3FBBA

Crystal structure of the mimivirus ndk n62l-r107g double mutant complexed with udp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
133
structure length
133
Chain Sequence
b'AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFPET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 42
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3fbbA00
1NHKL 3Q89A 4KPCA 3BBFA 3EM1A 1LEOA 3FBBA 2B8PA 2AZ3A 1MN7A 4DI6A 1HHQA 1B99A 3NGUA 1KDNA 1NPKA 1S59A 3BBCA 3EVMA 5C7PA 3FCWA 2DXDA 3FCVA 3GPAA 5CAAA 1NCLA 3B6BA 3R9LA 3EICA 4UOHA 1BUXA 3EVWA 3ELHA 3BH7B 1NDLA 1NSPA 1F3FA 3B54A 1WKKA 2CWKA 4F4AA 2DY9A 1S57A 3ETMA 1ZS6A 2ZUAA 4UOGA 1XQIA 3ZTOA 3DKDA 1NLKL 3EMTA 4O0NA 4C6AA 3FBFA 3NGRA 3ZTPA 2DXEA 3MPDA 3WX8A 1VYAA 2B8QA 4CP5A 5IOLA 2HVDA 2DYAA 1LWXA 3Q86A 3VGSA 4EK2A 3VGTA 1WKLA 3Q8YA 1K44A 5CABA 1NDPA 1U8WA 1UCNA 3FBCA 1WKJA 1NSQA 1BHNA 3GP9A 3FKBA 4ANCA 2AZ1A 4FKYA 1B4SA 1F6TA 1NB2A 3BBBA 2BEFA 4ANDA 1NDKA 3PRVA 1S5ZA 1PKUA 2NCKL 2HVEA 3FBEA 3ZTRA 3ENAA 4DUTA 4HR2A 5BXIA 1PAEX 4W98A 3NGTA 1HLWA 3NGSA 3Q8UA 3JS9A 4WBFA 3EJMA 3ZTQA 4ANEA 3ZTSA 3BH6B 1HIYA 1XIQA 3VVTA 3DDIA 1JXVA 4S0MA 3FC9A 1EHWA 2DXFA 2HURA 4FKXA 4UOFA 4F36A 2BX6A 1NSKL 3L7UA 3EVOA 3PJ9A 3VGVA 4DZ6A 1W7WA 3G2XA 3VVUA 1NUEA 1BE4A 4ENOA 3VGUA 3EE3A 1MN9A 3Q8VA 2VU5A 1NDCA 3Q83A
chains in the Genus database with same CATH superfamily
4I1TA 3FSXA 3KLEB 3CT9A 4HLBA 3M4XA 3N28A 3E01A 4UOHA 4ZN1A 4PWUA 2ZWPA 3T1AA 2JC0A 1WF1A 1XWLA 3M6XA 3NLCA 3QIDA 1VRTB 1OQ3A 1Q8KA 5BYRA 1QDUB 2K3KA 5FIIA 2PEBA 5EGYA 1SL0A 2A2CA 2XSJB 1VC0A 2BJ8A 3H4BA 4DR4J 2GMLA 2CA9A 2WCXA 1WSRA 3D6MB 4IFYB 2Z2ZA 3KNGA 2FHOB 5BJRA 3DLHA 3Q0AA 4DV1F 1S97A 2R2SA 5AXMA 2WOMB 5KFCA 2KL8A 4MH8A 2OJ3A 3EJMA 2AWZA 4Y6IA 1SB6A 4LF5J 4OI4A 1IXKA 1RT6A 1X4EA 3TARA 4CQ1A 4NLSA 4CLLA 2PI4A 4KO0B 1D9DA 3GONA 5KFZA 4I7FA 1S12A 3JYTB 2H51B 3GB0A 2C2DA 2FJDB 4JBCA 1F9HA 4NLYA 2XEXA 1NK9A 4B9MA 3IO1A 3RR7A 2FIUA 4IR9A 5GAEU 2OD4A 3NS7B 3M9MB 3ET6B 5ADZA 4RW6B 4RR5A 2N3OA 1VQ5S 1GTEA 2VL1A 3KK1B 1RKIA 1ZETA 5KG1A 3KNAA 3AD8C 3HULA 3O5TB 4KKOA 5F0WA 1CBKA 3MCSA 4C8MA 4K4YA 3ZXWA 3TANA 2GCFA 1YKWA 2A0FB 3EZUA 1RAHB 2BKNA 3OTOF 1NH8A 4PG4A 5F8NA 1T05A 2NYIA 4B3TF 1BLUA 2YKNB 4A8XA 1NJZA 4QWEA 4DV5F 1QAYA 5KT5A 5LJ3Y 1NU4A 1RWNB 2IC3A 2DNPA 1U6FA 3KLGB 4USJC 2VG7B 4WU2A 4R0JA 3NMAA 4DV4J 1R7IA 1M5HA 2I0XA 4N7TA 2JC1A 4NXMF 3T6BA 2BE2A 4M5JA 3BR9A 2LKZA 2PMZD 3PYFA 4DI6A 1DTTA 3F41A 4O3OA 3H20A 1AXQA 1XMOJ 3OVSA 3KK2B 3FMWA 1NCLA 2F1FA 4WP8A 4OHVA 1Q16B 1EP4B 3JQKA 4GVBA 1H2UX 3IR7B 4FPRA 4PG6A 4JI1J 2ZUAA 1FESA 5IC6B 1TKZA 1Y5IB 1QJHA 2CNOB 2JFKA 1VBYA 4ID8A 2KJWA 5AT1B 1R8HA 1L3TA 4UTGA 1PGZA 5F3TA 1LWCB 2C2ZB 1S7IA 3FKBA 2E5LF 1IBKF 1SC3B 5DGBA 1HPZB 4NRTA 1HNIA 3R7NB 4CT8A 5F8LA 4HHHA 1XNQF 1X0FA 1U4BA 1FWKA 2CJKA 1GMUA 2V2VA 5HMWA 5D0HA 2ZH2A 2RDDA 2C2EA 3KK3B 2HVHA 8AT1B 1LV5A 3OHAA 1S0NA 4X4QA 3LP2A 3HHKA 3IN5A 2A6OA 4CLTA 4NZ7A 4DR7F 5FDLB 2G1HA 1FD8A 4LFCF 1VQSA 4OI3A 3B54A 1DQ9A 4ZLJA 1ZM3A 1BGXT 2VICA 4P9SA 2FDNA 2E5JA 4AL7A 2AJQA 2IPOB 2XHCA 2EK1A 1FJGF 2NREA 4NXNJ 1PBUA 4PWDB 3I4HX 3QQCD 3AQOA 5F9NA 2FUG9 2HEKA 1U49A 5FD1A 1CSJA 1FRXA 3W2VB 4RWXA 2KYZA 4RUAA 4ZPBA 4P7VA 5I42B 2WK4A 1EARA 1IBMJ 3FZ2A 2HQCA 3CJKB 2XM3A 2JJ4D 2R2RA 1N54B 3H90A 5KFJA 2KJVA 1WEXA 4NA1A 5IT9Y 3HCXA 1CULB 4P2FA 3TNVA 4DS5A 3EM1A 3R6GB 2W24A 3LALA 1HNWF 3M8QA 2R7QA 1B99A 2B7BB 4HHJA 2D3ZA 4B17A 1F0XA 5LMUJ 2Z58B 3M32B 4FYWB 2FC8A 5IQ6A 4Q45A 4B3OB 1U1QA 1CQMA 2AYMA 2DO4A 2YKMB 1VBXA 4TU8A 2Z2LA 3DM2A 1DBDA 4C0BA 2H65B 3BSAA 4TY9A 2F40A 4J37A 1GMWD 4WK1A 3MGJA 3JSYA 4JV1A 3FBCA 2J0SD 1H7WA 5THWA 1WC6A 2VPXB 5B0FA 1MROA 4RUCA 2AHOB 2BJEA 3RBDA 5HMXA 4RW8A 4DR3F 2DPIA 5KFGA 5CYQA 4O0IA 2ZM6J 2NPFA 3G2XA 4CYUA 4C3KA 1UVMA 3GCWP 1S6UA 2X7IA 2F9DA 2KH9A 4CLSA 2RKIB 1TV6A 2FY8A 3IXQA 4NCBA 4C8KA 4PPDA 3J7YI 1FKOB 4K59A 1O8BA 5DRKA 2VB6A 1B70B 2BKOA 1N5TA 4WZQA 2B9XA 1CJUA 5A8RA 2DRBA 2BM0A 1CG2A 2XMJA 1AUDA 4X4TA 4P75A 4NL5A 9RUBA 2VFTA 3OPKA 2HHXA 1SIWB 3K7RA 2PE8A 2W4PA 1TUVA 4ILLA 5DZ7A 3WQPA 3ET6A 5IWAF 2AV5A 2V69A 5IQQA 1I3OB 2EEYA 3KK1A 1EB0A 2YWFA 4OX8A 4YY3F 3HT3A 2FLLA 1TK5A 1XIQA 5LXRA 1NK6A 3GIKA 4ZVOB 5K14A 2KDOA 2DGXA 3GYXB 2B56A 1KQSR 2WONB 4LIRA 4QIWD 3GFXA 4URGA 5EX0A 2FZGB 1MMDA 2QRRA 2QV6A 2KFYA 1T02A 1YTYA 4HTJA 2DIVA 3QWPA 2W9BA 1M1KT 3TA1A 2VPWB 2K8GA 2GW8A 2QLWA 4MKBA 3DRSA 4C8YA 1SIZA 3MM6A 2F4VF 4DOZA 3A8KA 2G2OA 2MXYA 4HEA9 5DQGA 3AB2B 4OHWA 3J7Z5 2O3DA 5J1PA 2FYXA 4DFKA 2OEJA 2XQCA 1RTDB 2CQIA 3DGVA 2Q66A 1UP1A 1NRKA 4RX6A 3RBEA 3B8HA 2EC2A 1EP4A 3OFHA 1K8AT 2CFXA 4NLOA 1S9GB 4DQQA 2HNYA 2B9EA 3DRYA 2BQ3A 1UWBB 3TJ9A 1V6HA 4JI3F 2HWHA 4XDCA 3P4UB 1S1WA 3W60A 4N76A 2NQPA 5SZTA 1KFDA 5K9FA 2D69A 1AB8A 4CLWA 1V3RA 5HSPA 3MR2A 1HHQA 1HPZA 3B6BA 2UV8A 4OLPA 3MPUB 2AF6A 4NMLA 1KKHA 5I3QA 3KLVA 1F9EB 2DY9A 2RD5C 2KTQA 2ACMA 4J9QA 1JNRB 1SJ1A 4F67A 3TZXA 2XY7A 3SYZA 3O44A 4DG1A 1SBRA 2FHJA 3OL9A 2ZJPQ 2DYAA 4LREA 4DL2A 2DEIA 1QUPA 3VAFA 4TN2A 2KXHA 2BKPA 1YVFA 4A48A 5J2NB 1NSQA 3VZIA 4KH0B 2DNHA 3J81Y 1S5ZA 3FEZA 1N4LA 3IR6B 2HZVA 4OJ3A 5LMNF 1HFEL 3KJNB 4M5NA 3OT9A 1NJWA 2KHDA 2IVMA 2HHQA 4ED1A 1K0VA 2JX2A 2KFNA 1S48A 2IBOA 3OUYB 1SL1A 1SUQA 1C1CA 4CWBA 3FVYA 4MKYA 1WHWA 3QIPA 1PYTA 2Y0BB 2EFQA 2V4JA 1BQNA 3D1HA 3CE8A 4CM0A 5AE2A 3LA0A 3R5BA 1LWFB 3EICA 3MM8A 1QM9A 4FYXB 1WKKA 5I42A 3J80Y 2GAGC 2DGUA 1FKPB 4ZLPA 2CQ0A 3EZOA 4DPYA 3GG0A 3SQOP 2ZH8A 1UFKA 1EJ7L 2DCLA 2YWKA 5IOLA 3KUEA 5IT4A 1TL3B 2OMLA 2XZDB 2RF2A 5IV3A 3RTVA 3NXZA 2BRLA 1XEZA 1RADB 1YITS 4ED6A 3MM9B 4X66J 3HJFA 1N36J 1LW2B 2EFVA 1M5KC 3CMES 1PAUB 2F9JA 2VKRA 4AYBD 4DL3A 4B3OA 1OPIA 2XLKA 5K8MA 2CQDA 5HK4A 3CIZA 3MUVP 4HACB 2POKA 2QJ3A 4ZVUB 1K0TA 3RAMA 2VPZB 1YSJA 5IXUA 3GR1A 1N5YB 2VBWA 3O1LA 2B0GA 3BJYA 2BJ7A 3GPAA 4W92B 1U45A 2VQFF 3H0PA 3RUBL 1CC8A 4OYAA 2VODA 3TZWA 1LFWA 3VF0B 2LU1A 2DR5A 2CKWA 3BEGB 4ZP7A 2QIFA 1B7YB 4CP5A 4Y3CA 3DOKB 3DI6B 3DLKB 4MK9A 3VGSA 1NAQA 1Q53A 1FD2A 2VFSA 3TUJC 5J2QB 4V1Ak 1DFDA 3GJQB 2R8GA 3GIIA 3UFCX 3PW5A 4OX9J 3DU6A 4ZK7M 3RG6A 1HBOB 4F4ZA 2KB2A 2ZVSA 1KD1T 4IYQA 3ITHB 2HAFA 3AXKA 2RVJA 4FXDA 2K1RA 4LVNP 3KJQB 3OVBA 4R5PA 3S7RA 4CZCA 1RE1B 4DUYF 2FVPA 1JLBB 2C3MA 3ADAC 1X5TA 1RHUB 4XPCA 3SSSA 2ZVIA 3IBCB 3O2IA 5IZHA 4X4SA 4I2PA 2CQHA 3VTIA 2XG8A 5AE3A 4IG0B 1WC5A 2VDHA 1S0MA 1VBKA 3P3DA 1ZZFA 4C97A 5L1LA 1YJ9S 2ILZA 2AX0A 4A8FA 4MIAA 1Q81T 3RB3A 1TKTA 2UUCF 3MECB 1CJVA 4QZVB 1HBNA 3ZZUA 4DV3J 1CJTB 1BHNA 5D4OA 5D4LA 2AYEA 3F73A 2H3EB 1F5AA 1YJRA 4NRUA 2YNIA 2DGVA 2HK2A 1RZMA 2R3VA 1RCOB 2MJUA 1WEYA 3LTOA 4CLPA 2GQ2A 2LP4A 2EW9A 2Z56B 1VFJA 3LWMA 2ABYA 4ES1A 4Q0BA 2CNNB 2NS1B 4ED5A 1RUSA 1TAQA 3CCLS 4C11B 4WYLA 4DR5F 5T14A 4YFUA 1NK7A 4CIOA 3CCQS 2J6TA 2K3IA 4KFBA 1WOOA 2N82B 1XNRJ 2IDLA 3K5OA 4RWWA 4KHPF 2FLPA 3FCVA 1WG4A 4O3PA 3PDNA 2PN6A 3RB4A 1R8PA 4K0KJ 3P6YC 2C3OA 3PX6A 2NZ4A 1HNZF 7AT1B 3V6JA 1LW0A 3PR4A 4USWA 3VAHA 3E8OA 4LBHA 6FD1A 3L7PA 1WG5A 2HVDA 2JWNA 3BDPA 3BS9A 2VDIA 1N32F 5ITHA 1GTHA 3NGKA 5KFWA 2ATLA 1RAGB 4ZJLA 3TOQA 4ANDA 3NWGA 3BREA 4JV0A 3FBEA 1VK8A 2DGTA 3I96A 3MTKA 1X4HA 5CHCB 4DQPA 2VJUA 4LF9F 1M5PC 2F63A 4K50A 1Q95G 4LT6A 3KWMA 3KMSA 4J5OA 3NWRA 1UWAA 1QUVA 1R89A 4X62J 2HWTA 1FFWB 3TA2A 3PRDA 2EG2A 4LF1A 1G2EA 4X4UA 4F3QA 3BBCA 1S59A 2PSZA 3UQSA 1RDRA 3QRQA 5HVHA 3W61A 4LBPA 4FS1A 1YJNS 2W7OA 3L95X 2KG1A 2V0NA 4EYIB 1LXJA 2VA2A 1D9AA 1VIOA 2QL5B 3G4SS 1X8DA 2Z0GA 4DU8A 2YQ0A 4OV1A 1N56A 4JI7F 1T9YA 3RRKA 5DLGA 2NXNA 4OHXA 2QA4G 4EO8A 2M88A 6AT1B 2WHOA 5A8WA 3A12A 5CYJA 3V6KA 2ERRA 4DN9A 3NGTA 1Y0HA 1RTHB 1FKPA 3A8IA 3K0JA 2RUGA 2HSEB 1QLNA 2AEMA 2BOAA 3VHQA 1QE1A 1H73A 3H4DA 4DV1J 1JLCA 3QFHA 3LH2S 1CVJA 2Q79A 1FFGB 4I2QA 1F2GA 3BGRB 5KFSA 3N01A 2JLEA 1X9WA 4HI1A 3HKZD 1S10A 4WFYA 3FMBA 4NCGB 1Q7YT 4IG3B 4IOCQ 2E9RX 4RZRA 2A10A 2XSFA 3PM9A 4Q44A 2ZKUA 2L08A 3CD6S 1WTFA 1UZHA 5JJBA 1DLOA 2HBRB 1NPPA 1R31A 2N7YA 2DNKA 1WOSA 4Y2AA 2QL7B 5H1SV 3T1HJ 1HYSB 3C6UA 2UVVA 2YPYA 3TUIC 3L4BC 2M3DA 4N47A 1NKBA 5H9FJ 3RB6A 1YJWS 1PYSB 3FK4A 3W5YA 4OX7A 4ZVPB 2HFUA 3HMJG 1G4CA 3MTJA 2YVSA 2M7SA 3BYPA 3R27A 4O44A 2GJFA 1SJ4P 1PC5A 2MKSA 1WC4A 4OI2A 2DH8A 3H59A 1UPMB 2FLOA 2RQ4A 2WVBA 4RKUC 1RTJA 4OZ5A 4DV5J 2L9NA 3MAHA 1H6KX 4PABA 3G8QA 3Q83A 3EUNA 3ETOA 3MFHA 4J9KA 1MN7A 4B9UA 3ISND 2GQQA 1M1HA 4N8OA 2PIIA 2KM8B 4ZPCA 2AGPA 5K8PA 3H2VE 3MMBA 4ED4A 2CPEA 4WWSA 2JEFA 5E3RA 2DIUA 3ONQA 3MR3A 1N5SA 2ATCB 3ISZA 1JLBA 5F3ZA 1OSDA 4B3MF 3ILJA 3PO5A 2MY8A 1KHWA 5E5NA 1YBUA 1U0HB 1LKZA 4K4ZA 3SCKE 1UEVA 5GADI 2RQCA 3ZTRA 1GAOA 5M2PA 3J7ZT 2HHWA 1Q8IA 2BV3A 2NR0A 5GAHU 3OJUA 1SV5B 2DGWA 2HHPA 3PIOQ 1HW9A 3OXFA 3PJXA 1XNQJ 1WSVA 1FJ7A 1ICEB 1IBLJ 1IWGA 1V9OA 4BWJA 1SJRA 2HG4A 3R7BB 2HS0A 4CO2A 5BYSA 4NLVA 2M70A 1TL5A 4Q5VA 2MSSA 1TVRA 1XBWA 3QGPA 4U8YA 1SQFA 3TAMA 1MWZA 2GFFA 2EXUA 2RU9A 4K5SA 3DHXA 4JI5J 4DR7J 4YN3B 2EK6A 2EKYA 5L1KA 1WD6A 4JI0F 3RU0A 4QYZJ 2MLYA 3CJ8A 3NRBA 3PEHA 3D0IE 2DNLA 1VYAA 3EXYA 4LFCJ 2HZCA 3ENWA 3H2UB 2GJIA 2OPRA 4MFBA 3VAJA 1ZM2A 2ZHAA 1KBRA 1TFYA 4JV5F 2XYHB 1JLFB 2VBYA 2NYHA 3NP5A 3C6TB 1NB2A 2MQ8A 4MKVA 2DR7A 2GA7A 2LU2A 1K9MT 1HNXF 2BW7A 5A6WA 3K5LA 2ZDPA 3ENAA 5D77A 1FJGJ 3JS9A 2CAJA 2CJYB 4X4PA 1L5UA 4BC7A 4TLRA 3X3UA 3H2LA 3UN5A 4DN0A 2MQOA 5CYMB 2J8AA 2HFVA 4ENOA 4QYRA 1NZAA 2CQ2A 3NY0A 1X5PA 2B9WA 4KSEB 4N77A 2PFDA 4ES3A 1TAUA 3IS9A 1RBLA 5DDRC 3OXLA 2DCUB 3IRXA 1GH8A 1JLEA 3C16A 4ZPWR 5U47A 3BH7B 3PNIA 1HNVB 1TKXB 3J81U 4C9DA 5T7LB 3TVZA 3WX4A 3NCPA 2CQGA 3UDCA 1HWIA 1S1XA 1FX2A 2ZH4A 3HK2A 1S6OA 4C8NA 3EX7B 3AT1B 4ZS6A 5KFVA 1U8WA 2ZH3A 3GJRB 2RAQA 1RT7B 4Y00A 4LJMA 3KDOA 2VV5A 3M05A 2HIQA 2GVDA 3IAM9 1T3OA 1CS4B 2GC8A 1S1UB 3R7SB 2ZHBA 4LF6F 1N33J 5C25B 3W9JA 4DSKA 4YB5A 3J80U 4RW9A 2J8SA 3ZZZA 5A8KA 3PW0A 4DX7A 3MR7A 2YBVA 3BSCA 3KKFA 3V81A 4J9MA 2RDJA 3DXSX 2CVIA 5CZXA 2HKEA 3HHEA 2GHVC 4R0EA 3IM8A 2K7JA 3AY0A 3KLHB 2PFFB 3SCIE 1WHXA 3MEGA 3CD5A 4DX8H 2ZD1A 3PEJA 5JXSA 4UT4A 4QIFA 4IRKA 2IVFB 4LRAA 1IM6A 1FFSB 5AXNA 1U1RA 4EK2A 3OR1B 4RU9A 2AGOA 4LSNB 3TRGA 1V3SA 4ECQA 1BWEA 3TVKA 1VQLS 2YKOA 5DJBA 1RGVA 2CJAA 2XO6A 1IJFB 3QO9B 1HI8A 2VFUA 1YHQS 4KC5A 4LF8F 1VRUA 1U47A 2RRNA 4PKDB 4NEYA 2DNQA 4P7TA 3GR0A 2FTRA 1HYSA 1SJQA 3AH6A 1HD0A 4L73A 3R1LA 2DD8S 2KXFA 1HWUA 1N6QB 4HH1A 3KLIB 5AJ3F 1WHVA 3W8GA 3NS5A 3K59A 2BXJA 4YQWA 1T9WA 4KGZB 3K58A 3SFGA 4O4GB 2QLXA 1RAOA 3SIPB 5HANA 4JV2A 1P9YA 5J2MA 2MZJA 2C22A 1RWUA 1MNEA 4QR2A 3HHDA 4MKAA 3IR5B 4YP3A 2ZWOA 1JX4A 3V6DB 4HDGA 3A4TA 4OJHA 2W1BA 3SQGB 2KYXA 3DLGA 3THTA 2FJVA 7FDRA 3DFEA 9ATCB 5CABA 1C0TB 1RACB 3TZZA 5KFHA 3I0SA 2DNMA 4OZ0A 3KLFA 4F50A 4H4KA 1PKUA 4JI4F 3NAIA 4DL7A 1FK9B 2HGLA 1UL3A 1U09A 4KQZA 3MCOA 1BXNA 2N7CA 3IGVA 4D3HA 2HGNA 4PR6A 3RBZA 1HARA 2MDAA 2LXIA 1S49A 2Q3PA 2CDQA 3HSGA 3T9NA 1U25A 2FVQA 3G86A 2YNHB 2BOPA 3DOLA 4XDDA 4U95A 2R7WA 2CYYA 1U02A 3WZ0A 3M30B 3SDEB 2CVEA 1LWEA 4JI3J 1RT4A 5L39A 4F4YA 2CJBA 2UUAJ 3EPGA 2OH2A 4RBVA 1NK8A 2W2OP 2O5DA 3CGIA 2PEHA 3KUGA 1GT8A 1T11A 5A2QU 2H5IB 1VCTA 3UD4P 4CO4A 1XR7A 2QYGA 4LBIA 1RT1B 3CJ4A 4I6AA 4M5LA 2W4DA 3KG1A 3S1TA 4H54A 4QW9A 4X64F 2AJ1A 3UDVA 5D0GA 2J0QD 4ATNA 4DQSA 3LQVA 1NO8A 2ZE2B 1BQMB 4P72A 5A6PA 1GXUA 1VQOS 3UDLA 5KFAA 3VQSA 4ZLLA 3RW7A 1MN9A 3GG1A 3EYZA 5C24B 3IM9A 2CRLA 2LQ9A 1GMVA 4QU7A 4AD6A 4B9TA 1J5EF 1T0TV 4MT1A 5D0RA 3MEDA 3N6NA 4DPTA 2ZDOA 2CPIA 2XWXA 3VQTA 4WFAQ 1IKXB 3OLAA 3GE9A 5CCMA 3DLLQ 5HVGA 1H74A 2KT5A 4CH1A 4EBCA 2H48B 4EO6A 3IBWA 5HBMB 4ZP8A 3BR8A 2JVRA 1S9EB 2B6AA 1NK5A 2DHXA 4DV2F 1JLAB 1M0SA 2DNZA 1RYRA 2W8KA 5C42A 3RZAA 4I64A 1RBOB 2XI3A 1TKDA 4HI2A 1R0AA 1U6ZA 4IR1A 4RNOA 2QG9B 3CJRA 2C2NA 3DCAA 1I5OB 2YQ1A 2MZSA 5DGAA 2C1EB 1D0EA 1XMQJ 3J7A1 5KG7A 5KG3A 1HI0P 1YX2A 5F9LA 3CJTA 4PG8A 1CS4A 2VH7A 1WELA 4Q8EA 5LOQA 5C25A 2HW3A 3QLHA 1IN0A 2WBMA 2W2PP 2VQEF 1MU2B 4IDKA 2AEFA 3Q24A 3Q8QB 2WBRA 1GQEA 2HFZA 4LSLB 3DHWC 5KFEA 4DSEA 4ZHRA 3M2VB 3Q8PB 2RRAA 3PYEA 3DNCA 2C2OB 3G96A 2ASDA 4YR2A 1NXIA 5D8HB 3V4IA 4B3SJ 2UUBF 4LIWA 2HYIB 1IKVB 2P9EA 3M2UB 3R97A 2ZH1A 2QT7A 4TVAB 4IOBA 1TL1A 1EETA 3QAUA 3ZTQA 1U1PA 4WFXA 4YEAA 1N5QA 3KHGA 5M2RA 2V8GA 1FRIA 4A8KA 4K4SA 3C2PA 2F4FA 3MM5B 4KHRA 4FBUA 4LSNA 2ZEJA 2D3O1 4FYVB 1X4CA 1HQEA 3QMQA 4ALZA 4DUYJ 4CO3A 4ZPAA 3MURP 1ELOA 3UVJA 4TU9A 3NNHA 3I5AA 3I0RA 2HRTA 1UJ5A 4QOTA 3BKUA 2Q43A 4EZ6A 4B3RF 1B0PA 3E01B 3BN4A 2CPJA 2IMWP 1F1BB 1JJCB 1LNQA 3F44A 1IKWA 2ZZMA 4FDFA 2O66A 2BABA 3T9ZA 3BKFA 1JB0C 1RWKB 1UMJA 2MZQA 4YR3A 2M8HA 1NDKA 4ED2A 1WACA 1J2VA 2UUCJ 3NOGA 1PBAA 4R8UA 3PHEA 5BXIA 3O6QA 3FEYB 1RTIA 4X4NA 3NG8A 4OYOA 4M95A 5D4PA 4OZ1A 3UNYA 2BJ3A 4F7VA 1JMTA 3VGVA 2XMAA 2XLIA 1OY8A 4ZJOA 3ENVA 4LQ9A 5C2GA 1N48A 3QT6A 1VI7A 1SJ3P 1ZM9A 1S6PA 1T3NA 4YB1P 2BBEA 2YNGA 4DR5J 1Z2ZA 4LVOP 2HHVA 2ZC4A 4I7FB 3QGIA 3Q23A 4KHPJ 3U1MA 3TVYA 3ILOA 2R8KA 1RAEB 1EQMA 2OEKA 3ICLA 2YNHA 1TZ0A 1RWMB 2X1GA 1FRJA 5SUHA 3HKWA 4F3MA 3SDEA 2VG5A 3HZEA 4KKOB 3VAGA 3TQ1A 4ZA1A 1GNKA 2C3YA 5IM0A 1S6QA 2IA6A 1N32J 4Z2XA 1ZPVA 3RRHA 4W4MA 4NMXA 2J76E 2CJ9A 1T05B 4NYPA 2DBBA 1URNA 1PCAA 1HQ2A 4U67Q 2G2ZA 4ZVHA 3H98A 2GIFA 4J9RA 2XZTB 1WC1A 4LRCA 3VVUA 1MWYA 1U1OA 3M6WA 4NLPA 4LF9J 4ED3A 1SC1B 2IC3B 3QGHA 3R2CJ 2BUNA 3NGUA 4I0WA 2H5JB 1A6LA 1L3KA 1U8SA 3EVWA 1AT1B 3ELHA 4EBDA 3PKYA 3TUPA 4M63A 2A2DA 2BM1A 4ES2A 1GFWB 3R6LB 1YIJS 2ZE2A 3JAMY 1NK0A 1DTTB 4DR1F 1Y10A 1JKHB 3C15A 4GVBB 4P10A 3QZ7A 4Y34A 1K44A 4QYZK 2Q1LA 1UCNA 4ICLA 2HFOA 1TFWA 4PAAA 5KT6A 2H4WB 3HSDA 3TJ8A 2F8HA 5DG9A 1TKZB 3HFZB 4NCAA 2M5YA 5E2QA 1AA1B 2MJNA 3PHTA 2XULA 2J5AA 2MQLA 3H25A 4F26A 4OYBA 2KRBA 3LP1A 4ZVSB 4DR2F 1VQ4S 2W7PA 3HD1A 5B7WA 1NHKL 4ECVA 4K4TA 2PA8D 1SKSA 5I4MA 5KT4A 4FYDA 1Q79A 1VC6A 3CC2S 5A76A 1ZS6A 2IAJA 1T94A 4ECTA 3VAKA 3HVRA 2DY1A 2Y8YA 2J9DE 4FVCA 3CCES 2ZH9A 2QFIA 1RK8A 2XGPA 2JRSA 1NNDA 5CD4H 2ASJA 1JLGA 3GFYA 3TX8A 2L9WA 4DR4F 2V6AA 1AROP 1AFIA 5F8GA 1ROFA 2RMLA 2BQRA 3D66A 1SH0A 5KOXA 1C4CA 1NMEB 4CLKA 3D3CJ 3QT7A 1QSLA 5J1EA 3CC4S 2R2TA 3WBZA 2DRDA 2VONA 4UW2A 2QL9B 3FEXB 3TI0A 3PW4A 2UU9J 1S9FA 4URQU 1S1TA 3OFFA 1HMVA 2OAUA 4GC6A 1Y4ZB 2EFNA 4G1IA 3HPOA 2R7XA 3NBPA 2OPQA 4ZVRB 3NL0A 2GO8A 4F4AA 4CT9A 3ETMA 2Y8WA 5LL6d 2Y3YA 3M8QB 4PEOA 2K2PA 3DRXA 4U6PA 1P9QC 3FRZA 1HBMA 4DPOA 1H0HB 5F8IA 3AOAA 3HVWA 2FVCA 3BSNA 1HWLA 1T8EA 4ANCA 3MAQA 4KV8A 1IUJA 1BY9A 2J6SA 3I9ZA 4OI6A 3C14A 3O3LA 3EXCX 3M2RA 3OVAA 3AA8A 3T5KA 4X84A 2VUGA 3AQPA 4LFBF 4TYAA 1JLQA 1KOOA 1T95A 1E6VA 4UF4A 4PPZA 2QFJA 2C3PA 2M2BA 2OKQA 1MMLA 2HAIA 3G9CA 1MROB 4FN5A 5EWGA 1FEEA 2DHGA 2E1MC 3DLJA 3RBXA 1NB7A 4RW8B 3OQ2A 4DU7A 3D5MA 1NJYA 2HHSA 3HD2A 5GAGU 2GVZA 5CYQB 3UPFA 3UD5A 4O3SA 1XMOF 4CYUB 2VHGA 2P2CB 1KTVA 1F9FA 3MM7A 2J0XA 4AL6A 4I6YA 2HHHF 1TV6B 3GJSB 3CF5Q 3CDUA 4A47A 4WFBQ 1UVIA 3HLUA 3N79A 5A8RB 1CJUB 3I5CA 1P27B 2P5VA 3QYYA 3ZNJ1 3NGSA 3GZ7A 5LM7E 1Q8LA 1S72S 5HMYA 2V8VA 1BC6A 2ZOFA 4OMFG 1X4AA 2LXUA 3CCJS 2IA0A 2HQGA 1RLCL 3D3BJ 1OY6A 5B0CA 3VGUA 1L3VA 4ELTA 3W62A 3HVAA 1EX8A 5K5MA 4ILMA 5K14B 4C2MA 3NCRA 3UI3A 4PUOA 3AA9A 2AMCB 3QRRA 1KWMA 3Q2TC 3L9ZA 3MFIA 2NSCA 2QLFB 5F0UA 2HQFA 4RBUA 3EMTA 5B0DA 4USUA 1EAYC 3CB4A 4OJ1A 3M8RA 4QR0A 2W9BB 4IH5A 3IG1A 4NLUA 2CZVC 1YBAA 1HBUB 2I9SA 4OLOA 3DRSB 3BGLA 1KNZA 1VS3A 3MM6B 3PG9A 3MPVA 1LQ9A 2V94A 4B02A 1ZAVA 4CRJA 4M94A 3PW2A 3QNWB 1S4EA 2FZKB 2JEJA 3PFEA 4PXDA 3DXBA 4B9LA 5F8MA 3FJ2A 3UCGA 4KGMA 2V8HA 2UV8G 1AUSL 2ZBIA 4S0MA 1WJ9A 3CD0A 4YOEA 4KTQA 1JKHA 3A8JA 4LMZA 2XYGB 4DQRA 5DETA 2IM3A 2HNYB 1ZA2B 3FRYA 4GO7X 4WFZA 2XHWA 2DRAA 3ZC4A 1ZPWX 1RWWB 4U8VA 2DXDA 1NPRA 1S1WB 3R9LA 3BYRA 5GAEI 1Y3JA 3I31A 5KFXA 3AJ1A 4DL6A 3RR8A 1VR6A 2W4CA 2X1AA 4YMEA 2FHJD 1SVDA 1R43A 1OWXA 1T9UA 1T9XA 2AGQA 4JI8F 4CH7A 2FQQB 5KFIA 2OPSA 3L7OA 2FVSA 4DJBA 4DG1B 3LPEA 3M6VA 2VFRA 3D67A 2XLJA 2HBZB 2P6TA 1IJEB 4L76A 2XS7A 1HLWA 1IWAA 5A0YA 2RJZA 3IA0A 4HL9A 3WC2A 1WOPA 1QSSA 5J2PB 3K57A 4DCJB 2H5EA 2X3GA 1RA6A 2Z30B 1NSKL 5C2CA 3N9UC 2OMOA 3FZBA 4BHQA 3W1YC 5HI7A 5IS2A 3Q8RB 2RIJA 2W01A 2G4BA 3NNCA 1I1GA 2DNYA 5E41A 4LF8J 1T7PA 4NLQA 4C8OA 4GO5X 3HXMA 3M8PA 3CXCR 1L3SA 1DHMA 1SUQB 2I38A 2XMVA 4HYKA 1C1CB 2W8LA 1FJEB 5AJ3J 3QIPB 4LR8A 2RUSA 2V4JB 3FUYA 1BQNB 2DHAA 4D3GA 2ZHOA 2D3OR 3MPDA 3MM8B 3BQ2A 3A3PB 1S76D 1YZ7A 5IFMA 4ZLNA 3GP9A 3MR5A 3DC2A 3HFVA 3I32A 1PYOB 1U1LA 2YPZA 3M8YA 2OEMA 4OL8A 1TUWA 2RF2B 3G82A 2AP6A 1RXOB 4NPOA 5KFKA 3LGNA 5IC4B 1TL4A 2HGMA 3CCTA 2W9CA 3KJFB 4Q2MA 4MJKA 4MTPA 2DO0A 2QA4S 1RT2A 1N0UA 1VLOA 4NI2A 4CLZA 2V4RA 1KR4A 1CEZA 4DF8A 2KT3A 2RU3A 2OP5A 1FJCA 3J7AN 3SV4A 1JK9B 4DMZA 3CO0P 3BGOP 1AYEA 3THVA 2VG6A 3ENQA 4XK8C 2D74B 3OSNA 4JI2F 3TW0A 4X4OA 2YWWA 2ZNYA 3GJTB 1EKRA 1D1UA 3SV3A 5LSRA 1A9NB 4OX6A 1OIAA 3JQJA 2DR9A 3MD1A 1RKJA 4QIEA 3M1VA 4OZ2A 4FF1A 5FJ4A 2DEJA 2AQ4A 4P52A 4X64J 1B7FA 3EE3A 3DGPA 5KFTA 1R8BA 2CJXB 2MKIA 2VBZA 4DV7F 3KDNA 2K1RB 3EVMA 5E33A 1B3TA 4R5PB 2EC0A 1ZA1B 2Y1JA 3MUMP 2EFGA 1REVB 3CCSS 1JWWA 2ZH7A 3LWLA 4OZNA 4Z7YA 1JIHA 3S01A 4KE5A 3OBIA 2DHHA 3BZQA 3FBFA 3ZTPA 2DXEA 1WC3A 4I2PB 3R5JB 1FRHA 5EN1A 3CCVS 3C8YA 4YDDB 2WTFA 1FNMA 1R8CA 2X51A 2DVIA 1SPBP 1X4BA 1XK8A 1TKTB 1DQAA 3DDKA 4USMA 5E3QA 1CJVB 1SQGA 4CO0A 2HVZA 5GMKa 1LXNA 3HVTA 1HBNB 4E0DA 3DYAA 1IVZA 1TMJA 4FKXA 5G0RA 2YNIB 5AE1A 2YH1A 3R2DJ 2EKNA 2UXBF 2Y0SD 4QBUA 3PR5B 3IGNA 4DV2J 3JAMU 1HBUA 4LF2A 2VU5A 4WIIA 4Q0BB 1VK3A 3RGIA 5DM7Q 4P2SA 3CDEA 2FLNA 2CJQA 4DPUA 1HI1A 4CI0B 4TXSA 4JI6F 4G1PA 1CC7A 2NSBA 1YJVA 2HNZA 2DHSA 1Q78A 1VMBA 3MMCA 3TYTA 4G1QA 3W2WA 4I68A 3KHRA 2A1BA 4KFBB 4EFAC 3LP0A 2VASA 4Z7CA 4EWTA 1WDDA 5DQIA 5KG6A 3I6PA 3CULA 1Y00A 3RRGA 4ID5A 1VQKS 2WB4A 2ZJRQ 1LW0B 2LFVA 4OYZA 1H2VZ 3NEKA 3P5TL 3H40A 4DV0J 1RT5A 4P2XA 4YHHJ 3MOZA 5HATA 2DGQA 2W2NP 1B0VA 2CPFA 2WSEC 3DN9A 2Z2YB 1JXVA 1PJ6A 4CO1A 3CPWR 2WB1D 2EBEA 3JSRA 3PYGA 2IYGA 1Y3KA 3IP0A 1FVQA 4P71A 5CH7B 5L38A 2B8PA 2LDIA 2QA1A 1RWOB 3MF5A 2GAHC 3GYGA 4DR6F 4C3MA 2DITA 5D3GA 2QLBB 3ZFVA 4B9VA 1Y11A 4LRDA 1VJQA 1N52B 3ZNUA 5J2PA 1XQIA 2OTLS 1NKEA 1RHMB 5DO2A 2QA2A 2W7AA 3U1NA 4DL5A 3BF4A 2GS8A 4FZVA 3G6ES 4Q7AA 1U2FA 1QAXA 1J5OA 1GXTA 2HQIA 4H4OB 1SC4B 5BR8F 1BWVA 3H7HB 1KVKA 4B3RJ 5KT2A 2HRYA 4NOHA 2OIHA 4G3IA 4ECWA 3TEHB 2FZCB 2UXCJ 1T03A 2ROPA 5LJ5Y 5A8WB 4OYXA 4C7QA 4ZCKA 1FDDA 1N5VA 1HR0J 2CDRB 4NZ0A 4AXIA 3BDEA 4TY8A 2MGZA 3HT0A 1UTAA 3D1OA 2AW0A 3MMJA 4E8UA 3CMQA 1RQ0A 4DBQA 2N4CA 4I4BA 1QE1B 1VQ6S 2GHWA 2EVZA 4ZP6A 1JLCB 5EWEA 4BWMA 2E7VA 2G2YA 5E0OA 2B4VA 3PKMA 2LQBA 2KFZA 4I2QB 1TMMA 2C3UA 1PILA 2PGCA 4ED0A 4C6AA 1NH7A 3KFWX 5L8RC 5GMDA 2JHEA 3VR1A 3KJVA 4DHVA 3GV5B 3DRRA 1HL6A 1O6XA 1RISA 4LF4F 3KHLA 4I67A 1DLOB 3CO9A 3SI8A 1RAFB 2V9WA 3MHYA 4Q43A 5ETKA 1X31C 2IYIA 5HJXA 1TP7A 2KN4A 3C6UB 1SCJB 1CJKA 5E7OB 2LECA 3W9IA 2E9TA 2VF3A 3FGVA 4ZCLA 3VAMA 3QZ8A 4F36A 3M9OB 4IFVB 1SH3A 2CQCA 1YGYA 4QQBA 3J81j 3QWUA 1NK4A 3FFIA 5RUBA 3MD3A 4O44B 4E98A 2FJWA 3F0NA 2V67A 2B51A 1RABB 5HO4A 4F8RA 5HMZA 1R27B 4GVLA 4WJBA 4KT0C 1RTJB 1ZTTA 1F3FA 3UR3C 4USVA 3O8WA 4K0KF 4OHYA 3GIJA 4UOGA 2HLUA 1FHTA 2OO4A 5KG5A 2LLZA 3K17A 3VAIA 1T9VA 4CH0S 2CPXA 1VLYA 3V5RA 2E7XA 2WVFA 4OYWA 1IR0A 2IJFA 2XC9A 3MMBB 2UZAA 1KLMB 1UA0A 4UY8T 4DR1J 4YB7A 3R3TA 2BQUA 3DLEA 4ECRA 2G13A 1UJ6A 3BPSP 3HSZA 3PRVA 3OHBA 4P74A 1NBEB 3GWCA 3THPA 2ALYB 2BYCA 1U1MA 1SKWA 1REVA 2KM8C 3DMJA 2ACYA 1LFPA 2FB0A 2H1YA 1BQXA 4M1KA 2DXFA 2CPYA 3HHLA 4BBYA 4A46A 4W90B 3OFGA 3MXHP 3CJQA 4HKQA 2Z8QA 1U2CA 5ETQA 3ISNC 1N34F 4M8LA 3KUHA 1RLDA 1FA0A 5L1IA 1RT3A 5JVGQ 3OD2A 3CJ0A 4WE1A 2NXUA 2BJ1A 4K2JA 4C3LA 2ROGA 2PC6A 3DRPA 2NXJA 4DR2J 3HO1A 1JJHA 4N41A 1J27A 3MUTP 2EPIA 3ZTOA 1FWPA 1Q8BA 3N4WA 4X65F 5FLXY 3MDFA 4GKJF 4KJIA 1TVRB 1RSCA 4ERDA 2FJXA 3TAMB 1OQ6A 4TKTA 2AYBA 3AD9C 4GC7A 3MEEA 1D3WA 3FQKA 2I1RA 4OI1A 2MZ1A 4FBTA 4ZVFA 5D4NA 4DX5A 5M2UA 2M8DB 1Z4UA 4DXLA 2OPRB 3DU5A 3GFHA 4MFBB 4WK3A 3PRBA 2B5JA 3QT5A 2B7CB 4PQUA 4UOFA 3ZZ0A 2CQPA 4K8RA 3E2EA 5HLFA 2FC9A 3LF0A 1ZYQA 3CIMA 4N56A 2DNOA 1IKYA 4LRBA 2LA6A 4NX9A 1XERA 3BBFA 1CLFA 2GGPA 2YNFA 1XN9A 1K47A 2QE5A 1M90T 2RDIA 1IBCB 3JSMA 3RW6A 4OJGA 3L3CA 4A8OA 3IS9B 4WKYA 1JJ4A 2QO3A 5KG2A 2QMUB 3IRXB 1VQ8S 3PX0A 1VQPS 1JLEB 3C16B 1IQTA 2I5JB 2ZC3A 5HP1A 2R7UA 4LQ3A 3VGTA 4PYDA 3T1HF 3M9NB 3GILA 3T5LA 3IC1A 4NLDA 2BEFA 4WF9Q 4TYBA 1S1XB 1AZSA 1TQLA 2HVEA 3LO3A 4RNFA 1N8RT 3NMRA 1Q5VA 1XC9A 1H3DA 1UPPA 2HURA 2HFNA 4DEZA 4LFBJ 1R0BG 2GVDB 1X9MA 4H4OA 4O3QA 2CG8A 4ZPTR 2R8IA 1C0UA 5D0EA 3CSKA 4RW9B 1I51B 5A8KB 5KFYA 4LF7F 2CNLB 4UZCA 4EBEA 3V81B 2DPJA 4ED8A 5IT9U 2OPPB 3W7BA 2XMKA 1ZH5A 1S7HA 3T3FA 4K7QA 5KFLA 3UN3A 3MEGB 2HHHJ 4BC9A 3D6HB 3HM9A 2ZD1B 1WTBA 1FT8A 2M0GB 2B3TB 1B64A 2ZITA 2DNNA 5DZ6A 3EGZA 1DAXA 4F25A 1TELA 1M5OC 3OXGA 3ZO7A 4OQJA 2QZ8A 4Y2CA 3JTPA 3ZTSA 4ANEA 2RE1A 1DQ8A 1YJUA 2X1BA 4M5MA 2PT0A 3LAMA 4FNHA 2W2MP 1ZAXA 5ETRA 3CCRS 3V2UC 3K89A 2PO4A 4J9VA 1HHTP 3OR2A 1IBLF 1NJXA 2MZTA 2JLGA 1VRUB 3PYDA 3POTA 2E44A 5EHHA 1E6YA 3PX4A 3FDSA 1KVIA 3IBFB 1VISA 7FD1A 4OYMA 2V4QA 4DPWA 1RA7A 2D3UA 1FNXH 4L75A 4M5DA 1U26A 4JI5F 4DLGA 1C1BA 1SQEA 5ETTA 3GMGA 4IFVA 2XY6A 3P45B 1P1TA 3OTOJ 5J2MB 4HH0A 4WKRA 3AODA 4NWBA 2UXDF 3PIPQ 4B3TJ 3T1YF 4RL1A 3LUYA 1V3ZA 2G1DA 3GIMA 2G0IA 1JXLA 3DLGB 2X3DA 2G0JA 4FF3A 4ECXA 4QU6A 1WI6A 3I0SB 3AJ2A 1W26A 5DDQC 3KLFB 3DDIA 4ZCIA 2X1FA 3AD7C 4WXOA 4DZ6A 5EX3A 3ZZOA 4NXMJ 2ZH5A 4QR1A 2EI5A 4ZVGA 4OZ3A 2E1PA 3IFEA 2VC1A 1KLMA 8ATCB 1H98A 4C98A 1PSDA 2U1AA 1R6YA 4F2SA 4EUVA 3QJLA 1SH2A 3J7YU 4NA2A 3ILIA 2F8MA 3SFUA 5E3AA 1G1XA 3DOLB 2LCWA 3JQMA 4L74A 3DOMB 4DSFA 3IRWP 2OGUA 5HROB 2CNKB 1LWEB 1RT4B 3OTCA 1UJ4A 1IM4A 5I3UA 1WI8A 4I56A 1LWXA 4LSZB 1APSA 5KOWA 2CPZA 4F0HA 3D9BA 2E5LJ 1IBKJ 1WKJA 3OL7A 4ER8A 2L9DA 3NCQA 4JI8J 2JL9A 1F6TA 1TL7A 4BS2A 2Y1RI 4EGLA 2RS2A 3MMAA 4DS4A 4JYAF 3JTOA 4H4MA 1ITPA 4U7UK 5DM6Q 2V8PA 3GV8B 4HTIA 3MAAA 2N3LA 1A7GE 3KLEA 2ZZNA 1MWQA 1U48A 4ZKAA 1N33F 2RB7A 4M5GA 2C2RA 2BVZA 2OUGA 4AL5A 3CTRA 1TUGB 4RU2A 1LEOA 1VRTA 4LR7A 3BPDA 2VZ9A 5C7PA 2W2QP 3FCWA 2XSJA 4PZVA 2H4YB 1JQGA 3GU0A 2XZWA 3GTYX 4NZ6A 2APOA 4PG7A 5KAKA 3VWSA 4IFYA 4NYOA 2J0WA 2IVYA 4WTYA 5HL7Q 2FGOA 1X9SA 3MEDB 2AU0A 2GNKA 3CUNA 4YDXA 2EG1A 2WOMA 1U24A 3ZZTA 1RAJA 2NLWA 2YKPA 3U1LA 4FYYB 2MMYA 4ZMMA 2DISA 1NHUA 3M6UA 4KO0A 2ZNZA 1VC5A 3SXLA 2LVWA 3JYTA 1S79A 4CLUA 3R5AA 1X60A 5DS7A 3QJJA 2R7SA 3I82A 1WF0A 5GAHI 1GEHA 4PYAA 3CW2C 2MTLA 1W7WA 2I5JA 4RW6A 2B6AB 1V5VA 1AFJA 3GYNA 1HNWJ 1VQNS 2FJBB 5H9EJ 3R5DA 5HVFA 3ULHA 2PA3A 5C42B 3EWGA 2LQ8A 2LEAA 1R0AB 3CNQP 1FDBA 1NSPA 5CXTA 2DGSA 4A8SA 4WZMA 2XMTA 3K5NA 1TR0A 1UVNA 2EFPA 5B08A 5DG7A 5AXLA 4U7CA 4J90A 1RAAB 2M4MA 2YKNA 4DSIA 4TNOA 2ZOMA 3CCMS 3AB4B 2H54B 4MYUA 1X5SA 1WKLA 1HW8A 1ZAWA 4GKKF 4RLEA 3DLBA 1MG7A 2DR8A 3KLGA 2VG7A 3QFWA 3CCUS 3GQCA 3QLHB 3GCXP 3D6FB 2A6MA 5BYQA 4IDKB 4RW7B 4ECSA 2HZAA 5D15A 4WIQA 2NPIA 4JI2J 3IWXA 1W25A 4DR3J 4ZHRB 4P2MA 5I3PA 1B0TA 2OPPA 3V4IB 3CC7S 3B4DA 3KK2A 2IFXA 3C66A 1TL1B 4J9NA 1EETB 1V5IB 1FRMA 4ETXA 2YXLA 5KT7A 3UCZP 4IH7A 5HN0A 3RYLA 1RJJA 2UUTA 4A8QA 4Y28C 4MK7A 2JVOA 2BA9A 3D2WA 2UUAF 2MHNA 2ADBA 1VHFA 3P8BB 4OZLA 4CLYA 4DV7J 4EI2A 1LWCA 4AT1B 4C8LA 1Y5LB 1WG1A 2QC3A 1HQEB 3NGRA 3TEGA 3F56A 1SJFA 3HHLC 3UVJB 4O3NA 4DV6F 3I0RB 1SKRA 4RUHA 3US5A 2J7UA 4DL4A 2XMWA 3HZGA 3W5XA 5IWAJ 4N5SA 1XMBA 3KK3A 3T5HA 2XGQA 5KFMA 1Q5YA 2E9ZA 4LFAF 1IKWB 2SXLA 4YY3J 2CZ9A 2EWHA 1KVJA 2BW2A 1HIYA 3KMQA 5FDLA 4J9PA 2UP1A 5KFFA 3L7UA 3T5JA 2DT9A 2G9OA 4USTA 1QSYA 4R8UB 2KG0A 1RTIB 4CO5A 4IO1A 2IRXA 1G7CB 4OFZA 4FF4A 2R8JA 3U27A 1FXLA 4CDIA 1FTRA 1S0VA 1KDNA 4DF4A 2MYFA 3OLBA 2UXBJ 2ZBCA 3TJAA 2F4VJ 4I6WA 4PWDA 3QAEA 2MKCA 4JI6J 2E5GA 1S6PB 3PXGa 2YNGB 5EUHA 3W2VA 2A18A 1YJ7A 2DJWA 3E51A 4ZVEA 3PCOB 4ZP9A 3CJKA 2VOOA 1OPZA 1RHJB 3PY8A 1Q82T 4PCQA 3C3LA 2V2ZA 1RI7A 3D54A 1H38A 1PAEX 2UUWA 4XO0A 1CULA 2KZZA 3DOMA 3H5XA 1UW4A 5HROA 2VG5B 1QVFR 2VKZG 1K73T 4KB7A 4NLRA 2MQNA 3MI7X 5IM0B 1S6QB 3FSIA 5ETMA 4URSA 1BE4A 3M32A 5FLXU 1VQ7S 3Q8VA 1I94F 4F0MA 2VC0A 4KPCA 3UO0A 4MIWA 4F2RA 2YKMA 3UN2A 4DDFA 2LEPA 1X4GA 1HKAA 1WWHA 2FVRA 1UAWA 1XMQF 1Y5NB 3Q2SC 4X4VA 1S57A 5B0EA 1RWVB 3G87A 1QY7A 4WFNQ 1P1LA 2HMIB 3UCUP 4DR6J 2OLWA 2B8QA 3H5YA 1FO1A 3H5UA 1KHVA 3BSOA 1GMWA 4Q8FA 3T19A 4U96A 4K5RA 1UEKA 4B3SF 4J9SA 3C15B 4ZCMA 3C19A 5LMNJ 3PACA 5BR8J 4ICLB 2YH0A 3VVTA 2WVCA 5L9XA 4IQMA 3D0HE 2YTCA 3JSBA 4CNZA 2R7RA 4MIBA 2RKIA 2FJEB 2BANB 2R9LA 2LMIA 1R0CB 4ELUA 3LGMA 2E7WA 1FKOA 2P9GA 3AFGA 1KLNA 4J9OA 3ZZYA 3FBBA 3G6XA 4FF2A 4O23A 3HF5A 2E1AA 1FF2A 3I9V9 4KGXB 2PI5A 3LP1B 2DB1A 1P8GA 2IJNA 1S99A 4NEZA 4J7CA 1FDNA 4F04B 3AHPA 2XMMA 3TO8A 2KRRA 1H2TZ 1VJWA 3NGDA 3EGVA 3BO4A 3BQ1A 2PD1A 3W8PA 2B43A 3K8VA 2GIQA 4ECZA 2IY5B 2IAJB 2WSCC 2ROEA 3UDEA 5KFNA 4C0HA 4KRWA 4ZOSA 2MLZA 2WONA 1C4AA 4LF4J 4HDHA 3V4MA 4IKAA 4C8ZA 3KG0A 1S1VB 4EZ9A 1JLGB 4FXVA 3KTQA 4K4XA 4DUZF 1KS2A 3I56S 3FC9A 2E5HA 2L3MA 3D4JA 1WORA 2K7KA 1FXDA 4ETZA 4YR0A 5A2QY 5J1EB 3RAXA 1NKCA 2IM2A 1G6BA 1YQHA 3UNGC 3UW1A 3MCNA 4DLEA 4ED7A 2KO1A 4RW7A 2HRUA 2VQFJ 2GHPA 5E3CA 1DJ0A 2CQBA 1RTDA 2KU7A 1HWJA 3DKDA 2GIRA 1S1TB 1YRTA 4CLFA 1HMVB 2U2FA 2J9DA 2IHR1 3A13A 4N8NA 1YBTA 3TA0A 1RU1A 3GFZA 2GX8A 3CCWA 3NBPB 1YLXA 2OPQB 1S9GA 4DSJA 4UZBA 4G65A 5L1JA 3I87A 3LANA 1UWBA 2WW8A 1KQFB 3MPYA 2FHMA 2B9YA 1HBMB 2HS3A 2UVUA 1VQ9S 2NUHA 4WBFA 3BO2A 4C0OC 3WHIA 3B4MA 4KV8B 4LUBA 1G3OA 2JSXA 3W65A 3MEKA 5KFOA 3C14B 4TLQA 3M2RB 1QD1A 1D8ZA 2BJDA 1JNZB 2ZBRA 1NJIT 2LDYA 2ZBPA 1JLQB 3NNAA 1NDCA 1E6VB 3BQ0A 3HSJA 2VA3A 1MW7A 1Y9OA 5L9NA 4GRSA 2AT1B 2VD3A 4KBIA 3AOBA 5ETOA 1YWXA 4ECYA 1N34J 2XMUA 1UEUA 3NAHA 3U02A 2FY1A 5EWFA 2CIMA 5KTQA 5J2NA 1W2IA 2ZUGA 4ZVQB 4IUFA 4IH6A 2GVZB 3FQLA 4USHA 5H9FK 3CD7A 5DLFA 2MKJA 2VFVA 2ZZTA 2RS8A 3MM7B 4X65J 3CDBA 1OYDA 1D09B 4GKJJ 2HK3A 2DH7A 4QIVA 4K4WA 2J9CA 1VBZA 1ULRA 3M8WA 3OUYA 4R25A 2LQ5A 1IR1A 2V2QA 2D9OA 2G0CA 4QCLA 3R1HA 4DWIA 1X4DA 2JNJA 1LOUA 4KR0B 1SI9A 3W63A 2Z2MA 1LWFA 3JTNA 4UUWA 1YK9A 3T41A 3KYLA 1SKUB 1FNOA 2RNEA 2LXFA 3OL6A 2B4PA 4ECUA 2MPUA 2BMBA 1LK7A 5IT0A 1O0PA 2RQMA 2MY7A 2MZRA 1URRA 4QPXA 3D6TB 1GXLA 2J7KA 1HNZJ 2J6UA 5KFUA 4AE5A 2QMWA 4AQYF 5K20B 1F5BA 1Q0NA 1WC0A 1TL3A 3VZHA 1WEZA 4J9UE 3OJSA 2F7VA 3SZ2A 2CPDA 2ASLA 2WSFC 4DSLA 3MM9A 4RJVA 2MEWA 4PUOB 2HNDB 3HJVA 2R4FA 3I55S 4L3KA 1LW2A 5KG0A 3MOJB 2L41A 5AXKA 1RBAA 3OL8A 2MQMA 2E29A 1YZ6A 4M5HA 4RNHA 4L6V3 3BN7A 3QSIA 1FX4A 1KFSA 5GADU 4PXBA 2GO9A 2VPYB 2AJ0A 4Q2LA 3D1QA 2CPHA 2P8IA 4HACA 1HHSA 1RAIB 1RYSA 5KFQA 3IG1B 2F3JA 4TQRA 2XCAA 1WDTA 3UD3P 3M7VA 1N5YA 1TK8A 2HMIA 3S8SA 4OHZA 3CDAA 1A0OB 2AD9A 3PJ9A 3KHHA 4A8MP 4X4RA 4ZJQA 1F2HA 3MPWA 2ADCA 3LW5C 2D41A 1R3NA 2UU9F 3UE2A 2YX4A 5F41A 3DOKA 3DI6A 3DLKA 3SSRA 5KT3A 3SCJE 2WRMA 2QYCA 2Y1LB 2ZJQQ 3PTWA 3VCDA 5J2QA 1KQGB 3N6MA 2BANA 1YG0A 2IRUA 2ZFHA 1HBOA 4JI7J 4LF7J 5HQMA 4RW4B 2GZOA 3N5BA 1PO6A 3ITHA 2D9PA 5MAOA 1X4FA 4KYZA 2I8EA 2FHKA 1SC6A 2QX0A 4LRFA 4WP3A 2OPSB 3OTBA 4DUTA 2YWEA 2F5GA 1RWXB 2MKYA 2Q6CA 5KFDA 1WHYA 1KQKA 1MLAA 2IJRA 1TTHB 3B82A 5JVHQ 4F3OA 4KY3A 1KEKA 2GJ2A 2WW4A 4RBTA 1XJWB 2R7VA 4IG0A 5A0YB 2JLFA 4A8WA 1S77D 5HQLA 1VDHA 4AFFA 1UZDA 1FE4A 4IRDA 2GV1A 1NPKA 4F4XA 3DDNA 3BKTA 2IRYA 2H9ZA 1GX5A 3AOCA 3LAKA 3MECA 5H9EK 4OYPA 2V68A 2FGCA 1S1VA 1S4FA 1N0VC 3UWTA 4Y0FA 3TAQA 3PVXA 1CJTA 2MKKA 2YWGA 2KXNB 3WX8A 3GV7B 3RB0A 3A3OB 2ZOGA 2JOQA 3M8PB 4NE9C 3R5CA 2AJ2A 5D78A 4OYIA 1WF2A 4WU3A 1PG5B 4LF5F 5CZVA 4NLTA 2V2KA 3W9HA 4Y65A 4C11A 3TQEA 1QAJA 2W9AA 5GVQA 2UXDJ 2OFHX 2O67A 3A1YG 3T1YJ 4BCAA 1FXRA 3CEDA 1OS5A 4FNIA 3L09A 2B4UA 4WXWA 5ETVA 4PXEA 3EVOA 3CJ2A 4I69A 8RUCA 2B4OA 2XS2A 3G82B 2XNQA 2BJ9A 3FSYA 4RNNA 2P6SA 2O01C 3PZPA 1DRZA 1LK5A 2W9CB 3GSIA 1RT2B 4NI2B 3V6HA 3SEOA 4B3MJ 1KSPA 3A3NB 3I5BA 1MMNA 3KXDA 2VG6B 2OD6A 2XB2D 1HQUB 1H7XA 4DV4F 5F8JA 1EQ0A 5HJYA 1L3UA 1S0OA 4DQIA 3N6LA 4NLXA 1RCXB 4JYAJ 4YB6A 3Q8SB 1IQZA 3H8YA 2WZ1A 1U1NA 4JI1F 1KN6A 2ASYA 2RT3A 3M1VB 2WVEA 2KVQE 2HIYA 2A3JA 4K4VA 3DGPB 4GMKA 5G4DA 4JI0J 4QWDA 1EZZB 2P9CA 5HAOA 1Q4RA 3Q86A 1OJ4A 1FDAA 5B09A 4JV5J 1RTHA 5GMEA 2PDAA 3IMQJ 3IAS9 4PG5A 1HNXJ 4DZDA 4X2BA 5KG4A 3BV8A 2NZCA 1UETA 3MCMA 3R8YA 2BE9B 1REGX 1FWLA 4ITSA 4LR9A 1OMSA 3WIUA 3BGRA 4YUDA 3W3SA 4OI0A 1U7LA 3H5SA 1JXEA 3BM7A 2PMWA 4NCGA 4IG3A 1HWKA 2HNDA 3UR0A 1NSAA 3TUZC 4UY85 3HI9A 4QWCA 3HVTB 2R7OA 5ETLA 3EPIA 2R7TA 3JB9k 3DYAB 2LA4A 2LEBA 2E66A 2D7SA 3NOCA 5G0RB 2YKQA 5L46A 2KI2A 5GAGI 2DTJA 3GIRA 4KGKA 1K1SA 4MMOA 3G8SA 5B0AA 2UVRA 4F02A 4NXNF 2QTWA 2HVIA 5CCLA 1UW9A 2HS4A 3PJWA 2IBKA 1JJ2R 2RSQA 2Y9HA 2HNZB 3T6JA 3MMCB 4G1QB 3B78A 3W2WB 4NA3A 4CM2A 1SL2A 2IIHA 3NS6A 1AW0A 2C2MB 5MLCV 2XWYA 2Z57B 2V63A 5K8OA 2YQ3A 4UQTA 3CJSA 2OHDA 3LP0B 4FKYA 1IBMF 3M8SA 1M1GA 1TU0B 2DNGA 2ILYA 3TWZA 3OTEA 2KT2A 2EFOA 3G6VA 2NXCA 3OTDA 4ID5B 4GKKJ 4LF6J 1N88A 1PIEA 3AAWB 1H72C 1DY3A 3E3XA 1W2BR 4RUBA 2QEXS 1RT5B 2KVIA 4RW4A 4Y2MA 1Y7PA 5LMUF 4ZDNA 1UKUA 1CQNA 2QMXA 2OFGX 1MSWD 1VQMS 2AIRB 1NDLA 5HQ8A 4MAKA 2LYVA 1R8AA 3MZIA 3PFOA 2DNRA 1U2RA 2IM1A 1U0HA 1DARA 4O0NA 4FP9A 4WYWA 3R5GA 4M5KA 5D3GB 4WCEQ 1KC8T 4U9RA 1UVLA 2F65A 5F8HA 1SV5A 4HHUA 2AZ1A 2DH9A 2V8DA 4ZITA 2OSQA 1X7VA 2CG4A 4DV6J 3TX0A 4XTTA 3OFEA 2ZM6F 3PO4A 5JUMA 1J5OB 3Q22A 1DURA 1BD6A 2XNRA 3K2YA 4AUKA 1EIYB 2M52A 2CWXA 4LFAJ 5C5JA 3QRPA 1TK0A 1VQYA 3BB5A 4NLWA 4BLGA 1DTQB 1T03B 2O1PA 3Q89A 1O51A 1VGYA 2AZ3A 4DCPB 4A8YA 4KHMA 4C4WA 1O5JA 4ZIVA 3TP2A 2YX1A 4K2XA 3D68A 2JH3A 4B08A 4IQXA 4UUXA 4M5IA 1Q1KA 1YDLA 4TY8B 2MGZB 1U6BA 1DZ5A 3W66A 3ZZPA 4QJVA 5J1NA 2JDJA 1JLFA 2YKAA 4AXJA 3C6TA 1RHQB 3S6EA 2BE7D 3HDSA 2QGFB 2FPHX 1WNEA 3EDRB 2GMJA 1Q86T 4CTAB 3MWBA 2CQ4A 4JB8B 4J91A 1UVJA 3BBBA 2BR0A 4JI4J 3WIVA 4MK8A 5CYMA 2NCKL 3KJVB 2M9KA 3DRRB 3BGFA 2XS5A 3JXOA 3OSPA 3D28A 2XBPA 3H42A 1EKSA 5DG8A 4IO9Q 3QT8A 5KFBA 3NKYA 2QN6B 2RQKA 4KPYA 1Q7LB 4DL0C 1XR6A 3WC0A 2E5IA 1HNVA 1TKXA 4C48A 1CJKB 2GMHA 4V19X 5T7LA 2CADA 2RH3A 1OO0B 5KFRA 1HQUA 3LPYA 3WDOA 1K1QA 2WAQD 1OYEA 3LOUA 2C42A 1BUXA 1QVGR 4QWAA 1I94J 3FFIB 4XAKA 4KH1B 4UOCA 2MQPA 1RT7A 1FEHA 4JOUA 2ZBQA 4Z37A 2JEIA 4ZN3A 1PJ7A 4XIUA 2V34A 2RHSB 1S1UA 3HFKA 2IMOA 5EDWA 5KFPA 5DDPC 4USKA 2MSTA 2K06A 1ZZNA 2RILA 2MQQA 1D9FA 2CQ1A 3G6YA 1D8YA 3C46A 2RRBA 1RU2A 3N0VA 5DQHA 4DV0F 4IOAQ 3EGWB 3Q8UA 4YHHF 4PWWA 4MYTA 1OY9A 2AX1A 3HHLD 3PW7A 3FCHA 2Z4PA 3DLEB 2BX6A 2YX7A 4ZVTB 4WPAA 3P49B 4QW8A 1QTMA 2Q6BA 2VIHA 1F60B 4F4KA 1NUEA 2XO7A 2UVWA 3KLHA 2DK2A 2ALZA 4HVZA 2V50A 2AYGA 3DMJB 2L48A 1P6TA 3BGUA 1J5EJ 1X0PA 3HHLB 4G6VB 4ZPVR 2HFSA 2C28A 3M8ZA 4L72B 2AJFE 3OR1A 4RPFA 1NZ8A 1RT3B 2CXEA 1UFWA 4WE1B 1RP5A 4TU7A 1FRLA 1KONA 2V5HG 1ZBTA 2HLTA 3DRPB 2VJVA 3Q8YA 2J7WA 3QO9A 1NDPA 1GX6A 4KGVB 1KOHA 2ZH6A 4EU0A 5LSOA 4A4JA 4WP9A 2DGOA 4RNMA 3TZYA 1N6QA 3BH6B 3KLIA 1QTNB 3MEEB 2UXCF 1UA1A 2WVDA 1RHRB 1YJTA 1KTQA 3HX9A 1RTZA 4O4GA 5CD4A 2CZ4A 2GQCA 1ZTWA 1HR0F 2YWHA 3HP6A 1FRKA 4DUZJ 1U1KA 2B5JB 3HHNB 3K8WA 5IV4A 1F3VA 4PQUB 3V6DA 2W25A 5HLFB 5ETNA 1FE0A 4PQAA 1VIXA 4KIAA 3SQGA 1IKYB 1Z2LA 1BMQB 2DR6A 2CWKA 4DCOB 1C0TA 2KKHA 1M5VC 2GGPB 2YNFB 4JP8A 3IWNC 2VQEJ 3QJPA 1RT6B 4DFJA 4TQSA 2QSWA 4X66F 1RB0A 2LQJA 2N4DA 1N36F 1FK9A 3JSMB 5CA5A 4L3NA 3KOAA 2UUBJ 2OSRA 4PXCA 2XI2A 1R6VA 1HD1A 4UQGA 3G8TA 1NEEA 1YRUA 5HP1B 4HR2A 4HT5A 5K8NA 4J9LA 1QAIA 2HHTA 3QATA 3M30A 2F8EX 4USIA 2FD2A 2HQ3A 3IWLA 1T9TA 4QPTA 4CNYA 2JFDA 4NYZA 4FS2A 1AZSB 1ACMB 1RHKB 4E2FB 1KRPA 3K5MA 4U7UD 3SSQA 2Y1IA 2BZ2A 1FCAA 1ZM4A 4OZJA 3AXMA 3EDQB 1NM2A 4JUZA 1XTZA 4EMDA 2MLXA 4OIXA 2XYPB 2I2YA 5LT5A 2HBYB 3D0GE 3VALA 3RJMB 5ETSA 2JEGA 4KAIA 1RT1A 2QSFA 1FKAF 1C0UB 2OELA 2DKOB 2J9EA 1FERA 2EBGA 2HWIA 2NXEA 2JZ5A 4YS2A 2HBQB 4OX9F 2AJ4A 1DTQA 2R42A 4EEYA 4CCHA 3K5PA 2PMHA 2ZKTA 2BE2B 2RHQB 3CCZA 1KP6A 1B4SA 5E3PA 1BQMA 3KG4A 3I4PA 1NHVA 3RAQA 2XY5A 2FJAB 1M5SA 4QIGA 4ZIWA 3MR6A 2I6WA 2HQDA 1Z1ZA 5C24A 3G71S 3QBCA 4IRCA 5ETPA 4B9NA 4DPXA 2E1RA 4FPIA 4K4UA 2IM0A 2VBXA 3P96A 4DFMA 2D1CA 3TR5A 4CTAA 2QLJB 1IKXA 3TAPA 1YRXA 4WTOB 2KHCA 4ILRA 5CAAA 1SXLA 4F4WA 1HNIB 4NLGA 3ZZRA 1PC4A 3OR2B 4OV6A 5B0GA 4DV3F 3POTB 2BDPA 3EGNA 5CQGA 1CPZA 4DX6A 1E6YB 4ELVA 5HBMA 1VHIA 2MB0B 5D6GA 4AQYJ 1S9EA 4NASA 1ZOTA 3LGHA 1VRQC 2BRKA 3ILLA 3LP2B 4M5DB 2AKWB 1JLAA 3CWJA 5DDOC 1WUUA 1C1BB 2V9KA 1XR5A 4B9SA 1X5OA 4O3RA 2C2KB 2NUUG 3VV2B 4BDPA 2CUYA 4O4RA 3SMZA 3QPIA 2KZMA 4RO0A 4FVMA 1EHWA 1XNRF 2OTJS 3AJDA 2IDEA 4V19J 1PJ5A 3U7JA 4HT7A 5T41A 2AEJA 3GSDA 4XPEA 2E1CA 1C2PA 3P5BP 3OV7A 5LSLA 1FVSA 4QWBA 1YI2S 3QSYB 1UFLA 6FDRA 2XCPA 4Y2IA 1MU2A 2R2UA 1GK8A 3X1LB 2R8HA 1U0SA 2HPUA 1IR2A 4LSLA 3N5FA 3OW2R 3CDWA 2MHEA 3W64A 3SCLE 3D7SB 2MKHA 1OSCA 3A8EA 3M2VA 2COLA 1NLKL 1VOMA 3W5ZA 1FTCA 2BACA 1IKVA 1UVKA 4P6QA 4EYHB 3M2UA 3GLJA 4H4KC 3CMAS 3PV8A 2HHUA 5LXYA 1FI4A 5B0BA 4PRFA 4Y2KA 5I3UB 2OI2A 2VOPA 3QGGA 4W98A 5JMNA 4X62F 3CJ5A 3MM5A 4F0KA 3EZ5A 3FNNA 1I6JA 4FXWA 1HA1A 1TL7B 3DM2B 1F5CA 3BO3A 4ZPDA 3SBMA 3MMAB 4H4MB 2YY3A 3CJ3A 3CVKA 4DFPA 1RWPB 3MAAB 2CQ3A 4P73A 2XTJP
chains in the Genus database with same CATH topology
1NHKL 3Q89A 4KPCA 3BBFA 3EM1A 1LEOA 3FBBA 2B8PA 2AZ3A 1MN7A 4DI6A 1HHQA 1B99A 3NGUA 1KDNA 1NPKA 1S59A 3BBCA 3EVMA 5C7PA 3FCWA 2DXDA 3FCVA 3GPAA 5CAAA 1NCLA 3B6BA 3R9LA 3EICA 4UOHA 1BUXA 3EVWA 3ELHA 3BH7B 1NDLA 1NSPA 1F3FA 3B54A 1WKKA 2CWKA 4F4AA 2DY9A 1S57A 3ETMA 1ZS6A 2ZUAA 4UOGA 1XQIA 3ZTOA 3DKDA 1NLKL 3EMTA 4O0NA 4C6AA 3FBFA 3NGRA 3ZTPA 2DXEA 3MPDA 3WX8A 1VYAA 2B8QA 4CP5A 5IOLA 2HVDA 2DYAA 1LWXA 3Q86A 3VGSA 4EK2A 3VGTA 1WKLA 3Q8YA 1K44A 5CABA 1NDPA 1U8WA 1UCNA 3FBCA 1WKJA 1NSQA 1BHNA 3GP9A 3FKBA 4ANCA 2AZ1A 4FKYA 1B4SA 1F6TA 1NB2A 3BBBA 2BEFA 4ANDA 1NDKA 3PRVA 1S5ZA 1PKUA 2NCKL 2HVEA 3FBEA 3ZTRA 3ENAA 4DUTA 4HR2A 5BXIA 1PAEX 4W98A 3NGTA 1HLWA 3NGSA 3Q8UA 3JS9A 4WBFA 3EJMA 3ZTQA 4ANEA 3ZTSA 3BH6B 1HIYA 1XIQA 3VVTA 3DDIA 1JXVA 4S0MA 3FC9A 1EHWA 2DXFA 2HURA 4FKXA 4UOFA 4F36A 2BX6A 1NSKL 3L7UA 3EVOA 3PJ9A 3VGVA 4DZ6A 1W7WA 3G2XA 3VVUA 1NUEA 1BE4A 4ENOA 3VGUA 3EE3A 1MN9A 3Q8VA 2VU5A 1NDCA 3Q83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHK L;  3Q89 A;  4KPC A;  3BBF A;  3EM1 A;  1LEO A;  3FBB A;  2B8P A;  2AZ3 A;  1MN7 A;  4DI6 A;  1HHQ A;  1B99 A;  3NGU A;  1KDN A;  1NPK A;  1S59 A;  3BBC A;  3EVM A;  5C7P A;  3FCW A;  2DXD A;  3FCV A;  3GPA A;  5CAA A;  1NCL A;  3B6B A;  3R9L A;  3EIC A;  4UOH A;  1BUX A;  3EVW A;  3ELH A;  3BH7 B;  1NDL A;  1NSP A;  1F3F A;  3B54 A;  1WKK A;  2CWK A;  4F4A A;  2DY9 A;  1S57 A;  3ETM A;  1ZS6 A;  2ZUA A;  4UOG A;  1XQI A;  3ZTO A;  3DKD A;  1NLK L;  3EMT A;  4O0N A;  4C6A A;  3FBF A;  3NGR A;  3ZTP A;  2DXE A;  3MPD A;  3WX8 A;  1VYA A;  2B8Q A;  4CP5 A;  5IOL A;  2HVD A;  2DYA A;  1LWX A;  3Q86 A;  3VGS A;  4EK2 A;  3VGT A;  1WKL A;  3Q8Y A;  1K44 A;  5CAB A;  1NDP A;  1U8W A;  1UCN A;  3FBC A;  1WKJ A;  1NSQ A;  1BHN A;  3GP9 A;  3FKB A;  4ANC A;  2AZ1 A;  4FKY A;  1B4S A;  1F6T A;  1NB2 A;  3BBB A;  2BEF A;  4AND A;  1NDK A;  3PRV A;  1S5Z A;  1PKU A;  2NCK L;  2HVE A;  3FBE A;  3ZTR A;  3ENA A;  4DUT A;  4HR2 A;  5BXI A;  1PAE X;  4W98 A;  3NGT A;  1HLW A;  3NGS A;  3Q8U A;  3JS9 A;  4WBF A;  3EJM A;  3ZTQ A;  4ANE A;  3ZTS A;  3BH6 B;  1HIY A;  1XIQ A;  3VVT A;  3DDI A;  1JXV A;  4S0M A;  3FC9 A;  1EHW A;  2DXF A;  2HUR A;  4FKX A;  4UOF A;  4F36 A;  2BX6 A;  1NSK L;  3L7U A;  3EVO A;  3PJ9 A;  3VGV A;  4DZ6 A;  1W7W A;  3G2X A;  3VVU A;  1NUE A;  1BE4 A;  4ENO A;  3VGU A;  3EE3 A;  1MN9 A;  3Q8V A;  2VU5 A;  1NDC A;  3Q83 A; 
#chains in the Genus database with same CATH topology
 4I1T A;  3FSX A;  3KLE B;  3CT9 A;  4HLB A;  3M4X A;  3N28 A;  3E01 A;  4UOH A;  4ZN1 A;  4PWU A;  2ZWP A;  3T1A A;  2JC0 A;  1WF1 A;  1XWL A;  3M6X A;  3NLC A;  3QID A;  1VRT B;  1OQ3 A;  1Q8K A;  5BYR A;  1QDU B;  2K3K A;  5FII A;  2PEB A;  5EGY A;  1SL0 A;  2A2C A;  2XSJ B;  1VC0 A;  2BJ8 A;  3H4B A;  4DR4 J;  2GML A;  2CA9 A;  2WCX A;  1WSR A;  3D6M B;  4IFY B;  2Z2Z A;  3KNG A;  2FHO B;  5BJR A;  3DLH A;  3Q0A A;  4DV1 F;  1S97 A;  2R2S A;  5AXM A;  2WOM B;  5KFC A;  2KL8 A;  4MH8 A;  2OJ3 A;  3EJM A;  2AWZ A;  4Y6I A;  1SB6 A;  4LF5 J;  4OI4 A;  1IXK A;  1RT6 A;  1X4E A;  3TAR A;  4CQ1 A;  4NLS A;  4CLL A;  2PI4 A;  4KO0 B;  1D9D A;  3GON A;  5KFZ A;  4I7F A;  1S12 A;  3JYT B;  2H51 B;  3GB0 A;  2C2D A;  2FJD B;  4JBC A;  1F9H A;  4NLY A;  2XEX A;  1NK9 A;  4B9M A;  3IO1 A;  3RR7 A;  2FIU A;  4IR9 A;  5GAE U;  2OD4 A;  3NS7 B;  3M9M B;  3ET6 B;  5ADZ A;  4RW6 B;  4RR5 A;  2N3O A;  1VQ5 S;  1GTE A;  2VL1 A;  3KK1 B;  1RKI A;  1ZET A;  5KG1 A;  3KNA A;  3AD8 C;  3HUL A;  3O5T B;  4KKO A;  5F0W A;  1CBK A;  3MCS A;  4C8M A;  4K4Y A;  3ZXW A;  3TAN A;  2GCF A;  1YKW A;  2A0F B;  3EZU A;  1RAH B;  2BKN A;  3OTO F;  1NH8 A;  4PG4 A;  5F8N A;  1T05 A;  2NYI A;  4B3T F;  1BLU A;  2YKN B;  4A8X A;  1NJZ A;  4QWE A;  4DV5 F;  1QAY A;  5KT5 A;  5LJ3 Y;  1NU4 A;  1RWN B;  2IC3 A;  2DNP A;  1U6F A;  3KLG B;  4USJ C;  2VG7 B;  4WU2 A;  4R0J A;  3NMA A;  4DV4 J;  1R7I A;  1M5H A;  2I0X A;  4N7T A;  2JC1 A;  4NXM F;  3T6B A;  2BE2 A;  4M5J A;  3BR9 A;  2LKZ A;  2PMZ D;  3PYF A;  4DI6 A;  1DTT A;  3F41 A;  4O3O A;  3H20 A;  1AXQ A;  1XMO J;  3OVS A;  3KK2 B;  3FMW A;  1NCL A;  2F1F A;  4WP8 A;  4OHV A;  1Q16 B;  1EP4 B;  3JQK A;  4GVB A;  1H2U X;  3IR7 B;  4FPR A;  4PG6 A;  4JI1 J;  2ZUA A;  1FES A;  5IC6 B;  1TKZ A;  1Y5I B;  1QJH A;  2CNO B;  2JFK A;  1VBY A;  4ID8 A;  2KJW A;  5AT1 B;  1R8H A;  1L3T A;  4UTG A;  1PGZ A;  5F3T A;  1LWC B;  2C2Z B;  1S7I A;  3FKB A;  2E5L F;  1IBK F;  1SC3 B;  5DGB A;  1HPZ B;  4NRT A;  1HNI A;  3R7N B;  4CT8 A;  5F8L A;  4HHH A;  1XNQ F;  1X0F A;  1U4B A;  1FWK A;  2CJK A;  1GMU A;  2V2V A;  5HMW A;  5D0H A;  2ZH2 A;  2RDD A;  2C2E A;  3KK3 B;  2HVH A;  8AT1 B;  1LV5 A;  3OHA A;  1S0N A;  4X4Q A;  3LP2 A;  3HHK A;  3IN5 A;  2A6O A;  4CLT A;  4NZ7 A;  4DR7 F;  5FDL B;  2G1H A;  1FD8 A;  4LFC F;  1VQS A;  4OI3 A;  3B54 A;  1DQ9 A;  4ZLJ A;  1ZM3 A;  1BGX T;  2VIC A;  4P9S A;  2FDN A;  2E5J A;  4AL7 A;  2AJQ A;  2IPO B;  2XHC A;  2EK1 A;  1FJG F;  2NRE A;  4NXN J;  1PBU A;  4PWD B;  3I4H X;  3QQC D;  3AQO A;  5F9N A;  2FUG 9;  2HEK A;  1U49 A;  5FD1 A;  1CSJ A;  1FRX A;  3W2V B;  4RWX A;  2KYZ A;  4RUA A;  4ZPB A;  4P7V A;  5I42 B;  2WK4 A;  1EAR A;  1IBM J;  3FZ2 A;  2HQC A;  3CJK B;  2XM3 A;  2JJ4 D;  2R2R A;  1N54 B;  3H90 A;  5KFJ A;  2KJV A;  1WEX A;  4NA1 A;  5IT9 Y;  3HCX A;  1CUL B;  4P2F A;  3TNV A;  4DS5 A;  3EM1 A;  3R6G B;  2W24 A;  3LAL A;  1HNW F;  3M8Q A;  2R7Q A;  1B99 A;  2B7B B;  4HHJ A;  2D3Z A;  4B17 A;  1F0X A;  5LMU J;  2Z58 B;  3M32 B;  4FYW B;  2FC8 A;  5IQ6 A;  4Q45 A;  4B3O B;  1U1Q A;  1CQM A;  2AYM A;  2DO4 A;  2YKM B;  1VBX A;  4TU8 A;  2Z2L A;  3DM2 A;  1DBD A;  4C0B A;  2H65 B;  3BSA A;  4TY9 A;  2F40 A;  4J37 A;  1GMW D;  4WK1 A;  3MGJ A;  3JSY A;  4JV1 A;  3FBC A;  2J0S D;  1H7W A;  5THW A;  1WC6 A;  2VPX B;  5B0F A;  1MRO A;  4RUC A;  2AHO B;  2BJE A;  3RBD A;  5HMX A;  4RW8 A;  4DR3 F;  2DPI A;  5KFG A;  5CYQ A;  4O0I A;  2ZM6 J;  2NPF A;  3G2X A;  4CYU A;  4C3K A;  1UVM A;  3GCW P;  1S6U A;  2X7I A;  2F9D A;  2KH9 A;  4CLS A;  2RKI B;  1TV6 A;  2FY8 A;  3IXQ A;  4NCB A;  4C8K A;  4PPD A;  3J7Y I;  1FKO B;  4K59 A;  1O8B A;  5DRK A;  2VB6 A;  1B70 B;  2BKO A;  1N5T A;  4WZQ A;  2B9X A;  1CJU A;  5A8R A;  2DRB A;  2BM0 A;  1CG2 A;  2XMJ A;  1AUD A;  4X4T A;  4P75 A;  4NL5 A;  9RUB A;  2VFT A;  3OPK A;  2HHX A;  1SIW B;  3K7R A;  2PE8 A;  2W4P A;  1TUV A;  4ILL A;  5DZ7 A;  3WQP A;  3ET6 A;  5IWA F;  2AV5 A;  2V69 A;  5IQQ A;  1I3O B;  2EEY A;  3KK1 A;  1EB0 A;  2YWF A;  4OX8 A;  4YY3 F;  3HT3 A;  2FLL A;  1TK5 A;  1XIQ A;  5LXR A;  1NK6 A;  3GIK A;  4ZVO B;  5K14 A;  2KDO A;  2DGX A;  3GYX B;  2B56 A;  1KQS R;  2WON B;  4LIR A;  4QIW D;  3GFX A;  4URG A;  5EX0 A;  2FZG B;  1MMD A;  2QRR A;  2QV6 A;  2KFY A;  1T02 A;  1YTY A;  4HTJ A;  2DIV A;  3QWP A;  2W9B A;  1M1K T;  3TA1 A;  2VPW B;  2K8G A;  2GW8 A;  2QLW A;  4MKB A;  3DRS A;  4C8Y A;  1SIZ A;  3MM6 A;  2F4V F;  4DOZ A;  3A8K A;  2G2O A;  2MXY A;  4HEA 9;  5DQG A;  3AB2 B;  4OHW A;  3J7Z 5;  2O3D A;  5J1P A;  2FYX A;  4DFK A;  2OEJ A;  2XQC A;  1RTD B;  2CQI A;  3DGV A;  2Q66 A;  1UP1 A;  1NRK A;  4RX6 A;  3RBE A;  3B8H A;  2EC2 A;  1EP4 A;  3OFH A;  1K8A T;  2CFX A;  4NLO A;  1S9G B;  4DQQ A;  2HNY A;  2B9E A;  3DRY A;  2BQ3 A;  1UWB B;  3TJ9 A;  1V6H A;  4JI3 F;  2HWH A;  4XDC A;  3P4U B;  1S1W A;  3W60 A;  4N76 A;  2NQP A;  5SZT A;  1KFD A;  5K9F A;  2D69 A;  1AB8 A;  4CLW A;  1V3R A;  5HSP A;  3MR2 A;  1HHQ A;  1HPZ A;  3B6B A;  2UV8 A;  4OLP A;  3MPU B;  2AF6 A;  4NML A;  1KKH A;  5I3Q A;  3KLV A;  1F9E B;  2DY9 A;  2RD5 C;  2KTQ A;  2ACM A;  4J9Q A;  1JNR B;  1SJ1 A;  4F67 A;  3TZX A;  2XY7 A;  3SYZ A;  3O44 A;  4DG1 A;  1SBR A;  2FHJ A;  3OL9 A;  2ZJP Q;  2DYA A;  4LRE A;  4DL2 A;  2DEI A;  1QUP A;  3VAF A;  4TN2 A;  2KXH A;  2BKP A;  1YVF A;  4A48 A;  5J2N B;  1NSQ A;  3VZI A;  4KH0 B;  2DNH A;  3J81 Y;  1S5Z A;  3FEZ A;  1N4L A;  3IR6 B;  2HZV A;  4OJ3 A;  5LMN F;  1HFE L;  3KJN B;  4M5N A;  3OT9 A;  1NJW A;  2KHD A;  2IVM A;  2HHQ A;  4ED1 A;  1K0V A;  2JX2 A;  2KFN A;  1S48 A;  2IBO A;  3OUY B;  1SL1 A;  1SUQ A;  1C1C A;  4CWB A;  3FVY A;  4MKY A;  1WHW A;  3QIP A;  1PYT A;  2Y0B B;  2EFQ A;  2V4J A;  1BQN A;  3D1H A;  3CE8 A;  4CM0 A;  5AE2 A;  3LA0 A;  3R5B A;  1LWF B;  3EIC A;  3MM8 A;  1QM9 A;  4FYX B;  1WKK A;  5I42 A;  3J80 Y;  2GAG C;  2DGU A;  1FKP B;  4ZLP A;  2CQ0 A;  3EZO A;  4DPY A;  3GG0 A;  3SQO P;  2ZH8 A;  1UFK A;  1EJ7 L;  2DCL A;  2YWK A;  5IOL A;  3KUE A;  5IT4 A;  1TL3 B;  2OML A;  2XZD B;  2RF2 A;  5IV3 A;  3RTV A;  3NXZ A;  2BRL A;  1XEZ A;  1RAD B;  1YIT S;  4ED6 A;  3MM9 B;  4X66 J;  3HJF A;  1N36 J;  1LW2 B;  2EFV A;  1M5K C;  3CME S;  1PAU B;  2F9J A;  2VKR A;  4AYB D;  4DL3 A;  4B3O A;  1OPI A;  2XLK A;  5K8M A;  2CQD A;  5HK4 A;  3CIZ A;  3MUV P;  4HAC B;  2POK A;  2QJ3 A;  4ZVU B;  1K0T A;  3RAM A;  2VPZ B;  1YSJ A;  5IXU A;  3GR1 A;  1N5Y B;  2VBW A;  3O1L A;  2B0G A;  3BJY A;  2BJ7 A;  3GPA A;  4W92 B;  1U45 A;  2VQF F;  3H0P A;  3RUB L;  1CC8 A;  4OYA A;  2VOD A;  3TZW A;  1LFW A;  3VF0 B;  2LU1 A;  2DR5 A;  2CKW A;  3BEG B;  4ZP7 A;  2QIF A;  1B7Y B;  4CP5 A;  4Y3C A;  3DOK B;  3DI6 B;  3DLK B;  4MK9 A;  3VGS A;  1NAQ A;  1Q53 A;  1FD2 A;  2VFS A;  3TUJ C;  5J2Q B;  4V1A k;  1DFD A;  3GJQ B;  2R8G A;  3GII A;  3UFC X;  3PW5 A;  4OX9 J;  3DU6 A;  4ZK7 M;  3RG6 A;  1HBO B;  4F4Z A;  2KB2 A;  2ZVS A;  1KD1 T;  4IYQ A;  3ITH B;  2HAF A;  3AXK A;  2RVJ A;  4FXD A;  2K1R A;  4LVN P;  3KJQ B;  3OVB A;  4R5P A;  3S7R A;  4CZC A;  1RE1 B;  4DUY F;  2FVP A;  1JLB B;  2C3M A;  3ADA C;  1X5T A;  1RHU B;  4XPC A;  3SSS A;  2ZVI A;  3IBC B;  3O2I A;  5IZH A;  4X4S A;  4I2P A;  2CQH A;  3VTI A;  2XG8 A;  5AE3 A;  4IG0 B;  1WC5 A;  2VDH A;  1S0M A;  1VBK A;  3P3D A;  1ZZF A;  4C97 A;  5L1L A;  1YJ9 S;  2ILZ A;  2AX0 A;  4A8F A;  4MIA A;  1Q81 T;  3RB3 A;  1TKT A;  2UUC F;  3MEC B;  1CJV A;  4QZV B;  1HBN A;  3ZZU A;  4DV3 J;  1CJT B;  1BHN A;  5D4O A;  5D4L A;  2AYE A;  3F73 A;  2H3E B;  1F5A A;  1YJR A;  4NRU A;  2YNI A;  2DGV A;  2HK2 A;  1RZM A;  2R3V A;  1RCO B;  2MJU A;  1WEY A;  3LTO A;  4CLP A;  2GQ2 A;  2LP4 A;  2EW9 A;  2Z56 B;  1VFJ A;  3LWM A;  2ABY A;  4ES1 A;  4Q0B A;  2CNN B;  2NS1 B;  4ED5 A;  1RUS A;  1TAQ A;  3CCL S;  4C11 B;  4WYL A;  4DR5 F;  5T14 A;  4YFU A;  1NK7 A;  4CIO A;  3CCQ S;  2J6T A;  2K3I A;  4KFB A;  1WOO A;  2N82 B;  1XNR J;  2IDL A;  3K5O A;  4RWW A;  4KHP F;  2FLP A;  3FCV A;  1WG4 A;  4O3P A;  3PDN A;  2PN6 A;  3RB4 A;  1R8P A;  4K0K J;  3P6Y C;  2C3O A;  3PX6 A;  2NZ4 A;  1HNZ F;  7AT1 B;  3V6J A;  1LW0 A;  3PR4 A;  4USW A;  3VAH A;  3E8O A;  4LBH A;  6FD1 A;  3L7P A;  1WG5 A;  2HVD A;  2JWN A;  3BDP A;  3BS9 A;  2VDI A;  1N32 F;  5ITH A;  1GTH A;  3NGK A;  5KFW A;  2ATL A;  1RAG B;  4ZJL A;  3TOQ A;  4AND A;  3NWG A;  3BRE A;  4JV0 A;  3FBE A;  1VK8 A;  2DGT A;  3I96 A;  3MTK A;  1X4H A;  5CHC B;  4DQP A;  2VJU A;  4LF9 F;  1M5P C;  2F63 A;  4K50 A;  1Q95 G;  4LT6 A;  3KWM A;  3KMS A;  4J5O A;  3NWR A;  1UWA A;  1QUV A;  1R89 A;  4X62 J;  2HWT A;  1FFW B;  3TA2 A;  3PRD A;  2EG2 A;  4LF1 A;  1G2E A;  4X4U A;  4F3Q A;  3BBC A;  1S59 A;  2PSZ A;  3UQS A;  1RDR A;  3QRQ A;  5HVH A;  3W61 A;  4LBP A;  4FS1 A;  1YJN S;  2W7O A;  3L95 X;  2KG1 A;  2V0N A;  4EYI B;  1LXJ A;  2VA2 A;  1D9A A;  1VIO A;  2QL5 B;  3G4S S;  1X8D A;  2Z0G A;  4DU8 A;  2YQ0 A;  4OV1 A;  1N56 A;  4JI7 F;  1T9Y A;  3RRK A;  5DLG A;  2NXN A;  4OHX A;  2QA4 G;  4EO8 A;  2M88 A;  6AT1 B;  2WHO A;  5A8W A;  3A12 A;  5CYJ A;  3V6K A;  2ERR A;  4DN9 A;  3NGT A;  1Y0H A;  1RTH B;  1FKP A;  3A8I A;  3K0J A;  2RUG A;  2HSE B;  1QLN A;  2AEM A;  2BOA A;  3VHQ A;  1QE1 A;  1H73 A;  3H4D A;  4DV1 J;  1JLC A;  3QFH A;  3LH2 S;  1CVJ A;  2Q79 A;  1FFG B;  4I2Q A;  1F2G A;  3BGR B;  5KFS A;  3N01 A;  2JLE A;  1X9W A;  4HI1 A;  3HKZ D;  1S10 A;  4WFY A;  3FMB A;  4NCG B;  1Q7Y T;  4IG3 B;  4IOC Q;  2E9R X;  4RZR A;  2A10 A;  2XSF A;  3PM9 A;  4Q44 A;  2ZKU A;  2L08 A;  3CD6 S;  1WTF A;  1UZH A;  5JJB A;  1DLO A;  2HBR B;  1NPP A;  1R31 A;  2N7Y A;  2DNK A;  1WOS A;  4Y2A A;  2QL7 B;  5H1S V;  3T1H J;  1HYS B;  3C6U A;  2UVV A;  2YPY A;  3TUI C;  3L4B C;  2M3D A;  4N47 A;  1NKB A;  5H9F J;  3RB6 A;  1YJW S;  1PYS B;  3FK4 A;  3W5Y A;  4OX7 A;  4ZVP B;  2HFU A;  3HMJ G;  1G4C A;  3MTJ A;  2YVS A;  2M7S A;  3BYP A;  3R27 A;  4O44 A;  2GJF A;  1SJ4 P;  1PC5 A;  2MKS A;  1WC4 A;  4OI2 A;  2DH8 A;  3H59 A;  1UPM B;  2FLO A;  2RQ4 A;  2WVB A;  4RKU C;  1RTJ A;  4OZ5 A;  4DV5 J;  2L9N A;  3MAH A;  1H6K X;  4PAB A;  3G8Q A;  3Q83 A;  3EUN A;  3ETO A;  3MFH A;  4J9K A;  1MN7 A;  4B9U A;  3ISN D;  2GQQ A;  1M1H A;  4N8O A;  2PII A;  2KM8 B;  4ZPC A;  2AGP A;  5K8P A;  3H2V E;  3MMB A;  4ED4 A;  2CPE A;  4WWS A;  2JEF A;  5E3R A;  2DIU A;  3ONQ A;  3MR3 A;  1N5S A;  2ATC B;  3ISZ A;  1JLB A;  5F3Z A;  1OSD A;  4B3M F;  3ILJ A;  3PO5 A;  2MY8 A;  1KHW A;  5E5N A;  1YBU A;  1U0H B;  1LKZ A;  4K4Z A;  3SCK E;  1UEV A;  5GAD I;  2RQC A;  3ZTR A;  1GAO A;  5M2P A;  3J7Z T;  2HHW A;  1Q8I A;  2BV3 A;  2NR0 A;  5GAH U;  3OJU A;  1SV5 B;  2DGW A;  2HHP A;  3PIO Q;  1HW9 A;  3OXF A;  3PJX A;  1XNQ J;  1WSV A;  1FJ7 A;  1ICE B;  1IBL J;  1IWG A;  1V9O A;  4BWJ A;  1SJR A;  2HG4 A;  3R7B B;  2HS0 A;  4CO2 A;  5BYS A;  4NLV A;  2M70 A;  1TL5 A;  4Q5V A;  2MSS A;  1TVR A;  1XBW A;  3QGP A;  4U8Y A;  1SQF A;  3TAM A;  1MWZ A;  2GFF A;  2EXU A;  2RU9 A;  4K5S A;  3DHX A;  4JI5 J;  4DR7 J;  4YN3 B;  2EK6 A;  2EKY A;  5L1K A;  1WD6 A;  4JI0 F;  3RU0 A;  4QYZ J;  2MLY A;  3CJ8 A;  3NRB A;  3PEH A;  3D0I E;  2DNL A;  1VYA A;  3EXY A;  4LFC J;  2HZC A;  3ENW A;  3H2U B;  2GJI A;  2OPR A;  4MFB A;  3VAJ A;  1ZM2 A;  2ZHA A;  1KBR A;  1TFY A;  4JV5 F;  2XYH B;  1JLF B;  2VBY A;  2NYH A;  3NP5 A;  3C6T B;  1NB2 A;  2MQ8 A;  4MKV A;  2DR7 A;  2GA7 A;  2LU2 A;  1K9M T;  1HNX F;  2BW7 A;  5A6W A;  3K5L A;  2ZDP A;  3ENA A;  5D77 A;  1FJG J;  3JS9 A;  2CAJ A;  2CJY B;  4X4P A;  1L5U A;  4BC7 A;  4TLR A;  3X3U A;  3H2L A;  3UN5 A;  4DN0 A;  2MQO A;  5CYM B;  2J8A A;  2HFV A;  4ENO A;  4QYR A;  1NZA A;  2CQ2 A;  3NY0 A;  1X5P A;  2B9W A;  4KSE B;  4N77 A;  2PFD A;  4ES3 A;  1TAU A;  3IS9 A;  1RBL A;  5DDR C;  3OXL A;  2DCU B;  3IRX A;  1GH8 A;  1JLE A;  3C16 A;  4ZPW R;  5U47 A;  3BH7 B;  3PNI A;  1HNV B;  1TKX B;  3J81 U;  4C9D A;  5T7L B;  3TVZ A;  3WX4 A;  3NCP A;  2CQG A;  3UDC A;  1HWI A;  1S1X A;  1FX2 A;  2ZH4 A;  3HK2 A;  1S6O A;  4C8N A;  3EX7 B;  3AT1 B;  4ZS6 A;  5KFV A;  1U8W A;  2ZH3 A;  3GJR B;  2RAQ A;  1RT7 B;  4Y00 A;  4LJM A;  3KDO A;  2VV5 A;  3M05 A;  2HIQ A;  2GVD A;  3IAM 9;  1T3O A;  1CS4 B;  2GC8 A;  1S1U B;  3R7S B;  2ZHB A;  4LF6 F;  1N33 J;  5C25 B;  3W9J A;  4DSK A;  4YB5 A;  3J80 U;  4RW9 A;  2J8S A;  3ZZZ A;  5A8K A;  3PW0 A;  4DX7 A;  3MR7 A;  2YBV A;  3BSC A;  3KKF A;  3V81 A;  4J9M A;  2RDJ A;  3DXS X;  2CVI A;  5CZX A;  2HKE A;  3HHE A;  2GHV C;  4R0E A;  3IM8 A;  2K7J A;  3AY0 A;  3KLH B;  2PFF B;  3SCI E;  1WHX A;  3MEG A;  3CD5 A;  4DX8 H;  2ZD1 A;  3PEJ A;  5JXS A;  4UT4 A;  4QIF A;  4IRK A;  2IVF B;  4LRA A;  1IM6 A;  1FFS B;  5AXN A;  1U1R A;  4EK2 A;  3OR1 B;  4RU9 A;  2AGO A;  4LSN B;  3TRG A;  1V3S A;  4ECQ A;  1BWE A;  3TVK A;  1VQL S;  2YKO A;  5DJB A;  1RGV A;  2CJA A;  2XO6 A;  1IJF B;  3QO9 B;  1HI8 A;  2VFU A;  1YHQ S;  4KC5 A;  4LF8 F;  1VRU A;  1U47 A;  2RRN A;  4PKD B;  4NEY A;  2DNQ A;  4P7T A;  3GR0 A;  2FTR A;  1HYS A;  1SJQ A;  3AH6 A;  1HD0 A;  4L73 A;  3R1L A;  2DD8 S;  2KXF A;  1HWU A;  1N6Q B;  4HH1 A;  3KLI B;  5AJ3 F;  1WHV A;  3W8G A;  3NS5 A;  3K59 A;  2BXJ A;  4YQW A;  1T9W A;  4KGZ B;  3K58 A;  3SFG A;  4O4G B;  2QLX A;  1RAO A;  3SIP B;  5HAN A;  4JV2 A;  1P9Y A;  5J2M A;  2MZJ A;  2C22 A;  1RWU A;  1MNE A;  4QR2 A;  3HHD A;  4MKA A;  3IR5 B;  4YP3 A;  2ZWO A;  1JX4 A;  3V6D B;  4HDG A;  3A4T A;  4OJH A;  2W1B A;  3SQG B;  2KYX A;  3DLG A;  3THT A;  2FJV A;  7FDR A;  3DFE A;  9ATC B;  5CAB A;  1C0T B;  1RAC B;  3TZZ A;  5KFH A;  3I0S A;  2DNM A;  4OZ0 A;  3KLF A;  4F50 A;  4H4K A;  1PKU A;  4JI4 F;  3NAI A;  4DL7 A;  1FK9 B;  2HGL A;  1UL3 A;  1U09 A;  4KQZ A;  3MCO A;  1BXN A;  2N7C A;  3IGV A;  4D3H A;  2HGN A;  4PR6 A;  3RBZ A;  1HAR A;  2MDA A;  2LXI A;  1S49 A;  2Q3P A;  2CDQ A;  3HSG A;  3T9N A;  1U25 A;  2FVQ A;  3G86 A;  2YNH B;  2BOP A;  3DOL A;  4XDD A;  4U95 A;  2R7W A;  2CYY A;  1U02 A;  3WZ0 A;  3M30 B;  3SDE B;  2CVE A;  1LWE A;  4JI3 J;  1RT4 A;  5L39 A;  4F4Y A;  2CJB A;  2UUA J;  3EPG A;  2OH2 A;  4RBV A;  1NK8 A;  2W2O P;  2O5D A;  3CGI A;  2PEH A;  3KUG A;  1GT8 A;  1T11 A;  5A2Q U;  2H5I B;  1VCT A;  3UD4 P;  4CO4 A;  1XR7 A;  2QYG A;  4LBI A;  1RT1 B;  3CJ4 A;  4I6A A;  4M5L A;  2W4D A;  3KG1 A;  3S1T A;  4H54 A;  4QW9 A;  4X64 F;  2AJ1 A;  3UDV A;  5D0G A;  2J0Q D;  4ATN A;  4DQS A;  3LQV A;  1NO8 A;  2ZE2 B;  1BQM B;  4P72 A;  5A6P A;  1GXU A;  1VQO S;  3UDL A;  5KFA A;  3VQS A;  4ZLL A;  3RW7 A;  1MN9 A;  3GG1 A;  3EYZ A;  5C24 B;  3IM9 A;  2CRL A;  2LQ9 A;  1GMV A;  4QU7 A;  4AD6 A;  4B9T A;  1J5E F;  1T0T V;  4MT1 A;  5D0R A;  3MED A;  3N6N A;  4DPT A;  2ZDO A;  2CPI A;  2XWX A;  3VQT A;  4WFA Q;  1IKX B;  3OLA A;  3GE9 A;  5CCM A;  3DLL Q;  5HVG A;  1H74 A;  2KT5 A;  4CH1 A;  4EBC A;  2H48 B;  4EO6 A;  3IBW A;  5HBM B;  4ZP8 A;  3BR8 A;  2JVR A;  1S9E B;  2B6A A;  1NK5 A;  2DHX A;  4DV2 F;  1JLA B;  1M0S A;  2DNZ A;  1RYR A;  2W8K A;  5C42 A;  3RZA A;  4I64 A;  1RBO B;  2XI3 A;  1TKD A;  4HI2 A;  1R0A A;  1U6Z A;  4IR1 A;  4RNO A;  2QG9 B;  3CJR A;  2C2N A;  3DCA A;  1I5O B;  2YQ1 A;  2MZS A;  5DGA A;  2C1E B;  1D0E A;  1XMQ J;  3J7A 1;  5KG7 A;  5KG3 A;  1HI0 P;  1YX2 A;  5F9L A;  3CJT A;  4PG8 A;  1CS4 A;  2VH7 A;  1WEL A;  4Q8E A;  5LOQ A;  5C25 A;  2HW3 A;  3QLH A;  1IN0 A;  2WBM A;  2W2P P;  2VQE F;  1MU2 B;  4IDK A;  2AEF A;  3Q24 A;  3Q8Q B;  2WBR A;  1GQE A;  2HFZ A;  4LSL B;  3DHW C;  5KFE A;  4DSE A;  4ZHR A;  3M2V B;  3Q8P B;  2RRA A;  3PYE A;  3DNC A;  2C2O B;  3G96 A;  2ASD A;  4YR2 A;  1NXI A;  5D8H B;  3V4I A;  4B3S J;  2UUB F;  4LIW A;  2HYI B;  1IKV B;  2P9E A;  3M2U B;  3R97 A;  2ZH1 A;  2QT7 A;  4TVA B;  4IOB A;  1TL1 A;  1EET A;  3QAU A;  3ZTQ A;  1U1P A;  4WFX A;  4YEA A;  1N5Q A;  3KHG A;  5M2R A;  2V8G A;  1FRI A;  4A8K A;  4K4S A;  3C2P A;  2F4F A;  3MM5 B;  4KHR A;  4FBU A;  4LSN A;  2ZEJ A;  2D3O 1;  4FYV B;  1X4C A;  1HQE A;  3QMQ A;  4ALZ A;  4DUY J;  4CO3 A;  4ZPA A;  3MUR P;  1ELO A;  3UVJ A;  4TU9 A;  3NNH A;  3I5A A;  3I0R A;  2HRT A;  1UJ5 A;  4QOT A;  3BKU A;  2Q43 A;  4EZ6 A;  4B3R F;  1B0P A;  3E01 B;  3BN4 A;  2CPJ A;  2IMW P;  1F1B B;  1JJC B;  1LNQ A;  3F44 A;  1IKW A;  2ZZM A;  4FDF A;  2O66 A;  2BAB A;  3T9Z A;  3BKF A;  1JB0 C;  1RWK B;  1UMJ A;  2MZQ A;  4YR3 A;  2M8H A;  1NDK A;  4ED2 A;  1WAC A;  1J2V A;  2UUC J;  3NOG A;  1PBA A;  4R8U A;  3PHE A;  5BXI A;  3O6Q A;  3FEY B;  1RTI A;  4X4N A;  3NG8 A;  4OYO A;  4M95 A;  5D4P A;  4OZ1 A;  3UNY A;  2BJ3 A;  4F7V A;  1JMT A;  3VGV A;  2XMA A;  2XLI A;  1OY8 A;  4ZJO A;  3ENV A;  4LQ9 A;  5C2G A;  1N48 A;  3QT6 A;  1VI7 A;  1SJ3 P;  1ZM9 A;  1S6P A;  1T3N A;  4YB1 P;  2BBE A;  2YNG A;  4DR5 J;  1Z2Z A;  4LVO P;  2HHV A;  2ZC4 A;  4I7F B;  3QGI A;  3Q23 A;  4KHP J;  3U1M A;  3TVY A;  3ILO A;  2R8K A;  1RAE B;  1EQM A;  2OEK A;  3ICL A;  2YNH A;  1TZ0 A;  1RWM B;  2X1G A;  1FRJ A;  5SUH A;  3HKW A;  4F3M A;  3SDE A;  2VG5 A;  3HZE A;  4KKO B;  3VAG A;  3TQ1 A;  4ZA1 A;  1GNK A;  2C3Y A;  5IM0 A;  1S6Q A;  2IA6 A;  1N32 J;  4Z2X A;  1ZPV A;  3RRH A;  4W4M A;  4NMX A;  2J76 E;  2CJ9 A;  1T05 B;  4NYP A;  2DBB A;  1URN A;  1PCA A;  1HQ2 A;  4U67 Q;  2G2Z A;  4ZVH A;  3H98 A;  2GIF A;  4J9R A;  2XZT B;  1WC1 A;  4LRC A;  3VVU A;  1MWY A;  1U1O A;  3M6W A;  4NLP A;  4LF9 J;  4ED3 A;  1SC1 B;  2IC3 B;  3QGH A;  3R2C J;  2BUN A;  3NGU A;  4I0W A;  2H5J B;  1A6L A;  1L3K A;  1U8S A;  3EVW A;  1AT1 B;  3ELH A;  4EBD A;  3PKY A;  3TUP A;  4M63 A;  2A2D A;  2BM1 A;  4ES2 A;  1GFW B;  3R6L B;  1YIJ S;  2ZE2 A;  3JAM Y;  1NK0 A;  1DTT B;  4DR1 F;  1Y10 A;  1JKH B;  3C15 A;  4GVB B;  4P10 A;  3QZ7 A;  4Y34 A;  1K44 A;  4QYZ K;  2Q1L A;  1UCN A;  4ICL A;  2HFO A;  1TFW A;  4PAA A;  5KT6 A;  2H4W B;  3HSD A;  3TJ8 A;  2F8H A;  5DG9 A;  1TKZ B;  3HFZ B;  4NCA A;  2M5Y A;  5E2Q A;  1AA1 B;  2MJN A;  3PHT A;  2XUL A;  2J5A A;  2MQL A;  3H25 A;  4F26 A;  4OYB A;  2KRB A;  3LP1 A;  4ZVS B;  4DR2 F;  1VQ4 S;  2W7P A;  3HD1 A;  5B7W A;  1NHK L;  4ECV A;  4K4T A;  2PA8 D;  1SKS A;  5I4M A;  5KT4 A;  4FYD A;  1Q79 A;  1VC6 A;  3CC2 S;  5A76 A;  1ZS6 A;  2IAJ A;  1T94 A;  4ECT A;  3VAK A;  3HVR A;  2DY1 A;  2Y8Y A;  2J9D E;  4FVC A;  3CCE S;  2ZH9 A;  2QFI A;  1RK8 A;  2XGP A;  2JRS A;  1NND A;  5CD4 H;  2ASJ A;  1JLG A;  3GFY A;  3TX8 A;  2L9W A;  4DR4 F;  2V6A A;  1ARO P;  1AFI A;  5F8G A;  1ROF A;  2RML A;  2BQR A;  3D66 A;  1SH0 A;  5KOX A;  1C4C A;  1NME B;  4CLK A;  3D3C J;  3QT7 A;  1QSL A;  5J1E A;  3CC4 S;  2R2T A;  3WBZ A;  2DRD A;  2VON A;  4UW2 A;  2QL9 B;  3FEX B;  3TI0 A;  3PW4 A;  2UU9 J;  1S9F A;  4URQ U;  1S1T A;  3OFF A;  1HMV A;  2OAU A;  4GC6 A;  1Y4Z B;  2EFN A;  4G1I A;  3HPO A;  2R7X A;  3NBP A;  2OPQ A;  4ZVR B;  3NL0 A;  2GO8 A;  4F4A A;  4CT9 A;  3ETM A;  2Y8W A;  5LL6 d;  2Y3Y A;  3M8Q B;  4PEO A;  2K2P A;  3DRX A;  4U6P A;  1P9Q C;  3FRZ A;  1HBM A;  4DPO A;  1H0H B;  5F8I A;  3AOA A;  3HVW A;  2FVC A;  3BSN A;  1HWL A;  1T8E A;  4ANC A;  3MAQ A;  4KV8 A;  1IUJ A;  1BY9 A;  2J6S A;  3I9Z A;  4OI6 A;  3C14 A;  3O3L A;  3EXC X;  3M2R A;  3OVA A;  3AA8 A;  3T5K A;  4X84 A;  2VUG A;  3AQP A;  4LFB F;  4TYA A;  1JLQ A;  1KOO A;  1T95 A;  1E6V A;  4UF4 A;  4PPZ A;  2QFJ A;  2C3P A;  2M2B A;  2OKQ A;  1MML A;  2HAI A;  3G9C A;  1MRO B;  4FN5 A;  5EWG A;  1FEE A;  2DHG A;  2E1M C;  3DLJ A;  3RBX A;  1NB7 A;  4RW8 B;  3OQ2 A;  4DU7 A;  3D5M A;  1NJY A;  2HHS A;  3HD2 A;  5GAG U;  2GVZ A;  5CYQ B;  3UPF A;  3UD5 A;  4O3S A;  1XMO F;  4CYU B;  2VHG A;  2P2C B;  1KTV A;  1F9F A;  3MM7 A;  2J0X A;  4AL6 A;  4I6Y A;  2HHH F;  1TV6 B;  3GJS B;  3CF5 Q;  3CDU A;  4A47 A;  4WFB Q;  1UVI A;  3HLU A;  3N79 A;  5A8R B;  1CJU B;  3I5C A;  1P27 B;  2P5V A;  3QYY A;  3ZNJ 1;  3NGS A;  3GZ7 A;  5LM7 E;  1Q8L A;  1S72 S;  5HMY A;  2V8V A;  1BC6 A;  2ZOF A;  4OMF G;  1X4A A;  2LXU A;  3CCJ S;  2IA0 A;  2HQG A;  1RLC L;  3D3B J;  1OY6 A;  5B0C A;  3VGU A;  1L3V A;  4ELT A;  3W62 A;  3HVA A;  1EX8 A;  5K5M A;  4ILM A;  5K14 B;  4C2M A;  3NCR A;  3UI3 A;  4PUO A;  3AA9 A;  2AMC B;  3QRR A;  1KWM A;  3Q2T C;  3L9Z A;  3MFI A;  2NSC A;  2QLF B;  5F0U A;  2HQF A;  4RBU A;  3EMT A;  5B0D A;  4USU A;  1EAY C;  3CB4 A;  4OJ1 A;  3M8R A;  4QR0 A;  2W9B B;  4IH5 A;  3IG1 A;  4NLU A;  2CZV C;  1YBA A;  1HBU B;  2I9S A;  4OLO A;  3DRS B;  3BGL A;  1KNZ A;  1VS3 A;  3MM6 B;  3PG9 A;  3MPV A;  1LQ9 A;  2V94 A;  4B02 A;  1ZAV A;  4CRJ A;  4M94 A;  3PW2 A;  3QNW B;  1S4E A;  2FZK B;  2JEJ A;  3PFE A;  4PXD A;  3DXB A;  4B9L A;  5F8M A;  3FJ2 A;  3UCG A;  4KGM A;  2V8H A;  2UV8 G;  1AUS L;  2ZBI A;  4S0M A;  1WJ9 A;  3CD0 A;  4YOE A;  4KTQ A;  1JKH A;  3A8J A;  4LMZ A;  2XYG B;  4DQR A;  5DET A;  2IM3 A;  2HNY B;  1ZA2 B;  3FRY A;  4GO7 X;  4WFZ A;  2XHW A;  2DRA A;  3ZC4 A;  1ZPW X;  1RWW B;  4U8V A;  2DXD A;  1NPR A;  1S1W B;  3R9L A;  3BYR A;  5GAE I;  1Y3J A;  3I31 A;  5KFX A;  3AJ1 A;  4DL6 A;  3RR8 A;  1VR6 A;  2W4C A;  2X1A A;  4YME A;  2FHJ D;  1SVD A;  1R43 A;  1OWX A;  1T9U A;  1T9X A;  2AGQ A;  4JI8 F;  4CH7 A;  2FQQ B;  5KFI A;  2OPS A;  3L7O A;  2FVS A;  4DJB A;  4DG1 B;  3LPE A;  3M6V A;  2VFR A;  3D67 A;  2XLJ A;  2HBZ B;  2P6T A;  1IJE B;  4L76 A;  2XS7 A;  1HLW A;  1IWA A;  5A0Y A;  2RJZ A;  3IA0 A;  4HL9 A;  3WC2 A;  1WOP A;  1QSS A;  5J2P B;  3K57 A;  4DCJ B;  2H5E A;  2X3G A;  1RA6 A;  2Z30 B;  1NSK L;  5C2C A;  3N9U C;  2OMO A;  3FZB A;  4BHQ A;  3W1Y C;  5HI7 A;  5IS2 A;  3Q8R B;  2RIJ A;  2W01 A;  2G4B A;  3NNC A;  1I1G A;  2DNY A;  5E41 A;  4LF8 J;  1T7P A;  4NLQ A;  4C8O A;  4GO5 X;  3HXM A;  3M8P A;  3CXC R;  1L3S A;  1DHM A;  1SUQ B;  2I38 A;  2XMV A;  4HYK A;  1C1C B;  2W8L A;  1FJE B;  5AJ3 J;  3QIP B;  4LR8 A;  2RUS A;  2V4J B;  3FUY A;  1BQN B;  2DHA A;  4D3G A;  2ZHO A;  2D3O R;  3MPD A;  3MM8 B;  3BQ2 A;  3A3P B;  1S76 D;  1YZ7 A;  5IFM A;  4ZLN A;  3GP9 A;  3MR5 A;  3DC2 A;  3HFV A;  3I32 A;  1PYO B;  1U1L A;  2YPZ A;  3M8Y A;  2OEM A;  4OL8 A;  1TUW A;  2RF2 B;  3G82 A;  2AP6 A;  1RXO B;  4NPO A;  5KFK A;  3LGN A;  5IC4 B;  1TL4 A;  2HGM A;  3CCT A;  2W9C A;  3KJF B;  4Q2M A;  4MJK A;  4MTP A;  2DO0 A;  2QA4 S;  1RT2 A;  1N0U A;  1VLO A;  4NI2 A;  4CLZ A;  2V4R A;  1KR4 A;  1CEZ A;  4DF8 A;  2KT3 A;  2RU3 A;  2OP5 A;  1FJC A;  3J7A N;  3SV4 A;  1JK9 B;  4DMZ A;  3CO0 P;  3BGO P;  1AYE A;  3THV A;  2VG6 A;  3ENQ A;  4XK8 C;  2D74 B;  3OSN A;  4JI2 F;  3TW0 A;  4X4O A;  2YWW A;  2ZNY A;  3GJT B;  1EKR A;  1D1U A;  3SV3 A;  5LSR A;  1A9N B;  4OX6 A;  1OIA A;  3JQJ A;  2DR9 A;  3MD1 A;  1RKJ A;  4QIE A;  3M1V A;  4OZ2 A;  4FF1 A;  5FJ4 A;  2DEJ A;  2AQ4 A;  4P52 A;  4X64 J;  1B7F A;  3EE3 A;  3DGP A;  5KFT A;  1R8B A;  2CJX B;  2MKI A;  2VBZ A;  4DV7 F;  3KDN A;  2K1R B;  3EVM A;  5E33 A;  1B3T A;  4R5P B;  2EC0 A;  1ZA1 B;  2Y1J A;  3MUM P;  2EFG A;  1REV B;  3CCS S;  1JWW A;  2ZH7 A;  3LWL A;  4OZN A;  4Z7Y A;  1JIH A;  3S01 A;  4KE5 A;  3OBI A;  2DHH A;  3BZQ A;  3FBF A;  3ZTP A;  2DXE A;  1WC3 A;  4I2P B;  3R5J B;  1FRH A;  5EN1 A;  3CCV S;  3C8Y A;  4YDD B;  2WTF A;  1FNM A;  1R8C A;  2X51 A;  2DVI A;  1SPB P;  1X4B A;  1XK8 A;  1TKT B;  1DQA A;  3DDK A;  4USM A;  5E3Q A;  1CJV B;  1SQG A;  4CO0 A;  2HVZ A;  5GMK a;  1LXN A;  3HVT A;  1HBN B;  4E0D A;  3DYA A;  1IVZ A;  1TMJ A;  4FKX A;  5G0R A;  2YNI B;  5AE1 A;  2YH1 A;  3R2D J;  2EKN A;  2UXB F;  2Y0S D;  4QBU A;  3PR5 B;  3IGN A;  4DV2 J;  3JAM U;  1HBU A;  4LF2 A;  2VU5 A;  4WII A;  4Q0B B;  1VK3 A;  3RGI A;  5DM7 Q;  4P2S A;  3CDE A;  2FLN A;  2CJQ A;  4DPU A;  1HI1 A;  4CI0 B;  4TXS A;  4JI6 F;  4G1P A;  1CC7 A;  2NSB A;  1YJV A;  2HNZ A;  2DHS A;  1Q78 A;  1VMB A;  3MMC A;  3TYT A;  4G1Q A;  3W2W A;  4I68 A;  3KHR A;  2A1B A;  4KFB B;  4EFA C;  3LP0 A;  2VAS A;  4Z7C A;  4EWT A;  1WDD A;  5DQI A;  5KG6 A;  3I6P A;  3CUL A;  1Y00 A;  3RRG A;  4ID5 A;  1VQK S;  2WB4 A;  2ZJR Q;  1LW0 B;  2LFV A;  4OYZ A;  1H2V Z;  3NEK A;  3P5T L;  3H40 A;  4DV0 J;  1RT5 A;  4P2X A;  4YHH J;  3MOZ A;  5HAT A;  2DGQ A;  2W2N P;  1B0V A;  2CPF A;  2WSE C;  3DN9 A;  2Z2Y B;  1JXV A;  1PJ6 A;  4CO1 A;  3CPW R;  2WB1 D;  2EBE A;  3JSR A;  3PYG A;  2IYG A;  1Y3K A;  3IP0 A;  1FVQ A;  4P71 A;  5CH7 B;  5L38 A;  2B8P A;  2LDI A;  2QA1 A;  1RWO B;  3MF5 A;  2GAH C;  3GYG A;  4DR6 F;  4C3M A;  2DIT A;  5D3G A;  2QLB B;  3ZFV A;  4B9V A;  1Y11 A;  4LRD A;  1VJQ A;  1N52 B;  3ZNU A;  5J2P A;  1XQI A;  2OTL S;  1NKE A;  1RHM B;  5DO2 A;  2QA2 A;  2W7A A;  3U1N A;  4DL5 A;  3BF4 A;  2GS8 A;  4FZV A;  3G6E S;  4Q7A A;  1U2F A;  1QAX A;  1J5O A;  1GXT A;  2HQI A;  4H4O B;  1SC4 B;  5BR8 F;  1BWV A;  3H7H B;  1KVK A;  4B3R J;  5KT2 A;  2HRY A;  4NOH A;  2OIH A;  4G3I A;  4ECW A;  3TEH B;  2FZC B;  2UXC J;  1T03 A;  2ROP A;  5LJ5 Y;  5A8W B;  4OYX A;  4C7Q A;  4ZCK A;  1FDD A;  1N5V A;  1HR0 J;  2CDR B;  4NZ0 A;  4AXI A;  3BDE A;  4TY8 A;  2MGZ A;  3HT0 A;  1UTA A;  3D1O A;  2AW0 A;  3MMJ A;  4E8U A;  3CMQ A;  1RQ0 A;  4DBQ A;  2N4C A;  4I4B A;  1QE1 B;  1VQ6 S;  2GHW A;  2EVZ A;  4ZP6 A;  1JLC B;  5EWE A;  4BWM A;  2E7V A;  2G2Y A;  5E0O A;  2B4V A;  3PKM A;  2LQB A;  2KFZ A;  4I2Q B;  1TMM A;  2C3U A;  1PIL A;  2PGC A;  4ED0 A;  4C6A A;  1NH7 A;  3KFW X;  5L8R C;  5GMD A;  2JHE A;  3VR1 A;  3KJV A;  4DHV A;  3GV5 B;  3DRR A;  1HL6 A;  1O6X A;  1RIS A;  4LF4 F;  3KHL A;  4I67 A;  1DLO B;  3CO9 A;  3SI8 A;  1RAF B;  2V9W A;  3MHY A;  4Q43 A;  5ETK A;  1X31 C;  2IYI A;  5HJX A;  1TP7 A;  2KN4 A;  3C6U B;  1SCJ B;  1CJK A;  5E7O B;  2LEC A;  3W9I A;  2E9T A;  2VF3 A;  3FGV A;  4ZCL A;  3VAM A;  3QZ8 A;  4F36 A;  3M9O B;  4IFV B;  1SH3 A;  2CQC A;  1YGY A;  4QQB A;  3J81 j;  3QWU A;  1NK4 A;  3FFI A;  5RUB A;  3MD3 A;  4O44 B;  4E98 A;  2FJW A;  3F0N A;  2V67 A;  2B51 A;  1RAB B;  5HO4 A;  4F8R A;  5HMZ A;  1R27 B;  4GVL A;  4WJB A;  4KT0 C;  1RTJ B;  1ZTT A;  1F3F A;  3UR3 C;  4USV A;  3O8W A;  4K0K F;  4OHY A;  3GIJ A;  4UOG A;  2HLU A;  1FHT A;  2OO4 A;  5KG5 A;  2LLZ A;  3K17 A;  3VAI A;  1T9V A;  4CH0 S;  2CPX A;  1VLY A;  3V5R A;  2E7X A;  2WVF A;  4OYW A;  1IR0 A;  2IJF A;  2XC9 A;  3MMB B;  2UZA A;  1KLM B;  1UA0 A;  4UY8 T;  4DR1 J;  4YB7 A;  3R3T A;  2BQU A;  3DLE A;  4ECR A;  2G13 A;  1UJ6 A;  3BPS P;  3HSZ A;  3PRV A;  3OHB A;  4P74 A;  1NBE B;  3GWC A;  3THP A;  2ALY B;  2BYC A;  1U1M A;  1SKW A;  1REV A;  2KM8 C;  3DMJ A;  2ACY A;  1LFP A;  2FB0 A;  2H1Y A;  1BQX A;  4M1K A;  2DXF A;  2CPY A;  3HHL A;  4BBY A;  4A46 A;  4W90 B;  3OFG A;  3MXH P;  3CJQ A;  4HKQ A;  2Z8Q A;  1U2C A;  5ETQ A;  3ISN C;  1N34 F;  4M8L A;  3KUH A;  1RLD A;  1FA0 A;  5L1I A;  1RT3 A;  5JVG Q;  3OD2 A;  3CJ0 A;  4WE1 A;  2NXU A;  2BJ1 A;  4K2J A;  4C3L A;  2ROG A;  2PC6 A;  3DRP A;  2NXJ A;  4DR2 J;  3HO1 A;  1JJH A;  4N41 A;  1J27 A;  3MUT P;  2EPI A;  3ZTO A;  1FWP A;  1Q8B A;  3N4W A;  4X65 F;  5FLX Y;  3MDF A;  4GKJ F;  4KJI A;  1TVR B;  1RSC A;  4ERD A;  2FJX A;  3TAM B;  1OQ6 A;  4TKT A;  2AYB A;  3AD9 C;  4GC7 A;  3MEE A;  1D3W A;  3FQK A;  2I1R A;  4OI1 A;  2MZ1 A;  4FBT A;  4ZVF A;  5D4N A;  4DX5 A;  5M2U A;  2M8D B;  1Z4U A;  4DXL A;  2OPR B;  3DU5 A;  3GFH A;  4MFB B;  4WK3 A;  3PRB A;  2B5J A;  3QT5 A;  2B7C B;  4PQU A;  4UOF A;  3ZZ0 A;  2CQP A;  4K8R A;  3E2E A;  5HLF A;  2FC9 A;  3LF0 A;  1ZYQ A;  3CIM A;  4N56 A;  2DNO A;  1IKY A;  4LRB A;  2LA6 A;  4NX9 A;  1XER A;  3BBF A;  1CLF A;  2GGP A;  2YNF A;  1XN9 A;  1K47 A;  2QE5 A;  1M90 T;  2RDI A;  1IBC B;  3JSM A;  3RW6 A;  4OJG A;  3L3C A;  4A8O A;  3IS9 B;  4WKY A;  1JJ4 A;  2QO3 A;  5KG2 A;  2QMU B;  3IRX B;  1VQ8 S;  3PX0 A;  1VQP S;  1JLE B;  3C16 B;  1IQT A;  2I5J B;  2ZC3 A;  5HP1 A;  2R7U A;  4LQ3 A;  3VGT A;  4PYD A;  3T1H F;  3M9N B;  3GIL A;  3T5L A;  3IC1 A;  4NLD A;  2BEF A;  4WF9 Q;  4TYB A;  1S1X B;  1AZS A;  1TQL A;  2HVE A;  3LO3 A;  4RNF A;  1N8R T;  3NMR A;  1Q5V A;  1XC9 A;  1H3D A;  1UPP A;  2HUR A;  2HFN A;  4DEZ A;  4LFB J;  1R0B G;  2GVD B;  1X9M A;  4H4O A;  4O3Q A;  2CG8 A;  4ZPT R;  2R8I A;  1C0U A;  5D0E A;  3CSK A;  4RW9 B;  1I51 B;  5A8K B;  5KFY A;  4LF7 F;  2CNL B;  4UZC A;  4EBE A;  3V81 B;  2DPJ A;  4ED8 A;  5IT9 U;  2OPP B;  3W7B A;  2XMK A;  1ZH5 A;  1S7H A;  3T3F A;  4K7Q A;  5KFL A;  3UN3 A;  3MEG B;  2HHH J;  4BC9 A;  3D6H B;  3HM9 A;  2ZD1 B;  1WTB A;  1FT8 A;  2M0G B;  2B3T B;  1B64 A;  2ZIT A;  2DNN A;  5DZ6 A;  3EGZ A;  1DAX A;  4F25 A;  1TEL A;  1M5O C;  3OXG A;  3ZO7 A;  4OQJ A;  2QZ8 A;  4Y2C A;  3JTP A;  3ZTS A;  4ANE A;  2RE1 A;  1DQ8 A;  1YJU A;  2X1B A;  4M5M A;  2PT0 A;  3LAM A;  4FNH A;  2W2M P;  1ZAX A;  5ETR A;  3CCR S;  3V2U C;  3K89 A;  2PO4 A;  4J9V A;  1HHT P;  3OR2 A;  1IBL F;  1NJX A;  2MZT A;  2JLG A;  1VRU B;  3PYD A;  3POT A;  2E44 A;  5EHH A;  1E6Y A;  3PX4 A;  3FDS A;  1KVI A;  3IBF B;  1VIS A;  7FD1 A;  4OYM A;  2V4Q A;  4DPW A;  1RA7 A;  2D3U A;  1FNX H;  4L75 A;  4M5D A;  1U26 A;  4JI5 F;  4DLG A;  1C1B A;  1SQE A;  5ETT A;  3GMG A;  4IFV A;  2XY6 A;  3P45 B;  1P1T A;  3OTO J;  5J2M B;  4HH0 A;  4WKR A;  3AOD A;  4NWB A;  2UXD F;  3PIP Q;  4B3T J;  3T1Y F;  4RL1 A;  3LUY A;  1V3Z A;  2G1D A;  3GIM A;  2G0I A;  1JXL A;  3DLG B;  2X3D A;  2G0J A;  4FF3 A;  4ECX A;  4QU6 A;  1WI6 A;  3I0S B;  3AJ2 A;  1W26 A;  5DDQ C;  3KLF B;  3DDI A;  4ZCI A;  2X1F A;  3AD7 C;  4WXO A;  4DZ6 A;  5EX3 A;  3ZZO A;  4NXM J;  2ZH5 A;  4QR1 A;  2EI5 A;  4ZVG A;  4OZ3 A;  2E1P A;  3IFE A;  2VC1 A;  1KLM A;  8ATC B;  1H98 A;  4C98 A;  1PSD A;  2U1A A;  1R6Y A;  4F2S A;  4EUV A;  3QJL A;  1SH2 A;  3J7Y U;  4NA2 A;  3ILI A;  2F8M A;  3SFU A;  5E3A A;  1G1X A;  3DOL B;  2LCW A;  3JQM A;  4L74 A;  3DOM B;  4DSF A;  3IRW P;  2OGU A;  5HRO B;  2CNK B;  1LWE B;  1RT4 B;  3OTC A;  1UJ4 A;  1IM4 A;  5I3U A;  1WI8 A;  4I56 A;  1LWX A;  4LSZ B;  1APS A;  5KOW A;  2CPZ A;  4F0H A;  3D9B A;  2E5L J;  1IBK J;  1WKJ A;  3OL7 A;  4ER8 A;  2L9D A;  3NCQ A;  4JI8 J;  2JL9 A;  1F6T A;  1TL7 A;  4BS2 A;  2Y1R I;  4EGL A;  2RS2 A;  3MMA A;  4DS4 A;  4JYA F;  3JTO A;  4H4M A;  1ITP A;  4U7U K;  5DM6 Q;  2V8P A;  3GV8 B;  4HTI A;  3MAA A;  2N3L A;  1A7G E;  3KLE A;  2ZZN A;  1MWQ A;  1U48 A;  4ZKA A;  1N33 F;  2RB7 A;  4M5G A;  2C2R A;  2BVZ A;  2OUG A;  4AL5 A;  3CTR A;  1TUG B;  4RU2 A;  1LEO A;  1VRT A;  4LR7 A;  3BPD A;  2VZ9 A;  5C7P A;  2W2Q P;  3FCW A;  2XSJ A;  4PZV A;  2H4Y B;  1JQG A;  3GU0 A;  2XZW A;  3GTY X;  4NZ6 A;  2APO A;  4PG7 A;  5KAK A;  3VWS A;  4IFY A;  4NYO A;  2J0W A;  2IVY A;  4WTY A;  5HL7 Q;  2FGO A;  1X9S A;  3MED B;  2AU0 A;  2GNK A;  3CUN A;  4YDX A;  2EG1 A;  2WOM A;  1U24 A;  3ZZT A;  1RAJ A;  2NLW A;  2YKP A;  3U1L A;  4FYY B;  2MMY A;  4ZMM A;  2DIS A;  1NHU A;  3M6U A;  4KO0 A;  2ZNZ A;  1VC5 A;  3SXL A;  2LVW A;  3JYT A;  1S79 A;  4CLU A;  3R5A A;  1X60 A;  5DS7 A;  3QJJ A;  2R7S A;  3I82 A;  1WF0 A;  5GAH I;  1GEH A;  4PYA A;  3CW2 C;  2MTL A;  1W7W A;  2I5J A;  4RW6 A;  2B6A B;  1V5V A;  1AFJ A;  3GYN A;  1HNW J;  1VQN S;  2FJB B;  5H9E J;  3R5D A;  5HVF A;  3ULH A;  2PA3 A;  5C42 B;  3EWG A;  2LQ8 A;  2LEA A;  1R0A B;  3CNQ P;  1FDB A;  1NSP A;  5CXT A;  2DGS A;  4A8S A;  4WZM A;  2XMT A;  3K5N A;  1TR0 A;  1UVN A;  2EFP A;  5B08 A;  5DG7 A;  5AXL A;  4U7C A;  4J90 A;  1RAA B;  2M4M A;  2YKN A;  4DSI A;  4TNO A;  2ZOM A;  3CCM S;  3AB4 B;  2H54 B;  4MYU A;  1X5S A;  1WKL A;  1HW8 A;  1ZAW A;  4GKK F;  4RLE A;  3DLB A;  1MG7 A;  2DR8 A;  3KLG A;  2VG7 A;  3QFW A;  3CCU S;  3GQC A;  3QLH B;  3GCX P;  3D6F B;  2A6M A;  5BYQ A;  4IDK B;  4RW7 B;  4ECS A;  2HZA A;  5D15 A;  4WIQ A;  2NPI A;  4JI2 J;  3IWX A;  1W25 A;  4DR3 J;  4ZHR B;  4P2M A;  5I3P A;  1B0T A;  2OPP A;  3V4I B;  3CC7 S;  3B4D A;  3KK2 A;  2IFX A;  3C66 A;  1TL1 B;  4J9N A;  1EET B;  1V5I B;  1FRM A;  4ETX A;  2YXL A;  5KT7 A;  3UCZ P;  4IH7 A;  5HN0 A;  3RYL A;  1RJJ A;  2UUT A;  4A8Q A;  4Y28 C;  4MK7 A;  2JVO A;  2BA9 A;  3D2W A;  2UUA F;  2MHN A;  2ADB A;  1VHF A;  3P8B B;  4OZL A;  4CLY A;  4DV7 J;  4EI2 A;  1LWC A;  4AT1 B;  4C8L A;  1Y5L B;  1WG1 A;  2QC3 A;  1HQE B;  3NGR A;  3TEG A;  3F56 A;  1SJF A;  3HHL C;  3UVJ B;  4O3N A;  4DV6 F;  3I0R B;  1SKR A;  4RUH A;  3US5 A;  2J7U A;  4DL4 A;  2XMW A;  3HZG A;  3W5X A;  5IWA J;  4N5S A;  1XMB A;  3KK3 A;  3T5H A;  2XGQ A;  5KFM A;  1Q5Y A;  2E9Z A;  4LFA F;  1IKW B;  2SXL A;  4YY3 J;  2CZ9 A;  2EWH A;  1KVJ A;  2BW2 A;  1HIY A;  3KMQ A;  5FDL A;  4J9P A;  2UP1 A;  5KFF A;  3L7U A;  3T5J A;  2DT9 A;  2G9O A;  4UST A;  1QSY A;  4R8U B;  2KG0 A;  1RTI B;  4CO5 A;  4IO1 A;  2IRX A;  1G7C B;  4OFZ A;  4FF4 A;  2R8J A;  3U27 A;  1FXL A;  4CDI A;  1FTR A;  1S0V A;  1KDN A;  4DF4 A;  2MYF A;  3OLB A;  2UXB J;  2ZBC A;  3TJA A;  2F4V J;  4I6W A;  4PWD A;  3QAE A;  2MKC A;  4JI6 J;  2E5G A;  1S6P B;  3PXG a;  2YNG B;  5EUH A;  3W2V A;  2A18 A;  1YJ7 A;  2DJW A;  3E51 A;  4ZVE A;  3PCO B;  4ZP9 A;  3CJK A;  2VOO A;  1OPZ A;  1RHJ B;  3PY8 A;  1Q82 T;  4PCQ A;  3C3L A;  2V2Z A;  1RI7 A;  3D54 A;  1H38 A;  1PAE X;  2UUW A;  4XO0 A;  1CUL A;  2KZZ A;  3DOM A;  3H5X A;  1UW4 A;  5HRO A;  2VG5 B;  1QVF R;  2VKZ G;  1K73 T;  4KB7 A;  4NLR A;  2MQN A;  3MI7 X;  5IM0 B;  1S6Q B;  3FSI A;  5ETM A;  4URS A;  1BE4 A;  3M32 A;  5FLX U;  1VQ7 S;  3Q8V A;  1I94 F;  4F0M A;  2VC0 A;  4KPC A;  3UO0 A;  4MIW A;  4F2R A;  2YKM A;  3UN2 A;  4DDF A;  2LEP A;  1X4G A;  1HKA A;  1WWH A;  2FVR A;  1UAW A;  1XMQ F;  1Y5N B;  3Q2S C;  4X4V A;  1S57 A;  5B0E A;  1RWV B;  3G87 A;  1QY7 A;  4WFN Q;  1P1L A;  2HMI B;  3UCU P;  4DR6 J;  2OLW A;  2B8Q A;  3H5Y A;  1FO1 A;  3H5U A;  1KHV A;  3BSO A;  1GMW A;  4Q8F A;  3T19 A;  4U96 A;  4K5R A;  1UEK A;  4B3S F;  4J9S A;  3C15 B;  4ZCM A;  3C19 A;  5LMN J;  3PAC A;  5BR8 J;  4ICL B;  2YH0 A;  3VVT A;  2WVC A;  5L9X A;  4IQM A;  3D0H E;  2YTC A;  3JSB A;  4CNZ A;  2R7R A;  4MIB A;  2RKI A;  2FJE B;  2BAN B;  2R9L A;  2LMI A;  1R0C B;  4ELU A;  3LGM A;  2E7W A;  1FKO A;  2P9G A;  3AFG A;  1KLN A;  4J9O A;  3ZZY A;  3FBB A;  3G6X A;  4FF2 A;  4O23 A;  3HF5 A;  2E1A A;  1FF2 A;  3I9V 9;  4KGX B;  2PI5 A;  3LP1 B;  2DB1 A;  1P8G A;  2IJN A;  1S99 A;  4NEZ A;  4J7C A;  1FDN A;  4F04 B;  3AHP A;  2XMM A;  3TO8 A;  2KRR A;  1H2T Z;  1VJW A;  3NGD A;  3EGV A;  3BO4 A;  3BQ1 A;  2PD1 A;  3W8P A;  2B43 A;  3K8V A;  2GIQ A;  4ECZ A;  2IY5 B;  2IAJ B;  2WSC C;  2ROE A;  3UDE A;  5KFN A;  4C0H A;  4KRW A;  4ZOS A;  2MLZ A;  2WON A;  1C4A A;  4LF4 J;  4HDH A;  3V4M A;  4IKA A;  4C8Z A;  3KG0 A;  1S1V B;  4EZ9 A;  1JLG B;  4FXV A;  3KTQ A;  4K4X A;  4DUZ F;  1KS2 A;  3I56 S;  3FC9 A;  2E5H A;  2L3M A;  3D4J A;  1WOR A;  2K7K A;  1FXD A;  4ETZ A;  4YR0 A;  5A2Q Y;  5J1E B;  3RAX A;  1NKC A;  2IM2 A;  1G6B A;  1YQH A;  3UNG C;  3UW1 A;  3MCN A;  4DLE A;  4ED7 A;  2KO1 A;  4RW7 A;  2HRU A;  2VQF J;  2GHP A;  5E3C A;  1DJ0 A;  2CQB A;  1RTD A;  2KU7 A;  1HWJ A;  3DKD A;  2GIR A;  1S1T B;  1YRT A;  4CLF A;  1HMV B;  2U2F A;  2J9D A;  2IHR 1;  3A13 A;  4N8N A;  1YBT A;  3TA0 A;  1RU1 A;  3GFZ A;  2GX8 A;  3CCW A;  3NBP B;  1YLX A;  2OPQ B;  1S9G A;  4DSJ A;  4UZB A;  4G65 A;  5L1J A;  3I87 A;  3LAN A;  1UWB A;  2WW8 A;  1KQF B;  3MPY A;  2FHM A;  2B9Y A;  1HBM B;  2HS3 A;  2UVU A;  1VQ9 S;  2NUH A;  4WBF A;  3BO2 A;  4C0O C;  3WHI A;  3B4M A;  4KV8 B;  4LUB A;  1G3O A;  2JSX A;  3W65 A;  3MEK A;  5KFO A;  3C14 B;  4TLQ A;  3M2R B;  1QD1 A;  1D8Z A;  2BJD A;  1JNZ B;  2ZBR A;  1NJI T;  2LDY A;  2ZBP A;  1JLQ B;  3NNA A;  1NDC A;  1E6V B;  3BQ0 A;  3HSJ A;  2VA3 A;  1MW7 A;  1Y9O A;  5L9N A;  4GRS A;  2AT1 B;  2VD3 A;  4KBI A;  3AOB A;  5ETO A;  1YWX A;  4ECY A;  1N34 J;  2XMU A;  1UEU A;  3NAH A;  3U02 A;  2FY1 A;  5EWF A;  2CIM A;  5KTQ A;  5J2N A;  1W2I A;  2ZUG A;  4ZVQ B;  4IUF A;  4IH6 A;  2GVZ B;  3FQL A;  4USH A;  5H9F K;  3CD7 A;  5DLF A;  2MKJ A;  2VFV A;  2ZZT A;  2RS8 A;  3MM7 B;  4X65 J;  3CDB A;  1OYD A;  1D09 B;  4GKJ J;  2HK3 A;  2DH7 A;  4QIV A;  4K4W A;  2J9C A;  1VBZ A;  1ULR A;  3M8W A;  3OUY A;  4R25 A;  2LQ5 A;  1IR1 A;  2V2Q A;  2D9O A;  2G0C A;  4QCL A;  3R1H A;  4DWI A;  1X4D A;  2JNJ A;  1LOU A;  4KR0 B;  1SI9 A;  3W63 A;  2Z2M A;  1LWF A;  3JTN A;  4UUW A;  1YK9 A;  3T41 A;  3KYL A;  1SKU B;  1FNO A;  2RNE A;  2LXF A;  3OL6 A;  2B4P A;  4ECU A;  2MPU A;  2BMB A;  1LK7 A;  5IT0 A;  1O0P A;  2RQM A;  2MY7 A;  2MZR A;  1URR A;  4QPX A;  3D6T B;  1GXL A;  2J7K A;  1HNZ J;  2J6U A;  5KFU A;  4AE5 A;  2QMW A;  4AQY F;  5K20 B;  1F5B A;  1Q0N A;  1WC0 A;  1TL3 A;  3VZH A;  1WEZ A;  4J9U E;  3OJS A;  2F7V A;  3SZ2 A;  2CPD A;  2ASL A;  2WSF C;  4DSL A;  3MM9 A;  4RJV A;  2MEW A;  4PUO B;  2HND B;  3HJV A;  2R4F A;  3I55 S;  4L3K A;  1LW2 A;  5KG0 A;  3MOJ B;  2L41 A;  5AXK A;  1RBA A;  3OL8 A;  2MQM A;  2E29 A;  1YZ6 A;  4M5H A;  4RNH A;  4L6V 3;  3BN7 A;  3QSI A;  1FX4 A;  1KFS A;  5GAD U;  4PXB A;  2GO9 A;  2VPY B;  2AJ0 A;  4Q2L A;  3D1Q A;  2CPH A;  2P8I A;  4HAC A;  1HHS A;  1RAI B;  1RYS A;  5KFQ A;  3IG1 B;  2F3J A;  4TQR A;  2XCA A;  1WDT A;  3UD3 P;  3M7V A;  1N5Y A;  1TK8 A;  2HMI A;  3S8S A;  4OHZ A;  3CDA A;  1A0O B;  2AD9 A;  3PJ9 A;  3KHH A;  4A8M P;  4X4R A;  4ZJQ A;  1F2H A;  3MPW A;  2ADC A;  3LW5 C;  2D41 A;  1R3N A;  2UU9 F;  3UE2 A;  2YX4 A;  5F41 A;  3DOK A;  3DI6 A;  3DLK A;  3SSR A;  5KT3 A;  3SCJ E;  2WRM A;  2QYC A;  2Y1L B;  2ZJQ Q;  3PTW A;  3VCD A;  5J2Q A;  1KQG B;  3N6M A;  2BAN A;  1YG0 A;  2IRU A;  2ZFH A;  1HBO A;  4JI7 J;  4LF7 J;  5HQM A;  4RW4 B;  2GZO A;  3N5B A;  1PO6 A;  3ITH A;  2D9P A;  5MAO A;  1X4F A;  4KYZ A;  2I8E A;  2FHK A;  1SC6 A;  2QX0 A;  4LRF A;  4WP3 A;  2OPS B;  3OTB A;  4DUT A;  2YWE A;  2F5G A;  1RWX B;  2MKY A;  2Q6C A;  5KFD A;  1WHY A;  1KQK A;  1MLA A;  2IJR A;  1TTH B;  3B82 A;  5JVH Q;  4F3O A;  4KY3 A;  1KEK A;  2GJ2 A;  2WW4 A;  4RBT A;  1XJW B;  2R7V A;  4IG0 A;  5A0Y B;  2JLF A;  4A8W A;  1S77 D;  5HQL A;  1VDH A;  4AFF A;  1UZD A;  1FE4 A;  4IRD A;  2GV1 A;  1NPK A;  4F4X A;  3DDN A;  3BKT A;  2IRY A;  2H9Z A;  1GX5 A;  3AOC A;  3LAK A;  3MEC A;  5H9E K;  4OYP A;  2V68 A;  2FGC A;  1S1V A;  1S4F A;  1N0V C;  3UWT A;  4Y0F A;  3TAQ A;  3PVX A;  1CJT A;  2MKK A;  2YWG A;  2KXN B;  3WX8 A;  3GV7 B;  3RB0 A;  3A3O B;  2ZOG A;  2JOQ A;  3M8P B;  4NE9 C;  3R5C A;  2AJ2 A;  5D78 A;  4OYI A;  1WF2 A;  4WU3 A;  1PG5 B;  4LF5 F;  5CZV A;  4NLT A;  2V2K A;  3W9H A;  4Y65 A;  4C11 A;  3TQE A;  1QAJ A;  2W9A A;  5GVQ A;  2UXD J;  2OFH X;  2O67 A;  3A1Y G;  3T1Y J;  4BCA A;  1FXR A;  3CED A;  1OS5 A;  4FNI A;  3L09 A;  2B4U A;  4WXW A;  5ETV A;  4PXE A;  3EVO A;  3CJ2 A;  4I69 A;  8RUC A;  2B4O A;  2XS2 A;  3G82 B;  2XNQ A;  2BJ9 A;  3FSY A;  4RNN A;  2P6S A;  2O01 C;  3PZP A;  1DRZ A;  1LK5 A;  2W9C B;  3GSI A;  1RT2 B;  4NI2 B;  3V6H A;  3SEO A;  4B3M J;  1KSP A;  3A3N B;  3I5B A;  1MMN A;  3KXD A;  2VG6 B;  2OD6 A;  2XB2 D;  1HQU B;  1H7X A;  4DV4 F;  5F8J A;  1EQ0 A;  5HJY A;  1L3U A;  1S0O A;  4DQI A;  3N6L A;  4NLX A;  1RCX B;  4JYA J;  4YB6 A;  3Q8S B;  1IQZ A;  3H8Y A;  2WZ1 A;  1U1N A;  4JI1 F;  1KN6 A;  2ASY A;  2RT3 A;  3M1V B;  2WVE A;  2KVQ E;  2HIY A;  2A3J A;  4K4V A;  3DGP B;  4GMK A;  5G4D A;  4JI0 J;  4QWD A;  1EZZ B;  2P9C A;  5HAO A;  1Q4R A;  3Q86 A;  1OJ4 A;  1FDA A;  5B09 A;  4JV5 J;  1RTH A;  5GME A;  2PDA A;  3IMQ J;  3IAS 9;  4PG5 A;  1HNX J;  4DZD A;  4X2B A;  5KG4 A;  3BV8 A;  2NZC A;  1UET A;  3MCM A;  3R8Y A;  2BE9 B;  1REG X;  1FWL A;  4ITS A;  4LR9 A;  1OMS A;  3WIU A;  3BGR A;  4YUD A;  3W3S A;  4OI0 A;  1U7L A;  3H5S A;  1JXE A;  3BM7 A;  2PMW A;  4NCG A;  4IG3 A;  1HWK A;  2HND A;  3UR0 A;  1NSA A;  3TUZ C;  4UY8 5;  3HI9 A;  4QWC A;  3HVT B;  2R7O A;  5ETL A;  3EPI A;  2R7T A;  3JB9 k;  3DYA B;  2LA4 A;  2LEB A;  2E66 A;  2D7S A;  3NOC A;  5G0R B;  2YKQ A;  5L46 A;  2KI2 A;  5GAG I;  2DTJ A;  3GIR A;  4KGK A;  1K1S A;  4MMO A;  3G8S A;  5B0A A;  2UVR A;  4F02 A;  4NXN F;  2QTW A;  2HVI A;  5CCL A;  1UW9 A;  2HS4 A;  3PJW A;  2IBK A;  1JJ2 R;  2RSQ A;  2Y9H A;  2HNZ B;  3T6J A;  3MMC B;  4G1Q B;  3B78 A;  3W2W B;  4NA3 A;  4CM2 A;  1SL2 A;  2IIH A;  3NS6 A;  1AW0 A;  2C2M B;  5MLC V;  2XWY A;  2Z57 B;  2V63 A;  5K8O A;  2YQ3 A;  4UQT A;  3CJS A;  2OHD A;  3LP0 B;  4FKY A;  1IBM F;  3M8S A;  1M1G A;  1TU0 B;  2DNG A;  2ILY A;  3TWZ A;  3OTE A;  2KT2 A;  2EFO A;  3G6V A;  2NXC A;  3OTD A;  4ID5 B;  4GKK J;  4LF6 J;  1N88 A;  1PIE A;  3AAW B;  1H72 C;  1DY3 A;  3E3X A;  1W2B R;  4RUB A;  2QEX S;  1RT5 B;  2KVI A;  4RW4 A;  4Y2M A;  1Y7P A;  5LMU F;  4ZDN A;  1UKU A;  1CQN A;  2QMX A;  2OFG X;  1MSW D;  1VQM S;  2AIR B;  1NDL A;  5HQ8 A;  4MAK A;  2LYV A;  1R8A A;  3MZI A;  3PFO A;  2DNR A;  1U2R A;  2IM1 A;  1U0H A;  1DAR A;  4O0N A;  4FP9 A;  4WYW A;  3R5G A;  4M5K A;  5D3G B;  4WCE Q;  1KC8 T;  4U9R A;  1UVL A;  2F65 A;  5F8H A;  1SV5 A;  4HHU A;  2AZ1 A;  2DH9 A;  2V8D A;  4ZIT A;  2OSQ A;  1X7V A;  2CG4 A;  4DV6 J;  3TX0 A;  4XTT A;  3OFE A;  2ZM6 F;  3PO4 A;  5JUM A;  1J5O B;  3Q22 A;  1DUR A;  1BD6 A;  2XNR A;  3K2Y A;  4AUK A;  1EIY B;  2M52 A;  2CWX A;  4LFA J;  5C5J A;  3QRP A;  1TK0 A;  1VQY A;  3BB5 A;  4NLW A;  4BLG A;  1DTQ B;  1T03 B;  2O1P A;  3Q89 A;  1O51 A;  1VGY A;  2AZ3 A;  4DCP B;  4A8Y A;  4KHM A;  4C4W A;  1O5J A;  4ZIV A;  3TP2 A;  2YX1 A;  4K2X A;  3D68 A;  2JH3 A;  4B08 A;  4IQX A;  4UUX A;  4M5I A;  1Q1K A;  1YDL A;  4TY8 B;  2MGZ B;  1U6B A;  1DZ5 A;  3W66 A;  3ZZP A;  4QJV A;  5J1N A;  2JDJ A;  1JLF A;  2YKA A;  4AXJ A;  3C6T A;  1RHQ B;  3S6E A;  2BE7 D;  3HDS A;  2QGF B;  2FPH X;  1WNE A;  3EDR B;  2GMJ A;  1Q86 T;  4CTA B;  3MWB A;  2CQ4 A;  4JB8 B;  4J91 A;  1UVJ A;  3BBB A;  2BR0 A;  4JI4 J;  3WIV A;  4MK8 A;  5CYM A;  2NCK L;  3KJV B;  2M9K A;  3DRR B;  3BGF A;  2XS5 A;  3JXO A;  3OSP A;  3D28 A;  2XBP A;  3H42 A;  1EKS A;  5DG8 A;  4IO9 Q;  3QT8 A;  5KFB A;  3NKY A;  2QN6 B;  2RQK A;  4KPY A;  1Q7L B;  4DL0 C;  1XR6 A;  3WC0 A;  2E5I A;  1HNV A;  1TKX A;  4C48 A;  1CJK B;  2GMH A;  4V19 X;  5T7L A;  2CAD A;  2RH3 A;  1OO0 B;  5KFR A;  1HQU A;  3LPY A;  3WDO A;  1K1Q A;  2WAQ D;  1OYE A;  3LOU A;  2C42 A;  1BUX A;  1QVG R;  4QWA A;  1I94 J;  3FFI B;  4XAK A;  4KH1 B;  4UOC A;  2MQP A;  1RT7 A;  1FEH A;  4JOU A;  2ZBQ A;  4Z37 A;  2JEI A;  4ZN3 A;  1PJ7 A;  4XIU A;  2V34 A;  2RHS B;  1S1U A;  3HFK A;  2IMO A;  5EDW A;  5KFP A;  5DDP C;  4USK A;  2MST A;  2K06 A;  1ZZN A;  2RIL A;  2MQQ A;  1D9F A;  2CQ1 A;  3G6Y A;  1D8Y A;  3C46 A;  2RRB A;  1RU2 A;  3N0V A;  5DQH A;  4DV0 F;  4IOA Q;  3EGW B;  3Q8U A;  4YHH F;  4PWW A;  4MYT A;  1OY9 A;  2AX1 A;  3HHL D;  3PW7 A;  3FCH A;  2Z4P A;  3DLE B;  2BX6 A;  2YX7 A;  4ZVT B;  4WPA A;  3P49 B;  4QW8 A;  1QTM A;  2Q6B A;  2VIH A;  1F60 B;  4F4K A;  1NUE A;  2XO7 A;  2UVW A;  3KLH A;  2DK2 A;  2ALZ A;  4HVZ A;  2V50 A;  2AYG A;  3DMJ B;  2L48 A;  1P6T A;  3BGU A;  1J5E J;  1X0P A;  3HHL B;  4G6V B;  4ZPV R;  2HFS A;  2C28 A;  3M8Z A;  4L72 B;  2AJF E;  3OR1 A;  4RPF A;  1NZ8 A;  1RT3 B;  2CXE A;  1UFW A;  4WE1 B;  1RP5 A;  4TU7 A;  1FRL A;  1KON A;  2V5H G;  1ZBT A;  2HLT A;  3DRP B;  2VJV A;  3Q8Y A;  2J7W A;  3QO9 A;  1NDP A;  1GX6 A;  4KGV B;  1KOH A;  2ZH6 A;  4EU0 A;  5LSO A;  4A4J A;  4WP9 A;  2DGO A;  4RNM A;  3TZY A;  1N6Q A;  3BH6 B;  3KLI A;  1QTN B;  3MEE B;  2UXC F;  1UA1 A;  2WVD A;  1RHR B;  1YJT A;  1KTQ A;  3HX9 A;  1RTZ A;  4O4G A;  5CD4 A;  2CZ4 A;  2GQC A;  1ZTW A;  1HR0 F;  2YWH A;  3HP6 A;  1FRK A;  4DUZ J;  1U1K A;  2B5J B;  3HHN B;  3K8W A;  5IV4 A;  1F3V A;  4PQU B;  3V6D A;  2W25 A;  5HLF B;  5ETN A;  1FE0 A;  4PQA A;  1VIX A;  4KIA A;  3SQG A;  1IKY B;  1Z2L A;  1BMQ B;  2DR6 A;  2CWK A;  4DCO B;  1C0T A;  2KKH A;  1M5V C;  2GGP B;  2YNF B;  4JP8 A;  3IWN C;  2VQE J;  3QJP A;  1RT6 B;  4DFJ A;  4TQS A;  2QSW A;  4X66 F;  1RB0 A;  2LQJ A;  2N4D A;  1N36 F;  1FK9 A;  3JSM B;  5CA5 A;  4L3N A;  3KOA A;  2UUB J;  2OSR A;  4PXC A;  2XI2 A;  1R6V A;  1HD1 A;  4UQG A;  3G8T A;  1NEE A;  1YRU A;  5HP1 B;  4HR2 A;  4HT5 A;  5K8N A;  4J9L A;  1QAI A;  2HHT A;  3QAT A;  3M30 A;  2F8E X;  4USI A;  2FD2 A;  2HQ3 A;  3IWL A;  1T9T A;  4QPT A;  4CNY A;  2JFD A;  4NYZ A;  4FS2 A;  1AZS B;  1ACM B;  1RHK B;  4E2F B;  1KRP A;  3K5M A;  4U7U D;  3SSQ A;  2Y1I A;  2BZ2 A;  1FCA A;  1ZM4 A;  4OZJ A;  3AXM A;  3EDQ B;  1NM2 A;  4JUZ A;  1XTZ A;  4EMD A;  2MLX A;  4OIX A;  2XYP B;  2I2Y A;  5LT5 A;  2HBY B;  3D0G E;  3VAL A;  3RJM B;  5ETS A;  2JEG A;  4KAI A;  1RT1 A;  2QSF A;  1FKA F;  1C0U B;  2OEL A;  2DKO B;  2J9E A;  1FER A;  2EBG A;  2HWI A;  2NXE A;  2JZ5 A;  4YS2 A;  2HBQ B;  4OX9 F;  2AJ4 A;  1DTQ A;  2R42 A;  4EEY A;  4CCH A;  3K5P A;  2PMH A;  2ZKT A;  2BE2 B;  2RHQ B;  3CCZ A;  1KP6 A;  1B4S A;  5E3P A;  1BQM A;  3KG4 A;  3I4P A;  1NHV A;  3RAQ A;  2XY5 A;  2FJA B;  1M5S A;  4QIG A;  4ZIW A;  3MR6 A;  2I6W A;  2HQD A;  1Z1Z A;  5C24 A;  3G71 S;  3QBC A;  4IRC A;  5ETP A;  4B9N A;  4DPX A;  2E1R A;  4FPI A;  4K4U A;  2IM0 A;  2VBX A;  3P96 A;  4DFM A;  2D1C A;  3TR5 A;  4CTA A;  2QLJ B;  1IKX A;  3TAP A;  1YRX A;  4WTO B;  2KHC A;  4ILR A;  5CAA A;  1SXL A;  4F4W A;  1HNI B;  4NLG A;  3ZZR A;  1PC4 A;  3OR2 B;  4OV6 A;  5B0G A;  4DV3 F;  3POT B;  2BDP A;  3EGN A;  5CQG A;  1CPZ A;  4DX6 A;  1E6Y B;  4ELV A;  5HBM A;  1VHI A;  2MB0 B;  5D6G A;  4AQY J;  1S9E A;  4NAS A;  1ZOT A;  3LGH A;  1VRQ C;  2BRK A;  3ILL A;  3LP2 B;  4M5D B;  2AKW B;  1JLA A;  3CWJ A;  5DDO C;  1WUU A;  1C1B B;  2V9K A;  1XR5 A;  4B9S A;  1X5O A;  4O3R A;  2C2K B;  2NUU G;  3VV2 B;  4BDP A;  2CUY A;  4O4R A;  3SMZ A;  3QPI A;  2KZM A;  4RO0 A;  4FVM A;  1EHW A;  1XNR F;  2OTJ S;  3AJD A;  2IDE A;  4V19 J;  1PJ5 A;  3U7J A;  4HT7 A;  5T41 A;  2AEJ A;  3GSD A;  4XPE A;  2E1C A;  1C2P A;  3P5B P;  3OV7 A;  5LSL A;  1FVS A;  4QWB A;  1YI2 S;  3QSY B;  1UFL A;  6FDR A;  2XCP A;  4Y2I A;  1MU2 A;  2R2U A;  1GK8 A;  3X1L B;  2R8H A;  1U0S A;  2HPU A;  1IR2 A;  4LSL A;  3N5F A;  3OW2 R;  3CDW A;  2MHE A;  3W64 A;  3SCL E;  3D7S B;  2MKH A;  1OSC A;  3A8E A;  3M2V A;  2COL A;  1NLK L;  1VOM A;  3W5Z A;  1FTC A;  2BAC A;  1IKV A;  1UVK A;  4P6Q A;  4EYH B;  3M2U A;  3GLJ A;  4H4K C;  3CMA S;  3PV8 A;  2HHU A;  5LXY A;  1FI4 A;  5B0B A;  4PRF A;  4Y2K A;  5I3U B;  2OI2 A;  2VOP A;  3QGG A;  4W98 A;  5JMN A;  4X62 F;  3CJ5 A;  3MM5 A;  4F0K A;  3EZ5 A;  3FNN A;  1I6J A;  4FXW A;  1HA1 A;  1TL7 B;  3DM2 B;  1F5C A;  3BO3 A;  4ZPD A;  3SBM A;  3MMA B;  4H4M B;  2YY3 A;  3CJ3 A;  3CVK A;  4DFP A;  1RWP B;  3MAA B;  2CQ3 A;  4P73 A;  2XTJ P; 
#chains in the Genus database with same CATH homology
 1NHK L;  3Q89 A;  4KPC A;  3BBF A;  3EM1 A;  1LEO A;  3FBB A;  2B8P A;  2AZ3 A;  1MN7 A;  4DI6 A;  1HHQ A;  1B99 A;  3NGU A;  1KDN A;  1NPK A;  1S59 A;  3BBC A;  3EVM A;  5C7P A;  3FCW A;  2DXD A;  3FCV A;  3GPA A;  5CAA A;  1NCL A;  3B6B A;  3R9L A;  3EIC A;  4UOH A;  1BUX A;  3EVW A;  3ELH A;  3BH7 B;  1NDL A;  1NSP A;  1F3F A;  3B54 A;  1WKK A;  2CWK A;  4F4A A;  2DY9 A;  1S57 A;  3ETM A;  1ZS6 A;  2ZUA A;  4UOG A;  1XQI A;  3ZTO A;  3DKD A;  1NLK L;  3EMT A;  4O0N A;  4C6A A;  3FBF A;  3NGR A;  3ZTP A;  2DXE A;  3MPD A;  3WX8 A;  1VYA A;  2B8Q A;  4CP5 A;  5IOL A;  2HVD A;  2DYA A;  1LWX A;  3Q86 A;  3VGS A;  4EK2 A;  3VGT A;  1WKL A;  3Q8Y A;  1K44 A;  5CAB A;  1NDP A;  1U8W A;  1UCN A;  3FBC A;  1WKJ A;  1NSQ A;  1BHN A;  3GP9 A;  3FKB A;  4ANC A;  2AZ1 A;  4FKY A;  1B4S A;  1F6T A;  1NB2 A;  3BBB A;  2BEF A;  4AND A;  1NDK A;  3PRV A;  1S5Z A;  1PKU A;  2NCK L;  2HVE A;  3FBE A;  3ZTR A;  3ENA A;  4DUT A;  4HR2 A;  5BXI A;  1PAE X;  4W98 A;  3NGT A;  1HLW A;  3NGS A;  3Q8U A;  3JS9 A;  4WBF A;  3EJM A;  3ZTQ A;  4ANE A;  3ZTS A;  3BH6 B;  1HIY A;  1XIQ A;  3VVT A;  3DDI A;  1JXV A;  4S0M A;  3FC9 A;  1EHW A;  2DXF A;  2HUR A;  4FKX A;  4UOF A;  4F36 A;  2BX6 A;  1NSK L;  3L7U A;  3EVO A;  3PJ9 A;  3VGV A;  4DZ6 A;  1W7W A;  3G2X A;  3VVU A;  1NUE A;  1BE4 A;  4ENO A;  3VGU A;  3EE3 A;  1MN9 A;  3Q8V A;  2VU5 A;  1NDC A;  3Q83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...