1LWEB

Crystal structure of m41l/t215y mutant hiv-1 reverse transcriptase (rtmn) in complex with nevirapine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
423
structure length
401
Chain Sequence
b'ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 102
structure length 401
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lweB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweB03
3OL9A 2W7OA 2WCXA 2JLEA 2AWZA 4RZRA 4PQUB 5I3UB 3QO9A 3DM2A 3KK3B 2QE5A 4KHMA 2V0NA 4MIAA 3IS9B 4O3SA 2JEGA 2YNHA 3KOAA 5KFHA 1JLQB 1S0MA 1TV6B 4IH5A 3IGVA 1N56A 4KV8B 4ED0A 1JLCB 1ZETA 2YKNA 3H4DA 3KLVA 3BSNA 3C6TB 2GIQA 4RNMA 1RYRA 5KT3A 1VRUA 2C22A 5C42B 3FQLA 1RT3B 2ZD1B 2C2EA 1JLGB 4ZMMA 1RDRA 4ECSA 4JV1A 4PWDA 2AX1A 1S6PA 5EDWA 3GIKA 3GV5B 4K4VA 1RA7A 2D41A 2XCPA 4DL7A 1JKHA 1S9GB 2XGPA 5KT5A 4PUOA 5L1JA 5CYQB 4ZVHA 1LWFA 1S9EA 4I2QB 1RA6A 1DTTA 3E01A 4I7FB 3KNAA 2RKIA 5HBMB 4PQUA 2BQRA 3G6XA 1LW2B 3LAMA 5FDLB 1IKWA 3KK3A 4M95A 1JIHA 3IS9A 1N48A 1J5OA 2ZE2A 2HNYB 1S0NA 1REVA 2W9AA 1TV6A 5K14A 4KV8A 3DYAA 1YVFA 2IJNA 3LALA 3N6NA 3GYNA 1T05A 1RTJB 2WOMB 3I5BA 2C2RA 1LWEB 4U6PA 5HROB 5C42A 3KLGA 4ICLB 2DPJA 4ED3A 3N6MA 4KE5A 3GQCA 4TQSA 1BQNA 1TP7A 4G1QA 1S9GA 2RDJA 4MK9A 4KAIA 2IM1A 4GC7A 5CYMB 4IG0B 1IKYA 2IAJA 2O5DA 1JLEA 4I7FA 1RTDB 4NLQA 5F9NA 3OLAA 3I5CA 5KG5A 2FVQA 4H4MA 4B3OB 3CJ0A 3MR6A 1BQMB 1HARA 2FVRA 2HNYA 4TQRA 4ZVEA 3MTKA 3MECB 1TKZB 3T19A 2WONB 1N6QB 3H5SA 4K4WA 4EYHB 2E9TA 4IOBA 2HAIA 3SI8A 4IFVB 5DGBA 1HPZA 5KT7A 1RTJA 4M94A 4ZPCA 1HNVA 3JSMA 3DRRB 3H5YA 3MEGA 4ZVGA 3PR5B 5KFGA 2GIRA 3M8PB 4XO0A 3V6DA 3ISNC 3EZUA 1N5YB 5HLFB 3RAXA 4IG3A 4TXSA 3CO9A 3GV7B 2GC8A 4O44B 4ECRA 3H5UA 1S1UB 3TAMA 1KLMA 5KFLA 3KHGA 2I5JB 5EWGA 4IG0A 4NLSA 3OL6A 3HHKA 3MFIA 2JEIA 4X2BA 5L1KA 4MKAA 4NYZA 5KFEA 3QZ8A 3BR9A 2W9BA 3DRPA 4QWAA 3CVKA 4EBEA 4LSLB 3KLFA 3LP0A 4NLPA 1K1QA 2VA2A 3G86A 3RBEA 5HP1A 5KFTA 5F9LA 2WONA 3MEDB 3UPFA 3Q8QB 2BQ3A 4IRCA 3V6HA 5C25A 4KSEB 2AGPA 1TQLA 2FVCA 3FQKA 3OSNA 2D3ZA 2VG6A 2YKMB 1NHVA 1OS5A 3KHHA 3BSAA 1S97A 3KLIB 3PW4A 1JLAB 5KFIA 3M8PA 4NLRA 2HNZB 4JUZA 1SV5B 1JXLA 4WYWA 3PJWA 3PZPA 4ED8A 3PW2A 3DLEB 3HVTB 4NLWA 3KLEA 3KJVB 1RTHB 4F4ZA 1SH2A 3PW0A 2IMWP 3DM2B 4DEZA 5KG4A 3EPIA 1DTQB 2YNHB 4H54A 5DGAA 1IKVA 3QIPB 3BSOA 3PW7A 3QIDA 2ASDA 2J6UA 1HMVB 1LW0A 5J1EA 4FS2A 1S49A 1C0UA 2D7SA 3MEEB 1XR5A 4NCGA 2XI2A 4RW6A 1VRUB 4XPEA 2WK4A 3HVWA 2BQUA 2YKMA 2R2SA 4ZP8A 4KKOA 2HNDB 5DG9A 3DOLA 4R5PB 1LWCB 1RT7A 4PWDB 1S6PB 5KFFA 2V4QA 4RW4A 1HNIA 1WNEA 3NMAA 3DRSA 1JKHB 1D0EA 5KFJA 4F4XA 4PUOB 3SFGA 4QWCA 1LWFB 1S9EB 3HVTA 3KJVA 2R8HA 1RTHA 1DTTB 3E01B 3FFIA 5KFDA 1GX6A 2OPQA 3QLHA 1RTIA 2RKIB 4ZHRA 4R0EA 2D3UA 3QGHA 1D1UA 4IDKB 1IKWB 3M9OB 2FJVA 1DTQA 1S1WB 1J5OB 5KG1A 2ZE2B 3QIPA 4EO8A 1REVB 1S1VA 4IH7A 4MK7A 5K14B 2B6AB 1EETA 1HQEB 5C24B 1HMVA 2VG7A 3DYAB 3KHLA 4DL4A 2R8IA 3MEEA 3FSIA 5KFRA 1T05B 4EEYA 4XPCA 2XGQA 3RB4A 3DMJA 4RNNA 3RBDA 3KLGB 5KFOA 4WFYA 2HNDA 4ID5A 4TY8B 4FS1A 3BGRB 3TQ1A 4R5PA 1LWCA 4Q8EA 4NLTA 4ECYA 4WE1A 1BQNB 3I0RB 4G1QB 3QGIA 3DLKA 3T5LA 2UVVA 2OPSA 3H5XA 1IKYB 2IAJB 4ED6A 1JLEB 2IC3A 5J2QA 4H4MB 4IDKA 4U7CA 2ASJA 5C5JA 1S1WA 4J9SA 3HKWA 1QUVA 4Q44A 3OSPA 3E51A 2B6AA 5C24A 1HQEA 2QV6A 4TLRA 1T3NA 1QAIA 5KFZA 2HWIA 1HPZB 1IKXB 2IM2A 5KFSA 1TL1B 4IRDA 5KG2A 2JEFA 3CJ4A 1HNVB 3JSMB 3LP2A 3T5KA 3MEGB 4URSA 4TY8A 1DLOA 3BGRA 4ZPAA 4ECTA 1T94A 3V6DB 3NL0A 4K4TA 4IG3B 3I0RA 3H2LA 3KMQA 1XR6A 5KFUA 2IBKA 3TAMB 1KLMB 4QWDA 5KFAA 4ZPDA 1W25A 1T03B 5T14A 2BR0A 3KHRA 2AU0A 1FKOA 2R2TA 3KLHA 5J2MB 4ZP7A 2W9BB 3DRPB 4YR2A 4O4GA 1RAJA 4WYLA 5JUMA 3KLFB 3LP0B 3PW5A 4NLDA 3JYTA 5HP1B 4Q43A 2E9ZA 3LANA 4Q0BA 5C25B 5KFCA 2DPIA 3RB0A 1IKXA 4ECXA 3M8QB 4R8UB 5KFBA 1TL1A 2VG6B 2OPRA 4JV2A 3KK2B 4TY9A 4ECWA 1KHWA 4NLVA 1HYSB 2CKWA 3KLEB 1T03A 3UQSA 4LSNA 4YR3A 1SH3A 5F8MA 3PVXA 5J2PB 1RT1B 4URQU 5J2MA 1S4FA 4NRTA 5F8HA 3MR5A 4KHRA 2JEJA 1IKVB 2HMIB 2RDIA 3V6KA 2R2UA 2WTFA 4ECZA 3KMSA 1EP4A 1LW0B 5J1EB 3D5MA 1C0UB 3IG1B 4DG1B 1SUQA 1MU2A 3Q8PB 4NCGB 3M8QA 2V4RA 2AGOA 2RF2A 4RW6B 4R8UA 4K4SA 2J6TA 5J2NB 4EBCA 4ZP9A 4KKOB 4ZPBA 2XCAA 3DOLB 5D3GB 4MIBA 1RT7B 2B5JA 3KK2A 3BJYA 3DLGA 4RW4B 1HNIB 2R8JA 1C1CA 3DRSB 3NBPA 1NNDA 3BQ0A 2FVSA 1HYSA 3RAQA 5L1IA 3G6YA 4J9LA 3V6JA 5DQGA 2YNGA 3FFIB 3VQSA 3GIIA 2OPQB 1RTIB 3QLHB 3I0SA 4ZHRB 1XR7A 3CDEA 4F4YA 5J2PA 1RT1A 2F8EX 1C0TA 2ZKUA 4KBIA 1FK9B 2HMIA 1S1VB 2AGQA 4NLXA 1EETB 4O3RA 2VG7B 2C28A 2ATLA 1K1SA 3IG1A 4DG1A 2ILZA 4ECQA 5KG0A 3DMJB 3GIJA 2CJQA 4DL5A 2IJFA 5J2NA 2BRKA 2V9WA 3GV8B 4ID5B 1TVRA 5DG8A 5D3GA 4DL3A 2YNIB 2OPPA 4IFYA 3CDUA 4YR0A 4WE1B 1S6QB 3DOKB 2YNFA 3DLKB 3IRXA 3KK1A 4RNFA 4H4OB 2OPSB 3OL8A 4HYKA 2C2DA 1RYSA 4WZMA 4J9OA 2UUTA 3CJ3A 4ZP6A 2E9RX 1RT5A 4Q45A 5KG7A 4GC6A 3T1AA 2IC3B 1NHUA 5J2QB 1S10A 4IRKA 3M9NB 2J6SA 3H98A 1FK9A 4WXOA 5EUHA 2XWYA 3H59A 2W8KA 3LP1B 3V4IA 1TL3A 4RW8A 3D28A 5DQIA 5KFQA 3Q8SB 3CIZA 5KFPA 4RU9A 4IH6A 1S1XB 2EC0A 3LP2B 1RT4A 2VG5B 4I2PA 2WRMA 2AQ4A 1DLOB 4RW9A 4MK8A 2YNIA 2FLLA 3V81B 5KFWA 2FLPA 4MFBA 4URGA 1S9FA 1S6QA 3DOKA 1QE1B 4H4OA 3C6UB 4KB7A 5KFNA 2UVWA 3OLBA 4IR1A 3QGGA 2W7PA 1FKOB 3BQ1A 4EBDA 3KLHB 3SFUA 4QW8A 4O4GB 5EWFA 1RT2A 4RUCA 4KFBB 4RW7B 3JYTB 1Z4UA 4NLGA 2R8GA 4J9NA 4Q0BB 1KHVA 3DDKA 1TKXB 1GX5A 3LP1A 3QZ7A 5DG7A 5F8NA 1FKPB 3NKYA 1S1TB 3FDSA 3ISND 1R0AB 1S1XA 5F8LA 4OL8A 2OPRB 3OHBA 2VG5A 2ILYA 4O3PA 4K4YA 2IM3A 2W9CB 3V81A 4K4ZA 4RNOA 5KFYA 5DQHA 5EWEA 4MKBA 2ALZA 3PR4A 1QE1A 4ECVA 2FVPA 3C6UA 5I3UA 3NGDA 5KFMA 3CDWA 3MF5A 2HWHA 4LSNB 3UDLA 3IN5A 1ZTWA 1JLFB 1JLQA 3Q8RB 2VA3A 4Y3CA 1JLCA 4KFBA 2B43A 4EYIB 2I1RA 4TYAA 4J9MA 4RW7A 3C6TA 4RNHA 1I6JA 3MR3A 1EP4B 5DLFA 5L9XA 2XC9A 4WFXA 1TKXA 1VRTB 4K4XA 2ZD1A 1RT3A 1SUQB 1JLGA 1MU2B 4DL2A 2RF2B 1FKPA 4O4RA 1S1TA 4F4WA 1R0AA 3GILA 3CJ2A 3GIMA 1UWBB 4Q8FA 1S0OA 4NZ0A 2B5JB 3ITHB 5CYQA 3DLGB 5I42B 2W9CA 3DI6B 4I2QA 3BREA 1C1CB 3NBPB 4IKAA 5KT6A 4WXWA 4YP3A 3OL7A 3PHEA 5F8JA 3NAIA 3H4BA 4LQ9A 5HBMA 3H40A 4MH8A 1LW2A 5FDLA 4FBUA 2WB4A 2YNGB 3RB6A 4NLOA 4QPXA 3I0SB 1JLFA 3M9MB 4O3NA 4ED1A 3LAKA 1C0TB 3EPGA 3T5HA 4ECUA 4RUAA 2BRLA 3MR2A 2AX0A 2XI3A 1SH0A 3IGNA 3CWJA 4J9RA 2WOMA 1LWEA 3N6LA 1VRTA 5HROA 3I5AA 4TYBA 4ICLA 2OH2A 4O3QA 5F8GA 4TN2A 4Y34A 1UWBA 3QYYA 1TVRB 4ZVFA 5KFVA 4JV0A 4WFZA 2OPPB 3ITHA 4IFYB 5CYMA 5I42A 3DI6A 4QWBA 5L1LA 4J9KA 4K4UA 1IM4A 2YNFB 3IRXB 1RTDA 3KK1B 2R2RA 4WZQA 3T5JA 3G6VA 4G3IA 4B3OA 4FBTA 1RT5B 2ASLA 1BQMA 4F50A 1MMLA 2JC1A 1RT6B 1HQUB 1C2PA 4NLYA 3MECA 3HVAA 1C1BB 1TKZA 1N6QA 1S48A 3CJ5A 1JLBB 2BE2B 3TVKA 4QWEA 4IFVA 4ED7A 4YQWA 2FLNA 4IQXA 4K50A 4HKQA 5KG6A 2JC0A 2IM0A 3V4IB 1TL3B 3DRRA 2IA6A 1TKTB 4RW8B 5F8IA 2BANB 1RT4B 1N5YA 5HLFA 4I2PB 1CSJA 5KFXA 4KO0A 3BSCA 4O44A 4NRUA 4RW9B 4Y2AA 3MFHA 5KG3A 1S1UA 1JX4A 4KO0B 1U09A 3BQ2A 4IR9A 2I5JA 4MFBB 5JXSA 2FJXA 2FJWA 5KFKA 3QO9B 4YMEA 4QW9A 3FRZA 1N4LA 3UR0A 4LSLA 2WHOA 3PJXA 1QAJA 1RT6A 1HQUA 5KT4A 4NLUA 1C1BA 3OHAA 3MEDA 1JLBA 1RT2B 4O3OA 2BE2A 2YKNB 4LQ3A 4J9PA 5DLGA 3RB3A 1ZTTA 4ED2A 3ICLA 2UVUA 2UUWA 1TKTA 3NAHA 3KLIA 2UVRA 1JLAA 2W8LA 2BANA 5KT2A 2HNZA 1SV5A 4Y2CA 4DL6A 4EO6A 2R8KA 4J9QA 3DLEA
chains in the Genus database with same CATH superfamily
2AW0A 5I3UB 5A76A 2YNHA 4MKYA 4DUYF 2ZH9A 4DV6F 1TV6B 3TEGA 3O1LA 3S7RA 1RCXB 2VBWA 1VMBA 4L6V3 4ZJQA 5DM6Q 2XGPA 4PUOA 5KOWA 1DZ5A 2G13A 2MZTA 2ZBQA 1DTTA 3R8YA 2RKIA 1LW2B 2MQQA 1EJ7L 1Y00A 5K14A 3Q0AA 1N5SA 2V4JA 6AT1B 3HSZA 3GQCA 2CQHA 2IM1A 2C3PA 3JB9k 4USJC 5KG5A 4DXLA 3QBCA 2RH3A 4MYUA 2FVRA 1WI6A 2VC1A 2RS2A 2WONB 2GIFA 4AQYF 4DSIA 2BA9A 2BABA 3A3PB 2MSSA 2UV8A 4DCJB 1VQ8S 3ENAA 5A2QY 4DN9A 4RO0A 3MAHA 4NYZA 1JJ4A 4B02A 2DNQA 3C16A 2DHGA 2NR0A 4DR7J 1NPPA 2BV3A 3HO1A 1EZZB 3R7BB 4GKJF 2IDLA 1IN0A 1VQ6S 1AW0A 3BSOA 3GYGA 2ZH5A 2J6UA 1P9YA 2M7SA 3N01A 3OD2A 5D6GA 3O6QA 3DOLA 4NZ6A 4R5PB 1NO8A 2KYXA 4RW4A 1HNIA 3VAFA 2HZCA 3D1QA 2B4OA 3E01B 2OPQA 2QGFB 3MM6B 1KONA 2OTJS 1DTQA 3QIPA 2R3VA 5B0BA 3VV2B 4A8XA 1HIYA 2GVZA 1N36F 1U1QA 1VHIA 4ID5A 4OIXA 1LWCA 4JI0J 5CCMA 2C2KB 4UQGA 4HHJA 4LFCF 1CJUA 2KT2A 4IDKA 3T1HJ 2ZBRA 3IMQJ 4Q44A 3OSPA 1VQNS 1KQSR 1NBEB 2OJ3A 4DR1F 4X4RA 1PJ6A 2OSRA 2VV5A 4ZPAA 4K4TA 3SDEA 1VJQA 3TAMB 4ZP7A 5HMXA 3DGPB 1OQ3A 2NREA 4FKXA 1VQYA 5MLCV 1IQZA 3KG1A 1Y5IB 2RRBA 3TUZC 1RLDA 1SC1B 3PRBA 2O67A 5AT1B 4KHRA 3TZXA 4B3SF 3TVZA 4YUDA 5J1PA 2DXDA 2EG2A 4N41A 1QSYA 2BJEA 1XJWB 1T7PA 1OMSA 4OZ2A 3CJKA 4FPIA 4BBYA 4HH1A 4JI5F 5J2PA 2DXFA 2F8EX 2GFFA 4LR7A 3KJQB 2KTQA 3SV3A 1B99A 3Q8VA 2H4YB 5KG0A 4FZVA 3SQGB 1WTBA 1I94F 2OPPA 2IHR1 1S6QB 1P9QC 4CLZA 1BY9A 3CB4A 1BUXA 1M1KT 4PXBA 1S5ZA 2RDDA 4WFBQ 4X62F 2QT7A 1RT4A 4PQAA 2FLLA 4K59A 2BKOA 1M90T 3GFZA 5E33A 4CLSA 2RIJA 4I64A 3SFUA 4O4GB 3R7SB 4KFBB 1H2UX 1F9HA 5IT9U 1WACA 5DG7A 4USHA 2CQ3A 3EGVA 3EZOA 5EWEA 4NCBA 1YJNS 3MGJA 4P2FA 4TYAA 5LM7E 4LF5J 3MR3A 2JLGA 1F2HA 3GB0A 1UP1A 3G4SS 2LDIA 3HCXA 4LQ9A 4D3HA 1HL6A 1B64A 4E2FB 3OXLA 1C0TB 2ZZNA 1YRXA 3CJTA 1I3OB 5KFVA 5CYMA 3HHLD 3LPEA 3G6VA 3O8WA 4NMLA 3DKDA 3DXBA 1HA1A 1RWOB 1Y7PA 1ZZFA 3OUYB 1U7LA 2YQ1A 5F41A 3K5MA 1WC3A 5GAEI 3Q89A 4DV3F 4YMEA 4QW9A 4ES1A 4H4KA 2LKZA 1ZAXA 1NK9A 4V19J 3KLIA 2XTJP 1EAYC 1SV5A 3SCKE 2GQQA 2E1MC 2JH3A 4CYUA 4BDPA 2CPHA 2GIQA 4RNMA 3P6YC 3K7RA 1WG5A 5LXYA 5L1JA 5IM0B 3GCXP 3RAMA 4I2QB 1XK8A 4ZVQB 2BQRA 4BHQA 5FDLB 3QWPA 2HVDA 2W9AA 2IJNA 3G8QA 4M5KA 3GYNA 2RQ4A 4U6PA 1S6OA 1R8BA 3PJ9A 2KVQE 4FF1A 4P73A 4K5RA 2OSQA 3WX4A 1HI1A 2E7WA 2W7AA 1ACMB 5M2RA 3H5YA 3AJ2A 3ISNC 3RAXA 3EVWA 2UUBF 2HBZB 2I5JB 3C14A 4B3TF 4X2BA 3AHPA 2DY9A 4QWAA 2XM3A 2KB2A 4LSLB 1K1QA 5KFTA 2BQ3A 4KGVB 3Q8QB 1QY7A 4U95A 3V6HA 1UEUA 1XEZA 3QT8A 4KY3A 2EI5A 2RJZA 2RQMA 4EK2A 1RWXB 2DHXA 4MKVA 3ZTQA 2R4FA 2LYVA 1X4AA 3DM2B 3QSYB 1ZZNA 3UR3C 2RU9A 2GW8A 2EWHA 2YKMA 2M5YA 1BE4A 4B3RF 4OJ1A 1IBMJ 3DLLQ 4DQSA 2P6SA 1SI9A 2MQLA 1HMVA 3NNCA 4NPOA 3KLGB 2LLZA 1UW9A 3RYLA 3QGIA 2W2PP 4ED6A 4JI4J 4U7CA 2HHUA 3QT6A 5F0WA 3E51A 4Y28C 4XIUA 3F73A 1JQGA 1TAUA 5KG2A 3FSXA 3LWMA 3V6DB 3E2EA 1GMWA 2GGPA 2IBKA 1KLMB 2Z2YB 4ITSA 1O0PA 4HT5A 2DT9A 4C7QA 1AFIA 3KLFB 1TL1A 5L38A 1T9TA 2ASYA 3CD5A 4GVBB 1V3SA 1QVGR 1NPRA 4LSNA 2MKKA 2GJFA 1FTRA 4DR3F 5HJXA 3KG4A 2L3MA 2V6AA 3PY8A 1RUSA 2XMMA 1YZ7A 2IMOA 4LT6A 1GK8A 3JTOA 1VR6A 1X31C 1Y11A 4ZS6A 2QC3A 4ZLPA 3M05A 3GIIA 5DO2A 4F4YA 2DNOA 1D8YA 5LOQA 2HMIA 3PO5A 2CQ1A 1H0HB 4FP9A 1UFWA 4DV5J 4CM2A 1SKWA 4LRBA 4IFYA 2C2DA 1RYSA 4WZMA 3OTDA 4GC6A 1YRUA 4F26A 3J80Y 2EXUA 2YX1A 3B6BA 1VBXA 3CJSA 3CMES 2XWYA 1S76D 1N33F 2AF6A 3WIVA 2ZWOA 4I2PA 1U8SA 1UL3A 1X0PA 4H4OA 2G1DA 2Q43A 1RKJA 1RT2A 2FY1A 2F8MA 5AXLA 3DDKA 1G2EA 3QZ7A 1NLKL 4YB1P 2UP1A 3FDSA 1ZA1B 3UD4P 2ILYA 4PEOA 4EFAC 1PAEX 1CJVA 2MSTA 1WHVA 1HD0A 3LTOA 3M8SA 3TUIC 2QMUB 1I6JA 4OJ3A 2IBOA 3RGIA 2ZD1A 4P2SA 3IM8A 3OXGA 3CDBA 5L46A 3FGVA 2H54B 3DLGB 3D4JA 4X65J 1C1CB 5KT6A 2F7VA 1FCAA 2KZMA 4AXIA 3RB6A 3DHXA 3QFHA 3UE2A 2E5LJ 4B3MJ 4RUAA 1RSCA 2XI3A 1SH0A 2YKQA 4ICLA 1MWYA 3J81j 2JZ5A 3MPVA 4DSJA 1NSPA 3POTB 2F9DA 1IWAA 1V3RA 4J9KA 1RTDA 3IR6B 3M8YA 4FBTA 1XC9A 3PRDA 3MWBA 1VQMS 1U1KA 4RW8B 2FB0A 3T1YF 3QJPA 1VQ9S 2I6WA 3BEGB 1HNXJ 5BR8J 4O44A 1FJCA 2FJWA 4U8VA 1N4LA 4L75A 3NS5A 4ILRA 4J9PA 3TUPA 3OFEA 2CJYB 3AA8A 4DLGA 2CNLB 3UI3A 6FDRA 3FC9A 1AZSA 2L9WA 2BE7D 1FO1A 1X5PA 3M2RA 2WVBA 3O5TB 1DJ0A 1UKUA 5C42B 4CDIA 4K0KJ 5IC4B 4WF9Q 5FJ4A 2IY5B 1FDBA 2ZZTA 1SIWB 1YVFA 1LWEB 5THWA 4NXNJ 4X4QA 1X8DA 4LREA 5EX3A 4HHUA 1QSSA 1ULRA 4KGMA 2PT0A 2VFSA 5F9NA 1JLEA 4A48A 4M5DB 1Z1ZA 3PYDA 2RU3A 2XS7A 1NK4A 2PDAA 4KHPJ 3SI8A 2HGMA 2X7IA 4ZPCA 5A8KA 1FI4A 3PR5B 2GCFA 5BJRA 4UF4A 5FLXY 5L1KA 5B0AA 3DRPA 2M2BA 1LK7A 1HNZJ 1YZ6A 2MGZB 2AGPA 2FVCA 4KGKA 2A18A 3IR5B 3PIOQ 2NSCA 2ZNYA 4NLRA 4D3GA 5HSPA 3F0NA 3KJVB 1F5AA 4OYMA 2KG0A 3S01A 2XMUA 1PIEA 2F4VF 4H54A 2YPZA 3AB2B 1XTZA 1MMNA 3CULA 4HI2A 4A8SA 2NZCA 4GO5X 2HHSA 1Q7LB 1JKHB 2QSFA 4F4XA 1ZAVA 3SFGA 4KRWA 1Y5NB 2BW7A 3M8RA 4IH7A 2B6AB 2VG7A 1KLNA 4ZOSA 1UPMB 2ZBPA 1TFWA 4WFYA 1UEVA 3QATA 2AIRB 4QQBA 4WE1A 2KXNB 2OPSA 4LJMA 2R7RA 2ZBIA 2CG8A 3W1YC 2LEBA 1QJHA 1S1WA 1E6YB 2LP4A 2YPYA 4I0WA 2M70A 1U26A 2XNRA 2M8DB 3UWTA 3NL0A 2ZEJA 4QWDA 1X4BA 2B9WA 3MM9B 2OFHX 1XNQF 3OFHA 1OYDA 4X4TA 4PAAA 4USIA 1UZHA 2A0FB 2VG6B 3MAQA 1V3ZA 4X84A 1NU4A 2HHHF 3CJRA 4URQU 1S4FA 1H7WA 4NXMJ 2MLYA 3KG0A 2WAQD 2VPXB 3AA9A 4RW6B 4YHHJ 2RNEA 4G1PA 2B5JA 1PAUB 3UNGC 2R8JA 1VIOA 1VBYA 3RAQA 3GTYX 1XR7A 3MD3A 4YDXA 3MAAB 1L3SA 1VLYA 4CO0A 1K1SA 5D0HA 3DMJB 3A13A 3UD5A 3V4MA 1M5OC 5DG8A 2IIHA 1ZM9A 2JFDA 4V1Ak 2XO7A 3W9IA 4WTOB 3QGPA 2ACMA 3R27A 2E5GA 4K2XA 1FWLA 1Q8BA 1KTVA 3A1YG 3PIPQ 2VBXA 2V69A 2YY3A 1HWJA 5B08A 4LF1A 1TFYA 4A8YA 3QNWB 4QW8A 3E3XA 3J7YI 4YEAA 2W2NP 3RG6A 1RAIB 1UEKA 2PMHA 2YH0A 1MMDA 4CLLA 2HVIA 1VQOS 2ZVSA 3JQJA 1KBRA 3IN5A 3G2XA 3P8BB 2HLTA 2BKNA 2BXJA 1BD6A 3K2YA 4W98A 3WHIA 3G87A 1EX8A 4YP3A 5AXNA 1RACB 4FVCA 4I67A 2K1RA 4QIGA 1D8ZA 4ECUA 3AOAA 1DFDA 1DARA 2QL5B 4AYBD 3N6LA 3QSIA 3TQEA 2CPEA 2OO4A 1NM2A 5GAGU 3H25A 4WFZA 1NJIT 1EB0A 4DQIA 4CLFA 4WZQA 3ISZA 2R2RA 4Z7YA 4F25A 4IOAQ 1N6QA 1CQMA 3CDAA 3MMCB 4OHZA 3HXMA 4OV6A 5KFXA 4RW9B 1FNMA 2DITA 4IR9A 4HACB 2C3UA 4B17A 4NEYA 3AD9C 5HN0A 1N32J 4DX6A 1KVJA 4FPRA 1N5TA 1WEXA 2X51A 2XB2D 4UT4A 1KRPA 2BYCA 4Y2CA 2HPUA 5HK4A 2QRRA 3GIRA 2J7WA 5LSRA 2V0NA 3UN2A 3CCJS 1VBZA 1Q7YT 2Z4PA 1DQ9A 3KLVA 4S0MA 1NEEA 2FZCB 1RYRA 2GA7A 3TNVA 1U6BA 2AX1A 1RA7A 3JQMA 3G8SA 1PILA 1DQ8A 4G1IA 2CIMA 2ZJPQ 4EWTA 1YBAA 3HFKA 3MCSA 5IXUA 3FRYA 2IRYA 1GMWD 4MK9A 4P2MA 1ITPA 1CS4B 4WP9A 4A8FA 4H4MA 2DVIA 1XNRJ 3TO8A 1BQMB 2HNYA 4X66F 5K8MA 4F8RA 5CHCB 2COLA 1H74A 1IR2A 5DGBA 3Q83A 4PWWA 4Y2IA 2XULA 3SV4A 4BWMA 1RHMB 5KFLA 4DSLA 2XBPA 3D0IE 3P4UB 2BOAA 4JV5J 2Z58B 5H9FJ 3KHHA 4PR6A 3F56A 2XYHB 2EPIA 1RWMB 2DR9A 4NL5A 2WK4A 4A4JA 3PX4A 3G9CA 2KM8C 1R8HA 3OV7A 2GJ2A 3W2VA 4I6WA 1D1UA 1QAXA 3C46A 3M6UA 4DV0J 1S1VA 4MK7A 2AZ3A 1HQEB 3DYAB 4O23A 4LFBF 3BGRB 3VALA 1K44A 4GRSA 1BHNA 1F1BB 4F3OA 2IAJB 1N88A 5J2QA 1XMOF 1TL7B 3HKWA 4CO4A 4DF4A 3OFFA 2XY7A 2HWIA 2FYXA 3CD7A 3OR2A 2CQPA 3EZ5A 1HKAA 1HHQA 3ET6B 2RQCA 3KLHA 3PYEA 4C11A 2J7KA 3M2VB 1DBDA 2NXJA 3M8QB 5D4OA 2OPRA 1RTZA 3KK2B 2ABYA 2WBMA 1X9MA 1UJ5A 1T03A 4ZLLA 3KNGA 1SH3A 5K5MA 2V9KA 2JEJA 2GMJA 3CJ8A 3HJVA 3RTVA 2R2UA 2ZDPA 4QYZJ 2HLUA 2GHWA 1T8EA 1NXIA 5J2NB 4OZJA 2NPFA 1RZMA 5C2GA 2YKAA 1FEHA 4C48A 5DQGA 3QLHB 1HFEL 2I2YA 4WU3A 2ZKUA 1CBKA 2H4WB 1M5VC 4I56A 1BGXT 4RNFA 3DLKB 4HYKA 3ZZRA 5IWAJ 4M5LA 2FGOA 2ATCB 2AT1B 4EZ9A 2LA4A 1URRA 3GJTB 2WRMA 2GMHA 3MUVP 4BC7A 2EK6A 1FKOB 3IXQA 4OHYA 2HHTA 2VFVA 4LF9J 1A9NB 2XZDB 1Z4UA 1TKXB 3MR7A 3LP1A 4QBUA 4OL8A 4O3PA 3CEDA 2DY1A 4ECVA 2GO8A 2XMJA 4DX8H 1EIYB 8RUCA 2B43A 1NJWA 1B4SA 5DLFA 5L9XA 1VRTB 3HHNB 4N56A 1CC7A 1GFWB 1RT3A 1RBOB 4DL2A 3CJQA 4E0DA 4DSEA 4JYAF 4I69A 2W9CA 3CC7S 1S4EA 2M88A 2AYEA 3NY0A 1JLFA 4O3NA 4YDDB 3M8WA 1VQKS 3PNIA 2OH2A 3CIMA 4DPUA 3D67A 1VQ5S 1FRHA 3MPDA 1NZAA 1IM4A 3IRXB 4F2RA 2Y0BB 4B3OA 4A47A 4NLYA 1TKZA 2J0QD 2WSEC 4LBHA 1N8RT 4JI8J 4K50A 1KQGB 1YGYA 4HLBA 5HLFA 3G82B 3J7ZT 2HZVA 1WOSA 3JAMY 4USVA 1SJFA 3FRZA 2X3DA 2W25A 3BM7A 1JLBA 3UW1A 5B0DA 1RHRB 2BE2A 2VKZG 1FJGJ 1GTEA 2PIIA 4J9UE 3OFGA 2J0WA 2N4DA 5E3RA 5E41A 2IPOB 4C3LA 3TANA 4PWDA 1N5VA 1S6PA 1AB8A 3GIKA 4DL7A 3L7OA 3LAMA 1FD8A 4DV1F 1TV6A 3CE8A 2E5JA 3ZZOA 3W9JA 2WOMB 3N6MA 2HKEA 4TQSA 4G1QA 1FX2A 1VIXA 4DV2F 1PBAA 2CJXB 2YKOA 2VFTA 2ZVIA 2CJKA 3GMGA 3L95X 4KPYA 4DPWA 4CO3A 3D2WA 1C4CA 5KFGA 5G0RA 5GAHU 2CRLA 3H5UA 1S1UB 4CO1A 2HQCA 2ZUAA 2OUGA 4UTGA 4TKTA 3C15B 5HP1A 2WONA 4Y2MA 4OX8A 3D7SB 4C8YA 4MTPA 1N34F 1NSKL 4KH0B 4ANCA 3L4BC 1WTFA 1FF2A 5EN1A 1X9SA 4NLWA 2CVEA 1SH2A 2G0JA 4DEZA 4ELTA 2IYGA 2QA4S 4OZ1A 2Y0SD 1O8BA 4ZP8A 4OYBA 3TX8A 3VAHA 5KFFA 3NMAA 4WWSA 1R0BG 1N5QA 5A0YB 1S9EB 1GX6A 2R7VA 1REVB 1KEKA 3W60A 2R8IA 3NGRA 3RB4A 2M0GB 4R5PA 1BQXA 3BPSP 2BM0A 3H5XA 3OT9A 3N79A 1HNWF 4JBCA 4OYWA 1T3NA 1WI8A 2VFUA 3MMAB 3T5KA 1KD1T 3QAEA 5GMKa 4ECTA 2F65A 2BR0A 3I31A 4U96A 2A2CA 3HHLB 2MEWA 4WYLA 3BKFA 4JI1J 1M5SA 1U47A 2DPIA 1FXDA 1OY8A 3I87A 4ENOA 1HW9A 3M32A 3W7BA 3HSJA 4OX7A 3RW7A 2HS3A 4FXWA 2FDNA 4ED5A 2V94A 3IG1B 1MU2A 4NCGB 2VHGA 5LMUF 4OZLA 4QIWD 2OKQA 3CMAS 1T9XA 4DHVA 1FD2A 2BJ3A 1TMMA 2UXCJ 3NGUA 5C7PA 4ZCMA 4OHWA 3A12A 2CJQA 3MZIA 2IJFA 4DUYJ 3Q2TC 2VOOA 4DV6J 3N28A 5T7LA 5IV3A 1F6TA 2UUTA 3HSDA 4Q45A 1NSAA 1S10A 2WVFA 1WC0A 3LH2S 1F5CA 1IR1A 3V4IA 5T41A 3D28A 4C4WA 1S1XB 2AQ4A 3DLBA 2AJ4A 4MFBA 1S6QA 4KB7A 1MN9A 1WJ9A 3BN4A 2W7PA 2HRYA 4WCEQ 4OLPA 5A8RA 2DNPA 4ZIVA 4ZCKA 3CTRA 2BEFA 5CD4H 1AXQA 3MMBB 1SJQA 2GQ2A 4AQYJ 1UJ4A 2G2YA 4DZDA 4B9SA 2CNNB 3GLJA 4C0HA 4KFBA 4EYIB 2OIHA 5EHHA 3NMRA 1S72S 3PDNA 3GIMA 2MLZA 1S0OA 3PV8A 2QEXS 3PHEA 4F0KA 3FZ2A 4I4BA 3B4DA 2GZOA 3OR1B 3CWJA 1K0VA 4GKJJ 5HROA 3W5XA 4LRAA 2YKPA 2OHDA 5F8GA 5D0RA 1FVSA 2KT3A 4RL1A 3KK1B 3L9ZA 1SKUB 1RT6B 4B9MA 3GJQB 2AKWB 5KG6A 3DRRA 2HHQA 1IVZA 1CSJA 3BSCA 4JI6F 1QTNB 1HBMB 3AQPA 4DR7F 2MYFA 5M2PA 1FRIA 5BYRA 5DJBA 3EXYA 2B56A 5EGYA 1WWHA 1LWXA 4DSKA 3KYLA 4ZCLA 1AUDA 2UUWA 2ZH3A 1JJ2R 1IBCB 3NNHA 3DLEA 2JLEA 4RZRA 4FXDA 4DR1J 2VODA 4EUVA 4RLEA 1PKUA 2CXEA 1ZETA 1F9EB 1VFJA 2G9OA 1XN9A 3R5DA 3R5JB 4ZMMA 1UAWA 4M95A 2WVEA 1H3DA 3I55S 1IBKF 2OEKA 4TU8A 3HK2A 1NRKA 4B3SJ 1ZPWX 3M2UB 1QLNA 2LQ8A 4WPAA 3I5CA 3EM1A 1JB0C 4DDFA 3ZZPA 3MM7A 1HBOB 1HR0J 1VK3A 3VAMA 4OV1A 1S12A 4JI5J 4XO0A 1KP6A 2KRBA 2M9KA 4IG3A 4OQJA 4DQRA 3CPWR 3G96A 1M1HA 4TLQA 1I94J 1JNZB 1UJ6A 1N54B 3G6ES 3FQKA 2D3ZA 3I9V9 1JLAB 3W2WA 2HNZB 4HDHA 3SSSA 2HGNA 4X62J 1KQKA 3ELHA 1K0TA 2YNHB 1IKVA 1LV5A 1R0CB 1EHWA 3MEEB 3VHQA 4XPEA 4A8WA 3MTJA 2VU5A 2VH7A 1RT7A 2F40A 4OX9F 4PUOB 1RBLA 1DTTB 4P7VA 3EPIA 1EKSA 2RKIB 5K14B 1D9DA 1HBUA 4DPYA 5KFRA 4XPCA 2V4JB 3T9ZA 4RNNA 2MKCA 2DNHA 3HKZD 4ATNA 2IC3A 5C5JA 2RS8A 3C2PA 3OJUA 2CPIA 4ETZA 5CXTA 4I6YA 2Q6CA 1WUUA 3DXSX 4MJKA 2RT3A 2H65B 2DIUA 3QRQA 3FEYB 3CCUS 3WZ0A 3WIUA 5HMYA 2JHEA 3R1LA 1HYSB 2BJ7A 3UQSA 1UA1A 2Z2MA 1XMBA 2AMCB 3KMSA 4DV3J 4N7TA 2WSFC 3EXCX 3Q24A 2VJVA 3DOLB 4RW4B 1HNIB 3WC2A 3TYTA 2YNGA 2OPQB 5IT4A 3BV8A 4MAKA 3P96A 1CJTA 2GVZB 4ID5B 4ES3A 9RUBA 4OHVA 1CJUB 3MUTP 3AFGA 4PG4A 3UDVA 4IYQA 4ED4A 2ZFHA 3N4WA 1XQIA 5KFWA 3QWUA 3K8WA 3SDEB 4FVMA 4RX6A 3U27A 5L39A 1NMEB 2E1RA 2XZWA 3BQ1A 4EBDA 5LSOA 1Y3KA 5SUHA 4RUCA 4QIEA 4RW7B 1KHVA 5D0GA 4DN0A 1X5OA 2EVZA 1S1TB 1Z2ZA 3CCRS 1FNXH 2PFDA 2AJ2A 2HFZA 2V2ZA 4M1KA 1ZTWA 1JLCA 2QL7B 4K4XA 1BC6A 1U6ZA 5IFMA 1M5KC 5F8JA 1BWEA 1WC6A 4DMZA 2VDHA 3M30A 3EPGA 1EARA 4LFAF 5A6PA 3T3FA 4TYBA 4YOEA 2CUYA 2DO4A 3BPDA 3QYYA 2QLXA 3M4XA 2OPPB 5ITHA 2R7QA 2OMOA 1AA1B 4CLPA 3T5JA 2I0XA 2KKHA 4B3RJ 2ASLA 5RUBA 1FKAF 3MECA 1W26A 3CJ5A 1VJWA 4HT7A 1MWZA 2CQ2A 1TKTB 4EU0A 2SXLA 2ZH1A 1RT4B 4P71A 3K59A 4DS4A 1O51A 4L3NA 2K7JA 5AE1A 3BGOP 3PJXA 3J81Y 3MM5A 4NLUA 3MEDA 3RBXA 4LQ3A 3OTCA 1U1PA 1S6UA 2F4FA 3TWZA 4J91A 3AT1B 4M63A 2CPDA 5KT2A 4Y0FA 4DL6A 4CNZA 2APOA 2R8KA 1G7CB 1ZM2A 2VDIA 3PX6A 3KOAA 4Y6IA 3NNAA 2DGSA 4YY3F 3MMJA 2FD2A 4OI0A 2HZAA 2YX4A 1VRUA 1UVKA 4LIWA 1ZOTA 1DAXA 1W2BR 5D8HB 4I7FB 2HFUA 3R6GB 3NG8A 2ZE2A 1S0NA 2V50A 2P8IA 5C42A 2Y1IA 4DR3J 1T9YA 5CYMB 1B0VA 4ILLA 3VF0B 2Z0GA 1IKYA 2E7XA 3ZNJ1 5JJBA 4TU7A 1F3VA 5HAOA 1HBNA 4FN5A 3LGHA 4ZN3A 4CH7A 2QMXA 2QYGA 2GIRA 4TXSA 2DISA 1WF2A 3KHGA 3IFEA 5EWGA 3D54A 4M5DA 1K47A 4AL5A 2P6TA 3LP0A 2XLJA 5C25A 2ACYA 2IVYA 1Q95G 3JSYA 1OQ6A 3KLIB 1FDNA 2FZKB 2WB1D 3OJSA 1SV5B 3PJWA 1NJZA 1N33J 4CYUB 3PW0A 2QIFA 4N5SA 5KG4A 2B8PA 2E5HA 1WOPA 1NDKA 4FS2A 1YHQS 3ONQA 2CJ9A 3HVWA 4KKOA 2X1GA 4ZJOA 3HT0A 4RKUC 3HULA 1R8AA 3EMTA 3KJVA 3FFIA 2V8PA 4ZHRA 3DCAA 1FFWB 3R5GA 3G8TA 4OI1A 1OY9A 3S6EA 4QU7A 1GXLA 5CZXA 1Q0NA 5D15A 2QYCA 2Z30B 3ULHA 4DCPB 2PI4A 4GO7X 2V8HA 3WBZA 2B6AA 2IM2A 2NXCA 5CABA 5IC6B 3SEOA 4UOCA 2ZHAA 2IFXA 5KFUA 5KFAA 3R2DJ 1RWWB 4DR4J 3JSBA 5BXIA 4CIOA 1U2RA 5HMZA 1S77D 3JYTA 2PC6A 3ZFVA 2KL8A 2K3KA 3Q22A 4DV7F 1OWXA 4NA3A 3PO4A 3T1YJ 5AE3A 3PVXA 2J8SA 4Q2MA 2FC9A 3MR5A 4MYTA 3CD6S 2NQPA 1U8WA 4X65F 2W2MP 2YVSA 2XQCA 3AXKA 1PJ5A 3K5NA 3G6YA 4J9LA 1GAOA 3OTOF 2XNQA 2ZNZA 1H38A 1IXKA 2D3O1 2B51A 2NXNA 5ETPA 4DL3A 3MPWA 2YNIB 4OZ0A 1L3TA 2J9CA 4ANEA 3CJ3A 4NI2A 2CYYA 3ZTRA 3H98A 3MAAA 1HNXF 5EUHA 3A8JA 2YWHA 4CT8A 1TL3A 2BM1A 3CCVS 4DR2F 4CM0A 2KFYA 2IJRA 2FLPA 2GGPB 3C6UB 2B3TB 4F04B 2HHPA 1UFKA 1SCJB 5JMNA 1GX5A 2MKYA 3L3CA 2DR6A 1R0AB 3HSGA 3F41A 5CCLA 2MQMA 3NGDA 4LSNB 4I1TA 2EBGA 3Q8RB 2JSXA 1MN7A 2I1RA 3C6TA 1VS3A 1UWBB 1YX2A 3DRXA 2KJVA 1LOUA 5HBMA 4QPXA 3FMWA 2WVCA 1Z2LA 3D9BA 1X4GA 2F4VJ 1IM6A 2MJUA 3MDFA 2EW9A 3HD1A 3CT9A 4IFYB 2GX8A 4MT1A 7AT1B 1HHTP 4DR6J 1C1BB 4OI3A 2JX2A 3TR5A 4IFVA 2NYHA 2XZTB 2KI2A 4PABA 2EEYA 1N5YA 4I2PB 3GFXA 2HGLA 4NRUA 3BBFA 2GMLA 2ZH2A 4WP8A 1RT2B 4AUKA 3H8YA 1WC4A 5DLGA 2Y8YA 2UUAJ 3MMCA 2UVRA 2ZOGA 1SJ1A 2EKNA 3AB4B 5CAAA 4J9QA 5E0OA 4PQUB 3M7VA 3QT7A 3W61A 2QE5A 3IS9B 1B0PA 2JEGA 4WJBA 1YQHA 4XAKA 3TA1A 1N56A 4KV8B 2FY8A 2BKPA 2LQ9A 2BUNA 5KT3A 2ZD1B 1XNQJ 1MNEA 1NB7A 4WFNQ 1WORA 5KT5A 3KNAA 1NUEA 2AEJA 1F0XA 5GADU 1MW7A 2NXEA 3NWRA 1RTJB 2HHHJ 4ICLB 2ALYB 3GONA 4EMDA 5M2UA 4IG0B 1RTDB 4FNIA 5DRKA 2CADA 3R5AA 1U1NA 4QR1A 1SVDA 1U6FA 3PXGa 1OPZA 2CZ4A 3MCNA 1SBRA 3MEGA 2A3JA 5AXMA 3EZUA 1YJWS 3GV7B 4O44B 3T6BA 3FBBA 1ZYQA 2QLBB 1OO0B 4MKAA 2G2ZA 1S99A 2W9BA 3CVKA 2F5GA 4NLPA 4IRCA 2ZKTA 2D9OA 5C2CA 4OMFG 3AD7C 2WW8A 2DHSA 2W4CA 3BSAA 5B0GA 3TZWA 2XSJB 3Q8YA 4DZ6A 5J1EA 4ZN1A 2OI2A 1D9AA 3AQOA 3UN5A 5DG9A 4XDDA 1T9VA 4AFFA 3DRSA 4YB7A 1RHUB 4NZ7A 4PYDA 3T5HA 2FHKA 3M9OB 1AUSL 4EO8A 3SQOP 1TK5A 2DGOA 4QR0A 4DFMA 1KQFB 3W62A 3QT5A 3KUGA 2DGUA 1JLEB 2VC0A 4J7CA 2ASJA 1WEYA 5ETMA 1HQEA 4NWBA 5A8KB 3LP2A 3GR1A 5AE2A 1DLOA 3BGRA 4CI0B 4WKYA 1NZ8A 3KHRA 3CC4S 5DZ6A 3ILLA 3DRPB 2HBYB 3PW5A 3ZZ0A 5A8WA 2E7VA 4Q0BA 1HD1A 4R8UB 3HP6A 3VTIA 2OLWA 4UOHA 3LWLA 2KU7A 4KJIA 3JS9A 1RT1B 5F8HA 2RDIA 2HFNA 2C3YA 2JLFA 4KC5A 2VKRA 1U0HA 4KPCA 3M8QA 5FD1A 2DK2A 5I3PA 1Q79A 5D3GB 3KK2A 1FDAA 3VAKA 1SXLA 1VQ7S 2FVSA 4OLOA 2QO3A 1RP5A 4AXJA 4C98A 1Q8IA 4OI6A 3Q86A 1FK9B 1S0VA 2D9PA 2MLXA 2O01C 4OJHA 2VG7B 3UCZP 1NKBA 2MQ8A 4DL5A 5J2NA 2LQBA 1TVRA 4WFAQ 3RRKA 4AD6A 4WE1B 4ZLJA 2YNFA 2OPSB 3JSRA 1QD1A 4J9OA 1MROB 3CMQA 1NHUA 2Y9HA 4LRDA 5CH7B 4CQ1A 2LVWA 4IO9Q 1SKRA 4DV4F 3VZHA 2NXUA 3ZC4A 5DQIA 3KJFB 3HFZB 1X60A 2XG8A 1GEHA 4F4AA 5MAOA 1W2IA 4U8YA 3FEXB 2R8GA 2PEBA 1HI8A 2RMLA 3RW6A 5F8LA 4X66J 3H20A 2AV5A 3ZTOA 2C3MA 5KFYA 2X3GA 1KR4A 3MF5A 2DH7A 2FGCA 2HHVA 3CXCR 3PX0A 1FFGB 1TKXA 2DNGA 1YRTA 1V5VA 3H42A 2B5JB 5CYQA 1Y10A 4UOGA 3LGMA 8AT1B 1T9WA 2J0SD 4ED1A 3LAKA 2DGTA 2X1FA 2R7OA 4DPOA 1VRTA 2H9ZA 2L48A 3ETOA 4QWBA 4AE5A 2V2KA 5CD4A 4K5SA 2EC2A 2MKIA 3EGNA 2ZH7A 1HQUB 1UA0A 2DCLA 4B9NA 4CO5A 1F9FA 2KXFA 3MFHA 5KG3A 5D0EA 1FRKA 2Z2LA 3B4MA 2UUCJ 2YWKA 3QO9B 4LFBJ 1X0FA 4Y00A 4O3OA 2YKNB 3UD3P 3RB3A 4XDCA 5B0CA 1XMOJ 2BJ1A 2EFGA 1L5UA 1RHJB 1BMQB 2Q6BA 2VBZA 3DGVA 1ZBTA 3SXLA 2VPYB 5KFHA 1R31A 3JTNA 2KT5A 2HYIB 4USUA 2N82B 2MJNA 4UW2A 4QIFA 4O0IA 2ZC4A 5I3QA 4IUFA 3D66A 2GHVC 3C19A 3F44A 1J5OA 2K1RB 1LFWA 3W5ZA 2CNOB 3I5BA 2DPJA 3PYGA 5H9FK 1W7WA 1BQNA 1TP7A 2RDJA 4KAIA 3U1LA 1PGZA 2O5DA 3PHTA 5BYQA 4ZVUB 2CNKB 4Z37A 1FNOA 3MR6A 1PSDA 4TQRA 4ZVEA 4JI2F 1N6QB 4EYHB 1U1MA 1J5EF 1GQEA 1NHKL 2AEFA 1YJUA 3SIPB 2XYPB 2MZQA 2C2NA 4JI3J 2JEIA 3FMBA 3W5YA 1SJ3P 2JRSA 5DDPC 2XWXA 2JVOA 1FWKA 3WDOA 5ETOA 2GAGC 4ZVRB 3HVTB 2N3LA 2VPZB 1RTHB 2Q79A 3ENQA 4QU6A 4KQZA 5GMEA 2ASDA 1UVMA 1LW0A 4EI2A 4NMXA 3UVJA 3CGIA 4FF3A 2R2SA 2HS4A 2HNDB 1WNEA 2DR8A 4USTA 2EFPA 2PA8D 4QWCA 4C0BA 3HHLC 3GE9A 1FE0A 5U47A 1EQMA 2RD5C 1EETA 1P1TA 2DXEA 2MDAA 4C97A 4HHHA 4CWBA 4TY8B 2J5AA 4FS1A 2L9DA 2B4UA 4DF8A 4KYZA 3I0RB 3A3NB 4FKYA 5EX0A 4C9DA 5A0YA 1NCLA 4H4MB 3K17A 4JYAJ 3EGWB 4ERDA 2LEPA 3DOMA 3ADAC 4QYZK 4TU9A 5KFSA 1CJKA 2W01A 2HVEA 3CJ4A 3QQCD 4URSA 2R7SA 1X4HA 2DNLA 4NOHA 3TA2A 3KMQA 2V68A 1P1LA 4MIWA 2JVRA 2RRAA 1FRLA 3ZZUA 2O1PA 4Q43A 2CJAA 1KVIA 3QFWA 2HURA 1PYOB 3AXMA 2K7KA 1Q78A 4JV2A 5ETKA 2G0CA 4BLGA 4L74A 3C66A 4FYWB 2VBYA 5F8MA 2D69A 1M5HA 2Y1LB 2CWXA 4ECZA 3AH6A 3FBEA 3QPIA 1EP4A 3D5MA 3Q8PB 2RF2A 2CZVC 3I56S 1RHKB 3NBPA 4B9UA 1IJEB 3VQSA 3I0SA 3DHWC 3PEHA 1S1VB 1LFPA 1U49A 4ZITA 3IG1A 1F3FA 1M0SA 1YJ7A 2DB1A 3K57A 2ZZMA 2QG9B 1H2TZ 5J2QB 1X4CA 1NKEA 3LOUA 1CULB 4UOFA 2B8QA 3FK4A 4CO2A 2HQDA 3OR2B 4JB8B 4IH6A 4DV1J 4BC9A 2VG5B 1SL0A 4F4KA 4LUBA 3H7HB 1QE1B 4DFKA 4OYAA 5F0UA 1YBTA 3QGGA 3IBCB 4DPTA 2AJQA 3KLHB 3HVRA 1VOMA 4DV2J 2MB0B 1XWLA 3TA0A 2AU0A 1S1XA 2OPRB 1GNKA 3OHBA 3A8IA 2JNJA 5GAGI 1Q4RA 3PFEA 2FC8A 3Q23A 4FYXB 1JLQA 4J5OA 4LVNP 2MQOA 2RB7A 3GP9A 4NYPA 4YB5A 1JLGA 1VQ4S 2CZ9A 1OSDA 4RBUA 3VVTA 4Q8FA 3ITHB 3ZTPA 3OVAA 3W65A 2NLWA 1N34J 2AHOB 2QLWA 5IT9Y 3W8GA 5KAKA 4J9RA 1I5OB 2WVDA 3I5AA 3RZAA 1XMQF 4ZVFA 1V6HA 5LL6d 1FHTA 2IVFB 4G3IA 1XBWA 1HLWA 4LF7J 4OX6A 3QMQA 3VAJA 4X64J 4BWJA 1LQ9A 1WC1A 2J76E 5JXSA 2DNNA 4G6VB 5KFKA 2W4DA 4GKKF 4QZVB 4BS2A 3I9ZA 1QAJA 1RT6A 2QL9B 2LXIA 4DWIA 1HNWJ 3NS6A 1RAFB 2KVIA 2WCXA 2BMBA 1R8CA 3IGVA 2Z8QA 4ED0A 3H4DA 1VISA 3HF5A 4G65A 3FQLA 1RT3B 2ZH6A 2DCUB 4JV1A 4ELVA 4C8NA 2AYGA 4ZDNA 1JXEA 1T95A 3IR7B 4HEA9 1IKWA 1FDDA 2HQ3A 2NUUG 3C3LA 2ZWPA 1T05A 2XLKA 2C2RA 1ZH5A 2K8GA 1A0OB 2Z57B 2XMWA 3ZNUA 4GC7A 3KJNB 2V2QA 5LMUJ 2LECA 3CJ0A 4B3OB 2FJBB 3S1TA 1T11A 1TKZB 1D3WA 2DD8S 4K4WA 4IOBA 2E5IA 1HPZA 5J1NA 3FNNA 5FIIA 5LT5A 1HNVA 3JSMA 1TKDA 3AOCA 3TVYA 1B70B 2RHQB 4WU2A 2IDEA 3FEZA 5HLFB 3N9UC 4Q7AA 3MFIA 2ZOFA 2NUHA 5JVHQ 1BXNA 2VA2A 2DRDA 1HBOA 2MKHA 1SIZA 1OS5A 3RRHA 3D0GE 4DUZJ 4JUZA 2R7TA 3CCZA 5LJ5Y 4DU8A 4B9TA 4Z7CA 3OQ2A 1JWWA 3GZ7A 2VL1A 3B54A 4NE9C 4RWWA 2HQFA 5E3CA 2NCKL 2M8HA 4LF8F 4KR0B 4YB6A 1EQ0A 1C0UA 1XR5A 3RBZA 2D3OR 2FUG9 2IA0A 1I51B 4PWDB 1S6PB 4RWXA 1UMJA 1HWIA 3J7Z5 1UPPA 2D3UA 3AJ1A 2XMVA 2VQFF 1R6VA 4N8NA 3MEEA 3TW0A 3NGTA 3RBDA 5LXRA 3TQ1A 5E5NA 1UWAA 4ECYA 4G1QB 2R7WA 3T5LA 2UVVA 2XS2A 7FDRA 3D68A 1YWXA 1AFJA 1QAIA 1IKXB 2H3EB 2OTLS 5G0RB 1VQSA 8ATCB 2ZJRQ 2FHMA 3THPA 1X5SA 4FYVB 2C1EB 3MPYA 5J2MB 2QMWA 1KSPA 2CQIA 5HP1B 3LANA 1YJRA 4FYDA 4ILMA 3K5OA 3VAGA 2IVMA 4LMZA 4CLYA 2F8HA 1SC3B 2J9DA 4JI6J 4YS2A 5DDOC 2HIYA 3J80U 2VIHA 2X1BA 4E98A 3D3BJ 2POKA 2OEMA 3BJYA 1NNDA 3NP5A 1HYSA 3OTBA 2Y1RI 2CVIA 2LQJA 4DSFA 1Q8LA 3HMJG 4A8QA 4KBIA 4LF6F 2KFNA 4O3RA 3U1MA 1TL4A 2ATLA 2NPIA 3PEJA 2V9WA 2Q66A 2Y3YA 2NYIA 3DOKB 3UDCA 2DKOB 4X4OA 2W2OP 3PG9A 3W64A 2MZ1A 2LEAA 4WIQA 3WC0A 2YXLA 1YG0A 4RU9A 2KRRA 4FF4A 1IBKJ 1KOHA 2XMKA 4LF4F 2B0GA 4RUHA 1PCAA 4JOUA 4F0HA 4CTAB 5F8NA 1FKPB 3ISND 1Q5VA 3M32B 5DQHA 2ALZA 1RWKB 4C3KA 2HWHA 3MM8A 1HI0P 1NH8A 2I38A 4Y3CA 3SYZA 4RW7A 4N76A 3R7NB 1AYEA 4HI1A 1MU2B 4ZKAA 1RI7A 3HDSA 4C8ZA 2DBBA 1S1TA 3M8ZA 4F4WA 5ADZA 3CJ2A 3L7PA 3UFCX 4ZVSB 5I42B 6FD1A 3DI6B 1H72C 4WXWA 4FBUA 4FF2A 4JI7F 2WW4A 2QFIA 3SSQA 4DFJA 2OEJA 1O6XA 4HDGA 3IGNA 1X5TA 1ROFA 4O3QA 3FKBA 4TNOA 1HR0F 4A8MP 5T7LB 3QRRA 3I4HX 5HI7A 2JC1A 1FE4A 1RU1A 3HVAA 4OX9J 3IM9A 4HKQA 4C0OC 4X4UA 3GFYA 3V4IB 3NCQA 2W2QP 3MOJB 4KO0B 4MFBB 2FJXA 3BB5A 3B78A 1ZAWA 1WKJA 5F3TA 5A8RB 2XMTA 4HVZA 4DPXA 5DETA 3TJAA 3M1VA 1PC4A 1TKTA 3R2CJ 1IJFB 3NGKA 4EO6A 3P49B 3KK3B 4Q5VA 1R43A 2ERRA 2HAFA 4DFPA 5HL7Q 1U1OA 1GH8A 2C22A 1Q16B 1YDLA 2AJ1A 2C3OA 2C2ZB 4K4VA 1R27B 1S9GB 5DS7A 5GAHI 2R42A 1LWFA 4OYOA 4H4KC 4ES2A 9ATCB 5HQMA 3CCWA 4RU2A 4WK3A 5FLXU 5D4LA 3N6NA 4O0NA 4U7UK 2F63A 1HQ2A 5HROB 3MPUB 3MURP 1T0TV 2Y8WA 2M52A 3BDPA 2CJBA 1T9UA 3EE3A 1QM9A 4I7FA 4CLWA 4CCHA 2P9GA 1K9MT 3H5SA 3EYZA 1E6VA 4ER8A 3IAM9 1RWNB 3MEKA 1DHMA 2ROEA 3THVA 3DRRB 4ZPTR 3M8PB 1JNRB 3OL6A 3HHKA 4ZA1A 2VQEF 2C2OB 4PPZA 1FX4A 3K0JA 3OTEA 3IAS9 2G2OA 1JXLA 4WYWA 3I4PA 3DLEB 3KLEA 4OYZA 3VAIA 1DURA 4LRFA 5IOLA 3PW7A 5HJYA 2D7SA 2BQUA 3ZZTA 1IBLF 5AJ3F 3T9NA 2R8HA 1RTIA 1LK5A 3EWGA 5H9EJ 5C24B 1VC0A 4NEZA 4A8OA 2KZZA 5KFOA 3ZO7A 2HRTA 3FJ2A 2YX7A 4NLTA 1YKWA 4DR5F 5E3PA 1FESA 3EX7B 1RABB 1UCNA 1RHQB 1QUVA 3MM7B 3JTPA 4ZLNA 1AROP 3R5BA 4RBTA 1T94A 2ZM6F 4IG3B 3TZZA 4LFAJ 1KOOA 2PMZD 5T14A 2G1HA 3BGLA 3GPAA 1FEEA 3HHDA 1PYSB 2UV8G 2NZ4A 2UU9F 5KFCA 3LUYA 5D78A 3W2WB 4PXCA 3HHEA 1IKVB 3R1HA 2WTFA 4F36A 2KO1A 1UZDA 1FRJA 4DG1B 1SUQA 2CPXA 4ZIWA 3AODA 1RT7B 1Q5YA 2JJ4D 4UY8T 1P27B 2CQGA 5L1IA 3K5LA 1DRZA 3CW2C 2GHPA 2DNKA 3D1OA 4NX9A 2HBQB 1HBUB 5B09A 2ILZA 3Q8UA 4P72A 1PBUA 4QJVA 4YY3J 5ETTA 4YR0A 3OPKA 2UXDF 4ZP6A 1OY6A 1RT5A 2E9RX 2IC3B 1J2VA 3UNYA 4WBFA 2GVDA 3H59A 1TR0A 1YJTA 3CIZA 5LMNF 3PKYA 1IQTA 3D6MB 3ZZZA 2YNIA 3V81B 5KTQA 2M3DA 1VLOA 1D9FA 4PKDB 1VC6A 1KN6A 4LSZB 3HPOA 4J9NA 2KN4A 4U7UD 3KWMA 3DU6A 4MKBA 3C6UA 5I3UA 3ENWA 1U02A 2MZRA 4F3MA 2VASA 3LA0A 4RNHA 3B82A 2GV1A 1R0AA 3RUBL 1CVJA 1RAGB 1NH7A 3BREA 5HVGA 1LW2A 1GT8A 2WB4A 2YNGB 4DI6A 3PM9A 3ZZYA 4CP5A 4QCLA 2FHJA 1CJTB 2LMIA 4RUBA 1WOOA 1UWBA 4GVLA 1WSRA 4DX7A 2H51B 3TP2A 4M5IA 3R9LA 3D6HB 2YWGA 2JC0A 5L9NA 5K8OA 3V5RA 4J9VA 4P7TA 3M6VA 2KXHA 1JX4A 2QTWA 1VCTA 5LSLA 2L08A 1C1BA 1NSQA 1CLFA 5CZVA 1SJRA 1JMTA 1QVFR 5HMWA 4ED2A 1KVKA 3NWGA 3M6XA 3W66A 3ICLA 3GU0A 3P45B 3R6LB 5E3QA 4ETXA 2V67A 2M4MA 1K8AT 1NK5A 4O3SA 4IH5A 2PA3A 4KGZB 5HVFA 1JLCB 3TUJC 4RBVA 2W4PA 5GAEU 2A1BA 3GV5B 2D41A 5DM7Q 2B9EA 1URNA 1OJ4A 2CDRB 2EFQA 3E01A 2OD4A 4PQUA 5CYJA 3MM6A 4F3QA 3IS9A 2V34A 2UXBF 4OFZA 3M30B 4OYPA 4KV8A 4DV7J 2LDYA 1EKRA 5JVGQ 4PRFA 3W8PA 3N0VA 2ZJQQ 2CPJA 2PE8A 1HWKA 4DUTA 4L3KA 4Q2LA 3MECB 1YIJS 2E9TA 2F3JA 5SZTA 5CQGA 2EFNA 1RTJA 3OTOJ 4KH1B 4LVOP 2HQIA 4DR4F 3CO9A 2GC8A 5D77A 3TAMA 4IG0A 2CDQA 1RK8A 3FCHA 3MM5B 3RBEA 3DGPA 3MEDB 3UPFA 1TQLA 1G6BA 3EVMA 4ZPWR 4OI2A 3A3OB 2OP5A 3H2UB 1ZPVA 4DR2J 4C8MA 2ZH8A 5DGAA 3QIDA 4ID8A 2YTCA 1VRUB 1X4FA 2V4QA 2Z2ZA 4K8RA 3MCMA 2XSJA 3SMZA 4DX5A 2D74B 5KFDA 4PWUA 2DTJA 3CCQS 2ZE2B 2JFKA 4AT1B 3BKUA 1JJCB 1XERA 3SQGA 4F02A 5D4PA 3E8OA 1IKYB 3CUNA 1WHWA 5DDQC 3ENVA 4J9SA 4PYAA 1HBNB 3VQTA 4USKA 2XYGB 5KOXA 2JEFA 3MHYA 5DZ7A 2KHCA 4DS5A 3H2LA 1D09B 1MWQA 1W25A 2HSEB 2GAHC 5CA5A 2HG4A 4O4GA 2PMWA 4C2MA 2WZ1A 3LP0B 1U25A 5C25B 1ZM3A 4P6QA 1S7IA 1X9WA 4TY9A 2LXFA 4NLVA 3LO3A 1RJJA 2HWTA 4OYXA 4R8UA 4IO1A 5D4NA 4ZP9A 4KKOB 1F2GA 2H5JB 4YFUA 2MXYA 3FFIB 4ZPVR 2I9SA 4ZHRB 1RT1A 1C0TA 4M5NA 1RE1B 4CLTA 4NLXA 2GS8A 2CPYA 1RCOB 2BW2A 2YQ3A 2BRKA 3J7AN 5D3GA 4DR6F 1PC5A 1N36J 3LGNA 4WP3A 3D1HA 3AAWB 2A6MA 5KG7A 3T1AA 1NK7A 1FK9A 1FRMA 3OUYA 4LFCJ 1TU0B 1LEOA 2P9EA 5E3AA 3VGVA 3FSYA 2MY7A 4JP8A 3KUHA 1MROA 2UUAF 5A6WA 3JYTB 4NLGA 3BYPA 1RWPB 3TAPA 1NJXA 4K4YA 2LXUA 3MXHP 2VD3A 2DHHA 5K20B 1TMJA 2K3IA 4JI0F 2BDPA 4J9MA 3QJJA 2R9LA 3GCWP 4UQTA 4O4RA 1VDHA 4QYRA 2JWNA 3T1HF 5IM0A 4I2QA 2BX6A 2HEKA 4MH8A 5FDLA 3GJSB 4NLOA 2VONA 3HJFA 2L41A 3JAMU 2AX0A 2YBVA 5E2QA 1YTYA 2B7BB 3DDIA 4QPTA 3ZTSA 1J27A 4JV0A 5L1LA 4K4UA 1LNQA 4F0MA 4F50A 4NI2B 3KDNA 1S48A 3OVSA 1S57A 4QWEA 2FLNA 4IQXA 3UDEA 1TL3B 3TZYA 3CC2S 2BANB 2FPHX 2I5JA 2RE1A 4B08A 3ZXWA 1OYEA 2K2PA 2PGCA 3UR0A 4LSLA 1HQUA 5IQ6A 3PTWA 4LR9A 1FVQA 2UVUA 5K9FA 3FZBA 4FNHA 2DH8A 1SPBP 1GMUA 3QO9A 3DM2A 1WDTA 1CC8A 2V2VA 2U2FA 2YKNA 2BJ8A 3C6TB 1RAHB 3BO4A 2RUGA 2MKJA 2C2EA 5LJ3Y 1FA0A 5EDWA 5K8PA 1NDPA 2QSWA 3M6WA 2P9CA 5HBMB 1Q86T 3IBFB 1YLXA 5ETSA 4PZVA 4P52A 2H5EA 1HHSA 1NK0A 4UUXA 3KLGA 4F2SA 3RRGA 3US5A 1FXLA 1KFDA 3D3CJ 2CA9A 3IO1A 4W92B 3C16B 2RHSB 1HARA 4IFVB 1H2VZ 2DGWA 2VZ9A 2O3DA 5HVHA 3G71S 3V6DA 1N5YB 4ECRA 1SKSA 1KLMA 3D6FB 3AOBA 3GSDA 4NLSA 4LF5F 1N0UA 3QZ8A 4F67A 4CH0S 4EBEA 5I4MA 3KLFA 5F9LA 3HLUA 3OSNA 1WDDA 1KDNA 1NHVA 4XK8C 4GVBA 3PW2A 3P5TL 4DV4J 1U24A 4RPFA 1QAYA 2FQQB 2KG1A 1U4BA 1DTQB 3K58A 3QIPB 3FUYA 1U45A 2OGUA 2MKSA 4LF2A 3IC1A 2CQ4A 1LWCB 3I82A 1Y3JA 2FTRA 3HVTA 1RTHA 3O44A 2LU2A 4IDKB 2GJIA 2MZSA 1YBUA 2VOPA 2DRAA 4USMA 2JDJA 4DL4A 2E66A 3V2UC 2E1PA 3R5CA 2HNDA 1GTHA 3CCES 2AYMA 1F60B 3AD8C 1RAAB 4TLRA 2XHCA 2VF3A 2Y1JA 3MEGB 4TY8A 3I0RA 1SQGA 4ZPDA 2DGXA 5ETLA 1WSVA 3CD0A 2W9BB 4YR2A 2UUBJ 4W4MA 4B3TJ 2AD9A 4Z2XA 1VC5A 3RB0A 2N7CA 4ZVOB 3CJKB 1U2CA 2CKWA 2V8DA 5J2PB 1IR0A 1NPKA 2FHJD 5HQ8A 2PD1A 5J1EB 1PO6A 4KIAA 5HANA 1R7IA 3SCLE 4CLUA 1B3TA 3CO0P 4J37A 4MMOA 4MIBA 3DLGA 1C1CA 3DRSB 2DO0A 1UVNA 4HTJA 3TRGA 1WF0A 2I8EA 3RU0A 1UVLA 1LKZA 3CCTA 1WELA 4I68A 3GIJA 3GV8B 3POTA 2HK2A 2DH9A 3S8SA 3MI7X 2E29A 4M5JA 4RW8A 3Q8SB 2UUCF 1GXUA 4HR2A 3LP2B 1DLOB 3JQKA 1TZ0A 4ZVPB 3RR8A 1S9FA 5KFNA 4NYOA 3EGZA 1UW4A 2LFVA 1KS2A 2LA6A 1CULA 1RLCL 1IBMF 4PXEA 5A8WB 1V5IB 4Q0BB 4KTQA 4B9LA 2XY6A 3OXFA 3BH6B 1SL2A 3NKYA 4XTTA 2VG5A 2F9JA 4JI2J 5HATA 3I32A 4K4ZA 2AJFE 1J5EJ 2BOPA 1QE1A 5KFMA 3TX0A 4C3MA 3O3LA 4U67Q 4DL0C 2B7CB 3KFWX 2XC9A 2ZBCA 1U0HB 4JI4F 1H98A 3W3SA 3DLHA 3NAIA 2AEMA 3TJ8A 4L76A 4WKRA 1FFSB 2N7YA 3J7YU 1WEZA 3MR2A 3PACA 1HWUA 1LWEA 3K89A 3FCWA 3HZEA 1G3OA 1TVRB 1V9OA 3ITHA 2CQCA 4LIRA 3BO2A 2YNFB 4ANDA 5ETNA 2VJUA 1MMLA 1C2PA 1NDCA 2MHEA 4K2JA 2ZDOA 2KHDA 2FJDB 2IM0A 4NASA 4IQMA 1RWUA 4JI3F 2DNRA 2MPUA 3IWLA 3BQ2A 2R7UA 2B9YA 3P5BP 5G4DA 5ETQA 2WHOA 3BKTA 2KJWA 2MGZA 5GADI 3AJDA 1ZTTA 2Q1LA 3NAHA 1HWLA 1TTHB 2W8LA 4N47A 3NOGA 1VQPS 3OL9A 2YQ0A 2AWZA 1A6LA 5DDRC 2LCWA 2H5IB 4DV5F 2PI5A 4KHMA 4MIAA 1VI7A 5F3ZA 3AY0A 4A8KA 4R25A 5E7OB 1RDRA 1JKHA 5CYQB 4DU7A 2DIVA 3G6XA 3NRBA 3MUMP 2XMAA 4UZBA 3CCLS 2MMYA 1P8GA 1X4EA 3PFOA 3WX8A 3W9HA 1DY3A 4N77A 4NCAA 1MG7A 2EKYA 1CPZA 1IWGA 4CT9A 4KE5A 5B0EA 1U0SA 2AJ0A 1U1LA 4PG7A 4DCOB 2P2CB 2ZC3A 4DQQA 3C14B 4NLQA 3BN7A 2E1CA 2B9XA 4WK1A 1E6YA 3T19A 1GMVA 1R89A 2PO4A 1NB2A 2HVZA 1UFLA 2MZJA 3TAQA 3HX9A 3MM9A 3BR9A 3G86A 4L73A 2VG6A 2YKMB 1S97A 3NS7B 5KFIA 2CQDA 2E5LF 4B3MF 1RWVB 4F4ZA 2IMWP 2WSCC 2FJAB 1HMVB 4RW6A 1L3KA 4ZVTB 3QRPA 1D0EA 5KFJA 2J0XA 3A8EA 3QGHA 4NA1A 1J5OB 5BR8F 2DGVA 4PXDA 3DMJA 4C8LA 2RQKA 3VCDA 4Q8EA 1APSA 1BQNB 2QLFB 4P10A 1BLUA 2L9NA 2U1AA 5IQQA 2OFGX 1KKHA 2EK1A 5KFZA 1MLAA 2CQBA 4E8UA 1TL1B 2KYZA 1UVIA 3UCUP 1O5JA 4DQPA 2HBRB 1XR6A 2RAQA 2HK3A 1I1GA 3CNQP 1XMQJ 3TARA 2BZ2A 5K8NA 5JUMA 4K0KF 3NEKA 2J7UA 3L09A 4NLDA 2E9ZA 1FTCA 1IKXA 3H90A 4X4SA 1ZM4A 2YH1A 1KHWA 1NK6A 1FXRA 4YR3A 4NXNF 5J2MA 4NRTA 3BDEA 2HMIB 4OI4A 1LW0B 1JJHA 4GKKJ 3UVJB 4K4SA 2AGOA 2J6TA 1R3NA 4ZPBA 4KHPF 1JK9B 3DFEA 1SC4B 1M5PC 2VFRA 1EETB 5ETVA 2YWFA 2BJDA 5IT0A 2DEIA 4LF7F 4OZNA 4Y2KA 3LF0A 1HNZF 4H4OB 1N0VC 2GNKA 2V8GA 2DJWA 4X64F 1KC8T 3THTA 3GJRB 4C8KA 3DOMB 3DNCA 1T02A 2QFJA 3EVOA 5KFQA 1CJKB 3ETMA 4A46A 4RW9A 4MK8A 1CJVB 2ZUGA 1ELOA 4HACA 3DOKA 1TUVA 3OLBA 4IR1A 4FDFA 4M5MA 4U9RA 1OPIA 3OW2R 3UN3A 2P5VA 4FYYB 1TK8A 3DN9A 1QDUB 2D1CA 2LQ5A 4RNOA 3LPYA 3CDWA 3SSRA 2E44A 3CCMS 1EP4B 3FBFA 1OSCA 4CTAA 2RF2B 2H1YA 1FKPA 3GILA 2JL9A 4IKAA 3NBPB 3H4BA 2HS0A 2J8AA 3VR1A 3I0SB 2IRXA 3M9MB 2BRLA 3J81U 2A6OA 4LF8J 1SC6A 5I42A 3DI6A 3DLJA 1CS4A 3HFVA 3SCIE 1BQMA 4YQWA 1REGX 3GWCA 4ED7A 3VZIA 2IA6A 4X4NA 2PFFB 3NCRA 1T3OA 4NXMF 1AZSB 1U09A 2VQFJ 2ZOMA 4HH0A 3M2RB 3DRYA 4Y65A 2AYBA 2HFOA 4YHHF 3L7UA 4DUZF 3A8KA 2ADBA 5IV4A 3HT3A 3IP0A 1SJ4P 2MQNA 4R0JA 3BF4A 4LRCA 3SCJE 4KO0A 4N8OA 2G0IA 2W7OA 1RADB 2ADCA 5GVQA 1JLQB 3DC2A 1S7HA 2O66A 3BSNA 2OELA 2E1AA 1JLGB 2XCPA 5B0FA 2J9EA 1RISA 3ILIA 2MY8A 2N3OA 3KK3A 2HFVA 1JIHA 3FCVA 1N48A 1B7FA 3D0HE 2HRUA 4FXVA 3DYAA 3TOQA 2UZAA 2QA2A 3EUNA 2QLJB 4PG8A 4ED3A 3NLCA 1S9GA 2K06A 2DEJA 3A4TA 1FT8A 2IAJA 3OLAA 2CQ0A 1PYTA 2FVQA 4DLEA 1F5BA 1TL7A 2OAUA 2NSBA 3IWXA 1Q81T 1KFSA 1R8PA 1RAEB 2BJ9A 2VUGA 2DR7A 1WG1A 4ZVGA 4V19X 4LF6J 2VPWB 1Y9OA 2CAJA 3ET6A 4QIVA 5KFEA 4P74A 1CEZA 1CQNA 1Q53A 2XEXA 3M2VA 1S79A 2RSQA 2GQCA 4AL7A 1B7YB 3M8PA 1R6YA 1LXNA 4QR2A 1GXTA 3PZPA 2EFVA 1X7VA 1B0TA 3MD1A 2KH9A 2YWEA 2KFZA 3TJ9A 5IS2A 3P3DA 3KUEA 4LF4J 4F7VA 2J9DE 1PG5B 4R0EA 3QLHA 1SB6A 2MHNA 1IKWB 2DR5A 2FJVA 1DQAA 1S1WB 5KG1A 4C8OA 3EDRB 3FSIA 1T05B 4P9SA 4I6AA 3B8HA 3ILOA 1N32F 3DLKA 2XO6A 1VK8A 2PSZA 1P6TA 2XLIA 1UTAA 1VHFA 4OJGA 2QA4G 5C24A 1ICEB 3X3UA 4X4PA 1HPZB 3T6JA 4IRDA 4JI7J 1HNVB 3JSMB 4NA2A 4GMKA 3PCOB 5BYSA 1FKOA 2R2TA 3MOZA 1C4AA 1RAJA 3GYXB 5B7WA 1WHYA 4WIIA 3K5PA 3PKMA 3C8YA 3SBMA 4ECXA 2DNMA 2EG1A 4ECWA 2JOQA 4LR8A 1VBKA 4C6AA 4PPDA 1NK8A 1RB0A 2LU1A 2NS1B 1C0UB 2W24A 4ZJLA 1NKCA 1XNRF 2G4BA 3MCOA 3BQ0A 4P75A 3BS9A 1H73A 3J7A1 4TVAB 5H1SV 1OIAA 2BVZA 2BE9B 2C28A 4DG1A 2ZHBA 3QJLA 2FJEB 3IRXA 4JV5F 1RGVA 1RAOA 4IRKA 4EGLA 4WXOA 3ILJA 4K7QA 1WC5A 1VYAA 3G82A 3NCPA 1S59A 4URGA 2HVHA 2UVWA 2B4VA 3OVBA 3BGUA 1L3VA 4J90A 1VQLS 1NDLA 4DOZA 3NOCA 2AP6A 2VICA 1QTMA 4PG5A 2EBEA 4DV0F 3V81A 3BBBA 4CH1A 4OZ5A 1YITS 1JXVA 1N52B 1QUPA 1WKKA 3UDLA 1VRQC 5A2QU 1Q82T 3CF5Q 2VA3A 2HHWA 1FWPA 4HL9A 2HHXA 2ROGA 2HIQA 1Y0HA 2VQEJ 4NZ0A 3EJMA 3WQPA 1WF1A 3OL7A 4OHXA 4OZ3A 1RQ0A 3LQVA 4ELUA 2ZH4A 2CPFA 3N5BA 2WOMA 1Y4ZB 4CLKA 4Y34A 3BZQA 2XS5A 2XHWA 3HM9A 1IBLJ 5AJ3J 4RR5A 3X1LB 4ZCIA 1SL1A 4KGXB 5AXKA 1KTQA 3U02A 3N5FA 2HW3A 1S1UA 4ALZA 4LBIA 2IRUA 2QA1A 2R7XA 3VGSA 4M5GA 3C15A 5KT4A 3OHAA 3I96A 2ZHOA 1QSLA 1L3UA 2QZ8A 4DR5J 1TAQA 2FIUA 3IRWP 2X1AA 1SQEA 1HW8A 3K8VA 3MM8B 4L72B 3TI0A 2ZM6J 1S0MA 3FVYA 1NJYA 2ZITA 5IWAF 1IUJA 4ECSA 4ZVHA 1S9EA 2UU9J 1RA6A 2DNZA 4PG6A 2HNYB 1REVA 4AL6A 5L8RC 3LALA 3LW5C 4LF9F 2WBRA 2QN6B 3GG1A 1FJEB 1BWVA 1A7GE 3U1NA 1PJ7A 3MTKA 3KDOA 2HAIA 2RILA 5KT7A 2A10A 3HZGA 4M94A 1Q1KA 3MMAA 4HTIA 1TUWA 3PYFA 3KTQA 3HHLA 1RXOB 2RUSA 2V63A 2UXDJ 2VB6A 1YJ9S 4KSEB 5H9EK 2XSFA 4M8LA 3M1VB 2B4PA 3PW4A 4DJBA 1FRXA 4ED8A 4DBQA 1AT1B 1MSWD 3W2VB 5LMNJ 1RBAA 3OBIA 1S49A 5HO4A 4NCGA 2XI2A 3CCSS 2DHAA 4PCQA 4EZ6A 2C42A 4JI8F 1LWFB 1UVJA 3CSKA 3VGUA 3KXDA 2A2DA 3KHLA 2RVJA 1NAQA 4CNYA 4EEYA 3DU5A 2XGQA 1K73T 1G1XA 2N4CA 2MQPA 1YSJA 3VVUA 3BO3A 3H2VE 3VGTA 3HI9A 3IBWA 1FJGF 3QAUA 4C11B 1U48A 2BBEA 3UO0A 2BACA 1E6VB 2QV6A 3JXOA 2KM8B 1YK9A 1YI2S 5HQLA 1T03B 3R97A 4M5HA 2FHOB 3KKFA 2V8VA 3D6TB 5KFBA 3MMBA 3HD2A 3I6PA 2XY5A 3RR7A 3KLEB 4OYIA 1Q8KA 3GSIA 3UCGA 3V6KA 2HQGA 2CPZA 2V4RA 4EBCA 1X4DA 3BH7B 2QX0A 2XCAA 4WTYA 1U2FA 2OMLA 2ROPA 4LBPA 3NXZA 1YJVA 4USWA 3V6JA 3GFHA 4QOTA 2F1FA 1RTIB 3CDEA 2DNYA 2FZGB 2QJ3A 3OR1A 2AGQA 1G4CA 4ECQA 3R3TA 2CG4A 3CDUA 4ZK7M 3KK1A 3OL8A 1VGYA 3U7JA 4CRJA 1FERA 3M9NB 2J6SA 4W90B 7FD1A 2W8KA 3LP1B 2YWWA 1WHXA 5KFPA 2H48B 2EC0A 2UXBJ 1WG4A 3NGSA 1RKIA 3IWNC 3SZ2A 1HBMA 3BGFA 1XIQA 5GMDA 1ZS6A 2AZ1A 3T41A 2HFSA 2KDOA 5EWFA 2DRBA 2Q3PA 2PEHA 3PRVA 2PN6A 2CFXA 4B9VA 1RU2A 1H6KX 1LXJA 2IM3A 2W9CB 4X4VA 3Q2SC 3PR4A 3GG0A 2FVPA 2C2MB 2CWKA 4YN3B 3EICA 3W63A 1JLFB 1CG2A 1KNZA 1TELA 3O2IA 1U1RA 3FBCA 3IA0A 4WFXA 2DYAA 4UZCA 1SUQB 2RRNA 3BBCA 2OD6A 2V5HG 5ETRA 1Y5LB 2IYIA 4RJVA 4UUWA 3H40A 1H7XA 1ZA2B 4CZCA 1FJ7A 4IOCQ 1WKLA 3TEHB 4P2XA 4TN2A 3M2UA 1WD6A 4JI1F 2EFOA 3EDQB 3H0PA 2MTLA 1RT5B 1JLBB 3GR0A 2BE2B 2DGQA 3TVKA 2W1BA 1TL5A 2GVDB 2GO9A 3BR8A 5F8IA 1TUGB 5IZHA 1SQFA 4Y2AA 1KWMA 3VWSA 4BCAA 3DDNA 4UY85 1M1GA 1UETA 4KT0C 2Z56B 2FLOA 1JLAA 2UXCF 2BANA 3RJMB 2HNZA 1TK0A 3BYRA
chains in the Genus database with same CATH topology
2AW0A 5I3UB 3QO9A 3DM2A 3OFGA 1ZBTA 2J0WA 3SXLA 2YNHA 2VPYB 2N4DA 1CC8A 5KFHA 2ZH9A 4DUYF 1R31A 4DV6F 4MKYA 1TV6B 2U2FA 5E3RA 3O1LA 5E41A 2YKNA 3S7RA 3C6TB 4C3LA 3TANA 3JTNA 3BO4A 2VBWA 1VMBA 2KT5A 2RUGA 2MKJA 2C2EA 5LJ3Y 4L6V3 4PWDA 1FA0A 1N5VA 5DM6Q 1S6PA 5EDWA 2HYIB 3GIKA 5K8PA 2N82B 4DL7A 2MJNA 2QSWA 2XGPA 4UW2A 4PUOA 4QIFA 5KOWA 4O0IA 1DZ5A 2G13A 2ZC4A 3L7OA 3M6WA 2MZTA 5I3QA 4IUFA 2P9CA 1DTTA 2RKIA 5HBMB 1Q86T 1LW2B 3LAMA 2MQQA 2GHVC 3F44A 1J5OA 1FD8A 4DV1F 2K1RB 1TV6A 5K14A 1LFWA 1Y00A 3CE8A 3Q0AA 2E5JA 3ZZOA 1N5SA 2H5EA 1HHSA 2WOMB 2V4JA 3I5BA 4UUXA 1NK0A 3KLGA 4F2SA 2DPJA 3RRGA 3N6MA 3GQCA 2CQHA 4TQSA 1BQNA 1TP7A 4G1QA 2RDJA 4KAIA 2IM1A 3US5A 1FXLA 3U1LA 1VIXA 1PGZA 2O5DA 2C3PA 1KFDA 4DV2F 3JB9k 4USJC 5KG5A 5BYQA 4Z37A 2RH3A 1FNOA 3IO1A 4W92B 4MYUA 3MR6A 1PSDA 1HARA 2FVRA 1WI6A 2VC1A 4TQRA 4ZVEA 2RS2A 4JI2F 1N6QB 2WONB 4EYHB 2YKOA 4AQYF 1U1MA 4DSIA 4IFVB 2VFTA 1H2VZ 1J5EF 2BA9A 2DGWA 3GMGA 2CJKA 2BABA 3L95X 1GQEA 4KPYA 4CO3A 2VZ9A 2O3DA 3D2WA 1C4CA 5KFGA 5G0RA 3G71S 5GAHU 1YJUA 3V6DA 1N5YB 4ECRA 2CRLA 2MSSA 2UV8A 3H5UA 1S1UB 1SKSA 1KLMA 1VQ8S 4CO1A 2MZQA 3GSDA 5A2QY 4NLSA 4DN9A 4LF5F 1N0UA 2JEIA 3FMBA 3MAHA 4NYZA 3QZ8A 4F67A 1JJ4A 4CH0S 4EBEA 4B02A 2DNQA 5I4MA 3KLFA 4TKTA 1SJ3P 2DHGA 5HP1A 5F9LA 2WONA 2JRSA 4OX8A 4Y2MA 2NR0A 5DDPC 3HLUA 2XWXA 2JVOA 2BV3A 3HO1A 3WDOA 4C8YA 3OSNA 4MTPA 1N34F 1NHVA 1WTFA 4XK8C 1FF2A 5EN1A 1X9SA 3PW2A 3P5TL 3HVTB 1U24A 2N3LA 2VPZB 4NLWA 1RTHB 2Q79A 3ENQA 2CVEA 1SH2A 4GKJF 1IN0A 1QAYA 4DEZA 1VQ6S 2KG1A 1U4BA 4ELTA 4QU6A 1DTQB 3K58A 1AW0A 3QIPB 3BSOA 2IYGA 2QA4S 2ZH5A 4KQZA 2J6UA 2ASDA 1UVMA 1U45A 1LW0A 4OZ1A 2M7SA 2Y0SD 3N01A 2MKSA 3CGIA 5D6GA 4FF3A 1O8BA 3IC1A 2R2SA 2HS4A 2CQ4A 3O6QA 2HNDB 4ZP8A 3TX8A 3DOLA 3VAHA 4NZ6A 4R5PB 1LWCB 5KFFA 1NO8A 1WNEA 2DR8A 2KYXA 4RW4A 1HNIA 3NMAA 3I82A 1Y3JA 2EFPA 1N5QA 2FTRA