1SUQB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with janssen-r185545
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
427
structure length
427
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of Conformational and Positional Adaptability in Structure-Based Design of TMC125-R165335 (Etravirine) and Related Non-nucleoside Reverse Transcriptase Inhibitors That Are Highly Potent and Effective against Wild-Type and Drug-Resistant HIV-1 Variants
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords REVERSE TRANSCRIPTASE
total genus 95
structure length 427
sequence length 427
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1suqB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1suqB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1suqB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1suqB03
1RT3A 2GIQA 4ZPBA 5KFLA 3UR0A 1C2PA 5KFKA 5KT6A 3IG1A 2W9BA 1TL3A 2OPRB 1RTHA 1C1CA 1FK9A 1HMVB 3CDEA 5KFBA 2UVUA 4KHRA 3DRRA 3OL6A 4KV8B 1RTIB 3MEDB 3PW4A 1HNVB 4I2PA 4RW9A 1RT4A 4R5PB 5I42A 4U7CA 2R8IA 2AQ4A 2JC1A 4NLYA 3UQSA 1JLBA 4IFVA 2YKMA 3SFUA 5KG0A 5KFWA 1TKXA 4ECQA 3RBEA 3IRXA 2QE5A 3KLEA 2XGQA 3PJWA 2VG5A 1S0NA 4O44A 2ZE2B 5KFYA 5L1IA 1TV6B 3V4IA 4ZP6A 2ZKUA 2R8JA 1S49A 3MEEA 1JKHB 2OPPB 3SI8A 5I3UB 3C6UB 5DLGA 4QW8A 4LQ9A 5KT4A 1RA6A 1T03B 3DLKA 1S1VB 1IM4A 2IAJA 4MIBA 3KHGA 4LSLA 2AGQA 3I0SB 4KBIA 5F8IA 5C42B 1RT6A 1S6PA 4MIAA 4YR3A 1S6QA 4LSNB 2FVQA 1S9GA 1SV5B 5DQIA 3UPFA 3QLHB 3HVTA 4ED3A 3OL9A 3DMJA 4ED6A 1S1UA 1XR5A 2W9CA 3HKWA 2C28A 2FJWA 3IS9A 3OL8A 5JXSA 1SH2A 4GC6A 4R0EA 3RB3A 1LWFB 4RW7A 1TQLA 4JV1A 4ECWA 4K4UA 2HMIB 5DGAA 2RF2B 2YNHB 3MEGA 2W9AA 2ASJA 2R2SA 3H4DA 3NMAA 3GQCA 4J9PA 5HBMA 3M8QB 3LP1A 1J5OA 1KLMB 2RKIB 4KKOA 3KLGB 3KK3B 5C25B 4EBDA 2IC3B 1FKPA 4YQWA 4NLWA 5EUHA 3DM2B 4O4GA 3ICLA 2JEFA 2XGPA 4EYHB 1FKOB 4XO0A 3CDWA 4IR1A 1S0MA 3RB0A 4PWDA 3DOLB 1HPZA 4F4XA 1REVA 5FDLB 3KLHB 4DL5A 3DI6A 2C22A 4RW6B 4IKAA 2V0NA 3PHEA 2CKWA 5J1EA 2FVCA 1EP4B 2D7SA 1RAJA 2WRMA 2FVRA 4Q43A 2UVVA 1HQEA 4IH7A 4MK8A 1LWEB 5F8LA 2V9WA 1JLAA 3BREA 1VRUB 3MR2A 4ECTA 1DLOA 1S1WB 2YKNA 4Q0BB 1YVFA 3CJ0A 2WOMA 1S10A 3GIMA 5KFSA 1JLEA 3ISNC 3KLFB 1JIHA 4ZPAA 4RNOA 5L9XA 3FQLA 3DRSA 3D5MA 4WZMA 2ATLA 2UUWA 2OPSB 2B43A 5HP1B 1IKYA 4IFYA 3MFIA 3JSMB 2AGOA 3DDKA 4WE1A 5KFGA 3TAMB 2HNZA 4B3OA 5KT3A 1C1BA 2ALZA 2UVRA 2YNIB 3DLEA 3NBPB 3BSOA 3DOKA 2AU0A 1MMLA 2BRKA 1TKTB 4TY8B 3KK1A 1S9EA 1N6QA 4F4ZA 3C6TB 2HNYA 4M94A 3G6VA 3GV7B 3I5CA 4IOBA 3T5JA 2ASDA 4I7FA 1S9FA 3V81B 3LP2B 4RNFA 3V6DB 5KG4A 5EWFA 5D3GB 4ED2A 4DG1A 1IKVB 4XPCA 4NLDA 1RT3B 3BSAA 3IG1B 5L1LA 3DRPB 1DTQA 2IM2A 4ZPCA 5KG5A 3GV8B 2RDJA 4RNNA 2OPRA 1C1CB 1FK9B 1HMVA 1T3NA 4NCGA 2R2RA 3DRRB 2FJVA 3KHLA 1RTIA 3E51A 1HNVA 3G6XA 4ECSA 1JLQA 4I2PB 2IA6A 1HARA 5I42B 4R5PA 3LAKA 4RUCA 4Q45A 4IRCA 3OLBA 3KOAA 4RW8A 2YKMB 2YNGB 4WYLA 3FSIA 3T5HA 1XR6A 1T94A 3IRXB 3N6MA 3QZ8A 3KLEB 3FFIB 4IG0B 3DYAA 1TP7A 4TN2A 1RA7A 2VG5B 2R2TA 4O44B 4KSEB 3V6KA 2J6TA 3KNAA 4K50A 1JKHA 2IM1A 2OPPA 3NL0A 5I3UA 3C6UA 2I1RA 3CVKA 1RDRA 3DLGB 3GYNA 4NLQA 4ECRA 3T5LA 1JLFB 4JUZA 2D3UA 2R8HA 1T03A 2FLPA 3DLKB 2GC8A 1S1VA 1S48A 2IAJB 4Q8FA 4IG3A 4ZP7A 5KFJA 1VRTA 3I0SA 4J9LA 4G1QA 5C42A 1SUQA 4KHMA 1S6QB 2XWYA 3RBDA 4NLTA 5KFHA 2HWIA 4YMEA 5KFCA 1ZTTA 3BQ2A 1S9GB 4NZ0A 5F8MA 3KHHA 3BJYA 4EBEA 4RW4B 3LAMA 4Y34A 2OPQA 5CYQA 3CDUA 4DL6A 1S1UB 2W9CB 4ED1A 2XI3A 1S1XB 2V4RA 3RAQA 3IS9B 1RT2A 3QYYA 1N4LA 1K1SA 5KG2A 3H5YA 3EPIA 3GIIA 1LWFA 4RW7B 4RNHA 3BR9A 2B5JA 4ICLA 5KFIA 4TXSA 2XI2A 5EDWA 1JLGA 2WCXA 2WTFA 2W8KA 1D1UA 5F8JA 1BQMA 3V6HA 1LW2A 4I2QA 4ID5B 5DG9A 3ISND 3M8QA 3LP1B 3M9OB 1KLMA 4NYZA 2E9ZA 3FDSA 3KJVB 4KKOB 3I0RA 3KLGA 4NLSA 1W25A 3BGRB 1EETB 2BANB 4YR0A 3H5XA 2IC3A 2BQUA 3DM2A 4O4GB 1FKOA 2UUTA 4ZHRA 2E9RX 4QWCA 4G3IA 1HPZB 5KFUA 5K14B 1XR7A 1TKZB 4NLXA 3DI6B 2I5JB 2CJQA 4RW6A 4KFBA 4K4SA 4PUOA 3V6JA 2R2UA 5KG6A 5J1EB 1IKWB 1C0TA 5DLFA 2WONA 2VG7B 4ZP9A 3Q8PB 1LWEA 3KMSA 3MR3A 1S0OA 3H59A 4RNMA 4QW9A 5F8GA 4TQRA 1VRUA 5KFTA 4H4OA 1S1WA 4Q0BA 4J9KA 3I5BA 4KAIA 3D28A 2WOMB 3PJXA 3GILA 2JEIA 5HROA 1JLEB 1KHVA 3KLFA 3CIZA 5C24B 4HYKA 4ECYA 4GC7A 3I5AA 2XCPA 3N6LA 3OSNA 5HP1A 1IKYB 4IFYB 4IRKA 1RT7B 2FJXA 2EC0A 3JSMA 2BQRA 3SFGA 1CSJA 4WE1B 3TAMA 4ED0A 4O3PA 2YNFA 2HNZB 2DPJA 3T1AA 4B3OB 2BRLA 1SH0A 2YNIA 3DLEB 3KLIB 4WXWA 3RAXA 1TKTA 3KK1B 1S9EB 1N6QB 4RUAA 4EYIB 4K4VA 2FLNA 3C6TA 2HNYB 3CJ5A 2W7OA 1TVRB 3TQ1A 1R0AA 4O3SA 4J9OA 2R8KA 5CYMA 1QE1A 3LP2A 4MKAA 5JUMA 2BR0A 5DG8A 5D3GA 1MU2A 2DPIA 4DG1B 5C5JA 1IKVA 5F8HA 1RT1A 5KFMA 3GV5B 1ZETA 1JXLA 4K4ZA 4RU9A 1RT5A 5J2PA 2BE2A 4NLVA 3DRPA 1DTQB 2VG6B 4ECVA 4NCGB 2IJFA 4R8UA 5KFFA 2B6AB 3MECA 4F50A 3RB6A 4FBUA 4NLPA 4IDKB 1JLQB 5F8NA 5DQHA 3OL7A 1RYRA 3PW5A 2JC0A 4EO6A 1T05B 3HVAA 4O3QA 4ED7A 2AX0A 2FLLA 4RW8B 3FQKA 1BQNA 2YNGA 1LW0B 2ILYA 3NAHA 3FFIA 1IKXB 3QO9A 4IG0A 1WNEA 3KMQA 3DYAB 4MK7A 4WZQA 3M9MB 4QWDA 2E9TA 3LP0A 5KFVA 4ZPDA 1JLCA 5DGBA 5KFQA 3M8PA 3KK2A 3EPGA 4H4MA 4KO0A 2VA3A 1S1TA 1RTJA 1DTTB 1TL1A 2W8LA 3DLGA 1SH3A 4URQU 1JLFA 4EBCA 4F4YA 4XPEA 4PQUA 4J9SA 2HNDB 5J2MB 1I6JA 5J2QB 4IG3B 4IRDA 1VRTB 1SUQB 2OH2A 4WFZA 2XCAA 3H40A 1UWBB 2D3ZA 1HNIA 2ZD1A 4DL2A 1HYSB 1N56A 3UDLA 4RW4A 5F9NA 4NLRA 3PW0A 2OPQB 5CYQB 4JV0A 3QIDA 4JV2A 1GX6A 2IJNA 2UVWA 1S1XA 2ILZA 1RT2B 3NKYA 3OHAA 3ITHB 4QWBA 2WK4A 3QZ7A 3BSNA 2IM3A 2HWHA 2B5JB 4ICLB 3GIJA 1JLGB 3MR6A 4Q8EA 1BQMB 4WYWA 2XC9A 1LW2B 4I2QB 5J2NA 4ID5A 4YR2A 1RTDA 3N6NA 3IN5A 3G6YA 5DQGA 4ECZA 1N5YA 3CWJA 1HQUA 3E01B 3KJVA 3JYTA 3OSPA 3I0RB 3BGRA 1EETA 2BANA 1C0UB 4WFXA 4Y2AA 5KG3A 3T5KA 3H5SA 4F4WA 4FS2A 5HLFA 3EZUA 2IM0A 4ZHRB 2FVPA 5K14A 1TKZA 4MFBA 2I5JA 4KFBB 3H4BA 4PUOB 4TY9A 4K4WA 3QIPA 1LWCA 4G1QB 4DL4A 3LANA 3CJ3A 1IKWA 4QPXA 2J6SA 1C0TB 4Y2CA 2WONB 2VG7A 4M95A 3QGIA 3MFHA 3BSCA 5EWEA 1NHVA 5KFXA 1TL3B 2W9BB 4NLOA 1RTHB 3MF5A 4H4OB 4MH8A 3PW2A 3NAIA 4KV8A 3PW7A 3MEDA 4DL7A 1GX5A 2WB4A 3PZPA 5KFNA 5HROB 4RW9B 1RT4B 4EEYA 4NLUA 3PR5B 4ZVEA 3BQ0A 5KFAA 5C24A 1JLBB 4IFVB 2W7PA 1TKXB 1RT7A 4O4RA 4HKQA 3MR5A 4ZVFA 3QGHA 4NRUA 4FS1A 1N48A 2ZE2A 2V4QA 2YNFB 1TV6A 3V4IB 4TYAA 5F9LA 3KLIA 3OLAA 3MEEB 1QAJA 3G86A 4TYBA 5L1KA 5KT5A 4WXOA 5KFZA 5KT7A 1S97A 1TVRA 2VA2A 2AWZA 1R0AB 3H2LA 4J9NA 5CYMB 1QE1B 4LSLB 5KFOA 4OL8A 1RT6B 1S6PB 1S4FA 2O5DA 5EWGA 1MU2B 1JX4A 3OHBA 2ASLA 1RT1B 4LSNA 2JEJA 3LALA 2J6UA 1NNDA 4KE5A 1SV5A 5T14A 4EO8A 3QLHA 1RT5B 3HVTB 5J2PB 2BE2B 3CO9A 4ZMMA 5KFPA 5DG7A 3DMJB 2VG6A 4ECXA 4TQSA 4NRTA 4TLRA 4X2BA 4R8UB 2B6AA 3MECB 3HHKA 4NLGA 4IDKA 5KFRA 4URSA 1NHUA 1T05A 3Q8RB 3TVKA 4ZVHA 4K4XA 2HMIA 2IBKA 1BQNB 1OS5A 2RF2A 2YNHA 1LW0A 3MEGB 4MK9A 3KHRA 4ECUA 4DEZA 5HBMB 3H98A 1J5OB 1IKXA 3QO9B 2RKIA 4ZP8A 4O3NA 4H54A 3LP0B 3KK3A 1Z4UA 5C25A 1JLCB 1FKPB 3M8PB 3KK2B 2FVSA 4H4MB 4KO0B 1ZTWA 2F8EX 3HVWA 4Q44A 1S1TB 2IMWP 2R8GA 1RTJB 1DTTA 1TL1B 3MTKA 1RYSA 5KFEA 4U6PA 5KG7A 3GIKA 4PWDB 2WHOA 3DOLA 2RDIA 1REVB 2JLEA 5FDLA 3KLHA 4PQUB 4DL3A 4MKBA 3BQ1A 2HNDA 5J2MA 1D0EA 1U09A 5J2QA 2JEGA 3IGNA 3M9NB 4O3RA 1EP4A 2D41A 1HQEB 2GIRA 1K1QA 4KB7A 2C2EA 1UWBA 1KHWA 1HNIB 1JLAB 2ZD1B 1HYSA 4LQ3A 4ZVGA 1DLOB 2YKNB 3CJ4A 4J9RA 3Q8SB 3VQSA 2C2RA 2AGPA 3NGDA 3RB4A 1QAIA 5KFDA 3PVXA 4K4TA 4J9MA 1QUVA 3ITHA 3DRSB 4FBTA 3CJ2A 2OPSA 4QWAA 4RZRA 4ED8A 4Y3CA 4IH5A 2QV6A 4WFYA 4K4YA 5J2NB 1RTDB 2HAIA 1N5YB 3PR4A 1HQUB 3E01A 3JYTB 3QGGA 4YP3A 1C1BB 4URGA 3KLVA 4J9QA 3NBPA 2C2DA 3DOKB 3IGVA 3T19A 4QWEA 1C0UA 2BQ3A 3Q8QB 3H5UA 4TY8A 5KT2A 5HLFB 5L1JA 3FRZA 4I7FB 4O3OA 3V81A 4MFBB 3V6DA 5KG1A 4IQXA 2AX1A 3QIPB 1LWCB 4IR9A 4IH6A
chains in the Genus database with same CATH superfamily
3CJRA 2OJ3A 2COLA 2HBZB 1Q53A 3MCMA 5KT6A 3BBBA 3N0VA 2WVBA 3JSBA 3WX8A 4CP5A 1SCJB 2F63A 3N01A 3TJ8A 1FNXH 1FK9A 1VFJA 3DHXA 1FRMA 4BCAA 2IPOB 2DH9A 4U7CA 1G7CB 1BE4A 4X4UA 2QFIA 2DEJA 2EFNA 1OO0B 5ITHA 1X4FA 3FCHA 3P8BB 2FY8A 5KG0A 3MMAA 2ZKTA 2QLJB 2V6AA 2MGZA 3UN3A 3VZHA 4AL5A 2CQ3A 4U9RA 5HI7A 5LSOA 5L1IA 1TV6B 3I82A 4KC5A 2ZKUA 5CD4A 2JX2A 4OYXA 2KDOA 2CQHA 3PDNA 1FEHA 3MEEA 2V63A 3BH7B 4XAKA 3CDAA 5HJXA 4JI5F 4LFCF 3CW2C 2GCFA 2MLXA 8ATCB 1KKHA 4U7UD 2UV8G 1T03B 2XHCA 3QFWA 4K5SA 4R0JA 3FGVA 3QJLA 4JV5J 1RKJA 2IAJA 4MIBA 1WG5A 3I0SB 4KBIA 3W5ZA 4MIAA 1RT6A 1KLNA 2B8PA 3BYPA 3TZYA 1FX4A 4LSNB 5J1PA 4LIRA 1SV5B 1O51A 2W2PP 4LR9A 3HVTA 1EKSA 4ED3A 3QAUA 1VJQA 2ROPA 3NNCA 3DMJA 4ED6A 1XR5A 2XLKA 3HXMA 3HKWA 2C28A 2FJWA 4CNYA 2KG0A 2D9OA 3HO1A 1RU1A 4RWXA 4TU7A 4GC6A 5G4DA 2A18A 3MHYA 1LWFB 3O1LA 3VF0B 2K1RB 4J5OA 1N34F 4JV1A 4ECWA 2HMIB 4QOTA 4JI0J 5HVHA 3W8GA 3MEGA 2W9AA 4RBTA 3KG4A 4DFMA 3TUPA 2ZZNA 1X31C 1P6TA 3M8QB 3LP1A 5HMZA 1I94J 2HVZA 4KKOA 3D0GE 3HF5A 2CXEA 3NCRA 2MJNA 1XNRF 4GKKJ 2BABA 3AFGA 4K2JA 5EUHA 4KGKA 2Q6BA 4C98A 3CDWA 3GPAA 5B08A 2VJUA 1S0MA 2XB2D 4OX6A 1NEEA 2JWNA 4PWDA 2CADA 4ELVA 2R7UA 1HPZA 5FDLB 3ETMA 3C46A 2B0GA 3QT5A 4KGMA 3SQGA 1QD1A 3AA9A 4D3GA 4F04B 5LJ3Y 3Q22A 2GHWA 3M4XA 1Y10A 4WPAA 2NS1B 2WRMA 3PYGA 2HK2A 1AZSA 4IH7A 2DO0A 4MK8A 4X4TA 3HJVA 4USMA 4OYWA 2QFJA 3D6MB 4F25A 3G82B 4DQSA 3MM7A 4JI8F 4N76A 1VBZA 3VAMA 1EZZB 4BC9A 3PRVA 1S10A 4OV1A 3VV2B 3GIMA 3UCUP 5D0EA 1FRHA 4RNOA 1Q86T 3R7BB 2OEJA 3DRSA 3D5MA 3AD9C 4WZMA 5LMUF 3BH6B 3MUMP 5HP1B 1E6YA 2UXBJ 1OQ3A 5IWAF 3JSMB 3CJQA 2DHSA 1FJGJ 2HGNA 2EFGA 4WE1A 2V8GA 5KFGA 3TAMB 2OFHX 1Z2ZA 3ZZRA 1TAQA 4B3OA 1GFWB 1C1BA 1U02A 1H2TZ 1U2FA 1WOOA 3D1QA 4RX6A 3RJMB 2CDRB 5C2GA 5D0HA 1MMLA 3BSOA 2MQQA 5JMNA 3MAAB 1CJUB 3KK1A 1S9EA 1N6QA 1T9TA 3AT1B 3LQVA 4OLPA 2YWHA 5IWAJ 4M94A 2KHCA 1FJGF 2P9EA 5F3ZA 1FE4A 1B0PA 2ZBPA 3T5JA 1YRUA 3TEGA 2X1BA 1TR0A 4C8YA 2PGCA 3IWNC 1ZYQA 1EQMA 1FX2A 2EKYA 4ZLLA 1M5SA 4ED2A 4DG1A 1F2HA 1IKVB 4XPCA 1GMUA 2IA0A 1RT3B 2YWWA 3TNVA 3UN2A 3GYGA 2WW4A 4CLKA 2FGOA 2K3IA 1OYDA 3GJQB 5GMKa 5L1LA 1J5EJ 1DTQA 3MWBA 4ZPCA 2HQFA 1XMQJ 2DD8S 1C1CB 1HMVA 2ZH2A 4B3SF 4NCGA 4DL0C 2XMAA 3SV4A 2I9SA 5H9EJ 1N5TA 2FJVA 3H90A 1HR0J 1A9NB 2HHVA 3HD1A 1O5JA 4LREA 2KT3A 3G6XA 1HW8A 4ECSA 5DZ7A 2F40A 2FJAB 4RUCA 1SKSA 2DNGA 4LF6J 3OLBA 4AXJA 2ZHBA 4LF4J 3CMES 4A8MP 4WYLA 5A8WB 4V19X 3NNHA 3T5HA 4B3TJ 1QAYA 2QTWA 3QZ8A 2O3DA 2F9DA 3FEYB 2BE9B 3ADAC 2HG4A 2ZZTA 1RA7A 2VG5B 2QA4G 1MWYA 3IO1A 5D0GA 2NXJA 2DGUA 1JKHA 3B8HA 1M5KC 3NL0A 4DPYA 4USJC 1RDRA 3L09A 1OY8A 1RHRB 2HQ3A 5FLXY 5B0BA 2XBPA 4OX8A 4OZJA 3VAKA 4P72A 2M3DA 4QIWD 4L74A 2D3UA 2R8HA 3K5OA 4C6AA 4H4KC 3NCPA 3GTYX 1SUQA 4KHMA 1Y5IB 1S6QB 4DUTA 3UO0A 2OSQA 4PPDA 3RG6A 5KFHA 1N36F 1ZTTA 3WZ0A 4ER8A 4J9VA 2HHXA 5F8MA 3BJYA 3EYZA 4RW4B 4UY8T 4WF9Q 4JI7J 2CQ2A 3CDUA 4DR3F 3LWMA 3I6PA 5F3TA 2PO4A 2BJEA 2V4RA 3MM8B 3WQPA 1HA1A 1RT2A 3PACA 3QYYA 4JYAF 1N4LA 5KG2A 1H2VZ 3OTOJ 3A3OB 1WORA 4LUBA 2GHPA 1U1PA 5A6WA 4Q44A 2KFZA 1YLXA 2XI2A 3P5BP 2WCXA 5F8JA 1D1UA 1VBYA 1BQMA 3BF4A 4DQQA 4ID5B 5AE3A 5DG9A 4LFCJ 1K44A 1NO8A 3M8QA 3LP1B 4FXVA 4NCBA 3PG9A 4LF8F 2RE1A 4LIWA 2F4VJ 4OHYA 4KKOB 3I0RA 1YJUA 2C3MA 2J9EA 2MY8A 3MM6A 1XIQA 4NLSA 4PAAA 3AOAA 2BANB 2W7AA 2NZCA 1F5CA 3OVAA 2DYAA 4I1TA 2J8SA 4QJVA 2AHOB 2PIIA 5T7LB 2E9RX 2RQKA 4QWCA 2F4VF 1HPZB 4DX6A 1PCAA 2KL8A 2I5JB 3SQGB 4RW6A 4PUOA 2YH1A 1WOPA 3GLJA 2KTQA 3MMBB 2E5LJ 4ZVQB 2G2OA 2NXUA 4RR5A 5F0UA 5HVFA 5DLFA 2P6SA 2WONA 2VG7B 4ZP9A 1M90T 4B9UA 2W2NP 4EZ6A 1FE0A 5JJBA 2KJWA 5KFTA 2R3VA 3MM7B 4ZCKA 5EHHA 3I5BA 3HHDA 3RYLA 5BR8J 4J9KA 1X9SA 4NEYA 4YDDB 3GILA 1N33J 5BJRA 2CDQA 2G0CA 2BX6A 1KHVA 3CIZA 1Q1KA 4DSKA 1N33F 1YJTA 2A6MA 1HD1A 2ZNYA 5D4OA 2XCPA 3LGNA 5HO4A 4CYUA 1NSPA 2ACMA 5LM7E 1MW7A 1RT7B 2BKPA 3BGOP 2EC0A 3JSMA 3DLBA 1N5SA 5CQGA 4WE1B 1KS2A 4WFBQ 3K57A 3TAMA 1WDTA 4ED0A 2DJWA 3CCMS 2KM8C 3DLHA 1SH0A 3ELHA 1EAYC 2V34A 2A10A 3FBBA 1SJQA 3N5FA 1VK3A 1HBOA 1CJUA 2EFPA 3U02A 1S9EB 2LYVA 4ES2A 3GE9A 3GFYA 5LOQA 4OX9F 4ZCIA 1BC6A 4E0DA 2R8KA 1KTQA 2XG8A 3LP2A 4CTAB 1K73T 3IFEA 4OZ1A 5ETNA 4NCAA 3DFEA 5D3GA 3MMCA 1ZA2B 2DPIA 1V5IB 1IKVA 3EE3A 1TKDA 1B7FA 5HQ8A 2VBWA 4K4ZA 5I3QA 1ZM4A 4RU9A 3NGTA 2JVRA 2VPXB 2BE2A 2YKPA 4Q7AA 1RAFB 1DTQB 3OT9A 1RJJA 2DXDA 3IR5B 4LR8A 1ZM2A 4USUA 3CULA 1VIXA 3CJKA 2CPXA 3W62A 1HR0F 4NCGB 1HBMA 1CC8A 3JAMY 2UXBF 4DWIA 2CQPA 1CEZA 1JQGA 2H48B 2Z2LA 2Z8QA 2QA1A 1RBOB 1JLQB 3K89A 2AEMA 1VQ7S 1S12A 4OHWA 4NL5A 3HT0A 3R8YA 1H98A 2LKZA 1T05B 2G2ZA 2YKAA 2YWEA 2F8HA 2AX0A 4ED7A 2KJVA 2G1DA 4CM2A 4RW8B 4H4KA 1ELOA 3R27A 2DVIA 4C8ZA 3QSIA 1RAGB 3PRBA 3GCXP 3IXQA 4OYAA 2MLYA 5G0RA 4WZQA 1E6VB 2QSFA 3M9MB 3LP0A 5H1SV 3M8PA 1BXNA 3JQMA 2GO9A 3MD3A 3OVBA 1TL1A 1XMOF 2YQ3A 3GONA 1S79A 4ED5A 2MSTA 2MY7A 1V3SA 3DGPB 4XPEA 2DT9A 3OTDA 1VQOS 2LP4A 5J2MB 4IRDA 4IG3B 1RHQB 1X7VA 4A46A 4C97A 4XTTA 3F73A 1XMQF 3RR7A 4B3MF 1R8BA 4B3SJ 4WFZA 1X5PA 2J5AA 4N77A 4JBCA 1AUSL 3DCAA 4L75A 1R0CB 1HYSB 3D6HB 4RW4A 3BBCA 4LBPA 3QGPA 3UDLA 4TNOA 4YB6A 5F9NA 3W1YC 1JJ4A 3IA0A 1HHSA 1NXIA 2NXEA 2YQ0A 1RAHB 2J9CA 2XLJA 4DV5F 1VQKS 2IJNA 2UVWA 2D9PA 1JJHA 4MYTA 1RT2B 3NKYA 1M1KT 4QWBA 2VB6A 3QZ7A 8AT1B 1WUUA 4LSZB 1T9YA 2IM3A 1UVKA 3OUYB 2E5IA 2W4PA 3LO3A 3CGIA 2QSWA 3TAPA 1MWQA 2I2YA 4YR2A 4ID5A 3G6YA 1RTDA 3N6NA 3O5TB 2C3OA 4UOFA 5CCLA 5DQGA 4ECZA 5CABA 5DRKA 5ETKA 1HQUA 2HLUA 1VQYA 3TJAA 3MM6B 2ZH9A 1NPPA 4OMFG 4WTOB 1B70B 2DGWA 2WSEC 3KDNA 4B9LA 1N32J 3HFVA 1L3UA 1FDDA 4RBVA 4Z7CA 2PEHA 2FVPA 2E1MC 1J27A 4UTGA 5T7LA 3J7ZT 5A2QY 2CWKA 1XNRJ 3WC0A 1RBLA 5K14A 2KN4A 3MM9A 1D8ZA 4WU3A 2I5JA 4KR0B 4TLQA 3W61A 4PUOB 1N0UA 4TY9A 4DR3J 1UJ4A 5GAGU 2XYGB 3BKFA 4JI5J 4DPXA 2J6SA 3HI9A 3TW0A 2K2PA 2EK6A 2VBZA 1RBAA 4M5DA 1VQ6S 4Q2MA 4WP9A 2IDEA 4MJKA 1TL3B 3K8VA 4OHVA 2WB1D 1N52B 1V6HA 3BM7A 2V67A 3R5AA 3PW7A 3MEDA 1S59A 2J7KA 3HSGA 2WB4A 3PZPA 2NQPA 4CQ1A 1RT4B 1ZPVA 1X60A 3PR5B 3HSJA 4DOZA 3BQ0A 2ZOFA 1GEHA 5KFAA 4LRDA 1RAEB 2NZ4A 4HT7A 2EBGA 3BN7A 4ZN3A 1TKXB 3S7RA 1RWKB 1D9AA 4HKQA 3HHLB 3HD2A 3R2DJ 1YK9A 1LV5A 1XERA 4HTIA 3AD7C 1P8GA 2ZJRQ 2FJDB 2A3JA 3V4IB 4TYAA 1IBCB 1YJVA 3CCLS 3KLIA 2LLZA 2YPZA 3A1YG 5IM0B 1W2IA 2RMLA 3BKTA 3FBCA 4I0WA 5KFZA 4AUKA 4LFBF 4IYQA 1S97A 4DQPA 2XSFA 2KVQE 4DUZF 1W7WA 1QE1B 3C16B 5E3AA 4LSLB 4OHZA 4N47A 2OELA 4GO5X 4IO9Q 1S4FA 1IR2A 1MU2B 4P10A 3PYDA 1NNDA 2JHEA 2P9GA 4CCHA 5CYJA 1H0HB 2VONA 2CPDA 2BE2B 3GR1A 4UY85 4IOAQ 3JXOA 2VG6A 1PJ5A 1WJ9A 4NRTA 1IBKJ 1J2VA 3MECB 2Y1JA 5HATA 4IDKA 2V4JA 2V94A 3BBFA 4FYXB 2MKIA 1NHUA 1IJFB 4CM0A 2V5HG 4HH0A 4CO1A 3RZAA 4EI2A 3KG1A 4Y2KA 1PBAA 5DM6Q 2IBKA 5M2PA 1R8HA 1A0OB 4MK9A 3SYZA 2WW8A 3MPYA 4ANDA 4C11B 2H1YA 3F0NA 2MKHA 3JQJA 5G0RB 3X3UA 3L4BC 3KK3A 3LW5C 5C25A 2BM1A 4CI0B 2AF6A 1FERA 1VDHA 3M8PB 3KK2B 1HQ2A 1JXEA 2G2YA 4AYBD 4WFNQ 3MAHA 5LMUJ 4F4ZA 2R8GA 1RTJB 1TL1B 1KQGB 2YX7A 3QRRA 2W24A 2OFGX 1IM6A 4DLEA 1VRQC 2WHOA 3DOLA 2ASYA 5AXNA 1REVB 2M8DB 5DDRC 2BJ9A 3DGPA 4DL3A 4C3KA 3F41A 5J2MA 1U09A 3M2VB 5GAHU 3IGNA 1MMDA 2N7CA 4X4VA 3A12A 3B4DA 3FRYA 4WP8A 2P5VA 1EJ7L 3GFHA 5IV4A 1HNXJ 1NMEB 3SCJE 3RAMA 3JTPA 1WF2A 4XK8C 1CS4B 1GMWD 1IBMF 5A76A 4KPYA 3R7SB 4I67A 1DLOB 2YWFA 4UUXA 2YKNB 4NZ7A 3Q8SB 3P49B 3VQSA 1OY6A 2K7JA 4FKXA 2DO4A 3D66A 3NGDA 4ILLA 3VGVA 3PVXA 2Y8YA 5ETVA 4K4TA 4EMDA 1WSVA 3RW6A 3BR8A 4DV3F 2L08A 1RHKB 1P1TA 1SBRA 1KTVA 1AUDA 3AJ2A 4GKJJ 2FZKB 4WKRA 3OUYA 3MR7A 3CIMA 3AY0A 4IH5A 4AQYF 4JI4J 2DY9A 1RTDB 2E1RA 3L7OA 1UW9A 1N5YB 1V3RA 2Z0GA 4F7VA 4B02A 2B9WA 1HQUB 1LXJA 3TA2A 2C2NA 3NXZA 1X4EA 1KQSR 3DOKB 3IGVA 3B78A 4DSFA 2BQ3A 2RRBA 5HLFB 4OYBA 4YHHJ 3SBMA 2MEWA 3Q24A 5L1JA 5D4PA 2XM3A 1GXTA 4LF5J 2KZMA 4U8YA 1VQSA 5BYQA 3OD2A 2BZ2A 2AX1A 3QIPB 4C0BA 2AIRB 5KFLA 3ILLA 1NSQA 3ZTPA 1IBLF 2VQEJ 1FI4A 2F1FA 1WELA 1V3ZA 5ETLA 3VWSA 4JI1J 2R42A 2QT7A 4LF1A 1DQ8A 1K0VA 2OPRB 1RTHA 4P7VA 3CDEA 4ZIVA 1PYTA 4NZ6A 3ZTRA 3ZO7A 1R6YA 3MEDB 2D3OR 4G6VB 2UP1A 3QJJA 1M5VC 4I2PA 1GK8A 2DEIA 2FTRA 2R8IA 3ZFVA 1I94F 1RWWB 4WJBA 3D3BJ 5L38A 3PW5A 4JI1F 2BBEA 1F3FA 1LK7A 2YKMA 4ECQA 5KFWA 1TKXA 2UXDF 3RBEA 4B3RJ 4DR7F 1FVQA 3IRXA 1WHVA 2QE5A 3KLEA 4Y6IA 3HHLA 2EC2A 3POTA 4A4JA 4CO2A 6FD1A 1IQTA 1A7GE 1VC5A 2XMJA 2HZVA 2R8JA 1CJVB 2E5HA 1RISA 4OQJA 3D2WA 1S49A 4ELTA 2V2VA 3SI8A 5I3UB 3C6UB 3PEHA 4BWMA 4ETXA 3KYLA 2WVDA 1YDLA 2DHGA 2MTLA 2MZTA 2LECA 1H2UX 1RA6A 4Y2MA 5I3PA 1NJIT 5GAGI 4CIOA 3CDBA 4LSLA 4AL6A 1GMWA 2AGQA 1W2BR 5C42B 4B9NA 4JI3J 4LF9F 5D8HB 4YR3A 2F9JA 2XS2A 1Q8IA 2RRAA 3T41A 1B0VA 2FVQA 1HWKA 1GAOA 1WC3A 1X4GA 2EWHA 2HS4A 2JVOA 3UPFA 2A0FB 5DQIA 2UU9J 3OL9A 4M5NA 4F3MA 4OI0A 2BW7A 2E1CA 3BV8A 1XQIA 2YWKA 2HWTA 3BGLA 1S72S 1WEYA 3OL8A 2QJ3A 3S1TA 5LSRA 3B82A 2KT2A 4ANCA 4FXWA 2XY6A 1LQ9A 3RB3A 4RW7A 2FPHX 5B09A 5CCMA 4TKTA 3TR5A 2L3MA 1I5OB 1L3KA 2UUAF 1Y00A 2DNHA 2RF2B 2W1BA 3EGNA 2ASJA 2ALYB 3GQCA 4J9PA 1JXVA 1K9MT 1F6TA 1PKUA 1KLMB 1Q5VA 2RKIB 2E1AA 2DR6A 4JP8A 3PCOB 3W2VB 3K5MA 4B9VA 2GAHC 1UEUA 4JYAJ 2HVHA 2P8IA 2FZCB 2ZVSA 5D78A 5C25B 4EBDA 1QVFR 4QU6A 4CRJA 4C4WA 1HBUB 2W2OP 3B54A 3DM2B 4O4GA 2BJDA 2BM0A 2NUHA 4NLWA 1FKOB 1B0TA 1NZAA 4EWTA 5K20B 3RB0A 3TRGA 5L8RC 4YDXA 3J7A1 3DOLB 2C22A 3KLHB 2OTJS 4IKAA 2CKWA 2FJEB 3AD8C 3BB5A 3D54A 2D7SA 4Q43A 2UVVA 2JFKA 3OFFA 1HQEA 1LWEB 1UL3A 3QPIA 2V9WA 4IO1A 3RW7A 2RQCA 1VRUB 3ETOA 2X1GA 3D67A 1DLOA 3T6BA 1S1WB 2VH7A 4ALZA 5M2UA 4ECTA 2ZWOA 3UVJA 2ADCA 4LF7J 2WOMA 2UXCF 1JLEA 2HBYB 4OV6A 3IBFB 1Y5LB 3KLFB 2VFSA 1F0XA 2DR8A 4LMZA 3FQLA 4YY3J 1W26A 4N7TA 3NCQA 1NCLA 4YB5A 2DR7A 1TK5A 2OP5A 4LF7F 3ZZOA 1IKYA 4IFYA 3MFIA 4B3MJ 3GB0A 3TX0A 4PEOA 1FWKA 2KG1A 4NXNJ 2CQ4A 3NGKA 1KOHA 3PFOA 4P2XA 4DPTA 4F4AA 1VBKA 3EXCX 3NBPB 2CVEA 4A47A 1XNQJ 1RP5A 3A13A 4KQZA 4X4SA 3CCSS 1U0HA 5AXLA 2AU0A 1WC4A 1QSSA 2EFQA 5F0WA 4N56A 1XEZA 3G6VA 1BY9A 4IOBA 4ITSA 1QJHA 2Z57B 1XMBA 3VAIA 3AJ1A 3CCVS 2Z58B 5K8NA 4U96A 3CCJS 2EVZA 5A8RB 3CCES 4NLDA 1LFWA 4P6QA 4C0HA 1T3OA 4OJHA 4KJIA 1SIWB 1WKKA 3BSAA 3IAM9 4K8RA 2M7SA 3SCLE 1NH7A 1NUEA 4U95A 1RYRA 4C8KA 3M8SA 3DRPB 3C19A 3G9CA 3O6QA 3BPSP 4F0KA 5KG5A 4RNNA 2OPRA 1R8PA 2VQFF 1FK9B 2MZJA 3AOCA 1L3SA 4A8OA 2R2RA 4HHUA 4DPUA 1BLUA 2J9DE 2G0JA 2VU5A 1HI8A 3KUHA 1HARA 1SJ1A 5RUBA 3LH2S 3UDCA 3SQOP 4F2RA 4Q45A 2MSSA 3KOAA 2YNGB 2HVDA 4DR7J 3MAQA 1T94A 3IRXB 3KLEB 1ZM3A 2XWXA 2NCKL 4IG0B 4GKKF 1TP7A 3POTB 3QNWB 2DGQA 1SVDA 2EKNA 1YHQS 1NJWA 5IT4A 1HWJA 2LEPA 5B0FA 1CJVA 2N3LA 3M05A 3P96A 4K50A 3GR0A 2HFVA 4TVAB 3IBWA 2DNNA 3C6UA 3R6GB 3DLGB 4ECRA 1S57A 1JLFB 2DGVA 1OPZA 3DKDA 3ONQA 1SC6A 2V2KA 1PC5A 2VFTA 3CCWA 4JUZA 1T03A 4B17A 4O0IA 1TK8A 4Q8FA 1S48A 2IAJB 1YRTA 2OKQA 4KGVB 4WKYA 1VRTA 3I0SA 3ZTSA 2MKSA 4J9LA 1L5UA 4CT8A 1VQ4S 4GVLA 2LXIA 3R5DA 4HVZA 4BHQA 5U47A 3RRHA 3BGUA 2EXUA 4DPOA 3THTA 5B7WA 1A6LA 4BBYA 5KFCA 4EBEA 3PKYA 4ILMA 4LF8J 1UFLA 1UW4A 2ZC4A 2H51B 2JRSA 2OSRA 3CJ8A 4DL6A 1WEZA 2FYXA 2D3O1 2NREA 2MZRA 1QTNB 2MKJA 3IM9A 2KFNA 3C66A 3GIIA 1LWFA 2AZ1A 2AZ3A 2BOAA 3BR9A 2B5JA 1U25A 4A8SA 2V8DA 4TXSA 1NK0A 1JLGA 2BYCA 2C2MB 3KJNB 1GTEA 1RCXB 1LW2A 3QSYB 3V6HA 2E5LF 1KR4A 2DKOB 4F67A 1WG4A 1UA0A 3ISND 2Y8WA 2A2DA 2ZH3A 3QBCA 4RUHA 2MZQA 3C8YA 4DV1F 2RHSB 4XDDA 1EETB 4CLWA 2MXYA 4ED4A 3DM2A 4O4GB 3TUJC 1FKOA 4ZHRA 1S6UA 1CG2A 5EGYA 3I4HX 4FZVA 4FYVB 3J80Y 3QT7A 2KZZA 3UW1A 5KFUA 2ASDA 4NLXA 1TKZB 3IP0A 1ZPWX 3KKFA 3NY0A 4KFBA 3OR1B 1RGVA 2AYEA 3W5YA 3HSDA 3V6JA 1KVJA 3DHWC 3TUIC 5GADI 4X4RA 2OGUA 5L39A 1C0TA 1AT1B 1EKRA 1D9DA 1LWEA 3KMSA 3MR3A 1DARA 4QW9A 4DU7A 2AJ2A 3D7SB 4QQBA 4TQRA 4AL7A 1CC7A 1OJ4A 4H4OA 1S1WA 2DTJA 1S4EA 3CD5A 3I4PA 4FPRA 3UVJB 4JI8J 2UUAJ 1R8CA 3P5TL 3D9BA 3D28A 2WOMB 2GMHA 4L76A 4ZJLA 4X62J 4X66F 1VQ5S 3R1LA 3QRQA 2QO3A 1FJEB 3GJRB 1S76D 2YVSA 5C24B 5LXRA 4HYKA 5HJYA 5BYRA 2JNJA 1WTBA 5LXYA 4OI3A 3I5AA 2IVFB 3OSNA 5HP1A 1E6YB 1IKYB 4IFYB 2MZ1A 4DI6A 2XQCA 2V8HA 4DR6J 2XMWA 2Z56B 3TARA 1P9QC 1YJRA 2G9OA 4O3PA 3D68A 2DPJA 4B3OB 3LF0A 2FGCA 1HWUA 4WXWA 3MAAA 2HFNA 3KK1B 1N6QB 3MMJA 3ZZYA 4RUAA 4EYIB 1KNZA 3FMBA 3PKMA 3CJ5A 1TVRB 3OJUA 3I9ZA 2HURA 1KC8T 1EIYB 2V2QA 2FIUA 4LJMA 5DG8A 3G8QA 4HTJA 4DG1B 2MJUA 3CE8A 3R5JB 2ZVIA 2DCLA 1JXLA 2XS7A 3UWTA 1U1QA 2DGOA 5A0YB 1QVGR 2KI2A 1RT5A 5J2PA 2CUYA 4NLVA 2JOQA 2KB2A 1MN7A 2Y1IA 3A8JA 2IJFA 3M30A 1X9WA 4FBUA 1M0SA 2B9YA 2KHDA 3NOGA 2L9DA 4DR4F 5F8NA 1YGYA 3CSKA 4OYOA 2X7IA 3OL7A 3UD4P 1YTYA 3NGRA 2FLLA 3FQKA 3UDEA 3R5CA 3EX7B 4J7CA 5A8WA 4ZVPB 2BJ7A 3OTBA 3Q2TC 1FTRA 2ILYA 2MHEA 1NSKL 2WVEA 5HMWA 2ABYA 3NAHA 2I0XA 3VAJA 1IKXB 3QO9A 2OEMA 4LRAA 2VQEF 2VBXA 3M6VA 3TZXA 3WIUA 3OXGA 5CZVA 4GRSA 4NYPA 2ZHAA 1YBAA 3MURP 3VAGA 4NYOA 3H7HB 5LMNF 3T1HJ 5DGBA 1VHFA 5KFQA 1U1MA 3H0PA 4H4MA 2AEJA 3EPGA 1XC9A 1S1TA 2R7OA 3D6FB 4J37A 1DTTB 2ATCB 4FYWB 3DLGA 4URQU 1T0TV 1N8RT 2LMIA 1RCOB 1VS3A 4F4YA 4F3OA 1FD8A 4K7QA 1L3TA 4L3NA 5J2QB 4MAKA 1VRTB 3EM1A 2LCWA 2VQFJ 1SUQB 2MYFA 2RH3A 2OH2A 1R0BG 3GFZA 3BKUA 4CLTA 3QT6A 4I4BA 4DL2A 1N56A 2W4CA 1X5SA 4GMKA 1ACMB 1YSJA 3IWLA 2B7CB 3MOZA 2XY5A 2APOA 1LFPA 1AXQA 1Q82T 1N32F 1DZ5A 1S77D 2WAQD 3MM8A 4M5KA 4DR5J 3FSXA 2WK4A 3LA0A 3PO5A 4ENOA 2QL5B 2FHJD 3GP9A 2GJ2A 2Q79A 2HWHA 2MKKA 2B5JB 1VQPS 1RUSA 3GIJA 1JLGB 4ZVOB 2XSJB 5E3PA 3ZZPA 3CO0P 1BQMB 1PAUB 4M5IA 4WYWA 5DS7A 3ZTQA 1U2CA 5J2NA 3L3CA 4DUYJ 2VC0A 3ZZ0A 4BDPA 2E29A 2DRBA 3GSDA 3CWJA 3MPVA 3JYTA 3E01B 2KVIA 1UJ6A 3I0RB 4LFAF 2LDIA 4FNHA 1RWOB 2M2BA 4LBIA 3TANA 1EETA 2BANA 4Y2AA 3ENVA 3H5SA 3NG8A 4F4WA 2CZ4A 2O66A 2X51A 2VFUA 3HX9A 3H20A 4WIQA 2EEYA 2HGLA 1NBEB 2DNMA 3IBCB 4L72B 3SCKE 4EU0A 1TKZA 5HANA 3OR1A 2EBEA 1PJ7A 2OEKA 3VGSA 3H4BA 3L7PA 3N5BA 1LWCA 2HBQB 3MMBA 1TMMA 3LANA 3CJ3A 3I56S 2C3YA 3D0IE 4QPTA 2WONB 2VG7A 1PBUA 2VD3A 2E7WA 3QGIA 3BSCA 5AE2A 3EZ5A 4N41A 2RD5C 3HM9A 1P1LA 1T02A 2RS8A 5KFXA 3FK4A 4QBUA 2W9BB 4ES3A 1FHTA 4H4OB 4MH8A 1MN9A 2CJYB 2IIHA 2NSCA 4USIA 5CZXA 4O3SA 3NAIA 4KV8A 2QMXA 4X62F 2CJAA 4USTA 2FY1A 4RW9B 4EEYA 4OI2A 4NLUA 1QY7A 1YWXA 4WBFA 5LSLA 2QGFB 1YZ7A 3G2XA 1JLBB 2GMLA 3SSSA 4IFVB 1PJ6A 2HZCA 2XNRA 2GVZB 3W2WB 2LDYA 4C8LA 1BHNA 2EW9A 2CPFA 3HKZD 1RT7A 1VC6A 1Y5NB 2IYIA 3MR5A 3QGHA 1Y11A 3L9ZA 2DY1A 4NRUA 1YBUA 4CZCA 2ZE2A 2V4QA 1QSYA 2ZNZA 4PXDA 3RR8A 4LR7A 1OPIA 1FFGB 4QCLA 3OLAA 3PFEA 3G86A 2V69A 1UVIA 1HBOB 2FZGB 2WBMA 1PAEX 5KT5A 2BDPA 2CQ0A 2XS5A 1TVRA 2DNPA 2HIQA 1Q5YA 4DQRA 3H2LA 1NH8A 3CNQP 3ENWA 3M2UB 1FVSA 5KFOA 3M7VA 1PYOB 1UTAA 4LF2A 5EWGA 4HI1A 3HHLC 4FP9A 3OHBA 1YJNS 1PG5B 3LALA 5MAOA 2J6UA 2CFXA 4KE5A 1RAOA 5A0YA 5T14A 1X5OA 1M1GA 3QLHA 1I51B 1RHMB 2HRUA 5IOLA 5KFPA 2ADBA 2MMYA 3QRPA 1MNEA 2JZ5A 1QUPA 2PD1A 5ETRA 4ECXA 3CJKB 4X2BA 1VIOA 3M30B 1RE1B 4NXNF 1HBMB 5HMYA 3CD0A 4FVCA 1M5PC 5E41A 5JVGQ 5D4NA 3OPKA 5KFRA 3AXMA 1RSCA 3MPWA 1ZOTA 1IXKA 2VC1A 1YRXA 5D4LA 2MQOA 1U1LA 1T05A 3TVKA 1Y0HA 2HPUA 3EVWA 4K59A 4CH1A 2AJQA 2BV3A 4F02A 2YNHA 3KHRA 1URRA 2QA4S 4A8WA 1NKEA 2AKWB 1SB6A 1J5OB 2G4BA 4O3NA 2RRNA 1B64A 3LP0B 1Z4UA 2AP6A 2BW2A 1FKPB 3HVWA 1K0TA 2J0WA 2F8EX 4I64A 4DCJB 4PKDB 2UUCJ 1S1TB 4RWWA 3PXGa 1DTTA 3GG1A 5K8OA 2B7BB 1VCTA 1B7YB 3HLUA 4ES1A 4JV5F 2M88A 2AD9A 2CPJA 1WEXA 2C42A 1D0EA 3DRXA 3RUBL 2XMUA 4YFUA 2JEGA 3MM5B 3X1LB 4QIFA 2CRLA 1EP4A 2D41A 4DV0F 2GQQA 1F1BB 1RKIA 3PYFA 2V68A 4UZCA 3H40A 6AT1B 4ELUA 2QEXS 1JLAB 5E0OA 4KT0C 1HYSA 3LPYA 5GMDA 4LQ3A 1UEVA 2B9EA 3IMQJ 2HRTA 3F56A 4DHVA 1APSA 5ETOA 2C2RA 1YG0A 2CPZA 4O0NA 1QAIA 2G13A 3NMRA 2PFFB 4RUBA 1TAUA 5IXUA 1HWIA 3VQTA 4C3MA 3RRGA 2AEFA 2DHXA 2OPSA 1GXLA 2W4DA 2Y1LB 4QWAA 2XSJA 2YBVA 4Y3CA 2NSBA 4DSLA 2IRXA 1Y3KA 2B51A 2Y3YA 3OFGA 3PO4A 2ZJPQ 1NPKA 2LQBA 2R9LA 1GH8A 4P74A 3JYTB 4WFAQ 2XZWA 1KQKA 1S7IA 2F5GA 2NUUG 4J9QA 3T19A 3I87A 1KDNA 4TY8A 3DDIA 3M8WA 3CCTA 2CYYA 2ERRA 4RU2A 4LRFA 1X0FA 1UVMA 4CLLA 2I6WA 4I7FB 3VTIA 4DZ6A 3V81A 1CPZA 2HS3A 5KG1A 2HZAA 1QDUB 2V2ZA 4IR9A 2B56A 1WHWA 2UXDJ 2R7TA 2GIQA 5GADU 4C8NA 1ITPA 1DBDA 1NAQA 1C2PA 1H6KX 4M5DB 3IR6B 1NB7A 1VQ8S 5DZ6A 4DR1F 2W9BA 1TL3A 1NDCA 1NK9A 3G87A 4RBUA 4DSEA 5B0DA 2UVUA 4KHRA 2EK1A 2ZBQA 4FNIA 4AT1B 1RTIB 3OL6A 1KD1T 1HNVB 1OMSA 3FUYA 4J9UE 2J0SD 4RW9A 1RT4A 4R5PB 5I42A 3MTJA 2ZH5A 2AQ4A 3RBXA 1S0VA 1DFDA 3M8YA 4OZ0A 3UQSA 4USKA 4IFVA 1HBNB 3UNYA 4Z37A 3SFUA 2DK2A 2GVZA 3W2WA 2RVJA 2HHHF 1WKJA 3NS7B 9RUBA 3BYRA 1H72C 3QWPA 3AQOA 4Z2XA 3ISZA 5ETPA 2XGQA 2HHSA 2PDAA 4O44A 2ZE2B 2OO4A 3R5BA 2FQQB 4FXDA 4ZP6A 3V4IA 1BWEA 3UNGC 2DRAA 3ILJA 1VLYA 3DN9A 4ILRA 4KGXB 1FFSB 1WI8A 2H54B 4UOHA 3Q8VA 3J80U 5B0CA 2Z2YB 4QW8A 1H7XA 1F9FA 5H9FJ 4CWBA 4X84A 2GJIA 3DLKA 3QT8A 3T9NA 2KRBA 3KHGA 1VQMS 4RO0A 5F8IA 1FNMA 1KVIA 3A4TA 1RU2A 2JL9A 4C8OA 1SL1A 1FXDA 1S9GA 4P52A 1HI1A 3W8PA 3QLHB 1UA1A 2FC9A 4OZNA 2J7UA 1S1UA 4X64J 4NASA 4IOCQ 1NJYA 1R6VA 3W63A 1OY9A 3IS9A 2VL1A 1U49A 4F8RA 5JXSA 2OI2A 2V4JB 1FESA 1QAXA 3FMWA 3IR7B 2FHKA 1IBMJ 3PIOQ 4ZJOA 3M32A 1FJCA 1PYSB 3P6YC 2VBYA 1TQLA 2P2CB 3M8RA 4OJ3A 5DGAA 2G1HA 2LVWA 2YNHB 3NMAA 2R2SA 3H4DA 1UEKA 2HFUA 3NWRA 7AT1B 4PR6A 3DNCA 1J5OA 5D0RA 3CCUS 3ULHA 3S8SA 3KK3B 4QU7A 1C4AA 3HFZB 5K5MA 4D3HA 3KMQA 2IC3B 3CD7A 3VGUA 4YQWA 4AQYJ 4QR0A 1T9WA 3JQKA 1VGYA 4XO0A 1YX2A 5IFMA 2XGPA 4EYHB 3FEZA 2OD6A 2N4DA 1RAIB 3E3XA 1REVA 4DL5A 3DI6A 1D9FA 2Q6CA 4ZITA 5ADZA 3M2VA 4B08A 2GW8A 3PHEA 3HP6A 3MM5A 5J1EA 2VJVA 2FVCA 1EP4B 4C7QA 5K8PA 4TU9A 4DR6F 3JAMU 1I1GA 1VR6A 1JLAA 3VZIA 2DNYA 1CS4A 4GVBA 3LUYA 3G71S 2WVFA 3BREA 4C48A 3MR2A 5A6PA 3CXCR 2YKNA 5E3RA 3CJ0A 2JDJA 4FN5A 2LFVA 4K2XA 1JMTA 4KYZA 4Q2LA 2DXEA 1GQEA 1NB2A 2VASA 1JB0C 4ZPAA 1FKAF 3BDEA 3MXHP 4EK2A 2B43A 2HFSA 2Q1LA 1MMNA 1OWXA 4G1IA 4L6V3 3C2PA 4GKJF 3FKBA 3K0JA 5DO2A 2MQLA 2DGSA 4KIAA 3DDKA 4C2MA 5SZTA 1QTMA 1NLKL 4EUVA 2QRRA 4DUZJ 1Q7LB 2UVRA 3ZXWA 2YNIB 3DLEA 2Q66A 4C9DA 3DOKA 3DU6A 2BRKA 3BDPA 4EGLA 1TKTB 4TY8B 3C6TB 2GQ2A 2HNYA 4YHHF 3SV3A 2BE7D 3SSRA 1G6BA 2F4FA 2PC6A 4OHXA 4I7FA 2ZM6F 1S9FA 4RNFA 3VAHA 1NK6A 5KG4A 2AT1B 2GGPB 3A8IA 3EGVA 1VHIA 2UV8A 4Y0FA 2FHJA 4A8KA 3T1YF 2V50A 2HHWA 3CCZA 1X4DA 2HSEB 3OTOF 3CF5Q 5IQQA 2RDJA 2E1PA 4ZVSB 1T3NA 1P27B 4ZCLA 1NKBA 2VHGA 1HNVA 4DU8A 4QIVA 4I2PB 2E5GA 2LQJA 5I42B 4R5PA 2IA6A 3LAKA 2AV5A 3IWXA 3N28A 3G8TA 3R9LA 1KFSA 1WSRA 1V5VA 4IRCA 5A8KB 2YKMB 2W25A 2RAQA 1TL7B 3KG0A 2CNKB 1XR6A 1Y3JA 2RQMA 1SPBP 3N6MA 1MROB 2UUBF 2DBBA 3FFIB 4MKYA 1RADB 3W9IA 1UMJA 3DYAA 4TN2A 3T1YJ 1KP6A 4O44B 3BGFA 4LBHA 2XNQA 3VVTA 2RT3A 4J91A 1UZDA 3KNAA 2CQCA 2B4OA 4P75A 1EB0A 2IM1A 3W3SA 5I3UA 4MKVA 2I1RA 4NLQA 3ZZTA 4NMXA 5BXIA 1Q4RA 3TUZC 3T5LA 2HHQA 2H65B 3BN4A 3M1VB 2B9XA 2HRYA 4YB1P 2BA9A 3AAWB 2WSCC 3OBIA 3DLKB 3G8SA 2GC8A 2V8PA 1UVNA 1IUJA 5KFJA 4KTQA 5C42A 3J7YU 3CJTA 2XWYA 3RBDA 3R7NB 1IVZA 4R25A 2CJ9A 2FD2A 2HWIA 2YX4A 2HVEA 3O2IA 1S9GB 1LKZA 4NZ0A 2VDIA 3MEKA 2KXNB 4KH0B 2ZWPA 4ATNA 5CYQA 3H2UB 1D3WA 1S1UB 2XHWA 4W92B 4ED1A 1U6BA 4FPIA 1S1XB 2K06A 4DN0A 2IDLA 2XULA 3TZZA 1MWZA 3EXYA 1K1SA 4UOCA 4YY3F 1SJFA 4RJVA 1JNZB 3US5A 3EPIA 4RW7B 4DX5A 2BKNA 3M32B 2RJZA 4RNHA 1PIEA 2NPFA 2IMOA 5KFIA 2XO7A 2WTFA 3UN5A 2R7XA 1Z1ZA 4I2QA 3GG0A 2E9ZA 1KLMA 1ULRA 3OXFA 3DGVA 3FDSA 3KJVB 2OMLA 3FZ2A 3W2VA 3OR2A 1AYEA 1W25A 3KXDA 1DHMA 4LF4F 3BGRB 4UQTA 3GYXB 3S01A 4YR0A 3H5XA 4ZLPA 1HBUA 1G3OA 3K5PA 4NOHA 4U67Q 4UUWA 2P6TA 3DXSX 3HHNB 4NA1A 4X66J 1NDPA 4P71A 3HHEA 4G3IA 4PG8A 1XR7A 4ZIWA 4K4SA 4P2SA 3DI6B 1WTFA 2IY5B 4OIXA 4HL9A 2U2FA 5IC6B 5KG6A 3J81Y 2R7RA 5ETSA 4A48A 3BEGB 3M2RB 2H5JB 1DRZA 1DQAA 4NPOA 4WIIA 4PZVA 4DV7J 4DSIA 1UVLA 3OQ2A 3P3DA 1JWWA 1VISA 3GJTB 4WU2A 4MTPA 1VRUA 3LTOA 1KVKA 4N8NA 5MLCV 3DC2A 4Y28C 3PYEA 2UUCF 4KAIA 1NK7A 1TK0A 1XK8A 5HROA 1JLEB 3KLFA 3K2YA 4F36A 3THPA 3SDEB 4NI2A 4LVNP 1KQFB 2ZJQQ 2JLGA 3BO4A 2AJ1A 4ECYA 1XN9A 1X0PA 3N6LA 1RWMB 3UE2A 2N82B 3UDVA 4IRKA 3GJSB 3ILOA 3GU0A 3SFGA 4UQGA 1CSJA 2CNOB 1N88A 2YNFA 3VHQA 3T1AA 2YNIA 3DLEB 1T7PA 3NRBA 1TFYA 2MPUA 3HT3A 5KTQA 5HMXA 1TKTA 3NGUA 1O6XA 3RAXA 4K4VA 3C6TA 1Q8LA 2B3TB 3K17A 4DR4J 3FZBA 1R0AA 2RB7A 4J9OA 2AYBA 3PNIA 4A8FA 4PCQA 4MKAA 2RDDA 4F3QA 5JUMA 1CLFA 3F44A 1SC1B 4WTYA 4FKYA 2GGPA 2BOPA 2AW0A 5A8RA 5C5JA 5F8HA 1ZETA 4OI6A 4FF4A 3ENAA 1YI2S 1TU0B 2QN6B 2MZSA 1WKLA 3DRPA 3IRWP 3LOUA 1FDNA 3QMQA 4NX9A 3SIPB 3T1HF 2RU3A 4RKUC 4R8UA 5KFFA 1RAAB 4L73A 4PG6A 4DR2J 2PI4A 4P2FA 4ZPTR 2Z2ZA 4DV0J 1U0SA 3FCVA 5DQHA 2UZAA 1WOSA 4QR2A 1TFWA 2LEAA 4EO6A 2OTLS 4BC7A 4O3QA 3TX8A 1HNZJ 4BLGA 1YITS 2XMTA 1BQNA 2GVDB 4RPFA 2YNGA 3SEOA 1LW0B 1H38A 1S7HA 3M6UA 2AJ0A 2NYHA 1FRJA 1MROA 2VIHA 3FFIA 2GIFA 4IG0A 1WNEA 3DYAB 4MK7A 2KO1A 2QL7B 4NEZA 2BJ1A 2RQ4A 4QIEA 3AH6A 4USVA 2ZH4A 5HVGA 2E9TA 1JLCA 2C2KB 1U26A 3TA1A 4KO0A 2VA3A 3RGIA 1SL2A 5F41A 2MKYA 3MCOA 3W9HA 4QYZJ 3Q89A 2JSXA 4CLZA 4UT4A 1JLFA 1S6OA 4EBCA 1F9EB 2V9KA 1VOMA 4J9SA 4PXCA 4YS2A 2ZHOA 1RABB 2QYGA 3TEHB 2CQGA 3MUTP 1ZS6A 3KTQA 1DAXA 3PJ9A 4JI2F 4UZBA 2XCAA 2LXFA 2XMVA 1UWBB 2NPIA 4MIWA 1U2RA 1HNIA 2YKQA 2ZD1A 3TYTA 4AXIA 4DV2J 2XYHB 3UCZP 4W90B 2N4CA 3GFXA 1LK5A 1WC5A 3PW0A 5CYQB 2K7KA 2VFVA 3QIDA 4HH1A 3PHTA 1GX6A 2HFOA 2MB0B 1S1XA 4JI2J 2ILZA 5IT9U 5C7PA 1ROFA 1SI9A 2X3DA 3L7UA 3ITHB 3C15A 2QLXA 5HSPA 3OHAA 3BSNA 1ZH5A 1G2EA 2L41A 5BYSA 2PA8D 1I3OB 1SQEA 2C3UA 2VZ9A 3CD6S 2M9KA 2F7VA 1KEKA 4DX7A 2J0QD 3C3LA 2XC9A 2HLTA 2DH8A 5CH7B 1LW2B 1WC1A 3IN5A 4WK3A 1CULA 2L9WA 3A8EA 3ET6A 3Q86A 1N5VA 5B0EA 1PC4A 4PXBA 3KJVA 4HACA 3ZC4A 4DCOB 4V1Ak 1TUVA 3K5LA 3M6XA 1P9YA 3P4UB 1C0UB 4WFXA 1WF1A 2DIUA 5KG3A 3T5KA 2HYIB 2BUNA 3NNAA 2Y9HA 2IM0A 3CC7S 5A2QU 4ZCMA 4ZHRB 1FEEA 4PQAA 3L95X 3J7YI 1YZ6A 1VC0A 3HK2A 4KFBB 1KOOA 5IQ6A 3PX4A 4G1QB 1LNQA 5FLXU 4QPXA 1HHTP 1C0TB 4Y2CA 1MSWD 4M95A 3TVZA 2E44A 1CJTA 3MFHA 5EWEA 2CWXA 3A8KA 4ZOSA 4DF4A 4LF6F 1N54B 2Y0SD 4NLOA 2MQMA 3IC1A 3NP5A 3PTWA 3MF5A 1WG1A 2XY7A 1SIZA 2CAJA 3PW2A 5GAEU 4BS2A 2K8GA 4FVMA 4DL7A 4OZ3A 2EG1A 2DNRA 5KFNA 2LEBA 2PI5A 4PRFA 1SKUB 3B6BA 1RK8A 2GA7A 4OZ2A 2PEBA 4OZ5A 5C24A 2ZH8A 3THVA 2XTJP 2DITA 4XDCA 1XWLA 5ETTA 2G0IA 4M63A 4O4RA 3K58A 1ZM9A 1HKAA 1YJ9S 4ZVFA 2UXCJ 4ID8A 3AODA 3D1HA 1RXOB 3BS9A 2EFVA 3C14A 8RUCA 3AXKA 3W7BA 4CLUA 5F9LA 3UI3A 3MEEB 3T3FA 2GAGC 4TYBA 3MCNA 5L1KA 2NLWA 1FA0A 2QL9B 1Q0NA 1XMOJ 3MDFA 4KRWA 1VQNS 4ZDNA 1LEOA 1MLAA 2EPIA 1CQMA 1X9MA 2AWZA 4NWBA 1R0AB 3B4MA 3SMZA 4J9NA 2YH0A 1U1NA 4PWWA 3CCRS 1LOUA 1S6PB 2HQGA 2FC8A 1CBKA 1DQ9A 2J7WA 2O67A 3R5GA 4HHJA 4DV4J 2JEFA 4N8OA 4LSNA 3DRYA 2OMOA 2PFDA 3CC2S 2VPWB 1SV5A 2DH7A 3TVYA 4EO8A 4HDHA 1RT5B 3HVTB 5J2PB 2DNKA 2QC3A 3BZQA 2LU1A 2FLPA 1ICEB 2VOOA 3LGMA 3D3CJ 2ZH1A 1U48A 2HQIA 1RWNB 5CAAA 1B3TA 3KUGA 3VAFA 3HHKA 1REGX 3KJQB 3W65A 1Q78A 1YIJS 1NJXA 4NLGA 2DNZA 4CO4A 4URSA 2QLFB 1IR1A 5GAHI 3Q8RB 2KM8B 1FO1A 2EI5A 4ZS6A 2HMIA 1BQNB 1FNOA 2GVDA 1OS5A 1IWAA 1BD6A 5HBMB 2QZ8A 2OLWA 1IKXA 3QO9B 4ZP8A 5AT1B 1N36J 2ZZMA 1OYEA 4H54A 3RU0A 1JLCB 3DLLQ 2FVSA 2XZDB 3VVUA 4H4MB 4TU8A 3PX0A 2IMWP 4ERDA 1U4BA 2BVZA 3EVMA 2DXFA 2OUGA 2XEXA 1WI6A 3EZOA 4USWA 5KFEA 1RYSA 4U6PA 2FUG9 4YN3B 4PWDB 1X4HA 2MQ8A 3T9ZA 5FDLA 2JLEA 1PILA 3HHLD 3JSRA 3TQEA 4MKBA 4QR1A 1Q7YT 3ZTOA 1M1HA 5J2QA 1SJRA 2BXJA 3TO8A 2LU2A 2VICA 2R7QA 4QZVB 2HFZA 3M9NB 1TUWA 1AZSB 2CNLB 2IRYA 5AJ3J 3GMGA 3CJSA 4M1KA 4NA2A 1R89A 1HNIB 1S99A 2E66A 2LQ5A 4OJ1A 1NK8A 5H9EK 4MT1A 5FJ4A 3G82A 4WWSA 2B4VA 3CJ4A 1BWVA 1VJWA 4DFKA 4HR2A 3I32A 1WDDA 2CJXB 1NRKA 1AFIA 1SC3B 4B3RF 2M70A 3ITHA 2YY3A 3C15B 4DR5F 9ATCB 3DRSB 3FBFA 4C0OC 1U7LA 3GCWP 3R1HA 3CJ2A 1HWLA 1R27B 2LQ8A 1R31A 4ED8A 1FDAA 4N5SA 2MHNA 2QV6A 2H3EB 3WX4A 2HW3A 5J2NB 4FF1A 2HAIA 3K59A 4FF3A 1CULB 2F3JA 3ET6B 2GS8A 1FJ7A 3E01A 4HACB 1C1BB 4OZLA 3KLVA 2DR5A 2YKOA 4LFAJ 2N3OA 2C2DA 1Y4ZB 1C0UA 1QSLA 3Q8QB 1NK4A 1CVJA 2YPYA 4QYRA 1WF0A 5KT2A 4F4KA 3UD3P 2GFFA 2R7WA 2MQNA 2ACYA 3O44A 2KU7A 4NMLA 4O3OA 2LXUA 5DETA 3V6DA 2M5YA 4DV1J 1SQGA 2LQ9A 1UZHA 2HHTA 1LWCB 1IN0A 1RLDA 1RT3A 4ZPBA 2LA4A 3UR0A 4YOEA 2PMHA 1ZAXA 4P9SA 5KFKA 1CJTB 2Z4PA 5LJ5Y 2HQDA 3IG1A 4I56A 2A6OA 1J5EF 3G4SS 3BPDA 3FC9A 2PSZA 3FSYA 1Q81T 4EFAC 3OV7A 1C1CA 1HMVB 5KFBA 3OXLA 1IBKF 3DRRA 4KV8B 4DV7F 3PW4A 4G1PA 4HT5A 7FDRA 2JC1A 2W2QP 4NLYA 3M6WA 4WP3A 1JLBA 4KHPJ 4S0MA 3K5NA 3PM9A 2BJ8A 3R3TA 3UD5A 1SKRA 1YBTA 2MKCA 4B3TF 3G6ES 4EZ9A 3U1NA 4LT6A 4DPWA 2DIVA 1PGZA 1N5QA 3V2UC 3JSYA 3PJWA 2VG5A 3TZWA 4F0MA 1S0NA 1UPPA 3N79A 1DURA 5KFYA 1FDBA 5K9FA 3C14B 2BJ3A 2ROGA 2GX8A 1HL6A 1IJEB 2F8MA 1JKHB 1Q8KA 3AOBA 1WACA 2OPPB 1YKWA 3IM8A 3NS5A 5FD1A 5GVQA 5DLGA 2E7XA 3U1MA 1ZAWA 3Q0AA 3BO3A 5DDPC 2XLIA 1ZZNA 1NM2A 2K3KA 3PRDA 4LQ9A 4DS4A 5KT4A 3A3NB 1S1VB 1IM4A 1XTZA 3M2UA 1OSDA 1TELA 2HHPA 2L48A 2WBRA 4P2MA 1S6PA 4OI1A 1FRKA 1S6QA 2PMZD 1F3VA 3TOQA 3MCSA 3TI0A 1VMBA 1OQ6A 2CQ1A 2ZOGA 3QJPA 1UFWA 2CPYA 2AYMA 3CMQA 5KOWA 3RBZA 5LL6d 2QMWA 1FT8A 1RWPB 2IJRA 1QM9A 3HDSA 5B0AA 5T41A 3W9JA 2W9CA 1H74A 4DJBA 4X4OA 3AHPA 1SH2A 4R0EA 2KRRA 2PT0A 2C1EB 2KT5A 1T9VA 4JOUA 4K4UA 2VDHA 4LRBA 2PE8A 4QYZK 2IBOA 3MPDA 2ZBRA 4X65F 3FBEA 4ZVRB 2P9CA 5CXTA 5HBMA 4K5RA 3G96A 2HVIA 4Y00A 3NS6A 4CLPA 3VALA 2OIHA 3KLGB 1NHKL 1RI7A 1VLOA 2YTCA 3R97A 3J7Z5 4B9SA 2Q43A 2L9NA 3WBZA 1FKPA 2BMBA 1KN6A 3ICLA 4IR1A 4DR2F 1FRXA 3OW2R 1NK5A 4OLOA 4DX8H 1HHQA 2RSQA 3HFKA 4IUFA 2ZC3A 4U7UK 4NA3A 2DNQA 4F4XA 1U1RA 4JI6J 3U27A 4PYAA 4RW6B 4A8XA 2NR0A 2ZDPA 3MI7X 2EFOA 5HQMA 2V0NA 4DZDA 4DUYF 1YJWS 2FHMA 1F9HA 3CEDA 5E2QA 3QQCD 5EX3A 3V4MA 1AW0A 1RAJA 2FVRA 3CCQS 3I31A 1JJ2R 5F8LA 4PG7A 3HZEA 1ZBTA 2YQ1A 2HKEA 3QATA 5KOXA 1TMJA 2HK3A 3H8YA 3RRKA 1F5AA 3LGHA 1RHUB 2CNNB 2Q3PA 2ZEJA 5BR8F 4Q0BB 1GMVA 1YVFA 4OI4A 3W5XA 2V8VA 5KFSA 3ISNC 1NPRA 4J90A 2FJBB 1NJZA 1JIHA 2CQIA 5L9XA 1WC6A 3Q8YA 2KYZA 2ATLA 2UUWA 2OPSB 2CA9A 4CYUB 4O23A 1NSAA 1F60B 2IVYA 2AGOA 2IRUA 2M4MA 3HVRA 1AROP 2ZITA 1IWGA 3JTNA 2HNZA 2D74B 5KT3A 2RNEA 5DM7Q 2ALZA 4KPCA 5HK4A 3D6TB 3W64A 4DCPB 2POKA 4DXLA 2E7VA 2KYXA 2MLZA 3R6LB 3CT9A 1Z2LA 1ZA1B 2DHHA 2IVMA 4HEA9 2BEFA 4CO5A 3I5CA 4DDFA 3GV7B 3RTVA 1S5ZA 2I8EA 1JNRB 1JK9B 1T11A 3EJMA 3V81B 3KUEA 3LP2B 4CTAA 3J7AN 3V6DB 1HW9A 5EWFA 3ZNJ1 1RWUA 5D3GB 3MMCB 5I4MA 4DV3J 3NWGA 4CO3A 4JI3F 3EGWB 5AXKA 2CPEA 3IG1B 2IM2A 4OYZA 2R7VA 2CQBA 2CZVC 3GV8B 2XMMA 1M5HA 4DR1J 2AYGA 2HHUA 3KWMA 4FYDA 3KHLA 3DRRB 2DGXA 4XIUA 1RTIA 2JJ4D 2JH3A 3E51A 4ZVTB 5GAEI 4DF8A 1JLQA 1CJKB 5JVHQ 1H73A 4PG5A 5IT0A 2CJKA 3HMJG 2CPHA 2N7YA 4E98A 1HBNA 4RW8A 5DDQC 1RTZA 4RL1A 3FSIA 1VI7A 2HHHJ 1K8AT 5K8MA 3LWLA 5L9NA 2R2TA 1E6VA 5J1NA 4KSEB 1MG7A 3CMAS 1VK8A 4ZLJA 3V6KA 4WCEQ 4NE9C 2VPZB 1SKWA 3QAEA 4ZVUB 4BWJA 2J6TA 4B9TA 1DJ0A 4V19J 2OPPA 3CVKA 3GYNA 3E2EA 2FB0A 2C3PA 2JLFA 1U45A 1GT8A 3OTCA 1SXLA 1UKUA 1YQHA 1S1VA 1UWAA 4IG3A 4ZP7A 1FRIA 4ZJQA 2GMJA 1TZ0A 4KY3A 1H3DA 3FVYA 1YJ7A 1NDKA 4NLTA 5IC4B 2ZUAA 1KBRA 4YMEA 4CNZA 3BQ2A 2O01C 3DDNA 1V9OA 2A2CA 2M8HA 3N4WA 4AD6A 3KHHA 4OYPA 5IS2A 3LAMA 2Z30B 4Y34A 2VOPA 2OPQA 4KHPF 3TJ9A 1KWMA 2W9CB 3QWUA 2X1AA 5THWA 4K0KF 3T6JA 2XI3A 3RAQA 1FWLA 1WHYA 4DQIA 3IS9B 1EHWA 1FXRA 2XYPB 2CJBA 3H5YA 4M8LA 4LRCA 1RHJB 4C3LA 5EDWA 4ICLA 2W8KA 3GSIA 3MUVP 1PSDA 3D0HE 5E3QA 4ANEA 1UPMB 2DR9A 5CA5A 2R4FA 4ETZA 2PN6A 3AJDA 1UJ5A 3UCGA 2OHDA 1Q16B 2RUGA 2VKRA 4E2FB 4NYZA 3M9OB 2IYGA 4NXMJ 2LA6A 3KLGA 1UCNA 2NXCA 3EMTA 1R43A 2IC3A 2BQUA 3H25A 2Y0BB 2UUTA 4G65A 5ETQA 3CC4S 3M8ZA 4JI6F 4NXMF 2O1PA 5K14B 3MM9B 2CJQA 2B8QA 4FDFA 2R2UA 4HDGA 5DDOC 1Q8BA 4I6AA 2RS2A 5J1EB 1G1XA 1IKWB 1BUXA 3J81U 5E33A 3WC2A 2XMKA 3Q8PB 1S0OA 2HS0A 2M52A 3H59A 5AXMA 4RNMA 3EDRB 5C2CA 5F8GA 4GVBB 5EX0A 3DOMB 5D77A 4ZKAA 1HNZF 2J9DA 4CDIA 5M2RA 4Q0BA 1EARA 1AFJA 3O8WA 2GNKA 2HQCA 3PJXA 5AE1A 4DV4F 2JEIA 4YB7A 1DY3A 3OFHA 5HQLA 3W66A 3PY8A 3UR3C 1SQFA 1PO6A 3KJFB 4LF5F 4IQMA 4GC7A 1N0VC 3AQPA 3N9UC 2RIJA 5LMNJ 2FJXA 2HBRB 2R7SA 2KKHA 5AJ3F 2BQRA 2CQDA 2E5JA 2HAFA 3SSQA 4F26A 4HHHA 3HCXA 2FDNA 2HNZB 2NXNA 3AA8A 1UETA 2BRLA 6FDRA 5L46A 2VODA 4CLSA 3KLIB 3KFWX 4L3KA 4ZK7M 4LF9J 3PIPQ 3GWCA 5IM0A 4DV2F 1GXUA 1U1OA 2FLNA 2HNYB 4UW2A 2W7OA 3TQ1A 5CHCB 1O0PA 3V5RA 2CIMA 5CYMA 1HFEL 1QE1A 3C16A 4KGZB 2ZM6J 5FIIA 3CUNA 1N34J 2BR0A 3W60A 4X64F 3ENQA 1MU2A 1RACB 3GZ7A 1HIYA 4OFZA 4PYDA 1RT1A 5KFMA 4Y2IA 3GV5B 4DFPA 2HIYA 3PV8A 4QIGA 1LWXA 4OYMA 1LXNA 2YX1A 2VG6B 2ZBIA 2DISA 4OX7A 3U7JA 2ROEA 4ECVA 3FJ2A 4F50A 1VYAA 1X4AA 2B6AB 3MECA 3VGTA 3RB6A 2B4UA 4NLPA 4IDKB 4OX9J 2MQPA 1CJKA 1O8BA 4A8QA 2ZH6A 3FCWA 2JC0A 2KXFA 3HVAA 1NKCA 5A8KA 2GV1A 1TL7A 2ZH7A 2CPIA 1R7IA 2H5EA 1SJ4P 3FNNA 5HAOA 4C11A 2UUBJ 1NDLA 3VCDA 4PXEA 2RU9A 2VF3A 4QWDA 1EX8A 2F65A 1RB0A 5KFVA 4CT9A 4ZPDA 5E7OB 2B4PA 2H9ZA 1L3VA 2EG2A 3KK2A 3WDOA 3S6EA 1Q95G 3OJSA 1RTJA 5E5NA 1XBWA 2W8LA 3MOJB 1FCAA 1SH3A 1TL4A 4JB8B 3M1VA 1Q79A 2X3GA 1FWPA 2KXHA 4LFBJ 2YXLA 4PQUA 2ZBCA 4Z7YA 3D1OA 2HNDB 1I6JA 3AB2B 4DMZA 2QA2A 1HNXF 4PPZA 1ZZFA 2RHQB 3LPEA 2HEKA 2D3ZA 3Q83A 4M5JA 2PMWA 1KSPA 2ZDOA 4NLRA 1AB8A 1U8SA 2OPQB 2GJFA 2H4YB 2J8AA 4JV0A 3JB9k 1BGXT 3K8WA 4JV2A 2U1AA 2MDAA 5E3CA 4A8YA 3Q2SC 1VQ9S 3CB4A 1B99A 3P45B 2FLOA 2XO6A 4F0HA 4P7TA 4DFJA 1K47A 1IQZA 1T95A 5IT9Y 5H9FK 2VKZG 1XNQF 4ICLB 4E8UA 2CG8A 2W01A 1U47A 2DHAA 2PA3A 3MR6A 5GMEA 4Q8EA 3K7RA 3R2CJ 1C4CA 4I2QB 1NZ8A 3NLCA 3I55S 2X1FA 1ZAVA 1N5YA 2DB1A 5LT5A 4CLFA 3OFEA 3OSPA 3OR2B 3HSZA 5CD4H 2DNOA 5IZHA 3J81j 3BGRA 3CPWR 4DV5J 4F2SA 3FEXB 3SCIE 4USHA 5HLFA 3EZUA 3ILIA 4HLBA 2QLBB 3I96A 4X4QA 4FS2A 3ZZZA 1HI0P 1CQNA 1BMQB 4W4MA 4UF4A 4DLGA 3DU5A 3U1LA 1BQXA 1HNWF 4MFBA 2CG4A 2WVCA 3EDQB 4CH0S 4PABA 1RQ0A 2I38A 3QIPA 2WSFC 4X65J 4K4WA 3DXBA 4DL4A 3SXLA 1IKWA 1IBLJ 3M2RA 1GTHA 1Y9OA 1XJWB 1X4BA 4U8VA 1VBXA 1NHVA 2XZTB 4M5GA 3DOMA 1WHXA 1RTHB 1RWVB 3HPOA 2QLWA 3IAS9 2W2MP 1SL0A 2FHOB 3JTOA 2AJ4A 1GX5A 1FF2A 3MD1A 1D8YA 5HROB 4B9MA 2QG9B 3O3LA 1U24A 4GO7X 4W98A 1RLCL 1TUGB 4ZVEA 3SDEA 3MPUB 4NI2B 4KH1B 4OYIA 4DN9A 4UOGA 2W7PA 1HNWJ 3MMAB 1H7WA 3WIVA 1AA1B 4Y65A 2AMCB 2IHR1 2Z2MA 3TP2A 1OSCA 2MGZB 1VQLS 2J0XA 1U6ZA 5SUHA 1B4SA 4FS1A 1N48A 4JI4F 1FXLA 2QIFA 4I68A 2YNFB 1TV6A 1X5TA 2YWGA 2IFXA 4PWUA 4RLEA 1M5OC 4JI7F 4JI0F 5KAKA 1QAJA 2BKOA 4CH7A 3SZ2A 2QMUB 2D69A 4WXOA 4FYYB 5KT7A 5DJBA 4FF2A 1FD2A 4YUDA 3PEJA 2VA2A 5CYMB 1SJ3P 3OVSA 2RUSA 2KFYA 4OL8A 1RT6B 2DCUB 4I6WA 2O5DA 3BO2A 4DS5A 5IV3A 3MZIA 1JX4A 2JEJA 2ASLA 1RT1B 5D15A 1U1KA 1URNA 1F2GA 1X4CA 2VV5A 2UU9F 2DRDA 3EVOA 5EN1A 4ZMMA 5DG7A 3CO9A 3UFCX 1OIAA 4CLYA 1T8EA 3DMJB 1F5BA 2GQCA 3GIRA 5HL7Q 4OJGA 3WHIA 4TQSA 2CZ9A 4TLRA 1HLWA 4R8UB 3OTEA 2B6AA 3CTRA 2VFRA 4M5MA 2AJFE 1KFDA 3HULA 3H42A 2GO8A 1U8WA 2DGTA 1T9XA 3TA0A 1Y7PA 3PX6A 3DLJA 2K1RA 2OAUA 1HD0A 4ZVHA 3JS9A 4I6YA 4K4XA 2J76E 1D09B 2ZFHA 2RF2A 3MEGB 1LW0A 4C8MA 4DBQA 3NOCA 4X4PA 1JJCB 4DEZA 2KH9A 4ECUA 2WZ1A 3H98A 3ZZUA 2RKIA 3NEKA 1KRPA 1KONA 3AB4B 4AFFA 1EQ0A 3KDOA 4M5LA 1WD6A 4M5HA 1U6FA 3ZNUA 1UFKA 2DNLA 1T9UA 3I9V9 4KO0B 1ZTWA 2QYCA 4P73A 3TAQA 3MGJA 2CVIA 2D1CA 4DSJA 2OD4A 3MTKA 4YEAA 2H4WB 5KG7A 1UP1A 4ZPVR 2GHVC 2QX0A 4ZA1A 2RDIA 3GIKA 3KLHA 4PQUB 1NU4A 3EWGA 3NGSA 4WK1A 3BQ1A 2HNDA 2VPYB 1R8AA 2C2ZB 1WC0A 3HZGA 3VR1A 1QLNA 4CO0A 4O3RA 4Q5VA 1RZMA 1GNKA 3Q8UA 1HQEB 2GIRA 1K1QA 4KB7A 2C2EA 1UWBA 1KHWA 3TWZA 4AE5A 2ZD1B 3KNGA 3A3PB 1X8DA 4ZVGA 1FRLA 1G4CA 4J9RA 2RILA 2BACA 2VUGA 4X4NA 3Q23A 2AGPA 4HI2A 2M0GB 3EUNA 4DV6F 5KFDA 2Y1RI 3RB4A 4J9MA 4MMOA 4PG4A 1QUVA 3EGZA 1WWHA 1UAWA 1FFWB 4ZLNA 3EICA 4FBTA 3E8OA 2NYIA 1UVJA 4RZRA 2ZUGA 2GZOA 4MYUA 4WFYA 5HN0A 4K4YA 1RWXB 5ETMA 4I69A 3QFHA 3PR4A 3QGGA 4YP3A 2ZOMA 4URGA 4ZPWR 2H5IB 3NBPA 4QWEA 1U0HB 3H2VE 4K0KJ 4LVOP 3H5UA 2HGMA 5D6GA 3D4JA 2JFDA 2SXLA 5B0GA 1FTCA 1IR0A 1TTHB 7FD1A 4ZN1A 4DV6J 3HJFA 1R3NA 1SC4B 3FRZA 2A1BA 4MFBB 1TL5A 4IQXA 4G1QA 4IH6A 2C2OB
chains in the Genus database with same CATH topology
2OJ3A 2COLA 1Q53A 5KT6A 3N0VA 3JSBA 3N01A 1FNXH 1FK9A 1VFJA 3DHXA 1FRMA 4BCAA 2DH9A 4U7CA 1G7CB 4X4UA 2EFNA 1OO0B 5ITHA 1X4FA 3FCHA 5KG0A 3MMAA 2ZKTA 2MGZA 3VZHA 4AL5A 2CQ3A 4U9RA 5HI7A 5LSOA 5L1IA 1TV6B 3I82A 4KC5A 2ZKUA 2JX2A 2KDOA 2CQHA 3PDNA 1FEHA 3MEEA 3J80Y 4JI5F 4XAKA 3CDAA 4LFCF 2GCFA 2UV8G 1T03B 4K5SA 3QJLA 4R0JA 3FGVA 1RKJA 2IAJA 4MIBA 1WG5A 3I0SB 4KBIA 4MIAA 1RT6A 1KLNA 4LSNB 5J1PA 4LIRA 1SV5B 1O51A 3HVTA 4ED3A 3NNCA 3QAUA 2ROPA 3DMJA 4ED6A 1XR5A 2XLKA 3HXMA 3HKWA 2C28A 2FJWA 4CNYA 2KG0A 2D9OA 3HO1A 4RWXA 4TU7A 4GC6A 5G4DA 2A18A 3MHYA 1LWFB 3O1LA 3VF0B 2K1RB 4J5OA 1N34F 4JV1A 4ECWA 2HMIB 4QOTA 4DFMA 3MEGA 2W9AA 4RBTA 3KG4A 2ZZNA 5HMZA 1P6TA 3M8QB 3LP1A 2HVZA 4KKOA 3D0GE 3HF5A 1XNRF 3NCRA 2MJNA 2BABA 5EUHA 4KGKA 2Q6BA 4C98A 3CDWA 5B08A 1S0MA 2XB2D 4OX6A 1NEEA 2JWNA 4PWDA 2R7UA 1HPZA 5FDLB 3C46A 2B0GA 3SQGA 4KGMA 4D3GA 3AA9A 5LJ3Y 3Q22A 2GHWA 3M4XA 2NS1B 2WRMA 4IH7A 2DO0A 4MK8A 4X4TA 2QFJA 4F25A 4DQSA 3MM7A 4JI8F 4N76A 1VBZA 3VAMA 4BC9A 1S10A 4OV1A 3GIMA 3UCUP 1FRHA 4RNOA 1Q86T 3DRSA 3D5MA 4WZMA 5LMUF 3MUMP 5HP1B 1E6YA 1OQ3A 5IWAF 3JSMB 2DHSA 2HGNA 2EFGA 4WE1A 2V8GA 5KFGA 3TAMB 2OFHX 1Z2ZA 3ZZRA 1TAQA 4B3OA 3D1QA 1C1BA 1U2FA 1H2TZ 4RX6A 4FF1A 3BSOA 1MMLA 2MQQA 3KK1A 1S9EA 1N6QA 3LQVA 4OLPA 4F4ZA 1FJGF 2YWHA 4M94A 2KHCA 2P9EA 5F3ZA 1FE4A 1B0PA 3T5JA 1YRUA 2X1BA 1TR0A 4C8YA 2PGCA 3IWNC 1ZYQA 2EKYA 1M5SA 4ED2A 4DG1A 2IA0A 1IKVB 4XPCA 3TNVA 1RT3B 2FGOA 2K3IA 5GMKa 5L1LA 1DTQA 3MWBA 4ZPCA 4B3SF 2DD8S 1C1CB 1HMVA 2ZH2A 4C8OA 4NCGA 4DL0C 3SV4A 2HHQA 2I9SA 5H9EJ 1N5TA 2FJVA 1A9NB 2HHVA 1O5JA 3G6XA 2KT3A 4ECSA 1HW8A 2F40A 2FJAB 4RUCA 1SKSA 2DNGA 3OLBA 4AXJA 2ZHBA 3CMES 4A8MP 4WYLA 5A8WB 4V19X 3NNHA 3T5HA 1QAYA 3QZ8A 2O3DA 2F9DA 3FEYB 2HG4A 1RA7A 2VG5B 2QA4G 1MWYA 3IO1A 2DGUA 1JKHA 3B8HA 1M5KC 3NL0A 4USJC 1RDRA 3L09A 2HQ3A 5FLXY 5B0BA 2XBPA