4ANEA

R80n mutant of nucleoside diphosphate kinase from mycobacterium tuberculosis
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
135
structure length
135
Chain Sequence
TERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTNAIAAVRQLAGGTDPVQAAAPGTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Structure of Mycobacterium Tuberculosis Nucleoside Diphosphate Kinase R80N Mutant in Complex with Citrate
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 42
structure length 135
sequence length 135
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4aneA00
5CABA 2HVEA 1LWXA 1ZS6A 3VGUA 1NHKL 1KDNA 4EK2A 3ZTQA 3Q89A 2DXEA 1S59A 3WX8A 1B4SA 1VYAA 4W98A 1HLWA 1NDCA 3ZTOA 2HVDA 3Q86A 1NCLA 3L7UA 1PAEX 3EJMA 3FBFA 1NDLA 3R9LA 4ANEA 3BH6B 4ANCA 3PRVA 3VVUA 1NSPA 3ZTRA 1XQIA 1B99A 3NGTA 1U8WA 1MN9A 1K44A 2DYAA 1WKJA 2HURA 4ANDA 3VGTA 3EM1A 1UCNA 3FCWA 1BE4A 4WBFA 1NSQA 4F36A 4C6AA 3B54A 4KPCA 3Q83A 1NB2A 4O0NA 2ZUAA 1MN7A 1WKKA 2B8PA 5CAAA 3B6BA 3BBBA 4FKYA 3JS9A 3DKDA 4S0MA 1NDPA 2DY9A 1PKUA 3GPAA 5BXIA 1BUXA 4DUTA 3EICA 3FKBA 1HHQA 1S5ZA 1F6TA 4UOFA 3DDIA 1LEOA 1NSKL 3MPDA 2AZ3A 4CP5A 3G2XA 1NPKA 1W7WA 3BH7B 4F4AA 3ZTSA 2B8QA 1WKLA 1BHNA 3ETMA 2CWKA 3PJ9A 3EMTA 3FBEA 3ZTPA 2BX6A 5IOLA 3EVWA 2NCKL 3VGVA 4UOGA 2DXFA 5C7PA 3FCVA 1JXVA 3EVOA 3EE3A 2DXDA 3GP9A 1F3FA 3VVTA 4ENOA 3NGRA 3FC9A 3NGSA 1EHWA 3BBCA 2AZ1A 1NDKA 3ELHA 3EVMA 4DZ6A 1NUEA 3NGUA 4UOHA 4HR2A 3VGSA 2BEFA 3ENAA 3FBCA 1XIQA 3FBBA 3Q8VA 3Q8YA 4FKXA 1NLKL 3Q8UA 3BBFA 2VU5A 1HIYA 4DI6A 1S57A
chains in the Genus database with same CATH superfamily
3G82A 4A46A 4DS5A 2MDAA 1H6KX 2AW0A 1VYAA 2CJQA 2BKOA 4YB7A 3ZZTA 2UUCJ 4DV1F 2CADA 4CO3A 1ZPVA 5H9EK 3N79A 4ZA1A 2PGCA 4USWA 1QAIA 3I9ZA 1RWVB 3F0NA 2ZWPA 4Q2MA 2HRTA 2IHR1 4X4PA 3GYXB 2C3PA 3UD3P 2GQQA 4B3RJ 1MNEA 4M5MA 2Z56B 3V2UC 2CG4A 5I3UB 2HQ3A 2BANB 3QIPB 1W2IA 1OS5A 5E3AA 3KK1A 3MM8A 4H4KA 4N56A 2V68A 1N36F 3CCRS 3CCLS 4AE5A 3PO4A 1KHWA 3VAKA 4FBTA 4NRTA 4ZCMA 2F3JA 3D0IE 4BWMA 2HVEA 4P72A 3ADAC 2NS1B 4ER8A 3E2EA 1F2HA 4DPXA 4TQRA 1H74A 4DQPA 3NS5A 2C2EA 3G4SS 1HW8A 3LQVA 2IM3A 2DVIA 5DQGA 3D1OA 4RW9B 1U8WA 4DZDA 2JEJA 3H5XA 1NK7A 3UD5A 1M5HA 2D9OA 2XMVA 3DN9A 1QSLA 2RKIA 3KJFB 2G4BA 1KVIA 4FNIA 3H8YA 1ZH5A 5AXMA 1S6UA 2FHJD 4IYQA 4QU7A 2G1DA 2DHXA 3F44A 1XNRJ 3AD8C 1IR0A 2YNFA 4DV3F 4QOTA 3CTRA 3NEKA 4P10A 2QA2A 2ZBPA 2UXBF 1YKWA 3BREA 3M8QB 5F8IA 2RU3A 1EETB 3JSMA 2ZNYA 1ZM3A 1VJQA 2XCAA 3PY8A 4RUCA 3A3OB 2U1AA 5A8RA 1F9EB 1WELA 4JI3F 1HQUA 3TA1A 1FFSB 3A8EA 2Y8YA 1NPPA 3NOCA 3R3TA 1WC1A 2PT0A 2OEJA 3NGKA 3POTB 1S7HA 1V6HA 4ILRA 2IBKA 1GXLA 1C1CB 5T14A 2BBEA 3UI3A 4RPFA 2VZ9A 2EC2A 3R27A 4LQ9A 2BABA 4GC6A 2ZH9A 4PXEA 2HVHA 2KRBA 4G1QA 2FUG9 2ZNZA 3ZTRA 2ZZNA 4KGXB 4P2XA 1HNZJ 2VODA 4LFBJ 1N54B 2QFJA 1RT1B 1TK0A 5DGAA 4QJVA 1IBMF 2BOPA 4DR2J 1LW2A 2GQ2A 2HLTA 2QLXA 3RW7A 4CO5A 1Y5NB 5HI7A 4NA2A 3M32A 2KT3A 1YX2A 1N5YB 4MIWA 5GVQA 3JQJA 1NNDA 3AOCA 4NLRA 2LLZA 3TVZA 1CS4B 3KLEA 4G1PA 2YBVA 1JXVA 1OQ3A 2R7QA 5DM6Q 1QD1A 4IFYA 5BYQA 5EWFA 4I7FA 4ZP9A 4MK8A 4UOHA 4OX9F 2GO8A 1RAAB 1X9WA 2W9CB 1S76D 4QCLA 3AQOA 1H0HB 1TVRB 2J8SA 2EFVA 3M1VB 5D78A 2C28A 1H38A 3LAKA 4WFYA 3BSAA 3V6DA 3O8WA 1R43A 1WNEA 1C0TA 4MIAA 3AY0A 2H5IB 1N34F 1U24A 3THVA 1S7IA 3KXDA 3DHXA 3DYAA 3EX7B 1R31A 2HQFA 2X1GA 2BJ8A 4XDCA 1RAFB 3FEYB 4D3HA 1SJQA 3DRXA 3EZUA 1FWKA 4PAAA 3PACA 3MPDA 2VUGA 2VF3A 4JUZA 2XYHB 4ZK7M 3HD2A 4FYDA 3MMCA 2AX0A 1CJKA 3HO1A 3QGHA 3CULA 4CNZA 2JWNA 3GFHA 3H98A 1VMBA 4E8UA 1SC6A 4KV8B 5AE3A 3HLUA 5KFLA 3T1YF 1NK6A 3M2UB 2VPWB 3IC1A 3RB3A 3V4IB 2AF6A 3OTOF 3EUNA 1TKXA 2PFDA 2WOMB 4B9UA 2G0CA 3CJ0A 3VGUA 1NHKL 3MFHA 1WG4A 4WYLA 2PMWA 4WXWA 3TW0A 2W2PP 3J81U 1OO0B 5C5JA 4W98A 1FDDA 4HACA 3O44A 1Q4RA 3SFUA 3MMAB 4C98A 3RRGA 1SL1A 4RU9A 2WONA 2YXLA 5A2QU 4KGKA 2KDOA 2HZCA 1P9YA 1S1VB 2HURA 4LRFA 3D1HA 3BQ1A 1U2CA 2HQCA 4CH1A 3TUJC 4PRFA 2B8PA 4DU8A 2A6MA 1AROP 2BOAA 4WP8A 2NZ4A 3KWMA 1HKAA 4H4MA 5KFYA 2CVIA 2Z2MA 4NMLA 4CM0A 2V63A 4DEZA 2NQPA 4UOFA 2DRBA 3HHLA 1FRJA 5E41A 3H0PA 5J1PA 2A6OA 2QL9B 3NNAA 4LMZA 1TUGB 2RHQB 2W01A 1KEKA 5F8NA 2E7XA 4N5SA 4EWTA 2Z58B 1AA1B 3WDOA 3HXMA 5IV3A 4X2BA 4OV6A 1DTTB 1H72C 2B5JB 2HWTA 2MMYA 2Q1LA 5DDRC 4LF7J 3G9CA 4IRCA 2MHNA 2ABYA 3OR2A 3DMJB 1FFWB 1SJFA 3T1HJ 2IRXA 4OMFG 2FC9A 2C2MB 4C48A 2YKMA 4ED6A 3C2PA 2BE2B 3CJKA 4DV4F 5JJBA 1RT6A 3BYRA 1VHIA 1JXEA 1YK9A 4M1KA 2ZH6A 2HFOA 3UR0A 3J80U 1IKVA 4DPTA 4OV1A 4RUAA 2DYAA 4FDFA 4B3OB 2MEWA 2B9XA 3TP2A 1DQ9A 1SJ4P 1UCNA 2PC6A 3TANA 5KFXA 3BQ0A 2YTCA 4ES2A 3CUNA 3MI7X 3MEEA 2RAQA 1KQGB 5JVHQ 4ZPTR 4NCGA 2ZOMA 1HNXJ 3HPOA 8RUCA 1FJ7A 2V67A 2XZWA 3NWGA 3CCUS 4MFBB 4QIWD 1S9FA 1URNA 1NRKA 1X8DA 5B7WA 1FDAA 2EWHA 3OLBA 1OY8A 1FNOA 4BBYA 3TEHB 2J7UA 2Z2ZA 1SJ3P 2ZH3A 1IJFB 3MXHP 2V6AA 3GU0A 2I1RA 2P6TA 3RYLA 5T7LA 1NJWA 2VBZA 2D41A 4F50A 1QE1A 2KVQE 4Q45A 1UJ6A 4ZPCA 1B4SA 4EEYA 3MEDB 4KO0A 1M1HA 1DBDA 4HHHA 5GMKa 4BDPA 1WHVA 2LQ8A 2DR5A 1X4BA 3PDNA 2KB2A 3QQCD 4DR4J 3D1QA 2BV3A 2OGUA 3GIMA 3Q83A 1OY9A 3PIPQ 3GJRB 4NLOA 2DNMA 3TWZA 5LMNJ 3DOKA 1UZDA 2DH7A 3HVAA 2DO4A 3W63A 4B02A 3KHRA 3C16A 2BQUA 3B78A 1X7VA 4DL6A 4RNFA 1S48A 4CO4A 2UZAA 4I0WA 2X3GA 1M5PC 2VBXA 1IBKJ 3JTNA 2XMMA 3GONA 2I6WA 2WBRA 1X0FA 3QBCA 3KJQB 3A13A 5KTQA 4X64J 2K1RA 1X4FA 4JP8A 4M5HA 1D9DA 1VRUB 5CQGA 5H9FJ 4YUDA 1XEZA 1VC5A 3M6VA 3ILOA 4QWDA 3UQSA 2CQBA 4LFAF 2ALYB 1SXLA 1TL3B 5C42A 3U27A 2HFVA 4F4ZA 3M8PA 3DRSB 3V81B 1E6YA 1G1XA 1YZ6A 2KXFA 4E0DA 4OI1A 3D7SB 2WRMA 3D0GE 1ELOA 2YWEA 2DIVA 4IH5A 5F41A 2FLLA 1H2UX 2KJWA 3S6EA 4ZLNA 1KTQA 5F0UA 4KFBA 1VBKA 2GW8A 4OYOA 4M5JA 1VRQC 4WU3A 3NP5A 4USTA 1U6BA 3RBEA 3B8HA 3MGJA 1F1BB 3HI9A 4U96A 3P8BB 1CG2A 1DAXA 2MGZA 3L4BC 2HGNA 3BGRA 1RCXB 3VAMA 4RW9A 3DLGA 4OYBA 2DGWA 1O6XA 4HT7A 3DRPA 3M6XA 2HK3A 1VISA 4X62J 1HD1A 1A6LA 1Z1ZA 2XC9A 2OFHX 1TR0A 3LPEA 3JTOA 3CCZA 3HFZB 3CD0A 5MLCV 2UUBJ 4EMDA 4P7TA 4ZPDA 3QFWA 4Y2MA 2LEBA 1RT2A 2WVBA 4ID5A 2HGLA 2IDLA 1MU2A 2JFKA 2QA4S 5HLFB 3ZO7A 3ULHA 4QIVA 4AL6A 4DMZA 3W64A 1X4GA 1EP4B 1WC3A 4ECRA 5HP1A 4UQGA 8AT1B 3T6BA 3BH7B 3IGVA 2A18A 4CI0B 1HI8A 2ZHBA 2HNDB 4JI4J 5L9XA 5K8OA 2B6AA 1RTJB 3KUEA 5C25A 2JC0A 5DDOC 2E1RA 3D6HB 1SL0A 1SH2A 3I0RB 5J1EA 4PWDB 2D3OR 2CXEA 5HL7Q 5C2GA 4B9SA 3AJ2A 3M30B 4H4OB 2VDIA 2DNQA 4LBHA 3B4MA 5A76A 2XSJA 2RDDA 2X1AA 2OLWA 4ZPVR 2FJXA 1CLFA 4DXLA 2R8HA 3OQ2A 4IFVA 1TAQA 3SIPB 3PFOA 1JWWA 4ZCLA 2AYMA 2JHEA 3B54A 4F25A 4OIXA 2CQ0A 2ZKUA 3LTOA 1N5QA 1JLQB 3CGIA 2ZFHA 3CJQA 2MZTA 3GB0A 2XLIA 2FLPA 3TVKA 2DGTA 3W2VA 1K1SA 1JK9B 3OUYB 4A8QA 4OI6A 3EVOA 5DDQC 4JI5F 1NEEA 2J8AA 4FPIA 2KG1A 3LALA 3BKFA 1IBCB 3MCSA 4F4YA 1RTDA 1HWUA 3ZNJ1 2OP5A 3FBCA 1RWNB 1X4AA 1S4EA 2A1BA 4OX7A 2MXYA 4X4SA 2R8KA 2VJUA 4EZ6A 2LFVA 4IOBA 3TI0A 1S6PA 4OFZA 2UUAF 1GMWD 1NDCA 2RRNA 2OPQB 4NLTA 3P96A 2WVFA 1JNRB 2A2CA 4RW4B 1T8EA 2FHKA 4B9MA 1E6VB 2A0FB 4P2FA 1KS2A 3QWPA 2FHOB 3VQTA 2EG1A 2YWHA 4CDIA 4IDKA 1NB2A 5CAAA 2OFGX 3SQGB 3CEDA 3P49B 3BGOP 1SH0A 4KC5A 4O4RA 1WC5A 3EPIA 1OJ4A 1NSKL 3TUZC 3DLLQ 3MM5B 1QAJA 5ETTA 1WHYA 4IRKA 3UCUP 4WFXA 4LR8A 1RTHB 4C9DA 4EZ9A 4OYWA 3IG1A 3VVTA 2G1HA 4JV5J 3QFHA 3ZFVA 4QPXA 2GHPA 3N9UC 1EAYC 1LV5A 1JJCB 4LR7A 1LWCA 2AEFA 2ZWOA 2FPHX 1EQMA 4WXOA 2H54B 5AT1B 4X4TA 3D6FB 4CH7A 1PJ7A 4QU6A 3IBFB 4AXJA 3RGIA 5HK4A 4IG3A 4YEAA 1YITS 3G6VA 5FDLA 2HVIA 4ED8A 5K8MA 4C8OA 2ZBCA 5CCLA 1R0CB 3QSIA 2DNRA 2DNYA 3FCWA 1LWFB 4JI1F 4PG4A 3KFWX 2XCPA 2MZSA 3KLGB 4NLXA 1BQMB 1MROB 1UFWA 2Y1RI 2BJ1A 3T5JA 4N77A 4FBUA 3D28A 2R7TA 1PO6A 1HBMA 2FJDB 2H51B 2IC3A 4PXBA 2ZE2A 1VBZA 3PIOQ 2DT9A 1S79A 4OZ0A 3S8SA 4PG5A 5EX0A 5KG3A 1K0VA 4RO0A 3DHWC 2CRLA 3Q8VA 4R8UA 4Y28C 2P9CA 3GR1A 2XB2D 5DG8A 2ADBA 2DXEA 3MAAA 3OLAA 4DCOB 1WACA 3RR7A 4L75A 3QRPA 2L41A 3PX6A 2W24A 1YBUA 2KL8A 1CJVA 2MZJA 1TL1B 3FRYA 1J2VA 5ETKA 1RA6A 4YY3F 4JI2J 1N5VA 2G0JA 2I5JB 2V8GA 3BS9A 4PXDA 4CQ1A 3R1LA 1C0UA 2HHTA 2PN6A 3R5BA 2J9DE 4B3MF 2HNYB 4DUTA 4DPOA 4PUOB 4LRBA 3EXCX 4G3IA 2YWGA 4OZ1A 2HFSA 3PEHA 3U1NA 2V69A 4B9LA 2C3UA 3PW0A 3R5AA 3DLEB 1V5IB 3MR2A 4ZOSA 4I2PA 4I64A 4Y6IA 2MKCA 2GIRA 2GA7A 2XLJA 4DUYJ 2DNKA 1HW9A 1RU1A 4YB5A 1OPIA 5ITHA 4LIWA 3K58A 1T3OA 2LMIA 4DFMA 3DM2B 2OPSA 3IBWA 3QPIA 3L09A 2RRAA 2J5AA 3PV8A 1REVB 1U47A 2RU9A 2HRUA 3D6TB 3CJ2A 3N5FA 3KOAA 2J9EA 2W25A 4PG8A 5B0FA 3K17A 1RISA 1KQSR 2JJ4D 1M90T 1S72S 1Q81T 2BRKA 3VVUA 2EK1A 1WEYA 1RXOB 1HNVB 5GAGI 1XMOJ 1TKZB 4ZS6A 3DU6A 3UNGC 1PIEA 4KBIA 1FTCA 2GGPB 3IAM9 3PKMA 1CQMA 4B17A 4JI0J 3VAJA 2LEAA 5FD1A 3W2WA 2ZBIA 4HH0A 5D6GA 3TJAA 5KT7A 4ECVA 4WKYA 3CCJS 3FSIA 2XQCA 1U0HA 3CCVS 2XS7A 2MQQA 4LIRA 2E9RX 4IO9Q 1JJ2R 3HVTB 4JYAJ 3IGNA 4M5GA 4DV2J 2XWYA 3MHYA 1BWEA 1C1BB 1N33J 4DSKA 3DCAA 5BYRA 2WB4A 1WHXA 4HVZA 3QRQA 2XZTB 2CPZA 4ICLB 1L3VA 2BRLA 2N4CA 2EFGA 3MZIA 3DOMB 3KUHA 2IA0A 1P1LA 5CZXA 4PG7A 4A8KA 3EGWB 1LOUA 4KGVB 2HMIA 2E66A 3CDUA 2W7AA 2W9BA 1KONA 2YNHA 1MSWD 4USIA 5CYQA 2VQFJ 1K9MT 2FZCB 2EPIA 1RI7A 3LW5C 2CQ2A 1HBNB 4Q0BB 2KRRA 4J9KA 1VC6A 1B7YB 2V50A 4MJKA 5MAOA 3PW7A 2J7WA 4WIIA 2DNPA 3KK2B 3TYTA 1F6TA 1HNWF 1T9WA 5CCMA 1X60A 3UN2A 1RT7B 3C6TA 1RT5A 2Y0SD 2EI5A 2YQ1A 4OZLA 2RJZA 1Y9OA 5JUMA 5HMYA 3GMGA 1FEEA 2OD4A 3LGHA 5KFJA 4O44A 4CLPA 1VQMS 1MMNA 3W65A 3UD4P 3AOAA 3JSRA 2LDYA 4DV7F 6AT1B 2AJ0A 4EK2A 4G6VB 1YDLA 1CQNA 2ZHOA 2RS8A 4ZN3A 4QWCA 3CJSA 2EKYA 5CD4H 1VRTB 2ROEA 2YKNA 2ZH2A 1FK9A 4DUZJ 4OZNA 1LXJA 2DRAA 4OI0A 3UO0A 2XZDB 5KFOA 3IA0A 2XYGB 2QYCA 2LXUA 1XBWA 2HVZA 5K9FA 1RTZA 4JBCA 1P9QC 2FVPA 3N6MA 4OHXA 5LMUJ 1QUVA 3ZXWA 2EEYA 3KJVB 1UWBA 2F4VF 5HBMA 3TRGA 4LT6A 3QLHA 1PBUA 4ED2A 2VFTA 4MTPA 2AEJA 2V4QA 4ILMA 2BEFA 5KFNA 4X4NA 1RWUA 3LP2B 3D0HE 1XMQJ 5IM0B 2WB1D 2WHOA 3G8SA 4ZMMA 5CYJA 2Q43A 3Q89A 5I42A 2DNLA 3ZZ0A 1XR5A 4A8OA 1D9FA 1RB0A 1CJTB 3G6XA 3CC7S 2CKWA 1Y10A 2ASLA 3FGVA 3H20A 4NWBA 3EZ5A 4I56A 2MLXA 3A4TA 2BXJA 2KFZA 1LW0B 1U2FA 3ENQA 3MUTP 1DJ0A 3CD7A 3UVJB 1YJUA 1U1QA 1GNKA 2DGQA 3DDNA 1F5BA 3M6WA 3SCJE 3FCHA 4I6AA 1RWKB 5AXNA 5F9NA 1LWEA 2HHXA 1RAEB 2AD9A 5M2PA 1DLOA 2K3KA 4YS2A 4TU8A 3MPYA 3NMAA 1KFDA 1HBOA 1NDKA 2XO6A 3MF5A 5DGBA 1NH8A 2C2ZB 2HQIA 2KKHA 3DLHA 4AQYF 2D74B 3VGSA 1FRXA 2L9WA 2Y1LB 4ETXA 1XR7A 4Z37A 1RACB 4GKKJ 2ZOGA 4DR7J 3DRRB 1SIWB 5LXYA 3QO9A 4P52A 4DR5J 4ED3A 5LSRA 4I2QB 2QMXA 3WC0A 4WPAA 5ETRA 4BCAA 1B7FA 3FFIA 1HPZA 2OPPA 2R8GA 4F02A 1QSSA 1UPPA 4AXIA 5FLXU 2MQMA 1RYRA 3OTEA 2C22A 4CTAB 4EU0A 3K5MA 2ZDPA 3K5PA 4R5PA 1VQOS 1FX2A 2OELA 1SIZA 5KFEA 2O3DA 2C2DA 2AJFE 4RZRA 3MM6A 4ERDA 2IIHA 3FKBA 1J27A 5A6PA 3LWMA 3LP0B 2XGPA 2VQEF 3CJ8A 2UUWA 4PEOA 2QIFA 3CDEA 1RT4A 2M8HA 2YKPA 4F0MA 3OVBA 5LSLA 5C24A 4NLWA 3ZZUA 2CAJA 3IN5A 4I4BA 1BY9A 3J81j 1F3FA 3RAMA 3BBCA 2ZD1B 3T9NA 3T6JA 2VOOA 1AXQA 1CPZA 3GFXA 2QMWA 2ACMA 2ATCB 3MMBA 4P71A 4K5RA 1PAUB 1A7GE 2HBQB 3GFZA 1T9XA 3J7YU 3B82A 3QWUA 4QIGA 2MZQA 4DPWA 1U1KA 4LVOP 2WSCC 5E5NA 3BN7A 1AW0A 1SUQA 1UKUA 2VG7B 2MKSA 4HL9A 4PZVA 5A8KB 3NGTA 1PBAA 3VZHA 1RT3A 1GEHA 2NSCA 4D3GA 3GG0A 3GJQB 1S9GA 3KHLA 3BJYA 4PQAA 1G2EA 4OZ3A 4LF6J 4R0EA 5J2MA 3Q2SC 2AZ3A 2DHAA 5IFMA 4V19X 1NK9A 2CPYA 4C8MA 2IDEA 1HR0J 4ED4A 2CDRB 4TN2A 1O51A 1HNIB 4KHPJ 5EWEA 2QG9B 4MYUA 3LP1A 3DGPB 4PWWA 5LMUF 4P74A 1SCJB 2MSSA 2XBPA 5ETOA 2CPXA 3I87A 1C4AA 1TMMA 5KFFA 5LL6d 3GIIA 2AMCB 3CMAS 3CWJA 2FVCA 3EXYA 1YJ7A 3A1YG 4NXMJ 3ENVA 1TKTA 1OYDA 4B9VA 1DY3A 1TELA 2AYGA 3K0JA 4ZN1A 1U2RA 3W3SA 4U9RA 2OPRB 1D8ZA 2GVDA 2F1FA 4QBUA 1RSCA 4Q5VA 5B09A 2F4FA 1P1TA 4EO6A 1FNMA 3GPAA 1NKEA 2G2ZA 2H1YA 3BR8A 3HSGA 1YIJS 2FQQB 4A8SA 1RDRA 4NLYA 3KTQA 3DOLA 2VFVA 1MWYA 4RW7A 5J2PB 3CXCR 2BX6A 2W2NP 2E5LF 4RW8B 3MTKA 2JEGA 4DX8H 2XS2A 3RR8A 1UVJA 4F4WA 2HAIA 2RH3A 2VG6A 3OVAA 4TY9A 2VC1A 1TL4A 4EBCA 3OXFA 2UXDF 4DG1A 1RWWB 1H3DA 1VQ7S 3G82B 4DR6J 4LQ3A 1BC6A 1FWLA 1VS3A 3E01A 1UW4A 2ZM6J 5KT3A 3GIRA 3L7PA 5IC6B 3TEGA 2MKIA 3W62A 4RL1A 2LQJA 4L3NA 2HZAA 2Y8WA 5CZVA 3UN3A 5G4DA 3F56A 2CIMA 1MN7A 3BPSP 2E44A 3JS9A 6FD1A 2UV8A 2MZ1A 2VHGA 2WVDA 1Q5VA 4LREA 1N4LA 3ISND 2HHHJ 1R8PA 3AXMA 3NCPA 1R7IA 2XNQA 2UU9J 2O1PA 1WKLA 1URRA 4F3OA 3BR9A 2CFXA 4NCBA 1J5OA 3EDQB 4RW6A 4BC7A 3C66A 5IZHA 2DR9A 3KK1B 3MM8B 2COLA 3CDAA 1PYSB 1CC8A 2HLUA 2AX1A 1YGYA 3LAMA 4OHYA 2LQBA 5K14A 4I6YA 2R7WA 3HJFA 3PO5A 2CQCA 2YVSA 3UPFA 1N0VC 3ZTQA 1UEKA 2FY1A 1RAJA 2Y1IA 2AJ2A 3C15A 3MCMA 2MLZA 3SV4A 1PAEX 1KWMA 4YR0A 1NHVA 3A3PB 4NYOA 1HYSB 2H48B 5IC4B 3L3CA 2RS2A 3LA0A 2RKIB 3SDEA 4AL7A 2OTJS 1DTQA 4YN3B 4A8YA 4IG0A 2HQDA 2HBYB 4J9UE 1YG0A 5ETQA 4WTOB 2F8MA 4M63A 2WSEC 5DDPC 2EW9A 4XDDA 2KTQA 4O3RA 1KLNA 2YNFB 5BJRA 5JVGQ 5ETPA 5C7PA 1QDUB 1UVLA 1JKHA 4DCJB 3JSMB 1D8YA 2E7WA 1HR0F 4DLEA 5GADU 2AYEA 3IS9A 5A8RB 5IT9Y 1PYTA 1HQUB 5AXKA 4TLQA 2J0SD 3C14A 4GO5X 5KG6A 1RE1B 4DSLA 2L08A 2VD3A 4X66F 2NREA 2R7RA 4JI7F 2MY7A 2W7PA 4RUHA 1YTYA 1FRKA 3OBIA 2MKHA 1DRZA 1FEHA 3NOGA 1GMVA 4G1QB 2BKPA 3MAHA 3N28A 3FJ2A 4DQRA 1RLDA 4PWUA 1HQ2A 2VG5A 3CO9A 1LW2B 4JI8F 2KYXA 3AT1B 2NZCA 3M32B 3SEOA 1RHRB 3M8WA 1UMJA 3LP2A 2IRUA 2XNRA 2CQ3A 1KRPA 3TZYA 2YQ0A 3KLEB 1RBLA 4JI6F 2K8GA 1CVJA 4IFYB 3BQ2A 1CULA 4I7FB 4O3QA 3L7OA 3NGDA 3HHLC 3NL0A 2ZH7A 2J0QD 4OYZA 3NBPA 4J9LA 4B3SJ 1NH7A 2C3MA 3KLFA 2XULA 1Q86T 3G6YA 4USHA 1HHSA 1FF2A 3RBDA 3V6DB 1S6OA 2RD5C 1C0TB 4LF5F 2X7IA 3UFCX 4FF4A 4DV6F 3O1LA 1AUDA 2VC0A 1N5SA 3DYAB 3PCOB 4B3TF 1VQSA 3PEJA 4ZHRA 4KR0B 4F04B 2OMLA 3IRXA 4NMXA 5CD4A 1RAIB 4FNHA 3OL6A 1R3NA 2MHEA 2JSXA 5DS7A 2HBZB 3FMBA 1S5ZA 3GSIA 2FVSA 1J5EJ 2QLWA 2UVVA 2K2PA 4MK9A 1REGX 2R2TA 2IBOA 4USKA 1VIOA 3GJTB 3MMCB 1CJKB 3HK2A 2RQMA 1GFWB 1EHWA 2AGQA 3HULA 1NUEA 3M05A 2DH9A 3GQCA 4ATNA 1YJWS 4DCPB 3ETOA 1DQAA 1RJJA 5D77A 1BD6A 1WSVA 3H90A 2AJQA 4ES1A 1TKXB 4K2JA 2G13A 3HSDA 2R3VA 4K4UA 1DURA 4FZVA 4ZP6A 4UT4A 3KJNB 1Q7YT 2P9EA 4OLOA 3W9IA 4HACB 3VTIA 4DFPA 4PYAA 2DH8A 2WONB 3HMJG 2B3TB 3NWRA 5F8MA 4YB6A 3AB2B 4J9RA 4DR1F 2XMUA 2BJ9A 1WG5A 1S6QA 2N82B 3SFGA 4H4MB 2XSFA 3EWGA 3SSSA 4J7CA 4CP5A 1TAUA 4NZ6A 1VFJA 1Q8LA 4K4VA 3HHLB 1BHNA 3KHHA 1IKWA 4XO0A 4CZCA 4WP3A 1B0VA 5F8JA 1OSCA 2DO0A 1LFWA 1VBXA 3JSBA 5LT5A 4UY8T 2P5VA 2GJIA 2E9TA 2VKZG 3W61A 3OR2B 1VQPS 3Q8UA 2LECA 1N6QA 4CRJA 1OSDA 5ETLA 2HGMA 4F2SA 2APOA 2DHSA 3RTVA 4DQSA 4NA1A 1IUJA 4DL0C 4GKJF 2CDQA 2B4PA 2YKMB 2E1PA 4J5OA 3CJKB 3MM7A 3PYDA 3ILLA 1HWKA 1RT6B 2V8HA 4CLKA 4ZDNA 4ECXA 3CC2S 1IKVB 3D9BA 3GCXP 1GK8A 1FJGF 1MN9A 2F7VA 2BA9A 3UW1A 2R2SA 2O5DA 5EWGA 1S10A 2HHQA 3IWLA 1Z2LA 2UVWA 1NZAA 3BYPA 4CWBA 3DI6A 1H7XA 5IT0A 1B0TA 2Z2LA 2KZMA 1JB0C 1SC3B 3VCDA 2Q66A 2CQGA 3W7BA 4ECTA 4NCGB 4OLPA 1U1NA 2ZITA 2CWKA 2HEKA 1UJ5A 2FHMA 5IT9U 4CO1A 3TAMA 3IM8A 2K3IA 2KXNB 4NZ7A 3WIUA 1UWAA 1H2TZ 2YX4A 4K7QA 1I94J 4FF3A 1S1UA 3CJ5A 1T05A 1XNQF 1PYOB 1EQ0A 2VDHA 5E33A 1S0MA 3I96A 1F9FA 3OTBA 4LF9J 3R6LB 4YOEA 2DCLA 5T7LB 1FKPA 2ATLA 5IQ6A 2C2NA 4M5LA 2FZKB 4DV5J 5HROA 5EX3A 1QE1B 4HHJA 4QW9A 4KO0B 4NX9A 2Y9HA 4CO0A 4YQWA 1H7WA 3MTJA 1XQIA 4KYZA 1PJ5A 4ED1A 2EFQA 4F0KA 1YJNS 3K59A 1RZMA 4KPCA 3DGVA 4K4SA 1JLCA 4C8LA 5L8RC 3DOKB 3A8KA 2PIIA 3AOBA 4C8YA 1IVZA 3VF0B 4BHQA 4F4XA 2VJVA 5AE1A 2N3LA 1O5JA 2C3YA 4MKAA 2XS5A 2CNKB 1DARA 4YFUA 4USJC 4L6V3 1JMTA 1T9TA 5F3TA 2XI2A 4DJBA 5H9FK 3K8VA 3DLBA 1RHKB 1S1TA 5HATA 2V4JA 2UXCF 2JOQA 2JNJA 1IBLF 3IM9A 5KFVA 4YR2A 4WFZA 4QR1A 3UR3C 2K1RB 5IWAJ 1KLMA 1N8RT 4DQQA 3JSYA 2B43A 1S0NA 1KDNA 1FJEB 2EG2A 3J81Y 1FKOA 5BR8F 3M2VA 2YWFA 2D7SA 3FBFA 4NI2B 3K5LA 4OL8A 2R7VA 4ZVGA 2QA4G 3T5KA 5C42B 5A2QY 3M8PB 2BM1A 3U7JA 5KG2A 1E6YB 2CZVC 1U49A 2CPFA 3DC2A 1QVFR 2CPEA 2RDJA 5DQIA 3UDEA 2B4VA 4OZ5A 4JV1A 1HARA 2DR8A 4KFBB 3AODA 3QAEA 3FBEA 2W2OP 3PYFA 3UCGA 3NKYA 2J6TA 3THTA 2N7YA 1Y3KA 3M9MB 2MGZB 3NGUA 4CLYA 3BGRB 3TX8A 2ZJRQ 2FC8A 1HYSA 1Y7PA 2CWXA 4DI6A 3C6UA 1F60B 4NXNF 1S1XA 4RX6A 3DLGB 3M2RA 4HDHA 2QE5A 3DRPB 4RBTA 2DNHA 2BUNA 3VWSA 3KLIA 1HLWA 2QSWA 3QZ8A 3J80Y 4OYPA 2B7BB 1XK8A 1ZM9A 3CT9A 1N32J 1JJ4A 3PW2A 4AL5A 4Y00A 4ZLLA 3N0VA 4Q43A 2ROPA 3S1TA 1RT2B 1UZHA 2BQ3A 1SVDA 1YJVA 2ZUAA 4ID5B 1MU2B 2QLFB 5HANA 2D1CA 4LFCF 3WIVA 2M5YA 4OJHA 4CM2A 4KKOA 3VALA 5HP1B 1H98A 2Z57B 3GYGA 2YWKA 1SJ1A 2GMHA 4DL5A 2RDIA 1M5OC 4ZVTB 1KFSA 4NLQA 1SI9A 4BWJA 1FE0A 1Q16B 1R8CA 1UETA 2B6AB 2ZKTA 5C25B 5G0RA 1T02A 4USUA 3FMWA 4K0KJ 5J1EB 2NXJA 5J1NA 2EXUA 3PRDA 4ZVRB 3GV7B 4DR3J 1EZZB 2N7CA 2WW4A 3SQOP 3T5HA 4Q7AA 5JXSA 4YHHJ 2ZH5A 1VIXA 1WDTA 3RRHA 3OFGA 3FQLA 2BR0A 1NJIT 2BJEA 2YKOA 2XSJB 4A8FA 3TA0A 5KFDA 3T1AA 4FS1A 4IFVB 1FDNA 4Z7YA 7AT1B 3V6HA 4LF8F 1GX5A 1YZ7A 2FVRA 3HFVA 2LQ5A 3SMZA 2ZEJA 1GTEA 2U2FA 1L3TA 4KQZA 2VPYB 2NXNA 3CCES 3KDNA 1AZSA 1NMEB 2HAFA 3ZTPA 3R5JB 2M4MA 2ZZTA 3W2VB 4UOGA 2DXFA 4X65J 2R8JA 1I6JA 4Z7CA 1SH3A 4ZVOB 3ENWA 3FC9A 2DD8S 4ETZA 1VDHA 2DGOA 3VQSA 2J0XA 2JH3A 4C7QA 1RTDB 3H25A 2CPHA 3FNNA 3T19A 3DLKA 3THPA 4EBEA 1Q7LB 3ZZOA 2UUCF 1S6PB 4DSEA 3CJRA 5KG1A 2RE1A 1NK5A 3Q86A 1HQEA 2YPZA 2IY5B 1KQFB 2OO4A 2F40A 1Q53A 4Z2XA 3RUBL 1VJWA 2DNGA 3EDRB 2RUSA 1WKKA 4B3RF 4IDKB 3CCSS 2WTFA 2DGSA 4JV0A 2M70A 3OR1A 2POKA 3PR5B 3KMQA 1NPKA 2HHVA 1WUUA 4HH1A 1S1WA 2DR6A 1YSJA 2RQCA 2I8EA 3NGSA 1XERA 3N4WA 3IG1B 2DISA 2DCUB 1JLAA 3EPGA 1JLEA 5HVFA 4GMKA 2KYZA 4DS4A 2A2DA 3M9OB 1V3ZA 1A0OB 2FJWA 1LWCB 2Q79A 4XPCA 1TL7A 2QEXS 3NCRA 3W9JA 2GJ2A 3SV3A 4Y3CA 4IG3B 4ANEA 4ANCA 5DG9A 5FDLB 4ECWA 4I6WA 2YPYA 3I0SA 4MH8A 4XPEA 3MFIA 2V8VA 3QJPA 4WZMA 2BJDA 3DU5A 3G71S 3DKDA 1S0VA 5A8WA 4IH6A 5F8LA 2QSFA 1XNRF 4XTTA 4NLSA 4FYXB 4Q8FA 1FVQA 1KR4A 4ZIWA 4C4WA 2QZ8A 4A8XA 4CT9A 1HBMB 1TUVA 3JQKA 2IC3B 1FHTA 2ZE2B 1Q78A 4J91A 5L39A 1X4HA 1NKCA 1KSPA 1I51B 4PXCA 4MKYA 4PR6A 1K1QA 4ELUA 1FI4A 3HVWA 4J90A 5F8HA 3AD7C 2N4DA 1N88A 4R8UB 1Y00A 1P6TA 3DFEA 2GO9A 3GV8B 5E3RA 4IRDA 3H4BA 1JX4A 1EKRA 3TARA 2YNIA 1BQNA 3M8YA 1WTBA 1RHUB 3MECB 3MAAB 2DHHA 4PABA 4WFNQ 2OSQA 2YNGA 1S9EA 3LO3A 5LXRA 1HNZF 4WFBQ 2KT2A 5D15A 3P45B 3IWXA 4LFBF 1CJVB 1VQNS 1S0OA 3CCWA 1Q95G 4QQBA 4ANDA 5C2CA 1UTAA 4OI4A 3WX4A 4DR2F 4O4GA 3PTWA 4K4WA 5D8HB 4ECSA 5D4OA 1C0UB 3H59A 4M5KA 1S4FA 2IAJA 3OW2R 4OZ2A 1WG1A 3J7YI 1IKYA 1X4DA 1VQ8S 2HNZA 5KG0A 3M8SA 3BSNA 2Z0GA 2QYGA 1F3VA 4DN0A 4URSA 4CLLA 4I2PB 4YDXA 3FEXB 1VQKS 2GVZA 4UW2A 1UA0A 3GFYA 3IR7B 3ILJA 3EZOA 2X3DA 2LQ9A 2OEKA 1VOMA 1YRUA 2OPSB 1T9YA 3LPYA 2JLEA 3W8PA 5KT5A 2IYIA 1VCTA 3CB4A 2DY1A 2V2VA 2JEIA 3HHLD 2ASYA 4OHZA 4DV0J 2KJVA 1HD0A 2C1EB 4PKDB 2FJVA 3TX0A 3SCKE 2B51A 5LOQA 2HSEB 4ILLA 1IKXA 3G87A 3GIKA 2AIRB 1PKUA 4ZP7A 3HHDA 3W2WB 4NE9C 3Q22A 1TUWA 2ILZA 1U0HB 4KJIA 4OX8A 4HLBA 2QMUB 4FXDA 2ZC4A 2R2RA 5F9LA 4LF4J 2R7OA 1XJWB 1R89A 5HJXA 1CJUA 2PA3A 2OMOA 1X4EA 4CNYA 1UVMA 5DLGA 4FVMA 5E7OB 4NI2A 1BGXT 5KFWA 3JYTA 1P27B 3BBFA 1UA1A 3PFEA 1LWXA 2K7KA 1RYSA 3MWBA 5DQHA 3AJ1A 5E0OA 2XO7A 2YWWA 5ADZA 4M5DA 2V34A 5A0YA 2ILYA 2HMIB 3FDSA 3GJSB 3R2CJ 4ES3A 3HFKA 3R9LA 4B08A 2W9BB 3R1HA 5KFIA 3KK3A 2YNHB 4DV1J 4LSZB 3OHAA 1TV6A 2DHGA 2NR0A 5CYQB 5KOXA 3MCOA 4LBIA 3BEGB 4U67Q 3PW5A 3PYGA 1G7CB 2RQ4A 4QIFA 2P8IA 2KU7A 1IWGA 4F7VA 1ZBTA 4P2MA 3Q2TC 4S0MA 1SKRA 2BDPA 1U02A 2FJAB 2VOPA 2W7OA 2CQDA 2B9EA 2OEMA 4YDDB 5EDWA 2HHPA 2UP1A 1MG7A 2IVMA 5AXLA 5L1JA 1Q8KA 5DETA 4C0HA 3C6TB 1RT5B 4LRDA 2PI5A 4FP9A 4U7UD 4FS2A 5D3GA 1JLGA 2OSRA 4LF7F 4O44B 2B4OA 3BDPA 4GRSA 1RWPB 4K8RA 5E2QA 1KQKA 1FERA 1N36J 4A47A 2F9JA 2WW8A 3T1HF 3HKZD 1MWZA 3MEGA 2DPIA 3RW6A 2ZH8A 3I56S 4P2SA 1ZTTA 2LU1A 4DOZA 4ECZA 2FLOA 1ITPA 4QW8A 4IR9A 1U09A 2RF2A 1RK8A 4DHVA 2YKNB 1FK9B 7FDRA 1NHUA 2HZVA 1N52B 3BF4A 2LYVA 3G96A 4BLGA 5SUHA 4DFJA 1YQHA 4N8OA 1N48A 4P75A 1KC8T 3OPKA 3E8OA 2MJUA 3QNWB 3UNYA 1HNXF 2CZ4A 1WF2A 3J7A1 4NYPA 2K7JA 1B64A 3RBXA 3CMQA 3V4MA 3QMQA 3UDVA 5D0HA 3ZZZA 3UN5A 1HI0P 2GIFA 1UWBB 2UXBJ 5HBMB 1S77D 3VZIA 3QLHB 3KLVA 2P2CB 4EGLA 4J9QA 4JI3J 3Q23A 4ELVA 5KFRA 3O3LA 3MMJA 2X51A 4WP9A 5EGYA 1FKAF 2RT3A 2CPDA 3DDKA 4HHUA 3MM9A 2QO3A 4IH7A 5I42B 1T03A 2MPUA 3J7Z5 2FLNA 3ITHA 1X0PA 3H5YA 2UV8G 1G3OA 1CSJA 4OZJA 4DR4F 4Y2IA 4ZVPB 1SV5A 2NXEA 4ZKAA 5D4LA 5GADI 5LMNF 5B0BA 1JLBA 1IBMJ 1RU2A 4DSFA 3W60A 1WDDA 3GZ7A 1OY6A 2RUGA 4GVBA 2DNZA 4C11A 4LSNA 4F4AA 2VFRA 5DZ7A 1UEUA 1GTHA 2FB0A 4JV2A 3I4HX 3EVWA 2FD2A 3I6PA 5KFKA 1LWEB 2WVCA 4LRCA 1IBKF 1SB6A 3IMQJ 3RRKA 1DLOB 4J9OA 1ZOTA 3KG0A 2FIUA 1HBOB 5KG7A 2DNNA 4OJGA 3MUMP 2FHJA 1WORA 4X64F 1FD8A 4OX9J 5GAEI 2V0NA 4U8YA 3ISNC 5CA5A 5HQMA 1WWHA 4XIUA 4ZVFA 4QIEA 3W8GA 3QO9B 2V4RA 3A3NB 1NK8A 2MKJA 4X4OA 1V5VA 3BKUA 3FFIB 1HPZB 2OPPB 1UAWA 2QX0A 3AA9A 2RRBA 1N34J 4FF2A 4C6AA 1X5TA 3QJLA 4KPYA 4BC9A 1KP6A 4R5PB 3PRBA 4IO1A 4PPDA 2WCXA 3MM6B 2BVZA 1RHJB 2F65A 1OQ6A 1RT4B 1YI2S 3M8ZA 5C24B 2H65B 5J2NA 3I55S 4PQUA 3W66A 3D3BJ 2DRDA 4L72B 3T1YJ 1FO1A 3FSXA 3MMBB 1M0SA 2PEBA 2DBBA 2LA4A 4F2RA 2KFNA 2DTJA 3UWTA 5ETMA 4JB8B 2GIQA 4X62F 3OTOJ 5FJ4A 1SKWA 2UUBF 3FRZA 4KY3A 2L9NA 2OAUA 1CEZA 1SUQB 3R2DJ 4X4UA 4G65A 1B99A 3HSZA 4ZLPA 2ZH4A 1RT3B 2IMOA 2M88A 1AYEA 3A12A 2QLBB 1S9GB 4B9TA 2C2RA 3KG1A 3JAMY 1QAYA 4JOUA 1LFPA 1L3KA 1XWLA 3G2XA 5J2MB 3GWCA 3ET6A 1APSA 4QWAA 4JI4F 1EJ7L 3SZ2A 2HWIA 5IOLA 4DL3A 1U8SA 1IR2A 1OYEA 3BGLA 3EE3A 3LP1B 3L95X 2OUGA 3QATA 1QUPA 1WEZA 2E5GA 1VK8A 2G0IA 3MECA 2W9AA 1VQ9S 3K5NA 2AHOB 3NNCA 2CPIA 5EHHA 3BZQA 5KT4A 2ZVSA 3D2WA 3BGUA 3TJ8A 1KTVA 5KFAA 3E3XA 4E98A 3CPWR 4OYXA 1TKTB 3R5GA 3QIDA 4DV4J 2XLKA 1KHVA 3NS7B 3CD6S 3GCWP 4DX7A 3Q0AA 4I1TA 2XHCA 1V3SA 1WOSA 2I9SA 2GVDB 4TYAA 4AFFA 1KBRA 5HJYA 3TZZA 2JRSA 3BO4A 3WZ0A 2ACYA 1ZYQA 2MKKA 3AHPA 4I67A 5LJ3Y 2CQPA 4UF4A 3ETMA 4ZIVA 3DOLB 2VICA 1VQ4S 4RW7B 3QZ7A 2NCKL 4F67A 1F0XA 2XMAA 1C4CA 5H1SV 3H2LA 3BSOA 1U26A 5T41A 4KT0C 1FDBA 2VG6B 1MWQA 4W92B 4OX6A 4MAKA 1VQYA 4OHVA 4TLRA 4KGMA 2R8IA 1K0TA 4QWEA 4DG1B 1PILA 3A8JA 3IRWP 3MDFA 1WC4A 2IVFB 2DEJA 4KAIA 1S59A 4J9SA 1M1KT 2XMKA 3E01B 3PNIA 1NJYA 5KFUA 1HWJA 5KFMA 3AXKA 2GAHC 5FLXY 3CNQP 4NLVA 5L46A 3BB5A 4ZJLA 2GHVC 3O5TB 3CIZA 1U6ZA 2DIUA 1S49A 1NK0A 5CYMA 2BM0A 2V8PA 5KOWA 4NPOA 2LDIA 1R0AA 4KH0B 3EICA 3DDIA 5HO4A 1ICEB 2EC0A 3K5OA 3KHGA 2BW2A 1TFWA 3LOUA 5E3CA 4JV5F 1TK5A 1J5OB 4FYYB 4RW6B 2HBRB 5E3QA 4UZBA 4CLFA 4Y0FA 3HM9A 3EVMA 1G6BA 4X84A 2NPIA 2BQRA 1T94A 4HI1A 1D09B 4KSEB 1NJXA 5K14B 2CQ1A 2JX2A 2EKNA 2MQ8A 3M8RA 5EUHA 4WIQA 3Q24A 2M7SA 3R7SB 3PR4A 2V9WA 3C15B 1JLFA 4LFAJ 3G6ES 2LP4A 2XY7A 1HBUA 1NSPA 2CNNB 1Q0NA 2YX7A 4F3MA 2BKNA 4ZVHA 3SDEB 1NXIA 1DTQB 2ROGA 3H4DA 2GNKA 4LR9A 4IG0B 2MLYA 3N01A 4F8RA 2EBEA 3C19A 2LXIA 3SCLE 3LANA 1VGYA 1Q8IA 3N5BA 1OWXA 1WJ9A 3K89A 1Z4UA 1NPRA 3PM9A 1JKHB 5J2QA 4Y65A 3IS9B 5AE2A 4OI2A 2J0WA 2GMJA 3HF5A 3R5DA 4WFAQ 2WSFC 2YH0A 2FJBB 3P5TL 3C14B 2PEHA 3US5A 4ZCIA 4A48A 3FZBA 1U1OA 2JLFA 3HHNB 3MPUB 4ZJQA 4J37A 3CF5Q 2QGFB 2MSTA 4OYMA 4NRUA 4JI2F 1ZA1B 4NCAA 3GR0A 3JAMU 2CJXB 3NAIA 1LQ9A 3UDCA 4ZVQB 4AUKA 4B9NA 5B08A 4DN9A 5L9NA 2EFNA 2VG5B 4NZ0A 5K20B 1BUXA 1N56A 3BPDA 2YX1A 1ZPWX 2UVUA 2Q6BA 1AFJA 1UP1A 1DQ8A 4WE1A 2W4CA 4K4TA 3D66A 1RTIA 1AT1B 3FSYA 3GSDA 5L1KA 4CLTA 4DUYF 5M2UA 3JQMA 3QSYB 4MMOA 1DZ5A 2G9OA 1N5TA 1FE4A 1CULB 1VI7A 3Q8YA 4O0IA 1IN0A 1R6VA 3JXOA 2QN6B 3OXGA 2E9ZA 3NBPB 1ZS6A 1WI6A 1HWIA 2Y3YA 1RAGB 3KLFB 3TJ9A 4C3MA 2X1FA 1SL2A 3DXSX 1XMOF 3FZ2A 4TY8A 3PKYA 2W2QP 1AB8A 2H4WB 3RBZA 1HMVA 4LSLA 1RWMB 1RADB 4JI0F 2JDJA 3R8YA 4ZHRB 4LBPA 3OXLA 4CYUA 1Q1KA 3IRXB 3D4JA 2F63A 4N47A 1KOOA 3OFFA 2BJ7A 3OHBA 2AEMA 4DL2A 4QYZK 4CLUA 3CIMA 4OHWA 1O0PA 2GCFA 2H3EB 2Z30B 2VFSA 4JYAF 1U45A 4DV2F 2WZ1A 2E1AA 3HKWA 1N33F 2QRRA 3ZC4A 5KFPA 1IR1A 3VAHA 5SZTA 2BE7D 4JI5J 2O01C 2P9GA 3NXZA 4RNMA 3HVRA 1HIYA 1GT8A 4Y34A 5D0RA 3SI8A 2V2ZA 3IFEA 2H4YB 3WX8A 2QJ3A 2UUAJ 1KVJA 1YRTA 1FRLA 3JB9k 4CO2A 2VQFF 2XWXA 2QFIA 2HS0A 2HKEA 4LF2A 2OIHA 3HCXA 1FJCA 1YHQS 1GXTA 1ZA2B 3HDSA 1SQEA 5GMEA 3F73A 3C46A 3D54A 4H54A 4HTIA 2NSBA 1S6QB 5H9EJ 3M6UA 3TUPA 2JVOA 3KG4A 5I3UA 2BANA 3QIPA 2G2OA 3SBMA 1IKWB 1X5PA 4O3OA 1BWVA 3KNAA 2W1BA 2FGCA 4ELTA 2HHUA 4G1IA 3I9V9 3J7ZT 4IOAQ 2FDNA 3FBBA 2Z4PA 2VU5A 3MD3A 1UFLA 3T3FA 1WOOA 1N6QB 1JIHA 4WU2A 3KLHB 2R4FA 2JZ5A 4DUZF 5F8GA 1YBTA 4ED7A 3QT6A 3MM7B 2PMHA 5HVHA 3BSCA 4HDGA 3HSJA 3PRVA 2NXCA 3DNCA 2R7XA 5KFBA 3CDBA 1ZZFA 3K7RA 4L74A 4KE5A 3EM1A 2MJNA 4IR1A 5D4NA 1TFYA 1I5OB 4ZPWR 1RHQB 2BW7A 5B0CA 2QL7B 4K4ZA 4U7CA 3DI6B 4JI1J 1M5VC 4UZCA 1WF0A 1GMWA 3CJTA 3I4PA 2KHDA 2CJKA 1HA1A 3M8QA 3KYLA 3PYEA 1LK7A 3TAMB 1EETA 1EX8A 1IQZA 2OD6A 1SBRA 3U02A 2CUYA 4H4KC 1S1UB 1T05B 1ZZNA 4E2FB 5I3PA 1VHFA 1XMQF 1T0TV 4EYHB 3SXLA 1NLKL 3POTA 2CG8A 4W4MA 5B0GA 4EI2A 1C1CA 1FKPB 4K4YA 1MLAA 5HROB 2JLGA 4DQIA 2J76E 5KAKA 4LVNP 3MEKA 1WHWA 2ADCA 5GAHU 2AYBA 1VLYA 4FF1A 5IQQA 2MKYA 1RT1A 5KFCA 4YY3J 3LUYA 3D68A 1XTZA 3BGFA 4RNHA 4ZCKA 3MUVP 1GXUA 1NSAA 4HTJA 3CC4S 1JLCB 1Y4ZB 3MOZA 4ZPAA 1N5YA 2GAGC 4B3MJ 2ZJPQ 2D3O1 1NK4A 4C3KA 1CS4A 4LUBA 2AT1B 3MR3A 3ICLA 1U25A 4CH0S 1S1TB 4U8VA 2W9CA 3I5AA 2V4JB 1TVRA 2GHWA 4I68A 4GKKF 1D1UA 4DR7F 4U7UK 3OTCA 1PCAA 2M0GB 4MKBA 3M1VA 4QR2A 5A6WA 1NO8A 4DR5F 3R5CA 1UFKA 5HMWA 1KLMB 2JVRA 1SQFA 5M2RA 4M94A 3X3UA 1SKSA 1ZAXA 5E3PA 2OHDA 1FKOB 7FD1A 1D3WA 1M5SA 4TQSA 2HVDA 3OL8A 3L7UA 1QTMA 1VQ6S 3QRRA 3M2VB 5AJ3J 2YY3A 2CQ4A 2MQLA 4J9MA 2HHWA 2NXUA 2VB6A 4UUWA 2HHSA 3PHTA 2GQCA 4WBFA 3CJ4A 2NUUG 3GTYX 4URGA 1GAOA 3BBBA 4Q2LA 4FVCA 4Y2KA 2PE8A 1P8GA 5BXIA 3O6QA 4QWBA 5DM7Q 1LEOA 1MMDA 4WYWA 2ALZA 4K4XA 1EB0A 2Q3PA 2V2QA 2XMJA 4KV8A 3UE2A 1JXLA 2F9DA 2IFXA 2B9YA 3PX0A 2E1MC 2QTWA 3P4UB 1F5CA 4FXWA 1ZM4A 3QJJA 3IXQA 3M2UA 2HWHA 1FXRA 3V4IA 2HS4A 1IM4A 3CCQS 1XIQA 2WOMA 1NU4A 1FRHA 3CVKA 3C6UB 3B4DA 1S1XB 3FEZA 5LSOA 3M2RB 1X5SA 3CCMS 4C0OC 1ZETA 1M1GA 2CYYA 4HI2A 3KLIB 2GX8A 3O2IA 3MMAA 2PO4A 4HKQA 3SCIE 4CCHA 4GVLA 2W4PA 1WD6A 3NMRA 1S1VA 1R0BG 4LRAA 1PC4A 4O3SA 4YB1P 3KKFA 2WBMA 4RWWA 4LF6F 4IQMA 5HSPA 4P9SA 3TAPA 4X4RA 2F8HA 1RABB 4MYTA 4F0HA 3AJDA 1SKUB 1VLOA 2EVZA 4KHPF 4KKOB 1HNWJ 2CA9A 4RLEA 3TZXA 1NBEB 3W5YA 4C97A 3NG8A 1TMJA 4DLGA 1DTTA 4QR0A 2B5JA 4M95A 2VV5A 3SSRA 1YJTA 4RR5A 1WSRA 3HZEA 4RNNA 3Q8PB 4L76A 3DMJA 5G0RB 1L3UA 4DV7J 2J6UA 4NXMF 2H9ZA 4ZVEA 2BE2A 1DFDA 3I5CA 3BDEA 2RSQA 2AJ4A 2XMTA 2FYXA 2KFYA 5EN1A 3BKTA 4B3OA 1Q82T 9RUBA 2VASA 3GLJA 3R6GB 1JNZB 2HFUA 4PYDA 4OJ3A 1NSQA 2JC1A 2KT5A 1Y0HA 5HN0A 2KH9A 1R27B 4KTQA 2CJ9A 2PA8D 3NCQA 4Y2AA 3CSKA 2OJ3A 1Q8BA 1W7WA 2DKOB 4MFBA 1RLCL 3I31A 1AZSB 3IWNC 3P3DA 2XMWA 2IYGA 3VGVA 1VR6A 5KT6A 2F4VJ 1KVKA 3D67A 4CLZA 2HYIB 3JTPA 4A8WA 1FTRA 4CIOA 2P6SA 2GC8A 2IJNA 1PJ6A 3DLKB 4IKAA 3GIJA 4DR6F 2NPFA 3D6MB 4RNOA 3OD2A 2ZM6F 3MEDA 1RKJA 2AU0A 3QT8A 1KNZA 2VFUA 1HHTP 1HQEB 2IJFA 1HI1A 2LXFA 2V9KA 2AQ4A 2IRYA 3GYNA 3P5BP 2XHWA 5AJ3F 2VKRA 4ZLJA 2HHHF 2UU9F 1UVNA 3VAIA 3OR1B 2KZZA 3NAHA 3R7BB 1S97A 3EMTA 2M8DB 3MPWA 3QT5A 4BS2A 1S1WB 4FN5A 2DXDA 2J6SA 3NGRA 4KHMA 4UOCA 2DK2A 2QT7A 2B4UA 1JLAB 4NYZA 4HR2A 4O3PA 5THWA 1JLEB 4AQYJ 5HQLA 2Y1JA 2ZBRA 4NLUA 3AAWB 1KKHA 2KHCA 1GMUA 2R7UA 1TL7B 1VRUA 4USMA 2YKAA 2Q6CA 1N0UA 2XY5A 5D0GA 3LGMA 4ZVUB 2ZOFA 2VPXB 1TL3A 9ATCB 1SPBP 5HMXA 4YR3A 3BO3A 4FPRA 1RQ0A 3DRSA 2E5IA 4V1Ak 3V81A 5LJ5Y 1TP7A 5HVGA 5KFGA 2HK2A 4YP3A 1K44A 1EARA 1WKJA 2W2MP 3VAFA 2X1BA 4V19J 2HS3A 3I0SB 4QPTA 1FA0A 3MR5A 3DLJA 5A8WB 2V5HG 2AGPA 1U4BA 5L1IA 2IM0A 4OYAA 2VQEJ 4NASA 3G86A 3OT9A 3M7VA 4ITSA 3MOJB 3ZZPA 4NEYA 5B0EA 4AD6A 2W8KA 1XN9A 3LF0A 3Q8SB 3KLHA 2MQOA 3AD9C 1FXLA 3VV2B 5I3QA 3QGPA 1VC0A 3VHQA 3BM7A 3W5XA 5F3ZA 2JFDA 2XTJP 4R25A 2KI2A 5DLFA 2YNIB 1BQNB 5K8NA 1AUSL 1UVIA 1ZTWA 3H40A 5LM7E 2DB1A 2YNGB 1S9EB 4ZVSB 2W4DA 4M5IA 2ZC3A 1ULRA 2CQIA 2WAQD 4K2XA 1V9OA 1BXNA 5DO2A 2M3DA 4MK7A 4WF9Q 5HLFA 3LWLA 3NS6A 4DF4A 3OL7A 4O4GB 3HHKA 1Y3JA 2YKQA 1EP4A 3RB4A 3HD1A 2IAJB 3PHEA 2AJ1A 4J9VA 2B8QA 4WCEQ 2HNDA 2DNOA 1IKYB 3PX4A 4N76A 2HNZB 2DGXA 2C42A 1RTJA 4PCQA 4UUXA 1VBYA 2AZ1A 1CC7A 3NY0A 1B3TA 4EO8A 2GVZB 3OSNA 2RNEA 4C8ZA 3I0RA 4PWDA 2CZ9A 4LF1A 3N6NA 4N7TA 1QY7A 1ZAWA 4B3SF 3M30A 4H4OA 3R97A 3RJMB 2YH1A 1RWXB 2MTLA 1H73A 1NKBA 3FK4A 3H5UA 4GO7X 1KN6A 1U0SA 4IOCQ 4A4JA 2KG0A 3QGGA 2HIYA 2GS8A 2JL9A 1QJHA 4TU7A 3MCNA 4UY85 1WI8A 1JLQA 2CPJA 1IKXB 1FWPA 1X4CA 3I82A 1T7PA 5CHCB 1HHQA 2G2YA 1TQLA 2PSZA 1J5EF 1D9AA 1LXNA 4M5NA 4KH1B 3MR6A 3OUYA 3TZWA 2E5JA 4FYWB 3FCVA 3ZZYA 2ZHAA 3QYYA 2LKZA 2B0GA 3RB0A 3UDLA 2E5LJ 1FX4A 1WC0A 4C2MA 3WBZA 2B56A 1CJUB 3GG1A 3G8TA 2XG8A 2PI4A 3JYTB 2B9WA 1YWXA 1VK3A 1UL3A 2UXDJ 2RMLA 3TOQA 3KMSA 3I5BA 1RBAA 4U95A 2CNOB 4WTYA 2K06A 2IA6A 2OPQA 4RWXA 2VONA 2FZGB 2HG4A 1V3RA 4M5DB 5A0YB 1O8BA 3OTDA 4RW4A 2D3UA 5KG5A 1HWLA 3KK3B 1E6VA 1RKIA 4M8LA 1YJ9S 4MKVA 1T3NA 2BZ2A 1TV6B 4DWIA 1XR6A 5ETNA 5DRKA 5U47A 1W25A 1X9SA 3SQGA 4KHRA 3BV8A 3AFGA 1JJHA 3MM5A 2RVJA 3N6LA 1M5KC 4MIBA 1I3OB 3VAGA 2SXLA 3NLCA 2DJWA 3V6JA 2ZDOA 1IQTA 3PJ9A 1QM9A 1RTHA 5CH7B 3T5LA 4WK1A 1NB7A 2FTRA 2HPUA 3DRYA 5D3GB 3IAS9 1HL6A 1CBKA 1JLGB 1U7LA 2JEFA 1T9VA 4DX5A 2MYFA 4TNOA 1UVKA 4URQU 3CW2C 8ATCB 2LEPA 3MEGB 5L38A 2ZUGA 2GZOA 2VIHA 1NM2A 2XYPB 2F8EX 4KIAA 2V2KA 2RF2B 3H42A 3BH6B 2V94A 1L3SA 3IP0A 4RU2A 1U1MA 4N8NA 1WEXA 2NLWA 1SC1B 3U1MA 5KFTA 5KT2A 2LCWA 3PG9A 1LWFA 2L3MA 4NLPA 3KLGA 4P7VA 2E5HA 1BQMA 1MROA 5KFZA 2RB7A 4CLWA 2EK6A 4DU7A 2VH7A 5FIIA 2QC3A 2MQPA 1I94F 1RAOA 4KRWA 2DR7A 3F41A 4Q8EA 2O66A 3P6YC 4RJVA 4WZQA 1X31C 4FXVA 4LF9F 4L3KA 1C2PA 3G8QA 4NLDA 4P6QA 4N41A 2NUHA 2OI2A 1S57A 4DV5F 3PJWA 3TQEA 3MM9B 4X66J 1HFEL 4MT1A 3ZTOA 4JI7J 1NCLA 4PG6A 3OJSA 5IXUA 3FQKA 1T03B 2E1CA 2HFNA 4C8NA 3Q8QB 1AFIA 4C3LA 4F3QA 1TL1A 1PC5A 2ZZMA 3ITHB 5JMNA 2FVQA 3TAQA 1UPMB 3GE9A 5DZ6A 2I5JA 3HHEA 3PW4A 1LK5A 3TA2A 2LVWA 4ALZA 1SV5B 2AV5A 2FY8A 1U1PA 1BLUA 2HNYA 2HRYA 4PUOA 1JLBB 5KFHA 4ZITA 4JI8J 4AYBD 1KOHA 1T11A 3QT7A 1TK8A 5ETVA 2IM2A 4GVBB 4C11B 3EGVA 3KDOA 3DLEA 2F5GA 4LSNB 3IR6B 5K8PA 2LU2A 3H2UB 4NA3A 2XGQA 4UTGA 2VPZB 4ZP8A 4CT8A 4NOHA 3RZAA 1Y5IB 4AT1B 1IM6A 4DZ6A 4TVAB 4JI6J 4W90B 1I1GA 2CNLB 4X4VA 4IUFA 3ZNUA 5HQ8A 3DM2A 2ZVIA 2VBYA 5IWAF 1K73T 2MZRA 1F2GA 1REVA 3C8YA 5CABA 1T95A 5B0AA 2OH2A 2BE9B 1WOPA 4TKTA 3T41A 2Y0BB 3ISZA 2IMWP 3EJMA 5GMDA 1HNVA 1RAHB 1TKZA 4K50A 2GGPA 3OL9A 1IWAA 4LF5J 3AQPA 2GMLA 4DV6J 1Y11A 1R6YA 5IV4A 4B3TJ 3OFHA 4FKYA 3MAQA 3T9ZA 2ERRA 3AH6A 3FUYA 1G4CA 3SSQA 3HVTA 1PG5B 1C1BA 4ECQA 4DX6A 2RILA 3RU0A 5J2NB 5D0EA 2GJFA 4PQUB 3ELHA 5IS2A 4ICLA 3K8WA 1B0PA 1W26A 3ENAA 4TYBA 2IPOB 2Z8QA 3DOMA 2ASJA 2IM1A 2J9CA 1ZAVA 4WK3A 3ZZRA 2VBWA 4F26A 2W8LA 3W5ZA 1RHMB 4ECYA 1TKDA 2R2UA 1F9HA 3K57A 4ED5A 3TNVA 1N32F 3D3CJ 2O67A 5DG7A 2R9LA 4ZJOA 4FYVB 1NJZA 4DDFA 4L73A 1HBNA 4Q0BA 4F36A 2XI3A 4I69A 4HYKA 2L9DA 4USVA 3KK2A 3C3LA 4DR1J 1B70B 3SYZA 4OI3A 5DJBA 1RT7A 1MMLA 1FT8A 3ET6B 2PFFB 6FDRA 3CCTA 2QV6A 1GQEA 3WHIA 2Z2YB 2CVEA 2D69A 4DPYA 1FESA 1S99A 1OPZA 4K0KF 1YRXA 4EUVA 3W1YC 2VL1A 3PVXA 4DR3F 2H5EA 1NAQA 3CJ3A 1T9UA 2DGVA 3KUGA 3LH2S 4YHHF 4CLSA 4O3NA 3MURP 1VRTA 3MPVA 4GKJJ 3H2VE 3M9NB 2QL5B 2AKWB 1TTHB 2IJRA 3LGNA 5K5MA 1LKZA 4XAKA 2CJBA 5KFQA 2J9DA 3HT3A 3HX9A 1FJGJ 3OSPA 5I4MA 1W2BR 3WQPA 2E7VA 4WKRA 3OV7A 5ETSA 3MD1A 5CXTA 3EYZA 2I38A 5IT4A 2M2BA 1RBOB 2BMBA 1RUSA 5GAEU 1TZ0A 4X65F 3CE8A 3KJVA 4EFAC 1H2VZ 1NZ8A 2PDAA 2C2KB 1GH8A 1X9MA 2ASDA 1XNQJ 2WK4A 2DPJA 1IXKA 2GV1A 5IM0A 1U1RA 1XMBA 3L9ZA 1MW7A 1RA7A 1SJRA 3FVYA 2UUTA 3R7NB 2V8DA 2PD1A 2RIJA 3CMES 2M52A 5F0WA 2M9KA 3GILA 2EFPA 3E51A 1CJTA 5RUBA 2ZJQQ 1Z2ZA 3WC2A 1RP5A 1EIYB 1YLXA 3HT0A 1K8AT 1D0EA 1FVSA 2L48A 1LW0A 1BE4A 1QSYA 2XEXA 4O0NA 3IR5B 1UJ4A 1OMSA 2KM8C 1VQ5S 3UVJA 4KGZB 2IVYA 2C2OB 5CYMB 1X5OA 4OYIA 5B0DA 1R0AB 2AGOA 3CD5A 4XK8C 1TL5A 1JQGA 4J9PA 4RKUC 3U1LA 3V6KA 2FJEB 3GP9A 4ENOA 3EGNA 1BQXA 1YVFA 2HQGA 4UQTA 1U1LA 2BACA 1PSDA 4TXSA 3RAXA 5GAHI 3VR1A 2UXCJ 4K59A 3DRRA 1IBLJ 2MB0B 1OIAA 4I2QA 4F4KA 3K2YA 2HIQA 1R8HA 1BMQB 3ONQA 4QYZJ 4DSIA 4RUBA 5BR8J 1NDLA 1A9NB 3S01A 4KB7A 2N3OA 1RCOB 4GC7A 1TU0B 1JLFB 4R0JA 4C8KA 1ROFA 4U6PA 1HBUB 4EBDA 4DL7A 4NL5A 3RG6A 4HT5A 1YJRA 4CTAA 4Q44A 1EKSA 1Q5YA 2J7KA 3CO0P 4ZPBA 4O23A 4QYRA 3B6BA 2VA2A 2PMZD 3IBCB 3PXGa 3LP0A 3PZPA 1FRMA 3TQ1A 1ACMB 2R42A 1RGVA 4DBQA 2QLJB 3AA8A 3HP6A 4K5SA 2H5JB 2ZH1A 4NEZA 5D4PA 1U48A 1U6FA 4EYIB 1FXDA 2MQNA 4DPUA 2ZD1A 4OQJA 1KD1T 3HJVA 5HAOA 2C3OA 2NYIA 1SQGA 5J2QB 1VQLS 1UEVA 2DITA 2KVIA 2I0XA 4FKXA 1L5UA 1RWOB 2D9PA 4HEA9 4TU9A 4C0BA 4Y2CA 5KFSA 2YQ3A 1R8BA 2HW3A 2LA6A 4NXNJ 2FGOA 1FNXH 3DXBA 2KN4A 1IJEB 2DEIA 5HMZA 2AP6A 1Y5LB 2KM8B 2VG7A 3HZGA 3MR7A 2XY6A 3NRBA 1F5AA 2WVEA 5A8KA 1YBAA 2I2YA 4DSJA 2D3ZA 2RQKA 3UCZP 3KNGA 3VGTA 2MY8A 1FCAA 4DV3J 2XM3A 1FFGB 2UVRA 3IO1A 3TVYA 4YMEA 4ECUA 2DY9A 3NNHA 4LJMA 2GFFA 3OVSA 1K47A 4J9NA 2BJ3A 2EFOA 4LFCJ 2QA1A 3CDWA 1HNIA 4A8MP 5GAGU 4WE1B 3DGPA 3I32A 1GX6A 1RTIB 1WTFA 2KO1A 3H7HB 3BO2A 3MEEB 3BN4A 2B7CB 1FRIA 1S12A 3S7RA 4WWSA 5BYSA 2A10A 3V5RA 3D5MA 4ID8A 3RAQA 1LNQA 2R7SA 3EGZA 5KG4A 1SC4B 1WC6A 3M4XA 1QLNA 3GV5B 1QVGR 1FD2A 4X4QA 1QAXA 3QGIA 4DV0F 3TR5A 2OPRA 1Q79A 4RBUA 2AWZA 3Q8RB 4TY8B 1PGZA 2OKQA 3PJXA 2KXHA 2EBGA 2HFZA 4DL4A 5L1LA 1HMVB 4LSLB 1ZM2A 2CJAA 3ILIA 1DHMA 2DGUA 3TUIC 3W9HA 1NDPA 2CQHA 4QZVB 4LF8J 2OTLS 4CYUB 4PPZA 4RBVA 3A8IA 2BYCA 1UW9A 4DF8A 3ZTSA 3X1LB 2CJYB 2NYHA 2RHSB 5J2PA 2VA3A 4OJ1A 4DFKA 4LF4F 4RW8A 4P73A 4NLGA 4ED0A 3RB6A 3TO8A 3AB4B 3OFEA 3J7AN 1XC9A 3QAUA 2E29A 1R8AA 2A3JA 1WF1A 3C16B 3H5SA 4IQXA 1QTNB 2ZBQA 4WJBA 3OJUA
chains in the Genus database with same CATH topology
5CABA 2HVEA 1LWXA 1ZS6A 3VGUA 1NHKL 1KDNA 4EK2A 3ZTQA 3Q89A 2DXEA 1S59A 3WX8A 1B4SA 1VYAA 4W98A 1HLWA 1NDCA 3ZTOA 2HVDA 3Q86A 1NCLA 3L7UA 1PAEX 3EJMA 3FBFA 1NDLA 3R9LA 4ANEA 3BH6B 4ANCA 3PRVA 3VVUA 1NSPA 3ZTRA 1XQIA 1B99A 3NGTA 1U8WA 1MN9A 1K44A 2DYAA 1WKJA 2HURA 4ANDA 3VGTA 3EM1A 1UCNA 3FCWA 1BE4A 4WBFA 1NSQA 4F36A 4C6AA 3B54A 4KPCA 3Q83A 1NB2A 4O0NA 2ZUAA 1MN7A 1WKKA 2B8PA 5CAAA 3B6BA 3BBBA 4FKYA 3JS9A 3DKDA 4S0MA 1NDPA 2DY9A 1PKUA 3GPAA 5BXIA 1BUXA 4DUTA 3EICA 3FKBA 1HHQA 1S5ZA 1F6TA 4UOFA 3DDIA 1LEOA 1NSKL 3MPDA 2AZ3A 4CP5A 3G2XA 1NPKA 1W7WA 3BH7B 4F4AA 3ZTSA 2B8QA 1WKLA 1BHNA 3ETMA 2CWKA 3PJ9A 3EMTA 3FBEA 3ZTPA 2BX6A 5IOLA 3EVWA 2NCKL 3VGVA 4UOGA 2DXFA 5C7PA 3FCVA 1JXVA 3EVOA 3EE3A 2DXDA 3GP9A 1F3FA 3VVTA 4ENOA 3NGRA 3FC9A 3NGSA 1EHWA 3BBCA 2AZ1A 1NDKA 3ELHA 3EVMA 4DZ6A 1NUEA 3NGUA 4UOHA 4HR2A 3VGSA 2BEFA 3ENAA 3FBCA 1XIQA 3FBBA 3Q8VA 3Q8YA 4FKXA 1NLKL 3Q8UA 3BBFA 2VU5A 1HIYA 4DI6A 1S57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CAB A;  2HVE A;  1LWX A;  1ZS6 A;  3VGU A;  1NHK L;  1KDN A;  4EK2 A;  3ZTQ A;  3Q89 A;  2DXE A;  1S59 A;  3WX8 A;  1B4S A;  1VYA A;  4W98 A;  1HLW A;  1NDC A;  3ZTO A;  2HVD A;  3Q86 A;  1NCL A;  3L7U A;  1PAE X;  3EJM A;  3FBF A;  1NDL A;  3R9L A;  4ANE A;  3BH6 B;  4ANC A;  3PRV A;  3VVU A;  1NSP A;  3ZTR A;  1XQI A;  1B99 A;  3NGT A;  1U8W A;  1MN9 A;  1K44 A;  2DYA A;  1WKJ A;  2HUR A;  4AND A;  3VGT A;  3EM1 A;  1UCN A;  3FCW A;  1BE4 A;  4WBF A;  1NSQ A;  4F36 A;  4C6A A;  3B54 A;  4KPC A;  3Q83 A;  1NB2 A;  4O0N A;  2ZUA A;  1MN7 A;  1WKK A;  2B8P A;  5CAA A;  3B6B A;  3BBB A;  4FKY A;  3JS9 A;  3DKD A;  4S0M A;  1NDP A;  2DY9 A;  1PKU A;  3GPA A;  5BXI A;  1BUX A;  4DUT A;  3EIC A;  3FKB A;  1HHQ A;  1S5Z A;  1F6T A;  4UOF A;  3DDI A;  1LEO A;  1NSK L;  3MPD A;  2AZ3 A;  4CP5 A;  3G2X A;  1NPK A;  1W7W A;  3BH7 B;  4F4A A;  3ZTS A;  2B8Q A;  1WKL A;  1BHN A;  3ETM A;  2CWK A;  3PJ9 A;  3EMT A;  3FBE A;  3ZTP A;  2BX6 A;  5IOL A;  3EVW A;  2NCK L;  3VGV A;  4UOG A;  2DXF A;  5C7P A;  3FCV A;  1JXV A;  3EVO A;  3EE3 A;  2DXD A;  3GP9 A;  1F3F A;  3VVT A;  4ENO A;  3NGR A;  3FC9 A;  3NGS A;  1EHW A;  3BBC A;  2AZ1 A;  1NDK A;  3ELH A;  3EVM A;  4DZ6 A;  1NUE A;  3NGU A;  4UOH A;  4HR2 A;  3VGS A;  2BEF A;  3ENA A;  3FBC A;  1XIQ A;  3FBB A;  3Q8V A;  3Q8Y A;  4FKX A;  1NLK L;  3Q8U A;  3BBF A;  2VU5 A;  1HIY A;  4DI6 A;  1S57 A; 
#chains in the Genus database with same CATH topology
 3G82 A;  4A46 A;  4DS5 A;  2MDA A;  1H6K X;  2AW0 A;  1VYA A;  2CJQ A;  2BKO A;  4YB7 A;  3ZZT A;  2UUC J;  4DV1 F;  2CAD A;  4CO3 A;  1ZPV A;  5H9E K;  3N79 A;  4ZA1 A;  2PGC A;  4USW A;  1QAI A;  3I9Z A;  1RWV B;  3F0N A;  2ZWP A;  4Q2M A;  2HRT A;  2IHR 1;  4X4P A;  3GYX B;  2C3P A;  3UD3 P;  2GQQ A;  4B3R J;  1MNE A;  4M5M A;  2Z56 B;  3V2U C;  2CG4 A;  5I3U B;  2HQ3 A;  2BAN B;  3QIP B;  1W2I A;  1OS5 A;  5E3A A;  3KK1 A;  3MM8 A;  4H4K A;  4N56 A;  2V68 A;  1N36 F;  3CCR S;  3CCL S;  4AE5 A;  3PO4 A;  1KHW A;  3VAK A;  4FBT A;  4NRT A;  4ZCM A;  2F3J A;  3D0I E;  4BWM A;  2HVE A;  4P72 A;  3ADA C;  2NS1 B;  4ER8 A;  3E2E A;  1F2H A;  4DPX A;  4TQR A;  1H74 A;  4DQP A;  3NS5 A;  2C2E A;  3G4S S;  1HW8 A;  3LQV A;  2IM3 A;  2DVI A;  5DQG A;  3D1O A;  4RW9 B;  1U8W A;  4DZD A;  2JEJ A;  3H5X A;  1NK7 A;  3UD5 A;  1M5H A;  2D9O A;  2XMV A;  3DN9 A;  1QSL A;  2RKI A;  3KJF B;  2G4B A;  1KVI A;  4FNI A;  3H8Y A;  1ZH5 A;  5AXM A;  1S6U A;  2FHJ D;  4IYQ A;  4QU7 A;  2G1D A;  2DHX A;  3F44 A;  1XNR J;  3AD8 C;  1IR0 A;  2YNF A;  4DV3 F;  4QOT A;  3CTR A;  3NEK A;  4P10 A;  2QA2 A;  2ZBP A;  2UXB F;  1YKW A;  3BRE A;  3M8Q B;  5F8I A;  2RU3 A;  1EET B;  3JSM A;  2ZNY A;  1ZM3 A;  1VJQ A;  2XCA A;  3PY8 A;  4RUC A;  3A3O B;  2U1A A;  5A8R A;  1F9E B;  1WEL A;  4JI3 F;  1HQU A;  3TA1 A;  1FFS B;  3A8E A;  2Y8Y A;  1NPP A;  3NOC A;  3R3T A;  1WC1 A;  2PT0 A;  2OEJ A;  3NGK A;  3POT B;  1S7H A;  1V6H A;  4ILR A;  2IBK A;  1GXL A;  1C1C B;  5T14 A;  2BBE A;  3UI3 A;  4RPF A;  2VZ9 A;  2EC2 A;  3R27 A;  4LQ9 A;  2BAB A;  4GC6 A;  2ZH9 A;  4PXE A;  2HVH A;  2KRB A;  4G1Q A;  2FUG 9;  2ZNZ A;  3ZTR A;  2ZZN A;  4KGX B;  4P2X A;  1HNZ J;  2VOD A;  4LFB J;  1N54 B;  2QFJ A;  1RT1 B;  1TK0 A;  5DGA A;  4QJV A;  1IBM F;  2BOP A;  4DR2 J;  1LW2 A;  2GQ2 A;  2HLT A;  2QLX A;  3RW7 A;  4CO5 A;  1Y5N B;  5HI7 A;  4NA2 A;  3M32 A;  2KT3 A;  1YX2 A;  1N5Y B;  4MIW A;  5GVQ A;  3JQJ A;  1NND A;  3AOC A;  4NLR A;  2LLZ A;  3TVZ A;  1CS4 B;  3KLE A;  4G1P A;  2YBV A;  1JXV A;  1OQ3 A;  2R7Q A;  5DM6 Q;  1QD1 A;  4IFY A;  5BYQ A;  5EWF A;  4I7F A;  4ZP9 A;  4MK8 A;  4UOH A;  4OX9 F;  2GO8 A;  1RAA B;  1X9W A;  2W9C B;  1S76 D;  4QCL A;  3AQO A;  1H0H B;  1TVR B;  2J8S A;  2EFV A;  3M1V B;  5D78 A;  2C28 A;  1H38 A;  3LAK A;  4WFY A;  3BSA A;  3V6D A;  3O8W A;  1R43 A;  1WNE A;  1C0T A;  4MIA A;  3AY0 A;  2H5I B;  1N34 F;  1U24 A;  3THV A;  1S7I A;  3KXD A;  3DHX A;  3DYA A;  3EX7 B;  1R31 A;  2HQF A;  2X1G A;  2BJ8 A;  4XDC A;  1RAF B;  3FEY B;  4D3H A;  1SJQ A;  3DRX A;  3EZU A;  1FWK A;  4PAA A;  3PAC A;  3MPD A;  2VUG A;  2VF3 A;  4JUZ A;  2XYH B;  4ZK7 M;  3HD2 A;  4FYD A;  3MMC A;  2AX0 A;  1CJK A;  3HO1 A;  3QGH A;  3CUL A;  4CNZ A;  2JWN A;  3GFH A;  3H98 A;  1VMB A;  4E8U A;  1SC6 A;  4KV8 B;  5AE3 A;  3HLU A;  5KFL A;  3T1Y F;  1NK6 A;  3M2U B;  2VPW B;  3IC1 A;  3RB3 A;  3V4I B;  2AF6 A;  3OTO F;  3EUN A;  1TKX A;  2PFD A;  2WOM B;  4B9U A;  2G0C A;  3CJ0 A;  3VGU A;  1NHK L;  3MFH A;  1WG4 A;  4WYL A;  2PMW A;  4WXW A;  3TW0 A;  2W2P P;  3J81 U;  1OO0 B;  5C5J A;  4W98 A;  1FDD A;  4HAC A;  3O44 A;  1Q4R A;  3SFU A;  3MMA B;  4C98 A;  3RRG A;  1SL1 A;  4RU9 A;  2WON A;  2YXL A;  5A2Q U;  4KGK A;  2KDO A;  2HZC A;  1P9Y A;  1S1V B;  2HUR A;  4LRF A;  3D1H A;  3BQ1 A;  1U2C A;  2HQC A;  4CH1 A;  3TUJ C;  4PRF A;  2B8P A;  4DU8 A;  2A6M A;  1ARO P;  2BOA A;  4WP8 A;  2NZ4 A;  3KWM A;  1HKA A;  4H4M A;  5KFY A;  2CVI A;  2Z2M A;  4NML A;  4CM0 A;  2V63 A;  4DEZ A;  2NQP A;  4UOF A;  2DRB A;  3HHL A;  1FRJ A;  5E41 A;  3H0P A;  5J1P A;  2A6O A;  2QL9 B;  3NNA A;  4LMZ A;  1TUG B;  2RHQ B;  2W01 A;  1KEK A;  5F8N A;  2E7X A;  4N5S A;  4EWT A;  2Z58 B;  1AA1 B;  3WDO A;  3HXM A;  5IV3 A;  4X2B A;  4OV6 A;  1DTT B;  1H72 C;  2B5J B;  2HWT A;  2MMY A;  2Q1L A;  5DDR C;  4LF7 J;  3G9C A;  4IRC A;  2MHN A;  2ABY A;  3OR2 A;  3DMJ B;  1FFW B;  1SJF A;  3T1H J;  2IRX A;  4OMF G;  2FC9 A;  2C2M B;  4C48 A;  2YKM A;  4ED6 A;  3C2P A;  2BE2 B;  3CJK A;  4DV4 F;  5JJB A;  1RT6 A;  3BYR A;  1VHI A;  1JXE A;  1YK9 A;  4M1K A;  2ZH6 A;  2HFO A;  3UR0 A;  3J80 U;  1IKV A;  4DPT A;  4OV1 A;  4RUA A;  2DYA A;  4FDF A;  4B3O B;  2MEW A;  2B9X A;  3TP2 A;  1DQ9 A;  1SJ4 P;  1UCN A;  2PC6 A;  3TAN A;  5KFX A;  3BQ0 A;  2YTC A;  4ES2 A;  3CUN A;  3MI7 X;  3MEE A;  2RAQ A;  1KQG B;  5JVH Q;  4ZPT R;  4NCG A;  2ZOM A;  1HNX J;  3HPO A;  8RUC A;  1FJ7 A;  2V67 A;  2XZW A;  3NWG A;  3CCU S;  4MFB B;  4QIW D;  1S9F A;  1URN A;  1NRK A;  1X8D A;  5B7W A;  1FDA A;  2EWH A;  3OLB A;  1OY8 A;  1FNO A;  4BBY A;  3TEH B;  2J7U A;  2Z2Z A;  1SJ3 P;  2ZH3 A;  1IJF B;  3MXH P;  2V6A A;  3GU0 A;  2I1R A;  2P6T A;  3RYL A;  5T7L A;  1NJW A;  2VBZ A;  2D41 A;  4F50 A;  1QE1 A;  2KVQ E;  4Q45 A;  1UJ6 A;  4ZPC A;  1B4S A;  4EEY A;  3MED B;  4KO0 A;  1M1H A;  1DBD A;  4HHH A;  5GMK a;  4BDP A;  1WHV A;  2LQ8 A;  2DR5 A;  1X4B A;  3PDN A;  2KB2 A;  3QQC D;  4DR4 J;  3D1Q A;  2BV3 A;  2OGU A;  3GIM A;  3Q83 A;  1OY9 A;  3PIP Q;  3GJR B;  4NLO A;  2DNM A;  3TWZ A;  5LMN J;  3DOK A;  1UZD A;  2DH7 A;  3HVA A;  2DO4 A;  3W63 A;  4B02 A;  3KHR A;  3C16 A;  2BQU A;  3B78 A;  1X7V A;  4DL6 A;  4RNF A;  1S48 A;  4CO4 A;  2UZA A;  4I0W A;  2X3G A;  1M5P C;  2VBX A;  1IBK J;  3JTN A;  2XMM A;  3GON A;  2I6W A;  2WBR A;  1X0F A;  3QBC A;  3KJQ B;  3A13 A;  5KTQ A;  4X64 J;  2K1R A;  1X4F A;  4JP8 A;  4M5H A;  1D9D A;  1VRU B;  5CQG A;  5H9F J;  4YUD A;  1XEZ A;  1VC5 A;  3M6V A;  3ILO A;  4QWD A;  3UQS A;  2CQB A;  4LFA F;  2ALY B;  1SXL A;  1TL3 B;  5C42 A;  3U27 A;  2HFV A;  4F4Z A;  3M8P A;  3DRS B;  3V81 B;  1E6Y A;  1G1X A;  1YZ6 A;  2KXF A;  4E0D A;  4OI1 A;  3D7S B;  2WRM A;  3D0G E;  1ELO A;  2YWE A;  2DIV A;  4IH5 A;  5F41 A;  2FLL A;  1H2U X;  2KJW A;  3S6E A;  4ZLN A;  1KTQ A;  5F0U A;  4KFB A;  1VBK A;  2GW8 A;  4OYO A;  4M5J A;  1VRQ C;  4WU3 A;  3NP5 A;  4UST A;  1U6B A;  3RBE A;  3B8H A;  3MGJ A;  1F1B B;  3HI9 A;  4U96 A;  3P8B B;  1CG2 A;  1DAX A;  2MGZ A;  3L4B C;  2HGN A;  3BGR A;  1RCX B;  3VAM A;  4RW9 A;  3DLG A;  4OYB A;  2DGW A;  1O6X A;  4HT7 A;  3DRP A;  3M6X A;  2HK3 A;  1VIS A;  4X62 J;  1HD1 A;  1A6L A;  1Z1Z A;  2XC9 A;  2OFH X;  1TR0 A;  3LPE A;  3JTO A;  3CCZ A;  3HFZ B;  3CD0 A;  5MLC V;  2UUB J;  4EMD A;  4P7T A;  4ZPD A;  3QFW A;  4Y2M A;  2LEB A;  1RT2 A;  2WVB A;  4ID5 A;  2HGL A;  2IDL A;  1MU2 A;  2JFK A;  2QA4 S;  5HLF B;  3ZO7 A;  3ULH A;  4QIV A;  4AL6 A;  4DMZ A;  3W64 A;  1X4G A;  1EP4 B;  1WC3 A;  4ECR A;  5HP1 A;  4UQG A;  8AT1 B;  3T6B A;  3BH7 B;  3IGV A;  2A18 A;  4CI0 B;  1HI8 A;  2ZHB A;  2HND B;  4JI4 J;  5L9X A;  5K8O A;  2B6A A;  1RTJ B;  3KUE A;  5C25 A;  2JC0 A;  5DDO C;  2E1R A;  3D6H B;  1SL0 A;  1SH2 A;  3I0R B;  5J1E A;  4PWD B;  2D3O R;  2CXE A;  5HL7 Q;  5C2G A;  4B9S A;  3AJ2 A;  3M30 B;  4H4O B;  2VDI A;  2DNQ A;  4LBH A;  3B4M A;  5A76 A;  2XSJ A;  2RDD A;  2X1A A;  2OLW A;  4ZPV R;  2FJX A;  1CLF A;  4DXL A;  2R8H A;  3OQ2 A;  4IFV A;  1TAQ A;  3SIP B;  3PFO A;  1JWW A;  4ZCL A;  2AYM A;  2JHE A;  3B54 A;  4F25 A;  4OIX A;  2CQ0 A;  2ZKU A;  3LTO A;  1N5Q A;  1JLQ B;  3CGI A;  2ZFH A;  3CJQ A;  2MZT A;  3GB0 A;  2XLI A;  2FLP A;  3TVK A;  2DGT A;  3W2V A;  1K1S A;  1JK9 B;  3OUY B;  4A8Q A;  4OI6 A;  3EVO A;  5DDQ C;  4JI5 F;  1NEE A;  2J8A A;  4FPI A;  2KG1 A;  3LAL A;  3BKF A;  1IBC B;  3MCS A;  4F4Y A;  1RTD A;  1HWU A;  3ZNJ 1;  2OP5 A;  3FBC A;  1RWN B;  1X4A A;  1S4E A;  2A1B A;  4OX7 A;  2MXY A;  4X4S A;  2R8K A;  2VJU A;  4EZ6 A;  2LFV A;  4IOB A;  3TI0 A;  1S6P A;  4OFZ A;  2UUA F;  1GMW D;  1NDC A;  2RRN A;  2OPQ B;  4NLT A;  3P96 A;  2WVF A;  1JNR B;  2A2C A;  4RW4 B;  1T8E A;  2FHK A;  4B9M A;  1E6V B;  2A0F B;  4P2F A;  1KS2 A;  3QWP A;  2FHO B;  3VQT A;  2EG1 A;  2YWH A;  4CDI A;  4IDK A;  1NB2 A;  5CAA A;  2OFG X;  3SQG B;  3CED A;  3P49 B;  3BGO P;  1SH0 A;  4KC5 A;  4O4R A;  1WC5 A;  3EPI A;  1OJ4 A;  1NSK L;  3TUZ C;  3DLL Q;  3MM5 B;  1QAJ A;  5ETT A;  1WHY A;  4IRK A;  3UCU P;  4WFX A;  4LR8 A;  1RTH B;  4C9D A;  4EZ9 A;  4OYW A;  3IG1 A;  3VVT A;  2G1H A;  4JV5 J;  3QFH A;  3ZFV A;  4QPX A;  2GHP A;  3N9U C;  1EAY C;  1LV5 A;  1JJC B;  4LR7 A;  1LWC A;  2AEF A;  2ZWO A;  2FPH X;  1EQM A;  4WXO A;  2H54 B;  5AT1 B;  4X4T A;  3D6F B;  4CH7 A;  1PJ7 A;  4QU6 A;  3IBF B;  4AXJ A;  3RGI A;  5HK4 A;  4IG3 A;  4YEA A;  1YIT S;  3G6V A;  5FDL A;  2HVI A;  4ED8 A;  5K8M A;  4C8O A;  2ZBC A;  5CCL A;  1R0C B;  3QSI A;  2DNR A;  2DNY A;  3FCW A;  1LWF B;  4JI1 F;  4PG4 A;  3KFW X;  2XCP A;  2MZS A;  3KLG B;  4NLX A;  1BQM B;  1MRO B;  1UFW A;  2Y1R I;  2BJ1 A;  3T5J A;  4N77 A;  4FBU A;  3D28 A;  2R7T A;  1PO6 A;  1HBM A;  2FJD B;  2H51 B;  2IC3 A;  4PXB A;  2ZE2 A;  1VBZ A;  3PIO Q;  2DT9 A;  1S79 A;  4OZ0 A;  3S8S A;  4PG5 A;  5EX0 A;  5KG3 A;  1K0V A;  4RO0 A;  3DHW C;  2CRL A;  3Q8V A;  4R8U A;  4Y28 C;  2P9C A;  3GR1 A;  2XB2 D;  5DG8 A;  2ADB A;  2DXE A;  3MAA A;  3OLA A;  4DCO B;  1WAC A;  3RR7 A;  4L75 A;  3QRP A;  2L41 A;  3PX6 A;  2W24 A;  1YBU A;  2KL8 A;  1CJV A;  2MZJ A;  1TL1 B;  3FRY A;  1J2V A;  5ETK A;  1RA6 A;  4YY3 F;  4JI2 J;  1N5V A;  2G0J A;  2I5J B;  2V8G A;  3BS9 A;  4PXD A;  4CQ1 A;  3R1L A;  1C0U A;  2HHT A;  2PN6 A;  3R5B A;  2J9D E;  4B3M F;  2HNY B;  4DUT A;  4DPO A;  4PUO B;  4LRB A;  3EXC X;  4G3I A;  2YWG A;  4OZ1 A;  2HFS A;  3PEH A;  3U1N A;  2V69 A;  4B9L A;  2C3U A;  3PW0 A;  3R5A A;  3DLE B;  1V5I B;  3MR2 A;  4ZOS A;  4I2P A;  4I64 A;  4Y6I A;  2MKC A;  2GIR A;  2GA7 A;  2XLJ A;  4DUY J;  2DNK A;  1HW9 A;  1RU1 A;  4YB5 A;  1OPI A;  5ITH A;  4LIW A;  3K58 A;  1T3O A;  2LMI A;  4DFM A;  3DM2 B;  2OPS A;  3IBW A;  3QPI A;  3L09 A;  2RRA A;  2J5A A;  3PV8 A;  1REV B;  1U47 A;  2RU9 A;  2HRU A;  3D6T B;  3CJ2 A;  3N5F A;  3KOA A;  2J9E A;  2W25 A;  4PG8 A;  5B0F A;  3K17 A;  1RIS A;  1KQS R;  2JJ4 D;  1M90 T;  1S72 S;  1Q81 T;  2BRK A;  3VVU A;  2EK1 A;  1WEY A;  1RXO B;  1HNV B;  5GAG I;  1XMO J;  1TKZ B;  4ZS6 A;  3DU6 A;  3UNG C;  1PIE A;  4KBI A;  1FTC A;  2GGP B;  3IAM 9;  3PKM A;  1CQM A;  4B17 A;  4JI0 J;  3VAJ A;  2LEA A;  5FD1 A;  3W2W A;  2ZBI A;  4HH0 A;  5D6G A;  3TJA A;  5KT7 A;  4ECV A;  4WKY A;  3CCJ S;  3FSI A;  2XQC A;  1U0H A;  3CCV S;  2XS7 A;  2MQQ A;  4LIR A;  2E9R X;  4IO9 Q;  1JJ2 R;  3HVT B;  4JYA J;  3IGN A;  4M5G A;  4DV2 J;  2XWY A;  3MHY A;  1BWE A;  1C1B B;  1N33 J;  4DSK A;  3DCA A;  5BYR A;  2WB4 A;  1WHX A;  4HVZ A;  3QRQ A;  2XZT B;  2CPZ A;  4ICL B;  1L3V A;  2BRL A;  2N4C A;  2EFG A;  3MZI A;  3DOM B;  3KUH A;  2IA0 A;  1P1L A;  5CZX A;  4PG7 A;  4A8K A;  3EGW B;  1LOU A;  4KGV B;  2HMI A;  2E66 A;  3CDU A;  2W7A A;  2W9B A;  1KON A;  2YNH A;  1MSW D;  4USI A;  5CYQ A;  2VQF J;  1K9M T;  2FZC B;  2EPI A;  1RI7 A;  3LW5 C;  2CQ2 A;  1HBN B;  4Q0B B;  2KRR A;  4J9K A;  1VC6 A;  1B7Y B;  2V50 A;  4MJK A;  5MAO A;  3PW7 A;  2J7W A;  4WII A;  2DNP A;  3KK2 B;  3TYT A;  1F6T A;  1HNW F;  1T9W A;  5CCM A;  1X60 A;  3UN2 A;  1RT7 B;  3C6T A;  1RT5 A;  2Y0S D;  2EI5 A;  2YQ1 A;  4OZL A;  2RJZ A;  1Y9O A;  5JUM A;  5HMY A;  3GMG A;  1FEE A;  2OD4 A;  3LGH A;  5KFJ A;  4O44 A;  4CLP A;  1VQM S;  1MMN A;  3W65 A;  3UD4 P;  3AOA A;  3JSR A;  2LDY A;  4DV7 F;  6AT1 B;  2AJ0 A;  4EK2 A;  4G6V B;  1YDL A;  1CQN A;  2ZHO A;  2RS8 A;  4ZN3 A;  4QWC A;  3CJS A;  2EKY A;  5CD4 H;  1VRT B;  2ROE A;  2YKN A;  2ZH2 A;  1FK9 A;  4DUZ J;  4OZN A;  1LXJ A;  2DRA A;  4OI0 A;  3UO0 A;  2XZD B;  5KFO A;  3IA0 A;  2XYG B;  2QYC A;  2LXU A;  1XBW A;  2HVZ A;  5K9F A;  1RTZ A;  4JBC A;  1P9Q C;  2FVP A;  3N6M A;  4OHX A;  5LMU J;  1QUV A;  3ZXW A;  2EEY A;  3KJV B;  1UWB A;  2F4V F;  5HBM A;  3TRG A;  4LT6 A;  3QLH A;  1PBU A;  4ED2 A;  2VFT A;  4MTP A;  2AEJ A;  2V4Q A;  4ILM A;  2BEF A;  5KFN A;  4X4N A;  1RWU A;  3LP2 B;  3D0H E;  1XMQ J;  5IM0 B;  2WB1 D;  2WHO A;  3G8S A;  4ZMM A;  5CYJ A;  2Q43 A;  3Q89 A;  5I42 A;  2DNL A;  3ZZ0 A;  1XR5 A;  4A8O A;  1D9F A;  1RB0 A;  1CJT B;  3G6X A;  3CC7 S;  2CKW A;  1Y10 A;  2ASL A;  3FGV A;  3H20 A;  4NWB A;  3EZ5 A;  4I56 A;  2MLX A;  3A4T A;  2BXJ A;  2KFZ A;  1LW0 B;  1U2F A;  3ENQ A;  3MUT P;  1DJ0 A;  3CD7 A;  3UVJ B;  1YJU A;  1U1Q A;  1GNK A;  2DGQ A;  3DDN A;  1F5B A;  3M6W A;  3SCJ E;  3FCH A;  4I6A A;  1RWK B;  5AXN A;  5F9N A;  1LWE A;  2HHX A;  1RAE B;  2AD9 A;  5M2P A;  1DLO A;  2K3K A;  4YS2 A;  4TU8 A;  3MPY A;  3NMA A;  1KFD A;  1HBO A;  1NDK A;  2XO6 A;  3MF5 A;  5DGB A;  1NH8 A;  2C2Z B;  2HQI A;  2KKH A;  3DLH A;  4AQY F;  2D74 B;  3VGS A;  1FRX A;  2L9W A;  2Y1L B;  4ETX A;  1XR7 A;  4Z37 A;  1RAC B;  4GKK J;  2ZOG A;  4DR7 J;  3DRR B;  1SIW B;  5LXY A;  3QO9 A;  4P52 A;  4DR5 J;  4ED3 A;  5LSR A;  4I2Q B;  2QMX A;  3WC0 A;  4WPA A;  5ETR A;  4BCA A;  1B7F A;  3FFI A;  1HPZ A;  2OPP A;  2R8G A;  4F02 A;  1QSS A;  1UPP A;  4AXI A;  5FLX U;  2MQM A;  1RYR A;  3OTE A;  2C22 A;  4CTA B;  4EU0 A;  3K5M A;  2ZDP A;  3K5P A;  4R5P A;  1VQO S;  1FX2 A;  2OEL A;  1SIZ A;  5KFE A;  2O3D A;  2C2D A;  2AJF E;  4RZR A;  3MM6 A;  4ERD A;  2IIH A;  3FKB A;  1J27 A;  5A6P A;  3LWM A;  3LP0 B;  2XGP A;  2VQE F;  3CJ8 A;  2UUW A;  4PEO A;  2QIF A;  3CDE A;  1RT4 A;  2M8H A;  2YKP A;  4F0M A;  3OVB A;  5LSL A;  5C24 A;  4NLW A;  3ZZU A;  2CAJ A;  3IN5 A;  4I4B A;  1BY9 A;  3J81 j;  1F3F A;  3RAM A;  3BBC A;  2ZD1 B;  3T9N A;  3T6J A;  2VOO A;  1AXQ A;  1CPZ A;  3GFX A;  2QMW A;  2ACM A;  2ATC B;  3MMB A;  4P71 A;  4K5R A;  1PAU B;  1A7G E;  2HBQ B;  3GFZ A;  1T9X A;  3J7Y U;  3B82 A;  3QWU A;  4QIG A;  2MZQ A;  4DPW A;  1U1K A;  4LVO P;  2WSC C;  5E5N A;  3BN7 A;  1AW0 A;  1SUQ A;  1UKU A;  2VG7 B;  2MKS A;  4HL9 A;  4PZV A;  5A8K B;  3NGT A;  1PBA A;  3VZH A;  1RT3 A;  1GEH A;  2NSC A;  4D3G A;  3GG0 A;  3GJQ B;  1S9G A;  3KHL A;  3BJY A;  4PQA A;  1G2E A;  4OZ3 A;  4LF6 J;  4R0E A;  5J2M A;  3Q2S C;  2AZ3 A;  2DHA A;  5IFM A;  4V19 X;  1NK9 A;  2CPY A;  4C8M A;  2IDE A;  1HR0 J;  4ED4 A;  2CDR B;  4TN2 A;  1O51 A;  1HNI B;  4KHP J;  5EWE A;  2QG9 B;  4MYU A;  3LP1 A;  3DGP B;  4PWW A;  5LMU F;  4P74 A;  1SCJ B;  2MSS A;  2XBP A;  5ETO A;  2CPX A;  3I87 A;  1C4A A;  1TMM A;  5KFF A;  5LL6 d;  3GII A;  2AMC B;  3CMA S;  3CWJ A;  2FVC A;  3EXY A;  1YJ7 A;  3A1Y G;  4NXM J;  3ENV A;  1TKT A;  1OYD A;  4B9V A;  1DY3 A;  1TEL A;  2AYG A;  3K0J A;  4ZN1 A;  1U2R A;  3W3S A;  4U9R A;  2OPR B;  1D8Z A;  2GVD A;  2F1F A;  4QBU A;  1RSC A;  4Q5V A;  5B09 A;  2F4F A;  1P1T A;  4EO6 A;  1FNM A;  3GPA A;  1NKE A;  2G2Z A;  2H1Y A;  3BR8 A;  3HSG A;  1YIJ S;  2FQQ B;  4A8S A;  1RDR A;  4NLY A;  3KTQ A;  3DOL A;  2VFV A;  1MWY A;  4RW7 A;  5J2P B;  3CXC R;  2BX6 A;  2W2N P;  2E5L F;  4RW8 B;  3MTK A;  2JEG A;  4DX8 H;  2XS2 A;  3RR8 A;  1UVJ A;  4F4W A;  2HAI A;  2RH3 A;  2VG6 A;  3OVA A;  4TY9 A;  2VC1 A;  1TL4 A;  4EBC A;  3OXF A;  2UXD F;  4DG1 A;  1RWW B;  1H3D A;  1VQ7 S;  3G82 B;  4DR6 J;  4LQ3 A;  1BC6 A;  1FWL A;  1VS3 A;  3E01 A;  1UW4 A;  2ZM6 J;  5KT3 A;  3GIR A;  3L7P A;  5IC6 B;  3TEG A;  2MKI A;  3W62 A;  4RL1 A;  2LQJ A;  4L3N A;  2HZA A;  2Y8W A;  5CZV A;  3UN3 A;  5G4D A;  3F56 A;  2CIM A;  1MN7 A;  3BPS P;  2E44 A;  3JS9 A;  6FD1 A;  2UV8 A;  2MZ1 A;  2VHG A;  2WVD A;  1Q5V A;  4LRE A;  1N4L A;  3ISN D;  2HHH J;  1R8P A;  3AXM A;  3NCP A;  1R7I A;  2XNQ A;  2UU9 J;  2O1P A;  1WKL A;  1URR A;  4F3O A;  3BR9 A;  2CFX A;  4NCB A;  1J5O A;  3EDQ B;  4RW6 A;  4BC7 A;  3C66 A;  5IZH A;  2DR9 A;  3KK1 B;  3MM8 B;  2COL A;  3CDA A;  1PYS B;  1CC8 A;  2HLU A;  2AX1 A;  1YGY A;  3LAM A;  4OHY A;  2LQB A;  5K14 A;  4I6Y A;  2R7W A;  3HJF A;  3PO5 A;  2CQC A;  2YVS A;  3UPF A;  1N0V C;  3ZTQ A;  1UEK A;  2FY1 A;  1RAJ A;  2Y1I A;  2AJ2 A;  3C15 A;  3MCM A;  2MLZ A;  3SV4 A;  1PAE X;  1KWM A;  4YR0 A;  1NHV A;  3A3P B;  4NYO A;  1HYS B;  2H48 B;  5IC4 B;  3L3C A;  2RS2 A;  3LA0 A;  2RKI B;  3SDE A;  4AL7 A;  2OTJ S;  1DTQ A;  4YN3 B;  4A8Y A;  4IG0 A;  2HQD A;  2HBY B;  4J9U E;  1YG0 A;  5ETQ A;  4WTO B;  2F8M A;  4M63 A;  2WSE C;  5DDP C;  2EW9 A;  4XDD A;  2KTQ A;  4O3R A;  1KLN A;  2YNF B;  5BJR A;  5JVG Q;  5ETP A;  5C7P A;  1QDU B;  1UVL A;  1JKH A;  4DCJ B;  3JSM B;  1D8Y A;  2E7W A;  1HR0 F;  4DLE A;  5GAD U;  2AYE A;  3IS9 A;  5A8R B;  5IT9 Y;  1PYT A;  1HQU B;  5AXK A;  4TLQ A;  2J0S D;  3C14 A;  4GO5 X;  5KG6 A;  1RE1 B;  4DSL A;  2L08 A;  2VD3 A;  4X66 F;  2NRE A;  2R7R A;  4JI7 F;  2MY7 A;  2W7P A;  4RUH A;  1YTY A;  1FRK A;  3OBI A;  2MKH A;  1DRZ A;  1FEH A;  3NOG A;  1GMV A;  4G1Q B;  2BKP A;  3MAH A;  3N28 A;  3FJ2 A;  4DQR A;  1RLD A;  4PWU A;  1HQ2 A;  2VG5 A;  3CO9 A;  1LW2 B;  4JI8 F;  2KYX A;  3AT1 B;  2NZC A;  3M32 B;  3SEO A;  1RHR B;  3M8W A;  1UMJ A;  3LP2 A;  2IRU A;  2XNR A;  2CQ3 A;  1KRP A;  3TZY A;  2YQ0 A;  3KLE B;  1RBL A;  4JI6 F;  2K8G A;  1CVJ A;  4IFY B;  3BQ2 A;  1CUL A;  4I7F B;  4O3Q A;  3L7O A;  3NGD A;  3HHL C;  3NL0 A;  2ZH7 A;  2J0Q D;  4OYZ A;  3NBP A;  4J9L A;  4B3S J;  1NH7 A;  2C3M A;  3KLF A;  2XUL A;  1Q86 T;  3G6Y A;  4USH A;  1HHS A;  1FF2 A;  3RBD A;  3V6D B;  1S6O A;  2RD5 C;  1C0T B;  4LF5 F;  2X7I A;  3UFC X;  4FF4 A;  4DV6 F;  3O1L A;  1AUD A;  2VC0 A;  1N5S A;  3DYA B;  3PCO B;  4B3T F;  1VQS A;  3PEJ A;  4ZHR A;  4KR0 B;  4F04 B;  2OML A;  3IRX A;  4NMX A;  5CD4 A;  1RAI B;  4FNH A;  3OL6 A;  1R3N A;  2MHE A;  2JSX A;  5DS7 A;  2HBZ B;  3FMB A;  1S5Z A;  3GSI A;  2FVS A;  1J5E J;  2QLW A;  2UVV A;  2K2P A;  4MK9 A;  1REG X;  2R2T A;  2IBO A;  4USK A;  1VIO A;  3GJT B;  3MMC B;  1CJK B;  3HK2 A;  2RQM A;  1GFW B;  1EHW A;  2AGQ A;  3HUL A;  1NUE A;  3M05 A;  2DH9 A;  3GQC A;  4ATN A;  1YJW S;  4DCP B;  3ETO A;  1DQA A;  1RJJ A;  5D77 A;  1BD6 A;  1WSV A;  3H90 A;  2AJQ A;  4ES1 A;  1TKX B;  4K2J A;  2G13 A;  3HSD A;  2R3V A;  4K4U A;  1DUR A;  4FZV A;  4ZP6 A;  4UT4 A;  3KJN B;  1Q7Y T;  2P9E A;  4OLO A;  3W9I A;  4HAC B;  3VTI A;  4DFP A;  4PYA A;  2DH8 A;  2WON B;  3HMJ G;  2B3T B;  3NWR A;  5F8M A;  4YB6 A;  3AB2 B;  4J9R A;  4DR1 F;  2XMU A;  2BJ9 A;  1WG5 A;  1S6Q A;  2N82 B;  3SFG A;  4H4M B;  2XSF A;  3EWG A;  3SSS A;  4J7C A;  4CP5 A;  1TAU A;  4NZ6 A;  1VFJ A;  1Q8L A;  4K4V A;  3HHL B;  1BHN A;  3KHH A;  1IKW A;  4XO0 A;  4CZC A;  4WP3 A;  1B0V A;  5F8J A;  1OSC A;  2DO0 A;  1LFW A;  1VBX A;  3JSB A;  5LT5 A;  4UY8 T;  2P5V A;  2GJI A;  2E9T A;  2VKZ G;  3W61 A;  3OR2 B;  1VQP S;  3Q8U A;  2LEC A;  1N6Q A;  4CRJ A;  1OSD A;  5ETL A;  2HGM A;  4F2S A;  2APO A;  2DHS A;  3RTV A;  4DQS A;  4NA1 A;  1IUJ A;  4DL0 C;  4GKJ F;  2CDQ A;  2B4P A;  2YKM B;  2E1P A;  4J5O A;  3CJK B;  3MM7 A;  3PYD A;  3ILL A;  1HWK A;  1RT6 B;  2V8H A;  4CLK A;  4ZDN A;  4ECX A;  3CC2 S;  1IKV B;  3D9B A;  3GCX P;  1GK8 A;  1FJG F;  1MN9 A;  2F7V A;  2BA9 A;  3UW1 A;  2R2S A;  2O5D A;  5EWG A;  1S10 A;  2HHQ A;  3IWL A;  1Z2L A;  2UVW A;  1NZA A;  3BYP A;  4CWB A;  3DI6 A;  1H7X A;  5IT0 A;  1B0T A;  2Z2L A;  2KZM A;  1JB0 C;  1SC3 B;  3VCD A;  2Q66 A;  2CQG A;  3W7B A;  4ECT A;  4NCG B;  4OLP A;  1U1N A;  2ZIT A;  2CWK A;  2HEK A;  1UJ5 A;  2FHM A;  5IT9 U;  4CO1 A;  3TAM A;  3IM8 A;  2K3I A;  2KXN B;  4NZ7 A;  3WIU A;  1UWA A;  1H2T Z;  2YX4 A;  4K7Q A;  1I94 J;  4FF3 A;  1S1U A;  3CJ5 A;  1T05 A;  1XNQ F;  1PYO B;  1EQ0 A;  2VDH A;  5E33 A;  1S0M A;  3I96 A;  1F9F A;  3OTB A;  4LF9 J;  3R6L B;  4YOE A;  2DCL A;  5T7L B;  1FKP A;  2ATL A;  5IQ6 A;  2C2N A;  4M5L A;  2FZK B;  4DV5 J;  5HRO A;  5EX3 A;  1QE1 B;  4HHJ A;  4QW9 A;  4KO0 B;  4NX9 A;  2Y9H A;  4CO0 A;  4YQW A;  1H7W A;  3MTJ A;  1XQI A;  4KYZ A;  1PJ5 A;  4ED1 A;  2EFQ A;  4F0K A;  1YJN S;  3K59 A;  1RZM A;  4KPC A;  3DGV A;  4K4S A;  1JLC A;  4C8L A;  5L8R C;  3DOK B;  3A8K A;  2PII A;  3AOB A;  4C8Y A;  1IVZ A;  3VF0 B;  4BHQ A;  4F4X A;  2VJV A;  5AE1 A;  2N3L A;  1O5J A;  2C3Y A;  4MKA A;  2XS5 A;  2CNK B;  1DAR A;  4YFU A;  4USJ C;  4L6V 3;  1JMT A;  1T9T A;  5F3T A;  2XI2 A;  4DJB A;  5H9F K;  3K8V A;  3DLB A;  1RHK B;  1S1T A;  5HAT A;  2V4J A;  2UXC F;  2JOQ A;  2JNJ A;  1IBL F;  3IM9 A;  5KFV A;  4YR2 A;  4WFZ A;  4QR1 A;  3UR3 C;  2K1R B;  5IWA J;  1KLM A;  1N8R T;  4DQQ A;  3JSY A;  2B43 A;  1S0N A;  1KDN A;  1FJE B;  2EG2 A;  3J81 Y;  1FKO A;  5BR8 F;  3M2V A;  2YWF A;  2D7S A;  3FBF A;  4NI2 B;  3K5L A;  4OL8 A;  2R7V A;  4ZVG A;  2QA4 G;  3T5K A;  5C42 B;  5A2Q Y;  3M8P B;  2BM1 A;  3U7J A;  5KG2 A;  1E6Y B;  2CZV C;  1U49 A;  2CPF A;  3DC2 A;  1QVF R;  2CPE A;  2RDJ A;  5DQI A;  3UDE A;  2B4V A;  4OZ5 A;  4JV1 A;  1HAR A;  2DR8 A;  4KFB B;  3AOD A;  3QAE A;  3FBE A;  2W2O P;  3PYF A;  3UCG A;  3NKY A;  2J6T A;  3THT A;  2N7Y A;  1Y3K A;  3M9M B;  2MGZ B;  3NGU A;  4CLY A;  3BGR B;  3TX8 A;  2ZJR Q;  2FC8 A;  1HYS A;  1Y7P A;  2CWX A;  4DI6 A;  3C6U A;  1F60 B;  4NXN F;  1S1X A;  4RX6 A;  3DLG B;  3M2R A;  4HDH A;  2QE5 A;  3DRP B;  4RBT A;  2DNH A;  2BUN A;  3VWS A;  3KLI A;  1HLW A;  2QSW A;  3QZ8 A;  3J80 Y;  4OYP A;  2B7B B;  1XK8 A;  1ZM9 A;  3CT9 A;  1N32 J;  1JJ4 A;  3PW2 A;  4AL5 A;  4Y00 A;  4ZLL A;  3N0V A;  4Q43 A;  2ROP A;  3S1T A;  1RT2 B;  1UZH A;  2BQ3 A;  1SVD A;  1YJV A;  2ZUA A;  4ID5 B;  1MU2 B;  2QLF B;  5HAN A;  2D1C A;  4LFC F;  3WIV A;  2M5Y A;  4OJH A;  4CM2 A;  4KKO A;  3VAL A;  5HP1 B;  1H98 A;  2Z57 B;  3GYG A;  2YWK A;  1SJ1 A;  2GMH A;  4DL5 A;  2RDI A;  1M5O C;  4ZVT B;  1KFS A;  4NLQ A;  1SI9 A;  4BWJ A;  1FE0 A;  1Q16 B;  1R8C A;  1UET A;  2B6A B;  2ZKT A;  5C25 B;  5G0R A;  1T02 A;  4USU A;  3FMW A;  4K0K J;  5J1E B;  2NXJ A;  5J1N A;  2EXU A;  3PRD A;  4ZVR B;  3GV7 B;  4DR3 J;  1EZZ B;  2N7C A;  2WW4 A;  3SQO P;  3T5H A;  4Q7A A;  5JXS A;  4YHH J;  2ZH5 A;  1VIX A;  1WDT A;  3RRH A;  3OFG A;  3FQL A;  2BR0 A;  1NJI T;  2BJE A;  2YKO A;  2XSJ B;  4A8F A;  3TA0 A;  5KFD A;  3T1A A;  4FS1 A;  4IFV B;  1FDN A;  4Z7Y A;  7AT1 B;  3V6H A;  4LF8 F;  1GX5 A;  1YZ7 A;  2FVR A;  3HFV A;  2LQ5 A;  3SMZ A;  2ZEJ A;  1GTE A;  2U2F A;  1L3T A;  4KQZ A;  2VPY B;  2NXN A;  3CCE S;  3KDN A;  1AZS A;  1NME B;  2HAF A;  3ZTP A;  3R5J B;  2M4M A;  2ZZT A;  3W2V B;  4UOG A;  2DXF A;  4X65 J;  2R8J A;  1I6J A;  4Z7C A;  1SH3 A;  4ZVO B;  3ENW A;  3FC9 A;  2DD8 S;  4ETZ A;  1VDH A;  2DGO A;  3VQS A;  2J0X A;  2JH3 A;  4C7Q A;  1RTD B;  3H25 A;  2CPH A;  3FNN A;  3T19 A;  3DLK A;  3THP A;  4EBE A;  1Q7L B;  3ZZO A;  2UUC F;  1S6P B;  4DSE A;  3CJR A;  5KG1 A;  2RE1 A;  1NK5 A;  3Q86 A;  1HQE A;  2YPZ A;  2IY5 B;  1KQF B;  2OO4 A;  2F40 A;  1Q53 A;  4Z2X A;  3RUB L;  1VJW A;  2DNG A;  3EDR B;  2RUS A;  1WKK A;  4B3R F;  4IDK B;  3CCS S;  2WTF A;  2DGS A;  4JV0 A;  2M70 A;  3OR1 A;  2POK A;  3PR5 B;  3KMQ A;  1NPK A;  2HHV A;  1WUU A;  4HH1 A;  1S1W A;  2DR6 A;  1YSJ A;  2RQC A;  2I8E A;  3NGS A;  1XER A;  3N4W A;  3IG1 B;  2DIS A;  2DCU B;  1JLA A;  3EPG A;  1JLE A;  5HVF A;  4GMK A;  2KYZ A;  4DS4 A;  2A2D A;  3M9O B;  1V3Z A;  1A0O B;  2FJW A;  1LWC B;  2Q79 A;  4XPC A;  1TL7 A;  2QEX S;  3NCR A;  3W9J A;  2GJ2 A;  3SV3 A;  4Y3C A;  4IG3 B;  4ANE A;  4ANC A;  5DG9 A;  5FDL B;  4ECW A;  4I6W A;  2YPY A;  3I0S A;  4MH8 A;  4XPE A;  3MFI A;  2V8V A;  3QJP A;  4WZM A;  2BJD A;  3DU5 A;  3G71 S;  3DKD A;  1S0V A;  5A8W A;  4IH6 A;  5F8L A;  2QSF A;  1XNR F;  4XTT A;  4NLS A;  4FYX B;  4Q8F A;  1FVQ A;  1KR4 A;  4ZIW A;  4C4W A;  2QZ8 A;  4A8X A;  4CT9 A;  1HBM B;  1TUV A;  3JQK A;  2IC3 B;  1FHT A;  2ZE2 B;  1Q78 A;  4J91 A;  5L39 A;  1X4H A;  1NKC A;  1KSP A;  1I51 B;  4PXC A;  4MKY A;  4PR6 A;  1K1Q A;  4ELU A;  1FI4 A;  3HVW A;  4J90 A;  5F8H A;  3AD7 C;  2N4D A;  1N88 A;  4R8U B;  1Y00 A;  1P6T A;  3DFE A;  2GO9 A;  3GV8 B;  5E3R A;  4IRD A;  3H4B A;  1JX4 A;  1EKR A;  3TAR A;  2YNI A;  1BQN A;  3M8Y A;  1WTB A;  1RHU B;  3MEC B;  3MAA B;  2DHH A;  4PAB A;  4WFN Q;  2OSQ A;  2YNG A;  1S9E A;  3LO3 A;  5LXR A;  1HNZ F;  4WFB Q;  2KT2 A;  5D15 A;  3P45 B;  3IWX A;  4LFB F;  1CJV B;  1VQN S;  1S0O A;  3CCW A;  1Q95 G;  4QQB A;  4AND A;  5C2C A;  1UTA A;  4OI4 A;  3WX4 A;  4DR2 F;  4O4G A;  3PTW A;  4K4W A;  5D8H B;  4ECS A;  5D4O A;  1C0U B;  3H59 A;  4M5K A;  1S4F A;  2IAJ A;  3OW2 R;  4OZ2 A;  1WG1 A;  3J7Y I;  1IKY A;  1X4D A;  1VQ8 S;  2HNZ A;  5KG0 A;  3M8S A;  3BSN A;  2Z0G A;  2QYG A;  1F3V A;  4DN0 A;  4URS A;  4CLL A;  4I2P B;  4YDX A;  3FEX B;  1VQK S;  2GVZ A;  4UW2 A;  1UA0 A;  3GFY A;  3IR7 B;  3ILJ A;  3EZO A;  2X3D A;  2LQ9 A;  2OEK A;  1VOM A;  1YRU A;  2OPS B;  1T9Y A;  3LPY A;  2JLE A;  3W8P A;  5KT5 A;  2IYI A;  1VCT A;  3CB4 A;  2DY1 A;  2V2V A;  2JEI A;  3HHL D;  2ASY A;  4OHZ A;  4DV0 J;  2KJV A;  1HD0 A;  2C1E B;  4PKD B;  2FJV A;  3TX0 A;  3SCK E;  2B51 A;  5LOQ A;  2HSE B;  4ILL A;  1IKX A;  3G87 A;  3GIK A;  2AIR B;  1PKU A;  4ZP7 A;  3HHD A;  3W2W B;  4NE9 C;  3Q22 A;  1TUW A;  2ILZ A;  1U0H B;  4KJI A;  4OX8 A;  4HLB A;  2QMU B;  4FXD A;  2ZC4 A;  2R2R A;  5F9L A;  4LF4 J;  2R7O A;  1XJW B;  1R89 A;  5HJX A;  1CJU A;  2PA3 A;  2OMO A;  1X4E A;  4CNY A;  1UVM A;  5DLG A;  4FVM A;  5E7O B;  4NI2 A;  1BGX T;  5KFW A;  3JYT A;  1P27 B;  3BBF A;  1UA1 A;  3PFE A;  1LWX A;  2K7K A;  1RYS A;  3MWB A;  5DQH A;  3AJ1 A;  5E0O A;  2XO7 A;  2YWW A;  5ADZ A;  4M5D A;  2V34 A;  5A0Y A;  2ILY A;  2HMI B;  3FDS A;  3GJS B;  3R2C J;  4ES3 A;  3HFK A;  3R9L A;  4B08 A;  2W9B B;  3R1H A;  5KFI A;  3KK3 A;  2YNH B;  4DV1 J;  4LSZ B;  3OHA A;  1TV6 A;  2DHG A;  2NR0 A;  5CYQ B;  5KOX A;  3MCO A;  4LBI A;  3BEG B;  4U67 Q;  3PW5 A;  3PYG A;  1G7C B;  2RQ4 A;  4QIF A;  2P8I A;  2KU7 A;  1IWG A;  4F7V A;  1ZBT A;  4P2M A;  3Q2T C;  4S0M A;  1SKR A;  2BDP A;  1U02 A;  2FJA B;  2VOP A;  2W7O A;  2CQD A;  2B9E A;  2OEM A;  4YDD B;  5EDW A;  2HHP A;  2UP1 A;  1MG7 A;  2IVM A;  5AXL A;  5L1J A;  1Q8K A;  5DET A;  4C0H A;  3C6T B;  1RT5 B;  4LRD A;  2PI5 A;  4FP9 A;  4U7U D;  4FS2 A;  5D3G A;  1JLG A;  2OSR A;  4LF7 F;  4O44 B;  2B4O A;  3BDP A;  4GRS A;  1RWP B;  4K8R A;  5E2Q A;  1KQK A;  1FER A;  1N36 J;  4A47 A;  2F9J A;  2WW8 A;  3T1H F;  3HKZ D;  1MWZ A;  3MEG A;  2DPI A;  3RW6 A;  2ZH8 A;  3I56 S;  4P2S A;  1ZTT A;  2LU1 A;  4DOZ A;  4ECZ A;  2FLO A;  1ITP A;  4QW8 A;  4IR9 A;  1U09 A;  2RF2 A;  1RK8 A;  4DHV A;  2YKN B;  1FK9 B;  7FDR A;  1NHU A;  2HZV A;  1N52 B;  3BF4 A;  2LYV A;  3G96 A;  4BLG A;  5SUH A;  4DFJ A;  1YQH A;  4N8O A;  1N48 A;  4P75 A;  1KC8 T;  3OPK A;  3E8O A;  2MJU A;  3QNW B;  3UNY A;  1HNX F;  2CZ4 A;  1WF2 A;  3J7A 1;  4NYP A;  2K7J A;  1B64 A;  3RBX A;  3CMQ A;  3V4M A;  3QMQ A;  3UDV A;  5D0H A;  3ZZZ A;  3UN5 A;  1HI0 P;  2GIF A;  1UWB B;  2UXB J;  5HBM B;  1S77 D;  3VZI A;  3QLH B;  3KLV A;  2P2C B;  4EGL A;  4J9Q A;  4JI3 J;  3Q23 A;  4ELV A;  5KFR A;  3O3L A;  3MMJ A;  2X51 A;  4WP9 A;  5EGY A;  1FKA F;  2RT3 A;  2CPD A;  3DDK A;  4HHU A;  3MM9 A;  2QO3 A;  4IH7 A;  5I42 B;  1T03 A;  2MPU A;  3J7Z 5;  2FLN A;  3ITH A;  1X0P A;  3H5Y A;  2UV8 G;  1G3O A;  1CSJ A;  4OZJ A;  4DR4 F;  4Y2I A;  4ZVP B;  1SV5 A;  2NXE A;  4ZKA A;  5D4L A;  5GAD I;  5LMN F;  5B0B A;  1JLB A;  1IBM J;  1RU2 A;  4DSF A;  3W60 A;  1WDD A;  3GZ7 A;  1OY6 A;  2RUG A;  4GVB A;  2DNZ A;  4C11 A;  4LSN A;  4F4A A;  2VFR A;  5DZ7 A;  1UEU A;  1GTH A;  2FB0 A;  4JV2 A;  3I4H X;  3EVW A;  2FD2 A;  3I6P A;  5KFK A;  1LWE B;  2WVC A;  4LRC A;  1IBK F;  1SB6 A;  3IMQ J;  3RRK A;  1DLO B;  4J9O A;  1ZOT A;  3KG0 A;  2FIU A;  1HBO B;  5KG7 A;  2DNN A;  4OJG A;  3MUM P;  2FHJ A;  1WOR A;  4X64 F;  1FD8 A;  4OX9 J;  5GAE I;  2V0N A;  4U8Y A;  3ISN C;  5CA5 A;  5HQM A;  1WWH A;  4XIU A;  4ZVF A;  4QIE A;  3W8G A;  3QO9 B;  2V4R A;  3A3N B;  1NK8 A;  2MKJ A;  4X4O A;  1V5V A;  3BKU A;  3FFI B;  1HPZ B;  2OPP B;  1UAW A;  2QX0 A;  3AA9 A;  2RRB A;  1N34 J;  4FF2 A;  4C6A A;  1X5T A;  3QJL A;  4KPY A;  4BC9 A;  1KP6 A;  4R5P B;  3PRB A;  4IO1 A;  4PPD A;  2WCX A;  3MM6 B;  2BVZ A;  1RHJ B;  2F65 A;  1OQ6 A;  1RT4 B;  1YI2 S;  3M8Z A;  5C24 B;  2H65 B;  5J2N A;  3I55 S;  4PQU A;  3W66 A;  3D3B J;  2DRD A;  4L72 B;  3T1Y J;  1FO1 A;  3FSX A;  3MMB B;  1M0S A;  2PEB A;  2DBB A;  2LA4 A;  4F2R A;  2KFN A;  2DTJ A;  3UWT A;  5ETM A;  4JB8 B;  2GIQ A;  4X62 F;  3OTO J;  5FJ4 A;  1SKW A;  2UUB F;  3FRZ A;  4KY3 A;  2L9N A;  2OAU A;  1CEZ A;  1SUQ B;  3R2D J;  4X4U A;  4G65 A;  1B99 A;  3HSZ A;  4ZLP A;  2ZH4 A;  1RT3 B;  2IMO A;  2M88 A;  1AYE A;  3A12 A;  2QLB B;  1S9G B;  4B9T A;  2C2R A;  3KG1 A;  3JAM Y;  1QAY A;  4JOU A;  1LFP A;  1L3K A;  1XWL A;  3G2X A;  5J2M B;  3GWC A;  3ET6 A;  1APS A;  4QWA A;  4JI4 F;  1EJ7 L;  3SZ2 A;  2HWI A;  5IOL A;  4DL3 A;  1U8S A;  1IR2 A;  1OYE A;  3BGL A;  3EE3 A;  3LP1 B;  3L95 X;  2OUG A;  3QAT A;  1QUP A;  1WEZ A;  2E5G A;  1VK8 A;  2G0I A;  3MEC A;  2W9A A;  1VQ9 S;  3K5N A;  2AHO B;  3NNC A;  2CPI A;  5EHH A;  3BZQ A;  5KT4 A;  2ZVS A;  3D2W A;  3BGU A;  3TJ8 A;  1KTV A;  5KFA A;  3E3X A;  4E98 A;  3CPW R;  4OYX A;  1TKT B;  3R5G A;  3QID A;  4DV4 J;  2XLK A;  1KHV A;  3NS7 B;  3CD6 S;  3GCW P;  4DX7 A;  3Q0A A;  4I1T A;  2XHC A;  1V3S A;  1WOS A;  2I9S A;  2GVD B;  4TYA A;  4AFF A;  1KBR A;  5HJY A;  3TZZ A;  2JRS A;  3BO4 A;  3WZ0 A;  2ACY A;  1ZYQ A;  2MKK A;  3AHP A;  4I67 A;  5LJ3 Y;  2CQP A;  4UF4 A;  3ETM A;  4ZIV A;  3DOL B;  2VIC A;  1VQ4 S;  4RW7 B;  3QZ7 A;  2NCK L;  4F67 A;  1F0X A;  2XMA A;  1C4C A;  5H1S V;  3H2L A;  3BSO A;  1U26 A;  5T41 A;  4KT0 C;  1FDB A;  2VG6 B;  1MWQ A;  4W92 B;  4OX6 A;  4MAK A;  1VQY A;  4OHV A;  4TLR A;  4KGM A;  2R8I A;  1K0T A;  4QWE A;  4DG1 B;  1PIL A;  3A8J A;  3IRW P;  3MDF A;  1WC4 A;  2IVF B;  2DEJ A;  4KAI A;  1S59 A;  4J9S A;  1M1K T;  2XMK A;  3E01 B;  3PNI A;  1NJY A;  5KFU A;  1HWJ A;  5KFM A;  3AXK A;  2GAH C;  5FLX Y;  3CNQ P;  4NLV A;  5L46 A;  3BB5 A;  4ZJL A;  2GHV C;  3O5T B;  3CIZ A;  1U6Z A;  2DIU A;  1S49 A;  1NK0 A;  5CYM A;  2BM0 A;  2V8P A;  5KOW A;  4NPO A;  2LDI A;  1R0A A;  4KH0 B;  3EIC A;  3DDI A;  5HO4 A;  1ICE B;  2EC0 A;  3K5O A;  3KHG A;  2BW2 A;  1TFW A;  3LOU A;  5E3C A;  4JV5 F;  1TK5 A;  1J5O B;  4FYY B;  4RW6 B;  2HBR B;  5E3Q A;  4UZB A;  4CLF A;  4Y0F A;  3HM9 A;  3EVM A;  1G6B A;  4X84 A;  2NPI A;  2BQR A;  1T94 A;  4HI1 A;  1D09 B;  4KSE B;  1NJX A;  5K14 B;  2CQ1 A;  2JX2 A;  2EKN A;  2MQ8 A;  3M8R A;  5EUH A;  4WIQ A;  3Q24 A;  2M7S A;  3R7S B;  3PR4 A;  2V9W A;  3C15 B;  1JLF A;  4LFA J;  3G6E S;  2LP4 A;  2XY7 A;  1HBU A;  1NSP A;  2CNN B;  1Q0N A;  2YX7 A;  4F3M A;  2BKN A;  4ZVH A;  3SDE B;  1NXI A;  1DTQ B;  2ROG A;  3H4D A;  2GNK A;  4LR9 A;  4IG0 B;  2MLY A;  3N01 A;  4F8R A;  2EBE A;  3C19 A;  2LXI A;  3SCL E;  3LAN A;  1VGY A;  1Q8I A;  3N5B A;  1OWX A;  1WJ9 A;  3K89 A;  1Z4U A;  1NPR A;  3PM9 A;  1JKH B;  5J2Q A;  4Y65 A;  3IS9 B;  5AE2 A;  4OI2 A;  2J0W A;  2GMJ A;  3HF5 A;  3R5D A;  4WFA Q;  2WSF C;  2YH0 A;  2FJB B;  3P5T L;  3C14 B;  2PEH A;  3US5 A;  4ZCI A;  4A48 A;  3FZB A;  1U1O A;  2JLF A;  3HHN B;  3MPU B;  4ZJQ A;  4J37 A;  3CF5 Q;  2QGF B;  2MST A;  4OYM A;  4NRU A;  4JI2 F;  1ZA1 B;  4NCA A;  3GR0 A;  3JAM U;  2CJX B;  3NAI A;  1LQ9 A;  3UDC A;  4ZVQ B;  4AUK A;  4B9N A;  5B08 A;  4DN9 A;  5L9N A;  2EFN A;  2VG5 B;  4NZ0 A;  5K20 B;  1BUX A;  1N56 A;  3BPD A;  2YX1 A;  1ZPW X;  2UVU A;  2Q6B A;  1AFJ A;  1UP1 A;  1DQ8 A;  4WE1 A;  2W4C A;  4K4T A;  3D66 A;  1RTI A;  1AT1 B;  3FSY A;  3GSD A;  5L1K A;  4CLT A;  4DUY F;  5M2U A;  3JQM A;  3QSY B;  4MMO A;  1DZ5 A;  2G9O A;  1N5T A;  1FE4 A;  1CUL B;  1VI7 A;  3Q8Y A;  4O0I A;  1IN0 A;  1R6V A;  3JXO A;  2QN6 B;  3OXG A;  2E9Z A;  3NBP B;  1ZS6 A;  1WI6 A;  1HWI A;  2Y3Y A;  1RAG B;  3KLF B;  3TJ9 A;  4C3M A;  2X1F A;  1SL2 A;  3DXS X;  1XMO F;  3FZ2 A;  4TY8 A;  3PKY A;  2W2Q P;  1AB8 A;  2H4W B;  3RBZ A;  1HMV A;  4LSL A;  1RWM B;  1RAD B;  4JI0 F;  2JDJ A;  3R8Y A;  4ZHR B;  4LBP A;  3OXL A;  4CYU A;  1Q1K A;  3IRX B;  3D4J A;  2F63 A;  4N47 A;  1KOO A;  3OFF A;  2BJ7 A;  3OHB A;  2AEM A;  4DL2 A;  4QYZ K;  4CLU A;  3CIM A;  4OHW A;  1O0P A;  2GCF A;  2H3E B;  2Z30 B;  2VFS A;  4JYA F;  1U45 A;  4DV2 F;  2WZ1 A;  2E1A A;  3HKW A;  1N33 F;  2QRR A;  3ZC4 A;  5KFP A;  1IR1 A;  3VAH A;  5SZT A;  2BE7 D;  4JI5 J;  2O01 C;  2P9G A;  3NXZ A;  4RNM A;  3HVR A;  1HIY A;  1GT8 A;  4Y34 A;  5D0R A;  3SI8 A;  2V2Z A;  3IFE A;  2H4Y B;  3WX8 A;  2QJ3 A;  2UUA J;  1KVJ A;  1YRT A;  1FRL A;  3JB9 k;  4CO2 A;  2VQF F;  2XWX A;  2QFI A;  2HS0 A;  2HKE A;  4LF2 A;  2OIH A;  3HCX A;  1FJC A;  1YHQ S;  1GXT A;  1ZA2 B;  3HDS A;  1SQE A;  5GME A;  3F73 A;  3C46 A;  3D54 A;  4H54 A;  4HTI A;  2NSB A;  1S6Q B;  5H9E J;  3M6U A;  3TUP A;  2JVO A;  3KG4 A;  5I3U A;  2BAN A;  3QIP A;  2G2O A;  3SBM A;  1IKW B;  1X5P A;  4O3O A;  1BWV A;  3KNA A;  2W1B A;  2FGC A;  4ELT A;  2HHU A;  4G1I A;  3I9V 9;  3J7Z T;  4IOA Q;  2FDN A;  3FBB A;  2Z4P A;  2VU5 A;  3MD3 A;  1UFL A;  3T3F A;  1WOO A;  1N6Q B;  1JIH A;  4WU2 A;  3KLH B;  2R4F A;  2JZ5 A;  4DUZ F;  5F8G A;  1YBT A;  4ED7 A;  3QT6 A;  3MM7 B;  2PMH A;  5HVH A;  3BSC A;  4HDG A;  3HSJ A;  3PRV A;  2NXC A;  3DNC A;  2R7X A;  5KFB A;  3CDB A;  1ZZF A;  3K7R A;  4L74 A;  4KE5 A;  3EM1 A;  2MJN A;  4IR1 A;  5D4N A;  1TFY A;  1I5O B;  4ZPW R;  1RHQ B;  2BW7 A;  5B0C A;  2QL7 B;  4K4Z A;  4U7C A;  3DI6 B;  4JI1 J;  1M5V C;  4UZC A;  1WF0 A;  1GMW A;  3CJT A;  3I4P A;  2KHD A;  2CJK A;  1HA1 A;  3M8Q A;  3KYL A;  3PYE A;  1LK7 A;  3TAM B;  1EET A;  1EX8 A;  1IQZ A;  2OD6 A;  1SBR A;  3U02 A;  2CUY A;  4H4K C;  1S1U B;  1T05 B;  1ZZN A;  4E2F B;  5I3P A;  1VHF A;  1XMQ F;  1T0T V;  4EYH B;  3SXL A;  1NLK L;  3POT A;  2CG8 A;  4W4M A;  5B0G A;  4EI2 A;  1C1C A;  1FKP B;  4K4Y A;  1MLA A;  5HRO B;  2JLG A;  4DQI A;  2J76 E;  5KAK A;  4LVN P;  3MEK A;  1WHW A;  2ADC A;  5GAH U;  2AYB A;  1VLY A;  4FF1 A;  5IQQ A;  2MKY A;  1RT1 A;  5KFC A;  4YY3 J;  3LUY A;  3D68 A;  1XTZ A;  3BGF A;  4RNH A;  4ZCK A;  3MUV P;  1GXU A;  1NSA A;  4HTJ A;  3CC4 S;  1JLC B;  1Y4Z B;  3MOZ A;  4ZPA A;  1N5Y A;  2GAG C;  4B3M J;  2ZJP Q;  2D3O 1;  1NK4 A;  4C3K A;  1CS4 A;  4LUB A;  2AT1 B;  3MR3 A;  3ICL A;  1U25 A;  4CH0 S;  1S1T B;  4U8V A;  2W9C A;  3I5A A;  2V4J B;  1TVR A;  2GHW A;  4I68 A;  4GKK F;  1D1U A;  4DR7 F;  4U7U K;  3OTC A;  1PCA A;  2M0G B;  4MKB A;  3M1V A;  4QR2 A;  5A6W A;  1NO8 A;  4DR5 F;  3R5C A;  1UFK A;  5HMW A;  1KLM B;  2JVR A;  1SQF A;  5M2R A;  4M94 A;  3X3U A;  1SKS A;  1ZAX A;  5E3P A;  2OHD A;  1FKO B;  7FD1 A;  1D3W A;  1M5S A;  4TQS A;  2HVD A;  3OL8 A;  3L7U A;  1QTM A;  1VQ6 S;  3QRR A;  3M2V B;  5AJ3 J;  2YY3 A;  2CQ4 A;  2MQL A;  4J9M A;  2HHW A;  2NXU A;  2VB6 A;  4UUW A;  2HHS A;  3PHT A;  2GQC A;  4WBF A;  3CJ4 A;  2NUU G;  3GTY X;  4URG A;  1GAO A;  3BBB A;  4Q2L A;  4FVC A;  4Y2K A;  2PE8 A;  1P8G A;  5BXI A;  3O6Q A;  4QWB A;  5DM7 Q;  1LEO A;  1MMD A;  4WYW A;  2ALZ A;  4K4X A;  1EB0 A;  2Q3P A;  2V2Q A;  2XMJ A;  4KV8 A;  3UE2 A;  1JXL A;  2F9D A;  2IFX A;  2B9Y A;  3PX0 A;  2E1M C;  2QTW A;  3P4U B;  1F5C A;  4FXW A;  1ZM4 A;  3QJJ A;  3IXQ A;  3M2U A;  2HWH A;  1FXR A;  3V4I A;  2HS4 A;  1IM4 A;  3CCQ S;  1XIQ A;  2WOM A;  1NU4 A;  1FRH A;  3CVK A;  3C6U B;  3B4D A;  1S1X B;  3FEZ A;  5LSO A;  3M2R B;  1X5S A;  3CCM S;  4C0O C;  1ZET A;  1M1G A;  2CYY A;  4HI2 A;  3KLI B;  2GX8 A;  3O2I A;  3MMA A;  2PO4 A;  4HKQ A;  3SCI E;  4CCH A;  4GVL A;  2W4P A;  1WD6 A;  3NMR A;  1S1V A;  1R0B G;  4LRA A;  1PC4 A;  4O3S A;  4YB1 P;  3KKF A;  2WBM A;  4RWW A;  4LF6 F;  4IQM A;  5HSP A;  4P9S A;  3TAP A;  4X4R A;  2F8H A;  1RAB B;  4MYT A;  4F0H A;  3AJD A;  1SKU B;  1VLO A;  2EVZ A;  4KHP F;  4KKO B;  1HNW J;  2CA9 A;  4RLE A;  3TZX A;  1NBE B;  3W5Y A;  4C97 A;  3NG8 A;  1TMJ A;  4DLG A;  1DTT A;  4QR0 A;  2B5J A;  4M95 A;  2VV5 A;  3SSR A;  1YJT A;  4RR5 A;  1WSR A;  3HZE A;  4RNN A;  3Q8P B;  4L76 A;  3DMJ A;  5G0R B;  1L3U A;  4DV7 J;  2J6U A;  4NXM F;  2H9Z A;  4ZVE A;  2BE2 A;  1DFD A;  3I5C A;  3BDE A;  2RSQ A;  2AJ4 A;  2XMT A;  2FYX A;  2KFY A;  5EN1 A;  3BKT A;  4B3O A;  1Q82 T;  9RUB A;  2VAS A;  3GLJ A;  3R6G B;  1JNZ B;  2HFU A;  4PYD A;  4OJ3 A;  1NSQ A;  2JC1 A;  2KT5 A;  1Y0H A;  5HN0 A;  2KH9 A;  1R27 B;  4KTQ A;  2CJ9 A;  2PA8 D;  3NCQ A;  4Y2A A;  3CSK A;  2OJ3 A;  1Q8B A;  1W7W A;  2DKO B;  4MFB A;  1RLC L;  3I31 A;  1AZS B;  3IWN C;  3P3D A;  2XMW A;  2IYG A;  3VGV A;  1VR6 A;  5KT6 A;  2F4V J;  1KVK A;  3D67 A;  4CLZ A;  2HYI B;  3JTP A;  4A8W A;  1FTR A;  4CIO A;  2P6S A;  2GC8 A;  2IJN A;  1PJ6 A;  3DLK B;  4IKA A;  3GIJ A;  4DR6 F;  2NPF A;  3D6M B;  4RNO A;  3OD2 A;  2ZM6 F;  3MED A;  1RKJ A;  2AU0 A;  3QT8 A;  1KNZ A;  2VFU A;  1HHT P;  1HQE B;  2IJF A;  1HI1 A;  2LXF A;  2V9K A;  2AQ4 A;  2IRY A;  3GYN A;  3P5B P;  2XHW A;  5AJ3 F;  2VKR A;  4ZLJ A;  2HHH F;  2UU9 F;  1UVN A;  3VAI A;  3OR1 B;  2KZZ A;  3NAH A;  3R7B B;  1S97 A;  3EMT A;  2M8D B;  3MPW A;  3QT5 A;  4BS2 A;  1S1W B;  4FN5 A;  2DXD A;  2J6S A;  3NGR A;  4KHM A;  4UOC A;  2DK2 A;  2QT7 A;  2B4U A;  1JLA B;  4NYZ A;  4HR2 A;  4O3P A;  5THW A;  1JLE B;  4AQY J;  5HQL A;  2Y1J A;  2ZBR A;  4NLU A;  3AAW B;  1KKH A;  2KHC A;  1GMU A;  2R7U A;  1TL7 B;  1VRU A;  4USM A;  2YKA A;  2Q6C A;  1N0U A;  2XY5 A;  5D0G A;  3LGM A;  4ZVU B;  2ZOF A;  2VPX B;  1TL3 A;  9ATC B;  1SPB P;  5HMX A;  4YR3 A;  3BO3 A;  4FPR A;  1RQ0 A;  3DRS A;  2E5I A;  4V1A k;  3V81 A;  5LJ5 Y;  1TP7 A;  5HVG A;  5KFG A;  2HK2 A;  4YP3 A;  1K44 A;  1EAR A;  1WKJ A;  2W2M P;  3VAF A;  2X1B A;  4V19 J;  2HS3 A;  3I0S B;  4QPT A;  1FA0 A;  3MR5 A;  3DLJ A;  5A8W B;  2V5H G;  2AGP A;  1U4B A;  5L1I A;  2IM0 A;  4OYA A;  2VQE J;  4NAS A;  3G86 A;  3OT9 A;  3M7V A;  4ITS A;  3MOJ B;  3ZZP A;  4NEY A;  5B0E A;  4AD6 A;  2W8K A;  1XN9 A;  3LF0 A;  3Q8S B;  3KLH A;  2MQO A;  3AD9 C;  1FXL A;  3VV2 B;  5I3Q A;  3QGP A;  1VC0 A;  3VHQ A;  3BM7 A;  3W5X A;  5F3Z A;  2JFD A;  2XTJ P;  4R25 A;  2KI2 A;  5DLF A;  2YNI B;  1BQN B;  5K8N A;  1AUS L;  1UVI A;  1ZTW A;  3H40 A;  5LM7 E;  2DB1 A;  2YNG B;  1S9E B;  4ZVS B;  2W4D A;  4M5I A;  2ZC3 A;  1ULR A;  2CQI A;  2WAQ D;  4K2X A;  1V9O A;  1BXN A;  5DO2 A;  2M3D A;  4MK7 A;  4WF9 Q;  5HLF A;  3LWL A;  3NS6 A;  4DF4 A;  3OL7 A;  4O4G B;  3HHK A;  1Y3J A;  2YKQ A;  1EP4 A;  3RB4 A;  3HD1 A;  2IAJ B;  3PHE A;  2AJ1 A;  4J9V A;  2B8Q A;  4WCE Q;  2HND A;  2DNO A;  1IKY B;  3PX4 A;  4N76 A;  2HNZ B;  2DGX A;  2C42 A;  1RTJ A;  4PCQ A;  4UUX A;  1VBY A;  2AZ1 A;  1CC7 A;  3NY0 A;  1B3T A;  4EO8 A;  2GVZ B;  3OSN A;  2RNE A;  4C8Z A;  3I0R A;  4PWD A;  2CZ9 A;  4LF1 A;  3N6N A;  4N7T A;  1QY7 A;  1ZAW A;  4B3S F;  3M30 A;  4H4O A;  3R97 A;  3RJM B;  2YH1 A;  1RWX B;  2MTL A;  1H73 A;  1NKB A;  3FK4 A;  3H5U A;  4GO7 X;  1KN6 A;  1U0S A;  4IOC Q;  4A4J A;  2KG0 A;  3QGG A;  2HIY A;  2GS8 A;  2JL9 A;  1QJH A;  4TU7 A;  3MCN A;  4UY8 5;  1WI8 A;  1JLQ A;  2CPJ A;  1IKX B;  1FWP A;  1X4C A;  3I82 A;  1T7P A;  5CHC B;  1HHQ A;  2G2Y A;  1TQL A;  2PSZ A;  1J5E F;  1D9A A;  1LXN A;  4M5N A;  4KH1 B;  3MR6 A;  3OUY A;  3TZW A;  2E5J A;  4FYW B;  3FCV A;  3ZZY A;  2ZHA A;  3QYY A;  2LKZ A;  2B0G A;  3RB0 A;  3UDL A;  2E5L J;  1FX4 A;  1WC0 A;  4C2M A;  3WBZ A;  2B56 A;  1CJU B;  3GG1 A;  3G8T A;  2XG8 A;  2PI4 A;  3JYT B;  2B9W A;  1YWX A;  1VK3 A;  1UL3 A;  2UXD J;  2RML A;  3TOQ A;  3KMS A;  3I5B A;  1RBA A;  4U95 A;  2CNO B;  4WTY A;  2K06 A;  2IA6 A;  2OPQ A;  4RWX A;  2VON A;  2FZG B;  2HG4 A;  1V3R A;  4M5D B;  5A0Y B;  1O8B A;  3OTD A;  4RW4 A;  2D3U A;  5KG5 A;  1HWL A;  3KK3 B;  1E6V A;  1RKI A;  4M8L A;  1YJ9 S;  4MKV A;  1T3N A;  2BZ2 A;  1TV6 B;  4DWI A;  1XR6 A;  5ETN A;  5DRK A;  5U47 A;  1W25 A;  1X9S A;  3SQG A;  4KHR A;  3BV8 A;  3AFG A;  1JJH A;  3MM5 A;  2RVJ A;  3N6L A;  1M5K C;  4MIB A;  1I3O B;  3VAG A;  2SXL A;  3NLC A;  2DJW A;  3V6J A;  2ZDO A;  1IQT A;  3PJ9 A;  1QM9 A;  1RTH A;  5CH7 B;  3T5L A;  4WK1 A;  1NB7 A;  2FTR A;  2HPU A;  3DRY A;  5D3G B;  3IAS 9;  1HL6 A;  1CBK A;  1JLG B;  1U7L A;  2JEF A;  1T9V A;  4DX5 A;  2MYF A;  4TNO A;  1UVK A;  4URQ U;  3CW2 C;  8ATC B;  2LEP A;  3MEG B;  5L38 A;  2ZUG A;  2GZO A;  2VIH A;  1NM2 A;  2XYP B;  2F8E X;  4KIA A;  2V2K A;  2RF2 B;  3H42 A;  3BH6 B;  2V94 A;  1L3S A;  3IP0 A;  4RU2 A;  1U1M A;  4N8N A;  1WEX A;  2NLW A;  1SC1 B;  3U1M A;  5KFT A;  5KT2 A;  2LCW A;  3PG9 A;  1LWF A;  2L3M A;  4NLP A;  3KLG A;  4P7V A;  2E5H A;  1BQM A;  1MRO A;  5KFZ A;  2RB7 A;  4CLW A;  2EK6 A;  4DU7 A;  2VH7 A;  5FII A;  2QC3 A;  2MQP A;  1I94 F;  1RAO A;  4KRW A;  2DR7 A;  3F41 A;  4Q8E A;  2O66 A;  3P6Y C;  4RJV A;  4WZQ A;  1X31 C;  4FXV A;  4LF9 F;  4L3K A;  1C2P A;  3G8Q A;  4NLD A;  4P6Q A;  4N41 A;  2NUH A;  2OI2 A;  1S57 A;  4DV5 F;  3PJW A;  3TQE A;  3MM9 B;  4X66 J;  1HFE L;  4MT1 A;  3ZTO A;  4JI7 J;  1NCL A;  4PG6 A;  3OJS A;  5IXU A;  3FQK A;  1T03 B;  2E1C A;  2HFN A;  4C8N A;  3Q8Q B;  1AFI A;  4C3L A;  4F3Q A;  1TL1 A;  1PC5 A;  2ZZM A;  3ITH B;  5JMN A;  2FVQ A;  3TAQ A;  1UPM B;  3GE9 A;  5DZ6 A;  2I5J A;  3HHE A;  3PW4 A;  1LK5 A;  3TA2 A;  2LVW A;  4ALZ A;  1SV5 B;  2AV5 A;  2FY8 A;  1U1P A;  1BLU A;  2HNY A;  2HRY A;  4PUO A;  1JLB B;  5KFH A;  4ZIT A;  4JI8 J;  4AYB D;  1KOH A;  1T11 A;  3QT7 A;  1TK8 A;  5ETV A;  2IM2 A;  4GVB B;  4C11 B;  3EGV A;  3KDO A;  3DLE A;  2F5G A;  4LSN B;  3IR6 B;  5K8P A;  2LU2 A;  3H2U B;  4NA3 A;  2XGQ A;  4UTG A;  2VPZ B;  4ZP8 A;  4CT8 A;  4NOH A;  3RZA A;  1Y5I B;  4AT1 B;  1IM6 A;  4DZ6 A;  4TVA B;  4JI6 J;  4W90 B;  1I1G A;  2CNL B;  4X4V A;  4IUF A;  3ZNU A;  5HQ8 A;  3DM2 A;  2ZVI A;  2VBY A;  5IWA F;  1K73 T;  2MZR A;  1F2G A;  1REV A;  3C8Y A;  5CAB A;  1T95 A;  5B0A A;  2OH2 A;  2BE9 B;  1WOP A;  4TKT A;  3T41 A;  2Y0B B;  3ISZ A;  2IMW P;  3EJM A;  5GMD A;  1HNV A;  1RAH B;  1TKZ A;  4K50 A;  2GGP A;  3OL9 A;  1IWA A;  4LF5 J;  3AQP A;  2GML A;  4DV6 J;  1Y11 A;  1R6Y A;  5IV4 A;  4B3T J;  3OFH A;  4FKY A;  3MAQ A;  3T9Z A;  2ERR A;  3AH6 A;  3FUY A;  1G4C A;  3SSQ A;  3HVT A;  1PG5 B;  1C1B A;  4ECQ A;  4DX6 A;  2RIL A;  3RU0 A;  5J2N B;  5D0E A;  2GJF A;  4PQU B;  3ELH A;  5IS2 A;  4ICL A;  3K8W A;  1B0P A;  1W26 A;  3ENA A;  4TYB A;  2IPO B;  2Z8Q A;  3DOM A;  2ASJ A;  2IM1 A;  2J9C A;  1ZAV A;  4WK3 A;  3ZZR A;  2VBW A;  4F26 A;  2W8L A;  3W5Z A;  1RHM B;  4ECY A;  1TKD A;  2R2U A;  1F9H A;  3K57 A;  4ED5 A;  3TNV A;  1N32 F;  3D3C J;  2O67 A;  5DG7 A;  2R9L A;  4ZJO A;  4FYV B;  1NJZ A;  4DDF A;  4L73 A;  1HBN A;  4Q0B A;  4F36 A;  2XI3 A;  4I69 A;  4HYK A;  2L9D A;  4USV A;  3KK2 A;  3C3L A;  4DR1 J;  1B70 B;  3SYZ A;  4OI3 A;  5DJB A;  1RT7 A;  1MML A;  1FT8 A;  3ET6 B;  2PFF B;  6FDR A;  3CCT A;  2QV6 A;  1GQE A;  3WHI A;  2Z2Y B;  2CVE A;  2D69 A;  4DPY A;  1FES A;  1S99 A;  1OPZ A;  4K0K F;  1YRX A;  4EUV A;  3W1Y C;  2VL1 A;  3PVX A;  4DR3 F;  2H5E A;  1NAQ A;  3CJ3 A;  1T9U A;  2DGV A;  3KUG A;  3LH2 S;  4YHH F;  4CLS A;  4O3N A;  3MUR P;  1VRT A;  3MPV A;  4GKJ J;  3H2V E;  3M9N B;  2QL5 B;  2AKW B;  1TTH B;  2IJR A;  3LGN A;  5K5M A;  1LKZ A;  4XAK A;  2CJB A;  5KFQ A;  2J9D A;  3HT3 A;  3HX9 A;  1FJG J;  3OSP A;  5I4M A;  1W2B R;  3WQP A;  2E7V A;  4WKR A;  3OV7 A;  5ETS A;  3MD1 A;  5CXT A;  3EYZ A;  2I38 A;  5IT4 A;  2M2B A;  1RBO B;  2BMB A;  1RUS A;  5GAE U;  1TZ0 A;  4X65 F;  3CE8 A;  3KJV A;  4EFA C;  1H2V Z;  1NZ8 A;  2PDA A;  2C2K B;  1GH8 A;  1X9M A;  2ASD A;  1XNQ J;  2WK4 A;  2DPJ A;  1IXK A;  2GV1 A;  5IM0 A;  1U1R A;  1XMB A;  3L9Z A;  1MW7 A;  1RA7 A;  1SJR A;  3FVY A;  2UUT A;  3R7N B;  2V8D A;  2PD1 A;  2RIJ A;  3CME S;  2M52 A;  5F0W A;  2M9K A;  3GIL A;  2EFP A;  3E51 A;  1CJT A;  5RUB A;  2ZJQ Q;  1Z2Z A;  3WC2 A;  1RP5 A;  1EIY B;  1YLX A;  3HT0 A;  1K8A T;  1D0E A;  1FVS A;  2L48 A;  1LW0 A;  1BE4 A;  1QSY A;  2XEX A;  4O0N A;  3IR5 B;  1UJ4 A;  1OMS A;  2KM8 C;  1VQ5 S;  3UVJ A;  4KGZ B;  2IVY A;  2C2O B;  5CYM B;  1X5O A;  4OYI A;  5B0D A;  1R0A B;  2AGO A;  3CD5 A;  4XK8 C;  1TL5 A;  1JQG A;  4J9P A;  4RKU C;  3U1L A;  3V6K A;  2FJE B;  3GP9 A;  4ENO A;  3EGN A;  1BQX A;  1YVF A;  2HQG A;  4UQT A;  1U1L A;  2BAC A;  1PSD A;  4TXS A;  3RAX A;  5GAH I;  3VR1 A;  2UXC J;  4K59 A;  3DRR A;  1IBL J;  2MB0 B;  1OIA A;  4I2Q A;  4F4K A;  3K2Y A;  2HIQ A;  1R8H A;  1BMQ B;  3ONQ A;  4QYZ J;  4DSI A;  4RUB A;  5BR8 J;  1NDL A;  1A9N B;  3S01 A;  4KB7 A;  2N3O A;  1RCO B;  4GC7 A;  1TU0 B;  1JLF B;  4R0J A;  4C8K A;  1ROF A;  4U6P A;  1HBU B;  4EBD A;  4DL7 A;  4NL5 A;  3RG6 A;  4HT5 A;  1YJR A;  4CTA A;  4Q44 A;  1EKS A;  1Q5Y A;  2J7K A;  3CO0 P;  4ZPB A;  4O23 A;  4QYR A;  3B6B A;  2VA2 A;  2PMZ D;  3IBC B;  3PXG a;  3LP0 A;  3PZP A;  1FRM A;  3TQ1 A;  1ACM B;  2R42 A;  1RGV A;  4DBQ A;  2QLJ B;  3AA8 A;  3HP6 A;  4K5S A;  2H5J B;  2ZH1 A;  4NEZ A;  5D4P A;  1U48 A;  1U6F A;  4EYI B;  1FXD A;  2MQN A;  4DPU A;  2ZD1 A;  4OQJ A;  1KD1 T;  3HJV A;  5HAO A;  2C3O A;  2NYI A;  1SQG A;  5J2Q B;  1VQL S;  1UEV A;  2DIT A;  2KVI A;  2I0X A;  4FKX A;  1L5U A;  1RWO B;  2D9P A;  4HEA 9;  4TU9 A;  4C0B A;  4Y2C A;  5KFS A;  2YQ3 A;  1R8B A;  2HW3 A;  2LA6 A;  4NXN J;  2FGO A;  1FNX H;  3DXB A;  2KN4 A;  1IJE B;  2DEI A;  5HMZ A;  2AP6 A;  1Y5L B;  2KM8 B;  2VG7 A;  3HZG A;  3MR7 A;  2XY6 A;  3NRB A;  1F5A A;  2WVE A;  5A8K A;  1YBA A;  2I2Y A;  4DSJ A;  2D3Z A;  2RQK A;  3UCZ P;  3KNG A;  3VGT A;  2MY8 A;  1FCA A;  4DV3 J;  2XM3 A;  1FFG B;  2UVR A;  3IO1 A;  3TVY A;  4YME A;  4ECU A;  2DY9 A;  3NNH A;  4LJM A;  2GFF A;  3OVS A;  1K47 A;  4J9N A;  2BJ3 A;  2EFO A;  4LFC J;  2QA1 A;  3CDW A;  1HNI A;  4A8M P;  5GAG U;  4WE1 B;  3DGP A;  3I32 A;  1GX6 A;  1RTI B;  1WTF A;  2KO1 A;  3H7H B;  3BO2 A;  3MEE B;  3BN4 A;  2B7C B;  1FRI A;  1S12 A;  3S7R A;  4WWS A;  5BYS A;  2A10 A;  3V5R A;  3D5M A;  4ID8 A;  3RAQ A;  1LNQ A;  2R7S A;  3EGZ A;  5KG4 A;  1SC4 B;  1WC6 A;  3M4X A;  1QLN A;  3GV5 B;  1QVG R;  1FD2 A;  4X4Q A;  1QAX A;  3QGI A;  4DV0 F;  3TR5 A;  2OPR A;  1Q79 A;  4RBU A;  2AWZ A;  3Q8R B;  4TY8 B;  1PGZ A;  2OKQ A;  3PJX A;  2KXH A;  2EBG A;  2HFZ A;  4DL4 A;  5L1L A;  1HMV B;  4LSL B;  1ZM2 A;  2CJA A;  3ILI A;  1DHM A;  2DGU A;  3TUI C;  3W9H A;  1NDP A;  2CQH A;  4QZV B;  4LF8 J;  2OTL S;  4CYU B;  4PPZ A;  4RBV A;  3A8I A;  2BYC A;  1UW9 A;  4DF8 A;  3ZTS A;  3X1L B;  2CJY B;  2NYH A;  2RHS B;  5J2P A;  2VA3 A;  4OJ1 A;  4DFK A;  4LF4 F;  4RW8 A;  4P73 A;  4NLG A;  4ED0 A;  3RB6 A;  3TO8 A;  3AB4 B;  3OFE A;  3J7A N;  1XC9 A;  3QAU A;  2E29 A;  1R8A A;  2A3J A;  1WF1 A;  3C16 B;  3H5S A;  4IQX A;  1QTN B;  2ZBQ A;  4WJB A;  3OJU A; 
#chains in the Genus database with same CATH homology
 5CAB A;  2HVE A;  1LWX A;  1ZS6 A;  3VGU A;  1NHK L;  1KDN A;  4EK2 A;  3ZTQ A;  3Q89 A;  2DXE A;  1S59 A;  3WX8 A;  1B4S A;  1VYA A;  4W98 A;  1HLW A;  1NDC A;  3ZTO A;  2HVD A;  3Q86 A;  1NCL A;  3L7U A;  1PAE X;  3EJM A;  3FBF A;  1NDL A;  3R9L A;  4ANE A;  3BH6 B;  4ANC A;  3PRV A;  3VVU A;  1NSP A;  3ZTR A;  1XQI A;  1B99 A;  3NGT A;  1U8W A;  1MN9 A;  1K44 A;  2DYA A;  1WKJ A;  2HUR A;  4AND A;  3VGT A;  3EM1 A;  1UCN A;  3FCW A;  1BE4 A;  4WBF A;  1NSQ A;  4F36 A;  4C6A A;  3B54 A;  4KPC A;  3Q83 A;  1NB2 A;  4O0N A;  2ZUA A;  1MN7 A;  1WKK A;  2B8P A;  5CAA A;  3B6B A;  3BBB A;  4FKY A;  3JS9 A;  3DKD A;  4S0M A;  1NDP A;  2DY9 A;  1PKU A;  3GPA A;  5BXI A;  1BUX A;  4DUT A;  3EIC A;  3FKB A;  1HHQ A;  1S5Z A;  1F6T A;  4UOF A;  3DDI A;  1LEO A;  1NSK L;  3MPD A;  2AZ3 A;  4CP5 A;  3G2X A;  1NPK A;  1W7W A;  3BH7 B;  4F4A A;  3ZTS A;  2B8Q A;  1WKL A;  1BHN A;  3ETM A;  2CWK A;  3PJ9 A;  3EMT A;  3FBE A;  3ZTP A;  2BX6 A;  5IOL A;  3EVW A;  2NCK L;  3VGV A;  4UOG A;  2DXF A;  5C7P A;  3FCV A;  1JXV A;  3EVO A;  3EE3 A;  2DXD A;  3GP9 A;  1F3F A;  3VVT A;  4ENO A;  3NGR A;  3FC9 A;  3NGS A;  1EHW A;  3BBC A;  2AZ1 A;  1NDK A;  3ELH A;  3EVM A;  4DZ6 A;  1NUE A;  3NGU A;  4UOH A;  4HR2 A;  3VGS A;  2BEF A;  3ENA A;  3FBC A;  1XIQ A;  3FBB A;  3Q8V A;  3Q8Y A;  4FKX A;  1NLK L;  3Q8U A;  3BBF A;  2VU5 A;  1HIY A;  4DI6 A;  1S57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...