1X4DA

Solution structure of rrm domain in matrin 3
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
102
structure length
102
Chain Sequence
GSSGSSGQKGRVETRRVVHIMDFQRGKNLRYQLLQLVEPFGVISNHLILNKINEAFIEMATTEDAQAAVDYYTTTPALVFGKPVRVHLSQKYKRIKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matrin 3
publication title Solution structure of RRM domain in Matrin 3
rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 12
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x4dA00
2MKIA 1YWXA 1UP1A 4TLQA 3BEGB 2LCWA 2D9OA 4V19X 3VAJA 3ZZZA 4ED5A 2V94A 3BO2A 5LJ5Y 1VQMS 3NNAA 1K73T 1ZZFA 2AD9A 5DDQC 2HZCA 5LXYA 5GAGU 1X5OA 1VC0A 3THTA 2DH8A 5HO4A 2J0QD 4FXVA 2CPYA 3UE2A 1YI2S 2OTJS 3N9UC 1U6BA 3JB9k 4YB1P 3MUVP 1UW4A 4PRFA 2ZJPQ 2L9WA 2LA4A 1X5SA 2DNKA 1AUDA 2DIUA 3SDEA 2OTLS 2MKHA 2MSSA 1WHYA 2RS8A 3MURP 1WI8A 1VQLS 2MKJA 3J7ZT 1JJ2R 3IWNC 1FXLA 4WIIA 5DM7Q 2KXFA 4IUFA 3U1LA 5GMKa 2DNRA 2M52A 3CCUS 1F9FA 1N52B 1XN9A 1SJQA 3BO3A 3SMZA 1H6KX 2DGSA 5LSOA 2CQ1A 5GAHU 2DK2A 3VAIA 1X4CA 4LMZA 2MKKA 1WTBA 3CCLS 1VBYA 3CCMS 1A7GE 4F02A 2DNLA 5EN1A 2YKAA 3NNHA 2LEAA 2CJKA 2AYMA 1YIJS 3R1HA 2MYFA 2KHCA 2LQ5A 5DM6Q 3I55S 2UP1A 2VONA 2K3KA 2L41A 2HGLA 2EVZA 1M5PC 2XS5A 3P6YC 3BO4A 1WG1A 3VAFA 1ZH5A 2M7SA 3US5A 4F25A 1S72S 5H1SV 3G8SA 1HA1A 1WEYA 2YWKA 2N82B 2M9KA 2GHPA 2DO4A 3LPYA 1QVGR 2AYEA 2DGTA 2RT3A 2MZSA 2U2FA 4U67Q 2KVIA 2RUGA 5IFMA 4WFNQ 4FXWA 1PO6A 1U1MA 2CPEA 4PR6A 2FHOB 1VQNS 2U1AA 2FY1A 4J5OA 1H2UX 2CQGA 2N3OA 2D3OR 1VBZA 2M2BA 1K8AT 2MZJA 2LEBA 2DITA 2MQNA 5MLCV 3UCUP 3L3CA 1WF2A 2MB0B 1YJWS 5IM0B 1FHTA 2MMYA 3B4MA 2I2YA 1FJ7A 2VOOA 5CXTA 2XNRA 4WKRA 4TU7A 1Q86T 2EK6A 2CPDA 2MGZA 3G6ES 3IRWP 2RRAA 1HL6A 4P6QA 1FO1A 3H2VE 3PIOQ 2DB1A 2MXYA 3LQVA 2E44A 2KXHA 4LIRA 2DGXA 5D77A 3K0JA 1NO8A 4C0OC 3P5TL 2F9DA 4Y0FA 3MUMP 3CCJS 2MQPA 2X1GA 1Q7YT 2JVRA 1X4HA 2DGVA 1U1RA 1X5PA 2MJUA 4IOAQ 1WHWA 2LXIA 2YH1A 2G1DA 2CPXA 4C7QA 3EX7B 1A9NB 1WG5A 2MJNA 2YH0A 4CQ1A 2NLWA 1M5VC 1U6FA 1WI6A 1N8RT 2XS7A 1RK8A 3CF5Q 2KM8C 2KXNB 2MHNA 1G2EA 2LKZA 3G9CA 3CCSS 1VC5A 4Z2XA 2ZJRQ 2MY7A 1SJFA 1WEZA 1VBXA 3HI9A 4Y00A 1BY9A 1VC6A 2ADCA 2CPJA 2XS2A 2DNNA 3S01A 1SJ4P 3V4MA 1M5OC 3G4SS 2YTCA 3R1LA 2A3JA 2M8HA 3EGNA 4M5DB 4ZKAA 1D8ZA 2OSQA 3G8TA 2KI2A 3UD3P 2RNEA 5DDPC 1P1TA 3UCZP 3MD3A 2CQ2A 1ZZNA 2RRBA 1JJ4A 4QU6A 1U2FA 2DGOA 2N3LA 5DETA 2M8DB 3ULHA 1H2VZ 1WHXA 2HGNA 3NS6A 3G96A 4RU2A 2HYIB 1FNXH 2PE8A 3S6EA 3CULA 2EK1A 2L08A 5IQQA 4ERDA 1U1NA 3UWTA 2I38A 2KN4A 3G71S 2QFJA 3VALA 3J7YU 3CXCR 3P49B 1PGZA 3CUNA 3VAHA 2DNOA 2MQLA 2SXLA 1M1KT 2KM8B 3UD4P 1N54B 2JWNA 1JMTA 1QVFR 2JRSA 2DNPA 1FT8A 3PIPQ 4UY8T 2MZRA 1DBDA 1JJHA 4A8XA 2DIVA 5GVQA 1YJ9S 1IQTA 3UCGA 1KC8T 2F3JA 5JVHQ 2RS2A 1X4DA 2JVOA 1UFWA 1X4AA 2MZ1A 2ZJQQ 4WFBQ 3CCRS 2LECA 4QPTA 1KD1T 2WBRA 1HD1A 2AYBA 1DRZA 2DGUA 3CC7S 2MQMA 2CQDA 3VAKA 1SXLA 2LMIA 3Q2SC 5GADU 1OIAA 2MPUA 3CCQS 1U1PA 2OSRA 1URNA 3NMRA 4WFAQ 3CC2S 2DHXA 1FJEB 3BS9A 1WEXA 2DO0A 1NJIT 2LYVA 3MI7X 3CPWR 1R8PA 1U1OA 2JX2A 3H2UB 4QU7A 2CQCA 5DDOC 5D78A 2OIHA 2KRRA 4PKDB 1U1LA 2CQ0A 1W2BR 2MZQA 2RVJA 3R27A 1Q82T 3NNCA 1SJRA 3MUTP 1VQOS 2RQCA 1VQPS 1OPIA 2M88A 3CMAS 2CQPA 4OZ0A 2M4MA 5IM0A 1X4EA 2MZTA 3I56S 2J0SD 3SDEB 2CPFA 4LJMA 2E5GA 2MSTA 3RW6A 1R8HA 2X1BA 5GAEU 2Q79A 2MQQA 2XNQA 3THPA 2NZ4A 2CQ4A 2HGMA 4IO9Q 2CPIA 2QA4S 5CA5A 1KQSR 2BZ2A 2M0GB 2KG1A 1VQ8S 1M5KC 1YHQS 5LXRA 2J76E 1OWXA 1U1KA 2B0GA 4W90B 2RU3A 2DGQA 2G4BA 4F26A 2DISA 1VQKS 2DH7A 2DNMA 2DNGA 3MXHP 2MKCA 2O3DA 1Q81T 2PEHA 1NU4A 2X1FA 2DHAA 2VODA 1DZ5A 3TO8A 1VQ6S 3P3DA 2DHSA 1YJNS 3CD6S 2MQOA 3SXLA 2E5JA 3OW2R 2CPHA 3NS5A 3S7RA 1X4GA 1WG4A 3DXBA 3EGZA 1VQ7S 2MY8A 2KYXA 1SJ3P 3ZZYA 1M90T 1N88A 3VF0B 3S8SA 3VAMA 4BS2A 1VQ4S 1DHMA 1WELA 4WCEQ 2LXUA 3CMES 1RKJA 2GO9A 3D2WA 1P27B 4TU8A 1S79A 1OO0B 2F9JA 2M70A 3CC4S 2CQ3A 3HHNB 1HD0A 4W92B 2FPHX 5CYJA 2CPZA 2X1AA 2BOPA 4IOCQ 2KU7A 2KT5A 1CVJA 4C4WA 2CQHA 2D9PA 5DDRC 2CQBA 5ITHA 2KG0A 2KFYA 3DLLQ 1FJCA 2N7CA 2ADBA 1YITS 2XB2D 3B4DA 1H2TZ 3RW7A 2DNYA 3CTRA 3U1MA 2DNQA 2HVZA 4YUDA 4TU9A 3MOJB 2VOPA 2DH9A 2XSFA 1WF1A 2MGZB 1X4BA 1O0PA 4QQBA 1VQ9S 2CQIA 1U1QA 2FC9A 4YOEA 5LSLA 2E5HA 1D9AA 3TYTA 2KH9A 5JVGQ 5FJ4A 2ERRA 1VQ5S 4WF9Q 2MKSA 3MDFA 1L3KA 2DGWA 2DNHA 2LA6A 1WWHA 4EGLA 2DNZA 2J8AA 3FEXB 1B7FA 3MD1A 2RQ4A 2OJ3A 1UAWA 4CH0S 4UQTA 1YTYA 4CH1A 5LJ3Y 1KOOA 3Q2TC 3TP2A 4OZ1A 2E5IA 1WF0A 3CCVS 1X4FA 1KOHA 3FEYB 5BJRA 2FC8A 1X5TA 3CCES 1WHVA 1K9MT 2KRBA 4CIOA 1QM9A 3VAGA 2AYGA 2G0CA 2QEXS 1X0FA 2K8GA 5HL7Q 2DHGA
chains in the Genus database with same CATH superfamily
4NA2A 3JS9A 1VQMS 2HBRB 2YKNA 5BXIA 1R6YA 3V81A 2BANB 1DLOB 1TKXB 1AW0A 3M7VA 4LFBF 1Y9OA 5FD1A 1XK8A 1RT3B 1CSJA 2JEGA 2XLJA 3OHBA 1VQLS 2MKJA 1EP4A 4U96A 3MGJA 4KO0A 3NS7B 1SKWA 2CQ1A 5IT4A 3HPOA 5M2RA 2UUBF 3J81Y 4DPYA 1WKLA 3MEGA 2ILZA 2R7SA 2M7SA 3PO4A 4JV5F 2O1PA 1ZETA 3ETMA 4JV0A 1FESA 5EUHA 1S57A 3DDKA 4YR2A 2WBMA 3DCAA 3MECA 3ENQA 1CJTA 4G3IA 4X66J 2D3OR 1SC4B 3MMJA 2MQNA 2HVDA 4QWDA 2UUAF 5CXTA 1VFJA 1S12A 4TU7A 1PYOB 1SV5A 4F0MA 4YMEA 3KHRA 3DHXA 2MXYA 1IR2A 2E44A 2HMIA 1P8GA 1KHVA 2JOQA 2JVRA 4DWIA 1NEEA 1JLQA 3C6TB 1WG5A 2YH0A 1YZ7A 5ETKA 4CLFA 4DCJB 2GAHC 1CPZA 2NXUA 1HI0P 4OI3A 1WEZA 2RDIA 2ADCA 3T19A 2XS2A 1C1BA 4P72A 1M5OC 2YTCA 3KLIA 3H4BA 4AL7A 1B0PA 1TQLA 4EZ9A 2OI2A 3AD7C 3KNGA 2JEIA 2A18A 1XJWB 4Q8EA 1FDBA 4PG4A 2IC3A 2ZNYA 2FVCA 4ZLLA 5LT5A 4DPXA 3LTOA 4NLVA 4PPDA 4C8KA 3PJWA 8ATCB 3Q8UA 1PIEA 2MZRA 1DBDA 4PXEA 5L46A 3KXDA 3OTDA 5L39A 1HWIA 1N34F 3BN4A 3T1YF 1F5CA 4FVMA 3MEKA 4WFBQ 4ZVGA 3CCRS 1Q79A 2AYBA 2FZKB 5D3GA 3TAQA 3CGIA 2ZE2B 4RW9B 3V5RA 2AJQA 4ZP7A 3AH6A 5D0HA 5KFAA 1Q16B 1U1PA 4PQUA 1SPBP 3T3FA 4DR6F 1KVKA 2ROGA 5AXKA 1JXVA 3V6JA 3V81B 3CPWR 3J7A1 2CQ0A 3D68A 4LF8J 4RNHA 4TKTA 1TL5A 1U45A 3CJ8A 3M30A 2XZDB 1EP4B 3NP5A 4KO0B 2UUWA 2B9YA 3MM6A 4CH7A 3MXHP 3QJLA 2X1FA 2DHAA 2H3EB 2V8GA 2E5JA 2K2PA 3MEGB 5M2PA 2R8JA 2CPHA 4FXDA 4L74A 1N36F 2NYHA 3EGVA 3KLGA 4OX7A 4A8WA 3LW5C 1O6XA 2BKNA 3TZWA 4LRFA 3ZFVA 1P27B 4TU8A 1CC8A 3M8YA 3MECB 1R8AA 1CJTB 1FX4A 1Y7PA 2HW3A 3W5ZA 2WAQD 2QMWA 2XMTA 2ADBA 3TUZC 3QZ7A 1B4SA 3U1MA 1YJUA 1BQXA 2J8SA 2P6TA 1SV5B 4DSFA 3JSYA 3J7Z5 4L73A 5KFJA 4FYDA 3RR7A 2RD5C 1S1TA 1N4LA 2FUG9 3GONA 2OJ3A 1UAWA 2EBEA 2XO6A 2WVDA 1JLQB 4HEA9 4HTIA 1GNKA 1HR0F 4C9DA 3LO3A 2R8KA 1KS2A 1FTCA 4ZVHA 1CJVA 4ZCIA 3H5YA 3VQSA 2K8GA 4J9RA 4HHHA 4TLQA 2D9OA 3PYEA 1X9MA 3ZZZA 1C1BB 3U7JA 3AT1B 2K1RA 3KLIB 2V4QA 1RT7A 3RG6A 2IFXA 4YR0A 3JB9k 2XY7A 2CZVC 3CD5A 3LANA 2F1FA 3DXSX 2DIUA 4DL4A 2CJAA 4OYMA 1GX5A 5LM7E 4N8NA 4IRKA 3ZTSA 2DRBA 1YVFA 4ZVFA 4BBYA 2DEIA 1KQGB 2VFTA 1SJQA 1OY9A 1WSVA 3W66A 4YS2A 2LQ9A 1IBLJ 4F02A 2DNLA 2UU9F 4LSLA 2J6SA 2JEFA 1NH7A 2LQ5A 4C97A 3I55S 4DUZF 2B43A 5D3GB 1M5PC 3CSKA 2COLA 3GE9A 4J9NA 1RT4A 1T95A 3VV2B 3K8WA 4PQUB 2AYEA 1WC1A 4DU8A 3IMQJ 1PC5A 2U2FA 3B54A 2J0XA 4HLBA 3QFWA 3HSJA 4UOCA 2BUNA 2LEBA 1AYEA 4RWXA 1HNXF 1DURA 2I2YA 3KG1A 1RU2A 3UR0A 3D67A 4E8UA 4IH5A 3M30B 2Z2LA 4X4SA 2QL7B 2IBOA 2N7YA 1EKSA 3MM6B 4C0OC 2EEYA 4UY85 3DN9A 3CJKA 4OL8A 4F0HA 2BJ7A 3ZTPA 2AQ4A 3IWLA 3I4HX 3QO9A 2G0IA 1MN7A 3F56A 2W7AA 2J6TA 2B4PA 2HQFA 4DZDA 4PG8A 2AJFE 1NLKL 1BMQB 1G2EA 2PGCA 2MY7A 3RUBL 2DNNA 1BQNA 1UVNA 4IFYA 3V4MA 5KAKA 2M8HA 1N5VA 1NSAA 3G82A 3UDCA 4B3MJ 2M8DB 2W1BA 3GCWP 4NZ6A 1F2HA 3TAPA 4ERDA 3R9LA 4O3NA 3K2YA 2IM0A 5GAGI 1B0VA 2KM8B 5GMEA 3UD4P 4P7TA 4EI2A 1AZSA 4HHJA 3PIPQ 4RW8A 1B0TA 2XC9A 2VFUA 4NYOA 4NMLA 4E2FB 1UFWA 4C2MA 4LBIA 2HQIA 3Q8YA 2DR6A 2W9CA 1CJVB 1RWKB 3PRVA 4L76A 4K4SA 1TELA 3W2WA 4FF3A 1FEHA 2K1RB 2P9CA 3M2VA 1RT7B 4KY3A 3IRXA 1XQIA 1KDNA 4H54A 1FVSA 5C25A 2NSBA 2YQ0A 4I7FA 4YHHF 5IM0A 3CWJA 1NHUA 4Y28C 3MPDA 2ZDOA 1IKVA 4GO5X 3VGVA 3P45B 1PG5B 1YRXA 2ZVIA 5F3TA 3GQCA 2HGMA 4I4BA 2N4CA 2KG1A 2HQ3A 1U1KA 3TUIC 4F26A 2AGQA 2PEHA 3MPWA 4J9VA 2R8GA 4ELTA 4LSLB 3RB6A 3C19A 3SQOP 4M1KA 5F8IA 4U6PA 4C3MA 1P9YA 4O3SA 4OZJA 5LMUF 1RKJA 3D2WA 1RYRA 4B3SJ 3RBZA 4G1QA 2MHEA 1KLNA 2J6UA 4PAAA 2E1PA 2CQBA 2DCUB 2F8EX 2ZC3A 3FGVA 3UDEA 4DN9A 2VPYB 1UVIA 2DNQA 2HBQB 2HK3A 5D4PA 2VOPA 1CEZA 2Y3YA 2VBYA 4LVOP 4LRCA 4ZP8A 5ETPA 2B4OA 4WF9Q 2DGWA 1V3SA 2AV5A 4DV2F 2FHMA 3CJKB 5GMDA 3MD1A 3PHTA 4J91A 3KJVA 1IM4A 2C2RA 3QO9B 1KHWA 1KOOA 2Z57B 3HD2A 4OYZA 4O3RA 1WHVA 4ECRA 1RA7A 4RW6A 1YBAA 3AQPA 4ENOA 1LWFA 5E41A 2LCWA 1BQNB 2HKEA 4IFYB 2Z58B 4LUBA 4URGA 2AD9A 2HZCA 5AE3A 2AGPA 3G82B 5ETLA 2EG1A 3P8BB 3D1HA 4CLTA 4RL1A 2GIRA 1KBRA 5J1NA 3UR3C 2BE2A 1F5BA 1RT6B 3KMQA 2Y1LB 3SDEA 3C66A 4LREA 4RNNA 3W1YC 2E1MC 2V8DA 1FDAA 5KFGA 4NASA 1N52B 1AZSB 3FEZA 4RW8B 5LSOA 2DK2A 4USHA 1LWCA 1N32F 3V6KA 1T3NA 2RHSB 5EN1A 1EZZB 5E2QA 1EKRA 3CJTA 1NK6A 3R5CA 2XS5A 4URQU 1S6OA 1WG1A 2LXFA 1G6BA 2W9CB 4LFAJ 4KBIA 4IR1A 2D41A 4DV1J 1FDDA 2GHPA 3GILA 2W8LA 3TI0A 3W2WB 4NCAA 3Q0AA 1FKAF 1FXRA 2MZSA 4CO0A 1KWMA 3M9MB 3OPKA 1PO6A 4DSIA 4FXWA 4A46A 2CPEA 4F4YA 2FHOB 9RUBA 3M2VB 3OR1A 3IRXB 1KQKA 1H38A 1UFLA 3PEJA 3N4WA 1NKEA 4IO1A 5C25B 5IT9Y 4I7FB 5IM0B 3R5JB 5F9NA 5A8RB 1IKVB 1RWUA 1SUQA 3BN7A 3KLEA 3QAEA 3RBDA 2OPSA 4JI6F 2O5DA 3BM7A 2ROPA 4KGXB 1X4HA 3K57A 2EKNA 5BR8F 3W7BA 4QWAA 5U47A 3A8EA 4CQ1A 1M5VC 5KG3A 2XBPA 2PA3A 2V8HA 2CRLA 4ANCA 1VJWA 2GGPA 2D69A 2Z56B 5KFKA 3AY0A 1VC5A 5IC6B 4Z2XA 2WSFC 5B0AA 2A3JA 4G1QB 1JNZB 3G8TA 1ZYQA 3J81U 7FDRA 3UCZP 3RBEA 4LF6F 1GTEA 4JI2J 1XR7A 3FVYA 4DI6A 3IAS9 3NS6A 2QSWA 3S6EA 4IQXA 4P9SA 2ZKUA 4EEYA 1FVQA 4F50A 1PGZA 4Q0BA 3CUNA 5JJBA 1ZS6A 1N54B 4R0JA 4O44B 1YJ9S 3KJVB 2GMJA 1X4DA 3K8VA 5KFRA 3BGUA 3KLVA 4QPTA 2WHOA 1PKUA 3K5MA 4ECSA 3TA2A 1X9WA 1LWFB 5K8PA 2OSRA 1FX2A 4KB7A 3GSIA 4LRDA 3MM9A 3DU5A 4Q2MA 3NOGA 1RAHB 1WC0A 3BKUA 3AFGA 3R27A 5DG7A 1C0UA 4ED4A 4ICLA 1XNQF 1FDNA 4FKXA 1VQPS 2M88A 1S0OA 2BE2B 3BBCA 1X4EA 4CP5A 2GAGC 4C3KA 5KT6A 3HLUA 4UT4A 3SDEB 1VDHA 2JC0A 2MQQA 2Y0BB 2GMLA 3Q89A 2BMBA 4DV6F 4DUTA 1N5SA 1Q8KA 4DPTA 5B09A 3ZTOA 3PFEA 5KFCA 1LWCB 3IG1A 3T1HJ 4DL7A 1NU4A 3VGTA 4CLKA 1WD6A 2Z4PA 2IHR1 4OV1A 2MQOA 2OP5A 4OYPA 4IRDA 4XO0A 3RAXA 1NZ8A 1D1UA 1MSWD 3S8SA 2ZUAA 1RWPB 4DPUA 4HDGA 2FZGB 4MT1A 2C2MB 1W25A 3OVAA 2YNIA 4FKYA 1APSA 3OR1B 4W92B 1RHRB 4NZ0A 2HS0A 4LFBJ 2KU7A 2K3IA 3BZQA 1VHFA 1U0HA 1R3NA 2XMVA 5DS7A 4YY3F 3AA9A 2PT0A 3POTA 4IG3A 3MOJB 1AUSL 2QLWA 4RUHA 2K7JA 3SFGA 1SUQB 3VVUA 1OS5A 5IWAF 3KLEB 4RKUC 3TYTA 2OPQA 4ZVSB 2MKSA 4LIWA 2OPSB 1FK9A 2LA6A 2UUBJ 4K4ZA 4NYPA 4UQTA 1T05B 2LQBA 3G6VA 4ID8A 1VGYA 5J2MB 4J9QA 2C28A 4JV5J 3EDRB 3J7YI 3KTQA 4YN3B 5CAAA 1K9MT 4MIAA 3GP9A 3I9V9 3HCXA 2GGPB 4LBHA 3C8YA 2R7TA 2CXEA 2KTQA 2XZWA 1FRHA 3KUGA 2QJ3A 1RHQB 3FK4A 3GFYA 4YR3A 2RIJA 3L9ZA 2XWYA 5GAGU 1URRA 3CJSA 2J0QD 2CPYA 2UUAJ 3CB4A 1M1HA 1FRXA 3TWZA 4CO5A 3AXKA 4DPOA 2Q6BA 3QGGA 3HZEA 4FBTA 4Q0BB 1S6UA 1RE1B 1F9FA 4WXWA 1GXTA 2DGSA 5ETNA 4LMZA 2HHSA 4WP9A 5AXLA 3W5YA 3UPFA 2KFZA 4ELUA 3ZNUA 2C3YA 5DM6Q 5KT5A 2HGLA 4UZCA 1S1WA 1LWEA 4JI3F 1RAJA 1U6ZA 4M63A 3DOKA 4QOTA 2ZZNA 2ZBCA 3LPYA 1KQFB 3MM9B 2FJDB 3FRZA 3PKYA 3TZXA 2EW9A 4J5OA 5D4OA 1C0UB 6AT1B 4O3OA 3TZZA 5MLCV 1T7PA 1LFWA 3ZTQA 1BHNA 1UWBA 5A8WA 2DHHA 2CFXA 2KB2A 4RX6A 4RNMA 1PAEX 1JLAA 2AGOA 4BC7A 3AD8C 1N34J 3T1YJ 1TL7A 2RE1A 4NL5A 1JLCA 4DF4A 2RRNA 3IG1B 3MAQA 2UVUA 1HFEL 2RMLA 3WX8A 4IOAQ 1WHWA 4USKA 3Q86A 2CPXA 4LF7F 3E01A 2RJZA 3PHEA 2E66A 2ABYA 5HI7A 1S59A 2YWEA 2OO4A 2R2RA 1EETA 4DR6J 4FF1A 1Y5NB 5B7WA 3HMJG 2CG4A 2V8PA 4QYZJ 1NBEB 3GIJA 2YNIB 3K5OA 1RBOB 4XTTA 4C0BA 4AYBD 1KLMA 4UTGA 5D8HB 3CD7A 2NUUG 2YQ1A 1U0HB 3GJQB 2EK1A 3POTB 4IG3B 1NNDA 4CM2A 4AD6A 1SL0A 2OPQB 5DQHA 4WE1A 1FK9B 3B82A 3KLHA 3ZZPA 1RHUB 3FQLA 4P2FA 4ECYA 1KC8T 2NS1B 1N36J 4M94A 2EXUA 4ES1A 2VC1A 1DRZA 3I32A 3KDNA 3K5LA 1ZA2B 4WJBA 2XMAA 1N5YB 1S1UA 4ATNA 4MKVA 4Q7AA 2AJ0A 2XY6A 1RISA 4MFBA 4ES2A 4KGMA 1U1OA 3R5BA 2UUTA 1ZA1B 2CG8A 4DR2J 3IXQA 3N6NA 5I3QA 1Y10A 3OR2A 2MZTA 2C2OB 2F8HA 1IQZA 1UW9A 2MSTA 3VZHA 2ZZTA 1SKRA 5J2PA 2B6AA 1NSQA 5DZ6A 5LXRA 2HVIA 1W7WA 3EYZA 3D6FB 1XR6A 2FJXA 2GCFA 1HR0J 2VODA 2XM3A 4LF4F 2QA2A 1Q8LA 3HP6A 2HHQA 3NS5A 2XMKA 2XZTB 4JI7F 1OY8A 4CLPA 4LR7A 3LGNA 2KYXA 2M5YA 1S1WB 3DOKB 2PC6A 2WVFA 3GIMA 2RKIA 1YBTA 3HM9A 1RTHA 2LFVA 5RUBA 2GX8A 4USWA 4IOCQ 1MMLA 3FCWA 1CVJA 2GQCA 2D9PA 4TQSA 3EPIA 4NXMF 4CLLA 1UWBB 1H2TZ 5A8WB 3NAHA 4DHVA 4DX8H 4DQSA 1X4BA 2XTJP 2DD8S 2YXLA 2B4UA 1JLAB 5LSLA 3CDAA 2JFKA 2DY1A 3M6XA 1Q8IA 2ZEJA 2JH3A 1TL7B 4AXJA 2ZOFA 2NXEA 2UU9J 3M9NB 4DUZJ 2WB4A 3WX4A 3E01B 1IBKF 4I1TA 1XIQA 3VAGA 1EETB 2QGFB 3OFFA 2B8PA 4NX9A 4R0EA 2OUGA 3FQKA 5A8KA 3DC2A 2BBEA 3R5DA 2DHGA 3OT9A 1YQHA 2V2ZA 2FGCA 4FP9A 3BO2A 2IVYA 2AEMA 5AE1A 2F7VA 1VC0A 1MG7A 3THTA 1D0EA 2DH8A 2CJQA 1KLMB 1HNXJ 3ZC4A 3UE2A 3EUNA 4Y2MA 3E2EA 1VIXA 2QV6A 2ZJPQ 4F8RA 3SI8A 4F36A 1MNEA 1WHYA 1WI8A 2MKYA 1K47A 2WVEA 3QFHA 4NLDA 1M0SA 4YFUA 1YRUA 4WIIA 1XWLA 2KXFA 4IUFA 1LK5A 4ZP9A 4P2XA 3CCUS 2HVHA 4ZMMA 1XN9A 3I5AA 4WE1B 1DTQB 1Y00A 2EFGA 3T5HA 3K7RA 3M8RA 1N5QA 3IR7B 1V9OA 2UP1A 2R7VA 4HI1A 3H4DA 2IMWP 1LW2A 5AXMA 3LP0A 2MEWA 1S72S 1S1UB 2NPFA 1SC1B 3R3TA 1HPZA 4MFBB 1UCNA 5DLFA 3TA0A 3PTWA 3FMWA 4NLRA 1OYEA 2MZJA 4O0NA 4DG1A 1SC6A 4OJGA 2PDAA 3JAMU 2HHTA 1FJ7A 1D3WA 4ITSA 3G6ES 1UA1A 3DKDA 5J2PB 2B6AB 3PIOQ 1HMVA 1IR0A 3BSCA 4OHWA 1VS3A 3W8GA 2CNKB 1YRTA 2QLJB 3GV5B 1KN6A 4PWDA 4N47A 4C7QA 1T94A 3NCRA 2ZBPA 1RT5A 5DQGA 2DPJA 2YY3A 1BWEA 3CF5Q 3G9CA 1NMEB 2IDEA 3TW0A 5KFTA 4HH0A 1OJ4A 2BX6A 1NK9A 2AMCB 1YJVA 2RKIB 3VVTA 1AFJA 1RTHB 4DL5A 2EWHA 2NYIA 2LQJA 3G86A 4YHHJ 3FSYA 4DZ6A 1U2FA 5DETA 3K59A 1H2VZ 4KHRA 4ED8A 2HGNA 2BJ8A 2R3VA 4ETZA 3MR2A 2HZVA 3TEHB 2VKZG 4OHVA 1U1NA 1F9HA 4ZVEA 4DR5F 3J7YU 4JOUA 3P49B 4V19J 2HQGA 4X4VA 3TUPA 4J9LA 2JRSA 1UPPA 3T9NA 2AEFA 2HNYA 1J5OA 5IT9U 5JVHQ 3ZZUA 2J7UA 2MZ1A 3LOUA 4N7TA 3H7HB 3CC7S 4O23A 5LMUJ 2I9SA 4M5LA 1FFWB 4PEOA 4KT0C 4P74A 5A8KB 4OZ3A 3OVBA 3L7PA 2GHVC 2YVSA 2DRAA 2BJ3A 3FC9A 3F44A 3HT3A 3GIKA 2UVRA 3W2VA 2CQCA 3WBZA 2GNKA 1O5JA 1OMSA 1C4AA 1T9WA 4DBQA 1VQOS 2V34A 2VB6A 1WDDA 1CS4A 2E9TA 3OUYA 4KH0B 2C2DA 3CJRA 2IVFB 2DRDA 1SC3B 2CQ4A 4DV2J 5EGYA 1FWPA 5J1PA 4K2XA 2IRXA 2G4BA 2DISA 3OLBA 5IZHA 4ECXA 2D3O1 4USJC 1S10A 2DPIA 2V69A 3W9JA 3PX6A 1LW2B 4KHMA 1RWOB 1VQ7S 3LP0B 1XMBA 4DR3J 2KVQE 2YWGA 1NH8A 3I6PA 2YPYA 5KT2A 5KFXA 4M5DA 3DU6A 1L3SA 4WTYA 4DU7A 5M2UA 4DG1B 5ITHA 2RAQA 5ETTA 2DNYA 3CTRA 5DO2A 3HKZD 4YB6A 1WF1A 2PEBA 2G1HA 3W60A 3QGIA 4F0KA 1HMVB 2KO1A 1N32J 5JVGQ 1U0SA 3SEOA 1UJ4A 1FWKA 5JUMA 3OL7A 4B9VA 4DPWA 1JLFB 4CNZA 4PWDB 2HQCA 2PN6A 3CJ5A 4EMDA 2ZZMA 1FA0A 1RT5B 1R6VA 3R5GA 4ZJQA 4CIOA 1SQEA 2BYCA 1YG0A 1DFDA 5HBMB 4KPCA 1KVJA 2Q1LA 2QA1A 1HBUB 1N0UA 2YNFB 3GYGA 3R8YA 4ED2A 4NLYA 5KFWA 2Y1JA 2HWIA 1U2RA 1UW4A 2FJAB 2HFUA 1QDUB 4ZP6A 1HYSA 4NYZA 1RWNB 3SSRA 4JI0F 2P9EA 4Z7YA 2IY5B 4JI6J 3ZZOA 4N5SA 3FCHA 2IM3A 1MN9A 3CD0A 1JK9B 4KSEB 3TVKA 1QY7A 5BR8J 2HNYB 1J5OB 1S9GA 3CCMS 2I5JA 4ZIVA 2JZ5A 2AYMA 2W7OA 1X31C 4P73A 1EIYB 2VG5A 2BA9A 3AOAA 1Q4RA 2HHWA 1TL3A 4ZPTR 4A8OA 1SIZA 1FI4A 5C42A 1TVRA 2WRMA 4LF6J 4PR6A 2ZITA 2FY1A 3W2VB 2EFPA 3IC1A 2E7WA 2ZH4A 1VISA 3BKTA 2M2BA 3GTYX 2MQ8A 4A8YA 2FQQB 1TZ0A 3B4MA 1CS4B 5THWA 3OUYB 4N41A 4WKRA 3DI6A 2ZH9A 4CNYA 4I67A 4TQRA 2ZOGA 3G6XA 3OSNA 3H2VE 4B9MA 1MROA 4DV7F 2E9RX 2KXHA 4N76A 1U49A 2Q3PA 3CCJS 2X51A 1TK0A 2V50A 4RBVA 1WNEA 2UXCF 2LXIA 2LU1A 1QE1A 1U6FA 1YJTA 3CCSS 1ZPVA 4KR0B 4Q43A 1VC6A 5KT4A 4P2MA 3V6DB 4DV0F 4G1PA 4M5DB 3OVSA 1XNQJ 1FFGB 2ZWPA 2RRBA 4OZ5A 2W01A 2HLUA 4DXLA 4P10A 3UWTA 3G71S 3B78A 4DV6J 2AIRB 4O3PA 2XI3A 4NEZA 1RTZA 4L75A 4PUOA 2DNPA 1Y0HA 4Y34A 1SKUB 1V3RA 2HHXA 2W24A 4NCBA 2ZHOA 1VOMA 3JQKA 4DSLA 4AL6A 3CCQS 3NMRA 4WFAQ 4C8LA 1K1QA 3GR0A 4KV8A 2HS4A 1FJEB 4MH8A 2DO0A 5A6WA 1PYSB 4OI0A 3EDQB 3W9HA 2VBZA 4PG6A 2ACMA 3QWUA 4QW9A 5J2QB 5EDWA 4JI4F 5HLFA 5IWAJ 4PG7A 1HYSB 2PI4A 3BYPA 4KRWA 1ZPWX 3LWMA 3M9OB 4ZLNA 3W5XA 4IO9Q 1IUJA 1YHQS 1OWXA 3H98A 3J7AN 3D6HB 4CLWA 1S9GB 3W62A 4B9LA 2I5JB 1RWMB 1Z2LA 1YJNS 1RTIA 1LK7A 1RKIA 4MYUA 2HWTA 1ZAXA 1WG4A 1WOOA 2ZH5A 4HTJA 4Y2KA 1TL3B 4ED6A 4ZVPB 4G65A 2VJVA 1TVRB 4X4OA 5HROA 3DLGA 2LDYA 4TNOA 1HBMB 3ZXWA 2BABA 4W98A 4XPEA 4OHXA 1B3TA 3JXOA 4F04B 4JI8F 4RW4A 2IMOA 4RW7A 4YQWA 1P9QC 1FJCA 2N7CA 2ZKTA 3QIDA 3FCVA 3HVTA 2DH9A 2EC2A 1NKBA 5F8HA 5D4LA 4Q8FA 4B9UA 3KNAA 4ED0A 2LVWA 1MROB 3QMQA 4ZVUB 2AJ2A 5I4MA 5F3ZA 1VQ5S 1YBUA 4J9SA 4AQYF 4ZJLA 4CDIA 3R6LB 4EK2A 1YTYA 2OGUA 1QE1B 4JI3J 2Y1IA 4BCAA 2DXFA 1I94F 2AYGA 3MAAA 1NKCA 2QZ8A 4DX6A 2W2QP 1JLEA 3N6LA 3TOQA 3NXZA 2R7QA 2EPIA 2KZZA 5KFQA 2DJWA 3GG0A 4YB1P 5K5MA 2EC0A 5HMZA 1FKPA 3ITHB 4D3GA 4JI1J 2LA4A 5KFVA 3BSNA 1E6YA 2MKHA 1EHWA 1PILA 4LSNA 3EZ5A 3KJQB 2BJDA 4PUOB 4XDDA 1S7HA 1NAQA 1CJKA 5KFNA 4LF7J 3CCLS 3PW4A 1N5TA 4OX6A 2LEAA 2CJKA 4I56A 1HWKA 3OSPA 1H3DA 3ZO7A 3BO4A 1ZH5A 4Z7CA 5KFOA 1FRJA 1UZHA 1NDLA 4F25A 4X4NA 1RB0A 5HJYA 1WEYA 2ZBIA 4ILRA 4OZNA 2Q66A 2OD4A 3FKBA 4KV8B 4OMFG 2QYCA 4MIWA 4RWWA 1P6TA 3TUJC 1YJRA 1S99A 2V4JB 4PABA 2ACYA 1CJUA 5L9XA 2JSXA 5HLFB 2R7XA 3MMAA 2ALZA 4B3RF 3IRWP 4DCOB 2FGOA 3HJFA 1H74A 4DR4F 1T9VA 1QD1A 4DMZA 2DGXA 2M3DA 4GO7X 4HI2A 2MLZA 2F9DA 4LSZB 1LQ9A 4EBCA 1RTIB 1Q78A 1ROFA 4O3QA 2MJNA 2WW8A 4NXNF 4LR9A 3W63A 2KXNB 2ZJRQ 3MM5A 2XYPB 2ZH6A 4K4WA 4M5NA 4K59A 2DYAA 5HROB 3DLGB 4GRSA 3MAHA 2RNEA 5IOLA 1P1TA 4RW4B 5K8OA 4TYAA 3NCQA 3N28A 2XHCA 4F3QA 1HARA 3NEKA 2WB1D 3CULA 4NLXA 2V63A 1GFWB 3HVTB 2IAJA 1HWJA 1UZDA 4I64A 4LF4J 4A8XA 5L1JA 3UCGA 4I6AA 4JI7J 5DLGA 2XYGB 1R8CA 3GFHA 3VTIA 1NDKA 3MAAB 5ETMA 3HULA 4L3NA 1R0AA 3MR7A 1BQMA 4K4VA 1H73A 4USUA 5EX3A 5T41A 5KFDA 3OXGA 3A3OB 3MI7X 4WU2A 1K0TA 2JX2A 4NXMJ 5D78A 3HZGA 2RVJA 3MFIA 3A8IA 2XI2A 1FKPB 2GIQA 4M5GA 2WONA 3AJDA 1Q7LB 3NAIA 5DGBA 4UZBA 2L9NA 4DJBA 3UN3A 4NLUA 4LSNB 2B4VA 4BLGA 4EBEA 4WPAA 2CPIA 3CIZA 5CA5A 1ULRA 3D54A 2PMWA 2GVDA 1I5OB 3MMCA 4B9NA 1CJKB 3PJXA 2DH7A 1IBKJ 2PMHA 4MK7A 4H4OA 3PYGA 4CYUA 1RQ0A 1S0NA 4A8KA 3MMBA 2OLWA 2VC0A 2R42A 1ZTWA 2KDOA 1U2CA 1F2GA 1WELA 2HS3A 2H54B 1PYTA 1FRLA 4F3MA 2XLIA 2CZ9A 3HHNB 2BJ9A 1WUUA 1WKJA 3DLLQ 2AJ1A 1CJUB 2QLXA 4NEYA 1PSDA 3MMAB 2HVZA 1Z4UA 4L72B 1HHTP 1HHQA 1UEVA 2VBXA 3MDFA 3CEDA 3MWBA 3PYDA 4ECWA 3MTKA 3JQMA 4QYRA 4KPYA 2VG7A 2Y1RI 3BB5A 3KYLA 3Q2TC 1W2IA 2FVRA 4XIUA 4ZLJA 1ZAVA 3MEDA 3OL8A 3MTJA 4GMKA 2G0CA 3OXLA 3MM5B 1ZAWA 5L8RC 2HSEB 3VAJA 3KFWX 3DRPA 5FLXY 1IKXA 2HWHA 3V2UC 5HVFA 2V2QA 1TKTB 1T9XA 4ANEA 4HT5A 3OFGA 2C3PA 3GPAA 3I87A 4IG0A 4G6VB 2ZH2A 5D0RA 2HG4A 3N79A 2FJWA 3BQ1A 4LF5F 2DTJA 1FXLA 3P4UB 5DM7Q 2IAJB 3U1LA 1IBMF 1K0VA 1HIYA 1EJ7L 1AB8A 1GTHA 3AA8A 1UVLA 1OPZA 4FZVA 4NLQA 1A7GE 2ZUGA 4TYBA 4UQGA 4CLUA 5L38A 2W7PA 2ZD1A 3VAFA 2CYYA 3M1VA 1HBNA 1GK8A 4A8FA 1NM2A 1HNIA 2AEJA 1R0AB 1BQMB 2HBZB 1M1GA 1NHKL 3JSBA 2DGTA 4LFCF 5ADZA 2OEMA 4IDKA 3VZIA 3OJSA 3MEEB 1NDPA 1T0TV 4HH1A 6FD1A 2N3OA 2CNNB 4OHZA 2OKQA 3NWGA 3KG4A 3R2CJ 2WONB 4DR5J 3DGVA 1ZTTA 3AOBA 1JKHA 5KFHA 2RUSA 5KFUA 4P6QA 3FBEA 4DQPA 2YKNB 2GVDB 3MMCB 2HNDA 2L48A 2UXDF 3DLKA 2QO3A 5JXSA 3MUMP 2CVEA 1RU1A 3TX0A 4DR1F 2B7CB 4H4OB 1U8WA 1QTMA 3EX7B 3MMBB 5LMNF 5HQ8A 2VKRA 2AZ1A 2JC1A 4DR7F 3QT8A 3HI9A 4FBUA 2CPJA 3MCOA 3K5PA 3N0VA 3CDWA 3ILIA 4WKYA 2IJRA 5IT0A 2B51A 1KKHA 3GFXA 3LGHA 1KFDA 3MD3A 2CQ2A 1DQAA 2VBWA 4YP3A 3G96A 4ALZA 4USTA 4TLRA 2ZFHA 3DRSA 2QFJA 1Q53A 3VALA 3UW1A 1NB7A 1M1KT 1Q0NA 3W8PA 1HNVA 3LP2A 8AT1B 3O5TB 3PX4A 4B02A 1RACB 4KE5A 3RRGA 2VG7B 2HHHF 2ILYA 4S0MA 3OFEA 2QSFA 1KD1T 2WBRA 4DR2F 1HD1A 4L3KA 3MEDB 1MWQA 2WW4A 1OIAA 3OTOF 2HMIB 2IM1A 5AXNA 1CBKA 3DRPB 1IKXB 4LF1A 3D3BJ 1NJIT 3GLJA 2KRRA 1T9UA 2CVIA 3OV7A 1YX2A 4USIA 1Q82T 3DOMA 1SJRA 1S1XA 4I2QA 1S9EA 4IG0B 5F0UA 3J80Y 3EXYA 1IBCB 2J0SD 4ECZA 2CPFA 3SSQA 4LJMA 1LWXA 1R8HA 3WHIA 4ZCMA 4RLEA 2QA4S 5E0OA 4ANDA 3IAM9 5F41A 5HAOA 2QG9B 1RAEB 4LVNP 1XR5A 3U27A 3CIMA 2GJFA 3QZ8A 2YKMA 5EHHA 2IC3B 1UEUA 3LUYA 4RU9A 3M4XA 3I0RA 3HKWA 2R2SA 2ZD1B 4ZVOB 3QRRA 2PIIA 1SL2A 1WC6A 3M1VB 1HBNB 3DGPA 1RLCL 4BS2A 2FZCB 1RWWB 3D5MA 4ZVQB 2ZC4A 2H5JB 4IDKB 2F9JA 2M70A 1TFYA 2OPPA 2YQ3A 1ZBTA 1KVIA 1H7WA 2HVEA 3M6VA 3CJQA 1VK3A 2VG6A 4JI0J 3B4DA 2H1YA 3M8SA 4JBCA 2GQQA 4Y6IA 4UOFA 4MTPA 2Y9HA 1U24A 4KH1B 4GKKF 1RCOB 4C6AA 3HT0A 3QATA 2F4VF 2VASA 5CZVA 2KJWA 2HNDB 3DLKB 4OJ1A 3IA0A 4WP3A 2YWFA 2F8MA 1MWYA 2FVSA 4M8LA 5G0RA 1WF0A 4FS2A 4WZMA 3SCJE 4ELVA 5DQIA 5G4DA 2KL8A 4UF4A 4QR0A 4CLSA 8RUCA 3FBFA 2CNOB 3GYNA 1F60B 3F0NA 5LXYA 4DLGA 2XMWA 3KHGA 3T6BA 3HXMA 3A4TA 4P7VA 1UEKA 1S97A 4Q45A 3KLGB 2F40A 2VFVA 2DNKA 4KGZB 3OBIA 4DV7J 3DRSB 4CO1A 2UV8A 3SSSA 2DKOB 4C0HA 1V5VA 1VRUA 3HSZA 1HNVB 2DCLA 3LP2B 1MWZA 3BO3A 4QZVB 4NZ7A 3PY8A 3P96A 2UXCJ 4E0DA 2JEJA 2A2CA 2YWHA 1EAYC 1X8DA 2GVZA 1YJ7A 2B56A 1GXLA 3MPUB 4FDFA 1GH8A 2FDNA 2HAFA 3DDIA 3T9ZA 1N56A 5D4NA 4DV0J 2V4RA 5H1SV 1U48A 4WU3A 2UV8G 4BWJA 1S1TB 2G0JA 1TP7A 2RT3A 4U67Q 5J1EA 3CCTA 1L5UA 1RZMA 1U1MA 3T41A 1UWAA 1VQNS 3C6UA 1H2UX 4EO8A 4OYIA 2FVPA 3DOMB 1S1XB 1S9EB 2GJIA 4J9PA 4B3OA 2YNGA 3I5BA 2GS8A 4F4WA 1Q86T 1KNZA 4IQMA 5CZXA 2IYIA 3MPVA 1RI7A 3EICA 2IA6A 3OL6A 1QUPA 3ZZ0A 3CCWA 2RQMA 1JNRB 3I5CA 5D77A 3LWLA 3QJJA 2RILA 2YKMB 1U09A 4NOHA 2IIHA 3ENVA 3VCDA 3ADAC 5L1LA 2IM2A 3PG9A 2YKQA 1UJ6A 4K50A 3QAUA 5KFEA 1PJ6A 1F5AA 3RBXA 3I0RB 1XMQF 3PACA 2F63A 4J9UE 2LKZA 3DGPB 3ICLA 1SKSA 1SJFA 5AT1B 3HO1A 1OYDA 3N01A 1RAAB 4LQ3A 4LT6A 3ILJA 1B64A 2HHPA 2OPPB 2EFQA 4JI4J 5DDPC 2Z2ZA 4DCPB 1OSDA 2N4DA 1N48A 1RTJA 4WK1A 1HWLA 3ILOA 2Z30B 3C3LA 2C2ZB 1RT4B 4TY8A 5BYSA 3NKYA 3CJ4A 2ASJA 3IO1A 4X62F 3MM8A 5KG4A 1N33F 3SCLE 2V9WA 2BQUA 2G2OA 1GMVA 4EBDA 3EZOA 4OX9F 2QL9B 3H2LA 4J9OA 4QYZK 4ILLA 1QTNB 2B9EA 5B0CA 2LMIA 3A3PB 3EE3A 1C1CA 1Y5LB 3Q2SC 3PR5B 3KHLA 2VF3A 5L1IA 4RUCA 2XMMA 3TEGA 5GAHI 2V9KA 2C42A 4JI8J 2LYVA 3E3XA 1NUEA 4QU7A 2OIHA 2XY5A 4F4ZA 1S76D 2DT9A 5F0WA 5LL6d 3NNCA 2KYZA 2BXJA 2H4YB 2XO7A 3U02A 1T3OA 2E5GA 1I6JA 4HDHA 4DR3F 4HT7A 4AQYJ 3H40A 1VRUB 2M0GB 1VQ8S 3BGRA 4H4MA 1U02A 3RRHA 3EJMA 2DGQA 1HHSA 3ZNJ1 4K4YA 3PO5A 2XMUA 1XBWA 4NMXA 3FZBA 3TQEA 1UPMB 4X2BA 4LRAA 1I94J 1F1BB 1TKXA 5D0GA 3VGUA 2H48B 4K4TA 1N88A 2KJVA 4OYWA 2GO9A 4WYWA 5J1EB 2WVBA 1RCXB 4HKQA 1R0BG 3ET6A 2CQ3A 1TUGB 4GC7A 2KFNA 5CYJA 3IBFB 3C6UB 3UQSA 1IVZA 4FPRA 4B9SA 1SQFA 2DXEA 3HFKA 4DSKA 4DQRA 3L4BC 2BEFA 3TRGA 1YITS 3CVKA 3GV7B 3S1TA 3I96A 2AT1B 4PYDA 2XSFA 5AJ3F 1Y3JA 1CLFA 1N6QA 5F8NA 1S9FA 2HHVA 1D9AA 2E7VA 2ZWOA 1WWHA 2E1CA 3TA1A 1XMOF 4XPCA 3RRKA 3M8QA 4MYTA 1BUXA 1SH0A 4DUYF 3H5UA 3TP2A 1X4FA 1KOHA 4GVBA 3FEYB 4X4UA 2XEXA 3UFCX 3TANA 4JI5F 4FYYB 2H5EA 2RF2A 3IN5A 5HL7Q 3Q24A 3SQGA 1NK0A 5ETOA 5ETRA 2C3UA 3HHLD 4CLZA 4IFVA 5IS2A 3OLAA 3MHYA 3Q8QB 1T9YA 1YI2S 3D7SB 3N9UC 2EFOA 1GAOA 1RTJB 4B3RJ 1HQ2A 2C1EB 3C6TA 2RQKA 2MSSA 2FB0A 3T6JA 3BKFA 4DR4J 4TY8B 1JJ2R 3IWNC 4P75A 2UUCF 2QC3A 1HI8A 4X4QA 1EARA 3SMZA 3FBCA 3L7UA 3I4PA 1REGX 2GMHA 1TV6A 3IGNA 3MM8B 5H9EJ 2FHJA 3WQPA 5CCMA 3TR5A 3R1HA 4NXNJ 3BQ2A 3PEHA 2ZHBA 2VONA 1TMMA 2E29A 3U1NA 2GQ2A 2AU0A 3P6YC 2CDRB 2POKA 3BPSP 2ATCB 1C1CB 2QYGA 2N82B 3BBBA 1QVGR 2Z2MA 4PWUA 5HSPA 1KR4A 3G2XA 2XWXA 1VBZA 3DRYA 3HK2A 3ELHA 3L3CA 1FRIA 2JLEA 1FHTA 2MMYA 2CJBA 4RW6B 4TN2A 2CPDA 5FLXU 4ETXA 1JXLA 2DB1A 2AX1A 1KRPA 2CADA 1JB0C 4K7QA 3BGRB 4H4MB 3O2IA 1SB6A 1UL3A 3DDNA 2RB7A 2VD3A 2D3ZA 2MQPA 4TY9A 1Q7YT 4CM0A 4QIEA 4ECVA 2R2TA 2A2DA 2EI5A 2W4CA 3AQOA 2BVZA 4AT1B 2YX7A 1RA6A 2UVWA 2F4FA 4G1IA 2KM8C 3JSMA 3THVA 4KTQA 1VBXA 1IKWA 2BRKA 4GVLA 2E5LF 3D0GE 4YEAA 4F4KA 3BR8A 3ET6B 4Y2CA 4ZDNA 5T7LA 2D7SA 4K4UA 1F6TA 2V0NA 2N3LA 5HN0A 2BACA 3KWMA 1FNXH 2W9AA 4AE5A 4I68A 2VICA 3BH7B 3WDOA 4MIBA 1UJ5A 3AB2B 5EX0A 2J0WA 1N6QB 5E3PA 4O4GA 1QVFR 3EVMA 2HAIA 2QT7A 1F3VA 3D1OA 3M8QB 2JVOA 1ZM2A 2KKHA 4ZPDA 3NGRA 4GVBB 4DV4F 1S0VA 1X60A 3HHEA 2I0XA 4PXDA 4CCHA 5E3QA 3PVXA 1CC7A 1FF2A 2RF2B 4OLOA 2JLFA 4DV5F 1AROP 3W3SA 2J7KA 3SQGB 2RDDA 2ZH1A 2CJXB 4OX8A 4IFVB 4QBUA 4QW8A 5E5NA 4F3OA 2HFOA 4ECQA 4B3TF 1LNQA 1J2VA 4ILMA 5F8GA 4CWBA 1RT1A 3R7NB 3WZ0A 2WVCA 4NLWA 2JHEA 5GAEU 2JDJA 3AAWB 5HMYA 2Q79A 4RUBA 2AZ3A 2QFIA 2RU3A 3MOZA 1TV6B 2H9ZA 4F67A 2OMLA 3TJ8A 3P3DA 2WSCC 3CD6S 2IYGA 3Q8PB 2VV5A 3Q8VA 1JJCB 3MCSA 1IJEB 1X4GA 3H59A 5KFYA 2LLZA 3PKMA 4PPZA 3BGOP 1D8YA 3O1LA 1TAUA 2NZCA 4KC5A 1HLWA 2LXUA 3CMES 1RHJB 4MKYA 3D28A 2BKPA 3H25A 1RYSA 4CO3A 1W26A 2XGQA 2KT5A 4LF5J 2IJFA 1IM6A 4XAKA 1IBMJ 4JUZA 5H9FK 2KHDA 3O3LA 3BBFA 1NJXA 1O0PA 3RZAA 2HFZA 4TVAB 4RBUA 2KH9A 5FJ4A 1YLXA 3R2DJ 3KUHA 1TR0A 2DNHA 3KKFA 1WSRA 3FEXB 4DN0A 2RQ4A 4ICLB 1TL1A 3J80U 2FLNA 2VL1A 2VJUA 5KT7A 2WTFA 4ZPCA 4ES3A 1UFKA 2AW0A 4JI1F 5BJRA 2FC8A 2R2UA 4DS5A 4FPIA 4ECTA 4FNHA 4LFCJ 3JSMB 3TZYA 1X0FA 2KT2A 2VQFF 1IKWB 2LDIA 1ZZFA 1S7IA 3UN5A 2OTJS 2JJ4D 5T7LB 1U6BA 1JXEA 2JNJA 2GC8A 3IR6B 4QWCA 1GMWA 4EYHB 3RAQA 3A12A 3LALA 3J7ZT 3DMJA 3CJ2A 4K5SA 3IFEA 4ZCLA 2UXDJ 3OXFA 4O4GB 4DR1J 4Y2AA 5GAHU 2UXBF 3VAIA 4ZVTB 4Z37A 1D09B 2XULA 2VDHA 1I51B 3KJFB 5LMNJ 2DR9A 2R4FA 1EB0A 1RAOA 3MFHA 4KGVB 3BR9A 4DR7J 2VDIA 5A2QY 1OSCA 5B0DA 3H0PA 1IXKA 3JYTA 3G8SA 2YWKA 2FLOA 2M9KA 2Z8QA 2DO4A 3TX8A 1XNRJ 1J27A 3P5BP 4YB5A 1M5SA 1BGXT 3LP1A 3R97A 3HSGA 2MB0B 4DEZA 1RT1B 4F4XA 1NJWA 2VOOA 1R0CB 2BE9B 2XG8A 1FO1A 5JMNA 3SCIE 3N6MA 1Q1KA 3SV3A 3KK1A 4X65F 2HHHJ 2FJBB 2V8VA 3FMBA 1U1RA 1A9NB 2NLWA 4F4AA 4DQIA 3OTOJ 1N8RT 4C8YA 3NY0A 1RXOB 4DL2A 3H5XA 1BY9A 2CUYA 2E9ZA 3KDOA 3M32A 2WSEC 3S01A 1SJ4P 3FSIA 4OYOA 1CQNA 3EGNA 1KFSA 4ZKAA 3QQCD 3UD3P 4EFAC 4OZ2A 1WOPA 4FF4A 5LOQA 2B7BB 1WHXA 1LOUA 4ECUA 1LWEB 1NXIA 3L95X 2J7WA 1KP6A 1VQYA 1LFPA 1VJQA 4UY8T 3KHHA 1NRKA 3Q83A 2DIVA 3KG0A 3MCNA 3JSRA 3IM8A 1TL1B 3IBCB 4CT8A 4CI0B 3NL0A 5CD4H 4LQ9A 2GIFA 2E1RA 1HQUA 3BYRA 2VUGA 3VAKA 1SXLA 4MK9A 1NHVA 5C7PA 4CLYA 5KFLA 3TVYA 1QAYA 2YX1A 1JLCB 3CC2S 4AXIA 1P1LA 1FNOA 1RWXB 4MKBA 2CA9A 4X4PA 4IR9A 2BW7A 1U1LA 3M8ZA 3MUTP 1OPIA 3CMAS 1R89A 2M4MA 2GO8A 4GKKJ 4XDCA 4OYXA 5AE2A 2I6WA 4H4KC 2FJEB 2F4VJ 3DMJB 2A10A 1DTTA 4CRJA 3EWGA 3FFIA 1GXUA 1WC3A 2J76E 3KMSA 4OZLA 3PR4A 2MDAA 3DYAA 1TTHB 3EGWB 3GZ7A 2MKCA 2O3DA 4PQAA 1Q81T 4OQJA 3R7BB 5HMWA 5E3RA 1QSYA 4GC6A 2AHOB 2KZMA 3Q23A 5KFIA 3DXBA 3PX0A 5F8LA 3O6QA 1RT6A 3HVWA 1S5ZA 3I82A 3ZZYA 3JYTB 1XTZA 4ZLPA 4RR5A 2RHQB 1JQGA 4JB8B 2BKOA 3KLHB 3B8HA 2OFHX 3GV8B 3LP1B 5DDRC 3CMQA 2KG0A 2KFYA 3FNNA 3N5FA 3A8JA 3BDPA 2FHKA 2ZBRA 4M5HA 3W9IA 2QMXA 3ISZA 3KK1B 2HFVA 1RAIB 2C3MA 3PXGa 3C46A 3D0HE 2NXCA 4A47A 2YKPA 1JLGA 3GIRA 3OR2B 1PJ5A 1NPPA 4OZ1A 2E5IA 1RBAA 4IH6A 5IXUA 2HFNA 1RT2A 2O01C 1F3FA 3O8WA 5A8RA 4R8UA 1EQ0A 2HRTA 3M32B 4ED5A 5CD4A 1Q8BA 2VPZB 4QIWD 1UTAA 2B8QA 4FXVA 3GIIA 1TKDA 2BR0A 3KUEA 2IDLA 3QSYB 1IKYA 1FERA 4QIGA 4CO2A 5HK4A 1D9DA 3R7SB 2X7IA 4AL5A 2XCAA 5FDLA 4U95A 4WTOB 3J81j 1Q95G 2DR7A 3BV8A 1XMQJ 4ZPWR 4ZPBA 2MYFA 1FD8A 4DLEA 1TK8A 1HQUB 3FBBA 3SYZA 5KFBA 1GT8A 4RZRA 1ZOTA 1HA1A 1MW7A 2BW2A 4UW2A 2RUGA 4BWMA 4WFNQ 4P52A 2JLGA 3VWSA 2K06A 4O44A 1Z1ZA 5T14A 2L9DA 1H7XA 4FN5A 2J9EA 4QPXA 4NRUA 2R8IA 1WF2A 3DLHA 5CQGA 4LRBA 1X7VA 1LEOA 4C8MA 2GZOA 2EK6A 1ZM3A 3E8OA 1DTTB 3X3UA 3C16A 1WC4A 4X62J 3FFIB 3HFZB 3JAMY 1N33J 1BC6A 2Y0SD 2DR5A 3DYAB 1KSPA 4DX5A 3PFOA 1F9EB 2ZBQA 4OX9J 4OIXA 1X5PA 2MJUA 4Q44A 4YDXA 2YH1A 4LF2A 3BF4A 1OY6A 1RLDA 2CAJA 3FSXA 2LEPA 3UDLA 1Y5IB 2VFSA 1TK5A 1RK8A 4RNOA 4EWTA 1ZM4A 2R9LA 2CWKA 2HURA 5H9FJ 2P6SA 2WOMA 2ZDPA 4A8SA 4PG5A 3R1LA 4U7UK 3M05A 5HP1A 1VBKA 2G2YA 2B5JA 3NG8A 2IPOB 2DGOA 2ASLA 2CNLB 5F9LA 1S49A 4RPFA 4ID5A 4U8VA 1YKWA 4DFKA 1TUVA 2V6AA 3N5BA 2J9DA 4NA3A 1HPZB 3Q8SB 2MQLA 2SXLA 4PXBA 2JWNA 2ZH7A 2Y8YA 4H4KA 2OEJA 3NGTA 3PW7A 1WORA 3X1LB 1TFWA 4LBPA 2CJ9A 3H5SA 1JLGB 1R31A 2VFRA 2LECA 2E1AA 5KG2A 3HHDA 3C14A 1U25A 2CDQA 1RT2B 4R8UB 5HQMA 3UNYA 2I8EA 1HW9A 2FIUA 2HIQA 4KQZA 3QT5A 1S6QA 2ALYB 1W2BR 3T5LA 4WZQA 2MTLA 4IKAA 1FRKA 1T05A 2V2KA 5AJ3J 2C22A 5J2MA 1QUVA 3I56S 1IKYB 3ISND 2P5VA 1HQEA 2CIMA 5J2NA 3L09A 2JFDA 4PZVA 4M5MA 4KAIA 1S4FA 4OI4A 3HFVA 3THPA 5FDLB 1U47A 4HVZA 1XMOJ 3PM9A 1M5KC 3NGSA 2FJVA 1PJ7A 5L1KA 4DUYJ 2BV3A 1FXDA 1UA0A 3HD1A 3TO8A 4ZN3A 3HVAA 1VQ6S 2W25A 4JI5J 4A4JA 3SXLA 1S0MA 3OW2R 5K20B 4FYXB 3KLFA 5F8JA 3CDUA 1M90T 1N0VC 1RTDA 5D6GA 3GMGA 3I0SA 1REVA 1O8BA 3WIVA 4P2SA 3CNQP 4PWWA 4GKJF 3B6BA 3MR3A 1DQ8A 3L7OA 4WFZA 3OTEA 3MF5A 2VQEF 2UUCJ 1PBAA 2W8KA 3GYXB 3MR6A 2NR0A 3C16B 2IBKA 2C3OA 2ERRA 1RDRA 4OJ3A 1LV5A 4UOHA 2GJ2A 1E6VA 4OYBA 2HRUA 1B7FA 2BOAA 5ETSA 1CQMA 3A8KA 1MU2A 1SH3A 3MCMA 3RAMA 2F5GA 3CE8A 2O66A 1GQEA 1BXNA 3CCES 5HVHA 3W61A 4NLGA 1HNWF 2MKIA 1CULA 2WOMB 2B9XA 4K2JA 1K73T 5IC4B 4DSEA 2PFFB 1VI7A 2QMUB 1X5OA 3QGPA 1NJZA 5HP1B 5HO4A 2WZ1A 2B5JB 2Q6CA 4NLSA 3K5NA 5I3PA 3MUVP 2ASYA 4XK8C 2ZOMA 1IR1A 4WP8A 5FIIA 4ID5B 1UKUA 1WOSA 3WC0A 4KHPF 5CYMA 1NZAA 4D3HA 4Y2IA 2VA3A 1H6KX 1NJYA 2Z2YB 2D74B 2W2OP 3H20A 1V3ZA 3GJSB 2HZAA 2D3UA 1YIJS 4YB7A 3LAKA 3C14B 2EVZA 4CT9A 4USMA 1O51A 5KFZA 1X9SA 2H51B 3VQTA 2E5LJ 3AJ2A 2A1BA 4E98A 3DLBA 1VYAA 2O67A 1G7CB 4RO0A 5EWFA 1S6QB 3DFEA 4NRTA 1K8AT 1NK8A 3PRDA 3UVJA 2ZM6F 1TKZA 4ZPVR 2EFNA 2XNRA 4LF9F 1HQEB 5J2NB 1RHKB 2R7WA 1N5YA 1VK8A 2XMJA 1BE4A 1SQGA 3GG1A 4LIRA 4FS1A 2CJYB 1NO8A 4JP8A 3P5TL 1U7LA 2BE7D 4DV4J 2HIYA 2AX0A 3GJTB 2IRUA 4JV2A 3KLFB 4DV5J 1WI6A 2GHWA 2QIFA 1FNMA 3H42A 4DX7A 1RTDB 4W4MA 2OPRA 2XSJA 1S1VA 3I0SB 4DSJA 3MR5A 1REVB 5B0GA 4C8OA 4B3TJ 3LPEA 5HATA 3M2UA 5CYQA 3VHQA 4F2RA 2VG5B 5A2QU 3OTCA 2PE8A 1J5EF 1S6PA 5IQQA 3AB4B 1C0TA 5C42B 1VMBA 4N56A 3VAHA 3LF0A 2C2KB 3RJMB 3IR5B 3QWPA 1JMTA 2B3TB 3BQ0A 3KJNB 5DGAA 3AODA 3CJ0A 6FDRA 1E6VB 1K44A 1IQTA 3NLCA 1XERA 3DOLA 1SIWB 5KOWA 1MU2B 2OELA 3DI6B 1NCLA 2H4WB 2W2PP 2MQMA 1LXJA 2W9BA 1CULB 4DL3A 1B7YB 2AWZA 3EVWA 4NWBA 2OFGX 2HFSA 2XHWA 2R8HA 3AJ1A 1NPKA 1R8PA 4I6WA 3H2UB 2YX4A 2Z0GA 2W4PA 1MMNA 2C2EA 3WIUA 4DFMA 4TXSA 4K0KF 2FLLA 3D66A 2WCXA 3HHLC 1KONA 5B08A 1FKOA 4J9MA 5CYMB 3BJYA 1RP5A 2XNQA 3Q8RB 3OHAA 1KQSR 4DS4A 2XLKA 4BDPA 4NPOA 2XQCA 2DNGA 2PI5A 4FYWB 1IWAA 1FFSB 4DV3F 3S7RA 2FY8A 2VQFJ 1VLYA 3PDNA 3EGZA 3OQ2A 5K9FA 2MY8A 1XC9A 3EMTA 3VF0B 2DVIA 3VAMA 2VZ9A 1HNZF 1DHMA 3BSOA 2NREA 1Y4ZB 1L3UA 3HHKA 4QR2A 3GSDA 4O4RA 1HKAA 3CC4S 4P71A 2FPHX 2CPZA 2EG2A 2X1AA 1NPRA 4DL6A 1DTQA 4FYVB 3M6UA 3QT7A 3UVJB 2XB2D 4DDFA 1TKZB 3OFHA 4KYZA 4CTAA 2UXBJ 3QPIA 3I31A 3D4JA 3H90A 4EGLA 5KG6A 1EQMA 5C2GA 2L3MA 4JYAF 1DARA 4C8ZA 3T5KA 1HWUA 4X64F 4NLTA 1V5IB 3T5JA 1GMUA 2GW8A 4Y65A 3NMAA 1YWXA 2OPRB 3BEGB 5I3UA 1MLAA 2XSJB 2BJEA 1S1VB 3F41A 2V94A 4WBFA 4DF8A 2VA2A 3NNAA 1UVMA 2K7KA 2OEKA 1ICEB 2NUHA 3M2UB 5CYQB 4QWBA 3BGLA 3LH2S 3RTVA 5CH7B 5CHCB 5GADI 1HW8A 1U8SA 1S6PB 3IS9A 2RS8A 3EXCX 1C0TB 1HBOA 4A48A 2BRLA 3M8WA 3HJVA 4X65J 5C24A 2M52A 2VHGA 5C2CA 2ZNZA 2I1RA 3K89A 1EX8A 3E51A 3M2RA 2MKKA 3KK2A 4ZS6A 2W2NP 4RW7B 2J9DE 3AD9C 1FJGF 2NQPA 2FVQA 2YKAA 3DOLB 3NNHA 1DAXA 1PAUB 3RB4A 2L41A 1T02A 2P2CB 2W9BB 2P9GA 4AUKA 2MLXA 4LR8A 2WK4A 3RGIA 2HLTA 5DJBA 3T1AA 1TU0B 2CQGA 5HANA 1SI9A 2DITA 4QJVA 4EZ6A 4A8MP 4J7CA 2G2ZA 1FKOB 1K1SA 3M8PA 3TAMA 4C8NA 1JLEB 2MLYA 2DXDA 1X0PA 3IP0A 3PW0A 2R7UA 3FJ2A 3UD5A 4ZCKA 4I2PA 2OMOA 1KEKA 1R43A 3PV8A 1FRMA 4ZA1A 4C48A 5D0EA 3GFZA 4I0WA 3TQ1A 4N8OA 2LQ8A 2G1DA 2QN6B 3D9BA 1E6YB 3V4IA 4RNFA 4OI2A 2QX0A 2QTWA 1TAQA 3ZZRA 2FTRA 1M5HA 2PO4A 3M6WA 4DL0C 1ELOA 2YNHA 3PYFA 1NDCA 4NE9C 1I3OB 2ZH8A 3G4SS 4NI2A 5ETQA 1D8ZA 2KI2A 3C2PA 4QU6A 3CT9A 4IH7A 1Y11A 4X66F 5DRKA 2XCPA 4RU2A 2GV1A 2ZVSA 3Q22A 2QE5A 2KN4A 1NB2A 3HHLA 4CTAB 2Y8WA 4F7VA 3ENWA 3OTBA 2X3DA 1ITPA 3DRRA 1DQ9A 3ILLA 3SIPB 3TNVA 1ZM9A 1BLUA 1WACA 4MKAA 1YSJA 5A76A 1TUWA 3SV4A 2J5AA 1HI1A 4BC9A 4OI6A 5I3UB 3KK3A 9ATCB 4RBTA 2H5IB 2PMZD 3QYYA 3ETOA 3DLJA 4PKDB 2C2NA 4HL9A 2X3GA 4ZPAA 4ZIWA 1Y3KA 4ZK7M 1JLFA 2IRYA 3DHWC 4WK3A 4X84A 3GB0A 3I9ZA 3IS9B 4ZHRA 1HBOB 4DFPA 3PNIA 4BHQA 5C24B 4A8QA 3GWCA 5HJXA 5HBMA 2BJ1A 5F8MA 1HBUA 3M2RB 3LGMA 1IWGA 3MM7A 3KK2B 1WC5A 1DZ5A 1RHMB 2YNFA 1RAFB 3LAMA 4OJHA 2VU5A 1UETA 1OQ6A 1SJ3P 5K14A 4Y3CA 4C11A 2YBVA 1VQ4S 1FCAA 2QL5B 3DM2A 4EYIB 3SBMA 1IN0A 4C4WA 4ZN1A 1L3TA 3A13A 3RW7A 4LF8F 3HX9A 4C98A 4YUDA 1RSCA 3M8PB 3TAMB 5B0FA 5B0BA 4WWSA 1Q5VA 1WJ9A 2BQ3A 1VQ9S 3ENAA 5C5JA 4CZCA 5K8MA 1R8BA 3A3NB 2YPZA 1QSLA 4QCLA 3FRYA 3DLEA 5B0EA 4I2PB 3FZ2A 3JQJA 2OD6A 2HNZA 4CH1A 5KFFA 2QLBB 3V4IB 2LP4A 4B17A 3CCVS 1DY3A 2ATLA 4PXCA 1GX6A 4NLPA 2R7RA 2FHJD 1G1XA 1QAJA 4OHYA 3GJRB 3D6TB 4IRCA 2YNHB 3AXMA 1WTFA 3TARA 4K4XA 4V19X 3HDSA 5LJ5Y 5DDQC 4X4RA 4NI2B 4CYUB 3NGDA 1Q5YA 1SCJB 3IM9A 2IJNA 1AA1B 2ROEA 4PRFA 2YWWA 2L9WA 5D15A 1FE0A 1X5SA 4U8YA 1AUDA 3ZZTA 2HPUA 3MURP 3SCKE 5I42A 4Q5VA 3HHLB 2VPWB 4EO6A 5GMKa 2DNRA 5E33A 5BYRA 3QNWB 3SFUA 1BWVA 1XNRF 3V6DA 1X4CA 4WFXA 1WTBA 3DRRB 2BM1A 1VBYA 1H72C 5KTQA 5DG8A 2A0FB 1R27B 2VPXB 2NXJA 1RUSA 2XYHB 3CJ3A 2PD1A 1AXQA 3US5A 3H8YA 1G3OA 4YDDB 3RR8A 1UVKA 1NK4A 3KK3B 4R25A 2HQDA 2EKYA 2KVIA 5IFMA 5L9NA 5KFMA 7FD1A 2U1AA 3D6MB 2YKOA 2OAUA 3UCUP 3GU0A 1YJWS 4I6YA 1RWVB 1LW0A 4ZVRB 4CO4A 2ASDA 5SUHA 3NOCA 4ZHRB 5KG1A 2EBGA 2MGZA 2RRAA 4K5RA 5H9EK 4QWEA 4J9KA 3CDBA 4U7UD 1JX4A 1A6LA 5KG0A 4WYLA 5KG7A 3K0JA 1YGYA 1IJFB 3PCOB 3MM7B 4HYKA 2DBBA 2DGVA 2R7OA 1DJ0A 3GR1A 3A1YG 1IBLF 2LU2A 5J2QA 3CO0P 2XS7A 1QAXA 2MHNA 5K14B 4C11B 2BM0A 4HR2A 3RYLA 4N77A 4OI1A 4KKOA 2HK2A 3DM2B 4IOBA 2AJ4A 3ONQA 1C4CA 4Q2LA 3QSIA 1RJJA 4IYQA 2A6MA 5KT3A 2UVVA 2D1CA 2J9CA 4HACA 1ZZNA 1JJ4A 3VR1A 2HYIB 3C15A 2Q43A 1HNIB 3JTOA 4B08A 2I38A 4M5JA 1F0XA 3IBWA 3CXCR 4WXOA 3D1QA 2CKWA 4URSA 5SZTA 5EWEA 3DLEB 3QJPA 4QIFA 3O44A 4J37A 3UI3A 2F3JA 1TL4A 3FDSA 2RS2A 1HBMA 3JTNA 2HNZB 1X4AA 2ZJQQ 2V2VA 1CG2A 1JKHB 3CCZA 1JWWA 3G6YA 1PC4A 5GADU 3AHPA 5A0YA 3QIPA 4ZITA 3IGVA 1L3VA 1URNA 3BS9A 4GKJJ 1VRTA 5DDOC 1JIHA 3NGKA 2VQEJ 2MZQA 2NCKL 2W2MP 1QJHA 2RQCA 2V5HG 4OYAA 1U4BA 2RU9A 3K58A 1B70B 3R5AA 3NWRA 1T11A 4B3MF 4C3LA 1RAGB 3RW6A 4B9TA 3QGHA 2W4DA 5I42B 1QAIA 2NZ4A 3AOCA 3W64A 2BZ2A 2P8IA 4ER8A 4QR1A 4MMOA 1VQKS 5IV3A 5A6PA 3UDVA 2QRRA 4O0IA 1YDLA 4ED7A 2DHSA 4M95A 4PCQA 2VIHA 5KFPA 1C2PA 1HNWJ 3QLHA 3ITHA 3TVZA 3QRPA 5EWGA 2IVMA 2HHUA 2ZH3A 1RBLA 1S4EA 3FUYA 1VR6A 1YK9A 4MAKA 1QLNA 1RABB 1HD0A 2JL9A 3PJ9A 2BOPA 4I69A 3PW2A 3BH6B 2RH3A 2CQHA 1WDTA 5GAEI 1S77D 4KHPJ 4WIQA 2AKWB 1LW0B 3WC2A 4MK8A 3OJUA 4KIAA 2MGZB 4QQBA 2FD2A 3NRBA 1U1QA 4OV6A 4YOEA 1VIOA 1GMWD 3BPDA 1L3KA 5CABA 3BGFA 3QT6A 3HF5A 2CWXA 3EZUA 4I2QB 4KGKA 4KFBA 5LJ3Y 2V4JA 4YY3J 1SL1A 3NCPA 1X5TA 2FYXA 3LA0A 1VRQC 1QM9A 4RUAA 3HSDA 2H65B 4NA1A 1UP1A 4KKOB 3V6HA 3NGUA 4ZOSA 3BDEA 4UUXA 5LSRA 2ZM6J 4ED3A 4B3SF 3OL9A 1ACMB 4HACB 4LF9J 3D3CJ 1WKKA 2OTLS 3C15B 5CCLA 3R6GB 4DFJA 2XGPA 4KJIA 3NBPA 3DNCA 2NPIA 1GEHA 1AFIA 1T03A 2AP6A 1T9TA 1KTVA 1NK7A 4J90A 2VG6B 1LXNA 2QA4G 2IA0A 2KHCA 4X4TA 5ETVA 2K3KA 2V67A 2PA8D 1H98A 3PZPA 4UUWA 2BQRA 2CZ4A 2OHDA 3TJ9A 2NSCA 4EU0A 5A0YB 4F2SA 3QRQA 3BREA 3QIPB 1UMJA 1PCAA 3CO9A 1FEEA 1B99A 4HHUA 1VLOA 1A0OB 1JLBA 5KFSA 1VRTB 4R5PA 1J5EJ 2QLFB 5G0RB 1T8EA 5E7OB 2GFFA 2NXNA 1TMJA 3RB0A 2A6OA 1G4CA 3TJAA 5KOXA 1HL6A 3GCXP 1YZ6A 5KG5A 2BDPA 1NSPA 3LQVA 4USVA 3ISNC 1VCTA 2APOA 3G87A 1SJ1A 4NCGA 4Y0FA 2X1GA 3G8QA 4DQQA 1RGVA 5HMXA 1OQ3A 1D9FA 2HBYB 3QLHB 3BSAA 4NLOA 2E7XA 2AF6A 4QIVA 1XEZA 3UO0A 1VHIA 4Y00A 3RB3A 3IWXA 4V1Ak 4L6V3 4LFAF 2GA7A 4EUVA 4DV1F 5E3CA 2OSQA 4K0KJ 3EPGA 2GVZB 2BANA 1DLOA 1KTQA 5HQLA 1U26A 4FVCA 4JV1A 3ULHA 3EVOA 2VH7A 4RJVA 1AT1B 2L08A 1RT3A 4ED1A 2V68A 4DOZA 2DNOA 4WFYA 3RU0A 5IV4A 3EM1A 1FT8A 3PW5A 1JJHA 2DEJA 5GVQA 4DV3J 2EFVA 5DZ7A 4KFBB 4B3OB 2YNGB 4MJKA 1R7IA 3MPYA 1LKZA 2DGUA 1HNZJ 2CQDA 2PFDA 2RDJA 1RADB 5HVGA 1Z2ZA 1FE4A 2MPUA 2DHXA 4FNIA 5BYQA 5K8NA 1WEXA 1VQSA 1BD6A 3OD2A 3W65A 1SVDA 2HEKA 1NSKL 3PRBA 1I1GA 2ZHAA 2FLPA 2CQPA 3KOAA 4OZ0A 1SH2A 1FTRA 3VGSA 3UN2A 2G13A 3SZ2A 4JI2F 4UOGA 4ZJOA 2X1BA 3JTPA 3UNGC 3NBPB 1V6HA 1T03B 2B9WA 1H0HB 2B0GA 4W90B 4JYAJ 2DNMA 2HRYA 1TKTA 5DG9A 4OLPA 3F73A 1SBRA 4X64J 1QSSA 4U7CA 4K8RA 2PSZA 5MAOA 2UZAA 4WCEQ 3MZIA 2KT3A 1S79A 1OO0B 1JLBB 5IQ6A 2F65A 4R5PB 4PYAA 2DR8A 3CW2C 1PBUA 1UVJA 3CDEA 3ZTRA 4TU9A 5E3AA 4AFFA 3K17A 1FD2A 2CQIA 4M5KA 2FC9A 3QBCA 1NK5A 2E5HA 4M5IA 4FF2A 3HVRA 1FJGJ 4NCGB 2DNZA 2J8AA 1S48A 1FWLA 2DY9A 4CH0S 3DRXA 7AT1B 3MEEA 2OH2A 3D0IE 3T1HF 4U9RA 1MMDA 2KRBA 2ZE2A 4RW9A 2QEXS 2RSQA 4OFZA 2G9OA
chains in the Genus database with same CATH topology
2MKIA 4QR0A 1YQHA 4NA2A 2WOMB 2FGCA 4FP9A 3GYNA 3BO2A 2B9XA 1VQMS 1F60B 2YKNA 2IVYA 1K73T 4DSEA 2PFFB 5AE1A 1VI7A 2F7VA 5LXYA 4DLGA 1R6YA 1X5OA 3V81A 3QGPA 1VC0A 2XMWA 1NJZA 5HP1B 3THTA 1D0EA 2DH8A 3KHGA 2BANB 1DLOB 3T6BA 5HO4A 2CJQA 1KLMB 3ZC4A 3UE2A 3HXMA 3EUNA 2B5JB 2Q6CA 4Y2MA 1TKXB 4NLSA 3E2EA 4P7VA 3K5NA 1AW0A 5I3PA 3MUVP 2ASYA 1S97A 4Q45A 1VIXA 3KLGB 2QV6A 2ZJPQ 4LFBF 4XK8C 2F40A 4F8RA 1Y9OA 2VFVA 2ZOMA 5FD1A 1XK8A 3SI8A 2DNKA 1RT3B 5FIIA 1CSJA 4ID5B 3OBIA 1MNEA 2XLJA 2JEGA 1UKUA 1WHYA 1WI8A 3OHBA 1VQLS 2MKJA 3DRSB 3WC0A 4CO1A 4KHPF 1EP4A 4NLDA 2UV8A 1M0SA 5CYMA 3MGJA 3SSSA 4YFUA 1YRUA 1NZAA 4WIIA 4C0HA 1XWLA 4D3HA 2KXFA 4IUFA 4KO0A 1LK5A 4ZP9A 3CCUS 2HVHA 4Y2IA 1SKWA 1VRUA 2VA3A 1HNVB 1XN9A 2DCLA 1MWZA 3I5AA 3LP2B 4ZMMA 3BO3A 1H6KX 1NJYA 4QZVB 4NZ7A 2CQ1A 4WE1B 2D74B 3P96A 3PY8A 1DTQB 1Y00A 2EFGA 3T5HA 4E0DA 3H20A 2JEJA 1V3ZA 3K7RA 5IT4A 3M8RA 1N5QA 2A2CA 2YWHA 3HPOA 1X8DA 5M2RA 2D3UA 1YIJS 2UUBF 2B56A 3J81Y 3IR7B 1V9OA 3MEGA 4YB7A 1GXLA 2ILZA 2UP1A 2R7VA 1GH8A 4HI1A 3LAKA 3H4DA 2R7SA 2IMWP 2EVZA 2FDNA 1LW2A 4CT9A 1O51A 5KFZA 5AXMA 3LP0A 3T9ZA 1X9SA 1N56A 2M7SA 5D4NA 1S72S 3VQTA 2V4RA 5H1SV 1U48A 3PO4A 4JV5F 2O1PA 4WU3A 2UV8G 1ZETA 1S1UB 4JV0A 1FESA 5EUHA 4BWJA 2NPFA 3AJ2A 2A1BA 1S1TB 3DDKA 3R3TA 1TP7A 2RT3A 4E98A 4YR2A 4U67Q 5J1EA 3DLBA 3CCTA 1HPZA 2O67A 1G7CB 4MFBB 2WBMA 3DCAA 5DLFA 1L5UA 1U1MA 3MECA 5EWFA 3ENQA 1VQNS 4G3IA 3C6UA 1S6QB 3DFEA 4NRTA 1H2UX 2D3OR 3TA0A 4EO8A 3FMWA 4NLRA 2MZJA 1K8AT 2FVPA 1S1XB 3MMJA 4DG1A 2MQNA 1SC6A 4OJGA 1NK8A 1S9EB 2GJIA 3PRDA 4QWDA 2PDAA 4J9PA 4B3OA 2ZM6F 2YNGA 3I5BA 2UUAF 1TKZA 4ZPVR 4F4WA 2HHTA 2EFNA 1FJ7A 5CXTA 2XNRA 4LF9F 1VFJA 1HQEB 5J2NB 1D3WA 4TU7A 1Q86T 1KNZA 1SV5A 4ITSA 4IQMA 5CZXA 4YMEA 3G6ES 1UA1A 2IYIA 5J2PB 2B6AB 1RI7A 3MPVA 2R7WA 3PIOQ 3KHRA 1HMVA 3OL6A 3DHXA 1N5YA 2IA6A 1VK8A 1IR0A 2XMJA 1QUPA 3BSCA 4OHWA 3ZZ0A 2MXYA 1VS3A 2E44A 2RQMA 3CCWA 1JNRB 3GG1A 4LIRA 4FS1A 2HMIA 3I5CA 1P8GA 5D77A 3LWLA 1NO8A 3P5TL 3QJJA 1KHVA 2RILA 1YRTA 2JOQA 2YKMB 1U09A 2JVRA 1U7LA 4NOHA 3GV5B 1KN6A 3ENVA 3VCDA 4DWIA 4PWDA 2AX0A 1NEEA 5L1LA 2IM2A 1JLQA 3C6TB 2YKQA 4N47A 1UJ6A 4K50A 4C7QA 3QAUA 1T94A 1WG5A 2YH0A 2IRUA 5KFEA 3NCRA 1F5AA 1RT5A 3I0RB 4JV2A 3KLFB 1CPZA 1XMQF 5DQGA 1WI6A 2GHWA 2QIFA 3PACA 2DPJA 2YY3A 1BWEA 3CF5Q 2NXUA 1HI0P 2LKZA 3G9CA 3ICLA 1FNMA 4OI3A 3TW0A 1SKSA 1SJFA 3HO1A 1WEZA 5KFTA 4HH0A 1RTDB 2RDIA 2ADCA 2OPRA 3N01A 3T19A 2XS2A 2XSJA 4LQ3A 1S1VA 3I0SB 1C1BA 1NK9A 4DSJA 3MR5A 1REVB 2RKIB 1YJVA 5B0GA 1M5OC 4C8OA 2YTCA 3KLIA 1AFJA 4LT6A 3H4BA 1B64A 1RTHB 2HHPA 2OPPB 1B0PA 1TQLA 2EWHA 2EFQA 2LQJA 2NYIA 3G86A 4AL7A 4DL5A 5DDPC 4EZ9A 3M2UA 3FSYA 3KNGA 2JEIA 5CYQA 1OSDA 2A18A 2N4DA 4F2RA 2VG5B 4Q8EA 1U2FA 1FDBA 5DETA 3K59A 4PG4A 1H2VZ 1RTJA 1N48A 4KHRA 4ED8A 2HGNA 4WK1A 3OTCA 1HWLA 2IC3A 4ETZA 2ZNYA 2FVCA 3MR2A 2PE8A 1J5EF 2VKZG 5LT5A 1S6PA 3C3LA 5IQQA 3AB4B 4OHVA 1U1NA 1RT4B 4NLVA 1C0TA 4ZVEA 4TY8A 5C42B 1VMBA 3J7YU 4DR5F 4JOUA 3P49B 4N56A 3VAHA 5BYSA 3NKYA 3LF0A 4PPDA 3CJ4A 4V19J 3IR5B 4C8KA 4X4VA 3PJWA 3QWPA 1JMTA 4J9LA 2B3TB 2JRSA 3BQ0A 2MZRA 2ASJA 1DBDA 3IO1A 5DGAA 4PXEA 3CJ0A 3T9NA 1E6VB 6FDRA 4X62F 2HNYA 3OTDA 1J5OA 1IQTA 5L39A 5JVHQ 1HWIA 3MM8A 3NLCA 5KG4A 3ZZUA 1N34F 1N33F 3BN4A 2J7UA 3SCLE 3T1YF 1F5CA 1XERA 3DOLA 2V9WA 4FVMA 2MZ1A 1SIWB 5KOWA 2BQUA 3LOUA 3MEKA 4WFBQ 4ZVGA 1MU2B 3CCRS 1Q79A 4EBDA 3DI6B 4OX9F 2AYBA 3H2LA 4J9OA 3CC7S 5D3GA 2MQMA 4ILLA 4O23A 3TAQA 1LXJA 3CGIA 2I9SA 2ZE2B 4RW9B 5B0CA 2LMIA 2W9BA 1C1CA 1Y5LB 3Q2SC 4KT0C 3V5RA 3PR5B 2AJQA 5A8KB 4ZP7A 3KHLA 3AH6A 5KFAA 1Q16B 5L1IA 1U1PA 4RUCA 2XMMA 5GAHI 4DL3A 4PQUA 3OVBA 3L7PA 2GHVC 2AWZA 4NWBA 3T3FA 2OFGX 2YVSA 2V9KA 2XHWA 2C42A 2DRAA 2ROGA 3AJ1A 3F44A 5AXKA 2LYVA 2R8HA 4DR6F 3HT3A 3GIKA 3E3XA 3V6JA 3V81B 3CPWR 2UVRA 1R8PA 3J7A1 4I6WA 3H2UB 2YX4A 2Z0GA 3W2VA 2CQCA 3WBZA 4QU7A 2OIHA 2XY5A 2W4PA 4F4ZA 2CQ0A 2GNKA 1S76D 1MMNA 1O5JA 2C2EA 2DT9A 5F0WA 5LL6d 4DFMA 2KYZA 1C4AA 4RNHA 4TKTA 4TXSA 4DBQA 3NNCA 1VQOS 4K0KF 2BXJA 2FLLA 3HHLC 2WCXA 1TL5A 2VB6A 1U45A 2XO7A 1KONA 5B08A 2E9TA 3OUYA 2C2DA 3U02A 1T3OA 1FKOA 3M30A 2IVFB 4J9MA 2E5GA 1EP4B 5CYMB 3BJYA 1RP5A 3NP5A 2XNQA 1I6JA 4HDHA 3Q8RB 4KO0B 2CQ4A 4HT7A 4DR3F 5EGYA 3OHAA 3H40A 1VRUB 1KQSR 2M0GB 1VQ8S 3BGRA 4DS4A 2XLKA 4H4MA 4BDPA 3RRHA 5J1PA 4K2XA 2UUWA 2DGQA 1HHSA 2IRXA 2G4BA 2DISA 2B9YA 3MM6A 4NPOA 3OLBA 4CH7A 5IZHA 4K4YA 3PO5A 2XMUA 2DNGA 3MXHP 2PI5A 3QJLA 1XBWA 4ECXA 2X1FA 2DHAA 3FZBA 4X2BA 4USJC 2V8GA 1S10A 2DPIA 2E5JA 2K2PA 4DV3F 3MEGB 1TKXA 5M2PA 2R8JA 2CPHA 3S7RA 4FXDA 3PX6A 1LW2B 1VLYA 3PDNA 1N36F 3EGZA 4KHMA 3OQ2A 3KLGA 5K9FA 1VQ7S 2MY8A 4OX7A 4A8WA 1XC9A 3LP0B 1XMBA 3LW5C 4K4TA 1N88A 3VF0B 2DVIA 2KJVA 3VAMA 2VZ9A 1HNZF 1DHMA 3BSOA 2YWGA 2NREA 1Y4ZB</