3FBBA

Crystal structure of the mimivirus ndk n62l-r107g double mutant complexed with udp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
133
structure length
133
Chain Sequence
AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
total genus 42
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3fbbA00
5BXIA 2AZ1A 1KDNA 3WX8A 3Q8UA 1U8WA 2CWKA 3EVMA 3FCWA 2DXEA 4S0MA 1S59A 3VGUA 3VGSA 4ANCA 1NLKL 3FBEA 3Q8YA 1NDCA 3B54A 3ZTQA 1F6TA 2VU5A 3GPAA 1WKLA 1K44A 3Q86A 3BBBA 3DKDA 1HHQA 1WKKA 3ETMA 1W7WA 1HIYA 3FBBA 2ZUAA 3BBFA 1BE4A 3ENAA 3L7UA 4UOGA 1B4SA 3EE3A 3R9LA 3EVWA 3DDIA 3NGSA 1XIQA 3EJMA 4DUTA 2B8QA 4CP5A 1NSQA 1PKUA 3ZTOA 3ZTSA 3Q8VA 1XQIA 1HLWA 3FBCA 2DYAA 3FC9A 5CABA 4DI6A 3NGTA 4ANEA 3VVUA 3EM1A 1MN7A 4FKYA 1VYAA 4ANDA 1NHKL 2BEFA 3NGUA 4HR2A 5CAAA 3EMTA 4KPCA 1LEOA 2NCKL 4UOFA 4O0NA 2DXFA 4WBFA 1ZS6A 1B99A 3EICA 3PRVA 1PAEX 3ZTRA 3VVTA 1MN9A 1WKJA 4DZ6A 1NPKA 2B8PA 4F4AA 3G2XA 3FBFA 3VGVA 3BBCA 2AZ3A 3NGRA 1JXVA 1S5ZA 2HVEA 3VGTA 1F3FA 1NDPA 1NSPA 4UOHA 3EVOA 4EK2A 1S57A 3BH7B 4ENOA 1UCNA 5C7PA 4C6AA 1NUEA 2HURA 1EHWA 2BX6A 3ELHA 3JS9A 1NSKL 4W98A 4F36A 3B6BA 1BHNA 5IOLA 1NCLA 2DY9A 2HVDA 3FCVA 3PJ9A 1BUXA 1LWXA 3MPDA 3BH6B 3Q83A 3GP9A 3Q89A 2DXDA 1NDKA 1NDLA 4FKXA 3ZTPA 3FKBA 1NB2A
chains in the Genus database with same CATH superfamily
1E6VA 2VPWB 3Q8UA 1S9GA 1UVLA 4HKQA 1VI7A 4ZVUB 4FYDA 3UD5A 2HYIB 4UQGA 4TU8A 2JEIA 2UVRA 2AWZA 2VJUA 4ZVFA 2RU9A 2XSFA 1V9OA 2H9ZA 2KI2A 1VISA 4DV2F 2KN4A 2B3TB 5H9FJ 2HWHA 5HATA 3IR6B 2BKPA 3R5JB 2FVSA 2OD4A 1TK5A 3UW1A 1G3OA 4GVBA 2C2NA 5H9EJ 4F3OA 4OZNA 1SQGA 5DG9A 1X0FA 2ZBPA 1ZAWA 3MAAB 1H0HB 2EW9A 3D6HB 5KFOA 3PTWA 3RB6A 2M88A 3BGUA 4LBIA 4RW4B 2HQDA 4IDKA 1S6PB 3GE9A 3C6UA 1Q0NA 2Y0SD 5JVGQ 1XWLA 4K2XA 3GR0A 4K4ZA 1S76D 3BSAA 2DPIA 2CFXA 3GYNA 1S7IA 2XMTA 2FLNA 9ATCB 3MD3A 4PG5A 2BBEA 2VG7B 5E3CA 2VU5A 2H4YB 2YPZA 3DLGB 1RE1B 3DRPA 3P96A 4JV5J 4KV8A 2DNHA 1KNZA 5HVFA 2KT3A 2R7QA 4DUZF 4IRKA 4DV3J 3FUYA 3NRBA 2MQPA 3W61A 2V68A 4N8OA 2ZVSA 4PG4A 4IFVB 3KUGA 2GO9A 2V4JB 5D78A 2QT7A 1S0MA 3A8EA 2KHCA 4HACB 1J5OB 3CCWA 1S1UA 1W25A 3TX8A 3W2WA 4JI0J 1Q95G 1TL1B 2XMUA 3Q22A 3NGDA 4EUVA 1N33J 1CVJA 4HVZA 3FK4A 3MR3A 2BXJA 3PCOB 4JI7J 1QAJA 4ZPCA 4CTAB 4DV1F 2CQCA 3RAXA 4DF8A 4DV5J 2MZRA 2RVJA 3UNYA 2KRRA 1EP4A 1RT4A 4PQUB 1FKOB 4I2QB 2CVIA 5DM6Q 1YKWA 1KFSA 3HX9A 3EUNA 2OELA 1HI8A 3BSNA 1Y00A 2NUUG 1K0VA 1N6QA 2DXDA 5HMZA 5I3UA 2G2ZA 3GV7B 2XMMA 4QPXA 4RU9A 3MCMA 5CXTA 5GAGI 4IRDA 1T7PA 1U2CA 5KT5A 2JZ5A 2VA3A 4ZVSB 4X66J 3R3TA 1GXTA 2YKPA 2CQBA 4ZVHA 4CLUA 3UD3P 2GMLA 4JI4F 4DR7F 4DR5J 4RJVA 5DQIA 3V6JA 1SJQA 2DNOA 3W66A 1XQIA 3Q8SB 3GIMA 2YWWA 1FJ7A 5FJ4A 4CLLA 2XGPA 2KT5A 4PUOB 8AT1B 4LIWA 1R8CA 2MKYA 4EO6A 5H1SV 3MCOA 3V2UC 3IS9B 2J0WA 4F4AA 2M7SA 2AW0A 4ZPBA 4BCAA 2Y9HA 1HNZJ 4YY3F 1NUEA 3VHQA 1O0PA 3E2EA 3S8SA 2UXDJ 1IM4A 4KC5A 4NRUA 4O4GA 3PYEA 3R27A 1X5OA 3LO3A 2E1CA 4ZVQB 4I56A 2JLEA 3BN7A 3BKFA 3HSJA 4EEYA 2LXUA 2C3OA 5KFPA 4HI2A 4WU2A 4NXNF 4R0JA 1OYDA 3EVWA 3ZZZA 1AXQA 3D4JA 1HWJA 4DBQA 1HI0P 3IGNA 2CIMA 3HPOA 3WIUA 2AJ4A 3DOLB 2I5JA 4WP9A 4C97A 2LEPA 1OSCA 3VZHA 2VL1A 3AJ1A 4OFZA 1U8SA 2EBEA 2FJVA 2CZ9A 4A8SA 1FRLA 3OTCA 1CJVA 1PAEX 1VQOS 2XHWA 4ALZA 2B8PA 2E7XA 1C1CB 3TZZA 3N6NA 2J0SD 3W2VA 4F4KA 3PKYA 1JXVA 3QFHA 2JHEA 1QVFR 2AYMA 1PCAA 1I5OB 4NLGA 2CDRB 3DOMB 1JJCB 3A13A 3ULHA 2D3O1 4LRBA 3PJXA 2ZH9A 3A8KA 4RW8A 2HK2A 2FYXA 2V6AA 1RAJA 3OT9A 2KL8A 4KRWA 2JNJA 3ISND 1S6QA 4YS2A 3FCHA 2B4VA 2DHXA 1T3NA 2BRKA 4KH0B 2XQCA 4Y2CA 3EZOA 2COLA 1TL7A 3HSDA 1IKYB 1KLMA 4IH7A 2J8SA 2R7UA 4XTTA 4ECZA 2JEGA 1M5OC 1TKZA 4IKAA 1K9MT 3HKZD 5HQLA 3I9V9 2VPYB 2AYBA 5KG2A 3QJLA 2AQ4A 5THWA 3GSIA 4A46A 3AJDA 3BJYA 2A0FB 3GFHA 3VCDA 2DNPA 2DNGA 1RLDA 2EFGA 3KJNB 2KZZA 4J9OA 1HPZB 4IUFA 4WFNQ 5KFQA 4WFXA 4DU8A 2KYXA 2DNYA 3Q83A 2WOMB 3THVA 1XMOJ 3N6MA 4OYBA 4H4MB 3T1HJ 4CLFA 4JI1J 1EZZB 1ZETA 2DXEA 4WFZA 1FXDA 3CCRS 2IVFB 3V6KA 1BWEA 1R27B 1PYSB 1UETA 4LF7F 1XR5A 3BB5A 3EZUA 1HW8A 1SUQB 5RUBA 3DM2B 1QUPA 3VZIA 2D7SA 2MGZA 4J9VA 3EDRB 1YZ7A 4DR6F 3UFCX 4ICLB 2Y8WA 4AQYF 2XNQA 4MIAA 3KFWX 1JLFB 4OHZA 5ETSA 2R8HA 1CC7A 2R8KA 2V34A 5F0UA 2A6OA 4LF5F 3ELHA 3HCXA 2NXUA 4PABA 1F6TA 3GPAA 2ZD1A 2XMVA 1R8BA 3QIPB 1RXOB 4DX8H 4JOUA 2HIQA 3J7YU 4B9SA 4NL5A 1S7HA 2R7SA 1R8AA 2J6UA 4L76A 4ER8A 2XHCA 1S9EA 2M3DA 4TYAA 2HFUA 4RWWA 4CCHA 3TVZA 2Z2ZA 2H5IB 4LF2A 1VR6A 2YNHB 2MQLA 2I1RA 4EBCA 3CE8A 1LK7A 1FVQA 3O44A 2KFZA 2LP4A 2LDYA 4DJBA 4JV2A 2VICA 3R8YA 2PGCA 2J0QD 3OR2A 4RW6B 4NLWA 4DL2A 2VFVA 1OYEA 2I8EA 2A2DA 3V6DB 4O3RA 3EICA 3PRVA 1GMUA 3QZ8A 2BUNA 5KT2A 1R0AB 1W26A 1BXNA 2CDQA 2AGOA 1WHWA 1JMTA 4HHJA 2LQBA 3CEDA 2NYIA 1RWNB 2Y3YA 3M8WA 1OPZA 5EUHA 2E9ZA 3W8GA 1X4CA 3D0IE 4OHWA 4ZCIA 3A4TA 3WX8A 1S1XA 3T6BA 3PW7A 5IWAJ 2HFVA 4X4TA 1B7FA 4G6VB 1K47A 3HHEA 4M5DB 1BQNB 3H98A 5KFRA 2CVEA 3ZNJ1 4OI4A 3MEEB 4CH7A 2ZH8A 1NPPA 3MUMP 2B9YA 4EZ6A 2VA2A 3BYPA 2ZDOA 2Z2MA 4QW9A 2IMWP 3BR8A 3Q8VA 1SQFA 4AUKA 1IUJA 2AEJA 3DFEA 3PJWA 1WHYA 5J2QB 4U96A 4FYVB 2QFIA 1A9NB 4ZK7M 2MHNA 2BOPA 4HHHA 3BR9A 4CI0B 2ASJA 4IFYA 3IM9A 5C2GA 2MKHA 1UFWA 2E1MC 1CQMA 1HQUA 1JNRB 4DG1B 3PO5A 2WAQD 3KDOA 3LGMA 5ETQA 2HVEA 4DPWA 2UUAF 3VGTA 5KG4A 3K5NA 4DFMA 3IAS9 1WACA 3UDCA 2JVRA 4NEYA 1RHKB 2HNDB 3FCVA 4ID8A 4DUYF 3OL7A 2KXNB 4JUZA 1IBLJ 1HBNA 4TYBA 2CPZA 4X64J 2A18A 3TX0A 1K1QA 2N82B 4C3MA 4ILLA 2KJWA 1JLBA 3LWMA 1PBAA 4RUHA 1RTJB 3T9NA 5K9FA 2B8QA 5KOXA 4AXJA 2CADA 3SSRA 3RBXA 3LF0A 1R8HA 1HMVA 3IWXA 4WWSA 4C8LA 1VRTB 2RIJA 3GR1A 3GJSB 4K2JA 4H4KC 3JQJA 4TQRA 2MZJA 4WBFA 5BYSA 2XYPB 4NLOA 4L6V3 1L3TA 2ZBQA 2MKKA 1F9FA 3MPYA 4LSZB 4DV6J 1RU2A 1Q5VA 2I6WA 2PFFB 1LW2A 4U95A 2GQCA 3H2VE 1APSA 1S1TB 1P27B 2POKA 1H38A 2C22A 3JTOA 1UVMA 3D7SB 5HVGA 3D28A 2QL5B 3SSQA 5J2MA 3EXYA 2BE7D 4DX6A 4XK8C 5ETPA 4ZOSA 3Q8RB 5E5NA 3EE3A 1TZ0A 1RAEB 3WX4A 3MM9A 3DI6B 1FJEB 1FK9B 3F41A 5KFUA 2LU1A 2ZH6A 2WW8A 1IVZA 4O3PA 1YJNS 1YJWS 2BE9B 1HYSA 2IRXA 1DLOA 3LQVA 1S0OA 3P8BB 3I0SA 5CYQB 1ZS6A 2JFDA 1TL3A 1X31C 4A48A 2UU9J 4WFAQ 1QDUB 1IBMF 3SV4A 1NPKA 3CCZA 2YKQA 5EN1A 1OPIA 2UV8G 1NKEA 2UXBF 4K4WA 1F3FA 2AX0A 4LSLA 3OUYB 2W9CB 3IGVA 5CHCB 3PX0A 5IV3A 4IO1A 3V81A 3CJTA 2NXCA 2QIFA 3BH6B 1N0VC 2CPEA 3AXKA 3M30A 2V8GA 4K0KF 3US5A 4CLPA 2DTJA 2W1BA 3VGSA 4ZHRB 4J9LA 4OX9J 3EGVA 2CPFA 3THPA 1X4DA 1OS5A 3G71S 2OPPB 4DV0F 4CLZA 2QN6B 2BQRA 4ZDNA 3D9BA 3MMBA 3JYTA 3C2PA 3DDNA 1HNXJ 4IG3A 1LV5A 4CRJA 3CCSS 1IWAA 1KVIA 3PYGA 4P7TA 1TAQA 5D4OA 4IQXA 5F8NA 5HQMA 3DLKA 3D0HE 3O8WA 4ED1A 4ED2A 1TFWA 1B0PA 1SVDA 4F0KA 3CPWR 1EJ7L 4ZLNA 1B0TA 1NEEA 2DGQA 1QVGR 1DTQA 4M5MA 2ZM6J 5B0DA 3DXBA 4J9PA 1UVKA 1RBOB 5KG6A 4DSIA 4F8RA 4U7UD 3H5XA 1FA0A 2HURA 1FRMA 4W98A 2QL9B 3TYTA 2DRAA 4Q43A 3FMWA 1NCLA 5T14A 4URGA 1F9HA 4EWTA 1C1BA 1S59A 3KNGA 3RTVA 2E5LF 3CDUA 1U6BA 3J80Y 1ICEB 1FWKA 4QU7A 4OV6A 1U6ZA 3UR0A 3KMSA 3V4IB 3KK1A 2XB2D 1UL3A 2GQQA 1KVKA 1XIQA 1EAYC 4RNOA 3PG9A 2UP1A 3CD7A 2AGQA 1LWCB 1U02A 4RKUC 1KONA 4PZVA 1VQ4S 3AOBA 4Y2IA 1NHKL 2MQQA 1OY6A 2B4UA 3UN2A 1YGYA 3TZWA 3MPWA 3CJRA 4ID5A 2RILA 4KIAA 1VIOA 1KKHA 3W7BA 3RB0A 5E3QA 1XMBA 2CJYB 3JS9A 2QJ3A 1VDHA 1DTTA 1ZOTA 4DV2J 2VDIA 3KK3B 3NNAA 2EFNA 2H5EA 2XTJP 3QPIA 1JLCA 1ZA2B 1RJJA 2BJEA 3TAMA 5F0WA 4NCGB 4P2SA 1M0SA 3FEYB 2HS4A 5F3TA 2IIHA 1FESA 4L75A 2XO6A 1WDDA 2MHEA 2EKNA 4LVNP 4V19J 1VJWA 2GVDA 2JL9A 1NSQA 1KWMA 4X4SA 2Y0BB 3CT9A 1B64A 3UNGC 4Q8EA 4DI6A 2X51A 2W24A 3T19A 4DPYA 5HL7Q 1N34F 3NGUA 4CO1A 3SFUA 2FGCA 5EX0A 4KGMA 1QJHA 3HZGA 1MLAA 2F9DA 3U02A 1TAUA 4PYAA 3QO9B 4ZITA 2E9TA 1YQHA 2CG8A 2ZOFA 3Q2TC 4UZCA 1MROA 5D15A 4DUZJ 1B70B 2W9BA 1EKSA 3MM5B 1XNQF 2H3EB 1GMWD 1E6VB 4JYAF 2D3UA 1S9GB 4OHVA 2J8AA 3DC2A 2HRTA 2BANA 1TU0B 4J9SA 3HVAA 4Q5VA 1EETA 4EU0A 4DFJA 4OJ3A 1I94F 1K1SA 4WZMA 2B9EA 4DV1J 4Q2LA 3MCSA 4NLRA 2IFXA 5KFNA 3AXMA 5G0RA 2BQ3A 2RAQA 2UUWA 2UUTA 5LXYA 2FIUA 4W90B 4GVBB 2HVHA 4WCEQ 2BE2A 1HLWA 2QLFB 4HTJA 2WVCA 5CZXA 2PC6A 2WVFA 5CABA 3IRXA 2XS2A 2QL7B 5GAGU 3OVBA 2RNEA 4EFAC 4ECVA 3DRYA 4ZPWR 3O5TB 4IDKB 1URRA 3GV8B 3CWJA 3AD8C 4F4WA 3C6UB 4JI4J 4DR7J 2DGVA 4LRCA 2ZE2A 2CJQA 1ZBTA 4IG0A 4P9SA 2HHPA 1FERA 1UVIA 5DLGA 1LNQA 4PEOA 2H1YA 2Y1JA 3DRPB 1P1LA 4KV8B 3KG1A 4DF4A 2KKHA 4QPTA 1DQ9A 1KDNA 3OBIA 4A8KA 4DL7A 4WK3A 2HGMA 3TUIC 4WJBA 2KM8C 4NLDA 1RHUB 1S1UB 3VQSA 3W2WB 1MWZA 3R9LA 4WP8A 4ATNA 3NWGA 4C8MA 3MF5A 4YY3J 4IR9A 3M8QA 4NI2A 3TJ9A 4LIRA 2X3GA 2V63A 3H4DA 3H4BA 1EP4B 1RT4B 5DDQC 4OZ2A 2M52A 3GIKA 3OQ2A 4MIWA 2MZQA 2MKJA 4K7QA 3HHKA 3K58A 4DV7F 4CZCA 5E3RA 1MN9A 1OJ4A 2VONA 1N6QB 3DNCA 1S1WA 2QYCA 3IWLA 4NXNJ 1WEXA 5I3UB 3QRQA 2DHSA 3I4PA 1FDAA 6FD1A 1NJZA 4OYXA 1T05A 4WKRA 2HW3A 3UD4P 1XJWB 1VK3A 3N5FA 5A8WA 4E0DA 1RT6A 3H2UB 3KKFA 3NOCA 1Y3KA 5GVQA 1BY9A 1L3KA 5F9LA 3MR5A 4FBUA 3WQPA 2R7VA 3D5MA 2A6MA 2HPUA 4K4XA 3M7VA 4DL3A 2ATLA 2E1PA 2QA4S 4KJIA 3W60A 2FY8A 2FVPA 4YDXA 1SH3A 1UJ4A 3PR4A 2RQ4A 3AJ2A 3C19A 3H5YA 3K5MA 4LF9F 3JAMU 5GMDA 3AA8A 3IG1A 4ECSA 4EZ9A 3W5YA 4ES1A 1U47A 2J9CA 2CRLA 4FNHA 3GIJA 4UQTA 4MKBA 3PX6A 4Y00A 2AZ3A 4O4GB 3C66A 5B0BA 3PV8A 2IC3A 1JIHA 2E7VA 2R8IA 1Z1ZA 3MEKA 1KD1T 4A8WA 3KMQA 5DRKA 3RRGA 1SI9A 5ITHA 3TW0A 2DR7A 5ETMA 5KFHA 2AJFE 3KJVA 5B0CA 2W01A 4B3OA 3I0RA 2GC8A 2YVSA 2AIRB 4NA2A 3CGIA 1MWYA 2VBXA 1HR0F 2I5JB 1NJWA 4K4VA 2XMKA 3HJFA 4ES2A 3BZQA 4HYKA 4C8OA 2BQUA 1AUDA 4F26A 3GIRA 1A0OB 1I1GA 1CJVB 2J7UA 2YWKA 2HVIA 1P9YA 3W2VB 5J2PA 1S12A 3KLIA 2NPFA 5D0RA 3M6VA 1X9MA 4LQ9A 2PMHA 4O4RA 2IPOB 2W4CA 2CNKB 2CWXA 2YTCA 4LR8A 2LA4A 5K8OA 3CB4A 4LF7J 4ELTA 2VJVA 4EGLA 3BPDA 2MQ8A 1Q8LA 4RW8B 1VQPS 1ZM9A 4X4OA 5KT3A 3UO0A 2R8JA 4PXCA 1U1PA 1SC3B 3RR7A 2JRSA 1IQZA 1S6QB 2YQ3A 4DR6J 1B0VA 2XLKA 4X4UA 2FPHX 3T9ZA 3BSCA 4AQYJ 2YWHA 4ZLLA 2GS8A 3RW7A 2HHXA 4NLUA 4I6WA 1NHUA 1TL7B 3DHWC 2IAJA 4DSJA 1KLMB 2A3JA 2HNZA 4WF9Q 4CNZA 1TKZB 3KLVA 1OQ3A 1QE1A 4OV1A 4CP5A 1AB8A 3ENQA 2H65B 4YN3B 4LF5J 1JLEA 4P75A 5BR8F 1NK0A 3GFZA 3LWLA 1RKJA 3AAWB 3DMJA 3CC2S 2GQ2A 4B02A 2BEFA 3EPGA 1YWXA 2HQ3A 4I6YA 2UXCF 4RUAA 4ZVTB 2EEYA 5L9NA 3MXHP 2LEBA 3F73A 1YLXA 1VQYA 3PW0A 3AH6A 3PEHA 4JP8A 1E6YA 5I4MA 3QRRA 2HHWA 1OIAA 4MKYA 5CYMA 4PG7A 4XPCA 5IC6B 4LT6A 2YKOA 2CQHA 4OLPA 5IXUA 3C46A 4IH6A 1NLKL 1YK9A 4CLKA 1VBYA 4NE9C 4ZS6A 2EFVA 4ZA1A 3ICLA 4N76A 5DG8A 1WTBA 2MGZB 3JQKA 2Z56B 3DDIA 1T9UA 1Q5YA 2PA8D 2OO4A 3GLJA 4DCJB 2AJ2A 3HHLC 1ZTTA 3HT3A 3EYZA 3BPSP 2KG1A 2YKNA 2GHVC 1R7IA 2ZZTA 2GJIA 5HVHA 4QWCA 2F63A 1XNRF 4NOHA 4DXLA 3CO0P 2RRAA 3D1HA 3HFZB 5JUMA 3OL8A 3BBCA 3SDEA 3TUPA 4DQSA 2ZD1B 4G1PA 3G9CA 5KFJA 3PJ9A 1S9EB 4C0BA 3BREA 3T5HA 2C2OB 2ILYA 2YBVA 3MEDA 4YB7A 1IR0A 4ETXA 1UJ5A 2IYGA 3TUJC 4LF6F 1CC8A 1WKKA 2IM0A 2W2PP 1M5HA 2L9WA 1J2VA 4NA3A 1KC8T 2FVCA 2UUAJ 4USMA 3OR2B 1UZHA 1NPRA 1NO8A 2NPIA 3H20A 5E41A 2OI2A 1KTQA 3LP1A 5LXRA 4A8FA 4DUYJ 1XN9A 1U0HA 2ASYA 4M94A 2PSZA 4O3SA 1OWXA 1VQLS 3HKWA 1RK8A 3A8JA 3B4DA 1S97A 5EDWA 4HEA9 3CCTA 3KLHA 3OFGA 3SXLA 4ZCMA 3K0JA 1JLGA 5LMUF 3CIMA 1YRUA 3IBFB 2MPUA 1EQ0A 3BQ0A 2RJZA 1IJEB 2E5HA 1S1XB 2FHKA 3NWRA 4I67A 4DR1F 4ZJOA 5DGAA 1CJUA 2ZOMA 1FI4A 3UPFA 3BV8A 1RT3A 2DGUA 3JB9k 3LAMA 2P9GA 3VGUA 4OMFG 1QY7A 1IJFB 4CWBA 1ZPVA 3RR8A 1PJ5A 3OV7A 1TUGB 3TQ1A 4F0HA 3HM9A 3MEGA 4KPYA 4DL0C 4O3OA 5KFXA 4KH1B 4QWBA 3NAHA 5HROA 4IFYB 4B3MF 1XMQF 3BM7A 3B82A 3M2VA 1PILA 2EPIA 6AT1B 1FX2A 1ZZNA 3BDPA 1AA1B 1HQUB 3VVUA 4F4YA 2OPRA 3WZ0A 1RADB 3GWCA 4FNIA 3THTA 2CQPA 1D09B 1Y11A 2KFYA 2G0IA 1U6FA 4J9UE 2ROEA 4QQBA 1IWGA 2M4MA 1FRKA 1HBNB 3C8YA 5HP1A 2OP5A 3TRGA 1RTHA 2HK3A 1KQGB 3AODA 2PFDA 3BQ1A 1WD6A 2WB4A 3MI7X 3G6XA 4OJHA 4C8YA 2ZEJA 2XWXA 2LXIA 2B51A 1JLBB 3NAIA 2R9LA 1I3OB 4NLPA 4A8MP 4FF3A 3M1VA 3QQCD 4RUBA 3ETMA 1IBMJ 1HMVB 3CCVS 3TZXA 3KHGA 4DSKA 2EBGA 1N8RT 2UXBJ 4WFYA 3O1LA 3UVJA 1WG4A 3SCKE 4I2PA 2BJ3A 2FY1A 4DEZA 1WF2A 1WHXA 3PXGa 5FDLA 3CD0A 1YRTA 1GNKA 3UDEA 2LDIA 1YSJA 4K0KJ 3MD1A 3GONA 2FHJD 2F5GA 4BWMA 2ZHBA 2LU2A 1X4HA 1LWEA 3BKTA 2V4RA 2R7XA 1LW2B 1P8GA 4DV0J 1YG0A 4BDPA 1FDNA 2GHWA 3U1MA 2VBWA 3VWSA 2BVZA 3PKMA 3BH7B 5GMKa 4GKKF 5J2MB 2FC9A 2WHOA 5HBMA 4OZJA 1TVRA 4NLQA 4CH0S 1WEYA 1U8WA 2B6AA 2CQDA 4URQU 3C3LA 1Q1KA 5AE1A 3MM9B 4DQRA 3IFEA 3DKDA 1U4BA 2AEMA 1O8BA 4WTYA 1UW9A 4UOGA 1NNDA 1VQ7S 1H7XA 3VAFA 3PVXA 1HYSB 4DL4A 1DLOB 2ZZMA 1S79A 2VF3A 4Z7CA 1LOUA 1KSPA 3I0SB 1SH0A 1JLQA 1T0TV 2GCFA 4DQPA 4DX5A 1TL3B 1WF1A 3NMRA 2MJNA 1N0UA 4PR6A 2L9NA 1RHMB 3MDFA 3RW6A 1GEHA 2E5LJ 4MK8A 4LSLB 4RNFA 5DETA 4TLQA 2R2UA 5KG5A 3V81B 2BZ2A 3VGVA 3N6LA 1C0UA 4HH1A 3M30B 4DPUA 1KHVA 1SCJB 2HFNA 4NCAA 1VLOA 4Z37A 3WIVA 2V8HA 3UE2A 1LQ9A 3GP9A 2C3MA 3QGHA 2VC0A 1N5QA 3W64A 4IR1A 1X9WA 2C28A 2BOAA 1K8AT 2IY5B 3MMBB 3CO9A 1WI8A 3B54A 2ZC4A 3JYTB 1RAIB 1WOSA 4IG3B 3C14A 2B5JA 4IYQA 3HVWA 4DR3F 2QV6A 3KTQA 3TAQA 4QJVA 2XWYA 3DLKB 3CCUS 4HL9A 2OFHX 1G4CA 5D3GA 3ZZOA 2YWFA 2JLGA 1DTQB 1TMMA 4ANEA 3W65A 3FRYA 4FYYB 2HWTA 5DS7A 2GIFA 1DQAA 1FKPA 2B56A 3D1QA 3CMAS 4JBCA 3R7NB 2WK4A 5I3PA 1H72C 3LP2A 4UOHA 1EX8A 3VAJA 1C1BB 2M8DB 4ZCKA 1AROP 3BYRA 4W4MA 1X4BA 1BHNA 3IM8A 2H54B 4R0EA 4USTA 3ZTPA 1L3SA 1SJFA 1P1TA 4AD6A 4P7VA 2HHHF 4PWWA 1SJ3P 2YNGA 2B43A 1N34J 4IO9Q 5EX3A 3KK1B 4MAKA 3I32A 1F2GA 2MSTA 2QTWA 3NNHA 5KFGA 4OLOA 2WVEA 3IBCB 4NMXA 5KG1A 1U1KA 4M8LA 5E0OA 2BKNA 1XNQJ 1NXIA 3NCPA 4TNOA 1JX4A 4JYAJ 4X4RA 3UCUP 1V3RA 3LANA 4DPTA 5KT7A 5HN0A 3FNNA 4ID5B 2MY7A 5T7LA 1RWWB 3KUHA 3M4XA 2V2VA 1I94J 2QA1A 1RAHB 3MTJA 1DTTB 4OIXA 3NL0A 2VHGA 1S5ZA 1CQNA 1SKUB 5J2NA 1JLCB 4NYOA 1YVFA 1L3UA 4QIWD 4UZBA 3TAMB 4F50A 3M2UA 4YHHF 3EGNA 4OZ1A 3X1LB 2H48B 2Y1RI 4B3RF 1B7YB 4E8UA 1LFWA 1RABB 2GVDB 4EBEA 2DHGA 2Y1LB 1PO6A 1D9FA 5DG7A 1FFWB 3RAMA 3KK2A 3VR1A 1TK0A 1KEKA 2NYHA 2HEKA 3HHDA 1HNWF 2AHOB 4NXMF 5LSRA 4Q7AA 1H7WA 4AL7A 4LF4F 2K3IA 2HSEB 3MPVA 3CD5A 1FRXA 4ED0A 2BKOA 1MROB 3POTA 3PW5A 3UI3A 2W9BB 2W8KA 5IT9Y 1VQ6S 4UOFA 4USWA 1PJ7A 3HLUA 2I0XA 2D1CA 1X4AA 2BANB 2HQGA 2ZHAA 4USIA 1S77D 2RKIA 1EETB 1FTCA 1NMEB 2AX1A 1ITPA 2D9OA 3L95X 3MAHA 4C2MA 3K59A 2KXHA 2EFQA 5F8JA 1NB2A 1WTFA 5G0RB 5KFTA 3GB0A 3RB3A 3TA1A 5F8HA 2XCPA 4DV7J 4HTIA 4NLYA 4CO4A 4ZLPA 2BE2B 2Q79A 1ZH5A 2HHSA 3OW2R 4FVMA 3IRXB 4F2RA 4MYTA 4PRFA 2WTFA 4XDDA 4PWDA 3ZZTA 2YNIA 7FDRA 2CPYA 5KG0A 3ENVA 2WCXA 2GZOA 1R0CB 4M5LA 1TL5A 1CS4A 5A0YA 2V8DA 3HDSA 4ZLJA 4PPDA 2MZSA 3D3BJ 3E8OA 4F7VA 1HARA 4UT4A 2XS5A 4LF8F 2ZE2B 3OTDA 3LPYA 3IN5A 4IG0B 4U7UK 1UW4A 1S99A 3W9JA 3QYYA 4FYXB 2OUGA 5D8HB 1FRJA 4ES3A 3U27A 4ECQA 1X60A 4LF9J 4FS2A 1M1HA 4ILRA 2V69A 2CJ9A 2ZOGA 4OI1A 3SEOA 1WOOA 2ZUGA 1KQSR 3NOGA 1MNEA 2OTLS 3LAKA 2QLWA 3M8QB 2ZKTA 4NI2B 3MUVP 1RCOB 1VHIA 1ZAVA 5JMNA 2DGSA 2BR0A 2CNNB 4M5GA 1N48A 4CLWA 2RRBA 4U9RA 5AE2A 2F7VA 4KSEB 5IT4A 5L9XA 2VPXB 1RLCL 3RRHA 4A47A 1FNXH 1S1WB 4NLXA 4DV4F 3M6XA 3CC7S 3SMZA 2CPHA 5CH7B 1M5PC 4C8KA 4MK9A 1RWUA 1U1RA 1G6BA 3FVYA 3NCRA 1T05B 2VG5A 2P5VA 2HIYA 1S10A 2UUCF 3Q0AA 5A8WB 1CJTA 1RT6B 1HR0J 3FRZA 1QSYA 2CZ4A 1UTAA 3R6LB 3EGWB 5KG7A 4C9DA 5A8RA 2QMXA 3GV5B 1GTEA 3B6BA 2OFGX 1FHTA 4P6QA 5FIIA 2OPQA 3R5CA 4RW7A 3BQ2A 1RA7A 4B08A 5KFAA 3HP6A 3EX7B 2MY8A 3J7AN 3PR5B 1FNMA 3FBEA 3QBCA 3QWUA 4QW8A 2QFJA 4DR4J 3KUEA 3DOKA 7FD1A 1TL4A 1W7WA 4UUXA 3IG1B 2RQMA 4WTOB 1FE4A 3FQKA 1KP6A 2IM3A 5AT1B 1HWIA 2E9RX 1CEZA 4ZPAA 3E01A 1Q82T 3Q23A 4ECUA 2YY3A 4WE1A 5GADI 2O01C 2BACA 1T9VA 3NP5A 8ATCB 2IC3B 4GO5X 1D1UA 1S48A 4ZJQA 1RYRA 3HFVA 2UXDF 1Q7LB 3R2CJ 4FS1A 2Q43A 2R7TA 4NLVA 4OL8A 2MB0B 2BJDA 4G65A 1IBCB 3KJVB 2UVUA 4QIGA 2FVRA 4B3OB 2P9CA 3I0RB 2WSCC 5BR8J 3CJQA 1B3TA 1XC9A 3A3OB 3MPDA 2WONA 4FKXA 3I96A 1SKSA 4M63A 2ATCB 4A8XA 1ZM2A 4NZ7A 3GYXB 1FF2A 3QATA 3PY8A 1OO0B 2UXCJ 4USUA 1NJYA 1D9DA 4UY85 5F8MA 4RBTA 3N01A 1S6UA 1FWPA 3CCMS 2WW4A 3QWPA 2L3MA 2DHAA 3J81j 4UF4A 5J2PB 2ZH3A 1PIEA 4LRAA 3KLIB 4ED7A 1HL6A 2NXNA 2MQOA 3NCQA 5MLCV 4B3SF 3DHXA 2IJFA 1RAOA 1RI7A 3OHBA 3L09A 2V5HG 3RUBL 1WDTA 3RYLA 4ED3A 1FRHA 2N7CA 4DPOA 3CJ0A 4N8NA 1Z2ZA 3VAKA 2LVWA 1F5AA 1RP5A 2DNMA 3D1OA 2AKWB 4YUDA 1XEZA 2F8HA 2G0CA 3G86A 4KR0B 2RUSA 2MYFA 1UEUA 4I68A 2IAJB 4DX7A 2XNRA 5AJ3F 3GFXA 4E98A 1WG1A 2DGXA 4R5PA 1FKAF 2HNZB 1X5SA 2DRDA 3JAMY 1QE1B 1AT1B 1XNRJ 4KGVB 4DR2F 3H5SA 2FHJA 2VG6A 1JLEB 4AXIA 3AD9C 1VQ8S 2CJAA 2D74B 3DMJB 1MU2A 4JI3F 1J5EF 3OLBA 2MKSA 1HNIA 2CQ3A 4RZRA 4DS5A 3B8HA 1CSJA 4YEAA 3CCJS 3JTPA 4CLTA 1DBDA 5LM7E 1WC0A 2OSRA 1R6YA 5HLFA 2OJ3A 2NCKL 3R2DJ 2EK1A 1U1LA 2SXLA 2FLLA 1U1QA 5G4DA 1ZPWX 1PBUA 4XPEA 4LF6J 3ZNUA 5HJXA 4U7CA 3RU0A 1E6YB 3DLHA 5DZ7A 2DISA 1VQNS 1C4CA 5CYMB 4B9NA 2G2OA 2R2RA 4C8NA 1DQ8A 1SL2A 2B7BB 1YHQS 2DBBA 4G1QA 1GK8A 2MLZA 1YRXA 3MHYA 5GAHI 2GMHA 3BGLA 1WNEA 2AZ1A 3QGGA 1HWLA 2P8IA 2FD2A 3SBMA 3C15A 2L08A 2R7RA 3ZFVA 3OTOF 2MSSA 4P2MA 5E3PA 3OFHA 3KJFB 2I38A 5LMUJ 2FJEB 1PC5A 2WRMA 2E5JA 2BV3A 1B4SA 1HKAA 4CYUA 2YKNB 3DXSX 2HQCA 2J9DE 3K7RA 1UVNA 1RWMB 5B08A 2HAIA 5CD4A 3UCZP 4DR1J 1FE0A 3W9IA 3HJVA 4TU9A 2ADCA 4TQSA 2KXFA 2P9EA 3GSDA 2M9KA 4RLEA 3SDEB 1YBAA 1RHJB 1FFSB 2OGUA 3M6WA 2R2SA 3PO4A 2OAUA 3ZTRA 1WKJA 4KHRA 2B9WA 2MMYA 4OI0A 5KFYA 4K5SA 3MGJA 3NGRA 1XR6A 1EQMA 1XERA 4ENOA 2PA3A 4B3MJ 1XMQJ 3MEDB 1FJGF 3J7YI 3T5LA 1FEHA 2G9OA 4ECTA 1IKVA 1PC4A 3QLHA 3FKBA 2LLZA 2J6TA 3UQSA 2ZKUA 3FEXB 3DU6A 3PIPQ 5D4PA 1A7GE 3DLBA 1FXRA 1BWVA 2C2DA 4JI6F 4FF4A 4C8ZA 1WSVA 3DU5A 1M5VC 5F8GA 1DY3A 3PYFA 3LP1B 2DGTA 1U0HB 4M5NA 3JSBA 4NCBA 2D9PA 2VQFF 2GNKA 1X8DA 3KLHB 3D3CJ 3QSYB 5KT6A 3HHLA 3EGZA 4M1KA 1JLGB 1CPZA 1TV6A 2C3YA 2HHQA 1T8EA 3FC9A 5ETVA 3D6MB 1FT8A 1LFPA 2ZBRA 4PKDB 4I0WA 4LFCF 4K4YA 2FC8A 2M2BA 3OVSA 2DCLA 2GAHC 2B4OA 3H90A 1N52B 3W5ZA 2XZWA 2M70A 5KFSA 1LK5A 1F60B 5D4LA 1CJUB 4B9VA 1SC6A 3FEZA 3UR3C 1RT3B 3JSMA 2EXUA 3PRDA 4FXVA 1UWBA 2CA9A 3ITHA 4UW2A 4N47A 4WFBQ 4LRFA 4Y2AA 2B4PA 3MEGB 3LP0A 5HROB 4O3NA 2MQNA 3PFOA 3OSPA 5CYJA 3M2VB 1YITS 4KGZB 1IBKF 1V3SA 2YQ0A 1RKIA 2OPRB 4GKKJ 5LMNF 3ZC4A 2OD6A 2EKYA 4TU7A 4U8YA 1JQGA 1Z4UA 2EVZA 4Z2XA 3AD7C 3N5BA 4CO3A 5B0GA 4I69A 5A2QY 4HI1A 5GAEU 5HP1B 1A6LA 1RQ0A 4URSA 4DPXA 1B99A 3J80U 2Z8QA 3OXGA 4U8VA 5HSPA 1RTHB 1Y5LB 2FUG9 1KTVA 1WC3A 1UVJA 3ZO7A 2DIUA 2ZVIA 4JI5F 1VQMS 2DITA 1T02A 4TVAB 2IJRA 2IBKA 1WORA 1N32F 4FP9A 2HHUA 2Q6CA 4C7QA 5LJ5Y 3M1VB 1WOPA 1EIYB 4PXBA 1JJ2R 2YX1A 3Q89A 4LQ3A 4CDIA 2RDJA 1SL1A 1G1XA 3FCWA 1EKRA 5LOQA 1EB0A 2R8GA 5KTQA 4Z7YA 2CJKA 3UVJB 3I5AA 2C42A 3MFHA 2RU3A 2WSFC 3QRPA 4I2PB 1G7CB 5KFCA 2DCUB 1IKXA 5FDLB 2Z58B 1TKTA 3QAEA 3B78A 3IO1A 4TXSA 1CULA 4MTPA 4ELUA 4F0MA 2E1RA 3GZ7A 1LWEB 2F8EX 5CD4H 3CW2C 2NSBA 3GFYA 4OZLA 3ZZ0A 4IOBA 3SQOP 5ADZA 1OY8A 1KOHA 4JI2F 2JFKA 2E7WA 2VUGA 4NZ0A 3GCXP 2AV5A 3GIIA 1KQKA 5C25A 3TNVA 2GGPA 4OYZA 5HBMB 1TVRB 5KFMA 5KFLA 4DR3J 1GXLA 5C7PA 2B6AB 5HANA 4UUWA 1NSKL 3A12A 4FBTA 1CJKA 4AYBD 1KS2A 5JJBA 1LWXA 3OFFA 3GJTB 4V19X 3Q8PB 5IZHA 3TJAA 3VAIA 2YKAA 1FRIA 3PHTA 1W2IA 5LT5A 4J9QA 2J0XA 2EWHA 1FEEA 3MZIA 4KBIA 2CPJA 1SL0A 5D0HA 1VRUA 3SFGA 1JLQB 1K73T 2I9SA 4J9MA 5ETRA 2V2QA 5HJYA 4ZPTR 5E3AA 3BGFA 1JXLA 3UDLA 1WC4A 4OYAA 3ZTOA 5C24A 3VTIA 3AA9A 4EBDA 2B9XA 3HD2A 2HG4A 5K20B 2HHHJ 4R8UA 1C0UB 4DSLA 1W2BR 3ISZA 1RTIA 1RA6A 2QLJB 3GG0A 2IDLA 1SC1B 1SIZA 2N3OA 2EC2A 3A3PB 1EARA 5EWFA 4TLRA 2KDOA 4P73A 4DCPB 4WXOA 2VPZB 2C3PA 1HWKA 4P71A 1N5VA 5L38A 2ZBCA 4ITSA 2WB1D 3C14B 2B5JB 4MYUA 2FVQA 3OXLA 2V4QA 1V6HA 2IRUA 1GX5A 4QR2A 1DFDA 3NEKA 5D3GB 3RRKA 1X7VA 2MLXA 2XSJA 4LFAF 3QT6A 6FDRA 4YFUA 1X4GA 1LW0A 3T1AA 2OTJS 4PG8A 4LREA 3IWNC 3AY0A 3AQPA 4KO0A 3S7RA 2GVZA 2QA2A 3KHRA 1FKPB 2ACYA 1YJ9S 1ZM4A 3MM8A 2W9AA 2HMIA 5DJBA 4NPOA 3M8ZA 4MMOA 4YHHJ 4DN0A 2MLYA 3LP2B 2EG2A 4B3RJ 3KLGA 2MQMA 4EMDA 2Z57B 2EI5A 1Q8BA 5K8MA 4PXEA 3MR6A 1Y3JA 3IBWA 2GAGC 4KFBA 3G96A 1R8PA 2B7CB 2FJDB 2HZVA 3EVOA 5L1KA 2YNGB 2DB1A 1EHWA 4ZPDA 1HNWJ 1TK8A 4NXMJ 5LSLA 4F02A 4LF4J 2A10A 2PE8A 4P72A 1ZA1B 4LBHA 2RS8A 4PPZA 3EDQB 3CJ4A 3KXDA 3BSOA 4J91A 2HQFA 4TKTA 3VV2B 5CQGA 2O1PA 4QIEA 4R25A 1S72S 5F8LA 1KFDA 2M5YA 2XGQA 4FF1A 4U67Q 1ZTWA 3JXOA 2G1DA 5T7LB 3L9ZA 3A1YG 2XZDB 1JK9B 2XBPA 1JNZB 2ZFHA 5ETTA 4K5RA 2QE5A 2OEKA 4EI2A 3MR7A 3EM1A 1UA0A 2RMLA 3KLEA 2QG9B 4KHMA 5J2NB 3CDEA 1R89A 4YB1P 3GILA 4D3HA 3ILLA 5J1EA 2ADBA 3M2UB 4EK2A 1ACMB 2KG0A 1U1NA 1MMDA 2C2EA 1HA1A 2CKWA 5MAOA 2VKZG 2IA0A 1IN0A 2XI3A 3AB4B 2DNNA 3KK2B 3NBPA 1F0XA 1NZAA 3R97A 3U1LA 4LF8J 3W5XA 4F3QA 3CDAA 3FFIA 4RNHA 1UPPA 3POTB 3I56S 4C98A 3OXFA 2LKZA 4NASA 4OZ3A 5D4NA 4CT8A 4L3KA 3DLEA 2D41A 4RL1A 4KGXB 4A4JA 3M2RA 4XO0A 2F40A 1FDBA 2MXYA 4J5OA 2RKIB 2NQPA 3CCES 4ZP7A 1NH8A 3H0PA 2W2OP 2BM1A 2V8VA 1Q8IA 1RWXB 2LQ9A 1IKWA 4F3MA 1KN6A 5B0FA 2VV5A 3TUZC 2O3DA 3J81Y 2EK6A 1NDPA 2OHDA 2YXLA 2ZH7A 5IQQA 1FJCA 1KQFB 3SCJE 1YJ7A 4CNYA 5M2PA 4LFBF 1JXEA 4X4PA 2DGWA 3M32A 1YIJS 2G1HA 4DV4J 4B9UA 2PEHA 3IR7B 3OVAA 2XY6A 4C3KA 2GO8A 2BA9A 1YX2A 3PW4A 1OQ6A 4PWDB 2YNIB 2Q3PA 4LSNA 2CG4A 4X62F 1N5YA 2VFUA 3PRBA 1DARA 2UUCJ 5D0GA 1JKHA 1CS4B 5A0YB 3M9NB 4ZJLA 4AL5A 3H2LA 3IP0A 2IBOA 3SV3A 4DL6A 5DDPC 3D0GE 3QMQA 2J9DA 4LR9A 3GCWP 4P52A 1S1VA 3TJ8A 3BEGB 5HMXA 5CAAA 3P49B 1BD6A 4OI2A 4QR0A 3ZZRA 2XS7A 2MKCA 5K14A 3VVTA 3BS9A 1M5SA 2ZNZA 2W2QP 2B0GA 5ETOA 1Q8KA 3PACA 3DGVA 2H5JB 4I64A 2HVZA 4RW9A 4RUCA 4LF1A 5FLXY 5LSOA 3TA2A 5GADU 3LA0A 3T1YF 2KFNA 5LJ3Y 2NUHA 3GYGA 3CMES 4K4SA 4MJKA 2QEXS 1G2EA 1UAWA 4MIBA 1QAXA 2FTRA 1Y5IB 2DR8A 3ZTQA 2HFZA 3SYZA 3IXQA 1UP1A 4NEZA 1RU1A 2E5IA 4P2FA 4ED5A 1UZDA 2HS3A 4ZVPB 1RTDA 1T3OA 4GKJF 4P2XA 3TEHB 2G13A 4KKOA 5DGBA 3K5PA 1H2VZ 1GQEA 5A6PA 2APOA 5E7OB 2VG5B 2W4PA 5AXKA 2WSEC 3ADAC 4ANDA 1HHTP 1CJTB 1BLUA 2E29A 2P6TA 2BJ1A 4USVA 3RJMB 1LXNA 5A8RB 2JJ4D 1RAAB 1FFGB 2ZWPA 3FGVA 2OPQB 3K17A 4RW7B 5IQ6A 4X4VA 2YNFA 2RF2A 1TELA 4X65F 1UCNA 4B17A 2CXEA 2KM8B 2C2ZB 1YI2S 3DOKB 1JLAA 3AT1B 4B3SJ 4NYZA 1UA1A 4OX6A 2CQIA 5A6WA 3GG1A 2HRUA 2FZGB 2GW8A 1F1BB 3E01B 2IHR1 3DRRA 2K3KA 4WE1B 3DRSA 2DR9A 3CJKA 2GFFA 3FSIA 4QBUA 2W7AA 3J7Z5 1WF0A 4RPFA 3OHAA 5AJ3J 4K8RA 2CQ0A 1VYAA 4A8YA 3T41A 4KPCA 4MKAA 5T41A 1WI6A 4G1IA 2AMCB 3E3XA 3K57A 4DR2J 2U2FA 2HKEA 3F56A 1RHRB 2WONB 3MPUB 4JI3J 1J5EJ 3NS5A 2R7OA 2E66A 3GJQB 3ETOA 2NR0A 3JQMA 2C1EB 1L5UA 4H4OA 1PSDA 3TQEA 5DO2A 1VQ5S 1BMQB 4ED4A 1HD0A 2AJ1A 2OEJA 3MECA 4BWJA 3KNAA 4MT1A 1QAYA 1CLFA 3G8SA 1FCAA 3UCGA 1LWFA 5CCLA 1U24A 2GX8A 1MW7A 2YPYA 1SJ1A 3FBBA 3L7UA 2R3VA 2XLJA 2IVYA 3NGSA 4KHPF 1S4FA 4O44A 2RD5C 5GAHU 2FZKB 3L3CA 1H74A 3DLLQ 4DS4A 1TMJA 5HI7A 4FKYA 2W8LA 3BO2A 1QLNA 3FSYA 3OTBA 3FJ2A 2PD1A 3QGPA 3OTOJ 4BC7A 4ED8A 2QRRA 1JWWA 2CQ4A 4C0OC 3LW5C 4UY8T 2EG1A 4R5PB 4C6AA 2F4VF 1YDLA 1F5CA 3J7A1 1MG7A 3GU0A 2VG6B 4QIVA 3CCLS 2N4CA 2R7WA 3NS6A 3TVYA 3MR2A 2HRYA 1UFKA 1VIXA 2KTQA 1MU2B 1T9TA 3PNIA 1SXLA 5C42A 2CAJA 1HNIB 3S1TA 3DGPA 4DU7A 4CO0A 3TANA 3TR5A 1VC6A 1SKWA 2EC0A 4L3NA 4WPAA 4HLBA 1REVA 1QTNB 5HLFB 3W8PA 2LMIA 2HS0A 2CPIA 1VK8A 3O2IA 5ETKA 5U47A 1FJGJ 4ECXA 4PG6A 1RB0A 3M8PA 4DFKA 1YJRA 4FPIA 4F2SA 1XBWA 2RHSB 1MN7A 1U1OA 3SI8A 4DDFA 4OYMA 2K1RA 4KB7A 1KVJA 4KGKA 3NS7B 1BQXA 3CJ5A 2X1GA 4QOTA 3O3LA 2YWGA 4ZVEA 2K7KA 4JI6J 4G1QB 3QGIA 1KHWA 1NU4A 3CTRA 2XY7A 5SZTA 2YKMA 2KJVA 2VQFJ 1NAQA 5F41A 3AOCA 3C15B 1N88A 2JC0A 4XDCA 3VQTA 1TKXA 4GMKA 2HLUA 4CLYA 2Y8YA 4CYUB 5HQ8A 4LFCJ 3NMAA 4M5IA 2JEFA 3MM6A 3FDSA 3X3UA 3IRWP 2RHQB 3FQLA 1BE4A 3PX4A 1HFEL 1RSCA 5KFWA 4WK1A 3OR1A 5IFMA 2U1AA 1T9XA 2QO3A 3MM7A 4UOCA 4QYZK 3VF0B 4F4ZA 5DZ6A 1RISA 1RT2A 4L74A 2EFOA 2M8HA 3HXMA 3N79A 2J76E 1TUWA 3KLFA 2VC1A 4B3TF 2DH8A 1REGX 2KVIA 1HWUA 1Q16B 1C0TA 1AFIA 4O0IA 3LTOA 4OZ5A 3SQGA 4Y0FA 3HVTA 2ACMA 1IKVB 3QLHB 2L9DA 1IBKJ 4TY8A 1OY9A 2IVMA 3WDOA 4F4XA 2ZH1A 1C2PA 5LMNJ 4MFBA 3S6EA 4N56A 4TY9A 5IOLA 3D68A 3WHIA 1BGXT 2VBZA 2ALYB 4G3IA 2O67A 3WC2A 1RT7A 2QA4G 3ZZYA 4LR7A 2RH3A 1NDCA 1AFJA 4DWIA 1RT5A 3HHLB 1H3DA 4WIQA 4J37A 4C4WA 1TV6B 4JI5J 1R31A 3H40A 2DEJA 4JI8F 1H2TZ 1F2HA 1N32J 1U7LA 1RAFB 1YZ6A 3C16A 4HDHA 1ROFA 4XAKA 1X0PA 5AXMA 2NREA 3ENWA 3H59A 2ABYA 2OMLA 2PMWA 1VQSA 2IYIA 2FJXA 1Q4RA 5L1JA 2QSWA 1HNVA 4OJGA 3KHHA 5EWGA 3JSMB 1BQMA 2XG8A 3R5GA 1UWBB 3QJJA 3ITHB 5C5JA 2PMZD 2LQJA 3NLCA 4B9LA 4Q44A 3MOZA 3LP0B 1YJTA 1RTZA 3QZ7A 2XI2A 1GT8A 4QWEA 4L72B 5BXIA 3DYAA 4FXDA 2CPDA 2IM1A 1FNOA 4JI2J 2QSFA 4X84A 1DURA 3Q8QB 2GJFA 3NXZA 2J7WA 3BGRA 4Q8FA 2YX7A 1O6XA 2FJWA 1WEZA 1IQTA 3Q24A 1FVSA 4NLTA 2HNYA 1Y0HA 3MWBA 4DOZA 4USKA 2OLWA 2ZNYA 2GMJA 2KHDA 3I9ZA 4DL5A 2DT9A 5IT0A 1WSRA 1V3ZA 4KT0C 3CULA 4I1TA 5K8NA 2UUBF 5AE3A 3SCLE 4ZVOB 5LL6d 1SIWB 3OL6A 3QAUA 3ONQA 1N5SA 4K4UA 2RDIA 2KO1A 3TOQA 4O0NA 1WC6A 4LVOP 4C0HA 1I6JA 4FXWA 2VIHA 4A8OA 4RWXA 5D77A 2ZH4A 2D3OR 3HD1A 5L39A 3MOJB 2CQGA 1YBUA 3IC1A 3W63A 4CM0A 1MMLA 2F65A 2R42A 1URNA 3CDWA 3HSZA 1VCTA 1ELOA 4ECRA 4TN2A 2MDAA 3HZEA 1AZSA 5HK4A 1IKXB 4YQWA 1Q78A 1TKTB 3D54A 1CULB 4FDFA 4QR1A 2DR5A 4OZ0A 1CBKA 1HW9A 1GAOA 2V94A 1FD2A 5ETLA 4Q0BA 2FHMA 3RBZA 1QUVA 1RT1A 2OSQA 3KYLA 3CC4S 2HBYB 2DEIA 1DRZA 3GJRB 5C25B 4CO5A 2GGPB 1QSLA 2HWIA 1X4FA 2IA6A 2ZH5A 4ZIWA 2LFVA 4RR5A 2FDNA 2L48A 3G82A 1HQEA 1SH2A 4F04B 4FYWB 5E33A 3I4HX 1CJKB 4IRCA 1F9EB 2J6SA 1NJIT 3WBZA 3DN9A 4LFAJ 1D9AA 2XC9A 4YR3A 4MH8A 2BABA 4FVCA 2V9WA 3I82A 2MJUA 1MSWD 2DY9A 4BS2A 4BC9A 2KYZA 2K2PA 1VRUB 5A8KA 1DZ5A 1U45A 2KRBA 4ZN3A 1L3VA 1TQLA 5IT9U 1HQ2A 3M9OB 1GMWA 3Q8YA 2CQ2A 3VAMA 3N4WA 5HMWA 1HBOA 5IM0A 2J9EA 4V1Ak 2J7KA 5C24B 1QSSA 5I42A 2RDDA 3OD2A 1N36F 3CMQA 3T5JA 1TP7A 4Y2MA 1UMJA 4R8UB 1PYOB 4N41A 2AGPA 2V67A 1RTIB 1MWQA 2WBMA 3R7SB 1Y9OA 2AYGA 5L46A 3HFKA 1T95A 4ZKAA 4YB5A 3QFWA 2GA7A 1VMBA 4Y34A 3H8YA 1GXUA 1H73A 2UVVA 3BN4A 3CCQS 1FXLA 3KWMA 4RU2A 3MMAA 3RBEA 3H5UA 2G4BA 1SJRA 2V0NA 5CZVA 1XK8A 1PJ6A 2XZTB 3R1HA 4N77A 3C6TA 3R5DA 4CH1A 1R0BG 4GRSA 2MZTA 4WZQA 4N5SA 3AB2B 2XYGB 2XSJB 4WXWA 1SQEA 1UJ6A 4OYOA 5B7WA 5F9NA 1LW0B 4HH0A 3D6TB 2HFSA 4RBVA 3FMBA 1HHQA 4KO0B 2GVZB 3NNCA 1S0VA 3U7JA 3ET6A 2VQEF 3BO4A 3MM8B 2HMIB 1AW0A 2XMWA 4KE5A 2VD3A 1TFYA 3KLGB 2O5DA 1J27A 1GMVA 1RHQB 4KFBB 4YR2A 3BGOP 3CVKA 3MMCA 2FJAB 3EMTA 1TR0A 4DHVA 2QX0A 1X9SA 3IAM9 3T5KA 2JX2A 2HZAA 4UTGA 2RE1A 4EO8A 5F3ZA 2AJ0A 1RZMA 2DVIA 1WC1A 1NSPA 3S01A 3HHNB 1WUUA 1IR1A 4P10A 2HBQB 2DJWA 1T03A 4GO7X 3CD6S 1RWVB 2KB2A 4J9NA 3N0VA 2KU7A 1Y10A 3TP2A 5CA5A 2Z2YB 1NK7A 1N56A 3G8TA 2HAFA 3RAQA 3TEGA 2OPSA 1NRKA 3BBFA 1QAIA 4ECWA 1HBUA 1VS3A 1U2RA 4M5HA 4OQJA 5M2UA 2V50A 2E44A 4Q45A 2AD9A 3KLEB 4OHXA 5E2QA 3CNQP 4LFBJ 4I7FA 2AEFA 2ILZA 4ELVA 1VC5A 2ZJPQ 5J1EB 4RBUA 2NXEA 2YH0A 3V5RA 4X62J 1U0SA 4J9KA 3DRXA 1Q53A 4ZCLA 4C11A 1FWLA 2WBRA 1T94A 1UKUA 1C4AA 2LA6A 3NBPB 3ZXWA 4X4NA 4DQIA 2DH9A 3P5TL 3JSYA 2JVOA 2Z2LA 3WC0A 1UEVA 3FZBA 2CUYA 5HMYA 1SV5A 1HBMA 3HVRA 3FFIB 4CO2A 2K06A 4ZP6A 2DHHA 3H42A 2XMJA 5EHHA 2H4WB 2CZVC 3DLEB 2MEWA 1NB7A 2NZCA 3M2RB 1D3WA 3R7BB 5KFBA 1U26A 2CJXB 3G8QA 3K5OA 3PM9A 2PT0A 1TTHB 4NLSA 2ZC3A 4FZVA 2F3JA 2RSQA 3TA0A 3FBCA 4MKVA 3PIOQ 3F0NA 4BHQA 3T1YJ 2PO4A 1IKWB 2KT2A 3N28A 4QYZJ 5J1NA 5SUHA 4OJ1A 2PDAA 1M1KT 4Y65A 3QT7A 5KG3A 1XTZA 2CYYA 5F8IA 3LOUA 5KOWA 3CJSA 1GX6A 2UZAA 3M32B 1YTYA 1S57A 4NZ6A 3GMGA 4F36A 3M8RA 3BO3A 1SKRA 3MAAA 4GKJJ 2FQQB 4PQAA 1FDDA 4K59A 1IM6A 4LSNB 1N5YB 2R4FA 4J7CA 4RW4A 3CXCR 3A8IA 2VASA 1S6PA 1JKHB 1NK6A 4B9MA 2RRNA 2Z30B 2OH2A 1KOOA 3BBBA 1Y4ZB 1HIYA 1BC6A 1JB0C 5L8RC 5AXLA 1X4EA 1S1VB 2VG7A 2W2NP 4X65J 1I51B 1VFJA 3DLGA 2N3LA 2GIQA 2O66A 3BDEA 4Y6IA 2XEXA 2C2MB 5K14B 4OHYA 3TWZA 1WHVA 2IM2A 2AT1B 3M6UA 4IFVA 3PDNA 3LUYA 2V4JA 4HACA 1J5OA 4RW9B 5KFEA 1S6OA 2X1FA 2FJBB 3IMQJ 2DNKA 2C3UA 1TL1A 3Q2SC 3UN5A 4QWDA 2L41A 3CJ3A 3SSSA 2YQ1A 3GQCA 4C3LA 1S49A 3K5LA 5BYQA 3W62A 4OX7A 3SCIE 2BX6A 4CTAA 2ROGA 2PI5A 3OJSA 3OPKA 2CJBA 4PQUA 1D8YA 2RUGA 2W7OA 1FKOA 2CWKA 4I2QA 3TI0A 3AHPA 2LYVA 3R6GB 4QU6A 1YJVA 4FN5A 3RB4A 4ZVRB 3CIZA 1RTDB 3HSGA 2LECA 4L73A 4PXDA 7AT1B 4KKOB 2X1AA 2VFRA 2AF6A 4NRTA 4OYIA 1VRQC 3EJMA 4WYWA 3PW2A 3UDVA 3HMJG 2FB0A 3HI9A 1TKDA 1VQKS 3QT8A 3BKUA 2IJNA 3PHEA 4MK7A 2LXFA 2YNFB 4ERDA 2V2ZA 2RF2B 3H25A 1NK5A 1H98A 3EZ5A 4DLGA 3R1LA 2W7PA 4JV5F 1VHFA 1N5TA 4F25A 4DV3F 4H54A 3CF5Q 3KG0A 3G6YA 2ZH2A 4PUOA 2FZCB 2HFOA 2QGFB 1JLAB 3CDBA 1SBRA 4KHPJ 3I87A 3PZPA 5FD1A 5B09A 2AJQA 4LBPA 2JSXA 4E2FB 5DDOC 4DR4F 1Q7YT 2W2MP 3IS9A 4ZIVA 1RUSA 1RAGB 1BUXA 4JI0F 1NDLA 1N33F 2HGLA 3DRRB 2JWNA 1K0TA 1VOMA 4USJC 4JI7F 1PG5B 3DRSB 3CJKB 2HQIA 1SPBP 2GHPA 4DV5F 3R5AA 5L1LA 1R43A 3OSNA 4ZVGA 4M95A 2F4VJ 4A8QA 1X5TA 1LXJA 2BJ7A 3D6FB 5I3QA 2XY5A 1O5JA 5KFZA 3AFGA 1YBTA 4NX9A 2MZ1A 3MCNA 5KFVA 3DOLA 4X66F 2JEJA 4ZMMA 1Q81T 1KLNA 4IOCQ 4H4OB 3U1NA 2ZWOA 3D2WA 4X2BA 4ZP9A 3KHLA 4DR5F 3MECB 2Z0GA 3KOAA 2GJ2A 1C1CA 1LWFB 3J7ZT 1QM9A 3SZ2A 4ZP8A 2X7IA 1CG2A 4RNMA 3A3NB 3T6JA 4PYDA 3DOMA 3I31A 4ETZA 4BLGA 4O44B 4GC7A 2VKRA 4LMZA 1Z2LA 1WKLA 4P74A 1FX4A 3RG6A 1U09A 1AUSL 5DQHA 2BW7A 3D66A 1HNZF 4DUTA 2J5AA 4JB8B 4ZN1A 1P6TA 1PKUA 9RUBA 3TO8A 5BJRA 1NK8A 1T11A 4DSEA 3FSXA 3M8SA 3OJUA 1PYTA 1YJUA 2VZ9A 2BM0A 3PEJA 4DN9A 2HZCA 1UWAA 2BMBA 1IKYA 2VFTA 4AE5A 1RWPB 5J1PA 3ILJA 4J90A 2DIVA 4OI6A 5HO4A 4CIOA 2W4DA 4EYIB 4YP3A 2HHTA 1DHMA 2JOQA 1SB6A 4AT1B 1VBKA 5C42B 2ASLA 3H7HB 2HVDA 2KH9A 3PYDA 2NXJA 5ETNA 4O23A 1KR4A 3DGPB 4YDDB 4DFPA 1HPZA 1ULRA 3D67A 5A2QU 2ALZA 4NYPA 1REVB 4B3TJ 1GTHA 3P6YC 2ZDPA 2WOMA 3Q86A 1Y5NB 2ZZNA 1RACB 3HT0A 4H4MA 1VQ9S 2VB6A 5JVHQ 3M8PB 4WP3A 5CCMA 2OKQA 2ROPA 4JV0A 2K1RB 3W3SA 2D3ZA 1HI1A 4Y28C 2MTLA 1RWOB 2Q1LA 2OMOA 3AQOA 1X5PA 5KFFA 4DQQA 1SUQA 4M5KA 3DM2A 3JTNA 2JDJA 1Q86T 2YKMB 1VBZA 2ASDA 2ZBIA 3P5BP 4HDGA 4DMZA 3K8VA 2JC1A 3ILOA 3FBFA 4ICLA 3MURP 1TKXB 1JLFA 4KQZA 3K8WA 1H6KX 2Z4PA 2Y1IA 4JI8J 4CT9A 4FF2A 3MM6B 4OX8A 4B9TA 3I5BA 5K8PA 1IXKA 2JH3A 4ECYA 1V5IB 2UVWA 3OR1B 4GVLA 3CSKA 3QIPA 3MM7B 3EXCX 3V4MA 1RT2B 2PI4A 1RCXB 3TARA 3KLFB 5H9FK 2DY1A 1WWHA 4QCLA 2M0GB 1R3NA 1C0TB 1OMSA 1XMOF 2UV8A 3SQGB 3T1HF 4JI1F 3HVTB 5H9EK 1JJ4A 2YNHA 2K8GA 2Q6BA 4AL6A 4TY8B 2RT3A 3UN3A 2QYGA 2RQKA 4MFBB 3ZZUA 2PIIA 3LH2S 3G6ES 2NS1B 4CM2A 4RW6A 1KRPA 1RBLA 2X3DA 3HF5A 3P4UB 4FPRA 3DDKA 3G6VA 3QJPA 3V6DA 2PEBA 2DK2A 1RT7B 3BF4A 4O3QA 2C2RA 1R0AA 2XYHB 2P6SA 4AFFA 1RT5B 3PFEA 2UUBJ 3FZ2A 4JV1A 4PCQA 5IS2A 2R2TA 3LALA 4ANCA 2OEMA 4DLEA 1NHVA 3GTYX 2VDHA 1WJ9A 2QLBB 3UWTA 3C16B 2DKOB 2BJ9A 2LQ5A 3DCAA 1U2FA 2XULA 1RGVA 5KFKA 4IQMA 2JLFA 4M5DA 1BQNA 2DO4A 3P45B 5D6GA 4LUBA 3MEEA 3OFEA 1HNVB 2DO0A 3CJ8A 2VFSA 4YMEA 2MKIA 2DYAA 2A2CA 1N54B 1BQMB 2F1FA 1AYEA 1VC0A 3T3FA 2AP6A 2F9JA 2KVQE 1NJXA 4GC6A 4RNNA 2LEAA 4J9RA 5J2QA 3NGKA 2XO7A 1FD8A 4KAIA 5GMEA 3AOAA 5IV4A 2DPJA 3ILIA 3DYAB 2CPXA 4KTQA 4M5JA 4WU3A 3W9HA 4DG1A 2GV1A 2NLWA 3G4SS 1RWKB 1VBXA 2X1BA 1ZZFA 3BGRB 1TUVA 3EVMA 4QIFA 4WYLA 5DDRC 2XM3A 1JJHA 3EPIA 2HNDA 4QWAA 2HNYB 3HK2A 2QLXA 4K50A 5B0EA 2ZJQQ 3TVKA 1P9QC 3K89A 3MAQA 1SC4B 3RGIA 2IRYA 5HAOA 1VJQA 5GAEI 2Q66A 2BW2A 2YWEA 4QZVB 2ERRA 3R5BA 1SJ4P 1RTJA 2WVDA 5IWAF 3V6HA 4YOEA 1HHSA 2G0JA 4OYPA 3O6QA 3TZYA 3LPEA 1WC5A 2H51B 5KFIA 1VRTA 2ZHOA 4Y3CA 2V2KA 2DNZA 1U48A 3HULA 2KZMA 2OIHA 3CJ2A 1N36J 4H4KA 1NKBA 1AZSB 1NBEB 4NWBA 4X4QA 3KG4A 3G87A 3MTKA 1T9WA 3W1YC 2RB7A 3I55S 3HO1A 1H2UX 1PGZA 3NKYA 3P3DA 2BDPA 2FGOA 4OYWA 4S0MA 3B4MA 1S0NA 2QMUB 2DR6A 4Q0BB 1RT1B 1S1TA 4WKYA 1S9FA 2DRBA 1UFLA 2FHOB 3M05A 4HT5A 1NSAA 5DQGA 3MFIA 1M1GA 4ZPVR 4DZDA 2YX4A 4HHUA 4IH5A 3ZTSA 3M9MB 1NM2A 2DNLA 3KDNA 3G82B 1HQEB 1IBLF 2F4FA 2K7JA 3DLJA 2AYEA 4QYRA 3DI6A 4RX6A 4BBYA 1FK9A 5IC4B 3L4BC 5KAKA 4X64F 1O51A 4D3GA 1LEOA 5A76A 1GFWB 2FLOA 4DCOB 4DZ6A 2FLPA 3JSRA 2N4DA 3QIDA 4YB6A 2W25A 4USHA 2VQEJ 3IA0A 3QT5A 5CYQA 3E51A 5A8KB 1OSDA 4Q2MA 2G2YA 1RDRA 4EYHB 5C2CA 5KFDA 2LQ8A 1F5BA 1HBOB 5IM0B 1NDKA 1F3VA 5JXSA 5I42B 3OUYA 2W9CA 5DM7Q 3HHLD 2V8PA 2DNQA 4YR0A 3VALA 2VH7A 1VLYA 1RYSA 1ZYQA 3QSIA 1FTRA 1R6VA 2E5GA 1NZ8A 2VBYA 3ZZPA 2ZUAA 4ILMA 4Y2KA 2IMOA 2DNRA 4F67A 4CLSA 4DSFA 1NK9A 4DV6F 4ZHRA 2CQ1A 3J81U 1ZM3A 2I2YA 4W92B 2OPPA 4RO0A 1M5KC 2RS2A 2HBZB 1M90T 3NGTA 3OL9A 3OTEA 4LRDA 2C2KB 3IR5B 3MMAB 3OLAA 3EWGA 2A1BA 1IR2A 2DXFA 8RUCA 4LJMA 2CNLB 2LCWA 4NA1A 4ED6A 5KT4A 4PWUA 3RZAA 3C6TB 3G2XA 2HLTA 1U49A 5BYRA 3KJQB 2GIRA 5EGYA 4K4TA 1S4EA 5EWEA 1WELA 1T9YA 2RQCA 4OI3A 4XIUA 3NY0A 3ET6B 1QD1A 2WZ1A 2VOPA 2UU9F 1K44A 2VODA 1RBAA 2XLIA 2DH7A 1Q79A 3M8YA 2NSCA 5B0AA 2XCAA 5K5MA 3MMCB 4IOAQ 1N4LA 2HHVA 1NKCA 3VAGA 5FLXU 2ZJRQ 1U25A 3V4IA 2N7YA 4NMLA 4OX9F 1D8ZA 1LWCA 2CNOB 5DLFA 2HBRB 3L7PA 4U6PA 2AU0A 1T03B 3NG8A 2QC3A 5D0EA 2QMWA 3SIPB 2V9KA 3ISNC 5M2RA 1NH7A 3MUTP 1HNXF 1UPMB 1FO1A 1ZAXA 1MMNA 1HD1A 2F8MA 2BRLA 2WVBA 3I6PA 4I4BA 2P2CB 2VOOA 2OPSB 2BYCA 2D69A 1HBUB 3LGHA 1NK4A 3K2YA 1U1MA 3TAPA 4WIIA 1WG5A 3QNWB 4C48A 1DJ0A 4PAAA 1Y7PA 1D0EA 3KK3A 2ZM6F 1UEKA 3CUNA 3ENAA 3N9UC 4I7FB 1DAXA 1QTMA 3MMJA 4HT7A 1XR7A 2QZ8A 2DGOA 4N7TA 4NCGA 3RBDA 1VGYA 2BJ8A 2EFPA 2HGNA 2ZITA 3LGNA 2DD8S 3F44A 4HR2A 4C11B 2IDEA 2NZ4A 4I6AA 2E1AA 3VAHA 1GH8A 4KYZA 5L1IA 5AXNA 1PAUB 2PN6A 1V5VA 4KY3A 2XMAA 1SV5B 1HBMB 3QO9A 3L7OA 3I5CA 4CQ1A 2YH1A 1KBRA 1LKZA 3MM5A
chains in the Genus database with same CATH topology
5BXIA 2AZ1A 1KDNA 3WX8A 3Q8UA 1U8WA 2CWKA 3EVMA 3FCWA 2DXEA 4S0MA 1S59A 3VGUA 3VGSA 4ANCA 1NLKL 3FBEA 3Q8YA 1NDCA 3B54A 3ZTQA 1F6TA 2VU5A 3GPAA 1WKLA 1K44A 3Q86A 3BBBA 3DKDA 1HHQA 1WKKA 3ETMA 1W7WA 1HIYA 3FBBA 2ZUAA 3BBFA 1BE4A 3ENAA 3L7UA 4UOGA 1B4SA 3EE3A 3R9LA 3EVWA 3DDIA 3NGSA 1XIQA 3EJMA 4DUTA 2B8QA 4CP5A 1NSQA 1PKUA 3ZTOA 3ZTSA 3Q8VA 1XQIA 1HLWA 3FBCA 2DYAA 3FC9A 5CABA 4DI6A 3NGTA 4ANEA 3VVUA 3EM1A 1MN7A 4FKYA 1VYAA 4ANDA 1NHKL 2BEFA 3NGUA 4HR2A 5CAAA 3EMTA 4KPCA 1LEOA 2NCKL 4UOFA 4O0NA 2DXFA 4WBFA 1ZS6A 1B99A 3EICA 3PRVA 1PAEX 3ZTRA 3VVTA 1MN9A 1WKJA 4DZ6A 1NPKA 2B8PA 4F4AA 3G2XA 3FBFA 3VGVA 3BBCA 2AZ3A 3NGRA 1JXVA 1S5ZA 2HVEA 3VGTA 1F3FA 1NDPA 1NSPA 4UOHA 3EVOA 4EK2A 1S57A 3BH7B 4ENOA 1UCNA 5C7PA 4C6AA 1NUEA 2HURA 1EHWA 2BX6A 3ELHA 3JS9A 1NSKL 4W98A 4F36A 3B6BA 1BHNA 5IOLA 1NCLA 2DY9A 2HVDA 3FCVA 3PJ9A 1BUXA 1LWXA 3MPDA 3BH6B 3Q83A 3GP9A 3Q89A 2DXDA 1NDKA 1NDLA 4FKXA 3ZTPA 3FKBA 1NB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BXI A;  2AZ1 A;  1KDN A;  3WX8 A;  3Q8U A;  1U8W A;  2CWK A;  3EVM A;  3FCW A;  2DXE A;  4S0M A;  1S59 A;  3VGU A;  3VGS A;  4ANC A;  1NLK L;  3FBE A;  3Q8Y A;  1NDC A;  3B54 A;  3ZTQ A;  1F6T A;  2VU5 A;  3GPA A;  1WKL A;  1K44 A;  3Q86 A;  3BBB A;  3DKD A;  1HHQ A;  1WKK A;  3ETM A;  1W7W A;  1HIY A;  3FBB A;  2ZUA A;  3BBF A;  1BE4 A;  3ENA A;  3L7U A;  4UOG A;  1B4S A;  3EE3 A;  3R9L A;  3EVW A;  3DDI A;  3NGS A;  1XIQ A;  3EJM A;  4DUT A;  2B8Q A;  4CP5 A;  1NSQ A;  1PKU A;  3ZTO A;  3ZTS A;  3Q8V A;  1XQI A;  1HLW A;  3FBC A;  2DYA A;  3FC9 A;  5CAB A;  4DI6 A;  3NGT A;  4ANE A;  3VVU A;  3EM1 A;  1MN7 A;  4FKY A;  1VYA A;  4AND A;  1NHK L;  2BEF A;  3NGU A;  4HR2 A;  5CAA A;  3EMT A;  4KPC A;  1LEO A;  2NCK L;  4UOF A;  4O0N A;  2DXF A;  4WBF A;  1ZS6 A;  1B99 A;  3EIC A;  3PRV A;  1PAE X;  3ZTR A;  3VVT A;  1MN9 A;  1WKJ A;  4DZ6 A;  1NPK A;  2B8P A;  4F4A A;  3G2X A;  3FBF A;  3VGV A;  3BBC A;  2AZ3 A;  3NGR A;  1JXV A;  1S5Z A;  2HVE A;  3VGT A;  1F3F A;  1NDP A;  1NSP A;  4UOH A;  3EVO A;  4EK2 A;  1S57 A;  3BH7 B;  4ENO A;  1UCN A;  5C7P A;  4C6A A;  1NUE A;  2HUR A;  1EHW A;  2BX6 A;  3ELH A;  3JS9 A;  1NSK L;  4W98 A;  4F36 A;  3B6B A;  1BHN A;  5IOL A;  1NCL A;  2DY9 A;  2HVD A;  3FCV A;  3PJ9 A;  1BUX A;  1LWX A;  3MPD A;  3BH6 B;  3Q83 A;  3GP9 A;  3Q89 A;  2DXD A;  1NDK A;  1NDL A;  4FKX A;  3ZTP A;  3FKB A;  1NB2 A; 
#chains in the Genus database with same CATH topology
 1E6V A;  2VPW B;  3Q8U A;  1S9G A;  1UVL A;  4HKQ A;  1VI7 A;  4ZVU B;  4FYD A;  3UD5 A;  2HYI B;  4UQG A;  4TU8 A;  2JEI A;  2UVR A;  2AWZ A;  2VJU A;  4ZVF A;  2RU9 A;  2XSF A;  1V9O A;  2H9Z A;  2KI2 A;  1VIS A;  4DV2 F;  2KN4 A;  2B3T B;  5H9F J;  2HWH A;  5HAT A;  3IR6 B;  2BKP A;  3R5J B;  2FVS A;  2OD4 A;  1TK5 A;  3UW1 A;  1G3O A;  4GVB A;  2C2N A;  5H9E J;  4F3O A;  4OZN A;  1SQG A;  5DG9 A;  1X0F A;  2ZBP A;  1ZAW A;  3MAA B;  1H0H B;  2EW9 A;  3D6H B;  5KFO A;  3PTW A;  3RB6 A;  2M88 A;  3BGU A;  4LBI A;  4RW4 B;  2HQD A;  4IDK A;  1S6P B;  3GE9 A;  3C6U A;  1Q0N A;  2Y0S D;  5JVG Q;  1XWL A;  4K2X A;  3GR0 A;  4K4Z A;  1S76 D;  3BSA A;  2DPI A;  2CFX A;  3GYN A;  1S7I A;  2XMT A;  2FLN A;  9ATC B;  3MD3 A;  4PG5 A;  2BBE A;  2VG7 B;  5E3C A;  2VU5 A;  2H4Y B;  2YPZ A;  3DLG B;  1RE1 B;  3DRP A;  3P96 A;  4JV5 J;  4KV8 A;  2DNH A;  1KNZ A;  5HVF A;  2KT3 A;  2R7Q A;  4DUZ F;  4IRK A;  4DV3 J;  3FUY A;  3NRB A;  2MQP A;  3W61 A;  2V68 A;  4N8O A;  2ZVS A;  4PG4 A;  4IFV B;  3KUG A;  2GO9 A;  2V4J B;  5D78 A;  2QT7 A;  1S0M A;  3A8E A;  2KHC A;  4HAC B;  1J5O B;  3CCW A;  1S1U A;  1W25 A;  3TX8 A;  3W2W A;  4JI0 J;  1Q95 G;  1TL1 B;  2XMU A;  3Q22 A;  3NGD A;  4EUV A;  1N33 J;  1CVJ A;  4HVZ A;  3FK4 A;  3MR3 A;  2BXJ A;  3PCO B;  4JI7 J;  1QAJ A;  4ZPC A;  4CTA B;  4DV1 F;  2CQC A;  3RAX A;  4DF8 A;  4DV5 J;  2MZR A;  2RVJ A;  3UNY A;  2KRR A;  1EP4 A;  1RT4 A;  4PQU B;  1FKO B;  4I2Q B;  2CVI A;  5DM6 Q;  1YKW A;  1KFS A;  3HX9 A;  3EUN A;  2OEL A;  1HI8 A;  3BSN A;  1Y00 A;  2NUU G;  1K0V A;  1N6Q A;  2DXD A;  5HMZ A;  5I3U A;  2G2Z A;  3GV7 B;  2XMM A;  4QPX A;  4RU9 A;  3MCM A;  5CXT A;  5GAG I;  4IRD A;  1T7P A;  1U2C A;  5KT5 A;  2JZ5 A;  2VA3 A;  4ZVS B;  4X66 J;  3R3T A;  1GXT A;  2YKP A;  2CQB A;  4ZVH A;  4CLU A;  3UD3 P;  2GML A;  4JI4 F;  4DR7 F;  4DR5 J;  4RJV A;  5DQI A;  3V6J A;  1SJQ A;  2DNO A;  3W66 A;  1XQI A;  3Q8S B;  3GIM A;  2YWW A;  1FJ7 A;  5FJ4 A;  4CLL A;  2XGP A;  2KT5 A;  4PUO B;  8AT1 B;  4LIW A;  1R8C A;  2MKY A;  4EO6 A;  5H1S V;  3MCO A;  3V2U C;  3IS9 B;  2J0W A;  4F4A A;  2M7S A;  2AW0 A;  4ZPB A;  4BCA A;  2Y9H A;  1HNZ J;  4YY3 F;  1NUE A;  3VHQ A;  1O0P A;  3E2E A;  3S8S A;  2UXD J;  1IM4 A;  4KC5 A;  4NRU A;  4O4G A;  3PYE A;  3R27 A;  1X5O A;  3LO3 A;  2E1C A;  4ZVQ B;  4I56 A;  2JLE A;  3BN7 A;  3BKF A;  3HSJ A;  4EEY A;  2LXU A;  2C3O A;  5KFP A;  4HI2 A;  4WU2 A;  4NXN F;  4R0J A;  1OYD A;  3EVW A;  3ZZZ A;  1AXQ A;  3D4J A;  1HWJ A;  4DBQ A;  1HI0 P;  3IGN A;  2CIM A;  3HPO A;  3WIU A;  2AJ4 A;  3DOL B;  2I5J A;  4WP9 A;  4C97 A;  2LEP A;  1OSC A;  3VZH A;  2VL1 A;  3AJ1 A;  4OFZ A;  1U8S A;  2EBE A;  2FJV A;  2CZ9 A;  4A8S A;  1FRL A;  3OTC A;  1CJV A;  1PAE X;  1VQO S;  2XHW A;  4ALZ A;  2B8P A;  2E7X A;  1C1C B;  3TZZ A;  3N6N A;  2J0S D;  3W2V A;  4F4K A;  3PKY A;  1JXV A;  3QFH A;  2JHE A;  1QVF R;  2AYM A;  1PCA A;  1I5O B;  4NLG A;  2CDR B;  3DOM B;  1JJC B;  3A13 A;  3ULH A;  2D3O 1;  4LRB A;  3PJX A;  2ZH9 A;  3A8K A;  4RW8 A;  2HK2 A;  2FYX A;  2V6A A;  1RAJ A;  3OT9 A;  2KL8 A;  4KRW A;  2JNJ A;  3ISN D;  1S6Q A;  4YS2 A;  3FCH A;  2B4V A;  2DHX A;  1T3N A;  2BRK A;  4KH0 B;  2XQC A;  4Y2C A;  3EZO A;  2COL A;  1TL7 A;  3HSD A;  1IKY B;  1KLM A;  4IH7 A;  2J8S A;  2R7U A;  4XTT A;  4ECZ A;  2JEG A;  1M5O C;  1TKZ A;  4IKA A;  1K9M T;  3HKZ D;  5HQL A;  3I9V 9;  2VPY B;  2AYB A;  5KG2 A;  3QJL A;  2AQ4 A;  5THW A;  3GSI A;  4A46 A;  3AJD A;  3BJY A;  2A0F B;  3GFH A;  3VCD A;  2DNP A;  2DNG A;  1RLD A;  2EFG A;  3KJN B;  2KZZ A;  4J9O A;  1HPZ B;  4IUF A;  4WFN Q;  5KFQ A;  4WFX A;  4DU8 A;  2KYX A;  2DNY A;  3Q83 A;  2WOM B;  3THV A;  1XMO J;  3N6M A;  4OYB A;  4H4M B;  3T1H J;  4CLF A;  4JI1 J;  1EZZ B;  1ZET A;  2DXE A;  4WFZ A;  1FXD A;  3CCR S;  2IVF B;  3V6K A;  1BWE A;  1R27 B;  1PYS B;  1UET A;  4LF7 F;  1XR5 A;  3BB5 A;  3EZU A;  1HW8 A;  1SUQ B;  5RUB A;  3DM2 B;  1QUP A;  3VZI A;  2D7S A;  2MGZ A;  4J9V A;  3EDR B;  1YZ7 A;  4DR6 F;  3UFC X;  4ICL B;  2Y8W A;  4AQY F;  2XNQ A;  4MIA A;  3KFW X;  1JLF B;  4OHZ A;  5ETS A;  2R8H A;  1CC7 A;  2R8K A;  2V34 A;  5F0U A;  2A6O A;  4LF5 F;  3ELH A;  3HCX A;  2NXU A;  4PAB A;  1F6T A;  3GPA A;  2ZD1 A;  2XMV A;  1R8B A;  3QIP B;  1RXO B;  4DX8 H;  4JOU A;  2HIQ A;  3J7Y U;  4B9S A;  4NL5 A;  1S7H A;  2R7S A;  1R8A A;  2J6U A;  4L76 A;  4ER8 A;  2XHC A;  1S9E A;  2M3D A;  4TYA A;  2HFU A;  4RWW A;  4CCH A;  3TVZ A;  2Z2Z A;  2H5I B;  4LF2 A;  1VR6 A;  2YNH B;  2MQL A;  2I1R A;  4EBC A;  3CE8 A;  1LK7 A;  1FVQ A;  3O44 A;  2KFZ A;  2LP4 A;  2LDY A;  4DJB A;  4JV2 A;  2VIC A;  3R8Y A;  2PGC A;  2J0Q D;  3OR2 A;  4RW6 B;  4NLW A;  4DL2 A;  2VFV A;  1OYE A;  2I8E A;  2A2D A;  3V6D B;  4O3R A;  3EIC A;  3PRV A;  1GMU A;  3QZ8 A;  2BUN A;  5KT2 A;  1R0A B;  1W26 A;  1BXN A;  2CDQ A;  2AGO A;  1WHW A;  1JMT A;  4HHJ A;  2LQB A;  3CED A;  2NYI A;  1RWN B;  2Y3Y A;  3M8W A;  1OPZ A;  5EUH A;  2E9Z A;  3W8G A;  1X4C A;  3D0I E;  4OHW A;  4ZCI A;  3A4T A;  3WX8 A;  1S1X A;  3T6B A;  3PW7 A;  5IWA J;  2HFV A;  4X4T A;  1B7F A;  4G6V B;  1K47 A;  3HHE A;  4M5D B;  1BQN B;  3H98 A;  5KFR A;  2CVE A;  3ZNJ 1;  4OI4 A;  3MEE B;  4CH7 A;  2ZH8 A;  1NPP A;  3MUM P;  2B9Y A;  4EZ6 A;  2VA2 A;  3BYP A;  2ZDO A;  2Z2M A;  4QW9 A;  2IMW P;  3BR8 A;  3Q8V A;  1SQF A;  4AUK A;  1IUJ A;  2AEJ A;  3DFE A;  3PJW A;  1WHY A;  5J2Q B;  4U96 A;  4FYV B;  2QFI A;  1A9N B;  4ZK7 M;  2MHN A;  2BOP A;  4HHH A;  3BR9 A;  4CI0 B;  2ASJ A;  4IFY A;  3IM9 A;  5C2G A;  2MKH A;  1UFW A;  2E1M C;  1CQM A;  1HQU A;  1JNR B;  4DG1 B;  3PO5 A;  2WAQ D;  3KDO A;  3LGM A;  5ETQ A;  2HVE A;  4DPW A;  2UUA F;  3VGT A;  5KG4 A;  3K5N A;  4DFM A;  3IAS 9;  1WAC A;  3UDC A;  2JVR A;  4NEY A;  1RHK B;  2HND B;  3FCV A;  4ID8 A;  4DUY F;  3OL7 A;  2KXN B;  4JUZ A;  1IBL J;  1HBN A;  4TYB A;  2CPZ A;  4X64 J;  2A18 A;  3TX0 A;  1K1Q A;  2N82 B;  4C3M A;  4ILL A;  2KJW A;  1JLB A;  3LWM A;  1PBA A;  4RUH A;  1RTJ B;  3T9N A;  5K9F A;  2B8Q A;  5KOX A;  4AXJ A;  2CAD A;  3SSR A;  3RBX A;  3LF0 A;  1R8H A;  1HMV A;  3IWX A;  4WWS A;  4C8L A;  1VRT B;  2RIJ A;  3GR1 A;  3GJS B;  4K2J A;  4H4K C;  3JQJ A;  4TQR A;  2MZJ A;  4WBF A;  5BYS A;  2XYP B;  4NLO A;  4L6V 3;  1L3T A;  2ZBQ A;  2MKK A;  1F9F A;  3MPY A;  4LSZ B;  4DV6 J;  1RU2 A;  1Q5V A;  2I6W A;  2PFF B;  1LW2 A;  4U95 A;  2GQC A;  3H2V E;  1APS A;  1S1T B;  1P27 B;  2POK A;  1H38 A;  2C22 A;  3JTO A;  1UVM A;  3D7S B;  5HVG A;  3D28 A;  2QL5 B;  3SSQ A;  5J2M A;  3EXY A;  2BE7 D;  4DX6 A;  4XK8 C;  5ETP A;  4ZOS A;  3Q8R B;  5E5N A;  3EE3 A;  1TZ0 A;  1RAE B;  3WX4 A;  3MM9 A;  3DI6 B;  1FJE B;  1FK9 B;  3F41 A;  5KFU A;  2LU1 A;  2ZH6 A;  2WW8 A;  1IVZ A;  4O3P A;  1YJN S;  1YJW S;  2BE9 B;  1HYS A;  2IRX A;  1DLO A;  3LQV A;  1S0O A;  3P8B B;  3I0S A;  5CYQ B;  1ZS6 A;  2JFD A;  1TL3 A;  1X31 C;  4A48 A;  2UU9 J;  4WFA Q;  1QDU B;  1IBM F;  3SV4 A;  1NPK A;  3CCZ A;  2YKQ A;  5EN1 A;  1OPI A;  2UV8 G;  1NKE A;  2UXB F;  4K4W A;  1F3F A;  2AX0 A;  4LSL A;  3OUY B;  2W9C B;  3IGV A;  5CHC B;  3PX0 A;  5IV3 A;  4IO1 A;  3V81 A;  3CJT A;  2NXC A;  2QIF A;  3BH6 B;  1N0V C;  2CPE A;  3AXK A;  3M30 A;  2V8G A;  4K0K F;  3US5 A;  4CLP A;  2DTJ A;  2W1B A;  3VGS A;  4ZHR B;  4J9L A;  4OX9 J;  3EGV A;  2CPF A;  3THP A;  1X4D A;  1OS5 A;  3G71 S;  2OPP B;  4DV0 F;  4CLZ A;  2QN6 B;  2BQR A;  4ZDN A;  3D9B A;  3MMB A;  3JYT A;  3C2P A;  3DDN A;  1HNX J;  4IG3 A;  1LV5 A;  4CRJ A;  3CCS S;  1IWA A;  1KVI A;  3PYG A;  4P7T A;  1TAQ A;  5D4O A;  4IQX A;  5F8N A;  5HQM A;  3DLK A;  3D0H E;  3O8W A;  4ED1 A;  4ED2 A;  1TFW A;  1B0P A;  1SVD A;  4F0K A;  3CPW R;  1EJ7 L;  4ZLN A;  1B0T A;  1NEE A;  2DGQ A;  1QVG R;  1DTQ A;  4M5M A;  2ZM6 J;  5B0D A;  3DXB A;  4J9P A;  1UVK A;  1RBO B;  5KG6 A;  4DSI A;  4F8R A;  4U7U D;  3H5X A;  1FA0 A;  2HUR A;  1FRM A;  4W98 A;  2QL9 B;  3TYT A;  2DRA A;  4Q43 A;  3FMW A;  1NCL A;  5T14 A;  4URG A;  1F9H A;  4EWT A;  1C1B A;  1S59 A;  3KNG A;  3RTV A;  2E5L F;  3CDU A;  1U6B A;  3J80 Y;  1ICE B;  1FWK A;  4QU7 A;  4OV6 A;  1U6Z A;  3UR0 A;  3KMS A;  3V4I B;  3KK1 A;  2XB2 D;  1UL3 A;  2GQQ A;  1KVK A;  1XIQ A;  1EAY C;  4RNO A;  3PG9 A;  2UP1 A;  3CD7 A;  2AGQ A;  1LWC B;  1U02 A;  4RKU C;  1KON A;  4PZV A;  1VQ4 S;  3AOB A;  4Y2I A;  1NHK L;  2MQQ A;  1OY6 A;  2B4U A;  3UN2 A;  1YGY A;  3TZW A;  3MPW A;  3CJR A;  4ID5 A;  2RIL A;  4KIA A;  1VIO A;  1KKH A;  3W7B A;  3RB0 A;  5E3Q A;  1XMB A;  2CJY B;  3JS9 A;  2QJ3 A;  1VDH A;  1DTT A;  1ZOT A;  4DV2 J;  2VDI A;  3KK3 B;  3NNA A;  2EFN A;  2H5E A;  2XTJ P;  3QPI A;  1JLC A;  1ZA2 B;  1RJJ A;  2BJE A;  3TAM A;  5F0W A;  4NCG B;  4P2S A;  1M0S A;  3FEY B;  2HS4 A;  5F3T A;  2IIH A;  1FES A;  4L75 A;  2XO6 A;  1WDD A;  2MHE A;  2EKN A;  4LVN P;  4V19 J;  1VJW A;  2GVD A;  2JL9 A;  1NSQ A;  1KWM A;  4X4S A;  2Y0B B;  3CT9 A;  1B64 A;  3UNG C;  4Q8E A;  4DI6 A;  2X51 A;  2W24 A;  3T19 A;  4DPY A;  5HL7 Q;  1N34 F;  3NGU A;  4CO1 A;  3SFU A;  2FGC A;  5EX0 A;  4KGM A;  1QJH A;  3HZG A;  1MLA A;  2F9D A;  3U02 A;  1TAU A;  4PYA A;  3QO9 B;  4ZIT A;  2E9T A;  1YQH A;  2CG8 A;  2ZOF A;  3Q2T C;  4UZC A;  1MRO A;  5D15 A;  4DUZ J;  1B70 B;  2W9B A;  1EKS A;  3MM5 B;  1XNQ F;  2H3E B;  1GMW D;  1E6V B;  4JYA F;  2D3U A;  1S9G B;  4OHV A;  2J8A A;  3DC2 A;  2HRT A;  2BAN A;  1TU0 B;  4J9S A;  3HVA A;  4Q5V A;  1EET A;  4EU0 A;  4DFJ A;  4OJ3 A;  1I94 F;  1K1S A;  4WZM A;  2B9E A;  4DV1 J;  4Q2L A;  3MCS A;  4NLR A;  2IFX A;  5KFN A;  3AXM A;  5G0R A;  2BQ3 A;  2RAQ A;  2UUW A;  2UUT A;  5LXY A;  2FIU A;  4W90 B;  4GVB B;  2HVH A;  4WCE Q;  2BE2 A;  1HLW A;  2QLF B;  4HTJ A;  2WVC A;  5CZX A;  2PC6 A;  2WVF A;  5CAB A;  3IRX A;  2XS2 A;  2QL7 B;  5GAG U;  3OVB A;  2RNE A;  4EFA C;  4ECV A;  3DRY A;  4ZPW R;  3O5T B;  4IDK B;  1URR A;  3GV8 B;  3CWJ A;  3AD8 C;  4F4W A;  3C6U B;  4JI4 J;  4DR7 J;  2DGV A;  4LRC A;  2ZE2 A;  2CJQ A;  1ZBT A;  4IG0 A;  4P9S A;  2HHP A;  1FER A;  1UVI A;  5DLG A;  1LNQ A;  4PEO A;  2H1Y A;  2Y1J A;  3DRP B;  1P1L A;  4KV8 B;  3KG1 A;  4DF4 A;  2KKH A;  4QPT A;  1DQ9 A;  1KDN A;  3OBI A;  4A8K A;  4DL7 A;  4WK3 A;  2HGM A;  3TUI C;  4WJB A;  2KM8 C;  4NLD A;  1RHU B;  1S1U B;  3VQS A;  3W2W B;  1MWZ A;  3R9L A;  4WP8 A;  4ATN A;  3NWG A;  4C8M A;  3MF5 A;  4YY3 J;  4IR9 A;  3M8Q A;  4NI2 A;  3TJ9 A;  4LIR A;  2X3G A;  2V63 A;  3H4D A;  3H4B A;  1EP4 B;  1RT4 B;  5DDQ C;  4OZ2 A;  2M52 A;  3GIK A;  3OQ2 A;  4MIW A;  2MZQ A;  2MKJ A;  4K7Q A;  3HHK A;  3K58 A;  4DV7 F;  4CZC A;  5E3R A;  1MN9 A;  1OJ4 A;  2VON A;  1N6Q B;  3DNC A;  1S1W A;  2QYC A;  3IWL A;  4NXN J;  1WEX A;  5I3U B;  3QRQ A;  2DHS A;  3I4P A;  1FDA A;  6FD1 A;  1NJZ A;  4OYX A;  1T05 A;  4WKR A;  2HW3 A;  3UD4 P;  1XJW B;  1VK3 A;  3N5F A;  5A8W A;  4E0D A;  1RT6 A;  3H2U B;  3KKF A;  3NOC A;  1Y3K A;  5GVQ A;  1BY9 A;  1L3K A;  5F9L A;  3MR5 A;  4FBU A;  3WQP A;  2R7V A;  3D5M A;  2A6M A;  2HPU A;  4K4X A;  3M7V A;  4DL3 A;  2ATL A;  2E1P A;  2QA4 S;  4KJI A;  3W60 A;  2FY8 A;  2FVP A;  4YDX A;  1SH3 A;  1UJ4 A;  3PR4 A;  2RQ4 A;  3AJ2 A;  3C19 A;  3H5Y A;  3K5M A;  4LF9 F;  3JAM U;  5GMD A;  3AA8 A;  3IG1 A;  4ECS A;  4EZ9 A;  3W5Y A;  4ES1 A;  1U47 A;  2J9C A;  2CRL A;  4FNH A;  3GIJ A;  4UQT A;  4MKB A;  3PX6 A;  4Y00 A;  2AZ3 A;  4O4G B;  3C66 A;  5B0B A;  3PV8 A;  2IC3 A;  1JIH A;  2E7V A;  2R8I A;  1Z1Z A;  3MEK A;  1KD1 T;  4A8W A;  3KMQ A;  5DRK A;  3RRG A;  1SI9 A;  5ITH A;  3TW0 A;  2DR7 A;  5ETM A;  5KFH A;  2AJF E;  3KJV A;  5B0C A;  2W01 A;  4B3O A;  3I0R A;  2GC8 A;  2YVS A;  2AIR B;  4NA2 A;  3CGI A;  1MWY A;  2VBX A;  1HR0 F;  2I5J B;  1NJW A;  4K4V A;  2XMK A;  3HJF A;  4ES2 A;  3BZQ A;  4HYK A;  4C8O A;  2BQU A;  1AUD A;  4F26 A;  3GIR A;  1A0O B;  1I1G A;  1CJV B;  2J7U A;  2YWK A;  2HVI A;  1P9Y A;  3W2V B;  5J2P A;  1S12 A;  3KLI A;  2NPF A;  5D0R A;  3M6V A;  1X9M A;  4LQ9 A;  2PMH A;  4O4R A;  2IPO B;  2W4C A;  2CNK B;  2CWX A;  2YTC A;  4LR8 A;  2LA4 A;  5K8O A;  3CB4 A;  4LF7 J;  4ELT A;  2VJV A;  4EGL A;  3BPD A;  2MQ8 A;  1Q8L A;  4RW8 B;  1VQP S;  1ZM9 A;  4X4O A;  5KT3 A;  3UO0 A;  2R8J A;  4PXC A;  1U1P A;  1SC3 B;  3RR7 A;  2JRS A;  1IQZ A;  1S6Q B;  2YQ3 A;  4DR6 J;  1B0V A;  2XLK A;  4X4U A;  2FPH X;  3T9Z A;  3BSC A;  4AQY J;  2YWH A;  4ZLL A;  2GS8 A;  3RW7 A;  2HHX A;  4NLU A;  4I6W A;  1NHU A;  1TL7 B;  3DHW C;  2IAJ A;  4DSJ A;  1KLM B;  2A3J A;  2HNZ A;  4WF9 Q;  4CNZ A;  1TKZ B;  3KLV A;  1OQ3 A;  1QE1 A;  4OV1 A;  4CP5 A;  1AB8 A;  3ENQ A;  2H65 B;  4YN3 B;  4LF5 J;  1JLE A;  4P75 A;  5BR8 F;  1NK0 A;  3GFZ A;  3LWL A;  1RKJ A;  3AAW B;  3DMJ A;  3CC2 S;  2GQ2 A;  4B02 A;  2BEF A;  3EPG A;  1YWX A;  2HQ3 A;  4I6Y A;  2UXC F;  4RUA A;  4ZVT B;  2EEY A;  5L9N A;  3MXH P;  2LEB A;  3F73 A;  1YLX A;  1VQY A;  3PW0 A;  3AH6 A;  3PEH A;  4JP8 A;  1E6Y A;  5I4M A;  3QRR A;  2HHW A;  1OIA A;  4MKY A;  5CYM A;  4PG7 A;  4XPC A;  5IC6 B;  4LT6 A;  2YKO A;  2CQH A;  4OLP A;  5IXU A;  3C46 A;  4IH6 A;  1NLK L;  1YK9 A;  4CLK A;  1VBY A;  4NE9 C;  4ZS6 A;  2EFV A;  4ZA1 A;  3ICL A;  4N76 A;  5DG8 A;  1WTB A;  2MGZ B;  3JQK A;  2Z56 B;  3DDI A;  1T9U A;  1Q5Y A;  2PA8 D;  2OO4 A;  3GLJ A;  4DCJ B;  2AJ2 A;  3HHL C;  1ZTT A;  3HT3 A;  3EYZ A;  3BPS P;  2KG1 A;  2YKN A;  2GHV C;  1R7I A;  2ZZT A;  2GJI A;  5HVH A;  4QWC A;  2F63 A;  1XNR F;  4NOH A;  4DXL A;  3CO0 P;  2RRA A;  3D1H A;  3HFZ B;  5JUM A;  3OL8 A;  3BBC A;  3SDE A;  3TUP A;  4DQS A;  2ZD1 B;  4G1P A;  3G9C A;  5KFJ A;  3PJ9 A;  1S9E B;  4C0B A;  3BRE A;  3T5H A;  2C2O B;  2ILY A;  2YBV A;  3MED A;  4YB7 A;  1IR0 A;  4ETX A;  1UJ5 A;  2IYG A;  3TUJ C;  4LF6 F;  1CC8 A;  1WKK A;  2IM0 A;  2W2P P;  1M5H A;  2L9W A;  1J2V A;  4NA3 A;  1KC8 T;  2FVC A;  2UUA J;  4USM A;  3OR2 B;  1UZH A;  1NPR A;  1NO8 A;  2NPI A;  3H20 A;  5E41 A;  2OI2 A;  1KTQ A;  3LP1 A;  5LXR A;  4A8F A;  4DUY J;  1XN9 A;  1U0H A;  2ASY A;  4M94 A;  2PSZ A;  4O3S A;  1OWX A;  1VQL S;  3HKW A;  1RK8 A;  3A8J A;  3B4D A;  1S97 A;  5EDW A;  4HEA 9;  3CCT A;  3KLH A;  3OFG A;  3SXL A;  4ZCM A;  3K0J A;  1JLG A;  5LMU F;  3CIM A;  1YRU A;  3IBF B;  2MPU A;  1EQ0 A;  3BQ0 A;  2RJZ A;  1IJE B;  2E5H A;  1S1X B;  2FHK A;  3NWR A;  4I67 A;  4DR1 F;  4ZJO A;  5DGA A;  1CJU A;  2ZOM A;  1FI4 A;  3UPF A;  3BV8 A;  1RT3 A;  2DGU A;  3JB9 k;  3LAM A;  2P9G A;  3VGU A;  4OMF G;  1QY7 A;  1IJF B;  4CWB A;  1ZPV A;  3RR8 A;  1PJ5 A;  3OV7 A;  1TUG B;  3TQ1 A;  4F0H A;  3HM9 A;  3MEG A;  4KPY A;  4DL0 C;  4O3O A;  5KFX A;  4KH1 B;  4QWB A;  3NAH A;  5HRO A;  4IFY B;  4B3M F;  1XMQ F;  3BM7 A;  3B82 A;  3M2V A;  1PIL A;  2EPI A;  6AT1 B;  1FX2 A;  1ZZN A;  3BDP A;  1AA1 B;  1HQU B;  3VVU A;  4F4Y A;  2OPR A;  3WZ0 A;  1RAD B;  3GWC A;  4FNI A;  3THT A;  2CQP A;  1D09 B;  1Y11 A;  2KFY A;  2G0I A;  1U6F A;  4J9U E;  2ROE A;  4QQB A;  1IWG A;  2M4M A;  1FRK A;  1HBN B;  3C8Y A;  5HP1 A;  2OP5 A;  3TRG A;  1RTH A;  2HK3 A;  1KQG B;  3AOD A;  2PFD A;  3BQ1 A;  1WD6 A;  2WB4 A;  3MI7 X;  3G6X A;  4OJH A;  4C8Y A;  2ZEJ A;  2XWX A;  2LXI A;  2B51 A;  1JLB B;  3NAI A;  2R9L A;  1I3O B;  4NLP A;  4A8M P;  4FF3 A;  3M1V A;  3QQC D;  4RUB A;  3ETM A;  1IBM J;  1HMV B;  3CCV S;  3TZX A;  3KHG A;  4DSK A;  2EBG A;  1N8R T;  2UXB J;  4WFY A;  3O1L A;  3UVJ A;  1WG4 A;  3SCK E;  4I2P A;  2BJ3 A;  2FY1 A;  4DEZ A;  1WF2 A;  1WHX A;  3PXG a;  5FDL A;  3CD0 A;  1YRT A;  1GNK A;  3UDE A;  2LDI A;  1YSJ A;  4K0K J;  3MD1 A;  3GON A;  2FHJ D;  2F5G A;  4BWM A;  2ZHB A;  2LU2 A;  1X4H A;  1LWE A;  3BKT A;  2V4R A;  2R7X A;  1LW2 B;  1P8G A;  4DV0 J;  1YG0 A;  4BDP A;  1FDN A;  2GHW A;  3U1M A;  2VBW A;  3VWS A;  2BVZ A;  3PKM A;  3BH7 B;  5GMK a;  4GKK F;  5J2M B;  2FC9 A;  2WHO A;  5HBM A;  4OZJ A;  1TVR A;  4NLQ A;  4CH0 S;  1WEY A;  1U8W A;  2B6A A;  2CQD A;  4URQ U;  3C3L A;  1Q1K A;  5AE1 A;  3MM9 B;  4DQR A;  3IFE A;  3DKD A;  1U4B A;  2AEM A;  1O8B A;  4WTY A;  1UW9 A;  4UOG A;  1NND A;  1VQ7 S;  1H7X A;  3VAF A;  3PVX A;  1HYS B;  4DL4 A;  1DLO B;  2ZZM A;  1S79 A;  2VF3 A;  4Z7C A;  1LOU A;  1KSP A;  3I0S B;  1SH0 A;  1JLQ A;  1T0T V;  2GCF A;  4DQP A;  4DX5 A;  1TL3 B;  1WF1 A;  3NMR A;  2MJN A;  1N0U A;  4PR6 A;  2L9N A;  1RHM B;  3MDF A;  3RW6 A;  1GEH A;  2E5L J;  4MK8 A;  4LSL B;  4RNF A;  5DET A;  4TLQ A;  2R2U A;  5KG5 A;  3V81 B;  2BZ2 A;  3VGV A;  3N6L A;  1C0U A;  4HH1 A;  3M30 B;  4DPU A;  1KHV A;  1SCJ B;  2HFN A;  4NCA A;  1VLO A;  4Z37 A;  3WIV A;  2V8H A;  3UE2 A;  1LQ9 A;  3GP9 A;  2C3M A;  3QGH A;  2VC0 A;  1N5Q A;  3W64 A;  4IR1 A;  1X9W A;  2C28 A;  2BOA A;  1K8A T;  2IY5 B;  3MMB B;  3CO9 A;  1WI8 A;  3B54 A;  2ZC4 A;  3JYT B;  1RAI B;  1WOS A;  4IG3 B;  3C14 A;  2B5J A;  4IYQ A;  3HVW A;  4DR3 F;  2QV6 A;  3KTQ A;  3TAQ A;  4QJV A;  2XWY A;  3DLK B;  3CCU S;  4HL9 A;  2OFH X;  1G4C A;  5D3G A;  3ZZO A;  2YWF A;  2JLG A;  1DTQ B;  1TMM A;  4ANE A;  3W65 A;  3FRY A;  4FYY B;  2HWT A;  5DS7 A;  2GIF A;  1DQA A;  1FKP A;  2B56 A;  3D1Q A;  3CMA S;  4JBC A;  3R7N B;  2WK4 A;  5I3P A;  1H72 C;  3LP2 A;  4UOH A;  1EX8 A;  3VAJ A;  1C1B B;  2M8D B;  4ZCK A;  1ARO P;  3BYR A;  4W4M A;  1X4B A;  1BHN A;  3IM8 A;  2H54 B;  4R0E A;  4UST A;  3ZTP A;  1L3S A;  1SJF A;  1P1T A;  4AD6 A;  4P7V A;  2HHH F;  4PWW A;  1SJ3 P;  2YNG A;  2B43 A;  1N34 J;  4IO9 Q;  5EX3 A;  3KK1 B;  4MAK A;  3I32 A;  1F2G A;  2MST A;  2QTW A;  3NNH A;  5KFG A;  4OLO A;  2WVE A;  3IBC B;  4NMX A;  5KG1 A;  1U1K A;  4M8L A;  5E0O A;  2BKN A;  1XNQ J;  1NXI A;  3NCP A;  4TNO A;  1JX4 A;  4JYA J;  4X4R A;  3UCU P;  1V3R A;  3LAN A;  4DPT A;  5KT7 A;  5HN0 A;  3FNN A;  4ID5 B;  2MY7 A;  5T7L A;  1RWW B;  3KUH A;  3M4X A;  2V2V A;  1I94 J;  2QA1 A;  1RAH B;  3MTJ A;  1DTT B;  4OIX A;  3NL0 A;  2VHG A;  1S5Z A;  1CQN A;  1SKU B;  5J2N A;  1JLC B;  4NYO A;  1YVF A;  1L3U A;  4QIW D;  4UZB A;  3TAM B;  4F50 A;  3M2U A;  4YHH F;  3EGN A;  4OZ1 A;  3X1L B;  2H48 B;  2Y1R I;  4B3R F;  1B7Y B;  4E8U A;  1LFW A;  1RAB B;  2GVD B;  4EBE A;  2DHG A;  2Y1L B;  1PO6 A;  1D9F A;  5DG7 A;  1FFW B;  3RAM A;  3KK2 A;  3VR1 A;  1TK0 A;  1KEK A;  2NYH A;  2HEK A;  3HHD A;  1HNW F;  2AHO B;  4NXM F;  5LSR A;  4Q7A A;  1H7W A;  4AL7 A;  4LF4 F;  2K3I A;  2HSE B;  3MPV A;  3CD5 A;  1FRX A;  4ED0 A;  2BKO A;  1MRO B;  3POT A;  3PW5 A;  3UI3 A;  2W9B B;  2W8K A;  5IT9 Y;  1VQ6 S;  4UOF A;  4USW A;  1PJ7 A;  3HLU A;  2I0X A;  2D1C A;  1X4A A;  2BAN B;  2HQG A;  2ZHA A;  4USI A;  1S77 D;  2RKI A;  1EET B;  1FTC A;  1NME B;  2AX1 A;  1ITP A;  2D9O A;  3L95 X;  3MAH A;  4C2M A;  3K59 A;  2KXH A;  2EFQ A;  5F8J A;  1NB2 A;  1WTF A;  5G0R B;  5KFT A;  3GB0 A;  3RB3 A;  3TA1 A;  5F8H A;  2XCP A;  4DV7 J;  4HTI A;  4NLY A;  4CO4 A;  4ZLP A;  2BE2 B;  2Q79 A;  1ZH5 A;  2HHS A;  3OW2 R;  4FVM A;  3IRX B;  4F2R A;  4MYT A;  4PRF A;  2WTF A;  4XDD A;  4PWD A;  3ZZT A;  2YNI A;  7FDR A;  2CPY A;  5KG0 A;  3ENV A;  2WCX A;  2GZO A;  1R0C B;  4M5L A;  1TL5 A;  1CS4 A;  5A0Y A;  2V8D A;  3HDS A;  4ZLJ A;  4PPD A;  2MZS A;  3D3B J;  3E8O A;  4F7V A;  1HAR A;  4UT4 A;  2XS5 A;  4LF8 F;  2ZE2 B;  3OTD A;  3LPY A;  3IN5 A;  4IG0 B;  4U7U K;  1UW4 A;  1S99 A;  3W9J A;  3QYY A;  4FYX B;  2OUG A;  5D8H B;  1FRJ A;  4ES3 A;  3U27 A;  4ECQ A;  1X60 A;  4LF9 J;  4FS2 A;  1M1H A;  4ILR A;  2V69 A;  2CJ9 A;  2ZOG A;  4OI1 A;  3SEO A;  1WOO A;  2ZUG A;  1KQS R;  3NOG A;  1MNE A;  2OTL S;  3LAK A;  2QLW A;  3M8Q B;  2ZKT A;  4NI2 B;  3MUV P;  1RCO B;  1VHI A;  1ZAV A;  5JMN A;  2DGS A;  2BR0 A;  2CNN B;  4M5G A;  1N48 A;  4CLW A;  2RRB A;  4U9R A;  5AE2 A;  2F7V A;  4KSE B;  5IT4 A;  5L9X A;  2VPX B;  1RLC L;  3RRH A;  4A47 A;  1FNX H;  1S1W B;  4NLX A;  4DV4 F;  3M6X A;  3CC7 S;  3SMZ A;  2CPH A;  5CH7 B;  1M5P C;  4C8K A;  4MK9 A;  1RWU A;  1U1R A;  1G6B A;  3FVY A;  3NCR A;  1T05 B;  2VG5 A;  2P5V A;  2HIY A;  1S10 A;  2UUC F;  3Q0A A;  5A8W B;  1CJT A;  1RT6 B;  1HR0 J;  3FRZ A;  1QSY A;  2CZ4 A;  1UTA A;  3R6L B;  3EGW B;  5KG7 A;  4C9D A;  5A8R A;  2QMX A;  3GV5 B;  1GTE A;  3B6B A;  2OFG X;  1FHT A;  4P6Q A;  5FII A;  2OPQ A;  3R5C A;  4RW7 A;  3BQ2 A;  1RA7 A;  4B08 A;  5KFA A;  3HP6 A;  3EX7 B;  2MY8 A;  3J7A N;  3PR5 B;  1FNM A;  3FBE A;  3QBC A;  3QWU A;  4QW8 A;  2QFJ A;  4DR4 J;  3KUE A;  3DOK A;  7FD1 A;  1TL4 A;  1W7W A;  4UUX A;  3IG1 B;  2RQM A;  4WTO B;  1FE4 A;  3FQK A;  1KP6 A;  2IM3 A;  5AT1 B;  1HWI A;  2E9R X;  1CEZ A;  4ZPA A;  3E01 A;  1Q82 T;  3Q23 A;  4ECU A;  2YY3 A;  4WE1 A;  5GAD I;  2O01 C;  2BAC A;  1T9V A;  3NP5 A;  8ATC B;  2IC3 B;  4GO5 X;  1D1U A;  1S48 A;  4ZJQ A;  1RYR A;  3HFV A;  2UXD F;  1Q7L B;  3R2C J;  4FS1 A;  2Q43 A;  2R7T A;  4NLV A;  4OL8 A;  2MB0 B;  2BJD A;  4G65 A;  1IBC B;  3KJV B;  2UVU A;  4QIG A;  2FVR A;  4B3O B;  2P9C A;  3I0R B;  2WSC C;  5BR8 J;  3CJQ A;  1B3T A;  1XC9 A;  3A3O B;  3MPD A;  2WON A;  4FKX A;  3I96 A;  1SKS A;  4M63 A;  2ATC B;  4A8X A;  1ZM2 A;  4NZ7 A;  3GYX B;  1FF2 A;  3QAT A;  3PY8 A;  1OO0 B;  2UXC J;  4USU A;  1NJY A;  1D9D A;  4UY8 5;  5F8M A;  4RBT A;  3N01 A;  1S6U A;  1FWP A;  3CCM S;  2WW4 A;  3QWP A;  2L3M A;  2DHA A;  3J81 j;  4UF4 A;  5J2P B;  2ZH3 A;  1PIE A;  4LRA A;  3KLI B;  4ED7 A;  1HL6 A;  2NXN A;  2MQO A;  3NCQ A;  5MLC V;  4B3S F;  3DHX A;  2IJF A;  1RAO A;  1RI7 A;  3OHB A;  3L09 A;  2V5H G;  3RUB L;  1WDT A;  3RYL A;  4ED3 A;  1FRH A;  2N7C A;  4DPO A;  3CJ0 A;  4N8N A;  1Z2Z A;  3VAK A;  2LVW A;  1F5A A;  1RP5 A;  2DNM A;  3D1O A;  2AKW B;  4YUD A;  1XEZ A;  2F8H A;  2G0C A;  3G86 A;  4KR0 B;  2RUS A;  2MYF A;  1UEU A;  4I68 A;  2IAJ B;  4DX7 A;  2XNR A;  5AJ3 F;  3GFX A;  4E98 A;  1WG1 A;  2DGX A;  4R5P A;  1FKA F;  2HNZ B;  1X5S A;  2DRD A;  3JAM Y;  1QE1 B;  1AT1 B;  1XNR J;  4KGV B;  4DR2 F;  3H5S A;  2FHJ A;  2VG6 A;  1JLE B;  4AXI A;  3AD9 C;  1VQ8 S;  2CJA A;  2D74 B;  3DMJ B;  1MU2 A;  4JI3 F;  1J5E F;  3OLB A;  2MKS A;  1HNI A;  2CQ3 A;  4RZR A;  4DS5 A;  3B8H A;  1CSJ A;  4YEA A;  3CCJ S;  3JTP A;  4CLT A;  1DBD A;  5LM7 E;  1WC0 A;  2OSR A;  1R6Y A;  5HLF A;  2OJ3 A;  2NCK L;  3R2D J;  2EK1 A;  1U1L A;  2SXL A;  2FLL A;  1U1Q A;  5G4D A;  1ZPW X;  1PBU A;  4XPE A;  4LF6 J;  3ZNU A;  5HJX A;  4U7C A;  3RU0 A;  1E6Y B;  3DLH A;  5DZ7 A;  2DIS A;  1VQN S;  1C4C A;  5CYM B;  4B9N A;  2G2O A;  2R2R A;  4C8N A;  1DQ8 A;  1SL2 A;  2B7B B;  1YHQ S;  2DBB A;  4G1Q A;  1GK8 A;  2MLZ A;  1YRX A;  3MHY A;  5GAH I;  2GMH A;  3BGL A;  1WNE A;  2AZ1 A;  3QGG A;  1HWL A;  2P8I A;  2FD2 A;  3SBM A;  3C15 A;  2L08 A;  2R7R A;  3ZFV A;  3OTO F;  2MSS A;  4P2M A;  5E3P A;  3OFH A;  3KJF B;  2I38 A;  5LMU J;  2FJE B;  1PC5 A;  2WRM A;  2E5J A;  2BV3 A;  1B4S A;  1HKA A;  4CYU A;  2YKN B;  3DXS X;  2HQC A;  2J9D E;  3K7R A;  1UVN A;  1RWM B;  5B08 A;  2HAI A;  5CD4 A;  3UCZ P;  4DR1 J;  1FE0 A;  3W9I A;  3HJV A;  4TU9 A;  2ADC A;  4TQS A;  2KXF A;  2P9E A;  3GSD A;  2M9K A;  4RLE A;  3SDE B;  1YBA A;  1RHJ B;  1FFS B;  2OGU A;  3M6W A;  2R2S A;  3PO4 A;  2OAU A;  3ZTR A;  1WKJ A;  4KHR A;  2B9W A;  2MMY A;  4OI0 A;  5KFY A;  4K5S A;  3MGJ A;  3NGR A;  1XR6 A;  1EQM A;  1XER A;  4ENO A;  2PA3 A;  4B3M J;  1XMQ J;  3MED B;  1FJG F;  3J7Y I;  3T5L A;  1FEH A;  2G9O A;  4ECT A;  1IKV A;  1PC4 A;  3QLH A;  3FKB A;  2LLZ A;  2J6T A;  3UQS A;  2ZKU A;  3FEX B;  3DU6 A;  3PIP Q;  5D4P A;  1A7G E;  3DLB A;  1FXR A;  1BWV A;  2C2D A;  4JI6 F;  4FF4 A;  4C8Z A;  1WSV A;  3DU5 A;  1M5V C;  5F8G A;  1DY3 A;  3PYF A;  3LP1 B;  2DGT A;  1U0H B;  4M5N A;  3JSB A;  4NCB A;  2D9P A;  2VQF F;  2GNK A;  1X8D A;  3KLH B;  3D3C J;  3QSY B;  5KT6 A;  3HHL A;  3EGZ A;  4M1K A;  1JLG B;  1CPZ A;  1TV6 A;  2C3Y A;  2HHQ A;  1T8E A;  3FC9 A;  5ETV A;  3D6M B;  1FT8 A;  1LFP A;  2ZBR A;  4PKD B;  4I0W A;  4LFC F;  4K4Y A;  2FC8 A;  2M2B A;  3OVS A;  2DCL A;  2GAH C;  2B4O A;  3H90 A;  1N52 B;  3W5Z A;  2XZW A;  2M70 A;  5KFS A;  1LK5 A;  1F60 B;  5D4L A;  1CJU B;  4B9V A;  1SC6 A;  3FEZ A;  3UR3 C;  1RT3 B;  3JSM A;  2EXU A;  3PRD A;  4FXV A;  1UWB A;  2CA9 A;  3ITH A;  4UW2 A;  4N47 A;  4WFB Q;  4LRF A;  4Y2A A;  2B4P A;  3MEG B;  3LP0 A;  5HRO B;  4O3N A;  2MQN A;  3PFO A;  3OSP A;  5CYJ A;  3M2V B;  1YIT S;  4KGZ B;  1IBK F;  1V3S A;  2YQ0 A;  1RKI A;  2OPR B;  4GKK J;  5LMN F;  3ZC4 A;  2OD6 A;  2EKY A;  4TU7 A;  4U8Y A;  1JQG A;  1Z4U A;  2EVZ A;  4Z2X A;  3AD7 C;  3N5B A;  4CO3 A;  5B0G A;  4I69 A;  5A2Q Y;  4HI1 A;  5GAE U;  5HP1 B;  1A6L A;  1RQ0 A;  4URS A;  4DPX A;  1B99 A;  3J80 U;  2Z8Q A;  3OXG A;  4U8V A;  5HSP A;  1RTH B;  1Y5L B;  2FUG 9;  1KTV A;  1WC3 A;  1UVJ A;  3ZO7 A;  2DIU A;  2ZVI A;  4JI5 F;  1VQM S;  2DIT A;  1T02 A;  4TVA B;  2IJR A;  2IBK A;  1WOR A;  1N32 F;  4FP9 A;  2HHU A;  2Q6C A;  4C7Q A;  5LJ5 Y;  3M1V B;  1WOP A;  1EIY B;  4PXB A;  1JJ2 R;  2YX1 A;  3Q89 A;  4LQ3 A;  4CDI A;  2RDJ A;  1SL1 A;  1G1X A;  3FCW A;  1EKR A;  5LOQ A;  1EB0 A;  2R8G A;  5KTQ A;  4Z7Y A;  2CJK A;  3UVJ B;  3I5A A;  2C42 A;  3MFH A;  2RU3 A;  2WSF C;  3QRP A;  4I2P B;  1G7C B;  5KFC A;  2DCU B;  1IKX A;  5FDL B;  2Z58 B;  1TKT A;  3QAE A;  3B78 A;  3IO1 A;  4TXS A;  1CUL A;  4MTP A;  4ELU A;  4F0M A;  2E1R A;  3GZ7 A;  1LWE B;  2F8E X;  5CD4 H;  3CW2 C;  2NSB A;  3GFY A;  4OZL A;  3ZZ0 A;  4IOB A;  3SQO P;  5ADZ A;  1OY8 A;  1KOH A;  4JI2 F;  2JFK A;  2E7W A;  2VUG A;  4NZ0 A;  3GCX P;  2AV5 A;  3GII A;  1KQK A;  5C25 A;  3TNV A;  2GGP A;  4OYZ A;  5HBM B;  1TVR B;  5KFM A;  5KFL A;  4DR3 J;  1GXL A;  5C7P A;  2B6A B;  5HAN A;  4UUW A;  1NSK L;  3A12 A;  4FBT A;  1CJK A;  4AYB D;  1KS2 A;  5JJB A;  1LWX A;  3OFF A;  3GJT B;  4V19 X;  3Q8P B;  5IZH A;  3TJA A;  3VAI A;  2YKA A;  1FRI A;  3PHT A;  1W2I A;  5LT5 A;  4J9Q A;  2J0X A;  2EWH A;  1FEE A;  3MZI A;  4KBI A;  2CPJ A;  1SL0 A;  5D0H A;  1VRU A;  3SFG A;  1JLQ B;  1K73 T;  2I9S A;  4J9M A;  5ETR A;  2V2Q A;  5HJY A;  4ZPT R;  5E3A A;  3BGF A;  1JXL A;  3UDL A;  1WC4 A;  4OYA A;  3ZTO A;  5C24 A;  3VTI A;  3AA9 A;  4EBD A;  2B9X A;  3HD2 A;  2HG4 A;  5K20 B;  2HHH J;  4R8U A;  1C0U B;  4DSL A;  1W2B R;  3ISZ A;  1RTI A;  1RA6 A;  2QLJ B;  3GG0 A;  2IDL A;  1SC1 B;  1SIZ A;  2N3O A;  2EC2 A;  3A3P B;  1EAR A;  5EWF A;  4TLR A;  2KDO A;  4P73 A;  4DCP B;  4WXO A;  2VPZ B;  2C3P A;  1HWK A;  4P71 A;  1N5V A;  5L38 A;  2ZBC A;  4ITS A;  2WB1 D;  3C14 B;  2B5J B;  4MYU A;  2FVQ A;  3OXL A;  2V4Q A;  1V6H A;  2IRU A;  1GX5 A;  4QR2 A;  1DFD A;  3NEK A;  5D3G B;  3RRK A;  1X7V A;  2MLX A;  2XSJ A;  4LFA F;  3QT6 A;  6FDR A;  4YFU A;  1X4G A;  1LW0 A;  3T1A A;  2OTJ S;  4PG8 A;  4LRE A;  3IWN C;  3AY0 A;  3AQP A;  4KO0 A;  3S7R A;  2GVZ A;  2QA2 A;  3KHR A;  1FKP B;  2ACY A;  1YJ9 S;  1ZM4 A;  3MM8 A;  2W9A A;  2HMI A;  5DJB A;  4NPO A;  3M8Z A;  4MMO A;  4YHH J;  4DN0 A;  2MLY A;  3LP2 B;  2EG2 A;  4B3R J;  3KLG A;  2MQM A;  4EMD A;  2Z57 B;  2EI5 A;  1Q8B A;  5K8M A;  4PXE A;  3MR6 A;  1Y3J A;  3IBW A;  2GAG C;  4KFB A;  3G96 A;  1R8P A;  2B7C B;  2FJD B;  2HZV A;  3EVO A;  5L1K A;  2YNG B;  2DB1 A;  1EHW A;  4ZPD A;  1HNW J;  1TK8 A;  4NXM J;  5LSL A;  4F02 A;  4LF4 J;  2A10 A;  2PE8 A;  4P72 A;  1ZA1 B;  4LBH A;  2RS8 A;  4PPZ A;  3EDQ B;  3CJ4 A;  3KXD A;  3BSO A;  4J91 A;  2HQF A;  4TKT A;  3VV2 B;  5CQG A;  2O1P A;  4QIE A;  4R25 A;  1S72 S;  5F8L A;  1KFD A;  2M5Y A;  2XGQ A;  4FF1 A;  4U67 Q;  1ZTW A;  3JXO A;  2G1D A;  5T7L B;  3L9Z A;  3A1Y G;  2XZD B;  1JK9 B;  2XBP A;  1JNZ B;  2ZFH A;  5ETT A;  4K5R A;  2QE5 A;  2OEK A;  4EI2 A;  3MR7 A;  3EM1 A;  1UA0 A;  2RML A;  3KLE A;  2QG9 B;  4KHM A;  5J2N B;  3CDE A;  1R89 A;  4YB1 P;  3GIL A;  4D3H A;  3ILL A;  5J1E A;  2ADB A;  3M2U B;  4EK2 A;  1ACM B;  2KG0 A;  1U1N A;  1MMD A;  2C2E A;  1HA1 A;  2CKW A;  5MAO A;  2VKZ G;  2IA0 A;  1IN0 A;  2XI3 A;  3AB4 B;  2DNN A;  3KK2 B;  3NBP A;  1F0X A;  1NZA A;  3R97 A;  3U1L A;  4LF8 J;  3W5X A;  4F3Q A;  3CDA A;  3FFI A;  4RNH A;  1UPP A;  3POT B;  3I56 S;  4C98 A;  3OXF A;  2LKZ A;  4NAS A;  4OZ3 A;  5D4N A;  4CT8 A;  4L3K A;  3DLE A;  2D41 A;  4RL1 A;  4KGX B;  4A4J A;  3M2R A;  4XO0 A;  2F40 A;  1FDB A;  2MXY A;  4J5O A;  2RKI B;  2NQP A;  3CCE S;  4ZP7 A;  1NH8 A;  3H0P A;  2W2O P;  2BM1 A;  2V8V A;  1Q8I A;  1RWX B;  2LQ9 A;  1IKW A;  4F3M A;  1KN6 A;  5B0F A;  2VV5 A;  3TUZ C;  2O3D A;  3J81 Y;  2EK6 A;  1NDP A;  2OHD A;  2YXL A;  2ZH7 A;  5IQQ A;  1FJC A;  1KQF B;  3SCJ E;  1YJ7 A;  4CNY A;  5M2P A;  4LFB F;  1JXE A;  4X4P A;  2DGW A;  3M32 A;  1YIJ S;  2G1H A;  4DV4 J;  4B9U A;  2PEH A;  3IR7 B;  3OVA A;  2XY6 A;  4C3K A;  2GO8 A;  2BA9 A;  1YX2 A;  3PW4 A;  1OQ6 A;  4PWD B;  2YNI B;  2Q3P A;  4LSN A;  2CG4 A;  4X62 F;  1N5Y A;  2VFU A;  3PRB A;  1DAR A;  2UUC J;  5D0G A;  1JKH A;  1CS4 B;  5A0Y B;  3M9N B;  4ZJL A;  4AL5 A;  3H2L A;  3IP0 A;  2IBO A;  3SV3 A;  4DL6 A;  5DDP C;  3D0G E;  3QMQ A;  2J9D A;  4LR9 A;  3GCW P;  4P52 A;  1S1V A;  3TJ8 A;  3BEG B;  5HMX A;  5CAA A;  3P49 B;  1BD6 A;  4OI2 A;  4QR0 A;  3ZZR A;  2XS7 A;  2MKC A;  5K14 A;  3VVT A;  3BS9 A;  1M5S A;  2ZNZ A;  2W2Q P;  2B0G A;  5ETO A;  1Q8K A;  3PAC A;  3DGV A;  2H5J B;  4I64 A;  2HVZ A;  4RW9 A;  4RUC A;  4LF1 A;  5FLX Y;  5LSO A;  3TA2 A;  5GAD U;  3LA0 A;  3T1Y F;  2KFN A;  5LJ3 Y;  2NUH A;  3GYG A;  3CME S;  4K4S A;  4MJK A;  2QEX S;  1G2E A;  1UAW A;  4MIB A;  1QAX A;  2FTR A;  1Y5I B;  2DR8 A;  3ZTQ A;  2HFZ A;  3SYZ A;  3IXQ A;  1UP1 A;  4NEZ A;  1RU1 A;  2E5I A;  4P2F A;  4ED5 A;  1UZD A;  2HS3 A;  4ZVP B;  1RTD A;  1T3O A;  4GKJ F;  4P2X A;  3TEH B;  2G13 A;  4KKO A;  5DGB A;  3K5P A;  1H2V Z;  1GQE A;  5A6P A;  2APO A;  5E7O B;  2VG5 B;  2W4P A;  5AXK A;  2WSE C;  3ADA C;  4AND A;  1HHT P;  1CJT B;  1BLU A;  2E29 A;  2P6T A;  2BJ1 A;  4USV A;  3RJM B;  1LXN A;  5A8R B;  2JJ4 D;  1RAA B;  1FFG B;  2ZWP A;  3FGV A;  2OPQ B;  3K17 A;  4RW7 B;  5IQ6 A;  4X4V A;  2YNF A;  2RF2 A;  1TEL A;  4X65 F;  1UCN A;  4B17 A;  2CXE A;  2KM8 B;  2C2Z B;  1YI2 S;  3DOK B;  1JLA A;  3AT1 B;  4B3S J;  4NYZ A;  1UA1 A;  4OX6 A;  2CQI A;  5A6W A;  3GG1 A;  2HRU A;  2FZG B;  2GW8 A;  1F1B B;  3E01 B;  2IHR 1;  3DRR A;  2K3K A;  4WE1 B;  3DRS A;  2DR9 A;  3CJK A;  2GFF A;  3FSI A;  4QBU A;  2W7A A;  3J7Z 5;  1WF0 A;  4RPF A;  3OHA A;  5AJ3 J;  4K8R A;  2CQ0 A;  1VYA A;  4A8Y A;  3T41 A;  4KPC A;  4MKA A;  5T41 A;  1WI6 A;  4G1I A;  2AMC B;  3E3X A;  3K57 A;  4DR2 J;  2U2F A;  2HKE A;  3F56 A;  1RHR B;  2WON B;  3MPU B;  4JI3 J;  1J5E J;  3NS5 A;  2R7O A;  2E66 A;  3GJQ B;  3ETO A;  2NR0 A;  3JQM A;  2C1E B;  1L5U A;  4H4O A;  1PSD A;  3TQE A;  5DO2 A;  1VQ5 S;  1BMQ B;  4ED4 A;  1HD0 A;  2AJ1 A;  2OEJ A;  3MEC A;  4BWJ A;  3KNA A;  4MT1 A;  1QAY A;  1CLF A;  3G8S A;  1FCA A;  3UCG A;  1LWF A;  5CCL A;  1U24 A;  2GX8 A;  1MW7 A;  2YPY A;  1SJ1 A;  3FBB A;  3L7U A;  2R3V A;  2XLJ A;  2IVY A;  3NGS A;  4KHP F;  1S4F A;  4O44 A;  2RD5 C;  5GAH U;  2FZK B;  3L3C A;  1H74 A;  3DLL Q;  4DS4 A;  1TMJ A;  5HI7 A;  4FKY A;  2W8L A;  3BO2 A;  1QLN A;  3FSY A;  3OTB A;  3FJ2 A;  2PD1 A;  3QGP A;  3OTO J;  4BC7 A;  4ED8 A;  2QRR A;  1JWW A;  2CQ4 A;  4C0O C;  3LW5 C;  4UY8 T;  2EG1 A;  4R5P B;  4C6A A;  2F4V F;  1YDL A;  1F5C A;  3J7A 1;  1MG7 A;  3GU0 A;  2VG6 B;  4QIV A;  3CCL S;  2N4C A;  2R7W A;  3NS6 A;  3TVY A;  3MR2 A;  2HRY A;  1UFK A;  1VIX A;  2KTQ A;  1MU2 B;  1T9T A;  3PNI A;  1SXL A;  5C42 A;  2CAJ A;  1HNI B;  3S1T A;  3DGP A;  4DU7 A;  4CO0 A;  3TAN A;  3TR5 A;  1VC6 A;  1SKW A;  2EC0 A;  4L3N A;  4WPA A;  4HLB A;  1REV A;  1QTN B;  5HLF B;  3W8P A;  2LMI A;  2HS0 A;  2CPI A;  1VK8 A;  3O2I A;  5ETK A;  5U47 A;  1FJG J;  4ECX A;  4PG6 A;  1RB0 A;  3M8P A;  4DFK A;  1YJR A;  4FPI A;  4F2S A;  1XBW A;  2RHS B;  1MN7 A;  1U1O A;  3SI8 A;  4DDF A;  4OYM A;  2K1R A;  4KB7 A;  1KVJ A;  4KGK A;  3NS7 B;  1BQX A;  3CJ5 A;  2X1G A;  4QOT A;  3O3L A;  2YWG A;  4ZVE A;  2K7K A;  4JI6 J;  4G1Q B;  3QGI A;  1KHW A;  1NU4 A;  3CTR A;  2XY7 A;  5SZT A;  2YKM A;  2KJV A;  2VQF J;  1NAQ A;  5F41 A;  3AOC A;  3C15 B;  1N88 A;  2JC0 A;  4XDC A;  3VQT A;  1TKX A;  4GMK A;  2HLU A;  4CLY A;  2Y8Y A;  4CYU B;  5HQ8 A;  4LFC J;  3NMA A;  4M5I A;  2JEF A;  3MM6 A;  3FDS A;  3X3U A;  3IRW P;  2RHQ B;  3FQL A;  1BE4 A;  3PX4 A;  1HFE L;  1RSC A;  5KFW A;  4WK1 A;  3OR1 A;  5IFM A;  2U1A A;  1T9X A;  2QO3 A;  3MM7 A;  4UOC A;  4QYZ K;  3VF0 B;  4F4Z A;  5DZ6 A;  1RIS A;  1RT2 A;  4L74 A;  2EFO A;  2M8H A;  3HXM A;  3N79 A;  2J76 E;  1TUW A;  3KLF A;  2VC1 A;  4B3T F;  2DH8 A;  1REG X;  2KVI A;  1HWU A;  1Q16 B;  1C0T A;  1AFI A;  4O0I A;  3LTO A;  4OZ5 A;  3SQG A;  4Y0F A;  3HVT A;  2ACM A;  1IKV B;  3QLH B;  2L9D A;  1IBK J;  4TY8 A;  1OY9 A;  2IVM A;  3WDO A;  4F4X A;  2ZH1 A;  1C2P A;  5LMN J;  4MFB A;  3S6E A;  4N56 A;  4TY9 A;  5IOL A;  3D68 A;  3WHI A;  1BGX T;  2VBZ A;  2ALY B;  4G3I A;  2O67 A;  3WC2 A;  1RT7 A;  2QA4 G;  3ZZY A;  4LR7 A;  2RH3 A;  1NDC A;  1AFJ A;  4DWI A;  1RT5 A;  3HHL B;  1H3D A;  4WIQ A;  4J37 A;  4C4W A;  1TV6 B;  4JI5 J;  1R31 A;  3H40 A;  2DEJ A;  4JI8 F;  1H2T Z;  1F2H A;  1N32 J;  1U7L A;  1RAF B;  1YZ6 A;  3C16 A;  4HDH A;  1ROF A;  4XAK A;  1X0P A;  5AXM A;  2NRE A;  3ENW A;  3H59 A;  2ABY A;  2OML A;  2PMW A;  1VQS A;  2IYI A;  2FJX A;  1Q4R A;  5L1J A;  2QSW A;  1HNV A;  4OJG A;  3KHH A;  5EWG A;  3JSM B;  1BQM A;  2XG8 A;  3R5G A;  1UWB B;  3QJJ A;  3ITH B;  5C5J A;  2PMZ D;  2LQJ A;  3NLC A;  4B9L A;  4Q44 A;  3MOZ A;  3LP0 B;  1YJT A;  1RTZ A;  3QZ7 A;  2XI2 A;  1GT8 A;  4QWE A;  4L72 B;  5BXI A;  3DYA A;  4FXD A;  2CPD A;  2IM1 A;  1FNO A;  4JI2 J;  2QSF A;  4X84 A;  1DUR A;  3Q8Q B;  2GJF A;  3NXZ A;  2J7W A;  3BGR A;  4Q8F A;  2YX7 A;  1O6X A;  2FJW A;  1WEZ A;  1IQT A;  3Q24 A;  1FVS A;  4NLT A;  2HNY A;  1Y0H A;  3MWB A;  4DOZ A;  4USK A;  2OLW A;  2ZNY A;  2GMJ A;  2KHD A;  3I9Z A;  4DL5 A;  2DT9 A;  5IT0 A;  1WSR A;  1V3Z A;  4KT0 C;  3CUL A;  4I1T A;  5K8N A;  2UUB F;  5AE3 A;  3SCL E;  4ZVO B;  5LL6 d;  1SIW B;  3OL6 A;  3QAU A;  3ONQ A;  1N5S A;  4K4U A;  2RDI A;  2KO1 A;  3TOQ A;  4O0N A;  1WC6 A;  4LVO P;  4C0H A;  1I6J A;  4FXW A;  2VIH A;  4A8O A;  4RWX A;  5D77 A;  2ZH4 A;  2D3O R;  3HD1 A;  5L39 A;  3MOJ B;  2CQG A;  1YBU A;  3IC1 A;  3W63 A;  4CM0 A;  1MML A;  2F65 A;  2R42 A;  1URN A;  3CDW A;  3HSZ A;  1VCT A;  1ELO A;  4ECR A;  4TN2 A;  2MDA A;  3HZE A;  1AZS A;  5HK4 A;  1IKX B;  4YQW A;  1Q78 A;  1TKT B;  3D54 A;  1CUL B;  4FDF A;  4QR1 A;  2DR5 A;  4OZ0 A;  1CBK A;  1HW9 A;  1GAO A;  2V94 A;  1FD2 A;  5ETL A;  4Q0B A;  2FHM A;  3RBZ A;  1QUV A;  1RT1 A;  2OSQ A;  3KYL A;  3CC4 S;  2HBY B;  2DEI A;  1DRZ A;  3GJR B;  5C25 B;  4CO5 A;  2GGP B;  1QSL A;  2HWI A;  1X4F A;  2IA6 A;  2ZH5 A;  4ZIW A;  2LFV A;  4RR5 A;  2FDN A;  2L48 A;  3G82 A;  1HQE A;  1SH2 A;  4F04 B;  4FYW B;  5E33 A;  3I4H X;  1CJK B;  4IRC A;  1F9E B;  2J6S A;  1NJI T;  3WBZ A;  3DN9 A;  4LFA J;  1D9A A;  2XC9 A;  4YR3 A;  4MH8 A;  2BAB A;  4FVC A;  2V9W A;  3I82 A;  2MJU A;  1MSW D;  2DY9 A;  4BS2 A;  4BC9 A;  2KYZ A;  2K2P A;  1VRU B;  5A8K A;  1DZ5 A;  1U45 A;  2KRB A;  4ZN3 A;  1L3V A;  1TQL A;  5IT9 U;  1HQ2 A;  3M9O B;  1GMW A;  3Q8Y A;  2CQ2 A;  3VAM A;  3N4W A;  5HMW A;  1HBO A;  5IM0 A;  2J9E A;  4V1A k;  2J7K A;  5C24 B;  1QSS A;  5I42 A;  2RDD A;  3OD2 A;  1N36 F;  3CMQ A;  3T5J A;  1TP7 A;  4Y2M A;  1UMJ A;  4R8U B;  1PYO B;  4N41 A;  2AGP A;  2V67 A;  1RTI B;  1MWQ A;  2WBM A;  3R7S B;  1Y9O A;  2AYG A;  5L46 A;  3HFK A;  1T95 A;  4ZKA A;  4YB5 A;  3QFW A;  2GA7 A;  1VMB A;  4Y34 A;  3H8Y A;  1GXU A;  1H73 A;  2UVV A;  3BN4 A;  3CCQ S;  1FXL A;  3KWM A;  4RU2 A;  3MMA A;  3RBE A;  3H5U A;  2G4B A;  1SJR A;  2V0N A;  5CZV A;  1XK8 A;  1PJ6 A;  2XZT B;  3R1H A;  4N77 A;  3C6T A;  3R5D A;  4CH1 A;  1R0B G;  4GRS A;  2MZT A;  4WZQ A;  4N5S A;  3AB2 B;  2XYG B;  2XSJ B;  4WXW A;  1SQE A;  1UJ6 A;  4OYO A;  5B7W A;  5F9N A;  1LW0 B;  4HH0 A;  3D6T B;  2HFS A;  4RBV A;  3FMB A;  1HHQ A;  4KO0 B;  2GVZ B;  3NNC A;  1S0V A;  3U7J A;  3ET6 A;  2VQE F;  3BO4 A;  3MM8 B;  2HMI B;  1AW0 A;  2XMW A;  4KE5 A;  2VD3 A;  1TFY A;  3KLG B;  2O5D A;  1J27 A;  1GMV A;  1RHQ B;  4KFB B;  4YR2 A;  3BGO P;  3CVK A;  3MMC A;  2FJA B;  3EMT A;  1TR0 A;  4DHV A;  2QX0 A;  1X9S A;  3IAM 9;  3T5K A;  2JX2 A;  2HZA A;  4UTG A;  2RE1 A;  4EO8 A;  5F3Z A;  2AJ0 A;  1RZM A;  2DVI A;  1WC1 A;  1NSP A;  3S01 A;  3HHN B;  1WUU A;  1IR1 A;  4P10 A;  2HBQ B;  2DJW A;  1T03 A;  4GO7 X;  3CD6 S;  1RWV B;  2KB2 A;  4J9N A;  3N0V A;  2KU7 A;  1Y10 A;  3TP2 A;  5CA5 A;  2Z2Y B;  1NK7 A;  1N56 A;  3G8T A;  2HAF A;  3RAQ A;  3TEG A;  2OPS A;  1NRK A;  3BBF A;  1QAI A;  4ECW A;  1HBU A;  1VS3 A;  1U2R A;  4M5H A;  4OQJ A;  5M2U A;  2V50 A;  2E44 A;  4Q45 A;  2AD9 A;  3KLE B;  4OHX A;  5E2Q A;  3CNQ P;  4LFB J;  4I7F A;  2AEF A;  2ILZ A;  4ELV A;  1VC5 A;  2ZJP Q;  5J1E B;  4RBU A;  2NXE A;  2YH0 A;  3V5R A;  4X62 J;  1U0S A;  4J9K A;  3DRX A;  1Q53 A;  4ZCL A;  4C11 A;  1FWL A;  2WBR A;  1T94 A;  1UKU A;  1C4A A;  2LA6 A;  3NBP B;  3ZXW A;  4X4N A;  4DQI A;  2DH9 A;  3P5T L;  3JSY A;  2JVO A;  2Z2L A;  3WC0 A;  1UEV A;  3FZB A;  2CUY A;  5HMY A;  1SV5 A;  1HBM A;  3HVR A;  3FFI B;  4CO2 A;  2K06 A;  4ZP6 A;  2DHH A;  3H42 A;  2XMJ A;  5EHH A;  2H4W B;  2CZV C;  3DLE B;  2MEW A;  1NB7 A;  2NZC A;  3M2R B;  1D3W A;  3R7B B;  5KFB A;  1U26 A;  2CJX B;  3G8Q A;  3K5O A;  3PM9 A;  2PT0 A;  1TTH B;  4NLS A;  2ZC3 A;  4FZV A;  2F3J A;  2RSQ A;  3TA0 A;  3FBC A;  4MKV A;  3PIO Q;  3F0N A;  4BHQ A;  3T1Y J;  2PO4 A;  1IKW B;  2KT2 A;  3N28 A;  4QYZ J;  5J1N A;  5SUH A;  4OJ1 A;  2PDA A;  1M1K T;  4Y65 A;  3QT7 A;  5KG3 A;  1XTZ A;  2CYY A;  5F8I A;  3LOU A;  5KOW A;  3CJS A;  1GX6 A;  2UZA A;  3M32 B;  1YTY A;  1S57 A;  4NZ6 A;  3GMG A;  4F36 A;  3M8R A;  3BO3 A;  1SKR A;  3MAA A;  4GKJ J;  2FQQ B;  4PQA A;  1FDD A;  4K59 A;  1IM6 A;  4LSN B;  1N5Y B;  2R4F A;  4J7C A;  4RW4 A;  3CXC R;  3A8I A;  2VAS A;  1S6P A;  1JKH B;  1NK6 A;  4B9M A;  2RRN A;  2Z30 B;  2OH2 A;  1KOO A;  3BBB A;  1Y4Z B;  1HIY A;  1BC6 A;  1JB0 C;  5L8R C;  5AXL A;  1X4E A;  1S1V B;  2VG7 A;  2W2N P;  4X65 J;  1I51 B;  1VFJ A;  3DLG A;  2N3L A;  2GIQ A;  2O66 A;  3BDE A;  4Y6I A;  2XEX A;  2C2M B;  5K14 B;  4OHY A;  3TWZ A;  1WHV A;  2IM2 A;  2AT1 B;  3M6U A;  4IFV A;  3PDN A;  3LUY A;  2V4J A;  4HAC A;  1J5O A;  4RW9 B;  5KFE A;  1S6O A;  2X1F A;  2FJB B;  3IMQ J;  2DNK A;  2C3U A;  1TL1 A;  3Q2S C;  3UN5 A;  4QWD A;  2L41 A;  3CJ3 A;  3SSS A;  2YQ1 A;  3GQC A;  4C3L A;  1S49 A;  3K5L A;  5BYQ A;  3W62 A;  4OX7 A;  3SCI E;  2BX6 A;  4CTA A;  2ROG A;  2PI5 A;  3OJS A;  3OPK A;  2CJB A;  4PQU A;  1D8Y A;  2RUG A;  2W7O A;  1FKO A;  2CWK A;  4I2Q A;  3TI0 A;  3AHP A;  2LYV A;  3R6G B;  4QU6 A;  1YJV A;  4FN5 A;  3RB4 A;  4ZVR B;  3CIZ A;  1RTD B;  3HSG A;  2LEC A;  4L73 A;  4PXD A;  7AT1 B;  4KKO B;  2X1A A;  2VFR A;  2AF6 A;  4NRT A;  4OYI A;  1VRQ C;  3EJM A;  4WYW A;  3PW2 A;  3UDV A;  3HMJ G;  2FB0 A;  3HI9 A;  1TKD A;  1VQK S;  3QT8 A;  3BKU A;  2IJN A;  3PHE A;  4MK7 A;  2LXF A;  2YNF B;  4ERD A;  2V2Z A;  2RF2 B;  3H25 A;  1NK5 A;  1H98 A;  3EZ5 A;  4DLG A;  3R1L A;  2W7P A;  4JV5 F;  1VHF A;  1N5T A;  4F25 A;  4DV3 F;  4H54 A;  3CF5 Q;  3KG0 A;  3G6Y A;  2ZH2 A;  4PUO A;  2FZC B;  2HFO A;  2QGF B;  1JLA B;  3CDB A;  1SBR A;  4KHP J;  3I87 A;  3PZP A;  5FD1 A;  5B09 A;  2AJQ A;  4LBP A;  2JSX A;  4E2F B;  5DDO C;  4DR4 F;  1Q7Y T;  2W2M P;  3IS9 A;  4ZIV A;  1RUS A;  1RAG B;  1BUX A;  4JI0 F;  1NDL A;  1N33 F;  2HGL A;  3DRR B;  2JWN A;  1K0T A;  1VOM A;  4USJ C;  4JI7 F;  1PG5 B;  3DRS B;  3CJK B;  2HQI A;  1SPB P;  2GHP A;  4DV5 F;  3R5A A;  5L1L A;  1R43 A;  3OSN A;  4ZVG A;  4M95 A;  2F4V J;  4A8Q A;  1X5T A;  1LXJ A;  2BJ7 A;  3D6F B;  5I3Q A;  2XY5 A;  1O5J A;  5KFZ A;  3AFG A;  1YBT A;  4NX9 A;  2MZ1 A;  3MCN A;  5KFV A;  3DOL A;  4X66 F;  2JEJ A;  4ZMM A;  1Q81 T;  1KLN A;  4IOC Q;  4H4O B;  3U1N A;  2ZWO A;  3D2W A;  4X2B A;  4ZP9 A;  3KHL A;  4DR5 F;  3MEC B;  2Z0G A;  3KOA A;  2GJ2 A;  1C1C A;  1LWF B;  3J7Z T;  1QM9 A;  3SZ2 A;  4ZP8 A;  2X7I A;  1CG2 A;  4RNM A;  3A3N B;  3T6J A;  4PYD A;  3DOM A;  3I31 A;  4ETZ A;  4BLG A;  4O44 B;  4GC7 A;  2VKR A;  4LMZ A;  1Z2L A;  1WKL A;  4P74 A;  1FX4 A;  3RG6 A;  1U09 A;  1AUS L;  5DQH A;  2BW7 A;  3D66 A;  1HNZ F;  4DUT A;  2J5A A;  4JB8 B;  4ZN1 A;  1P6T A;  1PKU A;  9RUB A;  3TO8 A;  5BJR A;  1NK8 A;  1T11 A;  4DSE A;  3FSX A;  3M8S A;  3OJU A;  1PYT A;  1YJU A;  2VZ9 A;  2BM0 A;  3PEJ A;  4DN9 A;  2HZC A;  1UWA A;  2BMB A;  1IKY A;  2VFT A;  4AE5 A;  1RWP B;  5J1P A;  3ILJ A;  4J90 A;  2DIV A;  4OI6 A;  5HO4 A;  4CIO A;  2W4D A;  4EYI B;  4YP3 A;  2HHT A;  1DHM A;  2JOQ A;  1SB6 A;  4AT1 B;  1VBK A;  5C42 B;  2ASL A;  3H7H B;  2HVD A;  2KH9 A;  3PYD A;  2NXJ A;  5ETN A;  4O23 A;  1KR4 A;  3DGP B;  4YDD B;  4DFP A;  1HPZ A;  1ULR A;  3D67 A;  5A2Q U;  2ALZ A;  4NYP A;  1REV B;  4B3T J;  1GTH A;  3P6Y C;  2ZDP A;  2WOM A;  3Q86 A;  1Y5N B;  2ZZN A;  1RAC B;  3HT0 A;  4H4M A;  1VQ9 S;  2VB6 A;  5JVH Q;  3M8P B;  4WP3 A;  5CCM A;  2OKQ A;  2ROP A;  4JV0 A;  2K1R B;  3W3S A;  2D3Z A;  1HI1 A;  4Y28 C;  2MTL A;  1RWO B;  2Q1L A;  2OMO A;  3AQO A;  1X5P A;  5KFF A;  4DQQ A;  1SUQ A;  4M5K A;  3DM2 A;  3JTN A;  2JDJ A;  1Q86 T;  2YKM B;  1VBZ A;  2ASD A;  2ZBI A;  3P5B P;  4HDG A;  4DMZ A;  3K8V A;  2JC1 A;  3ILO A;  3FBF A;  4ICL A;  3MUR P;  1TKX B;  1JLF A;  4KQZ A;  3K8W A;  1H6K X;  2Z4P A;  2Y1I A;  4JI8 J;  4CT9 A;  4FF2 A;  3MM6 B;  4OX8 A;  4B9T A;  3I5B A;  5K8P A;  1IXK A;  2JH3 A;  4ECY A;  1V5I B;  2UVW A;  3OR1 B;  4GVL A;  3CSK A;  3QIP A;  3MM7 B;  3EXC X;  3V4M A;  1RT2 B;  2PI4 A;  1RCX B;  3TAR A;  3KLF B;  5H9F K;  2DY1 A;  1WWH A;  4QCL A;  2M0G B;  1R3N A;  1C0T B;  1OMS A;  1XMO F;  2UV8 A;  3SQG B;  3T1H F;  4JI1 F;  3HVT B;  5H9E K;  1JJ4 A;  2YNH A;  2K8G A;  2Q6B A;  4AL6 A;  4TY8 B;  2RT3 A;  3UN3 A;  2QYG A;  2RQK A;  4MFB B;  3ZZU A;  2PII A;  3LH2 S;  3G6E S;  2NS1 B;  4CM2 A;  4RW6 A;  1KRP A;  1RBL A;  2X3D A;  3HF5 A;  3P4U B;  4FPR A;  3DDK A;  3G6V A;  3QJP A;  3V6D A;  2PEB A;  2DK2 A;  1RT7 B;  3BF4 A;  4O3Q A;  2C2R A;  1R0A A;  2XYH B;  2P6S A;  4AFF A;  1RT5 B;  3PFE A;  2UUB J;  3FZ2 A;  4JV1 A;  4PCQ A;  5IS2 A;  2R2T A;  3LAL A;  4ANC A;  2OEM A;  4DLE A;  1NHV A;  3GTY X;  2VDH A;  1WJ9 A;  2QLB B;  3UWT A;  3C16 B;  2DKO B;  2BJ9 A;  2LQ5 A;  3DCA A;  1U2F A;  2XUL A;  1RGV A;  5KFK A;  4IQM A;  2JLF A;  4M5D A;  1BQN A;  2DO4 A;  3P45 B;  5D6G A;  4LUB A;  3MEE A;  3OFE A;  1HNV B;  2DO0 A;  3CJ8 A;  2VFS A;  4YME A;  2MKI A;  2DYA A;  2A2C A;  1N54 B;  1BQM B;  2F1F A;  1AYE A;  1VC0 A;  3T3F A;  2AP6 A;  2F9J A;  2KVQ E;  1NJX A;  4GC6 A;  4RNN A;  2LEA A;  4J9R A;  5J2Q A;  3NGK A;  2XO7 A;  1FD8 A;  4KAI A;  5GME A;  3AOA A;  5IV4 A;  2DPJ A;  3ILI A;  3DYA B;  2CPX A;  4KTQ A;  4M5J A;  4WU3 A;  3W9H A;  4DG1 A;  2GV1 A;  2NLW A;  3G4S S;  1RWK B;  1VBX A;  2X1B A;  1ZZF A;  3BGR B;  1TUV A;  3EVM A;  4QIF A;  4WYL A;  5DDR C;  2XM3 A;  1JJH A;  3EPI A;  2HND A;  4QWA A;  2HNY B;  3HK2 A;  2QLX A;  4K50 A;  5B0E A;  2ZJQ Q;  3TVK A;  1P9Q C;  3K89 A;  3MAQ A;  1SC4 B;  3RGI A;  2IRY A;  5HAO A;  1VJQ A;  5GAE I;  2Q66 A;  2BW2 A;  2YWE A;  4QZV B;  2ERR A;  3R5B A;  1SJ4 P;  1RTJ A;  2WVD A;  5IWA F;  3V6H A;  4YOE A;  1HHS A;  2G0J A;  4OYP A;  3O6Q A;  3TZY A;  3LPE A;  1WC5 A;  2H51 B;  5KFI A;  1VRT A;  2ZHO A;  4Y3C A;  2V2K A;  2DNZ A;  1U48 A;  3HUL A;  2KZM A;  2OIH A;  3CJ2 A;  1N36 J;  4H4K A;  1NKB A;  1AZS B;  1NBE B;  4NWB A;  4X4Q A;  3KG4 A;  3G87 A;  3MTK A;  1T9W A;  3W1Y C;  2RB7 A;  3I55 S;  3HO1 A;  1H2U X;  1PGZ A;  3NKY A;  3P3D A;  2BDP A;  2FGO A;  4OYW A;  4S0M A;  3B4M A;  1S0N A;  2QMU B;  2DR6 A;  4Q0B B;  1RT1 B;  1S1T A;  4WKY A;  1S9F A;  2DRB A;  1UFL A;  2FHO B;  3M05 A;  4HT5 A;  1NSA A;  5DQG A;  3MFI A;  1M1G A;  4ZPV R;  4DZD A;  2YX4 A;  4HHU A;  4IH5 A;  3ZTS A;  3M9M B;  1NM2 A;  2DNL A;  3KDN A;  3G82 B;  1HQE B;  1IBL F;  2F4F A;  2K7J A;  3DLJ A;  2AYE A;  4QYR A;  3DI6 A;  4RX6 A;  4BBY A;  1FK9 A;  5IC4 B;  3L4B C;  5KAK A;  4X64 F;  1O51 A;  4D3G A;  1LEO A;  5A76 A;  1GFW B;  2FLO A;  4DCO B;  4DZ6 A;  2FLP A;  3JSR A;  2N4D A;  3QID A;  4YB6 A;  2W25 A;  4USH A;  2VQE J;  3IA0 A;  3QT5 A;  5CYQ A;  3E51 A;  5A8K B;  1OSD A;  4Q2M A;  2G2Y A;  1RDR A;  4EYH B;  5C2C A;  5KFD A;  2LQ8 A;  1F5B A;  1HBO B;  5IM0 B;  1NDK A;  1F3V A;  5JXS A;  5I42 B;  3OUY A;  2W9C A;  5DM7 Q;  3HHL D;  2V8P A;  2DNQ A;  4YR0 A;  3VAL A;  2VH7 A;  1VLY A;  1RYS A;  1ZYQ A;  3QSI A;  1FTR A;  1R6V A;  2E5G A;  1NZ8 A;  2VBY A;  3ZZP A;  2ZUA A;  4ILM A;  4Y2K A;  2IMO A;  2DNR A;  4F67 A;  4CLS A;  4DSF A;  1NK9 A;  4DV6 F;  4ZHR A;  2CQ1 A;  3J81 U;  1ZM3 A;  2I2Y A;  4W92 B;  2OPP A;  4RO0 A;  1M5K C;  2RS2 A;  2HBZ B;  1M90 T;  3NGT A;  3OL9 A;  3OTE A;  4LRD A;  2C2K B;  3IR5 B;  3MMA B;  3OLA A;  3EWG A;  2A1B A;  1IR2 A;  2DXF A;  8RUC A;  4LJM A;  2CNL B;  2LCW A;  4NA1 A;  4ED6 A;  5KT4 A;  4PWU A;  3RZA A;  3C6T B;  3G2X A;  2HLT A;  1U49 A;  5BYR A;  3KJQ B;  2GIR A;  5EGY A;  4K4T A;  1S4E A;  5EWE A;  1WEL A;  1T9Y A;  2RQC A;  4OI3 A;  4XIU A;  3NY0 A;  3ET6 B;  1QD1 A;  2WZ1 A;  2VOP A;  2UU9 F;  1K44 A;  2VOD A;  1RBA A;  2XLI A;  2DH7 A;  1Q79 A;  3M8Y A;  2NSC A;  5B0A A;  2XCA A;  5K5M A;  3MMC B;  4IOA Q;  1N4L A;  2HHV A;  1NKC A;  3VAG A;  5FLX U;  2ZJR Q;  1U25 A;  3V4I A;  2N7Y A;  4NML A;  4OX9 F;  1D8Z A;  1LWC A;  2CNO B;  5DLF A;  2HBR B;  3L7P A;  4U6P A;  2AU0 A;  1T03 B;  3NG8 A;  2QC3 A;  5D0E A;  2QMW A;  3SIP B;  2V9K A;  3ISN C;  5M2R A;  1NH7 A;  3MUT P;  1HNX F;  1UPM B;  1FO1 A;  1ZAX A;  1MMN A;  1HD1 A;  2F8M A;  2BRL A;  2WVB A;  3I6P A;  4I4B A;  2P2C B;  2VOO A;  2OPS B;  2BYC A;  2D69 A;  1HBU B;  3LGH A;  1NK4 A;  3K2Y A;  1U1M A;  3TAP A;  4WII A;  1WG5 A;  3QNW B;  4C48 A;  1DJ0 A;  4PAA A;  1Y7P A;  1D0E A;  3KK3 A;  2ZM6 F;  1UEK A;  3CUN A;  3ENA A;  3N9U C;  4I7F B;  1DAX A;  1QTM A;  3MMJ A;  4HT7 A;  1XR7 A;  2QZ8 A;  2DGO A;  4N7T A;  4NCG A;  3RBD A;  1VGY A;  2BJ8 A;  2EFP A;  2HGN A;  2ZIT A;  3LGN A;  2DD8 S;  3F44 A;  4HR2 A;  4C11 B;  2IDE A;  2NZ4 A;  4I6A A;  2E1A A;  3VAH A;  1GH8 A;  4KYZ A;  5L1I A;  5AXN A;  1PAU B;  2PN6 A;  1V5V A;  4KY3 A;  2XMA A;  1SV5 B;  1HBM B;  3QO9 A;  3L7O A;  3I5C A;  4CQ1 A;  2YH1 A;  1KBR A;  1LKZ A;  3MM5 A; 
#chains in the Genus database with same CATH homology
 5BXI A;  2AZ1 A;  1KDN A;  3WX8 A;  3Q8U A;  1U8W A;  2CWK A;  3EVM A;  3FCW A;  2DXE A;  4S0M A;  1S59 A;  3VGU A;  3VGS A;  4ANC A;  1NLK L;  3FBE A;  3Q8Y A;  1NDC A;  3B54 A;  3ZTQ A;  1F6T A;  2VU5 A;  3GPA A;  1WKL A;  1K44 A;  3Q86 A;  3BBB A;  3DKD A;  1HHQ A;  1WKK A;  3ETM A;  1W7W A;  1HIY A;  3FBB A;  2ZUA A;  3BBF A;  1BE4 A;  3ENA A;  3L7U A;  4UOG A;  1B4S A;  3EE3 A;  3R9L A;  3EVW A;  3DDI A;  3NGS A;  1XIQ A;  3EJM A;  4DUT A;  2B8Q A;  4CP5 A;  1NSQ A;  1PKU A;  3ZTO A;  3ZTS A;  3Q8V A;  1XQI A;  1HLW A;  3FBC A;  2DYA A;  3FC9 A;  5CAB A;  4DI6 A;  3NGT A;  4ANE A;  3VVU A;  3EM1 A;  1MN7 A;  4FKY A;  1VYA A;  4AND A;  1NHK L;  2BEF A;  3NGU A;  4HR2 A;  5CAA A;  3EMT A;  4KPC A;  1LEO A;  2NCK L;  4UOF A;  4O0N A;  2DXF A;  4WBF A;  1ZS6 A;  1B99 A;  3EIC A;  3PRV A;  1PAE X;  3ZTR A;  3VVT A;  1MN9 A;  1WKJ A;  4DZ6 A;  1NPK A;  2B8P A;  4F4A A;  3G2X A;  3FBF A;  3VGV A;  3BBC A;  2AZ3 A;  3NGR A;  1JXV A;  1S5Z A;  2HVE A;  3VGT A;  1F3F A;  1NDP A;  1NSP A;  4UOH A;  3EVO A;  4EK2 A;  1S57 A;  3BH7 B;  4ENO A;  1UCN A;  5C7P A;  4C6A A;  1NUE A;  2HUR A;  1EHW A;  2BX6 A;  3ELH A;  3JS9 A;  1NSK L;  4W98 A;  4F36 A;  3B6B A;  1BHN A;  5IOL A;  1NCL A;  2DY9 A;  2HVD A;  3FCV A;  3PJ9 A;  1BUX A;  1LWX A;  3MPD A;  3BH6 B;  3Q83 A;  3GP9 A;  3Q89 A;  2DXD A;  1NDK A;  1NDL A;  4FKX A;  3ZTP A;  3FKB A;  1NB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...