1LWEB

Crystal structure of m41l/t215y mutant hiv-1 reverse transcriptase (rtmn) in complex with nevirapine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
423
structure length
401
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 102
structure length 401
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lweB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweB03
2ILZA 4QW8A 5J2NA 4H4OB 5DG7A 3FFIB 1S1XA 2W8LA 3NMAA 3PR5B 3SI8A 1C1CB 1TL1B 1MMLA 2JLEA 2R2RA 3PJXA 4MKAA 2YKMA 4ICLA 4DL4A 2WCXA 1S1UB 2W9BA 3FDSA 4TYAA 2BRKA 4NLTA 5J1EB 3DLGB 2XCPA 4KO0A 5J2PA 4H54A 1LWFB 3MECA 4R5PA 5F8GA 2BQUA 3KLGA 3OSNA 3CDWA 5DQHA 4IRDA 1BQMA 4XO0A 3LALA 4KHRA 4TXSA 1S1VA 3M9OB 5L1LA 3DRRA 3DI6B 4JUZA 1S1TA 2UVVA 3KLFA 2HWIA 2WB4A 3KK2A 2BQ3A 1TV6A 2D3UA 4WXWA 3KJVA 3E51A 3KK3A 3NBPA 1JLEA 5CYQB 2V4RA 4EEYA 1QAIA 3KLIA 1REVB 3UDLA 1BQNB 4RW9B 1LWFA 3MECB 3FSIA 5JUMA 4DL5A 3MEEA 4KHMA 2FVRA 4NLSA 4WYLA 3KLGB 1JKHA 1S6PB 4QWBA 5KG1A 5KT6A 4F4WA 3OLAA 1HNVB 4ZPDA 2R8HA 2C2RA 5I3UA 3DRRB 5KFNA 4ECRA 4URQU 5KG2A 4RNMA 3M8QB 4U6PA 2BANA 4Q0BB 2YNGB 3LP1A 4R8UA 3T5LA 5DG9A 3GIJA 4KE5A 4H4MB 5CYMA 5CYQA 1SV5B 3KK3B 3MR5A 1S9EA 1BQNA 5EWFA 4IR1A 2UVWA 3ISND 2V4QA 3H40A 3MEEB 4M94A 1D0EA 1IKYB 3BSOA 1SH0A 4QWAA 3OL9A 1JLQA 1HPZA 1S49A 3BSAA 5F8HA 5HBMB 5KG0A 3UQSA 3BSNA 4NLXA 4ED3A 1RT3A 3KMQA 1HQUB 4KFBB 4LSLA 4DG1A 1RTJA 3KMSA 2WONB 1RTDA 4MIBA 1S9EB 2ATLA 1JX4A 3V6KA 1TKZB 5F8JA 2ZKUA 1K1SA 2RF2B 3NAIA 2JEJA 2GIRA 1IKXB 4KO0B 1JLFB 5HP1A 3GQCA 4R5PB 2AX1A 1R0AB 4QWEA 3ITHA 3QGGA 3OLBA 2FJXA 5L1KA 4J9KA 4RW7A 2BRLA 2AQ4A 3QIPA 3GIMA 2HNZB 2QV6A 5DG8A 4J9SA 3VQSA 4DL2A 2GC8A 1C0TB 4RU9A 4MFBA 3DRSB 4LSLB 2WONA 4DG1B 2VG6B 4M95A 2XC9A 2IA6A 4RNNA 3I5CA 1JLEB 4XPEA 2IM3A 4RNHA 4TN2A 4IKAA 2AU0A 4EBCA 1VRTB 1TQLA 4EBEA 4LQ3A 4KV8B 3E01A 2AX0A 3T5KA 1IKVB 1UWBA 4IG0B 4RW6A 4PQUB 4NYZA 3KLEA 2FVPA 4YR0A 2W7PA 3TQ1A 1LW0A 4MK8A 1QAJA 5KG3A 1RT6A 2FJWA 3PW7A 3MF5A 4YMEA 2EC0A 3Q8SB 3BQ2A 4MH8A 2BANB 1C0TA 4Q0BA 2YNIA 2YNGA 2YKNB 1RT2A 1N6QB 2I5JA 2OPSA 4TLRA 4QWCA 2IM1A 1JLGB 4NLDA 4O3OA 1S9FA 4H4MA 3MEDA 1ZETA 1TVRB 2R8KA 1SV5A 1DTTB 3HVTA 4I2PA 3NKYA 3MR3A 5KG4A 4KSEB 3T19A 4YR3A 5L1IA 3IG1B 3KK1A 4RNOA 2W9CA 3KLEB 1FK9B 1NHUA 3M9NB 5C42B 2B6AB 3UR0A 3I0RB 4ZP9A 4IDKA 4QPXA 4ZPCA 3BR9A 3M8PA 1RT4B 2FLPA 1J5OB 5HROA 1T03B 2IAJA 5EWEA 3KK2B 4WZQA 5DGBA 5C5JA 3RB0A 4NLPA 3IRXB 1HMVB 2DPJA 5KFMA 4ED8A 4EO6A 1FKPB 2O5DA 4NLOA 4I2PB 2ASJA 1BQMB 4WFXA 1DTTA 2HMIB 4NLYA 1VRUA 2HNDA 1FK9A 2JC1A 5JXSA 3IG1A 2B6AA 3KK1B 1TV6B 4JV1A 1NHVA 4G1QB 3JYTA 3G86A 3V81A 1SUQB 3N6LA 5KFJA 4ED0A 3CDUA 2YNHB 4HKQA 3MEGA 3H5SA 3IS9B 5J2QB 5KT5A 4IH6A 1JLAA 3C6TA 3KHGA 4LSNA 2IC3B 2AWZA 5EUHA 1EP4A 1S9GA 5D3GB 3H5XA 1HNVA 2RDIA 4ED7A 1CSJA 1DLOB 2WOMB 1S1XB 3E01B 4PUOB 5KFLA 1C1CA 1TL1A 4RW8B 1JIHA 4NLRA 4Q43A 3OL8A 2YKMB 3V6JA 5KFIA 3D28A 4ED6A 5KFUA 2C2EA 2QE5A 1C0UA 1RTHB 3H98A 4NLWA 1N56A 2C22A 3NAHA 4WYWA 3PW0A 3KNAA 3CDEA 5J2QA 3T5HA 4K4VA 3H59A 5EDWA 3MEGB 1JLAB 4LSNB 2FVCA 3M9MB 2ILYA 2ASDA 5KFWA 5T14A 1W25A 1EP4B 3PVXA 1TVRA 4KB7A 3QZ7A 4IH7A 1TKZA 2RF2A 3DMJA 1IKXA 3DOKB 1LWEB 4ZPAA 5KFPA 5F8MA 3BREA 4RNFA 2UUTA 2IM0A 5KFKA 4F4XA 2OPQA 3HHKA 2BQRA 1RTDB 4ID5B 3EPIA 4IG3B 3KLIB 3NGDA 3QYYA 2IAJB 4FS1A 3CO9A 3LP0B 3HVWA 3V4IA 2FVQA 4IFVB 2R2SA 2W9AA 4IRCA 3I5BA 5DGAA 1XR5A 3BQ1A 1FKPA 3QZ8A 1S0NA 3DM2B 4URGA 3UPFA 2OPPB 4I2QA 4LQ9A 2FLLA 4G3IA 4O44A 4HYKA 1KLMB 3OL7A 5EWGA 1I6JA 3V6HA 5K14B 3DOLA 4MKBA 3DRSA 2GIQA 1RT1A 5F8NA 4G1QA 1ZTTA 2WK4A 3H5UA 4RZRA 3RB4A 5KFAA 4RW4B 1U09A 2W8KA 5C24B 1KHVA 2R8GA 2VA2A 4OL8A 2HAIA 3IS9A 4K4XA 1N6QA 3SFUA 5J2PB 3OHAA 4NRUA 1JLGA 4ZVFA 2E9RX 3H2LA 3GIIA 4RUAA 4Y3CA 4I2QB 5C25A 1RT6B 2J6TA 3DM2A 2AGQA 5HLFB 3PW4A 4K4YA 3RBDA 1JLBA 4ECVA 4O44B 3V6DB 2YKNA 2YNIB 4MIAA 5KFYA 4FBTA 2I5JB 5K14A 4J9LA 3RB6A 1JXLA 1GX6A 3QGIA 3H4BA 4ED2A 4RW4A 3D5MA 4Y2CA 2FLNA 2IMWP 3KJVB 1S97A 1REVA 3NBPB 2D41A 5L1JA 4DL3A 1RTIA 3QO9A 5F8IA 4EBDA 3MR2A 5C42A 1RYRA 2OPRB 4O3PA 2VG5A 2XGPA 4ZPBA 3BQ0A 5DQGA 5KG6A 5C25B 3MR6A 3DMJB 2HNYB 1RYSA 3G6VA 1S1WA 3DOKA 3CJ0A 3Q8QB 1S0OA 5KG5A 2RKIB 2HWHA 2XI3A 3LANA 3KHLA 1RAJA 3KHHA 5J1EA 4I7FB 4FBUA 5KFTA 2HMIA 3DLEA 2B43A 3DRPB 2IBKA 1IKWA 4MK7A 3PR4A 2XWYA 1TKTB 4U7CA 3OHBA 3BGRB 1OS5A 4URSA 3T5JA 5KT4A 2JEGA 3CJ5A 1KLMA 5HBMA 4NLGA 1EETA 1HNIA 3KLFB 3EZUA 2ALZA 3C6TB 1RT3B 5FDLA 2IC3A 1KHWA 5KFDA 1S9GB 5D3GA 2YNFB 4ZHRA 1HQEA 3DYAB 4YP3A 4IRKA 5DLGA 2WOMA 1LW2B 2I1RA 2W9CB 4RW8A 2AGOA 2RDJA 1R0AA 3GV8B 4K4WA 1TKTA 4NZ0A 5KT7A 1JKHB 1S6PA 1XR6A 3PHEA 3QIDA 2UUWA 4ECZA 3QIPB 5KFHA 4RW7B 5HLFA 3LAKA 2OH2A 1WNEA 3CWJA 3QGHA 3GV5B 3M8QA 1TP7A 4NLVA 3JSMA 4R8UB 5DLFA 2ASLA 3LAMA 2UVRA 1TKXB 3ICLA 5F9LA 4ZVGA 2ZE2B 4KKOB 1HMVA 2YNFA 1NNDA 1DTQB 1D1UA 4FS2A 4J9RA 4NCGA 1TL3B 4JV2A 4EYIB 1T94A 3C6UA 4ZP7A 4RUCA 3EPGA 4DL7A 1VRTA 3PZPA 1IM4A 4O3RA 2HNDB 3GIKA 1RTIB 3QO9B 1UWBB 4O4GB 5KFRA 3V4IB 1N48A 1Z4UA 4IFVA 5KFOA 4YR2A 4K4TA 4ECSA 3SFGA 4ECYA 4K4SA 1HPZB 1YVFA 2E9ZA 1JLQB 3GV7B 5KFZA 4O4RA 1S1VB 3JSMB 5KG7A 3DI6A 3CIZA 1S10A 4NLQA 2ZE2A 1DTQA 1K1QA 1RT2B 4WZMA 4NCGB 3MEDB 4IFYA 4TY9A 4I7FA 3TAMA 4J9NA 3C6UB 2IJFA 3MFIA 3DDKA 3H4DA 4B3OB 3HVTB 3QLHA 1JLFA 4RW9A 5HP1B 4O3NA 1FKOB 2ZD1B 4GC6A 3ITHB 2V0NA 3I5AA 1S6QA 1HARA 1RT1B 1C2PA 4J9MA 4Q8FA 2BE2B 5KFVA 4ECQA 4J9OA 2C2DA 3BGRA 5C24A 4DEZA 5F8LA 3FFIA 4F4YA 4DL6A 4WFZA 3RAQA 4ZVEA 1EETB 1HNIB 4MFBB 5I42A 2VG6A 5FDLB 2JEFA 2CKWA 3LP2B 3CJ3A 4TYBA 3PW2A 3NL0A 1HQEB 3DYAA 4Q45A 1JLBB 3PW5A 2CJQA 4QW9A 1GX5A 2D7SA 3KOAA 4WE1A 2R2TA 4ZVHA 2ZD1A 2AGPA 1N4LA 3OSPA 4JV0A 1RT5B 2OPQB 3KLHA 1S6QB 4PWDA 4ID5A 4KAIA 3JYTB 4IG3A 1RA7A 2BE2A 3GYNA 2YNHA 3V81B 2R2UA 4IH5A 4J9PA 2R8JA 2UVUA 2HNYA 5KT3A 3DLGA 2DPIA 1S1WB 5KFGA 2C28A 1RA6A 5KFQA 3PJWA 2OPSB 2RKIA 1RT7B 1RTJB 3Q8PB 2VG5B 2J6UA 1QE1A 1HYSA 2R8IA 5KFEA 3RB3A 3FQLA 4TY8A 4IQXA 3DOLB 4ECTA 3IGNA 3FQKA 4WE1B 5KFBA 4PWDB 1C0UB 1RTHA 4QWDA 4R0EA 1RT5A 3KLHB 3IGVA 5KFSA 4MK9A 2WTFA 5HROB 2IJNA 3G6XA 3N6MA 2B5JA 3DLKA 3M8PB 5KFCA 5KFFA 1J5OA 4TQRA 4KBIA 1T03A 1C1BA 4ZP8A 2VG7B 5J2MB 4EO8A 5F9NA 4YQWA 1QUVA 3I0SB 2WHOA 3GILA 2XCAA 3IRXA 1N5YB 5CYMB 1QE1B 4O3SA 3RAXA 4Y34A 2F8EX 5I3UB 3TAMB 5L9XA 4TY8B 4GC7A 4ZMMA 2XI2A 3QLHB 3BJYA 3V6DA 1RDRA 1FKOA 3LP1B 4ECWA 3OL6A 3ISNC 1LWEA 1LWCA 4K4UA 3FRZA 1JLCB 1S4FA 2JEIA 1SUQA 2D3ZA 1C1BB 3CJ2A 3Q8RB 3KLVA 1HQUA 4KFBA 2OPRA 3CJ4A 2E9TA 4ZP6A 1N5YA 2JC0A 3LP2A 3N6NA 2OPPA 5KT2A 4F50A 3BSCA 3CVKA 5KFXA 4PUOA 4ECUA 4WFYA 1S1TB 4O4GA 1DLOA 1T3NA 3H5YA 3G6YA 1TKXA 4Q8EA 4KKOA 3I0RA 1MU2B 1JLCA 3TVKA 4K50A 4IDKB 3HVAA 4TQSA 1LWCB 3MFHA 1TL3A 3MTKA 2FVSA 3RBEA 1RT4A 1T05A 2HNZA 3DLEB 1SH2A 4WXOA 3DRPA 2BR0A 1IKWB 1S48A 4ED1A 1RT7A 4IR9A 4IFYB 1SH3A 4O3QA 1HYSB 4Y2AA 4H4OA 4B3OA 2W7OA 1VRUB 2FJVA 5J2NB 4IG0A 4IOBA 5DQIA 4ICLB 2V9WA 1MU2A 1S1UA 2W9BB 1LW0B 3HKWA 3T1AA 4Q44A 4F4ZA 4ZHRB 2WRMA 2J6SA 1ZTWA 4EYHB 2B5JB 3DLKB 4J9QA 2VA3A 4NRTA 1T05B 3IN5A 4NLUA 3KHRA 1LW2A 4KV8A 2VG7A 1IKVA 4RW6B 3LP0A 5I42B 5J2MA 4PQUA 3I0SA 1XR7A 2IM2A 1IKYA 4X2BA 4XPCA 1S0MA 4K4ZA 2XGQA 4ECXA
chains in the Genus database with same CATH superfamily
2ILZA 4QW8A 3BKUA 2ZH8A 4H4OB 2W8LA 1S1XA 4DV6J 4GMKA 3PR5B 1UVNA 3NMAA 1MMLA 2R7UA 1NPKA 4DL4A 4ICLA 3WIVA 3HP6A 1S1UB 2HFUA 2XEXA 2OO4A 3EM1A 3JTPA 2R7XA 5J1EB 4UOGA 4DV4F 5IV3A 2RAQA 5D15A 1MROA 1UKUA 3GG1A 1WKJA 5J2PA 4H54A 3CJKA 2ZJPQ 2XZTB 4F02A 1ZOTA 2ZH2A 5ETSA 2OEKA 3OVSA 1RAIB 2CA9A 2Y0SD 3OSNA 4H4KC 4LRDA 3M6UA 1SQGA 5E3QA 2ADBA 4MT1A 4TXSA 1FVSA 2IJRA 2W2QP 4WPAA 2GVDA 1CBKA 4OQJA 1S1TA 1NBEB 1X4EA 2CG8A 2HWIA 3V5RA 4DXLA 4LF4F 2Z4PA 2XS5A 1FJGJ 2DR6A 3WHIA 3ILJA 2J9DA 4WXWA 3THVA 3UDVA 4ETZA 3VAHA 4MKYA 3MHYA 2V4RA 1RWUA 1PGZA 1QAIA 3AA8A 1REVB 4C97A 2HVHA 1BQNB 4RW9B 2H1YA 4N76A 1MWZA 1MROB 1WHXA 4DCOB 2QMWA 4DX6A 2KG1A 4DL5A 2BDPA 3TNVA 2FVRA 4QWBA 1JKHA 1FWPA 4F4WA 1X9MA 3CC4S 4ZPDA 1P8GA 1RZMA 2CQ1A 1HBOB 1T0TV 2V68A 5KFNA 3OVAA 2BANA 4Q0BB 2UU9J 2D1CA 1YWXA 2GQ2A 5CZXA 5DJBA 3T5LA 3TARA 1RLDA 3GIJA 1I1GA 2IBOA 5CYMA 3R2CJ 1SV5B 2WVBA 1XK8A 3PACA 4IO9Q 1RWVB 4DR6F 1S9EA 4JBCA 4DU8A 3PFEA 2EK6A 2UVWA 5E0OA 2HLUA 1AFIA 1S7IA 3N4WA 4XDDA 1D0EA 1SKRA 2KI2A 1HI0P 3QRRA 1IKYB 2EFPA 3OL9A 4CLKA 4ENOA 5HI7A 2VBZA 3F41A 1HNWJ 1VIXA 2G4BA 2GFFA 1X4FA 4NLXA 3S1TA 3R5DA 4OZ1A 2RJZA 3PY8A 4JI7F 4DG1A 4DCPB 2MZRA 3QJLA 1PC5A 2C42A 3B6BA 1IR0A 4MIBA 1RTDA 1UTAA 4UQGA 3TZYA 2DIUA 4OYPA 2V34A 5F8JA 2JEJA 4C7QA 1UPPA 4ZLNA 4OHXA 3TX8A 5GVQA 2CXEA 2RILA 2E5HA 2HVDA 4KO0B 1HNZF 2M8HA 2W01A 1HNWF 2AX1A 1KONA 2W4CA 2CG4A 2DGSA 4QWEA 2E5JA 2XWXA 3D0IE 3QGGA 4P7TA 3OTOF 2BKPA 3OLBA 4YHHF 2OFHX 4HI1A 4JI2F 3QIPA 2DHXA 3KDOA 2HNZB 4GKJJ 3VQSA 1PJ6A 3NCQA 4C48A 4LSLB 3MM5A 3FBFA 1LK7A 1U02A 4MKVA 4AXJA 2XMAA 1F9FA 1YJTA 1X31C 2Z57B 1F5AA 1U1LA 4X65F 2AU0A 4LQ3A 4IKAA 3NNCA 2PC6A 1VRTB 3HVRA 2CJKA 4OZ5A 4PQUB 1UWBA 1IBKJ 4J9VA 1DHMA 2QEXS 1HLWA 3GR1A 2W7PA 1RHUB 3TQ1A 2BM1A 2R4FA 1Y5LB 4IOAQ 3C8YA 1R0BG 2GCFA 3ISZA 3BQ2A 3J80Y 3W8PA 1C0TA 4QIVA 3O5TB 3M2UB 2OPSA 3L09A 2F4VF 2BJ9A 2IM1A 1M0SA 4NEYA 3TP2A 2POKA 3UN5A 1Q8BA 3PV8A 4F4AA 3MR7A 1KQKA 1C4CA 2HW3A 1D9FA 3I4HX 4OIXA 4LF4J 3HVTA 4I2PA 1W26A 2MQOA 4JB8B 2CPZA 4YR3A 2FGOA 4K0KF 2W9CA 4LRFA 3KLEB 2V6AA 3TJ9A 4DZDA 4DSIA 4M1KA 1JNRB 2V63A 2UZAA 4NMLA 2KRRA 3G87A 2PFDA 1RHQB 3BR9A 3M8PA 1RT4B 2OUGA 5HROA 1J27A 2DCLA 3QT7A 2EG2A 2BUNA 3PYFA 4J9UE 2JVRA 1XBWA 2H65B 4FPRA 2W1BA 4OX7A 4P71A 1F2HA 3W5XA 4RBTA 5C5JA 2CVIA 1BMQB 2C3UA 3H2UB 1V3SA 4HVZA 5HATA 1N0UA 1KBRA 1WEZA 2XSJB 4EO6A 1M5VC 2KTQA 4B9TA 1YZ6A 4M8LA 2DGUA 1H7XA 2JNJA 1BHNA 3LF0A 1Q86T 4K5RA 2HNDA 2MTLA 4M5DB 2YH1A 2B6AA 4ANEA 1HBUB 4LREA 1D9DA 2NSBA 1FESA 1G6BA 3AJ2A 5BYSA 1MN7A 3HSGA 3JYTA 3FBBA 3G86A 4NYOA 1KR4A 2OGUA 2RRNA 3CDUA 4A8YA 1Y10A 5HL7Q 3P3DA 1H2VZ 4LJMA 1X8DA 3HMJG 5KT5A 4IH6A 1JLAA 3C6TA 1U0HA 2YPYA 1EP4A 5D3GB 2DRDA 3SCLE 1S57A 1Q5VA 3RR7A 1HNVA 4MMOA 4R0JA 4ED7A 4ED4A 1CSJA 3VF0B 4NA1A 1S1XB 4PUOB 3SBMA 1TL1A 4DR2J 2YKMB 3I82A 1DY3A 1WF0A 5E3CA 5KFIA 3PYEA 5KFUA 1ROFA 5JVHQ 2D3O1 1VBZA 1N56A 4LFCF 4LIWA 2MKJA 4ELVA 1TL5A 5EDWA 3JTOA 3VQTA 2MHNA 2UUBF 4LSNB 3TVZA 4JI5J 1YIJS 1LV5A 4LFBJ 1X9SA 4A4JA 2YY3A 4OZ3A 3IRWP 4YB1P 4DF8A 1TVRA 2EPIA 2P5VA 3BH6B 3PEJA 2FD2A 1CLFA 1KN6A 2CPFA 2CPDA 4ES1A 1LWEB 4FKYA 3CC2S 2MZQA 2C2NA 5KTQA 2UUTA 2IM0A 3B82A 5KFKA 3A13A 2J0QD 2MQPA 3HHKA 2BQRA 1RTDB 2OD6A 4G65A 3EPIA 3UVJB 2KFYA 3POTB 3HM9A 2OIHA 1U2CA 1S77D 3GE9A 2MXYA 1U7LA 1WUUA 2IY5B 5G4DA 5IOLA 1CJVA 4BC7A 3QT8A 4V1Ak 3HVWA 1A7GE 5DM6Q 3CMES 2DKOB 3EGWB 5DGAA 3HPOA 1XR5A 3PDNA 3BN4A 3BPDA 3BQ1A 4DV3F 1S0NA 1T7PA 4URGA 2OPPB 3EVWA 1VHFA 4G3IA 1NDKA 2OP5A 3CCTA 1IXKA 5K14B 3VHQA 2BW7A 4USIA 1U1NA 2ZC4A 2QGFB 3D6FB 3UCUP 1RT1A 4DV1F 5F8NA 1ZTTA 4UZCA 3H5UA 4LT6A 3I87A 4RZRA 2IRUA 4JI8J 3BBBA 1IBCB 4JP8A 3TUJC 4YUDA 2BVZA 2C3OA 2Q43A 2H51B 3BKTA 7FD1A 2LQ5A 3OHAA 1OO0B 2QLWA 2CQCA 4P10A 3C16B 4Y3CA 3P6YC 5C25A 2FHJA 2BEFA 3K5NA 2AGQA 1JXVA 3RBDA 1JLBA 4ECVA 5CCMA 5DDRC 2H48B 2YNIB 3KJNB 4MIAA 4FBTA 2I5JB 3PXGa 2ZBPA 2Z2LA 2IIHA 3SQOP 4DFPA 1GX6A 2GNKA 1FRIA 3W66A 2UXCF 2ZH7A 1W7WA 2CZ9A 4BHQA 4C8OA 2HGNA 2VH7A 3QWPA 4Q5VA 3NBPB 4OYIA 4LBHA 4U67Q 1NKEA 3CCES 2JSXA 3LH2S 4DL3A 4QU6A 1GH8A 3GMGA 2MMYA 1MW7A 2QX0A 5C42A 1XEZA 4DSFA 4DUYF 3CDAA 5KOWA 1V6HA 2XGPA 1LEOA 2ZVSA 3MUTP 5DQGA 2V4JB 1CJKA 1O0PA 2XZDB 4OX6A 1XNRF 2B4PA 1S6OA 4H4KA 1O5JA 4OHWA 2K3IA 1S1WA 3MD1A 3CJ0A 3T3FA 1M90T 5A0YA 5K8NA 1P9QC 2RKIB 1YK9A 4F7VA 4DR4J 2XI3A 2FHKA 3BZQA 3PFOA 4FZVA 3OJUA 1K9MT 2C3YA 4I7FB 1N88A 4FBUA 1EHWA 1FWLA 2D74B 2MLYA 3DRPB 1R6YA 3EGZA 2GGPB 4MK7A 3BN7A 2B4VA 4PXDA 5EGYA 1KSPA 1TKTB 1PAEX 1YJWS 2GHVC 5AXLA 3OHBA 4LF6J 3L7PA 2HZAA 1KS2A 5KT4A 3J7ZT 3PKMA 4Z7YA 3KLFB 2X51A 1L3UA 1FFWB 3IR5B 5FDLA 1G7CB 4WZQA 5KFDA 5D3GA 2QT7A 2K7JA 4ZHRA 1UZHA 2M3DA 3CCWA 4HTJA 2GHWA 2XMVA 2DH7A 1MWQA 1RHRB 3IM9A 2AGOA 1BWEA 2DEIA 3U7JA 1TKTA 3LGHA 3MAAB 1R8AA 1S5ZA 5GMEA 1JKHB 1X5SA 1XR6A 3DKDA 3QIDA 2MQ8A 4U96A 3K5MA 1H3DA 1MLAA 1OMSA 2M5YA 4W92B 4RW7B 3PX0A 3LAKA 4KGXB 4PPZA 3CWJA 3QGHA 3GV5B 3MMCB 2OH2A 4R8UB 4BS2A 3JSMA 3P45B 1UA0A 2UVRA 1HW8A 4CLFA 5F9LA 1HHSA 1D1UA 2YNFA 1FFSB 4EYIB 1T94A 2QL9B 4KY3A 4ZP7A 4ANDA 4RPFA 4RUCA 2ZH5A 3HHNB 4ZPTR 2J8AA 3AA9A 2J9EA 1RCOB 5KFRA 2MSTA 4A47A 3JS9A 3MTJA 5D78A 2P2CB 3EICA 1CULB 3UDEA 4CO1A 3CEDA 2NXUA 5KFOA 4K4TA 4ECSA 1N36J 2EBGA 1I5OB 3UWTA 2AIRB 3CW2C 1VBKA 4DV6F 2Y1IA 2XMWA 4HHHA 1I3OB 4O4RA 2FJAB 1UJ5A 4M5GA 5DZ7A 4F0HA 3G2XA 4X64J 1KVJA 1F1BB 5KG7A 3K5PA 4BDPA 1Q8KA 2VQFJ 2HBZB 1VFJA 1RT2B 1E6VA 3S7RA 6AT1B 3NGUA 1Y7PA 1DRZA 2B51A 1A0OB 1Q16B 5SUHA 4Y00A 4I7FA 3TAMA 3MFIA 5A2QY 2VBYA 2ZUAA 3HVTB 4FP9A 4RW9A 2ZOGA 2EKNA 4USVA 4CM2A 5HAOA 1XMQJ 4ZS6A 1L3TA 2QN6B 3FK4A 2Y3YA 1OQ6A 1L5UA 1OY8A 1S6QA 1UZDA 1RT1B 2VBWA 3HKZD 2BE2B 5ETMA 3KG0A 3RAMA 3FKBA 1ZM3A 4L72B 2JLGA 5F8LA 2YXLA 3SCKE 3FFIA 2CUYA 4DEZA 4X4OA 4WFZA 3P5TL 1HNIB 3K89A 5H9EK 4XK8C 5L39A 1S6UA 4USTA 1SJ3P 4B9UA 1UJ4A 5IWAF 2OMLA 4D3HA 2LA6A 1RXOB 3O6QA 3J81U 2NQPA 2LXIA 3KOAA 4WE1A 1FEHA 2H9ZA 1NSQA 1QTMA 2LQBA 3DXBA 2BACA 4PWDA 1T3OA 3KJFB 2HVEA 3KUGA 4IG3A 2QMXA 2BE2A 2R8JA 4ELUA 2MHEA 1UW9A 2MQNA 4NA2A 1YJRA 4PXCA 4ZVPB 3VTIA 1RB0A 4A8QA 1U45A 1SKSA 5JVGQ 5A8WA 5HVGA 5A0YB 3AY0A 3PJWA 2VUGA 2Z56B 3BB5A 1RTJB 4LIRA 5HMWA 3Q8PB 1DJ0A 2VIHA 3Q8YA 2ZNZA 3TUIC 3F44A 2WVFA 1MMNA 2J6UA 1VDHA 2I9SA 5DDOC 5FLXY 1V3RA 1YBTA 2XSFA 3GYGA 3RB3A 2GHPA 3FQLA 4ZCLA 4WFAQ 2L41A 1ZYQA 3W2WA 3CCMS 3R7BB 1U47A 4GKJF 3AQOA 2X3GA 5CABA 3FQKA 4WE1B 3J7YI 2FGCA 5KFBA 1N54B 2JRSA 4FXWA 4M5NA 2Z58B 1BLUA 5KFSA 5D4OA 5HROB 2IJNA 3M8PB 3U1MA 2CQHA 1HNZJ 1T03A 1B4SA 5J2MB 4YQWA 3E2EA 3GILA 3RBXA 5IV4A 5CYMB 2IYIA 1UAWA 2L48A 5ETPA 1VC6A 1KVIA 5IQ6A 5I3UB 4HHJA 3E3XA 5L9XA 1UJ6A 4GC7A 2FYXA 2XHCA 2JOQA 3PRDA 3K8VA 1ZAXA 3V6DA 5ETLA 3JAMU 4ECWA 3OL6A 3G9CA 1NH8A 1V5IB 1LWEA 4JI6J 3NS6A 3I4PA 3W5ZA 1B3TA 3PG9A 1UVIA 2ZJQQ 3NCRA 4DCJB 1SUQA 4NWBA 3PTWA 1C1BB 2JFKA 3EXCX 3HD1A 1BGXT 4AT1B 4BCAA 3KLVA 4RL1A 4RU2A 5E3AA 2KHDA 1TZ0A 1EQ0A 4DR6J 1UW4A 2G9OA 2OPPA 2MKCA 4N8NA 1OQ3A 3BDEA 3A3NB 3CVKA 1TKDA 1S1TB 4O4GA 2O01C 2NR0A 5ETTA 1WEXA 3H5YA 3KJQB 1ZH5A 1XWLA 1AW0A 3I0RA 1WORA 5GMDA 3FBCA 4TQSA 1LWCB 1TL3A 1T9UA 2GVZA 2P9EA 4KIAA 2B8PA 5M2UA 4NCBA 1SH2A 2PFFB 2ZJRQ 4WK3A 1FTRA 2EC2A 2PI5A 1WKKA 4PXBA 1Q7YT 4DZ6A 4ED1A 2X1BA 1N34J 1RT7A 1KQGB 1HBMA 3VAFA 1VCTA 2AJ0A 2FY8A 2ZC3A 2E1RA 3MCOA 4UW2A 1SH3A 4WTOB 1I94F 3KYLA 4X66F 2FJVA 3M30A 3A8EA 3EVOA 4OZNA 2MGZB 1IR1A 2MKIA 1OPIA 3P49B 2V9WA 4K59A 1S1UA 3K0JA 3HKWA 4CLYA 3SCIE 2GVZB 4Q44A 1HW9A 2IRYA 3J81Y 3JSYA 2B5JB 1S79A 2KDOA 2FUG9 3NGTA 2FHJD 2VPWB 2U2FA 3GU0A 4GVLA 4OX8A 3IN5A 2XY6A 2HBRB 3D6HB 3OBIA 2AJ2A 1IKVA 3LP0A 1YQHA 7FDRA 4FVCA 1SI9A 2PIIA 2QLBB 2X1GA 3MM8B 4N7TA 1GNKA 2HFVA 1JK9B 1RWKB 3GB0A 2XGQA 1U1RA 1VS3A 2Z8QA 2EFOA 3D67A 3ZNJ1 1HD1A 3OV7A 1RWMB 2ZOFA 3I32A 4WTYA 4DI6A 2ZH6A 3AB4B 4B9NA 1C1CB 2CPHA 2R2RA 3OR1B 3PJXA 1IR2A 1RADB 2V2ZA 4NCAA 3TAPA 2WCXA 3TR5A 4QQBA 1Q53A 4C0HA 3LQVA 2V8GA 4DSLA 4PR6A 1ZM4A 3MI7X 4L74A 3AD7C 1WHWA 2XCPA 1DFDA 4CYUB 1W2IA 2LXUA 3HI9A 5F8GA 2JZ5A 1X4CA 3TEHB 4F26A 9RUBA 1Z2LA 3JQMA 4OYOA 3NNAA 3KLGA 2C2OB 1X4HA 3CDWA 5DQHA 4XO0A 4AE5A 3LALA 4KHRA 8RUCA 3MUVP 1S1VA 1CG2A 2CNOB 3DI6B 1WI8A 3KLFA 3AFGA 3KK2A 2H5IB 2BQ3A 2AT1B 3SMZA 4UOCA 4USUA 5CCLA 4ILMA 4EU0A 3EGVA 3KK3A 1CJUB 1P27B 3NBPA 1KWMA 5CYQB 1KFDA 5LL6d 4DQQA 4EEYA 5J1PA 1RHKB 3KLIA 5KAKA 4LFAF 3FEYB 3SQGA 1LWFA 3MECB 1HL6A 2WB1D 3BEGB 2AEJA 2V50A 3QT5A 4PABA 1Q8LA 2IPOB 1NPPA 2HS4A 3H42A 2FPHX 2MLXA 3GPAA 5KG1A 5KT6A 2UXDF 4BWJA 4DPYA 3OLAA 1IQTA 1Q79A 2RB7A 5I3UA 2EXUA 2GVDB 3PO5A 2OMOA 2D69A 5KG2A 3LWLA 1CC7A 1X0PA 4ZCIA 1HHQA 4NXNJ 2VDHA 2VZ9A 2G2YA 2D3OR 4F8RA 4QZVB 1K0TA 3K58A 1HBNB 3RRHA 1TAUA 4O0IA 4GKKF 4KH0B 2V4QA 2QFJA 4FVMA 3J7A1 3MEEB 2ZUGA 1U25A 4P2MA 3GCWP 4QPTA 4EZ9A 1RHJB 2F65A 5CZVA 3MAHA 2BABA 3BGFA 5A8RA 4U95A 1NK8A 4KGZB 4G1IA 3BSAA 3L3CA 1DURA 3R8YA 2CQ4A 1WKLA 5B08A 1HQUB 4KFBB 1YBAA 2P9CA 4LUBA 1IM6A 2XBPA 3B54A 1MMDA 1S9EB 1IBMF 4LFCJ 3V6KA 3POTA 2ZKUA 2AF6A 1MWYA 4L75A 4KGKA 3W5YA 4I67A 4YN3B 2IA0A 2GIRA 3J7YU 1IKXB 4CYUA 3GQCA 4R5PB 3D4JA 3TJAA 3W64A 5HJYA 4DR2F 4CLSA 4Q7AA 2FJXA 1B0PA 2EBEA 2Y8WA 3CC7S 4RW7A 1HWIA 3CMQA 2AQ4A 4JYAF 2N3OA 2QV6A 1BUXA 1FO1A 2EI5A 2HPUA 3CTRA 1B64A 4J9SA 3DU5A 5I3PA 2AEFA 2KB2A 2GC8A 3OXGA 4RU9A 2HRUA 3CB4A 2HQFA 2WONA 1PJ5A 2VG6B 3GSIA 4X84A 3IFEA 1REGX 3LPYA 1NK4A 5B0CA 4XPEA 2HKEA 2B9EA 2DB1A 2W4PA 4TN2A 3CCJS 4K4ZA 3H25A 1TQLA 2M9KA 4KV8B 1R6VA 1LKZA 4CTAA 1IKVB 4FXDA 4IG0B 2KJWA 3RU0A 4DN9A 3RYLA 4GVBA 4AUKA 3C46A 1LW0A 1FRHA 1CPZA 2QG9B 2NZCA 3C16A 1WTFA 2CQ2A 1RT6A 3MGJA 5KG3A 3MF5A 2EC0A 1CQMA 1QY7A 4RBUA 3IM8A 2PA8D 5KFWA 1RT2A 2ZHBA 2I5JA 2HVZA 4UQTA 4QWCA 4LF8J 4WP3A 1HIYA 4J37A 3CPWR 1ZA2B 5H9EJ 1TVRB 1DTTB 1ZZFA 3EJMA 2YBVA 1R8BA 3PNIA 3QATA 4KPCA 4QYRA 4QCLA 2KVIA 4FYXB 2F5GA 3W62A 5L1IA 3IG1B 2DRBA 1FK9B 4CO5A 2PD1A 3M9NB 1YI2S 2B6AB 3UR0A 4F3QA 2MEWA 1FNOA 3KNGA 4DR1F 2W2PP 1J5OB 2IAJA 4Z2XA 1VK8A 2HWTA 3FZ2A 2OELA 2F4VJ 3RB0A 4M5HA 2L9NA 3N28A 3MEKA 4WFBQ 3IRXB 2Y1JA 2OD4A 1HMVB 3VGVA 3NNHA 2DPJA 4U8YA 4ED8A 4FF2A 2KYZA 3CJSA 1LXNA 4NLOA 1UEUA 1NHKL 2BJ7A 3A4TA 4WFXA 2HMIB 2HFOA 2DHHA 4NLYA 4ZN1A 3GJQB 1QSSA 4B3SJ 3RRGA 3TUPA 4XAKA 5JXSA 2DNHA 2CNLB 2RSQA 3U02A 2HHSA 1TV6B 1WC0A 1PYSB 4JV1A 1AA1B 2XMUA 4LF6F 4WU2A 5K8MA 4J91A 3V81A 3N6LA 4JOUA 2GQQA 4NZ7A 3GZ7A 5KFJA 2I38A 4X65J 4ED0A 2AYMA 3IS9B 5J2QB 1O6XA 3EYZA 1D8YA 4Z7CA 1VLYA 3IR6B 1S9GA 1UETA 2KKHA 4OI6A 2DNMA 2JH3A 1QUPA 3P8BB 3B78A 2ATCB 1KRPA 1VMBA 2WOMB 1PJ7A 5KFLA 4Y65A 5CYJA 1C1CA 2KJVA 2VDIA 1VC0A 4NLRA 2DEJA 3CD0A 4Q43A 3V6JA 1XNRJ 5H9FJ 2B4UA 1JB0C 1X4DA 3I56S 2QE5A 2R7QA 1C0UA 1EX8A 1O8BA 1R3NA 2LA4A 3QWUA 4LRBA 5ETRA 4JV5F 4DUYJ 5U47A 3PW0A 2DVIA 2CYYA 3CDEA 4PG6A 3BO4A 1VQ7S 1VISA 3ZTPA 1VOMA 1XQIA 3MEGB 1JLAB 2MQQA 4JI4J 4CH7A 1EB0A 2HEKA 3Q8UA 2A0FB 2ASDA 3ZTQA 2AYBA 5T14A 1UVLA 2XS2A 1CS4B 3NXZA 4CH0S 2XULA 3M32A 2PMZD 4XIUA 4KB7A 2QMUB 1QAYA 4IH7A 1TKZA 4PZVA 2YWKA 4OV6A 4ZLPA 2QA1A 2IYGA 4C8MA 5KFPA 1T02A 2E5IA 3M30B 3D66A 4Z37A 1F2GA 4WJBA 3NY0A 3SXLA 2AW0A 1SJRA 1WG4A 2LCWA 1RCXB 3LGNA 3TEGA 2I2YA 2VQEF 2VODA 2RNEA 1J5EJ 2GMLA 2KVQE 2ZH1A 1YJ9S 2WSCC 2FVQA 1GXTA 2CADA 3ZC4A 4IFVB 2R2SA 4HLBA 2KXNB 1NK6A 4IRCA 3IWLA 1JXEA 1B0VA 1FKPA 2LU2A 1X4BA 4CP5A 3UPFA 3DXSX 2XB2D 3MM7B 4HT7A 4O44A 1ZS6A 2Y0BB 2DGXA 3V6HA 4C11B 3DOLA 1NSAA 3QJPA 4MKBA 4CNZA 1K8AT 5HVFA 3DRSA 2XY5A 3BPSP 4G1QA 1WC3A 2WK4A 4DV3J 3RB4A 4HHUA 5KFAA 1YTYA 2L9DA 5F0WA 4ILLA 5C24B 2R8GA 4CM0A 5GADU 3IS9A 1FJGF 4QR1A 7AT1B 3PX6A 2AJFE 5J2PB 1Y5NB 2HBYB 4ZVFA 3RG6A 3SDEB 3ZNUA 3KFWX 3H2LA 2E9RX 2CZVC 1GQEA 1F3FA 1J2VA 2J6TA 1NU4A 1RWNB 3BGUA 4C8KA 3OR2A 3V6DB 2YKNA 3TZZA 2CWKA 5D8HB 2R7SA 2YX1A 3M2UA 3JQJA 3T9ZA 3RW7A 3QGIA 4ZN3A 3H4BA 4FNIA 2XLIA 4RW4A 4C98A 4KJIA 3KJVB 1SCJB 1KDNA 2BJEA 3TYTA 3T1YJ 1TMJA 2UUBJ 5F8IA 1M1KT 5ETOA 3KTQA 3J80U 3BV8A 3Q8VA 3IC1A 4JI1J 1RJJA 4UF4A 4EWTA 2NZ4A 2HK2A 1NK5A 1YLXA 2GAHC 5KG6A 3OR2B 2LEBA 2MY7A 3G6VA 1NDLA 3Q8QB 4M63A 3UCGA 2HWHA 3GSDA 2HGLA 2VB6A 3DOMB 5FD1A 3LANA 3KHLA 5J1EA 2HHVA 4I6WA 1MSWD 1PILA 5KFTA 2HMIA 3OT9A 3EXYA 1Q8IA 2HFSA 3KUHA 4U8VA 1JJCB 3K5LA 5C2GA 2IBKA 5B7WA 1IKWA 2E7XA 5EHHA 3PR4A 2F40A 3HFVA 2DK2A 1F6TA 2E5GA 3SCJE 1NM2A 3D1OA 4U7CA 5AJ3F 3GJRB 1V3ZA 3JQKA 2WVEA 2GMHA 3T5JA 4URSA 4CQ1A 2ALYB 4DV5F 1EETA 4HH0A 3TI0A 2DIVA 2J7WA 4BC9A 3C6TB 1U0HB 3P5BP 3CCRS 1HNXJ 2EWHA 2IFXA 5HQMA 2A18A 1R89A 2Q66A 2YNFB 1HI1A 1PCAA 3QNWB 2B9XA 2B9YA 2HURA 2FHOB 1HQEA 3DYAB 1YDLA 4RO0A 3WC0A 2CPJA 2WOMA 1LW2B 2I1RA 2WBRA 2W9CB 2E1PA 4RW8A 1NB7A 2PEHA 1R0AA 2VFRA 3C66A 5K8PA 2RDJA 3SDEA 1QLNA 2K7KA 4HDGA 4NZ0A 1S6PA 4CLLA 5THWA 2AHOB 4F36A 2PEBA 2UUWA 4ECZA 1X9WA 3QIPB 4WWSA 2GZOA 1NMEB 3BBCA 5DZ6A 4OHZA 2RIJA 1IBLF 4I0WA 5A8WB 5L8RC 5C2CA 1Q7LB 2XQCA 4ZVGA 2ZE2B 1HMVA 4FKXA 5IT9U 1DTQB 4FS2A 2CZ4A 3DFEA 2KG0A 4JV2A 1XN9A 3PZPA 1ELOA 2GMJA 3EPGA 2OHDA 4E98A 4E8UA 3FNNA 1RTIB 4O4GB 1UWBB 1TMMA 1T9WA 2FZKB 1IN0A 2V2QA 4ZITA 5M2PA 2R7TA 3V4IB 1Z4UA 4IFVA 3D6TB 2FIUA 1VQMS 2K2PA 4YY3J 4ECYA 1XC9A 3W8GA 2E9ZA 2M0GB 1GXLA 3ULHA 3HCXA 2GJFA 5KFZA 3CD6S 3CJRA 3JSMB 1S4EA 3DI6A 3BKFA 4B3MJ 2A3JA 1DTQA 1K1QA 2HQ3A 3UD3P 2X7IA 4NCGB 3MEDB 4Y0FA 4C2MA 5LSOA 1NAQA 5DRKA 1EKSA 2IJFA 4HACA 4HI2A 5FLXU 4B3OB 3CCQS 4JI3J 4O3NA 2EK1A 2ZD1B 2OTLS 1EJ7L 4LR8A 5JJBA 3VALA 2NPIA 4BBYA 3I5AA 3H7HB 1HARA 1C2PA 4J9MA 3MMBB 5KOXA 4KHPJ 5KFVA 3RW6A 2C2DA 3BGRA 5GADI 3IP0A 1HKAA 4DL6A 1N32J 4ZVEA 3WIUA 2K3KA 2CDRB 4WCEQ 5I42A 2VG6A 4UUWA 2QA4S 5LMNF 1XERA 1VQ8S 4DV7J 3NL0A 2DTJA 4WKRA 1FRXA 1HQEB 3DYAA 3ZZRA 1TK5A 1IWGA 4CTAB 1F9HA 1JLBB 3PW5A 2CJQA 4ZVUB 1V5VA 4TU8A 2D7SA 4QW9A 2ERRA 4JI7J 2G2ZA 4ZVHA 2ZD1A 1FRMA 1T9TA 3RUBL 4DF4A 1N4LA 1S59A 4JV0A 1F60B 2BJ1A 3UD5A 1S6QB 3OSPA 2IVFB 3WX8A 4OJGA 2DY9A 2J7UA 1SL2A 3A3OB 4IH5A 3WDOA 5L9NA 5ITHA 1EIYB 2UVUA 2A1BA 3M8ZA 2CPIA 2DPIA 3NG8A 1EQMA 2F4FA 5KFGA 1KNZA 1RA6A 1RU2A 3UD4P 3F73A 2HHHJ 2OSRA 3G8TA 2DNKA 1ZM9A 2VU5A 1U49A 2F9DA 1KFSA 2EKYA 4DX8H 3I55S 2NS1B 1R8PA 1QM9A 3HHLA 4FYVB 2G0IA 3DNCA 4N56A 4QIWD 5KFEA 4TY8A 1NCLA 1FDAA 4FYWB 3KG1A 1GMVA 2BW2A 1X4AA 4DUZF 1ITPA 4QWDA 1RTHA 2H4YB 3BM7A 1RT5A 3KLHB 3IMQJ 4MK9A 2MPUA 2RS2A 2UUCJ 3DLKA 2PO4A 5EN1A 1J5OA 4KQZA 3DDIA 2QYCA 5B0EA 4EO8A 2UUAJ 2VG7B 1K44A 5CH7B 4C0BA 1QUVA 4A46A 4DFMA 1D09B 2B56A 2W4DA 4P7VA 1RWOB 2N82B 5E41A 2M7SA 3UW1A 2R7WA 1QE1B 2JX2A 2RRAA 4M5MA 3RAXA 2F8EX 2K1RB 2H54B 2KH9A 2CQIA 4TY8B 2AZ3A 1X5PA 2XI2A 3P4UB 4WP9A 1RDRA 1FKOA 3NGRA 1XNQF 1VRQC 2LQJA 4LR7A 4EGLA 4JI1F 1UMJA 2DNRA 2HFNA 3FRZA 1VJQA 1ZPVA 4DHVA 1SL1A 3HJVA 2JEIA 2O66A 5L38A 5F3TA 2YKPA 4WKYA 4NXMJ 3HO1A 3BYRA 3QT6A 3QSIA 2CFXA 3Q8RB 3T9NA 5ETNA 2QFIA 2HIYA 2E9TA 4ZP6A 2JC0A 1SQFA 2K1RA 3TUZC 3LP2A 2WSEC 2RUGA 2MKHA 3BSCA 3IBWA 4PUOA 1WACA 4ECUA 2QA2A 1T3NA 3SSRA 3D0GE 2ASYA 3G6YA 3OD2A 4PG5A 1E6YB 4KKOA 4LVOP 3CCUS 1JLCA 1SJ4P 1QAXA 4IDKB 3IR7B 1DZ5A 3MFHA 4IUFA 1RBLA 3RBEA 1SJFA 4DX5A 3DLEB 2BBEA 2DNYA 3TQEA 4CO2A 3DRPA 2NCKL 5HN0A 4AQYJ 2BR0A 1NJXA 1WOSA 1KD1T 3HX9A 1S48A 3U1LA 1SC4B 1UA1A 3JXOA 3ZZTA 4X4VA 4K7QA 4IR9A 5D0EA 4PKDB 1WC5A 1HYSB 3QQCD 4Y2AA 2XLKA 4B3OA 2JVOA 2UUCF 3QAEA 3OUYA 1XMOF 1H72C 1Y3JA 4C3KA 5DQIA 3AD9C 1IJFB 1GEHA 2J5AA 2ZBRA 5D4LA 2W9BB 3ET6A 1LW0B 1TK0A 1FF2A 2MQMA 2MLZA 3T1AA 2WW4A 4X62F 1U1OA 3FVYA 1UEVA 4ITSA 1H73A 2FB0A 4F04B 4EYHB 3DLKB 2E66A 4OZ2A 2VA3A 1WD6A 1T05B 1NDCA 4NLUA 3KHRA 1FD2A 2FDNA 3HHDA 1QVFR 3HJFA 3TA2A 4PQUA 3OTEA 5I42B 1QVGR 1AYEA 4X2BA 2LU1A 1K0VA 3ONQA 1S0MA 1SKUB 1FNMA 3WQPA 4DDFA 5AE2A 5B0DA 2ZH4A 4DR3J 4ECXA 1JJ2R 2FY1A 4LF2A 5J2NA 5DG7A 1M5HA 2QTWA 3FFIB 3BBFA 2UP1A 2VL1A 1TL1B 2JLEA 2HQDA 5T7LB 1FDDA 2VV5A 3ZXWA 4IYQA 3R1HA 1BC6A 3JTNA 3CUNA 2BRKA 2O1PA 1LFPA 2AJQA 2JJ4D 1JQGA 3T1HJ 4DV7F 2HFZA 4KO0A 4F67A 2HGMA 2GAGC 2HLTA 1RK8A 2ACYA 2DXFA 3H0PA 4RUHA 3MM9B 2XO6A 4DV0J 2BQUA 2DR9A 1EARA 1ZA1B 4MTPA 2XSJA 3R2DJ 1KP6A 4ZJLA 2GJIA 1BQMA 1ZAWA 3HSZA 4OV1A 1WOPA 3M9OB 1T9XA 5L1LA 3MWBA 3VZHA 2WB4A 4M5DA 2C3PA 5LMUJ 3MM6A 1TV6A 4B9LA 1NZ8A 2H5EA 2VFVA 3R5JB 4GRSA 4JI0J 1QTNB 1T9VA 4WP8A 3E51A 2ZEJA 2BM0A 1JLEA 3OJSA 2OSQA 4K8RA 2J0XA 1BQXA 3JSRA 4KRWA 3UDLA 2YH0A 2DITA 3F0NA 5JUMA 3ZZPA 2PDAA 2LEAA 2YWFA 4B17A 4NLSA 1DBDA 4DV2J 3CSKA 1HNVB 2R8HA 2C2RA 3ETMA 3R5BA 3DRRB 4B3TF 3TZWA 4B3SF 1XMBA 4RNMA 1NK7A 2E1MC 2YNGB 2DO0A 5K5MA 1H7WA 2HRTA 3ZTOA 4FXVA 4YY3F 4DR5F 5DM7Q 1M5OC 3DOMA 1FDBA 5LJ3Y 5DG9A 4KE5A 4H4MB 1NSPA 2ZOMA 1GT8A 1VYAA 3FMBA 3KUEA 3VAKA 1TFYA 3S01A 2ZKTA 4LF9F 1RAFB 4UTGA 2DGQA 2RRBA 1LWXA 3ISND 3H40A 1YITS 2MKSA 1DARA 4M94A 1IVZA 5IT0A 3R27A 4USWA 3R97A 3U27A 4QWAA 2DGWA 2QSWA 1JLQA 2CQ3A 1PIEA 5B0GA 1KVKA 1HPZA 1LOUA 2PA3A 1URNA 2ZBCA 1KOOA 3BSNA 4KTQA 2AMCB 2YQ0A 4A48A 4ED3A 1RT3A 1EKRA 3WZ0A 3TVYA 6FD1A 1RTJA 4NASA 2ZM6J 3QBCA 1RAAB 4CLTA 2NYHA 5D4NA 2YQ3A 1U2RA 1WEYA 5HQLA 2ATLA 1X5TA 1JX4A 1UPMB 1TKZB 2UXBF 4ILRA 1WG1A 1Y4ZB 2JWNA 3NAIA 5DS7A 3KDNA 3HHLC 5HP1A 4KR0B 4AYBD 3QJJA 1R0AB 4B9MA 4LMZA 2NUHA 2VONA 3ITHA 2ZWOA 3O1LA 1AT1B 1U4BA 2DBBA 2E5LF 5L1KA 4EZ6A 4M5KA 2W25A 4OYZA 3GIMA 3SV3A 1TL7A 2V5HG 1UVKA 2DXDA 3QMQA 5EX3A 4BWMA 1F5CA 5GMKa 5DG8A 3CJTA 4DL2A 5E33A 1PO6A 1C0TB 1V9OA 4QIFA 1RAHB 2MSSA 2R7RA 3CDBA 3DRSB 2DNZA 4HH1A 1PBUA 4M95A 2CNKB 3EE3A 2DGTA 4N8OA 4RNNA 2IA6A 3I5CA 3KG4A 3KXDA 4PPDA 2IM3A 4IO1A 4L6V3 1VQKS 4DSKA 2FJEB 1DAXA 1UL3A 5D0RA 1L3SA 2AX0A 3A1YG 2OFGX 2X1FA 4NYZA 3Q89A 1RE1B 2XY7A 2FVPA 2APOA 2CDQA 2KO1A 2KN4A 3UI3A 4ZLLA 3W3SA 4MK8A 1QAJA 1LXJA 5D6GA 4UY85 2VKRA 4NI2A 2LLZA 3O3LA 4OYMA 3Q8SB 4PXEA 4WIIA 2BANB 4Q0BA 5KFQA 2YKNB 2YNGA 1IBMJ 4MIWA 3MOZA 4A8MP 3N79A 3TANA 1JLGB 1G3OA 1E6VB 2XNQA 5LOQA 4RLEA 4H4MA 1S9FA 1OY9A 1SV5A 5F0UA 1RAOA 4U7UD 3US5A 2J76E 2MZSA 2V8PA 3DC2A 3MR3A 1HA1A 2QLJB 4KSEB 4F2SA 2J9DE 3NS7B 3KK1A 1FXDA 5E3PA 3M8RA 3IO1A 2OI2A 2VC1A 3DGVA 4Y2MA 4OJ1A 3I0RB 3BS9A 4A8KA 3EZOA 2DYAA 4QPXA 4DQSA 3DLLQ 3WC2A 1PC4A 2FLPA 2NPFA 5GAEI 1M5PC 4USHA 4U9RA 4C6AA 4DOZA 1HR0J 5EWEA 3W60A 4OHVA 1P9YA 5DGBA 2DHGA 4USKA 1HWKA 2FJBB 3K5OA 1NJZA 1N52B 5KFMA 2H3EB 3G82B 1HI8A 1FKPB 2ZH9A 2ASJA 4NXNF 1DTTA 3MD3A 1FT8A 2XMMA 3EMTA 3VAIA 2DISA 1SJQA 3KK1B 2CJYB 1RABB 1Y5IB 1FX2A 3QRPA 3FSYA 2A6OA 2HZVA 2DNLA 3IAS9 1RKIA 3N01A 1WHVA 4YEAA 4HKQA 3CJ8A 2FZGB 2SXLA 3HXMA 2P6SA 2HG4A 4PYAA 1XMQF 3KHGA 2NLWA 2AWZA 5EUHA 1AZSA 3DN9A 3H5XA 3Q86A 2RDIA 2MJUA 3M32B 4OYAA 1SJ1A 4P2XA 4ZCMA 2HRYA 4OMFG 5HMXA 5CD4A 1DLOB 1JJHA 1H98A 2DH9A 2RH3A 5C7PA 5DLFA 2VOPA 3OL8A 4RW8B 1JIHA 4OZJA 3D28A 2K06A 1OYEA 1Q81T 2QYGA 3H98A 4EFAC 3MMBA 2HBQB 2B0GA 3I9V9 1X5OA 2EG1A 3TJ8A 4LF5F 3T5HA 4IOCQ 4K4VA 3H59A 3UN3A 3M9MB 3GYXB 1A9NB 3BF4A 4Y6IA 1W25A 1X7VA 4OI1A 1CVJA 1EP4B 3PHTA 4P52A 1HR0F 3HFKA 3R1LA 4OX9J 2RF2A 2XLJA 3DMJA 5E5NA 4JV5J 2DNNA 1U8SA 3MMCA 3OFFA 3DOKB 4NEZA 3RTVA 4ZCKA 2IVMA 5F8MA 3BREA 1H2UX 3UNYA 3CE8A 4RNFA 2OPQA 3NP5A 1RSCA 1R8HA 2IVYA 1LQ9A 2V8VA 4G1PA 4CNYA 3AJ1A 5LM7E 4DV4J 1VHIA 4FS1A 3CO9A 3GTYX 2NXJA 3HLUA 4D3GA 3HF5A 5D77A 1PG5B 2RE1A 2OJ3A 2K8GA 1FA0A 2AEMA 3QZ8A 3NOGA 3LWMA 2FLLA 4I2QA 3CXCR 3C19A 2ROGA 1WI6A 3MMJA 4ZVTB 5M2RA 1M5KC 1NDPA 3OL7A 1XTZA 1I6JA 3TRGA 4PG4A 5RUBA 2RMLA 2QLFB 2RD5C 5F3ZA 3BYPA 4DQPA 4LBPA 1JMTA 3MPDA 3PRVA 1N34F 2UV8G 3FRYA 4RW4B 1U09A 3A12A 3D3BJ 3SSSA 3ENQA 1QJHA 2W8KA 2AV5A 1IWAA 2MZJA 3N0VA 4ZDNA 1RBOB 1S99A 3CJKB 4K4XA 1YJNS 5LSLA 1N6QA 1WHYA 3SFUA 1CJTB 3DRXA 4DR7J 4NRUA 1JLGA 1FI4A 1NEEA 1T9YA 3D54A 4ZVQB 1OSDA 4DSEA 2DH8A 2NUUG 3UNGC 4RUAA 3C3LA 4DLGA 3GFYA 1RT6B 1FFGB 3DM2A 2V9KA 5HLFB 2DY1A 3I9ZA 3MMAA 4OFZA 3TX0A 2RHSB 2B7BB 3K59A 4K4YA 2J0SD 4USJC 2VJUA 2E5LJ 3W63A 5KFYA 4WF9Q 3PYDA 4C11A 5IFMA 1Q5YA 4OJ3A 3TO8A 5DDQC 3RB6A 2F8MA 1JXLA 4ED2A 3D5MA 2HS3A 3R5AA 4RWXA 2FLNA 1L3KA 2IMWP 5CD4H 4V19J 3DLBA 2N7YA 4DR7F 1YJ7A 2GA7A 4Q2LA 4GO5X 3QO9A 4FF1A 2BE7D 2IDLA 4NYPA 3MR2A 2DR8A 3L9ZA 2MKYA 1U0SA 1VGYA 5AXMA 1LFWA 1RYRA 3NMRA 1DQ8A 4ZPBA 2YTCA 1FVQA 3M8WA 1T95A 1U24A 4FDFA 2FZCB 2XZWA 2I6WA 2JLFA 4DQRA 3N5BA 2RQMA 4DQIA 2KHCA 3SZ2A 3DMJB 2HNYB 4F0MA 1RYSA 4WU3A 4ZVSB 1S0OA 5SZTA 2XYHB 3HT0A 4N41A 4DLEA 1RAJA 4P72A 3K2YA 1SPBP 4F25A 1H38A 2B43A 3DLEA 3LO3A 3FZBA 1NH7A 4J7CA 2VPYB 4L73A 3UE2A 4B02A 4LF9J 3CULA 4F2RA 1D8ZA 3BO2A 3M6XA 2MZTA 3VVUA 4IQMA 3QSYB 1TFWA 3VGTA 2XHWA 3UO0A 2KXFA 2W2OP 4RR5A 1VQSA 3D6MB 2JEGA 5E2QA 1PSDA 4CO0A 3D68A 3EZUA 2ALZA 5A8KA 4A8OA 1SC1B 3CNQP 2CWXA 3SEOA 1QD1A 1N33F 3ZO7A 4B3MF 1VI7A 2B3TB 2XM3A 4IRKA 1AROP 1U6ZA 4B9SA 2O67A 1NUEA 2D9OA 5HQ8A 3GV8B 4K4WA 4LRAA 3CJQA 3VGSA 4DPXA 5KT7A 1FHTA 4HR2A 3MOJB 5KFHA 2LYVA 5HLFA 2YWEA 3M6WA 3GIRA 3MMAB 2Y8YA 1TP7A 1URRA 2L3MA 2ZZTA 1RAGB 4OZ0A 1GXUA 2ASLA 1U8WA 3THPA 1Y11A 2RQ4A 2CQ0A 3MURP 4J9RA 1RTZA 4NCGA 2ZHOA 4DL7A 4O3RA 4PAAA 2CAJA 1VRTA 4ALZA 4C8YA 3R3TA 4N77A 4GO7X 3D2WA 2HNDB 3GIKA 3QO9B 1IBLJ 2OTJS 3LOUA 3EDQB 3OXLA 5AT1B 5G0RB 4QYZK 3FEXB 2M4MA 4YR2A 6FDRA 1O51A 1U26A 4K4SA 1HPZB 4MYTA 1NKBA 2VOOA 4RX6A 2E1AA 1JLQB 4CDIA 2CPYA 4QU7A 4B08A 3CCVS 2DRAA 3EGNA 3W9HA 5D0GA 3FCHA 5IXUA 4USMA 2PSZA 4NLQA 2AYGA 2CPEA 2H4WB 2Z30B 4ETXA 1GFWB 1H2TZ 4QBUA 2A2CA 4AQYF 2XNRA 3SV4A 3ILOA 1M1GA 4IFYA 1U1PA 3FC9A 1KTQA 3TAQA 3PX4A 2F7VA 1WSVA 1WELA 4J9NA 1R27B 2Q3PA 1JLFA 2GIFA 1FKOB 1H0HB 2B9WA 3UFCX 2LECA 3JAMY 4GC6A 3ITHB 4N47A 3W65A 2C1EB 5DETA 3Q2TC 1HWLA 4OJHA 3JB9k 3MDFA 4Q8FA 1XMOJ 2F3JA 1NSKL 1B0TA 3AAWB 4ECQA 1YX2A 4J9OA 4YFUA 3H90A 1AUDA 2BOAA 4CWBA 5IT4A 3RAQA 1EETB 4MFBB 2U1AA 1NJYA 2HSEB 1GMUA 5FDLB 3BO3A 4FYYB 3TZXA 4TYBA 3CJ3A 3PW2A 2OKQA 2Z2MA 2YKOA 4I64A 2EFVA 2LQ8A 4ZVRB 3UR3C 4Q45A 1VBXA 1JWWA 4O23A 3P96A 2R2TA 2V8HA 2MB0B 2QJ3A 1RT5B 2OPQB 3KLHA 1XIQA 4A8FA 2KZZA 1WC1A 2M2BA 4ID5A 3AOCA 4KAIA 2B4OA 2KL8A 4CRJA 2RQCA 1KQSR 4J90A 5AXNA 5KT3A 3IWNC 5K8OA 2HAFA 1VQ6S 2RKIA 3C2PA 1GTEA 4QYZJ 2VG5B 2DR5A 3RZAA 3C14B 4NXMF 3OTCA 2R8IA 3GLJA 1B7FA 4RKUC 2QIFA 1UEKA 1DQAA 4PRFA 2MQLA 2V69A 2E7WA 4CI0B 4ECTA 3IGNA 3VZIA 4ZKAA 3NLCA 1K47A 2YWGA 4E2FB 1C4AA 1SIWB 3R6GB 3TA1A 4EI2A 2WZ1A 2WTFA 3PW7A 2VHGA 1WTBA 3G6XA 2E7VA 4CZCA 2B5JA 5KFCA 5KFFA 5IC4B 2G1HA 3D1QA 2FTRA 2N4CA 1Y00A 2BZ2A 4KBIA 4ZP8A 5IQQA 4LF7F 2DT9A 3I0SB 2C3MA 2WHOA 5HVHA 5GAGI 2V8DA 3DU6A 3D7SB 3HD2A 2XCAA 1RP5A 4V19X 4DR4F 2WW8A 3C14A 4LRCA 5K9FA 4O3SA 4I68A 4Y34A 1FJCA 1S76D 2NSCA 5BR8F 3TAMB 3CCLS 1NKCA 2HHQA 2A2DA 4ZMMA 3QLHB 1ZBTA 1BXNA 2Y1LB 4ID8A 4CT9A 3LP1B 4YOEA 3ISNC 4L76A 3Q2SC 2CJBA 4WBFA 5BYRA 4CLUA 3J7AN 1OJ4A 2N4DA 2OEMA 1JLCB 1U1KA 2CVEA 1S7HA 2ZWPA 1Q82T 2HK3A 2ZDPA 4NI2B 4X4TA 3CJ2A 2PGCA 3MPUB 1ICEB 1BY9A 3N9UC 4I4BA 1VBYA 1HQUA 4KFBA 1SXLA 2J7KA 2CJAA 4RJVA 5HMYA 4NA3A 2MZ1A 1FJEB 2UXCJ 4R25A 2Q79A 1N5YA 1P1LA 1VQ5S 2AP6A 4KHPF 1NB2A 3K57A 4F50A 3HZEA 5ETVA 4WFYA 1VQNS 3A8JA 1N5SA 2OLWA 2Y9HA 3S6EA 1NK0A 4B3TJ 1MN9A 4Q8EA 1CEZA 4K50A 1MU2B 2N7CA 3PKYA 3GFZA 1T05A 2V2KA 2HNZA 4PG7A 4WXOA 4JI4F 3CIMA 5DO2A 5LMNJ 1UFKA 2YX4A 3I31A 4DV1J 3RGIA 2C2KB 4IFYB 2YKAA 1N32F 1PAUB 2ROPA 4FPIA 2NXNA 4O3QA 3GR0A 4H4OA 1WF1A 2E1CA 3IAM9 1VRUB 2HHUA 5J2NB 4IG0A 4IOBA 3DHXA 1KKHA 3C15A 2P6TA 3OR1A 4I1TA 5E3RA 3Q23A 1G4CA 2LVWA 4OI2A 4OYBA 4EK2A 3M8SA 1F0XA 1ZTWA 2YWWA 3L7UA 4P74A 2LFVA 3H20A 3HHLD 4NRTA 4ZK7M 4J9QA 1LW2A 1Y0HA 3F56A 3T1HF 2VG7A 4RW6B 2R7OA 2WBMA 3A8KA 3IBCB 3PVXA 3I0SA 4DJBA 2ZZNA 1IKYA 4E0DA 1WOOA 4DMZA 1FJ7A 4XPCA 1UP1A 4K2JA 3OUYB 1RI7A 3SI8A 3MXHP 1NZAA 2YKMA 1RLCL 2Q6CA 4MKAA 1M1HA 3HSDA 1L3VA 2OAUA 2R42A 3K8WA 2W9BA 4DR3F 3FDSA 5IC6B 4U7UK 1RISA 4TYAA 4JI5F 3TOQA 2OEJA 3OFHA 1OYDA 1UFWA 4NLTA 2QZ8A 5LJ5Y 2KU7A 3DLGB 3MZIA 2I0XA 3FMWA 1LWFB 3MECA 4R5PA 1VK3A 2EFNA 2COLA 2LEPA 4RUBA 3G8QA 1H6KX 5CA5A 5B0AA 2L08A 3FGVA 4IRDA 1TUWA 2ZBIA 2YWHA 3OTDA 5AJ3J 3TW0A 3DRRA 4F0KA 4JUZA 3SSQA 1WSRA 2UVVA 3ENAA 4C0OC 1HBUA 2RS8A 2W7AA 2D3UA 1E6YA 2GX8A 5BR8J 4HEA9 1NK9A 3KJVA 5BXIA 1OWXA 2X3DA 4LF8F 2V67A 3UVJA 1SL0A 2ZDOA 4QIGA 1P6TA 4LF7J 8AT1B 3CMAS 3FSIA 2JL9A 3MM9A 5ETKA 4DSJA 3MEEA 1PKUA 4KHMA 4WYLA 2DNGA 3KLGB 1S6PB 1WWHA 3AXMA 3HULA 2DGOA 4PG8A 4F3MA 2M8DB 3O44A 3WBZA 1B99A 4Q2MA 5AE3A 2A10A 4ECRA 4TVAB 1SVDA 4URQU 3M8QB 4U6PA 2RT3A 3LP1A 4R8UA 2BE9B 4ZJQA 3PEHA 4CO4A 2W2NP 2DR7A 2VPZB 3T41A 1TUGB 3MPVA 1OIAA 4NPOA 8ATCB 3O8WA 1N5QA 4XTTA 5CYQA 2XTJP 3KK3B 1CJUA 2DD8S 2WVCA 1YRTA 3QFWA 1BQNA 4C3LA 4DPUA 5AE1A 5EWFA 3MR5A 4IR1A 3H8YA 1VQOS 4KGMA 1TU0B 2VF3A 4JYAJ 2CNNB 1CULA 4UZBA 3J7Z5 4A8XA 4ZLJA 3BSOA 1R7IA 1CS4A 1SH0A 2RQKA 3CCZA 2GV1A 4P2SA 4ZIWA 3AT1B 1VLOA 3OQ2A 3ADAC 3CF5Q 4F3OA 4K0KJ 1S49A 1TL7B 4KT0C 5F8HA 5HBMB 5KG0A 3UQSA 3J81j 4CH1A 4DFJA 4TU9A 2EFQA 1MG7A 3VAJA 2DNPA 1B70B 1LNQA 4WFNQ 3G4SS 2V94A 1FKAF 5BJRA 4LSLA 3MM5B 5JMNA 1FRJA 2PI4A 3ZZZA 2AD9A 4GKKJ 5A6PA 2FQQB 4UT4A 2WONB 3ENVA 3KMSA 1U2FA 4LF5J 1ZAVA 4M5LA 1K1SA 2RF2B 4OI4A 4X4SA 3ENWA 3QRQA 2R7VA 1RKJA 1YGYA 2UUAF 1JLFB 4DWIA 2KFNA 5IT9Y 2G0JA 1NXIA 3LTOA 3UDCA 5H1SV 4ED5A 1NJIT 2EVZA 1RWPB 2BV3A 4J9KA 4KC5A 2BRLA 1IBKF 1CJKB 2AJ1A 3GP9A 4Y2KA 4DUZJ 3OVBA 2DHAA 2AYEA 3DRYA 2PT0A 4L3NA 4Y2IA 4MFBA 4DG1B 4OI3A 1U48A 1VJWA 5A76A 2XC9A 1J5EF 2FLOA 3R9LA 1JLEB 1GMWA 5LT5A 3EVMA 4RNHA 1VQLS 2HHHF 1FCAA 1P1TA 4LSZB 4EBCA 4EBEA 1RGVA 3E01A 1FRKA 3NS5A 2FC8A 3R6LB 3T5KA 4RW6A 3RRKA 4JI2J 3AH6A 4P2FA 2J9CA 3KLEA 2QL5B 3CD5A 5HMZA 4YR0A 3QFHA 2UXDJ 4O0NA 4X4UA 2C2MB 2Z2YB 1KTVA 3AOAA 1UVMA 2FJWA 3PCOB 4HDHA 4CLZA 4YMEA 3BDPA 4OLOA 5HK4A 4AD6A 2GS8A 3DCAA 5B0BA 4MH8A 1CQNA 1HD0A 3V2UC 2YNIA 3HDSA 1N6QB 3JSBA 4TLRA 4DBQA 3VCDA 1RAEB 2HQGA 2VFSA 2VQEJ 3RJMB 4NLDA 1RWXB 3IXQA 3M1VA 2VD3A 1FXRA 3GFHA 3MEDA 4FNHA 4O3OA 2VFUA 5I4MA 1ZETA 3BGLA 2R8KA 3D1HA 3NKYA 2JDJA 2KRBA 4HACB 5KG4A 3T19A 1N5TA 3ZZYA 2XG8A 2HS0A 3NGKA 1RUSA 1K73T 1NHUA 3M7VA 2GQCA 5C42B 3VV2B 1PYTA 4ZP9A 4IDKA 3M2RA 4C8LA 4ZPCA 3PIOQ 5A8RB 1VR6A 2MJNA 4YB6A 1T03B 4W98A 3KK2B 4JI3F 3ELHA 4NLPA 2JFDA 3AODA 4PWUA 4OLPA 3CO0P 1N33J 1WG5A 2O5DA 1AZSB 4I2PB 3WX4A 2HYIB 1BQMB 5D0HA 2P9GA 1UCNA 1VRUA 3AB2B 1FK9A 1U6FA 2JC1A 3IG1A 3Q24A 1R43A 3W7BA 4S0MA 1KC8T 1NHVA 2F1FA 4G1QB 9ATCB 4AFFA 2VASA 1SUQB 2FHMA 1BD6A 2CJ9A 2DNQA 1TTHB 5CHCB 2XYGB 2YNHB 1N0VC 3MEGA 3H5SA 5L46A 3NEKA 4CIOA 2BKOA 1NO8A 2B8QA 1CJTA 2Q1LA 2XMJA 4LSNA 2IC3B 1H74A 3QPIA 2LP4A 1RU1A 2IRXA 3G82A 2DO4A 3ZZ0A 5IZHA 3IA0A 2VICA 3PM9A 4MJKA 1NRKA 1WJ9A 2DNOA 4TKTA 4ATNA 2HHWA 1PBAA 3E01B 4X66J 4C9DA 1A6LA 4RBVA 3W2WB 1QSLA 1FEEA 1I94J 4ED6A 2C2EA 1T11A 1RTHB 2YKQA 4DPWA 2BA9A 2J8SA 2BOPA 4NLWA 4N5SA 3NAHA 4OYXA 4WYWA 3G6ES 2C22A 3KNAA 4C8ZA 5J2QA 2M70A 1APSA 2ZM6F 4YB7A 5AXKA 1FWKA 1S72S 1VC5A 5FJ4A 2FVCA 2R3VA 2ILYA 1TL4A 4FF3A 3PRBA 5HJXA 2KM8B 4NZ6A 1HWJA 2N3LA 1FD8A 3QZ7A 2GO8A 3AHPA 3GCXP 1AXQA 4LVNP 4LR9A 2MGZA 4DR1J 1IKXA 4ZPAA 1FRLA 1FERA 2HQCA 2X1AA 3OTBA 4F4XA 2LXFA 3OXFA 2Q6BA 2P8IA 2ZFHA 2XMKA 4ID5B 2KFZA 4J5OA 4C3MA 4IG3B 1WC6A 3KLIB 2CIMA 3QYYA 4NL5A 3NGDA 2IAJB 4NX9A 4W4MA 3LP0B 5A6WA 3V4IA 4P75A 3ETOA 2G0CA 2W9AA 3I5BA 4KYZA 1R8CA 1UVJA 4JI6F 3DM2B 3BGOP 4I6AA 2WVDA 2YQ1A 2DXEA 3DHWC 3LGMA 3M05A 4LQ9A 4TNOA 5IM0A 1N5VA 3LW5C 1KLMB 3NWGA 4DV2F 5EWGA 4CLPA 3EUNA 4HYKA 1VQYA 1HHTP 2KT3A 2CJXB 4DS4A 1U1MA 1HFEL 2GIQA 4MYUA 3ZZUA 1G1XA 1KOHA 4TU7A 4M5IA 4P9SA 4WK1A 4CCHA 1KHVA 2VA2A 2DHSA 1S0VA 4OL8A 2F8HA 2HAIA 4BLGA 4JI0F 4C4WA 2GW8A 2BJDA 5LMUF 3KMQA 3T1YF 2E44A 3GIIA 4NOHA 2VC0A 3X3UA 4I2QB 3FCWA 5DDPC 1QSYA 3CCSS 2FJDB 2V4JA 3PW4A 2RVJA 4O44B 2V2VA 3ZTSA 4DV0F 2NREA 1HWUA 5K14A 3VVTA 4J9LA 1SBRA 4OX9F 5J1NA 1FNXH 1IJEB 3DDNA 4Y2CA 5CAAA 4K2XA 4A8SA 4DFKA 4QR0A 1S97A 2VFTA 1REVA 3HSJA 2D41A 3B8HA 5L1JA 3ZTRA 1EAYC 1RTIA 2ADCA 4EBDA 4ZVOB 5G0RA 2ZH3A 3AXKA 5ETQA 5T41A 3MM8A 2OPRB 1X60A 1KLNA 2NXCA 2VG5A 1YRXA 3M2RB 1I51B 4I56A 4NMXA 4O3PA 2BX6A 3DLJA 4CLWA 3BQ0A 4DS5A 4ELTA 5GAEU 5C25B 2J0WA 2LDYA 2MDAA 3MR6A 2M88A 4EMDA 1SB6A 2EEYA 4ZA1A 5HSPA 3G8SA 5IWAJ 3DOKA 1LK5A 2W24A 1YJVA 3D0HE 4DN0A 5KG5A 5LXYA 3W9JA 3RR8A 5HO4A 1OY6A 3CT9A 3KHHA 1R0CB 2HZCA 4DPTA 2IHR1 4XDCA 2LDIA 2XO7A 1YBUA 3K7RA 5E7OB 2XWYA 4X4PA 2ROEA 1HBMB 3VAMA 3HK2A 4OHYA 4W90B 4KPYA 4PYDA 1TK8A 3MPWA 3ZFVA 1GTHA 3BGRB 1OS5A 3PO4A 2LMIA 2XMTA 3CJ5A 1VIOA 1KLMA 5HBMA 4YHHJ 1HNIA 2NYIA 4LBIA 1D9AA 2QLXA 3UN2A 3OTOJ 4NLGA 1RT3B 2H5JB 3ET6B 2IC3A 1KHWA 4ZIVA 5GAHI 4MAKA 1S9GB 1TELA 2G1DA 4AXIA 5K20B 3Q0AA 2QRRA 2VQFF 3AQPA 1X4GA 4LFAJ 3LA0A 2QSFA 4YP3A 2RDDA 5DLGA 4X64F 3VAGA 1MNEA 3B4DA 4X4NA 4OYWA 1YZ7A 2GGPA 3EZ5A 3I96A 2XYPB 3AD8C 3ZZOA 3X1LB 2AKWB 1GMWD 3PHEA 4KH1B 2HHXA 1HBOA 1FXLA 2CQPA 3MCMA 1NPRA 3M8YA 1WNEA 2DGVA 4B3RF 1VQ4S 3M8QA 4NLVA 3MCNA 5B09A 3LAMA 2LKZA 1TKXB 3ICLA 5HANA 3W2VA 4RNOA 4KKOB 4X4QA 2BXJA 1NNDA 2HIQA 4YDXA 3SYZA 1OSCA 2RU9A 1TL3B 3W9IA 3C6UA 1OPZA 2UV8A 4ES3A 4P73A 1G2EA 1IM4A 4M5JA 5EX0A 1GAOA 1F3VA 4UUXA 4HT5A 3FUYA 5IS2A 3R5CA 2CPXA 2C2ZB 2CRLA 4YS2A 5D4PA 1N48A 1XNQJ 3AJDA 4GVBB 3SFGA 2EW9A 3OFEA 1KEKA 4ER8A 2UU9F 1YVFA 1W2BR 4UY8T 3E8OA 3FCVA 3GV7B 1RWWB 3LPEA 3EDRB 3MM7A 1S1VB 4AL7A 3FJ2A 3DGPB 1S10A 2E29A 3CIZA 3OPKA 3THTA 1SKWA 1YSJA 1Q4RA 2ZE2A 1Y3KA 3GJTB 3MM6B 3R5GA 1RQ0A 4PEOA 1U1QA 3AOBA 2B7CB 3M1VB 2HHPA 1FX4A 5B0FA 3W2VB 3T6BA 4WZMA 2Y1RI 4DL0C 2BJ8A 1QDUB 4TY9A 2Z0GA 1ZM2A 3K17A 3SIPB 3L4BC 3C6UB 3VGUA 1ZZNA 3DDKA 2KZMA 2A6MA 3H4DA 2AZ1A 2ZZMA 3QLHA 5HP1B 3SQGB 1S12A 1YKWA 3D3CJ 1CC8A 3D9BA 3M6VA 4PWWA 5GAHU 4UOHA 3W61A 1BWVA 2V0NA 3KKFA 1IUJA 2CQGA 1SIZA 2ZVIA 5BYQA 4YDDB 3PJ9A 2ZHAA 3TA0A 4QIEA 2GO9A 5CXTA 2BJ3A 4L3KA 4DX7A 4ZPVR 4PCQA 1KQFB 2BMBA 3DGPA 1Q0NA 2WSFC 5C24A 3KWMA 3S8SA 4F4YA 5A2QU 2BYCA 3IWXA 4X4RA 2HHTA 1XJWB 4I69A 4NE9C 3BR8A 2UXBJ 3W1YC 3VR1A 2JEFA 2CKWA 4QJVA 3LP2B 2YPZA 1UFLA 2O3DA 3I6PA 4DUTA 5GAGU 3N5FA 3OW2R 5F41A 2L9WA 3A3PB 2KYXA 3HT3A 1TUVA 2MYFA 4B3RJ 4A8WA 1GX5A 4AL5A 1Q78A 2Z2ZA 3FSXA 3M2VA 3GJSB 4RWWA 2IDEA 2AGPA 4YB5A 1U6BA 3U1NA 2QO3A 3JYTB 1ZPWX 1RA7A 3GYNA 3LUYA 4J9PA 2YNHA 3V81B 2R2UA 4G6VB 2HNYA 1TR0A 3DLGA 1YRUA 1S1WB 2C28A 1Z2ZA 2OPSB 3GONA 1RT7B 1BE4A 1UWAA 3NOCA 4EUVA 3MUMP 1Y9OA 3MPYA 1SC3B 1YJUA 1QE1A 3O2IA 1HYSA 3CD7A 3OFGA 4OI0A 3VWSA 4DR5J 4QOTA 1NLKL 4K5SA 2QL7B 4ES2A 4IQXA 4ERDA 3DOLB 4DPOA 2MKKA 1RBAA 3L95X 5MLCV 1YHQS 3M2VB 4PWDB 1C0UB 2YVSA 4R0EA 3ILIA 3IGVA 1Q95G 3EWGA 2JHEA 3HHEA 3N6MA 1N8RT 2EFGA 3DLHA 3Q22A 4TQRA 1F9EB 1VQPS 1VQ9S 1WDDA 3NRBA 1C1BA 2I8EA 5A8KB 5F9NA 4JI8F 1F5BA 1ULRA 2PN6A 3NWRA 2QA4G 3V4MA 3IRXA 1N5YB 1YG0A 1HBNA 1D3WA 2G2OA 2IMOA 3MCSA 3T6JA 2GJ2A 4FYDA 4PQAA 3L7OA 5H9FK 2WAQD 1SC6A 1FE4A 3CGIA 2PMWA 3QAUA 5MAOA 3BJYA 4WIQA 4ZJOA 3HFZB 4CO3A 1RACB 2FC9A 1FTCA 3H2VE 3MAAA 3IBFB 3QGPA 1LWCA 3A8IA 1WF2A 4K4UA 2RUSA 2ZITA 1S4FA 3R7SB 5CQGA 1ACMB 3GWCA 1JJ4A 2KT5A 3PYGA 2D3ZA 4F4KA 2VKZG 4TLQA 3GFXA 2AJ4A 3NCPA 2YX7A 5FIIA 1EZZB 2KT2A 1JNZB 4HTIA 2LQ9A 1NJWA 2OPRA 3CJ4A 2VPXB 1AB8A 3FEZA 3N6NA 4I6YA 2XS7A 1AFJA 5KT2A 1IQZA 2M52A 2PE8A 2MY8A 5KFXA 3BH7B 3R7NB 4CT8A 5IM0B 1M5SA 1DLOA 2F63A 3M4XA 4C8NA 4ANCA 3G71S 1R31A 1FE0A 3FBEA 1TKXA 2DJWA 5I3QA 3C15B 3TVKA 5LSRA 3HVAA 1T8EA 4LFBF 1SQEA 4KGVB 1DQ9A 1Q1KA 2CQDA 2FVSA 3ILLA 3MTKA 1RHMB 2CQBA 1RT4A 2VJVA 4AL6A 1FDNA 2ABYA 4B9VA 4FN5A 4ZPWR 2KXHA 1HNXF 2ZBQA 3RBZA 2VBXA 2RHQB 1IKWB 1AUSL 4DU7A 1PYOB 4P6QA 4DV5J 2KM8C 1B7YB 3NGSA 4X62J 3HHLB 4Y28C 2BKNA 2ZNYA 4FF4A 3MAQA 2W2MP 2W7OA 5LXRA 2ACMA 4OZLA 3EX7B 1N36F 1Z1ZA 4HL9A 5T7LA 2R9LA 2PMHA 4ICLB 3UCZP 1WC4A 3PIPQ 1MU2A 2NXEA 2G13A 4QR2A 1X0FA 4LF1A 4F4ZA 4ZHRB 2F9JA 2WRMA 4ZOSA 3TWZA 3G96A 2J6SA 1HQ2A 1WDTA 5ADZA 3B4MA 4KV8A 1TAQA 2QC3A 1XR7A 5J2MA 2D9PA 1CJVB 2IM2A 4UOFA 1GK8A 3GG0A 2DCUB 3Q83A 2HVIA 2HQIA 3HZGA 2RU3A
chains in the Genus database with same CATH topology
2ILZA 4QW8A 2ZH8A 4H4OB 2W8LA 1S1XA 3NMAA 4GMKA 3PR5B 1UVNA 1MMLA 2R7UA 4DL4A 4ICLA 3HP6A 1S1UB 2XEXA 2OO4A 3JTPA 2R7XA 5J1EB 3CJKA 2ZJPQ 1MROA 1UKUA 3GG1A 1M1KT 5J2PA 4H54A 4F02A 1ZOTA 2ZH2A 3OVSA 2Y0SD 3OSNA 4H4KC 2ADBA 3M6UA 5E3QA 4TXSA 1FVSA 4OQJA 1S1TA 1X4EA 2HWIA 3V5RA 4LF4F 2Z4PA 2XS5A 4WXWA 2J9DA 3THVA 4MKYA 4ETZA 3VAHA 3MHYA 2V4RA 1RWUA 1PGZA 1QAIA 3AA8A 1REVB 4C97A 2HVHA 1BQNB 4RW9B 4N76A 1MWZA 1MROB 1WHXA 2KG1A 2QMWA 4DL5A 2BDPA 3TNVA 2FVRA 4QWBA 1JKHA 4F4WA 1X9MA 3CC4S 4ZPDA 1P8GA 2CQ1A 1HBOB 5KFNA 3OVAA 2BANA 4Q0BB 2D1CA 1YWXA 2GQ2A 5CZXA 5DJBA 3T5LA 3TARA 3GIJA 1I1GA 2IBOA 5CYMA 4DR6F 1SV5B 3PACA 1XK8A 4IO9Q 1S9EA 4JBCA 3PFEA 2EK6A 2UVWA 5E0OA 2HLUA 1AFIA 3N4WA 4XDDA 1D0EA 1SKRA 2KI2A 1HI0P 1IKYB 2EFPA 3OL9A 5HI7A 2VBZA 3F41A 1VIXA 2G4BA 2GFFA 1X4FA 4NLXA 3S1TA 3R5DA 4OZ1A 2RJZA 3PY8A 4JI7F 4DG1A 2MZRA 1PC5A 2C42A 1IR0A 4MIBA 1RTDA 4UQGA 2DIUA 5F8JA 2JEJA 4C7QA 4OHXA 3TX8A 5GVQA 1HNZF 2RILA 2E5HA 1HNWF 4KO0B 2M8HA 2AX1A 1KONA 2W4CA 2CG4A 2DGSA 4QWEA 2E5JA 2XWXA 3D0IE 3QGGA 4P7TA 3OTOF 3OLBA 4YHHF 2OFHX 4HI1A 4JI2F 3QIPA 2DHXA 2HNZB 3VQSA 3NCQA 4LSLB 3MM5A 4AXJA 1LK7A 3F73A 2NZ4A 1F9FA 1YJTA 1U1LA 1F5AA 4X65F 2AU0A 4LQ3A 4IKAA 3NNCA 2PC6A 1VRTB 3HVRA 2CJKA 4OZ5A 4PQUB 1UWBA 2QEXS 1DHMA 3GR1A 2W7PA 3TQ1A 2BM1A 2R4FA 1Y5LB 4IOAQ 3C8YA 2GCFA 3ISZA 3BQ2A 3J80Y 1C0TA 4QIVA 3O5TB 3M2UB 2OPSA 3L09A 2F4VF 2IM1A 1M0SA 3TP2A 3PV8A 2POKA 1Q8BA 1KQKA 1C4CA 2HW3A 1D9FA 3I4HX 4OIXA 3HVTA 4I2PA 2MQOA 2CPZA 4YR3A 2FGOA 4K0KF 2W9CA 3KLEB 4DSIA 4M1KA 1JNRB 2UZAA 4NMLA 2KRRA 3BR9A 3M8PA 1RT4B 5HROA 2DCLA 2EG2A 2BUNA 4OX7A 2JVRA 1XBWA 4FPRA 1XMQF 4WZQA 4RBTA 5C5JA 2CVIA 2C3UA 3H2UB 4HVZA 1V3SA 1N0UA 1WEZA 2XSJB 1M5VC 4EO6A 4B9TA 4M8LA 2DGUA 1H7XA 3LF0A 1Q86T 4K5RA 2HNDA 4M5DB 2YH1A 2B6AA 1HBUB 1D9DA 2NSBA 1FESA 1G6BA 3AJ2A 5BYSA 3JYTA 3G86A 4NYOA 1KR4A