4ANEA

R80n mutant of nucleoside diphosphate kinase from mycobacterium tuberculosis
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
135
structure length
135
Chain Sequence
b'TERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTNAIAAVRQLAGGTDPVQAAAPGTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title Structure of Mycobacterium Tuberculosis Nucleoside Diphosphate Kinase R80N Mutant in Complex with Citrate
pubmed doi rcsb
total genus 42
structure length 135
sequence length 135
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4aneA00
3VVUA 4WBFA 1MN7A 4O0NA 1NDPA 3Q8YA 3BBFA 2ZUAA 1LWXA 4HR2A 5C7PA 4FKXA 4ANDA 2DXEA 2BEFA 1S57A 3BBBA 1S59A 2HVDA 3FCVA 1WKLA 4UOHA 1WKJA 4KPCA 3VVTA 1NHKL 3ETMA 4CP5A 1VYAA 1HIYA 1NDLA 2CWKA 2DY9A 3NGSA 1NB2A 1MN9A 4W98A 2B8PA 3ENAA 3MPDA 2HVEA 3FC9A 1W7WA 3Q8UA 3Q89A 3EVMA 3BH7B 3EMTA 4ENOA 1F3FA 1B99A 5CABA 3DKDA 3JS9A 1S5ZA 4DUTA 2B8QA 3FBBA 4S0MA 1B4SA 3DDIA 3NGTA 5CAAA 1HLWA 2AZ1A 1F6TA 4UOFA 1NSQA 5IOLA 3GP9A 3NGUA 3FBCA 1WKKA 1HHQA 1NUEA 2AZ3A 3G2XA 3EVOA 4UOGA 3FBFA 1KDNA 4F36A 1U8WA 1NDCA 1BHNA 3PRVA 3ZTPA 4ANCA 4DI6A 3ZTOA 4C6AA 4F4AA 3FBEA 3GPAA 1LEOA 1UCNA 2DXDA 3EICA 3ZTSA 3FCWA 1XQIA 2BX6A 1NSPA 3B54A 3Q86A 1NCLA 5BXIA 1BE4A 1PAEX 3BBCA 3VGTA 4DZ6A 2DXFA 3FKBA 3Q83A 4FKYA 3R9LA 3Q8VA 3VGUA 2VU5A 3ZTQA 1JXVA 1K44A 3NGRA 1ZS6A 2DYAA 3VGSA 1PKUA 3ELHA 3EVWA 3VGVA 1NPKA 2HURA 4ANEA 1BUXA 1NLKL 1NSKL 1EHWA 3PJ9A 3EE3A 3ZTRA 3B6BA 3WX8A 1XIQA 2NCKL 3EJMA 1NDKA 3EM1A 3L7UA 3BH6B 4EK2A
chains in the Genus database with same CATH superfamily
1XR5A 5A0YA 1JKHA 2CQ0A 1HPZB 1KFSA 1JIHA 2ZJPQ 2W4DA 1IKVB 2M52A 4PWUA 4DV5F 2I9SA 2YNHB 4M5HA 4Q8EA 4PWDB 1M1KT 2RD5C 1SC6A 1VFJA 3MR7A 1Q7LB 1PC4A 2H65B 1UAWA 3M8QB 3AB4B 3D68A 1EJ7L 1TKXB 2WSFC 4XDDA 2Q1LA 2QL9B 3M30A 2YKNB 1T9YA 3HKWA 1N52B 2MZJA 2KFZA 2E5GA 4V19X 1PJ5A 1HWLA 1ZZFA 1UW4A 2XZWA 3MPUB 4MTPA 4NL5A 3B4DA 2HRYA 2FVQA 3O1LA 1Q8IA 3JTOA 1OY8A 3BF4A 3NG8A 3CDUA 4WIQA 5KFDA 1HIYA 3BGUA 1YGYA 2V9WA 2U1AA 2FHOB 1Y5LB 4IRKA 4CM0A 2J8AA 5K14B 1V5VA 1WG5A 2LDIA 3O8WA 4IO9Q 3MEGA 2OPRB 3N6NA 4LRCA 3UDEA 2W2OP 3CCMS 2A2CA 1KSPA 2VA2A 3SMZA 2WSEC 4PQAA 2ZKTA 4ENOA 5BYSA 3EMTA 3HMJG 4LFCJ 2RKIB 1FFSB 3MAAA 4KE5A 2FPHX 2ZD1B 2FZKB 1RWNB 1IM4A 4I0WA 5J2MB 3C15A 4Y00A 2KXHA 2I38A 4I2QA 4P71A 1LWCA 5T7LA 4KHPJ 2XO6A 3KLHB 3RBDA 5L38A 4PPZA 4MFBB 4FS2A 4J9RA 3PW7A 1H74A 3HHLC 1HBMA 2RMLA 3CJ0A 2HHXA 2OI2A 5CYQA 2IYGA 4YB6A 1N33F 2HVIA 2CG8A 4J9QA 2YKPA 2HSEB 2FB0A 4O3NA 3NNCA 1F5AA 5CZVA 2DEJA 1VQSA 3H98A 3MMJA 5MAOA 5IM0B 2ACYA 1YTYA 1ROFA 2V5HG 4NEYA 3KNGA 1VK3A 1U1QA 3QT6A 2ZH4A 2W2NP 4CNYA 3DLJA 3C6UB 3T1AA 2OPPA 3TVYA 4V19J 1FJCA 1N36F 1LXNA 4O4RA 1CJUA 5B0FA 5IQQA 4XPCA 4MK9A 1FD2A 2NXEA 4MK7A 1I6JA 2ZKUA 3Q86A 1RA7A 5CYQB 4JB8B 2CPZA 2CDQA 1TU0B 2G1DA 1LWEA 3NCRA 2CPXA 3DXSX 4FNIA 4K8RA 2JHEA 4HACB 2NPFA 2YNGB 4CH7A 2N82B 2LLZA 1HNIA 4R0EA 4ZP7A 2XM3A 2HQ3A 1H2VZ 3CJTA 3VGUA 2HNZA 4LVNP 2RDJA 2CQBA 5U47A 1YK9A 2V63A 4DDFA 2WZ1A 3L09A 3TQEA 4K0KF 2WTFA 2K2PA 1Y00A 3CW2C 3DYAA 4DR3J 1SKSA 3DI6A 4CM2A 5KFWA 1K73T 1S0NA 3LP2A 1VC6A 2HURA 3K17A 2XTJP 4DL2A 4JI5J 4BS2A 2QE5A 2EKNA 2OLWA 4TN2A 1RCXB 2H5JB 2HZAA 1BQXA 3EYZA 5E7OB 2KKHA 2G2ZA 4FF1A 1NPRA 1S4FA 1V3ZA 3RRKA 3QMQA 5L8RC 4DV0F 2CZ4A 3KG4A 3PJ9A 2GVDB 2RF2B 5HK4A 5KOWA 5KT5A 1RHUB 2GQQA 2IJRA 3ZTRA 4YY3J 3HVAA 2X51A 1K8AT 5EGYA 5IT9Y 3UO0A 2HIQA 3TA0A 5KFGA 2IHR1 4ZPBA 2XLKA 4DSJA 3FQLA 1VQ5S 4I64A 4B9TA 1SJQA 3UW1A 4CTAB 4Q8FA 1CJTA 1TUVA 2HFVA 4K2JA 4N8OA 4QZVB 1E6YA 3NS6A 4YDXA 2JOQA 4JI7J 4EU0A 1UWAA 3KHHA 2EG2A 2IPOB 5AE1A 1C0TA 3DOKB 1U4BA 3Q8PB 2MEWA 3JQJA 4WU2A 1QSSA 2V50A 1ITPA 3I0SA 3B8HA 1S57A 1RWVB 5GAEU 2MB0B 4I7FB 1U8SA 1WEZA 4GO7X 2R7SA 2V34A 1WKJA 4KPCA 1OYDA 5LM7E 2AT1B 2MQ8A 4I2PA 4O4GA 6FDRA 5I42B 3J80U 4CP5A 1RGVA 2B7CB 1I3OB 5F8NA 4LRDA 4A47A 2DY9A 3KLGB 4F4YA 2IY5B 3HP6A 3F41A 3TA1A 4DV0J 2FGOA 2VC0A 3QIDA 1SPBP 2GW8A 2ZBRA 2ZHBA 4ED1A 1D1UA 3SQGA 4F2SA 2HS3A 9RUBA 5GAHU 2CQ3A 1TKTA 2AU0A 1RT7A 2YWFA 3OR2B 3FEXB 2DHXA 3EVMA 4PG6A 5B08A 3MTKA 3KG1A 1U0HA 1URRA 3G4SS 1QVFR 3W2WA 4KHRA 3GFXA 1FEEA 3JS9A 1KKHA 4PKDB 4CNZA 5HP1A 3RZAA 3I31A 4KGZB 3NGTA 4MYUA 2V8HA 4X4RA 1R8HA 2DGVA 1FX2A 1DTQA 4FZVA 1NKEA 3PY8A 2P6TA 1FERA 4FNHA 3R8YA 2FJBB 4DF4A 1T9XA 2BBEA 3D6MB 3GZ7A 2AWZA 1VIOA 4WE1B 2RKIA 2PFDA 1KQKA 2YH0A 3M1VB 3KUEA 2X7IA 1FWLA 4DLGA 3WZ0A 3MEKA 4LF7J 2AP6A 4UOGA 1U26A 3QPIA 3V81A 2ZBPA 3DRYA 3QAEA 2ALYB 3WHIA 4UOCA 2B5JA 2GIQA 3GYXB 4C3KA 2M0GB 3D1QA 3I9V9 4N5SA 2OSRA 1I1GA 5LMUF 4YN3B 2IIHA 4TXSA 5DDQC 1GX5A 2ZE2B 5GAGU 1A7GE 5EWEA 4OX9J 4USKA 1GMVA 3ZZYA 5HSPA 4ELVA 3GG1A 1XC9A 5HMYA 4X2BA 1JLGA 2MSSA 3DLGA 4KC5A 1WG1A 4L74A 5IZHA 1D9FA 2R8JA 1LWCB 4B3SF 1HMVB 1K1QA 1D9AA 3R5DA 2G2OA 4QOTA 3PZPA 2IMWP 2HIYA 4ZVEA 2V8DA 4NCGA 1SC1B 4FKYA 2HLTA 3CNQP 2L08A 4ZP6A 1YZ6A 3CC7S 1AT1B 4H4MB 2CZVC 2ZD1A 1BWEA 2YH1A 1ZS6A 2B6AB 1BQMB 1ZM9A 3MAAB 4ZITA 2XYGB 1KVKA 2VQEF 1XERA 3HK2A 1Z1ZA 2DYAA 2CUYA 2GO8A 4PQUA 3CJ8A 4ID8A 4DPYA 1X7VA 2PD1A 5ETPA 3UN2A 1CJVA 2HKEA 2UVRA 3QIPB 4J37A 3W2VB 1TUWA 5IFMA 5KT2A 4DR2F 2XS7A 4K4ZA 3DLEA 1AXQA 5L1IA 3AJDA 3S8SA 2UUCF 4QPXA 5SUHA 2PEBA 2DEIA 2HVZA 2DNGA 3C19A 4NXNJ 2GZOA 3MGJA 3BGFA 1WDDA 2NXUA 1R8CA 1RTIA 2C2MB 2NCKL 2VFUA 2MQOA 1HNWJ 3OVBA 2D3ZA 3C3LA 2F9JA 2PI4A 3PM9A 2LFVA 3BH6B 4P74A 4WTOB 1S10A 5CYMA 2F63A 2NSCA 1RAIB 3R6LB 4NE9C 5KFPA 1U6BA 1AB8A 4ZHRB 3SV3A 2YX1A 4WP8A 4ZVFA 1U1PA 2HYIB 3KTQA 2CPIA 3BSOA 2FHJA 2VA3A 3T5LA 1HKAA 1W2BR 2LU1A 2K7JA 4HR2A 1HPZA 2AX1A 5CCLA 3DDNA 2YX4A 2QMUB 2KH9A 3PJXA 3IRXB 3SI8A 2BE2A 1XMQJ 2E1AA 4BC7A 4DX8H 3I82A 3A3NB 1T3NA 4QU7A 1RWPB 1S1UB 2FZGB 1HL6A 2W2PP 3FCVA 5E3QA 1WACA 2HK3A 2V4QA 4LF7F 3KMSA 2D1CA 2RS8A 3T41A 2AD9A 2YQ1A 1RT6A 2J6SA 2PA3A 1RAJA 5AJ3F 2ZZTA 4PXCA 1FKPA 2FY1A 2VOOA 2MKIA 3OL8A 5B0CA 3ZZTA 4U7CA 5A8RB 1EP4B 3OTCA 2UU9F 5HMZA 1FKOA 2GMHA 4CH0S 2HNDA 3O5TB 2RB7A 1T7PA 3LUYA 1SB6A 2M7SA 4CH1A 3LP0B 5FDLA 3P4UB 5K9FA 2HQDA 2Q3PA 3N4WA 3SCLE 1OO0B 4Y0FA 1FFWB 2R7XA 3V6HA 1YDLA 3B82A 1FJ7A 3MURP 1JXLA 2AJQA 1GNKA 1X5PA 3EXYA 4HVZA 1B4SA 4NMLA 5F3TA 1J5EJ 3RR7A 2X1BA 2LA6A 1QTMA 3M6WA 1NNDA 4KIAA 5LSOA 1F6TA 3QZ7A 3IM9A 4PQUB 3G6XA 5K5MA 4TU9A 4QIVA 1V3RA 4DV7J 2F3JA 2LXUA 5KFFA 1S9FA 3BM7A 2AEFA 3NMRA 1KTVA 2MZ1A 4C11B 5GMDA 5DM7Q 2D3OR 1S1WA 3E51A 5F8IA 4D3HA 2AJ2A 1OPZA 3I5CA 3K89A 1S0MA 3CJKA 1F60B 1CS4B 3CCWA 1VK8A 4UT4A 4LF9J 4ZPTR 4IDKB 3QAUA 4K4SA 3KK3B 5FLXU 3V6KA 2LXIA 4YB1P 3TEHB 1FXRA 2AYEA 1UETA 2BW2A 3N0VA 4H4KA 1QDUB 1S76D 3R27A 3QBCA 4QCLA 5H1SV 2DTJA 3CE8A 3IS9A 1JLAB 1SI9A 4EWTA 2Z57B 2KG0A 2AYGA 2OSQA 3FMBA 1EETB 3BO4A 1UVMA 4NA3A 1RT1A 1KHVA 2V0NA 4Q0BA 3FEZA 4NASA 3LA0A 2EKYA 3Q8RB 2OPPB 3ZTSA 4DX7A 1VQKS 4ED8A 4OX8A 3QQCD 4IO1A 1U0SA 4F4WA 1KOHA 1NCLA 2NYIA 3FGVA 5E33A 5IXUA 2BANA 1SJ4P 2GAHC 1M0SA 4OZNA 2UXDF 3ZTQA 4QW9A 3K58A 1MWQA 3DI6B 1K44A 2MKKA 1UJ4A 4O44B 4JV2A 2DGTA 2IYIA 2ZNZA 4K7QA 1VI7A 4OYPA 5L1JA 3FEYB 1J5OA 3VGSA 3ZZRA 2MXYA 1FKAF 3ELHA 2CQDA 2MMYA 5KG6A 1L3TA 1YRTA 1TP7A 2HWTA 1NK0A 2IA6A 3JYTB 1REGX 4KQZA 2VBYA 3I96A 3P5BP 4PYAA 2OEKA 3C14A 4R5PB 4YY3F 1RTZA 5CD4H 4B3SJ 2ZBIA 2IC3A 5SZTA 5KG1A 1N88A 2QYCA 2E5JA 4DV2F 4LF8J 1SVDA 3CWJA 4USWA 3TA2A 2H1YA 2DNQA 3IGNA 1UJ6A 3WX8A 2LEAA 3ETOA 3K5PA 1IM6A 2GMLA 1KD1T 1HQUB 1UWBA 3BGRB 2QLXA 3A4TA 1U6ZA 2AW0A 3X3UA 3GYGA 1D8ZA 4OMFG 1C0UA 2IMOA 2ROPA 4EBCA 2DGSA 4JI1F 1I94J 1MROB 1Q82T 2E29A 3M6XA 4ECZA 3CO0P 2YWWA 1XR7A 1IVZA 1JJHA 4EBDA 3PO4A 1LWXA 1VQMS 2MPUA 1T11A 2IBOA 1WG4A 3LP1B 2BJ1A 1RT5B 4Z2XA 5CA5A 5A6PA 1TAUA 3C16A 4AE5A 3QFWA 4B9LA 4J9SA 3M9MB 5AJ3J 1KHWA 3OV7A 2HPUA 2R9LA 1QUPA 3CCES 3K5LA 1JLAA 3KDNA 3RBXA 5C24A 3E3XA 2Y9HA 3AQOA 3SSQA 3ETMA 1N8RT 2Q6BA 2FVRA 3CD5A 3VCDA 2NXCA 3GCXP 1NO8A 1MWYA 1EQ0A 1NDLA 2WCXA 3FZBA 3LPYA 1TELA 4PWDA 3NGSA 4IG3B 4PYDA 3AD8C 3AA8A 4DQPA 3C15B 1P9QC 3TEGA 3A3PB 2D3UA 3KJFB 4U9RA 5DZ7A 2KDOA 1RSCA 1X0PA 4PAAA 5K8PA 1VQYA 3AD7C 1U2CA 1S7IA 5IT0A 4JI0F 1LXJA 5I4MA 4PG7A 4YUDA 4I69A 2BW7A 3WBZA 4CLFA 1VQNS 3Q8QB 1XNRF 1B99A 2I5JA 4RWWA 4C0OC 5DGAA 3SCIE 3DXBA 1N5YA 2IBKA 5F0WA 4EUVA 5A8WA 1B70B 1KWMA 2JLGA 2VPYB 4F26A 2HMIB 4OLPA 3TJ8A 5HQ8A 4J9UE 5JJBA 1NPPA 2MZQA 4W4MA 4KHPF 5D4PA 3QT7A 4Q5VA 2HHTA 1HNXF 4AT1B 3NGUA 4U7UK 1FVQA 1N6QB 1EIYB 1OY9A 2ZOGA 1JLBB 4LFBJ 3RYLA 5HBMA 2KB2A 3CCJS 3HDSA 1TFYA 2AZ3A 1VISA 4GKKJ 4NYOA 2QLBB 1U8WA 2VFVA 1Y9OA 4MMOA 4FBUA 4XO0A 2QSWA 2RDDA 3QWUA 2MKHA 2XULA 3IBFB 5E0OA 1LK7A 3TR5A 1FX4A 3M2RB 3VAJA 3BDPA 1IR0A 3NL0A 4YOEA 1ZAXA 3AY0A 4LF1A 1IUJA 2AMCB 1Q8KA 3OTOJ 4F04B 2JEIA 4F4AA 4RW7A 4OZ3A 2F40A 1RXOB 3DOMB 2QFJA 2KT5A 2QIFA 3EDQB 3GPAA 4ICLA 4UQTA 1PYTA 3MFHA 4H4OB 2V4JB 2HHWA 3HT0A 4Y2AA 5ETKA 2FLNA 5CZXA 1VQ4S 2BX6A 1P1LA 1IKYB 2B4UA 4OHXA 4DWIA 1ZH5A 3PX6A 1GXLA 2J7WA 4NLTA 3RB6A 4PUOB 1M5PC 4M1KA 4GVBB 1XNQF 3UQSA 1NM2A 4LFAF 3QGGA 4NYPA 3H8YA 4DPUA 4ECYA 2BR0A 1R0AB 1H98A 1S6QA 1X5SA 4R0JA 1HBMB 1PILA 1S49A 2BRKA 2LQ8A 3L7OA 1CEZA 3TVZA 3TAPA 1RT5A 1S72S 4K59A 4KFBB 4CQ1A 4CT9A 5B0BA 2V69A 3EZUA 2JJ4D 1K1SA 3MEEA 3MPWA 4NA2A 3H25A 4USIA 1BWVA 2V8GA 5E3PA 1IKXA 4M5DA 1XMBA 2RH3A 4RX6A 4IH6A 2A6OA 2Y1JA 6AT1B 2BV3A 1RQ0A 1CC8A 2N4CA 3TJ9A 1Y5IB 2FJVA 1HBOA 1RKIA 2MQQA 2GAGC 1O51A 2CJXB 2LQJA 1TMJA 2MKYA 4KKOB 3HULA 5F9LA 4EBEA 3C46A 3IM8A 1S0OA 4TYBA 1FRIA 3MR5A 2MHEA 1R89A 2BM0A 2R7UA 3PR5B 3DFEA 2HS4A 1CQMA 3ENQA 1SJ1A 4P75A 1LW2A 4NYZA 1HW8A 2ZVSA 1YVFA 3OTBA 3ZNJ1 2BJEA 2CAJA 3I56S 3V4IA 1PJ7A 1UZDA 2YWEA 2XQCA 2ZH3A 4WXWA 1PO6A 1VQ8S 4N7TA 1TL1B 3NGKA 1N0UA 1VBKA 2BXJA 3LF0A 4ALZA 1RE1B 4N77A 3ILJA 4LT6A 4DEZA 5C7PA 2EWHA 3BSNA 4OFZA 2F5GA 4IH7A 3FJ2A 4X62J 1R3NA 1WC5A 2FTRA 4WTYA 2Y0BB 5LXRA 1XMOJ 1GX6A 1S9GA 5KFMA 2Z2ZA 3MOZA 1T03B 1FO1A 2C2NA 4LVOP 1GQEA 2HQCA 3N28A 4HHUA 1VRUB 1Y5NB 4A8XA 4F2RA 4N47A 1Q8LA 4URSA 1FT8A 2IVFB 2QMWA 1TMMA 3NRBA 4CLPA 4NCBA 3EZOA 4QWBA 1B0TA 4JP8A 4LBHA 5D78A 4XTTA 5J1EA 3J7YI 2PFFB 4JI3J 4C9DA 4Q0BB 3TVKA 2ZH1A 1HQUA 1WD6A 4TLQA 3C2PA 1N33J 1WF1A 1UKUA 5DM6Q 2BJ3A 3M8SA 3Q89A 3V2UC 1S77D 3IBWA 1GTHA 2QN6B 4K4XA 2EC2A 3BSCA 3MF5A 3W66A 3HZEA 1C0TB 1S5ZA 2ZNYA 4ZVQB 4WYLA 2RNEA 5KT6A 4ECXA 3DDIA 4KO0A 2HGMA 2HZCA 4WU3A 1QLNA 2YXLA 2OO4A 3QIPA 4USMA 2WBRA 5ETVA 1T05B 2OPSB 2M8HA 3D1HA 4YB7A 1RAHB 3MUMP 2VQFF 4IR9A 2F9DA 3G8QA 2ILZA 5KFSA 7AT1B 4JI0J 4QR1A 2QFIA 1FVSA 1S1TA 2HHPA 3FBFA 1ZPVA 4F36A 2KG1A 2C2EA 2VOPA 5L9NA 3LOUA 4DUZJ 1VQOS 4USUA 4L75A 4G65A 3K5OA 5D3GA 2LQ5A 2R8HA 1S1TB 2F8EX 5B0AA 1PYOB 3ILOA 5HVHA 4LFAJ 2KRRA 3ET6B 3MPVA 1XK8A 3P5TL 2DISA 2VFTA 3MEDA 3NLCA 1CSJA 3RU0A 4DI6A 1RHJB 2FJEB 3OFHA 2Q79A 3NOCA 1SC3B 3KK1A 1S9EB 4DF8A 3OD2A 4NX9A 5LJ5Y 1S6QB 2R4FA 2HHUA 1GFWB 3T5HA 1H3DA 1PCAA 4HACA 2ZDOA 3N5FA 4IOAQ 3B4MA 1LKZA 2F4VJ 2KM8C 3D2WA 2RU3A 3W1YC 4P2XA 3BBCA 4PG4A 2ZEJA 4RPFA 1RT6B 4ILRA 2XMMA 2JVOA 4OV1A 2MQMA 1RU1A 1TL3A 4PR6A 5LMNF 1C2PA 2ZITA 5EWGA 1UMJA 2MY8A 2DH7A 2RE1A 3D3BJ 1X4FA 1RUSA 1HBNB 3V81B 1UVJA 3OL9A 2HW3A 3GFHA 2V8VA 2ADBA 1L3UA 4MJKA 2DPJA 4HDGA 3EGZA 2FC8A 3K0JA 2Z2YB 5A8KA 3KHRA 3CXCR 2O3DA 4DL6A 1NJYA 1NJIT 4YEAA 4GVLA 3EUNA 4TLRA 7FD1A 4UF4A 2ATCB 1PJ6A 1VJWA 1NSKL 1RWOB 4P72A 1UWBB 2C2OB 3BGRA 1WEYA 2LQBA 1JLCA 2UV8G 3EE3A 5EUHA 4TQRA 4ZCLA 3KK2A 2WOMA 3JXOA 4DR2J 3TW0A 2IFXA 5KT4A 4OJ1A 1B7FA 4NOHA 3LP0A 2DT9A 4TYAA 5FDLB 3VAHA 4B3OB 1LFWA 3AJ1A 1LV5A 2W01A 4OJ3A 4QR0A 2B9EA 1IBKJ 4AUKA 3KK2B 2F8HA 3KLHA 2XMAA 1HNIB 2JX2A 4F50A 1Z2LA 2ASJA 1U02A 1DLOB 4JV5F 4DG1B 1RBAA 4QIEA 5EX3A 3FSYA 3J81U 2JFKA 4P6QA 4O3OA 3GG0A 3TUZC 3QSYB 4DR4J 3PW5A 2DHHA 3AB2B 3ZC4A 3W63A 1XTZA 2VBZA 2XYPB 2D69A 1QAIA 4NCAA 1VBXA 2DNHA 2V4JA 2ZH6A 3T1YF 2AYBA 2Y0SD 4ICLB 5J1EB 2WBMA 2CYYA 2POKA 3H5UA 2XWYA 4I2PB 3TO8A 4DU8A 3MCNA 4DR5J 3Q24A 3GJSB 5HI7A 2WONB 3IFEA 1S12A 1L3VA 4I6WA 4ER8A 2CJBA 2JC0A 2YPZA 1NXIA 4NCGB 3ZXWA 3OLBA 3GV7B 3QT8A 4ED2A 3M8RA 1B0VA 3RW6A 3JTNA 5C2CA 4MKAA 1TTHB 1S48A 2B9WA 2P9CA 3NXZA 4IYQA 4JI7F 1FDBA 3DC2A 5C25A 2B8PA 2WAQD 3CIZA 3G87A 3MZIA 4ZP9A 4CLWA 8RUCA 1X9MA 1XWLA 5LMUJ 2J0QD 3DRSB 3LW5C 4HI2A 2HHQA 3GFZA 3DRRB 4F4KA 5IT9U 4LRFA 3L7PA 1U2FA 1X4DA 4LSNB 1NK5A 4M95A 4MK8A 1IBMF 3LP1A 3NP5A 1F3FA 3R5BA 1TV6B 3HHNB 2MTLA 1ICEB 3HO1A 4LREA 3UCGA 3HT3A 2FLPA 4OHYA 4IDKA 3M4XA 5DG7A 3QJPA 1Q5VA 1CQNA 2DIVA 3G82A 4X64F 3TI0A 2NREA 2AZ1A 1N5YB 2BABA 2JL9A 2RQ4A 5FLXY 4UQGA 4JV1A 4EMDA 4DLEA 3UD4P 4CYUA 4RL1A 2FIUA 3DHWC 5D15A 4FF4A 4PXDA 2YKQA 3M8PA 2XMTA 2ZWPA 3KJQB 3MI7X 4LSZB 4RUHA 5CD4A 1FJEB 2BMBA 1T9WA 3KLIA 4EI2A 1IKXB 3IWLA 3O44A 3WC0A 3KNAA 2V67A 4Y6IA 2FLLA 2W9CA 4DPXA 1FRHA 3HF5A 1RYRA 1DLOA 1FNXH 5ETSA 3T3FA 2UXBJ 1BHNA 3JSRA 4HT5A 4LSNA 4OJHA 4ZJOA 4JI2F 5JVGQ 1YJ7A 1OS5A 3JSBA 3W2WB 4ZS6A 2FLOA 3LGMA 3MM9B 1HR0J 4JBCA 2J9DE 3MCSA 2HNDB 2DNYA 2WOMB 4ZA1A 1DURA 5K8OA 3OXFA 3T19A 4EEYA 3FBEA 4NZ0A 3IWNC 5A76A 4IQMA 3H20A 2UXBF 4NXMJ 4DCPB 2GS8A 1X4GA 1SBRA 3OL7A 3O3LA 2UVWA 4DSFA 3R5CA 2HG4A 3DDKA 5HJYA 1WELA 1U1RA 4OIXA 4E98A 3G6VA 5D4LA 4A8MP 4QIGA 4ECWA 1YHQS 3E01A 2Z2MA 2RS2A 2DXFA 3PX0A 1G6BA 5I42A 4QWCA 2RUSA 3UNGC 2W4CA 2ILYA 3U1MA 1FXDA 1OIAA 2VICA 1H7WA 3PIPQ 3BZQA 4O3RA 1Y11A 2NXJA 3KG0A 3ISNC 3S7RA 4LBIA 5BJRA 2CPYA 2FUG9 5HJXA 1NKBA 3CD7A 1KP6A 1MG7A 4DG1A 2YNFA 2GO9A 2M9KA 2NXNA 3ZZPA 2JVRA 4RNMA 3SV4A 5E3RA 1E6YB 3EPIA 3OLAA 4FPIA 4DL5A 2OP5A 4YB5A 3GIIA 1Y10A 4O23A 5D8HB 3W8GA 2R7QA 4EYHB 4RU2A 3HSJA 1M5HA 4K50A 1NSAA 4GO5X 1J5EF 3EJMA 2ZOMA 3BS9A 4TY8B 4FP9A 3VHQA 3V6JA 3CDAA 1U25A 2HFZA 2VL1A 1LOUA 1HR0F 3ILLA 2JH3A 2BANB 2HS0A 2V2ZA 4GRSA 2EFPA 3VVUA 4C2MA 4YR0A 1Q8BA 2PA8D 3S6EA 1NDPA 1FDDA 2VG5B 3OSPA 4QIFA 1QY7A 3BN4A 3PO5A 2X1FA 3QO9B 3KOAA 1HBNA 3DN9A 3MEEB 5AE3A 1GXTA 2BOPA 2G2YA 3DYAB 4RLEA 3G82B 2O67A 5HATA 3BBBA 4ECQA 2VG7B 1WKLA 3CCSS 1YI2S 1RT2B 3TP2A 2EBEA 2PE8A 4LBPA 5GMEA 4WFNQ 2D7SA 3I4HX 4UZCA 2DPIA 4KH0B 4F7VA 1LQ9A 2B4PA 1N5SA 2YNGA 5BR8J 1YBAA 1R0CB 4DR1F 2ASLA 2HHVA 2E44A 4IG0A 4X64J 2VG6B 1EQMA 2KM8B 1RTDB 4IKAA 5GAHI 5ETOA 4XDCA 5JVHQ 4W98A 2ZDPA 4K5RA 1S9EA 4B9VA 3SYZA 3C16B 3HSZA 3POTA 2IA0A 1JKHB 2Q6CA 5F0UA 1TK0A 3FC9A 1S1VB 3QLHA 3KHGA 1W7WA 1KC8T 4YR3A 3QJJA 2B4OA 3Q8UA 2E9RX 4DOZA 2NZCA 4YQWA 2QTWA 3SZ2A 1U7LA 1MROA 3R6GB 2UUTA 1VS3A 2GJ2A 2OPQB 3FRYA 4ZKAA 4ZDNA 1Q4RA 2DGWA 5DQGA 4GKJF 3PVXA 3CIMA 1NJWA 2XG8A 2UV8A 1WJ9A 4PABA 2OTJS 3R5JB 2ZOFA 2R7WA 4DFPA 2MJNA 3BO3A 4OZ2A 1SJRA 2BE9B 4EO6A 1NJZA 4C8MA 4LQ3A 2B43A 4DV3J 2H9ZA 1R8PA 1MU2A 2HAIA 4DR5F 3HI9A 2E5LJ 4QYZK 1TVRB 1BXNA 2O66A 2JDJA 5DDRC 3FNNA 1WOPA 2XYHB 3CVKA 3JYTA 3ZZUA 4AXIA 1HQEA 1RDRA 3KLFA 1DFDA 2QRRA 3S01A 1VOMA 4I6YA 3MMAA 3U7JA 2KI2A 1YRUA 4CO2A 3MHYA 4OYWA 5C2GA 2DGOA 4DCOB 4QYZJ 3RR8A 1SL2A 1TKTB 2DITA 3I6PA 4I4BA 1I51B 1FTCA 2YWKA 4C7QA 4A46A 3HFVA 2DNNA 1VC5A 1BQNB 2QGFB 4NLDA 2WW8A 2OFGX 2QA4S 4RJVA 3IRXA 1J5OB 2DR8A 1G3OA 3C6UA 3MCMA 2Z2LA 4J91A 4C0HA 4DN0A 2JZ5A 2JSXA 7FDRA 1H0HB 4U6PA 2UZAA 1Q7YT 1NHUA 1UFLA 1WNEA 3AJ2A 4IG3A 3CJSA 3N6LA 4LF9F 4OI1A 4A4JA 1CPZA 2GHPA 4OX6A 5ADZA 5J2QA 4DPTA 3VTIA 3R5AA 4ZPVR 4QJVA 4B08A 2W9BB 1BD6A 1T03A 4CLKA 5MLCV 3CF5Q 1VC0A 3J80Y 4L76A 2XMKA 4OZLA 2QX0A 2AEMA 2MY7A 2CG4A 4ED6A 4OI2A 3M30B 3RB3A 4ZLPA 1IWGA 4JI1J 1C1BB 3GV8B 1U2RA 2IDEA 3PCOB 5KG7A 1CBKA 5KFTA 1OSDA 2IJNA 4LIWA 3HCXA 2HGNA 4X4PA 1NPKA 3QRQA 1G1XA 1LW2B 2H5IB 4F3OA 3CUNA 4LUBA 2C28A 2SXLA 4OI0A 4ZJQA 1FK9A 2JFDA 3FQKA 4LR7A 4KGMA 4DR1J 1VIXA 3A8JA 3M8PB 1CULA 3M8WA 2BDPA 1R31A 4X65J 1C0UB 3OTDA 4FXVA 1R7IA 2GVZB 3A8KA 2RUGA 2F65A 3M1VA 4HDHA 2ZHAA 3VAMA 5L9XA 1S0VA 1Q1KA 1VJQA 2AKWB 3GU0A 4UUXA 4QBUA 3N01A 3OFEA 4C3MA 4WXOA 4FN5A 4LF5J 4M5KA 3PW0A 3Q0AA 2XHWA 2OEJA 1VHFA 2RU9A 3DRPA 4WBFA 1K0TA 3IBCB 5CYJA 1PGZA 3T1YJ 3MDFA 1PBUA 2GCFA 1NAQA 4PXBA 3RW7A 2QA2A 2UXDJ 1EX8A 1U1MA 2ZUAA 2MKCA 3R5GA 1S79A 2HLUA 2PSZA 1X5OA 2W24A 2P6SA 4KBIA 5HBMB 3MR6A 3R1LA 4B3RJ 4DMZA 1Y3KA 2BEFA 4BCAA 5J2NB 2VASA 2BQRA 2W4PA 4NLUA 4WCEQ 3MTJA 3G96A 1QAXA 4IOCQ 4GKKF 2VH7A 3W2VA 2JEJA 1YJRA 4WZQA 1MMLA 3IA0A 4DUYJ 1WOOA 3P3DA 5K8MA 3OTOF 5I3UA 1D8YA 2QEXS 1R43A 1FRJA 1NH8A 2FHMA 4IFVB 2A18A 2GNKA 2RSQA 1FD8A 5KFZA 3T6JA 2MGZB 4A8QA 4I6AA 1HNXJ 5H9FJ 2PDAA 2UUCJ 2CJKA 2X3GA 3E8OA 2C2DA 2E7VA 1AUSL 1Q79A 3T9NA 3IG1B 4RW9A 3CPWR 4WPAA 4WK1A 1TFWA 4EYIB 5CQGA 2KYZA 3HZGA 2DH9A 1KQGB 3WDOA 4NLPA 2RQMA 1X31C 2C3PA 2RVJA 4DHVA 5IQ6A 4IG0B 3RBEA 1C1BA 1E6VA 3SXLA 3UDLA 2OHDA 2XSJB 5IT4A 3G6YA 4FS1A 2KJWA 1RK8A 2QMXA 4X4NA 4FYWB 3LAKA 4H4KC 1NSQA 2VF3A 2YX7A 2KJVA 2CQ2A 3T5KA 1C1CA 2F8MA 2IM3A 1U1NA 4Y3CA 4LF6F 4FYXB 1J2VA 1JLCB 2XMWA 5LSLA 2HGLA 1VBYA 3CC4S 1RHRB 2XY7A 2KO1A 2XNQA 2HFOA 4B3TJ 2XNRA 4OZ0A 1DHMA 4PZVA 1NHVA 1YKWA 3OVAA 1WC0A 3CDEA 2WONA 4P7TA 4DV6F 1C4AA 3OW2R 3BREA 4CLZA 4DV1F 3DLHA 3R97A 5FJ4A 4LMZA 3D54A 5EX0A 1RAGB 2FGCA 2RRBA 2XCPA 3T1HJ 3NOGA 3LP2B 2UUBJ 2UU9J 4DJBA 5J2PA 4F25A 2PEHA 4LFCF 4ANCA 4NI2A 1FK9B 4ID5B 4IFYA 4B3TF 4HYKA 2DNOA 3BV8A 1NK7A 3JTPA 5C42A 1J27A 1HMVA 2ZFHA 3NBPB 4KO0B 1UCNA 1RAFB 1QVGR 1YJNS 3NAIA 1XJWB 4F3MA 1AW0A 3Q2SC 3CD6S 2BOAA 1UVKA 2KXFA 3MM8A 3OFFA 1FE0A 3W64A 1BE4A 4ZK7M 4YR2A 4DV5J 1CJTB 1H2UX 3L3CA 2DKOB 4O3PA 2ASDA 2N3LA 2BUNA 1N0VC 2VU5A 3QYYA 1IBMJ 4PUOA 1M5OC 1XBWA 2LMIA 1YWXA 2ROEA 2MYFA 3PFOA 1NBEB 3GIRA 4Z7CA 1FTRA 2B9YA 2VBXA 2VD3A 4YS2A 2VV5A 2WK4A 3ULHA 3PHEA 4R8UA 2UUAJ 1VHIA 3VGVA 4CLUA 4OYBA 1UTAA 4OLOA 1RAOA 4U8YA 2RQCA 4KJIA 1FFGB 4NWBA 3CCRS 4F4XA 1H2TZ 1KLMB 1TL3B 2H51B 1OJ4A 1EETA 4MIBA 5LSRA 1VQPS 1IR2A 3QRPA 5KFIA 5F9NA 4LQ9A 1N56A 2B0GA 2FD2A 4C48A 5K20B 2NZ4A 3MM8B 3WQPA 4G3IA 2VG6A 4Y28C 4LRBA 2CKWA 2UUWA 1SQEA 3KUGA 2AJ4A 3CMES 4ES2A 1QAJA 5HO4A 4YHHJ 4Y2CA 1KVIA 4D3GA 4MKYA 3K8VA 3PTWA 3PYGA 2RHSB 3FFIB 1CC7A 1U0HB 2HQFA 3KLIB 3ONQA 3Q8YA 4X62F 4CO5A 1G7CB 2PIIA 2BRLA 4TU7A 1SC4B 1VLYA 1WC3A 2OIHA 2XY5A 2ZWOA 3IR7B 4F02A 3UFCX 3TJAA 5HANA 2H4WB 4Y2IA 1JK9B 3TAMA 3UVJA 2APOA 5IC4B 3HD2A 3IXQA 4KYZA 4OYMA 1O0PA 2DBBA 3M9NB 2KVIA 2YQ3A 4MT1A 3HJVA 3WIUA 5LXYA 4V1Ak 2MDAA 1ZBTA 5D0EA 2H4YB 3W60A 1VYAA 3W9HA 1WF2A 2WW4A 3FRZA 1OWXA 1WORA 1YIJS 5L1LA 2B3TB 2A1BA 4TKTA 1SCJB 2IJFA 3DU5A 4HH1A 4P73A 4X4QA 3GV5B 4J9OA 2YVSA 2Q66A 2DO0A 4FXDA 3BGLA 1NJXA 2I1RA 2YKMA 2K3KA 1RTDA 1IJFB 3GR0A 4JI5F 1XN9A 1M1HA 1ZOTA 2BKOA 2QL7B 5F8MA 4OV6A 3PJWA 4B3MF 3BH7B 4FF2A 3CGIA 2J7UA 3D0IE 2HHSA 3LPEA 2X1GA 3IAS9 4RUAA 1IKYA 3NS5A 4KAIA 2AF6A 4X66F 3W61A 4BBYA 1JJCB 4JI6J 3CJ5A 3W62A 2NUHA 1N5TA 1WWHA 4B9NA 1Y7PA 3KYLA 3P45B 4IOBA 4N41A 3O2IA 1N54B 1WKKA 3J81Y 1X60A 1ZA2B 4ED0A 2BKPA 1JLQB 2CJ9A 4NEZA 2DY1A 3OTEA 2MQNA 4FYYB 1PSDA 2L41A 1SL1A 2LEPA 3OR1B 2XMVA 4TY8A 5KFYA 4C8ZA 1XMQF 3R7SB 1XNQJ 4KFBA 2W2QP 2W8KA 4EZ6A 1N34J 1PIEA 1C4CA 1TL7B 1KFDA 1I94F 2FJAB 3OXGA 4RNNA 4DX5A 3N5BA 2E9TA 1RJJA 4MAKA 3OHAA 5IWAJ 3BQ2A 1YX2A 4C6AA 1TL1A 2DNPA 5A8RA 3C6TA 1E6VB 2A3JA 3AXMA 1AYEA 3M8QA 5F8HA 3BJYA 4E8UA 1QSLA 3BKFA 3UR0A 3CCQS 4LIRA 3OFGA 1W2IA 2CIMA 5JUMA 4I68A 2PT0A 2J9DA 2VB6A 5DS7A 2CQ1A 1CJUB 4O3SA 4ES1A 1AROP 4CYUB 4PWWA 3VGTA 1VRQC 2DGQA 3UN5A 1FDAA 1LNQA 3OUYB 4FBTA 2GV1A 4Q2MA 3F0NA 1FRMA 3M8ZA 5E5NA 5KFCA 4K4YA 3MM5A 4Y34A 3T9ZA 1VQ7S 2I6WA 3H5YA 4OHWA 2Z58B 4A48A 1HYSA 1RT4A 2XI3A 3BR9A 2KYXA 2MHNA 1JMTA 1YJWS 2HBZB 4M63A 3TZYA 3D28A 4U8VA 4K4UA 5LMNJ 1N5VA 3CO9A 5KFBA 4KT0C 3NWGA 1EAYC 4P2MA 1U49A 3PYEA 1PG5B 1QTNB 1JLBA 4WP3A 2VDIA 2EFNA 4WIIA 2OUGA 5F8JA 4JUZA 4NXMF 1TL4A 1U6FA 2XMUA 1PBAA 1D3WA 1NZ8A 1XIQA 4OHZA 5J2QB 4KGKA 5I3PA 1KONA 1ZTTA 5C42B 2HFUA 2I8EA 5ETTA 2BQUA 1UP1A 3JSMA 1A6LA 3D6HB 4WKRA 1ZM2A 3MM7A 4EK2A 1U45A 1MLAA 1MWZA 4DV4F 3GSDA 3HPOA 4DQQA 4W92B 2K1RA 2YKOA 5BYRA 1CJKA 3D66A 3ISND 1TKDA 1F2GA 1JNZB 4KV8B 2GQCA 2B6AA 3UD3P 2CNOB 4USTA 4ANDA 2UXCJ 4KTQA 3SCKE 2V4RA 3PRBA 2HWIA 4H4MA 4XK8C 2OMOA 5K14A 4CDIA 3D4JA 2R2SA 3MMCA 1U48A 1A0OB 4F0KA 3G6ES 2DD8S 1Q86T 1H6KX 2IVYA 2GMJA 3ENWA 1YJVA 3NMAA 3LTOA 5IWAF 2E1CA 4FYVB 5F8LA 3A13A 1TVRA 3EGWB 4J9LA 4B3OA 3KJVB 1R0AA 1EARA 3IWXA 4E0DA 1V6HA 2QO3A 5DGBA 4ECTA 5HMXA 2BE7D 4AD6A 1D0EA 1SKUB 3GONA 1QUVA 3I0RB 2W9BA 1GMUA 1RWXB 4J9VA 4OYIA 4CZCA 1ZETA 2M70A 1REVB 3EWGA 4LRAA 1V3SA 3VZIA 3Q23A 1RT4B 1FNMA 3IG1A 4RW9B 1HYSB 2P9EA 1RHQB 2HQGA 5A0YB 2DNMA 3L9ZA 5ITHA 2PI5A 2P5VA 2HFSA 4RW7B 4KPYA 1M90T 1X4HA 3M2VA 1FWPA 3POTB 4MKBA 4WE1A 1T8EA 4L3NA 3US5A 2ATLA 1WI8A 4RNFA 4YDDB 2EG1A 2JLEA 1TK8A 2WVEA 2LXFA 3QATA 1ZTWA 1HWJA 1HQ2A 1DY3A 2AX0A 2QG9B 4M8LA 3ZZOA 4QWEA 3VF0B 4JI8J 3IP0A 2C1EB 1QJHA 4M5JA 3QFHA 4ZVGA 2ZH8A 1Y4ZB 3D6TB 3MM9A 4CTAA 1RACB 3VQTA 3DCAA 1VCTA 4ID5A 1N32J 2EI5A 4YHHF 5F3ZA 5D0RA 2C22A 2J6UA 5KFRA 1K9MT 3RUBL 2KTQA 3NY0A 2CPDA 3MR3A 1HNWF 1G2EA 3PHTA 2OPQA 3CJQA 1SH0A 3R7BB 4DV3F 3M6UA 4CT8A 2LVWA 4NXNF 2VODA 3AODA 3CJ2A 1FWKA 2DK2A 4KGVB 4O3QA 3SSSA 1N48A 1GAOA 2U2FA 2FVSA 1PYSB 1F0XA 2IM2A 5KG2A 5HROA 3CCZA 5BXIA 4DSEA 1WF0A 2XCAA 1SQGA 2IRUA 3H2VE 2E1RA 4P10A 2W7PA 4DZ6A 2WB1D 4RW6B 4CO4A 2LP4A 1F3VA 2IC3B 4JI2J 3GQCA 2F1FA 1UFWA 4JI8F 1AUDA 2VKZG 3MM6B 2MZSA 3N6MA 1HHTP 3SDEA 3NNAA 2KT2A 3DHXA 2R8GA 3V6DB 4LSLA 1FDNA 3DRRA 3HSGA 5C24B 4C8KA 4EZ9A 4K0KJ 1JX4A 4USJC 2YQ0A 4ZVSB 2RILA 3KK3A 1EZZB 1B3TA 3K2YA 2CQGA 3GWCA 2VG7A 2RQKA 5ETRA 3G86A 5G0RB 2DB1A 4C98A 4H4OA 3TX0A 3H40A 1LK5A 3BO2A 2F4VF 1S1WB 1KNZA 2DIUA 1YJ9S 4C11A 2C2KB 5GVQA 1F9HA 3MD3A 2YY3A 5C5JA 2N7YA 5KFNA 2DRDA 3I5AA 1LW0B 5HL7Q 4RU9A 1KQSR 1A9NB 3EM1A 1F2HA 1RADB 3VAGA 2C2RA 2BYCA 5IM0A 3HLUA 2DHGA 4QWDA 3SCJE 3J7ZT 2XO7A 2AGPA 3DM2A 4NZ6A 2BVZA 1MN7A 4NLWA 5DQIA 3GMGA 3NS7B 3PACA 4BLGA 5CYMB 3G8TA 3PNIA 5LL6d 1FRKA 1SUQB 2B7BB 4DV4J 2C42A 2ZH7A 4J9KA 1DTQB 4K4VA 2DXEA 5L46A 2HNZB 2WVDA 3M8YA 3MAHA 4OJGA 1YJUA 4ELUA 2H3EB 2VFSA 5DZ6A 3AOCA 2VFRA 3G8SA 1NHKL 2GC8A 1P8GA 3DLKA 2C3YA 1JLFB 1SIZA 5T14A 2IRYA 4DR6F 3RAXA 2PMHA 2CWKA 5J1PA 3EXCX 2ASYA 1WHWA 2HEKA 4DQSA 1MN9A 2M5YA 4F4ZA 2J8SA 2OJ3A 3ZO7A 1CVJA 2PMZD 4BHQA 1S6PB 2EFQA 5F41A 4GKJJ 1JWWA 4F67A 3H90A 1T94A 3RB4A 2ZM6J 1HWKA 2R7OA 2M8DB 2NLWA 1FA0A 4NA1A 4O4GB 2Z56B 1HNZF 1FRLA 1DTTA 1RTJB 1UW9A 2ZC4A 3BKUA 3DKDA 4N56A 3UN3A 4A8FA 2LA4A 2VPWB 5LT5A 2B8QA 1R8BA 1FF2A 1DQ8A 1S6OA 3GTYX 1N4LA 4NLOA 1O8BA 4ATNA 2DGXA 3I0SB 2V9KA 2P8IA 4N76A 4UOFA 3AQPA 1DAXA 2P9GA 2VDHA 5E2QA 3CDWA 2Y8YA 4DPOA 3D9BA 4NRUA 5KOXA 3OPKA 2G1HA 4QR2A 5RUBA 4ED3A 4DL4A 1IBLF 1M5SA 2HRTA 1JXEA 4I2QB 4J90A 2F4FA 3W9JA 5THWA 5CCMA 3CCTA 2CJQA 3PW4A 2QLFB 2FHKA 3ITHB 4LR9A 3MM5B 4CO3A 4YP3A 3MEDB 3PYFA 1U1LA 2HHHF 1TZ0A 3UD5A 3BSAA 1RAAB 4DFMA 2KT3A 3PRVA 1YLXA 2IAJA 1JB0C 3GJRB 5GADU 2KXNB 2VG5A 1K0VA 2HRUA 4P9SA 4ECRA 2J6TA 2HNYB 4DX6A 1RABB 2CQPA 4DUYF 1RKJA 2W7OA 1Q5YA 3KMQA 4HKQA 2K7KA 3NCPA 2E9ZA 4J7CA 2HAFA 2V2KA 3TZXA 4ZVHA 2KHDA 3VZHA 3M32A 3HM9A 1LFPA 3C14B 4R5PA 4M94A 1LEOA 2NS1B 3D0GE 2RDIA 4ZN3A 5KTQA 2XGPA 2V68A 3EICA 3HFKA 3FCWA 1XQIA 2OPSA 5GAEI 1NSPA 5DETA 2LYVA 2HBRB 3I5BA 4BWMA 4AQYF 3SFGA 3FMWA 1OYEA 1PAEX 3HFZB 1RT7B 4O44A 3Q8VA 4Q44A 2UUBF 3W5XA 2CRLA 3AHPA 3UPFA 1SV5B 1LWEB 2ZUGA 3DRPB 3MCOA 1JXVA 1Q0NA 4Q43A 2V2QA 3THVA 1TR0A 2QLJB 1VMBA 5B0EA 1RWUA 2L9NA 3ICLA 3W65A 4B9MA 3IC1A 2K8GA 1MNEA 2DH8A 1M5VC 1WHYA 1NK4A 4C97A 3HVTA 3OXLA 4HL9A 4C8NA 3ILIA 2NPIA 1PAUB 3ITHA 3HKZD 4QIWD 3W9IA 3NKYA 3ZZZA 4ZPAA 2XC9A 2AJ0A 5T41A 4P52A 5HVFA 5I3UB 2BQ3A 2C3MA 1P6TA 1HARA 3CT9A 4Y2MA 2XS2A 2HFNA 2M88A 4LSLB 2BJ9A 4X4TA 2XLIA 2XZDB 1S4EA 1S9GB 3LANA 4ECSA 4QQBA 2V8PA 4HLBA 3RJMB 5D77A 2ZM6F 4DR7J 3IMQJ 1UEUA 3KLVA 1IR1A 2WVBA 3LWMA 5EHHA 2ZJQQ 3OBIA 3CJKB 5KG5A 1N6QA 2A0FB 4C3LA 4DR7F 1UVIA 4X4OA 1OY6A 2FVCA 4K2XA 2ZBCA 4A8KA 1AFJA 1NEEA 1GXUA 2J0XA 4DXLA 4LF4J 4AL7A 3QGHA 1VLOA 1ZA1B 2E5HA 3PW2A 3MD1A 5H9EJ 4CLTA 4CI0B 1S1XB 1SXLA 1T9TA 5A6WA 4IRDA 2CPJA 4LF5F 2GVZA 2MKJA 4RW8A 3BQ0A 3OT9A 2DHAA 4IR1A 2YPYA 4IUFA 1WOSA 5LOQA 3BYPA 2G0CA 4L72B 3JSMB 4ILLA 4F3QA 3ISZA 2W9AA 4UTGA 2KZMA 4P2SA 3CB4A 2EW9A 2H48B 2HVEA 4A8WA 1TV6A 5KFKA 2ROGA 2QYGA 2VC1A 2BZ2A 2YNFB 4FVCA 1QM9A 4HTIA 3CCUS 1T9VA 1H73A 2J0WA 3D0HE 2O01C 4I67A 1FKPB 1ZM4A 4S0MA 1HBUB 5ETNA 3H42A 3G71S 1SJ3P 1TQLA 2FYXA 1WSRA 2MZTA 3HSDA 3K5MA 2VUGA 4X4VA 4C4WA 4B17A 4QWAA 3GJQB 1RZMA 3VALA 2AGQA 1R6YA 3ET6A 1T9UA 2RAQA 3HVTB 3J7Z5 4MIAA 2CADA 3FBCA 1FI4A 2BJ8A 2GVDA 4Z7YA 1LWFB 5A2QU 3A1YG 1X5TA 1L3KA 4OYZA 4TU8A 1RP5A 2JEGA 2CDRB 1FESA 2WB4A 4ED7A 4TQSA 4AL5A 5B7WA 1KDNA 3FUYA 2GX8A 3I0RA 3SBMA 2AGOA 2I2YA 1UZHA 4DBQA 4WKYA 5KFOA 1Z4UA 4ZPWR 2CFXA 3LAMA 4OYAA 2BJ7A 3HHLB 2DHSA 2QL5B 4PCQA 2QT7A 4XAKA 2A6MA 8ATCB 4DV6J 4DUZF 2OH2A 2ZH5A 4WK3A 2B51A 3KJVA 4RUBA 3Q8SB 2KN4A 1YBTA 1HNVA 3ZTOA 2W2MP 3PKMA 2DCUB 3UWTA 2AJ1A 3TOQA 4U95A 1XEZA 3IR5B 4CIOA 2KFNA 1SIWB 3H2UB 2XI2A 3R2DJ 2VONA 4IFYB 1NK8A 4RKUC 2XWXA 1RU2A 3WX4A 1SUQA 3CMAS 2OELA 4WFXA 2L3MA 1HD0A 4C0BA 3QT5A 2PGCA 1KOOA 4BDPA 2KZZA 3UR3C 2GQ2A 3FZ2A 2N7CA 3PKYA 1B0PA 1X0FA 2HHHJ 4JYAF 3PX4A 4USVA 1BQMA 1P27B 1YZ7A 2FHJD 4UUWA 5E3CA 3R9LA 2HMIA 2JC1A 3TUIC 3KDOA 4XIUA 4ITSA 1VRTB 1KRPA 5B0DA 5H9EK 4OHVA 1UEKA 2D3O1 3ADAC 4HH0A 2VKRA 3A8EA 1MMDA 4KHMA 4AFFA 2FZCB 3IAM9 3SEOA 3UI3A 3UCUP 1QSYA 3P49B 3K8WA 1H7XA 3U27A 5KT7A 5DDOC 4RBTA 1WTBA 3A12A 3F56A 3JSYA 3VQSA 4B9UA 5I3QA 2EK6A 1FEHA 3BR8A 5C25B 3BGOP 3DOKA 5DRKA 4OQJA 1WHVA 5JMNA 1X9SA 2LCWA 3B6BA 1KN6A 4EGLA 3W3SA 2D74B 3FVYA 5KG0A 3KKFA 1S7HA 2CVEA 2JWNA 2VBWA 3D1OA 4RBUA 2ZJRQ 1DRZA 1XNRJ 2OKQA 3GJTB 4ZIWA 1SKWA 1X4AA 2YNIB 2E7WA 4OX9F 1KR4A 2QA1A 3K5NA 4J9NA 1VQ6S 2HK2A 2BE2B 1U24A 4FPRA 3H7HB 1RLCL 3AFGA 3MMBA 5AE2A 3M2RA 1BC6A 4DV1J 2UVUA 3UDCA 3SFUA 3GFYA 4ZOSA 2CQCA 2HVDA 3F44A 4CLYA 1DQAA 3LGNA 1RBLA 2FJDB 1PC5A 3VVTA 1ULRA 1GH8A 3JQMA 3TWZA 2GJFA 4FDFA 4E2FB 1T05A 2HVHA 1VGYA 2UVVA 2W25A 3LWLA 5D0HA 9ATCB 1KEKA 4DV2J 4LF8F 4W90B 1MSWD 3EDRB 4QYRA 3KLEB 4M5NA 3T5JA 4GVBA 3DLEB 3M32B 3DLLQ 4OZJA 4U7UD 1IWAA 4DQIA 4KY3A 2DNRA 2IM0A 2YNHA 4CO0A 5KAKA 5A8KB 1YRXA 4KB7A 1LW0A 3BYRA 3GB0A 4KV8A 1NK9A 1G4CA 1VR6A 2G13A 2J76E 3FBBA 5B0GA 3GYNA 3TNVA 4BWJA 1YG0A 1JLEA 2VQFJ 2K1RB 1CULB 1F9EB 2VPZB 3GLJA 3E01B 2YNIA 2B4VA 3GR1A 1UPPA 4J5OA 4LJMA 4R8UB 4X66J 4I7FA 5G0RA 2R8KA 3R2CJ 1RCOB 5IOLA 2H5EA 1VRUA 4CWBA 2OAUA 1Q95G 3QZ8A 2QSFA 3RB0A 3N9UC 2XMJA 3NAHA 1NUEA 3P6YC 2Y1IA 5M2PA 3G2XA 5IS2A 3IN5A 2Z4PA 5KFJA 1HBUA 1JLGB 2XSFA 4DZDA 4URGA 5EDWA 1YITS 3IO1A 4H54A 3J81j 3IS9B 2CJYB 2C3OA 1Q53A 2LDYA 4A8SA 4JI3F 1CLFA 3KK1B 2MJUA 1NRKA 1S6UA 2CJAA 2G0JA 3PIOQ 2FJWA 2YWGA 1DQ9A 2EXUA 3K57A 1WUUA 1IKVA 2WVCA 3K7RA 3UE2A 3TUJC 3LQVA 4DR6J 4WZMA 2OFHX 2WHOA 4ZVRB 5A8WB 4LFBF 2HNYA 5HQLA 5GAGI 2QLWA 1FNOA 3CMQA 4DL3A 1BQNA 1S99A 2GFFA 4G1QA 3RRHA 3OUYA 2ZZNA 3HHLD 3W5YA 2C2ZB 3EPGA 1RT3B 1XMOF 4WF9Q 3C66A 4L73A 4M5GA 3GE9A 4KR0B 3THTA 3WC2A 2B9XA 1JLFA 3DNCA 4GC7A 1IQTA 1QD1A 3FKBA 2ZVIA 2V94A 4ILMA 2G0IA 3FFIA 1DJ0A 3HD1A 5HQMA 1N34F 1OMSA 5D0GA 3OJUA 4DCJB 3OSNA 3RRGA 2KL8A 2BM1A 4KRWA 2VQEJ 2VIHA 3NGRA 2AV5A 4K4TA 5HP1B 1WTFA 3CC2S 2EK1A 1RWKB 5L1KA 3SSRA 4DS5A 5KFUA 4EFAC 4NLGA 4U67Q 3H2LA 1PKUA 1ELOA 5DJBA 4ZJLA 6FD1A 1BLUA 3D67A 4NLSA 2YTCA 3WIVA 4Y65A 3IRWP 4DL7A 1EB0A 3D6FB 3GSIA 1SKRA 2NSBA 3OR1A 2R3VA 4WFYA 1WC6A 4PPDA 3SQGB 3THPA 2QA4G 3TQ1A 2Y8WA 1APSA 3AXKA 1X4EA 3UNYA 1HA1A 2MSTA 5DQHA 3GIJA 1U09A 1MMNA 2K3IA 2B5JB 2F7VA 3LGHA 3M2UB 3U02A 2GHWA 5D6GA 2L9DA 2CWXA 3L7UA 1S1UA 2LEBA 3PEJA 3TAQA 2OEMA 1S1VA 3QLHB 4LF2A 3H59A 4TVAB 3HVRA 4ECUA 1RT1B 3CTRA 5HLFA 4B3MJ 1HWIA 2CNKB 1VDHA 1HI1A 4MIWA 3CCVS 2NUUG 3O6QA 2DR7A 5K8NA 3L95X 4IH5A 1ZPWX 3RAMA 1F9FA 3MMAB 4DR4F 3S1TA 3V6DA 2EVZA 2ADCA 1S59A 4YMEA 1P9YA 4MKVA 3NBPA 3QNWB 2R42A 2Q43A 2M3DA 1NMEB 3VWSA 4DS4A 5HMWA 4B9SA 4X4SA 4A8OA 4RZRA 2O1PA 3MMCB 2KFYA 3Q22A 1NU4A 2E1MC 1GMWA 1UFKA 3TUPA 3CJ4A 2IRXA 3DGPA 3QWPA 5E3AA 4OL8A 1GK8A 2I0XA 3IGVA 4PG8A 4ZLNA 4RW8B 4G1QB 3BKTA 2VJUA 5D3GB 3MPDA 2I5JB 3FSXA 1MW7A 4FYDA 3CDBA 4DN9A 1TAQA 3PYDA 5DG8A 1L3SA 3TZWA 5KG4A 4ZIVA 2MKSA 1OSCA 3D7SB 4HT7A 4JV5J 2R7VA 5H9FK 3U1NA 2CNNB 2IVMA 5CABA 1VQLS 3NNHA 4WFAQ 4DUTA 3CJRA 3F73A 5AXNA 4ECVA 1U1OA 2DR5A 3KUHA 5KFXA 5CAAA 1HLWA 3GIKA 4NRTA 1D09B 1FKOB 1SH2A 2YKNA 2DNKA 2OTLS 4GC6A 2XSJA 3KHLA 2RRNA 4NZ7A 4OI4A 1R27B 3DLGB 4Q45A 5DLGA 2LECA 3MECA 3MPYA 1RI7A 2HBQB 1WEXA 2MLYA 5FIIA 3MAQA 3Q2TC 4RW6A 1UA1A 2YBVA 5AXMA 4OI6A 2CZ9A 2ZE2A 1OPIA 2O5DA 3LO3A 2R2RA 1ZM3A 2QV6A 1WC1A 2ZHOA 4Z37A 5CXTA 4JI4F 1EKSA 3ZTPA 3RTVA 1V9OA 2QC3A 1IQZA 2M2BA 2MGZA 4P2FA 2FDNA 5IC6B 4DQRA 1RTHB 1UVNA 2YWHA 4JYAJ 3NGDA 4ZCKA 3J7A1 5J2NA 5ETQA 2PN6A 1CG2A 3B54A 2XGQA 4OZ5A 4M5LA 2XZTB 1ZZNA 4KSEB 1RTIB 2OD4A 3NEKA 1T3OA 3NCQA 4F0MA 1U1KA 4JV0A 4OYOA 3Q83A 1Y3JA 5ETMA 4DPWA 2BJDA 3RG6A 2X3DA 4DL0C 1UPMB 3PV8A 2ZH2A 3V4IB 3AA9A 1MU2B 1YBUA 1ZAVA 1L5UA 3RAQA 1R8AA 3HJFA 2DR6A 2EFVA 2V6AA 3J7YU 3OL6A 2FJXA 4WJBA 5DDPC 3MMBB 2J7KA 4FXWA 1RT3A 3EVWA 3V5RA 1RLDA 4ZCMA 5DLFA 1YQHA 1S97A 4NPOA 4GMKA 4RR5A 1H38A 4ERDA 1IBLJ 2BA9A 1NLKL 2B56A 4LF6J 3X1LB 2NR0A 3M05A 5EWFA 4F8RA 4RBVA 1NH7A 5CH7B 3H5XA 2GHVC 3KLGA 1SH3A 4C8OA 4F0HA 1JJ2R 1FJGF 2VJVA 3QGIA 4BC9A 1RHMB 3SIPB 1TUGB 3GILA 2UP1A 5A2QY 4ZMMA 4ZHRA 1NDKA 5AXLA 2PO4A 3AT1B 3PXGa 1WDTA 5B09A 8AT1B 4RUCA 3H4DA 1UA0A 1FHTA 2ZH9A 5IV3A 4RO0A 2AEJA 4L6V3 1IBCB 2EBGA 3C8YA 3MECB 2D9OA 4R25A 3R3TA 4TY9A 2ABYA 4RW4B 3BBFA 2HZVA 5EN1A 1RHKB 3DMJB 1YJTA 2PC6A 5DO2A 5KFVA 3P96A 3I32A 4DSKA 4KGXB 4FKXA 3D5MA 3PFEA 1RT2A 2HWHA 5E41A 3I4PA 2NYHA 2K06A 4OZ1A 4NLQA 1Q81T 1CS4A 4HEA9 4PEOA 2DRBA 1RYSA 4NI2B 4UOHA 5LJ3Y 3MUVP 4U96A 1NZAA 4LF4F 4HTJA 5AXKA 4Q2LA 3TAMB 2DNLA 3UVJB 4KKOA 3W5ZA 3H5SA 3AH6A 2XBPA 4K5SA 1VBZA 1CJKB 1O5JA 2RF2A 2VZ9A 3PEHA 1JQGA 4N8NA 1O6XA 2QJ3A 1N32F 2V2VA 4ZVOB 2DR9A 4CCHA 2R7RA 4QW8A 2HBYB 5KFEA 3OVSA 1RISA 4M5DB 1DZ5A 1RAEB 3ENAA 4M5MA 1T95A 3R7NB 1HI8A 4P7VA 2XLJA 3AOAA 2W7AA 4AXJA 1WHXA 1IBKF 1FE4A 3DMJA 4WWSA 2Y1LB 3CEDA 2CVIA 4I1TA 4NLVA 1K47A 1WI6A 4ZCIA 2ERRA 3JAMY 1FJGJ 2CPEA 1BY9A 3BDEA 4WFZA 3KFWX 2ZC3A 3LH2S 2P2CB 1DARA 3N79A 1SJFA 4TNOA 2J0SD 2LU2A 3ZFVA 2E7XA 2WSCC 3GP9A 4NLRA 1JLQA 5G4DA 3W8PA 5KFQA 5L39A 1D9DA 2Y3YA 4B02A 2DRAA 2Z30B 1HHQA 1RA6A 4NLXA 4CO1A 4WFBQ 4DSIA 1W26A 4MH8A 5HLFB 5FD1A 2LKZA 3BEGB 1B7YB 1R6VA 3KJNB 4DSLA 3LALA 3L4BC 1NDCA 3H4BA 1TKZB 2GIFA 2J9CA 5M2RA 3ZZ0A 1TL5A 2XY6A 3MR2A 4ED5A 4OI3A 4LR8A 1IN0A 2MQLA 3DLKB 3BPDA 4ES3A 3UCZP 3EGNA 1REVA 4JI4J 1WC4A 5BR8F 3AAWB 1BMQB 1WSVA 2C3UA 4XPEA 2PMWA 4G6VB 2GA7A 3KLEA 3TARA 1M1GA 4C8LA 3CSKA 2KHCA 2YKMB 4PXEA 3AD9C 3HHEA 4UW2A 2GIRA 1P1TA 4USHA 1N5QA 1AZSA 3A8IA 3BPSP 4MFBA 4FVMA 1GEHA 2E5IA 3T6BA 3KXDA 1GT8A 3BB5A 4ETXA 3OJSA 3MFIA 3EZ5A 1DTTB 1RTJA 4L3KA 3TANA 2OGUA 3RBZA 5J2MA 3CD0A 5M2UA 4UZBA 4PG5A 2LQ9A 1RTHA 1T0TV 2N3OA 2DGUA 4G1PA 5AT1B 2X1AA 4IRCA 2RT3A 3CCLS 2AJFE 2FVPA 3QRRA 3HHKA 3DOLA 2IAJB 2L48A 2M4MA 2YKAA 3B78A 4HHJA 3QJLA 4O0IA 2DCLA 3DGPB 2COLA 2OPRA 4UY8T 2R7TA 1ACMB 1NK6A 1V5IB 2AHOB 2E5LF 1KTQA 1Z2ZA 1FCAA 3OHBA 5KFLA 2E66A 3EX7B 4DFKA 3DU6A 1EP4A 3D3CJ 4ZPCA 2D41A 2JNJA 2W1BA 3CJ3A 3QSIA 4WP9A 1UEVA 3R1HA 1HNVB 3I87A 2JEFA 3U1LA 1YSJA 1JNRB 4ZP8A 3SQOP 1HW9A 1KS2A 2G4BA 4Y2KA 3ENVA 2R2TA 3HHLA 3I9ZA 4B3RF 2KRBA 3JQKA 5IV4A 1Q16B 4QU6A 1KVJA 5HAOA 3W7BA 3M7VA 1EKRA 1F5BA 3M2VB 2J5AA 4O0NA 4QPTA 1Y0HA 1ZYQA 2AYMA 2CQ4A 1QE1B 2GGPA 1IKWB 2XS5A 4IQXA 1KBRA 1TK5A 1VRTA 5D4NA 4CRJA 1OQ3A 1LWFA 2CXEA 3QGPA 2KVQE 5CHCB 2AQ4A 1F1BB 1M5KC 4X4UA 1QE1A 1S6PA 2GGPB 2XHCA 4NLYA 2R2UA 1RBOB 4AQYJ 3BQ1A 5GMKa 2EFOA 1SV5A 5KT3A 2DO4A 3DRXA 5DG9A 3JAMU 2RIJA 2ZZMA 4M5IA 1QAYA 2R8IA 4PRFA 4RWXA 3MUTP 2RHQB 3TYTA 1OQ6A 3IR6B 2MQPA 2H54B 1NKCA 1H72C 1F5CA 2ZBQA 1ZAWA 2JRSA 1NB2A 4RNHA 3VAIA 2WVFA 1HQEB 4ZLJA 3KLFB 2VHGA 3SDEB 2IDLA 4HI1A 2AIRB 3MM6A 4DR3F 2HQIA 5D4OA 3T1HF 2RRAA 2W9CB 3E2EA 2GJIA 2MLXA 3PRDA 3FCHA 1TL7A 4I56A 2CQHA 4K4WA 1RWMB 4OYXA 1KLNA 4MYTA 1R0BG 3TZZA 5J2PB 4ETZA 1KLMA 2E1PA 4X84A 3A3OB 3QO9A 3DM2B 4X65F 1UL3A 4J9PA 2EC0A 4DV7F 3DOLB 4C8YA 2FC9A 3M6VA 4NMXA 3DLBA 1B64A 2OMLA 1HBOB 1GTEA 1HHSA 2A2DA 2CPHA 4WYWA 1S1XA 5J1NA 3TX8A 3VR1A 4CLLA 2W8LA 4AYBD 4G1IA 3FDSA 4RNOA 1IKWA 2CPFA 5KFAA 5F8GA 1X4BA 3PR4A 2J9EA 2CNLB 4DFJA 2OD6A 3VAKA 4YFUA 2XB2D 1HD1A 1FXLA 3KWMA 5HN0A 2DJWA 1HI0P 3EVOA 2Z8QA 4RW4A 4HHHA 4ZVUB 1URNA 1AFIA 3HXMA 1HNZJ 1I5OB 3DRSA 5GADI 1UJ5A 5BYQA 3TRGA 2D9PA 1T02A 4ZPDA 3HHDA 2BKNA 2MZRA 5ETLA 4ZVTB 1AA1B 3HX9A 3NWRA 4Q7AA 5T7LB 3RGIA 5KFHA 1NB7A 4UY85 1IXKA 3FK4A 3DGVA 4URQU 4AL6A 2IM1A 2QZ8A 1X4CA 2WRMA 3VV2B 3ZNUA 3J7AN 1X8DA 2L9WA 2JLFA 4ZN1A 1XR6A 2ALZA 3G9CA 2DNZA 1BGXT 1Q78A 1RWWB 2Z0GA 5HROB 1FRXA 1JJ4A 2DXDA 2FY8A 1HWUA 1KQFB 2EFGA 2EPIA 4KH1B 4CLSA 3M2UA 3M9OB 5JXSA 3EGVA 3H0PA 3JB9k 3MEGB 5KG3A 4IFVA 3MM7B 4EO8A 4ED4A 2VPXB 2KU7A 3AOBA 4OX7A 4DU7A 2G9OA 1X9WA 3MOJB 2EEYA 3C6TB 2UXCF 3FSIA 3P8BB 2FQQB 3VAFA 1U47A 1C1CB 3PG9A 1AZSB 3I55S 4ZVPB 3GCWP 2DVIA 3GIMA 3MXHP 2CA9A 2RJZA 4FF3A 1DBDA 1SL0A 3OR2A 4ANEA 1BUXA 2XEXA 1TKXA 1SQFA 5HVGA 4J9MA 1UVLA 3K59A 3BN7A 3CULA 1IJEB 3PDNA 1VQ9S 1EHWA 2A10A 2Y1RI 1CJVB 2ACMA 3MWBA 3UDVA 4ELTA 2MLZA 3HVWA 2UUAF 4JOUA 4ZLLA 1GMWD 4JI6F 1RB0A 3V4MA 1TKZA 4A8YA 1W25A 3OQ2A 2CQIA 1HFEL 1N36J 2NQPA 2BACA 1JLEB 3DOMA 2N4DA
chains in the Genus database with same CATH topology
3VVUA 4WBFA 1MN7A 4O0NA 1NDPA 3Q8YA 3BBFA 2ZUAA 1LWXA 4HR2A 5C7PA 4FKXA 4ANDA 2DXEA 2BEFA 1S57A 3BBBA 1S59A 2HVDA 3FCVA 1WKLA 4UOHA 1WKJA 4KPCA 3VVTA 1NHKL 3ETMA 4CP5A 1VYAA 1HIYA 1NDLA 2CWKA 2DY9A 3NGSA 1NB2A 1MN9A 4W98A 2B8PA 3ENAA 3MPDA 2HVEA 3FC9A 1W7WA 3Q8UA 3Q89A 3EVMA 3BH7B 3EMTA 4ENOA 1F3FA 1B99A 5CABA 3DKDA 3JS9A 1S5ZA 4DUTA 2B8QA 3FBBA 4S0MA 1B4SA 3DDIA 3NGTA 5CAAA 1HLWA 2AZ1A 1F6TA 4UOFA 1NSQA 5IOLA 3GP9A 3NGUA 3FBCA 1WKKA 1HHQA 1NUEA 2AZ3A 3G2XA 3EVOA 4UOGA 3FBFA 1KDNA 4F36A 1U8WA 1NDCA 1BHNA 3PRVA 3ZTPA 4ANCA 4DI6A 3ZTOA 4C6AA 4F4AA 3FBEA 3GPAA 1LEOA 1UCNA 2DXDA 3EICA 3ZTSA 3FCWA 1XQIA 2BX6A 1NSPA 3B54A 3Q86A 1NCLA 5BXIA 1BE4A 1PAEX 3BBCA 3VGTA 4DZ6A 2DXFA 3FKBA 3Q83A 4FKYA 3R9LA 3Q8VA 3VGUA 2VU5A 3ZTQA 1JXVA 1K44A 3NGRA 1ZS6A 2DYAA 3VGSA 1PKUA 3ELHA 3EVWA 3VGVA 1NPKA 2HURA 4ANEA 1BUXA 1NLKL 1NSKL 1EHWA 3PJ9A 3EE3A 3ZTRA 3B6BA 3WX8A 1XIQA 2NCKL 3EJMA 1NDKA 3EM1A 3L7UA 3BH6B 4EK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VVU A;  4WBF A;  1MN7 A;  4O0N A;  1NDP A;  3Q8Y A;  3BBF A;  2ZUA A;  1LWX A;  4HR2 A;  5C7P A;  4FKX A;  4AND A;  2DXE A;  2BEF A;  1S57 A;  3BBB A;  1S59 A;  2HVD A;  3FCV A;  1WKL A;  4UOH A;  1WKJ A;  4KPC A;  3VVT A;  1NHK L;  3ETM A;  4CP5 A;  1VYA A;  1HIY A;  1NDL A;  2CWK A;  2DY9 A;  3NGS A;  1NB2 A;  1MN9 A;  4W98 A;  2B8P A;  3ENA A;  3MPD A;  2HVE A;  3FC9 A;  1W7W A;  3Q8U A;  3Q89 A;  3EVM A;  3BH7 B;  3EMT A;  4ENO A;  1F3F A;  1B99 A;  5CAB A;  3DKD A;  3JS9 A;  1S5Z A;  4DUT A;  2B8Q A;  3FBB A;  4S0M A;  1B4S A;  3DDI A;  3NGT A;  5CAA A;  1HLW A;  2AZ1 A;  1F6T A;  4UOF A;  1NSQ A;  5IOL A;  3GP9 A;  3NGU A;  3FBC A;  1WKK A;  1HHQ A;  1NUE A;  2AZ3 A;  3G2X A;  3EVO A;  4UOG A;  3FBF A;  1KDN A;  4F36 A;  1U8W A;  1NDC A;  1BHN A;  3PRV A;  3ZTP A;  4ANC A;  4DI6 A;  3ZTO A;  4C6A A;  4F4A A;  3FBE A;  3GPA A;  1LEO A;  1UCN A;  2DXD A;  3EIC A;  3ZTS A;  3FCW A;  1XQI A;  2BX6 A;  1NSP A;  3B54 A;  3Q86 A;  1NCL A;  5BXI A;  1BE4 A;  1PAE X;  3BBC A;  3VGT A;  4DZ6 A;  2DXF A;  3FKB A;  3Q83 A;  4FKY A;  3R9L A;  3Q8V A;  3VGU A;  2VU5 A;  3ZTQ A;  1JXV A;  1K44 A;  3NGR A;  1ZS6 A;  2DYA A;  3VGS A;  1PKU A;  3ELH A;  3EVW A;  3VGV A;  1NPK A;  2HUR A;  4ANE A;  1BUX A;  1NLK L;  1NSK L;  1EHW A;  3PJ9 A;  3EE3 A;  3ZTR A;  3B6B A;  3WX8 A;  1XIQ A;  2NCK L;  3EJM A;  1NDK A;  3EM1 A;  3L7U A;  3BH6 B;  4EK2 A; 
#chains in the Genus database with same CATH topology
 1XR5 A;  5A0Y A;  1JKH A;  2CQ0 A;  1HPZ B;  1KFS A;  1JIH A;  2ZJP Q;  2W4D A;  1IKV B;  2M52 A;  4PWU A;  4DV5 F;  2I9S A;  2YNH B;  4M5H A;  4Q8E A;  4PWD B;  1M1K T;  2RD5 C;  1SC6 A;  1VFJ A;  3MR7 A;  1Q7L B;  1PC4 A;  2H65 B;  1UAW A;  3M8Q B;  3AB4 B;  3D68 A;  1EJ7 L;  1TKX B;  2WSF C;  4XDD A;  2Q1L A;  2QL9 B;  3M30 A;  2YKN B;  1T9Y A;  3HKW A;  1N52 B;  2MZJ A;  2KFZ A;  2E5G A;  4V19 X;  1PJ5 A;  1HWL A;  1ZZF A;  1UW4 A;  2XZW A;  3MPU B;  4MTP A;  4NL5 A;  3B4D A;  2HRY A;  2FVQ A;  3O1L A;  1Q8I A;  3JTO A;  1OY8 A;  3BF4 A;  3NG8 A;  3CDU A;  4WIQ A;  5KFD A;  1HIY A;  3BGU A;  1YGY A;  2V9W A;  2U1A A;  2FHO B;  1Y5L B;  4IRK A;  4CM0 A;  2J8A A;  5K14 B;  1V5V A;  1WG5 A;  2LDI A;  3O8W A;  4IO9 Q;  3MEG A;  2OPR B;  3N6N A;  4LRC A;  3UDE A;  2W2O P;  3CCM S;  2A2C A;  1KSP A;  2VA2 A;  3SMZ A;  2WSE C;  4PQA A;  2ZKT A;  4ENO A;  5BYS A;  3EMT A;  3HMJ G;  4LFC J;  2RKI B;  1FFS B;  3MAA A;  4KE5 A;  2FPH X;  2ZD1 B;  2FZK B;  1RWN B;  1IM4 A;  4I0W A;  5J2M B;  3C15 A;  4Y00 A;  2KXH A;  2I38 A;  4I2Q A;  4P71 A;  1LWC A;  5T7L A;  4KHP J;  2XO6 A;  3KLH B;  3RBD A;  5L38 A;  4PPZ A;  4MFB B;  4FS2 A;  4J9R A;  3PW7 A;  1H74 A;  3HHL C;  1HBM A;  2RML A;  3CJ0 A;  2HHX A;  2OI2 A;  5CYQ A;  2IYG A;  4YB6 A;  1N33 F;  2HVI A;  2CG8 A;  4J9Q A;  2YKP A;  2HSE B;  2FB0 A;  4O3N A;  3NNC A;  1F5A A;  5CZV A;  2DEJ A;  1VQS A;  3H98 A;  3MMJ A;  5MAO A;  5IM0 B;  2ACY A;  1YTY A;  1ROF A;  2V5H G;  4NEY A;  3KNG A;  1VK3 A;  1U1Q A;  3QT6 A;  2ZH4 A;  2W2N P;  4CNY A;  3DLJ A;  3C6U B;  3T1A A;  2OPP A;  3TVY A;  4V19 J;  1FJC A;  1N36 F;  1LXN A;  4O4R A;  1CJU A;  5B0F A;  5IQQ A;  4XPC A;  4MK9 A;  1FD2 A;  2NXE A;  4MK7 A;  1I6J A;  2ZKU A;  3Q86 A;  1RA7 A;  5CYQ B;  4JB8 B;  2CPZ A;  2CDQ A;  1TU0 B;  2G1D A;  1LWE A;  3NCR A;  2CPX A;  3DXS X;  4FNI A;  4K8R A;  2JHE A;  4HAC B;  2NPF A;  2YNG B;  4CH7 A;  2N82 B;  2LLZ A;  1HNI A;  4R0E A;  4ZP7 A;  2XM3 A;  2HQ3 A;  1H2V Z;  3CJT A;  3VGU A;  2HNZ A;  4LVN P;  2RDJ A;  2CQB A;  5U47 A;  1YK9 A;  2V63 A;  4DDF A;  2WZ1 A;  3L09 A;  3TQE A;  4K0K F;  2WTF A;  2K2P A;  1Y00 A;  3CW2 C;  3DYA A;  4DR3 J;  1SKS A;  3DI6 A;  4CM2 A;  5KFW A;  1K73 T;  1S0N A;  3LP2 A;  1VC6 A;  2HUR A;  3K17 A;  2XTJ P;  4DL2 A;  4JI5 J;  4BS2 A;  2QE5 A;  2EKN A;  2OLW A;  4TN2 A;  1RCX B;  2H5J B;  2HZA A;  1BQX A;  3EYZ A;  5E7O B;  2KKH A;  2G2Z A;  4FF1 A;  1NPR A;  1S4F A;  1V3Z A;  3RRK A;  3QMQ A;  5L8R C;  4DV0 F;  2CZ4 A;  3KG4 A;  3PJ9 A;  2GVD B;  2RF2 B;  5HK4 A;  5KOW A;  5KT5 A;  1RHU B;  2GQQ A;  2IJR A;  3ZTR A;  4YY3 J;  3HVA A;  2X51 A;  1K8A T;  5EGY A;  5IT9 Y;  3UO0 A;  2HIQ A;  3TA0 A;  5KFG A;  2IHR 1;  4ZPB A;  2XLK A;  4DSJ A;  3FQL A;  1VQ5 S;  4I64 A;  4B9T A;  1SJQ A;  3UW1 A;  4CTA B;  4Q8F A;  1CJT A;  1TUV A;  2HFV A;  4K2J A;  4N8O A;  4QZV B;  1E6Y A;  3NS6 A;  4YDX A;  2JOQ A;  4JI7 J;  4EU0 A;  1UWA A;  3KHH A;  2EG2 A;  2IPO B;  5AE1 A;  1C0T A;  3DOK B;  1U4B A;  3Q8P B;  2MEW A;  3JQJ A;  4WU2 A;  1QSS A;  2V50 A;  1ITP A;  3I0S A;  3B8H A;  1S57 A;  1RWV B;  5GAE U;  2MB0 B;  4I7F B;  1U8S A;  1WEZ A;  4GO7 X;  2R7S A;  2V34 A;  1WKJ A;  4KPC A;  1OYD A;  5LM7 E;  2AT1 B;  2MQ8 A;  4I2P A;  4O4G A;  6FDR A;  5I42 B;  3J80 U;  4CP5 A;  1RGV A;  2B7C B;  1I3O B;  5F8N A;  4LRD A;  4A47 A;  2DY9 A;  3KLG B;  4F4Y A;  2IY5 B;  3HP6 A;  3F41 A;  3TA1 A;  4DV0 J;  2FGO A;  2VC0 A;  3QID A;  1SPB P;  2GW8 A;  2ZBR A;  2ZHB A;  4ED1 A;  1D1U A;  3SQG A;  4F2S A;  2HS3 A;  9RUB A;  5GAH U;  2CQ3 A;  1TKT A;  2AU0 A;  1RT7 A;  2YWF A;  3OR2 B;  3FEX B;  2DHX A;  3EVM A;  4PG6 A;  5B08 A;  3MTK A;  3KG1 A;  1U0H A;  1URR A;  3G4S S;  1QVF R;  3W2W A;  4KHR A;  3GFX A;  1FEE A;  3JS9 A;  1KKH A;  4PKD B;  4CNZ A;  5HP1 A;  3RZA A;  3I31 A;  4KGZ B;  3NGT A;  4MYU A;  2V8H A;  4X4R A;  1R8H A;  2DGV A;  1FX2 A;  1DTQ A;  4FZV A;  1NKE A;  3PY8 A;  2P6T A;  1FER A;  4FNH A;  3R8Y A;  2FJB B;  4DF4 A;  1T9X A;  2BBE A;  3D6M B;  3GZ7 A;  2AWZ A;  1VIO A;  4WE1 B;  2RKI A;  2PFD A;  1KQK A;  2YH0 A;  3M1V B;  3KUE A;  2X7I A;  1FWL A;  4DLG A;  3WZ0 A;  3MEK A;  4LF7 J;  2AP6 A;  4UOG A;  1U26 A;  3QPI A;  3V81 A;  2ZBP A;  3DRY A;  3QAE A;  2ALY B;  3WHI A;  4UOC A;  2B5J A;  2GIQ A;  3GYX B;  4C3K A;  2M0G B;  3D1Q A;  3I9V 9;  4N5S A;  2OSR A;  1I1G A;  5LMU F;  4YN3 B;  2IIH A;  4TXS A;  5DDQ C;  1GX5 A;  2ZE2 B;  5GAG U;  1A7G E;  5EWE A;  4OX9 J;  4USK A;  1GMV A;  3ZZY A;  5HSP A;  4ELV A;  3GG1 A;  1XC9 A;  5HMY A;  4X2B A;  1JLG A;  2MSS A;  3DLG A;  4KC5 A;  1WG1 A;  4L74 A;  5IZH A;  1D9F A;  2R8J A;  1LWC B;  4B3S F;  1HMV B;  1K1Q A;  1D9A A;  3R5D A;  2G2O A;  4QOT A;  3PZP A;  2IMW P;  2HIY A;  4ZVE A;  2V8D A;  4NCG A;  1SC1 B;  4FKY A;  2HLT A;  3CNQ P;  2L08 A;  4ZP6 A;  1YZ6 A;  3CC7 S;  1AT1 B;  4H4M B;  2CZV C;  2ZD1 A;  1BWE A;  2YH1 A;  1ZS6 A;  2B6A B;  1BQM B;  1ZM9 A;  3MAA B;  4ZIT A;  2XYG B;  1KVK A;  2VQE F;  1XER A;  3HK2 A;  1Z1Z A;  2DYA A;  2CUY A;  2GO8 A;  4PQU A;  3CJ8 A;  4ID8 A;  4DPY A;  1X7V A;  2PD1 A;  5ETP A;  3UN2 A;  1CJV A;  2HKE A;  2UVR A;  3QIP B;  4J37 A;  3W2V B;  1TUW A;  5IFM A;  5KT2 A;  4DR2 F;  2XS7 A;  4K4Z A;  3DLE A;  1AXQ A;  5L1I A;  3AJD A;  3S8S A;  2UUC F;  4QPX A;  5SUH A;  2PEB A;  2DEI A;  2HVZ A;  2DNG A;  3C19 A;  4NXN J;  2GZO A;  3MGJ A;  3BGF A;  1WDD A;  2NXU A;  1R8C A;  1RTI A;  2C2M B;  2NCK L;  2VFU A;  2MQO A;  1HNW J;  3OVB A;  2D3Z A;  3C3L A;  2F9J A;  2PI4 A;  3PM9 A;  2LFV A;  3BH6 B;  4P74 A;  4WTO B;  1S10 A;  5CYM A;  2F63 A;  2NSC A;  1RAI B;  3R6L B;  4NE9 C;  5KFP A;  1U6B A;  1AB8 A;  4ZHR B;  3SV3 A;  2YX1 A;  4WP8 A;  4ZVF A;  1U1P A;  2HYI B;  3KTQ A;  2CPI A;  3BSO A;  2FHJ A;  2VA3 A;  3T5L A;  1HKA A;  1W2B R;  2LU1 A;  2K7J A;  4HR2 A;  1HPZ A;  2AX1 A;  5CCL A;  3DDN A;  2YX4 A;  2QMU B;  2KH9 A;  3PJX A;  3IRX B;  3SI8 A;  2BE2 A;  1XMQ J;  2E1A A;  4BC7 A;  4DX8 H;  3I82 A;  3A3N B;  1T3N A;  4QU7 A;  1RWP B;  1S1U B;  2FZG B;  1HL6 A;  2W2P P;  3FCV A;  5E3Q A;  1WAC A;  2HK3 A;  2V4Q A;  4LF7 F;  3KMS A;  2D1C A;  2RS8 A;  3T41 A;  2AD9 A;  2YQ1 A;  1RT6 A;  2J6S A;  2PA3 A;  1RAJ A;  5AJ3 F;  2ZZT A;  4PXC A;  1FKP A;  2FY1 A;  2VOO A;  2MKI A;  3OL8 A;  5B0C A;  3ZZT A;  4U7C A;  5A8R B;  1EP4 B;  3OTC A;  2UU9 F;  5HMZ A;  1FKO A;  2GMH A;  4CH0 S;  2HND A;  3O5T B;  2RB7 A;  1T7P A;  3LUY A;  1SB6 A;  2M7S A;  4CH1 A;  3LP0 B;  5FDL A;  3P4U B;  5K9F A;  2HQD A;  2Q3P A;  3N4W A;  3SCL E;  1OO0 B;  4Y0F A;  1FFW B;  2R7X A;  3V6H A;  1YDL A;  3B82 A;  1FJ7 A;  3MUR P;  1JXL A;  2AJQ A;  1GNK A;  1X5P A;  3EXY A;  4HVZ A;  1B4S A;  4NML A;  5F3T A;  1J5E J;  3RR7 A;  2X1B A;  2LA6 A;  1QTM A;  3M6W A;  1NND A;  4KIA A;  5LSO A;  1F6T A;  3QZ7 A;  3IM9 A;  4PQU B;  3G6X A;  5K5M A;  4TU9 A;  4QIV A;  1V3R A;  4DV7 J;  2F3J A;  2LXU A;  5KFF A;  1S9F A;  3BM7 A;  2AEF A;  3NMR A;  1KTV A;  2MZ1 A;  4C11 B;  5GMD A;  5DM7 Q;  2D3O R;  1S1W A;  3E51 A;  5F8I A;  4D3H A;  2AJ2 A;  1OPZ A;  3I5C A;  3K89 A;  1S0M A;  3CJK A;  1F60 B;  1CS4 B;  3CCW A;  1VK8 A;  4UT4 A;  4LF9 J;  4ZPT R;  4IDK B;  3QAU A;  4K4S A;  3KK3 B;  5FLX U;  3V6K A;  2LXI A;  4YB1 P;  3TEH B;  1FXR A;  2AYE A;  1UET A;  2BW2 A;  3N0V A;  4H4K A;  1QDU B;  1S76 D;  3R27 A;  3QBC A;  4QCL A;  5H1S V;  2DTJ A;  3CE8 A;  3IS9 A;  1JLA B;  1SI9 A;  4EWT A;  2Z57 B;  2KG0 A;  2AYG A;  2OSQ A;  3FMB A;  1EET B;  3BO4 A;  1UVM A;  4NA3 A;  1RT1 A;  1KHV A;  2V0N A;  4Q0B A;  3FEZ A;  4NAS A;  3LA0 A;  2EKY A;  3Q8R B;  2OPP B;  3ZTS A;  4DX7 A;  1VQK S;  4ED8 A;  4OX8 A;  3QQC D;  4IO1 A;  1U0S A;  4F4W A;  1KOH A;  1NCL A;  2NYI A;  3FGV A;  5E33 A;  5IXU A;  2BAN A;  1SJ4 P;  2GAH C;  1M0S A;  4OZN A;  2UXD F;  3ZTQ A;  4QW9 A;  3K58 A;  1MWQ A;  3DI6 B;  1K44 A;  2MKK A;  1UJ4 A;  4O44 B;  4JV2 A;  2DGT A;  2IYI A;  2ZNZ A;  4K7Q A;  1VI7 A;  4OYP A;  5L1J A;  3FEY B;  1J5O A;  3VGS A;  3ZZR A;  2MXY A;  1FKA F;  3ELH A;  2CQD A;  2MMY A;  5KG6 A;  1L3T A;  1YRT A;  1TP7 A;  2HWT A;  1NK0 A;  2IA6 A;  3JYT B;  1REG X;  4KQZ A;  2VBY A;  3I96 A;  3P5B P;  4PYA A;  2OEK A;  3C14 A;  4R5P B;  4YY3 F;  1RTZ A;  5CD4 H;  4B3S J;  2ZBI A;  2IC3 A;  5SZT A;  5KG1 A;  1N88 A;  2QYC A;  2E5J A;  4DV2 F;  4LF8 J;  1SVD A;  3CWJ A;  4USW A;  3TA2 A;  2H1Y A;  2DNQ A;  3IGN A;  1UJ6 A;  3WX8 A;  2LEA A;  3ETO A;  3K5P A;  1IM6 A;  2GML A;  1KD1 T;  1HQU B;  1UWB A;  3BGR B;  2QLX A;  3A4T A;  1U6Z A;  2AW0 A;  3X3U A;  3GYG A;  1D8Z A;  4OMF G;  1C0U A;  2IMO A;  2ROP A;  4EBC A;  2DGS A;  4JI1 F;  1I94 J;  1MRO B;  1Q82 T;  2E29 A;  3M6X A;  4ECZ A;  3CO0 P;  2YWW A;  1XR7 A;  1IVZ A;  1JJH A;  4EBD A;  3PO4 A;  1LWX A;  1VQM S;  2MPU A;  1T11 A;  2IBO A;  1WG4 A;  3LP1 B;  2BJ1 A;  1RT5 B;  4Z2X A;  5CA5 A;  5A6P A;  1TAU A;  3C16 A;  4AE5 A;  3QFW A;  4B9L A;  4J9S A;  3M9M B;  5AJ3 J;  1KHW A;  3OV7 A;  2HPU A;  2R9L A;  1QUP A;  3CCE S;  3K5L A;  1JLA A;  3KDN A;  3RBX A;  5C24 A;  3E3X A;  2Y9H A;  3AQO A;  3SSQ A;  3ETM A;  1N8R T;  2Q6B A;  2FVR A;  3CD5 A;  3VCD A;  2NXC A;  3GCX P;  1NO8 A;  1MWY A;  1EQ0 A;  1NDL A;  2WCX A;  3FZB A;  3LPY A;  1TEL A;  4PWD A;  3NGS A;  4IG3 B;  4PYD A;  3AD8 C;  3AA8 A;  4DQP A;  3C15 B;  1P9Q C;  3TEG A;  3A3P B;  2D3U A;  3KJF B;  4U9R A;  5DZ7 A;  2KDO A;  1RSC A;  1X0P A;  4PAA A;  5K8P A;  1VQY A;  3AD7 C;  1U2C A;  1S7I A;  5IT0 A;  4JI0 F;  1LXJ A;  5I4M A;  4PG7 A;  4YUD A;  4I69 A;  2BW7 A;  3WBZ A;  4CLF A;  1VQN S;  3Q8Q B;  1XNR F;  1B99 A;  2I5J A;  4RWW A;  4C0O C;  5DGA A;  3SCI E;  3DXB A;  1N5Y A;  2IBK A;  5F0W A;  4EUV A;  5A8W A;  1B70 B;  1KWM A;  2JLG A;  2VPY B;  4F26 A;  2HMI B;  4OLP A;  3TJ8 A;  5HQ8 A;  4J9U E;  5JJB A;  1NPP A;  2MZQ A;  4W4M A;  4KHP F;  5D4P A;  3QT7 A;  4Q5V A;  2HHT A;  1HNX F;  4AT1 B;  3NGU A;  4U7U K;  1FVQ A;  1N6Q B;  1EIY B;  1OY9 A;  2ZOG A;  1JLB B;  4LFB J;  3RYL A;  5HBM A;  2KB2 A;  3CCJ S;  3HDS A;  1TFY A;  2AZ3 A;  1VIS A;  4GKK J;  4NYO A;  2QLB B;  1U8W A;  2VFV A;  1Y9O A;  4MMO A;  4FBU A;  4XO0 A;  2QSW A;  2RDD A;  3QWU A;  2MKH A;  2XUL A;  3IBF B;  5E0O A;  1LK7 A;  3TR5 A;  1FX4 A;  3M2R B;  3VAJ A;  3BDP A;  1IR0 A;  3NL0 A;  4YOE A;  1ZAX A;  3AY0 A;  4LF1 A;  1IUJ A;  2AMC B;  1Q8K A;  3OTO J;  4F04 B;  2JEI A;  4F4A A;  4RW7 A;  4OZ3 A;  2F40 A;  1RXO B;  3DOM B;  2QFJ A;  2KT5 A;  2QIF A;  3EDQ B;  3GPA A;  4ICL A;  4UQT A;  1PYT A;  3MFH A;  4H4O B;  2V4J B;  2HHW A;  3HT0 A;  4Y2A A;  5ETK A;  2FLN A;  5CZX A;  1VQ4 S;  2BX6 A;  1P1L A;  1IKY B;  2B4U A;  4OHX A;  4DWI A;  1ZH5 A;  3PX6 A;  1GXL A;  2J7W A;  4NLT A;  3RB6 A;  4PUO B;  1M5P C;  4M1K A;  4GVB B;  1XNQ F;  3UQS A;  1NM2 A;  4LFA F;  3QGG A;  4NYP A;  3H8Y A;  4DPU A;  4ECY A;  2BR0 A;  1R0A B;  1H98 A;  1S6Q A;  1X5S A;  4R0J A;  1HBM B;  1PIL A;  1S49 A;  2BRK A;  2LQ8 A;  3L7O A;  1CEZ A;  3TVZ A;  3TAP A;  1RT5 A;  1S72 S;  4K59 A;  4KFB B;  4CQ1 A;  4CT9 A;  5B0B A;  2V69 A;  3EZU A;  2JJ4 D;  1K1S A;  3MEE A;  3MPW A;  4NA2 A;  3H25 A;  4USI A;  1BWV A;  2V8G A;  5E3P A;  1IKX A;  4M5D A;  1XMB A;  2RH3 A;  4RX6 A;  4IH6 A;  2A6O A;  2Y1J A;  6AT1 B;  2BV3 A;  1RQ0 A;  1CC8 A;  2N4C A;  3TJ9 A;  1Y5I B;  2FJV A;  1HBO A;  1RKI A;  2MQQ A;  2GAG C;  1O51 A;  2CJX B;  2LQJ A;  1TMJ A;  2MKY A;  4KKO B;  3HUL A;  5F9L A;  4EBE A;  3C46 A;  3IM8 A;  1S0O A;  4TYB A;  1FRI A;  3MR5 A;  2MHE A;  1R89 A;  2BM0 A;  2R7U A;  3PR5 B;  3DFE A;  2HS4 A;  1CQM A;  3ENQ A;  1SJ1 A;  4P75 A;  1LW2 A;  4NYZ A;  1HW8 A;  2ZVS A;  1YVF A;  3OTB A;  3ZNJ 1;  2BJE A;  2CAJ A;  3I56 S;  3V4I A;  1PJ7 A;  1UZD A;  2YWE A;  2XQC A;  2ZH3 A;  4WXW A;  1PO6 A;  1VQ8 S;  4N7T A;  1TL1 B;  3NGK A;  1N0U A;  1VBK A;  2BXJ A;  3LF0 A;  4ALZ A;  1RE1 B;  4N77 A;  3ILJ A;  4LT6 A;  4DEZ A;  5C7P A;  2EWH A;  3BSN A;  4OFZ A;  2F5G A;  4IH7 A;  3FJ2 A;  4X62 J;  1R3N A;  1WC5 A;  2FTR A;  4WTY A;  2Y0B B;  5LXR A;  1XMO J;  1GX6 A;  1S9G A;  5KFM A;  2Z2Z A;  3MOZ A;  1T03 B;  1FO1 A;  2C2N A;  4LVO P;  1GQE A;  2HQC A;  3N28 A;  4HHU A;  1VRU B;  1Y5N B;  4A8X A;  4F2R A;  4N47 A;  1Q8L A;  4URS A;  1FT8 A;  2IVF B;  2QMW A;  1TMM A;  3NRB A;  4CLP A;  4NCB A;  3EZO A;  4QWB A;  1B0T A;  4JP8 A;  4LBH A;  5D78 A;  4XTT A;  5J1E A;  3J7Y I;  2PFF B;  4JI3 J;  4C9D A;  4Q0B B;  3TVK A;  2ZH1 A;  1HQU A;  1WD6 A;  4TLQ A;  3C2P A;  1N33 J;  1WF1 A;  1UKU A;  5DM6 Q;  2BJ3 A;  3M8S A;  3Q89 A;  3V2U C;  1S77 D;  3IBW A;  1GTH A;  2QN6 B;  4K4X A;  2EC2 A;  3BSC A;  3MF5 A;  3W66 A;  3HZE A;  1C0T B;  1S5Z A;  2ZNY A;  4ZVQ B;  4WYL A;  2RNE A;  5KT6 A;  4ECX A;  3DDI A;  4KO0 A;  2HGM A;  2HZC A;  4WU3 A;  1QLN A;  2YXL A;  2OO4 A;  3QIP A;  4USM A;  2WBR A;  5ETV A;  1T05 B;  2OPS B;  2M8H A;  3D1H A;  4YB7 A;  1RAH B;  3MUM P;  2VQF F;  4IR9 A;  2F9D A;  3G8Q A;  2ILZ A;  5KFS A;  7AT1 B;  4JI0 J;  4QR1 A;  2QFI A;  1FVS A;  1S1T A;  2HHP A;  3FBF A;  1ZPV A;  4F36 A;  2KG1 A;  2C2E A;  2VOP A;  5L9N A;  3LOU A;  4DUZ J;  1VQO S;  4USU A;  4L75 A;  4G65 A;  3K5O A;  5D3G A;  2LQ5 A;  2R8H A;  1S1T B;  2F8E X;  5B0A A;  1PYO B;  3ILO A;  5HVH A;  4LFA J;  2KRR A;  3ET6 B;  3MPV A;  1XK8 A;  3P5T L;  2DIS A;  2VFT A;  3MED A;  3NLC A;  1CSJ A;  3RU0 A;  4DI6 A;  1RHJ B;  2FJE B;  3OFH A;  2Q79 A;  3NOC A;  1SC3 B;  3KK1 A;  1S9E B;  4DF8 A;  3OD2 A;  4NX9 A;  5LJ5 Y;  1S6Q B;  2R4F A;  2HHU A;  1GFW B;  3T5H A;  1H3D A;  1PCA A;  4HAC A;  2ZDO A;  3N5F A;  4IOA Q;  3B4M A;  1LKZ A;  2F4V J;  2KM8 C;  3D2W A;  2RU3 A;  3W1Y C;  4P2X A;  3BBC A;  4PG4 A;  2ZEJ A;  4RPF A;  1RT6 B;  4ILR A;  2XMM A;  2JVO A;  4OV1 A;  2MQM A;  1RU1 A;  1TL3 A;  4PR6 A;  5LMN F;  1C2P A;  2ZIT A;  5EWG A;  1UMJ A;  2MY8 A;  2DH7 A;  2RE1 A;  3D3B J;  1X4F A;  1RUS A;  1HBN B;  3V81 B;  1UVJ A;  3OL9 A;  2HW3 A;  3GFH A;  2V8V A;  2ADB A;  1L3U A;  4MJK A;  2DPJ A;  4HDG A;  3EGZ A;  2FC8 A;  3K0J A;  2Z2Y B;  5A8K A;  3KHR A;  3CXC R;  2O3D A;  4DL6 A;  1NJY A;  1NJI T;  4YEA A;  4GVL A;  3EUN A;  4TLR A;  7FD1 A;  4UF4 A;  2ATC B;  1PJ6 A;  1VJW A;  1NSK L;  1RWO B;  4P72 A;  1UWB B;  2C2O B;  3BGR A;  1WEY A;  2LQB A;  1JLC A;  2UV8 G;  3EE3 A;  5EUH A;  4TQR A;  4ZCL A;  3KK2 A;  2WOM A;  3JXO A;  4DR2 J;  3TW0 A;  2IFX A;  5KT4 A;  4OJ1 A;  1B7F A;  4NOH A;  3LP0 A;  2DT9 A;  4TYA A;  5FDL B;  3VAH A;  4B3O B;  1LFW A;  3AJ1 A;  1LV5 A;  2W01 A;  4OJ3 A;  4QR0 A;  2B9E A;  1IBK J;  4AUK A;  3KK2 B;  2F8H A;  3KLH A;  2XMA A;  1HNI B;  2JX2 A;  4F50 A;  1Z2L A;  2ASJ A;  1U02 A;  1DLO B;  4JV5 F;  4DG1 B;  1RBA A;  4QIE A;  5EX3 A;  3FSY A;  3J81 U;  2JFK A;  4P6Q A;  4O3O A;  3GG0 A;  3TUZ C;  3QSY B;  4DR4 J;  3PW5 A;  2DHH A;  3AB2 B;  3ZC4 A;  3W63 A;  1XTZ A;  2VBZ A;  2XYP B;  2D69 A;  1QAI A;  4NCA A;  1VBX A;  2DNH A;  2V4J A;  2ZH6 A;  3T1Y F;  2AYB A;  2Y0S D;  4ICL B;  5J1E B;  2WBM A;  2CYY A;  2POK A;  3H5U A;  2XWY A;  4I2P B;  3TO8 A;  4DU8 A;  3MCN A;  4DR5 J;  3Q24 A;  3GJS B;  5HI7 A;  2WON B;  3IFE A;  1S12 A;  1L3V A;  4I6W A;  4ER8 A;  2CJB A;  2JC0 A;  2YPZ A;  1NXI A;  4NCG B;  3ZXW A;  3OLB A;  3GV7 B;  3QT8 A;  4ED2 A;  3M8R A;  1B0V A;  3RW6 A;  3JTN A;  5C2C A;  4MKA A;  1TTH B;  1S48 A;  2B9W A;  2P9C A;  3NXZ A;  4IYQ A;  4JI7 F;  1FDB A;  3DC2 A;  5C25 A;  2B8P A;  2WAQ D;  3CIZ A;  3G87 A;  3MZI A;  4ZP9 A;  4CLW A;  8RUC A;  1X9M A;  1XWL A;  5LMU J;  2J0Q D;  3DRS B;  3LW5 C;  4HI2 A;  2HHQ A;  3GFZ A;  3DRR B;  4F4K A;  5IT9 U;  4LRF A;  3L7P A;  1U2F A;  1X4D A;  4LSN B;  1NK5 A;  4M95 A;  4MK8 A;  1IBM F;  3LP1 A;  3NP5 A;  1F3F A;  3R5B A;  1TV6 B;  3HHN B;  2MTL A;  1ICE B;  3HO1 A;  4LRE A;  3UCG A;  3HT3 A;  2FLP A;  4OHY A;  4IDK A;  3M4X A;  5DG7 A;  3QJP A;  1Q5V A;  1CQN A;  2DIV A;  3G82 A;  4X64 F;  3TI0 A;  2NRE A;  2AZ1 A;  1N5Y B;  2BAB A;  2JL9 A;  2RQ4 A;  5FLX Y;  4UQG A;  4JV1 A;  4EMD A;  4DLE A;  3UD4 P;  4CYU A;  4RL1 A;  2FIU A;  3DHW C;  5D15 A;  4FF4 A;  4PXD A;  2YKQ A;  3M8P A;  2XMT A;  2ZWP A;  3KJQ B;  3MI7 X;  4LSZ B;  4RUH A;  5CD4 A;  1FJE B;  2BMB A;  1T9W A;  3KLI A;  4EI2 A;  1IKX B;  3IWL A;  3O44 A;  3WC0 A;  3KNA A;  2V67 A;  4Y6I A;  2FLL A;  2W9C A;  4DPX A;  1FRH A;  3HF5 A;  1RYR A;  1DLO A;  1FNX H;  5ETS A;  3T3F A;  2UXB J;  1BHN A;  3JSR A;  4HT5 A;  4LSN A;  4OJH A;  4ZJO A;  4JI2 F;  5JVG Q;  1YJ7 A;  1OS5 A;  3JSB A;  3W2W B;  4ZS6 A;  2FLO A;  3LGM A;  3MM9 B;  1HR0 J;  4JBC A;  2J9D E;  3MCS A;  2HND B;  2DNY A;  2WOM B;  4ZA1 A;  1DUR A;  5K8O A;  3OXF A;  3T19 A;  4EEY A;  3FBE A;  4NZ0 A;  3IWN C;  5A76 A;  4IQM A;  3H20 A;  2UXB F;  4NXM J;  4DCP B;  2GS8 A;  1X4G A;  1SBR A;  3OL7 A;  3O3L A;  2UVW A;  4DSF A;  3R5C A;  2HG4 A;  3DDK A;  5HJY A;  1WEL A;  1U1R A;  4OIX A;  4E98 A;  3G6V A;  5D4L A;  4A8M P;  4QIG A;  4ECW A;  1YHQ S;  3E01 A;  2Z2M A;  2RS2 A;  2DXF A;  3PX0 A;  1G6B A;  5I42 A;  4QWC A;  2RUS A;  3UNG C;  2W4C A;  2ILY A;  3U1M A;  1FXD A;  1OIA A;  2VIC A;  1H7W A;  3PIP Q;  3BZQ A;  4O3R A;  1Y11 A;  2NXJ A;  3KG0 A;  3ISN C;  3S7R A;  4LBI A;  5BJR A;  2CPY A;  2FUG 9;  5HJX A;  1NKB A;  3CD7 A;  1KP6 A;  1MG7 A;  4DG1 A;  2YNF A;  2GO9 A;  2M9K A;  2NXN A;  3ZZP A;  2JVR A;  4RNM A;  3SV4 A;  5E3R A;  1E6Y B;  3EPI A;  3OLA A;  4FPI A;  4DL5 A;  2OP5 A;  4YB5 A;  3GII A;  1Y10 A;  4O23 A;  5D8H B;  3W8G A;  2R7Q A;  4EYH B;  4RU2 A;  3HSJ A;  1M5H A;  4K50 A;  1NSA A;  4GO5 X;  1J5E F;  3EJM A;  2ZOM A;  3BS9 A;  4TY8 B;  4FP9 A;  3VHQ A;  3V6J A;  3CDA A;  1U25 A;  2HFZ A;  2VL1 A;  1LOU A;  1HR0 F;  3ILL A;  2JH3 A;  2BAN B;  2HS0 A;  2V2Z A;  4GRS A;  2EFP A;  3VVU A;  4C2M A;  4YR0 A;  1Q8B A;  2PA8 D;  3S6E A;  1NDP A;  1FDD A;  2VG5 B;  3OSP A;  4QIF A;  1QY7 A;  3BN4 A;  3PO5 A;  2X1F A;  3QO9 B;  3KOA A;  1HBN A;  3DN9 A;  3MEE B;  5AE3 A;  1GXT A;  2BOP A;  2G2Y A;  3DYA B;  4RLE A;  3G82 B;  2O67 A;  5HAT A;  3BBB A;  4ECQ A;  2VG7 B;  1WKL A;  3CCS S;  1YI2 S;  1RT2 B;  3TP2 A;  2EBE A;  2PE8 A;  4LBP A;  5GME A;  4WFN Q;  2D7S A;  3I4H X;  4UZC A;  2DPI A;  4KH0 B;  4F7V A;  1LQ9 A;  2B4P A;  1N5S A;  2YNG A;  5BR8 J;  1YBA A;  1R0C B;  4DR1 F;  2ASL A;  2HHV A;  2E44 A;  4IG0 A;  4X64 J;  2VG6 B;  1EQM A;  2KM8 B;  1RTD B;  4IKA A;  5GAH I;  5ETO A;  4XDC A;  5JVH Q;  4W98 A;  2ZDP A;  4K5R A;  1S9E A;  4B9V A;  3SYZ A;  3C16 B;  3HSZ A;  3POT A;  2IA0 A;  1JKH B;  2Q6C A;  5F0U A;  1TK0 A;  3FC9 A;  1S1V B;  3QLH A;  3KHG A;  1W7W A;  1KC8 T;  4YR3 A;  3QJJ A;  2B4O A;  3Q8U A;  2E9R X;  4DOZ A;  2NZC A;  4YQW A;  2QTW A;  3SZ2 A;  1U7L A;  1MRO A;  3R6G B;  2UUT A;  1VS3 A;  2GJ2 A;  2OPQ B;  3FRY A;  4ZKA A;  4ZDN A;  1Q4R A;  2DGW A;  5DQG A;  4GKJ F;  3PVX A;  3CIM A;  1NJW A;  2XG8 A;  2UV8 A;  1WJ9 A;  4PAB A;  2OTJ S;  3R5J B;  2ZOF A;  2R7W A;  4DFP A;  2MJN A;  3BO3 A;  4OZ2 A;  1SJR A;  2BE9 B;  4EO6 A;  1NJZ A;  4C8M A;  4LQ3 A;  2B43 A;  4DV3 J;  2H9Z A;  1R8P A;  1MU2 A;  2HAI A;  4DR5 F;  3HI9 A;  2E5L J;  4QYZ K;  1TVR B;  1BXN A;  2O66 A;  2JDJ A;  5DDR C;  3FNN A;  1WOP A;  2XYH B;  3CVK A;  3JYT A;  3ZZU A;  4AXI A;  1HQE A;  1RDR A;  3KLF A;  1DFD A;  2QRR A;  3S01 A;  1VOM A;  4I6Y A;  3MMA A;  3U7J A;  2KI2 A;  1YRU A;  4CO2 A;  3MHY A;  4OYW A;  5C2G A;  2DGO A;  4DCO B;  4QYZ J;  3RR8 A;  1SL2 A;  1TKT B;  2DIT A;  3I6P A;  4I4B A;  1I51 B;  1FTC A;  2YWK A;  4C7Q A;  4A46 A;  3HFV A;  2DNN A;  1VC5 A;  1BQN B;  2QGF B;  4NLD A;  2WW8 A;  2OFG X;  2QA4 S;  4RJV A;  3IRX A;  1J5O B;  2DR8 A;  1G3O A;  3C6U A;  3MCM A;  2Z2L A;  4J91 A;  4C0H A;  4DN0 A;  2JZ5 A;  2JSX A;  7FDR A;  1H0H B;  4U6P A;  2UZA A;  1Q7Y T;  1NHU A;  1UFL A;  1WNE A;  3AJ2 A;  4IG3 A;  3CJS A;  3N6L A;  4LF9 F;  4OI1 A;  4A4J A;  1CPZ A;  2GHP A;  4OX6 A;  5ADZ A;  5J2Q A;  4DPT A;  3VTI A;  3R5A A;  4ZPV R;  4QJV A;  4B08 A;  2W9B B;  1BD6 A;  1T03 A;  4CLK A;  5MLC V;  3CF5 Q;  1VC0 A;  3J80 Y;  4L76 A;  2XMK A;  4OZL A;  2QX0 A;  2AEM A;  2MY7 A;  2CG4 A;  4ED6 A;  4OI2 A;  3M30 B;  3RB3 A;  4ZLP A;  1IWG A;  4JI1 J;  1C1B B;  3GV8 B;  1U2R A;  2IDE A;  3PCO B;  5KG7 A;  1CBK A;  5KFT A;  1OSD A;  2IJN A;  4LIW A;  3HCX A;  2HGN A;  4X4P A;  1NPK A;  3QRQ A;  1G1X A;  1LW2 B;  2H5I B;  4F3O A;  3CUN A;  4LUB A;  2C28 A;  2SXL A;  4OI0 A;  4ZJQ A;  1FK9 A;  2JFD A;  3FQK A;  4LR7 A;  4KGM A;  4DR1 J;  1VIX A;  3A8J A;  3M8P B;  1CUL A;  3M8W A;  2BDP A;  1R31 A;  4X65 J;  1C0U B;  3OTD A;  4FXV A;  1R7I A;  2GVZ B;  3A8K A;  2RUG A;  2F65 A;  3M1V A;  4HDH A;  2ZHA A;  3VAM A;  5L9X A;  1S0V A;  1Q1K A;  1VJQ A;  2AKW B;  3GU0 A;  4UUX A;  4QBU A;  3N01 A;  3OFE A;  4C3M A;  4WXO A;  4FN5 A;  4LF5 J;  4M5K A;  3PW0 A;  3Q0A A;  2XHW A;  2OEJ A;  1VHF A;  2RU9 A;  3DRP A;  4WBF A;  1K0T A;  3IBC B;  5CYJ A;  1PGZ A;  3T1Y J;  3MDF A;  1PBU A;  2GCF A;  1NAQ A;  4PXB A;  3RW7 A;  2QA2 A;  2UXD J;  1EX8 A;  1U1M A;  2ZUA A;  2MKC A;  3R5G A;  1S79 A;  2HLU A;  2PSZ A;  1X5O A;  2W24 A;  2P6S A;  4KBI A;  5HBM B;  3MR6 A;  3R1L A;  4B3R J;  4DMZ A;  1Y3K A;  2BEF A;  4BCA A;  5J2N B;  2VAS A;  2BQR A;  2W4P A;  4NLU A;  4WCE Q;  3MTJ A;  3G96 A;  1QAX A;  4IOC Q;  4GKK F;  2VH7 A;  3W2V A;  2JEJ A;  1YJR A;  4WZQ A;  1MML A;  3IA0 A;  4DUY J;  1WOO A;  3P3D A;  5K8M A;  3OTO F;  5I3U A;  1D8Y A;  2QEX S;  1R43 A;  1FRJ A;  1NH8 A;  2FHM A;  4IFV B;  2A18 A;  2GNK A;  2RSQ A;  1FD8 A;  5KFZ A;  3T6J A;  2MGZ B;  4A8Q A;  4I6A A;  1HNX J;  5H9F J;  2PDA A;  2UUC J;  2CJK A;  2X3G A;  3E8O A;  2C2D A;  2E7V A;  1AUS L;  1Q79 A;  3T9N A;  3IG1 B;  4RW9 A;  3CPW R;  4WPA A;  4WK1 A;  1TFW A;  4EYI B;  5CQG A;  2KYZ A;  3HZG A;  2DH9 A;  1KQG B;  3WDO A;  4NLP A;  2RQM A;  1X31 C;  2C3P A;  2RVJ A;  4DHV A;  5IQ6 A;  4IG0 B;  3RBE A;  1C1B A;  1E6V A;  3SXL A;  3UDL A;  2OHD A;  2XSJ B;  5IT4 A;  3G6Y A;  4FS1 A;  2KJW A;  1RK8 A;  2QMX A;  4X4N A;  4FYW B;  3LAK A;  4H4K C;  1NSQ A;  2VF3 A;  2YX7 A;  2KJV A;  2CQ2 A;  3T5K A;  1C1C A;  2F8M A;  2IM3 A;  1U1N A;  4Y3C A;  4LF6 F;  4FYX B;  1J2V A;  1JLC B;  2XMW A;  5LSL A;  2HGL A;  1VBY A;  3CC4 S;  1RHR B;  2XY7 A;  2KO1 A;  2XNQ A;  2HFO A;  4B3T J;  2XNR A;  4OZ0 A;  1DHM A;  4PZV A;  1NHV A;  1YKW A;  3OVA A;  1WC0 A;  3CDE A;  2WON A;  4P7T A;  4DV6 F;  1C4A A;  3OW2 R;  3BRE A;  4CLZ A;  4DV1 F;  3DLH A;  3R97 A;  5FJ4 A;  4LMZ A;  3D54 A;  5EX0 A;  1RAG B;  2FGC A;  2RRB A;  2XCP A;  3T1H J;  3NOG A;  3LP2 B;  2UUB J;  2UU9 J;  4DJB A;  5J2P A;  4F25 A;  2PEH A;  4LFC F;  4ANC A;  4NI2 A;  1FK9 B;  4ID5 B;  4IFY A;  4B3T F;  4HYK A;  2DNO A;  3BV8 A;  1NK7 A;  3JTP A;  5C42 A;  1J27 A;  1HMV A;  2ZFH A;  3NBP B;  4KO0 B;  1UCN A;  1RAF B;  1QVG R;  1YJN S;  3NAI A;  1XJW B;  4F3M A;  1AW0 A;  3Q2S C;  3CD6 S;  2BOA A;  1UVK A;  2KXF A;  3MM8 A;  3OFF A;  1FE0 A;  3W64 A;  1BE4 A;  4ZK7 M;  4YR2 A;  4DV5 J;  1CJT B;  1H2U X;  3L3C A;  2DKO B;  4O3P A;  2ASD A;  2N3L A;  2BUN A;  1N0V C;  2VU5 A;  3QYY A;  1IBM J;  4PUO A;  1M5O C;  1XBW A;  2LMI A;  1YWX A;  2ROE A;  2MYF A;  3PFO A;  1NBE B;  3GIR A;  4Z7C A;  1FTR A;  2B9Y A;  2VBX A;  2VD3 A;  4YS2 A;  2VV5 A;  2WK4 A;  3ULH A;  3PHE A;  4R8U A;  2UUA J;  1VHI A;  3VGV A;  4CLU A;  4OYB A;  1UTA A;  4OLO A;  1RAO A;  4U8Y A;  2RQC A;  4KJI A;  1FFG B;  4NWB A;  3CCR S;  4F4X A;  1H2T Z;  1KLM B;  1TL3 B;  2H51 B;  1OJ4 A;  1EET A;  4MIB A;  5LSR A;  1VQP S;  1IR2 A;  3QRP A;  5KFI A;  5F9N A;  4LQ9 A;  1N56 A;  2B0G A;  2FD2 A;  4C48 A;  5K20 B;  2NZ4 A;  3MM8 B;  3WQP A;  4G3I A;  2VG6 A;  4Y28 C;  4LRB A;  2CKW A;  2UUW A;  1SQE A;  3KUG A;  2AJ4 A;  3CME S;  4ES2 A;  1QAJ A;  5HO4 A;  4YHH J;  4Y2C A;  1KVI A;  4D3G A;  4MKY A;  3K8V A;  3PTW A;  3PYG A;  2RHS B;  3FFI B;  1CC7 A;  1U0H B;  2HQF A;  3KLI B;  3ONQ A;  3Q8Y A;  4X62 F;  4CO5 A;  1G7C B;  2PII A;  2BRL A;  4TU7 A;  1SC4 B;  1VLY A;  1WC3 A;  2OIH A;  2XY5 A;  2ZWO A;  3IR7 B;  4F02 A;  3UFC X;  3TJA A;  5HAN A;  2H4W B;  4Y2I A;  1JK9 B;  3TAM A;  3UVJ A;  2APO A;  5IC4 B;  3HD2 A;  3IXQ A;  4KYZ A;  4OYM A;  1O0P A;  2DBB A;  3M9N B;  2KVI A;  2YQ3 A;  4MT1 A;  3HJV A;  3WIU A;  5LXY A;  4V1A k;  2MDA A;  1ZBT A;  5D0E A;  2H4Y B;  3W60 A;  1VYA A;  3W9H A;  1WF2 A;  2WW4 A;  3FRZ A;  1OWX A;  1WOR A;  1YIJ S;  5L1L A;  2B3T B;  2A1B A;  4TKT A;  1SCJ B;  2IJF A;  3DU5 A;  4HH1 A;  4P73 A;  4X4Q A;  3GV5 B;  4J9O A;  2YVS A;  2Q66 A;  2DO0 A;  4FXD A;  3BGL A;  1NJX A;  2I1R A;  2YKM A;  2K3K A;  1RTD A;  1IJF B;  3GR0 A;  4JI5 F;  1XN9 A;  1M1H A;  1ZOT A;  2BKO A;  2QL7 B;  5F8M A;  4OV6 A;  3PJW A;  4B3M F;  3BH7 B;  4FF2 A;  3CGI A;  2J7U A;  3D0I E;  2HHS A;  3LPE A;  2X1G A;  3IAS 9;  4RUA A;  1IKY A;  3NS5 A;  4KAI A;  2AF6 A;  4X66 F;  3W61 A;  4BBY A;  1JJC B;  4JI6 J;  3CJ5 A;  3W62 A;  2NUH A;  1N5T A;  1WWH A;  4B9N A;  1Y7P A;  3KYL A;  3P45 B;  4IOB A;  4N41 A;  3O2I A;  1N54 B;  1WKK A;  3J81 Y;  1X60 A;  1ZA2 B;  4ED0 A;  2BKP A;  1JLQ B;  2CJ9 A;  4NEZ A;  2DY1 A;  3OTE A;  2MQN A;  4FYY B;  1PSD A;  2L41 A;  1SL1 A;  2LEP A;  3OR1 B;  2XMV A;  4TY8 A;  5KFY A;  4C8Z A;  1XMQ F;  3R7S B;  1XNQ J;  4KFB A;  2W2Q P;  2W8K A;  4EZ6 A;  1N34 J;  1PIE A;  1C4C A;  1TL7 B;  1KFD A;  1I94 F;  2FJA B;  3OXG A;  4RNN A;  4DX5 A;  3N5B A;  2E9T A;  1RJJ A;  4MAK A;  3OHA A;  5IWA J;  3BQ2 A;  1YX2 A;  4C6A A;  1TL1 A;  2DNP A;  5A8R A;  3C6T A;  1E6V B;  2A3J A;  3AXM A;  1AYE A;  3M8Q A;  5F8H A;  3BJY A;  4E8U A;  1QSL A;  3BKF A;  3UR0 A;  3CCQ S;  4LIR A;  3OFG A;  1W2I A;  2CIM A;  5JUM A;  4I68 A;  2PT0 A;  2J9D A;  2VB6 A;  5DS7 A;  2CQ1 A;  1CJU B;  4O3S A;  4ES1 A;  1ARO P;  4CYU B;  4PWW A;  3VGT A;  1VRQ C;  2DGQ A;  3UN5 A;  1FDA A;  1LNQ A;  3OUY B;  4FBT A;  2GV1 A;  4Q2M A;  3F0N A;  1FRM A;  3M8Z A;  5E5N A;  5KFC A;  4K4Y A;  3MM5 A;  4Y34 A;  3T9Z A;  1VQ7 S;  2I6W A;  3H5Y A;  4OHW A;  2Z58 B;  4A48 A;  1HYS A;  1RT4 A;  2XI3 A;  3BR9 A;  2KYX A;  2MHN A;  1JMT A;  1YJW S;  2HBZ B;  4M63 A;  3TZY A;  3D28 A;  4U8V A;  4K4U A;  5LMN J;  1N5V A;  3CO9 A;  5KFB A;  4KT0 C;  3NWG A;  1EAY C;  4P2M A;  1U49 A;  3PYE A;  1PG5 B;  1QTN B;  1JLB A;  4WP3 A;  2VDI A;  2EFN A;  4WII A;  2OUG A;  5F8J A;  4JUZ A;  4NXM F;  1TL4 A;  1U6F A;  2XMU A;  1PBA A;  1D3W A;  1NZ8 A;  1XIQ A;  4OHZ A;  5J2Q B;  4KGK A;  5I3P A;  1KON A;  1ZTT A;  5C42 B;  2HFU A;  2I8E A;  5ETT A;  2BQU A;  1UP1 A;  3JSM A;  1A6L A;  3D6H B;  4WKR A;  1ZM2 A;  3MM7 A;  4EK2 A;  1U45 A;  1MLA A;  1MWZ A;  4DV4 F;  3GSD A;  3HPO A;  4DQQ A;  4W92 B;  2K1R A;  2YKO A;  5BYR A;  1CJK A;  3D66 A;  3ISN D;  1TKD A;  1F2G A;  1JNZ B;  4KV8 B;  2GQC A;  2B6A A;  3UD3 P;  2CNO B;  4UST A;  4AND A;  2UXC J;  4KTQ A;  3SCK E;  2V4R A;  3PRB A;  2HWI A;  4H4M A;  4XK8 C;  2OMO A;  5K14 A;  4CDI A;  3D4J A;  2R2S A;  3MMC A;  1U48 A;  1A0O B;  4F0K A;  3G6E S;  2DD8 S;  1Q86 T;  1H6K X;  2IVY A;  2GMJ A;  3ENW A;  1YJV A;  3NMA A;  3LTO A;  5IWA F;  2E1C A;  4FYV B;  5F8L A;  3A13 A;  1TVR A;  3EGW B;  4J9L A;  4B3O A;  3KJV B;  1R0A A;  1EAR A;  3IWX A;  4E0D A;  1V6H A;  2QO3 A;  5DGB A;  4ECT A;  5HMX A;  2BE7 D;  4AD6 A;  1D0E A;  1SKU B;  3GON A;  1QUV A;  3I0R B;  2W9B A;  1GMU A;  1RWX B;  4J9V A;  4OYI A;  4CZC A;  1ZET A;  2M70 A;  1REV B;  3EWG A;  4LRA A;  1V3S A;  3VZI A;  3Q23 A;  1RT4 B;  1FNM A;  3IG1 A;  4RW9 B;  1HYS B;  2P9E A;  1RHQ B;  2HQG A;  5A0Y B;  2DNM A;  3L9Z A;  5ITH A;  2PI5 A;  2P5V A;  2HFS A;  4RW7 B;  4KPY A;  1M90 T;  1X4H A;  3M2V A;  1FWP A;  3POT B;  4MKB A;  4WE1 A;  1T8E A;  4L3N A;  3US5 A;  2ATL A;  1WI8 A;  4RNF A;  4YDD B;  2EG1 A;  2JLE A;  1TK8 A;  2WVE A;  2LXF A;  3QAT A;  1ZTW A;  1HWJ A;  1HQ2 A;  1DY3 A;  2AX0 A;  2QG9 B;  4M8L A;  3ZZO A;  4QWE A;  3VF0 B;  4JI8 J;  3IP0 A;  2C1E B;  1QJH A;  4M5J A;  3QFH A;  4ZVG A;  2ZH8 A;  1Y4Z B;  3D6T B;  3MM9 A;  4CTA A;  1RAC B;  3VQT A;  3DCA A;  1VCT A;  4ID5 A;  1N32 J;  2EI5 A;  4YHH F;  5F3Z A;  5D0R A;  2C22 A;  2J6U A;  5KFR A;  1K9M T;  3RUB L;  2KTQ A;  3NY0 A;  2CPD A;  3MR3 A;  1HNW F;  1G2E A;  3PHT A;  2OPQ A;  3CJQ A;  1SH0 A;  3R7B B;  4DV3 F;  3M6U A;  4CT8 A;  2LVW A;  4NXN F;  2VOD A;  3AOD A;  3CJ2 A;  1FWK A;  2DK2 A;  4KGV B;  4O3Q A;  3SSS A;  1N48 A;  1GAO A;  2U2F A;  2FVS A;  1PYS B;  1F0X A;  2IM2 A;  5KG2 A;  5HRO A;  3CCZ A;  5BXI A;  4DSE A;  1WF0 A;  2XCA A;  1SQG A;  2IRU A;  3H2V E;  2E1R A;  4P10 A;  2W7P A;  4DZ6 A;  2WB1 D;  4RW6 B;  4CO4 A;  2LP4 A;  1F3V A;  2IC3 B;  4JI2 J;  3GQC A;  2F1F A;  1UFW A;  4JI8 F;  1AUD A;  2VKZ G;  3MM6 B;  2MZS A;  3N6M A;  1HHT P;  3SDE A;  3NNA A;  2KT2 A;  3DHX A;  2R8G A;  3V6D B;  4LSL A;  1FDN A;  3DRR A;  3HSG A;  5C24 B;  4C8K A;  4EZ9 A;  4K0K J;  1JX4 A;  4USJ C;  2YQ0 A;  4ZVS B;  2RIL A;  3KK3 A;  1EZZ B;  1B3T A;  3K2Y A;  2CQG A;  3GWC A;  2VG7 A;  2RQK A;  5ETR A;  3G86 A;  5G0R B;  2DB1 A;  4C98 A;  4H4O A;  3TX0 A;  3H40 A;  1LK5 A;  3BO2 A;  2F4V F;  1S1W B;  1KNZ A;  2DIU A;  1YJ9 S;  4C11 A;  2C2K B;  5GVQ A;  1F9H A;  3MD3 A;  2YY3 A;  5C5J A;  2N7Y A;  5KFN A;  2DRD A;  3I5A A;  1LW0 B;  5HL7 Q;  4RU9 A;  1KQS R;  1A9N B;  3EM1 A;  1F2H A;  1RAD B;  3VAG A;  2C2R A;  2BYC A;  5IM0 A;  3HLU A;  2DHG A;  4QWD A;  3SCJ E;  3J7Z T;  2XO7 A;  2AGP A;  3DM2 A;  4NZ6 A;  2BVZ A;  1MN7 A;  4NLW A;  5DQI A;  3GMG A;  3NS7 B;  3PAC A;  4BLG A;  5CYM B;  3G8T A;  3PNI A;  5LL6 d;  1FRK A;  1SUQ B;  2B7B B;  4DV4 J;  2C42 A;  2ZH7 A;  4J9K A;  1DTQ B;  4K4V A;  2DXE A;  5L46 A;  2HNZ B;  2WVD A;  3M8Y A;  3MAH A;  4OJG A;  1YJU A;  4ELU A;  2H3E B;  2VFS A;  5DZ6 A;  3AOC A;  2VFR A;  3G8S A;  1NHK L;  2GC8 A;  1P8G A;  3DLK A;  2C3Y A;  1JLF B;  1SIZ A;  5T14 A;  2IRY A;  4DR6 F;  3RAX A;  2PMH A;  2CWK A;  5J1P A;  3EXC X;  2ASY A;  1WHW A;  2HEK A;  4DQS A;  1MN9 A;  2M5Y A;  4F4Z A;  2J8S A;  2OJ3 A;  3ZO7 A;  1CVJ A;  2PMZ D;  4BHQ A;  1S6P B;  2EFQ A;  5F41 A;  4GKJ J;  1JWW A;  4F67 A;  3H90 A;  1T94 A;  3RB4 A;  2ZM6 J;  1HWK A;  2R7O A;  2M8D B;  2NLW A;  1FA0 A;  4NA1 A;  4O4G B;  2Z56 B;  1HNZ F;  1FRL A;  1DTT A;  1RTJ B;  1UW9 A;  2ZC4 A;  3BKU A;  3DKD A;  4N56 A;  3UN3 A;  4A8F A;  2LA4 A;  2VPW B;  5LT5 A;  2B8Q A;  1R8B A;  1FF2 A;  1DQ8 A;  1S6O A;  3GTY X;  1N4L A;  4NLO A;  1O8B A;  4ATN A;  2DGX A;  3I0S B;  2V9K A;  2P8I A;  4N76 A;  4UOF A;  3AQP A;  1DAX A;  2P9G A;  2VDH A;  5E2Q A;  3CDW A;  2Y8Y A;  4DPO A;  3D9B A;  4NRU A;  5KOX A;  3OPK A;  2G1H A;  4QR2 A;  5RUB A;  4ED3 A;  4DL4 A;  1IBL F;  1M5S A;  2HRT A;  1JXE A;  4I2Q B;  4J90 A;  2F4F A;  3W9J A;  5THW A;  5CCM A;  3CCT A;  2CJQ A;  3PW4 A;  2QLF B;  2FHK A;  3ITH B;  4LR9 A;  3MM5 B;  4CO3 A;  4YP3 A;  3MED B;  3PYF A;  1U1L A;  2HHH F;  1TZ0 A;  3UD5 A;  3BSA A;  1RAA B;  4DFM A;  2KT3 A;  3PRV A;  1YLX A;  2IAJ A;  1JB0 C;  3GJR B;  5GAD U;  2KXN B;  2VG5 A;  1K0V A;  2HRU A;  4P9S A;  4ECR A;  2J6T A;  2HNY B;  4DX6 A;  1RAB B;  2CQP A;  4DUY F;  1RKJ A;  2W7O A;  1Q5Y A;  3KMQ A;  4HKQ A;  2K7K A;  3NCP A;  2E9Z A;  4J7C A;  2HAF A;  2V2K A;  3TZX A;  4ZVH A;  2KHD A;  3VZH A;  3M32 A;  3HM9 A;  1LFP A;  3C14 B;  4R5P A;  4M94 A;  1LEO A;  2NS1 B;  3D0G E;  2RDI A;  4ZN3 A;  5KTQ A;  2XGP A;  2V68 A;  3EIC A;  3HFK A;  3FCW A;  1XQI A;  2OPS A;  5GAE I;  1NSP A;  5DET A;  2LYV A;  2HBR B;  3I5B A;  4BWM A;  4AQY F;  3SFG A;  3FMW A;  1OYE A;  1PAE X;  3HFZ B;  1RT7 B;  4O44 A;  3Q8V A;  4Q44 A;  2UUB F;  3W5X A;  2CRL A;  3AHP A;  3UPF A;  1SV5 B;  1LWE B;  2ZUG A;  3DRP B;  3MCO A;  1JXV A;  1Q0N A;  4Q43 A;  2V2Q A;  3THV A;  1TR0 A;  2QLJ B;  1VMB A;  5B0E A;  1RWU A;  2L9N A;  3ICL A;  3W65 A;  4B9M A;  3IC1 A;  2K8G A;  1MNE A;  2DH8 A;  1M5V C;  1WHY A;  1NK4 A;  4C97 A;  3HVT A;  3OXL A;  4HL9 A;  4C8N A;  3ILI A;  2NPI A;  1PAU B;  3ITH A;  3HKZ D;  4QIW D;  3W9I A;  3NKY A;  3ZZZ A;  4ZPA A;  2XC9 A;  2AJ0 A;  5T41 A;  4P52 A;  5HVF A;  5I3U B;  2BQ3 A;  2C3M A;  1P6T A;  1HAR A;  3CT9 A;  4Y2M A;  2XS2 A;  2HFN A;  2M88 A;  4LSL B;  2BJ9 A;  4X4T A;  2XLI A;  2XZD B;  1S4E A;  1S9G B;  3LAN A;  4ECS A;  4QQB A;  2V8P A;  4HLB A;  3RJM B;  5D77 A;  2ZM6 F;  4DR7 J;  3IMQ J;  1UEU A;  3KLV A;  1IR1 A;  2WVB A;  3LWM A;  5EHH A;  2ZJQ Q;  3OBI A;  3CJK B;  5KG5 A;  1N6Q A;  2A0F B;  4C3L A;  4DR7 F;  1UVI A;  4X4O A;  1OY6 A;  2FVC A;  4K2X A;  2ZBC A;  4A8K A;  1AFJ A;  1NEE A;  1GXU A;  2J0X A;  4DXL A;  4LF4 J;  4AL7 A;  3QGH A;  1VLO A;  1ZA1 B;  2E5H A;  3PW2 A;  3MD1 A;  5H9E J;  4CLT A;  4CI0 B;  1S1X B;  1SXL A;  1T9T A;  5A6W A;  4IRD A;  2CPJ A;  4LF5 F;  2GVZ A;  2MKJ A;  4RW8 A;  3BQ0 A;  3OT9 A;  2DHA A;  4IR1 A;  2YPY A;  4IUF A;  1WOS A;  5LOQ A;  3BYP A;  2G0C A;  4L72 B;  3JSM B;  4ILL A;  4F3Q A;  3ISZ A;  2W9A A;  4UTG A;  2KZM A;  4P2S A;  3CB4 A;  2EW9 A;  2H48 B;  2HVE A;  4A8W A;  1TV6 A;  5KFK A;  2ROG A;  2QYG A;  2VC1 A;  2BZ2 A;  2YNF B;  4FVC A;  1QM9 A;  4HTI A;  3CCU S;  1T9V A;  1H73 A;  2J0W A;  3D0H E;  2O01 C;  4I67 A;  1FKP B;  1ZM4 A;  4S0M A;  1HBU B;  5ETN A;  3H42 A;  3G71 S;  1SJ3 P;  1TQL A;  2FYX A;  1WSR A;  2MZT A;  3HSD A;  3K5M A;  2VUG A;  4X4V A;  4C4W A;  4B17 A;  4QWA A;  3GJQ B;  1RZM A;  3VAL A;  2AGQ A;  1R6Y A;  3ET6 A;  1T9U A;  2RAQ A;  3HVT B;  3J7Z 5;  4MIA A;  2CAD A;  3FBC A;  1FI4 A;  2BJ8 A;  2GVD A;  4Z7Y A;  1LWF B;  5A2Q U;  3A1Y G;  1X5T A;  1L3K A;  4OYZ A;  4TU8 A;  1RP5 A;  2JEG A;  2CDR B;  1FES A;  2WB4 A;  4ED7 A;  4TQS A;  4AL5 A;  5B7W A;  1KDN A;  3FUY A;  2GX8 A;  3I0R A;  3SBM A;  2AGO A;  2I2Y A;  1UZH A;  4DBQ A;  4WKY A;  5KFO A;  1Z4U A;  4ZPW R;  2CFX A;  3LAM A;  4OYA A;  2BJ7 A;  3HHL B;  2DHS A;  2QL5 B;  4PCQ A;  2QT7 A;  4XAK A;  2A6M A;  8ATC B;  4DV6 J;  4DUZ F;  2OH2 A;  2ZH5 A;  4WK3 A;  2B51 A;  3KJV A;  4RUB A;  3Q8S B;  2KN4 A;  1YBT A;  1HNV A;  3ZTO A;  2W2M P;  3PKM A;  2DCU B;  3UWT A;  2AJ1 A;  3TOQ A;  4U95 A;  1XEZ A;  3IR5 B;  4CIO A;  2KFN A;  1SIW B;  3H2U B;  2XI2 A;  3R2D J;  2VON A;  4IFY B;  1NK8 A;  4RKU C;  2XWX A;  1RU2 A;  3WX4 A;  1SUQ A;  3CMA S;  2OEL A;  4WFX A;  2L3M A;  1HD0 A;  4C0B A;  3QT5 A;  2PGC A;  1KOO A;  4BDP A;  2KZZ A;  3UR3 C;  2GQ2 A;  3FZ2 A;  2N7C A;  3PKY A;  1B0P A;  1X0F A;  2HHH J;  4JYA F;  3PX4 A;  4USV A;  1BQM A;  1P27 B;  1YZ7 A;  2FHJ D;  4UUW A;  5E3C A;  3R9L A;  2HMI A;  2JC1 A;  3TUI C;  3KDO A;  4XIU A;  4ITS A;  1VRT B;  1KRP A;  5B0D A;  5H9E K;  4OHV A;  1UEK A;  2D3O 1;  3ADA C;  4HH0 A;  2VKR A;  3A8E A;  1MMD A;  4KHM A;  4AFF A;  2FZC B;  3IAM 9;  3SEO A;  3UI3 A;  3UCU P;  1QSY A;  3P49 B;  3K8W A;  1H7X A;  3U27 A;  5KT7 A;  5DDO C;  4RBT A;  1WTB A;  3A12 A;  3F56 A;  3JSY A;  3VQS A;  4B9U A;  5I3Q A;  2EK6 A;  1FEH A;  3BR8 A;  5C25 B;  3BGO P;  3DOK A;  5DRK A;  4OQJ A;  1WHV A;  5JMN A;  1X9S A;  2LCW A;  3B6B A;  1KN6 A;  4EGL A;  3W3S A;  2D74 B;  3FVY A;  5KG0 A;  3KKF A;  1S7H A;  2CVE A;  2JWN A;  2VBW A;  3D1O A;  4RBU A;  2ZJR Q;  1DRZ A;  1XNR J;  2OKQ A;  3GJT B;  4ZIW A;  1SKW A;  1X4A A;  2YNI B;  2E7W A;  4OX9 F;  1KR4 A;  2QA1 A;  3K5N A;  4J9N A;  1VQ6 S;  2HK2 A;  2BE2 B;  1U24 A;  4FPR A;  3H7H B;  1RLC L;  3AFG A;  3MMB A;  5AE2 A;  3M2R A;  1BC6 A;  4DV1 J;  2UVU A;  3UDC A;  3SFU A;  3GFY A;  4ZOS A;  2CQC A;  2HVD A;  3F44 A;  4CLY A;  1DQA A;  3LGN A;  1RBL A;  2FJD B;  1PC5 A;  3VVT A;  1ULR A;  1GH8 A;  3JQM A;  3TWZ A;  2GJF A;  4FDF A;  4E2F B;  1T05 A;  2HVH A;  1VGY A;  2UVV A;  2W25 A;  3LWL A;  5D0H A;  9ATC B;  1KEK A;  4DV2 J;  4LF8 F;  4W90 B;  1MSW D;  3EDR B;  4QYR A;  3KLE B;  4M5N A;  3T5J A;  4GVB A;  3DLE B;  3M32 B;  3DLL Q;  4OZJ A;  4U7U D;  1IWA A;  4DQI A;  4KY3 A;  2DNR A;  2IM0 A;  2YNH A;  4CO0 A;  5KAK A;  5A8K B;  1YRX A;  4KB7 A;  1LW0 A;  3BYR A;  3GB0 A;  4KV8 A;  1NK9 A;  1G4C A;  1VR6 A;  2G13 A;  2J76 E;  3FBB A;  5B0G A;  3GYN A;  3TNV A;  4BWJ A;  1YG0 A;  1JLE A;  2VQF J;  2K1R B;  1CUL B;  1F9E B;  2VPZ B;  3GLJ A;  3E01 B;  2YNI A;  2B4V A;  3GR1 A;  1UPP A;  4J5O A;  4LJM A;  4R8U B;  4X66 J;  4I7F A;  5G0R A;  2R8K A;  3R2C J;  1RCO B;  5IOL A;  2H5E A;  1VRU A;  4CWB A;  2OAU A;  1Q95 G;  3QZ8 A;  2QSF A;  3RB0 A;  3N9U C;  2XMJ A;  3NAH A;  1NUE A;  3P6Y C;  2Y1I A;  5M2P A;  3G2X A;  5IS2 A;  3IN5 A;  2Z4P A;  5KFJ A;  1HBU A;  1JLG B;  2XSF A;  4DZD A;  4URG A;  5EDW A;  1YIT S;  3IO1 A;  4H54 A;  3J81 j;  3IS9 B;  2CJY B;  2C3O A;  1Q53 A;  2LDY A;  4A8S A;  4JI3 F;  1CLF A;  3KK1 B;  2MJU A;  1NRK A;  1S6U A;  2CJA A;  2G0J A;  3PIO Q;  2FJW A;  2YWG A;  1DQ9 A;  2EXU A;  3K57 A;  1WUU A;  1IKV A;  2WVC A;  3K7R A;  3UE2 A;  3TUJ C;  3LQV A;  4DR6 J;  4WZM A;  2OFH X;  2WHO A;  4ZVR B;  5A8W B;  4LFB F;  2HNY A;  5HQL A;  5GAG I;  2QLW A;  1FNO A;  3CMQ A;  4DL3 A;  1BQN A;  1S99 A;  2GFF A;  4G1Q A;  3RRH A;  3OUY A;  2ZZN A;  3HHL D;  3W5Y A;  2C2Z B;  3EPG A;  1RT3 B;  1XMO F;  4WF9 Q;  3C66 A;  4L73 A;  4M5G A;  3GE9 A;  4KR0 B;  3THT A;  3WC2 A;  2B9X A;  1JLF A;  3DNC A;  4GC7 A;  1IQT A;  1QD1 A;  3FKB A;  2ZVI A;  2V94 A;  4ILM A;  2G0I A;  3FFI A;  1DJ0 A;  3HD1 A;  5HQM A;  1N34 F;  1OMS A;  5D0G A;  3OJU A;  4DCJ B;  3OSN A;  3RRG A;  2KL8 A;  2BM1 A;  4KRW A;  2VQE J;  2VIH A;  3NGR A;  2AV5 A;  4K4T A;  5HP1 B;  1WTF A;  3CC2 S;  2EK1 A;  1RWK B;  5L1K A;  3SSR A;  4DS5 A;  5KFU A;  4EFA C;  4NLG A;  4U67 Q;  3H2L A;  1PKU A;  1ELO A;  5DJB A;  4ZJL A;  6FD1 A;  1BLU A;  3D67 A;  4NLS A;  2YTC A;  3WIV A;  4Y65 A;  3IRW P;  4DL7 A;  1EB0 A;  3D6F B;  3GSI A;  1SKR A;  2NSB A;  3OR1 A;  2R3V A;  4WFY A;  1WC6 A;  4PPD A;  3SQG B;  3THP A;  2QA4 G;  3TQ1 A;  2Y8W A;  1APS A;  3AXK A;  1X4E A;  3UNY A;  1HA1 A;  2MST A;  5DQH A;  3GIJ A;  1U09 A;  1MMN A;  2K3I A;  2B5J B;  2F7V A;  3LGH A;  3M2U B;  3U02 A;  2GHW A;  5D6G A;  2L9D A;  2CWX A;  3L7U A;  1S1U A;  2LEB A;  3PEJ A;  3TAQ A;  2OEM A;  1S1V A;  3QLH B;  4LF2 A;  3H59 A;  4TVA B;  3HVR A;  4ECU A;  1RT1 B;  3CTR A;  5HLF A;  4B3M J;  1HWI A;  2CNK B;  1VDH A;  1HI1 A;  4MIW A;  3CCV S;  2NUU G;  3O6Q A;  2DR7 A;  5K8N A;  3L95 X;  4IH5 A;  1ZPW X;  3RAM A;  1F9F A;  3MMA B;  4DR4 F;  3S1T A;  3V6D A;  2EVZ A;  2ADC A;  1S59 A;  4YME A;  1P9Y A;  4MKV A;  3NBP A;  3QNW B;  2R42 A;  2Q43 A;  2M3D A;  1NME B;  3VWS A;  4DS4 A;  5HMW A;  4B9S A;  4X4S A;  4A8O A;  4RZR A;  2O1P A;  3MMC B;  2KFY A;  3Q22 A;  1NU4 A;  2E1M C;  1GMW A;  1UFK A;  3TUP A;  3CJ4 A;  2IRX A;  3DGP A;  3QWP A;  5E3A A;  4OL8 A;  1GK8 A;  2I0X A;  3IGV A;  4PG8 A;  4ZLN A;  4RW8 B;  4G1Q B;  3BKT A;  2VJU A;  5D3G B;  3MPD A;  2I5J B;  3FSX A;  1MW7 A;  4FYD A;  3CDB A;  4DN9 A;  1TAQ A;  3PYD A;  5DG8 A;  1L3S A;  3TZW A;  5KG4 A;  4ZIV A;  2MKS A;  1OSC A;  3D7S B;  4HT7 A;  4JV5 J;  2R7V A;  5H9F K;  3U1N A;  2CNN B;  2IVM A;  5CAB A;  1VQL S;  3NNH A;  4WFA Q;  4DUT A;  3CJR A;  3F73 A;  5AXN A;  4ECV A;  1U1O A;  2DR5 A;  3KUH A;  5KFX A;  5CAA A;  1HLW A;  3GIK A;  4NRT A;  1D09 B;  1FKO B;  1SH2 A;  2YKN A;  2DNK A;  2OTL S;  4GC6 A;  2XSJ A;  3KHL A;  2RRN A;  4NZ7 A;  4OI4 A;  1R27 B;  3DLG B;  4Q45 A;  5DLG A;  2LEC A;  3MEC A;  3MPY A;  1RI7 A;  2HBQ B;  1WEX A;  2MLY A;  5FII A;  3MAQ A;  3Q2T C;  4RW6 A;  1UA1 A;  2YBV A;  5AXM A;  4OI6 A;  2CZ9 A;  2ZE2 A;  1OPI A;  2O5D A;  3LO3 A;  2R2R A;  1ZM3 A;  2QV6 A;  1WC1 A;  2ZHO A;  4Z37 A;  5CXT A;  4JI4 F;  1EKS A;  3ZTP A;  3RTV A;  1V9O A;  2QC3 A;  1IQZ A;  2M2B A;  2MGZ A;  4P2F A;  2FDN A;  5IC6 B;  4DQR A;  1RTH B;  1UVN A;  2YWH A;  4JYA J;  3NGD A;  4ZCK A;  3J7A 1;  5J2N A;  5ETQ A;  2PN6 A;  1CG2 A;  3B54 A;  2XGQ A;  4OZ5 A;  4M5L A;  2XZT B;  1ZZN A;  4KSE B;  1RTI B;  2OD4 A;  3NEK A;  1T3O A;  3NCQ A;  4F0M A;  1U1K A;  4JV0 A;  4OYO A;  3Q83 A;  1Y3J A;  5ETM A;  4DPW A;  2BJD A;  3RG6 A;  2X3D A;  4DL0 C;  1UPM B;  3PV8 A;  2ZH2 A;  3V4I B;  3AA9 A;  1MU2 B;  1YBU A;  1ZAV A;  1L5U A;  3RAQ A;  1R8A A;  3HJF A;  2DR6 A;  2EFV A;  2V6A A;  3J7Y U;  3OL6 A;  2FJX A;  4WJB A;  5DDP C;  3MMB B;  2J7K A;  4FXW A;  1RT3 A;  3EVW A;  3V5R A;  1RLD A;  4ZCM A;  5DLF A;  1YQH A;  1S97 A;  4NPO A;  4GMK A;  4RR5 A;  1H38 A;  4ERD A;  1IBL J;  2BA9 A;  1NLK L;  2B56 A;  4LF6 J;  3X1L B;  2NR0 A;  3M05 A;  5EWF A;  4F8R A;  4RBV A;  1NH7 A;  5CH7 B;  3H5X A;  2GHV C;  3KLG A;  1SH3 A;  4C8O A;  4F0H A;  1JJ2 R;  1FJG F;  2VJV A;  3QGI A;  4BC9 A;  1RHM B;  3SIP B;  1TUG B;  3GIL A;  2UP1 A;  5A2Q Y;  4ZMM A;  4ZHR A;  1NDK A;  5AXL A;  2PO4 A;  3AT1 B;  3PXG a;  1WDT A;  5B09 A;  8AT1 B;  4RUC A;  3H4D A;  1UA0 A;  1FHT A;  2ZH9 A;  5IV3 A;  4RO0 A;  2AEJ A;  4L6V 3;  1IBC B;  2EBG A;  3C8Y A;  3MEC B;  2D9O A;  4R25 A;  3R3T A;  4TY9 A;  2ABY A;  4RW4 B;  3BBF A;  2HZV A;  5EN1 A;  1RHK B;  3DMJ B;  1YJT A;  2PC6 A;  5DO2 A;  5KFV A;  3P96 A;  3I32 A;  4DSK A;  4KGX B;  4FKX A;  3D5M A;  3PFE A;  1RT2 A;  2HWH A;  5E41 A;  3I4P A;  2NYH A;  2K06 A;  4OZ1 A;  4NLQ A;  1Q81 T;  1CS4 A;  4HEA 9;  4PEO A;  2DRB A;  1RYS A;  4NI2 B;  4UOH A;  5LJ3 Y;  3MUV P;  4U96 A;  1NZA A;  4LF4 F;  4HTJ A;  5AXK A;  4Q2L A;  3TAM B;  2DNL A;  3UVJ B;  4KKO A;  3W5Z A;  3H5S A;  3AH6 A;  2XBP A;  4K5S A;  1VBZ A;  1CJK B;  1O5J A;  2RF2 A;  2VZ9 A;  3PEH A;  1JQG A;  4N8N A;  1O6X A;  2QJ3 A;  1N32 F;  2V2V A;  4ZVO B;  2DR9 A;  4CCH A;  2R7R A;  4QW8 A;  2HBY B;  5KFE A;  3OVS A;  1RIS A;  4M5D B;  1DZ5 A;  1RAE B;  3ENA A;  4M5M A;  1T95 A;  3R7N B;  1HI8 A;  4P7V A;  2XLJ A;  3AOA A;  2W7A A;  4AXJ A;  1WHX A;  1IBK F;  1FE4 A;  3DMJ A;  4WWS A;  2Y1L B;  3CED A;  2CVI A;  4I1T A;  4NLV A;  1K47 A;  1WI6 A;  4ZCI A;  2ERR A;  3JAM Y;  1FJG J;  2CPE A;  1BY9 A;  3BDE A;  4WFZ A;  3KFW X;  2ZC3 A;  3LH2 S;  2P2C B;  1DAR A;  3N79 A;  1SJF A;  4TNO A;  2J0S D;  2LU2 A;  3ZFV A;  2E7X A;  2WSC C;  3GP9 A;  4NLR A;  1JLQ A;  5G4D A;  3W8P A;  5KFQ A;  5L39 A;  1D9D A;  2Y3Y A;  4B02 A;  2DRA A;  2Z30 B;  1HHQ A;  1RA6 A;  4NLX A;  4CO1 A;  4WFB Q;  4DSI A;  1W26 A;  4MH8 A;  5HLF B;  5FD1 A;  2LKZ A;  3BEG B;  1B7Y B;  1R6V A;  3KJN B;  4DSL A;  3LAL A;  3L4B C;  1NDC A;  3H4B A;  1TKZ B;  2GIF A;  2J9C A;  5M2R A;  3ZZ0 A;  1TL5 A;  2XY6 A;  3MR2 A;  4ED5 A;  4OI3 A;  4LR8 A;  1IN0 A;  2MQL A;  3DLK B;  3BPD A;  4ES3 A;  3UCZ P;  3EGN A;  1REV A;  4JI4 J;  1WC4 A;  5BR8 F;  3AAW B;  1BMQ B;  1WSV A;  2C3U A;  4XPE A;  2PMW A;  4G6V B;  2GA7 A;  3KLE A;  3TAR A;  1M1G A;  4C8L A;  3CSK A;  2KHC A;  2YKM B;  4PXE A;  3AD9 C;  3HHE A;  4UW2 A;  2GIR A;  1P1T A;  4USH A;  1N5Q A;  1AZS A;  3A8I A;  3BPS P;  4MFB A;  4FVM A;  1GEH A;  2E5I A;  3T6B A;  3KXD A;  1GT8 A;  3BB5 A;  4ETX A;  3OJS A;  3MFI A;  3EZ5 A;  1DTT B;  1RTJ A;  4L3K A;  3TAN A;  2OGU A;  3RBZ A;  5J2M A;  3CD0 A;  5M2U A;  4UZB A;  4PG5 A;  2LQ9 A;  1RTH A;  1T0T V;  2N3O A;  2DGU A;  4G1P A;  5AT1 B;  2X1A A;  4IRC A;  2RT3 A;  3CCL S;  2AJF E;  2FVP A;  3QRR A;  3HHK A;  3DOL A;  2IAJ B;  2L48 A;  2M4M A;  2YKA A;  3B78 A;  4HHJ A;  3QJL A;  4O0I A;  2DCL A;  3DGP B;  2COL A;  2OPR A;  4UY8 T;  2R7T A;  1ACM B;  1NK6 A;  1V5I B;  2AHO B;  2E5L F;  1KTQ A;  1Z2Z A;  1FCA A;  3OHB A;  5KFL A;  2E66 A;  3EX7 B;  4DFK A;  3DU6 A;  1EP4 A;  3D3C J;  4ZPC A;  2D41 A;  2JNJ A;  2W1B A;  3CJ3 A;  3QSI A;  4WP9 A;  1UEV A;  3R1H A;  1HNV B;  3I87 A;  2JEF A;  3U1L A;  1YSJ A;  1JNR B;  4ZP8 A;  3SQO P;  1HW9 A;  1KS2 A;  2G4B A;  4Y2K A;  3ENV A;  2R2T A;  3HHL A;  3I9Z A;  4B3R F;  2KRB A;  3JQK A;  5IV4 A;  1Q16 B;  4QU6 A;  1KVJ A;  5HAO A;  3W7B A;  3M7V A;  1EKR A;  1F5B A;  3M2V B;  2J5A A;  4O0N A;  4QPT A;  1Y0H A;  1ZYQ A;  2AYM A;  2CQ4 A;  1QE1 B;  2GGP A;  1IKW B;  2XS5 A;  4IQX A;  1KBR A;  1TK5 A;  1VRT A;  5D4N A;  4CRJ A;  1OQ3 A;  1LWF A;  2CXE A;  3QGP A;  2KVQ E;  5CHC B;  2AQ4 A;  1F1B B;  1M5K C;  4X4U A;  1QE1 A;  1S6P A;  2GGP B;  2XHC A;  4NLY A;  2R2U A;  1RBO B;  4AQY J;  3BQ1 A;  5GMK a;  2EFO A;  1SV5 A;  5KT3 A;  2DO4 A;  3DRX A;  5DG9 A;  3JAM U;  2RIJ A;  2ZZM A;  4M5I A;  1QAY A;  2R8I A;  4PRF A;  4RWX A;  3MUT P;  2RHQ B;  3TYT A;  1OQ6 A;  3IR6 B;  2MQP A;  2H54 B;  1NKC A;  1H72 C;  1F5C A;  2ZBQ A;  1ZAW A;  2JRS A;  1NB2 A;  4RNH A;  3VAI A;  2WVF A;  1HQE B;  4ZLJ A;  3KLF B;  2VHG A;  3SDE B;  2IDL A;  4HI1 A;  2AIR B;  3MM6 A;  4DR3 F;  2HQI A;  5D4O A;  3T1H F;  2RRA A;  2W9C B;  3E2E A;  2GJI A;  2MLX A;  3PRD A;  3FCH A;  1TL7 A;  4I56 A;  2CQH A;  4K4W A;  1RWM B;  4OYX A;  1KLN A;  4MYT A;  1R0B G;  3TZZ A;  5J2P B;  4ETZ A;  1KLM A;  2E1P A;  4X84 A;  3A3O B;  3QO9 A;  3DM2 B;  4X65 F;  1UL3 A;  4J9P A;  2EC0 A;  4DV7 F;  3DOL B;  4C8Y A;  2FC9 A;  3M6V A;  4NMX A;  3DLB A;  1B64 A;  2OML A;  1HBO B;  1GTE A;  1HHS A;  2A2D A;  2CPH A;  4WYW A;  1S1X A;  5J1N A;  3TX8 A;  3VR1 A;  4CLL A;  2W8L A;  4AYB D;  4G1I A;  3FDS A;  4RNO A;  1IKW A;  2CPF A;  5KFA A;  5F8G A;  1X4B A;  3PR4 A;  2J9E A;  2CNL B;  4DFJ A;  2OD6 A;  3VAK A;  4YFU A;  2XB2 D;  1HD1 A;  1FXL A;  3KWM A;  5HN0 A;  2DJW A;  1HI0 P;  3EVO A;  2Z8Q A;  4RW4 A;  4HHH A;  4ZVU B;  1URN A;  1AFI A;  3HXM A;  1HNZ J;  1I5O B;  3DRS A;  5GAD I;  1UJ5 A;  5BYQ A;  3TRG A;  2D9P A;  1T02 A;  4ZPD A;  3HHD A;  2BKN A;  2MZR A;  5ETL A;  4ZVT B;  1AA1 B;  3HX9 A;  3NWR A;  4Q7A A;  5T7L B;  3RGI A;  5KFH A;  1NB7 A;  4UY8 5;  1IXK A;  3FK4 A;  3DGV A;  4URQ U;  4AL6 A;  2IM1 A;  2QZ8 A;  1X4C A;  2WRM A;  3VV2 B;  3ZNU A;  3J7A N;  1X8D A;  2L9W A;  2JLF A;  4ZN1 A;  1XR6 A;  2ALZ A;  3G9C A;  2DNZ A;  1BGX T;  1Q78 A;  1RWW B;  2Z0G A;  5HRO B;  1FRX A;  1JJ4 A;  2DXD A;  2FY8 A;  1HWU A;  1KQF B;  2EFG A;  2EPI A;  4KH1 B;  4CLS A;  3M2U A;  3M9O B;  5JXS A;  3EGV A;  3H0P A;  3JB9 k;  3MEG B;  5KG3 A;  4IFV A;  3MM7 B;  4EO8 A;  4ED4 A;  2VPX B;  2KU7 A;  3AOB A;  4OX7 A;  4DU7 A;  2G9O A;  1X9W A;  3MOJ B;  2EEY A;  3C6T B;  2UXC F;  3FSI A;  3P8B B;  2FQQ B;  3VAF A;  1U47 A;  1C1C B;  3PG9 A;  1AZS B;  3I55 S;  4ZVP B;  3GCW P;  2DVI A;  3GIM A;  3MXH P;  2CA9 A;  2RJZ A;  4FF3 A;  1DBD A;  1SL0 A;  3OR2 A;  4ANE A;  1BUX A;  2XEX A;  1TKX A;  1SQF A;  5HVG A;  4J9M A;  1UVL A;  3K59 A;  3BN7 A;  3CUL A;  1IJE B;  3PDN A;  1VQ9 S;  1EHW A;  2A10 A;  2Y1R I;  1CJV B;  2ACM A;  3MWB A;  3UDV A;  4ELT A;  2MLZ A;  3HVW A;  2UUA F;  4JOU A;  4ZLL A;  1GMW D;  4JI6 F;  1RB0 A;  3V4M A;  1TKZ A;  4A8Y A;  1W25 A;  3OQ2 A;  2CQI A;  1HFE L;  1N36 J;  2NQP A;  2BAC A;  1JLE B;  3DOM A;  2N4D A; 
#chains in the Genus database with same CATH homology
 3VVU A;  4WBF A;  1MN7 A;  4O0N A;  1NDP A;  3Q8Y A;  3BBF A;  2ZUA A;  1LWX A;  4HR2 A;  5C7P A;  4FKX A;  4AND A;  2DXE A;  2BEF A;  1S57 A;  3BBB A;  1S59 A;  2HVD A;  3FCV A;  1WKL A;  4UOH A;  1WKJ A;  4KPC A;  3VVT A;  1NHK L;  3ETM A;  4CP5 A;  1VYA A;  1HIY A;  1NDL A;  2CWK A;  2DY9 A;  3NGS A;  1NB2 A;  1MN9 A;  4W98 A;  2B8P A;  3ENA A;  3MPD A;  2HVE A;  3FC9 A;  1W7W A;  3Q8U A;  3Q89 A;  3EVM A;  3BH7 B;  3EMT A;  4ENO A;  1F3F A;  1B99 A;  5CAB A;  3DKD A;  3JS9 A;  1S5Z A;  4DUT A;  2B8Q A;  3FBB A;  4S0M A;  1B4S A;  3DDI A;  3NGT A;  5CAA A;  1HLW A;  2AZ1 A;  1F6T A;  4UOF A;  1NSQ A;  5IOL A;  3GP9 A;  3NGU A;  3FBC A;  1WKK A;  1HHQ A;  1NUE A;  2AZ3 A;  3G2X A;  3EVO A;  4UOG A;  3FBF A;  1KDN A;  4F36 A;  1U8W A;  1NDC A;  1BHN A;  3PRV A;  3ZTP A;  4ANC A;  4DI6 A;  3ZTO A;  4C6A A;  4F4A A;  3FBE A;  3GPA A;  1LEO A;  1UCN A;  2DXD A;  3EIC A;  3ZTS A;  3FCW A;  1XQI A;  2BX6 A;  1NSP A;  3B54 A;  3Q86 A;  1NCL A;  5BXI A;  1BE4 A;  1PAE X;  3BBC A;  3VGT A;  4DZ6 A;  2DXF A;  3FKB A;  3Q83 A;  4FKY A;  3R9L A;  3Q8V A;  3VGU A;  2VU5 A;  3ZTQ A;  1JXV A;  1K44 A;  3NGR A;  1ZS6 A;  2DYA A;  3VGS A;  1PKU A;  3ELH A;  3EVW A;  3VGV A;  1NPK A;  2HUR A;  4ANE A;  1BUX A;  1NLK L;  1NSK L;  1EHW A;  3PJ9 A;  3EE3 A;  3ZTR A;  3B6B A;  3WX8 A;  1XIQ A;  2NCK L;  3EJM A;  1NDK A;  3EM1 A;  3L7U A;  3BH6 B;  4EK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...