3FBBA

Crystal structure of the mimivirus ndk n62l-r107g double mutant complexed with udp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
133
structure length
133
Chain Sequence
AGLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSKAPRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTDAISKIRRLQGNILTPGTIRGDLANDIGENLIHASDSEDSAVDEISIWFPET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase
publication title Dissecting the unique nucleotide specificity of mimivirus nucleoside diphosphate kinase.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Transferase
total genus 42
structure length 133
sequence length 133
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2008-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 3fbbA00
1JXVA 1VYAA 2DXFA 4DZ6A 2CWKA 3EVWA 3ZTPA 3EE3A 3MPDA 4UOGA 1S57A 1PAEX 1U8WA 1LEOA 4KPCA 4W98A 3EMTA 4DUTA 2BEFA 1K44A 3VGTA 2AZ1A 1HLWA 2VU5A 3BBFA 3DKDA 1NDKA 1XIQA 4ANCA 2DXEA 4FKYA 3BBBA 1EHWA 4UOFA 3JS9A 1NLKL 1B4SA 3ETMA 5CABA 3EICA 1PKUA 1F6TA 1S5ZA 3FBFA 4S0MA 3ZTSA 3NGSA 3GPAA 3EVMA 1BUXA 4DI6A 1BE4A 3VVTA 3G2XA 3DDIA 1NDLA 5CAAA 3EJMA 1NCLA 3ELHA 3GP9A 3ZTQA 1LWXA 3FC9A 3Q89A 3Q86A 4C6AA 1WKLA 3L7UA 1ZS6A 3FKBA 2NCKL 3BBCA 5BXIA 3ZTRA 3BH6B 2DXDA 4UOHA 3VVUA 2HVDA 4F4AA 3FBEA 1NB2A 2AZ3A 4ANDA 3VGUA 5C7PA 3FCWA 1W7WA 2DYAA 3WX8A 1MN7A 1NSPA 1KDNA 1NHKL 1NSKL 1S59A 3Q8VA 2ZUAA 1XQIA 2HURA 3ENAA 3PRVA 3Q8UA 1NDCA 3Q8YA 4F36A 3Q83A 1NPKA 2B8PA 2B8QA 5IOLA 1HIYA 1HHQA 2BX6A 4CP5A 3EVOA 3VGVA 1BHNA 4FKXA 1WKKA 4HR2A 2HVEA 3R9LA 1NSQA 3FBCA 1F3FA 2DY9A 1NUEA 1B99A 4WBFA 3PJ9A 3VGSA 3NGUA 1UCNA 4O0NA 4EK2A 4ENOA 3NGTA 1NDPA 3ZTOA 3FBBA 3FCVA 1MN9A 3NGRA 3BH7B 3EM1A 3B54A 4ANEA 3B6BA 1WKJA
chains in the Genus database with same CATH superfamily
1UL3A 3K7RA 1LFPA 3LP2B 3IAS9 1RHJB 3T1YF 1RTZA 2O1PA 4NLUA 4LIWA 2IJRA 1KHWA 4OX6A 4EBEA 4IFVA 4O23A 4YP3A 2HFVA 1BLUA 2DNLA 2IVFB 2WW8A 1NK5A 1VRUA 1HKAA 3O5TB 1CG2A 3CD5A 4WIQA 2GW8A 3GV8B 4U6PA 2OIHA 4M5GA 3FSIA 4HH1A 3ZZPA 2HYIB 2B4VA 1S49A 5KG3A 3TX0A 2B4UA 3CW2C 2BQUA 1I94J 4YFUA 1PC4A 1QAJA 3M2VB 1TMJA 3X3UA 1Y10A 4N8NA 1V3ZA 2C28A 3G6YA 2QL9B 3OHBA 5L1JA 1CSJA 4QU6A 3PIOQ 5KFIA 1UETA 1FDAA 2V94A 2HPUA 2AYEA 3ZZOA 3UN2A 1S57A 4B9MA 1E6YA 5H9FK 5IQQA 1SJRA 3PDNA 2G0JA 2WK4A 4LJMA 4EZ9A 3MUMP 1T95A 1S5ZA 3KTQA 1WSVA 4E98A 3MCMA 2DVIA 4RBUA 3TUIC 3O2IA 1HYSA 2V50A 2KXHA 2JH3A 3LGHA 2E1AA 4NMXA 3F44A 4DCOB 1UP1A 1IBCB 3MMCA 5HVFA 1P9YA 4X64F 2CQ3A 3K8WA 4USHA 1RHRB 5L39A 3AFGA 1E6VB 3W63A 4JB8B 2VKZG 4TYBA 3WC2A 3M6UA 4TQSA 3UDEA 4NLPA 2XS5A 1RAHB 5LMNJ 2UXDF 3JQJA 4TY8B 3IR7B 1S0NA 4HKQA 1CPZA 1YJVA 4CDIA 2YXLA 1FKPA 1KQGB 2AP6A 3JSYA 4B3TF 5HVGA 1YBTA 3C3LA 5I3QA 4F02A 2CJKA 2QV6A 3N01A 3BV8A 3NS5A 2L41A 3ICLA 4B3SF 1S48A 3F56A 1R0AA 2GGPB 3JQMA 5J2QA 1H38A 2DRBA 2VJVA 1HNXF 3WHIA 5T41A 2BOPA 3CDBA 1GQEA 3GFYA 2VB6A 3M8PB 1NJIT 1NHKL 1AUSL 1RTJA 2PN6A 4MK9A 5DG7A 4O4GA 5GAEU 3G4SS 2L48A 5KFAA 4DFPA 4HR2A 3CJ4A 3SYZA 4Z2XA 3GYGA 4O0NA 4F4KA 2W2PP 3SEOA 3PW4A 4DQIA 2KKHA 3QGHA 4IG3A 3L95X 1DBDA 1KS2A 3ZZTA 2W8KA 2NXEA 3HM9A 5H9FJ 2HZAA 2J9DA 3OXLA 2DR9A 1UJ5A 5G0RB 4ECTA 1G3OA 3EMTA 3SSRA 3OL8A 1EKRA 4RUAA 4CYUB 2L3MA 5FD1A 5HN0A 4RJVA 2M2BA 4B9SA 3EZ5A 1NK7A 4U9RA 3QGIA 1M1KT 3DDIA 4RW4B 1HWJA 1FWKA 2EC0A 4KKOA 3GP9A 3CCRS 4R8UB 3H4DA 2R2RA 5KT3A 1FE4A 3JQKA 2B4PA 4RW7A 1MW7A 1RT5B 1U48A 3EPGA 2IRUA 1WEZA 1ZAWA 3BEGB 3CTRA 1CEZA 4CLTA 2YQ3A 2GQQA 2DH8A 5FLXU 2AYGA 4M5DA 2W7OA 2XMUA 3UN5A 4OV1A 3DRPA 1JB0C 3QNWB 4CP5A 3T6BA 1UA1A 3TAMA 3P96A 3MPYA 2FUG9 3KJQB 2WB4A 4LSNB 3KUGA 2A6OA 2PC6A 2VQFF 3R2DJ 4IO9Q 1G4CA 1GMUA 2KYXA 3BSAA 1EJ7L 4KV8B 1LXJA 4ZN3A 1N36F 4JI3J 2WBRA 3BKFA 4DG1A 3HSDA 2RQCA 2ADCA 3PIPQ 1SI9A 2W25A 1M5OC 1VBYA 4B3OB 3TVZA 1CJTA 5CAAA 4AFFA 2DH7A 2HZVA 3KOAA 3G86A 3G82B 1RWKB 4DR2F 2R7RA 3OFEA 4USMA 3C2PA 1WELA 2WHOA 2DD8S 4X66F 2AZ3A 4O3NA 3UNYA 1S12A 4QOTA 4NLXA 1GTEA 3DNCA 1RU1A 4TN2A 5KG0A 2W2NP 3LP1A 5L9XA 1GAOA 2BRLA 5DQIA 3LANA 4ITSA 3LP0A 2DR7A 4NXNF 3TJ9A 4CZCA 2BVZA 1AUDA 1S1TA 3FUYA 4FF4A 4N7TA 1ZBTA 3C16A 3KJVA 5EN1A 4FPIA 1QLNA 2HGMA 3DOKB 3T1YJ 4L3NA 4TXSA 1SC3B 3M7VA 2R7XA 4FZVA 1RU2A 4FYWB 2OPPB 3VAJA 1HQUB 1RB0A 3MXHP 4Y00A 1VIOA 3THPA 1FKOB 3PYDA 4X4RA 2E1MC 3DOMA 2UXCF 3FZ2A 2XEXA 2KJWA 1T0TV 1TKDA 2D69A 4Z7YA 3DFEA 4R0JA 1AZSB 5ITHA 2R2SA 3KMQA 1DY3A 2XMJA 1HWIA 4NZ7A 4IH6A 5KFMA 2IAJB 4NLYA 4J9PA 2K7JA 4IR1A 3NAIA 3Q23A 1YHQS 4IRCA 1U47A 4I7FB 2A1BA 4O3RA 3GSDA 3BQ1A 3EM1A 2K7KA 3LWLA 4YOEA 3PVXA 2ERRA 2V4JA 1VGYA 1HW8A 5CZVA 2VV5A 3NS7B 4GKKF 3DHXA 3GTYX 2JRSA 1EHWA 3AD8C 4DQSA 3EZUA 4ICLA 3AY0A 5CQGA 5IWAF 3CT9A 1JMTA 2DGSA 2VFSA 1HQEA 4CNZA 2OJ3A 3W2VB 3CJ5A 1LW2B 1V5IB 2CQCA 4Y2CA 3HHLA 2CDQA 1Y3JA 1WC0A 4X64J 1HBOB 3D7SB 4CQ1A 2BDPA 4AUKA 2KHDA 3CJKB 4RO0A 3HD2A 2PI4A 3OR2A 4HHUA 2OKQA 5E33A 5M2UA 2CPYA 2DHXA 4GVLA 1SQGA 4KO0B 1N5SA 2UXDJ 3MOZA 2GO8A 3NMAA 3RUBL 1NKEA 4LR8A 1UA0A 2KFZA 3PHTA 3CD6S 3DRYA 4NLVA 4MT1A 2FY8A 2MKKA 4QIEA 1AB8A 4B3TJ 5A8RA 3EX7B 3D0HE 5K5MA 1VC5A 3Q2TC 2VPXB 3J81Y 2N4DA 3GONA 3SZ2A 3MM7B 4B3SJ 2V6AA 3HHNB 3LP2A 2HAIA 1D1UA 1VMBA 1HNXJ 2FGCA 3MECB 1S1WB 4OZ2A 3J81j 1PG5B 1NM2A 4LVNP 1OYEA 4C8MA 3W2WB 3TUJC 4DBQA 3BYPA 2ZZNA 4ZN1A 3U02A 3QFHA 5GMDA 3IBFB 2LEPA 5IM0B 1S6UA 2YWWA 1EARA 2RJZA 2OPQB 2CJYB 1TL4A 1CULB 1DARA 4KPYA 1BGXT 2EFPA 5J2NB 3M2VA 4DR7F 3J7A1 2XI3A 1S9EB 3LGMA 4LIRA 1TAQA 2FHMA 4KPCA 4DR1F 5HVHA 1FFWB 2H4WB 2VU5A 4RL1A 3JAMY 1QAYA 2KM8C 4U7UK 4CLUA 4KGZB 1VQ8S 2M88A 3FK4A 3RB3A 2Q1LA 3AB2B 1TFYA 4CO4A 3S01A 3TZWA 1IUJA 1FNOA 1B0PA 3DDNA 2WVEA 1G6BA 4F2SA 2JDJA 1SKRA 4P9SA 5L8RC 1SC1B 2D9OA 1NSKL 2GMHA 3H5SA 2I0XA 3M8ZA 2FTRA 3EVOA 2C3YA 2OFHX 1H0HB 2K06A 3TZXA 1HA1A 3M8QA 1IXKA 5KFXA 4MKYA 3RBZA 2VQFJ 5H9EK 5GAHU 2XSJB 3GMGA 2RIJA 3NNHA 3CDEA 3UN3A 4F67A 1N36J 1E6VA 1R6VA 4J5OA 4JV2A 4UZCA 4JI6F 3DKDA 1X0FA 4WU3A 2QA2A 3I6PA 2PDAA 5FDLB 3W9HA 2F63A 1P9QC 3ET6A 4TY8A 1N48A 4H4KC 3PG9A 4DR2J 3J80U 4OLOA 1AT1B 5J2MB 2LQJA 4BCAA 2DXDA 4X66J 4IQMA 3D1HA 3A3PB 4DX6A 1TL3B 4XPCA 3RBEA 2AYMA 3ENAA 3PR4A 1JLCA 4DUZJ 2OD6A 2MQOA 2OTJS 2HBQB 5DZ7A 2J0WA 2ZZTA 2FVCA 3I56S 4K4XA 3CIZA 3OSPA 2O3DA 4ENOA 1RKJA 2UVUA 4OL8A 1RT4B 1YK9A 2QZ8A 5KT6A 2NYHA 4H4OB 2P9EA 4FYVB 2LXUA 1VYAA 4WZQA 3QT8A 2YX4A 1KSPA 4DS4A 1X4DA 1M1GA 3HPOA 2GVDB 4UQTA 2O67A 3DRRA 4ZP6A 1VBKA 2DHAA 3MPWA 3TW0A 1JJ2R 1FJCA 1WACA 2MZTA 3OL6A 2MSSA 3ILOA 3GIMA 2MQQA 2OO4A 3DLLQ 4X4OA 3CJRA 1DLOA 4CLWA 1FNMA 3Q22A 4CYUA 5SUHA 2RB7A 1RAJA 3TOQA 5JVGQ 5KFVA 2BR0A 1NZAA 2NS1B 3BO2A 5KFPA 2E9ZA 1TV6B 2AJQA 4R8UA 4YN3B 2YNGB 3EZOA 2HHPA 1XK8A 2DNOA 2BJ3A 3OR1A 5H9EJ 2E1RA 1VRQC 1RT5A 4Z37A 1QY7A 5IS2A 4LVOP 1D8YA 3LAKA 1LV5A 3EE3A 4P72A 3ZZ0A 1JLBA 4GKKJ 2F9DA 2FVSA 3HFVA 5ETQA 5KG7A 1T7PA 2ZC3A 4I6WA 3TARA 5J1NA 4ELTA 5CH7B 4TU9A 4LF9F 1FD2A 4LSNA 3HFKA 1QM9A 4Y2MA 4P71A 2DHSA 4O44B 4MIBA 4RLEA 5ETTA 1XMBA 3CCJS 3IWNC 5E5NA 5D15A 3NCQA 4F4WA 2IM0A 3FCHA 3UO0A 2UV8G 2V2ZA 2ZNZA 3ITHB 2YH0A 4LRCA 4PUOA 1HBUA 1HQ2A 3A1YG 3C6TB 4ANDA 1DTQB 4YR2A 5AE1A 5JMNA 5HO4A 1TK5A 4B3OA 2J0QD 2LLZA 4ETXA 2BE9B 3JSMB 1DQAA 2M70A 4OFZA 3P5TL 3ONQA 3VAHA 1Q82T 5THWA 2Q6BA 3PR5B 4ZLLA 2R9LA 2HNYB 4K2JA 4OMFG 1DQ8A 4UZBA 2KYZA 5KFLA 2WONB 2YWKA 1FJGF 3EVWA 3GILA 2DCUB 1PAEX 3HP6A 1RWUA 4DN9A 2HMIB 2L9NA 4HACB 1ZTTA 4DSKA 1J2VA 2E5JA 3PTWA 4ZPBA 2R2UA 1OSDA 1U02A 3PYGA 1YDLA 3HHDA 1LWEA 1Y5LB 2KO1A 3BGFA 3W5YA 3HFZB 2HS3A 4J9NA 3EJMA 3UDLA 2VDIA 4OYOA 1TKZA 4GC6A 3W3SA 3B8HA 1VQPS 1YKWA 3EDRB 2E1CA 2OPPA 3I9ZA 1BXNA 5HSPA 1HQUA 4DF8A 3UVJB 5K8PA 2EKYA 1Y11A 3RB6A 1KHVA 1FKOA 1RQ0A 1SPBP 3M6WA 4ID8A 2MMYA 5GMEA 4WPAA 5HI7A 3QGPA 2W8LA 1IQZA 2BJ1A 5K14B 2AIRB 4YB7A 5KFJA 4YR0A 1SUQA 2Q6CA 2R7UA 2CDRB 1FEEA 3WDOA 1A6LA 5B0GA 4U96A 4EO6A 2DISA 2V9WA 5IC4B 3OL7A 1KRPA 2NPFA 2I38A 4DR1J 1CLFA 1PYSB 3W64A 2IAJA 2IM1A 5KFOA 2DY1A 1VC6A 2D3ZA 1HHSA 2MDAA 3LH2S 4B9TA 3IBCB 3LAMA 5D6GA 2KZZA 1RT3B 3T41A 3CCLS 5DGAA 4U7CA 2VG5A 3ZZYA 1PJ7A 5LXYA 3OFFA 2FZKB 3D0IE 2MY8A 1XNRF 1RHUB 1JLQA 4L76A 1DAXA 3CB4A 3S6EA 1MLAA 3C8YA 5BJRA 1DURA 3QWPA 4C11A 3PEJA 3Q0AA 3CEDA 4FYDA 2HRUA 1V3SA 1IWAA 1Q78A 1WC4A 3JXOA 3NEKA 3WIUA 5KFTA 1HW9A 4ATNA 3W2VA 3H2UB 4ZJOA 2Y1JA 1LW2A 1Z2LA 1SJ3P 3IP0A 2RU9A 2EEYA 3NGTA 1X4HA 1C0UB 1RLDA 1EAYC 1OY9A 1Y0HA 4USIA 2BYCA 3R1HA 3E01B 4JI6J 1JIHA 1KTVA 4N77A 3E51A 5DDQC 4LF2A 2A2DA 5EX0A 2VUGA 4O4RA 3HK2A 5CYJA 3M6XA 4S0MA 1ZETA 5F8JA 3NGSA 3GPAA 2V68A 5KFEA 1BE4A 3MTJA 4M5LA 4RNFA 1HD1A 3SXLA 4UQGA 4FP9A 2CJQA 3AHPA 3CD7A 1FVSA 3I5BA 2E5GA 5DLGA 4FXWA 3FKBA 4ETZA 1Q53A 2NLWA 3VALA 5ETLA 5DDRC 4NXMF 1QAXA 1YZ7A 4QWEA 3VHQA 5KG2A 3H4BA 3GG0A 3Q8VA 3T1AA 2AJ4A 3BSCA 3MM7A 3TX8A 5F8LA 5C25B 4F36A 2DKOB 3TI0A 2B8QA 1RT6A 3MECA 1S1WA 2HGLA 3VGSA 5KFKA 3P4UB 5C5JA 4KH1B 3L9ZA 3FCVA 2HFUA 4CWBA 1L3TA 4ZLJA 4PCQA 2QA1A 2ZH3A 2YKOA 2OPQA 5CZXA 3RRKA 1NU4A 3AOCA 1CULA 3TJ8A 4UOFA 3JS9A 1KQSR 2HLTA 2IYIA 2F4FA 3R5JB 2VBYA 3HDSA 1ROFA 1S9EA 1Q5VA 5KG5A 2FY1A 2V2KA 4ZVEA 1YWXA 2LFVA 2A0FB 3OVBA 1RAFB 4P7TA 5EWGA 4I1TA 4C3LA 3IWLA 1RLCL 4H54A 2NPIA 4IH5A 2J9CA 2R7QA 3SQGB 2BACA 1NO8A 2IA0A 1PYTA 2XLJA 4NCGA 2FHJA 4JI4F 3NP5A 3OXFA 4ZLPA 1HIYA 2MKHA 5HJYA 5KFCA 3R7BB 1RAAB 4OJ1A 2F8HA 3KG0A 1LOUA 1X9WA 4TY9A 2QFIA 4OLPA 4KAIA 4USTA 3NGRA 2UVVA 4ZPWR 1IWGA 4KT0C 4OYPA 1R8CA 2IVYA 1H2TZ 2MLYA 4LF9J 3QZ7A 7AT1B 3W8PA 3W66A 2ZJRQ 4OYBA 2Y1RI 4ECRA 4JI0F 3VTIA 3HHEA 3ZC4A 2XMAA 2XCPA 2QFJA 5I42B 1ZM4A 3UE2A 4ZHRB 2BE7D 2I9SA 1U49A 1NJXA 3NAHA 1NHUA 2HNZB 2D3O1 3KUHA 4HEA9 5FDLA 2B9EA 5CCLA 2IVMA 1QUPA 3D68A 3OFGA 1U09A 2XB2D 3SI8A 3NNAA 1SQFA 3OJSA 3CJQA 3JYTB 1KKHA 1HNVB 3AOBA 1MG7A 3MEDB 1T9XA 2M4MA 2ZKTA 4X4QA 2GMLA 2PA8D 5GADI 2AJFE 3KLEB 2IBKA 3QZ8A 1B3TA 1FJGJ 5JJBA 4HL9A 5IZHA 1U8WA 2BANA 1LEOA 4FYYB 4O0IA 5FLXY 2W4DA 1TUVA 3W9JA 4W92B 1R89A 1HARA 4ANCA 1O6XA 1OQ6A 2RUGA 5DM6Q 3K2YA 2OUGA 4DSJA 2JLGA 1VRTA 1RDRA 1B7YB 2X1AA 1SC6A 3Q86A 2ZJQQ 4F8RA 2QT7A 3V6DB 3R7SB 4ES1A 2IHR1 4PYDA 2GVDA 1XMOF 1TMMA 1FXLA 2DJWA 2VODA 3SCKE 3MTKA 4DL2A 1SB6A 1VQ7S 3FZBA 5B09A 4ZDNA 2V8GA 4DF4A 2AEMA 2UUCJ 3ZXWA 2AJ2A 3Q8UA 3LO3A 4C0HA 3CJTA 1NK6A 1IKVB 4DV7F 2JSXA 2DGVA 1SQEA 3DRSA 4LRAA 2FJDB 4Q45A 1M5VC 4LFBF 1X4BA 1IBMF 3TEGA 3HKWA 3MEKA 2W9CB 1R8BA 1KOOA 3NBPB 3CC7S 2YNGA 1RTHA 3CJ8A 1PCAA 3TVYA 3JB9k 4FF2A 1CQMA 1VQSA 2N3LA 3R5BA 2DXEA 1HPZB 3PW7A 3D9BA 3MAAB 1RK8A 1S9FA 3N6LA 2Z56B 4JI1F 4IOBA 4A48A 3J7YI 3OHAA 4K59A 2FHKA 1XR7A 4OI2A 3GJRB 2R42A 2F4VF 1N5YB 3PRDA 2PFFB 1XNRJ 4N56A 4CTAA 2VICA 1T9WA 3HJFA 1WDTA 3M8RA 5HMXA 3IA0A 2F3JA 3PKYA 1RTIB 3FCWA 1S1UB 4O44A 1T8EA 3VWSA 2ZH2A 5I3UB 3AJ1A 2U1AA 4F7VA 2LDYA 1PSDA 3FEZA 9RUBA 3R5AA 4YB1P 4AL5A 2R7SA 2WB1D 1HI1A 2ALZA 2XMVA 3ULHA 2XHWA 3SBMA 3ITHA 4WXOA 4PRFA 1YVFA 3C6TA 1VHFA 1DTQA 2R8IA 1S6QB 1IBLJ 2B7BB 2HNDA 4ALZA 3BF4A 4C2MA 4MIWA 2H5JB 2M3DA 2V8DA 3I96A 2MKJA 2RUSA 3TYTA 2W9AA 1IR0A 1UFKA 4F3QA 4J9MA 1NDKA 3NLCA 3DHWC 4CM2A 3QLHA 3D54A 1GMWD 2HNYA 1LWCB 2WW4A 3Q24A 3H25A 2F7VA 3CO9A 3GJTB 1DTTB 4RWWA 1OYDA 4DI6A 5B7WA 1Q95G 2C2KB 2JVOA 2WONA 1YJNS 2CYYA 4TNOA 2BKNA 4BS2A 4MMOA 2K1RA 3CWJA 2HMIA 2UXBF 3AAWB 2YPYA 4ED1A 1Q0NA 4NXMJ 2FDNA 4K0KF 5JUMA 3P49B 3K17A 5LM7E 1WOPA 3RW7A 1WDDA 3PNIA 3QAEA 4NASA 4UOCA 1GFWB 2C2NA 4FYXB 4DPOA 1FTCA 2LQ8A 3KYLA 3SV3A 5J1EB 4JI7F 1VRUB 2YWHA 4OJHA 4OYAA 4UF4A 2DY9A 5B08A 4I2PA 3VQSA 3HSGA 2XGQA 1PO6A 4PQUB 2CQ0A 1WOOA 2CFXA 3PHEA 1U0HA 3UCUP 2X3GA 3MM6B 1KLMB 1EP4A 1S99A 1S6OA 1PBUA 1WHYA 5L1KA 5K14A 4X4SA 3R7NB 3ENVA 1HBNB 2R2TA 2QLJB 2DIVA 1U1QA 4O3PA 1SJ4P 4DL7A 2AF6A 2ZOFA 1NCLA 1BWEA 4WWSA 4FBUA 4M63A 2KFYA 3GJSB 4Y2KA 4RNOA 2DRDA 1VOMA 2F1FA 5K9FA 1E6YB 2VJUA 1UVNA 5CHCB 3PRBA 2IDEA 2XWYA 1JQGA 4JI4J 2EFNA 2O5DA 1VLYA 3DLGA 4Q7AA 2FJEB 4CO5A 3IC1A 1XEZA 3G8TA 2FZGB 3LGNA 1WHVA 2QSFA 2CIMA 2JEIA 1C1CB 5U47A 1VLOA 1MN7A 4NL5A 5LSRA 2QMXA 2MJNA 3MMCB 3HKZD 2VA3A 2W2OP 4PQAA 4KHPJ 1KVJA 1G7CB 5BR8F 5K20B 4O3QA 1S4FA 1FTRA 1ZTWA 2M8HA 2DNQA 4JI0J 2V4QA 1B4SA 2XY5A 1X5OA 4QBUA 1C0UA 2VPYB 1UTAA 3IGVA 2VPZB 3IO1A 2ZH9A 3E01A 3L7UA 1FX2A 3D67A 1LKZA 2C3OA 1X5PA 3N5FA 1ICEB 1FKPB 2RD5C 1OY8A 1N6QB 2ZJPQ 1O51A 1OPZA 2EWHA 5IV4A 1L5UA 2HIQA 2AV5A 2RU3A 1FNXH 2AW0A 3IMQJ 4TU8A 1JLGA 2YX7A 2IC3B 3ETOA 2LQBA 3G6XA 1VQYA 4ZITA 4DL4A 4DU7A 3WX4A 1K8AT 3DC2A 3CJ2A 3T5JA 5DO2A 2C3PA 4QR2A 1GNKA 4I68A 1P27B 3TVKA 5SZTA 1SH0A 1KBRA 1UCNA 1U1LA 2PD1A 3AQOA 4EO8A 4I2QB 4ZA1A 4D3GA 1U26A 3B4DA 2G1HA 4EBDA 3H0PA 1S6PB 5L38A 1RTJB 4B17A 3KHLA 3MD3A 2J9EA 3OVSA 5A8WB 4QWDA 2ZFHA 3LW5C 2LMIA 2OTLS 4OQJA 1OPIA 1FRKA 3KNGA 4F2RA 5IQ6A 4F0MA 2PMHA 1VFJA 3U27A 3A3NB 4Y34A 4CT8A 1D9AA 1XMOJ 1RJJA 1LK5A 2AJ0A 4NX9A 1OSCA 3ZZUA 2HHXA 1IR2A 4MIAA 2PO4A 2VBZA 4IRKA 4KGMA 2IRYA 4EMDA 1UFLA 4TU7A 4J9QA 3KK1B 4AT1B 3MUVP 4MK7A 4I4BA 1G2EA 1GXLA 4EWTA 1FX4A 4DV7J 3J80Y 2RH3A 3IRXB 5CD4A 3W9IA 4KKOB 2HZCA 5HQMA 2VDHA 4LFBJ 2DB1A 3N6NA 4OIXA 1IBMJ 5ADZA 1S1XA 4ID5B 3PW0A 1QD1A 1VQLS 3NNCA 4C8YA 1N33F 1NK0A 5BYQA 1GK8A 2PT0A 3R6GB 1CBKA 2RDJA 3P3DA 2FZCB 3TEHB 3ZNUA 4HYKA 2JFKA 3MMBB 1WI8A 1W2BR 3SSSA 3DRPB 2I6WA 1RABB 4MKBA 4JI1J 1QE1A 3OW2R 2OAUA 2VF3A 4J9VA 2P8IA 2F4VJ 4HVZA 4ES3A 4NOHA 1APSA 2NXJA 1H74A 3TUPA 2GAHC 4WE1A 1FESA 4JV0A 1QSSA 3W7BA 5AJ3F 1S0MA 4C3KA 1RAOA 1K47A 1EKSA 1TUGB 1IM6A 1WHWA 1WUUA 2Z57B 1UEKA 4M94A 2HWTA 4ZHRA 3AQPA 1NPKA 2XYGB 4WFXA 2RMLA 1VHIA 2ZM6F 4C97A 2HRYA 3CMES 4B3MF 1YI2S 1B99A 1N54B 3NGUA 2ZHAA 4EK2A 4MFBB 4RNNA 1OY6A 1WSRA 1XTZA 4DR6F 2X1GA 3LUYA 3NOCA 2QN6B 1Q81T 3Q8SB 2HQCA 1WF2A 2DGTA 2V67A 3JYTA 4WKRA 1HNVA 2ASDA 1FK9A 4I0WA 4JI5J 3MEDA 4A4JA 5D0EA 3R8YA 3TWZA 3HI9A 3D1OA 3KWMA 5HP1B 3IM8A 3KLEA 4R0EA 1Y7PA 4PXDA 2YWEA 3MAHA 1A7GE 2UXBJ 3CMQA 3CC4S 3T6JA 4LT6A 3M30A 3IXQA 4ZKAA 2ASLA 5KTQA 3G71S 4ZCLA 1KC8T 4WYLA 4K0KJ 2J5AA 4ECZA 4F4XA 3MWBA 3SCIE 4QWBA 3KLIB 2XNRA 4QWCA 1YJ7A 4OYWA 3DI6A 3U1MA 4L74A 5C2GA 3FMWA 4UUWA 4JI7J 4NEZA 5DRKA 3V6DA 4R5PB 2ZH1A 1UKUA 1U1MA 5KFSA 1XMQF 3V4MA 2MXYA 1CJVB 3EGZA 4KR0B 4BBYA 2WVFA 3FBCA 2GVZB 3M32B 3DOMB 2ZKUA 1UPMB 3BREA 4J9RA 2JEGA 1RYRA 2CQHA 2J8AA 2B9XA 1WKJA 4K8RA 4TLRA 4PG8A 1HNWJ 2E7WA 3PACA 1LWFB 3CCQS 3RB0A 1VBZA 3RZAA 2IA6A 4DV2F 2CPDA 7FDRA 3QPIA 3RYLA 1FWPA 3MEEB 4NZ0A 2W9CA 3V6HA 3D6TB 2UUTA 1I5OB 3NBPA 1T3OA 1NEEA 5T14A 5HQLA 5A6WA 3I4PA 2R8KA 3MMJA 3V81A 3H5XA 1HPZA 2QA4S 3MAAA 3CDAA 5KFRA 4WP3A 1EX8A 5LSOA 2KXFA 3V6KA 2J6UA 4KY3A 1T94A 4ICLB 2EC2A 1C2PA 1N5YA 2BOAA 2V8HA 1T3NA 1K73T 1U1OA 2LA6A 2ROEA 3UFCX 5L9NA 2ROPA 5F8MA 2G1DA 1RTIA 1SKWA 2RQMA 3UD5A 2H3EB 3CCZA 1S1UA 3KLVA 1FE0A 3K59A 1TR0A 2BQRA 4ZK7M 3BN4A 1JLAB 1RA7A 2DR6A 2EW9A 1S77D 1YG0A 3GB0A 4EYHB 4Z7CA 5BR8J 5B0CA 1R7IA 3MF5A 3UR0A 2RSQA 3OR2B 4J91A 4CLYA 4DSLA 1YJTA 2YWGA 4K5RA 3E2EA 1VQOS 2RS2A 2E5LF 2L08A 2HKEA 3DM2A 2C3UA 2G13A 4YR3A 1H72C 4ILLA 3MM9A 4J9KA 5F3ZA 3Q89A 5ETRA 1WKLA 2CRLA 5GADU 3HVTA 4NCAA 3RRGA 1SKUB 3B82A 1ULRA 4FF3A 4IR9A 1EZZB 2CPJA 1LWCA 1R8HA 1BQXA 4OJGA 2NXCA 4CO1A 1M5KC 5T7LB 4NYZA 2ATCB 3DYAB 2XSFA 2EPIA 2WCXA 4NLWA 4NLSA 5AXMA 2BX6A 1BHNA 8ATCB 1REVA 2GQ2A 5ETNA 4H4MA 3AH6A 1HWKA 2HBRB 4U95A 4O3OA 1Y00A 4LBHA 3A3OB 1BQNA 1FRHA 3MR6A 4CNYA 1S0VA 5J1EA 5MAOA 3BYRA 4C4WA 4F3OA 3V2UC 2DGUA 6AT1B 4KFBB 4LF7F 3OLAA 1Q8KA 4PQUA 2CNKB 2K3KA 4A46A 3BJYA 4RU2A 2RKIA 1JNZB 1IR1A 4N76A 2QIFA 2HAFA 3FRZA 1KEKA 2RDIA 4B3RF 3VZIA 1NSAA 3MM6A 1KLMA 2VFRA 5KG4A 3ZTRA 2JOQA 3KXDA 4GO7X 3GE9A 1IKXA 3FFIA 3I9V9 4NI2A 4TQRA 5F8NA 3K5OA 1HBNA 4F3MA 2A10A 3RW6A 1F5CA 5B0DA 2D9PA 1QVGR 3X1LB 5LJ5Y 3DLKA 3KJFB 4NZ6A 1HHQA 3VGVA 1PBAA 1RE1B 4XPEA 3J7YU 4XTTA 1SC4B 4L6V3 2Z30B 2AEFA 1UVIA 2LVWA 1C4CA 1MU2B 1KQFB 1N33J 1RA6A 2VASA 4NE9C 1R43A 3PYFA 4DR5F 5KFDA 4AD6A 1K44A 4PG7A 1SJFA 2PFDA 5KOWA 4F0KA 1UVKA 3MPUB 3M8QB 1KN6A 4ZPVR 2V2QA 2XGPA 4RUBA 1TK0A 1C1CA 4WFAQ 5JXSA 1VQMS 2BJ7A 2MY7A 3RBXA 1I1GA 4XO0A 3GV7B 1CC8A 1WORA 1ZAXA 5AJ3J 3IRWP 4Q8EA 3O44A 1NKCA 3K5PA 4ZVFA 3D5MA 3QWUA 5I4MA 5D4OA 2BBEA 2XHCA 3ET6B 3PJWA 4Q43A 2ZM6J 2E7VA 2C2OB 3E3XA 4B3MJ 2DPJA 2VOOA 2XBPA 5C24A 1TL1B 1N6QA 4DPYA 2WSEC 4A8MP 2KJVA 1K0VA 1QUVA 3UD3P 2OMLA 3W60A 3PY8A 4DR6J 2IC3A 2Y0SD 2HVZA 3DCAA 4F26A 4ZCKA 1D09B 5AT1B 1JLCB 2QMWA 3KG1A 1NPRA 2V9KA 4YS2A 1FJ7A 4DV4F 1EQ0A 3CF5Q 4I2QA 4M5IA 2ROGA 1M90T 3V4IB 2ZITA 1HR0F 2FC8A 3EYZA 5DQHA 1S6PA 4FVCA 4C6AA 3QRRA 7FD1A 5KFYA 2KN4A 2QLXA 3BH6B 5HANA 2LDIA 2EK6A 1OS5A 5A8WA 4WTOB 1X7VA 3DRRB 2CKWA 2CQ2A 4RW6B 3L7OA 3M6VA 2ZE2A 4JV1A 1U2RA 5AXLA 4K4YA 1XMQJ 2B43A 1BMQB 2DPIA 2RQ4A 1DLOB 2DNKA 4UT4A 4AL7A 2B4OA 1XNQF 4PXBA 4KHMA 1SCJB 3KK1A 2ABYA 1VR6A 2ATLA 2DGOA 3AD7C 3IAM9 2GV1A 1Q86T 1TKTB 4LR7A 6FD1A 3IRXA 2Z0GA 5LL6d 1UFWA 3M8SA 3OR1B 2FLPA 4ID5A 2H1YA 2D7SA 4A8FA 2MZRA 1ZM9A 3ZTQA 3MMBA 2E1PA 1JLBB 2HW3A 2APOA 4ED3A 2UVRA 2UU9F 2I5JB 4YY3F 1FEHA 2BABA 4N8OA 2PEHA 2QYCA 1KLNA 1N5TA 1TP7A 2FD2A 4JBCA 3OL9A 2JNJA 1WC3A 2IJFA 3DXBA 2HQFA 4PUOB 2FJXA 5A8KA 1HBUB 4RBTA 3W65A 4KQZA 4TVAB 4DOZA 2PEBA 4OYIA 4IQXA 4V19J 1XERA 1C1BA 3CCVS 1SIZA 2E5LJ 2CPIA 3QO9B 4MFBA 2PMZD 3LOUA 3IS9B 5DG9A 2AGPA 3UCZP 2NREA 2ZOMA 2GMJA 2LU2A 2WVCA 4C8OA 5FJ4A 2DNRA 1N0UA 5F0WA 1IKYA 1I51B 2V0NA 3K0JA 4ZJQA 2V8VA 5HP1A 4EI2A 2I8EA 4IOAQ 1UJ4A 5D8HB 3PKMA 1QVFR 1LWEB 3MGJA 4ZPTR 4NLGA 2E66A 2LXIA 2YNFB 3N6MA 4IUFA 1TKZB 4QR1A 2HQDA 3RB4A 2DNNA 3I0SB 1VQNS 3KLIA 4DV3F 1FVQA 3BB5A 5EDWA 3BSNA 1L3SA 2CG8A 3KLGA 1PJ5A 2BJEA 2ZBCA 3HVRA 4R5PA 4DUTA 4P2FA 1CJVA 4LF7J 2ZH8A 3QATA 2J0SD 3M32A 2GVZA 4KE5A 4YB5A 3BGRA 2Z4PA 3DRXA 2DGWA 5ETSA 3OTDA 1SUQB 4B3RJ 1VDHA 2D1CA 2PSZA 1RSCA 2LU1A 1ITPA 5LMUF 1LWFA 2QYGA 3NWRA 4ECUA 2MSTA 3R5GA 4DFJA 3BPSP 3CJ3A 5D0HA 4OZ3A 1HFEL 1NSPA 3A8IA 2OFGX 3MEEA 2WVDA 1YBAA 4IKAA 4C8LA 1GX5A 1X4GA 2KU7A 3GV5B 3QSIA 2VG5B 2BUNA 3JTOA 4IG0A 2CNOB 1JLQB 1VI7A 4I64A 2DBBA 4C11B 1P8GA 5L46A 2GZOA 4DR5J 2FGOA 3VGTA 1KR4A 3DLEA 2GIQA 4ZVOB 5E3PA 3SQOP 2CJXB 1LK7A 3CGIA 5HROA 1XC9A 5KT4A 3FJ2A 3V5RA 5C42B 4OZJA 1BUXA 4I67A 3QJLA 1JLAA 5CA5A 3KLHB 5HK4A 4AYBD 2NCKL 2IBOA 5GMKa 3C6UA 1P1TA 2HLUA 3THVA 4LBPA 3RRHA 2RHQB 1V5VA 5J2PB 2XTJP 2ZH7A 4QIVA 4QYZK 3HLUA 3O8WA 3S7RA 1VQ9S 4M5NA 2FVRA 1KFDA 1X9MA 3L4BC 1PC5A 4Y3CA 2CJAA 2HFZA 2M7SA 1NK8A 3DOLA 3A4TA 2R3VA 3PJXA 4QW8A 1R0CB 4J9SA 3BR8A 2GX8A 2R8HA 4MK8A 3DMJA 4QIGA 1W25A 2CQ4A 4PWWA 1NPPA 4CH0S 2G2YA 1TTHB 3B54A 5T7LA 4Y6IA 1HNIB 3MR2A 3DYAA 2WOMB 2RRNA 1TL7B 3W61A 3K8VA 5AE2A 1TZ0A 3RTVA 4UY8T 1N52B 1U1NA 2WRMA 1RT6B 3KKFA 5IV3A 4URSA 3NMRA 4RKUC 1HR0J 2CPEA 2HVIA 3AA9A 4ECQA 4WP8A 5HMWA 3CCMS 4HI1A 3H59A 2M8DB 2AGOA 4LREA 3GSIA 5C2CA 4WTYA 2QRRA 4KFBA 3BGOP 3FBEA 3R5CA 2UZAA 3LA0A 4WF9Q 1WEXA 1YRXA 5DDOC 5K8NA 2MKYA 3GR0A 4UTGA 5LJ3Y 1CJKA 1YRUA 1NBEB 2RRAA 3CCES 3QJPA 3S8SA 5E3RA 1HL6A 4PYAA 2MJUA 2VIHA 1XNQJ 3T9ZA 1U45A 1VK3A 5HL7Q 4OJ3A 1RT1A 3D3BJ 4OZ1A 1T9TA 4GVBA 1YLXA 3N0VA 5BYSA 3OTCA 1U24A 2CQDA 4NCGB 3W62A 1S7HA 3ZFVA 4PR6A 1AFIA 4FKYA 4TYAA 5F8HA 1HI0P 1MU2A 3KHGA 4U8YA 2X1BA 2FIUA 4DL6A 1RUSA 1FJEB 4K4ZA 2GHWA 2KRRA 3ISND 1O0PA 4PABA 3EPIA 4QPTA 3D66A 5AXNA 4QYZJ 3VGUA 2E5HA 4J37A 2UU9J 3EWGA 4YY3J 4P2XA 1LW0B 4GC7A 3ZO7A 4P73A 1IJFB 4F25A 1RHKB 1YSJA 1U6ZA 3HXMA 4BWMA 1NSQA 2XQCA 3DDKA 3QT7A 1WC5A 4PZVA 2BJDA 1DJ0A 4X65F 2HRTA 4XAKA 3RG6A 2B9WA 3EDQB 4OX9F 2GJFA 3RAMA 2P5VA 2YKNB 1TL1A 2B5JB 1XIQA 3LF0A 4P2SA 3C14A 1TL5A 3US5A 3H5YA 1K1QA 1U0SA 4ZS6A 1XJWB 3T5HA 4DQPA 3KHHA 2MZJA 1YTYA 3A8JA 2J7UA 2KZMA 1TVRB 2XO6A 3KK3A 1GX6A 4ED4A 5DG8A 1NB7A 3QGGA 1K9MT 4EEYA 2BANB 4NXNJ 4FDFA 2XULA 4FNIA 1EQMA 1M1HA 2V5HG 2YNHB 3AD9C 2IMOA 3E8OA 3HULA 5C7PA 3D1QA 4PEOA 4WK3A 3MUTP 2Z58B 3V4IA 5KFNA 2YPZA 5L1IA 2HBZB 3GLJA 1VRTB 2GCFA 5DJBA 2EKNA 4WXWA 2W2QP 3BR9A 2JL9A 1GMVA 2YKMB 4PPZA 1RBLA 3N4WA 1MMLA 4DS5A 4Q44A 4RW6A 3SFGA 4ED5A 2VFUA 1FF2A 5DETA 2OSQA 1JXVA 2KB2A 4X62F 1MROB 4ED2A 3FDSA 4L3KA 2XMKA 2UXCJ 3GFZA 2XNQA 3OBIA 4ZP8A 2RDDA 4DX7A 3DRSB 2XY7A 3MR7A 4ECSA 4CO3A 2MHNA 4CLSA 1QDUB 3MCSA 3R27A 3D2WA 2W9BB 4EYIB 2CNLB 1TKTA 5EWEA 5LMUJ 4LRDA 1NZ8A 1KNZA 1CJUB 5F8IA 1HHTP 4R25A 1RTHB 5IT0A 2GA7A 3PV8A 3SSQA 4C9DA 3GCXP 1RYSA 4HT7A 3P8BB 3HD1A 1W7WA 2XYHB 1HBMB 2WSCC 2C2RA 2CZVC 3PZPA 2DHGA 2NSBA 2HVEA 3OT9A 4QWAA 3HT3A 2CUYA 2RS8A 3TQEA 4CTAB 4DV6F 3BSOA 4KTQA 1JNRB 2XWXA 3QAUA 1VISA 2JWNA 4DV0F 2I5JA 5KOXA 3VAFA 3FQLA 5IWAJ 4OZNA 2KHCA 4DN0A 2LKZA 4ER8A 1GXTA 3VAMA 1RWWB 2DNHA 1VJWA 1QJHA 4OZ5A 1NMEB 3VF0B 3KLFB 3I32A 3EICA 1SV5A 2L9DA 1RTDA 3WBZA 1Z1ZA 1ZYQA 2HNDB 4ZVGA 2MEWA 3BKUA 3J7ZT 5KT7A 2Y8WA 5CYQB 4P7VA 5A2QU 3C46A 3AA8A 2HFSA 3QO9A 1VC0A 3K5LA 3IS9A 2QO3A 5M2RA 3M9NB 5MLCV 3HMJG 3QLHB 5HLFA 1AW0A 1VIXA 1F0XA 3O6QA 1VBXA 1NNDA 3M05A 1YRTA 5EGYA 2AX1A 3SDEB 3R9LA 2K1RB 2ZH4A 2Q66A 4EGLA 8RUCA 3OLBA 4L72B 2FJAB 3LTOA 2YNIA 3CCSS 2HK3A 1X31C 2DXFA 2KG0A 4URQU 4NLQA 4HHHA 4ECVA 2JX2A 2YNFA 2MZQA 5KFFA 4J9OA 1WG5A 2BV3A 2DT9A 3EGNA 3I0SA 2ZVIA 4DX5A 1IKWB 4I2PB 4ZVHA 1RAIB 4OI1A 3G2XA 1VK8A 1K1SA 4DZDA 1U0HB 3RAQA 3P6YC 1PAUB 3BN7A 3JTPA 1EP4B 2D3OR 1S97A 4P10A 4DV1F 2JZ5A 2R7TA 3U7JA 4NWBA 4ZIVA 2DYAA 1FRLA 2RHSB 3G6VA 2AGQA 1T9YA 4YQWA 4DR7J 4KHRA 2BZ2A 4PXEA 4BWJA 2EFQA 1GT8A 5HJXA 4LSLB 3G96A 3TUZC 4CM0A 4NA3A 1D9DA 3TNVA 1T05B 2IFXA 3W8GA 1BD6A 1UW9A 1PILA 2ZWOA 3WQPA 1UAWA 2E29A 1YJRA 1RT7A 2LEAA 4UY85 4K4WA 2W7AA 2YY3A 3MEGB 3DLGB 1UZDA 1D3WA 1R8PA 2VPWB 5AXKA 2VG7B 1Q7YT 2HSEB 5DQGA 3TA0A 2HEKA 4FXVA 2IDLA 3KK2A 4EBCA 2HWIA 5EWFA 5CYMA 1SL0A 4X4VA 4HH0A 2CQBA 3NGKA 9ATCB 4J9LA 4J7CA 3CCTA 2P6TA 2XZTB 4C0OC 4EFAC 4MJKA 1FXRA 3PCOB 3M9MB 2W01A 1ZPVA 5C42A 3OUYA 2WAQD 4YMEA 3OTOF 3KLHA 1FERA 4ES2A 2GIRA 2B9YA 5IFMA 4DPWA 3QIDA 2R4FA 1WC6A 4HDGA 4FKXA 1Q7LB 4ECWA 4IOCQ 4KB7A 4ZVSB 2DNZA 2XZDB 1WTFA 3Q8PB 2E5IA 3NCPA 5J2PA 1J5EF 4X65J 1S1VB 1Q5YA 1JLFA 2W24A 2F40A 3MPDA 4OX9J 1JLGB 3C15B 4ERDA 4W98A 4B9VA 2BEFA 3MFHA 2NYIA 3N9UC 2QSWA 4IFYB 2H4YB 2LQ5A 2OP5A 2ZD1A 4BC7A 1FHTA 4OX8A 1N32F 1X5SA 1HNIA 2WOMA 1TL7A 1Q8LA 4C8KA 3IN5A 2KVQE 3HF5A 5BXIA 2KVIA 1FT8A 1FA0A 2R7VA 1L3UA 4G1QA 3ILLA 2LECA 3GIRA 1NRKA 4IRDA 3NRBA 2UUBF 3MZIA 2H5IB 1SL1A 2YTCA 3JSRA 3G87A 5LOQA 2CQGA 1UZHA 1N4LA 4RUCA 3CMAS 2IY5B 1Z2ZA 5F0UA 1S4EA 3I82A 2XMMA 4CLFA 3K89A 2HS0A 3NGDA 1D8ZA 3OVAA 3OTEA 4PWUA 4DUZF 4X62J 1FFGB 1DQ9A 4DZ6A 4CT9A 2XG8A 2LP4A 1UWBB 3D6FB 3TP2A 3IBWA 5D4PA 4K4TA 4ELVA 2BJ8A 1JLEB 3AODA 2NQPA 2I2YA 3BDEA 1S1XB 2XS2A 1OO0B 4K7QA 3T9NA 4AE5A 1I6JA 1VCTA 2CVEA 4PG6A 5KFHA 1RAGB 3G6ES 4LFAF 4AXIA 3VVUA 1Y5NB 1F3VA 4OYMA 3GU0A 2BW7A 3BKTA 3H7HB 5RUBA 1WF1A 1HMVA 1QE1B 3Q8YA 3KG4A 4RW8B 1QTMA 1GXUA 2BE2B 4ECYA 2J6TA 3CXCR 2N7CA 2HHTA 4ZJLA 1CC7A 2LYVA 1Z4UA 4DV6J 4WE1B 3PYEA 4DV0J 1LW0A 4MAKA 4JYAF 2WBMA 1X5TA 4Y2AA 2C22A 4YDXA 4JI8F 3W5ZA 4NRTA 2H65B 3LPEA 3EUNA 4X4PA 2OPRB 3NY0A 3GIJA 2A18A 1DZ5A 1FXDA 1JKHB 4CLPA 4NRUA 4RW9B 4WZMA 4WFNQ 2AKWB 1RWXB 3H2LA 2YKNA 4ZPDA 2B5JA 3H2VE 1KONA 2IYGA 2GC8A 1GMWA 3IM9A 3NG8A 1FK9B 3D28A 3MM5B 3KJNB 3BGUA 2JFDA 1JX4A 1O8BA 1WJ9A 1HWUA 4DL0C 2HFOA 1TVRA 3PRVA 2FJBB 1ZOTA 5IOLA 2BM0A 2IRXA 4DUYF 1R31A 2DR8A 2R7WA 3HJVA 4QW9A 5D4NA 1FDBA 1U25A 5B0FA 3O1LA 4HLBA 3TA2A 3M30B 2YNHA 1Q79A 6FDRA 2OEJA 5E41A 3EGVA 4DJBA 1BWVA 3OXGA 2QLBB 2R8GA 3DI6B 5A6PA 5LXRA 4KGKA 1B64A 2YKMA 2RVJA 4N47A 3GFXA 3W1YC 3HZEA 5GAGI 2XO7A 3ZTSA 4XDDA 3IG1A 2N3OA 3N28A 1VQ5S 5DGBA 1N0VC 3OJUA 5J1PA 2ZNYA 2XLIA 1BY9A 2EK1A 2HQGA 2FJVA 2AJ1A 1MROA 2DH9A 5KG1A 1J5OA 3J7Z5 3KNAA 4E8UA 4DV1J 2MKIA 1OQ3A 3LWMA 3QYYA 3QT5A 4LF8F 5HQ8A 5HBMA 4OI3A 2X51A 4YUDA 2AYBA 3ILJA 1KDNA 2EFVA 1NAQA 2KRBA 4NA2A 2W9BA 3UR3C 2PE8A 4FXDA 1CJUA 4I69A 4K4SA 3DLHA 1Q4RA 2OH2A 5HATA 2GFFA 1FCAA 3PW5A 1X4FA 5CXTA 1NDPA 3V81B 1SXLA 3GFHA 3MHYA 1HBMA 2VH7A 4WFZA 3B6BA 2E44A 3PX0A 2C1EB 1UEVA 1O5JA 4MH8A 1X4AA 4RWXA 1D9FA 1ACMB 3U1LA 5KFWA 5HMZA 3MDFA 2J7KA 3RBDA 1HNZF 2X7IA 1B0TA 3T3FA 3OPKA 4DCJB 1SL2A 1B70B 2N82B 2BW2A 1C0TB 2K3IA 2RILA 4DWIA 2MB0B 1RWPB 3CD0A 4P52A 1RHMB 2M5YA 2Y1IA 5IT4A 1N5VA 2QLFB 5K8MA 1B0VA 1UWAA 3PFOA 3GR1A 2COLA 2Y8YA 2M9KA 3KLFA 4P74A 3AXKA 4DR4F 2CZ9A 3MMAB 1VJQA 4DR3F 3M1VB 2B51A 4WFBQ 2WSFC 2D74B 3OTOJ 3VZHA 2H51B 4K4VA 4PKDB 4URGA 2FLOA 3DM2B 2WZ1A 1OMSA 5DDPC 5CYQA 3MM9B 4G6VB 3IWXA 2VZ9A 1NK9A 3HVTB 3UDCA 2OI2A 4WIIA 3TJAA 2MGZB 1J5EJ 1Q16B 1YJWS 3K5NA 1ZM3A 2KT3A 3RR8A 3W5XA 3CUNA 1SVDA 3VQTA 5IT9U 3SDEA 1YX2A 4M1KA 1OIAA 5KFBA 2DNMA 3HHLD 1REVB 4Y28C 5AE3A 1N32J 4JOUA 2IM3A 4OYXA 2CZ4A 4H4MB 1FRXA 2B6AB 1KVKA 2AMCB 4ZVPB 2C3MA 2QL7B 1BQNB 5ETPA 1A9NB 2EFOA 2NUHA 2HG4A 2XMTA 4QJVA 2H5EA 1V3RA 2UUBJ 1ZZNA 1IKWA 4A8WA 2V69A 3PEHA 1IJEB 3KDNA 4RPFA 4DLEA 3H40A 4HT5A 1S76D 1NK4A 2ASJA 2RKIB 2ZDOA 3HVAA 3BO4A 2B8PA 2G2OA 2RT3A 2OEMA 4WBFA 3UQSA 3VR1A 2IPOB 2V34A 1AFJA 1P6TA 1IKXB 4KH0B 3FFIB 2BA9A 4NI2B 2CJBA 1TQLA 2R8JA 1I3OB 2GGPA 3GYXB 2EBGA 1F2HA 1FRJA 3HSJA 3MURP 3DLKB 4LSLA 2VC1A 2XLKA 5E0OA 3M8PA 2GAGC 3CCWA 2XCAA 4GKJF 2FVPA 2HIYA 1T05A 3TQ1A 3POTB 3KDOA 5E3AA 4ILMA 3TR5A 2MQPA 2MPUA 1PJ6A 2CPHA 1YIJS 2EFGA 4LFAJ 3NOGA 5ETVA 3AT1B 3MEGA 1KFSA 3UWTA 3A8EA 1GH8A 4QYRA 2VG7A 2HK2A 3B78A 1RZMA 5I3PA 5IXUA 2DEIA 4WP9A 1MMNA 2GJ2A 5KT5A 4JV5F 5E7OB 4B02A 2PA3A 2XZWA 4M8LA 5H1SV 4ED7A 4FS2A 2Z2MA 5G0RA 2O01C 2OMOA 3M2UB 2RF2B 2G4BA 1WKKA 2CPFA 3A12A 1U6BA 2OD4A 2ZBPA 2GS8A 3CE8A 1U2FA 1W26A 3CDUA 4RW4A 4JYAJ 5DLFA 5D3GB 1T11A 2OSRA 4JI8J 3T1HF 5FIIA 1G1XA 1IQTA 3HZGA 1WOSA 4ZP7A 4LF5F 4JUZA 4DV5F 3GIIA 1JJCB 5C24B 1XR5A 4Y0FA 1SKSA 1S1VA 4ED0A 3QJJA 5D78A 3VVTA 1NH7A 1NH8A 2JVRA 1CVJA 3C15A 1AA1B 3N5BA 2XM3A 3R5DA 4IFYA 3T5LA 1NKBA 2IM2A 1AYEA 3ZZZA 3V6JA 2AWZA 4W90B 3I0RB 2BXJA 4KV8A 1WD6A 5B0EA 3I5AA 1H98A 3GG1A 2CQPA 4F04B 1NDCA 2YWFA 3RU0A 4DUYJ 1S9GB 1RKIA 1RP5A 4IDKB 2C2ZB 3I5CA 2KM8B 4B9UA 1D0EA 3G82A 2P9CA 4DFKA 1C4AA 3ISNC 4Q0BB 3M9OB 3QT6A 1U1KA 1EETB 2MQLA 2DHHA 2ZE2B 5BYRA 1KWMA 3H90A 4WCEQ 4NCBA 4DQQA 2G2ZA 2DO4A 1WTBA 5CCMA 1BC6A 2QL5B 2F8EX 3D0GE 1UEUA 3TAQA 1PKUA 1HI8A 2QX0A 2OPSB 5M2PA 2PMWA 3SMZA 2HFNA 4RBVA 3BM7A 3BBCA 1UWBA 2RRBA 2QE5A 4LF8J 2X3DA 2BQ3A 3VAKA 1NB2A 3CCUS 1JLEA 4B9LA 5G4DA 3TZYA 2VD3A 1YQHA 3DOKA 4ZCMA 1SJ1A 2L9WA 1N56A 5F3TA 1PYOB 3DU5A 2CXEA 2GHPA 2LQ9A 2VBWA 1VQ6S 1FFSB 4JP8A 1TFWA 4QZVB 3FNNA 3LPYA 1WNEA 2ZHOA 2GNKA 1M0SA 2LEBA 4LF1A 1MMDA 3CO0P 2ZWPA 2UUCF 4YEAA 2F9JA 3N79A 2MQ8A 4RR5A 4USUA 3BO3A 4RW8A 2EVZA 3HO1A 1UVLA 2BE2A 3GIKA 4F4YA 1S10A 4LF6F 3BQ2A 1MNEA 1AZSA 1HNZJ 4KSEB 2HGNA 1NLKL 2B56A 1F6TA 4USKA 2RE1A 1GEHA 5KFUA 1IN0A 1ZPWX 3C66A 2N7YA 5A8KB 2LA4A 5LT5A 1FDDA 5CD4H 1F9HA 1ZA1B 3FRYA 3UPFA 1EB0A 2P6SA 4I7FA 3UW1A 4YDDB 5IC6B 2AEJA 3H8YA 4DR4J 3K57A 3EXCX 4DR3J 2OPRA 2ZZMA 3AOAA 1C1BB 2HHUA 2H48B 1RT2B 1JKHA 4P2MA 4RW9A 3D4JA 4ED8A 1SBRA 4WFYA 5KFGA 3P5BP 1Q8BA 2AT1B 3CULA 2Q79A 2UUAF 2BRKA 3FGVA 4JI2F 2UUWA 2F5GA 1NHVA 2G0IA 5D0GA 4X4NA 1F3FA 4A8KA 2HBYB 1H7XA 1IKYB 1AXQA 3MM5A 4Q5VA 1V6HA 2CPXA 1R6YA 2H9ZA 2YKAA 3S1TA 3F0NA 3MFIA 5KG6A 3FQKA 5E2QA 2VA2A 3UCGA 4OZLA 2ZOGA 4TLQA 2E9TA 2XC9A 3ZZRA 1HBOA 2CVIA 4DPUA 4ECXA 1IBLF 3ETMA 3VAGA 3CJKA 4ZOSA 3CIMA 1U7LA 4PAAA 4GO5X 3MPVA 4KO0A 1MWQA 4B08A 1MWYA 3KLGB 4UOHA 1WF0A 4DU8A 4WU2A 3T19A 3PO5A 3CJ0A 4FF1A 3RGIA 2IJNA 3DGVA 4IH7A 4PXCA 4CCHA 2AHOB 3BGRB 1XR6A 2ZUAA 5A0YB 1XN9A 1A0OB 2F65A 2FB0A 1RADB 2NZ4A 4RNMA 4DHVA 4FS1A 5A2QY 3DGPB 3UD4P 3R97A 3MI7X 1TELA 2Z2ZA 2QTWA 2UVWA 3AXMA 2ZEJA 4C7QA 4QU7A 4YHHF 4DDFA 4UOGA 5D77A 1RACB 1KQKA 3GQCA 1TKXB 3W2WA 1H7WA 2EI5A 1IVZA 2ZDPA 3FSYA 4GKJJ 4OHWA 3EXYA 5CABA 4CLKA 4IG0B 3JSBA 5IM0A 4M95A 5F9NA 2C2DA 2ZH5A 3A8KA 3QFWA 1QSLA 3FVYA 2CA9A 3OSNA 2BKPA 5HAOA 1Y9OA 4NLDA 1YZ6A 2A2CA 4CI0B 4JV5J 3DLEB 4KYZA 5J2NA 2CPZA 4ZPCA 3THTA 5DZ6A 3R3TA 1WHXA 1C0TA 4EZ6A 2MKCA 4DSEA 2J0XA 4HTJA 1N34F 5HROB 2HQIA 4PWDB 3QRPA 1DHMA 5EX3A 3PJ9A 1HD0A 2FLLA 3C6UB 3MMAA 4LFCF 4MTPA 3M1VA 3T1HJ 4OI4A 3WIVA 3HVWA 4DQRA 1RXOB 2V4RA 4LF5J 3IFEA 3HX9A 2HHHF 4DV5J 4ZCIA 2MQNA 2ZVSA 2OLWA 5EUHA 1M5HA 3TA1A 3BBBA 4USVA 2JJ4D 3M4XA 4G1PA 2MGZA 3DOLB 3SCJE 1FRIA 3IR6B 3FEXB 2R7OA 3L3CA 3DMJB 2LCWA 2Q3PA 1T9UA 2CJ9A 4E2FB 4WK1A 1LWXA 4KHPF 2VQEF 1N8RT 4IO1A 4GRSA 2HHQA 2XSJA 2X1FA 2GO9A 3NCRA 3OV7A 2D3UA 2BKOA 2DCLA 3OQ2A 3D6MB 2B6AA 3HCXA 5GAGU 2GJIA 1J27A 1WG4A 1IBKF 2D41A 2YQ0A 2K8GA 1YITS 2VG6B 1ZH5A 3FBBA 3NXZA 3NWGA 4EU0A 1F5AA 3MCOA 5F9LA 3QMQA 4ANEA 5J2MA 2YQ1A 1S0OA 1CJKB 3PO4A 4V19X 5KAKA 3G9CA 3MR5A 1PGZA 3R1LA 4LUBA 4NYPA 1TL3A 3CDWA 4IYQA 4Q8FA 4X4UA 2NSCA 3ILIA 2NR0A 3I87A 2DR5A 1RT1B 2JHEA 1KOHA 3M8WA 3L7PA 4GVBB 1NJYA 4DXLA 3CVKA 4NYOA 5D4LA 3I4HX 2MTLA 1Y4ZB 3ZNJ1 1RT4A 3IGNA 2ZHBA 1M5PC 2FC9A 1F2GA 4H4OA 2VFVA 3PFEA 3POTA 3BS9A 4AXJA 4A8SA 1T03B 4UUXA 2ASYA 4RU9A 3DLBA 1R27B 2W4CA 1H6KX 3BQ0A 2V8PA 4DSFA 2CADA 1EIYB 4RNHA 5DM7Q 1Q8IA 4HHJA 2MLXA 1TUWA 2JLEA 2KL8A 1F9FA 1DFDA 4G3IA 1WG1A 3RJMB 2E7XA 3M2UA 2RF2A 2NUUG 3M2RB 4LF6J 1OJ4A 2XY6A 4K2XA 2ZBQA 2DNPA 3ADAC 5K8OA 2VOPA 1ZA2B 4M5HA 4OHZA 2IMWP 1TV6A 2J6SA 3FBFA 2WVBA 3QIPB 5D3GA 1H2UX 2MLZA 2KDOA 1CS4B 2CNNB 4J90A 1Q1KA 2FHJD 4ELUA 4K4UA 4WKYA 5B0AA 2QEXS 3MOJB 1RBAA 4DPXA 2OHDA 2ZBRA 3KMSA 1FWLA 4C98A 2EXUA 3C14B 2YKQA 4DL5A 3Q8RB 2EG1A 3UDVA 2UUAJ 5ETMA 1XBWA 1H2VZ 4JI2J 4QIWD 3MD1A 3VCDA 1FDNA 4OHVA 1K0TA 3KK3B 5KT2A 2HHSA 3DN9A 1U1PA 5L1LA 4XIUA 2K2PA 3I0RA 4J9UE 2VC0A 1R0BG 1R8AA 4AQYF 5JVHQ 4F4ZA 1LNQA 4ILRA 2AX0A 1BQMB 1S9GA 4ZPAA 3LALA 3I31A 4IDKA 3BBFA 4L75A 3G8QA 2LXFA 4WYWA 1QTNB 3F73A 3SV4A 3F41A 3FMBA 2W2MP 1U2CA 2VHGA 3C19A 3FSXA 3GYNA 3JSMA 4Q0BA 1EETA 4BHQA 2KH9A 1UPPA 4JI5F 4KGVB 1X60A 2DNGA 2HVDA 3MM8B 5A76A 2J8SA 2B3TB 4CH1A 1FRMA 2VFTA 2BM1A 3TANA 2P9GA 2JEJA 2OPSA 3WX8A 3UI3A 2JC0A 1X8DA 1S7IA 4ZVRB 4TKTA 3QQCD 4USJC 4G1IA 2YVSA 4KRWA 3EGWB 4HACA 1FI4A 3LQVA 3ISZA 4P6QA 4ZMMA 1NJZA 4QCLA 2HHVA 2Y3YA 3WZ0A 4DV2J 2VL1A 4IFVB 1MN9A 1RWMB 4OHYA 2U2FA 4CRJA 1M5SA 4YHHJ 1TU0B 4I6YA 4M5JA 2QA4G 4MYUA 3UNGC 2FYXA 1RWOB 4LRBA 1RI7A 2AZ1A 2M52A 4M5KA 4Y65A 1R3NA 4RUHA 1P1LA 3BZQA 4F0HA 2E9RX 3ENWA 4A47A 3UVJA 4LQ3A 3VV2B 5GAEI 5D0RA 1KTQA 2W7PA 2ZC4A 5E3QA 4H4KA 1HNWF 3O3LA 2YBVA 2HHWA 2XMWA 2FQQB 2V2VA 2JC1A 4K5SA 1WI6A 4L73A 2VONA 3RR7A 3TZZA 2Z8QA 2AU0A 1RISA 3GCWP 1UVJA 1REGX 1N34J 2VBXA 1XQIA 4LRFA 1SV5B 1RTDB 5GVQA 4X4TA 3Q83A 2ACMA 2OELA 4KGXB 1KD1T 2Y0BB 1YJUA 4DPTA 1L3VA 4LFCJ 3NL0A 2DITA 3J81U 3R2CJ 3OD2A 1RT3A 4B9NA 1ZM2A 2G9OA 1RT2A 2DRAA 1U1RA 3PX4A 3TRGA 1KVIA 2DK2A 4HTIA 4FBTA 2HHHJ 2W4PA 5HLFB 4LF4F 1HYSB 1TAUA 1JK9B 3FEYB 4DCPB 1HLWA 5KFQA 1U6FA 4Q2MA 1X0PA 2ALYB 3BGLA 1H3DA 4NPOA 2J9DE 3T5KA 4NA1A 3CNQP 1X4CA 2C2MB 3QSYB 4U8VA 4CO0A 4OI0A 1SH3A 2VQEJ 2BJ9A 2KFNA 4FPRA 3FC9A 3SCLE 1ZS6A 2YNIB 1RBOB 2QG9B 3H5UA 4C8ZA 4BDPA 2XYPB 3CC2S 2V63A 2ILYA 4HI2A 4I6AA 2Y9HA 3OTBA 1UVMA 1F1BB 4A8OA 1S59A 2BMBA 2OGUA 4C48A 4D3HA 2KG1A 1IBKJ 3GWCA 3ENQA 2IIHA 3U1NA 1RWVB 3JAMU 2XS7A 3VAIA 1JWWA 2CWXA 2YKPA 4MYTA 2O66A 1F5BA 2EG2A 3BH7B 2ZUGA 5A0YA 1FKAF 3J7AN 4ZLNA 4RX6A 3Q8QB 2J7WA 2B7CB 1R0AB 4KJIA 5J2QB 4NEYA 3DGPA 4X84A 2KT2A 2SXLA 2QGFB 4DMZA 3PM9A 5C25A 3GJQB 4AL6A 4LMZA 4KC5A 1NDLA 2DGXA 4O4GB 3NS6A 2NXUA 1TKXA 2CQIA 8AT1B 5IT9Y 1RT7B 4GMKA 4XDCA 1X9SA 5DS7A 2POKA 2OEKA 1V9OA 2Y1LB 3CPWR 4A8QA 3CJSA 4IG3B 3QBCA 4M5MA 3TAPA 4LSZB 1RGVA 1I94F 2FJWA 1HWLA 1FO1A 1RWNB 2HS4A 1WWHA 3PXGa 5E3CA 3H42A 3KK2B 3HHLC 4C0BA 2CG4A 4ZIWA 1NUEA 4QQBA 4FNHA 2DEJA 3PX6A 5CYMB 4LQ9A 4ZVUB 4DFMA 1TK8A 3P45B 2KT5A 1H73A 1ELOA 1U4BA 3L09A 4N5SA 1S72S 1LFWA 1N88A 3PW2A 2MQMA 3OUYB 1FD8A 3SFUA 1YBUA 4PWDA 1WEYA 2JLFA 2C2EA 4F50A 3AJDA 3SQGA 4RW7B 3MR3A 3DU6A 3H98A 5B0BA 4U67Q 2MHEA 1N5QA 1CQNA 3D6HB 3ELHA 2AQ4A 4M5DB 2XI2A 4OZ0A 1JLFB 1PIEA 1ZAVA 4CLLA 4ED6A 1JJHA 1T02A 3TAMB 3K58A 2ADBA 1IM4A 1RAEB 4YB6A 1RHQB 4F4AA 3G8SA 3HHKA 2FLNA 2RNEA 4CH7A 1UMJA 2ZD1B 4DL3A 2HURA 2G0CA 2KI2A 1UJ6A 4C8NA 3NKYA 2PI5A 2I1RA 1GTHA 4EUVA 4MKAA 1JXEA 4DG1B 4Y2IA 4DV4J 5I42A 5LSLA 4PG5A 2GHVC 4AQYJ 5LMNF 4G1QB 4XK8C 1VQ4S 1CJTB 2HNZA 2GQCA 1X4EA 3AJ2A 4QPXA 2Z2YB 2YH1A 1SIWB 4ZVQB 4LR9A 3H20A 2FVQA 5F8GA 2Q43A 1KP6A 2VG6A 2KTQA 1AROP 1ZZFA 1UW4A 3EVMA 4WJBA 3BDPA 3LP1B 2PIIA 3SIPB 4Q2LA 2MYFA 4P75A 2F8MA 3LP0B 2FHOB 2RAQA 3MAQA 2VKRA 3Q2SC 4W4MA 1LXNA 4MKVA 2NXNA 2AD9A 1S1TB 3QRQA 2HVHA 4X2BA 4NLTA 4OYZA 3KHRA 4RZRA 3C16B 1MSWD 3KJVB 4BC9A 2YX1A 4V1Ak 1Y5IB 4OI6A 1JJ4A 2ZBIA 1URRA 4DLGA 3KFWX 2RQKA 4USWA 3A13A 1LQ9A 5HMYA 2QLWA 1OWXA 1T03A 3I55S 2HQ3A 4HDHA 2FPHX 2CWKA 1HMVB 3AB4B 1DRZA 1S79A 2ACYA 4G65A 2QJ3A 2CAJA 4PPDA 3WC0A 2MKSA 2P2CB 4UW2A 4DEZA 1URNA 1T9VA 2N4CA 5ETOA 2QC3A 3IR5B 1NXIA 2EBEA 1JXLA 1IKVA 1F9EB 3M2RA 3MCNA 4ZP9A 3HSZA 4U7UD 4QIFA 1YJ9S 2MZ1A 4OV6A 1QAIA 4NLOA 4NLRA 3GZ7A 3TO8A 2JEFA 4KIAA 4N41A 3M8YA 4FVMA 3B4MA 3QIPA 2B0GA 2DGQA 1W2IA 1CS4A 1SH2A 4CIOA 4OX7A 3D3CJ 4ZVTB 3BPDA 2V4JB 3K5MA 1VQKS 4O3SA 3RAXA 1WC1A 1XWLA 2M0GB 3DLJA 5ETKA 4K50A 2NZCA 2CQ1A 4PG4A 2UP1A 3ZTOA 1YGYA 1F60B 1VS3A 2H54B 4CO2A 3R6LB 1SJQA 4LF4J 3ZTPA 1Y3KA 2WTFA 4I56A 5EHHA 3HT0A 2MZSA 1HQEB 4JI3F 4C3MA 2Z2LA 2GIFA 4LBIA 5I3UA 1U8SA 3HHLB 5F41A 2HWHA 4OHXA 1BQMA 1RCOB 4A8XA 2W1BA 4DX8H 2ZH6A 5GAHI 4A8YA 2A3JA 1S6QA 4CLZA 2DNYA 2DIUA 2UV8A 1RCXB 4DV3J 2QMUB 4KBIA 1L3KA 3IG1B 5KFZA 2PGCA 2DO0A 4DSIA 2ILZA 4BLGA 1NJWA 2A6MA 2KXNB 4E0DA 1MWZA 4NMLA 5A8RB 3KUEA 1B7FA 3MM8A 1J5OB 1QSYA 1DTTA 2DTJA 2J76E 3CSKA 4QR0A 4FN5A 3JTNA 2C42A 3DXSX 3OFHA 5HBMB
chains in the Genus database with same CATH topology
1JXVA 1VYAA 2DXFA 4DZ6A 2CWKA 3EVWA 3ZTPA 3EE3A 3MPDA 4UOGA 1S57A 1PAEX 1U8WA 1LEOA 4KPCA 4W98A 3EMTA 4DUTA 2BEFA 1K44A 3VGTA 2AZ1A 1HLWA 2VU5A 3BBFA 3DKDA 1NDKA 1XIQA 4ANCA 2DXEA 4FKYA 3BBBA 1EHWA 4UOFA 3JS9A 1NLKL 1B4SA 3ETMA 5CABA 3EICA 1PKUA 1F6TA 1S5ZA 3FBFA 4S0MA 3ZTSA 3NGSA 3GPAA 3EVMA 1BUXA 4DI6A 1BE4A 3VVTA 3G2XA 3DDIA 1NDLA 5CAAA 3EJMA 1NCLA 3ELHA 3GP9A 3ZTQA 1LWXA 3FC9A 3Q89A 3Q86A 4C6AA 1WKLA 3L7UA 1ZS6A 3FKBA 2NCKL 3BBCA 5BXIA 3ZTRA 3BH6B 2DXDA 4UOHA 3VVUA 2HVDA 4F4AA 3FBEA 1NB2A 2AZ3A 4ANDA 3VGUA 5C7PA 3FCWA 1W7WA 2DYAA 3WX8A 1MN7A 1NSPA 1KDNA 1NHKL 1NSKL 1S59A 3Q8VA 2ZUAA 1XQIA 2HURA 3ENAA 3PRVA 3Q8UA 1NDCA 3Q8YA 4F36A 3Q83A 1NPKA 2B8PA 2B8QA 5IOLA 1HIYA 1HHQA 2BX6A 4CP5A 3EVOA 3VGVA 1BHNA 4FKXA 1WKKA 4HR2A 2HVEA 3R9LA 1NSQA 3FBCA 1F3FA 2DY9A 1NUEA 1B99A 4WBFA 3PJ9A 3VGSA 3NGUA 1UCNA 4O0NA 4EK2A 4ENOA 3NGTA 1NDPA 3ZTOA 3FBBA 3FCVA 1MN9A 3NGRA 3BH7B 3EM1A 3B54A 4ANEA 3B6BA 1WKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JXV A;  1VYA A;  2DXF A;  4DZ6 A;  2CWK A;  3EVW A;  3ZTP A;  3EE3 A;  3MPD A;  4UOG A;  1S57 A;  1PAE X;  1U8W A;  1LEO A;  4KPC A;  4W98 A;  3EMT A;  4DUT A;  2BEF A;  1K44 A;  3VGT A;  2AZ1 A;  1HLW A;  2VU5 A;  3BBF A;  3DKD A;  1NDK A;  1XIQ A;  4ANC A;  2DXE A;  4FKY A;  3BBB A;  1EHW A;  4UOF A;  3JS9 A;  1NLK L;  1B4S A;  3ETM A;  5CAB A;  3EIC A;  1PKU A;  1F6T A;  1S5Z A;  3FBF A;  4S0M A;  3ZTS A;  3NGS A;  3GPA A;  3EVM A;  1BUX A;  4DI6 A;  1BE4 A;  3VVT A;  3G2X A;  3DDI A;  1NDL A;  5CAA A;  3EJM A;  1NCL A;  3ELH A;  3GP9 A;  3ZTQ A;  1LWX A;  3FC9 A;  3Q89 A;  3Q86 A;  4C6A A;  1WKL A;  3L7U A;  1ZS6 A;  3FKB A;  2NCK L;  3BBC A;  5BXI A;  3ZTR A;  3BH6 B;  2DXD A;  4UOH A;  3VVU A;  2HVD A;  4F4A A;  3FBE A;  1NB2 A;  2AZ3 A;  4AND A;  3VGU A;  5C7P A;  3FCW A;  1W7W A;  2DYA A;  3WX8 A;  1MN7 A;  1NSP A;  1KDN A;  1NHK L;  1NSK L;  1S59 A;  3Q8V A;  2ZUA A;  1XQI A;  2HUR A;  3ENA A;  3PRV A;  3Q8U A;  1NDC A;  3Q8Y A;  4F36 A;  3Q83 A;  1NPK A;  2B8P A;  2B8Q A;  5IOL A;  1HIY A;  1HHQ A;  2BX6 A;  4CP5 A;  3EVO A;  3VGV A;  1BHN A;  4FKX A;  1WKK A;  4HR2 A;  2HVE A;  3R9L A;  1NSQ A;  3FBC A;  1F3F A;  2DY9 A;  1NUE A;  1B99 A;  4WBF A;  3PJ9 A;  3VGS A;  3NGU A;  1UCN A;  4O0N A;  4EK2 A;  4ENO A;  3NGT A;  1NDP A;  3ZTO A;  3FBB A;  3FCV A;  1MN9 A;  3NGR A;  3BH7 B;  3EM1 A;  3B54 A;  4ANE A;  3B6B A;  1WKJ A; 
#chains in the Genus database with same CATH topology
 1UL3 A;  3K7R A;  1LFP A;  3LP2 B;  3IAS 9;  1RHJ B;  3T1Y F;  1RTZ A;  2O1P A;  4NLU A;  4LIW A;  2IJR A;  1KHW A;  4OX6 A;  4EBE A;  4IFV A;  4O23 A;  4YP3 A;  2HFV A;  1BLU A;  2DNL A;  2IVF B;  2WW8 A;  1NK5 A;  1VRU A;  1HKA A;  3O5T B;  1CG2 A;  3CD5 A;  4WIQ A;  2GW8 A;  3GV8 B;  4U6P A;  2OIH A;  4M5G A;  3FSI A;  4HH1 A;  3ZZP A;  2HYI B;  2B4V A;  1S49 A;  5KG3 A;  3TX0 A;  2B4U A;  3CW2 C;  2BQU A;  1I94 J;  4YFU A;  1PC4 A;  1QAJ A;  3M2V B;  1TMJ A;  3X3U A;  1Y10 A;  4N8N A;  1V3Z A;  2C28 A;  3G6Y A;  2QL9 B;  3OHB A;  5L1J A;  1CSJ A;  4QU6 A;  3PIO Q;  5KFI A;  1UET A;  1FDA A;  2V94 A;  2HPU A;  2AYE A;  3ZZO A;  3UN2 A;  1S57 A;  4B9M A;  1E6Y A;  5H9F K;  5IQQ A;  1SJR A;  3PDN A;  2G0J A;  2WK4 A;  4LJM A;  4EZ9 A;  3MUM P;  1T95 A;  1S5Z A;  3KTQ A;  1WSV A;  4E98 A;  3MCM A;  2DVI A;  4RBU A;  3TUI C;  3O2I A;  1HYS A;  2V50 A;  2KXH A;  2JH3 A;  3LGH A;  2E1A A;  4NMX A;  3F44 A;  4DCO B;  1UP1 A;  1IBC B;  3MMC A;  5HVF A;  1P9Y A;  4X64 F;  2CQ3 A;  3K8W A;  4USH A;  1RHR B;  5L39 A;  3AFG A;  1E6V B;  3W63 A;  4JB8 B;  2VKZ G;  4TYB A;  3WC2 A;  3M6U A;  4TQS A;  3UDE A;  4NLP A;  2XS5 A;  1RAH B;  5LMN J;  2UXD F;  3JQJ A;  4TY8 B;  3IR7 B;  1S0N A;  4HKQ A;  1CPZ A;  1YJV A;  4CDI A;  2YXL A;  1FKP A;  1KQG B;  2AP6 A;  3JSY A;  4B3T F;  5HVG A;  1YBT A;  3C3L A;  5I3Q A;  4F02 A;  2CJK A;  2QV6 A;  3N01 A;  3BV8 A;  3NS5 A;  2L41 A;  3ICL A;  4B3S F;  1S48 A;  3F56 A;  1R0A A;  2GGP B;  3JQM A;  5J2Q A;  1H38 A;  2DRB A;  2VJV A;  1HNX F;  3WHI A;  5T41 A;  2BOP A;  3CDB A;  1GQE A;  3GFY A;  2VB6 A;  3M8P B;  1NJI T;  1NHK L;  1AUS L;  1RTJ A;  2PN6 A;  4MK9 A;  5DG7 A;  4O4G A;  5GAE U;  3G4S S;  2L48 A;  5KFA A;  4DFP A;  4HR2 A;  3CJ4 A;  3SYZ A;  4Z2X A;  3GYG A;  4O0N A;  4F4K A;  2W2P P;  3SEO A;  3PW4 A;  4DQI A;  2KKH A;  3QGH A;  4IG3 A;  3L95 X;  1DBD A;  1KS2 A;  3ZZT A;  2W8K A;  2NXE A;  3HM9 A;  5H9F J;  2HZA A;  2J9D A;  3OXL A;  2DR9 A;  1UJ5 A;  5G0R B;  4ECT A;  1G3O A;  3EMT A;  3SSR A;  3OL8 A;  1EKR A;  4RUA A;  4CYU B;  2L3M A;  5FD1 A;  5HN0 A;  4RJV A;  2M2B A;  4B9S A;  3EZ5 A;  1NK7 A;  4U9R A;  3QGI A;  1M1K T;  3DDI A;  4RW4 B;  1HWJ A;  1FWK A;  2EC0 A;  4KKO A;  3GP9 A;  3CCR S;  4R8U B;  3H4D A;  2R2R A;  5KT3 A;  1FE4 A;  3JQK A;  2B4P A;  4RW7 A;  1MW7 A;  1RT5 B;  1U48 A;  3EPG A;  2IRU A;  1WEZ A;  1ZAW A;  3BEG B;  3CTR A;  1CEZ A;  4CLT A;  2YQ3 A;  2GQQ A;  2DH8 A;  5FLX U;  2AYG A;  4M5D A;  2W7O A;  2XMU A;  3UN5 A;  4OV1 A;  3DRP A;  1JB0 C;  3QNW B;  4CP5 A;  3T6B A;  1UA1 A;  3TAM A;  3P96 A;  3MPY A;  2FUG 9;  3KJQ B;  2WB4 A;  4LSN B;  3KUG A;  2A6O A;  2PC6 A;  2VQF F;  3R2D J;  4IO9 Q;  1G4C A;  1GMU A;  2KYX A;  3BSA A;  1EJ7 L;  4KV8 B;  1LXJ A;  4ZN3 A;  1N36 F;  4JI3 J;  2WBR A;  3BKF A;  4DG1 A;  3HSD A;  2RQC A;  2ADC A;  3PIP Q;  1SI9 A;  2W25 A;  1M5O C;  1VBY A;  4B3O B;  3TVZ A;  1CJT A;  5CAA A;  4AFF A;  2DH7 A;  2HZV A;  3KOA A;  3G86 A;  3G82 B;  1RWK B;  4DR2 F;  2R7R A;  3OFE A;  4USM A;  3C2P A;  1WEL A;  2WHO A;  2DD8 S;  4X66 F;  2AZ3 A;  4O3N A;  3UNY A;  1S12 A;  4QOT A;  4NLX A;  1GTE A;  3DNC A;  1RU1 A;  4TN2 A;  5KG0 A;  2W2N P;  3LP1 A;  5L9X A;  1GAO A;  2BRL A;  5DQI A;  3LAN A;  4ITS A;  3LP0 A;  2DR7 A;  4NXN F;  3TJ9 A;  4CZC A;  2BVZ A;  1AUD A;  1S1T A;  3FUY A;  4FF4 A;  4N7T A;  1ZBT A;  3C16 A;  3KJV A;  5EN1 A;  4FPI A;  1QLN A;  2HGM A;  3DOK B;  3T1Y J;  4L3N A;  4TXS A;  1SC3 B;  3M7V A;  2R7X A;  4FZV A;  1RU2 A;  4FYW B;  2OPP B;  3VAJ A;  1HQU B;  1RB0 A;  3MXH P;  4Y00 A;  1VIO A;  3THP A;  1FKO B;  3PYD A;  4X4R A;  2E1M C;  3DOM A;  2UXC F;  3FZ2 A;  2XEX A;  2KJW A;  1T0T V;  1TKD A;  2D69 A;  4Z7Y A;  3DFE A;  4R0J A;  1AZS B;  5ITH A;  2R2S A;  3KMQ A;  1DY3 A;  2XMJ A;  1HWI A;  4NZ7 A;  4IH6 A;  5KFM A;  2IAJ B;  4NLY A;  4J9P A;  2K7J A;  4IR1 A;  3NAI A;  3Q23 A;  1YHQ S;  4IRC A;  1U47 A;  4I7F B;  2A1B A;  4O3R A;  3GSD A;  3BQ1 A;  3EM1 A;  2K7K A;  3LWL A;  4YOE A;  3PVX A;  2ERR A;  2V4J A;  1VGY A;  1HW8 A;  5CZV A;  2VV5 A;  3NS7 B;  4GKK F;  3DHX A;  3GTY X;  2JRS A;  1EHW A;  3AD8 C;  4DQS A;  3EZU A;  4ICL A;  3AY0 A;  5CQG A;  5IWA F;  3CT9 A;  1JMT A;  2DGS A;  2VFS A;  1HQE A;  4CNZ A;  2OJ3 A;  3W2V B;  3CJ5 A;  1LW2 B;  1V5I B;  2CQC A;  4Y2C A;  3HHL A;  2CDQ A;  1Y3J A;  1WC0 A;  4X64 J;  1HBO B;  3D7S B;  4CQ1 A;  2BDP A;  4AUK A;  2KHD A;  3CJK B;  4RO0 A;  3HD2 A;  2PI4 A;  3OR2 A;  4HHU A;  2OKQ A;  5E33 A;  5M2U A;  2CPY A;  2DHX A;  4GVL A;  1SQG A;  4KO0 B;  1N5S A;  2UXD J;  3MOZ A;  2GO8 A;  3NMA A;  3RUB L;  1NKE A;  4LR8 A;  1UA0 A;  2KFZ A;  3PHT A;  3CD6 S;  3DRY A;  4NLV A;  4MT1 A;  2FY8 A;  2MKK A;  4QIE A;  1AB8 A;  4B3T J;  5A8R A;  3EX7 B;  3D0H E;  5K5M A;  1VC5 A;  3Q2T C;  2VPX B;  3J81 Y;  2N4D A;  3GON A;  3SZ2 A;  3MM7 B;  4B3S J;  2V6A A;  3HHN B;  3LP2 A;  2HAI A;  1D1U A;  1VMB A;  1HNX J;  2FGC A;  3MEC B;  1S1W B;  4OZ2 A;  3J81 j;  1PG5 B;  1NM2 A;  4LVN P;  1OYE A;  4C8M A;  3W2W B;  3TUJ C;  4DBQ A;  3BYP A;  2ZZN A;  4ZN1 A;  3U02 A;  3QFH A;  5GMD A;  3IBF B;  2LEP A;  5IM0 B;  1S6U A;  2YWW A;  1EAR A;  2RJZ A;  2OPQ B;  2CJY B;  1TL4 A;  1CUL B;  1DAR A;  4KPY A;  1BGX T;  2EFP A;  5J2N B;  3M2V A;  4DR7 F;  3J7A 1;  2XI3 A;  1S9E B;  3LGM A;  4LIR A;  1TAQ A;  2FHM A;  4KPC A;  4DR1 F;  5HVH A;  1FFW B;  2H4W B;  2VU5 A;  4RL1 A;  3JAM Y;  1QAY A;  2KM8 C;  4U7U K;  4CLU A;  4KGZ B;  1VQ8 S;  2M88 A;  3FK4 A;  3RB3 A;  2Q1L A;  3AB2 B;  1TFY A;  4CO4 A;  3S01 A;  3TZW A;  1IUJ A;  1FNO A;  1B0P A;  3DDN A;  2WVE A;  1G6B A;  4F2S A;  2JDJ A;  1SKR A;  4P9S A;  5L8R C;  1SC1 B;  2D9O A;  1NSK L;  2GMH A;  3H5S A;  2I0X A;  3M8Z A;  2FTR A;  3EVO A;  2C3Y A;  2OFH X;  1H0H B;  2K06 A;  3TZX A;  1HA1 A;  3M8Q A;  1IXK A;  5KFX A;  4MKY A;  3RBZ A;  2VQF J;  5H9E K;  5GAH U;  2XSJ B;  3GMG A;  2RIJ A;  3NNH A;  3CDE A;  3UN3 A;  4F67 A;  1N36 J;  1E6V A;  1R6V A;  4J5O A;  4JV2 A;  4UZC A;  4JI6 F;  3DKD A;  1X0F A;  4WU3 A;  2QA2 A;  3I6P A;  2PDA A;  5FDL B;  3W9H A;  2F63 A;  1P9Q C;  3ET6 A;  4TY8 A;  1N48 A;  4H4K C;  3PG9 A;  4DR2 J;  3J80 U;  4OLO A;  1AT1 B;  5J2M B;  2LQJ A;  4BCA A;  2DXD A;  4X66 J;  4IQM A;  3D1H A;  3A3P B;  4DX6 A;  1TL3 B;  4XPC A;  3RBE A;  2AYM A;  3ENA A;  3PR4 A;  1JLC A;  4DUZ J;  2OD6 A;  2MQO A;  2OTJ S;  2HBQ B;  5DZ7 A;  2J0W A;  2ZZT A;  2FVC A;  3I56 S;  4K4X A;  3CIZ A;  3OSP A;  2O3D A;  4ENO A;  1RKJ A;  2UVU A;  4OL8 A;  1RT4 B;  1YK9 A;  2QZ8 A;  5KT6 A;  2NYH A;  4H4O B;  2P9E A;  4FYV B;  2LXU A;  1VYA A;  4WZQ A;  3QT8 A;  2YX4 A;  1KSP A;  4DS4 A;  1X4D A;  1M1G A;  3HPO A;  2GVD B;  4UQT A;  2O67 A;  3DRR A;  4ZP6 A;  1VBK A;  2DHA A;  3MPW A;  3TW0 A;  1JJ2 R;  1FJC A;  1WAC A;  2MZT A;  3OL6 A;  2MSS A;  3ILO A;  3GIM A;  2MQQ A;  2OO4 A;  3DLL Q;  4X4O A;  3CJR A;  1DLO A;  4CLW A;  1FNM A;  3Q22 A;  4CYU A;  5SUH A;  2RB7 A;  1RAJ A;  3TOQ A;  5JVG Q;  5KFV A;  2BR0 A;  1NZA A;  2NS1 B;  3BO2 A;  5KFP A;  2E9Z A;  1TV6 B;  2AJQ A;  4R8U A;  4YN3 B;  2YNG B;  3EZO A;  2HHP A;  1XK8 A;  2DNO A;  2BJ3 A;  3OR1 A;  5H9E J;  2E1R A;  1VRQ C;  1RT5 A;  4Z37 A;  1QY7 A;  5IS2 A;  4LVO P;  1D8Y A;  3LAK A;  1LV5 A;  3EE3 A;  4P72 A;  3ZZ0 A;  1JLB A;  4GKK J;  2F9D A;  2FVS A;  3HFV A;  5ETQ A;  5KG7 A;  1T7P A;  2ZC3 A;  4I6W A;  3TAR A;  5J1N A;  4ELT A;  5CH7 B;  4TU9 A;  4LF9 F;  1FD2 A;  4LSN A;  3HFK A;  1QM9 A;  4Y2M A;  4P71 A;  2DHS A;  4O44 B;  4MIB A;  4RLE A;  5ETT A;  1XMB A;  3CCJ S;  3IWN C;  5E5N A;  5D15 A;  3NCQ A;  4F4W A;  2IM0 A;  3FCH A;  3UO0 A;  2UV8 G;  2V2Z A;  2ZNZ A;  3ITH B;  2YH0 A;  4LRC A;  4PUO A;  1HBU A;  1HQ2 A;  3A1Y G;  3C6T B;  4AND A;  1DTQ B;  4YR2 A;  5AE1 A;  5JMN A;  5HO4 A;  1TK5 A;  4B3O A;  2J0Q D;  2LLZ A;  4ETX A;  2BE9 B;  3JSM B;  1DQA A;  2M70 A;  4OFZ A;  3P5T L;  3ONQ A;  3VAH A;  1Q82 T;  5THW A;  2Q6B A;  3PR5 B;  4ZLL A;  2R9L A;  2HNY B;  4K2J A;  4OMF G;  1DQ8 A;  4UZB A;  2KYZ A;  5KFL A;  2WON B;  2YWK A;  1FJG F;  3EVW A;  3GIL A;  2DCU B;  1PAE X;  3HP6 A;  1RWU A;  4DN9 A;  2HMI B;  2L9N A;  4HAC B;  1ZTT A;  4DSK A;  1J2V A;  2E5J A;  3PTW A;  4ZPB A;  2R2U A;  1OSD A;  1U02 A;  3PYG A;  1YDL A;  3HHD A;  1LWE A;  1Y5L B;  2KO1 A;  3BGF A;  3W5Y A;  3HFZ B;  2HS3 A;  4J9N A;  3EJM A;  3UDL A;  2VDI A;  4OYO A;  1TKZ A;  4GC6 A;  3W3S A;  3B8H A;  1VQP S;  1YKW A;  3EDR B;  2E1C A;  2OPP A;  3I9Z A;  1BXN A;  5HSP A;  1HQU A;  4DF8 A;  3UVJ B;  5K8P A;  2EKY A;  1Y11 A;  3RB6 A;  1KHV A;  1FKO A;  1RQ0 A;  1SPB P;  3M6W A;  4ID8 A;  2MMY A;  5GME A;  4WPA A;  5HI7 A;  3QGP A;  2W8L A;  1IQZ A;  2BJ1 A;  5K14 B;  2AIR B;  4YB7 A;  5KFJ A;  4YR0 A;  1SUQ A;  2Q6C A;  2R7U A;  2CDR B;  1FEE A;  3WDO A;  1A6L A;  5B0G A;  4U96 A;  4EO6 A;  2DIS A;  2V9W A;  5IC4 B;  3OL7 A;  1KRP A;  2NPF A;  2I38 A;  4DR1 J;  1CLF A;  1PYS B;  3W64 A;  2IAJ A;  2IM1 A;  5KFO A;  2DY1 A;  1VC6 A;  2D3Z A;  1HHS A;  2MDA A;  3LH2 S;  4B9T A;  3IBC B;  3LAM A;  5D6G A;  2KZZ A;  1RT3 B;  3T41 A;  3CCL S;  5DGA A;  4U7C A;  2VG5 A;  3ZZY A;  1PJ7 A;  5LXY A;  3OFF A;  2FZK B;  3D0I E;  2MY8 A;  1XNR F;  1RHU B;  1JLQ A;  4L76 A;  1DAX A;  3CB4 A;  3S6E A;  1MLA A;  3C8Y A;  5BJR A;  1DUR A;  3QWP A;  4C11 A;  3PEJ A;  3Q0A A;  3CED A;  4FYD A;  2HRU A;  1V3S A;  1IWA A;  1Q78 A;  1WC4 A;  3JXO A;  3NEK A;  3WIU A;  5KFT A;  1HW9 A;  4ATN A;  3W2V A;  3H2U B;  4ZJO A;  2Y1J A;  1LW2 A;  1Z2L A;  1SJ3 P;  3IP0 A;  2RU9 A;  2EEY A;  3NGT A;  1X4H A;  1C0U B;  1RLD A;  1EAY C;  1OY9 A;  1Y0H A;  4USI A;  2BYC A;  3R1H A;  3E01 B;  4JI6 J;  1JIH A;  1KTV A;  4N77 A;  3E51 A;  5DDQ C;  4LF2 A;  2A2D A;  5EX0 A;  2VUG A;  4O4R A;  3HK2 A;  5CYJ A;  3M6X A;  4S0M A;  1ZET A;  5F8J A;  3NGS A;  3GPA A;  2V68 A;  5KFE A;  1BE4 A;  3MTJ A;  4M5L A;  4RNF A;  1HD1 A;  3SXL A;  4UQG A;  4FP9 A;  2CJQ A;  3AHP A;  3CD7 A;  1FVS A;  3I5B A;  2E5G A;  5DLG A;  4FXW A;  3FKB A;  4ETZ A;  1Q53 A;  2NLW A;  3VAL A;  5ETL A;  5DDR C;  4NXM F;  1QAX A;  1YZ7 A;  4QWE A;  3VHQ A;  5KG2 A;  3H4B A;  3GG0 A;  3Q8V A;  3T1A A;  2AJ4 A;  3BSC A;  3MM7 A;  3TX8 A;  5F8L A;  5C25 B;  4F36 A;  2DKO B;  3TI0 A;  2B8Q A;  1RT6 A;  3MEC A;  1S1W A;  2HGL A;  3VGS A;  5KFK A;  3P4U B;  5C5J A;  4KH1 B;  3L9Z A;  3FCV A;  2HFU A;  4CWB A;  1L3T A;  4ZLJ A;  4PCQ A;  2QA1 A;  2ZH3 A;  2YKO A;  2OPQ A;  5CZX A;  3RRK A;  1NU4 A;  3AOC A;  1CUL A;  3TJ8 A;  4UOF A;  3JS9 A;  1KQS R;  2HLT A;  2IYI A;  2F4F A;  3R5J B;  2VBY A;  3HDS A;  1ROF A;  1S9E A;  1Q5V A;  5KG5 A;  2FY1 A;  2V2K A;  4ZVE A;  1YWX A;  2LFV A;  2A0F B;  3OVB A;  1RAF B;  4P7T A;  5EWG A;  4I1T A;  4C3L A;  3IWL A;  1RLC L;  4H54 A;  2NPI A;  4IH5 A;  2J9C A;  2R7Q A;  3SQG B;  2BAC A;  1NO8 A;  2IA0 A;  1PYT A;  2XLJ A;  4NCG A;  2FHJ A;  4JI4 F;  3NP5 A;  3OXF A;  4ZLP A;  1HIY A;  2MKH A;  5HJY A;  5KFC A;  3R7B B;  1RAA B;  4OJ1 A;  2F8H A;  3KG0 A;  1LOU A;  1X9W A;  4TY9 A;  2QFI A;  4OLP A;  4KAI A;  4UST A;  3NGR A;  2UVV A;  4ZPW R;  1IWG A;  4KT0 C;  4OYP A;  1R8C A;  2IVY A;  1H2T Z;  2MLY A;  4LF9 J;  3QZ7 A;  7AT1 B;  3W8P A;  3W66 A;  2ZJR Q;  4OYB A;  2Y1R I;  4ECR A;  4JI0 F;  3VTI A;  3HHE A;  3ZC4 A;  2XMA A;  2XCP A;  2QFJ A;  5I42 B;  1ZM4 A;  3UE2 A;  4ZHR B;  2BE7 D;  2I9S A;  1U49 A;  1NJX A;  3NAH A;  1NHU A;  2HNZ B;  2D3O 1;  3KUH A;  4HEA 9;  5FDL A;  2B9E A;  5CCL A;  2IVM A;  1QUP A;  3D68 A;  3OFG A;  1U09 A;  2XB2 D;  3SI8 A;  3NNA A;  1SQF A;  3OJS A;  3CJQ A;  3JYT B;  1KKH A;  1HNV B;  3AOB A;  1MG7 A;  3MED B;  1T9X A;  2M4M A;  2ZKT A;  4X4Q A;  2GML A;  2PA8 D;  5GAD I;  2AJF E;  3KLE B;  2IBK A;  3QZ8 A;  1B3T A;  1FJG J;  5JJB A;  4HL9 A;  5IZH A;  1U8W A;  2BAN A;  1LEO A;  4FYY B;  4O0I A;  5FLX Y;  2W4D A;  1TUV A;  3W9J A;  4W92 B;  1R89 A;  1HAR A;  4ANC A;  1O6X A;  1OQ6 A;  2RUG A;  5DM6 Q;  3K2Y A;  2OUG A;  4DSJ A;  2JLG A;  1VRT A;  1RDR A;  1B7Y B;  2X1A A;  1SC6 A;  3Q86 A;  2ZJQ Q;  4F8R A;  2QT7 A;  3V6D B;  3R7S B;  4ES1 A;  2IHR 1;  4PYD A;  2GVD A;  1XMO F;  1TMM A;  1FXL A;  2DJW A;  2VOD A;  3SCK E;  3MTK A;  4DL2 A;  1SB6 A;  1VQ7 S;  3FZB A;  5B09 A;  4ZDN A;  2V8G A;  4DF4 A;  2AEM A;  2UUC J;  3ZXW A;  2AJ2 A;  3Q8U A;  3LO3 A;  4C0H A;  3CJT A;  1NK6 A;  1IKV B;  4DV7 F;  2JSX A;  2DGV A;  1SQE A;  3DRS A;  4LRA A;  2FJD B;  4Q45 A;  1M5V C;  4LFB F;  1X4B A;  1IBM F;  3TEG A;  3HKW A;  3MEK A;  2W9C B;  1R8B A;  1KOO A;  3NBP B;  3CC7 S;  2YNG A;  1RTH A;  3CJ8 A;  1PCA A;  3TVY A;  3JB9 k;  4FF2 A;  1CQM A;  1VQS A;  2N3L A;  3R5B A;  2DXE A;  1HPZ B;  3PW7 A;  3D9B A;  3MAA B;  1RK8 A;  1S9F A;  3N6L A;  2Z56 B;  4JI1 F;  4IOB A;  4A48 A;  3J7Y I;  3OHA A;  4K59 A;  2FHK A;  1XR7 A;  4OI2 A;  3GJR B;  2R42 A;  2F4V F;  1N5Y B;  3PRD A;  2PFF B;  1XNR J;  4N56 A;  4CTA A;  2VIC A;  1T9W A;  3HJF A;  1WDT A;  3M8R A;  5HMX A;  3IA0 A;  2F3J A;  3PKY A;  1RTI B;  3FCW A;  1S1U B;  4O44 A;  1T8E A;  3VWS A;  2ZH2 A;  5I3U B;  3AJ1 A;  2U1A A;  4F7V A;  2LDY A;  1PSD A;  3FEZ A;  9RUB A;  3R5A A;  4YB1 P;  4AL5 A;  2R7S A;  2WB1 D;  1HI1 A;  2ALZ A;  2XMV A;  3ULH A;  2XHW A;  3SBM A;  3ITH A;  4WXO A;  4PRF A;  1YVF A;  3C6T A;  1VHF A;  1DTQ A;  2R8I A;  1S6Q B;  1IBL J;  2B7B B;  2HND A;  4ALZ A;  3BF4 A;  4C2M A;  4MIW A;  2H5J B;  2M3D A;  2V8D A;  3I96 A;  2MKJ A;  2RUS A;  3TYT A;  2W9A A;  1IR0 A;  1UFK A;  4F3Q A;  4J9M A;  1NDK A;  3NLC A;  3DHW C;  4CM2 A;  3QLH A;  3D54 A;  1GMW D;  2HNY A;  1LWC B;  2WW4 A;  3Q24 A;  3H25 A;  2F7V A;  3CO9 A;  3GJT B;  1DTT B;  4RWW A;  1OYD A;  4DI6 A;  5B7W A;  1Q95 G;  2C2K B;  2JVO A;  2WON A;  1YJN S;  2CYY A;  4TNO A;  2BKN A;  4BS2 A;  4MMO A;  2K1R A;  3CWJ A;  2HMI A;  2UXB F;  3AAW B;  2YPY A;  4ED1 A;  1Q0N A;  4NXM J;  2FDN A;  4K0K F;  5JUM A;  3P49 B;  3K17 A;  5LM7 E;  1WOP A;  3RW7 A;  1WDD A;  3PNI A;  3QAE A;  4NAS A;  4UOC A;  1GFW B;  2C2N A;  4FYX B;  4DPO A;  1FTC A;  2LQ8 A;  3KYL A;  3SV3 A;  5J1E B;  4JI7 F;  1VRU B;  2YWH A;  4OJH A;  4OYA A;  4UF4 A;  2DY9 A;  5B08 A;  4I2P A;  3VQS A;  3HSG A;  2XGQ A;  1PO6 A;  4PQU B;  2CQ0 A;  1WOO A;  2CFX A;  3PHE A;  1U0H A;  3UCU P;  2X3G A;  3MM6 B;  1KLM B;  1EP4 A;  1S99 A;  1S6O A;  1PBU A;  1WHY A;  5L1K A;  5K14 A;  4X4S A;  3R7N B;  3ENV A;  1HBN B;  2R2T A;  2QLJ B;  2DIV A;  1U1Q A;  4O3P A;  1SJ4 P;  4DL7 A;  2AF6 A;  2ZOF A;  1NCL A;  1BWE A;  4WWS A;  4FBU A;  4M63 A;  2KFY A;  3GJS B;  4Y2K A;  4RNO A;  2DRD A;  1VOM A;  2F1F A;  5K9F A;  1E6Y B;  2VJU A;  1UVN A;  5CHC B;  3PRB A;  2IDE A;  2XWY A;  1JQG A;  4JI4 J;  2EFN A;  2O5D A;  1VLY A;  3DLG A;  4Q7A A;  2FJE B;  4CO5 A;  3IC1 A;  1XEZ A;  3G8T A;  2FZG B;  3LGN A;  1WHV A;  2QSF A;  2CIM A;  2JEI A;  1C1C B;  5U47 A;  1VLO A;  1MN7 A;  4NL5 A;  5LSR A;  2QMX A;  2MJN A;  3MMC B;  3HKZ D;  2VA3 A;  2W2O P;  4PQA A;  4KHP J;  1KVJ A;  1G7C B;  5BR8 F;  5K20 B;  4O3Q A;  1S4F A;  1FTR A;  1ZTW A;  2M8H A;  2DNQ A;  4JI0 J;  2V4Q A;  1B4S A;  2XY5 A;  1X5O A;  4QBU A;  1C0U A;  2VPY B;  1UTA A;  3IGV A;  2VPZ B;  3IO1 A;  2ZH9 A;  3E01 A;  3L7U A;  1FX2 A;  3D67 A;  1LKZ A;  2C3O A;  1X5P A;  3N5F A;  1ICE B;  1FKP B;  2RD5 C;  1OY8 A;  1N6Q B;  2ZJP Q;  1O51 A;  1OPZ A;  2EWH A;  5IV4 A;  1L5U A;  2HIQ A;  2AV5 A;  2RU3 A;  1FNX H;  2AW0 A;  3IMQ J;  4TU8 A;  1JLG A;  2YX7 A;  2IC3 B;  3ETO A;  2LQB A;  3G6X A;  1VQY A;  4ZIT A;  4DL4 A;  4DU7 A;  3WX4 A;  1K8A T;  3DC2 A;  3CJ2 A;  3T5J A;  5DO2 A;  2C3P A;  4QR2 A;  1GNK A;  4I68 A;  1P27 B;  3TVK A;  5SZT A;  1SH0 A;  1KBR A;  1UCN A;  1U1L A;  2PD1 A;  3AQO A;  4EO8 A;  4I2Q B;  4ZA1 A;  4D3G A;  1U26 A;  3B4D A;  2G1H A;  4EBD A;  3H0P A;  1S6P B;  5L38 A;  1RTJ B;  4B17 A;  3KHL A;  3MD3 A;  2J9E A;  3OVS A;  5A8W B;  4QWD A;  2ZFH A;  3LW5 C;  2LMI A;  2OTL S;  4OQJ A;  1OPI A;  1FRK A;  3KNG A;  4F2R A;  5IQ6 A;  4F0M A;  2PMH A;  1VFJ A;  3U27 A;  3A3N B;  4Y34 A;  4CT8 A;  1D9A A;  1XMO J;  1RJJ A;  1LK5 A;  2AJ0 A;  4NX9 A;  1OSC A;  3ZZU A;  2HHX A;  1IR2 A;  4MIA A;  2PO4 A;  2VBZ A;  4IRK A;  4KGM A;  2IRY A;  4EMD A;  1UFL A;  4TU7 A;  4J9Q A;  3KK1 B;  4AT1 B;  3MUV P;  4MK7 A;  4I4B A;  1G2E A;  1GXL A;  4EWT A;  1FX4 A;  4DV7 J;  3J80 Y;  2RH3 A;  3IRX B;  5CD4 A;  3W9I A;  4KKO B;  2HZC A;  5HQM A;  2VDH A;  4LFB J;  2DB1 A;  3N6N A;  4OIX A;  1IBM J;  5ADZ A;  1S1X A;  4ID5 B;  3PW0 A;  1QD1 A;  1VQL S;  3NNC A;  4C8Y A;  1N33 F;  1NK0 A;  5BYQ A;  1GK8 A;  2PT0 A;  3R6G B;  1CBK A;  2RDJ A;  3P3D A;  2FZC B;  3TEH B;  3ZNU A;  4HYK A;  2JFK A;  3MMB B;  1WI8 A;  1W2B R;  3SSS A;  3DRP B;  2I6W A;  1RAB B;  4MKB A;  4JI1 J;  1QE1 A;  3OW2 R;  2OAU A;  2VF3 A;  4J9V A;  2P8I A;  2F4V J;  4HVZ A;  4ES3 A;  4NOH A;  1APS A;  2NXJ A;  1H74 A;  3TUP A;  2GAH C;  4WE1 A;  1FES A;  4JV0 A;  1QSS A;  3W7B A;  5AJ3 F;  1S0M A;  4C3K A;  1RAO A;  1K47 A;  1EKS A;  1TUG B;  1IM6 A;  1WHW A;  1WUU A;  2Z57 B;  1UEK A;  4M94 A;  2HWT A;  4ZHR A;  3AQP A;  1NPK A;  2XYG B;  4WFX A;  2RML A;  1VHI A;  2ZM6 F;  4C97 A;  2HRY A;  3CME S;  4B3M F;  1YI2 S;  1B99 A;  1N54 B;  3NGU A;  2ZHA A;  4EK2 A;  4MFB B;  4RNN A;  1OY6 A;  1WSR A;  1XTZ A;  4DR6 F;  2X1G A;  3LUY A;  3NOC A;  2QN6 B;  1Q81 T;  3Q8S B;  2HQC A;  1WF2 A;  2DGT A;  2V67 A;  3JYT A;  4WKR A;  1HNV A;  2ASD A;  1FK9 A;  4I0W A;  4JI5 J;  3MED A;  4A4J A;  5D0E A;  3R8Y A;  3TWZ A;  3HI9 A;  3D1O A;  3KWM A;  5HP1 B;  3IM8 A;  3KLE A;  4R0E A;  1Y7P A;  4PXD A;  2YWE A;  3MAH A;  1A7G E;  2UXB J;  3CMQ A;  3CC4 S;  3T6J A;  4LT6 A;  3M30 A;  3IXQ A;  4ZKA A;  2ASL A;  5KTQ A;  3G71 S;  4ZCL A;  1KC8 T;  4WYL A;  4K0K J;  2J5A A;  4ECZ A;  4F4X A;  3MWB A;  3SCI E;  4QWB A;  3KLI B;  2XNR A;  4QWC A;  1YJ7 A;  4OYW A;  3DI6 A;  3U1M A;  4L74 A;  5C2G A;  3FMW A;  4UUW A;  4JI7 J;  4NEZ A;  5DRK A;  3V6D A;  4R5P B;  2ZH1 A;  1UKU A;  1U1M A;  5KFS A;  1XMQ F;  3V4M A;  2MXY A;  1CJV B;  3EGZ A;  4KR0 B;  4BBY A;  2WVF A;  3FBC A;  2GVZ B;  3M32 B;  3DOM B;  2ZKU A;  1UPM B;  3BRE A;  4J9R A;  2JEG A;  1RYR A;  2CQH A;  2J8A A;  2B9X A;  1WKJ A;  4K8R A;  4TLR A;  4PG8 A;  1HNW J;  2E7W A;  3PAC A;  1LWF B;  3CCQ S;  3RB0 A;  1VBZ A;  3RZA A;  2IA6 A;  4DV2 F;  2CPD A;  7FDR A;  3QPI A;  3RYL A;  1FWP A;  3MEE B;  4NZ0 A;  2W9C A;  3V6H A;  3D6T B;  2UUT A;  1I5O B;  3NBP A;  1T3O A;  1NEE A;  5T14 A;  5HQL A;  5A6W A;  3I4P A;  2R8K A;  3MMJ A;  3V81 A;  3H5X A;  1HPZ A;  2QA4 S;  3MAA A;  3CDA A;  5KFR A;  4WP3 A;  1EX8 A;  5LSO A;  2KXF A;  3V6K A;  2J6U A;  4KY3 A;  1T94 A;  4ICL B;  2EC2 A;  1C2P A;  1N5Y A;  2BOA A;  2V8H A;  1T3N A;  1K73 T;  1U1O A;  2LA6 A;  2ROE A;  3UFC X;  5L9N A;  2ROP A;  5F8M A;  2G1D A;  1RTI A;  1SKW A;  2RQM A;  3UD5 A;  2H3E B;  3CCZ A;  1S1U A;  3KLV A;  1FE0 A;  3K59 A;  1TR0 A;  2BQR A;  4ZK7 M;  3BN4 A;  1JLA B;  1RA7 A;  2DR6 A;  2EW9 A;  1S77 D;  1YG0 A;  3GB0 A;  4EYH B;  4Z7C A;  5BR8 J;  5B0C A;  1R7I A;  3MF5 A;  3UR0 A;  2RSQ A;  3OR2 B;  4J91 A;  4CLY A;  4DSL A;  1YJT A;  2YWG A;  4K5R A;  3E2E A;  1VQO S;  2RS2 A;  2E5L F;  2L08 A;  2HKE A;  3DM2 A;  2C3U A;  2G13 A;  4YR3 A;  1H72 C;  4ILL A;  3MM9 A;  4J9K A;  5F3Z A;  3Q89 A;  5ETR A;  1WKL A;  2CRL A;  5GAD U;  3HVT A;  4NCA A;  3RRG A;  1SKU B;  3B82 A;  1ULR A;  4FF3 A;  4IR9 A;  1EZZ B;  2CPJ A;  1LWC A;  1R8H A;  1BQX A;  4OJG A;  2NXC A;  4CO1 A;  1M5K C;  5T7L B;  4NYZ A;  2ATC B;  3DYA B;  2XSF A;  2EPI A;  2WCX A;  4NLW A;  4NLS A;  5AXM A;  2BX6 A;  1BHN A;  8ATC B;  1REV A;  2GQ2 A;  5ETN A;  4H4M A;  3AH6 A;  1HWK A;  2HBR B;  4U95 A;  4O3O A;  1Y00 A;  4LBH A;  3A3O B;  1BQN A;  1FRH A;  3MR6 A;  4CNY A;  1S0V A;  5J1E A;  5MAO A;  3BYR A;  4C4W A;  4F3O A;  3V2U C;  2DGU A;  6AT1 B;  4KFB B;  4LF7 F;  3OLA A;  1Q8K A;  4PQU A;  2CNK B;  2K3K A;  4A46 A;  3BJY A;  4RU2 A;  2RKI A;  1JNZ B;  1IR1 A;  4N76 A;  2QIF A;  2HAF A;  3FRZ A;  1KEK A;  2RDI A;  4B3R F;  3VZI A;  1NSA A;  3MM6 A;  1KLM A;  2VFR A;  5KG4 A;  3ZTR A;  2JOQ A;  3KXD A;  4GO7 X;  3GE9 A;  1IKX A;  3FFI A;  3I9V 9;  4NI2 A;  4TQR A;  5F8N A;  3K5O A;  1HBN A;  4F3M A;  2A10 A;  3RW6 A;  1F5C A;  5B0D A;  2D9P A;  1QVG R;  3X1L B;  5LJ5 Y;  3DLK A;  3KJF B;  4NZ6 A;  1HHQ A;  3VGV A;  1PBA A;  1RE1 B;  4XPE A;  3J7Y U;  4XTT A;  1SC4 B;  4L6V 3;  2Z30 B;  2AEF A;  1UVI A;  2LVW A;  1C4C A;  1MU2 B;  1KQF B;  1N33 J;  1RA6 A;  2VAS A;  4NE9 C;  1R43 A;  3PYF A;  4DR5 F;  5KFD A;  4AD6 A;  1K44 A;  4PG7 A;  1SJF A;  2PFD A;  5KOW A;  4F0K A;  1UVK A;  3MPU B;  3M8Q B;  1KN6 A;  4ZPV R;  2V2Q A;  2XGP A;  4RUB A;  1TK0 A;  1C1C A;  4WFA Q;  5JXS A;  1VQM S;  2BJ7 A;  2MY7 A;  3RBX A;  1I1G A;  4XO0 A;  3GV7 B;  1CC8 A;  1WOR A;  1ZAX A;  5AJ3 J;  3IRW P;  4Q8E A;  3O44 A;  1NKC A;  3K5P A;  4ZVF A;  3D5M A;  3QWU A;  5I4M A;  5D4O A;  2BBE A;  2XHC A;  3ET6 B;  3PJW A;  4Q43 A;  2ZM6 J;  2E7V A;  2C2O B;  3E3X A;  4B3M J;  2DPJ A;  2VOO A;  2XBP A;  5C24 A;  1TL1 B;  1N6Q A;  4DPY A;  2WSE C;  4A8M P;  2KJV A;  1K0V A;  1QUV A;  3UD3 P;  2OML A;  3W60 A;  3PY8 A;  4DR6 J;  2IC3 A;  2Y0S D;  2HVZ A;  3DCA A;  4F26 A;  4ZCK A;  1D09 B;  5AT1 B;  1JLC B;  2QMW A;  3KG1 A;  1NPR A;  2V9K A;  4YS2 A;  1FJ7 A;  4DV4 F;  1EQ0 A;  3CF5 Q;  4I2Q A;  4M5I A;  2ROG A;  1M90 T;  3V4I B;  2ZIT A;  1HR0 F;  2FC8 A;  3EYZ A;  5DQH A;  1S6P A;  4FVC A;  4C6A A;  3QRR A;  7FD1 A;  5KFY A;  2KN4 A;  2QLX A;  3BH6 B;  5HAN A;  2LDI A;  2EK6 A;  1OS5 A;  5A8W A;  4WTO B;  1X7V A;  3DRR B;  2CKW A;  2CQ2 A;  4RW6 B;  3L7O A;  3M6V A;  2ZE2 A;  4JV1 A;  1U2R A;  5AXL A;  4K4Y A;  1XMQ J;  2B43 A;  1BMQ B;  2DPI A;  2RQ4 A;  1DLO B;  2DNK A;  4UT4 A;  4AL7 A;  2B4O A;  1XNQ F;  4PXB A;  4KHM A;  1SCJ B;  3KK1 A;  2ABY A;  1VR6 A;  2ATL A;  2DGO A;  3AD7 C;  3IAM 9;  2GV1 A;  1Q86 T;  1TKT B;  4LR7 A;  6FD1 A;  3IRX A;  2Z0G A;  5LL6 d;  1UFW A;  3M8S A;  3OR1 B;  2FLP A;  4ID5 A;  2H1Y A;  2D7S A;  4A8F A;  2MZR A;  1ZM9 A;  3ZTQ A;  3MMB A;  2E1P A;  1JLB B;  2HW3 A;  2APO A;  4ED3 A;  2UVR A;  2UU9 F;  2I5J B;  4YY3 F;  1FEH A;  2BAB A;  4N8O A;  2PEH A;  2QYC A;  1KLN A;  1N5T A;  1TP7 A;  2FD2 A;  4JBC A;  3OL9 A;  2JNJ A;  1WC3 A;  2IJF A;  3DXB A;  2HQF A;  4PUO B;  2FJX A;  5A8K A;  1HBU B;  4RBT A;  3W65 A;  4KQZ A;  4TVA B;  4DOZ A;  2PEB A;  4OYI A;  4IQX A;  4V19 J;  1XER A;  1C1B A;  3CCV S;  1SIZ A;  2E5L J;  2CPI A;  3QO9 B;  4MFB A;  2PMZ D;  3LOU A;  3IS9 B;  5DG9 A;  2AGP A;  3UCZ P;  2NRE A;  2ZOM A;  2GMJ A;  2LU2 A;  2WVC A;  4C8O A;  5FJ4 A;  2DNR A;  1N0U A;  5F0W A;  1IKY A;  1I51 B;  2V0N A;  3K0J A;  4ZJQ A;  2V8V A;  5HP1 A;  4EI2 A;  2I8E A;  4IOA Q;  1UJ4 A;  5D8H B;  3PKM A;  1QVF R;  1LWE B;  3MGJ A;  4ZPT R;  4NLG A;  2E66 A;  2LXI A;  2YNF B;  3N6M A;  4IUF A;  1TKZ B;  4QR1 A;  2HQD A;  3RB4 A;  2DNN A;  3I0S B;  1VQN S;  3KLI A;  4DV3 F;  1FVQ A;  3BB5 A;  5EDW A;  3BSN A;  1L3S A;  2CG8 A;  3KLG A;  1PJ5 A;  2BJE A;  2ZBC A;  3HVR A;  4R5P A;  4DUT A;  4P2F A;  1CJV A;  4LF7 J;  2ZH8 A;  3QAT A;  2J0S D;  3M32 A;  2GVZ A;  4KE5 A;  4YB5 A;  3BGR A;  2Z4P A;  3DRX A;  2DGW A;  5ETS A;  3OTD A;  1SUQ B;  4B3R J;  1VDH A;  2D1C A;  2PSZ A;  1RSC A;  2LU1 A;  1ITP A;  5LMU F;  1LWF A;  2QYG A;  3NWR A;  4ECU A;  2MST A;  3R5G A;  4DFJ A;  3BPS P;  3CJ3 A;  5D0H A;  4OZ3 A;  1HFE L;  1NSP A;  3A8I A;  2OFG X;  3MEE A;  2WVD A;  1YBA A;  4IKA A;  4C8L A;  1GX5 A;  1X4G A;  2KU7 A;  3GV5 B;  3QSI A;  2VG5 B;  2BUN A;  3JTO A;  4IG0 A;  2CNO B;  1JLQ B;  1VI7 A;  4I64 A;  2DBB A;  4C11 B;  1P8G A;  5L46 A;  2GZO A;  4DR5 J;  2FGO A;  3VGT A;  1KR4 A;  3DLE A;  2GIQ A;  4ZVO B;  5E3P A;  3SQO P;  2CJX B;  1LK7 A;  3CGI A;  5HRO A;  1XC9 A;  5KT4 A;  3FJ2 A;  3V5R A;  5C42 B;  4OZJ A;  1BUX A;  4I67 A;  3QJL A;  1JLA A;  5CA5 A;  3KLH B;  5HK4 A;  4AYB D;  2NCK L;  2IBO A;  5GMK a;  3C6U A;  1P1T A;  2HLU A;  3THV A;  4LBP A;  3RRH A;  2RHQ B;  1V5V A;  5J2P B;  2XTJ P;  2ZH7 A;  4QIV A;  4QYZ K;  3HLU A;  3O8W A;  3S7R A;  1VQ9 S;  4M5N A;  2FVR A;  1KFD A;  1X9M A;  3L4B C;  1PC5 A;  4Y3C A;  2CJA A;  2HFZ A;  2M7S A;  1NK8 A;  3DOL A;  3A4T A;  2R3V A;  3PJX A;  4QW8 A;  1R0C B;  4J9S A;  3BR8 A;  2GX8 A;  2R8H A;  4MK8 A;  3DMJ A;  4QIG A;  1W25 A;  2CQ4 A;  4PWW A;  1NPP A;  4CH0 S;  2G2Y A;  1TTH B;  3B54 A;  5T7L A;  4Y6I A;  1HNI B;  3MR2 A;  3DYA A;  2WOM B;  2RRN A;  1TL7 B;  3W61 A;  3K8V A;  5AE2 A;  1TZ0 A;  3RTV A;  4UY8 T;  1N52 B;  1U1N A;  2WRM A;  1RT6 B;  3KKF A;  5IV3 A;  4URS A;  3NMR A;  4RKU C;  1HR0 J;  2CPE A;  2HVI A;  3AA9 A;  4ECQ A;  4WP8 A;  5HMW A;  3CCM S;  4HI1 A;  3H59 A;  2M8D B;  2AGO A;  4LRE A;  3GSI A;  5C2C A;  4WTY A;  2QRR A;  4KFB A;  3BGO P;  3FBE A;  3R5C A;  2UZA A;  3LA0 A;  4WF9 Q;  1WEX A;  1YRX A;  5DDO C;  5K8N A;  2MKY A;  3GR0 A;  4UTG A;  5LJ3 Y;  1CJK A;  1YRU A;  1NBE B;  2RRA A;  3CCE S;  3QJP A;  3S8S A;  5E3R A;  1HL6 A;  4PYA A;  2MJU A;  2VIH A;  1XNQ J;  3T9Z A;  1U45 A;  1VK3 A;  5HL7 Q;  4OJ3 A;  1RT1 A;  3D3B J;  4OZ1 A;  1T9T A;  4GVB A;  1YLX A;  3N0V A;  5BYS A;  3OTC A;  1U24 A;  2CQD A;  4NCG B;  3W62 A;  1S7H A;  3ZFV A;  4PR6 A;  1AFI A;  4FKY A;  4TYA A;  5F8H A;  1HI0 P;  1MU2 A;  3KHG A;  4U8Y A;  2X1B A;  2FIU A;  4DL6 A;  1RUS A;  1FJE B;  4K4Z A;  2GHW A;  2KRR A;  3ISN D;  1O0P A;  4PAB A;  3EPI A;  4QPT A;  3D66 A;  5AXN A;  4QYZ J;  3VGU A;  2E5H A;  4J37 A;  2UU9 J;  3EWG A;  4YY3 J;  4P2X A;  1LW0 B;  4GC7 A;  3ZO7 A;  4P73 A;  1IJF B;  4F25 A;  1RHK B;  1YSJ A;  1U6Z A;  3HXM A;  4BWM A;  1NSQ A;  2XQC A;  3DDK A;  3QT7 A;  1WC5 A;  4PZV A;  2BJD A;  1DJ0 A;  4X65 F;  2HRT A;  4XAK A;  3RG6 A;  2B9W A;  3EDQ B;  4OX9 F;  2GJF A;  3RAM A;  2P5V A;  2YKN B;  1TL1 A;  2B5J B;  1XIQ A;  3LF0 A;  4P2S A;  3C14 A;  1TL5 A;  3US5 A;  3H5Y A;  1K1Q A;  1U0S A;  4ZS6 A;  1XJW B;  3T5H A;  4DQP A;  3KHH A;  2MZJ A;  1YTY A;  3A8J A;  2J7U A;  2KZM A;  1TVR B;  2XO6 A;  3KK3 A;  1GX6 A;  4ED4 A;  5DG8 A;  1NB7 A;  3QGG A;  1K9M T;  4EEY A;  2BAN B;  4NXN J;  4FDF A;  2XUL A;  4FNI A;  1EQM A;  1M1H A;  2V5H G;  2YNH B;  3AD9 C;  2IMO A;  3E8O A;  3HUL A;  5C7P A;  3D1Q A;  4PEO A;  4WK3 A;  3MUT P;  2Z58 B;  3V4I A;  5KFN A;  2YPZ A;  5L1I A;  2HBZ B;  3GLJ A;  1VRT B;  2GCF A;  5DJB A;  2EKN A;  4WXW A;  2W2Q P;  3BR9 A;  2JL9 A;  1GMV A;  2YKM B;  4PPZ A;  1RBL A;  3N4W A;  1MML A;  4DS5 A;  4Q44 A;  4RW6 A;  3SFG A;  4ED5 A;  2VFU A;  1FF2 A;  5DET A;  2OSQ A;  1JXV A;  2KB2 A;  4X62 F;  1MRO B;  4ED2 A;  3FDS A;  4L3K A;  2XMK A;  2UXC J;  3GFZ A;  2XNQ A;  3OBI A;  4ZP8 A;  2RDD A;  4DX7 A;  3DRS B;  2XY7 A;  3MR7 A;  4ECS A;  4CO3 A;  2MHN A;  4CLS A;  1QDU B;  3MCS A;  3R27 A;  3D2W A;  2W9B B;  4EYI B;  2CNL B;  1TKT A;  5EWE A;  5LMU J;  4LRD A;  1NZ8 A;  1KNZ A;  1CJU B;  5F8I A;  1HHT P;  4R25 A;  1RTH B;  5IT0 A;  2GA7 A;  3PV8 A;  3SSQ A;  4C9D A;  3GCX P;  1RYS A;  4HT7 A;  3P8B B;  3HD1 A;  1W7W A;  2XYH B;  1HBM B;  2WSC C;  2C2R A;  2CZV C;  3PZP A;  2DHG A;  2NSB A;  2HVE A;  3OT9 A;  4QWA A;  3HT3 A;  2CUY A;  2RS8 A;  3TQE A;  4CTA B;  4DV6 F;  3BSO A;  4KTQ A;  1JNR B;  2XWX A;  3QAU A;  1VIS A;  2JWN A;  4DV0 F;  2I5J A;  5KOX A;  3VAF A;  3FQL A;  5IWA J;  4OZN A;  2KHC A;  4DN0 A;  2LKZ A;  4ER8 A;  1GXT A;  3VAM A;  1RWW B;  2DNH A;  1VJW A;  1QJH A;  4OZ5 A;  1NME B;  3VF0 B;  3KLF B;  3I32 A;  3EIC A;  1SV5 A;  2L9D A;  1RTD A;  3WBZ A;  1Z1Z A;  1ZYQ A;  2HND B;  4ZVG A;  2MEW A;  3BKU A;  3J7Z T;  5KT7 A;  2Y8W A;  5CYQ B;  4P7V A;  5A2Q U;  3C46 A;  3AA8 A;  2HFS A;  3QO9 A;  1VC0 A;  3K5L A;  3IS9 A;  2QO3 A;  5M2R A;  3M9N B;  5MLC V;  3HMJ G;  3QLH B;  5HLF A;  1AW0 A;  1VIX A;  1F0X A;  3O6Q A;  1VBX A;  1NND A;  3M05 A;  1YRT A;  5EGY A;  2AX1 A;  3SDE B;  3R9L A;  2K1R B;  2ZH4 A;  2Q66 A;  4EGL A;  8RUC A;  3OLB A;  4L72 B;  2FJA B;  3LTO A;  2YNI A;  3CCS S;  2HK3 A;  1X31 C;  2DXF A;  2KG0 A;  4URQ U;  4NLQ A;  4HHH A;  4ECV A;  2JX2 A;  2YNF A;  2MZQ A;  5KFF A;  4J9O A;  1WG5 A;  2BV3 A;  2DT9 A;  3EGN A;  3I0S A;  2ZVI A;  4DX5 A;  1IKW B;  4I2P B;  4ZVH A;  1RAI B;  4OI1 A;  3G2X A;  1VK8 A;  1K1S A;  4DZD A;  1U0H B;  3RAQ A;  3P6Y C;  1PAU B;  3BN7 A;  3JTP A;  1EP4 B;  2D3O R;  1S97 A;  4P10 A;  4DV1 F;  2JZ5 A;  2R7T A;  3U7J A;  4NWB A;  4ZIV A;  2DYA A;  1FRL A;  2RHS B;  3G6V A;  2AGQ A;  1T9Y A;  4YQW A;  4DR7 J;  4KHR A;  2BZ2 A;  4PXE A;  4BWJ A;  2EFQ A;  1GT8 A;  5HJX A;  4LSL B;  3G96 A;  3TUZ C;  4CM0 A;  4NA3 A;  1D9D A;  3TNV A;  1T05 B;  2IFX A;  3W8G A;  1BD6 A;  1UW9 A;  1PIL A;  2ZWO A;  3WQP A;  1UAW A;  2E29 A;  1YJR A;  1RT7 A;  2LEA A;  4UY8 5;  4K4W A;  2W7A A;  2YY3 A;  3MEG B;  3DLG B;  1UZD A;  1D3W A;  1R8P A;  2VPW B;  5AXK A;  2VG7 B;  1Q7Y T;  2HSE B;  5DQG A;  3TA0 A;  2HEK A;  4FXV A;  2IDL A;  3KK2 A;  4EBC A;  2HWI A;  5EWF A;  5CYM A;  1SL0 A;  4X4V A;  4HH0 A;  2CQB A;  3NGK A;  9ATC B;  4J9L A;  4J7C A;  3CCT A;  2P6T A;  2XZT B;  4C0O C;  4EFA C;  4MJK A;  1FXR A;  3PCO B;  3M9M B;  2W01 A;  1ZPV A;  5C42 A;  3OUY A;  2WAQ D;  4YME A;  3OTO F;  3KLH A;  1FER A;  4ES2 A;  2GIR A;  2B9Y A;  5IFM A;  4DPW A;  3QID A;  2R4F A;  1WC6 A;  4HDG A;  4FKX A;  1Q7L B;  4ECW A;  4IOC Q;  4KB7 A;  4ZVS B;  2DNZ A;  2XZD B;  1WTF A;  3Q8P B;  2E5I A;  3NCP A;  5J2P A;  1J5E F;  4X65 J;  1S1V B;  1Q5Y A;  1JLF A;  2W24 A;  2F40 A;  3MPD A;  4OX9 J;  1JLG B;  3C15 B;  4ERD A;  4W98 A;  4B9V A;  2BEF A;  3MFH A;  2NYI A;  3N9U C;  2QSW A;  4IFY B;  2H4Y B;  2LQ5 A;  2OP5 A;  2ZD1 A;  4BC7 A;  1FHT A;  4OX8 A;  1N32 F;  1X5S A;  1HNI A;  2WOM A;  1TL7 A;  1Q8L A;  4C8K A;  3IN5 A;  2KVQ E;  3HF5 A;  5BXI A;  2KVI A;  1FT8 A;  1FA0 A;  2R7V A;  1L3U A;  4G1Q A;  3ILL A;  2LEC A;  3GIR A;  1NRK A;  4IRD A;  3NRB A;  2UUB F;  3MZI A;  2H5I B;  1SL1 A;  2YTC A;  3JSR A;  3G87 A;  5LOQ A;  2CQG A;  1UZH A;  1N4L A;  4RUC A;  3CMA S;  2IY5 B;  1Z2Z A;  5F0U A;  1S4E A;  3I82 A;  2XMM A;  4CLF A;  3K89 A;  2HS0 A;  3NGD A;  1D8Z A;  3OVA A;  3OTE A;  4PWU A;  4DUZ F;  4X62 J;  1FFG B;  1DQ9 A;  4DZ6 A;  4CT9 A;  2XG8 A;  2LP4 A;  1UWB B;  3D6F B;  3TP2 A;  3IBW A;  5D4P A;  4K4T A;  4ELV A;  2BJ8 A;  1JLE B;  3AOD A;  2NQP A;  2I2Y A;  3BDE A;  1S1X B;  2XS2 A;  1OO0 B;  4K7Q A;  3T9N A;  4AE5 A;  1I6J A;  1VCT A;  2CVE A;  4PG6 A;  5KFH A;  1RAG B;  3G6E S;  4LFA F;  4AXI A;  3VVU A;  1Y5N B;  1F3V A;  4OYM A;  3GU0 A;  2BW7 A;  3BKT A;  3H7H B;  5RUB A;  1WF1 A;  1HMV A;  1QE1 B;  3Q8Y A;  3KG4 A;  4RW8 B;  1QTM A;  1GXU A;  2BE2 B;  4ECY A;  2J6T A;  3CXC R;  2N7C A;  2HHT A;  4ZJL A;  1CC7 A;  2LYV A;  1Z4U A;  4DV6 J;  4WE1 B;  3PYE A;  4DV0 J;  1LW0 A;  4MAK A;  4JYA F;  2WBM A;  1X5T A;  4Y2A A;  2C22 A;  4YDX A;  4JI8 F;  3W5Z A;  4NRT A;  2H65 B;  3LPE A;  3EUN A;  4X4P A;  2OPR B;  3NY0 A;  3GIJ A;  2A18 A;  1DZ5 A;  1FXD A;  1JKH B;  4CLP A;  4NRU A;  4RW9 B;  4WZM A;  4WFN Q;  2AKW B;  1RWX B;  3H2L A;  2YKN A;  4ZPD A;  2B5J A;  3H2V E;  1KON A;  2IYG A;  2GC8 A;  1GMW A;  3IM9 A;  3NG8 A;  1FK9 B;  3D28 A;  3MM5 B;  3KJN B;  3BGU A;  2JFD A;  1JX4 A;  1O8B A;  1WJ9 A;  1HWU A;  4DL0 C;  2HFO A;  1TVR A;  3PRV A;  2FJB B;  1ZOT A;  5IOL A;  2BM0 A;  2IRX A;  4DUY F;  1R31 A;  2DR8 A;  2R7W A;  3HJV A;  4QW9 A;  5D4N A;  1FDB A;  1U25 A;  5B0F A;  3O1L A;  4HLB A;  3TA2 A;  3M30 B;  2YNH A;  1Q79 A;  6FDR A;  2OEJ A;  5E41 A;  3EGV A;  4DJB A;  1BWV A;  3OXG A;  2QLB B;  2R8G A;  3DI6 B;  5A6P A;  5LXR A;  4KGK A;  1B64 A;  2YKM A;  2RVJ A;  4N47 A;  3GFX A;  3W1Y C;  3HZE A;  5GAG I;  2XO7 A;  3ZTS A;  4XDD A;  3IG1 A;  2N3O A;  3N28 A;  1VQ5 S;  5DGB A;  1N0V C;  3OJU A;  5J1P A;  2ZNY A;  2XLI A;  1BY9 A;  2EK1 A;  2HQG A;  2FJV A;  2AJ1 A;  1MRO A;  2DH9 A;  5KG1 A;  1J5O A;  3J7Z 5;  3KNA A;  4E8U A;  4DV1 J;  2MKI A;  1OQ3 A;  3LWM A;  3QYY A;  3QT5 A;  4LF8 F;  5HQ8 A;  5HBM A;  4OI3 A;  2X51 A;  4YUD A;  2AYB A;  3ILJ A;  1KDN A;  2EFV A;  1NAQ A;  2KRB A;  4NA2 A;  2W9B A;  3UR3 C;  2PE8 A;  4FXD A;  1CJU A;  4I69 A;  4K4S A;  3DLH A;  1Q4R A;  2OH2 A;  5HAT A;  2GFF A;  1FCA A;  3PW5 A;  1X4F A;  5CXT A;  1NDP A;  3V81 B;  1SXL A;  3GFH A;  3MHY A;  1HBM A;  2VH7 A;  4WFZ A;  3B6B A;  2E44 A;  3PX0 A;  2C1E B;  1UEV A;  1O5J A;  4MH8 A;  1X4A A;  4RWX A;  1D9F A;  1ACM B;  3U1L A;  5KFW A;  5HMZ A;  3MDF A;  2J7K A;  3RBD A;  1HNZ F;  2X7I A;  1B0T A;  3T3F A;  3OPK A;  4DCJ B;  1SL2 A;  1B70 B;  2N82 B;  2BW2 A;  1C0T B;  2K3I A;  2RIL A;  4DWI A;  2MB0 B;  1RWP B;  3CD0 A;  4P52 A;  1RHM B;  2M5Y A;  2Y1I A;  5IT4 A;  1N5V A;  2QLF B;  5K8M A;  1B0V A;  1UWA A;  3PFO A;  3GR1 A;  2COL A;  2Y8Y A;  2M9K A;  3KLF A;  4P74 A;  3AXK A;  4DR4 F;  2CZ9 A;  3MMA B;  1VJQ A;  4DR3 F;  3M1V B;  2B51 A;  4WFB Q;  2WSF C;  2D74 B;  3OTO J;  3VZH A;  2H51 B;  4K4V A;  4PKD B;  4URG A;  2FLO A;  3DM2 B;  2WZ1 A;  1OMS A;  5DDP C;  5CYQ A;  3MM9 B;  4G6V B;  3IWX A;  2VZ9 A;  1NK9 A;  3HVT B;  3UDC A;  2OI2 A;  4WII A;  3TJA A;  2MGZ B;  1J5E J;  1Q16 B;  1YJW S;  3K5N A;  1ZM3 A;  2KT3 A;  3RR8 A;  3W5X A;  3CUN A;  1SVD A;  3VQT A;  5IT9 U;  3SDE A;  1YX2 A;  4M1K A;  1OIA A;  5KFB A;  2DNM A;  3HHL D;  1REV B;  4Y28 C;  5AE3 A;  1N32 J;  4JOU A;  2IM3 A;  4OYX A;  2CZ4 A;  4H4M B;  1FRX A;  2B6A B;  1KVK A;  2AMC B;  4ZVP B;  2C3M A;  2QL7 B;  1BQN B;  5ETP A;  1A9N B;  2EFO A;  2NUH A;  2HG4 A;  2XMT A;  4QJV A;  2H5E A;  1V3R A;  2UUB J;  1ZZN A;  1IKW A;  4A8W A;  2V69 A;  3PEH A;  1IJE B;  3KDN A;  4RPF A;  4DLE A;  3H40 A;  4HT5 A;  1S76 D;  1NK4 A;  2ASJ A;  2RKI B;  2ZDO A;  3HVA A;  3BO4 A;  2B8P A;  2G2O A;  2RT3 A;  2OEM A;  4WBF A;  3UQS A;  3VR1 A;  2IPO B;  2V34 A;  1AFJ A;  1P6T A;  1IKX B;  4KH0 B;  3FFI B;  2BA9 A;  4NI2 B;  2CJB A;  1TQL A;  2R8J A;  1I3O B;  2GGP A;  3GYX B;  2EBG A;  1F2H A;  1FRJ A;  3HSJ A;  3MUR P;  3DLK B;  4LSL A;  2VC1 A;  2XLK A;  5E0O A;  3M8P A;  2GAG C;  3CCW A;  2XCA A;  4GKJ F;  2FVP A;  2HIY A;  1T05 A;  3TQ1 A;  3POT B;  3KDO A;  5E3A A;  4ILM A;  3TR5 A;  2MQP A;  2MPU A;  1PJ6 A;  2CPH A;  1YIJ S;  2EFG A;  4LFA J;  3NOG A;  5ETV A;  3AT1 B;  3MEG A;  1KFS A;  3UWT A;  3A8E A;  1GH8 A;  4QYR A;  2VG7 A;  2HK2 A;  3B78 A;  1RZM A;  5I3P A;  5IXU A;  2DEI A;  4WP9 A;  1MMN A;  2GJ2 A;  5KT5 A;  4JV5 F;  5E7O B;  4B02 A;  2PA3 A;  2XZW A;  4M8L A;  5H1S V;  4ED7 A;  4FS2 A;  2Z2M A;  5G0R A;  2O01 C;  2OMO A;  3M2U B;  2RF2 B;  2G4B A;  1WKK A;  2CPF A;  3A12 A;  1U6B A;  2OD4 A;  2ZBP A;  2GS8 A;  3CE8 A;  1U2F A;  1W26 A;  3CDU A;  4RW4 A;  4JYA J;  5DLF A;  5D3G B;  1T11 A;  2OSR A;  4JI8 J;  3T1H F;  5FII A;  1G1X A;  1IQT A;  3HZG A;  1WOS A;  4ZP7 A;  4LF5 F;  4JUZ A;  4DV5 F;  3GII A;  1JJC B;  5C24 B;  1XR5 A;  4Y0F A;  1SKS A;  1S1V A;  4ED0 A;  3QJJ A;  5D78 A;  3VVT A;  1NH7 A;  1NH8 A;  2JVR A;  1CVJ A;  3C15 A;  1AA1 B;  3N5B A;  2XM3 A;  3R5D A;  4IFY A;  3T5L A;  1NKB A;  2IM2 A;  1AYE A;  3ZZZ A;  3V6J A;  2AWZ A;  4W90 B;  3I0R B;  2BXJ A;  4KV8 A;  1WD6 A;  5B0E A;  3I5A A;  1H98 A;  3GG1 A;  2CQP A;  4F04 B;  1NDC A;  2YWF A;  3RU0 A;  4DUY J;  1S9G B;  1RKI A;  1RP5 A;  4IDK B;  2C2Z B;  3I5C A;  2KM8 B;  4B9U A;  1D0E A;  3G82 A;  2P9C A;  4DFK A;  1C4A A;  3ISN C;  4Q0B B;  3M9O B;  3QT6 A;  1U1K A;  1EET B;  2MQL A;  2DHH A;  2ZE2 B;  5BYR A;  1KWM A;  3H90 A;  4WCE Q;  4NCB A;  4DQQ A;  2G2Z A;  2DO4 A;  1WTB A;  5CCM A;  1BC6 A;  2QL5 B;  2F8E X;  3D0G E;  1UEU A;  3TAQ A;  1PKU A;  1HI8 A;  2QX0 A;  2OPS B;  5M2P A;  2PMW A;  3SMZ A;  2HFN A;  4RBV A;  3BM7 A;  3BBC A;  1UWB A;  2RRB A;  2QE5 A;  4LF8 J;  2X3D A;  2BQ3 A;  3VAK A;  1NB2 A;  3CCU S;  1JLE A;  4B9L A;  5G4D A;  3TZY A;  2VD3 A;  1YQH A;  3DOK A;  4ZCM A;  1SJ1 A;  2L9W A;  1N56 A;  5F3T A;  1PYO B;  3DU5 A;  2CXE A;  2GHP A;  2LQ9 A;  2VBW A;  1VQ6 S;  1FFS B;  4JP8 A;  1TFW A;  4QZV B;  3FNN A;  3LPY A;  1WNE A;  2ZHO A;  2GNK A;  1M0S A;  2LEB A;  4LF1 A;  1MMD A;  3CO0 P;  2ZWP A;  2UUC F;  4YEA A;  2F9J A;  3N79 A;  2MQ8 A;  4RR5 A;  4USU A;  3BO3 A;  4RW8 A;  2EVZ A;  3HO1 A;  1UVL A;  2BE2 A;  3GIK A;  4F4Y A;  1S10 A;  4LF6 F;  3BQ2 A;  1MNE A;  1AZS A;  1HNZ J;  4KSE B;  2HGN A;  1NLK L;  2B56 A;  1F6T A;  4USK A;  2RE1 A;  1GEH A;  5KFU A;  1IN0 A;  1ZPW X;  3C66 A;  2N7Y A;  5A8K B;  2LA4 A;  5LT5 A;  1FDD A;  5CD4 H;  1F9H A;  1ZA1 B;  3FRY A;  3UPF A;  1EB0 A;  2P6S A;  4I7F A;  3UW1 A;  4YDD B;  5IC6 B;  2AEJ A;  3H8Y A;  4DR4 J;  3K57 A;  3EXC X;  4DR3 J;  2OPR A;  2ZZM A;  3AOA A;  1C1B B;  2HHU A;  2H48 B;  1RT2 B;  1JKH A;  4P2M A;  4RW9 A;  3D4J A;  4ED8 A;  1SBR A;  4WFY A;  5KFG A;  3P5B P;  1Q8B A;  2AT1 B;  3CUL A;  2Q79 A;  2UUA F;  2BRK A;  3FGV A;  4JI2 F;  2UUW A;  2F5G A;  1NHV A;  2G0I A;  5D0G A;  4X4N A;  1F3F A;  4A8K A;  2HBY B;  1H7X A;  1IKY B;  1AXQ A;  3MM5 A;  4Q5V A;  1V6H A;  2CPX A;  1R6Y A;  2H9Z A;  2YKA A;  3S1T A;  3F0N A;  3MFI A;  5KG6 A;  3FQK A;  5E2Q A;  2VA2 A;  3UCG A;  4OZL A;  2ZOG A;  4TLQ A;  2E9T A;  2XC9 A;  3ZZR A;  1HBO A;  2CVI A;  4DPU A;  4ECX A;  1IBL F;  3ETM A;  3VAG A;  3CJK A;  4ZOS A;  3CIM A;  1U7L A;  4PAA A;  4GO5 X;  3MPV A;  4KO0 A;  1MWQ A;  4B08 A;  1MWY A;  3KLG B;  4UOH A;  1WF0 A;  4DU8 A;  4WU2 A;  3T19 A;  3PO5 A;  3CJ0 A;  4FF1 A;  3RGI A;  2IJN A;  3DGV A;  4IH7 A;  4PXC A;  4CCH A;  2AHO B;  3BGR B;  1XR6 A;  2ZUA A;  5A0Y B;  1XN9 A;  1A0O B;  2F65 A;  2FB0 A;  1RAD B;  2NZ4 A;  4RNM A;  4DHV A;  4FS1 A;  5A2Q Y;  3DGP B;  3UD4 P;  3R97 A;  3MI7 X;  1TEL A;  2Z2Z A;  2QTW A;  2UVW A;  3AXM A;  2ZEJ A;  4C7Q A;  4QU7 A;  4YHH F;  4DDF A;  4UOG A;  5D77 A;  1RAC B;  1KQK A;  3GQC A;  1TKX B;  3W2W A;  1H7W A;  2EI5 A;  1IVZ A;  2ZDP A;  3FSY A;  4GKJ J;  4OHW A;  3EXY A;  5CAB A;  4CLK A;  4IG0 B;  3JSB A;  5IM0 A;  4M95 A;  5F9N A;  2C2D A;  2ZH5 A;  3A8K A;  3QFW A;  1QSL A;  3FVY A;  2CA9 A;  3OSN A;  2BKP A;  5HAO A;  1Y9O A;  4NLD A;  1YZ6 A;  2A2C A;  4CI0 B;  4JV5 J;  3DLE B;  4KYZ A;  5J2N A;  2CPZ A;  4ZPC A;  3THT A;  5DZ6 A;  3R3T A;  1WHX A;  1C0T A;  4EZ6 A;  2MKC A;  4DSE A;  2J0X A;  4HTJ A;  1N34 F;  5HRO B;  2HQI A;  4PWD B;  3QRP A;  1DHM A;  5EX3 A;  3PJ9 A;  1HD0 A;  2FLL A;  3C6U B;  3MMA A;  4LFC F;  4MTP A;  3M1V A;  3T1H J;  4OI4 A;  3WIV A;  3HVW A;  4DQR A;  1RXO B;  2V4R A;  4LF5 J;  3IFE A;  3HX9 A;  2HHH F;  4DV5 J;  4ZCI A;  2MQN A;  2ZVS A;  2OLW A;  5EUH A;  1M5H A;  3TA1 A;  3BBB A;  4USV A;  2JJ4 D;  3M4X A;  4G1P A;  2MGZ A;  3DOL B;  3SCJ E;  1FRI A;  3IR6 B;  3FEX B;  2R7O A;  3L3C A;  3DMJ B;  2LCW A;  2Q3P A;  1T9U A;  2CJ9 A;  4E2F B;  4WK1 A;  1LWX A;  4KHP F;  2VQE F;  1N8R T;  4IO1 A;  4GRS A;  2HHQ A;  2XSJ A;  2X1F A;  2GO9 A;  3NCR A;  3OV7 A;  2D3U A;  2BKO A;  2DCL A;  3OQ2 A;  3D6M B;  2B6A A;  3HCX A;  5GAG U;  2GJI A;  1J27 A;  1WG4 A;  1IBK F;  2D41 A;  2YQ0 A;  2K8G A;  1YIT S;  2VG6 B;  1ZH5 A;  3FBB A;  3NXZ A;  3NWG A;  4EU0 A;  1F5A A;  3MCO A;  5F9L A;  3QMQ A;  4ANE A;  5J2M A;  2YQ1 A;  1S0O A;  1CJK B;  3PO4 A;  4V19 X;  5KAK A;  3G9C A;  3MR5 A;  1PGZ A;  3R1L A;  4LUB A;  4NYP A;  1TL3 A;  3CDW A;  4IYQ A;  4Q8F A;  4X4U A;  2NSC A;  3ILI A;  2NR0 A;  3I87 A;  2DR5 A;  1RT1 B;  2JHE A;  1KOH A;  3M8W A;  3L7P A;  4GVB B;  1NJY A;  4DXL A;  3CVK A;  4NYO A;  5D4L A;  3I4H X;  2MTL A;  1Y4Z B;  3ZNJ 1;  1RT4 A;  3IGN A;  2ZHB A;  1M5P C;  2FC9 A;  1F2G A;  4H4O A;  2VFV A;  3PFE A;  3POT A;  3BS9 A;  4AXJ A;  4A8S A;  1T03 B;  4UUX A;  2ASY A;  4RU9 A;  3DLB A;  1R27 B;  2W4C A;  1H6K X;  3BQ0 A;  2V8P A;  4DSF A;  2CAD A;  1EIY B;  4RNH A;  5DM7 Q;  1Q8I A;  4HHJ A;  2MLX A;  1TUW A;  2JLE A;  2KL8 A;  1F9F A;  1DFD A;  4G3I A;  1WG1 A;  3RJM B;  2E7X A;  3M2U A;  2RF2 A;  2NUU G;  3M2R B;  4LF6 J;  1OJ4 A;  2XY6 A;  4K2X A;  2ZBQ A;  2DNP A;  3ADA C;  5K8O A;  2VOP A;  1ZA2 B;  4M5H A;  4OHZ A;  2IMW P;  1TV6 A;  2J6S A;  3FBF A;  2WVB A;  3QIP B;  5D3G A;  1H2U X;  2MLZ A;  2KDO A;  1CS4 B;  2CNN B;  4J90 A;  1Q1K A;  2FHJ D;  4ELU A;  4K4U A;  4WKY A;  5B0A A;  2QEX S;  3MOJ B;  1RBA A;  4DPX A;  2OHD A;  2ZBR A;  3KMS A;  1FWL A;  4C98 A;  2EXU A;  3C14 B;  2YKQ A;  4DL5 A;  3Q8R B;  2EG1 A;  3UDV A;  2UUA J;  5ETM A;  1XBW A;  1H2V Z;  4JI2 J;  4QIW D;  3MD1 A;  3VCD A;  1FDN A;  4OHV A;  1K0T A;  3KK3 B;  5KT2 A;  2HHS A;  3DN9 A;  1U1P A;  5L1L A;  4XIU A;  2K2P A;  3I0R A;  4J9U E;  2VC0 A;  1R0B G;  1R8A A;  4AQY F;  5JVH Q;  4F4Z A;  1LNQ A;  4ILR A;  2AX0 A;  1BQM B;  1S9G A;  4ZPA A;  3LAL A;  3I31 A;  4IDK A;  3BBF A;  4L75 A;  3G8Q A;  2LXF A;  4WYW A;  1QTN B;  3F73 A;  3SV4 A;  3F41 A;  3FMB A;  2W2M P;  1U2C A;  2VHG A;  3C19 A;  3FSX A;  3GYN A;  3JSM A;  4Q0B A;  1EET A;  4BHQ A;  2KH9 A;  1UPP A;  4JI5 F;  4KGV B;  1X60 A;  2DNG A;  2HVD A;  3MM8 B;  5A76 A;  2J8S A;  2B3T B;  4CH1 A;  1FRM A;  2VFT A;  2BM1 A;  3TAN A;  2P9G A;  2JEJ A;  2OPS A;  3WX8 A;  3UI3 A;  2JC0 A;  1X8D A;  1S7I A;  4ZVR B;  4TKT A;  3QQC D;  4USJ C;  4G1I A;  2YVS A;  4KRW A;  3EGW B;  4HAC A;  1FI4 A;  3LQV A;  3ISZ A;  4P6Q A;  4ZMM A;  1NJZ A;  4QCL A;  2HHV A;  2Y3Y A;  3WZ0 A;  4DV2 J;  2VL1 A;  4IFV B;  1MN9 A;  1RWM B;  4OHY A;  2U2F A;  4CRJ A;  1M5S A;  4YHH J;  1TU0 B;  4I6Y A;  4M5J A;  2QA4 G;  4MYU A;  3UNG C;  2FYX A;  1RWO B;  4LRB A;  1RI7 A;  2AZ1 A;  2M52 A;  4M5K A;  4Y65 A;  1R3N A;  4RUH A;  1P1L A;  3BZQ A;  4F0H A;  2E9R X;  3ENW A;  4A47 A;  3UVJ A;  4LQ3 A;  3VV2 B;  5GAE I;  5D0R A;  1KTQ A;  2W7P A;  2ZC4 A;  5E3Q A;  4H4K A;  1HNW F;  3O3L A;  2YBV A;  2HHW A;  2XMW A;  2FQQ B;  2V2V A;  2JC1 A;  4K5S A;  1WI6 A;  4L73 A;  2VON A;  3RR7 A;  3TZZ A;  2Z8Q A;  2AU0 A;  1RIS A;  3GCW P;  1UVJ A;  1REG X;  1N34 J;  2VBX A;  1XQI A;  4LRF A;  1SV5 B;  1RTD B;  5GVQ A;  4X4T A;  3Q83 A;  2ACM A;  2OEL A;  4KGX B;  1KD1 T;  2Y0B B;  1YJU A;  4DPT A;  1L3V A;  4LFC J;  3NL0 A;  2DIT A;  3J81 U;  3R2C J;  3OD2 A;  1RT3 A;  4B9N A;  1ZM2 A;  2G9O A;  1RT2 A;  2DRA A;  1U1R A;  3PX4 A;  3TRG A;  1KVI A;  2DK2 A;  4HTI A;  4FBT A;  2HHH J;  2W4P A;  5HLF B;  4LF4 F;  1HYS B;  1TAU A;  1JK9 B;  3FEY B;  4DCP B;  1HLW A;  5KFQ A;  1U6F A;  4Q2M A;  1X0P A;  2ALY B;  3BGL A;  1H3D A;  4NPO A;  2J9D E;  3T5K A;  4NA1 A;  3CNQ P;  1X4C A;  2C2M B;  3QSY B;  4U8V A;  4CO0 A;  4OI0 A;  1SH3 A;  2VQE J;  2BJ9 A;  2KFN A;  4FPR A;  3FC9 A;  3SCL E;  1ZS6 A;  2YNI B;  1RBO B;  2QG9 B;  3H5U A;  4C8Z A;  4BDP A;  2XYP B;  3CC2 S;  2V63 A;  2ILY A;  4HI2 A;  4I6A A;  2Y9H A;  3OTB A;  1UVM A;  1F1B B;  4A8O A;  1S59 A;  2BMB A;  2OGU A;  4C48 A;  4D3H A;  2KG1 A;  1IBK J;  3GWC A;  3ENQ A;  2IIH A;  3U1N A;  1RWV B;  3JAM U;  2XS7 A;  3VAI A;  1JWW A;  2CWX A;  2YKP A;  4MYT A;  2O66 A;  1F5B A;  2EG2 A;  3BH7 B;  2ZUG A;  5A0Y A;  1FKA F;  3J7A N;  4ZLN A;  4RX6 A;  3Q8Q B;  2J7W A;  2B7C B;  1R0A B;  4KJI A;  5J2Q B;  4NEY A;  3DGP A;  4X84 A;  2KT2 A;  2SXL A;  2QGF B;  4DMZ A;  3PM9 A;  5C25 A;  3GJQ B;  4AL6 A;  4LMZ A;  4KC5 A;  1NDL A;  2DGX A;  4O4G B;  3NS6 A;  2NXU A;  1TKX A;  2CQI A;  8AT1 B;  5IT9 Y;  1RT7 B;  4GMK A;  4XDC A;  1X9S A;  5DS7 A;  2POK A;  2OEK A;  1V9O A;  2Y1L B;  3CPW R;  4A8Q A;  3CJS A;  4IG3 B;  3QBC A;  4M5M A;  3TAP A;  4LSZ B;  1RGV A;  1I94 F;  2FJW A;  1HWL A;  1FO1 A;  1RWN B;  2HS4 A;  1WWH A;  3PXG a;  5E3C A;  3H42 A;  3KK2 B;  3HHL C;  4C0B A;  2CG4 A;  4ZIW A;  1NUE A;  4QQB A;  4FNH A;  2DEJ A;  3PX6 A;  5CYM B;  4LQ9 A;  4ZVU B;  4DFM A;  1TK8 A;  3P45 B;  2KT5 A;  1H73 A;  1ELO A;  1U4B A;  3L09 A;  4N5S A;  1S72 S;  1LFW A;  1N88 A;  3PW2 A;  2MQM A;  3OUY B;  1FD8 A;  3SFU A;  1YBU A;  4PWD A;  1WEY A;  2JLF A;  2C2E A;  4F50 A;  3AJD A;  3SQG A;  4RW7 B;  3MR3 A;  3DU6 A;  3H98 A;  5B0B A;  4U67 Q;  2MHE A;  1N5Q A;  1CQN A;  3D6H B;  3ELH A;  2AQ4 A;  4M5D B;  2XI2 A;  4OZ0 A;  1JLF B;  1PIE A;  1ZAV A;  4CLL A;  4ED6 A;  1JJH A;  1T02 A;  3TAM B;  3K58 A;  2ADB A;  1IM4 A;  1RAE B;  4YB6 A;  1RHQ B;  4F4A A;  3G8S A;  3HHK A;  2FLN A;  2RNE A;  4CH7 A;  1UMJ A;  2ZD1 B;  4DL3 A;  2HUR A;  2G0C A;  2KI2 A;  1UJ6 A;  4C8N A;  3NKY A;  2PI5 A;  2I1R A;  1GTH A;  4EUV A;  4MKA A;  1JXE A;  4DG1 B;  4Y2I A;  4DV4 J;  5I42 A;  5LSL A;  4PG5 A;  2GHV C;  4AQY J;  5LMN F;  4G1Q B;  4XK8 C;  1VQ4 S;  1CJT B;  2HNZ A;  2GQC A;  1X4E A;  3AJ2 A;  4QPX A;  2Z2Y B;  2YH1 A;  1SIW B;  4ZVQ B;  4LR9 A;  3H20 A;  2FVQ A;  5F8G A;  2Q43 A;  1KP6 A;  2VG6 A;  2KTQ A;  1ARO P;  1ZZF A;  1UW4 A;  3EVM A;  4WJB A;  3BDP A;  3LP1 B;  2PII A;  3SIP B;  4Q2L A;  2MYF A;  4P75 A;  2F8M A;  3LP0 B;  2FHO B;  2RAQ A;  3MAQ A;  2VKR A;  3Q2S C;  4W4M A;  1LXN A;  4MKV A;  2NXN A;  2AD9 A;  1S1T B;  3QRQ A;  2HVH A;  4X2B A;  4NLT A;  4OYZ A;  3KHR A;  4RZR A;  3C16 B;  1MSW D;  3KJV B;  4BC9 A;  2YX1 A;  4V1A k;  1Y5I B;  4OI6 A;  1JJ4 A;  2ZBI A;  1URR A;  4DLG A;  3KFW X;  2RQK A;  4USW A;  3A13 A;  1LQ9 A;  5HMY A;  2QLW A;  1OWX A;  1T03 A;  3I55 S;  2HQ3 A;  4HDH A;  2FPH X;  2CWK A;  1HMV B;  3AB4 B;  1DRZ A;  1S79 A;  2ACY A;  4G65 A;  2QJ3 A;  2CAJ A;  4PPD A;  3WC0 A;  2MKS A;  2P2C B;  4UW2 A;  4DEZ A;  1URN A;  1T9V A;  2N4C A;  5ETO A;  2QC3 A;  3IR5 B;  1NXI A;  2EBE A;  1JXL A;  1IKV A;  1F9E B;  3M2R A;  3MCN A;  4ZP9 A;  3HSZ A;  4U7U D;  4QIF A;  1YJ9 S;  2MZ1 A;  4OV6 A;  1QAI A;  4NLO A;  4NLR A;  3GZ7 A;  3TO8 A;  2JEF A;  4KIA A;  4N41 A;  3M8Y A;  4FVM A;  3B4M A;  3QIP A;  2B0G A;  2DGQ A;  1W2I A;  1CS4 A;  1SH2 A;  4CIO A;  4OX7 A;  3D3C J;  4ZVT B;  3BPD A;  2V4J B;  3K5M A;  1VQK S;  4O3S A;  3RAX A;  1WC1 A;  1XWL A;  2M0G B;  3DLJ A;  5ETK A;  4K50 A;  2NZC A;  2CQ1 A;  4PG4 A;  2UP1 A;  3ZTO A;  1YGY A;  1F60 B;  1VS3 A;  2H54 B;  4CO2 A;  3R6L B;  1SJQ A;  4LF4 J;  3ZTP A;  1Y3K A;  2WTF A;  4I56 A;  5EHH A;  3HT0 A;  2MZS A;  1HQE B;  4JI3 F;  4C3M A;  2Z2L A;  2GIF A;  4LBI A;  5I3U A;  1U8S A;  3HHL B;  5F41 A;  2HWH A;  4OHX A;  1BQM A;  1RCO B;  4A8X A;  2W1B A;  4DX8 H;  2ZH6 A;  5GAH I;  4A8Y A;  2A3J A;  1S6Q A;  4CLZ A;  2DNY A;  2DIU A;  2UV8 A;  1RCX B;  4DV3 J;  2QMU B;  4KBI A;  1L3K A;  3IG1 B;  5KFZ A;  2PGC A;  2DO0 A;  4DSI A;  2ILZ A;  4BLG A;  1NJW A;  2A6M A;  2KXN B;  4E0D A;  1MWZ A;  4NML A;  5A8R B;  3KUE A;  1B7F A;  3MM8 A;  1J5O B;  1QSY A;  1DTT A;  2DTJ A;  2J76 E;  3CSK A;  4QR0 A;  4FN5 A;  3JTN A;  2C42 A;  3DXS X;  3OFH A;  5HBM B; 
#chains in the Genus database with same CATH homology
 1JXV A;  1VYA A;  2DXF A;  4DZ6 A;  2CWK A;  3EVW A;  3ZTP A;  3EE3 A;  3MPD A;  4UOG A;  1S57 A;  1PAE X;  1U8W A;  1LEO A;  4KPC A;  4W98 A;  3EMT A;  4DUT A;  2BEF A;  1K44 A;  3VGT A;  2AZ1 A;  1HLW A;  2VU5 A;  3BBF A;  3DKD A;  1NDK A;  1XIQ A;  4ANC A;  2DXE A;  4FKY A;  3BBB A;  1EHW A;  4UOF A;  3JS9 A;  1NLK L;  1B4S A;  3ETM A;  5CAB A;  3EIC A;  1PKU A;  1F6T A;  1S5Z A;  3FBF A;  4S0M A;  3ZTS A;  3NGS A;  3GPA A;  3EVM A;  1BUX A;  4DI6 A;  1BE4 A;  3VVT A;  3G2X A;  3DDI A;  1NDL A;  5CAA A;  3EJM A;  1NCL A;  3ELH A;  3GP9 A;  3ZTQ A;  1LWX A;  3FC9 A;  3Q89 A;  3Q86 A;  4C6A A;  1WKL A;  3L7U A;  1ZS6 A;  3FKB A;  2NCK L;  3BBC A;  5BXI A;  3ZTR A;  3BH6 B;  2DXD A;  4UOH A;  3VVU A;  2HVD A;  4F4A A;  3FBE A;  1NB2 A;  2AZ3 A;  4AND A;  3VGU A;  5C7P A;  3FCW A;  1W7W A;  2DYA A;  3WX8 A;  1MN7 A;  1NSP A;  1KDN A;  1NHK L;  1NSK L;  1S59 A;  3Q8V A;  2ZUA A;  1XQI A;  2HUR A;  3ENA A;  3PRV A;  3Q8U A;  1NDC A;  3Q8Y A;  4F36 A;  3Q83 A;  1NPK A;  2B8P A;  2B8Q A;  5IOL A;  1HIY A;  1HHQ A;  2BX6 A;  4CP5 A;  3EVO A;  3VGV A;  1BHN A;  4FKX A;  1WKK A;  4HR2 A;  2HVE A;  3R9L A;  1NSQ A;  3FBC A;  1F3F A;  2DY9 A;  1NUE A;  1B99 A;  4WBF A;  3PJ9 A;  3VGS A;  3NGU A;  1UCN A;  4O0N A;  4EK2 A;  4ENO A;  3NGT A;  1NDP A;  3ZTO A;  3FBB A;  3FCV A;  1MN9 A;  3NGR A;  3BH7 B;  3EM1 A;  3B54 A;  4ANE A;  3B6B A;  1WKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...