3VAHA

Structure of u2af65 variant with bru3c4 dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
174
structure length
174
Chain Sequence
GPLGSARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/dna
molecule keywords Splicing factor U2AF 65 kDa subunit
publication title U2AF65 adapts to diverse pre-mRNA splice sites through conformational selection of specific and promiscuous RNA recognition motifs.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vahA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vahA02
1X4DA 4WFAQ 2X1FA 3CCQS 1VC5A 2G4BA 2RQCA 1M5VC 5CYJA 1H2UX 2DISA 2LKZA 2ADCA 2D9PA 1G2EA 3CUNA 2CQIA 2FPHX 5DDOC 3P3DA 1K73T 1DBDA 2MZ1A 3BO4A 4LMZA 2CPYA 2DNZA 1YJWS 4PR6A 1HD0A 2MB0B 2MQOA 1WHXA 4U67Q 2CQGA 3HHNB 3VAJA 2M0GB 1OO0B 3CCLS 1X4EA 2MZJA 2CQDA 4CH1A 3MOJB 4QU6A 2M9KA 1A7GE 3MI7X 2E44A 1PGZA 3H2UB 2J8AA 2GHPA 1JJ4A 2OJ3A 2JRSA 5CXTA 3SXLA 2LCWA 5HO4A 1WEZA 5DM6Q 3BO3A 1WEYA 2YH0A 3NNAA 3J7YU 4FXWA 2QA4S 3G4SS 2NLWA 1X0FA 4F02A 2MZQA 2J76E 2LMIA 3S6EA 3UCUP 3UD3P 2RQ4A 3RW6A 1UP1A 1UW4A 4ED5A 2RRBA 2KH9A 1S79A 3SMZA 3R27A 2JVRA 1U1MA 2OTJS 1P1TA 2MY7A 2N7CA 2LA6A 2SXLA 3DXBA 5ITHA 2MJUA 5GAGU 1Q86T 5D77A 1WF2A 2CPEA 3G8SA 5GAHU 3CPWR 3MXHP 4CIOA 2ERRA 1HD1A 1KOOA 1WEXA 1U1LA 1M90T 3K0JA 2MY8A 5LSLA 2LECA 4M5DB 2JVOA 3R1LA 3IWNC 2VONA 3CCES 2HZCA 1R8HA 3I56S 2DITA 2EVZA 2JX2A 2KI2A 3MDFA 4OZ1A 3CCMS 4YB1P 5GAEU 4IOCQ 2WBRA 1Q81T 3NNCA 2XS5A 2CPIA 2CQ1A 4F25A 1VC0A 1H2TZ 3ZZYA 1FNXH 1X4BA 2L08A 2LXUA 2PE8A 2FC9A 1VQ8S 1U1OA 1UFWA 4ZKAA 1NJIT 2KM8C 1VBXA 3EX7B 2A3JA 2KRBA 2M7SA 1U1PA 2MZTA 1SJRA 2VOPA 5DDPC 3VF0B 2KXNB 2ADBA 1WF0A 2RVJA 3VAIA 3LPYA 2X1BA 2CQHA 2LQ5A 5LXRA 2MKJA 2DO0A 1WHVA 1FJEB 3Q2TC 5LXYA 1WG4A 2MYFA 1VQ6S 2I2YA 2AYMA 2F9JA 2DGUA 1VQKS 3OW2R 2YH1A 2LA4A 2X1GA 3R1HA 1N88A 1SXLA 1VQPS 2FC8A 2CPXA 1WHWA 1WG5A 4LIRA 4QPTA 3BO2A 1D8ZA 2KG1A 3EGNA 1WWHA 2RU3A 3CCJS 3UCZP 2I38A 2MSSA 3CD6S 1ZH5A 2CQBA 3MUTP 3CCUS 2HYIB 1VQNS 4TLQA 3TO8A 2RUGA 2LXIA 3MD1A 2MKHA 1M5OC 2MQLA 2KHCA 3UCGA 1H2VZ 2F3JA 1A9NB 1H6KX 2LYVA 2J0SD 1YHQS 1YIJS 2DH7A 2RS2A 2K3KA 3VAFA 1UAWA 2CPHA 3B4MA 1NO8A 4QU7A 4WF9Q 3U1LA 4UQTA 2UP1A 2CQPA 2KYXA 3CCSS 1URNA 2KXHA 2X1AA 2CQ4A 1ZZFA 1U6BA 4TU7A 3CXCR 3MUMP 1YITS 1W2BR 3CTRA 2QEXS 4IUFA 1P27B 1OWXA 2LEAA 2E5IA 4TU9A 2CJKA 2DNNA 2VODA 3G96A 4YUDA 4RU2A 4J5OA 3CMAS 3NNHA 2RRAA 1WHYA 1VQ9S 2XSFA 2DO4A 2J0QD 1WG1A 2NZ4A 3EGZA 2L9WA 2DHGA 3THTA 1S72S 1X4FA 1FJCA 5H1SV 1U6FA 2ZJQQ 1QVFR 3B4DA 2D9OA 2Q79A 2CQ2A 2EK1A 1X4CA 2MQQA 5GMKa 1DRZA 3CMES 1Q82T 1VQLS 1VQMS 2N82B 1X4GA 2G0CA 1YJ9S 2OSRA 5EN1A 2M8DB 1K8AT 1R8PA 3MUVP 3G71S 3DLLQ 2MKIA 1X4AA 2LEBA 2DIUA 1WF1A 2CPJA 2MKCA 3ZZZA 2DGQA 5JVHQ 2M2BA 2YKAA 1KD1T 3THPA 1KC8T 2QFJA 3CC4S 2E5GA 3HI9A 1BY9A 1OPIA 1FO1A 2DNRA 4CH0S 1M1KT 2DNYA 1JMTA 1N52B 3MD3A 2DGXA 1VC6A 2MQMA 5DDQC 2CPDA 2AYBA 2M88A 2KM8B 3I55S 2CQCA 3S8SA 2FHOB 3UE2A 4P6QA 3ULHA 3FEXB 1M5PC 1F9FA 4TU8A 2B0GA 2MZRA 2CPFA 4WKRA 2DHSA 4Y00A 4YOEA 2O3DA 5IFMA 1VQOS 5CA5A 4WFBQ 3IRWP 3P5TL 2G1DA 3FEYB 2ZJPQ 4BS2A 3CF5Q 3G8TA 2KG0A 1N54B 2DH9A 2BOPA 2MKKA 4C0OC 2DHAA 2ZJRQ 3G6ES 4W92B 1YI2S 4OZ0A 2DNHA 2MQPA 3Q2SC 2M52A 2MMYA 2M70A 2AYEA 2N3LA 1QM9A 3VALA 2XB2D 4A8XA 2V94A 2DGWA 1JJ2R 2DNOA 4Z2XA 2DNMA 1QVGR 3N9UC 5D78A 1YTYA 4V19X 2KT5A 1HL6A 1O0PA 2BZ2A 1Q7YT 2U1AA 2HGNA 4FXVA 2OTLS 2AYGA 2OIHA 2CPZA 1X5PA 2RS8A 2VOOA 4PRFA 2F9DA 1DZ5A 1CVJA 3NMRA 3CCVS 3UWTA 3SDEB 1PO6A 2AD9A 4W90B 2YWKA 3SDEA 3U1MA 3CC2S 3CCRS 4PKDB 3BS9A 1JJHA 4QQBA 2MHNA 3TP2A 1RKJA 5BJRA 5GVQA 5JVGQ 2HVZA 4C7QA 1WI8A 2N3OA 3UD4P 4EGLA 1M5KC 2OSQA 1VQ5S 2DNGA 4CQ1A 3S7RA 1D9AA 1RK8A 2E5JA 1KQSR 4IOAQ 4LJMA 1K9MT 2CQ0A 3NS6A 3VAMA 5LJ5Y 1ZZNA 1VQ4S 2RT3A 2DB1A 2MSTA 5GADU 1SJQA 2CQ3A 2KN4A 5IM0B 3S01A 5LSOA 1B7FA 3BEGB 4WCEQ 1FT8A 5IM0A 2HGMA 2DGOA 1HA1A 2XNQA 1VBZA 3CC7S 1YWXA 1U1QA 2M4MA 2KVIA 2MPUA 1WELA 5DM7Q 1WI6A 2M8HA 2DNQA 4F26A 4UY8T 3VAKA 1FJ7A 2DK2A 3P6YC 3RW7A 1X5SA 4IO9Q 2JWNA 2MKSA 3NS5A 5DDRC 5DETA 3VAHA 2MZSA 1X5TA 2U2FA 1SJFA 5FJ4A 1U1RA 3L3CA 1KOHA 1X5OA 2MGZB 4C4WA 1U2FA 4WIIA 2K8GA 2MGZA 3V4MA 3MURP 2PEHA 2GO9A 2RNEA 2DH8A 2DNKA 1U1NA 2XS7A 3P49B 1IQTA 2DGTA 3J7ZT 4Y0FA 2DNLA 2D3OR 2KXFA 2MJNA 1AUDA 3CULA 1OIAA 1U1KA 3G9CA 1FXLA 1L3KA 1N8RT 3H2VE 2KFYA 3LQVA 3D2WA 2HGLA 2XNRA 3TYTA 3VAGA 2KU7A 2DIVA 1FHTA 1SJ4P 1VBYA 1X4HA 2DGVA 2FY1A 1YJNS 2YTCA 1XN9A 5IQQA 3PIPQ 2L41A 3PIOQ 1WTBA 4ERDA 5HL7Q 1DHMA 2DHXA 2EK6A 3JB9k 2E5HA 1NU4A 4WFNQ 2DGSA 2DNPA 5LJ3Y 2KRRA 1VQ7S 2MXYA 3US5A 5MLCV 1SJ3P 2XS2A 2MQNA
chains in the Genus database with same CATH superfamily
3CCQS 3ENQA 3T19A 2WRMA 4N76A 4KH1B 4Q45A 3T3FA 4JI5J 2FPHX 3D7SB 4KPYA 4ZOSA 2UUWA 3QFWA 1GXUA 1FRJA 3UDCA 1ZM9A 4PEOA 4YB5A 4CH1A 3W9JA 3MPUB 5K20B 1V9OA 3L4BC 2NYIA 3QJLA 2XI2A 2ROEA 1S6QA 3QT7A 1N36J 4OI0A 4F3QA 4U7UK 1NH7A 1WEYA 3QJPA 3UDVA 4M63A 5HVFA 1IBMJ 2BQUA 3LP1B 4F4YA 1YX2A 3FQKA 2WOMA 4G6VB 2HHUA 2L9DA 1I6JA 4CWBA 1HI0P 4ECTA 4K7QA 4DV3F 2PD1A 2MEWA 4ZVSB 1FEEA 1HD1A 5CYQB 2M5YA 1FA0A 2HQ3A 4DR3F 5D15A 4DV5F 4C8OA 1S12A 1YRTA 3TZWA 2KI2A 1ICEB 5GAEU 2ZM6J 3MPDA 4RW9A 4A47A 3GU0A 2ASLA 2Q3PA 2CPIA 3CD7A 1G4CA 3KNGA 2VFVA 3MM8B 3HF5A 3QZ8A 3QJJA 4LF2A 1SC1B 3UNYA 1ELOA 2K1RB 2YNHA 2A3JA 3CDWA 4N47A 3FCHA 2RHSB 3KLVA 1SJRA 4NEZA 3OLBA 3I0RA 1CEZA 2DO0A 4B17A 3L7UA 4CLLA 2I2YA 2QZ8A 4LRAA 4CNYA 1WG5A 3VVTA 2JNJA 2QRRA 2CIMA 5KAKA 3CJ0A 4TLQA 4QOTA 2FYXA 4QZVB 3TX8A 2N7YA 4DI6A 3EDQB 1HHSA 4L6V3 2ZH3A 2POKA 3CJSA 2HW3A 4RW8A 1DTTB 2PSZA 3GSDA 1Y3KA 3O5TB 2E5IA 2BR0A 1WC1A 4KYZA 4ZJLA 5JJBA 2WVDA 3ZNJ1 3MM7B 1HNVB 2B5JB 1PAEX 4CT8A 4DPUA 2XI3A 1TL1B 1NHKL 3KLFA 1WC0A 2Z2LA 3PV8A 4I2PB 1T05B 2IBOA 3W64A 3R97A 1DRZA 2VG7A 3KUHA 1NDKA 1JNRB 1U25A 1R8PA 4NCAA 4WK1A 3CB4A 1U2CA 5EUHA 1ZBTA 2WONB 5KG6A 4K4VA 3GV7B 1IKXA 1NKBA 1S0OA 2GVDA 3MEEB 2VJVA 2XY5A 4N77A 3SI8A 1IKWA 1TK8A 1SH3A 4DV0J 2OI2A 4J9UE 2KJWA 5HJXA 4ZCLA 3IS9B 2BEFA 2AJQA 3DU6A 4I6WA 4BS2A 2Z57B 4IG0B 4JI6J 3ZXWA 4NASA 3Q2SC 2M52A 4IDKB 4F8RA 1APSA 1BD6A 2MHEA 1RABB 4RU9A 1J5EJ 2XMAA 4J9NA 1KFSA 5IS2A 4X64F 4F36A 4DV7J 2OIHA 2RS8A 3TUJC 2DXFA 3EZOA 2Y1LB 2HFOA 2NUUG 2HIYA 5BJRA 1TKZA 1TMJA 5B0BA 1QTMA 2HG4A 3V4IB 1X9WA 2C2KB 2J8SA 1J5OA 2YWFA 3MR7A 4XPCA 4OYWA 3KLFB 3S01A 3SCKE 3GFXA 2KVIA 3KJQB 4KBIA 4F4KA 3M8YA 3V81A 2H65B 1S49A 4ECRA 2PMHA 3VTIA 2UUCF 2MZSA 1SJFA 1U1RA 3L3CA 4OHZA 3V4MA 3T1HF 4PAAA 2NPIA 5D6GA 1WDTA 2AWZA 1AUDA 1U1KA 2VV5A 1REVB 5AJ3J 1PBUA 1KQGB 4DZ6A 4ANDA 2V69A 2UXBF 1FD2A 4GMKA 2YWHA 1VHFA 4O4GB 2CADA 3KWMA 4NA3A 1IJFB 5T7LB 2VG6B 3N79A 1Q79A 2ASJA 1RT4A 1O6XA 4DQPA 1VYAA 3ET6A 2FLPA 1Z2LA 1HBMA 1O5JA 4I6AA 4J9MA 1JLAB 1RAGB 3CUNA 3H90A 4WWSA 4JV1A 1DBDA 1OPZA 2OMLA 4LRDA 3GIMA 4DJBA 3PW2A 2HZVA 3TUPA 4QR1A 2HFZA 3K58A 4AL7A 4CLTA 4KHPF 4FKYA 4WE1A 3IMQJ 4PWDB 1L3SA 2CZ4A 2J6UA 3UN5A 1CQMA 4QW9A 1KN6A 2ALYB 3MCSA 3F73A 4AT1B 2ZH4A 3R27A 1B7YB 1LW2A 1FRIA 3NGUA 3NXZA 4FYDA 5GAHU 4WJBA 1DQAA 3GZ7A 2LECA 4LRCA 1I1GA 3R3TA 1B0VA 2KB2A 5B09A 1Q81T 1CC8A 1CS4A 5KOXA 1RWKB 2J7KA 2WAQD 1S5ZA 1ZA1B 1H0HB 3MCOA 1NJXA 1FTRA 2KZMA 2XZTB 2MZTA 4Y34A 3C8YA 1M1GA 1ZETA 1VLYA 2C3PA 3PYEA 3KLHB 2D3O1 1S9FA 1OY8A 1CJUB 1HNWJ 2V9WA 4RUBA 4HT7A 1AFJA 4NXNF 2IVMA 2RU3A 3FRZA 5J2QA 4U8VA 1VQNS 4ZVUB 3Q24A 5DLFA 3JSBA 3MD1A 4ZIVA 4DR6J 1F3FA 3PRVA 1HBUB 4M5LA 4ZVTB 1RAAB 2ZUGA 4NLXA 3RR8A 1HBOB 3W60A 4KH0B 1XWLA 4B3TF 2ZD1B 1N33F 2AV5A 1RSCA 3H5UA 1HHTP 2D69A 2LQJA 1LEOA 4OIXA 3N6MA 3BKUA 1RISA 4RO0A 1WHYA 3PVXA 3UDLA 4UF4A 1S0VA 2F8MA 1S72S 2FHJD 2XCPA 1UWBA 4GKJF 1UTAA 4ZP6A 3EXYA 4XO0A 1CG2A 4RJVA 1JLBB 4QBUA 1QAJA 2OPQB 5G0RA 3T5LA 3MAAA 1FF2A 4IFYB 3SSRA 1Q8IA 2DIUA 3K5LA 5JVHQ 2E1MC 1HNXF 3FSIA 3HI9A 4LF5F 2E9ZA 1SC4B 4CLSA 3KHHA 3SV3A 2ASDA 1UZHA 3A3PB 4Y00A 1KVKA 3KG0A 4WFBQ 2G1DA 3D1QA 3DXSX 5KFQA 2DXDA 5I4MA 3OLAA 4FBTA 3MMJA 1NMEB 2DHAA 5KFKA 3OUYB 3NG8A 2J0XA 2KDOA 2XB2D 1UVLA 5DGBA 5DZ7A 3TRGA 4ED4A 5KT6A 1MU2A 3NMAA 2J9DE 1RWXB 2HS0A 4P75A 4ZDNA 5E0OA 2BM1A 4NLTA 1GTHA 4OYOA 2GAHC 3M2RB 3BQ0A 3PEJA 5F8GA 3HKZD 3DRRA 2QIFA 3RJMB 1KQSR 3HPOA 5ETNA 2DB1A 1SJQA 1FFGB 3EXCX 3BEGB 2J9DA 1UFLA 4R5PB 4AFFA 3L7OA 4OJ3A 2BRLA 2NXEA 4LBHA 3BGRA 1WC3A 1KKHA 2U2FA 1FKOA 3TA1A 5HQLA 3RB4A 3W1YC 2AX0A 3VVUA 4MAKA 3FJ2A 1TTHB 1S9GB 3OR2B 5EWFA 3P49B 2FVCA 3FRYA 2BW2A 5B0EA 4Y0FA 2DNLA 2KXFA 1T95A 4Z7YA 3Q8SB 2C2OB 3H2VE 1PCAA 3BREA 1DJ0A 3G8QA 4P2FA 4RWXA 1XMOJ 4X62F 2YTCA 4W4MA 2HK2A 2L41A 2XMMA 4ED6A 2EK6A 4EBDA 2E5HA 4F0HA 4WFNQ 1Q95G 2MXYA 1NLKL 4CDIA 4NEYA 3ETOA 3JYTA 2HRTA 3W8PA 3DCAA 3MTJA 2VJUA 3VAJA 2C2EA 2MZJA 4RNHA 2DR8A 5KT7A 3H2UB 1LWEB 1RT3B 5IZHA 1NDLA 3CGIA 4ZPBA 2RQMA 2BRKA 2DTJA 3SBMA 1TL4A 1UPPA 3IM8A 2YH0A 2WZ1A 4Q7AA 1F60B 2BOAA 4ETXA 2MLXA 3KLIB 4A8KA 1NJWA 5EDWA 1R6YA 1T8EA 2MJUA 3QGGA 3OSNA 1V3SA 3GQCA 2XMKA 2V4JA 3A13A 3J80Y 4J9VA 3MCNA 2JEFA 4JYAF 2XWXA 1R8HA 5J2PB 1JWWA 2QLFB 4OV6A 2UVVA 3IA0A 4HDGA 3MM5A 4ZVPB 1EKRA 2DRBA 4BWMA 2YNIA 2A2CA 4ELUA 2KRBA 3M2VB 5IT0A 3GJSB 4B3MF 4WZMA 5LXRA 4GRSA 1Q8KA 4Y2MA 2WTFA 5C42B 3ZNUA 3OW2R 1A6LA 3UW1A 3CMQA 1UW9A 5C24A 3FZBA 3CCUS 1HR0J 4LF9J 1NKCA 3DOMB 4RPFA 2G2YA 3A8JA 3UCGA 2F4VJ 5HAOA 4KO0B 4IRDA 2NXCA 3V2UC 3QIPB 3EVWA 1S4EA 2JLFA 3W2WB 3ZZRA 2DH7A 3EUNA 3ENAA 3D3CJ 2A10A 1SH0A 1WJ9A 3EZUA 3JTPA 5E3PA 3DHWC 1M5SA 1Y4ZB 2YBVA 1F1BB 5M2PA 1P27B 4CLFA 2H3EB 3G96A 4CO3A 4LSZB 4YB7A 2LEPA 2GFFA 5L46A 2RE1A 2ROPA 2XSFA 2IC3B 3OVSA 4L72B 2CWKA 3HULA 4OLPA 3DLEA 3IP0A 2RU9A 3BR9A 3BYRA 2CG4A 3MEDA 1RAFB 3RTVA 3UPFA 2LQ8A 2R7VA 1K8AT 3TJ9A 3C6TA 3FEZA 3QAEA 2IYGA 3PKMA 2O1PA 2HFNA 4H4MA 1URRA 1FJGF 1NPRA 2DYAA 1KC8T 4EU0A 1CJKB 2V4QA 1FO1A 2WW4A 4X84A 4NPOA 2DRAA 5CABA 3E01A 1KRPA 2FHOB 1UZDA 2QLJB 3RRGA 4UOHA 1U0HA 3GCXP 4B3RJ 1XC9A 2UUTA 4NLWA 1FRMA 3RBDA 1ZTWA 2E29A 4FPIA 3DLKA 1FI4A 3AQOA 1R0AB 1HFEL 3EDRB 2VKZG 4DU7A 3CEDA 6FDRA 4FF3A 3LF0A 5D78A 3R2CJ 3DI6A 2KT5A 1NZAA 4LR7A 3GV8B 1CVJA 3LP2A 3HD2A 4FS2A 4DQRA 1TKTB 2IMOA 2XZWA 4UW2A 1VQ5S 1D9AA 4ZCMA 2UU9J 5CZVA 2BUNA 4WKYA 4JI3F 2KN4A 1RUSA 2QLBB 2AQ4A 4H4OB 4K59A 4RBTA 3CC7S 1YWXA 3IFEA 1ZPVA 4QIFA 2OPPA 4F26A 5E3QA 1N5YB 5H9EJ 2YY3A 3T1YJ 2RH3A 1BQXA 2C3YA 4ELVA 3J81U 2QL9B 3OHBA 1U48A 4IG3A 4D3HA 4ZVOB 1IR2A 1U1NA 3GIRA 2HNDB 1RHJB 5ETTA 3RUBL 5HBMA 3NAIA 4EMDA 1SC3B 2GC8A 4ZPCA 1PILA 5LMUJ 2CNOB 2W8LA 4NLRA 2WHOA 3MMCB 1FRKA 3CWJA 3US5A 3TQEA 3ILIA 1NHUA 3QO9B 4HACB 4DX8H 1H2UX 2UXCJ 1CJVB 2ACYA 4DPTA 3MFIA 2UZAA 3BO4A 1FK9B 1ZAVA 1MSWD 1XMQJ 2Q66A 3W8GA 1VQYA 4FN5A 4PR6A 5LMNJ 1TL7A 5E3CA 2VDHA 4ICLB 2CQDA 2FY8A 2LU1A 4NLGA 2JJ4D 1SKSA 3ZFVA 2ZHBA 1IR1A 3CDBA 4U96A 3O6QA 4ES2A 4DPYA 4DL3A 4F4AA 4F3OA 2VPXB 1VCTA 1UWAA 4EEYA 3LH2S 3OVBA 1Q4RA 4W98A 4FXWA 2FVQA 1S1VB 4QWDA 4IRCA 3H5YA 2QA2A 2R9LA 5HVGA 3QRPA 1S79A 3DRSB 3BF4A 1IJEB 2MY7A 2DVIA 3TVKA 1F9HA 1U1LA 3DDIA 3FCVA 2JVOA 3R1LA 3IWNC 2LXFA 3MM6A 1RI7A 1RT6A 4URQU 4DOZA 4Z7CA 3ILLA 4OYPA 2BJ1A 1H98A 1UETA 2W24A 1NK5A 1V5VA 1X4BA 4JI1J 1U1OA 3BQ1A 1C0UB 1MWZA 3H20A 3VF0B 3NBPB 3VAIA 3UDEA 1QY7A 2W9CA 4MIAA 3PJ9A 1NPPA 4ZCIA 3GG1A 3CJ8A 3HHLA 2ZEJA 5KFHA 3BZQA 2Q43A 2MDAA 5J2MB 3GJQB 1NHVA 3U7JA 2E1AA 4QIWD 3AXMA 2Y1RI 1OSDA 1ZAWA 3FKBA 4N8NA 5SZTA 4DV4F 2W2NP 3JS9A 1Z1ZA 2DKOB 2CQPA 1FRLA 4LF4J 3CCSS 1URNA 2COLA 4RWWA 5J1EA 4ILRA 2LEAA 2UVWA 1E6VB 3IG1A 4C2MA 2PFDA 1S76D 2X7IA 4YUDA 4PQUA 1S6UA 4WFYA 5F8LA 4PG5A 1H74A 5IXUA 1HHQA 3MPVA 5K14B 3TEGA 1QVFR 3HMJG 4CP5A 3HCXA 3DRPA 1T9TA 3ETMA 1DQ8A 5EN1A 1VRTA 4QIEA 4K5SA 5HLFB 1VIXA 4R0JA 2DGQA 4DUTA 3CC4S 1BY9A 3J7YI 2XWYA 4YB6A 2V2ZA 3LGHA 2CJYB 2KM8B 3BV8A 5IT4A 4LVOP 2O3DA 3A4TA 3P5TL 1RU2A 3IRXA 5HK4A 2R7WA 1OQ3A 3H0PA 5BYQA 1R7IA 2GAGC 3KLEA 4OZ0A 3WIUA 3N5FA 4F3MA 4WYLA 4NX9A 1S6PB 4NYZA 5KG2A 1YTYA 3G2XA 2IY5B 1Q7YT 4LR9A 3M6VA 1X5PA 3KTQA 1Y5NB 1CBKA 4PZVA 2BABA 2ROGA 2EEYA 2W9BB 4AQYF 1GNKA 2YWEA 4PG4A 3I9ZA 4WP3A 1NXIA 2OSQA 1IKVB 2O01C 4LJMA 1K9MT 1FFWB 1ZZNA 1OYDA 2CQ3A 2E1RA 2W2PP 2EFOA 5CZXA 1VBZA 2M4MA 1UL3A 3FZ2A 4ETZA 1KQFB 2AIRB 4UY8T 1EAYC 3I0SB 1YKWA 2ZNYA 2HQDA 1VRTB 5D4NA 5KG7A 5F0WA 3PG9A 3M8PA 4C8KA 3SIPB 2XLKA 4NI2A 4JI5F 2BJ9A 4USHA 1H38A 2B56A 2C2RA 3W5ZA 4F7VA 1OIAA 3OHAA 3G9CA 4USVA 3LQVA 4GVLA 4LREA 5I3UA 3D4JA 4ZS6A 2PGCA 5D4LA 3TARA 1N34F 2M3DA 2PFFB 2ZE2A 1CJTB 2DR6A 1DFDA 4Y28C 1N4LA 2JH3A 2AEFA 3C46A 4QCLA 3M32A 5KFVA 3PR5B 4LMZA 3IBWA 3DDNA 3QIDA 1EARA 2MQOA 4DEZA 4U67Q 3RG6A 3GV5B 1RBOB 4QU6A 2HHWA 1BHNA 1A7GE 1WDDA 4BC9A 4WBFA 4A46A 2OJ3A 1VMBA 2E9TA 1QDUB 2ZM6F 5IV4A 1MMNA 2IJFA 3D9BA 4KRWA 3CJKA 1LNQA 3OTBA 3T6BA 3B54A 3C16B 3A3NB 4X4OA 3HT0A 3BH7B 1GK8A 4JOUA 2LQ9A 3GB0A 4BDPA 2JSXA 3RRKA 1RJJA 1FKAF 3DXBA 3S1TA 4ZHRA 1SC6A 4N8OA 4EK2A 3IAM9 1J27A 2EG2A 4OX9J 1UJ6A 1M90T 3K0JA 1ULRA 1DURA 3CO9A 2CNKB 1FRXA 3HFKA 2H5IB 1RLDA 2IMWP 2EBEA 4NI2B 2GHVC 4CO1A 5KFSA 3MDFA 2Z56B 3KUEA 4UY85 4ZN1A 5KT3A 3P45B 2B4VA 4C8YA 4OYXA 2L08A 2LXUA 2PE8A 1S9EA 1LK7A 2BKPA 2FC9A 3Q23A 2DHHA 1MMLA 2ZBPA 3D0GE 2BE2B 3N0VA 5KT2A 3H40A 4TYBA 4CH7A 1S7HA 2LQ5A 1T03B 1VQ6S 3IO1A 2ZE2B 3DLBA 4OHVA 4USIA 3MGJA 2FC8A 2WK4A 2R7TA 2VA2A 4K50A 3PNIA 4FF1A 4ZLJA 5KG4A 2VFTA 1DLOA 3LTOA 2GGPA 1N5QA 3KLGA 3LALA 2BYCA 2HEKA 3GP9A 3GYGA 4WU3A 1W2IA 2IRXA 4X65J 4DR2J 4HR2A 3M9NB 2GS8A 1H2VZ 2V63A 1C1CB 3NLCA 1RTJA 2HHHF 2UUBF 2K3KA 4I69A 4I67A 2XBPA 3OL8A 2UP1A 3GSIA 2VF3A 2HFSA 2KXHA 3QRRA 1FTCA 1I3OB 1W7WA 1N6QB 2CQ4A 4URGA 3NWGA 3DGPA 3HVWA 1B0PA 2QO3A 4G1QA 5EWEA 4O44A 4X4TA 1JKHA 3FBFA 1KWMA 3GIJA 4DL4A 4J5OA 3OR1B 1H7WA 3CD5A 2DHGA 1RT1A 4DV0F 5A8RB 2GQCA 5HP1A 4M94A 5DLGA 4CLYA 2ZJQQ 1KFDA 4ED3A 2CQ2A 1FXRA 5ETPA 2R2SA 4B08A 2QYCA 1V3RA 5C25A 5CYMB 2L3MA 3BDEA 3RBZA 4OMFG 3QFHA 2CRLA 3KK1A 4DQIA 5A8KB 2D7SA 4KAIA 1J5EF 1BWEA 3IAS9 2XG8A 5CHCB 3KG1A 1I94J 3UQSA 4TU8A 2DHSA 1GXLA 1VQOS 1GEHA 5A6WA 3FDSA 3M6WA 2GVZA 1WOPA 2R42A 2E5LJ 1N32J 2XC9A 1GX5A 4XDCA 5IV3A 3ISNC 2KZZA 3OTCA 2DNHA 4JI2F 4V1Ak 1JLFB 3ZTSA 3M30A 3KK3A 3M9MB 1KQKA 1HBNB 1SI9A 2U1AA 4USKA 1GFWB 2F9DA 1FDBA 3OTOF 1VGYA 4M8LA 4AYBD 3PTWA 3PO5A 4FNHA 1YQHA 3LAKA 4USMA 4C8LA 2G2ZA 2ZFHA 1VQ4S 3BGFA 3TNVA 1T3OA 4WK3A 2YKNA 3FBBA 5IM0A 4ZN3A 4NRTA 4IR9A 5B0CA 2DK2A 4DX5A 4UOGA 2VIHA 2BKOA 4DR1J 3WQPA 2CFXA 4WIIA 2MGZA 1Q8BA 4NCGA 4WTYA 1YJTA 1VIOA 4F2RA 4GVBA 1BQNA 4OYAA 2VFUA 1HNZF 2PC6A 3KK2B 2DEIA 1L3KA 3QT5A 1BLUA 4J9OA 2HQFA 4OI3A 1TK5A 3RB6A 3VAGA 3PKYA 1SJ4P 4JV5J 4ERDA 3G82A 4HLBA 4J7CA 4P74A 2B4OA 3HKWA 3NWRA 3H4BA 1JLGA 5B08A 2DCLA 4KHRA 2LKZA 1RYSA 5D0RA 4ECYA 5LOQA 1AB8A 4CO2A 1WC4A 1R3NA 3BJYA 1FERA 2CQGA 5F8NA 4H4KC 1OO0B 1RT2A 1S97A 2C2MB 3EYZA 2W4CA 4ECQA 1TV6A 5HO4A 1QTNB 3PACA 1H73A 3HVTB 2Y0SD 1QUVA 3RAMA 3UR0A 2MZQA 1RWMB 2V2VA 2W2OP 2E7XA 4QW8A 2YKQA 1FVSA 2LA6A 3DKDA 1AUSL 2QX0A 4NLUA 4CI0B 2IDEA 4UUXA 4HHUA 1H72C 3L9ZA 3FVYA 1F6TA 2A6OA 4PWUA 2HSEB 4NL5A 5KFTA 4DLEA 1FNXH 2QTWA 1MROA 4EBEA 2IIHA 3WC2A 2CZ9A 2UUAJ 4B9TA 3TX0A 3EX7B 2UXDJ 3LP0B 1QAXA 1JXLA 2UV8A 2CQHA 5GADI 3Q2TC 3DOKA 3IR5B 1EETA 3BQ2A 1SVDA 2V6AA 4ZITA 2HFUA 5B0GA 4QPTA 4RLEA 3GIKA 1PYSB 4NXMF 1K44A 3AD9C 4LF7J 2MSSA 1ZH5A 2XY7A 2HAFA 3PRBA 2ZUAA 2HMIA 4QYZK 3QBCA 1Q16B 2P9GA 3ZZPA 1FWKA 1SKRA 2F65A 3R8YA 5D8HB 1LXJA 4BCAA 3LPEA 3D28A 3ZZ0A 3BSOA 1GMUA 1TUWA 1V6HA 3QLHB 4J9LA 3WX4A 1QAYA 3MMAB 4UQTA 3OPKA 1EZZB 5IC6B 1EHWA 2W9AA 1HQEA 2FIUA 5FDLA 2OELA 2WW8A 5K5MA 1C4AA 1EIYB 3PDNA 1HWUA 2ZH2A 2J0QD 5F3TA 2NUHA 2BANB 3DN9A 5A0YB 3MECA 2IA6A 3TW0A 4LSLA 4B3OB 4EYIB 3RYLA 2QFIA 2N82B 3OL6A 3N28A 3D66A 4B9UA 1FKPA 2Z0GA 1HPZA 2EWHA 5LT5A 3MUVP 3G71S 4CLWA 2MKIA 1PSDA 1O8BA 3PW5A 4DV3J 5FD1A 1RTHA 4ZPDA 1H3DA 4DUZF 2E5GA 2DNRA 4J9RA 2B8PA 2L9NA 5E33A 4Y2KA 1TP7A 4LBPA 5DDQC 2FZCB 2P6TA 3CJ2A 1EKSA 3PM9A 2KO1A 5B7WA 1BQMB 1HWIA 5L1LA 1VRUA 3K5OA 3W9IA 4DV5J 4DR3J 4OI4A 5HROB 4RW4B 2UVUA 1XR7A 4KPCA 2VPZB 2PA3A 4OLOA 2C28A 4ZVGA 3P5BP 2HRUA 2DNOA 2OUGA 2RKIB 2LQBA 2JC1A 2CUYA 2WBMA 4FYXB 2OTLS 1DTQB 4EWTA 4WFZA 3SDEB 2OAUA 5A8WA 1OY9A 2OFGX 2HKEA 3BN4A 1UA1A 1N5TA 3UD4P 2KJVA 4TLRA 5JMNA 1JX4A 1RK8A 1SJ1A 5DRKA 3ZC4A 1B7FA 4K5RA 1KONA 1XMOF 1Q8LA 4LF8F 2VG5A 4XK8C 2GMHA 3G6YA 2YKMB 4UUWA 4I2QA 2HBRB 2QSWA 2J6TA 2R8GA 1IWAA 1F2GA 3JAMU 1S1UB 4E2FB 2RRNA 4BBYA 1JLEA 2EC2A 4AUKA 2IJNA 1SCJB 1EP4A 2V8HA 5B0AA 2D3OR 1N8RT 1U7LA 3Q0AA 2AGQA 4C48A 2DIVA 4PCQA 1TL3A 4QR0A 1YJNS 1VOMA 5EX3A 3TAQA 1DHMA 1SQFA 4PXCA 4KV8A 2VQEF 4QJVA 2XS2A 2MQNA 4ZIWA 4WFAQ 4CTAA 1S48A 3TA0A 2G4BA 5GAEI 5L1JA 4C11B 2QL7B 4PUOA 1C0TB 4HHJA 2GQQA 1PC5A 4RUAA 3MAQA 4MKAA 1C1BB 1YGYA 3RZAA 5DG8A 3J80U 4EZ9A 2M9KA 3JTNA 2W4PA 5DQHA 4O3PA 2XHWA 1E6YA 2LCWA 2VASA 5HN0A 1YJUA 1LV5A 4C3LA 1NKEA 1NDCA 5L1KA 4Q0BA 4F04B 2J76E 1UW4A 3DOLB 4ED2A 2LP4A 3K59A 3AOAA 2A6MA 2VD3A 2F7VA 1HMVA 2E1CA 2XMWA 4NMLA 4M5DB 1RWUA 2BJ8A 4KGZB 2OPSA 2HZCA 1WUUA 2FJBB 2IM1A 3LANA 4DPXA 2X51A 3CJTA 3IBCB 2OHDA 3N6NA 2CJAA 3G87A 1HR0F 4LF9F 2CQ1A 1T9UA 1H2TZ 5B0DA 4QWEA 5LL6d 1RLCL 3FFIB 2F4VF 5KFOA 2IYIA 5H9FJ 2KM8C 3Q83A 3LPYA 2KL8A 2EFQA 4C0BA 5D4PA 1XJWB 2UUCJ 2V34A 4ZVHA 5K8MA 4YR2A 3DRXA 3DHXA 1RT7A 3V5RA 2FJWA 1SXLA 3T1HJ 4UZBA 4KKOA 1JK9B 4Q2MA 2I38A 5L39A 3CD6S 2HYIB 3DMJA 3PO4A 2LXIA 4IFVB 2Q1LA 2MKHA 3NGTA 1LWFB 4OZJA 3NS7B 1T9VA 1C4CA 3ENVA 5DJBA 2LYVA 3DDKA 3SZ2A 2HNZB 1RB0A 4M5NA 1AZSB 1H7XA 3DM2A 2HNYA 3HHLD 4OYZA 2ZDOA 2MLYA 3W65A 4RW6B 2RF2B 2F8EX 4MYTA 4NLSA 2GA7A 3JTOA 2DNNA 2RDDA 4C3KA 3C6UA 3WC0A 2HPUA 1IBLF 4UZCA 4WZQA 4L74A 2E9RX 3K5PA 4OZ5A 2ZNZA 4X4RA 4DS4A 2LDYA 1UA0A 2B6AA 4X4PA 4B3RF 1MW7A 1CULB 1RWVB 1N5VA 1LW0A 2ZWOA 4J37A 1X4GA 3KJVB 1FFSB 4TY9A 1R27B 1BC6A 2V67A 3ZZZA 3BGUA 1SUQB 2HS4A 3THPA 2J7UA 2OD6A 4MFBA 1GX6A 2BJ7A 2YKPA 2V68A 4IH6A 1T9YA 3JQJA 5L8RC 5J2NA 5G4DA 3T9ZA 1VJQA 1U6ZA 4ENOA 3TOQA 1KDNA 3WZ0A 1JLCA 3HLUA 1D09B 2EI5A 4JV0A 1RTDB 1MMDA 2AYEA 4YY3F 1RADB 3D3BJ 2DGWA 2IPOB 3JSYA 1S1XB 1O0PA 2P9CA 3CCWA 2CPZA 4ZP7A 2VOOA 4A8QA 1S1WA 3IM9A 4UOFA 4U7CA 2AGPA 2EKNA 5F3ZA 4NXNJ 3KG4A 4HEA9 1WI8A 3C15B 4IH7A 1M5KC 4C8ZA 3ONQA 1TVRB 4ELTA 2V8VA 2HHTA 2RDJA 2YNFB 2DGOA 1JXEA 4RZRA 5CCLA 1K47A 1NDPA 3C14B 3FNNA 3RW7A 4DL2A 2JWNA 4B3TJ 1N33J 1LWCB 4OL8A 1RXOB 3V6DB 4KFBB 2FLLA 3W2VA 3POTB 5ETVA 4YFUA 4GC7A 3MM9A 4K4TA 3DLGB 2ALZA 1K0VA 3ZZOA 5BXIA 5C7PA 2KU7A 5D4OA 4LIWA 2DGVA 3I87A 1HI1A 5IQQA 4JI0J 1NSKL 1DAXA 1U47A 5I42A 3TAMA 5HL7Q 1L3UA 3SQGB 4CLZA 2IAJA 1SKWA 1C2PA 1VQ7S 4FXDA 4QYZJ 2EXUA 3R2DJ 4KGXB 5F8JA 1TR0A 4JP8A 1HNXJ 1G2EA 1VDHA 2RJZA 3VGVA 4LF5J 2OLWA 2QMUB 1YJWS 4M5HA 1B64A 4R8UA 1KLMA 4LF6F 3BGLA 3PHTA 5JXSA 3MFHA 4YHHF 1S6QB 4MIWA 3SXLA 2F1FA 3KHRA 3ZTPA 3MR2A 2C3UA 1UVJA 3J7YU 7AT1B 2UV8G 1HYSA 2WOMB 3G4SS 5T41A 2JFDA 4CO0A 3UCUP 1UP1A 1FCAA 3UVJA 4E98A 1ZS6A 4IR1A 2EBGA 4YP3A 1TAQA 5LM7E 5M2UA 1QE1A 2F8HA 5LSLA 4L76A 1R8BA 4MK9A 4RNFA 2GCFA 4DG1A 2B8QA 1X8DA 3K8WA 3I56S 5HJYA 2WB4A 4RW9B 5EGYA 2LFVA 1Y00A 1NBEB 4F4XA 1XR5A 2A2DA 2YNHB 3KDNA 2PI4A 5BR8F 3I0RB 2FGOA 1MN9A 4P52A 5DO2A 3KMQA 2CVIA 1U24A 3D67A 4LF4F 2XHCA 1N88A 4A8YA 4Y2AA 3QATA 1WHWA 5E41A 1QD1A 3OTDA 2QGFB 3B8HA 2KG1A 1YVFA 3Q22A 2EW9A 5IC4B 1RT5A 4P7TA 2GW8A 1RKIA 4MT1A 2B7BB 2N4DA 2UVRA 2AEJA 4X62J 4CM2A 5J1PA 1RWNB 1UPMB 2B9WA 2CPHA 2HFVA 2PDAA 3M2UA 3B4MA 4QU7A 4WF9Q 5DGAA 1JLQA 4RW8B 1YBUA 1U45A 2ZBCA 4LFAF 1JNZB 3CXCR 3NCRA 1MWQA 3M4XA 3GFZA 3TA2A 2ZBRA 4ZMMA 4OZ3A 5KFLA 1NSQA 1T9XA 3CMAS 3E8OA 5AXLA 4KJIA 1ZTTA 1UMJA 4OJHA 2ZBIA 3R5JB 3M8SA 4N7TA 4YDDB 1WD6A 1SL0A 2XMJA 2VG7B 3NGRA 5GMKa 4ID5A 1M5HA 4U8YA 3WDOA 2ZH9A 2OSRA 4P73A 1G7CB 1EB0A 4B3SJ 3MMBA 4BHQA 3IWXA 1FX4A 3M6UA 1JQGA 3NGSA 2RQKA 1HQUA 2MKCA 2QMWA 2ZC4A 1IKXB 4P2SA 2GVDB 2XYGB 3HHEA 1RWWB 4CH0S 3Q89A 1R0BG 4O3NA 1ACMB 2MQMA 5CCMA 2CPDA 3DYAA 1IKWB 3S8SA 4NLDA 4I7FA 2J9CA 4JYAJ 5IFMA 4ANEA 2FB0A 3SCLE 1S1TA 4MIBA 4PYDA 3D6FB 3OFHA 2BOPA 1U02A 4DR7J 4KGVB 4DFPA 5F9LA 2QA1A 1RBAA 4TY8A 2CVEA 2I5JA 2GJFA 2V94A 3VGTA 3MEGA 2C2NA 1OSCA 3WX8A 2GMLA 3AJDA 5IQ6A 4B3MJ 4I4BA 2AMCB 3T9NA 4JI4J 2R7RA 4PRFA 2RB7A 2JEGA 3JSMA 3CCVS 3U1MA 1JJHA 2F5GA 1TKZB 5JVGQ 3UN2A 4A8MP 2BACA 5L9NA 1UEVA 1VJWA 1J5OB 3ILJA 3I4PA 3R6GB 2NR0A 4LFCF 2AJ4A 4B9MA 3D6MB 3V81B 2BE9B 4XDDA 4LUBA 1TFWA 4QYRA 1KVJA 1R8CA 3GONA 5AE2A 3I32A 4DSEA 4KIAA 5DETA 2OD4A 2P2CB 1YLXA 3W66A 1X5OA 1F5BA 2NPFA 3BGOP 1V5IB 2GJ2A 5H9EK 1IQTA 3DYAB 4EBCA 1REGX 3VV2B 3FSXA 2GNKA 3NGKA 3W5XA 3M1VA 3UFCX 5E5NA 1NK8A 3V6HA 3BM7A 1RT4B 5LJ3Y 1UJ4A 3ET6B 2FZKB 1HBMB 2RQCA 1QAIA 1FJGJ 5CYJA 3SV4A 4RNMA 2D9PA 1GMWA 2XO6A 5DDOC 2BDPA 5KFIA 2VC1A 3GMGA 1WHXA 4LSNA 2YVSA 3KNAA 5E2QA 1ZM4A 5K8OA 4PWWA 2HLUA 3HX9A 1N5SA 2R8IA 2GHPA 4YR0A 4FYWB 4QPXA 4WE1B 1YZ7A 1TKXA 4YS2A 3I5BA 2XLIA 1IM4A 5D0EA 1JXVA 4LR8A 3ITHA 4KSEB 1LW2B 3VZIA 5GAGU 4OX7A 3G8SA 4DWIA 1NCLA 4P9SA 2OPRA 1U2RA 4OZLA 2OKQA 2DRDA 2DBBA 4CNZA 1S0NA 4YB1P 2XGQA 3PX0A 1CS4B 3NNCA 3HZEA 4DSIA 1VC0A 3PFEA 4DL7A 3O44A 3A1YG 4WIQA 4AE5A 3HFVA 1NJIT 2V5HG 3X3UA 4DF8A 5DDPC 4FF2A 4NA2A 1OY6A 4I64A 4FYYB 3U27A 2QLWA 2WSCC 2F9JA 1VQKS 1YBAA 3UI3A 1XMBA 2F63A 4NRUA 1IBKF 5SUHA 2YQ3A 1PJ6A 5J2QB 4Q44A 3HD1A 3TO8A 2Q6BA 7FD1A 1FRHA 4LQ9A 3LUYA 1H6KX 1RA7A 4I68A 1LFWA 1W25A 2HZAA 1B0TA 2E7WA 3BPSP 4FBUA 3PW7A 2QT7A 3ZTOA 1R6VA 3F0NA 4MMOA 3A8IA 3OD2A 3LOUA 2PMZD 3MUMP 4RW7A 3CTRA 4ID8A 2W7OA 3RBEA 1KTVA 3ZTQA 5K8NA 2J9EA 1UWBB 1FJCA 4PXBA 2Q79A 4ITSA 1IKYA 2EK1A 3NP5A 2W2QP 2H4WB 1S4FA 5G0RB 1N32F 4A48A 2G0CA 4Y6IA 2FLNA 3MAAB 4WP9A 2A0FB 5ADZA 2CPJA 4CYUA 1GAOA 4FVMA 3IN5A 2QE5A 1OPIA 1M1KT 3MR6A 1N52B 2DGXA 1RTIA 2V8DA 1FNOA 3RB0A 3ULHA 1ZOTA 4LFBF 2BX6A 2YQ0A 2HAIA 2ZKTA 3PHEA 5CA5A 3OT9A 3VWSA 1YK9A 5KFMA 2DH9A 3KJFB 4CRJA 3JAMY 2GHWA 2YNGA 2PT0A 1IQZA 1Q5VA 1MU2B 3I96A 1A0OB 4FKXA 5I3PA 4XIUA 4YMEA 5KTQA 3TJAA 4HKQA 4DR1F 2I9SA 2JOQA 3K2YA 5KOWA 2IJRA 4EYHB 5JUMA 3BS9A 1VQSA 2R7QA 1NK0A 1RKJA 1PKUA 3DRRB 1WC5A 2OEMA 4UOCA 2E5JA 3D6HB 1FNMA 4B9VA 1X31C 3R5BA 5GADU 2V2KA 4JV5F 1U1QA 1HNIA 1WI6A 4K4XA 4DV4J 2BW7A 3M8QA 1AYEA 2VU5A 3BGRB 1NK9A 1FKOB 1SV5A 2NREA 2ASYA 3ICLA 4U9RA 2B9YA 4Y3CA 2VPYB 1FWPA 3DFEA 1FHTA 3GYXB 3AOCA 4ZA1A 5KT5A 2PA8D 2FGCA 1NU4A 1VK8A 2GIRA 2KRRA 5KFXA 4DV2F 2I1RA 3TJ8A 4RKUC 2VPWB 4DV1F 1SBRA 1XTZA 3BKTA 4DL6A 2Y1JA 2K7JA 1M0SA 3JYTB 2MZ1A 3AT1B 4X4VA 1KEKA 1HD0A 2EFGA 3HHNB 1D1UA 2ATCB 3TAPA 3MI7X 3KMSA 4DR5F 1JJ4A 4NZ7A 5CXTA 2VH7A 3GPAA 3NNAA 2Z4PA 2QA4S 1X0FA 3LP1A 2UUAF 2BBEA 5DG9A 2UXDF 4CLPA 2JVRA 5KFPA 3FMWA 1WF2A 2CPEA 2V4JB 1KOOA 3J7A1 1WEXA 2B4PA 2RAQA 2JZ5A 2G13A 5CYQA 1AROP 1R31A 4AQYJ 2LDIA 3CCES 3QGPA 1VBKA 3CE8A 2CXEA 4LF7F 3MM5B 2GMJA 4XAKA 1VQ8S 1Y7PA 2YNIB 1KS2A 4C0HA 3MM8A 2QMXA 2K1RA 1XNQJ 4G1IA 2CDQA 2ZWPA 1IWGA 2KXNB 2RVJA 4E8UA 3ZZUA 1FJEB 2DCUB 2HHSA 3VCDA 5F0UA 1NPKA 1PBAA 4O23A 2E66A 3FGVA 5C24B 4HTJA 3T5HA 2LLZA 5B0FA 4O0NA 4GO7X 2WSFC 3H5SA 3K8VA 3OFGA 1P1LA 1WOSA 2MQLA 2AKWB 5LSRA 2KHCA 4DPWA 2IRYA 1N34J 1Y9OA 4WTOB 2FUG9 4EFAC 4WFXA 2VQFF 2X3GA 4CLUA 1NO8A 5CH7B 4X66F 1WSVA 3F56A 2ZH7A 2W7PA 2ZHAA 4ZPAA 1DTTA 1VLOA 2I6WA 1TZ0A 2QEXS 4NLPA 1OWXA 3TUZC 2QA4G 1EJ7L 1U8WA 3HSDA 2R8KA 3BBCA 1B99A 1WG1A 4P7VA 3MM7A 2NZ4A 1HNVA 2B5JA 3ADAC 3DLEB 1X4FA 2D3UA 1S10A 1TL1A 3D54A 4I2PA 3MEDB 1T05A 1JB0C 5IT9Y 2D41A 3C6TB 4ZPVR 1X4AA 1G3OA 3A12A 4H4MB 2JHEA 1RAEB 2WONA 4WP8A 4DHVA 3O3LA 3MZIA 3MEEA 1JMTA 3J7Z5 1VC6A 2LU2A 3E01B 2CQCA 4DCPB 3I31A 3FEXB 1WTFA 4DX6A 4UTGA 1U0HB 1IXKA 1SL1A 3FEYB 1RHUB 3IS9A 4M5MA 2XEXA 1MWYA 4PPZA 5K9FA 4FPRA 4IG0A 3DLKB 1F5AA 1OS5A 4WYWA 4F50A 4JI7F 2IVYA 4IDKA 4QWAA 3AJ2A 4A8WA 2V8PA 3L95X 1RBLA 3DI6B 3GJTB 3BH6B 2XQCA 2BJ3A 3QGHA 3LP2B 3UWTA 4MK7A 1Q1KA 3KOAA 2YWKA 3IR7B 2QG9B 1U49A 4OYBA 4DSKA 5GVQA 3ELHA 4ED0A 4CQ1A 4M95A 5CD4H 4PG8A 3V4IA 1IBCB 2YPZA 2HHHJ 1SKUB 2NZCA 2OPPB 2UUBJ 3OVAA 3JXOA 3AY0A 3MR5A 3P6YC 2CJXB 4RX6A 4PYAA 4PXDA 4IG3B 3VGUA 4DQSA 1RWPB 2K8GA 4YR3A 4MJKA 1DARA 2RNEA 3HFZB 4C6AA 2DH8A 2DNKA 3Q86A 1Q0NA 5DS7A 1P9YA 2K06A 1Y10A 5HBMB 2B4UA 4X4QA 1REVA 5ETMA 2XNRA 1X4HA 3I4HX 4O4GA 3FSYA 4CLKA 3THVA 1MLAA 2FDNA 5T7LA 2VG6A 4JUZA 3GFYA 3T6JA 1SJ3P 3GTYX 2R4FA 4Q8FA 2RUSA 1GTEA 8AT1B 2VKRA 2CQIA 1JLAA 4G65A 1RE1B 2DNZA 4QIGA 1TL7B 1TUVA 2M0GB 3CCLS 1Q5YA 1TU0B 4F0MA 3MOJB 3NCPA 2R2TA 4DFKA 2JLEA 1WEZA 4USTA 2WVEA 1V3ZA 4PWDA 3WHIA 4E0DA 1IN0A 1N56A 4JI2J 4OZNA 4WXOA 2QV6A 4ED5A 3T1AA 2W01A 2DY1A 4ILMA 3A3OB 3T5JA 1P1TA 5ITHA 1P9QC 3F41A 4CIOA 3CDUA 5I3QA 3B78A 3SSQA 1S77D 2PEBA 1YG0A 2MY8A 3OTOJ 1HKAA 2CJ9A 5ETSA 3MM6B 4QIVA 2RIJA 1RT6B 2J5AA 2HQIA 3B82A 1QSLA 3BDPA 2FHKA 2IDLA 2E1PA 5IWAF 4KE5A 1NNDA 4DUYF 1UFWA 1NSPA 1NAQA 4KB7A 4NYOA 2DPIA 2ACMA 4DBQA 1RHKB 3FMBA 3AB4B 4A8OA 2W9CB 3KLHA 5LXYA 4NLYA 4M5GA 1CJUA 3HHLB 4ZVFA 4EZ6A 3PX4A 2A18A 3TZXA 1D8ZA 2Y0BB 4DR4J 2HWHA 8RUCA 5F8MA 1ZPWX 4JBCA 4N5SA 1HNZJ 1M5OC 1FDDA 2Z30B 3QSYB 4OZ2A 1KLNA 2XSJA 3OJSA 1HBUA 4GKKF 4MKVA 3M9OB 3VAFA 1UAWA 2NXJA 1HBOA 4J9PA 4ATNA 2KYXA 4ZVQB 2ZD1A 2RHQB 5RUBA 3PW4A 1ZZFA 2AU0A 5KFFA 1RACB 5J1EB 2QL5B 4K2JA 1UFKA 4K2XA 3IG1B 2WSEC 3M8WA 4PQUB 3MWBA 4M5IA 3EGZA 2R7UA 4AD6A 3J81j 2D9OA 4F0KA 4MYUA 5HANA 3DRPB 1X4CA 1JLBA 3R5GA 1FXDA 1BMQB 3HVRA 1NH8A 2VBXA 4ECUA 2YXLA 2OPQA 1UKUA 4IFYA 3RGIA 3MCMA 4B9NA 2HK3A 1FX2A 1UVKA 2HVDA 2M88A 3TQ1A 2XY6A 2MZRA 2YX1A 3ILOA 2FQQB 3IRXB 3CF5Q 3GYNA 1N36F 2ZOFA 3KLEB 2ZJRQ 2BQ3A 4W92B 2P9EA 3OUYA 1T94A 2MQPA 1IBMF 3MPWA 3VALA 3ENWA 2XSJB 3FBEA 2R3VA 4UT4A 3D68A 2O67A 1XEZA 1PJ7A 2K7KA 4V19X 1HL6A 5CAAA 2R7SA 3BBBA 4FXVA 5F8HA 2J6SA 1DZ5A 3CJ3A 1CQNA 3HK2A 1PO6A 3AFGA 3NGDA 9ATCB 1U0SA 5KFAA 4PKDB 1JIHA 3AOBA 2MHNA 4NXMJ 2NQPA 2HVZA 3M2RA 4NZ0A 2N3OA 3H25A 1YJ7A 1RAHB 2AX1A 4IOAQ 1GQEA 5LJ5Y 2EFPA 3BPDA 2KHDA 4HH0A 2FVRA 2C3OA 2VL1A 3M7VA 2V9KA 3ZTRA 4JI0F 5KG5A 4R5PA 1WELA 4ED1A 3TR5A 5DM7Q 4PPDA 3T41A 4ZP8A 4M5KA 3FBCA 4IO9Q 3M8PB 3O2IA 5FJ4A 3MPYA 2CWXA 2BV3A 2HHVA 4MK8A 2V50A 3R5CA 4DFJA 2YQ1A 2YPYA 3UNGC 5HMZA 1S9GA 3OR2A 1WKLA 2DGTA 3RAQA 4ECVA 2F4FA 3CULA 4D3GA 4ZLLA 2AJ2A 2VDIA 5I3UB 5A2QY 3TZYA 3OXFA 2FY1A 3BSCA 1WNEA 2QN6B 1ZAXA 1HIYA 3AJ1A 3JB9k 1PIEA 4OHWA 2DGSA 4NLOA 2V4RA 4PG7A 5ETOA 1HLWA 2ADCA 4CO4A 4DUZJ 3M32B 3CIZA 1K73T 1YJVA 4CO5A 1L5UA 1Q53A 2OP5A 4B9SA 1X4EA 1FDAA 1PGZA 1UVNA 1LWEA 1RT3A 2JRSA 1Z4UA 3H42A 2KT3A 3NRBA 2DR9A 5DM6Q 3CJKB 3HXMA 5FLXY 4NLQA 4K0KJ 3AH6A 1GMWD 1LFPA 1AW0A 5J1NA 4AL6A 2KH9A 2IRUA 1XERA 3KLIA 2VFRA 5AT1B 4ZHRB 1U09A 3GIIA 3CPWR 3MXHP 1NB7A 3E3XA 2XM3A 2QSFA 4XPEA 1TUGB 2KTQA 2ZITA 2JX2A 2V8GA 4OZ1A 3HJFA 3PJWA 3B6BA 2WBRA 5J2PA 3SEOA 4JI6F 1S9EB 1YJRA 2NS1B 1GH8A 3HHDA 4ZKAA 1VBXA 3EZ5A 4LF8J 3M2VA 2ADBA 2IM2A 3IR6B 2QYGA 1WHVA 1WG4A 4DV7F 2AYMA 1G6BA 5C5JA 5C42A 5H9FK 2C1EB 1XNRJ 4UQGA 2W7AA 4PQAA 4DS5A 3DNCA 4KC5A 3SCIE 5KG3A 2FVSA 1DLOB 3EGNA 1VHIA 2GGPB 3F44A 3MOZA 3VQSA 2FHMA 3KLGB 3MUTP 1CLFA 2NSCA 3AA8A 4HTIA 3BKFA 3DOMA 4Q43A 2HS3A 4DV6J 3CW2C 1RTJB 4KO0A 2F3JA 1A9NB 1YHQS 3QIPA 5KFUA 2ILZA 1L3VA 4A4JA 4H4KA 3W2WA 2XZDB 4K4ZA 1G1XA 2JC0A 2OH2A 2HWTA 3C66A 2VQEJ 2JEJA 4OFZA 4B3SF 3LA0A 2ZH1A 1RHRB 1QSSA 2CG8A 4DZDA 3CJ5A 1Q78A 1U6BA 5C2CA 1ZM3A 3K7RA 4TU7A 1NJYA 2MQ8A 3DGPB 5AE1A 2HWIA 3H7HB 3MTKA 4G1QB 1VK3A 4O44B 4TU9A 1JKHB 1TMMA 3VHQA 2AJ0A 2VBZA 3NNHA 1B3TA 5AJ3F 2IC3A 1RT1B 5HP1B 2H51B 2KFZA 1RDRA 5H1SV 1CC7A 4BWJA 3B4DA 2OGUA 3A8EA 2HHQA 4A8SA 3N6LA 2NXUA 4C9DA 3EMTA 4WPAA 1VQMS 4YDXA 3TVZA 3AA9A 2W2MP 5C25B 2GQ2A 3SFGA 4DR7F 2KVQE 4LRBA 2ZBQA 1X7VA 2LVWA 3X1LB 3KK1B 3CNQP 2FJAB 1CJKA 5CD4A 4I1TA 2PO4A 2GZOA 3I55S 1I51B 4JI4F 2CPFA 1RU1A 2PN6A 2GVZB 5KFZA 2VZ9A 4ALZA 4DU8A 1NM2A 4K8RA 4DSJA 4KR0B 5DZ6A 2GJIA 1R0AA 5KFEA 2BMBA 3HO1A 1SH2A 1RHQB 3M30B 3KK3B 5A76A 3OFFA 4J91A 4C98A 2ZOGA 3CJRA 4P2MA 4HI2A 5HI7A 3OBIA 3CCRS 4O0IA 2GO8A 2BA9A 5KG0A 2AJ1A 3OFEA 1TKTA 4DSFA 1U4BA 3EWGA 2CKWA 3J7AN 1RAIB 3PRDA 3VZHA 1TAUA 3U1NA 2HVEA 2RT3A 3TWZA 4ECSA 3V6KA 5M2RA 2YKNB 5IM0B 1TK0A 2Q6CA 4WCEQ 3A8KA 4H4OA 4KGKA 1NK7A 2M8HA 3AODA 1S59A 1R43A 3W7BA 3VAKA 3R5AA 3OL9A 1N5YA 3HVAA 1HNWF 5DDRC 4F4WA 3VAHA 5HVHA 2MGZB 2XULA 1U2FA 4S0MA 1WC6A 1S6OA 2ZZTA 2GO9A 4NCGB 4RR5A 4ZJOA 1QUPA 2AJFE 4GVBB 2XS7A 1BQNB 1D8YA 1YBTA 4FZVA 5HMXA 1IBLJ 1FXLA 2HNDA 3OJUA 3TYTA 2Z2YB 2XLJA 4DR6F 1WORA 3NL0A 2HLTA 1Y5LB 3PJXA 4ECWA 3K17A 1S7IA 2DXEA 3G82B 1EX8A 1BE4A 3MMCA 3Q8VA 4DDFA 3G6VA 3EICA 2C2ZB 3PCOB 4CZCA 1JLGB 1RP5A 4CM0A 3RB3A 3QO9A 4HACA 3MAHA 3QT8A 4USJC 5AXMA 3LGNA 3UD5A 1CJVA 1FK9A 2OFHX 4DFMA 3JSRA 1RT2B 2IHR1 2H48B 4OJGA 4ICLA 4JI8J 5KFBA 1K1SA 1TV6B 4Q8EA 1YRXA 3CJQA 2B7CB 5D0HA 4YY3J 2VB6A 1S1VA 4IQXA 3KUGA 1KSPA 3UD3P 4L73A 5F41A 3RW6A 3DRSA 3OL7A 2OTJS 2N7CA 2SXLA 2NXNA 2AZ1A 2B9XA 2ERRA 2NCKL 3HDSA 2WVFA 3FCWA 1NB2A 1VI7A 2B9EA 2VONA 2ZZMA 2QJ3A 2KT2A 3AB2B 3D1OA 1BGXT 4IOCQ 1R0CB 2DR7A 2CDRB 2ZC3A 1ROFA 1MROB 5ETKA 1VRQC 4Y2IA 8ATCB 2VA3A 1C0UA 1F5CA 4IO1A 1KBRA 1WSRA 2HVHA 1WF0A 4KT0C 2X1BA 3NBPA 2XMUA 3DOKB 2MKJA 5GMEA 1EETB 3E2EA 2MYFA 1NUEA 1WKJA 4J90A 1W26A 1WOOA 2X1GA 1WWHA 3CCJS 4M5JA 1B70B 2CQBA 5J2MA 2H4YB 2HMIB 4ECZA 1TFYA 3WBZA 5EHHA 3AD7C 2J0SD 1VISA 2OMOA 1FE4A 3C19A 3CCZA 4YEAA 3KXDA 3EPGA 3W61A 1HQEB 9RUBA 5FDLB 3CVKA 3FK4A 2V2QA 1YITS 2ZH6A 5KT4A 2VODA 4K4YA 1E6VA 5E7OB 2EC0A 4Y65A 3SQOP 1LQ9A 2FJDB 4YQWA 4LF6J 2JL9A 3MECB 1NJZA 3G6XA 5K14A 3LGMA 3GILA 4YHHJ 4LSLB 1GMVA 3QT6A 4LQ3A 2MQQA 3D0IE 2MKYA 4L3NA 4WU2A 4DX7A 1FKPB 4ZPTR 1HPZB 2M8DB 2P5VA 5BYSA 3DLLQ 2LEBA 3H98A 3N4WA 5HLFA 2P6SA 1RTHB 2D1CA 5FIIA 2QFJA 2XYHB 5D3GA 1WKKA 2DNYA 3MD3A 4USWA 3PW0A 1M5PC 1VRUB 4WKRA 5ETLA 4YOEA 3IRWP 3PEHA 3P96A 1LOUA 2KG0A 1ZYQA 1IUJA 1RTZA 3PFOA 3O1LA 3G6ES 1YI2S 4C3MA 3RRHA 6FD1A 4X4UA 1Z2ZA 2ZOMA 1JJ2R 4IRKA 1S6PA 1QVGR 3IXQA 5BR8J 3OV7A 4NYPA 4ED8A 1SB6A 2BZ2A 3EE3A 3IGVA 1XK8A 1KHWA 2O66A 3FQLA 2EPIA 2ZZNA 1MG7A 5A8WB 4JV2A 3P4UB 4W90B 2O5DA 2N4CA 2W9BA 4J9SA 1RAOA 4QWCA 2H5JB 3DLHA 2DNGA 3S7RA 1IKVA 1F9EB 3N01A 2CQ0A 2BQRA 3ISZA 3W62A 1R8AA 1QSYA 4DL5A 2VG5B 3RR7A 3R7SB 4ZP9A 2DNQA 1VR6A 3C2PA 4X64J 1ITPA 3I0SA 1ZA2B 4I2QB 2H5EA 4KHMA 2CYYA 1UJ5A 4LFAJ 5A6PA 1JLEB 5D3GB 1EP4B 3MR3A 2MJNA 3TI0A 4ZK7M 3H2LA 4P10A 4QWBA 4ZLPA 1TL3B 1VBYA 3IWLA 4ZLNA 3HHLC 1WTBA 4NWBA 1IM6A 4L3KA 4KV8B 4NCBA 1T0TV 4OI1A 4CTAB 2G0IA 2NSBA 2I0XA 1CJTA 2XCAA 2R7OA 1M5VC 4IQMA 2DISA 4PUOB 2HHPA 4QR2A 3Q8RB 3HP6A 3PY8A 3P3DA 3Q8YA 5KG1A 3OQ2A 2MB0B 4X4NA 3DGVA 2UXBJ 4C8MA 2E44A 1S0MA 1HI8A 2J8AA 5KFJA 3ZZTA 4R0EA 1E6YB 3GCWP 4I0WA 4OYIA 4Q0BB 2FJXA 3C16A 1BWVA 2RQ4A 2VFSA 1BUXA 2AP6A 3SMZA 3TZZA 1XNQF 4IOBA 4I6YA 4B9LA 5HATA 2MTLA 2XMTA 5D77A 1HMVB 1OQ6A 3EPIA 3PZPA 2OPSB 2ATLA 3CJ4A 3G86A 4U95A 3BR8A 2K2PA 1Y5IB 3PYFA 2B3TB 4KHPJ 2XYPB 1XBWA 1X9MA 4F25A 1KNZA 3ZZYA 2XGPA 1Y11A 1D9DA 2EFVA 1B4SA 3TVYA 4LFCJ 1U1PA 1DQ9A 1PYTA 2BE2A 3RU0A 2QC3A 3CO0P 2W4DA 4PABA 2WB1D 2ABYA 1T03A 1KVIA 1RT7B 2YH1A 3R1HA 3W3SA 4P72A 1VQPS 3C3LA 1MNEA 2AHOB 4LIRA 4KKOB 1UEUA 5HMWA 3I6PA 3UCZP 1T11A 3DMJB 4RBUA 1RCOB 4OX6A 1R89A 3UN3A 2UU9F 3JQMA 2CNLB 1RYRA 1C1CA 1YIJS 3HSJA 3DM2B 2DT9A 5IT9U 2HNYB 4ANCA 3T1YF 4FVCA 2QLXA 3I9V9 3KHLA 2X1AA 1N6QA 2KYZA 4AXIA 2YWGA 2FJVA 1W2BR 4V19J 4IUFA 5L38A 3OSPA 4X4SA 3C6UB 2Y8YA 3PYGA 1MN7A 2GIFA 2F40A 3OR1A 2DO4A 1N48A 2BJEA 2Y3YA 2FLOA 2L9WA 3THTA 5LMUF 5A8RA 2R7XA 2B6AB 1Q7LB 2OEJA 4URSA 4P2XA 1LW0B 5MAOA 2RILA 3P8BB 4DPOA 2WVBA 3HT3A 1XIQA 1OYEA 2Z58B 5CYMA 1WF1A 2BXJA 1YZ6A 2M2BA 2UXCF 3SSSA 3RAXA 3EGWB 3LO3A 4MFBB 3UR3C 5A8KA 3D0HE 2ZH5A 2YKOA 1XMQF 5KFDA 5LMNF 2HURA 2G9OA 2Y9HA 3UE2A 4P6QA 3EM1A 5J2NB 3I82A 2B0GA 3GG0A 2R2RA 3QGIA 4GKJJ 2HQGA 3HZGA 3CCTA 4MH8A 2FJEB 5CQGA 3O8WA 1JLCB 5GAHI 2HVIA 2ZVIA 1Y3JA 3KYLA 4EO8A 4OV1A 3QWPA 4C0OC 4ES1A 2DPJA 2HIQA 2M70A 1SIZA 1JLFA 2DNMA 2AGOA 4NLVA 3U02A 1IR0A 1HBNA 2HGNA 4RNOA 2AYGA 5AXNA 1S1WB 2I8EA 5HQMA 4ZVEA 1RZMA 5U47A 2XMVA 1IBKJ 1D3WA 4QQBA 5KFRA 2R8HA 4C7QA 4DL0C 2H54B 2AEMA 3R6LB 1XR6A 4F2SA 5KFNA 1SIWB 3OTEA 3R9LA 2MSTA 4JI1F 3IC1A 1NSAA 1NK4A 5HQ8A 1FT8A 2HGMA 1HA1A 2JFKA 4GC6A 1S99A 2MPUA 1M1HA 1NK6A 3HJVA 5HMYA 4OHXA 3UO0A 1X5TA 4LBIA 1RCXB 3T5KA 3W2VB 1UVIA 2PEHA 2FD2A 2RD5C 4PG6A 3MM9B 3R7NB 1PAUB 4KGMA 3GE9A 3KK2A 1KTQA 3W63A 2HGLA 3CDAA 5ETRA 4Q2LA 4OJ1A 1XN9A 5I42B 4O3OA 3TAMB 5GAGI 3PIPQ 2Z8QA 3QMQA 1RQ0A 2IAJB 4JB8B 3ZO7A 5KFCA 4ZPWR 4ZCKA 3HHKA 4CCHA 1X4DA 2X1FA 3FUYA 2DD8S 4KY3A 2Z2ZA 2JDJA 1T7PA 1OMSA 1T3NA 3QPIA 2GIQA 4HDHA 2CPYA 4R8UB 2RSQA 3MF5A 1KLMB 2PMWA 3IBFB 4LFBJ 4CT9A 4RBVA 4K4SA 1LXNA 4DMZA 3LWLA 4ZVRB 4F4ZA 1RHMB 3AHPA 3M8ZA 2EKYA 3BO3A 4DCOB 3LW5C 2FVPA 3HVTA 1HYSB 1UVMA 4TKTA 2MLZA 1F3VA 2NLWA 1D9FA 4F02A 1L3TA 2BJDA 2LMIA 3ISND 3UVJB 4FDFA 5EX0A 2RRBA 1U1MA 1Q86T 2BM0A 1QE1B 1UEKA 4U6PA 3CT9A 3N5BA 4DG1B 5AE3A 2VBYA 2J0WA 4BC7A 2DITA 2EVZA 2GX8A 4OX8A 4DR4F 1GT8A 3CSKA 2XS5A 2C42A 4USUA 3I5CA 5DQGA 4ILLA 4NOHA 3Q8QB 2YX7A 1HWLA 2OEKA 4HI1A 2M7SA 3LP0A 2VOPA 1TL5A 2AT1B 4DSLA 4OYMA 3PR4A 3KDOA 4RL1A 3DLJA 3PX6A 4N41A 2DGUA 3VGSA 4IH5A 5THWA 2ZH8A 2HBQB 4HVZA 1HARA 4KTQA 1X60A 4YN3B 2D74B 2RUGA 1RT5B 3SFUA 1F0XA 1ZM2A 2RMLA 2VHGA 2P8IA 2PIIA 2BVZA 3HSZA 5K8PA 2FHJA 3HSGA 2IM3A 1HW9A 2CZVC 3M2UB 4RUHA 3QWUA 4DV2J 3QLHA 1JLQB 3U1LA 1QJHA 3GR0A 1LK5A 3MMAA 3CIMA 4DV1J 3W5YA 2CAJA 7FDRA 4KQZA 2PI5A 2W25A 2CJKA 4DLGA 4RU2A 1TELA 4Q5VA 2RRAA 1VQ9S 3JQKA 6AT1B 1XQIA 3KFWX 3QNWB 4C97A 2BANA 1U6FA 3QQCD 5A0YA 1S57A 4DR5J 4TNOA 3MHYA 4HT5A 3LAMA 2IM0A 4ID5B 4B3OA 3OXLA 1Q82T 1VQLS 1YJ9S 1BXNA 3MMBB 3BB5A 1T02A 1HQUB 1YRUA 4O3RA 2HHXA 3EVOA 3H4DA 3EVMA 2IVFB 5E3AA 3AXKA 2AYBA 4DCJB 4AXJA 2VICA 4ZJQA 2V0NA 4NZ6A 2HBZB 3L7PA 4I7FB 1LKZA 2DJWA 2Y1IA 1BQMA 2JEIA 4TVAB 1RWOB 2EG1A 4H54A 1S1TB 2ZJPQ 5HROA 4RW4A 3G8TA 1N54B 1KP6A 2MKKA 3GFHA 4MKBA 4DQQA 2IFXA 2RDIA 4TY8B 5KFWA 1QM9A 2I5JB 3SYZA 2BE7D 3MEGB 4FF4A 1RA6A 4K4UA 4Z2XA 3K89A 2RKIA 1HWKA 4WXWA 4N56A 4GO5X 4FNIA 4OX9F 1DTQA 2AF6A 4Y2CA 3HM9A 3JSMB 1F2HA 4TYAA 2AD9A 3SDEA 1SL2A 3K5MA 2XTJP 4U7UD 1FVQA 3TP2A 4TN2A 1CSJA 4EGLA 3GWCA 4R25A 1SPBP 3D6TB 4TXSA 1I5OB 3NS6A 3VAMA 2C3MA 4EO6A 3NKYA 1PC4A 5A2QU 4G3IA 2XNQA 3VR1A 3L09A 2VQFJ 1D0EA 3DU5A 4F67A 1FJ7A 2YKMA 1X5SA 4X66J 2MKSA 3NS5A 1KOHA 5L9XA 3V6JA 4C4WA 2IA0A 1HWJA 3FC9A 1S1UA 4RUCA 4Z37A 1OJ4A 4FYVB 5DQIA 1DY3A 3NEKA 4JI3J 3H8YA 3TEHB 5L1IA 4ECXA 4X65F 4DR2F 3M1VB 1FD8A 3K57A 3PIOQ 4OI6A 1UCNA 4FS1A 2FZGB 4FP9A 2Z2MA 1RAJA 3J81Y 3BYPA 3KHGA 3GJRB 1VC5A 4K0KF 5FLXU 5T14A 2EFNA 3VQTA 2J7WA 2KKHA 4C11A 1C0TA 3W9HA 4ER8A 4K4WA 1TKDA 1PYOB 4LSNB 4LT6A 1PJ5A 2VUGA 1C1BA 4G1PA 4IKAA 3M6XA 1Y0HA 2Y8WA 2IBKA 4HL9A 1FESA 5EWGA 1TKXB 2DEJA 4JI7J 3ITHB 3S6EA 2YWWA 2B43A 3EGVA 3AAWB 4MKYA 4EI2A 3DOLA 2ZVSA 1EQMA 5BYRA 1X0PA 5HSPA 1I94F 2OPRB 2CJBA 5F9NA 3E51A 4OQJA 4M5DA 4DN0A 1XNRF 1IVZA 5C2GA 2H9ZA 5GMDA 3NY0A 2E5LF 3CCMS 2APOA 2VBWA 1FEHA 4DN9A 1LWXA 4O3SA 3AQPA 1HQ2A 1U8SA 2FTRA 2KFNA 4DV6F 5E3RA 2DY9A 3FFIA 4IYQA 1FE0A 2H1YA 1K0TA 4AL5A 4J9KA 4NA1A 3CD0A 1X9SA 4B02A 2HQCA 2LA4A 5KFGA 3RBXA 4HYKA 1N0VC 1O51A 2CPXA 1NEEA 3BO2A 1PG5B 3TANA 3MEKA 1KR4A 3QZ7A 3BN7A 3QYYA 4IFVA 5F8IA 2WCXA 3GR1A 4RNNA 3BSNA 1LWFA 2G1HA 3R7BB 3IGNA 3EJMA 3Q8UA 4O3QA 2HRYA 3M8RA 1AFIA 1VFJA 2VC0A 2RS2A 4HH1A 4O4RA 1AXQA 1SQEA 2HNZA 1AZSA 3KJNB 1JJCB 3LWMA 4DF4A 3GLJA 1J2VA 4PXEA 4RW6A 3I5AA 4TQSA 2RF2A 4RW7B 2X3DA 1HW8A 1T9WA 3KKFA 2NYHA 1WACA 4TQRA 3QRQA 4LVNP 5D0GA 3R5DA 1KHVA 4J9QA 2AZ3A 2A1BA 1IKYB 2HBYB 5KFYA 3PYDA 1TQLA 1CULA 2W1BA 3CMES 1FDNA 3KJVA 3BSAA 5ETQA 4CYUB 3H5XA 2B51A 4OHYA 1SQGA 2YKAA 2W8KA 1KD1T 1SUQA 3M05A 5AXKA 1P8GA 4ED7A 1YDLA 3QSIA 2AW0A 2D3ZA 1RTIB 3OXGA 2ILYA 2CA9A 5DG7A 4M1KA 1F9FA 3DRYA 3NCQA 1U26A 3D1HA 2YX4A 2OO4A 4P71A 1RTDA 2MMYA 4OI2A 5IWAJ 2N3LA 2YNGB 1K1QA 4DUYJ 3WIVA 4A8XA 3H59A 4LRFA 3TUIC 2G0JA 4DXLA 3N9UC 1VS3A 2CNNB 2C2DA 3CDEA 4NE9C 5IOLA 1S1XA 2L48A 3NMRA 3Q8PB 3BBFA 3CC2S 2C22A 4XTTA 2G2OA 1NRKA 1N0UA 1FWLA 3PXGa 3C15A 2WVCA 2JLGA 1TVRA 3AD8C 4I56A 1NZ8A 2XO7A 1EQ0A 3DC2A 4ES3A 5LSOA 2YNFA 4LF1A 2ZDPA 4GKKJ 1HNIB 4BLGA 2DR5A 1AT1B 2K3IA 2E7VA 1AA1B 1YSJA 3M8QB 1RGVA 3C14A 3NAHA 3QAUA 1SV5B 2CJQA 4X2BA 1GXTA 2ZKUA 4C8NA 4NMXA 2R8JA 1LWCA 3V6DA 4KFBA 3MURP 2R2UA 3POTA 1CPZA 3J7ZT 1QLNA 1P6TA 4MTPA 3DLGA 2KFYA 3D2WA 3NOGA 2BKNA 4L75A 2GV1A 4JI8F 4EUVA 3D5MA 3SCJE 2DHXA 4A8FA 2ZHOA 2DNPA 3SQGA 4HHHA 5MLCV 3NOCA 3K5NA
chains in the Genus database with same CATH topology
3CCQS 1RP5A 1DFDA 1HBMB 4Y28C 3ENQA 3T19A 1N4LA 2JH3A 2RQCA 3RB3A 1QAIA 2WRMA 5CYJA 3QO9A 3SV4A 4N76A 4Q45A 4RNMA 3MAHA 2D9PA 3T3FA 4USJC 2FPHX 5AXMA 5DDOC 4ZOSA 4KPYA 2UUWA 2BDPA 3C46A 4QCLA 3LGNA 3M32A 5KFVA 3PR5B 4LMZA 5KFIA 1FK9A 1GXUA 2OFHX 2VC1A 1FRJA 3DDNA 3GMGA 3IBWA 3QIDA 3UDCA 2MQOA 1WHXA 4DEZA 4U67Q 4LSNA 1ZM9A 4DFMA 2YVSA 3JSRA 1RT2B 5E2QA 3KNAA 2IHR1 4YB5A 3GV5B 4CH1A 1ZM4A 4OJGA 5K8OA 4QU6A 4ICLA 1V9OA 2HHWA 1A7GE 2HLUA 5KFBA 2NYIA 3QJLA 3HX9A 1N5SA 4BC9A 2R8IA 1K1SA 2GHPA 4A46A 4YR0A 1TV6B 1VMBA 2OJ3A 2XI2A 2E9TA 4Q8EA 1YRXA 4QPXA 2ROEA 1S6QA 4WE1B 4OI0A 4F3QA 4U7UK 2ZM6F 2B7CB 1TKXA 1MMNA 2IJFA 1NH7A 1WEYA 3I5BA 2XLIA 3QJPA 1IM4A 4KRWA 4M63A 3CJKA 2BQUA 3OTBA 3LP1B 4F4YA 3T6BA 3FQKA 2VB6A 2WOMA 1S1VA 4G6VB 4X4OA 4IQXA 1KSPA 2HHUA 2L9DA 1I6JA 3UD3P 5F41A 1HI0P 4JOUA 3RW6A 3ITHA 4ECTA 4DV3F 2LQ9A 3GB0A 4BDPA 4KSEB 1LW2B 2JSXA 3DRSA 3RRKA 3OL7A 2OTJS 2PD1A 1RJJA 2N7CA 1FKAF 2SXLA 3VZIA 3DXBA 3S1TA 4OX7A 5GAGU 4ZHRA 1SC6A 3G8SA 4N8OA 4DWIA 3IAM9 1FEEA 2B9XA 3HDSA 2ERRA 2EG2A 1HD1A 1UJ6A 2OPRA 1M90T 3K0JA 1U2RA 4OZLA 5CYQB 1ULRA 1DURA 3CO9A 1FRXA 2OKQA 1VI7A 2DBBA 2M5YA 1FA0A 2HQ3A 3HFKA 4CNZA 3AB2B 2KT2A 4DV5F 4DR3F 2IMWP 2EBEA 4C8OA 2ZZMA 2GHVC 1YRTA 4CO1A 3D1OA 5KFSA 2KI2A 3MDFA 1S0NA 4YB1P 2XGQA 3PX0A 4UY85 5GAEU 1BGXT 4A47A 4RW9A 5KT3A 4IOCQ 3NNCA 1HNWF 2B4VA 4C8YA 2ASLA 3HZEA 2Q3PA 2CPIA 2DR7A 4DSIA 1VC0A 2ZC3A 3PFEA 4DL7A 3CD7A 3O44A 1ROFA 3A1YG 3KNGA 4AE5A 1MROB 2L08A 2LXUA 2VFVA 2PE8A 1S9EA 1LK7A 2FC9A 3MM8B 3HF5A 3QZ8A 3QJJA 3Q23A 1MMLA 1NJIT 1ELOA 2K1RB 2V5HG 4Y2IA 2YNHA 2A3JA 3D0GE 3CDWA 4N47A 2BE2B 3FCHA 3X3UA 3KLVA 2VA3A 1SJRA 3N0VA 1C0UA 1F5CA 4IO1A 4DF8A 5DDPC 4FF2A 5KT2A 2HVHA 3OLBA 1WF0A 4KT0C 4TYBA 3H40A 4NA2A 2X1BA 3I0RA 3NBPA 4CH7A 1S7HA 2LQ5A 2XMUA 1CEZA 1T03B 3DOKB 2MKJA 2DO0A 4I64A 4B17A 1EETB 3E2EA 2MYFA 2QLWA 3U27A 2I2YA 3IO1A 2WSCC 2QZ8A 2ZE2B 1VQ6S 3DLBA 2F9JA 1VQKS 1YBAA 3UI3A 1XMBA 4OHVA 2X1GA 4USIA 3MGJA 2FC8A 2WK4A 4NRUA 4CNYA 1IBKF 1WG5A 2R7TA 2VA2A 5SUHA 4K50A 3PNIA 4FF1A 1WWHA 2QRRA 5KG4A 2VFTA 3CCJS 1DLOA 2YQ3A 2GGPA 2CIMA 5KAKA 1N5QA 5J2QB 2CQBA 4Q44A 3CJ0A 5J2MA 3KLGA 3LALA 4TLQA 3TO8A 4QOTA 2BYCA 2HMIB 2Q6BA 7FD1A 4QZVB 4WU3A 1W2IA 2IRXA 3TX8A 4ECZA 1FRHA 1TFYA 4LQ9A 3M9NB 3WBZA 5EHHA 1H2VZ 2N7YA 1C1CB 3LUYA 3NLCA 1RTJA 2HHHF 1H6KX 2J0SD 2UUBF 1HHSA 2OMOA 1FE4A 2K3KA 4I69A 4L6V3 1RA7A 4I68A 1LFWA 1W25A 4I67A 2XBPA 2ZH3A 3OL8A 2POKA 1B0TA 3CCZA 2UP1A 2E7WA 4YEAA 4FBUA 3PW7A 2QT7A 2KXHA 3EPGA 2HW3A 1FTCA 4RW8A 1DTTB 1HQEB 1N6QB 2CQ4A 2PSZA 4MMOA 5FDLB 3CVKA 3LOUA 3GSDA 2PMZD 4URGA 3MUMP 3NWGA 1Y3KA 3DGPA 4RW7A 2ZH6A 3CTRA 3O5TB 4ID8A 2W7OA 1YITS 3HVWA 2E5IA 1B0PA 2QO3A 4G1QA 2BR0A 5EWEA 4O44A 5KT4A 1JKHA 4X4TA 4K4YA 2VODA 1E6VA 5JJBA 5E7OB 3GIJA 4DL4A 4J5OA 3OR1B 2EC0A 4Y65A 1H7WA 3RBEA 3MM7B 1KTVA 1LQ9A 1HNVB 2B5JB 2FJDB 3CD5A 4YQWA 2JL9A 5K8NA 2DHGA 2J9EA 1RT1A 1UWBB 2XI3A 1TL1B 4CT8A 4DV0F 5A8RB 2GQCA 5HP1A 4M94A 3MECB 5DLGA 3KLFA 1FJCA 1NJZA 4PXBA 3G6XA 2Z2LA 5K14A 2ZJQQ 1KFDA 3PV8A 3LGMA 4I2PB 2Q79A 1T05B 3GILA 4ITSA 1IKYA 4ED3A 4LSLB 2IBOA 2CQ2A 2EK1A 3NP5A 4LQ3A 1FXRA 2MQQA 1N32F 1S4FA 3D0IE 5G0RB 1DRZA 2VG7A 4A48A 2R2SA 2G0CA 4L3NA 4WU2A 4Y6IA 4B08A 2FLNA 1FKPB 2QYCA 4ZPTR 1JNRB 1HPZB 1V3RA 5C25A 3K59A 2M8DB 2P5VA 1U25A 5BYSA 1R8PA 5CYMB 2L3MA 3BDEA 4NCAA 3DLLQ 4WK1A 5ADZA 2LEBA 3CB4A 2CPJA 3H98A 3N4WA 4OMFG 5EUHA 1ZBTA 1GAOA 4FVMA 2P6SA 2WONB 1RTHB 5KG6A 3IN5A 5HLFA 2CRLA 2D1CA 5FIIA 4K4VA 3KK1A 3GV7B 1IKXA 1NKBA 4DQIA 2QE5A 2QFJA 5A8KB 1S0OA 2D7SA 1OPIA 3MEEB 4KAIA 1M1KT 1J5EF 5D3GA 1BWEA 3IAS9 3MR6A 2DNYA 1N52B 3MD3A 2DGXA 1RTIA 2XG8A 3PW0A 2V8DA 2XY5A 5CHCB 3KG1A 1FNOA 4N77A 3SI8A 3RB0A 1IKWA 3UQSA 1TK8A 3ULHA 1M5PC 1SH3A 1VRUB 4TU8A 4WKRA 1ZOTA 2DHSA 4LFBF 2KJWA 4YOEA 1GXLA 2HAIA 2ZKTA 3PHEA 1VQOS 4ZCLA 5CA5A 3IRWP 3IS9B 5A6WA 3FDSA 3M6WA 3PEHA 3VWSA 3P96A 2AJQA 3DU6A 4I6WA 4BS2A 5KFMA 2XC9A 1LOUA 2KG0A 2DH9A 1ZYQA 1GX5A 1IUJA 4XDCA 4IG0B 3PFOA 3O1LA 3ISNC 3G6ES 1YI2S 2KZZA 3OTCA 2DNHA 4C3MA 3Q2SC 3RRHA 3JAMY 2M52A 6FD1A 4X4UA 2GHWA 4IDKB 1Z2ZA 4F8RA 4JI2F 1APSA 1BD6A 1JLFB 2MHEA 2YNGA 2PT0A 2ZOMA 1JJ2R 1IQZA 4IRKA 1S6PA 1QVGR 1MU2B 3IXQA 3OV7A 4NYPA 4RU9A 3I96A 3M30A 3KK3A 3M9MB 1KQKA 4ED8A 4J9NA 1HBNB 1KFSA 5I3PA 4XIUA 5IS2A 1SB6A 2BZ2A 1SI9A 3IGVA 4YMEA 4X64F 5KTQA 2U1AA 1XK8A 1KHWA 2OIHA 2O66A 4HKQA 2RS8A 3TUJC 2F9DA 3FQLA 4DR1F 2I9SA 1FDBA 3OTOF 2EPIA 1VGYA 2ZZNA 2JOQA 3K2YA 5A8WB 5KOWA 4M8LA 4JV2A 4AYBD 4W90B 2O5DA 3PO5A 2N4CA 4EYHB 5JUMA 2W9BA 3BS9A 4J9SA 1VQSA 4FNHA 2R7QA 2HFOA 2NUUG 4QWCA 1NK0A 1YQHA 5BJRA 1RKJA 1TKZA 3LAKA 3DLHA 5B0BA 3DRRB 1QTMA 4C8LA 2DNGA