1SUQB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r185545
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
427
structure length
427
Chain Sequence
b'PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REVERSE TRANSCRIPTASE
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 95
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1suqB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1suqB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1suqB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1suqB03
1HMVB 1ZTTA 4K4TA 3CVKA 1TP7A 3DRPA 5CYMA 1N48A 4RNOA 2OH2A 3DYAA 3KHRA 3V4IB 2IM0A 3NKYA 1WNEA 1S9EA 4O3RA 1YVFA 4J9LA 2C2DA 4K4WA 3MR3A 4EBDA 1W25A 1UWBB 2CJQA 5KFSA 3MFIA 4NLWA 4NLXA 4ZVHA 3LP2A 2FVQA 5CYQB 1FKPA 2YNHA 4Y34A 3E01A 2W8KA 2W9BA 4JV1A 2XWYA 2WHOA 3KK3B 1RTHB 3FFIB 4R5PB 5KFDA 2IBKA 2RKIA 1RT5B 2WK4A 4LQ3A 5DGBA 2FVSA 4IRCA 3KJVA 4DEZA 3JYTB 4MK8A 1S10A 4RW9B 1S0OA 3QGGA 4K4SA 4YR0A 1S1TA 5F8IA 2V0NA 5HP1A 4EO8A 3NBPB 1S1XA 1N5YA 3KHLA 3CJ2A 2E9RX 2IJFA 4NLQA 4J9SA 5J2MA 5I42A 1VRTB 3IG1B 2HNZA 5HP1B 4ED2A 1N5YB 5EWEA 2GIQA 2FVPA 3CO9A 2OPRA 4WFXA 4ID5A 5J2MB 4M95A 4NLSA 5T14A 3RB0A 4RW8B 3QYYA 3KLIA 4U7CA 2IM2A 1BQNB 4H4MB 3BSOA 5C5JA 2W8LA 4G3IA 3KK1A 3KK2A 1TQLA 1TV6B 5KFQA 4DL7A 3DI6B 2WB4A 3Q8QB 2JLEA 1JLGB 4IFVA 2XGQA 1SUQA 3LAMA 1LWCA 5C25A 4QW9A 1IKXA 3T5LA 5J1EB 2J6SA 1RT3A 1RTJB 5KFVA 1MU2B 4O4RA 2RF2A 5DG7A 4IDKA 2B6AA 4IFVB 5C25B 1S9GA 3DDKA 5KT7A 2R2SA 3IN5A 3JSMA 3LALA 4R0EA 3I0SA 2BRKA 4QWDA 5HBMB 2DPIA 1HYSB 4IRKA 4PQUB 4WE1A 4ICLB 2I1RA 4MK9A 2YKNA 1HNVB 4KSEB 4QW8A 1JLAA 3D28A 5KFLA 2WOMA 3GIJA 1SH2A 4O4GB 4PWDA 4WYWA 3MECB 3OLBA 3I5CA 4F4XA 1REVB 3PW4A 2I5JA 1KHVA 5F8GA 2XI2A 1JLCB 1N6QA 3FQLA 3N6NA 2JC0A 5KFOA 3DRSB 4U6PA 2VG5A 3RB6A 2BQRA 2HMIA 1JIHA 1JLFA 3OHAA 4JV0A 1C1CA 1S0MA 4NLGA 2ALZA 2JEGA 3NL0A 2R2TA 1TL1B 3OSNA 1JKHA 5C24A 4Q0BB 4ECQA 1RT4A 2YKMB 1NHUA 1HNIB 2IM3A 3D5MA 4FS1A 1C1BA 4ZVEA 2HWHA 4NLUA 3RB4A 1JKHB 3DOKB 2ASLA 3T5KA 4B3OB 4DL3A 5K14A 2FJXA 1QUVA 2HNDA 5KFRA 2W9CA 3GILA 4RW7A 5KFGA 3G6VA 4TYBA 1SV5A 1K1QA 2BR0A 3I5BA 1RT6A 3CDWA 1J5OA 1RTIB 3KLGA 3PW0A 4KB7A 3CIZA 3BREA 4WXWA 1N4LA 3C6TA 2D41A 5KFCA 3TVKA 3DRRB 3MR2A 1IM4A 1ZETA 1JX4A 3KNAA 3DLGA 1RT1B 1S1UB 2OPPA 5JXSA 4RW4A 3OSPA 3GV7B 2D3UA 3H40A 2B5JA 5KT4A 1DLOB 4KHMA 4IG3A 4ZHRB 3IGNA 4QPXA 1S6QB 4IG0B 4GC7A 3EPIA 3LP0A 1LW0B 2VG7B 1VRUA 4NRUA 2IAJB 2BANB 4JUZA 4MK7A 4KKOB 1DTTA 3OL8A 2WTFA 1DTQB 4F4ZA 2XGPA 2R8JA 3I0RA 4Q45A 2YNGB 1HQUB 4MKAA 4TY8B 5F8MA 3V6JA 1QAJA 2R8GA 1HMVA 2UUWA 5DQHA 3DM2B 1S1VB 4Y3CA 3EPGA 2WRMA 4NLOA 5KG2A 2XCAA 3V4IA 3CDEA 4GC6A 5D3GB 2CKWA 3SFUA 1UWBA 2FVRA 1RAJA 2YNIB 3QO9B 5KG6A 4I2PA 4HYKA 3FDSA 5EWGA 5CYQA 2IC3B 3Q8PB 1BQMB 3PHEA 5KT2A 4YR2A 3PW2A 4ZPBA 3Q8SB 2E9ZA 4QWBA 3KK3A 1RTHA 4I2PB 4O3OA 3ITHB 3MEGB 3GV8B 3FFIA 4ECTA 1S97A 4I7FB 3MF5A 5L1IA 2C2RA 3IS9B 3BQ2A 4R5PA 4ECYA 4KO0B 1RT5A 2YNFB 4RW6B 1TKZB 4ZVGA 5KFPA 3RAQA 4WZQA 2C28A 3V81A 1RDRA 5C42B 2AGOA 3KLHB 3JYTA 4MIAA 4RW9A 3GIIA 2E9TA 2UVVA 4ED8A 3MEEB 1LWEB 4RU9A 3V81B 4O3QA 2FJVA 3M9OB 1IKVB 3NBPA 4ED7A 2R2UA 3QGIA 1VRTA 3H98A 3IG1A 5DLGA 4TYAA 4ED0A 3KLFB 1HPZA 3TAMB 4URGA 4TN2A 3KHHA 4XPEA 4RW8A 2WONB 4KV8B 5HROB 3UQSA 1BQNA 3NGDA 4H4MA 1TL3B 2FLLA 1HPZB 1S1WB 3T19A 3T1AA 3CWJA 2ASDA 3DMJA 4ZPAA 1TV6A 5KFZA 4TQRA 3MR5A 4RUAA 1XR7A 4DL5A 1RYRA 2R2RA 4RNFA 3OLAA 5J2QA 3HKWA 3DI6A 3PR5B 4KFBB 3V6DB 3DMJB 4Q43A 1JLGA 4RZRA 4NZ0A 4X2BA 3OL6A 2W9AA 4QWCA 2GIRA 5J2QB 5J1EA 1KLMB 1RTJA 2JEIA 1MU2A 3H5YA 5KFYA 2UVUA 3PVXA 1CSJA 5F9LA 3E51A 2FLNA 3CDUA 1C0UB 5DQGA 4K4VA 5KG3A 2V9WA 5DGAA 3HVWA 3T5JA 1T3NA 1EETB 1S9FA 5HBMA 2XCPA 1HYSA 4WZMA 4H54A 4G1QA 5KFJA 2DPJA 4PQUA 4ICLA 4Q8FA 3SI8A 2AX1A 3GYNA 2BQ3A 4ECWA 4IH6A 3N6LA 2AGQA 1HNVA 3DLKB 4G1QB 3G6XA 3C6UB 4RUCA 1D1UA 4K4XA 4XPCA 3RBDA 4O4GA 3QLHB 3MECA 3M8PB 4RNHA 1REVA 5L1LA 4WFYA 5KT6A 3OHBA 3BQ0A 1JLCA 4IKAA 4EO6A 2AGPA 3H5XA 5DG8A 3DRSA 3DLEB 1GX6A 3LANA 2ILYA 4ECSA 1JXLA 1IKYB 3M9MB 3BSAA 1RT7B 4MFBB 3CJ0A 1TL1A 1LWFB 4Y2CA 1NHVA 2HNYB 4Q0BA 2YKMA 5KG0A 1HNIA 3KHGA 3GQCA 1S48A 4J9KA 1D0EA 3DOKA 3MR6A 3T5HA 4B3OA 4LSNB 4MIBA 3QIPB 2V4RA 2EC0A 1T03B 5J2NB 1IKWB 2ZE2B 2AQ4A 2UUTA 4ED6A 3IRXA 1HQEB 1RTIA 4KE5A 1TKXB 4QWEA 5KFAA 1OS5A 3RAXA 3DRRA 4FS2A 2WCXA 4J9NA 3RBEA 1RT1A 1S1UA 3IRXB 3CJ4A 3H4DA 2VA2A 3MEDB 5JUMA 2J6TA 1DLOA 5F8JA 1TKTB 3M8QB 4ZHRA 2IM1A 1S6QA 4IG0A 1SH0A 5KG7A 2ZD1B 5F9NA 3FRZA 4O3SA 4EEYA 1LW0A 2VG7A 3NAIA 2IAJA 4ECXA 2BANA 4RNNA 3NMAA 4H4OA 4KKOA 4ZMMA 1S6PB 1DTQA 2IJNA 3KMQA 4LSLB 2YNGA 1HQUA 4TY8A 2JEJA 4EYIB 3DOLB 3HHKA 4H4OB 4O3PA 2OPSB 3DM2A 3H4BA 4NLRA 3BSNA 4QWAA 4K4YA 1S1VA 4PUOB 2F8EX 3BSCA 3G6YA 5KFNA 3PJWA 5KT5A 4ED1A 5I3UB 4OL8A 5DLFA 3ICLA 5D3GA 3QZ8A 1RA7A 4ECZA 2R8KA 4F4WA 1QAIA 1FKOB 3KLVA 2YNIA 3QO9A 1FK9A 2BE2B 1QE1B 1K1SA 2IC3A 1BQMA 5EWFA 1R0AB 2RDJA 4I2QB 1JLEA 4ECRA 1FK9B 3ITHA 3MEGA 1GX5A 4I7FA 2J6UA 3ISND 2OPQB 3IS9A 5KFKA 3TQ1A 2UVRA 4KO0A 2YNFA 1JLEB 3LP1B 4RW6A 3IGVA 1TKZA 3FSIA 3N6MA 3KLEB 4NLVA 5KFUA 1T05B 4O44B 5KT3A 5C42A 4M94A 5KG1A 2UVWA 2HWIA 2IMWP 3KLHA 5F8HA 1JLBB 3QZ7A 3MEEA 1LWEA 5KFWA 1IKVA 3MFHA 2VG6A 1RTDB 4JV2A 3H5UA 1I6JA 1T94A 3HVTA 2VG6B 3KLFA 2B43A 3TAMA 3H59A 4NRTA 4YMEA 5DG9A 4TQSA 4LQ9A 4J9OA 3DRPB 5CYMB 4URSA 5L9XA 2WONA 4KV8A 5HROA 3DYAB 4KHRA 3HVTB 1TL3A 2RDIA 1S9EB 1S1WA 1TVRA 4O3NA 5KG5A 1C0TA 4YQWA 2QV6A 2W7PA 4J9MA 4FBTA 3HVAA 2HAIA 4TLRA 3GIMA 1TVRB 3LP2B 4KFBA 1C0TB 3BGRA 3V6DA 2AX0A 5KFMA 4J9RA 1FKPB 2YNHB 3BJYA 5F8NA 3UR0A 3E01B 3KOAA 2FVCA 2W9BB 1RYSA 1KLMA 4MH8A 3BGRB 1S4FA 3QIDA 4KAIA 2W7OA 2AU0A 3PZPA 1C0UA 4ZPDA 4YP3A 2RKIB 3CJ3A 2GC8A 4ZVFA 1EETA 3KJVB 3Q8RB 1S1TB 2VA3A 4NYZA 1S1XB 3DLKA 1U09A 1XR5A 5KFHA 3C6UA 1S0NA 5I42B 1LW2A 1HARA 4WXOA 2HNZB 3BR9A 3QLHA 2AWZA 2BRLA 4IOBA 4J9QA 4ZP9A 3M8PA 2C22A 4K4UA 2OPRB 4ID5B 4J9PA 1LW2B 4IRDA 3KLIB 2O5DA 4TY9A 4TXSA 3DLEA 4ZP7A 2ASJA 3KK1B 4NLYA 3KK2B 2FJWA 4MKBA 3CJ5A 1IKYA 4F4YA 4Q44A 1RT7A 4IFYA 4MFBA 4ZP6A 5KFTA 3PW5A 2R8HA 1LWFA 1SUQB 1JLQA 1LWCB 2HNYA 4DG1A 5KG4A 1IKXB 3PR4A 5KFEA 4URQU 1RT3B 4IFYB 3GIKA 2RF2B 4IDKB 2B6AB 1JLQB 1S9GB 4DG1B 2V4QA 3KMSA 4WFZA 4KBIA 3JSMB 4LSNA 2D3ZA 3QIPA 5EDWA 3GV5B 3LAKA 1T03A 5J2NA 3I0SB 1IKWA 2ZE2A 5L1JA 3G86A 5HLFA 4EBEA 4WE1B 3H2LA 1HQEA 3PW7A 2IA6A 4FBUA 1TKXA 2YKNB 2ZKUA 1JLAB 3M9NB 5HLFB 4EYHB 2D7SA 2BQUA 5F8LA 2WOMB 2FLPA 5FDLA 3MEDA 4NCGA 4NLTA 4PWDB 3I5AA 3H5SA 4DL2A 1TKTA 3M8QA 2I5JB 4XO0A 5FDLB 2ZD1A 3EZUA 4NCGB 1N6QB 3V6KA 4K4ZA 1SH3A 1MMLA 2VG5B 5KFFA 5L1KA 4EBCA 4IQXA 2HMIB 1JLFB 2XC9A 3RB3A 1S6PA 1C1CB 3MTKA 4LSLA 5KFXA 2ILZA 5EUHA 3DOLA 4ZP8A 4ECUA 2OPSA 5C24B 1Z4UA 1RT4B 4PUOA 3QGHA 4Y2AA 2ATLA 4ZPCA 1C1BB 1EP4A 3BQ1A 2QE5A 4IR1A 1S49A 5I3UA 3V6HA 5K14B 4K50A 2HNDB 2W9CB 1EP4B 1FKOA 4RW7B 5J2PA 1RA6A 4IH7A 4F50A 4DL6A 1XR6A 2BE2A 1C2PA 1QE1A 4NLPA 1SV5B 3SFGA 1N56A 3FQKA 3OL9A 1RT6B 1R0AA 3UDLA 4ECVA 1J5OB 5J2PB 3KLGB 3UPFA 4I2QA 1ZTWA 3C6TB 2JC1A 4WYLA 5DQIA 4R8UB 3OL7A 3VQSA 2C2EA 2JEFA 4Q8EA 3DLGB 4NLDA 2OPQA 2OPPB 5KFBA 4RW4B 3LP1A 4R8UA 2B5JB 4IR9A 3PJXA 3KLEA 2R8IA 1T05A 4O44A 1KHWA 5KFIA 1RT2A 4IG3B 4RNMA 1JLBA 1NNDA 4DL4A 3LP0B 4YR3A 1RT2B 1VRUB 1DTTB 1RTDA 4IH5A 4HKQA 2XI3A 3NAHA 3I0RB 3ISNC 4ED3A
chains in the Genus database with same CATH superfamily
2ZBQA 2VQEJ 2V2QA 4DX5A 1D9DA 3RZAA 2J0XA 2MQMA 2ZBRA 2JVOA 1IBLF 3CCUS 2ZNYA 7FDRA 2FZGB 1S1XA 2PFDA 2E9RX 2VODA 5IXUA 4ID5A 1CJTA 2AEFA 4P2SA 4N8OA 2WVDA 4F67A 4M5DA 2JJ4D 3ZTQA 4CLWA 2FC9A 1MN9A 2HKEA 5B0GA 1IUJA 4QW8A 4KSEB 2HHVA 3TJ8A 3PRDA 2F4VJ 5FD1A 1YSJA 1VGYA 4NLGA 2EKNA 2HFNA 1TL1B 2E5LF 4LBIA 4C4WA 1NB7A 4RW7A 4J7CA 1RUSA 1SV5A 1RT6A 1RLCL 5IT9U 2EK6A 2E1MC 5GAEU 2D3UA 3KWMA 3CCRS 3VAMA 2B9WA 4GC7A 1KVIA 2O3DA 1X4CA 3W5XA 4PKDB 2HQ3A 1JB0C 5AE2A 3HLUA 3MR7A 1T0TV 5KG2A 5E3QA 3W9JA 3SFUA 1YQHA 5KG6A 2HBQB 2LQ8A 4FZVA 4PG7A 2PA8D 2DR8A 4LF9J 1IBMF 1RTHA 1YLXA 4DV2J 2K1RA 1EX8A 4PAAA 2E9TA 1H38A 3CB4A 3MM9A 2NREA 1U0HA 5L8RC 4X4NA 4RW8A 4LREA 1Y4ZB 1VQKS 3G8QA 3OLAA 3R9LA 2OMOA 3ZNJ1 5A2QY 1MU2A 3CDUA 1RAIB 3D7SB 4YHHJ 2KHDA 1KONA 4PQUA 2FY1A 4ECWA 1ITPA 2Z4PA 4K4XA 2MSSA 4J5OA 1UP1A 5L1LA 5LM7E 1F9HA 5AXMA 4BBYA 2ZBCA 3DRSA 2RHSB 2HHPA 4OX9F 2XMAA 2AF6A 9ATCB 1LWFB 4GKJF 1Y5LB 4A8KA 1S72S 1HW8A 4WCEQ 3KDOA 1RTIA 2EC2A 4TU8A 1Y9OA 2VICA 4CO4A 2ZHOA 3BKTA 4E8UA 2YQ3A 1SJQA 2IAJA 4H4OA 1JWWA 1NJZA 4D3GA 2V5HG 3HHKA 1AYEA 4LIWA 1SIZA 3MEKA 1VOMA 5THWA 2MLZA 1FK9A 2CA9A 3M8WA 3PRVA 4I2QB 3O44A 1G2EA 3R5DA 4DPXA 3IGVA 1JLEB 3ZO7A 5C42A 2HWIA 3MMCA 2CQPA 4JV2A 3M2RA 2DCUB 1HNZF 2ZBPA 2ZUAA 3H59A 1UVIA 2RAQA 2Z2YB 1RU1A 4DOZA 4UY8T 4ZLNA 3HI9A 1F0XA 4KAIA 4N8NA 2RKIB 5HMZA 1G1XA 3Q8RB 2RMLA 2Z56B 4NYZA 1U09A 2CPHA 4C8NA 4J9QA 2BJ1A 1UTAA 4DR7J 2DCLA 2VZ9A 4ZP7A 3RRHA 4MKBA 4F4YA 3PW5A 4DG1A 5KG4A 3AQPA 1IJEB 1MN7A 2V4QA 2UXCF 4JI2J 2PA3A 3JSMB 2G9OA 1L3UA 3TZYA 1KKHA 2EWHA 2YKNB 1CJKB 4DWIA 3Q8VA 2EFGA 2DGTA 2HVIA 1GTEA 4CLKA 3RB3A 1C1CB 3MTKA 2BMBA 5K8OA 3T6JA 1FEEA 1NMEB 2ATLA 4WTYA 1X4DA 5DS7A 2F40A 5K14B 2HEKA 4PG4A 4HACB 2MKCA 2JZ5A 1XR6A 1C2PA 1QE1A 1JXEA 2GVDB 4LR9A 3M2VB 2J5AA 3MD3A 5D4OA 1AUSL 3LP1A 2B5JB 4IR9A 2YWHA 1M5PC 3OTOF 2HHUA 1I1GA 3B4MA 1RTDA 4IH5A 2ZH4A 3LQVA 3ILOA 2V4JB 3MDFA 4AFFA 2IM0A 2WW8A 4CNYA 1P27B 3KUEA 4UY85 1UWBB 1VIXA 1WEXA 2VC0A 3FBBA 5JVGQ 4HR2A 1NH7A 1OQ3A 4DEZA 2HRYA 2HNZA 5HP1B 2DHAA 2DIVA 1N5YB 3CO9A 1WI8A 4WIIA 2MQPA 4M5NA 1L3TA 4W90B 1Y11A 3LAMA 1FO1A 1WC3A 2C42A 1TZ0A 4YB5A 3IN5A 4DS4A 3MAAB 2YTCA 2QN6B 1U4BA 4OHVA 3SCJE 5KFLA 4DQPA 1QTNB 4LVOP 2XO7A 1JLCB 4U6PA 1T02A 1S6UA 2AYEA 1HIYA 1D3WA 3PG9A 4NA1A 4YB7A 1RHMB 3HSZA 4PABA 1C1BA 3G4SS 2DHGA 4ANDA 3L4BC 2BR0A 3VTIA 5LXYA 4Q44A 3CIZA 3SCIE 3FCHA 4Y65A 4RW4A 3IGNA 4DV1J 1AROP 1X60A 4NRUA 3AQOA 4OZ3A 3V6JA 1UA1A 3TVYA 2YX4A 2HQFA 2CKWA 1RAOA 2YNIB 1AXQA 1KC8T 3D3CJ 3DOMB 3TO8A 1HNXJ 2C2RA 4RW6B 3RAQA 3V81A 1DRZA 1UVJA 4EFAC 3NS7B 4NA3A 3H98A 2G2OA 1Q7LB 1RAEB 2FLLA 3CWJA 1RYRA 5LSOA 4QWCA 3CNQP 2DH7A 3NXZA 1T3NA 1S9FA 1HR0F 1TAQA 4G1QA 1ZM4A 1ZAXA 3G96A 2GQCA 3F73A 2DXDA 3AY0A 1KTVA 1TL1A 1RWXB 1REGX 3NRBA 1D0EA 2OHDA 2EC0A 1T03B 3ZZOA 3IP0A 4TNOA 1TKXB 5KOWA 1OS5A 1ZBTA 3IRXB 1YWXA 1S0VA 4UOHA 3BN4A 3N9UC 3A12A 4RU2A 4QU6A 3VZHA 2HQGA 2E29A 3VAHA 2CQ0A 1X4BA 1RWOB 2M70A 2BJ3A 2NXUA 2J0WA 4PPZA 3JXOA 2WBRA 5HO4A 3NY0A 5CABA 5F41A 3VGSA 1SCJB 4KQZA 1FWPA 3OW2R 4Z2XA 1FVSA 4CO3A 1T94A 5A6WA 4MIWA 2HHTA 1IBLJ 2H4YB 3US5A 4KHRA 5E3PA 3N01A 4CLUA 1S9EB 1TVRA 1C0TA 3GIMA 4OLOA 5F8NA 3KOAA 2W9BB 1RK8A 3DHXA 3AD7C 4K5SA 3ZZ0A 3HSDA 2YWFA 1WKLA 2P6TA 1ICEB 3Q2TC 2M9KA 5LOQA 1OJ4A 4P2XA 2B9EA 3VCDA 4ZPTR 5CD4H 2KVIA 3CJ5A 1Q5VA 2R8HA 2CWKA 1LWFA 2OELA 1IKXB 2HGLA 3LAKA 1YRTA 5L1JA 1B0TA 4A47A 4N5SA 4NLTA 1U45A 4KPCA 2HMIB 2XC9A 2GIFA 2ZHBA 1OYDA 2V8VA 4MKYA 3B54A 4UZCA 4IR1A 3PXGa 4K50A 3JSBA 2LQJA 2OD4A 4I2QA 1H2TZ 5DQIA 3GJRB 2HK2A 2K7JA 1U02A 2GMJA 3AODA 2E7VA 2R9LA 1Q82T 3CVKA 2QL5B 3W2WB 4N76A 3L09A 3DDNA 4C8ZA 2QT7A 2RKIA 2WK4A 2ZBIA 4P74A 1RLDA 2QRRA 5K8MA 1XC9A 5HVFA 1KN6A 5GAGU 2JNJA 3T1HF 3L9ZA 5KFQA 1X31C 3HJVA 3TOQA 3P5TL 2YQ0A 3JSMA 3D0IE 4WU2A 3FEYB 2ZH6A 2LQBA 1O5JA 2YKNA 4GKJJ 1FD8A 1CJKA 3TA0A 2DGWA 2HBZB 2AJQA 3GB0A 4TKTA 1IR2A 2BQRA 1OMSA 4DCJB 1C1CA 1SJFA 4P2FA 4OZLA 3VGUA 3SV3A 5HVHA 4DV0F 4PRFA 5K14A 1UJ5A 4HACA 2GVDA 3I5BA 3M2VA 3PW0A 4WXWA 1JX4A 4A8SA 2U2FA 1ROFA 3A8JA 2B5JA 3KDNA 1S6QB 1IBCB 3J7ZT 4F4ZA 5DRKA 1Q8LA 4I1TA 3CJQA 4KGVB 4ZCMA 2V4JA 2LQ9A 5D6GA 2ZM6J 5LMNF 2MKSA 1UWBA 2FVRA 1RAJA 2DGQA 4LRAA 1FWKA 3NS6A 1SIWB 4ZVTB 1N5VA 4CCHA 5KFPA 4WZQA 4IYQA 1FTCA 2RIJA 1NJIT 3H2UB 2W1BA 2YX7A 2B7CB 4OV1A 1RHRB 1QDUB 4TN2A 3MAQA 3G82B 1RISA 2R2RA 3PO4A 2YBVA 3V6DB 2HQIA 2CPJA 3H5YA 5D77A 3LTOA 3MAAA 3CCES 3PKMA 3OFEA 2POKA 2HK3A 2UXCJ 4FNIA 2HRUA 4WFYA 5KT6A 1JLCA 1ZM3A 1SJ3P 2HWTA 4FYDA 3NGTA 4M1KA 3CXCR 4K2JA 3OJSA 2QG9B 1F3VA 3CCWA 2B4OA 1AW0A 3FSXA 4FYYB 2Y1IA 3GYXB 3HFKA 2RSQA 2N7CA 2AQ4A 1PYOB 2A18A 4USHA 3W63A 3RBEA 2IVMA 2NUHA 4HT5A 4EI2A 2J6TA 1UEUA 3MPYA 2L08A 2ZJRQ 2DY1A 2IM1A 3MM8B 1KSPA 5BYRA 4EEYA 3J7Z5 3FK4A 3NMAA 2MYFA 1WOPA 4UQTA 3BSNA 4NLRA 4OI4A 3SYZA 3CJKA 1T9XA 4AQYF 2QLBB 4LRDA 3D3BJ 2R8KA 4TVAB 3QATA 2YNIA 3OTEA 5EWFA 1WC6A 3DOMA 4RW6A 3N6MA 3ETOA 3QZ7A 2OJ3A 1VBKA 2VG6A 2MY7A 4I64A 4OMFG 4CT8A 3HSJA 1NSKL 4ECQA 4QIGA 1RYSA 2G13A 1MMDA 1CJVB 3KJVB 1HHTP 4F36A 5KFHA 3TUPA 4F3MA 1FNXH 2EFNA 4JI3F 4IOBA 2C22A 1BC6A 3OXFA 3KLIB 2O5DA 1WDDA 4PWUA 1JJ4A 5F3TA 3ZTOA 4LFCF 1N34F 4P7TA 3FEZA 5SZTA 3TZWA 2OAUA 4FPIA 1S7IA 1FFGB 1T03A 1D9FA 2LA4A 1TKXA 2E1CA 1ULRA 2HG4A 5D4LA 3LF0A 3I6PA 4FXWA 3EZUA 1HBNB 1MMLA 2VG5B 1UEVA 4C3KA 4ZP8A 1Z4UA 1PGZA 2ABYA 2JDJA 4CRJA 4ZCLA 3IR5B 1BWVA 3V6HA 4QIEA 4OHZA 4DL6A 4ZIVA 1NJWA 4NLPA 3FQKA 3TAPA 4WYLA 3VQSA 2C2EA 3DKDA 4LFAF 1KHWA 1D09B 2GA7A 4YR3A 3P5BP 2GQ2A 1UJ6A 2AKWB 5RUBA 4K4TA 2FYXA 4LF8J 2BBEA 1S9EA 4G65A 2C2DA 5IM0B 2YH1A 4F02A 1XNRF 2CJQA 4C0HA 3GJQB 3M8RA 2C3OA 2GZOA 2W9BA 2VB6A 1NB2A 5EGYA 1RE1B 5KFDA 2LXUA 2DH9A 3JYTB 1H6KX 1A9NB 1WHYA 4MKVA 2GHWA 5EWEA 2Q1LA 5J2MB 3RJMB 5U47A 1RJJA 1WDTA 2BOPA 1GXTA 1UA0A 2JLEA 1IKXA 3LA0A 4O4RA 2BEFA 3D2WA 3VGTA 2RU3A 3WX8A 5IOLA 1IM6A 3I82A 3D28A 4OYPA 2L48A 1NSPA 4YS2A 3RW7A 1GFWB 2HRTA 2GJFA 5DM7Q 3VZIA 2HMIA 1HA1A 4CO5A 2R2TA 1WC4A 1JKHA 8RUCA 2YKMB 1NHUA 2JWNA 3CTRA 4ZVEA 4GMKA 2PMWA 4K59A 2B4UA 1R7IA 4JP8A 2QFIA 5ETTA 2WB1D 2KHCA 4C11B 3GV7B 4RWXA 3NGUA 2WVEA 2Z30B 1U6BA 2DGXA 2YKOA 3RGIA 3GCXP 2IA0A 3S7RA 1RU2A 3MOJB 2B8PA 3GG1A 1S1VB 2IVFB 3M6WA 1RZMA 3DGPB 2VKZG 3NNCA 3CSKA 4GVBB 3PW2A 4PXBA 5EX3A 1X9WA 2YNFB 2DNRA 2C28A 1FDAA 2DHHA 1EZZB 4NX9A 3KG0A 1VJQA 3DMJA 4N7TA 4LMZA 1XBWA 2I2YA 4NZ0A 1HBMB 1TTHB 4HHHA 2JEIA 1L5UA 2JSXA 1NJYA 1UVMA 3EXYA 3TX8A 4ZJQA 2HGMA 4IH6A 2XWXA 1BD6A 4FKYA 2WVFA 4NOHA 3OHBA 2IPOB 2DHXA 4ZVQB 4ZJOA 5HMWA 4HEA9 4S0MA 2CDRB 2BJ9A 4WF9Q 3Q2SC 1NHVA 2CJKA 3M2UB 4A8YA 4F2RA 4ANCA 2OGUA 1BQXA 2UZAA 4DF8A 3B6BA 1YRXA 4PYAA 4ED6A 1BE4A 1X4EA 1H3DA 4UUXA 2YWGA 3MEDB 2U1AA 4UF4A 4E2FB 1S6QA 2FZKB 2JFKA 4B3MF 1CPZA 4IQMA 2DNQA 1M5VC 2AV5A 2DB1A 3H25A 1RI7A 3ETMA 3CJRA 4PUOB 3UI3A 2QLFB 2HFUA 4ZPVR 2Q43A 2K3KA 2COLA 3W64A 4DV3J 4GRSA 2BM0A 1WHWA 1TK5A 4I4BA 3TQ1A 4RZRA 4AL5A 2ZHAA 3H8YA 4M94A 1KEKA 1BY9A 5D0HA 2AHOB 2OP5A 2KO1A 1C4CA 3HVTA 1N5QA 4TQSA 4LQ9A 2EFPA 5CYMB 3G82A 4OI2A 3PV8A 4DUZJ 3C3LA 2PD1A 4TLRA 2YWWA 2VBYA 3V6DA 2YNHB 3E01B 2FVCA 1S4FA 3W66A 2O66A 2GAGC 1CJUB 2FGCA 2GC8A 1UJ4A 4P73A 2HFOA 2QA4G 2PO4A 3KG1A 2LXIA 4A46A 3TVZA 4ITSA 3NNAA 2FJWA 1YDLA 3Q0AA 4DQSA 3DLBA 2W2PP 5J1PA 3KUGA 2RQCA 2R7OA 3WC2A 4IFYB 3LGNA 2J9DE 3VAFA 2O1PA 1ZPWX 2BKNA 5ETMA 2APOA 4DV0J 1LEOA 3I5AA 4XO0A 3MM8A 1FJCA 2XMWA 3BS9A 5HL7Q 5ETVA 3GJTB 4EUVA 5KFFA 4IQXA 4WBFA 1JLFB 2ILZA 4JI1J 4Y2AA 4XDCA 2W9CB 2CVEA 1SKUB 2UUCF 4CH0S 4X4TA 3QT5A 3UVJB 1ZTWA 2JEFA 4Q8EA 2OPPB 5LMNJ 2QMXA 2DGSA 5HN0A 5ETKA 4ELUA 4FF4A 2CJAA 2LP4A 4CLPA 1TP7A 1RHJB 4C8YA 2UXDJ 1LK5A 2XLKA 4EBDA 1W25A 5I3PA 1OPZA 1RHQB 2VIHA 3OR1B 3EE3A 5GAHU 3VAIA 2VBWA 1RT5B 2IYIA 3QFWA 3KJVA 1S10A 2MLYA 2FHMA 1FRJA 3Q86A 3JQKA 1VRTB 2DYAA 4OI3A 3DLJA 5T14A 4WFXA 4NLSA 3KLIA 3BSOA 1HWJA 1PBAA 2V8PA 1I5OB 1U6FA 1JLGB 4ES3A 4M5IA 4L74A 3K17A 3DHWC 3EYZA 1RWUA 4USTA 4WYWA 5C7PA 3M8SA 1SJ1A 1KHVA 1X0PA 3PTWA 1HBNA 5KFOA 2VG5A 3KFWX 4NEYA 4P72A 1HNIB 4CTAB 2KTQA 3ZTPA 4B3OB 2UV8G 3PCOB 3AB2B 4XAKA 1RWMB 1VBXA 4K2XA 1FE4A 2NYHA 3CEDA 3CDWA 1RKJA 2YVSA 4ZOSA 4PZVA 3DRRB 1IM4A 2AP6A 3IM9A 2DEIA 4MT1A 1Y3JA 5KT4A 3KUHA 1X9MA 4PR6A 4QPXA 1N36F 3FZ2A 5F8MA 3GMGA 1H0HB 3BO4A 2CQHA 1WJ9A 2LEPA 5IM0A 5D3GB 3LPYA 3BDEA 1B7YB 4I2PA 1NKBA 2P2CB 2IC3B 4RLEA 5KT2A 1BLUA 4LFBF 1E6VB 1GK8A 3TQEA 1VQYA 3HHLB 1O8BA 4UZBA 3JYTA 5BYQA 3WQPA 4OV6A 1XMOF 1VFJA 2CWXA 5CQGA 1WHVA 4O0IA 4TYAA 4LT6A 1SI9A 1RCOB 3N79A 3Q89A 3A3OB 5KFZA 4RUAA 1FD2A 3PR5B 1VLYA 3JB9k 2UVUA 1VQPS 3UDCA 3G6ES 2W2NP 4LFCJ 1N34J 4XPCA 2QLXA 4RNHA 1HI8A 1Z1ZA 2ATCB 4EO6A 1VJWA 3WBZA 1Q4RA 2HNYB 2YKMA 3KHGA 2YXLA 1SL2A 2VASA 3OXLA 5J2NB 1U1PA 2IY5B 1H7XA 3HULA 4J9NA 2EW9A 4C11A 3R5CA 4HT7A 1LKZA 5AJ3J 3CJTA 5FLXY 4AUKA 3GU0A 5KAKA 2OPSB 2DKOB 1S1VA 2QLWA 1YJNS 2IBOA 3MOZA 4F25A 3OTBA 4USIA 1R0AB 2ZH7A 2VBXA 2M7SA 2QYCA 2YNFA 4R8UB 4UW2A 1FJGF 2A2DA 1TUWA 2D3OR 4U67Q 1MROB 4UOGA 3KJNB 4LBHA 4F4KA 1VQ6S 2RDIA 2W7PA 2HFVA 3NOCA 5IT0A 3N4WA 2N7YA 2ACMA 3PEHA 3UR0A 1HBMA 4DV7F 5IS2A 4ER8A 1XWLA 2CNNB 3BBFA 3IMQJ 3OBIA 3JSRA 2ZZMA 4ZVOB 4ZVFA 1M5OC 3JAMY 3FMBA 3PYGA 1S0NA 4DZ6A 5B08A 1Q7YT 3OR2A 2RDDA 2LKZA 4ZKAA 4CP5A 2PFFB 2GVZA 2C2NA 1JLQA 1LWCB 1NLKL 3M2UA 4CLZA 1RT3B 2D74B 3D1HA 3GV5B 2E1RA 5HANA 5LMUF 1N0UA 1S7HA 3JTNA 1CBKA 1K0TA 3PW7A 2FHKA 1M5KC 3MEDA 2VDHA 2QYGA 1N6QB 4K4ZA 1HI1A 2XY5A 1ZAVA 3K5PA 4PUOA 3BQ1A 4YEAA 1U6ZA 4ILLA 2HNDB 1VR6A 2HVZA 4P71A 2H5EA 1J5OB 1GEHA 3FJ2A 3GJSB 3QGPA 2XYGB 3GE9A 2IRXA 4NI2B 4QU7A 5IWAJ 5CYMA 5F0WA 3HXMA 4DPUA 2H3EB 1X5PA 2YNHA 2F1FA 1X4FA 3E01A 2NR0A 2WHOA 1KFDA 3GR1A 4BHQA 2MQQA 4Y2KA 3TI0A 1KBRA 3SDEB 1RAHB 1Y10A 2K3IA 2J8SA 3Q22A 4EO8A 2CQBA 4NLQA 2B4VA 1T95A 2IM2A 2W8LA 3NWGA 4KIAA 1TQLA 1TV6B 3IAS9 3S6EA 3GONA 1V3SA 5C25A 3T5LA 1WC1A 3QT8A 5DM6Q 1HYSB 3VAGA 4JI4F 4FVCA 4IO1A 4F0KA 4DR5F 1EQMA 1REVB 2SXLA 1R6VA 1JLFA 2XSFA 4Y2IA 4LF7J 1X5TA 4AL7A 3HM9A 1VQ9S 3Q8UA 2CQIA 4JYAJ 4B3MJ 1FA0A 1QUVA 5KFRA 2W9CA 2XNQA 2QMUB 3UVJA 5LSLA 1VS3A 3J81j 1YJUA 1RT1B 2OPPA 3W1YC 5HATA 5GADI 1DQ8A 2DR5A 4JI0F 1LW0B 4A8FA 4JUZA 4MK7A 3DFEA 2WTFA 2R7WA 5H9FJ 1ZAWA 1F1BB 4NLOA 4DF4A 4PWWA 3OD2A 1UVLA 1P9YA 3Q8PB 3OR1A 3Q8SB 4NXNF 5IFMA 1R43A 3AAWB 1PILA 4F0HA 1RT5A 1XTZA 2OEKA 1WF1A 1LWEB 1FRHA 2RQKA 1VRTA 5AXKA 1HPZA 2CPEA 1URRA 3EX7B 1Q81T 2WZ1A 1XR7A 1ZM9A 2AJ1A 3PNIA 3UD3P 1JLGA 2NCKL 4HH1A 4DFMA 2MLXA 1VC5A 1V3ZA 3ENWA 4YFUA 2BE7D 2V9WA 5M2PA 2DPJA 4HLBA 2PIIA 2XMUA 4CO0A 3QQCD 4U7UD 2I9SA 1VK3A 4WFBQ 1RBOB 3QLHB 2BM1A 2OFGX 1L3VA 1RWKB 4QZVB 2ASYA 4ECSA 2DISA 1H73A 2W25A 1IKYB 3R6GB 4F3OA 1HNIA 3CCMS 4PXEA 4JV5F 4B3OA 2BKOA 1VBYA 2C2OB 1JJHA 5ETNA 2UUTA 2NPFA 1UFKA 4ZVPB 3RAXA 3DRRA 2YWEA 3ADAC 3OXGA 2W01A 3W9HA 2GX8A 2ZD1B 2UUCJ 3DXBA 3QMQA 1NPKA 2IJNA 6AT1B 1HNWF 4CM2A 2O67A 3H4BA 2F8EX 4DMZA 4WKYA 4ED1A 1OPIA 2MQNA 1VQNS 5D3GA 4NXMJ 2F3JA 4Y6IA 3DGVA 2IC3A 1SC4B 5CCLA 1E6VA 4HTJA 4EMDA 3KLEB 4Y28C 1T05B 4O44B 1EHWA 4DR1F 1YG0A 4DN9A 2KFZA 1CQNA 1HKAA 2XS2A 1MLAA 2DVIA 1YJ7A 2DH8A 3DRPB 1UMJA 5L9XA 2CDQA 2AJ2A 2KZMA 2MY8A 1T9VA 3JS9A 1M90T 1OQ6A 1FJ7A 2WVBA 3BGRA 4B3TF 3BJYA 4M63A 4OJGA 1HQ2A 2MJUA 1J5EF 4P52A 1XN9A 4OI0A 3SSQA 2VA3A 5HJYA 1HARA 2VDIA 1JJCB 3GSIA 3HHDA 3K8WA 3PR4A 2HNYA 2X1FA 4F8RA 1G4CA 1OY8A 3BO2A 1SJRA 4DSLA 2JVRA 5J2NA 3UDEA 5CHCB 4WE1B 2DRDA 4C8KA 4V1Ak 1T9YA 3M9NB 2D7SA 1X5SA 4NCGA 1N5SA 2MZTA 2W2QP 1KVJA 3QT6A 2UXBJ 4DQQA 1WEYA 4ECUA 4BS2A 2OPSA 2JL9A 3WIVA 1XNQF 1NM2A 4DR3J 4RBVA 2ZH3A 1RA6A 4IH7A 3D6HB 2QIFA 3L7UA 1R0AA 1F60B 2JC1A 2NQPA 4R8UA 2R8IA 1MROA 1VRUB 3I56S 3I0RB 3HD1A 1SC6A 3NKYA 1QVGR 3HHEA 2CG4A 4J9LA 2I8EA 2OMLA 2VHGA 1RWNB 4QPTA 4DR6F 4JB8B 3RYLA 1PIEA 3TJ9A 4K4SA 4ZLJA 1V9OA 1OO0B 4KR0B 2EPIA 5AT1B 4DFPA 1KQFB 4ED2A 3OVBA 2GIQA 3BV8A 4O0NA 3HT3A 3CT9A 4G1PA 1T7PA 1ZM2A 2VBZA 2HFZA 4C8OA 3QNWB 1LWCA 1RT3A 2ZJQQ 2M2BA 4LR8A 4QWDA 2ZDOA 5D8HB 4ICLB 2EBEA 2ZWPA 3PRBA 2YPZA 2BKPA 2A1BA 3I5CA 1N6QA 3N6NA 3T9NA 4DV6F 2ZWOA 2R7VA 4Y00A 4B3RF 4DPOA 3F56A 1S0MA 4USWA 4ED4A 2PMZD 3D5MA 4X66F 3D4JA 1MW7A 4C7QA 2HNDA 3RTVA 3OVSA 4X4SA 1J5OA 3BREA 2ZH1A 1N4LA 3OVAA 3PEJA 2N3LA 3NS5A 4B3SJ 3NGKA 1OYEA 3FZBA 3T1YF 3IBWA 2FD2A 3OL8A 1DTQB 1XMBA 2HPUA 4NI2A 7FD1A 2AZ1A 1WHXA 2MSTA 4LVNP 1FCAA 3W5YA 1FJGJ 1Q0NA 5L46A 3MCMA 4DX8H 1NDLA 2KRBA 5HI7A 1BQMB 1QVFR 3HZEA 4ERDA 3MEGB 1S59A 1NK0A 3ELHA 4O3QA 1PAEX 1IKVB 3GIRA 3RR7A 1CVJA 5J1NA 4YN3B 2BW7A 2DGUA 4ZVUB 4CI0B 4KV8B 5CYJA 1M1HA 1UPMB 5LJ5Y 1PAUB 1TV6A 4YY3J 3GZ7A 2GIRA 2XMMA 1MMNA 4R25A 5D78A 1AA1B 4ZK7M 2XYHB 4P10A 2XNRA 1HYSA 2DNGA 4DUYJ 4DLGA 3SI8A 2CZ4A 3N6LA 1ZZNA 2VPYB 4B9LA 1D1UA 4LRFA 3FC9A 1REVA 2ZZNA 1FERA 5LMUJ 1TL4A 1FXRA 3LANA 3T9ZA 3V4MA 1WG1A 4X65F 1MWYA 3PIOQ 2ROGA 1WF0A 3R3TA 4DLEA 4C0BA 1RT1A 3CJ4A 4UQGA 5JUMA 2UUAJ 3HSGA 2DY9A 3F44A 1SH0A 3R5JB 2B51A 1NXIA 4C0OC 1LW0A 4NL5A 1WUUA 5E41A 4Z37A 1WORA 4K0KJ 4LSZB 1N33J 1N88A 3J7YU 4OL8A 1NDPA 5DLFA 3ICLA 1QAIA 3AA9A 3KLVA 4RX6A 1U1QA 3DN9A 1VIOA 2OPQB 5KFKA 3C8YA 2HFSA 2UVRA 2MKYA 2GNKA 4CYUB 3QAUA 1FVQA 3GTYX 2L9DA 1LWEA 5KFWA 1ZOTA 3PY8A 3RAMA 2AJ4A 1YKWA 4DCOB 2VF3A 3EDRB 1RBLA 1W2BR 4ANEA 1BGXT 3CMAS 1QSYA 2HAIA 2GHPA 1Q8KA 4J9RA 4FF3A 3DLLQ 1SKWA 2HHQA 1PJ6A 3BGFA 2ADBA 1RP5A 3QLHA 3I4PA 4UOFA 3AH6A 1LW2B 4DQIA 1MG7A 1KRPA 1IKYA 2F8MA 2YWKA 4DR5J 2GHVC 1FRIA 4IDKB 2GJIA 3BYPA 4WFZA 5HLFA 2J8AA 2V69A 4X4QA 2HS0A 1FDDA 2VQFF 1NH8A 1CQMA 1B3TA 3O3LA 3H5SA 2GO8A 2I5JB 4YUDA 2ZD1A 2G1DA 3U02A 1UCNA 4N77A 3DDIA 1NO8A 1QM9A 4NCBA 1RBAA 2PEHA 1QY7A 1Q78A 1NDCA 3FCWA 1RHKB 2XTJP 2GJ2A 1EP4B 2YKAA 3EICA 1X0FA 5J2PB 1YBAA 3O5TB 4H4KA 2NXEA 2V8GA 2VU5A 3KLEA 1T05A 4O44A 3D6TB 2F65A 1S5ZA 3KYLA 1RT2B 2J76E 2IJRA 1KVKA 1FHTA 3RB6A 4ED3A 4GVLA 1F3FA 1QAXA 3EUNA 4DSEA 2XB2D 2F7VA 3DRPA 2YX1A 3SSRA 2QA2A 1V5VA 4K4WA 3SCKE 4ZVHA 1FDNA 2UP1A 3KK3B 3J7YI 1N32F 1YZ6A 1G6BA 2JH3A 1VHFA 3FSYA 4HI1A 1R31A 3I55S 1I94J 4NMXA 2C2KB 1HD1A 2MKIA 1NDKA 2CJXB 3QYYA 3J81Y 4U7CA 1VMBA 1NAQA 3MAHA 4KGMA 4IFVB 3BM7A 2RHQB 2R2SA 2C3UA 3ZC4A 3TEHB 4WE1A 4JI5F 2HIYA 5IZHA 4FKXA 2MDAA 2CRLA 2CQ4A 2IYGA 2JEGA 3U1MA 2V63A 2K06A 5H9FK 2IM3A 4XDDA 2ASLA 4OJHA 3CIMA 2Q6BA 2W24A 4C9DA 1TL7B 1PO6A 5B0EA 1WKJA 3TUZC 4ZHRB 1ACMB 3CCQS 1VRUA 2MMYA 3I0RA 3QAEA 2R8GA 4RBUA 3D54A 2UUWA 4WTOB 2FHOB 4HHJA 3BYRA 4CH7A 3PX0A 1O51A 4LF5F 4FXDA 1CEZA 1U1KA 1K9MT 1R8CA 4X4UA 1Q8IA 4FXVA 1RDRA 3KLHB 5GAEI 4B3TJ 4KHPJ 3F0NA 4V19X 4AE5A 3QGIA 3HO1A 1FESA 1KQGB 3CO0P 4NASA 3ENVA 2V2VA 3T19A 3V2UC 3P8BB 1KDNA 5J2QA 1V6HA 4KFBB 2UU9F 1B70B 4RKUC 3M8YA 3E51A 1ZA1B 2FB0A 5DQGA 3HVWA 4Y0FA 5E3AA 1M1GA 2CPZA 4ICLA 1SC1B 1BUXA 4F04B 4U95A 1SPBP 2AGQA 3TJAA 1H2VZ 4GO7X 3FMWA 3BQ0A 3M32B 5IT9Y 1RT7B 1PG5B 3CJ0A 6FD1A 3BDPA 1S48A 1GXUA 2VOPA 2CYYA 3QIPB 4C3LA 1PJ7A 1SBRA 2ZE2B 3M1VB 4AT1B 3CC4S 3HKZD 3HFZB 2VA2A 1XNQJ 3M8QB 4ECXA 4KJIA 4RNNA 1HBOB 3KMQA 1DTQA 4IUFA 2AJ0A 1NBEB 3DOLB 1PYSB 3C15B 4BWJA 2G0JA 3G6YA 4LF2A 5KFNA 4DV5F 2KB2A 1B4SA 3M8ZA 2J9DA 2AD9A 1BQMA 2A0FB 3MEGA 1XIQA 3AJ1A 4PPDA 1VHIA 1WSRA 2FIUA 1VC0A 3UE2A 5KFUA 3JQMA 2OLWA 2VJVA 1HHSA 4CNZA 2VQEF 1RADB 4QCLA 1IKVA 3MFHA 2PGCA 2LVWA 3R5GA 1S79A 1R0CB 4DR6J 3CCLS 4URSA 4KV8A 3MM5B 1GH8A 1JNZB 2JRSA 2KT5A 1SKRA 3AD8C 3UR3C 5MAOA 2W7OA 4J37A 1B64A 4I68A 4ZPDA 4CM0A 5MLCV 4H4KC 3ILJA 1U8SA 5I42B 3R5BA 3BR9A 2AWZA 2PI4A 3KK2B 2QL9B 2BJ8A 4X84A 3IWNC 2MZ1A 1SUQB 4URQU 1EKRA 1S9GB 2DRBA 1WF2A 3EZ5A 2Y9HA 2F4VF 3BR8A 3OUYB 2XLJA 5FDLA 2EVZA 3TA1A 1RAAB 3EVOA 1T3OA 4ZVSB 3K89A 3THPA 1GMVA 5C24B 3T1YJ 4WU3A 3MUTP 1RKIA 3TANA 1XERA 5HMYA 3A1YG 3SFGA 3KLGB 3C6TB 2HURA 3CULA 2OPQA 3H2VE 4CYUA 2FHJA 3ZZYA 2DXFA 1NNDA 2HBYB 2VFRA 2BJ7A 3CDAA 2MZRA 4LF9F 5DZ7A 5ITHA 3J80U 4W4MA 4NLWA 5CYQB 2E66A 4Y34A 2KN4A 4PCQA 4LF6J 3RG6A 2LFVA 2CADA 2DNMA 1B99A 2HQDA 2VJUA 2N4CA 5DDQC 3FKBA 3IG1B 3G87A 5DDPC 1F2HA 1JXVA 2CPDA 2C3MA 1RTZA 3HCXA 2P9CA 1K73T 1CJTB 3GPAA 4XIUA 2WB4A 4YHHF 3Q8QB 1YX2A 3OPKA 2J6SA 2P9EA 3A8KA 1UFWA 4IDKA 1Q1KA 4JI6F 1UZDA 1VBZA 3GSDA 2XMKA 2CQ1A 2I1RA 2NZCA 3K2YA 5A8RB 4ILRA 1SH2A 4DUTA 2I5JA 2DT9A 2MTLA 1G3OA 4LIRA 1U47A 1FFWB 1PC5A 3G6VA 1U2FA 1KP6A 3D6MB 3M6VA 1B7FA 3MR2A 3I96A 3RW6A 1M5HA 5JXSA 2DO4A 3RBXA 1MNEA 2VG7B 2XY7A 2BANB 3ENQA 4KKOB 1TMMA 4WP8A 3QRQA 1HQUB 4MKAA 3CCJS 2ZOMA 1FI4A 3MMBB 4Y3CA 1ZZFA 2Q79A 4OYMA 2F9DA 4OLPA 3QO9B 4MJKA 4RUBA 3BGUA 3D1QA 3KK3A 4ECTA 1SKSA 3W5ZA 3MF5A 3IS9B 2RU9A 4DV4F 3OFFA 3B4DA 3MEEB 3B82A 4RU9A 2MXYA 1SJ4P 2A6MA 5AE1A 1V3RA 3MTJA 2Q66A 5HAOA 1TL3B 5IV3A 3S1TA 2ASDA 4TLQA 2K7KA 2GGPB 4CO2A 3O1LA 3BBCA 4GO5X 3AHPA 3MUVP 4X64F 4FF2A 4OZ2A 2Z58B 3TWZA 3B78A 3DLKB 3C6UB 4NWBA 2XHCA 3D0GE 1CS4B 3W7BA 4L73A 3A8EA 4NE9C 3DLEB 2X7IA 2B9YA 3DCAA 1HWLA 2G0CA 1DQAA 2VQFJ 3K7RA 2H54B 2R7TA 3P3DA 4CLSA 1RHUB 2XSJB 4E0DA 1LXNA 1VQOS 2E5LJ 5HMXA 3PHTA 1TL7A 4KE5A 2ZH8A 1BWEA 5CA5A 4ZHRA 2IFXA 4ZMMA 3P4UB 4K8RA 3FBEA 4H4OB 4QIVA 5SUHA 4HI2A 3NGSA 3CCVS 1KFSA 4FVMA 1JLEA 4I67A 1FK9B 3CD7A 3KLHA 1IBMJ 1N32J 3C14B 4DX6A 3DYAB 1FF2A 1VQMS 2E9ZA 2OI2A 1GQEA 4KFBA 1U24A 5KFMA 1FKPB 5L38A 4NA2A 5CH7B 2E7XA 2Y3YA 5BJRA 4C98A 3SQOP 3MCOA 3UNGC 4JI5J 4L75A 3M32A 3NCQA 1RT7A 2HLUA 4ZLLA 2Q6CA 2HVDA 1TR0A 3PX4A 4DG1B 3AXKA 4OX9J 3QIPA 1KNZA 1NCLA 3I0SB 2ZE2A 3M1VA 4K7QA 3G86A 5E3CA 4USMA 3K8VA 5LL6d 3M8QA 2M8HA 1FXLA 4EBCA 2Y8WA 1HBOA 2FY8A 2N82B 3DOLA 3C15A 2CQGA 4JI7F 2RNEA 4DPTA 4ZPCA 2KI2A 4RWWA 4OFZA 5DZ6A 2QEXS 2M3DA 2CAJA 2CPFA 4NLDA 2Y1LB 2E1AA 3PYFA 3JSYA 3LWMA 1FX2A 4LF5J 1I3OB 2HHSA 1YTYA 1HMVB 2KFNA 1N5TA 2MEWA 3MM5A 2GW8A 2M5YA 1ZA2B 1HNXF 2CQDA 1OWXA 2E44A 1HNZJ 1BXNA 1VLOA 1UW9A 1P6TA 2ALYB 1S12A 2IBKA 1U1MA 3BO3A 4MK8A 4RW9B 3PFOA 2DD8S 4YR0A 3DU6A 2V0NA 5HP1A 1N5YA 5I42A 1X8DA 2Z0GA 3MI7X 2FVPA 3BGOP 1GMUA 5FIIA 1TUGB 3ZTRA 3LO3A 3KK2A 3P6YC 3LH2S 2DHSA 4LBPA 4M8LA 3WZ0A 4DL7A 2HIQA 1SUQA 4QW9A 5J1EB 4KY3A 1S9GA 2PT0A 5T41A 1Y3KA 1PSDA 4IRKA 2BA9A 2R4FA 3J81U 4X62F 3OUYA 2Y0SD 4ES1A 8ATCB 5A2QU 3OLBA 4F4XA 5F8GA 3VALA 3MPVA 1P1TA 5GAGI 1X7VA 4OQJA 5C24A 4FS1A 1LK7A 3IXQA 5E0OA 1J2VA 3W60A 1VQ4S 4I56A 2HLTA 2QGFB 4KH1B 2HQCA 3KLGA 1GT8A 3FVYA 1RCXB 3C6TA 3KNAA 1B0VA 3OSPA 4DV5J 1DLOB 2I0XA 3K5OA 2FGOA 1UFLA 5DQHA 3OTOJ 2GFFA 2HS3A 5B0FA 4OZ5A 4RBTA 4HYKA 5EWGA 5CYQA 4DSFA 3OFGA 3PHEA 3I9ZA 1C4AA 1K44A 2GMLA 2M4MA 4A48A 4IOAQ 3HJFA 4ZCKA 4NCAA 3ZZPA 2DEJA 2UVVA 3V81B 4DPYA 3SSSA 1YBTA 4DXLA 4UOCA 2NPIA 3IG1A 1EJ7L 4JOUA 4L3KA 4EZ6A 4C48A 5HROB 1IJFB 5KTQA 2CUYA 3QJJA 4DJBA 4B17A 4TQRA 3MR5A 4DL5A 2ROEA 3ZNUA 4NZ7A 1RWVB 3HF5A 2OSRA 4PEOA 3PVXA 4FDFA 3W65A 2EKYA 2XZDB 1FJEB 2X3GA 1UAWA 1WC0A 3QSIA 4G1QB 5A8RA 4U8YA 1IN0A 2KXNB 1JQGA 2OFHX 3PYEA 1YIJS 3BSAA 2QLJB 2VPZB 2J0QD 5KG0A 4CT9A 4J9KA 1NK4A 2CG8A 1N8RT 1NSQA 1IKWB 2CNKB 4J90A 3IRXA 4QWEA 4RUHA 4FS2A 1KD1T 3QBCA 4ID8A 4LF4F 1WOOA 2DNNA 4N47A 2VG7A 3NAIA 2BANA 4KKOA 1S6PB 1HQUA 3GYGA 3MMBA 1OY6A 1QTMA 3PX6A 5B09A 2KXHA 3QO9A 5GVQA 1K1SA 3KXDA 3IS9A 2RD5C 5KG1A 1FRMA 2IMWP 3O8WA 3MEEA 4NZ6A 3EGZA 4LF1A 1YGYA 1YJRA 2B43A 2NLWA 4QR2A 4OYOA 1ZH5A 1TL3A 3MCNA 3G8TA 2MGZB 2GGPA 5GMEA 1TVRB 1C0TB 4UUWA 3PFEA 2ZC4A 3N0VA 3MM6B 2OKQA 2ZITA 2XHWA 4OJ1A 2BVZA 4CZCA 2GMHA 3DLKA 5IC4B 3MPUB 3UWTA 3C6UA 3HHNB 1KOOA 1Q86T 1HR0J 1CS4A 1V5IB 4JI6J 4BLGA 3UFCX 3DLEA 3D68A 3KK1B 1CULB 4OX6A 3AXMA 3SMZA 2RF2B 2XSJA 3KMSA 2XMTA 4KBIA 2R7SA 2KYXA 1FNMA 4HDGA 2L9WA 3H2LA 2IA6A 3EGWB 4FBUA 4EYHB 1HLWA 5F8LA 2X3DA 3L3CA 1FTRA 3NCPA 5F0UA 2UUBF 4ZS6A 2E5GA 3W8PA 4ZPWR 2FUG9 2KG0A 3OFHA 3HK2A 3TZZA 3OL9A 4QIFA 1LFPA 1QUPA 1WKKA 5A76A 2QO3A 5I4MA 1RWWB 3R8YA 2GCFA 4IG3B 5CCMA 3NWRA 2RT3A 2ZM6F 4HKQA 4HVZA 3C14A 3M30B 1HWIA 4DS5A 3W2WA 4DV4J 1N48A 3DYAA 3KHRA 3V4IB 4USJC 1T9TA 2QA4S 1YVFA 3ZZUA 4NLXA 1FKPA 4JV1A 5G0RB 4LQ3A 2JHEA 3NGRA 1EKSA 4RL1A 4EU0A 5F8IA 1FKAF 1APSA 3NBPB 2DIUA 3CJ2A 4J9SA 3RR8A 1CG2A 4X64J 4BC7A 1K47A 2ZOFA 4N56A 4G3IA 3ULHA 5BYSA 2M88A 2XGQA 2QA1A 3PYDA 1IBKF 4L3NA 1URNA 2QX0A 3I0SA 2DGVA 5B0DA 3W62A 3IWXA 1HNVB 5GMKa 4B9UA 3GIJA 4O4GB 3FEXB 4JI8F 2XI2A 3QWPA 4QBUA 3OHAA 5D4PA 4Q0BB 3HP6A 2RQ4A 3D0HE 5DDOC 4KB7A 3J7A1 3TYTA 1S1UB 4RJVA 2HS4A 4KHMA 1HL6A 3EWGA 2EI5A 2MZSA 3HFVA 2H48B 4QYRA 3A3PB 5ETOA 1HMVA 4M5KA 3EPGA 5ETLA 3MWBA 3FDSA 4DI6A 4QWBA 2AJFE 3DC2A 3ITHB 8AT1B 3TAQA 2R7XA 1YJ9S 4RW9A 2HAFA 4ED7A 3AOCA 3CGIA 5HSPA 3KHHA 3UQSA 3NGDA 5H1SV 4K5RA 1S1WB 2LLZA 1GTHA 3L7PA 3HKWA 2FHJD 4OX8A 5J1EA 3T1HJ 5L9NA 4PXDA 2DO0A 5C2CA 4X4PA 1X4GA 1C0UB 4N41A 1PYTA 2A10A 4BWMA 2V94A 2VV5A 2XCPA 5KFJA 4EGLA 4Z7CA 1PBUA 2MHEA 3EJMA 4PXCA 4AL6A 1CLFA 2DR6A 4FF1A 3CCSS 2R7RA 1FRXA 2NXCA 1F9EB 5IQQA 3M9MB 4OX7A 4Y2CA 1Y5IB 2K2PA 3Q24A 2HVHA 1KLNA 3R1HA 2Y1JA 2K8GA 4XTTA 4MIBA 4YDXA 3S8SA 5BR8F 2AT1B 1NK8A 1P1LA 1WWHA 1HQEB 3HVRA 3MHYA 2L3MA 4JI7J 3RUBL 1GNKA 1DLOA 1TKTB 3W61A 5KG7A 3FRZA 3OV7A 2XULA 4PG5A 1NKCA 3HT0A 3QPIA 4ZIWA 3BSCA 4O23A 4TU9A 5KT5A 2O01C 3CJKB 2YY3A 1YJWS 3T6BA 2BE2B 2B4PA 2LDYA 2RDJA 9RUBA 5A8WB 1YJTA 1SB6A 2LXFA 3SEOA 3THVA 4M5JA 4LF8F 3RBZA 3H5UA 1I6JA 4OYXA 2VG6B 4KPYA 4J9OA 1HWKA 2BJEA 2KYZA 5HROA 1EARA 3I31A 4J9MA 5KG5A 3HVAA 3BKFA 5LJ3Y 3X1LB 3TARA 1R0BG 1S77D 2VPWB 3ZZRA 3CF5Q 1CJVA 3PJ9A 1FDBA 1I51B 2MZJA 4KGZB 1VISA 5I3QA 4ZVRB 1XR5A 2ZVIA 3ENAA 2F9JA 2OPRB 3IR6B 2R7QA 3CC7S 4IRDA 2WBMA 1U1NA 4CLYA 2ZZTA 2MJNA 1HBUB 3TR5A 4YOEA 2G0IA 4X62J 3FBCA 2B9XA 4WJBA 5KOXA 1K0VA 3N5BA 2HBRB 2B6AB 2CPXA 2BX6A 1IKWA 4Q7AA 3A13A 5T7LB 2XYPB 1DJ0A 2VD3A 2KDOA 4B9MA 1VYAA 2RE1A 3SCLE 3V6KA 1UVNA 1SH3A 4WKRA 2V34A 1S6PA 1RAGB 5KFXA 4Q5VA 5EUHA 4OZNA 4ELVA 1RT4B 3VAJA 2HVEA 2QE5A 1LV5A 1U2CA 3VR1A 2PI5A 2DNHA 2DRAA 2C3PA 3UDLA 4AQYJ 1LOUA 2G4BA 4DHVA 4CQ1A 1FNOA 1AFIA 3MGJA 1NSAA 2X1GA 3ZXWA 2DNYA 3NAHA 1WNEA 3MCSA 4O3RA 2XS5A 2MGZA 3ILLA 3E2EA 3MM6A 1F5AA 1W26A 2LQ5A 1YHQS 4X4RA 5J2MA 1FXDA 5M2UA 2PDAA 2MQLA 4LR7A 2H5JB 4H4MB 3KK1A 1CULA 1FFSB 4JI3J 2MKKA 1NEEA 1L3KA 2RF2A 3R1LA 3LALA 3SQGB 5B0BA 2BRKA 5DO2A 5GAHI 3QWUA 3NG8A 3BGLA 3MECB 2JC0A 4IO9Q 1KWMA 1U25A 2QJ3A 5HK4A 3NL0A 3BH6B 4LF4J 3HDSA 2HWHA 3CMES 1JKHB 3N5FA 3LW5C 2CJYB 1PCAA 5DDRC 4TYBA 2DITA 4UT4A 1UVKA 3TVKA 1WOSA 3H40A 4MYUA 2DGOA 4IG3A 2WW4A 2DNKA 2RUGA 4LFAJ 3C46A 3M30A 2M8DB 4Q2MA 3DGPA 3V4IA 2GV1A 4DV3F 4GVBA 2VFSA 3GFYA 4A8WA 4LUBA 5JVHQ 3GV8B 5G0RA 1S97A 3EDQB 1XNRJ 4P9SA 5D0RA 2GO9A 2P6SA 1FT8A 3NBPA 4QJVA 3IBFB 1TU0B 4DUZF 2BZ2A 3IA0A 4URGA 4DU8A 5CAAA 2XEXA 3RU0A 2NZ4A 1R6YA 4OJ3A 4EWTA 2NS1B 4NMLA 3DMJB 3OL6A 1SQFA 1R8PA 2L41A 2RQMA 1TELA 3SXLA 3MD1A 3T5JA 1EETB 4L72B 2AX1A 2BQ3A 2W4DA 2ZDPA 3GYNA 1HNVA 3G6XA 4RUCA 5LSRA 2V9KA 1U49A 3H20A 2DR9A 4O4GA 1H7WA 1P8GA 2EEYA 3OT9A 5AE3A 4WFNQ 3TW0A 2EG2A 3GG0A 2C2ZB 4DX7A 2LYVA 4MFBB 1OSCA 4Q0BA 2LDIA 3DU5A 1N52B 3T5HA 2MKJA 2HHHF 2V4RA 3C19A 4ALZA 2ZFHA 2XY6A 2XG8A 2UUBJ 5EN1A 2HGNA 1TKDA 5KFAA 1S1UA 2CJ9A 4JI1F 5F8JA 4O3SA 2D9PA 4DQRA 3B8HA 2ADCA 2JOQA 4DBQA 4ENOA 3PJWA 3QZ8A 1RA7A 2JX2A 1KQKA 3IFEA 1EQ0A 4OZJA 3ITHA 3FCVA 1GX5A 1WG4A 5HJXA 3DNCA 2FQQB 5BXIA 4M5MA 3LUYA 1R27B 1RQ0A 2UXDF 1X9SA 4YMEA 1S76D 3UN2A 3HVTB 1IWGA 1S1WA 1U1LA 2ZH9A 2PC6A 4ED5A 1FEHA 4USVA 4Z7YA 3AJDA 1DQ9A 1AUDA 1CJUA 2AU0A 1C0UA 4YP3A 1S4EA 1M0SA 1S1TB 2XMVA 4ETXA 2M52A 3V5RA 1VQ7S 1IBKJ 1VQLS 4K4UA 1KS2A 3OTCA 1CC7A 4NLYA 1VQSA 2CZVC 1T9UA 4IFYA 5KFTA 5FJ4A 1NU4A 4JI8J 3H90A 3FRYA 3GFZA 1Q95G 2NSBA 3UCUP 1HQEA 2NUUG 2AMCB 2KM8B 1JLAB 4OZ0A 2YH0A 4PWDB 2V8HA 4DL2A 1TKTA 4FP9A 2CNOB 3AD9C 2XS7A 4JBCA 3E3XA 1FE0A 3HX9A 1S49A 3PDNA 1EB0A 2LU1A 2BE2A 3IR7B 4C8LA 3EM1A 3D1OA 5A8WA 2BJDA 2IHR1 1WI6A 3PJXA 3MZIA 4RNMA 2EFOA 2BUNA 1NHKL 3P45B 3ISNC 5DJBA 4FPRA 4RNOA 1MWQA 4PYDA 2FVQA 2W8KA 2XWYA 3FFIB 2HYIB 2AEMA 4R5PB 1TUVA 2J7UA 3W2VB 3FBFA 3R2DJ 4LJMA 3DRXA 1UWAA 2OPRA 2B8QA 2CQ3A 3RB0A 3RRKA 1Q16B 3H0PA 4UTGA 4CDIA 1HBUA 3QSYB 1IR0A 2KL8A 3DI6B 1VC6A 3EZOA 1RTJB 5KFVA 1H2UX 2W4PA 2B6AA 1RAFB 3EVWA 4R0EA 2PN6A 2DPIA 5HBMB 5T7LA 3LGMA 2OO4A 2EFQA 5B7WA 5BR8J 3PW4A 1WD6A 1NKEA 4JV0A 2XM3A 4CTAA 3OSNA 4KRWA 1RT4A 2WSFC 1IQTA 4DCPB 3T5KA 4J91A 3ZTSA 2PSZA 2Q3PA 1QLNA 2ACYA 2P5VA 4LRBA 1U48A 5KFCA 4OIXA 4C3MA 5AJ3F 5L39A 1HW9A 2FDNA 3KJQB 3AOBA 3WDOA 2VKRA 2E5IA 4P6QA 2Y1RI 2XGPA 2HHWA 2XCAA 1R8BA 2IDEA 2MZQA 3R6LB 2NSCA 3ZZTA 3CC2S 4YB1P 4I2PB 3AA8A 3HHLA 5L1IA 5CZVA 2WSCC 4KO0B 3LPEA 3MMAB 3C2PA 2AGOA 2XZWA 2OTLS 1MSWD 4DZDA 1NUEA 2FJVA 4QIWD 1U0SA 1NK7A 3KLFB 1Y0HA 4XPEA 2WONB 4H4MA 1WSVA 4A8OA 4RNFA 4OHXA 3CD6S 2B0GA 1CSJA 1D9AA 4K4VA 3SQGA 3D9BA 6FDRA 3I87A 4Q8FA 2DTJA 2MKHA 2VFTA 3LWLA 3MECA 3M8PB 2KVQE 3H5XA 4WK1A 3TNVA 4J9VA 3TEGA 4RO0A 2HZCA 2HZAA 2PEBA 2FJBB 3U1NA 3DXSX 3GQCA 3BPDA 3GP9A 2BV3A 4RPFA 3FNNA 4ES2A 3GFXA 3CE8A 3SBMA 4DR2F 2DBBA 3K0JA 3UN3A 1TFYA 2XO6A 1OSDA 3R7NB 3BBBA 1M5SA 2FTRA 1N36J 4ECZA 3SIPB 4F4WA 1FKOB 2H1YA 2XBPA 1VRQC 5K20B 1D8ZA 3FSIA 1FWLA 3IM8A 4R0JA 5IWAF 4E98A 1W2IA 2RH3A 1VDHA 4LFBJ 1GXLA 4L76A 4KT0C 2B7BB 1QSLA 4NRTA 1NZAA 3I4HX 3BH7B 3IWLA 1XMOJ 1NRKA 1VI7A 2R3VA 2QV6A 3G71S 1DZ5A 3LP2B 2C1EB 3QIDA 3P49B 3PZPA 4M5HA 3R27A 1EETA 2VPXB 2WSEC 2A6OA 2H9ZA 3Q83A 1LFWA 5E33A 2MQ8A 2BRLA 1RABB 1EIYB 4J9PA 1IWAA 3OR2B 4TXSA 5AXNA 1Y00A 2GAHC 3NMRA 4MFBA 5KFEA 2GVZB 3ET6B 3M4XA 1JLQB 3CDBA 3G2XA 3ONQA 3HPOA 3QRRA 1AZSB 3MXHP 2IRUA 1RGVA 4CLLA 2BQUA 1HI0P 1HHQA 1OIAA 4MMOA 3BF4A 4LF7F 2KFYA 3QT7A 1YJVA 5L1KA 2KKHA 4JYAF 4RR5A 1QAYA 4F2SA 5A6PA 3JQJA 2QFJA 3AT1B 3MM7B 1TK8A 1GAOA 4HHUA 1HFEL 2FC8A 5JMNA 2Y0BB 2RS2A 4B9VA 2C3YA 4I6AA 3P96A 5IT4A 3F41A 4WK3A 2AEJA 3WHIA 3K58A 2H51B 2Z2ZA 3POTB 3MFIA 2JLGA 1DARA 2RRNA 3SDEA 2V2ZA 4BDPA 2FVSA 4IRCA 4DV7J 3UD4P 1S0OA 1WEZA 4FYVB 1S1TA 3KHLA 2IJFA 2MHNA 2DR7A 3TUJC 4ZLPA 4M95A 2QSWA 2DK2A 1BQNB 4PG8A 5C5JA 3CPWR 1X4AA 2GQQA 3J7AN 4AXJA 5ETSA 3GR0A 2WVCA 3NEKA 1U8WA 4AXIA 4ATNA 1S6OA 5DG7A 2E7WA 5C25B 2KJWA 5KT7A 4PG6A 3HHLC 1NPRA 3KJFB 2XMJA 3O2IA 1JLAA 4ZN3A 2DXEA 2VC1A 3TP2A 4PWDA 2MQOA 4CLFA 1FRKA 2HHHJ 1O0PA 3PKYA 3FQLA 3SV4A 5E7OB 1HWUA 4Q2LA 1JIHA 2ALZA 1T9WA 2OSQA 1UETA 4PQAA 3DOKB 4DL3A 2LECA 2LA6A 3BN7A 2KXFA 2VL1A 1ZETA 3K57A 4ZJLA 1S99A 2IMOA 3CJ8A 4IG0B 2ZEJA 2X51A 2R8JA 4TY8B 4NXMF 3DM2B 2QSFA 2CQCA 2LU2A 3FGVA 5D15A 2CXEA 1SVDA 5D0EA 4O3OA 2NXJA 3FFIA 3VAKA 5FLXU 4R5PA 4ECYA 2P8IA 3W2VA 3PM9A 2QZ8A 5K9FA 1T8EA 5K8PA 4ED8A 4ELTA 3M9OB 3NOGA 4U8VA 4Y2MA 2R2UA 4WPAA 1KTQA 2DNPA 5AXLA 4ED0A 1QD1A 2VOOA 4NYOA 1CC8A 1WG5A 1HPZB 1ELOA 1KQSR 3DI6A 2BYCA 1S57A 2W9AA 3EMTA 1SL1A 2N3OA 1KLMB 1QSSA 1RTJA 5KFYA 3K59A 5F9LA 2FLNA 1UW4A 5KG3A 4GKKF 5HBMA 3NNHA 4WZMA 3VGVA 4CH1A 1SL0A 1U1RA 2CJBA 1SQEA 4OYAA 1UPPA 4JI4J 2EXUA 2AGPA 1GMWA 4WFAQ 1YITS 5LXRA 4USKA 1RACB 2WAQD 2ZNZA 2ILYA 1JXLA 4J9UE 2D3O1 3JAMU 3UNYA 3SZ2A 3BZQA 1NZ8A 1WELA 4P2MA 3UO0A 4EK2A 2RUSA 5H9EJ 4C2MA 4DSIA 3CCTA 3KNGA 3R7BB 1NK9A 2UXBF 2OD6A 1M1KT 1X5OA 3WC0A 5F9NA 4DR3F 1YRUA 4LSLB 3CCZA 3D66A 4EYIB 2FPHX 4JI0J 1IVZA 4BC9A 3RRGA 4QWAA 4K4YA 2EK1A 4WP3A 5B0AA 1BMQB 1RSCA 4DPWA 2J6UA 3ISND 3BEGB 1R8HA 2J9CA 5DETA 2HZVA 4KO0A 2D9OA 3MMAA 5KT3A 2J0SD 4NXNJ 1JLBB 2JFDA 3N28A 4A8QA 3R2CJ 3KLFA 5DG9A 2NYIA 2HW3A 4QYZJ 2WONA 3U27A 3HMJG 1XEZA 4O3NA 5HVGA 3GLJA 4USUA 2AX0A 2QC3A 2ZVSA 3BGRB 3JTPA 1VCTA 3UCZP 4YB6A 4W92B 4A8MP 3NP5A 5EX0A 1Q79A 3JTOA 4P75A 4WXOA 2KT2A 3M8PA 2CQ2A 3K5NA 3CJSA 1T11A 5JJBA 2BABA 1U1OA 3CD5A 3IC1A 2B3TB 2V67A 4DFKA 1A0OB 4P7VA 4EBEA 2ZKUA 4JV5J 2WOMB 4OYWA 3IBCB 1HD0A 4DR4F 1L3SA 4M5LA 4NCGB 2FJAB 2CFXA 4YDDB 3QRPA 1Q5YA 4WWSA 1R8AA 2VONA 3NLCA 3WIUA 1XQIA 1HNWJ 2A2CA 3U1LA 2CVIA 4B9NA 3HZGA 1FKOA 3EVMA 4DDFA 4F50A 4B3SF 1N56A 1PKUA 3DLGB 4F3QA 5KFBA 3CUNA 2HHXA 3E8OA 2KM8C 1RXOB 3GFHA 5A0YB 3LP0B 2J7KA 2YQ1A 3ZZZA 1DTTB 2XI3A 1G7CB 1ZTTA 4DR1J 4HH0A 4DSKA 1OY9A 2OUGA 5IQ6A 3QJLA 5KFSA 3LP2A 1AB8A 3MUMP 4HDHA 2R42A 5DGBA 2DNOA 2OIHA 5ADZA 2RB7A 1J5EJ 1N0VC 3X3UA 3IO1A 4QR0A 3UN5A 5ETPA 2CIMA 4YY3F 3BKUA 2E5HA 1A7GE 2QTWA 3W8GA 2MPUA 2H4WB 3A4TA 2DNLA 4DUYF 3ET6A 3UDVA 2W2OP 3T41A 4AYBD 1NJXA 2BXJA 1AZSA 5GADU 1Z2ZA 2UV8A 3ILIA 1O6XA 4I0WA 2Y8YA 2FJDB 2L9NA 1AT1B 2QL7B 1UEKA 4DSJA 4QR1A 3M7VA 3MPDA 3QFHA 1IR1A 4OHWA 4DR2J 1E6YB 1K8AT 1F6TA 4KTQA 5CZXA 3M6UA 3VVTA 3C16B 2BOAA 3RB4A 4NLUA 2BE9B 2FJXA 1XMQF 1H74A 3MM7A 1DAXA 5KFGA 1N54B 2UUAF 1K1QA 1Q53A 2D41A 2PMHA 4B02A 2ZH2A 3QJPA 1TAUA 3AJ2A 2KT3A 4K0KF 3L7OA 1N33F 2ERRA 2LCWA 2F8HA 2G1HA 2YNGB 2WRMA 3CDEA 2ZJPQ 3D6FB 2RRBA 3POTA 2X1AA 2H5IB 2PE8A 2P9GA 2MB0B 4ZPBA 2V68A 4BCAA 4I7FB 1XJWB 2YKPA 4LRCA 2N4DA 2IDLA 1TKZB 4ZVGA 5A8KB 2V50A 4V19J 1DFDA 5ETRA 2E5JA 3TAMB 3IAM9 3EXCX 2LEAA 1BQNA 5B0CA 2D1CA 1RB0A 3VVUA 2YPYA 3C66A 4Q43A 2JLFA 1F5BA 4EZ9A 5F3ZA 3Q8YA 2KJVA 3VV2B 5DGAA 1F9FA 4H54A 1Y5NB 3EGVA 1DHMA 3M6XA 1W7WA 1JK9B 1WTBA 3CW2C 2Z2LA 3VHQA 1GX6A 1U7LA 4HL9A 1TK0A 4DV6J 4B3RJ 3DOKA 3MR6A 5D4NA 4LSNB 1D8YA 5EHHA 4B9TA 4X66J 3CMQA 4CWBA 3H4DA 4IG0A 1F5CA 2AW0A 2EFVA 1Q8BA 2JEJA 4TY8A 2FLOA 1R3NA 4G6VB 4O3PA 3DM2A 4I69A 2F4FA 5I3UB 4MTPA 4NPOA 3UD5A 4OI6A 4I6YA 2ZOGA 4D3HA 3T3FA 1QJHA 4ECRA 2Z8QA 2IIHA 3BPSP 7AT1B 1PC4A 2UVWA 5HQMA 1YI2S 2W7AA 4F26A 4C97A 5CXTA 4DV2F 3A8IA 4YQWA 1DURA 5E5NA 5K5MA 5E2QA 4M5GA 2BDPA 1KLMA 1I94F 3R97A 5GMDA 1ZPVA 3H42A 2VFUA 1S1XB 2IVYA 1LW2A 4CO1A 2KG1A 4ZP9A 4ID5B 4TY9A 3HHLD 2ASJA 4ZDNA 5K8NA 4M5DB 2W4CA 3I9V9 4KH0B 5EDWA 1X4HA 3AFGA 3KTQA 4DU7A 1B0PA 1NPPA 4X65J 5HLFB 2X1BA 3Q23A 4ZA1A 3R5AA 1NK6A 4DFJA 2M0GB 2RVJA 4LSLA 2DNZA 3MPWA 3VF0B 4WIQA 3GWCA 1TMJA 3I32A 3QGHA 3UCGA 1EP4A 2B56A 4RW7B 5J2PA 1SV5B 1RT6B 3M05A 4ECVA 3D67A 3UPFA 1A6LA 1MWZA 1RT2A 1U2RA 4OI1A 2ZH5A 1JLBA 4ZN1A 3A3NB 2I6WA 1UKUA 2OH2A 3FUYA 3MURP 4A4JA 2F63A 4AD6A 3MR3A 4I6WA 2EG1A 1Z2LA 3VWSA 1RTHB 4DL0C 4KHPF 3G9CA 2KU7A 2K1RB 4G1IA 2RS8A 3HD2A 2Z2MA 4CLTA 3QGGA 3O6QA 3MM9B 1KR4A 1U0HB 1AFJA 2FZCB 4RW8B 2XLIA 5M2RA 4GKKJ 3PIPQ 5C2GA 1PJ5A 5ETQA 1IQZA 5G4DA 4IFVA 5HQ8A 4WP9A 2D69A 1MU2B 4F4AA 3DDKA 1VQ8S 1DBDA 4DR7F 3TX0A 2VUGA 3TZXA 4OZ1A 2J9EA 1EAYC 1H72C 2HSEB 3UW1A 2ZUGA 3MMJA 4PQUB 4MK9A 1U26A 4B08A 3U7JA 2AYMA 2WOMA 5LT5A 4HTIA 1TL5A 2GS8A 4JI2F 3VQTA 3K5LA 3DRSB 4OYBA 2OEJA 4TU7A 1BHNA 3NCRA 2W2MP 3GILA 2F5GA 4KYZA 3OTDA 1RTIB 4X4VA 3DLGA 3K5MA 3J80Y 1SQGA 5A0YA 4W98A 1YBUA 3EPIA 3LP0A 2FJEB 3ISZA 2IAJB 3H7HB 1DTTA 4Q45A 2BACA 1QAJA 1H98A 2EBGA 4FYXB 4MYTA 2KRRA 4GC6A 3DRYA 1FX4A 3WX4A 4YR2A 1R89A 3AB4B 4X4OA 3BQ2A 3BB5A 5C42B 3MMCB 4MIAA 1RWPB 3GIIA 3M2RB 1VQ5S 5DLGA 1YK9A 1J27A 1DY3A 3S01A 3T1AA 4KC5A 1F2GA 4ZPAA 4F0MA 3OQ2A 2R7UA 1IXKA 4FNHA 4X2BA 4U96A 3TRGA 5J2QB 4C8MA 1YZ7A 1WTFA 1WACA 2DJWA 5H9EK 4OHYA 2RRAA 5CD4A 1VK8A 2AZ3A 5E3RA 1SC3B 3RBDA 5D0GA 4XK8C 1JMTA 2G2YA 2A3JA 2OTJS 2CZ9A 2E1PA 3KKFA 4IKAA 5DG8A 2IRYA 3EGNA 3GCWP 2V2KA 3THTA 1E6YA 4F7VA 2NXNA 4QQBA 3G8SA 3C16A 4DR4J 2LMIA 2CNLB 2C2MB 3LOUA 3PACA 2XZTB 2RJZA 2OEMA 2WCXA 4DN0A 1JNRB 4KGXB 4A8XA 3PO5A 2KH9A 4OYIA 3DLHA 5IV4A 2AYBA 3W3SA 2YNGA 1ZYQA 4L6V3 1Y7PA 3CD0A 2BW2A 1TFWA 4FN5A 2H65B 1SXLA 4QOTA 4QYZK 1P9QC 4DV1F 1LWXA 1QE1B 4ZITA 2G2ZA 4I7FA 3LP1B 1TKZA 4NLVA 4C6AA 2Z57B 5F8HA 5A8KA 3R7SB 2CPYA 1RTDB 1ZS6A 2ZKTA 3TAMA 4U7UK 1NK5A 2CPIA 2YKQA 3AOAA 1WC5A 4FBTA 4LF6F 4ILMA 2VH7A 2VFVA 1UZHA 3IRWP 4ZCIA 4MH8A 4OYZA 3L95X 3CJ3A 2UU9J 4MAKA 1LNQA 4NYPA 4CIOA 2HNZB 5HQLA 3ZFVA 4B9SA 4ZP6A 1JJ2R 1KOHA 3GIKA 4LSNA 2D3ZA 4IOCQ 1LQ9A 2V6AA 1LXJA 2AYGA 1XK8A 4ETZA 4NEZA 2FLPA 1XMQJ 2J7WA 3LGHA 5FDLB 3TUIC 4U9RA 1C1BB 5I3UA 1FRLA 2ROPA 4FYWB 3TA2A 2I38A 2KZZA 1UL3A 2RILA 1GMWD 3OL7A 3W9IA 4RW4B 2LEBA 2QMWA 5KFIA 2AIRB 2XQCA 2V8DA 4DL4A 5IC6B 2ZC3A 3OJUA 4KGKA 3KG4A
chains in the Genus database with same CATH topology
4FPRA 1TP7A 4RNOA 2MZRA 4LF9F 5ITHA 4C8YA 1LK5A 2XLKA 4EBDA 1W25A 5I3PA 1OPZA 4NLWA 1D9DA 2FVQA 5CYQB 2E66A 4Y34A 3RZAA 2W8KA 3OR1B 2J0XA 2MQMA 2KN4A 2XWYA 4PCQA 3FFIB 2HYIB 5GAHU 3VAIA 2VBWA 2JVOA 4R5PB 1IBLF 1RT5B 1TUVA 3CCUS 2IYIA 2DNMA 2J7UA 2ZNYA 3W2VB 3KJVA 1S10A 2FHMA 1FRJA 7FDRA 1S1XA 4LJMA 2N4CA 2E9RX 5DDQC 2VODA 3DRXA 5IXUA 1VRTB 3IG1B 4OI3A 3DLJA 2OPRA 2CQ3A 4ID5A 4WFXA 5T14A 4NLSA 1Q16B 3RRKA 5DDPC 3RB0A 3KLIA 2CPDA 2C3MA 3BSOA 2P9CA 1K73T 1HWJA 4P2SA 1HBUA 1IR0A 4N8OA 4XIUA 3DI6B 1U6FA 2WB4A 4YHHF 3Q8QB 1VC6A 1JLGB 4F67A 4M5DA 2JJ4D 3OPKA 2J6SA 1RTJB 2P9EA 5KFVA 1H2UX 4ES3A 1UFWA 2W4PA 4IDKA 2B6AA 2FC9A 1Q1KA 4JI6F 4R0EA 2PN6A 1VBZA 3GSDA 5B0GA 2XMKA 2DPIA 5HBMB 2CQ1A 5T7LA 2I1RA 1IUJA 3LGMA 2OO4A 3DHWC 3K2YA 4QW8A 4KSEB 2EFQA 5A8RB 3EYZA 4ILRA 2HHVA 1RWUA 5B7WA 1SH2A 4WYWA 3PW4A 3M8SA 3PRDA 1SJ1A 2I5JA 1KHVA 1X0PA 5FD1A 2DT9A 1HBNA 5KFOA 1WD6A 2VG5A 3KFWX 1NKEA 4JV0A 1YSJA 1VGYA 4NLGA 2HFNA 1G3OA 4CTAA 4LIRA 1TL1B 2E5LF 3OSNA 4C4WA 4KRWA 1RT4A 1HNIB 2WSFC 1IQTA 4CTAB 2KTQA 1NB7A 1U47A 3T5KA 1PC5A 4B3OB 2UV8G 3AB2B 4XAKA 2PSZA 1VBXA 4RW7A 4K2XA 1FE4A 3G6VA 1U2FA 2Q3PA 1SV5A 3CEDA 1QLNA 1RT6A 2ACYA 3CDWA 2P5VA 1U48A 3M6VA 1RKJA 2YVSA 1B7FA 4ZOSA 5KFCA 3MR2A 3DRRB 1IM4A 2AP6A 1M5HA 2EK6A 3I96A 2E1MC 4OIXA 4C3MA 5JXSA 5GAEU 5AJ3F 2DO4A 1Y3JA 2D3UA 5KT4A 1X9MA 3KWMA 4PR6A 4QPXA 3CCRS 3VAMA 2B9WA 5L39A 1MNEA 4GC7A 1KVIA 1HW9A 2FDNA 1N36F 2VG7B 2O3DA 3WDOA 2XY7A 1X4CA 2VKRA 2BANB 3ENQA 4KKOB 2E5IA 3FZ2A 4P6QA 2Y1RI 2XGPA 4PKDB 1HQUB 4MKAA 2HQ3A 5F8MA 1JB0C 3GMGA 5AE2A 3CCJS 2HHWA 2ZOMA 3MMBB 4Y3CA 1ZZFA 1H0HB 3HLUA 3BO4A 2Q79A 5KG2A 2XCAA 1R8BA 5E3QA 2CQHA 2LEPA 5IM0A 5D3GB 2F9DA 2MZQA 3BDEA 3LPYA 3SFUA 2NSCA 1YQHA 4OLPA 3ZZTA 5KG6A 3QO9B 4MJKA 4I2PA 1NKBA 3CC2S 2IC3B 4FZVA 4RLEA 4PG7A 2PA8D 3BGUA 5KT2A 4YB1P 2DR8A 3D1QA 1IBMF 3KK3A