1LWEB

Crystal structure of m41l/t215y mutant hiv-1 reverse transcriptase (rtmn) in complex with nevirapine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
423
structure length
401
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
total genus 102
structure length 401
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lweB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweB03
1DTQA 3RBDA 3DMJA 4O44B 4NCGA 3DMJB 1JLEA 4IG0B 4Q43A 1JLEB 2I1RA 3NKYA 4F4XA 1QUVA 1MMLA 3OL6A 1UWBA 1KLMB 5D3GB 3BGRB 3I0RB 4R0EA 1RT6A 2RKIA 5HP1A 4RNHA 3QO9A 3T1AA 3OSNA 4DG1B 2HWIA 1HYSA 3ISNC 3KK1B 3E01A 3MEGA 4R8UB 4F4WA 1HNIA 4MKAA 2W9BA 3E01B 1S9FA 4IFYA 2EC0A 4K4ZA 5DGAA 3GIIA 2W9CA 4ZP6A 4YQWA 2V9WA 1RTHB 1HNVB 5KFBA 4QWDA 1VRUA 4F4ZA 1GX5A 4WXOA 1VRUB 1S0OA 3NMAA 2D3UA 3ITHB 1D1UA 4O3PA 1MU2B 2WOMA 1RT3B 2YNHA 1RYSA 2WOMB 1YVFA 4URSA 3DLGA 3V4IA 1S1UA 4ECSA 3DLGB 4KKOB 3KHGA 1BQNA 1CSJA 4EBDA 1DLOB 3DOKB 1NHVA 4ID5A 3VQSA 5KT5A 1S0NA 3HVWA 3LAKA 2W7PA 4J9QA 5KG4A 4J9MA 3KLGA 1IKXA 3IS9B 1N48A 2IC3B 2QE5A 1FK9B 5EWEA 3CVKA 3MEEA 4ECXA 2ZKUA 3QGIA 3MEEB 2XC9A 3T5JA 2OPPB 4DL6A 3RB0A 2UVWA 1HQUB 1XR7A 5JUMA 5KT7A 1RTJB 4H4OA 1ZETA 2YNGA 1XR6A 3JSMA 4IH6A 3NL0A 4O3RA 4R5PA 3KLVA 2IJNA 4XPCA 4QW9A 4ED3A 4IQXA 1LW0B 5KFXA 1TVRB 4ZVFA 1JKHB 2HMIB 3IGNA 5DLFA 4DL3A 1RTIB 4DL2A 5J2PA 1RT7A 3CO9A 2GIQA 5J2PB 4O3OA 2ASJA 4IRDA 3H5XA 4IDKA 4IR1A 4PUOA 1EP4A 2YKMB 5KT6A 5KFHA 4J9PA 1K1SA 3E51A 4ZPBA 3SI8A 3DRRA 4WZQA 1S1VA 5F8IA 5DG9A 1S1VB 4RNNA 3OHBA 4WZMA 4ZP8A 2BANA 3M8QA 2BR0A 4G1QA 4K4XA 1SV5A 4G1QB 1TQLA 2F8EX 3BSNA 4KHRA 4O4GA 2E9ZA 1S1WA 4NLVA 4HYKA 1REVA 2RDJA 4EYHB 3MR2A 1HQEA 4EO6A 2B6AA 3KK3A 4KO0B 1N5YA 2C2RA 4ICLA 2FVPA 1TL1B 1JLAB 3CJ4A 1JLGA 4NRTA 1IKVA 2FVRA 3D28A 3GIMA 1JLQA 4ZVEA 1JLBA 1JLQB 4WYWA 4O3SA 1JLBB 4WFZA 2OPRB 4TN2A 5KG2A 3H59A 5KFUA 5C5JA 4LQ3A 3PW0A 4RW4B 4I2QA 1S6QA 3EPIA 4J9RA 4I2QB 2OPSA 2UUWA 3BQ1A 4ECYA 1RT4B 4DL4A 2ILZA 3M8PB 3Q8SB 3MECB 4I2PB 4J9KA 3V6KA 4NLRA 2R2SA 5J2NA 4IOBA 2BQRA 5F8LA 4Y34A 1LWFB 2UVVA 3D5MA 4PWDB 1RYRA 5F8NA 4NLTA 4FS2A 1RT1B 2WCXA 5I42A 2HNZA 2IAJA 3KOAA 2HNZB 4H54A 3TVKA 4K4SA 1TKZB 3CWJA 4IR9A 1EETB 3V81A 1RT2A 5J2QB 2D3ZA 4ECQA 2IM1A 2HNYB 4H4MA 4IFVA 4KFBA 3G86A 4NLQA 4K4VA 4XO0A 2WK4A 5KFNA 3M9OB 5DG8A 2AX1A 1TKTA 1RDRA 3DI6B 4LSNA 2BRKA 1QAIA 4JV2A 4TY8A 2FLPA 1S1TA 4ZVHA 1RTDA 2OPQA 4GC6A 2OH2A 4QPXA 5J2MA 3RAXA 1S9GA 3N6NA 4NLDA 4MKBA 4X2BA 2AX0A 1J5OA 3Q8QB 1JXLA 2R2TA 3MEDB 1R0AA 4TYAA 3EPGA 1SUQB 3I5BA 3OL7A 1R0AB 4IG0A 3OLBA 3QZ7A 5KG6A 1RAJA 1SH0A 2WRMA 2XI3A 2AWZA 2R8GA 1KLMA 1HPZA 2B5JB 3BGRA 3I0RA 3JYTB 5D3GA 3ICLA 1HPZB 3KJVB 1BQMB 3DDKA 5KFMA 4ED7A 2BE2B 2ALZA 1VRTB 3PR4A 4DG1A 1IKWB 1IKYB 5KFIA 3OLAA 3KK1A 2RDIA 5CYQB 4R8UA 4K4WA 3KK2B 1T03B 2ZE2B 4JV0A 4RW8B 5CYMB 3V6DB 1C0TA 3T5KA 1C0TB 4PQUB 3CJ5A 3H4BA 3BJYA 3BSOA 3FRZA 4F50A 1RTHA 1HNVA 3BSCA 5DQHA 5KT4A 3RB6A 4K4TA 3C6TB 5JXSA 4MK8A 5L1JA 4EEYA 4Q8FA 3ITHA 1S9EA 4QWBA 2WB4A 2AU0A 1S9EB 1U09A 1MU2A 5FDLA 5DGBA 1RT3A 3MR3A 5FDLB 1WNEA 1N6QA 4ZMMA 5L1IA 5KFFA 3MFIA 3V6JA 4KKOA 1N6QB 3RB4A 4OL8A 2C2DA 3KNAA 1C1BA 1DLOA 3DOKA 5HLFA 3IN5A 2I5JB 3T5LA 1C1BB 5HLFB 3H4DA 5KFEA 5HBMB 2UVUA 3UR0A 3IS9A 2IC3A 3DM2B 1FK9A 2VG6B 5C42B 3EZUA 4O3QA 3CJ3A 2DPIA 4RZRA 1T3NA 2IM0A 4J9SA 1JLCB 2OPPA 2CJQA 4KBIA 5I3UB 1HQUA 4NLPA 1Z4UA 1S1XA 1RTJA 4TXSA 4EO8A 3PZPA 3DOLB 1S1XB 4ECVA 4KB7A 2XGQA 3LAMA 4NYZA 3PR5B 5KG7A 2ILYA 2XI2A 1XR5A 3TAMB 3KLHB 4WE1B 1LW0A 4QW8A 3GV8B 1TVRA 4RW7B 2VA3A 1JKHA 2HMIA 3QLHB 2HAIA 3MTKA 3QGHA 4TYBA 5EWGA 1RTIA 4Q0BB 2D7SA 2HNDB 2R8KA 4RW9A 1NHUA 4RW6B 4MIBA 2W7OA 1RA6A 4ED2A 4RW9B 3PW5A 2JEJA 1KHVA 2YKMA 2YNFB 4MK7A 1I6JA 4U6PA 1TL3A 1IM4A 5KFJA 2XCPA 1TL3B 3I5CA 2IA6A 3DYAB 1DTTB 2RF2B 3NAIA 4QWEA 3HHKA 4FS1A 1LW2B 1FKOB 2J6SA 4B3OA 3FQKA 4B3OB 3FSIA 1S6PB 3OSPA 2E9RX 2YKNB 5KFCA 4Y3CA 1LWCB 5DLGA 3SFUA 3MR6A 3PW2A 4TQSA 4DEZA 3PW4A 4ED0A 4KO0A 3IGVA 4TQRA 3M9MB 4ZPDA 2E9TA 3GIJA 5HROA 2DPJA 1TL1A 1TV6B 5HROB 1JLAA 3QYYA 4HKQA 3BREA 1N56A 5F9NA 3G6XA 3NBPB 3V6HA 2OPRA 3DLEB 3H98A 4IKAA 3NGDA 1T05B 3GQCA 4JV1A 4URQU 5KFGA 4RW4A 4I7FB 3G6VA 4MFBB 5L1KA 4ECZA 4EBCA 1RT4A 4Q8EA 3M8PA 3MECA 1RT5B 4I2PA 1SH3A 3MF5A 3CJ0A 1LWFA 3H40A 2ASDA 1JX4A 4J9LA 5F8HA 4PWDA 2FVSA 4ECWA 2BQ3A 1RT1A 2D41A 3Q8RB 2IM3A 4NLYA 3KLEB 4FBTA 2R2UA 1TKZA 4IG3B 1EETA 2V0NA 5DQGA 5J2QA 4NLWA 4ED6A 2HNYA 2R8HA 2JEIA 2FVCA 4F4YA 2IMWP 4URGA 1OS5A 5K14B 4M95A 3KLFB 3N6LA 4J9OA 2C28A 4QWCA 4FBUA 1SH2A 3OL9A 1S49A 3DI6A 1TP7A 5KFYA 3LP0B 5KFOA 5KFPA 5KT2A 2BQUA 3QZ8A 2J6TA 4K4YA 5KFLA 1C0UB 3MEDA 1D0EA 1ZTTA 1SUQA 2W8KA 2IM2A 1QE1B 4ECRA 3TQ1A 3OL8A 5KFSA 3LP1B 2GIRA 4NLXA 5KG3A 3T5HA 2VA2A 2B5JA 3UPFA 3JYTA 4Y2AA 2VG7A 3KJVA 1BQMA 3LANA 3LP2B 3QIPB 2BE2A 2VG7B 1VRTA 1N4LA 4RNOA 3GILA 3FFIB 3HKWA 3RB3A 2J6UA 2WONA 1IKWA 1IKYA 2VG5B 2WONB 4ZP9A 5KFAA 5CYQA 2QV6A 3KK2A 1T03A 5KG0A 4KV8A 1W25A 2ZE2A 4RW8A 5CYMA 4KV8B 5C25A 3V6DA 3UDLA 3OHAA 5C25B 2AGPA 5J1EA 3KHLA 2JEFA 4ZHRB 4PQUA 1HMVB 5J1EB 1TKXB 2FLLA 3SFGA 2XCAA 2YNIB 3C6TA 3DLKB 3UQSA 1DTQB 3CIZA 5EWFA 3M9NB 5L9XA 1K1QA 5F8GA 4NCGB 5T14A 3FDSA 4JUZA 3KMSA 1C2PA 3H5SA 2V4RA 4ZP7A 4YP3A 3KHHA 4WYLA 1UWBB 3GV7B 3Q8PB 2I5JA 5KG1A 1RT6B 2RKIB 5HP1B 5HBMA 2C2EA 3QO9B 1JIHA 1S4FA 2JEGA 1HYSB 5C42A 3DM2A 2VG6A 2C22A 1FKPA 3MEGB 3PW7A 4IRCA 1HNIB 2W9BB 1FKPB 1HARA 4IFYB 4K50A 4DL7A 2FJVA 1JLCA 5I3UA 2W9CB 3DOLA 2ATLA 3BQ2A 4WFYA 4RNFA 5KFTA 3FQLA 2W9AA 2CKWA 5DG7A 3TAMA 3KLHA 4IH5A 4NRUA 4WE1A 2HWHA 3IG1A 4DL5A 2FJXA 3CDUA 2WTFA 2YNHB 3IG1B 4RW7A 3V4IB 3GV5B 1S1UB 3QLHA 3PJWA 2JC0A 4NZ0A 4ED1A 4Q0BA 4NLGA 1BQNB 2HNDA 4MH8A 4ZPAA 4Q45A 4ID5B 4RW6A 4YR0A 4EYIB 2W8LA 2GC8A 3LALA 1IKXB 2YNFA 3KLGB 1S48A 4YR2A 2ASLA 5KFWA 3CDWA 3HVTA 4ZVGA 3DYAA 1DTTA 2RF2A 4EBEA 4ECUA 3HVTB 3RBEA 3CJ2A 1LW2A 1FKOA 4XPEA 4H4OB 2YNGB 2AGQA 3JSMB 1S6PA 5DQIA 4KAIA 4RUCA 2YKNA 1LWCA 4ED8A 4R5PB 4QWAA 2UVRA 2FJWA 4K4UA 4J9NA 4G3IA 5L1LA 5F9LA 3IRXA 1RT7B 3IRXB 1TV6A 4IDKB 4Q44A 4LQ9A 4PUOB 1EP4B 3BSAA 3NBPA 4KSEB 4TLRA 3DLEA 3DRRB 3PJXA 3DRPA 3KHRA 3PVXA 1T05A 1JLFA 5EUHA 3DRPB 3DRSA 5KT3A 4YR3A 2WHOA 1JLFB 3GIKA 3DRSB 2BANB 4I7FA 3M8QB 2O5DA 4MFBA 4WXWA 1SV5B 4RU9A 1RT5A 3N6MA 3QIDA 2BRLA 4ZPCA 4ECTA 4O4GB 5KFZA 1S1WB 1J5OB 1LWEA 5C24A 3C6UA 1REVB 3CDEA 1LWEB 5C24B 1T94A 3C6UB 4WFXA 5KFRA 3BR9A 5F8MA 1HQEB 2B6AB 3T19A 3KK3B 1N5YB 5F8JA 1RA7A 4ICLB 3G6YA 4MK9A 3KLEA 4IG3A 2R8JA 5KFVA 1JLGB 3H2LA 1IKVB 3H5UA 2XWYA 4NLUA 2V4QA 2JC1A 1GX6A 4KHMA 5K14A 1S0MA 4M94A 4NLSA 3KLFA 4RUAA 4YMEA 5KG5A 1S97A 3NAHA 2AGOA 4GC7A 3QGGA 3PHEA 4NLOA 4O3NA 4IRKA 1S6QB 2JLEA 3MFHA 3LP0A 2OPSB 3KMQA 1KHWA 1ZTWA 3H5YA 4LSLA 4LSLB 5KFDA 5J2NB 2FLNA 3HVAA 3I0SA 1C0UA 2IJFA 3I0SB 3BQ0A 5KFQA 4TY9A 2UUTA 1QE1A 5I42B 2IAJB 5EDWA 3RAQA 2FVQA 3LP1A 2B43A 3KLIA 3V81B 2R2RA 1RT2B 4MIAA 4U7CA 3KLIB 3QIPA 3LP2A 4H4MB 2AQ4A 4Y2CA 4IFVB 3FFIA 4KFBB 2IBKA 5KFKA 4IH7A 2R8IA 2VG5A 4RNMA 3ISND 2XGPA 1TKTB 4O4RA 4LSNB 2ZD1A 2ZD1B 3GYNA 4TY8B 1C1CA 1S1TB 1HMVA 4ZHRA 2OPQB 1TKXA 1RTDB 1C1CB 4KE5A 3MR5A 5J2MB 3I5AA 1S9GB 2YNIA 1NNDA 1S10A 1QAJA 3DLKA 4O44A
chains in the Genus database with same CATH superfamily
1DTQA 3WDOA 2LFVA 4TLQA 3GG1A 5MAOA 4ERDA 5HP1A 2XQCA 3CCMS 3D6TB 5LT5A 2RT3A 4K5SA 4FNHA 4LF5F 4F4ZA 5GAGI 4W92B 4NCAA 1MU2B 2YNHA 4DS4A 1AT1B 4Y2MA 2M2BA 4ID5A 4BS2A 1IKXA 1VQ9S 1FE4A 3QGIA 4DR7F 3CMES 4DL6A 3LPYA 3B4MA 3SIPB 2F63A 2IJNA 4ED3A 2DRAA 4QIEA 2M7SA 3R5GA 1RQ0A 4AD6A 3DRRA 3W3SA 4CLLA 2AJFE 2X7IA 5ETQA 1FHTA 1H7WA 1SJ3P 1VGYA 1VJQA 2U1AA 4G1PA 2OSRA 3HF5A 1DRZA 2DJWA 2GCFA 3CJ4A 1AFJA 2DEIA 2WBRA 3TZXA 3P3DA 1U1NA 1M5PC 2VBWA 4X4OA 1FERA 1Z2ZA 2R7XA 3DXSX 2X1FA 3EWGA 1RT2A 5J2QB 2KG0A 1VBXA 1UFKA 2RMLA 1QAIA 4GC6A 1M5KC 3DGVA 3MM9B 1JXLA 1R0AA 4OLPA 1HA1A 3QZ7A 2EFPA 4UTGA 5JVHQ 1SH0A 1M5VC 3GFYA 4DF8A 1R8BA 2JLFA 1HR0F 4ZLNA 2OD4A 4PQUB 3BJYA 1U6FA 3OW2R 5K8OA 3MMAA 4CM0A 2OFHX 4ZMMA 2C2DA 2V4JB 3KNAA 4N77A 4JI5J 4O3QA 2G2OA 1JLCB 2IIHA 5AXKA 2N3LA 5HQMA 1TUVA 2HYIB 2PGCA 1MW7A 2FDNA 5B0DA 2M5YA 1NRKA 1NHUA 2KU7A 2A1BA 1DTTB 3FSIA 1VBYA 2YKNB 4LF1A 3FEZA 4OI3A 1X5SA 4E0DA 3R9LA 2IMOA 2OPRA 4X66F 3GQCA 2AJ2A 4MFBB 1SH3A 1CJTB 4DN9A 4X62J 3TNVA 4F7VA 3M2VB 4N56A 2D69A 3F56A 4NLYA 4JI7J 4LF9J 2A6OA 3R5CA 4PWUA 2PI5A 2EKYA 2J0SD 2MQPA 3UNYA 4OFZA 2DR5A 2YPZA 2AP6A 1VHIA 2ZKTA 4OX9J 1FRMA 2VA2A 2VQFF 3HJFA 1VRTA 1B0PA 3T6BA 3N4WA 3DOMB 3X1LB 2OIHA 3PCOB 3L4BC 5B0CA 1MN9A 4KV8B 3MPDA 3KHLA 4ZHRB 5J1EB 2CAJA 3C6TA 3PO5A 1KKHA 4JUZA 2WZ1A 2DNKA 4WYLA 1UWBB 1URNA 1S4FA 2DT9A 1N52B 5C42A 2IYGA 2F8HA 1FKPB 3EXYA 3G8QA 4DL7A 4RNFA 5KFTA 5IQQA 3DHXA 3UW1A 2QMWA 3GV5B 1S1UB 3HXMA 3JQJA 1H38A 2CQCA 1FEEA 1F9HA 2HVEA 4WK1A 1YI2S 4F0KA 2UVRA 1WSVA 4LSZB 2GO9A 2HGLA 2BACA 4ENOA 4UUWA 4ZJLA 3NBPA 3J7YI 3KHRA 1WC6A 1VQMS 4WXWA 2DITA 5U47A 1RT5A 1H72C 2BRLA 2HQIA 3L7PA 3EYZA 3C6UB 3P8BB 2AJ4A 2PO4A 4MK9A 4CTAA 1OSDA 1IKVB 1SQGA 2KH9A 1A0OB 2V4QA 1GX6A 4C6AA 1S0MA 4NLSA 1IUJA 2XHWA 2AGOA 1XBWA 1S12A 4Q5VA 1PJ6A 3UN3A 4ZVPB 4FXDA 2IJFA 3MCMA 3BQ0A 1WD6A 1I94J 3QJPA 2WBMA 3N9UC 3WX8A 3BKFA 3ZZUA 1Q78A 3SCIE 3CF5Q 4Q2LA 2XBPA 2LXUA 4XIUA 2M70A 1S10A 1FDNA 3RBDA 2M88A 5LMUF 1QUVA 1IBCB 5T7LB 4ANCA 3OL6A 1IQZA 2RKIA 3R7NB 3EE3A 1KD1T 4M5MA 3RU0A 1HNVB 2B0GA 3BF4A 4C2MA 4DQPA 2CDQA 2D3UA 2CJBA 1RYSA 2P6SA 4C8OA 5A8KB 1X60A 1R8PA 2W7PA 1PCAA 1TELA 2H4WB 3U1NA 3VVUA 2ZKUA 1ROFA 1UMJA 1H0HB 2UVWA 2NUHA 2PI4A 1XR6A 3CIMA 3C66A 4N76A 1WOPA 1NK6A 3CD7A 3IGNA 4Y6IA 1GMWD 2QG9B 5IWAF 2BYCA 3DGPB 2UUCF 1HBOA 4WKRA 1NPPA 4HR2A 4F8RA 1TQLA 2RQ4A 4O4GA 1S1WA 2XM3A 1REVA 1OY8A 4DR1J 4HHHA 4DR5F 3PRVA 2V2ZA 3D28A 2EG1A 1JLQA 1YJRA 1NH8A 3NOGA 2J8AA 3NMRA 3D5MA 1N5SA 2XLIA 1VQ4S 5IZHA 5GMKa 3JS9A 3SZ2A 3ZTOA 4LSNA 1AZSB 2UU9F 2Z56B 5ETVA 4TY8A 4B9MA 4ZVHA 2HLUA 3PEJA 3M6UA 3QRQA 3CSKA 2WRMA 1KLMA 5D3GA 5KFMA 3KJVB 2BDPA 1HBMA 3R8YA 1X4AA 2XS5A 3DKDA 2K3KA 1C0TB 3CCZA 5JXSA 4CM2A 3CDBA 1X0FA 1WNEA 3IN5A 3HKZD 5D78A 1FK9A 1HKAA 1X31C 1KRPA 1TK0A 3QRPA 1L3UA 4OYOA 1S1XB 2XGQA 3AOBA 3LGHA 3PR5B 2L48A 2D7SA 4HACB 2BABA 1KHVA 4OYWA 2HK3A 4QYRA 1L3VA 4M8LA 2DGSA 1S6PB 2ZH3A 3TJAA 4TQRA 4RO0A 1JK9B 2KYXA 3W2WB 2LEPA 1Y5LB 3M1VB 4AUKA 1T3OA 1OWXA 3MMBB 5L1KA 1S6UA 1KQSR 1YHQS 2BBEA 1JX4A 4J9LA 1KP6A 4GO7X 2FVSA 2CYYA 2V2QA 3Q8RB 1FXRA 2ZBPA 1HL6A 2YH1A 1TKZA 1TKDA 1KVIA 2I6WA 3CCVS 2Q6BA 3N6LA 3HZEA 4WP8A 2Q1LA 1S6OA 3D54A 2RU3A 5E5NA 3RW6A 4WWSA 4IO9Q 5KFLA 2JNJA 2MMYA 3MEDA 4I0WA 3MUVP 2IM2A 3MOJB 1NO8A 2YWGA 2DH8A 3I4HX 1U1OA 2V9KA 3UR3C 2CVIA 3Q2TC 1YBAA 4A8WA 4P6QA 2MZRA 4GKJF 1TKXB 2XCAA 1SBRA 3NWGA 4NZ6A 1K1QA 1FXLA 1FDBA 2CG8A 3UD5A 2CG4A 3CMAS 5KG1A 1SJQA 1HLWA 1O0PA 2V34A 2E5LJ 3OD2A 4K50A 4DX7A 4DSLA 1V6HA 3LUYA 4DQIA 1WC4A 4CO0A 3PIOQ 1QVGR 2DNYA 2LDIA 2WTFA 4B9TA 1RWOB 1SJFA 2C3MA 4YR0A 3KLGB 4QZVB 5HVHA 2DNQA 5SZTA 1YRXA 4HI2A 3A8KA 1HBUB 3V4MA 1LXNA 2LLZA 2DISA 4KH0B 4ED8A 1DZ5A 4LQ9A 1EP4B 3BSAA 4USHA 5HMWA 4KSEB 1T05A 3DRSA 1FNMA 2HHTA 3S01A 2ZHAA 5J1NA 2J9DE 1S5ZA 2VFTA 2ZZNA 4B3RF 1RA7A 2ACYA 3CW2C 1IBLJ 4MJKA 5K14A 2JLEA 1LWXA 1WC5A 2ZVIA 3Q86A 1N54B 3R1HA 1TUGB 4NA1A 2EFQA 1EAYC 1YJTA 2HFZA 2DO4A 1XMOF 1FXDA 4IH7A 4RBTA 2V8VA 4RNMA 3ISND 5LMNF 4ZOSA 1RTDB 2VKRA 1TU0B 4JI3F 4U67Q 2RUSA 3PTWA 3PRDA 2E1PA 3ULHA 2MKCA 4MTPA 2ROEA 2L9WA 3GIIA 1RTHB 1PAUB 4Y2IA 2MKJA 1BQNA 4EBDA 1XC9A 3C16A 1UJ5A 1GEHA 4J9MA 4PAAA 4AQYF 2W4PA 2XC9A 3WQPA 3WZ0A 2K2PA 2YNGA 3R7BB 4YY3J 1KWMA 3UDVA 3EGZA 4R5PA 4G1IA 3NNHA 4JB8B 4DL3A 1U2CA 4AXIA 1Q8IA 2YKQA 2PEHA 1G1XA 2JH3A 4OV6A 5LSRA 2HQFA 5H1SV 4G1QB 3H20A 2MKIA 1C4CA 1NKBA 1FRLA 1N5YA 1RAEB 2FVPA 1TL4A 1TL1B 4NRTA 3GIMA 5L8RC 3IP0A 4DUZJ 2YWHA 5KG2A 4RW4B 3HHLA 3EPIA 1KTQA 1YGYA 1RT4B 2KHDA 2CQ4A 2FIUA 1U6ZA 1RB0A 3ELHA 3V81A 1UPPA 4NLQA 1LEOA 2WK4A 5DG8A 1J5OA 4O0IA 3K58A 2CRLA 3BR8A 4OHZA 4K5RA 1JB0C 1IKWB 4R8UA 1BMQB 3EUNA 4RW8B 1G2EA 4K4TA 3D3BJ 1U09A 2RS8A 2HBQB 3MI7X 3SEOA 3HD2A 1C1BA 2VONA 1IBMJ 4DQRA 1UEUA 2IM0A 2N82B 4IO1A 3GIRA 4RW7B 2VA3A 1RTIA 5EGYA 3X3UA 2HNDB 1L3KA 1OYDA 5GAGU 5A8WB 2NUUG 2IPOB 3Q8YA 3P6YC 3MR6A 1TL5A 1YKWA 4B3SJ 4ZPDA 2XEXA 3AY0A 3QYYA 3BEGB 3SQGA 2DNLA 3BREA 3LGMA 2M8HA 4JV1A 1BD6A 2MDAA 2FHKA 2Y1LB 3M8PA 1X5TA 4EGLA 2RAQA 4C0BA 3EGWB 3TJ9A 2H3EB 4IG3B 4ED6A 1NDPA 4M95A 4QWCA 1V9OA 4USMA 3LP0B 3IC1A 3UN2A 2BQUA 1PKUA 4K4YA 1LK7A 4LT6A 1S57A 1R0BG 4LFCJ 2VG7A 1CJUB 4P74A 5AE3A 3GILA 3HKWA 1UJ6A 3FMBA 2CNOB 2BV3A 1AW0A 2ZE2A 3OHAA 5C25A 1R3NA 2K8GA 3D0HE 2FLLA 3CIZA 2EVZA 2DHSA 2QLBB 2MY8A 4YP3A 5THWA 2HKEA 4KC5A 5SUHA 2QL9B 5M2UA 2MGZB 2DH7A 2JEGA 5AJ3J 1RAFB 3VR1A 4AT1B 4TKTA 3TX0A 4OX7A 4F25A 3M8RA 1HWUA 1WI8A 2ZJRQ 3LALA 1CEZA 4NA2A 2FUG9 2PC6A 4RUCA 2PA8D 3BDEA 3MPWA 2Q6CA 3RTVA 2VFRA 4NL5A 4OZ2A 1TL7B 1TV6A 5IV4A 5F0UA 4NEYA 1XJWB 4OZ5A 4RR5A 2N7CA 1NKCA 3GIKA 2BANB 4CYUA 4DV5F 5C24B 3UVJB 3BR9A 3W63A 4G6VB 2D3OR 3OXLA 1X0PA 2Y8WA 2J9EA 1X4FA 2J9DA 2LP4A 5IXUA 1KVKA 4PXCA 1KHWA 3DXBA 2FHMA 4YEAA 4JYAJ 2KRBA 2LU1A 4DZ6A 2F4VF 3W9JA 4CH1A 3Q24A 3IO1A 2R2RA 3D7SB 8RUCA 1F1BB 1RWWB 1YJNS 2AQ4A 4Y2CA 2HHQA 3GR1A 2VG5A 4DV3F 2FQQB 1NZAA 4ATNA 2B9WA 1UFWA 3THTA 4D3GA 7FDRA 1QAJA 1T9XA 2J7KA 2OSQA 4Z37A 3BH7B 2I1RA 2WSEC 1XNRF 4DG1B 1S4EA 4PQAA 2AYGA 3AT1B 4X4TA 2R4FA 5K8PA 2NXCA 2WOMA 4KRWA 4ECSA 4F2SA 1DLOB 3DOKB 1RK8A 4PYAA 2UXCF 1N33F 3KDNA 1HBNB 4AFFA 1RI7A 2HGNA 1NSQA 1XR7A 5KT7A 4H4OA 2CNKB 3C46A 5DLFA 3ZTQA 4QYZK 4F4AA 3PHTA 2ZBIA 2AV5A 2YKMB 2XLKA 1WDDA 4FYVB 4CIOA 4ZP8A 1EKSA 4OYMA 5GADI 1RUSA 3IM9A 3DU5A 2N3OA 1SQFA 2ZITA 1E6VA 5K20B 3I32A 1P1LA 2Z58B 3R7SB 3BQ1A 5HVGA 2QRRA 4DX6A 4JI1J 4A8OA 3O44A 3W5XA 1WWHA 2G1DA 3M32A 4QPTA 2GHVC 3ZC4A 4X66J 1DY3A 4I68A 9RUBA 2VFSA 3E2EA 2OPQA 1TK8A 4QPXA 5J2MA 8AT1B 1DARA 4X2BA 2AX0A 1FNXH 3G96A 1R0AB 1U0HB 2KXNB 1KQFB 3I0RA 4ED7A 4NEZA 1WELA 4HH0A 2ZNZA 3PKYA 2DBBA 3J81j 3EXCX 4F50A 1RT3A 4KKOA 2UP1A 1M1HA 3H4DA 3CJRA 2DK2A 3MM6A 2W2OP 1T3NA 2A2DA 1VR6A 3JSYA 2XI2A 1Y3KA 3OR2B 2DR7A 4J37A 3VGVA 2KB2A 1RA6A 4BC9A 2Q3PA 1TL3A 4DU8A 1FRIA 3E3XA 1RCOB 2VPZB 3B4DA 2DVIA 4M5JA 2FY8A 3GPAA 5A2QY 1X4HA 5H9EK 1GQEA 4URQU 4I7FB 5A6PA 3IM8A 3MECA 4YDDB 5B0EA 2ZHOA 1I3OB 1N5QA 3KJQB 1KOOA 4PWDA 2C3PA 2GFFA 3BBFA 1GTEA 4CLWA 1YIJS 2HHUA 5GAHI 2JEIA 3LPEA 1MWQA 4AYBD 2C28A 1MWYA 1TTHB 1YRTA 1SIWB 1YDLA 1WF2A 1WG1A 2RH3A 4WBFA 1ZTTA 5E3QA 3CCQS 4G65A 4X4RA 1BQMA 1NAQA 1DFDA 4QU7A 1VFJA 2EPIA 3AJ2A 5CYMA 4DBQA 1X9SA 2AGPA 4FVCA 2NPFA 3M30A 3M9NB 5F8GA 4ZLPA 4DFKA 1KTVA 4LUBA 3TEHB 2I5JA 2HWTA 1RAIB 2VUGA 3TZZA 5A6WA 4DUYF 1QAXA 4LMZA 3CT9A 3A8EA 3FQLA 3MOZA 3TAMA 3KLHA 1F6TA 2CZVC 4B3MF 5A0YB 2FGOA 2JC0A 4D3HA 2JL9A 2ZJQQ 1E6YA 1FTCA 2OUGA 3I4PA 3ZO7A 5DDOC 2B9XA 2XYHB 5HQ8A 4L72B 5DZ7A 4YHHF 4QWAA 3TZWA 2QMUB 2YY3A 3DC2A 2MSTA 2HQDA 2ZDOA 3HHEA 4P9SA 3H2UB 1AUDA 3IR7B 3M8QB 2O5DA 3BDPA 4QU6A 2KHCA 2HS0A 1Q8BA 5F8JA 4DUTA 5KFVA 4DPUA 4AL5A 5IWAJ 3T1YF 2UUCJ 4H4KC 1VC6A 1U26A 1VBKA 4C8ZA 3K5MA 4GVBA 2DNRA 5E33A 1QE1A 3IWLA 4DR5J 4CZCA 3IR6B 4QIWD 4H4MB 1YBUA 1PJ7A 3G8TA 1Q8LA 4PXEA 2F9JA 4KGMA 2A0FB 3NGTA 3QAUA 3D9BA 3DLKA 3U02A 2YNIA 3DMJA 3MM7B 3SCKE 3HHLD 2NXNA 2R7WA 3OSNA 3ISNC 2Q66A 1WHVA 2XYGB 2W9CA 4DPOA 1S0OA 1SKRA 3K17A 1FEHA 3LH2S 4URSA 3V4IA 1DBDA 1CJVB 1NHVA 4P2FA 4J7CA 4DS5A 2DNOA 3D6FB 1ZAVA 2LA4A 2QSFA 5IM0B 5IFMA 3UCZP 1RT7A 2VBZA 4IDKA 1ZS6A 3ZTRA 5KFHA 1FRKA 4B9SA 3KUHA 4I6AA 3MTJA 5EHHA 1HNXJ 3PYDA 2WVFA 2IJRA 3BZQA 2FVRA 2GVZB 1IBKJ 1JLQB 3H42A 4HDHA 3UO0A 3Q8SB 3ENVA 4QR2A 4NLRA 2OMOA 5J2NA 1KVJA 4EU0A 2BJ1A 4PXDA 3EVOA 5F8NA 5GMEA 4NLTA 4JI2F 2HPUA 1U8SA 4LVOP 4KPYA 3VALA 2O3DA 3M9OB 5KFNA 2QA4G 3S8SA 2EG2A 2Z30B 4OZLA 5HQLA 3ILLA 1HQ2A 2MPUA 2DIVA 2BEFA 2BX6A 2R8GA 3BS9A 1YTYA 5IOLA 2X1BA 4JI5F 2HURA 3S6EA 2FJEB 2GJIA 1U1QA 3RB6A 4KT0C 3ITHA 5D0EA 5FDLA 3MPVA 2R7RA 1CQMA 1QAYA 3FJ2A 1K73T 3Q8UA 1U45A 2IC3A 3DM2B 3HFKA 3CJ3A 3R6GB 3MAAB 4DLGA 1MLAA 1RTJA 3C19A 4TXSA 3DOLB 1Q0NA 2F65A 3BO2A 4WE1B 1RE1B 1TVRA 2AT1B 3LO3A 1HHQA 3UE2A 4MIBA 2BJ8A 2OTJS 4ED2A 4Y2KA 4RL1A 1K47A 3JQKA 4FP9A 3DYAB 4QWEA 3OFGA 3W8GA 2U2FA 3FQKA 2BOAA 4X62F 2RDDA 3IGVA 3NG8A 1JLAA 4JI7F 3H8YA 3PACA 2LMIA 3TRGA 4LF9F 3G6XA 3NGDA 2F1FA 1BLUA 3MM8B 4I2PA 1IJEB 2H5EA 2C42A 3FVYA 5F8HA 5C2CA 5GVQA 1SL0A 3KLEB 3KUEA 1Q4RA 5L38A 2Z57B 5KFYA 1FFSB 4B3RJ 1JJHA 1H7XA 1RBLA 2W2MP 2HFVA 4OYPA 1APSA 4FYWB 5KFAA 4ZP9A 5CYQA 2ERRA 4TU9A 1YITS 3V6DA 3CCES 4J90A 1NSPA 1OPIA 2XMWA 5T14A 4MKVA 4KYZA 2V4RA 3L7UA 1SQEA 5EN1A 2C3UA 4IFYB 2RS2A 3CJKB 3CE8A 2ASYA 4HI1A 3OR1A 1UVLA 1SB6A 3RJMB 2DRDA 1IWAA 2HWHA 4DL5A 5I3PA 3AB2B 4NZ0A 4ED1A 4OIXA 4NLGA 4C4WA 2K3IA 1U1PA 1UVNA 4QYZJ 1M5OC 1QSSA 1FKOA 3WC2A 3JSMB 4XDDA 3C14B 4KGVB 3D1HA 2B9EA 4EZ9A 4GVLA 4PPDA 1MROB 2HW3A 1S99A 3CCLS 4AQYJ 2WHOA 3DRSB 1B4SA 2E5GA 2ZH6A 1SV5B 2MSSA 4QCLA 4ZPTR 5F8MA 2FHOB 2QGFB 1I94F 4DQQA 4ICLB 5ETLA 3ILOA 1F60B 2Z2ZA 2CDRB 1FRJA 5F3TA 2EFOA 2LEAA 2DHAA 4GC7A 2PEBA 2OPSB 2VQEF 1ZTWA 4RUHA 5C7PA 1WKJA 3VAGA 2KZMA 4LF8F 1ZZFA 2IAJB 1WOSA 3J7ZT 4WU3A 4U7CA 1UAWA 1LQ9A 3GSIA 4KFBB 3DDIA 4OJ1A 2R8IA 3UD4P 3CB4A 1TKTB 2ZJPQ 1HMVA 3B54A 1S9GB 1CPZA 3G71S 1FWLA 2JRSA 2F7VA 4IG0B 4HTJA 3MCSA 2FY1A 2VDIA 3MHYA 4R0EA 5DS7A 1RT6A 3QO9A 3WIUA 3R2DJ 4RLEA 1HNIA 4L3NA 4XK8C 2LU2A 1F5AA 3KNGA 3W8PA 2W24A 2G13A 3VQTA 3VAFA 2DCUB 1U02A 1ZH5A 3CTRA 3JSBA 1IR0A 4DSJA 1ZPVA 4NX9A 4OYZA 4X4UA 2DR6A 5IT4A 2G0CA 4N47A 2OPPB 3CULA 3EDRB 3SQOP 5GMDA 2AEFA 1FJ7A 5AT1B 4DL2A 4PZVA 3H5XA 3H90A 4PUOA 4LR8A 3PO4A 3SI8A 1RWKB 5H9EJ 4HTIA 5GAEI 2QEXS 4DU7A 2GZOA 1AXQA 4OI1A 2V2KA 4WYWA 2BW2A 4WFZA 1S77D 4DMZA 1U1MA 1J2VA 2ZM6J 2FZGB 3ISZA 5FJ4A 4DFJA 2JWNA 4DHVA 4DSFA 1VQYA 2XTJP 3N01A 2K7JA 5MLCV 2EI5A 3RAXA 2W2PP 4NLDA 4PG6A 3ZZZA 2IBOA 2V69A 3V6KA 4TYAA 3AHPA 1SUQB 5DRKA 1T9TA 5KG6A 3BGRA 1WG4A 5KFIA 2C1EB 4CLYA 2QC3A 1HI1A 1TMMA 1GXTA 5KT4A 2VB6A 4QWBA 1N88A 2AU0A 4YDXA 1XN9A 3QBCA 4C8MA 1RWNB 2IDLA 3T5LA 1C1BB 2OAUA 4TU7A 1PAEX 2KFYA 4DQSA 3EZUA 2VBXA 3A8IA 4ETXA 1K0VA 5I3UB 3GTYX 3DCAA 3CJTA 4KQZA 1J5EF 3PY8A 1JKHA 4I4BA 3US5A 1I5OB 4RW9A 3WBZA 4RW6B 1EHWA 3GB0A 2DR9A 3OVSA 1RJJA 2RF2B 4FS1A 1LW2B 2MQ8A 2VHGA 1TK5A 1FD2A 8ATCB 4DWIA 2IYIA 2VH7A 2V8PA 1U1RA 1PJ5A 3SQGB 1KDNA 1PG5B 5LSOA 1EB0A 5KFGA 3MAHA 1F3FA 1GXLA 5CZXA 1H73A 3P5BP 5D6GA 3J80U 3IA0A 1WF0A 4OZ0A 1EETA 4F4YA 2GAGC 3N5FA 2ZH8A 4M5GA 5KT2A 4B9LA 1T9VA 5B0FA 3TQ1A 3ZXWA 4P7VA 3LP2B 2VG7B 4DX5A 1IKYA 2E5LF 5LJ3Y 6FDRA 2VODA 3AJ1A 1GMVA 5C25B 4P73A 1VQSA 2OI2A 2HAFA 2ZUGA 5EWFA 2F4VJ 2RIJA 3M2RB 4ES3A 4DV3J 1SIZA 3PW7A 2PA3A 4P7TA 1X4DA 3GU0A 4TNOA 3TA1A 3QLHA 4ZPAA 1REGX 2VC0A 2FTRA 1VJWA 3CJ2A 3D1OA 1YSJA 5DQIA 1ZA2B 1WORA 4CI0B 1Z1ZA 2L9NA 2XYPB 2RQCA 1R8HA 3VAJA 4NMXA 3UNGC 2UXCJ 1NDKA 3GWCA 1IBLF 2YX4A 3DLEA 1QSYA 1TFYA 2DB1A 3PG9A 3R97A 2RNEA 6FD1A 5HATA 3SDEB 4CYUB 2HEKA 3CDEA 1GAOA 3KK3B 3R3TA 2P2CB 1KEKA 4RU2A 3PYFA 3QT7A 4M94A 1H6KX 1B70B 4J9UE 4NLOA 2GGPA 4V19J 3KMQA 5G0RA 5IV3A 5KFDA 1H2UX 3MMCA 1CVJA 2CQ2A 2HHHJ 1SKSA 1R6VA 3FNNA 5I42B 3DDNA 2HIQA 1OQ6A 3QIPA 2I8EA 2A10A 3EMTA 2HHPA 1QVFR 4ZLJA 3AFGA 3NS7B 3OXGA 2CJAA 1CJKA 4F4XA 4UF4A 3VHQA 1AUSL 4LF7J 1L3SA 3I55S 3MEGA 1OY9A 1B7FA 3D2WA 1R31A 4CO4A 4ALZA 1Q79A 4WXOA 4O3PA 2WOMB 1LFPA 1CSJA 5KT5A 3M8WA 3VQSA 4C8YA 3B78A 5D4NA 3MEEA 1VQPS 3AXMA 3FMWA 4O3RA 4UY85 1VYAA 4XPCA 2BM1A 3KG4A 4C3LA 4ELUA 5A2QU 2PIIA 2KXHA 4IRDA 4P71A 1H2VZ 4DUZF 3A1YG 2CPJA 4TVAB 2LQ8A 4EYHB 2V8GA 2HRYA 4OYAA 3O3LA 3W5ZA 4JI4J 2QLJB 4CQ1A 1JLBA 1WJ9A 4HT7A 4RUBA 1S6QA 1X5OA 4DN0A 3MM5A 4X4PA 1FKAF 2UVVA 2CQHA 4M5IA 3J7Z5 2WCXA 1VQ5S 1AROP 3HJVA 3G86A 4YN3B 5BR8F 2IVFB 4C3MA 5JMNA 1X4GA 2BRKA 2AF6A 4MKBA 3EPGA 2XMJA 2ZBCA 2UXBF 1RAJA 4USKA 1IBMF 4B17A 2E1AA 2ZH1A 4CDIA 5LXYA 3DLHA 3MWBA 1XNQF 2RRAA 4KPCA 2NREA 5E0OA 2WB4A 1MU2A 1DAXA 4ZCMA 3MFIA 1D3WA 3LGNA 3HHDA 5E3AA 3TUZC 4J9SA 2VD3A 4KB7A 2RE1A 1NMEB 3BGOP 4OV1A 2YWKA 2ZZTA 3AA9A 5F41A 3QFHA 4B3SF 3NP5A 1I6JA 1TL3B 1WTFA 3I5CA 2IA6A 5DDQC 3NAIA 4DR4F 3SYZA 1LNQA 4B3MJ 4F02A 1RWMB 4ED0A 2QIFA 1IN0A 1UPMB 1U49A 2OLWA 4HKQA 4LRBA 2MQNA 4PEOA 3RUBL 2DR8A 2MQQA 4JP8A 5BYSA 3H2VE 2KN4A 2ALYB 5HL7Q 4HVZA 2GMLA 4I64A 2EW9A 5J2QA 3R5DA 4USJC 3K89A 3KG1A 3QZ8A 3MM9A 4Z7YA 2DYAA 4DSKA 4C8KA 1HW9A 4NA3A 4ECRA 5KFSA 2GIRA 1S72S 1EKRA 3LANA 3T1YJ 2CIMA 1PC4A 4PQUA 5CQGA 1RAAB 2YKOA 3MAQA 1X9MA 3UI3A 2XWXA 2XMVA 4F2RA 1HI0P 3PXGa 2V4JA 2MKKA 2B7BB 1UTAA 4RJVA 1WEZA 1BHNA 2W9BB 4A8MP 1JLCA 1M5HA 4DV4F 1KC8T 1PILA 2ACMA 4H4KA 1YJUA 3NXZA 2YWEA 1UJ4A 1VS3A 4U9RA 4MH8A 5F3ZA 1XTZA 4ZN1A 1DTTA 3D4JA 3THVA 2YKNA 2NXJA 2ZZMA 1TAUA 2UZAA 2M4MA 4J9NA 1VC5A 4ZVUB 2CNNB 3SV3A 3IRXA 2NQPA 3SSRA 1VCTA 4B9NA 2V63A 1SCJB 1MN7A 4LBHA 4MFBA 3QIDA 4ZPCA 1G3OA 3K57A 1ZZNA 1LWEA 4A8QA 1CJTA 1XK8A 4JYAF 3T19A 3M2VA 4X84A 4DFPA 2B3TB 3R5JB 4F3OA 4B9VA 4BDPA 4NI2B 2UV8A 4LSLA 4LVNP 3I0SA 3Q0AA 2I0XA 3M4XA 1YWXA 3ET6B 2RQMA 2EKNA 4UQTA 2UUTA 2W1BA 1VI7A 3P45B 4IFVB 4X4SA 4RKUC 3DOMA 4LRFA 2ZD1A 2R7VA 2ZDPA 4ES2A 4ZHRA 1H98A 2B51A 3DMJB 4JI2J 1D9DA 1K9MT 1SC3B 1KFDA 3NKYA 2V5HG 1UWBA 3T1AA 2QZ8A 2M3DA 2FJDB 4ZP6A 1HHSA 2XMMA 2GAHC 1S1UA 1NPKA 2VV5A 3G9CA 1UETA 1S0NA 3CJ8A 4Q2MA 1FFWB 3TYTA 2ROPA 3LW5C 1S7IA 5EWEA 4C11B 3CVKA 1VRQC 4ECXA 3C2PA 3T5JA 1HIYA 4YB7A 3OUYB 2CVEA 4PABA 2IRYA 4IQXA 4EWTA 2HMIB 3UDEA 3GE9A 2X1GA 2CPIA 1M1KT 1TMJA 2OP5A 3OJSA 4NXNF 1G6BA 4WZMA 2PDAA 3QJLA 4DPYA 4NLVA 4WF9Q 2NLWA 2RDJA 2HVIA 3CCWA 3MR2A 1KR4A 4E98A 4JI1F 3VAHA 1XERA 4RWXA 1CG2A 1IKVA 1RBAA 3QNWB 4ZVEA 1YJ9S 4A48A 3S1TA 3T3FA 1PC5A 1VQOS 4I2QA 3IWXA 3MXHP 4DPXA 2CPEA 3R27A 4Y34A 2F8MA 3GSDA 3FBCA 3TAQA 2Y8YA 1RT1B 4H54A 3GZ7A 4DV0F 3CWJA 3MZIA 4QBUA 2DNNA 2JDJA 2IM1A 3RYLA 2KO1A 1YJVA 2AX1A 1T95A 3OXFA 1R43A 3UCUP 3QT6A 1QLNA 1WKLA 3N6NA 1U24A 1SKUB 2R2TA 3GYXB 3GP9A 5T7LA 1HPZA 3ICLA 3JYTB 1Q5VA 1M5SA 3TAPA 4X4VA 2X1AA 1SKWA 3BSOA 2L3MA 1HNVA 4WPAA 2HS4A 4GRSA 5FDLB 5AXNA 3JTPA 5A8KA 1WF1A 5KFEA 4ZVRB 2VF3A 2M9KA 4CO1A 3RBXA 2F40A 4EO8A 3PZPA 1Z4UA 3NNCA 1FA0A 3HFVA 1I1GA 1NH7A 2CQ1A 1O6XA 2ZC3A 3MTKA 4Q0BB 2JEJA 1WI6A 3TANA 5ETRA 3L09A 4KR0B 4U6PA 1IM4A 4PG7A 3DGPA 2D9PA 1T9UA 2GW8A 4LREA 3LOUA 2EXUA 3M7VA 4FNIA 3PX4A 3BKTA 4LF6J 2DGQA 4WFAQ 1RBOB 5D15A 2NXUA 5LL6d 3GJTB 4XDCA 2D41A 1LFWA 2V0NA 1F2GA 2QLWA 5GAEU 3ILIA 3SBMA 1ZM2A 1C0UB 3OL8A 3PFOA 5CCLA 3KJVA 2CQGA 3CC7S 3D67A 3TUIC 1FVQA 2VQEJ 2MJNA 1JJ2R 5FLXY 4LF8J 2J7UA 3TA0A 2FJAB 2ZOGA 4UQGA 1R0CB 5F0WA 4NXMF 3HDSA 3T1HF 2QLFB 2O67A 1A9NB 3K5PA 1U1KA 4FF1A 5IC6B 1UCNA 2W9AA 3IG1A 2FJXA 3CDUA 3OVAA 4WJBA 4Q45A 2ZWPA 3LQVA 4HACA 1N32J 4EYIB 1S48A 1K0TA 2ASLA 2ZH7A 3CDWA 3HVTA 2NS1B 1RXOB 1RKIA 4MT1A 1S6PA 3UD3P 4G3IA 3QATA 2Z2LA 1ELOA 3W2WA 3NOCA 3M1VA 3R1LA 3TZYA 3MMBA 4RU9A 1HQEB 2P9GA 1M90T 4M5DB 1Y5NB 2Z2MA 4NYOA 1UA0A 1JLGB 3H2LA 2AJ1A 5KG5A 4WIIA 4IRKA 4OZNA 3MFHA 4FF3A 1RHQB 2LYVA 3PFEA 3LA0A 3M8ZA 3ZZYA 1KONA 2DNZA 1HNZF 1QJHA 1CS4B 2CJKA 4DX8H 2VIHA 5B7WA 1SPBP 2IBKA 5KFKA 2YTCA 2P9EA 2Y0SD 4O4RA 3VF0B 5L39A 1C1CA 1FDDA 1TKXA 2WW8A 5FIIA 4O44A 4DPWA 4DZDA 1UVJA 4PG8A 1O8BA 1JLEA 2GQ2A 2O01C 3GYGA 4AL7A 4OJHA 4ER8A 3CCJS 3IAS9 1O51A 3RBZA 3SSSA 1SJ4P 1VC0A 1WHWA 2YH0A 4YQWA 2V9WA 1VRUA 3RGIA 1GX5A 3NMAA 1F5BA 3KXDA 3OPKA 1R7IA 4WCEQ 2IVYA 2W2NP 4YUDA 2N4DA 3FUYA 4Y28C 3KLGA 1HQUB 1PGZA 3Q22A 3TEGA 1HNXF 2JJ4D 3I6PA 1Q5YA 2XSJB 1EP4A 1IBKF 3OTOF 1Y9OA 4E8UA 4V1Ak 5IS2A 3EDQB 4DV6J 4U8YA 1J5EJ 4KO0B 3G82B 4I67A 2GMHA 5DETA 2O1PA 3BYPA 3A4TA 1DURA 1N34F 4PG4A 3WC0A 3CCUS 5KAKA 4AE5A 4USUA 3IBCB 2HNZA 3CCRS 2YKAA 2JOQA 2DNMA 1ZA1B 3DI6B 1VHFA 1B64A 3QAEA 1RTDA 2KVIA 1HD1A 5HN0A 2UUAF 1UZDA 3OL7A 2MEWA 2MQLA 1U2RA 2NPIA 3NGSA 4CH0S 2BE2B 2XZTB 4M5LA 5HMZA 1T03B 1MMNA 3T5KA 3H4BA 1RTHA 5DQHA 4J91A 3TW0A 4DR2F 2ZOFA 4QR0A 1S9EA 2GIFA 4K0KF 4CLSA 2DD8S 3V6JA 2WB1D 5HLFA 5HBMB 2ZH4A 3UR0A 2EFVA 2Z8QA 2W01A 3EZOA 4DR3J 5EX3A 2KT5A 2ILYA 2AD9A 4CO3A 2B7CB 4F4KA 3AB4B 4O23A 1Q8KA 1RHKB 4TYBA 2JVRA 3JTNA 3T9NA 2XS7A 4RW9B 4MIWA 2VL1A 1B0VA 3PNIA 4USTA 3OFEA 2IFXA 3MURP 3OSPA 1RHRB 5KFCA 3JB9k 4DFMA 4PPZA 1QDUB 3PW4A 4RPFA 4JI0F 3GIJA 3DLBA 1TL1A 1V3RA 1N56A 2E7WA 1BQXA 3V6HA 3H98A 2HBYB 2RSQA 4RW4A 1O5JA 1RT4A 2Y1RI 4X4QA 3K5NA 4CLPA 1OPZA 2EFGA 3HULA 1W2BR 2IM3A 4OHVA 2J5AA 2FVCA 2NZ4A 3KLFB 1OIAA 3OL9A 4F0HA 5KFPA 2YVSA 4USWA 1WUUA 1FFGB 3FK4A 3LP1B 5FD1A 2P5VA 1PSDA 4CO2A 2N7YA 1XMQF 3FFIB 3BGLA 3RW7A 1IKWA 3U27A 1FJEB 4RW8A 3UDLA 3G4SS 3IMQJ 2J76E 5BYQA 1NBEB 2RHSB 3F44A 1X4BA 2G2ZA 4NCGB 4OYBA 2R7TA 1TFWA 2Y9HA 2MXYA 4ZP7A 4L74A 1RU1A 5CH7B 4LF2A 1F3VA 1HYSB 2C22A 1U47A 3NCPA 2QL7B 4OYXA 2QYGA 1YX2A 4NRUA 1WHXA 2GQQA 1JJ4A 4RW7A 4DV2F 3ZNJ1 2HNDA 2BJEA 4EBEA 5A8WA 3RBEA 2MZSA 1FJGF 1R27B 2HHSA 4ZS6A 3HO1A 3PIPQ 1F0XA 4BBYA 2KJVA 2HRUA 5LXRA 4HLBA 2BJ3A 2CQ0A 2VU5A 3T6JA 2DY9A 1ZM3A 2QFJA 1T8EA 3JQMA 4DCJB 5ITHA 3N0VA 3O5TB 2AMCB 3DRPA 1ZBTA 2MY7A 3EICA 3QPIA 1VDHA 4I56A 5RUBA 1N36J 1U25A 2ZNYA 3OFFA 5LOQA 2B6AB 2VBYA 4PXBA 2NXEA 4P10A 3U7JA 4IG3A 2R8JA 4CP5A 2XWYA 2QSWA 2DGOA 1D8YA 1A6LA 4OHYA 2M52A 3LP0A 3M2UB 4L3KA 1WEXA 4LFAF 1CJUA 5HSPA 3FCVA 2BXJA 1S1TB 4KE5A 3QQCD 4HDGA 1IR2A 5J1PA 2NSCA 2BUNA 1NPRA 2LEBA 2MGZA 5BR8J 2AKWB 1YBTA 2YKPA 1AB8A 3KK1B 2RILA 4FDFA 2GJFA 2DNGA 3W1YC 2UXBJ 1GTHA 2ZBQA 3FSYA 1X9WA 4P75A 5K5MA 3HVWA 4L75A 2D74B 1XNQJ 4F26A 2DEJA 3IS9B 3MEEB 5CYJA 4F3MA 2A6MA 2P8IA 2IRXA 4IH6A 3NNAA 2KVQE 2YPYA 2CZ4A 1LW0B 5KFXA 4ED5A 3A12A 1TL7A 4X64F 3MUTP 1OMSA 3N28A 5F8IA 4KHPF 2BANA 4K4XA 2ZM6F 1NK8A 1Y00A 4HYKA 2CQBA 3UVJA 4EO6A 2BKNA 3TVYA 2CWKA 3KJNB 4FYYB 1OQ3A 2EK6A 1L5UA 2XMAA 1JLBB 2EK1A 4ZJQA 3H59A 2RUGA 4HH1A 2CWXA 4IUFA 4DR4J 3PW0A 4DL4A 2ILZA 3NCRA 1LWFB 4NE9C 3QWPA 4FS2A 3TVKA 4ANDA 1WDTA 3POTB 1D9AA 2HNYB 2VASA 3CNQP 2VFUA 3IBFB 5IT9U 4JV2A 3K59A 3C15B 2OH2A 3NCQA 3P5TL 2B4PA 3PEHA 1BXNA 1AFIA 2B5JB 5CA5A 3K8VA 4DG1A 3OLAA 1GNKA 2A2CA 3OFHA 3F41A 3KK2B 2YQ3A 3R5AA 4F3QA 5L1JA 2J0WA 4C8LA 4LF4F 3HX9A 4EI2A 2RRBA 3AH6A 3SSQA 4JBCA 3RB4A 1DLOA 3DOKA 2XSFA 3MEKA 3J7A1 1CULB 1HBNA 1NK7A 2VG6B 4RZRA 4KBIA 4K7QA 3MD1A 2K1RA 1NDLA 3W7BA 5E3PA 5KG7A 2AEJA 1XR5A 2J9CA 2ROGA 4U8VA 4WKYA 1U48A 3QSYB 4I69A 1AYEA 3NS5A 2YKMA 2YNFB 2J6SA 4B3OA 4DV4J 1JXEA 3UCGA 2GVDB 1JJCB 1LWCB 4DEZA 3HSZA 5HROA 2M0GB 1X4CA 3BKUA 4NASA 5ETTA 1JWWA 2DGUA 3ZZRA 2BVZA 3KG0A 4ZJOA 3KUGA 3AOCA 2BQ3A 1FDAA 5ETKA 2QTWA 3Q83A 4ELVA 2IMWP 2DIUA 4CLKA 1S49A 2CXEA 3U1LA 3G6ES 5A8RB 1JQGA 1D0EA 1R8AA 1U0HA 5IC4B 3UDCA 4YB5A 1UVMA 5KG3A 2MKYA 2CQPA 3OTCA 1H3DA 3RB3A 2BW7A 1FX2A 1SJ1A 2QN6B 3GFXA 3OT9A 5KG0A 2IDEA 4I6WA 3NS6A 3HSGA 3DRXA 3DLKB 1DTQB 1ICEB 1T11A 5AE2A 5L9XA 2XY6A 2JZ5A 3KMSA 3KHHA 2DHXA 2XS2A 5HP1B 4P52A 4TU8A 2PFDA 3I9ZA 4P72A 3Q8VA 6AT1B 1X8DA 2OJ3A 1Y7PA 3AD8C 3EM1A 4IH5A 3OR2A 4P2MA 2YNHB 4ID5B 4DOZA 1IKXB 4BWMA 4HHUA 2MLYA 2AGQA 5DO2A 4OHWA 4K59A 5D4OA 2FJWA 4EZ6A 5BJRA 3IRXB 2PFFB 4BLGA 1ZOTA 3DRRB 3PVXA 3PV8A 5D0GA 4I7FA 2F9DA 2HHHF 1LWEB 3TO8A 4QIFA 1EARA 3S7RA 3Q23A 4NXNJ 2CUYA 2MZ1A 2JC1A 2OEKA 4CRJA 2G4BA 4LSLB 3K7RA 1L3TA 3C3LA 3I0SB 3J7YU 4UOHA 1OY6A 4NMLA 4UOGA 4MIAA 1RT2B 1HNWF 5K8MA 7AT1B 4LF7F 1XQIA 3M6WA 2ZD1B 2E66A 3MR5A 1D09B 3R6LB 4WP9A 4CLUA 3CUNA 4DV0J 4B02A 2CPXA 3A3NB 3VCDA 3HM9A 1UW9A 2OGUA 1WC1A 5KFBA 1RWUA 1D1UA 5A0YA 3MMAB 1PIEA 3KHGA 2Y3YA 2VICA 1WEYA 2XZDB 2QE5A 1CBKA 3KFWX 1FRHA 2NZCA 3W2VA 1P27B 3KLVA 3W9HA 2QT7A 4JI4F 3K8WA 1K1SA 1BUXA 4ZPVR 2ATCB 3M8QA 1ZAWA 2F8EX 4MKYA 3BO3A 4AL6A 2G2YA 3DHWC 1FE0A 2QYCA 2OPRB 2DNHA 2V68A 3P96A 4J9RA 4I2QB 4ECYA 1G4CA 2ZVSA 5F8LA 2AIRB 4N7TA 1Q81T 4CNZA 1NJIT 3LTOA 1YG0A 2DGVA 5EX0A 1FO1A 3B6BA 4QQBA 4H4MA 1T0TV 2MB0B 4K4VA 4F67A 3OVBA 4UW2A 2Y1JA 2WAQD 2W4DA 1RLCL 5FLXU 4DV7F 4C9DA 2AHOB 3MM7A 2XI3A 2B8QA 3I96A 1HPZB 3DDKA 4PRFA 5HO4A 1VRTB 4ZKAA 4M5KA 4JV0A 3C6TB 2F3JA 3QFWA 4WFNQ 3MR3A 3ETMA 1N6QA 1SJRA 1CJVA 4YB6A 2FZCB 2UUBJ 5C42B 4NZ7A 1RSCA 2E5JA 4M5HA 1XIQA 5BYRA 2J7WA 4CT8A 1TUWA 3LAMA 1SL1A 3I31A 5IM0A 3GV8B 2FYXA 4PG5A 2ZFHA 1ZPWX 4NXMJ 4ZVSB 3T1HJ 3ZNUA 1VISA 3EJMA 1UVKA 4UZBA 4ANEA 3AA8A 1LKZA 2HRTA 3TVZA 4IOAQ 2FD2A 1NCLA 4WK3A 2DPJA 2GVZA 3NBPB 3PDNA 4RBVA 3ADAC 4Q8EA 1RT5B 3CC4S 3OBIA 2B8PA 5ETPA 3M8SA 5E7OB 4CTAB 1KLNA 5CABA 1NJXA 1NB7A 2UXDF 1AA1B 4OLOA 3PX0A 1VOMA 2H48B 2WW4A 4IQMA 4FKYA 4OX8A 3TI0A 1HI8A 2W8KA 5E41A 4A47A 1FD8A 1N4LA 5JVGQ 1IXKA 2YWWA 2H5JB 5KTQA 4FF4A 1NXIA 2LXFA 4WIQA 2GV1A 1LV5A 3W64A 5AXMA 1VK8A 1KFSA 1RGVA 1A7GE 2K06A 1VQNS 1HNZJ 1QUPA 4M1KA 2POKA 2RKIB 1GXUA 3DM2A 2LCWA 2YQ0A 1WC3A 3JXOA 3MAAA 2CPHA 1UEKA 3DOLA 2ATLA 3BQ2A 4WFYA 2DY1A 5T41A 9ATCB 2FLOA 4WE1A 4KGXB 3HPOA 3IG1B 2D9OA 2W8LA 4I6YA 3FC9A 2HVZA 3DYAA 3HVTB 7FD1A 2IVMA 3L95X 5DJBA 2UV8G 1VK3A 4LIWA 1JLFA 1HBOB 2W25A 5D4PA 3G2XA 3MM8A 4O4GB 2HBRB 1S1WB 2G1HA 1REVB 3FKBA 4FPRA 1T94A 1HWLA 4OI2A 3FEXB 2LQBA 3KLEA 3H5UA 5CD4A 1GT8A 1PYSB 4YMEA 3NAHA 3OTOJ 1Q86T 2ZEJA 4BHQA 1YJ7A 3MCOA 4LBIA 3MCNA 4TY9A 3RAQA 2B43A 3KLIA 5LJ5Y 3HMJG 1N34J 4ZCIA 5HJXA 4LSNB 4TY8B 3WHIA 1C1CB 3I5AA 1JNRB 1NNDA 4O44B 3EVWA 2H51B 1JLEB 1RHMB 5HMXA 5CCMA 1KLMB 5D3GB 1FWPA 1HBMB 4GKKF 1FTRA 3E01A 4IFYA 2C2OB 3CJKA 4UOFA 3CCSS 4ID8A 2XB2D 1VRUB 2UUAJ 3ZTSA 2JX2A 3HFZB 5B0AA 5E2QA 3LAKA 1FK9B 3PX6A 4ZITA 1I51B 2MQOA 2RB7A 3JSMA 3MR7A 4DR2J 1ZAXA 2MYFA 3C14A 5ETNA 4K0KJ 4ZVFA 4ZA1A 5J2PA 4IYQA 2GX8A 4O3OA 1MROA 4RBUA 3FBBA 1S1VA 4Z2XA 1SV5A 1HD0A 2ADBA 2E9ZA 2LXIA 4ICLA 3DLLQ 1T02A 3IBWA 3KKFA 1B0TA 4KTQA 3CD6S 1EQMA 2OPSA 1DJ0A 3HSJA 1G7CB 1V3ZA 2R2SA 3JTOA 4V19X 1JMTA 4JI0J 1H74A 2SXLA 1PBUA 3GFZA 2IAJA 2HNZB 1TKZB 4J5OA 2AZ3A 3MD3A 4KFBA 3HP6A 2DXEA 2EWHA 2LDYA 2YWFA 1TKTA 3IWNC 3D6HB 1WHYA 1S9GA 1RKJA 1QTNB 2K7KA 3MEDB 3NGUA 4IG0A 4FF2A 4EMDA 4N8OA 4QOTA 1UFLA 3SCLE 3E8OA 4OMFG 3CJ5A 3ENWA 2P6TA 2MZTA 1S9EB 1JXVA 1D8ZA 1XMQJ 5HLFB 4DXLA 2E1MC 3GFHA 2FPHX 2DPIA 4U96A 2B4OA 3OTDA 2OPPA 2CJQA 4ECVA 2AEMA 4GMKA 1FNOA 1RAGB 1X4EA 2R8KA 3PW5A 2JLGA 2CPFA 4LF6F 3AXKA 4A8KA 3H25A 4XTTA 3EGNA 4Y0FA 3BB5A 4Y3CA 1M1GA 2VPWB 1QTMA 4UY8T 4DV2J 3I82A 2ZC4A 2M8DB 1WOOA 4J9VA 3Q2SC 1K8AT 4W98A 1T05B 1FJGJ 4JV5J 1RP5A 2PD1A 1HWKA 2WSCC 4C0OC 3CJ0A 3A3OB 3BM7A 2BJ9A 1WG5A 2VKZG 2R7SA 2Z0GA 4NLWA 2E5IA 4FXVA 5K14B 3RR8A 1KS2A 2J6TA 1SUQA 1Q7YT 4DV1J 3BGFA 3UPFA 4MYUA 1GH8A 1MSWD 4W90B 1UVIA 4PR6A 4N41A 3W60A 3SFGA 1VLOA 3UQSA 2J0QD 4LFAJ 1R89A 4A8FA 1GK8A 4DR6J 1N32F 1IQTA 3KWMA 4Z7CA 1PBAA 4DF4A 5I3UA 1Z2LA 2CKWA 4CO5A 3VGTA 3PJWA 1KQGB 1BQNB 4RW6A 3C16B 2GC8A 2RF2A 3BBCA 2KM8B 1LW2A 2YNGB 3I87A 3HZGA 4KAIA 1V5VA 4R5PB 4BC7A 4DCOB 2F4FA 5LSLA 3O1LA 2ZH2A 1EX8A 2L08A 1R6YA 1NK0A 2IY5B 2PN6A 4LRCA 4MAKA 3MMJA 5KT3A 3ZZTA 3DRPB 2B4VA 2CQDA 4YOEA 1RLDA 2FGCA 4ECTA 2CJXB 3B8HA 1VMBA 3CO0P 4WFXA 3CXCR 1FRXA 1UW4A 1KBRA 1N5YB 1RABB 4X64J 2HK2A 3AOAA 4KHPJ 4OI0A 2EFNA 1S97A 2COLA 3QGGA 3HHLB 3PYGA 5L46A 2R9LA 2FLNA 4XAKA 2FC8A 2I38A 3BPSP 5KFQA 2DHGA 3V81B 3LP2A 3R5BA 4R25A 4P2XA 1P6TA 4JI6F 3GYNA 4Q8FA 2LKZA 1NK5A 1J5OB 3P4UB 2F5GA 3EZ5A 4Y00A 2VOOA 1U4BA 4OZ3A 3M2RA 2VPYB 4JI8F 2MHNA 1S9FA 4R8UB 1WKKA 2XO7A 1RISA 5D4LA 2HZVA 1Q53A 3DLGA 2V94A 2E7VA 5E3RA 3IRWP 4LF5J 3Q89A 3GJSB 4LRDA 1ZETA 5ETMA 4LF4J 4LR7A 4ED4A 4DV6F 2VC1A 3HVRA 4HEA9 1RTIB 1W2IA 1VQ8S 3IXQA 2MKHA 2MJUA 5KT6A 3O2IA 4DJBA 3J81Y 4DR7J 3VV2B 5CHCB 3MDFA 3SDEA 1F2HA 4KHRA 3DN9A 2MZQA 3KK3A 1EJ7L 1EIYB 1NJYA 1GFWB 2G0JA 2BE9B 2I9SA 1QY7A 3M8PB 2BMBA 1W7WA 3GMGA 1SC1B 4DCPB 1F9EB 4PWWA 2C3OA 2OHDA 1RYRA 3NGRA 5I42A 3TJ8A 3J80Y 2WVCA 3LWLA 4IR9A 5GADU 4XO0A 1FCAA 1CLFA 1RDRA 2GMJA 2KXFA 2NSBA 2FLPA 4X65F 3Q8QB 3OLBA 5AXLA 4WFBQ 1UP1A 4B08A 2VZ9A 5D0RA 1H2TZ 4K4WA 4C0HA 2ZE2B 5HANA 2C3YA 4DR3F 3SCJE 4MK8A 4EEYA 5DGBA 4ZPWR 4KJIA 3BV8A 4PYDA 5KFFA 2E7XA 4QJVA 4M5NA 3ZFVA 3L3CA 1HR0J 2KJWA 2KL8A 2CFXA 4FKXA 3BH6B 3D0GE 1U6BA 2XZWA 4C8NA 2K1RB 2VOPA 2PT0A 3A3PB 3KTQA 3QGHA 2HAIA 3A13A 1JNZB 3QWUA 1Q95G 3VVTA 2HQ3A 4MK7A 5KFJA 4PKDB 2IRUA 3HHKA 4B3OB 4L6V3 3W65A 4GO5X 4KY3A 4DL0C 2FZKB 2E9TA 5ADZA 2HLTA 1TV6B 5HROB 3GONA 2HQGA 4IKAA 1NU4A 4ZN3A 5G4DA 2OEJA 4ECZA 3H0PA 4I1TA 3PYEA 3QSIA 2IA0A 4FBTA 2YQ1A 4DI6A 5HI7A 4DSEA 4URGA 2Y1IA 5H9FK 5HMYA 1MMDA 5KFOA 1RU2A 1K44A 1RAOA 2E29A 4OZJA 4OJGA 3QT8A 1W26A 2J6UA 4U7UD 3MPUB 3VGSA 4B9UA 2WONA 2VG5B 1FI4A 5GAHU 2H65B 1VLYA 2O66A 1U2FA 2CNLB 5KOXA 4CCHA 1P8GA 1HNWJ 2VQFJ 2L9DA 4NCBA 5HAOA 4LFBF 4CLZA 2FJVA 1P9YA 1X5PA 4USIA 3I9V9 4A46A 3AQPA 4YR2A 3AODA 3V2UC 2BOPA 3TOQA 4H4OB 2EBEA 1N36F 4OJ3A 2AYBA 2HQCA 4K4UA 1NUEA 2RU9A 5L1LA 2HVHA 4Q44A 2C2ZB 3K5LA 2QMXA 2BKPA 4CH7A 2ZHBA 3PM9A 2H4YB 3K5OA 2MQMA 3HHNB 3G6YA 1E6VB 4EUVA 4RUAA 4O3NA 3TUPA 2VPXB 3DLJA 1NJZA 4LIRA 1XMBA 2FVQA 3M32B 4MMOA 2XGPA 1RZMA 3OTEA 3RR7A 2OPQB 4NPOA 3KDOA 5J2MB 4CLFA 1S7HA 5D8HB 2BKOA 2HIYA 3M8YA 2JVOA 3I0RB 2P9CA 1MNEA 2W9BA 4B3TF 3AQOA 4A8XA 4DV7J 2Z4PA 2RD5C 2B56A 3RAMA 1U0SA 1RT3B 5LMUJ 2LQ9A 4KKOB 3RRGA 1RWPB 3OTBA 2FJBB 3MGJA 1FVSA 3NLCA 4ZDNA 2VFVA 3JAMY 3R2CJ 3MM6B 3IAM9 2GQCA 5JUMA 2XHCA 3W2VB 2WVBA 4QW9A 1Q7LB 2PSZA 3CO9A 2DGTA 2OKQA 2L41A 1KSPA 2HG4A 2BJDA 4IR1A 4J9PA 4RNNA 3TARA 3SMZA 2Q79A 1KN6A 3BSNA 4OZ1A 1UKUA 4X4NA 3MPYA 3MUMP 3I56S 3CJQA 2AJ0A 5KOWA 2N4CA 4NI2A 2UUWA 4J9KA 3MECB 2A18A 4IOBA 2BQRA 2ZOMA 3ET6A 4PWDB 3SXLA 1NHKL 4HT5A 2D3ZA 5K8NA 4ECQA 4IFVA 1EZZB 1V5IB 3NY0A 1HW8A 1BWVA 4ITSA 1UEVA 3LWMA 1TAQA 2KDOA 4DPTA 2DO0A 4CNYA 1Y3JA 2UXDJ 1BQMB 2OTLS 2ALZA 3PR4A 2CPYA 2KKHA 1VQ7S 2UU9J 1HHTP 5CYMB 3UWTA 4QIVA 3M30B 3VTIA 1N6QB 2W4CA 3B82A 5AE1A 2NYHA 4ZVOB 2I5JB 2DHHA 2UVUA 5B0BA 4C11A 2OEMA 3BN4A 2HHWA 4ZLLA 3OUYA 3TAMB 3KLHB 4QW8A 1DQ8A 2V2VA 2HMIA 2FB0A 2W7OA 1SI9A 2QO3A 4L76A 2XCPA 1E6YB 3D3CJ 4BCAA 2QA4S 3TP2A 4U95A 2E9RX 1YJWS 5DLGA 4TQSA 2XLJA 3M9MB 1N0VC 2H54B 3ENAA 2D3O1 5F9NA 4L73A 2NYIA 4ZK7M 4OHXA 1S79A 4EBCA 3O8WA 3MF5A 3H7HB 3CMQA 4QR1A 4ECWA 1RT1A 1DHMA 1RTZA 4OI4A 1Y4ZB 2AYEA 2QJ3A 2R8HA 2QX0A 1OS5A 2H5IB 2DH9A 2ZH9A 3U1MA 2J0XA 1SH2A 3BPDA 3NEKA 3D1QA 2R7OA 1RADB 2XG8A 2KFNA 4GVBB 1C4AA 1QE1B 2VJUA 4YB1P 3JYTA 1S0VA 1RWVB 4K8RA 2VJVA 2KFZA 1Y10A 2GJ2A 2DGWA 4KV8A 1P1TA 2JEFA 5J1EA 2KT2A 4KIAA 4ILLA 2YNIB 4C97A 2XY7A 2HVDA 2MTLA 1C2PA 3FZ2A 3RZAA 1ITPA 3QMQA 2CA9A 3DNCA 3L7OA 3CD5A 1JIHA 3FCHA 1FKPA 3EVMA 2W9CB 4GKJJ 3FBEA 2G9OA 1UZHA 4FN5A 3V4IB 5B0GA 4Q0BA 1Y5IB 3W62A 4GKKJ 1SL2A 2XMKA 1B99A 4XPEA 3FBFA 1LOUA 2KRRA 3HCXA 3VWSA 4F0MA 1U7LA 5CZVA 1RT7B 2PMZD 2HSEB 4NYPA 4IDKB 5DDPC 1YK9A 2DNPA 3PJXA 2C2MB 2GHWA 1JLFB 1BC6A 3F73A 2D1CA 4M63A 3N6MA 4OQJA 2CPDA 1QD1A 3C6UA 2RHQB 1RHJB 3GJQB 2ZBRA 1T9WA 4OX9F 1N5VA 4KHMA 3TA2A 3ZTPA 1J27A 5B09A 1WACA 3AAWB 2RJZA 5HJYA 1XWLA 2OFGX 5J2NB 3HVAA 3ZZPA 1WC0A 1BY9A 1P9QC 1C0UA 2AW0A 1NEEA 3LF0A 4C48A 4S0MA 3KLIB 2J8SA 1NSAA 2WSFC 1ZM9A 2ZUAA 3FSXA 3AD7C 4DDFA 2XULA 2GO8A 2AYMA 1MMLA 2R7QA 1KNZA 2BA9A 3BYRA 1XMOJ 1UWAA 4F4WA 5LMNJ 2HFUA 3E01B 2RVJA 2HFOA 2MKSA 2EC0A 4K4ZA 1FX4A 5DM6Q 4QWDA 1GMUA 3TUJC 3ONQA 3ITHB 2DRBA 4JI3J 3CC2S 1URRA 5CD4H 3CD0A 2GS8A 1TZ0A 4OYIA 4J9QA 1N48A 2IC3B 1OO0B 3QJJA 1Q82T 3RB0A 1RTJB 3T9ZA 1SXLA 3NL0A 2FHJA 3BGUA 2G0IA 1TVRB 5J2PB 4U7UK 2DTJA 3ZZ0A 4WZQA 1IR1A 1S1VB 3OHBA 1NLKL 2BR0A 2EBGA 2PMWA 1VQKS 1HQEA 2BE7D 4M5DA 2XY5A 2W2QP 1JLAB 1NB2A 1JLGA 5HVFA 4O3SA 2LQJA 2MHEA 4TN2A 5KFUA 4C3KA 4LQ3A 4I2PB 5H9FJ 2ZWOA 5DM7Q 1YRUA 3KOAA 5DZ6A 4K4SA 2C2NA 1CS4A 1SVDA 1PYOB 1VQ6S 2YX7A 1AZSA 3PKMA 2AJQA 2QFIA 1HFEL 4CT9A 1HWIA 5JJBA 3I5BA 2KTQA 2X51A 1YLXA 3O6QA 2AWZA 4ETZA 3AJDA 3EGVA 2Q43A 2QA2A 2UUBF 5CYQB 3V6DB 1C0TA 2E1CA 3TR5A 2NCKL 4P2SA 5L1IA 4OL8A 1X7VA 5C2GA 1FJCA 3D66A 4NLPA 1HQUA 4A4JA 1S1XA 1FWKA 3OR1B 1Y0HA 5IT0A 4DLEA 3BBBA 5EWGA 4DR1F 2HGMA 4IOCQ 2XSJA 1OYEA 1FKOB 1SC6A 4ES1A 4UUXA 2WVDA 2CJ9A 1VQLS 3SFUA 3PW2A 4KO0A 3G82A 4BWJA 3FRYA 4DSIA 1NDCA 3UN5A 1NSKL 3K0JA 4JOUA 3G6VA 3T41A 1ZM4A 2R7UA 2R42A 2IHR1 1IVZA 4WU2A 3KJFB 3WIVA 3RRKA 5DQGA 1ZYQA 3M6XA 3PJ9A 3DI6A 4CWBA 1T9YA 1NM2A 4O0NA 1PYTA 1MWZA 1Q16B 3DU6A 1YZ6A 4ILRA 1B3TA 3V5RA 3HK2A 4ZIWA 3T5HA 4Y2AA 2C2RA 2BE2A 4RNOA 5HK4A 1SC4B 2EEYA 1NKEA 2BZ2A 2QV6A 1CC8A 1T03A 3FZBA 1W25A 1HMVB 2E1RA 1S76D 4UZCA 3H5SA 2Z2YB 3GV7B 1Y11A 2HHXA 1RT6B 5HBMA 2C2EA 3QO9B 1VIXA 2YBVA 4USVA 3FEYB 4MYTA 1HNIB 5I4MA 4ZVQB 4JI6J 4QIGA 2EC2A 1F5CA 2JFDA 3W66A 1RACB 5A76A 3AD9C 5DDRC 1DQAA 4K2XA 1TR0A 4LRAA 3J81U 4JI8J 3JSRA 2AZ1A 3CEDA 5L9NA 1BWEA 4ECUA 2W7AA 4E2FB 2PE8A 1HBUA 2HFNA 3ETOA 4FVMA 4FPIA 4R0JA 2XNQA 3ENQA 2CADA 2V67A 2LQ5A 4PUOB 2CZ9A 4UOCA 5EUHA 4YR3A 2V8DA 3N5BA 4AXJA 3N79A 2DKOB 1OSCA 5K9FA 4LR9A 2HS3A 4FYDA 3VAIA 3KLFA 3PHEA 1VIOA 1BGXT 3DFEA 2HHVA 3H5YA 4W4MA 4DV5J 3KYLA 1RHUB 2APOA 3L9ZA 1NK9A 5BXIA 4NWBA 1LK5A 3LP1A 3UFCX 4RX6A 2KT3A 2B9YA 3FFIA 4HHJA 3J7AN 3THPA 2OO4A 2QA1A 4YFUA 3VAMA 4NCGA 4Q43A 1IWGA 4A8YA 2XNRA 3BGRB 3NGKA 4PCQA 4RNHA 2HWIA 1HYSA 1RAHB 4MKAA 2DXDA 5DGAA 1FF2A 4X65J 2DGXA 4LBPA 1YVFA 1CC7A 1XNRJ 3DLGB 2KI2A 2OELA 5KG4A 4ZVTB 1MG7A 1T7PA 3VAKA 1VBZA 4HL9A 1RWXB 3CPWR 2CPZA 3GLJA 3CJSA 1JKHB 3HT3A 3NRBA 2GIQA 2ASJA 1ACMB 1N33J 3M05A 3E51A 4ZPBA 3BN7A 5DG9A 3M6VA 3TWZA 4G1QA 3G87A 3CGIA 3W5YA 3W9IA 2DCLA 2B6AA 2Y0BB 2JFKA 3QT5A 2KYZA 2LVWA 1QM9A 5ETSA 4RWWA 3GCXP 5C5JA 4EFAC 3M2UA 3TQEA 2HZAA 2VDHA 2E5HA 3F0NA 1DQ9A 3D68A 5I3QA 2QL5B 4KH1B 2KM8C 1EETB 4A8SA 2YX1A 4N5SA 1FT8A 1S1TA 3P49B 2MZJA 2LECA 4FZVA 2GHPA 3HLUA 3C8YA 4FXWA 3GJRB 3FGVA 1S59A 1IKYB 2H1YA 3KK1A 2RDIA 1GMWA 3FRZA 3BSCA 4LJMA 2JHEA 4YY3F 2B4UA 3HD1A 3VGUA 3HHLC 3FCWA 2OMLA 3IS9A 4F04B 1CQNA 1NZ8A 4WP3A 5ETOA 4WTYA 4NYZA 2NR0A 3RRHA 5D77A 3D0IE 2R3VA 1LW0A 3CCTA 2CQIA 3QLHB 2LA6A 4F36A 1KOHA 4OI6A 1N5TA 4K2JA 2XMUA 4ILMA 4ZCKA 4LFBJ 2DXFA 4JV5F 2V8HA 2C2KB 3HSDA 2MLZA 1LXJA 4C98A 1XEZA 3HT0A 2JSXA 2HFSA 1PO6A 2YXLA 3NWRA 5B08A 3IR5B 3DLEB 2KG1A 3WX4A 1NK4A 2I2YA 1YZ7A 1N0UA 3SV4A 1OJ4A 1LWFA 3H40A 2ASDA 1IM6A 2MLXA 3HI9A 3GR0A 4UT4A 1R8CA 4DV1F 2R2UA 3GCWP 3POTA 2XO6A 2HNYA 5D0HA 3PRBA 4J9OA 1F9FA 3RG6A 4FBUA 1TP7A 3VZHA 2GGPB 1BE4A 4CLTA 3D6MB 3C15A 5G0RB 3EX7B 3MMCB 4KGZB 1QSLA 2RQKA 2RRNA 4NLXA 2ABYA 3G8SA 2B5JA 2ADCA 4DR6F 4ZIVA 3QIPB 3K2YA 3OJUA 5M2PA 2WONB 2XMTA 2X3DA 3KK2A 1U1LA 2BJ7A 5CAAA 5E3CA 3IFEA 1CJKB 4Q7AA 3FDSA 5IQ6A 3Q8PB 3JAMU 1EQ0A 2FC9A 1CULA 2OD6A 2VG6A 3MEGB 4IRCA 1HARA 4Y65A 2CJYB 4ELTA 2GNKA 5CXTA 2CQ3A 1V3SA 1ULRA 5DG7A 2X3GA 2HZCA 2GA7A 3TX8A 1Q1KA 2YNFA 5KFWA 2H9ZA 4ZVGA 4B3TJ 4NOHA 1FESA 2V6AA 4DUYJ 2HBZB 2GVDA 3ILJA 1LWCA 1HWJA 4YS2A 1NJWA 1D9FA 5F9LA 1UL3A 2QLXA 1B7YB 1N8RT 2ZH5A 4TLRA 1KQKA 1YQHA 3A8JA 1U8WA 5KFZA 2BM0A 5C24A 4YHHJ 4OX6A 5KFRA 2V50A 4N8NA 2PMHA 2A3JA 4C7QA 3W61A 4LFCF 4NLUA 3GG0A 4EK2A 2FHJD 2KZZA 3VZIA 1S6QB 3CDAA 1M0SA 3MM5B 5M2RA 5A8RA 1UA1A 3OV7A 1IJFB 3BO4A 3DRYA 5EDWA 3QRRA 2E44A 4FYXB 1WTBA 1WSRA 4ZCLA 3QGPA 5AJ3F 3ZZOA 5LM7E 3OQ2A 2WVEA 4WTOB 1RCXB 5IT9Y 4KGKA
chains in the Genus database with same CATH topology
1DTQA 3EZ5A 3WDOA 3DMJA 1UVJA 4PG8A 1O8BA 4Y00A 4TLQA 1JLEA 2GQ2A 2VOOA 2O01C 3P49B 3MM7B 4AL7A 1U4BA 4OJHA 3GG1A 3SCKE 3CCJS 3IAS9 1O51A 3HHLD 5MAOA 4ERDA 5HP1A 2R7WA 3CCMS 3SSSA 3OSNA 3M2RA 1SJ4P 1VC0A 2VPYB 3ISNC 1WHWA 4JI8F 5LT5A 2RT3A 2MHNA 1S9FA 4R8UB 2Q66A 1WHVA 4K5SA 2XO7A 4FNHA 1RISA 4LF5F 5D4LA 2YH0A 2W9CA 4YQWA 2V9WA 1VRUA 4F4ZA 1GX5A 4DPOA 5GAGI 1S0OA 3NMAA 1SKRA 3LH2S 1FEHA 4W92B 1F5BA 4NCAA 1MU2B 2YNHA 1Q53A 4URSA 3DLGA 3V4IA 1R7IA 3OPKA 4WCEQ 4DS4A 2IVYA 4Y2MA 1DBDA 1NHVA 4ID5A 2M2BA 4BS2A 4YUDA 2V94A 2N4DA 4Y28C 3KLGA 1IKXA 1VQ9S 4DS5A 1FE4A 5E3RA 2DNOA 3IRWP 3QGIA 4DR7F 3CMES 1ZAVA 4DL6A 1HQUB 3LPYA 1PGZA 3Q22A 1ZETA 2LA4A 3B4MA 2QSFA 1HNXF 2IJNA 4ED3A 4DV6F 5IM0B 2VC1A 5IFMA 2DRAA 4QIEA 2JJ4D 2M7SA 3HVRA 3UCZP 1RQ0A 1RTIB 4HEA9 1RT7A 1W2IA 3I6PA 1VQ8S 3IXQA 2VBZA 2MKHA 2MJUA 4IDKA 2XSJB 1EP4A 5KT6A 5KFHA 3O2IA 4DJBA 1IBKF 3J81Y 3DRRA 3W3SA 1FRKA 4B9SA 2AJFE 5CHCB 3OTOF 1Y9OA 4E8UA 3MDFA 4I6AA 5IS2A 1FHTA 3MTJA 3SDEA 5EHHA 4KHRA 1H7WA 3DN9A 1SJ3P 1VGYA 2MZQA 3KK3A 4KO0B 2U1AA 4G1PA 2OSRA 3HF5A 1DRZA 4I67A 3BZQA 2DJWA 2GCFA 3CJ4A 2FVRA 2GMHA 1AFJA 5DETA 2WBRA 1NJYA 1JLQB 2O1PA 3P3DA 4HDHA 1DURA 1N34F 1U1NA 1M5PC 4PG4A 2I9SA 1QY7A 2VBWA 3M8PB 3Q8SB 3ENVA 4X4OA 3GMGA 4QR2A 4NLRA 2OMOA 5J2NA 1KVJA 4EU0A 1FERA 4PXDA 3WC0A 3CCUS 5KAKA 4AE5A 5F8NA 2C3OA 1RYRA 1Z2ZA 4NLTA 4JI2F 5I42A 3J80Y 2HNZA 2HPUA 1U8SA 3DXSX 3CCRS 2X1FA 2R7XA 3LWLA 2YKAA 4IR9A 5GADU 1RT2A 5J2QB 4LVOP 4KPYA 2JOQA 2DNMA 2KG0A 3VALA 4XO0A 2O3DA 5KFNA 3M9OB 1FCAA 1CLFA 1RDRA 3DI6B 2GMJA 3S8SA 2QA4G 1VBXA 1VHFA 1B64A 2RMLA 1QAIA 2KXFA 2EG2A 2NSBA 3QAEA 2FLPA 1RTDA 4GC6A 4OZLA 2KVIA 1M5KC 1HD1A 4X65F 3MM9B 5HN0A 3Q8QB 1JXLA 1R0AA 2MPUA 2UUAF 4OLPA 3OL7A 3OLBA 1HA1A 5AXLA 4WFBQ 1UP1A 2EFPA 4B08A 2MQLA 3QZ7A 1U2RA 5JVHQ 1SH0A 1M5VC 2DIVA 3GFYA 2NPIA 2R8GA 4DF8A 2VZ9A 3BS9A