1SUQB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r185545
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 95
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1suqB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1suqB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1suqB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1suqB03
5C42B 1WNEA 3IG1B 4NZ0A 1ZETA 4O3PA 2JEJA 1RT7A 2OPPB 4IG3B 5HLFB 3CWJA 3H59A 2YNHB 3QLHB 3BJYA 4KAIA 1EP4A 4PQUB 4ZVFA 4RW8B 4KSEB 1RAJA 3QGIA 1JXLA 4RZRA 1RT4A 3EZUA 4QWCA 3KLEB 4JUZA 3IS9B 4RUCA 4XPEA 4MK7A 3CJ5A 4NLQA 3GIIA 4DL7A 4ZPDA 2C2DA 3LP0B 4YR2A 1N56A 3QO9B 4URQU 3DMJA 4O3RA 5EDWA 5J2PA 3M9OB 3FQLA 4K50A 3H4BA 4IR1A 3LAMA 4RW9A 1RTJA 1DTQA 1OS5A 5J2NA 3GYNA 4EBCA 3T5KA 3I5AA 2JLEA 5HBMA 1RT1A 2CJQA 3DI6A 2GIQA 2HNDB 4NLXA 2W7PA 3RB0A 1FK9B 4K4XA 4ECZA 1TQLA 1N48A 3KLIB 3TAMA 3UQSA 3KHLA 1I6JA 2BRLA 4B3OB 4WZMA 1LW2A 1QE1B 5D3GA 3H5SA 2IBKA 2BE2B 1RA6A 1RA7A 3DRSB 1RTIA 4R0EA 2VG5B 4H4OA 3C6TA 2EC0A 5KFDA 4ECVA 1HMVB 1TL3A 4PWDB 3LANA 4F50A 1HQEA 3HKWA 4IOBA 2J6SA 3BQ1A 4R5PB 4NCGA 4ZPBA 4HYKA 4URSA 3RB3A 4WE1B 4ECWA 2HMIA 2R2SA 2OPSA 3BGRB 4NLVA 1C1CA 5J1EA 4TY9A 1JKHA 1CSJA 2YNIA 3HHKA 4K4ZA 1C2PA 2RF2B 3DOKB 5CYQA 1RT6A 3MECA 2YNFB 5KFXA 2WB4A 4KFBA 5K14B 1JLBA 5J2PB 1N6QB 5KG3A 1TKZA 1RT5B 4QPXA 4EBEA 4NLYA 4ECRA 4TYBA 4EO8A 3KLHA 2R8GA 1GX6A 4NLWA 4JV1A 1S9GB 2OPQB 1HNIB 4O4GB 3V4IA 3E51A 2E9RX 2ZE2A 1KHVA 2VA3A 5L9XA 4ED7A 1T05A 4KO0A 4MFBB 1BQNB 3OLAA 4O44B 4MKBA 2W9CA 1VRTB 1HQUB 3KMQA 1JLQA 4H4MB 2B43A 1RTHA 4IG0A 5D3GB 3JYTB 5F8JA 1BQMB 3PR4A 2D3UA 4DL2A 4ECSA 1JLFB 1DLOB 3G86A 2AGPA 5HROA 1LWCB 5T14A 1HNVA 2B5JA 3Q8RB 2E9ZA 2WHOA 5KFUA 4F4YA 1KHWA 2R8IA 1C1BB 1S9EB 1T03A 3CVKA 5KT3A 5L1LA 2XCPA 3MFHA 4WYLA 1N5YB 4NLOA 2IC3A 3MTKA 5KFOA 5KFCA 1VRUB 3DRRA 3MEDB 5KFHA 2ASDA 4TQSA 2YNIB 3BSOA 3VQSA 4GC7A 1UWBB 3H4DA 4J9NA 2AX0A 1NNDA 3V81B 4IR9A 2XGPA 3BREA 5F9NA 2AU0A 3IRXB 2IM2A 1IM4A 1QAJA 3LP2B 4EYIB 1RT3A 4NRTA 3V6DA 1DTTB 1JLCB 1MU2A 2R8HA 2ATLA 2GC8A 2XI2A 1RTDA 2FLPA 1LW0A 2WONB 2W7OA 2J6TA 5KFNA 2C28A 5EUHA 5I42B 5KG7A 4DL4A 3PZPA 2JEFA 3DOLB 2ILZA 2IJNA 4O3QA 2FLNA 4TY8B 3H5XA 1S6PB 2JEGA 3CO9A 3I0SA 3TQ1A 1TL1B 3M8QA 2HWIA 1RTHB 4JV0A 2WCXA 5KFAA 2VG6A 3PR5B 2V4RA 1FKOB 1JLEB 3GV8B 5J2MB 4IRCA 2OPRB 4RW7B 1S0MA 3KHGA 5C24A 5HP1A 5KT2A 4IFYA 1IKYA 2RDJA 3OL9A 3DM2A 2CKWA 2RKIA 1S6QA 3KLFA 4WFYA 1FKPB 3NAHA 2ASLA 3KK1A 5KFBA 5EWGA 2B6AB 4EYHB 5FDLB 4WYWA 3E01A 4IH7A 4ZP7A 4URGA 4KKOA 2C22A 4G3IA 5KT5A 1S1WB 2BANB 2FVCA 2I5JA 1SH2A 4J9RA 4O3OA 3I5CA 5F8LA 2YKMA 3ISNC 3H98A 5F8NA 4WFXA 3HVTB 5F9LA 5KFEA 3OL6A 1LWEA 3T5LA 2BQRA 1TVRA 3KK2A 4MIBA 3DLKA 2HAIA 4RW6A 3OL8A 2FVRA 1K1QA 4ZPAA 3FDSA 4KHRA 2DPJA 3SI8A 4J9SA 4LQ3A 3I0RA 2WOMA 1IKXA 4ICLA 4ZHRA 4YR0A 5KFSA 3GIKA 2HNZA 3GILA 3C6UA 5KG2A 2QE5A 2YKNB 4ID5A 4LSLA 3GV7B 4Q0BA 1IKVB 4QW9A 5CYMA 3MR6A 1K1SA 2BR0A 5KG4A 3Q8QB 3OHAA 3MR5A 2UVRA 3PHEA 3GV5B 4FBUA 5L1JA 3ITHA 4YQWA 4DG1B 3PW2A 4ECUA 2VA2A 1C0TB 1TV6A 1REVA 2I1RA 4QWAA 1RT2B 3DRPA 4IFVB 4PUOA 1MMLA 3MEEB 1J5OB 5KFQA 5KFPA 2UVWA 4NRUA 4RNNA 2IM1A 3DYAB 3FQKA 1LWFB 4RUAA 4FS2A 4TQRA 2ZD1A 3T19A 1C0UA 2F8EX 1HPZA 5F8IA 1RT7B 4ZVEA 4K4VA 4KHMA 3UDLA 2FJWA 2R2TA 1EP4B 3D5MA 2W8KA 3CJ0A 3QGGA 3QZ7A 4RNMA 1EETA 3KJVA 5J2QA 1RT4B 3N6MA 1JLAA 4WXOA 1NHUA 2BQ3A 1TKXA 4EEYA 3HVWA 1R0AA 5KFFA 4YMEA 2YNGA 4M95A 4J9KA 2W8LA 4HKQA 3DDKA 5KT6A 1KLMA 3DMJB 2FLLA 4RW9B 1S10A 2HNYA 4QWBA 1RTJB 4GC6A 1DTQB 1S1UA 5C25A 3MEGA 2BQUA 2VG7A 5J2NB 1ZTTA 3BQ2A 4YR3A 2E9TA 4YP3A 5HBMB 5I3UA 2WRMA 1RT1B 3DI6B 4G1QA 2W9BA 3RB6A 4IKAA 3M8PA 4RW4A 3NGDA 5KFJA 4R8UA 1S1VA 3TAMB 4KV8A 2FJXA 3OSNA 4TN2A 4J9OA 4MK9A 4O3NA 4WFZA 1LW2B 5DLFA 3KK3A 4DL6A 4FS1A 5F8GA 1RYRA 3ICLA 4Y2AA 2J6UA 3CIZA 1JIHA 1RTIB 1SH0A 4H4OB 3C6TB 4LQ9A 3DLGA 4K4TA 3QIPA 5DGAA 1TL3B 1IKWA 1HQEB 3KMSA 4ZVHA 4IH5A 4IDKA 4NCGB 3GIJA 1SUQA 5KT7A 4IQXA 5KFYA 3BQ0A 2HMIB 2OPSB 1C1CB 1TKTA 4ED0A 5J1EB 3GQCA 1JKHB 2D3ZA 1S49A 3MF5A 3G6XA 3PJXA 5KFMA 5EWFA 4O3SA 2ASJA 5CYQB 4I2QA 1RT6B 1XR7A 3MECB 3CDWA 4QWDA 3MR3A 4LSNA 3G6VA 2R8KA 4KFBB 1JLBB 2IAJA 4ZP8A 4Y34A 1NHVA 4ED8A 1TKZB 1Z4UA 3FFIA 4I7FA 3M9NB 2OH2A 3KLHB 5DG7A 2DPIA 3NBPA 4U7CA 4F4ZA 3V4IB 5C5JA 1S1TA 2ZE2B 3D28A 1S1XA 5EWEA 1JLGA 1D1UA 1SV5A 3JSMA 3KLGA 1T05B 3PJWA 4KO0B 4NLRA 3SFGA 3EPGA 1XR6A 3DLEA 4RU9A 2W9CB 5C42A 3IG1A 3NL0A 1JLQB 4IRKA 4IG0B 2OPPA 4J9PA 4IG3A 5HLFA 3BSNA 4ED2A 4ZP6A 2AGOA 2YNHA 3QLHA 4H54A 3UR0A 4PQUA 4RW8A 3LAKA 5HROB 4EO6A 3MR2A 1HNVB 3KLEA 3HVAA 4WXWA 3V6KA 2B5JB 3IS9A 3N6NA 3OHBA 1JX4A 4Q45A 2D7SA 2FVPA 1T03B 3LP0A 4K4SA 2BRKA 3H2LA 3QO9A 2IC3B 2V9WA 3CJ3A 3DRRB 1W25A 3H5UA 2ZKUA 4MKAA 5DLGA 4Q8FA 4RNHA 2QV6A 3T5HA 3RBDA 4KB7A 4O4RA 2ALZA 2FJVA 3PW4A 1T3NA 4NLDA 2IM0A 4ECXA 1D0EA 2XC9A 2HNDA 1RT3B 4F4XA 3V6DB 4Y3CA 1FK9A 1MU2B 4Y2CA 3KNAA 3KLIA 4Q8EA 1RTDB 3ISND 1LW0B 1S4FA 5L1KA 4B3OA 4K4WA 2XGQA 5KG5A 4WZQA 4TXSA 1QE1A 2BE2A 3DRSA 5DGBA 2VG5A 3I0SB 1TP7A 1XR5A 1S0OA 3M8QB 3NKYA 1HMVA 4PWDA 2VG6B 2IA6A 3I5BA 4R5PA 5C24B 4WE1A 5HP1B 4IFYB 1IKYB 4NLTA 4IH6A 4IRDA 3BGRA 3DM2B 4MH8A 2RKIB 1S6QB 3KLFB 2C2RA 4J9LA 2XWYA 4DL3A 3BSAA 3TVKA 3KK1B 2RF2A 3DOKA 2C2EA 3PVXA 4ECTA 2YNFA 3E01B 2IJFA 2W9AA 4KKOB 5K14A 1N6QA 3RAQA 1RT5A 2I5JB 4RNOA 2YKMB 1S9GA 2OPQA 1HNIA 4O4GA 5KFLA 5KFRA 4ED1A 1LWEB 5KT4A 3H40A 1TVRB 3KK2B 3DLKB 2IM3A 4RW6B 2ILYA 4MFBA 1BQNA 4O44A 3I0RB 2WOMB 1IKXB 4ICLB 3T1AA 1VRTA 1HQUA 4ZHRB 2HNZB 1YVFA 3BR9A 3C6UB 4QW8A 2UVVA 4QWEA 4H4MA 4ID5B 5KFVA 4LSLB 3JYTA 1BQMA 4Q0BB 2JC0A 4ZMMA 5KG1A 3Q8SB 2XCAA 3KLVA 3PW7A 4XO0A 1JLFA 1DLOA 5CYMB 2WK4A 3V6JA 4Q44A 1LWCA 2RDIA 5KFTA 3T5JA 3IGVA 3ITHB 3N6LA 1C1BA 1S9EA 1TV6B 4NYZA 5KFIA 1REVB 4ED3A 1N5YA 4PUOB 3DRPB 4OL8A 1VRUA 3MEDA 4NLUA 4ECYA 3LP1A 1UWBA 3H5YA 4F4WA 3V81A 1GX5A 3OL7A 4NLGA 2ZD1B 1SH3A 1C0UB 3CDEA 3QYYA 2IMWP 3IRXA 1HPZB 5KG6A 1U09A 1QUVA 5KFKA 3LP2A 5DG9A 3NAIA 4RNFA 1DTTA 1JLCA 1S9FA 3CJ2A 5DQHA 2WONA 2XI3A 1EETB 3KJVB 5J2QB 4M94A 2WTFA 1JLAB 1ZTWA 5I42A 4NLPA 4KBIA 4MIAA 3DOLA 1TKXB 1R0AB 4TY8A 5DQGA 1S6PA 4I2PA 4XPCA 1T94A 2YNGB 3MFIA 3RBEA 2R2UA 1HYSA 2D41A 1N4LA 3QIDA 3OLBA 2O5DA 1TL1A 4KE5A 3M9MB 1KLMB 4ECQA 2R8JA 4FBTA 1FKOA 4TLRA 1JLEA 5J2MA 2OPRA 4EBDA 4RW7A 2HNYB 4ZPCA 5JXSA 3Q8PB 3KHHA 1S1UB 4ED6A 3PW5A 4NLSA 5C25B 3MEGB 2VG7B 4Q43A 5L1IA 2AGQA 3CDUA 1S97A 5I3UB 4DEZA 4G1QB 4U6PA 1FKPA 2W9BB 5KG0A 3IN5A 3M8PB 4RW4B 2B6AA 5JUMA 5FDLA 4ZVGA 4K4YA 1HARA 2AWZA 1S1VB 4R8UB 4KV8B 5KFGA 4X2BA 3KHRA 2UUTA 4J9MA 2HWHA 3LP1B 3QGHA 1S1WA 2BANA 3KK3B 4MK8A 3RB4A 1S48A 1RYSA 2R2RA 3OSPA 2FVQA 5KFWA 3RAXA 3G6YA 3V6HA 3HVTA 2V4QA 2V0NA 3DLGB 3QIPB 3QZ8A 1IKWB 2JC1A 5F8MA 4IDKB 3FRZA 4J9QA 1SUQB 1QAIA 3UPFA 2GIRA 3IGNA 3EPIA 1S0NA 3CJ4A 3NMAA 1TKTB 2YKNA 2UVUA 2JEIA 2UUWA 4K4UA 3KOAA 1IKVA 4I2PB 3SFUA 1HYSB 4I2QB 2FVSA 4LSNB 3LALA 4ZP9A 2IAJB 5DG8A 4DL5A 3FFIB 4I7FB 4DG1A 1RDRA 3PW0A 1C0TA 5KFZA 4JV2A 3FSIA 3NBPB 5DQIA 3GIMA 1RT2A 1S1TB 4IFVA 5F8HA 3MEEA 1J5OA 1S1XB 1JLGB 3BSCA 2AX1A 4TYAA 1SV5B 3JSMB 2AQ4A 3KLGB 3DLEB 3DYAA 1LWFA
chains in the Genus database with same CATH superfamily
4F02A 2CPYA 4QWCA 2C2MB 2NLWA 2YWGA 5H1SV 5J2PA 3M9OB 2N4DA 1REGX 5B09A 2HNDB 2P9EA 4X66F 2I0XA 3OTEA 2HW3A 4CT8A 3CJSA 1U6BA 4X4VA 3HHLA 4WIQA 3K2YA 1U02A 5DDRC 4NZ6A 2DGWA 2LKZA 3GYGA 2F8HA 2XM3A 1RT6A 4ERDA 5J2PB 3VGVA 1W2BR 2FQQB 3GR1A 3H25A 3E51A 3FKBA 4A8XA 2E1CA 2W9CA 2NXUA 1OQ6A 3KMQA 4DR3F 4IG0A 3MPVA 3AOBA 2ZH4A 4BLGA 4MKVA 2GCFA 5T14A 2E1RA 4L72B 3CVKA 2DNGA 3F44A 1B0PA 1IM6A 3VQSA 1ZPWX 1Z1ZA 3EWGA 3IC1A 4OI4A 2XYPB 1QAJA 4QBUA 1LW0A 3POTA 7FDRA 3SQOP 2Y8YA 4USHA 2QL5B 1J5EJ 2PGCA 1TL1B 3D3CJ 1JLEB 5J2MB 2LXIA 1TUVA 2CKWA 3KLFA 1FKPB 4X4RA 5EWGA 4KKOA 2FJEB 2XSJB 2YKMA 3BO4A 1R6YA 2DO0A 4ID8A 4NI2A 3EGVA 1SQGA 2HBRB 5CXTA 4CWBA 5KG2A 1HBMB 4OJHA 2H65B 1GQEA 2HS4A 1D3WA 1REVA 1GK8A 3M05A 4H4KA 2P8IA 2EFQA 5LM7E 1LWFB 2KYXA 5K8MA 4LSZB 2DH8A 2IYGA 3QBCA 4W90B 1KR4A 1W26A 4CDIA 1EP4B 3OFEA 3BV8A 4LFCJ 1TKXA 4KTQA 2HVEA 2HFSA 4P7VA 5K8OA 4WFBQ 2F8MA 3J81U 5BYQA 4E8UA 4UTGA 3W9HA 2LA4A 1Q78A 1NJZA 3T9ZA 4JI5J 3W2WB 2DGUA 3BQ0A 5THWA 3DRXA 4QQBA 4OI6A 1IBCB 2PEBA 1XR7A 1OPIA 3MECB 3BBFA 3FFIA 4C8NA 2ZH9A 3PX6A 4F4ZA 2LLZA 3DHWC 4P10A 2YPZA 3H2VE 1T05B 2Q1LA 4D3GA 3SFGA 1XR6A 5CQGA 4MT1A 4LRBA 3HO1A 2ERRA 3WZ0A 4KH0B 5EHHA 1YJNS 2YKOA 3N6NA 4Q45A 4K4SA 1T9UA 3EGZA 2G2ZA 3QO9A 2V9WA 2XWXA 5G0RA 4LUBA 4CO0A 1U48A 4OLOA 2E5GA 4I56A 4KB7A 2FJVA 2O1PA 4ECXA 1J2VA 1MU2B 3KNAA 2AJ4A 3F73A 4WZQA 1KRPA 1CC8A 3DRSA 1HBOB 4I69A 4PWDA 3UD4P 1JNZB 2M8DB 4HH0A 1RQ0A 2VBZA 3DOKA 1N6QA 2HVIA 1YBAA 2A10A 1XEZA 1Q53A 3MPYA 1IR2A 3N01A 3UWTA 2JC0A 3W65A 2WK4A 3EVOA 2O3DA 3D6HB 1KONA 4ER8A 2AT1B 4C98A 2NUUG 5D0EA 4KPYA 3SIPB 3OL7A 1T9TA 3CDEA 4NA1A 1WG5A 4RPFA 3LP2A 5KOXA 2FJAB 1S9FA 1HI1A 1L3SA 2B4OA 4ECQA 4FPRA 5HQMA 4YHHF 1OWXA 2J9CA 4TLRA 4RW7A 4LJMA 3GG0A 4PXBA 5FD1A 4G1QB 2W9BB 4ZVGA 4X2BA 2UUTA 4J9MA 4ZCKA 4MK8A 3UW1A 2MJUA 1T0TV 1F60B 1MW7A 4DV6F 5F8MA 3OXFA 1F9HA 4N77A 2HIQA 6AT1B 1JK9B 4K4UA 1RADB 3DLBA 1XJWB 2HBQB 2PMHA 5AXMA 1IVZA 2DNNA 3IP0A 1TELA 3O8WA 4O3PA 3AD7C 3D1QA 2M5YA 2KXNB 3QGIA 2IDEA 4DL7A 4JI7F 4E98A 3M32A 4OZ2A 4BBYA 4K50A 1ZS6A 1DTQA 1NKEA 1LXJA 3T5KA 4JYAF 3OFGA 2DH7A 4CM2A 3KLIB 3TAMA 4B3OB 2CQ4A 1GXLA 5L9NA 2VBWA 2Q43A 4GKKJ 1U1OA 5AXKA 1SQFA 5K5MA 3DXBA 2VJVA 4B9UA 4A8QA 3RJMB 3MTJA 1NSPA 1SL0A 3OVAA 4P9SA 1TKZA 1RT5B 4QPXA 4FPIA 2R8GA 2YPYA 1EJ7L 2OPQB 1HNIB 4Y6IA 5MLCV 3IWNC 3QSYB 2U2FA 1BQNB 1OQ3A 1NK5A 4IO1A 1MLAA 3HXMA 4NWBA 5AT1B 2ZNZA 1SJ3P 1P27B 2EPIA 2L08A 1TAQA 5HROA 1VYAA 1S9EB 2ZOGA 5KT3A 3MFHA 1FWKA 4WFNQ 5C2GA 4B3TJ 1YZ7A 3R1HA 4LFAJ 2W7OA 3SCJE 5EUHA 5I42B 3H5XA 4AL5A 3QT6A 2ZFHA 3THPA 1S0MA 3R8YA 2MKIA 3OFFA 3ET6A 4OYAA 1WC0A 1RABB 3I4HX 2W4CA 2UUCJ 4IH7A 3BM7A 1X9SA 3D2WA 2I5JA 3ZNJ1 4LF5J 1XIQA 1NAQA 5F9LA 1TVRA 3FSYA 1UPPA 4USMA 2CYYA 4X4QA 3UVJA 3MR5A 3ITHA 4YQWA 3EJMA 3DRPA 2DNYA 3MDFA 1PBAA 2ZD1A 4CLFA 4ALZA 4A47A 4HI1A 1NK6A 4YR3A 5E33A 4YP3A 4IKAA 2P9CA 4KV8A 2FJXA 2N3LA 1HW9A 2PFFB 5F8GA 3MOZA 3C6TB 1KOHA 2Y8WA 4IH5A 4NCGB 1JXVA 4DV7F 4GMKA 4Q7AA 5LMUJ 4DJBA 3VVTA 1KQKA 5CYQB 1CJUB 4QWDA 4KFBB 4I7FA 3CCMS 2ACYA 2EG1A 3DLLQ 4OI2A 4QYRA 1R8HA 2E5LJ 2YWWA 3IG1A 1BUXA 2W25A 1WELA 3RGIA 4L73A 1IQTA 3TZYA 3TZZA 5HJYA 2D7SA 1UL3A 2BRKA 4FKXA 3ILIA 4WWSA 1U47A 5J1PA 2XC9A 3QSIA 3FMWA 2KO1A 2BE2A 1UVMA 4FXDA 4DR7J 2IA6A 3I5BA 4YDDB 1QD1A 4GVBA 3PG9A 2DHGA 3BGRA 1OYEA 1RHRB 2NPIA 1DQAA 2VPYB 2E66A 1RCOB 1YJWS 3ZZPA 5B0GA 3LTOA 2DNRA 2V8GA 1WHXA 3GV5B 1WC5A 1BQMA 4Q0BB 5ETMA 3GJRB 1DLOA 4RX6A 1LWCA 2NYHA 5KFIA 2GJFA 3NNHA 4K5RA 4I6WA 3MEDA 2IIHA 3H5YA 1RBOB 2FY8A 4DV0J 3IRXA 3C8YA 2ZBRA 3G4SS 4FYVB 3M1VA 5HN0A 2AJ1A 4DX5A 1YI2S 1MMNA 2DJWA 4XPCA 2IA0A 2IDLA 3MCMA 1LWXA 5CD4H 2DITA 2ZWPA 2B6AA 1HARA 3G82A 1GXTA 5L38A 2R2RA 3UDEA 2XMVA 2K2PA 1I94J 4QOTA 2AP6A 2KHDA 2OAUA 2RSQA 1WF1A 2GQQA 5HAOA 1TKTB 2JEIA 1HI8A 4ELTA 1KQGB 2RHQB 4RJVA 4LSNB 5GAGI 2BMBA 1N88A 2DR6A 2MKKA 2XMTA 1H6KX 3JSMB 2BM0A 1GNKA 1PCAA 3QLHB 1BWVA 5HMZA 4JUZA 4G65A 2NYIA 2RILA 2DRBA 3US5A 1MWQA 4O0IA 2BJ3A 1N5SA 1RTJA 2DHAA 2Q79A 2AD9A 3GZ7A 2KXHA 1V5IB 2W7PA 2MQQA 2X3GA 1I6JA 3Q8VA 3NS5A 1RA6A 1B70B 2CPDA 4UZCA 2VHGA 2ZHAA 5HMYA 1JKHA 4AXIA 3RU0A 2YH0A 5B0FA 4OYWA 5GAEI 4KGKA 3Q8YA 2J0XA 3HHDA 4IUFA 4DR6J 4EZ6A 4F4YA 2ZJPQ 1WACA 3P3DA 3BGOP 1WDTA 3DLHA 3V81B 2XG8A 1TZ0A 5F9NA 1JJ4A 3FBEA 4C3LA 2APOA 1SJ4P 2IJNA 1I5OB 4USTA 2CNKB 3BPDA 2DY9A 2R7QA 1IKYA 4UOGA 4CRJA 2CQDA 2V8PA 1RHQB 3GJSB 1RACB 2Y0BB 1FVSA 5F8LA 1VCTA 1LWEA 4PG6A 2RQCA 3OUYB 3D67A 4KHRA 4NZ7A 4RWWA 4XDDA 4J9SA 3GILA 5A8RA 3IO1A 2A1BA 4QIFA 4DG1B 2CQCA 1HWKA 3R6LB 4J90A 2HHHJ 1J5OB 3AA8A 1KNZA 3WDOA 1JXEA 4DPWA 4PKDB 1Y9OA 4JI8J 4DUZJ 3KJVA 3N6MA 3W3SA 3CCRS 4NXNJ 4ZITA 1W2IA 4DQSA 3BQ2A 1JJ2R 4CTAB 3TR5A 3M8PA 4R8UA 1LW2B 4Y2AA 2GAGC 3QIPA 1TL3B 1Y0HA 1RK8A 1FHTA 1PAUB 5LJ5Y 3MCOA 5H9FJ 3MR3A 2NXEA 2GMHA 5DM7Q 3OQ2A 3KLHB 2WW4A 4JI6J 3D6TB 1S1TA 1S77D 3VGSA 2KVQE 5BXIA 3BBCA 4WJBA 4YUDA 3LAKA 3IS9A 2YXLA 3HSJA 1U1NA 5CA5A 3CDAA 2QV6A 2J7WA 2ALZA 4NLDA 2IM0A 1SC1B 5D77A 4B3SJ 2RRNA 4Y3CA 1TK5A 3C46A 3MMAA 1UVIA 1U45A 1AT1B 3PJ9A 2M0GB 5HVGA 1YK9A 4R5PA 3JSBA 4R25A 4QIGA 4U7UD 1R7IA 2DIVA 1UEKA 4EUVA 2IMOA 5A0YA 3J80Y 1VQYA 1FE0A 1UPMB 2W9AA 5H9EJ 1Y7PA 3DNCA 4RW6B 1IKXB 2F3JA 4QW8A 2HNZB 4FYDA 4AL6A 5KG1A 2XS5A 1CJVA 3T5JA 2V8DA 2QMUB 4PUOB 1LK5A 2H3EB 1VFJA 2CWXA 3WHIA 2GMLA 2BM1A 3OXLA 4C11B 4MMOA 2VU5A 1FJ7A 4QZVB 1HL6A 1JLAB 2BOPA 4KBIA 2GIFA 3C16B 3THVA 1KLMB 4FBTA 4ZPCA 4ED4A 2M9KA 4NL5A 1T9YA 2AGQA 3DFEA 1RWKB 3B82A 3IN5A 5JUMA 3FCWA 1GXUA 2BANA 1FXRA 5D0GA 2CVEA 3BGUA 3J81Y 5ETSA 5IT9U 2C3UA 4UT4A 2GJIA 2LA6A 3HT0A 3IGNA 4FVCA 2K1RA 2V68A 4IOAQ 2KKHA 4ZP9A 5DG8A 5ETRA 1C0TA 5F8HA 3OXGA 4KIAA 4C48A 1JLGB 2CUYA 2AX1A 4CO1A 2G0JA 3BGLA 4NZ0A 2M4MA 1VQMS 4KRWA 3MGJA 5A8WB 4DZ6A 4J5OA 4PQUB 3QT5A 1JXLA 3EZUA 3TNVA 2F4VF 4YR2A 4YFUA 3UDCA 3CJKA 4W92B 5D3GA 1IJEB 2VG5B 5EN1A 2HFNA 2E7XA 4F50A 2BYCA 1WHWA 2HMIA 2R2SA 3N79A 2YNIA 3HHKA 4K4ZA 2FHJA 4C0HA 1FJEB 4NYPA 2YNFB 3I31A 4JV1A 1T11A 1V9OA 1M5SA 2V4JA 4I67A 2VD3A 1KHVA 3QJJA 1M90T 4MFBB 3SMZA 1WKJA 3MM6A 1WHVA 1CS4A 5D3GB 1QAXA 4KGZB 2FIUA 1AZSA 2WHOA 4OI3A 1V3SA 3HCXA 4KHPF 4K2XA 2W2QP 4WTYA 4ZA1A 4CYUB 2YNIB 4GC7A 2DGTA 3CW2C 1NNDA 2LQJA 3H42A 1R27B 1PAEX 3RRGA 1IM4A 3T3FA 2CJXB 4X66J 4X64J 2VC0A 1EB0A 2FLNA 2XMAA 1HNXF 4ZJOA 3M8QA 4IRCA 1N54B 4QU6A 3OL9A 1FJGF 2F5GA 1S6OA 1JQGA 5KFBA 2C22A 4WBFA 5KT5A 2OEMA 9ATCB 2XHWA 1ZM4A 3OL8A 2WOMA 4ICLA 3AQPA 2MSTA 3GIKA 1XQIA 1E6VB 2OIHA 2YKNB 4ID5A 4DX6A 3GV7B 3ZZYA 1IKVB 3KYLA 4YOEA 5KG4A 3QAUA 4N47A 3W63A 4G6VB 1TV6A 1HR0J 4QWAA 1K9MT 1Q5VA 2R7WA 2GW8A 3DC2A 4B3MJ 1C0UA 1T7PA 1RT7B 2J0QD 4GRSA 2D1CA 2CPIA 5J2QA 3HM9A 1ZM9A 5IWAF 4EEYA 4QIEA 5U47A 2OO4A 2O66A 3RAMA 5LMNJ 2VG7A 2MPUA 2AJ2A 3CO0P 1LXNA 5JVHQ 5KFJA 5BYSA 3UI3A 2DISA 1L3TA 1EIYB 1GEHA 1UVJA 4DV2F 4IDKA 4ELUA 1KSPA 5DO2A 4DSJA 3CCQS 2QA1A 3GQCA 5A6WA 3B78A 3PJXA 2XSFA 4I6YA 2QA2A 1Z4UA 3CUNA 1Y5IB 2PN6A 4I4BA 4OYMA 2XZWA 1XMQF 2YKAA 5GMKa 4DR4F 3NY0A 3HD1A 2ROEA 1WEYA 4J9PA 4IG3A 3CJQA 2YNHA 4RW8A 1G7CB 2V34A 3EGNA 3BO3A 3RRHA 1W25A 4HDHA 1G4CA 1R6VA 2KM8C 1WG4A 2D74B 3HHLC 3CMES 4OHXA 3TUIC 2NS1B 4Q8EA 1S4FA 4LBIA 2KZMA 2DGQA 3TA2A 4QIWD 3CCZA 3HZEA 4IH6A 3MMBB 4L6V3 1A9NB 3M8WA 4P52A 2HFZA 4TU8A 4ECTA 1ZAVA 1UEVA 1LNQA 4C7QA 4O4GA 4JP8A 1VJQA 3GR0A 3N9UC 2Z2YB 2DCUB 4I6AA 4ZHRB 1WOOA 3BEGB 4ZMMA 4Q2LA 1MMDA 1TL7B 5KFTA 3P45B 3P8BB 1N5YA 4DFKA 3VWSA 2LEBA 2HRUA 4NLUA 1C4CA 4CCHA 4CLWA 3M6WA 1QUVA 4N7TA 1DTTA 3D4JA 1HQ2A 3JAMU 2D41A 2LP4A 2HNYB 2MMYA 3E2EA 2G1HA 1S97A 1URNA 3RBXA 3PTWA 1S1VB 3EZ5A 3EDRB 3QGHA 3MCNA 4FNIA 1BLUA 4A4JA 3PCOB 1KVKA 2HHUA 3CXCR 2GIRA 2UVUA 4J91A 2A3JA 5KOWA 3ONQA 4I2QB 1F3VA 3L3CA 3TX0A 2AQ4A 4LBHA 3BYPA 2CXEA 4NLVA 2W2OP 1G2EA 1UVNA 2ATCB 4NASA 3H59A 2YWHA 1RT4A 4ENOA 3RW6A 4ZPDA 3CJRA 2IYIA 1LV5A 1UA0A 4RW9A 1XN9A 4YHHJ 2IRYA 3A3OB 1TUGB 1D9FA 1Q7YT 1FDBA 3CNQP 2BEFA 4K4XA 2GHVC 2V9KA 3UQSA 3AXKA 4R0EA 4U9RA 2GZOA 4ZVPB 5F3TA 1T9VA 4DV6J 2N7CA 1QSYA 4BCAA 1BGXT 2BA9A 5D15A 1VK8A 4J7CA 2KZZA 4NLYA 1HLWA 5IFMA 3C15B 5L9XA 3GONA 4H4MB 2IRUA 3MPUB 1JLFB 2AGPA 1HNVA 1FERA 5LSLA 3K89A 3R7SB 3NLCA 2XGPA 5HVHA 4WP3A 3LOUA 1U1LA 3V6DA 3K5PA 1S72S 1FF2A 2X1BA 4RUBA 3DU6A 2A18A 2ILZA 1OMSA 1S6PB 2JEGA 1WTFA 3HHEA 2J9DE 3ILOA 1B7YB 5FDLB 4DN0A 1YJTA 2HHXA 3QATA 2L48A 4K2JA 4RBTA 2M88A 4WFXA 1VQ6S 3DLKA 2MQ8A 1WKKA 2CA9A 2CJBA 1MN7A 3S8SA 1RAOA 6FDRA 3I55S 1Z2ZA 2ZOMA 3OHAA 4EGLA 3Q86A 2DR7A 4IFVB 3Q2TC 3QNWB 2IHR1 4FS2A 4WP8A 1IBMF 1FEHA 4NMLA 1N32J 3MD3A 4JI1J 1S6UA 1AA1B 1PJ6A 1FCAA 4DR2J 1WF2A 5HQLA 3UD3P 4F3OA 3I82A 3NGUA 1UP1A 2LXFA 4C4WA 2J9EA 4WFZA 1RYRA 2Y1JA 1RTIB 4H4OB 4F8RA 1JJHA 1IKWA 5SUHA 1BY9A 3U7JA 4HT7A 4ES3A 1C1CB 3M2VA 2V2KA 2ZH1A 4JBCA 5HQ8A 2CPZA 4JI3J 2UZAA 4ZP8A 3M9NB 4U95A 1FE4A 2D69A 2AYBA 3DU5A 1UETA 3UE2A 4F2SA 1T03B 1OIAA 1HWJA 3NCQA 5DLGA 3T5HA 3MPWA 3MWBA 1TL5A 1IJFB 4Y2CA 4TXSA 1QE1A 1R8BA 1BMQB 3BB5A 3OJSA 1VGYA 3DM2B 1HIYA 1K47A 3T9NA 3BSAA 3TVKA 2RF2A 2RJZA 2IJFA 3N4WA 3TJAA 1S9GA 4JI0F 2IM3A 3QT7A 2HBYB 3T1AA 1VRTA 1KVJA 3C6UB 4P6QA 3JYTA 1SKWA 5IQQA 1WJ9A 1NZAA 2YQ1A 4E0DA 4BS2A 4DUYF 2XMMA 4FF4A 3IAM9 3GJQB 2K7KA 4LF9J 2QGFB 4C8KA 2HQCA 4ECYA 5GAHI 5E7OB 1R8CA 4ELVA 5IC6B 4C8LA 1U1RA 1HNWF 4TU7A 2WTFA 2I38A 4C8MA 3DOLA 4TY8A 1JNRB 2B9EA 3QIDA 3CIMA 1NJWA 1NK9A 3K0JA 1KTVA 4F67A 2DB1A 1S5ZA 2QSWA 2AWZA 5KFGA 4F0HA 1X4FA 4C8OA 3R5CA 5KFWA 3OSPA 2JC1A 3TJ8A 3MM9A 4GKJJ 1S0NA 3OTOF 2N4CA 1NDCA 5ETOA 3ZTRA 4USWA 1S1XB 1MROA 5T41A 2KN4A 3HHLD 3MM7A 5C42B 3CCSS 1N36F 2OPPB 2VKZG 4CNYA 3TZWA 3MD1A 4KSEB 4QYZJ 4NEYA 4RUCA 2PC6A 3SSSA 1N56A 4O3RA 4PXEA 2ZC3A 3RYLA 1S0VA 4K59A 3PKYA 2B0GA 2GIQA 3NG8A 2R4FA 2KH9A 1NSAA 5D0HA 1HMVB 3AAWB 1DHMA 1RWWB 4URSA 4WE1B 4U7UK 3FVYA 4DU7A 3CE8A 2B4PA 4WU3A 1TAUA 2XMKA 4DFJA 4TYBA 2QJ3A 4NLWA 4LRFA 4IO9Q 2VFTA 2VJUA 3GG1A 4O44B 4EI2A 4CO3A 1X5OA 5IZHA 3ULHA 3AJ2A 3N5FA 3PR4A 3I32A 2NSCA 5C7PA 2VDIA 3T6BA 4B17A 2N82B 3CMAS 3QGPA 1QJHA 1HHTP 3TARA 1NSKL 3PY8A 4J9NA 1NUEA 4DF8A 3DHXA 3TZXA 4OI0A 1XERA 2LQ5A 3CC2S 5KG7A 3ZTSA 1NJIT 2HWIA 1KFSA 3PR5B 2VG6A 4IFYA 4NXMF 3NAHA 3CCES 3E01A 1SVDA 3MUMP 4J9RA 3HVTB 3FGVA 1CG2A 1WI8A 1WI6A 1KEKA 3DGPB 2GJ2A 2QG9B 3G2XA 4IQMA 3D0GE 4JI4J 2CWKA 4LSLA 4Y2KA 2UVRA 2VOOA 4KC5A 2VA2A 2CNLB 2MQPA 3D1HA 3EICA 4IOCQ 5IT9Y 2QLBB 3IM8A 1OY8A 1Z2LA 1M1HA 2PDAA 2HFVA 1M5PC 1FDNA 4CLUA 5F8IA 5LL6d 2R2TA 1EETA 1PSDA 3GE9A 2BQ3A 3HVWA 5KFFA 1IWAA 1UMJA 3EXCX 2CDRB 1P9YA 1XK8A 4QWBA 1S1UA 4B02A 3K8WA 2UXDF 5HBMB 5I3UA 2CADA 1S59A 3OSNA 2PEHA 1Q79A 1UW9A 4CM0A 1JIHA 4XTTA 2KRBA 2DGSA 4QJVA 2ZBQA 4ILRA 3Q89A 2PIIA 2DHXA 4AFFA 3OJUA 2GGPB 2CQ1A 1XC9A 1U1KA 3NBPA 2L3MA 3M6VA 3G96A 1VISA 2MZRA 4PEOA 3MCSA 3MM5A 3MMCA 4ZP6A 4EU0A 3V5RA 1YDLA 2EC2A 2X1FA 4KGVB 1T9WA 3CJ3A 2ZKUA 4JV5F 4AL7A 2HGLA 4OJ1A 4O4RA 4FF1A 1RT3B 2XY7A 8ATCB 2H48B 2WSFC 3CCLS 4S0MA 2LQ8A 2ZVIA 4HH1A 4V19J 1TP7A 3CCJS 3MMCB 2VASA 2C2KB 2YBVA 1X4BA 1S6QB 4L3KA 2J8AA 2XBPA 3KK1B 1KLNA 2JJ4D 1UTAA 2DXEA 2VPWB 2KFZA 4RNOA 2Y9HA 1ZZNA 1NK8A 3KK2B 2MKHA 1KQSR 3K7RA 1QSLA 3TQEA 3EGWB 1F5BA 4ITSA 1SKSA 3UN2A 4LF1A 1VLOA 1CULB 4OX7A 3SSRA 2OSQA 4PPDA 1HWIA 3OPKA 1E6YB 2NSBA 3JQMA 5E3RA 5KFKA 1UA1A 2G9OA 5DQHA 2XI3A 4NLPA 4LF2A 2RS8A 4LF6F 3AH6A 2QIFA 2O5DA 1P8GA 2YKPA 4P71A 4Q43A 1PBUA 3CB4A 2J5AA 4F3QA 5EX3A 3ZZRA 2PMWA 4D3HA 4JI2F 2BKOA 3DLGB 1B7FA 3FRZA 4M63A 4C3KA 5D4PA 4FNHA 4F2RA 3LPEA 3PRBA 3KWMA 3H8YA 3MUTP 2HEKA 3AD8C 3ENQA 2GHWA 2HHTA 3OR1B 3PW0A 4LIWA 1RT2A 4KQZA 4QR1A 4A8WA 2AJFE 3LWLA 3GYXB 2JEJA 5AJ3F 1GMUA 3CWJA 5JJBA 1VDHA 4RZRA 4UQTA 4N41A 2V5HG 1PC4A 1RWXB 3C14B 1U0HA 3NGTA 3W8GA 2DIUA 3J81j 1RT1A 4FYXB 4ES2A 3WQPA 3W9JA 5GMEA 3SZ2A 2LCWA 3Q2SC 2CPJA 4KY3A 3L09A 1ZM3A 2J6SA 2YWEA 2VODA 3THTA 5LSRA 3RB3A 1WSRA 5B0DA 1CC7A 1TR0A 5K14B 1JLBA 3KTQA 3CPWR 4CNZA 4KO0A 1HQUB 4X62J 4DFMA 2A6MA 4DL2A 2KI2A 5KTQA 2B5JA 2R8IA 5L1LA 2F4VJ 2ASDA 1IR0A 2XNQA 3EVWA 2G0CA 4N8NA 1T95A 1NLKL 2QO3A 3F41A 2DR8A 4O3QA 3U27A 2J0WA 1KQFB 3J7YI 2DD8S 3GCWP 2V4RA 1FKOB 4N8OA 1Y5NB 2OPRB 2VZ9A 2MY8A 3PRVA 3VZHA 2RKIA 2MY7A 3KJQB 3SV3A 2FYXA 4DQQA 4CLKA 4X4OA 3M2RA 3JAMY 2B9XA 4N5SA 1OY9A 3H98A 1KP6A 3M8YA 1X31C 2FVRA 2CJKA 1ZYQA 3M7VA 2DNQA 4YR0A 1D8ZA 4LFBJ 3L4BC 2MKJA 2DBBA 5DRKA 3FMBA 3HFVA 2XO6A 3KKFA 4DFPA 5T7LA 1SBRA 5KFQA 3BDPA 3SQGA 1J5EF 3LPYA 3CT9A 3M2RB 1HPZA 1HNZJ 5F0UA 3UDLA 3AOAA 2W8KA 4CLTA 4WXOA 1NHUA 4KPCA 3DKDA 3W2VB 5GMDA 1KS2A 3RR7A 4MYTA 1YRUA 4QIVA 3MEGA 1SJ1A 2GX8A 2QA4S 5J2NB 1UFKA 1YSJA 1IWGA 2WRMA 2G2OA 3D6FB 3DI6B 3CCUS 3OT9A 1RWUA 1FRHA 4Z7CA 2VB6A 2J6UA 4FS1A 4OHWA 1NDLA 2KT3A 1TTHB 2BV3A 3SCIE 2OD6A 4DV1J 3LW5C 5KT7A 2OPSB 4ETXA 3VAGA 3MF5A 1VJWA 1DZ5A 2PO4A 1SB6A 2IAJA 2KJWA 3PKMA 4LFCF 5AE2A 5CCLA 2EFNA 1LEOA 4DUTA 1RHUB 4JOUA 1OSCA 4DR5F 4TLQA 1QSSA 4YB7A 2KXFA 5LXYA 2B3TB 2HHWA 3LGHA 4JI5F 1IUJA 4WCEQ 2DR5A 1PYTA 3U1NA 1X7VA 2HNDA 6FD1A 1N52B 4K4WA 1NH7A 1V3RA 5DGBA 4Z37A 3NRBA 2EEYA 3HKZD 1XR5A 1MWYA 5HP1B 4HR2A 3OTDA 5H9EK 5LSOA 1RWMB 3X3UA 5GADI 1KOOA 4LF8J 2E7WA 3AHPA 2R7VA 4ZVTB 5KT4A 1SJFA 2HSEB 1CBKA 2V2VA 2V2ZA 4U67Q 3L9ZA 7AT1B 5KFVA 3X1LB 5CYMB 4KGMA 2B56A 3T1YJ 1NB2A 4B3RJ 2C1EB 4WKYA 1YHQS 4ANDA 2CQBA 3TJ9A 1U1QA 3S6EA 1GX5A 2ZUAA 3G71S 1K0TA 1U09A 1QM9A 1XNQJ 2OMLA 3VZIA 3QPIA 2YY3A 2YNGB 1HYSA 1TL1A 4YB6A 3QRRA 1JLEA 5J2MA 4UQGA 3CGIA 3U1LA 1FKPA 5KG0A 1TMJA 3HFZB 2HK3A 5D4LA 3RG6A 2O01C 3RB4A 2XSJA 2HGMA 4NEZA 2V0NA 3QZ8A 1CEZA 2MZ1A 1SUQB 3J80U 3S01A 1HBMA 1XNRJ 1HYSB 4YEAA 2FVSA 2H9ZA 5HMXA 2BX6A 3ILJA 3P4UB 1YWXA 3W8PA 4HVZA 4BWJA 4OHYA 1SV5B 1RHJB 2VFSA 1LWFA 2HVZA 1JWWA 2FGCA 1EP4A 4ZVFA 2Z58B 4UY85 3KLEB 1GTHA 2BVZA 4ZK7M 4IR1A 5ETKA 1RZMA 2IY5B 4NLXA 1UVKA 2UU9J 4NOHA 1RAGB 4G1IA 4DMZA 5A8KB 3IXQA 3W2WA 3FZBA 3WIUA 1VC5A 4OYOA 2FD2A 1CPZA 1A0OB 3MECA 1RBLA 3TAPA 4ZCIA 3K59A 5DDPC 1APSA 2M8HA 1F9FA 1FRJA 1PKUA 4ED7A 1T05A 1FRXA 1FTCA 4A8OA 1QLNA 3NMRA 3G86A 2KG1A 1ZZFA 2FHOB 2OP5A 5ETVA 2Z2MA 2RS2A 1U2FA 4WYLA 1VRUB 5B0BA 1Q0NA 4TQSA 3J7Z5 3BSOA 1CJTB 4F36A 1KDNA 3BREA 2IM2A 4GKKF 3BZQA 2VKRA 1MU2A 2WONB 1VQOS 1YJUA 3GSIA 1S57A 4CZCA 1HBOA 4ZOSA 4CH7A 2KHCA 3GP9A 2WCXA 1OPZA 2I6WA 4C97A 2IBOA 2GVDB 4ZP7A 1U7LA 1S1WB 1X4HA 3EUNA 3OL6A 1YKWA 1SXLA 4UZBA 3ELHA 1RAIB 2BDPA 2JLGA 3SYZA 3RUBL 2CZVC 4UOCA 4B3TF 4HL9A 3BR8A 2CG8A 1VQ4S 4LFAF 4LIRA 2JLFA 4Q2MA 1VS3A 3HJFA 2BJ7A 3DYAB 3FQKA 1QAYA 4RUAA 3JSYA 3EXYA 1Y00A 2QSFA 1Y5LB 3QZ7A 1R8PA 2UUCF 1FEEA 2AEJA 1TFYA 4M95A 1UFLA 3IBCB 3FZ2A 4HKQA 5LT5A 4GC6A 2LQ9A 4G1QA 2W9BA 3UCUP 2A0FB 5HL7Q 4FN5A 4O3NA 2MKSA 1SJQA 2JHEA 3PRDA 1RGVA 2ZH8A 1HQEB 3KMSA 3GIJA 1F2GA 2NXJA 1VQKS 1NEEA 3TOQA 4GO5X 5J1EB 1B64A 3MM8B 4LRAA 4NCAA 3M30B 1NSQA 1FD8A 4YY3J 2DPIA 3TVYA 3B54A 2RRAA 5EWEA 4GVLA 1VBZA 3FC9A 4RU9A 1WF0A 1F9EB 1LOUA 4CLPA 4IRKA 1KKHA 1WC1A 1M5KC 3Q24A 4LF4J 2VFUA 3MR2A 2V94A 3C3LA 3HMJG 2FVPA 3K5OA 4FYWB 3P5BP 4TNOA 3DRRB 4ZVOB 4OYXA 2DGXA 1N5TA 1FRLA 1TU0B 1RWNB 3KLIA 4MTPA 5LMUF 4B3OA 2DNMA 4C6AA 2RQMA 1RWPB 3I0SB 2HBZB 3RBZA 5BYRA 3GJTB 2DXDA 2CNNB 4X4NA 3VAJA 4DV3J 2E5LF 1NZ8A 1R43A 2MZTA 3VHQA 1YITS 2MQOA 1Q86T 1RT5A 1RU1A 1XWLA 2MJNA 2OPQA 1HNIA 4CO4A 2R7UA 1BQNA 1QVFR 2MB0B 1N0VC 3NXZA 1FNOA 2HURA 3IR6B 4M5NA 2HWTA 1S9EA 2XS7A 3MZIA 4DXLA 1FD2A 4DR7F 3DLJA 1SH3A 2IMWP 4ANEA 3NAIA 2WZ1A 3ENWA 1IN0A 4WPAA 4XAKA 5I42A 4M8LA 3ZC4A 4R0JA 1R0AB 4ILMA 2EK6A 1RSCA 4V19X 3M9MB 2K8GA 4FYYB 2PA3A 3NP5A 4UW2A 1SIWB 3Q8PB 3PW5A 3KHHA 4NLSA 5C25B 5DETA 4M5DB 2WW8A 3CDUA 4RW4B 2GO9A 1X60A 3IBWA 2XY6A 4F04B 5HO4A 3T1HJ 3G6YA 3BH6B 4XK8C 5K8PA 4MKYA 4DV0F 3OTBA 2CPEA 3GB0A 1RDRA 3L95X 1VQNS 2FZCB 2RMLA 1V6HA 3QMQA 2QZ8A 1U49A 3KLGB 2UUAF 1YTYA 3DLEB 3R9LA 2ZHOA 3IAS9 1ZAWA 2YWFA 1FDAA 2FHJD 3CJ5A 4DBQA 2A2DA 4WIIA 1FRIA 2GNKA 4ZCLA 2HQIA 3LAMA 7FD1A 2MQMA 1HBNB 1I94F 2ZH2A 4W98A 4HACB 1FK9B 3MEKA 2VIHA 2B4UA 4F0MA 2Y1IA 1V5VA 1RA7A 4F25A 4M5MA 3GFHA 3C6TA 1RXOB 2BE9B 4OX9J 3HKWA 3QFWA 4QR2A 4NCGA 4ZPBA 2CNOB 2HAFA 1Y10A 4ZVUB 2L9DA 3OFHA 5M2UA 5CYQA 1CJUA 2WB4A 4X65J 3LQVA 4KFBA 3B4DA 4FF2A 4DV5F 3MOJB 4ECRA 3CC4S 4EO8A 1HKAA 4A46A 3W60A 4LBPA 1AYEA 2C2ZB 2UXBJ 3AXMA 2NREA 3H2UB 4PG8A 2V63A 5CH7B 4ZS6A 2DYAA 4P7TA 3IFEA 1C1BB 4IYQA 2GVZB 1S12A 2PI4A 3ENAA 1UWBB 3UNGC 3MAAB 4PYDA 3T6JA 2RVJA 2RHSB 2P6SA 5GVQA 3D9BA 2XZTB 2EFGA 3BBBA 2QFIA 2FLPA 2J6TA 2ALYB 2BUNA 4K8RA 2XYHB 1ULRA 2GO8A 2DEIA 3FUYA 2H54B 3KHGA 2E1AA 5B0AA 3HPOA 2ZZMA 1H98A 4DR6F 5F8NA 3T5LA 1RKIA 1GTEA 3TRGA 1O5JA 3VAMA 4Q0BA 2D9OA 1HBUB 4PR6A 2F65A 2V50A 1YZ6A 3MEEB 2HQFA 2IM1A 4TQRA 4C9DA 3CDBA 2RB7A 4USJC 4RNMA 3OR2B 1Y4ZB 2XEXA 2C3OA 5ETLA 5KT6A 3DMJB 2DEJA 4C3MA 1ZTTA 1N5QA 3BKFA 3PFEA 3D0IE 4MK9A 2Y1RI 1NM2A 2DO4A 1FJCA 5IV4A 4UOFA 1IBLJ 3TUJC 3GU0A 4A48A 4M1KA 1SPBP 2MGZB 1CJKB 4MAKA 1TKTA 2L9NA 1S49A 4UOHA 1H7XA 2PE8A 4LSNA 1U0SA 2OSRA 4JI8F 3ENVA 2M7SA 4DUZF 2VONA 4U7CA 3V4IB 2ZE2B 4NXNF 4M5JA 2ADBA 3JSMA 4ZPTR 4NLRA 1JLQB 4U96A 2AF6A 3QLHA 3M8ZA 4H54A 2LU2A 1X5SA 5E3PA 5F0WA 5I3QA 4USUA 2O67A 2OMOA 2IC3B 3A8KA 1DFDA 3W66A 4Q8FA 1N8RT 1NH8A 3ADAC 3I4PA 1S99A 1T3NA 3PW4A 2YX4A 1U2CA 1RTDB 3OTCA 2KB2A 4N76A 2AJ0A 4PQAA 3EE3A 4CI0B 4JI6F 1RWOB 2W2NP 2WVFA 5C24B 3A13A 2XWYA 2VQEJ 3UD5A 1O8BA 3RAQA 4KT0C 2Y1LB 1XMOJ 2DY1A 3I0RB 2DKOB 3TAQA 5E3CA 3QRPA 2GS8A 2VQFJ 4B3SF 4QCLA 3HSZA 5ADZA 2ZKTA 3SCLE 2YKQA 4ED3A 1P9QC 1SC6A 3V81A 3MXHP 4USKA 3M2UB 3M8SA 2AV5A 2X3DA 2WSEC 1W7WA 4I2PA 3FRYA 2CDQA 2DHSA 2CQHA 2MEWA 4B9NA 1BE4A 3VGUA 5KAKA 4FKYA 2N3OA 1N33J 1XTZA 2W1BA 1GT8A 3KK3B 2RNEA 3PEJA 3FNNA 3PIOQ 3AY0A 1YRTA 4UF4A 3DOMB 3OUYA 1P1TA 2OEKA 4DDFA 4P2MA 4I2PB 3HK2A 1UZDA 3CJ8A 2QL7B 3ETOA 3KG1A 2L41A 4DG1A 2ZJRQ 5KFZA 4JV2A 1VOMA 1J5OA 2B9YA 2MXYA 2QMWA 3CCWA 4QYZK 2J7KA 5HLFB 4DX8H 2VH7A 3VAHA 4YN3B 2AIRB 4XPEA 4MK7A 4NLQA 3TEGA 3LP0B 4LR8A 1CQMA 3H4BA 5AXNA 5CAAA 2CRLA 3NOGA 4CTAA 4M5KA 1HD0A 1N48A 3IA0A 1UJ5A 1LW2A 3MHYA 4JI2J 3K17A 2EC0A 1TL3A 3LGNA 3LANA 1MNEA 2EKNA 4HYKA 4K7QA 3LO3A 4B9LA 3PO4A 1C2PA 3PFOA 4MYUA 5KG3A 3KLHA 1N34J 2Z30B 3AA9A 3GPAA 1H2UX 1P6TA 2GHPA 4DQIA 1B4SA 2RUSA 1H2VZ 2DRDA 2HLTA 4RBVA 1X4GA 2LEPA 3R5AA 2NPFA 1NKCA 2RUGA 2H5IB 1FTRA 2DK2A 2NXCA 5KFHA 2ZHBA 2AX0A 4NYOA 1URRA 2B7CB 4DN9A 2HRYA 1JLCB 2R8HA 2XI2A 5KFNA 1T3OA 3H90A 2JZ5A 4LR7A 4QU7A 4P73A 5E3AA 3CD5A 2E1MC 4DI6A 3TA0A 3O5TB 2ZWOA 2OTLS 2GMJA 1BXNA 1SH2A 3B4MA 4P2SA 1AFIA 5IC4B 1P1LA 5B0CA 4RW6A 1I1GA 3W7BA 1FWLA 1VBKA 1IKXA 1RHMB 2WVBA 2HNZA 3SDEB 4PXDA 1IXKA 2HIYA 2UP1A 1AW0A 3TVZA 3PW2A 4ECUA 3Q22A 1FFSB 4X64F 3G6ES 3TUPA 4PUOA 4X4SA 3IMQJ 4AQYJ 2Y0SD 4ATNA 3CEDA 4CO5A 4C11A 4ZN1A 2E7VA 3TWZA 3MPDA 3D5MA 1JLAA 1DJ0A 1PYSB 4ZIVA 3M6UA 3C16A 2XLJA 1KLMA 1N5VA 1S79A 1FRMA 2CJ9A 2IVMA 1BD6A 1ELOA 2J7UA 3L7PA 2ZOFA 3ICLA 2KM8B 2I9SA 1D9AA 2JFDA 4FVMA 3HHLB 3KG4A 5DGAA 3ETMA 1HR0F 2E5HA 4ZVHA 3KUHA 4ZLLA 3AB2B 3FEYB 4OX8A 4PCQA 1IBKJ 4B3MF 1IR1A 1RT6B 4DCOB 4Y34A 2OH2A 3UN3A 1RAHB 1U25A 4ZJLA 2NQPA 3MAQA 1JLGA 1VQ7S 2GFFA 2W9CB 5D4OA 2E5JA 1FXDA 4IG0B 1RISA 4KYZA 5LMNF 1PJ5A 3BSNA 5A8WA 4P74A 2ZEJA 4PQUA 1RE1B 3HVAA 3NCPA 4WXWA 1JX4A 3KDOA 3KFWX 1VIOA 2HLUA 2F9DA 1S4EA 4RU2A 5LJ3Y 5ETNA 1LW0B 3CULA 3POTB 2G13A 2VG5A 2NXNA 1QY7A 1HFEL 2KT5A 4HDGA 4IRDA 3KLFB 4O23A 3PYDA 1K73T 2H5JB 2C2EA 2YNFA 3PXGa 4KKOB 1XBWA 2YKMB 4NI2B 4MFBA 3MR7A 4DR5J 3R1LA 3O6QA 2FTRA 2QEXS 2Q6CA 2LU1A 3IGVA 1REVB 3GTYX 1A6LA 4CYUA 1AFJA 3A12A 5DG9A 2HHSA 2F63A 2VFRA 3CJ2A 5FIIA 3QWPA 3SXLA 3WX8A 1TKDA 3SEOA 3G9CA 2VPZB 1TKXB 3MFIA 2LDYA 1NMEB 1D09B 1EAYC 4I0WA 2FGOA 5L1IA 2HK2A 4U6PA 2DHHA 3TEHB 2OKQA 3JTOA 3KHRA 5IT4A 3D3BJ 1S48A 5CD4A 3DDIA 2A2CA 2K3KA 1YJ7A 2V4QA 1WOSA 1H0HB 3U1MA 2EFOA 2R7XA 1QAIA 3UPFA 4AD6A 3EPIA 1E6VA 2VICA 2YKNA 5FJ4A 2UUWA 2OEJA 3KOAA 1X5TA 1IKVA 4N56A 2C3MA 2JFKA 1EKRA 2ZM6F 3FFIB 4NMXA 3PACA 3GLJA 3HFKA 1FT8A 2EWHA 3NWRA 1RT7A 5E3QA 4KAIA 2FZKB 5SZTA 3QO9B 4J37A 4OJ3A 1LKZA 5G0RB 1FKAF 4DR3J 3S7RA 5IV3A 4OV6A 4ECZA 3FEZA 4ZDNA 2R7RA 2FZGB 1X9MA 3DRSB 3K58A 4ECVA 1Q5YA 4PWDB 1Q8LA 2QYGA 1EKSA 1HWLA 3DOKB 5KFXA 3LGMA 1NU4A 1N6QB 4P75A 1GX6A 2UUBF 3IM9A 2LEAA 1U4BA 2VA3A 2Z2ZA 3UNYA 1DQ9A 4FXVA 1FO1A 1RTHA 3A8JA 4ANCA 1DY3A 2W01A 2E9ZA 3TI0A 3PHTA 2XCPA 2XZDB 1YG0A 3H4DA 2G1DA 4DSEA 2NZ4A 4CIOA 4RWXA 4OHVA 3DXSX 1WDDA 3LP2B 4K5SA 1M5OC 3AT1B 2CQPA 3R5GA 3CO9A 3TQ1A 1VC6A 1RTHB 2MKCA 1L3UA 4RW7B 4WU2A 2ZDPA 2BJDA 3MMBA 3NWGA 3PV8A 2W4PA 4WFYA 2ASLA 1CQNA 3KXDA 3HSDA 1ZA2B 4G3IA 1U6ZA 2Q66A 1RB0A 2H5EA 3NS6A 1M5VC 3SI8A 2CJAA 1M5HA 4ZHRA 1TL7A 2BR0A 4AT1B 4FBUA 2J0SD 1EQ0A 4EK2A 2H51B 2EBEA 4OV1A 2NCKL 2P2CB 5JVGQ 2N7YA 4M5LA 3TO8A 4B9TA 3P49B 1OJ4A 3HLUA 5F3ZA 2HHVA 2CQ3A 2W24A 4CO2A 3NNCA 3M32B 4J9KA 3R7BB 3NGRA 4OX6A 2HNYA 2NUHA 1DTQB 2BQUA 4ZVSB 4DS4A 5E5NA 1S1VA 3TAMB 4J9OA 4DQPA 4PZVA 2EK1A 2MQNA 4LQ9A 5DM6Q 2FJDB 4LRDA 4IQXA 1M1GA 2CQGA 4C8ZA 2CPHA 3A4TA 1GFWB 4I2QA 3G6VA 4LF7F 1N32F 2CJYB 2R3VA 4ED8A 2ABYA 1TKZB 5LOQA 4JI1F 1K8AT 1X4AA 4DR2F 1D1UA 1X8DA 2B9WA 2GAHC 5RUBA 4USVA 1O51A 3ZZ0A 2V8VA 1VLYA 5HROB 4EO6A 1MG7A 5D0RA 1WKLA 2ZVSA 1F5CA 2IJRA 3HP6A 3I96A 1VIXA 2J8SA 5DZ7A 1D0EA 2RQKA 1YJ9S 2B8PA 5KG5A 3ZTQA 3HT3A 1UAWA 4JI3F 1UEUA 4DQRA 3UFCX 2K7JA 3F0NA 1GMWA 3WC0A 2G0IA 1H3DA 3ET6B 4LT6A 2DNKA 2C2RA 2I5JB 1U8WA 2UXCF 1RJJA 4U8YA 4ED1A 3W61A 3TP2A 1TVRB 1WORA 4A8FA 3C15A 1HW8A 1VR6A 2M52A 1YVFA 4H4MA 2KDOA 3PW7A 1JLFA 1SL2A 4F4KA 2RDIA 3DCAA 3UVJB 2OHDA 3ITHB 4NYZA 3DRPB 3ZZOA 3IBFB 4LVNP 1J27A 1K0VA 2ZD1B 1SIZA 4OYPA 3CSKA 5ITHA 2ADCA 5A2QU 4KH1B 2HHQA 2AYEA 4DSLA 2BJ9A 2NZCA 3MURP 3GMGA 2DNOA 1S6PA 2EFVA 3GSDA 2JVOA 1N4LA 2WBRA 5K20B 4EBDA 3IWXA 2QLJB 1Q8BA 4CLLA 5FDLA 4K4YA 4JI7J 3OVBA 4KV8B 1RBAA 1YIJS 1BC6A 4ZLJA 5K9FA 4LF9F 4JYAJ 4AYBD 4CLSA 3NMAA 2FHMA 4QR0A 3OVSA 2BOAA 1VK3A 5L46A 4I7FB 2XNRA 2BXJA 4IFVA 4TYAA 2FHKA 3IG1B 4K0KF 3OW2R 2MDAA 3BN7A 1F5AA 3GIIA 4OZLA 2WAQD 2C2DA 2DCLA 1PJ7A 4CP5A 1AB8A 2Y3YA 4CT9A 2QTWA 3IRWP 1H2TZ 1MSWD 3U02A 3GYNA 4EBCA 2KL8A 4GKJF 2EVZA 5A76A 3KHLA 4HLBA 2BRLA 4WZMA 4Z7YA 2IBKA 2BE2B 4TVAB 1RTIA 4H4OA 4C2MA 1X0PA 3ZFVA 2HS0A 4GVBB 4OZNA 5IOLA 4ECWA 1M0SA 3BGRB 1C1CA 1BWEA 1UJ4A 3SBMA 5IT0A 1OY6A 2AJQA 3NOCA 2OELA 4C0OC 4EBEA 1ZM2A 3FEXB 2J76E 4MKBA 3PYFA 2UUAJ 2B43A 4NE9C 1BQMB 1DLOB 4DX7A 1LWCB 4OJGA 1KHWA 1T03A 1ZOTA 4OYBA 2DNHA 5M2RA 1FA0A 3MEDB 2WVEA 1VQ8S 3IRXB 3M1VB 2ACMA 2HHPA 2ATLA 2HVDA 2DNZA 2HKEA 3EDQB 2BJEA 1FNMA 2HS3A 3DM2A 4ETZA 3PEHA 2B6AB 4EYHB 3G82B 2OI2A 1B0VA 3KUEA 1D8YA 4L74A 4FF3A 4DSIA 4DV5J 2MQLA 2BQRA 4X4PA 3PIPQ 1B0TA 3FDSA 2DPJA 2F7VA 3C6UA 1VHFA 1U26A 2JDJA 1LFPA 3Q8QB 3FCVA 3PHEA 1NXIA 5L1JA 4NA2A 1F1BB 2XHCA 3G8QA 3C2PA 1DURA 1LFWA 1MMLA 4DV7J 2F40A 2XY5A 1JMTA 1AXQA 2ZNYA 3R5DA 3EVMA 2F8EX 2HQ3A 2FJWA 4PABA 2JL9A 2W8LA 4HEA9 3BF4A 1VC0A 3HI9A 4FZVA 1RTJB 3PX4A 4B9VA 3G87A 2F1FA 4JI4F 1U1PA 4X4UA 1Q1KA 2MSSA 4LVOP 4LR9A 1QTNB 2WSCC 1RAFB 5GAHU 4KR0B 1JKHB 1HA1A 2DGOA 3T41A 3BKUA 1NHVA 3O44A 2XMUA 1S1XA 1BHNA 2MZQA 1YBTA 1UJ6A 5C42A 2KTQA 2OPPA 1MWZA 1R0CB 4O0NA 3V6KA 2YTCA 5CABA 2RQ4A 4UUWA 1H73A 3A1YG 4WK1A 4DSFA 1SKUB 2MTLA 2FUG9 4V1Ak 4P2FA 4F4XA 1R8AA 3TYTA 1Q95G 2DR9A 1Q81T 4ZIWA 4X84A 4A8YA 1HMVA 2KRRA 4WE1A 3ZZZA 3K8VA 1IKYB 2JSXA 9RUBA 1S7HA 4J9LA 2Z57B 1QDUB 4XDCA 3BO2A 4HI2A 2EW9A 2CPFA 1BQXA 1X4CA 1LWEB 2ILYA 4O44A 3BR9A 5A8RB 1SC4B 3Q8SB 2CFXA 2XCAA 4Q44A 3GWCA 2R42A 3N6LA 4M5GA 4OL8A 2HZVA 1Q4RA 1WD6A 1RKJA 2C3PA 1RTZA 5HI7A 3KJVB 1G6BA 3CD0A 2VC1A 2E5IA 3VF0B 2R2UA 5HMWA 1GMVA 3LF0A 2FPHX 2QX0A 4ED6A 2KFYA 1X4EA 3AB4B 3M8PB 4Y2IA 4R8UB 4CH1A 2HWHA 1RYSA 4DV4F 2FVQA 5ETPA 3HVTA 3C19A 3QIPB 3DGPA 2MZJA 2R7TA 3PYGA 2QL9B 1IQZA 2VV5A 4I1TA 2B8QA 4DL5A 3HZGA 3DN9A 3GIMA 1S1TB 2CZ4A 2OGUA 5ETQA 4ILLA 2Q3PA 1ZETA 1T9XA 1ZH5A 3D54A 3QQCD 3PNIA 1PIEA 4OIXA 1NCLA 3IS9B 2L9WA 2H1YA 3J7AN 1DAXA 4PG4A 2AZ1A 1OSDA 5BR8F 5EDWA 3D66A 2FC9A 1YRXA 1RCXB 4F4AA 5HBMA 1R3NA 2BE7D 3RB0A 3J7A1 1Q7LB 2V67A 4DPYA 3BDEA 3MMAB 4WTOB 3VV2B 2DGVA 3IWLA 2MKYA 2QLWA 1VI7A 2IPOB 3I6PA 4R5PB 2QFJA 3CCVS 3M8RA 2CG4A 5A0YB 5B0EA 1WC4A 1M1KT 1LQ9A 2GGPA 3I9ZA 3RW7A 1AUSL 2E9RX 2PSZA 1TK0A 3AJ1A 3CJTA 3HF5A 3OLAA 2P9GA 3D7SB 1G3OA 2EG2A 2D3UA 2B51A 2DNLA 1CJVB 4DR1F 4I68A 2W4DA 4B9SA 4NLOA 3VALA 4OLPA 4U8VA 4OI1A 5ETTA 3OBIA 1RT3A 4DF4A 3PZPA 2RT3A 2EBGA 2C42A 2EKYA 1VQ5S 3D6MB 3A3PB 1S6QA 5A6PA 3SV4A 4X62F 3KK1A 2XTJP 3CC7S 2YH1A 3KDNA 3ZTPA 3JXOA 5M2PA 2BANB 4WKRA 4PAAA 3KK2A 2QMXA 1G1XA 3BN4A 2K1RB 1V3ZA 1DARA 3R2CJ 3DRYA 1C0TB 2MHNA 1CULA 1HD1A 4MIWA 1WC6A 2UVWA 1O0PA 2ZZTA 1E6YA 3UDVA 1HHQA 3FBBA 4ZVEA 5CHCB 4PG7A 3CJ0A 3QGGA 1YGYA 4FP9A 1H74A 2HVHA 3WIVA 3VAKA 3C66A 4Y2MA 4TKTA 4Q5VA 3RB6A 3QJPA 3NGDA 4LFBF 3O3LA 3TANA 3CJKB 5DLFA 2C2OB 4DL6A 3DDNA 1VQSA 4MJKA 3QT8A 3DLGA 3K5MA 3S1TA 4FDFA 2K3IA 4J9VA 2HMIB 1UWAA 4ED0A 4DSKA 2D3ZA 4F3MA 5HK4A 5KFMA 4O3SA 2ASJA 1UZHA 1HNZF 3OR1A 5DG7A 4DLEA 4GO7X 3WC2A 2XO7A 5C5JA 2V4JB 4M5HA 3KUGA 3JTPA 4DCPB 2J9DA 4L76A 2DRAA 1UVLA 3MM6B 3M4XA 2KG0A 1CS4B 1WWHA 2KVIA 1AZSB 1UFWA 2Z0GA 3H2LA 3HVRA 3HJVA 3C14A 4DV1F 4DWIA 1EZZB 3KJFB 4RKUC 1FX4A 3NGKA 2XGQA 1ZPVA 4RO0A 3AFGA 5I4MA 1UCNA 2VDHA 3BYRA 3M8QB 2QC3A 4MH8A 1NDPA 5E41A 5AE1A 4DL3A 4PG5A 2CQ2A 5K14A 4EMDA 2F9JA 5KFLA 3FBFA 3JS9A 2Z2LA 2YQ0A 2C3YA 1Q82T 2WOMB 4ICLB 1HQUA 2D3O1 1ZA1B 4ID5B 4YB1P 1X4DA 1VQPS 1QUPA 2UV8A 1KN6A 4OZ5A 1TV6B 3QAEA 2W7AA 4Z2XA 1SJRA 3LP1A 4OZJA 1FFGB 4NLGA 1C0UB 1U6FA 1B99A 4RNFA 5J2QB 3A8EA 3N5BA 1ZTWA 5E2QA 1Y11A 4MIAA 1RUSA 2KT2A 3OLBA 4LF8F 1FKOA 4PYAA 2OPRA 4P72A 2VG7B 3MAHA 4FXWA 3FK4A 4DEZA 2IVFB 4ZPWR 2RU9A 3LP1B 1TUWA 1DRZA 1NK0A 2DTJA 3V6HA 3T1YF 4B3RF 2CVIA 4IDKB 2OUGA 1L3KA 2H4YB 2HZAA 1KC8T 5K8NA 2ZBIA 1KBRA 1WTBA 4RBUA 3PYEA 1VBXA 1XNQF 4EFAC 4J9UE 1NK7A 3J7YU 1PYOB 3CD6S 3EMTA 1NJXA 2XS2A 3F56A 2BKPA 1VBYA 2VBYA 4IG3B 3ZZUA 3UCGA 2YNHB 2PD1A 4RW8B 1RAJA 3VTIA 2V69A 3W2VA 5D78A 5DDOC 3FQLA 1OS5A 5J2NA 3I5AA 4ZVRB 2CJQA 2PMZD 3DI6A 1HI0P 1XNRF 3R5BA 1RI7A 4KHPJ 3H5SA 4PWWA 4DPXA 2FY1A 1FWPA 1GH8A 2F4FA 5FLXU 5HANA 2OPSA 4TY9A 3E3XA 2OLWA 1HNXJ 2PI5A 2ZM6J 3KNGA 2LDIA 1KD1T 2D9PA 5IXUA 4O4GB 1FJGJ 2V6AA 4BWMA 5DDQC 4DU8A 5B7WA 3QJLA 4C8YA 4ECSA 1NRKA 3UCZP 5EX0A 2Z4PA 4AE5A 2UU9F 2B4VA 3HD2A 1NKBA 2X1AA 1N5YB 3MTKA 3VR1A 5KFCA 4KJIA 5H9FK 2BABA 1XMBA 1VQLS 1DTTB 2JVRA 5D8HB 1WOPA 4DL4A 2JEFA 4H4KC 4OZ1A 4BC7A 5KFAA 4JV0A 2KFNA 2ZH7A 5HP1A 2RDDA 3ISZA 1X9WA 2XB2D 3LUYA 4ZVQB 2ZBCA 5A2QY 3ZO7A 1WEZA 3NEKA 5IWAJ 3RRKA 4ZCMA 2X51A 3ISNC 3D68A 2ZC4A 4MIBA 2RE1A 2UUBJ 4F26A 3BH7B 4LQ3A 1H7WA 4W4MA 5CYMA 1TMMA 1NBEB 3BS9A 1JB0C 2VPXB 4BC9A 4DV2J 2I1RA 1S76D 2XYGB 2WVDA 3P6YC 2V2QA 2X7IA 3T19A 1LK7A 3JQKA 3JSRA 2VFVA 3L7OA 5HATA 1XMQJ 1RT4B 4TU9A 4YMEA 4DR4J 2YNGA 5GADU 4RW9B 2UV8G 2JRSA 2FB0A 3R5JB 3FSXA 1KWMA 2B7BB 3WX4A 3I56S 2ZBPA 1RWVB 3ZTOA 4AXJA 3CMQA 4UY8T 3CIZA 1SH0A 4NA3A 3K57A 4RR5A 4CQ1A 1EX8A 2G4BA 2PFDA 1SUQA 2VL1A 2ZH5A 3G6XA 3RR8A 2HFOA 1R0BG 1HWUA 2ASYA 2LVWA 4C0BA 4JB8B 2BJ8A 1SV5A 3R27A 3EPGA 2AEMA 3SCKE 2XMWA 2H4WB 4ED2A 2AGOA 4OFZA 2R7SA 1HNVB 3KLEA 3N28A 3OHBA 1ZAXA 2HRTA 1CVJA 3H0PA 2RIJA 2YWKA 3PM9A 8RUCA 2LECA 3H5UA 2RRBA 4RNHA 3RBDA 1PILA 1F2HA 2KJVA 3V6DB 2VOPA 5A8KA 1S0OA 4YY3F 1FESA 4EZ9A 5CCMA 4NLTA 3UN5A 3J7ZT 3AD9C 3GFZA 3B6BA 4LF4F 2BZ2A 3K5NA 2VF3A 4LF7J 2JWNA 4BDPA 4OYIA 3HHNB 3G8TA 4ED5A 3V2UC 3DLKB 1WG1A 5IQ6A 5IS2A 2MZSA 3HULA 1YJVA 2RH3A 4Y00A 3KLVA 2PT0A 5DS7A 1QTMA 3R2DJ 1VRUA 2LQBA 2Z56B 1CJTA 4F0KA 4P2XA 4HHUA 3HX9A 1KTQA 2WONA 4DV3F 3VVUA 2EI5A 2YX1A 2R8JA 2D3OR 2I8EA 5CYJA 1NHKL 5JXSA 2HFUA 2CQ0A 2Z8QA 3P5TL 1EQMA 4ZLPA 2GVDA 3AJDA 1AROP 2POKA 1S1WA 1YBUA 3L7UA 2FC8A 2JNJA 4M5IA 2UXCJ 1IKWB 4J9QA 1Q16B 3V4MA 3M2VB 3SFUA 2HPUA 1Q8IA 4YB5A 3FSIA 3W9IA 1Y3JA 3DYAA 4ZJQA 1WUUA 3PDNA 3QFHA 3BJYA 2Q6BA 3ZZTA 4URQU 3T1HF 3UO0A 3RTVA 4YDXA 3R7NB 3H20A 3CD7A 1SI9A 1TQLA 1KVIA 1FDDA 1RU2A 2QYCA 2WB1D 2HZCA 1QE1B 3LA0A 2QRRA 2MYFA 4EWTA 1HQEA 3RZAA 5J1EA 1CSJA 2EFPA 3MM8A 2RF2B 1YJRA 3AODA 3CF5Q 3M30A 4LF5F 2U1AA 2MLXA 1NPPA 2LFVA 2ZITA 1S9GB 4OZ0A 1U1MA 3VQTA 1U8SA 4E2FB 1VRTB 1C4AA 3JYTB 5F8JA 4K0KJ 2CZ9A 4B9MA 1T8EA 1RAEB 3OD2A 5KFUA 2NR0A 2OD4A 1PGZA 2MLZA 5KFOA 3DRRA 4OX9F 1KFDA 2AU0A 3NS7B 2IVYA 1OO0B 2W2MP 3SSQA 2GC8A 2ROGA 4DPOA 4UUXA 3DOLB 4AUKA 4TY8B 4X65F 3GCXP 3I0SA 4Y28C 1NK4A 1IBMJ 2I2YA 3GV8B 2RDJA 4Y0FA 5F41A 2UXBF 4DLGA 3IR5B 1D9DA 3ILLA 4URGA 3FBCA 1DQ8A 2FVCA 5AE3A 3AQOA 4O3OA 3G8SA 5KFEA 2PA8D 5DZ6A 3MM9B 1K1QA 1RP5A 1CLFA 1WC3A 5KFSA 2LYVA 2DT9A 4QW9A 3MR6A 2OJ3A 2BW7A 4KGXB 1EARA 5KFPA 1MROB 3GFXA 4RNNA 5HSPA 3MM7B 2ZUGA 2DNPA 4I64A 5I3PA 2C2NA 1NB7A 2SXLA 2IRXA 1R0AA 3W5YA 1ROFA 3DDKA 2FLLA 4HTIA 3R97A 1S10A 5D4NA 5C25A 3QRQA 4M5DA 5MAOA 3H7HB 2AKWB 4RW4A 1QVGR 2LMIA 4TN2A 3E8OA 1NJYA 3MMJA 1YLXA 2HGNA 2HYIB 2CIMA 2FLOA 1VQ9S 3I9V9 5EWFA 3VGTA 1WSVA 2OFGX 2R8KA 2HG4A 1U2RA 5L39A 2M2BA 2E1PA 3EZOA 4PPZA 3D28A 5J1NA 2VBXA 3KLGA 3DLEA 3NL0A 1NDKA 3Q0AA 3JB9k 4USIA 3FJ2A 1R31A 3UR0A 4PWUA 4CH0S 4JI0J 2CQIA 3W1YC 2P5VA 2XLIA 4MKAA 4DPTA 2LXUA 1IBLF 3EX7B 1ZBTA 1HBNA 3BPSP 4XIUA 4PXCA 1N0UA 1Y3KA 5CZVA 1B3TA 2EXUA 4DUYJ 4HACA 1FK9A 3ISND 5L1KA 2HQGA 1WEXA 2VG6B 1HHSA 4IFYB 2DH9A 3PX0A 1HNWJ 4L3NA 2WVCA 1RLCL 3E01B 5D6GA 4BHQA 3B8HA 1L3VA 5KFRA 4RUHA 3H40A 2RAQA 4DL0C 1GAOA 3JQJA 3GIRA 5BJRA 2UVVA 4HHHA 3LH2S 4QWEA 4LSLB 1NO8A 2GQCA 3EYZA 3V6JA 2CAJA 3N0VA 4DZDA 1C1BA 2GVZA 1UWBA 3OTOJ 3MAAA 1MN9A 2RU3A 1O6XA 2P6TA 3A8IA 4PRFA 2OTJS 2KU7A 3TW0A 1PG5B 1EETB 2IFXA 2VQEF 3CTRA 5B08A 2MHEA 3KG0A 4A8MP 3RBEA 4ES1A 1FFWB 1N36J 3HDSA 1S1UB 3W64A 1XMOF 2QLXA 5I3UB 2XQCA 3Q23A 1AUDA 4YS2A 3Q83A 4OQJA 2VQFF 3RAXA 1NPRA 3CJ4A 2QLFB 5HJXA 3BKTA 1HBUA 2V8HA 2CPXA 3NBPB 2YX7A 3DGVA 3MEEA 2E29A 4L75A 3MUVP 1RHKB 1WNEA 3MM5B 1EHWA 3R3TA 3ZNUA 2JX2A 3OR2A 2DVIA 1N33F 2FDNA 2HQDA 1DBDA 3DMJA 3BGFA 4NCBA 1PC5A 4RL1A 2JLEA 3NNAA 4ZLNA 5C2CA 3AOCA 1H38A 4CLZA 3K5LA 2BW2A 5KFDA 4DV4J 4IOBA 3BQ1A 2MGZA 1CJKA 3O1LA 1FI4A 2QN6B 5CZXA 3TX8A 1FXLA 4WK3A 3V4IA 3MI7X 2ZE2A 1UKUA 2QA4G 4NXMJ 2ZZNA 3TA1A 1JLQA 4HTJA 5E0OA 2FJBB 3EM1A 4NX9A 5DJBA 1PO6A 3Q8RB 3W62A 2HHHF 1L5UA 4Y65A 2IC3A 1X5PA 5BR8J 3I87A 4IR9A 1FNXH 4DPUA 4EYIB 4NRTA 1RTDA 4LRCA 2C28A 1SQEA 4ZPVR 1A7GE 1RLDA 1N34F 5C24A 5KT2A 1FX2A 2AHOB 3W5XA 3UR3C 4WYWA 2ROPA 3I5CA 3P96A 1F0XA 2HAIA 2QT7A 4ZPAA 2UXDJ 4HHJA 4ZKAA 3I0RA 1Q8KA 2QE5A 5LXRA 4LMZA 3A3NB 5GAGU 4QPTA 1JJCB 1K1SA 3NCRA 5JMNA 1TL4A 4DR1J 1RT2B 2AW0A 1NPKA 4NRUA 4HT5A 3WBZA 5HVFA 2ZH6A 4K4VA 4KHMA 4ZN3A 3M2UA 3TUZC 1OYDA 3KJNB 3QWUA 4LREA 1ACMB 1SKRA 2WBMA 1U0HB 3R6GB 4X4TA 1H72C 1F3FA 2E9TA 3OV7A 1RT1B 2M3DA 2XMJA 1ITPA 3KK3A 2ZDOA 4JV5J 4K4TA 2K06A 3DOMA 3PO5A 2X1GA 1SC3B 5KFYA 2YVSA 4AQYF 1K44A 2GV1A 3CDWA 1JLBB 3HSGA 3JTNA 5GAEU 1FVQA 2E44A 4WP9A 3LWMA 2BJ1A 1YQHA 2COLA 4DOZA 3PJWA 4KO0B 5FLXY 1GMWD 3Q8UA 4DHVA 4DS5A 5HLFA 5L8RC 2BBEA 2W2PP 2ZJQQ 1S7IA 2B5JB 2VUGA 4CLYA 5G4DA 3LP0A 3VAIA 2AZ3A 2AEFA 3D1OA 2A6OA 2RD5C 2GQ2A 1WHYA 1SCJB 1IBKF 1R89A 2AMCB 3NKYA 1VMBA 2BACA 1VRQC 1SL1A 2DXFA 2RKIB 1I3OB 2OFHX 2AYMA 3PVXA 4LF6J 2ZH3A 3GFYA 3ZXWA 2YQ3A 4WFAQ 2M70A 4OHZA 4A8SA 3NGSA 1UW4A 4A8KA 4XO0A 8AT1B 2R9LA 1FRKA 1X0FA 3M6XA 5T7LB 4B08A 4G1PA 3SQGB 4F4WA 5IM0A 2G2YA 3QYYA 1HPZB 5KG6A 5AXLA 1I51B 1JLCA 2KYZA 4M94A 3D0HE 3W5ZA 5DQGA 1T94A 1TFWA 1VHIA 4KE5A 3VAFA 4NPOA 2JOQA 1YX2A 5AJ3J 3MEGB 2MLYA 2XULA 3CCTA 2GA7A 2BKNA 5IM0B 2JH3A 1F6TA 4RLEA 2AYGA 4WF9Q 1TK8A 3O2IA 3SDEA 3FCHA 4OYZA 1ICEB 1RAAB 2XLKA 3LALA 4F7VA 2IAJB 5EGYA 4DCJB 2R7OA 5DQIA 4OZ3A 4OMFG 3IR7B 3BSCA 1T02A 3VCDA 1U24A
chains in the Genus database with same CATH topology
2Q3PA 1ZETA 1UVNA 1G2EA 1ZH5A 2ZHOA 3D54A 4F02A 3IAS9 1ZAWA 3H59A 3PNIA 2CPYA 2YWHA 2YWFA 4OIXA 1FDAA 1RT4A 2FHJD 4QWCA 3IS9B 2L9WA 3RW6A 3CJ5A 1DAXA 4ZPDA 2NLWA 4DBQA 4PG4A 2A2DA 2IYIA 1OSDA 1LV5A 2YWGA 4WIIA 5H1SV 5BR8F 1FRIA 2GNKA 5J2PA 4ZCLA 5EDWA 3M9OB 1UA0A 2N4DA 2HQIA 3LAMA 4RW9A 1XN9A 2FC9A 7FD1A 2MQMA 2IRYA 1HBNB 1I94F 1YRXA 1D9FA 5HBMA 2ZH2A 5B09A 1R3NA 1Q7YT 2HNDB 1FDBA 2P9EA 4X66F 3RB0A 2I0XA 3J7A1 3OTEA 1FK9B 4K4XA 1Q7LB 2GHVC 2V9KA 2HW3A 3UQSA 3MEKA 3BDEA 3MMAB 2B4UA 2Y1IA 4CT8A 1RA7A 4F25A 4R0EA 2DGVA 3GFHA 3C6TA 3IWLA 4U9RA 1U6BA 4X4VA 3HHLA 2QLWA 3K2YA 1VI7A 3I6PA 3HKWA 4R5PB 4QR2A 2QFJA 4NCGA 4ZPBA 5F3TA 5DDRC 4NZ6A 2DGWA 2LKZA 2N7CA 1QSYA 4BCAA 3CCVS 1BGXT 3M8RA 2BA9A 2L9DA 2CG4A 3OFHA 5A0YB 5M2UA 2F8HA 5CYQA 1RT6A 5B0EA 4ERDA 2WB4A 1M1KT 1LQ9A 3LQVA 4KFBA 5J2PB 2GGPA 1VK8A 3B4DA 4DV5F 4FF2A 3MOJB 2KZZA 4ECRA 4NLYA 1W2BR 3CC4S 4EO8A 3GR1A 3H25A 3I9ZA 3RW7A 2E9RX 2PSZA 3E51A 4A46A 1TK0A 4A8XA 3AJ1A 5IFMA 5L9XA 2E1CA 3HF5A 3OLAA 2W9CA 2NXUA 1OQ6A 2P9GA 3KMQA 4H4MB 2IRUA 4IG0A 4DR3F 2NREA 3H2UB 1G3OA 2EG2A 2D3UA 3MPVA 4PG8A 2ZH4A 1JLFB 2B51A 5CH7B 4ZS6A 2AGPA 2DNLA 2GCFA 5T14A 4P7TA 3IFEA 1HNVA 2E1RA 4DR1F 1FERA 4L72B 4I68A 1C1BB 3CVKA 4IYQA 5LSLA 2W4DA 4B9SA 2DNGA 3F44A 4NLOA 1B0PA 2PI4A 3VQSA 3VALA 3UNGC 1UWBB 1ZPWX 3NLCA 4OLPA 1Z1ZA 4OI1A 3IC1A 2XGPA 4OI4A 3T6JA 2RVJA 1U1LA 2P6SA 3LOUA 3OBIA 1QAJA 5GVQA 4QBUA 1RT3A 3V6DA 3K5PA 2EFGA 2FLPA 1LW0A 1FF2A 1S72S 2X1BA 3POTA 2J6TA 3DU6A 2A18A 4DF4A 3PZPA 2RT3A 2BUNA 7FDRA 2ILZA 1S6PB 2JEGA 4USHA 1WTFA 1ULRA 1TL1B 2GO8A 2PGCA 2EBGA 1JLEB 5J2MB 2C42A 2EKYA 2LXIA 3HHEA 1VQ5S 3KHGA 2J9DE 1TUVA 2CKWA 1S6QA 5A6PA 3KLFA 3SV4A 1FKPB 4X4RA 4X62F 3KK1A 5EWGA 3CC7S 5FDLB 2YH1A 2E1AA 4DN0A 5B0AA 3HPOA 4KKOA 2ZZMA 1YJTA 1H98A 5M2PA 2BANB 2FJEB 2XSJB 2HHXA 2L48A 4WKRA 2YKMA 3BO4A 4RBTA 1R6YA