1X4DA

Solution structure of rrm domain in matrin 3
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
102
structure length
102
Chain Sequence
GSSGSSGQKGRVETRRVVHIMDFQRGKNLRYQLLQLVEPFGVISNHLILNKINEAFIEMATTEDAQAAVDYYTTTPALVFGKPVRVHLSQKYKRIKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Matrin 3
publication title Solution structure of RRM domain in Matrin 3
rcsb
source organism Mus musculus
total genus 12
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x4dA00
1PGZA 5CXTA 3CTRA 2HGNA 3SDEB 3CULA 5GADU 5FJ4A 2MZQA 3PIPQ 1U2FA 2ZJRQ 2XNRA 2KHCA 2XS5A 2MZ1A 3UCUP 1SJRA 4QU6A 3TP2A 4M5DB 2KXFA 1M5OC 1VQ4S 2DISA 4QQBA 2JX2A 1VQMS 2AYGA 4F02A 3LQVA 4V19X 3BEGB 2HZCA 3CCVS 4UY8T 2YKAA 2L41A 2CQ1A 3MUTP 1M5KC 1QVFR 2KI2A 2MSTA 2XB2D 3P5TL 1WF1A 3V4MA 1DRZA 2UP1A 4IO9Q 2OIHA 1WG1A 1VQLS 1U1KA 2RQCA 3J7ZT 1VBZA 3CCQS 1Q7YT 1URNA 1VQOS 3UE2A 2MQOA 3I55S 1WEZA 1M90T 3R27A 2O3DA 3CPWR 2MPUA 4LJMA 3NMRA 2X1FA 3VAIA 5D77A 1M1KT 4J5OA 3THTA 3UD4P 4TU8A 3P6YC 3CMES 3CCRS 3UCGA 4PKDB 2X1AA 2CPYA 1O0PA 2G0CA 2JRSA 3DLLQ 3S7RA 2RVJA 4A8XA 2MY8A 2HGMA 3EGNA 2E5GA 1FJ7A 1X5TA 1ZZFA 2L08A 1H6KX 3MI7X 4W90B 2DO4A 3CD6S 1Q86T 2CQHA 2FPHX 1VC5A 1S72S 2E5IA 2M0GB 2MJUA 5IM0B 3B4MA 2KXNB 4PRFA 2RRBA 3D2WA 2VOPA 2JVOA 3TO8A 2KT5A 2FC9A 3BO2A 1K9MT 3ZZZA 4YOEA 3S01A 2MY7A 2MGZB 3G96A 2DK2A 5DDRC 2YWKA 2DO0A 2RS2A 1YHQS 1WELA 2SXLA 3VAHA 3MD1A 3ULHA 1UAWA 4UQTA 2J0SD 1X5PA 2DH7A 3TYTA 4PR6A 3CXCR 2MQMA 5CYJA 2G1DA 4C0OC 2N3LA 1QM9A 2DGUA 2CPEA 3Q2TC 2V94A 2RUGA 3CMAS 2MKJA 4TLQA 3I56S 2YH1A 1U6FA 2MQNA 2YH0A 1A9NB 2QFJA 1X4GA 3S6EA 2CJKA 3MD3A 1WF2A 2LMIA 2HGLA 2MQLA 1FHTA 2EVZA 2BOPA 2MSSA 5BJRA 2ADCA 1JMTA 2N3OA 1D9AA 5GAEU 1U1QA 1VC6A 5CA5A 1X5SA 2DGVA 5LXYA 2LYVA 2E5HA 2DNYA 2DHSA 4Y0FA 1X4CA 2M52A 1S79A 3G8TA 2KRRA 2DNPA 3CCUS 3CCLS 2RRAA 3R1HA 3VF0B 2FHOB 1WEXA 1WI8A 3R1LA 1OO0B 4FXVA 1HA1A 2CQGA 1Q82T 2PEHA 2OJ3A 3IRWP 3BS9A 2M8DB 2QA4S 2FC8A 5DM7Q 1VQ7S 3MOJB 1OWXA 1RK8A 2DNGA 5DDQC 4WFNQ 3MUVP 1HD1A 2JVRA 5H1SV 2EK6A 3G6ES 3NS5A 1DHMA 4ED5A 2CQ4A 2BZ2A 2KRBA 3JB9k 2GHPA 2XSFA 1X4DA 4W92B 2VONA 5DDPC 1SJFA 4EGLA 2KVIA 3THPA 2VODA 1KD1T 1FNXH 1WHWA 2E5JA 5GMKa 1VQNS 4P6QA 2D9PA 1NU4A 2B0GA 2DNQA 2RNEA 1YJNS 3CCMS 2VOOA 4LIRA 2CPHA 3ZZYA 2DB1A 4BS2A 1D8ZA 3LPYA 1SJ4P 4WIIA 2DGXA 1NO8A 1A7GE 2MXYA 2HYIB 2L9WA 4WFAQ 1CVJA 2N7CA 1JJHA 2QEXS 2J76E 1WHXA 5HL7Q 1HL6A 1WTBA 5DM6Q 2KN4A 1PO6A 1X4BA 1VQ8S 1YI2S 2M4MA 5IFMA 3P49B 1YTYA 1P1TA 3CCJS 3H2UB 2MJNA 1U1MA 4RU2A 2DGQA 5IQQA 1K8AT 2DNRA 1WHVA 4QU7A 2DIVA 2RS8A 3UWTA 3MUMP 2OTJS 1G2EA 2CQ3A 2LXUA 1FJCA 1YITS 2I2YA 2MZJA 1KOHA 3NNHA 2GO9A 1ZH5A 5MLCV 2KXHA 1U1RA 1X5OA 3VALA 3CF5Q 4LMZA 2DHGA 2YTCA 2MKHA 1N52B 1KOOA 4OZ0A 1JJ4A 1VQPS 1M5PC 4F26A 1YIJS 1FJEB 3EX7B 3FEXB 1W2BR 1VQ9S 3B4DA 4IOCQ 1H2TZ 4CH1A 1KC8T 1WWHA 1U6BA 5LJ5Y 3UCZP 1N8RT 3NNAA 2DITA 5EN1A 1JJ2R 2CQ2A 3NNCA 2XS2A 3K0JA 2MZSA 3NS6A 5HO4A 4Z2XA 2DIUA 2CQPA 2MMYA 2K8GA 3OW2R 1QVGR 2X1GA 2MKKA 2M88A 1SJQA 2MKSA 2ZJQQ 1UFWA 3RW7A 4WFBQ 2NLWA 2KM8B 2G4BA 2MKIA 1VQ5S 5IM0A 1DBDA 2DNKA 2MYFA 3HHNB 2MZTA 4TU7A 2KG0A 3J7YU 2J8AA 2XNQA 2AYEA 4CH0S 2D9OA 2N82B 1L3KA 2MQQA 4CIOA 2FY1A 2D3OR 3SMZA 1YJWS 1VC0A 1H2VZ 3CCES 2EK1A 3VAFA 2LEAA 1DZ5A 3US5A 2CPZA 5D78A 1X4FA 2E44A 4TU9A 2DGTA 2LXIA 3FEYB 2MB0B 3BO3A 2X1BA 2RT3A 2F3JA 4YB1P 3L3CA 3MXHP 2KYXA 1N54B 2DNZA 2RU3A 3UD3P 2JWNA 2DGOA 2DH8A 2DHXA 1FO1A 3VAKA 2RQ4A 3G8SA 2ERRA 1N88A 1VQKS 2F9JA 4CQ1A 2LA4A 2CPDA 5JVGQ 3HI9A 1M5VC 3RW6A 2M70A 3CC4S 2DNOA 3U1MA 2XS7A 1FXLA 2ADBA 1B7FA 4ZKAA 1AUDA 3SDEA 5GAGU 5GVQA 1FT8A 1SJ3P 1WG4A 2M2BA 2LA6A 2U2FA 2K3KA 2AD9A 4Y00A 2MHNA 3S8SA 5ITHA 1RKJA 1OIAA 2AYBA 4OZ1A 3VAGA 1Q81T 1U1NA 2DNNA 2A3JA 3CUNA 4IUFA 3CC2S 1U1OA 2MZRA 3U1LA 3G4SS 3VAJA 4U67Q 5DETA 1ZZNA 1WHYA 5LSOA 2MQPA 2KG1A 3DXBA 1UP1A 1X0FA 2LEBA 3EGZA 3BO4A 1X4HA 1U1LA 1VBXA 2MKCA 2CPXA 3MDFA 1WG5A 5DDOC 2WBRA 2OSQA 1HD0A 2M9KA 3CC7S 2LKZA 2CQDA 1X4EA 3MURP 5LXRA 2CQIA 1F9FA 1K73T 2KM8C 2OSRA 2I38A 2NZ4A 4C7QA 4WF9Q 2DNHA 2HVZA 2LQ5A 3N9UC 2CQCA 1BY9A 4C4WA 1KQSR 1VBYA 1YWXA 1OPIA 4YUDA 2PE8A 1WI6A 2M7SA 3Q2SC 1R8PA 4IOAQ 2CQ0A 4WKRA 2DNMA 4FXWA 3G71S 1WEYA 2LECA 2U1AA 3SXLA 3P3DA 2KH9A 2F9DA 1NJIT 1XN9A 1U1PA 1VQ6S 2OTLS 3VAMA 1WF0A 5JVHQ 4ERDA 3G9CA 4QPTA 2KFYA 2AYMA 1SXLA 4WCEQ 3CCSS 3PIOQ 2DGWA 2J0QD 2DHAA 2DH9A 2KU7A 2CPFA 5GAHU 1UW4A 5LJ3Y 1YJ9S 2ZJPQ 5LSLA 2CPIA 2CQBA 2M8HA 1IQTA 3H2VE 2DNLA 1H2UX 2LCWA 2Q79A 1R8HA 1X4AA 2DGSA 2CPJA 3IWNC 2MGZA 1P27B 4F25A
chains in the Genus database with same CATH superfamily
2CXEA 1LOUA 1XK8A 3CMQA 1WUUA 1FK9B 1RWPB 4KO0A 2XNRA 2XS5A 1PG5B 4LBIA 3HCXA 1T03A 1ZA2B 2QO3A 3E2EA 1QE1B 3V4MA 1MROB 4M5NA 2JEJA 1TKXA 1H7WA 2IVMA 1Q7YT 2ZD1A 5CZVA 2MQOA 3FCWA 3OVBA 1UVNA 1IQZA 2X1FA 2AP6A 3TEHB 5A0YB 1MG7A 3VWSA 3IR7B 2DR6A 3MEDB 1S1XA 1GQEA 2GGPB 4PG8A 1J5OA 3IA0A 2MY8A 1IJFB 3PW0A 3BKFA 3ZO7A 1U24A 4FBTA 4RW7B 4NLTA 3B4MA 3NCRA 4PRFA 1TKZA 3HM9A 2JVOA 2DJWA 4FPIA 3ZZZA 2EBGA 1Y3KA 4QOTA 2QLBB 4IH5A 4FS1A 3MAHA 4LSLA 4JI2J 1JWWA 4C0OC 4CLUA 4J90A 1I5OB 5J1EA 2V94A 4LRDA 4NRTA 2MQNA 4ANEA 1C2PA 3P8BB 1HKAA 1XR5A 2P9CA 3TQEA 3PYFA 1CULB 5KFWA 1U1QA 2UUAF 1VC6A 1KR4A 4X2BA 1NNDA 3ADAC 4L3KA 2Y1RI 2RHSB 4QIFA 2VFSA 2JEIA 1N36F 3L9ZA 2FY8A 2ZOGA 3OSNA 2XBPA 4Y34A 3ILOA 2LLZA 2W4PA 1HA1A 5D3GA 4F8RA 2P9GA 4ZVRB 3NCPA 3GYGA 3M05A 4I7FB 2ZBQA 4WBFA 4KGZB 3SZ2A 3R5BA 2NQPA 3W1YC 2GHPA 1X4DA 1RHQB 2LXFA 5HSPA 3R7NB 1I6JA 2O66A 2J8SA 2OPRB 2N7YA 4ZIWA 1SKWA 2B0GA 1NSPA 2RNEA 2E7WA 4LIRA 1ZTTA 2GMHA 2BJ9A 1K44A 4M5MA 5HL7Q 3UO0A 1YI2S 1U0HB 1UEKA 5IFMA 5EUHA 1U1MA 3C14A 2RUSA 2NXUA 5IWAF 3UWTA 3MUMP 4ECVA 1FJCA 1SKRA 4WP8A 3DI6A 4P10A 1O5JA 3DDKA 4F26A 4TY8A 5E0OA 1YIJS 3KTQA 1MU2A 1ZAWA 3ZZTA 1KWMA 4DV5J 2W25A 3KHRA 3GTYX 1CJUB 1GXLA 1AZSA 1JLBA 1BQNA 4DI6A 3Q8SB 4JI6F 2QLJB 2VC1A 2M88A 4Q7AA 3RGIA 4A8FA 3I96A 1GTHA 1ROFA 2J8AA 2AYEA 3GIRA 3LWMA 3MMCB 5CYQA 2ZH4A 3FFIA 3NGUA 3R9LA 3T5JA 2LXIA 2YPYA 3TUJC 2B7BB 4OX9F 3GV5B 3RU0A 2F4VF 2IM2A 5B0EA 2CPDA 1U25A 1V5IB 3GSDA 3KLIB 1AB8A 4YDXA 3BPDA 4G1QB 3W9HA 2I5JA 1FXLA 1LWXA 2XTJP 2CJBA 4U8VA 1D9FA 4GKKJ 1SJ3P 3TANA 1F5CA 2DHHA 2LQ9A 1Q0NA 2XYHB 1G1XA 2RE1A 4Z7YA 4NEZA 4RBUA 3DOMB 4OZ1A 1SB6A 1HQEB 2CNNB 2YX7A 2P2CB 4H4OA 2B8PA 2NXJA 4P2FA 2AEMA 3MDFA 4KBIA 2YPZA 1HD0A 2D3ZA 2F8HA 1K73T 4JYAJ 1IR1A 3N6MA 2VG7A 3FEZA 2DNHA 1S9EA 3ZTRA 2PD1A 3OR1A 4ZMMA 4DV3J 4F4XA 1FEHA 3ZTOA 2RKIB 2IMWP 4M5LA 3EWGA 3H25A 1YJTA 4FKXA 4DFKA 3W2VA 4Q2MA 2KHDA 2C22A 5T7LA 3Q8QB 2UVVA 2P6SA 1QAJA 4DV2F 1H2UX 3C6UA 2GIQA 5KT3A 4E2FB 4F25A 3RB4A 2HGNA 3FCHA 1JKHA 2H9ZA 5IT9U 4RBVA 2DKOB 2XHCA 2YNGB 1UJ5A 1VQ4S 1VGYA 1VQMS 2RRNA 2GZOA 1HNVA 2DR9A 1S6PA 3QYYA 2I6WA 2HRUA 3GIIA 3UD5A 3ZTSA 4ZVUB 1WDDA 4C8YA 3I55S 3M30A 2O3DA 2BJEA 4PEOA 2NXNA 3QAEA 3KMSA 1IBMJ 2RAQA 1M5SA 1N5YA 2Q3PA 2G9OA 1F3VA 5KT6A 1H72C 2CPYA 5DQHA 3R6GB 4DU7A 5C42A 2B9YA 1HQ2A 2R9LA 4ED4A 3MI7X 4L73A 3GONA 4CH7A 3GILA 4XPEA 1JK9B 3ZZRA 3CJ4A 1EP4A 3MAQA 5DG7A 3WIVA 4C6AA 3QNWB 3DGVA 1TMMA 3I32A 1F2HA 4X84A 4KO0B 1N4LA 2ILZA 5CYJA 2KYZA 3OJSA 1X8DA 4JOUA 2UUCJ 3ETOA 4F4KA 4DR4J 1T03B 3EVMA 2VU5A 1Q7LB 2ZZTA 2XMUA 1DTQB 2HPUA 3ZFVA 1D9AA 2W9CA 5ETRA 2DNYA 2ZD1B 3G8TA 2FTRA 3QQCD 3R2DJ 2W9AA 1QSLA 1VK8A 2M8DB 1S1XB 5HQLA 1IKYB 2Q6CA 4DPTA 1C1BA 2OD4A 3M1VA 1YK9A 3NS7B 1KFSA 4LT6A 3TJ8A 1J5OB 4GVLA 1XMOF 4Q5VA 1FNXH 2R8JA 1VQNS 1WORA 4WTYA 5EWEA 4IDKA 4UZBA 4DV6F 1YJNS 2ZH9A 4QR1A 3RUBL 1NRKA 1UEUA 3IFEA 4N41A 1WHXA 4PG6A 1PO6A 1X4BA 1FDBA 2BJDA 3ENQA 4LBHA 2DNRA 4S0MA 2RS8A 3Q24A 1NJWA 4LSLB 1LKZA 3M9OB 4MIBA 2E29A 5J1EB 3KK2A 2XZTB 2R2SA 4LMZA 1RWXB 4LF8J 4LVNP 3QRRA 5BXIA 1CJKA 3TUZC 4DUTA 1M5PC 4LRBA 2IY5B 1RWVB 3P4UB 3HSJA 4K2XA 1ZA1B 2CQ2A 3SQGA 2LVWA 1REVA 1D9DA 5KFVA 2DIUA 2CQPA 4CLZA 2ZBRA 1T9YA 3MM7A 4ZVOB 5D3GB 2HHWA 1HWLA 3J7YU 4NXNJ 2D9OA 1WOOA 3O5TB 3SMZA 1VC0A 3T5KA 2CPZA 4X62F 5A8KA 3D6MB 5B0GA 3PYGA 4EBCA 1MNEA 5KG4A 1JXVA 1U0SA 1FX2A 1XBWA 1M5VC 2D69A 4HYKA 1N32F 3AH6A 2HFSA 2OELA 1NKEA 5GAGU 1UVKA 4R0JA 4USKA 1KVIA 4DQIA 3DN9A 4WU2A 1VHIA 2YXLA 2HS0A 4P52A 3DI6B 3G4SS 5LMUF 2BKPA 4DSKA 5AJ3F 4TY8B 3BQ2A 1MU2B 1DTTB 4C2MA 3H42A 4DPOA 4K4SA 3PVXA 1AZSB 1JLBB 1BQNB 2XI3A 4USHA 1BY9A 5KFXA 2A6OA 2CJQA 4KHPJ 1WNEA 2O01C 4YB6A 2M7SA 1UKUA 2AJ1A 1GXUA 4C8NA 4P7VA 1IWGA 4NMXA 2VPXB 5E3PA 5HMWA 4ZP7A 1HWKA 2COLA 5CYQB 4KKOB 3FFIB 1IM6A 1Q95G 3KDNA 2DHAA 1S9FA 1Y10A 5LSLA 2YWHA 2YNIA 2FGOA 1T05A 2BBEA 3QT5A 1CBKA 5KFUA 2I5JB 5CXTA 2E1AA 2PGCA 4DSLA 4RNMA 2ZNZA 3B54A 3MTKA 2JX2A 2CVIA 2X3GA 3BEGB 2XWYA 4UY8T 4KHRA 3KG1A 3CJ3A 4H4OB 4WYLA 2NSBA 1P9YA 2QV6A 2MLXA 2EFQA 4J9PA 4Q43A 4LFAF 3R27A 5J2PA 1R0AA 2Y0SD 3UCGA 4OX7A 3OR1B 4QBUA 3PW2A 3PNIA 5I3UA 2JRSA 2M5YA 2H54B 3POTA 4ID5A 2DY1A 4A8XA 3OTOF 1TL5A 3MM9A 4ECSA 4MYUA 2HGMA 3W2VB 3V6HA 2L08A 1LFPA 1A6LA 2R2RA 5T7LB 2XSJA 3MPDA 5IM0B 1MWZA 2KXNB 1VDHA 2RRBA 3PRVA 2BRLA 3B82A 3C6UB 3BSOA 4FF4A 5HJXA 1K9MT 4YOEA 1HNZJ 3G86A 2EKNA 2DO0A 2RS2A 3FZBA 2B56A 1JKHB 2FGCA 2AGQA 2FHJD 2V8HA 1GX5A 1HNVB 1S6PB 2HGLA 1S10A 4K0KF 1V3SA 2LYVA 1MN9A 1HIYA 3DU5A 5KFKA 3M30B 2NYHA 2JOQA 4LFCJ 2DNPA 3VF0B 1WI8A 3OBIA 4N8OA 4B3RF 4JI4J 4B3MF 1ZBTA 3NGSA 5DDQC 1TTHB 5F8IA 3BREA 1X9MA 3NBPA 3KHGA 2HHTA 4I68A 5C42B 2PFFB 3T6JA 3FMBA 2PIIA 2HBRB 1D8YA 2CJYB 1K47A 4TKTA 4P6QA 5F8JA 2DRBA 3CCMS 2Z4PA 2HRTA 2N4CA 4ZPAA 3W8GA 2GW8A 4WFAQ 1JJHA 3ZZOA 1EP4B 1PKUA 3PR4A 4JI8J 3DLGB 3R3TA 4RU2A 2A0FB 1K1QA 3U1NA 2I2YA 3EZUA 4P2XA 3IM9A 1S0OA 3M9MB 2XY6A 4DUZF 1N52B 2V9KA 4OZ0A 2NPIA 4HDGA 2IMOA 1G4CA 1VQ9S 2W9CB 4IOCQ 4LFBF 1HHQA 2V63A 2IRXA 5T14A 2CUYA 4LIWA 2PA8D 4IO1A 3J7AN 3BBFA 4P2SA 2NXEA 1SUQA 4E98A 1SJQA 4LR7A 4WK1A 3QFWA 3CSKA 1S1VA 1D0EA 2FLLA 4OZJA 3RB6A 1VQ5S 5DG9A 1UPPA 3BN7A 2DNKA 4TU7A 2F40A 2CZ4A 3HLUA 4J9LA 3M1VB 1VQSA 5BYQA 4QW9A 1VRTB 4NA2A 3Q8UA 4PAAA 3SYZA 2F3JA 3L3CA 1TU0B 4IDKB 2Y0BB 7FD1A 2LA4A 2ZVSA 4ECWA 1SC4B 3U1MA 1SL1A 4I4BA 2OO4A 3HXMA 1V9OA 2K3KA 2AX0A 3ISZA 2AMCB 2FD2A 4BLGA 4ZJOA 4M5HA 3ONQA 3CC2S 1U2CA 2V4RA 3KK2B 2AEFA 4ECRA 5DLFA 1UP1A 1CJKB 2ASJA 5KG6A 1BMQB 1EZZB 4X4OA 3W66A 1VJQA 4USMA 4N47A 5LMNJ 2MDAA 3SQGB 3TVZA 1REVB 1CLFA 3PFOA 4WU3A 3EJMA 1DQ9A 3E51A 1IBCB 3MM7B 4A8KA 3FUYA 3GR0A 3G71S 1Z4UA 3M8YA 1KHWA 3G6YA 3GV7B 2ZM6J 1UETA 1XQIA 3TZXA 3JQJA 4L75A 4X4RA 2PT0A 4I64A 4F3QA 2EC2A 2AYMA 4WCEQ 5A8KB 2E9ZA 4C3KA 1CC7A 3CWJA 4JI7J 5D4LA 3NLCA 3GG0A 2Q79A 4JI5J 2ZHAA 4XAKA 1RT7B 1UA1A 4ICLB 4K4YA 4DFPA 3QRQA 3V81A 1Z2LA 3TVKA 5J2QA 3M8QA 4DV1J 1A0OB 4ETZA 3TZYA 2E5LF 4EBDA 2MLZA 1RWOB 2HHSA 4CYUA 3H90A 2AEJA 1DQAA 1KLMA 4HHUA 4OX6A 5JXSA 3PKYA 2RF2A 3IAS9 2HZCA 4OYOA 5C25A 2V8VA 5E7OB 3HJFA 1YJRA 1URNA 3DOKA 1WEZA 3CPWR 3KUEA 3G82A 5L39A 4MIWA 2H5IB 3NP5A 4AL6A 2UUTA 2XMWA 1MWQA 4URQU 4WFZA 1NLKL 5DGBA 1WACA 3BN4A 4EUVA 1SH3A 4M94A 5ADZA 3QJLA 2J9DE 1Q16B 5D0EA 4PZVA 3J80U 3K59A 4O3PA 1URRA 4IG0A 4I6WA 2YNIB 2VFVA 2D7SA 4CLFA 3TO8A 1K0VA 1T05B 1RTJA 2CWXA 4LF9J 4LF4F 5DDRC 2ZC4A 4K4ZA 3HKWA 4OJ3A 4J9MA 2DXFA 2HS4A 2QMWA 2WRMA 2R7OA 4LQ3A 3ZTQA 4HT7A 3GIKA 2UU9F 3CMAS 3PEHA 2UZAA 2CJKA 4HH0A 2LMIA 1W26A 1W7WA 3OTEA 4PUOA 4C8ZA 5IT0A 2DGVA 4RW4A 4IRDA 3IG1A 2WVEA 3NWGA 1B70B 2DHSA 2VV5A 1SL2A 2RRAA 3CCUS 3MM8A 2PEBA 3MR5A 4DR6J 4LF7F 3CDAA 3I82A 2JEFA 4ED1A 2V9WA 5I3UB 3D6FB 4ZJLA 4OIXA 4ID5B 3POTB 4JUZA 2KFNA 2ZBPA 1WHWA 1UJ6A 2BJ7A 5KG1A 4FF3A 1VRQC 4OYWA 3QGIA 2XSJB 3FBEA 1DARA 1QLNA 1BQMA 1NO8A 3W2WA 3CCTA 4QIGA 2L9WA 5AE1A 4RZRA 2W24A 2VPYB 2XY7A 3RG6A 3ENVA 4DF8A 3D3BJ 2FVCA 2IYIA 1YITS 2Z58B 1X5OA 3N4WA 4O3SA 3U02A 2PA3A 4PCQA 3FEXB 3M8SA 3RBDA 4ZJQA 1U6BA 1EJ7L 3NNCA 4ZVGA 5HANA 4QYRA 2R3VA 3FBBA 2MKKA 2ASYA 2FLOA 4O3RA 2IDLA 3LPEA 3B78A 2EG1A 2UVWA 2XNQA 1O51A 2GS8A 1QAYA 4KPCA 2CJXB 3K5MA 2WBMA 3NBPB 1HNWJ 2LEAA 4RUHA 1NMEB 1GFWB 2CDRB 3M8PA 4BBYA 2A2DA 2DGTA 1Q5YA 2R8KA 2LFVA 4F7VA 3HT3A 3CO0P 2DH8A 1RWNB 4GKJJ 2YKQA 4J9UE 2QTWA 3LALA 2JEGA 1RA7A 4C0HA 4OYIA 4JI2F 2MLYA 3HI9A 1HW9A 4IQMA 3DM2A 1GNKA 3M4XA 3MR6A 4DL3A 4ZCKA 4O4GA 1FE0A 1BWVA 3EE3A 4XIUA 2U2FA 4H4MB 4CDIA 4HACA 3S8SA 1PJ7A 4ECXA 1JLEA 2Z57B 3HJVA 4I6AA 2GIFA 2A10A 4KR0B 2IIHA 1R27B 5JMNA 5EWFA 1OY9A 3K58A 3CC7S 3ILJA 4ECZA 4MIAA 2HHHJ 4OYZA 1YBTA 2LQ5A 1S99A 1SUQB 5CCLA 5A76A 2HMIA 5IV4A 3PO4A 1S1VB 2QMUB 1RHRB 4WKRA 5AT1B 4EEYA 5SZTA 4F36A 2WB4A 1BLUA 4XTTA 3DOLB 1NJIT 2WSFC 3W60A 1UVIA 4YDDB 1WF0A 1IKXB 3KLFA 3ZZUA 2KFYA 1HBMB 4OX9J 4RUAA 2F4VJ 1V3ZA 3TJ9A 5HK4A 5LJ3Y 3MAAA 2JDJA 1FD8A 3ICLA 4QWCA 1NPKA 3EMTA 2ZHBA 1P27B 3AY0A 3CTRA 1PAEX 4DX7A 2OPQA 1IXKA 2KHCA 2GJIA 3TP2A 3J81U 4DV5F 1YLXA 4QQBA 4ED2A 3R7BB 1WC6A 2KI2A 5HI7A 4OZ5A 3CB4A 4ED3A 2NZCA 3F73A 2OI2A 2BRKA 1S6QA 5DS7A 3UE2A 1L3VA 2W1BA 2ZDPA 3H4DA 2DPIA 3NMRA 1FWLA 2OFGX 1VFJA 3P6YC 3CCRS 4PKDB 1MMNA 2X1AA 3R5JB 4EBEA 4UUXA 4F4YA 1ELOA 3BGUA 4EZ6A 3EPGA 3H5SA 4PWUA 1X5TA 1WKKA 1HBOB 3SSQA 2EFNA 4DV2J 4MH8A 1S72S 2M0GB 3O2IA 1ZM4A 3FBCA 1T0TV 4V1Ak 1ZM2A 4RX6A 3BO2A 4XDDA 2R2UA 3V81B 3MFIA 5FD1A 5J2QB 3HHLD 3D68A 3M8QB 2DH7A 1L5UA 4ES3A 5DGAA 1U48A 4Y2KA 4CYUB 3Q2TC 4PQUB 1KLMB 4TLQA 2RF2B 1EQ0A 1O8BA 1RWKB 4JYAF 4C8MA 5C25B 2N3OA 3SCJE 1RHKB 3KJQB 1X5SA 3HSGA 5AE2A 1PC4A 4DV3F 3DOKB 2F8MA 1FFWB 3G82B 3R1HA 4J9OA 1WEXA 5F0UA 2CQGA 4A8YA 3OFEA 1S97A 4ITSA 2BM0A 1VQ7S 2ZKUA 4U8YA 1KFDA 2BR0A 1APSA 2P6TA 4G1IA 2JVRA 4EYHB 2XQCA 3AOCA 5DDPC 4RJVA 4FBUA 4IFYA 4DQQA 3QT8A 3PO5A 3ZZYA 4IG0B 2HYIB 2ZZNA 4QCLA 1CVJA 1HQUA 2ZH1A 4Y2MA 2PFDA 1IN0A 3AJ2A 1RTJB 5KFTA 4QU7A 4QIWD 1LQ9A 1UMJA 5F9NA 3OQ2A 1KOHA 2HHQA 3JXOA 3I9ZA 2XGPA 4ZLJA 3R7SB 3OXGA 4D3HA 2FVPA 1VQPS 1IBMF 4PUOB 4CH1A 4RW4B 3IG1B 2DITA 3NAIA 3C46A 2HWTA 4C0BA 3GG1A 4Z2XA 3MM8B 1UFWA 2HURA 2G4BA 2QL5B 2MYFA 2QMXA 3LP2B 4I67A 1UA0A 2N82B 5DRKA 4LF6J 4ZOSA 2IPOB 3TX0A 4CIOA 3HFZB 2VASA 2E44A 5CHCB 4DN0A 1FRLA 4DV6J 3Q89A 5KFCA 3R2CJ 3MXHP 4O23A 3HK2A 3DXSX 2DGOA 3TW0A 2DHXA 4IG3A 1KTQA 2A6MA 1NM2A 3T6BA 1BQMB 3W2WB 4GRSA 1SC3B 4MYTA 4U7CA 2W4DA 3BGLA 5J1PA 2J7KA 3AJDA 2NPFA 1AUDA 2UUCF 3BGOP 4DR4F 1YZ6A 2GV1A 4QPXA 2QSWA 2XGQA 1U1NA 4IUFA 2DR8A 4IRKA 1X0FA 4WXOA 3J80Y 2OSQA 1WC4A 2AV5A 3IAM9 2RDJA 5A8RA 1KVJA 4DLGA 3MF5A 4YUDA 4X66J 4DF4A 4HTJA 2DNMA 2XMAA 1WEYA 3H40A 3R5CA 5E3AA 4NZ7A 4OV6A 3PCOB 3LP1A 3D0HE 3D67A 4K50A 4YN3B 1VQ6S 3DYAA 5G4DA 3B8HA 3M8PB 1NZAA 2BYCA 4H4KA 4HL9A 4ZP9A 3GFXA 2B9WA 2R2TA 1VISA 2VBYA 1R8HA 2GJ2A 2ZOMA 3IWNC 3MFHA 2AF6A 3PJWA 1IKWA 5I4MA 3PX0A 2GHWA 4O4GB 4JP8A 4HACB 1RT5A 2J0XA 1M5OC 2DISA 1GMWD 3TA0A 3HHLC 4TN2A 3LQVA 2ZH3A 2CFXA 5AJ3J 2CQ1A 2BE2A 1FESA 4NI2A 3P5TL 1WF1A 2UP1A 2DXDA 3QSIA 1F9EB 2RQCA 3CDUA 5AXLA 4KFBB 4MT1A 1RADB 1M90T 1C1CB 4USVA 3FCVA 4NXNF 3I87A 4CLWA 3DRPA 2HMIB 4RL1A 3F41A 1XIQA 3K57A 3D6TB 2YWGA 2X7IA 3EZ5A 3QGHA 1CS4B 4ECQA 2BQUA 2A2CA 3FC9A 3GLJA 3C6TA 3T1HJ 1Y4ZB 1S1TA 3KLFB 2HG4A 1QDUB 1CJTA 4MFBA 2B9XA 1RT1A 4AXJA 4B02A 3VZIA 3MAAB 3TA2A 1TELA 5KFMA 4YB7A 4EK2A 3MMJA 1NH8A 2UXCJ 3HVTA 2YWKA 1DQ8A 2VFTA 4O0NA 1UWBA 2V68A 2XM3A 1RU1A 2NREA 2J0SD 1TP7A 1JLFB 4DR5J 4PR6A 1UJ4A 1RU2A 4DFMA 1LWEA 2KKHA 3FK4A 3QMQA 3J7Z5 4NLDA 3SBMA 4HH1A 3W5YA 3CVKA 1NK8A 3IXQA 4KHPF 3RR7A 4JI3J 4HI1A 3SQOP 1S6QB 3V4IA 1RTZA 4B9NA 4O4RA 1OPZA 2FC8A 4A8SA 4U7UD 1UZHA 5DM7Q 3MOJB 4HVZA 2B43A 2OEKA 3OTOJ 1KS2A 4WXWA 5H1SV 2AU0A 1NSKL 5L1JA 4DZ6A 2B51A 2K7KA 3KG4A 4N56A 4P9SA 4DCOB 1ITPA 1RTDA 3GYXB 2FDNA 1S6UA 3IP0A 2MXYA 3GCWP 3J7YI 2ASDA 2QYGA 4QWAA 1N48A 2UXBF 5KFIA 1BGXT 2ASLA 3FSIA 3PW7A 1WTBA 5DM6Q 1XC9A 2AGOA 3P49B 2MQ8A 3RRHA 2WVFA 4A8WA 5KFQA 1AFJA 1NK5A 3PG9A 2VC0A 3DMJB 3OFFA 3CO9A 3KJNB 2F65A 4XK8C 2HHVA 3TUIC 1FDAA 1U47A 1B3TA 4CT9A 4G1PA 4RW8A 1EIYB 4NXMJ 5GAGI 4AXIA 3WQPA 2XS2A 1U8WA 5E33A 4B3RJ 2ZDOA 5KFPA 4NLXA 5E5NA 4DV7J 3QSYB 3H5YA 3J81Y 1KVKA 4J9VA 3HD1A 2JSXA 2HZVA 4USJC 3AD7C 3V6KA 4IFYB 3X1LB 3TAQA 4FP9A 2JWNA 3VAKA 1VQKS 4CQ1A 2H48B 3IWXA 4DLEA 3ITHA 3CC4S 2DNOA 1BWEA 1OQ6A 2ADBA 2AQ4A 3QZ7A 4J9RA 3K8VA 1FTCA 2LU1A 2ZFHA 4AQYJ 4TXSA 3HVRA 1DJ0A 1RKJA 2AYBA 4FKYA 3CUNA 4OLPA 3W7BA 4OHYA 2KG1A 1N5VA 1RA6A 2ZE2B 2IBOA 4LFCF 1X4HA 1FA0A 4CNYA 1WG5A 1RZMA 4DX8H 4EO8A 3PX4A 2RD5C 4JI4F 2CG4A 1AFIA 1X4EA 1S76D 2CQIA 3CDWA 1ACMB 2I38A 1DAXA 2IDEA 3I9V9 3I4PA 2OPRA 2PI4A 2ZHOA 2E1CA 1NUEA 3QATA 4ED7A 4QPTA 2QIFA 3PIOQ 5KFNA 4K59A 1IJEB 1NHVA 4JI8F 4IG3B 1RWMB 3OTBA 3GB0A 3HZEA 3LANA 4O44A 1SPBP 1Q78A 4LR8A 1R0BG 3GIJA 2ZJRQ 3UCUP 5IC4B 4WFXA 3HSZA 2OGUA 3Q8VA 1HARA 1VYAA 2IJRA 3DGPA 2HS3A 1QVFR 4ECYA 3T5LA 4ED8A 4C48A 1YJVA 2DEJA 1TVRA 5E3RA 4ZS6A 1FX4A 5A8RB 4PYAA 5D77A 2H5EA 3BKUA 1PBAA 2J6SA 4KGXB 4YP3A 1NDLA 3KLIA 1B7YB 2G0CA 2YNFB 3LP1B 4G1QA 4R5PA 1BE4A 3EGNA 2E5GA 1FJ7A 1S12A 1TK0A 3GWCA 1H98A 1OQ3A 3NOGA 1XNQJ 3SFUA 1NPRA 3B6BA 4I2QB 3EDQB 3OVSA 1HQEA 2L3MA 3ZNJ1 4OI2A 1IKWB 2SXLA 2VB6A 4DHVA 1UAWA 5F3ZA 1JXLA 1TUVA 2G13A 4WPAA 1R7IA 2G1DA 4ZIVA 1RT5B 4YR2A 1RDRA 2MKJA 1RT6B 1U6FA 5LMNF 4Y6IA 5D6GA 3C66A 2BE2B 4Q8EA 1FHTA 5LM7E 4NI2B 2ADCA 1YJ7A 4ES1A 3CJ0A 1HI8A 3IO1A 1T7PA 2ZM6F 1HPZA 4ZVTB 3IR5B 2UVUA 3KJVA 4KYZA 4OYPA 2CDQA 2YY3A 2HBQB 3DRRB 2GVDA 2PEHA 3DRPB 1OSCA 3BS9A 3HFKA 2IVFB 1OWXA 2ZITA 2IBKA 1UZDA 3ZC4A 4JI7F 4PXEA 4DQPA 2KRBA 2XI2A 4RU9A 4W92B 3QJJA 3C6TB 1N34J 4QWDA 3THPA 1S1TB 2VODA 3KHHA 4F04B 2XMVA 3UR0A 4DEZA 4OHVA 2QL7B 1CJTB 4MFBB 1RT1B 2Z2LA 3GFZA 2CPHA 4DV1F 1RE1B 3CCWA 3ET6A 3L95X 3MECB 1VQ8S 3HVTB 3D66A 6FDRA 1UWBB 1U26A 2QLFB 4PWWA 2AKWB 3CJQA 1LWEB 2W9BA 3IGVA 1U2RA 1ZH5A 2YTCA 1KOOA 2HNYA 1NK6A 2VH7A 5K20B 4E0DA 4HR2A 4RLEA 3B4DA 2EFGA 1Y11A 4CO3A 2JZ5A 2JC0A 2IRYA 2DXEA 4ES2A 4UY85 4KHMA 2R7SA 5B0CA 1UTAA 4LF7J 1U45A 2KM8B 1HLWA 3HHNB 2ZH8A 5KFSA 4J9SA 1KQGB 1GK8A 1DZ5A 2D1CA 1REGX 1H74A 1OSDA 2HZAA 1SC6A 1RP5A 2IM3A 4UT4A 3I5BA 4NLPA 4LF9F 1RTDB 1D3WA 2ERRA 4LF5J 4URGA 5E2QA 2VPZB 2GMLA 3TRGA 2KVQE 3D1OA 2DRDA 4NYZA 4B3OA 3VTIA 4OI1A 1DTQA 3CDEA 4TQSA 3W3SA 1NXIA 3BR8A 2M2BA 1XMBA 2MHNA 4AFFA 1OIAA 3CE8A 2UXDJ 3VHQA 1QUVA 3CT9A 4RWWA 4U6PA 1C4CA 1IKYA 1E6VA 4RW8B 4L76A 1QAXA 2EFVA 4DX5A 4IQXA 1LWFA 4DR6F 3GE9A 5CH7B 2FLPA 1UVMA 3H20A 2C2MB 3A1YG 1NHUA 1FERA 4DJBA 4IOAQ 1FD2A 2HBYB 3QO9B 3OSPA 2H4YB 2H4WB 4X4VA 2UV8A 1Q79A 4G3IA 5F3TA 3MTJA 4ILRA 3GU0A 2XLKA 1MW7A 5D0HA 2VQEJ 1Q1KA 4ALZA 5HMYA 1TR0A 2W01A 1YQHA 2FHKA 2ZJPQ 1HBNA 4BWMA 1VQYA 4PWDA 2E7VA 1GH8A 1EKSA 3ITHB 1TV6A 3FRYA 4FZVA 3CULA 2B5JA 4Q44A 3T5HA 3NWRA 4UOHA 4GC7A 2ROPA 5ETVA 3SSSA 3G8QA 1PC5A 4AT1B 2VFRA 3KLEA 2YKAA 3GJSB 1K1SA 4DPWA 4YR0A 4NCGA 5IQ6A 4IO9Q 3R5GA 2W2MP 4PQAA 1U1KA 3MR2A 3FVYA 4QYZJ 3DDNA 4MK8A 2JHEA 4JBCA 4ZPTR 1M1KT 3UD4P 3DRSA 1HNWF 4U95A 4JI0J 2OD6A 4X64J 4GKJF 3UI3A 1JLAA 1SJ1A 4K7QA 3PJXA 3LGNA 4X4NA 1Q86T 4O3OA 3UW1A 3IC1A 3AODA 2KT5A 4O44B 2FC9A 4NMLA 3G96A 1NDPA 5D8HB 5T41A 3BGFA 5ETOA 1DTTA 2BJ3A 3CD0A 1RT3B 2GO8A 4DPXA 3PTWA 1AROP 3LAMA 2ROEA 2C2OB 1LW2A 2WAQD 2HHHF 3DGPB 3FKBA 3MM6A 5ETNA 5J2NA 3SCKE 3UNYA 5C7PA 5D4NA 3OL8A 4DCJB 1TVRB 3M7VA 4C3MA 2HRYA 2XCPA 3HF5A 4KKOA 3CCLS 2RJZA 3GV8B 1OO0B 4FXVA 1Q5VA 3LGMA 3AXKA 2DNGA 2QSFA 4M95A 1T9WA 2HIYA 2EK6A 3NS5A 1DHMA 1FRHA 1NB2A 1PCAA 3N79A 4N76A 2BZ2A 2IHR1 4OYXA 4R5PB 2VONA 1NK4A 3E01A 1B0TA 4DR2J 3I6PA 4DCPB 2D9PA 2OMOA 1NZ8A 3A8JA 4OFZA 3NGDA 3WHIA 4Y65A 4CO2A 1D8ZA 4WIIA 2RDIA 2F4FA 3AQPA 1H3DA 4DS4A 5H9FK 1P1TA 2HFVA 1WHVA 1BUXA 4RPFA 1S1UA 3I4HX 3AD8C 5A8WA 4DOZA 1ZYQA 1OYDA 1LFWA 4OYMA 4F4ZA 4CTAA 3BH7B 5DG8A 1W2BR 3VV2B 4KIAA 3G87A 1JJ2R 4CLTA 1YRTA 3TZWA 4F50A 1HPZB 3K0JA 4AUKA 2GC8A 3KJVB 2X1GA 5HVFA 4M1KA 2ZJQQ 3KWMA 2GVDB 5IM0A 1DBDA 3SI8A 3PV8A 2Z2YB 3SFGA 4CH0S 4ER8A 4HLBA 1RLCL 1YJWS 4I1TA 3T1AA 3AB4B 2BKNA 4IH6A 2MB0B 1YBUA 4YB1P 1R8AA 2ZH7A 3U7JA 1GX6A 1HNXJ 4GVBB 3X3UA 3ET6B 1B7FA 4RNOA 3HD2A 1HWIA 1RACB 2DNNA 3O8WA 2W9BB 2MZRA 2CADA 2ZH2A 4Q8FA 4YHHF 3DXBA 1RGVA 2HNYB 4HT5A 4IR9A 2M9KA 1HW8A 4MMOA 2BMBA 2GQQA 3OFHA 3TARA 1PILA 3M6WA 5CAAA 3JS9A 2IM1A 2V4QA 1R8PA 2OEMA 2U1AA 4P73A 2L9NA 5K8OA 4F3MA 2RB7A 3AJ1A 4LRAA 1D09B 3WIUA 4ZPBA 5L38A 2CIMA 5KAKA 4CRJA 3IWLA 3V2UC 4ETXA 3DLGA 2J0QD 2HKEA 1AYEA 3W9IA 2VD3A 1P6TA 4PPZA 3H0PA 2D74B 4Y2AA 4PPDA 1IBLJ 3GJQB 5D4OA 1IBKJ 2EW9A 3K5NA 4Z7CA 1FKPA 4NLQA 5KFFA 2R8GA 1KDNA 4B3OB 4ANDA 2F5GA 5GADU 4UTGA 2GQ2A 1U2FA 2G0JA 3TA1A 2KXFA 2Z2ZA 1QAIA 3M8ZA 2WVCA 4NL5A 3CCVS 1YX2A 4IOBA 2HAFA 3ELHA 1E6VB 2OIHA 3KLHA 1RHUB 3T9NA 8ATCB 1LWFB 4ZPVR 3QZ8A 1RTIA 3D1HA 3QIDA 4GO5X 4LF6F 1N0VC 1VRTA 2HHXA 3MCMA 5A6PA 4CLSA 4DR3F 4OI0A 1IWAA 3MCSA 1BQXA 3S7RA 2RVJA 2QX0A 2AWZA 2VF3A 5J2MA 2FJAB 3CD6S 3CNQP 4JV2A 1RTHA 3RRKA 2MJUA 3IS9A 1S48A 1HBNB 3ISND 4PWDB 3AOBA 3VR1A 1TV6B 3ENAA 3M6UA 4N77A 3LH2S 5L1LA 4JV1A 1QTNB 2AX1A 2B5JB 2MTLA 3DDIA 3TYTA 5K8MA 3UFCX 1QM9A 2CPEA 2YH0A 1RAJA 1U02A 1S0MA 3KLEB 3MD3A 4PXDA 4NCGB 3U27A 5GAEU 4X66F 2N4DA 3JSRA 4DZDA 3DLBA 1NJYA 1SH2A 2C3UA 5IT4A 3NGKA 3UNGC 3MMBB 2W7OA 1VMBA 3UN5A 4X65J 2PO4A 1S0NA 4PG7A 3E8OA 3DRSB 2QA4S 3H7HB 4FNHA 2B3TB 3FNNA 1LXNA 1J27A 1CC8A 1NK0A 5I3PA 1RT7A 3SEOA 4ICLA 1JLAB 4LRCA 1KD1T 1S6OA 2IJFA 3OXFA 4WP3A 1SKUB 1V6HA 1FVQA 1TKTB 4ZITA 5ETKA 4DG1A 3BGRA 4PABA 4M8LA 2W2NP 5KG5A 2JH3A 4ZPDA 2WSEC 5IQQA 5AE3A 1FKOA 5KG0A 2DIVA 3H4BA 5DQIA 4NCAA 3PW4A 2C2KB 5DQGA 2MZJA 2OAUA 3NG8A 2KXHA 3VALA 1LW2B 3N6NA 2IA6A 1F0XA 3MM6B 1JJ4A 1X9WA 5J2NB 3FQKA 4OI4A 1FTRA 1KC8T 2BJ1A 2B6AA 1XR7A 2FJDB 4QR2A 1RBAA 5KT4A 4N5SA 2XMMA 1KQFB 2C3OA 2K8GA 1QVGR 4RUBA 4LUBA 3D0GE 3T1HF 3RBXA 4RUCA 3TVYA 4BWJA 3PM9A 2E1PA 1TK8A 3CIZA 1S1WA 4O3NA 3BPSP 3BBCA 1L3KA 4CO5A 2ZKTA 3AHPA 3GMGA 3ILLA 2B8QA 2C42A 5F8MA 1KHVA 3OL7A 2UXCF 3E01B 1N54B 5KFHA 1Y9OA 5I3QA 4YEAA 2UXBJ 4DSJA 1RYRA 1LNQA 4DR5F 2IRUA 2M70A 3A8EA 1WOPA 3SDEA 2WB1D 1FT8A 1NEEA 2G0IA 4UW2A 3MOZA 2AIRB 2KT2A 5ITHA 5F9LA 1S1UB 2A3JA 4JI3F 3IRXA 3U1LA 4I0WA 2CNKB 5A8WB 4ZCIA 5HN0A 3SSRA 2J6UA 3BO4A 4CTAB 2R8IA 3EGVA 2E9TA 2WBRA 5C24A 1EKRA 1M5HA 3ZTPA 3OHBA 2YKNA 4Y2CA 4KV8A 2EWHA 4I6YA 2HVZA 3N9UC 1TUGB 4Q45A 1V3RA 3Q22A 1I51B 4WTOB 1IR0A 4UZCA 1N0UA 2BUNA 4ZP6A 4NX9A 4DV4J 3JAMY 1KRPA 2V2QA 5B09A 2AT1B 3VVTA 4BCAA 4F2SA 2DGWA 5HBMA 2RDDA 2XWXA 4DUYJ 3TR5A 5CABA 1VHFA 1Z2ZA 3JTOA 3I0RA 2AJ0A 3WBZA 1FRJA 3ISNC 4EI2A 3KJFB 2I0XA 2VJUA 2CNLB 2ILYA 1RAFB 1TFWA 2PMZD 4NXMF 4FDFA 4NCBA 2CAJA 2IVYA 2HQDA 3PW5A 4XO0A 3BH6B 3N01A 4YY3J 3AT1B 2NYIA 3HHKA 2J7WA 3IM8A 4KRWA 3NMAA 3MPWA 4DV7F 2MPUA 3OLBA 4WYWA 5L8RC 1B4SA 3THTA 2VZ9A 4OV1A 5L1IA 2BKOA 1JQGA 3HFVA 3CW2C 4XDCA 4DBQA 1N33J 2JJ4D 3CGIA 3EGWB 2F8EX 3C8YA 2BE7D 3OUYA 2DPJA 4ZN1A 4H4MA 2CVEA 3D9BA 2ALYB 4AQYF 4DN9A 3BDEA 3D2WA 5KTQA 2VOPA 2XLJA 2XC9A 2V2ZA 1YG0A 1FKPB 2E66A 2MY7A 1VOMA 2NS1B 4DQSA 3VAHA 3MD1A 2FJWA 2F7VA 5RUBA 2N3LA 3M8WA 4OYBA 3MCOA 3PX6A 3PKMA 4NOHA 2MQLA 3PHTA 3H59A 1L3UA 3KLHB 3DOLA 5HLFA 2KFZA 1EETB 4DSFA 4Y0FA 3Q86A 1H7XA 2X3DA 3PJ9A 1IKXA 1RTIB 1HBMA 4KH1B 4MTPA 1Q82T 2BJ8A 1XJWB 4LVOP 4PXCA 5THWA 4WFNQ 1HD1A 1F5AA 1W2IA 1NK7A 3DLHA 3TX8A 1F60B 2I9SA 2DVIA 2XSFA 3GCXP 1SL0A 3G6VA 5J2MB 3TJAA 3A8KA 4NA3A 2ZOFA 3D1QA 2DNQA 1RTHB 3K7RA 3K8WA 1FVSA 3T1YJ 3IS9B 1T3NA 2Z8QA 1MN7A 5AXNA 5F8HA 4JB8B 4J91A 1LW0A 5D15A 5AXKA 4DL6A 4ZDNA 4P71A 4YFUA 3CCJS 1S4FA 2DGQA 2V6AA 1G2EA 3GZ7A 3K5LA 1ZAVA 4CNZA 2ABYA 2YX1A 3W9JA 4ELUA 2V0NA 3J7A1 2X51A 2YWWA 3P5BP 2AW0A 3KK1B 3SV3A 2LEPA 2VBXA 1P1LA 2EPIA 2DY9A 2YQ0A 5HO4A 4HDHA 4DR7J 2MMYA 3TNVA 1HBOA 8AT1B 1EQMA 3F56A 4ILMA 4MKYA 1QJHA 4FF1A 4NWBA 2YWEA 4ECUA 1XNQF 5ETTA 3VAFA 2WVBA 5CCMA 5D78A 5E3CA 4TU9A 2P9EA 4OHXA 3AQOA 1NB7A 1FO1A 4ELVA 5F8LA 4F67A 2F9JA 4ZA1A 4PQUA 4DFJA 1UL3A 5JVGQ 4DG1B 3BGRB 4ZN3A 3J81j 1J5EJ 2HNZB 4OJHA 2XS7A 4U96A 2MKYA 4C3LA 4K8RA 2KZZA 4NASA 1F3FA 1WG4A 1FKOB 3KMQA 1UPMB 4M5DA 5IZHA 5HQ8A 1ZM3A 3OVAA 3VAGA 1IVZA 1HHSA 3NY0A 1KQKA 5LSOA 2MQPA 1F2GA 1UFLA 5HAOA 5BR8F 4DSEA 4DDFA 1JXEA 4Y2IA 1R8CA 2HK2A 4FYDA 1RAGB 4F2RA 4B9LA 3AD9C 2B6AB 3MURP 4RW9A 5CD4A 3GFYA 4QR0A 1DLOA 1RAEB 4WF9Q 1WC1A 2CQCA 3T3FA 4QWBA 5ETQA 4ILLA 4FYWB 4Y28C 5C5JA 2CQ0A 1N34F 3SXLA 3NOCA 3UN3A 1PYOB 1S1WB 1VIXA 1MSWD 2BM1A 2UUBF 2H51B 2VG6A 3M2UA 4CP5A 4AE5A 3MPYA 4A4JA 2DH9A 1UW4A 2FJEB 1YJ9S 3M6VA 5F41A 4NLWA 5M2UA 3H2VE 2DT9A 2HNDA 1S7IA 3VZHA 3RAMA 2VDHA 2C2RA 3W5ZA 1QY7A 2C2ZB 5LT5A 3NL0A 3SDEB 2KDOA 2RIJA 3GFHA 3IBFB 1TAQA 1NJZA 4CZCA 3IRXB 3O44A 1LEOA 1NH7A 5KT7A 2B4VA 3Q8RB 2BQ3A 4IFVA 3BBBA 1DRZA 2XYGB 4HTIA 4RO0A 3LP2A 1VQLS 5C24B 3J7ZT 3OD2A 2FVSA 2YKNB 4KV8B 3BZQA 4LJMA 3LW5C 3K5OA 4X4PA 2BACA 5DJBA 1SV5A 3LUYA 1ZOTA 1OS5A 1R89A 4LF5F 2QGFB 2Y1JA 4B3SJ 1ZZFA 2FUG9 3DHWC 3I31A 5HJYA 2CQHA 2RH3A 1TZ0A 5HBMB 1VC5A 2HVDA 1Y00A 1CQNA 2IYGA 4CLYA 2UXDF 4DX6A 3I0RB 4MKBA 4UQTA 4BC7A 5FLXU 2WCXA 1TUWA 2MQMA 1VK3A 2QLWA 1TKDA 3WX8A 2QN6B 3DHXA 2RUGA 4PYDA 3GQCA 2RILA 2LQBA 2HFOA 5M2RA 2C2EA 2E1RA 2NXCA 3CEDA 5CA5A 1S57A 2C2DA 1X4CA 2M52A 4O3QA 1G6BA 2GFFA 2VDIA 3RAQA 4OMFG 5B0FA 1W25A 2PC6A 4M5GA 2JLGA 1FRKA 5HP1B 2VQEF 3A3OB 2RHQB 3G6ES 2HHUA 1RI7A 4M5JA 3MEGA 5K8PA 2IJNA 1NKBA 4ZVEA 3TAMA 3OUYB 4B9VA 2E5JA 1C4AA 1NJXA 1I94J 3NGRA 5HVGA 5A2QY 2DB1A 2HQIA 2QT7A 5IV3A 2C28A 4ZCLA 2XMTA 4KSEB 1PBUA 2G2OA 3JYTA 4RNFA 3UVJA 5I42A 2M4MA 8RUCA 3M6XA 4ZHRA 1RCOB 2GVZB 2QZ8A 3OPKA 2R7QA 4KFBA 2CQ3A 2LXUA 1UFKA 7AT1B 1C1CA 1FKAF 2WVDA 2VL1A 1JLQB 5LSRA 2Q66A 1EB0A 3CF5Q 3LAKA 4QYZK 5LL6d 3G6XA 2E7XA 3QIPA 3ENWA 2B9EA 4NE9C 4FXDA 1CS4A 3D0IE 1RKIA 2EFOA 2HHPA 2FHJA 3F0NA 1N8RT 4OLOA 3NNAA 5HLFB 3CJRA 2QRRA 3AOAA 3DFEA 2JC1A 3W65A 4JI0F 4X64F 5KFOA 2V8GA 1RYSA 4YR3A 1T3OA 3A3PB 5U47A 1AT1B 1TKXB 5G0RA 4USUA 3M9NB 1H2VZ 3DLKA 2HEKA 2IAJA 3RTVA 1Q53A 4ZVHA 3LA0A 1RUSA 1YGYA 3AAWB 2Y3YA 4TYBA 1JLFA 2KYXA 2DNZA 3KG0A 5H9FJ 5KOWA 3PFEA 2W2PP 2R7RA 2C1EB 4EZ9A 2DCLA 1FEEA 4A8MP 1LW0B 3D54A 1OJ4A 1Q8LA 2QA1A 3OT9A 2LA6A 4JV5F 3CJ5A 2KTQA 4K4TA 1Q81T 3KOAA 1TKZB 2FJXA 1BD6A 4U67Q 1WHYA 2HQGA 4DS5A 3EGZA 4DXLA 1MMDA 5B0DA 1ZTWA 4AD6A 2BOAA 1FNMA 4OZLA 3LOUA 3LTOA 5LXRA 3BF4A 4F0HA 1ZPVA 1IM4A 2OSRA 4F0MA 2O5DA 4DSIA 1UW9A 1VBYA 1AXQA 3V6DA 2PE8A 3MR7A 3NEKA 1KKHA 4DR2F 1RXOB 3KK3A 2C3PA 3HP6A 3PEJA 2WOMA 4OZ3A 1SVDA 1U1PA 2HWHA 2OTLS 4HI2A 1GXTA 3WC2A 3OL9A 2HLUA 5CYMA 4NPOA 2KU7A 3DMJA 3C3LA 2ATLA 1Y5NB 1GAOA 3QBCA 4NA1A 1ULRA 2HVEA 1ZS6A 4M5DB 4YHHJ 1XMQJ 1T9VA 2AJQA 4USWA 3RZAA 2DTJA 3DC2A 4TNOA 3MZIA 1KP6A 2P8IA 3HMJG 4M5KA 1DY3A 2XZWA 2D3O1 3DNCA 3C14B 3KFWX 4RW6A 1JLGA 2XULA 1VQOS 5IOLA 4RW9B 2W7AA 1BHNA 2H5JB 4J37A 1DLOB 3N28A 3VAIA 3JSMA 2KJWA 2XO6A 2NUHA 1Y3JA 2XLIA 3CMES 2A18A 4B08A 1X31C 2BE9B 3TI0A 1BXNA 4DQRA 1YRUA 2CWKA 4G65A 2Z30B 1TL7A 2WSCC 2VG6B 1HNXF 1M1GA 4YS2A 3M2UB 2DRAA 2CZ9A 2WONA 5KT2A 2FPHX 3N5FA 2V8DA 5L9NA 1IR2A 2V5HG 4OI6A 2HNDB 2PMWA 4NLUA 1WJ9A 2EFPA 2OH2A 2ZE2A 3C19A 2R7XA 3W8PA 5D0RA 2C3MA 1F9HA 5KG2A 1FRMA 1HFEL 1Q8IA 1YDLA 1E6YA 4DWIA 1FRIA 2OHDA 2AJ2A 1IKVA 3BYRA 1S49A 2QFJA 3S6EA 2PMHA 1WF2A 4IFVB 5FDLA 1B64A 2B4UA 2D41A 3CJTA 1R8BA 3QWPA 3PACA 2AZ3A 3QAUA 3W5XA 2CJAA 2HWIA 2FHOB 3RB3A 3R1LA 2K1RA 2VA3A 1X0PA 3L7PA 4DR3J 5KFEA 1YBAA 1LWCA 4WWSA 2NUUG 1SV5B 5JUMA 3Q0AA 1TMJA 2EKYA 3VGTA 3CD5A 2JLFA 1IBLF 2VJVA 1IBKF 2VG7B 1S9EB 5GMKa 3A12A 2KZMA 3NKYA 3T41A 5CQGA 4BS2A 3KUHA 2HK3A 2OPSA 2QEXS 1CJVA 3BDPA 3FDSA 3KHLA 5AXMA 2DYAA 3LO3A 6AT1B 4QZVB 2GO9A 4B9UA 1U1RA 3R6LB 3IGNA 2ZVIA 5KG3A 3DLJA 2MKHA 2YBVA 4PG5A 3GP9A 2HFZA 1QSSA 2DEIA 1AW0A 4UOFA 5LJ5Y 2YNFA 4C97A 4K5RA 4J9KA 3HSDA 2VQFJ 3E3XA 3KUGA 5KFDA 1FWPA 2YX4A 3G2XA 3JTPA 5KFYA 3UDLA 4JI1J 3RW7A 1Q8KA 4ZVSB 4I2QA 4QJVA 1S5ZA 3L7OA 1FFGB 3MEGB 4W4MA 4C9DA 3TAMB 1N5YB 1H38A 2Y8WA 4IKAA 3GJRB 1N88A 1I1GA 3D6HB 4P7TA 2J7UA 1HNIA 1RT6A 3RW6A 2WW4A 1KSPA 1R43A 3JYTB 1P8GA 3UVJB 5I42B 4J7CA 3MEEA 4ZHRB 3KKFA 1XNRJ 2GCFA 2XG8A 2AJ4A 4DV0J 2KO1A 2B7CB 3PY8A 3CCZA 4CLLA 5ETPA 5KFGA 3DRRA 1LK7A 1VRUA 3D28A 5DLGA 3QIPB 4X65F 5GADI 2XMKA 4CO0A 5J1NA 4ZCMA 2DBBA 4R25A 4C4WA 1KQSR 3PRDA 3KDOA 5KFJA 2V4JA 1AUSL 5FLXY 1YSJA 2UV8G 2V50A 2OKQA 5L46A 1S0VA 5G0RB 5B0BA 2QJ3A 3MPUB 3D5MA 2ZBIA 3MECA 3LGHA 1HHTP 3DLKB 2IAJB 1NCLA 4L6V3 3L7UA 1X9SA 3CDBA 2I8EA 3OLAA 5GAHU 5IT9Y 1NBEB 2XMJA 4GMKA 2QFIA 2DNLA 4CM2A 2KL8A 1C1BB 5F8NA 2DGSA 3EDRB 5HMZA 2VKRA 1JIHA 2VHGA 1U6ZA 2PDAA 2ATCB 3KNGA 2MZ1A 2FJVA 2HIQA 4NLOA 4V19X 2KT3A 2BXJA 1QD1A 3MUTP 1M5KC 2ZH6A 4F4WA 3RB0A 2MSTA 2XB2D 3DLEA 1HR0J 4NRUA 3BR9A 4A47A 4NYOA 2HW3A 3OTCA 2POKA 4C8KA 1G3OA 2XEXA 4TQRA 1NDKA 1PAUB 4J5OA 1U4BA 2O1PA 1KEKA 1Y7PA 3V6DB 4RKUC 2W2QP 3MR3A 2GQCA 2ALZA 4M5IA 1T02A 2Q1LA 1NDCA 3KK3B 5GAEI 3QRPA 1O0PA 2WOMB 5C2CA 1FNOA 1VI7A 3EVWA 1HYSA 1T95A 3ZZ0A 1H6KX 2YNHA 5EX0A 4X4UA 1UEVA 4MAKA 2R7TA 1FJGJ 2E5IA 5CYMB 4LRFA 2Z56B 4LQ9A 4GC6A 4KAIA 3RR8A 1XTZA 3S01A 1KLNA 2LQJA 2DR5A 2HLTA 1T11A 2QL9B 4ED0A 1RAHB 3BV8A 1FI4A 2AGPA 3CJ2A 2OPPA 3GSIA 2YH1A 4TVAB 3QGGA 2WTFA 1JMTA 3QO9A 5H9EK 2IC3A 3H98A 2E5HA 4RW6B 1JLGB 1XR6A 4DV4F 2KRRA 1YRXA 4DR1F 3JSMB 5CZXA 1TQLA 3UDCA 4P72A 1RK8A 4B3TJ 4I56A 1NHKL 4ZP8A 4P75A 2VA2A 4TY9A 4MKVA 1CEZA 4DUYF 2OMLA 4ED5A 2WW8A 4AL7A 1SIZA 1TL7B 3CJKA 2NR0A 3KNAA 4ED6A 4NLYA 2WONB 1N5QA 3FJ2A 1HI1A 3KYLA 4MK7A 4EFAC 4FS2A 2KB2A 4ZVQB 3LPYA 3A8IA 2N7CA 4NLGA 1HL6A 2KN4A 3NAHA 1YTYA 4J9QA 2H3EB 1WDTA 4R0EA 1LK5A 4YY3F 1QSYA 1M0SA 2IFXA 2BW7A 3L4BC 2HBZB 3L09A 5HROA 3A13A 1N5SA 1E6YB 4LR9A 2EI5A 4KE5A 3O3LA 1IKVB 2V8PA 4RR5A 3TOQA 3R5DA 4HHJA 2R42A 3HHLA 5FDLB 2APOA 3VQTA 1H2TZ 1WWHA 1NKCA 3PXGa 2MZSA 3BSCA 3JSYA 1RT4A 3OW2R 4LF2A 2QYCA 2V34A 2ZC3A 1N33F 3QFHA 1VIOA 2FJBB 4WFBQ 2K1RB 1LWCB 2KG0A 4QIEA 1PJ6A 2FZCB 2YQ1A 5K14A 3HVWA 2V2KA 5J2PB 5KG7A 1R0AB 4QW8A 4UOGA 1CG2A 3FEYB 4RNHA 2YQ3A 5HATA 4L74A 2RT3A 2XZDB 3CD7A 1RT3A 3LWLA 3M8RA 5ETMA 2JNJA 3PDNA 5EHHA 3AFGA 1KTVA 1FXDA 2OPSB 1CJVB 2CA9A 3MM9B 3AXMA 3BM7A 1SQFA 4CO1A 1U09A 2HQFA 2Y9HA 2EXUA 1M1HA 2OUGA 2G2YA 5GMEA 2K06A 2XYPB 4F3OA 1ZZNA 1KONA 2Y1IA 2W8KA 1VBXA 2VIHA 2OFHX 2BEFA 1U8SA 3Q8YA 3BQ0A 4KPYA 1RLDA 3OFGA 4FYYB 2UUAJ 3Q2SC 4AYBD 2EC0A 2LECA 2EG2A 1FFSB 4Q0BA 2YWFA 1N36J 4P2MA 3MM5A 3T1YF 4IRCA 1LXJA 3VAMA 3OTDA 1EHWA 1R6YA 1YJUA 3CCSS 3TAPA 4ZVPB 1R3NA 4YQWA 1WC0A 2E9RX 3K2YA 1Q8BA 2CPIA 2CQBA 1HBUA 1IQTA 3MHYA 3SCIE 3V5RA 1OY6A 2PN6A 4G6VB 1RBLA 5D0GA 4ELTA 1WD6A 3BYPA 1S4EA 1HNIB 2CPJA 2FHMA 3FQLA 4KTQA 4XPCA 1UVLA 1GTEA 1PGZA 3UQSA 5FJ4A 3MEEB 1NK9A 1GMUA 4CI0B 1Y5IB 1YKWA 1SJRA 1RT2A 1N56A 2AYGA 4BDPA 5BR8J 2L41A 5IWAJ 1TFYA 3SCLE 1VRUB 4DR7F 1VBZA 3CCQS 2W4CA 1S7HA 1SI9A 4C11A 1RSCA 4MKAA 2YVSA 2UUWA 2GJFA 2DD8S 5CD4H 2GA7A 2R7WA 4OHWA 2VG5A 1WKJA 2RSQA 2V4JB 1ZETA 1UVJA 3C16A 4JI6J 2MEWA 2UUBJ 1QUPA 3NXZA 1RWUA 4GVBA 3JQMA 1F6TA 2J6TA 3MPVA 1N6QA 1J5EF 2LDYA 1WSVA 5ETSA 4Z37A 2HQCA 3O1LA 3EVOA 1JLCA 3I5AA 2ROGA 3W63A 4Y3CA 2QA2A 2DK2A 4ECTA 4CT8A 3N0VA 1X5PA 3FMWA 4ZLLA 1GEHA 1PSDA 3VGUA 1J2VA 4DPUA 3Q83A 2BANA 1A9NB 1X4GA 3ZXWA 3CJ8A 2MSSA 5BJRA 5M2PA 3DLEB 4KQZA 4WFYA 1T8EA 1GMWA 2J9EA 1VLYA 3QJPA 1KNZA 3R97A 1K0TA 1SQEA 3HKZD 1XERA 1B99A 3DRXA 2BDPA 2Y8YA 3IRWP 3SV4A 3QPIA 4WZMA 3MWBA 2XO7A 3BKTA 1C0UA 3LF0A 2IM0A 2IA0A 4I69A 2CQ4A 4H4KC 1HYSB 5SUHA 2YNHB 5KFLA 1NU4A 3H8YA 2RQMA 3HO1A 2DGXA 5GMDA 1SIWB 1OMSA 2R7VA 2HVHA 1WC3A 2OEJA 4QIVA 5DZ7A 1S9GA 2R4FA 4ZVFA 1LV5A 2J9DA 2MJNA 1K8AT 1F1BB 4GKKF 1SKSA 4C98A 3C15A 2FIUA 3M2RA 4BC9A 1U7LA 2OPPB 1QTMA 3IBCB 2QC3A 5KOXA 4RWXA 1WSRA 1T9TA 4OZNA 1FJEB 3EX7B 3M2VA 4P74A 3HVAA 2IC3B 2VICA 4W98A 2Q6BA 1R0CB 2FQQB 3NS6A 3EM1A 2CKWA 4DL0C 2MKSA 3RJMB 2RQKA 4FN5A 2NLWA 4ZK7M 1JB0C 2EBEA 1NSQA 4B3SF 2HSEB 3D7SB 2BABA 5EDWA 1RHJB 3HHEA 4X4SA 1SBRA 4NZ6A 1GT8A 4LF1A 1PYTA 3US5A 4WP9A 3CJKB 1RAOA 2RU3A 4B9MA 4HHHA 4N7TA 3VVUA 4OL8A 4CLPA 4K4UA 3OV7A 4DMZA 2J9CA 3TUPA 2L48A 1HI0P 3EZOA 1KBRA 5GVQA 3WC0A 3PHEA 4TYAA 4U9RA 2AD9A 4EU0A 3MMAA 4E8UA 5HROB 2AHOB 1ZAXA 3EXCX 5F8GA 3DU6A 3MMBA 4A46A 3VCDA 2LU2A 2ACMA 2AZ1A 3CIMA 1RJJA 2LEBA 2GMJA 3HHLB 4UOCA 1SH0A 1WC5A 1NPPA 5LOQA 2C3YA 5E3QA 2ZUGA 3HX9A 4B17A 2ZBCA 2KM8C 4C7QA 5B08A 4IR1A 1Y5LB 1RT4B 3HHDA 3CJSA 1OPIA 1MWYA 3THVA 2W8LA 1TKTA 3MCNA 2YKPA 1I94F 2KH9A 5K14B 4WZQA 4EMDA 2DR7A 1B0VA 4CO4A 1OY8A 2CG8A 3KLGA 3RRGA 1SXLA 2FB0A 4OJ1A 1VLOA 2F63A 2UVRA 2JFKA 2CPFA 2M8HA 1JX4A 3JAMU 4UUWA 5KFZA 3PR5B 4ZLPA 4OQJA 3VGVA 4UF4A 4FPRA 1TL1A 1X4AA 1XMOJ 1TL3A 4FNIA 2MGZA 4KGKA 4YB5A 4KJIA 4JV5J 2MZQA 2VKZG 1PJ5A 5KFRA 3BQ1A 1XWLA 1P9QC 2ZUAA 3GJTB 3RAXA 1Z1ZA 3P45B 4NZ0A 2CYYA 4O0IA 4F4AA 3FBFA 4M63A 3A4TA 5DO2A 1CPZA 3K89A 2J5AA 2C2NA 3D3CJ 4WJBA 1SCJB 1C0TA 1T9XA 2YKMA 3UPFA 2KJVA 4LSZB 2F1FA 7FDRA 4N8NA 2VBWA 5A6WA 3PZPA 4Q0BB 3MM5B 2PI5A 1UCNA 1VJWA 4ZLNA 5HMXA 2CZVC 2DO4A 4A8OA 2CJ9A 5HVHA 3HT0A 3QLHA 1HBUB 2ZWPA 4X62J 3EYZA 2NSCA 1YZ7A 1ICEB 2WZ1A 1MMLA 4LBPA 3ZZPA 2GHVC 3UN2A 2VFUA 1RT2B 3FZ2A 4ENOA 2DGUA 1N32J 3GIMA 3T19A 3I56S 3BSNA 2RU9A 3DM2B 2GNKA 2ZEJA 2BOPA 3R8YA 4LF8F 2V69A 1DFDA 4LSNA 4NLSA 9RUBA 1X60A 1WKLA 2QLXA 2Z2MA 2CRLA 4CLKA 5LMUJ 1JLEB 2W7PA 4C11B 4I2PA 1FRXA 1RHMB 1S79A 3SIPB 1FDDA 2LP4A 1HMVA 3M32A 2VG5B 3EXYA 1FXRA 2K2PA 2AJFE 1RCXB 3MUVP 3C16B 1RAIB 2B4OA 5K9FA 1Q4RA 5K5MA 1TK5A 2H1YA 1SJFA 1SQGA 4EGLA 4A48A 3W61A 1N6QB 1YVFA 2L9DA 3R5AA 4FF2A 1KN6A 4BHQA 1JLCB 2VOOA 5B0AA 3I0SA 3BSAA 2BVZA 2DCUB 4F0KA 4DPYA 1A7GE 4FYXB 2J76E 2CNOB 3RBEA 4RNNA 1WOSA 1XMQF 4ATNA 4PG4A 3TEGA 1B0PA 2I1RA 3NRBA 4NYPA 3OR2A 2QG9B 2A1BA 3T9ZA 1X7VA 3LP0A 3TQ1A 2ACYA 3H2LA 4UQGA 3FSYA 3QGPA 4QWEA 2BANB 2DHGA 2ZNYA 4OI3A 3H5XA 4LREA 5ETLA 2P5VA 2G2ZA 4HKQA 4AL5A 2OPQB 4D3GA 4R8UA 2ZH5A 6FD1A 2LQ8A 4OJGA 4URSA 1AA1B 4CWBA 3H5UA 2K3IA 2MKIA 4NEYA 5KFBA 5K8NA 4K4VA 4LFAJ 1V5VA 2MZTA 1HWJA 4FVMA 4RBTA 1FCAA 5JJBA 1VBKA 1C0UB 4K5SA 2FY1A 2D3OR 3JQKA 4K4WA 1F5BA 4MJKA 1L3TA 2XCAA 2GIRA 4J9NA 4WIQA 4DL2A 3I5CA 4K4XA 4WE1A 4L3NA 3UD3P 3RBZA 3ETMA 2RQ4A 5C2GA 3HDSA 1R6VA 4DL7A 2WHOA 4L72B 4OYAA 1RABB 3MEKA 1FK9A 1S9GB 2NCKL 2JFDA 3WZ0A 1EETA 4Y00A 3JTNA 3QT6A 1JJCB 3C15B 5IC6B 9ATCB 1EARA 2HQ3A 3M2RB 1U1OA 1RWWB 3PRBA 5DETA 2QE5A 5D4PA 1QE1A 3NGTA 1MROA 2CPXA 3BJYA 1RB0A 2W2OP 3M2VB 2LKZA 2CQDA 2HVIA 4EWTA 3W62A 1F9FA 2H65B 2BV3A 2NZ4A 4K0KJ 3TWZA 3TZZA 5A0YA 1YWXA 1R31A 3MEDA 4KGMA 1WI6A 2D3UA 2GGPA 2Y1LB 5DZ6A 3MGJA 4KY3A 1TL4A 5E41A 3VQSA 5BYRA 2F9DA 1N5TA 3P96A 3DRYA 4B3MJ 5JVHQ 3G9CA 3PYEA 2FZGB 2Z0GA 3OHAA 2B4PA 4RW7A 4OX8A 1VCTA 2BX6A 2LCWA 4OZ2A 3KK1A 3S1TA 3AA9A 3PIPQ 1HNZF 4QU6A 4B9TA 3MMAB 1RQ0A 2RMLA 3AA8A 4F02A 2MHEA 3OJUA 2VQFF 1HQUB 1NAQA 3K17A 4WK3A 2R7UA 3QWUA 1CULA 1WG1A 3IN5A 4JI1F 1PIEA 3K5PA 5KFAA 4IYQA 2VPWB 1OYEA 1BC6A 3KXDA 4DUZJ 1H0HB 1T94A 5EWGA 4PXBA 5HQMA 2G1HA 4TU8A 4LFBJ 2HFNA 2LDIA 3AB2B 4I7FA 4Q2LA 1EX8A 3FRZA 5F0WA 4DL5A 4ZPWR 1D1UA 4KC5A 3DLLQ 1S59A 2HNZA 1G7CB 3UDEA 3KLGB 3JSBA 3EPIA 4W90B 2WK4A 4FVCA 3PYDA 1GMVA 2PSZA 4ZPCA 2GX8A 1XNRF 2BW2A 3C2PA 1TL1B 1TL3B 4DV0F 2QA4G 3HZGA 2MGZB 2FYXA 1U0HA 5IS2A 4CM0A 2HFUA 4EO6A 1YHQS 1ZPWX 1WELA 1VS3A 3ULHA 1JNZB 3CXCR 2FZKB 2VUGA 4JV0A 5L9XA 1NSAA 3QT7A 4YMEA 3BB5A 4C8OA 3IR6B 2EVZA 1CJUA 5LXYA 3FSXA 2JLEA 1H73A 2OLWA 3GR1A 4DL4A 2YKOA 3IBWA 1JNRB 5MAOA 3N5BA 3GPAA 4K2JA 3OL6A 4KT0C 2YKMB 1C0TB 3GYNA 2OJ3A 2EEYA 3FGVA 3Q23A 4B9SA 2Q43A 1FF2A 3MMCA 4H54A 2FVQA 4NLRA 2GAHC 3HPOA 2HAIA 3JB9k 2KVIA 2XHWA 3OXLA 3O6QA 4HEA9 3HULA 4U7UK 5KT5A 4X4TA 1ZM9A 3QLHB 1SJ4P 3A3NB 4GO7X 5BYSA 3DYAB 1DURA 1RBOB 2K7JA 1SC1B 3H2UB 4MK9A 4C8LA 4FYVB 4TLRA 2OTJS 3DOMA 5A2QU 5L1KA 3NNHA 1HR0F 5MLCV 3W64A 4A8QA 2OP5A 5H9EJ 2E5LJ 4ANCA 3Q8PB 1XEZA 1RISA 4LSNB 2R8HA 3UCZP 4NLVA 1HWUA 4EYIB 5EN1A 4DU8A 4DR1J 4USIA 1I3OB 2V67A 4I2PB 1U49A 1UWAA 1HMVB 1CSJA 4X4QA 4ID8A 3DCAA 4OHZA 1L3SA 3M32B 2XY5A 3RYLA 4V19J 2RKIA 4WKYA 2ZWOA 1PYSB 1FJGF 1FWKA 2MQQA 1EAYC 2EK1A 4KGVB 3CCES 1FE4A 1X4FA 3F44A 3BO3A 3WDOA 2X1BA 3D4JA 3ILIA 2GAGC 3EICA 2JL9A 3VGSA 3G8SA 1S77D 1RAAB 2M3DA 1WTFA 3I0SB 4KH0B 3N6LA 5EGYA 1Y0HA 3KLVA 1IUJA 5FIIA 3NCQA 4JI5F 1T9UA 2ZZMA 4ZKAA 5EX3A 4USTA 3ZNUA 2FVRA 2E1MC 2YNGA 3OR2B 4IH7A 5GAHI 3LP0B 5IXUA 3WX4A 4LF4J 3VAJA 2BA9A 1U1LA 5HP1A 2MKCA 2J0WA 5DDOC 4KB7A 2UU9J 4R8UB 4B3TF 3V6JA 3DKDA 1CQMA 3UDVA 1VR6A 4FXWA 2V2VA 5B7WA 3P3DA 1FDNA 1MLAA 3IMQJ 1O6XA 1XN9A 3V4IB 4ERDA 2GVZA 4WE1B 2O67A 2BQRA 2VBZA 3EUNA 2FLNA 1JLQA 4CCHA 1TAUA 3UR3C
chains in the Genus database with same CATH topology
1JIHA 1LOUA 2R8GA 1XK8A 4B3OB 1U6ZA 1FK9B 3AY0A 3CTRA 5GADU 4KO0A 2GQ2A 1U2FA 2OPQA 2XNRA 1IXKA 2PDAA 2KHCA 2XS5A 2GJIA 3KNGA 2MZ1A 3TA1A 3TP2A 2FJVA 2HIQA 2KXFA 4DV5F 4QQBA 1QAIA 4NLOA 4ED2A 4NL5A 4V19X 2KT3A 1T03A 3CCVS 2BXJA 4IOBA 3MUTP 1M5KC 2QO3A 2ZH6A 2KI2A 4F4WA 3E2EA 3RB0A 2MSTA 5HI7A 2XB2D 1QE1B 3V4MA 1MROB 1E6VB 4OZ5A 2OIHA 3DLEA 3CB4A 4ED3A 3KLHA 2JEJA 1TKXA 3F73A 4NRUA 1H7WA 2IVMA 2BRKA 3T9NA 1Q7YT 2ZD1A 1S6QA 5DS7A 5CZVA 3UE2A 1LWFB 2MQOA 4ZPVR 3BR9A 4A47A 3QZ8A 4NYOA 2HW3A 1RTIA 3D1HA 1L3VA 2ZDPA 3OTCA 3QIDA 1UVNA 2POKA 3H4DA 4C8KA 1IQZA 1G3OA 2DPIA 4GO5X 2OFGX 4LF6F 2XEXA 1N0VC 4TQRA 2X1FA 2AP6A 3NMRA 1VRTA 4J5OA 1VFJA 1U4BA 5A0YB 3VWSA 3P6YC 3IR7B 2O1PA 1KEKA 1Y7PA 3CCRS 3MEDB 4RKUC 4PKDB 3V6DB 1S1XA 1GQEA 2HHXA 1MMNA 2GGPB 3MR3A 2X1AA 5A6PA 4EBEA 2GQCA 2ALZA 1T02A 4UUXA 4PG8A 2Q1LA 1ELOA 4F4YA 3BGUA 4DR3F 4OI0A 4EZ6A 3KK3B 3H5SA 5GAEI 3EPGA 1O0PA 2WOMB 3MCSA 4PWUA 1FNOA 1BQXA 3S7RA 1VI7A 2RVJA 1J5OA 3IA0A 2AWZA 2MY8A 1IJFB 1HYSA 5J2MA 1T95A 1X5TA 1HBOB 3ZZ0A 3PW0A 3SSQA 1H6KX 2YNHA 2FJAB 5EX0A 2EFNA 1U24A 3CD6S 1UEVA 4X4UA 4MAKA 2R7TA 4MH8A 1S72S 4FBTA 1RTHA 2E5IA 5CYMB 4JV2A 3RRKA 2M0GB 3O2IA 2MJUA 3IS9A 1S48A 1ZM4A 4LQ9A 4NLTA 4RW7B 3B4MA 3NCRA 4PRFA 4GC6A 1HBNB 1TKZA 3ISND 4KAIA 4PWDB 3HM9A 2JVOA 1ZM2A 2DJWA 4RX6A 3RR8A 3BO2A 3VR1A 1XTZA 4XDDA 3ZZZA 1TV6B 3S01A 1KLNA 3M6UA 4N77A 2R2UA 2EBGA 2LQJA 3LH2S 1Y3KA 4QOTA 5L1LA 2DR5A 3V81B 4JV1A 4IH5A 4FS1A 2HLTA 3MFIA 2AX1A 5FD1A 5J2QB 2B5JB 3HHLD 3M8QB 3MAHA 4LSLA 2DH7A 1L5UA 3TYTA 2PFFB 4ED0A 1JWWA 4C0OC 5K8MA 4ES3A 5DGAA 2AGPA 1U48A 3CJ2A 4Y2KA 1QM9A 3UFCX 5J1EA 2CPEA 3Q2TC 2OPPA 2V94A 4PQUB 1KLMB 2YH1A 4TLQA 4NRTA 2MQNA 2RF2B 2YH0A 1RAJA 1O8BA 1S0MA 1C2PA 4JYAF 3QGGA 3KLEB 4C8MA 3MD3A 2WTFA 1XR5A 2P9CA 5C25B 4PXDA 4NCGB 1JMTA 2N3OA 3QO9A 3SCJE 3U27A 5KFWA 5GAEU 1U1QA 2UUAF 4X66F 2N4DA 1VC6A 1X5SA 3JSRA 1KR4A 4X2BA 2IC3A 1NNDA 5AE2A 3H98A 2E5HA 4RW6B 2Y1RI 1JLGB 1PC4A 4QIFA 1SH2A 2C3UA 2VFSA 3DOKB 1XR6A 4DV3F 4DV4F 5IT4A 1NJYA 2F8MA 1N36F 2JEIA 3NGKA 2ZOGA 3UNGC 3OSNA 2XBPA 3MMBB 2W7OA 1VMBA 2KRRA 4Y34A 2LLZA 3R1HA 2PO4A 1S0NA 2W4PA 1YRXA 4J9OA 4DR1F 3JSMB 5CZXA 1WEXA 1TQLA 4PG7A 1HA1A 5F0UA 2CQGA 3E8OA 3DRSB 4F8RA 5D3GA 2P9GA 4A8YA 2QA4S 3OFEA 3UDCA 1S97A 3NCPA 3M05A 2BM0A 4FNHA 1RK8A 2ZKUA 4I7FB 4ITSA 1KFDA 2B3TB 4I56A 4ZP8A 2BR0A 1APSA 3FNNA 1LXNA 2P6TA 2VA2A 1CC8A 4G1IA 1NK0A 2JVRA 5I3PA 4TY9A 4EYHB 1RT7A 3SZ2A 1CEZA 4DUYF 2OMLA 3R5BA 3SEOA 4ED5A 4ICLA 2NQPA 1JLAB 2WW8A 4AL7A 2GHPA 1SIZA 1X4DA 5DDPC 2LXFA 4FBUA 3CJKA 1KD1T 4IFYA 1I6JA 2O66A 2NR0A 1S6OA 4DQQA 2IJFA 2OPRB 2N7YA 3KNAA 4ED6A 1SKWA 4NLYA 3OXFA 2B0GA 2WONB 3PO5A 2RNEA 1N5QA 3FJ2A 1HI1A 3KYLA 2E7WA 4MK7A 1V6HA 4EFAC 4FS2A 4LIRA 1ZTTA 2GMHA 1FVQA 3ZZYA 2KB2A 1TKTB 3LPYA 4IG0B 2HYIB 4DG1A 3BGRA 2ZZNA 4QCLA 1CVJA 2N7CA 4M8LA 1HQUA 2ZH1A 4Y2MA 5HL7Q 4NLGA 1HL6A 5KG5A 2KN4A 3NAHA 1IN0A 1YI2S 3AJ2A 5IFMA 1RTJB 5EUHA 2JH3A 1YTYA 4J9QA 4ZPDA 2WSEC 1U1MA 5IQQA 5AE3A 1FKOA 4R0EA 1LK5A 5KFTA 4YY3F 1QSYA 2NXUA 5KG0A 5IWAF 4QU7A 2DIVA 3UWTA 3H4BA 4QIWD 1M0SA 2IFXA 3MUMP 1LQ9A 3L09A 1UMJA 5DQIA 5HROA 5F9NA 3OQ2A 4NCAA 1N5SA 4ECVA 3PW4A 1E6YB 1FJCA 1SKRA 5DQGA 2MZJA 1KOHA 2HHQA 2EI5A 3DI6A 4KE5A 2OAUA 3NG8A 3I9ZA 3O3LA 2KXHA 2XGPA 1IKVB 3VALA 1LW2B 3N6NA 2IA6A 1O5JA 3TOQA 3OXGA 3DDKA 1F0XA 3R5DA 4D3HA 4HHJA 3MM6B 2FVPA 1JJ4A 3HHLA 1VQPS 1X9WA 4F26A 4TY8A 5E0OA 5J2NB 3FQKA 1MU2A 5FDLB 1YIJS 1IBMF 2APOA 1ZAWA 3VQTA 3ZZTA 4PUOB 2W25A 3KHRA 1GXLA 1H2TZ 4OI4A 1FTRA 4CH1A 1KC8T 1WWHA 4RW4B 1NKCA 2B6AA 1XR7A 3IG1B 2DITA 1JLBA 3NAIA 1BQNA 2FJDB 4QR2A 3C46A 2HWTA 4C0BA 3PXGa 5KT4A 3Q8SB 3GG1A 4JI6F 4N5SA 2MZSA 2XMMA 3BSCA 4Z2XA 1KQFB 2C3OA 3JSYA 1RT4A 2K8GA 2VC1A 3OW2R 1QVGR 3MM8B 2QYCA 2M88A 2ZC3A 1N33F 4Q7AA 1VIOA 4A8FA 1UFWA 2FJBB 4WFBQ 2K1RB 4LUBA 3D0GE 3T1HF 2G4BA 4RUCA 3TVYA 4BWJA 3I96A 1LWCB 3PM9A 2MYFA 2QMXA 3LP2B 2KG0A 4QIEA 1GTHA 1ROFA 2J8AA 1TK8A 2AYEA 3LWMA 4I67A 3CIZA 5K14A 1S1WA 5DRKA 4O3NA 4ZOSA 2N82B 1UA0A 1L3KA 4CO5A 2ZKTA 3AHPA 3MMCB 5CYQA 4CIOA 3HVWA 2V2KA 2ZH4A 3GMGA 5J2PB 5KG7A 3FFIA 1R0AB 2C42A 2VASA 2E44A 3T5JA 4QW8A 2LXIA 1CG2A 3FEYB 5CHCB 4RNHA 1FRLA 4DN0A 5F8MA 1KHVA 2YQ3A 5KFCA 3OL7A 2UXCF 3E01B 3TUJC 2RT3A 3MXHP 2B7BB 3CD7A 4O23A 1N54B 3HK2A 1RT3A 3DXSX 2DGOA 4OX9F 2DHXA 3TW0A 4IG3A 3LWLA 5KFHA 1Y9OA 3M8RA 3GV5B 5I3QA 4YEAA 3RU0A 2F4VF 1KTQA 2IM2A 3PDNA 5B0EA 4DSJA 2CPDA 1RYRA 1U25A 3GSDA 3KLIB 3T6BA 2IRUA 5EHHA 1BQMB 3W2WB 4DR5F 4YDXA 4MYTA 1KTVA 4U7CA 1FXDA 2M70A 2W4DA 2OPSB 4NLQA 4G1QB 3BGLA 3A8EA 5J1PA 2I5JA 2J7KA 3MM9B 1FXLA 2NPFA 2CJBA 3BM7A 1AUDA 1D9FA 2UUCF 3SDEA 2WB1D 1FT8A 1SJ3P 4DR4F 4CO1A 3TANA 1F5CA 1NEEA 1U09A 2GV1A 4UW2A 2LQ9A 3MOZA 2QSWA 4QPXA 1G1XA 2RE1A 4RBUA 2KT2A 5ITH