4BA 3MDFA 1NJIT 1WWHA 2K3KA 2NLWA 2Q79A 1ZZNA 5IM0B 2FC8A 3R1HA 2OSRA 4Y00A 3MURP 5CYJA 2CQ4A 2MKCA 2DITA 2E5IA 5DDPC 4A8XA 1WF0A 1VC0A 1WHXA 2M4MA 2QEXS 3P5TL 2N82B 5EN1A 1WF2A 1X4AA 2X1BA 1UFWA 2M2BA 4WFNQ 2AYEA 3BEGB 4C0OC 3CCSS 2GHPA 2HYIB 1IQTA 1HD0A 3NS5A 1U6FA 1YWXA 1K73T 2M0GB 2MSSA 5DETA 2MJNA 1X5SA 1BY9A 2KM8C 2L9WA 2DNKA 4F02A 1S79A 2N7CA 2KG1A 4PKDB 2QFJA 2K8GA 3CCLS 2DGOA 1YJ9S 1A9NB 2BZ2A 2MY7A 2VOOA 4V19X 1X5OA 1M5PC 2XSFA 1U2FA 2DGUA 4WFBQ 1DRZA 1DBDA 1N52B 2CQ2A 3CCRS 1X4FA 1ZH5A 3NS6A 5DDQC 5DM7Q 2KI2A 1VQ6S 3SDEB 5GAHU 2UP1A 1FJCA 3TYTA 2LYVA 3K0JA 2M8DB 3B4MA 2MGZB 2XS7A 1QVGR 1R8PA 2FY1A 1N54B 1SJRA 2D9PA 3G8SA 2VODA 4LJMA 3VALA 5GADU 3BO2A 3ZZYA 1OO0B 1YJWS 2CPYA 3MI7X 4IO9Q 2M52A 3THPA 3EGNA 1WHWA 2CPDA 3VAKA 2CPHA 2DO0A 3CCES 3CMAS 3VAMA 1Q82T 1HL6A 2VOPA 5DDOC 2KXNB 1U6BA 1O0PA 3EGZA 2MHNA 2LECA 1OWXA 1U1RA 3JB9k 2M88A 2F3JA 3G4SS 2B0GA 2KM8B
chains in the Genus database with same CATH superfamily
1H2UX 4Q0BB 4RW6A 2OPSA 3OL7A 4KYZA 4EZ9A 3I0RB 4R25A 3N9UC 2MQOA 4F04B 1WJ9A 4EEYA 3PRBA 2RH3A 4RNHA 5D15A 1J2VA 4NLWA 2VZ9A 5HI7A 1Q81T 3RBDA 3ZZUA 1S1WA 2JVOA 4F0MA 5KT7A 2IM0A 4NZ7A 2XMAA 1LXJA 2IM3A 3HSDA 4KC5A 2YH0A 4JI3F 4P6QA 4F0KA 1FKPB 1H6KX 4ZLJA 5IS2A 1WI6A 4YY3J 4DL7A 1EQMA 4KO0A 5B0FA 2AJFE 3HHEA 4IFVB 1HQEB 3J80Y 1S4EA 4UZCA 2WW8A 3DXBA 4IDKB 3X1LB 3ULHA 3QJPA 2NYIA 3ENAA 2DGXA 5BJRA 2XNRA 1RHUB 3HHLB 2PE8A 3EMTA 3CCJS 4U95A 5HLFA 1GNKA 3O6QA 1JLBB 3LGMA 3P4UB 5IFMA 3W2VB 4E2FB 3W9HA 2QLWA 1RWPB 4HTJA 1CJKB 1BHNA 1PKUA 1YX2A 2KB2A 5IZHA 2BOPA 2R7VA 1UPPA 4K4SA 1S0OA 3PO5A 3DNCA 1TVRA 1C0UA 1MWYA 4PXBA 3GSDA 4OX9J 4JI7J 1RWMB 3OV7A 3OTOF 1KOHA 2AYBA 1T9UA 1UVLA 3AQOA 3CJKA 1AA1B 2GS8A 3OVAA 4LUBA 3SDEA 3MR3A 1T05B 3GWCA 1S1UA 2PN6A 3FZBA 2DHSA 1N5YA 2UUBF 1B99A 1VHIA 2D41A 1DLOB 3ILIA 2MXYA 1DZ5A 4X62F 4ZVPB 2V34A 4ZPWR 3K5MA 1FVQA 4K0KF 4WWSA 2QA4S 2CDQA 4KTQA 1H7WA 4RLEA 5LL6d 1S97A 4N8OA 3V6KA 3H7HB 4YS2A 2GCFA 2DR7A 2YKAA 4IRCA 1RBLA 2RVJA 1WF1A 4DV5J 2KTQA 3RBEA 3M8ZA 1XTZA 4ZP9A 2IRUA 2BJ1A 3JYTB 3M32B 3CJ4A 3LAMA 3HK2A 4QYRA 4A8YA 2L08A 3HKZD 4TQRA 2HQCA 1W26A 4B3SF 1LWCB 3WZ0A 4KSEB 5HMWA 4L73A 4ELUA 1T95A 2DBBA 1E6VA 4DPOA 2VC1A 4OJHA 3D5MA 5G0RB 1OJ4A 4WE1B 2W9BA 3DGPB 2C2ZB 2F8MA 2G2OA 1UCNA 1Z1ZA 3MM9B 2RRAA 3CJ3A 3E51A 1XK8A 2PO4A 3OL6A 2XLJA 4RW4B 3OFEA 4DR1J 3F0NA 1Q95G 4Q45A 4A8KA 2GIFA 1U1MA 3PYFA 2M70A 1T8EA 1TL5A 2KU7A 3R2CJ 2C2DA 1NZ8A 1C4CA 2DCUB 4ZP7A 4Y00A 2QL7B 2HVEA 4RNFA 2K7KA 3MMBA 4OYOA 4IR1A 1DQ8A 1X4AA 1O51A 3V81B 1SIWB 3JSRA 3OJSA 1FX2A 2DYAA 4DX8H 4F4WA 1MMDA 2GHPA 2P9CA 2MJNA 3LH2S 4O3RA 3OTDA 5J1EA 3QIPB 1A9NB 2VOOA 5MAOA 4DPYA 5AT1B 2V63A 1N52B 3MWBA 4ETZA 1H7XA 4K4VA 1V3ZA 2KO1A 3NLCA 1QTMA 2MGZB 2XS7A 4IG0A 5F0WA 1CULA 5GADU 1TMJA 2CJBA 4O4RA 3UD5A 2IA0A 1YJWS 3V6HA 4DF4A 2AU0A 2V9KA 1HBNB 2H65B 1D1UA 3GCXP 2WVEA 3T19A 3VAMA 3CE8A 3GB0A 4ZIVA 1SL2A 1RWNB 3MAAB 4ZS6A 1NAQA 2LECA 1N34J 4L72B 3QSIA 1MU2B 2LCWA 2VDIA 2KHCA 1HR0F 3QT5A 3HULA 2RQCA 3ADAC 4Y2IA 3C15B 3ENVA 2QV6A 3DDKA 3QFWA 4IR9A 5D0HA 4YB7A 1HWKA 3AD8C 3FMWA 4ELTA 1WELA 2BRKA 2UXDF 4YP3A 1HYSA 1FJ7A 3KYLA 3N5FA 2YWEA 4ICLB 4O3NA 3P96A 4DR2J 1BQNB 2COLA 4IG3A 2YKNB 2EKYA 3NCPA 3BS9A 3M2RA 1FKOA 2RRBA 1RT5B 2Z2LA 4UUWA 3PDNA 1D8YA 1PIEA 3S01A 1NJZA 1S9EA 2HS0A 4NA3A 4CLPA 3KJQB 2O1PA 3CJSA 3NG8A 1IWAA 1T7PA 2C42A 1MMNA 2V8HA 3FCWA 5LMNJ 2WZ1A 2CZVC 4ZP8A 3KUGA 4I56A 2XTJP 4G1QA 1KONA 2F1FA 3C16A 4EMDA 3S7RA 2GQCA 2VFVA 2AD9A 5BYRA 1IR2A 1RP5A 4PAAA 4NWBA 1FRJA 5CAAA 4U9RA 3CCTA 3BGFA 4J5OA 1FHTA 4OHYA 1GH8A 1RHJB 4M5GA 4Q7AA 4YB1P 1WOSA 2EBEA 7AT1B 5RUBA 1JLFB 1Y3KA 1AUSL 2MQ8A 3I6PA 4J7CA 2BRLA 2V5HG 2E7WA 4ZJLA 2L48A 4URGA 2L41A 1D0EA 3AFGA 4ZVUB 4TYAA 4YOEA 4WXOA 1U1NA 3F56A 4NLVA 1XMOJ 5H9FK 2XMVA 3PZPA 5JJBA 2NR0A 3W2WA 4M94A 2OTJS 3C8YA 1FF2A 4DR5J 3CPWR 1S12A 2QT7A 5IQ6A 5KG2A 2NZCA 2V8PA 2HK2A 3DRPB 5I3PA 5DQIA 3PEHA 2LU1A 2VBZA 3HVTB 5LT5A 4DV0J 3PTWA 4IRKA 3PNIA 2GJIA 4DPTA 1RCXB 2YWGA 1NHKL 4RZRA 1UWBA 4ZVSB 3K5LA 3AAWB 2IRXA 4F25A 4C11A 1U1KA 4J9VA 1NJYA 3LP2A 3US5A 1AUDA 4H4OB 1L3KA 1I94F 2DIUA 4FYYB 2FJWA 1TKZB 3L3CA 3TJ9A 4RU2A 4EUVA 4FDFA 3ZTRA 3QIDA 3MOJB 1GAOA 5HO4A 3I87A 2XYGB 1VDHA 5IT4A 4GVBB 1QAIA 4B3OB 4K5RA 2NXEA 3KHRA 1TKTB 3CCUS 4OZ1A 2FLPA 3VAGA 2V0NA 2F40A 1JJ2R 2HQFA 1GK8A 4M5LA 4F3QA 2R7WA 2QIFA 5L1LA 2FVRA 3SZ2A 2CADA 3KK1B 1N48A 4DX5A 3GYXB 4DR3J 2OMLA 4FKYA 1S0MA 3SI8A 4IUFA 4UZBA 2U2FA 2K3KA 2NLWA 1NSAA 2Y3YA 2PGCA 1DJ0A 1F0XA 1HNZF 5DDPC 4PXEA 1FRKA 4M5NA 3PX0A 1NKEA 4IFYA 4TYBA 3HSZA 4S0MA 3R5GA 3UDCA 2GMLA 3G2XA 4LR8A 3CCSS 4F7VA 1SH2A 1WC6A 3ZZOA 5LM7E 4V19X 5L9NA 1RAHB 3TWZA 1WOOA 2NSBA 3KK2B 2CFXA 2AQ4A 1S6PB 4I2QB 3R2DJ 8RUCA 4H4KC 3DOMB 5DG7A 2XMMA 3MCOA 1RT2B 5I3UA 4WTOB 1N36J 3D0HE 3CJQA 2NS1B 2B4UA 3SQGB 3D4JA 3QZ8A 1N54B 4LJMA 3CDBA 3BO2A 3DKDA 3AOCA 4CT8A 2YY3A 3G6VA 3EGNA 2CPDA 5DLFA 2IMOA 3PYEA 3IG1A 4PG5A 5A76A 1RTDA 2Q6BA 2ROGA 4MFBB 2KXNB 4P9SA 2DCLA 3EGZA 2PA3A 3DOKA 2ZKUA 4DFMA 3IM9A 3AH6A 2EWHA 3PKYA 3IBCB 2LEAA 3BGLA 1U1OA 3K8VA 4NZ0A 2V94A 4XPEA 3MMAA 3GE9A 2EFVA 1DTTB 3VQTA 3GFHA 4C8YA 1FESA 1WEZA 3G9CA 3N6NA 5DGAA 3L7UA 2HIQA 4RUCA 4LF8F 2HHUA 1ZAWA 2R2TA 4I64A 3WC2A 2MZ1A 2XZDB 1VFJA 5CQGA 2BW7A 1N88A 3D66A 2HVZA 2K1RB 4KQZA 3TVKA 3DYAA 4ID5B 3MD3A 2G9OA 5EWFA 5SZTA 5A8WB 1UPMB 3QWUA 2DNLA 2LXUA 4X64F 4DWIA 3GG1A 4WIQA 2CQ0A 3AB2B 3AXMA 1B64A 4ITSA 3LAKA 1FRIA 4JYAF 1F60B 2GIQA 3MTJA 1EP4B 3V6DA 5HMZA 4PQAA 5ETPA 4N77A 2VG7B 4O3OA 2E1AA 3MEKA 2MKJA 5JXSA 2KRBA 2F8EX 4C9DA 3FUYA 2MSTA 2G0JA 4J9NA 4J9OA 2M7SA 2IVYA 2IMWP 4NCGA 4C8NA 3QT8A 1KEKA 2AJ0A 4QW9A 4XPCA 2M3DA 3M6XA 3UNYA 3QJLA 4YR2A 3BR9A 4LF4F 4M5IA 4I1TA 2ZD1A 4DU7A 3QQCD 5M2PA 4TNOA 2IVFB 2WB4A 1JLQA 1WC5A 1VQ9S 2YH1A 4FXDA 2VPYB 1M90T 3GMGA 5CHCB 4WZQA 2UXCJ 4FS1A 4KT0C 2XSJB 5DLGA 1B0TA 1UA0A 2QGFB 1TUGB 4U8YA 2LVWA 3QWPA 4Q0BA 4RBUA 2BJ3A 3M2UB 1J5EJ 3M9MB 3I0RA 1RT7A 1I3OB 3K8WA 4DN9A 2V8DA 2ROEA 3ISNC 3TOQA 2IDLA 1CJVB 2AJ4A 3NCRA 1KKHA 3BB5A 3IWXA 4DUYJ 2HW3A 5U47A 4KH1B 1RAOA 4ZHRA 3ZZPA 2JZ5A 2CJYB 1N56A 1DTQB 1IKYA 1TKDA 1G2EA 3TA0A 3FBEA 1FKPA 1HI8A 3R1LA 3ET6B 1U0HB 4BWMA 4ZLPA 4ZITA 4WYWA 1LXNA 2HAIA 5C5JA 1K8AT 4IFVA 2JSXA 3DLJA 2R4FA 1HQEA 4IDKA 2EFGA 4NI2B 1YQHA 3T41A 3G6ES 5IWAJ 3UNGC 2X1GA 2RS2A 4H4MB 3QPIA 5K8MA 4LT6A 3W64A 4MTPA 3HHLA 1PJ6A 2BJ8A 2BEFA 4PWDB 1JLBA 2ERRA 1FO1A 5CYMA 2AT1B 2OUGA 1IN0A 3P49B 2KYXA 2PEBA 4PUOA 1VC6A 4KIAA 4ECSA 3H40A 2G4BA 1NJIT 1T94A 3GFYA 3MURP 3HXMA 2R8JA 5KFUA 1M1GA 1WHXA 2EFQA 3C66A 3PFEA 3L7PA 3SCJE 2HVHA 1C2PA 4Y65A 3M9OB 1T05A 3PX6A 1S4FA 1Y00A 1VK8A 2BE2B 1JLEB 1G7CB 3VV2B 1IWGA 4ILLA 1DLOA 2HBZB 2MTLA 5J2QB 2WONB 2K8GA 3FSIA 2QZ8A 2BZ2A 3PR4A 1CLFA 4WFBQ 2A1BA 4NL5A 1TV6B 4XIUA 2RJZA 5DG9A 3BN4A 1JX4A 1TL7B 3G8SA 3KLHA 1AW0A 2A6MA 2G2YA 4RBTA 1F1BB 4JI3J 2CPHA 1KVKA 5DDOC 5HJYA 4NCBA 1LWCA 2MZJA 2BR0A 4MAKA 4QWBA 4PQUB 1W2IA 2AV5A 1REVA 1UW4A 3L7OA 3EZOA 3WX8A 2BABA 3JQMA 2O66A 5C24B 2GV1A 5G0RA 2HNYB 3HD2A 4WE1A 3DGPA 2YWFA 4K5SA 3BZQA 4ZCLA 3MM9A 1S49A 1M5HA 2QN6B 1YRXA 4HDHA 5KFCA 4DDFA 4RW4A 4DL6A 1RZMA 2VU5A 1H74A 2NPFA 1U02A 3IMQJ 5ETTA 1Z2LA 4UUXA 1OSCA 4RX6A 2W8LA 3VAFA 2FB0A 1XR6A 1SC4B 3VGSA 5KFMA 2N4DA 2IC3B 3I5AA 3K7RA 4MK8A 5HN0A 1VRTB 1WHVA 3KNAA 1Q5VA 3UD3P 2ILZA 1RK8A 2UUBJ 1NSKL 1YJTA 2GFFA 1PBUA 1GMVA 4ZCIA 3TZYA 2AIRB 3EXYA 3DLKB 4X62J 2V4QA 3O1LA 2APOA 5C2CA 4OIXA 1RGVA 3V81A 4K0KJ 3J7ZT 5E33A 4ECZA 3BJYA 1HWUA 5HVHA 3SV4A 4DCJB 2R7UA 3J7Z5 3QIPA 2NREA 4WZMA 3J81U 2I8EA 1S48A 4IQXA 2DNYA 1SKWA 5I42B 2NPIA 3BO4A 3OTBA 7FDRA 4P7TA 2W1BA 5KFPA 2XS5A 4QIEA 4OJ1A 2PMZD 1KQKA 2MGZA 4WIIA 4JI1F 4LVOP 3M8QA 2QLBB 3BV8A 3CCVS 4X4VA 2XG8A 4F4ZA 2R7RA 3C6TB 1X5PA 2CNLB 1T3NA 4X66F 4Y2MA 4ZVEA 4B3SJ 1ZAXA 4RUAA 2HZVA 2HBRB 4ZKAA 4B3TF 4ERDA 2R8IA 2BVZA 1FERA 3U1MA 5BXIA 3MAAA 1W7WA 2YKQA 2XZTB 2OGUA 2F4VF 3PCOB 1MU2A 1T9VA 2FLLA 4A46A 4B9MA 2GQ2A 2B4PA 5A8KB 4R5PA 3DN9A 3LP0B 5B0EA 5AXMA 5B7WA 3UO0A 3DLGB 2KXHA 3FCVA 1AZSB 3I55S 3BGRB 4WFAQ 1SJQA 3OHBA 2CDRB 1R0AA 4ICLA 3CCWA 2MHEA 1ZPVA 2YKNA 6AT1B 1HW9A 2E44A 4LMZA 1RT5A 4A4JA 1UAWA 1ZBTA 4QIWD 3T3FA 5EHHA 3DDNA 4LREA 1E6YB 2VASA 2W7PA 4A8MP 4L74A 2F65A 3CJ5A 4KKOA 3IS9B 1RT4B 3OQ2A 4NMXA 2AYMA 2VPWB 3K58A 1FFWB 1IQZA 5GAGU 1LW0A 3PKMA 2E7VA 2MQNA 3EICA 4FBUA 3DLLQ 2GW8A 5ETKA 3LO3A 4NLGA 2J9DE 1G6BA 1Y7PA 3CMES 3KMSA 5B08A 1HMVB 2JEJA 2B5JB 1ULRA 4ECUA 3GJQB 2MZTA 5J2MB 3PIPQ 3QRRA 1B0PA 3FGVA 4GMKA 1WWHA 4B9TA 3I96A 2IIHA 1JLFA 3FZ2A 4B17A 4JI0F 1L3TA 3B54A 3I4PA 2DXFA 3OSPA 4PPDA 4R8UB 2E1RA 1X0PA 3W61A 2N82B 3G87A 2GJ2A 3ZTQA 4FBTA 5D3GA 1IKVB 4OHWA 2M0GB 2KM8C 2DJWA 4F02A 1KLMB 2CJQA 2VH7A 1DRZA 1HR0J 2JJ4D 2AEJA 3CCRS 5DDQC 2P2CB 4IRDA 5GAHU 2UP1A 3OFHA 2W7AA 1Q8KA 3HVTA 2UXDJ 1Y3JA 1AXQA 1T02A 2LQ9A 1WSVA 3IR7B 1R6YA 5HANA 3HD1A 3IFEA 5KFTA 1CC8A 2DR8A 4DXLA 1RLCL 2I1RA 3W5XA 4CLSA 2JFDA 4H4OA 2ZC4A 5F8MA 1W2BR 1NDKA 1TKZA 3PRVA 1LWEB 5GADI 3AOBA 4OYIA 3R6LB 4G6VB 3HJFA 4LF2A 3SSSA 2DEJA 2ZKTA 2C3MA 4B3OA 3GQCA 2ZM6F 1TKTA 1VQ8S 2NXJA 4XDDA 2EFPA 4N76A 4C2MA 2IBKA 1LWFA 5A2QU 2MB0B 2LKZA 3N01A 1HD1A 3D7SB 5K14A 2G1HA 4H54A 3JTOA 4JI7F 4JP8A 5DG8A 4I4BA 5HQMA 2L9NA 4DPUA 2GMJA 4LRFA 4JB8B 4FP9A 1NPPA 2W9AA 3BN7A 3FKBA 3AT1B 2I5JB 1PYOB 2KFYA 1M5VC 2MYFA 4J9UE 5BR8F 5F9LA 1JXLA 1IBCB 2QMXA 3Q86A 2BQ3A 1O5JA 1XR5A 1QAXA 5GMKa 2J9EA 2AX1A 2BKOA 4QQBA 5I3QA 1CJUB 5D78A 4NRTA 4MYTA 3Q2TC 5C25B 3W60A 4IH7A 3HVWA 5D0GA 1X4CA 4LSZB 3BSAA 4RW9B 1RAJA 4OZ3A 5E0OA 4F2SA 4DR6F 5KFWA 2I6WA 3PJXA 2MQLA 1S6PA 5EGYA 4DI6A 4F4YA 3CD6S 1SBRA 4KO0B 3DOMA 3KG1A 3D9BA 3MPDA 1VQLS 2Y8YA 1RT2A 3M05A 4IH6A 3HDSA 1TUWA 3UDVA 1JJ4A 2VJVA 2A3JA 2M8HA 2L9DA 1VK3A 3SQGA 2HZAA 2XO6A 1I94J 1RBAA 1HFEL 1D9FA 2LFVA 2RDDA 2B7CB 5KFHA 1JNRB 1N32F 3ZNUA 2HLTA 2JWNA 3KLIB 3UCUP 2XWXA 4YDXA 4MFBA 3M1VA 4O3QA 4B08A 2MKHA 4KAIA 4GC7A 3EGWB 2EI5A 5JVHQ 4P73A 4Z2XA 3I4HX 4CM2A 4ZN3A 4ES2A 4KHPF 1U2CA 1VR6A 1C0UB 1DTTA 1ZAVA 4TU9A 3M6UA 3TVYA 1SKRA 4TKTA 4F4XA 1SJ1A 2RNEA 3TNVA 4N8NA 1PGZA 1SJ4P 2WB1D 3CJKB 2YQ3A 2XI2A 4LFAF 2FC9A 3RRHA 2GVDB 1N5YB 2K1RA 3Q8YA 3CGIA 4XAKA 4ID5A 4M5DB 1C4AA 4DL4A 1BD6A 2RD5C 3LA0A 1Q4RA 4CLYA 2UUCF 2E9TA 3RRKA 4O3SA 2FYXA 1HNZJ 4F67A 1FRHA 5HATA 2JFKA 3PR5B 2AW0A 2VKZG 3MXHP 2LU2A 3MD1A 5D6GA 1VIOA 2ZVIA 4Z7CA 3OHAA 2UV8A 2UVUA 3SYZA 3BO3A 1JQGA 1RUSA 2AJ2A 2YNHA 2VG7A 4AYBD 4UOHA 5KG1A 3DMJB 4DS5A 1TAUA 1B4SA 1ZZNA 2IRYA 2V9WA 2ZH6A 2HFVA 3QMQA 2DITA 4QJVA 1TK0A 4DV7J 1T03A 3HFZB 1BMQB 3DRRB 1YVFA 2WSEC 3JS9A 3T9NA 1E6VB 4EWTA 2YNGB 4CLZA 2AYEA 2HYIB 4FZVA 1EAYC 2OI2A 1XQIA 3QRQA 2EEYA 2A0FB 3AJ2A 3EPIA 2PI4A 2YNIB 3I5BA 1PC5A 2OO4A 3MMCB 5AXNA 2XSJA 5F3ZA 4BBYA 3W65A 2ZWPA 2M8DB 3HLUA 2FJAB 5HMXA 4M95A 1SJRA 3M2UA 2ZNYA 4LF8J 1N0UA 1GMUA 2CPYA 3MI7X 5D4LA 3RB0A 2VA3A 3OTCA 1KP6A 4OI0A 2BM0A 4USTA 1U4BA 4DCPB 2K06A 1Q82T 4ED6A 4KGKA 1O0PA 1U8SA 2OH2A 3CB4A 3GJSB 3NNHA 3NMRA 2CAJA 1DTQA 1SC6A 3MPYA 3UN2A 2GO9A 1R89A 3OLBA 4ZJQA 3ET6A 2QL5B 1Y5LB 2G13A 2Y1RI 2DVIA 4OMFG 2CPXA 3RW7A 4ED2A 4X64J 4GO7X 3FQLA 2GA7A 4NI2A 3FVYA 2GHWA 4JYAJ 4HHHA 3KG4A 1FTCA 1X4HA 1IM6A 4LFBF 4KJIA 3A3PB 5KT6A 4PWDA 1RCOB 3W63A 3GLJA 1XC9A 3T1YF 5E41A 5HK4A 3ZFVA 5CD4H 5A2QY 1B70B 3QRPA 2A2CA 3LPYA 4YR0A 4B9UA 5THWA 4LF4J 2FHJA 3EZ5A 5HBMB 2XY7A 2C3UA 1SPBP 3AOAA 3MM5B 1N5VA 4LRCA 4OYWA 2WVFA 1FT8A 2GZOA 2Y1IA 4WKRA 2NXUA 3UVJA 2BE2A 3CC7S 1JLEA 4JI5F 1PO6A 3KFWX 1PCAA 1HNWF 1HYSB 5H9EJ 3DC2A 2IYIA 5LSOA 1L3UA 2E5GA 3CXCR 3H98A 3WQPA 4MMOA 3A4TA 2RQKA 5B0GA 1TV6A 5KFJA 4KGVB 3WHIA 1C0TB 1NMEB 5CYQA 2HBQB 4I6AA 4MKVA 1S9EB 2C22A 3HVAA 2R2SA 1NM2A 2Z2ZA 4UQGA 2J8SA 4ECQA 3DLBA 1QUPA 3O8WA 3QO9B 3RBXA 2RU9A 1ZETA 3QZ7A 2HURA 2HZCA 5CD4A 2NSCA 2Y0SD 1VMBA 4ECRA 4QCLA 1OS5A 1Y5IB 3C16B 3NGSA 2CQ1A 2Z56B 2HHVA 4WF9Q 1DY3A 3B82A 3UR3C 3D0IE 4PQUA 4OYMA 2O67A 4B9LA 4CIOA 1FX4A 3ZTPA 2DNMA 3R5AA 2DHHA 5IC6B 3S8SA 2RT3A 4WXWA 5C24A 4DV3F 1AFJA 2HNYA 3NKYA 3EX7B 2JEGA 4ANDA 2MKYA 3VGUA 2ASYA 4DV6F 3OR1B 4B02A 1PC4A 4F2RA 1VC5A 1FWLA 5KG4A 3GJTB 2HG4A 4CH0S 1NK9A 4MYUA 4C98A 2DNQA 4PG6A 1H2VZ 4UTGA 5HQLA 3J7YU 2UVWA 2WHOA 1FXRA 4ZVRB 4YMEA 1VQ7S 2IC3A 4TN2A 2XB2D 4TU7A 2ZH8A 4FYXB 2ZJPQ 3DFEA 2IAJB 3AB4B 5ETVA 1YBAA 5DQGA 3R27A 4IKAA 1JWWA 4FPIA 1FTRA 1WI8A 2HS4A 3J80U 1KHWA 2D3OR 5C42B 1P9YA 3U27A 4C11B 2X3DA 3D0GE 4ENOA 1XNQF 3LP2B 2RU3A 2ZH7A 4LSLA 3EWGA 5LMUF 2FC8A 1ZPWX 4ECXA 4MKAA 2CQ4A 5D4NA 4PWUA 1F5AA 2HVDA 3C3LA 3ELHA 5CABA 4ED4A 5I42A 2KL8A 1HKAA 3HFVA 3TARA 1WORA 2J0XA 3MPVA 3H42A 3N6LA 5HROB 1G4CA 1C1CA 2LDYA 3OXFA 1KBRA 5ETMA 3C6TA 1EKRA 1REGX 4R0EA 1UZDA 4PKDB 2NUHA 3R7BB 3NWGA 1S0NA 1ZH5A 3SBMA 3SCLE 2WCXA 4N5SA 3HHDA 3TYTA 3W5ZA 3K0JA 3BSCA 4A47A 1RAEB 2J6UA 3VALA 3HX9A 4P75A 4ES1A 2VB6A 4PZVA 3D1QA 3RUBL 3THPA 2RB7A 2UZAA 5A8KA 3VAKA 1F6TA 3LP0A 1S6UA 4YN3B 2DT9A 2B8QA 1GTEA 3KG0A 4OLOA 4P52A 3G4SS 1QUVA 3TA2A 4E8UA 3M8PB 1M0SA 3BGRA 4EBDA 3PJ9A 3ZC4A 1TK5A 2QSWA 4ZPTR 4O4GA 2ZE2A 3HHLC 4K4WA 1RT3B 1S1TB 3NOCA 5K8PA 1SUQB 2V50A 1A0OB 1E6YA 3GTYX 5C7PA 4OL8A 2CNOB 2CPEA 1SL1A 1B7YB 4K50A 1RT4A 4P2SA 1KHVA 1TELA 1RKJA 5I3UB 4WFZA 5F0UA 1YJNS 3RAQA 1MG7A 4EK2A 1XERA 3E01A 1ZYQA 1RA6A 3UN3A 3UD4P 1HMVA 1H0HB 2V2KA 2UV8G 5J2MA 3BBCA 1QE1B 1ZM4A 3CJ8A 2Z57B 4TQSA 1J5OB 3KLFB 1CQMA 5F8GA 4JI1J 4W92B 2ZBPA 4GRSA 3LWLA 1LWXA 4X66J 2E1PA 3MEDB 3MMAB 4R8UA 3KJVA 4ZJOA 4B3TJ 2DH9A 3KUHA 1VRUA 1ZM9A 4N7TA 5JUMA 3CW2C 3OUYA 2OD4A 3GV7B 5KG6A 1KLMA 4CLLA 4DN0A 1B3TA 3M8WA 3GYGA 2E1MC 3R6GB 2OPPA 2VBXA 2HWHA 3DYAB 3H5UA 3WBZA 1Y0HA 1R0BG 5LSLA 2Z58B 4QR2A 3PW4A 1NEEA 3AXKA 3UCGA 4WP8A 3OR2B 2CUYA 3D6FB 1U47A 4HH0A 1HNVA 2BKNA 1MWQA 4YEAA 2IVMA 5KT5A 4QIVA 4AL6A 2NXCA 1OIAA 2AGPA 3AJDA 1RTJB 3TUPA 4DU8A 3VVTA 1MMLA 1FK9B 2E5JA 1VBXA 3G82A 3TQEA 4AXIA 2J9DA 1R7IA 5T14A 4LF1A 3HM9A 5DS7A 2QJ3A 4KPYA 4C6AA 1WC3A 3I0SB 4NLTA 2YQ1A 3A1YG 1EIYB 3I82A 1NSQA 2C28A 3ENQA 1P27B 1RHKB 4UOFA 3PVXA 1NUEA 3D2WA 1VCTA 1P9QC 4ED1A 3P5BP 3H20A 4FXWA 4DR4F 4Y34A 5CH7B 1I6JA 1JLQB 4OLPA 2F9DA 2RDIA 2J7WA 3B6BA 2K2PA 4JI0J 2R7XA 3MAQA 1S10A 4X65F 2MEWA 1SJ3P 2WBRA 4J90A 5L8RC 2AJ1A 5KFVA 5J2NB 2MLXA 1Q8BA 4QR1A 2CRLA 3T1AA 1MN7A 2E1CA 4YR3A 4USKA 1RT7B 3G6XA 2DXDA 1ZOTA 3DOLB 1EB0A 2XMTA 3CUNA 1TMMA 4EYIB 4AL7A 1CJUA 3H5SA 2EC2A 4CO3A 2DB1A 2HFNA 2B6AA 4PXCA 5C25A 1FNMA 2FDNA 4C8KA 4OYAA 4EYHB 5GAGI 1XR7A 2UVRA 4ZHRB 1S7HA 5ETLA 3DHXA 1ZS6A 4RW9A 1IKYB 3J81j 3B78A 4YFUA 2XYPB 3JSMB 3KOAA 5KFLA 2PDAA 2ZH3A 4DPXA 1VOMA 3NAIA 4MK9A 1HWIA 2R7SA 1UFWA 4OQJA 2GGPB 3NGRA 1GT8A 3Q8QB 2Z2MA 4JI6F 1X5SA 3MECB 2N7CA 2QFJA 1DQ9A 2DGOA 3NXZA 2HS3A 1DBDA 2CQ2A 1LFWA 3KLIA 4DV1F 3FCHA 5KFBA 4P74A 3T5KA 3BGUA 1R0CB 4JV2A 3PG9A 2ZM6J 1PBAA 1QVGR 5CYMB 3MMJA 2ABYA 3MZIA 4G3IA 1RT6A 2OD6A 4GVLA 4PUOB 1WDDA 1X9SA 1KN6A 4FF1A 2CA9A 4I67A 5GAHI 2EC0A 3Q8SB 1OWXA 4G1IA 2WSCC 4CTAA 1GQEA 5CZVA 2I9SA 3H2UB 2ZZNA 2DPIA 1VBYA 2XC9A 2OTLS 2GVDA 1LK5A 4PR6A 1XN9A 2VG5B 4BS2A 4M5DA 2VF3A 5BR8J 5KFDA 3OVBA 2W7OA 4C97A 1NHVA 1VYAA 2WVBA 3AD7C 3H4DA 3VVUA 3QLHA 3CDWA 5KFZA 3OBIA 1OQ3A 2C3YA 5KT4A 3KLHB 2MY8A 4UOCA 1FDAA 2XQCA 1TAQA 2KJVA 4DR6J 1IBLF 2PT0A 4DLEA 4F3OA 1VLOA 2ZH9A 1RWVB 2V2VA 2LLZA 1X9WA 3DMJA 1D9AA 1FFGB 4C0HA 2M9KA 3NRBA 4DS4A 4UY8T 1YHQS 2HGMA 1REVB 5K20B 3Q0AA 3IGNA 2DGQA 3DRRA 4DSLA 3N79A 2ZOMA 3QGPA 3BPSP 1N32J 1S1VB 4X4UA 4KV8A 2YNGA 3GV5B 2CG4A 5EUHA 3LOUA 3TO8A 3CD7A 3LGNA 3GZ7A 4DQSA 5ADZA 5E7OB 1UA1A 3X3UA 4KR0B 2H5IB 2VG6B 2YNIA 4Y3CA 2DPJA 4KHPJ 3MMCA 3UN5A 4HDGA 2MZQA 2OPQB 2CJAA 2XMKA 4DR7F 1WEYA 3DM2B 1OPIA 2W4PA 2ZZTA 1FD8A 2OEKA 4GC6A 2PMWA 1HIYA 1XMQF 4OYZA 4USHA 4NEZA 3HCXA 4LF5F 4LFAJ 4YB6A 1EARA 3FBFA 1FRLA 4WTYA 1APSA 4OYBA 2XMJA 3ZO7A 2KFNA 1UETA 2W9CB 1F9HA 4NX9A 4RBVA 2AP6A 5KT3A 1GFWB 2JX2A 1RBOB 2IFXA 3LP1B 3T5LA 1ICEB 2UUCJ 3M4XA 2X3GA 4FYWB 3GIRA 1HQUA 2OKQA 2BBEA 1KTVA 3SCKE 1OYDA 4M1KA 4U67Q 1SH0A 3I9ZA 1S59A 2HEKA 2B8PA 2YX1A 2H54B 2FTRA 2DNHA 3CTRA 5KFKA 2R8GA 1RWOB 3M8QB 2EFNA 1RU2A 1ZZFA 4K59A 3QGIA 3OFFA 3N5BA 3HO1A 3D28A 4ZLLA 4DFJA 3NMAA 1WC1A 4NLSA 5D0EA 1FRXA 4QR0A 3PW0A 2FD2A 4HTIA 5HBMA 2AGQA 1SKSA 5DZ6A 4EI2A 3GYNA 1RWKB 3MM5A 4R5PB 2MZRA 2AZ3A 1LOUA 4WU2A 2LP4A 4JOUA 1S9GA 4AL5A 2LA4A 3M9NB 3A8IA 4E0DA 2A10A 2OPRB 4UF4A 2DRAA 1R0AB 4RJVA 2ZHAA 3MCNA 4KY3A 1HBOB 1OSDA 1WF2A 2FVCA 4NLRA 5AE1A 4ANEA 1C0TA 2B9YA 3NS5A 5HVGA 1NJXA 4ZVOB 3I5CA 3KXDA 4CRJA 4KKOB 1WKKA 4YB5A 3QO9A 3QAUA 3NS6A 4JV1A 1VQ6S 2OEMA 5H9EK 1Y5NB 4RO0A 1LW0B 4MJKA 4KRWA 4ZPAA 4M5HA 3QT7A 2HKEA 4RWXA 2JLGA 4CI0B 3RB6A 3ZZYA 1JLCB 1Q5YA 1JLAB 3TANA 3MM6A 2DO0A 4NA1A 2Y8WA 2PD1A 4HT7A 2B43A 3D54A 2RHSB 4LFBJ 1DARA 2Z4PA 1D9DA 4NZ6A 4OX8A 1NZAA 1FVSA 5IXUA 2A18A 4PABA 1U49A 3HHKA 2R3VA 2DY9A 4ZVFA 5CXTA 4CQ1A 3T1YJ 3MR5A 1R43A 2BJEA 3OR1A 2DR5A 4DZDA 3VZHA 2BQUA 5EWGA 1VQMS 1NKCA 2YNFA 1JMTA 3TUIC 4RR5A 5ETQA 5D3GB 3THVA 4KPCA 2MQQA 3EVWA 5T7LB 4YDDB 2D74B 2HQDA 1Q0NA 2IY5B 1RISA 3A8KA 2YPYA 2QC3A 2MQMA 4A48A 4ER8A 4B3MF 5HJXA 2CVIA 1R8HA 2XULA 3L95X 5HP1B 4FN5A 2Y1LB 1M1KT 1HHSA 1YITS 2LXFA 5KFXA 1VRQC 2Q66A 1K1SA 4I68A 1F3VA 4DX7A 3FQKA 2IAJA 4JI5J 2B4OA 1HNWJ 3TP2A 1RI7A 4JBCA 3RG6A 3RR7A 1TFWA 1L3VA 4QOTA 2HNZB 2WK4A 4W90B 1NBEB 5C42A 1BWEA 1KOOA 2GC8A 3A3NB 1R3NA 1TL1B 4J9KA 4DSFA 2WOMB 1X4EA 4EFAC 4WFXA 5F8JA 3C46A 1RJJA 2CKWA 2LEPA 2CIMA 5HROA 4NLDA 4MT1A 3M30B 3CJTA 3RGIA 3W62A 1LWFB 2AEFA 4KGMA 2D3UA 3Q2SC 3H4BA 2J9CA 1YGYA 4DEZA 2VC0A 1RTHB 5K14B 4HVZA 2CQGA 1S76D 2EK1A 5DZ7A 5E3PA 2EFOA 2DY1A 2CZ9A 5DO2A 1AT1B 2I0XA 1EKSA 3T9ZA 4DV3J 1R27B 4A8FA 4ID8A 1F3FA 2IHR1 4DV6J 2HMIB 2WBMA 2CJ9A 4ZPDA 1AYEA 2YPZA 1YJ7A 2IYGA 4ECVA 3M8PA 4WK1A 2SXLA 1BQXA 5D4PA 4LVNP 2XBPA 3CDEA 2E5HA 1I1GA 2HGLA 4LFCF 1RT3A 3MCSA 1WSRA 3J7A1 4FVMA 4O23A 3GV8B 1S1TA 2VHGA 3DRSB 4ED8A 2ZBQA 1SUQA 1XJWB 1D8ZA 2MJUA 2QFIA 1RLDA 1WACA 1BXNA 3MM7B 2UU9F 4PEOA 4QPTA 4G65A 4D3GA 2V69A 1VHFA 4OZ0A 4ILMA 1QAJA 2KH9A 1FJEB 2C2OB 3OW2R 2DK2A 5CCMA 3FEXB 1XNQJ 2VBWA 2LMIA 4NXMF 5GMEA 4DV7F 5LMUJ 2ZZMA 3DU5A 2NZ4A 2HFSA 1VQ5S 1YK9A 3H2VE 3M1VB 3D1HA 3UW1A 1QE1A 4HYKA 2GO8A 1YI2S 3D6MB 1J5OA 2YWWA 3KLFA 3FSYA 1QDUB 1MNEA 1CS4B 3E8OA 5JVGQ 2W8KA 3HHNB 3SXLA 3GU0A 4IO1A 3SFGA 3MEDA 4MIAA 4ED5A 3J7YI 2PFFB 3SSQA 4DV2F 1R8CA 5LXRA 2AHOB 2JRSA 1HA1A 1S9FA 2VONA 1CSJA 1QD1A 1FWKA 2OSRA 4UOGA 4AE5A 4QWCA 3ONQA 4U7UD 1S77D 3FK4A 4EZ6A 3H5YA 1U09A 3NS7B 2ILYA 4NEYA 2ZEJA 5KG3A 2H3EB 4B3RF 1OPZA 3RU0A 1N6QB 1IQTA 1U7LA 4FF3A 1KS2A 2MSSA 4DJBA 2CNKB 3BGOP 2A2DA 3OR2A 4DQIA 4PYDA 1X4FA 2VDHA 4J91A 5HMYA 1K0TA 3PX4A 2V4JB 3N0VA 2LYVA 2HWTA 4KBIA 1RTJA 3WIUA 1IJEB 1FK9A 2BJ9A 1H72C 3AJ1A 3POTB 1NB7A 1WHWA 2ZOGA 1UJ5A 2Q43A 2YWHA 2YNHB 4LSNA 1YJRA 5L39A 3KK3A 4EU0A 2GQQA 3I0SA 1S99A 4TY8B 3ZZTA 4MIWA 1TKXB 1MROB 4HEA9 3FRYA 2QX0A 2F8HA 4WCEQ 1QJHA 4NLPA 1T03B 3PXGa 1KC8T 4NYOA 4ETXA 4GO5X 1I5OB 1NDCA 4FNIA 5C2GA 4IH5A 1UKUA 2MLYA 3U1LA 4Z7YA 4NYPA 3IN5A 3A3OB 2BJDA 2KN4A 2VFUA 2VJUA 4FNHA 2OEJA 1UVMA 2CYYA 2Y0BB 1WG1A 3V4MA 3MUTP 4P2XA 2ZDPA 3D6HB 5J2NA 4KH0B 1RHRB 4L3KA 1F9FA 2DRDA 3QATA 2XGQA 1PAUB 3DOLA 3TRGA 3VR1A 4RUBA 3CNQP 1ELOA 3AQPA 4BWJA 2CQHA 2ZVSA 3MPWA 4NLYA 2XGPA 5L1IA 3HT0A 1VQKS 4HT5A 4Q43A 1VS3A 5IQQA 2HHXA 4DUZF 8ATCB 1ZM2A 3JSMA 3NY0A 4X4NA 4AUKA 3BF4A 4I6WA 2VQFJ 2Z2YB 2DH7A 3C2PA 1RABB 1N5TA 3MCMA 3I9V9 3CSKA 2GGPA 4ATNA 1GEHA 3BPDA 2QLXA 3QT6A 4U6PA 4J9RA 3MECA 1PJ7A 3BBBA 4Y0FA 3RB4A 4I7FB 3FBBA 2FVPA 3R5BA 2DNOA 2KFZA 4M63A 2VFSA 2GVZB 1VISA 1FD2A 5FD1A 2RRNA 5KTQA 2WSFC 3OPKA 1U8WA 4ZDNA 2C2NA 4CP5A 1HI1A 4B9NA 1HQ2A 3GIMA 4B9VA 4PG8A 1PILA 2DNZA 5LJ5Y 3HHLD 4DFKA 2BANB 3Q8PB 3NBPB 9RUBA 4DR4J 2BA9A 5EWEA 4K4ZA 1U25A 4K4UA 4IOBA 3BQ0A 8AT1B 3R7NB 1V3RA 2WTFA 2XZWA 3UVJB 4PWWA 4X65J 2E5LF 1FJGF 2VG5A 2NQPA 5HAOA 1YIJS 2BDPA 1VLYA 2I38A 3WX4A 4G1PA 1YSJA 5KFEA 2CPFA 4ILRA 3CIZA 2V4RA 1OY8A 2BYCA 5CYQB 4TLQA 2ZNZA 2CWKA 3EUNA 1PAEX 4NYZA 4Z37A 1KFDA 2QMUB 4LF9F 2RKIB 2ZOFA 1VIXA 2ALZA 1M5OC 4DF8A 1U24A 4K8RA 2FY8A 2DTJA 4KGXB 1X4BA 2AF6A 5D77A 3PV8A 1YZ6A 5LOQA 1NK4A 4CO0A 4HH1A 3FJ2A 3DI6B 2ZHOA 1IXKA 2BE7D 1RXOB 4RWWA 1VQPS 3IP0A 4JI6J 1UEVA 3WC0A 2X1FA 4CM0A 4XO0A 7FD1A 4NXNF 3LQVA 1S1VA 4L6V3 4DV1J 3SQOP 1S6OA 3LW5C 3FBCA 1KWMA 1CG2A 5CYJA 2E9ZA 1WKLA 2QLFB 3V2UC 2E5IA 4K2XA 2VG6A 1FWPA 2B3TB 4DV4F 4HL9A 1Z2ZA 2RQMA 3JXOA 2OPQA 2QG9B 3WDOA 3K2YA 3DM2A 4C0OC 1S79A 3OSNA 3MHYA 3IBWA 4DSEA 2FGCA 1S6QB 4JV5F 1TUVA 1BQMB 1QSSA 3Q22A 1OQ6A 4I69A 3DU6A 1UJ4A 1R8PA 2QA4G 2FY1A 2W2NP 2W9CA 1OO0B 4OV6A 4USUA 3LP1A 3CCZA 1U6BA 4CT9A 4DZ6A 1ROFA 2BE9B 1U1RA 4LSLB 5DJBA 1T9XA 3KLEB 3V5RA 2G0IA 2DIVA 1KSPA 3CD5A 5CZXA 2KYZA 2CQ3A 4J37A 2HK3A 2CPIA 5KFNA 2C1EB 1IBLJ 3KHGA 1SQGA 4J9LA 4CZCA 1C1CB 4U96A 2YX7A 4TU8A 4CCHA 1P8GA 3W3SA 4TY9A 2XEXA 2P9GA 3UI3A 1CPZA 1UEUA 2DRBA 2AZ1A 3N6MA 4GKKJ 3NNAA 2PA8D 2YKMB 5A6WA 3JAMY 1UW9A 1UVNA 4WFYA 3GFXA 5FDLB 4K7QA 2LDIA 1ZA1B 3Q8VA 1V6HA 2EKNA 2XMWA 1FXDA 4WBFA 5ITHA 2CPZA 1Z4UA 2CWXA 4F36A 4DR7J 4AFFA 1BLUA 1FXLA 2OPRA 3M8SA 3GR1A 4O4GB 2ZE2B 3TQ1A 1XMQJ 4KE5A 2XCAA 3PY8A 2ZC3A 1HBOA 4QIFA 4DG1B 2R8HA 5K5MA 1FA0A 4LF5J 1LW2B 4LRDA 1K1QA 3MM8B 2HPUA 3KHHA 5L38A 4X4SA 4QW8A 2R42A 4YHHF 2CVEA 1VQ4S 5A0YB 2DGSA 3MEEB 1XMBA 2ZITA 3IA0A 4PXDA 2LEBA 2MKSA 4ELVA 3MEGB 4QU6A 2R7QA 2V8VA 4F50A 3E01B 1GMWA 4A8WA 5T41A 3QAEA 1X4GA 2J8AA 1RQ0A 1HBMB 4ZA1A 2ZBIA 2JLEA 1YLXA 1JLCA 2XS2A 1EX8A 3BKTA 1TFYA 4NLXA 1JLAA 4J9MA 2RF2A 1A7GE 4ZVQB 1TK8A 2D3O1 2ASLA 2JEIA 1MLAA 3JQKA 3NWRA 2PFDA 5J1NA 1SXLA 3GONA 1KFSA 2HQIA 1TR0A 1D09B 3E3XA 1T9WA 4AD6A 1GMWD 3SMZA 1Q78A 3KHLA 2GIRA 5EDWA 3T6JA 5IV4A 3SCIE 4KFBB 1N33F 1NO8A 3KJVB 3V4IB 1J27A 2W25A 1X9MA 1HNIB 5KFFA 2EK6A 1VRUB 3R5JB 1DHMA 5F9NA 6FDRA 5T7LA 4JI8F 3OUYB 4JI2F 3FFIA 3UE2A 5IC4B 4NLOA 3ZZ0A 4NMLA 2OPPB 5HP1A 2JLFA 2RUSA 5AJ3F 2J6TA 1U1LA 1TL4A 1UL3A 4QU7A 2KKHA 2GHVC 3P3DA 4OI2A 4JV0A 3W8GA 3ZTOA 2DR9A 4F26A 4USVA 3K59A 4Y2KA 1IKWB 2KZMA 2HNZA 1NK7A 3W8PA 3TZXA 1IBMF 5DRKA 1HNVB 3R3TA 1CJTB 5J2PA 4BCAA 1TL1A 2FJBB 1JIHA 4L75A 4OFZA 2WOMA 1S7IA 3O44A 2NXNA 2MPUA 3PFOA 3G82B 3O3LA 1WEXA 3UDLA 1WC0A 3QJJA 3MPUB 4N41A 3A12A 2WW4A 1RAAB 3VF0B 3FSXA 3ZTSA 5GAEU 3ZXWA 1QVFR 4BC7A 3M30A 5F8IA 4JUZA 2JC1A 3IBFB 2YKPA 1WF0A 1LKZA 4OI3A 1RTHA 1IKXA 3P5TL 3QNWB 1L3SA 1FE4A 2O01C 2XLIA 2WVCA 3GCWP 2V68A 1F5CA 1OYEA 3U1NA 1HD0A 3PW2A 3HZEA 2IJFA 4CLTA 3GIIA 2HRTA 2EPIA 5BYQA 3IR6B 3CDUA 2IDEA 2XSFA 1M5SA 3BH6B 1GXUA 4LF6F 3TVZA 4USJC 2HMIA 1K44A 3T1HF 4V1Ak 3W9IA 1VI7A 3EJMA 3R8YA 4RUHA 1KQGB 2VPXB 3Q83A 1IBKF 2B56A 3BH7B 4IO9Q 3OD2A 3QBCA 3D3CJ 2ZBCA 4B3MJ 1SV5B 2B6AB 2E7XA 2VOPA 3DRSA 1K0VA 4WYLA 3JB9k 2J0WA 1ZTWA 2ADBA 1RWXB 3M6WA 2CNNB 1B7FA 3MM7A 4WPAA 1V5IB 1H2TZ 3FEZA 3M2VB 3G71S 2PIIA 3ZZRA 1KQFB 2R7TA 3TAMA 1K47A 1Y11A 1SC3B 2MKKA 2OSQA 3I31A 4P2MA 2WVDA 4KB7A 2RE1A 1N5QA 2FLNA 1NDPA 1UZHA 4IOAQ 1U0SA 4LBHA 1RDRA 2B51A 5ETSA 2DNNA 3CO9A 3LGHA 3CEDA 4YQWA 1LQ9A 2F63A 1IJFB 3K17A 3TJ8A 5L1KA 2J7UA 3NCQA 1CS4A 2PEHA 2DR6A 3UCZP 2KDOA 3QGHA 1TU0B 2LQ5A 5E2QA 1RT6B 1U1PA 2YKOA 3LALA 1SKUB 5IOLA 4MKBA 3HJVA 3K5OA 2DISA 1Q16B 1V3SA 3ITHB 4CTAB 3PIOQ 2KHDA 2EVZA 1KDNA 4FXVA 2HHPA 2KVQE 3GPAA 4ED3A 1VQSA 3ICLA 5K8NA 3K89A 3GIKA 3S6EA 3V6JA 1TP7A 4B9SA 3PM9A 1XIQA 1C1BB 4RW7A 2CQBA 1SCJB 1N6QA 4C7QA 3HSJA 5AE3A 1XBWA 3RAMA 4LRAA 2RDJA 3T5HA 5IV3A 1ITPA 1IUJA 2UUAF 3IAS9 1Q86T 2KG0A 1H73A 1UFKA 2JDJA 3CF5Q 1PYTA 4I0WA 4PG7A 4OZNA 2L3MA 5J1PA 2V4JA 2W01A 3QLHB 4LFCJ 3W1YC 3TAPA 2UXBF 3W66A 2H1YA 2FHMA 3M8RA 4F0HA 3A13A 1VQOS 4CO1A 3R5DA 3POTA 5A8RA 1JJHA 4OYXA 2VQEF 3TJAA 4M5MA 2LA6A 2ASDA 2UU9J 3EE3A 3I32A 1VQNS 4TY8A 5B0DA 1TKXA 3RBZA 4OX6A 1MROA 4LIRA 2PC6A 4RNMA 1GX6A 3TA1A 5KFGA 3H90A 4ZCMA 4NXMJ 3D3BJ 4C3LA 4WP3A 4QYZJ 2FGOA 2HFZA 4KV8B 2EG2A 3PACA 1WKJA 3Q8UA 3Q24A 4O44A 1X7VA 4ZMMA 5IM0A 3GP9A 3TEGA 5E3QA 2NUUG 1NNDA 3FC9A 3EPGA 2W4DA 2C2RA 3FNNA 3LPEA 4USMA 4DV2J 2HNDA 4IQMA 5KG5A 4U7UK 3TX8A 5M2UA 3ILLA 3IXQA 4C8LA 4EGLA 1JKHB 1NJWA 3MR2A 3TX0A 3NNCA 3DLEB 5LSRA 4FYVB 4B3RJ 2DH8A 2HSEB 2HFUA 1HWJA 1WHYA 3HZGA 2F4FA 2Y9HA 3KKFA 2ACMA 3UDEA 2HQ3A 3OLAA 2H48B 1HQUB 2QSFA 5K9FA 2XM3A 1B0VA 3KLGA 2LQJA 3F44A 2DHXA 2BW2A 2H5EA 4DQPA 4RNOA 4I7FA 2QO3A 2Q1LA 1VC0A 3TUZC 1GXTA 2M4MA 4DL2A 4NLQA 2OP5A 1UJ6A 3W5YA 2ZHBA 1NK6A 3NL0A 2R9LA 2GVZA 4OZLA 4OJ3A 4WFNQ 2E66A 1YWXA 1FKAF 3PW7A 1U2RA 2L9WA 1RAGB 1NRKA 2FZKB 2JNJA 2J5AA 2OFHX 1DFDA 3R5CA 2HHSA 3D6TB 1EQ0A 3L09A 2Z30B 4CLFA 1YDLA 2ROPA 4KGZB 2BANA 1SIZA 3NBPA 3N4WA 1YZ7A 3CT9A 4LF7F 4KHMA 2Q6CA 4CYUB 4O3PA 3C14B 3PJWA 2H51B 2QYGA 1JLGB 4RKUC 1FDBA 1I51B 1NK0A 2GAGC 2Q3PA 3OL8A 1Q8IA 1S9GB 5L9XA 3EYZA 2FZCB 2M88A 1WC4A 2F3JA 3GR0A 3PRDA 3W2VA 3IAM9 2FHJD 1CJKA 3DGVA 3AA9A 3OFGA 4FKXA 3UWTA 1DQAA 1F9EB 1YJVA 2NCKL 1EETB 1H38A 2RKIA 3G86A 3EGVA 1RSCA 1UTAA 1PG5B 1CVJA 4DUZJ 6FD1A 5KFYA 4TVAB 1VBZA 4C48A 5B09A 4C3KA 3NGKA 2HBYB 2VIHA 2ASJA 1NU4A 3DI6A 1OMSA 2Y1JA 1U26A 4R0JA 2VV5A 1AROP 2ZDOA 3BKFA 3PEJA 2FJEB 3JQJA 3NGUA 3MM6B 1S0VA 2V6AA 3AD9C 4QWEA 3MFIA 3VGTA 2FZGB 2F5GA 3GJRB 2J7KA 5B0AA 2LXIA 3A8JA 1YBTA 2H4YB 3OTEA 2KT5A 1SC1B 4MH8A 2YNFB 2VUGA 3VAHA 3JYTA 3M32A 2HLUA 4PG4A 1RE1B 4I6YA 1WG4A 2C2MB 3K5PA 3R7SB 4DSIA 2HIYA 3CJRA 1FNOA 4DMZA 1S6QA 4XDCA 4QZVB 1Q1KA 2D3ZA 1EZZB 1BQMA 3C6UB 4LR7A 3TAQA 2E5LJ 3ILJA 4Q2MA 3T6BA 1FJGJ 1HW8A 2X51A 3IWLA 1SH3A 2AGOA 1RACB 1VBKA 3BM7A 3F41A 2N3OA 2KJWA 3O5TB 5E3RA 2OHDA 2ZBRA 4P2FA 3TZZA 2XWYA 3BSOA 3EDQB 2DNGA 2BUNA 3RJMB 2YX4A 3KLEA 2ZJQQ 3DXSX 4KHRA 1F2HA 1Q53A 4LF9J 1HI0P 5MLCV 2QA1A 3OTOJ 5LJ3Y 4M5KA 2M5YA 2BXJA 3L9ZA 2IM2A 5F8HA 4OJGA 5B0BA 3CCQS 5KFQA 1FEHA 2V2ZA 1HNXF 5A6PA 2UVVA 4OI4A 2OJ3A 2E29A 1BGXT 1T11A 3NAHA 1RA7A 2YBVA 4RNNA 2H9ZA 4ZP6A 4U8VA 2BKPA 3TR5A 4ED7A 4F3MA 3QYYA 3MUVP 4NXNJ 3BDEA 3KJFB 4K2JA 1L5UA 2YKMA 1D3WA 2H4WB 2H5JB 4Y28C 3OXLA 3CVKA 1CQNA 2IBOA 3TZWA 1M5KC 2K3IA 3UPFA 5FDLA 2ZH5A 4DV4J 3DDIA 4NRUA 4DSJA 2AEMA 5KFRA 1HPZB 3JTNA 2W2OP 1HWLA 2VBYA 3UFCX 2NYHA 2DHAA 2BQRA 2XI3A 2RILA 1Y10A 4ECWA 2CQPA 3KMQA 3GFZA 2XYHB 4OHZA 3AY0A 3L4BC 5D4OA 4DG1A 3CD0A 4U7CA 2G0CA 1HBNA 3TUJC 1S1XB 4TXSA 2R2UA 2FQQB 4JV5J 3KDOA 1LW2A 5ETRA 3MM8A 4Q8FA 2UUWA 1RB0A 2P9EA 3GG0A 4QIGA 4LQ3A 3BBFA 4X4QA 2HQGA 2PMHA 4JI4F 5A0YA 3MEEA 2QLJB 3BYPA 3C15A 2DXEA 2QEXS 4HACB 4O0IA 5EN1A 1RHMB 5L46A 2X1BA 4P71A 5IT0A 3MEGA 4V19J 2DD8S 2QL9B 1U6FA 2EG1A 2E9RX 1HBMA 3CCLS 2MY7A 4EBEA 3SV3A 5GMDA 5BYSA 2DGUA 2IJNA 4USIA 1BQNA 1MW7A 1RT1B 2VPZB 4AQYF 2B4VA 1ACMB 1FDDA 3B4MA 3PYGA 3CJ0A 2D9PA 4F4KA 1PSDA 1F5BA 4NLUA 1F2GA 4KFBA 1SL0A 3V4IA 2Z0GA 2HHHF 5KOWA 3EXCX 3CMAS 2JEFA 1ZTTA 1HNIA 3D67A 2AKWB 1NH8A 1YRUA 2RIJA 3O2IA 1U6ZA 4I2PB 2W24A 2RHQB 2Z8QA 4QBUA 4CH1A 4ED0A 1QSYA 5KG0A 3M7VA 3CULA 2CXEA 1KR4A 4DPWA 2VQFF 5JMNA 3KNGA 4ZOSA 2DGVA 1YRTA 1IKWA 1Y4ZB 5DGBA 2ACYA 3IRXB 1HLWA 4MKYA 3R9LA 1XNRF 5EX0A 3VAJA 4GKJF 1CJTA 4O0NA 3CJ2A 3M8YA 5H1SV 2DGTA 2AX0A 1P6TA 2AWZA 2J0QD 1LV5A 2HHWA 1NK8A 5ETOA 4YHHJ 3DCAA 2CPJA 2KXFA 2XO7A 1BWVA 4LSNB 2BX6A 1A6LA 2XY6A 3KK3B 2PI5A 1WNEA 4ZCKA 3DRPA 5F8NA 2IPOB 4Q44A 1IM4A 2X7IA 3H59A 3P45B 4NOHA 2CQIA 1CEZA 4NCAA 1K9MT 1KLNA 4YY3F 2D7SA 4TLRA 4AT1B 1FCAA 2LQ8A 2HRUA 3Q89A 5KG7A 1NB2A 3MUMP 3E2EA 4ZVTB 3BREA 2A6OA 4C0BA 2PSZA 3TEHB 2CQCA 3H8YA 2N7YA 3BSNA 2DGWA 1N33J 4GVBA 4QWAA 1KD1T 1HBUB 2DNRA 2RS8A 4JI8J 2FJVA 4HI2A 4JI2J 1WOPA 1EHWA 3U7JA 2HFOA 1UMJA 1SV5A 3AA8A 5G4DA 1LNQA 1QSLA 4E98A 1QAYA 5AJ3J 4OX9F 3VAIA 1RTZA 4DL5A 2FIUA 4DFPA 4A8OA 5F8LA 1MWZA 4M5JA 2W2MP 1V5VA 4OZ2A 2B9WA 3KK1A 1RTIB 1R31A 2KRRA 4LIWA 4ECYA 2EXUA 2VA2A 2OLWA 1SJFA 3M2VA 3M6VA 2V8GA 1IBMJ 4RW8B 1TL3B 1XWLA 2OELA 4RW6B 2OPSB 3CC4S 2JH3A 1NCLA 5KFOA 4DL0C 3K57A 2VL1A 3SIPB 4L3NA 5LXYA 5AE2A 1ZM3A 4RU9A 1X0FA 4XK8C 1RAIB 4EO8A 3AHPA 3IR5B 3I56S 4LRBA 1S1WB 2YXLA 4DV5F 3U02A 3KTQA 1VJWA 2GJFA 4J9SA 4C8ZA 4N47A 4ZIWA 2ADCA 2ALYB 4N56A 2N3LA 4CNZA 3KLVA 4CO4A 3IRWP 3CDAA 3KK2A 4I2QA 2GAHC 4BHQA 2ZJRQ 5FLXU 1T9YA 1P1TA 3ITHA 4NE9C 3EZUA 3H0PA 5E5NA 4DL3A 3NP5A 4WKYA 2G1DA 2O5DA 5DM6Q 2JVRA 1LK7A 2XNQA 3CC2S 2BMBA 1C1BA 1LEOA 4EO6A 3J81Y 4LF6J 1FDNA 5HLFB 2JOQA 4P7VA 2EW9A 1HARA 3R1HA 3QGGA 3T1HJ 2HVIA 2ZWOA 4A8XA 3LANA 1IBKJ 1N4LA 1WD6A 3VCDA 2JC0A 3DLHA 1TVRB 3D68A 1T0TV 3HFKA 4DR1F 3FMBA 5GAEI 1QLNA 1G3OA 1K73T 3OVSA 2DNKA 4ANCA 1YJ9S 3H25A 1X5OA 1M5PC 4XTTA 1VJQA 2JL9A 1NPKA 2VKRA 5DM7Q 2KI2A 4ZLNA 1NK5A 3SDEB 1S1UB 1FJCA 3PO4A 5E3CA 2FLOA 5KFAA 1OY9A 2XMUA 5A8WA 1S57A 2M52A 2QE5A 4DBQA 4DHVA 4GKKF 4UY85 4NASA 3MR7A 4HKQA 1N0VC 1HL6A 2P6TA 2C3PA 2YQ0A 4NPOA 2B7BB 3CO0P 2KM8B 1URNA 3ETMA 3IWNC 2G2ZA 2QRRA 1MSWD 4MK7A 4ZVHA 1UEKA 3THTA 3G96A 1EP4A 1QY7A 3CCMS 2MMYA 2ZUAA 1SVDA 2JHEA 4CLKA 1KTQA 3B4DA 4CLWA 4QYZK 4Q5VA 4QWDA 1RKIA 3FEYB 1RYRA 2B9EA 2OIHA 1JKHA 1NH7A 3IO1A 4RPFA 1S72S 3KWMA 4DQRA 1N34F 3DLEA 3OJUA 2R2RA 4X4TA 4FF4A 1SI9A 2QMWA 3JSBA 2QTWA 5I4MA 1HHQA 3SFUA 2VD3A 5IT9U 2J0SD 1V9OA 2UUAJ 2RMLA 2W9BB 2OMOA 2ZH2A 4X4RA 1JK9B 4WU3A 2UUTA 2HRYA 3C19A 2UXBJ 4MIBA 1NXIA 1O6XA 2K7JA 4DR2F 1X4DA 2FVSA 5ETNA 4J9QA 5HSPA 3BQ2A 2VQEJ 1S5ZA 1PJ5A 2FJDB 1CJVA 1P1LA 3EDRB 1ZA2B 4DLGA 3ZZZA 4URSA 1WDTA 1U48A 4ZK7M 4Y2CA 4K4XA 1GX5A 5LMNF 3MMBB 2OFGX 2I2YA 1RWWB 3LF0A 2V67A 4IOCQ 1U0HA 3UR0A 1AFIA 3VHQA 5L1JA 3BKUA 4HHUA 1UP1A 1DAXA 4OHXA 4Q8EA 2IJRA 3A8EA 3HT3A 3P6YC 5DDRC 4ZPCA 4CYUA 3C14A 1QTNB 5J1EB 1YG0A 2DNPA 1N5SA 3DRXA 4HI1A 4RL1A 1JLGA 3D1OA 3VWSA 3T5JA 4WJBA 1FNXH 2W2QP 4H4MA 1IR1A 1U1QA 2ATCB 5B0CA 1X5TA 4QPXA 4IG0B 1CULB 4UQTA 2N4CA 2D1CA 1VQYA 4F4AA 1XMOF 3EM1A 4F8RA 3VTIA 4H4KA 5D0RA 2HGNA 2CZ4A 4ES3A 2DKOB 2QA2A 2YTCA 4URQU 3ZNJ1 1NPRA 1EETA 3ILOA 4NA2A 4DR5F 4CH7A 1LFPA 1YKWA 2ATLA 3K5NA 5HL7Q 3Q23A 3HPOA 4BLGA 3IGVA 5M2RA 3MOZA 4AXJA 3ENWA 4FPRA 1RADB 2MDAA 2RUGA 3R97A 1GTHA 1JB0C 4DV0F 3HF5A 3CWJA 1UWAA 5KFSA 4OI1A 4CLUA 1HHTP 1KVIA 3PHTA 5J2QA 4LBIA 2WONA 3MFHA 3FRZA 3DRYA 2RF2B 3LWMA 1M1HA 4IG3B 5AXLA 4CO2A 1IR0A 3BR8A 3MGJA 4C8MA 4OZ5A 3M2RB 2AYGA 3PHEA 1FKOB 5KAKA 4LBPA 1QM9A 4PRFA 3TI0A 2R8KA 5F3TA 3RZAA 1TL7A 1YJUA 5GVQA 1NDLA 5KFIA 4ZPBA 2J76E 2KT2A 5K8OA 1O8BA 3RW6A 1T9TA 2D9OA 2XHCA 1WTBA 4C3MA 4G1QB 4X84A 3FFIB 5H9FJ 5FLXY 4CNYA 2HWIA 1JJCB 4LF7J 3GILA 3EVOA 1URRA 1GXLA 3G6YA 3C6UA 3SSRA 3RAXA 2WRMA 4EBCA 2XCPA 5DETA 4OZJA 4CWBA 2KG1A 1R8AA 1TQLA 4DR3F 3NGDA 2F7VA 3RRGA 1U2FA 1WTFA 4USWA 2VFRA 1SQEA 5J2PB 1U45A 3W9JA 1NHUA 5FIIA 5CCLA 3MAHA 3HVRA 3W2WB 1Q7LB 2VODA 3DHWC 2P6SA 3SEOA 1X60A 1FFSB 4ZPVR 4UT4A 3CCES 3TW0A 3NGTA 1SB6A 3OL9A 3CMQA 1VRTA 5KOXA 2MHNA 5SUHA 2C2EA 4PPZA 2C3OA 3G8TA 4Q2LA 4WK3A 4DQQA 3HMJG 1IKXB 3DLKA 1UWBB 1N36F 1Y9OA 2ZUGA 2V2QA 2R7OA 3IC1A 1H3DA 4ECTA 3NOGA 2VICA 1TZ0A 2KVIA 1SQFA 4FF2A 3BQ1A 4YUDA 3Q8RB 2FHKA 3LUYA 2U1AA 1R8BA 2FPHX 2WAQD 3GSIA 3NEKA 1HPZA 1DURA 2DO4A 3IM8A 5E3AA 2P8IA 1UFLA 1KRPA 3B8HA 3RR8A 2W4CA 4CO5A 5KT2A 5FJ4A 5CA5A 3JTPA 4DSKA 2MQPA 1FEEA 3G8QA 5HVFA 1S1XA 4OI6A 2BJ7A 2BM1A 3ISND 3P8BB 1BC6A 3RYLA 3KUEA 2W2PP 3F73A 3HSGA 1Q8LA 1X31C 2F9JA 3RB3A 3WIVA 3BYRA 2MKIA 1Q7YT 4OYPA 3AODA 4HACA 4K4YA 1RHQB 3TAMB 2GMHA 2XLKA 2FHOB 5IT9Y 4M8LA 1TTHB 2X1AA 3DLGA 1AZSA 1R6VA 1JXVA 2GX8A 3HI9A 4D3HA 2MZSA 1RU1A 1CC7A 1FE0A 3MTKA 4IYQA 1JXEA 3H2LA 2RAQA 1RT1A 2XY5A 4IFYB 4A8QA 1AB8A 2CG8A 1Q79A 1UVIA 4DCOB 4FVCA 1EJ7L 1WUUA 2C2KB 1NKBA 1HNXJ 4X4PA 1FI4A 4Y6IA 3IS9A 4LR9A 1PYSB 1X8DA 4DUTA 3QFHA 5AXKA 2YWKA 4I2PA 1BUXA 2RQ4A 1RYSA 2EBGA 3IG1B 2ZH4A 2B9XA 4W4MA 2B5JA 4RW7B 1RTDB 3UQSA 4K4TA 3HP6A 1OY6A 3MR6A 3VQSA 2CQDA 3DOKB 2GNKA 2P5VA 1RWUA 3OT9A 2KZZA 3MF5A 2O3DA 2QYCA 3IRXA 2AJQA 4DX6A 2UXCF 4Y2AA 3N28A 4P72A 4L76A 2HHQA 4C4WA 3KJNB 4LQ9A 1IVZA 3ETOA 2BOAA 1YTYA 4A8SA 1RAFB 2CJKA 3HKWA 4ZVGA 1KQSR 4X2BA 3OXGA 1KNZA 3W7BA 1J5EF 1IKVA 2KT3A 4UW2A 2DHGA 3BDPA 5D8HB 5A8RB 2F4VJ 4JI4J 3CIMA 4ZN1A 4ALZA 2YVSA 3EVMA 3LTOA 4DUYF 3QSYB 2CJXB 1N8RT 1NSPA 3RTVA 2LQBA 2HHTA 4CDIA 3KDNA 2BACA 1WG5A 4OX7A 2POKA 2J6SA 4OHVA 4P10A 2OAUA 1YBUA 2IA6A 3JAMU 4BDPA 3VZIA 4AQYJ 3MDFA 4O44B 3PYDA 1BE4A 2Q79A 5IM0B 3GIJA 1UVJA 2MKCA 2FJXA 5IWAF 1NLKL 1LWEA 4HLBA 2FUG9 2DEIA 3V6DB 4OV1A 3J7AN 4HR2A 2HHHJ 4J9PA 1T3OA 1KVJA 2M2BA 2ZH1A 1H98A 1FRMA 2ZFHA 3BEGB 1HBUA 2HNDB 5DQHA 1BY9A 3VGVA 4PYAA 1XEZA 3ISZA 2BV3A 2FVQA 3JSYA 3PW5A 4FYDA 3FDSA 4NCGB 3H5XA 1CBKA 5F41A 2D69A 5EX3A 4HHJA 4W98A 2AMCB 4X4OA 2MLZA 2IM1A 2ZD1B 2HAFA 4BC9A 1VGYA 9ATCB 4FS2A 1JNZB 3S1TA 1RTIA 4DOZA 2XHWA 4WP9A 1G1XA 1W25A 2I5JA 4C8OA 2RSQA 1XNRJ 3KLGB 4GKJJ 2VFTA 4RW8A 1UVKA 1MN9A 1TL3A 5HQ8A 4PCQA 2B0GA
chains in the Genus database with same CATH topology
3GR0A 4NZ6A 3PRDA 1W2BR 1H2UX 4OX8A 1NZAA 1TKZA 4Q0BB 4RW6A 2OPSA 3OL7A 3W2VA 1FVSA 3IAM9 5IXUA 1LWEB 2A18A 1U49A 3HHKA 2FHJD 5GADI 4EZ9A 4ZVFA 3I0RB 5CXTA 4R25A 3AA9A 4G6VB 3N9UC 3HJFA 4CQ1A 2MQOA 3MR5A 1R43A 2BJEA 3OR1A 2DR5A 3OFGA 4EEYA 3SSSA 3VZHA 2BQUA 2ZKTA 5EWGA 1VQMS 3PRBA 3UWTA 1NKCA 2YNFA 2C3MA 4B3OA 1JMTA 3TUIC 3GQCA 2RH3A 1DQAA 4RNHA 1J2VA 2ZM6F 4NLWA 5D3GB 3THVA 2VZ9A 1YJVA 5HI7A 1Q81T 2MQQA 3RBDA 3ZZUA 1EETB 1TKTA 1VQ8S 1S1WA 5T7LB 4XDDA 4YDDB 2EFPA 4N76A 2JVOA 4C2MA 1H38A 2IBKA 2D74B 2RKIA 3G86A 5KT7A 1LWFA 2IM0A 4NZ7A 1LXJA 1RISA 2IM3A 2MB0B 1CVJA 4KC5A 2LKZA 2MQMA 3N01A 2YH0A 4A48A 6FD1A 4P6QA 4B3MF 2CVIA 1R8HA 4JI3F 1FKPB 2XULA 5KFYA 1H6KX 3L95X 5HP1B 4FN5A 1VBZA 1M1KT 5IS2A 5B09A 1WI6A 5K14A 1HD1A 1HHSA 4C3KA 4H54A 1YITS 2LXFA 3NGKA 4DL7A 4KO0A 5KFXA 3JTOA 5B0FA 2Q66A 2AJFE 3HHEA 2ASJA 1K1SA 4IFVB 4JI7F 4I68A 1NU4A 3FQKA 1HQEB 3DI6A 3J80Y 5DG8A 4I4BA 2WW8A 2Y1JA 2IAJA 3DXBA 1U26A 4IDKB 2B4OA 4R0JA 2L9NA 3X1LB 3TP2A 3ULHA 2GMJA 2VV5A 3QJPA 1RI7A 1AROP 2ZDOA 2NYIA 4JBCA 3PEJA 4FP9A 2FJEB 3RR7A 2W9AA 1TFWA 1L3VA 4QOTA 2HNZB 2WK4A 3BN7A 3MM6B 4W90B 1S0VA 2I5JB 5C42A 2DGXA 5BJRA 2XNRA 1BWEA 1KOOA 2GC8A 3HHLB 2KFYA 2PE8A 4QWEA 1R3NA 3CCJS 1M5VC 2MYFA 1TL1B 3MFIA 4J9KA 5HLFA 5BR8F 1GNKA 3O6QA 5F9LA 1JXLA 2QMXA 1JLBB 3LGMA 4DSFA 2WOMB 2BQ3A 1O5JA 5IFMA 3W2VB 2J7KA 5B0AA 1X4EA 2QLWA 1XR5A 4EFAC 2LXIA 4HTJA 3OTEA 2KT5A 4WFXA 5F8JA 1QAXA 4MH8A 5GMKa 5IZHA 2KB2A 2BOPA 2R7VA 2J9EA 3C46A 1RJJA 4K4SA 2AX1A 1S0OA 2CKWA 3DNCA 4QQBA 5I3QA 3PO5A 2YNFB 5D78A 1TVRA 1C0UA 2LEPA 2VUGA 3VAHA 4NRTA 2CIMA 4MYTA 3Q2TC 5C25B 4IH7A 3JYTA 5HROA 3M32A 2HLUA 1MWYA 4PG4A 4NLDA 3HVWA 4PXBA 3GSDA 3M30B 1X4CA 4I6YA 3BSAA 4RW9B 1LWFB 1RAJA 4KGMA 2D3UA 1WG4A 3Q2SC 3OV7A 5E0OA 3OTOF 3H4BA 1KOHA 1YGYA 2J9CA 3K5PA 2AYBA 4F2SA 4DEZA 1UVLA 4DSIA 2VC0A 5KFWA 3AQOA 1FNOA 3PJXA 1S6QA 4XDCA 4DMZA 1RTHB 3CJKA 2MQLA 4QZVB 1Q1KA 1S6PA 5K14B 5EGYA 4F4YA 2D3ZA 3OVAA 1SBRA 4LUBA 3CD6S 4KO0B 3DOMA 3KG1A 4HVZA 3SDEA 3MR3A 2CQGA 1S76D 1BQMA 3C6UB 1T05B 3GWCA 1S1UA 1RT2A 2PN6A 1VQLS 3FZBA 2DHSA 3M05A 1N5YA 2EK1A 4IH6A 3HDSA 1JJ4A 2A3JA 2M8HA 2UUBF 2L9DA 1VK3A 3TAQA 3SQGA 2D41A 4Q2MA 5E3PA 2EFOA 3T6BA 1HW8A 1DLOB 2MXYA 2X51A 3IWLA 1SH3A 1DZ5A 4X62F 2AGOA 5DO2A 2I0XA 3BM7A 1HFEL 3F41A 4ZPWR 3K5MA 2N3OA 1FVQA 2KJWA 3O5TB 3T9ZA 1D9FA 2B7CB 1R27B 4A8FA 5KFHA 1JNRB 1N32F 4K0KF 2HLTA 2JWNA 3KLIB 5E3RA 2XWXA 4YDXA 3UCUP 2QA4S 4MFBA 4ID8A 3M1VA 2CDQA 2IHR1 4O3QA 4B08A 2HMIB 4KTQA 2MKHA 2XWYA 4KAIA 1H7WA 3BSOA 2WBMA 2CJ9A 2DNGA 2BUNA 4RLEA 4ZPDA 5LL6d 4GC7A 1S97A 2IYGA 4N8OA 2YX4A 3V6KA 3EGWB 4ECVA 2EI5A 2GCFA 3KLEA 2DR7A 2YKAA 3M8PA 4WK1A 4IRCA 2RVJA 2SXLA 5JVHQ 1BQXA 5D4PA 3I4HX 4Z2XA 2ZJQQ 3DXSX 4KHRA 4LVNP 1WF1A 1Q53A 2XBPA 3CDEA 4ES2A 4KHPF 2KTQA 1HI0P 5MLCV 3RBEA 2QA1A 1XTZA 2E5HA 1I1GA 1C0UB 4ZP9A 5LJ3Y 1DTTA 1ZAVA 2HGLA 4TU9A 2M5YA 3M6UA 2IRUA 4LFCF 1RT3A 3JYTB 3MCSA 2BXJA 2IM2A 3M32B 3TVYA 5F8HA 3CJ4A 1SKRA 3J7A1 3LAMA 4FVMA 4TKTA 4O23A 4OJGA 4QYRA 1S1TA 5B0BA 3GV8B 4F4XA 4A8YA 3HK2A 1SJ1A 2L08A 2RNEA 3HKZD 4TQRA 3DRSB 3TNVA 4ED8A 1SUQA 3CCQS 1D8ZA 2MJUA 5KFQA 1FEHA 1HNXF 5A6PA 2UVVA 4OI4A 4B3SF 2OJ3A 1LWCB 2E29A 4N8NA 1WACA 1BGXT 1PGZA 3NAHA 1SJ4P 1RA7A 4RNNA 2WB1D 3MM7B 3CJKB 3WZ0A 4KSEB 2H9ZA 2YQ3A 4ZP6A 5HMWA 2XI2A 4ELUA 4LFAF 2UU9F 2FC9A 3TR5A 4QPTA 4ED7A 3RRHA 4F3MA 3QYYA 4D3GA 3MUVP 1T95A 3BDEA 1N5YB 1VHFA 2K1RA 4OZ0A 2DBBA 4ILMA 3CGIA 1QAJA 1L5UA 2KH9A 1E6VA 4DPOA 1FJEB 2VC1A 2YKMA 3OW2R 4XAKA 4OJHA 4ID5A 2DK2A 5CCMA 3D5MA 3FEXB 2VBWA 1D3WA 4M5DB 1C4AA 2LMIA 4NXMF 4Y28C 3OXLA 4DL4A 4DV7F 1BD6A 2RD5C 2ZZMA 5G0RB 3DU5A 1Q4RA 3CVKA 1CQNA 2IBOA 2NZ4A 2UUCF 1M5KC 2E9TA 3RRKA 4WE1B 4O3SA 2W9BA 2K3IA 3UPFA 1VQ5S 2F8MA 5FDLA 4F67A 2ZH5A 1Z1ZA 3H2VE 3MM9B 1FRHA 2RRAA 3M1VB 3D1HA 2JFKA 3UW1A 1QE1A 3PR5B 4HYKA 4NRUA 4DSJA 2GO8A 1YI2S 5KFRA 1J5OA 1HPZB 3CJ3A 3E51A 3JTNA 1XK8A 2PO4A 3OL6A 2XLJA 3FSYA 3KLFA 4RW4B 2AW0A 3OFEA 1MNEA 1HWLA 2VBYA 2VKZG 3MXHP 2LU2A 3UFCX 2BQRA 2DHAA 3E8OA 2XI3A 3MD1A 5D6GA 2RILA 5JVGQ 2W8KA 3HHNB 4Q45A 3SXLA 1VIOA 4ECWA 2CQPA 4A8KA 1U1MA 3KMQA 3GFZA 4IO1A 3SFGA 3MEDA 4OHZA 4MIAA 2M70A 3AY0A 2UV8A 3OHAA 1T8EA 2UVUA 4ED5A 5D4OA 4DG1A 3CD0A 3SYZA 4U7CA 3BO3A 1HBNA 2G0CA 3J7YI 1TL5A 3TUJC 2PFFB 2YNHA 1S1XB 2VG7A 4TXSA 2R2UA 2KU7A 3SSQA 4DV2F 1R8CA 4AYBD 5LXRA 5KG1A 1LW2A 3DMJB 2JRSA 4DS5A 1TAUA 1HA1A 2C2DA 1S9FA 2VONA 3MM8A 1C4CA 2UUWA 1CSJA 4Q8FA 2DCUB 2P9EA 3GG0A 4ZP7A 1ZZNA 2IRYA 2V9WA 2OSRA 4QIGA 4Y00A 4LQ3A 2ZH6A 4X4QA 4AE5A 4QWCA 3QMQA 3ONQA 2PMHA 4JI4F 1S77D 2DITA 4RNFA 2K7KA 5A0YA 3MMBA 4QJVA 3MEEA 1TK0A 4EZ6A 3H5YA 1U09A 1T03A 2QEXS 4IR1A 3DRRB 2ILYA 4O0IA 1DQ8A 5EN1A 5KG3A 1X4AA 1O51A 3V81B 2X1BA 1YVFA 1SIWB 2WSEC 3T9NA 3JSRA 5IT0A 1E6VB 3MEGA 4EWTA 2YNGB 3OJSA