3VAHA

Structure of u2af65 variant with bru3c4 dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
174
structure length
174
Chain Sequence
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title U2AF65 adapts to diverse pre-mRNA splice sites through conformational selection of specific and promiscuous RNA recognition motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/dna
molecule keywords Splicing factor U2AF 65 kDa subunit
total genus 40
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vahA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vahA02
2KRBA 5GAHU 2RS2A 3LPYA 3TP2A 1YIJS 4WKRA 2MPUA 3JB9k 3S8SA 1WHVA 2DGSA 1KQSR 2HYIB 3UCUP 2LCWA 2FPHX 2KT5A 4IOCQ 2EVZA 2F9JA 2MQPA 1VC6A 2RNEA 2AD9A 2N82B 4F25A 2JRSA 1KOOA 2HZCA 2MKHA 1FT8A 2RQCA 4UY8T 2OSRA 2VOOA 2DHSA 1YTYA 5JVGQ 2DNQA 2CQBA 2KN4A 1VBZA 1K9MT 1S79A 3Q2SC 5LJ5Y 1VQ6S 3Q2TC 2K3KA 3G8SA 3V4MA 1WF0A 2DNMA 3RW7A 3G4SS 2WBRA 5DETA 4WFBQ 3BO4A 1H2TZ 2DGXA 5LXRA 1NO8A 2DNOA 1SXLA 3MI7X 3BO3A 3EGZA 1BY9A 2YTCA 2D3OR 3CC2S 1F9FA 3THPA 5H1SV 3J7ZT 5CYJA 2CQIA 5LXYA 1U1QA 4YB1P 1KOHA 2CQPA 2DHXA 2MQNA 3MOJB 2RRBA 5GADU 2X1GA 2FY1A 2RT3A 1WF1A 1FJEB 2AYGA 2M7SA 5BJRA 2MSTA 1VBYA 3TO8A 2LECA 4CH1A 2LEBA 4TU8A 1U1OA 3NS6A 4UQTA 2MQQA 3NNAA 3CCLS 3CUNA 2SXLA 1YJNS 2DH9A 2LMIA 2VODA 4QPTA 2KH9A 3G8TA 1VQ5S 3VAFA 3CCMS 2U1AA 3G71S 3CC7S 1FJCA 1JMTA 2DNKA 1VC0A 2LKZA 1U6BA 4WCEQ 2MYFA 3EGNA 3VAKA 2CQ1A 4OZ0A 3VALA 2RRAA 2DH8A 2G1DA 5IM0A 2EK6A 2L08A 4PR6A 3VF0B 5CA5A 2DO4A 2VONA 2CQ2A 1VQ8S 4YUDA 5CXTA 2KXNB 2I2YA 1YHQS 4YOEA 1N52B 2DNZA 2OIHA 1X4DA 2CPEA 2EK1A 2LXUA 1DZ5A 2NZ4A 2CPXA 1D8ZA 1X4EA 3CCES 2MMYA 3US5A 1HD1A 1Q7YT 2M52A 2KHCA 1UAWA 1H2VZ 1FHTA 4FXWA 2ZJPQ 5DDQC 1P27B 1M5VC 5JVHQ 1U1RA 2DNGA 2XSFA 1WF2A 1PGZA 1WHYA 2KFYA 2MZ1A 1A9NB 1WG5A 2CQCA 4Y0FA 3BO2A 2CPHA 2ERRA 3CCUS 2GO9A 1SJFA 2KXHA 1QM9A 5D77A 1WEXA 3UCGA 2L41A 2E5JA 2M70A 1X4GA 3P6YC 3PIPQ 2MXYA 3NMRA 3CCSS 3B4MA 1HA1A 2JWNA 1RK8A 1M5PC 1KD1T 5LJ3Y 5HO4A 3I55S 2L9WA 2D9PA 3P3DA 2KU7A 3MDFA 1WEZA 5DDRC 3UE2A 2DNYA 2DGOA 2KYXA 5LSLA 3MXHP 4CIOA 1KC8T 4A8XA 3R27A 3G9CA 1O0PA 3P5TL 1X5TA 1M1KT 3BS9A 1D9AA 2DK2A 2U2FA 1K8AT 2A3JA 3EX7B 1X5PA 1K73T 2DIUA 2YWKA 3PIOQ 2AYBA 3NNHA 2MJUA 1U1PA 2N3OA 2B0GA 5DM7Q 2MKCA 2CQ0A 3CF5Q 4IO9Q 1SJRA 2DNRA 1VQLS 2DHAA 1WG1A 3G6ES 2MZTA 2Q79A 3FEXB 2UP1A 4P6QA 2DIVA 3MUTP 1VQMS 1YWXA 2DO0A 2YKAA 4LIRA 4TU7A 2M0GB 2DH7A 5GVQA 1U2FA 1YJ9S 1JJ2R 3MURP 1FJ7A 1U1LA 2KG0A 1N88A 1R8PA 1A7GE 1S72S 2ADBA 1QVFR 3MD3A 3DXBA 2BOPA 2DGTA 4U67Q 3FEYB 1U1MA 1X4AA 1WG4A 2V94A 1UP1A 1WWHA 3SXLA 2KRRA 1U1KA 2G0CA 5IQQA 2M9KA 3ZZZA 4Y00A 1P1TA 1NJIT 2CPJA 1WHXA 1JJ4A 4WF9Q 2CQ4A 2QA4S 2CPYA 3S7RA 4IOAQ 3SDEB 3D2WA 2AYMA 1SJ4P 2MB0B 2LA4A 3U1MA 1X4CA 2KI2A 3CTRA 3CCVS 2MQMA 2CPDA 2XB2D 1X4FA 2K8GA 3VAHA 3UD4P 2JVOA 2DNHA 2I38A 1U1NA 2MJNA 3CULA 1VQPS 2KXFA 4ZKAA 1PO6A 2OJ3A 1VQ4S 3THTA 4FXVA 1HL6A 2RU3A 2MQOA 5DDOC 2CQ3A 3R1LA 3TYTA 2XS7A 1VC5A 4LJMA 2JX2A 1OIAA 1VQ7S 2MGZB 1Q81T 1QVGR 3CXCR 4RU2A 5LSOA 2RS8A 1UW4A 2DGVA 2HGLA 3CPWR 2MKKA 3ZZYA 1DBDA 2LQ5A 1CVJA 2N7CA 1OWXA 2FHOB 4WIIA 5GAGU 2OSQA 2DGUA 1X5OA 2DB1A 2MKIA 1X0FA 2E5HA 2N3LA 1FO1A 4C7QA 4CH0S 5GMKa 2AYEA 4TLQA 1WELA 2F3JA 1Q82T 4V19X 2G4BA 2DNNA 1IQTA 3SMZA 3IRWP 1X5SA 1VQ9S 2CQHA 2LEAA 1WI8A 4M5DB 2RQ4A 1DRZA 4QU7A 2DHGA 1X4HA 2PEHA 4F26A 2CQDA 1SJ3P 4C0OC 4WFNQ 5MLCV 4W92B 2QEXS 1WHWA 2HVZA 2MKSA 4CQ1A 2MHNA 2YH0A 2J8AA 3BEGB 2M8DB 4C4WA 5GAEU 1XN9A 2CJKA 3U1LA 2J76E 2J0QD 4W90B 2MY8A 2M4MA 1OPIA 2ZJRQ 1YITS 1W2BR 1OO0B 2J0SD 1U6FA 1Q86T 3UCZP 1VBXA 2LA6A 1VQKS 2ZJQQ 2LYVA 2CPZA 4ERDA 1SJQA 2YH1A 2FC9A 1N54B 2X1FA 3MUMP 3CMAS 1WTBA 1NU4A 3J7YU 2DGQA 1R8HA 1FXLA 1M90T 3UWTA 3R1HA 3CD6S 2CPIA 3I56S 1H2UX 3CCJS 3MUVP 5EN1A 1AUDA 2X1AA 2E44A 2M8HA 2MZSA 4IUFA 2MZRA 2MKJA 5DDPC 1YJWS 4Z2XA 2OTLS 1JJHA 4OZ1A 1URNA 2OTJS 2E5IA 2DITA 3G96A 2BZ2A 3MD1A 4TU9A 2X1BA 3L3CA 1HD0A 5D78A 1WEYA 3DLLQ 3LQVA 1UFWA 2JVRA 2M88A 3NNCA 2DISA 2CPFA 2MZQA 3H2UB 3HI9A 4PKDB 3IWNC 2KVIA 3H2VE 1X4BA 2KM8B 1ZH5A 4J5OA 4EGLA 4ED5A 3RW6A 2DGWA 2MY7A 4PRFA 5DM6Q 3UD3P 4BS2A 2GHPA 1ZZFA 3S6EA 1G2EA 3HHNB 3OW2R 3N9UC 1WI6A 2D9OA 2XS2A 5HL7Q 3CMES 2ADCA 2CQGA 5ITHA 2MGZA 1VQOS 1ZZNA 1B7FA 2DNLA 3S01A 4QU6A 2E5GA 1M5KC 3NS5A 1YI2S 1M5OC 3ULHA 2KM8C 3VAJA 2O3DA 1N8RT 1DHMA 5FJ4A 1L3KA 2MZJA 3B4DA 2XNQA 2HGNA 2RUGA 2XNRA 1RKJA 2RVJA 2XS5A 2MSSA 2NLWA 3P49B 2M2BA 4QQBA 4F02A 2KG1A 2MQLA 1H6KX 3SDEA 3K0JA 3CCQS 3CCRS 5IFMA 4WFAQ 3VAIA 2QFJA 3VAGA 1VQNS 5IM0B 2PE8A 3CC4S 4LMZA 2HGMA 2FC8A 2VOPA 3VAMA 2F9DA 2DNPA 2LXIA 1FNXH
chains in the Genus database with same CATH superfamily
4DV1F 2AJQA 1QUPA 5D8HB 3HJFA 1X31C 4NXNF 5KFJA 1AUSL 1CJUB 1EETA 2EBGA 4MFBA 3KK1B 2ZH8A 1XNQJ 3D1OA 1S97A 2MPUA 3MF5A 3JB9k 1TKZB 2JLEA 4K5RA 3S8SA 2ROGA 3TZYA 1RT2A 3BSAA 2D3O1 2HMIB 4V19J 1FE0A 1KQSR 4X4UA 2IPOB 3W1YC 1KR4A 1RBOB 4BLGA 4ZPBA 4ZJLA 2Y0BB 4YMEA 4IOCQ 5D4OA 2OPPB 4O3PA 1HR0F 2R8GA 2MQPA 3KKFA 1FX2A 5F8LA 1S5ZA 4RX6A 4DSKA 4KO0A 1EAYC 4J90A 4JI0F 2AD9A 4IG0B 4K2JA 2JRSA 2M5YA 4R5PA 1FTRA 4DL5A 4JI8F 2HZCA 2MKHA 3PACA 1RT5B 5D0HA 1KRPA 1HMVA 3ELHA 2OSRA 2I5JA 1KNZA 2NREA 2C1EB 2BM0A 1A0OB 2FHMA 3B82A 3PM9A 2DNQA 2X3GA 4HT5A 1ACMB 2CQBA 2F8EX 1DFDA 1S79A 3Q2SC 5JMNA 1Q8IA 1J2VA 2QA2A 2QL9B 4LR8A 1VQ6S 3Q2TC 2K3KA 2HVIA 3EZUA 1AT1B 1WC5A 2IHR1 2XEXA 2XI3A 1RT3B 2XULA 4OI3A 1P6TA 4QW8A 4ITSA 5KFGA 1UZDA 3RBDA 1Y10A 5KFAA 2AV5A 1H38A 4OHWA 1MN9A 2YXLA 1HNWF 2J0XA 3DC2A 2BUNA 2DNOA 1SXLA 2IYIA 2WSEC 3MI7X 3BO3A 4DWIA 4LF9F 2UXCJ 1HNIA 4MKBA 4P7TA 1PYOB 3MFIA 2D3OR 2ZH7A 2XQCA 5H1SV 3O3LA 2VPWB 3J7ZT 1NDPA 2ZOGA 2Z30B 3M4XA 1JLGA 1Y4ZB 3MR7A 5C2CA 1EQMA 1S57A 2K06A 3I4HX 2QSFA 3EWGA 3QFWA 1GMUA 4FKYA 5IC4B 4DV7F 4DFJA 2RRBA 2DY9A 2VL1A 3QWUA 4DEZA 1SC6A 1SIWB 2DEIA 5GADU 3GILA 1I94J 1CQNA 3KLEA 3NCQA 4FZVA 2CNKB 4ZLLA 4XO0A 4ZHRA 1R0AA 3D6FB 1HHSA 2HHVA 4BWMA 4A8KA 4DR2J 2OPSA 2W9CB 3BGFA 1Q78A 2HIQA 2IM0A 3OFHA 2LEBA 1TFYA 2C2KB 4RBVA 3D1HA 2VHGA 1U1OA 2BRLA 4UQTA 1DLOB 3QPIA 2MQQA 4QWAA 3NNAA 4DSIA 2UUCJ 3ZZUA 1T05A 4B3SF 5A0YA 1LEOA 4GC7A 4WE1B 4USHA 1VBKA 2OO4A 4DX8H 3DCAA 4XPCA 2YX1A 4Z7YA 2GAGC 4TN2A 4DOZA 2HIYA 3JSYA 2LQ9A 4OMFG 5F8JA 4C9DA 4H4OB 4IO9Q 3CC7S 1JWWA 4HH1A 2DNKA 5EX0A 2AJ2A 4C0HA 5JUMA 3QLHB 5I3UB 4WCEQ 5D3GB 2MYFA 3VZIA 1HQEB 1Y5LB 5HLFA 3LP0A 4PWUA 1R0AB 3OBIA 3U02A 2R2RA 1Y5IB 3PX0A 1F1BB 4C8OA 3TZZA 2IY5B 4ZVUB 4AFFA 1GTEA 5RUBA 3FCHA 5CXTA 4UW2A 4LQ9A 4ZA1A 2JL9A 2EK1A 4LFCF 2LXUA 2L3MA 4UZCA 4KRWA 1QLNA 2DVIA 5K14B 4DX6A 1WC1A 2GMJA 4F3MA 3OTBA 3CO9A 2D74B 3HHDA 2UZAA 4AQYF 3R7BB 3D68A 2I1RA 1XEZA 4LBPA 4ECUA 3MR2A 3U7JA 2W1BA 1VOMA 3TQEA 1SC3B 4RLEA 4R25A 2QRRA 1D9FA 2J6UA 1Q1KA 1FHTA 4ZCKA 4ZMMA 2OELA 3CJKB 2CRLA 1F9EB 1OY9A 3DLHA 2HG4A 1U1RA 3ONQA 1KLMA 1WF2A 3ITHA 3KG1A 5KT5A 2ASJA 3EE3A 4F67A 2MZ1A 4NXMF 1RTIA 2HRUA 3LUYA 4ZVSB 2AF6A 1IR0A 1WG5A 2H5IB 3GONA 1H74A 3IAM9 4ID8A 2CPHA 3BDEA 2R8HA 3NP5A 2ERRA 3LP2A 2BXJA 2P9CA 2C2RA 4DCPB 3NL0A 2LFVA 5GAGI 2BKPA 4RU9A 5D77A 1D8YA 3NMAA 1NSQA 3QZ7A 2FY8A 1Y5NB 2YKQA 4EFAC 5DLFA 3R7NB 2DR9A 3UVJB 2OEMA 1Z2ZA 4JP8A 4YY3F 2E5JA 2M70A 1X4GA 1T3NA 3QO9B 2HQCA 4I6AA 4X62F 2VFSA 2Q43A 4XAKA 4USUA 4K4YA 3EMTA 3QWPA 1KLMB 3I6PA 4NPOA 1I94F 2WONA 4ER8A 1N5TA 1N6QA 1KD1T 4ELVA 3I55S 2OPRA 4DX5A 4NYPA 3P3DA 3KJVB 2K1RB 2YKPA 2ZEJA 2KU7A 4ZPTR 4G6VB 2FJVA 3EPGA 4L73A 2PT0A 2DGOA 2KYXA 4M5LA 5F9LA 3HHEA 4CTAA 1BGXT 3LTOA 4I56A 2HNYB 3GV8B 3MM8A 1KC8T 3LW5C 2ZHOA 4Q5VA 1UZHA 2GMLA 3P5TL 4WBFA 4ZK7M 4FBUA 2KFNA 1X5TA 1HPZB 4FF3A 1LV5A 2DK2A 2U2FA 3P96A 3QATA 2RQMA 3BB5A 2DYAA 5F8GA 1K8AT 3QRQA 3HHLA 1X5PA 3H20A 3M2RA 4RW4A 4UOCA 5L38A 4J9QA 1K73T 2E7VA 4DV6J 3CD6S 4KGKA 3ET6A 3G2XA 1WKKA 2J7KA 3AD7C 2Q66A 3ZO7A 2RMLA 4EEYA 2RJZA 2ZDPA 4RPFA 5A0YB 4G65A 2A6OA 1QTNB 1NDLA 3BBFA 3DRPB 2KZZA 2MKCA 4ES1A 2CQ0A 1F5AA 2ZBCA 3WIVA 3CF5Q 5I3UA 4E0DA 5D4LA 3QJLA 4RKUC 2DXDA 4DX7A 5K8NA 4RJVA 2JFKA 3LP1B 1HPZA 1WG1A 2QFIA 4YB6A 1S59A 1C2PA 4ZLPA 2IDEA 2X3DA 4USIA 1OJ4A 1WTFA 1JLCA 4FN5A 3MUTP 1Q0NA 2DRDA 1VQMS 1TL1A 1MWZA 1U0HA 2DO0A 5F8HA 3KLFA 1RWUA 1RQ0A 2YKAA 4EBCA 2VKZG 2XSJA 2M0GB 3QGHA 2EEYA 2MHEA 2YVSA 1FVSA 3CDWA 4RW8A 2WVCA 4NCGA 1JJ2R 3K5MA 1EQ0A 3CJ8A 3MURP 4WPAA 2IVMA 3F44A 4FVCA 5BYRA 3KHLA 3JQKA 4QBUA 2ZHAA 4DV5J 2W4DA 1EIYB 1NMEB 1R8PA 1A7GE 4MTPA 4MIWA 2VPZB 4WFXA 4KR0B 1S72S 3I31A 1QVFR 1T03B 1WACA 1U7LA 3MD3A 1OMSA 2Y1LB 3DXBA 4QR1A 2CJ9A 4USJC 2APOA 3PNIA 3KLGA 1TAUA 1C0TB 3CDAA 3GJQB 2VC0A 1UWBB 3BR9A 1UEUA 2AU0A 1UP1A 3ZNJ1 4NOHA 5K8MA 3PHTA 3SXLA 4EU0A 4ZN1A 2G0CA 2MQ8A 4ED2A 2Z2LA 3WX4A 2QO3A 2JLGA 3WQPA 2V63A 3TRGA 3M32B 3M30A 3PTWA 2CPJA 1WHXA 3NWRA 1HR0J 4DJBA 2V8VA 1HQ2A 1NK5A 1S1WA 2CQ4A 3TUIC 2QLWA 3DYAA 3A8IA 4NYZA 3K5OA 4DU7A 2XLJA 4DU8A 1UVNA 1TR0A 3NGSA 2MB0B 1HYSA 3RB6A 1HWUA 3OVAA 1GMWD 4QW9A 1YDLA 1RJJA 3M2UA 4DLEA 1S0OA 1WC0A 1IXKA 2CYYA 1S49A 5SUHA 4AL5A 2W2MP 3FEZA 5B08A 2ZDOA 1VS3A 1P9QC 3BGOP 4IFVA 3LWMA 3BGRA 4IQXA 3LA0A 4NXMJ 1RWNB 3UD5A 3MEGB 3U1NA 3W8GA 2AGOA 3TANA 3OQ2A 4ZKAA 4DV4J 3D0IE 4OZ3A 2HMIA 3THTA 1PSDA 4F8RA 1HL6A 3SIPB 3EUNA 4LF8J 1IQZA 2W24A 4O3SA 4K4XA 5KTQA 4F4KA 1RB0A 2XS7A 2POKA 1J27A 3W62A 3K17A 1OIAA 2BR0A 1VQ7S 3ZC4A 1M5SA 1HQEA 2R7WA 4Q8FA 1QVGR 1UW4A 2DGVA 2ZZNA 2NSBA 4DUYJ 3DU5A 3QT6A 4CH7A 1QE1B 5EGYA 1DBDA 3MM8B 2LQ5A 3M1VA 4NZ6A 4OYOA 1ZTWA 1ZYQA 2N7CA 4DBQA 1P8GA 1SBRA 2HEKA 2GIQA 3CB4A 4J9UE 4M5GA 2G13A 5KFIA 2OSQA 4PG6A 4CO0A 1HBUB 4M5IA 3FMBA 4YHHF 4GC6A 2DGUA 4XTTA 1IBKF 2DB1A 4N47A 3KLIB 2XCPA 1HBMA 4ZS6A 4WP9A 1FO1A 3ZZ0A 1HBOB 4C7QA 2C22A 5B0DA 2DR7A 1CPZA 2E7XA 4CYUA 1ZAVA 3C16A 3DLGB 1N56A 4UUWA 3KJNB 3VCDA 4J9PA 3W3SA 3TEHB 2W25A 1WC4A 3GB0A 1NJXA 5KFSA 2C3UA 1Q82T 5KG7A 5H9EK 4CO5A 5IWAJ 4I1TA 4NLVA 5I3QA 2QLFB 4N56A 1LW2B 1X5SA 4UZBA 4DL7A 2WSFC 1UA1A 2GIRA 4B02A 2CQHA 2W7OA 2EG2A 4M5DB 2YNIA 3NEKA 1NB2A 2RQ4A 4LF6F 4NLGA 4QU7A 2DHGA 1X4HA 3TVZA 2XYGB 3OXFA 1MWYA 3V6HA 2KZMA 4ID5B 2HBZB 5KG4A 4C48A 2C3OA 3ZZRA 4KIAA 2W7AA 4MYTA 3OSNA 1VR6A 1S7IA 1X7VA 3HF5A 2MKSA 4CQ1A 1DJ0A 4Y2CA 3FSYA 2BQUA 4HT7A 3O44A 2YH0A 2BE7D 2J8AA 1JLQB 1SKWA 4Y65A 4DV0J 3LH2S 3TAPA 4P2XA 1NJZA 4JI7F 3HFVA 2A6MA 2CJKA 1XN9A 4GKJF 2J76E 1U2CA 3N5BA 2YKNB 4CYUB 4DDFA 3KHHA 4LIWA 2N4CA 4A8YA 5L1JA 2F4VJ 1SV5A 4GKJJ 4W90B 1MWQA 1OPIA 4OJ1A 2H4WB 3M9NB 1OO0B 2AX1A 2DHHA 2LXFA 2XMKA 3DLEA 2Z0GA 3BQ2A 4IRCA 1VQKS 4EI2A 2R7XA 1WOOA 2QJ3A 2CPZA 3H98A 1AZSA 1SJQA 4I7FA 4ZLNA 4X64J 2YH1A 5ADZA 1GXUA 3L7OA 5IOLA 4DR6F 2I6WA 2I5JB 4ANDA 3CE8A 2C2MB 1ZETA 3DM2A 3CMAS 1NU4A 5EUHA 3W60A 1H3DA 1MNEA 3IBWA 4RNOA 2VQEJ 4MIAA 1RHKB 1RWKB 1FERA 4DV2F 3OJSA 4DSFA 3M8PA 5E3CA 2WVEA 3HULA 2PC6A 1IWAA 4QR2A 2IA0A 1JXEA 2QMUB 3MMJA 4LFAF 3MUVP 1KHWA 1IM6A 4QWBA 4DCJB 3LAKA 4ZVHA 1TK0A 2IC3A 1JXVA 1RA7A 3CIMA 1RGVA 3I5CA 3OT9A 4TXSA 1PC5A 3R5AA 2XC9A 4Y2KA 3CCZA 2VG7A 3ISND 3M2VA 3EJMA 4A8OA 2E5IA 2V50A 4PPDA 4QIFA 4NMLA 3N79A 2BZ2A 3MD1A 4NLDA 1GX6A 4K7QA 1T9TA 4OJGA 3W2WB 4PEOA 5J2PB 1GXTA 3B78A 1YK9A 4B9LA 1RAGB 2ZBQA 1GMVA 5D78A 4DLGA 1WEYA 2B51A 1VHFA 4ZN3A 3PXGa 2VBWA 1IKYA 2ZOFA 1FX4A 1KFDA 1NHUA 4P72A 3HHKA 4YN3B 1VLYA 1XQIA 2RRNA 3H2UB 4DV4F 2OKQA 3IA0A 2KVIA 4IFYA 3B54A 1S77D 3I87A 3KYLA 3H2VE 2VKRA 5D4PA 3VGSA 2W7PA 4LF8F 4K0KJ 2EFNA 3IGNA 2IM1A 1KFSA 2R7SA 4Q0BA 2C3MA 3PW2A 1IJFB 4L75A 2EFOA 3RW6A 3C16B 1FE4A 1EZZB 2AMCB 3DLGA 2V2VA 3T6BA 1UVMA 3R2DJ 1IKWB 5M2PA 2R7UA 4LFBJ 5CYQB 2ZC3A 1B0VA 1R27B 3GIMA 3W7BA 4J9OA 3UD3P 4YP3A 1VMBA 1N5QA 4DUYF 1ZZFA 4OLPA 3PKMA 2J9DA 1PBAA 5L9XA 4DXLA 5THWA 1N32J 3V4IA 2ZFHA 1T9UA 1RT5A 3M8WA 3OW2R 3SQGA 2A2CA 1GX5A 5KT2A 2EFQA 2C2EA 2PIIA 2XS2A 4A4JA 5HL7Q 1PCAA 1QDUB 4GO7X 2ADCA 2YQ0A 3TA2A 3KLHB 1UMJA 2ROEA 2P9GA 4DL3A 4K4VA 1RHMB 1T9WA 2IJFA 4KY3A 1R8CA 2CJQA 3ISNC 1UEKA 4NLRA 1NPKA 3AOBA 3M8QA 2QMXA 4O44B 5DGBA 4L72B 4M5KA 2PFFB 4X65J 3BN4A 3CEDA 1RCOB 2OUGA 1H72C 3EICA 2ZITA 3AQOA 3IO1A 3JSBA 3MMCA 4HHUA 4UT4A 1MROA 5DG8A 3G82B 3AA8A 2YPYA 3ULHA 4DR3F 1VRUA 3IM9A 2YNGA 3M7VA 4NEYA 2BACA 3E51A 5IWAF 3IM8A 3KJFB 1W7WA 5B7WA 4HHHA 3ETMA 2I0XA 2Y1IA 2UUWA 4DSJA 3TZXA 2CG4A 5FJ4A 3PO4A 3DFEA 1DTTB 4ECWA 1LW0A 4X2BA 1UKUA 2HGNA 4YEAA 2A0FB 5DO2A 3RZAA 2RVJA 2XS5A 1F6TA 4EWTA 2V69A 1DURA 2KTQA 3VGVA 4OZ5A 4TLRA 2AKWB 1SKRA 1HQUB 1WC3A 1ZS6A 4I68A 5L8RC 5IV4A 4B9SA 3BH7B 2M2BA 1M1GA 3L9ZA 4QQBA 4DPUA 2YNGB 4F36A 2FJXA 3FQKA 5ETTA 3KK2A 4ZP9A 3K0JA 1C1BA 1WOSA 3AHPA 4G1QB 4RNMA 4PUOA 1HKAA 3CCRS 5L1LA 4OI6A 3EZOA 2ZBPA 3DOMA 6FDRA 3W8PA 3PJWA 5IS2A 3TAQA 3SSSA 1S6OA 5FLXY 2FC8A 1XERA 4WFZA 5HATA 5LL6d 3W9JA 3HDSA 1FNXH 2PI5A 4H4KA 3RRGA 3T3FA 1S0VA 4C3MA 4B9MA 2NCKL 3QAUA 4I0WA 4I4BA 4RL1A 2Z57B 4ELTA 4U95A 3EM1A 1CULB 3NGTA 5LSRA 3OL8A 2R42A 2JH3A 1RWMB 2J9EA 3J81j 3DNCA 4ECQA 2ZBRA 3NBPB 2G9OA 3C15B 2GIFA 4G1IA 2DGSA 2OLWA 4MK9A 5B0GA 3MECB 3LPEA 2E9RX 4OV1A 2LCWA 4ED6A 4XIUA 3PW5A 2FPHX 1FK9B 3W2WA 2EVZA 2XTJP 4I64A 1Q5YA 1VC6A 4K59A 3H7HB 3WDOA 2L9DA 5CZXA 4C97A 3PW4A 3CJSA 1JB0C 1LOUA 2B7CB 3KLGB 4QYRA 3C6UB 3PCOB 1FT8A 1FXDA 4USVA 3MCNA 5ETRA 3VVTA 3BYRA 4P73A 2HFOA 1X8DA 1CJVB 1UVKA 3M32A 3SFUA 2ZKUA 1KWMA 2ROPA 4X4TA 4YY3J 4C3LA 3VWSA 3VVUA 1VBZA 3HVWA 4GO5X 1QSYA 4LSNA 1K9MT 3D6HB 1UVJA 5LJ5Y 1GEHA 2PN6A 3MCMA 4MKYA 1WDTA 3SQOP 3KNAA 2IAJB 3V4MA 2VFTA 1UPMB 4DN0A 2DNMA 1UJ6A 2ATLA 2WAQD 4LFAJ 3LP0B 3A1YG 3PJ9A 2ATCB 3MTKA 3RW7A 3CJ2A 4CLWA 1H2TZ 4X62J 4AXJA 4WFBQ 1UCNA 3BO4A 5LXRA 2NXUA 1NO8A 2Q6BA 1VQYA 3FVYA 1XBWA 3H5XA 5KG5A 3EGZA 4EBDA 1LFPA 1BY9A 3QIPB 4PG5A 2B9EA 2YTCA 4X4OA 1R31A 4OX9J 2A18A 3HSZA 2UU9J 1LK5A 1VLOA 3VQSA 4NMXA 4M63A 2CQIA 5LXYA 1JJCB 1RP5A 3MM5A 4YB1P 1G6BA 1KOHA 5HROB 1O6XA 1U1QA 4NEZA 1RUSA 1RT1B 2MQNA 2HVEA 2QL5B 2KT3A 2FJBB 1JKHA 2FY1A 2RT3A 3CD5A 1KBRA 1GK8A 1VK3A 1WF1A 2VDIA 4NRTA 5AE2A 5JJBA 3DLKB 3MEEB 5AXNA 4Y2AA 3M8RA 1XNRF 5E3RA 1BMQB 2XWXA 1VBYA 4X4VA 3TO8A 4AL7A 5E41A 4KYZA 2LECA 5C2GA 4CH1A 4L74A 2AZ3A 3GFXA 3NS6A 3PYEA 4KKOA 4RW6A 3TVKA 4DPXA 2Y0SD 3GV5B 1L3TA 1K0VA 3T9NA 3CCLS 3CUNA 1N33F 2SXLA 1HHQA 4I2QA 3W61A 2DR6A 4H4KC 1YJNS 1OYDA 3UI3A 3JYTA 2RILA 2UVRA 1TV6B 3DDIA 1RBAA 4JBCA 4YDDB 1FKOB 2HK2A 3BJYA 4K8RA 4QPTA 4C8KA 3W65A 5KAKA 4QIVA 2BJ3A 1VJQA 3F41A 3A3OB 4HI2A 4OYAA 2WHOA 5A8RB 5T7LA 5J1EA 3GFHA 2F8MA 2IDLA 5CYMA 4EUVA 2MLZA 4U7UK 1JMTA 1WSRA 2ILYA 1PG5B 2LKZA 2XGQA 1VC0A 1MW7A 3MAAA 2V4QA 3VAKA 3QT5A 4Z37A 4PQUA 4OZ0A 2G1DA 2I9SA 2W9AA 4JYAJ 3EGVA 4OZLA 2O67A 2QGFB 1V3RA 1FRIA 3DKDA 3GTYX 1GT8A 1W2IA 2DCUB 2EBEA 2L08A 1RHRB 4I6YA 4P75A 3ENAA 4X66J 1TK8A 3PO5A 5KFDA 4RUBA 3HJVA 3H42A 2DNZA 4NXNJ 2UV8A 1JLBB 3KLHA 3LOUA 2OIHA 1VIXA 2CPEA 5F8MA 1DZ5A 2C2ZB 1N36F 2GMHA 1OY6A 2CPXA 2V2KA 1X4EA 3GG1A 4RNFA 2VQFJ 3CCES 3NWGA 4C11A 3BSOA 1G3OA 3US5A 4HYKA 1HD1A 1PJ7A 5KFLA 5L9NA 1NSAA 1UAWA 3NCRA 2EXUA 3HX9A 1N34J 2V4JA 1Y0HA 2YWFA 2QX0A 3W63A 3SEOA 5M2UA 1VGYA 3MAAB 1P27B 1WSVA 4ID5A 1M5VC 3D3CJ 2V0NA 3IBCB 3NGKA 3VZHA 3ZTRA 2V6AA 1RDRA 2QE5A 1V3SA 2KFYA 1EB0A 3M6XA 2HWIA 3AH6A 3OFGA 4G1PA 4NA3A 4O0NA 2EPIA 2QLJB 3ILIA 3MM6B 1OS5A 4X4SA 1X60A 2BABA 3TR5A 3MFHA 1TKTB 2EFGA 2HNZB 2CWKA 4LR7A 3T9ZA 2R7VA 3GZ7A 1HW9A 4PABA 2KXHA 4DR5J 2XYPB 1LFWA 1QM9A 3R3TA 1RE1B 1WEXA 2LU2A 4LFCJ 1LW0B 4K0KF 3PFEA 4ECZA 2F65A 4ETXA 3FZ2A 3UCGA 3N6LA 2CG8A 4MFBB 5IV3A 3RB3A 4EBEA 3GYNA 3VGTA 3PIPQ 3P6YC 3LGMA 3IG1B 1NBEB 2DPIA 3UO0A 1TKZA 4PYAA 2ZD1A 3K58A 3M2VB 4A8SA 1UWAA 1SJ1A 2JWNA 4IG3B 1RT6A 2YNFA 4RNNA 3M30B 5LJ3Y 2LP4A 3TAMA 2WB4A 2L9WA 3KG4A 4DUZF 2BMBA 4NWBA 1HQUA 2BEFA 2HHPA 3MDFA 4PXCA 5HN0A 2ZE2B 2FGOA 3IN5A 3AB2B 2BQRA 3UE2A 2PMZD 4JI1J 4WIQA 4B9NA 3W9HA 2V9KA 2E1CA 3MXHP 1TUGB 5G0RB 2BKOA 5E7OB 3RB0A 4LF1A 1FJGF 5A2QY 1F0XA 4RUAA 3WHIA 1D9AA 2H51B 1M0SA 4HTIA 3V81A 1JLQA 2AGPA 1HI0P 3I32A 1C0UB 2A3JA 1LWFB 1S6PB 5HQLA 5C7PA 3UN3A 4CLLA 4DUTA 2AYBA 2UUAF 1HWIA 2MJUA 4NZ0A 4F0KA 1N0UA 1XTZA 3T1YF 3MCOA 5CYQA 4QWDA 1RT3A 1BHNA 4FF2A 2N3OA 2GVDA 3SV4A 3PR4A 2B0GA 2RSQA 2Z2ZA 4YQWA 3OTOJ 5DM7Q 2J9CA 1EP4B 1B70B 1CJVA 3CD0A 3M2UB 3KHGA 4QIWD 5L39A 2ZH2A 1SJRA 1VQLS 4FNHA 4CT8A 5HMYA 1SL1A 1WOPA 2OFGX 3PRVA 2Q79A 3FEXB 4BC7A 2UU9F 3FSIA 2EKNA 2VA3A 2WBMA 2DIVA 2FTRA 3LGNA 2JEIA 1UJ4A 4IDKB 5F0UA 1E6YA 1JLCB 4CLTA 4TU7A 1YVFA 4C6AA 2AJ0A 2F40A 1PAEX 2RKIA 2ZM6F 5GVQA 1U2FA 2K7KA 2QL7B 3CDEA 2LQ8A 2CZVC 3ZTOA 2G1HA 1RU2A 4CO1A 2HURA 3CT9A 3NGRA 1FF2A 1DQ8A 1LKZA 4Q43A 1U1LA 1J5OA 4ZVOB 1N88A 2C3YA 4OX6A 3P4UB 1RHUB 3R8YA 1GXLA 3KUEA 4O3QA 5DLGA 1UL3A 5EWEA 3TX8A 2YQ1A 4WZMA 2ADBA 1FRKA 1K1SA 1D9DA 2BOPA 1TL4A 2DGTA 4DZ6A 5DG9A 1U25A 1FDAA 3H4DA 3PJXA 3VR1A 1Y3JA 2E5LJ 1S6UA 3ZZOA 1RTJA 1VYAA 2O1PA 2CKWA 2C3PA 1YRXA 3KLIA 1WWHA 2JEJA 1IKXB 1K1QA 2GCFA 3QO9A 4CI0B 1AW0A 3KK2B 4WYLA 2YPZA 4H4OA 5K20B 3K89A 3EVWA 3ZZZA 3T1AA 2HRYA 1ZPVA 1IUJA 2QN6B 1NJIT 2VG5B 4WF9Q 4NLQA 2CJAA 1NDCA 4ZPDA 5CQGA 5J2NA 4HH0A 2CPYA 3S7RA 1PC4A 4ED0A 1NAQA 3HVTA 2HHQA 3Q8YA 2AYMA 3JAMU 1SJ4P 2VU5A 3R2CJ 2OD4A 2IYGA 2P2CB 2YNIB 3K5PA 4R0JA 1KONA 3LWLA 1XIQA 4CTAB 1S10A 1RADB 1E6VA 3OHBA 3T41A 2K8GA 3FJ2A 4N8NA 2WRMA 2CA9A 3LP1A 4FKXA 4NLTA 3GR0A 5KFNA 1SVDA 4E98A 2JOQA 2RQKA 2NS1B 3FGVA 3N6MA 1NK6A 2MJNA 4GVBA 1PO6A 4HTJA 2OJ3A 1JQGA 2LDYA 1VQ4S 1KVKA 4NLYA 4FXVA 5B0CA 2ZVSA 3G6VA 2OP5A 1RU1A 1CSJA 3MR3A 5DDOC 3T5KA 3T1HF 5KOWA 4ZJOA 4IQMA 3R1LA 1VIOA 2HHUA 4FYWB 2VF3A 3CJKA 2Y9HA 3CNQP 5D0EA 4QOTA 3N0VA 3ITHB 5KG1A 1TZ0A 1V5IB 2NXCA 3AFGA 3CXCR 4JI0J 1DY3A 2RS8A 5K8OA 1S4EA 4UUXA 4K4ZA 5IT9U 2HGLA 6FD1A 3CPWR 4WXOA 3ZZYA 4ELUA 5A8WA 1FA0A 2XMMA 5C25B 2AT1B 5KFUA 3AODA 3Q89A 4ZVEA 3DLBA 1LWCA 3DI6A 2R7TA 1TK5A 2PA8D 1X5OA 5G0RA 5AJ3J 2KB2A 5A76A 3HPOA 2VJUA 4B9TA 4K4SA 1K47A 2LQBA 1X0FA 1UW9A 4DV6F 4HL9A 1QAJA 4U7CA 4ANCA 2OHDA 1ROFA 3H5SA 2IIHA 2FIUA 4PWDB 1TKXA 1NNDA 3C14A 1RAJA 2ACYA 2E1RA 4KH0B 1WELA 4WJBA 4KV8A 1JLEA 1Q5VA 4CM0A 4WP3A 4V19X 3DRSA 3RAQA 1S1XB 3SMZA 3X3UA 3D5MA 3RYLA 3IRWP 4WE1A 2AWZA 1HW8A 2B56A 5ETNA 5J1PA 1VQ9S 2HKEA 4HACA 1J5EF 1FI4A 2HWTA 4FS1A 1IWGA 3PZPA 3AD9C 1I1GA 1KQFB 1SUQB 1NH7A 4RW6B 2B9XA 4RW7A 1FD8A 4AUKA 3C8YA 5MLCV 2HNZA 3PHEA 2FVCA 5A8KB 1V6HA 3HFKA 4I2QB 4NLUA 4ZVGA 4X4RA 2E5LF 4F2SA 1RT6B 3K8VA 2XO6A 1IBLF 1VISA 1FKOA 4U96A 3KHRA 2M8DB 2IM2A 3OR1A 3PYDA 4O3RA 2HQ3A 4C4WA 3D54A 1T02A 1T94A 1YRUA 3U1LA 2BKNA 1SC4B 2HRTA 3I0SA 2CJXB 4KFBA 5CCLA 3BDPA 2VB6A 2IVYA 2M4MA 4JUZA 2E1AA 2QSWA 1JLGB 2QG9B 4M5MA 1YITS 1RT7B 2G2YA 1W2BR 3JS9A 5KT3A 4XPEA 3IRXA 3UCZP 5HBMA 4FS2A 4MYUA 3H0PA 3KWMA 3JAMY 1B64A 4CNYA 1XMQF 3N5FA 2RB7A 3N28A 1S6PA 2FC9A 2HQFA 3MOZA 3QIDA 3IAS9 5KFOA 3MWBA 4OQJA 3M8PB 4KC5A 4FF4A 3KDNA 2GO8A 2KHDA 3QNWB 4IO1A 2WSCC 3SBMA 3R97A 1FXLA 5EHHA 1IKVB 1N34F 1IBMF 3UWTA 3R1HA 2QIFA 3BKFA 1TTHB 3I56S 3CCJS 4DQQA 2ASYA 1FESA 4UTGA 1WD6A 5KFKA 2YNHB 3WZ0A 2C28A 3IRXB 1NJYA 2GJIA 3TW0A 2JNJA 5C42B 1RACB 2DTJA 2M8HA 1U8SA 2MZSA 2MKJA 2OPQB 2KT2A 1RTIB 2Z2YB 3E01B 3TA1A 1TUVA 3KJVA 3HHLD 1N5SA 4MKVA 5A6WA 3HMJG 4C8MA 2Z58B 2GHWA 4NA2A 4URQU 1URNA 3HD2A 4B3RF 2UXBF 1IR1A 4CO3A 4L76A 2F7VA 1DQAA 3L95X 3D28A 4P2MA 1NSKL 1S12A 2X1BA 3FFIB 4PXEA 3G6YA 3UVJA 3THVA 4X64F 3H90A 2DR8A 2AZ1A 4JI5F 2IMOA 4R5PB 1C1CB 3AOCA 4DSEA 1EARA 2XYHB 1U2RA 1YJ7A 3BZQA 4GVBB 4O3NA 2F63A 3TNVA 4DV3J 1QAYA 5F0WA 3TARA 5DRKA 3WC0A 4DHVA 4PKDB 4WZQA 4M95A 9RUBA 1CEZA 4USMA 1Y00A 2MDAA 2J6TA 5EWGA 3D67A 2ILZA 5FDLB 3PG9A 2UV8G 1VHIA 4J5OA 4NLSA 3C15A 4OYMA 4EGLA 1FTCA 3M8YA 1Z2LA 4C3KA 2AQ4A 3PKYA 1JLFB 3PW7A 1LQ9A 1HNXF 3VTIA 2J7UA 4YHHJ 1IBKJ 2YX4A 3BBBA 1F3VA 4OV6A 3QZ8A 4PQAA 2HLTA 4YFUA 4BS2A 2GHPA 3HD1A 2F1FA 1G2EA 2Y8YA 4JV5J 2P6SA 4R0EA 3CSKA 2J5AA 3ENVA 2QLXA 3G8QA 1BQNB 5J2NB 3CMES 4YS2A 1BWEA 1GH8A 3MPWA 2CQGA 4E2FB 1VQOS 1NK7A 3AD8C 3AOAA 2DNLA 2PFDA 1TL3B 3D3BJ 4PXDA 3IS9B 2W4PA 3OTOF 2ZHBA 4IOBA 1O8BA 5J2QB 4PZVA 4RNHA 5MAOA 4YR2A 2W8LA 5CD4A 1N48A 1QUVA 1WNEA 5CZVA 4K4UA 2R2SA 2QA1A 3VAJA 2Y3YA 4JI3F 3E3XA 1CJKA 3T5HA 1S1UA 2UXCF 2R8KA 1X0PA 2F8HA 3KK3A 2ASLA 1NUEA 2P9EA 4ZHRB 4ZVTB 3GSDA 1DQ9A 3B4DA 4C8YA 1BUXA 1R0BG 1DTTA 2XNRA 2FD2A 3KMQA 2MSSA 4BHQA 3BREA 1NK0A 4B9VA 2IAJA 4ILRA 2RHQB 3HSGA 3BGLA 4FDFA 2L48A 3OJUA 5H9EJ 4F02A 2XI2A 4O23A 1RZMA 1CC7A 5D3GA 2JC0A 3P45B 3EVMA 5B0BA 1Q8BA 4ZDNA 3K8WA 1T0TV 4WYWA 2GQQA 3NAIA 1UWBA 4KJIA 4NX9A 1S4FA 9ATCB 4AT1B 2ZH9A 4IDKA 1UPPA 4ED1A 1V3ZA 2HGMA 2VFRA 3EDQB 4AE5A 2DKOB 3AA9A 2AJ1A 2GA7A 3M6WA 3S1TA 4IRKA 2DNPA 1F9HA 4OFZA 1RLCL 4ZP8A 3ZFVA 5HROA 3ZTQA 7FDRA 2KRBA 4LVNP 4CP5A 1W25A 4YR3A 2H65B 4B3TJ 2GVZB 2VBZA 3L7UA 2ACMA 3LPYA 4P2SA 4NLPA 1YIJS 2UUBF 5LMUF 2FHJD 4WKRA 3P8BB 4F4XA 4R8UB 1G7CB 2VD3A 1FCAA 2W9BA 1TQLA 4J9MA 3DDKA 3DMJA 3UCUP 5AXLA 2HBRB 4ILMA 4RWWA 4URSA 4WWSA 2PEBA 2R3VA 2N7YA 5F3ZA 3DHXA 4K4TA 2WVFA 2JZ5A 2F9JA 5F9NA 3Q23A 1AROP 5DJBA 4ICLA 4CLFA 2RNEA 4FYDA 1U0HB 2DRAA 4C2MA 1REVA 2FUG9 1KOOA 2RF2B 4OIXA 1NKBA 4UY8T 3OR1B 1P1LA 2HAIA 2JHEA 1H7XA 2XZDB 2VOOA 2OI2A 1RABB 2WVDA 1YTYA 5JVGQ 4RUCA 4F0HA 1FXRA 1OSDA 1RWWB 1SI9A 2HFUA 2BJDA 1LWFA 2GC8A 1PBUA 2KN4A 3DXSX 3BQ1A 4P52A 5AE1A 3J7A1 1NHVA 3R5JB 2HVDA 4DFKA 4NA1A 3NG8A 3UN2A 3R6LB 4ILLA 4RBUA 2LLZA 2QLBB 3D9BA 3D66A 3X1LB 4LF9J 2WOMB 3IR7B 2FVPA 1F2GA 5SZTA 3G4SS 3TVYA 2WBRA 1Q95G 3I0RA 4KFBB 4OHXA 4EO6A 5DETA 1ICEB 2DGXA 5DQHA 3OTEA 4O4GA 3CJ3A 4TYAA 1B0TA 1C4AA 1PKUA 2IC3B 4PAAA 3BN7A 4ECYA 4AL6A 2F4FA 4HI1A 4MMOA 2W9CA 1NPRA 1U1NA 4KGZB 3H25A 3CC2S 3THPA 3W9IA 2HS0A 2IJNA 2OPRB 1UETA 4QCLA 1FWLA 1TL7A 1UEVA 2NR0A 3H4BA 4ZVQB 4QIEA 2AEMA 5KFTA 5ETOA 5CD4H 3OLAA 1REGX 4RBTA 4NLWA 2B4PA 2VPXB 1V5VA 2V9WA 3OR2B 1WDDA 3NLCA 3R5DA 4GVLA 2VBYA 4KH1B 5KFPA 4NASA 3J7AN 4KGMA 4F3QA 5ETLA 2OFHX 4D3HA 2D41A 5EWFA 1NK9A 2HHHF 3TWZA 3HCXA 4DR1J 5C25A 1AFJA 3FBCA 4ES2A 1JK9B 1HNIB 4EO8A 1V9OA 4DR1F 3C14B 2QT7A 2YNFB 3LO3A 4N76A 4OHZA 5KT6A 4DV5F 3KJQB 2BW7A 3QGGA 2DH9A 5KOXA 1RTZA 3NOCA 3KMSA 4JI4F 3FFIA 4DV2J 4XDCA 2PO4A 4LF5J 2HVHA 1IVZA 3LAMA 2OD6A 1VQ5S 3VAFA 4UF4A 4OI4A 4U8VA 2GV1A 3MPVA 4HR2A 1YG0A 4N8OA 5T41A 3G6XA 3DRSB 3GPAA 1XMBA 2OPSB 4F4ZA 1XC9A 3G71S 1RKIA 1SQEA 2HFNA 3RBZA 3UW1A 2RDJA 2N4DA 1U47A 3IGVA 2F4VF 4IRDA 5CYMB 3I5AA 3OL7A 2RDIA 5DS7A 5HVHA 2CQ1A 1YGYA 3PVXA 4A46A 2C2DA 5J1NA 4ECTA 1YZ6A 4KE5A 5IM0A 4DL6A 2O01C 3HZEA 5KFVA 3M1VB 5CABA 1N0VC 1AB8A 4PR6A 3VF0B 3WIUA 1RAAB 1JLBA 2DO4A 2KVQE 3GG0A 5HJXA 5U47A 2CQ2A 2H48B 3BYPA 5LOQA 3BBCA 1VQ8S 2VONA 2O66A 1N33J 1X4DA 4AYBD 4V1Ak 3KK1A 4C11B 1RSCA 5KFFA 1HBMB 2BJ9A 2ZKTA 2B4UA 3JQMA 1S1VB 2MMYA 4OHVA 3SV3A 3SCLE 2KJVA 1QSSA 5HLFB 5BYSA 4F7VA 2Q3PA 2M52A 3K2YA 3NGDA 1GQEA 3GCWP 1R6YA 2DRBA 1RWVB 3GYGA 1HARA 2KDOA 2ZJPQ 3QJPA 3MAHA 3MCSA 3QRPA 1S48A 4PG7A 4Q2MA 4ED7A 2MLXA 1C1BB 1CC8A 3C6TB 2YY3A 2ZZTA 2B5JB 2XSFA 1TVRB 1YQHA 1PGZA 1WHYA 3AT1B 4F3OA 5K5MA 3TQ1A 2DXEA 4JOUA 4L3KA 1WC6A 2R9LA 3J7Z5 1N5YA 3R5CA 3BO2A 3F56A 3CCUS 1IKYB 2GO9A 2A10A 2ZBIA 1NRKA 3QMQA 1SJFA 3KTQA 5B0EA 3TUPA 3W5ZA 1I6JA 3D7SB 4BDPA 1SV5B 3FC9A 3JTNA 2KJWA 3M05A 1RAEB 5C24B 1FJGJ 4NLOA 5D15A 4A8QA 2MXYA 3ZZPA 4PWWA 4DR7J 2R2UA 2EG1A 3CCSS 1HWKA 3B4MA 1HA1A 1TVRA 1RK8A 4ECVA 1H73A 1U6ZA 1VJWA 4I7FB 5HO4A 1MN7A 4NCBA 2D9PA 3KLEB 1NHKL 2H1YA 1HHTP 4JI8J 4NZ7A 2GQ2A 2XWYA 1JLEB 2IRUA 4DS5A 2DNYA 3FCVA 1QD1A 5LSLA 2ZZMA 3C46A 5A6PA 2XLKA 3HT0A 4LQ3A 3M8ZA 1ULRA 2ZWPA 4CIOA 2HS3A 1NB7A 4JV2A 3CJTA 3R27A 3RG6A 4HEA9 1NXIA 1TU0B 3HSDA 3PFOA 3GIIA 3RGIA 4L6V3 2HBYB 3OTCA 4NI2A 3FRZA 3BS9A 1NK8A 2W2OP 3KUHA 2HS4A 2YKMA 4XK8C 2AIRB 4HHJA 4D3GA 4WU2A 3EX7B 4LF5F 4ED4A 1S9FA 1F5BA 1SH3A 3PIOQ 3OUYA 2FJEB 3P5BP 3RTVA 2JFDA 4A8WA 1URRA 2GVDB 3V6JA 1JIHA 1U1PA 1S99A 2ZM6J 3MMBA 3O5TB 1T7PA 4LSLB 3W66A 5ETMA 4USWA 2IBKA 4O0IA 3FZBA 1SKUB 4LRAA 1TELA 4DUZJ 3K59A 2DNRA 4ZCIA 2HFSA 4NI2B 4Q2LA 1SQFA 3G6ES 4Q44A 5KT7A 4RZRA 4ZJQA 1L3VA 2WB1D 1U0SA 1YWXA 4IG0A 3U27A 2HW3A 3I0RB 4USKA 3KDOA 2DH7A 3C3LA 2YX7A 3PRBA 4KGXB 2B4VA 2B9WA 3D0GE 2EWHA 3BH6B 2LVWA 4M5DA 4LF7J 2AX0A 2MEWA 2W4CA 1FJ7A 1CULA 4ZCLA 2KG0A 1FK9A 3UDVA 3RBEA 1U45A 3F73A 1B0PA 3QJJA 2GNKA 2L9NA 1GAOA 2AJ4A 3E8OA 3I9V9 4A48A 4NE9C 3IXQA 1BQMB 1U09A 1RTJB 4LF4J 4KHRA 4FYXB 1X4AA 1DTQA 4W4MA 4HLBA 1WG4A 2B7BB 2COLA 2V94A 4OYXA 3G87A 1DARA 5GADI 3RB4A 1RI7A 4PG8A 2KRRA 5EX3A 2VJVA 4J9RA 2BJ7A 4NLXA 2Z56B 4Q7AA 3JXOA 3QGIA 1YLXA 2M9KA 1I5OB 3MMAA 5E0OA 3NRBA 5FD1A 3G82A 1NEEA 1HNVB 2GGPA 2RD5C 2VPYB 3J81U 3GIJA 5FDLA 2YBVA 1KTQA 5DZ6A 2UVUA 4C8LA 3ZNUA 4X4PA 3MPDA 3VQTA 1VCTA 3SDEB 4WTYA 2X7IA 4C98A 3D2WA 4DR7F 1X4CA 2ZOMA 3CJQA 4EK2A 2KI2A 3LP2B 2AEJA 1IR2A 1TMMA 3N6NA 3CCVS 1VI7A 2F5GA 4EMDA 2CPDA 4ZITA 1X4FA 3V6DB 2XB2D 3VAHA 3UD4P 3MMCB 2JVOA 4I67A 3T5LA 2DNHA 4ECRA 2CFXA 1PAUB 2I38A 3CWJA 5CH7B 4LSNB 5F41A 1CBKA 2B4OA 4CLZA 1SIZA 3RRHA 1VRUB 3CULA 4R8UA 1VQPS 2KXFA 1YJRA 2Z4PA 3DOKB 4KPCA 1UFKA 2RU3A 4N41A 2XMJA 1FDDA 1FRMA 1HI1A 2YWEA 3D4JA 3K7RA 4IKAA 2MQOA 4DV1J 1NK4A 3CDBA 3TYTA 3MAQA 2E7WA 1VC5A 2UXDJ 2JX2A 1Z1ZA 2FZCB 4KBIA 3FUYA 1R89A 4P71A 2MGZB 3QRRA 1PIEA 2FVSA 1RAOA 2XY5A 3M9MB 1Q81T 4RU2A 2JEFA 5LSOA 3BSCA 5LMNF 2BX6A 4IFYB 3PDNA 3MHYA 8AT1B 3ILLA 3BGUA 4OI2A 2MKKA 5LT5A 5GMEA 5B0AA 1MLAA 2JSXA 1CVJA 2VZ9A 4LF2A 4JI2J 1HNXJ 2HHXA 5KFZA 2HFVA 4WIIA 3RU0A 5K9FA 3A8KA 3ZXWA 2YKMB 4DI6A 1G1XA 1JKHB 3OPKA 3OFFA 4WXWA 5ETKA 4OI0A 4DPWA 1B7YB 2BE2A 3FMWA 3H40A 4CM2A 1YBAA 3C6TA 2ZH4A 2HQGA 4CDIA 2P6TA 3IP0A 5GMKa 4DFPA 2AYEA 1TMJA 1B3TA 2BJEA 5C42A 2ZE2A 3H8YA 1FFGB 3OVBA 4WP8A 2GX8A 1XJWB 2DNNA 3MR5A 1N5YB 2G4BA 1N5VA 4GKKJ 1IQTA 4TQRA 1Y9OA 1XWLA 1IM4A 4Y28C 3DU6A 5F3TA 2LEAA 2B5JA 2NYIA 4RR5A 5HP1A 4FYYB 3WC2A 3NS5A 4LRCA 3Q8RB 2GJFA 1FEEA 2D69A 1VDHA 3OR2A 3VGUA 3MR6A 2V4RA 2CQDA 4J7CA 5ETQA 5A8KA 2NSCA 3FKBA 2VQFF 4W92B 2QEXS 1RAHB 4FBTA 2HVZA 2HBQB 3D0HE 3EZ5A 2QMWA 1AZSB 2ALYB 3KFWX 4YR0A 2HHSA 1SH0A 4NL5A 2XY6A 2FZGB 5J2MB 1YX2A 1K0TA 1RTHB 1XMOF 1U4BA 1BWVA 5HMZA 5IT9Y 3D6TB 3NKYA 2J0QD 1XMOJ 3HLUA 2QV6A 8RUCA 2OAUA 2DBBA 3DRYA 2HQIA 2C2OB 3A13A 2KKHA 3MEDB 1ZM4A 1WKLA 3H59A 1CJTA 3QT7A 3A3PB 4DR2F 1KS2A 1U6FA 2VASA 3FSXA 3J80Y 2QYGA 3T19A 4WTOB 1VBXA 1FKPA 1Q86T 2ZJQQ 4A8FA 4ETZA 4YB7A 3ISZA 1FJEB 2CZ9A 1PILA 2LYVA 2FDNA 3MM6A 1OQ3A 4TY9A 2BW2A 1J5EJ 4ERDA 2HHWA 4N5SA 3HHLB 3M2RB 4DN9A 3Q83A 1D0EA 1R43A 2D3UA 3DI6B 3W5XA 3MUMP 1WTBA 3UDEA 1LWXA 1FVQA 5I4MA 2RF2A 5DQGA 2OMLA 3GFYA 3OTDA 5D0RA 2V5HG 5KFBA 3IMQJ 1ZTTA 2V8HA 2YQ3A 4DSLA 2XMUA 3GYXB 2CPIA 1RT4B 4J9VA 4C8NA 1H2UX 1IBCB 1XR5A 2IA6A 1MMNA 1FNMA 1UTAA 3IR6B 2HQDA 4B3TF 4USTA 4LRDA 2WVBA 5EN1A 4HVZA 1AUDA 2YWHA 4I69A 1RCXB 3CDUA 3HHLC 1S9GB 4KV8B 4QWCA 3GR1A 2XGPA 2X1AA 1HNZJ 2J8SA 2MZRA 2AHOB 2D3ZA 2PA3A 2V8PA 3NGUA 5DGAA 4NCAA 3IWLA 2CXEA 1SQGA 4ZP6A 4Z2XA 5D6GA 4BBYA 1K44A 2RDDA 4TY8A 3SCIE 1YJWS 4Q0BB 1NH8A 4IH7A 1LWCB 2R2TA 1UA0A 1AFIA 5KG6A 1KHVA 1YJVA 2DITA 1FDBA 3OFEA 3G96A 2R7QA 2W8KA 1SL0A 2R8JA 4OJ3A 5HJYA 4TU9A 4QJVA 3V6DA 4DFMA 2W2PP 1FEHA 3L3CA 1S0MA 5T14A 1XMQJ 2OEJA 3N01A 4K5SA 4OX9F 3Q22A 4DL0C 3CGIA 3MEKA 4RW9A 3LQVA 4GRSA 1TL1B 1UFWA 2JVRA 4CT9A 4DL2A 2WCXA 2DISA 2CPFA 5KFEA 2FLLA 2AP6A 1NPPA 2CIMA 4C0BA 4DMZA 3K5LA 1B99A 1X4BA 2D1CA 1CLFA 2VG7B 2P5VA 3ADAC 3OHAA 5A8RA 5C5JA 2DXFA 1HBOA 3GQCA 2ZH6A 4IH5A 2VIHA 4Z7CA 2PMWA 4P10A 4Y2MA 2VDHA 3BPDA 3HVTB 1R8BA 2J7WA 2BRKA 3FBBA 1RLDA 1WUUA 3CCTA 2XZTB 4ZP7A 1HBUA 2MY7A 4PRFA 1JLFA 3E2EA 4DPYA 1E6VB 3HT3A 1EHWA 4ICLB 3Q86A 2E9TA 3ZTPA 3SI8A 1RT1A 3GLJA 4LVOP 3HM9A 3DGPA 1FWPA 4TKTA 3HHNB 2R4FA 5IQ6A 2IFXA 1RBLA 1WI6A 2D9OA 1FRXA 4F4YA 5F8NA 1TUWA 1S1WB 4OYZA 2GJ2A 5B0FA 3TJ8A 2RKIB 1FFWB 2DCLA 2ZVIA 4F0MA 2HHHJ 1ZZNA 1ZM3A 1B7FA 1HYSB 1S0NA 4DG1A 2EW9A 2VBXA 3QIPA 4QU6A 2E5GA 1CS4A 2FLOA 3B8HA 4MKAA 2XMAA 2BM1A 3Q8VA 4KHMA 1Q8LA 1M5OC 2BANB 2BA9A 4X84A 5KG3A 1U26A 1YBUA 3TUJC 2E9ZA 1S76D 2ZH5A 3MEGA 4DR4F 2NXNA 4GKKF 5EDWA 1ZA1B 3RJMB 2O3DA 2CZ4A 1KLNA 3DYAB 1N8RT 3TA0A 2HZAA 2NUHA 2E1MC 1RTDB 2CNOB 4JI2F 2QTWA 1H7WA 4FNIA 1LXNA 3M8SA 1L3KA 3RAXA 2W2QP 1EKRA 2MZJA 1TKXB 2VV5A 5FLXU 4DG1B 3OSPA 2OH2A 4F4WA 3B6BA 3NY0A 4LUBA 3MMBB 2UVWA 2PD1A 2HPUA 2W01A 3MZIA 1FDNA 4IFVB 5DQIA 4LF7F 1FFSB 2ALZA 2XO7A 3NOGA 4KB7A 2DR5A 2Q1LA 2PDAA 3DGVA 2A2DA 2GHVC 3P49B 1ZAXA 2XSJB 3I4PA 4OYWA 4RUHA 3ET6B 2MQLA 3AXMA 4B08A 4UY85 2ZWOA 4NCGB 4P2FA 1FWKA 3OVSA 3CCQS 3KG0A 5E5NA 4OLOA 3H5UA 4CO4A 2XY7A 1UVIA 3HFZB 4P74A 4TVAB 1RTDA 3LF0A 4J9NA 3EYZA 3M6UA 1YRTA 3KLFB 2EFVA 3VAGA 1VQNS 3CC4S 4LRFA 2LDIA 2WZ1A 3RBXA 3TAMB 5L1IA 1SL2A 3VAMA 1S1TB 3FQLA 4O3OA 2F9DA 2LQJA 2LXIA 4U7UD 4J9KA 1AXQA 4NRUA 3QFHA 5KFRA 1T8EA 3HKZD 5GAHU 1JLAA 4PXBA 5D0GA 2RS2A 2H3EB 4WFYA 1RAFB 5C24A 2C2NA 1PYTA 3TP2A 4DR5F 2WK4A 4CLYA 2XBPA 3JYTB 1KSPA 1WHVA 5CCMA 5BXIA 1T03A 3D1QA 2HYIB 2PSZA 5HBMB 3V81B 5J2QA 4LT6A 5K8PA 4OHYA 4OYBA 4QZVB 2K1RA 2KT5A 1S9EB 5HAOA 1MG7A 3A8EA 4DR6J 3MPUB 2VH7A 2XHCA 2AEFA 2V2QA 3ILOA 1F60B 1MMLA 5FIIA 2OPPA 4ANEA 4F25A 2N82B 3MM9A 2JEGA 1N32F 1S1UB 2RQCA 2GFFA 1VRTA 3UDCA 1YJTA 3FK4A 4TQSA 1HBNA 5JXSA 4QIGA 2R8IA 2DHSA 4Q8EA 3O6QA 4UOFA 2ZUAA 1KEKA 1HLWA 1EX8A 2CJYB 2NXEA 3LANA 3TOQA 1J5OB 4PWDA 3GSIA 2NPFA 4H54A 2ZD1B 3OD2A 4QWEA 4DF4A 4ZPCA 1S1VA 3GV7B 1R3NA 2LEPA 3EVOA 3R7SB 3G8SA 3DGPB 3HXMA 1WF0A 4ZIWA 3UN5A 4J9LA 1X9WA 1TL5A 4LBIA 2WTFA 1ZM2A 2OGUA 2VG6A 1E6YB 1C4CA 2AGQA 2RIJA 3OUYB 2DPJA 1BD6A 4ENOA 3V5RA 3ENWA 3QYYA 3M8QB 4O44A 1APSA 4B3MJ 2DD8S 1F9FA 4U8YA 2C42A 1F5CA 2Z8QA 4DR4J 3MEDA 1VFJA 3KUGA 5CYJA 1FRJA 3ICLA 3DLEB 3T1HJ 1IKXA 2R7RA 1RWXB 2CQPA 2DHXA 1SUQA 2H4YB 1S9GA 1D3WA 4XDDA 3UR0A 1UVLA 2X1GA 3ENQA 2BVZA 3MM7A 2FVRA 2VFUA 5HK4A 1R7IA 1TP7A 2M7SA 5IC6B 3UNGC 2GW8A 2K7JA 1T9XA 4DPOA 5BJRA 2MSTA 4UQGA 1MU2B 3W2VB 1EKSA 2HAFA 1C0UA 3DN9A 3OL6A 4DV0F 4F50A 4DQRA 3FDSA 1IN0A 4HDGA 2UUTA 4TU8A 1XNRJ 2WONB 3BV8A 4ZVPB 2YKOA 2IVFB 1FNOA 5HQ8A 1N6QB 4PQUB 4TY8B 4DCOB 2J6SA 2JLFA 2Y8WA 5DG7A 2KFZA 2PMHA 3ETOA 2DJWA 3IC1A 5A2QU 2ZUGA 2LMIA 2VODA 1VK8A 4KAIA 1OY8A 3W5YA 2KH9A 3G8TA 1IBMJ 2CVIA 4B9UA 3DLKA 3MEEA 1W26A 2G0JA 2RE1A 1CQMA 1QJHA 3GJTB 1NLKL 3MMAB 4FP9A 5F8IA 3CCMS 3QLHA 5LM7E 4KSEB 2U1AA 4YB5A 1MMDA 5J2PA 4G3IA 2NQPA 1FJCA 5D4NA 3SCKE 1RT7A 2RHSB 4YDXA 3CIZA 1U6BA 3JSRA 4LBHA 1U49A 3EGNA 4CLKA 1Q16B 3VALA 2RRAA 1R6VA 1SB6A 2DH8A 3E01A 3EDRB 1N4LA 3A12A 4B3SJ 5H9FK 5M2RA 1BC6A 1XR7A 2VC1A 3T6JA 2EK6A 2CNLB 4CLUA 1SKSA 1A6LA 1OQ6A 1TV6A 1O51A 2YNHA 5L46A 1RISA 2G2ZA 3AJ1A 4BCAA 5CA5A 4WK3A 3H5YA 2B6AA 4MT1A 4M5JA 4YUDA 2KXNB 1YHQS 1U8WA 2I2YA 1N52B 1YZ7A 5IT4A 4YOEA 2XHWA 2MTLA 1KN6A 1IKVA 1FKPB 1Q8KA 4Y6IA 1NM2A 3HSJA 4J37A 4MIBA 4N7TA 3UR3C 1D8ZA 2NZ4A 3QT8A 1TFWA 3MM9B 3QSIA 3TEGA 2VQEF 2DY1A 1Q7YT 2WOMA 1Q53A 5E3QA 2EC0A 2KHCA 5E3AA 3I82A 1S9EA 3CVKA 1RTHA 1VRQC 2M3DA 1H2VZ 2Z2MA 4MAKA 5HMWA 1M1HA 3WX8A 2HZVA 2IRXA 3AQPA 4FXWA 5DDQC 1T9YA 1FKAF 4PG4A 2RUSA 4Y3CA 5HSPA 1ZA2B 3QQCD 1NKCA 3AXKA 3CCWA 1SPBP 5JVHQ 4ECSA 3DM2B 2UVVA 2DNGA 2QZ8A 4IG3A 3FBEA 3L4BC 4BWJA 2B9YA 3NS7B 1YKWA 2EI5A 4P7VA 1A9NB 5B09A 1AYEA 4RW7B 1ITPA 3Q8SB 4ALZA 1S1XA 1IJEB 4HKQA 1MSWD 5E2QA 2CQCA 4ES3A 4Y0FA 3KXDA 3SFGA 3A8JA 4CCHA 1BQXA 2HWHA 3HO1A 2NYHA 3BM7A 2ASDA 5BR8J 4W98A 3TUZC 5GAEI 3HVAA 2BE2B 4FF1A 1X9MA 1UJ5A 5BR8F 2NPIA 1HIYA 1WJ9A 2FQQB 4KQZA 2L41A 4QYZJ 4ZPAA 3VHQA 1XR6A 1NCLA 3NMRA 2MLYA 2GZOA 3M6VA 4LSZB 3HK2A 4WK1A 1M5PC 2HFZA 2H5JB 4KO0B 2CUYA 1DLOA 2GGPB 1EP4A 3NAHA 3JSMA 1LW2A 5KG0A 3HZGA 4JI6F 5I42A 3MM7B 4ZOSA 1WEZA 5DDRC 5LMNJ 1U48A 2H5EA 4MK7A 1MU2A 3W2VA 2ZH3A 2JDJA 3L09A 2K3IA 2XZWA 2JC1A 7FD1A 1FRLA 1P9YA 6AT1B 4F4AA 3J80U 3CMQA 4A8XA 5KFYA 3G9CA 1O0PA 4F2RA 3O8WA 1RWOB 4CO2A 3PX4A 2UUAJ 1OPZA 3IR5B 1M1KT 3IG1A 3CJ4A 1CJKB 1GFWB 3RR7A 2AJFE 5J2MA 2NXJA 5G4DA 4AD6A 4KGVB 1LWEB 2DIUA 2Y1RI 2YWKA 4IR9A 3NNHA 1VQSA 4O4GB 4ED3A 5AXKA 4UOHA 5A8WB 1XK8A 3DOLB 1R0CB 3I96A 5AE3A 4J9SA 3V6KA 4X66F 4X65F 4CRJA 2FJDB 2O5DA 2WW8A 5HANA 1TL7B 3EXYA 2HNDB 4KKOB 4OX8A 1F2HA 1KP6A 1O5JA 2QC3A 4I2PA 4N77A 1MROB 2DHAA 4A8MP 4FPRA 1KQKA 2AW0A 2MZTA 2UP1A 4K50A 3FRYA 3OV7A 1GNKA 1RHJB 3GE9A 4P6QA 3BKUA 7AT1B 4Y2IA 2B3TB 4EYIB 2QYCA 5HI7A 3POTB 4LF4F 4LIRA 3V2UC 3MTJA 4FXDA 3DHWC 3DOLA 1VRTB 2VG5A 1YJ9S 1NZ8A 1RT2B 4M94A 4MH8A 3Q8PB 4H4MA 1LWEA 2EKYA 3DMJB 3TX0A 1SC1B 5H9FJ 1CJUA 3GU0A 1Q79A 1YBTA 3J81Y 2PI4A 4JI3J 4IYQA 1NDKA 2ZC4A 5ETSA 2V4JB 1R8AA 4L3NA 3SZ2A 4BC9A 4U67Q 2FVQA 3AB4B 3FEYB 3N4WA 1CG2A 3SCJE 1U1MA 2V34A 5KFWA 3W64A 1JXLA 3K5NA 1EETB 3FBFA 2HSEB 2GAHC 4MJKA 1L3UA 3CD7A 3ZZTA 1Y3KA 2WW4A 3MM5B 1U1KA 2CJBA 4OZJA 5IQQA 3RAMA 3Q8QB 2FJWA 1S1TA 3CO0P 3GJRB 3PYFA 3KOAA 1Y11A 3F0NA 4Y00A 2RH3A 2XLIA 2CNNB 1P1TA 3IBFB 3AJ2A 1Y7PA 1H0HB 2JJ4D 3UNYA 2PGCA 3UDLA 5KFCA 1JJ4A 2V68A 2HHTA 5BYQA 2QA4S 4H4MB 4IOAQ 4S0MA 2B8QA 1REVB 2B43A 3PR5B 3EGWB 1HNZF 2LA4A 3U1MA 2FLPA 4Y34A 3IFEA 3TJAA 3A4TA 3CTRA 5HP1B 3UFCX 2MQMA 1N36J 4OYPA 1T3OA 5K14A 3PY8A 3V4IB 4ATNA 3NCPA 3NXZA 2UUBJ 3J7YI 3NBPA 1ZM9A 3D6MB 3R5BA 3BF4A 5ETPA 1U02A 4ECXA 3L7PA 2BV3A 3JQJA 2FLNA 4QYZK 1T9VA 4CZCA 2XMVA 1RA6A 2CQ3A 2Q6CA 2YWGA 3DRRB 5IZHA 3GCXP 4CWBA 1ELOA 3GWCA 4KT0C 2Y1JA 2BBEA 2IMWP 4LJMA 4X4QA 1RT4A 3TJ9A 2CDRB 4KHPJ 2ZNZA 1KTVA 4DV3F 3DRPA 5E33A 4B3MF 4B17A 2BANA 2LU1A 3MOJB 2K2PA 4KHPF 4U6PA 1RAIB 2BE9B 3O2IA 3AJDA 1RWPB 3KLVA 1CS4B 1UFLA 1L5UA 3PYGA 3O1LA 4IH6A 1OWXA 4NYOA 3PV8A 4JI4J 2FHOB 4B3RJ 1WKJA 2FHJA 3Q8UA 5GAGU 5ETVA 4B3OA 2RAQA 4LFBF 1SCJB 1SH2A 4LREA 2MKIA 5L1KA 1KDNA 4P9SA 2E5HA 2N3LA 1GMWA 2FJAB 4CH0S 4OYIA 1I51B 2EC2A 3I0SB 4EYHB 2R7OA 2VA2A 4LRBA 2XM3A 5HVGA 1RYRA 1S6QB 4TLQA 2P8IA 2F3JA 1FRHA 4RWXA 3UPFA 5DZ7A 4JV5F 4M8LA 3OXLA 2ZH1A 4JI1F 4G1QA 1L3SA 4I2PB 1X9SA 4E8UA 3ZTSA 3K57A 2CDQA 4ZPVR 3WBZA 2HNYA 3R5GA 4LR9A 1WI8A 2VFVA 4JI6J 5KT4A 2KYZA 4QPXA 1DRZA 2NZCA 3MPYA 3KNGA 3HKWA 3T5JA 1NZAA 2PEHA 4F26A 2BDPA 4JV1A 2FZKB 5HMXA 1SJ3P 4C0OC 4WFNQ 1BE4A 3H2LA 1WHWA 2XG8A 3JTOA 1D1UA 1Q7LB 4RW9B 4DF8A 1XNQF 3SSRA 3DOKA 2MHNA 1DAXA 3A3NB 5GAHI 3BEGB 4A47A 1TKTA 1QTMA 1JNRB 1HMVB 2BQ3A 5GAEU 2GQCA 2OPQA 4RO0A 5T7LB 1H98A 5IXUA 1QY7A 5J1EB 1HI8A 2HLUA 1Q4RA 1S6QA 2MY8A 2YKNA 2ZJRQ 4LF6J 1HFEL 2CAJA 4LSLA 4M1KA 2RU9A 3HVRA 2J0SD 2W2NP 1QAXA 2V8GA 4M5HA 1IKWA 1NSPA 4JYAF 2J0WA 3MECA 2LA6A 1QE1A 2CWXA 1CJTB 3BKTA 3C2PA 3VV2B 1HWLA 3JSMB 5KFMA 3G86A 1EJ7L 1LK7A 4I6WA 4ZIVA 1F3FA 1N54B 2A1BA 2X1FA 3Q0AA 2OEKA 4F04B 2YWWA 1ZBTA 2B6AB 1U24A 3SQGB 1Z4UA 3EXCX 3RR8A 3J7YU 3GIKA 2DGQA 4ZVFA 3TI0A 1R8HA 5KFQA 4TYBA 3GIRA 1M90T 3MGJA 3M9OB 4JI7J 3EPIA 1QAIA 1C1CA 3Q24A 4FPIA 3GJSB 4PCQA 1ZOTA 4DL4A 4AQYJ 2VG6B 3UQSA 3IWXA 4WU3A 4DQSA 1HNWJ 3JTPA 1PYSB 2ABYA 1YJUA 2E44A 5AT1B 4IUFA 2FHKA 4OJHA 5DDPC 2B8PA 3LALA 2KL8A 3ILJA 4K4WA 3PX6A 3QAEA 5HQMA 2OTLS 3C19A 4CLSA 1JJHA 2XMTA 4OZ1A 1OYEA 3RUBL 2OTJS 2G2OA 1T11A 4DS4A 1KVJA 2V8DA 4DQPA 5AXMA 3C66A 4DV7J 1YI2S 3GFZA 2DEJA 1DTQB 1YSJA 1HD0A 4C8ZA 4ZPWR 3DLLQ 1T05B 2UXDF 2M88A 3NNCA 4EZ6A 1GTHA 4WKYA 3QBCA 4J91A 4JI5J 1OSCA 2H9ZA 2BJ1A 2MZQA 3HI9A 4FYVB 3AY0A 4OI1A 3DLJA 3IWNC 3PEJA 2V2ZA 3DRRA 2KM8B 2VUGA 5LMUJ 2DT9A 1ZH5A 4DZDA 1I3OB 4ED5A 2UUCF 2DGWA 4ZLJA 3T1YJ 1PJ6A 1RHQB 3AAWB 3LGHA 3OXGA 2NUUG 4MK8A 4B3OB 1S7HA 5DM6Q 5E3PA 1KKHA 2IM3A 2IRYA 1TKDA 4JB8B 4ZCMA 1PJ5A 4ZVRB 1D09B 4HACB 3BGRB 3S6EA 3CJRA 5I3PA 2OMOA 2VICA 3PW0A 1IBLJ 1JLAB 1KVIA 3N9UC 2QA4G 3R9LA 2G0IA 2XCAA 1ZAWA 1WORA 2D7SA 3FNNA 4OL8A 4PYDA 3RRKA 3OL9A 4CLPA 3CJ5A 4OZ2A 1JX4A 5ITHA 2MGZA 1LNQA 3OLBA 2H54B 5KFXA 3BPSP 2ZNYA 2IBOA 3HP6A 3S01A 2J9DE 4U9RA 1M5HA 1TAQA 4FVMA 1M5KC 4GMKA 4KPYA 4ED8A 4PPZA 1BLUA 3CW2C 4RW8B 4TNOA 8ATCB 2FGCA 5I42B 4CNZA 2KM8C 2KO1A 3BQ0A 5IT0A 3BR8A 5AJ3F 1NJWA 1C0TA 4O4RA 1LXJA 3C6UA 3CJ0A 3QSYB 2XMWA 3SYZA 5CAAA 4UOGA 1HBNB 2CVEA 1DHMA 3TZWA 2AYGA 3I5BA 1AA1B 2E66A 3PRDA 5GMDA 3SSQA 2E29A 1ZPWX 1TL3A 2IJRA 3PEHA 2I8EA 2XNQA 1KQGB 1RYSA 2RUGA 4DQIA 4JV0A 1RKJA 4EZ9A 4URGA 4X4NA 2NLWA 3QGPA 1HWJA 2CADA 3GP9A 1BQNA 2W9BB 2FYXA 1RXOB 1HNVA 3DRXA 4M5NA 4DPTA 1FD2A 4DR3J 4OX7A 3FCWA 2HNDA 1B4SA 1G4CA 2GVZA 3DDNA 2HK3A 2KG1A 3IS9A 1H6KX 2X51A 3SDEA 3I9ZA 4HDHA 1QSLA 1BQMA 5CHCB 5KFHA 3BSNA 2UXBJ 2GS8A 4AXIA 2BYCA 2BJ8A 2E1PA 2FB0A 5IFMA 2EFPA 4WFAQ 3VAIA 2QFJA 4PUOB 3POTA 3GMGA 4K2XA 2V67A 5IM0B 2PE8A 4OZNA 5KG2A 4IR1A 4LMZA 1NKEA 3DOMB 4QR0A 4RW4B 2MKYA 5HVFA 2BOAA 2VOPA 4KTQA 4Q45A 1JNZB 3R6GB 1BXNA 1T95A 3KK3B
chains in the Genus database with same CATH topology
4DV1F 2AJQA 1QUPA 5D8HB 3HJFA 4NXNF 5KFJA 1EETA 2EBGA 4MFBA 3KK1B 2ZH8A 3D1OA 1S97A 2MPUA 3MF5A 3JB9k 1TKZB 2JLEA 4K5RA 3S8SA 2ROGA 2HMIB 1RT2A 3BSAA 4X4UA 4V19J 1FE0A 1KQSR 1KR4A 4ZPBA 4YMEA 4IOCQ 5D4OA 2OPPB 4O3PA 1HR0F 2R8GA 2MQPA 3KKFA 5F8LA 4DSKA 4RX6A 4KO0A 4JI0F 2AD9A 4IG0B 2JRSA 2M5YA 4R5PA 1FTRA 4DL5A 4JI8F 2HZCA 2MKHA 3PACA 1RT5B 1KRPA 1HMVA 2OSRA 2I5JA 1KNZA 2NREA 2BM0A 2FHMA 3B82A 3PM9A 2DNQA 2X3GA 4HT5A 1DFDA 2CQBA 2F8EX 1S79A 3Q2SC 1Q8IA 1J2VA 2QA2A 1VQ6S 3Q2TC 2K3KA 2HVIA 3EZUA 4QW8A 2IHR1 2XEXA 2XULA 1RT3B 2XI3A 4OI3A 1P6TA 5KFGA 4ITSA 4CCHA 3RBDA 5KFAA 2AV5A 1H38A 4OHWA 1HNWF 2J0XA 3DC2A 2BUNA 2DNOA 1SXLA 2IYIA 2WSEC 3MI7X 3BO3A 4DWIA 4LF9F 1HNIA 4MKBA 4P7TA 3MFIA 2D3OR 2ZH7A 5H1SV 3O3LA 2VPWB 3J7ZT 2ZOGA 3M4XA 1JLGA 1Y4ZB 3I4HX 2QSFA 4DV7F 4DFJA 2RRBA 3QWUA 2VL1A 4DEZA 5GADU 1SC6A 1SIWB 3GILA 1CQNA 3KLEA 3NCQA 4FZVA 4XO0A 4ZHRA 1R0AA 1HHSA 2HHVA 4BWMA 4A8KA 2OPSA 2W9CB 3BGFA 1Q78A 2HIQA 2IM0A 3OFHA 2LEBA 1TFYA 4RBVA 1U1OA 3D1HA 2BRLA 4UQTA 1DLOB 3QPIA 2MQQA 4QWAA 3NNAA 4DSIA 3ZZUA 1T05A 4B3SF 5A0YA 4GC7A 4WE1B 4USHA 2OO4A 4DX8H 3DCAA 4XPCA 2YX1A 4TN2A 4DOZA 3JSYA 2LQ9A 4OMFG 5F8JA 4C9DA 4H4OB 3CC7S 4HH1A 2DNKA 5EX0A 4C0HA 5JUMA 3QLHB 5I3UB 4WCEQ 5D3GB 2MYFA 3VZIA 1HQEB 1Y5LB 5HLFA 3LP0A 4PWUA 1R0AB 3OBIA 3U02A 2R2RA 1Y5IB 3PX0A 4C8OA 4AFFA 1GTEA 3FCHA 5CXTA 4UW2A 4LQ9A 4ZA1A 2JL9A 2EK1A 4LFCF 2LXUA 2L3MA 4KRWA 1QLNA 2DVIA 5K14B 2GMJA 4F3MA 3OTBA 3CO9A 2D74B 3HHDA 2UZAA 4AQYF 2I1RA 1XEZA 4ECUA 3U7JA 1VOMA 4RLEA 4R25A 2QRRA 1D9FA 2J6UA 1Q1KA 1FHTA 4ZCKA 4ZMMA 3CJKB 2CRLA 3DLHA 2HG4A 1U1RA 3ONQA 1KLMA 1WF2A 3ITHA 3KG1A 5KT5A 2ASJA 4F67A 2MZ1A 4NXMF 1RTIA 2HRUA 3LUYA 2AF6A 1IR0A 1WG5A 4ID8A 3IAM9 2ERRA 2CPHA 3BDEA 2R8HA 3NP5A 2C2RA 3LP2A 2BXJA 2P9CA 3NL0A 5GAGI 4RU9A 1D8YA 5D77A 3NMAA 3QZ7A 4EFAC 1Y5NB 2YKQA 5DLFA 2DR9A 1Z2ZA 4YY3F 2E5JA 2M70A 1X4GA 3QO9B 4I6AA 4X62F 2VFSA 2Q43A 4XAKA 4K4YA 3QWPA 1KLMB 3I6PA 4NPOA 1I94F 2WONA 1N6QA 1N5TA 1KD1T 4ELVA 3I55S 2OPRA 4NYPA 3P3DA 3KJVB 2K1RB 2YKPA 4ZPTR 2KU7A 4G6VB 2FJVA 3EPGA 2PT0A 2DGOA 2KYXA 3HHEA 4CTAA 1BGXT 4I56A 2HNYB 3GV8B 3MM8A 1KC8T 3LW5C 2ZHOA 4Q5VA 2GMLA 3P5TL 4ZK7M 4FBUA 2KFNA 1X5TA 1HPZB 4FF3A 1LV5A 2DK2A 2U2FA 3P96A 2RQMA 3BB5A 5F8GA 1K8AT 3HHLA 1X5PA 3H20A 3M2RA 4RW4A 4UOCA 5L38A 4J9QA 1K73T 3CD6S 4KGKA 2J7KA 2Q66A 2RMLA 4EEYA 2RJZA 2ZDPA 5A0YB 3DRPB 2KZZA 2MKCA 4ES1A 2CQ0A 1F5AA 2ZBCA 3CF5Q 4E0DA 5I3UA 3QJLA 5D4LA 4RKUC 5K8NA 2JFKA 3LP1B 1HPZA 1WG1A 4ZLPA 4YB6A 1C2PA 4USIA 4FN5A 1WTFA 1JLCA 3MUTP 1VQMS 1TL1A 1MWZA 2DO0A 5F8HA 3KLFA 1RWUA 1RQ0A 2YKAA 4EBCA 2VKZG 2XSJA 2M0GB 3QGHA 2MHEA 2YVSA 1FVSA 3CDWA 4RW8A 4NCGA 1JJ2R 3K5MA 3MURP 2IVMA 3F44A 4FVCA 5BYRA 3KHLA 4QBUA 2ZHAA 2W4DA 1R8PA 1A7GE 4MTPA 4MIWA 2VPZB 4WFXA 4KR0B 1S72S 3I31A 1QVFR 1T03B 1WACA 1U7LA 3MD3A 4QR1A 3DXBA 4USJC 2CJ9A 3KLGA 2APOA 3PNIA 1TAUA 1C0TB 3CDAA 2VC0A 1UWBB 3BR9A 1UEUA 2AU0A 1UP1A 4NOHA 5K8MA 3SXLA 4ED2A 4EU0A 2G0CA 2Z2LA 3WX4A 2QO3A 2JLGA 3TRGA 3M32B 3M30A 2CPJA 1WHXA 4DJBA 2V8VA 1NK5A 1S1WA 2CQ4A 3TUIC 2QLWA 3DYAA 4NYZA 2XLJA 3K5OA 1UVNA 1TR0A 2MB0B 1HYSA 3RB6A 1HWUA 3OVAA 4QW9A 4DLEA 1RJJA 3M2UA 1S0OA 1IXKA 2CYYA 1S49A 5SUHA 4AL5A 3FEZA 5B08A 2ZDOA 1VS3A 1P9QC 4IFVA 3LWMA 4IQXA 3BGRA 2AGOA 3MEGB 3U1NA 2HMIA 3TANA 3OQ2A 4ZKAA 3D0IE 3THTA 1PSDA 4F8RA 1HL6A 3EUNA 4O3SA 1IQZA 2W24A 4K4XA 5KTQA 4F4KA 2XS7A 2POKA 1OIAA 2BR0A 1VQ7S 3ZC4A 1M5SA 1HQEA 2R7WA 4Q8FA 1QVGR 1UW4A 2DGVA 2ZZNA 2NSBA 3DU5A 4CH7A 1QE1B 5EGYA 1DBDA 3MM8B 2LQ5A 3M1VA 4NZ6A 1ZTWA 1ZYQA 2N7CA 4DBQA 1P8GA 1SBRA 2GIQA 3CB4A 2G13A 5KFIA 2OSQA 4PG6A 4CO0A 1HBUB 3FMBA 4YHHF 4GC6A 2DGUA 1IBKF 2DB1A 4N47A 3KLIB 2XCPA 1HBMA 4ZS6A 1FO1A 3ZZ0A 1HBOB 4C7QA 2C22A 5B0DA 2DR7A 1CPZA 2E7XA 1ZAVA 3DLGB 1N56A 4UUWA 3VCDA 4J9PA 3W3SA 2W25A 3GB0A 1NJXA 5KFSA 2C3UA 1Q82T 5KG7A 4CO5A 4I1TA 4NLVA 5I3QA 4N56A 1LW2B 1X5SA 4DL7A 2WSFC 1UA1A 2GIRA 4B02A 2CQHA 2W7OA 2EG2A 4M5DB 2YNIA 2RQ4A 4LF6F 4NLGA 4QU7A 2DHGA 1X4HA 3TVZA 3OXFA 1MWYA 3V6HA 2KZMA 5KG4A 2C3OA 3ZZRA 4KIAA 2W7AA 4MYTA 3OSNA 3HF5A 1X7VA 2MKSA 4CQ1A 1DJ0A 4Y2CA 3FSYA 2BQUA 4HT7A 3O44A 2YH0A 1SKWA 2J8AA 1JLQB 4Y65A 3TAPA 3LH2S 1NJZA 4JI7F 2CJKA 1XN9A 4GKJF 2J76E 3N5BA 2YKNB 4DDFA 3KHHA 4LIWA 2N4CA 4A8YA 5L1JA 1SV5A 4W90B 1OPIA 4OJ1A 3M9NB 1OO0B 2AX1A 2LXFA 2XMKA 3BQ2A 3DLEA 2Z0GA 4IRCA 1VQKS 2R7XA 2CPZA 3H98A 1SJQA 4I7FA 4DR6F 2YH1A 5ADZA 1GXUA 3L7OA 2I5JB 3CE8A 1ZETA 3DM2A 3CMAS 1NU4A 5EUHA 4RNOA 1MNEA 1H3DA 3IBWA 4MIAA 1FERA 4DV2F 3OJSA 4DSFA 3M8PA 5E3CA 2PC6A 4QR2A 2IA0A 1JXEA 3MMJA 4LFAF 3MUVP 1KHWA 4QWBA 3LAKA 4ZVHA 1TK0A 2IC3A 3CIMA 1RA7A 3I5CA 1RGVA 4TXSA 2XC9A 1PC5A 3R5AA 4Y2KA