3VZIA

Crystal structure of crispr-associated protein
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
214
Chain Sequence
HMSYGVRLHVWGERALFTRPEMKVERVSYDIITPSAARGILEAIHWKPAIRWVVDSIQVLKPICFESIRRLSAASISKAIKAGRTDELVKYVEEDRQQRAATVLREVGYIIAAHFEMTDKAGPDDNVGKHLDIFNRRARRGQCFQAPCLGTREFPASFALLGDDDASDPALSGERDLGWMLHDIDFADGMTPRFFRARMVDGLVAVPPPQDGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Crispr-associated protein Cas5, dvulg subtype
publication title Conservation and Variability in the Structure and Function of the Cas5d Endoribonuclease in the CRISPR-Mediated Microbial Immune System
pubmed doi rcsb
source organism Xanthomonas oryzae pv. oryzae
molecule tags Dna binding protein
total genus 55
structure length 214
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09704 Cas_Cas5d CRISPR-associated protein (Cas_Cas5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2660 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vziA00
3KG4A 5CD4H 4F3MA 4QYZJ 4N77A 3VZIA 4U7UK 5H9EJ 5H9FJ 4R0JA 3VZHA
chains in the Genus database with same CATH superfamily
4QIWD 5D3GB 3OR2A 5D4PA 2DBBA 1PYTA 1CEZA 4J9KA 1QE1A 2ZBIA 2E1RA 4J9RA 4HT7A 1WHYA 1RCXB 3TYTA 1RAGB 2CQBA 4YB7A 1CJUA 4KO0B 1T03A 1NK9A 4RUBA 4DV4J 5J2NA 3UWTA 3THPA 2AJFE 3P45B 1WELA 5KFNA 3UN5A 3T5HA 2G4BA 1G3OA 4Y65A 1HW8A 3TQEA 2ZOGA 1AW0A 2QMUB 1S1UB 3R5CA 1CJVA 1T94A 2E1CA 1AYEA 4DR5J 2HHUA 3OVBA 4ETZA 4S0MA 3MGJA 1AA1B 1T3OA 1MMNA 2P5VA 3BGRA 4PG4A 3IGVA 1DQ9A 4O3RA 2AT1B 4NZ0A 2QYCA 1U0HA 2OSRA 2XGQA 1R89A 3PX0A 5IQ6A 2M7SA 3ZFVA 2J6SA 3VGTA 2Y1RI 1WC6A 8RUCA 3CUNA 3VALA 4DR6J 5F9LA 1OIAA 5HVFA 4CH0S 3RBZA 4OZ0A 3AD7C 2MPUA 4QU6A 4X4OA 4ID5B 3K7RA 1ICEB 1RWPB 2QT7A 1WG5A 2IJNA 1H72C 2CJQA 3NS5A 5IZHA 4BS2A 4Q0BB 2XYHB 5AT1B 1TL5A 4NEZA 4HTJA 4DR4J 3O6QA 2IVMA 3CGIA 5E0OA 2VOPA 1XNQF 2ZH4A 1D8YA 4ZVTB 2RKIA 1J5OA 1JLCB 3ENAA 2K7KA 4LRCA 1MWZA 2F9JA 4LF8F 4OL8A 2IFXA 3Q8RB 4ZVRB 4FS2A 3D4JA 3P5TL 4X4UA 5ETQA 4PQUB 1PC5A 2BE9B 4FYYB 3CEDA 1HBMB 4ZP8A 1N56A 2VFRA 2OSQA 1TZ0A 1DHMA 1T9VA 5KG7A 3ZZ0A 1J2VA 2CQIA 4FVCA 4ANDA 2MKHA 5H9EJ 3CDEA 2F5GA 3ULHA 3SV3A 4FF3A 1N32J 3Q8SB 4LFBJ 1X4EA 1ZAWA 1I6JA 4IFVB 1F1BB 1VFJA 2YKOA 2G2ZA 1UEKA 2UUWA 3HHNB 3NGDA 3Q2TC 4ZK7M 3W60A 2ZUGA 3SBMA 4DL4A 2R7SA 2LDIA 3QT7A 3PVXA 3NKYA 9ATCB 3T1HF 1IBMF 1FDAA 1Q95G 4OI6A 4NA2A 1FKOA 2KG1A 1OQ3A 5I3UB 1GTHA 3NG8A 4IO1A 1U24A 3E01A 1F5BA 4A8SA 1DARA 2MGZA 2WZ1A 3GIIA 2AYMA 3BN7A 4ZJQA 4EWTA 2KT5A 4Y0FA 3VVUA 2GO9A 1EQ0A 5EDWA 5HLFA 3C6TB 1NJIT 2CJ9A 4ZS6A 1YHQS 2CIMA 3PYEA 1IQZA 3HSDA 1JLFA 1D9FA 2KTQA 3L7OA 3MAHA 2CA9A 2WAQD 3SSSA 3ZZRA 4O3OA 3MM9B 3JAMU 4FPRA 2VH7A 3LGNA 1WUUA 1YLXA 3ZTSA 3CC7S 4CIOA 1U1OA 1WC0A 2PIIA 2V9KA 1U4BA 1SVDA 4F8RA 4U8YA 1WHWA 2HHPA 2CZ4A 2V8PA 1NPPA 5E7OB 4C9DA 2B8QA 2YNHB 2V50A 3PG9A 3OVSA 2Z4PA 5AJ3J 4DOZA 2HWIA 3I32A 2VG5B 2I9SA 3DU6A 4K0KJ 1LWEA 4UQTA 2DO0A 2BKPA 3D5MA 3RBXA 1NO8A 2V2ZA 4A47A 3ZZOA 2FGOA 1S0MA 4NLQA 3M30B 1RT7B 3D3BJ 3BR8A 3H98A 4FDFA 3JXOA 2IYGA 3QWPA 2E5HA 5HJXA 1JX4A 1RCOB 2CQ2A 2Z8QA 4DSIA 3BDEA 5F8IA 3NGSA 3M2RA 1KQFB 3B4DA 4G1IA 1PG5B 4XPEA 4P52A 2YNIB 2NZCA 3LPYA 2XTJP 5KFPA 2OMOA 3DFEA 2Y0BB 3S8SA 3ZZPA 3TAMA 1REGX 4ETXA 3TZZA 3FEZA 5KG2A 3QT8A 5HMWA 3I0RB 3SIPB 4G65A 5KT5A 2JEJA 2G0CA 4BLGA 2QA4G 4X4QA 4DV4F 2OP5A 3EJMA 3T6JA 1JLBB 4DPXA 2IC3A 1HNIB 1RT3B 3FK4A 2JOQA 1YJWS 1JJCB 2J7UA 3G87A 4DR5F 1RHQB 1SJ3P 3W5ZA 2P2CB 4H4MA 3KK1A 4WBFA 1A9NB 2EC0A 2IBOA 1GX5A 1NB7A 1G1XA 3M6WA 2DNYA 2X3GA 5KG6A 3IO1A 4NLDA 2WW4A 1F3VA 3N0VA 2Y3YA 2XMWA 3I6PA 3MR2A 4JYAJ 4DR6F 4UUWA 1ZBTA 2BANB 4NASA 3NS6A 3T19A 2RQCA 2ZKTA 4LRAA 2U2FA 3HX9A 2V2KA 2L9DA 5ETRA 4ELVA 4ZVPB 1KWMA 4DR4F 3NOCA 1CVJA 1ZZNA 1D1UA 1QAIA 2GX8A 1VQ8S 1SCJB 1S1VB 3GJTB 1RKJA 4XK8C 1QUPA 2OEJA 3LO3A 3QIPA 2QA2A 2CXEA 3HVAA 1WKLA 3KJNB 2QG9B 3P4UB 5LSRA 1Q79A 3HFKA 3OXFA 4IRCA 3K5NA 1FD8A 4Q2LA 4AE5A 2VDIA 5C25A 3D9BA 2VL1A 1HYSA 1JKHB 3MMCA 1JJHA 4MIAA 3FEYB 3RAXA 3W7BA 1NDLA 3CJ5A 3PRBA 4RW6B 4IH6A 2Z0GA 4A8KA 2JC0A 2KRRA 2V8VA 3TVKA 4GO5X 1U02A 1FWKA 1NJZA 3LAKA 5DG8A 1N32F 1IR1A 5L1KA 3OFGA 1RTHB 1R8BA 2X1AA 1WTBA 1S0NA 2C2DA 1N0UA 1CQNA 2ZOFA 2XSFA 2EG1A 4FF1A 1QTMA 2RH3A 3GYNA 5IC4B 1S99A 3D28A 2AJQA 1KN6A 2FJVA 3D68A 4HT5A 1FRMA 2KRBA 3PIOQ 5IOLA 1N54B 3BPDA 3J7Z5 4X4SA 4CO3A 2BE7D 4JI4J 3KHLA 3M8YA 1LXNA 2KVQE 1VQPS 1OJ4A 4CZCA 3PR4A 5K8MA 3MPYA 3HVTB 2I5JA 1NDKA 2QLJB 4K4XA 2GCFA 2CDRB 1U6BA 4ICLA 1S76D 3CJ4A 5DJBA 3S1TA 1Q8KA 3R5JB 2CPXA 2RU9A 2BJ7A 1VQYA 3KLFA 1JLGB 2LEAA 3CJ3A 2HVEA 2ZFHA 1REVA 3PYGA 4G1QA 1S72S 5IV3A 4OYIA 5D4OA 3Q22A 3IR7B 1Q7YT 5AJ3F 2IM0A 4KHRA 1UVJA 4BC9A 5K8OA 2RHQB 2XMUA 5E33A 3ONQA 2E7VA 4NXMJ 2D69A 4K0KF 3SQOP 2CPZA 3RAQA 1O0PA 2BACA 4EFAC 3KK3A 1BGXT 2HQIA 3MCNA 2WSCC 3CCUS 2KT2A 1RE1B 4A4JA 2GGPA 1FTCA 2QJ3A 4WK3A 3K8WA 2BRLA 4DWIA 5LMNJ 4C8NA 2FLNA 3K5MA 4DV1F 4PYDA 2NLWA 2KM8C 1UJ4A 4XDCA 2VFSA 2QL7B 3AHPA 3TP2A 2VG7B 1G2EA 4I2QA 1TV6A 2R7RA 3CCSS 2G2OA 3SZ2A 3MECB 4OYZA 4Z7YA 2AHOB 2QEXS 3HHDA 4Z7CA 4IOAQ 3KLEB 1OY9A 2VV5A 4C11B 2QIFA 2LA6A 3NNAA 2DGUA 3H0PA 3PFOA 5AXLA 2W2MP 3OTEA 5LSOA 2P9GA 2JEFA 4LF5F 1DBDA 4J9LA 5IXUA 5H9FJ 2AV5A 5T41A 3WX8A 4DV2F 3R8YA 1HIYA 3MR3A 4KKOA 1VC0A 3F73A 3EICA 3JSMA 3FCVA 5E2QA 4Y2AA 3KG4A 4ZLNA 1UVNA 2MDAA 4B9SA 1SQEA 4MJKA 2WVBA 2ZC3A 3VQTA 3KUEA 1OQ6A 4QYZJ 5E5NA 4JYAF 1H0HB 1Q82T 2J0WA 3TX0A 2AEMA 1TL1B 2PEHA 2RUGA 1H3DA 4I69A 1XIQA 4I56A 4M5DA 4KFBB 3CF5Q 3DYAA 2V8GA 5A8RA 1HNXJ 1M5VC 1RU1A 5J1EB 5L39A 3VR1A 5DGBA 5K9FA 2W9BB 1FNMA 2MQPA 2ZBCA 3AXMA 4QCLA 4PXBA 2KFZA 4WJBA 1XR5A 4OYAA 1KQKA 4X4PA 3JYTB 1UJ6A 2K2PA 1U2FA 1XEZA 3K17A 1TL7A 2YWEA 1NJXA 1DQ8A 4K2XA 1S9GA 4PCQA 4ED4A 4U6PA 1N6QA 1S7IA 3RZAA 5G0RA 2DH7A 3CJ0A 5AXNA 4NRTA 2VIHA 4R8UB 4RR5A 2HQGA 4JV0A 2LYVA 3DU5A 1WC4A 2XS5A 3OTCA 2PA8D 1WHVA 5HANA 2OFGX 2HYIB 2AD9A 2ZZMA 2E5IA 5LJ5Y 1NJWA 1VGYA 2AGOA 4RZRA 1S6QA 1YIJS 3HJVA 2DHXA 4FS1A 2AQ4A 3J7AN 1FI4A 3UW1A 3RB0A 4HVZA 2F9DA 4CM2A 2HNDA 4RPFA 4JI1J 3IS9B 5KOWA 4B3MJ 3S6EA 3SDEB 4UZBA 1S9EA 1YBUA 2C3YA 3NGTA 4JI4F 5JVGQ 5AXKA 2HVHA 3MM8B 3IXQA 2Q6CA 3DDIA 5EUHA 1MMDA 1RT6B 1IXKA 1RYSA 4LREA 3PKYA 2KB2A 4LF2A 2ZDOA 3UR0A 5KFOA 2QA1A 2YQ1A 4J37A 4MMOA 4O4GB 2G0IA 2N3OA 2FVPA 3Q8PB 2VOOA 4P7TA 5B0DA 1TMMA 1BUXA 4PABA 4URGA 1IQTA 1E6VB 1C1CA 2JWNA 3NMRA 1NRKA 4JI8J 3FRYA 3HSZA 1X5TA 1ZM9A 4LRBA 2B56A 1MROB 5KFHA 4YDDB 4U7UK 3PKMA 3CSKA 3DOMB 2ZUAA 1WD6A 2BQUA 2I1RA 2P8IA 1S1XA 2BJ9A 2HZAA 5KG1A 1NXIA 3UDEA 3CULA 3W9JA 1NJYA 2XC9A 4QW9A 3VAHA 5LMUJ 3W61A 3GLJA 2HNZB 4OQJA 2HHHJ 1OO0B 4DSKA 3QJJA 2XGPA 2BJ8A 4F26A 4B3RF 2RS8A 1ULRA 2VKZG 1X4FA 2XMVA 3DXBA 5LMNF 1TR0A 5HROB 3EGWB 1XMOJ 3MOJB 2R3VA 2C1EB 1HQUA 2KXFA 1IKWB 1WWHA 2OTLS 1U2RA 2MJNA 4OJ3A 4GVBA 5L38A 4ENOA 3TARA 3DXSX 1HNVA 3SQGA 2VHGA 1WOPA 5A8KA 2XLKA 3WIUA 3B54A 5H9EK 1R6VA 3ET6A 3J7YU 1HHSA 2CQGA 5DDPC 2E9ZA 4X4RA 1JJ2R 3PX4A 1T9XA 1BD6A 1HHQA 3M6XA 3WBZA 4ZVQB 1CJUB 3PIPQ 5J2NB 3GR0A 4J9NA 1N88A 5JXSA 3R97A 1F9HA 3B78A 4LIRA 1Q16B 3HHLB 1OSDA 4XTTA 1OY6A 4E8UA 3IRWP 3TZYA 2MZJA 3GZ7A 2CQPA 2Z2ZA 3BGRB 2I38A 3TUZC 4ZITA 4H4KA 2KHCA 3NWRA 2XS7A 4F4YA 3QSYB 1B0PA 4NE9C 2V4RA 3C3LA 2RJZA 1RTZA 2XMAA 5GAHU 2M0GB 2RF2A 4C8MA 3AFGA 2CJXB 3P5BP 3PXGa 1HNXF 1QTNB 4ZVSB 1P6TA 2MQOA 2MKSA 4DFPA 4L75A 2K3KA 4P6QA 1GAOA 1MN9A 3DLEB 4NLWA 3T1YJ 2DGVA 2W9CA 3F56A 2VBYA 3ZNJ1 2F8EX 4P2XA 2D3ZA 1ZAXA 1M1HA 3G2XA 2F1FA 1X5OA 2CWKA 1QJHA 1QUVA 4PUOA 1LK5A 2OEMA 2RKIB 1J5OB 2UXCJ 1VJWA 5KFIA 5JJBA 3HFZB 5JUMA 3RRKA 3FBFA 5HQLA 4MKVA 3RB3A 5A76A 2FJAB 4ZP7A 4KY3A 3BO3A 2KXHA 1VRQC 1S6UA 4IYQA 3DM2A 1VIXA 2UVWA 2XMKA 4ZVUB 2E7WA 3V81A 2QO3A 4ZMMA 3W8PA 4DFMA 3LAMA 1HPZA 3EMTA 3DRPA 2OPPA 3GFYA 4IUFA 1GMWA 3BPSP 2CQ1A 2DRBA 4CYUA 1Q8LA 1I94J 2HFOA 4YS2A 1VHIA 1RWKB 2AEFA 2RUSA 1SUQB 2DCUB 2CJKA 1RWXB 3Q2SC 3M8PA 4JI1F 2J9DA 2DR8A 2A6MA 4B3MF 2WW8A 2H3EB 2JH3A 4Q8FA 4I7FA 2BKOA 2HBYB 4FKXA 2UUTA 2Y1LB 5KFAA 1SH0A 2EFGA 3MPUB 2XI2A 1K1SA 4EBEA 1FKOB 4IRKA 5I3QA 4XDDA 2OKQA 2PE8A 2MQNA 5T14A 1JQGA 1RDRA 1AFJA 3LOUA 3BBCA 4F0KA 2MGZB 1PYOB 4I4BA 1EZZB 4AL6A 3DOLB 2HRTA 2PI5A 4ILMA 3B6BA 2HHXA 4F4AA 5HLFB 2OMLA 4ZVGA 5SZTA 2HIQA 4KRWA 1UA0A 4HI2A 1N5TA 2ZD1A 1YJNS 3QZ7A 3G71S 1X9WA 3D1OA 3D54A 4JI8F 1HI1A 2YH1A 2ASDA 4GKKJ 2XNRA 4NLOA 5HK4A 1YRTA 1N48A 3UO0A 1FEHA 4J9VA 1RZMA 1Y0HA 4OX8A 2MHEA 1YK9A 3K8VA 4YMEA 4PPDA 1RSCA 3RBEA 1B0TA 4PKDB 5G4DA 2HHHF 3J7A1 4W98A 3VAGA 4GC7A 1NK8A 3R7SB 4Y6IA 2OEKA 4UY85 4DG1A 2J6TA 2VJVA 3CJRA 1HW9A 5F8LA 1F9EB 1LWEB 2PFDA 2MEWA 3J81Y 1T9YA 4DU8A 1Y00A 3NAHA 4E0DA 2HEKA 1XMOF 2ACMA 5GAGI 3A8JA 1HWIA 4IG0A 1TQLA 3SCJE 1S1WA 2AP6A 2DGOA 4NRUA 2DISA 2H1YA 3BJYA 3LH2S 1WOSA 1JNZB 5HMXA 2WVCA 3M4XA 1NU4A 2NCKL 2YBVA 5CD4A 3HKWA 4OZ1A 1U8WA 2L08A 2WSFC 3Q0AA 1NLKL 3DMJA 2MSSA 4IO9Q 2AJ1A 2EWHA 3TAMB 1CC7A 3HVRA 4N5SA 5KG4A 1HQEB 2HG4A 3C2PA 1YRXA 3MI7X 3LTOA 1UCNA 3MUTP 2V4JA 2HK3A 3R2CJ 4ZJOA 5HSPA 2JRSA 1JMTA 1BWEA 4ZLLA 2IC3B 1PAUB 2VG6A 3L7UA 5F9NA 5IM0A 1O6XA 1BE4A 2M3DA 3GIJA 3OFHA 1U1NA 2NUUG 1VIOA 4J9MA 1VDHA 3KK1B 2H65B 1GXUA 4H4MB 3IM8A 5CYQB 2PN6A 4R5PA 4U9RA 4C8ZA 2YX7A 3LP2A 2HWTA 2QA4S 4RBTA 4QWBA 2UVUA 3TANA 1M5OC 4DR7J 3H8YA 4FPIA 3CC2S 5ETNA 2R8HA 3CCJS 1U1KA 4RJVA 3FSXA 4KPCA 2LA4A 1KDNA 2FJXA 4QBUA 4NMLA 2GA7A 2GAGC 3A12A 4U7UD 1NHKL 4RNMA 2GJFA 2WK4A 1TK8A 2JL9A 1P1TA 2XCPA 2HZVA 7FDRA 3DLGB 1HBUA 3IRXA 5CAAA 1RLDA 3M9MB 3T1YF 1N0VC 3H42A 4W4MA 3PNIA 3JQJA 3CJKB 1YKWA 4O0NA 4YFUA 1X60A 3UD3P 4IRDA 4RW9B 1R3NA 5GMKa 1KD1T 4ILRA 5KFTA 2UXCF 1NZAA 3P6YC 5CYMB 2CG4A 4DBQA 4OI3A 2NYIA 2PFFB 6AT1B 1Y11A 4C97A 4NL5A 2H4YB 2J8SA 1UW9A 2MKCA 1JLCA 5C25B 4ZVFA 3FSYA 2J6UA 4P2FA 1IKXA 2BJ3A 3MMCB 5A0YA 4WP3A 2DR6A 2DB1A 3MM7A 5KFRA 3I87A 3GJSB 5HATA 1HBMA 4TU7A 2UUAJ 3FCHA 1XR7A 3W64A 1U8SA 3EXCX 4P74A 2HVIA 1OS5A 1MW7A 2HW3A 2VF3A 2DXFA 1I94F 1YDLA 4CP5A 4E98A 1VK3A 2IM1A 1MU2A 4F36A 4UQGA 2WBRA 2IM3A 5A6PA 2MZTA 4WFNQ 4ZPTR 2YNFA 4TQRA 3CCLS 2BOPA 5KG3A 4IFVA 1SL0A 3NGKA 1O8BA 3M9OB 7FD1A 1LWXA 1V3ZA 3EDRB 1RU2A 2YWWA 4K4ZA 2MQQA 3MFHA 2ZH2A 4O0IA 2BA9A 3QRRA 5H9FK 3FKBA 4DV6F 1YTYA 1Q0NA 1FXDA 2BE2B 2NXJA 3AY0A 5F8HA 1S59A 4DCPB 1H74A 3PDNA 4GKKF 1NPRA 1SB6A 1FXLA 1JWWA 3C6TA 2UVRA 1TK0A 3H59A 2KH9A 2YQ3A 3BGOP 4QYZK 3VAJA 4CLYA 2ZHOA 3CPWR 1R7IA 1SH2A 1PJ5A 3TJAA 5KFGA 1TELA 3FDSA 3M9NB 2HFNA 1N8RT 1RHJB 4NA1A 2NXEA 4DMZA 4G1QB 3PEHA 5DS7A 5DLGA 1X0FA 4UTGA 2MQ8A 4PWDA 3AQOA 4U67Q 1GT8A 2DNHA 3HM9A 3POTB 2YNHA 3CDBA 4CLZA 1W2BR 2GQQA 2RDDA 5KT2A 3G96A 5D8HB 3VHQA 2GHVC 2BV3A 4KH0B 4A8MP 1HD0A 2GGPB 4BWJA 4XPCA 3OTOJ 2B5JA 1RT7A 2CKWA 4EBDA 5C5JA 1F5CA 5D6GA 3ENQA 4OYPA 5FD1A 2V6AA 1UEUA 1HWJA 3GFXA 4BC7A 2YNIA 3G4SS 4I2QB 4USKA 2BW2A 2IAJA 1VQ6S 2C2ZB 3H2LA 1L3KA 4ZCMA 3C66A 1QAJA 3T9NA 1C0UA 2YWHA 3K89A 2WB1D 1EKSA 2OIHA 3MEDA 3J80U 3OL6A 4OJGA 1BQNA 4NWBA 2KI2A 1NEEA 1SIZA 1PAEX 4N77A 1N5YA 3OW2R 2X1FA 5F8JA 5GMDA 1YZ6A 2ZHAA 1T9TA 2VFTA 3PW4A 4A8WA 4KKOB 1H2UX 4DL2A 1NDPA 1YITS 3JSMB 4ED3A 4DR7F 1NHUA 1HNZF 2WB4A 4P2SA 1BHNA 3TAQA 3V6JA 4LF6J 5DGAA 4PXEA 1RYRA 2W01A 4ZJLA 2XQCA 2HQDA 2WSEC 5DQHA 3SV4A 2V2QA 4YR3A 4DF8A 4WZQA 1ZPWX 4M1KA 4EZ6A 3KHRA 3IWLA 5CH7B 1FTRA 5EGYA 3H2UB 2Y9HA 3I5AA 4M5DB 4JV2A 1IUJA 1B7YB 3DYAB 5A8RB 4EBCA 1H7WA 4DPUA 4CH1A 3PYFA 2MY7A 2ZVSA 3BM7A 2NYHA 2B9YA 4OI2A 2EEYA 2CPFA 2CYYA 4QIEA 1VI7A 1G4CA 1S1VA 3MEEA 2QL9B 2RE1A 1QLNA 3NCPA 2EK1A 1CS4B 4I1TA 2C28A 1XBWA 2B4OA 3TWZA 3OFFA 3N9UC 4F4XA 1VQ9S 4F02A 4K7QA 3VAMA 4XAKA 4DPOA 1YGYA 2LVWA 4F3QA 4IR9A 2E66A 3H5YA 1N6QB 3PHTA 5G0RB 4FYXB 1Y5NB 2EK6A 1BQXA 1CULA 3OUYA 1HI0P 3AOBA 2EKNA 2SXLA 4C0OC 4IKAA 3BBBA 5CZXA 3M2VB 4ECSA 1XJWB 2Z56B 1B64A 4F04B 2DHGA 3EM1A 3I82A 1HI8A 4OYOA 4DEZA 2E9TA 4FYWB 1FJEB 4Q2MA 3AXKA 1S6QB 3TNVA 1RTHA 4DL7A 1V3RA 5F0UA 5KFUA 2CDQA 3M8RA 4WFXA 1URNA 2VBWA 2F65A 1GXLA 2MZRA 2RILA 2G13A 2MYFA 4USJC 3GPAA 2IY5B 2V8HA 1ZOTA 3ICLA 3G6VA 3D6FB 4RL1A 2O1PA 1EETB 5EWEA 1PGZA 1RWOB 8ATCB 3FNNA 1IKYB 3QNWB 5AE1A 4B08A 2ZE2A 2G2YA 3PW2A 1FFGB 5A2QY 5GAHI 3HSGA 1HBOB 2QLBB 1UVMA 4KGKA 4WP9A 5CCLA 4I64A 5BYRA 3G8SA 2DR7A 4YUDA 2EI5A 1RGVA 1YVFA 3W2VB 4AXIA 2COLA 3OT9A 3GIMA 4B3OB 3C46A 2R2SA 5HP1A 1C1CB 2V5HG 1NPKA 1ZTWA 4K4SA 5LT5A 2BOAA 1C0TA 2MLXA 1CSJA 3MCMA 1SQGA 5CABA 3EGNA 4PR6A 1B7FA 2OH2A 5IS2A 1WACA 3I9ZA 4ITSA 1VQLS 2DNMA 1KONA 2FZGB 3L09A 2APOA 5E41A 2ALYB 4DFJA 3HHLC 2O5DA 3OVAA 3MD1A 2DNZA 5F3TA 5BYQA 1NKBA 2LU2A 2BMBA 1QSLA 3IP0A 4HH0A 4A8FA 1Y10A 4ANEA 3EX7B 3QMQA 2DNOA 2DH8A 4C0HA 1SC6A 3WDOA 1RHUB 2QFJA 2YWGA 2BQ3A 1HQUB 4FYVB 3A3NB 4DR3J 3W66A 1D3WA 3OBIA 3DRRA 1AT1B 2B6AB 3QYYA 4GVBB 3LANA 4YY3J 3RU0A 5LL6d 4R0JA 1HNVB 2VQFJ 3SQGB 4K2JA 3F44A 1UETA 3DDNA 2WBMA 4ANCA 1IBLJ 2ZC4A 4Y2CA 5ETVA 4B9VA 2LXUA 3MECA 2EVZA 2UXBF 1HBNB 4RWWA 4WP8A 3GCWP 1JLEA 2HPUA 3CCVS 1HWLA 3MCSA 2LQ5A 2IIHA 1Y3KA 4RUAA 4EZ9A 2MSTA 4O23A 2A2CA 3H40A 2WRMA 1T02A 4LF6F 3BKFA 2M52A 1XC9A 4WWSA 2O67A 4LFCJ 1TTHB 2CPYA 4OV6A 3MR6A 2K06A 2JSXA 4DLEA 1M5PC 2GVDB 3I4PA 4K8RA 4MYTA 4PRFA 1LXJA 3BO2A 1X4CA 5IT9Y 1QVGR 3CCES 4C4WA 4NXNJ 3UDVA 2ERRA 2QLFB 1SKUB 2FC8A 2RF2B 3RB6A 2A3JA 2OPQB 3A3OB 3IGNA 1WTFA 2XYPB 4A8YA 3KMSA 1VR6A 1TL1A 2JZ5A 2IYIA 2H9ZA 5KFMA 1VQOS 1T9UA 3M1VB 4NMXA 4KQZA 2X1BA 1XK8A 3CCWA 4NLGA 3EZ5A 1VS3A 2OI2A 4PAAA 3C16A 2IBKA 1X9SA 4A8QA 4IFYB 3QJPA 4USUA 2R7QA 3I55S 2AYEA 1ZS6A 4NLSA 5KT3A 5E3PA 4GKJJ 1ZZFA 3OR1A 3WC2A 5ETMA 2ZM6J 3HJFA 4O3QA 4K4WA 1P1LA 1DY3A 1R6YA 4CT9A 3X1LB 3DM2B 3AJ2A 2CPDA 3V81B 4ECQA 3IWNC 1HPZB 3M32A 3UD4P 2U1AA 4DU7A 3MEKA 4WCEQ 3B8HA 4PWWA 4P7VA 3DI6B 4CYUB 3IG1B 3H20A 4OHWA 4HDHA 3RJMB 1SC3B 4MK8A 1SL1A 2XI3A 2YX4A 3BO4A 3DLJA 2GIQA 4OYXA 2JJ4D 2K8GA 4CDIA 4CTAB 1XNRJ 4USVA 1BLUA 4Y34A 2W4CA 2FLLA 1SC4B 2EBGA 2DXDA 2R8JA 5DQIA 2UP1A 4ZHRB 2JLEA 3SDEA 3KJVA 4NCBA 1IKVB 1FRHA 3SEOA 1RK8A 3PW7A 5K8NA 4FXVA 1WF2A 2J9CA 2FJDB 4F67A 5DLFA 3T5LA 4H54A 1RT6A 4C3LA 4C3MA 5B09A 1FNOA 4Y28C 4I2PA 2W4PA 4CLTA 3EZUA 4CLKA 3UFCX 2AKWB 1FRXA 4G3IA 2ZD1B 3QRQA 3EGVA 1JJ4A 3MAAA 2VA2A 2RS2A 4X4TA 5IWAJ 3NLCA 4KC5A 5KOXA 2ZOMA 2FY1A 1NH7A 2BW7A 3DLLQ 4QOTA 1MROA 4DX8H 2BJDA 3JQMA 2XMJA 5HQMA 3IN5A 5EWGA 2BDPA 2HSEB 1BQMB 4I67A 4MKAA 5CHCB 2H4WB 4USMA 3U1NA 4DQSA 2ZH8A 2AJ4A 1N34J 2HNZA 5HJYA 2HFZA 4OYBA 2BZ2A 3PRVA 2PSZA 4DR3F 2XB2D 1K0TA 3UVJA 1KKHA 2X3DA 1RT4A 5HROA 4YY3F 3BQ1A 2VQFF 4LBPA 1FE0A 3O8WA 1S97A 1GQEA 1V3SA 3V6DA 1S7HA 1RLCL 3SMZA 3DMJB 4F4KA 1IBLF 2XSJB 3V4IB 2QGFB 3ITHA 2VFUA 1LWCB 2J5AA 1ROFA 1UWBB 4EO6A 1H7XA 2GFFA 5IQQA 1OMSA 4FYDA 3GIRA 2W1BA 3D67A 1K9MT 4WFAQ 2V4JB 3AA9A 1VQMS 2UV8G 2CVEA 3BYPA 4DF4A 2XY7A 1FRKA 4AT1B 2IMWP 3LP1A 2AJ2A 1AZSA 2VG6B 4LJMA 3W3SA 4CLUA 1RKIA 2JNJA 1FKAF 1DRZA 1UVKA 4IQMA 4JI7J 5IM0B 1FNXH 1TFYA 3H4BA 3VAKA 1N5SA 3JB9k 1ZETA 4F25A 5J2PA 3V4MA 2BM0A 2YKNA 4R5PB 3JQKA 4M5IA 3KLHB 3HHLA 3QSIA 5I42A 3LP2B 2FHMA 4F4ZA 3CW2C 2XO6A 4ZKAA 1WI8A 4NXNF 4M5NA 5E3QA 4NOHA 1H2VZ 2B4UA 3GJQB 2ZBRA 4OI4A 2QZ8A 2AWZA 4YP3A 2DPJA 2GIRA 4IQXA 1Q8IA 5HI7A 1F2GA 3HHLD 1HBUB 3IRXB 3L9ZA 2IA0A 3ADAC 2AIRB 2OUGA 2DGXA 4RW4B 1UZHA 3MMAA 1LNQA 2J9DE 1JIHA 3DLEA 5DO2A 2WTFA 1Q5VA 3DLKA 3HK2A 2BJEA 4LF1A 3HDSA 1M5HA 2KFYA 5KT6A 4GKJF 4OYMA 2JFKA 2XG8A 4L74A 1R0AA 2OTJS 3PFEA 4RKUC 3GG0A 1VQ5S 2ZM6F 1K44A 1YBTA 4ECYA 3GWCA 2L9NA 1TP7A 4Z2XA 2C2KB 5EWFA 2GW8A 1OSCA 2XBPA 1IKXB 3UN2A 5A0YB 2HVZA 2CQ0A 5DDOC 1B70B 3DN9A 3MM7B 4M5MA 3QBCA 4OV1A 1UPMB 2DXEA 2EFQA 1RP5A 2MLZA 2UUBJ 3M8QA 4LBHA 4OI0A 3D3CJ 2UVVA 2KDOA 1MU2B 3SSRA 2DJWA 2E9RX 1N36J 4ZLJA 1Q5YA 5EHHA 1TU0B 1XNRF 2YNFB 3Q8QB 1SUQA 1YWXA 3L4BC 2DNRA 2XHCA 2OD6A 4IG3A 3GU0A 2ILZA 2BEFA 2BBEA 2Q3PA 4RBVA 2C42A 1D9AA 4OZLA 1FDDA 4K5RA 4MKBA 3K5PA 1K73T 4ZPWR 4EO8A 4J90A 3VAFA 1HLWA 4DL3A 3R7BB 5KFXA 4OZ5A 4QW8A 1YSJA 3ZTOA 4WKRA 3DOLA 4DI6A 4QWDA 3P49B 3IAM9 3R1LA 3ISZA 2FVCA 1HNWF 5A8WB 5IWAF 2XCAA 4FBTA 2EBEA 4DPYA 2DGTA 1QY7A 1JB0C 2WVDA 1U2CA 5KFLA 1XMQJ 1SJRA 3A13A 3FMWA 5MLCV 2J7KA 3W2WB 3P96A 1KP6A 2BXJA 1MSWD 2FVQA 3HVWA 4PWDB 3MR5A 2QFIA 1FVSA 2GS8A 3PZPA 2J0QD 3IA0A 4HYKA 4NYZA 3GCXP 1MNEA 1N34F 3MHYA 3D1QA 5GMEA 3BREA 2KJWA 4WFZA 1WC3A 4ED2A 4HL9A 5ETOA 1W2IA 3D0IE 1KNZA 2FY8A 1JLQB 3H5XA 1K1QA 3LPEA 3DRXA 4ZN3A 1FESA 3HZEA 2HGNA 3JSRA 2B5JB 2XMMA 4UUXA 5DZ6A 2OFHX 4TLQA 5K14B 3BGFA 4URSA 4HHHA 4QIGA 2I2YA 3KLIB 3ILJA 5IV4A 1G6BA 3WZ0A 4DQIA 3CCMS 4CH7A 5D4NA 4RUHA 1RA6A 1X31C 1KHWA 2EG2A 5KFBA 2KJVA 2EFOA 3ZZTA 2IAJB 1QVFR 3UNYA 4J9QA 2W24A 1S5ZA 4ECWA 3UR3C 3RW7A 2XMTA 1HQEA 1RWNB 4PWUA 4ZCIA 1C0UB 3F41A 3CD7A 3NNHA 1FKPA 3SCKE 3N79A 2Y0SD 3MWBA 5DG9A 3MEDB 1BQNB 4JI7F 2RVJA 4ZP6A 1N5YB 4DPTA 2ADBA 2YTCA 3LF0A 4OLPA 3GSIA 1KHVA 2N4CA 1UPPA 1CJKA 2W25A 3VVTA 3U27A 1MG7A 1T0TV 1WJ9A 2KN4A 2V9WA 5CYQA 1Y4ZB 3RB4A 5HVGA 4P75A 3L95X 1T05B 2RAQA 2PC6A 3ISND 3I56S 4G6VB 5CYJA 1YQHA 4LSNA 1WC1A 1KRPA 3QZ8A 4MIBA 1EP4A 2X51A 1R8AA 5DG7A 4HLBA 5CCMA 2FJEB 4UOHA 4RX6A 1TFWA 2VC1A 2IM2A 1SI9A 4OHXA 2V63A 3D7SB 1HWKA 3DLGA 3MM5A 5C24A 4MTPA 3TO8A 3CD6S 1OWXA 3CJKA 1MLAA 2GVZA 2ZITA 2AGPA 3E3XA 3OTDA 4ZDNA 2POKA 3BSOA 1FK9B 3ZZZA 2MKYA 4RW9A 3MEEB 4DR2J 2GIFA 1VRUA 1R31A 3MCOA 5CYMA 3OTBA 2L48A 2ZKUA 4P73A 4URQU 1RT5B 3UPFA 4K4TA 2A6OA 1U1MA 4WYWA 2V68A 3OSNA 3NNCA 1VC5A 2I8EA 5J1NA 2UUCJ 2YNGB 4MFBA 2YVSA 3I9V9 1CULB 5DRKA 3OUYB 2HLUA 3CB4A 5F8GA 1UJ5A 2UUBF 1CLFA 1U1PA 1KOOA 2MZQA 2W7AA 3CIZA 3LA0A 9RUBA 1N36F 2F4FA 3JS9A 3QPIA 2XWXA 1EHWA 1Q1KA 1RAFB 4LFBF 3HLUA 2OPRA 1S6PB 1ZA1B 4YB6A 4NZ6A 2JEIA 3KNAA 5DQGA 3GFHA 4PG5A 1CG2A 2Z2YB 3L7PA 4X84A 3K5LA 2Y1IA 1S0OA 1R0CB 3NWGA 4PG6A 2AGQA 1RT1A 5CQGA 2DEJA 2ZE2B 5BXIA 2LQJA 4EI2A 3THVA 2HHQA 1X8DA 4M63A 4OZNA 3I5BA 4R0EA 1FJGJ 2QTWA 1V6HA 2FLPA 3VF0B 2LU1A 3CO9A 3UCZP 2BE2A 1OY8A 3DKDA 2KYZA 3B4MA 5L8RC 3KOAA 1XMQF 1U48A 2G1DA 4MIWA 2OD4A 5HP1B 3ETMA 4DQPA 5C2CA 2J9EA 1UP1A 4KAIA 2E5LJ 1IWAA 5FLXY 4PXCA 4ZCLA 1C0TB 2MLYA 4JI0J 3FFIB 5D4LA 1RWWB 3NY0A 1KLNA 2K3IA 1BXNA 4WIIA 2HZCA 2FVSA 4YR2A 2DPIA 2D74B 4WFBQ 2ZDPA 2Z2MA 2DRAA 3FCWA 2PT0A 4FNHA 5KFYA 4A8OA 4L72B 2Y8YA 4EMDA 3PEJA 3POTA 3U1MA 2YPYA 4H4KC 4ECUA 4RUCA 4ZP9A 5T7LB 1CPZA 4WKYA 4LBIA 2HVDA 2Z58B 5ETPA 3DLBA 1VQ4S 4CCHA 1N52B 1F60B 2CNOB 2MXYA 3DRRB 1GMUA 3MUVP 3OLBA 3ETOA 4ED8A 4LT6A 1SXLA 2AJ0A 1NK0A 3H4DA 2HMIB 1IVZA 4RW7A 2B4PA 2Z57B 3CCZA 4JV1A 3MOZA 3RRHA 3OPKA 3BH6B 5KG5A 4OI1A 1NUEA 2RU3A 3H25A 3HMJG 1NKEA 5LM7E 2J8AA 3D6MB 3CXCR 1P9QC 4ALZA 1JLEB 2GNKA 3G6ES 2DNQA 1FJCA 4Q45A 3MR7A 1EJ7L 4C3KA 2HWHA 1E6YA 4QR0A 1X4DA 3K57A 5KTQA 3HHKA 3F0NA 3O2IA 1YZ7A 4J5OA 2DHSA 5J2MB 4USIA 1P27B 5D78A 2DHHA 2MZSA 2D9PA 5D0RA 4ZIVA 3TVYA 2YKMA 1TL3A 1JXVA 4LSLB 5IFMA 4EU0A 5DM6Q 2CJYB 1WEYA 1EQMA 1U45A 1KSPA 1IBCB 1Z1ZA 4PZVA 1LOUA 2D3UA 3TR5A 4C8YA 5LXRA 2R4FA 3SXLA 5DDQC 3G8TA 1RTIA 2DCLA 4KB7A 2P6SA 4C8OA 2LECA 1I1GA 3J81U 3I4HX 5HBMA 2WHOA 4DR2F 2DYAA 3GYXB 4GRSA 2ZH5A 1TKXB 4DR1J 3C16B 2VDHA 4CLPA 3AAWB 1X4BA 2DY1A 2RRNA 1FRIA 3CNQP 1IM4A 1JXLA 1DLOA 3GILA 3OR1B 1CS4A 4DX7A 4O4RA 2KG0A 2QMWA 5HO4A 1RTJA 1L3TA 3FRZA 1YJVA 3HHEA 5B0AA 2KO1A 1ZM4A 3DHXA 1NK6A 2MB0B 4TY9A 3V6HA 3TUIC 4F4WA 2XULA 2CQCA 4HH1A 3QO9A 3D0GE 3M32B 5KFQA 3M2VA 2BR0A 2MZ1A 2F8MA 3AOAA 2C3UA 3GV8B 4DV0J 3LGHA 4NX9A 4LR8A 5A6WA 5K8PA 2Q66A 2JLFA 3J7ZT 3PM9A 3NP5A 2HHVA 5K20B 4HI1A 4LF9J 3BQ2A 3MM6A 2NPFA 4OZ3A 2D7SA 5KFSA 4C6AA 3EXYA 2EFVA 1X5SA 1EETA 3KJVB 4EK2A 5FJ4A 2EXUA 4UZCA 4J7CA 2ILYA 2QL5B 2DO4A 1IKYA 1FJGF 3LP0A 2ZJRQ 2RSQA 2VC0A 1M1KT 3GTYX 1HBOA 3IWXA 2PO4A 4B02A 4I2PB 5D0EA 3THTA 4RNNA 3TA0A 3AB4B 4TYBA 2VKRA 2ROGA 3A8IA 2E5LF 3W2VA 2AMCB 1Q7LB 2R7UA 4B3OA 4J9SA 3MAAB 5KFJA 4JI0F 1LWFB 3N6LA 4I0WA 3RR7A 4P2MA 2KU7A 4PQAA 2ZEJA 3OHAA 2W2PP 2HBQB 3KDNA 4B9LA 2QE5A 4QPTA 4RWXA 2ATLA 3GYGA 3GB0A 3N01A 2DIVA 4NXMF 2VPYB 1SV5A 1RAEB 2DY9A 3ILOA 4IDKB 2JDJA 3CT9A 3HKZD 4RU2A 3P8BB 4OZ2A 2CZ9A 4EYIB 4Y00A 4CO2A 3ZZYA 3GP9A 5H1SV 2CNKB 1KLMA 1AB8A 4C98A 5C7PA 4LR7A 4OFZA 4DSJA 2FYXA 3UVJB 2N3LA 1RT4B 1X0PA 3TZXA 4YHHJ 2H54B 8AT1B 4C8LA 1NSPA 2C3MA 2FZCB 2B6AA 2R8KA 3V6DB 3HXMA 4PG8A 4ZPDA 2ASYA 1RT2B 4PG7A 2NXUA 3ITHB 3A1YG 3ZC4A 1RHKB 3TA1A 1H38A 3VAIA 3NCQA 3Q8YA 2UV8A 5M2PA 4JUZA 2VONA 4ED0A 2O66A 1L5UA 3LUYA 1GEHA 3BQ0A 3OFEA 3TUPA 1LK7A 1HBNA 3LP1B 1AZSB 3AB2B 1OYEA 3Q83A 3VZIA 1UVLA 2BJ1A 1WORA 1TVRA 1M5SA 3PYDA 4L3KA 2DRDA 4BWMA 3DGPB 2AX0A 2PDAA 5J2PB 2YKNB 4DV5J 3W8GA 4ZN1A 1X5PA 5I42B 4RLEA 4DSFA 1U09A 2C3OA 4RW8A 1FD2A 4L73A 4DUZJ 2RDIA 1GX6A 1KS2A 3DRYA 2GVDA 2HIYA 3I0SA 4CLFA 1DQAA 3G82B 3DRSA 2VFVA 2QC3A 4YN3B 2NSCA 3PCOB 2NS1B 2CWXA 2OPQA 3TAPA 1R8HA 5J2QA 2FVRA 4KV8A 2ZJPQ 2E29A 2XWYA 3MMAB 3W9IA 4DR1F 2X1GA 1U6ZA 2BX6A 3QATA 2ASLA 3DLKB 3M1VA 3DGVA 2CNNB 3NXZA 1PCAA 4NLUA 1R0AB 5IT4A 2IVFB 2WVFA 4OJ1A 4MKYA 1LW0B 3OXGA 3UDLA 3EWGA 4IFYA 3NGUA 4IR1A 4TY8A 3R3TA 4CQ1A 4NLPA 1K0VA 7AT1B 1IR2A 1S77D 2DT9A 4OJHA 4C0BA 3QIDA 1H98A 1UMJA 3ZO7A 2B0GA 1NZ8A 1HR0J 3VGSA 1RA7A 4QU7A 3ZZUA 1IWGA 4DV0F 2AW0A 3M8QB 2RD5C 5KFKA 1QDUB 1UVIA 3LGMA 4OHYA 2VD3A 2J7WA 2WONA 2ZZTA 2W8LA 2PI4A 3FBEA 3DI6A 3N6NA 3TJ8A 2KKHA 3IG1A 2ALZA 1EB0A 3MTKA 5RUBA 4LF9F 5AE2A 4CO4A 2OPSA 4MYUA 2O01C 2E7XA 4M5JA 5GVQA 4IG3B 4CTAA 1NH8A 1OPIA 3RBDA 4CLWA 2DH9A 3TI0A 1KR4A 4AL5A 4ZVEA 1G7CB 2Z30B 5E3RA 4ZLPA 3KXDA 1I3OB 4ZHRA 1FEEA 4UOCA 1IKVA 4TU9A 2QLXA 2RNEA 4K50A 4NYPA 2PMZD 4HKQA 1C1BB 3CVKA 1T3NA 2RHSB 2R8IA 2OHDA 2CVIA 1SL2A 1U26A 4KIAA 3TJ9A 2DITA 2IA6A 3K5OA 5M2RA 4DXLA 3IR6B 4DCOB 2F7VA 4J9PA 2GAHC 2DD8S 1S1TA 3LALA 1VLYA 4DL0C 1FFSB 4U7CA 1Y7PA 1SJ4P 4ES2A 4HTIA 4DV1J 2R8GA 2DHAA 2LDYA 3VV2B 1DFDA 1D8ZA 1X7VA 2B51A 3AD9C 2B3TB 2R7WA 1S10A 2NXCA 3R9LA 4LVNP 2MKKA 5LMUF 3N5BA 4GMKA 3NRBA 3PX6A 4PPZA 3T9ZA 2ZHBA 1Q78A 5DM7Q 2MMYA 5LXYA 1BQMA 1NAQA 4ZVOB 5GAEU 2CPJA 5C2GA 2FQQB 4X4VA 1QAYA 4LF5J 2G1HA 1TL4A 1KFSA 2LQBA 3MMBA 2V67A 5JVHQ 4GO7X 4YHHF 4DV2J 2WVEA 2M88A 3H2VE 3QT5A 3UE2A 2VQEJ 4F7VA 3W5YA 1DTQA 2P6TA 2QSFA 2HAIA 1GFWB 1NDCA 1M90T 4UF4A 3T41A 2HGLA 5EN1A 3GG1A 5L46A 5IC6B 2IPOB 2XSJA 3V4IA 2BQRA 3U7JA 4I68A 2EPIA 1LWCA 5A2QU 1UWBA 2GZOA 3PR5B 1FKPB 2HBZB 1U47A 1LKZA 4C2MA 3KHHA 3FBCA 4DDFA 1C2PA 4ECRA 4FKYA 4B9NA 1R27B 5F8MA 3G8QA 2R7VA 3CD5A 2HS4A 4DV5F 4UT4A 2R2RA 1CJKB 5KFVA 4YB1P 5HL7Q 4DUZF 1KOHA 2DNKA 4KJIA 5B0CA 3JTPA 4YQWA 2AX1A 3KLHA 4ZPVR 4DV7J 5D0HA 1U0SA 3D66A 3OXLA 4LSNB 1EP4B 4K4UA 3O3LA 2OGUA 1N5VA 1UL3A 4NA3A 2R42A 4QR1A 3MURP 1VBXA 4DZ6A 4TXSA 3M6UA 1R0BG 4HHUA 2HBRB 1LFPA 2DKOB 1XTZA 2IJRA 3PRDA 4TN2A 3US5A 1VBYA 4KE5A 4EEYA 4DUYJ 5FIIA 5GAGU 1V5IB 5C42B 1TAUA 2GJIA 3MM5B 5C24B 1N4LA 5ETTA 2HURA 3C15A 2GVZB 4OX9J 4RW4A 4D3GA 2LQ9A 2ZBPA 2ABYA 5ETLA 2JLGA 2C2OB 2IDLA 4B3SJ 2G0JA 1VRUB 3KUHA 1C4CA 2W2QP 3PW5A 4OX7A 5IT0A 4CO0A 2XYGB 4QYRA 1J27A 4LMZA 4U95A 6FD1A 3MD3A 3NL0A 4O44B 5U47A 4MFBB 4FXDA 1HR0F 1OPZA 2VA3A 1RAJA 2GJ2A 4FXWA 1DTTA 5FDLB 1ZH5A 1JXEA 4AQYJ 4BDPA 3KTQA 1IR0A 1KVIA 1TKTB 1AUDA 4KBIA 1HA1A 4XO0A 4DN9A 2OPRB 3V2UC 3OJSA 4QIFA 2FHOB 2PA3A 2GMJA 2HRYA 3MXHP 3BSCA 3IAS9 4NLXA 1VQKS 2FC9A 3D6HB 4X62J 4A48A 2ZBQA 1RACB 1RT1B 3FZ2A 1NB2A 3R6GB 4HHJA 2QYGA 5IT9U 2JVOA 5HAOA 1RQ0A 1D0EA 1SIWB 4ECXA 1PO6A 2K1RB 3TEHB 3KHGA 3CCRS 5ADZA 2KT3A 5D77A 4USTA 3BR9A 3C14B 2YH0A 1VQNS 4AYBD 4ER8A 3I96A 1EARA 4B3RJ 4U8VA 3BYRA 2DGWA 4L6V3 1U7LA 1VRTB 3OSPA 1NCLA 5A8WA 2W4DA 4R25A 5CZVA 2QV6A 4QWEA 3C19A 1ZTTA 4HACB 4UY8T 2ZH3A 3BN4A 2AZ1A 3MTJA 1ACMB 2LQ8A 2GO8A 2NPIA 3TX8A 1U1RA 4ZPBA 5AXMA 3W2WA 2FUG9 4CI0B 4DS5A 1EAYC 3FQKA 2XNQA 5AE3A 4LSZB 4HR2A 1KVJA 1TK5A 2G9OA 2HNYA 2YKQA 2E1PA 3VQSA 1HKAA 3C6UB 3CJSA 1TAQA 4ZPAA 3HULA 3AOCA 3W63A 2OLWA 2HRUA 3CDUA 3N6MA 1Q8BA 2JVRA 2NR0A 1OYDA 2VASA 2XY5A 5KG0A 4ERDA 1C4AA 1S4EA 2GV1A 4KGMA 5BYSA 2FLOA 3FUYA 4LR9A 2HKEA 4DL5A 3N4WA 1JLQA 2VQEF 3NAIA 2N82B 2R2UA 1O5JA 1XMBA 4P71A 1F3FA 3T3FA 3V5RA 3EVWA 3Q89A 2ADCA 5DETA 2LFVA 1DURA 4X64J 2R7TA 3WC0A 2D1CA 1V5VA 2C2EA 3GMGA 5K14A 1T95A 2YY3A 3KG0A 4RW7B 1RB0A 3KLIA 4NCGA 2NUHA 4X4NA 2R7XA 2CAJA 3CDAA 1T9WA 1T11A 4CO1A 1A0OB 1CBKA 1KFDA 1HARA 1B3TA 4YDXA 2R9LA 5ETSA 2HS3A 4AFFA 4O3SA 4N41A 4DJBA 1WKKA 3CJ8A 2VPXB 3FVYA 1E6YB 2XZDB 3Q8UA 2LEPA 3MPVA 3BV8A 4DV7F 5MAOA 3CDWA 3JAMY 1RWVB 1UFWA 1F0XA 5EX3A 1KQGB 3KJFB 3GFZA 1WSRA 2GC8A 1TKDA 1T05A 2VZ9A 3QFHA 4DZDA 3VZHA 2DEIA 2YKMB 1TL3B 1L3SA 4DSEA 2V94A 3PO5A 3RW6A 2RRBA 3DCAA 1APSA 4DUYF 1LW2B 2AYGA 3CIMA 3TW0A 1Y3JA 1RTIB 4OX9F 3MPWA 4C48A 4ED5A 3DOKB 4B3TJ 1HMVA 1K8AT 5HBMB 2RIJA 3S01A 3ZNUA 5ETKA 4DX5A 2HQ3A 3OL9A 4B3SF 4ZVHA 1D9DA 1WI6A 1PJ6A 4B17A 3Q86A 2WCXA 3AA8A 4OMFG 3WQPA 2ZJQQ 2MY8A 3D6TB 4ES3A 4N56A 2QMXA 1FK9A 2YKPA 1M0SA 2K7JA 1RTDA 3TA2A 4M94A 1XN9A 3AT1B 1FO1A 3GQCA 2ZH9A 1DLOB 2W7PA 1RABB 1IJEB 1RTJB 1UWAA 2LKZA 3U1LA 2E44A 5LSLA 3KK2B 1RT5A 4CNZA 4FF4A 3X3UA 2MTLA 5M2UA 1MN7A 3HD1A 4UW2A 1FF2A 2YNGA 4AQYF 1IJFB 2H48B 2UUAF 3TVZA 3J7YI 3FC9A 3QO9B 1YI2S 4MAKA 3NS7B 3QLHB 2ZH7A 2FJWA 2Q43A 3KMQA 3CCTA 4F3OA 1JLAA 4KR0B 5B0FA 4IH5A 3EPGA 2IRXA 4TVAB 4H4OB 5J1PA 3KJQB 2FB0A 4RU9A 4ELTA 2FGCA 3HFVA 1U49A 3A8KA 1PC4A 1S6PA 3CD0A 4WYLA 4M5HA 2RDJA 4CNYA 5B0EA 4X62F 1NBEB 4TNOA 4WIQA 3SSQA 2E1MC 3MM6B 5KFDA 3H90A 3HT3A 5D15A 3LW5C 4N47A 1CQMA 4P10A 4LRFA 1S4FA 2ROPA 3EVMA 3LP0B 4Y3CA 1FXRA 1NK4A 5THWA 2A2DA 1KBRA 2B9XA 3NBPA 3A4TA 3BEGB 1SJFA 2CADA 2HLTA 1L3UA 1GMVA 1VC6A 1VOMA 3N28A 1RHRB 2RQMA 1FCAA 1NSKL 4DS4A 1GH8A 2UXDJ 1YJTA 3TZWA 4Y2KA 3LWMA 3RR8A 2RRAA 3MPDA 2EW9A 4NLTA 3WX4A 2WOMA 3OR2B 3HPOA 3PJ9A 3FFIA 4UOFA 5HVHA 1QE1B 4I6WA 2FIUA 3N5FA 3KLGA 4YOEA 2E1AA 1T7PA 2MQLA 3M2UA 4EYHB 1SV5B 2PMWA 4JV5J 4GVLA 2EFNA 1T03B 4KGXB 3Q8VA 4TU8A 2KYXA 2PEBA 2BRKA 1TKZA 1KLMB 3RYLA 3W5XA 4LVOP 3OTOF 3Q23A 5T7LA 4WF9Q 4X64F 3CMES 2E5GA 1CJVB 3L3CA 2LMIA 3HT0A 3O5TB 2XM3A 4WTOB 1K47A 1ZM2A 1Z2LA 3MDFA 1VLOA 2Q6BA 3EUNA 4M95A 1U0HB 2RMLA 4CT8A 3BF4A 2HMIA 2VU5A 4JI5J 1MWQA 4V1Ak 1AFIA 1RXOB 4N76A 1FWPA 2CQHA 1Y5LB 2DVIA 2GQCA 4NLRA 1RWMB 2XZWA 3EVOA 1RAIB 3O44A 4JI3J 1Z4UA 2E5JA 2EKYA 4RNOA 1N5QA 2EFPA 1TVRB 1W7WA 1RAOA 4HDGA 4M8LA 4KT0C 3MZIA 2A18A 2BYCA 2ZH6A 1RAAB 4OYWA 4DPWA 2YXLA 4Q5VA 4RW8B 1UFKA 1M1GA 2BABA 4OHZA 1RISA 3BKTA 5J2MA 2B4VA 3I0SB 2W7OA 2HFSA 2GHPA 1NSAA 2MQMA 3DRSB 3OHBA 3CJQA 2YWFA 3VWSA 2F3JA 5DZ7A 3SYZA 3MEGA 1QAXA 1ZPVA 3M05A 1TUWA 2R2TA 2DR9A 4LSLA 4DV3J 5KFEA 1Z2ZA 4B3TF 4C7QA 3ELHA 3J81j 5J2QB 3T5KA 4KV8B 1N33J 5GAEI 3JSBA 5BR8J 4K4VA 2PGCA 3OJUA 3IBCB 4ECZA 2DGQA 2MJUA 4AL7A 4AD6A 3R5AA 1TUVA 1S6OA 4CLSA 2MKJA 1PYSB 3ZTRA 4KGZB 2YWKA 2DNGA 1TKXA 3SCIE 1AUSL 4FVMA 2IRYA 1CJTA 1P8GA 4TY8B 1F2HA 4NEYA 1GMWD 3CE8A 4W92B 2CQDA 4ATNA 5HMZA 5B7WA 3E01B 2CJBA 2JHEA 4X65J 3KLVA 3DC2A 1Q53A 4NI2A 4IOCQ 4DV6J 2L41A 1X4GA 3R5BA 1FX2A 4YR0A 2VODA 4WE1A 5KFFA 2RB7A 2ZZNA 4DLGA 1RBAA 1WSVA 3W9HA 1SKSA 3K2YA 3H5UA 1X4AA 3EE3A 4KGVB 5L1LA 4ES1A 4J91A 1JLFB 2WONB 3R1HA 4WTYA 1WKJA 2CNLB 2OPSB 2GMHA 1R8PA 5K5MA 3NOGA 3H5SA 4NCAA 2M70A 1FVQA 2J76E 3FZBA 4QIVA 3AD8C 2QSWA 3ILIA 4DQQA 2LCWA 4OHVA 4IH7A 2XZTB 1H73A 2M8HA 3M8SA 3G6YA 4Y2IA 5F3ZA 4QWCA 4J9UE 1QSYA 1AROP 3B82A 1EKRA 4B9MA 5LJ3Y 3BSAA 1A7GE 3JTOA 4ZPCA 3EPIA 1S0VA 4QZVB 4RO0A 1I51B 3EDQB 1HWUA 2UXDF 3BH7B 6FDRA 1S1TB 1DJ0A 2ASJA 1XR6A 5L1IA 3MUMP 2DNNA 3LQVA 3IBFB 3M2RB 2W2NP 4Z37A 5HQ8A 2HFVA 2GQ2A 1AXQA 3M8ZA 1A6LA 1LWFA 4RBUA 1XWLA 4Y2MA 3FSIA 3ISNC 2XO7A 5D3GA 4TYAA 3QGIA 4F3MA 1Q86T 1B99A 2ZVIA 4JP8A 4OLOA 3U02A 3NCRA 4NPOA 2O3DA 4JV5F 1VHFA 2JC1A 4M5GA 2XY6A 2CUYA 1NSQA 3CO0P 1VBZA 2KXNB 3G86A 3D0HE 2VUGA 2DIUA 2J0SD 5I4MA 1SKWA 3FEXB 4KO0A 4IDKA 3A3PB 4K5SA 1KVKA 1PSDA 4JI2J 3MMBB 2CPHA 1WOOA 4N8NA 4K59A 4TKTA 1FX4A 4DFKA 1NMEB 1S1UA 1FERA 2B7BB 3BZQA 2UU9J 1DTQB 1HNZJ 2CQ3A 1WNEA 4LFAJ 1VCTA 1KTQA 2NXNA 2KVIA 4JI5F 1X9MA 4CWBA 1M5KC 4BHQA 4I6AA 5E3AA 3I5CA 1RT2A 2IRUA 3IC1A 3UCUP 2NZ4A 2Y8WA 1U6FA 5E3CA 4IOBA 2FPHX 4ZA1A 1URRA 1FDBA 4JI3F 1EX8A 2IMOA 1WHXA 3MF5A 1BWVA 3TOQA 2M2BA 4ID5A 4KHPJ 4V19J 2OELA 3DHWC 1HFEL 4Q0BA 4FP9A 3QIPB 1QM9A 3ILLA 4LFCF 1P9YA 3DGPA 3SFUA 4JI6J 5FLXU 4QPXA 1HYSB 1YJ7A 3ZTQA 3GONA 4U96A 2HAFA 4GC6A 4WK1A 1VISA 4PQUA 3PHEA 1ZA2B 4DV3F 2JEGA 2CJAA 2F40A 3G82A 4K4YA 2HHTA 3OLAA 4BBYA 1N33F 4RNFA 3WIVA 1HQ2A 5BR8F 5GADU 1IM6A 4MH8A 2I6WA 4LUBA 2AEJA 2LP4A 3C15B 5KT4A 4KSEB 1UEVA 1S57A 4F0HA 3QAEA 2YX1A 2QN6B 3BGLA 1RWUA 1IBKJ 3EGZA 4LF7J 1PILA 4LQ3A 1FWLA 4ILLA 4TQSA 3CMAS 2D41A 1LW0A 4WXWA 4NYOA 3T6BA 1KC8T 2B9EA 4P9SA 4X65F 3T5JA 3IBWA 2VPWB 4CLLA 3DNCA 2JFDA 4UOGA 3HCXA 1WDTA 2N7YA 5I3UA 4BCAA 3MFIA 1JK9B 1YRUA 3PY8A 1FT8A 2FHJA 2V8DA 4DSLA 1DTTB 3PJXA 4WZMA 2D3O1 4W90B 4KH1B 3E8OA 3HO1A 2I5JB 2HS0A 5HN0A 4KTQA 4NZ7A 3W1YC 3PJWA 1NKCA 2KFNA 3GSDA 4O3PA 4FZVA 4ICLB 4KHMA 2LEBA 2ACYA 1HHTP 4LRDA 3OV7A 2P9EA 4G1PA 2FHJD 3KLFB 4F2SA 4PEOA 2HQFA 2IVYA 1REVB 1ITPA 3MM9A 3ENVA 2DGSA 4WXOA 3SFGA 2CQ4A 2FTRA 2LXFA 2W2OP 1WEZA 1LFWA 2HK2A 4X2BA 1UA1A 3JSYA 3GJRB 1WEXA 3RRGA 3QJLA 3KK3B 2FHKA 3KUGA 1W26A 4MT1A 2VG5A 1BY9A 4QQBA 2IJFA 3ZXWA 1F6TA 1SJQA 1VJQA 5I3PA 1C1BA 1YJ9S 1UTAA 3IMQJ 3FQLA 2A1BA 3M30A 1UW4A 1NM2A 2GHWA 2OO4A 2V4QA 1QSSA 2CPEA 2C3PA 4OX6A 1YJRA 4ED7A 4F50A 3R2DJ 2A0FB 3VCDA 3OQ2A 2IDEA 1UFLA 3R6LB 1TV6B 3EYZA 3RTVA 2HHWA 4Q8EA 1SPBP 2HNYB 5CA5A 5KFZA 2R7OA 1S12A 3I0RA 1IN0A 1GXTA 2FDNA 1L3VA 2UXBJ 4L76A 4JI2F 2QLWA 1JLBA 5JMNA 2M9KA 2RQ4A 1HNIA 1RT3A 2C2NA 1PIEA 1FA0A 1R43A 2B7CB 5CD4H 1RHMB 2UU9F 3ENWA 2EC2A 1RAHB 4LFAF 3HF5A 4QR2A 4F2RA 2NREA 1GNKA 3QGHA 4MK9A 5BJRA 4KPYA 1T8EA 3UDCA 1NK7A 3BB5A 4ELUA 4NCGB 3W65A 3AQPA 3R27A 3UN3A 1FRLA 3KKFA 4E2FB 1FHTA 2GMLA 1WF1A 5L1JA 2HHSA 2IHR1 4OIXA 2DNPA 4A46A 1BMQB 4OZJA 2DR5A 2BANA 3FMBA 1MMLA 5B08A 3K58A 4KHPF 4XIUA 3RAMA 1WDDA 3R7NB 3PO4A 4P72A 4X66J 1RJJA 2JX2A 1ELOA 4JI6F 4WU2A 2XS2A 4DX6A 2OJ3A 3DLHA 2CG8A 5L9NA 2W9AA 4CO5A 2Z2LA 1TL7B 4ECVA 1BC6A 3FJ2A 1S9GB 3KFWX 4FBUA 2Q79A 3OD2A 4NLVA 2M8DB 2KZMA 2B43A 1JKHA 2H51B 1PKUA 1Q81T 4AUKA 2YPZA 2KL8A 4RW6A 3AJDA 2H5JB 2ZWPA 2FD2A 1DAXA 1J5EJ 3QWUA 3RUBL 3VGUA 3WHIA 3ZTPA 1HMVB 2H5EA 2L9WA 5C42A 1IBKF 2V2VA 2XHWA 4ED1A 4LF7F 4TLRA 1VBKA 4JB8B 3IM9A 2RQKA 1SC1B 4NLYA 2HNDB 3G9CA 1RTDB 4QJVA 1CC8A 2M5YA 1PBAA 1S9EB 3E51A 1HL6A 3A8EA 2KZZA 3CJTA 3GV7B 3R5GA 3QQCD 4WPAA 1VQ7S 4O44A 4M5KA 4MK7A 4V19X 3QAUA 2H5IB 1I5OB 3VTIA 1VQSA 5KT7A 1RBOB 1KQSR 1LQ9A 1RBLA 2AZ3A 4L3NA 1MWYA 3UNGC 1Y5IB 5FDLA 3HVTA 2I0XA 3KYLA 3OL7A 3BBFA 3RG6A 4DN0A 3KDOA 1JLAB 2D3OR 3JTNA 2NSBA 2VB6A 3Q24A 5B0BA 4DL6A 1B4SA 1TKTA 1UZDA 3DDKA 2PMHA 4WU3A 1HD1A 3HD2A 4FNIA 4DUTA 2XEXA 4ZCKA 1KEKA 4B9TA 3BSNA 1F9FA 1JLGA 1S1XB 4PXDA 2XLJA 3D1HA 1KTVA 3SCLE 1SKRA 1DZ5A 5F8NA 3CMQA 1WF0A 4LF4J 3TEGA 1R8CA 3UI3A 4EGLA 2MHNA 1NNDA 1SJ1A 3NBPB 2CPIA 1X4HA 2K1RA 3CWJA 1ZYQA 4ID8A 3KNGA 1PJ7A 2ZNZA 1Q4RA 2ZNYA 3C14A 3CTRA 3CCQS 4ZOSA 1NHVA 1VK8A 1VRTA 3IFEA 1SBRA 1GK8A 3UD5A 3BS9A 4DQRA 5A8KB 1WC5A 2WOMB 3HI9A 5F41A 3TQ1A 4HACA 2VG7A 3ET6B 1ZM3A 2F4VJ 4KYZA 1FJ7A 2V34A 3KLGB 2X7IA 4QWAA 3M2UB 2J0XA 4USWA 4YB5A 3TUJC 1H6KX 3KLEA 3C6UA 4C11A 5CXTA 2N7CA 2CFXA 2VBXA 4YEAA 1QD1A 1FRJA 5KAKA 1TKZB 1UKUA 3GIKA 3SI8A 2W8KA 3QT6A 2VJUA 2PD1A 1O51A 1YJUA 3UCGA 3OL8A 2M4MA 3T1AA 3S7RA 2C22A 1S48A 3MMJA 4ZIWA 3TRGA 2C2RA 4LQ9A 4FN5A 1U25A 3M8WA 3M6VA 3QGGA 3GR1A 5D0GA 1VMBA 2OAUA 4F0MA 3KG1A 2FJBB 5KFWA 1V9OA 2ROEA 4JOUA 1RUSA 3IR5B 2Q1LA 2RT3A 2BUNA 3G6XA 4D3HA 4ECTA 4O3NA 4KFBA 2A10A 4N8OA 2KM8B 5F0WA 1LEOA 4USHA 5EX0A 4X66F 5LOQA 2W9CB 4Q7AA 3M7VA 3R5DA 4JBCA 3MAQA 1PBUA 1EIYB 3BGUA 1WG4A 5J1EA 4ED6A 3HP6A 2B9WA 1U1QA 2ZH1A 2W9BA 4PUOB 4C8KA 2F63A 4N7TA 3C8YA 2VPZB 4J9OA 1SQFA 2XLIA 3PTWA 2YQ0A 2P9CA 3NMAA 3CJ2A 3I31A 2ATCB 2BM1A 3GV5B 1XNQJ 5HMYA 3KWMA 3QRPA 1H2TZ 2D9OA 3JYTA 2HGMA 4LIWA 5B0GA 2AF6A 5SUHA 4CM0A 3NEKA 4B9UA 4LF8J 4Q44A 2HQCA 1TUGB 3MEGB 1ZAVA 4R8UA 1J5EF 1FDNA 3K59A 1F5AA 3DRPB 2OPPB 2VBZA 2ZWOA 1RI7A 2L3MA 5L9XA 1LW2A 3QGPA 4RNHA 3W62A 2HFUA 1WG1A 2CZVC 2MKIA 1S9FA 3CC4S 3DOKA 1W25A 3O1LA 1B0VA 3M8PB 1RADB 2DK2A 3UQSA 2Y1JA 4Q43A 4I7FB 3LWLA 1TMJA 4DCJB 2VICA 3FGVA 2BKNA 4I6YA 1CJTB 2N4DA 2LLZA 3IS9A 3PV8A 4PYAA 3K0JA 3RGIA 2V69A 2UUCF 1YG0A 2AU0A 1YBAA 1GTEA 3PACA 3GE9A 1JNRB 3MM8A 3P3DA 3KK2A 2UZAA 2QX0A 1LV5A 3T1HJ 1IBMJ 4NI2B 3AH6A 3V6KA 3J80Y 2V0NA 2C2MB 2B8PA 1Y9OA 5DDRC 4O4GA 3HZGA 4WE1B 3D2WA 2YKAA 3QLHA 5KFCA 1XERA 1NK5A 3FBBA 1HNWJ 1FFWB 3NGRA 4H4OA 4A8XA 1E6VA 4HEA9 2QRRA 1FE4A 4FF2A 1S49A 3QFWA 1SH3A 1D09B 3DOMA 1S79A 4LF4F 4CRJA 3HSJA 1U1LA 2KHDA 1UAWA 4M5LA 4DG1B 2DTJA 2DNLA 1YX2A 3BDPA 3AJ1A 3H7HB 5GADI 1VYAA 3PW0A 4IG0B 2NQPA 2CRLA 1S1WB 3AODA 4DHVA 3E2EA 3BKUA 4AXJA 3EZOA 2BVZA 2F8HA 5ITHA 2LXIA 3VGVA 1IKWA 1XQIA 2FZKB 4EUVA 2AYBA 2F4VF 4WFYA
chains in the Genus database with same CATH topology
3UPFA 3HT3A 4K4TA 3LW5C 4QIWD 1U1MA 3CC2S 4WYWA 2R8HA 3OSNA 5D3GB 3CCJS 4N47A 1U1KA 3NNCA 1VC5A 2I8EA 3FSXA 3OR2A 5J1NA 1CQMA 2LA4A 5D4PA 2YNGB 2DBBA 2FJXA 4MFBA 4QBUA 2YVSA 2GA7A 4NMLA 3I9V9 5DRKA 1CEZA 3OUYB 2HLUA 3CB4A 4RNMA 1S4FA 2ROPA 4J9KA 1QE1A 2ZBIA 3LP0B 2E1RA 2WK4A 5F8GA 4Y3CA 1FXRA 4J9RA 1TK8A 1NK4A 5THWA 2A2DA 2JL9A 4HT7A 1UJ5A 1P1TA 1WHYA 2UUBF 2B9XA 3NBPA 2XCPA 3TYTA 3BEGB 1SJFA 7FDRA 3DLGB 1CLFA 1U1PA 1KOOA 1HBUA 3IRXA 2HLTA 2MZQA 1L3UA 1VC6A 2CQBA 3M9MB 3T1YF 1N0VC 3PNIA 4YB7A 2W7AA 3CIZA 4KO0B 1T03A 1NK9A 3CJKB 1VOMA 3N28A 1N36F 5J2NA 3UWTA 3THPA 3QPIA 2AJFE 2RQMA 1WELA 2XWXA 5KFNA 1FCAA 1Q1KA 3T5HA 4DS4A 4LFBF 4YFUA 3HLUA 2OPRA 2G4BA 3UD3P 1G3OA 1S6PB 4RW9B 4IRDA 1GH8A 4Y65A 1HW8A 1R3NA 5GMKa 1KD1T 1YJTA 4ILRA 5KFTA 2UXCF 1NZAA 4Y2KA 4YB6A 3P6YC 5CYMB 2ZOGA 4NZ6A 2JEIA 1AW0A 1S1UB 3R5CA 2CG4A 3KNAA 5DQGA 3LWMA 3GFHA 4PG5A 4DBQA 1T94A 2E1CA 2HHUA 3RR8A 4OI3A 2NYIA 3OVBA 2RRAA 4ETZA 2PFFB 3MGJA 1T3OA 2EW9A 4NLTA 1MMNA 1CG2A 3WX4A 2P5VA 4C97A 3BGRA 3L7PA 4PG4A 3IGVA 4NL5A 4X84A 3K5LA 1DQ9A 2Y1IA 2WOMA 1S0OA 3OR2B 2MKCA 4O3RA 3HPOA 1JLCA 3NWGA 4NZ0A 5C25B 4ZVFA 3FSYA 4PG6A 2AGQA 2QYCA 3FFIA 2J6UA 2OSRA 1RT1A 2XGQA 1IKXA 3MMCB 5CQGA 1R89A 5A0YA 1QE1B 4I6WA 2ZE2B 3PX0A 2FIUA 2DB1A 3N5FA 3KLGA 4YOEA 2E1AA 5IQ6A 3MM7A 5KFRA 1T7PA 2MQLA 3I87A 3M2UA 2LQJA 2M7SA 3THVA 2HHQA 4EYHB 3ZFVA 2J6SA 1X8DA 1SV5B 2Y1RI 1HBMA 4M63A 4TU7A 4OZNA 3FCHA 3I5BA 1XR7A 3CUNA 3VALA 5F9LA 1OIAA 1U8SA 4R0EA 3EXCX 2EFNA 1T03B 1OS5A 2HVIA 4CH0S 1V6HA 2FLPA 1MW7A 4OZ0A 2HW3A 4TU8A 2MPUA 3VF0B 2LU1A 2KYXA 1I94F 4QU6A 3CO9A 4X4OA 2BRKA 3UCZP 4ID5B 3K7RA 2BE2A 2QT7A 1TKZA 1KLMB 3RYLA 2KYZA 4LVOP 4E98A 1WG5A 2IJNA 1VK3A 2IM1A 3B4MA 5L8RC 3OTOF 3Q23A 5T7LA 3KOAA 1MU2A 2CJQA 3NS5A 5IZHA 1XMQF 1U48A 4BS2A 4Q0BB 4WF9Q 2WBRA 2IM3A 5A6PA 2E5GA 4X64F 4UQGA 1TL5A 3CMES 4HTJA 2G1DA 2LMIA 3L3CA 2MZTA 4WFNQ 3O6QA 2OD4A 4MIWA 5HP1B 2IVMA 3CGIA 5E0OA 4DQPA 3O5TB 1XNQF 4ZPTR 2VOPA 2ZH4A 2YNFA 4TQRA 2J9EA 1UP1A 1D8YA 3CCLS 4KAIA 1ZM2A 2BOPA 5KG3A 4IFVA 1SL0A 5FLXY 1Z2LA 4PXCA 2RKIA 1J5OA 3NGKA 1O8BA 4ZCLA 3M9OB 3MDFA 1C0TB 1JLCB 7FD1A 2K7KA 1MWZA 2F9JA 2Q6BA 3EUNA 3FFIB 5D4LA 4M95A 4LF8F 2RMLA 4OL8A 4CT8A 1KLNA 2IFXA 1V3ZA 2K3IA 3Q8RB 4FS2A 4WIIA 3BF4A 2HZCA 2HMIA 2FVSA 4YR2A 3P5TL 4X4UA 2DPIA 4PQUB 4K4ZA 1PC5A 2MQQA 2D74B 4WFBQ 3CEDA 1HBMB 4ZP8A 2ZDPA 1AFIA 1N56A 2VFRA 2Z2MA 3MFHA 2ZH2A 2DRAA 2OSQA 4O0IA 4N76A 1TZ0A 1DHMA 2BA9A 2CQHA 2PT0A 4FNHA 5KFYA 4DV6F 1YTYA 4A8OA 5KG7A 4L72B 3ZZ0A 1Y5LB 2DVIA 1J2VA 2CQIA 4FVCA 2GQCA 1FXDA 4NLRA 2BE2B 3AY0A 3PEJA 2MKHA 3POTA 3CDEA 5F8HA 5H9EJ 2XZWA 3U1MA 3ULHA 3O44A 4H4KC 4ECUA 4RUCA 1Z4UA 4ZP9A 5T7LB 3SV3A 1CPZA 2E5JA 2EKYA 4FF3A 4WKYA 4RNOA 1N5QA 3PDNA 2EFPA 1TVRB 4GKKF 4HDGA 4M8LA 3DLBA 1SB6A 1FXLA 1JWWA 3Q8SB 3C6TA 1VQ4S 2UVRA 4CCHA 4KT0C 3H59A 2KH9A 1X4EA 1N52B 1TK0A 3MZIA 1F60B 2A18A 2YQ3A 1ZAWA 1I6JA 2BYCA 4IFVB 2ZH6A 3VAJA 2ZHOA 2MXYA 3CPWR 3DRRB 1VFJA 2YKOA 4Q5VA 3MUVP 1R7IA 1SH2A 3OLBA 2UUWA 3ETOA 4RW8B 4ED8A 4LT6A 3HHNB 1SXLA 5KFGA 2AJ0A 3NGDA 2BABA 1NK0A 4OHZA 3Q2TC 1RISA 4ZK7M 3FDSA 3M9NB 3H4DA 2HFNA 2ZUGA 2HMIB 1N8RT 5J2MA 4DL4A 2B4VA 4NA1A 2R7SA 2LDIA 4RW7A 3I0SB 2W7OA 3PVXA 4DMZA 4G1QB 3PEHA 2B4PA 2GHPA 3NKYA 3T1HF 5DS7A 5DLGA 1FDAA 2MQMA 4OI6A 3DRSB 3CCZA 4NA2A 3OHBA 1IBMF 4JV1A 3MOZA 2YWFA 3RRHA 3OPKA 3VWSA 1X0FA 5KG5A 1FKOA 4OI1A 2RU3A 3H25A 2KG1A 4PWDA 1OQ3A 3AQOA 2F3JA 3HMJG 5I3UB 3SYZA 1GTHA 1NKEA 3NG8A 3MEGA 1U24A 3E01A 4IO1A 4U67Q 1F5BA 1QAXA 1ZPVA 3M05A 2R2TA 1GT8A 2DNHA 4LSLA 4A8SA 2DR9A 1DARA 3HM9A 2MGZA 5KFEA 3GIIA 1Z2ZA 2AYMA 2J8AA 2YNHA 3CDBA 3POTB 3BN7A 1W2BR 4B3TF 2GQQA 3CXCR 1P9QC 4C7QA 4EWTA 2KT5A 5KT2A 4Y0FA 4KV8B 4ALZA 3T5KA 5J2QB 2GO9A 3G96A 5D8HB 1JLEB 2GNKA 3G6ES 2DNQA 1FJCA 2GHVC 2BV3A 5GAEI 5EDWA 3JSBA 4A8MP 5HLFA 1HD0A 3C6TB 4K4VA 2PGCA 1NJIT 3OJUA 2CJ9A 4Q45A 4ECZA 2GGPB 2DGQA 4BWJA 4ZS6A 2MJUA 2CIMA 4XPCA 1YHQS 4AL7A 4C3KA 2B5JA 2HWHA 3R5AA 1TUVA 1S6OA 1E6YA 1RT7A 2CKWA 2MKJA 4EBDA 4QR0A 1IQZA 1X4DA 1JLFA 2YWKA 5C5JA 1D9FA 3K57A 2DNGA 2KTQA 5KTQA 1TKXA 1F5CA 3HHKA 3SCIE 5D6GA 3L7OA 3ENQA 3O2IA 5FD1A 4FVMA 4J5OA 3MAHA 2DHSA 2IRYA 1UEUA 5J2MB 2WAQD 3SSSA 1P8GA 4TY8B 4O3OA 1HWJA 3ZZRA 3MM9B 4USIA 1P27B 4FPRA 5D78A 2VH7A 3GFXA 3LGNA 3CE8A 2MZSA 4BC7A 3CC7S 4W92B 4CIOA 1U1OA 2CQDA 2YNIA 2D9PA 4ATNA 4I2QB 5HMZA 5B7WA 3G4SS 2PIIA 3TVYA 2V9KA 2BW2A 1U4BA 2IAJA 3E01B 2CJBA 4F8RA 2YKMA 1TL3A 1VQ6S 3H2LA 4LSLB 5IFMA 4EU0A 2JHEA 5DM6Q 1WHWA 2HHPA 2CZ4A 1L3KA 1WEYA 5E7OB 3KLVA 4C9DA 3DC2A 1U45A 1KSPA 2YNHB 1Z1ZA 3OVSA 1Q53A 2Z4PA 4ZCMA 1LOUA 2D3UA 3TR5A 4C8YA 5LXRA 4DOZA 3C66A 2R4FA 1QAJA 3T9NA 1C0UA 2HWIA 4IOCQ 3SXLA 2YWHA 5DDQC 3I32A 2L41A 3G8TA 2VG5B 2WB1D 1RTIA 2OIHA 1X4GA 3R5BA 3MEDA 2DCLA 2I9SA 3DU6A 3OL6A 1LWEA 4KB7A 4OJGA 4UQTA 1BQNA 2DO0A 2P6SA 4YR0A 3D5MA 4NWBA 4C8OA 2LECA 2KI2A 1I1GA 2VODA 4WE1A 1NO8A 5KFFA 2RB7A 2ZZNA 1NEEA 1SIZA 4DLGA 4N77A 4A47A 3I4HX 5HBMA 3ZZOA 2FGOA 3OW2R 1N5YA 2X1FA 1S0MA 1SKSA 4NLQA 2WHOA 3M30B 3K2YA 5F8JA 3H5UA 1X4AA 1RT7B 2ZHAA 4DR2F 3BR8A 3H98A 5L1LA 4ES1A 1JLFB 2IYGA 3GYXB 3QWPA 2VFTA 2WONB 2E5HA 2ZH5A 1TKXB 4A8WA 3PW4A 4KKOB 3R1HA 1JX4A 1H2UX 4DL2A 4WTYA 2CQ2A 1YITS 2Z8QA 3JSMB 4DSIA 4ED3A 3BDEA 2OPSB 4DR7F 1NHUA 3AAWB 1HNZF 2WB4A 5F8IA 4P2SA 2GMHA 3TAQA 1R8PA 3V6JA 5K5MA 3M2RA 1X4BA 1KQFB 3H5SA 5DGAA 2RRNA 4PXEA 3B4DA 4G1IA 1FRIA 1IM4A 1JXLA 1DLOA 4XPEA 3GILA 3OR1B 2KG0A 1RYRA 4O4RA 4NCAA 2QMWA 2M70A 2YNIB 5HO4A 1FVQA 2J76E 2WSEC 3LPYA 3FZBA 4QIVA 5KFPA 1RTJA 2QSWA 2OMOA 3DFEA 3S8SA 5DQHA 3SV4A 1L3TA 4DQQA 3ZZPA 3FRZA 3TAMA 2LCWA 1YJVA 3HHEA 4OHVA 4YR3A 4DF8A 4IH7A 4ETXA 4WZQA 2M8HA 3M8SA 3G6YA 1ZPWX 5B0AA 2KO1A 1ZM4A 3FEZA 5KG2A 4M1KA 5HMWA 4Y2IA 3I0RB 3DHXA 4EZ6A 5F3ZA 4QWCA 1NK6A 3KHRA 1QSYA 2MB0B 1AROP 4TY9A 3B82A 3IWLA 5KT5A 5CH7B 1FTRA 5EGYA 4B9MA 2JEJA 3V6HA 2G0CA 3TUIC 3H2UB 2QA4G 4F4WA 5LJ3Y 2XULA 3I5AA 2CQCA 3BSAA 4M5DB 4JV2A 4HH1A 3QO9A 4X4QA 4DV4F 1IUJA 3DYAB 3D0GE 2OP5A 3M32B 5A8RB 3T6JA 5KFQA 1A7GE 4EBCA 3JTOA 3M2VA 4ZPCA 1JLBB 3EPIA 1S0VA 2IC3A 1H7WA 1HNIB 4QZVB 4CH1A 2BR0A 1RT3B 2MZ1A 2F8MA 1HWUA 2UXDF 2C3UA 2MY7A 2ZVSA 2JOQA 3GV8B 3BM7A 4NX9A 1YJWS 2B9YA 6FDRA 5A6WA 2J7UA 4OI2A 5K8PA 2Q66A 2CPFA 4DR5F 2JLFA 1S1TB 2CYYA 1SJ3P 1DJ0A 2ASJA 1XR6A 3J7ZT 5L1IA 4QIEA 1VI7A 3MUMP 2DNNA 3PM9A 1S1VA 3LQVA 3NP5A 3M2RB 4H4MA 3MEEA 3KK1A 4Z37A 2RE1A 5HQ8A 1QLNA 2HHVA 3NCPA 2EK1A 2GQ2A 1A9NB 1AXQA 2EC0A 2IBOA 4I1TA 2C28A 1A6LA 1GX5A 1XBWA 2B4OA 1NB7A 1G1XA 3M6WA 3OFFA 4HI1A 3N9UC 4F4XA 1VQ9S 2DNYA 4F02A 1LWFA 2X3GA 1XWLA 4RBUA 3BQ2A 3VAMA 4XAKA 5KG6A 4Y2MA 3FSIA 3IO1A 3MM6A 4NLDA 2NPFA 4DPOA 2D7SA 3ISNC 5KFSA 1YGYA 3EXYA 2LVWA 2XO7A 2EFVA 3N0VA 1X5SA 5D3GA 1EETA 4TYAA 3QGIA 4F3QA 4F3MA 3KJVB 1Q86T 4IR9A 5FJ4A 2E66A 3H5YA 1N6QB 2ILYA 4OLOA 5G0RB 3U02A 1Y5NB 2EK6A 2DO4A 2XMWA 1BQXA 3I6PA 3NCRA 4NPOA 2O3DA 3MR2A 4JV5F 4DR6F 3OUYA 1IKYA 4UUWA 1VHFA 1HI0P 1FJGF 2JC1A 3LP0A 2XY6A 1ZBTA 2ZJRQ 2SXLA 2BANB 2RSQA 3NS6A 3T19A 1VBZA 4C0OC 2VC0A 2RQCA 1M1KT 4IKAA 2ZKTA 5CZXA 3G86A 2KXNB 1HBOA 2U2FA 3D0HE 3HX9A 3M2VB 4ECSA 2VUGA 2DIUA 2J0SD 2V2KA 3IWXA 5I4MA 2PO4A 4B02A 1SKWA 4I2PB 1B64A 2L9DA 3FEXB 4ELVA 4KO0A 4IDKA 2DHGA 3THTA 4RNNA 3TA0A 4K5SA 3I82A 1HI8A 1PSDA 4DEZA 2E9TA 3AB4B 1FJEB 4TYBA 4DR4F 1CVJA 4Q2MA 2VKRA 3MMBB 1S6QB 2ROGA 1ZZNA 2CPHA 1D1UA 3TNVA 1RTHA 4DL7A 1QAIA 2GX8A 1V3RA 1VQ8S 5F0UA 1S1VB 5KFUA 4N8NA 2E5LF 2CDQA 4K59A 3W2VA 3M8RA 1Q7LB 4WFXA 1RKJA 2R7UA 4B3OA 1URNA 4XK8C 4J9SA 4TKTA 2VBWA 1QUPA 4DFKA 1GXLA 1S1UA 3LO3A 2MZRA 1FERA 2RILA 2B7BB 3QIPA 4JI0F 2QA2A 2G13A 3BZQA 5KFJA 2MYFA 4USJC 1LWFB 3HVAA 1DTQB 3N6LA 4I0WA 2V8HA 5LSRA 3RR7A 2CQ3A 1Q79A 1WNEA 1ZOTA 3HFKA 3ICLA 3OXFA 4IRCA 2KU7A 3G6VA 3K5NA 1KTQA 1FD8A 4Q2LA 4PQAA 2O1PA 3OHAA 2KVIA 1EETB 5EWEA 4JI5F 4AE5A 1X9MA 1PGZA 1M5KC 5C25A 2VL1A 1HYSA 4BHQA 4I6AA 3FNNA 5E3AA 3I5CA 4B9LA 1RT2A 1JKHB 2QE5A 4QPTA 4RWXA 1IKYB 3MMCA 2ATLA 1JJHA 3GB0A 2IRUA 4MIAA 5AE1A 3FEYB 4B08A 3N01A 3IC1A 3UCUP 3W7BA 3RAXA 2ZE2A 2NZ4A 3PW2A 3CJ5A 3PRBA 4RW6B 4IH6A 5A2QY 1U6FA 5E3CA 2DIVA 2Z0GA 5GAHI 4A8KA 4IOBA 2JC0A 4NXMF 2KRRA 2FPHX 2V8VA 1HBOB 1URRA 4ZA1A 2VPYB 1SV5A 1FDBA 3TVKA 4GO5X 1UVMA 4JI3F 2IMOA 4KGKA 5CCLA 4IDKB 1WHXA 2JDJA 4I64A 1NJZA 3MF5A 3CT9A 3HKZD 3LAKA 5DG8A 4RU2A 1N32F 3TOQA 5L1KA 2M2BA 4EYIB 4Y00A 5BYRA 4CO2A 4ID5A 3OFGA 3ZZYA 1RTHB 4V19J 1R8BA 5H1SV 3DHWC 2X1AA 3G8SA 1KLMA 4YUDA 2DR7A 4C98A 1WTBA 2EI5A 1HFEL 1S0NA 1RGVA 1YVFA 4OFZA 3W2VB 2C2DA 4DSJA 1N0UA 4AXIA 1CQNA 2COLA 2ZOFA 4B3OB 3GIMA 3C46A 4Q0BA 2XSFA 4FP9A 3QIPB 2R2SA 1QM9A 2EG1A 4FF1A 2N3LA 1RT4B 5HP1A 4LFCF 1QTMA 1X0PA </