1LWEB

Crystal structure of m41l/t215y mutant hiv-1 reverse transcriptase (rtmn) in complex with nevirapine
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
423
structure length
401
Chain Sequence
ETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 102
structure length 401
sequence length 423
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lweB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lweB03
1JLFA 1TKZA 2JEJA 4RNMA 2WTFA 4LQ9A 5KT6A 3BSNA 3IG1B 2WOMA 1QE1B 1Z4UA 4URQU 3H2LA 3DI6B 4O44B 3DLKB 1JLCA 1HPZA 1S1VB 2JLEA 5T14A 2WB4A 1TL1A 1S9GB 2WONA 1FK9A 5CYQB 2CJQA 3OSPA 1JLQA 3RB6A 2XCAA 3KLHA 4ID5A 3NAHA 5L1LA 2YKNA 2FJXA 4DL7A 1SH0A 3CVKA 4LSNB 3BJYA 4K4YA 3FRZA 3QGIA 3GQCA 4J9LA 5HLFA 3V81B 4KAIA 5I42B 5KFNA 1TKZB 4KSEB 3T1AA 5KT2A 3RB0A 3FQKA 5JXSA 2JEIA 5KFIA 1QE1A 1C1CB 2IC3B 4KO0B 2AGPA 4FS2A 1RT1B 4H4OA 2JEFA 3DLKA 1NNDA 1HPZB 1JLCB 4EO6A 4KHMA 4NLOA 5F8LA 2WONB 1FK9B 5CYQA 3GILA 1JLQB 2BE2A 2RDIA 4TYAA 4ID5B 5KFUA 3T5LA 4IR1A 4ED2A 2YKNB 1N5YA 1W25A 2O5DA 3DLEB 4LSNA 2AU0A 1FKPA 1RT5A 3V81A 4ED6A 5I42A 3DMJB 5I3UB 5L1KA 1C1CA 2IC3A 4KO0A 1IKWB 4KE5A 3KK2A 5EUHA 1RT1A 4H4OB 3T5HA 5KG6A 3N6MA 5DQHA 1RYRA 2R2UA 3IN5A 3E51A 4FBUA 3N6LA 3DRSB 3DOLA 1QAJA 3GIKA 4O3OA 4G3IA 5L9XA 3G6VA 2BE2B 3BQ1A 3ISND 3KLEA 3RAXA 1HNIB 1N5YB 3DLEA 1N6QA 3HVAA 1FKPB 1RT5B 4XPEA 3I0SA 4KHRA 3Q8SB 5KFJA 3KOAA 3H4BA 2VG5B 3DMJA 1VRTA 4TYBA 3H4DA 2B43A 5I3UA 3KNAA 4YR2A 2OPSA 5DLGA 3KLIB 1IKWA 3KK2B 4DL2A 3KHLA 3KJVB 4IG0A 3RBEA 4IFVA 3CDUA 3DRSA 3DOLB 1JLAA 4MK9A 4O3PA 5KG3A 5EWEA 4XO0A 4RZRA 5KFFA 5J2NA 3KLEB 5HROB 3CJ5A 1HNIA 2D3ZA 4J9RA 4ECRA 2R8JA 4EBDA 1N6QB 4ZPDA 2GIQA 3QYYA 3QGHA 3Q8RB 1TQLA 3I0SB 4ZP6A 4K50A 4J9QA 2DPJA 4F50A 4YQWA 2VG5A 4ECUA 3TVKA 1VRTB 1JXLA 3BQ0A 3V6HA 3HHKA 4NLPA 2OPSB 3G86A 3IS9B 2OH2A 4YP3A 3KLIA 2OPRB 3BGRA 4RW9A 5F8IA 2UVVA 1S1WB 3KJVA 4IG0B 3GIMA 1LWCB 1SH3A 4IFVB 4NYZA 3RB3A 4O3RA 1JLAB 1K1QA 4NLTA 3PR4A 4O3SA 3MR6A 4IR9A 3BREA 4NLGA 1JKHA 5J2NB 5KFBA 4MH8A 4RW4B 4Q8EA 5HROA 3LP0B 3M9OB 4ECZA 3T5JA 4RUCA 3PHEA 3OLAA 1HQUA 1TP7A 2BR0A 2OPQA 4EBEA 3CWJA 1C1BA 1DTQA 3BR9A 3QZ7A 3IS9A 5KT7A 5J2MA 2OPRA 3BGRB 4RW9B 4ZVGA 1S1WA 2GIRA 1LWCA 4ED7A 5C24B 4IRCA 2W8KA 1RT4A 5KFGA 3MFHA 5KFYA 5KFPA 1JKHB 2FVSA 4JUZA 3PW0A 3T5KA 2V9WA 4RW4A 1HQEA 2AX1A 3GIJA 3LP0A 3SI8A 3LANA 2R8GA 4M95A 5KFSA 4MIBA 5KFOA 2I5JA 1MU2B 5C5JA 4QWAA 1HQUB 3BSOA 4TY9A 4R8UB 4ED8A 5DQIA 2OPQB 1REVA 1U09A 1C1BB 4F4WA 2R8IA 4I7FB 1S49A 2W8LA 1C0TB 4NLWA 3BQ2A 5J2MB 3DYAA 1RT2B 1RTHA 1C2PA 2D41A 3CJ4A 4QWBA 4ECQA 4IH6A 5DGAA 2ALZA 3MFIA 4LQ3A 5C24A 4RU9A 1RT4B 2AX0A 2VG6A 4NCGB 2W9CA 4O4RA 3CJ3A 3H5UA 3NKYA 5DG9A 4ZP8A 1HQEB 3LALA 1S4FA 1NHVA 1YVFA 5DG7A 1RT3B 3M8PA 1JLEB 2I5JB 3DM2B 1MU2A 1ZTTA 4R8UA 4TQRA 1REVB 4RW7A 4I7FA 1DLOA 4RNFA 4NLRA 2IMWP 1C0TA 3FDSA 4WE1A 3DYAB 1RT2A 1RTHB 5KT4A 2YNGB 3C6UB 5F8MA 2C2RA 1TVRA 3CDWA 2VG6B 4NCGA 3H59A 1SUQB 1DTTB 1RA7A 2W9CB 1S1TB 2UUTA 2ZKUA 2VA2A 1S6PB 2IJFA 3V4IA 3MEEA 3BSCA 1RT3A 4KB7A 3M8PB 1JLEA 3DM2A 2J6UA 1VRUA 1I6JA 3IGNA 3DDKA 4RW7B 3Q8QB 2B5JA 3EPGA 1DLOB 1MMLA 2ILYA 1RDRA 1HMVA 4WE1B 3RB4A 1S6QA 3E01A 2YNGA 3ICLA 3C6UA 5C42B 4NLUA 5KFCA 1TVRB 1SUQA 1DTTA 5EWGA 4QWDA 1S1TA 3I5AA 1JLGB 2IAJA 3PVXA 4DL5A 2IM3A 1S6PA 4Q44A 3V4IB 3MEEB 2W7OA 3OLBA 4U6PA 3QIDA 1VRUB 3KLFA 4IRKA 2GC8A 2B5JB 2BRLA 3QIPA 2ATLA 3NBPB 1HMVB 3LAMA 2J6TA 4WXWA 2JC1A 1S6QB 3E01B 4URSA 5J1EA 2UVRA 5C42A 3V6JA 1IKXA 4KV8A 3VQSA 5KFXA 4WYWA 1JLGA 2IAJB 5J2QB 4RNOA 1T05B 2I1RA 2ASLA 4RW6A 4ED3A 1SH2A 5J2PA 3KLFB 4O4GA 4G1QB 4QW8A 3QIPB 3LAKA 5C25A 3NBPA 4YR3A 2JC0A 3C6TB 4GC7A 2UUWA 2WCXA 5L1IA 3TQ1A 2E9TA 1GX6A 4FBTA 1S9EB 4O3QA 4ECXA 5J1EB 2E9RX 3PW7A 3N6NA 4DG1A 1T03A 1HYSA 4DEZA 1IKXB 4KV8B 2XCPA 2W9AA 2VA3A 5J2QA 3D28A 1T05A 1NHUA 4NLQA 5KFRA 2QV6A 4LSLB 1XR5A 4RW6B 3T19A 1RTDB 4H54A 3H5YA 5J2PB 4O4GB 3I5CA 4G1QA 1BQNB 1LW2B 5C25B 5KG5A 2ZD1A 1HARA 3C6TA 1J5OB 1IKVA 3ISNC 1EP4A 4H4MA 1S9EA 1N48A 1BQMB 5F8JA 4YR0A 1RT6B 4DG1B 1T03B 3DLGB 4MIAA 5K14A 1HYSB 4TN2A 5KFEA 2QE5A 3NGDA 4Y3CA 3UQSA 3V6DA 4LSLA 1N56A 1R0AB 4K4TA 4F4ZA 3OL8A 3OHAA 3H40A 2ASJA 1RTDA 2VG7A 3KHHA 2BQRA 4WFYA 5CYMB 3DRRB 4PQUA 2V4QA 3GV5B 1BQNA 1LW2A 4MK8A 2ZD1B 4ZVHA 2IJNA 2W9BB 1J5OA 1IKVB 3OL7A 1FKOB 5KFQA 4F4YA 1EP4B 4H4MB 1BQMA 4HKQA 4KBIA 1RT6A 2FVRA 3DLGA 5K14B 3LP2B 5KFLA 2BQ3A 3KK3A 2AWZA 4ZVFA 3PJXA 1RT7B 2HWIA 3V6DB 5D3GA 4EEYA 2ZE2B 1R0AA 4EYHB 4J9SA 3UPFA 4IG3B 2VG7B 2FLLA 3OSNA 3I5BA 2YNFA 4R0EA 4ZMMA 5CYMA 2OPPA 4Q43A 3DRRA 4PQUB 3M9NB 4ZPBA 3NAIA 2F8EX 2WK4A 5KT5A 3UDLA 3KMSA 2W9BA 2R8HA 1XR6A 5KFTA 1FKOA 4Y34A 1K1SA 4WFZA 1C0UB 3CO9A 4ED1A 2C2DA 3LP2A 4ECTA 1ZETA 3FQLA 2IM0A 3KK3B 3QO9A 4IFYB 1RT7A 4QWEA 4EYIB 5D3GB 3H5XA 1S97A 2ZE2A 3CIZA 4MKAA 4MKBA 1UWBB 4IG3A 3GYNA 5KFAA 1D1UA 2YNFB 4ZHRA 2FLPA 2OPPB 2BQUA 3PZPA 1T94A 3MR5A 2IBKA 2D3UA 3I0RA 2XWYA 4WFXA 4QWCA 3TAMB 2FJVA 4ECYA 1T3NA 2XGPA 5KG7A 1TV6B 4KFBA 1C0UA 4NLSA 2C2EA 3UR0A 3KLVA 2AGOA 3LP1A 3DRPB 3GIIA 4HYKA 1JX4A 1KHWA 3RAQA 3KLGB 3KHGA 3QO9B 4IFYA 3G6XA 2HNDA 3RBDA 4Q0BB 3M9MB 2R2TA 2W7PA 4IOBA 5F9LA 1QAIA 1UWBA 4B3OA 4DL6A 2XGQA 2D7SA 4J9KA 4IKAA 3H5SA 3OHBA 2DPIA 1EETB 4ECSA 3V6KA 4ZHRB 2HWHA 5EWFA 1S0NA 4IDKA 2R2RA 3I0RB 2C22A 3TAMA 1S48A 3M8QA 3SFGA 4MFBB 3QLHB 5KFVA 4EBCA 1TV6A 4KFBB 4PWDA 3SFUA 5KFHA 3KMQA 3LP1B 3DRPA 1JIHA 1IM4A 2CKWA 4ZVEA 2E9ZA 3FSIA 3KLGA 2HNYB 2HNDB 1LW0B 1N4LA 4Q0BA 3IRXB 2YNHA 4I2PA 4O3NA 4J9MA 2ASDA 4B3OB 4M94A 2C28A 4QPXA 4NRUA 4K4XA 5DLFA 3FFIA 3MF5A 2UVWA 1EETA 4I2QA 3JYTA 3QGGA 2ILZA 3PW2A 4IDKB 1TKTB 2UVUA 2HNZA 2YKMA 4NLDA 3M8QB 1IKYA 1XR7A 3PW4A 4MFBA 3QLHA 3DOKB 4X2BA 4PWDB 2R2SA 1HNVB 1RTJA 4KKOB 3CJ2A 3D5MA 2HNYA 2IM1A 4WYLA 1S1XB 1RAJA 1LW0A 5DG8A 5JUMA 3IRXA 2YNHB 4I2PB 2RF2A 5KFZA 3JSMA 4ZP9A 3OL9A 4EO8A 3MEGA 3MECA 3FFIB 4J9PA 3PJWA 4FS1A 4I2QB 3JYTB 4ZP7A 4IQXA 5HBMA 1TKTA 2HNZB 4ICLB 2YKMB 4F4XA 1IKYB 3MR2A 3DOKA 5KFMA 5F8GA 4K4ZA 1LWEA 1HNVA 4QW9A 4J9NA 4K4VA 1RTJB 4KKOA 4NLXA 1RYSA 3GV8B 4ECVA 1S1XA 4TQSA 3OL6A 4ZPAA 4OL8A 4GC6A 4TY8A 2RF2B 2V4RA 1ZTWA 4NLVA 4ED0A 3JSMB 4RW8A 1TKXB 2EC0A 3MEGB 3MECB 2WHOA 3MR3A 4K4UA 4Y2AA 1SV5A 3KK1B 4RNHA 4RNNA 5HBMB 3Q8PB 2R8KA 2BANB 1S0OA 4NZ0A 4PUOA 2XI2A 2B6AA 4ICLA 4NRTA 1QUVA 1RTIA 1S10A 2BRKA 1LWEB 1TL3B 1JLBB 3NMAA 4WZQA 2YNIB 1RA6A 4TXSA 5KG2A 1LWFB 4Q45A 3KHRA 4TY8B 2IM2A 4DL4A 3IGVA 5F8HA 4DL3A 4MK7A 4RW8B 1TKXA 4NLYA 3ITHA 3EZUA 5KG0A 3G6YA 3BSAA 2XI3A 1SV5B 3KK1A 3QZ8A 4R5PA 2FLNA 2BANA 2IA6A 4PUOB 4ZPCA 2FVCA 4Y2CA 2B6AB 5KFWA 1KLMA 4XPCA 5HP1B 5DQGA 4U7CA 4JV1A 2HMIA 3EPIA 1RTIB 2RDJA 4IH7A 1S9FA 1TL3A 2FJWA 1JLBA 4K4SA 4URGA 3HVTB 4IH5A 2YNIA 2AGQA 3CDEA 5KG4A 1LWFA 1OS5A 3GV7B 4YMEA 5FDLA 2FVQA 4JV0A 4JV2A 3ITHB 2WRMA 5DGBA 3PW5A 2XC9A 2RKIA 4R5PB 1GX5A 5KT3A 3PR5B 1S0MA 4IRDA 4WZMA 3HVWA 2FVPA 3NL0A 1KLMB 1WNEA 5HP1A 5KFDA 1DTQB 1S1UB 3MEDB 2HMIB 5KG1A 1JLFB 1KHVA 4WXOA 3IG1A 2WOMB 2JEGA 3HVTA 3H98A 5L1JA 3DI6A 4O44A 5EDWA 2J6SA 4TLRA 1S1VA 3HKWA 1TL1B 1S9GA 5FDLB 2V0NA 3MTKA 4Q8FA 1D0EA 4J9OA 5F8NA 2RKIB 2HAIA 3KLHB 4RUAA 5KFKA 4ECWA 1CSJA 3CJ0A 2AQ4A 5F9NA 5HLFB 1S1UA 3MEDA 4K4WA
chains in the Genus database with same CATH superfamily
2LCWA 3VGVA 4X4QA 2F1FA 1WKJA 3NGUA 2Q1LA 3SEOA 4OLPA 3LW5C 4DU8A 3DI6B 4O44B 1ROFA 2QC3A 5U47A 1RK8A 1X4EA 1TL1A 1FK9A 3NGKA 1R3NA 2R4FA 4USHA 3NNCA 2KXFA 4ID5A 3NAHA 5L1LA 3BPDA 2YKNA 5AE2A 1Z2ZA 1XMBA 1FI4A 1TMMA 3CCJS 1U0HB 2UXCJ 3BJYA 4J9LA 2CQCA 1MNEA 3V81B 4DJBA 4WP8A 2BW7A 3MGJA 4FKYA 5KT2A 4DV1F 1XQIA 4C8LA 1XNQJ 1Q7LB 3M1VB 1QE1A 5LSLA 3CIMA 2IC3B 3S01A 1RT1B 4H4OA 3WX8A 1MN7A 1HPZB 3W66A 4RR5A 1XMOF 2DD8S 1KONA 2WONB 1AXQA 2QO3A 2V2VA 2V34A 3FBBA 4DR1F 1G3OA 2A6OA 3GMGA 4P10A 3MPDA 2RDIA 1S5ZA 4YEAA 5KFUA 2YKNB 2DK2A 1C4CA 1N5YA 1BXNA 1W25A 4QIEA 1WELA 4CLLA 3A3PB 3F56A 1FO1A 1FCAA 1Z1ZA 3T3FA 2MXYA 2MQPA 2P5VA 3IWLA 1UL3A 2C3UA 1RACB 2OP5A 5K8PA 2VHGA 5LMUJ 4NOHA 3UDEA 3MUMP 1VQKS 5L1KA 2CQIA 2IC3A 2G2OA 5E3CA 4KE5A 3KK2A 5EUHA 1RT1A 4H4OB 3Q23A 5KG6A 4AL7A 1RYRA 2AJ4A 3GJSB 3L7UA 4NA3A 4FBUA 3DRSB 2ROEA 1U1LA 2CFXA 2VFRA 5L9XA 4DS4A 3G6VA 2BE2B 2G0JA 5A0YA 3BQ1A 1Y5NB 5ETKA 1FKAF 3CC4S 1PBAA 1UMJA 2YX1A 2Y3YA 1HNIB 1N5YB 2F4VJ 3PIOQ 1KBRA 2HVDA 3NOCA 1FKPB 1RT5B 3T9NA 3I0SA 1RLDA 2GV1A 4KHRA 4A48A 5C2GA 2L9DA 4I1TA 3HVRA 3T1HF 2DNLA 2CYYA 1KNZA 1UVMA 1VRTA 4TYBA 5I3UA 2MKSA 2DIVA 2FY8A 4YR2A 1K8AT 3C8YA 4U9RA 5DLGA 4DR5J 3NNHA 1H73A 3KK2B 1MWZA 1G1XA 5KAKA 3KHLA 3KJVB 4IG0A 4IFVA 2QFIA 2U1AA 3K58A 3E2EA 1JLAA 2DNGA 4O3PA 4DHVA 4DV3J 5EWEA 4XO0A 4RZRA 4I6WA 5A0YB 3G96A 4J5OA 1JJHA 2BDPA 3KLEB 4LF7J 3FRYA 4RX6A 4ECRA 1YZ7A 2BM0A 4A8XA 2M5YA 3D7SB 2YWFA 1U02A 4EBDA 4ZPDA 1WG1A 2HRUA 3QGHA 2VQFJ 1TQLA 3I0SB 4K50A 2CQDA 1SPBP 1T11A 2CUYA 4YQWA 1ZPVA 2UXBF 2PFDA 4ECUA 1X0PA 1VRTB 1D9DA 3V6HA 3EM1A 4NLPA 2OPSB 2ZUAA 3IP0A 4G65A 4NA1A 1N36J 2OH2A 1SXLA 3BGRA 1S6OA 3G87A 4Z2XA 3RR7A 2Z0GA 3KJVA 2LA6A 3RRKA 3BKTA 1LWCB 1SH3A 2VOPA 2B7BB 4NLTA 3S7RA 3PR4A 1VQ5S 1R6YA 1Q53A 4AE5A 2M3DA 5EN1A 2BZ2A 4OZ2A 5KFBA 1VQ7S 3W2VB 4AYBD 1F2HA 1B3TA 3LP0B 4LF2A 4QYZK 4B9MA 3JSRA 3KXDA 4RUCA 2ZJQQ 1OSDA 3CCWA 2W2OP 1E6YA 3OLAA 5A2QY 5H9FJ 3CD0A 3BR9A 3NGRA 2GQQA 3SYZA 3D0IE 3IS9A 5BYRA 1U1KA 5KT7A 2FIUA 2OPRA 3BGRB 4NZ6A 4QYZJ 2BA9A 4ED7A 3ZZPA 4I0WA 3PACA 1OYDA 3BEGB 5KFGA 3WIUA 4DPOA 1R89A 1KR4A 5ETSA 5KFPA 2SXLA 4JUZA 3PW0A 4RW4A 4HH0A 3T5HA 1X4BA 3LP0A 5AXMA 3LANA 2R8GA 3B78A 4MTPA 4ZLJA 5KFOA 2I5JA 1MU2B 1WTFA 4QWAA 1M1GA 4MJKA 3BSOA 1SKWA 3R27A 4Z37A 1REVA 1U09A 1GT8A 2HFOA 2L08A 3WIVA 4I7FB 3L4BC 1CLFA 2JWNA 2RT3A 2HZVA 2W8LA 3DYAA 3I56S 2ALZA 4ECQA 3OT9A 4F02A 2QLJB 1IBLJ 1X7VA 2YKAA 4ANDA 1RT4B 1LKZA 2VG6A 2W9CA 2D9PA 3CJ3A 3H5UA 1R8HA 2IFXA 4HT5A 3Q0AA 4ZP8A 4G1IA 4DR3F 2DHHA 4V1Ak 1EQ0A 2JLGA 1YVFA 5DG7A 1RT3B 2KFZA 1JLEB 2I5JB 2ZOGA 2H5IB 3KJFB 4C0HA 3N5BA 4A8YA 4RW7A 1G6BA 1GMUA 2D1CA 2EK6A 4I7FA 3RTVA 1SKUB 1HHSA 1U49A 4JBCA 4DDFA 3FDSA 4YUDA 1SL1A 4C8OA 2Y8YA 4F25A 1QAXA 2NZCA 2W2PP 3A1YG 2RJZA 2CIMA 2C42A 2YQ0A 3CDWA 3D4JA 2VG6B 2WVCA 2ZC4A 1RA7A 1DTTB 2O3DA 1WDDA 3H59A 2BJ3A 2UUTA 2ZKUA 5IC4B 2RRAA 2OTJS 1BQXA 5K8OA 2VA2A 3MMAB 4OYBA 2B4PA 2KHDA 1X4FA 3I4HX 1RT3A 2R7SA 1ITPA 2GW8A 3O3LA 4J90A 3OFEA 3IGNA 3EJMA 2ZJRQ 1L3VA 1UWAA 2W7AA 3KDNA 4Y65A 2Z2LA 2OD4A 3WZ0A 5IWAJ 2BJ8A 4DUYF 2MGZB 3CC7S 2ZBRA 1RWKB 1VJQA 4DFMA 2MQ8A 2NPIA 2CQ3A 3C6UA 5KFCA 1D3WA 1K44A 3CJKA 3BBBA 3MUTP 1DTTA 1NKEA 3SDEB 2J0SD 2F7VA 1D09B 3MR7A 4DL5A 3MHYA 1S6PA 2DRDA 4Q44A 3V4IB 4DV4J 1XNRJ 2XB2D 5E41A 4PYDA 3ELHA 3QIDA 4S0MA 3FBEA 2GC8A 1R27B 2QLFB 4PCQA 2C2NA 1YDLA 2KT2A 2FZKB 3LAMA 4F4KA 1N5VA 1V3RA 3DLHA 1U7LA 5J1EA 3VZHA 1WF0A 3U1NA 5K8MA 5HAOA 1OO0B 1YJTA 2FC8A 1OY8A 4JV5J 5KFXA 1HBNB 4LFCJ 3WBZA 4ZCLA 1WOPA 1Z2LA 2FD2A 3Q86A 5D0HA 4ES1A 2L41A 3FZBA 5J2PA 1EQMA 4YDXA 2K8GA 1WG5A 1XBWA 5HI7A 4LF9J 2DJWA 1N32F 4G1QB 2MKKA 3RG6A 2D3O1 1KVJA 1MROB 2CPEA 4OZLA 2UUWA 3UD4P 3R7BB 1UJ5A 2A2CA 4LREA 1TL7B 5DDQC 5J1EB 3TAQA 3WC2A 4B08A 2H54B 5B0AA 4DG1A 1CS4B 2IHR1 2VASA 4DEZA 1LQ9A 2ZNYA 3AXKA 3GYGA 3KWMA 4J9VA 2Z57B 3H8YA 2YH0A 5L39A 3HM9A 5J2QA 2LXIA 1KQFB 1T05A 1HIYA 4NLQA 5KFRA 1NH8A 2QV6A 2LDIA 1IWGA 2NQPA 2J0XA 4N56A 3QWPA 1PYTA 1VR6A 5J2PB 1NRKA 3IC1A 2AJ0A 2Z2MA 4G1QA 4OJ3A 1WKKA 1WC6A 1QTNB 1WEZA 2MLYA 4P7TA 4DV7F 1HARA 3C6TA 1QAYA 4HTIA 1IKVA 1Q8KA 3ISNC 4WK1A 2VJVA 4DR7F 1EP4A 1TL7A 1R7IA 1BQMB 1Y5LB 1U6ZA 3IXQA 1TU0B 1F6TA 1C4AA 1NK6A 5F8JA 3FEYB 1T03B 4WZMA 5ETVA 3R5GA 3UN2A 4DX5A 4YDDB 2QFJA 2XLJA 3C15B 4Y3CA 3DLLQ 2YXLA 2ZNZA 4FXVA 2AEFA 4KRWA 4NYOA 3HFKA 2VDIA 3NG8A 1N56A 4F4ZA 1RBAA 2B9WA 4QQBA 4X65J 3CULA 4JI1J 4EUVA 4UUXA 2CG4A 2CPJA 3JSBA 4FF1A 1JNZB 2LMIA 3J80Y 2O66A 1LW2A 2GVDA 5AE1A 2CAJA 2GJ2A 2AJQA 1D9FA 2PT0A 3TA1A 1IKVB 3BDPA 1T9WA 3R5DA 3CCSS 1EP4B 3M2RA 1BQMA 1YJNS 1RZMA 3GJQB 4U67Q 4PQAA 4DN9A 2RU9A 3OVAA 5KFLA 4HEA9 1RHUB 3C15A 4YHHJ 1CEZA 4OYMA 4H4KA 1N33F 4LFAJ 4E98A 3LOUA 1TR0A 2YH1A 3AQOA 4CO3A 1EJ7L 4EYHB 1EKRA 4C8MA 2DKOB 4J9SA 2VJUA 2FLLA 3P6YC 4PG7A 4NEYA 4OX9F 2YNFA 1YJUA 3DFEA 4Q43A 3D67A 1Y9OA 1BWEA 2E1PA 3BH7B 2WK4A 5KT5A 2VKZG 3UDLA 2VC0A 3KMSA 4A8QA 2CJKA 3EICA 2KXHA 1XR6A 2PN6A 2R8HA 3EGZA 1HI8A 4M5DB 2V8HA 3M2RB 3X3UA 1K1SA 1T7PA 1C0UB 2XLIA 3MOZA 3CCLS 3U27A 4ZLNA 4OHWA 2ZDPA 2LQ5A 2IM0A 1QSSA 5B0BA 2XMKA 4OYPA 4EYIB 3MWBA 1S59A 2B9EA 3W8GA 3QSIA 1AFJA 4Y2MA 1VBKA 3GYNA 1O51A 1D1UA 1F9FA 1XERA 5KFAA 4ZHRA 2FHOB 2OPPB 2AJ1A 2RMLA 1T94A 2X3GA 3DXBA 5CZXA 3M8YA 3TARA 2BQUA 1RAOA 2D3UA 3CEDA 1TL5A 4HDHA 3QSYB 2IBKA 4WFXA 1REGX 3TAMB 4LF6J 2W24A 4ECYA 1T3NA 5KG7A 1R0BG 1C0UA 4NLSA 4FKXA 4AT1B 1UW4A 4X4TA 1NHKL 1S7IA 3DRPB 1Q78A 3KLVA 2Y1IA 3ENAA 2E1AA 5ETQA 2UUBJ 3G6XA 4LUBA 2G9OA 4X4UA 1N34F 3QJJA 3TJ9A 2HHSA 4DL6A 2C2KB 2W4PA 3B8HA 4J9KA 2DY1A 1U2CA 1OY9A 3H5SA 4HLBA 2CPYA 2E44A 1UVJA 1S0NA 4ZHRB 2DGQA 2QL7B 3EVOA 2EW9A 3UN3A 4ZCKA 5EWFA 1DRZA 4QPTA 4P2MA 3CE8A 4PEOA 2DY9A 1KD1T 1NJIT 4GKJJ 3KJNB 5FIIA 4FP9A 3SFGA 3EVWA 4EBCA 4PG4A 1RCXB 3Q8VA 3GR0A 1NSQA 3F73A 2WW8A 3W5ZA 3LP1B 1JIHA 1IM4A 4RUHA 4N7TA 3FSIA 2YBVA 2MEWA 1KLNA 1LW0B 1VQ6S 4Q0BA 3IRXB 2YNHA 4J37A 1TUVA 5M2UA 2FZCB 4B3OB 2CPZA 4X4PA 2C28A 1HBUB 2CVIA 2L9NA 3LGMA 2KG1A 3MF5A 5DLFA 2XS5A 1PAEX 1EETA 2FLOA 3OFHA 1HR0F 1MWQA 1TKTB 1QSYA 1X31C 4YY3J 2MYFA 5GMKa 3X1LB 3F41A 2VIHA 1NBEB 5IV3A 3JQKA 3W60A 1FJGF 2Z30B 4DQIA 5B0FA 4KKOB 1PAUB 2LDYA 3CJ2A 4C48A 4WYLA 4N8NA 4C8YA 1EZZB 1RAJA 1LW0A 2HFUA 3C19A 4HTJA 3BGLA 3IRXA 5DG8A 4I2PB 2B51A 3B54A 5KFZA 1YHQS 3JSMA 1HBUA 4EO8A 3MEGA 1AROP 4J9PA 4CNZA 3PJWA 3JAMU 3JYTB 3RW6A 3VV2B 4C11B 1S76D 1TKTA 4A8KA 2M7SA 4ED4A 3UCZP 3BR8A 2DR7A 2IJRA 2PI4A 2Y9HA 3H90A 3M30A 4KGKA 1HA1A 1FERA 1WI8A 2AF6A 2AJFE 4PYAA 3VAHA 2D74B 1HNVA 4KC5A 4QW9A 3NGSA 4TU8A 5ETMA 1RTJB 4NLXA 5IS2A 2EFGA 3CCQS 1EIYB 4B3TJ 3W3SA 2V50A 1VCTA 5A8RA 1RQ0A 1UETA 3MCNA 4TY8A 1TZ0A 3VQTA 3K59A 4GC6A 4OHXA 3V5RA 3JSMB 1TKXB 3MD1A 2NR0A 3MEGB 3MECB 1N0UA 2WHOA 1IQZA 3CCZA 1TK5A 4RNNA 3CCES 3PRDA 5IXUA 4XIUA 4MMOA 3BDEA 1RWPB 5LXRA 4PUOA 4YS2A 2HHTA 1URNA 1MLAA 2M70A 3D68A 5GADI 5L8RC 3M30B 2BW2A 3FK4A 4LF4F 3QT5A 1S10A 3VTIA 2J7UA 1H38A 3J7YI 4K4VA 1HI0P 4ZVOB 1XIQA 4TNOA 5H9EK 4X84A 3G8SA 4FF4A 4TXSA 2LXFA 3UNGC 1LWFB 4M1KA 4DL4A 4B3MJ 3VAMA 3Q2TC 2K3IA 3R5JB 1TKXA 2ZBQA 2O67A 3EZUA 2HK3A 4DPWA 5HVGA 1RB0A 3G8TA 2KTQA 3HLUA 4ZVSB 4R5PA 1PSDA 4FF3A 3BKFA 4ZPCA 2MKHA 1X5TA 4F67A 5L46A 3PX0A 4W92B 4EMDA 4UF4A 5KFWA 2Z4PA 1RLCL 4OZ1A 3HDSA 3MPWA 5DQGA 4U7CA 3NS5A 4MAKA 3Q83A 3D3BJ 4P2XA 2RDJA 2JZ5A 2QA4S 4IH7A 4B3RF 2EVZA 2OTLS 1VLYA 2HVHA 1SJRA 2QMWA 2V2QA 2JJ4D 4URGA 2H9ZA 3MOJB 2ADBA 4FNHA 1RAEB 1LWFA 1OS5A 1KKHA 2G1DA 5KG4A 5GAHI 5D4LA 2UU9J 1U2FA 4NPOA 2QZ8A 3M2VB 1UP1A 4TVAB 5DGBA 3PW5A 3PNIA 2RKIA 2XNRA 1S0MA 1HR0J 3PR5B 4A8FA 4IRDA 4NA2A 2OEJA 2F4VF 1U1RA 2FVPA 3ILIA 5ETLA 3NL0A 1O6XA 1Q0NA 2AIRB 2IYGA 2MLXA 1KLMB 3MAAA 2RU3A 2KG0A 3ZO7A 4DX7A 5KFDA 4UW2A 3TJAA 1WNEA 1TK0A 3AA9A 2CRLA 2XMMA 4NYPA 1KWMA 4HACB 1W7WA 5K8NA 1PO6A 2PFFB 8ATCB 2EG2A 1IR1A 1SKSA 2JEGA 1HNWF 2VBXA 2M88A 1NK9A 4O44A 3CJQA 2HZAA 1XMOJ 4CYUB 1TL1B 3J7ZT 5FDLB 2Q6CA 2V0NA 2YQ3A 4Q8FA 3M6WA 4Y6IA 4JI7J 3FUYA 1D0EA 2C2OB 4DV2J 4J9OA 2Q3PA 1SJFA 2RKIB 5F8NA 2CNLB 3BBCA 1JXVA 2IYIA 2DH9A 2ZWPA 2EC2A 4ECWA 4DSIA 4LIRA 1CSJA 1X4GA 5H9EJ 2AQ4A 5F9NA 1FFSB 2R2SA 2B43A 4GVBA 1TKZA 3BB5A 2JEJA 2WTFA 4LQ9A 4RJVA 1FESA 2IA0A 4M63A 4CLUA 1QE1B 1Z4UA 2Z2YB 1S6UA 1FE4A 2AYGA 1CULB 1HPZA 4JI6F 5T14A 4O0NA 4L6V3 1S9GB 2WONA 1ZM9A 2CJQA 1IJEB 3P8BB 2FB0A 2AP6A 1L3KA 2U2FA 3O6QA 2KL8A 4OYIA 4IO9Q 2LU2A 1U26A 1K9MT 1SH0A 4USIA 2F63A 3KUEA 1KOOA 2HHHJ 2ZM6J 2CPFA 3I96A 2VUGA 3GQCA 4K4YA 2ASYA 2IMOA 3JXOA 4KAIA 1IBKJ 1QLNA 2NCKL 4OJGA 2QG9B 1TKZB 4GVBB 5KFNA 1U6FA 3FQKA 1PC5A 4TKTA 5KFIA 4YN3B 3TUPA 1CULA 4WP3A 1NNDA 4EO6A 1F9EB 2XM3A 1TFYA 1CJVB 5AT1B 1U6BA 3VGSA 5HSPA 2CJYB 1NDKA 3C66A 4QIWD 2BE2A 2JFDA 2ERRA 2Y8WA 5IZHA 1GMWA 4LBHA 3T5LA 8RUCA 1I94J 3TQEA 1FF2A 1WHWA 3NP5A 5E3RA 3VAFA 1S7HA 9ATCB 1WKLA 1FKPA 1RT5A 3RUBL 3UNYA 2HQGA 1CQNA 2RUSA 1AB8A 2NXUA 2WSCC 4CI0B 3G6YA 1T9TA 2RNEA 2EBGA 5I3UB 3VAGA 1WOOA 2GFFA 1E6VA 5J1PA 2QA2A 2LKZA 5G0RA 1FFGB 3N6MA 3TZYA 3HMJG 1I1GA 1N88A 4ER8A 1RADB 3SSSA 4O3OA 3PHTA 1XEZA 1SB6A 4G3IA 4WWSA 3F0NA 2EFQA 3MCOA 3ISND 3KLEA 2NSBA 3I9ZA 4P75A 1JB0C 2NXCA 5A8WA 1YIJS 3HVAA 4K2JA 3C14B 1FNXH 3N28A 3ET6A 2VFVA 3GYXB 2HZCA 2CQPA 3H4DA 1T95A 2OPSA 5A2QU 3KLIB 3HSJA 1IKWA 1E6VB 1B4SA 5B0CA 3EXYA 5G0RB 1M5PC 3DU6A 4MK9A 5M2RA 1UVIA 5EX3A 1KQSR 2F8MA 1M5SA 2LQJA 3QBCA 3W2VA 3CJ5A 2D3ZA 3HSGA 1TK8A 3GLJA 4U8VA 3GP9A 2YKQA 3PYDA 5HMYA 3LGNA 1NK4A 1YSJA 1WC1A 3ISZA 2DPJA 4F50A 3MM5B 3WDOA 3BH6B 2OI2A 4X66J 1YBAA 1JXLA 3MMBB 2EXUA 2WAQD 2FHJD 3G86A 3IS9B 3KLIA 2OPRB 3G2XA 1X4DA 5F8IA 1F3VA 5IOLA 2R7UA 1IBLF 4YB6A 3GIMA 4F3QA 2XG8A 5ETTA 1P8GA 2OGUA 1K1QA 4O3SA 2BOAA 2DGWA 3MAHA 2W01A 2AEMA 2LU1A 4NLGA 4YFUA 3W65A 4B9UA 4MH8A 4RW4B 4C0OC 3GZ7A 3Q2SC 3UD3P 1NSKL 2ROPA 4NL5A 2ACYA 1SC3B 1R31A 2CNNB 3PHEA 3RJMB 2I6WA 1BUXA 2HHXA 4GKKJ 3MM5A 1C1BA 2VFSA 4I4BA 3VAIA 3MMBA 1QY7A 3SCLE 3NLCA 2XO7A 2HBQB 3EZOA 5GAEU 4RW9B 4ZVGA 2EK1A 2JLFA 3LQVA 2MKJA 3GIRA 4IRCA 2W8KA 1RT4A 2MPUA 3EVMA 1ZAVA 4NX9A 3DKDA 5KFYA 4A8OA 3MFHA 4DR2J 3G9CA 1Q16B 3ZZRA 5B0EA 2XBPA 2ZH9A 1CJKB 4I68A 2ZH4A 2RSQA 2ZBPA 2ZITA 2E1CA 1DY3A 2HRYA 2AT1B 1V3ZA 1TTHB 3HSZA 4DUZJ 1C1BB 1UZDA 1SVDA 4ZDNA 3TEGA 5CABA 1FRHA 4UTGA 4NLWA 3PW7A 2D41A 4QWBA 1U0SA 1IBKF 2HBYB 2V8GA 5FLXU 2CQ2A 4RU9A 2M9KA 3ILOA 1WC3A 1NUEA 4Y0FA 3E8OA 4O4RA 1FJ7A 3NKYA 4QJVA 5DG9A 4F26A 2RD5C 3LALA 1LWXA 2EKNA 3HHLC 3OD2A 1NHVA 1WSRA 2JSXA 4X4RA 4DV4F 2FJDB 4ILMA 1S99A 3AODA 3M8PA 2BJ9A 4QOTA 3RBXA 4N77A 3FEZA 3W61A 1YKWA 2KYXA 3W7BA 2E5LF 1WG4A 4RNFA 2CJ9A 4NLRA 3VWSA 2IMWP 3PO4A 1ZH5A 2CQBA 2YNGB 2V9KA 4X66F 2VOOA 3C6UB 2RE1A 2DITA 3QWUA 1RAFB 4OZNA 1TVRA 3EWGA 3CJKB 3TANA 4KTQA 2HQFA 1X9SA 1UA1A 1S1TB 3SDEA 2NUUG 2UUCJ 3HP6A 4CT9A 4BDPA 1S6PB 2IJFA 3V4IA 1HWJA 1SC6A 1WI6A 5AJ3F 5HO4A 5AJ3J 3EGWB 3M8PB 3DM2A 2QSWA 2VPXB 3QPIA 2J6UA 2N4CA 1LK7A 2LVWA 3W2WA 5LMNF 3DDKA 4KGVB 4OI3A 4Q7AA 3Q8QB 4P52A 2ILYA 2BUNA 4WF9Q 1F5CA 3DHWC 2XS7A 1S6QA 3OQ2A 1RHRB 2YNGA 1P9YA 1FXRA 4UQGA 3T6BA 2KN4A 1KVIA 2E7VA 5C42B 4NLUA 4ZJLA 4CDIA 1TVRB 2XQCA 4RKUC 4V19X 3A3NB 5D0RA 2HPUA 1S1TA 2HSEB 2GAGC 3HHEA 3S1TA 5L9NA 2IM3A 2X1GA 3W5YA 4BLGA 2KH9A 2DYAA 4KPCA 2W7OA 3OLBA 4DV0F 1VQ4S 4KPYA 3R6LB 6AT1B 1RHQB 2CQ4A 4WIIA 5GAEI 4IRKA 5HMZA 2WVDA 1NDPA 3A8KA 1PILA 3MMCA 4OZ0A 4DV5J 1CBKA 2YVSA 2UUBF 1MG7A 1ZPWX 2JC1A 1S6QB 4WXWA 2Y0BB 3NRBA 5IQ6A 5E2QA 3UVJB 2UVRA 2A2DA 2CPXA 5C42A 1GTHA 1X4AA 2B4OA 2MQMA 4DMZA 5CA5A 2NUHA 3V6JA 3VQSA 2BJ1A 3VZIA 3IWNC 3RU0A 1BD6A 3J80U 2FY1A 2BKNA 5J2QB 1YI2S 1T05B 1Y4ZB 3GU0A 2VV5A 4DR6F 3JB9k 1WF1A 2A6MA 2BACA 3GE9A 1WUUA 2FPHX 5CYJA 4BWMA 4ED3A 2HQDA 3KLFB 2HVIA 3PRVA 2EG1A 1LV5A 2DR5A 4QW8A 3QRPA 5C25A 3HD2A 2AD9A 1APSA 3NBPA 3C6TB 5L1IA 3TVYA 1U2RA 1GX6A 4FBTA 1S9EB 3K89A 2W2QP 2E9RX 3UVJA 1Y10A 4USWA 2IY5B 1T03A 2JL9A 4RU2A 3AJDA 2XTJP 1IKXB 4KV8B 2XCPA 4ID8A 5HN0A 1YJWS 3D28A 2VA3A 4I67A 1IBMJ 1ZM2A 4IOAQ 1B7YB 4DPYA 1ZM3A 2J9EA 3AJ1A 4OX9J 4H54A 4P2FA 4CRJA 2Y0SD 3CMAS 1YZ6A 2W4CA 1WTBA 1SKRA 3P96A 3I5CA 4X62F 1R0CB 4X4NA 1LW2B 5C25B 1TAQA 2GVDB 3QAUA 3UW1A 2ZH2A 1U1OA 3HI9A 2KT3A 5LXYA 1ZOTA 5GMEA 4V19J 3RRHA 2GMLA 5HQMA 4DUZF 1S9EA 2XMUA 2ZVIA 5DJBA 3L3CA 5I3PA 4YR0A 1IJFB 1VFJA 4MIAA 3ZZUA 4JI3F 3GFHA 3NGDA 2QE5A 2E1RA 4UZCA 2MQOA 1GEHA 2ZH3A 4B9NA 2LA4A 5D4NA 3H20A 3CCTA 2KFNA 2W25A 3MM8A 2HFZA 5AE3A 1HBOB 3ILJA 3T41A 3N0VA 3U02A 3OL8A 3GSDA 2BEFA 1TL4A 2VG7A 2IDLA 1MMDA 3FZ2A 3KHHA 3HHLD 1PGZA 1T02A 2ZBIA 3SSQA 1PYOB 5B7WA 1YBUA 3B4DA 3GV5B 4ZVHA 2DHAA 3JAMY 4B3TF 3RR8A 1J5OA 3D54A 2VL1A 4B02A 2K3KA 5I3QA 2RH3A 3SZ2A 4OI0A 3VVUA 3GR1A 1AUDA 2M52A 2CWKA 2XWXA 4GKKF 1OPIA 2QA1A 1RT6A 2BV3A 3CD7A 3KFWX 2OMOA 3G4SS 1VLOA 1HKAA 2BQ3A 2RQKA 4F04B 4WJBA 1A7GE 4DR7J 1KOHA 1AFIA 4LVOP 3IAS9 2HWIA 3AB2B 3V6DB 1N54B 4OYWA 2O01C 2QX0A 3MM8B 3FMBA 2XMTA 4DWIA 4UZBA 2VG7B 1N5SA 3OSNA 4GO5X 4ZMMA 4AL6A 2OPPA 1D8ZA 3CSKA 4ZPBA 4YB1P 1F60B 3PKMA 2W9BA 4CM0A 1Q1KA 4USUA 4CLZA 3M4XA 1LEOA 1FRKA 1FDBA 3NXZA 4FYWB 3QT6A 1Q82T 4FYXB 3TZXA 4ED1A 1Y5IB 2KHCA 2V8DA 4ECTA 2AYEA 4DU7A 3EXCX 4LRFA 3QO9A 1KSPA 3VVTA 1RT7A 3HHNB 1FRJA 1F3FA 2WVBA 1S97A 2ZE2A 3CIZA 2V4JA 4DR6J 3AFGA 2LECA 1JXEA 1MWYA 4IG3A 1WEXA 2WBMA 1ICEB 2GVZB 4DL0C 1LXNA 2GMJA 3PZPA 5HJXA 3MR5A 2KVQE 1VISA 3PFEA 4FNIA 3CCVS 3KTQA 5D4PA 4DQPA 4OMFG 3KKFA 2UXDJ 1O8BA 2C3MA 1U1NA 3OJSA 1TV6B 4KFBA 1UPMB 2PSZA 4DV6F 1S79A 2MKCA 2M8DB 4DV5F 3LP1A 2QLBB 3D0HE 3NCPA 3ENVA 3QRRA 3KHGA 2ZOFA 3QO9B 1PKUA 3L7OA 1WOSA 2HNDA 3RBDA 2HHWA 4Q0BB 1HFEL 1UA0A 2FHJA 4CLTA 2V4JB 4B3OA 1YK9A 4WFNQ 2D7SA 4B17A 3HFVA 1H3DA 2DPIA 3PEHA 2PGCA 1EETB 3TAPA 4IDKA 2R2RA 1WD6A 4JI4F 2HHPA 3D6HB 1X9WA 3M8QA 1P1LA 2X1AA 4MFBB 3Q8YA 5BYQA 3IRWP 1TV6A 4KFBB 4DFJA 2R3VA 2E66A 3LO3A 4ZVEA 2XZDB 3PEJA 2HNYB 3IR5B 3HFZB 1ELOA 2HNDB 2DIUA 2VB6A 3LF0A 3WHIA 2B4UA 5MLCV 2DRBA 4O3NA 4I2PA 5M2PA 5JVHQ 4M94A 4OHZA 4QPXA 2IBOA 2HGMA 3H42A 4NE9C 3DHXA 3FFIA 2CG8A 2MZSA 4NRUA 4PR6A 4X65F 3JYTA 3QGGA 4C11A 4IDKB 4X4VA 2HNZA 2ZBCA 1Y3KA 2KJVA 2VBWA 3DDIA 1RBLA 1VMBA 2UXDF 3M8QB 2H1YA 3IAM9 2HK2A 2KJWA 4MFBA 3PW4A 4QU6A 1IQTA 3BF4A 2QJ3A 1IXKA 3EUNA 4A47A 2XO6A 2WVFA 2XEXA 2BJEA 3ETOA 1HNVB 3D6TB 5BXIA 4DOZA 1RTJA 4NWBA 2RRNA 3D5MA 5ETPA 2HNYA 1S1XB 2JOQA 5A8RB 2H65B 2VQEJ 4FPRA 4W4MA 4M5IA 4OYAA 1M0SA 3HJFA 3FJ2A 2XSJB 4ELUA 4JI7F 3OL9A 4UOHA 3MECA 3FFIB 4PPZA 4FS1A 3AH6A 4LFCF 4I2QB 4LF5J 2Y1JA 1JNRB 2DH8A 3SQOP 2EEYA 2KM8C 2G4BA 3LPYA 3MXHP 2HNZB 4HHJA 3J7YU 2HYIB 3DRYA 4RLEA 3HF5A 2O1PA 2K7JA 3MR2A 4P72A 2F40A 5HANA 5D78A 5JMNA 5LJ5Y 1AYEA 1T3OA 3TW0A 4DZDA 4F7VA 2FGOA 4J9NA 2L9WA 7AT1B 1UEVA 3GV8B 1S1XA 1IWAA 4EK2A 4OL8A 3ZTQA 1RU1A 1VIOA 2V4RA 3PV8A 5LT5A 2XSJA 2R7QA 5HL7Q 2EC0A 4ZOSA 4B9TA 4K4UA 4C8ZA 1X5PA 5HBMB 1OSCA 1FDDA 1G4CA 2GHVC 2XI2A 4NZ0A 4HT7A 2HW3A 2CQGA 4L75A 4CO1A 1RBOB 2HURA 3O44A 2OAUA 3K5NA 1FJGJ 4NRTA 4WP9A 3NCRA 1K0TA 2BRKA 2E1MC 4JI4J 1X4CA 2DNZA 3FNNA 4N41A 4HH1A 1RWNB 2COLA 3CCMS 5CAAA 3OPKA 1WSVA 4MYTA 3V2UC 4F36A 1CG2A 4Q45A 3KJQB 1FX4A 1GXTA 3POTA 1YWXA 4K4XA 4FYDA 4XDCA 4DL3A 1RWMB 5KG0A 2X1BA 3ITHA 2EKYA 3M2VA 4FZVA 1VK8A 2DNPA 1NDCA 2IRXA 3BSAA 1SV5B 3KK1A 3PG9A 3SSRA 2FLNA 4E0DA 2ZFHA 4FXWA 4M5KA 4FYVB 1R43A 4Y2CA 2B6AB 1KC8T 3MCMA 2LP4A 1KLMA 1NEEA 4ELVA 4CP5A 5HP1B 2BABA 2OEKA 2E5IA 4J9UE 2W2NP 4AQYJ 1AUSL 4HACA 1TL3A 4QYRA 3TP2A 3IBWA 1ZZNA 4ZPWR 2AGQA 2GNKA 4DR4F 3POTB 1JK9B 4CYUA 4UQTA 5FDLA 3V4MA 2CZVC 2FVQA 4JV2A 2HHVA 3ITHB 2VQFF 5A6PA 3C46A 4UY85 1GX5A 2JVRA 2HIYA 1KTQA 2ZOMA 4ZVTB 3SIPB 2KZMA 4LR9A 1QDUB 2XMAA 1RWUA 5HP1A 3S6EA 1S1UB 2VPWB 1YITS 1JLFB 3D3CJ 2V2ZA 4HHUA 2E5HA 4WXOA 5ADZA 1XJWB 3AT1B 2DXDA 1Q86T 2YTCA 3I87A 1JJCB 5EDWA 2DO4A 2J6SA 3HKWA 4NCAA 1S9GA 2H48B 1YJ9S 5LSOA 1U25A 1ZAXA 3BN4A 1NSAA 1WDTA 5DS7A 3TUIC 2RAQA 2ZWOA 3VCDA 4DV2F 3R97A 3KG1A 2HAIA 2GX8A 3L09A 1SC4B 2V94A 2MTLA 3SMZA 3AB4B 2POKA 4N8OA 4U8YA 2EBEA 1WC5A 1S1UA 3K5OA 3CMES 1JLFA 1X5OA 3MUVP 4P2SA 2OLWA 5KT6A 2F9JA 1NPRA 2HIQA 4WK3A 3QGPA 4URQU 3H2LA 3EX7B 4DR4J 3FBCA 2G2ZA 2JLEA 1CJVA 3OSPA 2K1RA 2MZTA 3PFOA 1VQNS 4YOEA 2DH7A 3TX8A 1U8SA 3RB6A 2A1BA 2FC9A 1RAGB 2V8PA 2XCAA 4GKJF 1ZBTA 2IDEA 4IOCQ 4NXNF 2DEIA 4DL7A 3ILLA 2VH7A 3CVKA 4LBIA 2KU7A 2A3JA 5EHHA 4KGZB 4O23A 3SCJE 4DSFA 3T1AA 1VQ9S 3IWXA 5JXSA 1P1TA 3M6VA 1RHKB 2BJDA 2AGPA 4KO0B 2HBZB 3R8YA 3UE2A 2JEFA 2H4YB 3T6JA 1JLCB 2M0GB 1YTYA 4KHMA 5F8LA 3OVSA 5CYQA 1RE1B 1VS3A 2K1RB 5CH7B 3JS9A 4U95A 3GILA 1NJXA 3ADAC 4ATNA 2CQHA 5KOXA 1HD1A 4M5HA 2RVJA 5FLXY 1B0VA 1SJ3P 2B56A 5A8WB 4ED2A 2UU9F 4DUYJ 2GCFA 4RWXA 2O5DA 5D0GA 3VGTA 1IR0A 1SIZA 2KI2A 4LSNA 2AU0A 3C14A 1IR2A 1NH7A 2NSCA 3ET6B 3W9JA 3R5BA 4B3RJ 3W5XA 5HMWA 2DNMA 4UOCA 2VFUA 1C1CA 4KO0A 1N5TA 1IKWB 4ZJQA 2N3OA 2MSTA 5DQHA 3LWLA 2R2UA 3W62A 3IN5A 3GIKA 1QAJA 2HS3A 1AW0A 1V6HA 1RU2A 2LFVA 3QATA 3EMTA 3RAXA 2H5EA 1RAIB 5CD4H 2V68A 3HKZD 1R6VA 5E33A 3JTPA 3KOAA 1HW8A 3JTOA 2D9OA 3R6GB 1IVZA 5F41A 3DMJA 1FE0A 2Q6BA 4F0KA 3S8SA 5DRKA 2MKIA 3BBFA 4HVZA 2L48A 4DL2A 2XZTB 3VALA 1F2GA 3CDUA 1IBMF 1FWKA 1UAWA 1DZ5A 4ZA1A 1OYEA 2HQ3A 3CNQP 2B3TB 4I6AA 4LF7F 4BS2A 1H2UX 1RAHB 4L3KA 5EGYA 5HROB 2UV8A 4EWTA 2XY6A 2F9DA 2AW0A 4KYZA 3LUYA 1YX2A 2ACMA 2GIQA 3QYYA 4QR2A 2OD6A 5FD1A 5GAGU 3Q8RB 2RQCA 1VC6A 4PPDA 2DCLA 1X0FA 2DNKA 3TVKA 3HHKA 1XTZA 2DR6A 1WJ9A 3PDNA 4RBUA 4RW9A 4IO1A 4MIWA 2BE9B 4M5JA 1DAXA 4NZ7A 3CC2S 3THTA 5KTQA 2LXUA 3OVBA 4M5NA 2NXNA 4P9SA 3F44A 3MR6A 3J81Y 4IR9A 2A18A 4OI2A 1JKHA 3GWCA 4C2MA 5IT9Y 5J2NB 2R7WA 2H5JB 4Q8EA 4WU3A 5HROA 1CJKA 1UCNA 3M2UB 1HW9A 3T5JA 3A3OB 2KM8B 1YQHA 1LOUA 2CPHA 3NWRA 1HQUA 4DSJA 3K0JA 3H2UB 2OPQA 5IT0A 2E5LJ 2YX4A 4CNYA 3CXCR 1HNWJ 4RBTA 2LLZA 1FTRA 5J2MA 1KQGB 4K5RA 1VC0A 2P9EA 3JQMA 2GJFA 2PA8D 3NGTA 2X1FA 2B8QA 4D3HA 2ZZTA 3J7A1 5G4DA 4OV1A 1UPPA 2MZQA 2ROGA 1EKSA 1JKHB 2OSQA 4ETXA 1FWPA 1AZSA 3QNWB 3TR5A 3GIJA 2P9CA 1UJ4A 2BX6A 1M1KT 3SCIE 2CZ9A 2AYMA 3MM6A 2F5GA 4MIBA 1FHTA 1L3TA 3I55S 4ED8A 1HQUB 2ATCB 3D1QA 2G2YA 1EX8A 5ETNA 2OPQB 3H7HB 4LR8A 4EU0A 3DCAA 5DQIA 5IM0A 2R8IA 2DEJA 2HVZA 4C3KA 3GCWP 2MQQA 5LMUF 5J2MB 2VBZA 4LQ3A 3AHPA 5DGAA 4IH6A 1PIEA 3MFIA 4K0KJ 4IUFA 5C24A 1I3OB 3PIPQ 3DDNA 3MPYA 1U1QA 1NCLA 3GJTB 1IUJA 2GQ2A 4WTYA 1LFPA 1RP5A 5D0EA 3QJPA 4L72B 1HQEB 2KXNB 2I38A 4XDDA 3FGVA 1XNRF 2LEPA 3BS9A 1XC9A 1ACMB 3MM6B 1WC0A 3DM2B 4ZPTR 5LSRA 4WBFA 3QT7A 1ZTTA 1BGXT 1LNQA 3W2WB 3A4TA 1EB0A 5IM0B 4AXJA 1M90T 3AA8A 2MY8A 3CT9A 4LSZB 3UD5A 2FTRA 2NYIA 5KT4A 4WE1A 4DR5F 3TUJC 2J76E 1NB2A 4A46A 3R9LA 3GONA 3SV3A 4JP8A 4U7UK 4KH1B 2QGFB 2VBYA 5F8MA 4DF4A 1YJRA 4ITSA 2C2RA 4DPXA 4N47A 5LOQA 3SV4A 2PA3A 3CCUS 4OHVA 1B99A 1VQSA 2W1BA 2PMHA 1R8BA 3MEEA 3BSCA 5A8KB 4KB7A 3BZQA 4DI6A 1VOMA 3O1LA 4CO5A 2MJUA 2BM1A 2MQLA 2J7KA 3D66A 1CC7A 3EPGA 1TAUA 3MMCB 1HWKA 3TNVA 4HR2A 1OMSA 4WE1B 2CQ1A 2GIFA 3HT0A 2GO8A 3RB4A 3E01A 3ICLA 3CD5A 1LFWA 3TEHB 5GAHU 1H7XA 3CJRA 2A0FB 3UFCX 1V5VA 4EGLA 3MPVA 1JLGB 4DFKA 3W9IA 3BO2A 3PVXA 1M5VC 1P6TA 1KVKA 3MEEB 1DQ9A 3FMWA 1X9MA 1N5QA 2YPYA 1VIXA 1FRXA 3CO0P 4Y28C 1Y7PA 3TVZA 1VRUB 4DX6A 3KLFA 4U6PA 4TLQA 1B64A 2OSRA 2PD1A 4WIQA 1FVQA 4Y2IA 4I56A 1V3SA 4CM2A 2ABYA 4CIOA 3OUYB 2ATLA 3KDOA 3NBPB 1HMVB 1T0TV 4M5GA 7FD1A 3QRQA 4KHPJ 1GTEA 4DF8A 2J6TA 3E01B 4URSA 3AAWB 5IQQA 4RO0A 3P3DA 1NJYA 1KS2A 1IKXA 4KV8A 1Q5VA 3AD7C 3KUHA 4WYWA 2KKHA 2PMWA 1JLGA 2YWGA 2IAJB 2HFVA 4CWBA 4ALZA 1BHNA 2CJBA 2R7TA 2Q43A 2IRUA 2VFTA 1SH2A 1QD1A 4MKVA 2YWKA 3OUYA 3QIPB 3LAKA 5IWAF 2J0WA 2JC0A 4GC7A 1L5UA 1YGYA 2WCXA 1VQOS 3D1OA 3Q24A 3DXSX 4K59A 4XAKA 4O3QA 4ECXA 4NXMF 3T1YJ 4USJC 3N6NA 1YRUA 4LF8F 3LPEA 1M5HA 1VGYA 2BMBA 1HBOA 4LSLB 2BYCA 2ZHBA 4RW6B 3T19A 1RHMB 4OX8A 1Q8IA 4M5LA 1NU4A 3H5YA 2B9XA 4LRAA 5C7PA 4LF4J 3RW7A 3NWGA 4G6VB 2IVFB 2ZD1A 1BE4A 1B70B 1PCAA 1J5OB 4CLFA 4RL1A 1Q8LA 5D4OA 4F3MA 2DGTA 1QJHA 1N48A 2UUAF 2QL5B 3SBMA 1RT6B 3IMQJ 3I9V9 4GRSA 4ANEA 5KFEA 5DM6Q 1GXUA 1HYSB 3RBZA 1SIWB 4R0JA 1FDNA 3V6DA 4LBPA 4OHYA 1A9NB 2KT5A 2EPIA 1RKIA 4LSLA 2IIHA 3H40A 4LT6A 1RTDA 1F5BA 2VF3A 4OX7A 5A6WA 4WKRA 2BQRA 5CYMB 4ZIWA 3GJRB 5DDRC 4AD6A 1BQNA 1AT1B 2KB2A 3OFFA 2ZD1B 2E5JA 1HBMB 2IJNA 4MK8A 4USKA 5E5NA 3QT8A 3M8SA 3OL7A 1FKOB 1SQEA 3CDAA 2W9BB 5JVGQ 3D6FB 3ZFVA 1K73T 4ZN3A 3OTOF 1GQEA 5AXLA 5LL6d 3DLGA 2CQ0A 5LM7E 3T1YF 2OMLA 5B08A 2HKEA 2AWZA 1QM9A 1RT7B 2OUGA 4C9DA 5J1NA 1K47A 1TMJA 2ZE2B 2RIJA 2MSSA 1R0AA 4OYZA 4ZVUB 5SZTA 2D3OR 2OJ3A 1UFLA 4IG3B 3NY0A 4FVCA 4ENOA 3I5BA 4PWWA 2GVZA 4R0EA 1QVGR 5CYMA 3UI3A 4ED5A 3M32A 4OI4A 3KG0A 1UW9A 3M9NB 2AEJA 1Y0HA 3EYZA 1U24A 1NDLA 1FKOA 2XYPB 3RAMA 2RDDA 4P73A 2I2YA 4Y34A 4F0HA 4JI8J 2DT9A 3CO9A 3P5TL 1HNZF 1UVKA 3LP2A 2OELA 4FYYB 3FQLA 2ZUGA 3PYGA 2RHQB 4IFYB 4NCBA 1IN0A 1K0VA 2B7CB 1EAYC 2QL9B 5D3GB 2V2KA 4Q2MA 4QWEA 2BVZA 1U1PA 4UOFA 4MKAA 4MKBA 5K5MA 1S57A 1F9HA 1D9AA 1UFKA 2ADCA 2FJBB 3R2DJ 1V9OA 2CJXB 2JRSA 4RUBA 3M32B 3M7VA 2JFKA 3DLBA 3I0RA 4X4OA 4QWCA 5H9FK 1SCJB 5THWA 3B6BA 1HNXJ 2V5HG 2GQCA 3UR0A 4DV7J 3THPA 3IM9A 3CJTA 3GIIA 4HYKA 1JJ2R 2WSEC 1JX4A 4NXMJ 2JX2A 1KHWA 4ZS6A 3RAQA 3KLGB 1W2BR 4IFYA 5LMNJ 2GGPB 2AYBA 2GS8A 1KRPA 4OJHA 3M9MB 2R2TA 3N4WA 5F9LA 3G82B 1QAIA 2W7PA 2RQMA 2ZEJA 2YY3A 2F65A 2XGQA 1SI9A 3OHBA 1XMQJ 5D8HB 2C3OA 2PIIA 4JI5J 4ECSA 3V6KA 2N3LA 2HWHA 1VQYA 3M8WA 4FDFA 3BPSP 2H51B 3TOQA 3I0RB 2ZH7A 2C22A 1XNQF 2XS2A 1S48A 3N9UC 5B0GA 5B0DA 3AD9C 5D15A 5KFVA 3QLHB 1JMTA 3KMQA 3ULHA 5KFHA 1OJ4A 1TFWA 1NZ8A 4LR7A 4LF1A 2WZ1A 2E9ZA 3PTWA 1FNOA 3HULA 4JB8B 3KLGA 4F2RA 3O5TB 1N4LA 1RHJB 4CZCA 2IVMA 3ZTRA 4ZLLA 1OQ3A 3FCHA 1I5OB 4DUTA 2NREA 2UVWA 4I2QA 2Y1LB 3A13A 2ILZA 3P4UB 3PCOB 1H6KX 3FBFA 4USVA 4DZ6A 2HRTA 4OFZA 2FJEB 3OTCA 1HHQA 1R8PA 4WU2A 2YKMA 4NLDA 5JJBA 4EZ9A 4LF6F 1D8YA 3QLHA 3DOKB 2J9DE 4KR0B 2NXJA 4D3GA 1RSCA 2DNNA 3U1MA 4JI2F 4E2FB 3FSYA 2IM1A 2MHEA 4RWWA 3HX9A 3GPAA 1N34J 4TU7A 2M2BA 1NK0A 2QLXA 1MMNA 3MM9B 1S4EA 4PAAA 1RABB 4DSEA 1J5EF 3B4MA 4ZP7A 2DHXA 5HBMA 4CH0S 1VDHA 2DO0A 2Q79A 3I4PA 2YQ1A 4RBVA 4ICLB 4UY8T 2YKMB 4F4XA 1IKYB 4OZ3A 3DOKA 3EZ5A 2DBBA 4L73A 4G1PA 2QRRA 3ZZZA 2ZDOA 4F8RA 2XSFA 4R25A 5AXNA 3OL6A 1ZM4A 2KYZA 4WPAA 2CDRB 4AL5A 2RF2B 1PYSB 2ZHAA 1NSPA 1FD2A 3JTNA 1FT8A 2AKWB 3PYEA 3MM9A 4YHHF 3J81j 3M8RA 3BO4A 3MR3A 4L74A 1SV5A 3KK1B 4RNHA 2F3JA 2IVYA 2J9CA 4YB7A 2BANB 1S0OA 2XMVA 3G8QA 2NXEA 2B6AA 4ICLA 2F4FA 1N36F 2VU5A 2HBRB 1RUSA 1QUVA 2PEBA 2AV5A 5DDOC 1RTIA 2RS2A 4GO7X 2A10A 1LWEB 2DNOA 3FCWA 2DRAA 1SQGA 5F0UA 1TL3B 2QTWA 2HWTA 3PM9A 4W98A 3NMAA 4WZQA 1JQGA 1RA6A 3L95X 5KG2A 3KHRA 3IGVA 5F8HA 1R8AA 4PXBA 1ZS6A 1KTVA 4RW8B 2MMYA 5K20B 3J7Z5 2E29A 3OR2B 3B82A 4DCOB 3QZ8A 3CCRS 1J5EJ 1NZAA 2BJ7A 2DXFA 2BANA 2DXEA 2OEMA 4PG6A 4OI1A 2QT7A 2NYHA 1KN6A 2ZC3A 1G7CB 4XPCA 2HGLA 3K5MA 1QSLA 1H72C 3EPIA 1RTIB 1SJ4P 2GZOA 4QIGA 2J8SA 1S9FA 2FJWA 2MB0B 3T9ZA 4JI0F 3IBCB 4K4SA 2HFNA 3EGVA 4WCEQ 2YNIA 4CO2A 3CDEA 4CLWA 2RS8A 3OTOJ 2QIFA 8AT1B 3VAJA 4JI6J 2V8VA 4YMEA 1BMQB 2WB1D 1BWVA 1BLUA 2JDJA 2OO4A 2WRMA 3FEXB 3OR2A 3D1HA 4OV6A 4ZIVA 2DR8A 2XC9A 1S0VA 4DS5A 1FA0A 2ZKTA 5EX0A 1FEEA 3HO1A 3MPUB 5BYSA 1CJTB 3HVWA 3ONQA 4BC7A 2DISA 2R7OA 2CDQA 2HHHF 3MTJA 2RB7A 4WFAQ 1T9UA 4HDGA 5KG1A 1KQKA 4AXIA 1DURA 3BYRA 1RTZA 3I6PA 4JI2J 1UVNA 1N0VC 4P74A 1VYAA 4PXCA 3TWZA 1L3UA 4B3MF 4EFAC 4TLRA 4ZN1A 3ENWA 1DHMA 5GMDA 1KFDA 2P6SA 1XK8A 3IR7B 3MTKA 2ZH1A 2PI5A 2EWHA 1NO8A 2V69A 1X5SA 4NMXA 3KLHB 3ZXWA 5IT4A 2I8EA 4PXDA 1CJTA 2L3MA 1HNZJ 7FDRA 2IRYA 2XYGB 4DCJB 4MKYA 4PXEA 3IM8A 3K8VA 3CJ0A 1ZA1B 4LMZA 1PJ5A 5HLFB 2DR9A 3P49B 2GHPA 4K4WA 2RILA 1M1HA 2DCUB 1RWVB 4RNMA 3BSNA 3IG1B 2WOMA 3WC0A 4ZITA 1VQPS 1FRLA 3KUGA 3WQPA 2MLZA 1PJ7A 6FD1A 3DLKB 1JLCA 1S1VB 3RGIA 2WB4A 1UZHA 1M5OC 1ZYQA 5CYQB 1WC4A 2ZH6A 1RAAB 1JLQA 3GFXA 2HLUA 2PEHA 2ALYB 3CMQA 3KLHA 2OFGX 2Z2ZA 2FJXA 3C16A 3VAKA 3UO0A 4NXNJ 2H4WB 3DGPA 2XNQA 1N8RT 1VBXA 1B7FA 4LSNB 1CJUB 1HHTP 3CF5Q 3AD8C 1SJ1A 1RWOB 3FRZA 5HLFA 1WEYA 3QGIA 3UWTA 1Y00A 5DETA 3Q22A 5I42B 4J7CA 4KSEB 1PG5B 1KEKA 3RB0A 4DV1J 3NMRA 2JEIA 4OX6A 5E3QA 1C1CB 1NAQA 3TX0A 4FS2A 3DLKA 1OQ6A 5CXTA 4NLOA 1YBTA 1VQ8S 1FK9B 2X51A 2DTJA 2XMWA 3W1YC 4DV3F 1JLQB 1FVSA 2HS0A 2KRBA 5E3AA 1B0TA 4TYAA 4ID5B 4IR1A 3TZWA 3C16B 4ELTA 1YJ7A 3DGPB 3DLEB 5IFMA 3QQCD 1U0HA 2FDNA 2PDAA 2FUG9 3A8IA 5F3TA 1VBYA 2GAHC 3V81A 3N01A 4ED6A 5I42A 3DMJB 5IC6B 2HAFA 3AOBA 2DGOA 3BYPA 3M1VA 3M8ZA 3PYFA 3SCKE 4BWJA 2Z58B 3NEKA 2CNKB 2NPFA 2WSFC 1H98A 4CH7A 3E51A 4IQMA 1U45A 3N6LA 4Q2LA 3DOLA 2BE7D 3ENQA 1JWWA 2RRBA 3K2YA 4X64J 2DNYA 3EGNA 1FD8A 2BXJA 3H0PA 3VGUA 3PKYA 4L76A 3DLEA 1ZZFA 1N6QA 1H2TZ 1PJ6A 5CQGA 4XPEA 1GNKA 3Q8SB 1S77D 2K06A 5KFJA 3H4BA 2VG5B 1O0PA 5GVQA 5T7LA 3CB4A 2PMZD 3CUNA 3KNAA 5FJ4A 1WHYA 4JYAJ 4DFPA 4B9LA 3PRBA 4ZCIA 4DQQA 1WF2A 1CC8A 1QUPA 3PJ9A 5HATA 1HWUA 4DR3J 1ULRA 3RBEA 1NKBA 3DRSA 3DOLB 1VJWA 3GFYA 4QZVB 5KG3A 4DR2F 3SXLA 2R42A 5KFFA 3A12A 3G6ES 3BKUA 2BBEA 5J2NA 4HHHA 2DGUA 4ANCA 9RUBA 1HD0A 1T9VA 4J9RA 1HNIA 1KFSA 3M2UA 4AUKA 4Z7CA 1Q81T 1R8CA 4USMA 3I82A 2R8JA 1N6QB 4GMKA 2XULA 4PWUA 3TA0A 4ZP6A 4J9QA 2DB1A 2F8HA 2UXBJ 2VG5A 2LYVA 5T7LB 3BQ0A 4FF2A 3MCSA 3FKBA 4YP3A 1U1MA 2UVVA 3J7AN 4A8SA 1S1WB 2C3YA 2XMJA 4IG0B 3ZNJ1 4K0KF 1OWXA 4IFVB 1X60A 4NYZA 3RB3A 4O3RA 1JLAB 3MZIA 3OXGA 3KNGA 4Q5VA 1URRA 1VHFA 2OFHX 3ZTOA 3BREA 4PG5A 2MKYA 3DOMB 3LH2S 1VQMS 1DBDA 2D69A 1AZSB 1FTCA 2YKOA 4LJMA 4OIXA 2NS1B 4UUWA 3M9OB 4ECZA 3CDBA 4XK8C 4CO4A 3Q89A 3AY0A 4EI2A 5DM7Q 3HPOA 1TP7A 5H1SV 2BR0A 2VODA 2V67A 4EBEA 3CWJA 4WFBQ 2I9SA 3M6UA 2UV8G 3QZ7A 5BR8J 1L3SA 1CVJA 4LF8J 2C1EB 1Q8BA 2AHOB 4OYOA 4ETZA 1S1WA 4LFAF 2GIRA 1LWCA 2QMXA 5C24B 4C0BA 4AQYF 1SL2A 1WHXA 3IR6B 2FYXA 3ZZOA 4OJ1A 4ES2A 1G2EA 3DOMA 2FVSA 3ZTSA 2XY7A 3T5KA 2V9WA 3BO3A 1HQEA 2ZZNA 4KT0C 2AX1A 3N79A 3SI8A 4FPIA 1T9XA 5F0WA 4M95A 5KFSA 4X64F 2ZJPQ 3R7SB 2X3DA 1E6YB 4ZJOA 5C5JA 4TY9A 1FRMA 2YKPA 4R8UB 5K9FA 5C2CA 1FJEB 1GH8A 2DGXA 2J8AA 3PXGa 3E3XA 3M6XA 1YLXA 3BV8A 2CADA 4F4WA 1VBZA 1S49A 4HI2A 1C0TB 2B4VA 4ILRA 1C2PA 3CJ4A 1RT2B 1RTHA 3BQ2A 2UUCF 5CD4A 2DHGA 3TA2A 4ZVPB 2AX0A 2VC1A 4NCGB 1WHVA 4ZVRB 3SQGA 3AQPA 2B0GA 2FQQB 2QYCA 2C3PA 4WTOB 3PO5A 1S4FA 4ZLPA 2XY5A 2ZH8A 5A8KA 2YPZA 5IV4A 2I0XA 1LXJA 1MU2A 4L3NA 4MT1A 4R8UA 1DJ0A 3UCGA 4TQRA 1REVB 2X7IA 3ZTPA 1U4BA 4JOUA 1DLOA 4FN5A 1EARA 1X4HA 4ERDA 2OIHA 1C0TA 1A0OB 3DYAB 1RT2A 1RTHB 2E5GA 4AFFA 1FRIA 1N33J 2HQIA 1VC5A 4NMLA 3U1LA 4C97A 4M8LA 3QFHA 4NCGA 3RZAA 1SUQB 3FCVA 3SQGB 3RRGA 2RHSB 2E7WA 4QR0A 2R7XA 2JH3A 1NMEB 5DDPC 2MHNA 1S72S 1FJCA 1X8DA 4DSLA 4QR1A 1JLEA 2DGVA 2DHSA 2KRRA 1VRUA 1I6JA 3ZZ0A 3HT3A 3HHDA 2FJAB 5HVFA 4RW7B 1NPKA 2B5JA 1FWLA 1DLOB 1MMLA 3HZEA 1RDRA 4CLPA 1SJQA 2AMCB 4E8UA 1HMVA 2VD3A 3M05A 4FVMA 2N82B 2KFYA 3G71S 1Y3JA 1IBCB 2GHWA 1VI7A 4I69A 2GO9A 2MY7A 4PG8A 2WVEA 1SUQA 2KZZA 2ZVSA 5EWGA 4QWDA 2AJ2A 3I5AA 3DNCA 4QIVA 2IAJA 4QIFA 3OV7A 1I94F 3DU5A 3MMAA 3HZGA 3RYLA 4CCHA 4C3LA 4DQSA 3K5PA 2KO1A 2Z56B 1GXLA 3OXLA 4F2SA 3NOGA 1W26A 2MJNA 4PZVA 5A76A 2Y1RI 2YWEA 2B5JB 4KGMA 2BRLA 5BJRA 3QIPA 2Q66A 1P27B 2LQ9A 2MGZA 2LEBA 3MI7X 1YRTA 2HEKA 5AXKA 1GFWB 3EDRB 4ZPVR 2XLKA 5CCLA 2CZ4A 2UUAJ 1BY9A 2CPDA 4DXLA 2B8PA 4XTTA 4A8WA 3R3TA 4JI5F 4KQZA 4LIWA 4RNOA 3U7JA 1JJ4A 3TYTA 4CTAB 2I1RA 2ASLA 4RW6A 3LTOA 2HQCA 3TI0A 3UDVA 2MZJA 3EE3A 1GMVA 1S12A 1WACA 5CHCB 5HVHA 4O4GA 1RISA 3BN7A 3D6MB 1HWIA 1GAOA 2VKRA 1FEHA 2XHCA 3BGOP 4QBUA 4C8KA 4YR3A 4A4JA 3TQ1A 4LFBF 2CJAA 1H74A 1SC1B 4U96A 5MAOA 2E9TA 5CZVA 4F3OA 1QVFR 3OR1A 2VONA 2GJIA 3IFEA 4O0IA 3VHQA 3GG1A 1HYSA 4QU7A 3UN5A 2W9AA 5DZ7A 1HBNA 4KJIA 3R5AA 4OYXA 3OFGA 1NHUA 1PBUA 1VQLS 3FSXA 1Y11A 3AOAA 1RCOB 1XR5A 4CTAA 2VDHA 4DLEA 4KH0B 4DV0J 2QEXS 1SL0A 1RTDB 1AA1B 3LA0A 5ETRA 3KG4A 2NZ4A 1FX2A 3CGIA 3JSYA 3UDCA 2J7WA 4O4GB 2QN6B 4X62J 4PRFA 1BQNB 5KG5A 3CJSA 1HBMA 1MROA 2CPIA 1F0XA 3QAEA 5DO2A 4JI8F 4H4MA 2VQEF 3NS7B 1DQ8A 3OR1B 2M8HA 4DG1B 1CS4A 3DLGB 2EFNA 5K14A 3N5FA 2DGSA 3OTEA 4TN2A 2FHKA 3TUZC 4Y2KA 1GMWD 2B9YA 4JV5F 3PX6A 3THVA 3UQSA 1Q79A 4USTA 4LVNP 1R0AB 1NJWA 4K4TA 3DRXA 4B3SF 2ASJA 2FZGB 2EFVA 5F3ZA 2P9GA 4CQ1A 2IPOB 3OHAA 3EDQB 1RGVA 3FC9A 3NCQA 1GK8A 2MQNA 4WFYA 1J27A 3DRRB 4PQUA 4K8RA 5ITHA 3OJUA 2V4QA 2BKPA 1CPZA 3I31A 4C8NA 4ILLA 4B9SA 2P2CB 4LFBJ 1I51B 1OIAA 5KFQA 1VK3A 4OQJA 4H4MB 2YWHA 4WKYA 1HLWA 4F4YA 4HKQA 2LQ8A 1RI7A 3OXFA 4KBIA 1ZAWA 4Y00A 3GTYX 2FVRA 2CWXA 3GG0A 4OZJA 5K14B 3LP2B 3LWMA 1SQFA 4H4KC 4Z7YA 3D2WA 3KK3A 4ZVFA 4J91A 3PJXA 4CLKA 5HMXA 5D3GA 1NM2A 1SBRA 4IYQA 1ZA2B 2OKQA 4P7VA 2HGNA 2W2MP 3W64A 4EEYA 4LRCA 5SUHA 1XMQF 2MZRA 1UTAA 3UPFA 3AXMA 2RQ4A 3HD1A 3GCXP 1UFWA 1DQAA 3DRRA 4PQUB 2W4DA 4N5SA 2XHWA 3NAIA 3GB0A 3FVYA 2F8EX 3HJVA 4A8MP 2EI5A 2G0IA 1UJ6A 4X4SA 4W90B 5KFTA 1F5AA 4B9VA 3IA0A 4WFZA 4NI2A 3K8WA 2HFSA 2C2DA 4RPFA 3NNAA 4ZKAA 1ZETA 3H2VE 3KK3B 3AOCA 2GGPA 2J9DA 1NPPA 2R7VA 1N52B 1IM6A 3H5XA 1A6LA 4B3SJ 3G82A 1UWBB 3O2IA 4K2XA 1TELA 4PKDB 3HK2A 5GAGI 2YNFB 2WW4A 2FLPA 4ZK7M 2HS4A 1W2IA 1YG0A 2K2PA 2G0CA 2XWYA 3K17A 4UT4A 2YX7A 2CA9A 2FJVA 4JI0J 3ZC4A 1M5KC 4M5DA 2M4MA 2HLTA 2XGPA 5GADU 4NI2B 2MZ1A 1HNXF 1LK5A 3W63A 2C2EA 1BC6A 2AGOA 4DQRA 2VPZB 1HI1A 3J81U 4C7QA 2HVEA 5I4MA 4UOGA 3CD6S 3D0GE 4KHPF 3VF0B 3TZZA 1B0PA 1UVLA 3H25A 1RKJA 5LJ3Y 2V63A 2WBRA 1WORA 1H0HB 2J0QD 4IOBA 4BHQA 1UWBA 2QSFA 2C2MB 5D77A 3US5A 3CTRA 4IKAA 5HQLA 3C2PA 4ES3A 2ZM6F 5B09A 1NB7A 3ZNUA 4OZ5A 1T8EA 3GFZA 3TAMA 1NXIA 3L9ZA 1NK8A 2QLWA 5E7OB 1U48A 3JQJA 4LF9F 2EFPA 1N32J 3HSDA 4PWDA 3SFUA 2BOPA 3R1HA 3DRPA 3R5CA 2CKWA 4JI3J 1HQ2A 5D6GA 3QMQA 3TJ8A 2LEAA 2CVEA 3AJ2A 4F4AA 3K57A 1NK5A 4U7UD 4CLYA 4J9MA 4OI6A 3PX4A 2ASDA 2FHMA 3P5BP 3NS6A 3Q8UA 3I32A 2RUGA 3R2CJ 3BGFA 3TO8A 3DGVA 3PW2A 5IT9U 4DLGA 4CLSA 2C2ZB 2UVUA 4DBQA 4P6QA 2QMUB 2W9CB 1IKYA 1XR7A 4FXDA 3CPWR 1FXDA 2QA4G 4X2BA 4PWDB 2JVOA 2V6AA 3P45B 4LRDA 1UEKA 2G13A 1FFWB 2G1HA 1U8WA 2XYHB 2BKOA 2ZHOA 3BGUA 3D9BA 1KP6A 4DSKA 1V5IB 1DARA 5DZ6A 1NLKL 2UZAA 4BBYA 5JUMA 2YNHB 2RF2A 2OHDA 1TUGB 3OBIA 4DPTA 4ZP9A 5CCMA 3UCUP 4LRBA 5E3PA 5HJYA 1TUWA 3K7RA 2ZH5A 4IQXA 2J5AA 4NEZA 3ZZYA 3T1HJ 2DNQA 4OLOA 3R1LA 1Q5YA 4C6AA 1OPZA 4P71A 4JYAF 1H7WA 4CH1A 1H2VZ 2H3EB 5KFMA 3KYLA 5F8GA 4K4ZA 4GVLA 1LWEA 2XZWA 1CQMA 4KKOA 3HXMA 4C4WA 2EFOA 3VR1A 2N7CA 4ECVA 4KY3A 1PC4A 4TQSA 1RYSA 3QFWA 4HI1A 1OY6A 4ZPAA 4F0MA 4DV6J 3QJLA 1ZTWA 3K5LA 4NLVA 4ED0A 4QCLA 4RW8A 3R7NB 1F1BB 4I6YA 4ZCMA 1NK7A 1EHWA 4Y2AA 4TU9A 3W8PA 3Q8PB 5KOWA 2R8KA 1HL6A 2GA7A 3TRGA 1FXLA 2NLWA 4YY3F 1MW7A 1O5JA 2CXEA 2HG4A 1T9YA 2PE8A 2KVIA 1MSWD 1J2VA 4YB5A 3MAQA 4EZ6A 3PY8A 2VICA 2AZ1A 1JLBB 2DNHA 2YWWA 1FNMA 2P6TA 2GMHA 2YNIB 3MMJA 4DCPB 2E7XA 4TY8B 2IM2A 1UEUA 2P8IA 4K7QA 5HQ8A 4MK7A 1UKUA 4NLYA 1RWXB 3CW2C 3MM7B 1WWHA 2XI3A 1VHIA 1XWLA 2VPYB 3OTDA 3MEKA 1U47A 4LF5F 1Q4RA 2Z8QA 4MYUA 4PUOB 5E0OA 2IA6A 2PC6A 1FDAA 2FVCA 3ZZTA 4JI1F 2MDAA 4BCAA 2CNOB 4JV1A 2HMIA 3CJ8A 1MN9A 3A8JA 1TKDA 2R9LA 2QYGA 4CO0A 1YRXA 2JHEA 3DC2A 1JLBA 1YJVA 3HVTB 2KDOA 4IH5A 2ZZMA 3IBFB 2R7RA 3GV7B 2N4DA 2VZ9A 2JNJA 5T41A 3ETMA 3MM7A 3MDFA 1RJJA 4KGXB 5RUBA 5ETOA 3HHLA 3L7PA 4BC9A 4R5PB 1NJZA 1Q95G 4DPUA 5KT3A 3C3LA 1P9QC 5L38A 2HHQA 4N76A 6FDRA 3HCXA 1NKCA 2UXCF 3LGHA 1DTQB 3MEDB 2HMIB 1XN9A 3WX4A 1RXOB 1KHVA 2DNRA 2FGCA 3GSIA 4M5MA 5HK4A 3IG1A 2WOMB 4C3MA 4I64A 3IO1A 3HVTA 3H98A 5L1JA 3DI6A 3DN9A 3OW2R 1QTMA 1DFDA 1Q7YT 1S1VA 3O8WA 4ZVQB 4DR1J 4JV0A 3MURP 4HL9A 3W9HA 2AZ3A 1RWWB 3BM7A 2HHUA 3HHLB 2N7YA 3DLJA 2LQBA 3MD3A 4DN0A 4RUAA 1KDNA 3A8EA 4K5SA 5KFKA 2UP1A 4CT8A 4PABA 4DX8H 5BR8F 2K7KA 4KIAA 3UR3C 3MAAB 1HWLA 1CJUA 1VRQC 2APOA 2PO4A 3OTBA 4NASA 4C98A 2DVIA 1DTQA 3MEDA
chains in the Genus database with same CATH topology
2LCWA 4X4QA 2F1FA 3SEOA 2Q1LA 4OLPA 3LW5C 3DI6B 4O44B 1ROFA 5U47A 1RK8A 1X4EA 1TL1A 1FK9A 3NGKA 1R3NA 2R4FA 4USHA 3NNCA 2KXFA 4ID5A 3NAHA 5L1LA 2YKNA 5AE2A 1Z2ZA 1XMBA 3CCJS 3BJYA 4J9LA 2CQCA 1MNEA 3V81B 4DJBA 3MGJA 5KT2A 4DV1F 4C8LA 1Q7LB 3M1VB 1QE1A 5LSLA 3CIMA 2IC3B 3S01A 1RT1B 4H4OA 1HPZB 1XMOF 2DD8S 1KONA 2WONB 1AXQA 2QO3A 4DR1F 1G3OA 3GMGA 2RDIA 4YEAA 5KFUA 2YKNB 2DK2A 1C4CA 1N5YA 4QIEA 1W25A 1I94F 1WELA 3F56A 1FO1A 1FCAA 1Z1ZA 3T3FA 2MXYA 2MQPA 2P5VA 3IWLA 1UL3A 2C3UA 2OP5A 5K8PA 4NOHA 3MUMP 1VQKS 5L1KA 2CQIA 2IC3A 5E3CA 5EUHA 4KE5A 3KK2A 3Q23A 1RT1A 4H4OB 4AL7A 5KG6A 3T5HA 1RYRA 2AJ4A 4NA3A 4FBUA 3DRSB 2ROEA 1U1LA 2CFXA 2VFRA 5L9XA 4DS4A 3G6VA 2BE2B 5A0YA 1FKAF 3BQ1A 1Y5NB 1UMJA 2YX1A 1HNIB 1N5YB 3PIOQ 1FKPB 1RT5B 3T9NA 3I0SA 4KHRA 2GV1A 3HVRA 4A48A 3T1HF 2L9DA 4I1TA 2DNLA 2CYYA 1KNZA 1UVMA 1VRTA 4TYBA 5I3UA 2MKSA 2DIVA 4YR2A 1K8AT 3C8YA 4U9RA 5DLGA 3NNHA 1G1XA 3KK2B 1MWZA 5KAKA 3KHLA 3KJVB 4IG0A 4IFVA 2U1AA 3K58A 3E2EA 1JLAA 2DNGA 4O3PA 4DHVA 5EWEA 4XO0A 4RZRA 4I6WA 5A0YB 3G96A 4J5OA 1JJHA 2BDPA 3KLEB 3FRYA 4RX6A 4ECRA 2BM0A 4A8XA 2M5YA 2YWFA 4EBDA 4ZPDA 1WG1A 2HRUA 3QGHA 1TQLA 3I0SB 4K50A 2CQDA 4YQWA 1ZPVA 2UXBF 4ECUA 1X0PA 1VRTB 1D9DA 3V6HA 4NLPA 2OPSB 4NA1A 2OH2A 3RR7A 1SXLA 3BGRA 1S6OA 4Z2XA 2Z0GA 3KJVA 2LA6A 3RRKA 1LWCB 1SH3A 2B7BB 4NLTA 3S7RA 3PR4A 1VQ5S 1R6YA 1Q53A 4AE5A 2M3DA 5EN1A 2BZ2A 1VQ7S 5KFBA 3W2VB 4AYBD 3LP0B 4B9MA 3JSRA 4RUCA 2ZJQQ 1OSDA 3CCWA 3OLAA 1E6YA 5A2QY 5H9FJ 3CD0A 3BR9A 2GQQA 3SYZA 3D0IE 3IS9A 5BYRA 1U1KA 5KT7A 2FIUA 2OPRA 3BGRB 4NZ6A 4QYZJ 2BA9A 4ED7A 3ZZPA 4I0WA 3PACA 5KFGA 3BEGB 4DPOA 1R89A 1KR4A 5KFPA 2SXLA 4JUZA 3PW0A 4RW4A 4HH0A 1X4BA 3LP0A 5AXMA 3LANA 2R8GA 3B78A 4MTPA 5KFOA 2I5JA 1MU2B 1WTFA 4QWAA 3BSOA 4MJKA 1SKWA 3R27A 4Z37A 1REVA 1U09A 1GT8A 2HFOA 2L08A 1CLFA 4I7FB 2JWNA 2RT3A 2W8LA 3DYAA 3I56S 2ALZA