4ANEA

R80n mutant of nucleoside diphosphate kinase from mycobacterium tuberculosis
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
135
structure length
135
Chain Sequence
TERTLVLIKPDGIERQLIGEIISRIERKGLTIAALQLRTVSAELASQHYAEHEGKPFFGSLLEFITSGPVVAAIVEGTNAIAAVRQLAGGTDPVQAAAPGTIRGDFALETQFNLVHGSDSAESAQREIALWFPGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Structure of Mycobacterium Tuberculosis Nucleoside Diphosphate Kinase R80N Mutant in Complex with Citrate
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 42
structure length 135
sequence length 135
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2012-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4aneA00
1B4SA 2HURA 2AZ1A 3ELHA 4CP5A 3ZTRA 1WKKA 3B6BA 4ANDA 4DUTA 1HIYA 1MN7A 5IOLA 2B8PA 1NDPA 3EVWA 3ZTSA 1MN9A 2ZUAA 3MPDA 1LWXA 1NUEA 3EVMA 3FBEA 1ZS6A 5BXIA 4ANEA 3NGTA 4O0NA 3Q8VA 1S57A 3WX8A 2DXFA 4UOGA 4F4AA 3EJMA 5C7PA 1NCLA 1PAEX 1UCNA 4ANCA 3GPAA 2BEFA 4UOHA 3FCVA 3ZTPA 3ETMA 1LEOA 5CABA 4KPCA 1HHQA 1NDKA 2DYAA 2NCKL 1XQIA 1F6TA 3BH6B 3FKBA 3PRVA 4UOFA 3ZTQA 3Q8UA 1NLKL 2HVDA 1NSPA 1NSQA 2CWKA 1NHKL 4DZ6A 3FBFA 3B54A 3R9LA 3BBFA 3BBBA 4HR2A 3DKDA 2BX6A 3VGVA 3DDIA 1NDCA 1U8WA 1S59A 4EK2A 5CAAA 3Q8YA 3JS9A 3ZTOA 4C6AA 3GP9A 4S0MA 3VVUA 3FBCA 3FBBA 3PJ9A 4FKXA 4W98A 1WKLA 1B99A 1NPKA 3FCWA 2DXEA 4FKYA 3VGSA 3EE3A 1NDLA 2DY9A 1NSKL 3Q89A 1EHWA 3VGTA 1JXVA 2B8QA 3G2XA 1HLWA 3EVOA 3NGRA 2AZ3A 3L7UA 1BHNA 1W7WA 1F3FA 1NB2A 1BUXA 1PKUA 3EICA 3VGUA 1K44A 1BE4A 1XIQA 3BH7B 3EM1A 3Q83A 1WKJA 4F36A 3FC9A 3Q86A 1S5ZA 2HVEA 1KDNA 4WBFA 3VVTA 4DI6A 3EMTA 2DXDA 4ENOA 3NGUA 2VU5A 3NGSA 3BBCA 3ENAA 1VYAA
chains in the Genus database with same CATH superfamily
2W01A 2F63A 2KXNB 2ZM6J 2D3UA 4YB6A 2CQCA 1UKUA 2HNZB 2CJKA 3GILA 2VG5B 3PJWA 4DR6F 1U25A 4ZCKA 4K2JA 2HHHJ 2DNMA 1QTNB 3UDCA 1ZM4A 4USVA 4CO3A 3DOLB 4YB5A 2UZAA 3JQMA 4DOZA 3OVAA 3HHEA 2ROEA 3KMQA 2BX6A 5CYQA 1ZAVA 5C24B 1S59A 3LPYA 2BR0A 4FS2A 2PDAA 4BWMA 3HK2A 2XLIA 3RU0A 2LEPA 2PMZD 4FKXA 2KKHA 2CJ9A 4E8UA 4P74A 3M9NB 2GVDA 2F8EX 4ZJQA 3K59A 2BANA 4CLUA 1JJCB 1TTHB 3IR7B 5KOXA 4B3SF 3G6XA 2ZUGA 4F36A 1J5OB 1RE1B 4O3NA 4WYLA 2ZH3A 2DXDA 2KT5A 2M70A 2WK4A 5J2NA 4MAKA 3IG1B 5HMXA 5EWEA 3WDOA 5IM0A 1F5AA 2OHDA 3MGJA 3KHRA 3OBIA 3D1HA 3E01B 4CO2A 1GXLA 3QT7A 3CNQP 1B3TA 4NLQA 2ZH9A 4QYZJ 3P45B 2VZ9A 4X4UA 1SVDA 3D6TB 1F0XA 2RF2A 4OZ1A 2VHGA 5D0GA 3KLIA 3DLKB 2FJVA 4IFVA 4LJMA 4ZPVR 4AXJA 2CKWA 4L72B 3SFGA 1TMMA 3I55S 4K2XA 3ULHA 4W98A 1ZAXA 1H3DA 3L95X 2XLKA 1JNRB 3SCKE 2FDNA 3G9CA 2J6UA 5CYMA 2YKAA 3A8EA 3C66A 3D68A 5KFXA 2XO6A 4M5DA 1HWLA 3H4DA 4RW4A 3CWJA 3ELHA 2CQ3A 1WKKA 3B6BA 1NO8A 2D74B 2OEJA 1S0OA 4C8KA 3UR3C 5B0FA 3FEXB 5DLFA 3FEYB 4O0NA 5EX3A 2A0FB 1T03B 1NPRA 2VFSA 3PW7A 4BCAA 4I6WA 1DQAA 2UVUA 1WSRA 2BV3A 1S7HA 5EWFA 1SQGA 5KFPA 4JI2F 2HFSA 1IKXA 5EGYA 1UETA 1CS4B 4JYAJ 3SQGB 1RBOB 3GV5B 3HT0A 2GGPA 2R8HA 4USIA 2M5YA 2YKNB 3PW2A 3AOAA 4V19X 2QSFA 2C3OA 1U0SA 1E6YA 2VV5A 3WHIA 1X5TA 2F40A 4TY9A 4U95A 3HF5A 3QT8A 1TKZA 4R0JA 3ILLA 1PKUA 1YRXA 4MKAA 3SDEA 3M30A 2HRYA 1GMWA 1KSPA 3BGRB 4UW2A 2MQ8A 3WIUA 1TKDA 2KT2A 4HDGA 2QV6A 5A8KB 1TVRB 5A6PA 1LKZA 1TL7A 3HHLA 4MT1A 3W9IA 2BKOA 3M1VB 2VG6B 1K0VA 1F9FA 3BEGB 2FHMA 3CJKA 1PC4A 2MZRA 4F02A 4IUFA 3PJXA 2UUCJ 2VPYB 1CQMA 4ZVSB 3BO2A 3ETOA 2VONA 1OWXA 1LW2A 3K8VA 2M8DB 2GX8A 5DZ6A 2DGVA 4NEYA 4H4KA 2B4PA 4DV6J 1XNRF 1S4FA 2J0WA 3L7PA 3VVUA 3CGIA 3WZ0A 4ED8A 3TWZA 2DNKA 3KG4A 4PYDA 2O01C 1U1KA 3R2DJ 1B7YB 1Y5LB 5LOQA 1X60A 1G4CA 3R2CJ 2E44A 3DU6A 3OR2B 3DDNA 1GMVA 2B9WA 2ZKUA 3CCWA 2JFDA 2OAUA 2XZWA 5L1IA 4GO7X 1X8DA 5D4NA 4I69A 4K4VA 4J9RA 1BQMB 3QFWA 2KXHA 1S5ZA 1JLGB 2EW9A 1HNXF 2HHPA 5K5MA 1X7VA 4N5SA 2AZ1A 3LP1B 3VALA 4FF3A 4DR7F 3HI9A 5IWAF 1C2PA 1RLDA 2ZH1A 1F60B 4DFPA 4PCQA 3W2WB 2BE2B 3EJMA 3H5UA 3UD4P 1N56A 2G1DA 1TKXA 2J8AA 3CXCR 1YRUA 4DPWA 3IRXA 2XYHB 4CO5A 5DO2A 2H4WB 3M8RA 1S4EA 1BMQB 3DMJA 1DAXA 4Y28C 4USTA 4U7CA 2J6SA 4B3TJ 5IXUA 4UZCA 3CCRS 3OJUA 1EAYC 4DR1F 5B0CA 1K1SA 2VDIA 3LO3A 3AJ1A 3MMAA 2J7KA 2DNLA 1JB0C 1XJWB 2WOMA 2XB2D 5LMUJ 2JC0A 2WVDA 4RWWA 2Z2ZA 3UWTA 1WNEA 3BS9A 2Q6BA 5E2QA 4DR6J 4G1IA 2UVWA 1N8RT 1UJ5A 3KXDA 4DCOB 2BJ9A 1VBKA 1UWAA 2KI2A 1ZS6A 3I9ZA 4DL0C 3V6DA 1VBXA 3NMAA 1RWVB 2DNPA 1NH7A 2DISA 2Q1LA 4Q8EA 4ATNA 1QUPA 4OHWA 4DQRA 5AXKA 4YDXA 2FY1A 2R8GA 1R6YA 3GV7B 3RG6A 2OPPB 1CJTA 3EZUA 4S0MA 1FF2A 3C15B 3KLHA 4TQRA 3KK1A 2ZKTA 2DGTA 5AXLA 1NDLA 2FJAB 2IM2A 3X1LB 4KAIA 4OJGA 1RTDA 3CMES 2MJUA 3C6UB 2JHEA 4I0WA 1K44A 4B3RJ 4BS2A 3VVTA 4J5OA 1Q7LB 4H4OB 3RYLA 2YNFB 3V4MA 1S1WB 4LF7J 1VFJA 1KTVA 4OLOA 4ZKAA 4HL9A 1Q86T 2DO0A 1RAAB 1Z2ZA 4RW7A 2XY5A 4LF4J 1REGX 5LM7E 3VQSA 2G1HA 3U1NA 2FIUA 1RA7A 4QW9A 4ZN3A 2MKSA 4YP3A 1NK7A 2K3KA 3J81Y 4DSKA 1HBUB 2AJFE 3FKBA 3G8TA 5HK4A 3EGVA 4X4VA 1X0FA 3H42A 4MK8A 4DU8A 5A6WA 2CAJA 3NAIA 3SBMA 1TUVA 3AOBA 3KKFA 3KK2A 1B70B 3FGVA 5LSRA 2HVHA 2P5VA 4PQAA 3WC2A 2OIHA 2OSQA 1T9YA 4B9NA 4ED3A 2V50A 1S76D 5CXTA 2XHWA 2VPZB 3KG1A 3QZ7A 3KJVA 2GQQA 4FVMA 1X0PA 5KFGA 4EU0A 4ICLB 4X66F 1N5TA 4ECQA 1AW0A 2IJRA 2CADA 2KFYA 1B64A 3OHAA 1AROP 4KGXB 4O3OA 2HNDA 3O3LA 4C4WA 4DUTA 4M5GA 2F8HA 2KB2A 3US5A 2CNOB 4K4SA 1NDPA 3BQ0A 4JUZA 6FD1A 4A8SA 4J9MA 3CJ3A 3MR5A 2YPZA 2J8SA 4YEAA 2XULA 3FQLA 4BDPA 2VL1A 3JSMB 2R7XA 4OYZA 2LXIA 2DCUB 4WFZA 4C3MA 3KHLA 4NA3A 3IAM9 3MAAA 2LA4A 2OPSB 3BSCA 2V5HG 5CZVA 5H9EK 1AFIA 2ZE2B 4K5RA 6FDRA 1P9QC 1HW8A 3MEEA 1RT7B 4KC5A 3FBCA 4Z2XA 3OFFA 1WF1A 4EWTA 2KZMA 4J9LA 1C1CA 2CQIA 2UXCF 2B8QA 1KN6A 4I6YA 4H54A 1VHFA 4DFMA 2VJUA 5A8WA 3N9UC 5ETNA 3SSSA 3H40A 1HL6A 1RT1A 3ITHA 1X9SA 1UVKA 2Y8WA 4ILMA 3ENAA 1KLNA 2HLTA 3C16B 4RW6A 4N56A 1X5SA 4WFYA 2YQ1A 4KV8B 4RX6A 1A6LA 2X51A 3S6EA 2IRYA 3E3XA 4ZVEA 1UA0A 4NLRA 2IBOA 1I6JA 2K8GA 1DARA 3I4HX 1REVA 3HPOA 1M1HA 3W63A 4NWBA 2GVZB 2ASDA 4AL6A 4I68A 1MG7A 4FYVB 5KFUA 2HIQA 1P6TA 4YR0A 4YB1P 1HD1A 3ENVA 1RAGB 1JLQA 2O5DA 4JI7J 1NSAA 2UUWA 2X1BA 1HHSA 5HBMA 2A3JA 2CRLA 1U0HA 2V6AA 1TL3B 1UFKA 1RUSA 1GFWB 1W2IA 4ZVRB 1BHNA 1X5PA 4ECRA 3SSQA 3B8HA 1RBLA 2GW8A 2RJZA 3D7SB 1J27A 2BW7A 1YK9A 2DGWA 3BB5A 4Z7YA 4ZCMA 5KFQA 1VCTA 1T95A 2MTLA 3KLGB 2Y9HA 2I5JA 1YJUA 4AL7A 1N5YB 2HHUA 1HIYA 4DV5F 3ISNC 3HHDA 4NE9C 4DV4J 1NZAA 2HFNA 2ZUAA 3IBWA 1R0CB 2QL5B 2K7KA 3TZYA 4TYAA 2OTJS 1SXLA 2QA2A 1YHQS 1L3SA 3C14A 3MMCA 2B9YA 1TUGB 2R8KA 3BH6B 3O8WA 3PG9A 1JIHA 2DO4A 4DMZA 4AQYF 4JI8F 3TVYA 3QMQA 5MLCV 1O0PA 5E3PA 1F9EB 3Q8QB 5LMNJ 5DDOC 1SIZA 1T3NA 4ELVA 2VQEF 1KR4A 2DHSA 1S6QB 2DNRA 2F4VJ 1Q53A 1NJWA 2V2KA 2AWZA 4EO6A 1RAOA 2R2UA 2KG1A 2W4CA 4WKRA 2DHAA 2JC1A 2XYGB 1YJ7A 1FEEA 4U67Q 2VUGA 2ADBA 1XR6A 3G6ES 1RCXB 3HSGA 3BQ1A 3HSZA 4DL5A 2HBRB 2HURA 1YJRA 1R8BA 2HFOA 4L3NA 2N7CA 2XMUA 3BM7A 1U1RA 3GIJA 1JQGA 2C28A 4ILLA 1D9DA 1LWCB 1YITS 3TJAA 1SC1B 3GMGA 1RHKB 3IWXA 5F8MA 4ID5B 3T1HJ 1VRUA 4ZHRB 4FBUA 2GMLA 2UUBF 3OLBA 4ED1A 7AT1B 1BQXA 1UEKA 1HNWJ 2R7UA 2A10A 2XMAA 1SV5B 2DEJA 2WRMA 3TARA 1Y00A 4DSFA 3OVBA 2GQ2A 4DV7J 1B99A 2J9DA 2AX0A 5HAOA 2K06A 3THTA 4QOTA 1VLOA 4M94A 2RNEA 3HDSA 4NYZA 1HWUA 5C42A 1PBUA 2DEIA 1R3NA 4DSIA 4USUA 1NXIA 2YWFA 3NRBA 1S1UB 1U6BA 2UU9J 4C8NA 4HEA9 5J2QB 4K50A 1N5VA 4CWBA 1H2TZ 2DPIA 5J1NA 4ZMMA 1WHYA 1ZETA 3QWPA 3K5NA 3NGTA 2FUG9 3D3BJ 1F5BA 4F67A 5CYQB 3DRRB 1PAEX 3GJSB 2LLZA 3W62A 5ETVA 3V5RA 4E2FB 2FD2A 2G2OA 4DL2A 2KM8B 2V4QA 2Y8YA 3CIMA 1HNVA 5DJBA 3OL7A 4PAAA 4X65J 2QFJA 3BO4A 2AHOB 2GVDB 2BANB 1RT6A 3EXYA 1S1XA 3OTCA 3H20A 2FVRA 2VA3A 4XIUA 3DOMB 2DITA 1TKTA 3PY8A 5I42B 4J9OA 4U7UD 3VZIA 3CJ4A 5LT5A 4YMEA 5J2NB 4DR3J 3RBXA 3P5TL 2VDHA 4KQZA 3V4IA 1UJ4A 4IFYA 1SQFA 1WKJA 4B9LA 1KDNA 5A76A 2PEBA 2NZ4A 4MYUA 2VFTA 1QLNA 2X3GA 3IAS9 4DR2F 5DQGA 3G86A 4EEYA 1WC5A 3EDQB 1AZSB 2RF2B 3MCNA 2YKPA 2XMVA 3KLIB 2M4MA 3I31A 4MH8A 4NLVA 4X4RA 2VFVA 2V8PA 2OSRA 4DQIA 1HQUA 1TUWA 2J9DE 1P8GA 1MROA 3PDNA 3T6JA 1S0MA 4GO5X 3MM6B 2VODA 2CPYA 5CYMB 1KQSR 1PJ5A 2AU0A 2BOAA 1KC8T 4I7FA 3TUJC 4ALZA 2R8IA 1JJ2R 3LP2A 3OFHA 2WZ1A 2W9BA 5THWA 3OXFA 5HP1B 3D0IE 1EETA 4NLXA 2ASLA 1FDBA 4KKOB 2KG0A 4GMKA 1RYRA 1PYOB 1IJEB 4IOAQ 2DNNA 1ROFA 1WDDA 4WYWA 1S48A 2XMWA 2RKIB 2AEFA 2HRTA 4USJC 4JI4J 1NNDA 2ROGA 1IKXB 4B3OB 2AEJA 4X4TA 3MXHP 2E29A 5K20B 1NKEA 2XMTA 4NRTA 2HFZA 1XQIA 3F0NA 4CLTA 1RT2B 2VPXB 4Y2CA 4CH7A 1RK8A 3FQKA 1Q81T 2IA6A 2DH9A 3DDIA 1N33J 4TLQA 1V5IB 3MECA 3VZHA 4R8UA 4ECTA 4P7VA 4A48A 4DLGA 3KLEA 3IR5B 2JNJA 4DG1A 3CF5Q 4RPFA 1TL7B 5J2MA 3IR6B 4F26A 4CT8A 4OHYA 2POKA 4DSEA 3C3LA 3PRBA 3H2UB 3CJKB 4M5MA 3OT9A 5KFLA 4KRWA 1VQSA 1SC6A 5HQMA 1MN7A 2HHTA 4ZCIA 3OSNA 4EFAC 1URNA 2EFOA 2HW3A 2NYIA 3Q8VA 1AYEA 2BABA 4OZ3A 3P6YC 1Q5VA 2VQEJ 4CLKA 1BLUA 5HROA 2BJDA 2JEGA 1IM4A 2FLPA 4YB7A 4ZVFA 1S10A 3DC2A 3DGVA 2VQFF 2AX1A 2WB1D 2BJ7A 3P5BP 4KGKA 1GH8A 5HLFA 1S79A 3SI8A 3AODA 2Z8QA 1A7GE 3D1QA 2BE9B 3H2VE 2Y1JA 1PJ6A 2UXDJ 2QGFB 3DRXA 2K1RA 4UY85 5U47A 2MKKA 4CLPA 4A8QA 4DV1J 2N4CA 2HBZB 4RWXA 4JP8A 3CJ5A 5JVGQ 1T8EA 1HR0F 4ZCLA 1FX4A 4NXNF 1LWFB 1RACB 4P52A 2BYCA 4I2PA 4CLSA 4DLEA 3LAMA 2W7PA 2JRSA 2E9TA 2FTRA 4OX6A 2UUBJ 1KP6A 3IRXB 2PE8A 4AXIA 1JKHA 1FJGF 4PEOA 3W66A 5IQ6A 4ECZA 3SEOA 4PG6A 4KJIA 2AEMA 4XDDA 2LVWA 4XTTA 2IC3A 2DIUA 3HKZD 2R2SA 1UTAA 4LR9A 2WOMB 2CNKB 3OPKA 1Y5NB 2L9NA 1IBMJ 3MAQA 1QE1B 4ZP7A 5IT4A 2YH1A 1S72S 4P2MA 1HI8A 3TA2A 4PQUA 4C3KA 3G71S 2XY6A 3TA0A 2R7QA 4K5SA 1G2EA 3L3CA 1Y11A 1NJYA 2JSXA 4F3QA 2IJFA 1IKYB 2KVQE 2Z0GA 1RKIA 2IM1A 2XHCA 1J5EF 3L9ZA 1NB7A 3V6DB 1KHVA 3ICLA 2R7SA 1RHMB 3Q23A 3BBCA 2KRRA 1FFWB 3DLEB 4URSA 4QR0A 5DGAA 1N0VC 3DNCA 4UT4A 4DSLA 1Q8IA 4ERDA 3T5KA 1MMNA 3JAMY 1HMVB 2W9CB 4YOEA 2BQUA 4IH5A 2JWNA 1CJTB 4XPCA 4LBHA 1FKOB 4LF6F 1MWZA 1LEOA 2DTJA 3JAMU 4JI6F 1RTIB 5AE1A 3CT9A 4IDKA 3R5GA 3UDEA 1VOMA 2YKOA 1UVIA 4PWUA 1UVMA 4RJVA 1HKAA 4DBQA 3T1YJ 1NJZA 1VHIA 4CI0B 1T05A 4LSLA 2E66A 4IG0A 2YNHA 2O3DA 3EE3A 2G2YA 1S7IA 3CCMS 3T5HA 4U7UK 1L3UA 3RZAA 3L7UA 1UVLA 4DX6A 5ADZA 2J0QD 4DXLA 2ASYA 4F8RA 2ZHAA 4Q5VA 1URRA 2ZOGA 3AB2B 1WEZA 2B5JB 4Y3CA 3JTNA 3IS9A 1H7XA 4FPRA 2RU9A 5CH7B 1YLXA 5A8RA 4RKUC 5IOLA 1RWMB 2VG7B 4PXCA 3J7Z5 5KFSA 4NZ0A 1GQEA 4N41A 3PYEA 5T14A 3KK3A 4Q2LA 2QYCA 4QYRA 1RT3A 1HBNA 4NXMF 4LF5J 3GWCA 3BF4A 9ATCB 2XS2A 2KL8A 3M9MB 1NM2A 4ECYA 3KJVB 4B3MJ 1FT8A 3H5XA 2DRBA 4MFBB 4ZIVA 3M2RB 1NEEA 2RHSB 3DRSA 2J5AA 3J7A1 3THVA 4LT6A 3D54A 3BGOP 1NPKA 1UWBA 5D3GA 1S0VA 4NYPA 3SSRA 1TAUA 3RB0A 7FDRA 2CIMA 2F5GA 3SV4A 5IQQA 1KQKA 1RTHB 4HHHA 4BWJA 3N5FA 2C3YA 1BUXA 5IT9Y 3ISZA 2J0SD 1S1VB 1YJNS 3OV7A 1R8PA 1BQNA 2GIQA 1C1BB 3KUEA 2CQ1A 4WPAA 3UVJA 3GR0A 3B4MA 1JLAA 4ZVTB 5IT9U 3MTKA 5KT2A 2QG9B 1I94F 2J7WA 1A0OB 1MNEA 1KOHA 3H25A 3MEEB 2YWHA 2QL9B 3QNWB 1TK5A 2J0XA 4IH7A 4Z37A 3H5YA 1QAJA 3Q0AA 5DM6Q 4C11B 2CQDA 1C1CB 3M8PA 2MLYA 2UXBJ 3RBZA 3H7HB 3SQOP 1KQGB 3LQVA 1NDCA 1FRMA 5A8WB 3OD2A 4NYOA 2E1PA 3EDRB 2DR9A 4QIEA 3WBZA 4HTIA 1TFYA 1FE0A 2EFGA 2HQFA 4NMLA 1Q7YT 4IR1A 4LFAJ 4ITSA 5BJRA 2WW8A 2JZ5A 2YWEA 5KG6A 1EIYB 3MZIA 1FRLA 2XLJA 2VIHA 2DY1A 3KUGA 3GYXB 1FJEB 4YDDB 1R0BG 1UJ6A 3CJTA 3M2UA 3UCGA 3QAUA 3VAJA 4K8RA 1WC1A 2HRUA 4OHXA 1SJ3P 1XMBA 5K9FA 1PO6A 1M1KT 4KFBB 2HBQB 2HSEB 3I5AA 1JLQB 4F7VA 2QFIA 3NL0A 4OYMA 2W2QP 4Y34A 1FWLA 3BN4A 3OL9A 1P9YA 1U0HB 5F8LA 2KH9A 4MKVA 1TAQA 1R0AA 2HK2A 4JI1F 5KFFA 1EB0A 3FVYA 1RT5A 1UW4A 4MKBA 5KG1A 1PIEA 3NNHA 4PUOB 1QUVA 2FB0A 2LXFA 1TELA 3AD8C 3G87A 3T9NA 2I9SA 1NSKL 5I3PA 1S49A 3QWUA 4ZIWA 1B7FA 2AYGA 2H9ZA 5J2PB 3LWLA 4M5JA 5L8RC 5H9EJ 3R5BA 1LQ9A 5JUMA 1YKWA 2V8VA 1PYSB 4DV0F 4Q8FA 2KU7A 2F3JA 1FJ7A 2MPUA 2PA8D 2V8HA 2PSZA 3K57A 2AKWB 2Z30B 3ILIA 2LDYA 4XPEA 3EPGA 4ED4A 2FHJD 3QATA 2DXFA 1KNZA 2DH8A 2VASA 3KJQB 2ERRA 1HI1A 2N4DA 4OQJA 3ENQA 1C0UB 6AT1B 2WONA 4LREA 1JNZB 9RUBA 5HO4A 1UVJA 3L09A 8AT1B 2Q3PA 1DTTA 2X1FA 3TAPA 5F8JA 4ECXA 3DYAA 2AYEA 4X62F 2I1RA 3Q8YA 4ZLPA 1RTJB 4L6V3 3HXMA 3NMRA 1ZOTA 4K7QA 4AE5A 7FD1A 1E6VA 3W64A 4G3IA 1GMUA 1JJHA 2Z2YB 4ED7A 2V94A 2DNHA 1O6XA 1CLFA 5D78A 2V8DA 3ZZZA 4LF6J 4EBDA 3RAQA 2N7YA 1IXKA 3QZ8A 4HVZA 2LECA 4M5IA 3DOKB 3TEHB 3G4SS 4JI6J 1TV6B 1AXQA 1SJQA 4XDCA 4YHHF 2COLA 1FA0A 2Q66A 1U6FA 1PSDA 1GEHA 1UL3A 5L1JA 1Q5YA 5JXSA 3W3SA 3CC7S 4D3HA 1VC0A 2MKJA 2YH0A 1XR5A 3IRWP 3QIPB 1OPIA 4DZ6A 4DV2F 3CTRA 4RUCA 2XSJB 2KN4A 4DZDA 3OW2R 3TQEA 2BJ3A 2IRXA 1SUQA 3O5TB 2E7VA 2ACMA 3DLHA 1D0EA 3S8SA 3DDKA 4P75A 5AJ3J 1HPZB 4J90A 2P9CA 4AYBD 2EI5A 2ZHOA 3KHHA 1RGVA 1D8ZA 2ASJA 3W5XA 3W65A 3FRZA 2OGUA 2ZOMA 5KG4A 2ALYB 4WP3A 3BH7B 1AUSL 1N32F 4RUAA 1DQ8A 4NLWA 1ZPVA 3W7BA 1CG2A 4KHPF 3D66A 2XNQA 4P10A 1VQKS 5E33A 4TU8A 2BXJA 2NXJA 3P96A 4ZPCA 1LWEB 5KFVA 2EXUA 2GJ2A 2EFQA 2HNYB 4X2BA 4I2QA 1TKTB 4OZJA 1QAIA 4RNFA 1SI9A 1NSPA 1IBKJ 2MZTA 4DR5F 2BBEA 3BSOA 1Z2LA 4Y2MA 4GKKJ 3MEKA 2JL9A 3UR0A 2APOA 2K3IA 4EI2A 3H4BA 1RI7A 2ZD1A 3D0HE 1JLEA 1KOOA 2LYVA 4TN2A 4DN0A 1UEUA 4ZS6A 4NMXA 3G2XA 1KTQA 1R27B 2H5EA 3RRKA 4OI2A 2FJBB 2ILYA 2OTLS 2YX1A 4Y65A 1U02A 1Q8BA 2FPHX 2MSTA 1N54B 1Y4ZB 3QBCA 4O4GA 3VCDA 3HVWA 4RBUA 3CCES 4F4XA 3TYTA 5C25A 3LGHA 1TL1A 1B0PA 5EN1A 2XMMA 3M8QA 1QVFR 3PKMA 1ZA1B 1HNIB 3R5DA 3H59A 1RWXB 3M6XA 2B4UA 1VK3A 4K4ZA 3RB3A 4B08A 1T9UA 2VB6A 2XCAA 4V1Ak 5CYJA 1U8WA 2QX0A 4EK2A 1VMBA 3RB6A 2MY8A 1QDUB 2KTQA 3GP9A 4JI0F 3V6HA 4M5NA 1WJ9A 4LVOP 4J9UE 5HANA 2BW2A 1SC3B 5ETRA 4PZVA 1SL0A 2J9CA 5GAHU 3TAQA 1AUDA 3Q24A 1XEZA 3POTB 4CH0S 1W7WA 4KHMA 3LALA 4LRAA 2NXCA 3ONQA 5IC4B 4ED0A 1WC3A 2RT3A 3K8WA 4NCBA 3CJSA 3DRPB 5CCLA 4A8FA 2RD5C 2FLNA 1S9FA 1XK8A 1IWAA 3N28A 2AYMA 3RR8A 4ZP8A 4TVAB 4ZVPB 4EZ6A 3A12A 3DLGA 2EK6A 2GHWA 4ZA1A 5BXIA 3GYNA 3CO9A 3GIKA 1XTZA 3KUHA 3W5YA 1WOOA 5IFMA 3V2UC 2HVZA 1YIJS 4UUXA 3EWGA 4OZ2A 4DF8A 1CEZA 1FERA 2NSBA 1KVKA 5HI7A 3B4DA 1S9EA 1RT4A 3TR5A 1RU2A 2WB4A 4LF8F 1FK9A 5G4DA 4RUBA 3TUZC 3KLFA 5J2MB 2R7OA 2P6TA 2AGOA 2MMYA 2RDJA 2BOPA 5GAGI 3ZFVA 1JLBA 3IGVA 4HH1A 3IWNC 1EHWA 4ZPBA 5CCMA 1DTQA 2PA3A 1UW9A 3VAHA 2IVYA 4HACB 4CNYA 3JSBA 5RUBA 2HPUA 4U8YA 3BGFA 3MM5A 2GJFA 1L3VA 4DN9A 2DH7A 5HROB 1K8AT 3C8YA 3ZO7A 3A8KA 4CP5A 2E5HA 1T94A 4QWDA 3JQJA 4ZVQB 2YNIA 4HHUA 3ET6A 3HVTB 3DCAA 3TVKA 5C7PA 2HMIA 3A3OB 4F3MA 3LGMA 1QSLA 3MEGA 5BYSA 2IAJB 2HQGA 1U2RA 3LANA 3WIVA 2MQLA 1KWMA 1ZTWA 2K1RB 8ATCB 4EGLA 4LIRA 3AA8A 1M5OC 2RQMA 1HBOA 1FWKA 1K47A 2QLWA 4Y0FA 3SMZA 4J9VA 3AOCA 3PX4A 1NK0A 4KBIA 5A2QY 2JLEA 4NRUA 4PWDB 4N8OA 1OO0B 3HSJA 4PYAA 4GVBA 2AJ2A 1SJFA 1NB2A 1YI2S 2DKOB 3KHGA 4RBTA 1VQ9S 2BACA 1S6PA 3R6GB 5K14A 1UZDA 4Q0BA 4LBPA 3MPVA 1U48A 3RRHA 2XEXA 4U8VA 3I6PA 2HWIA 4JB8B 1Y7PA 1GXTA 2IC3B 4FP9A 5B0EA 3DI6A 4QYZK 1MWQA 3UI3A 4DUZJ 2QSWA 4ECSA 5CD4A 4C8LA 3DLJA 3OHBA 2CZ4A 3NBPA 2Q79A 3RUBL 3GPAA 3PXGa 2BVZA 1XMOF 2CVEA 4WCEQ 4PQUB 4DL7A 1KEKA 1JWWA 2VBYA 1UMJA 3CCUS 1ZM3A 2R2RA 5BR8F 3SCIE 3CDEA 4QCLA 1JMTA 2ZEJA 1SBRA 3VTIA 2E1CA 3W61A 2KRBA 4ZPTR 1NBEB 3C2PA 2AJ4A 2R7VA 4KHPJ 3FCWA 5KG2A 2IPOB 3Q89A 1H73A 1Q8KA 3HZGA 1SH0A 1YX2A 5GVQA 3HVAA 3M32B 2CJBA 2L9WA 4JV5F 2MZSA 2VG5A 1QVGR 1D3WA 1RWNB 1EJ7L 1IKWA 5HQ8A 1M90T 5GADI 1PC5A 1BC6A 1H72C 3DOLA 4ENOA 3QQCD 2C22A 4ZVOB 3DLLQ 2CJAA 2AGQA 1NK9A 2CXEA 3J81j 2XI3A 1BGXT 2OH2A 1W25A 3TO8A 5CD4H 4QR2A 3TVZA 1MU2A 1YRTA 3F41A 4PG5A 3CDWA 3NWRA 4F25A 3MCSA 3CCLS 4A8MP 2B43A 2B4VA 5KFRA 3J7AN 3NNAA 2XGPA 2H54B 4LSLB 4CCHA 4C48A 5F8NA 5F8HA 3R7BB 4A46A 1K9MT 1X31C 1FI4A 5J1EA 1UZHA 3NS5A 1J5OA 3LWMA 1HHTP 2HQDA 3CDAA 3IG1A 1HD0A 3U27A 2HG4A 4I64A 3GIIA 3UCUP 3MD3A 3BO3A 3DFEA 3UFCX 3IS9B 2CZVC 3CD7A 1N5SA 5KTQA 4JI5F 2W8LA 4EYIB 1GTEA 2QMUB 3TZXA 2G9OA 3A3PB 3SFUA 1FWPA 4O23A 5E0OA 5K8MA 2HHWA 3MCOA 4DU7A 4FF2A 3LOUA 1KFDA 1HBNB 1IKVA 1Q16B 3DLKA 2ALZA 4ANDA 3PIPQ 4FVCA 3D9BA 3T5JA 2H5JB 4GKJF 1N36F 4C8OA 2XCPA 2DJWA 2LEAA 3GIMA 1SIWB 2IJNA 2KHDA 1GTHA 1WHXA 1FDAA 3R7SB 1Z4UA 3K17A 5D3GB 4LF9J 2IYIA 3TUPA 2Q43A 3QO9A 2XO7A 3BBBA 4FN5A 5KFIA 4F0MA 3TNVA 5KG3A 4QU6A 2MLXA 4DPXA 2B7CB 2Y1RI 3ZTOA 4MIBA 2O66A 1CJVA 3E2EA 1FKPA 1FHTA 2RDIA 3NY0A 4K0KJ 1GK8A 2GA7A 4G65A 3M9OB 3VGTA 4DV3F 4CTAA 1JLAB 5KFYA 4HKQA 1T03A 3MM7B 5T7LB 4IQMA 4KGZB 4X4PA 4WK3A 3Q83A 1FRHA 3OLAA 2C3UA 5L39A 1CSJA 2P9EA 3D6HB 1U49A 1CS4A 3JXOA 1FRXA 2DGXA 1YZ6A 3CO0P 2ZBPA 3MI7X 3RR7A 2DNQA 1U8SA 3DHXA 2WVBA 2BE7D 3QIDA 1S57A 2CJQA 4NI2B 2DNZA 4WFXA 1LW0B 1XNQJ 2ZJRQ 1CJUB 1NMEB 1T9VA 2AQ4A 5JVHQ 2BJ8A 2DHHA 3K5PA 2NCKL 5KT6A 4C97A 4FYWB 1NLKL 2MKYA 2BA9A 2J7UA 2IHR1 3V6JA 3EYZA 2NPFA 1U4BA 2A2CA 5A8KA 1TVRA 4NLDA 5KFCA 2DGUA 4USHA 2VICA 1WHWA 3EGZA 3M2UB 1QJHA 3JTOA 4LFBF 2VG6A 4EUVA 1K73T 2MKCA 4MJKA 2M7SA 4KIAA 4QBUA 5A0YB 4UTGA 1YJVA 1FTCA 2XS7A 4DFJA 1N34J 3T1AA 1X9MA 4CLZA 1Q8LA 1JK9B 4AL5A 4R5PB 1H74A 5GAHI 1SJ4P 4Q7AA 2C2KB 2YWKA 1R0AB 4OI3A 1UPPA 3SCJE 2QO3A 4FNHA 1OYEA 2B7BB 2CNNB 1WACA 2ZVIA 2HHQA 1VQ6S 2HS0A 2RH3A 2W2PP 4IOBA 5KFNA 2OMOA 4ELTA 2D7SA 3EX7B 2I38A 1R8HA 1IBLJ 1BQMA 4QWEA 3V81A 1JLGA 4IQXA 3NG8A 2EBGA 1UVNA 2N3OA 4X64J 4A4JA 3GLJA 4OI4A 3FUYA 1GMWD 4P2SA 4KGVB 4NA2A 2WVCA 2BE2A 4YY3J 2E5LJ 3AXKA 1HI0P 2CWXA 2F8MA 3U02A 4N8NA 3WQPA 3FDSA 3M8SA 2YKMB 4I4BA 3GG1A 3LUYA 3HHLD 3ZZPA 3GCXP 2HS3A 3C19A 1B4SA 2DHGA 3JSRA 1G1XA 2LCWA 4DF4A 4MIAA 1DTTB 2ZNZA 1OJ4A 5E3AA 4QW8A 5AE3A 1CJKB 5E7OB 3FCHA 4O3SA 2GV1A 1F1BB 4R0EA 5KFJA 1TFWA 2QLXA 3R8YA 4NA1A 1D1UA 1YJ9S 4CIOA 1E6VB 3P49B 2DBBA 3UN5A 3ZNUA 5K8OA 4JI3F 1Y3JA 3PKYA 1SQEA 2A2DA 2E9ZA 3PW0A 1NK5A 2ADCA 3MPWA 2CPFA 3UCZP 2CQBA 5KFWA 2MZ1A 2IM3A 2FVQA 3CMQA 1OMSA 5D77A 4ZN1A 2U2FA 2JEJA 1XWLA 5M2UA 4DCPB 4A47A 5DETA 4YFUA 1R31A 2HVEA 2MQMA 1U1OA 1L5UA 4QJVA 3EVMA 3GR1A 3LF0A 1DHMA 4NL5A 4O3PA 3TQ1A 1IQTA 1EZZB 5EHHA 1D8YA 1S0NA 4LUBA 1VQ8S 4J91A 5KFBA 3MM9B 4B3SJ 1TMJA 3ZZYA 5HVGA 2JVRA 1OQ6A 3D1OA 2CYYA 4LFCF 5HVHA 3C6UA 2HS4A 3IN5A 1Y3KA 2A1BA 4O44B 1RXOB 2DK2A 3TAMB 2LQBA 4DQQA 3BDPA 3DKDA 3IC1A 4DR4F 3QJPA 4TU9A 2UV8G 4H4OA 4KT0C 3JS9A 2AP6A 1M5PC 2YVSA 2ZM6F 1HQ2A 3ENWA 1G3OA 5B09A 2KJVA 4ZVGA 5ETMA 3VAIA 1ELOA 2X1AA 2P2CB 2AV5A 2ZOFA 1SKUB 2YXLA 5KFDA 3GIRA 3D3CJ 5D8HB 4GKJJ 2HHHF 5D4OA 2DCLA 2IDLA 1VIXA 5IC6B 2U1AA 2XZDB 2EC2A 3AXMA 4NX9A 3I32A 2CPZA 2RSQA 1RWWB 4QIWD 3H90A 3T3FA 1PBAA 2H5IB 2RRAA 2RQ4A 2LQJA 2RHQB 3NWGA 1B0TA 3MR7A 2FZCB 2C2MB 3HM9A 2OMLA 3J81U 3R5AA 2CDQA 1ZZNA 2JOQA 2ZD1B 4RNOA 2F1FA 2M2BA 2ZDPA 4ICLA 2KXFA 2X3DA 3A8IA 3DM2B 4FBTA 2JJ4D 2R3VA 3O44A 4BHQA 3JYTA 2LDIA 1WWHA 3SXLA 4O4GB 3FSXA 3MM8B 3MEDA 3LH2S 1ZBTA 2P9GA 4OZLA 2PO4A 3PCOB 4RLEA 3PRDA 1RABB 1TL1B 1YBTA 2OJ3A 2OPQB 4WE1A 3AAWB 4JI2J 1NKBA 4ZVUB 4P2FA 1F5CA 3VGUA 1U7LA 3FFIB 1UFLA 3GSDA 2FHKA 3TRGA 3OUYB 3HLUA 1M0SA 3U7JA 2K2PA 4F50A 3KNGA 2GIFA 3HSDA 3M8ZA 2V69A 2AYBA 5HQLA 2Z58B 1RT7A 3Q8RB 2B4OA 1DBDA 2ZJQQ 1PYTA 3KNAA 2GIRA 3MUVP 1ULRA 5KFZA 4QPXA 2GQCA 3R1HA 5DG7A 1WI6A 2XTJP 2HVDA 4MK9A 1QAYA 4M8LA 1I3OB 1X4BA 1CVJA 1VRTB 2ZBRA 5K8PA 3PVXA 3C16A 2UV8A 5HMWA 3MUTP 1RADB 1EX8A 4RU2A 4KV8A 1HQEB 1DLOB 2NXNA 4YN3B 2BM1A 4FNIA 2VBZA 2QTWA 2MHEA 3AJDA 4KPYA 2HHXA 2V8GA 2VH7A 4KYZA 3PIOQ 4M1KA 3DLGB 2QLJB 5DQHA 3PFOA 3T6BA 2EC0A 5D6GA 2XYPB 2R42A 3Q86A 1H2UX 1XNRJ 2GVZA 2LEBA 1FKAF 5G0RB 4HTJA 2E5IA 4UUWA 2HKEA 4LRCA 4TY8B 1PGZA 4K4UA 4E98A 2DRDA 3FBEA 1YVFA 3BGLA 1FK9B 2OPRB 1DURA 2KJWA 2MQNA 1DY3A 1ZA2B 1VQLS 1G7CB 5KFHA 1VQ4S 1JLBB 2QC3A 3A1YG 1HNXJ 1K1QA 1WEXA 4CM2A 3PW4A 1SC4B 2KHCA 2RAQA 3VAKA 1WTFA 1DTQB 4JV2A 2EVZA 4DR7J 4QR1A 5IWAJ 3U1MA 4AT1B 1HFEL 2I6WA 2MEWA 1RAHB 1M1GA 3MM5B 4PKDB 2B9XA 3D2WA 1KFSA 3MTJA 3GFXA 4ECWA 4TYBA 3I96A 2B6AA 3TOQA 4HLBA 1TR0A 5KT5A 2OLWA 2YNIB 4C3LA 1F9HA 2EG2A 2UUCF 1VBZA 2LKZA 2IA0A 3OQ2A 4NZ7A 5FDLA 4IG3B 4K4WA 1GAOA 3P3DA 4DR1J 2G2ZA 2KVIA 4KR0B 2MGZB 4DV6F 1JLFB 1S6QA 1ZYQA 2PT0A 2FC9A 2LU2A 2D41A 1V9OA 2JLGA 2NSCA 3T41A 3I4PA 1O5JA 4F0HA 5E3QA 2NLWA 2XSFA 2VOOA 2WSCC 4RL1A 2FJDB 2YNGB 1KKHA 1OS5A 4M95A 1S6OA 5KT7A 2VF3A 5C2CA 1AA1B 3L7OA 1S6PB 5K14B 4Q0BB 3PM9A 1FJCA 2HZAA 4DCJB 2AJ0A 2H1YA 4CLYA 5B7WA 2WBMA 3KWMA 1DQ9A 2PI5A 4G1QB 1ZM2A 3DI6B 1G6BA 4ID5A 2ZWPA 4ZHRA 1ITPA 1LFWA 4FDFA 3I0RB 3T5LA 3KOAA 4W92B 1SV5A 2JH3A 1PAUB 3NEKA 2YWWA 1YDLA 1M5HA 1Q4RA 2M3DA 1S1TA 4DR4J 4B3TF 3G6VA 3OTDA 3NLCA 1KLMA 3DGPB 2IDEA 4KH1B 1T02A 4ES2A 3RAXA 4YS2A 2DIVA 5LMUF 3Q8UA 4EZ9A 4N77A 5H9FJ 5F8IA 1S1UA 5HL7Q 1KVJA 3THPA 2OEMA 2QA4S 4OZNA 4J9QA 5J2QA 2V0NA 1IKWB 4LF1A 5HJYA 2IRUA 2HHVA 2ZVSA 1YBUA 4HI1A 4CO4A 4ZOSA 3R5CA 1LV5A 3E51A 1S9GA 4MYTA 3HHKA 3FSYA 2QIFA 3DRRA 4B17A 3JQKA 1MU2B 1XERA 3MURP 4RW8A 2D3O1 2HWHA 1MMLA 3W9JA 5DG8A 1EARA 2YWGA 1O51A 2BJEA 4K4XA 4OI6A 4OYOA 3DOMA 3OL6A 3CDBA 4B9SA 5I42A 5J1EB 2BQ3A 3AQOA 5GAEI 3UD3P 2FLOA 3GZ7A 3AHPA 4DPUA 4X66J 1ZH5A 1XN9A 2DNYA 1IM6A 3L4BC 1NDKA 4ILRA 3P8BB 3M6VA 3M6WA 4DHVA 2W1BA 5GMKa 3QGPA 3RAMA 1LOUA 1C4CA 2HYIB 5DDRC 4B3RF 5IM0B 2ZNYA 3AY0A 1RB0A 2FVCA 2BDPA 4OZ0A 4NCGA 4LF7F 2ZC4A 3HVRA 1MMDA 2ZDOA 1AZSA 4AFFA 4C0BA 1SH3A 1IKVB 2HLUA 3BREA 4LF4F 4Y00A 2CQ2A 4FS1A 1HWKA 1HNZF 2I0XA 4Q45A 1DZ5A 2UP1A 4IFVB 4DX7A 3KFWX 5EWGA 3MM6A 3CD6S 3I87A 4J9KA 3TX0A 3CPWR 2UXCJ 3QO9B 2ZH6A 4NPOA 2MB0B 5HP1A 3K89A 2C2RA 4LRBA 4R25A 3VAGA 1CJVB 4HYKA 1FKPB 4FYXB 5D0EA 5CABA 3CD0A 1YJWS 4KKOA 2D3OR 4CNZA 4CH1A 1QSSA 4ER8A 3CE8A 4KH0B 4M5DB 2VBWA 2ACYA 5T41A 3TW0A 4X4OA 2JVOA 4RW4B 3F56A 4CTAB 4DS4A 2C3PA 3PX0A 2A18A 1OSDA 3E8OA 3QGIA 3GQCA 1FEHA 2N82B 1Z1ZA 5B0AA 4WZMA 4MTPA 4NLYA 1CC7A 1FXRA 1XMQF 2VC1A 2RKIA 5EDWA 1N6QA 3QSIA 4QIGA 1H98A 1X4AA 4B3OA 4OV6A 1UA1A 3MMBA 5AE2A 3HMJG 3LAKA 4C8ZA 4KO0A 3BYPA 1RKJA 4CZCA 1C4AA 1O8BA 3PO5A 5IV3A 1SPBP 3AA9A 1RT2A 2O67A 2X7IA 2P6SA 2AD9A 1Q79A 1Y9OA 2GGPB 5LSLA 5D4PA 2B8PA 4ED5A 1E6YB 2E9RX 4OHZA 4IKAA 1OQ3A 2RDDA 3M8WA 4U6PA 3K5LA 3G82A 3I9V9 3NAHA 1TKZB 1RHJB 5KG5A 4CRJA 3SDEB 3M30B 1T0TV 3OFEA 2DVIA 3X3UA 3H2LA 1M5VC 2JLFA 4JV0A 1WTBA 4RBVA 3RW7A 2E5JA 2Z56B 1HBMA 1FRIA 2E7WA 3VGVA 4DV5J 1UEVA 4IR9A 2LQ5A 4ED2A 4PG4A 3HHLB 5LJ5Y 4XO0A 2XZTB 4WU3A 2W8KA 3IGNA 4G1PA 4ETZA 4JOUA 4C9DA 2ATCB 3CC2S 1YZ7A 2L08A 3D28A 4ZLJA 1QM9A 3I0SA 3UNGC 3W5ZA 4AQYJ 3QJJA 3EICA 1S99A 1LW2B 3CB4A 4JI8J 4ELUA 1X4GA 3H98A 1L3TA 3M2VA 1IVZA 2HAIA 2HHSA 1I51B 3CUNA 5IV4A 3D67A 3TZWA 4UQGA 1X4CA 4Y2IA 4JI7F 3HX9A 3DHWC 1V3ZA 2W4DA 4PABA 3V81B 2RE1A 3DLBA 2E1RA 5DGBA 2FGCA 3CJ8A 3MPUB 2RMLA 2W25A 2DYAA 2QEXS 4OIXA 3NOGA 4UZBA 3N6LA 2GO8A 2M0GB 3GFHA 4PRFA 3JB9k 1LWFA 2RB7A 3RBEA 2HAFA 1RWOB 4DQSA 2B9EA 4WIIA 4EBEA 5DS7A 3I5BA 1QAXA 3GB0A 1Q0NA 3J7YI 3SIPB 4DV4F 4NLGA 3DRYA 4AUKA 1TKXB 2W4PA 2CPEA 2FVSA 2GS8A 3S01A 1LNQA 3QGHA 4MMOA 3TANA 3DMJB 2MLZA 4F3OA 1WD6A 3PW5A 2PN6A 2OUGA 3GG0A 3OJSA 1AFJA 5ETPA 2MSSA 3MOJB 5SUHA 5KT3A 1OPZA 1TL5A 1QE1A 2N3LA 3MMAB 5LMNF 5GMDA 4N76A 2F4VF 4IRDA 1C0TA 2ZWOA 2CQPA 3CCQS 2WW4A 1F3VA 1CQNA 5D0HA 4BBYA 2JDJA 1IN0A 1IKYA 1Q82T 1HWJA 3AD9C 5D4LA 1FRKA 4MKYA 4DFKA 1NK4A 1FXLA 1R43A 2FQQB 4QWCA 1WSVA 3QT5A 5H1SV 3DLEA 5ETSA 2YBVA 3R27A 5KFEA 4HH0A 4DEZA 3PEJA 4L3KA 1HMVA 2W9CA 2KT3A 1JXVA 2D3ZA 1X4DA 3RJMB 2ZH2A 1PILA 2HIYA 1FKOA 4URQU 4ZK7M 3RGIA 4UOCA 5DM7Q 4G6VB 3T1HF 1RTIA 2MQQA 3ISND 2KYZA 3CJ2A 4DPOA 3KLHB 3KK1B 4K4YA 1HNWF 1MN9A 1WDTA 4BLGA 1KBRA 3ZZRA 3M6UA 1RTDB 2IY5B 4DV7F 1NCLA 5KG0A 2C2EA 4N47A 1SH2A 2FY8A 2LA6A 2AJ1A 3CMAS 1ACMB 2MQOA 1HYSA 3ZZTA 1LXNA 4OX8A 2MKIA 1NHKL 4DR2J 3PZPA 2UU9F 1OY8A 2B5JA 4ZP6A 1RP5A 2C2OB 4LSZB 4RW7B 1HNZJ 3BV8A 4NASA 3LW5C 1OSCA 2CJYB 2VG7A 1CC8A 5KFAA 3KJNB 3NGRA 1OY6A 4A8YA 4WTOB 4HHJA 2ZZNA 4WP9A 2GAHC 1Q1KA 5KFTA 2QLBB 3KK2B 1VYAA 4X65F 3OFGA 2F7VA 2PI4A 4NEZA 1N4LA 4MFBA 2FGOA 1J2VA 4LF2A 3M2RA 3EGWB 3D6MB 5KFOA 2AGPA 1KQFB 2G4BA 1BWEA 4KE5A 3JYTB 4M5HA 3CD5A 2XNRA 1XMQJ 5JMNA 1VQYA 4DR3F 1GXUA 4WWSA 2V4JA 2NQPA 1U09A 1RTHA 4F2SA 3MEDB 4Y2KA 1U47A 4HT7A 2HNDB 4IOCQ 2ZH5A 2UUAF 3QPIA 4J37A 5F0UA 1S1VA 4GC7A 4B9MA 3TA1A 3VQTA 1TL4A 4WE1B 3IA0A 4BC9A 3ILOA 1C1BA 4C6AA 3EZ5A 1RCOB 2QLFB 4RNHA 5D15A 1VIOA 2CDRB 3UPFA 4ZVHA 3VR1A 4FKYA 1PCAA 3ZC4A 4KGMA 4IH6A 5B0BA 3MAAB 3MR6A 3TJ9A 3K0JA 2DR7A 1RA6A 4C11A 4ECUA 1A9NB 1NAQA 2V9KA 5GAGU 1SKWA 1T11A 1KHWA 3C46A 3Q2SC 1KONA 3KDOA 1VRQC 4YR3A 3NNCA 3UQSA 2FJEB 1VQ5S 3R1LA 5B0GA 2DR5A 3UNYA 3UD5A 1OIAA 2HVIA 2V4RA 3GSIA 1RT1B 1WF2A 3ITHB 1R89A 4RW6B 3R9LA 4HR2A 4C8YA 4ETXA 2C2ZB 2C2DA 3JTPA 1WC0A 4F0KA 2HQCA 4IRCA 3UN3A 3CEDA 3HFZB 3R7NB 3PO4A 2KFNA 4OYBA 4FZVA 3FJ2A 1GX5A 3BYRA 1V3SA 4JI4F 5D0RA 4LVNP 2QJ3A 2GAGC 4DX5A 4KFBA 4TQSA 4F4ZA 4LRDA 2OFGX 1REVB 3W8GA 2VQFJ 1APSA 5CZXA 3SZ2A 1WF0A 2WVFA 3QFHA 1DRZA 1VC5A 1H2VZ 2DPJA 1X5OA 5HBMB 3O1LA 4FXWA 2E5GA 1N33F 4WIQA 5B08A 4B02A 2XG8A 3A13A 4PUOA 1VQOS 5EX0A 3JSYA 2MKHA 5L9XA 1HR0J 1XBWA 4NXNJ 3ETMA 3BGUA 1ZTTA 1WUUA 2PGCA 5J2PA 3R3TA 1VR6A 2M9KA 1F6TA 3AB4B 3LA0A 4UOFA 3M8YA 1N0UA 3C6TA 2CWKA 4OYXA 2I5JB 2B6AB 1FNOA 3VV2B 4XAKA 4PXBA 4CT9A 2Y1IA 3H8YA 1WORA 1FJGJ 2H48B 3FZ2A 1U2CA 1D09B 4TXSA 2H3EB 5FDLB 3QLHA 2B0GA 1U1MA 3C14B 2NUUG 3LTOA 3MMCB 1C0UA 4ED6A 4WFBQ 2XGQA 1MW7A 1I5OB 2CA9A 1D9AA 1PJ7A 4IYQA 4IO1A 4OV1A 4DX8H 4LSNA 1RAFB 2NREA 2JFKA 4Q2MA 3BZQA 1F2GA 4NLTA 1RTJA 4QZVB 3WX8A 2KO1A 3NS7B 5B0DA 2C42A 4U96A 2ZH8A 2IFXA 2RQCA 4Q44A 2UXDF 5GADU 1FD8A 3BJYA 1J5EJ 2BQRA 2LXUA 1V5VA 1FVQA 1FVSA 5FJ4A 2KYXA 4DV1F 2ZBIA 4W4MA 4YUDA 2HFUA 1X4FA 5CA5A 1MLAA 3PYDA 4OJ1A 4K4TA 2CPXA 3OXGA 4KY3A 1IUJA 3RRGA 5ETTA 2UUTA 5DQIA 3DOKA 2AIRB 1IR1A 4OYPA 1TV6A 1F2HA 4RW9A 4B9TA 3PHTA 1RISA 2HGMA 2PD1A 2QRRA 4K59A 4NZ6A 2I2YA 2V2QA 2XM3A 1VRUB 2HBYB 2L48A 3OR1A 2RS2A 5BYQA 1S1TB 3MWBA 2R9LA 1KLMB 3QIPA 4C2MA 2UVVA 3UDLA 1EKSA 2XSJA 3TZZA 3RBDA 1ZAWA 2FYXA 3TEGA 5F3TA 5C5JA 3PNIA 1IBMF 2MYFA 5F9LA 8RUCA 3N6NA 1IQZA 2GZOA 4HI2A 3W8PA 4USWA 4PXEA 4UOHA 2KZZA 2R7TA 1HPZA 4HDHA 3ZTPA 1N88A 5C42B 3GFYA 4OMFG 4C0OC 4LR8A 2WAQD 3LGNA 1RJJA 1S9GB 3RW6A 1WG5A 1NHUA 3DU5A 4PPZA 1UAWA 5KOWA 3KYLA 3KTQA 2VOPA 4RW8B 2RUGA 1LWEA 2DB1A 3GJTB 2RILA 2FC8A 4NXMJ 1HNVB 4TU7A 5MAOA 2HNYA 1TK8A 2F9JA 2VPWB 4F4WA 1RT6B 1S1XB 1VLYA 3N79A 1VS3A 4L73A 3FMBA 1FO1A 2MXYA 2KFZA 1R8AA 3MMJA 3TUIC 4CO0A 3PHEA 1HWIA 2UUAJ 1S97A 2XBPA 3T1YF 4PWWA 3V4IB 2IMWP 3W60A 1YJTA 1LK5A 2AMCB 2GNKA 4NCGB 4CLWA 4IFYB 1YSJA 2G0IA 3N0VA 1U24A 1FX2A 2B56A 2QMWA 4QWAA 3R5JB 5HJXA 4X84A 2M52A 3HHNB 3MR3A 5ETLA 3BBFA 1NKCA 4PG7A 1GNKA 5F41A 2NZCA 2QN6B 4CLLA 1I94J 2PMHA 1Y10A 1RAIB 1R6VA 3O2IA 2BUNA 3PR4A 2QZ8A 4J9PA 4P2XA 1HQUB 3CULA 3LP0A 4MK7A 2J76E 1MROB 1CBKA 1T3OA 3HT3A 2CFXA 3PFEA 2DGQA 4OFZA 1ZM9A 2QT7A 5KG7A 1HNIA 4OI1A 4DL3A 2NXEA 2QYGA 2WHOA 1TQLA 3ADAC 4LF5F 2C2NA 1KD1T 3I56S 4OI0A 3NGSA 1X9WA 3PACA 4I7FB 2G13A 4B3MF 4KB7A 3IM9A 3LP2B 1WOSA 2W2MP 4OZ5A 2V63A 2W9BB 3ZXWA 4I56A 4QIVA 5CQGA 3FMWA 1EETB 2RIJA 5IT0A 2J9EA 3I82A 2EK1A 4M63A 3HFVA 5C2GA 4NLSA 1N6QB 3POTA 1CULA 3PRVA 3ZTQA 5LJ3Y 4OYAA 2WBRA 1FXDA 3MMBB 3MFHA 3DRPA 4KO0B 1X4EA 3DXSX 2MZQA 1FRJA 2OI2A 4H4MA 3FNNA 1D9FA 2DNGA 2H65B 1WG1A 1HLWA 1QY7A 4DJBA 2AZ3A 3CDUA 4B9UA 2ZITA 3A4TA 2Z57B 5LL6d 3IBCB 4JI1J 3CCSS 1EQMA 3G82B 4DI6A 2AJQA 4X4NA 1VQ7S 4CYUA 3MECB 2EG1A 4LR7A 4R8UB 3ZTRA 2UXBF 3QRPA 3AH6A 5FIIA 4DDFA 2E1MC 2XS5A 3HP6A 1EQ0A 1HBMB 2J6TA 4AD6A 3KLEB 2OD6A 3F44A 2R7RA 4DG1B 4WF9Q 4QIFA 3FCVA 4LFAF 4WFAQ 2WSEC 2GMJA 2VBXA 2ZH7A 4KPCA 5M2RA 2LQ8A 4WTYA 4DV0J 1FESA 4HACA 1FDDA 3UDVA 2OKQA 3GYGA 2L41A 2FVPA 2NR0A 3RTVA 3I0SB 1EP4A 1IBCB 2RVJA 3OTBA 5I3UA 1I1GA 3M2VB 1FFGB 2UVRA 3HVTA 3EXCX 4USKA 4KHRA 2HQIA 1U1LA 4ZDNA 1H0HB 2IAJA 3OTOF 1RBAA 3I5CA 2RRNA 4LIWA 3U1LA 4X62J 1L3KA 1FFSB 4ZPDA 5HLFB 2WTFA 3N4WA 3IO1A 4B9VA 3BKUA 2DR8A 1YGYA 3PR5B 4LQ9A 3QT6A 3K7RA 1IWGA 1WC4A 1RAEB 4OX7A 3GTYX 4PWDA 4ANCA 2BZ2A 1GX6A 4ES3A 3W2VA 2HWTA 4I2PB 3K58A 1YBAA 3DXBA 3CJ0A 4X4QA 1JX4A 2GCFA 1U45A 5E5NA 3HKWA 1JKHB 1RLCL 4OHVA 4DUYF 4YHHJ 5A2QU 4C98A 2CJXB 4OYWA 1S77D 5EUHA 1WKLA 3EUNA 5DLGA 1RHQB 2ZC3A 2EFPA 4RNNA 3PYFA 1BXNA 1JLCA 5ETQA 2Y1LB 1F3FA 5HSPA 4DV2J 3BSNA 3N5BA 4ZLLA 4QPTA 5HVFA 1VJWA 3HO1A 3S1TA 1C0TB 2VU5A 4DL6A 4OJHA 5L1LA 4J9SA 3ZZUA 2C1EB 4O0IA 3K2YA 4P9SA 3CCJS 4YR2A 2HGLA 1NPPA 3G8QA 3SYZA 4F4AA 2VKRA 1UCNA 3IM8A 1MSWD 3CIZA 4L74A 1P1TA 3IFEA 1N32J 3M32A 1RWUA 4W90B 1SL1A 2CUYA 1IR0A 3G8SA 2HNZA 1FCAA 2YX7A 2YQ3A 4P73A 2R8JA 3MF5A 2EFVA 3BSAA 1YWXA 3NGDA 3KJFB 2BRKA 4GVLA 3GFZA 1BD6A 1VQNS 1X4HA 4I67A 3GJQB 4A8KA 2V9WA 1IR2A 3CCTA 4I1TA 1P27B 3D6FB 5C24A 2XWXA 2EKYA 2LU1A 2Y3YA 5IS2A 4URGA 2NUHA 4EO8A 3EM1A 2ZJPQ 4DR5J 4IDKB 3PEHA 2NYHA 3HCXA 1HYSB 1T05B 4IG0B 2E7XA 1NJIT 1NRKA 2YNHB 3EZOA 5IZHA 2QL7B 2CQ0A 2AW0A 3MPDA 3M05A 4UOGA 2RU3A 2W9AA 2LP4A 3Q8PB 2W2OP 3W1YC 5AJ3F 2IM0A 2HEKA 5DZ7A 1QD1A 3KG0A 4OX9F 3E01A 5KT4A 4OLPA 1UFWA 1IJFB 3NGKA 5A8RB 3TX8A 2YKQA 4PG8A 2ZBCA 3RB4A 2H51B 1VGYA 1XR7A 3B78A 4ZLNA 5AXNA 4QU7A 3KK3B 3NCPA 3GJRB 1RT3B 1U1PA 5AXMA 2R4FA 4JV1A 1VQMS 4DQPA 4N7TA 2YY3A 1Q78A 2JX2A 1VQPS 5CHCB 4I6AA 4RU9A 3EMTA 2ROPA 2CZ9A 1NZ8A 4JI0J 3G96A 3DRSB 2AT1B 4CDIA 2V4JB 1IBKF 4ZPAA 4MIWA 5F0WA 1V6HA 4GKKF 1UWBB 3NCRA 4JBCA 4XK8C 1TU0B 1YQHA 5F3ZA 2RS8A 3T9ZA 2OO4A 3IBFB 1S12A 5K8NA 1RYSA 4TKTA 3MM7A 5T7LA 2B51A 3AJ2A 4A8XA 4WU2A 3IXQA 1BQNB 5ETKA 3M4XA 5ETOA 3AFGA 3UVJB 4FYDA 3HULA 1JJ4A 4FXDA 2D9OA 3OVSA 3IMQJ 3PTWA 3ILJA 1BWVA 2ABYA 3D4JA 4UY8T 3WC0A 2G0CA 4LRFA 4E0DA 2WCXA 2I8EA 1BY9A 2LQ9A 2HK3A 4NI2A 3UN2A 2M88A 3HFKA 1U26A 1WG4A 1LW0A 3SQGA 3MCMA 1CJUA 1DFDA 4Y2AA 1H6KX 3IP0A 4LF8J 3M8PB 2YKNA 3MAHA 2CNLB 3HD1A 2ZZMA 2V2ZA 3IWLA 4WBFA 2F4FA 5F8GA 3NP5A 5HN0A 3R97A 1T9XA 1RHRB 2NS1B 2VA2A 4PXDA 1NUEA 3AT1B 1M5KC 3BGRA 1M5SA 2WVEA 3MOZA 2R7WA 2BEFA 3BR8A 2X1GA 5M2PA 1FNMA 4FF1A 2V68A 2FHJA 2CPIA 1FE4A 1RU1A 3G6YA 5A0YA 4Q43A 3QJLA 3N6MA 3NCQA 3Q22A 2XI2A 3M1VA 5HMYA 4FPIA 3OTOJ 2CG4A 4R5PA 2V2VA 4QWBA 3GONA 2FJWA 5L46A 4Y6IA 1K0TA 4WFNQ 1ICEB 2HQ3A 2EBEA 3T19A 3D0GE 2P8IA 1WOPA 4RUHA 5LXYA 4ECVA 2M8HA 1RT5B 3CJQA 2GHPA 1RZMA 3NGUA 2B3TB 2IBKA 3VWSA 3NS6A 3CVKA 1U1NA 3MHYA 2QA1A 3ZNJ1 3A8JA 3OR2A 2HZVA 3K5OA 3M7VA 3BDEA 3MDFA 3C6TB 3BKTA 2VD3A 2JEFA 2XY7A 3CC4S 4FF4A 2K7JA 2RQKA 4NLUA 2MY7A 2PEHA 4DUYJ 5ITHA 3AQPA 3LP1A 4WZQA 1JXLA 3ZZOA 1VC6A 2ZH4A 1AT1B 2HZCA 3BR9A 3QLHB 2YKMA 3W2WA 1FD2A 1AB8A 3KMSA 1N52B 5I3QA 4GC6A 5CAAA 3B82A 1XC9A 4F04B 2Z2LA 4NLOA 3PYGA 3W9HA 3AD7C 2BRLA 3PJ9A 4OYIA 3CJRA 4LSNB 3VGSA 4P71A 4LQ3A 1RAJA 4RO0A 2DY9A 3OL8A 1U6ZA 1Y0HA 1XMOJ 2WONB 1CJKA 2BKNA 3EPIA 2MZJA 1JXEA 2Z2MA 3FC9A 5BR8J 3SV3A 2JEIA 3DYAB 2MQPA 2GJIA 3VAFA 2ZFHA 2OD4A 1FDNA 3QSYB 1LK7A 4A8OA 2FLLA 3J7ZT 4DWIA 2DGOA 4EBCA 5I4MA 1T7PA 3ZTSA 2KDOA 1SJRA 1H7WA 1RWPB 4C0HA 2CPHA 2L9DA 4JV5J 2FJXA 3MFIA 2DRAA 2DR6A 4BC7A 5L38A 5GMEA 2FZKB 4QQBA 4RW9B 1WEYA 2WSFC 2KM8C 2H4YB 2IYGA 2DNOA 3OR1B 3D5MA 2OELA 5GAEU 4PR6A 3FBBA 3MR2A 1NJXA 3CCZA 2EFNA 1NH8A 4DUZF 2CQHA 2VKZG 4FXVA 3UW1A 2OPPA 5LXRA 3MM9A 2CPDA 1SB6A 4F2RA 3DN9A 1XIQA 2Q6CA 1WHVA 3C15A 4O44A 3TAMA 1RWKB 1SUQB 4RR5A 5E3RA 1W2BR 4OX9J 2CPJA 3QAEA 1LWXA 4WXOA 1GT8A 4JI5J 4NCAA 5HATA 2YNFA 1PG5B 3VF0B 1TZ0A 1S1WA 1VBYA 1T9WA 1ZZFA 5J1PA 4DL4A 3B54A 5E41A 2C3MA 1RTZA 4USMA 3HZEA 4GRSA 4CM0A 2OFHX 4D3GA 3LPEA 4WP8A 1N36J 1QTMA 1HBUA 5L9NA 1S6UA 2MJNA 3GV8B 4WJBA 2PIIA 1HA1A 1OY9A 4I2QB 5SZTA 4IO9Q 3QRQA 2XQCA 1KVIA 2W24A 2IIHA 3P4UB 2BJ1A 2F65A 5BYRA 1FTRA 3HJVA 3QGGA 3DM2A 3FK4A 3S7RA 1KS2A 2NPIA 2W7AA 3TP2A 4KTQA 1VISA 2SXLA 4C7QA 1JLEB 5KFMA 4DV3J 5E3CA 4ZP9A 2YQ0A 3EGNA 4PPDA 3MM8A 3R6LB 2XC9A 2FZGB 5FD1A 3GU0A 2EWHA 2E1AA 1HHQA 2XWYA 4CLFA 4M5KA 2OPQA 5DDPC 2VC0A 2RUSA 4TLRA 3CW2C 3LP0B 2QE5A 2XMKA 3FRYA 3FFIA 3NXZA 2ZBQA 2YX4A 2IVFB 1TP7A 3OUYA 5AT1B 5C25B 1ZPWX 2BKPA 3JSMA 4O4RA 2W7OA 5KFKA 2PFDA 3OTEA 3M8QB 4UF4A 1T9TA 4C8MA 1SCJB 2OPSA 3QYYA 1YG0A 3CCVS 1H38A 5JJBA 3NKYA 4OJ3A 1EKRA 5HMZA 4ZITA 3BPSP 2ZE2A 1LXJA 4F4KA 1WC6A 2GO9A 3J80Y 1CPZA 3OXLA 3FSIA 4M5LA 4U9RA 1V3RA 4LF9F 2YTCA 1WELA 2O1PA 3HHLC 5DDQC 2FHOB 1CULB 1VRTA 2IMOA 4O3RA 3J80U 4LFBJ 2LMIA 3QRRA 4ID8A 1VK8A 1HQEA 1DLOA 2A6OA 3BN7A 4P72A 4K0KF 2DD8S 1R7IA 4H4MB 1RHUB 5LSOA 2D1CA 2R2TA 1SKRA 4X4SA 4H4KC 1TK0A 3FBFA 1NK8A 2ZZTA 4A8WA 4YQWA 2BMBA 4UQTA 3OSPA 4KSEB 5G0RA 1WI8A 2A6MA 4DSJA 1U2FA 1N5QA 4TY8A 1RSCA 1VJQA 2MHNA 1SJ1A 4CYUB 2GFFA 3F73A 1NHVA 3BQ2A 3FZBA 2CQGA 3H0PA 1OYDA 2OPRA 4RZRA 4TNOA 2DT9A 3PV8A 4JYAF 1XNQF 2ATLA 4L75A 3SCLE 4CO1A 1KRPA 1S9EB 1RT4B 1BE4A 1B0VA 2GHVC 3O6QA 4L76A 2PC6A 2IVMA 2MDAA 2OEKA 3KLFB 4DPYA 3ZZ0A 1TL3A 4J9NA 3H5SA 3J7YU 4EMDA 2RRBA 1DJ0A 2V67A 1SKSA 1Q95G 1RDRA 2GC8A 2F9DA 5L1KA 1N48A 2CG8A 3GE9A 1VDHA 1SL2A 1EP4B 4WK1A 4J7CA 2YPYA 3HD2A 3KLGA 3V6KA 2L3MA 4RNMA 2VFRA 3HJFA 2NXUA 5I3UB 2HGNA 1N5YA 5H9FK 4WXWA 3GCWP 2Y0SD 1NSQA 3Q2TC 4V19J 1N34F 2DGSA 2QMXA 2PFFB 1MWYA 4CQ1A 3PX6A 3KLVA 3ET6B 4Z7CA 2V34A 4IG3A 4FYYB 2CVIA 2VFUA 5KAKA 2CQ4A 3UO0A 2QA4G 2HMIB 1YTYA 2MGZA 3CSKA 1JLFA 2EPIA 3MEGB 2ZHBA 4NOHA 4HT5A 3FEZA 2EKNA 1Y5IB 2Z4PA 4NLPA 2HFVA 2GMHA 2BM0A 3UE2A 2AF6A 4IRKA 4P7TA 4JI3J 2D69A 1HBOB 4WKYA 4ZJLA 1HW9A 2PMWA 3W2VB 3VHQA 1RQ0A 1IBLF 1NU4A 4F4YA 3EVWA 2YNGA 2ILZA 3MD1A 3TJ8A 3BPDA 3BKFA 4ANEA 4X64F 2DHXA 3MPYA 4GVBB 3K5MA 1NK6A 2EEYA 4DPTA 5F9NA 5FLXY 4DS5A 4O3QA 1UPMB 2D9PA 4YY3F 2E5LF 2VJVA 3NOCA 4ZJOA 4G1QA 1UP1A 1HARA 2LFVA 1R8CA 1W26A 3A3NB 1U1QA 2W2NP 1JLCB 5FLXU 3KDNA 2XMJA 3I0RA 1LWCA 5DRKA 3NBPB 3TI0A 4ZPWR 2DXEA 2G0JA 4EYHB 3Q8SB 3MUMP 1P1LA 3EVOA 4OL8A 1QSYA 4LFCJ 1LFPA 4ES1A 4P6QA 4LMZA 3DGPA 3WX4A 4LBIA 5DG9A 2Y0BB 2OP5A 3VAMA 3N01A 1VI7A 1FNXH
chains in the Genus database with same CATH topology
1B4SA 2HURA 2AZ1A 3ELHA 4CP5A 3ZTRA 1WKKA 3B6BA 4ANDA 4DUTA 1HIYA 1MN7A 5IOLA 2B8PA 1NDPA 3EVWA 3ZTSA 1MN9A 2ZUAA 3MPDA 1LWXA 1NUEA 3EVMA 3FBEA 1ZS6A 5BXIA 4ANEA 3NGTA 4O0NA 3Q8VA 1S57A 3WX8A 2DXFA 4UOGA 4F4AA 3EJMA 5C7PA 1NCLA 1PAEX 1UCNA 4ANCA 3GPAA 2BEFA 4UOHA 3FCVA 3ZTPA 3ETMA 1LEOA 5CABA 4KPCA 1HHQA 1NDKA 2DYAA 2NCKL 1XQIA 1F6TA 3BH6B 3FKBA 3PRVA 4UOFA 3ZTQA 3Q8UA 1NLKL 2HVDA 1NSPA 1NSQA 2CWKA 1NHKL 4DZ6A 3FBFA 3B54A 3R9LA 3BBFA 3BBBA 4HR2A 3DKDA 2BX6A 3VGVA 3DDIA 1NDCA 1U8WA 1S59A 4EK2A 5CAAA 3Q8YA 3JS9A 3ZTOA 4C6AA 3GP9A 4S0MA 3VVUA 3FBCA 3FBBA 3PJ9A 4FKXA 4W98A 1WKLA 1B99A 1NPKA 3FCWA 2DXEA 4FKYA 3VGSA 3EE3A 1NDLA 2DY9A 1NSKL 3Q89A 1EHWA 3VGTA 1JXVA 2B8QA 3G2XA 1HLWA 3EVOA 3NGRA 2AZ3A 3L7UA 1BHNA 1W7WA 1F3FA 1NB2A 1BUXA 1PKUA 3EICA 3VGUA 1K44A 1BE4A 1XIQA 3BH7B 3EM1A 3Q83A 1WKJA 4F36A 3FC9A 3Q86A 1S5ZA 2HVEA 1KDNA 4WBFA 3VVTA 4DI6A 3EMTA 2DXDA 4ENOA 3NGUA 2VU5A 3NGSA 3BBCA 3ENAA 1VYAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4S A;  2HUR A;  2AZ1 A;  3ELH A;  4CP5 A;  3ZTR A;  1WKK A;  3B6B A;  4AND A;  4DUT A;  1HIY A;  1MN7 A;  5IOL A;  2B8P A;  1NDP A;  3EVW A;  3ZTS A;  1MN9 A;  2ZUA A;  3MPD A;  1LWX A;  1NUE A;  3EVM A;  3FBE A;  1ZS6 A;  5BXI A;  4ANE A;  3NGT A;  4O0N A;  3Q8V A;  1S57 A;  3WX8 A;  2DXF A;  4UOG A;  4F4A A;  3EJM A;  5C7P A;  1NCL A;  1PAE X;  1UCN A;  4ANC A;  3GPA A;  2BEF A;  4UOH A;  3FCV A;  3ZTP A;  3ETM A;  1LEO A;  5CAB A;  4KPC A;  1HHQ A;  1NDK A;  2DYA A;  2NCK L;  1XQI A;  1F6T A;  3BH6 B;  3FKB A;  3PRV A;  4UOF A;  3ZTQ A;  3Q8U A;  1NLK L;  2HVD A;  1NSP A;  1NSQ A;  2CWK A;  1NHK L;  4DZ6 A;  3FBF A;  3B54 A;  3R9L A;  3BBF A;  3BBB A;  4HR2 A;  3DKD A;  2BX6 A;  3VGV A;  3DDI A;  1NDC A;  1U8W A;  1S59 A;  4EK2 A;  5CAA A;  3Q8Y A;  3JS9 A;  3ZTO A;  4C6A A;  3GP9 A;  4S0M A;  3VVU A;  3FBC A;  3FBB A;  3PJ9 A;  4FKX A;  4W98 A;  1WKL A;  1B99 A;  1NPK A;  3FCW A;  2DXE A;  4FKY A;  3VGS A;  3EE3 A;  1NDL A;  2DY9 A;  1NSK L;  3Q89 A;  1EHW A;  3VGT A;  1JXV A;  2B8Q A;  3G2X A;  1HLW A;  3EVO A;  3NGR A;  2AZ3 A;  3L7U A;  1BHN A;  1W7W A;  1F3F A;  1NB2 A;  1BUX A;  1PKU A;  3EIC A;  3VGU A;  1K44 A;  1BE4 A;  1XIQ A;  3BH7 B;  3EM1 A;  3Q83 A;  1WKJ A;  4F36 A;  3FC9 A;  3Q86 A;  1S5Z A;  2HVE A;  1KDN A;  4WBF A;  3VVT A;  4DI6 A;  3EMT A;  2DXD A;  4ENO A;  3NGU A;  2VU5 A;  3NGS A;  3BBC A;  3ENA A;  1VYA A; 
#chains in the Genus database with same CATH topology
 2W01 A;  2F63 A;  2KXN B;  2ZM6 J;  2D3U A;  4YB6 A;  2CQC A;  1UKU A;  2HNZ B;  2CJK A;  3GIL A;  2VG5 B;  3PJW A;  4DR6 F;  1U25 A;  4ZCK A;  4K2J A;  2HHH J;  2DNM A;  1QTN B;  3UDC A;  1ZM4 A;  4USV A;  4CO3 A;  3DOL B;  4YB5 A;  2UZA A;  3JQM A;  4DOZ A;  3OVA A;  3HHE A;  2ROE A;  3KMQ A;  2BX6 A;  5CYQ A;  1ZAV A;  5C24 B;  1S59 A;  3LPY A;  2BR0 A;  4FS2 A;  2PDA A;  4BWM A;  3HK2 A;  2XLI A;  3RU0 A;  2LEP A;  2PMZ D;  4FKX A;  2KKH A;  2CJ9 A;  4E8U A;  4P74 A;  3M9N B;  2GVD A;  2F8E X;  4ZJQ A;  3K59 A;  2BAN A;  4CLU A;  1JJC B;  1TTH B;  3IR7 B;  5KOX A;  4B3S F;  3G6X A;  2ZUG A;  4F36 A;  1J5O B;  1RE1 B;  4O3N A;  4WYL A;  2ZH3 A;  2DXD A;  2KT5 A;  2M70 A;  2WK4 A;  5J2N A;  4MAK A;  3IG1 B;  5HMX A;  5EWE A;  3WDO A;  5IM0 A;  1F5A A;  2OHD A;  3MGJ A;  3KHR A;  3OBI A;  3D1H A;  3E01 B;  4CO2 A;  1GXL A;  3QT7 A;  3CNQ P;  1B3T A;  4NLQ A;  2ZH9 A;  4QYZ J;  3P45 B;  2VZ9 A;  4X4U A;  1SVD A;  3D6T B;  1F0X A;  2RF2 A;  4OZ1 A;  2VHG A;  5D0G A;  3KLI A;  3DLK B;  2FJV A;  4IFV A;  4LJM A;  4ZPV R;  4AXJ A;  2CKW A;  4L72 B;  3SFG A;  1TMM A;  3I55 S;  4K2X A;  3ULH A;  4W98 A;  1ZAX A;  1H3D A;  3L95 X;  2XLK A;  1JNR B;  3SCK E;  2FDN A;  3G9C A;  2J6U A;  5CYM A;  2YKA A;  3A8E A;  3C66 A;  3D68 A;  5KFX A;  2XO6 A;  4M5D A;  1HWL A;  3H4D A;  4RW4 A;  3CWJ A;  3ELH A;  2CQ3 A;  1WKK A;  3B6B A;  1NO8 A;  2D74 B;  2OEJ A;  1S0O A;  4C8K A;  3UR3 C;  5B0F A;  3FEX B;  5DLF A;  3FEY B;  4O0N A;  5EX3 A;  2A0F B;  1T03 B;  1NPR A;  2VFS A;  3PW7 A;  4BCA A;  4I6W A;  1DQA A;  2UVU A;  1WSR A;  2BV3 A;  1S7H A;  5EWF A;  1SQG A;  5KFP A;  4JI2 F;  2HFS A;  1IKX A;  5EGY A;  1UET A;  1CS4 B;  4JYA J;  3SQG B;  1RBO B;  3GV5 B;  3HT0 A;  2GGP A;  2R8H A;  4USI A;  2M5Y A;  2YKN B;  3PW2 A;  3AOA A;  4V19 X;  2QSF A;  2C3O A;  1U0S A;  1E6Y A;  2VV5 A;  3WHI A;  1X5T A;  2F40 A;  4TY9 A;  4U95 A;  3HF5 A;  3QT8 A;  1TKZ A;  4R0J A;  3ILL A;  1PKU A;  1YRX A;  4MKA A;  3SDE A;  3M30 A;  2HRY A;  1GMW A;  1KSP A;  3BGR B;  4UW2 A;  2MQ8 A;  3WIU A;  1TKD A;  2KT2 A;  4HDG A;  2QV6 A;  5A8K B;  1TVR B;  5A6P A;  1LKZ A;  1TL7 A;  3HHL A;  4MT1 A;  3W9I A;  2BKO A;  3M1V B;  2VG6 B;  1K0V A;  1F9F A;  3BEG B;  2FHM A;  3CJK A;  1PC4 A;  2MZR A;  4F02 A;  4IUF A;  3PJX A;  2UUC J;  2VPY B;  1CQM A;  4ZVS B;  3BO2 A;  3ETO A;  2VON A;  1OWX A;  1LW2 A;  3K8V A;  2M8D B;  2GX8 A;  5DZ6 A;  2DGV A;  4NEY A;  4H4K A;  2B4P A;  4DV6 J;  1XNR F;  1S4F A;  2J0W A;  3L7P A;  3VVU A;  3CGI A;  3WZ0 A;  4ED8 A;  3TWZ A;  2DNK A;  3KG4 A;  4PYD A;  2O01 C;  1U1K A;  3R2D J;  1B7Y B;  1Y5L B;  5LOQ A;  1X60 A;  1G4C A;  3R2C J;  2E44 A;  3DU6 A;  3OR2 B;  3DDN A;  1GMV A;  2B9W A;  2ZKU A;  3CCW A;  2JFD A;  2OAU A;  2XZW A;  5L1I A;  4GO7 X;  1X8D A;  5D4N A;  4I69 A;  4K4V A;  4J9R A;  1BQM B;  3QFW A;  2KXH A;  1S5Z A;  1JLG B;  2EW9 A;  1HNX F;  2HHP A;  5K5M A;  1X7V A;  4N5S A;  2AZ1 A;  3LP1 B;  3VAL A;  4FF3 A;  4DR7 F;  3HI9 A;  5IWA F;  1C2P A;  1RLD A;  2ZH1 A;  1F60 B;  4DFP A;  4PCQ A;  3W2W B;  2BE2 B;  3EJM A;  3H5U A;  3UD4 P;  1N56 A;  2G1D A;  1TKX A;  2J8A A;  3CXC R;  1YRU A;  4DPW A;  3IRX A;  2XYH B;  4CO5 A;  5DO2 A;  2H4W B;  3M8R A;  1S4E A;  1BMQ B;  3DMJ A;  1DAX A;  4Y28 C;  4UST A;  4U7C A;  2J6S A;  4B3T J;  5IXU A;  4UZC A;  3CCR S;  3OJU A;  1EAY C;  4DR1 F;  5B0C A;  1K1S A;  2VDI A;  3LO3 A;  3AJ1 A;  3MMA A;  2J7K A;  2DNL A;  1JB0 C;  1XJW B;  2WOM A;  2XB2 D;  5LMU J;  2JC0 A;  2WVD A;  4RWW A;  2Z2Z A;  3UWT A;  1WNE A;  3BS9 A;  2Q6B A;  5E2Q A;  4DR6 J;  4G1I A;  2UVW A;  1N8R T;  1UJ5 A;  3KXD A;  4DCO B;  2BJ9 A;  1VBK A;  1UWA A;  2KI2 A;  1ZS6 A;  3I9Z A;  4DL0 C;  3V6D A;  1VBX A;  3NMA A;  1RWV B;  2DNP A;  1NH7 A;  2DIS A;  2Q1L A;  4Q8E A;  4ATN A;  1QUP A;  4OHW A;  4DQR A;  5AXK A;  4YDX A;  2FY1 A;  2R8G A;  1R6Y A;  3GV7 B;  3RG6 A;  2OPP B;  1CJT A;  3EZU A;  4S0M A;  1FF2 A;  3C15 B;  3KLH A;  4TQR A;  3KK1 A;  2ZKT A;  2DGT A;  5AXL A;  1NDL A;  2FJA B;  2IM2 A;  3X1L B;  4KAI A;  4OJG A;  1RTD A;  3CME S;  2MJU A;  3C6U B;  2JHE A;  4I0W A;  1K44 A;  4B3R J;  4BS2 A;  3VVT A;  4J5O A;  1Q7L B;  4H4O B;  3RYL A;  2YNF B;  3V4M A;  1S1W B;  4LF7 J;  1VFJ A;  1KTV A;  4OLO A;  4ZKA A;  4HL9 A;  1Q86 T;  2DO0 A;  1RAA B;  1Z2Z A;  4RW7 A;  2XY5 A;  4LF4 J;  1REG X;  5LM7 E;  3VQS A;  2G1H A;  3U1N A;  2FIU A;  1RA7 A;  4QW9 A;  4ZN3 A;  2MKS A;  4YP3 A;  1NK7 A;  2K3K A;  3J81 Y;  4DSK A;  1HBU B;  2AJF E;  3FKB A;  3G8T A;  5HK4 A;  3EGV A;  4X4V A;  1X0F A;  3H42 A;  4MK8 A;  4DU8 A;  5A6W A;  2CAJ A;  3NAI A;  3SBM A;  1TUV A;  3AOB A;  3KKF A;  3KK2 A;  1B70 B;  3FGV A;  5LSR A;  2HVH A;  2P5V A;  4PQA A;  3WC2 A;  2OIH A;  2OSQ A;  1T9Y A;  4B9N A;  4ED3 A;  2V50 A;  1S76 D;  5CXT A;  2XHW A;  2VPZ B;  3KG1 A;  3QZ7 A;  3KJV A;  2GQQ A;  4FVM A;  1X0P A;  5KFG A;  4EU0 A;  4ICL B;  4X66 F;  1N5T A;  4ECQ A;  1AW0 A;  2IJR A;  2CAD A;  2KFY A;  1B64 A;  3OHA A;  1ARO P;  4KGX B;  4O3O A;  2HND A;  3O3L A;  4C4W A;  4DUT A;  4M5G A;  2F8H A;  2KB2 A;  3US5 A;  2CNO B;  4K4S A;  1NDP A;  3BQ0 A;  4JUZ A;  6FD1 A;  4A8S A;  4J9M A;  3CJ3 A;  3MR5 A;  2YPZ A;  2J8S A;  4YEA A;  2XUL A;  3FQL A;  4BDP A;  2VL1 A;  3JSM B;  2R7X A;  4OYZ A;  2LXI A;  2DCU B;  4WFZ A;  4C3M A;  3KHL A;  4NA3 A;  3IAM 9;  3MAA A;  2LA4 A;  2OPS B;  3BSC A;  2V5H G;  5CZV A;  5H9E K;  1AFI A;  2ZE2 B;  4K5R A;  6FDR A;  1P9Q C;  1HW8 A;  3MEE A;  1RT7 B;  4KC5 A;  3FBC A;  4Z2X A;  3OFF A;  1WF1 A;  4EWT A;  2KZM A;  4J9L A;  1C1C A;  2CQI A;  2UXC F;  2B8Q A;  1KN6 A;  4I6Y A;  4H54 A;  1VHF A;  4DFM A;  2VJU A;  5A8W A;  3N9U C;  5ETN A;  3SSS A;  3H40 A;  1HL6 A;  1RT1 A;  3ITH A;  1X9S A;  1UVK A;  2Y8W A;  4ILM A;  3ENA A;  1KLN A;  2HLT A;  3C16 B;  4RW6 A;  4N56 A;  1X5S A;  4WFY A;  2YQ1 A;  4KV8 B;  4RX6 A;  1A6L A;  2X51 A;  3S6E A;  2IRY A;  3E3X A;  4ZVE A;  1UA0 A;  4NLR A;  2IBO A;  1I6J A;  2K8G A;  1DAR A;  3I4H X;  1REV A;  3HPO A;  1M1H A;  3W63 A;  4NWB A;  2GVZ B;  2ASD A;  4AL6 A;  4I68 A;  1MG7 A;  4FYV B;  5KFU A;  2HIQ A;  1P6T A;  4YR0 A;  4YB1 P;  1HD1 A;  3ENV A;  1RAG B;  1JLQ A;  2O5D A;  4JI7 J;  1NSA A;  2UUW A;  2X1B A;  1HHS A;  5HBM A;  2A3J A;  2CRL A;  1U0H A;  2V6A A;  1TL3 B;  1UFK A;  1RUS A;  1GFW B;  1W2I A;  4ZVR B;  1BHN A;  1X5P A;  4ECR A;  3SSQ A;  3B8H A;  1RBL A;  2GW8 A;  2RJZ A;  3D7S B;  1J27 A;  2BW7 A;  1YK9 A;  2DGW A;  3BB5 A;  4Z7Y A;  4ZCM A;  5KFQ A;  1VCT A;  1T95 A;  2MTL A;  3KLG B;  2Y9H A;  2I5J A;  1YJU A;  4AL7 A;  1N5Y B;  2HHU A;  1HIY A;  4DV5 F;  3ISN C;  3HHD A;  4NE9 C;  4DV4 J;  1NZA A;  2HFN A;  2ZUA A;  3IBW A;  1R0C B;  2QL5 B;  2K7K A;  3TZY A;  4TYA A;  2OTJ S;  1SXL A;  2QA2 A;  1YHQ S;  1L3S A;  3C14 A;  3MMC A;  2B9Y A;  1TUG B;  2R8K A;  3BH6 B;  3O8W A;  3PG9 A;  1JIH A;  2DO4 A;  4DMZ A;  4AQY F;  4JI8 F;  3TVY A;  3QMQ A;  5MLC V;  1O0P A;  5E3P A;  1F9E B;  3Q8Q B;  5LMN J;  5DDO C;  1SIZ A;  1T3N A;  4ELV A;  2VQE F;  1KR4 A;  2DHS A;  1S6Q B;  2DNR A;  2F4V J;  1Q53 A;  1NJW A;  2V2K A;  2AWZ A;  4EO6 A;  1RAO A;  2R2U A;  2KG1 A;  2W4C A;  4WKR A;  2DHA A;  2JC1 A;  2XYG B;  1YJ7 A;  1FEE A;  4U67 Q;  2VUG A;  2ADB A;  1XR6 A;  3G6E S;  1RCX B;  3HSG A;  3BQ1 A;  3HSZ A;  4DL5 A;  2HBR B;  2HUR A;  1YJR A;  1R8B A;  2HFO A;  4L3N A;  2N7C A;  2XMU A;  3BM7 A;  1U1R A;  3GIJ A;  1JQG A;  2C28 A;  4ILL A;  1D9D A;  1LWC B;  1YIT S;  3TJA A;  1SC1 B;  3GMG A;  1RHK B;  3IWX A;  5F8M A;  4ID5 B;  3T1H J;  1VRU A;  4ZHR B;  4FBU A;  2GML A;  2UUB F;  3OLB A;  4ED1 A;  7AT1 B;  1BQX A;  1UEK A;  1HNW J;  2R7U A;  2A10 A;  2XMA A;  1SV5 B;  2DEJ A;  2WRM A;  3TAR A;  1Y00 A;  4DSF A;  3OVB A;  2GQ2 A;  4DV7 J;  1B99 A;  2J9D A;  2AX0 A;  5HAO A;  2K06 A;  3THT A;  4QOT A;  1VLO A;  4M94 A;  2RNE A;  3HDS A;  4NYZ A;  1HWU A;  5C42 A;  1PBU A;  2DEI A;  1R3N A;  4DSI A;  4USU A;  1NXI A;  2YWF A;  3NRB A;  1S1U B;  1U6B A;  2UU9 J;  4C8N A;  4HEA 9;  5J2Q B;  4K50 A;  1N5V A;  4CWB A;  1H2T Z;  2DPI A;  5J1N A;  4ZMM A;  1WHY A;  1ZET A;  3QWP A;  3K5N A;  3NGT A;  2FUG 9;  3D3B J;  1F5B A;  4F67 A;  5CYQ B;  3DRR B;  1PAE X;  3GJS B;  2LLZ A;  3W62 A;  5ETV A;  3V5R A;  4E2F B;  2FD2 A;  2G2O A;  4DL2 A;  2KM8 B;  2V4Q A;  2Y8Y A;  3CIM A;  1HNV A;  5DJB A;  3OL7 A;  4PAA A;  4X65 J;  2QFJ A;  3BO4 A;  2AHO B;  2GVD B;  2BAN B;  1RT6 A;  3EXY A;  1S1X A;  3OTC A;  3H20 A;  2FVR A;  2VA3 A;  4XIU A;  3DOM B;  2DIT A;  1TKT A;  3PY8 A;  5I42 B;  4J9O A;  4U7U D;  3VZI A;  3CJ4 A;  5LT5 A;  4YME A;  5J2N B;  4DR3 J;  3RBX A;  3P5T L;  2VDH A;  4KQZ A;  3V4I A;  1UJ4 A;  4IFY A;  1SQF A;  1WKJ A;  4B9L A;  1KDN A;  5A76 A;  2PEB A;  2NZ4 A;  4MYU A;  2VFT A;  1QLN A;  2X3G A;  3IAS 9;  4DR2 F;  5DQG A;  3G86 A;  4EEY A;  1WC5 A;  3EDQ B;  1AZS B;  2RF2 B;  3MCN A;  2YKP A;  2XMV A;  3KLI B;  2M4M A;  3I31 A;  4MH8 A;  4NLV A;  4X4R A;  2VFV A;  2V8P A;  2OSR A;  4DQI A;  1HQU A;  1TUW A;  2J9D E;  1P8G A;  1MRO A;  3PDN A;  3T6J A;  1S0M A;  4GO5 X;  3MM6 B;  2VOD A;  2CPY A;  5CYM B;  1KQS R;  1PJ5 A;  2AU0 A;  2BOA A;  1KC8 T;  4I7F A;  3TUJ C;  4ALZ A;  2R8I A;  1JJ2 R;  3LP2 A;  3OFH A;  2WZ1 A;  2W9B A;  5THW A;  3OXF A;  5HP1 B;  3D0I E;  1EET A;  4NLX A;  2ASL A;  1FDB A;  4KKO B;  2KG0 A;  4GMK A;  1RYR A;  1PYO B;  1IJE B;  4IOA Q;  2DNN A;  1ROF A;  1WDD A;  4WYW A;  1S48 A;  2XMW A;  2RKI B;  2AEF A;  2HRT A;  4USJ C;  4JI4 J;  1NND A;  2ROG A;  1IKX B;  4B3O B;  2AEJ A;  4X4T A;  3MXH P;  2E29 A;  5K20 B;  1NKE A;  2XMT A;  4NRT A;  2HFZ A;  1XQI A;  3F0N A;  4CLT A;  1RT2 B;  2VPX B;  4Y2C A;  4CH7 A;  1RK8 A;  3FQK A;  1Q81 T;  2IA6 A;  2DH9 A;  3DDI A;  1N33 J;  4TLQ A;  1V5I B;  3MEC A;  3VZH A;  4R8U A;  4ECT A;  4P7V A;  4A48 A;  4DLG A;  3KLE A;  3IR5 B;  2JNJ A;  4DG1 A;  3CF5 Q;  4RPF A;  1TL7 B;  5J2M A;  3IR6 B;  4F26 A;  4CT8 A;  4OHY A;  2POK A;  4DSE A;  3C3L A;  3PRB A;  3H2U B;  3CJK B;  4M5M A;  3OT9 A;  5KFL A;  4KRW A;  1VQS A;  1SC6 A;  5HQM A;  1MN7 A;  2HHT A;  4ZCI A;  3OSN A;  4EFA C;  1URN A;  2EFO A;  2HW3 A;  2NYI A;  3Q8V A;  1AYE A;  2BAB A;  4OZ3 A;  3P6Y C;  1Q5V A;  2VQE J;  4CLK A;  1BLU A;  5HRO A;  2BJD A;  2JEG A;  1IM4 A;  2FLP A;  4YB7 A;  4ZVF A;  1S10 A;  3DC2 A;  3DGV A;  2VQF F;  2AX1 A;  2WB1 D;  2BJ7 A;  3P5B P;  4KGK A;  1GH8 A;  5HLF A;  1S79 A;  3SI8 A;  3AOD A;  2Z8Q A;  1A7G E;  3D1Q A;  2BE9 B;  3H2V E;  2Y1J A;  1PJ6 A;  2UXD J;  2QGF B;  3DRX A;  2K1R A;  4UY8 5;  5U47 A;  2MKK A;  4CLP A;  4A8Q A;  4DV1 J;  2N4C A;  2HBZ B;  4RWX A;  4JP8 A;  3CJ5 A;  5JVG Q;  1T8E A;  1HR0 F;  4ZCL A;  1FX4 A;  4NXN F;  1LWF B;  1RAC B;  4P52 A;  2BYC A;  4I2P A;  4CLS A;  4DLE A;  3LAM A;  2W7P A;  2JRS A;  2E9T A;  2FTR A;  4OX6 A;  2UUB J;  1KP6 A;  3IRX B;  2PE8 A;  4AXI A;  1JKH A;  1FJG F;  4PEO A;  3W66 A;  5IQ6 A;  4ECZ A;  3SEO A;  4PG6 A;  4KJI A;  2AEM A;  4XDD A;  2LVW A;  4XTT A;  2IC3 A;  2DIU A;  3HKZ D;  2R2S A;  1UTA A;  4LR9 A;  2WOM B;  2CNK B;  3OPK A;  1Y5N B;  2L9N A;  1IBM J;  3MAQ A;  1QE1 B;  4ZP7 A;  5IT4 A;  2YH1 A;  1S72 S;  4P2M A;  1HI8 A;  3TA2 A;  4PQU A;  4C3K A;  3G71 S;  2XY6 A;  3TA0 A;  2R7Q A;  4K5S A;  1G2E A;  3L3C A;  1Y11 A;  1NJY A;  2JSX A;  4F3Q A;  2IJF A;  1IKY B;  2KVQ E;  2Z0G A;  1RKI A;  2IM1 A;  2XHC A;  1J5E F;  3L9Z A;  1NB7 A;  3V6D B;  1KHV A;  3ICL A;  2R7S A;  1RHM B;  3Q23 A;  3BBC A;  2KRR A;  1FFW B;  3DLE B;  4URS A;  4QR0 A;  5DGA A;  1N0V C;  3DNC A;  4UT4 A;  4DSL A;  1Q8I A;  4ERD A;  3T5K A;  1MMN A;  3JAM Y;  1HMV B;  2W9C B;  4YOE A;  2BQU A;  4IH5 A;  2JWN A;  1CJT B;  4XPC A;  4LBH A;  1FKO B;  4LF6 F;  1MWZ A;  1LEO A;  2DTJ A;  3JAM U;  4JI6 F;  1RTI B;  5AE1 A;  3CT9 A;  4IDK A;  3R5G A;  3UDE A;  1VOM A;  2YKO A;  1UVI A;  4PWU A;  1UVM A;  4RJV A;  1HKA A;  4DBQ A;  3T1Y J;  1NJZ A;  1VHI A;  4CI0 B;  1T05 A;  4LSL A;  2E66 A;  4IG0 A;  2YNH A;  2O3D A;  3EE3 A;  2G2Y A;  1S7I A;  3CCM S;  3T5H A;  4U7U K;  1L3U A;  3RZA A;  3L7U A;  1UVL A;  4DX6 A;  5ADZ A;  2J0Q D;  4DXL A;  2ASY A;  4F8R A;  2ZHA A;  4Q5V A;  1URR A;  2ZOG A;  3AB2 B;  1WEZ A;  2B5J B;  4Y3C A;  3JTN A;  3IS9 A;  1H7X A;  4FPR A;  2RU9 A;  5CH7 B;  1YLX A;  5A8R A;  4RKU C;  5IOL A;  1RWM B;  2VG7 B;  4PXC A;  3J7Z 5;  5KFS A;  4NZ0 A;  1GQE A;  4N41 A;  3PYE A;  5T14 A;  3KK3 A;  4Q2L A;  2QYC A;  4QYR A;  1RT3 A;  1HBN A;  4NXM F;  4LF5 J;  3GWC A;  3BF4 A;  9ATC B;  2XS2 A;  2KL8 A;  3M9M B;  1NM2 A;  4ECY A;  3KJV B;  4B3M J;  1FT8 A;  3H5X A;  2DRB A;  4MFB B;  4ZIV A;  3M2R B;  1NEE A;  2RHS B;  3DRS A;  2J5A A;  3J7A 1;  3THV A;  4LT6 A;  3D54 A;  3BGO P;  1NPK A;  1UWB A;  5D3G A;  1S0V A;  4NYP A;  3SSR A;  1TAU A;  3RB0 A;  7FDR A;  2CIM A;  2F5G A;  3SV4 A;  5IQQ A;  1KQK A;  1RTH B;  4HHH A;  4BWJ A;  3N5F A;  2C3Y A;  1BUX A;  5IT9 Y;  3ISZ A;  2J0S D;  1S1V B;  1YJN S;  3OV7 A;  1R8P A;  1BQN A;  2GIQ A;  1C1B B;  3KUE A;  2CQ1 A;  4WPA A;  3UVJ A;  3GR0 A;  3B4M A;  1JLA A;  4ZVT B;  5IT9 U;  3MTK A;  5KT2 A;  2QG9 B;  1I94 F;  2J7W A;  1A0O B;  1MNE A;  1KOH A;  3H25 A;  3MEE B;  2YWH A;  2QL9 B;  3QNW B;  1TK5 A;  2J0X A;  4IH7 A;  4Z37 A;  3H5Y A;  1QAJ A;  3Q0A A;  5DM6 Q;  4C11 B;  2CQD A;  1C1C B;  3M8P A;  2MLY A;  2UXB J;  3RBZ A;  3H7H B;  3SQO P;  1KQG B;  3LQV A;  1NDC A;  1FRM A;  5A8W B;  3OD2 A;  4NYO A;  2E1P A;  3EDR B;  2DR9 A;  4QIE A;  3WBZ A;  4HTI A;  1TFY A;  1FE0 A;  2EFG A;  2HQF A;  4NML A;  1Q7Y T;  4IR1 A;  4LFA J;  4ITS A;  5BJR A;  2WW8 A;  2JZ5 A;  2YWE A;  5KG6 A;  1EIY B;  3MZI A;  1FRL A;  2XLJ A;  2VIH A;  2DY1 A;  3KUG A;  3GYX B;  1FJE B;  4YDD B;  1R0B G;  1UJ6 A;  3CJT A;  3M2U A;  3UCG A;  3QAU A;  3VAJ A;  4K8R A;  1WC1 A;  2HRU A;  4OHX A;  1SJ3 P;  1XMB A;  5K9F A;  1PO6 A;  1M1K T;  4KFB B;  2HBQ B;  2HSE B;  3I5A A;  1JLQ B;  4F7V A;  2QFI A;  3NL0 A;  4OYM A;  2W2Q P;  4Y34 A;  1FWL A;  3BN4 A;  3OL9 A;  1P9Y A;  1U0H B;  5F8L A;  2KH9 A;  4MKV A;  1TAQ A;  1R0A A;  2HK2 A;  4JI1 F;  5KFF A;  1EB0 A;  3FVY A;  1RT5 A;  1UW4 A;  4MKB A;  5KG1 A;  1PIE A;  3NNH A;  4PUO B;  1QUV A;  2FB0 A;  2LXF A;  1TEL A;  3AD8 C;  3G87 A;  3T9N A;  2I9S A;  1NSK L;  5I3P A;  1S49 A;  3QWU A;  4ZIW A;  1B7F A;  2AYG A;  2H9Z A;  5J2P B;  3LWL A;  4M5J A;  5L8R C;  5H9E J;  3R5B A;  1LQ9 A;  5JUM A;  1YKW A;  2V8V A;  1PYS B;  4DV0 F;  4Q8F A;  2KU7 A;  2F3J A;  1FJ7 A;  2MPU A;  2PA8 D;  2V8H A;  2PSZ A;  3K57 A;  2AKW B;  2Z30 B;  3ILI A;  2LDY A;  4XPE A;  3EPG A;  4ED4 A;  2FHJ D;  3QAT A;  2DXF A;  1KNZ A;  2DH8 A;  2VAS A;  3KJQ B;  2ERR A;  1HI1 A;  2N4D A;  4OQJ A;  3ENQ A;  1C0U B;  6AT1 B;  2WON A;  4LRE A;  1JNZ B;  9RUB A;  5HO4 A;  1UVJ A;  3L09 A;  8AT1 B;  2Q3P A;  1DTT A;  2X1F A;  3TAP A;  5F8J A;  4ECX A;  3DYA A;  2AYE A;  4X62 F;  2I1R A;  3Q8Y A;  4ZLP A;  1RTJ B;  4L6V 3;  3HXM A;  3NMR A;  1ZOT A;  4K7Q A;  4AE5 A;  7FD1 A;  1E6V A;  3W64 A;  4G3I A;  1GMU A;  1JJH A;  2Z2Y B;  4ED7 A;  2V94 A;  2DNH A;  1O6X A;  1CLF A;  5D78 A;  2V8D A;  3ZZZ A;  4LF6 J;  4EBD A;  3RAQ A;  2N7Y A;  1IXK A;  3QZ8 A;  4HVZ A;  2LEC A;  4M5I A;  3DOK B;  3TEH B;  3G4S S;  4JI6 J;  1TV6 B;  1AXQ A;  1SJQ A;  4XDC A;  4YHH F;  2COL A;  1FA0 A;  2Q66 A;  1U6F A;  1PSD A;  1GEH A;  1UL3 A;  5L1J A;  1Q5Y A;  5JXS A;  3W3S A;  3CC7 S;  4D3H A;  1VC0 A;  2MKJ A;  2YH0 A;  1XR5 A;  3IRW P;  3QIP B;  1OPI A;  4DZ6 A;  4DV2 F;  3CTR A;  4RUC A;  2XSJ B;  2KN4 A;  4DZD A;  3OW2 R;  3TQE A;  2BJ3 A;  2IRX A;  1SUQ A;  3O5T B;  2E7V A;  2ACM A;  3DLH A;  1D0E A;  3S8S A;  3DDK A;  4P75 A;  5AJ3 J;  1HPZ B;  4J90 A;  2P9C A;  4AYB D;  2EI5 A;  2ZHO A;  3KHH A;  1RGV A;  1D8Z A;  2ASJ A;  3W5X A;  3W65 A;  3FRZ A;  2OGU A;  2ZOM A;  5KG4 A;  2ALY B;  4WP3 A;  3BH7 B;  1AUS L;  1N32 F;  4RUA A;  1DQ8 A;  4NLW A;  1ZPV A;  3W7B A;  1CG2 A;  4KHP F;  3D66 A;  2XNQ A;  4P10 A;  1VQK S;  5E33 A;  4TU8 A;  2BXJ A;  2NXJ A;  3P96 A;  4ZPC A;  1LWE B;  5KFV A;  2EXU A;  2GJ2 A;  2EFQ A;  2HNY B;  4X2B A;  4I2Q A;  1TKT B;  4OZJ A;  1QAI A;  4RNF A;  1SI9 A;  1NSP A;  1IBK J;  2MZT A;  4DR5 F;  2BBE A;  3BSO A;  1Z2L A;  4Y2M A;  4GKK J;  3MEK A;  2JL9 A;  3UR0 A;  2APO A;  2K3I A;  4EI2 A;  3H4B A;  1RI7 A;  2ZD1 A;  3D0H E;  1JLE A;  1KOO A;  2LYV A;  4TN2 A;  4DN0 A;  1UEU A;  4ZS6 A;  4NMX A;  3G2X A;  1KTQ A;  1R27 B;  2H5E A;  3RRK A;  4OI2 A;  2FJB B;  2ILY A;  2OTL S;  2YX1 A;  4Y65 A;  1U02 A;  1Q8B A;  2FPH X;  2MST A;  1N54 B;  1Y4Z B;  3QBC A;  4O4G A;  3VCD A;  3HVW A;  4RBU A;  3CCE S;  4F4X A;  3TYT A;  5C25 A;  3LGH A;  1TL1 A;  1B0P A;  5EN1 A;  2XMM A;  3M8Q A;  1QVF R;  3PKM A;  1ZA1 B;  1HNI B;  3R5D A;  3H59 A;  1RWX B;  3M6X A;  2B4U A;  1VK3 A;  4K4Z A;  3RB3 A;  4B08 A;  1T9U A;  2VB6 A;  2XCA A;  4V1A k;  5CYJ A;  1U8W A;  2QX0 A;  4EK2 A;  1VMB A;  3RB6 A;  2MY8 A;  1QDU B;  2KTQ A;  3GP9 A;  4JI0 F;  3V6H A;  4M5N A;  1WJ9 A;  4LVO P;  4J9U E;  5HAN A;  2BW2 A;  1SC3 B;  5ETR A;  4PZV A;  1SL0 A;  2J9C A;  5GAH U;  3TAQ A;  1AUD A;  3Q24 A;  1XEZ A;  3POT B;  4CH0 S;  1W7W A;  4KHM A;  3LAL A;  4LRA A;  2NXC A;  3ONQ A;  5IC4 B;  4ED0 A;  1WC3 A;  2RT3 A;  3K8W A;  4NCB A;  3CJS A;  3DRP B;  5CCL A;  4A8F A;  2RD5 C;  2FLN A;  1S9F A;  1XK8 A;  1IWA A;  3N28 A;  2AYM A;  3RR8 A;  4ZP8 A;  4TVA B;  4ZVP B;  4EZ6 A;  3A12 A;  3DLG A;  2EK6 A;  2GHW A;  4ZA1 A;  5BXI A;  3GYN A;  3CO9 A;  3GIK A;  1XTZ A;  3KUH A;  3W5Y A;  1WOO A;  5IFM A;  3V2U C;  2HVZ A;  1YIJ S;  4UUX A;  3EWG A;  4OZ2 A;  4DF8 A;  1CEZ A;  1FER A;  2NSB A;  1KVK A;  5HI7 A;  3B4D A;  1S9E A;  1RT4 A;  3TR5 A;  1RU2 A;  2WB4 A;  4LF8 F;  1FK9 A;  5G4D A;  4RUB A;  3TUZ C;  3KLF A;  5J2M B;  2R7O A;  2P6T A;  2AGO A;  2MMY A;  2RDJ A;  2BOP A;  5GAG I;  3ZFV A;  1JLB A;  3IGV A;  4HH1 A;  3IWN C;  1EHW A;  4ZPB A;  5CCM A;  1DTQ A;  2PA3 A;  1UW9 A;  3VAH A;  2IVY A;  4HAC B;  4CNY A;  3JSB A;  5RUB A;  2HPU A;  4U8Y A;  3BGF A;  3MM5 A;  2GJF A;  1L3V A;  4DN9 A;  2DH7 A;  5HRO B;  1K8A T;  3C8Y A;  3ZO7 A;  3A8K A;  4CP5 A;  2E5H A;  1T94 A;  4QWD A;  3JQJ A;  4ZVQ B;  2YNI A;  4HHU A;  3ET6 A;  3HVT B;  3DCA A;  3TVK A;  5C7P A;  2HMI A;  3A3O B;  4F3M A;  3LGM A;  1QSL A;  3MEG A;  5BYS A;  2IAJ B;  2HQG A;  1U2R A;  3LAN A;  3WIV A;  2MQL A;  1KWM A;  1ZTW A;  2K1R B;  8ATC B;  4EGL A;  4LIR A;  3AA8 A;  1M5O C;  2RQM A;  1HBO A;  1FWK A;  1K47 A;  2QLW A;  4Y0F A;  3SMZ A;  4J9V A;  3AOC A;  3PX4 A;  1NK0 A;  4KBI A;  5A2Q Y;  2JLE A;  4NRU A;  4PWD B;  4N8O A;  1OO0 B;  3HSJ A;  4PYA A;  4GVB A;  2AJ2 A;  1SJF A;  1NB2 A;  1YI2 S;  2DKO B;  3KHG A;  4RBT A;  1VQ9 S;  2BAC A;  1S6P A;  3R6G B;  5K14 A;  1UZD A;  4Q0B A;  4LBP A;  3MPV A;  1U48 A;  3RRH A;  2XEX A;  4U8V A;  3I6P A;  2HWI A;  4JB8 B;  1Y7P A;  1GXT A;  2IC3 B;  4FP9 A;  5B0E A;  3DI6 A;  4QYZ K;  1MWQ A;  3UI3 A;  4DUZ J;  2QSW A;  4ECS A;  5CD4 A;  4C8L A;  3DLJ A;  3OHB A;  2CZ4 A;  3NBP A;  2Q79 A;  3RUB L;  3GPA A;  3PXG a;  2BVZ A;  1XMO F;  2CVE A;  4WCE Q;  4PQU B;  4DL7 A;  1KEK A;  1JWW A;  2VBY A;  1UMJ A;  3CCU S;  1ZM3 A;  2R2R A;  5BR8 F;  3SCI E;  3CDE A;  4QCL A;  1JMT A;  2ZEJ A;  1SBR A;  3VTI A;  2E1C A;  3W61 A;  2KRB A;  4ZPT R;  1NBE B;  3C2P A;  2AJ4 A;  2R7V A;  4KHP J;  3FCW A;  5KG2 A;  2IPO B;  3Q89 A;  1H73 A;  1Q8K A;  3HZG A;  1SH0 A;  1YX2 A;  5GVQ A;  3HVA A;  3M32 B;  2CJB A;  2L9W A;  4JV5 F;  2MZS A;  2VG5 A;  1QVG R;  1D3W A;  1RWN B;  1EJ7 L;  1IKW A;  5HQ8 A;  1M90 T;  5GAD I;  1PC5 A;  1BC6 A;  1H72 C;  3DOL A;  4ENO A;  3QQC D;  2C22 A;  4ZVO B;  3DLL Q;  2CJA A;  2AGQ A;  1NK9 A;  2CXE A;  3J81 j;  2XI3 A;  1BGX T;  2OH2 A;  1W25 A;  3TO8 A;  5CD4 H;  4QR2 A;  3TVZ A;  1MU2 A;  1YRT A;  3F41 A;  4PG5 A;  3CDW A;  3NWR A;  4F25 A;  3MCS A;  3CCL S;  4A8M P;  2B43 A;  2B4V A;  5KFR A;  3J7A N;  3NNA A;  2XGP A;  2H54 B;  4LSL B;  4CCH A;  4C48 A;  5F8N A;  5F8H A;  3R7B B;  4A46 A;  1K9M T;  1X31 C;  1FI4 A;  5J1E A;  1UZH A;  3NS5 A;  1J5O A;  3LWM A;  1HHT P;  2HQD A;  3CDA A;  3IG1 A;  1HD0 A;  3U27 A;  2HG4 A;  4I64 A;  3GII A;  3UCU P;  3MD3 A;  3BO3 A;  3DFE A;  3UFC X;  3IS9 B;  2CZV C;  3CD7 A;  1N5S A;  5KTQ A;  4JI5 F;  2W8L A;  4EYI B;  1GTE A;  2QMU B;  3TZX A;  2G9O A;  3A3P B;  3SFU A;  1FWP A;  4O23 A;  5E0O A;  5K8M A;  2HHW A;  3MCO A;  4DU7 A;  4FF2 A;  3LOU A;  1KFD A;  1HBN B;  1IKV A;  1Q16 B;  3DLK A;  2ALZ A;  4AND A;  3PIP Q;  4FVC A;  3D9B A;  3T5J A;  2H5J B;  4GKJ F;  1N36 F;  4C8O A;  2XCP A;  2DJW A;  2LEA A;  3GIM A;  1SIW B;  2IJN A;  2KHD A;  1GTH A;  1WHX A;  1FDA A;  3R7S B;  1Z4U A;  3K17 A;  5D3G B;  4LF9 J;  2IYI A;  3TUP A;  2Q43 A;  3QO9 A;  2XO7 A;  3BBB A;  4FN5 A;  5KFI A;  4F0M A;  3TNV A;  5KG3 A;  4QU6 A;  2MLX A;  4DPX A;  2B7C B;  2Y1R I;  3ZTO A;  4MIB A;  2O66 A;  1CJV A;  3E2E A;  1FKP A;  1FHT A;  2RDI A;  3NY0 A;  4K0K J;  1GK8 A;  2GA7 A;  4G65 A;  3M9O B;  3VGT A;  4DV3 F;  4CTA A;  1JLA B;  5KFY A;  4HKQ A;  1T03 A;  3MM7 B;  5T7L B;  4IQM A;  4KGZ B;  4X4P A;  4WK3 A;  3Q83 A;  1FRH A;  3OLA A;  2C3U A;  5L39 A;  1CSJ A;  2P9E A;  3D6H B;  1U49 A;  1CS4 A;  3JXO A;  1FRX A;  2DGX A;  1YZ6 A;  3CO0 P;  2ZBP A;  3MI7 X;  3RR7 A;  2DNQ A;  1U8S A;  3DHX A;  2WVB A;  2BE7 D;  3QID A;  1S57 A;  2CJQ A;  4NI2 B;  2DNZ A;  4WFX A;  1LW0 B;  1XNQ J;  2ZJR Q;  1CJU B;  1NME B;  1T9V A;  2AQ4 A;  5JVH Q;  2BJ8 A;  2DHH A;  3K5P A;  2NCK L;  5KT6 A;  4C97 A;  4FYW B;  1NLK L;  2MKY A;  2BA9 A;  2J7U A;  2IHR 1;  3V6J A;  3EYZ A;  2NPF A;  1U4B A;  2A2C A;  5A8K A;  1TVR A;  4NLD A;  5KFC A;  2DGU A;  4USH A;  2VIC A;  1WHW A;  3EGZ A;  3M2U B;  1QJH A;  3JTO A;  4LFB F;  2VG6 A;  4EUV A;  1K73 T;  2MKC A;  4MJK A;  2M7S A;  4KIA A;  4QBU A;  5A0Y B;  4UTG A;  1YJV A;  1FTC A;  2XS7 A;  4DFJ A;  1N34 J;  3T1A A;  1X9M A;  4CLZ A;  1Q8L A;  1JK9 B;  4AL5 A;  4R5P B;  1H74 A;  5GAH I;  1SJ4 P;  4Q7A A;  2C2K B;  2YWK A;  1R0A B;  4OI3 A;  1UPP A;  3SCJ E;  2QO3 A;  4FNH A;  1OYE A;  2B7B B;  2CNN B;  1WAC A;  2ZVI A;  2HHQ A;  1VQ6 S;  2HS0 A;  2RH3 A;  2W2P P;  4IOB A;  5KFN A;  2OMO A;  4ELT A;  2D7S A;  3EX7 B;  2I38 A;  1R8H A;  1IBL J;  1BQM A;  4QWE A;  3V81 A;  1JLG A;  4IQX A;  3NG8 A;  2EBG A;  1UVN A;  2N3O A;  4X64 J;  4A4J A;  3GLJ A;  4OI4 A;  3FUY A;  1GMW D;  4P2S A;  4KGV B;  4NA2 A;  2WVC A;  2BE2 A;  4YY3 J;  2E5L J;  3AXK A;  1HI0 P;  2CWX A;  2F8M A;  3U02 A;  4N8N A;  3WQP A;  3FDS A;  3M8S A;  2YKM B;  4I4B A;  3GG1 A;  3LUY A;  3HHL D;  3ZZP A;  3GCX P;  2HS3 A;  3C19 A;  1B4S A;  2DHG A;  3JSR A;  1G1X A;  2LCW A;  4DF4 A;  4MIA A;  1DTT B;  2ZNZ A;  1OJ4 A;  5E3A A;  4QW8 A;  5AE3 A;  1CJK B;  5E7O B;  3FCH A;  4O3S A;  2GV1 A;  1F1B B;  4R0E A;  5KFJ A;  1TFW A;  2QLX A;  3R8Y A;  4NA1 A;  1D1U A;  1YJ9 S;  4CIO A;  1E6V B;  3P49 B;  2DBB A;  3UN5 A;  3ZNU A;  5K8O A;  4JI3 F;  1Y3J A;  3PKY A;  1SQE A;  2A2D A;  2E9Z A;  3PW0 A;  1NK5 A;  2ADC A;  3MPW A;  2CPF A;  3UCZ P;  2CQB A;  5KFW A;  2MZ1 A;  2IM3 A;  2FVQ A;  3CMQ A;  1OMS A;  5D77 A;  4ZN1 A;  2U2F A;  2JEJ A;  1XWL A;  5M2U A;  4DCP B;  4A47 A;  5DET A;  4YFU A;  1R31 A;  2HVE A;  2MQM A;  1U1O A;  1L5U A;  4QJV A;  3EVM A;  3GR1 A;  3LF0 A;  1DHM A;  4NL5 A;  4O3P A;  3TQ1 A;  1IQT A;  1EZZ B;  5EHH A;  1D8Y A;  1S0N A;  4LUB A;  1VQ8 S;  4J91 A;  5KFB A;  3MM9 B;  4B3S J;  1TMJ A;  3ZZY A;  5HVG A;  2JVR A;  1OQ6 A;  3D1O A;  2CYY A;  4LFC F;  5HVH A;  3C6U A;  2HS4 A;  3IN5 A;  1Y3K A;  2A1B A;  4O44 B;  1RXO B;  2DK2 A;  3TAM B;  2LQB A;  4DQQ A;  3BDP A;  3DKD A;  3IC1 A;  4DR4 F;  3QJP A;  4TU9 A;  2UV8 G;  4H4O A;  4KT0 C;  3JS9 A;  2AP6 A;  1M5P C;  2YVS A;  2ZM6 F;  1HQ2 A;  3ENW A;  1G3O A;  5B09 A;  2KJV A;  4ZVG A;  5ETM A;  3VAI A;  1ELO A;  2X1A A;  2P2C B;  2AV5 A;  2ZOF A;  1SKU B;  2YXL A;  5KFD A;  3GIR A;  3D3C J;  5D8H B;  4GKJ J;  2HHH F;  5D4O A;  2DCL A;  2IDL A;  1VIX A;  5IC6 B;  2U1A A;  2XZD B;  2EC2 A;  3AXM A;  4NX9 A;  3I32 A;  2CPZ A;  2RSQ A;  1RWW B;  4QIW D;  3H90 A;  3T3F A;  1PBA A;  2H5I B;  2RRA A;  2RQ4 A;  2LQJ A;  2RHQ B;  3NWG A;  1B0T A;  3MR7 A;  2FZC B;  2C2M B;  3HM9 A;  2OML A;  3J81 U;  3R5A A;  2CDQ A;  1ZZN A;  2JOQ A;  2ZD1 B;  4RNO A;  2F1F A;  2M2B A;  2ZDP A;  4ICL A;  2KXF A;  2X3D A;  3A8I A;  3DM2 B;  4FBT A;  2JJ4 D;  2R3V A;  3O44 A;  4BHQ A;  3JYT A;  2LDI A;  1WWH A;  3SXL A;  4O4G B;  3FSX A;  3MM8 B;  3MED A;  3LH2 S;  1ZBT A;  2P9G A;  4OZL A;  2PO4 A;  3PCO B;  4RLE A;  3PRD A;  1RAB B;  1TL1 B;  1YBT A;  2OJ3 A;  2OPQ B;  4WE1 A;  3AAW B;  4JI2 J;  1NKB A;  4ZVU B;  4P2F A;  1F5C A;  3VGU A;  1U7L A;  3FFI B;  1UFL A;  3GSD A;  2FHK A;  3TRG A;  3OUY B;  3HLU A;  1M0S A;  3U7J A;  2K2P A;  4F50 A;  3KNG A;  2GIF A;  3HSD A;  3M8Z A;  2V69 A;  2AYB A;  5HQL A;  2Z58 B;  1RT7 A;  3Q8R B;  2B4O A;  1DBD A;  2ZJQ Q;  1PYT A;  3KNA A;  2GIR A;  3MUV P;  1ULR A;  5KFZ A;  4QPX A;  2GQC A;  3R1H A;  5DG7 A;  1WI6 A;  2XTJ P;  2HVD A;  4MK9 A;  1QAY A;  4M8L A;  1I3O B;  1X4B A;  1CVJ A;  1VRT B;  2ZBR A;  5K8P A;  3PVX A;  3C16 A;  2UV8 A;  5HMW A;  3MUT P;  1RAD B;  1EX8 A;  4RU2 A;  4KV8 A;  1HQE B;  1DLO B;  2NXN A;  4YN3 B;  2BM1 A;  4FNI A;  2VBZ A;  2QTW A;  2MHE A;  3AJD A;  4KPY A;  2HHX A;  2V8G A;  2VH7 A;  4KYZ A;  3PIO Q;  4M1K A;  3DLG B;  2QLJ B;  5DQH A;  3PFO A;  3T6B A;  2EC0 A;  5D6G A;  2XYP B;  2R42 A;  3Q86 A;  1H2U X;  1XNR J;  2GVZ A;  2LEB A;  1FKA F;  5G0R B;  4HTJ A;  2E5I A;  4UUW A;  2HKE A;  4LRC A;  4TY8 B;  1PGZ A;  4K4U A;  4E98 A;  2DRD A;  3FBE A;  1YVF A;  3BGL A;  1FK9 B;  2OPR B;  1DUR A;  2KJW A;  2MQN A;  1DY3 A;  1ZA2 B;  1VQL S;  1G7C B;  5KFH A;  1VQ4 S;  1JLB B;  2QC3 A;  3A1Y G;  1HNX J;  1K1Q A;  1WEX A;  4CM2 A;  3PW4 A;  1SC4 B;  2KHC A;  2RAQ A;  3VAK A;  1WTF A;  1DTQ B;  4JV2 A;  2EVZ A;  4DR7 J;  4QR1 A;  5IWA J;  3U1M A;  4AT1 B;  1HFE L;  2I6W A;  2MEW A;  1RAH B;  1M1G A;  3MM5 B;  4PKD B;  2B9X A;  3D2W A;  1KFS A;  3MTJ A;  3GFX A;  4ECW A;  4TYB A;  3I96 A;  2B6A A;  3TOQ A;  4HLB A;  1TR0 A;  5KT5 A;  2OLW A;  2YNI B;  4C3L A;  1F9H A;  2EG2 A;  2UUC F;  1VBZ A;  2LKZ A;  2IA0 A;  3OQ2 A;  4NZ7 A;  5FDL A;  4IG3 B;  4K4W A;  1GAO A;  3P3D A;  4DR1 J;  2G2Z A;  2KVI A;  4KR0 B;  2MGZ B;  4DV6 F;  1JLF B;  1S6Q A;  1ZYQ A;  2PT0 A;  2FC9 A;  2LU2 A;  2D41 A;  1V9O A;  2JLG A;  2NSC A;  3T41 A;  3I4P A;  1O5J A;  4F0H A;  5E3Q A;  2NLW A;  2XSF A;  2VOO A;  2WSC C;  4RL1 A;  2FJD B;  2YNG B;  1KKH A;  1OS5 A;  4M95 A;  1S6O A;  5KT7 A;  2VF3 A;  5C2C A;  1AA1 B;  3L7O A;  1S6P B;  5K14 B;  4Q0B B;  3PM9 A;  1FJC A;  2HZA A;  4DCJ B;  2AJ0 A;  2H1Y A;  4CLY A;  5B7W A;  2WBM A;  3KWM A;  1DQ9 A;  2PI5 A;  4G1Q B;  1ZM2 A;  3DI6 B;  1G6B A;  4ID5 A;  2ZWP A;  4ZHR A;  1ITP A;  1LFW A;  4FDF A;  3I0R B;  3T5L A;  3KOA A;  4W92 B;  1SV5 A;  2JH3 A;  1PAU B;  3NEK A;  2YWW A;  1YDL A;  1M5H A;  1Q4R A;  2M3D A;  1S1T A;  4DR4 J;  4B3T F;  3G6V A;  3OTD A;  3NLC A;  1KLM A;  3DGP B;  2IDE A;  4KH1 B;  1T02 A;  4ES2 A;  3RAX A;  4YS2 A;  2DIV A;  5LMU F;  3Q8U A;  4EZ9 A;  4N77 A;  5H9F J;  5F8I A;  1S1U A;  5HL7 Q;  1KVJ A;  3THP A;  2OEM A;  2QA4 S;  4OZN A;  4J9Q A;  5J2Q A;  2V0N A;  1IKW B;  4LF1 A;  5HJY A;  2IRU A;  2HHV A;  2ZVS A;  1YBU A;  4HI1 A;  4CO4 A;  4ZOS A;  3R5C A;  1LV5 A;  3E51 A;  1S9G A;  4MYT A;  3HHK A;  3FSY A;  2QIF A;  3DRR A;  4B17 A;  3JQK A;  1MU2 B;  1XER A;  3MUR P;  4RW8 A;  2D3O 1;  2HWH A;  1MML A;  3W9J A;  5DG8 A;  1EAR A;  2YWG A;  1O51 A;  2BJE A;  4K4X A;  4OI6 A;  4OYO A;  3DOM A;  3OL6 A;  3CDB A;  4B9S A;  5I42 A;  5J1E B;  2BQ3 A;  3AQO A;  5GAE I;  3UD3 P;  2FLO A;  3GZ7 A;  3AHP A;  4DPU A;  4X66 J;  1ZH5 A;  1XN9 A;  2DNY A;  1IM6 A;  3L4B C;  1NDK A;  4ILR A;  3P8B B;  3M6V A;  3M6W A;  4DHV A;  2W1B A;  5GMK a;  3QGP A;  3RAM A;  1LOU A;  1C4C A;  2HYI B;  5DDR C;  4B3R F;  5IM0 B;  2ZNY A;  3AY0 A;  1RB0 A;  2FVC A;  2BDP A;  4OZ0 A;  4NCG A;  4LF7 F;  2ZC4 A;  3HVR A;  1MMD A;  2ZDO A;  1AZS A;  4AFF A;  4C0B A;  1SH3 A;  1IKV B;  2HLU A;  3BRE A;  4LF4 F;  4Y00 A;  2CQ2 A;  4FS1 A;  1HWK A;  1HNZ F;  2I0X A;  4Q45 A;  1DZ5 A;  2UP1 A;  4IFV B;  4DX7 A;  3KFW X;  5EWG A;  3MM6 A;  3CD6 S;  3I87 A;  4J9K A;  3TX0 A;  3CPW R;  2UXC J;  3QO9 B;  2ZH6 A;  4NPO A;  2MB0 B;  5HP1 A;  3K89 A;  2C2R A;  4LRB A;  4R25 A;  3VAG A;  1CJV B;  4HYK A;  1FKP B;  4FYX B;  5D0E A;  5CAB A;  3CD0 A;  1YJW S;  4KKO A;  2D3O R;  4CNZ A;  4CH1 A;  1QSS A;  4ER8 A;  3CE8 A;  4KH0 B;  4M5D B;  2VBW A;  2ACY A;  5T41 A;  3TW0 A;  4X4O A;  2JVO A;  4RW4 B;  3F56 A;  4CTA B;  4DS4 A;  2C3P A;  3PX0 A;  2A18 A;  1OSD A;  3E8O A;  3QGI A;  3GQC A;  1FEH A;  2N82 B;  1Z1Z A;  5B0A A;  4WZM A;  4MTP A;  4NLY A;  1CC7 A;  1FXR A;  1XMQ F;  2VC1 A;  2RKI A;  5EDW A;  1N6Q A;  3QSI A;  4QIG A;  1H98 A;  1X4A A;  4B3O A;  4OV6 A;  1UA1 A;  3MMB A;  5AE2 A;  3HMJ G;  3LAK A;  4C8Z A;  4KO0 A;  3BYP A;  1RKJ A;  4CZC A;  1C4A A;  1O8B A;  3PO5 A;  5IV3 A;  1SPB P;  3AA9 A;  1RT2 A;  2O67 A;  2X7I A;  2P6S A;  2AD9 A;  1Q79 A;  1Y9O A;  2GGP B;  5LSL A;  5D4P A;  2B8P A;  4ED5 A;  1E6Y B;  2E9R X;  4OHZ A;  4IKA A;  1OQ3 A;  2RDD A;  3M8W A;  4U6P A;  3K5L A;  3G82 A;  3I9V 9;  3NAH A;  1TKZ B;  1RHJ B;  5KG5 A;  4CRJ A;  3SDE B;  3M30 B;  1T0T V;  3OFE A;  2DVI A;  3X3U A;  3H2L A;  1M5V C;  2JLF A;  4JV0 A;  1WTB A;  4RBV A;  3RW7 A;  2E5J A;  2Z56 B;  1HBM A;  1FRI A;  2E7W A;  3VGV A;  4DV5 J;  1UEV A;  4IR9 A;  2LQ5 A;  4ED2 A;  4PG4 A;  3HHL B;  5LJ5 Y;  4XO0 A;  2XZT B;  4WU3 A;  2W8K A;  3IGN A;  4G1P A;  4ETZ A;  4JOU A;  4C9D A;  2ATC B;  3CC2 S;  1YZ7 A;  2L08 A;  3D28 A;  4ZLJ A;  1QM9 A;  3I0S A;  3UNG C;  3W5Z A;  4AQY J;  3QJJ A;  3EIC A;  1S99 A;  1LW2 B;  3CB4 A;  4JI8 J;  4ELU A;  1X4G A;  3H98 A;  1L3T A;  3M2V A;  1IVZ A;  2HAI A;  2HHS A;  1I51 B;  3CUN A;  5IV4 A;  3D67 A;  3TZW A;  4UQG A;  1X4C A;  4Y2I A;  4JI7 F;  3HX9 A;  3DHW C;  1V3Z A;  2W4D A;  4PAB A;  3V81 B;  2RE1 A;  3DLB A;  2E1R A;  5DGB A;  2FGC A;  3CJ8 A;  3MPU B;  2RML A;  2W25 A;  2DYA A;  2QEX S;  4OIX A;  3NOG A;  4UZB A;  3N6L A;  2GO8 A;  2M0G B;  3GFH A;  4PRF A;  3JB9 k;  1LWF A;  2RB7 A;  3RBE A;  2HAF A;  1RWO B;  4DQS A;  2B9E A;  4WII A;  4EBE A;  5DS7 A;  3I5B A;  1QAX A;  3GB0 A;  1Q0N A;  3J7Y I;  3SIP B;  4DV4 F;  4NLG A;  3DRY A;  4AUK A;  1TKX B;  2W4P A;  2CPE A;  2FVS A;  2GS8 A;  3S01 A;  1LNQ A;  3QGH A;  4MMO A;  3TAN A;  3DMJ B;  2MLZ A;  4F3O A;  1WD6 A;  3PW5 A;  2PN6 A;  2OUG A;  3GG0 A;  3OJS A;  1AFJ A;  5ETP A;  2MSS A;  3MOJ B;  5SUH A;  5KT3 A;  1OPZ A;  1TL5 A;  1QE1 A;  2N3L A;  3MMA B;  5LMN F;  5GMD A;  4N76 A;  2F4V F;  4IRD A;  1C0T A;  2ZWO A;  2CQP A;  3CCQ S;  2WW4 A;  1F3V A;  1CQN A;  5D0H A;  4BBY A;  2JDJ A;  1IN0 A;  1IKY A;  1Q82 T;  1HWJ A;  3AD9 C;  5D4L A;  1FRK A;  4MKY A;  4DFK A;  1NK4 A;  1FXL A;  1R43 A;  2FQQ B;  4QWC A;  1WSV A;  3QT5 A;  5H1S V;  3DLE A;  5ETS A;  2YBV A;  3R27 A;  5KFE A;  4HH0 A;  4DEZ A;  3PEJ A;  4L3K A;  1HMV A;  2W9C A;  2KT3 A;  1JXV A;  2D3Z A;  1X4D A;  3RJM B;  2ZH2 A;  1PIL A;  2HIY A;  1FKO A;  4URQ U;  4ZK7 M;  3RGI A;  4UOC A;  5DM7 Q;  4G6V B;  3T1H F;  1RTI A;  2MQQ A;  3ISN D;  2KYZ A;  3CJ2 A;  4DPO A;  3KLH B;  3KK1 B;  4K4Y A;  1HNW F;  1MN9 A;  1WDT A;  4BLG A;  1KBR A;  3ZZR A;  3M6U A;  1RTD B;  2IY5 B;  4DV7 F;  1NCL A;  5KG0 A;  2C2E A;  4N47 A;  1SH2 A;  2FY8 A;  2LA6 A;  2AJ1 A;  3CMA S;  1ACM B;  2MQO A;  1HYS A;  3ZZT A;  1LXN A;  4OX8 A;  2MKI A;  1NHK L;  4DR2 J;  3PZP A;  2UU9 F;  1OY8 A;  2B5J A;  4ZP6 A;  1RP5 A;  2C2O B;  4LSZ B;  4RW7 B;  1HNZ J;  3BV8 A;  4NAS A;  3LW5 C;  1OSC A;  2CJY B;  2VG7 A;  1CC8 A;  5KFA A;  3KJN B;  3NGR A;  1OY6 A;  4A8Y A;  4WTO B;  4HHJ A;  2ZZN A;  4WP9 A;  2GAH C;  1Q1K A;  5KFT A;  2QLB B;  3KK2 B;  1VYA A;  4X65 F;  3OFG A;  2F7V A;  2PI4 A;  4NEZ A;  1N4L A;  4MFB A;  2FGO A;  1J2V A;  4LF2 A;  3M2R A;  3EGW B;  3D6M B;  5KFO A;  2AGP A;  1KQF B;  2G4B A;  1BWE A;  4KE5 A;  3JYT B;  4M5H A;  3CD5 A;  2XNR A;  1XMQ J;  5JMN A;  1VQY A;  4DR3 F;  1GXU A;  4WWS A;  2V4J A;  2NQP A;  1U09 A;  1RTH A;  4F2S A;  3MED B;  4Y2K A;  1U47 A;  4HT7 A;  2HND B;  4IOC Q;  2ZH5 A;  2UUA F;  3QPI A;  4J37 A;  5F0U A;  1S1V A;  4GC7 A;  4B9M A;  3TA1 A;  3VQT A;  1TL4 A;  4WE1 B;  3IA0 A;  4BC9 A;  3ILO A;  1C1B A;  4C6A A;  3EZ5 A;  1RCO B;  2QLF B;  4RNH A;  5D15 A;  1VIO A;  2CDR B;  3UPF A;  4ZVH A;  3VR1 A;  4FKY A;  1PCA A;  3ZC4 A;  4KGM A;  4IH6 A;  5B0B A;  3MAA B;  3MR6 A;  3TJ9 A;  3K0J A;  2DR7 A;  1RA6 A;  4C11 A;  4ECU A;  1A9N B;  1NAQ A;  2V9K A;  5GAG U;  1SKW A;  1T11 A;  1KHW A;  3C46 A;  3Q2S C;  1KON A;  3KDO A;  1VRQ C;  4YR3 A;  3NNC A;  3UQS A;  2FJE B;  1VQ5 S;  3R1L A;  5B0G A;  2DR5 A;  3UNY A;  3UD5 A;  1OIA A;  2HVI A;  2V4R A;  3GSI A;  1RT1 B;  1WF2 A;  3ITH B;  1R89 A;  4RW6 B;  3R9L A;  4HR2 A;  4C8Y A;  4ETX A;  2C2Z B;  2C2D A;  3JTP A;  1WC0 A;  4F0K A;  2HQC A;  4IRC A;  3UN3 A;  3CED A;  3HFZ B;  3R7N B;  3PO4 A;  2KFN A;  4OYB A;  4FZV A;  3FJ2 A;  1GX5 A;  3BYR A;  1V3S A;  4JI4 F;  5D0R A;  4LVN P;  2QJ3 A;  2GAG C;  4DX5 A;  4KFB A;  4TQS A;  4F4Z A;  4LRD A;  2OFG X;  1REV B;  3W8G A;  2VQF J;  1APS A;  5CZX A;  3SZ2 A;  1WF0 A;  2WVF A;  3QFH A;  1DRZ A;  1VC5 A;  1H2V Z;  2DPJ A;  1X5O A;  5HBM B;  3O1L A;  4FXW A;  2E5G A;  1N33 F;  4WIQ A;  5B08 A;  4B02 A;  2XG8 A;  3A13 A;  4PUO A;  1VQO S;  5EX0 A;  3JSY A;  2MKH A;  5L9X A;  1HR0 J;  1XBW A;  4NXN J;  3ETM A;  3BGU A;  1ZTT A;  1WUU A;  2PGC A;  5J2P A;  3R3T A;  1VR6 A;  2M9K A;  1F6T A;  3AB4 B;  3LA0 A;  4UOF A;  3M8Y A;  1N0U A;  3C6T A;  2CWK A;  4OYX A;  2I5J B;  2B6A B;  1FNO A;  3VV2 B;  4XAK A;  4PXB A;  4CT9 A;  2Y1I A;  3H8Y A;  1WOR A;  1FJG J;  2H48 B;  3FZ2 A;  1U2C A;  1D09 B;  4TXS A;  2H3E B;  5FDL B;  3QLH A;  2B0G A;  1U1M A;  3C14 B;  2NUU G;  3LTO A;  3MMC B;  1C0U A;  4ED6 A;  4WFB Q;  2XGQ A;  1MW7 A;  1I5O B;  2CA9 A;  1D9A A;  1PJ7 A;  4IYQ A;  4IO1 A;  4OV1 A;  4DX8 H;  4LSN A;  1RAF B;  2NRE A;  2JFK A;  4Q2M A;  3BZQ A;  1F2G A;  4NLT A;  1RTJ A;  4QZV B;  3WX8 A;  2KO1 A;  3NS7 B;  5B0D A;  2C42 A;  4U96 A;  2ZH8 A;  2IFX A;  2RQC A;  4Q44 A;  2UXD F;  5GAD U;  1FD8 A;  3BJY A;  1J5E J;  2BQR A;  2LXU A;  1V5V A;  1FVQ A;  1FVS A;  5FJ4 A;  2KYX A;  4DV1 F;  2ZBI A;  4W4M A;  4YUD A;  2HFU A;  1X4F A;  5CA5 A;  1MLA A;  3PYD A;  4OJ1 A;  4K4T A;  2CPX A;  3OXG A;  4KY3 A;  1IUJ A;  3RRG A;  5ETT A;  2UUT A;  5DQI A;  3DOK A;  2AIR B;  1IR1 A;  4OYP A;  1TV6 A;  1F2H A;  4RW9 A;  4B9T A;  3PHT A;  1RIS A;  2HGM A;  2PD1 A;  2QRR A;  4K59 A;  4NZ6 A;  2I2Y A;  2V2Q A;  2XM3 A;  1VRU B;  2HBY B;  2L48 A;  3OR1 A;  2RS2 A;  5BYQ A;  1S1T B;  3MWB A;  2R9L A;  1KLM B;  3QIP A;  4C2M A;  2UVV A;  3UDL A;  1EKS A;  2XSJ A;  3TZZ A;  3RBD A;  1ZAW A;  2FYX A;  3TEG A;  5F3T A;  5C5J A;  3PNI A;  1IBM F;  2MYF A;  5F9L A;  8RUC A;  3N6N A;  1IQZ A;  2GZO A;  4HI2 A;  3W8P A;  4USW A;  4PXE A;  4UOH A;  2KZZ A;  2R7T A;  1HPZ A;  4HDH A;  3ZTP A;  1N88 A;  5C42 B;  3GFY A;  4OMF G;  4C0O C;  4LR8 A;  2WAQ D;  3LGN A;  1RJJ A;  1S9G B;  3RW6 A;  1WG5 A;  1NHU A;  3DU5 A;  4PPZ A;  1UAW A;  5KOW A;  3KYL A;  3KTQ A;  2VOP A;  4RW8 B;  2RUG A;  1LWE A;  2DB1 A;  3GJT B;  2RIL A;  2FC8 A;  4NXM J;  1HNV B;  4TU7 A;  5MAO A;  2HNY A;  1TK8 A;  2F9J A;  2VPW B;  4F4W A;  1RT6 B;  1S1X B;  1VLY A;  3N79 A;  1VS3 A;  4L73 A;  3FMB A;  1FO1 A;  2MXY A;  2KFZ A;  1R8A A;  3MMJ A;  3TUI C;  4CO0 A;  3PHE A;  1HWI A;  2UUA J;  1S97 A;  2XBP A;  3T1Y F;  4PWW A;  3V4I B;  2IMW P;  3W60 A;  1YJT A;  1LK5 A;  2AMC B;  2GNK A;  4NCG B;  4CLW A;  4IFY B;  1YSJ A;  2G0I A;  3N0V A;  1U24 A;  1FX2 A;  2B56 A;  2QMW A;  4QWA A;  3R5J B;  5HJX A;  4X84 A;  2M52 A;  3HHN B;  3MR3 A;  5ETL A;  3BBF A;  1NKC A;  4PG7 A;  1GNK A;  5F41 A;  2NZC A;  2QN6 B;  4CLL A;  1I94 J;  2PMH A;  1Y10 A;  1RAI B;  1R6V A;  3O2I A;  2BUN A;  3PR4 A;  2QZ8 A;  4J9P A;  4P2X A;  1HQU B;  3CUL A;  3LP0 A;  4MK7 A;  2J76 E;  1MRO B;  1CBK A;  1T3O A;  3HT3 A;  2CFX A;  3PFE A;  2DGQ A;  4OFZ A;  1ZM9 A;  2QT7 A;  5KG7 A;  1HNI A;  4OI1 A;  4DL3 A;  2NXE A;  2QYG A;  2WHO A;  1TQL A;  3ADA C;  4LF5 F;  2C2N A;  1KD1 T;  3I56 S;  4OI0 A;  3NGS A;  1X9W A;  3PAC A;  4I7F B;  2G13 A;  4B3M F;  4KB7 A;  3IM9 A;  3LP2 B;  1WOS A;  2W2M P;  4OZ5 A;  2V63 A;  2W9B B;  3ZXW A;  4I56 A;  4QIV A;  5CQG A;  3FMW A;  1EET B;  2RIJ A;  5IT0 A;  2J9E A;  3I82 A;  2EK1 A;  4M63 A;  3HFV A;  5C2G A;  4NLS A;  1N6Q B;  3POT A;  1CUL A;  3PRV A;  3ZTQ A;  5LJ3 Y;  4OYA A;  2WBR A;  1FXD A;  3MMB B;  3MFH A;  3DRP A;  4KO0 B;  1X4E A;  3DXS X;  2MZQ A;  1FRJ A;  2OI2 A;  4H4M A;  3FNN A;  1D9F A;  2DNG A;  2H65 B;  1WG1 A;  1HLW A;  1QY7 A;  4DJB A;  2AZ3 A;  3CDU A;  4B9U A;  2ZIT A;  3A4T A;  2Z57 B;  5LL6 d;  3IBC B;  4JI1 J;  3CCS S;  1EQM A;  3G82 B;  4DI6 A;  2AJQ A;  4X4N A;  1VQ7 S;  4CYU A;  3MEC B;  2EG1 A;  4LR7 A;  4R8U B;  3ZTR A;  2UXB F;  3QRP A;  3AH6 A;  5FII A;  4DDF A;  2E1M C;  2XS5 A;  3HP6 A;  1EQ0 A;  1HBM B;  2J6T A;  4AD6 A;  3KLE B;  2OD6 A;  3F44 A;  2R7R A;  4DG1 B;  4WF9 Q;  4QIF A;  3FCV A;  4LFA F;  4WFA Q;  2WSE C;  2GMJ A;  2VBX A;  2ZH7 A;  4KPC A;  5M2R A;  2LQ8 A;  4WTY A;  4DV0 J;  1FES A;  4HAC A;  1FDD A;  3UDV A;  2OKQ A;  3GYG A;  2L41 A;  2FVP A;  2NR0 A;  3RTV A;  3I0S B;  1EP4 A;  1IBC B;  2RVJ A;  3OTB A;  5I3U A;  1I1G A;  3M2V B;  1FFG B;  2UVR A;  3HVT A;  3EXC X;  4USK A;  4KHR A;  2HQI A;  1U1L A;  4ZDN A;  1H0H B;  2IAJ A;  3OTO F;  1RBA A;  3I5C A;  2RRN A;  4LIW A;  3U1L A;  4X62 J;  1L3K A;  1FFS B;  4ZPD A;  5HLF B;  2WTF A;  3N4W A;  3IO1 A;  4B9V A;  3BKU A;  2DR8 A;  1YGY A;  3PR5 B;  4LQ9 A;  3QT6 A;  3K7R A;  1IWG A;  1WC4 A;  1RAE B;  4OX7 A;  3GTY X;  4PWD A;  4ANC A;  2BZ2 A;  1GX6 A;  4ES3 A;  3W2V A;  2HWT A;  4I2P B;  3K58 A;  1YBA A;  3DXB A;  3CJ0 A;  4X4Q A;  1JX4 A;  2GCF A;  1U45 A;  5E5N A;  3HKW A;  1JKH B;  1RLC L;  4OHV A;  4DUY F;  4YHH J;  5A2Q U;  4C98 A;  2CJX B;  4OYW A;  1S77 D;  5EUH A;  1WKL A;  3EUN A;  5DLG A;  1RHQ B;  2ZC3 A;  2EFP A;  4RNN A;  3PYF A;  1BXN A;  1JLC A;  5ETQ A;  2Y1L B;  1F3F A;  5HSP A;  4DV2 J;  3BSN A;  3N5B A;  4ZLL A;  4QPT A;  5HVF A;  1VJW A;  3HO1 A;  3S1T A;  1C0T B;  2VU5 A;  4DL6 A;  4OJH A;  5L1L A;  4J9S A;  3ZZU A;  2C1E B;  4O0I A;  3K2Y A;  4P9S A;  3CCJ S;  4YR2 A;  2HGL A;  1NPP A;  3G8Q A;  3SYZ A;  4F4A A;  2VKR A;  1UCN A;  3IM8 A;  1MSW D;  3CIZ A;  4L74 A;  1P1T A;  3IFE A;  1N32 J;  3M32 A;  1RWU A;  4W90 B;  1SL1 A;  2CUY A;  1IR0 A;  3G8S A;  2HNZ A;  1FCA A;  2YX7 A;  2YQ3 A;  4P73 A;  2R8J A;  3MF5 A;  2EFV A;  3BSA A;  1YWX A;  3NGD A;  3KJF B;  2BRK A;  4GVL A;  3GFZ A;  1BD6 A;  1VQN S;  1X4H A;  4I67 A;  3GJQ B;  4A8K A;  2V9W A;  1IR2 A;  3CCT A;  4I1T A;  1P27 B;  3D6F B;  5C24 A;  2XWX A;  2EKY A;  2LU1 A;  2Y3Y A;  5IS2 A;  4URG A;  2NUH A;  4EO8 A;  3EM1 A;  2ZJP Q;  4DR5 J;  4IDK B;  3PEH A;  2NYH A;  3HCX A;  1HYS B;  1T05 B;  4IG0 B;  2E7X A;  1NJI T;  1NRK A;  2YNH B;  3EZO A;  5IZH A;  2QL7 B;  2CQ0 A;  2AW0 A;  3MPD A;  3M05 A;  4UOG A;  2RU3 A;  2W9A A;  2LP4 A;  3Q8P B;  2W2O P;  3W1Y C;  5AJ3 F;  2IM0 A;  2HEK A;  5DZ7 A;  1QD1 A;  3KG0 A;  4OX9 F;  3E01 A;  5KT4 A;  4OLP A;  1UFW A;  1IJF B;  3NGK A;  5A8R B;  3TX8 A;  2YKQ A;  4PG8 A;  2ZBC A;  3RB4 A;  2H51 B;  1VGY A;  1XR7 A;  3B78 A;  4ZLN A;  5AXN A;  4QU7 A;  3KK3 B;  3NCP A;  3GJR B;  1RT3 B;  1U1P A;  5AXM A;  2R4F A;  4JV1 A;  1VQM S;  4DQP A;  4N7T A;  2YY3 A;  1Q78 A;  2JX2 A;  1VQP S;  5CHC B;  4I6A A;  4RU9 A;  3EMT A;  2ROP A;  2CZ9 A;  1NZ8 A;  4JI0 J;  3G96 A;  3DRS B;  2AT1 B;  4CDI A;  2V4J B;  1IBK F;  4ZPA A;  4MIW A;  5F0W A;  1V6H A;  4GKK F;  1UWB B;  3NCR A;  4JBC A;  4XK8 C;  1TU0 B;  1YQH A;  5F3Z A;  2RS8 A;  3T9Z A;  2OO4 A;  3IBF B;  1S12 A;  5K8N A;  1RYS A;  4TKT A;  3MM7 A;  5T7L A;  2B51 A;  3AJ2 A;  4A8X A;  4WU2 A;  3IXQ A;  1BQN B;  5ETK A;  3M4X A;  5ETO A;  3AFG A;  3UVJ B;  4FYD A;  3HUL A;  1JJ4 A;  4FXD A;  2D9O A;  3OVS A;  3IMQ J;  3PTW A;  3ILJ A;  1BWV A;  2ABY A;  3D4J A;  4UY8 T;  3WC0 A;  2G0C A;  4LRF A;  4E0D A;  2WCX A;  2I8E A;  1BY9 A;  2LQ9 A;  2HK3 A;  4NI2 A;  3UN2 A;  2M88 A;  3HFK A;  1U26 A;  1WG4 A;  1LW0 A;  3SQG A;  3MCM A;  1CJU A;  1DFD A;  4Y2A A;  1H6K X;  3IP0 A;  4LF8 J;  3M8P B;  2YKN A;  3MAH A;  2CNL B;  3HD1 A;  2ZZM A;  2V2Z A;  3IWL A;  4WBF A;  2F4F A;  5F8G A;  3NP5 A;  5HN0 A;  3R97 A;  1T9X A;  1RHR B;  2NS1 B;  2VA2 A;  4PXD A;  1NUE A;  3AT1 B;  1M5K C;  3BGR A;  1M5S A;  2WVE A;  3MOZ A;  2R7W A;  2BEF A;  3BR8 A;  2X1G A;  5M2P A;  1FNM A;  4FF1 A;  2V68 A;  2FHJ A;  2CPI A;  1FE4 A;  1RU1 A;  3G6Y A;  5A0Y A;  4Q43 A;  3QJL A;  3N6M A;  3NCQ A;  3Q22 A;  2XI2 A;  3M1V A;  5HMY A;  4FPI A;  3OTO J;  2CG4 A;  4R5P A;  2V2V A;  4QWB A;  3GON A;  2FJW A;  5L46 A;  4Y6I A;  1K0T A;  4WFN Q;  1ICE B;  2HQ3 A;  2EBE A;  3T19 A;  3D0G E;  2P8I A;  1WOP A;  4RUH A;  5LXY A;  4ECV A;  2M8H A;  1RT5 B;  3CJQ A;  2GHP A;  1RZM A;  3NGU A;  2B3T B;  2IBK A;  3VWS A;  3NS6 A;  3CVK A;  1U1N A;  3MHY A;  2QA1 A;  3ZNJ 1;  3A8J A;  3OR2 A;  2HZV A;  3K5O A;  3M7V A;  3BDE A;  3MDF A;  3C6T B;  3BKT A;  2VD3 A;  2JEF A;  2XY7 A;  3CC4 S;  4FF4 A;  2K7J A;  2RQK A;  4NLU A;  2MY7 A;  2PEH A;  4DUY J;  5ITH A;  3AQP A;  3LP1 A;  4WZQ A;  1JXL A;  3ZZO A;  1VC6 A;  2ZH4 A;  1AT1 B;  2HZC A;  3BR9 A;  3QLH B;  2YKM A;  3W2W A;  1FD2 A;  1AB8 A;  3KMS A;  1N52 B;  5I3Q A;  4GC6 A;  5CAA A;  3B82 A;  1XC9 A;  4F04 B;  2Z2L A;  4NLO A;  3PYG A;  3W9H A;  3AD7 C;  2BRL A;  3PJ9 A;  4OYI A;  3CJR A;  4LSN B;  3VGS A;  4P71 A;  4LQ3 A;  1RAJ A;  4RO0 A;  2DY9 A;  3OL8 A;  1U6Z A;  1Y0H A;  1XMO J;  2WON B;  1CJK A;  2BKN A;  3EPI A;  2MZJ A;  1JXE A;  2Z2M A;  3FC9 A;  5BR8 J;  3SV3 A;  2JEI A;  3DYA B;  2MQP A;  2GJI A;  3VAF A;  2ZFH A;  2OD4 A;  1FDN A;  3QSY B;  1LK7 A;  4A8O A;  2FLL A;  3J7Z T;  4DWI A;  2DGO A;  4EBC A;  5I4M A;  1T7P A;  3ZTS A;  2KDO A;  1SJR A;  1H7W A;  1RWP B;  4C0H A;  2CPH A;  2L9D A;  4JV5 J;  2FJX A;  3MFI A;  2DRA A;  2DR6 A;  4BC7 A;  5L38 A;  5GME A;  2FZK B;  4QQB A;  4RW9 B;  1WEY A;  2WSF C;  2KM8 C;  2H4Y B;  2IYG A;  2DNO A;  3OR1 B;  3D5M A;  2OEL A;  5GAE U;  4PR6 A;  3FBB A;  3MR2 A;  1NJX A;  3CCZ A;  2EFN A;  1NH8 A;  4DUZ F;  2CQH A;  2VKZ G;  4FXV A;  3UW1 A;  2OPP A;  5LXR A;  3MM9 A;  2CPD A;  1SB6 A;  4F2R A;  3DN9 A;  1XIQ A;  2Q6C A;  1WHV A;  3C15 A;  4O44 A;  3TAM A;  1RWK B;  1SUQ B;  4RR5 A;  5E3R A;  1W2B R;  4OX9 J;  2CPJ A;  3QAE A;  1LWX A;  4WXO A;  1GT8 A;  4JI5 J;  4NCA A;  5HAT A;  2YNF A;  1PG5 B;  3VF0 B;  1TZ0 A;  1S1W A;  1VBY A;  1T9W A;  1ZZF A;  5J1P A;  4DL4 A;  3B54 A;  5E41 A;  2C3M A;  1RTZ A;  4USM A;  3HZE A;  4GRS A;  4CM0 A;  2OFH X;  4D3G A;  3LPE A;  4WP8 A;  1N36 J;  1QTM A;  1HBU A;  5L9N A;  1S6U A;  2MJN A;  3GV8 B;  4WJB A;  2PII A;  1HA1 A;  1OY9 A;  4I2Q B;  5SZT A;  4IO9 Q;  3QRQ A;  2XQC A;  1KVI A;  2W24 A;  2IIH A;  3P4U B;  2BJ1 A;  2F65 A;  5BYR A;  1FTR A;  3HJV A;  3QGG A;  3DM2 A;  3FK4 A;  3S7R A;  1KS2 A;  2NPI A;  2W7A A;  3TP2 A;  4KTQ A;  1VIS A;  2SXL A;  4C7Q A;  1JLE B;  5KFM A;  4DV3 J;  5E3C A;  4ZP9 A;  2YQ0 A;  3EGN A;  4PPD A;  3MM8 A;  3R6L B;  2XC9 A;  2FZG B;  5FD1 A;  3GU0 A;  2EWH A;  2E1A A;  1HHQ A;  2XWY A;  4CLF A;  4M5K A;  2OPQ A;  5DDP C;  2VC0 A;  2RUS A;  4TLR A;  3CW2 C;  3LP0 B;  2QE5 A;  2XMK A;  3FRY A;  3FFI A;  3NXZ A;  2ZBQ A;  2YX4 A;  2IVF B;  1TP7 A;  3OUY A;  5AT1 B;  5C25 B;  1ZPW X;  2BKP A;  3JSM A;  4O4R A;  2W7O A;  5KFK A;  2PFD A;  3OTE A;  3M8Q B;  4UF4 A;  1T9T A;  4C8M A;  1SCJ B;  2OPS A;  3QYY A;  1YG0 A;  3CCV S;  1H38 A;  5JJB A;  3NKY A;  4OJ3 A;  1EKR A;  5HMZ A;  4ZIT A;  3BPS P;  2ZE2 A;  1LXJ A;  4F4K A;  1WC6 A;  2GO9 A;  3J80 Y;  1CPZ A;  3OXL A;  3FSI A;  4M5L A;  4U9R A;  1V3R A;  4LF9 F;  2YTC A;  1WEL A;  2O1P A;  3HHL C;  5DDQ C;  2FHO B;  1CUL B;  1VRT A;  2IMO A;  4O3R A;  3J80 U;  4LFB J;  2LMI A;  3QRR A;  4ID8 A;  1VK8 A;  1HQE A;  1DLO A;  2A6O A;  3BN7 A;  4P72 A;  4K0K F;  2DD8 S;  1R7I A;  4H4M B;  1RHU B;  5LSO A;  2D1C A;  2R2T A;  1SKR A;  4X4S A;  4H4K C;  1TK0 A;  3FBF A;  1NK8 A;  2ZZT A;  4A8W A;  4YQW A;  2BMB A;  4UQT A;  3OSP A;  4KSE B;  5G0R A;  1WI8 A;  2A6M A;  4DSJ A;  1U2F A;  1N5Q A;  4TY8 A;  1RSC A;  1VJQ A;  2MHN A;  1SJ1 A;  4CYU B;  2GFF A;  3F73 A;  1NHV A;  3BQ2 A;  3FZB A;  2CQG A;  3H0P A;  1OYD A;  2OPR A;  4RZR A;  4TNO A;  2DT9 A;  3PV8 A;  4JYA F;  1XNQ F;  2ATL A;  4L75 A;  3SCL E;  4CO1 A;  1KRP A;  1S9E B;  1RT4 B;  1BE4 A;  1B0V A;  2GHV C;  3O6Q A;  4L76 A;  2PC6 A;  2IVM A;  2MDA A;  2OEK A;  3KLF B;  4DPY A;  3ZZ0 A;  1TL3 A;  4J9N A;  3H5S A;  3J7Y U;  4EMD A;  2RRB A;  1DJ0 A;  2V67 A;  1SKS A;  1Q95 G;  1RDR A;  2GC8 A;  2F9D A;  5L1K A;  1N48 A;  2CG8 A;  3GE9 A;  1VDH A;  1SL2 A;  1EP4 B;  4WK1 A;  4J7C A;  2YPY A;  3HD2 A;  3KLG A;  3V6K A;  2L3M A;  4RNM A;  2VFR A;  3HJF A;  2NXU A;  5I3U B;  2HGN A;  1N5Y A;  5H9F K;  4WXW A;  3GCW P;  2Y0S D;  1NSQ A;  3Q2T C;  4V19 J;  1N34 F;  2DGS A;  2QMX A;  2PFF B;  1MWY A;  4CQ1 A;  3PX6 A;  3KLV A;  3ET6 B;  4Z7C A;  2V34 A;  4IG3 A;  4FYY B;  2CVI A;  2VFU A;  5KAK A;  2CQ4 A;  3UO0 A;  2QA4 G;  2HMI B;  1YTY A;  2MGZ A;  3CSK A;  1JLF A;  2EPI A;  3MEG B;  2ZHB A;  4NOH A;  4HT5 A;  3FEZ A;  2EKN A;  1Y5I B;  2Z4P A;  4NLP A;  2HFV A;  2GMH A;  2BM0 A;  3UE2 A;  2AF6 A;  4IRK A;  4P7T A;  4JI3 J;  2D69 A;  1HBO B;  4WKY A;  4ZJL A;  1HW9 A;  2PMW A;  3W2V B;  3VHQ A;  1RQ0 A;  1IBL F;  1NU4 A;  4F4Y A;  3EVW A;  2YNG A;  2ILZ A;  3MD1 A;  3TJ8 A;  3BPD A;  3BKF A;  4ANE A;  4X64 F;  2DHX A;  3MPY A;  4GVB B;  3K5M A;  1NK6 A;  2EEY A;  4DPT A;  5F9N A;  5FLX Y;  4DS5 A;  4O3Q A;  1UPM B;  2D9P A;  4YY3 F;  2E5L F;  2VJV A;  3NOC A;  4ZJO A;  4G1Q A;  1UP1 A;  1HAR A;  2LFV A;  1R8C A;  1W26 A;  3A3N B;  1U1Q A;  2W2N P;  1JLC B;  5FLX U;  3KDN A;  2XMJ A;  3I0R A;  1LWC A;  5DRK A;  3NBP B;  3TI0 A;  4ZPW R;  2DXE A;  2G0J A;  4EYH B;  3Q8S B;  3MUM P;  1P1L A;  3EVO A;  4OL8 A;  1QSY A;  4LFC J;  1LFP A;  4ES1 A;  4P6Q A;  4LMZ A;  3DGP A;  3WX4 A;  4LBI A;  5DG9 A;  2Y0B B;  2OP5 A;  3VAM A;  3N01 A;  1VI7 A;  1FNX H; 
#chains in the Genus database with same CATH homology
 1B4S A;  2HUR A;  2AZ1 A;  3ELH A;  4CP5 A;  3ZTR A;  1WKK A;  3B6B A;  4AND A;  4DUT A;  1HIY A;  1MN7 A;  5IOL A;  2B8P A;  1NDP A;  3EVW A;  3ZTS A;  1MN9 A;  2ZUA A;  3MPD A;  1LWX A;  1NUE A;  3EVM A;  3FBE A;  1ZS6 A;  5BXI A;  4ANE A;  3NGT A;  4O0N A;  3Q8V A;  1S57 A;  3WX8 A;  2DXF A;  4UOG A;  4F4A A;  3EJM A;  5C7P A;  1NCL A;  1PAE X;  1UCN A;  4ANC A;  3GPA A;  2BEF A;  4UOH A;  3FCV A;  3ZTP A;  3ETM A;  1LEO A;  5CAB A;  4KPC A;  1HHQ A;  1NDK A;  2DYA A;  2NCK L;  1XQI A;  1F6T A;  3BH6 B;  3FKB A;  3PRV A;  4UOF A;  3ZTQ A;  3Q8U A;  1NLK L;  2HVD A;  1NSP A;  1NSQ A;  2CWK A;  1NHK L;  4DZ6 A;  3FBF A;  3B54 A;  3R9L A;  3BBF A;  3BBB A;  4HR2 A;  3DKD A;  2BX6 A;  3VGV A;  3DDI A;  1NDC A;  1U8W A;  1S59 A;  4EK2 A;  5CAA A;  3Q8Y A;  3JS9 A;  3ZTO A;  4C6A A;  3GP9 A;  4S0M A;  3VVU A;  3FBC A;  3FBB A;  3PJ9 A;  4FKX A;  4W98 A;  1WKL A;  1B99 A;  1NPK A;  3FCW A;  2DXE A;  4FKY A;  3VGS A;  3EE3 A;  1NDL A;  2DY9 A;  1NSK L;  3Q89 A;  1EHW A;  3VGT A;  1JXV A;  2B8Q A;  3G2X A;  1HLW A;  3EVO A;  3NGR A;  2AZ3 A;  3L7U A;  1BHN A;  1W7W A;  1F3F A;  1NB2 A;  1BUX A;  1PKU A;  3EIC A;  3VGU A;  1K44 A;  1BE4 A;  1XIQ A;  3BH7 B;  3EM1 A;  3Q83 A;  1WKJ A;  4F36 A;  3FC9 A;  3Q86 A;  1S5Z A;  2HVE A;  1KDN A;  4WBF A;  3VVT A;  4DI6 A;  3EMT A;  2DXD A;  4ENO A;  3NGU A;  2VU5 A;  3NGS A;  3BBC A;  3ENA A;  1VYA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...