3VZIA

Crystal structure of crispr-associated protein
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
214
Chain Sequence
HMSYGVRLHVWGERALFTRPEMKVERVSYDIITPSAARGILEAIHWKPAIRWVVDSIQVLKPICFESIRRLSAASISKAIKAGRTDELVKYVEEDRQQRAATVLREVGYIIAAHFEMTDKAGPDDNVGKHLDIFNRRARRGQCFQAPCLGTREFPASFALLGDDDASDPALSGERDLGWMLHDIDFADGMTPRFFRARMVDGLVAVPPPQDGGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Crispr-associated protein Cas5, dvulg subtype
publication title Conservation and Variability in the Structure and Function of the Cas5d Endoribonuclease in the CRISPR-Mediated Microbial Immune System
pubmed doi rcsb
source organism Xanthomonas oryzae pv. oryzae
total genus 55
structure length 214
sequence length 223
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09704 Cas_Cas5d CRISPR-associated protein (Cas_Cas5)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2660 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3vziA00
4R0JA 3KG4A 4U7UK 4N77A 5H9FJ 4F3MA 5H9EJ 5CD4H 3VZIA 3VZHA 4QYZJ
chains in the Genus database with same CATH superfamily
5THWA 2ASDA 1TFYA 2H3EB 4RW4B 1FXRA 3DXBA 1FTCA 2FD2A 2BRKA 3UR3C 2BJ9A 3TJAA 5A0YB 3TW0A 4ES3A 2EKNA 2HHVA 3MMJA 3ENAA 2AJ2A 3M32B 2SXLA 5F8JA 3PX0A 3KUEA 1N5YB 1IBLF 1WHYA 3MURP 5F8HA 1ICEB 2XMTA 5L46A 1K9MT 3AY0A 3C14A 2HURA 4DV3F 4PABA 2RDDA 3DDKA 3M8SA 1N54B 1FJGF 1Y10A 2PMHA 5AJ3J 1U48A 3OFGA 2JDJA 3BGOP 4XK8C 4LFCJ 3FUYA 2J6SA 3HFKA 4QIGA 2WSFC 4LFAJ 1B3TA 2ZBIA 2YWHA 3R1LA 4Q0BB 1QUPA 5DRKA 2CQ3A 3MPYA 2DR6A 2IJFA 5ETRA 1RQ0A 1MN9A 4DR1J 4JI7J 3AQOA 4DZDA 2R7WA 1SH2A 1VS3A 1N88A 4ZMMA 1KHVA 1SCJB 1D9FA 4U67Q 4I69A 5D8HB 5J2MA 4M1KA 4RKUC 3IA0A 1WSRA 4OYPA 2CKWA 2UXBF 2W7PA 1NDPA 2B51A 4RLEA 1RKJA 1X5OA 2X3GA 2RS2A 3KMSA 4CT9A 5AXLA 5KFDA 2XTJP 4JBCA 1EETB 1JXLA 2VG6A 1PGZA 2Q43A 2FB0A 1HYSA 1DURA 3EVOA 1WDDA 2Y1LB 4LF6J 2GMJA 4FDFA 4M5DB 5KG2A 2WCXA 1H2VZ 2PEBA 1BQXA 2CDRB 2RKIB 4CTAA 3O3LA 2KTQA 1JNRB 1GMVA 2MKSA 4AFFA 4F26A 1FVSA 4JI8F 4U8VA 2M0GB 2A2CA 1HMVB 1C1CA 2PI5A 2CZ9A 3H7HB 4KC5A 1OQ6A 3PR5B 5GAHI 1CULA 4GO7X 2HMIB 4KGKA 1XR5A 3DOLB 3ELHA 4LSNA 2VFUA 3CXCR 4LSLA 2QMWA 1H6KX 2VB6A 2VC1A 3UVJA 3QRQA 3MCMA 3RB4A 2FYXA 3OJUA 2RQCA 1SJ4P 1VR6A 1U1LA 4YEAA 2BEFA 3IAM9 5K8MA 2YNHA 1YGYA 4C11A 1HD0A 4F02A 4NYPA 2FLPA 3EGVA 4ATNA 4XDCA 3KNGA 3W2VB 4L6V3 3AD9C 4RW7B 3OVBA 1EHWA 3LOUA 2DNMA 2AHOB 2JL9A 2BM1A 2ZBPA 1SUQB 2G1HA 4I0WA 1HIYA 1AYEA 1WF0A 4RL1A 4IFYA 4ZP7A 2HS3A 1Q5VA 3GG0A 3B54A 3W8GA 2A6OA 3CJRA 2DY1A 4OI0A 1RWOB 4RW8A 5E5NA 1YJVA 5A8WB 1X0FA 3JSMB 5KFCA 5F8GA 4IOCQ 1JLAB 1SJFA 2M4MA 2XWYA 2V9WA 3DMJB 3OLBA 3JYTA 2HHSA 3UD3P 2HAIA 2VQFF 1P6TA 2Y1JA 2ADBA 4KHPF 2OPSB 3CJ2A 3KLHB 4GC7A 2EKYA 2LMIA 3ZZOA 2J8AA 5ETPA 3CC7S 4FBUA 1YJUA 2QYCA 2CQ4A 1S1UB 1RAHB 1S5ZA 1P27B 3LAKA 1W7WA 3RB6A 4KJIA 1HPZB 3NWRA 3M9MB 1UVJA 2VONA 1ZZNA 3AB4B 1E6VA 3T3FA 3T5KA 5L39A 2OGUA 2V0NA 2B9EA 4A8SA 4YY3J 4ED6A 4FP9A 4UOGA 3CCTA 3G6YA 3TZZA 5HATA 2KKHA 1S72S 3KLEB 4U7UK 3U27A 3A4TA 5LXRA 1U1QA 2XM3A 5DGAA 1TKZB 2HFUA 2AKWB 3RYLA 4KH1B 2JSXA 4LFBJ 1N36F 4NEZA 4OLPA 1MMDA 4A47A 3BKFA 1VBXA 4NRUA 1TUWA 4IRKA 3EPGA 1X5PA 5I3PA 4MK8A 1YQHA 4J9MA 5HROB 4NZ7A 1R89A 2H1YA 2FJEB 3MAHA 3THTA 4N47A 5HBMB 1ZAWA 1U1PA 2B4OA 3Q8VA 4EMDA 2JVRA 5CD4H 1UVMA 4EI2A 2D1CA 3HKZD 5HQLA 4LBIA 2DXEA 4OL8A 1JMTA 2J0SD 3NL0A 1S6PB 1P1LA 1RLDA 4EBCA 1C0TA 4I7FB 5U47A 1IWGA 2UXDF 2V94A 3GV5B 2ZH4A 4RW6A 3BGRA 1S10A 4ANDA 2XS2A 1L3SA 3LP0B 1FWPA 1Q8KA 2IC3B 2K3KA 3EVWA 3GIMA 2L9WA 3PKMA 1CJUB 1FCAA 3IRWP 3KTQA 2BJ7A 1OY6A 3I5AA 3F73A 3DRRB 3FNNA 4IFVB 4C8NA 4XPEA 3CJ3A 3M1VB 3DGPA 2VG5B 2C28A 2VA3A 4DEZA 2HGMA 4RNOA 3DLBA 3CMES 5IV4A 1XMQJ 4FYWB 5L9NA 4ZHRA 2ZBQA 2AGQA 1FFGB 4USKA 3LGHA 2CDQA 2XI3A 2ZKTA 3CO9A 1UWBA 3DRPB 5KFZA 1RK8A 1K73T 5IM0B 1GH8A 1GX6A 1Q7YT 2CNNB 2KHCA 4WFXA 2HFNA 4Y28C 2WSEC 1WOPA 3OV7A 2Z2MA 3PNIA 1VK3A 4OX9F 3G96A 4OIXA 5KTQA 2XYPB 5DZ6A 1UVNA 4KAIA 1WACA 1Q1KA 5KFUA 3CC4S 2W24A 4CYUA 4OI1A 4PG5A 2ERRA 4Y3CA 2HLUA 4AT1B 3ZZ0A 1FESA 2AW0A 1X9SA 3A8EA 2MLXA 1KLNA 2W2QP 4K4XA 3MEGA 1GX5A 1GAOA 2LXUA 5GAEI 4DSKA 4ES2A 4B02A 2QFJA 1A0OB 1RTDA 2FPHX 3KK1A 1RT5B 1YRXA 3HDSA 1AXQA 1MU2B 1R8PA 3CT9A 4F4ZA 2I5JB 3I82A 4WXOA 5EX0A 2HNZA 2D3O1 3RU0A 2QT7A 4K4YA 6FD1A 1DY3A 1Q86T 1I6JA 4NXNJ 5J2NA 5E3CA 2LXIA 2W9AA 4N77A 5C24A 3J7Z5 3NMRA 2C3PA 1FDDA 4ED1A 2RB7A 1F5AA 4QIWD 4ECZA 3G71S 3CW2C 4LF4F 3FBEA 1UFLA 3OT9A 4C98A 4RBUA 1T95A 2QFIA 2YWFA 2VL1A 2R2SA 2HVZA 2AJ0A 2LDIA 1FE0A 3PW0A 3DOKB 2WBRA 1S9EA 2V8PA 3UDLA 3BN4A 5DLFA 4IKAA 4M5LA 1REVB 4DF8A 2HG4A 3M2UA 1SC6A 2LA6A 4C3KA 4EEYA 3JTPA 3SDEA 1X4GA 3ONQA 1UFKA 2A0FB 2OMLA 1KBRA 2YNFB 4LF8F 2E1PA 5KG7A 1C2PA 1HKAA 3OR2A 3N9UC 4NE9C 1DHMA 5HVHA 3RR7A 3EGNA 1TV6A 3LP1A 3IBWA 3R97A 2M88A 3TRGA 2OO4A 1Q8BA 1IR1A 2YKNB 5KT6A 3OD2A 4OZ3A 2A6MA 2B9YA 2KO1A 4GVBB 4CLKA 3QWPA 2ZE2B 2HQIA 4X62F 3GILA 5GAEU 5A8KB 1HBOB 3R5DA 3UR0A 4KO0A 1L3KA 4G1QB 2HHWA 3M8WA 1ACMB 5KT4A 4WU3A 4ETXA 1YTYA 1MMNA 4PEOA 1ROFA 5A76A 1LK5A 4PXDA 4NMLA 2M3DA 1NB2A 5IS2A 1DARA 1RAFB 2OMOA 4USTA 5HAOA 1VQOS 1N5TA 3KJVA 4ZVHA 1HWJA 5LL6d 5CH7B 3EUNA 3K59A 4RW9B 3TUZC 1CJVB 3PW5A 5KT3A 2MJUA 1GMWA 5DETA 2WONB 2M8HA 2OD6A 4AQYJ 1URRA 5D4NA 3GFXA 2Z0GA 3EICA 4PUOB 3MF5A 4DFPA 3HSGA 1WEYA 1RBLA 4FNHA 2PD1A 2QRRA 3BN7A 2HIYA 3HHKA 1P8GA 2BBEA 2DRDA 4DUYJ 4A8OA 2J9CA 5T41A 1HHSA 3EJMA 3HHLB 2XHCA 4JV5J 3GYGA 2MZJA 2UUAJ 4XDDA 2XCPA 4QWBA 2FC9A 2QLWA 1RU2A 3PHTA 4X4RA 3HK2A 1YJNS 4B3MJ 1RTZA 1M90T 3EYZA 3KLIB 4V1Ak 1T7PA 2X1FA 4YB6A 1SJQA 2YKMB 1X8DA 4TY8A 5I3UA 2G0IA 1VQ5S 2E5IA 4DV7J 5L1LA 2HQ3A 4LF9J 4FS1A 5KG4A 1M5OC 4Y2KA 1CPZA 2YPZA 2MZRA 1S7IA 1RT3B 1M5SA 4JYAF 3NS5A 1G2EA 2MQ8A 1SQGA 4WK3A 4MKVA 4WFAQ 3DDNA 4PYDA 4NEYA 1SIZA 4DR3J 2MMYA 3FQLA 1RSCA 2MKYA 2CQDA 1CVJA 1PC4A 4OI6A 3DRSB 3MMAA 1RADB 3E01B 3TNVA 2EC0A 4DL5A 1U0HA 3NAIA 3M8RA 1KQSR 2ZH3A 1WC5A 2BJDA 4CO4A 4NLDA 3TJ9A 4O4GB 1VRTA 1VC5A 1FRHA 3M9OB 3Q89A 3FMWA 1S1TB 1G3OA 2BMBA 4MK7A 3I9V9 1UVLA 3W66A 2XULA 4IH5A 2UV8G 3TZWA 1JNZB 1ULRA 2F3JA 1CC8A 2Z2YB 2E7VA 3MUMP 4I2QB 5A8RA 2E5HA 2OSQA 4LFCF 1X5SA 3PVXA 3P45B 3SBMA 5J2PB 3D0HE 2D9OA 1Y3KA 1Q8IA 2P5VA 1RWKB 4ZS6A 3PEJA 2XZDB 3T1HJ 5L1IA 4MFBB 2BOPA 4LFAF 5J1EA 4WFBQ 2DXDA 1J5OA 4JI7F 4DR1F 3H4BA 4WWSA 4K4ZA 2EFPA 4AD6A 2XSJA 4DQRA 3DLEA 4HI2A 1QSYA 1S1XA 3QLHB 1R0BG 2A3JA 3MEEA 4BCAA 4CM2A 4LR7A 4K5RA 4DQSA 4NL5A 4GMKA 1Q4RA 1ZPWX 5F3TA 1BXNA 1TL3A 4OJ3A 2BUNA 4UOHA 4IUFA 3MXHP 1R3NA 2YNGA 3CJKB 3UPFA 5AXNA 3TARA 1W2BR 2WB1D 2MQQA 3CPWR 5ETNA 4LF6F 3MEKA 4C8KA 2DGVA 3FFIA 4LQ9A 2RSQA 4CH7A 4X65J 2HNDB 5LSLA 3CTRA 3CCSS 3EE3A 1UPPA 2XMVA 4HLBA 5E3AA 5C25B 4KQZA 4TLQA 2ZH5A 3DOMA 1P9QC 2QO3A 2ASYA 1LEOA 2MZSA 1RWXB 5I42B 2DHXA 4DQIA 4F4YA 2KXNB 2L9DA 4M8LA 3R2DJ 2LECA 3I0RA 4U7UD 2FIUA 4FF4A 3PJXA 2ZWOA 3AA9A 1R8CA 4QWDA 1FNMA 4DUZJ 1NK8A 2CXEA 1AUSL 1C4AA 4P71A 2UUTA 3HVRA 2V63A 2LA4A 4J9LA 4K4SA 1FRKA 2Q79A 1M1GA 3AODA 3IC1A 2BX6A 5EWGA 1IKVB 3R5JB 2KN4A 2JWNA 4X4SA 2WRMA 1FDAA 2OTLS 3GJTB 5A0YA 4C0OC 2ZM6J 3QT6A 2HVIA 1QVFR 3M32A 3R7SB 3W5YA 1FNOA 1QM9A 3M7VA 1N5YA 3TX0A 3I0SB 3JS9A 4CLSA 1FXDA 4OJGA 2XLKA 2N7YA 2YVSA 4KRWA 3K5NA 5HK4A 5AXMA 2H5EA 3M05A 1PAUB 2FVSA 1IXKA 3M2VB 1S48A 4DU8A 3KKFA 4WTOB 3D68A 3L7OA 4DR2J 1FK9B 2CG4A 3SYZA 1NPPA 2ZBRA 3ISNC 2CPEA 1SV5B 4Q0BA 1OYEA 3UFCX 1Z4UA 3TAPA 5K5MA 5FJ4A 1T3OA 4ED8A 2W01A 5D6GA 3D9BA 3M2RB 3SIPB 2C3OA 2E1MC 2QA4S 1CJKB 3RUBL 3HZEA 3R27A 1YDLA 3C6TB 1HARA 1F0XA 2RJZA 5G0RB 5C7PA 3HO1A 2V8VA 1JJ2R 3WHIA 4I6YA 2ROPA 3OTOJ 4ZA1A 4U9RA 1VCTA 2OEJA 1EETA 2ZBCA 3ET6B 3EWGA 5D4OA 4ECUA 1H7XA 3ENVA 2Y8YA 3O1LA 4M5DA 4IQXA 4B9UA 3NEKA 2RKIA 4O0NA 3QO9B 4DCOB 1EJ7L 3RAXA 3H2UB 2ZD1B 2PE8A 3GR1A 4A8WA 1OY8A 3DLJA 3R5CA 1RCOB 4YY3F 2H4YB 4CLTA 5F8MA 5GADU 4X4NA 2G4BA 1HMVA 3KDOA 3R2CJ 2BJEA 3CCMS 4PXCA 2OAUA 4ZVUB 3DGVA 4I6WA 5F0WA 4F3QA 2HBQB 4DG1B 2I38A 4P73A 8AT1B 3J81Y 3QMQA 4C8ZA 1XN9A 4OX6A 4P2FA 2BW7A 4PG6A 3DOLA 1HWLA 4LFBF 4FF3A 2CPIA 2B56A 1WELA 4N41A 1LWCB 3BREA 4KY3A 4QW9A 1ZAXA 3C46A 4NLSA 4ECYA 1XNQJ 5IOLA 1BQNB 2LP4A 3ZNUA 1AT1B 4DR5J 1PJ6A 1X4CA 2VICA 1TL7B 3PYEA 5D15A 2KH9A 2DIVA 3CULA 4PZVA 1VHIA 2G9OA 3EPIA 4TQSA 4ECSA 3LWMA 4WZMA 2QLBB 3R5BA 4RW7A 2A2DA 2NXUA 5EDWA 3TYTA 3ZZRA 3JSBA 1T3NA 2HQFA 3FRYA 3V5RA 2E9ZA 2VKRA 1SUQA 3AJ2A 2KG1A 3RRHA 3X1LB 1ZH5A 4XPCA 1IKWB 4KTQA 3MPVA 2CNLB 4KH0B 3D1OA 2PIIA 3LO3A 3OTEA 2FLNA 1N32J 3NOCA 2BOAA 3UDVA 3KHGA 3BSAA 2F9JA 2ZEJA 1HA1A 2CYYA 3T6JA 2FJAB 1NO8A 3JSMA 1XNRJ 3EXYA 2CQ2A 1JLAA 3CCRS 2FJWA 1OO0B 3GQCA 2L08A 4UUXA 2CQPA 1SBRA 2KM8B 4ZKAA 3ETMA 2YWWA 3HCXA 1XMQF 4PYAA 1T03B 4NWBA 2GZOA 4JOUA 2OPSA 5IT9Y 3KLHA 1RI7A 4YB5A 2JNJA 2CAJA 3GP9A 5ETKA 5B08A 1RAGB 2FHMA 2DEJA 2DGQA 2LQ9A 2HZCA 3VALA 1RWWB 3AXKA 4F2RA 3C15B 4N5SA 5CYQB 4H54A 3GMGA 1HPZA 4OHWA 2CNKB 1O8BA 5KT2A 4DLEA 3H25A 2LEAA 1TL1B 1B0PA 2XY7A 3UN2A 5F3ZA 1EX8A 4CP5A 4F25A 4QQBA 1X4AA 4OYAA 2NCKL 3DC2A 4CO0A 4NRTA 4BDPA 2XB2D 3KLEA 2DH8A 3RJMB 4A4JA 1FD8A 3VTIA 1R0CB 4PAAA 2NSBA 2E5LF 4PCQA 1XEZA 3PZPA 3DI6B 5HROA 4DFJA 3JB9k 2HS4A 4ECQA 3QSYB 4NXNF 2Z2LA 4NA2A 2HWIA 3I9ZA 2N4CA 5MLCV 3ZZTA 4Y6IA 5HBMA 2ZZMA 4B3TJ 2HFSA 2C1EB 2EFQA 4ED3A 2MQLA 2DNKA 2OPPB 2C2DA 4DLGA 3FSXA 3T9ZA 2DHAA 1M0SA 3ZNJ1 1S6PA 3EXCX 5KFPA 4I7FA 1WG4A 2YX4A 2D9PA 2DNHA 2P6SA 3V6DA 4JP8A 1NK5A 2WVCA 1RHUB 3LP0A 4WZQA 4RNNA 2IC3A 2QA1A 1RABB 1CJUA 2NXJA 3PFOA 3K0JA 1FTRA 4DJBA 4WKYA 2VFTA 3FZ2A 3HSJA 3DRRA 2DXFA 4IFVA 3M1VA 2VG5A 3BZQA 2HAFA 4B17A 1ZM2A 5KFAA 2MJNA 3HJVA 3ICLA 2KT2A 3FSYA 3MPUB 4KHRA 2OFGX 4RX6A 3Q8QB 1MWQA 1OPZA 2HZVA 1S4FA 2YWEA 1HNXJ 3OL6A 1YZ7A 2RUSA 2VJUA 1TKTB 4ZP6A 1QSLA 3PYGA 3VVUA 2IYIA 3EX7B 2AEFA 4PQAA 3DRPA 5IM0A 1G7CB 4X64J 2XY6A 2ZDPA 3ADAC 1VRUA 4Q43A 2QL7B 3B82A 4CCHA 1TUGB 3MOJB 2VOOA 2D69A 1WEZA 1KN6A 1KC8T 4K4VA 4ED5A 1RT2B 1FDBA 1PJ5A 2B8PA 1W26A 1CQMA 1V6HA 3HJFA 3CSKA 2HZAA 2MDAA 2CWKA 3N6MA 3CWJA 4L73A 1QAXA 1I3OB 4OI2A 1Q81T 2HGLA 1RT5A 4A8FA 1MU2A 3UD5A 5EWFA 3GJSB 2I5JA 4DUYF 1S77D 4TYAA 3I4PA 1JB0C 1GTEA 3L09A 4WP3A 1S57A 1S7HA 4JV5F 3PRVA 2UUAF 1TP7A 2CVEA 4C3MA 3QYYA 4DL6A 2R8KA 4KPCA 2ZOMA 1WOSA 2QZ8A 1AROP 4Y65A 1IR2A 1J27A 2RT3A 4B3MF 4Y2AA 4QPXA 5E2QA 4U7CA 4G1IA 4CO2A 3DOKA 8ATCB 2IIHA 4JI0J 3BV8A 1CC7A 4Z7YA 5LMNJ 2RUGA 3Q2SC 4QZVB 1REVA 4NX9A 4FF2A 4ZIVA 4LF9F 1B99A 1N0VC 3B6BA 3L9ZA 5KT7A 1S59A 4USHA 2OJ3A 3LP2B 1LW0B 5A6WA 1T05A 1VBZA 3BS9A 1WC0A 2CADA 5IC4B 2J0QD 3SCKE 2YNFA 2OPQB 5KFXA 2Z2ZA 2MYFA 4P2SA 4B9TA 2BKNA 4DR3F 3I96A 4Y2CA 1I5OB 3O2IA 3EGWB 1MROB 2BW2A 1GMWD 2HKEA 2DHSA 3R1HA 1U8WA 4PWUA 2YKNA 4A8MP 1FXLA 5BYRA 2GQCA 2ZE2A 3HHDA 2NSCA 4RU9A 1QVGR 4XAKA 3E51A 4E2FB 1HBOA 2WBMA 3OFEA 4F67A 4C6AA 4G1QA 3DLKB 1DJ0A 4NCGB 4LF1A 1FO1A 1LFPA 3WDOA 2CQ0A 2MQOA 1MG7A 5H9FJ 3ZZZA 1NH8A 2CWXA 4IR9A 1RXOB 3HVTA 4KKOB 3F0NA 2QL5B 4MAKA 1Q0NA 1A9NB 1NK6A 2NXEA 5EGYA 5D4LA 4YR3A 2B8QA 4ID8A 4RW9A 3PW4A 1CJVA 1IBCB 1OSDA 2WONA 1KTVA 3IAS9 3MR5A 2CJAA 1G6BA 1YWXA 1RTHB 4QYZJ 3CDUA 4RUCA 4NA3A 4PUOA 3HFVA 3DYAB 2RD5C 3VZHA 2BA9A 4YN3B 3T1HF 4FPRA 3EZ5A 1K0VA 4PWWA 2AP6A 4YUDA 4DSJA 4V19J 2GMHA 2XZWA 2DT9A 4GKJJ 2FQQB 4PRFA 2UV8A 4MIWA 2FJBB 1YK9A 2WK4A 4UY85 2FLOA 2VU5A 1FKOB 2UU9J 4I64A 2EWHA 4IG0B 3AA8A 2VQFJ 4L76A 3PXGa 3M30B 5AE2A 2JX2A 2XMWA 1VQKS 3P49B 2P2CB 2NUHA 2AEJA 5KFOA 3Q2TC 3KLIA 5H9EK 3ILIA 1SKWA 2YKMA 2ZH8A 1ZS6A 2R3VA 1MWYA 2IVFB 1DBDA 2UXCJ 4X65F 4F4AA 2COLA 4MK9A 1F5CA 4NI2B 1UW4A 2ZUAA 4NOHA 4DHVA 2ZH2A 1ZM9A 3KLGB 1WHXA 4LF2A 2DHGA 4DPTA 4MIAA 4I6AA 1APSA 4CLLA 2HVDA 3DN9A 3H2VE 3TAMB 1X4EA 2FHJA 3T5LA 2HHQA 4JI6J 1JLQB 3SEOA 2QLFB 5KFFA 1Y4ZB 4C2MA 2DRAA 3DRSA 1P9YA 3EMTA 3RRGA 3E01A 3H40A 5C5JA 2W4PA 5E0OA 2HRUA 3NGSA 2VBWA 2WOMB 4E98A 4DUZF 4QWEA 1KVIA 4H4KA 3WC2A 1VLYA 2GVZB 3U02A 4O4GA 5DO2A 5JVHQ 1L3TA 2X3DA 4RUBA 2VPWB 2X51A 3VZIA 1M5KC 5T14A 1S1TA 2HHUA 1U2RA 3ULHA 2C2EA 1WC3A 1X7VA 1NCLA 3OVSA 2ZM6F 1RP5A 4RNFA 3PRDA 1VQLS 3OTBA 3HFZB 1B0VA 1Z1ZA 2DYAA 1U1NA 4MTPA 2DHHA 1ZTTA 4J9SA 2IM3A 4WCEQ 4X66J 4EGLA 1BWVA 3N79A 2LQ5A 3MMCA 4WTYA 1GMUA 1FJ7A 3OTDA 3PX4A 2BACA 4QPTA 5SZTA 2UXDJ 2X1AA 4DZ6A 4DN9A 5J2PA 4DR2F 2RE1A 3Q24A 2Z56B 1UFWA 3PTWA 1VC0A 4LF5J 4MFBA 4X4PA 1X31C 1JWWA 1GXLA 2GVDB 3UN3A 2I6WA 2H54B 1XJWB 3MCNA 1UVKA 3BPSP 1ITPA 3SCJE 1K0TA 1NBEB 3BGFA 1N5VA 3QLHA 2BZ2A 4WYLA 1RZMA 3H98A 1HHQA 1KOHA 4BLGA 1IVZA 4PPDA 4NLXA 2G0JA 3DLGA 4FF1A 9RUBA 3H90A 3BQ0A 3BEGB 3QRPA 4H4KC 4L72B 3VGVA 2PDAA 4K2XA 3OTOF 3S6EA 1MNEA 2PA8D 4DV2J 1PCAA 1WHWA 1UP1A 2NPIA 3OL8A 3Q8SB 5HN0A 2B3TB 4CRJA 1U1MA 4EZ6A 4FN5A 1BHNA 1U47A 3IWNC 2HNDA 1AZSB 1VI7A 1S6QB 5CABA 3CUNA 3WIUA 3TEHB 2EG2A 4QJVA 5C25A 3PYDA 4J9OA 1NJXA 1REGX 5I42A 1U1RA 5ETVA 2ADCA 3WC0A 1SJ1A 3TUPA 5B0FA 2NQPA 3RBXA 4OHZA 2KDOA 2JOQA 2DH7A 2V5HG 3IR6B 1YI2S 2XWXA 1VBKA 1S1WB 1WC6A 3QZ8A 3BSOA 5D0RA 3F44A 3HKWA 4IOBA 2ZNZA 3CJQA 4DR5F 1WC1A 5HQ8A 3QJJA 1QE1B 3QWUA 2HYIB 4WE1B 1IBKJ 3OBIA 3HHNB 3I55S 3VQSA 2NXCA 3HVAA 2VF3A 1N33J 4IDKB 1QSSA 2GO9A 3Q83A 2PA3A 2X7IA 3GJRB 1EZZB 1M1HA 1PYOB 4GVLA 2G1DA 1ELOA 2BR0A 3N6LA 2XMKA 2QG9B 3GPAA 3OLAA 3M2VA 2GW8A 2AYEA 2WSCC 3GG1A 3K5PA 1FK9A 2CA9A 1N32F 4CH0S 4AL5A 2R42A 2GO8A 4OX7A 1SV5A 4C48A 2Z4PA 2XLIA 5BYSA 2DNGA 1JLCB 4Z2XA 3C16B 3M2RA 1XNRF 2FUG9 4DL7A 1CJKA 2EBGA 2KZMA 3MM7B 2GHWA 3PW2A 3C6TA 1UZDA 1Y7PA 2HWTA 5G0RA 4DSEA 2M5YA 3MEDB 4BHQA 2XS7A 2Z30B 1O5JA 3C66A 4ZVSB 3RW7A 2F9DA 2WHOA 1FT8A 1LFWA 1S49A 4WXWA 5GAGI 4HTIA 3UW1A 2WVFA 3EZOA 3VAKA 4CZCA 1K44A 4PQUB 4X2BA 5CYMB 1PG5B 2FVCA 2CPHA 4F4WA 4OYMA 3DM2B 4NASA 2CQHA 2FVQA 2ZD1A 4NLOA 2D3ZA 4EYHB 3MR2A 3DXSX 1N48A 2BE2B 1UMJA 1WUUA 4TNOA 3ENQA 2XG8A 3GZ7A 2F65A 4JI5J 2E66A 5IQ6A 2CQ1A 3FSIA 3QAUA 2HQCA 2V9KA 1PBUA 4DG1A 4HT5A 4OLOA 1X4BA 2OUGA 1VLOA 4WIIA 2JC1A 3A13A 4QIVA 1OSCA 3ISZA 4ECVA 2I1RA 1LWCA 2IAJB 5I3QA 3GU0A 1TZ0A 2AYBA 4ZPBA 4ANCA 3OR1B 4X4OA 3NGUA 1TL4A 2IRUA 1TL7A 3GTYX 2GMLA 1IUJA 5EX3A 1EIYB 4B3TF 5J1PA 2ASLA 3R7BB 2DR9A 3AOBA 2MSTA 1D8YA 5KFQA 3IN5A 1TK0A 2J8SA 2IBOA 3KJFB 1TAQA 2IA6A 4M5IA 1Q8LA 1KQGB 3G4SS 2DRBA 2AT1B 2KJWA 3VQTA 2JC0A 4DX7A 1IKWA 3S01A 3J7YI 2YXLA 2J7UA 1HNWJ 3NS7B 2UVRA 1NJWA 2F4VJ 2BDPA 3CVKA 3H5SA 1NDCA 4JB8B 1HNIB 4OFZA 4CLPA 2IDLA 3FC9A 5JJBA 2BQ3A 2HK3A 3PM9A 3P96A 2K3IA 5DLGA 4DU7A 4IRDA 1VK8A 2DR5A 1RT4A 3LUYA 3QZ7A 3VAMA 2EFOA 1RU1A 2HHHJ 5HMWA 3SSQA 2ACMA 2DGUA 1HNVB 3P3DA 1T03A 1LWEB 2MZTA 1D09B 1NSKL 1HNXF 4C9DA 3ZXWA 1X0PA 1RISA 1WORA 7FDRA 5LXYA 2R8GA 3C15A 2MLYA 2MY7A 1S0VA 5CYQA 1HYSB 2BKOA 3TP2A 3PO5A 4OZ2A 2BV3A 4OJ1A 4PG7A 4X64F 2C2KB 3OTCA 1CLFA 3IR5B 1TL1A 3CCES 2LQJA 4CQ1A 2IM0A 2W2NP 1R27B 1JLFB 3D0GE 4KGXB 2DCUB 3I6PA 1PAEX 4RPFA 2QTWA 1A7GE 4OYWA 4R0EA 2D74B 5L1JA 2O67A 1FWKA 5KFLA 4X4UA 1X4HA 1KR4A 1S1VB 2DTJA 3IG1B 2ILZA 3G82B 1D8ZA 4C0HA 4CH1A 3W61A 4V19X 4LSNB 4R5PB 3JQMA 3DI6A 4LBPA 1TAUA 1HBUB 2DNOA 2W8KA 2HVEA 1SL0A 1RACB 1NHUA 1UA1A 1VQYA 5KG6A 1IWAA 4Q8EA 3LF0A 2HRYA 3JTOA 2Z58B 2D7SA 3PR4A 1X9WA 4LRDA 3AAWB 4B9MA 3J81j 2OI2A 3NAHA 3UCUP 4PWDB 4J9QA 2BRLA 1LXJA 1JJCB 5KG5A 1NPRA 2OPPA 4DPXA 4CWBA 4JI0F 3K8VA 1HQEA 3G8QA 4NZ6A 3NP5A 5LMNF 2MQPA 2ZH7A 3OXLA 1V5IB 4FZVA 5E41A 1XMOJ 2HBYB 3H5XA 4DL4A 2C3UA 2HIQA 2AJQA 4ZP9A 3D5MA 5ETQA 1X4DA 4ZVTB 3QGIA 1H2TZ 4LUBA 2H9ZA 2RMLA 1M5HA 3KK2B 4NZ0A 1AFIA 4FS2A 4ZVGA 4LF7J 4L3NA 1I51B 1OIAA 3RAQA 2C2MB 1JXVA 1HI0P 1U7LA 2W7OA 4JI1F 3OUYB 1KVJA 3H0PA 4DR7J 3SSRA 3T5HA 3L95X 3MTJA 4F0KA 2V4QA 4ZPVR 1TKTA 3CCZA 4B3OB 5HLFB 3H42A 4IOAQ 2NLWA 3BDEA 2ZZNA 4K59A 4OZ1A 2AWZA 1F3FA 2PEHA 2DGXA 2ZH6A 2C22A 3AD8C 3BH6B 4K0KJ 1UA0A 3NKYA 1HHTP 1KVKA 2UZAA 1HBMA 5IT0A 4J37A 3ZZPA 1KS2A 2LU1A 2B43A 2FHKA 1RT2A 5KFTA 2RF2B 2GJFA 4E0DA 3ENWA 3KLFA 4I2PB 1HBNB 3LA0A 2RILA 5HI7A 3AHPA 3U7JA 5L1KA 2FZKB 5RUBA 1RBOB 2AX0A 2VPYB 2DD8S 3FCVA 4GKJF 2RU9A 1NK4A 4WJBA 2UU9F 3AQPA 5D4PA 3L4BC 4OV6A 3EGZA 1VQSA 2AIRB 5GAHU 2WZ1A 1VC6A 1SJ3P 3NCQA 1KHWA 4W92B 1WF2A 4ZPDA 4OZLA 2EW9A 2AMCB 2C2ZB 3NG8A 4O23A 4NCBA 4DV5J 1U02A 2UXCF 3KG0A 2FY1A 3CMQA 1C0TB 1RWPB 3PW7A 1RE1B 4OZJA 4PXBA 1J5EJ 1LW0A 5D0EA 1PJ7A 4DCJB 2ZOGA 2B7CB 5IC6B 2RDIA 4WFNQ 2OPQA 4JI6F 3PCOB 1WTBA 1MSWD 2E9TA 4ECXA 4KV8B 3TR5A 4F4XA 3GIJA 1MROA 1HL6A 5IQQA 2OELA 3QT5A 3CJ5A 2DEIA 1DTTA 4KHMA 3NGDA 1PILA 3SSSA 2MKHA 2YKAA 1CJTB 2RDJA 4F04B 2IY5B 3G87A 3D67A 4A46A 4D3HA 4IG3B 4LSZB 3RAMA 1Q82T 3JSYA 2VH7A 4PPZA 1FRXA 2GGPB 6FDRA 5KFWA 3RW6A 4ILRA 3HHLD 4CT8A 3D28A 4IR1A 1TTHB 2DGOA 4K4UA 4ZVEA 3VF0B 2EK1A 1PYSB 3D3CJ 4X66F 2W2OP 5GMDA 1NH7A 4DR6J 5ETSA 4QIFA 2Y3YA 2R7TA 3UCGA 1K47A 2GIQA 4C97A 4FXVA 4LVOP 3IM8A 3RRKA 1CQNA 3BO4A 3DYAA 1H7WA 3DU5A 2NUUG 3PY8A 2QL9B 3W7BA 5FIIA 1VQ8S 4LF5F 1GNKA 2R7UA 4OHYA 3SI8A 2LVWA 2LQBA 3WX8A 4A8YA 2GV1A 4ZJLA 3R3TA 3T6BA 4TKTA 1ZA2B 3N0VA 4USJC 2JH3A 1AW0A 3FEYB 3TWZA 3EDQB 2BQUA 2FHJD 2RU3A 5ADZA 5HSPA 4IG0A 3PACA 1S12A 3NBPB 4OJHA 1TMMA 2DR7A 2KJVA 3M30A 3HXMA 3HD1A 5CXTA 2GCFA 1KLMB 2FVRA 3MM9B 5LT5A 3RBEA 4DV2F 1UJ5A 4Q5VA 4YQWA 3NLCA 4R8UA 4Q2LA 4D3GA 1T9XA 2PMZD 2F7VA 3AJ1A 1NNDA 2RIJA 4NI2A 1DZ5A 2LDYA 4IO9Q 4TY9A 1YZ6A 3K5MA 3A8KA 1IR0A 2NPFA 4YS2A 3KLGA 1WSVA 4F2SA 5F8NA 2JFDA 1VQ4S 4WPAA 4ED2A 4PG4A 4A8XA 5T7LB 1TVRB 2HWHA 1RTIB 1B70B 2XMMA 3TAMA 3M8YA 1C1BA 3PJWA 3DU6A 2BJ3A 3HULA 4FXWA 1JLQA 3OR2B 4RUHA 3VHQA 4YHHF 3PDNA 2AGPA 1HWKA 1TV6B 1SL2A 1HQUB 4ER8A 1U1OA 2J9DA 4EO6A 5KG3A 1XMBA 3B4MA 2OKQA 3SQGA 2A10A 2E5LJ 2WOMA 3C6UB 1K1QA 2IMWP 1VIOA 3WZ0A 5JUMA 3MUTP 4O3PA 2GVZA 2WVBA 1SH0A 2B6AB 1VBYA 4R25A 5HQMA 3T5JA 3OL9A 4ED7A 2IVMA 1IBKF 2FZCB 1JJHA 2ZFHA 4WKRA 3J7AN 1EQMA 2MB0B 2KXHA 3R6GB 2R4FA 2JLGA 4ES1A 4W98A 5B0CA 3H5YA 1N33F 3SQOP 3Q22A 1S0NA 1UCNA 3QFHA 4Z37A 4ZJQA 1UW9A 2Y1RI 2N7CA 4ECTA 3MFHA 4ICLB 2LQ8A 1D3WA 1MW7A 3W60A 4UQGA 3G9CA 3NS6A 1YSJA 1ZOTA 2HEKA 4G6VB 9ATCB 2R2UA 3CCWA 2F5GA 4BC7A 4PR6A 1GQEA 4KFBB 2JLEA 3LGNA 3JQKA 3PHEA 2JJ4D 1C4CA 4HDGA 1FEEA 1NRKA 1IM4A 5B0BA 2CQBA 2KYZA 2ASJA 2IA0A 4QOTA 3J80Y 3DRXA 4QWAA 3PIOQ 1OQ3A 2CPXA 3LALA 1FEHA 3UWTA 4ZN3A 2B7BB 3A8JA 5B09A 2H48B 1S9GB 2UUWA 3UNGC 4O44B 3SFGA 2CUYA 2OPRB 1U6ZA 1VHFA 2DH9A 2KT3A 1S9FA 1WHVA 4QW8A 3AXMA 4JV1A 2LLZA 1SC3B 1C0UB 3BGUA 3ZZYA 5I3UB 2VQEJ 1NKCA 1AZSA 3OHBA 1VISA 3K57A 3VWSA 1NHKL 1S4EA 1HQ2A 5JXSA 1N6QB 1BE4A 3MD3A 1RBAA 2R7XA 4NLTA 2QMXA 1NSQA 4JI5F 4M63A 2MY8A 4ILMA 4DBQA 4RWWA 3ZC4A 1NDKA 2ZVIA 1Y5NB 4KYZA 2CJ9A 3IGNA 3HSDA 4NLRA 3P5TL 3BKUA 1D9AA 3W9HA 2W7AA 3J7A1 3N01A 1NJIT 2O01C 3KDNA 3RR8A 4N8OA 3H20A 4L3KA 2G2YA 5C42B 1VRTB 4M5HA 1QE1A 3IP0A 4H4OB 5AE1A 1IJEB 4EO8A 4LREA 3R5GA 4WYWA 1SKSA 2XNQA 2OIHA 2P9EA 1LWFA 4B9NA 3QATA 3R7NB 2V2ZA 4OZ5A 2GNKA 4ZVQB 4F50A 2LYVA 4IDKA 3IBFB 4HH1A 2R8IA 3UO0A 5KFJA 3D1HA 4O3NA 1KKHA 4W4MA 2GAGC 2VIHA 2B4VA 3S1TA 1WEXA 2HSEB 1IQZA 1VJQA 1NPKA 1HNWF 1T02A 3A1YG 1R43A 1QD1A 2F4VF 1R7IA 5KFEA 3SMZA 3OVAA 5KOXA 3KXDA 1SQEA 2YKQA 3BB5A 2K1RB 5H1SV 2MXYA 3KK3B 1F2HA 2CJYB 4HI1A 2CRLA 2V8DA 3OXFA 3C16A 5HP1B 2CPDA 3MM7A 1UZHA 2HHHF 3MEDA 2FJDB 3CDAA 1TL3B 4HHJA 2GQ2A 3POTB 2CJQA 2J6UA 2R7VA 1U2FA 4J9VA 1AA1B 5DZ7A 5MAOA 2OH2A 3M9NB 4CO5A 3MDFA 5CYMA 1SVDA 2XMAA 2AD9A 3O5TB 3DM2A 2ZWPA 4OYOA 4ELUA 4M5GA 2CJBA 3KYLA 3U1LA 2OEMA 1JLBB 2MEWA 4DX8H 4ANEA 3TA1A 3VCDA 2CFXA 4EBDA 2YH1A 1FKAF 2F4FA 5L38A 1SKRA 4G65A 2BE2A 4LVNP 2HHXA 5EUHA 2HHTA 4DX6A 2EBEA 5D77A 4YR0A 4M5JA 4IO1A 4HTJA 5DM7Q 3QAEA 3RZAA 2KU7A 2XQCA 4UZCA 2AEMA 3N6NA 4UW2A 2IVYA 8RUCA 1RDRA 1LK7A 2IM2A 2IBKA 1XK8A 2IAJA 2GHVC 3MM8B 3C8YA 3OR1A 2FC8A 4FXDA 1B0TA 3CD6S 1Q79A 3QJPA 4RBVA 1WKKA 4CNYA 2J0WA 1T0TV 1F9HA 1WOOA 1R8BA 3MPDA 3OJSA 4DUTA 1VGYA 2HBRB 2PC6A 1FWLA 3NRBA 3P5BP 4P2MA 1UVIA 3O8WA 1T9YA 3BJYA 5CD4A 2DGSA 2J6TA 4HACB 1XMOF 2V6AA 3GFHA 1MWZA 1FFSB 1LWXA 1JJ4A 3A3PB 1QAJA 1HNIA 2ALZA 1RT1B 2VJVA 4ELVA 1J2VA 2Q6BA 1SC1B 2R8JA 4ED0A 3TX8A 2ZC3A 4IQMA 3LTOA 2J76E 4LF7F 4TYBA 1U49A 1HD1A 1WKLA 3I5CA 3H59A 1IKXB 1EARA 2B9XA 4FYYB 5J2QB 2ABYA 5FD1A 3CDWA 3BR8A 4AUKA 4DR7F 3TO8A 2M2BA 4FNIA 1SB6A 4CI0B 1HNVA 1UJ4A 3W2WB 2K06A 1LWEA 2HPUA 2LKZA 2F63A 3NOGA 4DV4J 4EFAC 1MN7A 2OHDA 3D6FB 4DPWA 1FD2A 5E33A 2BE9B 4RW4A 3VVTA 4AE5A 2KHDA 5C2CA 3NNAA 2K7JA 2MTLA 2CQIA 1X9MA 4CLFA 4K0KF 4P10A 5CQGA 3AOAA 2L3MA 1JLFA 1DLOB 3THVA 2I8EA 2VBYA 2UVWA 4DMZA 4ZPWR 5DG9A 1UTAA 4B3SJ 2UUBJ 2VZ9A 3Q0AA 3L7UA 1EP4B 4FVCA 1NUEA 1XIQA 3IFEA 3MAAB 4YB7A 3FZBA 2JEGA 1WD6A 3UDEA 4MT1A 4M94A 1S1VA 2FTRA 3IG1A 1KFDA 3G82A 4C4WA 3Q8RB 4LMZA 4R5PA 1SXLA 3IR7B 2IYGA 4DL2A 3BO2A 3TOQA 1PO6A 4I4BA 4DN0A 2XGQA 2MPUA 2MZ1A 1HBUA 1JLEB 3K5LA 4CLYA 4KPYA 2K7KA 2MKKA 3BQ2A 3K89A 4TU9A 4YDDB 3TQ1A 1F1BB 3W3SA 4USIA 3HLUA 5KFNA 1KTQA 1NKBA 1M5VC 4PWDA 3M6WA 2WB4A 1CBKA 2DNRA 3HP6A 1S79A 4LRCA 1KFSA 1U4BA 2RH3A 2XHWA 5KFSA 3G6XA 3VV2B 4DQPA 4HT7A 2XBPA 4J91A 4DV5F 4MJKA 4EZ9A 3WX4A 4F3MA 3OQ2A 4OX8A 1JKHB 2YBVA 1QJHA 4N56A 5DQGA 2HFVA 2E5JA 4BBYA 2ZJPQ 1X4FA 1PSDA 2AQ4A 2CPJA 1J5EF 1U1KA 4F7VA 3KK2A 1B7YB 4WK1A 4ZJOA 1DTQB 3SV3A 2GAHC 2RHQB 2VODA 3CJ8A 5DJBA 3J80U 3J7ZT 4MMOA 1YG0A 2HMIA 3OUYA 3GJQB 2MQMA 3MZIA 2NYHA 4Q44A 1NDLA 4J9RA 3Q8UA 1LXNA 5D3GB 1IKYB 1RT7B 2C2OB 5E3PA 4B3OA 5HLFA 2N3LA 5CZXA 1SIWB 1FKPB 2R2RA 2DY9A 4XIUA 3PKYA 4DV0F 4I68A 2D3OR 2MGZB 2PT0A 1O0PA 4FYXB 3NCPA 4MKAA 2EI5A 2W25A 3W2VA 4U6PA 4U8YA 3D6TB 2Q1LA 4PG8A 1UAWA 5KFHA 5DDOC 3KNAA 4DR6F 3IS9B 4WU2A 1FF2A 3GSIA 3BSNA 2ZHBA 1BQMB 3PO4A 2RF2A 4TVAB 1FERA 3KFWX 3UE2A 1M5PC 3JQJA 3V81B 4UF4A 2B4UA 4IH6A 4ZITA 4Y00A 4ZCKA 1AFJA 2EG1A 4ZLPA 3GCWP 3NWGA 4I2PA 2GHPA 5DQIA 1HBNA 2L9NA 1CS4B 3FCWA 2QLXA 1VQPS 3V6JA 3QRRA 3I4HX 2DJWA 2DNNA 4KGVB 1LW2B 3V4IB 5A8WA 2HVHA 4CM0A 4DV1J 1JK9B 1ZA1B 4YDXA 3QSIA 3GIKA 4UQTA 1S99A 4F36A 4BC9A 4KT0C 2ZHAA 1N52B 3DMJA 2E9RX 3WIVA 3HD2A 4EBEA 2W9BB 5KFBA 4ECRA 1AUDA 4OI3A 4QIEA 2YPYA 2AU0A 3OL7A 1ZTWA 4BS2A 2VDHA 1WG1A 1S1UA 3CJ4A 5J1NA 5HANA 2R7SA 1BC6A 1FE4A 5GMEA 3ZZUA 5CYJA 3KJQB 2LEPA 4G1PA 1VQ7S 1RHKB 2BE7D 2DKOB 2GA7A 1WG5A 3M6UA 5B7WA 2KB2A 4Z7CA 2KFYA 2PSZA 2ILYA 3FK4A 2QSFA 1YIJS 3V6DB 1I94J 1SI9A 4B3RJ 2QYGA 2RQMA 2CPYA 3HF5A 4ZCMA 3MUVP 3R5AA 5F9NA 4P9SA 4C0BA 2LXFA 3CCQS 2UVVA 1UEVA 4KV8A 1YITS 4C3LA 2Z8QA 3NGRA 4RNHA 3N4WA 3MCSA 5F41A 5KFMA 4P75A 4DSLA 1G4CA 1TKZA 2KFNA 2RHSB 2F8HA 1R8AA 3D6MB 4P52A 1CJTA 2GJ2A 3MM6B 1VOMA 5KFVA 4DFKA 5E7OB 3B78A 4UZBA 1QUVA 4IG3A 4J9NA 1XTZA 3HZGA 2BYCA 5M2RA 2VASA 1AB8A 4NLGA 2IHR1 2J7WA 4F0MA 4KSEB 4HVZA 4JUZA 3T19A 2GGPA 4ZPAA 2G0CA 5LJ5Y 4E8UA 2G2OA 3LGMA 1VRUB 4YOEA 1OMSA 2K8GA 1QAYA 4B9VA 4Q8FA 3CNQP 3MTKA 3NGTA 2C3YA 1GXTA 2BABA 2GX8A 4RO0A 2B0GA 2GQQA 1RGVA 3I31A 1R0AB 2CZVC 4N76A 2V8HA 2AYMA 2J5AA 3MMBB 5F9LA 4MYTA 2O1PA 2MHNA 3I56S 4WBFA 4DX5A 1U6BA 2L41A 1WDTA 3PEHA 1F5BA 2BJ8A 1O51A 3Q8YA 2G13A 1BGXT 2B4PA 3TAQA 5D78A 2J0XA 3G8TA 4UOFA 2E5GA 4QYRA 4DF4A 1RTJB 3C3LA 3UQSA 5HO4A 1DRZA 2HS0A 3TANA 3DNCA 3NBPA 1RAOA 3QIPB 2UUCJ 4WP8A 3HVWA 4W90B 4ZP8A 4O3QA 2AJ1A 1KLMA 3GONA 5BR8J 3MM9A 4K4TA 3MM5B 1UETA 5L9XA 2NR0A 3KG1A 2B9WA 3AOCA 1YX2A 2QA2A 1RA7A 2VQEF 3NY0A 2BANB 5LSOA 4HHUA 1PBAA 4QU6A 3EZUA 1NSAA 2XS5A 4NXMJ 2QEXS 2Q66A 2FVPA 4KGMA 1T05B 5T7LA 2P9CA 1TVRA 1RTIA 1PKUA 2AJ4A 1OWXA 2M70A 3ZTPA 3GE9A 1KOOA 3GR0A 2R7OA 4M5KA 1UKUA 3WQPA 3BM7A 1TMJA 3H4DA 2ZHOA 4URQU 2R7QA 1HR0J 1OYDA 2DB1A 3A12A 3OHAA 4ZVPB 1HQUA 3MR3A 2H5IB 2VPZB 4FKYA 2P6TA 4Y2IA 3C6UA 2YWKA 2POKA 4I56A 4ZK7M 4Q45A 3NCRA 3QT8A 1N4LA 4ZOSA 2QE5A 3C2PA 1RWVB 2E7WA 2IDEA 4RR5A 2B6AA 4USWA 4FKXA 2R2TA 3ZFVA 3JAMY 5DG7A 2W2MP 4NMXA 2LFVA 3OSPA 1RA6A 4WFZA 4LJMA 4TXSA 3HVTB 4NLQA 3NGKA 2APOA 3CIMA 3U1MA 2GC8A 1D1UA 2V8GA 4M95A 1YJTA 1U45A 5LOQA 1FJEB 4ICLA 4X84A 5BYQA 4DCPB 3T9NA 1EKRA 2FDNA 2XGPA 1VRQC 4F4KA 3DKDA 3W8PA 3M8QB 3Q86A 3OFFA 4RWXA 2DR8A 4KFBA 2ZC4A 1HI1A 1V3SA 3V2UC 1RKIA 2FLLA 2RRAA 2VKZG 5KFKA 5K8OA 4ZVRB 2CPFA 4FVMA 1SPBP 4JI1J 3ETOA 2XMUA 3QQCD 2XO7A 2GJIA 2BVZA 3WBZA 3W65A 4MH8A 4GVBA 3KJNB 4OYXA 1S9GA 3V6HA 5A8KA 4OMFG 4O44A 2OP5A 4QCLA 2NZ4A 2OPRA 3AJDA 4DOZA 3VAIA 1V3ZA 1RUSA 3IMQJ 1U24A 3W9IA 3BH7B 2H65B 4P7TA 1F6TA 1C0UA 1NU4A 4N8NA 5LM7E 1YBUA 4RNMA 4K7QA 3HX9A 1Q78A 1NK9A 3HI9A 4HR2A 4P2XA 3TUJC 4LBHA 1G1XA 1FNXH 4ZPCA 1N6QA 1YLXA 3QGGA 1B7FA 4URGA 3J81U 4NCAA 2RRNA 1UJ6A 3SXLA 2KXFA 2UP1A 1SJRA 2KI2A 2CQGA 3MFIA 4L74A 4Q2MA 3CMAS 4CO3A 1XR7A 3FVYA 4DS5A 2OLWA 3TQEA 1Y5LB 1Q16B 3UN5A 3ILJA 2IRXA 2PFFB 4HL9A 3HHLA 1YBTA 5C42A 4ELTA 3GIIA 3FDSA 3LAMA 1U6FA 1H74A 4H4OA 3O44A 3QIDA 1OJ4A 4JI2J 2CNOB 2OSRA 3PFEA 2XYGB 2GFFA 3M4XA 5DM6Q 4Y34A 1QY7A 3ITHB 1BY9A 4K2JA 3IWLA 1B64A 1NB7A 4PXEA 5KFIA 2YQ3A 3MMCB 4F8RA 2VA2A 1RAEB 5AJ3F 3MPWA 5DG8A 3KHRA 1BLUA 2OTJS 5ETLA 1RT3A 4ED4A 5HJXA 5HMYA 3T41A 2E29A 4IH7A 3DCAA 2K1RA 1H0HB 4ZCIA 4WF9Q 2V4JB 3KK3A 1E6YB 1HNZJ 4ZLLA 5FDLB 2MKIA 5HP1A 1KQKA 2DNZA 1B4SA 4DR4J 4IYQA 1RT6B 1TKXB 5SUHA 4DDFA 1ZAVA 5IT9U 4J7CA 1KSPA 3DLGB 3CJSA 1JLGB 1WF1A 1N8RT 3CGIA 3POTA 2IPOB 4H4MB 3HHLC 4DV4F 4QR2A 3K17A 4K50A 5KFGA 2MLZA 3MAQA 4ZLJA 4X4VA 2DNLA 4K4WA 5ITHA 2W8LA 3KHHA 5JVGQ 3W5XA 1GEHA 3IRXB 3L3CA 2AYGA 1MMLA 2YKOA 3QT7A 1JLBA 2DBBA 2WVEA 4U95A 2YTCA 4NLYA 1IJFB 3SCLE 4B3SF 2UUBF 3I87A 4B08A 5HJYA 2ROGA 4I2QA 4BWJA 2PO4A 3TA2A 2NXNA 1TU0B 2CJKA 3B4DA 1EAYC 3CDEA 3FKBA 2Y0BB 2YQ0A 3CB4A 4JI4J 2YWGA 4ZCLA 5K14B 1U0SA 1CG2A 2RS8A 4GC6A 4NLPA 1HFEL 2E1CA 5A2QY 2YX7A 3MM8A 2IFXA 3RTVA 2RVJA 2AGOA 4YFUA 2QV6A 2WW4A 2Y9HA 5DDPC 2I2YA 2HNYB 1LOUA 1OY9A 1NMEB 4LRFA 4KR0B 5K20B 3CF5Q 4NLUA 3KUHA 3KUGA 5GADI 4J9UE 3CJKA 1OS5A 3SZ2A 5CA5A 3NNHA 2H5JB 5IZHA 3KLVA 1I1GA 1URNA 2LCWA 4JV2A 3UDCA 1N0UA 4PKDB 4HACA 3M8PB 1YKWA 3CDBA 4FYVB 1VJWA 3NNCA 4AL6A 1N5QA 4OYZA 3UNYA 3IXQA 4M5MA 4CLUA 1RT1A 2XNRA 3G8SA 5KT5A 2C2RA 2KVIA 4O4RA 4MIBA 2HLTA 4URSA 1WC4A 2CPZA 2C3MA 2D3UA 1IKXA 2CIMA 5J2QA 4YHHJ 4DPOA 5DDRC 1RHRB 4WFYA 2XC9A 1FX4A 5DDQC 2NZCA 1DAXA 1TL5A 1XBWA 3W2WA 5ETTA 3BYPA 3TI0A 2ATCB 4ERDA 2VG7B 4TN2A 5H9FK 1T11A 2KG0A 2JLFA 2KFZA 2J9EA 2K2PA 3I32A 2JEIA 5E3RA 1QTNB 1IKVA 1H73A 3D2WA 2NREA 2DNPA 3BKTA 1DLOA 4Q7AA 4ZIWA 3N5FA 3OFHA 2YNIB 2B5JB 4X4QA 3PX6A 3I0SA 4TLRA 4QYZK 1SC4B 1X5TA 3FBFA 1EP4A 2ZJRQ 1WI8A 3TZXA 3MAAA 1HWIA 2W9CB 4ZN1A 4DFMA 4DPUA 1NZAA 2X1GA 4FPIA 2I9SA 1NK0A 3CO0P 4KGZB 6AT1B 1RB0A 4ZVOB 3E2EA 2Y1IA 1KRPA 4G3IA 1BWEA 3RGIA 2JZ5A 2FJXA 2AJFE 2VDIA 4J5OA 3TA0A 4DV1F 4HKQA 2Z57B 2MKJA 2RAQA 4LIRA 3OW2R 3JAMU 3BBFA 1GXUA 1JLEA 1T94A 1YRUA 1DQ8A 1R6VA 2EFVA 5IV3A 1FRJA 1S97A 1RWNB 3G2XA 4LIWA 1VDHA 2C42A 2ZDOA 1RHJB 4ID5B 4OZNA 3ET6A 3HSZA 5KFYA 3LPYA 4DL0C 4O3RA 4J9KA 2HQDA 1NLKL 1TKDA 5EN1A 3QO9A 1V3RA 1JKHA 4LT6A 4DQQA 4K5SA 3EM1A 4A48A 1RWUA 3HM9A 4DWIA 4C8YA 2M7SA 3D54A 3OSNA 5ETOA 1ZZFA 1I94F 4B3RF 5L8RC 1SL1A 1DTQA 4QR0A 2ZH1A 5B0AA 3IBCB 2DO0A 1YJWS 1WI6A 2E1AA 3FBCA 5CZVA 1RT4B 4DV6J 1LKZA 3A3OB 2XY5A 4AL7A 4U96A 3TJ8A 3MECB 3M6VA 2DITA 3BBCA 5CHCB 5HMXA 1X60A 5D3GA 4N7TA 2UVUA 1IKYA 2DVIA 1RT7A 3UD4P 3P6YC 1NJZA 1GT8A 4DPYA 1NZ8A 3IM9A 1FKPA 1BQNA 2ZKUA 5A6PA 2ZITA 3L7PA 3VAHA 2MGZA 3SCIE 3CD0A 1IQTA 2IJRA 4O0IA 3VAFA 1IBMJ 3BDPA 3Q8PB 1RAJA 1UEKA 2ZVSA 5HVGA 1RWMB 1W2IA 3W5ZA 3ZTOA 2H4WB 3IS9A 3PYFA 3AH6A 1BQMA 5GAGU 3PG9A 3C14B 4LRBA 3V81A 4GKKJ 5EHHA 3T1YJ 1S0MA 1F60B 1VYAA 4J9PA 1YVFA 1GTHA 1CS4A 4I67A 4QU7A 1W25A 3IO1A 4DSIA 1LW2A 3V4IA 1PYTA 1D9DA 5M2PA 3MI7X 3CCUS 1U09A 2ZJQQ 3THPA 4ZLNA 2V69A 3RB3A 3DDIA 4DI6A 5J2MB 1M1KT 3W63A 3FMBA 2C2NA 2W9BA 1R6YA 2HBZB 3BGLA 1RHQB 3BYRA 1JIHA 2UUCF 3G86A 4JI3J 2VPXB 3PJ9A 5BR8F 2BKPA 1FHTA 3IGVA 3D1QA 1N34J 2VG6B 5HMZA 2JRSA 4P6QA 2IM1A 1A6LA 1YRTA 2EFGA 2L48A 1U26A 3OXGA 1IM6A 1S76D 1HQEB 1SQFA 4TQRA 2YQ1A 5H9EJ 2DPJA 1Y00A 4CTAB 4P7VA 4YP3A 4HHHA 2JFKA 3FEZA 4FYDA 4O3OA 4NXMF 2HHPA 2CQCA 4UY8T 1YJ9S 1C1CB 4USMA 2VFSA 3HMJG 1HW8A 3GYXB 2VFRA 2Y8WA 3S8SA 5IXUA 3DHWC 3VGUA 3TZYA 3MHYA 1K1SA 1HR0F 1XR6A 1EQ0A 4ZVFA 3VGTA 1CULB 1NEEA 3HT3A 5IFMA 3J7YU 4EUVA 4EYIB 3K8WA 3QJLA 3FBBA 5IWAJ 5LMUJ 5D0GA 2VUGA 4LSLB 1WNEA 3MM6A 2EXUA 3N5BA 3GYNA 2ROEA 2DK2A 3UVJB 1TQLA 4EK2A 2KT5A 1TELA 1FFWB 2KM8C 2BQRA 3CJ0A 2LU2A 2DNYA 3QGHA 1DQ9A 3GLJA 2YNHB 3JSRA 4C11B 1R31A 1BUXA 3CCLS 3AFGA 3MD1A 3GWCA 3MGJA 4NYZA 4AXIA 3RG6A 1HBMB 1IBLJ 1FRMA 2AZ3A 5LJ3Y 1YJ7A 4K8RA 5DGBA 1NKEA 4B9LA 2NS1B 1S6OA 4AQYF 4NLVA 4DV3J 1NJYA 1UPMB 4IFYB 1NHVA 2FY8A 1FJGJ 3GSDA 1R0AA 2EPIA 2CG8A 3KLFB 1GFWB 1QTMA 3MMBA 4NPOA 3QFWA 2XZTB 2KVQE 2W4CA 2F1FA 4RW8B 1NXIA 2WTFA 5A2QU 3VAJA 4CO1A 1YJRA 3IWXA 2J9DE 3FGVA 3ZTSA 1RTJA 3VAGA 3H5UA 4ENOA 2GIRA 4WIQA 3TEGA 1WTFA 2LEBA 4GO5X 3JYTB 2UXBJ 3QIPA 1HW9A 4QWCA 1U2CA 3GB0A 2U1AA 4DL3A 3GV8B 5CAAA 1RHMB 3MWBA 3MM5A 3G6ES 3D6HB 2XEXA 3PRBA 1RJJA 5IT4A 2V50A 1E6VB 1HI8A 4DV7F 1Z2ZA 1XERA 1T9UA 2BANA 4IRCA 3KHLA 2PGCA 1Q53A 4TU8A 3GIRA 1HWUA 3LW5C 7AT1B 4OZ0A 2E44A 3AD7C 3E3XA 4JI8J 2ZZTA 4QBUA 3GFYA 1VQNS 5FLXY 5BXIA 4F3OA 3HHEA 5I4MA 3QGPA 4LR9A 3NXZA 5M2UA 1WWHA 4B9SA 4X4TA 2O66A 3ZTQA 1NAQA 4NYOA 2JVOA 1DTTB 7FD1A 3GV7B 3OPKA 3F56A 1NSPA 1MLAA 3O6QA 3TVZA 3FQKA 3JXOA 1V5VA 2V68A 1F3VA 2D41A 4JI2F 2HRTA 3UCZP 3BSCA 2R7RA 4J90A 5B0DA 1FRIA 1BD6A 4OHVA 2V2QA 3BR9A 5CCMA 4C8MA 5C2GA 4P72A 2GS8A 4YMEA 3CD7A 1TUVA 1FDNA 5F0UA 3HT0A 4CLWA 2DGWA 2YX1A 1LNQA 4ILLA 3H2LA 3N28A 1Z2LA 1TK5A 2DISA 2MKCA 4RW6B 2E7XA 2G2ZA 4S0MA 2V2VA 2W2PP 3BGRB 3M8QA 3LP2A 1UWAA 2GIFA 2W1BA 3UI3A 2ZNYA 1VQ6S 5KG0A 4UTGA 3V6KA 2Y0SD 5BJRA 5B0GA 1HNZF 4CLZA 4EWTA 2AF6A 3RBDA 1RYSA 1U25A 1Y5IB 2OD4A 2DCLA 4I1TA 4UUWA 3E8OA 4DR4F 2V34A 2EC2A 3DGPB 3R9LA 5DQHA 2IMOA 3AT1B 1JX4A 1UL3A 5F8LA 2KRBA 3RB0A 3DRYA 3NMAA 3A8IA 3M8ZA 5JMNA 4ZHRB 4ZDNA 4KHPJ 2VD3A 1V9OA 1XC9A 4O3SA 2EVZA 3DLKA 4NCGA 3D0IE 1EKSA 4DV0J 2R8HA 4R8UB 1UWBB 3HPOA 4FBTA 4ZPTR 2XCAA 3ILOA 3GFZA 4ALZA 4KKOA 1ZBTA 2X1BA 5KAKA 1F2GA 2YY3A 1JXEA 3W62A 4KBIA 5ETMA 3W9JA 1L3VA 4C7QA 1H98A 2VFVA 1VFJA 2P9GA 2WW8A 2XYHB 2VBZA 1QDUB 1RTHA 3KG4A 4R0JA 4TU7A 4CYUB 4C8OA 1FVQA 2OEKA 1C1BB 2DGTA 1CEZA 1Q95G 3EVMA 2QMUB 3CIZA 2ZOFA 4RZRA 2O5DA 3D66A 2MZQA 3BPDA 3MEGB 3QNWB 3I5BA 3H8YA 2PFDA 5DS7A 1RTDB 3S7RA 2KRRA 4JI4F 5KOWA 3KK1B 5K9FA 1KONA 1N36J 2QN6B 3SQGB 2CVIA 5AT1B 1TR0A 3VR1A 4CNZA 4QR1A 2HNZB 5G4DA 2VOPA 3US5A 1FKOA 3C19A 2I0XA 4LRAA 4KB7A 2A18A 4LR8A 5J2NB 2RQ4A 1KEKA 3KMQA 5C24B 3T1AA 5GMKa 1KWMA 1Y11A 3ITHA 2WVDA 2CJXB 5KG1A 4YB1P 3D3BJ 1S9EB 2KZZA 1H72C 1LV5A 2Q6CA 2AX1A 1VIXA 3X3UA 3EDRB 2BM0A 1DFDA 3KOAA 3M2UB 4YR2A 2JEJA 3ZO7A 4A8QA 1T9WA 3SDEB 2V4JA 2A1BA 1E6YA 3U1NA 2M9KA 4HEA9 5D0HA 2QSWA 4A8KA 5FDLA 2KL8A 3QPIA 4KE5A 1SH3A 1HLWA 4OI4A 2P8IA 1RYRA 1KDNA 2PMWA 3F41A 5CCLA 1RT6A 1TKXA 3LP1B 1CSJA 3ISND 2O3DA 2QC3A 2XMJA 1JLGA 1TFWA 1PIEA 1Y0HA 4H4MA 2ALYB 1PC5A 1RAAB 1ZYQA 1T8EA 2KYXA 4KO0B 4CIOA 1KP6A 2FGCA 3LWLA 1KNZA 2HFZA 2Q3PA 3LANA 3CJTA 4XTTA 3IRXA 2JEFA 4CDIA 2QGFB 5HVFA 2DO4A 5LSRA 1VMBA 2XO6A 3KJVB 2XLJA 4OX9J 3CEDA 2F8EX 4EU0A 3FRZA 1VQMS 2N4DA 3LPEA 2EEYA 1FRLA 2DNQA 3MOZA 3CCJS 5E3QA 4HH0A 1ZM4A 3R8YA 1H2UX 4JV0A 3SFUA 1KD1T 1Y3JA 3BBBA 4DSFA 4C8LA 3DFEA 4DXLA 4WP9A 5K8NA 2QJ3A 4HYKA 2EK6A 4P74A 3B8HA 1T9TA 1N56A 5F8IA 4KIAA 3PV8A 1R8HA 3A3NB 2R9LA 2GVDA 5K14A 4RJVA 2J7KA 1FJCA 4NA1A 4ETZA 2V67A 3CC2S 1YHQS 2QIFA 1GK8A 2HFOA 1XNQF 1F9FA 4RUAA 1P1TA 3MCOA 2VHGA 2EFNA 2VV5A 2HNYA 2RRBA 3JTNA 2ZUGA 2QLJB 1LQ9A 4MKYA 5AXKA 1LWFB 4LF4J 3CD5A 5EWEA 2BXJA 2XI2A 4Y2MA 4L75A 4UOCA 2ATLA 4RU2A 2MSSA 2IRYA 2DIUA 1KQFB 1S0OA 3K5OA 2YH0A 4TY8B 3MR6A 1EB0A 3LQVA 3V4MA 3M8PA 1S6UA 2HQGA 1S6QA 1F9EB 1YBAA 2OFHX 2QA4G 2W4DA 3BO3A 4OYIA 3TUIC 4LF8J 2QX0A 3D7SB 3TVKA 1WJ9A 2F8MA 1XWLA 4F0HA 4DV6F 3PIPQ 4OQJA 3Q23A 4MKBA 1RCXB 3MMAB 2M8DB 1TK8A 1S1WA 2HW3A 1U0HB 2V4RA 5KFRA 4X62J 1O6XA 4OYBA 2HK2A 2VG7A 1L3UA 3RBZA 4USUA 3DLHA 2BJ1A 2IJNA 1Q7LB 3G6VA 2XSFA 3FEXB 4MYUA 2DPIA 4WE1A 5B0EA 1XQIA 4ECWA 2F40A 2E1RA 5AE3A 2ACYA 3FCHA 1IBMF 1VQ9S 2PN6A 2YNIA 2B5JA 3LH2S 2RNEA 3BF4A 1QAIA 1SKUB 5FLXU 2U2FA 2FJVA 4UT4A 1K8AT 2ZH9A 1N5SA 1QLNA 4Y0FA 2W9CA 3GCXP 1IN0A 1Y9OA 5A8RB 4GKKF 3T1YF 2JHEA 3K2YA 4OV1A 1DQAA 2V2KA 1RAIB 1NK7A 1L5UA 1T9VA 5K8PA 1JQGA 3ILLA 2MQNA 2AZ1A 5J1EB 1U8SA 2RQKA 1JLCA 1ZETA 5HL7Q 1J5OB 1OPIA 2XSJB 3DLEB 1S1XB 5GVQA 1FX2A 1H3DA 3MEEB 2MHEA 3TVYA 2AV5A 4AYBD 3QBCA 1ZM3A 4RBTA 4JI3F 2YNGB 2PI4A 3P4UB 4AXJA 4ID5A 3W64A 2FGOA 4PQUA 1N34F 2WAQD 3K58A 4DS4A 2N3OA 4XO0A 3FFIB 3SV4A 2FZGB 2CZ4A 3P8BB 3CCVS 4M5NA 2M52A 2YKPA 1RLCL 3FJ2A 2NYIA 1FA0A 4JYAJ 4HDHA 3M6XA 3ZTRA 4OHXA 3DOMB 1Q5YA 3CE8A 4USVA 3AB2B 3R6LB 3BQ1A 3MR7A 1WKJA 1ZPVA 4BWMA 1H38A 4GRSA 3KWMA 3I0RB 3VGSA 3DHXA 3MECA 5IWAF 2FHOB 5LMUF 2H51B 3DLLQ 4NLWA 2VBXA 3K7RA 2HGNA 2N82B 1BMQB 2VC0A 1FI4A 4LQ3A 3W1YC 1NM2A 1UEUA 4ITSA 1D0EA 3D4JA
chains in the Genus database with same CATH topology
5THWA 4QR2A 4DV4F 2DR7A 4NXNF 2Z2LA 2KJVA 3M30A 4NA2A 2ASDA 3HXMA 2HWIA 3I9ZA 1TFYA 2N4CA 4K50A 5MLCV 5KFGA 4RW4B 3ZZTA 4Y6IA 5HBMA 5CXTA 1FXRA 2ZZMA 3MAQA 2GCFA 1FTCA 1KLMB 3DXBA 2FVRA 2FD2A 3MM9B 4X4VA 2DNLA 5LT5A 4K4WA 5ITHA 2W8LA 2BRKA 4DV2F 3KHHA 3RBEA 3UR3C 1UJ5A 4Q5VA 4YQWA 5JVGQ 3NLCA 5A0YB 3TW0A 3IRXB 4ES3A 4R8UA 4Q2LA 4D3GA 3L3CA 2HHVA 2AYGA 3MMJA 2EFQA 2PMZD 3M32B 1MMLA 2YKOA 4ED3A 2SXLA 2F7VA 2MQLA 3PX0A 2DNKA 2OPPB 5F8JA 3AJ1A 1N5YB 1JLBA 2DBBA 2C2DA 1IBLF 4DLGA 1WHYA 3MURP 2YTCA 1NNDA 2RIJA 4NLYA 5F8HA 3FSXA 1IJFB 3T9ZA 2DHAA 1M0SA 2XMTA 1S6PA 1DZ5A 3EXCX 2LDYA 1K9MT 4IO9Q 5KFPA 3SCLE 4TY9A 4I7FA 3K5MA 1WG4A 4B3SF 1IR0A 2NPFA 2UUBF 3AY0A 3I87A 4B08A 3KLGA 4DV3F 3DDKA 3M8SA 4F2SA 2ROGA 1N54B 2YX4A 1FJGF 2JFDA 5F8NA 2D9PA 4I2QA 4BWJA 1VQ4S 2DNHA 2PMHA 1U48A 3OFGA 2JDJA 2P6SA 2PO4A 3TA2A 3V6DA 4ED2A 4PG4A 4XK8C 4A8XA 5T7LB 1NK5A 1TVRB 2HWHA 1RTIB 2CJKA 2XMMA 3LP0A 3TAMA 2J6SA 3B4DA 4WZQA 3HFKA 3CDEA 4RNNA 2IC3A 2QA1A 1C1BA 4QIGA 3PJWA 2WSFC 3DU6A 4FXWA 1JLQA 2ZBIA 3PFOA 2YWHA 3K0JA 3OR2B 4RUHA 1FTRA 3R1LA 4DJBA 1QUPA 5DRKA 4Q0BB 4YHHF 3PDNA 4WKYA 2AGPA 3CB4A 2CQ3A 3MPYA 1HWKA 2VFTA 3FZ2A 1TV6B 3DRRA 4IFVA 1SL2A 2YWGA 4ZCLA 2IJFA 1HQUB 1U1OA 3M1VA 2VG5A 5K14B 1RQ0A 2J9DA 3BZQA 4B17A 4EO6A 5KG3A 3AQOA 1CG2A 1XMBA 2RS8A 4NLPA 1ZM2A 4GC6A 5KFAA 1HFEL 1SH2A 2MJNA 1VS3A 2OKQA 3B4MA 3SQGA 3ICLA 1N88A 2R7WA 2A10A 2KT2A 2E1CA 3FSYA 4ZMMA 1KHVA 5A2QY 4KHRA 1D9FA 2WOMA 2OFGX 2YX7A 1K1QA 3C6UB 4RX6A 4U67Q 4I69A 3MM8A 3Q8QB 5D8HB 1OPZA 2IFXA 5J2MA 1S4FA 2IMWP 4M1KA 4RKUC 2YWEA 3IA0A 3RTVA 1VIOA 2RVJA 3WZ0A 2AGOA 5JUMA 4YFUA 2QV6A 3MUTP 4O3PA 2CKWA 2UXBF 2W7PA 3OL6A 1SH0A 2B51A 2B6AB 5DDPC 4RLEA 2I2YA 1RKJA 2HNYB 1X5OA 1VBYA 1TKTB 2X3GA 4R25A 1LOUA 3T5JA 3OL9A 2RS2A 4ED7A 5IT9Y 4ZP6A 1QSLA 2IYIA 4CT9A 3KMSA 5AXLA 2IVMA 5KFDA 4KR0B 4PQAA 3EX7B 1IBKF 3CF5Q 1JJHA 4NLUA 2ZFHA 4WKRA 3DRPA 5GADI 4JBCA 5IM0A 1EETB 1JXLA 2VG6A 1PGZA 2Q43A 2MB0B 3CJKA 1G7CB 2FB0A 2KXHA 2R4FA 1HYSA 2XY6A 1DURA 2JLGA 1OS5A 4ES1A 2ZDPA 5B0CA 3H5YA 3SZ2A 2GMJA 1VRUA 1N33F 3Q22A 5CA5A 1S0NA 3NNHA 5IZHA 4Q43A 4M5DB 3KLVA 5KG2A 1I1GA 4Z37A 2WCXA 1URNA 2Y1RI 1H2VZ 2LCWA 3B82A 2N7CA 4JV2A 4ECTA 4CCHA 3MFHA 1BQXA 2RKIB 4ICLB 4CTAA 3UDCA 2VOOA 1N0UA 3MOJB 1D3WA 1MW7A 3O3LA 4PKDB 1WEZA 1KN6A 1KC8T 3M8PB 4UQGA 2KTQA 1JNRB 3CDBA 2MKSA 4K4VA 4ED5A 3G9CA 1RT2B 1VJWA 4AFFA 4F26A 4AL6A 3NNCA 1N5QA 1FVSA 3NS6A 1FDBA 1YSJA 4JI8F 3IXQA 1ZOTA 2M0GB 2A2CA 4G6VB 1RT1A 2XNRA 1HMVB 1C1CA 3G8SA 1CQMA 1V6HA 5KT5A 2C2RA 2PI5A 4KC5A 3HJFA 2R2UA 3CSKA 2KVIA 4O4RA 3CCWA 3N6MA 2MDAA 4BC7A 3CWJA 1OQ6A 4MIBA 4PR6A 1QAXA 1GQEA 2HLTA 4URSA 4OI2A 2CPZA 3PR5B 2C3MA 1Q81T 4KFBB 2JLEA 3LGNA 5GAHI 2HGLA 1RT5A 4GO7X 2D3UA 2HMIB 4A8FA 1IKXA 3PHEA 1MU2A 2CIMA 5J2QA 4DPOA 4KGKA 1XR5A 3DOLB 2JJ4D 5EWFA 5DDRC 2I5JA 1C4CA 4LSNA 4DUYF 4HDGA 4WFYA 4TYAA 2VFUA 1FEEA 1S77D 3I4PA 2XC9A 3CXCR 1NRKA 1IM4A 5B0BA 4LSLA 5DDQC 1JB0C 2CQBA 1DAXA 2KYZA 1TL5A 1GTEA 2QMWA 1XBWA 1H6KX 3L09A 2ASJA 2IA0A 3W2WA 4QOTA 3J80Y 3DRXA 4QWAA 3PIOQ 1OQ3A 2CPXA 3LALA 3TI0A 1S7HA 2VB6A 2VC1A 1FEHA 4JV5F 3UWTA 2UUAF 1TP7A 2CVEA 2B7BB 4ERDA 2VG7B 5B09A 3RB4A 4TN2A 4C3MA 3OJUA 3QYYA 2RQCA 4DL6A 1SJ4P 2R8KA 1S9GB 1U1LA 2KG0A 2JLFA 2UUWA 4YEAA 3UNGC 3IAM9 4O44B 3SFGA 2ZOMA 5K8MA 2OPRB 2YNHA 1U6ZA 1VHFA 1YGYA 4C11A 2KFZA 2QZ8A 1AROP 1HD0A 2DH9A 4F02A 4Y65A 2J9EA 2K2PA 3I32A 2KT3A 2RT3A 4NYPA 5E3RA 1S9FA 2JEIA 4B3MF 1IKVA 4Y2AA 4QPXA 2FLPA 3D2WA 2NREA 1WHVA 2DNPA 5E2QA 4ATNA 4U7CA 4QW8A 4XDCA 3KNGA 4G1IA 3W2VB 4L6V3 4JV1A 4CO2A 2LLZA 3DOKA 1C0UB 1DLOA 4RW7B 3BGUA 4Q7AA 3OVBA 3ZZYA 5I3UB 3LOUA 2DNMA 3N5FA 3OFHA 2YNIB 2B5JB 2JL9A 1NKCA 2BM1A 4X4QA 3OHBA 1SUQB 1CC7A 3PX6A 3I0SA 4I0WA 4TLRA 2RUGA 3Q2SC 1WF0A 4QZVB 1X5TA 1REVA 4NX9A 3K57A 4FF2A 3VWSA 1EP4A 4IFYA 4ZP7A 2ZJRQ 1WI8A 5JXSA 4LF9F 1N0VC 2HS3A 1HWIA 3GG0A 2W9CB 1N6QB 3MD3A 5KT7A 2R7XA 4USHA 4DFMA 2OJ3A 3LP2B 4NLTA 1LW0B 5A6WA 2QMXA 1T05A 1VBZA 3BS9A 1NZAA 2X1GA 4JI5F 4M63A 2I9SA 1NK0A 2MY8A 2J0QD 3SCKE 4OI0A 2YNFA 2OPQB 5KFXA 4RW8A 4RWWA 4DBQA 4ILMA 5E5NA 3ZC4A 2MYFA 4P2SA 4B9TA 3E2EA 1Y5NB 1YJVA 4DR3F 2CJ9A 3IGNA 5A8WB 2Y1IA 1KRPA 3I96A 4Y2CA 1X0FA 4G3IA 1BWEA 4NLRA 2JZ5A 2FJXA 3O2IA 2AJFE 3EGWB 3P5TL 4J5OA 3TA0A 4DV1F 4HKQA 1MROB 2BW2A 2MKJA 2DHSA 3R1HA 3JSMB 1D9AA 4PWUA 5KFCA 2YKNA 4LIRA 2W7AA 5F8GA 4A8MP 4IOCQ 1FXLA 3OW2R 1JLAB 3J7A1 5BYRA 3N01A 1SJFA 2M4MA 2GQCA 1NJIT 2XWYA 2ZE2A 1GXUA 1JLEA 1T94A 2V9WA 3DMJB 1YRUA 2O01C 3OLBA 3HHDA 1DQ8A 3JYTA 2NSCA 3RR8A 4RU9A 1QVGR 2EFVA 2HHSA 1FRJA 4N8OA 3H20A 3UD3P 4XAKA 2HAIA 2VQFF 3E51A 1HBOA 2WBMA 1P6TA 5C42B 2Y1JA 1VRTB 3OFEA 1S97A 4F67A 1QE1A 4G1QA 2ADBA 4KHPF 3DLKB 2OPSB 3CJ2A 1DJ0A 4NCGB 3KLHB 4GC7A 2EKYA 2LMIA 3ZZOA 4H4OB 5AE1A 1IJEB 2J8AA 4LIWA 3CC7S 4EO8A 4FBUA 1YJUA 2QYCA 1FO1A 1LFPA 2CQ4A 2C42A 1S1UB 3WDOA 2ZDOA 2CQ0A 4WYWA 1SKSA 2XNQA 2OIHA 2MQOA 2P9EA 5H9FJ 4ID5B 3ZZZA 1NH8A 1P27B 3LAKA 4IR9A 1LWFA 3RB6A 4B9NA 4OZNA 5KFYA 3HVTA 3LPYA 4KKOB 4KJIA 1HPZB 4MAKA 4DL0C 4O3RA 3M9MB 4OZ5A 1UVJA 1A9NB 2GNKA 4F50A 2LYVA 4IDKA 1ZZNA 1NK6A 3AB4B 4J9KA 2VONA 5EGYA 4HH1A 1E6VA 5D4LA 4YR3A 2R8IA 5KFJA 3T3FA 3T5KA 3D1HA 4O3NA 5L39A 4ID8A 4RW9A 1TKDA 5EN1A 3PW4A 3QO9A 1V3RA 2B4VA 1JKHA 2V0NA 3S1TA 4LT6A 4DQQA 4A8SA 4K5SA 1OSDA 2WONA 4A48A 1WEXA 4ED6A 1RWUA 1KTVA 3HM9A 4DWIA 3IAS9 2M7SA 4C8YA 3MR5A 1IQZA 2CJAA 3D54A 1G6BA 4FP9A 3OSNA 1YWXA 1HNWF 1RTHB 1ZZFA 1I94F 4QYZJ 3CDUA 4B3RF 1T02A 3A1YG 4RUCA 1R43A 4NA3A 5L8RC 2F4VF 3CCTA 3G6YA 4PUOA 1R7IA 3DYAB 2RD5C 5KFEA 1SL1A 1DTQA 4QR0A 3SMZA 3VZHA 2ZH1A 2BA9A 5B0AA 3OVAA 5KOXA 1SQEA 2YKQA 3BB5A 2K1RB 5H1SV 2KKHA 2MXYA 1S72S 3T1HF 3KK3B 2DO0A 4FPRA 3KLEB 3EZ5A 1WI6A 4U7UK 1YJWS 1K0VA 2E1AA 3U27A 5LXRA 1U1QA 2AP6A 5DGAA 4HI1A 5CZVA 1RT4B 2CRLA 1TKZB 2V8DA 4YUDA 4DSJA 3OXFA 1LKZA 4V19J 5HP1B 2GMHA 2CPDA 2XZWA 3RYLA 2JSXA 2XY5A 1N36F 2DT9A 4AL7A 4OLPA 3MM7A 1MMDA 4A47A 4PRFA 2UV8A 2HHHF 4MIWA 2FJBB 2WK4A 3MECB 3M6VA 2DITA 1VBXA 4NRUA 5CHCB 5HMXA 4IRKA 4UY85 3EPGA 5D3GA 2FLOA 3MEDA 1X5PA 2UVUA 1IKYA 5I3PA 2FJDB 2DVIA 1FKOB 3CDAA 4MK8A 1RT7A 4I64A 1TL3B 1YQHA 4HHJA 4J9MA 3UD4P 3P6YC 5HROB 4NZ7A 1R89A 2EWHA 1NJZA 4IG0B 2GQ2A 1GT8A 3POTB 3AA8A 1FKPA 2CJQA 1BQNA 2FJEB 2J6UA 1U2FA 2R7VA 2ZKUA 3PXGa 5A6PA 2ZITA 3L7PA 3M30B 3MAHA 3THTA 4N47A 5AE2A 3VAHA 5MAOA 2OH2A 2JX2A 3M9NB 2XMWA 2MGZA 3SCIE 4CO5A 5HBMB 3CD0A 1VQKS 1IQTA 3MDFA 5CYMA 3P49B 4O0IA 2NUHA 1ZAWA 5KFOA 1U1PA 3Q2TC 3KLIA 3VAFA 2AD9A 2B4OA 3O5TB 3DM2A 3BDPA 1SKWA 2JVRA 3Q8PB 1RAJA 2YKMA 5CD4H 4ELUA 1UVMA 2ZH8A 2ZVSA 2Q66A 1MWYA 2CJBA 3KYLA 2D1CA 3HKZD 2IVFB 1DBDA 3U1LA 1JLBB 1W2IA 4X65F 4DX8H 3TA1A 3IS9A 2COLA 3VCDA 4OL8A 1JMTA 4MK9A 1F5CA 2J0SD 2CFXA 3NL0A 4EBDA 3AH6A 2YH1A 1S6PB 1P1LA 1BQMA 1UW4A 4EBCA 1FKAF 4NOHA 5L38A 4DHVA 1C0TA 5GAGU 1SKRA 4I7FB 5U47A 2UXDF 2V94A 2BE2A 4LVNP 3GV5B 1ZM9A 2ZH2A 3KLGB 2HHXA 3V81A 1WHXA 2ZH4A 4RW6A 5EUHA 2DHGA 4MIAA 5EHHA 1S0MA 2HHTA 1F60B 4J9PA 3BGRA 1S10A 4I6AA 1APSA 2EBEA 3DN9A 5D77A 3H2VE 2XS2A 1YVFA 4YR0A 1L3SA 3LP0B 1GTHA 3TAMB 1X4EA 2FHJA 3T5LA 2HHQA 4IO1A 4HTJA 4I67A 2IC3B 5DM7Q 3QAEA 2K3KA 3RZAA 2KU7A 3GIMA 4QU7A 2L9WA 3PKMA 1JLQB 1W25A 3IO1A 3SEOA 5KFFA 1FCAA 4DSIA 1LW2A 1Y4ZB 3V4IA 3IRWP 3N6NA 4UW2A 3KTQA 2IVYA 4C2MA 2DRAA 1RDRA 3I5AA 3F73A 3DRRB 3FNNA 4IFVB 4C8NA 4XPEA 1LK7A 1D9DA 3DRSA 2IM2A 2IBKA 3RRGA 3CJ3A 3M1VB 3DGPA 1XK8A 2VG5B 3E01A 2C28A 2VA3A 5M2PA 3MI7X 4DEZA 3H40A 2HGMA 2IAJA 5C5JA 4RNOA 3CCUS 2W4PA 3DLBA 3CMES 1U09A 5E0OA 2GHVC 2ZJQQ 2HRUA 2VBWA 3THPA 2WOMB 3RB3A 3MM8B 4E98A 5J2MB 4DUZF 3C8YA 4QWEA 3OR1A 2FC8A 1M1KT 1KVIA 4H4KA 5L9NA 3FMBA 4ZHRA 3WC2A 4FXDA 2W9BA 1R6YA 1B0TA 1VLYA 3BGLA 3CD6S 3U02A 1JIHA 4O4GA 5DO2A 1Q79A 5JVHQ 2AGQA 2UUCF 1L3TA 2VPWB 3G86A 2X51A 3QJPA 4RBVA 2VPXB 4CNYA 3VZIA 1M5KC 5T14A 1S1TA 2HHUA 5BR8F 2J0WA 2CDQA 1FHTA 1U2RA 3IGVA 2XI3A 3ULHA 3D1QA 2ZKTA 3CO9A 1UWBA 2C2EA 1X7VA 3DRPB 5KFZA 3OVSA 1RK8A 1R8BA 5IM0B 1K73T 1GH8A 2VG6B 5HMZA 2JRSA 1RP5A 1VGYA 2IM1A 1A6LA 1GX6A 3PRDA 1YRTA 2EFGA 4P6QA 4RNFA 1VQLS 3OTBA 2L48A 1U26A 2PC6A 1B0VA 1Q7YT 3OXGA 2KHCA 4WFXA 3NRBA 1Z1ZA 2HFNA 1UVIA 3O8WA 1S76D 4Y28C 2WSEC 1U1NA 1HQEB 3OV7A 2Z2MA 4MTPA 4TQRA 3BJYA 3PNIA 1ZTTA 4J9SA 5H9EJ 2IM3A 4WCEQ 1VK3A 4OX9F 3G96A 2DPJA 1Y00A 4EGLA 4OIXA 2DGSA 4CTAB 5KTQA 2J6TA 4P7VA 1UVNA 3N79A 2LQ5A 4YP3A 4KAIA 2JFKA 3MMCA 4WTYA 1FJ7A 1WACA 1XMOF 3FEZA 4FYDA 3GFHA 1Q1KA 3OTDA 4O3OA 5KFUA 3PX4A 1MWZA 2BACA 4QPTA 3CC4S 2HHPA 2W24A 5SZTA 4NXMF 1JJ4A 2X1AA 1QAJA 1HNIA 2CQCA 2ALZA 4UY8T 1RT1B 4ELVA 4OI1A 4DN9A 5J2PA 4DR2F 1C1CB 4PG5A 2ERRA 4Y3CA 2HLUA 1YJ9S 2RE1A 3ZZ0A 2VFSA 3Q24A 1FESA