3VAHA

Structure of u2af65 variant with bru3c4 dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
174
structure length
174
Chain Sequence
b'GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Splicing factor U2AF 65 kDa subunit
publication title U2AF65 adapts to diverse pre-mRNA splice sites through conformational selection of specific and promiscuous RNA recognition motifs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/dna
total genus 40
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vahA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vahA02
2U2FA 1M90T 4ERDA 2AYEA 2KM8C 1X4EA 2CPJA 2KRBA 1JJ4A 2DH7A 3ZZZA 2DGQA 2KRRA 2GHPA 1KOHA 2LA4A 2LCWA 2DGTA 1VQ4S 2CQGA 2ADBA 2YTCA 3JB9k 3UCZP 1WELA 2CQ4A 2CQHA 3LPYA 1ZH5A 5DM6Q 2YWKA 2M4MA 2DK2A 1ZZFA 3Q2TC 2MKJA 4CH1A 2DNRA 2U1AA 1X5PA 2RRAA 2CQ1A 3CCES 3THPA 1VBZA 5GAHU 2UP1A 3G8TA 4QU7A 2KFYA 3CC7S 1FJ7A 1WG5A 2KU7A 1YJ9S 2XB2D 2DNGA 2DGSA 3IWNC 2CQIA 1VQ5S 2MKIA 3BEGB 2FC9A 3VALA 5GADU 2CQ2A 2OSRA 5CYJA 5IM0B 2CQ3A 2I38A 2I2YA 2KXFA 4W92B 1HD0A 1KC8T 3FEYB 2LKZA 2MKSA 4CIOA 3G96A 2OTJS 1KQSR 2RU3A 5IQQA 1YJNS 2PEHA 2GO9A 1H2TZ 2M2BA 4Y00A 2G1DA 1KOOA 1K9MT 1HD1A 2DNOA 4ZKAA 1U1QA 2DNZA 2DGXA 3IRWP 5JVGQ 2MZJA 5LJ5Y 3D2WA 1X0FA 2MB0B 3H2VE 1RK8A 2MZ1A 3BO2A 5CA5A 4Y0FA 3MUTP 1X4CA 1UAWA 4LJMA 1VBYA 2E5JA 2CPIA 4A8XA 1WHVA 3CUNA 1ZZNA 2OTLS 3N9UC 2NZ4A 1H6KX 4CH0S 1QM9A 1WHXA 2CPEA 1VQKS 3OW2R 1M5PC 2MZRA 2AYBA 3S6EA 3ZZYA 4PR6A 4U67Q 2CQCA 1X4FA 2DIUA 3MI7X 3V4MA 4WFNQ 2DITA 1OIAA 3FEXB 1WG4A 2B0GA 2MZTA 1U2FA 2OIHA 2N7CA 5GMKa 2CPZA 1XN9A 2KI2A 2XSFA 3CC2S 2MQPA 2X1AA 2KXHA 4TU7A 2PE8A 1FO1A 5DDQC 1M5OC 2E5IA 3VAIA 3NNAA 1IQTA 2OSQA 3MD3A 1VC5A 4EGLA 2LQ5A 4IOAQ 1WI8A 4WFAQ 2CPFA 2LEBA 5ITHA 1K8AT 1D9AA 3L3CA 2EK6A 1VQ6S 3ULHA 3CCUS 2E5HA 3BS9A 3CCLS 1K73T 3THTA 2MQMA 2KXNB 3RW7A 2X1GA 5JVHQ 2M8HA 2XS2A 3NMRA 1SJ4P 1WG1A 5IFMA 2XS7A 1UP1A 2A3JA 2XNQA 2KHCA 2LXUA 2MKCA 1WTBA 4QQBA 3H2UB 4OZ1A 2HYIB 2F9DA 2RT3A 1H2UX 2FY1A 3CCSS 2DNKA 2HGNA 1X4BA 2RS8A 2N3OA 1VQ9S 1YTYA 1PGZA 1SJQA 2X1FA 1KD1T 3J7ZT 2O3DA 2RNEA 5LSLA 2KG0A 2DH9A 1U1RA 4FXVA 4C0OC 3UD4P 2HGMA 3CTRA 3TYTA 2E44A 2F3JA 1VQOS 4J5OA 4V19X 2WBRA 3J7YU 3NS6A 3S7RA 2SXLA 3TO8A 3MOJB 3R27A 2D9PA 1JMTA 2KT5A 2JWNA 4TLQA 2MQQA 3CCMS 2DGWA 1DHMA 3UWTA 1Q81T 2V94A 2CPHA 4IO9Q 3MUVP 1U1MA 2J0SD 2MY8A 2NLWA 3TP2A 2DNNA 1OO0B 1N52B 1WHYA 2K3KA 3VAFA 2LMIA 2QFJA 2LECA 3B4DA 2HVZA 4YB1P 1O0PA 1U1OA 3HHNB 4LMZA 3I55S 3G71S 1NU4A 3PIPQ 2DHSA 3CCJS 1Q7YT 1X4DA 4C4WA 4ED5A 5IM0A 2ZJPQ 3Q2SC 5DETA 1YJWS 3VAMA 1B7FA 4YUDA 2DISA 3CF5Q 3S8SA 2M7SA 2YKAA 4M5DB 2RS2A 3VAKA 2MJNA 1UFWA 1WF0A 1WHWA 1U6BA 1VQ8S 2G4BA 1A7GE 1YWXA 3EGZA 3K0JA 3G8SA 1PO6A 3CMAS 1N54B 3HI9A 2CQPA 3G6ES 1QVFR 4WIIA 4WF9Q 1URNA 2DGOA 4PKDB 1U1NA 4UY8T 1R8PA 1M5VC 3SDEB 3P6YC 2KM8B 2X1BA 2OJ3A 1U1LA 4FXWA 1N88A 5GVQA 5LXYA 3CMES 3SMZA 1M1KT 1JJ2R 2L9WA 2DB1A 1L3KA 2YH1A 2HGLA 4PRFA 2EVZA 2M52A 1FHTA 4QPTA 2KG1A 3DXBA 2G0CA 3I56S 3UD3P 2M8DB 3EX7B 2KH9A 1FJCA 1F9FA 4TU8A 4F26A 5HL7Q 3MDFA 2MQNA 5DDPC 2L41A 3CD6S 2AYMA 2XS5A 3RW6A 2DNLA 5H1SV 2VOPA 3SXLA 2J76E 1W2BR 1Q86T 1X4AA 4CQ1A 4RU2A 2MY7A 1M5KC 3P5TL 2Q79A 2KYXA 1U6FA 2YH0A 2FPHX 1N8RT 2BZ2A 1FXLA 2DGUA 1BY9A 3MURP 3CCQS 3UCUP 2J8AA 2RUGA 2DNMA 2CPXA 2KN4A 3VAJA 2LA6A 3BO4A 3CPWR 1CVJA 5LXRA 4P6QA 1VQPS 2JRSA 4WCEQ 1X4GA 4IOCQ 3G9CA 1FJEB 1WEZA 1VC0A 4F02A 2VONA 1R8HA 5BJRA 1VBXA 4QU6A 2CJKA 3PIOQ 2MYFA 2MQOA 5DDRC 2QA4S 1WF2A 1D8ZA 2ZJRQ 1VQNS 1RKJA 4UQTA 2DNQA 1NJIT 1WEXA 2DNYA 5DM7Q 1VQLS 3P3DA 1U1KA 4IUFA 2JVOA 2MHNA 3MUMP 2FC8A 4WFBQ 2JX2A 2MJUA 1YIJS 2MPUA 1X5OA 3LQVA 2MSSA 2AYGA 3UE2A 2VOOA 2MXYA 2DHGA 1Q82T 3NNCA 4BS2A 2DHAA 3VF0B 1P1TA 2M9KA 1YHQS 1VC6A 5GAEU 1WEYA 2VODA 5FJ4A 3CULA 2MZSA 2BOPA 2MKKA 1X5SA 1DZ5A 3CCVS 1SJ3P 3DLLQ 2CQDA 1JJHA 1WI6A 3B4MA 5HO4A 2RVJA 2RQCA 1WWHA 4YOEA 1NO8A 3U1LA 1WF1A 2FHOB 2M70A 2RQ4A 3BO3A 2N82B 3R1HA 1SJFA 2DNPA 1FNXH 1UW4A 3US5A 3MXHP 1OPIA 2HZCA 1SJRA 1HA1A 3P49B 2DHXA 1A9NB 5CXTA 1X5TA 1QVGR 4LIRA 1U1PA 2LXIA 2XNRA 2ADCA 2N3LA 1YITS 2MGZB 2EK1A 2K8GA 2ZJQQ 3CCRS 2DNHA 2AD9A 5D77A 3VAGA 2MGZA 2D3OR 5EN1A 1OWXA 2DGVA 3MD1A 3NS5A 5D78A 1YI2S 2M88A 1P27B 1VQMS 3SDEA 1VQ7S 1SXLA 3R1LA 4TU9A 2LYVA 3EGNA 4WKRA 2M0GB 3UCGA 2ERRA 2MKHA 5DDOC 2JVRA 2MSTA 2CQBA 4W90B 4Z2XA 2DO0A 4F25A 1DRZA 3S01A 3G4SS 2J0QD 1G2EA 2CPDA 2MMYA 2LEAA 1S72S 2DIVA 2CPYA 2D9OA 2MZQA 2MQLA 2RRBA 1H2VZ 5MLCV 3CXCR 1FT8A 2DH8A 2L08A 3NNHA 1S79A 1DBDA 3CC4S 1AUDA 1X4HA 2QEXS 2E5GA 2CQ0A 3U1MA 5LJ3Y 4OZ0A 2KVIA 2F9JA 3VAHA 1HL6A 2DO4A 5LSOA 4C7QA 5GAGU
chains in the Genus database with same CATH superfamily
2B3TB 2AYEA 4CLPA 2QA2A 1WC3A 1AZSA 2AEMA 1F9EB 2KRRA 4L76A 4I0WA 4J9NA 3V5RA 2UVVA 4I1TA 5KOWA 4KPYA 2JEJA 2PN6A 3HMJG 4CO3A 1SC3B 2KFYA 4OZ5A 4W98A 4JI5J 4NA2A 2I2YA 1RT2A 1NK0A 3DYAA 3CNQP 1TFYA 2A2CA 1FXRA 5B0AA 5J2PB 5IQQA 1K44A 4J9SA 4RW6A 3OQ2A 2V8PA 3FCHA 2MLZA 3MOZA 2DGXA 4PYAA 3A3OB 3H2VE 2XMUA 1ZM9A 4UUXA 1HARA 4ZPDA 1VQKS 1M5PC 2HFZA 2AX0A 5HK4A 2V63A 1Y5LB 4NXNF 1U09A 1OQ3A 1IKWB 4DR3F 1WG4A 4NRTA 1NRKA 1XN9A 4USUA 4ZDNA 3VZHA 1ZTWA 4DDFA 5B0CA 5ITHA 5L1LA 2ZBRA 3FSIA 2DR6A 1YRXA 5B08A 3RW7A 2PD1A 3TAQA 3KLFB 2WTFA 1DQAA 1XMOJ 1RXOB 1G4CA 3MMCA 2Y9HA 2MHEA 2XGPA 1BQMB 4AL5A 1FA0A 1HQUB 3LP0B 2JLFA 3PNIA 4ZVPB 4IQMA 4UY85 3GCXP 5AE3A 2J7UA 3H7HB 1HNZJ 1EAYC 2E44A 4BCAA 1KQKA 4DI6A 3CJ3A 4I7FA 2CJBA 2XMAA 5FLXY 1M5HA 5HANA 2RDJA 1B70B 1OO0B 1S6OA 3ZXWA 4BBYA 3MEEA 3HHNB 4RUAA 1LW2A 3LW5C 3S8SA 1XNRF 2RS2A 3VAKA 4URGA 2WOMB 4QYZK 3N01A 2E9ZA 1A7GE 4IG3A 4NLQA 1QVFR 4WF9Q 1UMJA 3HJVA 3LALA 1JLEB 2XI3A 1I5OB 2JFDA 1VDHA 1TKDA 2XMVA 4ELTA 2UXDJ 3VVUA 3DLGB 3QPIA 3R5DA 8ATCB 4QPTA 1HBNA 2BMBA 3TUPA 3BN4A 3SSRA 5J1PA 4QWDA 2CJ9A 4OHYA 5AXLA 2QA4G 4DUTA 2GHWA 2K7JA 5T14A 3P8BB 8RUCA 3MCSA 3HD1A 4OHXA 1HNWF 3PTWA 1KVKA 1PCAA 5KFGA 3AT1B 3TEGA 2LA6A 2NR0A 2JC0A 4WCEQ 1EJ7L 3DMJB 2Y1JA 3C66A 2O67A 1JLQB 2IRXA 3HCXA 2VG6A 1VLOA 4B9MA 3LTOA 4P2MA 1F2GA 2LVWA 4DOZA 4HH0A 4LREA 2RSQA 2QA1A 3RGIA 4DV0F 2IDLA 4ECZA 1SQGA 4X4NA 4K4TA 1GNKA 2XQCA 3LUYA 1NAQA 5DZ7A 2OO4A 3W5XA 4DWIA 2C2EA 2MKKA 1U49A 1FERA 2AU0A 4OFZA 3A3PB 3B4MA 3NOGA 3U27A 1ZAWA 3DC2A 1QSLA 2DCUB 2WONA 1Y7PA 2VPWB 1GQEA 3MTKA 2OPRB 4M5DA 4NLTA 3VGSA 3TI0A 2HQIA 1R89A 2DGVA 4ECYA 4H4KA 2P9CA 4KGMA 3QWUA 1RA7A 3RB4A 3O3LA 4ZLLA 4WKRA 2BJ7A 5D4PA 2ERRA 2IA0A 2V2ZA 4ZPTR 2BBEA 1YJTA 2XWYA 4TVAB 4QCLA 1CEZA 4LUBA 2R2TA 4GVBB 3R5JB 4TYBA 3SEOA 4BC7A 4Y2IA 5MLCV 2ZNYA 2BM1A 2XWXA 3NCQA 2K3IA 3IG1B 4C3KA 1HWKA 2CQ0A 1AUSL 2KVIA 1VRTB 3U7JA 3AJ2A 5LSOA 2EFNA 3PYDA 1ZS6A 1JJ4A 2B4OA 3JS9A 3I5AA 4DV6F 5T7LA 6FD1A 1QDUB 2GHPA 3FJ2A 3G6VA 2LA4A 2DGTA 1UWBB 2CQGA 3HLUA 1FJGF 1JB0C 5DJBA 2CYYA 4YB6A 3IN5A 4FYDA 3QT5A 4L3KA 5KFOA 2RF2B 4B3TF 2DNRA 2U1AA 3GV7B 4P7TA 2PA3A 3PKYA 4DL2A 4ZN1A 2DNGA 3HFKA 4ZK7M 4DV3F 5CYJA 3M8SA 4NASA 2FD2A 2KXFA 4P2SA 1KC8T 3MAAA 3IR5B 2J9CA 3G96A 3M6UA 5HLFB 1VHFA 1JKHB 2C22A 2LDIA 2H3EB 1R6YA 3W3SA 3I96A 1MROA 2ASDA 3A8KA 4YP3A 3D2WA 4O3NA 4DR7F 2V4JA 2VG7B 4R25A 4KGVB 4DQSA 1ZZNA 2OPQA 1PAUB 3ZZYA 4ITSA 5E3PA 4X64F 4LRDA 3KLHA 1FE4A 3EICA 4LF6J 3QGHA 3UNGC 4Y2MA 2X3GA 3VZIA 5J2MA 1IKWA 5KFWA 1VC5A 4GC6A 2CPFA 1LWFA 1KHWA 4X62J 2V8HA 3MR6A 3AOCA 1FWPA 3BM7A 1I1GA 3T1HJ 2EW9A 4OYWA 1L3VA 1NUEA 4DR6J 3DDKA 1EQ0A 1TKXB 3G6XA 2J0WA 2R8KA 4MKAA 5J1NA 4DPTA 3MAHA 1HQUA 3GP9A 4YEAA 3PX6A 1LWEB 2XO7A 3CTRA 1WSVA 3H20A 3MM7B 1UA0A 4V19X 4LR7A 5FDLB 3E2EA 2FLOA 2D9PA 4EUVA 3DDIA 4I2PB 4XDCA 4YMEA 3W8PA 1HI0P 4CTAB 3TP2A 1HNXJ 1NM2A 2OEMA 1UKUA 1TL7A 4LMZA 3W2WB 2XYHB 3W65A 4C4WA 5F8LA 2W1BA 3OXFA 2GW8A 1LWCB 1GH8A 1FXDA 3NCRA 4U8YA 2CFXA 2FIUA 2J9DA 2HFVA 1HPZB 2LDYA 1F2HA 3PVXA 1O8BA 1QAYA 4ED2A 2WOMA 2RH3A 4DSJA 4RNHA 3NL0A 2V9WA 2B7BB 2DB1A 1T9UA 2C3UA 3UD3P 4ZVSB 1L3TA 3MDFA 4CDIA 5GAHI 3OV7A 2QE5A 2RQKA 2MY7A 4DV2J 1FRJA 4FP9A 4LF8J 2YH0A 4X2BA 3IBFB 2ZD1A 4DV1J 1S6QB 4DZ6A 2CPXA 3NGRA 4O3OA 4LF6F 3UQSA 3AODA 2IRYA 1Y0HA 1ZA1B 3G9CA 3GFYA 5KFEA 4QU6A 3DI6B 2BACA 3KHRA 2R2RA 1Z4UA 2F63A 3DMJA 4NLSA 5CAAA 1VQNS 2LQJA 1RBOB 3UDEA 1JLQA 2GAGC 3CDBA 3P3DA 5HJXA 3DGPB 3R97A 3EJMA 1CBKA 1Q82T 4CLTA 4BS2A 3KK2B 4JI0J 2ASJA 1RSCA 4K7QA 4C8LA 3X1LB 1UJ4A 1KKHA 2M70A 3HULA 3DNCA 3QBCA 3AXKA 1WOPA 3M9NB 4K4WA 4Q2MA 2J6SA 4G65A 3I6PA 2WCXA 4K2JA 3ZC4A 2H65B 3UR0A 2OPRA 4Y3CA 4M5KA 4DFKA 3KOAA 1RACB 2O01C 4JYAF 1HQEB 1KRPA 4PAAA 2OH2A 5D4NA 5CYQB 4U8VA 1YZ6A 5LMUF 3QJLA 3D0HE 3UFCX 1QUPA 4RBUA 1H2VZ 1UVJA 3FFIB 2EFPA 2XY6A 4GVBA 1TUGB 2WRMA 2HFNA 3FBBA 4O44B 2HHXA 3IBWA 3M2RB 2LQ8A 3IG1A 1FK9B 3J81Y 3SQGB 3OJSA 3TWZA 2DH7A 3R8YA 1VRTA 4LF8F 4N76A 3UD5A 4LRCA 3C16A 1HQ2A 2YTCA 3EPGA 2GGPB 1U45A 4QR1A 4N5SA 2B9YA 1TL5A 4DR5F 1PYOB 3BKUA 3MR2A 1VBZA 3DOKA 2PIIA 2YKOA 3CC7S 2RF2A 5L38A 2DGSA 2CQIA 4ER8A 1M1GA 3E8OA 1F9HA 2B43A 4W92B 4OZJA 1RTDB 4DFMA 4YR0A 3OTBA 1K1QA 3T5KA 1WOOA 2FJXA 4PXEA 2H54B 2MB0B 1RHQB 5HLFA 2BJ8A 1UAWA 4X4UA 2Z0GA 2FVSA 5HATA 5B0FA 5KFQA 3TAPA 2VG7A 4R8UA 3MI7X 3AOAA 1GMVA 3HSDA 2ZWOA 2L3MA 4WU3A 1EKSA 3FEXB 2FGOA 3OT9A 2VFVA 4UUWA 4NCAA 2MQPA 1D09B 2PE8A 1FO1A 3HM9A 3M9OB 1ITPA 3C8YA 4KHRA 2OMOA 2ZUAA 3KK3B 2VQEF 4JI3F 3W66A 1IBMF 4NE9C 2BW7A 1FDBA 3ZNUA 3J7A1 4ED1A 2CADA 5D0HA 2R7QA 3MR7A 2PT0A 1DFDA 4HHHA 4DS5A 1CPZA 1HHTP 2F9DA 3MCOA 5J2QB 3GYXB 3BBBA 1S1VB 2X1FA 2HHTA 2HQCA 2NPIA 1EIYB 3UN3A 3TO8A 4L74A 4WK1A 1WD6A 3GU0A 4UOFA 2DGWA 1DHMA 4KIAA 3UWTA 1LWEA 1UPPA 3MUVP 1JLAB 2IM3A 3MM7A 2J0SD 5KG5A 4QWCA 1EZZB 5FDLA 4WXWA 3HVAA 3DLHA 1YQHA 3G71S 2E5LJ 3PIPQ 2UZAA 1Q7YT 4I2PA 3Q2SC 4CTAA 1CULB 3QRRA 1DTTB 4MIAA 1UFWA 3W2WA 3M2UB 1OPZA 1VQ8S 3GG0A 4CI0B 4KC5A 1LWCA 3K7RA 3HI9A 4M5MA 4PPZA 1T9WA 3K89A 4NCGB 4DR1F 1HPZA 5KT4A 1SI9A 1VCTA 2HRUA 2OPSA 1S48A 2J7WA 2KTQA 1S5ZA 2DEJA 4QYRA 4F0KA 1BWVA 2LQ9A 3R7NB 1IR0A 3TZYA 2KYXA 4PEOA 1YX2A 5J2NB 3M30A 2HK3A 5F8HA 2D69A 5K8OA 1C0UB 3MURP 3CCQS 5L9NA 3C6TB 3OL8A 1HWUA 2WBMA 1R43A 2ZE2B 1S6QA 4RUBA 3EM1A 3ITHB 5C7PA 1UZDA 4Y65A 4FPIA 3BR8A 2CJKA 1WDTA 4LBHA 2R8IA 5KG3A 5K8NA 4LFAJ 1Y5NB 2W8KA 1S59A 3K17A 2W7AA 2IA6A 1OY8A 2IHR1 4NYPA 1VC6A 4WBFA 3OJUA 2V68A 2XO6A 3DGPA 2VODA 2ZOGA 1LFPA 1EETB 1X5SA 2PGCA 4RNFA 2HG4A 2RQCA 2N82B 5LMNJ 1MN9A 4YY3F 3E01B 1RDRA 4OZ3A 3KLEB 1SB6A 3P49B 2DHXA 1X5TA 2AJQA 4FN5A 1SKSA 3FBEA 1N5QA 5DGBA 3OL9A 2ZHBA 1WC4A 4DL7A 2I8EA 2P5VA 1YI2S 3CT9A 5A8RB 1RP5A 1S0OA 5DDOC 3CJTA 2QTWA 3RRGA 2BXJA 1S0NA 4Z2XA 4F25A 3M1VB 4NZ0A 1HQEA 2MQLA 4USVA 5CYQA 1X4HA 1O5JA 3CW2C 3G82B 5CQGA 2BM0A 3CWJA 4C7QA 1DY3A 3M2RA 2VB6A 1X4EA 3ZZZA 2DR7A 3JXOA 3NS7B 2JJ4D 3SQGA 1B0PA 4WP9A 3MMAB 1XNQJ 5K14B 2RDIA 1RHJB 1VGYA 1X5PA 2HAIA 2GGPA 3PX0A 5F0WA 4QW9A 4C8KA 4O3SA 4KFBB 1XBWA 2KDOA 1VRQC 3BEGB 3KWMA 2R8HA 2CQ2A 3ONQA 2HFSA 3BSCA 2VDIA 5IT4A 1IWGA 4PG6A 3RTVA 2ZHOA 2ZOFA 4NZ6A 4X4QA 4WTYA 5KFSA 4HI1A 4PQUB 2RAQA 4DX5A 5DG9A 2XMTA 3GIJA 2I1RA 3DLKB 1RTDA 2LEPA 4FYYB 1UA1A 4A8XA 4A47A 3CUNA 4N8OA 4OZLA 4USTA 4ED6A 1JWWA 2F8EX 1MN7A 4TY8A 3V4MA 1JLCB 4OX9J 1T9TA 1CJKB 4NLWA 3BSNA 2MZTA 3EDQB 4AL7A 2XSFA 2AHOB 1IVZA 3DOLB 5HQLA 3MD3A 2B9WA 1WI8A 3OSNA 3RG6A 2LEBA 1VQ6S 2RHQB 1YJVA 3D3CJ 1X9MA 1R27B 1EX8A 5M2PA 3FGVA 3KK3A 3DRSA 1UP1A 3CD5A 3V6KA 2Z2ZA 1RE1B 4OZ1A 3I4PA 3ZNJ1 2EG2A 1DTQB 3KNGA 2HGNA 1WC6A 4DU8A 2RNEA 1OY6A 5J2QA 2YNFB 1KR4A 2Z2MA 3QJJA 4J5OA 1Y9OA 1S1VA 1SPBP 1UCNA 4K59A 1AFIA 3I55S 4LF9J 1S10A 4J9LA 1FRIA 1JLAA 3EUNA 4Y28C 2UUAF 5E3RA 1PAEX 3Q8YA 3PRBA 3IFEA 1JXVA 1WHWA 1NJYA 5C2GA 2Q1LA 3G86A 4KHPJ 3EGZA 1CULA 4PABA 4WIIA 1DTTA 4PKDB 4GO5X 2HK2A 2Y1LB 3FMBA 2VQFF 3ILLA 1N34F 4EO8A 4Z7CA 2V34A 4NCGA 3I56S 2UV8A 4IRCA 1F9FA 2HVEA 3TJ9A 1RAFB 4FBTA 2L41A 3TQ1A 4ZPVR 4N8NA 3SXLA 4X65J 1Q86T 2B9EA 3UN2A 3DU6A 2HHSA 1RWKB 3IM8A 4NZ7A 1N8RT 1NJZA 2FJAB 1AXQA 2RUGA 3V6DB 3CPWR 1HR0F 5J2NA 1R7IA 2Y1IA 4ZVUB 2UXCJ 3QZ8A 3EZ5A 2ABYA 2VONA 1FF2A 3C6TA 1V5IB 3N79A 3PIOQ 3MM8B 3LANA 2ZE2A 4MH8A 2W8LA 2VBWA 3ITHA 2ACYA 2DNYA 1VQLS 3RAXA 2FC8A 1HWJA 2VOOA 2MXYA 1VI7A 2C2RA 1S99A 3H8YA 3BBCA 1YHQS 2ZZTA 1NZ8A 1U47A 5L1IA 4NXMF 4TKTA 5D4OA 3L9ZA 2YKNB 4NI2B 4J7CA 4UTGA 2V2KA 5I4MA 4QOTA 1EETA 1R0CB 1HA1A 4LIRA 1Z2LA 3D5MA 4P72A 2N3LA 4AE5A 3GE9A 2FTRA 1HFEL 4QJVA 1Y11A 4FF1A 1DQ8A 3KLEA 4RLEA 2C2DA 4ELVA 1J5EJ 1IBLJ 1RYSA 5D78A 3SCLE 1O51A 3BPSP 2YX4A 3DRYA 3R1LA 5IWAF 4TU9A 2IFXA 3GR1A 3MPDA 3FKBA 1ACMB 2EFGA 2JVRA 2CQBA 4JI4J 2QGFB 3WBZA 4YHHF 2O66A 2OAUA 1F1BB 4H4MB 4EFAC 1D8YA 5KT6A 1S9FA 5C2CA 4LSLB 4J9PA 3U02A 1NSAA 1S4FA 2FUG9 4AQYF 3M1VA 2QEXS 1N33J 1Q4RA 5J1EB 2W9AA 3DKDA 1S57A 3PCOB 4CYUB 1XMQF 1HL6A 4URSA 3A12A 5GAGU 1WC1A 5KG1A 1FFSB 4ERDA 3I9ZA 2J8SA 1KOHA 1TKTA 5KFRA 2VHGA 4NLRA 2HRTA 2DCLA 2NZCA 3OVSA 1IR1A 1VBKA 3PRVA 1UEKA 3KJFB 3MMAA 1FEEA 3Q8PB 5K14A 5C42B 1KLMB 2Y0SD 4ZS6A 4DV7F 4F67A 1S1XB 4P9SA 4KFBA 1YJ7A 2IDEA 1V3ZA 4J37A 1PKUA 4NOHA 2J5AA 2HPUA 1BC6A 3GWCA 5ETTA 2F8HA 4PQUA 3ZZPA 1KQFB 1HW9A 3MPUB 4EMDA 4ZLNA 3T1YJ 4ZP8A 3R5BA 4DPXA 4CLLA 2C3MA 4EEYA 1BQXA 3F0NA 2WW4A 3JSMB 2OIHA 3T19A 3D1QA 1XWLA 1MMLA 2DXEA 4LRAA 1CJKA 4PWDB 2W25A 1U48A 2FJEB 3MCMA 2FHKA 4R5PB 2R7VA 5G4DA 3KXDA 1PIEA 3GIIA 6FDRA 3P45B 3I82A 1PJ7A 4NA3A 2G13A 1CQMA 2FY8A 1FDNA 1RA6A 1ROFA 1RWXB 1BWEA 1FVSA 1UW9A 5M2RA 2UUBF 3D0GE 3AD8C 5F8IA 2V67A 1PGZA 4CLUA 1S7IA 1HNVB 2CNLB 3W60A 3SCKE 1UPMB 1DTQA 3M32B 3EXCX 2ZDOA 3S7RA 4DL0C 3K5OA 2CPHA 4F4WA 4IO9Q 2YNFA 2BJDA 2UVWA 2LECA 4CO0A 4KQZA 1KLNA 3K5NA 4FF4A 4OMFG 2DJWA 4LFBJ 2XM3A 3W5ZA 1I51B 3OTOJ 2R2UA 2B5JB 2MEWA 2VPZB 1U8SA 3NKYA 5LXYA 3CMES 3QWPA 4PUOB 1NPKA 1JJ2R 1D1UA 2KT3A 2NYHA 4IDKB 4RPFA 1FHTA 2KG1A 1JXEA 1SV5B 3GCWP 1ZTTA 5H1SV 2VOPA 4CLSA 2KJVA 1M5KC 1FRKA 1CS4B 4IH5A 1KVIA 3HZGA 1IKYB 5A6PA 3QFWA 3T6BA 1FJEB 3BREA 3V6DA 3DOMB 4O0NA 4Z7YA 5L1JA 3MFIA 4JI8J 2E29A 1FKOB 4EWTA 3R6LB 5ETOA 2LP4A 4KT0C 3MM8A 2XBPA 3ZTQA 1WNEA 1F3VA 2VF3A 1QTMA 3J80U 3ILJA 1KTQA 2AQ4A 4UOGA 1WEYA 1WOSA 2CIMA 1U0HB 5AE1A 3DLLQ 2RMLA 3PG9A 4DF4A 1WUUA 2VH7A 4C0HA 1NO8A 2G9OA 1Q8LA 2CWKA 1OPIA 3H90A 2ZITA 1SJRA 4HDHA 5CXTA 1RUSA 1XR7A 3OR2B 4NI2A 2BOAA 2HS4A 4X66F 1Q95G 2ZJQQ 2WVDA 1FFGB 3WQPA 1TVRB 4NX9A 3THVA 1RAOA 2MTLA 2YWGA 4QR2A 2D7SA 2CJXB 3IBCB 1XTZA 3P5BP 1NK9A 2IC3B 2DY9A 1LEOA 3D4JA 1UJ5A 4WPAA 3IWLA 1T05A 4CLWA 2VL1A 1FTCA 4UZBA 2HHHF 2B51A 3BH6B 2ZBCA 2D9OA 1SH0A 3AY0A 4R0JA 1Q16B 2DH8A 3NNHA 3QO9A 4H4MA 3OSPA 5BXIA 5DGAA 2V5HG 1BUXA 2GFFA 3CJ2A 2EBGA 2C2MB 3NEKA 3CJ4A 4L3NA 4FDFA 5HQMA 1LNQA 4KYZA 3M8YA 2KFNA 1OY9A 4CYUA 5K5MA 2GIFA 1KWMA 2CA9A 3VGTA 2EI5A 2JL9A 3OTCA 2M4MA 2HMIB 2CVIA 2BE9B 4K4VA 4AXJA 3T5JA 3MPYA 5HSPA 4OLPA 5SUHA 2CNNB 3EMTA 2AT1B 1T9YA 2GQ2A 2F4VF 4DSLA 2FC9A 3ZTRA 2V50A 2ZH8A 1UWAA 3QLHB 2AKWB 1AROP 1KQSR 3GV8B 3V4IB 4GVLA 4JOUA 5I3UB 1R3NA 1T11A 2J7KA 3RYLA 4IFVA 3RB6A 1S1XA 2ILZA 2LU2A 1B99A 2ZDPA 2VFTA 3R2DJ 4O4RA 2NZ4A 1RADB 4A8QA 1IBKJ 1FX2A 5IQ6A 4M94A 3HT0A 1GMUA 4ZP6A 2Y1RI 1CC8A 1VLYA 2BRLA 4L6V3 1V3RA 2IYIA 3TUZC 2N7CA 2HS3A 3FRZA 2QFIA 1DAXA 3UDLA 2XC9A 2NS1B 3JSMA 3N4WA 1WSRA 2VBZA 3AH6A 4PWDA 1TQLA 3R5CA 4LF4F 1VOMA 2M3DA 4OHWA 3C15B 3QMQA 4GC7A 1S9EA 3RB3A 4JI7J 4G1QA 2H5IB 2K1RA 2BR0A 1VQ9S 4RNOA 2HGMA 1SC1B 2FJDB 2R8GA 4ZVGA 4K0KJ 3ICLA 1OS5A 4FYWB 2FGCA 2YQ1A 3ZFVA 3KHHA 3TA2A 3TJ8A 4DL6A 1CJUB 4C8YA 3FUYA 5I3PA 3ILIA 1O0PA 2NXJA 2JLEA 5IM0A 4JI1J 1B7FA 4H54A 4N7TA 1QLNA 2AGPA 2BQRA 2UUCJ 3A4TA 1F5CA 3M4XA 3ZTOA 2V9KA 3OFGA 1WF0A 3BSAA 1U6BA 2KVQE 1U2CA 4GMKA 2BE2A 1PC4A 4HEA9 4RW4A 3QGPA 3QRQA 1I94J 4JI6F 1M5VC 3SDEB 3NY0A 2VA2A 2B5JA 2A2DA 3O5TB 5KAKA 1RT1A 4L73A 3DDNA 3SMZA 2RHSB 3PX4A 4QW8A 3TOQA 4AXIA 4B3RF 3EX7B 4PUOA 4KV8A 4XO0A 2FJVA 1J5OB 4DR4F 4IDKA 2J76E 1W2BR 4LF7J 4CWBA 1QE1B 1IBKF 2ILYA 1F6TA 4B9VA 5KFFA 1YZ7A 1SV5A 4CH7A 1RWNB 2YQ0A 3Q0AA 3I87A 3FSYA 4Q5VA 2KT2A 4P6QA 2CJQA 1S1TA 1PC5A 2Z30B 5HAOA 2ZBIA 5BR8J 3D6TB 3RRHA 1R8HA 3BV8A 3MF5A 4FNHA 1MMDA 3CO9A 4V1Ak 2IM1A 2NQPA 5DDRC 1JK9B 1NJIT 3DOMA 1BHNA 2I9SA 5ETQA 4A8SA 2IM0A 1FKOA 3NNCA 1C2PA 2ATLA 3FCWA 1UFKA 2H4YB 3RUBL 4DV5J 3MMJA 3DYAB 2L48A 2CQDA 1JJHA 1S7HA 1T02A 4RW6B 3Q23A 1P9YA 1WC0A 3BGFA 1GEHA 4BLGA 1ZM4A 2H1YA 4PYDA 3HF5A 2P8IA 1NH7A 1Z1ZA 1AYEA 1IBCB 2YKQA 3D54A 2YWHA 2QL9B 4C9DA 3OR2A 5F9NA 1EARA 4DUYJ 4JI1F 1NHVA 2VKRA 3EGNA 5AE2A 2E7XA 1TVRA 5D0GA 4ZVRB 5BYSA 1TL1B 3AJDA 4F4YA 3BR9A 2IC3A 4K4UA 2HEKA 1G2EA 2H9ZA 4Y6IA 2WVCA 1M1HA 2RRBA 5GAEI 4O0IA 4LF5F 2HHVA 3CC4S 2G1HA 1VRUB 4N41A 4DQPA 4ZMMA 4E2FB 4USHA 4IOBA 2FLPA 1UL3A 3MMCB 3OLAA 2DO4A 2I5JB 2UXBJ 1YSJA 1LK7A 2QLBB 4I4BA 2C28A 4OHVA 2WHOA 5KT3A 3Q2TC 4I7FB 4M95A 4DL4A 3V6HA 2CQ1A 2B4UA 2COLA 2HMIA 4J9MA 2R7UA 1N5YA 2D3O1 4WXOA 1LW2B 1HD0A 2LKZA 1MU2A 4Y2CA 1Q5VA 2GO9A 2WVBA 3O1LA 4F4KA 2DNOA 1U1QA 4IG3B 2DNZA 4GRSA 4NLUA 5DS7A 3QLHA 3KLIB 4ECUA 1SL1A 1VIXA 3NGUA 1RK8A 3V4IA 4DUZF 3C19A 3M8QB 1H3DA 1NK6A 3ISNC 3M6WA 2CPIA 3N9UC 1U02A 2V4RA 3OW2R 1QAJA 4B3SF 2J9EA 5CD4A 3SSSA 3J7Z5 2JC1A 1YRTA 1FDAA 3LWLA 3W9JA 4WU2A 2AGOA 5GMKa 5HJYA 3RU0A 2XSJB 5HMWA 3IR7B 5KG6A 3NNAA 5HMXA 2ZH5A 4LIWA 3C2PA 2DHHA 4HTIA 4RUCA 4B3MJ 1GX6A 3L7OA 4EYHB 3PJ9A 3W1YC 1YBUA 2VG6B 3HDSA 4LF1A 1K47A 2HLUA 3QRPA 2E1AA 3VHQA 5IV3A 2B9XA 1NDKA 3KDOA 3OTEA 3G8QA 3QAEA 5LSLA 1U1RA 4DLGA 4ZVFA 2Q66A 3GIMA 4P52A 5B0EA 4E98A 1YJUA 2SXLA 2VC0A 3C46A 3I5CA 3PYFA 1S77D 4YB5A 1T7PA 1BMQB 3HFVA 5KFXA 1N52B 1WHYA 3GJRB 4C11A 3DGVA 2DD8S 1NU4A 4ED5A 4Q8EA 4HTJA 1CJUA 1IKXA 3SIPB 1SBRA 1YKWA 4M5DB 4JP8A 3R7SB 2OFGX 2ZC4A 3PY8A 3G6ES 2CQPA 2YNIB 3SI8A 3HSJA 1URNA 1K0VA 2HRYA 2X1BA 4BWMA 1U1LA 1TV6B 1UVIA 4OI0A 3I31A 3JTOA 2HAFA 1QY7A 1ZPVA 3D6FB 4ELUA 1FWKA 2XS5A 3RW6A 4ZLJA 3VQSA 3D9BA 3B78A 1SKRA 2WW8A 2IM2A 3RRKA 1NJXA 9ATCB 1VK3A 1BY9A 3UCUP 5G0RA 2HVIA 2DNMA 1QE1A 4O4GA 1VQYA 3PJXA 1V9OA 1HBOA 3TX8A 3HO1A 2BJEA 2CDQA 5KFJA 1W2IA 4DMZA 4HL9A 2DNQA 2B4VA 2RU9A 4I68A 3BGRA 1L5UA 1Q8BA 3A8IA 5GAEU 2DBBA 2BKPA 1BGXT 3A8EA 4QZVB 4DX7A 5EX0A 4IR1A 1IJEB 3MAAB 2CJYB 1V5VA 2FVRA 3PM9A 5ETMA 1WWHA 4ZPAA 4RW9B 3FMWA 3W5YA 3FVYA 1MROB 3D1OA 2GJIA 1A9NB 2V4JB 2MDAA 4ES1A 1YITS 4DCOB 4ED0A 2HS0A 2OPQB 1RWMB 4NPOA 3POTB 4LQ3A 5D77A 2CZ9A 2D3OR 4UOHA 1IUJA 2EFOA 1VQ7S 4MFBB 1RCXB 2M0GB 3KLHB 2V2QA 4JBCA 2AF6A 1Q7LB 4HDGA 5K8MA 5J2MB 1S9GB 3FNNA 2B8PA 5KFDA 2VKZG 2CPDA 1LWFB 3PW7A 5F8NA 2YXLA 2AW0A 1TL1A 4DF8A 5E7OB 3SCIE 1S79A 2NSCA 2GMJA 4KH0B 4BWJA 1LWXA 1URRA 3HKWA 4CLZA 2A10A 2ZEJA 1VRUA 5B0BA 5F8MA 4QYZJ 1WKJA 3RZAA 2KM8C 1U4BA 1GX5A 2ALYB 2AWZA 3ZZRA 1MW7A 3HFZB 2DGQA 1OYDA 4JI2J 2PI4A 2LCWA 2I5JA 3D68A 1NHUA 2WSEC 1NSPA 3UCZP 3LPYA 2JEIA 1XK8A 2KZMA 3TNVA 2MKJA 3LOUA 3I5BA 2RRAA 4KH1B 1GTEA 2DT9A 3G8TA 2HHQA 4QBUA 4DL3A 1TL7B 1C1CA 1T03B 4ZPCA 3TAMB 3IWXA 2VDHA 2GS8A 1B3TA 2H51B 1X8DA 4WP8A 5GADU 4PWWA 1N32J 3KLGA 4P2XA 1JLFB 1N0VC 2GVZB 2G1DA 3KLVA 1PILA 3QZ7A 1HD1A 3QAUA 1HYSA 3IRWP 1FKPB 3FQKA 2LLZA 5LJ5Y 2XCAA 3OVAA 3BO2A 4Y0FA 3AQPA 4KGXB 1VBYA 2OTLS 2IY5B 4B9SA 4JI5F 1H6KX 3ZZOA 1ULRA 2OI2A 4RW8B 3KLIA 2O1PA 3VQTA 2XZTB 3M8QA 1X4FA 4KKOB 4WFZA 4X4SA 1LXNA 2BJ1A 1RABB 3CDAA 2DITA 3OL7A 1GXUA 3BKTA 1H38A 1YG0A 4M5LA 5D0RA 4TU7A 2N4CA 2OSQA 2ZD1B 2LQ5A 2ATCB 3N5BA 3J81j 1X60A 1P8GA 1ZM2A 2FQQB 2XSJA 3FCVA 1RLCL 3GG1A 3SV4A 3J80Y 2EWHA 4MYTA 1VHIA 5DQGA 1IKVA 2NUUG 4NLDA 1MWQA 2Z56B 2A3JA 4YS2A 2V4QA 2P2CB 2FHJA 4QQBA 1NXIA 1X9WA 1RT3B 1H2UX 3CB4A 2IVYA 1LKZA 2RS8A 2N3OA 1YTYA 2Q6BA 4FF2A 4C0OC 4ZVHA 1QSSA 3WHIA 2WBRA 2A6OA 1FD8A 1XMOF 3UO0A 1RWPB 1Q81T 1Y10A 2AEFA 5B0GA 2YKMA 1JNZB 4OV1A 3VAFA 3B4DA 4YB1P 4B3OB 1U1OA 4WIQA 1X31C 4ZCKA 2HWHA 3JSRA 3CJ8A 3TZXA 4DPYA 1HNZF 5IOLA 5LL6d 4EO6A 4CT9A 1XR5A 2G4BA 5KFUA 4LFCJ 1FKAF 3CD0A 1V6HA 2E1CA 4UY8T 3K5PA 1HHSA 2KB2A 3T3FA 4NLVA 3IGVA 3K8WA 4FXWA 2YNIA 5GVQA 1O6XA 3V81B 4QIFA 2IIHA 4NEYA 5SZTA 3CO0P 1GXTA 4C8ZA 1N56A 5DDPC 1TV6A 2E1RA 1BQNA 2DNLA 1YBAA 2HZAA 4DX8H 4U96A 4EBDA 3GV5B 2HQFA 2ZH1A 1N36J 1W25A 4PG7A 3ENQA 2UXDF 3T9ZA 3PFOA 1VQPS 3C16B 4P73A 3BDPA 4ZCMA 1KBRA 1YVFA 1NKEA 2HIQA 3P96A 1JX4A 4IUFA 1FEHA 3CDWA 4X4TA 1YIJS 4RX6A 1RU1A 3DOKB 2OD4A 2GIRA 4I2QB 3BYRA 2BYCA 2CUYA 1Y5IB 3RBZA 3C3LA 2HSEB 2UU9J 1PSDA 5A2QU 4ED8A 2PSZA 5B7WA 1SJFA 1SJ1A 2FVPA 4RWXA 2W4CA 3X3UA 4AUKA 1QJHA 2ACMA 4RW9A 4ANEA 2B7CB 4GKJJ 5I42B 1FFWB 5F3TA 1OJ4A 3VAGA 2IAJA 3OXLA 4R8UB 4ZLPA 1PJ6A 3POTA 1U8WA 4F4AA 2KFZA 4HH1A 3EZOA 3MM6B 3MAQA 1PJ5A 4DR2J 4LFCF 4MFBA 3G4SS 2J0QD 1GT8A 2N7YA 2DIVA 4LSNA 3CXCR 5KFHA 1S9GA 3MFHA 1E6VB 1FT8A 1DBDA 3Q8SB 3U1MA 3JYTB 4X4VA 3KMQA 4WJBA 2FDNA 3A13A 1N5VA 3AFGA 2QSFA 1XQIA 4YR2A 3KG0A 1VIOA 4A48A 4PXCA 4B9LA 4TNOA 1SKUB 5KOXA 2CQHA 3H5YA 2YWKA 2EG1A 2HURA 3CJRA 3NP5A 2FVCA 4Y2KA 3KFWX 1B64A 4OI6A 3GYGA 5C5JA 2CNOB 4GKKJ 3UI3A 4QPXA 2CG4A 2KZZA 1SH3A 1REGX 3VALA 2DPIA 4USWA 2RILA 1CJVB 2A1BA 3NBPB 1T03A 2K7KA 3TAMA 4ZIWA 2AV5A 2YWFA 2ROEA 3E51A 4ZOSA 1JLFA 2BX6A 2MZ1A 4I69A 1IJFB 2GVZA 1ZBTA 1EHWA 2QLWA 4OHZA 4LJMA 4KY3A 3GSDA 1QM9A 5KT7A 1FKPA 3GYNA 1NK7A 2E7WA 4MK7A 4PR6A 3GFXA 2OPSB 2DIUA 1A6LA 2R7WA 4RW8A 4K2XA 3OR1A 3UN5A 5KG0A 4KKOA 4IFYA 3CC2S 4XPCA 3WX8A 3MECA 1KTVA 3M30B 5KFMA 5KFPA 4ECSA 3VAIA 4IQXA 1IQTA 5ETRA 2APOA 7FDRA 4WFAQ 2ZKTA 2DY1A 1KDNA 2OKQA 4ZP9A 2YNHB 3BS9A 3MR5A 1NNDA 3HSZA 3LF0A 4JV5J 1R8CA 1NPRA 4P74A 1I6JA 2BUNA 1SIZA 1WTBA 3PYEA 3QQCD 1FNOA 2RT3A 4OYXA 4ZIVA 3HHLB 4EU0A 2DXDA 4X62F 1KD1T 1MLAA 1NLKL 4P10A 3FEZA 2HWTA 3T1HF 1RT3A 2F3JA 5KG7A 3BPDA 4DR6F 3OPKA 1KP6A 3TUIC 2OD6A 4EZ6A 4IG0B 2FLNA 4DSIA 1T0TV 1J27A 4WTOB 1B7YB 3TVZA 2QFJA 5L39A 4EBCA 4RWWA 4KSEB 4JV0A 4TQRA 4A8YA 1C4AA 3MHYA 2M7SA 3ENAA 3UDCA 1Q79A 2OELA 4B3OA 2MJNA 3ZTPA 4PZVA 4NL5A 2BQ3A 3I32A 1U2RA 3KHLA 3G8SA 3CMAS 1VFJA 3VWSA 3SV3A 5DG8A 3KK1B 1HNXF 2ZC3A 4MKVA 1RU2A 3FSXA 1UJ6A 4HLBA 4YDDB 3QT6A 2XYPB 5B09A 4ANDA 2XZDB 3GJTB 1KSPA 1RT6A 2YH1A 4MKBA 3HJFA 5KTQA 3V2UC 2G0CA 5HQ8A 5L8RC 4F26A 3IC1A 4X4OA 3AHPA 3BDEA 1JJCB 3V81A 3AQOA 1D0EA 2Q43A 3TZWA 2JZ5A 1X4AA 3IR6B 4LVNP 4OYZA 3P5TL 3TA0A 5BYQA 2FPHX 4FYXB 2UVRA 5L46A 2VPYB 2ZZMA 2KN4A 3PHEA 4OYIA 2VG5A 3AXMA 4BHQA 4NMXA 4IOCQ 4H4KC 3ETOA 4A8FA 3C14B 4K50A 2HHWA 4K8RA 1Z2ZA 2QIFA 4LR8A 3CJ0A 5IT9U 4DV2F 2MQOA 2Z4PA 2FJWA 2WAQD 4DV1F 4WFBQ 3M2VB 1C1BB 3LQVA 4B17A 1K0TA 2DHGA 3FRYA 1HMVA 2IMWP 3J81U 1DJ0A 3WDOA 1Q8KA 5FJ4A 1LK5A 4U7UK 2JSXA 3DXSX 4O3QA 1RQ0A 4I2QA 3DM2B 1TELA 3CCTA 4C3LA 2FHOB 1H73A 3PW4A 2VC1A 2UVUA 3TA1A 4G6VB 3QIPB 2XNRA 4JI0F 1JIHA 1Q78A 2X3DA 3NOCA 2C2NA 3A8JA 4DSFA 3GONA 3W7BA 3PHTA 3B54A 3NS5A 4TY8B 1F60B 2IJFA 2XY7A 1FNMA 5I42A 3AAWB 3ZZTA 5B0DA 2CXEA 3DN9A 1RWOB 4LRFA 3HZEA 5U47A 4ILLA 4ILMA 2Z58B 4ZJQA 3MM6A 1YLXA 4QWEA 2KO1A 4BC9A 2L08A 3CJSA 1KNZA 3OXGA 2PFFB 2E5GA 4DN0A 4OX7A 1GAOA 3DRSB 3TX0A 1KS2A 1E6VA 3BN7A 2Z2YB 2DPJA 3R2CJ 1CJTA 4Z37A 3KTQA 3NG8A 3AD7C 4OJHA 1X9SA 1M90T 3JYTA 5D6GA 2HBRB 2OGUA 2AZ3A 2LFVA 5FIIA 1MMNA 2HHUA 4F36A 3TR5A 3VCDA 2C2KB 5LSRA 3MM5A 3FQLA 3CCES 5MAOA 3TQEA 4NLYA 5GAHU 2UP1A 5T41A 2RIJA 3BQ2A 2I0XA 2ZH2A 2VASA 3CDEA 2Z57B 2OLWA 2R7RA 3WIVA 4CIOA 4NXNJ 3MMBA 4DR3J 2OP5A 1TK8A 2EXUA 3M8RA 4B08A 1R0AB 1CJVA 4F0MA 1N5SA 2MZJA 3NRBA 3NBPA 1IM6A 2MLXA 5C24B 1F5AA 1WHVA 2FJBB 3B82A 2XMMA 2QLJB 3EVOA 4ZJOA 4CCHA 4IYQA 1RAEB 3BBFA 1NH8A 5HVFA 2KI2A 4PQAA 3HT3A 4IOAQ 3W63A 2L9NA 1D9AA 2C3PA 4NCBA 5HVGA 3ULHA 1K73T 4PXDA 2PMWA 2MQMA 4DX6A 4HACB 1SL0A 2BDPA 1PG5B 2GX8A 2XMWA 5JVHQ 2M8HA 1IM4A 3GTYX 4CP5A 2CG8A 2YNHA 2K2PA 4MT1A 3L7UA 4LRBA 4ETZA 2MKCA 4QIEA 2O5DA 2IJRA 2N4DA 2OEJA 1XNRJ 3HHLA 2VFUA 4G1IA 3M8ZA 3MOJB 3GPAA 3QYYA 2EKNA 1L3SA 2MQQA 1CC7A 2RJZA 2MY8A 2NLWA 3Q8RB 4Y2AA 4H4OB 2ROGA 3CCJS 4IG0A 5DETA 3CVKA 3K0JA 5EDWA 3D7SB 3BZQA 3MWBA 1EP4A 2P9EA 1RAJA 2E5LF 1HNWJ 1UVLA 3KK1A 2L9WA 2MKYA 5AXNA 2VA3A 1X0PA 2AYMA 2VD3A 3ZZUA 4P75A 3GB0A 1U25A 3I0SB 3N5FA 3LP2A 3JQKA 4NYOA 4DV0J 3OFEA 2C2OB 3ISND 4K4ZA 1GMWA 1RLDA 1ZYQA 3IRXA 1S0VA 2W2OP 3FC9A 2C3YA 1VC0A 4F02A 2D41A 1TKTB 4D3GA 2IJNA 2CWXA 4WE1B 2QA4S 1WF2A 1D8ZA 1RKJA 3B6BA 4OI2A 3C14A 2JVOA 2MHNA 4AD6A 2MSSA 4CO2A 1X7VA 2XLJA 3M9MB 2QO3A 1XJWB 3M2VA 1Y00A 1C1BA 1XC9A 4ZP7A 3RB0A 3IXQA 4RNMA 5HO4A 2GC8A 4LFAF 3BO3A 3R1HA 1UW4A 2BANB 2AGQA 3MPVA 1JQGA 3DM2A 2MGZB 3KG4A 2ZWPA 3R9LA 5DLGA 3CCRS 4ALZA 4USIA 3QIPA 1B0VA 3MEDB 5EN1A 3MD1A 1VQMS 2GA7A 8AT1B 5LMNF 3I0RA 3EXYA 4KRWA 4Q0BB 2QC3A 5HN0A 3EGWB 4CO4A 4OI1A 4DV6J 4USMA 1FRLA 1RAAB 1G7CB 3M8PB 3IP0A 1FJGJ 4C0BA 2J6TA 4A8MP 1H0HB 3RBEA 5LJ3Y 4B3TJ 2F9JA 3PFEA 2IMOA 5H9FJ 3JSBA 1RTJB 3GJQB 4WWSA 2U2FA 2QN6B 4DV3J 4ZPWR 3NGKA 2R8JA 1FX4A 5DO2A 2FZKB 4M5IA 1RTZA 2VFRA 2E66A 4CH1A 2QZ8A 4DEZA 4ECRA 4ECVA 1W7WA 4DR7J 1TKZB 1YJ9S 1MG7A 3AB4B 3UPFA 3LO3A 5DQIA 2OSRA 2YVSA 4U9RA 4X64J 3CJQA 2OEKA 1YJNS 3WZ0A 2PEHA 1XNQF 2HVHA 1K9MT 4FVCA 3LGHA 2DRDA 4DFPA 2PEBA 5H9FK 4RL1A 3BGOP 1X4CA 3OL6A 3TW0A 1KHVA 1RTHB 1R0AA 3NLCA 4CH0S 5K9FA 3S6EA 5C24A 4U67Q 3EDRB 4LBPA 4YQWA 3U1NA 4DXLA 4ECXA 5A0YB 1U2FA 3NWRA 4CT8A 3MCNA 2WSFC 4URQU 4YR3A 3DHWC 3T41A 1AT1B 1VQSA 3IAS9 3O6QA 2EK6A 3CCUS 3ZO7A 3LP1A 4N77A 2OUGA 4OX9F 1YGYA 4K5RA 2XS7A 3VR1A 1YK9A 3PACA 2KHCA 4HACA 4F4XA 3H42A 1VJWA 5A2QY 3GFHA 2HYIB 2LQBA 4IRDA 1R8AA 1NDPA 1SJQA 3KUGA 4C8NA 1FE0A 4HT5A 1VR6A 2XZWA 2AZ1A 4DQIA 3BH7B 3NS6A 1VISA 3R27A 1JMTA 3CCMS 1HI8A 1N48A 3A3NB 5AJ3J 3N0VA 5D4LA 1LW0B 4CLKA 2AJ4A 5A8WB 4NWBA 1XIQA 3CF5Q 1NZAA 1RGVA 3KNAA 5J2PA 4H4OA 1GFWB 4OX8A 3TRGA 2G2ZA 3R7BB 3Q8QB 2C1EB 1SKWA 3HHLC 2QG9B 4F2SA 1RKIA 4CLYA 3IS9B 4LF9F 2RB7A 1N88A 3GIKA 1L3KA 1T05B 5JMNA 1MNEA 3GQCA 4WFXA 3OTDA 2KH9A 2GZOA 4TU8A 4I56A 3CD6S 4KHPF 1R31A 1Q5YA 2V69A 2NREA 3QO9B 4CQ1A 3J7YI 4RU2A 2ZVIA 4FF3A 1RAGB 5K20B 3BQ1A 2A18A 5C25B 5AXMA 4IKAA 3OFHA 1CVJA 4J9UE 3I0SA 5JUMA 3W2VB 1LV5A 2JRSA 3KKFA 4ZITA 1IXKA 2B6AB 3KLFA 4RBVA 4X65F 1RB0A 3JSYA 1BQMA 1H74A 2ZJRQ 3VGVA 2CKWA 3LP0A 3EYZA 2DKOB 3NAHA 2BKNA 3MUMP 4WE1A 3UE2A 2R3VA 5KFYA 1KFSA 2BQUA 2DHAA 1ZPWX 2UXCF 1TTHB 2GHVC 3FDSA 2C3OA 1RWWB 4NEZA 4RO0A 2M5YA 2XEXA 2BOPA 4ED4A 1SJ3P 4IH7A 1TMMA 3KUHA 4JYAJ 1WF1A 2RQ4A 4U95A 1EQMA 3DLEB 2OFHX 4USKA 3MGJA 5F8GA 4IFVB 5HBMB 1HIYA 4LF2A 3D0IE 3L95X 1S4EA 2ADCA 2ALZA 4ES2A 1T9VA 3KJVB 5LMUJ 2YWEA 5AJ3F 3CEDA 2BANA 2GMHA 4ES3A 2YPYA 2MGZA 2BA9A 2M88A 4UT4A 1SXLA 1JLEA 2HBZB 2EFVA 3H40A 1NSKL 3MEDA 1NK8A 5KT5A 1TK0A 4U7CA 4W90B 3DLGA 1XEZA 1FRMA 3BB5A 4OYAA 5KG4A 2ZBPA 3OHBA 2CPYA 4Q0BA 3HP6A 1J5EF 2R4FA 1IBLF 1SCJB 4MMOA 3WIUA 3FBFA 3HX9A 2VFSA 4OZ0A 3M8PA 2RRNA 4DR5J 2BEFA 4OQJA 3PR5B 2Q6CA 5IFMA 1S9EB 4JI4F 3KYLA 3CDUA 2CRLA 2A0FB 4G1QB 2K1RB 3T1AA 1FDDA 1RTJA 3JB9k 1VMBA 3GLJA 1YRUA 1WELA 2CQ4A 3QNWB 5HROB 4FVMA 4A8WA 3JTPA 1N33F 2AJ2A 3ILOA 4FS1A 4ENOA 1JLGB 4J91A 3K59A 1E6YB 4FYVB 3PEJA 4QU7A 1FJ7A 1AW0A 4P2FA 3BGLA 4I6YA 5IM0B 4QIWD 1TKZA 5CYMB 4P71A 2PMHA 2NXEA 2M2BA 1JNRB 1RT4B 3QT8A 3EPIA 3KDNA 1HI1A 5ETKA 2BE2B 4RW4B 2ZH9A 1NKCA 1X0FA 2X7IA 4ATNA 3UDVA 3UNYA 4P7VA 3MUTP 2AJ0A 4HHJA 1RT1B 2Y8WA 4DSEA 2DYAA 2BW2A 2VQEJ 1G1XA 5JJBA 4JI3J 1TUWA 1IBMJ 1RTHA 5E41A 4WFNQ 4KV8B 3Q89A 2DR5A 2B0GA 4YN3B 4E8UA 4ZCLA 5IT9Y 2X1AA 5DDQC 1M5OC 2E5IA 3CIZA 5A0YA 3H5SA 3T1YF 2E5HA 3PEHA 3K57A 4DZDA 1S1TB 3F41A 5CABA 3NMRA 1CG2A 2ROPA 4J9OA 1RTIB 1SQEA 1RI7A 3M05A 2LXUA 4ILRA 3CCSS 3IO1A 1X4BA 3PZPA 4IR9A 4M5GA 1FESA 5CH7B 4DSKA 2O3DA 2KG0A 1UWBA 3ENWA 3J7YU 2EPIA 4S0MA 2ASYA 2KT5A 2EKYA 4TLQA 2F7VA 2W9CB 3KJNB 3W8GA 1S12A 2DNNA 2K3KA 5A8KB 2W7PA 3W64A 1FRHA 1FI4A 1RHMB 4DR1J 2DHSA 1YJWS 2YQ3A 4YUDA 4CNYA 1LW0A 5A8WA 4O3PA 1JKHA 5D3GB 1YWXA 4KBIA 2NCKL 1PO6A 3QGGA 4MTPA 3H2LA 2QL7B 2UUWA 3P6YC 3CJKB 2KM8B 3N6MA 1DARA 2DR9A 4M8LA 4F04B 2HGLA 4PRFA 2EVZA 5ADZA 4LFBF 1REVB 3IS9A 4ZCIA 1FJCA 1U0SA 1ICEB 3OTOF 2XHCA 3Q24A 3HSGA 1W26A 3GR0A 2QT7A 1S1WB 1UVKA 1OYEA 2Q79A 4NLPA 2BZ2A 2H48B 3QSYB 1H7WA 4MKYA 4HHUA 4NA1A 4MK8A 1K1SA 5C25A 4MJKA 5D0EA 4OI4A 4PXBA 2R7OA 2JFKA 1R6VA 3TVKA 1TKXA 4JB8B 4PG8A 4RNNA 1TZ0A 3W2VA 3BYPA 5HMYA 2B6AA 2A6MA 3M8WA 4YY3J 1NDLA 2MPUA 1X5OA 4A46A 3OD2A 1N5YB 4UOCA 3K5MA 2DXFA 2GIQA 1TU0B 2CNKB 5EWFA 1J2VA 5D15A 5IT0A 1MU2B 3CCVS 4JI8F 4IH6A 2RVJA 1IWAA 1JXLA 4KO0B 2DNPA 2OMLA 3TARA 3US5A 2Y8YA 1SH2A 1OQ6A 2HZCA 2E9TA 4WKYA 3H59A 2PC6A 5HVHA 3DLEA 1RBAA 3N28A 2PFDA 2GQQA 3WC0A 4PCQA 5HBMA 2HLTA 2AD9A 5ETPA 3HK2A 3KJVA 2UUTA 3SBMA 1NSQA 2BJ9A 2QMUB 4Q7AA 1HWIA 2G2YA 2WB4A 3PW0A 4QIGA 1DRZA 1HKAA 5RUBA 2FHJD 2RUSA 3S01A 2KKHA 1S72S 4OYMA 3OUYB 1TFWA 3UR3C 3KJQB 1BD6A 1RHRB 1RHKB 3DRXA 4EK2A 3OBIA 3RAMA 1AUDA 1G3OA 2VIHA 2IYGA 1KONA 3RBXA 1RAIB 5KFZA 4A8OA 2KRBA 2IBOA 2D3UA 3BGUA 3DI6A 1Q8IA 2ADBA 1RZMA 2P6SA 1SL2A 1ZZFA 4FXDA 3MR3A 1RT7B 2DR8A 1UEVA 1RISA 4PG5A 5HROA 4C11B 3UVJB 3KK2A 4HVZA 1JLGA 4DL5A 2MKIA 4OZNA 1E6YA 2HKEA 5EHHA 3O44A 1IKXB 3ISZA 4KTQA 4K4YA 4Y00A 3ENVA 4I6AA 4F0HA 5CYMA 5A76A 2G0JA 2BJ3A 3K8VA 4ETXA 2NUHA 1RT4A 4I64A 5M2UA 5CA5A 4RBTA 2K06A 2E5JA 3LA0A 4KE5A 1B0TA 4IO1A 2WB1D 2XTJP 4NRUA 3Q8VA 4ZVTB 4NLGA 4NMLA 4CRJA 4IRKA 1NB7A 4PG4A 4L75A 5HI7A 3KMSA 2CPZA 1P9QC 1AFJA 5EUHA 2V8GA 4JV2A 1VJQA 5G0RB 1HBUB 4R0EA 4O4GB 3FFIA 4RW7B 3CCLS 3THTA 4O44A 2QLXA 4ZPBA 2KXNB 3C6UB 4F7VA 2HW3A 2EEYA 1HBOB 1KQGB 1WG1A 2POKA 4EZ9A 1FK9A 2HWIA 2FY1A 1RTIA 3EE3A 2AX1A 3LAKA 3BGRB 4RJVA 2UUAJ 4ICLB 2HNZB 4FXVA 1GTHA 3ZTSA 2W9BB 2Z2LA 3PYGA 3G6YA 2MQ8A 3R6GB 3CCWA 3BKFA 4LVOP 3D28A 2XLIA 1U1MA 2IRUA 4JI7F 3OHAA 2VQFJ 1QD1A 1N34J 5IV4A 2W9CA 3ETMA 3VAMA 4AL6A 5A8KA 2WK4A 2VJVA 5GMDA 1T9XA 5E33A 4K0KF 3Q86A 3PRDA 3H25A 2XULA 2E1MC 5GAGI 1V3SA 2ZBQA 1ZM3A 4QIVA 5DZ6A 4XK8C 2GNKA 5D3GA 4ID5B 3D66A 4C3MA 1QAXA 3CJ5A 1HR0J 4Q8FA 2M52A 3CJKA 2UUCF 2M8DB 5F0UA 3EVMA 4F8RA 1REVA 4M1KA 2PDAA 1SVDA 4DPUA 1NMEB 1I94F 4EBEA 1U6FA 1OMSA 2DGUA 3LWMA 1LFWA 1PYSB 2J0XA 2FYXA 1S1WA 7FD1A 4W4MA 2PMZD 1RT5B 4XIUA 1CQNA 4MAKA 4HKQA 1UTAA 1VBXA 4NXMJ 4K4XA 2BKOA 3WC2A 4LF7F 4DBQA 1GXLA 4OL8A 3E3XA 1UZHA 2EC0A 2NXUA 4KGKA 4F3QA 2JX2A 3PV8A 2AYGA 1HW8A 2XLKA 4ED7A 4F50A 2V0NA 4N56A 2YPZA 4UW2A 3VF0B 1C1CB 4WZMA 1D9DA 2ZFHA 5BR8F 4C6AA 3KLGB 3DRPB 3IA0A 4ECWA 4YOEA 5IWAJ 2X51A 3AA9A 3LH2S 4C48A 3RBDA 1RCOB 4ZHRB 1HYSB 1Q53A 1U7LA 1RWUA 1QVGR 4YHHJ 3OLBA 4KO0A 1NCLA 2K8GA 3M2UA 5EGYA 4DV5F 2R7XA 4K5SA 3QJPA 4OX6A 1Q0NA 2C2ZB 4AQYJ 4DV4J 4B9NA 2RQMA 2W4PA 3JAMU 3UCGA 4O3RA 2F40A 1XMQJ 2IVFB 3L7PA 3FZBA 2DO0A 5K8PA 1TL3B 3K2YA 4FKXA 1WTFA 1AB8A 3PW2A 4WP3A 4DUYF 4DPOA 4EI2A 2H5JB 1IKVB 1QUVA 3OUYA 2ZH3A 3OFFA 1C0UA 2EC2A 2ZHAA 2JDJA 3N6LA 4N47A 4YDXA 2EFQA 3MEKA 5KFKA 2R2SA 3H5UA 4DV7J 1JLBB 1VQ4S 4C8OA 5IZHA 1ZH5A 4DQQA 2W4DA 1S6UA 3D67A 3GILA 2CAJA 2F1FA 2XMKA 3PDNA 1T3OA 2YKMB 2BVZA 1RWVB 2W7OA 2UXBF 2E1PA 2XB2D 1HLWA 2D74B 3PO5A 1VQ5S 2WVFA 1RT7A 3CD7A 4OYPA 2V8DA 1NB2A 2ZM6J 3UVJA 2NSBA 5F9LA 4TXSA 1S6PB 1KOOA 1MWYA 4ZKAA 3N6NA 5F8JA 3QGIA 3E01A 9RUBA 4CZCA 4M5HA 2VZ9A 3MEGB 1ZOTA 1P1LA 4FKYA 3O8WA 3AA8A 4XPEA 2CPEA 3Q8UA 3F44A 1UETA 2CQCA 2YX7A 1UVMA 4C97A 3WX4A 2V6AA 5A8RA 4Q2LA 4WYLA 1T95A 1NK4A 1BQNB 1TP7A 3HXMA 1Y3JA 1WACA 3MM9B 2UUBJ 4EGLA 5CZVA 4DV4F 3ET6B 3ZZ0A 1K8AT 3PJWA 2JEGA 2XCPA 2G0IA 4DG1B 3G82A 2HBYB 4J9VA 1HBUA 2CJAA 2BABA 5H9EJ 2HZVA 4RW7A 3H98A 2R9LA 5KFVA 4WYWA 4Q44A 3C6UA 3QSIA 5KT2A 4ZA1A 2VPXB 4DU7A 3V6JA 5FD1A 3J7ZT 2DH9A 1YBTA 3HHDA 5THWA 4LT6A 3NAIA 3RAQA 5E3AA 3TYTA 2Y3YA 4B3MF 1H72C 3GMGA 2V8VA 2JWNA 4ICLA 4CO5A 2HNZA 2W24A 1G6BA 2W9BA 1LQ9A 2ZNZA 1VYAA 4LSZB 2P9GA 2LMIA 3K5LA 1VK8A 1Y3KA 2HVZA 1FTRA 4CM2A 5AT1B 3FZ2A 2YKAA 2GVDB 1VS3A 3T9NA 2YBVA 1EKRA 3NGSA 3SFGA 3CSKA 2NXCA 5H9EK 2HQDA 5E2QA 3DLKA 2IAJB 2JH3A 4TYAA 2YNGB 2GAHC 2ZM6F 1WC5A 2C42A 2JHEA 2OJ3A 2WSCC 3G2XA 1M5SA 1M1KT 3D1HA 2QYCA 2ZOMA 3H0PA 2VBYA 1QSYA 4WZQA 1WORA 1JLCA 5HL7Q 2MQNA 4ID5A 4LSNB 4ED3A 1SQFA 3W9IA 3DOLA 4KHMA 1FXLA 2GO8A 4U7UD 2AIRB 2GJFA 2J8AA 1ZAVA 5LXRA 2HBQB 2BE7D 3BSOA 3O2IA 3QATA 3EVWA 2XGQA 5BJRA 1RT5A 5JXSA 4AFFA 4UZCA 2EBEA 4UQTA 2JEFA 1U1KA 2MJUA 3CCZA 4M63A 4X66J 1P1TA 1H98A 1LXJA 1S76D 1N4LA 2DRBA 2IPOB 1S49A 2J6UA 4LBIA 1WI6A 4KR0B 4DN9A 1F5BA 5I3QA 6AT1B 1FNXH 3MXHP 3DRPA 2HHPA 3B8HA 1A0OB 4J9RA 1SC6A 2EK1A 2FLLA 2OPPB 4MIWA 2HHHJ 3NGTA 4ZHRA 3CMQA 2DNHA 3I4HX 1D3WA 5FLXU 5CCLA 1FVQA 1OWXA 1LOUA 3D6MB 4AYBD 3OR1B 4DLEA 1QTNB 1U6ZA 4LR9A 2H4WB 4IFYB 1BLUA 3MECB 1C4CA 1KEKA 1C0TB 4DJBA 3BQ0A 3HVRA 5DLFA 2KYZA 2LEAA 4OJ3A 2BRKA 4QWAA 4OI3A 2R42A 5E3QA 1TL3A 1PBAA 2PI5A 2HNDB 3HHLD 3DRRB 4XAKA 3VAHA 4FS2A 1N0UA 2AJFE 1AA1B 2XHWA 2Q3PA 2QYGA 2CPJA 2UV8G 2F4VJ 3AOBA 5IXUA 3M7VA 1RJJA 3L09A 2NXNA 5DM6Q 3MZIA 2CZ4A 5KFIA 3VTIA 1JLBA 5LT5A 1T3NA 3THPA 2RKIB 1WG5A 2KU7A 3IWNC 4DCJB 2CQ3A 3LPEA 4JI2F 1SC4B 2MKSA 3T6JA 3DCAA 1U26A 2OTJS 2RU3A 4ZVEA 1KVJA 2CVEA 3L4BC 1H2TZ 2YKNA 3MTJA 5EX3A 3KG1A 3PXGa 4YFUA 1FD2A 4DFJA 5JVGQ 1IR2A 1F3FA 3H4DA 1NDCA 1S6PA 5IC4B 5HP1B 3HHKA 2FHMA 3HVTB 1RT6B 3NMAA 3MEGA 1DLOB 1N32F 2DRAA 2KHDA 1GMWD 3R5GA 4KB7A 1OIAA 4LF4J 1CSJA 1I3OB 3HD2A 5IS2A 2WVEA 5GMEA 2JOQA 4LQ9A 3BF4A 3TANA 2LU1A 4LSLA 5E3CA 2VG5B 3MM9A 4OJ1A 4Y34A 2X1GA 2XS2A 4X4PA 1WJ9A 4Q43A 4J9QA 1XR6A 3ET6A 5J1EA 2ZH6A 4OYOA 4Q45A 4YB7A 2XNQA 3HVWA 4HR2A 4DG1A 4DS4A 3H2UB 4ZN3A 2DNKA 2VU5A 5LM7E 2GQCA 3SZ2A 3UD4P 4M5NA 1SUQB 1HMVB 4UQGA 1VQOS 2HVDA 3QFHA 3AB2B 4RUHA 1HBMB 4KAIA 5ETLA 4CNZA 4ECTA 3LGNA 2V94A 3IAM9 4FNIA 1WKLA 2V2VA 2D1CA 4JI6J 4ZVOB 4XDDA 1N5TA 4USJC 2RE1A 5C42A 1YJRA 4ECQA 5A6WA 1KLMA 2ZJPQ 1S1UB 4M5JA 2B56A 1HNIB 4B3RJ 4OJGA 4DR4J 5KFAA 1U24A 1N6QB 2JNJA 3GIRA 3EGVA 1CLFA 2GVDA 4B02A 1R8PA 1Q1KA 3PW5A 2FZCB 1D9FA 2YNGA 2XY5A 4D3HA 2P6TA 4DPWA 3DXBA 3TVYA 4BDPA 3F56A 2QX0A 3PR4A 3ADAC 3SFUA 1P6TA 2E9RX 4OIXA 2RDDA 1XMBA 2KL8A 3CIMA 4J9KA 4R5PA 3GFZA 5CD4H 1CJTB 3VAJA 4NLXA 2HFOA 1X4GA 3F73A 1HHQA 5CCMA 4TQSA 4QR0A 2G2OA 1WEXA 5DM7Q 3JQMA 3MM5B 1TK5A 1MSWD 1TMJA 4F3OA 1N36F 4JV1A 4C98A 1HNVA 1NHKL 3OVBA 3H5XA 3M32A 1R0BG 3GZ7A 1FWLA 2HQ3A 4HYKA 2GV1A 3CULA 3JQJA 1DURA 5CHCB 3P4UB 2DTJA 2AEJA 3MMBB 3IMQJ 3U1LA 2YX1A 2CDRB 5KFLA 4X4RA 4RZRA 3DLJA 2E7VA 4A4JA 3W9HA 2RD5C 4RKUC 2LXIA 1U1PA 2Y0BB 3A1YG 5EWEA 1FCAA 5D8HB 2BV3A 3PKMA 2HNYB 4LF5J 2OPPA 1P27B 2UU9F 3D6HB 1B4SA 1TL4A 2MKHA 4KGZB 1TAQA 3T5LA 2MSTA 3W61A 2QMXA 4FZVA 2MMYA 4GKJF 2FVQA 1UEUA 1C0TA 1ELOA 1XERA 1H7XA 3SQOP 1CS4A 1FRXA 1AZSB 3JTNA 1OSDA 2OHDA 4A8KA 1NEEA 1IKYA 2HNDA 4XTTA 4DR2F 2AMCB 1RBLA 5KFNA 1T94A 3QIDA 2QMWA 3DRRA 3VGUA 4ID8A 5BYRA 5F41A 3RR7A 5KG2A 2XG8A 2GCFA 3IGNA 2QSWA 2R7SA 2DK2A 2J9DE 1IN0A 1GK8A 2I6WA 3HHEA 3TZZA 4FPRA 1RT2B 2VICA 4DUZJ 1EB0A 5ETVA 4K4SA 2W2MP 1BE4A 2XMJA 2I38A 2F65A 4OYBA 4B3SJ 1U0HA 3FEYB 3Q22A 2RKIA 2F5GA 4O23A 2W2NP 4C2MA 2ASLA 5E5NA 3M6VA 2QRRA 2FB0A 4DHVA 3RJMB 4OZ2A 3D3BJ 4GKKF 1EP4B 2VV5A 4I6WA 1WHXA 5E0OA 2HFUA 2MZRA 3LGMA 2AYBA 5F3ZA 5L1KA 2GMLA 3J7AN 3KHGA 5HP1A 3DU5A 2DEIA 4NYZA 3HVTA 5KFCA 1DLOA 4G3IA 2KXHA 4WFYA 2GJ2A 1YDLA 3LP2B 1TUVA 4RR5A 3FK4A 2F4FA 4KJIA 1APSA 2AJ1A 4ANCA 3L3CA 2ZUGA 1RAHB 3IRXB 4MIBA 1NK5A 1SJ4P 5AXKA 3SCJE 4V19J 4B9UA 1S97A 3VVTA 4CM0A 2R7TA 1HWLA 1UFLA 4NLOA 5DRKA 1TR0A 3R3TA 1ZETA 2W2QP 2YY3A 2JLGA 4CO1A 5L9XA 4I67A 2WZ1A 1PBUA 2L9DA 3BJYA 3PO4A 4OV6A 4JV5F 3MEEB 1RYRA 5DQHA 1L3UA 1SUQA 4PWUA 5IC6B 4G1PA 1ZA2B 4C8MA 1PYTA 1NJWA 1HBMA 5ETSA 3JAMY 4UF4A 2H5EA 1T8EA 1X4DA 2ZKUA 3SYZA 2AP6A 7AT1B 5EWGA 3TUJC 4FBUA 2DISA 2CZVC 3HKZD 3ELHA 4TN2A 3IM9A 3Q83A 5DG7A 5I3UA 1S1UA 4TLRA 4ZVQB 1N54B 1HNIA 4F2RA 3H4BA 3KUEA 3QT7A 2DGOA 1R8BA 1U1NA 2ZZNA 1HBNB 3I0RB 3GJSB 1N6QA 3M6XA 1ZAXA 3AJ1A 1OSCA 3MPWA 2IBKA 2QV6A 2XI2A 3R5AA 4L72B 4MYUA 4DQRA 2IVMA 4AT1B 3HPOA 3NXZA 4B9TA 2KJWA 3FBCA 2B4PA 5HMZA 1DQ9A 1TAUA 2ZVSA 2B8QA 3W62A 4X84A 3S1TA 2DVIA 2F8MA 2NPFA 3CGIA 4GO7X 3GSIA 4F4ZA 2FZGB 1MWZA 5GADI 2LXFA 5LOQA 2YKPA 4EYIB 4J90A 2PA8D 3DLBA 3BO4A 1NBEB 4U6PA 1RHUB 2ZH7A 1WEZA 1WKKA 1NKBA 2HQGA 5KFTA 2YWWA 3NWGA 2MYFA 3C15A 1BXNA 2QLFB 5KFBA 1Y4ZB 1NPPA 3SSQA 2QJ3A 1S0MA 2W01A 2W2PP 3K58A 1SIWB 2M9KA 2Z8QA 3EWGA 4E0DA 2MZSA 3I9V9 2VBXA 1DZ5A 2WONB 4MK9A 4HT7A 4WK3A 3TEHB 4QWBA 5ETNA 1KN6A 4DCPB 4TY9A 3EZUA 5CZXA 2QL5B 2ZH4A 3NCPA 4RU9A 3T5HA 4OLOA 2VJUA 2NYIA 3AD9C 4PPDA 3RR8A 1QAIA 2PO4A 3SDEA 2LYVA 3DHXA 3TJAA 4ZJLA 2HNYA 4CLFA 4KPCA 2XYGB 1IQZA 3DFEA 3LAMA 2MZQA 1UVNA 4JUZA 1J5OA 2HIYA 3LP1B 1F0XA 1WDDA 3NGDA 3VV2B 2VUGA 3UW1A 2D3ZA 3CE8A 4HI2A 1KFDA 5T7LB 1M0SA 2MLYA 4F3MA 3G87A
chains in the Genus database with same CATH topology
2B3TB 4ERDA 2FDNA 2AYEA 3I9ZA 2QA2A 5KFZA 4A8OA 1N5VA 2KRBA 2IBOA 2QSFA 2D3UA 4YR2A 3KG0A 1VIOA 2KRRA 4A48A 1KOHA 1TKTA 4PXCA 5KFRA 4TNOA 4B9LA 3BGUA 4I0WA 3DI6A 4J9NA 1Q8IA 2ADBA 5KOXA 2CQHA 2P6SA 3H5YA 2YWKA 2EG1A 1SL2A 1ZZFA 3NP5A 2FVCA 4Y2KA 3KFWX 3V5RA 2UVVA 1B64A 4FXDA 4NLRA 4I1TA 4OI6A 2DCLA 5KOWA 3OVSA 3MR3A 1RT7B 4KPYA 2JEJA 2PN6A 1UEVA 2DR8A 1RISA 3HMJG 4PG5A 5C5JA 3MMAA 5HROA 1FEEA 4C11B 4CO3A 3Q8PB 3KK2A 3UI3A 4QPXA 5K14A 2KFYA 4OZ5A 4HVZA 2CG4A 2KZZA 1SH3A 1JLGA 5C42B 2MKIA 4OZNA 4DL5A 4NA2A 1E6YA 3VALA 2DPIA 1KLMB 2I2YA 1RT2A 2Y0SD 2RILA 4ZS6A 4DV7F 3DYAA 1NK0A 1TFYA 5EHHA 2A2CA 4F67A 1FXRA 2A1BA 1S1XB 3O44A 1IKXB 5B0AA 5J2PB 3NBPB 5IQQA 4KFBA 1T03A 3ISZA 2K7KA 3TAMA 4KTQA 4K4YA 4Y00A 4J9SA 4RW6A 3OQ2A 3FCHA 2AV5A 3ENVA 2YWFA 3MOZA 1V3ZA 2DGXA 4J37A 4I6AA 2ROEA 4NOHA 3E51A 5CYMA 2J5AA 2HPUA 1BC6A 3GWCA 4ZOSA 3H2VE 1JLFA 2XMUA 3K8VA 1ZM9A 2MZ1A 4UUXA 4I69A 1IJFB 1RT4A 1ZBTA 2NUHA 4I64A 4RBTA 2F8HA 4ETXA 5CA5A 1HARA 2QLWA 4PQUA 4OHZA 4LJMA 1KQFB 1HW9A 2E5JA 3ZZPA 4ZPDA 3GSDA 4KE5A 1B0TA 1QM9A 4IO1A 2WB1D 5KT7A 1VQKS 1FKPA 1M5PC 2HFZA 2AX0A 4NRUA 4ZP8A 3GYNA 1NK7A 3R5BA 1Y5LB 2E7WA 4MK7A 4PR6A 4NLGA 3GFXA 4NMLA 2OPSB 2DIUA 4NXNF 1U09A 2C3MA 1OQ3A 1A6LA 4EEYA 1IKWB 1BQXA 2R7WA 4RW8A 4K2XA 4IRKA 3OR1A 1NB7A 4DR3F 4PG4A 1WG4A 4NRTA 5HI7A 3JSMB 2OIHA 5KG0A 3T19A 3D1QA 4KKOA 3KMSA 1NRKA 1XWLA 4IFYA 2CPZA 1XN9A 1MMLA 3CC2S 4XPCA 1P9QC 3MECA 1KTVA 3M30B 4ZDNA 5KFMA 5KFPA 5EUHA 3VAIA 4ECSA 4IQXA 2V8GA 1AFJA 1IQTA 3VZHA 1ZTWA 4PWDB 2W25A 4DDFA 1U48A 2APOA 2FJEB 7FDRA 4WFAQ 4JV2A 2ZKTA 2FHKA 5B0CA 5ITHA 5G0RB 4R5PB 1HBUB 4R0EA 5L1LA 2R7VA 4O4GB 3FSIA 2OKQA 4ZP9A 5G4DA 2YNHB 3FFIA 3GIIA 4RW7B 3BS9A 6FDRA 3CCLS 3MR5A 3THTA 4O44A 2QLXA 4ZPBA 2KXNB 3I82A 1YRXA 5B08A 1NNDA 3RW7A 2PD1A 4NA3A 2G13A 3TAQA 3C6UB 3KLFB 1CQMA 2WTFA 3LF0A 2HW3A 1DQAA 1HBOB 1R8CA 1KQGB 1WG1A 3MMCA 1FDNA 2POKA 1I6JA 2BUNA 4EZ9A 1SIZA 2MHEA 2XGPA 1BQMB 1RA6A 4AL5A 1WTBA 1ROFA 1FK9A 1FNOA 1FA0A 1HQUB 1BWEA 1FVSA 2HWIA 2RT3A 5M2RA 2FY1A 1RTIA 3LP0B 3HHLB 2UUBF 3D0GE 2JLFA 4EU0A 3PNIA 2AX1A 4IQMA 5F8IA 4UY85 3LAKA 4X62F 1PGZA 5AE3A 3BGRB 1KD1T 2J7UA 1HNVB 3FEZA 4ICLB 2HNZB 2HWTA 3T1HF 4FXVA 1RT3A 3SCKE 1GTHA 2W9BB 1DTQA 3M32B 2E44A 2F3JA 4BCAA 3EXCX 2Z2LA 1KQKA 5KG7A 2ZDOA 3S7RA 3CJ3A 4DR6F 4I7FA 3G6YA 2CJBA 3OPKA 4DL0C 5FLXY 1M5HA 3TUIC 3CCWA 3K5OA 2OD6A 2CPHA 3D28A 4LVOP 4EZ6A 4F4WA 2XLIA 4IG0B 2YNFA 4IO9Q 1U1MA 2FLNA 2RDJA 4DSIA 1OO0B 1S6OA 2IRUA 2BJDA 3TVZA 2QFJA 2UVWA 2LECA 4JI7F 5L39A 4EBCA 4CO0A 4BBYA 3MEEA 4RWWA 3OHAA 3HHNB 4KSEB 4JV0A 2W9CA 4KQZA 1KLNA 4RUAA 3K5NA 3VAMA 4AL6A 1LW2A 4FF4A 3LW5C 4TQRA 5A8KA 4A8YA 3S8SA 1C4AA 2WK4A 3MHYA 4OMFG 2M7SA 2DJWA 1XNRF 3UDCA 1Q79A 4B3OA 5E33A 2RS2A 3VAKA 2MJNA 4URGA 4K0KF 2WOMB 3N01A 4NL5A 2R2UA 3PRDA 2BQ3A 2B5JB 2E9ZA 1A7GE 3H25A 4IG3A 2XULA 3I32A 1U2RA 2E1MC 3KHLA 4NLQA 3G8SA 3CMAS 1VFJA 1QVFR 3VWSA 3SV3A 5GAGI 5DG8A 1V3SA 3KK1B 4WF9Q 1HNXF 1ZM3A 2ZC3A 1UMJA 4QIVA 2VPZB 3FSXA 1U8SA 3LALA 1JLEB 2XI3A 4XK8C 2GNKA 1UJ6A 5D3GA 4HLBA 4YDDB 2JFDA 3NKYA 5B09A 5LXYA 3CMES 3QWPA 1KSPA 4PUOB 4ID5B 1TKDA 1JJ2R 2XMVA 4C3MA 2KT3A 1D1UA 1RT6A 1QAXA 2YH1A 3CJ5A 4ELTA 4IDKB 4Q8FA 4MKBA 3DLGB 3HJFA 2M52A 5KTQA 3CJKA 3QPIA 3R5DA 1FHTA 4QPTA 2KG1A 1HBNA 2UUCF 3V2UC 2G0CA 3BN4A 5HQ8A 2M8DB 3SSRA 1JXEA 5J1PA 5F0UA 5L8RC 4F26A 1SV5B 3IC1A 4X4OA 4F8RA 3AHPA 3BDEA 4QWDA 1ZTTA 3V81A 2CJ9A 5H1SV 2VOPA 3AQOA 1D0EA 4OHYA 2Q43A 2JZ5A 1X4AA 1REVA 3IR6B 4M1KA 5AXLA 2KJVA 2PDAA 4LVNP 2QA4G 1M5KC 3P5TL 1FRKA 3TA0A 5BYQA 1I94F 4EBEA 1U6FA 2GHWA 2FPHX 4IH5A 2UVRA 2K7JA 2VPYB 5T14A 1KVIA 2DGUA 3HZGA 3MCSA 3LWMA 1LFWA 4OHXA 1HNWF 2J0XA 2ZZMA 5KFGA 1S1WA 2KN4A 7FD1A 3PHEA 2LA6A 2PMZD 1IKYB 5A6PA 2NR0A 2JC0A 1RT5B 2VG5A 4BHQA 4WCEQ 4XIUA 1CQNA 4MAKA 3DMJB 3T6BA 4IOCQ 3C66A 2Y1JA 2O67A 4H4KC 3ETOA 1FJEB 4A8FA 3BREA 4HKQA 4K50A 1JLQB 2HHWA 1Z2ZA 2IRXA 1VBXA 3V6DA 4K4XA 2QIFA 5L1JA 3MFIA 3CJ0A 2VG6A 3WC2A 4B9MA 4DBQA 4LF7F 1GXLA 4DV2F 2MQOA 2E29A 1FKOB 4EWTA 1F2GA 4OL8A 2Z4PA 3E3XA 2LVWA 2FJWA 4DOZA 2WAQD 2EC0A 4DV1F 2NXUA 4HH0A 4KGKA 4F3QA 4KT0C 2RSQA 2QA1A 4DV0F 4WFBQ 2JX2A 3M2VB 3PV8A 1C1BB 3MM8A 4ECZA 3LQVA 2AYGA 2XBPA 4B17A 1HW8A 2XLKA 4X4NA 4ED7A 2DHGA 3FRYA 2V0NA 4K4TA 1GNKA 4N56A 4F50A 1WNEA 3LUYA 4UW2A 1NAQA 3VF0B 1C1CB 1QTMA 4WZMA 1HMVA 2AQ4A 1KTQA 1D9DA 2IMWP 1DJ0A 1WEYA 1U4BA 3WDOA 2OO4A 2ZFHA 5BR8F 4DWIA 5FJ4A 2C2EA 2CIMA 2MKKA 1LK5A 1U49A 1FERA 4U7UK 2AU0A 4OFZA 2JSXA 5AE1A 3DXSX 3KLGB 3DLLQ 2RMLA 1RQ0A 4O3QA 4I2QA 3DM2B 4DF4A 3DRPB 3CCTA 3B4MA 3IA0A 2VH7A 4C0HA 4C3LA 4ECWA 4YOEA 1NO8A 3U27A 1ZAWA 2FHOB 2G9OA 1Q8LA 2X51A 3DC2A 3AA9A 3PW4A