1SUQB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r185545
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 95
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1suqB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1suqB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1suqB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1suqB03
4MIAA 5KFRA 1HNVB 3QLHB 3PW0A 1JX4A 1RT7A 4LSLB 1SH2A 1K1QA 2I1RA 2W8KA 4H4OA 3M8QA 2ASLA 1S49A 1RT4A 4Y3CA 3BSNA 1N4LA 3LANA 3OSNA 4G3IA 5F8LA 2HWIA 1S1XA 2BRKA 2WOMA 3DI6A 3UR0A 3MEDA 5KT5A 3QZ8A 4ECVA 4QW8A 2YNIB 4DL6A 1IKWB 2JEGA 3MR5A 2AWZA 1LWEA 2D41A 4TLRA 1EP4B 5J2NA 2FVPA 4I2PA 5EWGA 3OLBA 2UVUA 2YNFA 2YNHB 2ZD1A 5KG4A 5KFHA 1DTQB 3DYAA 2YKNB 1JKHB 3FDSA 2VG5B 5T14A 3C6UB 4KO0A 1R0AA 3UPFA 1RAJA 5L1LA 3UQSA 4IDKA 2B6AA 2OH2A 4TYAA 1T05B 1JLFA 1VRTB 1TQLA 1MU2B 1N6QA 4WYLA 4TY8B 3KHLA 4H4MA 4ZPBA 4Q0BB 5J2PB 2F8EX 4NZ0A 4KFBB 1S6PA 5CYMA 2HAIA 4ZP7A 4JV1A 3MEGB 3CWJA 3RAXA 3H40A 4MFBA 2HNDA 1RYRA 2JEFA 1TL3A 5J2MB 1IKYB 1RTHB 1EETB 4NLUA 4KHMA 3IG1A 4O3RA 2E9RX 4I2QA 3V81A 1S4FA 5KFKA 4Q45A 3LP0A 4IFYA 5HP1B 4IH6A 4ICLA 4RNOA 3H4DA 3CIZA 4TQSA 2XGQA 1ZTWA 4WXOA 2EC0A 4KV8B 2WCXA 5C24A 4EYIB 1QE1B 1RT2B 4F4YA 2O5DA 2OPPA 5F8JA 1LWCA 3BQ2A 2R8HA 2ZKUA 4RW7B 5KT3A 1UWBA 3QIPB 1T3NA 3CJ5A 3CVKA 4NLPA 1HNVA 3QLHA 4B3OB 1YVFA 3I5AA 4ZVHA 4LSLA 2XC9A 4ECYA 1TV6A 4ED2A 3KLHB 4Y34A 1S1VB 4TYBA 3DRRB 3GQCA 4ZP8A 3V6HA 4F50A 5KFFA 1QUVA 3BQ1A 2VG6B 3SI8A 2YNIA 1IKWA 4NLOA 5KFEA 4WYWA 4OL8A 4RNHA 1KLMB 3BQ0A 1EP4A 4NRTA 2WHOA 4ED3A 5KT2A 4K4WA 1DTQA 3TAMA 2YKNA 1JKHA 2XI3A 4IR1A 2VG5A 3SFUA 3IS9A 4PQUB 2FJXA 5DG9A 3Q8RB 3C6UA 4J9OA 3KLVA 4ED6A 3PW7A 3LALA 2ILYA 4IFVB 4KE5A 1ZTTA 2GIQA 5F8GA 1T05A 1VRTA 4DL3A 4FBUA 4ECXA 4RW4B 3DI6B 1MU2A 2ALZA 2I5JB 1SUQB 2IJFA 4TY8A 4NLGA 4Q0BA 5J2PA 2HMIB 2BQRA 3M8PB 1JLAB 2HNYB 4KFBA 3TVKA 1RA6A 3KOAA 1RT3B 2BANB 3DOLB 1QAJA 1W25A 5JXSA 2GC8A 4QWAA 3E01B 3NAHA 3MEGA 5KT4A 3DOKB 5C25B 1NHUA 2V9WA 4F4XA 3Q8SB 5I42B 5J2MA 1IKYA 1RTHA 1EETA 4DG1B 5KFAA 2J6UA 4K4ZA 5L1IA 4NYZA 2V4QA 4IDKB 2UVRA 1NNDA 3ISNC 4KKOB 4J9SA 1N56A 1N6QB 3M9OB 5HP1A 1HNIB 1RTIB 4ED7A 3PW4A 4O4RA 5CYQB 1C0UB 4YMEA 4MK7A 4KV8A 3DMJB 4ZVGA 1QE1A 1RT2A 4YQWA 1C2PA 4DL2A 4LQ3A 4RW7A 3SFGA 2D3ZA 3QIPA 1JIHA 1OS5A 3DLGB 4B3OA 2UVVA 4Q8EA 1ZETA 4O3PA 3KLEB 1KHVA 1S1VA 1WNEA 3DRRA 2AQ4A 2V4RA 1FKOB 2VG6A 2B43A 4FS2A 4NLVA 5KFLA 5KG3A 1KLMA 3PZPA 1QAIA 4NLQA 4EBDA 1RA7A 1S0MA 3LAKA 1BQMB 2R2UA 4JV2A 1UWBB 2VA3A 4X2BA 3BREA 2IA6A 3KK3B 4PQUA 3CDWA 3H4BA 4ZVFA 1TV6B 5KFQA 4DL4A 4IFVA 4R8UB 4YR3A 3I5CA 4RW4A 4WFYA 4ECSA 1TKZB 2I5JA 1SUQA 1J5OB 4EBCA 2BR0A 3CDUA 5KG6A 2HMIA 2W9BB 3BR9A 3M8PA 1JLAA 2HNYA 3OL6A 3OSPA 4QWDA 4EBEA 1RT3A 2BANA 3DOLA 3MF5A 4NLXA 2FVCA 2OPSB 3E01A 5KFTA 3DOKA 5C25A 2OPRB 3TAMB 3IS9B 5J2QB 5I42A 1MMLA 2YNGB 4DG1A 4RUCA 1S9GA 3GV8B 4JV0A 3NMAA 1I6JA 5KFDA 4KKOA 3DDKA 3DM2B 4O44B 5FDLB 2WB4A 1HNIA 2UUTA 1RTIA 3H5UA 4M95A 2FLLA 1CSJA 5CYQA 3EZUA 1C0UA 4RW9B 4NLSA 4YP3A 3DMJA 5KFYA 5DQGA 3MEEB 3H5YA 3NAIA 1S1TB 1IM4A 1N48A 2XGPA 4RUAA 1RT6B 3ITHB 2DPJA 3MECB 2J6SA 3DLGA 3CDEA 4IH5A 5DQHA 1C1CA 5KFJA 3H5SA 2FLNA 1TVRB 2YKMB 1T94A 3KLEA 2FLPA 5K14B 2QV6A 1FKOA 1S9EB 5HROB 2IM0A 3HKWA 2FJWA 5KFSA 5KFCA 2BRLA 4R5PB 2R2TA 3MR2A 1S1UB 3IGNA 5DG7A 1JLEB 3T5HA 1BQMA 5J1EB 4M94A 3IRXA 1GX6A 2ASJA 3OHAA 3KK3A 1LW0B 4ID5B 3MTKA 2RDJA 2FVSA 4GC6A 4DL5A 4J9RA 4R8UA 3KMQA 3IN5A 2AGOA 1FK9B 1FKPB 1TKZA 1J5OA 1HMVB 4FS1A 4PUOB 2W9BA 1TP7A 2IMWP 2RF2B 4ECRA 2C22A 4WXWA 1SH3A 4U7CA 3KNAA 3I0RB 4KAIA 2OPSA 2ASDA 1S0NA 3PR4A 3D5MA 1IKVB 2OPRA 3N6MA 5DG8A 1RTDB 3T5LA 3PR5B 1HQEA 1C1BB 5J2QA 5KFZA 1JLQB 4K4TA 2YNGA 4QWCA 4K4YA 4EYHB 3FSIA 5KT6A 4QWEA 5EDWA 1S9FA 3DM2A 4DL7A 4O44A 5FDLA 1HYSB 4WE1B 4TY9A 3PVXA 1TKTB 3VQSA 5JUMA 4RW9A 4ZHRB 3T5KA 3G6YA 3LAMA 5KG0A 3PW2A 5EUHA 3GV7B 3H98A 5KFBA 4K4XA 4O3SA 4FBTA 4HKQA 3MEEA 4IOBA 1JXLA 1S1TA 2WONA 2RDIA 4ZVEA 4DEZA 3KHHA 4K4SA 3NGDA 2R8IA 5L1JA 2J6TA 1RT6A 3ITHA 1N5YB 3MECA 1S9GB 4NLYA 4EO8A 4MH8A 1SV5B 1S0OA 1TVRA 2YKMA 1KHWA 3E51A 3OL7A 3OL8A 5K14A 1JLGB 5F9LA 2WTFA 4Q8FA 1S9EA 1LWFB 5HROA 1JLCB 4RU9A 4QW9A 2XI2A 5F8MA 2GIRA 3KK2B 4MIBA 2E9TA 2IC3B 3RB6A 3FQLA 3HVWA 4R5PA 3H59A 1K1SA 2C2DA 1S1UA 2E9ZA 3BJYA 1JLEA 4QPXA 5J1EA 2DPIA 3RB3A 3Q8PB 1LW0A 4ID5A 4NLWA 4O3NA 1C1CB 2UVWA 1RT1A 3CJ0A 1JLBB 3KJVB 4Y2CA 3H5XA 3PJXA 1RDRA 1FK9A 3KLGB 3PHEA 2W9AA 1FKPA 4EEYA 3RBEA 1HMVA 2R8KA 4PUOA 4URSA 4J9PA 3OL9A 2RF2A 3MR6A 1BQNB 5D3GB 4G1QB 5I3UB 5KFNA 3I0RA 4KB7A 3MFIA 4MKBA 1IKVA 3IRXB 5KFPA 1RTDA 4IRKA 1C1BA 5KG2A 1JLQA 4IRCA 4ECQA 4R0EA 2WRMA 4HYKA 1HYSA 4WE1A 1XR5A 4LQ9A 1DTTB 4EO6A 1HQUB 1TKTA 4WZQA 3RBDA 4ZHRA 3T1AA 4WFXA 2AGQA 3QO9B 4XPCA 5KG1A 3M9MB 2OPQB 3JSMB 4ZPAA 4IH7A 5F9NA 2D3UA 1HPZB 2AU0A 3C6TB 3I5BA 4WZMA 1HQEB 5HBMB 3TQ1A 1N5YA 2B5JB 1XR6A 4IG3B 2W9CB 4ECTA 1SV5A 2IM2A 3DLEB 1HARA 1TKXB 2UUWA 2ZE2B 2JLEA 3CJ3A 4ZPDA 1T03B 1JLGA 1VRUB 3DLKB 2W8LA 4JUZA 1LWFA 4K4UA 1JLCA 4NLTA 4F4ZA 5L9XA 3KK2A 5KFWA 1C0TB 3CJ4A 2IC3A 5EWEA 4J9MA 2WONB 1XR7A 4ZPCA 3V6KA 3DRSB 5HLFB 4RNMA 1S6QB 4J9NA 2IM3A 4KBIA 4IQXA 4Q44A 2IM1A 2BE2B 5KT7A 4O4GB 2JC1A 3KLIB 3KK1B 1JLBA 3KJVA 3RB0A 4IG0B 3QGGA 1S10A 3LP1B 3T19A 2IAJB 2HNZB 3KLGA 4F4WA 2IBKA 4K50A 3GV5B 4YR2A 2VA2A 3KHRA 2RKIB 3H2LA 1BQNA 5D3GA 4G1QA 5I3UA 5DLGA 4PWDB 1REVB 3BGRB 1LW2B 3HHKA 4TXSA 2XCPA 2XCAA 3KHGA 4RW8B 3BSCA 4KHRA 4TN2A 5DQIA 4Y2AA 5KFMA 1RT1B 5F8HA 2FVRA 5C5JA 2HWHA 3N6LA 4RW6B 5KFGA 1DTTA 2R2RA 1HQUA 4NCGB 3QIDA 3MFHA 2D7SA 4ECWA 2JEJA 5F8IA 1TL1B 3QZ7A 1SH0A 5F8NA 3QO9A 3V4IB 2OPQA 3JSMA 4O3OA 1S97A 3G6XA 3CO9A 2VG7B 1HPZA 4LSNB 3FFIB 3EPIA 3C6TA 4MKAA 5L1KA 3GILA 3T5JA 3IGVA 5HBMA 3BSOA 4IR9A 2BQ3A 3GIMA 4ZMMA 2B5JA 4XO0A 4H54A 4IG3A 5KFIA 5DGBA 3FRZA 4RNNA 3Q8QB 2W9CA 4ECUA 4ED1A 3DLEA 1TKXA 4KSEB 4RZRA 2ZE2A 1T03A 3NL0A 1RTJB 3HVTB 1VRUA 3DLKA 3BSAA 3G86A 1RT5B 4ED0A 3I0SB 4MK8A 3GYNA 1C0TA 1S1WB 2CKWA 1DLOB 3DRPB 3V6DB 5C42B 4ZP9A 1Z4UA 2W7PA 5KG5A 1IKXB 4U6PA 2YNHA 3GIJA 4I7FB 3LP2B 3EPGA 2AGPA 3JYTB 3DRSA 3KLFB 5HLFA 4YR0A 5DLFA 1S6QA 3RB4A 3NBPB 3GIIA 2BE2A 5KFVA 3PJWA 4O4GA 2ATLA 1RT7B 1S48A 3ICLA 3KLIA 3M8QB 4H4OB 3KK1A 1RT4B 4ZP6A 1D0EA 3OLAA 4IG0A 3M9NB 3GIKA 4IRDA 4NRUA 5KG7A 3LP1A 1S1XB 2C2EA 2IAJA 2HNZA 2WOMB 3N6NA 3MEDB 2IJNA 2QE5A 5EWFA 4MK9A 1U09A 1LWEB 2RKIA 5J2NB 4I2PB 3CJ2A 4PWDA 1REVA 2YNFB 1LW2A 2ZD1B 3BGRA 4J9LA 2JEIA 3QGHA 4RW8A 3DYAB 5KFUA 2AX0A 4J9KA 4ECZA 4K4VA 2JC0A 4KO0B 1R0AB 4RNFA 1RYSA 3UDLA 4GC7A 4O3QA 3V6JA 3D28A 3NKYA 1GX5A 2B6AB 3MR3A 2R8GA 3ISND 1JLFB 4RW6A 4URGA 5KFOA 4NCGA 4H4MB 2FJVA 3QGIA 3HVAA 1TL1A 2WK4A 1S6PB 5CYMB 2V0NA 3V4IA 5KFXA 2C28A 3PW5A 2R8JA 2BQUA 3OHBA 4URQU 2VG7A 4LSNA 3FFIA 4MFBB 2HNDB 4XPEA 3FQKA 1TL3B 2R2SA 2AX1A 2FVQA 4WFZA 3IG1B 4NLRA 4Q43A 2W7OA 5DGAA 3KMSA 4IKAA 4ED8A 3QYYA 4I2QB 2CJQA 3V81B 1D1UA 3RAQA 3LP0B 3KLHA 4IFYB 4QWBA 1RTJA 3HVTA 4ICLB 2C2RA 4J9QA 4NLDA 1RT5A 3I0SA 5C24B 3G6VA 1S1WA 1DLOA 3DRPA 3V6DA 5C42A 2ILZA 2OPPB 1IKXA 1LWCB 4I7FA 3LP2A 1NHVA 4TQRA 3JYTA 2XWYA 3KLFA 3NBPA
chains in the Genus database with same CATH superfamily
2BJ8A 1JX4A 3K58A 3M8QA 4EUVA 2AW0A 1ZPWX 1T8EA 2VFUA 3ZZRA 1LWEA 4PQAA 4I2PA 4KH1B 3CDBA 4W4MA 3C6UB 5T7LB 3DLHA 3W60A 1S79A 1FI4A 3W8GA 3TJ9A 5DM6Q 4MFBA 3ILOA 1EETB 4KHMA 3MPYA 3BYPA 3VHQA 3W63A 2O66A 4TQSA 1BMQB 4K0KF 2QYGA 1VQ6S 1CJTA 1CJUA 1KSPA 2Q6CA 3OJSA 3R5AA 1M0SA 2RUGA 1CULB 4HT5A 2A3JA 2RU3A 5A0YB 2WHOA 4ED3A 2J0SD 3RTVA 4PQUB 2BZ2A 4KE5A 1VCTA 1T05A 4UTGA 1ZPVA 1VQPS 3DDIA 3M8PB 3BV8A 5KAKA 2RIJA 1IKYA 2CPHA 2V4QA 2HZVA 4J9SA 5HP1A 4DV1J 2CQ2A 1X31C 4KV8A 1VJWA 2BKOA 3TW0A 4NZ7A 2WAQD 2DBBA 3QFWA 2M5YA 1WNEA 1FKOB 1SVDA 4Y00A 1VQLS 4ZJLA 3FRYA 2QL5B 4NXMF 2ZH1A 4RW4A 3R8YA 3BO4A 1RT3A 3DOLA 3MF5A 1CJVA 2GVDB 3IS9B 2KZMA 3DU6A 1NK0A 2P9GA 4O44B 1T9UA 2FLLA 4YP3A 2YBVA 2DR5A 3QRQA 3CO0P 1T94A 3BS9A 2GJIA 3JQKA 5KFSA 2P8IA 1X4BA 1NUEA 3ENAA 2Y0BB 1JXEA 3PKMA 2CQHA 1PG5B 3M2VA 5IT4A 4R8UA 1NBEB 1TKZA 3KUGA 3FEXB 4DL0C 3KNAA 3J7AN 4QWCA 5LJ5Y 2EFOA 2KXFA 2E1RA 2W4DA 5C2GA 1WACA 2CPXA 3G6YA 4FBTA 4UOHA 2RDIA 4CIOA 1K73T 2DH7A 1B0VA 3OL8A 1ZM3A 4DFMA 4UQTA 1R8CA 1NJYA 3KG0A 1K1SA 2M3DA 3RGIA 4X4VA 4DS4A 3DGVA 3BO2A 4ZJOA 2I2YA 4TU7A 4LFAF 1RTDA 2XULA 4L73A 1C1BA 4F2SA 1KQKA 1HHTP 2HBQB 1HQUB 1FDNA 1RGVA 2AGQA 1Q8BA 2KRBA 2ZH7A 1PILA 4C3LA 3M9MB 1IJEB 4DR3J 1HQEB 5HBMB 4PPZA 2PMZD 4AQYF 4K2XA 2NZCA 1HKAA 4JI8J 2R3VA 2J8SA 3SSSA 1SB6A 4M5KA 1FNOA 4FYWB 3O5TB 4ZPCA 3M6WA 1S6QB 2IM1A 3GP9A 2EKYA 4L3NA 4KJIA 3R7BB 3TX0A 4WTYA 3M8SA 1E6VB 5E3PA 3AOAA 2XCAA 2K2PA 2BOPA 1SC6A 1YZ6A 1RAHB 2HHTA 2F7VA 1WC0A 1NM2A 4OI0A 3EPIA 3M1VA 2G0JA 4ZIVA 1YDLA 2E5JA 3HO1A 4X62F 3G71S 2W9CA 5J1NA 3NS6A 1DY3A 3AQPA 2W2PP 1LQ9A 2K1RA 3DRPB 3CJQA 2VDHA 3IWXA 5ADZA 3RB4A 1SL0A 1NHKL 5KFVA 4O4GA 4RBUA 4DX5A 4JI0J 3OLAA 3GIKA 4OX9F 2C2EA 3R3TA 5EX0A 2GJ2A 4ELUA 1X4FA 3MR3A 2YWKA 2IIHA 2BM0A 2W4CA 3QYYA 3JTNA 3QRRA 1KTVA 4USKA 2DY1A 1LWCB 2CQGA 2XWYA 4Y3CA 4ALZA 4DPTA 1U26A 4K0KJ 3UD5A 3TOQA 3ZTRA 1MMNA 4WTOB 2DB1A 2UVUA 5T14A 2QMWA 2B6AA 3AHPA 3HPOA 4H4MA 4ZPBA 4KFBB 2B9XA 1TUWA 2J9DA 2BJ7A 2BJ3A 3RAXA 1FXLA 1AXQA 1NU4A 3RRGA 1U6ZA 4XTTA 1WTBA 3MM7B 4A46A 2ABYA 1O5JA 1RT2B 1NCLA 3RYLA 2B4VA 1IBLF 4ECYA 1HNVA 4B3OB 4M5DA 2R4FA 4NYPA 3THPA 1WC4A 4RNHA 5KT2A 3TNVA 1UP1A 2KM8B 3MM5A 4A8WA 1VRTA 3PYEA 4ECXA 3ENWA 4HACA 3IM9A 3L7UA 4LIWA 4NXMJ 5KFAA 4NYZA 1LFPA 2XYPB 2YQ3A 4OI1A 1N6QB 1HNIB 3OR1A 4LQ3A 1JK9B 2WBRA 4Q8EA 4ILLA 2V4RA 2GJFA 5KG3A 1U45A 1S0MA 1BQMB 5DZ6A 2RD5C 1NO8A 3CDWA 1FVQA 3RBZA 1WF2A 2AIRB 3HF5A 3R6LB 4DX8H 3BR9A 2NYIA 2Q6BA 3KJQB 5A6WA 2NREA 1DFDA 5C25A 2Z0GA 1I6JA 2VQEF 1KQGB 4F3OA 3UN3A 2EK6A 2X7IA 4CH1A 3MXHP 3JQMA 4CLLA 2RRNA 4L74A 2HURA 1RHMB 1FJGF 3AAWB 1VK3A 4ES3A 1S9EB 3HKWA 2X1FA 2FJWA 2FC9A 4R5PB 3MR2A 3JS9A 4DSFA 2FLOA 1NEEA 4F3MA 2NS1B 3NGUA 1UTAA 2GX8A 4LREA 3HXMA 2DXDA 3HFZB 3Q8UA 3ZTPA 3T9NA 3L4BC 4LMZA 5J2QA 5KFZA 1WI6A 4WKRA 3BBCA 4L3KA 4LFAJ 2KI2A 1SXLA 4ZHRB 3CD6S 3FKBA 4ZVEA 2J6TA 2JVOA 4EO8A 1KFDA 4U7UK 2KO1A 1KQSR 1J5EF 3CCWA 5HROA 2E5GA 3PX0A 3FQLA 4AQYJ 4OZ0A 4M5LA 1CVJA 3U7JA 1OSDA 2DPIA 4B9MA 1NPPA 4EEYA 3J7A1 2C1EB 3OL9A 3ZZZA 1IKVA 4ZLJA 5KFPA 1K0VA 1AA1B 1OY6A 2HEKA 1IBMF 2R7XA 3JSBA 2ZUGA 1HWKA 4JI5F 4DFJA 4M5NA 4XPCA 1I94F 3TUIC 1SC3B 3I5BA 2H5IB 4PEOA 1VC6A 2QA4S 4K4UA 1LWFA 4C8OA 3KWMA 2MKKA 4OX8A 1LNQA 4CM0A 1NJXA 4U95A 4X62J 2DO0A 1XJWB 1JB0C 3J81Y 3KJVA 3LGNA 3SSRA 2XM3A 4DWIA 1R7IA 5EX3A 2H51B 5E7OB 3EPGA 3DRYA 2J9DE 1VBXA 4OX9J 2V50A 1E6YA 3AFGA 4NCGB 5HATA 2QN6B 4O3OA 2KFYA 4NA2A 3T5JA 4PG6A 1APSA 2ALYB 3Q8QB 2HFNA 3PV8A 1Z2ZA 3DU5A 1S1WB 4WU3A 1VQKS 2A6MA 4U6PA 3D1QA 3LP2B 4YR0A 5HLFA 3PO5A 3MM8B 3ZTQA 2XLJA 4ZVUB 1RT4B 5K9FA 2B51A 2RS8A 4ZOSA 5KG7A 1XMQF 1X5PA 3RG6A 1PO6A 5J2NB 2IVFB 3BBFA 4DV3F 2JEIA 3M6UA 5KFUA 2QLFB 4J9KA 3LGHA 4A8FA 2XO7A 1U2CA 4O3QA 5L9NA 3DXSX 1S6PB 5CYMB 1VRQC 3TUZC 5A2QY 4N5SA 1KVKA 5L46A 3P5TL 4I2QB 4FDFA 6FDRA 3M7VA 4P72A 1RBOB 2N82B 4I7FA 1NHVA 5B0DA 2FZKB 3FZ2A 4F02A 3TAQA 2ASLA 2KTQA 2HWIA 1IKWB 4TU9A 3OLBA 3U1MA 1IBLJ 1O6XA 4USTA 3C66A 1B7YB 3PIOQ 1KTQA 3UD3P 2BE7D 1JLFA 2MZRA 3QT6A 4C48A 2VFTA 4ETXA 1VC5A 3HMJG 4NLUA 1S4FA 3H4DA 4KGVB 1ZTWA 1G3OA 3N0VA 2V8PA 1RAFB 4RW7B 3LTOA 3CC7S 3D9BA 2R7TA 2RMLA 3DRRB 1M5OC 5KFFA 2YNIA 3C8YA 3BQ0A 3F73A 2C42A 4HTJA 4OHVA 1HWLA 1G2EA 3GPAA 3AD8C 2HFSA 2XZWA 4OYMA 1MU2A 4KHPF 3MR7A 4ZPWR 5JXSA 2GC8A 1CQNA 1SIZA 1WC5A 5I42B 3ISNC 2DISA 4DOZA 3PW4A 5CYQB 1X4EA 4DBQA 2GGPB 2HBRB 2VQEJ 3GYGA 1QD1A 2HLUA 4OJ3A 3BO3A 5I4MA 3AJDA 4C8ZA 4F04B 4K2JA 1FJGJ 1BLUA 2BX6A 3BREA 2IVMA 3RZAA 5A8WB 1VISA 1S6UA 2HNYA 2YKOA 4P73A 4B9NA 5G4DA 1X0FA 3BF4A 3HSJA 2OPRB 3TAMB 4DG1A 2UXBF 2HS4A 3Q22A 5HSPA 3SXLA 4WIQA 1F5BA 1RI7A 1XC9A 5DJBA 1S1TB 1H98A 2IYGA 2IA0A 5DQHA 1FX2A 2DKOB 2VIHA 2FHJA 3NRBA 6FD1A 1GX6A 3L09A 1J5EJ 4J9RA 4Q2MA 3KMQA 2HSEB 1FK9B 4JI3F 1RISA 1KS2A 4F67A 2G1DA 3M32A 5DG8A 3AB2B 1SQEA 2YNGA 3HP6A 2DHHA 1X4GA 1RWOB 3R2DJ 5E0OA 3DM2A 1P6TA 2D9PA 3VQSA 4F0HA 2R7RA 1IBMJ 2QGFB 3KHHA 3OR2A 4JI5J 4DR6F 4J7CA 1I94J 4ZJQA 4FF1A 1JLCB 1R8AA 2Z2ZA 2Q43A 2ZFHA 1FJEB 3KNGA 3Q8PB 4ID5A 4OYBA 1N5TA 4IO1A 3DXBA 2R8KA 3OV7A 1Q5YA 1UL3A 3MMCA 1UVLA 2APOA 2JVRA 2CPFA 2F65A 2LEAA 2K3IA 4B3RF 3IAM9 4HDGA 3VAMA 3W66A 4UF4A 2D3UA 1HPZB 2R7VA 1N5YA 2UV8G 2Z56B 5E41A 2CVEA 4CO0A 5KFWA 2PFDA 2VQFF 2E1MC 5K20B 2VC1A 2BE2B 2NUHA 3KK1B 4RWWA 3LP1B 3ENQA 2ROGA 3VGVA 1FFWB 4O0IA 3H2LA 3HVRA 3HHKA 1C4AA 2LU2A 4RW8B 4KC5A 2VPXB 1EKSA 1KN6A 1XMQJ 3OUYA 5KFGA 4ECWA 4DV3J 1U0HB 5F8JA 3G6XA 3NGTA 1Q81T 4XO0A 2W7AA 3CT9A 1H74A 3L95X 2ZE2A 3IBFB 3BSAA 4DUYF 2HHVA 2EEYA 3DOMB 5DLFA 3SQGA 1RT7B 4AL5A 4NX9A 2L48A 5GVQA 1MWYA 3BN4A 3NS7B 1WKKA 2DH9A 3PYFA 4KO0B 3OTEA 3UDLA 1T9VA 3MAAB 3O3LA 1U2RA 3QGIA 4X4QA 1YBUA 5DDPC 2DEJA 5KFXA 3L3CA 2FVQA 4WFZA 3TUPA 1Q8KA 1TFWA 3F41A 1MROA 3JYTA 2E9TA 4C7QA 3QT7A 1SH2A 4G3IA 1Q1KA 2HQFA 4A8QA 2D41A 3KJNB 3EGVA 2CPIA 2XS2A 2MZJA 4ZS6A 3NOGA 1M5PC 3CJ8A 3MEGB 3CWJA 2I8EA 1BE4A 3ISZA 1TL3A 1RWWB 3H8YA 3UNGC 2E66A 5D4NA 1XMOJ 3BM7A 2O5DA 1FTCA 4C3KA 1N8RT 3AQOA 5SZTA 1T95A 3HFVA 4OJGA 4CCHA 2XMKA 1U6BA 2PD1A 2R7QA 1DTQA 3PDNA 4DQPA 1RB0A 3IS9A 3PW7A 2UXDF 3LALA 4ZDNA 1ZYQA 4K59A 2BANB 1QAJA 3S1TA 1LOUA 1V3RA 1RTHA 5L1IA 1Y3JA 2I9SA 4KKOB 2Y3YA 4GVBB 4E8UA 3GCWP 2GO8A 1DARA 5LMNF 1ZAVA 2UXBJ 4QIFA 2N4DA 2D3ZA 3DLGB 3QATA 1U48A 2B43A 1U0SA 1EIYB 1UWBB 3AY0A 1W2BR 3I5CA 3IWLA 3HZEA 2I5JA 3TX8A 5GADU 4QYZJ 2OPSB 1KEKA 4I56A 5HMWA 5B0GA 2VJUA 4OHWA 3IXQA 4J91A 4JI3J 5CD4A 3I82A 1C0UA 2OD4A 3EXCX 1A0OB 1CS4B 1R6YA 2ZDPA 4ID8A 2DNHA 5DDRC 2B7CB 3VV2B 4LVOP 1PGZA 3SYZA 1TMJA 4WFBQ 4DV4F 4LF6J 4CO1A 4A47A 2R7UA 2XZTB 2HAFA 1KVJA 1FRMA 1K47A 4HL9A 2DVIA 4P71A 3MTKA 3IP0A 3H42A 4ZCLA 4KGKA 4HHUA 4UOGA 1F3FA 1J2VA 3JTOA 4CH0S 2XS5A 2ADCA 3BH7B 1JMTA 2JZ5A 4YB6A 4CZCA 1HQEA 4A4JA 1KKHA 3G82A 4DL7A 4M5HA 5EUHA 4CT9A 3MEEA 4CQ1A 5D0GA 2BUNA 2WVEA 1S9GB 1VQYA 4CLWA 4BS2A 3WIVA 2VL1A 4DPOA 1AFJA 2V6AA 4KPYA 2DITA 3BJYA 3VGSA 1WSVA 3I31A 4DR1J 4DR7J 2CA9A 4PUOA 4CT8A 2VQFJ 1RAEB 1BQNB 5KFNA 4F25A 3I0RA 4KB7A 2M70A 1F1BB 1FVSA 1R3NA 3J7YU 2LXFA 1JLQA 4ATNA 1Q79A 3CD5A 3ILLA 1I3OB 5A6PA 3GMGA 2XY7A 3AJ2A 2Z8QA 2OGUA 3EUNA 4IG3B 1X4CA 1HARA 7AT1B 2UUWA 3D1OA 2JLEA 2KL8A 1D8ZA 2DCLA 5L9XA 5F0WA 4J9MA 4Y2MA 2RUSA 3DRSB 1N5QA 3MM9A 2QEXS 2J8AA 3RB0A 1IR1A 4DUYJ 3CJRA 4YOEA 4F4WA 2ZBCA 2D69A 1XNRF 5F8HA 4DUZF 4RW6B 1N54B 1DTTA 4X4UA 3GYXB 3CJKB 2OPQA 4XDDA 1S97A 4LSNB 3FFIB 2HFVA 4DR2F 2VICA 4RZRA 2CPZA 2QYCA 1RT5B 4ED0A 2VOPA 2HIQA 5E5NA 4F8RA 1UJ5A 1DLOB 1SQFA 4N8OA 3KLFB 2RE1A 1TL7B 4ECRA 3M8QB 4U7UD 2CJYB 2QE5A 1LWEB 4PXDA 4I2PB 3ELHA 4ECZA 4K4VA 4RNFA 2YKPA 1M1HA 2O01C 2F63A 2FJVA 2B4UA 1IBCB 5M2PA 4ZPVR 2C28A 4RWXA 4MFBB 2AX1A 1OQ3A 5ETVA 3I55S 1NK4A 4X4PA 2BKPA 4NLDA 3M05A 1CJTB 5CZXA 1CJUB 2AHOB 2I1RA 5CCLA 1RBLA 1N4LA 2MZTA 3UR0A 3DLJA 1YBAA 3OFGA 2NXCA 1R0BG 5JMNA 4UZCA 1RAOA 2HKEA 2JFDA 3K2YA 3UPFA 1FRKA 1RZMA 1F2GA 1T05B 2U2FA 4OI6A 1N6QA 2ROEA 2DHGA 1PCAA 2XO6A 2UXDJ 3VF0B 1IKYB 3IG1A 1WEXA 2CQDA 5HP1B 4E2FB 4HT7A 3BKFA 4KV8B 4CDIA 3CC2S 4EYIB 3CVKA 3OPKA 3Q2TC 4LBHA 3K8WA 1BXNA 5LMNJ 2F5GA 1FWKA 4IR1A 3QFHA 2NQPA 4UW2A 1IM6A 4RW4B 2GQCA 2ZH8A 3KOAA 1RT3B 3DOLB 5E3AA 3PXGa 4DPWA 3BPSP 1CJVB 3ADAC 5B7WA 4F36A 4KTQA 3BYRA 3WBZA 1N52B 3M9OB 2DR9A 2FYXA 2J7UA 2RJZA 3R9LA 2R9LA 5HQLA 3EDRB 4FYYB 3RAMA 2XQCA 3A3NB 1Q0NA 1W7WA 1S1VA 4D3GA 3IR6B 2L9DA 2KFNA 2LECA 2FGCA 2IA6A 3TA2A 2Y1LB 4R8UB 3H2VE 1TKZB 2AF6A 2BR0A 3PYDA 1KOHA 4QWDA 4NLXA 1UCNA 3DCAA 3B4DA 2KFZA 4JI2F 1RLCL 1V5VA 4PXEA 3D0HE 2O67A 2YWHA 4HR2A 2JWNA 5DQGA 3WZ0A 1P1TA 1KBRA 2DD8S 3DNCA 2PGCA 2QRRA 4P2SA 5K8NA 1DQAA 5CD4H 2FLNA 4LRBA 3FNNA 5HVHA 2IM0A 3FCHA 1GFWB 1Y3KA 2CRLA 3IGNA 4LSZB 4E0DA 4JI7J 3R5GA 3HSGA 3IR5B 1VMBA 1NSQA 4BC9A 4FS1A 1UJ6A 2BJ9A 2FJDB 5ITHA 1AUSL 3NNHA 1RTDB 1C1BB 1FJ7A 2QSWA 4TY9A 1HHSA 3PW2A 3CD7A 4HKQA 1TAUA 2AMCB 4GKKF 2CVIA 4GVLA 4PR6A 4BWMA 4RO0A 2BDPA 4DV0F 2QT7A 1XEZA 3K57A 2GIRA 2DNQA 1LXJA 1FFSB 3GCXP 3PO4A 3Q23A 4O3NA 3RW6A 3LA0A 3OBIA 1VJQA 2DCUB 1GQEA 4A48A 1YKWA 3D66A 4IRCA 1LKZA 3N4WA 1VYAA 4HYKA 3QQCD 1TKTA 1BQXA 1XNRJ 3X3UA 3NCPA 4DUZJ 3M1VB 1S77D 1U6FA 2W9CB 3MPUB 1SV5A 4V1Ak 2KHCA 2ZC4A 3JSRA 1JJ2R 2ZVSA 3O8WA 1WWHA 2K1RB 3CJ4A 4DR2J 2WVBA 1FDAA 4IO9Q 2VZ9A 5DDOC 3CD0A 4O4GB 3HZGA 1JLBA 3QGGA 2HFZA 4N41A 5AE2A 2XLIA 3X1LB 1D09B 2HWHA 1Q7LB 3C14A 2N3LA 1BC6A 1HR0J 1VFJA 3HX9A 2XLKA 1TFYA 1ZAXA 2K3KA 3AH6A 2QA2A 2A0FB 4LFCF 1Y4ZB 4KGZB 1SJQA 6AT1B 3W9JA 5GMDA 4B9TA 4PYDA 1JXVA 1VQ7S 1IWAA 3HM9A 1X7VA 1FDDA 2U1AA 2Z2MA 1Q4RA 1R8PA 3TP2A 2AP6A 4USHA 3J7Z5 2MKHA 1M1KT 1FO1A 3KXDA 4PWDA 3QGHA 4HI1A 1HNWF 2WSEC 2B6AB 2CQBA 3L9ZA 3UDCA 1YGYA 4H4MB 3FSXA 3M2RA 3IRWP 1SC4B 4LT6A 3MDFA 4QOTA 5DZ7A 3G6VA 1EHWA 1TTHB 4OHXA 4MIAA 1HNVB 4FKXA 1K1QA 3CJSA 3LANA 4M5DB 2WOMA 1P9YA 4C0BA 2JEGA 4JYAF 2FVPA 2ZD1A 2XB2D 4DPUA 1CPZA 5IOLA 1R0AA 1TAQA 5HQMA 3MM5B 4ZN3A 3O6QA 1VRTB 3FCWA 4OHYA 4CLSA 4WYLA 1OIAA 4HACB 3M30A 3HULA 4C0OC 2ASYA 2HNDA 2ZH5A 4LR9A 4FYDA 1Y10A 3BB5A 3V81A 2DGTA 1S4EA 2VFRA 2HQ3A 3OR1B 1IVZA 1KOOA 2OPPA 5LSLA 1Q78A 3CIMA 1FHTA 3QBCA 3ZNUA 1YQHA 1EP4A 2DGQA 2CQ3A 1D9DA 3TAMA 1YWXA 4ED6A 4Z7CA 3W9HA 4DL3A 2MQPA 3DI6B 1RCXB 2FD2A 4ZLNA 4TY8A 5GAHI 1L5UA 3FVYA 2VHGA 5HJYA 4CM2A 5C25B 1NHUA 3BH6B 2AEFA 4YEAA 4K4ZA 5AXNA 1ICEB 1QE1A 4CNZA 4YQWA 3IM8A 2OUGA 4DL2A 4JI2J 4I6AA 1KHVA 1NAQA 3OQ2A 3NCQA 1KLMA 1RU2A 4EBDA 3MMAA 3Q89A 1NRKA 3W5XA 1H7WA 2MZQA 4DPYA 2HMIA 2OP5A 4PG5A 1FRIA 5KFTA 5D4PA 5J2QB 2C2ZB 1UZHA 4DLGA 2YH0A 2UUTA 4NOHA 3EZUA 4CI0B 5KFYA 3RR8A 4Y6IA 4OX6A 4AE5A 1HIYA 1O0PA 4Y2KA 1FEHA 4X65F 2NUUG 3JB9k 1RHKB 3VQTA 4WF9Q 3DKDA 5HROB 2KVQE 2ZZNA 4KQZA 2VPZB 1U1LA 2BXJA 5DDQC 4GKKJ 3HSZA 4DV0J 2HGLA 3IN5A 2OAUA 1J5OA 5ETPA 2F1FA 2IRYA 2B0GA 1PC5A 4U7CA 3ZZOA 3D5MA 1IKVB 4DLEA 4Y65A 1NMEB 2B8QA 4QWEA 3VAJA 2KRRA 2P6TA 5HMXA 5MLCV 2MLXA 5HL7Q 4RR5A 4KR0B 5GMKa 2UZAA 3W2WA 3M8RA 3CCTA 1LWFB 1UJ4A 2LA6A 3RRHA 3SEOA 2DNGA 3MM6A 4S0MA 4ZK7M 2BABA 1GEHA 1U24A 3KJVB 2VFSA 1SJRA 1HMVA 2WBMA 5EN1A 3MR6A 2AJ0A 4LF8F 2ZH6A 1SPBP 5KG2A 4BLGA 3LO3A 1U1NA 4R0EA 1HD0A 1E6YB 1HYSA 1XR5A 2PI5A 2XBPA 5IC4B 3MZIA 4USJC 1JWWA 1D8YA 2PFFB 2AJFE 1NSPA 2QLWA 1H2TZ 3M4XA 1NPKA 3VAHA 4LFCJ 4FKYA 4X4NA 2KDOA 5HLFB 3UFCX 2CZVC 3UCZP 1X9SA 3CNQP 3MMBA 3GFXA 1AYEA 1XMBA 1SL2A 4ZVTB 2CJKA 1P1LA 3FBBA 4G1QA 4UOCA 1ZS6A 1G7CB 1X5TA 2OELA 3PNIA 3FBEA 1SIWB 1PKUA 3HHNB 4C8KA 3T9ZA 2DHAA 3QZ7A 1HNWJ 3TJ8A 3LQVA 5L1KA 1YJVA 4CNYA 2OLWA 4GMKA 3DLEA 4ED1A 4W92B 4LR8A 1SBRA 3NEKA 3G8SA 4YDXA 1X9MA 2MLZA 2AGPA 4I7FB 4K5RA 2HHSA 3QJLA 3KLIA 4IG0A 5CYJA 2IJNA 4EZ6A 1U09A 1NH8A 1PAUB 3HI9A 1WF1A 3BGRA 2CDRB 2AX0A 2IBOA 1WORA 1JLFB 4JYAJ 1OJ4A 4JI1F 4B17A 4C0HA 3QWPA 5M2UA 3AD9C 3HVTA 3I0SA 1FDBA 4QR2A 1F9EB 4XDCA 2B4PA 1F0XA 5KFRA 3PW0A 1RUSA 3N79A 2OIHA 2KB2A 3BGLA 3MGJA 2KH9A 1U49A 3EVOA 2YNIB 2VF3A 5GMEA 1DRZA 3AD7C 1RHRB 1D3WA 1MU2B 2E1CA 3I4PA 3GJSB 4OZ2A 1VIXA 4NZ0A 2YTCA 2OD6A 1DURA 1AZSA 2M7SA 4IOCQ 3K5NA 4V19J 2H65B 1UFLA 1QSYA 1KFSA 4IFYA 4OYPA 4LVNP 3H90A 2DNKA 2GHWA 3UDEA 1NK9A 5CHCB 2XNRA 1UWBA 4C8NA 4X66F 3GQCA 3DGPA 2HS3A 4OL8A 3T6JA 2YWWA 4A8YA 4UY85 2VG5A 3LPEA 2Y1RI 4CLZA 4FBUA 2YKAA 4ANDA 2IJFA 2IDLA 2F4VJ 2HNYB 1UPPA 1G4CA 4DSKA 2OEMA 2D1CA 4ZPTR 3CCES 4DG1B 3N9UC 4Q7AA 1HBMA 1N56A 2ZKTA 3I6PA 4FF2A 4B3SF 5C7PA 3EGNA 2KU7A 1O51A 2LQJA 2XYHB 2A2CA 1EZZB 2VG6A 4FS2A 1KLNA 4HI2A 4NLVA 5C2CA 4X65J 3D0IE 4X2BA 2QA1A 3SCJE 4Q5VA 1TV6B 3OJUA 1QJHA 2FIUA 2IHR1 4NASA 2HLTA 3I9V9 1DQ9A 3M32B 2KXHA 2HGNA 3D7SB 3DOKA 4DSEA 4QZVB 2YNGB 4BCAA 1S9GA 2GA7A 3DM2B 1RQ0A 1MSWD 2AJQA 1M90T 1MWQA 1IM4A 3AOBA 4P2MA 4WIIA 3OR2B 3Q24A 3KLEA 1FNMA 5ETQA 2QLXA 1KVIA 2DK2A 2MSTA 4ZIWA 4ID5B 1KQFB 3AA9A 4ES1A 2MHNA 3RU0A 1NK6A 1TP7A 4MMOA 5EHHA 2B7BB 3MMCB 2D9OA 4K4TA 1GXLA 4LF9J 1YJ9S 4ZLLA 2PEBA 3JTPA 5IWAF 2WVCA 4LF8J 5GAEI 4FXWA 3LAMA 2FQQB 1WF0A 1TUGB 8RUCA 2A10A 2G4BA 3D0GE 4DU8A 5M2RA 4FXDA 1T9YA 1N5YB 3HT0A 4DUTA 1VLYA 1L3SA 5HN0A 5B0BA 1FKPA 1CEZA 4B08A 1NKBA 4DF8A 3D1HA 4ECQA 3OUYB 5G0RA 4WE1A 4LQ9A 4OZ5A 5KG1A 5LXYA 3R2CJ 3TAPA 2GZOA 4CLYA 1HWUA 5AE1A 1CLFA 2ZE2B 1RHJB 1WKLA 2W8LA 3DN9A 1Z1ZA 2RRAA 3C46A 5A8KA 1ROFA 3MD1A 2IM3A 1XWLA 3SQGB 4Q44A 2YY3A 3FC9A 3VZHA 2XMUA 1IN0A 5DRKA 1DBDA 1S10A 1UZDA 1ACMB 2IRUA 1RAGB 3U1NA 1FFGB 1PYOB 1RT1B 2VFVA 1Y5NB 2N7YA 1HI8A 2NXJA 4F7VA 1F6TA 3JSMA 3CO9A 2BACA 3BSOA 4QYRA 4H54A 4JI1J 3V2UC 1FA0A 2JRSA 1T03A 3EYZA 1QVGR 2PDAA 1JNRB 1IXKA 4DR5F 1MROB 3JYTB 3HJVA 5U47A 3K17A 4OLOA 9ATCB 2HNZA 2BOAA 4NWBA 4EI2A 2DH8A 1REVA 4BBYA 4BDPA 2R8GA 2V8GA 4W90B 1B3TA 4WU2A 1VR6A 3TVYA 2LXIA 1TL3B 4Q43A 4NEYA 2HGMA 3CMAS 4M5GA 4FNHA 2WB1D 2C3PA 4WWSA 2Y0SD 2DRBA 3CJ3A 4FPRA 1NZ8A 4JB8B 1BHNA 2YWGA 1VQMS 3LWMA 5F8LA 2PMHA 1F60B 2DY9A 5D6GA 1DTQB 5DO2A 1RAIB 4X66J 2QFJA 1RAJA 2QTWA 3M2UA 4TYAA 3P3DA 2GV1A 2V63A 3ETOA 2HAIA 5L8RC 5JJBA 2VU5A 1RTHB 3PM9A 4NMXA 4YB7A 4A8OA 2VH7A 5DS7A 2XSJA 4F4YA 1PYSB 2R8HA 1T3NA 3CJ5A 3QLHA 1YVFA 2V94A 1IUJA 1PJ7A 2B8PA 2P6SA 4USVA 4B3SJ 1WUUA 2JSXA 3VAGA 1NPRA 2YKNA 4NCBA 3C2PA 3Q8RB 4GO7X 2FJXA 2AYEA 4CTAA 1YHQS 3AODA 2DGWA 4CWBA 5K8MA 2J7KA 2I5JB 1V5IB 5J2PA 1RA6A 5HQ8A 1VIOA 2DR8A 2AYGA 1YJTA 3DC2A 1EQMA 2HFUA 4P7VA 3ZZ0A 2J6UA 4B9LA 2MZSA 4LF7F 4I1TA 2ZJQQ 4OMFG 4O4RA 1FE4A 1C0UB 1DAXA 5LXRA 2MQMA 4BWJA 4WBFA 1FE0A 2RT3A 2LLZA 1S5ZA 2W2NP 1GTHA 3WC0A 3PZPA 3FMWA 2H4WB 2IVYA 4ZVFA 2ZBQA 1VQNS 5KG6A 1FJCA 4EBEA 4XAKA 3E01A 4RUCA 1OSCA 4JV0A 4Z7YA 3G82B 2DO4A 1NK5A 4NLSA 4B3MF 2XMJA 3MEEB 3OT9A 4RUAA 1F5CA 1AW0A 2AV5A 3R5DA 3CDEA 5IWAJ 1LK7A 2FLPA 4ITSA 3W3SA 1KRPA 3W9IA 1M5HA 2MKYA 4I64A 2AGOA 1Q8LA 2ZWOA 4PUOB 3ZFVA 2W9BA 1MWZA 1RHQB 3I0RB 2ZDOA 3N6MA 1JLQB 5KT6A 2DTJA 3HCXA 4ILMA 3HJFA 5RUBA 5KFBA 2OO4A 3F44A 1UW4A 2C2KB 2FZCB 3MECA 5D4LA 4MH8A 1TVRA 4PABA 3OL7A 1FF2A 2EFQA 4Q8FA 4QW9A 1LFWA 2Z57B 1ZM4A 2LEBA 5ETMA 3MM9B 4YFUA 1C1CB 3QWUA 2V68A 2XS7A 4WK1A 4URSA 4HEA9 1XN9A 3N28A 3QGPA 3QJJA 2YQ1A 4QCLA 4I6WA 3IRXB 2MSSA 3WC2A 5T41A 8AT1B 1DTTB 4DPXA 4MYTA 3FMBA 2I0XA 3UW1A 2OPQB 2V8HA 1YG0A 4ZPAA 2HHXA 3GTYX 4N56A 3SV3A 2PIIA 1XR6A 3JAMU 4QJVA 5KOWA 3K59A 4ZPDA 5D0HA 4ETZA 3MCSA 4RUHA 5BYQA 5LL6d 2NYHA 2HZAA 5L38A 2IBKA 3GV5B 4FYXB 1OY8A 4DR5J 4DCOB 2G0IA 1SKUB 3PRBA 5LSRA 1Q53A 4K5SA 4DU7A 3C16A 5KFMA 3KUEA 4I0WA 2KT2A 3GB0A 4UOFA 3MFHA 1ZM9A 3P8BB 1TK5A 4NPOA 1ZH5A 3NNAA 3GILA 3KYLA 4F3QA 3OTDA 4ECUA 4RNNA 1AB8A 3VGUA 4IQMA 2VBWA 3DLKA 3I4HX 5IC6B 4MK8A 1C0TA 1P27B 3BR8A 2OKQA 5IT9U 4CLUA 3J7YI 2W24A 2UUAF 3O1LA 3PTWA 2JFKA 1REGX 2CAJA 2FHKA 2DIVA 4YHHF 3BGOP 3KDOA 3OTBA 4GC7A 2QZ8A 2RSQA 3O2IA 2MKJA 2XMMA 4A8SA 1UAWA 4NMLA 3IFEA 2R8JA 1RWKB 4PG8A 3OHBA 1MN9A 1HBNA 3IG1B 4NLRA 1WOOA 4ZVRB 4C8YA 2N7CA 3ONQA 1RTJA 2C2RA 3V6DA 3DLLQ 1VHIA 4ZLPA 3WIUA 2W8KA 3CCRS 2L08A 1S1XA 3DI6A 2OEJA 4ANCA 5KT5A 4DL6A 4CYUA 2AWZA 2MYFA 1TMMA 2YNFA 4PRFA 2RRBA 2Q66A 3MAQA 3KTQA 2EBGA 2EG1A 2CPYA 2LVWA 3FUYA 1AT1B 1WHVA 1PJ5A 2SXLA 1UA0A 1WHYA 4DDFA 2JOQA 4QIEA 1KR4A 4Q45A 3LP0A 4IH6A 3MPVA 2ZHBA 3CIZA 1V3SA 2EI5A 1NB7A 5JVGQ 4KH0B 2RQKA 3HHLD 2DHSA 4ED2A 1KONA 3KLHB 1S1VB 1IBKF 1GMWA 4F50A 4ELVA 4X84A 2CNOB 4WYWA 5HI7A 1ITPA 3A13A 1R31A 4K4WA 4WZQA 3SFUA 4F4KA 2E1AA 2C3OA 2LMIA 2ILYA 2K7KA 2H54B 3MUVP 3G4SS 4QPTA 2CQ0A 3R6GB 1RHUB 2CADA 2X3DA 2ZWPA 5F3ZA 1WOSA 1RP5A 4YMEA 5FLXU 2EFVA 4P52A 3K0JA 3D6FB 1WOPA 4U8YA 1OS5A 3OTCA 4FVMA 2RNEA 4B3MJ 1MLAA 1B4SA 3EGZA 4DV5F 2MB0B 1VQSA 3I96A 5KFQA 2VASA 2ZBRA 1SUQA 1TK8A 1FRJA 2BV3A 1RK8A 1H38A 2EFGA 4JOUA 3DDKA 3ZO7A 4GRSA 2R42A 2ERRA 2J9EA 2GAGC 4MYUA 1N5SA 3DLBA 3TEGA 2DNRA 2GHVC 4EZ9A 3J80U 3PEJA 2PN6A 4ZA1A 1B7FA 4CLTA 1XK8A 3MUTP 4DI6A 2BEFA 2CWXA 1S7HA 4GC6A 1LK5A 2HRYA 1S6OA 3PR5B 1L3VA 1YTYA 1QY7A 3BPDA 5FDLA 4RJVA 1TKTB 1NB2A 2O3DA 4IOBA 1JXLA 4DEZA 2KKHA 3ITHA 4MKYA 2NSBA 4J37A 1SV5B 2BE9B 2LP4A 1KHWA 2JL9A 4N77A 4DXLA 2E9ZA 2PEHA 1TELA 5J1EA 4ELTA 2KT5A 4UT4A 3LPYA 1JLBB 2A2DA 3PJXA 3PHEA 3RBEA 4J9UE 2NPFA 3R27A 4OHZA 2QFIA 2X51A 1Y0HA 3G9CA 2GQQA 2RHSB 5AE3A 2DR6A 3C14B 3RBDA 3UO0A 4DV1F 2ZJRQ 1PIEA 3IC1A 3H2UB 1UW9A 3GSDA 1EAYC 2LCWA 1T02A 5IT0A 2XG8A 3UNYA 4F4AA 4IQXA 4DQRA 3OD2A 5B09A 3HFKA 2YX4A 3VTIA 3U1LA 3KHRA 2YX1A 4PWDB 3SMZA 4ZVSB 2UUAJ 3BSCA 1VQ5S 2DJWA 3ZZYA 1XQIA 2FVRA 2PMWA 4AYBD 3SCIE 1B64A 2R2RA 3OTOF 4PYAA 2D7SA 3TYTA 4YHHJ 2X1AA 4OYOA 3M2RB 3CTRA 4IR9A 4RBTA 2B5JA 2DNLA 2CXEA 5DGBA 3IR7B 2DIUA 4O23A 5AXLA 4RPFA 4Q2LA 4ZP6A 4NRUA 2WOMB 4DF4A 2LU1A 4PG4A 2P9EA 1WC3A 4MK9A 4F26A 2ZD1B 4EWTA 3NGKA 2MGZA 1T0TV 2KHDA 1R0AB 5GAGI 3ISND 5KFOA 1TL1A 3M30B 3V4IA 3K5OA 2HNDB 3NG8A 4C8MA 4FPIA 4H4KA 4HVZA 4ED8A 5JVHQ 2P2CB 3V81B 3I87A 3GFHA 5LM7E 1YJNS 2XEXA 3VZIA 3RUBL 4C6AA 2OPPB 3LW5C 3R5BA 1N34F 1S49A 3LOUA 5H9EK 2BRKA 1FX4A 4QW8A 2BJDA 1EP4B 3OVAA 2ZOFA 1IBKJ 1U4BA 4PKDB 4TY8B 3DDNA 2N3OA 1Q16B 4HLBA 1WKJA 2JEFA 2RB7A 3A8KA 2Q3PA 4DR3F 3GSIA 2EBEA 5FIIA 3CCMS 4RNOA 5LOQA 4JI8F 2WCXA 5C24A 1QE1B 5E3RA 2MKIA 4DQIA 4LSLA 2XC9A 1TV6A 4ZP8A 3SI8A 3BQ1A 4DCJB 2RQ4A 5J1PA 1KLMB 2M52A 2EFPA 3MMAB 1U02A 3MCOA 3NS5A 4J9OA 1ZAWA 3LGMA 1N5VA 4PCQA 5F8GA 1ZTTA 2Y1JA 3PYGA 4NLGA 4M5IA 2HMIB 4DV5J 2I38A 3IAS9 5AJ3F 3ET6A 2X1GA 3V4MA 4DN0A 4HTIA 1NNDA 1CQMA 3NY0A 1X9WA 3IBWA 4MIWA 1RACB 1V9OA 1BGXT 5BR8F 1RKIA 4RX6A 1U2FA 1F9FA 2YQ0A 5E33A 1R8HA 4NE9C 1SKSA 2G2ZA 2DNMA 5LMUF 1KC8T 3G96A 4NLQA 1FRLA 3LAKA 4JV2A 2R2UA 3G8TA 3WHIA 3B8HA 2GMLA 1J5OB 3CDUA 1B70B 3PKYA 4M1KA 1YK9A 2Z2LA 3JQJA 1YBTA 2DRDA 2PA8D 3P49B 2WB4A 1RTIA 4M95A 3L7OA 3GIRA 5IM0A 4DV7F 2XGPA 2WW8A 1X4HA 5CH7B 3JXOA 4NXNF 1MNEA 3CCLS 4WP9A 4WP3A 3W2WB 5CZVA 1FD8A 2L3MA 4H4KC 1NLKL 3MM6B 1XNQF 1GXTA 2H5EA 1HMVB 2IMWP 2ASDA 2W2QP 3WX8A 3Q8VA 3Q83A 4CLPA 2ZHOA 3CCUS 1FTRA 1HYSB 1PBAA 1U1PA 4RW9A 2ZITA 2R8IA 1RT6A 1OY9A 3F0NA 4MJKA 2Y9HA 3K8VA 1RADB 5H9EJ 1J27A 3GFZA 4QU6A 2WVDA 1SKRA 3U02A 3TO8A 4Y28C 3RB3A 1LW0A 4NLWA 1CC7A 1RT1A 1NKEA 2FHJD 3MMBB 4RLEA 1RDRA 3SDEA 2W9AA 1JJ4A 3PY8A 2RF2A 1HI0P 4G1QB 1M5SA 3MFIA 1S59A 1UEVA 5D4OA 5FD1A 4AL6A 3WDOA 4JV5F 2FPHX 1KD1T 1HW8A 2E5HA 2RHQB 1M5KC 4BC7A 3OTOJ 3DLEB 3D68A 4F4ZA 2RQCA 2IC3A 3GU0A 1RWVB 1B99A 4KBIA 2ZH9A 3KLIB 4IG0B 3R7NB 1HW9A 3NGSA 5F3TA 1N32F 2Z4PA 5I3UA 5A8RA 3BGRB 2C3YA 4TXSA 3GG0A 2W25A 4TN2A 5DQIA 5CAAA 2DNYA 1FXDA 3Q8YA 4KHPJ 2OEKA 2VUGA 4P2FA 3C6TA 1GAOA 2G0CA 3NGRA 2BQ3A 4DCPB 4DS5A 2MQNA 1T3OA 1W2IA 3P4UB 4JI4F 4L76A 3S6EA 3HVTB 1VRUA 2F40A 4I6YA 3BGUA 3I0SB 3GYNA 4USMA 1X5SA 2PA3A 4HH0A 2UUBF 2MJNA 3M9NB 2K8GA 2NLWA 2IAJA 3N6NA 3M6VA 1VQ4S 1LW2A 4FNIA 3BKUA 2NXEA 1N34J 4MTPA 3IA0A 3D67A 2EC2A 4DV6F 2Y1IA 2V4JA 2QJ3A 1PAEX 4ZCIA 1AZSB 2ZJPQ 2HIYA 1LXNA 4F0KA 3RAQA 3PFOA 5SUHA 4IFYB 4QWBA 3FEZA 1T7PA 1YJ7A 2VPYB 3VAIA 2J76E 5IQQA 4JP8A 3NBPA 1S12A 3DGPB 3MEDA 3TA0A 3TZYA 2YNHB 5KFHA 4QQBA 2VG5B 1U8SA 1R0CB 2CQCA 5IV3A 4X4RA 4OJHA 1X8DA 4DV2F 1UPMB 2FJBB 3RBXA 4O3RA 1HBMB 2F9DA 1H2UX 5AJ3J 4ICLA 3UN5A 3NWRA 3UD4P 3R1HA 4DR6J 3TVZA 2GS8A 4NLPA 3I5AA 4ZVPB 1N88A 2GAHC 2VG6B 4LF5F 2PT0A 5KFEA 1UVNA 5BR8J 4FF4A 3MTJA 5ETTA 4AD6A 1VQ9S 2LEPA 2EFNA 3KLVA 2XWXA 2MJUA 5LMUJ 4Q0BA 1QVFR 4C97A 3NAHA 2JLFA 3RRKA 3DFEA 3DOKB 2V2ZA 4HDHA 2LYVA 1V3ZA 4B3RJ 4TLQA 2FUG9 5THWA 2GVZA 4ZVGA 2XY6A 4Z2XA 2JDJA 3QIPA 3OFFA 5LSOA 2XMAA 2MQOA 4U67Q 5GAHU 3KLEB 4LF2A 3HHLA 2OMLA 3GJQB 4DV7J 2RU9A 1QAIA 3CC4S 1X5OA 4NXNJ 3BN7A 3KJFB 1K9MT 5AXKA 2CPDA 4J90A 2LKZA 4WFYA 2RDDA 5KTQA 1LEOA 2MY8A 1XNQJ 2F3JA 4P6QA 2UXCF 5E2QA 4B02A 2QL7B 3C15A 1GK8A 3A12A 1CSJA 3NWGA 3DMJA 1D9AA 2CJ9A 3FK4A 4BHQA 2QC3A 1VOMA 4C2MA 2RS2A 1C1CA 3H5SA 2IY5B 2QV6A 1YSJA 1RCOB 4I68A 2BRLA 7FDRA 4M94A 3IRXA 1UWAA 2GMHA 2OMOA 2IFXA 2OTLS 3D6TB 2HHHF 1FKPB 4ZVOB 4F2RA 5H1SV 2V2VA 4OYAA 3PR4A 3D54A 3RW7A 2M8DB 2CPEA 5EDWA 5A76A 5G0RB 4WE1B 2XTJP 2ZM6F 5JUMA 5ETSA 3K5MA 4A8KA 3GV7B 4O3SA 5F0UA 2V5HG 2ZBPA 4JV5J 4CO3A 2ZHAA 4O0NA 1QTMA 5A8KB 3HVWA 2C2DA 2L9WA 1JLEA 4QPXA 1ULRA 5CABA 4ED4A 2VOOA 3CJTA 1FKAF 1CG2A 2G9OA 4J5OA 5ETNA 2YPZA 1N32J 4G1PA 4OZ1A 3T3FA 7FD1A 3CMES 2JNJA 2J0WA 3JSMB 5B0EA 4IH7A 5ETRA 2BVZA 2LXUA 4OI3A 4P74A 4ECTA 4CRJA 2RVJA 1MG7A 1U1MA 1T03B 1JLGA 3UI3A 1RTZA 1GH8A 4R25A 1NJZA 1NDLA 2QMUB 4JI4J 1Q8IA 4LRAA 3EMTA 2HNZB 3TARA 3DRXA 4K50A 3W7BA 2XYGB 5D3GA 5DLGA 1REVB 1EB0A 2UUBJ 3HHLC 2V67A 3QRPA 2ZNZA 4CO2A 1GMVA 3VAKA 1U1RA 4NI2A 2K06A 3IGVA 4ZMMA 3T5HA 3FRZA 4DV6J 2JX2A 2D3OR 4N8NA 1TKXA 2COLA 3PFEA 4AT1B 4CH7A 3NL0A 3BDPA 2G2YA 2MKSA 2VV5A 3GIIA 4TKTA 2V2QA 4DSJA 4U96A 1UA1A 1VBYA 3CCSS 4UQGA 2HRTA 2JC0A 3THVA 2QO3A 3D28A 3NKYA 3M2UB 3B4MA 3QT8A 2D74B 2CJAA 2W1BA 1N36F 4TU8A 1Y9OA 1GTEA 3W65A 4C11A 2BQUA 4URQU 3CCJS 3TR5A 4P9SA 3KMSA 2CJQA 2GIFA 1D1UA 3KLHA 4DX6A 4B9UA 2PC6A 4CO4A 2DR7A 3FCVA 1HWJA 4DV2J 4ZN1A 2XSJB 5C42A 2ILZA 3TEHB 1ZZNA 2G2OA 2N4CA 3QLHB 4DV4J 4ANEA 4H4OA 3QZ8A 1PJ6A 3MR5A 3HLUA 5KG4A 2MZ1A 2YKNB 4CTAB 3R7SB 4LF5J 3VCDA 5J2PB 1P9QC 2F8HA 1VDHA 4JV1A 1VI7A 5E3QA 1RYRA 2MDAA 3R1LA 3EZOA 4OIXA 2HQIA 2E9RX 4QBUA 4KPCA 3TWZA 3P6YC 2XGQA 4OFZA 1BWEA 1ZZFA 3V5RA 5HK4A 2HQGA 1OPIA 3J81j 3BQ2A 2ZKUA 4KY3A 5KT3A 4ZVHA 2RILA 2ZZTA 4YUDA 1N33F 5LJ3Y 3H25A 1SI9A 4R0JA 1CJKA 3FZBA 3VR1A 4NRTA 1X4AA 2DNZA 1JKHA 4NA1A 3MWBA 4G1IA 1TUVA 2AEMA 2RAQA 1DJ0A 2EG2A 2FHOB 4NYOA 3E01B 2CZ9A 4D3HA 4F4XA 3Q8SB 5J2MA 2FZGB 5HO4A 4IDKB 3KFWX 2B9EA 1EX8A 4ED7A 2E1PA 3OVSA 2G13A 2UXCJ 1RAAB 2HYIB 4KIAA 3PCOB 3MPWA 2V69A 2AQ4A 4ILRA 4Z37A 3QNWB 1RU1A 4TNOA 4X4SA 5HMZA 1RA7A 5B0FA 1WSRA 2B9WA 2KJWA 1VLOA 1X0PA 4IFVA 4ECSA 2W9BB 1JLAA 3FBFA 2VDIA 3PG9A 3OSPA 2CUYA 1V6HA 2FVCA 1WI8A 5D0RA 2QIFA 2HHHJ 1H7XA 4WJBA 3H5UA 4MKVA 1C4CA 1NZAA 4RUBA 3MECB 2J6SA 4IH5A 1QAXA 2ZM6J 1TVRB 2MTLA 4OV1A 2R7WA 2W2MP 1NDPA 4PWUA 3KK3A 3CUNA 2OFGX 2RDJA 2XSFA 1HWIA 3SQOP 4YDDB 4LR7A 4KAIA 3HSDA 3K5LA 4EYHB 1SCJB 1SJ4P 3T1YF 1XMOF 4OI2A 4C9DA 3TUJC 2VJVA 2YKMA 1FNXH 1I5OB 5K14A 5F9LA 1H0HB 4RU9A 3RB6A 1S1UA 5D78A 1EJ7L 3RR7A 3W2VA 1HBUA 3F56A 3T6BA 5GAEU 1L3UA 2HHPA 2MLYA 3C16B 1QTNB 1WC1A 1Z2LA 4P75A 4MAKA 2XMWA 1NDCA 3T1AA 4WFXA 1OQ6A 4EU0A 5F9NA 1Y11A 4WZMA 1CBKA 2BYCA 2IM2A 3AT1B 3Q2SC 1NJWA 4AXJA 3DLKB 4NLTA 2W01A 3KK2A 1C0TB 5EWEA 3NXZA 4ERDA 4J9NA 2M9KA 5KT7A 4ES2A 2KYXA 4I4BA 3KLGA 3SCKE 4DFPA 4YR2A 4YB5A 1HL6A 2XCPA 1DQ8A 2AJ4A 3D4JA 4LIRA 3S8SA 5C5JA 2BW2A 1PBUA 3MPDA 4CP5A 1SH0A 5F8NA 2PSZA 3QO9A 3DHXA 3NNCA 1HBNB 2DNPA 1N36J 1TL5A 2OI2A 2VODA 1RTJB 1PYTA 4LF6F 2CKWA 3V6DB 2YXLA 4C4WA 1T9XA 3POTB 2ZH2A 1WG4A 3D3BJ 4U8VA 3G2XA 2FB0A 4IRDA 1S1XB 4CYUB 4FXVA 2RKIA 1HA1A 1AROP 2YNFB 2CJBA 1SJFA 4C3MA 1LWXA 2FY1A 1RYSA 3E8OA 4N7TA 1HBOA 3HVAA 2CG4A 2VG7A 4XPEA 4Y0FA 4B9VA 2VB6A 2HBYB 3UVJA 3MHYA 3LP0B 2ZC3A 3L7PA 4LRCA 1A9NB 3TZWA 1IKXA 3QAEA 2HRUA 1SKWA 1GMUA 1URNA 2D3O1 2HWTA 1RLDA 3QSYB 4DR1F 1QUPA 4DR7F 4CO5A 2A18A 3DYAA 2JLGA 1N33J 3H7HB 2OH2A 4MT1A 4YB1P 1TQLA 2IJRA 3KHLA 1RE1B 2F8EX 4FZVA 5HJXA 4ZP7A 4C98A 4FN5A 1AFIA 3MAHA 3WQPA 5KFKA 1SC1B 4QYZK 4ZCMA 1WC6A 2V2KA 2XY5A 5HVGA 4RL1A 2M0GB 5IZHA 1B0TA 3ZXWA 3TRGA 1DZ5A 1VHFA 4X4OA 2L41A 2VBZA 4GKJF 2HHQA 1WJ9A 1ZM2A 3G87A 3C6UA 3M8YA 5T7LA 5HMYA 2AT1B 2WVFA 2HZCA 2QX0A 1SUQB 2J5AA 4DQSA 1W25A 2EWHA 1H2VZ 4OLPA 1EETA 3BDEA 4IYQA 2J7WA 3UCGA 4V19X 3D2WA 3GONA 1JIHA 3LH2S 2LDYA 1CULA 1WELA 4P7TA 2RQMA 5A0YA 8ATCB 2VA3A 4PQUA 3H4BA 2BA9A 4P10A 2CJXB 3JAMY 1SJ1A 3D3CJ 4LJMA 4EBCA 1IJFB 2Q79A 3M8PA 3OL6A 5ETOA 2OFHX 1QM9A 1I1GA 3GV8B 3I9ZA 5FDLB 2NZ4A 1VGYA 3W8PA 2VD3A 2OHDA 2PE8A 2UV8A 3H5YA 3NAIA 1N48A 3LF0A 3ITHB 2FTRA 4M5JA 5CXTA 2DPJA 2UU9F 2XMTA 4L75A 3T1YJ 1TZ0A 2VKRA 3MCNA 1TK0A 1JNZB 1RKJA 1FKOA 3W5ZA 1RWNB 2H9ZA 3AA8A 5J1EB 4UUXA 2NXUA 4DL5A 3Q86A 3VVUA 1BD6A 3IBCB 3MD3A 4JBCA 1UKUA 1R6VA 1UVKA 2E7XA 1KDNA 2C22A 1HQ2A 2GVDA 1R8BA 5IT9Y 2B3TB 3C3LA 3FSIA 4IOAQ 2Z2YB 4O44A 4NA3A 3CULA 3SBMA 2V34A 4EK2A 5HANA 1VC0A 3BBBA 2JJ4D 3EICA 1QSLA 2KG0A 3NCRA 4MIBA 3A8IA 3M8WA 1QSSA 4W98A 4X4TA 2E5LF 3R97A 4IRKA 1RSCA 1YLXA 2X3GA 2BKNA 4M63A 3A1YG 3TANA 2LFVA 3GE9A 2HS0A 2LQ5A 5AT1B 2OSRA 2J0QD 4ZKAA 3TQ1A 4FF3A 1M1GA 2QA4G 2B5JB 4LRFA 2UUCF 2CQ4A 1YITS 3HT3A 3SIPB 2DT9A 2A6OA 3CW2C 4IUFA 2WONB 1XR7A 3PJ9A 1N0VC 4DSIA 4QU7A 4PZVA 4A8XA 4Y2IA 1RBAA 3G8QA 2MY7A 4A8MP 1RWXB 2EKNA 2HQDA 2QLBB 4OZLA 2MGZB 2LQ8A 2FJAB 3MOZA 1HQUA 3QIDA 3QPIA 2JEJA 3IMQJ 1TL1B 1NJIT 2BJ1A 3V4IB 3K89A 2RH3A 2CWKA 5HBMA 1YZ7A 3PHTA 3HK2A 2P9CA 1RJJA 1HNZF 2NXNA 1WHWA 2YNHA 3GIJA 4DSLA 1S6QA 1FESA 2J0XA 4JI7F 1S48A 3ICLA 2LDIA 3KHGA 3A8EA 2X1BA 3BGFA 2HFOA 1E6VA 3PX4A 3ULHA 4J9LA 5FLXY 2HQCA 2YWFA 2FDNA 2E7WA 2LQ9A 1FWLA 5CQGA 3CEDA 3AB4B 2ZNYA 5MAOA 1MW7A 2HK3A 1S57A 2R2SA 3T41A 5B08A 1B0PA 3OXFA 4DQQA 2C2NA 2ZVIA 2HHUA 1U1KA 4EFAC 5C24B 3DRPA 2GNKA 2YVSA 2MEWA 1U8WA 4LSLB 3OFEA 3BSNA 2MMYA 4ECVA 1HNXF 4TLRA 1F3VA 2KN4A 4WPAA 2CYYA 3CCVS 4GKJJ 1YJWS 3J80Y 4X64F 2E44A 2MKCA 3ET6B 5D15A 3H40A 3NP5A 3S01A 3C19A 3J81U 1H72C 1H73A 3A3PB 1Y7PA 2EW9A 2EC0A 1K8AT 1LWCA 2NR0A 1F2HA 4L6V3 4DMZA 4Y34A 3HHDA 4PXCA 1G1XA 3AOCA 1WEYA 2V8VA 3IWNC 5DG9A 2XZDB 3NLCA 4DJBA 3GZ7A 2GIQA 2ALZA 3M8ZA 2BQRA 3A8JA 4KFBA 3T1HF 5KT4A 1HR0F 2V9WA 5IXUA 3MM7A 1IR2A 4RKUC 1RTIB 1DHMA 3P45B 1F5AA 2GW8A 4MK7A 4FYVB 4DZDA 1RT2A 5IM0B 4TVAB 1F9HA 4B3OA 2UVVA 1ZETA 4O3PA 4OZJA 4WFNQ 2ZOGA 3R5JB 1NSKL 5A2QU 2OSQA 5KFLA 5K8PA 2UU9J 3I56S 4DR4F 1NK7A 1I51B 4DL4A 3PACA 4YR3A 5FJ4A 1ZOTA 3R5CA 4L72B 5CA5A 3FGVA 3N5BA 3EGWB 1T9WA 4AFFA 4XK8C 2GHPA 3HD1A 4LF4F 2R7OA 3B78A 1VBKA 3CMQA 4EGLA 1HNIA 4RW9B 2CDQA 3S7RA 3QSIA 4LFBF 5I3PA 1HHQA 4PWWA 3DHWC 1VQOS 1RT6B 3GWCA 2AD9A 2WW4A 2PI4A 5B0CA 3PEHA 1BQMA 2ASJA 3OHAA 1LW0B 2FVSA 2XMVA 3ILIA 3MOJB 1UETA 3SDEB 1YJRA 1D9FA 3B54A 2ROPA 2IRXA 2RF2B 4WXWA 1SH3A 2CZ4A 2AZ1A 2E5LJ 1Q5VA 4K4YA 2CNNB 3O44A 1WDDA 3PVXA 2CNKB 3VGTA 1ZA1B 2CG8A 1A6LA 2L9NA 3AXKA 2XHCA 3H98A 4K4XA 2HPUA 3NGDA 3FSYA 1UEKA 3M6XA 2M8HA 4ER8A 1S9EA 1YRUA 3GJTB 2IC3B 1UFWA 4R5PA 4FVCA 3TI0A 2UUCJ 4I69A 3CXCR 2UVWA 3CJ0A 1Y5IB 2V8DA 1WEZA 2WZ1A 5I3UB 5A8RB 3MMJA 4MKBA 1M5VC 4DX7A 2DGUA 3M2VB 1YJUA 3GR1A 3UN2A 1U1OA 1R27B 4OI4A 4EO6A 1EKRA 5HAOA 4ZHRA 1YI2S 1WHXA 5ETLA 3C6TB 3UE2A 1FD2A 2XNQA 2QL9B 2ADBA 2W2OP 3Q0AA 1VRUB 2C3MA 4OYIA 2ACYA 3V6KA 4HHJA 1QLNA 3EWGA 2OJ3A 2JC1A 1HNZJ 4PPDA 1H3DA 2IAJB 2EVZA 3VVTA 2VA2A 2DYAA 2QMXA 4OYXA 1LW2B 4KHRA 2Y8YA 1IQTA 3GG1A 4C8LA 2QLJB 4QR0A 3CE8A 5F8IA 2V4JB 2POKA 1WG1A 2KM8C 4OV6A 3GIMA 1YIJS 1O8BA 1HI1A 4KSEB 5E3CA 3G86A 2B56A 2DXFA 1NXIA 5F41A 4XIUA 1Z4UA 4KT0C 3NBPB 3ZZPA 2ATLA 2CQPA 2AKWB 5EGYA 4KRWA 2HVZA 2LQBA 4CLKA 3MEDB 4B9SA 4OX7A 2IPOB 3QJPA 2FY8A 4WKYA 5ETKA 1W26A 1GX5A 4RBVA 1HNXJ 1TR0A 4NCGA 3SCLE 2WK4A 2C2OB 3FJ2A 4ZITA 2CQ1A 1UEUA 1FCAA 3FQKA 1Q7YT 2BW7A 4E98A 2IMOA 3D6HB 4OQJA 1S99A 3B82A 4X64J 4ICLB 2AYMA 4K7QA 1S1WA 3QAUA 1Q82T 2ZH3A 1URRA 3LP2A 5GAGU 2WSCC 3MM8A 1IR0A 1KWMA 3CGIA 4U9RA 2EXUA 3RJMB 1RT4A 1U25A 1ZA2B 3D6MB 3GJRB 2Z30B 3PIPQ 4CLFA 3FEYB 5J2NA 5EWGA 1NKCA 4USIA 3CB4A 2YH1A 2E5IA 2KVIA 5L1LA 3UQSA 3SZ2A 4IDKA 2MHEA 4K8RA 4OYWA 1T9TA 2H5JB 4Q0BB 3OVBA 1S6PA 5CYMA 2F8MA 2F4FA 4QIWD 3OXGA 1OYEA 4I2QA 3T1HJ 1Y5LB 2HW3A 3KDNA 2GVZB 2M2BA 2ACMA 2GMJA 5B0AA 3QIPB 2NSCA 2UP1A 1FRXA 4LF1A 1QUVA 3HHLB 2B4OA 1IKWA 1UFKA 2DGVA 3GR0A 2MXYA 2YWEA 4YN3B 2XI3A 1RXOB 2FGOA 2FJEB 4DN9A 4UZBA 3ILJA 1TL4A 3QT5A 4QWAA 4DR4J 3THTA 2H4YB 2C3UA 2F9JA 2UVRA 4G65A 1SJ3P 3C15B 3P5BP 4LF4J 2CIMA 3DMJB 1VS3A 2GO9A 2ZH4A 3IO1A 5GADI 4B3TF 3MEKA 4RW7A 3A3OB 1PC4A 2KJVA 2YX7A 3OXLA 3DRRA 4LFBJ 4YS2A 3CCQS 1X4DA 3B6BA 1SL1A 3US5A 3MURP 1S76D 2W4PA 1RABB 2BBEA 2NPIA 2B9YA 2FHMA 5I42A 1MMLA 3NMAA 1R89A 3EDQB 5CYQA 1UVMA 2DHXA 2GGPA 3TJAA 4I67A 2AZ3A 4WCEQ 3ZTSA 4N76A 3A4TA 2HVHA 3MUMP 5KFCA 3TA1A 5HVFA 2HG4A 2R2TA 2KZZA 5LT5A 1JLEB 5A8WA 1WTFA 4USWA 3G6ES 2ZBIA 3P96A 1S0NA 2OPRA 3T5LA 2DXEA 4FP9A 5IS2A 3ZZUA 2M4MA 2ZOMA 4WP8A 5KG0A 1X60A 4ED5A 1S1TA 2H1YA 5L1JA 3BZQA 4NLYA 3EZ5A 1S0OA 2CPJA 1WDTA 2WTFA 1JLGB 3EM1A 1TU0B 2XI2A 5F8MA 3GFYA 1UMJA 2MPUA 2P5VA 3ENVA 1SQGA 4Y2CA 3H5XA 5BXIA 1FK9A 1FT8A 5D3GB 2BMBA 2F4VF 2VBYA 1IQZA 2EPIA 4N47A 5IV4A 1L3TA 3J7ZT 3SV4A 1VBZA 4NI2B 4LBPA 2AU0A 2PO4A 3OW2R 3POTA 4RU2A 4JI6F 1TKXB 5KOXA 4JUZA 1JLCA 2H48B 1Y00A 4J9VA 4RNMA 5CCMA 1K44A 4NL5A 5K5MA 2G1HA 3T19A 1S7IA 3CDAA 2KXNB 3ETMA 1FEEA 3QMQA 1JJHA 5DETA 4Y2AA 3VALA 4WFAQ 2QG9B 2KG1A 3N6LA 2CQIA 4YY3F 1P8GA 3TQEA 1XERA 4C11B 1HPZA 3CPWR 2AYBA 1UVJA 4MKAA 5DM7Q 4LF7J 3ZZTA 3U27A 1H6KX 4OZNA 2J9CA 4HHHA 1YX2A 1NDKA 5H9FK 2W7PA 5C42B 5KG5A 2I6WA 1IWGA 2GQ2A 1RWUA 2LA4A 2BE2A 2V9KA 4H4OB 3KK1A 4QR1A 2DGSA 1D0EA 3MI7X 3LP1A 3N01A 1EQ0A 2DRAA 4RW8A 3MCMA 3TZXA 3V6JA 4URGA 4LF9F 4EMDA 4LRDA 1NH7A 2V0NA 1XIQA 3PW5A 1U0HA 2DEIA 4ZVQB 2W7OA 2HBZB 2HVEA 3W62A 5D8HB 4WK3A 3ZNJ1 3HHEA 2H3EB 4G6VB 2VONA 3WX4A 3DOMA 1RT7A 3PRVA 2MQQA 1OWXA 4DHVA 3OSNA 3VWSA 2XHWA 3GLJA 1CJKB 1AUDA 4QIVA 1JKHB 3FDSA 1OPZA 4KO0A 3MAAA 4PXBA 1T11A 5J2MB 1N0UA 2Y8WA 2YKQA 4WXOA 3E2EA 2GCFA 4TYBA 3PX6A 3V6HA 2M88A 4B3TJ 4NLOA 3PRDA 1BUXA 3K7RA 3W5YA 1FRHA 1QDUB 3EVWA 2ZEJA 3W61A 4IFVB 4KGXB 2KT3A 4AL7A 5I3QA 4DFKA 3TVKA 1JLAB 3UDVA 4GO5X 3ZTOA 3MEGA 2O1PA 5D0EA 4OZ3A 2ZUAA 4P2XA 4LBIA 4KYZA 4NZ6A 3OFHA 1R43A 2DGOA 3LUYA 1C2PA 2DNNA 3SFGA 2HHWA 1YRXA 2GFFA 3EXYA 2MQLA 2JHEA 1FXRA 1QAYA 2OTJS 4M8LA 3KG1A 1GMWD 4OYZA 3KK3B 2AJ1A 1BY9A 4AXIA 3TZZA 1OMSA 2AJ2A 3K5PA 2ZZMA 2AEJA 5BYSA 2BANA 1OO0B 3CF5Q 2IYIA 2HK2A 4KGMA 5KFDA 4KKOA 5IQ6A 4GVBA 1KP6A 3N5FA 2BM1A 5H9FJ 1LV5A 1U47A 3HD2A 3DLGA 3HDSA 5KFJA 2YKMB 3E3XA 2Z58B 5K14B 5D77A 1GT8A 1S1UB 5DG7A 1U1QA 1JJCB 1MMDA 3W2VB 2WSFC 2K7JA 1HBUB 1WG5A 3I32A 2VC0A 1OYDA 2OPSA 1VK8A 3UR3C 4USUA 3VAFA 1S9FA 2NCKL 2IDEA 3T5KA 1CS4A 4F0MA 2MQ8A 2DNOA 1EARA 2WONA 4K4SA 2A1BA 2FC8A 1FWPA 1XTZA 3ZC4A 3E51A 1MN7A 2C2MB 4AUKA 4NCAA 3KK2B 1NK8A 3H59A 2VPWB 1HD1A 4JI6J 3BEGB 1HLWA 1GXUA 5AXMA 4PAAA 3EVMA 3AXMA 3KLGB 4J9PA 1YRTA 3BKTA 1S72S 2Q1LA 3UWTA 3UCUP 2WRMA 2VBXA 2BJEA 3QO9B 2E7VA 1BWVA 3LWLA 3W64A 4DZ6A 4YY3J 9RUBA 4ZCKA 5IFMA 3JSYA 1FERA 4PG7A 3KUHA 1GNKA 1XBWA 1U7LA 4QIGA 2R7SA 1CC8A 3AJ1A 1Q95G 5K8OA 3H0PA 2ATCB 4NEZA 3EX7B 4M5MA 2RKIB 2CNLB 1BQNA 2JH3A 3KKFA 1ZBTA 1UVIA 5BYRA 5BJRA 1HBOB 2DGXA 2VG7B 1KNZA 3CCZA 1G6BA 1PSDA 3UVJB 4IG3A 1RWMB 5KFIA 3KG4A 3W1YC 3HKZD 2YPYA 4ZP9A 1L3KA 1IKXB 2KYZA 3DRSA 4OJ1A 3SSQA 2CFXA 4HH1A 3PJWA 1HFEL 1VQ8S 1WD6A 3NMRA 2HVDA 2EK1A 3EE3A 5EWFA 4LUBA 1K0TA 3CJ2A 3FBCA 2VKZG 3DYAB 1Q86T 4ENOA 2QSFA 1ELOA 1RWPB 3H20A 4RW6A 1NSAA 2HVIA 5L39A 2E29A 1TKDA 3CSKA 1A7GE 3CJKA 3NOCA 4LSNA 3FFIA 4UY8T 5DGAA 4IKAA 1JQGA 3EJMA 4JI0F 4J9QA 1S0VA 1RT5A 1DLOA 4UUWA 4TQRA 3KLFA 1TL7A
chains in the Genus database with same CATH topology
3QAEA 1JX4A 2HRUA 1SKWA 2I1RA 2W8KA 3K58A 3M8QA 5CCLA 1URNA 4EUVA 2AW0A 3CCRS 1N4LA 2L08A 1ZPWX 1S1XA 2MZTA 3DI6A 3UR0A 2HWTA 5KT5A 4DL6A 3DLJA 1YBAA 2VFUA 1QUPA 3OFGA 3ZZRA 4DR1F 2AWZA 1LWEA 2MYFA 4PQAA 2A18A 4CO5A 4DR7F 4I2PA 4PRFA 2YNFA 3DYAA 2JLGA 3CDBA 3C6UB 2JFDA 3K2YA 5T7LB 3UPFA 1FRKA 2RRBA 3DLHA 2OH2A 2Q66A 1F2GA 1T05B 1S79A 4YB1P 3MAQA 3KTQA 1TQLA 2U2FA 2EBGA 1N6QA 2EG1A 4OI6A 3KHLA 2CPYA 2LVWA 2ROEA 2F8EX 1WHVA 2DHGA 4FZVA 2SXLA 1UA0A 1WHYA 4ZP7A 4C98A 5DM6Q 4FN5A 1AFIA 4MFBA 4DDFA 3VF0B 1IKYB 3MAHA 1EETB 4KHMA 3IG1A 2JOQA 3MPYA 1WEXA 2CQDA 4QIEA 5KFKA 1KR4A 4Q45A 3LP0A 5HP1B 4IH6A 3MPVA 4HT7A 2O66A 2ZHBA 3CIZA 1V3SA 4TQSA 4K0KF 4KV8B 4ZCMA 3CC2S 1VQ6S 2EI5A 4EYIB 2V2KA 1KSPA 1T8EA 1NB7A 2XY5A 2Q6CA 3OJSA 5JVGQ 3R5AA 2RQKA 3CVKA 3HHLD 2M0GB 2DHSA 1M0SA 3OPKA 5IZHA 1B0TA 1KONA 2RUGA 4ED2A 3KLHB 3Q2TC 3TRGA 1S1VB 1IBKF 1DZ5A 3K8WA 1VHFA 4X4OA 4F50A 2L41A 2VBZA 4HT5A 2A3JA 4ELVA 4GKJF 4X84A 4WYWA 5HI7A 2RU3A 5A0YB 1R31A 2WHOA 4ED3A 4K4WA 2HHQA 2J0SD 3RTVA 4IR1A 4WZQA 3SFUA 4PQUB 1ZM2A 4F4KA 3C6UA 5T7LA 2NQPA 2E1AA 2BZ2A 2C3OA 4UW2A 2LMIA 5HMYA 2ILYA 2K7KA 4KE5A 2HZCA 1T05A 1ZPVA 3MUVP 4RW4B 2GQCA 1SUQB 1VQPS 2J5AA 3M8PB 3G4SS 4DQSA 2ZH8A 3KOAA 1RT3B 5KAKA 3DOLB 1W25A 5E3AA 2EWHA 3PXGa 4QPTA 1H2VZ 2CQ0A 4OLPA 5B7WA 2RIJA 1IKYA 1EETA 2CPHA 2V4QA 3BDEA 4IYQA 4KTQA 4J9SA 2J7WA 3UCGA 3WBZA 1N52B 3M9OB 5HP1A 5F3ZA 2DR9A 2CQ2A 4V19X 1RP5A 2J7UA 2RJZA 4YMEA 3D2WA 4KV8A 2EFVA 3K0JA 2R9LA 1VJWA 3TW0A 4NZ7A 3RAMA 2WAQD 1JIHA 1OS5A 3OTCA 2DBBA 3LH2S 2LDYA 4FVMA 1WELA 1S1VA 2M5YA 2RNEA 3IR6B 2L9DA 4P7TA 4D3GA 1WNEA 1FKOB 2RQMA 4Y00A 2KFNA 2LECA 1VQLS 5A0YA 2FGCA 3EGZA 3FRYA 4DV5F 2MB0B 2VA3A 2IA6A 4PQUA 3H4BA 1VQSA 3I96A 3TA2A 5KFQA 2BA9A 4NXMF 2VASA 2ZH1A 4R8UB 3JAMY 4RW4A 3H2VE 1SJ1A 1TKZB 1SUQA 2AF6A 4LJMA 4EBCA 1IJFB 2BR0A 1TK8A 2Q79A 1FRJA