1RHKB

Crystal structure of the complex of caspase-3 with a phenyl-propyl-ketone inhibitor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
91
structure length
91
Chain Sequence
KIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-3
publication title Reducing the Peptidyl Features of Caspase-3 Inhibitors: A Structural Analysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 16
structure length 91
sequence length 91
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2003-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 1rhkB00
2DKOB 2XYHB 3D6FB 2Y0BB 2H51B 1ICEB 2CNOB 5IC6B 3GJQB 4ZVRB 3R7NB 1RHQB 4ZVSB 2XZTB 2CNLB 1RHKB 3R7SB 1RWVB 3IBCB 2H54B 4DCJB 2CNNB 2H5JB 3GJSB 1RWOB 3R5JB 5IC4B 1RHUB 3R6GB 1QDUB 2CJXB 2CJYB 1I3OB 1QTNB 2P2CB 2CDRB 3KJFB 3RJMB 4DCPB 2C2KB 2QL5B 3GJTB 4ZVPB 1RWNB 3R7BB 3NS7B 2H5IB 2FQQB 2QL9B 3EDRB 1RWMB 2Y1LB 3D6HB 2QLJB 2XZDB 2H4YB 1F9EB 3KJQB 1RHJB 2C2OB 2QLFB 2QL7B 4LSZB 3GJRB 1PYOB 1PAUB 3P4UB 3P45B 1SC1B 3D6MB 4ZVUB 1GFWB 1RWKB 2C2MB 1NMEB 1RWPB 3KJNB 2C2ZB 4ZVQB 2XYGB 3SIPB 4DCOB 3QNWB 2C1EB 4ZVOB 1IBCB 1RHRB 2HBZB 2CNKB 1RWWB 2H65B 1SC4B 3IBFB 1SC3B 2QLBB 2HBYB 1RE1B 4ZVTB 2XYPB 2H48B 4JB8B 3EDQB 1BMQB 3R6LB 2HBRB 2HBQB 5K20B 2H4WB 1I51B 1RHMB 1RWXB
chains in the Genus database with same CATH superfamily
3W9IA 1S6UA 4FPRA 3WBZA 2UV8G 3GP9A 3FBBA 5A0YA 1JNZB 1L5UA 2I38A 4I2QB 3R5JB 2RRBA 4NE9C 4Q44A 5EDWA 4DV5F 4P7TA 4F02A 4Q45A 1S72S 1IBKJ 2RS8A 3LP0A 1X4CA 4I67A 4DQRA 3O1LA 4N77A 1JXVA 1HFEL 2DB1A 2C3UA 2N7CA 2ERRA 1TTHB 2EFPA 2E5LJ 4W90B 4W92B 4WFZA 4KO0B 2A18A 3I0SB 2ROGA 1OY8A 4RW6A 3NGUA 3JXOA 2JEIA 4R5PB 4FF3A 1RHRB 1SXLA 3NCRA 4QIFA 3VZHA 4UQTA 5IT9U 4YN3B 3MEGB 3SQGB 5IWAF 4CO3A 2LLZA 3M8QA 4ZPDA 1XNQF 1S0OA 2A3JA 3FDSA 2AJ1A 1EKSA 2K06A 3BGUA 3NG8A 2XMJA 2GS8A 4DZ6A 4WP9A 2ASLA 4B3SF 5KFEA 4ENOA 5E7OB 1BXNA 2R7TA 4IKAA 4BLGA 4EU0A 4ALZA 2CJBA 4CO1A 3NS7B 2XMAA 3I0RB 4WFYA 1RBAA 2VIHA 3RBDA 3W64A 1NO8A 1GNKA 4K50A 5HQ8A 1ZS6A 3M8YA 4N8NA 3S01A 4LSNB 3CPWR 3RGIA 1R27B 1LOUA 1FESA 4DJBA 3OW2R 4LBIA 3PW5A 2C1EB 2GMLA 2YKOA 1T3OA 1N0UA 2KXHA 3QT6A 3H2LA 1ZA2B 3GG1A 4DX7A 3VAIA 5L9XA 3EXYA 2MGZA 2XSFA 2R7WA 1LK5A 1B7YB 2PDAA 2LXFA 5KOWA 2NQPA 2A6OA 2IM3A 3EXCX 2HRTA 3W5YA 2AZ3A 3CCSS 4J9UE 2DD8S 2XTJP 1U47A 1TP7A 5KT2A 4RBTA 4LQ3A 2Z58B 3J80U 4K4UA 3LWMA 4KH1B 1O5JA 3VVUA 3FGVA 2AX0A 1HBNB 1PBUA 3J81U 4KKOB 2J6SA 4H54A 4Z7CA 4DV1F 3M1VB 2JFKA 1M1HA 3GCWP 5GMKa 1S0MA 2JVOA 1TV6A 1WC6A 2BE9B 2XY6A 2AQ4A 1Z2LA 3ZO7A 4C8YA 4V19J 2DGSA 2W9CB 1HW8A 2VZ9A 1BC6A 1TZ0A 3IBFB 3PKMA 3F56A 1QM9A 3QAUA 2XYPB 4AXJA 3BZQA 2HNZA 2R7OA 4H4OB 5U47A 2XG8A 3CJKB 3AXKA 5A8KB 1QLNA 5HQMA 1BQXA 4DSIA 4NEYA 2C42A 2UUBF 2L9WA 1EZZB 2UXCF 3HJVA 5KFSA 4N5SA 1BE4A 1M5SA 1NJXA 1YBAA 1QDUB 2HFOA 5CYMB 5J2NA 1XERA 4I56A 5I42B 1I1GA 2HHHF 2BEFA 4HTJA 1M5OC 1MMNA 2ZE2A 3P8BB 4AD6A 1YJRA 1G1XA 1NK5A 1KQFB 4DV6F 3BBCA 1N6QA 4FBUA 4GC7A 4LFAF 2HNDA 4DFMA 5HVHA 4X66J 1TKXA 1KTVA 5AXNA 2YY3A 4LRBA 4ZA1A 1K0TA 3MZIA 1YI2S 3NGDA 3BQ1A 5C24A 3QSYB 1PCAA 5AJ3F 2JZ5A 1MU2A 3LGNA 3T6BA 4H4MA 2RQKA 3GIMA 3GPAA 1N5QA 3CCRS 2Z8QA 2E5IA 5H9EK 3BN7A 2C2RA 2FHOB 4QW9A 3IG1B 4K4XA 4UOFA 3QAEA 3PW2A 2Z2MA 5HBMB 2ABYA 2HFZA 2OSQA 4A8YA 2D3UA 2GVZA 3ENWA 4B17A 4JYAF 3BM7A 3N79A 4XTTA 4QIEA 4J9MA 4MIWA 1VLOA 5A0YB 4LF6F 2WBMA 5DDPC 4FZVA 2M9KA 3J80Y 2VOOA 1AFJA 4ED3A 2RF2A 4Q7AA 3HULA 2B8PA 4X4VA 3UPFA 2WONB 3J81Y 1H3DA 1LW2A 2RUGA 3TJ9A 5KFNA 4EBDA 2XZDB 1U7LA 3R5AA 4UF4A 3EGNA 2FGCA 2MLZA 2UUTA 3VTIA 3VAHA 3CMAS 3MAAA 3IM9A 4ES3A 3H8YA 2XYGB 2PEHA 1Y3JA 3BH6B 1N4LA 1IBCB 4LVOP 2XSJA 4RW6B 3VALA 3VGUA 4JOUA 4RW7A 1RK8A 1I6JA 3QT5A 1H6KX 2NXJA 2ZH1A 1HNIA 1XMOF 2CFXA 2YVSA 2QT7A 2GGPA 1Q95G 2NUUG 3EZ5A 3UCGA 4A8SA 3G6ES 2VICA 3PDNA 2QA4S 1FRKA 2BQUA 1U1LA 1EJ7L 3CJTA 5DG9A 3IWLA 1NK7A 1YZ6A 1ZM4A 1QSYA 3R6GB 4NCGA 4QOTA 2PFFB 1UWAA 4QU6A 3N4WA 3IO1A 4QW8A 3VAKA 2UUCJ 4O4RA 3QRRA 3SCKE 4DHVA 3GU0A 1RWMB 4NZ6A 3AA9A 1VIOA 3M30A 3DFEA 3US5A 4AFFA 1FI4A 2IA6A 3D2WA 4H4KC 4U8VA 1V3RA 3OLBA 1C0UA 3UNYA 2MQMA 4ZPBA 1LEOA 4TQRA 1J5EF 1S4EA 2DRBA 2FGOA 4QWCA 2GO8A 3O5TB 2BJ1A 2MHEA 5HJYA 3G4SS 4ZLNA 4DL0C 2MGZB 3RB6A 1WHYA 2DVIA 4GC6A 2YH1A 2DNMA 2N3LA 4JI5J 4OX6A 1U48A 2V8DA 2DY1A 2F8EX 3MFHA 1DAXA 4QCLA 2V8PA 4A46A 5HANA 2PSZA 2NXUA 3PX0A 3KYLA 1JJ4A 2RH3A 3N6MA 1Q8IA 4A8MP 2YNHA 4ZJQA 4ZK7M 2UXDF 3PIOQ 1FTRA 4MYUA 1HW9A 4NLUA 3TAMA 4JI8F 1TV6B 2UUAF 4P7VA 3C19A 5B7WA 2RRAA 3I55S 4BBYA 2J9DA 4ANEA 2GVDA 2OD6A 1SL2A 1U8WA 2CJAA 1O51A 2BACA 1IWGA 3ILJA 1NZ8A 5A76A 1T8EA 1EHWA 2HNZB 2GHVC 2YXLA 4PWUA 1FE4A 2IVFB 2BABA 2VBZA 2DCUB 2B9XA 2HIYA 4N8OA 4C98A 1NDLA 2GAGC 1S12A 1KVIA 1BQMA 5T7LA 1YQHA 2OELA 1XMQF 3Q2TC 1GTEA 1RB0A 2L9DA 4IFYA 5KG4A 4FF2A 3PCOB 3QZ8A 5KFPA 4MTPA 4CDIA 5AXLA 1P6TA 3UR3C 2YX7A 2ZE2B 3M2RA 2ZUGA 1YBUA 3IS9A 5IS2A 4X64J 4PYDA 3ADAC 1N6QB 3IRWP 2FHKA 3H5SA 2R8KA 1F0XA 2HNDB 1TKXB 3G8TA 3W8PA 1R0AA 4X4PA 4ZPWR 2XB2D 4IRDA 3PV8A 2OPRA 3GE9A 3M32A 1B70B 5C24B 3IWNC 1SV5A 1SC3B 4URSA 2FDNA 1N5YA 1KEKA 4WXWA 1XJWB 4UOHA 4URQU 1S99A 1NH8A 3BB5A 3M7VA 4KGKA 4U8YA 1HHSA 5RUBA 2CPYA 4YS2A 4IO9Q 2V94A 3JYTA 1Y7PA 3GJQB 5E0OA 4IOCQ 1N33J 2GVZB 5CAAA 7FD1A 3UCUP 2JSXA 4E2FB 4J9NA 4USVA 5KFLA 1CS4A 4LF7F 3RBXA 4ILLA 4QBUA 3IM8A 4D3HA 2JL9A 2QL5B 1VQLS 1FEEA 5AE1A 4DG1A 2RF2B 4ERDA 4QYRA 4DPWA 1OPIA 4W98A 3QJPA 1URNA 4EYIB 1N0VC 5DLGA 4NMXA 5KFZA 1LW2B 1VGYA 4ETZA 1U1OA 4DF8A 2XS5A 2HQIA 2I1RA 4NRUA 3KLFA 2VFTA 1QE1A 2FJVA 2P5VA 3MAAB 2QN6B 3EGWB 2FVQA 4IOAQ 2V67A 4C8LA 3IR6B 1NJWA 1XNRF 3FRYA 2G1DA 4QIVA 2QLBB 2XSJB 1FRIA 5LJ5Y 4CLKA 1WNEA 3X1LB 1GMUA 4RW7B 2HHQA 2RU3A 5FLXU 5H9EJ 4WWSA 3PRBA 3Q8QB 4ETXA 5C2CA 2YWHA 1HNIB 3CNQP 2GGPB 1RADB 1VQMS 4O4GA 5CCMA 4V19X 4LF5F 1RHKB 4WP8A 2VG6A 5CXTA 1IBMJ 2VD3A 3DLEB 2MEWA 1HNWJ 2CVIA 4UUXA 3LP1A 3MOJB 5LMNF 4NCGB 2H9ZA 2WB1D 1X5TA 4NMLA 4USMA 3D7SB 2KFYA 5ETNA 2LQ9A 1FKOA 3FMBA 2GNKA 4DV7J 3M30B 3ZZ0A 3I6PA 2O3DA 1M5PC 3CCVS 2W7AA 1GTHA 4C8ZA 3PNIA 2IJRA 4LF8J 2BJ7A 1C0UB 1X4DA 3MR3A 2ZJRQ 2HVDA 2G2YA 1RLDA 2DTJA 3EX7B 5JMNA 4PZVA 1T9YA 3JTNA 1S9FA 4L73A 1FXRA 2KFNA 4WU2A 5IM0A 1VRQC 2R8JA 1M0SA 4YDXA 1ZM3A 5ETPA 2YWGA 4ECZA 1NH7A 2Y1IA 4OX9F 2YWEA 2J76E 1RTZA 2HHVA 3G2XA 3CJ0A 5CD4A 1DY3A 3ENVA 3E3XA 2CPDA 2CXEA 2L08A 1K0VA 2YNHB 4JI6J 4DR7J 3HHLA 1R8AA 1RGVA 4YR0A 4RJVA 5M2PA 4CQ1A 3DRSA 1YDLA 5AXMA 3U27A 4AT1B 2V8VA 3U02A 2VKRA 4JI0F 3TAMB 4NLRA 1T95A 1EIYB 1WDTA 2DPIA 5L8RC 2HBZB 4IDKA 5A6WA 2KG0A 4OYIA 2JC0A 4NLGA 2ZOFA 2XMTA 2GVDB 2HBRB 4ZP6A 5FLXY 5KFGA 1WF2A 1FK9A 4WXOA 2XM3A 4X4TA 1TVRA 3BDPA 3CCJS 2Y3YA 4HLBA 3MM9A 4L3NA 3THVA 1R3NA 2EC0A 1RHQB 1X8DA 2XZTB 4K5SA 2CZ9A 4RU2A 2HK3A 4J91A 1BQMB 5T7LB 3JSYA 5BR8J 4IFYB 1JLQA 3NGSA 3OVAA 1PILA 3DOKA 2DT9A 2W7PA 2ZDOA 4DR3F 3L7PA 3UN3A 4F4XA 4KGVB 4CLUA 1RSCA 5E2QA 3M2RB 4WF9Q 5BJRA 5AT1B 4USUA 3HVTA 4TU9A 2CAJA 1T0TV 3M9OB 2NXEA 4YR2A 2BV3A 4F25A 1XEZA 1R0AB 2HWHA 2OPRB 4Y0FA 3PXGa 3I9V9 1OIAA 3M32B 2KJWA 2KDOA 2YQ0A 4WE1A 4F0MA 1SV5B 3H40A 2CDQA 4ZN3A 2ATCB 2BKPA 3A13A 1N5YB 4MIBA 3BPSP 4FVMA 2LECA 2E66A 4F0HA 2QA1A 2CQHA 4WJBA 2J8AA 4I4BA 1ZAVA 4O3RA 2QMUB 2GV1A 3T5HA 1H2UX 3JSRA 4E8UA 2GX8A 3JYTB 4K4TA 1JWWA 1I5OB 2VU5A 2CJYB 1IR1A 4L72B 4M5HA 2HYIB 4C8MA 3B4MA 1CS4B 5E41A 2BJ9A 2HHXA 3CB4A 4WFNQ 1KHVA 2H5IB 4JI2F 5GAHI 2KL8A 1TU0B 2B56A 4DG1B 1H73A 2DNZA 2X1BA 3N5BA 3KHLA 4LR9A 2RAQA 2J7WA 2E9TA 4A8QA 1DARA 2E5HA 5D3GA 1DHMA 2JJ4D 1WOPA 3UVJA 2K8GA 2P6SA 2U1AA 4USJC 2ZH6A 1QE1B 3U1MA 4GO7X 7AT1B 3DHWC 3HHNB 4CLTA 4FBTA 2KKHA 4UT4A 4PWDA 1C4CA 1RAHB 5LXYA 1MN7A 2XO7A 2E5GA 1VHFA 1HWUA 1MMDA 3WC2A 5GADU 1EB0A 3U1LA 2AYMA 2VBYA 2ZKUA 4AE5A 1RU2A 1JK9B 1VC5A 4MH8A 3V81A 5E3PA 1M1GA 2ZH7A 1WF0A 2M70A 2XWXA 2MTLA 2VG6B 4LF1A 3MR2A 2WVCA 2PD1A 3LP1B 2RD5C 5KFAA 5SZTA 4FXWA 3QJLA 3K8WA 4MJKA 3WZ0A 5DGBA 3HFKA 5CYQA 4BCAA 3CW2C 2DNHA 4TU7A 4YEAA 2ADCA 1YKWA 2F63A 1FKOB 3LPYA 2VG7A 2F5GA 2PO4A 1RQ0A 2EG2A 1Q7YT 1ULRA 2HNYB 4P52A 3H0PA 2I6WA 4DX5A 2KT5A 4ED1A 1Q8LA 2CZVC 4ZVHA 5AXKA 3DXBA 1OYDA 1S1WA 2HBYB 3VQTA 4X4UA 3G8SA 4ZVTB 3TZWA 5I3PA 4WIIA 3DOMA 3V2UC 1Q5VA 4OLOA 2BYCA 5HAOA 3TP2A 3BS9A 1FFGB 2MQNA 4NXMJ 4YY3J 3ILOA 3DDNA 5IM0B 1NJYA 3HPOA 1CEZA 1YJWS 2ZFHA 2HQCA 3AJ1A 1SJRA 2XS2A 3BREA 1Y9OA 3VQSA 1UZDA 2ZH8A 4R0EA 1W25A 3QGIA 2FZKB 3DMJA 1OY6A 3OHBA 3VAMA 3N6LA 4B3RJ 2HW3A 2DGQA 3KJVA 4KE5A 4O3PA 3ISND 1TR0A 2EWHA 2LFVA 3HHLB 4ZVUB 1QVGR 1PG5B 2MZQA 3TJAA 2HKEA 5B0BA 1WHWA 4OL8A 4JV2A 1NBEB 3DRSB 3NNAA 3KLEA 5DO2A 2QE5A 4PAAA 1X5OA 4YOEA 1RT7A 2UVVA 4IDKB 3K7RA 4L3KA 2JNJA 5KG0A 3SMZA 2BUNA 1NZAA 2KB2A 3QFWA 2M8DB 2HQFA 5HK4A 4ZLJA 5HMWA 2KYXA 3KWMA 1Y10A 2K3IA 1UVMA 3ILIA 3NXZA 2CQDA 1HNZJ 3HT0A 5KFXA 1FK9B 2XGPA 3QZ7A 1TVRB 4K4WA 3MM9B 2WAQD 2AEJA 2KXFA 2IM1A 2QG9B 2VQEF 1FD8A 4XDCA 3J7Z5 1K73T 1JLFA 1GMVA 3IFEA 3HO1A 1NSQA 2LA6A 3RRKA 4PR6A 4OYAA 1JLQB 2G13A 3CJ3A 3I87A 1NHKL 3D54A 5IXUA 2KM8C 3DOKB 2OIHA 2G0IA 2YKAA 2LEBA 5KFMA 3K58A 3KHHA 3HVAA 2VONA 3TVYA 1WC1A 1Q78A 1RZMA 3R97A 2LEAA 1X4FA 2MKKA 1DBDA 5CQGA 3VWSA 2OTLS 3CE8A 3RBZA 3MFIA 1JLCA 1R8CA 1REVB 2HVHA 1LFWA 3KTQA 1X5PA 4WE1B 2VBXA 1YHQS 3QO9A 3TA0A 4HT5A 3IP0A 2DK2A 1F9FA 4XDDA 2HQ3A 3Q2SC 4IH7A 1CULA 4Z2XA 3KK1A 1R8HA 3MM7B 3D67A 2E1CA 3K5MA 1HWKA 3RTVA 3CT9A 3AT1B 4KB7A 4I2PA 5A8RA 2W7OA 3CMQA 8RUCA 1TKZA 3KLIB 3RJMB 2W2OP 3OXGA 1H38A 4NLSA 1L3TA 1RABB 4UUWA 3SCLE 3GFXA 4C4WA 3KUEA 4DN0A 1FFWB 2WVBA 1WOOA 1NNDA 2EFQA 3M8PB 2JWNA 3GZ7A 2D3ZA 1YRTA 3D1HA 3NWRA 5HATA 4NLWA 2HURA 1WSVA 2QC3A 1SKUB 2R7QA 3DC2A 4ZHRA 1NB2A 4G3IA 3DDIA 5ITHA 2XI3A 3MR5A 1F1BB 5D3GB 3LWLA 3UVJB 4DSEA 3VAJA 1LWCA 3W9HA 3MF5A 4PG5A 1PJ6A 2LQJA 3DDKA 5DG8A 4X4SA 2NYHA 4AL6A 4PWDB 1J2VA 1SKSA 2FHJA 4EYHB 4OQJA 2ZEJA 4DZDA 3A3PB 3FEXB 2RIJA 2RSQA 2MYFA 2LQBA 5KFJA 3QRPA 2KVQE 3CCTA 5H1SV 3V81B 1UWBA 4L6V3 2RNEA 2R4FA 4LFBF 5B0DA 5KG5A 1VR6A 2FJEB 5GAEI 4Z7YA 4OI1A 4ZIWA 3TZZA 4P2FA 3CD7A 4ANDA 1ZYQA 4ZKAA 5CYQB 4QR2A 5K8PA 3AD7C 2ZBCA 4F3QA 2UXBF 2VHGA 3BJYA 1YJ9S 1RAIB 5LMUF 4EO8A 1XR5A 2VG7B 2RJZA 3IAS9 3HSGA 3RRGA 2DEJA 3M6VA 3UI3A 1VQ6S 4IH5A 3PW7A 1NM2A 3CWJA 3MOZA 4NLQA 4A48A 1KONA 4CZCA 1S1WB 1NB7A 3MPUB 3AD8C 2YKQA 4ELVA 3G71S 2PT0A 3DOMB 1MSWD 4Q8EA 4MT1A 1WEXA 5CCLA 1SL1A 3UD3P 1PSDA 1FWKA 4NLTA 1IBKF 2H1YA 3AOAA 4FYXB 4K8RA 4U7UK 1BD6A 2LQ5A 5D0HA 4DV0F 1LFPA 2PC6A 3PY8A 3FCHA 3GV7B 3V6DA 1NJIT 4K0KJ 4KFBB 2OEJA 2E7VA 4QYZJ 1PJ7A 3DMJB 1U0HA 1WI8A 1LW0B 4ZCLA 1S7HA 4LQ9A 1S48A 1A9NB 4J9PA 3KJVB 2BOAA 3B82A 1QSSA 1FF2A 2VUGA 4W4MA 4LFCF 2M5YA 3EVWA 5IFMA 3CXCR 2W4PA 3KLEB 4KY3A 5C7PA 3N0VA 2ZC4A 4P75A 3BGRA 5DQGA 1DQ8A 3FJ2A 3WX8A 1RT7B 1JLBA 4ED2A 4DQPA 2CA9A 1FKPA 4U7UD 2GW8A 4DXLA 3W61A 4NASA 1GMWA 2MQPA 4P2MA 2J5AA 2NLWA 4M95A 4OHVA 4ZLPA 5DS7A 1XWLA 1HBUA 1JLFB 2C3OA 3W3SA 2RKIA 4OHXA 5HJXA 3W2VA 3K5PA 2FC9A 4Y2CA 2E7XA 1WKLA 1IN0A 3DRRA 4ES1A 2OMLA 4N76A 2WRMA 4KGXB 1NXIA 2DNNA 3FUYA 4LREA 2YQ3A 4RNFA 2PGCA 4WP3A 4YHHF 1WWHA 4EUVA 1LNQA 2WSCC 1FNMA 2V2VA 3OSPA 4RW9A 1JLCB 4IR9A 4DV5J 1L3SA 2QTWA 3HI9A 3WHIA 3I4PA 3H4BA 1RKJA 1S1TA 4CLZA 2YNFA 2FHJD 3KMQA 3HHLC 1SQGA 1RHMB 5ETVA 1UVKA 3QO9B 4C2MA 3PW0A 2DKOB 2ZZNA 4L76A 2B6AA 2CWXA 4KC5A 5M2UA 1W7WA 3CDWA 4ID5A 4G65A 1T9XA 2BM0A 4RBUA 1CULB 3A1YG 3T5JA 3BSOA 1YITS 3SCJE 4JV5J 3OR2A 1KRPA 4P2SA 1RA6A 3VVTA 2AF6A 2Q66A 3D6TB 4I2PB 2VC0A 4ZP9A 2FPHX 1TKZB 4QPTA 3K17A 3KFWX 1XNQJ 3THTA 2OEMA 1IBLF 4F2RA 4FPIA 2J0WA 1UJ4A 3W2WA 4D3GA 4TY8B 3CCQS 1C1BA 4NWBA 2BE2A 3PTWA 4ZHRB 1YRXA 4LF9F 3PHEA 1FD2A 2DHHA 2IM2A 1N5VA 1U49A 1DRZA 1Z2ZA 3TNVA 3OTDA 4TN2A 4K5RA 1VLYA 1LWCB 5K9FA 3JS9A 4DPXA 2VA2A 2BXJA 2HVEA 1G3OA 1Q79A 2V4JA 3PR5B 4M1KA 1R0CB 3TJ8A 1NHVA 5L38A 3T1HF 1VQKS 3BYPA 4ZVRB 3R7NB 1MG7A 5GAEU 3J81j 1IJFB 2FB0A 2VPZB 3OJUA 3B78A 1QAIA 3OUYA 4NPOA 3BSAA 2QGFB 1RA7A 1KSPA 1S1VA 2L41A 1XN9A 2AGPA 1S6PA 2YX4A 1W2IA 4OYZA 1UWBB 5B09A 2W2MP 2BRLA 3OV7A 4ZVPB 3VV2B 1DQ9A 3BSNA 4U6PA 3KK3A 5LM7E 1F60B 1UFLA 2CG4A 3MM6B 2MQ8A 2WB4A 3R8YA 4F4KA 5E5NA 3MMJA 3AH6A 1CJKA 3TOQA 1KC8T 1RTIA 1T9WA 2CNKB 4MMOA 4ECSA 3TAQA 2V2KA 3DGPA 1HHTP 4KPCA 3K89A 1C2PA 1D9DA 3DU6A 4P74A 2W25A 1IKVA 3TEGA 3PG9A 3ZXWA 5IT4A 3I82A 3BR9A 2HG4A 2MB0B 1GMWD 1Q81T 2FJWA 3OFHA 3IBCB 1KFDA 3W8GA 2DGXA 2XS7A 4Y6IA 4Q0BA 1RT5A 2ILYA 4P72A 2DXFA 4P71A 1RWNB 3CDAA 2MY7A 4ZP8A 2Z2YB 3FEYB 5KFYA 3V6DB 1PBAA 4ED4A 1UEUA 4DF4A 1U0HB 2ZBQA 3FSIA 4EBEA 5IOLA 2J6UA 4ZPCA 4OZ5A 2UUBJ 2C2MB 2D69A 2HFVA 3SXLA 1FWPA 4IR1A 2XWYA 1K44A 2JH3A 1NKBA 3M6WA 3UFCX 3R5CA 3T5LA 5D6GA 3OR1A 1Q7LB 2G2OA 5KFWA 2HHHJ 4TU8A 4A47A 1V6HA 3MEDA 3MPWA 3R6LB 3I31A 3BGRB 5L46A 4M63A 4DV6J 3ZZOA 2MQQA 2F4FA 4DPYA 1JLBB 5K8NA 3GWCA 1E6YB 4LFAJ 1AYEA 1FKPB 5LSRA 1P8GA 2XZWA 2VFSA 5A2QU 2R9LA 5CZVA 2ZNZA 2UUCF 2EK1A 2K7JA 1NHUA 3PJ9A 5KFFA 1NCLA 1X9WA 5AJ3J 1N5SA 1FXLA 4DQQA 3DLHA 4QWAA 4EBCA 2W8KA 2WVFA 2PA8D 2XI2A 1HBUB 1JLGA 4CWBA 2YWKA 2RKIB 2RHQB 4GRSA 2LU1A 5K5MA 3PM9A 3W2VB 3H59A 6AT1B 4WTOB 4FNIA 5D4OA 1KS2A 1VQOS 2FY8A 4DR4F 4JYAJ 3AJDA 3DRRB 1TKTA 1S76D 1WACA 3RUBL 2GC8A 4CLPA 2WSEC 3FZBA 1A6LA 1R0BG 1VYAA 1WHXA 4OHYA 2HWIA 1N56A 1ZOTA 4DL2A 3M9MB 1NRKA 4Z37A 1YJNS 1FRLA 4I0WA 2I8EA 4RW9B 5CHCB 3BKTA 3AOCA 1H7XA 2W4DA 3Q8PB 1TL5A 1S1TB 2YNFB 5C25A 1KR4A 4K59A 1LXNA 4O3SA 1VRUA 2BQRA 2XMMA 3MCMA 2B6AB 2VC1A 4IG0A 2EEYA 4ED6A 4ID5B 2N82B 4M94A 5LSLA 4TLQA 3DRYA 3Q22A 5EGYA 2W2QP 9ATCB 4N47A 4L74A 3IWXA 2CQBA 3OR2B 2ZBRA 1X9SA 1L3UA 2LCWA 1O8BA 1RCOB 3FBCA 1U1KA 2C2EA 1V9OA 2RHSB 5BYRA 3SFGA 1XMOJ 4FYVB 5K14A 1QSLA 1KLMB 3NNHA 4WFXA 4ECRA 3KNGA 5L1JA 1YJVA 3EWGA 3TX8A 3UCZP 5DM7Q 2I2YA 3ZZPA 4F4ZA 3W2WB 1RYRA 1VK8A 1C1BB 1KQKA 1R6VA 3HCXA 2BE2B 2GZOA 5HL7Q 3ELHA 4XIUA 2D7SA 2HK2A 2Y1RI 3CGIA 4LRDA 2H48B 3TZXA 3A8EA 2I9SA 3RAMA 4UZBA 3G9CA 4I7FB 3T41A 2ASDA 5KG6A 3TAPA 1RT2A 4RNMA 2V4JB 4CIOA 1NLKL 1N32F 5A2QY 2L3MA 4KHPF 1VQ4S 2AWZA 2V9WA 3OUYB 4P2XA 2DCLA 1J5EJ 1S1VB 4PG4A 1B99A 4FN5A 2B51A 1IM6A 3B6BA 1S6PB 3IBWA 4FDFA 2HVZA 1CVJA 1FRXA 2QMXA 4PUOA 5KFUA 3KK3B 4EZ6A 3Q8SB 5GAGI 4IRCA 3I96A 4DUZF 4ZPAA 1ZM9A 1CG2A 2J9DE 1CJKB 1VCTA 3AD9C 1RTIB 1X0PA 1B7FA 3BGOP 1WC0A 3M8SA 1FERA 3FC9A 3R5BA 1N33F 4KHMA 4LIWA 2AX1A 1IR0A 2P6TA 3DGPB 1SH2A 2BQ3A 3T6JA 2HGMA 1RWXB 1C4AA 3H42A 1VBYA 3ZZRA 1IKVB 1G6BA 3DN9A 3UD5A 5J1PA 1JJ2R 1VK3A 4JI8J 2O01C 4YB1P 1AA1B 4P6QA 1PYTA 1A7GE 4C11B 2HFSA 2CDRB 2D3OR 2LU2A 5HP1A 3SZ2A 4PRFA 3OXLA 3DI6A 4Q0BB 2WOMB 1RT5B 3EMTA 5ADZA 5F3TA 4WPAA 3IMQJ 4ZJOA 3H2UB 4M5KA 3CC7S 5FJ4A 3NEKA 3DYAA 5J2QA 5H9FK 3J7YI 1Y3KA 4LR8A 1XR6A 1R8PA 2HIQA 4WTYA 4WKRA 3GIKA 1XMQJ 3I56S 5KG7A 2X3DA 3K2YA 1OSCA 1P27B 1TUWA 2DYAA 3QJJA 1RAFB 3POTA 2QFJA 2B7BB 1G7CB 1S97A 3LAMA 1YG0A 3OR1B 2AV5A 3AJ2A 4JV0A 3GYGA 5ETQA 5ETKA 4F4WA 3W65A 3MEDB 3PZPA 1HNWF 4NI2A 4RU9A 2GMHA 2HRUA 2AYGA 1OSDA 4OYXA 2FC8A 4DR2F 4RL1A 2F40A 3QIDA 3GG0A 2Y8WA 2AU0A 2DNKA 2BM1A 3HSDA 2KH9A 1RHUB 2MQLA 3MWBA 2ZNYA 4Y2AA 1F2HA 4G1IA 4DV7F 5G0RA 1ZTTA 4TYAA 3H5UA 1JKHA 1I94F 1LWEA 2OPQA 1FRJA 2EFNA 3ZZYA 2WCXA 4KGZB 2ZM6J 2QEXS 1JLGB 1EP4A 1FDNA 4YP3A 4DV4F 1SC1B 2RMLA 4ZVQB 2Y0SD 1TKTB 3N9UC 3OVSA 2BZ2A 2N4DA 5HVGA 5GMDA 1NK0A 1HR0F 4LF7J 2G2ZA 2CWKA 2OSRA 4FYYB 1GK8A 2F4VJ 2CQGA 1SL0A 2WK4A 1MWQA 4X4RA 3C46A 2HEKA 4F36A 2ZJPQ 5C25B 3A4TA 1WHVA 4KTQA 3CIMA 2A1BA 1VRUB 1IM4A 2BBEA 1MWYA 4IG0B 5KFQA 1TK5A 4HHJA 3MUVP 1XNRJ 3UWTA 1O6XA 4B9LA 1U2RA 3CUNA 1P9YA 1B0TA 2HHPA 3GJTB 4EZ9A 1MNEA 4X65F 3TQEA 1IKWA 4OZ2A 3MPYA 2DXDA 3KDNA 2HRYA 5IV3A 2LDYA 5K14B 4GMKA 2E1PA 4LBPA 4OJHA 2MKSA 1P1LA 2OUGA 1RAGB 3D0GE 2Z30B 4EWTA 1U1RA 3MGJA 2KI2A 1DTQB 2MMYA 2OLWA 2JX2A 3MCNA 3CCLS 1GT8A 2PFDA 1M5HA 3TR5A 4X62J 1Q4RA 1N88A 2VPWB 5BR8F 4OMFG 4RO0A 2IIHA 2D74B 4UOCA 4RBVA 5MLCV 1RT2B 5KG2A 1R7IA 3E8OA 1IQTA 1KD1T 2DIUA 3MCOA 4DQSA 2OPSA 1X5SA 2BW2A 1MW7A 2XY7A 3SSRA 2NSCA 4M5LA 3QMQA 4B02A 2JEFA 2FJXA 2J0QD 4PUOB 4JBCA 4RUCA 3K5NA 4LSZB 5IT9Y 4DBQA 3DLGA 3KMSA 1SIWB 4B3OA 1X4HA 4DPOA 1SPBP 1WDDA 1S9GA 2FVRA 1RLCL 1PAEX 5B0EA 2A6MA 2C2DA 1F9HA 3RW7A 1Q0NA 3FBEA 1Z1ZA 3E51A 2R42A 3TX0A 1UETA 1WEYA 4HH0A 2VV5A 1HD0A 1FVSA 1U6ZA 1FHTA 1HHQA 2CPJA 4HDGA 4ANCA 4ZPVR 1ZBTA 1FRMA 3ZTRA 4JI0J 1X31C 2DPJA 1LQ9A 2AJFE 5DLFA 4J37A 2C28A 2F9DA 3DRXA 4TYBA 3DCAA 4JI3F 1L3VA 2V68A 4RWXA 3LQVA 3QYYA 4XK8C 4NLYA 3P49B 1GX5A 3GB0A 5HP1B 1AXQA 1KTQA 3CIZA 4C0HA 3DI6B 2GIQA 3KK2A 4FS2A 3ULHA 4MKBA 4MKVA 5G4DA 3IAM9 3AOBA 3A8IA 5J2QB 2VQFF 4OLPA 2YQ1A 3TEHB 2R7RA 1V3SA 4ICLA 3M6UA 2LMIA 1OYEA 5KFTA 3D1OA 3ZZTA 2MXYA 1Q16B 4KHRA 3CDEA 1TMMA 2IFXA 1SJQA 1WF1A 1FJ7A 3NS6A 4I69A 3UN2A 1DURA 4BC7A 3PEJA 3POTB 4DR3J 3D3BJ 3D5MA 3KLHA 2HPUA 2O66A 1S7IA 3GV8B 4NI2B 2FIUA 4EEYA 1VIXA 1WC5A 1VJQA 2SXLA 2ZOGA 2D9PA 1FVQA 2COLA 4RNHA 1HNXF 3QT7A 1Q86T 3LP0B 3H2VE 1A0OB 2M3DA 4XO0A 1U2FA 3TUIC 2EXUA 4WYWA 2VFUA 3LOUA 4NCAA 2X3GA 3MPVA 2DNPA 2KYZA 2MDAA 5G0RB 3EDRB 1JKHB 4B08A 1VMBA 5HQLA 3RG6A 2OPQB 1X4AA 2QLFB 1EP4B 2ZJQQ 2EW9A 3LTOA 1PAUB 1UEVA 2MZJA 1GFWB 5H9FJ 1U25A 3I9ZA 1N52B 3MI7X 2QX0A 3M8QB 2BVZA 4U9RA 4RUAA 2AEFA 2B5JA 4U67Q 2WZ1A 4KYZA 1PC5A 2IAJA 2P8IA 3C2PA 1NDCA 4NXMF 4USTA 3Q8YA 4J9SA 4YY3F 4B9SA 4MYTA 2AP6A 1QY7A 2V2ZA 4RNOA 4JI2J 1MMLA 5I4MA 4OZJA 3DKDA 3N5FA 2DHSA 3W9JA 1T03A 4TY9A 1RCXB 2JHEA 3JB9k 3L4BC 3LGMA 1S79A 3PJWA 4HKQA 1RWUA 2KU7A 3T9ZA 2W9AA 2NXCA 2AJ4A 4DSJA 3BSCA 4BHQA 2Y1JA 1UJ5A 2NPFA 3CC2S 2C3PA 5L1IA 4BWJA 1M1KT 2BRKA 3OFEA 1VJWA 1UW9A 1CC8A 3W5XA 5EN1A 3CDBA 1U26A 2R2RA 5HVFA 3KUHA 4ZDNA 3WC0A 3GTYX 1IKWB 1QUVA 3ZZZA 4CRJA 1RBOB 4NA3A 3HLUA 4TXSA 4DEZA 2V69A 1ZZNA 1F2GA 1HWJA 4E98A 2DO4A 4XPEA 1CJUA 4PXEA 1S57A 1HNZF 4A8FA 3HHEA 2DGOA 4A8KA 4KR0B 2EKNA 2GJIA 5SUHA 3I5BA 4LSLA 5HMZA 3J7ZT 2ROEA 4UW2A 4IFVA 1KQSR 4WYLA 3TA1A 3CJ4A 3PR4A 4M8LA 2ACYA 3BV8A 1KVJA 3MTKA 2UU9F 2CVEA 3QQCD 3GIIA 3LP2A 1FT8A 3MCSA 3NOGA 3MECA 2GQ2A 3HK2A 1D3WA 3U1NA 1G2EA 1RACB 3RR7A 3H98A 2OTJS 2C2KB 4PWWA 3LW5C 2R8HA 4OJGA 3IGNA 3VGVA 4J9QA 1TK8A 1AROP 3ETMA 2KFZA 4YB7A 1IJEB 2H5EA 4GO5X 4DS5A 3EM1A 3DLGB 4B3OB 3OTEA 4DCOB 3ZNJ1 2JDJA 2DR7A 1S9GB 3UDVA 2H65B 3PO4A 3DHXA 4C7QA 3X3UA 4KO0A 1NSKL 1RT6A 3EYZA 2MSTA 2ZBPA 2B0GA 2KJVA 3FSYA 1JMTA 2OFGX 4DDFA 2CJKA 1HL6A 5J2NB 3MAQA 4KIAA 2JEGA 4Q43A 3TARA 2E7WA 3TUPA 1HNVA 1J5OA 1X7VA 2XMKA 2QLXA 3P5BP 1UVNA 3JQMA 2MHNA 2GFFA 4B3TF 1RJJA 3BO2A 3OPKA 3R7BB 4NLXA 4ED7A 1ZZFA 4XPCA 2Y1LB 2QSFA 2F65A 4IQXA 1BQNA 3AB4B 1V3ZA 1Y0HA 2IY5B 2YX1A 2RVJA 4OX7A 3Q23A 1MU2B 4JI4F 1EX8A 1RHJB 4Q2MA 3KK2B 4H4MB 3CCMS 2QA2A 2F8MA 2WVEA 4O3NA 1VQPS 1B3TA 4FS1A 2GQCA 2CIMA 4ZVOB 1OWXA 9RUBA 2YKPA 1RAOA 3WDOA 1UA1A 1TFYA 4ICLB 2KRBA 2AT1B 1SJ3P 1DLOA 3N01A 1HWLA 3D4JA 1Q82T 2V9KA 4ZVGA 3MDFA 1QD1A 3KNAA 5FDLA 2DRDA 4QWDA 1S0NA 1JB0C 2I5JA 3GYNA 3Q89A 2H51B 3KLHB 3H90A 2AMCB 3EVOA 4DS4A 2NYIA 2DGVA 1VQYA 1S4FA 1KWMA 5EUHA 5B0FA 5B0AA 1WG5A 5IC4B 2APOA 3G6VA 3QLHA 1B0PA 3EZOA 2EFVA 5KAKA 2KZZA 1UA0A 1OS5A 4ZP7A 1LWFA 1F5BA 3UW1A 5A8WA 2ATLA 2MPUA 3BBFA 5K8MA 3G6XA 3NLCA 1RAEB 3HHDA 2B4OA 5DGAA 1C0TA 3W5ZA 4LVNP 3R1HA 2RDDA 3L7UA 1S49A 3I5CA 5FIIA 3SDEA 1VS3A 2VDIA 2B5JB 3FQKA 1VFJA 3MMBA 1AUSL 3CCUS 2E1AA 4OZLA 4OYWA 2IAJB 2JFDA 3TWZA 3MD3A 3BBBA 2ZH3A 3NY0A 2FYXA 3CMES 1T03B 3NAIA 2CQIA 4X4QA 4H4OA 2RQ4A 3CC4S 1D9AA 4ILMA 4WZQA 1Y5IB 2HSEB 3EZUA 1PIEA 3VGTA 5HLFA 5HSPA 3KG0A 1K1SA 3QWPA 4EMDA 2HFUA 5HROA 4X4NA 2M88A 3MM8A 2UVUA 1ZAXA 2QLJB 2D9OA 5KFVA 1SJ4P 1TK0A 2IHR1 3ILLA 5I42A 4LUBA 1HIYA 4LR7A 4YUDA 4JI7F 3T3FA 2CYYA 4HYKA 2XULA 1WORA 1LV5A 4UY85 3K8VA 3DM2A 4NRTA 4NLPA 4WIQA 2NXNA 1U1QA 2YWWA 4PXCA 4JUZA 3UDEA 3T5KA 4DOZA 2XLKA 4LF4F 2KM8B 1CJUB 1TL4A 4I6WA 1KVKA 1PJ5A 5E3RA 5CZXA 2ZHOA 4MIAA 2OAUA 1WD6A 2V0NA 4F3MA 5F8JA 1CLFA 1ZTWA 1R6YA 2H4WB 2GJ2A 4CI0B 5KFKA 3P5TL 3G8QA 2ZH2A 4LSLB 4IFVB 5F9LA 3IG1A 1VQ8S 2IM0A 2YKNA 5BXIA 1NDPA 1KBRA 4DR1J 5LMUJ 5C42A 2QSWA 3M2UA 1TKDA 3T19A 4I1TA 1QTMA 3LP2B 1W2BR 3MECB 2B9YA 1Q8KA 3DU5A 4DCPB 4R8UA 1GQEA 3TZYA 4RNNA 4DV2F 3NMAA 2ZH5A 2QLWA 4GKKF 1XIQA 1FJGF 3MMCA 5JXSA 3MM5A 3CVKA 4IO1A 2XMUA 2IBKA 2W2PP 2QL7B 4KQZA 4C6AA 4HDHA 1XK8A 2EFOA 3OTOF 2JLEA 4U7CA 3VAGA 2AJ0A 2WONA 4F4YA 2FUG9 4YMEA 3GQCA 3R5DA 4CP5A 4DL4A 2MKCA 4USWA 4LRCA 4ED8A 2HHWA 1TMJA 2JVRA 4RLEA 4DV0J 3M8RA 1QUPA 1CQMA 1HKAA 2HAIA 1RT6B 5E3AA 4C0BA 3RR8A 1SCJB 3UDLA 4JV5F 3BR8A 2BA9A 5DZ6A 1NK8A 3KG1A 1KNZA 2NCKL 5F3ZA 2WW4A 3H4DA 3W63A 3AFGA 1VBKA 4DUTA 3SYZA 3RB4A 4ZMMA 1HNVB 1WC4A 1J5OB 2NZ4A 1QVFR 3KHGA 4LFCJ 3SCIE 3IS9B 5DDOC 2NPIA 5F0UA 5LSOA 4OI2A 4FYDA 4YB5A 5EWEA 2F7VA 4RWWA 3C6TA 5C2GA 3PFOA 2HAFA 2Q6CA 4ES2A 4RUHA 1TELA 5J1EA 2Y9HA 1BQNB 1QJHA 4GVLA 3CF5Q 2RDJA 3OTCA 1NMEB 1F3FA 1ROFA 5EWFA 3ZC4A 3JQJA 3N28A 3QGPA 3CJ8A 1T9VA 2IDEA 1HPZA 1U09A 3SI8A 3MEEA 4CLWA 1UAWA 1S59A 1DLOB 1S6QA 1V5IB 5F8GA 2HBQB 1SH3A 3UNGC 5J2MA 2VG5A 2ROPA 5FDLB 1ZPWX 3GFZA 4M5JA 4A8XA 4CLLA 4AQYJ 3MUMP 2IVYA 4NYOA 2I5JB 2DIVA 3BGFA 3NRBA 2G1HA 4B9NA 5J1NA 4RW4A 3R1LA 2FJDB 3SSQA 3FFIA 5EHHA 4YHHJ 2EPIA 3KJFB 4ITSA 2FHMA 3QLHB 1U24A 4LBHA 4DFPA 2QL9B 2MKJA 3CEDA 1LWFB 5M2RA 4ZJLA 3KLFB 2BE7D 1OQ6A 5A8WB 2R7SA 2ZWPA 2HS0A 3HKWA 2XGQA 1U6BA 3OL9A 4KRWA 4IQMA 2RQCA 1NKEA 2GHPA 4NZ7A 2VFRA 2VH7A 4ZCKA 3PVXA 3L09A 4NXNF 3ISZA 3M8WA 1QAXA 1QAYA 1C0TB 1FA0A 1GX6A 2HHSA 1U8SA 3BKUA 1HQUA 2HS3A 3K59A 3SDEB 4Y2MA 3PACA 1BUXA 4J5OA 1DQAA 5GMEA 3EE3A 3MMBB 3EGVA 1U1NA 4O4GB 2MKHA 2PN6A 3C14A 3PYGA 3Q0AA 1IBLJ 3D0HE 1H0HB 3M8ZA 4QYZK 4GKJF 5D78A 2YWFA 4CO4A 2XMVA 3AQPA 5LT5A 2MQOA 1SKWA 2R8IA 4ED0A 1JXLA 4CYUA 4LF9J 4MK7A 3HHLD 2E1MC 5IV4A 5K8OA 5C5JA 2K7KA 1NSAA 1RTDA 2DGWA 1AB8A 2PI4A 2FLOA 3DRPA 3OTBA 2EBGA 5HLFB 3GIJA 2YNIA 1R31A 1GEHA 2FQQB 5ETSA 5KT7A 2WW8A 5D8HB 4B9TA 4FKYA 4UZCA 5HROB 3MM8B 4OFZA 5GVQA 5KFHA 3E01A 2J9EA 2FZGB 1REGX 3T1HJ 4ZCIA 3A8JA 1N34J 1HQ2A 3J7A1 2IC3A 1RT3A 3V5RA 4B3MJ 1ZETA 2MZTA 3DM2B 4GVBA 1D8YA 2WSFC 3G6YA 2Z4PA 4C0OC 1BGXT 4NA2A 2CPHA 4DR5F 3GFYA 3L7OA 4DUYJ 5HO4A 3T9NA 1NU4A 1FNOA 2CUYA 3JAMU 2V8HA 1TL3A 3HFZB 1VQ7S 4WZMA 2QA4G 2PEBA 1YBTA 2DR5A 4C97A 2PMZD 2BMBA 4EI2A 2HLUA 1TAUA 2AJQA 1ITPA 2HLTA 4K2JA 5KT6A 5D0EA 3G96A 2YKNB 4RKUC 4C8KA 3D28A 2CJ9A 3ETOA 4N56A 5C42B 1OMSA 3M2UB 4ZOSA 3R2CJ 4OI6A 3S7RA 5F0WA 1RAAB 4R8UB 3NNCA 2BKOA 2DEIA 1UCNA 2H3EB 3MMCB 3CD5A 3HT3A 3MM5B 5DETA 1S9EA 4YDDB 5MAOA 1G4CA 5IZHA 1UZHA 4IYQA 5DJBA 3CD0A 4CH7A 3KJNB 3O8WA 1GXLA 1D09B 3KKFA 4KT0C 1M90T 5IT0A 1HA1A 5D77A 1RE1B 2RB7A 1S1XA 3EUNA 3FNNA 3HHKA 4MFBA 3MXHP 4QJVA 5K20B 2W8LA 4ZS6A 2BJ3A 2XC9A 3D6FB 4ZLLA 4DX8H 2RS2A 1WC3A 5THWA 2XO6A 2K2PA 1T02A 1O0PA 1VC0A 4PEOA 2WHOA 4DCJB 4RX6A 5KFDA 2VPYB 1EARA 1NUEA 4G1QA 3HVTB 3GV5B 2BW7A 3DLEA 3WX4A 2B43A 2DJWA 3W62A 2YPZA 1UVJA 4EGLA 1IKXA 3MAHA 2OO4A 1MROA 2KHDA 1KLNA 3B54A 1W26A 3C6TB 1TUGB 3ITHA 3AB2B 5J1EB 2J8SA 3LPEA 3RYLA 2K1RA 2VA3A 1T94A 3SIPB 3HZGA 4OJ1A 2HHUA 1BWEA 3RAXA 3F41A 2MLYA 4OZ1A 3TANA 3HDSA 2UVRA 1M5VC 3JTOA 1YTYA 2KO1A 8ATCB 1HPZB 4HR2A 2Q3PA 5CH7B 5GAHU 2LP4A 3MEEB 2BX6A 4YFUA 2A2CA 4EK2A 3HSZA 3ONQA 4DFKA 3JAMY 1FWLA 1S6QB 4OV6A 5J2MB 3PRVA 2VG5B 2FLLA 4A8WA 4DR4J 2AKWB 3B8HA 2WTFA 3HXMA 5L9NA 4A8OA 4DL5A 4ZCMA 5B08A 4Y3CA 4RW4B 4DV3F 5F8LA 2DNQA 3IGVA 3D3CJ 1N36F 5KT5A 1FJCA 3FFIB 4P9SA 4C3LA 1U0SA 2O67A 5F8NA 1RU1A 2H4YB 4HI2A 4NLVA 1K8AT 3TVZA 2EFGA 1T9UA 1FJEB 1EQ0A 1BHNA 1QAJA 4RW8A 5I3QA 4OYBA 3SSSA 2B8QA 2KXNB 3FK4A 1CPZA 2OEKA 3OBIA 3VZIA 1RT1A 4FNHA 3DLLQ 4JI1F 1BMQB 2LVWA 2VKZG 1HQUB 1WUUA 4S0MA 2KZMA 3DNCA 3PX4A 4DR6F 1N5TA 1T11A 1S6OA 2MJUA 2O5DA 2JOQA 3C14B 3BGLA 3FRZA 2HZAA 2DR9A 3M6XA 3ENAA 3F73A 5KG1A 2H5JB 3T1YJ 3D68A 4ZITA 4E0DA 2LKZA 3TRGA 2P2CB 2E5JA 4CYUB 4ATNA 2QZ8A 3BO3A 3TUJC 1Z4UA 1RTDB 4I6AA 3DRPB 1BY9A 4URGA 1CSJA 1S10A 1T05A 3BYRA 2YNIB 1K47A 1RKIA 2QJ3A 3OFFA 3CJRA 4G6VB 2RE1A 2V34A 2CQ0A 1PYOB 2GHWA 2ZC3A 2VFVA 2HFNA 1RWKB 3E01B 2V6AA 1N32J 5BYQA 4QPXA 2FZCB 4NYPA 4KHPJ 3TO8A 1OQ3A 4ILRA 2YTCA 1WSRA 2DR6A 2IC3B 1RT3B 4GVBB 3EICA 2HGLA 8AT1B 4LF2A 1AT1B 2E29A 1ACMB 5F8MA 1HBMA 4KJIA 1F5AA 2V63A 2F3JA 1TL3B 4CO0A 4DQIA 2RQMA 2B7CB 4HI1A 4DUZJ 2E5LF 5JUMA 2MLXA 2DISA 2Q79A 3CTRA 2UV8A 3GLJA 2YNGA 5KTQA 2ZM6F 1H2TZ 1RWOB 1F5CA 1L3KA 2XNQA 2JEJA 3ZZUA 4DL3A 2ZD1A 1X9MA 3IA0A 2QO3A 4TQSA 1YIJS 2Z0GA 2EI5A 4IG3A 2QFIA 2F4VF 1S9EB 4NOHA 3LUYA 3BN4A 4X84A 1AUDA 2PE8A 3LGHA 5HMYA 3EGZA 2KRRA 2Q43A 3M05A 4CT8A 3QT8A 4BC9A 1SVDA 3FCWA 1S1XB 3I4HX 5D4LA 1UPMB 1HWIA 1NPPA 2F8HA 3DXSX 4MFBB 2IYIA 1K9MT 3AXMA 4DSLA 2UP1A 4Y28C 4WBFA 1HI1A 3MUTP 1VQSA 3QBCA 1P1TA 1S77D 2CJQA 1H2VZ 3MR6A 1Q1KA 3UR0A 3DLKA 4FYWB 3S6EA 3TQ1A 5HMXA 3A3OB 2M7SA 2M2BA 3QSIA 4OJ3A 2DNGA 3G87A 1EETA 4G1QB 5CD4H 3J7AN 3UD4P 2CG8A 1IKXB 3BPDA 3PEHA 5GADI 4DR2J 3C6UA 4K4SA 1MROB 3QIPA 2OH2A 3FBFA 3UQSA 3CSKA 2RRNA 3ITHB 3A8KA 2LA4A 3R27A 4ER8A 1X4EA 4DN9A 3IRXA 4I68A 1EQMA 3MPDA 2K1RB 4X62F 2M4MA 3IR7B 1GAOA 4CNZA 2RUSA 3VHQA 3OL7A 4C3KA 1Q5YA 3P96A 1GH8A 5ETLA 2HNYA 1I94J 3E2EA 4ECTA 1SQFA 3KK1B 1UTAA 2CQ4A 3BQ0A 3G86A 1FEHA 2P9CA 4USHA 1BWVA 3RBEA 2DH8A 3CCWA 5ETRA 4LIRA 5A8RB 4DV4J 5FD1A 2M8HA 1VQ9S 5IWAJ 2V2QA 1UMJA 2ILZA 4O3QA 4MK9A 3OT9A 4DFJA 5F41A 2BANA 2CNNB 2IVMA 1ZPVA 2BDPA 2RU9A 4Q8FA 2EG1A 3Q8UA 1HR0J 4B3SJ 2RDIA 4EO6A 4ZN1A 1VRTA 1WKJA 2LYVA 1XQIA 2C2OB 2XNRA 1R43A 5F9NA 3GYXB 3P45B 1GXUA 5HI7A 3KUGA 4HACA 2D1CA 4F50A 4J90A 3SBMA 1RWPB 3CCZA 2FLNA 4RW8B 3BKFA 3M9NB 1U4BA 4Q5VA 4PPDA 1SI9A 1FO1A 2IJNA 1VBZA 3M2VA 1RT1B 1TL7A 4X65J 4OHZA 3PRDA 2PMWA 3AY0A 4X66F 2EK6A 3LAKA 1KHWA 3PYFA 2IRXA 3LF0A 4NLOA 1NEEA 1DZ5A 2F1FA 3CJSA 4M5IA 1S0VA 3OVBA 3I5AA 3L95X 2HMIA 3NGKA 2H54B 5IQQA 1YLXA 2JC1A 3R2DJ 2QMWA 1RP5A 4CH1A 1TAQA 3TUZC 4OI0A 2ADBA 3C8YA 3OSNA 3D6HB 3S8SA 2Y8YA 3Q83A 3LA0A 1T05B 2FJAB 2CQ3A 2ACMA 2MY8A 1KKHA 3BO4A 3VR1A 4CM2A 5DM6Q 4DV1J 3NGRA 3DOLA 2L48A 2O1PA 4PG6A 1PO6A 3BQ2A 4OIXA 2HZCA 2P9GA 1F3VA 1CJVA 2G4BA 4J9OA 4CO2A 4HHUA 4K7QA 4NL5A 3IR5B 1HBMB 1VC6A 3RZAA 3NS5A 2CPEA 2CQ2A 1REVA 3AHPA 1Y11A 2MJNA 4Y34A 2XMWA 1V5VA 2OPPA 1Y00A 1U45A 1YGYA 4C3MA 1YJUA 5DG7A 3GR0A 3W60A 4PQAA 2R3VA 4NA1A 2VBWA 2YNGB 3S1TA 1FE0A 5HN0A 4UOGA 3PX6A 3JTPA 3MM7A 4J9RA 2UXCJ 1TL1A 2DHGA 2IBOA 2ZD1B 2YKMA 3CJ2A 2IRUA 4HTIA 5ETOA 2X7IA 3KLIA 1S5ZA 2CRLA 4F67A 4DSKA 3DLBA 1RYSA 1HBOA 1WJ9A 5B0GA 5CABA 1IWAA 1WG4A 2M0GB 5LJ3Y 2DGUA 4IG3B 4LJMA 4O44A 3M8PA 3JQKA 2G0JA 2VF3A 3RW6A 1WEZA 2Z56B 2GJFA 1OPZA 2PMHA 4JI3J 1YVFA 2ZHBA 3HX9A 1HD1A 4F3OA 4FVCA 2J7UA 1UP1A 1SB6A 4OHWA 1IQZA 1VDHA 2Y0BB 3K0JA 3TVKA 2ZZMA 4KPYA 3MURP 3HF5A 2GQQA 1C1CA 2VQFJ 2B4UA 2DR8A 3GSDA 3H5XA 3MMAA 4Y2KA 3KLVA 3HD1A 1NSPA 1WKKA 3NBPA 1U02A 4AUKA 1AW0A 1M5KC 3DLKB 4PPZA 3K5OA 3NP5A 4JV1A 5D0RA 4LF6J 1PKUA 1EETB 3HMJG 1F9EB 1U1MA 3HFVA 5LXRA 3O3LA 4HH1A 4JI5F 3D6MB 3CO9A 5DZ7A 3C6UB 4C8OA 2XEXA 1VQ5S 1KN6A 4ZVEA 3DLJA 3QIPB 4KGMA 3NL0A 3PYEA 3ET6A 5E3QA 2C2ZB 1HNXJ 1S1UA 1RTJA 3MHYA 3IRXB 2K3KA 3RAQA 1YRUA 1JNRB 2IMOA 2FTRA 2C2NA 4QR0A 3C3LA 2N3OA 4CM0A 4ELUA 2Q6BA 1IKYA 1H72C 1WG1A 2C3YA 2I0XA 1XBWA 2V5HG 3QRQA 1TQLA 3QGHA 3OL6A 4CH0S 1FX4A 2BANB 3CD6S 2Q1LA 3HSJA 1CJTA 2UZAA 4C48A 1KFSA 4CTAA 2OHDA 2OFHX 4BS2A 3OXFA 4OZ0A 1RT4A 5KOXA 1VRTB 4G1PA 4M5MA 4RR5A 3RRHA 4KFBA 4R0JA 1UVIA 3K5LA 3VF0B 5JVHQ 2FLPA 3NKYA 1LW0A 5AE3A 4KBIA 4HACB 2RILA 3H5YA 1B64A 3R9LA 3M4XA 3V6JA 3FKBA 2HHTA 1KOOA 2OP5A 4YR3A 1RTHA 3P6YC 3M2VB 4YB6A 3AODA 2FVSA 1UW4A 2ASYA 1TL7B 1FTCA 3FZ2A 4X64F 3OD2A 2GMJA 2IA0A 3GIRA 4P73A 2HGNA 2XHWA 4ZVFA 4KV8A 2DGTA 2MKIA 1SJ1A 3GMGA 3CCES 2HMIB 3TW0A 2ZUAA 1OO0B 1K1QA 2FJBB 3U7JA 3QGGA 4FKXA 5ETTA 4K4YA 4QIGA 2CKWA 2X51A 4NZ0A 3OJSA 1X0FA 2UU9J 1LXJA 2KVIA 1H7WA 3SFUA 1YZ7A 3OL8A 2UXDJ 2Z57B 2OGUA 4F2SA 2CPFA 4PXBA 3Q8RB 1R89A 2P9EA 3DOLB 1U1PA 4WK1A 4DLGA 2UUAJ 1CJVB 1UL3A 2CQ1A 2ZWOA 4ECUA 1Y5LB 4P10A 1SUQA 5F8HA 4IUFA 2CNOB 1OY9A 1UFWA 1NAQA 4USIA 3CO0P 3WQPA 2CNLB 1T7PA 1CQNA 2DH7A 2OPPB 1KDNA 2R2TA 1QTNB 1FRHA 1IXKA 3RB0A 3VAFA 1FKAF 3JSBA 2WVDA 1HMVA 5KT3A 5JVGQ 3HZEA 1LK7A 1TL1B 2X1GA 2CADA 3KJQB 2YKMB 3A3NB 2MSSA 1VHIA 2AZ1A 2LEPA 1WELA 5JJBA 2NS1B 3TA2A 1HBOB 1Q8BA 3NGTA 3EVMA 1JJHA 1IBMF 2ALZA 2ALYB 1U2CA 4ECXA 1WTFA 4O44B 1HI0P 3FCVA 2U2FA 2IPOB 4B3TJ 2AD9A 4TY8A 1HYSA 4DU7A 1H98A 3GFHA 4JB8B 2AGQA 2DNRA 5L1LA 2VB6A 3FSXA 4IH6A 1I51B 4F4AA 1UEKA 3W66A 2W01A 2R7VA 2ZVSA 4JI4J 4M5GA 2DNYA 3O44A 3SQOP 1AZSA 1SC6A 2AW0A 2BJDA 3SV4A 3GILA 4HHHA 1C1CB 4LF8F 1YWXA 3NCPA 1R8BA 4K2XA 1HQEA 3MMAB 4UY8T 2HS4A 3NBPB 3C15A 4QWBA 1NK4A 2E44A 2FVPA 3IN5A 4OI3A 5CA5A 4NLDA 2QIFA 1SQEA 2NZCA 2ZHAA 1EKRA 3MM6A 4PG8A 1HI8A 3HM9A 2X1FA 2J0XA 3ET6B 2HQGA 3OHAA 4I6YA 1CC7A 4ECVA 1YX2A 1H74A 1S1UB 2GIFA 3MTJA 4JP8A 1VQNS 1RTJB 1FDAA 4J9KA 4FXVA 4DR1F 1VBXA 1ZAWA 1U6FA 4JI6F 4DR7F 3EJMA 3H20A 3PKYA 1YSJA 4NCBA 2PA3A 4B9VA 3D0IE 1D8ZA 2IYGA 4KH0B 4DL6A 2V8GA 1B0VA 1XC9A 1IKYB 1T9TA 5A6PA 4ECQA 4N7TA 4N41A 3HVRA 1JX4A 5L39A 1VISA 2D3O1 1ELOA 3MD1A 1RUSA 4FP9A 2DH9A 2IRYA 3QFHA 4LF5J 4OV1A 4WFBQ 4PABA 5KFIA 4F7VA 1CJTB 1KP6A 2AYEA 3V6HA 4WCEQ 2AIRB 1KQGB 2FY1A 3B4DA 4CTAB 5KFBA 4ECWA 4HEA9 2B4VA 1ZA1B 5LMNJ 4M5DA 3GJRB 2LXUA 2XLIA 5LL6d 1RT4B 4NYZA 4LMZA 3Q8VA 1RI7A 4AL7A 3LALA 4PYAA 2AEMA 2CPIA 3NAHA 5DQHA 4PXDA 4K4VA 5DQIA 5CYJA 3Q24A 3FQLA 4DPUA 1NDKA 3V4IA 4RZRA 1RTHB 4Y2IA 3BF4A 5GAGU 2GAHC 1ZH5A 1DFDA 4JI7J 4ZVSB 3QPIA 3R7SB 3CJ5A 3HD2A 1E6YA 2ZKTA 1KOHA 4KV8B 2CJXB 4TVAB 4LF4J 1FDBA 2XQCA 2LXIA 2J0SD 2MKYA 2G0CA 2MZ1A 3IXQA 1FX2A 5DRKA 5E33A 3NOCA 3ZTPA 3NMRA 4U95A 2KG1A 4OX9J 4OYPA 1BLUA 1Y5NB 5BYSA 2E1RA 2LDIA 4CLYA 3F0NA 2R7UA 1N8RT 2ZBIA 2A0FB 2B4PA 4NX9A 5ETMA 1D9FA 2VJVA 4AQYF 1SC4B 3PW4A 1UJ6A 3IC1A 5J2PA 4QZVB 2AHOB 4DV2J 3RB3A 4QR1A 3D9BA 3RU0A 4GKKJ 1X4BA 2VJUA 1FJGJ 2A10A 2W2NP 1Q53A 2VOPA 1JLEA 3J7YU 4F8RA 3GONA 1SUQB 3OTOJ 2CPXA 4QWEA 3H25A 1URRA 3ZTOA 4Y00A 2DITA 4CLSA 5T14A 1NJZA 1RXOB 3DYAB 4OZNA 4DU8A 2J6TA 4QU7A 1HMVB 1APSA 2OJ3A 5D4PA 2IDLA 2HZVA 1AFIA 1LWXA 2AGOA 2LQ8A 4DMZA 1NK6A 1J27A 2L9NA 2ZDPA 3HJFA 2GO9A 1B4SA 1KLMA 2HWTA 3SEOA 2DXEA 2R2SA 5B0CA 3C16A 2E9ZA 2IJFA 2FD2A 1HYSB 4Y65A 4OI4A 2N4CA 4F04B 4F26A 4J9VA 1XMBA 4KAIA 4IOBA 2WBRA 1RAJA 4I7FA 1JIHA 1FXDA 2EC2A 2V4QA 2GIRA 1NPKA 4CO5A 1E6VA 1AZSB 1LWEB 1RWVB 4OZ3A 5D0GA 2R8GA 1WTBA 3GJSB 1UKUA 4FF4A 1I3OB 3ISNC 4Q2LA 3OLAA 1HQEB 3V6KA 2E9RX 3W1YC 4DWIA 2V4RA 1N34F 4AYBD 3C15B 4B3MF 1NPRA 4X4OA 2PIIA 4QQBA 2FVCA 3TYTA 1WOSA 2HQDA 4DUYF 3P4UB 5KT4A 4I64A 1SIZA 3KLGA 5AE2A 2BKNA 1SH0A 2DHXA 1VI7A 1D0EA 4M5NA 2QV6A 2ASJA 2MZRA 2J9CA 3UO0A 1YK9A 2V50A 2F9JA 4PCQA 2YH0A 4LT6A 2J7KA 5I3UA 2W1BA 4CCHA 2OD4A 3JSMA 2KT2A 4C9DA 1CBKA 4B3RF 1NK9A 2QRRA 2BR0A 2ZH9A 2DHAA 1P9QC 2KN4A 4CLFA 3PO5A 1JJCB 1SBRA 3H7HB 1RBLA 4O23A 1DTTA 3SV3A 2PI5A 5EX3A 4LRFA 4V1Ak 1FNXH 2KT3A 3G82A 4NXNJ 4IRKA 4WFAQ 1FFSB 4L75A 5L1KA 2VDHA 3AQOA 1XR7A 3GSIA 4LRAA 4C11A 4PKDB 2UVWA 3ZNUA 2R7XA 1PYSB 2A2DA 4WKYA 2WOMA 4GKJJ 1XTZA 7FDRA 4M5DB 3AAWB 4UQGA 5F8IA 1JLAA 1F6TA 2C22A 3QNWB 1D1UA 2DNLA 4UTGA 4PG7A 2W9BA 4PQUA 3VGSA 1IVZA 4BWMA 5KFCA 3HP6A 2OI2A 2VL1A 4TLRA 1IR2A 2D41A 1JXEA 3V4IB 3R3TA 2OPSB 1YJTA 4DL7A 1SJFA 4ELTA 3KDOA 4I2QA 1IUJA 4B9UA 2EVZA 3A12A 2BJEA 4H4KA 1ZM2A 4ED5A 4DR5J 2OMOA 2POKA 2M52A 5DDQC 4ZPTR 2XHCA 3UDCA 4USKA 2ZVIA 1RDRA 2JLGA 4WK3A 2CPZA 5E3CA 2VASA 2NR0A 4DSFA 3QWUA 4ZIVA 3UN5A 3I0SA 2KTQA 4AXIA 3TI0A 5EX0A 1JQGA 2HVIA 4R5PA 1PC4A 2XY5A 3PYDA 3EPIA 4U96A 2ZOMA 3AA8A 3MEGA 1RWWB 3SQGA 3K57A 2GA7A 2OKQA 3PJXA 3P3DA 3I32A 3ICLA 5J2PB 2XLJA 3KXDA 3ZTSA 4FXDA 2N7YA 1UFKA 3PFEA 1TFWA 4DPTA 3ENQA 3O6QA 2CZ4A 3MEKA 3T1AA 4O0IA 1ICEB 1WI6A 4AL5A 1JLEB 3MR7A 4MAKA 1X60A 2KHCA 2JLFA 3GR1A 4DI6A 3NCQA 3BEGB 3GCXP 1MLAA 4OX8A 3I0RA 2EKYA 2B9WA 3L9ZA 2VQEJ 1SKRA 4LSNA 2R2UA 1VOMA 1Y4ZB 1YJ7A 2W4CA 3LANA 4F0KA 2W24A 6FDRA 3VCDA 4CNYA 3FEZA 3W7BA 3Q86A 2MZSA 2ZITA 4C8NA 2YPYA 1HARA 3F44A 2VPXB 3KG4A 2NUHA 1UVLA 2X1AA 3LH2S 1NKCA 3D1QA 2QYCA 1EAYC 4OYOA 2RT3A 2DO0A 2DY9A 4ID8A 4QIWD 3C16B 3WIVA 4HT7A 2DNOA 3T1YF 5D4NA 1OJ4A 4TKTA 1DTQA 2XCAA 3PIPQ 1FDDA 3BH7B 5IC6B 2QYGA 3PHTA 2XBPA 5T41A 2AYBA 2JRSA 4TNOA 2CQPA 2UUWA 2Z2ZA 6FD1A 1E6VB 3FMWA 1HBNA 2CQCA 3NWGA 4RUBA 3KOAA 4KKOA 4FF1A 5KG3A 4RPFA 2XCPA 3M1VA 2AJ2A 4WU3A 3OQ2A 3HVWA 3N6NA 2ZZTA 5EWGA 2EBEA 4BDPA 1DJ0A 3ZFVA 4YQWA 2W9CA 2Z2LA 4HL9A 5LOQA 4NEZA 2BJ8A 3KLGB 2NREA 4DV3J 2B9EA 1N36J 3WIUA 2ZH4A 3EDQB 4K0KF 3CJKA 3EPGA 3UE2A 4J9LA 5A8KA 4K4ZA 5I3UB 4B9MA 3C66A 4J7CA 4O3OA 1UPPA 4MK8A 1X4GA 3JSMB 5KFRA 4KSEB 3KHRA 3LO3A 3OFGA 4MKYA 2XYHB 2NSBA 3R5GA 4ECYA 1MN9A 1DTTB 4DLEA 2BOPA 3QATA 5DDRC 1N48A 4A4JA 2B3TB 5CYMA 4MKAA 2G9OA 3G82B 4EFAC 2IMWP 4CT9A 3O2IA 4XAKA 2DBBA 4OYMA 3DGVA 4JI1J 3ZTQA 3L3CA 2GCFA 4O0NA 3CDUA 3CULA 2DRAA 1HLWA 4DR6J 2C3MA 4LFBJ 2VODA 3BDEA 4X2BA 3THPA 1TUVA 3V4MA 4HVZA 5KFOA 1FCAA 1LKZA 1GXTA 1T3NA 1RISA 3HKZD 1PGZA 1JLAB 2YBVA 3D66A 5D15A 2UXBJ 5IQ6A 1MWZA 3FVYA 1N54B 4DX6A 2W9BB 4PQUB 4R25A 3CJQA 5HBMA
chains in the Genus database with same CATH topology
2DKOB 2XYHB 3D6FB 2Y0BB 2H51B 1ICEB 2CNOB 5IC6B 3GJQB 4ZVRB 3R7NB 1RHQB 4ZVSB 2XZTB 2CNLB 1RHKB 3R7SB 1RWVB 3IBCB 2H54B 4DCJB 2CNNB 2H5JB 3GJSB 1RWOB 3R5JB 5IC4B 1RHUB 3R6GB 1QDUB 2CJXB 2CJYB 1I3OB 1QTNB 2P2CB 2CDRB 3KJFB 3RJMB 4DCPB 2C2KB 2QL5B 3GJTB 4ZVPB 1RWNB 3R7BB 3NS7B 2H5IB 2FQQB 2QL9B 3EDRB 1RWMB 2Y1LB 3D6HB 2QLJB 2XZDB 2H4YB 1F9EB 3KJQB 1RHJB 2C2OB 2QLFB 2QL7B 4LSZB 3GJRB 1PYOB 1PAUB 3P4UB 3P45B 1SC1B 3D6MB 4ZVUB 1GFWB 1RWKB 2C2MB 1NMEB 1RWPB 3KJNB 2C2ZB 4ZVQB 2XYGB 3SIPB 4DCOB 3QNWB 2C1EB 4ZVOB 1IBCB 1RHRB 2HBZB 2CNKB 1RWWB 2H65B 1SC4B 3IBFB 1SC3B 2QLBB 2HBYB 1RE1B 4ZVTB 2XYPB 2H48B 4JB8B 3EDQB 1BMQB 3R6LB 2HBRB 2HBQB 5K20B 2H4WB 1I51B 1RHMB 1RWXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DKO B;  2XYH B;  3D6F B;  2Y0B B;  2H51 B;  1ICE B;  2CNO B;  5IC6 B;  3GJQ B;  4ZVR B;  3R7N B;  1RHQ B;  4ZVS B;  2XZT B;  2CNL B;  1RHK B;  3R7S B;  1RWV B;  3IBC B;  2H54 B;  4DCJ B;  2CNN B;  2H5J B;  3GJS B;  1RWO B;  3R5J B;  5IC4 B;  1RHU B;  3R6G B;  1QDU B;  2CJX B;  2CJY B;  1I3O B;  1QTN B;  2P2C B;  2CDR B;  3KJF B;  3RJM B;  4DCP B;  2C2K B;  2QL5 B;  3GJT B;  4ZVP B;  1RWN B;  3R7B B;  3NS7 B;  2H5I B;  2FQQ B;  2QL9 B;  3EDR B;  1RWM B;  2Y1L B;  3D6H B;  2QLJ B;  2XZD B;  2H4Y B;  1F9E B;  3KJQ B;  1RHJ B;  2C2O B;  2QLF B;  2QL7 B;  4LSZ B;  3GJR B;  1PYO B;  1PAU B;  3P4U B;  3P45 B;  1SC1 B;  3D6M B;  4ZVU B;  1GFW B;  1RWK B;  2C2M B;  1NME B;  1RWP B;  3KJN B;  2C2Z B;  4ZVQ B;  2XYG B;  3SIP B;  4DCO B;  3QNW B;  2C1E B;  4ZVO B;  1IBC B;  1RHR B;  2HBZ B;  2CNK B;  1RWW B;  2H65 B;  1SC4 B;  3IBF B;  1SC3 B;  2QLB B;  2HBY B;  1RE1 B;  4ZVT B;  2XYP B;  2H48 B;  4JB8 B;  3EDQ B;  1BMQ B;  3R6L B;  2HBR B;  2HBQ B;  5K20 B;  2H4W B;  1I51 B;  1RHM B;  1RWX B; 
#chains in the Genus database with same CATH topology
 3W9I A;  1S6U A;  4FPR A;  3WBZ A;  2UV8 G;  3GP9 A;  3FBB A;  5A0Y A;  1JNZ B;  1L5U A;  2I38 A;  4I2Q B;  3R5J B;  2RRB A;  4NE9 C;  4Q44 A;  5EDW A;  4DV5 F;  4P7T A;  4F02 A;  4Q45 A;  1S72 S;  1IBK J;  2RS8 A;  3LP0 A;  1X4C A;  4I67 A;  4DQR A;  3O1L A;  4N77 A;  1JXV A;  1HFE L;  2DB1 A;  2C3U A;  2N7C A;  2ERR A;  1TTH B;  2EFP A;  2E5L J;  4W90 B;  4W92 B;  4WFZ A;  4KO0 B;  2A18 A;  3I0S B;  2ROG A;  1OY8 A;  4RW6 A;  3NGU A;  3JXO A;  2JEI A;  4R5P B;  4FF3 A;  1RHR B;  1SXL A;  3NCR A;  4QIF A;  3VZH A;  4UQT A;  5IT9 U;  4YN3 B;  3MEG B;  3SQG B;  5IWA F;  4CO3 A;  2LLZ A;  3M8Q A;  4ZPD A;  1XNQ F;  1S0O A;  2A3J A;  3FDS A;  2AJ1 A;  1EKS A;  2K06 A;  3BGU A;  3NG8 A;  2XMJ A;  2GS8 A;  4DZ6 A;  4WP9 A;  2ASL A;  4B3S F;  5KFE A;  4ENO A;  5E7O B;  1BXN A;  2R7T A;  4IKA A;  4BLG A;  4EU0 A;  4ALZ A;  2CJB A;  4CO1 A;  3NS7 B;  2XMA A;  3I0R B;  4WFY A;  1RBA A;  2VIH A;  3RBD A;  3W64 A;  1NO8 A;  1GNK A;  4K50 A;  5HQ8 A;  1ZS6 A;  3M8Y A;  4N8N A;  3S01 A;  4LSN B;  3CPW R;  3RGI A;  1R27 B;  1LOU A;  1FES A;  4DJB A;  3OW2 R;  4LBI A;  3PW5 A;  2C1E B;  2GML A;  2YKO A;  1T3O A;  1N0U A;  2KXH A;  3QT6 A;  3H2L A;  1ZA2 B;  3GG1 A;  4DX7 A;  3VAI A;  5L9X A;  3EXY A;  2MGZ A;  2XSF A;  2R7W A;  1LK5 A;  1B7Y B;  2PDA A;  2LXF A;  5KOW A;  2NQP A;  2A6O A;  2IM3 A;  3EXC X;  2HRT A;  3W5Y A;  2AZ3 A;  3CCS S;  4J9U E;  2DD8 S;  2XTJ P;  1U47 A;  1TP7 A;  5KT2 A;  4RBT A;  4LQ3 A;  2Z58 B;  3J80 U;  4K4U A;  3LWM A;  4KH1 B;  1O5J A;  3VVU A;  3FGV A;  2AX0 A;  1HBN B;  1PBU A;  3J81 U;  4KKO B;  2J6S A;  4H54 A;  4Z7C A;  4DV1 F;  3M1V B;  2JFK A;  1M1H A;  3GCW P;  5GMK a;  1S0M A;  2JVO A;  1TV6 A;  1WC6 A;  2BE9 B;  2XY6 A;  2AQ4 A;  1Z2L A;  3ZO7 A;  4C8Y A;  4V19 J;  2DGS A;  2W9C B;  1HW8 A;  2VZ9 A;  1BC6 A;  1TZ0 A;  3IBF B;  3PKM A;  3F56 A;  1QM9 A;  3QAU A;  2XYP B;  4AXJ A;  3BZQ A;  2HNZ A;  2R7O A;  4H4O B;  5U47 A;  2XG8 A;  3CJK B;  3AXK A;  5A8K B;  1QLN A;  5HQM A;  1BQX A;  4DSI A;  4NEY A;  2C42 A;  2UUB F;  2L9W A;  1EZZ B;  2UXC F;  3HJV A;  5KFS A;  4N5S A;  1BE4 A;  1M5S A;  1NJX A;  1YBA A;  1QDU B;  2HFO A;  5CYM B;  5J2N A;  1XER A;  4I56 A;  5I42 B;  1I1G A;  2HHH F;  2BEF A;  4HTJ A;  1M5O C;  1MMN A;  2ZE2 A;  3P8B B;  4AD6 A;  1YJR A;  1G1X A;  1NK5 A;  1KQF B;  4DV6 F;  3BBC A;  1N6Q A;  4FBU A;  4GC7 A;  4LFA F;  2HND A;  4DFM A;  5HVH A;  4X66 J;  1TKX A;  1KTV A;  5AXN A;  2YY3 A;  4LRB A;  4ZA1 A;  1K0T A;  3MZI A;  1YI2 S;  3NGD A;  3BQ1 A;  5C24 A;  3QSY B;  1PCA A;  5AJ3 F;  2JZ5 A;  1MU2 A;  3LGN A;  3T6B A;  4H4M A;  2RQK A;  3GIM A;  3GPA A;  1N5Q A;  3CCR S;  2Z8Q A;  2E5I A;  5H9E K;  3BN7 A;  2C2R A;  2FHO B;  4QW9 A;  3IG1 B;  4K4X A;  4UOF A;  3QAE A;  3PW2 A;  2Z2M A;  5HBM B;  2ABY A;  2HFZ A;  2OSQ A;  4A8Y A;  2D3U A;  2GVZ A;  3ENW A;  4B17 A;  4JYA F;  3BM7 A;  3N79 A;  4XTT A;  4QIE A;  4J9M A;  4MIW A;  1VLO A;  5A0Y B;  4LF6 F;  2WBM A;  5DDP C;  4FZV A;  2M9K A;  3J80 Y;  2VOO A;  1AFJ A;  4ED3 A;  2RF2 A;  4Q7A A;  3HUL A;  2B8P A;  4X4V A;  3UPF A;  2WON B;  3J81 Y;  1H3D A;  1LW2 A;  2RUG A;  3TJ9 A;  5KFN A;  4EBD A;  2XZD B;  1U7L A;  3R5A A;  4UF4 A;  3EGN A;  2FGC A;  2MLZ A;  2UUT A;  3VTI A;  3VAH A;  3CMA S;  3MAA A;  3IM9 A;  4ES3 A;  3H8Y A;  2XYG B;  2PEH A;  1Y3J A;  3BH6 B;  1N4L A;  1IBC B;  4LVO P;  2XSJ A;  4RW6 B;  3VAL A;  3VGU A;  4JOU A;  4RW7 A;  1RK8 A;  1I6J A;  3QT5 A;  1H6K X;  2NXJ A;  2ZH1 A;  1HNI A;  1XMO F;  2CFX A;  2YVS A;  2QT7 A;  2GGP A;  1Q95 G;  2NUU G;  3EZ5 A;  3UCG A;  4A8S A;  3G6E S;  2VIC A;  3PDN A;  2QA4 S;  1FRK A;  2BQU A;  1U1L A;  1EJ7 L;  3CJT A;  5DG9 A;  3IWL A;  1NK7 A;  1YZ6 A;  1ZM4 A;  1QSY A;  3R6G B;  4NCG A;  4QOT A;  2PFF B;  1UWA A;  4QU6 A;  3N4W A;  3IO1 A;  4QW8 A;  3VAK A;  2UUC J;  4O4R A;  3QRR A;  3SCK E;  4DHV A;  3GU0 A;  1RWM B;  4NZ6 A;  3AA9 A;  1VIO A;  3M30 A;  3DFE A;  3US5 A;  4AFF A;  1FI4 A;  2IA6 A;  3D2W A;  4H4K C;  4U8V A;  1V3R A;  3OLB A;  1C0U A;  3UNY A;  2MQM A;  4ZPB A;  1LEO A;  4TQR A;  1J5E F;  1S4E A;  2DRB A;  2FGO A;  4QWC A;  2GO8 A;  3O5T B;  2BJ1 A;  2MHE A;  5HJY A;  3G4S S;  4ZLN A;  4DL0 C;  2MGZ B;  3RB6 A;  1WHY A;  2DVI A;  4GC6 A;  2YH1 A;  2DNM A;  2N3L A;  4JI5 J;  4OX6 A;  1U48 A;  2V8D A;  2DY1 A;  2F8E X;  3MFH A;  1DAX A;  4QCL A;  2V8P A;  4A46 A;  5HAN A;  2PSZ A;  2NXU A;  3PX0 A;  3KYL A;  1JJ4 A;  2RH3 A;  3N6M A;  1Q8I A;  4A8M P;  2YNH A;  4ZJQ A;  4ZK7 M;  2UXD F;  3PIO Q;  1FTR A;  4MYU A;  1HW9 A;  4NLU A;  3TAM A;  4JI8 F;  1TV6 B;  2UUA F;  4P7V A;  3C19 A;  5B7W A;  2RRA A;  3I55 S;  4BBY A;  2J9D A;  4ANE A;  2GVD A;  2OD6 A;  1SL2 A;  1U8W A;  2CJA A;  1O51 A;  2BAC A;  1IWG A;  3ILJ A;  1NZ8 A;  5A76 A;  1T8E A;  1EHW A;  2HNZ B;  2GHV C;  2YXL A;  4PWU A;  1FE4 A;  2IVF B;  2BAB A;  2VBZ A;  2DCU B;  2B9X A;  2HIY A;  4N8O A;  4C98 A;  1NDL A;  2GAG C;  1S12 A;  1KVI A;  1BQM A;  5T7L A;  1YQH A;  2OEL A;  1XMQ F;  3Q2T C;  1GTE A;  1RB0 A;  2L9D A;  4IFY A;  5KG4 A;  4FF2 A;  3PCO B;  3QZ8 A;  5KFP A;  4MTP A;  4CDI A;  5AXL A;  1P6T A;  3UR3 C;  2YX7 A;  2ZE2 B;  3M2R A;  2ZUG A;  1YBU A;  3IS9 A;  5IS2 A;  4X64 J;  4PYD A;  3ADA C;  1N6Q B;  3IRW P;  2FHK A;  3H5S A;  2R8K A;  1F0X A;  2HND B;  1TKX B;  3G8T A;  3W8P A;  1R0A A;  4X4P A;  4ZPW R;  2XB2 D;  4IRD A;  3PV8 A;  2OPR A;  3GE9 A;  3M32 A;  1B70 B;  5C24 B;  3IWN C;  1SV5 A;  1SC3 B;  4URS A;  2FDN A;  1N5Y A;  1KEK A;  4WXW A;  1XJW B;  4UOH A;  4URQ U;  1S99 A;  1NH8 A;  3BB5 A;  3M7V A;  4KGK A;  4U8Y A;  1HHS A;  5RUB A;  2CPY A;  4YS2 A;  4IO9 Q;  2V94 A;  3JYT A;  1Y7P A;  3GJQ B;  5E0O A;  4IOC Q;  1N33 J;  2GVZ B;  5CAA A;  7FD1 A;  3UCU P;  2JSX A;  4E2F B;  4J9N A;  4USV A;  5KFL A;  1CS4 A;  4LF7 F;  3RBX A;  4ILL A;  4QBU A;  3IM8 A;  4D3H A;  2JL9 A;  2QL5 B;  1VQL S;  1FEE A;  5AE1 A;  4DG1 A;  2RF2 B;  4ERD A;  4QYR A;  4DPW A;  1OPI A;  4W98 A;  3QJP A;  1URN A;  4EYI B;  1N0V C;  5DLG A;  4NMX A;  5KFZ A;  1LW2 B;  1VGY A;  4ETZ A;  1U1O A;  4DF8 A;  2XS5 A;  2HQI A;  2I1R A;  4NRU A;  3KLF A;  2VFT A;  1QE1 A;  2FJV A;  2P5V A;  3MAA B;  2QN6 B;  3EGW B;  2FVQ A;  4IOA Q;  2V67 A;  4C8L A;  3IR6 B;  1NJW A;  1XNR F;  3FRY A;  2G1D A;  4QIV A;  2QLB B;  2XSJ B;  1FRI A;  5LJ5 Y;  4CLK A;  1WNE A;  3X1L B;  1GMU A;  4RW7 B;  2HHQ A;  2RU3 A;  5FLX U;  5H9E J;  4WWS A;  3PRB A;  3Q8Q B;  4ETX A;  5C2C A;  2YWH A;  1HNI B;  3CNQ P;  2GGP B;  1RAD B;  1VQM S;  4O4G A;  5CCM A;  4V19 X;  4LF5 F;  1RHK B;  4WP8 A;  2VG6 A;  5CXT A;  1IBM J;  2VD3 A;  3DLE B;  2MEW A;  1HNW J;  2CVI A;  4UUX A;  3LP1 A;  3MOJ B;  5LMN F;  4NCG B;  2H9Z A;  2WB1 D;  1X5T A;  4NML A;  4USM A;  3D7S B;  2KFY A;  5ETN A;  2LQ9 A;  1FKO A;  3FMB A;  2GNK A;  4DV7 J;  3M30 B;  3ZZ0 A;  3I6P A;  2O3D A;  1M5P C;  3CCV S;  2W7A A;  1GTH A;  4C8Z A;  3PNI A;  2IJR A;  4LF8 J;  2BJ7 A;  1C0U B;  1X4D A;  3MR3 A;  2ZJR Q;  2HVD A;  2G2Y A;  1RLD A;  2DTJ A;  3EX7 B;  5JMN A;  4PZV A;  1T9Y A;  3JTN A;  1S9F A;  4L73 A;  1FXR A;  2KFN A;  4WU2 A;  5IM0 A;  1VRQ C;  2R8J A;  1M0S A;  4YDX A;  1ZM3 A;  5ETP A;  2YWG A;  4ECZ A;  1NH7 A;  2Y1I A;  4OX9 F;  2YWE A;  2J76 E;  1RTZ A;  2HHV A;  3G2X A;  3CJ0 A;  5CD4 A;  1DY3 A;  3ENV A;  3E3X A;  2CPD A;  2CXE A;  2L08 A;  1K0V A;  2YNH B;  4JI6 J;  4DR7 J;  3HHL A;  1R8A A;  1RGV A;  4YR0 A;  4RJV A;  5M2P A;  4CQ1 A;  3DRS A;  1YDL A;  5AXM A;  3U27 A;  4AT1 B;  2V8V A;  3U02 A;  2VKR A;  4JI0 F;  3TAM B;  4NLR A;  1T95 A;  1EIY B;  1WDT A;  2DPI A;  5L8R C;  2HBZ B;  4IDK A;  5A6W A;  2KG0 A;  4OYI A;  2JC0 A;  4NLG A;  2ZOF A;  2XMT A;  2GVD B;  2HBR B;  4ZP6 A;  5FLX Y;  5KFG A;  1WF2 A;  1FK9 A;  4WXO A;  2XM3 A;  4X4T A;  1TVR A;  3BDP A;  3CCJ S;  2Y3Y A;  4HLB A;  3MM9 A;  4L3N A;  3THV A;  1R3N A;  2EC0 A;  1RHQ B;  1X8D A;  2XZT B;  4K5S A;  2CZ9 A;  4RU2 A;  2HK3 A;  4J91 A;  1BQM B;  5T7L B;  3JSY A;  5BR8 J;  4IFY B;  1JLQ A;  3NGS A;  3OVA A;  1PIL A;  3DOK A;  2DT9 A;  2W7P A;  2ZDO A;  4DR3 F;  3L7P A;  3UN3 A;  4F4X A;  4KGV B;  4CLU A;  1RSC A;  5E2Q A;  3M2R B;  4WF9 Q;  5BJR A;  5AT1 B;  4USU A;  3HVT A;  4TU9 A;  2CAJ A;  1T0T V;  3M9O B;  2NXE A;  4YR2 A;  2BV3 A;  4F25 A;  1XEZ A;  1R0A B;  2HWH A;  2OPR B;  4Y0F A;  3PXG a;  3I9V 9;  1OIA A;  3M32 B;  2KJW A;  2KDO A;  2YQ0 A;  4WE1 A;  4F0M A;  1SV5 B;  3H40 A;  2CDQ A;  4ZN3 A;  2ATC B;  2BKP A;  3A13 A;  1N5Y B;  4MIB A;  3BPS P;  4FVM A;  2LEC A;  2E66 A;  4F0H A;  2QA1 A;  2CQH A;  4WJB A;  2J8A A;  4I4B A;  1ZAV A;  4O3R A;  2QMU B;  2GV1 A;  3T5H A;  1H2U X;  3JSR A;  4E8U A;  2GX8 A;  3JYT B;  4K4T A;  1JWW A;  1I5O B;  2VU5 A;  2CJY B;  1IR1 A;  4L72 B;  4M5H A;  2HYI B;  4C8M A;  3B4M A;  1CS4 B;  5E41 A;  2BJ9 A;  2HHX A;  3CB4 A;  4WFN Q;  1KHV A;  2H5I B;  4JI2 F;  5GAH I;  2KL8 A;  1TU0 B;  2B56 A;  4DG1 B;  1H73 A;  2DNZ A;  2X1B A;  3N5B A;  3KHL A;  4LR9 A;  2RAQ A;  2J7W A;  2E9T A;  4A8Q A;  1DAR A;  2E5H A;  5D3G A;  1DHM A;  2JJ4 D;  1WOP A;  3UVJ A;  2K8G A;  2P6S A;  2U1A A;  4USJ C;  2ZH6 A;  1QE1 B;  3U1M A;  4GO7 X;  7AT1 B;  3DHW C;  3HHN B;  4CLT A;  4FBT A;  2KKH A;  4UT4 A;  4PWD A;  1C4C A;  1RAH B;  5LXY A;  1MN7 A;  2XO7 A;  2E5G A;  1VHF A;  1HWU A;  1MMD A;  3WC2 A;  5GAD U;  1EB0 A;  3U1L A;  2AYM A;  2VBY A;  2ZKU A;  4AE5 A;  1RU2 A;  1JK9 B;  1VC5 A;  4MH8 A;  3V81 A;  5E3P A;  1M1G A;  2ZH7 A;  1WF0 A;  2M70 A;  2XWX A;  2MTL A;  2VG6 B;  4LF1 A;  3MR2 A;  2WVC A;  2PD1 A;  3LP1 B;  2RD5 C;  5KFA A;  5SZT A;  4FXW A;  3QJL A;  3K8W A;  4MJK A;  3WZ0 A;  5DGB A;  3HFK A;  5CYQ A;  4BCA A;  3CW2 C;  2DNH A;  4TU7 A;  4YEA A;  2ADC A;  1YKW A;  2F63 A;  1FKO B;  3LPY A;  2VG7 A;  2F5G A;  2PO4 A;  1RQ0 A;  2EG2 A;  1Q7Y T;  1ULR A;  2HNY B;  4P52 A;  3H0P A;  2I6W A;  4DX5 A;  2KT5 A;  4ED1 A;  1Q8L A;  2CZV C;  4ZVH A;  5AXK A;  3DXB A;  1OYD A;  1S1W A;  2HBY B;  3VQT A;  4X4U A;  3G8S A;  4ZVT B;  3TZW A;  5I3P A;  4WII A;  3DOM A;  3V2U C;  1Q5V A;  4OLO A;  2BYC A;  5HAO A;  3TP2 A;  3BS9 A;  1FFG B;  2MQN A;  4NXM J;  4YY3 J;  3ILO A;  3DDN A;  5IM0 B;  1NJY A;  3HPO A;  1CEZ A;  1YJW S;  2ZFH A;  2HQC A;  3AJ1 A;  1SJR A;  2XS2 A;  3BRE A;  1Y9O A;  3VQS A;  1UZD A;  2ZH8 A;  4R0E A;  1W25 A;  3QGI A;  2FZK B;  3DMJ A;  1OY6 A;  3OHB A;  3VAM A;  3N6L A;  4B3R J;  2HW3 A;  2DGQ A;  3KJV A;  4KE5 A;  4O3P A;  3ISN D;  1TR0 A;  2EWH A;  2LFV A;  3HHL B;  4ZVU B;  1QVG R;  1PG5 B;  2MZQ A;  3TJA A;  2HKE A;  5B0B A;  1WHW A;  4OL8 A;  4JV2 A;  1NBE B;  3DRS B;  3NNA A;  3KLE A;  5DO2 A;  2QE5 A;  4PAA A;  1X5O A;  4YOE A;  1RT7 A;  2UVV A;  4IDK B;  3K7R A;  4L3K A;  2JNJ A;  5KG0 A;  3SMZ A;  2BUN A;  1NZA A;  2KB2 A;  3QFW A;  2M8D B;  2HQF A;  5HK4 A;  4ZLJ A;  5HMW A;  2KYX A;  3KWM A;  1Y10 A;  2K3I A;  1UVM A;  3ILI A;  3NXZ A;  2CQD A;  1HNZ J;  3HT0 A;  5KFX A;  1FK9 B;  2XGP A;  3QZ7 A;  1TVR B;  4K4W A;  3MM9 B;  2WAQ D;  2AEJ A;  2KXF A;  2IM1 A;  2QG9 B;  2VQE F;  1FD8 A;  4XDC A;  3J7Z 5;  1K73 T;  1JLF A;  1GMV A;  3IFE A;  3HO1 A;  1NSQ A;  2LA6 A;  3RRK A;  4PR6 A;  4OYA A;  1JLQ B;  2G13 A;  3CJ3 A;  3I87 A;  1NHK L;  3D54 A;  5IXU A;  2KM8 C;  3DOK B;  2OIH A;  2G0I A;  2YKA A;  2LEB A;  5KFM A;  3K58 A;  3KHH A;  3HVA A;  2VON A;  3TVY A;  1WC1 A;  1Q78 A;  1RZM A;  3R97 A;  2LEA A;  1X4F A;  2MKK A;  1DBD A;  5CQG A;  3VWS A;  2OTL S;  3CE8 A;  3RBZ A;  3MFI A;  1JLC A;  1R8C A;  1REV B;  2HVH A;  1LFW A;  3KTQ A;  1X5P A;  4WE1 B;  2VBX A;  1YHQ S;  3QO9 A;  3TA0 A;  4HT5 A;  3IP0 A;  2DK2 A;  1F9F A;  4XDD A;  2HQ3 A;  3Q2S C;  4IH7 A;  1CUL A;  4Z2X A;  3KK1 A;  1R8H A;  3MM7 B;  3D67 A;  2E1C A;  3K5M A;  1HWK A;  3RTV A;  3CT9 A;  3AT1 B;  4KB7 A;  4I2P A;  5A8R A;  2W7O A;  3CMQ A;  8RUC A;  1TKZ A;  3KLI B;  3RJM B;  2W2O P;  3OXG A;  1H38 A;  4NLS A;  1L3T A;  1RAB B;  4UUW A;  3SCL E;  3GFX A;  4C4W A;  3KUE A;  4DN0 A;  1FFW B;  2WVB A;  1WOO A;  1NND A;  2EFQ A;  3M8P B;  2JWN A;  3GZ7 A;  2D3Z A;  1YRT A;  3D1H A;  3NWR A;  5HAT A;  4NLW A;  2HUR A;  1WSV A;  2QC3 A;  1SKU B;  2R7Q A;  3DC2 A;  4ZHR A;  1NB2 A;  4G3I A;  3DDI A;  5ITH A;  2XI3 A;  3MR5 A;  1F1B B;  5D3G B;  3LWL A;  3UVJ B;  4DSE A;  3VAJ A;  1LWC A;  3W9H A;  3MF5 A;  4PG5 A;  1PJ6 A;  2LQJ A;  3DDK A;  5DG8 A;  4X4S A;  2NYH A;  4AL6 A;  4PWD B;  1J2V A;  1SKS A;  2FHJ A;  4EYH B;  4OQJ A;  2ZEJ A;  4DZD A;  3A3P B;  3FEX B;  2RIJ A;  2RSQ A;  2MYF A;  2LQB A;  5KFJ A;  3QRP A;  2KVQ E;  3CCT A;  5H1S V;  3V81 B;  1UWB A;  4L6V 3;  2RNE A;  2R4F A;  4LFB F;  5B0D A;  5KG5 A;  1VR6 A;  2FJE B;  5GAE I;  4Z7Y A;  4OI1 A;  4ZIW A;  3TZZ A;  4P2F A;  3CD7 A;  4AND A;  1ZYQ A;  4ZKA A;  5CYQ B;  4QR2 A;  5K8P A;  3AD7 C;  2ZBC A;  4F3Q A;  2UXB F;  2VHG A;  3BJY A;  1YJ9 S;  1RAI B;  5LMU F;  4EO8 A;  1XR5 A;  2VG7 B;  2RJZ A;  3IAS 9;  3HSG A;  3RRG A;  2DEJ A;  3M6V A;  3UI3 A;  1VQ6 S;  4IH5 A;  3PW7 A;  1NM2 A;  3CWJ A;  3MOZ A;  4NLQ A;  4A48 A;  1KON A;  4CZC A;  1S1W B;  1NB7 A;  3MPU B;  3AD8 C;  2YKQ A;  4ELV A;  3G71 S;  2PT0 A;  3DOM B;  1MSW D;  4Q8E A;  4MT1 A;  1WEX A;  5CCL A;  1SL1 A;  3UD3 P;  1PSD A;  1FWK A;  4NLT A;  1IBK F;  2H1Y A;  3AOA A;  4FYX B;  4K8R A;  4U7U K;  1BD6 A;  2LQ5 A;  5D0H A;  4DV0 F;  1LFP A;  2PC6 A;  3PY8 A;  3FCH A;  3GV7 B;  3V6D A;  1NJI T;  4K0K J;  4KFB B;  2OEJ A;  2E7V A;  4QYZ J;  1PJ7 A;  3DMJ B;  1U0H A;  1WI8 A;  1LW0 B;  4ZCL A;  1S7H A;  4LQ9 A;  1S48 A;  1A9N B;  4J9P A;  3KJV B;  2BOA A;  3B82 A;  1QSS A;  1FF2 A;  2VUG A;  4W4M A;  4LFC F;  2M5Y A;  3EVW A;  5IFM A;  3CXC R;  2W4P A;  3KLE B;  4KY3 A;  5C7P A;  3N0V A;  2ZC4 A;  4P75 A;  3BGR A;  5DQG A;  1DQ8 A;  3FJ2 A;  3WX8 A;  1RT7 B;  1JLB A;  4ED2 A;  4DQP A;  2CA9 A;  1FKP A;  4U7U D;  2GW8 A;  4DXL A;  3W61 A;  4NAS A;  1GMW A;  2MQP A;  4P2M A;  2J5A A;  2NLW A;  4M95 A;  4OHV A;  4ZLP A;  5DS7 A;  1XWL A;  1HBU A;  1JLF B;  2C3O A;  3W3S A;  2RKI A;  4OHX A;  5HJX A;  3W2V A;  3K5P A;  2FC9 A;  4Y2C A;  2E7X A;  1WKL A;  1IN0 A;  3DRR A;  4ES1 A;  2OML A;  4N76 A;  2WRM A;  4KGX B;  1NXI A;  2DNN A;  3FUY A;  4LRE A;  2YQ3 A;  4RNF A;  2PGC A;  4WP3 A;  4YHH F;  1WWH A;  4EUV A;  1LNQ A;  2WSC C;  1FNM A;  2V2V A;  3OSP A;  4RW9 A;  1JLC B;  4IR9 A;  4DV5 J;  1L3S A;  2QTW A;  3HI9 A;  3WHI A;  3I4P A;  3H4B A;  1RKJ A;  1S1T A;  4CLZ A;  2YNF A;  2FHJ D;  3KMQ A;  3HHL C;  1SQG A;  1RHM B;  5ETV A;  1UVK A;  3QO9 B;  4C2M A;  3PW0 A;  2DKO B;  2ZZN A;  4L76 A;  2B6A A;  2CWX A;  4KC5 A;  5M2U A;  1W7W A;  3CDW A;  4ID5 A;  4G65 A;  1T9X A;  2BM0 A;  4RBU A;  1CUL B;  3A1Y G;  3T5J A;  3BSO A;  1YIT S;  3SCJ E;  4JV5 J;  3OR2 A;  1KRP A;  4P2S A;  1RA6 A;  3VVT A;  2AF6 A;  2Q66 A;  3D6T B;  4I2P B;  2VC0 A;  4ZP9 A;  2FPH X;  1TKZ B;  4QPT A;  3K17 A;  3KFW X;  1XNQ J;  3THT A;  2OEM A;  1IBL F;  4F2R A;  4FPI A;  2J0W A;  1UJ4 A;  3W2W A;  4D3G A;  4TY8 B;  3CCQ S;  1C1B A;  4NWB A;  2BE2 A;  3PTW A;  4ZHR B;  1YRX A;  4LF9 F;  3PHE A;  1FD2 A;  2DHH A;  2IM2 A;  1N5V A;  1U49 A;  1DRZ A;  1Z2Z A;  3TNV A;  3OTD A;  4TN2 A;  4K5R A;  1VLY A;  1LWC B;  5K9F A;  3JS9 A;  4DPX A;  2VA2 A;  2BXJ A;  2HVE A;  1G3O A;  1Q79 A;  2V4J A;  3PR5 B;  4M1K A;  1R0C B;  3TJ8 A;  1NHV A;  5L38 A;  3T1H F;  1VQK S;  3BYP A;  4ZVR B;  3R7N B;  1MG7 A;  5GAE U;  3J81 j;  1IJF B;  2FB0 A;  2VPZ B;  3OJU A;  3B78 A;  1QAI A;  3OUY A;  4NPO A;  3BSA A;  2QGF B;  1RA7 A;  1KSP A;  1S1V A;  2L41 A;  1XN9 A;  2AGP A;  1S6P A;  2YX4 A;  1W2I A;  4OYZ A;  1UWB B;  5B09 A;  2W2M P;  2BRL A;  3OV7 A;  4ZVP B;  3VV2 B;  1DQ9 A;  3BSN A;  4U6P A;  3KK3 A;  5LM7 E;  1F60 B;  1UFL A;  2CG4 A;  3MM6 B;  2MQ8 A;  2WB4 A;  3R8Y A;  4F4K A;  5E5N A;  3MMJ A;  3AH6 A;  1CJK A;  3TOQ A;  1KC8 T;  1RTI A;  1T9W A;  2CNK B;  4MMO A;  4ECS A;  3TAQ A;  2V2K A;  3DGP A;  1HHT P;  4KPC A;  3K89 A;  1C2P A;  1D9D A;  3DU6 A;  4P74 A;  2W25 A;  1IKV A;  3TEG A;  3PG9 A;  3ZXW A;  5IT4 A;  3I82 A;  3BR9 A;  2HG4 A;  2MB0 B;  1GMW D;  1Q81 T;  2FJW A;  3OFH A;  3IBC B;  1KFD A;  3W8G A;  2DGX A;  2XS7 A;  4Y6I A;  4Q0B A;  1RT5 A;  2ILY A;  4P72 A;  2DXF A;  4P71 A;  1RWN B;  3CDA A;  2MY7 A;  4ZP8 A;  2Z2Y B;  3FEY B;  5KFY A;  3V6D B;  1PBA A;  4ED4 A;  1UEU A;  4DF4 A;  1U0H B;  2ZBQ A;  3FSI A;  4EBE A;  5IOL A;  2J6U A;  4ZPC A;  4OZ5 A;  2UUB J;  2C2M B;  2D69 A;  2HFV A;  3SXL A;  1FWP A;  4IR1 A;  2XWY A;  1K44 A;  2JH3 A;  1NKB A;  3M6W A;  3UFC X;  3R5C A;  3T5L A;  5D6G A;  3OR1 A;  1Q7L B;  2G2O A;  5KFW A;  2HHH J;  4TU8 A;  4A47 A;  1V6H A;  3MED A;  3MPW A;  3R6L B;  3I31 A;  3BGR B;  5L46 A;  4M63 A;  4DV6 J;  3ZZO A;  2MQQ A;  2F4F A;  4DPY A;  1JLB B;  5K8N A;  3GWC A;  1E6Y B;  4LFA J;  1AYE A;  1FKP B;  5LSR A;  1P8G A;  2XZW A;  2VFS A;  5A2Q U;  2R9L A;  5CZV A;  2ZNZ A;  2UUC F;  2EK1 A;  2K7J A;  1NHU A;  3PJ9 A;  5KFF A;  1NCL A;  1X9W A;  5AJ3 J;  1N5S A;  1FXL A;  4DQQ A;  3DLH A;  4QWA A;  4EBC A;  2W8K A;  2WVF A;  2PA8 D;  2XI2 A;  1HBU B;  1JLG A;  4CWB A;  2YWK A;  2RKI B;  2RHQ B;  4GRS A;  2LU1 A;  5K5M A;  3PM9 A;  3W2V B;  3H59 A;  6AT1 B;  4WTO B;  4FNI A;  5D4O A;  1KS2 A;  1VQO S;  2FY8 A;  4DR4 F;  4JYA J;  3AJD A;  3DRR B;  1TKT A;  1S76 D;  1WAC A;  3RUB L;  2GC8 A;  4CLP A;  2WSE C;  3FZB A;  1A6L A;  1R0B G;  1VYA A;  1WHX A;  4OHY A;  2HWI A;  1N56 A;  1ZOT A;  4DL2 A;  3M9M B;  1NRK A;  4Z37 A;  1YJN S;  1FRL A;  4I0W A;  2I8E A;  4RW9 B;  5CHC B;  3BKT A;  3AOC A;  1H7X A;  2W4D A;  3Q8P B;  1TL5 A;  1S1T B;  2YNF B;  5C25 A;  1KR4 A;  4K59 A;  1LXN A;  4O3S A;  1VRU A;  2BQR A;  2XMM A;  3MCM A;  2B6A B;  2VC1 A;  4IG0 A;  2EEY A;  4ED6 A;  4ID5 B;  2N82 B;  4M94 A;  5LSL A;  4TLQ A;  3DRY A;  3Q22 A;  5EGY A;  2W2Q P;  9ATC B;  4N47 A;  4L74 A;  3IWX A;  2CQB A;  3OR2 B;  2ZBR A;  1X9S A;  1L3U A;  2LCW A;  1O8B A;  1RCO B;  3FBC A;  1U1K A;  2C2E A;  1V9O A;  2RHS B;  5BYR A;  3SFG A;  1XMO J;  4FYV B;  5K14 A;  1QSL A;  1KLM B;  3NNH A;  4WFX A;  4ECR A;  3KNG A;  5L1J A;  1YJV A;  3EWG A;  3TX8 A;  3UCZ P;  5DM7 Q;  2I2Y A;  3ZZP A;  4F4Z A;  3W2W B;  1RYR A;  1VK8 A;  1C1B B;  1KQK A;  1R6V A;  3HCX A;  2BE2 B;  2GZO A;  5HL7 Q;  3ELH A;  4XIU A;  2D7S A;  2HK2 A;  2Y1R I;  3CGI A;  4LRD A;  2H48 B;  3TZX A;  3A8E A;  2I9S A;  3RAM A;  4UZB A;  3G9C A;  4I7F B;  3T41 A;  2ASD A;  5KG6 A;  3TAP A;  1RT2 A;  4RNM A;  2V4J B;  4CIO A;  1NLK L;  1N32 F;  5A2Q Y;  2L3M A;  4KHP F;  1VQ4 S;  2AWZ A;  2V9W A;  3OUY B;  4P2X A;  2DCL A;  1J5E J;  1S1V B;  4PG4 A;  1B99 A;  4FN5 A;  2B51 A;  1IM6 A;  3B6B A;  1S6P B;  3IBW A;  4FDF A;  2HVZ A;  1CVJ A;  1FRX A;  2QMX A;  4PUO A;  5KFU A;  3KK3 B;  4EZ6 A;  3Q8S B;  5GAG I;  4IRC A;  3I96 A;  4DUZ F;  4ZPA A;  1ZM9 A;  1CG2 A;  2J9D E;  1CJK B;  1VCT A;  3AD9 C;  1RTI B;  1X0P A;  1B7F A;  3BGO P;  1WC0 A;  3M8S A;  1FER A;  3FC9 A;  3R5B A;  1N33 F;  4KHM A;  4LIW A;  2AX1 A;  1IR0 A;  2P6T A;  3DGP B;  1SH2 A;  2BQ3 A;  3T6J A;  2HGM A;  1RWX B;  1C4A A;  3H42 A;  1VBY A;  3ZZR A;  1IKV B;  1G6B A;  3DN9 A;  3UD5 A;  5J1P A;  1JJ2 R;  1VK3 A;  4JI8 J;  2O01 C;  4YB1 P;  1AA1 B;  4P6Q A;  1PYT A;  1A7G E;  4C11 B;  2HFS A;  2CDR B;  2D3O R;  2LU2 A;  5HP1 A;  3SZ2 A;  4PRF A;  3OXL A;  3DI6 A;  4Q0B B;  2WOM B;  1RT5 B;  3EMT A;  5ADZ A;  5F3T A;  4WPA A;  3IMQ J;  4ZJO A;  3H2U B;  4M5K A;  3CC7 S;  5FJ4 A;  3NEK A;  3DYA A;  5J2Q A;  5H9F K;  3J7Y I;  1Y3K A;  4LR8 A;  1XR6 A;  1R8P A;  2HIQ A;  4WTY A;  4WKR A;  3GIK A;  1XMQ J;  3I56 S;  5KG7 A;  2X3D A;  3K2Y A;  1OSC A;  1P27 B;  1TUW A;  2DYA A;  3QJJ A;  1RAF B;  3POT A;  2QFJ A;  2B7B B;  1G7C B;  1S97 A;  3LAM A;  1YG0 A;  3OR1 B;  2AV5 A;  3AJ2 A;  4JV0 A;  3GYG A;  5ETQ A;  5ETK A;  4F4W A;  3W65 A;  3MED B;  3PZP A;  1HNW F;  4NI2 A;  4RU9 A;  2GMH A;  2HRU A;  2AYG A;  1OSD A;  4OYX A;  2FC8 A;  4DR2 F;  4RL1 A;  2F40 A;  3QID A;  3GG0 A;  2Y8W A;  2AU0 A;  2DNK A;  2BM1 A;  3HSD A;  2KH9 A;  1RHU B;  2MQL A;  3MWB A;  2ZNY A;  4Y2A A;  1F2H A;  4G1I A;  4DV7 F;  5G0R A;  1ZTT A;  4TYA A;  3H5U A;  1JKH A;  1I94 F;  1LWE A;  2OPQ A;  1FRJ A;  2EFN A;  3ZZY A;  2WCX A;  4KGZ B;  2ZM6 J;  2QEX S;  1JLG B;  1EP4 A;  1FDN A;  4YP3 A;  4DV4 F;  1SC1 B;  2RML A;  4ZVQ B;  2Y0S D;  1TKT B;  3N9U C;  3OVS A;  2BZ2 A;  2N4D A;  5HVG A;  5GMD A;  1NK0 A;  1HR0 F;  4LF7 J;  2G2Z A;  2CWK A;  2OSR A;  4FYY B;  1GK8 A;  2F4V J;  2CQG A;  1SL0 A;  2WK4 A;  1MWQ A;  4X4R A;  3C46 A;  2HEK A;  4F36 A;  2ZJP Q;  5C25 B;  3A4T A;  1WHV A;  4KTQ A;  3CIM A;  2A1B A;  1VRU B;  1IM4 A;  2BBE A;  1MWY A;  4IG0 B;  5KFQ A;  1TK5 A;  4HHJ A;  3MUV P;  1XNR J;  3UWT A;  1O6X A;  4B9L A;  1U2R A;  3CUN A;  1P9Y A;  1B0T A;  2HHP A;  3GJT B;  4EZ9 A;  1MNE A;  4X65 F;  3TQE A;  1IKW A;  4OZ2 A;  3MPY A;  2DXD A;  3KDN A;  2HRY A;  5IV3 A;  2LDY A;  5K14 B;  4GMK A;  2E1P A;  4LBP A;  4OJH A;  2MKS A;  1P1L A;  2OUG A;  1RAG B;  3D0G E;  2Z30 B;  4EWT A;  1U1R A;  3MGJ A;  2KI2 A;  1DTQ B;  2MMY A;  2OLW A;  2JX2 A;  3MCN A;  3CCL S;  1GT8 A;  2PFD A;  1M5H A;  3TR5 A;  4X62 J;  1Q4R A;  1N88 A;  2VPW B;  5BR8 F;  4OMF G;  4RO0 A;  2IIH A;  2D74 B;  4UOC A;  4RBV A;  5MLC V;  1RT2 B;  5KG2 A;  1R7I A;  3E8O A;  1IQT A;  1KD1 T;  2DIU A;  3MCO A;  4DQS A;  2OPS A;  1X5S A;  2BW2 A;  1MW7 A;  2XY7 A;  3SSR A;  2NSC A;  4M5L A;  3QMQ A;  4B02 A;  2JEF A;  2FJX A;  2J0Q D;  4PUO B;  4JBC A;  4RUC A;  3K5N A;  4LSZ B;  5IT9 Y;  4DBQ A;  3DLG A;  3KMS A;  1SIW B;  4B3O A;  1X4H A;  4DPO A;  1SPB P;  1WDD A;  1S9G A;  2FVR A;  1RLC L;  1PAE X;  5B0E A;  2A6M A;  2C2D A;  1F9H A;  3RW7 A;  1Q0N A;  3FBE A;  1Z1Z A;  3E51 A;  2R42 A;  3TX0 A;  1UET A;  1WEY A;  4HH0 A;  2VV5 A;  1HD0 A;  1FVS A;  1U6Z A;  1FHT A;  1HHQ A;  2CPJ A;  4HDG A;  4ANC A;  4ZPV R;  1ZBT A;  1FRM A;  3ZTR A;  4JI0 J;  1X31 C;  2DPJ A;  1LQ9 A;  2AJF E;  5DLF A;  4J37 A;  2C28 A;  2F9D A;  3DRX A;  4TYB A;  3DCA A;  4JI3 F;  1L3V A;  2V68 A;  4RWX A;  3LQV A;  3QYY A;  4XK8 C;  4NLY A;  3P49 B;  1GX5 A;  3GB0 A;  5HP1 B;  1AXQ A;  1KTQ A;  3CIZ A;  4C0H A;  3DI6 B;  2GIQ A;  3KK2 A;  4FS2 A;  3ULH A;  4MKB A;  4MKV A;  5G4D A;  3IAM 9;  3AOB A;  3A8I A;  5J2Q B;  2VQF F;  4OLP A;  2YQ1 A;  3TEH B;  2R7R A;  1V3S A;  4ICL A;  3M6U A;  2LMI A;  1OYE A;  5KFT A;  3D1O A;  3ZZT A;  2MXY A;  1Q16 B;  4KHR A;  3CDE A;  1TMM A;  2IFX A;  1SJQ A;  1WF1 A;  1FJ7 A;  3NS6 A;  4I69 A;  3UN2 A;  1DUR A;  4BC7 A;  3PEJ A;  3POT B;  4DR3 J;  3D3B J;  3D5M A;  3KLH A;  2HPU A;  2O66 A;  1S7I A;  3GV8 B;  4NI2 B;  2FIU A;  4EEY A;  1VIX A;  1WC5 A;  1VJQ A;  2SXL A;  2ZOG A;  2D9P A;  1FVQ A;  2COL A;  4RNH A;  1HNX F;  3QT7 A;  1Q86 T;  3LP0 B;  3H2V E;  1A0O B;  2M3D A;  4XO0 A;  1U2F A;  3TUI C;  2EXU A;  4WYW A;  2VFU A;  3LOU A;  4NCA A;  2X3G A;  3MPV A;  2DNP A;  2KYZ A;  2MDA A;  5G0R B;  3EDR B;  1JKH B;  4B08 A;  1VMB A;  5HQL A;  3RG6 A;  2OPQ B;  1X4A A;  2QLF B;  1EP4 B;  2ZJQ Q;  2EW9 A;  3LTO A;  1PAU B;  1UEV A;  2MZJ A;  1GFW B;  5H9F J;  1U25 A;  3I9Z A;  1N52 B;  3MI7 X;  2QX0 A;  3M8Q B;  2BVZ A;  4U9R A;  4RUA A;  2AEF A;  2B5J A;  4U67 Q;  2WZ1 A;  4KYZ A;  1PC5 A;  2IAJ A;  2P8I A;  3C2P A;  1NDC A;  4NXM F;  4UST A;  3Q8Y A;  4J9S A;  4YY3 F;  4B9S A;  4MYT A;  2AP6 A;  1QY7 A;  2V2Z A;  4RNO A;  4JI2 J;  1MML A;  5I4M A;  4OZJ A;  3DKD A;  3N5F A;  2DHS A;  3W9J A;  1T03 A;  4TY9 A;  1RCX B;  2JHE A;  3JB9 k;  3L4B C;  3LGM A;  1S79 A;  3PJW A;  4HKQ A;  1RWU A;  2KU7 A;  3T9Z A;  2W9A A;  2NXC A;  2AJ4 A;  4DSJ A;  3BSC A;  4BHQ A;  2Y1J A;  1UJ5 A;  2NPF A;  3CC2 S;  2C3P A;  5L1I A;  4BWJ A;  1M1K T;  2BRK A;  3OFE A;  1VJW A;  1UW9 A;  1CC8 A;  3W5X A;  5EN1 A;  3CDB A;  1U26 A;  2R2R A;  5HVF A;  3KUH A;  4ZDN A;  3WC0 A;  3GTY X;  1IKW B;  1QUV A;  3ZZZ A;  4CRJ A;  1RBO B;  4NA3 A;  3HLU A;  4TXS A;  4DEZ A;  2V69 A;  1ZZN A;  1F2G A;  1HWJ A;  4E98 A;  2DO4 A;  4XPE A;  1CJU A;  4PXE A;  1S57 A;  1HNZ F;  4A8F A;  3HHE A;  2DGO A;  4A8K A;  4KR0 B;  2EKN A;  2GJI A;  5SUH A;  3I5B A;  4LSL A;  5HMZ A;  3J7Z T;  2ROE A;  4UW2 A;  4IFV A;  1KQS R;  4WYL A;  3TA1 A;  3CJ4 A;  3PR4 A;  4M8L A;  2ACY A;  3BV8 A;  1KVJ A;  3MTK A;  2UU9 F;  2CVE A;  3QQC D;  3GII A;  3LP2 A;  1FT8 A;  3MCS A;  3NOG A;  3MEC A;  2GQ2 A;  3HK2 A;  1D3W A;  3U1N A;  1G2E A;  1RAC B;  3RR7 A;  3H98 A;  2OTJ S;  2C2K B;  4PWW A;  3LW5 C;  2R8H A;  4OJG A;  3IGN A;  3VGV A;  4J9Q A;  1TK8 A;  1ARO P;  3ETM A;  2KFZ A;  4YB7 A;  1IJE B;  2H5E A;  4GO5 X;  4DS5 A;  3EM1 A;  3DLG B;  4B3O B;  3OTE A;  4DCO B;  3ZNJ 1;  2JDJ A;  2DR7 A;  1S9G B;  3UDV A;  2H65 B;  3PO4 A;  3DHX A;  4C7Q A;  3X3U A;  4KO0 A;  1NSK L;  1RT6 A;  3EYZ A;  2MST A;  2ZBP A;  2B0G A;  2KJV A;  3FSY A;  1JMT A;  2OFG X;  4DDF A;  2CJK A;  1HL6 A;  5J2N B;  3MAQ A;  4KIA A;  2JEG A;  4Q43 A;  3TAR A;  2E7W A;  3TUP A;  1HNV A;  1J5O A;  1X7V A;  2XMK A;  2QLX A;  3P5B P;  1UVN A;  3JQM A;  2MHN A;  2GFF A;  4B3T F;  1RJJ A;  3BO2 A;  3OPK A;  3R7B B;  4NLX A;  4ED7 A;  1ZZF A;  4XPC A;  2Y1L B;  2QSF A;  2F65 A;  4IQX A;  1BQN A;  3AB4 B;  1V3Z A;  1Y0H A;  2IY5 B;  2YX1 A;  2RVJ A;  4OX7 A;  3Q23 A;  1MU2 B;  4JI4 F;  1EX8 A;  1RHJ B;  4Q2M A;  3KK2 B;  4H4M B;  3CCM S;  2QA2 A;  2F8M A;  2WVE A;  4O3N A;  1VQP S;  1B3T A;  4FS1 A;  2GQC A;  2CIM A;  4ZVO B;  1OWX A;  9RUB A;  2YKP A;  1RAO A;  3WDO A;  1UA1 A;  1TFY A;  4ICL B;  2KRB A;  2AT1 B;  1SJ3 P;  1DLO A;  3N01 A;  1HWL A;  3D4J A;  1Q82 T;  2V9K A;  4ZVG A;  3MDF A;  1QD1 A;  3KNA A;  5FDL A;  2DRD A;  4QWD A;  1S0N A;  1JB0 C;  2I5J A;  3GYN A;  3Q89 A;  2H51 B;  3KLH B;  3H90 A;  2AMC B;  3EVO A;  4DS4 A;  2NYI A;  2DGV A;  1VQY A;  1S4F A;  1KWM A;  5EUH A;  5B0F A;  5B0A A;  1WG5 A;  5IC4 B;  2APO A;  3G6V A;  3QLH A;  1B0P A;  3EZO A;  2EFV A;  5KAK A;  2KZZ A;  1UA0 A;  1OS5 A;  4ZP7 A;  1LWF A;  1F5B A;  3UW1 A;  5A8W A;  2ATL A;  2MPU A;  3BBF A;  5K8M A;  3G6X A;  3NLC A;  1RAE B;  3HHD A;  2B4O A;  5DGA A;  1C0T A;  3W5Z A;  4LVN P;  3R1H A;  2RDD A;  3L7U A;  1S49 A;  3I5C A;  5FII A;  3SDE A;  1VS3 A;  2VDI A;  2B5J B;  3FQK A;  1VFJ A;  3MMB A;  1AUS L;  3CCU S;  2E1A A;  4OZL A;  4OYW A;  2IAJ B;  2JFD A;  3TWZ A;  3MD3 A;  3BBB A;  2ZH3 A;  3NY0 A;  2FYX A;  3CME S;  1T03 B;  3NAI A;  2CQI A;  4X4Q A;  4H4O A;  2RQ4 A;  3CC4 S;  1D9A A;  4ILM A;  4WZQ A;  1Y5I B;  2HSE B;  3EZU A;  1PIE A;  3VGT A;  5HLF A;  5HSP A;  3KG0 A;  1K1S A;  3QWP A;  4EMD A;  2HFU A;  5HRO A;  4X4N A;  2M88 A;  3MM8 A;  2UVU A;  1ZAX A;  2QLJ B;  2D9O A;  5KFV A;  1SJ4 P;  1TK0 A;  2IHR 1;  3ILL A;  5I42 A;  4LUB A;  1HIY A;  4LR7 A;  4YUD A;  4JI7 F;  3T3F A;  2CYY A;  4HYK A;  2XUL A;  1WOR A;  1LV5 A;  4UY8 5;  3K8V A;  3DM2 A;  4NRT A;  4NLP A;  4WIQ A;  2NXN A;  1U1Q A;  2YWW A;  4PXC A;  4JUZ A;  3UDE A;  3T5K A;  4DOZ A;  2XLK A;  4LF4 F;  2KM8 B;  1CJU B;  1TL4 A;  4I6W A;  1KVK A;  1PJ5 A;  5E3R A;  5CZX A;  2ZHO A;  4MIA A;  2OAU A;  1WD6 A;  2V0N A;  4F3M A;  5F8J A;  1CLF A;  1ZTW A;  1R6Y A;  2H4W B;  2GJ2 A;  4CI0 B;  5KFK A;  3P5T L;  3G8Q A;  2ZH2 A;  4LSL B;  4IFV B;  5F9L A;  3IG1 A;  1VQ8 S;  2IM0 A;  2YKN A;  5BXI A;  1NDP A;  1KBR A;  4DR1 J;  5LMU J;  5C42 A;  2QSW A;  3M2U A;  1TKD A;  3T19 A;  4I1T A;  1QTM A;  3LP2 B;  1W2B R;  3MEC B;  2B9Y A;  1Q8K A;  3DU5 A;  4DCP B;  4R8U A;  1GQE A;  3TZY A;  4RNN A;  4DV2 F;  3NMA A;  2ZH5 A;  2QLW A;  4GKK F;  1XIQ A;  1FJG F;  3MMC A;  5JXS A;  3MM5 A;  3CVK A;  4IO1 A;  2XMU A;  2IBK A;  2W2P P;  2QL7 B;  4KQZ A;  4C6A A;  4HDH A;  1XK8 A;  2EFO A;  3OTO F;  2JLE A;  4U7C A;  3VAG A;  2AJ0 A;  2WON A;  4F4Y A;  2FUG 9;  4YME A;  3GQC A;  3R5D A;  4CP5 A;  4DL4 A;  2MKC A;  4USW A;  4LRC A;  4ED8 A;  2HHW A;  1TMJ A;  2JVR A;  4RLE A;  4DV0 J;  3M8R A;  1QUP A;  1CQM A;  1HKA A;  2HAI A;  1RT6 B;  5E3A A;  4C0B A;  3RR8 A;  1SCJ B;  3UDL A;  4JV5 F;  3BR8 A;  2BA9 A;  5DZ6 A;  1NK8 A;  3KG1 A;  1KNZ A;  2NCK L;  5F3Z A;  2WW4 A;  3H4D A;  3W63 A;  3AFG A;  1VBK A;  4DUT A;  3SYZ A;  3RB4 A;  4ZMM A;  1HNV B;  1WC4 A;  1J5O B;  2NZ4 A;  1QVF R;  3KHG A;  4LFC J;  3SCI E;  3IS9 B;  5DDO C;  2NPI A;  5F0U A;  5LSO A;  4OI2 A;  4FYD A;  4YB5 A;  5EWE A;  2F7V A;  4RWW A;  3C6T A;  5C2G A;  3PFO A;  2HAF A;  2Q6C A;  4ES2 A;  4RUH A;  1TEL A;  5J1E A;  2Y9H A;  1BQN B;  1QJH A;  4GVL A;  3CF5 Q;  2RDJ A;  3OTC A;  1NME B;  1F3F A;  1ROF A;  5EWF A;  3ZC4 A;  3JQJ A;  3N28 A;  3QGP A;  3CJ8 A;  1T9V A;  2IDE A;  1HPZ A;  1U09 A;  3SI8 A;  3MEE A;  4CLW A;  1UAW A;  1S59 A;  1DLO B;  1S6Q A;  1V5I B;  5F8G A;  2HBQ B;  1SH3 A;  3UNG C;  5J2M A;  2VG5 A;  2ROP A;  5FDL B;  1ZPW X;  3GFZ A;  4M5J A;  4A8X A;  4CLL A;  4AQY J;  3MUM P;  2IVY A;  4NYO A;  2I5J B;  2DIV A;  3BGF A;  3NRB A;  2G1H A;  4B9N A;  5J1N A;  4RW4 A;  3R1L A;  2FJD B;  3SSQ A;  3FFI A;  5EHH A;  4YHH J;  2EPI A;  3KJF B;  4ITS A;  2FHM A;  3QLH B;  1U24 A;  4LBH A;  4DFP A;  2QL9 B;  2MKJ A;  3CED A;  1LWF B;  5M2R A;  4ZJL A;  3KLF B;  2BE7 D;  1OQ6 A;  5A8W B;  2R7S A;  2ZWP A;  2HS0 A;  3HKW A;  2XGQ A;  1U6B A;  3OL9 A;  4KRW A;  4IQM A;  2RQC A;  1NKE A;  2GHP A;  4NZ7 A;  2VFR A;  2VH7 A;  4ZCK A;  3PVX A;  3L09 A;  4NXN F;  3ISZ A;  3M8W A;  1QAX A;  1QAY A;  1C0T B;  1FA0 A;  1GX6 A;  2HHS A;  1U8S A;  3BKU A;  1HQU A;  2HS3 A;  3K59 A;  3SDE B;  4Y2M A;  3PAC A;  1BUX A;  4J5O A;  1DQA A;  5GME A;  3EE3 A;  3MMB B;  3EGV A;  1U1N A;  4O4G B;  2MKH A;  2PN6 A;  3C14 A;  3PYG A;  3Q0A A;  1IBL J;  3D0H E;  1H0H B;  3M8Z A;  4QYZ K;  4GKJ F;  5D78 A;  2YWF A;  4CO4 A;  2XMV A;  3AQP A;  5LT5 A;  2MQO A;  1SKW A;  2R8I A;  4ED0 A;  1JXL A;  4CYU A;  4LF9 J;  4MK7 A;  3HHL D;  2E1M C;  5IV4 A;  5K8O A;  5C5J A;  2K7K A;  1NSA A;  1RTD A;  2DGW A;  1AB8 A;  2PI4 A;  2FLO A;  3DRP A;  3OTB A;  2EBG A;  5HLF B;  3GIJ A;  2YNI A;  1R31 A;  1GEH A;  2FQQ B;  5ETS A;  5KT7 A;  2WW8 A;  5D8H B;  4B9T A;  4FKY A;  4UZC A;  5HRO B;  3MM8 B;  4OFZ A;  5GVQ A;  5KFH A;  3E01 A;  2J9E A;  2FZG B;  1REG X;  3T1H J;  4ZCI A;  3A8J A;  1N34 J;  1HQ2 A;  3J7A 1;  2IC3 A;  1RT3 A;  3V5R A;  4B3M J;  1ZET A;  2MZT A;  3DM2 B;  4GVB A;  1D8Y A;  2WSF C;  3G6Y A;  2Z4P A;  4C0O C;  1BGX T;  4NA2 A;  2CPH A;  4DR5 F;  3GFY A;  3L7O A;  4DUY J;  5HO4 A;  3T9N A;  1NU4 A;  1FNO A;  2CUY A;  3JAM U;  2V8H A;  1TL3 A;  3HFZ B;  1VQ7 S;  4WZM A;  2QA4 G;  2PEB A;  1YBT A;  2DR5 A;  4C97 A;  2PMZ D;  2BMB A;  4EI2 A;  2HLU A;  1TAU A;  2AJQ A;  1ITP A;  2HLT A;  4K2J A;  5KT6 A;  5D0E A;  3G96 A;  2YKN B;  4RKU C;  4C8K A;  3D28 A;  2CJ9 A;  3ETO A;  4N56 A;  5C42 B;  1OMS A;  3M2U B;  4ZOS A;  3R2C J;  4OI6 A;  3S7R A;  5F0W A;  1RAA B;  4R8U B;  3NNC A;  2BKO A;  2DEI A;  1UCN A;  2H3E B;  3MMC B;  3CD5 A;  3HT3 A;  3MM5 B;  5DET A;  1S9E A;  4YDD B;  5MAO A;  1G4C A;  5IZH A;  1UZH A;  4IYQ A;  5DJB A;  3CD0 A;  4CH7 A;  3KJN B;  3O8W A;  1GXL A;  1D09 B;  3KKF A;  4KT0 C;  1M90 T;  5IT0 A;  1HA1 A;  5D77 A;  1RE1 B;  2RB7 A;  1S1X A;  3EUN A;  3FNN A;  3HHK A;  4MFB A;  3MXH P;  4QJV A;  5K20 B;  2W8L A;  4ZS6 A;  2BJ3 A;  2XC9 A;  3D6F B;  4ZLL A;  4DX8 H;  2RS2 A;  1WC3 A;  5THW A;  2XO6 A;  2K2P A;  1T02 A;  1O0P A;  1VC0 A;  4PEO A;  2WHO A;  4DCJ B;  4RX6 A;  5KFD A;  2VPY B;  1EAR A;  1NUE A;  4G1Q A;  3HVT B;  3GV5 B;  2BW7 A;  3DLE A;  3WX4 A;  2B43 A;  2DJW A;  3W62 A;  2YPZ A;  1UVJ A;  4EGL A;  1IKX A;  3MAH A;  2OO4 A;  1MRO A;  2KHD A;  1KLN A;  3B54 A;  1W26 A;  3C6T B;  1TUG B;  3ITH A;  3AB2 B;  5J1E B;  2J8S A;  3LPE A;  3RYL A;  2K1R A;  2VA3 A;  1T94 A;  3SIP B;  3HZG A;  4OJ1 A;  2HHU A;  1BWE A;  3RAX A;  3F41 A;  2MLY A;  4OZ1 A;  3TAN A;  3HDS A;  2UVR A;  1M5V C;  3JTO A;  1YTY A;  2KO1 A;  8ATC B;  1HPZ B;  4HR2 A;  2Q3P A;  5CH7 B;  5GAH U;  2LP4 A;  3MEE B;  2BX6 A;  4YFU A;  2A2C A;  4EK2 A;  3HSZ A;  3ONQ A;  4DFK A;  3JAM Y;  1FWL A;  1S6Q B;  4OV6 A;  5J2M B;  3PRV A;  2VG5 B;  2FLL A;  4A8W A;  4DR4 J;  2AKW B;  3B8H A;  2WTF A;  3HXM A;  5L9N A;  4A8O A;  4DL5 A;  4ZCM A;  5B08 A;  4Y3C A;  4RW4 B;  4DV3 F;  5F8L A;  2DNQ A;  3IGV A;  3D3C J;  1N36 F;  5KT5 A;  1FJC A;  3FFI B;  4P9S A;  4C3L A;  1U0S A;  2O67 A;  5F8N A;  1RU1 A;  2H4Y B;  4HI2 A;  4NLV A;  1K8A T;  3TVZ A;  2EFG A;  1T9U A;  1FJE B;  1EQ0 A;  1BHN A;  1QAJ A;  4RW8 A;  5I3Q A;  4OYB A;  3SSS A;  2B8Q A;  2KXN B;  3FK4 A;  1CPZ A;  2OEK A;  3OBI A;  3VZI A;  1RT1 A;  4FNH A;  3DLL Q;  4JI1 F;  1BMQ B;  2LVW A;  2VKZ G;  1HQU B;  1WUU A;  4S0M A;  2KZM A;  3DNC A;  3PX4 A;  4DR6 F;  1N5T A;  1T11 A;  1S6O A;  2MJU A;  2O5D A;  2JOQ A;  3C14 B;  3BGL A;  3FRZ A;  2HZA A;  2DR9 A;  3M6X A;  3ENA A;  3F73 A;  5KG1 A;  2H5J B;  3T1Y J;  3D68 A;  4ZIT A;  4E0D A;  2LKZ A;  3TRG A;  2P2C B;  2E5J A;  4CYU B;  4ATN A;  2QZ8 A;  3BO3 A;  3TUJ C;  1Z4U A;  1RTD B;  4I6A A;  3DRP B;  1BY9 A;  4URG A;  1CSJ A;  1S10 A;  1T05 A;  3BYR A;  2YNI B;  1K47 A;  1RKI A;  2QJ3 A;  3OFF A;  3CJR A;  4G6V B;  2RE1 A;  2V34 A;  2CQ0 A;  1PYO B;  2GHW A;  2ZC3 A;  2VFV A;  2HFN A;  1RWK B;  3E01 B;  2V6A A;  1N32 J;  5BYQ A;  4QPX A;  2FZC B;  4NYP A;  4KHP J;  3TO8 A;  1OQ3 A;  4ILR A;  2YTC A;  1WSR A;  2DR6 A;  2IC3 B;  1RT3 B;  4GVB B;  3EIC A;  2HGL A;  8AT1 B;  4LF2 A;  1AT1 B;  2E29 A;  1ACM B;  5F8M A;  1HBM A;  4KJI A;  1F5A A;  2V63 A;  2F3J A;  1TL3 B;  4CO0 A;  4DQI A;  2RQM A;  2B7C B;  4HI1 A;  4DUZ J;  2E5L F;  5JUM A;  2MLX A;  2DIS A;  2Q79 A;  3CTR A;  2UV8 A;  3GLJ A;  2YNG A;  5KTQ A;  2ZM6 F;  1H2T Z;  1RWO B;  1F5C A;  1L3K A;  2XNQ A;  2JEJ A;  3ZZU A;  4DL3 A;  2ZD1 A;  1X9M A;  3IA0 A;  2QO3 A;  4TQS A;  1YIJ S;  2Z0G A;  2EI5 A;  4IG3 A;  2QFI A;  2F4V F;  1S9E B;  4NOH A;  3LUY A;  3BN4 A;  4X84 A;  1AUD A;  2PE8 A;  3LGH A;  5HMY A;  3EGZ A;  2KRR A;  2Q43 A;  3M05 A;  4CT8 A;  3QT8 A;  4BC9 A;  1SVD A;  3FCW A;  1S1X B;  3I4H X;  5D4L A;  1UPM B;  1HWI A;  1NPP A;  2F8H A;  3DXS X;  4MFB B;  2IYI A;  1K9M T;  3AXM A;  4DSL A;  2UP1 A;  4Y28 C;  4WBF A;  1HI1 A;  3MUT P;  1VQS A;  3QBC A;  1P1T A;  1S77 D;  2CJQ A;  1H2V Z;  3MR6 A;  1Q1K A;  3UR0 A;  3DLK A;  4FYW B;  3S6E A;  3TQ1 A;  5HMX A;  3A3O B;  2M7S A;  2M2B A;  3QSI A;  4OJ3 A;  2DNG A;  3G87 A;  1EET A;  4G1Q B;  5CD4 H;  3J7A N;  3UD4 P;  2CG8 A;  1IKX B;  3BPD A;  3PEH A;  5GAD I;  4DR2 J;  3C6U A;  4K4S A;  1MRO B;  3QIP A;  2OH2 A;  3FBF A;  3UQS A;  3CSK A;  2RRN A;  3ITH B;  3A8K A;  2LA4 A;  3R27 A;  4ER8 A;  1X4E A;  4DN9 A;  3IRX A;  4I68 A;  1EQM A;  3MPD A;  2K1R B;  4X62 F;  2M4M A;  3IR7 B;  1GAO A;  4CNZ A;  2RUS A;  3VHQ A;  3OL7 A;  4C3K A;  1Q5Y A;  3P96 A;  1GH8 A;  5ETL A;  2HNY A;  1I94 J;  3E2E A;  4ECT A;  1SQF A;  3KK1 B;  1UTA A;  2CQ4 A;  3BQ0 A;  3G86 A;  1FEH A;  2P9C A;  4USH A;  1BWV A;  3RBE A;  2DH8 A;  3CCW A;  5ETR A;  4LIR A;  5A8R B;  4DV4 J;  5FD1 A;  2M8H A;  1VQ9 S;  5IWA J;  2V2Q A;  1UMJ A;  2ILZ A;  4O3Q A;  4MK9 A;  3OT9 A;  4DFJ A;  5F41 A;  2BAN A;  2CNN B;  2IVM A;  1ZPV A;  2BDP A;  2RU9 A;  4Q8F A;  2EG1 A;  3Q8U A;  1HR0 J;  4B3S J;  2RDI A;  4EO6 A;  4ZN1 A;  1VRT A;  1WKJ A;  2LYV A;  1XQI A;  2C2O B;  2XNR A;  1R43 A;  5F9N A;  3GYX B;  3P45 B;  1GXU A;  5HI7 A;  3KUG A;  4HAC A;  2D1C A;  4F50 A;  4J90 A;  3SBM A;  1RWP B;  3CCZ A;  2FLN A;  4RW8 B;  3BKF A;  3M9N B;  1U4B A;  4Q5V A;  4PPD A;  1SI9 A;  1FO1 A;  2IJN A;  1VBZ A;  3M2V A;  1RT1 B;  1TL7 A;  4X65 J;  4OHZ A;  3PRD A;  2PMW A;  3AY0 A;  4X66 F;  2EK6 A;  3LAK A;  1KHW A;  3PYF A;  2IRX A;  3LF0 A;  4NLO A;  1NEE A;  1DZ5 A;  2F1F A;  3CJS A;  4M5I A;  1S0V A;  3OVB A;  3I5A A;  3L95 X;  2HMI A;  3NGK A;  2H54 B;  5IQQ A;  1YLX A;  2JC1 A;  3R2D J;  2QMW A;  1RP5 A;  4CH1 A;  1TAQ A;  3TUZ C;  4OI0 A;  2ADB A;  3C8Y A;  3OSN A;  3D6H B;  3S8S A;  2Y8Y A;  3Q83 A;  3LA0 A;  1T05 B;  2FJA B;  2CQ3 A;  2ACM A;  2MY8 A;  1KKH A;  3BO4 A;  3VR1 A;  4CM2 A;  5DM6 Q;  4DV1 J;  3NGR A;  3DOL A;  2L48 A;  2O1P A;  4PG6 A;  1PO6 A;  3BQ2 A;  4OIX A;  2HZC A;  2P9G A;  1F3V A;  1CJV A;  2G4B A;  4J9O A;  4CO2 A;  4HHU A;  4K7Q A;  4NL5 A;  3IR5 B;  1HBM B;  1VC6 A;  3RZA A;  3NS5 A;  2CPE A;  2CQ2 A;  1REV A;  3AHP A;  1Y11 A;  2MJN A;  4Y34 A;  2XMW A;  1V5V A;  2OPP A;  1Y00 A;  1U45 A;  1YGY A;  4C3M A;  1YJU A;  5DG7 A;  3GR0 A;  3W60 A;  4PQA A;  2R3V A;  4NA1 A;  2VBW A;  2YNG B;  3S1T A;  1FE0 A;  5HN0 A;  4UOG A;  3PX6 A;  3JTP A;  3MM7 A;  4J9R A;  2UXC J;  1TL1 A;  2DHG A;  2IBO A;  2ZD1 B;  2YKM A;  3CJ2 A;  2IRU A;  4HTI A;  5ETO A;  2X7I A;  3KLI A;  1S5Z A;  2CRL A;  4F67 A;  4DSK A;  3DLB A;  1RYS A;  1HBO A;  1WJ9 A;  5B0G A;  5CAB A;  1IWA A;  1WG4 A;  2M0G B;  5LJ3 Y;  2DGU A;  4IG3 B;  4LJM A;  4O44 A;  3M8P A;  3JQK A;  2G0J A;  2VF3 A;  3RW6 A;  1WEZ A;  2Z56 B;  2GJF A;  1OPZ A;  2PMH A;  4JI3 J;  1YVF A;  2ZHB A;  3HX9 A;  1HD1 A;  4F3O A;  4FVC A;  2J7U A;  1UP1 A;  1SB6 A;  4OHW A;  1IQZ A;  1VDH A;  2Y0B B;  3K0J A;  3TVK A;  2ZZM A;  4KPY A;  3MUR P;  3HF5 A;  2GQQ A;  1C1C A;  2VQF J;  2B4U A;  2DR8 A;  3GSD A;  3H5X A;  3MMA A;  4Y2K A;  3KLV A;  3HD1 A;  1NSP A;  1WKK A;  3NBP A;  1U02 A;  4AUK A;  1AW0 A;  1M5K C;  3DLK B;  4PPZ A;  3K5O A;  3NP5 A;  4JV1 A;  5D0R A;  4LF6 J;  1PKU A;  1EET B;  3HMJ G;  1F9E B;  1U1M A;  3HFV A;  5LXR A;  3O3L A;  4HH1 A;  4JI5 F;  3D6M B;  3CO9 A;  5DZ7 A;  3C6U B;  4C8O A;  2XEX A;  1VQ5 S;  1KN6 A;  4ZVE A;  3DLJ A;  3QIP B;  4KGM A;  3NL0 A;  3PYE A;  3ET6 A;  5E3Q A;  2C2Z B;  1HNX J;  1S1U A;  1RTJ A;  3MHY A;  3IRX B;  2K3K A;  3RAQ A;  1YRU A;  1JNR B;  2IMO A;  2FTR A;  2C2N A;  4QR0 A;  3C3L A;  2N3O A;  4CM0 A;  4ELU A;  2Q6B A;  1IKY A;  1H72 C;  1WG1 A;  2C3Y A;  2I0X A;  1XBW A;  2V5H G;  3QRQ A;  1TQL A;  3QGH A;  3OL6 A;  4CH0 S;  1FX4 A;  2BAN B;  3CD6 S;  2Q1L A;  3HSJ A;  1CJT A;  2UZA A;  4C48 A;  1KFS A;  4CTA A;  2OHD A;  2OFH X;  4BS2 A;  3OXF A;  4OZ0 A;  1RT4 A;  5KOX A;  1VRT B;  4G1P A;  4M5M A;  4RR5 A;  3RRH A;  4KFB A;  4R0J A;  1UVI A;  3K5L A;  3VF0 B;  5JVH Q;  2FLP A;  3NKY A;  1LW0 A;  5AE3 A;  4KBI A;  4HAC B;  2RIL A;  3H5Y A;  1B64 A;  3R9L A;  3M4X A;  3V6J A;  3FKB A;  2HHT A;  1KOO A;  2OP5 A;  4YR3 A;  1RTH A;  3P6Y C;  3M2V B;  4YB6 A;  3AOD A;  2FVS A;  1UW4 A;  2ASY A;  1TL7 B;  1FTC A;  3FZ2 A;  4X64 F;  3OD2 A;  2GMJ A;  2IA0 A;  3GIR A;  4P73 A;  2HGN A;  2XHW A;  4ZVF A;  4KV8 A;  2DGT A;  2MKI A;  1SJ1 A;  3GMG A;  3CCE S;  2HMI B;  3TW0 A;  2ZUA A;  1OO0 B;  1K1Q A;  2FJB B;  3U7J A;  3QGG A;  4FKX A;  5ETT A;  4K4Y A;  4QIG A;  2CKW A;  2X51 A;  4NZ0 A;  3OJS A;  1X0F A;  2UU9 J;  1LXJ A;  2KVI A;  1H7W A;  3SFU A;  1YZ7 A;  3OL8 A;  2UXD J;  2Z57 B;  2OGU A;  4F2S A;  2CPF A;  4PXB A;  3Q8R B;  1R89 A;  2P9E A;  3DOL B;  1U1P A;  4WK1 A;  4DLG A;  2UUA J;  1CJV B;  1UL3 A;  2CQ1 A;  2ZWO A;  4ECU A;  1Y5L B;  4P10 A;  1SUQ A;  5F8H A;  4IUF A;  2CNO B;  1OY9 A;  1UFW A;  1NAQ A;  4USI A;  3CO0 P;  3WQP A;  2CNL B;  1T7P A;  1CQN A;  2DH7 A;  2OPP B;  1KDN A;  2R2T A;  1QTN B;  1FRH A;  1IXK A;  3RB0 A;  3VAF A;  1FKA F;  3JSB A;  2WVD A;  1HMV A;  5KT3 A;  5JVG Q;  3HZE A;  1LK7 A;  1TL1 B;  2X1G A;  2CAD A;  3KJQ B;  2YKM B;  3A3N B;  2MSS A;  1VHI A;  2AZ1 A;  2LEP A;  1WEL A;  5JJB A;  2NS1 B;  3TA2 A;  1HBO B;  1Q8B A;  3NGT A;  3EVM A;  1JJH A;  1IBM F;  2ALZ A;  2ALY B;  1U2C A;  4ECX A;  1WTF A;  4O44 B;  1HI0 P;  3FCV A;  2U2F A;  2IPO B;  4B3T J;  2AD9 A;  4TY8 A;  1HYS A;  4DU7 A;  1H98 A;  3GFH A;  4JB8 B;  2AGQ A;  2DNR A;  5L1L A;  2VB6 A;  3FSX A;  4IH6 A;  1I51 B;  4F4A A;  1UEK A;  3W66 A;  2W01 A;  2R7V A;  2ZVS A;  4JI4 J;  4M5G A;  2DNY A;  3O44 A;  3SQO P;  1AZS A;  1SC6 A;  2AW0 A;  2BJD A;  3SV4 A;  3GIL A;  4HHH A;  1C1C B;  4LF8 F;  1YWX A;  3NCP A;  1R8B A;  4K2X A;  1HQE A;  3MMA B;  4UY8 T;  2HS4 A;  3NBP B;  3C15 A;  4QWB A;  1NK4 A;  2E44 A;  2FVP A;  3IN5 A;  4OI3 A;  5CA5 A;  4NLD A;  2QIF A;  1SQE A;  2NZC A;  2ZHA A;  1EKR A;  3MM6 A;  4PG8 A;  1HI8 A;  3HM9 A;  2X1F A;  2J0X A;  3ET6 B;  2HQG A;  3OHA A;  4I6Y A;  1CC7 A;  4ECV A;  1YX2 A;  1H74 A;  1S1U B;  2GIF A;  3MTJ A;  4JP8 A;  1VQN S;  1RTJ B;  1FDA A;  4J9K A;  4FXV A;  4DR1 F;  1VBX A;  1ZAW A;  1U6F A;  4JI6 F;  4DR7 F;  3EJM A;  3H20 A;  3PKY A;  1YSJ A;  4NCB A;  2PA3 A;  4B9V A;  3D0I E;  1D8Z A;  2IYG A;  4KH0 B;  4DL6 A;  2V8G A;  1B0V A;  1XC9 A;  1IKY B;  1T9T A;  5A6P A;  4ECQ A;  4N7T A;  4N41 A;  3HVR A;  1JX4 A;  5L39 A;  1VIS A;  2D3O 1;  1ELO A;  3MD1 A;  1RUS A;  4FP9 A;  2DH9 A;  2IRY A;  3QFH A;  4LF5 J;  4OV1 A;  4WFB Q;  4PAB A;  5KFI A;  4F7V A;  1CJT B;  1KP6 A;  2AYE A;  3V6H A;  4WCE Q;  2AIR B;  1KQG B;  2FY1 A;  3B4D A;  4CTA B;  5KFB A;  4ECW A;  4HEA 9;  2B4V A;  1ZA1 B;  5LMN J;  4M5D A;  3GJR B;  2LXU A;  2XLI A;  5LL6 d;  1RT4 B;  4NYZ A;  4LMZ A;  3Q8V A;  1RI7 A;  4AL7 A;  3LAL A;  4PYA A;  2AEM A;  2CPI A;  3NAH A;  5DQH A;  4PXD A;  4K4V A;  5DQI A;  5CYJ A;  3Q24 A;  3FQL A;  4DPU A;  1NDK A;  3V4I A;  4RZR A;  1RTH B;  4Y2I A;  3BF4 A;  5GAG U;  2GAH C;  1ZH5 A;  1DFD A;  4JI7 J;  4ZVS B;  3QPI A;  3R7S B;  3CJ5 A;  3HD2 A;  1E6Y A;  2ZKT A;  1KOH A;  4KV8 B;  2CJX B;  4TVA B;  4LF4 J;  1FDB A;  2XQC A;  2LXI A;  2J0S D;  2MKY A;  2G0C A;  2MZ1 A;  3IXQ A;  1FX2 A;  5DRK A;  5E33 A;  3NOC A;  3ZTP A;  3NMR A;  4U95 A;  2KG1 A;  4OX9 J;  4OYP A;  1BLU A;  1Y5N B;  5BYS A;  2E1R A;  2LDI A;  4CLY A;  3F0N A;  2R7U A;  1N8R T;  2ZBI A;  2A0F B;  2B4P A;  4NX9 A;  5ETM A;  1D9F A;  2VJV A;  4AQY F;  1SC4 B;  3PW4 A;  1UJ6 A;  3IC1 A;  5J2P A;  4QZV B;  2AHO B;  4DV2 J;  3RB3 A;  4QR1 A;  3D9B A;  3RU0 A;  4GKK J;  1X4B A;  2VJU A;  1FJG J;  2A10 A;  2W2N P;  1Q53 A;  2VOP A;  1JLE A;  3J7Y U;  4F8R A;  3GON A;  1SUQ B;  3OTO J;  2CPX A;  4QWE A;  3H25 A;  1URR A;  3ZTO A;  4Y00 A;  2DIT A;  4CLS A;  5T14 A;  1NJZ A;  1RXO B;  3DYA B;  4OZN A;  4DU8 A;  2J6T A;  4QU7 A;  1HMV B;  1APS A;  2OJ3 A;  5D4P A;  2IDL A;  2HZV A;  1AFI A;  1LWX A;  2AGO A;  2LQ8 A;  4DMZ A;  1NK6 A;  1J27 A;  2L9N A;  2ZDP A;  3HJF A;  2GO9 A;  1B4S A;  1KLM A;  2HWT A;  3SEO A;  2DXE A;  2R2S A;  5B0C A;  3C16 A;  2E9Z A;  2IJF A;  2FD2 A;  1HYS B;  4Y65 A;  4OI4 A;  2N4C A;  4F04 B;  4F26 A;  4J9V A;  1XMB A;  4KAI A;  4IOB A;  2WBR A;  1RAJ A;  4I7F A;  1JIH A;  1FXD A;  2EC2 A;  2V4Q A;  2GIR A;  1NPK A;  4CO5 A;  1E6V A;  1AZS B;  1LWE B;  1RWV B;  4OZ3 A;  5D0G A;  2R8G A;  1WTB A;  3GJS B;  1UKU A;  4FF4 A;  1I3O B;  3ISN C;  4Q2L A;  3OLA A;  1HQE B;  3V6K A;  2E9R X;  3W1Y C;  4DWI A;  2V4R A;  1N34 F;  4AYB D;  3C15 B;  4B3M F;  1NPR A;  4X4O A;  2PII A;  4QQB A;  2FVC A;  3TYT A;  1WOS A;  2HQD A;  4DUY F;  3P4U B;  5KT4 A;  4I64 A;  1SIZ A;  3KLG A;  5AE2 A;  2BKN A;  1SH0 A;  2DHX A;  1VI7 A;  1D0E A;  4M5N A;  2QV6 A;  2ASJ A;  2MZR A;  2J9C A;  3UO0 A;  1YK9 A;  2V50 A;  2F9J A;  4PCQ A;  2YH0 A;  4LT6 A;  2J7K A;  5I3U A;  2W1B A;  4CCH A;  2OD4 A;  3JSM A;  2KT2 A;  4C9D A;  1CBK A;  4B3R F;  1NK9 A;  2QRR A;  2BR0 A;  2ZH9 A;  2DHA A;  1P9Q C;  2KN4 A;  4CLF A;  3PO5 A;  1JJC B;  1SBR A;  3H7H B;  1RBL A;  4O23 A;  1DTT A;  3SV3 A;  2PI5 A;  5EX3 A;  4LRF A;  4V1A k;  1FNX H;  2KT3 A;  3G82 A;  4NXN J;  4IRK A;  4WFA Q;  1FFS B;  4L75 A;  5L1K A;  2VDH A;  3AQO A;  1XR7 A;  3GSI A;  4LRA A;  4C11 A;  4PKD B;  2UVW A;  3ZNU A;  2R7X A;  1PYS B;  2A2D A;  4WKY A;  2WOM A;  4GKJ J;  1XTZ A;  7FDR A;  4M5D B;  3AAW B;  4UQG A;  5F8I A;  1JLA A;  1F6T A;  2C22 A;  3QNW B;  1D1U A;  2DNL A;  4UTG A;  4PG7 A;  2W9B A;  4PQU A;  3VGS A;  1IVZ A;  4BWM A;  5KFC A;  3HP6 A;  2OI2 A;  2VL1 A;  4TLR A;  1IR2 A;  2D41 A;  1JXE A;  3V4I B;  3R3T A;  2OPS B;  1YJT A;  4DL7 A;  1SJF A;  4ELT A;  3KDO A;  4I2Q A;  1IUJ A;  4B9U A;  2EVZ A;  3A12 A;  2BJE A;  4H4K A;  1ZM2 A;  4ED5 A;  4DR5 J;  2OMO A;  2POK A;  2M52 A;  5DDQ C;  4ZPT R;  2XHC A;  3UDC A;  4USK A;  2ZVI A;  1RDR A;  2JLG A;  4WK3 A;  2CPZ A;  5E3C A;  2VAS A;  2NR0 A;  4DSF A;  3QWU A;  4ZIV A;  3UN5 A;  3I0S A;  2KTQ A;  4AXI A;  3TI0 A;  5EX0 A;  1JQG A;  2HVI A;  4R5P A;  1PC4 A;  2XY5 A;  3PYD A;  3EPI A;  4U96 A;  2ZOM A;  3AA8 A;  3MEG A;  1RWW B;  3SQG A;  3K57 A;  2GA7 A;  2OKQ A;  3PJX A;  3P3D A;  3I32 A;  3ICL A;  5J2P B;  2XLJ A;  3KXD A;  3ZTS A;  4FXD A;  2N7Y A;  1UFK A;  3PFE A;  1TFW A;  4DPT A;  3ENQ A;  3O6Q A;  2CZ4 A;  3MEK A;  3T1A A;  4O0I A;  1ICE B;  1WI6 A;  4AL5 A;  1JLE B;  3MR7 A;  4MAK A;  1X60 A;  2KHC A;  2JLF A;  3GR1 A;  4DI6 A;  3NCQ A;  3BEG B;  3GCX P;  1MLA A;  4OX8 A;  3I0R A;  2EKY A;  2B9W A;  3L9Z A;  2VQE J;  1SKR A;  4LSN A;  2R2U A;  1VOM A;  1Y4Z B;  1YJ7 A;  2W4C A;  3LAN A;  4F0K A;  2W24 A;  6FDR A;  3VCD A;  4CNY A;  3FEZ A;  3W7B A;  3Q86 A;  2MZS A;  2ZIT A;  4C8N A;  2YPY A;  1HAR A;  3F44 A;  2VPX B;  3KG4 A;  2NUH A;  1UVL A;  2X1A A;  3LH2 S;  1NKC A;  3D1Q A;  2QYC A;  1EAY C;  4OYO A;  2RT3 A;  2DO0 A;  2DY9 A;  4ID8 A;  4QIW D;  3C16 B;  3WIV A;  4HT7 A;  2DNO A;  3T1Y F;  5D4N A;  1OJ4 A;  4TKT A;  1DTQ A;  2XCA A;  3PIP Q;  1FDD A;  3BH7 B;  5IC6 B;  2QYG A;  3PHT A;  2XBP A;  5T41 A;  2AYB A;  2JRS A;  4TNO A;  2CQP A;  2UUW A;  2Z2Z A;  6FD1 A;  1E6V B;  3FMW A;  1HBN A;  2CQC A;  3NWG A;  4RUB A;  3KOA A;  4KKO A;  4FF1 A;  5KG3 A;  4RPF A;  2XCP A;  3M1V A;  2AJ2 A;  4WU3 A;  3OQ2 A;  3HVW A;  3N6N A;  2ZZT A;  5EWG A;  2EBE A;  4BDP A;  1DJ0 A;  3ZFV A;  4YQW A;  2W9C A;  2Z2L A;  4HL9 A;  5LOQ A;  4NEZ A;  2BJ8 A;  3KLG B;  2NRE A;  4DV3 J;  2B9E A;  1N36 J;  3WIU A;  2ZH4 A;  3EDQ B;  4K0K F;  3CJK A;  3EPG A;  3UE2 A;  4J9L A;  5A8K A;  4K4Z A;  5I3U B;  4B9M A;  3C66 A;  4J7C A;  4O3O A;  1UPP A;  4MK8 A;  1X4G A;  3JSM B;  5KFR A;  4KSE B;  3KHR A;  3LO3 A;  3OFG A;  4MKY A;  2XYH B;  2NSB A;  3R5G A;  4ECY A;  1MN9 A;  1DTT B;  4DLE A;  2BOP A;  3QAT A;  5DDR C;  1N48 A;  4A4J A;  2B3T B;  5CYM A;  4MKA A;  2G9O A;  3G82 B;  4EFA C;  2IMW P;  4CT9 A;  3O2I A;  4XAK A;  2DBB A;  4OYM A;  3DGV A;  4JI1 J;  3ZTQ A;  3L3C A;  2GCF A;  4O0N A;  3CDU A;  3CUL A;  2DRA A;  1HLW A;  4DR6 J;  2C3M A;  4LFB J;  2VOD A;  3BDE A;  4X2B A;  3THP A;  1TUV A;  3V4M A;  4HVZ A;  5KFO A;  1FCA A;  1LKZ A;  1GXT A;  1T3N A;  1RIS A;  3HKZ D;  1PGZ A;  1JLA B;  2YBV A;  3D66 A;  5D15 A;  2UXB J;  5IQ6 A;  1MWZ A;  3FVY A;  1N54 B;  4DX6 A;  2W9B B;  4PQU B;  4R25 A;  3CJQ A;  5HBM A; 
#chains in the Genus database with same CATH homology
 2DKO B;  2XYH B;  3D6F B;  2Y0B B;  2H51 B;  1ICE B;  2CNO B;  5IC6 B;  3GJQ B;  4ZVR B;  3R7N B;  1RHQ B;  4ZVS B;  2XZT B;  2CNL B;  1RHK B;  3R7S B;  1RWV B;  3IBC B;  2H54 B;  4DCJ B;  2CNN B;  2H5J B;  3GJS B;  1RWO B;  3R5J B;  5IC4 B;  1RHU B;  3R6G B;  1QDU B;  2CJX B;  2CJY B;  1I3O B;  1QTN B;  2P2C B;  2CDR B;  3KJF B;  3RJM B;  4DCP B;  2C2K B;  2QL5 B;  3GJT B;  4ZVP B;  1RWN B;  3R7B B;  3NS7 B;  2H5I B;  2FQQ B;  2QL9 B;  3EDR B;  1RWM B;  2Y1L B;  3D6H B;  2QLJ B;  2XZD B;  2H4Y B;  1F9E B;  3KJQ B;  1RHJ B;  2C2O B;  2QLF B;  2QL7 B;  4LSZ B;  3GJR B;  1PYO B;  1PAU B;  3P4U B;  3P45 B;  1SC1 B;  3D6M B;  4ZVU B;  1GFW B;  1RWK B;  2C2M B;  1NME B;  1RWP B;  3KJN B;  2C2Z B;  4ZVQ B;  2XYG B;  3SIP B;  4DCO B;  3QNW B;  2C1E B;  4ZVO B;  1IBC B;  1RHR B;  2HBZ B;  2CNK B;  1RWW B;  2H65 B;  1SC4 B;  3IBF B;  1SC3 B;  2QLB B;  2HBY B;  1RE1 B;  4ZVT B;  2XYP B;  2H48 B;  4JB8 B;  3EDQ B;  1BMQ B;  3R6L B;  2HBR B;  2HBQ B;  5K20 B;  2H4W B;  1I51 B;  1RHM B;  1RWX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...