3VAHA

Structure of u2af65 variant with bru3c4 dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
174
structure length
174
Chain Sequence
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Splicing factor U2AF 65 kDa subunit
publication title U2AF65 adapts to diverse pre-mRNA splice sites through conformational selection of specific and promiscuous RNA recognition motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/dna
total genus 40
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vahA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vahA02
1N52B 2WBRA 5CA5A 4ERDA 3H2VE 1U2FA 2DGVA 2M8DB 3CCSS 4QU6A 2DGSA 2MGZA 2AD9A 1SJFA 1X4FA 2FHOB 2DNLA 4C0OC 1X4DA 4YUDA 2LXIA 3J7YU 2CPJA 2CQCA 2E5JA 3EGZA 2ADBA 1VQ7S 3P49B 2L41A 2LQ5A 5LJ3Y 4QQBA 3BO2A 5CXTA 2GHPA 1Q7YT 1X5OA 3CXCR 2DNPA 5LXRA 4CQ1A 3MXHP 3CC7S 1X4HA 5IQQA 3OW2R 1WI6A 2DGXA 3VAGA 1U1QA 4WFAQ 1UP1A 5HL7Q 2ZJPQ 2LECA 2NZ4A 3CTRA 3P6YC 2D9OA 1WEXA 5DDRC 1YJNS 3I55S 1U1MA 2DHSA 1X4GA 2HGNA 3THPA 2KM8C 1M5OC 2DNGA 1WHXA 2CPXA 2F9DA 2N7CA 4WFBQ 3R1HA 4WKRA 4EGLA 2M9KA 2GO9A 2U2FA 2NLWA 4F26A 1OO0B 2J8AA 3UCZP 2LEAA 1U6FA 2D9PA 2RUGA 1KD1T 2MKCA 3S6EA 2CPFA 2DGOA 1ZZFA 2KN4A 2LMIA 1B7FA 1KQSR 2CQHA 2MPUA 3PIOQ 1HD0A 2VOOA 2LYVA 4LMZA 1QVGR 5DDOC 1VBZA 2N3LA 2E5HA 2MQMA 2DGUA 2YH0A 2CQ0A 2G4BA 2KG0A 2O3DA 2OSRA 2DIUA 1H2VZ 3S7RA 2CPIA 1F9FA 5IM0B 2KRRA 1YJWS 2OIHA 3CCLS 5ITHA 3VALA 2M4MA 4QU7A 3BS9A 5LSOA 3SDEB 1VQOS 1N54B 2VOPA 5LJ5Y 3P5TL 5DM6Q 1WF2A 5LXYA 3MDFA 4TU9A 1WTBA 1S79A 2MZQA 3G6ES 1JMTA 2D3OR 1JJ4A 2J76E 2PEHA 2KXFA 5HO4A 3J7ZT 3MUVP 2RNEA 1HA1A 4OZ1A 3UCUP 1KC8T 3RW7A 2FY1A 2MJUA 1DBDA 3G4SS 3MOJB 3SXLA 1OIAA 3UE2A 2F9JA 4W90B 2X1BA 3HI9A 4F25A 1NU4A 3IRWP 3EGNA 3D2WA 2ZJRQ 3G8TA 3CCQS 4WFNQ 3I56S 4V19X 2M88A 1K9MT 2MGZB 1WF1A 1VC6A 2UP1A 2FPHX 4BS2A 2MQLA 2DHGA 1WHVA 2HGLA 3G71S 3S8SA 2HVZA 3MD1A 1VBXA 2MQPA 1NJIT 2VONA 5CYJA 2DB1A 4WIIA 3CUNA 1OPIA 2B0GA 5DDQC 1FT8A 1PGZA 2MZRA 2JRSA 3V4MA 1WF0A 1X4AA 2M52A 2KVIA 4UY8T 1X4BA 2AYEA 1X5TA 1VC0A 5IFMA 5GAHU 4U67Q 3CF5Q 3S01A 2KXHA 1KOOA 5DETA 2MKKA 3FEYB 1N8RT 2M70A 2MB0B 3Q2TC 1XN9A 2DH9A 3US5A 2HGMA 1WG5A 1H6KX 1VQ9S 1FO1A 1YIJS 2PE8A 1VQ5S 3CCUS 2YWKA 4CH0S 2DITA 1M5PC 3HHNB 1IQTA 1W2BR 2MHNA 1WEYA 4P6QA 2KRBA 2BOPA 2J0SD 2DK2A 1YITS 2LCWA 3CC4S 3NS6A 2CQDA 2N3OA 3R1LA 2CQ2A 1M5VC 1R8HA 2K3KA 2DGWA 3IWNC 3MURP 1WEZA 3CULA 2RRAA 1O0PA 2DHAA 2DNHA 2DNNA 1A7GE 2LKZA 3VAJA 3JB9k 1WELA 4CIOA 1RKJA 3TO8A 2CPHA 3NS5A 4F02A 1SXLA 2DNOA 3UD3P 2ERRA 2RU3A 3FEXB 1PO6A 3K0JA 1QM9A 5JVHQ 1X5SA 3VAMA 2AYBA 1SJ3P 3B4DA 2J0QD 1VC5A 2OSQA 4PR6A 1VQMS 2RRBA 1WG1A 2AYMA 5D78A 2RQ4A 3B4MA 3UCGA 1WG4A 1FXLA 1X4EA 1JJ2R 2EK6A 2QFJA 3CCVS 2X1GA 2RQCA 1VBYA 2X1FA 4WCEQ 4A8XA 2MZJA 2MQNA 2MZ1A 1M90T 3VAIA 1Q86T 2I38A 2N82B 2JVOA 1U1KA 3CD6S 2DGQA 2KHCA 2CJKA 1M1KT 2MKHA 2DO4A 1DRZA 2LEBA 4IOAQ 1FJCA 2CPYA 3VAHA 2L9WA 4FXVA 5IM0A 3R27A 3CPWR 3RW6A 3UWTA 2A3JA 3TP2A 2CPZA 4Y00A 2MQQA 1K73T 2MY8A 1FHTA 4UQTA 2G1DA 4Z2XA 1VQPS 2LA4A 4OZ0A 2KM8B 5GADU 2LA6A 1X5PA 1U1LA 1Q81T 2EVZA 3NNHA 2ADCA 4YOEA 2JVRA 2KH9A 2KI2A 2XS5A 1U6BA 2V94A 3VAFA 4IUFA 1VQ4S 1P27B 1VQ8S 1URNA 2X1AA 1K8AT 2CQ4A 2AYGA 2XS2A 2M8HA 2MSSA 1VQLS 1FJ7A 3PIPQ 2L08A 1H2TZ 2CPEA 2EK1A 3H2UB 2MMYA 4WF9Q 3CCES 4Y0FA 3THTA 2OTJS 2JWNA 2F3JA 2FC9A 1U1NA 3CCRS 5GVQA 1BY9A 1SJRA 1VQ6S 4ZKAA 3U1MA 1AUDA 2I2YA 1S72S 4IOCQ 1WHWA 5JVGQ 3CC2S 1Q82T 1WI8A 2DNKA 1UW4A 1U1PA 5D77A 4TU7A 2KFYA 2E5IA 3LPYA 2MYFA 3G96A 1ZZNA 1H2UX 3N9UC 3TYTA 2CQBA 3NNAA 1D9AA 2MZTA 1HD1A 2LXUA 2E44A 2OJ3A 2RVJA 3ZZYA 5FJ4A 2MKIA 3DXBA 1L3KA 1FNXH 1YI2S 3MD3A 1FJEB 2DGTA 1M5KC 3CCMS 5GAGU 2VODA 2DH7A 2BZ2A 2KG1A 3NMRA 3CMES 2DO0A 2M7SA 1U1RA 1CVJA 1N88A 1RK8A 2CQGA 3ZZZA 1YWXA 2XNRA 2ZJQQ 3ULHA 1QVFR 2MJNA 3BO4A 1DHMA 2E5GA 2KYXA 1X0FA 2JX2A 1R8PA 2DNMA 2U1AA 1HL6A 2MKJA 2XS7A 4C4WA 1P1TA 4TLQA 2DNZA 3UD4P 3VF0B 1JJHA 3BO3A 2YTCA 3P3DA 1UFWA 1YHQS 1OWXA 4FXWA 5BJRA 3MUMP 2RS8A 4J5OA 2DH8A 5H1SV 2QA4S 2MZSA 1X4CA 3G8SA 2XB2D 2DNRA 5DDPC 2KT5A 2G0CA 2RS2A 3Q2SC 3VAKA 2CQ1A 2M2BA 4C7QA 5GMKa 3CMAS 5MLCV 2MY7A 2SXLA 5LSLA 4M5DB 1VQKS 4IO9Q 1G2EA 1KOHA 2HYIB 2Q79A 2DNQA 3G9CA 1NO8A 3L3CA 2HZCA 2DISA 2DNYA 2XSFA 2DHXA 2YKAA 4W92B 2DIVA 4CH1A 1WWHA 2CQIA 3SDEA 2MXYA 4LIRA 2FC8A 3MI7X 3DLLQ 1SJQA 2CPDA 3LQVA 5DM7Q 2OTLS 4QPTA 1YJ9S 3MUTP 2QEXS 4YB1P 3U1LA 2MQOA 3EX7B 2K8GA 1YTYA 1UAWA 1U1OA 1ZH5A 4PKDB 1VQNS 2RT3A 1DZ5A 5EN1A 1D8ZA 2XNQA 3SMZA 3CCJS 4TU8A 4PRFA 3BEGB 2CQ3A 1WHYA 1SJ4P 2YH1A 2KU7A 4LJMA 2MSTA 2KXNB 2CQPA 1A9NB 2M0GB 4ED5A 2MKSA 5GAEU 3NNCA 4RU2A
chains in the Genus database with same CATH superfamily
1KTVA 3V6HA 2W2QP 3HHKA 4DV0J 1BGXT 1RAOA 5AE2A 1BXNA 2L41A 4U96A 4QR2A 5ETSA 5KFIA 1FFGB 4LF4F 3GIMA 4QPXA 3BBCA 3VVUA 4YHHF 4NA2A 3P6YC 1RTHA 1J5OA 4QCLA 2ZWPA 4MJKA 1FK9B 2ZHAA 1N5SA 2J7KA 3BH6B 2GW8A 3LP0B 2KZZA 4PG4A 3DI6A 1NZAA 2EFQA 2B8PA 1HW8A 3QGPA 1HNVA 2ZUAA 2BE9B 2GIFA 3NS7B 2DIUA 3CJ3A 3MFIA 4I56A 1R8BA 2XSJA 3EJMA 4RNHA 2B43A 5KT5A 5LXYA 3ITHA 2JEGA 1U45A 1IJEB 3L95X 2DHHA 3QMQA 1SUQB 4LR9A 3M8QB 2CJBA 3LF0A 1FWPA 5EWEA 1PJ6A 2ZH7A 1KC8T 3H42A 4I2QB 2GVDB 3D54A 4W90B 1NU4A 3IRWP 4CT8A 2GNKA 1IR2A 1S6PB 5GMEA 3MPYA 1Z2LA 1NJXA 2YPZA 5KT4A 1KWMA 4USKA 1PGZA 3MAQA 3BQ2A 1GTEA 2XULA 5I3UB 2H51B 4AE5A 2OEKA 5KG0A 1J5OB 3KYLA 3JSRA 1HI8A 4FDFA 3H5XA 9ATCB 3NG8A 1MWZA 3M1VB 2PFFB 1HLWA 2DITA 2LU2A 4ZPCA 3ZC4A 2PIIA 1YZ7A 3DGPA 1P1LA 4LRAA 2LVWA 5ETOA 4WU2A 1F3FA 4O4RA 2ZDPA 2FGCA 4FVMA 2FLNA 1G4CA 4ZOSA 2OPQB 3CCZA 4FNIA 3P45B 2MTLA 3TOQA 3GWCA 4RW4B 2M5YA 3KLIA 2XZDB 3G82A 1MMNA 4PR6A 3HT0A 3L09A 3IP0A 5KFSA 3HLUA 2XHWA 3MR2A 2WVFA 5I42B 4IG3A 3ICLA 1M90T 3QO9A 4USTA 2HNYB 3HSGA 2CUYA 4WXOA 1G7CB 2XGPA 2L9WA 1FD2A 4NLOA 2IA6A 3CPWR 3IG1A 2OELA 3GR0A 1ZM3A 4RZRA 2QLJB 2MY8A 2NXJA 4OZ0A 4OYPA 5F0WA 4DI6A 3QT6A 4PG7A 4N77A 2QMXA 1S99A 2BX6A 1HWUA 1U6BA 3C66A 4IQXA 4QIEA 2XZWA 4JI5F 4Y28C 1HHSA 3I4HX 3MEGA 3CCES 4MYTA 2FD2A 2QL5B 1PYSB 5RUBA 4UUXA 4PYDA 2VL1A 3DGPB 5H9FJ 1NMEB 2ILZA 1TMJA 1WI8A 1S0VA 1Q1KA 4C3LA 4RNFA 1S1UB 1IWAA 2MZTA 2V9KA 3ELHA 2DCUB 2LXUA 3ZTQA 5D3GB 2IJFA 4PZVA 1FDAA 2ZBPA 1S1VA 1VOMA 3MD3A 2DGTA 4OHWA 1RP5A 3CCMS 3H59A 5F8NA 3PW5A 4R8UA 5L9XA 2KG1A 1PIEA 4TN2A 3MM9B 3ZZOA 4Y2CA 3POTA 3NGDA 2UVVA 1RKIA 1YWXA 2F4VF 2W8KA 2BW7A 1UA1A 5CYQA 4RW6B 4LF7F 1KBRA 3D3CJ 3GIJA 2A1BA 3MUMP 3OXFA 1YG0A 1H74A 2QSWA 1NSKL 3T6BA 1XNQF 2M2BA 1CBKA 4ZP6A 2UUTA 1RHMB 4LSNA 1BQNB 4M5DB 3NMAA 1G2EA 1JLFB 5E41A 2DNYA 4UOCA 5CD4A 4DX5A 2R2UA 2KKHA 4P2XA 3MUTP 3MM7A 1FWKA 2VZ9A 2RT3A 2E1AA 1DZ5A 2HNDA 1RADB 2Z56B 1S7IA 2JJ4D 1FDDA 5GAEU 4O3NA 3KHRA 4QWDA 2WB1D 2MGZA 2DNLA 4C0OC 2LXIA 2WOMA 1ZTTA 3T9NA 1S1VB 3OXLA 3BR8A 4ZVFA 4CWBA 1U26A 1X5OA 2DXFA 4ED0A 4R8UB 5KFKA 1L5UA 5HL7Q 3ZZTA 3R3TA 3THPA 3FQLA 4L74A 3QAUA 3PG9A 1ZM4A 5T7LB 2ATCB 4KGMA 2ROGA 3MPVA 3MCMA 1H98A 4RUHA 2VC0A 2DGUA 2YH0A 5A8WB 4KPCA 2CPIA 2H9ZA 1VR6A 1M5SA 2RDIA 2FHJD 4RJVA 2HQ3A 2EG1A 2V6AA 2D74B 1S79A 1LWEB 3BN4A 1JJ4A 1SV5B 2IAJB 2RNEA 4DSFA 2O5DA 5DZ6A 1R8AA 4ZPTR 1D3WA 4DQRA 5CZVA 4V19X 4TQSA 3GJSB 2MGZB 1IBKF 1VC6A 4HTIA 3OHBA 2WOMB 4WWSA 2DB1A 2ZE2B 1X4BA 1XIQA 3S01A 2JEIA 3M7VA 1VK3A 2MB0B 1HWIA 4KPYA 4NLQA 3N6LA 3NEKA 1WG5A 5AXLA 1VQ9S 1FO1A 2W1BA 1YIJS 3QBCA 2VQFJ 3LGNA 4I2PB 4F36A 3T41A 2VG7A 5A0YB 2FLPA 4LF5J 3MFHA 5C25B 1M5VC 1WEZA 1AT1B 5HQLA 5FLXY 3V6DA 2K1RB 1QAYA 1JK9B 1YRXA 4OV1A 4A8OA 1REGX 4M5LA 2HBRB 2RF2B 2R42A 4OZJA 2AIRB 2AP6A 2FLLA 4DR2F 3FRZA 2CXEA 1RT5A 3B4MA 3BPSP 1TKXA 1WG4A 3CVKA 3EMTA 1UEUA 4QIFA 4QYZJ 3KNAA 2UUAJ 3MPWA 1C2PA 3CD6S 3UPFA 2VUGA 4M5HA 1CJUB 4YR0A 4WIQA 1VFJA 2IJNA 4DU8A 3A8EA 1FX2A 1B3TA 4HEA9 3BJYA 1JLGB 5KFLA 1NH7A 2JC0A 1U4BA 4C8NA 1OYDA 2ADCA 2WVEA 1QAXA 4NMXA 4XTTA 1JB0C 1S12A 1VCTA 1DQAA 3DNCA 1KVJA 1MSWD 1KHVA 2AV5A 3RUBL 8ATCB 1EJ7L 4PXDA 3DC2A 3KHGA 2XY7A 3SV4A 1HMVB 3HO1A 3BYRA 1ZAWA 5CCLA 2J9DA 1OJ4A 4L3NA 1XEZA 1ZZNA 1IKVB 1KLMA 1N5VA 3TYTA 4DR3J 3I0SB 5CHCB 1D9AA 1N5YA 1WORA 1HD1A 5T41A 2OJ3A 2CADA 1N4LA 2GX8A 3IRXA 4E2FB 3MMJA 1YI2S 2B4PA 1IWGA 4C11A 1M5KC 4JB8B 2E9ZA 3R5JB 3QWPA 3LGMA 3I32A 7FDRA 2FJXA 4AYBD 2VA2A 1HBOA 3NY0A 2R4FA 4DFPA 4F50A 1S10A 3PEHA 2FQQB 5K8PA 2Y8WA 4JI1F 2JX2A 4I7FA 2U1AA 1GK8A 1UEVA 3H20A 1SL0A 1UFWA 4ZJOA 1RT3B 2QIFA 4FXWA 3D0IE 2FJVA 3N4WA 3AOBA 3H98A 4OI6A 2QL7B 2C2ZB 5BYSA 1S7HA 5JUMA 5MLCV 2OI2A 2BKPA 4DR1J 4Z37A 4OJGA 2C2OB 2DNQA 4LFCF 1Z4UA 3V2UC 1U8WA 5MAOA 3BF4A 1KVIA 2PC6A 1RT6B 4BLGA 4B9UA 4QPTA 3BH7B 1OQ6A 2YVSA 4P9SA 3QAEA 3PJXA 2YXLA 1ZH5A 4ZIWA 4ZLLA 4IFYA 4DFKA 1I1GA 3CW2C 2MSTA 3M8PA 3CJQA 3NNCA 4FKYA 4XAKA 4G1PA 2C3MA 2J8SA 2AD9A 1S9FA 2FHOB 3D3BJ 5HMYA 1N33J 3I5AA 2IVFB 1N32F 4ZPBA 4QOTA 5I3QA 2ZM6F 3Q8PB 2H5IB 3RTVA 5L8RC 4K50A 2XC9A 1LFWA 4ZPDA 5IQQA 1U1QA 4JI7F 3CTRA 4NLDA 5D0GA 5FLXU 1RHRB 2ZC4A 1B0TA 1UEKA 1U1MA 2BBEA 3A8IA 5BR8J 1VHIA 1XR6A 3MMAB 1S1XB 2U2FA 4DN9A 2J8AA 2RDDA 4JI0J 3VCDA 2BKOA 1JXEA 1KD1T 1QTMA 1LK5A 2VFSA 3KJNB 1F60B 1IKWB 1NDPA 4USHA 3AT1B 2VASA 1BWEA 1CQNA 2N3LA 2NSCA 1JXLA 1UZDA 2UXBJ 2D1CA 1WF2A 3O1LA 3HVAA 1N0VC 4AXIA 5B0AA 3SEOA 3RW7A 4KBIA 2CZ4A 2XO7A 4F25A 2V34A 4ZHRB 5L38A 1FNOA 3Q8UA 3EGNA 2YX7A 1T8EA 1K9MT 2FB0A 2FJDB 2MQPA 1NJIT 2WW8A 3R5DA 1FEHA 3V4MA 4EO6A 1SC3B 2XEXA 1WF0A 1NLKL 2M52A 3OTOJ 3Q2TC 4Q43A 3S1TA 3ZTOA 2KHDA 4BHQA 3JTPA 1QD1A 3TAQA 2C42A 2HWIA 4WXWA 2VBXA 1VRTB 3IWNC 4RW8B 1RCOB 2W25A 2FVRA 1O0PA 3PX4A 1TFYA 3ONQA 2EFVA 3RR8A 4C8LA 3TARA 5C24A 4DR4J 4OYAA 4DUYJ 4K4WA 1UJ6A 2RU3A 1X5SA 3UO0A 2IPOB 4DV3F 2WVCA 5ETMA 3UR3C 5EWGA 2PO4A 5D78A 3LW5C 2H1YA 1S6UA 2X1FA 4WCEQ 4NLYA 2I38A 5KFOA 3HHEA 3M2UB 2RAQA 2CJKA 1ZETA 3QT5A 5D4NA 1Q95G 4D3HA 1R0AB 3TP2A 2H4WB 3W66A 3W1YC 1NK7A 4YOEA 1WKJA 2KI2A 2XS5A 2L48A 3DRXA 4DX6A 2F8HA 2WTFA 2CQ4A 4P72A 4GO7X 2W9BB 2OMLA 1IKXA 4KY3A 4Y0FA 3EE3A 2OTJS 4CYUB 1HBUA 2J6UA 4MTPA 3I9V9 5F8GA 1RWPB 5HMZA 2I2YA 1K0VA 2DCLA 2E66A 2V9WA 1U1PA 3R6LB 1S49A 1YX2A 4GRSA 4V19J 1S0MA 1HQ2A 4WP3A 5GAHI 2XMAA 1I6JA 3NMRA 4GMKA 4PYAA 3VZHA 3CEDA 3BKTA 4HR2A 1Y0HA 1GQEA 5B09A 2E5GA 2KYXA 1E6YB 1F6TA 2HFVA 4DFMA 4ER8A 4DS5A 2XS7A 5B0GA 5B0BA 3ENWA 3ILLA 3E51A 2GMHA 5H1SV 1HBMB 4FS1A 2KT5A 2R9LA 1N5TA 2ZBIA 3DMJA 1IKYA 1VQKS 3W2VA 1PBAA 3G2XA 3O3LA 5KFVA 4O3QA 2UV8G 2KFNA 1DQ8A 1MROA 2YKAA 4ZJQA 1T3OA 1SJQA 3PR4A 3MM6A 3X3UA 1BHNA 3CCTA 5EUHA 4LF4J 4ED8A 3R7NB 3BGLA 4IRDA 4YHHJ 3Q23A 1R6YA 2ASYA 1RAGB 3O44A 2ZD1A 3TVYA 4PXCA 2ZH4A 1GXLA 4JV2A 1R27B 1WHYA 3M9OB 2Q43A 3H2VE 1XC9A 4OX6A 4I68A 4OHXA 2ACMA 3R5CA 3P49B 3PX0A 4DV7F 3GV8B 2UV8A 3C16B 1FVQA 1Q7YT 2DNPA 4QWEA 4FKXA 5IWAF 2VQEF 5J2MB 2VFTA 3QSYB 1NK0A 3THVA 2DHSA 2Y0BB 3CB4A 5K8NA 3BR9A 2QJ3A 4KTQA 4P75A 3X1LB 3DHXA 2V8GA 5KFMA 4A46A 2WAQD 3MM5A 5KFTA 2BJ8A 2JEFA 5KAKA 2Z58B 1KQSR 3GB0A 4LBPA 2FHMA 1Q8IA 2GGPA 1H2VZ 1F9FA 3KHLA 3CCLS 4FS2A 3VALA 2VKZG 1MROB 3PW4A 5KG6A 4JUZA 4O44A 5HMXA 3KK3A 2ZH8A 2R7VA 2DT9A 1TKTA 3SCKE 2BR0A 4B3RF 1JLQB 1PILA 1OIAA 2BE2A 4IDKB 1SBRA 2FVQA 4GVLA 5CYMA 4UOHA 4KGKA 4UOGA 1RABB 4WFNQ 2AHOB 3V81B 4J9LA 3FKBA 2O01C 2HNZA 5DLGA 2HVZA 5ETLA 4MKBA 4A47A 4N76A 4ANCA 2AYEA 5C2GA 2NZCA 4U67Q 4RNMA 2I0XA 2HLTA 1AA1B 1DURA 3ZZUA 3BGRA 3SQGB 4P7TA 4ECRA 4QIWD 4FBUA 1SC6A 1UZHA 4UOFA 3D1OA 2VD3A 2PE8A 3NCRA 1U48A 4JBCA 4ICLB 1QTNB 3D6FB 2IDEA 3NS6A 3OTEA 4OZLA 3E3XA 3CULA 1A7GE 2XO6A 2IMOA 1Q16B 2LLZA 4OL8A 1QE1B 2R8IA 3LP2A 5K20B 4FXDA 4LBIA 4F02A 2RILA 1HQEB 1S1WB 3GLJA 4QW8A 2VG5A 2V50A 5F8LA 2KTQA 2C3UA 2R2SA 2LDYA 2YY3A 4S0MA 2J0QD 4O44B 5AT1B 3SFUA 4TY8B 4B9TA 2VDHA 1S9EA 4NA1A 2YWEA 4JI5J 1NK4A 1FKPB 3IC1A 3GIIA 2BANA 3UN5A 4UQGA 3BSCA 3PHTA 5IM0A 2R7UA 4WK1A 1IXKA 1K73T 2HFOA 4UQTA 2G1DA 1Q8BA 2KM8B 3L7UA 2PI5A 2EVZA 1U7LA 1UETA 2KH9A 2GJIA 5KG5A 1XMOJ 4ED4A 3TEHB 1VQ4S 3CGIA 3HFKA 1TTHB 3CIZA 5HVHA 4CH7A 3THTA 2HFUA 2E7WA 4DF4A 2V4JB 2UUBF 1KFDA 2IRYA 4DSKA 5AXMA 2I5JB 4CLPA 1RLDA 2PEBA 2KFYA 1SL2A 2DRAA 4FP9A 3LP2B 1HHTP 2ZH9A 3DM2A 1TELA 5C5JA 4X4UA 3BQ1A 4RKUC 1UVMA 2HSEB 3J81U 1NXIA 1YQHA 2HHWA 3PW7A 4N5SA 1L3SA 3MPUB 3MOZA 3LP1B 2HLUA 1TAQA 2CWKA 2Y1LB 3R9LA 1M1HA 1QVFR 1S59A 4DV0F 1RWXB 2JZ5A 3LGHA 1R8PA 2V4RA 1FRLA 1S9GA 4NLPA 3KOAA 2WONA 3OFEA 2VBYA 1QJHA 4D3GA 2RS2A 4F2SA 3MCOA 2QT7A 2ZKUA 3RB3A 3KUHA 2LQ9A 4O3RA 2VPZB 2XYPB 3GIRA 1F2HA 1T3NA 3V4IA 1SH2A 5D15A 3G6XA 1MU2B 3W3SA 1YJ9S 3H90A 3W2WA 3U1LA 2AGQA 3N0VA 2HWHA 3P8BB 1AFIA 2LFVA 4WPAA 2KXNB 3OVSA 1AZSB 2WBRA 5CA5A 2JLGA 5K5MA 4C8MA 2F1FA 3VQSA 1HBNB 1RWMB 5JJBA 2ZZTA 4DZ6A 2GHPA 3U27A 1JLEB 2HVHA 4QWCA 2XZTB 1IJFB 1X9WA 3PTWA 1M5OC 5K14B 4PQUA 4NLWA 2W7PA 1Q8KA 1UKUA 3PZPA 4MYUA 1S9GB 1UFKA 7FD1A 5J1EA 4ZVPB 2LEPA 3OFGA 3EDRB 2KN4A 4ECVA 1TVRA 4F4XA 1NKEA 1T9XA 3MF5A 4HACB 3DOLA 2KG0A 2P5VA 3M8YA 2B4UA 1IBKJ 1HPZA 4NXNF 1EX8A 1UWAA 3VR1A 1QUPA 2A2CA 5KFCA 3PO4A 2FUG9 1VQSA 1UJ4A 1HNXF 2YNGA 1WTBA 1Y5NB 1JMTA 2R7QA 3W2WB 4CTAB 2ZH6A 3C14A 3J7ZT 4OZ1A 2FY1A 2J7WA 1RTDB 1BMQB 3DHWC 3SXLA 2XWYA 3PO5A 3JTNA 5IS2A 2VJVA 4RW9A 2BJDA 3LWLA 2BUNA 1DLOA 5HLFB 1WHVA 1ZPVA 1XWLA 2DY1A 1U6ZA 5B0CA 2VONA 1KEKA 1OPIA 3OSNA 4CDIA 1H73A 5GAHU 4PUOA 3OFFA 4C0BA 4K4TA 4QBUA 2EG2A 3JAMY 1GEHA 1SC4B 4DR2J 1RHUB 2FY8A 3KLEB 4OHVA 1TL1A 3QRQA 1AXQA 2XWXA 2C22A 4BC9A 3IN5A 1WEYA 5ETTA 1AFJA 4K4VA 2N3OA 4WP9A 3LTOA 3NAIA 4EBEA 1RTIA 4ZA1A 3RB6A 4CIOA 4H4KA 4WU3A 1HPZB 4JV0A 2ERRA 2BMBA 5JMNA 1GTHA 3ADAC 2BV3A 1FKOB 5ETNA 3FSIA 4AXJA 4MFBA 3C14B 4KR0B 4WJBA 4WYLA 1VIXA 2QA1A 2ZNZA 4ILMA 1M1KT 4ELTA 3M8SA 4YS2A 4FXVA 2KZMA 4K5SA 3UWTA 2COLA 3C46A 3T1YJ 3D0GE 4FF1A 2B4VA 5A8RA 4WE1B 3C15A 2W2PP 3VAFA 3PY8A 3AY0A 2KB2A 2X3GA 3D0HE 1DJ0A 3OBIA 5KFPA 2LQ8A 1FKAF 1TL1B 3ILOA 1TK8A 4QR0A 4KQZA 5GMDA 4USMA 4NLVA 3JSYA 4ZPVR 4F4KA 2IYIA 4E98A 2IA0A 2ZHBA 3MM8A 3OR2B 4RNNA 2B3TB 3ZZPA 3FCWA 2GIRA 4B08A 4PWDA 3CJKA 1NZ8A 1FNXH 1TV6B 3TJ9A 5LSRA 3DRYA 1JNZB 3J7YI 4LFCJ 4MFBB 3TX8A 5B08A 4GO5X 3ZZZA 1ZPWX 2AZ3A 5ETRA 1UL3A 3HPOA 1H3DA 2MKJA 4X4RA 3AJDA 4TLQA 5IC6B 2DPJA 1HWKA 2OH2A 4IH6A 1JJHA 3MZIA 4YFUA 4C8YA 3PV8A 2DEIA 1RAJA 2UUWA 3HHLA 3IMQJ 3ZZ0A 1QUVA 3CMAS 4IO9Q 2GVZB 4YN3B 3HVRA 5A8RB 1N32J 1AUSL 2R7OA 1FD8A 2DHXA 4CP5A 1RTJB 2EBEA 2ZM6J 2CYYA 1IBMF 3SDEA 2HZAA 3CJSA 2EC0A 3J7Z5 2CPDA 3M6UA 1MN7A 3OL8A 2E7XA 4FYXB 2B5JB 4FPRA 4EBCA 3EX7B 2IBOA 5KFBA 1JLBB 5DG8A 1SJ4P 4NI2A 1IUJA 4DLEA 4ED5A 3JAMU 4ERDA 1RQ0A 4OHYA 2AEMA 1ICEB 3KXDA 1IBCB 3A8KA 1UJ5A 1HHQA 1IVZA 3MECB 3KK2A 1Q5VA 1NJWA 3WIVA 4AL6A 4OYMA 2NZ4A 4U95A 2FTRA 5E5NA 3L7OA 2HGNA 1P9YA 3Q8YA 1OY9A 3TX0A 2YQ3A 1U8SA 2GO9A 4ITSA 2NLWA 4UZCA 1D09B 3EGWB 4O23A 1T0TV 2QX0A 3W5YA 2EXUA 4CLUA 2G0JA 1XNRF 5C42A 2IM2A 3TUIC 4ZITA 2E1PA 4ZCLA 1GMVA 2RDJA 3KFWX 4MIWA 3BS9A 3KTQA 4M5NA 3SDEB 4AFFA 3K5LA 4U6PA 4EEYA 1LWFA 4U7UD 2GV1A 2PEHA 1VYAA 2JOQA 1BQMB 3MOJB 1W7WA 3GZ7A 3IR5B 1HYSB 3DXSX 4F04B 5D6GA 4C6AA 4ZN3A 4A48A 2K2PA 1C0UB 4FF4A 2NS1B 2MQLA 3MWBA 5DQGA 2DEJA 3RRKA 2BRKA 3BPDA 3UVJA 2NXUA 1X4AA 2W2MP 1KDNA 2UUCF 2BM0A 1BLUA 2M70A 4C3KA 4DS4A 5GADI 1T02A 4DV3J 1C0TA 4F4YA 3US5A 2HMIB 5CZXA 4KKOB 4ZVEA 2YWKA 3HSJA 1PBUA 1CJVB 1RISA 4IG0B 3ZTRA 4LRDA 4WYWA 3I0RA 4H4MB 2O67A 1FI4A 1R6VA 1RKJA 3KK1B 4V1Ak 3FEXB 1R89A 2UVRA 2X3DA 5KFJA 2B7CB 1HKAA 4IR9A 4K4YA 2MLYA 5AJ3J 1VQMS 2EI5A 4UF4A 3WQPA 4DL7A 1C1BA 3VGTA 4QWAA 3UCGA 1TK5A 5LOQA 4NLRA 1LW2A 1ZTWA 3AA9A 2MZ1A 2AJ1A 2ZWOA 1IN0A 3DU5A 3E01B 3UD5A 2ZH3A 2FVCA 2WBMA 3MR6A 4J9NA 2KL8A 1F2GA 2F63A 4IOAQ 4B9NA 3WC0A 4PXBA 3K5MA 3L7PA 1W26A 3SV3A 1YBUA 3QLHB 1X5PA 1Q81T 1LK7A 4CLKA 2BA9A 4DSLA 1EKRA 2RQKA 2HK3A 5LMUF 4C48A 2GQCA 1UVIA 1VMBA 4F8RA 1UWBB 3PIPQ 5DO2A 5J2PA 1REVB 2YKMA 2ASLA 1JKHB 1NEEA 4CRJA 1WDTA 5H9EK 2OEMA 2QL9B 1AUDA 1QAJA 1S6QA 3MEKA 3RBEA 1UW4A 3PRBA 1H2UX 4Q0BB 4ZLNA 3FQKA 2IVMA 3KJVA 1NHKL 2IM0A 1FJEB 2JLFA 2OO4A 4DL2A 2EEYA 1X31C 4DR6F 2C3PA 3CMES 4AL5A 3ENVA 2YNFB 2DO0A 2M7SA 1RUSA 2XM3A 3ENAA 1RHJB 3FBBA 2D41A 1S0OA 3CDWA 1FRIA 3VTIA 2OD6A 3OLAA 3SFGA 6FD1A 5LL6d 4P73A 2W9CB 2Y1RI 2DNRA 2XQCA 1EQ0A 1FX4A 3EXYA 3EUNA 4Y2KA 3KDNA 3K5NA 5LSLA 1YVFA 4DV6F 4DPYA 5KG7A 2VIHA 4P7VA 2QN6B 3EXCX 3HJVA 3L3CA 4DV7J 4J7CA 2FC8A 3DLLQ 4CO0A 3PYEA 4LRCA 2VQEJ 1JLAB 2G2ZA 3T5KA 2C2EA 2YKMB 3W63A 1VLYA 4OZ2A 2XNQA 1TL7B 3GQCA 3MAAB 2AMCB 4QU6A 2CJYB 1X4FA 2R2TA 1UFLA 3PACA 4I1TA 2W4PA 1WJ9A 4PXEA 4ES1A 2LQ5A 2HW3A 5CXTA 2IIHA 4DPTA 4X4OA 3NBPA 3MXHP 3CC7S 1X4HA 2F4FA 3OW2R 3FFIA 4WFAQ 4NLUA 4ZS6A 3HXMA 2HEKA 1IR0A 3HULA 5DDRC 3TZXA 5IXUA 1OYEA 2F9DA 2P9EA 5DG9A 1BUXA 3FVYA 3O6QA 1C1CA 5DGBA 3HDSA 1U6FA 1V5IB 3OL7A 3FCVA 4URGA 2R8JA 2HS4A 4B3RJ 4LR8A 1RA7A 3VGSA 2YNIA 3PIOQ 2HRTA 2ALZA 1M1GA 4PEOA 1K0TA 3DDNA 3VZIA 1KKHA 1R8CA 4ZP9A 3PRDA 2BJEA 3UI3A 1I51B 2A0FB 2HWTA 5LJ5Y 3UDEA 4TNOA 4TU9A 1HQUA 3WBZA 1T11A 3IM9A 3KNGA 2GS8A 3MUVP 3AXKA 2RH3A 3DLGA 3CJ2A 4DUYF 4LUBA 3MEEA 1CJTB 1VRUB 4ID5B 3OFHA 2QMWA 3OD2A 4USUA 4Q5VA 3MMCB 3CCQS 3DRRB 2KO1A 3NKYA 5KFAA 2M88A 4WFZA 2UP1A 3J80Y 4ECSA 2C3OA 2ZBQA 1H0HB 1PG5B 2Z0GA 3LAKA 3CUNA 4RWWA 4M8LA 1DTTA 1VC0A 3Q83A 1Y5IB 4NL5A 2OLWA 3R5GA 3UN2A 4OX8A 4GVBA 2NYHA 2DXDA 1VQYA 3IFEA 3J7A1 1H6KX 3FBFA 2BW2A 3C8YA 2MHNA 4OYZA 1H38A 2BOPA 2J0SD 1YITS 4C2MA 2OP5A 4FPIA 3J81j 3IR7B 2GHWA 4B02A 2EBGA 4IQMA 3VAJA 1EP4B 1N5QA 5HBMB 4KRWA 1GT8A 3TJAA 5FDLB 4YB7A 4RU9A 2XLIA 3CJTA 4OJHA 1SJ3P 2ALYB 3QYYA 1J5EJ 1FK9A 4KSEB 3T1HF 3CWJA 3LP0A 2RKIB 1CLFA 2EFOA 3B82A 3M30B 4ETZA 4MK8A 3RG6A 4X62J 3VAIA 3D68A 3IS9B 2H48B 4LSLB 1D8YA 4CM0A 4LRFA 4QJVA 1SKSA 2EFGA 3EZUA 2AJFE 2ZBRA 2CPZA 1GH8A 2FHJA 2B9YA 4ZPWR 3OL6A 2LA6A 3BQ0A 2DRBA 4CO4A 1FVSA 3M8QA 1HIYA 4HT7A 1NCLA 2DPIA 1VQLS 2GVDA 7AT1B 2EK1A 3SSRA 3FMBA 4E0DA 1SJ1A 1S6PA 2QG9B 3AXMA 3SBMA 4IFVA 1UVLA 3HFZB 2MYFA 1DFDA 5I3UA 3NOCA 1SVDA 3ZZYA 2YX4A 3HJFA 3QNWB 4URQU 1PSDA 3FNNA 1QSYA 3QJJA 4RBUA 5DRKA 1TUWA 5J1NA 2F8EX 3Q22A 3M1VA 5J2NB 5KT3A 1RK8A 2VA3A 2QLXA 4OJ3A 4NA3A 4QR1A 3OLBA 3BO4A 2RD5C 3AAWB 2XLKA 2YX1A 1C4CA 4ECUA 2MEWA 1ITPA 1RGVA 1FRMA 2DNZA 3H5YA 3VF0B 2IDLA 2YTCA 1OWXA 4MKAA 3MMBB 1WTFA 3NGSA 2OPQA 3VAKA 2CQ1A 4C7QA 4HHUA 1S5ZA 3SSQA 4RW4A 1RT1B 1RZMA 3EDQB 3Q8QB 1RBOB 5J2QB 4F4AA 3D9BA 5A6WA 2H3EB 2MLZA 5I42A 3A4TA 3J80U 1XTZA 5E3AA 4HTJA 3RR7A 2HZVA 2HNYA 1YTYA 4H4OB 4PKDB 3SMZA 3CCJS 1WSRA 4IFVB 4OYWA 3T19A 3UNGC 1N52B 1N6QB 4KFBB 3CCSS 4USVA 1RTZA 1CEZA 2Y0SD 2IC3B 3LUYA 1YK9A 4RLEA 2B4OA 4ELVA 3NLCA 1MWYA 4PQAA 4NXNJ 1RXOB 2R8KA 4J37A 2D9OA 3I55S 1WHXA 5KFUA 3BM7A 3QRRA 2PMZD 1V5VA 1HNXJ 3GPAA 4O4GA 2LQBA 2V5HG 3GTYX 4F26A 5HQMA 3QJLA 1X7VA 3TNVA 4DQQA 2BVZA 4ZLPA 1K44A 1TAUA 2D9PA 2WSFC 2JFDA 1U24A 3G87A 1SB6A 1DAXA 2H4YB 1S1UA 4ZCMA 1J27A 1IBLJ 1FTRA 4C8ZA 5D3GA 5HSPA 2VOOA 2HHQA 4LMZA 1VBZA 4I6AA 1G1XA 1OY6A 3WZ0A 2KRRA 5DQIA 3WIUA 3GR1A 3M2VB 3N5FA 2JC1A 3MM9A 2J0XA 3JSMB 1KQKA 5LSOA 3FC9A 2HQIA 3DDKA 4WFXA 1N54B 4O3PA 2YPYA 2E1RA 4J9UE 1NK6A 2ZITA 2A2DA 2OKQA 2MZQA 2D3OR 3RRGA 4RW6A 5HO4A 4O3SA 3BGOP 1Q53A 1RAFB 3C2PA 5DS7A 4X4NA 4I4BA 4KC5A 1LFPA 4WTYA 4B9SA 1VK8A 4M5JA 4XK8C 2F40A 4KYZA 3KLFB 4M5DA 1BQNA 2OPPB 1CJKB 1JLFA 2J0WA 2DHGA 5F9LA 1A0OB 2BKNA 4OLOA 2L9NA 4OJ1A 2HURA 4GKJJ 4PG5A 2VG6B 4UY8T 3GYNA 2MKKA 4CZCA 3ZNUA 4NOHA 2HIYA 5LMNJ 2B56A 2FZGB 3GP9A 3CDUA 4M5GA 4ECZA 4O4GB 2EFPA 4I6WA 3AB2B 2VU5A 2KJWA 1F1BB 1VJWA 3CT9A 3ET6B 1R8HA 2P9CA 2E1MC 1XMOF 2DNHA 2LKZA 4DL5A 2VKRA 2NUHA 3NS5A 3NWGA 2GHVC 5JVHQ 2Z2YB 3DLBA 3CO0P 5KFRA 3DCAA 2OSQA 2RRBA 1WG1A 4ELUA 3OJSA 2EKNA 2P9GA 5IOLA 1FXLA 3TAMB 3GE9A 4YR3A 5T7LA 5IT4A 1L3VA 3AQPA 5IT0A 2AU0A 2AGOA 2LDIA 2ZDOA 1NJYA 5A8WA 2CJXB 3QT8A 5L46A 2A3JA 5KFNA 3LWMA 4ATNA 4CLWA 3FCHA 3U7JA 3GSIA 4N41A 1LWEA 4CO3A 3SCJE 5CH7B 1SV5A 2K06A 2IAJA 2RIJA 3PKMA 3K8VA 2ZH2A 3W9JA 3OXGA 1D9FA 4ID8A 3H4BA 2GQ2A 1D9DA 1BY9A 4DUZF 3WX8A 4JI3J 3CC2S 1LNQA 3QIPB 4B9LA 2XMTA 3HMJG 4LBHA 1NB7A 1B64A 1S0NA 3NCPA 2PSZA 2CQBA 2ZE2A 2VDIA 1PAUB 2QO3A 4Y34A 2GA7A 2IBKA 3DRPB 3FZ2A 3BBBA 2HAIA 2DH7A 4JI6J 2RMLA 3DN9A 1WDDA 1JXVA 4RWXA 1FFWB 1F9HA 3GIKA 2OHDA 5DZ7A 1IBMJ 4I2PA 2MJNA 4K7QA 1I94F 5A0YA 2QLFB 3V6JA 5C25A 3D67A 1F5CA 3ILJA 1ULRA 4Q44A 5F8IA 4FZVA 2K1RA 2QA4S 3PHEA 1M0SA 4Z7CA 2G0CA 3R5AA 3ILIA 1G3OA 5DJBA 2YNHA 1ACMB 2RF2A 4B3TF 2SXLA 2HVDA 4L3KA 3GYXB 3DRSB 2BM1A 4K4SA 2QSFA 4F7VA 5G0RB 1LXNA 1K47A 2DIVA 5KG2A 3MI7X 3LQVA 4RUCA 5AXKA 4DFJA 1TKDA 2MKYA 1RE1B 1YJ7A 2W2NP 2CKWA 1CPZA 1CJUA 3AD9C 4OYBA 3I82A 5EHHA 4NCGB 1JLGA 4PG6A 4UY85 4NCAA 1FE4A 2PN6A 1B70B 3HX9A 2XGQA 1XNRJ 3MAHA 3CXCR 1S1TB 1K1QA 1ROFA 4OX9J 2V8PA 3GCXP 1PJ7A 1DTQB 4RBVA 4J9PA 1HMVA 4RW7A 2BDPA 4PWUA 1TK0A 1V3RA 5KFFA 2WHOA 4TKTA 3DU6A 4HYKA 1VRQC 2QYGA 4P2SA 3ISNC 1IKVA 2D7SA 2YBVA 3I0SA 3I6PA 2YNHB 3NP5A 3Q8RB 5D4OA 1SKRA 2FVPA 4FYYB 1RB0A 3Q8SB 2VF3A 2EWHA 1MMDA 1CC8A 2HBYB 4JI8F 4OMFG 3M9NB 4XPEA 4DBQA 4J9MA 2UUCJ 3I4PA 1RT3A 1FRKA 3L9ZA 1EETB 4Z7YA 3CJ5A 1RI7A 3I56S 4LF9F 2BJ9A 1IM6A 2PD1A 3P5BP 2QYCA 3R7SB 3DLKB 3AODA 1RT6A 3ETMA 1FWLA 2QC3A 2R8HA 2W24A 4K4UA 4NEYA 1ZOTA 2ZH1A 4RW7B 5CABA 3KLHB 1Q8LA 4OYIA 3EGVA 4CLSA 3T1YF 4LF8F 2N4DA 3R1LA 4F0HA 2HBQB 3QGHA 1RWWB 2DHAA 1ZA1B 1YBAA 1WOSA 1IQZA 4F3MA 2IRXA 3QSIA 2JSXA 2HAFA 3IAS9 1VISA 2B7BB 1KN6A 4PWWA 2G1HA 3VHQA 4M5KA 2VJUA 3KLVA 3MMAA 2RQ4A 1S1XA 5HROB 3ZFVA 4H4KC 3GV5B 5LMUJ 1KNZA 3HVTA 5IV3A 2Y9HA 4ENOA 1IKWA 4ECYA 1T05B 2N82B 3NGTA 2HHXA 3F41A 4EMDA 5F8HA 2MKHA 3SI8A 1RWNB 2XCAA 5A8KB 3PVXA 4CNZA 2MQQA 1QAIA 1VQPS 2X7IA 2BACA 3H5UA 1RWOB 1U1LA 4F3OA 2M3DA 1RT7B 4IKAA 2H5JB 3EZ5A 2GJFA 2GMJA 1URNA 3ZO7A 2BABA 3OV7A 4DHVA 4DR6J 3KHHA 1D1UA 2CPEA 2GQQA 4DX7A 4ZHRA 5KFXA 1PYTA 2Y1IA 1KS2A 3I87A 3A3OB 2ACYA 4NLTA 4ZDNA 1LWXA 1X60A 3PM9A 2ZFHA 2RSQA 5SZTA 2PT0A 1JLCB 4MIBA 4F67A 3LPEA 3OL9A 3JS9A 2OGUA 3D66A 4QZVB 1TUGB 4DV6J 4I0WA 1U2CA 5LM7E 3CDAA 2QA4G 3PW0A 3M2RB 5HVGA 4QIVA 4J9VA 4KV8B 4F3QA 3ULHA 4C97A 3HVTB 3ZZRA 2P6SA 1FNMA 4C4WA 1VRTA 2WSEC 1HNIB 4RW8A 5DGAA 3P3DA 4DR5F 2WB4A 1O51A 3KJFB 3FSYA 2J9EA 2DH8A 4NRUA 4M5IA 1EQMA 1GXUA 2CVIA 2CZVC 2HHSA 4KH1B 2I1RA 3MTJA 1HFEL 2ZUGA 2XMWA 3DYAB 1KOHA 2HYIB 2VPYB 3I96A 3UDVA 1ZBTA 3PKYA 2VFRA 1RAAB 4KGZB 3GSDA 1TKZB 2E7VA 2IHR1 3AD7C 4RO0A 3OSPA 5DM7Q 1SIWB 4JI2F 2DRDA 3HHLC 5B7WA 5D0RA 2R2RA 3M2UA 4LIWA 1S76D 1UVKA 5KTQA 3UDLA 1R0AA 2M0GB 1GXTA 3B6BA 1KLNA 3NRBA 4K4XA 2DGSA 4CCHA 4DMZA 3EGZA 4LREA 1EIYB 4UZBA 2UU9J 2W7OA 4G1IA 4HKQA 2W9BA 1WI6A 4O0IA 2E1CA 4DG1A 4CYUA 2XY5A 3R1HA 2KT3A 3T3FA 2DKOB 4B3SF 3UCZP 2CFXA 4FYVB 3TZZA 4DPXA 3GFXA 2CIMA 4XO0A 3TEGA 2CQHA 3DLJA 4Q8EA 3LOUA 2G4BA 5D8HB 1CULB 3BKFA 4A8QA 1WNEA 3M8WA 4RX6A 3UW1A 1E6YA 1AB8A 4DR7F 1NDCA 3Q8VA 4OHZA 4ZJLA 1ELOA 2AKWB 5K8MA 4HL9A 1S4EA 4F2RA 2IFXA 3UE2A 4CLTA 3R2DJ 1HBMA 5KG3A 2XMMA 3D2WA 2DVIA 2BQUA 2LP4A 5L1KA 2BOAA 5AJ3F 2MQ8A 1VBXA 5CYJA 4CLZA 4M1KA 2XG8A 1LWCB 1EZZB 1KOOA 5DETA 4B3OB 3K2YA 5CCMA 3DLEB 4I64A 1KQFB 4M94A 4DG1B 2ZOFA 3RBXA 4C3MA 1SI9A 3FBCA 2RHSB 3T1HJ 2B6AB 2D3ZA 2JL9A 1FDNA 2DK2A 3OTDA 4ILRA 2XCPA 1FF2A 2CQ2A 2WK4A 2EFNA 2YWFA 4L73A 1T9UA 3C16A 5A6PA 1YJRA 1X8DA 2C3YA 4DWIA 5J2MA 3DOKB 1N36F 5L9NA 3QFWA 1OSDA 3FJ2A 4G6VB 3AHPA 3DOMB 2AYBA 4DSJA 1Q5YA 2QMUB 4BC7A 1WKLA 3W7BA 5D0EA 4OYOA 1RAIB 2RQCA 2HQGA 1FTCA 3PW2A 5ETQA 3SZ2A 1FJCA 3VAHA 3LA0A 3MEDB 1YRUA 3PYFA 5KG4A 3DGVA 4LF2A 1YKWA 2W9AA 5IQ6A 2GAHC 4YQWA 4OLPA 3UN3A 3EVWA 2V2KA 3VVTA 2E5LF 4USIA 3SQOP 2XS2A 3HKWA 1JLQA 5E7OB 4LFAF 4IDKA 2MMYA 5BYRA 1YSJA 1RTHB 2AGPA 3TRGA 2J6TA 3PFEA 3D6MB 3V81A 1SPBP 3F73A 4DCOB 1VGYA 2RU9A 4AUKA 3QPIA 3RB4A 2MLXA 3B78A 3LPYA 4X65F 3G96A 3K17A 3DI6B 4NRTA 3Q0AA 1SKWA 1EB0A 2AZ1A 1NDLA 2Z57B 3G8QA 4J9SA 1HNVB 3SQGA 1APSA 2G0IA 1Q0NA 3PX6A 2R7SA 5ETKA 4ICLA 4C8KA 2DJWA 2XSJB 4WBFA 5C7PA 2XNRA 2ZJQQ 3ITHB 4Y6IA 2K7KA 2HS0A 3LALA 3DDIA 1HL6A 3UD4P 1SQGA 4CT9A 4ZLJA 3C3LA 4AL7A 4I6YA 3QGIA 1QE1A 4ED6A 4YY3F 1Y3KA 2IJRA 4HVZA 1HQEA 1YRTA 1S1WA 2F7VA 1C4AA 4CNYA 5FIIA 5HAOA 3G9CA 2BE7D 4Y2AA 4TY8A 1R0BG 3RU0A 3ZXWA 2FIUA 4DV5F 3J7AN 4HI1A 4XPCA 3SYZA 2HQFA 4DQPA 4LRBA 4DL0C 1O8BA 1FKPA 4M95A 5L1IA 2QEXS 2YWWA 3M6WA 4DOZA 1FXRA 1NDKA 1XR5A 2CJ9A 1UAWA 2CNKB 4DUTA 1VQNS 8RUCA 2IRUA 2KDOA 2YH1A 2AW0A 4GKKJ 2D69A 4MKVA 2EW9A 3NGUA 1Q7LB 1VQ7S 4UW2A 5KT7A 1H7WA 1T9TA 3CCWA 5F3ZA 3BDEA 4CQ1A 3CJ4A 1B0VA 3HP6A 1GMWA 4XDCA 4JP8A 5HJXA 3KLIB 3OHAA 2W7AA 3G82B 2V4JA 4FBTA 1QDUB 1YJTA 4WKRA 2R8GA 4BDPA 2Y3YA 4LQ3A 2I5JA 4IG3B 4K0KF 2HQCA 1NKBA 3PRVA 3QO9B 4WZQA 3SIPB 2B51A 4B17A 3M05A 1TQLA 3JTOA 1T7PA 2H5EA 3H4DA 4LFBF 3IG1B 2NSBA 3LP1A 3UQSA 1Y3JA 4NXMF 3GG1A 4G65A 1SH0A 1FRJA 2QFIA 1MMLA 1YBTA 5KOXA 2MJUA 4DV1F 4ZP8A 1CG2A 3MEGB 2F5GA 5E3CA 3BSAA 4CLFA 3ETOA 2QZ8A 1J5EF 1HR0F 4WIIA 2B0GA 1HARA 2MZRA 2Z2ZA 4KT0C 3D28A 3AA8A 1RWUA 1MU2A 2WRMA 5CAAA 5EWFA 4X62F 2Q6BA 1N8RT 4NWBA 3BGUA 1VDHA 2KJVA 4ZK7M 5HI7A 2APOA 1HNZJ 3RBDA 1HWJA 3PNIA 4A8MP 1VQ5S 4K59A 3POTB 1LKZA 4IYQA 3D5MA 4OFZA 1AZSA 3QFHA 2PDAA 5CYQB 4DV4F 1HBNA 2K3KA 1NPRA 2D3O1 2RRAA 2MDAA 2VBZA 3MCNA 1RA6A 2DNNA 3IWXA 3TO8A 1JLEA 2AX1A 1U2RA 2DNOA 2RJZA 1PO6A 1BC6A 5KFEA 1SQFA 4LSNB 4TQRA 1UTAA 4EWTA 3G6VA 1OPZA 5SUHA 5K14A 1DQ9A 1SQEA 2ZEJA 4KHRA 1U0SA 4ZVUB 3HK2A 3PFOA 5FD1A 3TUJC 4L6V3 3N79A 1JJ2R 3FSXA 2X1GA 4IRKA 3HZEA 3MM7B 3JQJA 1H72C 4A8YA 3UDCA 2AEFA 1YJVA 3HVWA 4EU0A 4PABA 2HNDB 4HACA 4EBDA 2W8LA 3R27A 4DUZJ 2X51A 2HVIA 2LA4A 4LF6F 4KH0B 1RCXB 4DSEA 4X64F 3SCIE 2V63A 2AJ0A 4DEZA 4U7CA 3K89A 2ASDA 4CTAA 2DR6A 3BZQA 4NMLA 1RTDA 3IR6B 2L08A 2V67A 1WSVA 1H2TZ 3IBFB 8AT1B 2JHEA 3W65A 4PAAA 3KWMA 4WKYA 1LEOA 1S6OA 3KG0A 4XDDA 1FEEA 3VWSA 2DR5A 2FC9A 4KAIA 3MPDA 3CCRS 1SJRA 1I94J 4X2BA 3U1MA 5T14A 5HLFA 4ZN1A 5JVGQ 1NHUA 1Q82T 4TU7A 5B0EA 3W60A 2AWZA 1CSJA 4HDGA 1N34F 2ATLA 1OS5A 3KJQB 5FJ4A 1B0PA 3DXBA 4A4JA 4B3TJ 4NYOA 3UR0A 2QRRA 2Z30B 2PGCA 3KLEA 3LH2S 1N88A 2Q3PA 2FJWA 3HD1A 2CZ9A 4EZ6A 4N47A 1DHMA 2KYZA 3HSDA 2OAUA 2A6MA 5H9FK 3CD7A 4ZVGA 1YGYA 5M2PA 4OX7A 4J5OA 5GMKa 2OFHX 2C2NA 1VIOA 2Q79A 2AX0A 2L9DA 2GAGC 1FKOA 3EPGA 1HW9A 2XYGB 2C1EB 5HATA 3RAMA 1RYRA 3I5CA 3N5BA 1ZAVA 1X0PA 3R2CJ 3TZWA 1IBLF 4YB1P 4DXLA 5ETPA 2NPIA 4UUWA 1RAEB 3KMSA 3BEGB 4J9KA 2IVYA 4LJMA 3N28A 3TANA 2CQPA 2HRUA 2VG7B 1U2FA 2KT2A 2FGOA 2ADBA 4MK7A 4WE1A 5LJ3Y 2BJ7A 3BO2A 3V6DB 4IR1A 4ILLA 2DR9A 3PEJA 1EARA 3BN7A 5ADZA 1Q78A 4KIAA 4JI8J 5EDWA 1YJNS 3ZTPA 3KG1A 5ETVA 2Y8YA 3HM9A 2DNGA 4N8NA 1NK8A 2ZBCA 1RT5B 2M9KA 1SKUB 4I69A 2FHKA 3E2EA 1TKXB 2LEAA 3OR2A 1RHQB 4GKJF 1WKKA 4NYZA 3RBZA 2XYHB 2HHHJ 4CO1A 1B7FA 3AOCA 2CWXA 4X66J 3TZYA 2MPUA 1HD0A 3HT3A 2LYVA 1QVGR 5EX3A 1TV6A 2E5HA 2ZC3A 3L4BC 5LMNF 1Y7PA 1XMQJ 4Q7AA 4A8WA 4P2FA 2FJAB 4BBYA 4C0HA 4LF9J 2M4MA 4QU7A 3CSKA 4YP3A 4DLGA 5F41A 3TUPA 2VOPA 4KE5A 4AQYF 2J76E 3BBFA 2KXFA 3GCWP 1HA1A 3UCUP 3DLHA 2Z8QA 4ED3A 2VH7A 2V2VA 1U09A 4FNHA 2UZAA 4DL6A 4QIGA 2Z2LA 2ZJRQ 3AD8C 4RNOA 4LF8J 1WF1A 3W64A 2GVZA 3G71S 2BQRA 3S8SA 1S48A 4NPOA 1FT8A 1FE0A 3TQEA 1KLMB 1RTJA 1X5TA 3WHIA 1N5YB 3H8YA 3VGUA 3FEYB 3IRXB 4QW9A 2ZOMA 3F44A 1ZYQA 1XN9A 2B5JA 4C11B 5A2QY 1NJZA 1OSCA 3BGFA 1JLBA 1LOUA 3NOGA 4DPWA 4JV5F 2W2OP 3CCUS 1HBOB 2VBWA 2XI2A 1UPMB 3TQ1A 4I7FB 3R7BB 2AT1B 4N8OA 1BQXA 1VJQA 5C2CA 4TYBA 2PA8D 2HBZB 2CNOB 1XJWB 1S77D 1J2VA 4PG8A 5D0HA 3MECA 4OQJA 3K0JA 3P4UB 4FYWB 3TA0A 1RAHB 2OMOA 2HIQA 2GO8A 3H0PA 3NGKA 4L76A 3GONA 4JI3F 2V8VA 4UTGA 3NL0A 5IC4B 3W5XA 1X4EA 5KFQA 2EK6A 2QFJA 2V68A 4M5MA 4K8RA 1NPKA 5H9EJ 4KHMA 2DO4A 4IFYB 4JYAJ 4JI6F 1T9YA 2XTJP 3M8PB 4Y00A 1XK8A 1XMBA 4Z2XA 1FFSB 2V8DA 3QIDA 4IH5A 2JVRA 3TJ8A 1PAEX 4TY9A 1VQ8S 2X1AA 4R5PA 1RBAA 4QYZK 1BQMA 3RAQA 1RACB 3K7RA 2GJ2A 4J90A 2ILYA 1HYSA 2DD8S 2OUGA 3I5BA 1NAQA 3HFVA 3F0NA 4EYIB 5DLFA 1C0UA 2UXDF 2R7TA 1XQIA 2OPSA 4DV2F 2RUSA 4HLBA 3G86A 1U0HA 4DR5J 3W5ZA 3T5HA 1PC5A 2E44A 1NK5A 1Y00A 1A6LA 1L3KA 4BWMA 1RWKB 3MR3A 1PJ5A 3M6XA 2VPXB 3HSZA 1OQ3A 3GFHA 3H25A 5E0OA 4ZIVA 2HMIA 4KKOA 3BDPA 2E29A 1N56A 1SIZA 1V6HA 4YMEA 2PFDA 2YKPA 1CJVA 5IT9Y 3P96A 4JI2J 1YZ6A 4DQIA 3C6TA 2DBBA 4IG0A 4ECWA 2CVEA 1HNWF 1P1TA 4MT1A 1B7YB 1NM2A 3EM1A 4H4MA 2E9TA 1DARA 3A13A 1TFWA 1X4CA 1L3UA 5DDPC 3KK1A 4OX9F 1IR1A 3GG0A 2PA3A 1KTQA 1N0UA 3FGVA 3KUEA 4CO5A 3CJ8A 2DISA 1WWHA 1R31A 1GX5A 4LIRA 1RDRA 2IM3A 2W4CA 4R5PB 5I3PA 4NCBA 1EAYC 4DZDA 4HHJA 4FN5A 1TL4A 3IWLA 4Y2MA 1X9MA 2K8GA 3E01A 3LANA 2RE1A 4TU8A 4PRFA 2XMUA 2XBPA 2KU7A 2OPSB 2WVBA 4B3SJ 1A9NB 3HCXA 4Y2IA 1U0HB 5A2QU 2PMWA 2DGVA 2QGFB 2Q1LA 3QLHA 4O3OA 3O2IA 4YUDA 4LR7A 2CQCA 3K58A 5LT5A 1EHWA 5C24B 4WFYA 4YEAA 5LXRA 3WC2A 4B3MF 1RT2A 1UWBA 2QTWA 2LECA 4JI4F 1GAOA 1REVA 2DTJA 1JKHA 1WEXA 1JQGA 3T9ZA 3C6TB 4FF2A 4DR7J 1TZ0A 1OO0B 1NSAA 4DCPB 3H5SA 2MKCA 2CPFA 4Q0BA 2WZ1A 3EVMA 2LMIA 4OI2A 3B54A 2V2ZA 3S7RA 4W98A 2JEJA 3QQCD 4G1QA 4OIXA 4OZNA 1Y5LB 2HHPA 2YNFA 2Q6CA 2ZVIA 3EPIA 1VQOS 5GAGI 2UXCF 3V6KA 3GILA 3PXGa 2FJBB 3H7HB 2N7YA 3RAXA 1Y9OA 2X1BA 3CIMA 1IKXB 2W9CA 4F0MA 4EK2A 2OPRA 2CAJA 1I5OB 1HBUB 1U49A 4BS2A 2HGLA 1XR7A 3HHDA 2AF6A 3UNYA 2NR0A 2A6OA 1T03A 3TW0A 4X4SA 3CF5Q 2KXHA 1RT2B 2WW4A 2QA2A 3TVKA 1RLCL 2J5AA 1JLAA 1N36J 4X4PA 1PYOB 1RSCA 3FRYA 1UW9A 1L3TA 1TL7A 4CH0S 4WP8A 1IQTA 3MAAA 4P6QA 1GFWB 4WK3A 3OR1A 5B0DA 3FMWA 2MHEA 2CQDA 2IY5B 2DGWA 5E3RA 4ANEA 3W61A 2LQJA 1PKUA 3J81Y 9RUBA 2FVSA 5IT9U 3AQOA 3RB0A 4G1QB 3UD3P 3A1YG 1QM9A 3DMJB 2YQ0A 4OI1A 1IKYB 2B8QA 2OEJA 1RU2A 3VAMA 3W2VB 1Y4ZB 1ZM9A 2H65B 4U8YA 2DYAA 3PR5B 3KUGA 3IBWA 2DR8A 2XY6A 1PC4A 4DSIA 2E5LJ 3MM6B 4A8XA 4LFAJ 3CJRA 2OPRB 1Q86T 4Q45A 4OZ3A 4ETXA 4LVNP 2DGQA 2GZOA 3M8RA 2ZD1B 3QJPA 3LAMA 4DN0A 2LEBA 2CPYA 4IH7A 4P52A 3RW6A 1UA0A 2GCFA 1OY8A 2W4DA 2J7UA 4Q8FA 2HHUA 1KVKA 3NWRA 4X65J 1T03B 5KOWA 3B8HA 2FZKB 3EZOA 4F4WA 3CD5A 4K2JA 1I3OB 2V69A 2H54B 3VV2B 5HQ8A 2E9RX 1CJTA 1VRUA 4ID5A 3C19A 3MMCA 1U1NA 1FJGF 3DRRA 4BWJA 3OR1B 1R3NA 2C2KB 3MR5A 1VQ6S 2V8HA 5DQHA 4NZ0A 5D77A 3MM5B 3TWZA 1NRKA 1B99A 4OYXA 3TR5A 2FDNA 2C2MB 4YY3J 1O6XA 1WD6A 2GGPB 1T9WA 2AJ2A 4GC7A 4FYDA 3T5LA 1U1RA 3FBEA 4DV5J 4NLSA 1F5BA 3FUYA 4NLGA 2DR7A 2DNMA 3KK3B 1TKTB 1E6VA 1LW0A 2HFZA 3GFZA 2BE2B 2UU9F 1EP4A 5HBMA 5CYMB 4H54A 5FDLA 3Q2SC 2D3UA 1FRXA 1QLNA 2WVDA 4ECXA 3M8ZA 1WC6A 2P6TA 2HNZB 5F3TA 1X9SA 1NO8A 3GJTB 4TXSA 2CQIA 4HT5A 4KO0A 1T94A 2MXYA 5A76A 2RKIA 2BQ3A 3M30A 3VGVA 3BGRB 3CD0A 3IS9A 5HP1A 4LSLA 2G2YA 4KHPF 2CQ3A 4BCAA 3OQ2A 1WACA 5L1LA 4K0KJ 5M2RA 2F4VJ 2M8DB 1KFSA 5AE1A 5DG7A 1X4DA 3OUYA 3J7YU 2CPJA 2E5JA 2IMWP 3T6JA 4LF7J 4QQBA 3HKZD 1FRHA 2ZVSA 4LFBJ 5M2UA 5J1PA 2UVUA 2DGXA 3FZBA 2LXFA 4FVCA 1XNQJ 2VG5B 1U02A 1W2IA 4NXMJ 2YKNA 1X4GA 4X4QA 2CPXA 4G3IA 3AOAA 2BRLA 1S9EB 4RBTA 1T95A 2R7RA 3A3PB 1E6VB 1LW0B 3TAPA 1AROP 4AT1B 1HI1A 4DV1J 2DGOA 3Q89A 3EICA 2XI3A 5F0UA 3R8YA 2BANB 4HH1A 2HPUA 2MQMA 2OSRA 5IM0B 4J91A 1HR0J 2F65A 2OD4A 5J2NA 1BWVA 4KO0B 4USJC 4J9QA 5DM6Q 3N6NA 3I31A 1MLAA 3MDFA 4RR5A 1U47A 2GFFA 5L39A 3IBCB 1Y10A 5HP1B 4C98A 1JWWA 1DBDA 3G4SS 1CS4A 2F9JA 2XLJA 3M6VA 3MMBA 2ZHOA 2HHTA 2FZCB 3TVZA 2P2CB 3G8TA 1S57A 3O5TB 3E8OA 1FXDA 4NASA 1RT1A 1TL5A 2B9XA 2FPHX 5J2QA 1S97A 3OUYB 3QRPA 3MD1A 4DV4J 1NPPA 5DDQC 1ZS6A 2YKOA 3M32A 4DF8A 2CNNB 3DM2B 1MN9A 2CA9A 4NX9A 2YKNB 2HKEA 2ASJA 3QGGA 4H4OA 1KSPA 4O0NA 1VLOA 1VS3A 1M5PC 1W2BR 2CRLA 1N6QA 1R43A 4KFBA 2NQPA 3RJMB 5KFZA 2LCWA 4ECQA 1KR4A 2IC3A 4ED1A 4ECTA 3NCQA 4TVAB 1WELA 2N4CA 2WONB 5F9NA 4R25A 3JQMA 2HG4A 1BE4A 2Z4PA 1YJUA 2C28A 4LF6J 1VC5A 2HVEA 4X64J 1URRA 4DQSA 1DY3A 2RQMA 2AYMA 3V4IB 1KQGB 5F8MA 2PMHA 2C2DA 1JNRB 2B9WA 3BREA 1IM4A 4Y3CA 1CS4B 1NSPA 2RB7A 1H7XA 1U1KA 1K1SA 3ISZA 1WC1A 1WC5A 4EUVA 3BYPA 1S4FA 1VBKA 3M2VA 3JSBA 1FHTA 4DJBA 3K5OA 4EO8A 4R0EA 3JSMA 3BKUA 5GADU 3FEZA 1ZA2B 3M32B 2HFSA 3V5RA 3WDOA 2P8IA 3NNHA 1N34J 2JFKA 2V94A 5THWA 5IV4A 4NYPA 1P27B 3H2LA 3R97A 1K8AT 2VPWB 3IXQA 2A18A 4JOUA 5JXSA 2F3JA 3IAM9 5GVQA 4PQUB 5D4PA 2POKA 3KLFA 4Q2MA 4OI4A 2OPPA 1CJKA 2YQ1A 1S72S 1WHWA 1V9OA 4ANDA 2J9DE 5J1EB 1Y11A 3U1NA 2I6WA 3N9UC 2VG6A 2JDJA 1TVRB 2UVWA 4DU7A 3DOLB 5GAGU 5KFWA 2BZ2A 4R0JA 3RYLA 4ZCIA 3GFYA 4OV6A 4RUBA 3EWGA 5CD4H 4GKKF 3IM8A 2YNGB 1X0FA 2Z2MA 3A3NB 3ET6A 3HF5A 1GNKA 2RS8A 3G8SA 2XB2D 1MWQA 4RW9B 4J9RA 3SSSA 1HI0P 2MY7A 2XHCA 1DLOB 1FA0A 2QE5A 3OT9A 4X4TA 2CG8A 2ZZMA 2HZCA 1CC7A 5F8JA 1F3VA 4CH1A 1Z1ZA 4GC6A 1LXJA 3TAMA 4PUOB 2NXCA 3JXOA 1WC0A 3ZNJ1 1FCAA 4RPFA 4MKYA 3OTCA 3GMGA 3JQKA 2NXNA 1WOOA 1GMWD 3D1QA 1EKSA 1D8ZA 4MIAA 4X84A 1F5AA 3W8GA 1KHWA 1ZAXA 2V0NA 3D1HA 4JI1J 4MAKA 2VB6A 1RTIB 3TUZC 4NZ7A 1XERA 2V4QA 2JLEA 3W9HA 3D4JA 2VHGA 5HMWA 3RRHA 1Z2ZA 1NUEA 3IGVA 2ZJPQ 1SH3A 4MH8A 2Y1JA 4CLLA 3WX4A 4U7UK 1GMUA 2KM8C 2BYCA 3M4XA 2LU1A 4M63A 2AJ4A 4WFBQ 4EGLA 2ZOGA 3UFCX 4AQYJ 1UVJA 3QIPA 3N01A 3PYGA 4ZVOB 3S6EA 1N48A 2VV5A 1U25A 3C6UA 4EZ9A 3DRPA 3LO3A 4ED7A 2O3DA 1HNZF 3TA1A 3JYTA 4L75A 1NK9A 2R7WA 1RHKB 1YJWS 2OIHA 4PPDA 1SC1B 1RU1A 1LQ9A 4NZ6A 2R3VA 2CNLB 3EVOA 4DPOA 5K9FA 1UVNA 1P9QC 3C15B 3G6ES 4JV1A 3U02A 3PJ9A 2PI4A 3ENQA 3CDBA 4JI7J 4JV5J 4CO2A 1AW0A 2A10A 1VI7A 3DRSA 1FDBA 4CI0B 5K8OA 3MM8B 2GIQA 3AJ1A 3HZGA 3BV8A 5G0RA 4X4VA 2O1PA 1NH8A 2FYXA 4OI3A 1MW7A 2YWHA 1MG7A 4PWDB 4NLXA 3CJKB 2G13A 1Q79A 4DCJB 4ALZA 3QATA 3TI0A 5BYQA 3PDNA 2G9OA 2JH3A 4ZVRB 3CMQA 3HHNB 1TR0A 2KRBA 4NCGA 1R0CB 2HQDA 2O66A 3C6UB 3AH6A 3W9IA 1P6TA 2K3IA 2YWGA 4ES2A 2CPHA 1S1TA 3JYTB 1SXLA 4TLRA 3HHLB 1UPPA 4PCQA 4WTOB 1T9VA 5EGYA 1DTQA 1RJJA 2VQFF 4LT6A 1RWVB 3W62A 3NGRA 5IZHA 2CJQA 4C8OA 4LSZB 3GJQB 4LF5F 1VBYA 2QLBB 5EX0A 2MZJA 4XIUA 4LVOP 1KP6A 4B9MA 5E2QA 2UXDJ 2NCKL 4YB5A 4NI2B 1YDLA 2ABYA 4DV2J 4J9OA 3TA2A 2KFZA 1B4SA 2B9EA 2NPFA 1SL1A 3I9ZA 3MTKA 4QYRA 3AFGA 2IYGA 1TU0B 4DX8H 3ISND 4IUFA 5KT2A 4HH0A 3KK2B 5E3PA 2UUAF 4A8KA 1EETA 1V3ZA 1P8GA 4EFAC 2EKYA 1G6BA 4P10A 4IOCQ 3AJ2A 1HNWJ 3PJWA 2DNKA 3FDSA 5AE3A 2E5IA 1AYEA 3D6HB 4OZ5A 3OJUA 3DLKA 1ZM2A 1KRPA 4E8UA 2HK2A 4F4ZA 2HHVA 5G4DA 2NREA 3GYGA 5C42B 1PCAA 4IOBA 4A8FA 3CJ0A 2VODA 4YDDB 5HVFA 5L1JA 4KJIA 3KLHA 4ZMMA 2BJ1A 1CVJA 4QWBA 2CQGA 3A8JA 2EPIA 1LWFB 2GC8A 4KGVB 4MMOA 1O5JA 4RL1A 1YLXA 1F0XA 5HN0A 3K8WA 3BO3A 3T1AA 4DR3F 2NUUG 3NXZA 2MZSA 4DPUA 5KFHA 3K5PA 1NNDA 5E33A 2ZNYA 2XMVA 3BSOA 2XSFA 3UVJB 1KONA 4AD6A 5HROA 3QZ8A 3KKFA 2OTLS 4B3MJ 2QV6A 1TP7A 2HHHF 1LV5A 1T05A 4X66F 4CLYA 2MQOA 4JI4J 1C0TB 1QSSA 1QSLA 1XMQF 4USWA 2J6SA 2ROEA 4U8VA 5A8KA 2MKSA 4DR1F 3R6GB 4UT4A 1SJFA 1F9EB 4CM2A 2ZZNA 1RT7A 3K57A 4ZCKA 3I0RB 3RGIA 3T5JA 1D0EA 3DFEA 2BJ3A 4ZP7A 3QT7A 3VAGA 2W01A 5BXIA 1UP1A 2Q66A 5I4MA 2VFUA 2GMLA 2N7CA 1NBEB 1OMSA 2UXCJ 1CQMA 1C1BB 3D6TB 2NYIA 2WSCC 3PYDA 4OI0A 2RUGA 6AT1B 4EYHB 1LW2B 4LF1A 1NSQA 2I8EA 1ZZFA 2F8MA 5E3QA 3Q86A 1JLCA 1N33F 4TYAA 4NEZA 3OPKA 3KLGA 5DDOC 4URSA 4KGXB 2CQ0A 4LQ9A 3KMQA 4IRCA 3BB5A 3N6MA 5ITHA 3GJRB 1WC4A 4ZVQB 3M2RA 2I9SA 5AXNA 3P5TL 2CDRB 4KV8A 5BR8F 1MNEA 2AJQA 4N56A 3IO1A 3OVBA 2QLWA 4YB6A 4JI0F 1HNIA 4L72B 3CDEA 4HI2A 5IWAJ 3IGNA 1FERA 3HI9A 3EYZA 5J2PB 4MK9A 3W8PA 3GV7B 3KG4A 1TL3A 1M5HA 5D4LA 3DYAA 1S6QB 6FDRA 1WUUA 1Q4RA 3ZTSA 2JRSA 1TKZA 2UXBF 3H40A 2KVIA 3CE8A 5IFMA 1GX6A 3KJVB 4B9VA 4P2MA 1RBLA 1R7IA 2WCXA 5HJYA 2DH9A 3F56A 2HGMA 1WC3A 4JYAF 3QWUA 1HWLA 4Y65A 2K7JA 2IM1A 4DDFA 2AEJA 4F0KA 3CC4S 3Q24A 3GU0A 3DKDA 4Q2LA 4DL3A 3KLGB 3MURP 5GAEI 2DXEA 5KG1A 5B0FA 3JB9k 3OVAA 3HHLD 2FLOA 3OTOF 1NB2A 3SCLE 1RT4A 2DY9A 1JIHA 3M9MB 4W4MA 4EI2A 2BXJA 3R5BA 3B4DA 3MCSA 1WOPA 3CNQP 4C9DA 3G6YA 2HRYA 3CO9A 3MR7A 3CCVS 3BSNA 3KDOA 2MQNA 3IA0A 2JVOA 2HFNA 2KHCA 4NE9C 2ZH5A 1TL3B 4DR4F 1FJGJ 1XBWA 3HD2A 2FJEB 4U9RA 1DRZA 2ROPA 1CULA 3D7SB 4A8SA 4HHHA 3RZAA 3MHYA 1V3SA 2VICA 2HS3A 2V2QA 4DL4A 3NBPB 4YDXA 5KT6A 2AYGA 2M8HA 2MSSA 2VFVA 3FFIB 1FJ7A 1JJCB 3H2UB 4WF9Q 3O8WA 2JWNA 2J9CA 4WZMA 4K5RA 4HDHA 3NAHA 1RYSA 3AB4B 2NXEA 1UCNA 4ZKAA 1JX4A 1C1CB 1TUVA 4P74A 2L3MA 4ZVTB 2CG4A 1FESA 3NNAA 1LWCA 2C2RA 4N7TA 1SCJB 2YNIB 2XMKA 1RT4B 2XMJA 4B3OA 2RVJA 2MKIA 4YR2A 3DLEA 4ZPAA 4K4ZA 3VQTA 3QZ7A 2AQ4A 1VHFA 4ZVHA 1QY7A 3PCOB 2CDQA 1BD6A 2B6AA 1NKCA 3OTBA 1HQUB 4PPZA 3DLGB 1YHQS 1NHVA 3FK4A 5BJRA 3MGJA 2KVQE 5HK4A 2JNJA 3MEEB 2OFGX 1UMJA 4KHPJ 4K2XA 4I67A 2RRNA 3DOKA 4ES3A 2BEFA 2EC2A 2UUBJ 3A12A 3DOMA 2G2OA 2YKQA 5U47A 2VC1A 2RHQB 2R7XA 5HANA 4RUAA 4W92B 4ZVSB 1DTTB 5CQGA 4KB7A 1TMMA 5KFDA 3K59A 5KFGA 1SUQA 4FF3A 4GVBB 2CJAA 5KFYA 2ZKTA 1W25A 4I2QA 1U1OA 4ED2A 5EN1A 4P71A 4IO1A 3MEDA 4RU2A
chains in the Genus database with same CATH topology
2WBRA 1KTVA 5CA5A 2JLGA 3V6HA 5K5MA 3HHKA 2DGVA 4NCGB 1BGXT 1JLGA 2Q1LA 3QLHA 4C8MA 4O3OA 2F1FA 3O2IA 3VQSA 1HBNB 4YUDA 5AE2A 5JJBA 4PG6A 2CQCA 3K58A 4UY85 5LT5A 2L41A 4NCAA 1FE4A 2PN6A 4QR2A 3HX9A 5C24B 2XGQA 4WFYA 2GHPA 3MAHA 5KFIA 4YEAA 3CXCR 3U27A 1JLEB 2HVHA 1S1TB 5LXRA 3WC2A 4B3MF 1K1QA 1ROFA 1RT2A 1UWBA 4QWCA 4LF4F 2LECA 3GIMA 4JI4F 1GAOA 4QPXA 1REVA 2DTJA 1IJFB 4NA2A 4YHHF 1RTHA 3P6YC 1J5OA 1JKHA 1WEXA 1DTQB 1X9WA 4QCLA 1M5OC 4RBVA 4J9PA 5K14B 4PQUA 3T9ZA 4MJKA 1HMVA 4RW7A 4NLWA 2W7PA 3C6TB 1FK9B 1UKUA 3PZPA 4PWUA 2ZHAA 2BDPA 4FF2A 1N5SA 1TZ0A 4MYUA 1TK0A 1OO0B 1V3RA 5KFFA 2J7KA 2GW8A 3LP0B 1S9GB 2WHOA 2KZZA 4TKTA 7FD1A 3DU6A 3H5SA 5J1EA 4HYKA 2MKCA 4P2SA 2CPFA 3ISNC 1IKVA 2LEPA 2D7SA 4Q0BA 4PG4A 3I0SA 3I6PA 3OFGA 3DI6A 2KN4A 1NZAA 2LMIA 2EFQA 4ECVA 4OI2A 2YNHB 1TVRA 1HW8A 4F4XA 3NP5A 3Q8RB 1NKEA 5D4OA 1SKRA 3QGPA 3MF5A 1HNVA 2FVPA 3Q8SB 3DOLA 2KG0A 2P5VA 2DIUA 3S7RA 2JEJA 3CJ3A 2B4UA 2EWHA 1HPZA 4G1QA 4NXNF 4OIXA 1MMDA 4OZNA 3MFIA 1Y5LB 1CC8A 2HHPA 2YNFA 3VR1A 4I56A 2Q6CA 1QUPA 1R8BA 4JI8F 4OMFG 2A2CA 3M9NB 4XPEA 5KFCA 4DBQA 2XSJA 3EPIA 1VQOS 3PO4A 5GAGI 4J9MA 2FUG9 4RNHA 1VQSA 2B43A 5KT5A 1UJ4A 5LXYA 3ITHA 1HNXF 2JEGA 1U45A 2YNGA 1WTBA 2UXCF 3V6KA 1IJEB 3L95X 3QMQA 1SUQB 1Y5NB 1JMTA 2R7QA 3W2WB 4CTAB 3M8QB 3PXGa 3GILA 2CJBA 2ZH6A 3LF0A 5EWEA 3J7ZT 2FJBB 3I4PA 2ZH7A 4OZ1A 1KC8T 2N7YA 2FY1A 2J7WA 4I2QB 1RTDB 1RT3A 1FRKA 3RAXA 3DHWC 1EETB 3D54A 3SXLA 4W90B 1Y9OA 2X1BA 3CIMA 1IKXB 2XWYA 2W9CA 3PO5A 3CJ5A 1NU4A 3JTNA 5IS2A 2OPRA 3IRWP 1RI7A 4RW9A 4CT8A 2GNKA 2BJDA 3LWLA 1HBUB 3I56S 1S6PB 3MPYA 1U49A 2BUNA 1Z2LA 1DLOA 4BS2A 1NJXA 4LF9F 5HLFB 1WHVA 2HGLA 1ZPVA 5KT4A 1XWLA 1XR7A 2PD1A 1U6ZA 5B0CA 2VONA 1KEKA 2QYCA 1OPIA 1PGZA 3HHDA 3MAQA 3BQ2A 2AF6A 2XULA 1GTEA 5I3UB 3OSNA 3DLKB 2NR0A 4AE5A 1RT6A 1T03A 3TW0A 5GAHU 4X4SA 3CF5Q 2KXHA 1RT2B 4PUOA 2R8HA 2QA2A 3TVKA 2J5AA 2W24A 1JLAA 3OFFA 4C0BA 5KG0A 4X4PA 4K4TA 4QBUA 2EG2A 1J5OB 3KYLA 3JSRA 1HI8A 3H5XA 4K4UA 3JAMY 3FRYA 1ZOTA 2ZH1A 3NG8A 3KLEB 4RW7B 4OHVA 1TL1A 3KLHB 1L3TA 1Q8LA 1MWZA 1AXQA 3M1VB 2XWXA 2C22A 2PFFB 4BC9A 4CH0S 3IN5A 2DITA 1IQTA 1WEYA 2LU2A 4P6QA 4ZPCA 3ZC4A 3T1YF 1AFJA 4WK3A 4LF8F 3OR1A 4K4VA 5B0DA 2PIIA 3FMWA 2MHEA 2N4DA 2CQDA 3DGPA 1P1LA 2N3OA 2LVWA 3R1LA 3QGHA 4WU2A 2DGWA 3NAIA 5E3RA 4O4RA 4EBEA 2ZDPA 2DHAA 2LQJA 1RTIA 1YBAA 4ZA1A 2FGCA 3RB6A 3J81Y 2FVSA 1IQZA 4FVMA 4CIOA 4H4KA 4WU3A 4F3MA 2FLNA 2IRXA 3AQOA 1HPZB 4ZOSA 3RB0A 2JSXA 4JV0A 4G1QB 3UD3P 2OPQB 3A1YG 2ERRA 3CCZA 3IAS9 4FNIA 2B7BB 3TOQA 1QM9A 1KN6A 1GTHA 3DMJB 3GWCA 4RW4B 4OI1A 1IKYB 2M5YA 3KLIA 3VAMA 3W2VB 1Y4ZB 1ZM9A 2BV3A 1FKOB 1MMNA 4PR6A 3L09A 4AXJA 4MFBA 3PR5B 3FSIA 3KLVA 3MMAA 2RQ4A 1S1XA 5KFSA 3HLUA 4KR0B 4WJBA 4WYLA 2XHWA 3IBWA 3MR2A 2DR8A 5HROB 3ZFVA 1PC4A 2XY6A 5I42B 4DSIA 4IG3A 4H4KC 3GV5B 3MM6B 1KNZA 1VIXA 2QA1A 3HVTA 4A8XA 3ICLA 2ZNZA 1M90T 3QO9A 2OPRB 1Q86T 1IKWA 4ECYA 1T05B 4Q45A 2N82B 2HNYB 4ILMA 4ETXA 4LVNP 2DGQA 3M8RA 2HHXA 3F41A 4WXOA 1M1KT 4ELTA 3M8SA 5F8HA 2ZD1B 3QJPA 1G7CB 2MKHA 3SI8A 3LAMA 4DN0A 2LEBA 2XCAA 2CPYA 2XGPA 2L9WA 4FXVA 1FD2A 4IH7A 4NLOA 5A8KB 3PVXA 2IA6A 3CPWR 4CNZA 3IG1A 2KZMA 3GR0A 1ZM3A 4RZRA 4K5SA 3UWTA 1UA0A 2COLA 3RW6A 2GCFA 2MQQA 2W4DA 2J7UA 3C46A 2MY8A 4Q8FA 1QAIA 2HHUA 1VQPS 4OZ0A 3D0GE 1T03B 2BACA 3H5UA 5F0WA 5KOWA 3B8HA 4FF1A 4PG7A 1U1LA 4N77A 2QMXA 4F4WA 1S99A 2M3DA 4F3OA 1RT7B 2B4VA 5A8RA 1HWUA 4WE1B 4IKAA 1U6BA 3CD5A 3C66A 3EZ5A 3VAFA 3PY8A 4IQXA 3AY0A 2KB2A 4QIEA 2X3GA 2GMJA 1URNA 2XZWA 5HQ8A 2E9RX 3D0HE 1DJ0A 2BABA 3OBIA 5KFPA 4JI5F 1FKAF 4Y28C 1HHSA 1TL1B 4DHVA 3OV7A 3I4HX 1TK8A 3KHHA 1D1UA 3MEGA 2CPEA 4ID5A 1VRUA 4QR0A 3CCES 2GQQA 4ZHRA 4KQZA 5KFXA 4MYTA 2Y1IA 2FD2A 1KS2A 3I87A 3MMCA 1U1NA 1FJGF 3DRRA 3JSYA 3OR1B 1R3NA 2ACYA 4NLVA 2IYIA 4ZPVR 4BWJA 4F4KA 4NLTA 4E98A 4UUXA 3MR5A 4ZDNA 2VL1A 1VQ6S 2IA0A 2V8HA 2ZHBA 5DQHA 5H9FJ 2ILZA 4NZ0A 3PM9A 3MM8A 2ZFHA 3OR2B 1WI8A 2RSQA 4RNNA 5SZTA 5D77A 2B3TB 3MM5B 1S0VA 2PT0A 1NRKA 3ZZPA 1Q1KA 4C3LA 4RNFA 1S1UB 2GIRA 4B08A 3TR5A 1JLCB 2MZTA 2FDNA 2V9KA 4MIBA 4F67A 2DCUB 2LXUA 3OL9A 5D3GB 4PWDA 2IJFA 3CJKA 1FDAA 1S1VA 1TV6B 1WD6A 1VOMA 1FNXH 3MD3A 5LSRA 3DRYA 2DGTA 2GGPB 4OHWA 4QZVB 1RP5A 3CCMS 3H59A 5F8NA 1JNZB 4GC7A 3J7YI 3PW5A 4I0WA 4R8UA 5L9XA 2KG1A 3CDAA 4TN2A 4MFBB 4FYDA 3MM9B 3TX8A 2QA4G 3ZZOA 5B08A 4GO5X 3T5LA 1U1RA 3PW0A 3M2RB 4Y2CA 3POTA 3NGDA 4NLSA 4QIVA 3ZZZA 2UVVA 1RKIA 1YWXA 4KV8B 4F3QA 1F5BA 1ZPWX 3ULHA 4C97A 2W8KA 2F4VF 4NLGA 3HVTB 2DR7A 1UL3A 1UA1A 2DNMA 3KK3B 3HPOA 1H3DA 2MKJA 5CYQA 3ZZRA 2P6SA 1FNMA 4X4RA 4C4WA 1VRTA 4RW6B 2WSEC 4TLQA 4LF7F 2DPJA 1HWKA 1HNIB 1TKTB 4RW8A 3GIJA 2OH2A 4IH6A 1JJHA 5D