2IYIA

Structure of a light-induced intermediate of the bluf domain of the rhodobacterial protein appa
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
108
structure length
108
Chain Sequence
SDLVSCSYRSLAAPDLTLRDLLDIVETSQAHNARAQLTGALFYSQGVFFQWLEGRPAAVAEVMTHIQRDRRHSNVEILAEEPIAKRRFAGWHMQLSCSEADMRSLGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signal transduction
molecule keywords APPA, ANTIREPRESSOR OF PPSR, SENSOR OF BLUE LIGHT
publication title Crystal structures of the AppA BLUF domain photoreceptor provide insights into blue light-mediated signal transduction.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 31
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04940 BLUF Sensors of blue-light using FAD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2iyiA00
1IUJA 3K7RA 4NL5A 2W4CA 2VH7A 1XBWA 3IWXA 2N7YA 3DCAA 1N5SA 4YDXA 1TUVA 2ZDOA 1FEEA 2XMJA 4HI2A 2K7JA 4QOTA 1OQ6A 2HIQA 3HHLD 3IWLA 2OKQA 1KVJA 2OD6A 3T9NA 2GFFA 1S6UA 2BUNA 2K1RB 1N5QA 1VQSA 5B0FA 2PGCA 2W4DA 5B0EA 3KG0A 1TR0A 1Q4RA 2OP5A 3BB5A 1YJTA 2ASYA 3HHLA 3LGNA 4OIXA 4YEAA 5B0BA 1OQ3A 1YJUA 1Y3KA 5KAKA 5B08A 1SB6A 2FB0A 1S6OA 2LDIA 1OPZA 1Q53A 3BM7A 3E8OA 1CC7A 2XMUA 3QGPA 2GA7A 5T7LB 3TRGA 5K9FA 3CJKB 2GO8A 3BF4A 2BJEA 5A6WA 2RSQA 2AP6A 1FVQA 2OAUA 2Q3PA 4ZA1A 3LGMA 2HLTA 2XMVA 1AFIA 4FNIA 2KT3A 2ROEA 3I9ZA 4HL9A 1SQEA 1ULRA 4NPOA 5F0UA 1TL4A 4Y2IA 1LQ9A 2IYGA 4F67A 2HFOA 1CC8A 2XMWA 2BJDA 3UDCA 1APSA 1X7VA 4U9RA 2XMKA 2GGPA 4DN9A 1GXUA 3HDSA 1P8GA 1KQKA 1GXTA 1MWYA 1OSDA 1Y9OA 2LQBA 2QYCA 1WD6A 2QLWA 2GV1A 3FGVA 2FIUA 1K0VA 4OJGA 2ROGA 1VQYA 1Q8LA 2BBEA 4ZOSA 2PD1A 2XMMA 4Q2LA 1CPZA 3FRYA 1AFJA 2CRLA 2AW0A 1FE0A 4FNHA 2OFHX 2OD4A 1SI9A 2FTRA 5B09A 2FHMA 1FE4A 2BYCA 1X0PA 3BDEA 3KG1A 4OJ3A 3KNGA 5A6PA 2VV5A 1QUPA 1TZ0A 2XMTA 3KKFA 5B0CA 2QIFA 1FVSA 1MWZA 2OFGX 4DPOA 2GGPB 2GCFA 2N4DA 2RMLA 1JK9B 2RU9A 3MZIA 1Q8BA 4HH1A 1N5TA 1Y3JA 2HLUA 2LQ9A 3HHLB 4Y2KA 4EFAC 4HI1A 1YJVA 1URRA 2HQIA 5B0DA 3HX9A 1N5VA 3TOQA 2ZDPA 3GZ7A 1YG0A 3MCSA 5T7LA 2K7KA 2RILA 1YJRA 2IYIA 5F0WA 4A4JA 3CJKA 1KVIA 2ACYA 4HH0A 2KKHA 1YRXA 2OMOA 2JDJA 2ROPA 4OJHA 5B0GA 3WDOA 2K2PA 1AW0A 2KT2A 3QMQA 3HHLC 1W2IA 2LXFA 2AJ0A 2G9OA 3DXSX 4A48A 2N4CA 3HF5A 2AJ1A 1FD8A 5B0AA 1TL5A 2QLXA 1U7LA 1JWWA 4Q2MA 2K1RA 3HFKA 3F44A 2EW9A 4DL0C 1RJJA 3BR8A 3BGUA 3VTIA 2HFNA 1FESA 2L3MA 2KYZA 3LO3A 1R6YA 4OJ1A 4Y2MA 3TNVA 3BN7A 2IFXA 3FMBA 1V3ZA 1Y0HA 1P6TA 2W4PA 4A46A 5IXUA 1X8DA 4A47A
chains in the Genus database with same CATH superfamily
4JP8A 2JVRA 3IWLA 2FJAB 4A8KA 2ZM6F 1U1OA 4N77A 4I6YA 4PWWA 2VG7B 4AUKA 5GAEI 2OPSA 3MUVP 1RWUA 1F2HA 3FNNA 2R7XA 1KS2A 2MHNA 4N8OA 3T1YJ 2G4BA 1IBKJ 4MK9A 2Y3YA 2VD3A 4TLRA 4M5NA 4NLOA 1J2VA 5KFYA 1UVLA 3HX9A 4M63A 4KO0A 2JWNA 2G1DA 4FPIA 1HD0A 1VRUB 3T6JA 3KK1B 2O67A 1ELOA 4X66J 4DSEA 2KN4A 2MJUA 3BPDA 3PYEA 3TANA 1ZOTA 2KYZA 1T02A 2ZZTA 4O0IA 4IQXA 1S97A 3T5KA 3U1LA 4ECZA 1Q78A 4WWSA 3THTA 3BKTA 4EEYA 3VVTA 3S8SA 3M8YA 3D1QA 3HHKA 2KH9A 3JSMB 2XCAA 2MJNA 1PSDA 2CQ4A 4B9MA 2LYVA 3N5FA 3BH6B 4WIQA 4CO4A 1YJWS 3UO0A 2Z2LA 1KVKA 4F25A 1Q5YA 3M05A 4CLLA 4J5OA 1H0HB 4P7VA 2E1CA 3D1HA 3A8KA 3R27A 3J7ZT 2YQ1A 1Q81T 3KLVA 4WFZA 2FDNA 3G6ES 4EYHB 2YNGA 3TEGA 3J7AN 3BH7B 2CQBA 1SQFA 5ETLA 1CJTA 2IMWP 3X3UA 2JEFA 2A1BA 1WC6A 2IRXA 5F8NA 2OELA 5BYQA 2MY7A 1M1KT 3KMSA 3L4BC 2V8PA 3GONA 1Q1KA 2LA4A 3J7A1 2YWKA 3CTRA 5LJ3Y 4C11A 1X0FA 5KFCA 1S1XB 1VI7A 2W24A 1JIHA 2VQEJ 1JLFA 2DVIA 3POTB 3BM7A 4OYAA 5HMXA 4DL3A 3DDIA 2F9JA 1S1TA 1PJ6A 1RHJB 2IYGA 4RNOA 1FK9A 2DHGA 2G0JA 1H2UX 4AQYF 1EETA 3OJSA 1IR1A 2RT3A 4W4MA 2ZBCA 1KEKA 4FNHA 2R42A 1FE4A 3V6KA 4JI7F 4IRCA 3QIPA 4MT1A 2IHR1 1JLCB 1H6KX 1RDRA 2BJ8A 1UL3A 4DR1F 3PJWA 3CF5Q 2APOA 1SKSA 3A8EA 3HSZA 1OWXA 2GS8A 4IG3B 3UI3A 3EE3A 4DX8H 4J9PA 3KLHB 4EK2A 2ZH1A 1WKJA 3SQGA 2R2TA 4LFAJ 3MEEB 4B9VA 2XMJA 4HI2A 2BRLA 2OEMA 3KOAA 4JI8J 2ACMA 2FLNA 1XR7A 1N56A 4FF4A 4O3SA 3BF4A 2HFZA 1F6TA 2GQQA 1R8HA 2HVIA 4DUYF 2F4VJ 2DJWA 3MMBA 4EBDA 2W8KA 3MMJA 2FIUA 4KPCA 2V2ZA 2JFKA 1CPZA 1BGXT 4J9OA 2MXYA 3HPOA 4AFFA 4NLXA 4P6QA 2QA1A 3R7NB 3R9LA 1DHMA 3JSMA 2UXDF 1TP7A 2G1HA 5ETRA 1SUQB 3NGKA 5ETMA 2C2DA 1VR6A 1X4HA 2IM3A 1S57A 2DR7A 4DU8A 3BO2A 3CCMS 1WHVA 2FZKB 1XR6A 3OTOF 2ADCA 2BW2A 5DDQC 2ALZA 2OH2A 5J2PB 1U0HB 2KB2A 2WRMA 3KLFA 4ZIWA 2AD9A 1ROFA 2QT7A 4UQGA 1FF2A 1FX2A 1XJWB 2VG5B 3AXKA 4C0OC 3M6XA 4F04B 1UP1A 2MQPA 5F3ZA 3GLJA 1RU2A 2Y8YA 4TQRA 3DLGA 1VLOA 2VHGA 2KVIA 3KMQA 2HHTA 2OIHA 5KT4A 3SDEB 1P8GA 3L95X 5BR8F 3R5DA 4LF9J 4XO0A 4Y2AA 3KXDA 2ZBRA 4F2SA 4QYZJ 2J9CA 3LAMA 2XGQA 4B3TF 1ZM2A 3GCXP 5HVHA 1B0VA 2F7VA 4ECQA 1Q8BA 2KM8C 3ENAA 3HSGA 2LP4A 2UVUA 1VLYA 2Z4PA 3CPWR 1PGZA 2UUAF 3MR6A 3LUYA 3NCRA 4DV4J 1R0AB 2X1BA 3CMQA 3D66A 4L76A 3IBWA 3KWMA 1FKPA 3ADAC 1GAOA 3DGPA 1GK8A 2Y1JA 3FUYA 4CH7A 4LF8F 4ANDA 3KFWX 1KVJA 3H2UB 5B0FA 2YWWA 1M5SA 1JLCA 4ILRA 5CCLA 4FF1A 1GMVA 5B08A 3QGPA 2V0NA 4LBIA 2BQRA 1UPPA 2XO6A 4WF9Q 1RA7A 3D3BJ 4IG3A 1WOOA 3ULHA 1S0MA 4F26A 3LALA 3MMCB 1B0TA 2X1GA 3MGJA 3CCJS 3HD2A 4B9UA 1K0TA 3I82A 4A8WA 1U0SA 4LIRA 1XQIA 4JI0F 5CHCB 2IVYA 1YSJA 2GC8A 1HI8A 3GV7B 4FXWA 1C0TA 4X2BA 3S1TA 1H73A 3BKFA 3D68A 3Q8SB 3T1HJ 1UA0A 3SSQA 3RRHA 3LO3A 2ZHAA 2HKEA 3K89A 5LMUF 2WVCA 3CJ0A 1XNRF 1JMTA 5T14A 2E5LJ 5GMEA 2DGOA 1SJ4P 4IG0B 1SUQA 2CQ3A 2Q66A 4B3MJ 1Z4UA 2NLWA 1DRZA 5AXNA 2C2EA 4U8YA 5CYQA 1XK8A 1APSA 1WELA 1FT8A 2A18A 1IQZA 1S1VA 4G6VB 2JLFA 2LQBA 2V2KA 1VFJA 4FF2A 2MZTA 1U0HA 3A3OB 4ES3A 3DRSB 2K3KA 4KYZA 4FYYB 2CQ0A 2V2QA 2VJUA 3HHLB 1HYSA 2UZAA 5L9XA 1S0VA 1Y5LB 1JLAA 2RILA 3KUHA 3OQ2A 3CO9A 2JDJA 1EP4A 4OYPA 2L9NA 2CPHA 1IM6A 5DDRC 2KXNB 1OO0B 1JWWA 2DY1A 4OJ1A 1TKXA 3W2WA 1FERA 1CLFA 4YY3J 4NLRA 4RUBA 4MAKA 4C3LA 2LXIA 2HZCA 4RX6A 1NB2A 2IJFA 3MUTP 5D3GB 2XY5A 4GO5X 1K8AT 2XWYA 5KFSA 4U7CA 3R5JB 2QG9B 2AP6A 3N9UC 4NXNF 1TUGB 5LMNJ 4NRUA 3D0IE 5AXLA 5EWGA 3TWZA 4Q43A 3EYZA 1R0CB 4N76A 1WI6A 4CTAB 3K5LA 5K20B 1F60B 2PD1A 2HG4A 3PNIA 3M8ZA 2ZOGA 4LRFA 2JC0A 4RW4A 2ALYB 2DNQA 1R8PA 2U1AA 4RPFA 3M2RB 4Y0FA 3QSIA 1R6VA 1KBRA 3FSYA 3D5MA 1BQMB 4NLVA 2MQNA 2GQCA 1VQ4S 3WIVA 2ZNZA 1ZPWX 1QAXA 4X65J 3KHGA 1X5TA 2BQUA 3BN4A 3NCPA 1HBNB 1T9YA 2HNYA 3AJDA 1WHXA 1AT1B 2YNFA 5MAOA 3VQTA 5GAGU 3U02A 4KRWA 3TA0A 1EIYB 3QIDA 2YH0A 2V94A 4WCEQ 4NLUA 2FLLA 4ZMMA 3TQEA 3B6BA 1FCAA 2VA3A 2H54B 1OYDA 2H4WB 5A2QY 4BWMA 4QWDA 1WJ9A 3EGNA 2XWXA 4E2FB 5IT9U 3AA8A 3HCXA 4LREA 2BABA 2VONA 4Z37A 3RR8A 4J9RA 3CDAA 1J5OB 1Q8KA 2L08A 2DHSA 2MTLA 2ADBA 2WB4A 3LPYA 4ZS6A 3T9ZA 2CVIA 4K4ZA 5HJYA 2PT0A 1N5VA 5H9EK 5K14A 3TR5A 5E2QA 2MQMA 1RT3B 3PX6A 1SJ1A 4K7QA 4CLPA 2R8IA 4IO9Q 4KBIA 3CO0P 2F8EX 1RWVB 3R2CJ 4NLSA 4AXIA 4LR9A 2EW9A 4J7CA 4KGKA 1UFLA 5KFDA 1ZBTA 2OTJS 3DRSA 3VAJA 2N7YA 4RW6B 4NXMF 3HHLD 3Q8PB 2OKQA 4B3RF 4ERDA 5G0RB 4DV2J 3BB5A 3HHLA 3GYXB 1W2BR 2K06A 2BKNA 2QMUB 2HS3A 3GV8B 3QFHA 3MR5A 3VGSA 1RWKB 2JJ4D 2HS0A 4ITSA 2BJDA 3VGUA 5H1SV 4IRDA 4OYWA 1OSDA 2WSEC 3VGTA 1F5AA 5M2RA 3H0PA 1H74A 4PABA 4ZJOA 3F73A 4FBUA 2ZH2A 2R7SA 3CMAS 5IOLA 2VV5A 1VC0A 1RGVA 2YKQA 5KG7A 2CVEA 2RS8A 2P5VA 3M8RA 3RBDA 2MKHA 4WPAA 1IN0A 5KFIA 5D3GA 1NO8A 5E7OB 2W9CA 2XZDB 3OUYB 1LW0B 3US5A 3Q8QB 2EFQA 2DNLA 4HT7A 2ZKTA 1GMUA 2MYFA 3R7SB 4Q0BB 3DLKB 2HQGA 1LWFB 3JYTB 4RNHA 2LMIA 3CSKA 2DNZA 4LFBF 4UF4A 2I8EA 1TFYA 1U6FA 1RT1B 4CLKA 1HI1A 3CUNA 4DL5A 1RJJA 3VAKA 2J6TA 1G2EA 2IFXA 4ZVPB 3M1VA 1X8DA 2AZ1A 5HQ8A 1BQXA 2DEIA 2CA9A 2QA2A 3HVAA 3Q2SC 3CJRA 2ASJA 4XDCA 1OQ3A 1BQMA 1YJNS 3D6FB 3GSIA 3TRGA 2HHPA 3BQ1A 3LGMA 4DCJB 4ZCIA 1IKVA 1AROP 2DR8A 2XI3A 1QSSA 1NHUA 5KFLA 2BJ9A 2C2OB 3VZIA 3AFGA 3BKUA 3IA0A 2VDIA 5DQIA 4DG1A 1RAFB 4I6WA 2JH3A 7AT1B 3Q86A 3MWBA 1CJUA 3CCVS 5F0WA 4QIGA 4MIAA 3HT3A 3ZZ0A 4OJHA 3KJFB 4DX7A 2RJZA 3NGSA 3EXCX 5GADU 3TZWA 1V3SA 1DTTB 5D4LA 3BV8A 1HHQA 5DETA 1RHUB 4GKJJ 2ZVIA 1IJFB 1ZAVA 4MK7A 4M5MA 1V3ZA 5IFMA 5KFFA 1GH8A 3D4JA 1RHKB 3OR2B 2A2DA 1X9SA 1MNEA 2K1RB 3OXLA 3ETOA 1T05A 3J80Y 3OR1A 2UXCJ 3E8OA 1RT3A 3HFVA 2ZH6A 2AGQA 3K0JA 3HJVA 3O8WA 2G13A 5HL7Q 2HVZA 1LWCA 1RTIB 3D6TB 4PXBA 4KC5A 2ZFHA 2CJKA 2XO7A 3W5XA 2A10A 3CE8A 2J0XA 2QO3A 3BDEA 4HR2A 4QR2A 3HVWA 1LK5A 4NZ7A 2FQQB 3W60A 1QSLA 2KO1A 4CCHA 3QLHB 4CLWA 2DHAA 4X4RA 1YRTA 1FRKA 5B7WA 4AT1B 4X4SA 4OX9F 2KT2A 2RQMA 2D7SA 3W3SA 3I87A 1VC6A 2OSRA 4YB1P 2IAJA 1P6TA 1CJKB 3QNWB 4UTGA 4UY85 2DXEA 4EWTA 2RRAA 3SEOA 3QGGA 4YDXA 2ZVSA 1TR0A 4ZN1A 1K0VA 3M32B 3LA0A 4QPTA 1N34J 2BA9A 3OUYA 4QU7A 3C8YA 2WOMB 4LF2A 4ZJQA 3I0RA 3DM2A 1SV5A 3DLKA 3NBPA 1X60A 1S9FA 1QLNA 1BQNB 3IS9B 3HXMA 2ZOFA 3TAQA 1TVRB 3EUNA 3TUJC 4C8LA 1JLBA 3DLEB 2HAFA 1HLWA 2CADA 1Q8IA 1SI9A 5IWAJ 1OIAA 3MPDA 3C6UA 1QDUB 1FVSA 3NGDA 4IH7A 2V6AA 5DM7Q 1WSRA 3ILJA 1WG5A 2YPZA 1WF0A 1WC0A 4UUXA 1DTQA 2BOPA 2E66A 4ILMA 1J27A 1IKXA 5KFRA 3BYPA 3PRDA 2Z2YB 1HNVB 2E9RX 1MMNA 1UPMB 1GEHA 2DNGA 4P2MA 2Q43A 2AQ4A 2W4CA 1XBWA 3LGHA 1H2VZ 2CG8A 1FDNA 3OFGA 1NK6A 5B0EA 4F2RA 4RNMA 1K44A 3G8SA 2FY8A 2BM1A 3FCHA 3FK4A 4K5SA 1N33J 1NNDA 3MFHA 4OHYA 5T41A 2BKPA 1T03A 1DLOA 2LQJA 3J81j 3FGVA 4C48A 4YN3B 2C2MB 2HWHA 2AW0A 5EDWA 2VC0A 2FTRA 4LSNA 4I2QA 4DR6J 4C3MA 4R5PA 3DRRA 4MIBA 5KFHA 2HLUA 4HACA 4WP9A 4DSIA 3L7UA 4USWA 1OSCA 4KV8B 3CCLS 3FCVA 2DYAA 2G9OA 3P5TL 2UUCF 3BGOP 4YR3A 2EFVA 1CS4A 2X51A 4DJBA 2DB1A 1UFWA 4Y2MA 3FMBA 1ZH5A 5A8KA 5D6GA 4L75A 4DUZJ 2CJXB 4C4WA 1WC4A 2V4QA 4V19X 3G6YA 5JUMA 5DDPC 3O1LA 1NSAA 4IQMA 4P2FA 4HDHA 3IWNC 2GO8A 4DV7F 4EZ6A 5G4DA 4WZMA 3DOLA 2VPZB 5LSOA 4TY8B 2XM3A 1LW2A 1U49A 4P2XA 4OI0A 1WSVA 1N48A 3MECA 2OPPB 2XSFA 2IY5B 1HPZA 5F41A 1H98A 5HMZA 3S6EA 2F3JA 2E29A 5C7PA 4OI3A 1OY9A 3LTOA 3UD5A 4ECWA 5ETQA 3ZFVA 4HI1A 2HYIB 3M32A 1DZ5A 1FFWB 2K7KA 2IYIA 1U6ZA 2EG1A 1N36F 3NWRA 4ZP9A 3CC4S 1LKZA 2R7OA 2ZM6J 1SPBP 2J9EA 4ZPTR 3Q22A 1BC6A 3M9NB 4MKBA 4NEZA 4KQZA 1RT2B 4M5KA 1BQNA 1MSWD 4ZVHA 3CVKA 4C6AA 3N6NA 3MR7A 2FJEB 4F0MA 4OHWA 4CM0A 2YWHA 3RZAA 3AA9A 4HKQA 1Q5VA 5DDOC 1X4CA 2CPEA 3LP0B 1A6LA 1QJHA 3GMGA 4OIXA 3RBZA 4XDDA 3WIUA 2HBZB 3I9V9 1RWMB 3E51A 5I3UA 5I3QA 4R8UB 3RW6A 2BRKA 2ZJPQ 5LJ5Y 5EWFA 3FBFA 2HZVA 4Q2LA 1SC3B 5HK4A 1ZZNA 1JKHA 1RK8A 4QQBA 5DM6Q 1S79A 1QUVA 3KNGA 3B78A 1TKZB 4YB5A 1WG4A 3GYNA 3RB3A 2ZJRQ 3BGFA 4IYQA 1TL7A 5CD4A 4YR2A 1D9FA 2GNKA 5KFAA 2H5IB 3BSAA 4JI5F 4L3KA 2RHSB 3FEYB 2EK6A 1FKOA 4KH1B 4DV5F 1WC1A 4NCGA 2YTCA 4OYBA 3UNGC 2YKMA 5HVFA 2V9WA 5I42B 3ZTOA 2CQ1A 2AEFA 3A3NB 2AT1B 2M88A 3OFFA 1REVA 3DLLQ 3JSRA 1D1UA 3MAQA 2FGOA 2HBQB 1N6QB 2W2MP 2D3ZA 3LGNA 4GC7A 1VOMA 2EXUA 2QEXS 5IV3A 1MMDA 1WKKA 3H5UA 2XHWA 4JUZA 1U25A 1N54B 1IWAA 3A12A 4ECVA 3SXLA 4BHQA 5KFTA 4RR5A 1MWYA 2ZH3A 2GV1A 4MKYA 3MR3A 3WC2A 2ZJQQ 1I94F 5KFGA 1BLUA 2VBZA 1U1LA 3KUEA 2D41A 1FJGF 4B3SF 2MKIA 2QFJA 5JVGQ 1NUEA 4NZ6A 3V5RA 3X1LB 1KQSR 1NH7A 1GFWB 2KKHA 2ZNYA 4TY8A 2NR0A 3TVZA 2LQ5A 3A8IA 4Y6IA 1TL5A 4V19J 1MU2B 2BE9B 4AQYJ 2FHOB 3GFHA 1AZSB 4FYWB 2OPPA 4JBCA 4WFXA 4DX6A 3F56A 2V67A 2XMAA 4P9SA 5AT1B 2DRBA 4USJC 4MKAA 2Y9HA 1VQ8S 4JI7J 2W7AA 4AL7A 3CC7S 2CPYA 5DJBA 4LJMA 2RQ4A 4ZLLA 3I0SB 4NYOA 4DR1J 3C6TB 1FEHA 4ED1A 2GGPA 3BBCA 3OD2A 1VC5A 5SZTA 5A8WB 1I6JA 2JLGA 3PEJA 5E33A 2PI5A 2UVVA 1U1PA 1SC4B 5DG7A 4C0BA 3KNAA 3OSPA 1E6YA 4OJ3A 4WZQA 3C16B 2FZCB 1FWPA 1F5BA 2E5IA 2VC1A 2YBVA 4S0MA 2OEJA 1VQKS 3I6PA 2RUSA 1Y5IB 4LRAA 3B4DA 1FRLA 4NA1A 3MCMA 3EZ5A 1C0UA 3AXMA 3OT9A 3HHLC 3PYGA 2DRAA 4IOCQ 3BGRB 4DUYJ 2O01C 3PHEA 2RB7A 4UUWA 3NNHA 4CLYA 1QAJA 3M8PA 3C15B 1RE1B 3ZZPA 4UY8T 3DMJB 3R3TA 4LF4F 1WDDA 1LFWA 3IP0A 3HKZD 2ZE2A 1IBCB 4OYIA 2L48A 1PYTA 1UFKA 2UXDJ 2AEMA 4G1QA 4ZLJA 4ZA1A 1C1BA 3SV4A 3QJPA 2ZC4A 1ULRA 1KLNA 2FUG9 1U6BA 4F4XA 3WX8A 2MZRA 2VIHA 1Q8LA 2BJ7A 2F1FA 4LF6F 1FXDA 3C19A 1RTDB 3OTOJ 2R7TA 3MM8B 6FD1A 1KFSA 3UVJB 2B3TB 4A8OA 2PMWA 1U2FA 3BSNA 2DIVA 2Y1IA 4ALZA 1KTVA 1CVJA 4QR1A 4WTYA 1OJ4A 4O44B 4WFBQ 4Y00A 4DSKA 5BR8J 4H4OB 1PC5A 5GMKa 3BDPA 1NAQA 1RBLA 3K7RA 3ZXWA 3K8VA 1EJ7L 4KY3A 4B3TJ 3CJ3A 4FDFA 3CT9A 1TAUA 2RKIB 1KQFB 3GE9A 1S6OA 2XSJB 4C2MA 2BJ3A 1HBMB 2XMVA 2G2YA 2HPUA 5GAEU 1SIWB 1FJEB 3I9ZA 1CJVA 3M2UB 2B5JB 1KP6A 1KN6A 1YDLA 2DGXA 1AZSA 4IKAA 3FRYA 3VAHA 2OD4A 2HFSA 3BQ0A 3HMJG 4LF8J 3PW7A 4OMFG 4I56A 1N5TA 3JQKA 1NDLA 2GJIA 5ETKA 1VCTA 5KFKA 3GP9A 2C3UA 1YIJS 4RW8B 1KONA 1NZ8A 1VIOA 4AL5A 1FA0A 3BO3A 4HTIA 4FS2A 1LOUA 5EX0A 2AJ0A 1C1CB 1XEZA 3T6BA 3G8QA 4F8RA 1VDHA 1TMJA 4WYWA 5ETTA 4C8ZA 2CJQA 2PEHA 5A8WA 1X4DA 1E6VA 2B4UA 5KFZA 4A46A 1UVKA 3G82A 1X5OA 4A8QA 3IWXA 2Y0BB 2J0QD 3C16A 4NLGA 3RAQA 1M1GA 3DOKB 3H20A 2KM8B 2NSCA 4JI0J 3B82A 3TX8A 4JV2A 5A6WA 2LKZA 4ZPDA 4NWBA 4PR6A 2DH7A 1UVIA 3FFIA 3FQKA 4WE1A 1UJ5A 3C15A 5BXIA 4ZVSB 1IVZA 3FQLA 1NK8A 3W8GA 5LMUJ 5CCMA 2W9BA 4I68A 1S0OA 1XNRJ 3JTNA 2V50A 2KT5A 2O5DA 2CQCA 1NJWA 2WONB 2AEJA 2CAJA 1YJRA 3Q8UA 5I4MA 2V8DA 3FCWA 1OY8A 5EX3A 4LR8A 4QR0A 4DQQA 1R8CA 4WXWA 4ECRA 4KPYA 4RWXA 2YKNA 3LP2A 1FNXH 4TY9A 1NPRA 2IDEA 1TTHB 1JLGA 3H8YA 1NDCA 4KSEB 4NLPA 4I64A 3MM8A 2YKOA 4QOTA 4DDFA 3DXBA 1M90T 2XLJA 4N41A 2XYHB 4ATNA 3ILOA 5MLCV 1U8SA 3MPYA 4JI2F 4C8KA 2W2PP 4RU2A 1HNXF 1F9FA 3SCLE 3DFEA 4O44A 3GIIA 5IQQA 2MGZB 4ID8A 5KG5A 4U95A 2FLPA 4ZITA 2WVDA 5C2GA 2CQGA 3EVOA 2M8HA 1RBAA 4Y2CA 3BS9A 4ANCA 4OHVA 1PYOB 3MMAA 5DLGA 3EPGA 2FY1A 2KRBA 1Y3JA 1S6PB 4BS2A 3IBFB 5AJ3J 5CQGA 1TKTA 4X64F 1JLQB 2BX6A 2BACA 2CPFA 1JNZB 1HBMA 4P74A 4MYTA 1S9EA 4URQU 4RUCA 3DDNA 1X4BA 5B0AA 4NXNJ 2E5HA 2QL9B 3NS5A 3FBBA 2GO9A 2OHDA 3ZC4A 5DRKA 4A8MP 3PO4A 5HP1B 4M94A 2DH9A 2J9DA 3MM7A 1FEEA 5CAAA 3J7YI 1HWJA 3KLGA 2NUHA 4I6AA 1KNZA 1C4CA 3CJKB 4USUA 4RW8A 1XMOJ 3OSNA 4FPRA 2YNIB 1C1CA 4ZLNA 2HQCA 2DR5A 3NRBA 3ITHB 3Q8RB 3DGVA 1S12A 3NLCA 4TU9A 1VK3A 2RF2B 1FDDA 2HVHA 3W66A 3BQ2A 1YG0A 5F8MA 4K2JA 3KLIB 1IKWB 3AHPA 2AV5A 2MSSA 4WK1A 5J1EB 4RBVA 3IAS9 4LVNP 3NMRA 1M5PC 2LEBA 1H2TZ 3U7JA 4UT4A 1HQEA 4NLYA 4CLZA 4Z2XA 2GHWA 1P1TA 3CJQA 3SMZA 2QSWA 3CW2C 1RYRA 4I7FA 4M5LA 4EU0A 1PG5B 3T1YF 2M2BA 4CO3A 3DYAB 3OV7A 4LVOP 2WCXA 3AAWB 1WTBA 1P27B 4ID5A 4U9RA 1CQNA 3SIPB 3DOMB 2BOAA 3J81Y 3RJMB 3VQSA 3IRXA 2EKYA 3I96A 1B4SA 4R0EA 4OYOA 1HWUA 2XMTA 1TUWA 1HNIA 3CC2S 5DG9A 3MM9A 4QIVA 4KHMA 4NXMJ 2A0FB 4B3RJ 4WU3A 4LMZA 2C2KB 1KKHA 1FHTA 1YJ9S 3DKDA 2HFUA 1XMBA 2K2PA 3MM6B 3OLBA 5KTQA 4DSFA 3M6VA 1TK8A 2WK4A 5ETSA 2CJYB 1VISA 2J0SD 1BXNA 1F9HA 2C2ZB 3W1YC 5K8OA 3G96A 2F65A 2E5JA 5K5MA 4NL5A 2VPXB 3P6YC 4OI1A 1S1UB 2MKJA 2OPQA 1KLMB 5L1KA 4LSLB 4QZVB 4N47A 1B64A 5HQMA 4ZVFA 2A6OA 3QAEA 1AUSL 1SL2A 1HNWF 2PDAA 3QATA 1JLQA 4DPUA 2H48B 3ET6A 3KLEA 2WTFA 4A8YA 3PRBA 1JNRB 4LFBJ 4FKXA 4PPDA 4PQUA 2NPIA 2J7KA 1TFWA 4BWJA 3D2WA 5JVHQ 4KGVB 2BJ1A 1FKAF 3LAKA 4RL1A 5HP1A 4WU2A 4I69A 3CDUA 4UOGA 2IA0A 3PIPQ 3VF0B 2OPSB 2EKNA 3CJKA 3GR1A 1YBUA 2R4FA 3ZZTA 4AD6A 1S5ZA 2COLA 1LWEA 2YNIA 4USMA 5F8IA 4P72A 3I4PA 1Q82T 4Q8FA 4G1IA 2NS1B 3BSCA 2HGLA 4LF5F 3BREA 3BN7A 5H9FK 1SC6A 5IM0B 1JJCB 2C2NA 4ZVRB 3BYRA 2RF2A 1ZM4A 3VZHA 2HHQA 2GMHA 3R6LB 1NK5A 2VFRA 1JXVA 2KI2A 1NJYA 1IKWA 1IKYA 1FVQA 2HS4A 2YQ3A 2BXJA 4XTTA 2QZ8A 2FVQA 1U8WA 2VICA 1FRXA 4TU7A 4LR7A 1IQTA 3H40A 1G1XA 4C0HA 4ES1A 1WOSA 5EN1A 2NXJA 4A8XA 2AJ4A 4AL6A 3P45B 4LUBA 2ZH9A 1N0UA 2B51A 1YLXA 3KG4A 3CD7A 2RU9A 3VR1A 3GFXA 1KD1T 2X3DA 2MEWA 5F3TA 4M5JA 2HRTA 5KG2A 3TA2A 1QAIA 2F40A 5CH7B 4LFAF 2HQ3A 2DPIA 1XN9A 2YNGB 4BC9A 3N6MA 3QMQA 3DYAA 4ZPVR 3CXCR 3QJLA 3HKWA 1CJTB 2AIRB 2WSCC 4F4YA 3AJ1A 2CNKB 3O6QA 3OJUA 2DITA 3PHTA 4GRSA 2O3DA 1EKRA 4P2SA 4Q45A 3D1OA 4C11B 1Q86T 4B9TA 2IDLA 1SJRA 3DNCA 2V8GA 2D3O1 1JLFB 2CPIA 4OX9J 2W01A 5AXKA 4ZCKA 3UWTA 4RJVA 3JB9k 2HSEB 1S1TB 3V6DB 4DV6F 4ZN3A 3MI7X 2LDYA 1S1UA 1OPIA 1Q95G 4LSLA 3W8PA 3MAHA 3CCWA 2IC3A 1R27B 1RCOB 2EG2A 4NZ0A 5KFPA 1S72S 5LSRA 2UV8G 3QIPB 2R2SA 1U24A 2QLXA 1PAUB 5EUHA 3NKYA 2E7XA 2QL7B 3NGRA 5HO4A 2POKA 2MLZA 2AX1A 5E5NA 2OGUA 3OL6A 1Y5NB 1X5PA 3CJ4A 3TX0A 2OPRA 4LF9F 1BY9A 4WTOB 3PXGa 3Q23A 2HHHF 4KHPF 2ZWPA 1SB6A 2V8VA 3DRPA 4ED4A 2VFSA 3W9IA 5K9FA 3ENQA 3IXQA 4UQTA 4ILLA 3SQGB 4KGMA 2ZC3A 4X4UA 3IBCB 3ZNUA 4DFMA 1VQ5S 3DHWC 2QYCA 2CIMA 3M6UA 1DJ0A 2XS7A 1ZZFA 3G2XA 5IM0A 2GAHC 3MMBB 2HQDA 1Q7YT 3MD3A 4UZBA 2MQOA 1VJQA 4IO1A 2FHJD 2FHJA 1M5VC 5HJXA 3JAMU 1FI4A 4U8VA 4TVAB 4NA2A 2R8JA 1N4LA 4DSLA 3QT7A 1NCLA 4B17A 2YVSA 1K73T 5E3CA 5C42B 1N88A 2BR0A 4B3OA 3M2VA 2YWFA 2C1EB 2B43A 5IT0A 1NPPA 2F8HA 3UPFA 2RE1A 1T8EA 3AB2B 1V6HA 1B3TA 1SH3A 4JOUA 3FVYA 3KLFB 2IVMA 1X9MA 4USIA 2UUCJ 1B0PA 2ILYA 5ITHA 2DNOA 4HTJA 1B99A 3KK3A 2I38A 3RB0A 3DLGB 1X0PA 3UD3P 2YNHA 2QIFA 4DF8A 4YOEA 1Y7PA 4HH1A 1KOOA 2IJRA 4OL8A 2BDPA 4NE9C 5JJBA 3ZTSA 4USHA 4J9QA 3MCSA 2IRUA 1SQGA 4DV7J 2XC9A 2MDAA 3I4HX 3NY0A 5C24A 1RZMA 1XC9A 3VAGA 4UZCA 3T41A 2I2YA 2K3IA 4K4WA 2ZZNA 3ISZA 2QJ3A 1XIQA 3SCJE 3IAM9 3GB0A 1IR0A 3TZYA 3V81B 3V6DA 2IBOA 1L3SA 4DCPB 1YVFA 4OV1A 3OBIA 1H3DA 2O1PA 3QWPA 4GVBB 4OI6A 3U1MA 2CPDA 1RQ0A 1FKPB 3IRWP 5D15A 3HZGA 1NDPA 3DGPB 4YHHF 2AKWB 1N36J 4NRTA 1H72C 3UDEA 4DI6A 1U2CA 4X84A 5E3RA 1TAQA 2CJ9A 4DMZA 3SZ2A 1OY6A 1XTZA 4PG5A 2XMMA 1FE0A 1S99A 3CJ5A 3GU0A 5C25B 2HNDB 2E5GA 1TKDA 2CDQA 1UW9A 3MM5A 5C5JA 4O3PA 1VBXA 3NNCA 4DR2F 1EARA 2CJBA 4RW9A 4BLGA 4LT6A 1HKAA 1WNEA 2HURA 1AYEA 3JTPA 2WHOA 4WYLA 4F0HA 3BGUA 4OZ1A 5AE3A 3AODA 3DDKA 1TK5A 1GX6A 3MAAB 1IUJA 4OQJA 1NB7A 1C0TB 3BZQA 2FYXA 4RWWA 2JVOA 3DLJA 1QTMA 1LXJA 2YWEA 4JV0A 2LDIA 2CKWA 2Z30B 1WC3A 2D69A 1J5EJ 2V2VA 3UFCX 2Z0GA 2ROEA 2DGWA 2MLXA 3RYLA 2EPIA 4JI5J 2NXUA 3NGTA 4H4MA 2X1FA 2UXBF 3VWSA 1YTYA 4DV5J 4B02A 4RBUA 3CCQS 4OX6A 5U47A 3GILA 4K2XA 5C42A 2IA6A 2CUYA 3H5SA 3OTDA 5CYQB 1RKJA 1RT4B 4QCLA 1S1VB 1NZAA 1UTAA 3TJ9A 1O51A 5DGBA 1UAWA 5HVGA 4DL6A 4DWIA 3BGLA 1EAYC 1YWXA 1SH0A 2EFGA 2CNOB 4LQ3A 4IRKA 1ZYQA 2K8GA 4ANEA 2IIHA 1QSYA 1HYSB 3I56S 2RU3A 2BV3A 3TJAA 3H59A 1QE1A 1JLAB 1D9DA 1ZPVA 1EZZB 3EXYA 4PUOA 1S0NA 1NMEB 5HMWA 3IGVA 4WFNQ 1EP4B 3UR0A 2WSFC 1I94J 3CGIA 2QGFB 4JI4F 1F3VA 3NEKA 2C28A 4D3HA 1FJGJ 4B3SJ 1TKXB 3W2WB 3LF0A 1ZAXA 2RIJA 2UVWA 1XR5A 1N0VC 1VQ7S 2R7VA 4X4TA 1VQPS 4X4QA 4OZ0A 4C97A 4OZLA 1YRUA 3H4BA 2YX1A 5J2NB 2GVDA 2YWGA 2VL1A 2GHPA 2V8HA 1IBLF 1UZDA 5FDLA 1RWPB 2DXDA 4KGZB 4EBCA 3V81A 1URNA 3L7PA 2DHXA 2BYCA 3EICA 5CA5A 4CQ1A 3HHDA 4GVBA 5FJ4A 2PFDA 1QVGR 2J7UA 3AB4B 2KFNA 5HMYA 2VFTA 4RW4B 3MEDA 4OYZA 2NYHA 1WG1A 2OSQA 1C2PA 3TAMB 2VBWA 3W5ZA 4CO0A 5HATA 5C25A 2HNDA 2M3DA 1IM4A 1UA1A 2QFIA 3T9NA 2HIYA 2HNYB 4RZRA 3QYYA 5LT5A 5H9EJ 1T7PA 2YNFB 3V4IB 3S01A 1HL6A 3AQPA 2D9OA 2OO4A 4ZPBA 4Y34A 3KJVB 2EFPA 5ETOA 4FNIA 3K5OA 2W7PA 4Y2IA 3PW0A 4CP5A 1U1KA 1GXTA 3PG9A 1Q0NA 3IR6B 5CXTA 4QBUA 2UUWA 3H7HB 2DNMA 3MAAA 2BE7D 3JXOA 4KFBA 4LF4J 4EBEA 3N5BA 3WC0A 2UUBF 5FLXY 4EI2A 3M8SA 3QRPA 4ZK7M 3CDEA 4Y28C 4A48A 2AJ1A 5D78A 4PWUA 2HGMA 1R6YA 5K14B 3QT8A 1HR0F 3OHBA 3BBBA 4HVZA 2KTQA 2HEKA 1B7YB 5KT7A 2DH8A 4DUTA 1RT4A 1NSKL 2ZDOA 3CCTA 1T3OA 3HM9A 3GJSB 3PRVA 1JXLA 1OPZA 2XMUA 2GVZB 2PFFB 4OLOA 2OJ3A 3D54A 4RW7A 5E3PA 1XNQF 1X4EA 5A0YB 4WFYA 1HHTP 1VS3A 1RUSA 1RWXB 3G87A 4QWAA 3K5PA 4JV5J 4DR7F 2JLEA 3I5CA 4OX8A 2CDRB 3AD7C 3EGVA 5JXSA 3HHNB 3E2EA 4DLEA 4ED2A 5F8JA 2C3OA 4RBTA 3DI6A 1YI2S 1BE4A 5IV4A 4DPOA 3LP1B 4DR4F 2D9PA 3T19A 1VBYA 5B0DA 1DQAA 2QMXA 2R7QA 2P9EA 4OZNA 4ZDNA 3TI0A 3TA1A 4ZCMA 5B0GA 1RSCA 2F5GA 3PEHA 2H4YB 2PN6A 3DXSX 3TARA 4MFBA 1RXOB 2UXCF 1I51B 5J2NA 2W9CB 3TAPA 1U26A 4GKKF 1AUDA 4PPZA 2D1CA 3TZZA 9RUBA 3SV3A 1T11A 2VH7A 3KHHA 1I1GA 3VALA 5D0RA 4YEAA 3H5XA 4A8FA 3M1VB 4PXEA 2VF3A 3KJQB 5ETNA 4J90A 1SQEA 1FJ7A 3RAXA 3IO1A 3FMWA 1PO6A 2UP1A 1ZA2B 2XLIA 4WBFA 3TAMA 2JSXA 1PILA 3M30A 4WK3A 4ZP6A 5HLFA 3QRQA 1IKVB 2IPOB 4H4KA 2RAQA 2G0CA 4C8MA 2AYGA 1KDNA 2LU1A 1WEXA 3TO8A 2W2QP 4ZHRA 3V4IA 3HT0A 1OS5A 4A4JA 3KJVA 4OLPA 3Q24A 4NCAA 4DG1B 4ECUA 3PJXA 1U45A 3C2PA 1AW0A 1G3OA 4DV1F 5KT3A 3THPA 2YH1A 2FVSA 2MPUA 1M0SA 1CJUB 1FWKA 1FX4A 4PG8A 2CQDA 1N5YA 1S76D 2VOPA 1KQGB 1U48A 4Q5VA 2YKAA 4NOHA 3V2UC 2XY6A 4DSJA 1HD1A 3GV5B 2HBYB 2ZHBA 2EFOA 2W2NP 4CLFA 4P75A 2ZEJA 4PG7A 2UVRA 1GQEA 1T05B 1REGX 2MQLA 2CNLB 2XMKA 4FZVA 3OR1B 3HLUA 3W62A 5DS7A 4LRCA 5CYMB 3HI9A 2F9DA 4CO2A 3PFOA 1K1SA 1JK9B 4FYVB 1BWEA 1FDBA 1LWCB 1WF1A 3IMQJ 2DRDA 2E9TA 2GVZA 4EZ9A 1UJ6A 1Q7LB 1TV6A 1UCNA 1W25A 2DNKA 2GIRA 3GG0A 3QO9A 3FEZA 5A0YA 1HNXJ 1G6BA 3MXHP 2W25A 2GW8A 4DR3F 3IFEA 4RUAA 3OTEA 1HMVB 1VJWA 4DFKA 2W4PA 3LOUA 1IXKA 4WJBA 1SBRA 2FJVA 1MROA 3M4XA 5L1JA 3MCNA 2L9DA 4LRDA 1YBTA 1RU1A 2PC6A 2OD6A 2EWHA 3QWUA 1JB0C 3LP1A 3UN3A 2C42A 4M5HA 1CC7A 2IAJB 1UEKA 4YP3A 4DBQA 2Q3PA 2UUTA 2AYEA 3HJFA 4X64J 3EVWA 3GR0A 1T94A 2EBEA 1S6QA 2XULA 1RT6B 1KC8T 1RADB 3NGUA 4DOZA 5IT4A 2HRUA 4DLGA 2QA4G 3I0RB 3DM2B 1SV5B 3W2VB 3NBPB 3EGWB 4N7TA 4NYPA 1URRA 3OFHA 1JLBB 1BUXA 4IH5A 2J9DE 3C6UB 3LANA 2PEBA 1D8YA 4DPXA 2QX0A 4MTPA 2DCUB 2N3OA 3U1NA 2CFXA 1HWLA 5RUBA 1PJ7A 3NWGA 5CYJA 1DTQB 5LOQA 3SCKE 2FPHX 4DV3F 1IKXB 3TZXA 4NI2B 2KXFA 2DCLA 1RLCL 2MZSA 2BZ2A 3AH6A 2A2CA 1F1BB 1SKWA 2CXEA 2RSQA 1TU0B 2HK2A 1VRTA 1UWBB 1MW7A 4K59A 4WIIA 4TU8A 3EDRB 2YX7A 2VZ9A 3RR7A 2JEJA 3PVXA 4EUVA 3NAIA 1TL3B 1L3UA 1WF2A 3P8BB 2HWTA 3O2IA 1FFGB 2JX2A 1T03B 3DHXA 5KFVA 1DLOB 2I0XA 1A0OB 1VRQC 3HO1A 3KYLA 2E44A 5E3AA 1FRMA 4K50A 5HI7A 2ILZA 2DR9A 2N7CA 4LSNB 4I2QB 4R5PB 3DRRB 4CLSA 4HACB 4IH6A 3BR8A 2OMLA 2B9XA 2L9WA 3MUMP 1UEVA 3PZPA 5CYMA 4E8UA 3E01B 3T3FA 2KHDA 4OV6A 2BVZA 5DZ6A 3NNAA 2K7JA 3JSBA 5FLXU 1CS4B 2PGCA 2RRNA 1R8AA 4TLQA 1Q53A 5A8KB 3BPSP 1P9YA 3LQVA 5AE1A 2R8GA 4OFZA 1Z2ZA 2EFNA 2IJNA 5DO2A 3PV8A 3Q2TC 1RB0A 1HMVA 4ER8A 2ROGA 4O3NA 3DOLB 2B4OA 5KFUA 1LW2B 1AXQA 3MEGA 3O3LA 4H54A 4O3QA 3OTBA 1LXNA 1HI0P 3MECB 1HPZB 5F8HA 5EWEA 4JI6J 3MOZA 2QSFA 1HNWJ 2MZJA 3IM8A 2DKOB 1G7CB 1RT6A 1TL1B 3I31A 2JHEA 1Y11A 2IVFB 4PAAA 2V9KA 2QTWA 3A1YG 4CYUB 3R5GA 3W2VA 1VGYA 1YZ6A 4NLQA 3P96A 4TN2A 3O5TB 2P8IA 2ASYA 3UE2A 1JJHA 1SC1B 2J6SA 2XTJP 2FJXA 2MMYA 3FC9A 2ZD1A 4G1PA 5J2MB 2D74B 3PYDA 5KT5A 5HAOA 4DZDA 4LF1A 2QE5A 4LBHA 4K4SA 1T9WA 5ADZA 4XIUA 3OFEA 4LF5J 3ZTRA 3LPEA 2WVFA 3R1LA 5I3UB 1QUPA 4CO1A 4NI2A 4CH0S 2GCFA 1RYSA 2SXLA 2MY8A 1A7GE 2UU9F 3PCOB 2MHEA 1PBUA 1RI7A 3G8TA 1JKHB 1V5IB 4IDKB 1UWBA 4YMEA 1L3KA 2N4CA 3HF5A 3NS7B 5J1PA 1TL7B 4L73A 3CCZA 1TL3A 3HP6A 3PX0A 3QZ7A 1FKOB 3DCAA 4NCGB 3AJ2A 3BBFA 2YKMB 3AT1B 2LQ8A 2VG7A 5KG1A 5IT9Y 1NKCA 3VAFA 1HQ2A 4ZJLA 1REVB 3SBMA 3MURP 3C3LA 5F0UA 2XNQA 1W7WA 1TL4A 2O66A 1RT7B 3GG1A 4I1TA 4O4RA 1YZ7A 1X4AA 1HQUB 5JMNA 5A2QU 3E01A 4W92B 1R89A 5SUHA 1IR2A 1VRUA 2ATCB 3KK1A 1TZ0A 2Y0SD 2GX8A 1GNKA 1T95A 1U09A 4TKTA 1BHNA 1ZTTA 1EHWA 2I5JB 4BDPA 4JI1J 4TXSA 3TW0A 1YRXA 5KG4A 2DD8S 2VFUA 3KDOA 4CI0B 1HARA 4KGXB 4ELTA 3QRRA 3W63A 2QYGA 4N5SA 3J7YU 3K17A 3PW2A 4Y3CA 2XYGB 1P9QC 3MPWA 4CLTA 3OXGA 1HW8A 4DV6J 2DPJA 1NHVA 1KFDA 2J8SA 3PY8A 2OTLS 3K2YA 1R0BG 5KAKA 3BJYA 4KHRA 2RDJA 3CJTA 2YXLA 2HLTA 2HHVA 1Q16B 2BQ3A 4QU6A 1SJ3P 1N8RT 3QBCA 1TL1A 4B9SA 2XZTB 4XPCA 2ZZMA 3AQOA 1SL0A 3P49B 1U47A 4F3QA 2HHUA 4CYUA 1RAAB 2X7IA 2MSTA 2HVEA 3G86A 2GGPB 1HA1A 1MMLA 3OLAA 3NOGA 3L9ZA 1YJVA 4FVMA 2KU7A 2HHHJ 4KHPJ 4L72B 1E6YB 2FJWA 1S1XA 5J2MA 1YX2A 2F63A 4JB8B 1DQ8A 4X4OA 1T9XA 1HHSA 1CG2A 5KFQA 1HBUB 4O23A 4KIAA 4F36A 3POTA 2AU0A 2NCKL 1C0UB 1R3NA 1I5OB 3OW2R 2DTJA 3QT5A 4UW2A 1D09B 3M8PB 2AMCB 2V5HG 2WW8A 5IZHA 4OX7A 4I67A 1RBOB 4ED5A 1LK7A 1L3VA 5A8RB 4P71A 2DO0A 2OAUA 3AOBA 3H42A 4IDKA 1R7IA 2FVPA 4J9UE 3MCOA 3R6GB 2ZE2B 4ED6A 4WFAQ 1AB8A 2C22A 5KT6A 4OJGA 4G1QB 1C1BB 4OHXA 3W64A 4NCBA 4DPTA 3EX7B 5F9LA 4RUHA 1RAIB 5DG8A 5FIIA 3K8WA 2AX0A 2DHHA 3DRYA 3KLHA 5BYSA 3WQPA 2XI2A 3G71S 3GIKA 1U1NA 2G2ZA 3NAHA 2RRBA 2ROPA 4F7VA 4N8NA 2DGQA 1RT7A 4PZVA 3MEEA 2R2UA 5GMDA 1PIEA 3IG1B 5LL6d 4DL0C 2RNEA 2WBMA 3CWJA 2HAIA 4J9VA 5HANA 1HQUA 3GWCA 3AY0A 1N32F 3TP2A 2ZBPA 3TVKA 4P52A 2NQPA 2R3VA 3T5HA 2XLKA 3I5AA 1RAGB 3N6LA 2I5JA 1WHYA 4DL4A 2KHCA 2Z57B 2FC9A 2GA7A 2HWIA 4H4KC 1U1MA 4L6V3 1M5OC 2XB2D 2IMOA 4HL9A 3J80U 2WW4A 1MG7A 1H7XA 4DFJA 3QQCD 3OL9A 4KB7A 3GJRB 1NKEA 1ZM9A 3CB4A 1SJFA 5L46A 5DZ7A 1RHRB 2VG6B 1FNMA 1RHQB 2C2RA 5GAHU 1H38A 3K57A 2DISA 2XGPA 1CJVB 3EPIA 3GIMA 5IS2A 2VPYB 5KFWA 3D6MB 4TYAA 1YQHA 2OI2A 3GZ7A 2HVDA 2HZAA 5J2PA 4B9NA 1GXLA 1M1HA 4YHHJ 3KJNB 4Y65A 1KHWA 2B6AB 1U2RA 2J0WA 2VG5A 3L7OA 5KOXA 4YDDB 2H5EA 3K5NA 5CZXA 1RAJA 3C66A 3ELHA 2VQFF 1S10A 2J6UA 1YHQS 4K4UA 3SDEA 5F8LA 1E6VB 2MKYA 1UEUA 4DR5F 3H2LA 3G82B 3Q8YA 1KWMA 3R1HA 4DR2J 5THWA 5KG6A 3DC2A 1B70B 3C46A 4PQAA 1LV5A 4P7TA 3CEDA 2GZOA 2MZQA 2CQIA 5AJ3F 1HBUA 2VPWB 2B7CB 1UW4A 4LSZB 2CRLA 2VJVA 4ZVEA 3FZBA 4OI4A 2F4FA 3KKFA 3FFIB 2YY3A 1R0AA 4WE1B 4P73A 2KYXA 1CULB 1RHMB 8ATCB 2GHVC 2D3OR 4JI3F 5A8RA 4F0KA 2KVQE 3CJ8A 4QWCA 3PACA 1RABB 4ZVQB 3P4UB 2W9BB 4AE5A 4J9SA 3TVYA 1F0XA 4C9DA 5KOWA 2MQ8A 2CPXA 3L09A 2UXBJ 1NSQA 1JXEA 1XMOF 2R7RA 1IBMF 3THVA 2XCPA 4QYZK 4QW9A 2H5JB 5K8PA 2DO4A 2Z2ZA 2YKNB 5D0GA 3ZZYA 7FD1A 4RNFA 1VQSA 2CWXA 3LP2B 3GYGA 3NMAA 1JLGB 2IM1A 2QMWA 1QAYA 4DQPA 1D3WA 2I1RA 2JL9A 3FBEA 4QWBA 1NSPA 3MMCA 4EO8A 2IM0A 4FXVA 3CCUS 2B4PA 1X31C 2DIUA 4DN9A 3IG1A 5KFJA 4ETXA 1WD6A 3MDFA 4DPWA 1V3RA 2LEPA 1VQLS 1EB0A 3RGIA 1LNQA 3ENWA 1Z1ZA 4RKUC 1UVJA 4M5DB 4O3OA 5E3QA 2UV8A 4DV0F 2ZH4A 4C8OA 1NJIT 4JI4J 2H1YA 4J9NA 3I32A 3G6XA 2E9ZA 1BWVA 3AOAA 3V6HA 1WOPA 1X4FA 3PTWA 1DQ9A 4PXCA 3ENVA 3MMAB 4ZVOB 2RVJA 5DQGA 4YFUA 1Y00A 1VBKA 2HRYA 4Q2MA 3HFKA 4IG0A 4O0NA 4ZLPA 2H3EB 4N56A 3FJ2A 2VG6A 3ZZUA 1TKTB 1WKLA 2Q1LA 4OYXA 3EMTA 1IBLJ 2UUAJ 1S9EB 2CQHA 4YQWA 1NK9A 3AOCA 5KFXA 3Q8VA 1SVDA 2FLOA 1UKUA 1O8BA 1DARA 4C8NA 4MJKA 1DFDA 1U02A 4JYAF 3MHYA 2KFZA 4PYDA 1D0EA 5L38A 4U96A 2JZ5A 1OYEA 1SKUB 3C14B 4CNYA 1PC4A 4QIFA 3MM7B 4U67Q 2QLBB 4K0KF 1RP5A 2HK3A 3A13A 3KLGB 3TJ8A 4G3IA 1WACA 4ICLB 1Y9OA 4CM2A 2B6AA 4CIOA 4EMDA 4NLTA 2FHKA 1K9MT 2HNZB 5J1NA 1ZA1B 3NP5A 1CBKA 4ELUA 4NMXA 3CNQP 2EI5A 1K47A 3DLHA 2EVZA 2J8AA 2AYMA 3TEHB 3W5YA 4CDIA 2LXUA 1RCXB 3D0HE 4OI2A 1NH8A 4L3NA 1DBDA 2V4RA 1M5HA 2VA2A 4BBYA 2IRYA 2XBPA 3IM9A 3LW5C 2XQCA 2HQFA 2W4DA 1F9EB 1CULA 3KG0A 4B9LA 5B0BA 3W61A 6AT1B 1HQEB 1UJ4A 3UCUP 4CTAA 2BJEA 2UUBJ 1R31A 4MYUA 3MPVA 4NMLA 4NPOA 3R7BB 3M2RA 3FSXA 3GJTB 5IC4B 1AA1B 1S7HA 4I7FB 1FXRA 4OYMA 2AJFE 1CQMA 2AHOB 1HR0J 3I5BA 2CNNB 3FZ2A 1SL1A 4ID5B 1K1QA 4Z7CA 1XMQF 2OEKA 5L1LA 1HBNA 1SJQA 3UN5A 3TOQA 1EQ0A 3IRXB 2EC2A 1JJ4A 1VYAA 4U7UD 5K8NA 1HNIB 4E98A 4CNZA 3G4SS 1XNQJ 3T5LA 3MM9B 3N01A 3S7RA 3AD9C 5HROB 2HFNA 1FESA 4LF7F 1BD6A 3NOCA 3TNVA 2NXEA 1JJ2R 1HNZF 4IR9A 4DR7J 4C7QA 1QTNB 4M5DA 2P9GA 7FDRA 2J76E 2RQCA 1TUVA 2CQPA 5E41A 2I6WA 3R5CA 1N5QA 4ZVTB 3B54A 3ZTPA 4HT5A 4XPEA 1ZM3A 4DR4J 3Q0AA 1U1RA 1J5OA 2P6TA 3VV2B 1EKSA 4K5RA 4ED0A 2OPQB 4J9KA 2WZ1A 1NU4A 3IC1A 5KG3A 3HFZB 3HSDA 2DNHA 2FVRA 4IUFA 1WHWA 5H9FJ 4DQIA 3VGVA 4ZPCA 3OPKA 3K58A 4GKKJ 3WX4A 2QRRA 2VKRA 3ET6B 3KLEB 4WXOA 3CIZA 3A3PB 2N4DA 2DGUA 2NUUG 4DZ6A 2G0IA 2C3MA 4PQUB 1X9WA 1FJCA 2QLFB 4M5GA 2Z56B 4ZCLA 3L3CA 3CD5A 3QGHA 3C14A 2D3UA 1ICEB 3ZZZA 2OUGA 2WVEA 4RW6A 5G0RA 4ICLA 2CQ2A 2CZ9A 4HHUA 2HNZA 4DCOB 5FD1A 1F2GA 3W9HA 2KDOA 1LWEB 2J7WA 4LFCF 5DQHA 4X62F 3JQMA 2LLZA 1YKWA 2XS5A 4FP9A 1Q4RA 2BMBA 3M9MB 1FFSB 2NPFA 2AZ3A 2QC3A 3VVUA 1V9OA 2AYBA 4U7UK 4DQRA 4M8LA 2KJVA 1O6XA 4F4WA 1KTQA 2PO4A 4J9LA 4DV1J 4B08A 5ETPA 3CCRS 2AJQA 2FD2A 2QL5B 3CIMA 1IKYB 2H51B 3PW4A 1NJZA 1LW0A 3UQSA 3RTVA 4GC6A 3BSOA 2FHMA 5A6PA 1HIYA 4FVCA 4Q0BA 1LWFA 3JYTA 5C2CA 1WWHA 4DXLA 5EGYA 1RT1A 3WBZA 5KFOA 1V5VA 3GTYX 2R8HA 1QVFR 3Q83A 2QA4S 2OMOA 3F41A 3NXZA 3SFUA 1W2IA 2HFVA 2KJWA 2E1PA 4MMOA 1HWIA 3JSYA 3KDNA 4FKYA 2YPYA 3EWGA 3GJQB 2ZHOA 3D6HB 4GVLA 1IBKF 4J91A 3D67A 1RWOB 4UOHA 4ED7A 1GX5A 4KTQA 3MD1A 2HBRB 3V4MA 2CYYA 2DY9A 4PWDB 2HIQA 2ATLA 3CDBA 4KJIA 1NK4A 3HK2A 4W90B 1VHFA 2ZBIA 4M95A 4DL7A 4X66F 4QPXA 4Z7YA 2RHQB 5M2PA 1Z2LA 1BMQB 5HROA 1MN9A 1NXIA 1O0PA 4DR3J 2NXCA 4ENOA 4IFVB 1TMMA 3H2VE 4I4BA 4DHVA 4NA3A 3ISND 2LCWA 4DS4A 1DTTA 4G65A 4NYZA 2ASLA 5HSPA 1S4EA 2WVBA 2ZOMA 1KOHA 2NYIA 5BJRA 1Q79A 1VBZA 3OR2A 2B0GA 4Q7AA 4URGA 3GFYA 4RU9A 3HSJA 3ZZOA 1GT8A 2K1RA 2Z58B 2IC3B 3F44A 3EZOA 4PG4A 3M9OB 2PI4A 3PYFA 4IOBA 2LECA 4NLWA 4EGLA 4A47A 2M4MA 1S49A 2EEYA 4ZPWR 2JC1A 3ZNJ1 1ACMB 2V69A 4USVA 4F3OA 2PMHA 5F8GA 3F0NA 1T9TA 4J9MA 3PKMA 5D0EA 1RTIA 3A4TA 1SIZA 1XWLA 3MTKA 2XMWA 3UDCA 4LIWA 5KFEA 2OPRB 1NK0A 3QLHA 1FWLA 3DRPB 4DL2A 5DLFA 4WKYA 2VQEF 1X5SA 5B0CA 2HGNA 1UETA 4DV3J 2ZUAA 4KAIA 1KRPA 4TNOA 2PSZA 2VB6A 5CABA 2DNNA 2ZH5A 1WTFA 4MIWA 3WZ0A 1NBEB 3I55S 1CJKA 3GCWP 1S7IA 1QD1A 1HBOB 3HHEA 1PKUA 4USTA 3V6JA 2QN6B 2E1AA 2V63A 4KE5A 2ZH7A 5E0OA 1C4AA 2WB1D 2CG4A 2WOMA 1U4BA 1CSJA 2DBBA 2MQQA 3EZUA 3A8JA 3IS9A 3EJMA 4DEZA 1TVRA 2E7VA 3TQ1A 3DN9A 3DLEA 2M9KA 4M1KA 4B3OB 3PO5A 3MF5A 3M2VB 5D77A 3N0VA 3U27A 1LQ9A 1YGYA 5KT2A 2R7UA 2GAGC 4O4GB 1RWNB 2Q6CA 2W7OA 2P6SA 2KZMA 3AD8C 1RISA 5HQLA 5KG0A 2H65B 4EO6A 3LWLA 4MK8A 2M7SA 1FRIA 5IC6B 4JI8F 1YJ7A 4PWDA 3ZZRA 2RDIA 1QM9A 1HNVA 1YITS 3QSYB 2F4VF 1FDAA 4NASA 3KK3B 1WUUA 3OVAA 3RRGA 2JEIA 2YNHB 4MKVA 1KHVA 2H9ZA 3ZTQA 1YK9A 5LM7E 3Q89A 2XHCA 2CJAA 1MWQA 4F3MA 2L3MA 1J5EF 2ZBQA 1PYSB 2XG8A 4BC7A 3BR9A 3FSIA 4IFVA 1VIXA 5C24B 1JLEB 3UR3C 3PW5A 1HW9A 2GIQA 3GIJA 2W2OP 4K4XA 1VK8A 1RAEB 1YJTA 3EM1A 4PEOA 1TELA 5GAGI 4CH1A 1T3NA 3ETMA 4ED8A 2MKKA 2ZWOA 1WORA 2I9SA 4RO0A 8RUCA 2QLWA 1W26A 1RAOA 2PIIA 3HVRA 4KV8A 2X1AA 2M52A 1VQOS 2RMLA 4R25A 1KR4A 5L39A 1KVIA 4HH0A 4A8SA 3UDVA 2Q79A 2R9LA 3WDOA 3MM5B 2N3LA 4OHZA 5ETVA 2FJDB 3UDLA 1NDKA 1WI8A 2KG1A 2MB0B 3DU5A 5M2UA 1JX4A 1O5JA 4RW9B 1ITPA 3D7SB 5D4PA 3SSSA 1PBAA 3SCIE 3RUBL 2AWZA 3OVSA 2FB0A 4HDGA 3G6VA 3RBEA 2C3PA 2UU9J 4DV4F 4CWBA 4PCQA 2B9WA 2VODA 4FF3A 2DNRA 1AFIA 1HBOA 1GMWD 2V4JB 3D9BA 1RLDA 3FBCA 1GMWA 1GXUA 1VQ6S 1VQ9S 4W98A 1GTHA 3FRZA 2VKZG 3KUGA 1ZS6A 4CT8A 2AJ2A 2OLWA 3QGIA 2YX4A 2NXNA 4H4MB 3TUPA 1FRHA 1RT2A 2V34A 1F5CA 4ZP7A 4CO5A 3DLBA 2ACYA 1FNOA 2F8MA 2Z2MA 3QJJA 3BO4A 2XNRA 3PX4A 4UOCA 2PA3A 3LP0A 1FD8A 4O4GA 1Y10A 8AT1B 2ERRA 4FN5A 4I2PB 4WKRA 4QIWD 4F4ZA 2BW7A 4LBPA 3MEKA 1N5SA 2LEAA 3TUZC 4HYKA 1RWWB 4GMKA 3CJSA 3PR5B 2BUNA 2V68A 2DK2A 4R8UA 2X3GA 1QE1B 1Y3KA 5T7LB 3EDQB 4PUOB 5D8HB 3HZEA 4DF4A 3T5JA 5GVQA 3T1HF 2ZITA 1TKZA 3ICLA 1X7VA 5IQ6A 9ATCB 2C3YA 1VQMS 2M5YA 3E3XA 2KZZA 3FDSA 1L5UA 1VQYA 2E5LF 2M70A 4DQSA 2W1BA 5LXRA 4Q8EA 3KG1A 1JLEA 3J81U 1S48A 3R2DJ 2GVDB 2XEXA 1TK0A 1FD2A 4B3MF 5FDLB 5I42A 3OXFA 4ECXA 1R8BA 1WC5A 3VHQA 3JQJA 3QPIA 2RH3A 3ONQA 2A3JA 1N6QA 1SCJB 1T0TV 4CLUA 4HHHA 2XZWA 4DS5A 4F4KA 2GMLA 5GADI 2RQKA 3N28A 4CT9A 3MEDB 1OQ6A 4JV5F 2CPZA 2OP5A 3D28A 4RNNA 2B9EA 4F50A 3CCSS 4K8RA 3N79A 1UVNA 1ZETA 3M8WA 2KT3A 4ED3A 1Y4ZB 4HHJA 2DGTA 1F3FA 2DEJA 2L41A 2KFYA 4YY3F 4AXJA 4WP3A 4DPYA 1X4GA 3KHRA 3LH2S 2YKPA 2VUGA 4F02A 2OFGX 4MH8A 2B56A 4DFPA 2GQ2A 1MU2A 1NLKL 4F4AA 4ZVGA 1PJ5A 5LMNF 1U1QA 3OHAA 2V4JA 4KFBB 3UN2A 2CWKA 2JOQA 2EBGA 1NK7A 1RTZA 3IN5A 1M5KC 3ILIA 4J37A 3UW1A 2DXFA 3I0SA 2J5AA 3SSRA 2RUGA 4FXDA 3C6TA 1D9AA 5HBMB 1NHKL 1S6UA 4PKDB 2B7BB 5F9NA 3T1AA 3G9CA 3P5BP 3BEGB 1CEZA 1UWAA 2DGVA 4X65F 4E0DA 1UVMA 1LFPA 5D4NA 3GIRA 4C98A 2GJFA 1I3OB 1T9UA 2FJBB 4I2PA 3FEXB 2LFVA 4RW7B 4XAKA 3KK2B 2MKCA 2AF6A 2B4VA 3UCZP 1N32J 2Z8QA 3BGRA 3MZIA 1UMJA 5KFMA 2ABYA 1NJXA 4FYXB 5T7LA 3MTJA 2P9CA 3JS9A 3PIOQ 3DMJA 1HFEL 3DI6B 2R2RA 2MZ1A 3K5MA 5CD4H 2JRSA 2CPJA 3VTIA 3R5AA 1XERA 2VDHA 4HLBA 1LWXA 2R7WA 3OTCA 3B4MA 2DR6A 2LVWA 3D3CJ 4NLDA 1H7WA 2PE8A 4MFBB 1RTJB 3KHLA 2FC8A 3RBXA 5J2QB 1EQMA 2GMJA 4K4YA 1RTDA 1FRJA 1RA6A 4QIEA 3NCQA 3EGZA 1ZAWA 3UVJA 3N4WA 4X4NA 3VAMA 3IR7B 2ZUGA 4V1Ak 3GFZA 5DGAA 3RG6A 4ZOSA 4D3GA 5EHHA 4NEYA 2ZH8A 3R8YA 2QLJB 2VFVA 1NM2A 4LRBA 4DV2F 2KL8A 2KG0A 3RAMA 2VQFJ 4EFAC 3M7VA 3NS6A 4YS2A 3M8QB 3M30B 3CJ2A 3TYTA 3QZ8A 5HLFB 1YBAA 1RTHB 5A76A 2FZGB 4H4OA 4DR5J 3H4DA 2LXFA 2DNYA 2RD5C 1U7LA 4ZHRB 3PJ9A 2RKIA 2IM2A 4USKA 2VASA 3SFGA 2M8DB 2JNJA 2XSJA 1RT5B 1Y0HA 1RKIA 3EVMA 5L9NA 5LXYA 1SXLA 3M2UA 1P1LA 3DU6A 3PM9A 1FTRA 3MOJB 2B5JA 4XK8C 3RB6A 3PFEA 1N5YB 2ASDA 4RLEA 4JI3J 1L3TA 4L74A 3GPAA 4KR0B 3ISNC 5HN0A 1A9NB 2MKSA 2N82B 2HHXA 2DGSA 3OL7A 4YB6A 4KKOB 3J7Z5 1S9GB 4DN0A 1AFJA 4KT0C 2OFHX 4YUDA 5B09A 1IBMJ 3HULA 5HBMA 2DNPA 2JEGA 4CRJA 1QY7A 5D0HA 1S1WB 2W9AA 3P3DA 3JAMY 2EK1A 3W7BA 2VOOA 4ZKAA 3SQOP 2AGPA 4LF6J 2GJ2A 1G4CA 2B9YA 1NPKA 3GSDA 3MR2A 4TYBA 1WDTA 3ILLA 3DOKA 3WHIA 4IFYB 4UOFA 1TQLA 2HMIB 1TV6B 1DY3A 3KK2A 4R0JA 3VAIA 3QO9B 3RW7A 3DRXA 2AGOA 3H25A 2VBXA 2XS2A 4DV0J 4DX5A 2Y1RI 2NZ4A 1MROB 1IWGA 4F67A 2KXHA 4GKJF 3NG8A 4PG6A 2RS2A 5CZVA 1KQKA 2PMZD 1VQNS 4KH0B 1DURA 2HHSA 2WONA 4OZJA 4LQ9A 3GQCA 3R5BA 1ZTWA 4Q44A 1S6QB 2FGCA 1RACB 3IR5B 4TQSA 4IOAQ 3H90A 3PR4A 1RTJA 3HVTB 1N52B 4Y2KA 2FVCA 1FTCA 2DT9A 5J2QA 3NL0A 4JYAJ 2WAQD 1IJEB 1SKRA 2XYPB 3OL8A 2HHWA 4PYAA 3TUIC 1DAXA 3K59A 4K0KJ 2G2OA 4X4PA 1SH2A 1RAHB 3UD4P 4OZ5A 1EX8A 5LSLA 4ECYA 2U2FA 5I3PA 1KSPA 2VBYA 3RU0A 4X4VA 2E1MC 2NSBA 2BE2B 1FXLA 4QJVA 2MGZA 4OZ3A 1VHIA 1YJUA 5KFBA 3CDWA 3M8QA 3B8HA 5L8RC 1MLAA 3QT6A 1RTHA 4FS1A 3CD6S 2NZCA 4I0WA 2BANB 1UZHA 1S6PA 2GIFA 3CD0A 3CMES 4JI6F 1RT5A 1S4FA 2LU2A 4BCAA 1VRTB 3CCES 1PAEX 1S59A 2RDDA 1MWZA 4ZIVA 1NEEA 3OVBA 3SYZA 4ETZA 2Y1LB 1S77D 3PKYA 2LQ9A 4OZ2A 1N34F 2HQIA 4YB7A 2E1RA 4ZPAA 2Q6BA 3UCGA 4C3KA 2CZ4A 1NKBA 3QFWA 3ZO7A 4QWEA 4ECTA 5AE2A 5K8MA 2R8KA 1JQGA 4O3RA 1WEZA 5GAHI 4PRFA 2BEFA 1PCAA 4KKOA 1S9GA 5IWAF 5IXUA 3PDNA 1VMBA 2W8LA 1WEYA 4EYIB 4C8YA 1S1WA 4KO0B 4P10A 1XMQJ 3ITHA 3R97A 4ZVUB 5D4OA 3FKBA 4IR1A 4IFYA 4K4TA 3W9JA 3H5YA 4LF7J 2B8QA 2HMIA 3KLIA 2B8PA 4DU7A 1T9VA 4JI2J 4U6PA 1HNZJ 4AYBD 3O44A 4WP8A 5J1EA 1B7FA 4FBTA 2CZVC 1N33F 3JTOA 2HW3A 3M6WA 3MEGB 4NX9A 4CZCA 1NRKA 2P2CB 4FYDA 3MPUB 3UNYA 5KFNA 2WBRA 2LA6A 4QW8A 4ZP8A 4ELVA 4DR6F 3IGNA 4JV1A 2YQ0A 3H98A 2GFFA 4ECSA 5BYRA 3HVTA 4M5IA 4PXDA 3DOMA 4K4VA 2NREA 1R43A 2KRRA 3LWMA 3QAUA 1HWKA 3KTQA 2QV6A 2HFOA 1CC8A 2XY7A 1LEOA 4URSA 3MFIA 1MN7A 2JFDA 3HDSA 4JI1F 2PA8D 3CULA 3HD1A 2BBEA 4GO7X 4DUZF 3W65A 2Y8WA 4ES2A 2A6MA 2ZD1B 2M0GB 3RB4A 5L1IA 3MM6A 4LFCJ 4X62J 2BM0A 2BE2A 2ZKUA 1OMSA 2ZDPA 4QYRA 4HEA9 3VCDA 3D0GE 1FK9B 2BKOA 4YR0A 1EETB 2BANA 1D8ZA 2IBKA 1KLMA 3RRKA 2VU5A 2E7WA 2MLYA 2EC0A 1FO1A 1GTEA 6FDRA 3SI8A 5AXMA
chains in the Genus database with same CATH topology
5C25A 2HNDA 2M3DA 4M5DA 3JSRA 2P9GA 1IM4A 2J76E 2JVRA 7FDRA 2RQCA 3MAQA 1D1UA 1TUVA 2CQPA 5E41A 1UA1A 2FGOA 3IWLA 3T9NA 1N6QB 3R5CA 1N5QA 2FJAB 2D3ZA 2HNYB 4RZRA 3QYYA 4A8KA 3LGNA 4HT5A 5LT5A 4GC7A 1VOMA 5H9EJ 4XPEA 2YNFB 1T7PA 3V4IB 3S01A 1ZM3A 1HL6A 3AQPA 3Q0AA 1U1RA 1J5OA 2QEXS 2P6TA 1MMDA 2D9OA 2OO4A 4Y34A 4ZPBA 3H5UA 2XHWA 3KJVB 4JUZA 2EFPA 2ZM6F 1U1OA 1U25A 1N54B 4N77A 4I6YA 4FNIA 3K5OA 4K5RA 2W7PA 4ECVA 4Y2IA 4ED0A 3PW0A 3SXLA 2OPQB 4BHQA 1U1KA 4J9KA 1NU4A 3IC1A 5KFTA 5KG3A 2VG7B 1GXTA 1MWYA 4AUKA 2ZH3A 2DNHA 2GV1A 3IR6B 2FVRA 4IUFA 1WHWA 5H9FJ 5CXTA 4DQIA 4MKYA 4QBUA 3MR3A 5GAEI 3WC2A 2ZJQQ 2OPSA 3MUVP 2UUWA 1RWUA 4ZPCA 3OPKA 3K58A 1I94F 3WX4A 2DNMA 5KFGA 2QRRA 1BLUA 2VKRA 3FNNA 3KLEB 2R7XA 1KS2A 2MHNA 4N8OA 4WXOA 2VBZA 3CIZA 1U1LA 2G4BA 2D41A 1FJGF 4MK9A 4KFBA 2MKIA 4B3SF 2N4DA 2VD3A 4TLRA 2QFJA 5JVGQ 4NLOA 4EBEA 1J2VA 3N5BA 2DGUA 2NUUG 5KFYA 4NZ6A 3V5RA 3WC0A 1UVLA 2C3MA 4PQUB 1X9WA 3HX9A 4M63A 1KQSR 1NH7A 5FLXY 2UUBF 3X1LB 1FJCA 4KO0A 2JWNA 2G1DA 3M8SA 4ZCLA 2KKHA 1HD0A 1VRUB 3T6JA 4ZK7M 3L3CA 3KK1B 3CD5A 2ZNYA 3QGHA 4TY8A 2NR0A 2O67A 3CDEA 2LQ5A 3TVZA 2D3UA 1ELOA 3ZZZA 4Y28C 4A48A 4RW6A 4DSEA 4Y6IA 2AJ1A 2KN4A 1TL5A 5D78A 4V19J 2MJUA 1MU2B 5G0RA 3TANA 1ZOTA 4PWUA 4ICLA 2CQ2A 2FHOB 2HGMA 2KYZA 1T02A 1R6YA 3GFHA 5K14B 4O0IA 4IQXA 1HR0F 3OHBA 1S97A 4HVZA 3T5KA 2KTQA 2OPPA 4JBCA 3U1LA 4WFXA 2HNZA 3F56A 4ECZA 5FD1A 5KT7A 1F2GA 2DH8A 2KDOA 1LWEB 2J7WA 1Q78A 4LFCF 5DQHA 4USJC 2DRBA 1RT4A 4MKAA 4X62F 2ZDOA 3CCTA 3THTA 1VQ8S 2LLZA 2W7AA 4EEYA 2XS5A 1T3OA 3HM9A 4FP9A 3S8SA 1Q4RA 3D1QA 3HHKA 4AL7A 2KH9A 3CC7S 3JSMB 1JXLA 2XCAA 3M9MB 2MJNA 1OPZA 1PSDA 2CQ4A 2CPYA 5DJBA 4B9MA 2XMUA 2NPFA 2LYVA 2PFFB 4LJMA 4OLOA 3N5FA 2RQ4A 4CO4A 3I0SB 2OJ3A 4NYOA 1YJWS 3D54A 4RW7A 1V9OA 5E3PA 2Z2LA 2AYBA 4U7UK 4DQRA 1XNQF 4M8LA 2KJVA 3C6TB 1X4EA 4F4WA 4F25A 1FEHA 1KTQA 5A0YB 2PO4A 3M05A 4J9LA 4WFYA 4ED1A 1HHTP 1VS3A 2GGPA 4B08A 4J5OA 4QWAA 1H0HB 3K5PA 4P7VA 2E1CA 3D1HA 1VC5A 3CCRS 5SZTA 2AJQA 2FD2A 3R27A 5A8WB 3J7ZT 1I6JA 4DR7F 3CIMA 1IKYB 2JLEA 3I5CA 2JLGA 3PEJA 3PW4A 4C7QA 5E33A 1NJZA 1LW0A 3UQSA 3RTVA 1Q81T 2PI5A 4OX8A 3KLVA 4WFZA 4GC6A 1U1PA 2UVVA 5JXSA 5DG7A 3HHNB 3E2EA 2FDNA 2FHMA 4C0BA 3BSOA 4DLEA 3G6ES 3OSPA 3KNAA 4EYHB 4ED2A 5A6PA 5F8JA 1E6YA 2C3OA 4OJ3A 4WZQA 2YNGA 4FVCA 4RBTA 4Q0BA 3DI6A 1YI2S 1LWFA 3JYTA 1F5BA 2E5IA 4DPOA 1WWHA 2VC1A 5EGYA 3LP1B 2CQBA 4DR4F 2D9PA 3T19A 1RT1A 1VBYA 3WBZA 1VQKS 5KFOA 5B0DA 3I6PA 1DQAA 2IMWP 1Y5IB 3X3UA 2JEFA 2QMXA 3B4DA 2R8HA 2R7QA 1QVFR 1FRLA 4NA1A 2P9EA 4OZNA 4ZDNA 2QA4S 2A1BA 3TI0A 2OMOA 3F41A 3EZ5A 3SFUA 3TA1A 4ZCMA 5B0GA 1C0UA 2IRXA 3PEHA 3HHLC 4IOCQ 1W2IA 2DRAA 3BGRB 2PN6A 5F8NA 3DXSX 2O01C 2KJWA 3PHEA 5BYQA 3TARA 4MFBA 2MY7A 2RB7A 4UUWA 3NNHA 1QAJA 4MMOA 1M1KT 2UXCF 3KMSA 1HWIA 5J2NA 3M8PA 3JSYA 2W9CB 3TAPA 1U26A 4GKKF 1Q1KA 1AUDA 2LA4A 3J7A1 4PPZA 3ZZPA 2YWKA 4UY8T 3DMJB 3CTRA 5LJ3Y 2D1CA 2ZHOA 4C11A 1X0FA 5KFCA 1IBKF 1S1XB 3R3TA 3SV3A 2VH7A 4ED7A 4LF4F 1GX5A 1VI7A 2W24A 4KTQA 1JIHA 3MD1A 1LFWA 3V4MA 2CYYA 4PWDB 2HIQA 3KHHA 1I1GA 1JLFA 2ATLA 3CDBA 3VALA 4KJIA 3HKZD 1NK4A 4YEAA 2DVIA 3HK2A 2ZE2A 3POTB 3BM7A 2L48A 5HMXA 3H5XA 4DL3A 4A8FA 4W90B 1VHFA 2ZBIA 3M1VB 4PXEA 2F9JA 4M95A 1S1TA 4G1QA 4ZA1A 1C1BA 3SV4A 4DL7A 4X66F 3QJPA 2ZC4A 1SQEA 1ULRA 4QPXA 2IYGA 4RNOA 1FK9A 2DHGA 1H2UX 1KLNA 4AQYF 1EETA 2FUG9 3OJSA 1FJ7A 3RAXA 5M2PA 1U6BA 3IO1A 1Z2LA 4F4XA 2RT3A 3FMWA 5HROA 2ZBCA 1PO6A 2MZRA 2UP1A 1O0PA 2XLIA 3TAMA 1Q8LA 2JSXA 1PILA 2F1FA 3M30A 1FXDA 4WK3A 1KEKA 4LF6F 4ZP6A 4IFVB 5HLFA 1RTDB 4FNHA 1IKVB 3H2VE 1FE4A 3V6KA 4JI7F 4H4KA 2R7TA 3MM8B 6FD1A 1KFSA 2G0CA 4I4BA 4DHVA 4C8MA 2B3TB 4NA3A 4A8OA 3ISND 2AYGA 3QIPA 2LCWA 4IRCA 4DS4A 2LU1A 1WEXA 2IHR1 3TO8A 1DTTA 1JLCB 1U2FA 4NYZA 4ZHRA 3BSNA 2ASLA 1H6KX 1RDRA 2DIVA 3V4IA 1UL3A 2Y1IA 1OS5A 4DR1F 2ZOMA 3PJWA 4A4JA 1KOHA 4ALZA 3KJVA 1KTVA 4OLPA 3Q24A 3CF5Q 2NYIA 4NCAA 4QR1A 4DG1B 1CVJA 4WTYA 2APOA 1SKSA 3A8EA 1Q79A 5BJRA 3OR2A 4ECUA 1VBZA 3PJXA 2B0GA 1U45A 3C2PA 1AW0A 1G3OA 1OWXA 4DV1F 4O44B 4IG3B 4Q7AA 4URGA 3UI3A 5KT3A 3GFYA 3THPA 4WFBQ 4RU9A 2YH1A 2FVSA 2MPUA 1M0SA 3ZZOA 1GT8A 2K1RA 4DX8H 2IC3B 3F44A 3KLHB 4J9PA 2ZH1A 4Y00A 4PG4A 4PG8A 3M9OB 2PI4A 4DSKA 2CQDA 1N5YA 1S76D 2VOPA 4IOBA 1KQGB 1U48A 2LECA 4H4OB 4NLWA 4EGLA 4Q5VA 1PC5A 4A47A 2M4MA 1S49A 5GMKa 3BDPA 1NAQA 3SQGA 4ZPWR 2JC1A 2YKAA 3K7RA 2R2TA 3MEEB 4B9VA 4NOHA 2XMJA 3K8VA 4HI2A 2BRLA 3CJ3A 3V2UC 4F3OA 2PMHA 3KOAA 2XY6A 3CT9A 4DSJA 1HD1A 1TAUA 5F8GA 2RKIB 1KQFB 4J9MA 3PKMA 3GV5B 3GE9A 2FLNA 1S6OA 1XR7A 2ZHBA 2XSJB 2EFOA 1RTIA 1N56A 4FF4A 4O3SA 4C2MA 3BF4A 2HFZA 1SIZA 2GQQA 1R8HA 2HVIA 1XWLA 1HBMB 4DUYF 2XMVA 2HPUA 5GAEU 1SIWB 4PG7A 1FJEB 2DJWA 3I9ZA 3MTKA 2UVRA 3MMBA 3M2UB 1GQEA 2B5JB 2XMWA 3UDCA 4EBDA 4LIWA 5KFEA 1T05B 2OPRB 2MQLA 2XMKA 4FZVA 1KN6A 2W8KA 3OR1B 3HLUA 1NK0A 3QLHA 5DS7A 3MMJA 3DRPB 2FIUA 4DL2A 2JFKA 2DGXA 5DLFA 4IKAA 5CYMB 1CPZA 3FRYA 4WKYA 2VQEF 3VAHA 1BGXT 1X5SA 2OD4A 3HI9A 2F9DA 4CO2A 4J9OA 3BQ0A 5B0CA 2HGNA 1UETA 2MXYA 3PFOA 3HMJG 1K1SA 3HPOA 1JK9B 4KAIA 4NLXA 4OMFG 4AFFA 4I56A 3PW7A 1N5TA 4P6QA 4TNOA 1KRPA 1BWEA 2GJIA 2QA1A 1FDBA 1LWCB 1WF1A 1DHMA 3JSMA 2UXDF 1TP7A 2PSZA 2VB6A 2E9TA 1SUQB 2DNNA 5KFKA 2ZH5A 3NGKA 1WTFA 4MIWA 2C3UA 3WZ0A 3I55S 1YIJS 4RW8B 1KONA 1UJ6A 4EZ9A 1Q7LB 1TV6A 1W25A 1HBOB 1VIOA 3HHEA 2DNKA 2C2DA 2GIRA 4AL5A 1FA0A 3BO3A 4HTIA 1X4HA 3GG0A 1LOUA 3QO9A 4FS2A 3FEZA 5EX0A 5A0YA 2AJ0A 2IM3A 3V6JA 2E1AA 1C1CB 1XEZA 3T6BA 2DR7A 1G6BA 3MXHP 3G8QA 4F8RA 4KE5A 2W25A 2GW8A 3BO2A 3CCMS 4WYWA 4C8ZA 4DR3F 2ZH7A 1WHVA 3IFEA 1XR6A 3OTEA 4RUAA 2PEHA 2CJQA 5A8WA 1HMVB 1E6VA 1X4DA 2B4UA 5E0OA 3OTOF 1VJWA 2ADCA 4DFKA 2BW2A 5KFZA 5DDQC 2W4PA 1C4AA 3LOUA 1IXKA 2WB1D 1SBRA 4WJBA 4A46A 2ALZA 2FJVA 2CG4A 2WOMA 1UVKA 5J2PB 2OH2A 1X5OA 4A8QA 2KB2A 2WRMA 3KLFA 1U4BA 1MROA 3M4XA 5L1JA 2L9DA 2AD9A 3IWXA 1CSJA 2J0QD 4NLGA 1ROFA 3RAQA 2DBBA 2QT7A 2PC6A 2MQQA 2OD6A 2EWHA 3QWUA 3EZUA 1JB0C 3DOKB 3LP1A 3H20A 3IS9A 4UQGA 2C42A 4DEZA 1FF2A 2VG5B 1TVRA 2KM8B 2NSCA 1CC7A 3M6XA 2IAJB 4C0OC 3TQ1A 3DN9A 4YP3A 3B82A 3TX8A 3DLEA 2M9KA 1UP1A 4JV2A 5A6WA 2LKZA 4ZPDA 4M1KA 2Q3PA 2UUTA 2AYEA 4DBQA 2MQPA 4B3OB 3PO5A 3MF5A 4NWBA 5F3ZA 3M2VB 3HJFA 3GR0A 4TQRA 1T94A 5D77A 2EBEA 3N0VA 3DLGA 3U27A 4PR6A 1LQ9A 1YGYA 2DH7A 1UVIA 1S6QA 5KT2A 2KVIA 2XULA 2R7UA 3KMQA 3FFIA 3FQKA 2HHTA 4WE1A 1RT6B 4O4GB 2OIHA 5KT4A 3SDEB 1KC8T 1P8GA 2Q6CA 3L95X 5BR8F 1UJ5A 3R5DA 4DOZA 2W7OA 2P6SA 5IT4A 2KZMA 4XO0A 4Y2AA 1RISA 4F2SA 4QYZJ 2J9CA 3LAMA 2HRUA 5KG0A 4DLGA 2QA4G 3FQLA 4EO6A 3I0RB 2XGQA 1NK8A 3DM2B 1SV5B 3W2VB 4B3TF 5CCMA 1ZM2A 3LWLA 3NBPB 2M7SA 1FRIA 4MK8A 1B0VA 2W9BA 4I68A 1S0OA 3JTNA 4JI8F 2F7VA 4PWDA 2KT5A 3ZZRA 4ECQA 2RDIA 1Q8BA 2KM8C 2O5DA 3EGWB 1QM9A 2CQCA 1NJWA 2UVUA 2WONB 4NYPA 1URRA 3OFHA 1JLBB 1VLYA 1HNVA 2Z4PA 1YJRA 1YITS 3CPWR 1PGZA 2UUAF 2F4VF 1FDAA 3MR6A 3LUYA 3NCRA 5I4MA 3KK3B 4IH5A 2J9DE 3OVAA 3RRGA 2V8DA 3C6UB 3LANA 2JEIA 2YNHB 5EX3A 1D8YA 4DQQA 4QR0A 1R0AB 2X1BA 1R8CA 4WXWA 1KHVA 2H9ZA 4ECRA 3IBWA 4MTPA 2DCUB 4KPYA