1RHKB

Crystal structure of the complex of caspase-3 with a phenyl-propyl-ketone inhibitor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
91
structure length
91
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-3
publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 91
sequence length 91
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rhkB00
2C2KB 1BMQB 3R5JB 2HBYB 1RHMB 1IBCB 3IBFB 3EDRB 1RWXB 1RWMB 3D6FB 2HBRB 2CDRB 3QNWB 5K20B 2XYHB 2H4WB 3GJQB 3R7NB 3KJNB 1SC4B 3R6LB 1RE1B 2H51B 2H5IB 1RWNB 1NMEB 3R7BB 2CNKB 4ZVTB 4DCJB 2QL9B 3R6GB 4ZVQB 1QDUB 2XYGB 4DCPB 1I3OB 2QLJB 5IC6B 2C2OB 1QTNB 2CJXB 1RHRB 1RWOB 2QL7B 2DKOB 2CNOB 3R7SB 2H54B 1I51B 3RJMB 1F9EB 4ZVOB 2H48B 2H65B 2CJYB 3GJTB 1RHKB 3GJRB 2QLFB 2XZDB 3NS7B 2C1EB 3KJFB 4ZVUB 2H4YB 4DCOB 3P4UB 2XZTB 1RWPB 5IC4B 1SC3B 2CNNB 3P45B 4ZVSB 1GFWB 4ZVPB 2FQQB 2Y0BB 2HBQB 4JB8B 2C2ZB 3D6MB 4ZVRB 2Y1LB 2C2MB 2XYPB 1SC1B 1PAUB 4LSZB 1RHQB 2CNLB 2P2CB 3GJSB 2H5JB 2HBZB 1RHJB 3EDQB 1PYOB 3D6HB 2QLBB 3KJQB 1RWVB 3IBCB 1RWKB 1ICEB 3SIPB 1RWWB 2QL5B 1RHUB
chains in the Genus database with same CATH superfamily
3B8HA 3JAMU 1CJTA 1KDNA 5H9EJ 2RJZA 2MKYA 5EWEA 1XK8A 1JXEA 4GVBB 3T1HJ 1A7GE 1UVLA 1EIYB 2MKIA 1L3SA 1X4HA 1YKWA 1OJ4A 2XC9A 4ZVTB 1A6LA 4KPYA 1RWOB 1WG4A 3OSPA 4IRCA 3DXBA 2VBYA 3JYTB 1CQMA 5EWFA 4MAKA 2PA3A 4OYBA 4ZVUB 3PJ9A 4CLSA 2HFNA 2BA9A 1BD6A 1MSWD 4PXDA 1RYRA 1Y3KA 3GLJA 3KLIA 4NZ7A 2YY3A 3G82A 1NKCA 1C0UB 2YNFB 1Q8KA 1ZPWX 2YWEA 1FE4A 1YJUA 3SZ2A 2IFXA 5D8HB 1URNA 3SCJE 4ECRA 1NDCA 3WQPA 2EEYA 3RBXA 3CJ2A 3HULA 2AGQA 4B3TF 4RBUA 3G9CA 3D6FB 4N8OA 2KG1A 2JLFA 2QYGA 5J1EA 2F9JA 2DY1A 1S48A 5F0WA 3RB4A 3HK2A 1QJHA 2E1RA 1S10A 4HT5A 2PIIA 4ZVQB 5D6GA 5KG5A 2XS5A 4DFPA 3Q8UA 1R8HA 2OAUA 1QSLA 3TO8A 4GMKA 3AQOA 2P6SA 1O51A 3KDOA 3RJMB 3ONQA 3J7YI 4OV6A 2A2DA 3IGNA 1AXQA 1RB0A 2MDAA 2QIFA 1KRPA 2X1AA 1S12A 5BR8J 4B9TA 3DLGA 3ILJA 5MLCV 4RKUC 3L3CA 2CNNB 3TA2A 5FDLA 4ZVSB 3HFVA 5LJ3Y 4EMDA 3Q23A 1Y3JA 3KLHB 2WONB 1TL4A 4NMXA 2XGPA 4GC6A 2ZJRQ 4WK3A 3TA1A 2IM2A 1EP4B 2CJAA 4M5JA 1YTYA 5L46A 3I0RA 4C3KA 4BLGA 2GAHC 1X4FA 2XMWA 1DBDA 4OZLA 1U6BA 1FJGJ 1Y5IB 2VG5A 4O4GA 1SVDA 1W7WA 4LJMA 1QUVA 1J5OB 2ZZNA 1WOSA 4E98A 2QZ8A 4TY9A 2BUNA 4AYBD 3DHXA 4RBVA 3IGVA 2KT3A 5I42B 3GJQB 1QVFR 4K4YA 2UUWA 2HMIB 5IS2A 2LEBA 2HFSA 2B4PA 2CJXB 2PFFB 2IRUA 2W7PA 5ETNA 4Q43A 2FY8A 2ZOGA 4OX6A 1IN0A 4EGLA 4QIGA 2HKEA 3OFFA 3RAQA 2BX6A 4PG7A 4ECXA 4JYAJ 1REVA 1S0OA 4KH1B 3TZWA 4ES1A 1UVMA 1PYSB 2Y0SD 2WCXA 1FKAF 4ZP9A 3BKFA 2YKAA 4CLLA 3EM1A 4OYPA 5C42A 4X66J 4CO4A 4WIIA 1WHVA 3DOKB 2WSCC 3BR9A 2B7CB 2HHVA 4JV2A 3MEKA 4NCGB 3OR2B 4C0BA 1Q7LB 4N56A 1ULRA 2XSJA 3V4IB 1FXDA 1VYAA 1WF1A 5JXSA 3AOBA 4LF7J 3ZO7A 4Q8FA 4LFCJ 1UW9A 3JTOA 4XDDA 2GZOA 1BQMB 2VHGA 2GMLA 2JFKA 4NRTA 3MM7B 2UUBF 4C11A 1WF2A 3HFZB 3C15A 1IKVB 3GG0A 4UY8T 4IFYB 3C19A 4QPXA 2DPIA 2DY9A 1FRXA 4JUZA 3MFIA 2W1BA 2CJYB 2V8HA 4EUVA 2DIVA 3R2CJ 3WC0A 4CYUA 5F8LA 4M5IA 4KR0B 3CJ3A 4DR3J 3BN4A 2N7CA 1EX8A 5LSOA 1KNZA 2JL9A 1ZAWA 2F5GA 1WC3A 4Z37A 3DLKB 4J9VA 4DV1J 4QYZK 3S7RA 3H2LA 1JKHB 3NGDA 4JP8A 2HNYA 2ZHBA 3W2WA 2LFVA 4ZN1A 1S9GB 1RT1B 5KFTA 4MKVA 3BYRA 1ZPVA 1NLKL 4YN3B 4J5OA 1IR1A 2V9WA 3GYGA 1TFYA 4NA3A 4B9NA 4HDGA 3ET6B 2R7XA 2DYAA 2E7VA 2RDDA 4AL5A 5DDQC 2APOA 3T5HA 4J9SA 2VQFJ 3HMJG 2RKIB 5LM7E 1JLBB 1Y11A 3BGLA 2B5JA 2VFRA 4C8YA 1BWEA 2FVCA 1S77D 1SI9A 3JXOA 4ZPTR 1FD2A 1VC0A 4DI6A 4DCOB 2V2KA 2MGZA 3HKWA 4EWTA 3FUYA 3GIRA 2Q6BA 2MLZA 4UF4A 3P45B 5AE1A 5KFYA 1Q82T 3NWGA 4DUYF 3T1YF 2HBQB 3UDCA 4Y00A 1VLYA 1K0TA 1TVRA 4ZJLA 3V6HA 3OBIA 2UUCF 4LVOP 3GONA 1RT5A 1OMSA 1KOHA 2AX0A 2HIQA 3NGRA 2JVRA 5C7PA 4JI3J 4KH0B 2FGCA 2C28A 1IBCB 3ZZYA 4YB1P 2WBMA 1GXLA 3R27A 5SZTA 3OL7A 2MZ1A 2P9CA 2ZH3A 1NJWA 3SSSA 3IXQA 5C5JA 3Q22A 2LVWA 3J7AN 4ZCKA 3KG1A 1T03A 2E5LF 4ZJQA 4DXLA 4OYZA 1JJ2R 1MWZA 1XQIA 4NCAA 2GFFA 2RQCA 1HNXF 4RW4A 3LQVA 2BOAA 3GCXP 2VL1A 3K5OA 3FNNA 4EEYA 2E29A 3TNVA 4LF2A 4OZ0A 2ZHAA 3NGSA 2Z8QA 2C3PA 4QCLA 2KN4A 5I3UA 2F7VA 2Z58B 3EZ5A 2ZJPQ 1S76D 1V5IB 2YH1A 3I87A 3LGHA 3C2PA 4RW8A 1J27A 4U8VA 3CMAS 5HVGA 5FLXY 1KOOA 3MTJA 4WXOA 2LU1A 3UVJB 1C1BB 3QIPB 2M0GB 4TVAB 3D1QA 4PRFA 1Q1KA 2M8HA 1OYEA 2HHUA 2R2UA 1TKXB 1YJTA 4LRCA 4OI3A 4BWJA 5B09A 3DLEA 4WE1B 3ENQA 2F8MA 2VB6A 2KXNB 1GQEA 1X4EA 4IH7A 4QIWD 1D8ZA 1H72C 3MPWA 4TYBA 2CPZA 3F73A 2FC9A 1N5SA 1HQUA 2RVJA 4LF9J 3KLEB 3RAXA 4HLBA 3CJRA 1IWAA 3SBMA 4DUZJ 2QV6A 1VBKA 4L3KA 2V5HG 4LFAF 3B4MA 4ID5B 5DETA 4CLWA 1ZZFA 4Q5VA 3ENWA 2IMOA 1FDBA 1RTJB 2DXDA 3N28A 2ZVSA 3KK3B 3VAJA 2NYIA 4KC5A 3Q8RB 4DQPA 3OXFA 3MHYA 2HVIA 1LK5A 2QA2A 4Y2KA 3M8QB 5I4MA 5HLFA 4AFFA 2WSEC 4RWWA 2KRRA 5RUBA 3M6XA 2WAQD 2ATCB 3QZ8A 2VJVA 5A0YA 3VF0B 1S0MA 2RUSA 3T5JA 4DV4F 3I56S 5C24B 4R8UA 1HNWJ 3O8WA 4MK8A 9RUBA 5D0HA 5HN0A 3BZQA 4DV2J 1O5JA 2ZEJA 4ECZA 5E3PA 3DRRB 1XMOF 4DV0F 3NOCA 4Q2LA 3GCWP 4TY8A 2PT0A 3EGZA 3PIPQ 2E9ZA 1GK8A 3E3XA 1RLDA 4ECQA 1TELA 3M2VA 4ED1A 5D4NA 3BDPA 4B3MJ 4B9LA 4EZ6A 3BSNA 2VKZG 3JSBA 3DCAA 1N34F 5CABA 2ZKUA 1UL3A 4QOTA 5F3ZA 3O2IA 2CQIA 5DGBA 5KAKA 4R5PA 1FKOB 3A8JA 2GQ2A 2W9CA 5IWAJ 3EXYA 2W2QP 3TEGA 4YFUA 4OHZA 4CO5A 4K4VA 2LXUA 3I31A 7FDRA 1CJVB 1XNQF 1B0VA 5GAEU 1AA1B 5B0FA 4JV1A 2AGPA 3KMQA 4NZ6A 2J6UA 5HO4A 4O0NA 5J2PA 1Z4UA 1U7LA 2CG8A 1P6TA 2MEWA 3AA8A 2QN6B 2RRAA 1RT7A 1CULA 2AEJA 1NAQA 3A12A 1AB8A 3SEOA 3SFUA 2IDLA 3JQKA 1H2TZ 5KFCA 2JNJA 2GS8A 3MEGB 1F3FA 1NK9A 1HFEL 1DQAA 2R7SA 4X62J 3LW5C 5J2QB 1RK8A 1S0NA 4JB8B 3VALA 3BGOP 4YY3F 2Y1LB 3CJKB 1EAYC 1IQZA 2MB0B 4BDPA 4NWBA 3R2DJ 4IRDA 2KDOA 1P1TA 3CIZA 5T14A 4UQTA 3N5BA 5IOLA 2YWFA 1Q95G 5EX3A 2KU7A 4LFBF 3W61A 4A8MP 5IQQA 4LT6A 2JEGA 2ABYA 4WKYA 3DN9A 3TZYA 3AXMA 3TAMB 2RF2A 1XR5A 2DNPA 4MK9A 1LFWA 2KJVA 3EVMA 4NXMF 2W24A 2KM8C 2AQ4A 3ENVA 2PC6A 3NAIA 3LP2A 1VC5A 1TK5A 2XO7A 4DR1F 4F8RA 1DTTA 4RU9A 2QFJA 1FFWB 1WELA 3K5MA 3ILIA 3RB0A 3NCPA 3LGMA 1UJ4A 1R0AA 1RA6A 2HQCA 2XCAA 2VONA 3SCKE 1ZH5A 4RPFA 4ZLJA 4PPZA 3OTOF 3KG4A 1BE4A 4NYPA 4H4KA 1S7IA 2ROGA 3VVUA 4ZVPB 1OWXA 1WJ9A 3MPYA 2HNDB 2Y0BB 3AB2B 1VQYA 1OQ6A 2D9PA 4IO1A 4DHVA 4RR5A 2P9EA 3QRPA 2LDIA 4KKOA 1AROP 2QFIA 3UR0A 1U4BA 2AKWB 1UKUA 2ZOFA 4OYOA 1WSRA 2J76E 3THPA 1UZDA 4MYUA 2HQ3A 3SMZA 2LQ5A 5GMDA 2JJ4D 3OD2A 2XI2A 3KLIB 4CM2A 4XPCA 2FZCB 1S4EA 2E66A 4UOFA 1IKYA 4JI5J 3CCES 3TP2A 4QJVA 4KT0C 3VR1A 3CTRA 5D3GA 5THWA 3PVXA 1K9MT 5EN1A 3D3CJ 4JI1J 3Q0AA 2QL7B 4L3NA 5DQGA 4ZJOA 2B4UA 5ETOA 1FEHA 4DPOA 3TAQA 1VI7A 3HD1A 3SSRA 1SUQA 4M5MA 3W65A 2DCLA 4XPEA 3DNCA 4KIAA 2EW9A 1UA1A 3S6EA 3NLCA 1NO8A 4OYWA 1XJWB 3T41A 3G86A 1N6QA 5HQLA 1GNKA 4PABA 3V81B 3PFEA 1DZ5A 2XI3A 2C2NA 4ZP7A 4HACB 1VRUB 1S72S 2D3ZA 4M5DB 1RZMA 1JLQA 1VQSA 2R7TA 2PD1A 3IBCB 4DL6A 2WB4A 3I4PA 2FVQA 3MGJA 4DL2A 4QW8A 2AEFA 1TZ0A 4CT9A 1YJNS 1LWXA 4G1QB 1NK4A 5LSLA 5CD4A 2FB0A 3R5JB 2JEFA 2OPRA 5CQGA 4O44B 4CI0B 2IJNA 4B9SA 4F25A 3KG0A 4WU3A 5H9FK 2VG6B 3N6NA 4KV8B 4ECYA 2XMKA 1LXNA 1N4LA 1UEUA 2BE2B 2KO1A 2KI2A 4MIWA 2Y9HA 4DX6A 4AL6A 5KFUA 1RGVA 4YR0A 3THVA 1S6QB 1VBYA 4O4GB 1KVKA 3VAFA 5I3QA 3QGIA 3TYTA 4Y0FA 2ZD1B 4DR5F 4AT1B 4RW9A 1YZ7A 3NBPA 4WF9Q 4ZCMA 4F2SA 2MZJA 1TL7B 3M6VA 2C2ZB 2U2FA 2ZM6J 3TARA 1CJUB 1SC1B 3OW2R 4J9QA 4EK2A 4HHUA 1G3OA 1HPZA 3FFIB 3RYLA 4PYAA 2MQLA 2GAGC 4OZ5A 4I68A 3LWLA 4C8KA 5KT6A 2O3DA 4KO0B 2E9TA 4I4BA 3VAGA 5C42B 4F4WA 2NZ4A 1V3RA 3M32A 2DNRA 5IXUA 2HWHA 1HR0J 3U1NA 4G1PA 5KG0A 4ZVFA 3DM2B 5E7OB 2YX1A 5KFRA 3CJ5A 3PHEA 3NWRA 2HPUA 4DV3F 4LRDA 1UVJA 3EZUA 1QAJA 3TX8A 3H90A 2KZMA 1F9EB 2QYCA 2XSJB 1RHKB 1P9YA 3H0PA 5A76A 1VIOA 3SXLA 2ILYA 1N32F 3GIIA 3LTOA 1RAJA 3HZGA 5F0UA 4QQBA 4NYZA 4RW6B 3GSIA 2AP6A 1PYTA 1RTHA 4DMZA 1SH2A 3U27A 3CD7A 1UFLA 2QJ3A 3C15B 1F3VA 3LALA 1HNZJ 5B0EA 3HKZD 5C2GA 4WZMA 4ZVGA 2B9XA 2DO4A 2AJ4A 2F65A 1S1WB 2DR5A 3EUNA 4K2JA 3CCUS 4B3OB 4I6YA 2W2OP 3KHRA 4DUTA 3UO0A 1UPMB 4I64A 3FDSA 3IBFB 4HI1A 5CD4H 1FWLA 3H2VE 2JZ5A 2RB7A 3M30A 2IHR1 4LRBA 4C8ZA 4USKA 5HVFA 1YBUA 4JI8F 2M8DB 2FJBB 5F8GA 4W92B 4USUA 2GIFA 2AU0A 4MKAA 4DR4F 9ATCB 2UXCF 4P6QA 3HPOA 3KUEA 2KYXA 2MZSA 4JI4J 1JQGA 2FZKB 4YHHF 1BY9A 3UI3A 2XMJA 1RT3B 1I6JA 2W9BB 1VQLS 3NG8A 5KT3A 5GAEI 5D15A 3RW6A 2W4PA 2BABA 1FCAA 3W2VA 4FXWA 4PXCA 4O23A 1KVJA 2WOMA 5L38A 2HFUA 2HS0A 1H6KX 2IVMA 3D0HE 3E8OA 4GRSA 4PG4A 2MXYA 4ILRA 1HWIA 1JX4A 1CLFA 1TAQA 2BM1A 4CP5A 3IA0A 1RWKB 3LP1B 2LYVA 2MGZB 3DRPB 3LA0A 4P52A 2B4VA 3VAKA 4DX7A 1Q53A 2BJ1A 3ISND 1U1LA 2YH0A 1G4CA 2KB2A 2NPFA 3RTVA 5D0GA 2KG0A 2CA9A 4WK1A 4RUAA 3ZTPA 2H51B 4X4TA 1LWEA 1S7HA 4OHVA 5K8NA 5E5NA 3PO4A 2FJAB 3I6PA 2AX1A 4B3TJ 4CDIA 4OI0A 1Q4RA 2CWXA 1RT6A 3VCDA 3PY8A 3K57A 1Y7PA 1KKHA 4MK7A 5KG7A 4WFBQ 4PQUA 3W60A 2B51A 4ICLA 3PV8A 2KT5A 1N8RT 3BH7B 1XEZA 4ZCLA 1JB0C 4NL5A 4QBUA 3RB6A 3S1TA 1ZAVA 1TL3B 5DQHA 3J7Z5 1X5PA 5JMNA 1HNIA 5A8WA 1RHJB 1FESA 2M4MA 3BQ1A 4DJBA 3NNHA 4AQYF 3T19A 2QEXS 4F0MA 1X4AA 2FVRA 4CLUA 2V8DA 4HL9A 3TOQA 3UW1A 3QJLA 3NAHA 4GO7X 4QWEA 3QFWA 4RNNA 3NL0A 3N6LA 2YNIA 1NH7A 4MTPA 4URQU 2WBRA 1NMEB 1Z1ZA 4U7UD 2FLPA 3KJVB 1B3TA 4IR1A 4IDKA 3FK4A 3C66A 2JOQA 3M8YA 2DGWA 2J0QD 3BEGB 4XDCA 3W9IA 2QLFB 1FJGF 4KHRA 3A8IA 2H1YA 1VRTA 1FRMA 4OL8A 1YI2S 3N0VA 2ZUGA 3RBDA 2ZH7A 2BQRA 2V4JA 1U0HB 3MM6A 3IS9B 2CWKA 2FTRA 4U8YA 2JDJA 3BS9A 2WVDA 3NGTA 1NPKA 2DR9A 2D74B 5FLXU 4OJ3A 1SCJB 4JYAF 4FYXB 3OVAA 4TU8A 3ZTQA 3J7ZT 4OI2A 2R3VA 4ZITA 5CCMA 3TQEA 2QGFB 3EDRB 2HRTA 2BJEA 5J2NA 3N01A 1VCTA 2O67A 2BQUA 4IQMA 3TVKA 3DRSA 3MURP 3LP0B 3OVSA 3HSGA 2GVDA 4CTAB 3D6TB 2YKMB 5HROA 4KSEB 2AW0A 1JLGB 3NS7B 2UUBJ 4F0HA 2AYBA 4NPOA 5F9NA 1D9FA 3QZ7A 3BGRB 5KFFA 1PGZA 3PYFA 2Z57B 4DX8H 3HF5A 3QYYA 2HYIB 1SV5A 1S1TB 1RTDB 2RRNA 3K5NA 1H38A 1TL5A 4LR9A 1PAUB 1MWYA 2HBZB 2QC3A 3HO1A 1VBZA 4FNHA 2V67A 1H74A 3D0GE 4U95A 4C4WA 1HA1A 5KFHA 3UN3A 4I2QB 5HANA 3T1AA 5F41A 2EK1A 2F9DA 1NH8A 1PBUA 3A3PB 1FTCA 4FS2A 2PGCA 3AFGA 4DR3F 1CPZA 1WC1A 2DR6A 3MMCA 3HVWA 1FK9B 2W4CA 4WFYA 1IJEB 3BSOA 4EZ9A 2XNRA 3CCRS 3IWLA 1B7FA 1HMVB 2H5IB 3GFYA 2RD5C 2Z2LA 4WFNQ 2X3GA 2FUG9 2KFYA 4OX7A 1Q16B 2DKOB 1ELOA 2W8KA 2DD8S 3HVAA 2CQGA 3D0IE 4GVBA 4ED0A 2OPSB 5F8HA 3IO1A 4J9KA 3SSQA 4N5SA 2W9CB 2IY5B 1AZSB 2NSCA 2V50A 1DJ0A 3CC4S 2VICA 3W8GA 3BM7A 3D67A 1HD0A 5KFAA 4C97A 5FD1A 2NCKL 1HLWA 3M2UB 3R5CA 3CF5Q 3IN5A 1B7YB 3JYTA 4YUDA 4QYRA 5J2PB 2VQFF 4A4JA 2R9LA 5D4LA 3O1LA 4MMOA 2ADCA 2V8PA 4M1KA 4DUYJ 2M5YA 5K14B 4F0KA 2MMYA 3BGUA 1C0UA 2DHGA 1NRKA 2CQPA 1PCAA 2YNFA 1LW2B 2E44A 3C8YA 4K7QA 4O3QA 1K73T 4RL1A 2B4OA 1VHIA 3GV5B 4EBEA 5F8IA 2CQ2A 1TFWA 4ZLPA 3M9NB 4ED2A 3IAM9 4DF8A 4J9NA 1F0XA 5CYQB 1YVFA 3HM9A 2FDNA 2BYCA 4MIBA 4NXNF 4DFJA 3MUTP 2K3IA 4LF8J 3FMWA 3CULA 1PIEA 4CLPA 4FVCA 5IM0A 3AAWB 3QATA 2RF2B 1NPPA 3VVTA 2V8GA 4KGZB 4F4XA 3SFGA 4A8YA 3F0NA 2WVEA 3K0JA 4B08A 1HNXJ 3W9JA 1T9TA 4ZIWA 1S59A 3DC2A 2QRRA 4K8RA 5G4DA 2XSFA 3C6TA 1PYOB 2IAJB 4ES3A 1R0AB 3RGIA 4WWSA 4M5NA 2KVIA 4LMZA 4IG3B 3KLHA 1F5CA 2WONA 5KFPA 1BQXA 1VQ6S 3B82A 1IBKJ 5ITHA 2J9DE 2EFOA 3PW7A 2CDRB 2UXBJ 5G0RA 1G2EA 3EZOA 4C7QA 5B0DA 4KBIA 4DPTA 2WVBA 5ETPA 1SKSA 3BO3A 2L9WA 4NLDA 1FWPA 3HT0A 5IC6B 2X51A 1V6HA 1J5OA 2DNNA 4ZVOB 4DZ6A 2IMWP 2OFGX 5I42A 2ZH4A 3MAAB 4NLQA 4RBTA 4YR2A 2OD6A 2FHJD 2DXFA 1ACMB 3LGNA 4EU0A 4FPRA 1HI8A 2QO3A 1XN9A 2L3MA 4AXIA 3M8SA 4JBCA 3HVRA 1VQMS 2FPHX 5DDOC 4LFAJ 1EHWA 4X4RA 2RT3A 2P8IA 2CQ4A 1WORA 1UP1A 5KFDA 3KXDA 3W62A 4C8NA 4BC7A 2RSQA 3VAHA 3MM5B 3M9OB 4DUZF 2ZBRA 3DOKA 2EFPA 3CJSA 4USHA 3CC7S 2OPQA 2RHSB 2UU9J 3K58A 4I6WA 4C8LA 3EJMA 1T9UA 2BV3A 4OX8A 4NCGA 4IRKA 3OR2A 4GKJJ 1UETA 2QL9B 1CSJA 3V4IA 2DTJA 3H98A 8AT1B 4GO5X 1FRJA 3V5RA 1E6VB 1NU4A 2OP5A 2R4FA 3BPSP 5F3TA 1BQMA 3G96A 3MM7A 1OPIA 2KHCA 4ILMA 2OGUA 5HMXA 1IKVA 5CYMA 1VJQA 2PA8D 3G87A 1AW0A 1RSCA 1HNWF 3QGPA 1WNEA 1I94J 2EBGA 3CJTA 3L09A 2D9OA 2IBKA 3ADAC 4DV2F 3WZ0A 4QWAA 1FO1A 3D54A 4V19J 2WVFA 3DLKA 3FZBA 3GIMA 1YK9A 1JKHA 5J1NA 1FKPB 4RW9B 5A8RB 3DI6B 3M4XA 4AL7A 2BJ7A 1U2CA 1S9GA 1SJ4P 3KLFB 4CH1A 1AYEA 1DHMA 5A8KB 5EDWA 2BXJA 2ZZMA 4B3MF 1Q86T 1CJKB 3R5GA 4NE9C 1X31C 1SL0A 1EQ0A 2G2YA 4NLRA 5E0OA 1VC6A 1NSAA 2E5JA 4FXDA 2VFUA 4CZCA 2JFDA 4H54A 2MSSA 3P4UB 1HBUB 3MPDA 3ZTRA 2RKIA 1AUDA 1JLBA 2OEMA 4BHQA 2A6MA 1GFWB 1DARA 1EKSA 3GU0A 1JNZB 4ZVRB 2XMTA 1WHXA 3RG6A 1X4GA 3MR5A 1RADB 1N5VA 2OTJS 1V5VA 4TN2A 1NK7A 1UVNA 3GZ7A 3RRHA 4ZP8A 1EJ7L 3KHHA 4A8FA 2OSRA 4U67Q 4DS4A 4O4RA 2XMAA 2VA3A 4NYOA 3UD5A 3OUYB 2LA4A 1T9YA 1JLCB 5M2RA 1F60B 3ITHB 3JSRA 2XBPA 5K20B 5L9XA 4ZLNA 5HMZA 3FRZA 4S0MA 5L8RC 1U49A 3QT6A 3CCTA 4L72B 1WC6A 2VZ9A 4BS2A 3T9ZA 3J80U 4CO0A 2C1EB 2IM0A 4TKTA 2G1HA 4ED5A 4DL3A 2FJXA 2V69A 2OEKA 2CXEA 2BKOA 2J0XA 2ZE2B 3LANA 2CRLA 2F4FA 3AJ2A 4NMLA 2Z30B 4DLGA 3HD2A 3LPYA 1W2BR 2Y1RI 1VS3A 1TR0A 2D3O1 1RKIA 2HFZA 4PPDA 3IC1A 1LNQA 2V4QA 5DLGA 3UD4P 1W2IA 4Z2XA 1ICEB 5ETMA 5KOXA 3VZHA 2HQFA 3RR7A 1S57A 3KWMA 1TV6B 2QTWA 1F6TA 2HVEA 2YX7A 2AJFE 2G9OA 3BH6B 2LEPA 2XYHB 1NXIA 1K0VA 2ZUAA 4A8SA 1S97A 2A3JA 2LQ9A 3N6MA 4TQRA 1FA0A 1HI0P 3BF4A 2YQ1A 3FSXA 4P2MA 2YWKA 3NCRA 5SUHA 1FNOA 4LVNP 4C3MA 3UVJA 4X2BA 1C1BA 1RTIB 4DN0A 3QIPA 3RB3A 3J81Y 3QAEA 1AUSL 3IBWA 4OX9J 1HW8A 2NR0A 1N48A 2PEBA 3OR1A 3FBEA 5J2MB 3JS9A 1TKXA 4UZBA 4QWDA 4WE1A 2HGMA 1NK5A 5CXTA 4KJIA 2V0NA 1U1OA 4JI5F 1OIAA 3H4BA 4DWIA 2M7SA 5GVQA 4N7TA 3KLEA 2LDYA 5GADU 2CPFA 4JI1F 1NSKL 2YXLA 3OTEA 4OYMA 5DG8A 1NBEB 2P5VA 3PTWA 4EBDA 3CCVS 3IWXA 3KFWX 4ID5A 3UCZP 1LQ9A 5HVHA 4PYDA 1DTQB 3GFHA 1RTJA 1KHWA 2FC8A 3KK3A 5ETKA 1XMBA 5KT5A 2B6AB 5D0EA 2K8GA 4TLQA 3MZIA 5GMEA 4CLTA 2BR0A 3CO9A 2CNKB 3M8QA 3L95X 3DRYA 1CS4B 3GMGA 2CQ1A 2GO9A 4DPXA 4I2PA 3ISNC 5DM6Q 3HHLD 1WG1A 3M1VB 1D09B 4JI2J 1E6YB 2V68A 1KBRA 4LR8A 4URGA 1SB6A 3TA0A 4OI1A 2XNQA 2GMHA 1HBMB 1SH3A 2EPIA 4FYVB 2FQQB 1YJWS 2GMJA 1H2UX 1RAGB 2A18A 4OV1A 3D6MB 3DRRA 4LSNA 3HXMA 3I32A 3GSDA 1DURA 4H4OB 1LXJA 2R7UA 4C98A 1T3OA 3BSAA 1TK8A 3OFEA 4B9UA 4DOZA 2HRYA 2DGXA 5LJ5Y 4IQXA 4DR7J 4A8KA 2W8LA 4NASA 2DVIA 1SC6A 1XC9A 4DQIA 4B9MA 1KHVA 1RHMB 2WSFC 1OY8A 3CD5A 3L7OA 4CH7A 2FVPA 2KHDA 4WCEQ 3T9NA 3CDUA 3V2UC 3UN5A 2ZM6F 1FKOA 2VOOA 4LBIA 2OI2A 1M5OC 4CO3A 2V34A 1ZBTA 4TNOA 1SQGA 2C42A 2PI5A 4OZ1A 1CJVA 1N88A 4RJVA 2CQHA 3L7UA 3DDIA 4J9RA 2W4DA 3H20A 4C48A 3HDSA 4EI2A 3HP6A 5KFNA 1LEOA 1HR0F 1TK0A 4E0DA 1FFGB 2G0IA 1KSPA 2J8AA 4MJKA 4P10A 5CZXA 2VFTA 5KFEA 2QA1A 2P9GA 4OQJA 2AF6A 3RBZA 4WYWA 3MEGA 1QSSA 2L41A 2HQDA 3I9ZA 1R0CB 3UDEA 4DPYA 5J2QA 1N5TA 2QX0A 2AV5A 5IV4A 1ZS6A 2IYGA 5HL7Q 2GA7A 2QLXA 2IDEA 4NLPA 1EQMA 4F3OA 3ELHA 2ZVIA 3PKYA 5CAAA 2RNEA 2F63A 4FKYA 1HNZF 2YPZA 3W5YA 4A8WA 2A6OA 1QDUB 3ULHA 1X0FA 2HWTA 3MCOA 3TAMA 1WEYA 3PRDA 2OKQA 5CHCB 3NMAA 2GV1A 2UXCJ 5IC4B 5IT9Y 1IBLF 4KPCA 2UUTA 3WIVA 4ZPCA 2XLIA 3CW2C 1F2GA 2XMUA 3QO9B 3SV4A 3DOLB 1IVZA 2ZDOA 4LIWA 2C2MB 4X65J 3HI9A 1D9DA 3BBBA 2LQJA 2D69A 4JI4F 3ZZUA 1VOMA 2W01A 2YKPA 3NGUA 3D3BJ 2CQBA 2MZRA 2ZBQA 2ROPA 4UQGA 2E5HA 3G8SA 2HNDA 2OSQA 3T5KA 2CYYA 1G1XA 3PG9A 1RXOB 1JJHA 1T8EA 4DLEA 2YPYA 1N52B 3R9LA 3CC2S 5KG6A 1NHVA 2LXIA 5D78A 1YX2A 2DRDA 4UT4A 5KT7A 2QA4S 3D28A 4P7TA 2VUGA 4RNOA 4F50A 1M5VC 3KJFB 3HHLB 3NMRA 1AFJA 4WPAA 1KVIA 4W90B 3TR5A 2XHCA 5K9FA 4OZ2A 5KFZA 3FZ2A 1U0SA 3BBCA 3OLAA 1SL2A 1RTZA 2ASJA 1I5OB 2JX2A 4LSZB 3EPIA 3M8ZA 2DHHA 5AXMA 4USMA 1OO0B 3U7JA 2BKPA 5IQ6A 5IM0B 5GAGU 1YWXA 1HWJA 2E1MC 3V81A 2R2SA 2DIUA 2K3KA 3U02A 1FJEB 4P2XA 1K1QA 2MQ8A 2DGVA 4HACA 1IUJA 1VRUA 4AQYJ 4M5DA 2HW3A 4ZOSA 3ZXWA 4MH8A 3C6TB 4AD6A 1KTQA 4G1QA 2OMOA 3QSIA 3BQ0A 4E2FB 3N5FA 3R7SB 2G2OA 5M2UA 2EVZA 4PQAA 1JLAB 5B0GA 1YRXA 4O44A 5KG2A 2DPJA 4LF4F 2XMMA 2UV8A 4A8OA 1Q5VA 5LXYA 2Y8WA 1TMJA 1RU1A 2VG6A 3G2XA 4ZDNA 4KV8A 6FDRA 2X3DA 3WX8A 2ZBPA 4OZJA 1N54B 2KM8B 1R6VA 1S99A 2F8EX 2CG4A 5G0RB 4P73A 2BE2A 2DH9A 4O3NA 2IRYA 1FNXH 4OIXA 4J7CA 2K1RB 1U1RA 4LSLA 1MMDA 1S6QA 1GAOA 1R8BA 1DRZA 4PWUA 1UJ6A 1ZTWA 3KUHA 4UY85 2M88A 2WW8A 1W26A 4HTJA 4KQZA 3DFEA 2ZD1A 1XBWA 3ISZA 3ILLA 1HQEB 4DSFA 3SIPB 3CCSS 4ZS6A 1YLXA 2MLXA 1TL7A 1KQFB 1N36J 4K5RA 1CJUA 1JWWA 4DV6J 5A2QY 4PG8A 5GADI 2DNGA 2MZTA 3FFIA 3KNGA 3RU0A 4IH6A 4PUOB 4DR2F 1DLOA 1ZZNA 3N79A 4DCJB 4HH1A 2DBBA 1NUEA 1RHRB 4Z7CA 4KO0A 3LAMA 1RBAA 2N4DA 4G6VB 1N33F 3C3LA 4QYZJ 2XHWA 2BJ3A 3GJTB 3KYLA 3GIKA 5GMKa 4JV0A 4MIAA 4KHPJ 3DM2A 4PAAA 2OPQB 4DF4A 2M3DA 3HSDA 4F4AA 4IG0B 2CKWA 5IV3A 5DM7Q 2HHHF 1S0VA 2JC1A 1SIZA 5E3AA 2YKOA 1YJRA 3G6ES 2R8KA 4RW6A 1M5HA 2C3UA 3RRKA 1QLNA 1F5BA 2GGPB 3MF5A 2BQ3A 4JI0J 1PAEX 2YWGA 1T94A 1KWMA 5CYMB 2ZNYA 1RAAB 1S1WA 2EFVA 2J0WA 3KNAA 1FX4A 2AZ3A 4B3OA 2XCPA 3KLGB 3VGTA 1VQPS 1LW0A 3M6UA 4P75A 4NEZA 5HJYA 3MPUB 2XZDB 4X4OA 4KFBB 3OTDA 5L1IA 5AE2A 3RRGA 2J0SD 1V9OA 2ALYB 3MAQA 4CO2A 2JEJA 4UZCA 4OHYA 4MFBB 3FSIA 3OV7A 4A48A 2J9EA 4JV5J 2B0GA 4ZK7M 1RT3A 2W9BA 1QY7A 2IA6A 3RUBL 2Z4PA 3JB9k 2FZGB 3QT5A 2V2ZA 1FRKA 1FXRA 5U47A 3DOMB 2R42A 4F36A 1RAEB 1P9QC 3SYZA 1LV5A 1QAIA 3CB4A 2NZCA 1UWBB 1XERA 1L3UA 1N5QA 2MHNA 2QT7A 4WU2A 3LP1A 3DRPA 2HHQA 2XYGB 1BQNB 3VQTA 4X4UA 4NRUA 4R25A 4HVZA 2R8JA 1IR0A 4K4WA 5ADZA 3I9V9 2AJQA 3A3NB 2UV8G 3GYNA 4AUKA 1KLMB 2N4CA 3AQPA 3D2WA 4NXNJ 4ZPVR 3AT1B 3P5TL 1NSQA 2LQBA 3OL8A 1FEEA 2NREA 4TYAA 3PCOB 2K7KA 2IPOB 2OPPB 3TRGA 4DQQA 2HK2A 3V6DB 1RJJA 1JLEB 2HNZA 1KC8T 3CCQS 5JJBA 2ZHOA 2ROEA 2C3MA 4ELTA 4ES2A 3GR1A 4LF8F 1RWWB 3AB4B 2I0XA 1NJZA 5L1KA 5DS7A 2HSEB 3AXKA 4H4MB 1TL3A 4PG6A 1RWXB 1NK6A 1R6YA 2DH7A 3NXZA 4CIOA 2EBEA 2NPIA 2E9RX 1MW7A 4G65A 1CVJA 1X7VA 3GFXA 1X5OA 5J1PA 2WVCA 2FHKA 2OH2A 3OXGA 3CT9A 1URRA 1KLNA 3CJ0A 2F1FA 2LLZA 2I5JB 3KJVA 1IBKF 5LT5A 4CLKA 3OL9A 2P6TA 1U45A 2UXBF 4TU9A 4RNHA 1HWLA 1FWKA 3CDWA 3G8QA 1S1UA 1FDAA 1VRQC 3PJXA 4DV5J 4ED6A 3PX6A 1RWVB 3T3FA 2CPJA 2XS7A 3OR1B 4U7CA 1GXUA 1U0HA 3AY0A 4USVA 1SQEA 2RQKA 3IS9A 2W9AA 3HCXA 1QUPA 4USJC 5KG1A 1VLOA 1LK7A 2RQ4A 5HBMB 4HI2A 1RAFB 3UCGA 4IFVB 2EKNA 2PI4A 2ASDA 1EB0A 2XB2D 3R7BB 3LH2S 3J81U 2BRKA 1T0TV 1ZM3A 4ZPWR 4LRAA 1UCNA 1VFJA 1H3DA 3HLUA 1B4SA 1YGYA 4Y2AA 3FSYA 1WKKA 3CPWR 4DSEA 1FNMA 4W98A 3D4JA 2JVOA 3LP0A 4C0HA 1WEXA 1JNRB 1U6FA 3TVZA 2EC2A 2MY8A 4ETXA 2UU9F 4CTAA 1EKRA 4KTQA 2YKMA 5FIIA 4GKJF 1JLGA 4QU6A 2XTJP 2XWYA 3IG1B 1HWUA 2X1FA 3FCVA 5B0BA 4Q45A 1ROFA 3BGRA 1X4CA 4ZPBA 2OMLA 4I2PB 1S1TA 1WD6A 4HHHA 1RTDA 1FT8A 3TUZC 3TVYA 2NXUA 1U2FA 2F4VF 3QWPA 4J91A 2I2YA 1D8YA 3K7RA 3LUYA 4QPTA 3NS6A 3MAHA 4L73A 1ZM2A 3I96A 4LSNB 3BV8A 3R8YA 5DJBA 3D7SB 4I2QA 2B9WA 2AWZA 1A9NB 4DSJA 1I94F 1RA7A 3T5LA 3BYPA 2GNKA 4OMFG 2BJ9A 2HHXA 5C2CA 2WHOA 1FK9A 3TJAA 4NLUA 1HMVA 3OHAA 1WI8A 2B9EA 2GIRA 1GX6A 3D9BA 4B02A 1AT1B 1PSDA 2OPSA 5LMNJ 1AZSA 5KFQA 5HK4A 1KFSA 5E3RA 1T3NA 3POTB 3HHLC 3Q86A 3I0SB 3M2UA 1YITS 4YOEA 3QPIA 4A8QA 5KT2A 2RQMA 3MMAB 1SBRA 1NM2A 2XMVA 3PEHA 3VGVA 1F5AA 5BYSA 3K59A 4C6AA 3FCWA 3KJNB 2ZFHA 1RE1B 4WXWA 3AODA 2LCWA 5K14A 3AJ1A 3P49B 1APSA 3W7BA 1WC5A 3PYGA 2NYHA 3IRXB 4FBTA 1LW2A 2H65B 5DDRC 2VBZA 3MMBA 4BBYA 4X4QA 2LECA 3EGVA 2YQ0A 4EBCA 3RW7A 4YEAA 3RR8A 2XULA 1RAHB 4WJBA 5CYQA 4DQRA 4C8OA 1TL1B 4NI2B 2CNLB 1S4FA 1S1VB 4HEA9 2AHOB 1MWQA 1WKJA 4X4PA 2HHPA 3M2RB 2OD4A 2MHEA 4J9OA 2LKZA 2I8EA 2Z2YB 3QGGA 5T7LB 2BE7D 4FNIA 4F2RA 1H2VZ 2RS2A 2Q43A 2IAJA 5JUMA 5F8JA 2IC3B 4FF3A 4ZPAA 1RWNB 1TUGB 2VBWA 3FVYA 4O3OA 4IG3A 1TTHB 5KFGA 3Q89A 1NK8A 4DCPB 3OVBA 3HHNB 4Y6IA 3EYZA 1I51B 2I1RA 3PR4A 4RWXA 4K0KJ 5IT9U 2RE1A 4OYAA 5ETSA 1YJ9S 3MECB 2MKCA 3W8PA 4FF2A 2C22A 3M8PB 2LQ8A 3CO0P 4OJHA 1L3KA 3UD3P 1SL1A 3MAAA 2DO0A 3V6JA 5EHHA 4C0OC 5KG3A 4DU7A 1H7XA 3KJQB 1PC4A 5H9FJ 3PXGa 4OX9F 4PWDB 1ZM9A 1VGYA 4ZN3A 2VIHA 3G6VA 1LWFB 2VC1A 1BMQB 3AD9C 3LO3A 1K44A 4NCBA 3AH6A 3A13A 4ECTA 1RT2B 5HJXA 1HW9A 2NXNA 2VC0A 3S8SA 3PRVA 4NLYA 3KHGA 3PW2A 1U8SA 1VQOS 3MM5A 2DNYA 4V19X 1KR4A 2WTFA 3PYEA 4J9MA 4MT1A 3GP9A 2CFXA 3FRYA 4RUBA 3R3TA 1X9MA 2VG7B 3ILOA 2VV5A 3TUJC 4CT8A 1N0VC 4RNFA 4I7FB 4NLXA 1E6VA 2D1CA 1M1KT 3UPFA 3IRWP 3FQKA 2ZNZA 3HSZA 4DR6F 2J7KA 4NLWA 1WI6A 3CIMA 1UEVA 3MD3A 5KOWA 2GJFA 2ZKTA 5ETQA 4ITSA 2DNQA 2YNHB 3QJJA 4F02A 4UUWA 1MROB 2DXEA 2HZCA 4JI2F 2E7WA 2GQQA 2KXFA 4ED7A 2OELA 4LSLB 1YJVA 4ID8A 4V1Ak 4LBPA 3H5SA 3D66A 3HHEA 3A8KA 1P27B 1GXTA 1FD8A 3MM8A 5H9EK 1FKPA 5A8RA 3DI6A 1MN9A 2MKSA 4PEOA 2FJVA 4P9SA 2CQ0A 4FKXA 2BW7A 3UDVA 1IM6A 2MSTA 2VH7A 3KLFA 4ECSA 4DR7F 4UOGA 5A8KA 1RABB 1CJKA 1SPBP 2CPEA 4B3RJ 2VPZB 2DGQA 3CDAA 3ETMA 1UMJA 4M5GA 2UP1A 1DLOB 1T11A 2VA2A 2NXCA 4ENOA 2VQEJ 1S49A 1HBUA 2MKKA 1YRTA 4DN9A 3TUPA 1ZM4A 1NNDA 1U1MA 2DJWA 2R7WA 4ELVA 5A2QU 1OY6A 1S6PB 2XO6A 4KAIA 4X4NA 2K2PA 5KFSA 1EZZB 4P2SA 4KB7A 1FXLA 2DEJA 3G8TA 1SJQA 2C3OA 1KEKA 3OQ2A 1C0TA 2Y3YA 2KVQE 3AOAA 4IKAA 3LPEA 3MOZA 1WHYA 2AJ0A 4FF1A 2CNOB 2V94A 4GKKJ 3OUYA 1JLCA 2MZQA 4I0WA 3WX4A 2IA0A 3ITHA 2DH8A 3FEXB 3PJWA 3UQSA 1G7CB 1YBAA 1HYSB 1F9HA 1C4AA 2JHEA 4KRWA 2MQNA 1HD1A 1U6ZA 4AE5A 5FJ4A 1HBNB 1IBLJ 2MLYA 1LW0B 2GIQA 1T95A 1IBMJ 5IT4A 2X1BA 3CE8A 5KTQA 2ZE2A 3D68A 1T05A 5LMUF 2O01C 2VJUA 4Q0BB 1TKZA 2FHJA 2NS1B 3I4HX 2CPHA 2IM3A 5B7WA 1S79A 3NNAA 3GTYX 2EKYA 3OT9A 4M95A 3IAS9 2VPYB 3A4TA 4ED8A 4OLOA 1RI7A 3UE2A 1O6XA 1L3TA 1U1NA 2I6WA 3D5MA 4X65F 1TKTB 3D1HA 2ILZA 1TV6A 4PCQA 4L75A 2AJ2A 3Q2SC 2J6SA 1OS5A 2H4YB 1CC8A 7AT1B 1RLCL 3H8YA 2BE9B 3ZNJ1 1IKXA 1O0PA 3QJPA 2HQIA 4P2FA 1RTIA 2LP4A 1IKWB 2YKNB 5C25B 4IOCQ 3EVOA 1GMWD 3SQGB 2CQDA 2HFVA 1VBXA 2XYPB 3HHKA 5J2MA 3IWNC 1TQLA 3DGPB 4KYZA 3F44A 3OJUA 1YBTA 2GHVC 1IR2A 4KY3A 3CJQA 1FVQA 4F67A 3E01B 2R7VA 2DHSA 4RO0A 1KQSR 3LAKA 2B7BB 2HBRB 3DU5A 1TMMA 3NNCA 4A47A 4F4ZA 4J37A 3ETOA 1JIHA 4WFXA 3QWUA 2O1PA 3O3LA 2FLOA 2HNZB 4JOUA 4U7UK 3H5XA 2UVUA 1DTQA 2LA6A 4LREA 3VAMA 2N7YA 2OHDA 2BKNA 1ZAXA 2B6AA 3WC2A 2A2CA 2BRLA 3UR3C 3HFKA 5L39A 4CH0S 4Y2IA 4FPIA 3BKUA 4NLVA 1QE1B 1CS4A 2GC8A 2I9SA 1M5KC 1R8CA 4LF4J 3CDBA 1T02A 3M1VA 3CWJA 4CLFA 1NPRA 1E6YA 1RCOB 4ER8A 2IM1A 3J7A1 4ZHRB 4FN5A 3HVTB 1S9EB 3A1YG 4FZVA 1HBMA 3FKBA 2J6TA 1FJ7A 3EXCX 1S6OA 3DXSX 1SKRA 1GT8A 2JSXA 4RLEA 4N76A 4H4OA 3ZNUA 2ALZA 3SDEA 1BUXA 3VHQA 2ZC4A 4M5LA 2L9NA 1S1UB 4W4MA 2A1BA 3MOJB 3IM8A 1SKUB 2OEJA 1HI1A 3CXCR 5F9LA 4I67A 4DZDA 2R7OA 5JVGQ 2H54B 2HVDA 1Y9OA 3DHWC 4P7VA 2DNOA 4DR2J 5DZ6A 2VPWB 3IFEA 2XM3A 2OTLS 2J5AA 1N36F 1TP7A 2NQPA 2Z2ZA 4DV6F 2GO8A 3NY0A 3QMQA 1C1CA 2AT1B 4BC9A 4P74A 1N33J 2G13A 4K50A 4A8XA 2PMZD 3MR7A 4HTIA 4QWBA 2JRSA 2PN6A 1KQGB 4JI7J 3FC9A 2XS2A 3EDQB 3HSJA 2FD2A 3MTKA 1VDHA 2CZVC 4HHJA 4NA1A 4QR0A 4KHPF 3MCSA 2HHHJ 4FDFA 1YDLA 2DT9A 3WBZA 4DPUA 5EWGA 1BGXT 1RU2A 2HQGA 4URSA 4ANEA 4DG1B 3CCZA 4I6AA 3M9MB 5D4OA 3FGVA 3AD7C 2IRXA 5HP1B 1GTHA 1X4BA 2COLA 2YX4A 4PR6A 3M05A 3M7VA 4F7VA 1MG7A 3SCLE 2QMWA 4ED3A 2HS4A 4N8NA 3QAUA 3DDNA 1PJ6A 1SJ1A 2XZTB 5B0AA 4R0EA 3FMBA 4JI0F 1FRIA 2DGSA 2L9DA 3HHDA 4ECVA 2C2EA 2XY7A 2Q6CA 3JTNA 4DDFA 4F4YA 3ZC4A 5DG9A 2CJQA 2FHMA 2FLLA 2AD9A 2AJ1A 2L48A 1XMQF 4BWMA 4LQ9A 1NDKA 4NX9A 2CAJA 2OO4A 2DGUA 4OFZA 4K4UA 1NB2A 1DQ9A 1CG2A 2BW2A 1RKJA 1BLUA 3X3UA 1SIWB 1D1UA 4CWBA 3MEDA 3EPGA 3QO9A 3DOLA 1UW4A 2DRAA 2EXUA 1REGX 4LIRA 4Y28C 5HMWA 3OSNA 2JLGA 2JC0A 2CPYA 1PBAA 3QNWB 4CM0A 2J8SA 3BKTA 4AXJA 4JV5F 5KFXA 4FS1A 1P1LA 2E1AA 2RMLA 1R0BG 5HATA 3EGWB 1DY3A 3NKYA 2HZAA 2KYZA 4DL0C 3TZZA 1MU2B 5LSRA 4O3RA 4K4ZA 1U24A 3DYAB 1U8WA 2Z56B 3ZTOA 3KMSA 3EVWA 3G6YA 1VR6A 1XNRF 4C8MA 5DQIA 1EETB 5CZVA 2W2PP 1UVKA 4BCAA 1TUVA 4QIVA 1FX2A 4LF5J 4A46A 4N77A 4DU8A 3QLHB 1VMBA 3HHLA 2FHOB 3C16B 2WZ1A 5ETVA 3SQOP 4RU2A 3R97A 4O3PA 1HHTP 2MTLA 1NDPA 2VASA 1Q8LA 3MMBB 3EICA 2KFZA 2RDIA 1U09A 2W7AA 3IR5B 2V63A 1HNVB 3O44A 1UVIA 2HK3A 5B0CA 2H4WB 3LOUA 4JI6J 7FD1A 2A10A 4CNZA 2H3EB 3AHPA 5K8PA 3ZZ0A 3KK1A 1JK9B 2AEMA 3U1LA 3OLBA 2B56A 1QAYA 2KJWA 1I1GA 1B64A 3IR7B 3BREA 3C14B 2UZAA 2ZH1A 2RILA 4EFAC 3PRBA 1QSYA 3R5BA 1FE0A 4DFMA 4YDDB 1RT4B 2E1PA 8RUCA 3FJ2A 1Q8BA 1JLAA 3CNQP 2JWNA 2OJ3A 3W5ZA 2D3OR 3UDLA 2RRBA 2CQ3A 2GCFA 2BBEA 3Q8SB 4LBHA 3C6UB 5IZHA 3UN2A 4KGKA 4FXVA 1PO6A 3OJSA 2EK6A 1Z2ZA 3MXHP 4DV7J 2K1RA 4Q7AA 2CZ9A 2WK4A 4CNYA 2KL8A 2SXLA 2B3TB 4TLRA 2GVZB 2H9ZA 3IP0A 4RNMA 1QVGR 2HZVA 1NJYA 3JSMB 3M8RA 4DFKA 1XTZA 3KK2B 1HQEA 5LL6d 2AGOA 2BANB 1WF0A 2QLWA 4DV5F 3DMJB 1QAXA 2YNGA 2Q79A 1KD1T 3EX7B 2VODA 3MUVP 4PUOA 2CPDA 3BB5A 1R7IA 3QIDA 4QW9A 4UW2A 1CQNA 1RCXB 2F8HA 4QU7A 3VAIA 1DFDA 1DQ8A 4RUHA 2MYFA 2KFNA 4YP3A 3MD1A 4CCHA 1WOPA 3I55S 1CJTB 2GW8A 3NCQA 2VBXA 2AYEA 1NZ8A 1Y4ZB 5KFIA 4KGMA 3VTIA 2UVWA 5AXLA 3LF0A 3OTCA 3MCNA 3Q8QB 4ETZA 3J81j 2L08A 2MQQA 5BJRA 2DNHA 1WG5A 4IG0A 2VDIA 4LRFA 1DAXA 3JQMA 1RQ0A 4J9PA 3OFHA 4MKBA 3R7NB 2UXDJ 1LKZA 1J5EJ 3PM9A 2BJDA 2F4VJ 3QBCA 4CLZA 2R8HA 1CEZA 2GGPA 2V4RA 1SXLA 5E2QA 4J9LA 5DZ7A 2XGQA 1V3SA 3Q8YA 1NJIT 3G82B 5HAOA 1D3WA 1YQHA 1X9SA 3PO5A 3MUMP 2BACA 3H42A 3KLGA 2V9KA 2N3LA 2DR8A 1VQKS 4FYDA 3ZZOA 2FJDB 4USIA 2R7RA 1KN6A 3GG1A 3T6JA 2ZH5A 2BEFA 3MM8B 1SJFA 5HQMA 5AJ3F 4KFBA 5LXRA 5J1EB 4EO8A 3MWBA 2QMXA 3MDFA 3H5YA 2VFSA 4MFBA 2MJNA 1UFKA 3OL6A 4XIUA 3L7PA 1B70B 3MR2A 1N5YA 4QR1A 3KUGA 3HT3A 2F3JA 3R5DA 2PE8A 1L3VA 2POKA 1D0EA 5LMNF 4U9RA 3DOMA 1GMVA 1PKUA 1YZ6A 2ZC3A 2Q66A 3DLGB 1AFIA 5FDLB 3GFZA 1GEHA 3AA9A 1IM4A 2QE5A 4E8UA 1FFSB 2BMBA 3PYDA 1UWBA 2CPXA 3PX4A 2UUAF 3GJRB 4IUFA 1HIYA 3QGHA 5HI7A 1NK0A 2ASYA 1MLAA 2ZBCA 1BQNA 3I0RB 5DG7A 2N82B 4PWWA 3DLHA 2RU9A 1C0TB 3M6WA 3CCWA 4X4SA 2VG5B 1VHFA 1A0OB 4WP3A 2J7WA 4ZA1A 4ALZA 5DGAA 5E3CA 4EO6A 1KLMA 4X64J 4B17A 5KFVA 5CA5A 1VQ9S 4LF6J 1TKDA 1MMLA 3NOGA 4CRJA 2Y8YA 1BHNA 1RP5A 2E7XA 3MR6A 1R8AA 3C46A 3X1LB 1HBOA 5F8NA 2OPPA 3V6DA 2C2RA 1JLEA 3CUNA 1REVB 3CMQA 1FI4A 3BR8A 2K7JA 4IYQA 2NXEA 1QTNB 4H4MA 1T05B 1TKZB 4ZIVA 2Y1JA 2CZ4A 1WSVA 2R2RA 2CIMA 4L74A 2HS3A 3EMTA 4CQ1A 3B6BA 1Q79A 3FBCA 2CDQA 2PMWA 5BYRA 3I5BA 3W63A 1QD1A 4ZMMA 3THTA 1JLFA 4B3SF 1Y5NB 3CGIA 1KP6A 2OFHX 4DL4A 3GR0A 1U47A 4ED4A 4YR3A 1NKBA 2EFGA 3J80Y 2JLEA 2P2CB 2H5JB 1GTEA 4K4XA 3I82A 3OHBA 3FBBA 3HJFA 2I5JA 1K47A 3KOAA 2DEIA 1NEEA 3BGFA 4KE5A 4C11B 4K0KF 3KLVA 3FCHA 2R7QA 3TQ1A 3GV7B 4J90A 1IKXB 3NP5A 4R0JA 3O6QA 2DB1A 2ZBIA 2HBYB 3TI0A 5LOQA 4MKYA 4K59A 3NRBA 2DGOA 3KKFA 4ZKAA 1VQ8S 1WOOA 4CYUB 2HLUA 4HDHA 3UNGC 4WTOB 1FDDA 1RBLA 3R6GB 2AMCB 3FBFA 4I69A 4DX5A 1NJXA 2FGOA 1B99A 3BSCA 5HBMA 1X60A 4OZNA 4DL5A 1RBOB 1M5PC 2HNYB 3W2WB 4IFVA 1PG5B 4RX6A 4DL7A 1U1QA 1RWUA 4K5SA 3K2YA 5KFWA 4TXSA 4G1IA 5KG4A 3DLLQ 2XEXA 3AJDA 1LFPA 2ZITA 5HSPA 5ETRA 2Z2MA 3VV2B 1H0HB 2ADBA 4C2MA 2CJBA 4DSKA 3PNIA 3CJ8A 3T1HF 1FRLA 2PSZA 2PDAA 2A0FB 4DR6J 1U1PA 3QSYB 2C2KB 3IG1A 4WKRA 2MY7A 2AIRB 2B5JB 3ICLA 1Q7YT 3VWSA 2FVSA 2GQCA 2ZOMA 4OYXA 4ILLA 1T9VA 1JXVA 1ZA2B 3QT7A 1YRUA 3Q8PB 4NLSA 2NSBA 3B78A 4ZVEA 5KFJA 3TWZA 2VU5A 3O5TB 2H48B 4NA2A 3OXLA 4ERDA 2OIHA 1S1XA 5F8MA 3P5BP 1TVRB 4QIEA 3EWGA 2EFQA 3TEHB 3MM9A 1O8BA 2EFNA 2DNMA 2F40A 2WRMA 1UFWA 3SDEB 1RT5B 4DPWA 4LUBA 3VQSA 4YQWA 2PFDA 2DGTA 4ZP6A 1X5SA 4FP9A 3V6KA 2YQ3A 3CD0A 3BO4A 2QLBB 2DRBA 3CSKA 4FYWB 5ETLA 3PW4A 1NHUA 2DNZA 2Z0GA 2QL5B 4ELUA 1RHUB 1T03B 4B3RF 3P96A 3KTQA 1C1CB 4GC7A 4NLOA 2HVZA 1H98A 2ZJQQ 4WP8A 1HQ2A 1YJ7A 3POTA 4KGVB 2GHWA 4FYYB 4RW4B 3I0SA 2VQEF 5L1LA 3H40A 4IO9Q 4DQSA 1B0TA 3PHTA 2Y1IA 3MMAA 1V3ZA 3UNYA 5KFMA 2BVZA 5BR8F 1S9FA 3L9ZA 1F9FA 4RZRA 1VISA 3TJ8A 1S5ZA 4LR7A 2I38A 5I3UB 3TW0A 2M70A 4YMEA 3H4DA 2VF3A 3G6XA 2FLNA 1KQKA 2HHWA 3A8EA 3BDEA 4RW8B 4PKDB 1SKWA 2YTCA 3IRXA 3KHLA 1R89A 1OSDA 2O5DA 4ZVHA 4PXBA 4G3IA 4GKKF 2ZH8A 3GE9A 2IJRA 2E1CA 4Y2CA 3DLEB 2BZ2A 2CJKA 1RAOA 1TL1A 2DISA 4NI2A 4K4TA 2HG4A 1S1VA 1LWCA 4KGXB 2HHSA 1N56A 1VQ7S 2ZWPA 3PR5B 1HQUB 4UTGA 5LMUJ 5CCLA 3R6LB 1VIXA 2NUUG 3DU6A 3M2RA 1WTBA 1RISA 3QRQA 5DDPC 2OLWA 1JJCB 1YHQS 2QLJB 1TUWA 5DRKA 1IBMF 3LWMA 5T7LA 2J7UA 3MEDB 1ZETA 2VOPA 3CD6S 5ETTA 4X66F 2IC3A 3MEEA 4PG5A 2HURA 3TZXA 1WACA 2UVRA 2O66A 1UTAA 3BO2A 3PDNA 5GAHU 4F4KA 5HLFB 3MR3A 1Q0NA 2HFOA 3DRXA 1YSJA 1Y00A 3JSYA 4M8LA 4DEZA 3H5UA 4LF7F 5A0YB 3MECA 4LFCF 2MPUA 3M8PA 1NZAA 1WDDA 2V8VA 3GYXB 4R8UB 1D9AA 3JAMY 3R5AA 2XLJA 2RH3A 5IT0A 1SC4B 4TY8B 1PJ5A 4O3SA 4U96A 2AYGA 2LXFA 8ATCB 4PWDA 4D3GA 1FJCA 3MI7X 2B8QA 5K5MA 4RW7A 1LWFA 1I3OB 3PFOA 3M2VB 2C3YA 3CVKA 3IM9A 2VFVA 2UVVA 2IIHA 4X84A 3P3DA 3Q24A 2MKHA 4DV1F 1X0PA 5DLFA 2B8PA 5L1JA 1RT2A 1VK8A 5T41A 4ECUA 6FD1A 2C2DA 3M8WA 3W66A 2NXJA 3BJYA 1T9WA 2ZH9A 4R5PB 2Q3PA 2CVEA 4M63A 4UUXA 3L4BC 1R31A 1QTMA 3KK1B 1N0UA 1XWLA 2G0JA 2VG7A 4ANCA 2XZWA 1XR7A 2AYMA 4I7FA 4PXEA 2BJ8A 5KFLA 2G1DA 4GVLA 2KZZA 1UJ5A 1RT7B 1CULB 4L6V3 3T1YJ 5KFKA 3ZZZA 3ZZTA 4OLPA 1JJ4A 2YNHA 2KKHA 1GH8A 1MROA 1ZTTA 2UUCJ 1QM9A 5D77A 2HAIA 3ENAA 1F2HA 1FTRA 4OHWA 2HHTA 2R8GA 1SC3B 3Q2TC 2RUGA 1IWGA 4Y2MA 3BBFA 2WB1D 2YBVA 2FYXA 3AD8C 4JI3F 2EG2A 2HIYA 5CH7B 3IMQJ 1ZA1B 4HYKA 2E5LJ 2YNGB 1WUUA 4USWA 3VGSA 2LMIA 4OI4A 2CPIA 4XO0A 3E51A 2QSFA 5AT1B 3QT8A 2ASLA 3LP2B 4J9UE 2JEIA 1HHQA 1DTTB 1VQNS 1G6BA 3Q8VA 2K06A 3TAPA 3PZPA 2PMHA 1VQ5S 3ZZPA 3CEDA 5D0RA 5M2PA 4JI7F 4N41A 1S6PA 4IH5A 4DSLA 2KRBA 6AT1B 3VGUA 3CCJS 2YWWA 2RS8A 1EP4A 2DK2A 1FF2A 2G2ZA 2FIUA 4WZQA 1GMUA 4LF1A 2GX8A 2FJWA 2M52A 3OFGA 4KKOB 2LU2A 4K4SA 2XQCA 2EWHA 5E3QA 4WIQA 5E33A 3OPKA 1RAIB 4IOBA 2E5GA 3PEJA 2VPXB 4HH0A 3TJ9A 1PILA 3N9UC 3Q83A 2EC0A 1FRHA 1FVSA 2Q1LA 2HMIA 4D3HA 1HL6A 2X1GA 1HYSA 4NOHA 1IKYB 1RUSA 4EYHB 2CVIA 1XMQJ 5D3GB 3VZIA 2XG8A 2PEHA 5AXNA 1J2VA 1X4DA 1HBNA 2CJ9A 1SJRA 5EGYA 2HWIA 3EE3A 3WHIA 1IQTA 1BWVA 3V4MA 3B4DA 2DHAA 3B54A 2OUGA 4LF9F 4Q0BA 3GILA 1SUQB 3D1OA 2YKQA 3FEYB 4F26A 5AXKA 1N6QB 4Y3CA 1VJWA 3PIOQ 2J9CA 3QFHA 2V2QA 3QRRA 2RAQA 2QMUB 1ITPA 3TX0A 1N5YB 2H5EA 4XTTA 1RDRA 3PACA 4OJGA 4MYTA 1R27B 1TKTA 1JLQB 4YB5A 2J9DA 2CQCA 1KS2A 3U1MA 2DR7A 1U1KA 1NDLA 2W7OA 2ZWOA 2VD3A 2QG9B 4ZCIA 4ECWA 2E5IA 3S01A 4DV4J 3GJSB 4USTA 2OPRB 3MCMA 2IBOA 2PO4A 4IFYA 1XNRJ 4DBQA 1Q78A 1WWHA 2B9YA 1IJFB 1XMOJ 4DV0J 2FJEB 4Q2MA 1IKWA 2IJFA 2YKNA 5C25A 3K8VA 3SQGA 2W2MP 4CO1A 4P71A 1FERA 1T7PA 3W3SA 1WEZA 4PZVA 2X7IA 4L76A 3DGPA 1Y5LB 1WDTA 1SJ3P 1R43A 3GQCA 4WYLA 4LF5F 1YG0A 4ANDA 1B0PA 1N34J 3E01A 3NBPB 1RT1A 3PX0A 3PKMA 3IR6B 5AE3A 1HBOB 5EUHA 1HPZB 3H2UB 3KDNA 2BDPA 3H25A 3BQ2A 4ZPDA 3ET6A 3R1HA 2KTQA 1K1SA 1PC5A 4NLTA 1XNQJ 3AOCA 4RUCA 2IVYA 3OTBA 5A6WA 2BM0A 4F3QA 1NB7A 4JI6F 2MKJA 3RBEA 4YS2A 1SQFA 3W1YC 4XAKA 1U25A 4OI6A 5IWAF 2U1AA 4F04B 1BC6A 3D6HB 3M32B 2BOPA 1QE1A 2M2BA 4WP9A 2MQOA 5GAHI 3GIJA 1Y10A 1WTFA 2V2VA 3GPAA 4NLGA 3WIUA 3BN7A 1JLFB 1NCLA 2JH3A 2DHXA 2RIJA 3FEZA 4QWCA 5BXIA 1S6UA 3BPDA 4ZHRA 3HVTA 1S9EA 4YY3J 4WFZA 2RU3A 4YB6A 1U02A 2C2OB 2GHPA 1U26A 4M94A 1RTHB 3H59A 2ATLA 2N3OA 4ATNA 5IFMA 4X62F 4LFBJ 4DV7F 4X4VA 2FY1A 2ZH6A 4FF4A 1NKEA 2YWHA 1LOUA 4M5KA 4EYIB 2D3UA 1TU0B 2WW4A 4I56A 2XY5A 4NXMJ 3SV3A 1RYSA 1ZYQA 4YB7A 4M5HA 2QSWA 4Q8EA 4DR1J 3M30B 1Q8IA 5HMYA 2V6AA 4IOAQ 5GAGI 2D41A 5JVHQ 3OTOJ 4XK8C 4FVMA 4QR2A 1Z2LA 1CBKA 1OSCA 5K8OA 4TQSA 3J7YU 3PW0A 3N4WA 3W2VB 3GB0A 3DLJA 2WOMB 4OZ3A 4TU7A 3TUIC 1M90T 4F3MA 2XWXA 5K8MA 2HVHA 1OQ3A 1U48A 2GJ2A 2HGLA 3K5PA 4DG1A 2D7SA 1JXLA 5HQ8A 1TAUA 1WC4A 5HP1A 2VDHA 5KT4A 1KTVA 5E41A 4I1TA 4HT7A 2UXDF 2MJUA 2HGNA 1J5EF 3QQCD 3NEKA 4C3LA 1OPZA 1HARA 4WTYA 1RACB 2DNLA 5KFBA 1M0SA 4FBUA 2MQMA 3K17A 3CDEA 1UA0A 2DITA 4QZVB 4YDXA 3H7HB 1M5SA 1S1XB 1LWEB 1Q81T 2DCUB 1HHSA 3MM9B 2RDJA 5KFOA 4Y65A 2NUHA 5AJ3J 4NEYA 1GMWA 3ZTSA 1RT6B 3F56A 1M1HA 1YIJS 1KFDA 1X5TA 3UFCX 4PQUB 3NGKA 4ICLB 3K89A 1Q5YA 3W5XA 3CCLS 1P8GA 2HAFA 3SCIE 3W9HA 4WBFA 5L9NA 1MNEA 1K8AT 3I5AA 1PJ7A 2VKRA 3ZFVA 2R2TA 2EI5A 1HNIB 1X8DA 4LQ3A 5A8WB 3RAMA 3FQLA 1XR6A 2QA4G 3T6BA 3W64A 4DSIA 1VQ4S 1UZHA 3HJVA 1UAWA 3K8WA 3CJ4A 2UUAJ 1H73A 1MU2A 1OYDA 1RHQB 3DGVA 5DO2A 1C4CA 2RHQB 3SI8A 2GJIA 3DYAA 5C24A 2YNIB 2CUYA 3K5LA 3PW5A 3TANA 4UOHA 1SH0A 4U6PA 1EETA 4OHXA 3DLBA 4IDKB 1U2RA 3P8BB 2HRUA 4HKQA 3HX9A 3A3OB 3QLHA 4DR5J 2KH9A 1UEKA 3DKDA 1RWMB 3C16A 5H1SV 2ZH2A 3RZAA 2KT2A 1MMNA 3E2EA 1XIQA 3DDKA 4UOCA 1VRTB 3MFHA 4C9DA 4QIFA 3R1LA 2AZ1A 3MMJA 5BYQA 1NSPA 1W25A 1L5UA 1HNVA 5CYJA 5B08A 3UCUP 1WHWA 2V4JB 1KONA 3MM6B 4X64F 2ZDPA 3G71S 1Y0HA 1EARA 2IYIA 4LF6F 2M9KA 4DS5A 4O0IA 2XY6A 5MAOA 2KXHA 1RWPB 1HKAA 1LWCB 4CLYA 2ACMA 2MQPA 3UWTA 3JQJA 1BXNA 4P72A 3JTPA 1F1BB 2XLKA 4IR9A 3C14A 3WDOA 1IXKA 1C2PA 2EG1A 3MPVA 4DV3J 1NHKL 1X9WA 1MN7A 1JMTA 2NLWA 2LEAA 4B3SJ 1R3NA 4N47A 4WFAQ 3MEEB 2DNKA 5J2NB 2W2NP 1RT4A 2HLTA 2W25A 3DRSB 2IVFB 3ZZRA 2G4BA 1WKLA 2G0CA 4Y34A 4B9VA 1N32J 3F41A 2ACYA 2YVSA 3P6YC 4ZLLA 1M1GA 5I3PA 2GVDB 5HROB 3I5CA 3C6UA 2R8IA 3CMES 3US5A 1CC7A 5EX0A 1FDNA 1SV5B 3CJKA 2B43A 1T9XA 4HR2A 4K2XA 2GVZA 1HWKA 3JSMA 1ZOTA 5A6PA 1UPPA 3EGNA 4NZ0A 1OY9A 4Q44A 3CCMS 2ZZTA 5D4PA 1UWAA 3KK2A 1WC0A 1R8PA 4KHMA 2BANA 4OYIA 2ERRA 1H7WA 3DMJA 4H4KC 4JI8J 3NS5A 4RW7B 1FHTA 3G4SS 1GX5A 4DR4J 4Z7YA 3MMCB 3HZEA 1VK3A 3GV8B 4OJ1A 4YHHJ 2CADA 2HEKA 3GWCA
chains in the Genus database with same CATH topology
2C2KB 1BMQB 3R5JB 2HBYB 1RHMB 1IBCB 3IBFB 3EDRB 1RWXB 1RWMB 3D6FB 2HBRB 2CDRB 3QNWB 5K20B 2XYHB 2H4WB 3GJQB 3R7NB 3KJNB 1SC4B 3R6LB 1RE1B 2H51B 2H5IB 1RWNB 1NMEB 3R7BB 2CNKB 4ZVTB 4DCJB 2QL9B 3R6GB 4ZVQB 1QDUB 2XYGB 4DCPB 1I3OB 2QLJB 5IC6B 2C2OB 1QTNB 2CJXB 1RHRB 1RWOB 2QL7B 2DKOB 2CNOB 3R7SB 2H54B 1I51B 3RJMB 1F9EB 4ZVOB 2H48B 2H65B 2CJYB 3GJTB 1RHKB 3GJRB 2QLFB 2XZDB 3NS7B 2C1EB 3KJFB 4ZVUB 2H4YB 4DCOB 3P4UB 2XZTB 1RWPB 5IC4B 1SC3B 2CNNB 3P45B 4ZVSB 1GFWB 4ZVPB 2FQQB 2Y0BB 2HBQB 4JB8B 2C2ZB 3D6MB 4ZVRB 2Y1LB 2C2MB 2XYPB 1SC1B 1PAUB 4LSZB 1RHQB 2CNLB 2P2CB 3GJSB 2H5JB 2HBZB 1RHJB 3EDQB 1PYOB 3D6HB 2QLBB 3KJQB 1RWVB 3IBCB 1RWKB 1ICEB 3SIPB 1RWWB 2QL5B 1RHUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2K B;  1BMQ B;  3R5J B;  2HBY B;  1RHM B;  1IBC B;  3IBF B;  3EDR B;  1RWX B;  1RWM B;  3D6F B;  2HBR B;  2CDR B;  3QNW B;  5K20 B;  2XYH B;  2H4W B;  3GJQ B;  3R7N B;  3KJN B;  1SC4 B;  3R6L B;  1RE1 B;  2H51 B;  2H5I B;  1RWN B;  1NME B;  3R7B B;  2CNK B;  4ZVT B;  4DCJ B;  2QL9 B;  3R6G B;  4ZVQ B;  1QDU B;  2XYG B;  4DCP B;  1I3O B;  2QLJ B;  5IC6 B;  2C2O B;  1QTN B;  2CJX B;  1RHR B;  1RWO B;  2QL7 B;  2DKO B;  2CNO B;  3R7S B;  2H54 B;  1I51 B;  3RJM B;  1F9E B;  4ZVO B;  2H48 B;  2H65 B;  2CJY B;  3GJT B;  1RHK B;  3GJR B;  2QLF B;  2XZD B;  3NS7 B;  2C1E B;  3KJF B;  4ZVU B;  2H4Y B;  4DCO B;  3P4U B;  2XZT B;  1RWP B;  5IC4 B;  1SC3 B;  2CNN B;  3P45 B;  4ZVS B;  1GFW B;  4ZVP B;  2FQQ B;  2Y0B B;  2HBQ B;  4JB8 B;  2C2Z B;  3D6M B;  4ZVR B;  2Y1L B;  2C2M B;  2XYP B;  1SC1 B;  1PAU B;  4LSZ B;  1RHQ B;  2CNL B;  2P2C B;  3GJS B;  2H5J B;  2HBZ B;  1RHJ B;  3EDQ B;  1PYO B;  3D6H B;  2QLB B;  3KJQ B;  1RWV B;  3IBC B;  1RWK B;  1ICE B;  3SIP B;  1RWW B;  2QL5 B;  1RHU B; 
#chains in the Genus database with same CATH topology
 3B8H A;  3JAM U;  1CJT A;  1KDN A;  5H9E J;  2RJZ A;  2MKY A;  5EWE A;  1XK8 A;  1JXE A;  4GVB B;  3T1H J;  1A7G E;  1UVL A;  1EIY B;  2MKI A;  1L3S A;  1X4H A;  1YKW A;  1OJ4 A;  2XC9 A;  4ZVT B;  1A6L A;  4KPY A;  1RWO B;  1WG4 A;  3OSP A;  4IRC A;  3DXB A;  2VBY A;  3JYT B;  1CQM A;  5EWF A;  4MAK A;  2PA3 A;  4OYB A;  4ZVU B;  3PJ9 A;  4CLS A;  2HFN A;  2BA9 A;  1BD6 A;  1MSW D;  4PXD A;  1RYR A;  1Y3K A;  3GLJ A;  3KLI A;  4NZ7 A;  2YY3 A;  3G82 A;  1NKC A;  1C0U B;  2YNF B;  1Q8K A;  1ZPW X;  2YWE A;  1FE4 A;  1YJU A;  3SZ2 A;  2IFX A;  5D8H B;  1URN A;  3SCJ E;  4ECR A;  1NDC A;  3WQP A;  2EEY A;  3RBX A;  3CJ2 A;  3HUL A;  2AGQ A;  4B3T F;  4RBU A;  3G9C A;  3D6F B;  4N8O A;  2KG1 A;  2JLF A;  2QYG A;  5J1E A;  2F9J A;  2DY1 A;  1S48 A;  5F0W A;  3RB4 A;  3HK2 A;  1QJH A;  2E1R A;  1S10 A;  4HT5 A;  2PII A;  4ZVQ B;  5D6G A;  5KG5 A;  2XS5 A;  4DFP A;  3Q8U A;  1R8H A;  2OAU A;  1QSL A;  3TO8 A;  4GMK A;  3AQO A;  2P6S A;  1O51 A;  3KDO A;  3RJM B;  3ONQ A;  3J7Y I;  4OV6 A;  2A2D A;  3IGN A;  1AXQ A;  1RB0 A;  2MDA A;  2QIF A;  1KRP A;  2X1A A;  1S12 A;  5BR8 J;  4B9T A;  3DLG A;  3ILJ A;  5MLC V;  4RKU C;  3L3C A;  2CNN B;  3TA2 A;  5FDL A;  4ZVS B;  3HFV A;  5LJ3 Y;  4EMD A;  3Q23 A;  1Y3J A;  3KLH B;  2WON B;  1TL4 A;  4NMX A;  2XGP A;  4GC6 A;  2ZJR Q;  4WK3 A;  3TA1 A;  2IM2 A;  1EP4 B;  2CJA A;  4M5J A;  1YTY A;  5L46 A;  3I0R A;  4C3K A;  4BLG A;  2GAH C;  1X4F A;  2XMW A;  1DBD A;  4OZL A;  1U6B A;  1FJG J;  1Y5I B;  2VG5 A;  4O4G A;  1SVD A;  1W7W A;  4LJM A;  1QUV A;  1J5O B;  2ZZN A;  1WOS A;  4E98 A;  2QZ8 A;  4TY9 A;  2BUN A;  4AYB D;  3DHX A;  4RBV A;  3IGV A;  2KT3 A;  5I42 B;  3GJQ B;  1QVF R;  4K4Y A;  2UUW A;  2HMI B;  5IS2 A;  2LEB A;  2HFS A;  2B4P A;  2CJX B;  2PFF B;  2IRU A;  2W7P A;  5ETN A;  4Q43 A;  2FY8 A;  2ZOG A;  4OX6 A;  1IN0 A;  4EGL A;  4QIG A;  2HKE A;  3OFF A;  3RAQ A;  2BX6 A;  4PG7 A;  4ECX A;  4JYA J;  1REV A;  1S0O A;  4KH1 B;  3TZW A;  4ES1 A;  1UVM A;  1PYS B;  2Y0S D;  2WCX A;  1FKA F;  4ZP9 A;  3BKF A;  2YKA A;  4CLL A;  3EM1 A;  4OYP A;  5C42 A;  4X66 J;  4CO4 A;  4WII A;  1WHV A;  3DOK B;  2WSC C;  3BR9 A;  2B7C B;  2HHV A;  4JV2 A;  3MEK A;  4NCG B;  3OR2 B;  4C0B A;  1Q7L B;  4N56 A;  1ULR A;  2XSJ A;  3V4I B;  1FXD A;  1VYA A;  1WF1 A;  5JXS A;  3AOB A;  4LF7 J;  3ZO7 A;  4Q8F A;  4LFC J;  1UW9 A;  3JTO A;  4XDD A;  2GZO A;  1BQM B;  2VHG A;  2GML A;  2JFK A;  4NRT A;  3MM7 B;  2UUB F;  4C11 A;  1WF2 A;  3HFZ B;  3C15 A;  1IKV B;  3GG0 A;  4UY8 T;  4IFY B;  3C19 A;  4QPX A;  2DPI A;  2DY9 A;  1FRX A;  4JUZ A;  3MFI A;  2W1B A;  2CJY B;  2V8H A;  4EUV A;  2DIV A;  3R2C J;  3WC0 A;  4CYU A;  5F8L A;  4M5I A;  4KR0 B;  3CJ3 A;  4DR3 J;  3BN4 A;  2N7C A;  1EX8 A;  5LSO A;  1KNZ A;  2JL9 A;  1ZAW A;  2F5G A;  1WC3 A;  4Z37 A;  3DLK B;  4J9V A;  4DV1 J;  4QYZ K;  3S7R A;  3H2L A;  1JKH B;  3NGD A;  4JP8 A;  2HNY A;  2ZHB A;  3W2W A;  2LFV A;  4ZN1 A;  1S9G B;  1RT1 B;  5KFT A;  4MKV A;  3BYR A;  1ZPV A;  1NLK L;  4YN3 B;  4J5O A;  1IR1 A;  2V9W A;  3GYG A;  1TFY A;  4NA3 A;  4B9N A;  4HDG A;  3ET6 B;  2R7X A;  2DYA A;  2E7V A;  2RDD A;  4AL5 A;  5DDQ C;  2APO A;  3T5H A;  4J9S A;  2VQF J;  3HMJ G;  2RKI B;  5LM7 E;  1JLB B;  1Y11 A;  3BGL A;  2B5J A;  2VFR A;  4C8Y A;  1BWE A;  2FVC A;  1S77 D;  1SI9 A;  3JXO A;  4ZPT R;  1FD2 A;  1VC0 A;  4DI6 A;  4DCO B;  2V2K A;  2MGZ A;  3HKW A;  4EWT A;  3FUY A;  3GIR A;  2Q6B A;  2MLZ A;  4UF4 A;  3P45 B;  5AE1 A;  5KFY A;  1Q82 T;  3NWG A;  4DUY F;  3T1Y F;  2HBQ B;  3UDC A;  4Y00 A;  1VLY A;  1K0T A;  1TVR A;  4ZJL A;  3V6H A;  3OBI A;  2UUC F;  4LVO P;  3GON A;  1RT5 A;  1OMS A;  1KOH A;  2AX0 A;  2HIQ A;  3NGR A;  2JVR A;  5C7P A;  4JI3 J;  4KH0 B;  2FGC A;  2C28 A;  1IBC B;  3ZZY A;  4YB1 P;  2WBM A;  1GXL A;  3R27 A;  5SZT A;  3OL7 A;  2MZ1 A;  2P9C A;  2ZH3 A;  1NJW A;  3SSS A;  3IXQ A;  5C5J A;  3Q22 A;  2LVW A;  3J7A N;  4ZCK A;  3KG1 A;  1T03 A;  2E5L F;  4ZJQ A;  4DXL A;  4OYZ A;  1JJ2 R;  1MWZ A;  1XQI A;  4NCA A;  2GFF A;  2RQC A;  1HNX F;  4RW4 A;  3LQV A;  2BOA A;  3GCX P;  2VL1 A;  3K5O A;  3FNN A;  4EEY A;  2E29 A;  3TNV A;  4LF2 A;  4OZ0 A;  2ZHA A;  3NGS A;  2Z8Q A;  2C3P A;  4QCL A;  2KN4 A;  5I3U A;  2F7V A;  2Z58 B;  3EZ5 A;  2ZJP Q;  1S76 D;  1V5I B;  2YH1 A;  3I87 A;  3LGH A;  3C2P A;  4RW8 A;  1J27 A;  4U8V A;  3CMA S;  5HVG A;  5FLX Y;  1KOO A;  3MTJ A;  4WXO A;  2LU1 A;  3UVJ B;  1C1B B;  3QIP B;  2M0G B;  4TVA B;  3D1Q A;  4PRF A;  1Q1K A;  2M8H A;  1OYE A;  2HHU A;  2R2U A;  1TKX B;  1YJT A;  4LRC A;  4OI3 A;  4BWJ A;  5B09 A;  3DLE A;  4WE1 B;  3ENQ A;  2F8M A;  2VB6 A;  2KXN B;  1GQE A;  1X4E A;  4IH7 A;  4QIW D;  1D8Z A;  1H72 C;  3MPW A;  4TYB A;  2CPZ A;  3F73 A;  2FC9 A;  1N5S A;  1HQU A;  2RVJ A;  4LF9 J;  3KLE B;  3RAX A;  4HLB A;  3CJR A;  1IWA A;  3SBM A;  4DUZ J;  2QV6 A;  1VBK A;  4L3K A;  2V5H G;  4LFA F;  3B4M A;  4ID5 B;  5DET A;  4CLW A;  1ZZF A;  4Q5V A;  3ENW A;  2IMO A;  1FDB A;  1RTJ B;  2DXD A;  3N28 A;  2ZVS A;  3KK3 B;  3VAJ A;  2NYI A;  4KC5 A;  3Q8R B;  4DQP A;  3OXF A;  3MHY A;  2HVI A;  1LK5 A;  2QA2 A;  4Y2K A;  3M8Q B;  5I4M A;  5HLF A;  4AFF A;  2WSE C;  4RWW A;  2KRR A;  5RUB A;  3M6X A;  2WAQ D;  2ATC B;  3QZ8 A;  2VJV A;  5A0Y A;  3VF0 B;  1S0M A;  2RUS A;  3T5J A;  4DV4 F;  3I56 S;  5C24 B;  4R8U A;  1HNW J;  3O8W A;  4MK8 A;  9RUB A;  5D0H A;  5HN0 A;  3BZQ A;  4DV2 J;  1O5J A;  2ZEJ A;  4ECZ A;  5E3P A;  3DRR B;  1XMO F;  4DV0 F;  3NOC A;  4Q2L A;  3GCW P;  4TY8 A;  2PT0 A;  3EGZ A;  3PIP Q;  2E9Z A;  1GK8 A;  3E3X A;  1RLD A;  4ECQ A;  1TEL A;  3M2V A;  4ED1 A;  5D4N A;  3BDP A;  4B3M J;  4B9L A;  4EZ6 A;  3BSN A;  2VKZ G;  3JSB A;  3DCA A;  1N34 F;  5CAB A;  2ZKU A;  1UL3 A;  4QOT A;  5F3Z A;  3O2I A;  2CQI A;  5DGB A;  5KAK A;  4R5P A;  1FKO B;  3A8J A;  2GQ2 A;  2W9C A;  5IWA J;  3EXY A;  2W2Q P;  3TEG A;  4YFU A;  4OHZ A;  4CO5 A;  4K4V A;  2LXU A;  3I31 A;  7FDR A;  1CJV B;  1XNQ F;  1B0V A;  5GAE U;  1AA1 B;  5B0F A;  4JV1 A;  2AGP A;  3KMQ A;  4NZ6 A;  2J6U A;  5HO4 A;  4O0N A;  5J2P A;  1Z4U A;  1U7L A;  2CG8 A;  1P6T A;  2MEW A;  3AA8 A;  2QN6 B;  2RRA A;  1RT7 A;  1CUL A;  2AEJ A;  1NAQ A;  3A12 A;  1AB8 A;  3SEO A;  3SFU A;  2IDL A;  3JQK A;  1H2T Z;  5KFC A;  2JNJ A;  2GS8 A;  3MEG B;  1F3F A;  1NK9 A;  1HFE L;  1DQA A;  2R7S A;  4X62 J;  3LW5 C;  5J2Q B;  1RK8 A;  1S0N A;  4JB8 B;  3VAL A;  3BGO P;  4YY3 F;  2Y1L B;  3CJK B;  1EAY C;  1IQZ A;  2MB0 B;  4BDP A;  4NWB A;  3R2D J;  4IRD A;  2KDO A;  1P1T A;  3CIZ A;  5T14 A;  4UQT A;  3N5B A;  5IOL A;  2YWF A;  1Q95 G;  5EX3 A;  2KU7 A;  4LFB F;  3W61 A;  4A8M P;  5IQQ A;  4LT6 A;  2JEG A;  2ABY A;  4WKY A;  3DN9 A;  3TZY A;  3AXM A;  3TAM B;  2RF2 A;  1XR5 A;  2DNP A;  4MK9 A;  1LFW A;  2KJV A;  3EVM A;  4NXM F;  2W24 A;  2KM8 C;  2AQ4 A;  3ENV A;  2PC6 A;  3NAI A;  3LP2 A;  1VC5 A;  1TK5 A;  2XO7 A;  4DR1 F;  4F8R A;  1DTT A;  4RU9 A;  2QFJ A;  1FFW B;  1WEL A;  3K5M A;  3ILI A;  3RB0 A;  3NCP A;  3LGM A;  1UJ4 A;  1R0A A;  1RA6 A;  2HQC A;  2XCA A;  2VON A;  3SCK E;  1ZH5 A;  4RPF A;  4ZLJ A;  4PPZ A;  3OTO F;  3KG4 A;  1BE4 A;  4NYP A;  4H4K A;  1S7I A;  2ROG A;  3VVU A;  4ZVP B;  1OWX A;  1WJ9 A;  3MPY A;  2HND B;  2Y0B B;  3AB2 B;  1VQY A;  1OQ6 A;  2D9P A;  4IO1 A;  4DHV A;  4RR5 A;  2P9E A;  3QRP A;  2LDI A;  4KKO A;  1ARO P;  2QFI A;  3UR0 A;  1U4B A;  2AKW B;  1UKU A;  2ZOF A;  4OYO A;  1WSR A;  2J76 E;  3THP A;  1UZD A;  4MYU A;  2HQ3 A;  3SMZ A;  2LQ5 A;  5GMD A;  2JJ4 D;  3OD2 A;  2XI2 A;  3KLI B;  4CM2 A;  4XPC A;  2FZC B;  1S4E A;  2E66 A;  4UOF A;  1IKY A;  4JI5 J;  3CCE S;  3TP2 A;  4QJV A;  4KT0 C;  3VR1 A;  3CTR A;  5D3G A;  5THW A;  3PVX A;  1K9M T;  5EN1 A;  3D3C J;  4JI1 J;  3Q0A A;  2QL7 B;  4L3N A;  5DQG A;  4ZJO A;  2B4U A;  5ETO A;  1FEH A;  4DPO A;  3TAQ A;  1VI7 A;  3HD1 A;  3SSR A;  1SUQ A;  4M5M A;  3W65 A;  2DCL A;  4XPE A;  3DNC A;  4KIA A;  2EW9 A;  1UA1 A;  3S6E A;  3NLC A;  1NO8 A;  4OYW A;  1XJW B;  3T41 A;  3G86 A;  1N6Q A;  5HQL A;  1GNK A;  4PAB A;  3V81 B;  3PFE A;  1DZ5 A;  2XI3 A;  2C2N A;  4ZP7 A;  4HAC B;  1VRU B;  1S72 S;  2D3Z A;  4M5D B;  1RZM A;  1JLQ A;  1VQS A;  2R7T A;  2PD1 A;  3IBC B;  4DL6 A;  2WB4 A;  3I4P A;  2FVQ A;  3MGJ A;  4DL2 A;  4QW8 A;  2AEF A;  1TZ0 A;  4CT9 A;  1YJN S;  1LWX A;  4G1Q B;  1NK4 A;  5LSL A;  5CD4 A;  2FB0 A;  3R5J B;  2JEF A;  2OPR A;  5CQG A;  4O44 B;  4CI0 B;  2IJN A;  4B9S A;  4F25 A;  3KG0 A;  4WU3 A;  5H9F K;  2VG6 B;  3N6N A;  4KV8 B;  4ECY A;  2XMK A;  1LXN A;  1N4L A;  1UEU A;  2BE2 B;  2KO1 A;  2KI2 A;  4MIW A;  2Y9H A;  4DX6 A;  4AL6 A;  5KFU A;  1RGV A;  4YR0 A;  3THV A;  1S6Q B;  1VBY A;  4O4G B;  1KVK A;  3VAF A;  5I3Q A;  3QGI A;  3TYT A;  4Y0F A;  2ZD1 B;  4DR5 F;  4AT1 B;  4RW9 A;  1YZ7 A;  3NBP A;  4WF9 Q;  4ZCM A;  4F2S A;  2MZJ A;  1TL7 B;  3M6V A;  2C2Z B;  2U2F A;  2ZM6 J;  3TAR A;  1CJU B;  1SC1 B;  3OW2 R;  4J9Q A;  4EK2 A;  4HHU A;  1G3O A;  1HPZ A;  3FFI B;  3RYL A;  4PYA A;  2MQL A;  2GAG C;  4OZ5 A;  4I68 A;  3LWL A;  4C8K A;  5KT6 A;  2O3D A;  4KO0 B;  2E9T A;  4I4B A;  3VAG A;  5C42 B;  4F4W A;  2NZ4 A;  1V3R A;  3M32 A;  2DNR A;  5IXU A;  2HWH A;  1HR0 J;  3U1N A;  4G1P A;  5KG0 A;  4ZVF A;  3DM2 B;  5E7O B;  2YX1 A;  5KFR A;  3CJ5 A;  3PHE A;  3NWR A;  2HPU A;  4DV3 F;  4LRD A;  1UVJ A;  3EZU A;  1QAJ A;  3TX8 A;  3H90 A;  2KZM A;  1F9E B;  2QYC A;  2XSJ B;  1RHK B;  1P9Y A;  3H0P A;  5A76 A;  1VIO A;  3SXL A;  2ILY A;  1N32 F;  3GII A;  3LTO A;  1RAJ A;  3HZG A;  5F0U A;  4QQB A;  4NYZ A;  4RW6 B;  3GSI A;  2AP6 A;  1PYT A;  1RTH A;  4DMZ A;  1SH2 A;  3U27 A;  3CD7 A;  1UFL A;  2QJ3 A;  3C15 B;  1F3V A;  3LAL A;  1HNZ J;  5B0E A;  3HKZ D;  5C2G A;  4WZM A;  4ZVG A;  2B9X A;  2DO4 A;  2AJ4 A;  2F65 A;  1S1W B;  2DR5 A;  3EUN A;  4K2J A;  3CCU S;  4B3O B;  4I6Y A;  2W2O P;  3KHR A;  4DUT A;  3UO0 A;  1UPM B;  4I64 A;  3FDS A;  3IBF B;  4HI1 A;  5CD4 H;  1FWL A;  3H2V E;  2JZ5 A;  2RB7 A;  3M30 A;  2IHR 1;  4LRB A;  4C8Z A;  4USK A;  5HVF A;  1YBU A;  4JI8 F;  2M8D B;  2FJB B;  5F8G A;  4W92 B;  4USU A;  2GIF A;  2AU0 A;  4MKA A;  4DR4 F;  9ATC B;  2UXC F;  4P6Q A;  3HPO A;  3KUE A;  2KYX A;  2MZS A;  4JI4 J;  1JQG A;  2FZK B;  4YHH F;  1BY9 A;  3UI3 A;  2XMJ A;  1RT3 B;  1I6J A;  2W9B B;  1VQL S;  3NG8 A;  5KT3 A;  5GAE I;  5D15 A;  3RW6 A;  2W4P A;  2BAB A;  1FCA A;  3W2V A;  4FXW A;  4PXC A;  4O23 A;  1KVJ A;  2WOM A;  5L38 A;  2HFU A;  2HS0 A;  1H6K X;  2IVM A;  3D0H E;  3E8O A;  4GRS A;  4PG4 A;  2MXY A;  4ILR A;  1HWI A;  1JX4 A;  1CLF A;  1TAQ A;  2BM1 A;  4CP5 A;  3IA0 A;  1RWK B;  3LP1 B;  2LYV A;  2MGZ B;  3DRP B;  3LA0 A;  4P52 A;  2B4V A;  3VAK A;  4DX7 A;  1Q53 A;  2BJ1 A;  3ISN D;  1U1L A;  2YH0 A;  1G4C A;  2KB2 A;  2NPF A;  3RTV A;  5D0G A;  2KG0 A;  2CA9 A;  4WK1 A;  4RUA A;  3ZTP A;  2H51 B;  4X4T A;  1LWE A;  1S7H A;  4OHV A;  5K8N A;  5E5N A;  3PO4 A;  2FJA B;  3I6P A;  2AX1 A;  4B3T J;  4CDI A;  4OI0 A;  1Q4R A;  2CWX A;  1RT6 A;  3VCD A;  3PY8 A;  3K57 A;  1Y7P A;  1KKH A;  4MK7 A;  5KG7 A;  4WFB Q;  4PQU A;  3W60 A;  2B51 A;  4ICL A;  3PV8 A;  2KT5 A;  1N8R T;  3BH7 B;  1XEZ A;  4ZCL A;  1JB0 C;  4NL5 A;  4QBU A;  3RB6 A;  3S1T A;  1ZAV A;  1TL3 B;  5DQH A;  3J7Z 5;  1X5P A;  5JMN A;  1HNI A;  5A8W A;  1RHJ B;  1FES A;  2M4M A;  3BQ1 A;  4DJB A;  3NNH A;  4AQY F;  3T19 A;  2QEX S;  4F0M A;  1X4A A;  2FVR A;  4CLU A;  2V8D A;  4HL9 A;  3TOQ A;  3UW1 A;  3QJL A;  3NAH A;  4GO7 X;  4QWE A;  3QFW A;  4RNN A;  3NL0 A;  3N6L A;  2YNI A;  1NH7 A;  4MTP A;  4URQ U;  2WBR A;  1NME B;  1Z1Z A;  4U7U D;  2FLP A;  3KJV B;  1B3T A;  4IR1 A;  4IDK A;  3FK4 A;  3C66 A;  2JOQ A;  3M8Y A;  2DGW A;  2J0Q D;  3BEG B;  4XDC A;  3W9I A;  2QLF B;  1FJG F;  4KHR A;  3A8I A;  2H1Y A;  1VRT A;  1FRM A;  4OL8 A;  1YI2 S;  3N0V A;  2ZUG A;  3RBD A;  2ZH7 A;  2BQR A;  2V4J A;  1U0H B;  3MM6 A;  3IS9 B;  2CWK A;  2FTR A;  4U8Y A;  2JDJ A;  3BS9 A;  2WVD A;  3NGT A;  1NPK A;  2DR9 A;  2D74 B;  5FLX U;  4OJ3 A;  1SCJ B;  4JYA F;  4FYX B;  3OVA A;  4TU8 A;  3ZTQ A;  3J7Z T;  4OI2 A;  2R3V A;  4ZIT A;  5CCM A;  3TQE A;  2QGF B;  3EDR B;  2HRT A;  2BJE A;  5J2N A;  3N01 A;  1VCT A;  2O67 A;  2BQU A;  4IQM A;  3TVK A;  3DRS A;  3MUR P;  3LP0 B;  3OVS A;  3HSG A;  2GVD A;  4CTA B;  3D6T B;  2YKM B;  5HRO A;  4KSE B;  2AW0 A;  1JLG B;  3NS7 B;  2UUB J;  4F0H A;  2AYB A;  4NPO A;  5F9N A;  1D9F A;  3QZ7 A;  3BGR B;  5KFF A;  1PGZ A;  3PYF A;  2Z57 B;  4DX8 H;  3HF5 A;  3QYY A;  2HYI B;  1SV5 A;  1S1T B;  1RTD B;  2RRN A;  3K5N A;  1H38 A;  1TL5 A;  4LR9 A;  1PAU B;  1MWY A;  2HBZ B;  2QC3 A;  3HO1 A;  1VBZ A;  4FNH A;  2V67 A;  1H74 A;  3D0G E;  4U95 A;  4C4W A;  1HA1 A;  5KFH A;  3UN3 A;  4I2Q B;  5HAN A;  3T1A A;  5F41 A;  2EK1 A;  2F9D A;  1NH8 A;  1PBU A;  3A3P B;  1FTC A;  4FS2 A;  2PGC A;  3AFG A;  4DR3 F;  1CPZ A;  1WC1 A;  2DR6 A;  3MMC A;  3HVW A;  1FK9 B;  2W4C A;  4WFY A;  1IJE B;  3BSO A;  4EZ9 A;  2XNR A;  3CCR S;  3IWL A;  1B7F A;  1HMV B;  2H5I B;  3GFY A;  2RD5 C;  2Z2L A;  4WFN Q;  2X3G A;  2FUG 9;  2KFY A;  4OX7 A;  1Q16 B;  2DKO B;  1ELO A;  2W8K A;  2DD8 S;  3HVA A;  2CQG A;  3D0I E;  4GVB A;  4ED0 A;  2OPS B;  5F8H A;  3IO1 A;  4J9K A;  3SSQ A;  4N5S A;  2W9C B;  2IY5 B;  1AZS B;  2NSC A;  2V50 A;  1DJ0 A;  3CC4 S;  2VIC A;  3W8G A;  3BM7 A;  3D67 A;  1HD0 A;  5KFA A;  4C97 A;  5FD1 A;  2NCK L;  1HLW A;  3M2U B;  3R5C A;  3CF5 Q;  3IN5 A;  1B7Y B;  3JYT A;  4YUD A;  4QYR A;  5J2P B;  2VQF F;  4A4J A;  2R9L A;  5D4L A;  3O1L A;  4MMO A;  2ADC A;  2V8P A;  4M1K A;  4DUY J;  2M5Y A;  5K14 B;  4F0K A;  2MMY A;  3BGU A;  1C0U A;  2DHG A;  1NRK A;  2CQP A;  1PCA A;  2YNF A;  1LW2 B;  2E44 A;  3C8Y A;  4K7Q A;  4O3Q A;  1K73 T;  4RL1 A;  2B4O A;  1VHI A;  3GV5 B;  4EBE A;  5F8I A;  2CQ2 A;  1TFW A;  4ZLP A;  3M9N B;  4ED2 A;  3IAM 9;  4DF8 A;  4J9N A;  1F0X A;  5CYQ B;  1YVF A;  3HM9 A;  2FDN A;  2BYC A;  4MIB A;  4NXN F;  4DFJ A;  3MUT P;  2K3I A;  4LF8 J;  3FMW A;  3CUL A;  1PIE A;  4CLP A;  4FVC A;  5IM0 A;  3AAW B;  3QAT A;  2RF2 B;  1NPP A;  3VVT A;  2V8G A;  4KGZ B;  4F4X A;  3SFG A;  4A8Y A;  3F0N A;  2WVE A;  3K0J A;  4B08 A;  1HNX J;  3W9J A;  1T9T A;  4ZIW A;  1S59 A;  3DC2 A;  2QRR A;  4K8R A;  5G4D A;  2XSF A;  3C6T A;  1PYO B;  2IAJ B;  4ES3 A;  1R0A B;  3RGI A;  4WWS A;  4M5N A;  2KVI A;  4LMZ A;  4IG3 B;  3KLH A;  1F5C A;  2WON A;  5KFP A;  1BQX A;  1VQ6 S;  3B82 A;  1IBK J;  5ITH A;  2J9D E;  2EFO A;  3PW7 A;  2CDR B;  2UXB J;  5G0R A;  1G2E A;  3EZO A;  4C7Q A;  5B0D A;  4KBI A;  4DPT A;  2WVB A;  5ETP A;  1SKS A;  3BO3 A;  2L9W A;  4NLD A;  1FWP A;  3HT0 A;  5IC6 B;  2X51 A;  1V6H A;  1J5O A;  2DNN A;  4ZVO B;  4DZ6 A;  2IMW P;  2OFG X;  5I42 A;  2ZH4 A;  3MAA B;  4NLQ A;  4RBT A;  4YR2 A;  2OD6 A;  2FHJ D;  2DXF A;  1ACM B;  3LGN A;  4EU0 A;  4FPR A;  1HI8 A;  2QO3 A;  1XN9 A;  2L3M A;  4AXI A;  3M8S A;  4JBC A;  3HVR A;  1VQM S;  2FPH X;  5DDO C;  4LFA J;  1EHW A;  4X4R A;  2RT3 A;  2P8I A;  2CQ4 A;  1WOR A;  1UP1 A;  5KFD A;  3KXD A;  3W62 A;  4C8N A;  4BC7 A;  2RSQ A;  3VAH A;  3MM5 B;  3M9O B;  4DUZ F;  2ZBR A;  3DOK A;  2EFP A;  3CJS A;  4USH A;  3CC7 S;  2OPQ A;  2RHS B;  2UU9 J;  3K58 A;  4I6W A;  4C8L A;  3EJM A;  1T9U A;  2BV3 A;  4OX8 A;  4NCG A;  4IRK A;  3OR2 A;  4GKJ J;  1UET A;  2QL9 B;  1CSJ A;  3V4I A;  2DTJ A;  3H98 A;  8AT1 B;  4GO5 X;  1FRJ A;  3V5R A;  1E6V B;  1NU4 A;  2OP5 A;  2R4F A;  3BPS P;  5F3T A;  1BQM A;  3G96 A;  3MM7 A;  1OPI A;  2KHC A;  4ILM A;  2OGU A;  5HMX A;  1IKV A;  5CYM A;  1VJQ A;  2PA8 D;  3G87 A;  1AW0 A;  1RSC A;  1HNW F;  3QGP A;  1WNE A;  1I94 J;  2EBG A;  3CJT A;  3L09 A;  2D9O A;  2IBK A;  3ADA C;  4DV2 F;  3WZ0 A;  4QWA A;  1FO1 A;  3D54 A;  4V19 J;  2WVF A;  3DLK A;  3FZB A;  3GIM A;  1YK9 A;  1JKH A;  5J1N A;  1FKP B;  4RW9 B;  5A8R B;  3DI6 B;  3M4X A;  4AL7 A;  2BJ7 A;  1U2C A;  1S9G A;  1SJ4 P;  3KLF B;  4CH1 A;  1AYE A;  1DHM A;  5A8K B;  5EDW A;  2BXJ A;  2ZZM A;  4B3M F;  1Q86 T;  1CJK B;  3R5G A;  4NE9 C;  1X31 C;  1SL0 A;  1EQ0 A;  2G2Y A;  4NLR A;  5E0O A;  1VC6 A;  1NSA A;  2E5J A;  4FXD A;  2VFU A;  4CZC A;  2JFD A;  4H54 A;  2MSS A;  3P4U B;  1HBU B;  3MPD A;  3ZTR A;  2RKI A;  1AUD A;  1JLB A;  2OEM A;  4BHQ A;  2A6M A;  1GFW B;  1DAR A;  1EKS A;  3GU0 A;  1JNZ B;  4ZVR B;  2XMT A;  1WHX A;  3RG6 A;  1X4G A;  3MR5 A;  1RAD B;  1N5V A;  2OTJ S;  1V5V A;  4TN2 A;  1NK7 A;  1UVN A;  3GZ7 A;  3RRH A;  4ZP8 A;  1EJ7 L;  3KHH A;  4A8F A;  2OSR A;  4U67 Q;  4DS4 A;  4O4R A;  2XMA A;  2VA3 A;  4NYO A;  3UD5 A;  3OUY B;  2LA4 A;  1T9Y A;  1JLC B;  5M2R A;  1F60 B;  3ITH B;  3JSR A;  2XBP A;  5K20 B;  5L9X A;  4ZLN A;  5HMZ A;  3FRZ A;  4S0M A;  5L8R C;  1U49 A;  3QT6 A;  3CCT A;  4L72 B;  1WC6 A;  2VZ9 A;  4BS2 A;  3T9Z A;  3J80 U;  4CO0 A;  2C1E B;  2IM0 A;  4TKT A;  2G1H A;  4ED5 A;  4DL3 A;  2FJX A;  2V69 A;  2OEK A;  2CXE A;  2BKO A;  2J0X A;  2ZE2 B;  3LAN A;  2CRL A;  2F4F A;  3AJ2 A;  4NML A;  2Z30 B;  4DLG A;  3HD2 A;  3LPY A;  1W2B R;  2Y1R I;  1VS3 A;  1TR0 A;  2D3O 1;  1RKI A;  2HFZ A;  4PPD A;  3IC1 A;  1LNQ A;  2V4Q A;  5DLG A;  3UD4 P;  1W2I A;  4Z2X A;  1ICE B;  5ETM A;  5KOX A;  3VZH A;  2HQF A;  3RR7 A;  1S57 A;  3KWM A;  1TV6 B;  2QTW A;  1F6T A;  2HVE A;  2YX7 A;  2AJF E;  2G9O A;  3BH6 B;  2LEP A;  2XYH B;  1NXI A;  1K0V A;  2ZUA A;  4A8S A;  1S97 A;  2A3J A;  2LQ9 A;  3N6M A;  4TQR A;  1FA0 A;  1HI0 P;  3BF4 A;  2YQ1 A;  3FSX A;  4P2M A;  2YWK A;  3NCR A;  5SUH A;  1FNO A;  4LVN P;  4C3M A;  3UVJ A;  4X2B A;  1C1B A;  1RTI B;  4DN0 A;  3QIP A;  3RB3 A;  3J81 Y;  3QAE A;  1AUS L;  3IBW A;  4OX9 J;  1HW8 A;  2NR0 A;  1N48 A;  2PEB A;  3OR1 A;  3FBE A;  5J2M B;  3JS9 A;  1TKX A;  4UZB A;  4QWD A;  4WE1 A;  2HGM A;  1NK5 A;  5CXT A;  4KJI A;  2V0N A;  1U1O A;  4JI5 F;  1OIA A;  3H4B A;  4DWI A;  2M7S A;  5GVQ A;  4N7T A;  3KLE A;  2LDY A;  5GAD U;  2CPF A;  4JI1 F;  1NSK L;  2YXL A;  3OTE A;  4OYM A;  5DG8 A;  1NBE B;  2P5V A;  3PTW A;  4EBD A;  3CCV S;  3IWX A;  3KFW X;  4ID5 A;  3UCZ P;  1LQ9 A;  5HVH A;  4PYD A;  1DTQ B;  3GFH A;  1RTJ A;  1KHW A;  2FC8 A;  3KK3 A;  5ETK A;  1XMB A;  5KT5 A;  2B6A B;  5D0E A;  2K8G A;  4TLQ A;  3MZI A;  5GME A;  4CLT A;  2BR0 A;  3CO9 A;  2CNK B;  3M8Q A;  3L95 X;  3DRY A;  1CS4 B;  3GMG A;  2CQ1 A;  2GO9 A;  4DPX A;  4I2P A;  3ISN C;  5DM6 Q;  3HHL D;  1WG1 A;  3M1V B;  1D09 B;  4JI2 J;  1E6Y B;  2V68 A;  1KBR A;  4LR8 A;  4URG A;  1SB6 A;  3TA0 A;  4OI1 A;  2XNQ A;  2GMH A;  1HBM B;  1SH3 A;  2EPI A;  4FYV B;  2FQQ B;  1YJW S;  2GMJ A;  1H2U X;  1RAG B;  2A18 A;  4OV1 A;  3D6M B;  3DRR A;  4LSN A;  3HXM A;  3I32 A;  3GSD A;  1DUR A;  4H4O B;  1LXJ A;  2R7U A;  4C98 A;  1T3O A;  3BSA A;  1TK8 A;  3OFE A;  4B9U A;  4DOZ A;  2HRY A;  2DGX A;  5LJ5 Y;  4IQX A;  4DR7 J;  4A8K A;  2W8L A;  4NAS A;  2DVI A;  1SC6 A;  1XC9 A;  4DQI A;  4B9M A;  1KHV A;  1RHM B;  2WSF C;  1OY8 A;  3CD5 A;  3L7O A;  4CH7 A;  2FVP A;  2KHD A;  4WCE Q;  3T9N A;  3CDU A;  3V2U C;  3UN5 A;  2ZM6 F;  1FKO A;  2VOO A;  4LBI A;  2OI2 A;  1M5O C;  4CO3 A;  2V34 A;  1ZBT A;  4TNO A;  1SQG A;  2C42 A;  2PI5 A;  4OZ1 A;  1CJV A;  1N88 A;  4RJV A;  2CQH A;  3L7U A;  3DDI A;  4J9R A;  2W4D A;  3H20 A;  4C48 A;  3HDS A;  4EI2 A;  3HP6 A;  5KFN A;  1LEO A;  1HR0 F;  1TK0 A;  4E0D A;  1FFG B;  2G0I A;  1KSP A;  2J8A A;  4MJK A;  4P10 A;  5CZX A;  2VFT A;  5KFE A;  2QA1 A;  2P9G A;  4OQJ A;  2AF6 A;  3RBZ A;  4WYW A;  3MEG A;  1QSS A;  2L41 A;  2HQD A;  3I9Z A;  1R0C B;  3UDE A;  4DPY A;  5J2Q A;  1N5T A;  2QX0 A;  2AV5 A;  5IV4 A;  1ZS6 A;  2IYG A;  5HL7 Q;  2GA7 A;  2QLX A;  2IDE A;  4NLP A;  1EQM A;  4F3O A;  3ELH A;  2ZVI A;  3PKY A;  5CAA A;  2RNE A;  2F63 A;  4FKY A;  1HNZ F;  2YPZ A;  3W5Y A;  4A8W A;  2A6O A;  1QDU B;  3ULH A;  1X0F A;  2HWT A;  3MCO A;  3TAM A;  1WEY A;  3PRD A;  2OKQ A;  5CHC B;  3NMA A;  2GV1 A;  2UXC J;  5IC4 B;  5IT9 Y;  1IBL F;  4KPC A;  2UUT A;  3WIV A;  4ZPC A;  2XLI A;  3CW2 C;  1F2G A;  2XMU A;  3QO9 B;  3SV4 A;  3DOL B;  1IVZ A;  2ZDO A;  4LIW A;  2C2M B;  4X65 J;  3HI9 A;  1D9D A;  3BBB A;  2LQJ A;  2D69 A;  4JI4 F;  3ZZU A;  1VOM A;  2W01 A;  2YKP A;  3NGU A;  3D3B J;  2CQB A;  2MZR A;  2ZBQ A;  2ROP A;  4UQG A;  2E5H A;  3G8S A;  2HND A;  2OSQ A;  3T5K A;  2CYY A;  1G1X A;  3PG9 A;  1RXO B;  1JJH A;  1T8E A;  4DLE A;  2YPY A;  1N52 B;  3R9L A;  3CC2 S;  5KG6 A;  1NHV A;  2LXI A;  5D78 A;  1YX2 A;  2DRD A;  4UT4 A;  5KT7 A;  2QA4 S;  3D28 A;  4P7T A;  2VUG A;  4RNO A;  4F50 A;  1M5V C;  3KJF B;  3HHL B;  3NMR A;  1AFJ A;  4WPA A;  1KVI A;  4W90 B;  3TR5 A;  2XHC A;  5K9F A;  4OZ2 A;  5KFZ A;  3FZ2 A;  1U0S A;  3BBC A;  3OLA A;  1SL2 A;  1RTZ A;  2ASJ A;  1I5O B;  2JX2 A;  4LSZ B;  3EPI A;  3M8Z A;  2DHH A;  5AXM A;  4USM A;  1OO0 B;  3U7J A;  2BKP A;  5IQ6 A;  5IM0 B;  5GAG U;  1YWX A;  1HWJ A;  2E1M C;  3V81 A;  2R2S A;  2DIU A;  2K3K A;  3U02 A;  1FJE B;  4P2X A;  1K1Q A;  2MQ8 A;  2DGV A;  4HAC A;  1IUJ A;  1VRU A;  4AQY J;  4M5D A;  2HW3 A;  4ZOS A;  3ZXW A;  4MH8 A;  3C6T B;  4AD6 A;  1KTQ A;  4G1Q A;  2OMO A;  3QSI A;  3BQ0 A;  4E2F B;  3N5F A;  3R7S B;  2G2O A;  5M2U A;  2EVZ A;  4PQA A;  1JLA B;  5B0G A;  1YRX A;  4O44 A;  5KG2 A;  2DPJ A;  4LF4 F;  2XMM A;  2UV8 A;  4A8O A;  1Q5V A;  5LXY A;  2Y8W A;  1TMJ A;  1RU1 A;  2VG6 A;  3G2X A;  4ZDN A;  4KV8 A;  6FDR A;  2X3D A;  3WX8 A;  2ZBP A;  4OZJ A;  1N54 B;  2KM8 B;  1R6V A;  1S99 A;  2F8E X;  2CG4 A;  5G0R B;  4P73 A;  2BE2 A;  2DH9 A;  4O3N A;  2IRY A;  1FNX H;  4OIX A;  4J7C A;  2K1R B;  1U1R A;  4LSL A;  1MMD A;  1S6Q A;  1GAO A;  1R8B A;  1DRZ A;  4PWU A;  1UJ6 A;  1ZTW A;  3KUH A;  4UY8 5;  2M88 A;  2WW8 A;  1W26 A;  4HTJ A;  4KQZ A;  3DFE A;  2ZD1 A;  1XBW A;  3ISZ A;  3ILL A;  1HQE B;  4DSF A;  3SIP B;  3CCS S;  4ZS6 A;  1YLX A;  2MLX A;  1TL7 A;  1KQF B;  1N36 J;  4K5R A;  1CJU A;  1JWW A;  4DV6 J;  5A2Q Y;  4PG8 A;  5GAD I;  2DNG A;  2MZT A;  3FFI A;  3KNG A;  3RU0 A;  4IH6 A;  4PUO B;  4DR2 F;  1DLO A;  1ZZN A;  3N79 A;  4DCJ B;  4HH1 A;  2DBB A;  1NUE A;  1RHR B;  4Z7C A;  4KO0 A;  3LAM A;  1RBA A;  2N4D A;  4G6V B;  1N33 F;  3C3L A;  4QYZ J;  2XHW A;  2BJ3 A;  3GJT B;  3KYL A;  3GIK A;  5GMK a;  4JV0 A;  4MIA A;  4KHP J;  3DM2 A;  4PAA A;  2OPQ B;  4DF4 A;  2M3D A;  3HSD A;  4F4A A;  4IG0 B;  2CKW A;  5IV3 A;  5DM7 Q;  2HHH F;  1S0V A;  2JC1 A;  1SIZ A;  5E3A A;  2YKO A;  1YJR A;  3G6E S;  2R8K A;  4RW6 A;  1M5H A;  2C3U A;  3RRK A;  1QLN A;  1F5B A;  2GGP B;  3MF5 A;  2BQ3 A;  4JI0 J;  1PAE X;  2YWG A;  1T94 A;  1KWM A;  5CYM B;  2ZNY A;  1RAA B;  1S1W A;  2EFV A;  2J0W A;  3KNA A;  1FX4 A;  2AZ3 A;  4B3O A;  2XCP A;  3KLG B;  3VGT A;  1VQP S;  1LW0 A;  3M6U A;  4P75 A;  4NEZ A;  5HJY A;  3MPU B;  2XZD B;  4X4O A;  4KFB B;  3OTD A;  5L1I A;  5AE2 A;  3RRG A;  2J0S D;  1V9O A;  2ALY B;  3MAQ A;  4CO2 A;  2JEJ A;  4UZC A;  4OHY A;  4MFB B;  3FSI A;  3OV7 A;  4A48 A;  2J9E A;  4JV5 J;  2B0G A;  4ZK7 M;  1RT3 A;  2W9B A;  1QY7 A;  2IA6 A;  3RUB L;  2Z4P A;  3JB9 k;  2FZG B;  3QT5 A;  2V2Z A;  1FRK A;  1FXR A;  5U47 A;  3DOM B;  2R42 A;  4F36 A;  1RAE B;  1P9Q C;  3SYZ A;  1LV5 A;  1QAI A;  3CB4 A;  2NZC A;  1UWB B;  1XER A;  1L3U A;  1N5Q A;  2MHN A;  2QT7 A;  4WU2 A;  3LP1 A;  3DRP A;  2HHQ A;  2XYG B;  1BQN B;  3VQT A;  4X4U A;  4NRU A;  4R25 A;  4HVZ A;  2R8J A;  1IR0 A;  4K4W A;  5ADZ A;  3I9V 9;  2AJQ A;  3A3N B;  2UV8 G;  3GYN A;  4AUK A;  1KLM B;  2N4C A;  3AQP A;  3D2W A;  4NXN J;  4ZPV R;  3AT1 B;  3P5T L;  1NSQ A;  2LQB A;  3OL8 A;  1FEE A;  2NRE A;  4TYA A;  3PCO B;  2K7K A;  2IPO B;  2OPP B;  3TRG A;  4DQQ A;  2HK2 A;  3V6D B;  1RJJ A;  1JLE B;  2HNZ A;  1KC8 T;  3CCQ S;  5JJB A;  2ZHO A;  2ROE A;  2C3M A;  4ELT A;  4ES2 A;  3GR1 A;  4LF8 F;  1RWW B;  3AB4 B;  2I0X A;  1NJZ A;  5L1K A;  5DS7 A;  2HSE B;  3AXK A;  4H4M B;  1TL3 A;  4PG6 A;  1RWX B;  1NK6 A;  1R6Y A;  2DH7 A;  3NXZ A;  4CIO A;  2EBE A;  2NPI A;  2E9R X;  1MW7 A;  4G65 A;  1CVJ A;  1X7V A;  3GFX A;  1X5O A;  5J1P A;  2WVC A;  2FHK A;  2OH2 A;  3OXG A;  3CT9 A;  1URR A;  1KLN A;  3CJ0 A;  2F1F A;  2LLZ A;  2I5J B;  3KJV A;  1IBK F;  5LT5 A;  4CLK A;  3OL9 A;  2P6T A;  1U45 A;  2UXB F;  4TU9 A;  4RNH A;  1HWL A;  1FWK A;  3CDW A;  3G8Q A;  1S1U A;  1FDA A;  1VRQ C;  3PJX A;  4DV5 J;  4ED6 A;  3PX6 A;  1RWV B;  3T3F A;  2CPJ A;  2XS7 A;  3OR1 B;  4U7C A;  1GXU A;  1U0H A;  3AY0 A;  4USV A;  1SQE A;  2RQK A;  3IS9 A;  2W9A A;  3HCX A;  1QUP A;  4USJ C;  5KG1 A;  1VLO A;  1LK7 A;  2RQ4 A;  5HBM B;  4HI2 A;  1RAF B;  3UCG A;  4IFV B;  2EKN A;  2PI4 A;  2ASD A;  1EB0 A;  2XB2 D;  3R7B B;  3LH2 S;  3J81 U;  2BRK A;  1T0T V;  1ZM3 A;  4ZPW R;  4LRA A;  1UCN A;  1VFJ A;  1H3D A;  3HLU A;  1B4S A;  1YGY A;  4Y2A A;  3FSY A;  1WKK A;  3CPW R;  4DSE A;  1FNM A;  4W98 A;  3D4J A;  2JVO A;  3LP0 A;  4C0H A;  1WEX A;  1JNR B;  1U6F A;  3TVZ A;  2EC2 A;  2MY8 A;  4ETX A;  2UU9 F;  4CTA A;  1EKR A;  4KTQ A;  2YKM A;  5FII A;  4GKJ F;  1JLG A;  4QU6 A;  2XTJ P;  2XWY A;  3IG1 B;  1HWU A;  2X1F A;  3FCV A;  5B0B A;  4Q45 A;  1ROF A;  3BGR A;  1X4C A;  4ZPB A;  2OML A;  4I2P B;  1S1T A;  1WD6 A;  4HHH A;  1RTD A;  1FT8 A;  3TUZ C;  3TVY A;  2NXU A;  1U2F A;  2F4V F;  3QWP A;  4J91 A;  2I2Y A;  1D8Y A;  3K7R A;  3LUY A;  4QPT A;  3NS6 A;  3MAH A;  4L73 A;  1ZM2 A;  3I96 A;  4LSN B;  3BV8 A;  3R8Y A;  5DJB A;  3D7S B;  4I2Q A;  2B9W A;  2AWZ A;  1A9N B;  4DSJ A;  1I94 F;  1RA7 A;  3T5L A;  3BYP A;  2GNK A;  4OMF G;  2BJ9 A;  2HHX A;  5C2C A;  2WHO A;  1FK9 A;  3TJA A;  4NLU A;  1HMV A;  3OHA A;  1WI8 A;  2B9E A;  2GIR A;  1GX6 A;  3D9B A;  4B02 A;  1AT1 B;  1PSD A;  2OPS A;  5LMN J;  1AZS A;  5KFQ A;  5HK4 A;  1KFS A;  5E3R A;  1T3N A;  3POT B;  3HHL C;  3Q86 A;  3I0S B;  3M2U A;  1YIT S;  4YOE A;  3QPI A;  4A8Q A;  5KT2 A;  2RQM A;  3MMA B;  1SBR A;  1NM2 A;  2XMV A;  3PEH A;  3VGV A;  1F5A A;  5BYS A;  3K59 A;  4C6A A;  3FCW A;  3KJN B;  2ZFH A;  1RE1 B;  4WXW A;  3AOD A;  2LCW A;  5K14 A;  3AJ1 A;  3P49 B;  1APS A;  3W7B A;  1WC5 A;  3PYG A;  2NYH A;  3IRX B;  4FBT A;  1LW2 A;  2H65 B;  5DDR C;  2VBZ A;  3MMB A;  4BBY A;  4X4Q A;  2LEC A;  3EGV A;  2YQ0 A;  4EBC A;  3RW7 A;  4YEA A;  3RR8 A;  2XUL A;  1RAH B;  4WJB A;  5CYQ A;  4DQR A;  4C8O A;  1TL1 B;  4NI2 B;  2CNL B;  1S4F A;  1S1V B;  4HEA 9;  2AHO B;  1MWQ A;  1WKJ A;  4X4P A;  2HHP A;  3M2R B;  2OD4 A;  2MHE A;  4J9O A;  2LKZ A;  2I8E A;  2Z2Y B;  3QGG A;  5T7L B;  2BE7 D;  4FNI A;  4F2R A;  1H2V Z;  2RS2 A;  2Q43 A;  2IAJ A;  5JUM A;  5F8J A;  2IC3 B;  4FF3 A;  4ZPA A;  1RWN B;  1TUG B;  2VBW A;  3FVY A;  4O3O A;  4IG3 A;  1TTH B;  5KFG A;  3Q89 A;  1NK8 A;  4DCP B;  3OVB A;  3HHN B;  4Y6I A;  3EYZ A;  1I51 B;  2I1R A;  3PR4 A;  4RWX A;  4K0K J;  5IT9 U;  2RE1 A;  4OYA A;  5ETS A;  1YJ9 S;  3MEC B;  2MKC A;  3W8P A;  4FF2 A;  2C22 A;  3M8P B;  2LQ8 A;  3CO0 P;  4OJH A;  1L3K A;  3UD3 P;  1SL1 A;  3MAA A;  2DO0 A;  3V6J A;  5EHH A;  4C0O C;  5KG3 A;  4DU7 A;  1H7X A;  3KJQ B;  1PC4 A;  5H9F J;  3PXG a;  4OX9 F;  4PWD B;  1ZM9 A;  1VGY A;  4ZN3 A;  2VIH A;  3G6V A;  1LWF B;  2VC1 A;  1BMQ B;  3AD9 C;  3LO3 A;  1K44 A;  4NCB A;  3AH6 A;  3A13 A;  4ECT A;  1RT2 B;  5HJX A;  1HW9 A;  2NXN A;  2VC0 A;  3S8S A;  3PRV A;  4NLY A;  3KHG A;  3PW2 A;  1U8S A;  1VQO S;  3MM5 A;  2DNY A;  4V19 X;  1KR4 A;  2WTF A;  3PYE A;  4J9M A;  4MT1 A;  3GP9 A;  2CFX A;  3FRY A;  4RUB A;  3R3T A;  1X9M A;  2VG7 B;  3ILO A;  2VV5 A;  3TUJ C;  4CT8 A;  1N0V C;  4RNF A;  4I7F B;  4NLX A;  1E6V A;  2D1C A;  1M1K T;  3UPF A;  3IRW P;  3FQK A;  2ZNZ A;  3HSZ A;  4DR6 F;  2J7K A;  4NLW A;  1WI6 A;  3CIM A;  1UEV A;  3MD3 A;  5KOW A;  2GJF A;  2ZKT A;  5ETQ A;  4ITS A;  2DNQ A;  2YNH B;  3QJJ A;  4F02 A;  4UUW A;  1MRO B;  2DXE A;  2HZC A;  4JI2 F;  2E7W A;  2GQQ A;  2KXF A;  4ED7 A;  2OEL A;  4LSL B;  1YJV A;  4ID8 A;  4V1A k;  4LBP A;  3H5S A;  3D66 A;  3HHE A;  3A8K A;  1P27 B;  1GXT A;  1FD8 A;  3MM8 A;  5H9E K;  1FKP A;  5A8R A;  3DI6 A;  1MN9 A;  2MKS A;  4PEO A;  2FJV A;  4P9S A;  2CQ0 A;  4FKX A;  2BW7 A;  3UDV A;  1IM6 A;  2MST A;  2VH7 A;  3KLF A;  4ECS A;  4DR7 F;  4UOG A;  5A8K A;  1RAB B;  1CJK A;  1SPB P;  2CPE A;  4B3R J;  2VPZ B;  2DGQ A;  3CDA A;  3ETM A;  1UMJ A;  4M5G A;  2UP1 A;  1DLO B;  1T11 A;  2VA2 A;  2NXC A;  4ENO A;  2VQE J;  1S49 A;  1HBU A;  2MKK A;  1YRT A;  4DN9 A;  3TUP A;  1ZM4 A;  1NND A;  1U1M A;  2DJW A;  2R7W A;  4ELV A;  5A2Q U;  1OY6 A;  1S6P B;  2XO6 A;  4KAI A;  4X4N A;  2K2P A;  5KFS A;  1EZZ B;  4P2S A;  4KB7 A;  1FXL A;  2DEJ A;  3G8T A;  1SJQ A;  2C3O A;  1KEK A;  3OQ2 A;  1C0T A;  2Y3Y A;  2KVQ E;  3AOA A;  4IKA A;  3LPE A;  3MOZ A;  1WHY A;  2AJ0 A;  4FF1 A;  2CNO B;  2V94 A;  4GKK J;  3OUY A;  1JLC A;  2MZQ A;  4I0W A;  3WX4 A;  2IA0 A;  3ITH A;  2DH8 A;  3FEX B;  3PJW A;  3UQS A;  1G7C B;  1YBA A;  1HYS B;  1F9H A;  1C4A A;  2JHE A;  4KRW A;  2MQN A;  1HD1 A;  1U6Z A;  4AE5 A;  5FJ4 A;  1HBN B;  1IBL J;  2MLY A;  1LW0 B;  2GIQ A;  1T95 A;  1IBM J;  5IT4 A;  2X1B A;  3CE8 A;  5KTQ A;  2ZE2 A;  3D68 A;  1T05 A;  5LMU F;  2O01 C;  2VJU A;  4Q0B B;  1TKZ A;  2FHJ A;  2NS1 B;  3I4H X;  2CPH A;  2IM3 A;  5B7W A;  1S79 A;  3NNA A;  3GTY X;  2EKY A;  3OT9 A;  4M95 A;  3IAS 9;  2VPY B;  3A4T A;  4ED8 A;  4OLO A;  1RI7 A;  3UE2 A;  1O6X A;  1L3T A;  1U1N A;  2I6W A;  3D5M A;  4X65 F;  1TKT B;  3D1H A;  2ILZ A;  1TV6 A;  4PCQ A;  4L75 A;  2AJ2 A;  3Q2S C;  2J6S A;  1OS5 A;  2H4Y B;  1CC8 A;  7AT1 B;  1RLC L;  3H8Y A;  2BE9 B;  3ZNJ 1;  1IKX A;  1O0P A;  3QJP A;  2HQI A;  4P2F A;  1RTI A;  2LP4 A;  1IKW B;  2YKN B;  5C25 B;  4IOC Q;  3EVO A;  1GMW D;  3SQG B;  2CQD A;  2HFV A;  1VBX A;  2XYP B;  3HHK A;  5J2M A;  3IWN C;  1TQL A;  3DGP B;  4KYZ A;  3F44 A;  3OJU A;  1YBT A;  2GHV C;  1IR2 A;  4KY3 A;  3CJQ A;  1FVQ A;  4F67 A;  3E01 B;  2R7V A;  2DHS A;  4RO0 A;  1KQS R;  3LAK A;  2B7B B;  2HBR B;  3DU5 A;  1TMM A;  3NNC A;  4A47 A;  4F4Z A;  4J37 A;  3ETO A;  1JIH A;  4WFX A;  3QWU A;  2O1P A;  3O3L A;  2FLO A;  2HNZ B;  4JOU A;  4U7U K;  3H5X A;  2UVU A;  1DTQ A;  2LA6 A;  4LRE A;  3VAM A;  2N7Y A;  2OHD A;  2BKN A;  1ZAX A;  2B6A A;  3WC2 A;  2A2C A;  2BRL A;  3UR3 C;  3HFK A;  5L39 A;  4CH0 S;  4Y2I A;  4FPI A;  3BKU A;  4NLV A;  1QE1 B;  1CS4 A;  2GC8 A;  2I9S A;  1M5K C;  1R8C A;  4LF4 J;  3CDB A;  1T02 A;  3M1V A;  3CWJ A;  4CLF A;  1NPR A;  1E6Y A;  1RCO B;  4ER8 A;  2IM1 A;  3J7A 1;  4ZHR B;  4FN5 A;  3HVT B;  1S9E B;  3A1Y G;  4FZV A;  1HBM A;  3FKB A;  2J6T A;  1FJ7 A;  3EXC X;  1S6O A;  3DXS X;  1SKR A;  1GT8 A;  2JSX A;  4RLE A;  4N76 A;  4H4O A;  3ZNU A;  2ALZ A;  3SDE A;  1BUX A;  3VHQ A;  2ZC4 A;  4M5L A;  2L9N A;  1S1U B;  4W4M A;  2A1B A;  3MOJ B;  3IM8 A;  1SKU B;  2OEJ A;  1HI1 A;  3CXC R;  5F9L A;  4I67 A;  4DZD A;  2R7O A;  5JVG Q;  2H54 B;  2HVD A;  1Y9O A;  3DHW C;  4P7V A;  2DNO A;  4DR2 J;  5DZ6 A;  2VPW B;  3IFE A;  2XM3 A;  2OTL S;  2J5A A;  1N36 F;  1TP7 A;  2NQP A;  2Z2Z A;  4DV6 F;  2GO8 A;  3NY0 A;  3QMQ A;  1C1C A;  2AT1 B;  4BC9 A;  4P74 A;  1N33 J;  2G13 A;  4K50 A;  4A8X A;  2PMZ D;  3MR7 A;  4HTI A;  4QWB A;  2JRS A;  2PN6 A;  1KQG B;  4JI7 J;  3FC9 A;  2XS2 A;  3EDQ B;  3HSJ A;  2FD2 A;  3MTK A;  1VDH A;  2CZV C;  4HHJ A;  4NA1 A;  4QR0 A;  4KHP F;  3MCS A;  2HHH J;  4FDF A;  1YDL A;  2DT9 A;  3WBZ A;  4DPU A;  5EWG A;  1BGX T;  1RU2 A;  2HQG A;  4URS A;  4ANE A;  4DG1 B;  3CCZ A;  4I6A A;  3M9M B;  5D4O A;  3FGV A;  3AD7 C;  2IRX A;  5HP1 B;  1GTH A;  1X4B A;  2COL A;  2YX4 A;  4PR6 A;  3M05 A;  3M7V A;  4F7V A;  1MG7 A;  3SCL E;  2QMW A;  4ED3 A;  2HS4 A;  4N8N A;  3QAU A;  3DDN A;  1PJ6 A;  1SJ1 A;  2XZT B;  5B0A A;  4R0E A;  3FMB A;  4JI0 F;  1FRI A;  2DGS A;  2L9D A;  3HHD A;  4ECV A;  2C2E A;  2XY7 A;  2Q6C A;  3JTN A;  4DDF A;  4F4Y A;  3ZC4 A;  5DG9 A;  2CJQ A;  2FHM A;  2FLL A;  2AD9 A;  2AJ1 A;  2L48 A;  1XMQ F;  4BWM A;  4LQ9 A;  1NDK A;  4NX9 A;  2CAJ A;  2OO4 A;  2DGU A;  4OFZ A;  4K4U A;  1NB2 A;  1DQ9 A;  1CG2 A;  2BW2 A;  1RKJ A;  1BLU A;  3X3U A;  1SIW B;  1D1U A;  4CWB A;  3MED A;  3EPG A;  3QO9 A;  3DOL A;  1UW4 A;  2DRA A;  2EXU A;  1REG X;  4LIR A;  4Y28 C;  5HMW A;  3OSN A;  2JLG A;  2JC0 A;  2CPY A;  1PBA A;  3QNW B;  4CM0 A;  2J8S A;  3BKT A;  4AXJ A;  4JV5 F;  5KFX A;  4FS1 A;  1P1L A;  2E1A A;  2RML A;  1R0B G;  5HAT A;  3EGW B;  1DY3 A;  3NKY A;  2HZA A;  2KYZ A;  4DL0 C;  3TZZ A;  1MU2 B;  5LSR A;  4O3R A;  4K4Z A;  1U24 A;  3DYA B;  1U8W A;  2Z56 B;  3ZTO A;  3KMS A;  3EVW A;  3G6Y A;  1VR6 A;  1XNR F;  4C8M A;  5DQI A;  1EET B;  5CZV A;  2W2P P;  1UVK A;  4BCA A;  1TUV A;  4QIV A;  1FX2 A;  4LF5 J;  4A46 A;  4N77 A;  4DU8 A;  3QLH B;  1VMB A;  3HHL A;  2FHO B;  3C16 B;  2WZ1 A;  5ETV A;  3SQO P;  4RU2 A;  3R97 A;  4O3P A;  1HHT P;  2MTL A;  1NDP A;  2VAS A;  1Q8L A;  3MMB B;  3EIC A;  2KFZ A;  2RDI A;  1U09 A;  2W7A A;  3IR5 B;  2V63 A;  1HNV B;  3O44 A;  1UVI A;  2HK3 A;  5B0C A;  2H4W B;  3LOU A;  4JI6 J;  7FD1 A;  2A10 A;  4CNZ A;  2H3E B;  3AHP A;  5K8P A;  3ZZ0 A;  3KK1 A;  1JK9 B;  2AEM A;  3U1L A;  3OLB A;  2B56 A;  1QAY A;  2KJW A;  1I1G A;  1B64 A;  3IR7 B;  3BRE A;  3C14 B;  2UZA A;  2ZH1 A;  2RIL A;  4EFA C;  3PRB A;  1QSY A;  3R5B A;  1FE0 A;  4DFM A;  4YDD B;  1RT4 B;  2E1P A;  8RUC A;  3FJ2 A;  1Q8B A;  1JLA A;  3CNQ P;  2JWN A;  2OJ3 A;  3W5Z A;  2D3O R;  3UDL A;  2RRB A;  2CQ3 A;  2GCF A;  2BBE A;  3Q8S B;  4LBH A;  3C6U B;  5IZH A;  3UN2 A;  4KGK A;  4FXV A;  1PO6 A;  3OJS A;  2EK6 A;  1Z2Z A;  3MXH P;  4DV7 J;  2K1R A;  4Q7A A;  2CZ9 A;  2WK4 A;  4CNY A;  2KL8 A;  2SXL A;  2B3T B;  4TLR A;  2GVZ B;  2H9Z A;  3IP0 A;  4RNM A;  1QVG R;  2HZV A;  1NJY A;  3JSM B;  3M8R A;  4DFK A;  1XTZ A;  3KK2 B;  1HQE A;  5LL6 d;  2AGO A;  2BAN B;  1WF0 A;  2QLW A;  4DV5 F;  3DMJ B;  1QAX A;  2YNG A;  2Q79 A;  1KD1 T;  3EX7 B;  2VOD A;  3MUV P;  4PUO A;  2CPD A;  3BB5 A;  1R7I A;  3QID A;  4QW9 A;  4UW2 A;  1CQN A;  1RCX B;  2F8H A;  4QU7 A;  3VAI A;  1DFD A;  1DQ8 A;  4RUH A;  2MYF A;  2KFN A;  4YP3 A;  3MD1 A;  4CCH A;  1WOP A;  3I55 S;  1CJT B;  2GW8 A;  3NCQ A;  2VBX A;  2AYE A;  1NZ8 A;  1Y4Z B;  5KFI A;  4KGM A;  3VTI A;  2UVW A;  5AXL A;  3LF0 A;  3OTC A;  3MCN A;  3Q8Q B;  4ETZ A;  3J81 j;  2L08 A;  2MQQ A;  5BJR A;  2DNH A;  1WG5 A;  4IG0 A;  2VDI A;  4LRF A;  1DAX A;  3JQM A;  1RQ0 A;  4J9P A;  3OFH A;  4MKB A;  3R7N B;  2UXD J;  1LKZ A;  1J5E J;  3PM9 A;  2BJD A;  2F4V J;  3QBC A;  4CLZ A;  2R8H A;  1CEZ A;  2GGP A;  2V4R A;  1SXL A;  5E2Q A;  4J9L A;  5DZ7 A;  2XGQ A;  1V3S A;  3Q8Y A;  1NJI T;  3G82 B;  5HAO A;  1D3W A;  1YQH A;  1X9S A;  3PO5 A;  3MUM P;  2BAC A;  3H42 A;  3KLG A;  2V9K A;  2N3L A;  2DR8 A;  1VQK S;  4FYD A;  3ZZO A;  2FJD B;  4USI A;  2R7R A;  1KN6 A;  3GG1 A;  3T6J A;  2ZH5 A;  2BEF A;  3MM8 B;  1SJF A;  5HQM A;  5AJ3 F;  4KFB A;  5LXR A;  5J1E B;  4EO8 A;  3MWB A;  2QMX A;  3MDF A;  3H5Y A;  2VFS A;  4MFB A;  2MJN A;  1UFK A;  3OL6 A;  4XIU A;  3L7P A;  1B70 B;  3MR2 A;  1N5Y A;  4QR1 A;  3KUG A;  3HT3 A;  2F3J A;  3R5D A;  2PE8 A;  1L3V A;  2POK A;  1D0E A;  5LMN F;  4U9R A;  3DOM A;  1GMV A;  1PKU A;  1YZ6 A;  2ZC3 A;  2Q66 A;  3DLG B;  1AFI A;  5FDL B;  3GFZ A;  1GEH A;  3AA9 A;  1IM4 A;  2QE5 A;  4E8U A;  1FFS B;  2BMB A;  3PYD A;  1UWB A;  2CPX A;  3PX4 A;  2UUA F;  3GJR B;  4IUF A;  1HIY A;  3QGH A;  5HI7 A;  1NK0 A;  2ASY A;  1MLA A;  2ZBC A;  1BQN A;  3I0R B;  5DG7 A;  2N82 B;  4PWW A;  3DLH A;  2RU9 A;  1C0T B;  3M6W A;  3CCW A;  4X4S A;  2VG5 B;  1VHF A;  1A0O B;  4WP3 A;  2J7W A;  4ZA1 A;  4ALZ A;  5DGA A;  5E3C A;  4EO6 A;  1KLM A;  4X64 J;  4B17 A;  5KFV A;  5CA5 A;  1VQ9 S;  4LF6 J;  1TKD A;  1MML A;  3NOG A;  4CRJ A;  2Y8Y A;  1BHN A;  1RP5 A;  2E7X A;  3MR6 A;  1R8A A;  3C46 A;  3X1L B;  1HBO A;  5F8N A;  2OPP A;  3V6D A;  2C2R A;  1JLE A;  3CUN A;  1REV B;  3CMQ A;  1FI4 A;  3BR8 A;  2K7J A;  4IYQ A;  2NXE A;  1QTN B;  4H4M A;  1T05 B;  1TKZ B;  4ZIV A;  2Y1J A;  2CZ4 A;  1WSV A;  2R2R A;  2CIM A;  4L74 A;  2HS3 A;  3EMT A;  4CQ1 A;  3B6B A;  1Q79 A;  3FBC A;  2CDQ A;  2PMW A;  5BYR A;  3I5B A;  3W63 A;  1QD1 A;  4ZMM A;  3THT A;  1JLF A;  4B3S F;  1Y5N B;  3CGI A;  1KP6 A;  2OFH X;  4DL4 A;  3GR0 A;  1U47 A;  4ED4 A;  4YR3 A;  1NKB A;  2EFG A;  3J80 Y;  2JLE A;  2P2C B;  2H5J B;  1GTE A;  4K4X A;  3I82 A;  3OHB A;  3FBB A;  3HJF A;  2I5J A;  1K47 A;  3KOA A;  2DEI A;  1NEE A;  3BGF A;  4KE5 A;  4C11 B;  4K0K F;  3KLV A;  3FCH A;  2R7Q A;  3TQ1 A;  3GV7 B;  4J90 A;  1IKX B;  3NP5 A;  4R0J A;  3O6Q A;  2DB1 A;  2ZBI A;  2HBY B;  3TI0 A;  5LOQ A;  4MKY A;  4K59 A;  3NRB A;  2DGO A;  3KKF A;  4ZKA A;  1VQ8 S;  1WOO A;  4CYU B;  2HLU A;  4HDH A;  3UNG C;  4WTO B;  1FDD A;  1RBL A;  3R6G B;  2AMC B;  3FBF A;  4I69 A;  4DX5 A;  1NJX A;  2FGO A;  1B99 A;  3BSC A;  5HBM A;  1X60 A;  4OZN A;  4DL5 A;  1RBO B;  1M5P C;  2HNY B;  3W2W B;  4IFV A;  1PG5 B;  4RX6 A;  4DL7 A;  1U1Q A;  1RWU A;  4K5S A;  3K2Y A;  5KFW A;  4TXS A;  4G1I A;  5KG4 A;  3DLL Q;  2XEX A;  3AJD A;  1LFP A;  2ZIT A;  5HSP A;  5ETR A;  2Z2M A;  3VV2 B;  1H0H B;  2ADB A;  4C2M A;  2CJB A;  4DSK A;  3PNI A;  3CJ8 A;  3T1H F;  1FRL A;  2PSZ A;  2PDA A;  2A0F B;  4DR6 J;  1U1P A;  3QSY B;  2C2K B;  3IG1 A;  4WKR A;  2MY7 A;  2AIR B;  2B5J B;  3ICL A;  1Q7Y T;  3VWS A;  2FVS A;  2GQC A;  2ZOM A;  4OYX A;  4ILL A;  1T9V A;  1JXV A;  1ZA2 B;  3QT7 A;  1YRU A;  3Q8P B;  4NLS A;  2NSB A;  3B78 A;  4ZVE A;  5KFJ A;  3TWZ A;  2VU5 A;  3O5T B;  2H48 B;  4NA2 A;  3OXL A;  4ERD A;  2OIH A;  1S1X A;  5F8M A;  3P5B P;  1TVR B;  4QIE A;  3EWG A;  2EFQ A;  3TEH B;  3MM9 A;  1O8B A;  2EFN A;  2DNM A;  2F40 A;  2WRM A;  1UFW A;  3SDE B;  1RT5 B;  4DPW A;  4LUB A;  3VQS A;  4YQW A;  2PFD A;  2DGT A;  4ZP6 A;  1X5S A;  4FP9 A;  3V6K A;  2YQ3 A;  3CD0 A;  3BO4 A;  2QLB B;  2DRB A;  3CSK A;  4FYW B;  5ETL A;  3PW4 A;  1NHU A;  2DNZ A;  2Z0G A;  2QL5 B;  4ELU A;  1RHU B;  1T03 B;  4B3R F;  3P96 A;  3KTQ A;  1C1C B;  4GC7 A;  4NLO A;  2HVZ A;  1H98 A;  2ZJQ Q;  4WP8 A;  1HQ2 A;  1YJ7 A;  3POT A;  4KGV B;  2GHW A;  4FYY B;  4RW4 B;  3I0S A;  2VQE F;  5L1L A;  3H40 A;  4IO9 Q;  4DQS A;  1B0T A;  3PHT A;  2Y1I A;  3MMA A;  1V3Z A;  3UNY A;  5KFM A;  2BVZ A;  5BR8 F;  1S9F A;  3L9Z A;  1F9F A;  4RZR A;  1VIS A;  3TJ8 A;  1S5Z A;  4LR7 A;  2I38 A;  5I3U B;  3TW0 A;  2M70 A;  4YME A;  3H4D A;  2VF3 A;  3G6X A;  2FLN A;  1KQK A;  2HHW A;  3A8E A;  3BDE A;  4RW8 B;  4PKD B;  1SKW A;  2YTC A;  3IRX A;  3KHL A;  1R89 A;  1OSD A;  2O5D A;  4ZVH A;  4PXB A;  4G3I A;  4GKK F;  2ZH8 A;  3GE9 A;  2IJR A;  2E1C A;  4Y2C A;  3DLE B;  2BZ2 A;  2CJK A;  1RAO A;  1TL1 A;  2DIS A;  4NI2 A;  4K4T A;  2HG4 A;  1S1V A;  1LWC A;  4KGX B;  2HHS A;  1N56 A;  1VQ7 S;  2ZWP A;  3PR5 B;  1HQU B;  4UTG A;  5LMU J;  5CCL A;  3R6L B;  1VIX A;  2NUU G;  3DU6 A;  3M2R A;  1WTB A;  1RIS A;  3QRQ A;  5DDP C;  2OLW A;  1JJC B;  1YHQ S;  2QLJ B;  1TUW A;  5DRK A;  1IBM F;  3LWM A;  5T7L A;  2J7U A;  3MED B;  1ZET A;  2VOP A;  3CD6 S;  5ETT A;  4X66 F;  2IC3 A;  3MEE A;  4PG5 A;  2HUR A;  3TZX A;  1WAC A;  2UVR A;  2O66 A;  1UTA A;  3BO2 A;  3PDN A;  5GAH U;  4F4K A;  5HLF B;  3MR3 A;  1Q0N A;  2HFO A;  3DRX A;  1YSJ A;  1Y00 A;  3JSY A;  4M8L A;  4DEZ A;  3H5U A;  4LF7 F;  5A0Y B;  3MEC A;  4LFC F;  2MPU A;  3M8P A;  1NZA A;  1WDD A;  2V8V A;  3GYX B;  4R8U B;  1D9A A;  3JAM Y;  3R5A A;  2XLJ A;  2RH3 A;  5IT0 A;  1SC4 B;  4TY8 B;  1PJ5 A;  4O3S A;  4U96 A;  2AYG A;  2LXF A;  8ATC B;  4PWD A;  4D3G A;  1FJC A;  3MI7 X;  2B8Q A;  5K5M A;  4RW7 A;  1LWF A;  1I3O B;  3PFO A;  3M2V B;  2C3Y A;  3CVK A;  3IM9 A;  2VFV A;  2UVV A;  2IIH A;  4X84 A;  3P3D A;  3Q24 A;  2MKH A;  4DV1 F;  1X0P A;  5DLF A;  2B8P A;  5L1J A;  1RT2 A;  1VK8 A;  5T41 A;  4ECU A;  6FD1 A;  2C2D A;  3M8W A;  3W66 A;  2NXJ A;  3BJY A;  1T9W A;  2ZH9 A;  4R5P B;  2Q3P A;  2CVE A;  4M63 A;  4UUX A;  3L4B C;  1R31 A;  1QTM A;  3KK1 B;  1N0U A;  1XWL A;  2G0J A;  2VG7 A;  4ANC A;  2XZW A;  1XR7 A;  2AYM A;  4I7F A;  4PXE A;  2BJ8 A;  5KFL A;  2G1D A;  4GVL A;  2KZZ A;  1UJ5 A;  1RT7 B;  1CUL B;  4L6V 3;  3T1Y J;  5KFK A;  3ZZZ A;  3ZZT A;  4OLP A;  1JJ4 A;  2YNH A;  2KKH A;  1GH8 A;  1MRO A;  1ZTT A;  2UUC J;  1QM9 A;  5D77 A;  2HAI A;  3ENA A;  1F2H A;  1FTR A;  4OHW A;  2HHT A;  2R8G A;  1SC3 B;  3Q2T C;  2RUG A;  1IWG A;  4Y2M A;  3BBF A;  2WB1 D;  2YBV A;  2FYX A;  3AD8 C;  4JI3 F;  2EG2 A;  2HIY A;  5CH7 B;  3IMQ J;  1ZA1 B;  4HYK A;  2E5L J;  2YNG B;  1WUU A;  4USW A;  3VGS A;  2LMI A;  4OI4 A;  2CPI A;  4XO0 A;  3E51 A;  2QSF A;  5AT1 B;  3QT8 A;  2ASL A;  3LP2 B;  4J9U E;  2JEI A;  1HHQ A;  1DTT B;  1VQN S;  1G6B A;  3Q8V A;  2K06 A;  3TAP A;  3PZP A;  2PMH A;  1VQ5 S;  3ZZP A;  3CED A;  5D0R A;  5M2P A;  4JI7 F;  4N41 A;  1S6P A;  4IH5 A;  4DSL A;  2KRB A;  6AT1 B;  3VGU A;  3CCJ S;  2YWW A;  2RS8 A;  1EP4 A;  2DK2 A;  1FF2 A;  2G2Z A;  2FIU A;  4WZQ A;  1GMU A;  4LF1 A;  2GX8 A;  2FJW A;  2M52 A;  3OFG A;  4KKO B;  2LU2 A;  4K4S A;  2XQC A;  2EWH A;  5E3Q A;  4WIQ A;  5E33 A;  3OPK A;  1RAI B;  4IOB A;  2E5G A;  3PEJ A;  2VPX B;  4HH0 A;  3TJ9 A;  1PIL A;  3N9U C;  3Q83 A;  2EC0 A;  1FRH A;  1FVS A;  2Q1L A;  2HMI A;  4D3H A;  1HL6 A;  2X1G A;  1HYS A;  4NOH A;  1IKY B;  1RUS A;  4EYH B;  2CVI A;  1XMQ J;  5D3G B;  3VZI A;  2XG8 A;  2PEH A;  5AXN A;  1J2V A;  1X4D A;  1HBN A;  2CJ9 A;  1SJR A;  5EGY A;  2HWI A;  3EE3 A;  3WHI A;  1IQT A;  1BWV A;  3V4M A;  3B4D A;  2DHA A;  3B54 A;  2OUG A;  4LF9 F;  4Q0B A;  3GIL A;  1SUQ B;  3D1O A;  2YKQ A;  3FEY B;  4F26 A;  5AXK A;  1N6Q B;  4Y3C A;  1VJW A;  3PIO Q;  2J9C A;  3QFH A;  2V2Q A;  3QRR A;  2RAQ A;  2QMU B;  1ITP A;  3TX0 A;  1N5Y B;  2H5E A;  4XTT A;  1RDR A;  3PAC A;  4OJG A;  4MYT A;  1R27 B;  1TKT A;  1JLQ B;  4YB5 A;  2J9D A;  2CQC A;  1KS2 A;  3U1M A;  2DR7 A;  1U1K A;  1NDL A;  2W7O A;  2ZWO A;  2VD3 A;  2QG9 B;  4ZCI A;  4ECW A;  2E5I A;  3S01 A;  4DV4 J;  3GJS B;  4UST A;  2OPR B;  3MCM A;  2IBO A;  2PO4 A;  4IFY A;  1XNR J;  4DBQ A;  1Q78 A;  1WWH A;  2B9Y A;  1IJF B;  1XMO J;  4DV0 J;  2FJE B;  4Q2M A;  1IKW A;  2IJF A;  2YKN A;  5C25 A;  3K8V A;  3SQG A;  2W2M P;  4CO1 A;  4P71 A;  1FER A;  1T7P A;  3W3S A;  1WEZ A;  4PZV A;  2X7I A;  4L76 A;  3DGP A;  1Y5L B;  1WDT A;  1SJ3 P;  1R43 A;  3GQC A;  4WYL A;  4LF5 F;  1YG0 A;  4AND A;  1B0P A;  1N34 J;  3E01 A;  3NBP B;  1RT1 A;  3PX0 A;  3PKM A;  3IR6 B;  5AE3 A;  1HBO B;  5EUH A;  1HPZ B;  3H2U B;  3KDN A;  2BDP A;  3H25 A;  3BQ2 A;  4ZPD A;  3ET6 A;  3R1H A;  2KTQ A;  1K1S A;  1PC5 A;  4NLT A;  1XNQ J;  3AOC A;  4RUC A;  2IVY A;  3OTB A;  5A6W A;  2BM0 A;  4F3Q A;  1NB7 A;  4JI6 F;  2MKJ A;  3RBE A;  4YS2 A;  1SQF A;  3W1Y C;  4XAK A;  1U25 A;  4OI6 A;  5IWA F;  2U1A A;  4F04 B;  1BC6 A;  3D6H B;  3M32 B;  2BOP A;  1QE1 A;  2M2B A;  4WP9 A;  2MQO A;  5GAH I;  3GIJ A;  1Y10 A;  1WTF A;  2V2V A;  3GPA A;  4NLG A;  3WIU A;  3BN7 A;  1JLF B;  1NCL A;  2JH3 A;  2DHX A;  2RIJ A;  3FEZ A;  4QWC A;  5BXI A;  1S6U A;  3BPD A;  4ZHR A;  3HVT A;  1S9E A;  4YY3 J;  4WFZ A;  2RU3 A;  4YB6 A;  1U02 A;  2C2O B;  2GHP A;  1U26 A;  4M94 A;  1RTH B;  3H59 A;  2ATL A;  2N3O A;  4ATN A;  5IFM A;  4X62 F;  4LFB J;  4DV7 F;  4X4V A;  2FY1 A;  2ZH6 A;  4FF4 A;  1NKE A;  2YWH A;  1LOU A;  4M5K A;  4EYI B;  2D3U A;  1TU0 B;  2WW4 A;  4I56 A;  2XY5 A;  4NXM J;  3SV3 A;  1RYS A;  1ZYQ A;  4YB7 A;  4M5H A;  2QSW A;  4Q8E A;  4DR1 J;  3M30 B;  1Q8I A;  5HMY A;  2V6A A;  4IOA Q;  5GAG I;  2D41 A;  5JVH Q;  3OTO J;  4XK8 C;  4FVM A;  4QR2 A;  1Z2L A;  1CBK A;  1OSC A;  5K8O A;  4TQS A;  3J7Y U;  3PW0 A;  3N4W A;  3W2V B;  3GB0 A;  3DLJ A;  2WOM B;  4OZ3 A;  4TU7 A;  3TUI C;  1M90 T;  4F3M A;  2XWX A;  5K8M A;  2HVH A;  1OQ3 A;  1U48 A;  2GJ2 A;  2HGL A;  3K5P A;  4DG1 A;  2D7S A;  1JXL A;  5HQ8 A;  1TAU A;  1WC4 A;  5HP1 A;  2VDH A;  5KT4 A;  1KTV A;  5E41 A;  4I1T A;  4HT7 A;  2UXD F;  2MJU A;  2HGN A;  1J5E F;  3QQC D;  3NEK A;  4C3L A;  1OPZ A;  1HAR A;  4WTY A;  1RAC B;  2DNL A;  5KFB A;  1M0S A;  4FBU A;  2MQM A;  3K17 A;  3CDE A;  1UA0 A;  2DIT A;  4QZV B;  4YDX A;  3H7H B;  1M5S A;  1S1X B;  1LWE B;  1Q81 T;  2DCU B;  1HHS A;  3MM9 B;  2RDJ A;  5KFO A;  4Y65 A;  2NUH A;  5AJ3 J;  4NEY A;  1GMW A;  3ZTS A;  1RT6 B;  3F56 A;  1M1H A;  1YIJ S;  1KFD A;  1X5T A;  3UFC X;  4PQU B;  3NGK A;  4ICL B;  3K89 A;  1Q5Y A;  3W5X A;  3CCL S;  1P8G A;  2HAF A;  3SCI E;  3W9H A;  4WBF A;  5L9N A;  1MNE A;  1K8A T;  3I5A A;  1PJ7 A;  2VKR A;  3ZFV A;  2R2T A;  2EI5 A;  1HNI B;  1X8D A;  4LQ3 A;  5A8W B;  3RAM A;  3FQL A;  1XR6 A;  2QA4 G;  3T6B A;  3W64 A;  4DSI A;  1VQ4 S;  1UZH A;  3HJV A;  1UAW A;  3K8W A;  3CJ4 A;  2UUA J;  1H73 A;  1MU2 A;  1OYD A;  1RHQ B;  3DGV A;  5DO2 A;  1C4C A;  2RHQ B;  3SI8 A;  2GJI A;  3DYA A;  5C24 A;  2YNI B;  2CUY A;  3K5L A;  3PW5 A;  3TAN A;  4UOH A;  1SH0 A;  4U6P A;  1EET A;  4OHX A;  3DLB A;  4IDK B;  1U2R A;  3P8B B;  2HRU A;  4HKQ A;  3HX9 A;  3A3O B;  3QLH A;  4DR5 J;  2KH9 A;  1UEK A;  3DKD A;  1RWM B;  3C16 A;  5H1S V;  2ZH2 A;  3RZA A;  2KT2 A;  1MMN A;  3E2E A;  1XIQ A;  3DDK A;  4UOC A;  1VRT B;  3MFH A;  4C9D A;  4QIF A;  3R1L A;  2AZ1 A;  3MMJ A;  5BYQ A;  1NSP A;  1W25 A;  1L5U A;  1HNV A;  5CYJ A;  5B08 A;  3UCU P;  1WHW A;  2V4J B;  1KON A;  3MM6 B;  4X64 F;  2ZDP A;  3G71 S;  1Y0H A;  1EAR A;  2IYI A;  4LF6 F;  2M9K A;  4DS5 A;  4O0I A;  2XY6 A;  5MAO A;  2KXH A;  1RWP B;  1HKA A;  1LWC B;  4CLY A;  2ACM A;  2MQP A;  3UWT A;  3JQJ A;  1BXN A;  4P72 A;  3JTP A;  1F1B B;  2XLK A;  4IR9 A;  3C14 A;  3WDO A;  1IXK A;  1C2P A;  2EG1 A;  3MPV A;  4DV3 J;  1NHK L;  1X9W A;  1MN7 A;  1JMT A;  2NLW A;  2LEA A;  4B3S J;  1R3N A;  4N47 A;  4WFA Q;  3MEE B;  2DNK A;  5J2N B;  2W2N P;  1RT4 A;  2HLT A;  2W25 A;  3DRS B;  2IVF B;  3ZZR A;  2G4B A;  1WKL A;  2G0C A;  4Y34 A;  4B9V A;  1N32 J;  3F41 A;  2ACY A;  2YVS A;  3P6Y C;  4ZLL A;  1M1G A;  5I3P A;  2GVD B;  5HRO B;  3I5C A;  3C6U A;  2R8I A;  3CME S;  3US5 A;  1CC7 A;  5EX0 A;  1FDN A;  1SV5 B;  3CJK A;  2B43 A;  1T9X A;  4HR2 A;  4K2X A;  2GVZ A;  1HWK A;  3JSM A;  1ZOT A;  5A6P A;  1UPP A;  3EGN A;  4NZ0 A;  1OY9 A;  4Q44 A;  3CCM S;  2ZZT A;  5D4P A;  1UWA A;  3KK2 A;  1WC0 A;  1R8P A;  4KHM A;  2BAN A;  4OYI A;  2ERR A;  1H7W A;  3DMJ A;  4H4K C;  4JI8 J;  3NS5 A;  4RW7 B;  1FHT A;  3G4S S;  1GX5 A;  4DR4 J;  4Z7Y A;  3MMC B;  3HZE A;  1VK3 A;  3GV8 B;  4OJ1 A;  4YHH J;  2CAD A;  2HEK A;  3GWC A; 
#chains in the Genus database with same CATH homology
 2C2K B;  1BMQ B;  3R5J B;  2HBY B;  1RHM B;  1IBC B;  3IBF B;  3EDR B;  1RWX B;  1RWM B;  3D6F B;  2HBR B;  2CDR B;  3QNW B;  5K20 B;  2XYH B;  2H4W B;  3GJQ B;  3R7N B;  3KJN B;  1SC4 B;  3R6L B;  1RE1 B;  2H51 B;  2H5I B;  1RWN B;  1NME B;  3R7B B;  2CNK B;  4ZVT B;  4DCJ B;  2QL9 B;  3R6G B;  4ZVQ B;  1QDU B;  2XYG B;  4DCP B;  1I3O B;  2QLJ B;  5IC6 B;  2C2O B;  1QTN B;  2CJX B;  1RHR B;  1RWO B;  2QL7 B;  2DKO B;  2CNO B;  3R7S B;  2H54 B;  1I51 B;  3RJM B;  1F9E B;  4ZVO B;  2H48 B;  2H65 B;  2CJY B;  3GJT B;  1RHK B;  3GJR B;  2QLF B;  2XZD B;  3NS7 B;  2C1E B;  3KJF B;  4ZVU B;  2H4Y B;  4DCO B;  3P4U B;  2XZT B;  1RWP B;  5IC4 B;  1SC3 B;  2CNN B;  3P45 B;  4ZVS B;  1GFW B;  4ZVP B;  2FQQ B;  2Y0B B;  2HBQ B;  4JB8 B;  2C2Z B;  3D6M B;  4ZVR B;  2Y1L B;  2C2M B;  2XYP B;  1SC1 B;  1PAU B;  4LSZ B;  1RHQ B;  2CNL B;  2P2C B;  3GJS B;  2H5J B;  2HBZ B;  1RHJ B;  3EDQ B;  1PYO B;  3D6H B;  2QLB B;  3KJQ B;  1RWV B;  3IBC B;  1RWK B;  1ICE B;  3SIP B;  1RWW B;  2QL5 B;  1RHU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...