4ANEA

R80n mutant of nucleoside diphosphate kinase from mycobacterium tuberculosis
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
135
structure length
135
Chain Sequence
TERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTNAIAAVRQLAGGTDPVQAAAPGTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Structure of Mycobacterium Tuberculosis Nucleoside Diphosphate Kinase R80N Mutant in Complex with Citrate
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 42
structure length 135
sequence length 135
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4aneA00
1NPKA 3EVOA 3NGTA 3Q83A 3ZTPA 3FCVA 4FKYA 1HIYA 3NGUA 1ZS6A 4F36A 1NLKL 2DY9A 5BXIA 1NDPA 3EVWA 1WKJA 4CP5A 4F4AA 2VU5A 1XQIA 3B54A 2AZ3A 3EICA 2AZ1A 4WBFA 4DI6A 1PKUA 1S59A 1EHWA 4UOGA 3Q89A 4ANDA 4ENOA 4EK2A 2DXFA 3JS9A 2DYAA 5C7PA 3BBCA 1B99A 4DZ6A 1PAEX 3EM1A 3EVMA 3PRVA 3VVUA 1WKKA 1NDKA 3ENAA 3BH7B 5CAAA 1JXVA 3L7UA 1NCLA 2CWKA 1LWXA 3PJ9A 3MPDA 2HVEA 4C6AA 4FKXA 5CABA 3FC9A 1UCNA 2DXEA 3FBEA 4W98A 3Q8VA 4DUTA 1B4SA 5IOLA 3BBFA 3ZTOA 1F6TA 1NUEA 1W7WA 4KPCA 1BHNA 3Q8YA 3WX8A 1NSKL 3DDIA 2ZUAA 4UOHA 1NDCA 3GPAA 3VVTA 4S0MA 1NHKL 3NGRA 3FBCA 4O0NA 1WKLA 3FBFA 2HVDA 2HURA 2NCKL 3EE3A 3VGVA 3ZTRA 1KDNA 2DXDA 3ELHA 1VYAA 1NSPA 3VGTA 3EMTA 3DKDA 1NSQA 2B8QA 1F3FA 3G2XA 3BH6B 3Q8UA 1NB2A 3VGUA 3B6BA 3EJMA 3GP9A 1NDLA 1MN7A 1HHQA 3NGSA 3R9LA 1LEOA 3ZTSA 1U8WA 1XIQA 3Q86A 3FKBA 4HR2A 3ETMA 1S57A 3VGSA 1BE4A 2B8PA 3ZTQA 1K44A 1BUXA 1MN9A 3FCWA 2BX6A 3BBBA 4ANEA 4ANCA 2BEFA 3FBBA 1HLWA 4UOFA 1S5ZA
chains in the Genus database with same CATH superfamily
4RW6B 1S4FA 4JI3J 2DH8A 1PSDA 1S6OA 3TQEA 4IUFA 1YJTA 1FRJA 1RISA 2MYFA 3TWZA 1CSJA 1W25A 3G4SS 1FDBA 4PQAA 2E7XA 2W4CA 1ZZNA 3HVRA 4IQMA 1YK9A 1Q5VA 2FUG9 5EN1A 2DXEA 1Y10A 1G1XA 1SJ1A 3PACA 3M8ZA 4I6AA 3EZ5A 2KRBA 2IPOB 2BM0A 1VHIA 4NMXA 3Q8YA 1K1QA 4QYRA 4R5PA 2Q1LA 4QCLA 2VUGA 3IC1A 3ELHA 3RUBL 4B3RJ 3FQKA 4JB8B 2I8EA 3TZXA 2LQJA 2HBRB 2IVYA 3HP6A 2VZ9A 1UVKA 2UV8G 1HARA 2IYGA 4DPWA 3Q86A 3OFHA 3G9CA 2CQGA 3KMSA 4CTAA 2I9SA 5A0YB 3PM9A 4NA2A 1K44A 1TP7A 2DK2A 1S1VB 2QYGA 5EX0A 4A47A 1TMMA 3LOUA 1S12A 1EKRA 2LQ5A 1RADB 2WVFA 3LWMA 3ULHA 1CS4A 1JJ2R 2FHKA 3SSSA 3SYZA 3OSPA 3MMAB 4JI6J 5KFNA 3VAIA 3J7YU 3HK2A 2Y0SD 4UQTA 2PD1A 3VZIA 1EZZB 4NEYA 2M4MA 2FIUA 5CAAA 1VISA 1QE1A 2XTJP 4Q43A 3VAMA 3RG6A 2YTCA 5I42B 4NYPA 5A2QU 2ABYA 4BCAA 1BQMB 1VR6A 4ZCMA 1VQMS 1EETB 3H59A 2MQMA 5FDLA 4Q8FA 1OJ4A 5F3ZA 5M2PA 1YJRA 5EWEA 1G4CA 1E6VA 1X4EA 3NS5A 2E1CA 4J9UE 1EKSA 4KHMA 1VQNS 4PAAA 2UUBJ 1APSA 1C1BA 5LOQA 2JVRA 2WBRA 1WOPA 2GO9A 3GIIA 3OXGA 2GX8A 3V81A 3S1TA 4EBDA 3DFEA 4ZIWA 4A8SA 1FRLA 3B78A 4MKYA 2GV1A 1AYEA 2Y3YA 4WIIA 2MQPA 1U1KA 1VK8A 1NDPA 2H5EA 2MQNA 3POTA 1J5EJ 3FRZA 2D1CA 4A4JA 4ED1A 1URNA 5CYMB 3GLJA 1U02A 4YR3A 2PMWA 1VRTB 1SPBP 3TP2A 3P45B 1LWEB 4DSJA 2ZD1A 1V3ZA 4RBVA 1LNQA 4KYZA 1FWLA 4JI3F 4YN3B 2ZH7A 4KPCA 3G8SA 2BW7A 2W9CA 4J9LA 5D8HB 3EXCX 3ZZTA 4DWIA 1REVA 3DNCA 2W1BA 5LSOA 4PG6A 2MMYA 2W9AA 1NK6A 4HDHA 3W5ZA 2FQQB 4F0HA 1T3NA 3FNNA 2YNFA 1KKHA 5F9NA 4PQUB 3G6YA 1CPZA 4ED0A 2G1DA 2HZVA 3BPSP 2N3LA 1SBRA 4B3RF 3JQMA 1D8YA 2RVJA 5A6PA 1RTIB 2DY9A 5EDWA 2ZKTA 2J0WA 3K5OA 2L48A 5HMZA 2HHWA 3CCQS 1QSYA 2DXFA 1QD1A 1KD1T 1WHXA 3IN5A 2DNYA 4OZJA 4RW7A 3OTBA 3BEGB 1N52B 2LXIA 1L3KA 4TN2A 5IWAJ 4JI6F 1RE1B 4RZRA 1AB8A 3SZ2A 1OSCA 5KFRA 3D67A 4AT1B 5FJ4A 1U1OA 3OVBA 1S1WA 4ID5A 4DLEA 1R8BA 3BYPA 1GFWB 4USJC 4ZVOB 4CLYA 1XEZA 3MM8A 2DHHA 3BF4A 3JSYA 2KZZA 4P9SA 3V6DB 2V4JB 1JJ4A 3MPYA 1ZTWA 5J2NB 2CVIA 3LAMA 4OZ0A 1DY3A 1N5YB 1SV5B 2MKYA 2UUBF 2J6UA 3OVAA 4DV0J 2DNKA 3NS6A 4NMLA 2MKIA 2POKA 4FF2A 4CLPA 1HNXJ 2FVCA 1T3OA 4LRAA 5I3PA 2UVVA 2UXDJ 5BJRA 1JLQA 2QRRA 5JXSA 3MOZA 5K8PA 1A6LA 2DRAA 3K57A 4TU9A 3KJVB 2RU9A 4FBUA 1X9SA 1XR7A 4WFNQ 3RU0A 2VB6A 2JJ4D 1J5EF 2ZE2A 1Z2LA 4CLTA 4J9QA 4UOCA 3W60A 2RS2A 3GILA 4I2PA 2P6TA 3Q8UA 4I64A 4OHXA 2C3OA 5G0RB 3OUYA 2DNHA 1Q86T 3NOGA 5KFKA 1KLNA 1XIQA 4TU7A 1RWXB 4WK3A 5KG6A 1H3DA 2HHQA 4RU9A 3GG1A 2Z2MA 3LGHA 2BJEA 3OR2A 2XYGB 3MMCA 1IQTA 2HG4A 2OFHX 4OYPA 1FT8A 1YRTA 4RL1A 1K0TA 1YBAA 2OSQA 3L95X 3VF0B 1WSRA 2UU9J 5EGYA 4HYKA 2WW8A 2WK4A 2W8LA 3C14A 5LMUJ 4OJ1A 4O3SA 4QR2A 2BZ2A 1S9GA 2H3EB 2HQFA 5J2MB 3TZWA 3HVWA 2XZWA 3N01A 1P9YA 4K4UA 1RTJB 5AXMA 1U2RA 4ZVPB 3HHEA 4I2QB 1QTMA 4G6VB 2J7KA 3TR5A 3OFGA 5KFBA 1R8PA 3DM2A 5HI7A 5T7LA 2IY5B 1NSQA 5I4MA 2HHVA 1KWMA 1WEXA 5IWAF 3ZO7A 1HR0J 1W2BR 5KT6A 1U8WA 1P1TA 3D0IE 3OLAA 2Q6BA 5AXNA 3WQPA 4X4SA 3KK2A 5KFPA 2LQ9A 1UP1A 3OR1B 1G7CB 3UNGC 3AFGA 4ED7A 4CLZA 5DG8A 3PEJA 2MZ1A 3R2CJ 3A3OB 1ZBTA 1RACB 2NLWA 2I38A 5KFEA 2HK2A 1T02A 2IRYA 3BR9A 4Q45A 4OHVA 4NLDA 4WU3A 2QA1A 4A46A 1F5BA 3T1HJ 2ZH5A 2RRNA 1UWAA 3UWTA 4DV0F 4ZVRB 5SZTA 2HRYA 1LFWA 1SKRA 1IQZA 2N82B 1BMQB 1HNXF 3ZNJ1 1IM4A 1DURA 2HQCA 2E66A 2UXDF 2ZM6J 4UZCA 5A2QY 4F0KA 3KLIB 4A8QA 3M2RB 1B70B 1NB2A 3U7JA 3EPGA 3EJMA 3N6MA 5IC4B 2VA2A 3G96A 4F4ZA 2MLZA 2CDQA 4PEOA 2MKCA 3ET6A 3TAPA 1SXLA 3K8VA 3PIOQ 1ULRA 1DTTA 4LVNP 1S9FA 4DFKA 4WKYA 1XJWB 1ZPVA 2VG7A 1HPZB 1RJJA 2RIJA 3N5BA 2VODA 4M5DB 2OEJA 1KRPA 1WG1A 3H4DA 1U6BA 1NDKA 2JH3A 2A10A 2HHPA 3PW2A 4M5IA 1AT1B 2FVSA 2HLUA 3W2VA 3Q23A 1NUEA 1U6ZA 2PE8A 1KOHA 1VQ8S 4Y2MA 1S48A 2UU9F 4O0NA 2IBOA 1S6UA 1Y3KA 5LJ5Y 5LMUF 1VBYA 3ZZUA 1VRQC 3PCOB 2JC1A 4QR0A 3N79A 1Q81T 2Q79A 3J81U 5IZHA 3MOJB 4CH1A 1S72S 2QFJA 3AJDA 4DN9A 2FJWA 3D5MA 1RAOA 4JV0A 3U1LA 4ECZA 3UN3A 2G0IA 1VRUA 4R5PB 2ZZTA 3M8QA 2Y1IA 3GIJA 1HNVA 4JBCA 4MIWA 1CULA 5KG1A 3VHQA 3H42A 2R8HA 1HR0F 1C4CA 2AX0A 4P2FA 4ZPVR 2EI5A 1T0TV 2ZWOA 4NASA 1D3WA 1DQ8A 4CTAB 5KT5A 4B9TA 3BBFA 3OHAA 2MLXA 4DS4A 3HI9A 5D3GA 1CS4B 3GFHA 5BYRA 3MUVP 3AY0A 4C8KA 2DXDA 1QVGR 1CJTA 5HN0A 3EYZA 3EMTA 1PAUB 3DGVA 1N36J 3OVSA 4GMKA 3TX8A 1I51B 2VKZG 1QE1B 4N77A 3IWXA 3CEDA 1WC0A 3PV8A 2PA8D 4LIRA 3GTYX 1F1BB 4DR3J 2M88A 1NJYA 4ZN1A 5FDLB 2ZM6F 1SC4B 2BANA 1RWPB 1TKZA 2RQ4A 2DISA 2ACYA 4L3NA 1E6VB 2WBMA 3GZ7A 4RUCA 1PYTA 3EICA 1EHWA 1C1BB 2OMOA 3LWLA 1OWXA 4ZPAA 3V81B 5GADI 3H5YA 2RQKA 1RUSA 1FDDA 3IM9A 1R3NA 3HHLA 1S77D 3NMRA 2DHGA 3DRYA 1IVZA 1FO1A 3CJ2A 3POTB 3HZEA 1X5SA 3L7PA 4UY8T 1RAJA 3GR1A 1S99A 3DKDA 2M8DB 2OLWA 3KUEA 3T5KA 1NO8A 2G2YA 2ZD1B 3CCZA 4TYBA 1UMJA 1X9MA 4Q5VA 2QYCA 2W9CB 1KSPA 2EK6A 2RHSB 4AQYJ 4RNNA 2BEFA 1REVB 1BGXT 1M5PC 2ZJQQ 1V5VA 2HBQB 5D0RA 5A8RA 1U2FA 2QX0A 1ZM2A 4CT8A 3VAHA 4F4XA 2BE7D 2Z0GA 4BBYA 1OY8A 3D54A 3A3PB 2KTQA 2YNFB 2GIFA 4OYOA 3Q8PB 1JK9B 1WKKA 4WXWA 3O8WA 4MAKA 4MK9A 1GNKA 1FKAF 5C2GA 2JWNA 2KVQE 5ETNA 2ZBRA 4F4KA 4OYIA 4ES1A 3KXDA 2CVEA 4KH1B 1AZSA 3GFXA 1N32J 4HEA9 4JP8A 5THWA 1UPMB 5F8NA 3HULA 3IXQA 1T9VA 4TLRA 2RNEA 5CD4H 4RW7B 1EAYC 3FRYA 4NLGA 3TA1A 4HT7A 1XMOJ 1OIAA 1NBEB 4ZITA 3TVYA 4DX8H 3LANA 2W4DA 1N36F 3ZZOA 3O44A 2A0FB 4QIGA 3LAKA 2EEYA 2EWHA 2V8GA 4M63A 1S1WB 4ID5B 4DV3J 1TUVA 2LDYA 2UUCJ 1WOOA 2HWIA 3T9ZA 1T05A 4JI7J 3MM8B 4B3TJ 4RNHA 1N88A 4DR3F 2FZGB 4AYBD 5ETSA 4K8RA 1RKJA 2C3YA 1DJ0A 2IMOA 4N7TA 3QT5A 4DF4A 2DGSA 3KG0A 3EZOA 4DJBA 1C4AA 2OPPA 2XHCA 3ZZRA 2B4UA 3K58A 3J7ZT 1JLEA 1XMBA 3OTEA 4IDKA 1VYAA 3KK3A 2IC3A 4I1TA 4YFUA 1JLQB 4JI0J 2K2PA 4X4PA 4ECRA 5CCMA 2BACA 2ZJPQ 4AE5A 1VQ6S 4X4NA 2HVZA 2ZE2B 4MMOA 3MUTP 2LCWA 1RAFB 5DETA 4I0WA 1IN0A 1S9EA 3EVWA 5L46A 1ZYQA 4E0DA 4N47A 3IM8A 4I2PB 1RU1A 1FKPA 4TKTA 4CQ1A 3OUYB 2F9JA 1UJ5A 4AQYF 3A3NB 4ECYA 1VQ4S 3K5MA 3NWRA 3OR2B 4J91A 2R7VA 2YX7A 3MMCB 4TU8A 2HQ3A 1R0AA 3R5JB 2QO3A 5D0EA 3OTOJ 9RUBA 2HYIB 5J2PA 1HHSA 5KT3A 3PYFA 5DDQC 4MYUA 4B08A 3VALA 4I7FA 4CM0A 3MAHA 2AJ4A 4FS2A 4LQ9A 2AGPA 4KC5A 2CPIA 3C14B 4CLFA 1S9GB 4NPOA 3QAEA 5JMNA 4Y2IA 4DQSA 2IA0A 1VQSA 3B4MA 2F7VA 3J81Y 1N32F 1JB0C 4ZMMA 4MJKA 3RRHA 3GONA 3FSIA 2D3UA 2HQDA 4ZCLA 3DM2B 2PIIA 1EB0A 2OPQA 4GO7X 5T7LB 2FLPA 2EVZA 2XGQA 3J7AN 4NLTA 4NXNJ 1S6QA 4KKOA 2ZOMA 4WFBQ 1XMOF 1YI2S 2OGUA 1B64A 4Y2AA 3PW7A 1RABB 1NK4A 3SSQA 3KK2B 2H5IB 4DV3F 3LA0A 2BJ9A 2UUCF 3C15A 3UPFA 2FZCB 4JI7F 2CQDA 3N28A 4M5NA 4B3TF 2HURA 3R6GB 1FNMA 3PR4A 2DIVA 4YDDB 4X4UA 4DZDA 1J2VA 4F3OA 1T03A 1T9TA 2H5JB 4K50A 2XZDB 1UZHA 2D69A 2GFFA 3H90A 2CJ9A 3I5CA 3MMJA 4RX6A 1UFLA 2OKQA 3C46A 2KN4A 4OIXA 2AIRB 3W9HA 5GADU 2MSTA 4K4YA 4ZOSA 3TYTA 1QUVA 4DL6A 1S1UA 2CZ9A 3E2EA 4HH1A 3W8PA 3GU0A 4JI0F 2DRDA 2GVDA 4NCAA 4RNMA 3RJMB 4CYUA 4NLUA 3QMQA 1RGVA 1LXNA 3MWBA 1MWQA 4IQXA 2R7RA 1S6PA 3KHHA 2FHJD 2PC6A 1VQOS 1HNIA 2COLA 3ET6B 3CCJS 2JL9A 4HH0A 2GHPA 1Q53A 4AL5A 5AT1B 1DTTB 1S79A 3VVTA 4ELTA 3GWCA 2RAQA 5LMNJ 5LSLA 4U9RA 2VH7A 2VG7B 3ZNUA 2AD9A 2MKJA 1YX2A 5K8MA 1U7LA 1TUWA 3UD5A 1F3FA 5KFOA 5HP1A 1FRHA 2ADBA 2ALYB 2QL7B 2MLYA 2P6SA 1WORA 3K2YA 1Q7YT 2V50A 3OTOF 3W2VB 3ZC4A 2V67A 3ILIA 2AYEA 3DLJA 3BBBA 1FRKA 3RR7A 4DPTA 2OD4A 2F8MA 2HSEB 4KPYA 3CPWR 1JX4A 1H2UX 4DXLA 1S7IA 4YR2A 3NOCA 2IIHA 1A7GE 1VQ9S 4HTJA 3D7SB 5HVFA 1I3OB 2DITA 2EW9A 3L7UA 1UVNA 2BRKA 1U1RA 2XMAA 4OLOA 4CCHA 3TZZA 2M7SA 1VRUB 3PX6A 4WFAQ 3M8QB 4OI0A 1WEZA 2MGZA 3ILOA 4X4OA 1T9YA 1RHUB 1HNVB 4DCJB 1CULB 4FYYB 3THVA 4NXNF 3PXGa 2AYBA 2CRLA 3AQOA 3PDNA 2HFSA 4B9LA 1HBMA 1Y0HA 2O01C 2KH9A 1LOUA 3ISNC 3HSDA 3R6LB 3Q8RB 1N54B 5DQIA 2DJWA 3TVKA 4JI1J 4CDIA 4HACA 4PABA 2R7XA 1WHVA 4J90A 4DR4J 2KI2A 5KFZA 5B0FA 5D3GB 1F0XA 3CE8A 2AGQA 2M70A 2W9BA 4L3KA 2CQ1A 1CJTB 2AJFE 4F0MA 2LA6A 2V9WA 5A76A 4OYMA 2BXJA 2NYIA 4J9VA 3G6ES 4A8FA 4B3OA 4K4ZA 1SL2A 1VI7A 2UVRA 2HS0A 1UVLA 2EFPA 5DQHA 5KFLA 4I69A 4ICLA 1BC6A 1WELA 3PEHA 3W5XA 2N4CA 4CH7A 3VR1A 3KHGA 5EHHA 1RAAB 3QIPA 2BANB 3HFKA 1TKZB 3EGVA 1FFSB 4JI4J 1I6JA 2DNMA 1LW2A 1UPPA 2HIQA 3I5BA 2VJVA 4LSZB 3C8YA 1N5TA 3M6XA 1WG5A 1QSLA 1KR4A 4QWEA 2P9GA 3JYTA 2G13A 3RRGA 1YG0A 1F9HA 2FVRA 3W8GA 3BGRA 1LQ9A 3I9V9 3OT9A 4CLLA 1TELA 3H25A 2QG9B 1TL4A 4KH0B 4X84A 3K59A 3HHLB 2NSBA 5LMNF 2MHNA 4BS2A 4DU7A 2R7SA 2V9KA 4C3KA 4LFAJ 4EYHB 3MTJA 1M5VC 3EVOA 3MCSA 1UKUA 3NCRA 4QW8A 2RD5C 4OV6A 1X4FA 3FK4A 1PGZA 3MD3A 4QOTA 2JLGA 1RB0A 2GQCA 1G6BA 1RLDA 4NXMJ 4MIBA 2A2CA 4NLOA 4DUTA 4F04B 5H9FK 5GAEU 5K8OA 5A8RB 2IDEA 2XMKA 1FWPA 1HKAA 1GMWA 2CPJA 1NKBA 2HHTA 2XI2A 4RR5A 1XMQF 3TX0A 2BE9B 2KFYA 1DRZA 2I0XA 3EX7B 1V5IB 5EWFA 2LP4A 3W9IA 2XEXA 4DR1J 1NKEA 4F7VA 4EUVA 2LU1A 2FVPA 4DPXA 2AV5A 3FFIA 2D3OR 4F50A 1AZSB 4DF8A 3KWMA 4OZ5A 2N4DA 4KY3A 4CT9A 3I9ZA 1FVSA 2H54B 4JI1F 1S59A 2VASA 2V34A 3PO5A 4HI2A 3U1MA 3RBXA 4DR4F 2CAJA 1LFPA 3CDWA 4QWDA 2L9WA 4NCGA 5DG7A 2V4QA 3D4JA 3T3FA 1MROA 5DS7A 4EO6A 2OMLA 2XWXA 4DL0C 3CCRS 2M2BA 3NNHA 4D3GA 4KGMA 1X4AA 3MAQA 2LECA 3LO3A 2P5VA 3TQ1A 1T05B 2JEJA 2KT5A 5K9FA 3BSCA 1WHYA 3M4XA 2DR6A 4EBCA 3H8YA 3QWPA 3CD6S 4F2SA 4IRDA 1RTZA 1QVFR 4JI4F 4ATNA 3PW0A 5DLFA 2MXYA 1YJVA 3ISND 3OXFA 2OPPB 2WTFA 3DLGA 1JLEB 2HGMA 2J9DE 2ZJRQ 3ZTPA 4FYVB 4IDKB 3KK3B 2IC3B 4NYZA 1RZMA 1SC1B 4K5SA 2EBEA 2RDJA 1GMVA 4IYQA 2PN6A 2NXCA 2HZAA 4RW8A 1UEKA 3NL0A 2VBWA 3WZ0A 4MKAA 4PWDA 2AW0A 2OHDA 3FUYA 4WFZA 4KV8A 3NEKA 1X4DA 1HMVA 1ZPWX 5KT4A 1S9EB 1KQKA 1A0OB 1FKPB 2DGWA 1PG5B 4NXMF 2J6SA 4HHUA 3QT6A 3WC0A 1T11A 3NRBA 2UUTA 3D3BJ 1FXLA 4QU6A 4XIUA 4J7CA 1R0AB 5DQGA 2DNNA 5E41A 4OFZA 3BR8A 3GV7B 5LL6d 5J2PB 3KUGA 1NJXA 2H4WB 2DGXA 2KJWA 5KG5A 2B4VA 1S7HA 4I7FB 1TL3A 3CMAS 1N0UA 4R25A 4PG4A 2E1AA 4KIAA 2AEFA 4MK8A 4DR1F 1ICEB 1JLBA 3KYLA 1U1PA 5LXYA 4J9NA 1D9DA 4ERDA 4J9PA 1DLOA 3IGVA 2H65B 4F02A 4QPTA 1N56A 4B02A 2ASJA 3OTCA 3CDEA 4ED5A 3S01A 4ZS6A 1K8AT 2QSWA 2OPQB 3GPAA 1TTHB 1UVMA 3M8WA 2CPFA 4CNZA 2MZTA 1S6QB 1S1XA 3GMGA 3UDCA 4ETZA 4KKOB 3NP5A 4QU7A 4FF3A 2L41A 3M30A 2FY1A 3CJKA 1XBWA 2AGOA 2VC0A 3DDNA 4AUKA 3C15B 3H5SA 3IR5B 3TEHB 2B9YA 3CC4S 4DL5A 4N56A 4YQWA 3Q83A 2RRAA 4JV2A 1F5AA 3M32A 3BM7A 3CJQA 3M8YA 2J8AA 1X5TA 1T03B 4O23A 2DR7A 2V2VA 1JMTA 1FD8A 3BSOA 3DXSX 4F3QA 2HPUA 4CNYA 3AAWB 3QT8A 3RGIA 1FCAA 1Z4UA 1S1UB 1RYSA 2O66A 1F9EB 2GVDB 4IRCA 1IR1A 3E3XA 3GSDA 4C8MA 3R7NB 1FX2A 2NSCA 3W5YA 4LFBJ 4CYUB 2BYCA 5ETRA 1XR6A 4GVLA 3I56S 3CT9A 4MIAA 1S6PB 1Q7LB 1F9FA 5B0BA 2VQFJ 2DHSA 2K3KA 1HNIB 3TEGA 2MZSA 2DNOA 4GC7A 1WF2A 3RZAA 3MHYA 2FTRA 1HHTP 3IR6B 1FHTA 2BJ1A 2R9LA 2XLKA 4B9MA 1X4GA 3NGDA 4L75A 3OXLA 1MWZA 4DL3A 5EWGA 3SI8A 1RAEB 5DDOC 3LGMA 1TUGB 2XY5A 5HP1B 3BKTA 4J9SA 4AFFA 3UR0A 2XQCA 2SXLA 1X5OA 3IWLA 3C16A 2CJYB 4G65A 2AT1B 2WVBA 2PO4A 4E98A 3KK1A 2XSFA 3UCGA 1YTYA 1CQNA 3DRSA 3PX4A 3AD8C 5KFUA 2ZNZA 4QWAA 1SL1A 2C3UA 3W3SA 5IT4A 2MDAA 2CPEA 2LEPA 4WYWA 3BQ1A 1M1KT 4QIEA 3QRPA 2VG5A 2MGZB 4RO0A 3QSYB 2BJ7A 4C2MA 4NRTA 2YKPA 1O6XA 2Y1JA 4DV1J 2X1BA 1HYSA 3R7BB 1U45A 1TV6A 4OYXA 4KGVB 5F41A 1CJVA 1RWWB 2JFDA 2X7IA 1QLNA 2HGLA 2LEBA 4OZLA 1L3VA 3PFEA 5AE2A 1HBMB 2FLNA 1LK7A 2WB4A 4LSLA 2E1MC 1MSWD 1HWJA 4B17A 3HMJG 1LV5A 4M95A 1FA0A 4B9UA 4HACB 1RXOB 2C2DA 3VVUA 3JQJA 1TKDA 1JNZB 5DJBA 3T1AA 1HBUA 4AXJA 1M90T 3R5AA 4W98A 1KTQA 3UN5A 2K8GA 2KM8B 2D7SA 2QIFA 2W9BB 3VAKA 4I6WA 1TK0A 2GAGC 2V0NA 2LLZA 2HFVA 3H2VE 3PRBA 4B3OB 2XWYA 1I1GA 2GIQA 2ZH8A 2B56A 3W63A 1C0TA 1YWXA 3X3UA 4ICLB 4C7QA 3SBMA 1FRIA 3T6JA 3R9LA 1RT4A 4BC7A 4J9MA 1RT5A 3QIPB 5BR8J 3RAMA 2R3VA 4LFBF 1LW2B 1RK8A 2DGQA 4O4RA 3E51A 2XO6A 3JYTB 4RW4A 3BQ0A 2VQFF 3BGRB 3MFHA 1IJFB 4Q2LA 4K2XA 2E29A 1WC5A 3BV8A 3OV7A 4NCBA 4HL9A 2BV3A 4PR6A 2C2MB 4USIA 4U7CA 2VDHA 2XMWA 5C24A 2KYZA 5KG0A 4O3QA 2CPXA 3QGGA 4O44A 1TVRA 3QLHA 4BWMA 2XY7A 1L5UA 2I5JA 4RW9A 4EZ9A 3K0JA 2DHXA 3FBCA 3DU6A 3W9JA 3AOAA 3U1NA 5CA5A 3KTQA 2KT2A 4ECXA 4J5OA 3TNVA 1QDUB 2YQ3A 4PUOA 3G87A 5IS2A 3RB6A 3NGSA 1NPRA 2E9RX 3QSIA 2X3DA 3QAUA 1MU2A 5D4NA 1RHKB 2U1AA 4P7TA 4ANEA 2GZOA 5E3PA 1FESA 3D6FB 1B7FA 1UFWA 3UD3P 3BO3A 4F36A 3Q24A 1JXLA 2C1EB 1UWBA 4NLVA 2RQCA 2QN6B 1GK8A 2J8SA 3M1VA 3EM1A 4EZ6A 5L1IA 5CD4A 4DV1F 3ZZPA 1FJGJ 3FSYA 1LK5A 1DHMA 3FFIB 1F6TA 1R43A 2YX1A 4DR6J 3MI7X 1DBDA 1U0HA 3M8SA 1SJ3P 3DLEA 3FZ2A 2DGOA 2DHAA 2MQQA 1YRXA 1YBUA 4V19J 3KJNB 5IQQA 3NCQA 3R5DA 3WHIA 5K20B 3EDQB 3KLEA 3RW6A 1OQ3A 4PWWA 1SH3A 4NZ0A 2QMUB 4NCGB 4PXEA 3F44A 1M5OC 3DLLQ 4XK8C 3QGHA 1LEOA 1FERA 1MROB 4FF4A 2XLJA 5H9FJ 3N0VA 4QYZJ 2JLEA 3VV2B 2P2CB 4R0JA 4DV6J 2JRSA 1K9MT 4OYZA 1R8HA 1K1SA 1OSDA 1Y7PA 3Q8QB 4ECUA 7FD1A 4WE1A 3KG1A 2F4FA 3NXZA 1RLCL 2B7BB 2DYAA 3FEZA 1NB7A 2EFOA 2KDOA 1UEVA 1YRUA 4ZLPA 4RKUC 3RTVA 4KTQA 4UT4A 5BR8F 1S1TA 3GCWP 2XULA 4U8YA 5KOWA 2G1HA 4OYWA 2FYXA 5E3CA 4USTA 4F25A 3MR7A 2O3DA 4DOZA 3DLGB 2QL5B 3GYGA 2IJFA 2XBPA 4J9KA 3L7OA 1Q79A 3H20A 1RT2A 3FBFA 3K17A 2FLLA 3BREA 3QFWA 5IT0A 2Z4PA 3W66A 4IO1A 2Y1LB 3CCSS 1RBAA 2D41A 1FNXH 5HROA 5KFHA 3OBIA 4DMZA 2ZHAA 1BD6A 4RW8B 2UVUA 4PWDB 2DR9A 3HD1A 3O1LA 3VZHA 2BBEA 4KV8B 3ETMA 1TFWA 1HMVB 1OO0B 3IAM9 4Z37A 2DVIA 5IC6B 2C2RA 2CJBA 5HK4A 1VQKS 1D9AA 5HMXA 1ZS6A 2HWHA 2FJDB 5HJXA 2OP5A 4OI4A 4M5JA 1OYEA 4NE9C 3PIPQ 4DS5A 1NK5A 3LW5C 3IRWP 1XWLA 2G0CA 2DT9A 5AE3A 1FEHA 1R6YA 1MMDA 4FKXA 5F0UA 4OI2A 2DNQA 2QMWA 1HA1A 1RHJB 4LRFA 3IBWA 1TL3B 2IM2A 3GCXP 2M52A 2D74B 1Y5LB 5E33A 4ER8A 2GHVC 1JLBB 1RTDA 2IVMA 4Y65A 1FJGF 2FHOB 2AU0A 1ZM4A 3L3CA 1DLOB 2JSXA 2PI5A 1NHUA 3PG9A 4DR6F 4M5KA 4I6YA 1AW0A 2J9EA 4DX7A 3T5JA 2FJEB 2WVEA 2XI3A 2B0GA 2ILYA 3MM6A 3M6VA 4RPFA 1Q8BA 3CUNA 2HWTA 5DZ6A 4UOFA 2A6OA 3V2UC 3GQCA 4C8ZA 4DX6A 4I67A 1EP4A 1YJUA 1CVJA 1S1XB 1RT3A 1KEKA 1N5SA 4WXOA 4YOEA 4GKKJ 4LVOP 2CPYA 1UZDA 3I96A 3M30B 2VFRA 2KYXA 4BWJA 2D3ZA 1EQMA 4EK2A 3BBCA 2MTLA 3BSAA 5KFVA 3CJKB 2P9EA 5HJYA 2VBYA 2XHWA 4C48A 4DV6F 1ZM3A 4KSEB 2VA3A 1X31C 2L3MA 3I0RA 2HBZB 1OQ6A 4MFBA 2YKOA 2IFXA 3A8KA 3MEKA 2AJ1A 5E7OB 1U25A 2IM3A 3M32B 2NS1B 3RB0A 2R2TA 5HQMA 5LM7E 1NK8A 2R8KA 3R5GA 1FVQA 3QZ7A 1Q8IA 1FJEB 4UZBA 2KFZA 2V2ZA 2V8HA 3NS7B 5HL7Q 2UV8A 5F8JA 3G2XA 1OY9A 1M1HA 2B7CB 1XNQJ 4M5LA 2DEJA 2DR8A 4UF4A 1MN9A 2WSCC 4QR1A 2JEIA 2OEKA 3R3TA 2ASDA 3CJ3A 3RBDA 4WWSA 3M8PA 5BXIA 2OIHA 3G8QA 3LP0A 2FGOA 3N6NA 3LP1A 1VDHA 5I3UA 1NH8A 4EFAC 4DQRA 3W2WA 3JXOA 1VJQA 5D6GA 2ZFHA 2VL1A 3RYLA 3P96A 1U1MA 3CD0A 3AA8A 1F3VA 1QM9A 1SC6A 3OL8A 1WTBA 1FF2A 1IM6A 3FBEA 4B9NA 3UR3C 5HVHA 1X4BA 4HHHA 3HJFA 1R31A 2IBKA 3QNWB 3JTPA 3UFCX 3DRRA 4GRSA 2QT7A 1Q8KA 4P52A 2OAUA 1PC5A 3CC2S 1ZAWA 2GJIA 2HHSA 3C16B 4LF4J 2EC2A 1HBNA 2F1FA 1GX5A 1CG2A 2BOAA 4B9SA 4I68A 3GSIA 2P9CA 4ZVEA 3KK1B 4G3IA 1CLFA 3DRSB 3FBBA 2OPSA 2QE5A 3AH6A 2DKOB 2W4PA 4P10A 4M94A 1HQ2A 3B54A 1VQLS 3FMBA 1S0OA 4TNOA 5E2QA 3VCDA 4CZCA 1SKWA 4MYTA 2KT3A 1RCOB 3CF5Q 2VG5B 5IM0A 1JXVA 3BDEA 4C8NA 2XO7A 3I87A 3QJJA 3P3DA 2L08A 4FXDA 2FZKB 4Z2XA 3ENVA 1HYSB 4HDGA 4TLQA 1TV6B 2QC3A 1CJVB 1FI4A 2C2NA 4GKKF 1VMBA 4PZVA 5D77A 3D9BA 1KONA 2ZC4A 4LSLB 5IV3A 1S4EA 5JVHQ 1KS2A 3GFZA 1VLOA 2XSJA 4KR0B 2E44A 2GW8A 4XAKA 3K5LA 2Z8QA 2NUUG 5KFYA 1RHMB 2YPYA 4L76A 4JI2J 1HBUB 1JLCA 5KFMA 1UVIA 3L9ZA 3TARA 3RB4A 3S7RA 5H9EJ 2MSSA 2KXNB 2B6AA 2CQIA 4LT6A 4ZK7M 3AOBA 2IJNA 3UDVA 1MMLA 4A48A 2ZKUA 3BKUA 3ONQA 2QJ3A 4N41A 2ZZNA 3ITHA 3UDEA 4C3MA 1Q0NA 4O3RA 4UW2A 2B5JA 2AZ1A 1XNQF 1C0TB 2LXUA 4ENOA 1RT4B 2RU3A 1RT5B 3V6KA 2MPUA 3R5CA 4RUBA 2CJXB 1BWEA 1XR5A 1B4SA 3Q2SC 2NPFA 2JZ5A 2FJVA 2A2DA 3H0PA 4DV7J 4RW4B 2K06A 4DSIA 1FFWB 4NI2A 2ZBPA 3JSRA 1UA0A 1IBLJ 2C2KB 2N3OA 4Q44A 2AYMA 6AT1B 4LF5J 5C24B 2H51B 4DCPB 1FDNA 4FNHA 2UP1A 1C1CA 4O44B 1TVRB 3QLHB 5DM6Q 1ZH5A 5D0GA 3M2VA 2I5JB 4RW9B 2CPZA 2KRRA 3UQSA 1QY7A 1GTHA 3OFEA 1NLKL 3BO2A 5JJBA 4PUOB 2JC0A 2B4PA 3DMJA 3R8YA 1R27B 1Y00A 4LF4F 2DTJA 2G9OA 2E9TA 5IV4A 3ILLA 1QAIA 2V6AA 2PFFB 2HMIA 2EC0A 3N5FA 1MU2B 4X4RA 4Y34A 2IM0A 1R6VA 2JDJA 2UXBJ 3CCLS 5HANA 5J1NA 1M0SA 4LSNA 3QJLA 3T5LA 3DGPA 4ZVFA 5F8LA 5C2CA 4X4TA 4NL5A 2ILZA 1IWAA 1UWBB 3SV4A 2CQCA 4IKAA 2E5GA 5I3QA 1Q5YA 3M1VB 4WK1A 3V6JA 4L72B 3OJUA 1YVFA 3M2UA 4PXDA 2FHJA 2CJKA 1FRXA 3GIRA 3KMQA 2YKNA 1X0FA 4F8RA 4Y3CA 1U0HB 2MKSA 5D15A 3DLEB 3MCNA 2XGPA 3TAQA 1HIYA 1ZOTA 4TYAA 4JI2F 1WKJA 3CD5A 2RB7A 2FJBB 3KLEB 1H73A 4F4YA 2Q43A 3IGNA 1IKWA 1RWKB 3EVMA 1NMEB 1X60A 3I0SA 1PO6A 4KGKA 5IQ6A 3HT3A 3QPIA 3SCJE 2VDIA 3F41A 2ZDOA 4HLBA 4X64J 3AT1B 5K5MA 4ZPBA 2IDLA 4FPIA 5KFTA 2VFVA 4EGLA 4WE1B 2HRTA 1PC4A 4ZN3A 1O8BA 2ZVIA 2XMTA 3D68A 2Y8WA 4DR7J 3QYYA 1S1TB 3K8WA 3GFYA 2JX2A 3MAAA 5IFMA 2EXUA 1MMNA 1B0VA 3F56A 4A8YA 2NUHA 4PG5A 4ZP9A 4DV7F 2GMJA 3GV5B 2GA7A 1HD0A 1KVIA 3KFWX 3HSGA 3MGJA 2ZOFA 5KFWA 2R42A 3H2UB 4IG3A 2MHEA 4P6QA 1RT2B 1RWOB 4YB1P 4GC6A 2CA9A 2G0JA 1WACA 4CO3A 1IBLF 4E2FB 3AHPA 5HROB 4LF5F 1JKHA 3CXCR 1E6YA 2V2KA 3OPKA 5E5NA 4OJHA 2CJQA 2BJDA 4WU2A 4ILRA 3CB4A 3PRVA 4KQZA 5KFAA 2BQRA 2C2EA 4LRCA 1Z1ZA 5M2UA 4USHA 1V3RA 4X4QA 3Q8VA 2HRUA 4AD6A 2ZH6A 1ROFA 4FN5A 4IFVA 4O0IA 4YP3A 1AXQA 2DH7A 4CM2A 1FXRA 2QTWA 2EFNA 2NQPA 1SVDA 2NXUA 1NXIA 3PRDA 2CUYA 1HNWJ 1JQGA 2WW4A 2AHOB 2WOMA 3TOQA 3VQSA 1VIXA 2UXBF 2CG4A 1SUQA 4IH6A 3HM9A 4N8OA 4YHHJ 3MCOA 2H1YA 3D2WA 3D28A 2AJ0A 3LP2A 4OV1A 2IMWP 3N9UC 4ED2A 3OW2R 3NGUA 4CIOA 3RBEA 1QSSA 2KHDA 1RTDB 2I1RA 3EPIA 4WP8A 3NGKA 4JV1A 4OLPA 1U4BA 3VAFA 2HNZA 2ZBCA 1FTCA 4EYIB 1RT7A 3UE2A 4FXVA 1SH2A 5C25A 4IG0A 3MM6B 2QLFB 2R8GA 2ZZMA 2OPRA 1EP4B 1RT3B 1HQUA 2J9DA 1R8AA 4GO5X 3CCMS 1DARA 1P1LA 1VHFA 3QZ8A 1WNEA 2OH2A 3MD1A 4C0HA 2YX4A 1OS5A 1A9NB 2DGVA 4X64F 1YDLA 2WVDA 4K7QA 2UXCJ 3I0RB 3CJ4A 4ILMA 4MFBB 3DRPA 2QFIA 2ZHOA 3MM5A 3BPDA 2VFSA 2XZTB 3HJVA 4DR7F 3PO4A 4Y6IA 4OYBA 2GJFA 8ATCB 1R7IA 3FCVA 4BC9A 3CIMA 4LF1A 3GYXB 3I55S 1YGYA 5HQLA 4X4VA 4WP9A 3PVXA 4TQSA 3HHNB 4URQU 2EK1A 2Z2YB 1HBOA 1YQHA 4E8UA 1GXTA 4BLGA 2XG8A 3K89A 3IG1A 2B9EA 2CDRB 4XDDA 3SFGA 2W2PP 2RF2A 4O4GA 1FKOA 2J0QD 3P4UB 3M8PB 2PI4A 1NK9A 4ZLNA 2YH0A 2HEKA 4UOHA 3BSNA 3LP0B 1HNZJ 5AXKA 4LF2A 3LP1B 5I3UB 1FXDA 3W2WB 4QBUA 5HO4A 4V1Ak 1RU2A 2E1PA 2GO8A 4OJGA 1JJCB 3ZZZA 2UVWA 1KBRA 1R89A 2HS3A 2ZH9A 4PKDB 2KB2A 3IRXA 3SMZA 2BQ3A 1LW0A 2NREA 4LRDA 2R2RA 5KFGA 3ZTQA 2E5HA 5DG9A 1NU4A 2R7QA 2BJ8A 5E3AA 1TFYA 1YZ6A 4AL7A 1HNWF 2VBZA 4C0BA 1YHQS 2R2SA 1S5ZA 1NJIT 2F9DA 5J2QA 2VV5A 1G2EA 4URGA 3HSJA 4YB7A 3CMES 2KZMA 1WC4A 3DRRB 1N8RT 1NKCA 2YWKA 2CQ0A 4YHHF 2VQEJ 4CO0A 1B0PA 1FD2A 4H54A 2ZOGA 1ITPA 1NCLA 3I4PA 4DV5J 4PPZA 1HBNB 3FC9A 3M7VA 4WZMA 2HNYA 1ZA2B 2XS7A 2ASYA 1JLAA 1W26A 2OPSB 3IWNC 1WHWA 5KFQA 3DDIA 3ENWA 4RUHA 1H7XA 4H4KA 2W7PA 1Q16B 4CI0B 5GMKa 2B4OA 1IWGA 4GVBA 1H74A 2V8PA 3MFIA 4KHRA 4FVCA 2V94A 5KFXA 2W7AA 1L3SA 1VBKA 2DPIA 3ETOA 2VD3A 5IM0B 4O3NA 3I6PA 1OY6A 4ED6A 3K5PA 5KFIA 2BKNA 2VG6A 3ZZ0A 4LFCJ 2NXNA 2GQQA 1SQEA 3UN2A 1H38A 3MPUB 1U49A 2FPHX 1HWIA 2RE1A 3N6LA 2XSJB 1GQEA 3RW7A 5L38A 3V4MA 2FY8A 4DHVA 2UXCF 1WF1A 4UQGA 1KN6A 2F3JA 5E0OA 4FYXB 4I4BA 2F8HA 3THPA 2VPXB 3W64A 1JLCB 1RWMB 2XC9A 4DR2J 1V3SA 2HZCA 4U8VA 2BA9A 2HW3A 3C3LA 2B6AB 4USWA 1PILA 4WP3A 3RBZA 1RT6A 1YKWA 1SC3B 3UNYA 4NYOA 3HXMA 2GIRA 3ITHB 3SEOA 1ZAVA 1IBCB 2B5JB 4FBTA 4DBQA 4U95A 2BABA 1EX8A 3VGTA 3FEYB 1EARA 1FDAA 4K4SA 8AT1B 4PXBA 1UL3A 2YQ1A 1KLMA 3OTDA 1HHQA 1MLAA 3LGNA 5D4OA 3P49B 4MK7A 4WYLA 3MF5A 1HNZF 3M9MB 3WBZA 3FCWA 2WB1D 4YMEA 4HTIA 1CC8A 4NI2B 1FRMA 1BQXA 1GEHA 1IR2A 5L9XA 3M9OB 4TQRA 4DSLA 1WC1A 2XCPA 4USKA 2PGCA 1HI8A 4DV2J 1C1CB 1VC5A 4O3PA 3A4TA 4A8WA 2ZH3A 3M2VB 1PBUA 4ZDNA 3QFHA 2Z57B 1WD6A 3SDEA 4HKQA 3KLHA 2MJNA 4OMFG 5ETKA 3TW0A 4OI6A 3EUNA 3KLGA 5GAEI 3KDNA 1NHKL 1SH0A 2QLJB 4M1KA 2VQEF 2EG1A 4U7UD 3DMJB 2ERRA 3ZFVA 4ELVA 4DV5F 2DRBA 5LXRA 4FYWB 3TAMA 3DYAA 2RUSA 2EBGA 2HMIB 2LYVA 5B7WA 4RNOA 3I31A 1G3OA 1U1LA 3SQOP 4F4WA 3AD7C 2FC8A 2JEGA 1MW7A 4Y28C 2MQLA 3M9NB 1BE4A 1Y9OA 3I5AA 1M5SA 4LSNB 3FZBA 3DGPB 4Q2MA 5KOXA 1X9WA 1DQAA 3MR6A 2FLOA 4OQJA 4Y00A 2FJXA 3GYNA 1EQ0A 2CPDA 2HK3A 1IKVA 1TAQA 3UCZP 2DEIA 4X66J 3NNAA 2F4VJ 3I82A 4X62J 4G1QA 5CXTA 1Y5IB 3D1OA 2ATCB 4LFCF 3M2UB 3P5TL 1MNEA 1KP6A 2V2QA 2ADCA 5RUBA 2HVEA 4XDCA 3TJAA 2YKNB 1DFDA 2KXFA 3E01A 1PJ7A 1FJCA 3RB3A 1XERA 1SIWB 1FJ7A 3O3LA 2JLFA 4P75A 2VHGA 4WFXA 2ASLA 1KDNA 1JIHA 3A12A 4LIWA 2E7WA 2VPZB 1IKWB 2E5JA 4DR2F 1ZZFA 1YITS 3QGIA 1X5PA 3I0SB 3IO1A 5B0EA 1NDLA 3CJTA 1F5CA 4ES2A 4K4TA 4OX9J 4WIQA 4RU2A 4F3MA 2CYYA 4ZP8A 1SL0A 2ROPA 5LSRA 3TO8A 1PCAA 3MR3A 1V6HA 2AEJA 2OTJS 4F4AA 2QA4S 3MAAB 4CO1A 2JHEA 1D09B 4NX9A 3FSXA 4DFPA 4QJVA 3TUPA 4WTOB 5KAKA 1N33J 5KFDA 3UD4P 3CD7A 1X0PA 3ENAA 3MM7A 4ZVSB 2GHWA 3H2LA 3PJ9A 1H2VZ 4F67A 2LMIA 3UDLA 2W24A 4IG3B 3NAIA 2LA4A 3AODA 2IRXA 3BDPA 3CCTA 2MB0B 4K4VA 3ADAC 2OJ3A 3BS9A 4ZVUB 1JKHB 4DUYJ 2FD2A 1E6YB 4DV2F 2MKHA 5B0GA 1T9XA 4OZ1A 3SSRA 1IJEB 2B8QA 2Y1RI 3QRQA 5EUHA 4WFYA 4DDFA 4QPXA 3JQKA 3CJRA 3W62A 2XY6A 5LJ3Y 3I32A 2QGFB 4YB5A 4IFVB 1H7WA 1U09A 7AT1B 3CJ0A 3B4DA 5KFSA 1TL1A 2M9KA 1V9OA 1HLWA 3F0NA 2XYHB 4ZPTR 3M6UA 4RJVA 4UUXA 4LF8J 1XMQJ 3LUYA 1JWWA 3VWSA 4RBTA 2CQ3A 1N6QA 1PIEA 1F2HA 2WOMB 2W8KA 3C19A 3PTWA 1SUQB 3MM9A 1TL7A 2Z58B 3LALA 5F8HA 1RYRA 4I56A 1WSVA 4ZVHA 4U67Q 2BM1A 3D0HE 5IOLA 4P2MA 3LP2B 3MZIA 4A8XA 4X66F 1U8SA 2AEMA 1I5OB 2F4VF 2BR0A 2JEFA 1N34J 4H4MA 2N7YA 4X62F 1VJWA 3EDRB 3GIKA 2HNZB 4LUBA 2O67A 2GMLA 1RT7B 3CW2C 3DC2A 4NLXA 4KJIA 2J6TA 2R2UA 1QTNB 1TKXA 2ZH2A 2BW2A 3VGUA 5C25B 4IG0B 1LWCA 3PZPA 3ZTSA 2E9ZA 3OJSA 3KG4A 3NY0A 3BN4A 2CWXA 3L4BC 4P2SA 2OPRB 4N8NA 1HQUB 4ECWA 5K14A 2AQ4A 1TQLA 1T9WA 3W7BA 2ZH1A 2J7UA 4OI3A 4C11A 3R1LA 4OX9F 2E1RA 2XM3A 5K8NA 3JSBA 2VPYB 2F63A 3DRPB 3MM5B 2MY7A 2YY3A 4ED3A 5ETMA 2BVZA 4C4WA 2HHHJ 1U24A 3BGUA 2W2QP 3D6TB 1N4LA 5AE1A 3J80U 1TU0B 1OYDA 2FDNA 2R7WA 3CMQA 3OSNA 1XK8A 2XS2A 2FJAB 1N33F 1C0UA 1D0EA 3VAJA 3JB9k 5C42A 1HBOB 4FZVA 4DEZA 3P5BP 3LQVA 3AQPA 5L9NA 2K3IA 3IG1B 4PYDA 3BJYA 2NYHA 2QLBB 1TZ0A 2Z30B 4CO4A 4JI5J 2RF2B 2XLIA 4O4GB 1FKOB 2YKQA 2HAFA 2B51A 4DUYF 3A8IA 1WJ9A 1IKXA 1SJRA 2BX6A 2IM1A 5FLXU 2YNHA 2IHR1 3KNGA 3V5RA 1Z2ZA 1CC7A 3NWGA 2CZVC 4OZNA 3KOAA 3DOKA 1GXLA 4A8MP 5L39A 2MY8A 4R0EA 3X1LB 2HVIA 1XQIA 1CJKA 1PKUA 2FC9A 1GT8A 1S0VA 2HS4A 3C66A 4LR7A 1IKYA 2XMVA 1T7PA 3GB0A 2GNKA 4C97A 3BZQA 4JOUA 4P72A 3IRXB 1LWXA 1LW0B 3MPDA 1FFGB 4QQBA 4LF8F 1Y11A 2Y9HA 3HHKA 5L1JA 3PW4A 1KNZA 5J2QB 2OTLS 2A1BA 4OI1A 1Y3JA 2XMUA 2AP6A 1RBOB 3EE3A 1PYOB 1VK3A 5T41A 1BLUA 1NH7A 2DD8S 1Q1KA 3G86A 5GAGI 4LMZA 2HNDA 2GC8A 4FYDA 5KT2A 2CZ4A 3CO0P 2HNYB 1IBMJ 5F3TA 1WOSA 5F8GA 1JLAB 3MEGA 4CO2A 5KG4A 1N34F 2V63A 4RBUA 5KG2A 4WZQA 4GVBB 1VBXA 3JAMU 3CULA 5J1PA 2RT3A 2N7CA 5AJ3J 1VS3A 5CYQA 4W4MA 3G71S 4ANDA 2NZ4A 1B99A 1FE0A 3T1YJ 2DNLA 1H98A 3LTOA 5DM7Q 4ZP7A 3MECA 3TJ9A 1YJNS 4QZVB 2C2OB 2ROEA 2VG6B 4RWWA 4PWUA 1HI1A 4DQQA 1RCXB 2ACMA 2W25A 2W2MP 2JVOA 3MCMA 2VICA 1WWHA 4KRWA 3QBCA 3RR8A 3DOMA 6FD1A 2ZBQA 1KOOA 1NHVA 4TY8A 3VGVA 1HW8A 2DCUB 2YWWA 3UCUP 3FGVA 4M8LA 4OZ3A 2B9WA 4IR9A 2DR5A 3G6XA 3FMWA 2GVZA 4W92B 3BKFA 2B43A 4NLWA 3GIMA 1GAOA 2HHHF 3GJTB 1RT6B 2E5LJ 3BQ2A 1K47A 3KHLA 3HVTA 2G4BA 3T1HF 2M8HA 3TI0A 2ZUGA 2RS8A 1O5JA 5HMWA 4G1PA 3C6TA 3DOLA 3GG0A 3HD2A 3QWUA 2G2OA 2XNQA 3IBFB 1UW9A 1KLMB 4JI5F 2HVHA 1YJ7A 2DY1A 5GAHI 2KG1A 3PR5B 3A1YG 5ETOA 4PG7A 1UA1A 2CPHA 4K2JA 4C3LA 2I2YA 1WC3A 4KGXB 2P8IA 4K5RA 2A6MA 4EO8A 2GAHC 1B7YB 2RDDA 3Q22A 4DPOA 3KJQB 2AWZA 2R8JA 2C42A 4YB6A 3SDEB 2V8DA 3KLHB 2AKWB 1AUDA 2V69A 2R7UA 3KLGB 3M6WA 4MT1A 3RAXA 2IRUA 2UZAA 2C3PA 4JI8J 2HFZA 2HGNA 4DL4A 1ZETA 2ZBIA 1T94A 4RWXA 2NXJA 2JOQA 3TAMB 2HQIA 1UW4A 3DYAB 4CLWA 1IBMF 4OX6A 1CBKA 4WF9Q 5BYQA 3T6BA 2KU7A 5GMDA 5CZXA 1BXNA 3EZUA 3GV8B 1URRA 1HWKA 3FJ2A 3DDKA 4ED8A 2FVQA 1QJHA 4DPYA 5AJ3F 2GQ2A 1RTHA 2BJ3A 3MEDA 1NM2A 3T9NA 1WI8A 1U26A 2DB1A 4P2XA 2B9XA 1IKVB 3MMBA 2NXEA 2WHOA 1VOMA 3T1YF 5ETLA 3JTNA 1U48A 3SIPB 4H4OA 4B9VA 4KO0A 4G1QB 2Z2LA 4MKVA 3VTIA 3KNAA 2EFQA 5CH7B 4ZCKA 2V68A 2XNRA 1LKZA 3E01B 4YEAA 2DCLA 5F8MA 3CVKA 1X4HA 1WG4A 4K59A 5E3QA 2MKKA 2HQGA 4OYAA 2LFVA 3D1QA 1ZAXA 3DLBA 3KKFA 4ZPCA 5DGAA 2EKYA 2Z56B 3KUHA 4YUDA 2R7OA 3J7A1 5B0AA 4EWTA 3LPEA 3GJQB 5B08A 1NAQA 1VCTA 2K7KA 2WSFC 2E5LF 1PYSB 5A8KA 1YIJS 1YLXA 2XYPB 4YY3J 4ECVA 5C5JA 2WCXA 5F9LA 5FIIA 4FP9A 2ZEJA 2IA6A 4ZPWR 2ZVSA 5A8WA 1U47A 1JNRB 3QIDA 2RQMA 3D66A 3GJSB 3D6HB 3MTKA 4Z7CA 3R97A 1MWYA 5HMYA 3SQGA 2I6WA 5HSPA 1SKSA 3RRKA 3I4HX 3J80Y 3MM7B 2K1RA 4DR5J 3EWGA 1WDTA 2V4RA 1UTAA 1VC0A 1MN7A 1WF0A 2LKZA 4IOBA 4RNFA 2PMZD 2GGPA 3QQCD 1RAIB 2LQBA 1TK5A 1B3TA 3G8TA 1ZM9A 1N0VC 4FXWA 2BKOA 2V8VA 1CJUA 2GCFA 3DN9A 4QIWD 3EGZA 1SB6A 1TK8A 5FLXY 2HHUA 3R1HA 2E5IA 1IXKA 2OEMA 3G82A 3MEEA 4NZ6A 5B0DA 4DUZJ 2M5YA 3K7RA 4OJ3A 2OFGX 2VFTA 2F40A 5ETVA 5GAGU 4JI8F 3RAQA 1D1UA 5DLGA 2X1GA 3PJWA 4MKBA 2YNIA 1TL1B 1FK9A 4CLUA 4HI1A 1LWFA 5DDPC 2VIHA 3A8JA 1N6QB 5ADZA 4U7UK 3BB5A 2CQHA 1KQFB 4ED4A 3MM9B 1NSPA 4DPUA 1TL7B 2QA2A 5DO2A 2KVIA 3WDOA 1SI9A 3H40A 4AXIA 2GS8A 1QAJA 3TUJC 3R7SB 2YKAA 1J5OA 1I94J 3PHTA 3FKBA 4DSFA 3VGSA 2MZJA 4KFBA 4Y0FA 4J9RA 3O6QA 3TUZC 2NR0A 2X1AA 2YKMA 4H4MB 1BQNA 4K4WA 1SQFA 4YS2A 4CP5A 1LXJA 1SJFA 1C2PA 2BOPA 1TKXB 4ES3A 3JAMY 4DU8A 1U1NA 1LWCB 3T19A 1GXUA 1DZ5A 1HQEA 2VOPA 2KKHA 4L74A 3ENQA 2RMLA 5CABA 1DTQA 3QRRA 1VQPS 1Q82T 1W7WA 5K14B 2RKIA 4RLEA 1F2GA 2XB2D 3SXLA 2X3GA 2VOOA 2MQ8A 2YWFA 2DNGA 2DNZA 1P27B 1SCJB 2C22A 4C11B 2OI2A 3IFEA 4YY3F 4WCEQ 2MZQA 3DI6A 4PYAA 5D4LA 1O51A 4DFMA 5MLCV 1RWVB 2J5AA 3PYEA 2ZHBA 5GAHU 3HFVA 5BYSA 3HPOA 2YWEA 4WKRA 1ACMB 4IH5A 3R5BA 1C0UB 1VIOA 4DR5F 2YBVA 3JSMA 1Y4ZB 5C42B 4LR8A 2RH3A 1RP5A 3M8RA 1RHQB 2BDPA 2OELA 3TUIC 4AL6A 4ITSA 2VPWB 2H4YB 1PJ5A 3S8SA 1SJQA 4WJBA 4KT0C 1IKXB 2RILA 2YNHB 1U1QA 1HW9A 4P7VA 3NKYA 3QO9A 2CNKB 3DOKB 5KG3A 4R8UA 1Q95G 3TJ8A 4DUZF 1U0SA 1WKLA 1CJKB 2J0XA 2BE2A 4NLRA 3KJFB 3SCLE 4UTGA 1O0PA 3NNCA 4HT5A 1GX6A 1IKYB 4ZA1A 3QJPA 2HFNA 3HHLC 4CLKA 1VLYA 1RWNB 3S6EA 2DO0A 1SKUB 2H48B 1AROP 1CQMA 5HLFA 2EFGA 3DHXA 3CCES 3IR7B 4ZHRA 4XPCA 4IR1A 4ECSA 3GE9A 4O3OA 1BWVA 1NK7A 1I94F 1BY9A 2HNDB 2KFNA 4NWBA 3IS9A 2RUGA 3UVJA 5IT9U 3V6HA 1IUJA 2HBYB 3MEGB 1JLGA 5KFCA 4B3MJ 4IRKA 3C2PA 2AYGA 1W2IA 3IA0A 3AB4B 2XCAA 3DLKA 3PJXA 4A8KA 2YWGA 5CYQB 4Q0BA 3ZTRA 1XN9A 2BRLA 2MEWA 3TRGA 4ZJOA 2YNGA 3BH6B 4LBHA 3WIVA 1KFSA 3MECB 4JYAJ 3OLBA 2PFDA 2VONA 4IFYA 2C2ZB 3DRXA 3BGFA 2V5HG 1NZ8A 4M5HA 2C3MA 4P74A 1GH8A 2YH1A 2QSFA 1NRKA 3DOMB 3HO1A 4TY8B 1KHWA 4H4KC 4DG1A 3TA0A 3PHEA 3MR5A 2FHMA 2Q3PA 1F60B 1YSJA 4PPDA 2GVZB 1FWKA 4ETXA 5L1KA 5B09A 3H4BA 2BQUA 5CCLA 2CWKA 3DLHA 2YQ0A 3HVTB 4KGZB 2WONA 3CCUS 4P73A 1RKIA 2CXEA 1H2TZ 5KFJA 2FB0A 2HFOA 1NSKL 2CQPA 4ECQA 3C6TB 4OZ2A 3BN7A 4S0MA 2AMCB 3DOLB 1RAGB 3R27A 2DGTA 4DN0A 2EFVA 3LF0A 4LF6J 1NK0A 4N5SA 2W2NP 1NEEA 1RA7A 2LXFA 4MH8A 2DO4A 4DV4J 1M1GA 1B0TA 2CADA 4J9OA 1P9QC 3D3CJ 3CIZA 3P6YC 4ID8A 4ZP6A 4K4XA 3R2DJ 4PG8A 1BUXA 4QW9A 1AUSL 5L1LA 3AXKA 2KJVA 4URSA 2EG2A 2L9DA 1D8ZA 4LF7J 4QIVA 3PYDA 3KLFA 4K0KJ 1TKTA 4D3HA 3Q89A 3JS9A 2CNLB 3HCXA 2ZC3A 4FDFA 5CZVA 4USUA 1UJ4A 3QT7A 3EGNA 2CNNB 4NLQA 1UCNA 2YVSA 2Y8YA 2IAJA 1QUPA 1VGYA 2MZRA 1FNOA 2GJ2A 3CO9A 1KTVA 4KAIA 1TL5A 2ZUAA 1NDCA 1AA1B 3T41A 8RUCA 2F5GA 4DFJA 5HATA 2ZDPA 4QYZK 4B3MF 2DBBA 3K5NA 4GKJJ 4M5MA 2CQBA 2D9PA 1KC8T 3B8HA 5HAOA 1XNRJ 1UETA 5HBMA 3T5HA 1Q4RA 1HWLA 3SFUA 5KFFA 1RTHB 3MEDB 1AFJA 3D6MB 3HHLD 1R0BG 3WC2A 3MMBB 2LVWA 1DQ9A 5D78A 4CLSA 4H4OB 4JYAF 3CWJA 4KB7A 4LQ3A 3CC7S 2QZ8A 4KO0B 3DXBA 1WEYA 2VBXA 2WRMA 1RT1A 2IVFB 1TR0A 2DGUA 2RJZA 1UAWA 4BDPA 1KQSR 4IO9Q 3WX4A 2PA3A 2CQ2A 3CJ5A 4Z7YA 5ETTA 3NMAA 2JFKA 5JVGQ 4ZVTB 1Y5NB 2PEHA 3NGRA 2YPZA 2RDIA 2HVDA 4CH0S 4JV5J 3HLUA 2XMJA 3MPWA 4DCOB 2CJAA 2VKRA 3NBPA 5A8KB 1HI0P 3HSZA 1JLFA 4ZLJA 3OL6A 3J81j 3P8BB 1RI7A 4IOCQ 1RA6A 3C6UA 3HFZB 1S57A 2VJUA 5A8WB 1PJ6A 4C9DA 2W01A 4ZJLA 2QV6A 3HHDA 2L9NA 1L3UA 5HVGA 2DNPA 4LF6F 3ZXWA 3SQGB 1OPIA 3CJ8A 4DV4F 4ELUA 4ZJQA 3HZGA 1H6KX 3CTRA 3D1HA 3H5UA 4LBPA 4EMDA 2O1PA 2K1RB 1T8EA 1FTRA 3V4IA 2M0GB 1YJ9S 2J7WA 5ITHA 3QGPA 4LBIA 3VQTA 5J1EA 2GGPB 3CDBA 5SUHA 2ALZA 5GVQA 1UEUA 4XTTA 2R8IA 4LF7F 2OUGA 2X1FA 4K0KF 1CJUB 3Q2TC 2BMBA 2IYIA 3CCVS 4B3SJ 3FQLA 4LFAF 3TANA 2J0SD 4RW6A 3M05A 1RWUA 3G82B 4NLSA 3MEEB 3CDUA 4CWBA 2WSEC 4PCQA 4WPAA 4ALZA 1TMJA 5ETQA 3CDAA 2M3DA 4LREA 2Y0BB 3SCIE 4FS1A 4OL8A 4IOAQ 2YNIB 1REGX 1FK9B 3WIUA 4Q8EA 2XS5A 4OHYA 1LWFB 3BO4A 3BGOP 1N48A 3HF5A 1P8GA 3HVAA 2Z2ZA 1M5HA 4ZCIA 2C28A 4W90B 2AF6A 3QATA 2UUWA 3IAS9 1NPKA 3PX0A 2J76E 2ZITA 1HFEL 4GKJF 4DQIA 5M2RA 4CO5A 4EEYA 1XNRF 1OMSA 1J5OB 1MG7A 4DSEA 1NZAA 1RAHB 4NA1A 1NPPA 1IBKJ 2NPIA 4KFBB 4EI2A 4NRUA 1JXEA 4ECTA 5IXUA 5DGBA 3ZTOA 4HVZA 2YKMB 1BQNB 5A0YA 3WX8A 2Q6CA 5IT9Y 4EBEA 5HQ8A 3AOCA 1S1VA 2YXLA 6FDRA 1NJZA 1VFJA 3Q0AA 2PT0A 4X65J 3PW5A 3CSKA 2PEBA 3MMAA 3O2IA 1RSCA 3MXHP 1HQEB 4JUZA 1KFDA 1HD1A 1S0NA 1DTQB 1H72C 2G2ZA 1SJ4P 2U2FA 4UY85 3EXYA 4NEZA 4KHPJ 1FX4A 1QAXA 2RKIB 3HKWA 4G1IA 4JV5F 1XC9A 4L73A 2HHXA 5I42A 3H7HB 2QL9B 1BQMA 3NGTA 2OD6A 1M5KC 2HIYA 1EETA 3D0GE 2VU5A 5U47A 4DI6A 3DI6B 3THTA 2KM8C 5KT7A 2VF3A 3U27A 3ISZA 4C8YA 3A13A 1WUUA 2KO1A 1R0CB 3PKMA 2KXHA 2BUNA 1K0VA 2LEAA 3HKZD 4P71A 5GMEA 1AFIA 4OHZA 3SCKE 1T9UA 4LR9A 2W7OA 4NZ7A 5G4DA 2AJQA 2MQOA 4Y2CA 4NLYA 4KE5A 3JSMB 3TA2A 4MTPA 2UUAJ 1Q78A 3UW1A 1K73T 3DCAA 3H5XA 4C8OA 4LF9J 2CQ4A 3OFFA 4L6V3 2HLTA 3GP9A 5CYMA 2Q66A 3FDSA 1N5QA 1U6FA 3MUMP 1VRTA 2F8EX 4UUWA 2R4FA 3AJ1A 2CNOB 4FNIA 2BKPA 1LWEA 4B3SF 3QO9B 4R8UB 2J9CA 1WI6A 4FF1A 2BE2B 1SIZA 4TY9A 2R7TA 1UJ6A 1D9FA 1PBAA 1VQ7S 4ZVGA 1UFKA 4U96A 4Y2KA 1GMUA 1SQGA 3KDOA 2ZH4A 4YR0A 5C7PA 3MDFA 2EPIA 4DZ6A 5AXLA 1PAEX 3L09A 2D9OA 3DU5A 5DDRC 3TZYA 4DLGA 3BH7B 4KBIA 1CEZA 3KHRA 2CFXA 1X8DA 2LU2A 5KG7A 1YBTA 4PQUA 5HLFB 3LPYA 4USMA 4ZHRB 3SV3A 2ZWPA 2OO4A 4A8OA 1RTIA 1IBKF 1JJHA 3IS9B 5H9EK 3J7Z5 3UVJB 3UO0A 2HAIA 1VQ5S 1S10A 4PRFA 1JLGB 2WVCA 3BYRA 4ZLLA 2YWHA 4ZVQB 3CNQP 1OPZA 2B8PA 2X51A 1HL6A 3PKYA 4FPRA 3DLKB 4X65F 2LQ8A 3DHWC 4Q0BB 3CJSA 1KQGB 3G6VA 1NNDA 2VC1A 4EU0A 2YNGB 2EKNA 1TAUA 3AD9C 4KHPF 4DL7A 4ZKAA 4XPEA 3NLCA 2QLXA 1ZA1B 4IFYB 1Q8LA 4FVMA 2QMXA 3FCHA 2JNJA 3E8OA 9ATCB 2HFUA 1YZ7A 5CHCB 4BHQA 3V6DA 2V4JA 3EGWB 1BHNA 5J2NA 4DG1B 3OL9A 4J37A 3J7YI 5KTQA 1N5YA 1SV5A 2KL8A 3N4WA 3VAGA 1WC6A 5EX3A 2OSRA 4RUAA 3HDSA 3O5TB 5F8IA 1ELOA 4ILLA 2AJ2A 2KG0A 4TXSA 1RHRB 1T95A 2WONB 3GR0A 2UUAF 4ANCA 3KJVA 3AXMA 4QIFA 4LF9F 4FKYA 1FE4A 4LJMA 2AZ3A 1J27A 5F0WA 1P6TA 1QAYA 5D4PA 3US5A 4NOHA 3LH2S 3FVYA 5G0RA 4TVAB 4C6AA 2CKWA 4M5GA 2DH9A 4IH7A 2IJRA 3NG8A 2QA4G 4CRJA 4U6PA 5H1SV 3IMQJ 5T14A 3ICLA 2A3JA 2VFUA 1S49A 2AX1A 1RQ0A 3KLFB 3KLVA 1TKTB 3ILJA 4C8LA 4DX5A 2PMHA 4NA3A 3U02A 1KVJA 3B6BA 3PNIA 4DQPA 4YDXA 5MAOA 5E3RA 3F73A 3PFOA 2IAJB 2DPJA 3A8EA 5A6WA 3OHBA 1H0HB 5J2MA 2PSZA 1RTJA 1IR0A 2W2OP 3CGIA 1S0MA 4I2QA 2DIUA 1N5VA 1NJWA 1DAXA 5B0CA 2NZCA 2RHQB 4QWBA 4WBFA 4C0OC 3TVZA 1S76D 2FGCA 2DNRA 2ZNYA 1R8CA 4USVA 5HBMB 4NLPA 3AB2B 4OX7A 1X4CA 1UVJA 1GTEA 3CCWA 3NCPA 2LDIA 5LT5A 3PY8A 2WZ1A 4OHWA 1EIYB 2F65A 3OR1A 3MR2A 1WTFA 2PDAA 1ZTTA 3HT0A 1HWUA 4V19X 1RT1B 1U2CA 2MJUA 5DRKA 2K7JA 4X2BA 3AJ2A 2O5DA 2ATLA 1XTZA 3OL7A 1S97A 2D3O1 4HR2A 2CIMA 5DZ7A 1VQYA 5CYJA 2QEXS 4HHJA 2KHCA 5CQGA 1GMWD 1X7VA 1RDRA 3W61A 4F26A 3HX9A 4QWCA 1EJ7L 3PYGA 4PXCA 3NBPB 2RRBA 4UOGA 2A18A 1KVKA 3MPVA 1JLFB 5D0HA 3NAHA 3OQ2A 3KLIA 2H9ZA 2QLWA 3M2RA 3W65A 3C6UB 7FDRA 3IBCB 1YJWS 1KHVA 3JTOA 2WAQD 2CG8A 4N76A 4F2RA 4ZPDA 2B3TB 1NSAA 5FD1A 2NCKL 1L3TA 4XO0A 3UI3A 2RSQA 3IP0A 3V4IB 5L8RC 3W1YC 1VBZA 5ETPA 2ROGA 4OX8A 3H98A 1RBLA 3OD2A 4WTYA 3AA9A 4Q7AA 2XMMA 1HPZA 2APOA 3B82A 1FEEA 5J1EB 4DL2A 4M5DA 3Q8SB 3ZZYA 2HKEA 4C98A 4DSKA 2E7VA 2GMHA 1WDDA 3GJRB 3MURP 3BGLA 3FEXB 1VC6A 4ZIVA 5JUMA 4LRBA
chains in the Genus database with same CATH topology
1NPKA 3EVOA 3NGTA 3Q83A 3ZTPA 3FCVA 4FKYA 1HIYA 3NGUA 1ZS6A 4F36A 1NLKL 2DY9A 5BXIA 1NDPA 3EVWA 1WKJA 4CP5A 4F4AA 2VU5A 1XQIA 3B54A 2AZ3A 3EICA 2AZ1A 4WBFA 4DI6A 1PKUA 1S59A 1EHWA 4UOGA 3Q89A 4ANDA 4ENOA 4EK2A 2DXFA 3JS9A 2DYAA 5C7PA 3BBCA 1B99A 4DZ6A 1PAEX 3EM1A 3EVMA 3PRVA 3VVUA 1WKKA 1NDKA 3ENAA 3BH7B 5CAAA 1JXVA 3L7UA 1NCLA 2CWKA 1LWXA 3PJ9A 3MPDA 2HVEA 4C6AA 4FKXA 5CABA 3FC9A 1UCNA 2DXEA 3FBEA 4W98A 3Q8VA 4DUTA 1B4SA 5IOLA 3BBFA 3ZTOA 1F6TA 1NUEA 1W7WA 4KPCA 1BHNA 3Q8YA 3WX8A 1NSKL 3DDIA 2ZUAA 4UOHA 1NDCA 3GPAA 3VVTA 4S0MA 1NHKL 3NGRA 3FBCA 4O0NA 1WKLA 3FBFA 2HVDA 2HURA 2NCKL 3EE3A 3VGVA 3ZTRA 1KDNA 2DXDA 3ELHA 1VYAA 1NSPA 3VGTA 3EMTA 3DKDA 1NSQA 2B8QA 1F3FA 3G2XA 3BH6B 3Q8UA 1NB2A 3VGUA 3B6BA 3EJMA 3GP9A 1NDLA 1MN7A 1HHQA 3NGSA 3R9LA 1LEOA 3ZTSA 1U8WA 1XIQA 3Q86A 3FKBA 4HR2A 3ETMA 1S57A 3VGSA 1BE4A 2B8PA 3ZTQA 1K44A 1BUXA 1MN9A 3FCWA 2BX6A 3BBBA 4ANEA 4ANCA 2BEFA 3FBBA 1HLWA 4UOFA 1S5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NPK A;  3EVO A;  3NGT A;  3Q83 A;  3ZTP A;  3FCV A;  4FKY A;  1HIY A;  3NGU A;  1ZS6 A;  4F36 A;  1NLK L;  2DY9 A;  5BXI A;  1NDP A;  3EVW A;  1WKJ A;  4CP5 A;  4F4A A;  2VU5 A;  1XQI A;  3B54 A;  2AZ3 A;  3EIC A;  2AZ1 A;  4WBF A;  4DI6 A;  1PKU A;  1S59 A;  1EHW A;  4UOG A;  3Q89 A;  4AND A;  4ENO A;  4EK2 A;  2DXF A;  3JS9 A;  2DYA A;  5C7P A;  3BBC A;  1B99 A;  4DZ6 A;  1PAE X;  3EM1 A;  3EVM A;  3PRV A;  3VVU A;  1WKK A;  1NDK A;  3ENA A;  3BH7 B;  5CAA A;  1JXV A;  3L7U A;  1NCL A;  2CWK A;  1LWX A;  3PJ9 A;  3MPD A;  2HVE A;  4C6A A;  4FKX A;  5CAB A;  3FC9 A;  1UCN A;  2DXE A;  3FBE A;  4W98 A;  3Q8V A;  4DUT A;  1B4S A;  5IOL A;  3BBF A;  3ZTO A;  1F6T A;  1NUE A;  1W7W A;  4KPC A;  1BHN A;  3Q8Y A;  3WX8 A;  1NSK L;  3DDI A;  2ZUA A;  4UOH A;  1NDC A;  3GPA A;  3VVT A;  4S0M A;  1NHK L;  3NGR A;  3FBC A;  4O0N A;  1WKL A;  3FBF A;  2HVD A;  2HUR A;  2NCK L;  3EE3 A;  3VGV A;  3ZTR A;  1KDN A;  2DXD A;  3ELH A;  1VYA A;  1NSP A;  3VGT A;  3EMT A;  3DKD A;  1NSQ A;  2B8Q A;  1F3F A;  3G2X A;  3BH6 B;  3Q8U A;  1NB2 A;  3VGU A;  3B6B A;  3EJM A;  3GP9 A;  1NDL A;  1MN7 A;  1HHQ A;  3NGS A;  3R9L A;  1LEO A;  3ZTS A;  1U8W A;  1XIQ A;  3Q86 A;  3FKB A;  4HR2 A;  3ETM A;  1S57 A;  3VGS A;  1BE4 A;  2B8P A;  3ZTQ A;  1K44 A;  1BUX A;  1MN9 A;  3FCW A;  2BX6 A;  3BBB A;  4ANE A;  4ANC A;  2BEF A;  3FBB A;  1HLW A;  4UOF A;  1S5Z A; 
#chains in the Genus database with same CATH topology
 4RW6 B;  1S4F A;  4JI3 J;  2DH8 A;  1PSD A;  1S6O A;  3TQE A;  4IUF A;  1YJT A;  1FRJ A;  1RIS A;  2MYF A;  3TWZ A;  1CSJ A;  1W25 A;  3G4S S;  1FDB A;  4PQA A;  2E7X A;  2W4C A;  1ZZN A;  3HVR A;  4IQM A;  1YK9 A;  1Q5V A;  2FUG 9;  5EN1 A;  2DXE A;  1Y10 A;  1G1X A;  1SJ1 A;  3PAC A;  3M8Z A;  4I6A A;  3EZ5 A;  2KRB A;  2IPO B;  2BM0 A;  1VHI A;  4NMX A;  3Q8Y A;  1K1Q A;  4QYR A;  4R5P A;  2Q1L A;  4QCL A;  2VUG A;  3IC1 A;  3ELH A;  3RUB L;  4B3R J;  3FQK A;  4JB8 B;  2I8E A;  3TZX A;  2LQJ A;  2HBR B;  2IVY A;  3HP6 A;  2VZ9 A;  1UVK A;  2UV8 G;  1HAR A;  2IYG A;  4DPW A;  3Q86 A;  3OFH A;  3G9C A;  2CQG A;  3KMS A;  4CTA A;  2I9S A;  5A0Y B;  3PM9 A;  4NA2 A;  1K44 A;  1TP7 A;  2DK2 A;  1S1V B;  2QYG A;  5EX0 A;  4A47 A;  1TMM A;  3LOU A;  1S12 A;  1EKR A;  2LQ5 A;  1RAD B;  2WVF A;  3LWM A;  3ULH A;  1CS4 A;  1JJ2 R;  2FHK A;  3SSS A;  3SYZ A;  3OSP A;  3MMA B;  4JI6 J;  5KFN A;  3VAI A;  3J7Y U;  3HK2 A;  2Y0S D;  4UQT A;  2PD1 A;  3VZI A;  1EZZ B;  4NEY A;  2M4M A;  2FIU A;  5CAA A;  1VIS A;  1QE1 A;  2XTJ P;  4Q43 A;  3VAM A;  3RG6 A;  2YTC A;  5I42 B;  4NYP A;  5A2Q U;  2ABY A;  4BCA A;  1BQM B;  1VR6 A;  4ZCM A;  1VQM S;  1EET B;  3H59 A;  2MQM A;  5FDL A;  4Q8F A;  1OJ4 A;  5F3Z A;  5M2P A;  1YJR A;  5EWE A;  1G4C A;  1E6V A;  1X4E A;  3NS5 A;  2E1C A;  4J9U E;  1EKS A;  4KHM A;  1VQN S;  4PAA A;  2UUB J;  1APS A;  1C1B A;  5LOQ A;  2JVR A;  2WBR A;  1WOP A;  2GO9 A;  3GII A;  3OXG A;  2GX8 A;  3V81 A;  3S1T A;  4EBD A;  3DFE A;  4ZIW A;  4A8S A;  1FRL A;  3B78 A;  4MKY A;  2GV1 A;  1AYE A;  2Y3Y A;  4WII A;  2MQP A;  1U1K A;  1VK8 A;  1NDP A;  2H5E A;  2MQN A;  3POT A;  1J5E J;  3FRZ A;  2D1C A;  4A4J A;  4ED1 A;  1URN A;  5CYM B;  3GLJ A;  1U02 A;  4YR3 A;  2PMW A;  1VRT B;  1SPB P;  3TP2 A;  3P45 B;  1LWE B;  4DSJ A;  2ZD1 A;  1V3Z A;  4RBV A;  1LNQ A;  4KYZ A;  1FWL A;  4JI3 F;  4YN3 B;  2ZH7 A;  4KPC A;  3G8S A;  2BW7 A;  2W9C A;  4J9L A;  5D8H B;  3EXC X;  3ZZT A;  4DWI A;  1REV A;  3DNC A;  2W1B A;  5LSO A;  4PG6 A;  2MMY A;  2W9A A;  1NK6 A;  4HDH A;  3W5Z A;  2FQQ B;  4F0H A;  1T3N A;  3FNN A;  2YNF A;  1KKH A;  5F9N A;  4PQU B;  3G6Y A;  1CPZ A;  4ED0 A;  2G1D A;  2HZV A;  3BPS P;  2N3L A;  1SBR A;  4B3R F;  3JQM A;  1D8Y A;  2RVJ A;  5A6P A;  1RTI B;  2DY9 A;  5EDW A;  2ZKT A;  2J0W A;  3K5O A;  2L48 A;  5HMZ A;  2HHW A;  3CCQ S;  1QSY A;  2DXF A;  1QD1 A;  1KD1 T;  1WHX A;  3IN5 A;  2DNY A;  4OZJ A;  4RW7 A;  3OTB A;  3BEG B;  1N52 B;  2LXI A;  1L3K A;  4TN2 A;  5IWA J;  4JI6 F;  1RE1 B;  4RZR A;  1AB8 A;  3SZ2 A;  1OSC A;  5KFR A;  3D67 A;  4AT1 B;  5FJ4 A;  1U1O A;  3OVB A;  1S1W A;  4ID5 A;  4DLE A;  1R8B A;  3BYP A;  1GFW B;  4USJ C;  4ZVO B;  4CLY A;  1XEZ A;  3MM8 A;  2DHH A;  3BF4 A;  3JSY A;  2KZZ A;  4P9S A;  3V6D B;  2V4J B;  1JJ4 A;  3MPY A;  1ZTW A;  5J2N B;  2CVI A;  3LAM A;  4OZ0 A;  1DY3 A;  1N5Y B;  1SV5 B;  2MKY A;  2UUB F;  2J6U A;  3OVA A;  4DV0 J;  2DNK A;  3NS6 A;  4NML A;  2MKI A;  2POK A;  4FF2 A;  4CLP A;  1HNX J;  2FVC A;  1T3O A;  4LRA A;  5I3P A;  2UVV A;  2UXD J;  5BJR A;  1JLQ A;  2QRR A;  5JXS A;  3MOZ A;  5K8P A;  1A6L A;  2DRA A;  3K57 A;  4TU9 A;  3KJV B;  2RU9 A;  4FBU A;  1X9S A;  1XR7 A;  4WFN Q;  3RU0 A;  2VB6 A;  2JJ4 D;  1J5E F;  2ZE2 A;  1Z2L A;  4CLT A;  4J9Q A;  4UOC A;  3W60 A;  2RS2 A;  3GIL A;  4I2P A;  2P6T A;  3Q8U A;  4I64 A;  4OHX A;  2C3O A;  5G0R B;  3OUY A;  2DNH A;  1Q86 T;  3NOG A;  5KFK A;  1KLN A;  1XIQ A;  4TU7 A;  1RWX B;  4WK3 A;  5KG6 A;  1H3D A;  2HHQ A;  4RU9 A;  3GG1 A;  2Z2M A;  3LGH A;  2BJE A;  3OR2 A;  2XYG B;  3MMC A;  1IQT A;  2HG4 A;  2OFH X;  4OYP A;  1FT8 A;  1YRT A;  4RL1 A;  1K0T A;  1YBA A;  2OSQ A;  3L95 X;  3VF0 B;  1WSR A;  2UU9 J;  5EGY A;  4HYK A;  2WW8 A;  2WK4 A;  2W8L A;  3C14 A;  5LMU J;  4OJ1 A;  4O3S A;  4QR2 A;  2BZ2 A;  1S9G A;  2H3E B;  2HQF A;  5J2M B;  3TZW A;  3HVW A;  2XZW A;  3N01 A;  1P9Y A;  4K4U A;  1RTJ B;  5AXM A;  1U2R A;  4ZVP B;  3HHE A;  4I2Q B;  1QTM A;  4G6V B;  2J7K A;  3TR5 A;  3OFG A;  5KFB A;  1R8P A;  3DM2 A;  5HI7 A;  5T7L A;  2IY5 B;  1NSQ A;  5I4M A;  2HHV A;  1KWM A;  1WEX A;  5IWA F;  3ZO7 A;  1HR0 J;  1W2B R;  5KT6 A;  1U8W A;  1P1T A;  3D0I E;  3OLA A;  2Q6B A;  5AXN A;  3WQP A;  4X4S A;  3KK2 A;  5KFP A;  2LQ9 A;  1UP1 A;  3OR1 B;  1G7C B;  3UNG C;  3AFG A;  4ED7 A;  4CLZ A;  5DG8 A;  3PEJ A;  2MZ1 A;  3R2C J;  3A3O B;  1ZBT A;  1RAC B;  2NLW A;  2I38 A;  5KFE A;  2HK2 A;  1T02 A;  2IRY A;  3BR9 A;  4Q45 A;  4OHV A;  4NLD A;  4WU3 A;  2QA1 A;  4A46 A;  1F5B A;  3T1H J;  2ZH5 A;  2RRN A;  1UWA A;  3UWT A;  4DV0 F;  4ZVR B;  5SZT A;  2HRY A;  1LFW A;  1SKR A;  1IQZ A;  2N82 B;  1BMQ B;  1HNX F;  3ZNJ 1;  1IM4 A;  1DUR A;  2HQC A;  2E66 A;  2UXD F;  2ZM6 J;  4UZC A;  5A2Q Y;  4F0K A;  3KLI B;  4A8Q A;  3M2R B;  1B70 B;  1NB2 A;  3U7J A;  3EPG A;  3EJM A;  3N6M A;  5IC4 B;  2VA2 A;  3G96 A;  4F4Z A;  2MLZ A;  2CDQ A;  4PEO A;  2MKC A;  3ET6 A;  3TAP A;  1SXL A;  3K8V A;  3PIO Q;  1ULR A;  1DTT A;  4LVN P;  1S9F A;  4DFK A;  4WKY A;  1XJW B;  1ZPV A;  2VG7 A;  1HPZ B;  1RJJ A;  2RIJ A;  3N5B A;  2VOD A;  4M5D B;  2OEJ A;  1KRP A;  1WG1 A;  3H4D A;  1U6B A;  1NDK A;  2JH3 A;  2A10 A;  2HHP A;  3PW2 A;  4M5I A;  1AT1 B;  2FVS A;  2HLU A;  3W2V A;  3Q23 A;  1NUE A;  1U6Z A;  2PE8 A;  1KOH A;  1VQ8 S;  4Y2M A;  1S48 A;  2UU9 F;  4O0N A;  2IBO A;  1S6U A;  1Y3K A;  5LJ5 Y;  5LMU F;  1VBY A;  3ZZU A;  1VRQ C;  3PCO B;  2JC1 A;  4QR0 A;  3N79 A;  1Q81 T;  2Q79 A;  3J81 U;  5IZH A;  3MOJ B;  4CH1 A;  1S72 S;  2QFJ A;  3AJD A;  4DN9 A;  2FJW A;  3D5M A;  1RAO A;  4JV0 A;  3U1L A;  4ECZ A;  3UN3 A;  2G0I A;  1VRU A;  4R5P B;  2ZZT A;  3M8Q A;  2Y1I A;  3GIJ A;  1HNV A;  4JBC A;  4MIW A;  1CUL A;  5KG1 A;  3VHQ A;  3H42 A;  2R8H A;  1HR0 F;  1C4C A;  2AX0 A;  4P2F A;  4ZPV R;  2EI5 A;  1T0T V;  2ZWO A;  4NAS A;  1D3W A;  1DQ8 A;  4CTA B;  5KT5 A;  4B9T A;  3BBF A;  3OHA A;  2MLX A;  4DS4 A;  3HI9 A;  5D3G A;  1CS4 B;  3GFH A;  5BYR A;  3MUV P;  3AY0 A;  4C8K A;  2DXD A;  1QVG R;  1CJT A;  5HN0 A;  3EYZ A;  3EMT A;  1PAU B;  3DGV A;  1N36 J;  3OVS A;  4GMK A;  3TX8 A;  1I51 B;  2VKZ G;  1QE1 B;  4N77 A;  3IWX A;  3CED A;  1WC0 A;  3PV8 A;  2PA8 D;  4LIR A;  3GTY X;  1F1B B;  4DR3 J;  2M88 A;  1NJY A;  4ZN1 A;  5FDL B;  2ZM6 F;  1SC4 B;  2BAN A;  1RWP B;  1TKZ A;  2RQ4 A;  2DIS A;  2ACY A;  4L3N A;  1E6V B;  2WBM A;  3GZ7 A;  4RUC A;  1PYT A;  3EIC A;  1EHW A;  1C1B B;  2OMO A;  3LWL A;  1OWX A;  4ZPA A;  3V81 B;  5GAD I;  3H5Y A;  2RQK A;  1RUS A;  1FDD A;  3IM9 A;  1R3N A;  3HHL A;  1S77 D;  3NMR A;  2DHG A;  3DRY A;  1IVZ A;  1FO1 A;  3CJ2 A;  3POT B;  3HZE A;  1X5S A;  3L7P A;  4UY8 T;  1RAJ A;  3GR1 A;  1S99 A;  3DKD A;  2M8D B;  2OLW A;  3KUE A;  3T5K A;  1NO8 A;  2G2Y A;  2ZD1 B;  3CCZ A;  4TYB A;  1UMJ A;  1X9M A;  4Q5V A;  2QYC A;  2W9C B;  1KSP A;  2EK6 A;  2RHS B;  4AQY J;  4RNN A;  2BEF A;  1REV B;  1BGX T;  1M5P C;  2ZJQ Q;  1V5V A;  2HBQ B;  5D0R A;  5A8R A;  1U2F A;  2QX0 A;  1ZM2 A;  4CT8 A;  3VAH A;  4F4X A;  2BE7 D;  2Z0G A;  4BBY A;  1OY8 A;  3D54 A;  3A3P B;  2KTQ A;  2YNF B;  2GIF A;  4OYO A;  3Q8P B;  1JK9 B;  1WKK A;  4WXW A;  3O8W A;  4MAK A;  4MK9 A;  1GNK A;  1FKA F;  5C2G A;  2JWN A;  2KVQ E;  5ETN A;  2ZBR A;  4F4K A;  4OYI A;  4ES1 A;  3KXD A;  2CVE A;  4KH1 B;  1AZS A;  3GFX A;  1N32 J;  4HEA 9;  4JP8 A;  5THW A;  1UPM B;  5F8N A;  3HUL A;  3IXQ A;  1T9V A;  4TLR A;  2RNE A;  5CD4 H;  4RW7 B;  1EAY C;  3FRY A;  4NLG A;  3TA1 A;  4HT7 A;  1XMO J;  1OIA A;  1NBE B;  4ZIT A;  3TVY A;  4DX8 H;  3LAN A;  2W4D A;  1N36 F;  3ZZO A;  3O44 A;  2A0F B;  4QIG A;  3LAK A;  2EEY A;  2EWH A;  2V8G A;  4M63 A;  1S1W B;  4ID5 B;  4DV3 J;  1TUV A;  2LDY A;  2UUC J;  1WOO A;  2HWI A;  3T9Z A;  1T05 A;  4JI7 J;  3MM8 B;  4B3T J;  4RNH A;  1N88 A;  4DR3 F;  2FZG B;  4AYB D;  5ETS A;  4K8R A;  1RKJ A;  2C3Y A;  1DJ0 A;  2IMO A;  4N7T A;  3QT5 A;  4DF4 A;  2DGS A;  3KG0 A;  3EZO A;  4DJB A;  1C4A A;  2OPP A;  2XHC A;  3ZZR A;  2B4U A;  3K58 A;  3J7Z T;  1JLE A;  1XMB A;  3OTE A;  4IDK A;  1VYA A;  3KK3 A;  2IC3 A;  4I1T A;  4YFU A;  1JLQ B;  4JI0 J;  2K2P A;  4X4P A;  4ECR A;  5CCM A;  2BAC A;  2ZJP Q;  4AE5 A;  1VQ6 S;  4X4N A;  2HVZ A;  2ZE2 B;  4MMO A;  3MUT P;  2LCW A;  1RAF B;  5DET A;  4I0W A;  1IN0 A;  1S9E A;  3EVW A;  5L46 A;  1ZYQ A;  4E0D A;  4N47 A;  3IM8 A;  4I2P B;  1RU1 A;  1FKP A;  4TKT A;  4CQ1 A;  3OUY B;  2F9J A;  1UJ5 A;  4AQY F;  3A3N B;  4ECY A;  1VQ4 S;  3K5M A;  3NWR A;  3OR2 B;  4J91 A;  2R7V A;  2YX7 A;  3MMC B;  4TU8 A;  2HQ3 A;  1R0A A;  3R5J B;  2QO3 A;  5D0E A;  3OTO J;  9RUB A;  2HYI B;  5J2P A;  1HHS A;  5KT3 A;  3PYF A;  5DDQ C;  4MYU A;  4B08 A;  3VAL A;  4I7F A;  4CM0 A;  3MAH A;  2AJ4 A;  4FS2 A;  4LQ9 A;  2AGP A;  4KC5 A;  2CPI A;  3C14 B;  4CLF A;  1S9G B;  4NPO A;  3QAE A;  5JMN A;  4Y2I A;  4DQS A;  2IA0 A;  1VQS A;  3B4M A;  2F7V A;  3J81 Y;  1N32 F;  1JB0 C;  4ZMM A;  4MJK A;  3RRH A;  3GON A;  3FSI A;  2D3U A;  2HQD A;  4ZCL A;  3DM2 B;  2PII A;  1EB0 A;  2OPQ A;  4GO7 X;  5T7L B;  2FLP A;  2EVZ A;  2XGQ A;  3J7A N;  4NLT A;  4NXN J;  1S6Q A;  4KKO A;  2ZOM A;  4WFB Q;  1XMO F;  1YI2 S;  2OGU A;  1B64 A;  4Y2A A;  3PW7 A;  1RAB B;  1NK4 A;  3SSQ A;  3KK2 B;  2H5I B;  4DV3 F;  3LA0 A;  2BJ9 A;  2UUC F;  3C15 A;  3UPF A;  2FZC B;  4JI7 F;  2CQD A;  3N28 A;  4M5N A;  4B3T F;  2HUR A;  3R6G B;  1FNM A;  3PR4 A;  2DIV A;  4YDD B;  4X4U A;  4DZD A;  1J2V A;  4F3O A;  1T03 A;  1T9T A;  2H5J B;  4K50 A;  2XZD B;  1UZH A;  2D69 A;  2GFF A;  3H90 A;  2CJ9 A;  3I5C A;  3MMJ A;  4RX6 A;  1UFL A;  2OKQ A;  3C46 A;  2KN4 A;  4OIX A;  2AIR B;  3W9H A;  5GAD U;  2MST A;  4K4Y A;  4ZOS A;  3TYT A;  1QUV A;  4DL6 A;  1S1U A;  2CZ9 A;  3E2E A;  4HH1 A;  3W8P A;  3GU0 A;  4JI0 F;  2DRD A;  2GVD A;  4NCA A;  4RNM A;  3RJM B;  4CYU A;  4NLU A;  3QMQ A;  1RGV A;  1LXN A;  3MWB A;  1MWQ A;  4IQX A;  2R7R A;  1S6P A;  3KHH A;  2FHJ D;  2PC6 A;  1VQO S;  1HNI A;  2COL A;  3ET6 B;  3CCJ S;  2JL9 A;  4HH0 A;  2GHP A;  1Q53 A;  4AL5 A;  5AT1 B;  1DTT B;  1S79 A;  3VVT A;  4ELT A;  3GWC A;  2RAQ A;  5LMN J;  5LSL A;  4U9R A;  2VH7 A;  2VG7 B;  3ZNU A;  2AD9 A;  2MKJ A;  1YX2 A;  5K8M A;  1U7L A;  1TUW A;  3UD5 A;  1F3F A;  5KFO A;  5HP1 A;  1FRH A;  2ADB A;  2ALY B;  2QL7 B;  2MLY A;  2P6S A;  1WOR A;  3K2Y A;  1Q7Y T;  2V50 A;  3OTO F;  3W2V B;  3ZC4 A;  2V67 A;  3ILI A;  2AYE A;  3DLJ A;  3BBB A;  1FRK A;  3RR7 A;  4DPT A;  2OD4 A;  2F8M A;  2HSE B;  4KPY A;  3CPW R;  1JX4 A;  1H2U X;  4DXL A;  1S7I A;  4YR2 A;  3NOC A;  2IIH A;  1A7G E;  1VQ9 S;  4HTJ A;  3D7S B;  5HVF A;  1I3O B;  2DIT A;  2EW9 A;  3L7U A;  1UVN A;  2BRK A;  1U1R A;  2XMA A;  4OLO A;  4CCH A;  3TZZ A;  2M7S A;  1VRU B;  3PX6 A;  4WFA Q;  3M8Q B;  4OI0 A;  1WEZ A;  2MGZ A;  3ILO A;  4X4O A;  1T9Y A;  1RHU B;  1HNV B;  4DCJ B;  1CUL B;  4FYY B;  3THV A;  4NXN F;  3PXG a;  2AYB A;  2CRL A;  3AQO A;  3PDN A;  2HFS A;  4B9L A;  1HBM A;  1Y0H A;  2O01 C;  2KH9 A;  1LOU A;  3ISN C;  3HSD A;  3R6L B;  3Q8R B;  1N54 B;  5DQI A;  2DJW A;  3TVK A;  4JI1 J;  4CDI A;  4HAC A;  4PAB A;  2R7X A;  1WHV A;  4J90 A;  4DR4 J;  2KI2 A;  5KFZ A;  5B0F A;  5D3G B;  1F0X A;  3CE8 A;  2AGQ A;  2M70 A;  2W9B A;  4L3K A;  2CQ1 A;  1CJT B;  2AJF E;  4F0M A;  2LA6 A;  2V9W A;  5A76 A;  4OYM A;  2BXJ A;  2NYI A;  4J9V A;  3G6E S;  4A8F A;  4B3O A;  4K4Z A;  1SL2 A;  1VI7 A;  2UVR A;  2HS0 A;  1UVL A;  2EFP A;  5DQH A;  5KFL A;  4I69 A;  4ICL A;  1BC6 A;  1WEL A;  3PEH A;  3W5X A;  2N4C A;  4CH7 A;  3VR1 A;  3KHG A;  5EHH A;  1RAA B;  3QIP A;  2BAN B;  3HFK A;  1TKZ B;  3EGV A;  1FFS B;  4JI4 J;  1I6J A;  2DNM A;  1LW2 A;  1UPP A;  2HIQ A;  3I5B A;  2VJV A;  4LSZ B;  3C8Y A;  1N5T A;  3M6X A;  1WG5 A;  1QSL A;  1KR4 A;  4QWE A;  2P9G A;  3JYT A;  2G13 A;  3RRG A;  1YG0 A;  1F9H A;  2FVR A;  3W8G A;  3BGR A;  1LQ9 A;  3I9V 9;  3OT9 A;  4CLL A;  1TEL A;  3H25 A;  2QG9 B;  1TL4 A;  4KH0 B;  4X84 A;  3K59 A;  3HHL B;  2NSB A;  5LMN F;  2MHN A;  4BS2 A;  4DU7 A;  2R7S A;  2V9K A;  4C3K A;  4LFA J;  4EYH B;  3MTJ A;  1M5V C;  3EVO A;  3MCS A;  1UKU A;  3NCR A;  4QW8 A;  2RD5 C;  4OV6 A;  1X4F A;  3FK4 A;  1PGZ A;  3MD3 A;  4QOT A;  2JLG A;  1RB0 A;  2GQC A;  1G6B A;  1RLD A;  4NXM J;  4MIB A;  2A2C A;  4NLO A;  4DUT A;  4F04 B;  5H9F K;  5GAE U;  5K8O A;  5A8R B;  2IDE A;  2XMK A;  1FWP A;  1HKA A;  1GMW A;  2CPJ A;  1NKB A;  2HHT A;  2XI2 A;  4RR5 A;  1XMQ F;  3TX0 A;  2BE9 B;  2KFY A;  1DRZ A;  2I0X A;  3EX7 B;  1V5I B;  5EWF A;  2LP4 A;  3W9I A;  2XEX A;  4DR1 J;  1NKE A;  4F7V A;  4EUV A;  2LU1 A;  2FVP A;  4DPX A;  2AV5 A;  3FFI A;  2D3O R;  4F50 A;  1AZS B;  4DF8 A;  3KWM A;  4OZ5 A;  2N4D A;  4KY3 A;  4CT9 A;  3I9Z A;  1FVS A;  2H54 B;  4JI1 F;  1S59 A;  2VAS A;  2V34 A;  3PO5 A;  4HI2 A;  3U1M A;  3RBX A;  4DR4 F;  2CAJ A;  1LFP A;  3CDW A;  4QWD A;  2L9W A;  4NCG A;  5DG7 A;  2V4Q A;  3D4J A;  3T3F A;  1MRO A;  5DS7 A;  4EO6 A;  2OML A;  2XWX A;  4DL0 C;  3CCR S;  2M2B A;  3NNH A;  4D3G A;  4KGM A;  1X4A A;  3MAQ A;  2LEC A;  3LO3 A;  2P5V A;  3TQ1 A;  1T05 B;  2JEJ A;  2KT5 A;  5K9F A;  3BSC A;  1WHY A;  3M4X A;  2DR6 A;  4EBC A;  3H8Y A;  3QWP A;  3CD6 S;  4F2S A;  4IRD A;  1RTZ A;  1QVF R;  4JI4 F;  4ATN A;  3PW0 A;  5DLF A;  2MXY A;  1YJV A;  3ISN D;  3OXF A;  2OPP B;  2WTF A;  3DLG A;  1JLE B;  2HGM A;  2J9D E;  2ZJR Q;  3ZTP A;  4FYV B;  4IDK B;  3KK3 B;  2IC3 B;  4NYZ A;  1RZM A;  1SC1 B;  4K5S A;  2EBE A;  2RDJ A;  1GMV A;  4IYQ A;  2PN6 A;  2NXC A;  2HZA A;  4RW8 A;  1UEK A;  3NL0 A;  2VBW A;  3WZ0 A;  4MKA A;  4PWD A;  2AW0 A;  2OHD A;  3FUY A;  4WFZ A;  4KV8 A;  3NEK A;  1X4D A;  1HMV A;  1ZPW X;  5KT4 A;  1S9E B;  1KQK A;  1A0O B;  1FKP B;  2DGW A;  1PG5 B;  4NXM F;  2J6S A;  4HHU A;  3QT6 A;  3WC0 A;  1T11 A;  3NRB A;  2UUT A;  3D3B J;  1FXL A;  4QU6 A;  4XIU A;  4J7C A;  1R0A B;  5DQG A;  2DNN A;  5E41 A;  4OFZ A;  3BR8 A;  3GV7 B;  5LL6 d;  5J2P B;  3KUG A;  1NJX A;  2H4W B;  2DGX A;  2KJW A;  5KG5 A;  2B4V A;  1S7H A;  4I7F B;  1TL3 A;  3CMA S;  1N0U A;  4R25 A;  4PG4 A;  2E1A A;  4KIA A;  2AEF A;  4MK8 A;  4DR1 F;  1ICE B;  1JLB A;  3KYL A;  1U1P A;  5LXY A;  4J9N A;  1D9D A;  4ERD A;  4J9P A;  1DLO A;  3IGV A;  2H65 B;  4F02 A;  4QPT A;  1N56 A;  4B02 A;  2ASJ A;  3OTC A;  3CDE A;  4ED5 A;  3S01 A;  4ZS6 A;  1K8A T;  2QSW A;  2OPQ B;  3GPA A;  1TTH B;  1UVM A;  3M8W A;  2CPF A;  4CNZ A;  2MZT A;  1S6Q B;  1S1X A;  3GMG A;  3UDC A;  4ETZ A;  4KKO B;  3NP5 A;  4QU7 A;  4FF3 A;  2L41 A;  3M30 A;  2FY1 A;  3CJK A;  1XBW A;  2AGO A;  2VC0 A;  3DDN A;  4AUK A;  3C15 B;  3H5S A;  3IR5 B;  3TEH B;  2B9Y A;  3CC4 S;  4DL5 A;  4N56 A;  4YQW A;  3Q83 A;  2RRA A;  4JV2 A;  1F5A A;  3M32 A;  3BM7 A;  3CJQ A;  3M8Y A;  2J8A A;  1X5T A;  1T03 B;  4O23 A;  2DR7 A;  2V2V A;  1JMT A;  1FD8 A;  3BSO A;  3DXS X;  4F3Q A;  2HPU A;  4CNY A;  3AAW B;  3QT8 A;  3RGI A;  1FCA A;  1Z4U A;  1S1U B;  1RYS A;  2O66 A;  1F9E B;  2GVD B;  4IRC A;  1IR1 A;  3E3X A;  3GSD A;  4C8M A;  3R7N B;  1FX2 A;  2NSC A;  3W5Y A;  4LFB J;  4CYU B;  2BYC A;  5ETR A;  1XR6 A;  4GVL A;  3I56 S;  3CT9 A;  4MIA A;  1S6P B;  1Q7L B;  1F9F A;  5B0B A;  2VQF J;  2DHS A;  2K3K A;  1HNI B;  3TEG A;  2MZS A;  2DNO A;  4GC7 A;  1WF2 A;  3RZA A;  3MHY A;  2FTR A;  1HHT P;  3IR6 B;  1FHT A;  2BJ1 A;  2R9L A;  2XLK A;  4B9M A;  1X4G A;  3NGD A;  4L75 A;  3OXL A;  1MWZ A;  4DL3 A;  5EWG A;  3SI8 A;  1RAE B;  5DDO C;  3LGM A;  1TUG B;  2XY5 A;  5HP1 B;  3BKT A;  4J9S A;  4AFF A;  3UR0 A;  2XQC A;  2SXL A;  1X5O A;  3IWL A;  3C16 A;  2CJY B;  4G65 A;  2AT1 B;  2WVB A;  2PO4 A;  4E98 A;  3KK1 A;  2XSF A;  3UCG A;  1YTY A;  1CQN A;  3DRS A;  3PX4 A;  3AD8 C;  5KFU A;  2ZNZ A;  4QWA A;  1SL1 A;  2C3U A;  3W3S A;  5IT4 A;  2MDA A;  2CPE A;  2LEP A;  4WYW A;  3BQ1 A;  1M1K T;  4QIE A;  3QRP A;  2VG5 A;  2MGZ B;  4RO0 A;  3QSY B;  2BJ7 A;  4C2M A;  4NRT A;  2YKP A;  1O6X A;  2Y1J A;  4DV1 J;  2X1B A;  1HYS A;  3R7B B;  1U45 A;  1TV6 A;  4OYX A;  4KGV B;  5F41 A;  1CJV A;  1RWW B;  2JFD A;  2X7I A;  1QLN A;  2HGL A;  2LEB A;  4OZL A;  1L3V A;  3PFE A;  5AE2 A;  1HBM B;  2FLN A;  1LK7 A;  2WB4 A;  4LSL A;  2E1M C;  1MSW D;  1HWJ A;  4B17 A;  3HMJ G;  1LV5 A;  4M95 A;  1FA0 A;  4B9U A;  4HAC B;  1RXO B;  2C2D A;  3VVU A;  3JQJ A;  1TKD A;  1JNZ B;  5DJB A;  3T1A A;  1HBU A;  4AXJ A;  1M90 T;  3R5A A;  4W98 A;  1KTQ A;  3UN5 A;  2K8G A;  2KM8 B;  2D7S A;  2QIF A;  2W9B B;  3VAK A;  4I6W A;  1TK0 A;  2GAG C;  2V0N A;  2LLZ A;  2HFV A;  3H2V E;  3PRB A;  4B3O B;  2XWY A;  1I1G A;  2GIQ A;  2ZH8 A;  2B56 A;  3W63 A;  1C0T A;  1YWX A;  3X3U A;  4ICL B;  4C7Q A;  3SBM A;  1FRI A;  3T6J A;  3R9L A;  1RT4 A;  4BC7 A;  4J9M A;  1RT5 A;  3QIP B;  5BR8 J;  3RAM A;  2R3V A;  4LFB F;  1LW2 B;  1RK8 A;  2DGQ A;  4O4R A;  3E51 A;  2XO6 A;  3JYT B;  4RW4 A;  3BQ0 A;  2VQF F;  3BGR B;  3MFH A;  1IJF B;  4Q2L A;  4K2X A;  2E29 A;  1WC5 A;  3BV8 A;  3OV7 A;  4NCB A;  4HL9 A;  2BV3 A;  4PR6 A;  2C2M B;  4USI A;  4U7C A;  2VDH A;  2XMW A;  5C24 A;  2KYZ A;  5KG0 A;  4O3Q A;  2CPX A;  3QGG A;  4O44 A;  1TVR A;  3QLH A;  4BWM A;  2XY7 A;  1L5U A;  2I5J A;  4RW9 A;  4EZ9 A;  3K0J A;  2DHX A;  3FBC A;  3DU6 A;  3W9J A;  3AOA A;  3U1N A;  5CA5 A;  3KTQ A;  2KT2 A;  4ECX A;  4J5O A;  3TNV A;  1QDU B;  2YQ3 A;  4PUO A;  3G87 A;  5IS2 A;  3RB6 A;  3NGS A;  1NPR A;  2E9R X;  3QSI A;  2X3D A;  3QAU A;  1MU2 A;  5D4N A;  1RHK B;  2U1A A;  4P7T A;  4ANE A;  2GZO A;  5E3P A;  1FES A;  3D6F B;  1B7F A;  1UFW A;  3UD3 P;  3BO3 A;  4F36 A;  3Q24 A;  1JXL A;  2C1E B;  1UWB A;  4NLV A;  2RQC A;  2QN6 B;  1GK8 A;  2J8S A;  3M1V A;  3EM1 A;  4EZ6 A;  5L1I A;  5CD4 A;  4DV1 F;  3ZZP A;  1FJG J;  3FSY A;  1LK5 A;  1DHM A;  3FFI B;  1F6T A;  1R43 A;  2YX1 A;  4DR6 J;  3MI7 X;  1DBD A;  1U0H A;  3M8S A;  1SJ3 P;  3DLE A;  3FZ2 A;  2DGO A;  2DHA A;  2MQQ A;  1YRX A;  1YBU A;  4V19 J;  3KJN B;  5IQQ A;  3NCQ A;  3R5D A;  3WHI A;  5K20 B;  3EDQ B;  3KLE A;  3RW6 A;  1OQ3 A;  4PWW A;  1SH3 A;  4NZ0 A;  2QMU B;  4NCG B;  4PXE A;  3F44 A;  1M5O C;  3DLL Q;  4XK8 C;  3QGH A;  1LEO A;  1FER A;  1MRO B;  4FF4 A;  2XLJ A;  5H9F J;  3N0V A;  4QYZ J;  2JLE A;  3VV2 B;  2P2C B;  4R0J A;  4DV6 J;  2JRS A;  1K9M T;  4OYZ A;  1R8H A;  1K1S A;  1OSD A;  1Y7P A;  3Q8Q B;  4ECU A;  7FD1 A;  4WE1 A;  3KG1 A;  2F4F A;  3NXZ A;  1RLC L;  2B7B B;  2DYA A;  3FEZ A;  1NB7 A;  2EFO A;  2KDO A;  1UEV A;  1YRU A;  4ZLP A;  4RKU C;  3RTV A;  4KTQ A;  4UT4 A;  5BR8 F;  1S1T A;  3GCW P;  2XUL A;  4U8Y A;  5KOW A;  2G1H A;  4OYW A;  2FYX A;  5E3C A;  4UST A;  4F25 A;  3MR7 A;  2O3D A;  4DOZ A;  3DLG B;  2QL5 B;  3GYG A;  2IJF A;  2XBP A;  4J9K A;  3L7O A;  1Q79 A;  3H20 A;  1RT2 A;  3FBF A;  3K17 A;  2FLL A;  3BRE A;  3QFW A;  5IT0 A;  2Z4P A;  3W66 A;  4IO1 A;  2Y1L B;  3CCS S;  1RBA A;  2D41 A;  1FNX H;  5HRO A;  5KFH A;  3OBI A;  4DMZ A;  2ZHA A;  1BD6 A;  4RW8 B;  2UVU A;  4PWD B;  2DR9 A;  3HD1 A;  3O1L A;  3VZH A;  2BBE A;  4KV8 B;  3ETM A;  1TFW A;  1HMV B;  1OO0 B;  3IAM 9;  4Z37 A;  2DVI A;  5IC6 B;  2C2R A;  2CJB A;  5HK4 A;  1VQK S;  1D9A A;  5HMX A;  1ZS6 A;  2HWH A;  2FJD B;  5HJX A;  2OP5 A;  4OI4 A;  4M5J A;  1OYE A;  4NE9 C;  3PIP Q;  4DS5 A;  1NK5 A;  3LW5 C;  3IRW P;  1XWL A;  2G0C A;  2DT9 A;  5AE3 A;  1FEH A;  1R6Y A;  1MMD A;  4FKX A;  5F0U A;  4OI2 A;  2DNQ A;  2QMW A;  1HA1 A;  1RHJ B;  4LRF A;  3IBW A;  1TL3 B;  2IM2 A;  3GCX P;  2M52 A;  2D74 B;  1Y5L B;  5E33 A;  4ER8 A;  2GHV C;  1JLB B;  1RTD A;  2IVM A;  4Y65 A;  1FJG F;  2FHO B;  2AU0 A;  1ZM4 A;  3L3C A;  1DLO B;  2JSX A;  2PI5 A;  1NHU A;  3PG9 A;  4DR6 F;  4M5K A;  4I6Y A;  1AW0 A;  2J9E A;  4DX7 A;  3T5J A;  2FJE B;  2WVE A;  2XI3 A;  2B0G A;  2ILY A;  3MM6 A;  3M6V A;  4RPF A;  1Q8B A;  3CUN A;  2HWT A;  5DZ6 A;  4UOF A;  2A6O A;  3V2U C;  3GQC A;  4C8Z A;  4DX6 A;  4I67 A;  1EP4 A;  1YJU A;  1CVJ A;  1S1X B;  1RT3 A;  1KEK A;  1N5S A;  4WXO A;  4YOE A;  4GKK J;  4LVO P;  2CPY A;  1UZD A;  3I96 A;  3M30 B;  2VFR A;  2KYX A;  4BWJ A;  2D3Z A;  1EQM A;  4EK2 A;  3BBC A;  2MTL A;  3BSA A;  5KFV A;  3CJK B;  2P9E A;  5HJY A;  2VBY A;  2XHW A;  4C48 A;  4DV6 F;  1ZM3 A;  4KSE B;  2VA3 A;  1X31 C;  2L3M A;  3I0R A;  2HBZ B;  1OQ6 A;  4MFB A;  2YKO A;  2IFX A;  3A8K A;  3MEK A;  2AJ1 A;  5E7O B;  1U25 A;  2IM3 A;  3M32 B;  2NS1 B;  3RB0 A;  2R2T A;  5HQM A;  5LM7 E;  1NK8 A;  2R8K A;  3R5G A;  1FVQ A;  3QZ7 A;  1Q8I A;  1FJE B;  4UZB A;  2KFZ A;  2V2Z A;  2V8H A;  3NS7 B;  5HL7 Q;  2UV8 A;  5F8J A;  3G2X A;  1OY9 A;  1M1H A;  2B7C B;  1XNQ J;  4M5L A;  2DEJ A;  2DR8 A;  4UF4 A;  1MN9 A;  2WSC C;  4QR1 A;  2JEI A;  2OEK A;  3R3T A;  2ASD A;  3CJ3 A;  3RBD A;  4WWS A;  3M8P A;  5BXI A;  2OIH A;  3G8Q A;  3LP0 A;  2FGO A;  3N6N A;  3LP1 A;  1VDH A;  5I3U A;  1NH8 A;  4EFA C;  4DQR A;  3W2W A;  3JXO A;  1VJQ A;  5D6G A;  2ZFH A;  2VL1 A;  3RYL A;  3P96 A;  1U1M A;  3CD0 A;  3AA8 A;  1F3V A;  1QM9 A;  1SC6 A;  3OL8 A;  1WTB A;  1FF2 A;  1IM6 A;  3FBE A;  4B9N A;  3UR3 C;  5HVH A;  1X4B A;  4HHH A;  3HJF A;  1R31 A;  2IBK A;  3QNW B;  3JTP A;  3UFC X;  3DRR A;  4GRS A;  2QT7 A;  1Q8K A;  4P52 A;  2OAU A;  1PC5 A;  3CC2 S;  1ZAW A;  2GJI A;  2HHS A;  3C16 B;  4LF4 J;  2EC2 A;  1HBN A;  2F1F A;  1GX5 A;  1CG2 A;  2BOA A;  4B9S A;  4I68 A;  3GSI A;  2P9C A;  4ZVE A;  3KK1 B;  4G3I A;  1CLF A;  3DRS B;  3FBB A;  2OPS A;  2QE5 A;  3AH6 A;  2DKO B;  2W4P A;  4P10 A;  4M94 A;  1HQ2 A;  3B54 A;  1VQL S;  3FMB A;  1S0O A;  4TNO A;  5E2Q A;  3VCD A;  4CZC A;  1SKW A;  4MYT A;  2KT3 A;  1RCO B;  3CF5 Q;  2VG5 B;  5IM0 A;  1JXV A;  3BDE A;  4C8N A;  2XO7 A;  3I87 A;  3QJJ A;  3P3D A;  2L08 A;  4FXD A;  2FZK B;  4Z2X A;  3ENV A;  1HYS B;  4HDG A;  4TLQ A;  1TV6 B;  2QC3 A;  1CJV B;  1FI4 A;  2C2N A;  4GKK F;  1VMB A;  4PZV A;  5D77 A;  3D9B A;  1KON A;  2ZC4 A;  4LSL B;  5IV3 A;  1S4E A;  5JVH Q;  1KS2 A;  3GFZ A;  1VLO A;  2XSJ A;  4KR0 B;  2E44 A;  2GW8 A;  4XAK A;  3K5L A;  2Z8Q A;  2NUU G;  5KFY A;  1RHM B;  2YPY A;  4L76 A;  4JI2 J;  1HBU B;  1JLC A;  5KFM A;  1UVI A;  3L9Z A;  3TAR A;  3RB4 A;  3S7R A;  5H9E J;  2MSS A;  2KXN B;  2B6A A;  2CQI A;  4LT6 A;  4ZK7 M;  3AOB A;  2IJN A;  3UDV A;  1MML A;  4A48 A;  2ZKU A;  3BKU A;  3ONQ A;  2QJ3 A;  4N41 A;  2ZZN A;  3ITH A;  3UDE A;  4C3M A;  1Q0N A;  4O3R A;  4UW2 A;  2B5J A;  2AZ1 A;  1XNQ F;  1C0T B;  2LXU A;  4ENO A;  1RT4 B;  2RU3 A;  1RT5 B;  3V6K A;  2MPU A;  3R5C A;  4RUB A;  2CJX B;  1BWE A;  1XR5 A;  1B4S A;  3Q2S C;  2NPF A;  2JZ5 A;  2FJV A;  2A2D A;  3H0P A;  4DV7 J;  4RW4 B;  2K06 A;  4DSI A;  1FFW B;  4NI2 A;  2ZBP A;  3JSR A;  1UA0 A;  1IBL J;  2C2K B;  2N3O A;  4Q44 A;  2AYM A;  6AT1 B;  4LF5 J;  5C24 B;  2H51 B;  4DCP B;  1FDN A;  4FNH A;  2UP1 A;  1C1C A;  4O44 B;  1TVR B;  3QLH B;  5DM6 Q;  1ZH5 A;  5D0G A;  3M2V A;  2I5J B;  4RW9 B;  2CPZ A;  2KRR A;  3UQS A;  1QY7 A;  1GTH A;  3OFE A;  1NLK L;  3BO2 A;  5JJB A;  4PUO B;  2JC0 A;  2B4P A;  3DMJ A;  3R8Y A;  1R27 B;  1Y00 A;  4LF4 F;  2DTJ A;  2G9O A;  2E9T A;  5IV4 A;  3ILL A;  1QAI A;  2V6A A;  2PFF B;  2HMI A;  2EC0 A;  3N5F A;  1MU2 B;  4X4R A;  4Y34 A;  2IM0 A;  1R6V A;  2JDJ A;  2UXB J;  3CCL S;  5HAN A;  5J1N A;  1M0S A;  4LSN A;  3QJL A;  3T5L A;  3DGP A;  4ZVF A;  5F8L A;  5C2C A;  4X4T A;  4NL5 A;  2ILZ A;  1IWA A;  1UWB B;  3SV4 A;  2CQC A;  4IKA A;  2E5G A;  5I3Q A;  1Q5Y A;  3M1V B;  4WK1 A;  3V6J A;  4L72 B;  3OJU A;  1YVF A;  3M2U A;  4PXD A;  2FHJ A;  2CJK A;  1FRX A;  3GIR A;  3KMQ A;  2YKN A;  1X0F A;  4F8R A;  4Y3C A;  1U0H B;  2MKS A;  5D15 A;  3DLE B;  3MCN A;  2XGP A;  3TAQ A;  1HIY A;  1ZOT A;  4TYA A;  4JI2 F;  1WKJ A;  3CD5 A;  2RB7 A;  2FJB B;  3KLE B;  1H73 A;  4F4Y A;  2Q43 A;  3IGN A;  1IKW A;  1RWK B;  3EVM A;  1NME B;  1X60 A;  3I0S A;  1PO6 A;  4KGK A;  5IQ6 A;  3HT3 A;  3QPI A;  3SCJ E;  2VDI A;  3F41 A;  2ZDO A;  4HLB A;  4X64 J;  3AT1 B;  5K5M A;  4ZPB A;  2IDL A;  4FPI A;  5KFT A;  2VFV A;  4EGL A;  4WE1 B;  2HRT A;  1PC4 A;  4ZN3 A;  1O8B A;  2ZVI A;  2XMT A;  3D68 A;  2Y8W A;  4DR7 J;  3QYY A;  1S1T B;  3K8W A;  3GFY A;  2JX2 A;  3MAA A;  5IFM A;  2EXU A;  1MMN A;  1B0V A;  3F56 A;  4A8Y A;  2NUH A;  4PG5 A;  4ZP9 A;  4DV7 F;  2GMJ A;  3GV5 B;  2GA7 A;  1HD0 A;  1KVI A;  3KFW X;  3HSG A;  3MGJ A;  2ZOF A;  5KFW A;  2R42 A;  3H2U B;  4IG3 A;  2MHE A;  4P6Q A;  1RT2 B;  1RWO B;  4YB1 P;  4GC6 A;  2CA9 A;  2G0J A;  1WAC A;  4CO3 A;  1IBL F;  4E2F B;  3AHP A;  5HRO B;  4LF5 F;  1JKH A;  3CXC R;  1E6Y A;  2V2K A;  3OPK A;  5E5N A;  4OJH A;  2CJQ A;  2BJD A;  4WU2 A;  4ILR A;  3CB4 A;  3PRV A;  4KQZ A;  5KFA A;  2BQR A;  2C2E A;  4LRC A;  1Z1Z A;  5M2U A;  4USH A;  1V3R A;  4X4Q A;  3Q8V A;  2HRU A;  4AD6 A;  2ZH6 A;  1ROF A;  4FN5 A;  4IFV A;  4O0I A;  4YP3 A;  1AXQ A;  2DH7 A;  4CM2 A;  1FXR A;  2QTW A;  2EFN A;  2NQP A;  1SVD A;  2NXU A;  1NXI A;  3PRD A;  2CUY A;  1HNW J;  1JQG A;  2WW4 A;  2AHO B;  2WOM A;  3TOQ A;  3VQS A;  1VIX A;  2UXB F;  2CG4 A;  1SUQ A;  4IH6 A;  3HM9 A;  4N8O A;  4YHH J;  3MCO A;  2H1Y A;  3D2W A;  3D28 A;  2AJ0 A;  3LP2 A;  4OV1 A;  2IMW P;  3N9U C;  4ED2 A;  3OW2 R;  3NGU A;  4CIO A;  3RBE A;  1QSS A;  2KHD A;  1RTD B;  2I1R A;  3EPI A;  4WP8 A;  3NGK A;  4JV1 A;  4OLP A;  1U4B A;  3VAF A;  2HNZ A;  2ZBC A;  1FTC A;  4EYI B;  1RT7 A;  3UE2 A;  4FXV A;  1SH2 A;  5C25 A;  4IG0 A;  3MM6 B;  2QLF B;  2R8G A;  2ZZM A;  2OPR A;  1EP4 B;  1RT3 B;  1HQU A;  2J9D A;  1R8A A;  4GO5 X;  3CCM S;  1DAR A;  1P1L A;  1VHF A;  3QZ8 A;  1WNE A;  2OH2 A;  3MD1 A;  4C0H A;  2YX4 A;  1OS5 A;  1A9N B;  2DGV A;  4X64 F;  1YDL A;  2WVD A;  4K7Q A;  2UXC J;  3I0R B;  3CJ4 A;  4ILM A;  4MFB B;  3DRP A;  2QFI A;  2ZHO A;  3MM5 A;  3BPD A;  2VFS A;  2XZT B;  3HJV A;  4DR7 F;  3PO4 A;  4Y6I A;  4OYB A;  2GJF A;  8ATC B;  1R7I A;  3FCV A;  4BC9 A;  3CIM A;  4LF1 A;  3GYX B;  3I55 S;  1YGY A;  5HQL A;  4X4V A;  4WP9 A;  3PVX A;  4TQS A;  3HHN B;  4URQ U;  2EK1 A;  2Z2Y B;  1HBO A;  1YQH A;  4E8U A;  1GXT A;  4BLG A;  2XG8 A;  3K89 A;  3IG1 A;  2B9E A;  2CDR B;  4XDD A;  3SFG A;  2W2P P;  2RF2 A;  4O4G A;  1FKO A;  2J0Q D;  3P4U B;  3M8P B;  2PI4 A;  1NK9 A;  4ZLN A;  2YH0 A;  2HEK A;  4UOH A;  3BSN A;  3LP0 B;  1HNZ J;  5AXK A;  4LF2 A;  3LP1 B;  5I3U B;  1FXD A;  3W2W B;  4QBU A;  5HO4 A;  4V1A k;  1RU2 A;  2E1P A;  2GO8 A;  4OJG A;  1JJC B;  3ZZZ A;  2UVW A;  1KBR A;  1R89 A;  2HS3 A;  2ZH9 A;  4PKD B;  2KB2 A;  3IRX A;  3SMZ A;  2BQ3 A;  1LW0 A;  2NRE A;  4LRD A;  2R2R A;  5KFG A;  3ZTQ A;  2E5H A;  5DG9 A;  1NU4 A;  2R7Q A;  2BJ8 A;  5E3A A;  1TFY A;  1YZ6 A;  4AL7 A;  1HNW F;  2VBZ A;  4C0B A;  1YHQ S;  2R2S A;  1S5Z A;  1NJI T;  2F9D A;  5J2Q A;  2VV5 A;  1G2E A;  4URG A;  3HSJ A;  4YB7 A;  3CME S;  2KZM A;  1WC4 A;  3DRR B;  1N8R T;  1NKC A;  2YWK A;  2CQ0 A;  4YHH F;  2VQE J;  4CO0 A;  1B0P A;  1FD2 A;  4H54 A;  2ZOG A;  1ITP A;  1NCL A;  3I4P A;  4DV5 J;  4PPZ A;  1HBN B;  3FC9 A;  3M7V A;  4WZM A;  2HNY A;  1ZA2 B;  2XS7 A;  2ASY A;  1JLA A;  1W26 A;  2OPS B;  3IWN C;  1WHW A;  5KFQ A;  3DDI A;  3ENW A;  4RUH A;  1H7X A;  4H4K A;  2W7P A;  1Q16 B;  4CI0 B;  5GMK a;  2B4O A;  1IWG A;  4GVB A;  1H74 A;  2V8P A;  3MFI A;  4KHR A;  4FVC A;  2V94 A;  5KFX A;  2W7A A;  1L3S A;  1VBK A;  2DPI A;  3ETO A;  2VD3 A;  5IM0 B;  4O3N A;  3I6P A;  1OY6 A;  4ED6 A;  3K5P A;  5KFI A;  2BKN A;  2VG6 A;  3ZZ0 A;  4LFC J;  2NXN A;  2GQQ A;  1SQE A;  3UN2 A;  1H38 A;  3MPU B;  1U49 A;  2FPH X;  1HWI A;  2RE1 A;  3N6L A;  2XSJ B;  1GQE A;  3RW7 A;  5L38 A;  3V4M A;  2FY8 A;  4DHV A;  2UXC F;  1WF1 A;  4UQG A;  1KN6 A;  2F3J A;  5E0O A;  4FYX B;  4I4B A;  2F8H A;  3THP A;  2VPX B;  3W64 A;  1JLC B;  1RWM B;  2XC9 A;  4DR2 J;  1V3S A;  2HZC A;  4U8V A;  2BA9 A;  2HW3 A;  3C3L A;  2B6A B;  4USW A;  1PIL A;  4WP3 A;  3RBZ A;  1RT6 A;  1YKW A;  1SC3 B;  3UNY A;  4NYO A;  3HXM A;  2GIR A;  3ITH B;  3SEO A;  1ZAV A;  1IBC B;  2B5J B;  4FBT A;  4DBQ A;  4U95 A;  2BAB A;  1EX8 A;  3VGT A;  3FEY B;  1EAR A;  1FDA A;  4K4S A;  8AT1 B;  4PXB A;  1UL3 A;  2YQ1 A;  1KLM A;  3OTD A;  1HHQ A;  1MLA A;  3LGN A;  5D4O A;  3P49 B;  4MK7 A;  4WYL A;  3MF5 A;  1HNZ F;  3M9M B;  3WBZ A;  3FCW A;  2WB1 D;  4YME A;  4HTI A;  1CC8 A;  4NI2 B;  1FRM A;  1BQX A;  1GEH A;  1IR2 A;  5L9X A;  3M9O B;  4TQR A;  4DSL A;  1WC1 A;  2XCP A;  4USK A;  2PGC A;  1HI8 A;  4DV2 J;  1C1C B;  1VC5 A;  4O3P A;  3A4T A;  4A8W A;  2ZH3 A;  3M2V B;  1PBU A;  4ZDN A;  3QFH A;  2Z57 B;  1WD6 A;  3SDE A;  4HKQ A;  3KLH A;  2MJN A;  4OMF G;  5ETK A;  3TW0 A;  4OI6 A;  3EUN A;  3KLG A;  5GAE I;  3KDN A;  1NHK L;  1SH0 A;  2QLJ B;  4M1K A;  2VQE F;  2EG1 A;  4U7U D;  3DMJ B;  2ERR A;  3ZFV A;  4ELV A;  4DV5 F;  2DRB A;  5LXR A;  4FYW B;  3TAM A;  3DYA A;  2RUS A;  2EBG A;  2HMI B;  2LYV A;  5B7W A;  4RNO A;  3I31 A;  1G3O A;  1U1L A;  3SQO P;  4F4W A;  3AD7 C;  2FC8 A;  2JEG A;  1MW7 A;  4Y28 C;  2MQL A;  3M9N B;  1BE4 A;  1Y9O A;  3I5A A;  1M5S A;  4LSN B;  3FZB A;  3DGP B;  4Q2M A;  5KOX A;  1X9W A;  1DQA A;  3MR6 A;  2FLO A;  4OQJ A;  4Y00 A;  2FJX A;  3GYN A;  1EQ0 A;  2CPD A;  2HK3 A;  1IKV A;  1TAQ A;  3UCZ P;  2DEI A;  4X66 J;  3NNA A;  2F4V J;  3I82 A;  4X62 J;  4G1Q A;  5CXT A;  1Y5I B;  3D1O A;  2ATC B;  4LFC F;  3M2U B;  3P5T L;  1MNE A;  1KP6 A;  2V2Q A;  2ADC A;  5RUB A;  2HVE A;  4XDC A;  3TJA A;  2YKN B;  1DFD A;  2KXF A;  3E01 A;  1PJ7 A;  1FJC A;  3RB3 A;  1XER A;  1SIW B;  1FJ7 A;  3O3L A;  2JLF A;  4P75 A;  2VHG A;  4WFX A;  2ASL A;  1KDN A;  1JIH A;  3A12 A;  4LIW A;  2E7W A;  2VPZ B;  1IKW B;  2E5J A;  4DR2 F;  1ZZF A;  1YIT S;  3QGI A;  1X5P A;  3I0S B;  3IO1 A;  5B0E A;  1NDL A;  3CJT A;  1F5C A;  4ES2 A;  4K4T A;  4OX9 J;  4WIQ A;  4RU2 A;  4F3M A;  2CYY A;  4ZP8 A;  1SL0 A;  2ROP A;  5LSR A;  3TO8 A;  1PCA A;  3MR3 A;  1V6H A;  2AEJ A;  2OTJ S;  4F4A A;  2QA4 S;  3MAA B;  4CO1 A;  2JHE A;  1D09 B;  4NX9 A;  3FSX A;  4DFP A;  4QJV A;  3TUP A;  4WTO B;  5KAK A;  1N33 J;  5KFD A;  3UD4 P;  3CD7 A;  1X0P A;  3ENA A;  3MM7 A;  4ZVS B;  2GHW A;  3H2L A;  3PJ9 A;  1H2V Z;  4F67 A;  2LMI A;  3UDL A;  2W24 A;  4IG3 B;  3NAI A;  2LA4 A;  3AOD A;  2IRX A;  3BDP A;  3CCT A;  2MB0 B;  4K4V A;  3ADA C;  2OJ3 A;  3BS9 A;  4ZVU B;  1JKH B;  4DUY J;  2FD2 A;  1E6Y B;  4DV2 F;  2MKH A;  5B0G A;  1T9X A;  4OZ1 A;  3SSR A;  1IJE B;  2B8Q A;  2Y1R I;  3QRQ A;  5EUH A;  4WFY A;  4DDF A;  4QPX A;  3JQK A;  3CJR A;  3W62 A;  2XY6 A;  5LJ3 Y;  3I32 A;  2QGF B;  4YB5 A;  4IFV B;  1H7W A;  1U09 A;  7AT1 B;  3CJ0 A;  3B4D A;  5KFS A;  1TL1 A;  2M9K A;  1V9O A;  1HLW A;  3F0N A;  2XYH B;  4ZPT R;  3M6U A;  4RJV A;  4UUX A;  4LF8 J;  1XMQ J;  3LUY A;  1JWW A;  3VWS A;  4RBT A;  2CQ3 A;  1N6Q A;  1PIE A;  1F2H A;  2WOM B;  2W8K A;  3C19 A;  3PTW A;  1SUQ B;  3MM9 A;  1TL7 A;  2Z58 B;  3LAL A;  5F8H A;  1RYR A;  4I56 A;  1WSV A;  4ZVH A;  4U67 Q;  2BM1 A;  3D0H E;  5IOL A;  4P2M A;  3LP2 B;  3MZI A;  4A8X A;  4X66 F;  1U8S A;  2AEM A;  1I5O B;  2F4V F;  2BR0 A;  2JEF A;  1N34 J;  4H4M A;  2N7Y A;  4X62 F;  1VJW A;  3EDR B;  3GIK A;  2HNZ B;  4LUB A;  2O67 A;  2GML A;  1RT7 B;  3CW2 C;  3DC2 A;  4NLX A;  4KJI A;  2J6T A;  2R2U A;  1QTN B;  1TKX A;  2ZH2 A;  2BW2 A;  3VGU A;  5C25 B;  4IG0 B;  1LWC A;  3PZP A;  3ZTS A;  2E9Z A;  3OJS A;  3KG4 A;  3NY0 A;  3BN4 A;  2CWX A;  3L4B C;  4P2S A;  2OPR B;  4N8N A;  1HQU B;  4ECW A;  5K14 A;  2AQ4 A;  1TQL A;  1T9W A;  3W7B A;  2ZH1 A;  2J7U A;  4OI3 A;  4C11 A;  3R1L A;  4OX9 F;  2E1R A;  2XM3 A;  5K8N A;  3JSB A;  2VPY B;  2F63 A;  3DRP B;  3MM5 B;  2MY7 A;  2YY3 A;  4ED3 A;  5ETM A;  2BVZ A;  4C4W A;  2HHH J;  1U24 A;  3BGU A;  2W2Q P;  3D6T B;  1N4L A;  5AE1 A;  3J80 U;  1TU0 B;  1OYD A;  2FDN A;  2R7W A;  3CMQ A;  3OSN A;  1XK8 A;  2XS2 A;  2FJA B;  1N33 F;  1C0U A;  1D0E A;  3VAJ A;  3JB9 k;  5C42 A;  1HBO B;  4FZV A;  4DEZ A;  3P5B P;  3LQV A;  3AQP A;  5L9N A;  2K3I A;  3IG1 B;  4PYD A;  3BJY A;  2NYH A;  2QLB B;  1TZ0 A;  2Z30 B;  4CO4 A;  4JI5 J;  2RF2 B;  2XLI A;  4O4G B;  1FKO B;  2YKQ A;  2HAF A;  2B51 A;  4DUY F;  3A8I A;  1WJ9 A;  1IKX A;  1SJR A;  2BX6 A;  2IM1 A;  5FLX U;  2YNH A;  2IHR 1;  3KNG A;  3V5R A;  1Z2Z A;  1CC7 A;  3NWG A;  2CZV C;  4OZN A;  3KOA A;  3DOK A;  1GXL A;  4A8M P;  5L39 A;  2MY8 A;  4R0E A;  3X1L B;  2HVI A;  1XQI A;  1CJK A;  1PKU A;  2FC9 A;  1GT8 A;  1S0V A;  2HS4 A;  3C66 A;  4LR7 A;  1IKY A;  2XMV A;  1T7P A;  3GB0 A;  2GNK A;  4C97 A;  3BZQ A;  4JOU A;  4P72 A;  3IRX B;  1LWX A;  1LW0 B;  3MPD A;  1FFG B;  4QQB A;  4LF8 F;  1Y11 A;  2Y9H A;  3HHK A;  5L1J A;  3PW4 A;  1KNZ A;  5J2Q B;  2OTL S;  2A1B A;  4OI1 A;  1Y3J A;  2XMU A;  2AP6 A;  1RBO B;  3EE3 A;  1PYO B;  1VK3 A;  5T41 A;  1BLU A;  1NH7 A;  2DD8 S;  1Q1K A;  3G86 A;  5GAG I;  4LMZ A;  2HND A;  2GC8 A;  4FYD A;  5KT2 A;  2CZ4 A;  3CO0 P;  2HNY B;  1IBM J;  5F3T A;  1WOS A;  5F8G A;  1JLA B;  3MEG A;  4CO2 A;  5KG4 A;  1N34 F;  2V63 A;  4RBU A;  5KG2 A;  4WZQ A;  4GVB B;  1VBX A;  3JAM U;  3CUL A;  5J1P A;  2RT3 A;  2N7C A;  5AJ3 J;  1VS3 A;  5CYQ A;  4W4M A;  3G71 S;  4AND A;  2NZ4 A;  1B99 A;  1FE0 A;  3T1Y J;  2DNL A;  1H98 A;  3LTO A;  5DM7 Q;  4ZP7 A;  3MEC A;  3TJ9 A;  1YJN S;  4QZV B;  2C2O B;  2ROE A;  2VG6 B;  4RWW A;  4PWU A;  1HI1 A;  4DQQ A;  1RCX B;  2ACM A;  2W25 A;  2W2M P;  2JVO A;  3MCM A;  2VIC A;  1WWH A;  4KRW A;  3QBC A;  3RR8 A;  3DOM A;  6FD1 A;  2ZBQ A;  1KOO A;  1NHV A;  4TY8 A;  3VGV A;  1HW8 A;  2DCU B;  2YWW A;  3UCU P;  3FGV A;  4M8L A;  4OZ3 A;  2B9W A;  4IR9 A;  2DR5 A;  3G6X A;  3FMW A;  2GVZ A;  4W92 B;  3BKF A;  2B43 A;  4NLW A;  3GIM A;  1GAO A;  2HHH F;  3GJT B;  1RT6 B;  2E5L J;  3BQ2 A;  1K47 A;  3KHL A;  3HVT A;  2G4B A;  3T1H F;  2M8H A;  3TI0 A;  2ZUG A;  2RS8 A;  1O5J A;  5HMW A;  4G1P A;  3C6T A;  3DOL A;  3GG0 A;  3HD2 A;  3QWU A;  2G2O A;  2XNQ A;  3IBF B;  1UW9 A;  1KLM B;  4JI5 F;  2HVH A;  1YJ7 A;  2DY1 A;  5GAH I;  2KG1 A;  3PR5 B;  3A1Y G;  5ETO A;  4PG7 A;  1UA1 A;  2CPH A;  4K2J A;  4C3L A;  2I2Y A;  1WC3 A;  4KGX B;  2P8I A;  4K5R A;  2A6M A;  4EO8 A;  2GAH C;  1B7Y B;  2RDD A;  3Q22 A;  4DPO A;  3KJQ B;  2AWZ A;  2R8J A;  2C42 A;  4YB6 A;  3SDE B;  2V8D A;  3KLH B;  2AKW B;  1AUD A;  2V69 A;  2R7U A;  3KLG B;  3M6W A;  4MT1 A;  3RAX A;  2IRU A;  2UZA A;  2C3P A;  4JI8 J;  2HFZ A;  2HGN A;  4DL4 A;  1ZET A;  2ZBI A;  1T94 A;  4RWX A;  2NXJ A;  2JOQ A;  3TAM B;  2HQI A;  1UW4 A;  3DYA B;  4CLW A;  1IBM F;  4OX6 A;  1CBK A;  4WF9 Q;  5BYQ A;  3T6B A;  2KU7 A;  5GMD A;  5CZX A;  1BXN A;  3EZU A;  3GV8 B;  1URR A;  1HWK A;  3FJ2 A;  3DDK A;  4ED8 A;  2FVQ A;  1QJH A;  4DPY A;  5AJ3 F;  2GQ2 A;  1RTH A;  2BJ3 A;  3MED A;  1NM2 A;  3T9N A;  1WI8 A;  1U26 A;  2DB1 A;  4P2X A;  2B9X A;  1IKV B;  3MMB A;  2NXE A;  2WHO A;  1VOM A;  3T1Y F;  5ETL A;  3JTN A;  1U48 A;  3SIP B;  4H4O A;  4B9V A;  4KO0 A;  4G1Q B;  2Z2L A;  4MKV A;  3VTI A;  3KNA A;  2EFQ A;  5CH7 B;  4ZCK A;  2V68 A;  2XNR A;  1LKZ A;  3E01 B;  4YEA A;  2DCL A;  5F8M A;  3CVK A;  1X4H A;  1WG4 A;  4K59 A;  5E3Q A;  2MKK A;  2HQG A;  4OYA A;  2LFV A;  3D1Q A;  1ZAX A;  3DLB A;  3KKF A;  4ZPC A;  5DGA A;  2EKY A;  2Z56 B;  3KUH A;  4YUD A;  2R7O A;  3J7A 1;  5B0A A;  4EWT A;  3LPE A;  3GJQ B;  5B08 A;  1NAQ A;  1VCT A;  2K7K A;  2WSF C;  2E5L F;  1PYS B;  5A8K A;  1YIJ S;  1YLX A;  2XYP B;  4YY3 J;  4ECV A;  5C5J A;  2WCX A;  5F9L A;  5FII A;  4FP9 A;  2ZEJ A;  2IA6 A;  4ZPW R;  2ZVS A;  5A8W A;  1U47 A;  1JNR B;  3QID A;  2RQM A;  3D66 A;  3GJS B;  3D6H B;  3MTK A;  4Z7C A;  3R97 A;  1MWY A;  5HMY A;  3SQG A;  2I6W A;  5HSP A;  1SKS A;  3RRK A;  3I4H X;  3J80 Y;  3MM7 B;  2K1R A;  4DR5 J;  3EWG A;  1WDT A;  2V4R A;  1UTA A;  1VC0 A;  1MN7 A;  1WF0 A;  2LKZ A;  4IOB A;  4RNF A;  2PMZ D;  2GGP A;  3QQC D;  1RAI B;  2LQB A;  1TK5 A;  1B3T A;  3G8T A;  1ZM9 A;  1N0V C;  4FXW A;  2BKO A;  2V8V A;  1CJU A;  2GCF A;  3DN9 A;  4QIW D;  3EGZ A;  1SB6 A;  1TK8 A;  5FLX Y;  2HHU A;  3R1H A;  2E5I A;  1IXK A;  2OEM A;  3G82 A;  3MEE A;  4NZ6 A;  5B0D A;  4DUZ J;  2M5Y A;  3K7R A;  4OJ3 A;  2OFG X;  2VFT A;  2F40 A;  5ETV A;  5GAG U;  4JI8 F;  3RAQ A;  1D1U A;  5DLG A;  2X1G A;  3PJW A;  4MKB A;  2YNI A;  1TL1 B;  1FK9 A;  4CLU A;  4HI1 A;  1LWF A;  5DDP C;  2VIH A;  3A8J A;  1N6Q B;  5ADZ A;  4U7U K;  3BB5 A;  2CQH A;  1KQF B;  4ED4 A;  3MM9 B;  1NSP A;  4DPU A;  1TL7 B;  2QA2 A;  5DO2 A;  2KVI A;  3WDO A;  1SI9 A;  3H40 A;  4AXI A;  2GS8 A;  1QAJ A;  3TUJ C;  3R7S B;  2YKA A;  1J5O A;  1I94 J;  3PHT A;  3FKB A;  4DSF A;  3VGS A;  2MZJ A;  4KFB A;  4Y0F A;  4J9R A;  3O6Q A;  3TUZ C;  2NR0 A;  2X1A A;  2YKM A;  4H4M B;  1BQN A;  4K4W A;  1SQF A;  4YS2 A;  4CP5 A;  1LXJ A;  1SJF A;  1C2P A;  2BOP A;  1TKX B;  4ES3 A;  3JAM Y;  4DU8 A;  1U1N A;  1LWC B;  3T19 A;  1GXU A;  1DZ5 A;  1HQE A;  2VOP A;  2KKH A;  4L74 A;  3ENQ A;  2RML A;  5CAB A;  1DTQ A;  3QRR A;  1VQP S;  1Q82 T;  1W7W A;  5K14 B;  2RKI A;  4RLE A;  1F2G A;  2XB2 D;  3SXL A;  2X3G A;  2VOO A;  2MQ8 A;  2YWF A;  2DNG A;  2DNZ A;  1P27 B;  1SCJ B;  2C22 A;  4C11 B;  2OI2 A;  3IFE A;  4YY3 F;  4WCE Q;  2MZQ A;  3DI6 A;  4PYA A;  5D4L A;  1O51 A;  4DFM A;  5MLC V;  1RWV B;  2J5A A;  3PYE A;  2ZHB A;  5GAH U;  3HFV A;  5BYS A;  3HPO A;  2YWE A;  4WKR A;  1ACM B;  4IH5 A;  3R5B A;  1C0U B;  1VIO A;  4DR5 F;  2YBV A;  3JSM A;  1Y4Z B;  5C42 B;  4LR8 A;  2RH3 A;  1RP5 A;  3M8R A;  1RHQ B;  2BDP A;  2OEL A;  3TUI C;  4AL6 A;  4ITS A;  2VPW B;  2H4Y B;  1PJ5 A;  3S8S A;  1SJQ A;  4WJB A;  4KT0 C;  1IKX B;  2RIL A;  2YNH B;  1U1Q A;  1HW9 A;  4P7V A;  3NKY A;  3QO9 A;  2CNK B;  3DOK B;  5KG3 A;  4R8U A;  1Q95 G;  3TJ8 A;  4DUZ F;  1U0S A;  1WKL A;  1CJK B;  2J0X A;  2BE2 A;  4NLR A;  3KJF B;  3SCL E;  4UTG A;  1O0P A;  3NNC A;  4HT5 A;  1GX6 A;  1IKY B;  4ZA1 A;  3QJP A;  2HFN A;  3HHL C;  4CLK A;  1VLY A;  1RWN B;  3S6E A;  2DO0 A;  1SKU B;  2H48 B;  1ARO P;  1CQM A;  5HLF A;  2EFG A;  3DHX A;  3CCE S;  3IR7 B;  4ZHR A;  4XPC A;  4IR1 A;  4ECS A;  3GE9 A;  4O3O A;  1BWV A;  1NK7 A;  1I94 F;  1BY9 A;  2HND B;  2KFN A;  4NWB A;  3IS9 A;  2RUG A;  3UVJ A;  5IT9 U;  3V6H A;  1IUJ A;  2HBY B;  3MEG B;  1JLG A;  5KFC A;  4B3M J;  4IRK A;  3C2P A;  2AYG A;  1W2I A;  3IA0 A;  3AB4 B;  2XCA A;  3DLK A;  3PJX A;  4A8K A;  2YWG A;  5CYQ B;  4Q0B A;  3ZTR A;  1XN9 A;  2BRL A;  2MEW A;  3TRG A;  4ZJO A;  2YNG A;  3BH6 B;  4LBH A;  3WIV A;  1KFS A;  3MEC B;  4JYA J;  3OLB A;  2PFD A;  2VON A;  4IFY A;  2C2Z B;  3DRX A;  3BGF A;  2V5H G;  1NZ8 A;  4M5H A;  2C3M A;  4P74 A;  1GH8 A;  2YH1 A;  2QSF A;  1NRK A;  3DOM B;  3HO1 A;  4TY8 B;  1KHW A;  4H4K C;  4DG1 A;  3TA0 A;  3PHE A;  3MR5 A;  2FHM A;  2Q3P A;  1F60 B;  1YSJ A;  4PPD A;  2GVZ B;  1FWK A;  4ETX A;  5L1K A;  5B09 A;  3H4B A;  2BQU A;  5CCL A;  2CWK A;  3DLH A;  2YQ0 A;  3HVT B;  4KGZ B;  2WON A;  3CCU S;  4P73 A;  1RKI A;  2CXE A;  1H2T Z;  5KFJ A;  2FB0 A;  2HFO A;  1NSK L;  2CQP A;  4ECQ A;  3C6T B;  4OZ2 A;  3BN7 A;  4S0M A;  2AMC B;  3DOL B;  1RAG B;  3R27 A;  2DGT A;  4DN0 A;  2EFV A;  3LF0 A;  4LF6 J;  1NK0 A;  4N5S A;  2W2N P;  1NEE A;  1RA7 A;  2LXF A;  4MH8 A;  2DO4 A;  4DV4 J;  1M1G A;  1B0T A;  2CAD A;  4J9O A;  1P9Q C;  3D3C J;  3CIZ A;  3P6Y C;  4ID8 A;  4ZP6 A;  4K4X A;  3R2D J;  4PG8 A;  1BUX A;  4QW9 A;  1AUS L;  5L1L A;  3AXK A;  2KJV A;  4URS A;  2EG2 A;  2L9D A;  1D8Z A;  4LF7 J;  4QIV A;  3PYD A;  3KLF A;  4K0K J;  1TKT A;  4D3H A;  3Q89 A;  3JS9 A;  2CNL B;  3HCX A;  2ZC3 A;  4FDF A;  5CZV A;  4USU A;  1UJ4 A;  3QT7 A;  3EGN A;  2CNN B;  4NLQ A;  1UCN A;  2YVS A;  2Y8Y A;  2IAJ A;  1QUP A;  1VGY A;  2MZR A;  1FNO A;  2GJ2 A;  3CO9 A;  1KTV A;  4KAI A;  1TL5 A;  2ZUA A;  1NDC A;  1AA1 B;  3T41 A;  8RUC A;  2F5G A;  4DFJ A;  5HAT A;  2ZDP A;  4QYZ K;  4B3M F;  2DBB A;  3K5N A;  4GKJ J;  4M5M A;  2CQB A;  2D9P A;  1KC8 T;  3B8H A;  5HAO A;  1XNR J;  1UET A;  5HBM A;  3T5H A;  1Q4R A;  1HWL A;  3SFU A;  5KFF A;  1RTH B;  3MED B;  1AFJ A;  3D6M B;  3HHL D;  1R0B G;  3WC2 A;  3MMB B;  2LVW A;  1DQ9 A;  5D78 A;  4CLS A;  4H4O B;  4JYA F;  3CWJ A;  4KB7 A;  4LQ3 A;  3CC7 S;  2QZ8 A;  4KO0 B;  3DXB A;  1WEY A;  2VBX A;  2WRM A;  1RT1 A;  2IVF B;  1TR0 A;  2DGU A;  2RJZ A;  1UAW A;  4BDP A;  1KQS R;  4IO9 Q;  3WX4 A;  2PA3 A;  2CQ2 A;  3CJ5 A;  4Z7Y A;  5ETT A;  3NMA A;  2JFK A;  5JVG Q;  4ZVT B;  1Y5N B;  2PEH A;  3NGR A;  2YPZ A;  2RDI A;  2HVD A;  4CH0 S;  4JV5 J;  3HLU A;  2XMJ A;  3MPW A;  4DCO B;  2CJA A;  2VKR A;  3NBP A;  5A8K B;  1HI0 P;  3HSZ A;  1JLF A;  4ZLJ A;  3OL6 A;  3J81 j;  3P8B B;  1RI7 A;  4IOC Q;  1RA6 A;  3C6U A;  3HFZ B;  1S57 A;  2VJU A;  5A8W B;  1PJ6 A;  4C9D A;  2W01 A;  4ZJL A;  2QV6 A;  3HHD A;  2L9N A;  1L3U A;  5HVG A;  2DNP A;  4LF6 F;  3ZXW A;  3SQG B;  1OPI A;  3CJ8 A;  4DV4 F;  4ELU A;  4ZJQ A;  3HZG A;  1H6K X;  3CTR A;  3D1H A;  3H5U A;  4LBP A;  4EMD A;  2O1P A;  2K1R B;  1T8E A;  1FTR A;  3V4I A;  2M0G B;  1YJ9 S;  2J7W A;  5ITH A;  3QGP A;  4LBI A;  3VQT A;  5J1E A;  2GGP B;  3CDB A;  5SUH A;  2ALZ A;  5GVQ A;  1UEU A;  4XTT A;  2R8I A;  4LF7 F;  2OUG A;  2X1F A;  4K0K F;  1CJU B;  3Q2T C;  2BMB A;  2IYI A;  3CCV S;  4B3S J;  3FQL A;  4LFA F;  3TAN A;  2J0S D;  4RW6 A;  3M05 A;  1RWU A;  3G82 B;  4NLS A;  3MEE B;  3CDU A;  4CWB A;  2WSE C;  4PCQ A;  4WPA A;  4ALZ A;  1TMJ A;  5ETQ A;  3CDA A;  2M3D A;  4LRE A;  2Y0B B;  3SCI E;  4FS1 A;  4OL8 A;  4IOA Q;  2YNI B;  1REG X;  1FK9 B;  3WIU A;  4Q8E A;  2XS5 A;  4OHY A;  1LWF B;  3BO4 A;  3BGO P;  1N48 A;  3HF5 A;  1P8G A;  3HVA A;  2Z2Z A;  1M5H A;  4ZCI A;  2C28 A;  4W90 B;  2AF6 A;  3QAT A;  2UUW A;  3IAS 9;  1NPK A;  3PX0 A;  2J76 E;  2ZIT A;  1HFE L;  4GKJ F;  4DQI A;  5M2R A;  4CO5 A;  4EEY A;  1XNR F;  1OMS A;  1J5O B;  1MG7 A;  4DSE A;  1NZA A;  1RAH B;  4NA1 A;  1NPP A;  1IBK J;  2NPI A;  4KFB B;  4EI2 A;  4NRU A;  1JXE A;  4ECT A;  5IXU A;  5DGB A;  3ZTO A;  4HVZ A;  2YKM B;  1BQN B;  5A0Y A;  3WX8 A;  2Q6C A;  5IT9 Y;  4EBE A;  5HQ8 A;  3AOC A;  1S1V A;  2YXL A;  6FDR A;  1NJZ A;  1VFJ A;  3Q0A A;  2PT0 A;  4X65 J;  3PW5 A;  3CSK A;  2PEB A;  3MMA A;  3O2I A;  1RSC A;  3MXH P;  1HQE B;  4JUZ A;  1KFD A;  1HD1 A;  1S0N A;  1DTQ B;  1H72 C;  2G2Z A;  1SJ4 P;  2U2F A;  4UY8 5;  3EXY A;  4NEZ A;  4KHP J;  1FX4 A;  1QAX A;  2RKI B;  3HKW A;  4G1I A;  4JV5 F;  1XC9 A;  4L73 A;  2HHX A;  5I42 A;  3H7H B;  2QL9 B;  1BQM A;  3NGT A;  2OD6 A;  1M5K C;  2HIY A;  1EET A;  3D0G E;  2VU5 A;  5U47 A;  4DI6 A;  3DI6 B;  3THT A;  2KM8 C;  5KT7 A;  2VF3 A;  3U27 A;  3ISZ A;  4C8Y A;  3A13 A;  1WUU A;  2KO1 A;  1R0C B;  3PKM A;  2KXH A;  2BUN A;  1K0V A;  2LEA A;  3HKZ D;  4P71 A;  5GME A;  1AFI A;  4OHZ A;  3SCK E;  1T9U A;  4LR9 A;  2W7O A;  4NZ7 A;  5G4D A;  2AJQ A;  2MQO A;  4Y2C A;  4NLY A;  4KE5 A;  3JSM B;  3TA2 A;  4MTP A;  2UUA J;  1Q78 A;  3UW1 A;  1K73 T;  3DCA A;  3H5X A;  4C8O A;  4LF9 J;  2CQ4 A;  3OFF A;  4L6V 3;  2HLT A;  3GP9 A;  5CYM A;  2Q66 A;  3FDS A;  1N5Q A;  1U6F A;  3MUM P;  1VRT A;  2F8E X;  4UUW A;  2R4F A;  3AJ1 A;  2CNO B;  4FNI A;  2BKP A;  1LWE A;  4B3S F;  3QO9 B;  4R8U B;  2J9C A;  1WI6 A;  4FF1 A;  2BE2 B;  1SIZ A;  4TY9 A;  2R7T A;  1UJ6 A;  1D9F A;  1PBA A;  1VQ7 S;  4ZVG A;  1UFK A;  4U96 A;  4Y2K A;  1GMU A;  1SQG A;  3KDO A;  2ZH4 A;  4YR0 A;  5C7P A;  3MDF A;  2EPI A;  4DZ6 A;  5AXL A;  1PAE X;  3L09 A;  2D9O A;  3DU5 A;  5DDR C;  3TZY A;  4DLG A;  3BH7 B;  4KBI A;  1CEZ A;  3KHR A;  2CFX A;  1X8D A;  2LU2 A;  5KG7 A;  1YBT A;  4PQU A;  5HLF B;  3LPY A;  4USM A;  4ZHR B;  3SV3 A;  2ZWP A;  2OO4 A;  4A8O A;  1RTI A;  1IBK F;  1JJH A;  3IS9 B;  5H9E K;  3J7Z 5;  3UVJ B;  3UO0 A;  2HAI A;  1VQ5 S;  1S10 A;  4PRF A;  1JLG B;  2WVC A;  3BYR A;  4ZLL A;  2YWH A;  4ZVQ B;  3CNQ P;  1OPZ A;  2B8P A;  2X51 A;  1HL6 A;  3PKY A;  4FPR A;  3DLK B;  4X65 F;  2LQ8 A;  3DHW C;  4Q0B B;  3CJS A;  1KQG B;  3G6V A;  1NND A;  2VC1 A;  4EU0 A;  2YNG B;  2EKN A;  1TAU A;  3AD9 C;  4KHP F;  4DL7 A;  4ZKA A;  4XPE A;  3NLC A;  2QLX A;  1ZA1 B;  4IFY B;  1Q8L A;  4FVM A;  2QMX A;  3FCH A;  2JNJ A;  3E8O A;  9ATC B;  2HFU A;  1YZ7 A;  5CHC B;  4BHQ A;  3V6D A;  2V4J A;  3EGW B;  1BHN A;  5J2N A;  4DG1 B;  3OL9 A;  4J37 A;  3J7Y I;  5KTQ A;  1N5Y A;  1SV5 A;  2KL8 A;  3N4W A;  3VAG A;  1WC6 A;  5EX3 A;  2OSR A;  4RUA A;  3HDS A;  3O5T B;  5F8I A;  1ELO A;  4ILL A;  2AJ2 A;  2KG0 A;  4TXS A;  1RHR B;  1T95 A;  2WON B;  3GR0 A;  2UUA F;  4ANC A;  3KJV A;  3AXM A;  4QIF A;  4LF9 F;  4FKY A;  1FE4 A;  4LJM A;  2AZ3 A;  1J27 A;  5F0W A;  1P6T A;  1QAY A;  5D4P A;  3US5 A;  4NOH A;  3LH2 S;  3FVY A;  5G0R A;  4TVA B;  4C6A A;  2CKW A;  4M5G A;  2DH9 A;  4IH7 A;  2IJR A;  3NG8 A;  2QA4 G;  4CRJ A;  4U6P A;  5H1S V;  3IMQ J;  5T14 A;  3ICL A;  2A3J A;  2VFU A;  1S49 A;  2AX1 A;  1RQ0 A;  3KLF B;  3KLV A;  1TKT B;  3ILJ A;  4C8L A;  4DX5 A;  2PMH A;  4NA3 A;  3U02 A;  1KVJ A;  3B6B A;  3PNI A;  4DQP A;  4YDX A;  5MAO A;  5E3R A;  3F73 A;  3PFO A;  2IAJ B;  2DPJ A;  3A8E A;  5A6W A;  3OHB A;  1H0H B;  5J2M A;  2PSZ A;  1RTJ A;  1IR0 A;  2W2O P;  3CGI A;  1S0M A;  4I2Q A;  2DIU A;  1N5V A;  1NJW A;  1DAX A;  5B0C A;  2NZC A;  2RHQ B;  4QWB A;  4WBF A;  4C0O C;  3TVZ A;  1S76 D;  2FGC A;  2DNR A;  2ZNY A;  1R8C A;  4USV A;  5HBM B;  4NLP A;  3AB2 B;  4OX7 A;  1X4C A;  1UVJ A;  1GTE A;  3CCW A;  3NCP A;  2LDI A;  5LT5 A;  3PY8 A;  2WZ1 A;  4OHW A;  1EIY B;  2F65 A;  3OR1 A;  3MR2 A;  1WTF A;  2PDA A;  1ZTT A;  3HT0 A;  1HWU A;  4V19 X;  1RT1 B;  1U2C A;  2MJU A;  5DRK A;  2K7J A;  4X2B A;  3AJ2 A;  2O5D A;  2ATL A;  1XTZ A;  3OL7 A;  1S97 A;  2D3O 1;  4HR2 A;  2CIM A;  5DZ7 A;  1VQY A;  5CYJ A;  2QEX S;  4HHJ A;  2KHC A;  5CQG A;  1GMW D;  1X7V A;  1RDR A;  3W61 A;  4F26 A;  3HX9 A;  4QWC A;  1EJ7 L;  3PYG A;  4PXC A;  3NBP B;  2RRB A;  4UOG A;  2A18 A;  1KVK A;  3MPV A;  1JLF B;  5D0H A;  3NAH A;  3OQ2 A;  3KLI A;  2H9Z A;  2QLW A;  3M2R A;  3W65 A;  3C6U B;  7FDR A;  3IBC B;  1YJW S;  1KHV A;  3JTO A;  2WAQ D;  2CG8 A;  4N76 A;  4F2R A;  4ZPD A;  2B3T B;  1NSA A;  5FD1 A;  2NCK L;  1L3T A;  4XO0 A;  3UI3 A;  2RSQ A;  3IP0 A;  3V4I B;  5L8R C;  3W1Y C;  1VBZ A;  5ETP A;  2ROG A;  4OX8 A;  3H98 A;  1RBL A;  3OD2 A;  4WTY A;  3AA9 A;  4Q7A A;  2XMM A;  1HPZ A;  2APO A;  3B82 A;  1FEE A;  5J1E B;  4DL2 A;  4M5D A;  3Q8S B;  3ZZY A;  2HKE A;  4C98 A;  4DSK A;  2E7V A;  2GMH A;  1WDD A;  3GJR B;  3MUR P;  3BGL A;  3FEX B;  1VC6 A;  4ZIV A;  5JUM A;  4LRB A; 
#chains in the Genus database with same CATH homology
 1NPK A;  3EVO A;  3NGT A;  3Q83 A;  3ZTP A;  3FCV A;  4FKY A;  1HIY A;  3NGU A;  1ZS6 A;  4F36 A;  1NLK L;  2DY9 A;  5BXI A;  1NDP A;  3EVW A;  1WKJ A;  4CP5 A;  4F4A A;  2VU5 A;  1XQI A;  3B54 A;  2AZ3 A;  3EIC A;  2AZ1 A;  4WBF A;  4DI6 A;  1PKU A;  1S59 A;  1EHW A;  4UOG A;  3Q89 A;  4AND A;  4ENO A;  4EK2 A;  2DXF A;  3JS9 A;  2DYA A;  5C7P A;  3BBC A;  1B99 A;  4DZ6 A;  1PAE X;  3EM1 A;  3EVM A;  3PRV A;  3VVU A;  1WKK A;  1NDK A;  3ENA A;  3BH7 B;  5CAA A;  1JXV A;  3L7U A;  1NCL A;  2CWK A;  1LWX A;  3PJ9 A;  3MPD A;  2HVE A;  4C6A A;  4FKX A;  5CAB A;  3FC9 A;  1UCN A;  2DXE A;  3FBE A;  4W98 A;  3Q8V A;  4DUT A;  1B4S A;  5IOL A;  3BBF A;  3ZTO A;  1F6T A;  1NUE A;  1W7W A;  4KPC A;  1BHN A;  3Q8Y A;  3WX8 A;  1NSK L;  3DDI A;  2ZUA A;  4UOH A;  1NDC A;  3GPA A;  3VVT A;  4S0M A;  1NHK L;  3NGR A;  3FBC A;  4O0N A;  1WKL A;  3FBF A;  2HVD A;  2HUR A;  2NCK L;  3EE3 A;  3VGV A;  3ZTR A;  1KDN A;  2DXD A;  3ELH A;  1VYA A;  1NSP A;  3VGT A;  3EMT A;  3DKD A;  1NSQ A;  2B8Q A;  1F3F A;  3G2X A;  3BH6 B;  3Q8U A;  1NB2 A;  3VGU A;  3B6B A;  3EJM A;  3GP9 A;  1NDL A;  1MN7 A;  1HHQ A;  3NGS A;  3R9L A;  1LEO A;  3ZTS A;  1U8W A;  1XIQ A;  3Q86 A;  3FKB A;  4HR2 A;  3ETM A;  1S57 A;  3VGS A;  1BE4 A;  2B8P A;  3ZTQ A;  1K44 A;  1BUX A;  1MN9 A;  3FCW A;  2BX6 A;  3BBB A;  4ANE A;  4ANC A;  2BEF A;  3FBB A;  1HLW A;  4UOF A;  1S5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...