2CPIA

Solution structure of the rna recognition motif of cnot4
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
111
structure length
111
Chain Sequence
GSSGSSGASVRVVQKNLVFVVGLSQRLADPEVLKRPEYFGKFGKIHKVVINNSTSYAGSQGPSASAYVTYIRSEDALRAIQCVNNVVVDGRTLKASLGTTKYCSYSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CCR4-NOT transcription complex subunit 4
publication title Solution structure of the RNA recognition motif of CNOT4
rcsb
source organism Mus musculus
molecule tags Gene regulation
total genus 10
structure length 111
sequence length 111
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cpiA01
3LQVA 2MQLA 5DDRC 1WHWA 3H2UB 2GHPA 3CF5Q 2RQCA 4PR6A 3V4MA 3MURP 3VAFA 2KT5A 2DH7A 2DGWA 5GADU 2FHOB 4M5DB 3NS5A 3EGNA 3MUMP 1ZZNA 4EGLA 3TYTA 2MKKA 2X1BA 5CXTA 2CPFA 2L08A 3IWNC 1WEYA 2YH0A 2M2BA 1VQLS 2MZSA 1VQPS 2DH9A 1RK8A 2L9WA 1KC8T 4ERDA 2DHGA 5IFMA 1FJ7A 3CC4S 3CC7S 2RRAA 3MD1A 3K0JA 4C0OC 2CQCA 2CPXA 5HL7Q 2MZ1A 2YH1A 1D9AA 1PO6A 1UP1A 2RNEA 1A7GE 2CPJA 4PRFA 1DBDA 2CQ4A 1DHMA 2JX2A 1M1KT 2MY8A 2FPHX 2KVIA 3P3DA 3ZZZA 1U6BA 4C4WA 3MD3A 4UY8T 2MSSA 2G0CA 1UAWA 1YITS 3S6EA 1X5PA 2MKIA 5DDOC 2DGTA 3UCUP 5LXRA 2EK6A 1WG5A 2LXUA 1VQMS 1M90T 3CULA 2EK1A 1K9MT 2J0QD 1R8PA 3B4MA 3UCZP 1FT8A 5IM0B 2KM8C 3VF0B 2MZRA 3LPYA 2X1GA 2J0SD 2MSTA 1DRZA 5FJ4A 1D8ZA 1OO0B 2N7CA 2D3OR 2F9JA 4U67Q 1YWXA 2HVZA 1P1TA 2DNOA 3P6YC 2MPUA 1N8RT 2RQ4A 4YB1P 2OTLS 4WIIA 4LJMA 1KD1T 2CQ1A 2U1AA 5ITHA 1HA1A 3PIOQ 3EX7B 2CQDA 1VQ9S 4W92B 3VALA 1U1OA 1CVJA 3VAKA 1KOHA 1WELA 2XNRA 1WI8A 1PGZA 2MB0B 2M4MA 3Q2TC 1VQ7S 2M7SA 2MHNA 2KFYA 2DH8A 1N54B 2PE8A 2OIHA 2HGLA 1IQTA 1U6FA 5JVGQ 2DGQA 2DNPA 2WBRA 3CCLS 1YJ9S 2FC8A 3CD6S 5LSOA 2YTCA 3J7YU 2QA4S 1VC6A 2E5GA 1WF1A 2KRRA 1FNXH 3FEXB 5DDQC 2LA4A 2QEXS 1VC0A 1NU4A 2DNNA 5EN1A 1VC5A 3THTA 2KXHA 3R1HA 1VQ4S 3VAMA 1YTYA 2M70A 2CPYA 1S79A 2J8AA 2KG1A 3UWTA 1HL6A 1F9FA 1M5KC 1KOOA 3U1LA 5H1SV 2OSQA 4CH1A 5GMKa 4WFAQ 4FXWA 2VOPA 4CQ1A 3UD3P 3VAHA 2DNQA 3NS6A 4C7QA 2RUGA 3CCJS 2VOOA 5CYJA 3NMRA 3BO2A 4QU7A 2RVJA 1FHTA 4F26A 1X4HA 1M5OC 3TP2A 2I38A 4TU9A 1FJEB 2RRBA 2M0GB 2MYFA 1SJQA 2KXNB 2UP1A 2KHCA 2SXLA 3CCMS 1OIAA 2MQPA 2F3JA 2MQQA 1VBZA 5LJ5Y 2DGXA 2DGSA 2LMIA 5CA5A 4J5OA 3CCRS 2X1AA 1JJHA 2DIUA 3G71S 2MQMA 1FJCA 2CPEA 2KG0A 1U1NA 3SXLA 1S72S 1VQKS 3CC2S 1QM9A 2XS5A 3VAGA 1WHVA 1H6KX 1H2UX 2MMYA 2MGZA 1X5SA 1VQOS 1K8AT 1UFWA 4CIOA 1ZZFA 5JVHQ 1JJ2R 1FO1A 4YUDA 1X5OA 5D77A 2XNQA 3THPA 1BY9A 2MY7A 2AD9A 1X5TA 1HD1A 2DISA 2N3LA 3U1MA 2M8DB 4PKDB 1N52B 2RU3A 2HGNA 3B4DA 2B0GA 2MJUA 4F25A 5HO4A 2MKSA 2J76E 1W2BR 2QFJA 4QPTA 3R27A 3L3CA 3UCGA 2CPDA 2EVZA 2K3KA 1UW4A 4UQTA 3RW6A 5IM0A 4ED5A 1O0PA 3G6ES 1SXLA 2M9KA 2DO0A 3SMZA 1ZH5A 5DDPC 2E5JA 2MZTA 2CQ0A 2LECA 2KYXA 1WI6A 2MKCA 1XN9A 3CPWR 1WF0A 3FEYB 1VQ8S 4WKRA 5MLCV 1YJWS 3G96A 1K73T 3SDEA 2KRBA 2I2YA 1WG1A 2HZCA 1WEXA 3J7ZT 3S01A 2YKAA 2PEHA 4RU2A 1X4FA 1X4DA 2E5HA 4OZ1A 2G4BA 2DNGA 4P6QA 2ZJRQ 2ADCA 3CCQS 2CPZA 4WCEQ 1U2FA 3S8SA 3RW7A 3I55S 2LEAA 5LJ3Y 2NZ4A 3D2WA 5GAGU 2JVRA 2LCWA 1U1RA 1HD0A 3HHNB 2MZQA 5DM6Q 3NNCA 2A3JA 2D9OA 2RS2A 2N82B 1U1KA 4F02A 2DNLA 2DGVA 1YJNS 2OJ3A 2MXYA 1Q82T 5LSLA 5GAEU 2BOPA 3DXBA 1JJ4A 2XB2D 2DNZA 1VQ5S 1KQSR 2E44A 2KI2A 2DGOA 2GO9A 3BO3A 2YWKA 1OWXA 2O3DA 3CCSS 2CQIA 4WFNQ 2VODA 1WWHA 2MKJA 3G8TA 2CQ3A 4QU6A 2M52A 5LXYA 3HI9A 1X4AA 3P5TL 1VBYA 2JVOA 1WTBA 1NO8A 1X4GA 3CMAS 3H2VE 2MZJA 2KXFA 1M5VC 1OPIA 2NLWA 3DLLQ 3CCUS 2V94A 2KM8B 1U1MA 2FY1A 2U2FA 2LXIA 3G4SS 1Q81T 2VONA 4WFBQ 2XS2A 1WF2A 2DGUA 2AYEA 2DNRA 5BJRA 1Q7YT 2ZJPQ 4IOCQ 4BS2A 5DETA 1WHXA 4ZKAA 3R1LA 1SJRA 3ULHA 1N88A 4TLQA 2KU7A 3Q2SC 3P49B 1U1LA 2DNMA 2KH9A 3CMES 3BEGB 2KN4A 5GVQA 1U1QA 3US5A 2DK2A 2XSFA 1SJ3P 2RT3A 2MGZB 2LYVA 2ZJQQ 3OW2R 5DM7Q 2ERRA 1DZ5A 3VAJA 1H2TZ 3UD4P 1VBXA 4A8XA 3PIPQ 4LMZA 4YOEA 5IQQA 3CTRA 2JWNA 1YI2S 4W90B 2L41A 3TO8A 1WHYA 1Q86T 4IO9Q 2MJNA 3MI7X 1X4BA 2MKHA 4LIRA 2M88A 4WF9Q 1SJFA 4QQBA 4Y0FA 2K8GA 2DHAA 4IUFA 1YIJS 4OZ0A 2DHSA 3NNHA 2XS7A 3BS9A 1R8HA 2CPIA 2JRSA 3S7RA 4Y00A 4TU7A 3N9UC 1SJ4P 3MXHP 4TU8A 4V19X 1WG4A 2HYIB 2X1FA 2MQNA 2CQGA 3MOJB 2N3OA 2CJKA 1L3KA 2AYGA 1JMTA 2RS8A 2Q79A 3MUVP 3CCVS 2E5IA 2CQBA 3VAIA 3SDEB 1B7FA 2BZ2A 2DITA 1H2VZ 4FXVA 2LKZA 1X4EA 2DB1A 2ADBA 2DIVA 2CQ2A 1WEZA 2M8HA 1YHQS 1QVGR 1X0FA 2DO4A 3ZZYA 2AYMA 3BO4A 2LEBA 1QVFR 4Z2XA 2OSRA 3CCES 2HGMA 3NNAA 1VQNS 1AUDA 2CPHA 2DHXA 3IRWP 1NJIT 1URNA 2DNKA 2OTJS 3MUTP 2D9PA 1RKJA 3MDFA 1U1PA 2LA6A 4CH0S 3CUNA 2DNHA 3G8SA 2G1DA 2LQ5A 1X4CA 2CQHA 2FC9A 1M5PC 1FXLA 1VQ6S 3UE2A 3EGZA 2AYBA 3I56S 5D78A 1P27B 2F9DA 1G2EA 4IOAQ 3CXCR 2CQPA 2DNYA 3G9CA 1A9NB 5GAHU 3JB9k 2MQOA
chains in the Genus database with same CATH superfamily
3BSAA 3A12A 1YBAA 4ECXA 3MEGA 3J80U 1OQ6A 1QTMA 1L3TA 5L9XA 3G87A 4OMFG 2CJYB 3LANA 1WEYA 1SH2A 2Z2ZA 4NLSA 3CC7S 3RAQA 1A7GE 5HMYA 3RJMB 1P9QC 2JX2A 1KVJA 4JI5J 2FPHX 2ZD1B 2GC8A 1FD2A 3PX4A 4QWBA 3ZZ0A 3NCQA 2HNYA 4IRCA 3GG0A 2LXUA 3M6WA 4LRBA 3PFEA 3N28A 1S77D 1TV6B 1YWXA 1QJHA 1R0AA 4LT6A 1Z2LA 3NCRA 1I3OB 4KFBB 2CJQA 4K4VA 1DQAA 1Q1KA 2K7JA 1K0VA 2MB0B 4KE5A 5K14B 2WBMA 1AA1B 2PGCA 2EFNA 3DRPB 3QJLA 2DNPA 2L3MA 3LGMA 1RYSA 1RUSA 1S4FA 4ZLNA 1JKHA 2PIIA 3PYEA 4JP8A 3PX0A 2Q3PA 1NU4A 4MJKA 2WVDA 5EUHA 1N6QB 3OXLA 3THTA 4PPZA 1ZAXA 1YZ7A 1ZA1B 2B56A 2XTJP 3BJYA 3R7BB 4XAKA 1RAGB 4WFAQ 2PN6A 4RR5A 1HBUB 3MCNA 3NS6A 2VOOA 1B7YB 4HEA9 3PHTA 4M5MA 1FJEB 1HQ2A 4R5PA 1JLCB 1TVRB 2RDJA 4MKYA 3DI6A 4HTJA 2MQMA 2XGPA 2KYZA 1VQKS 4RNNA 4FBUA 2NXUA 4MKAA 1UFWA 5JVHQ 4OX7A 2AJ2A 4Q7AA 2DISA 2M8DB 4G1QB 1GMWA 4FDFA 1F1BB 2HWIA 4J90A 4WTYA 1W2BR 3DYAA 4AXJA 5HP1B 3R27A 1R31A 4DFPA 3V6DB 4IH5A 4QR0A 1QDUB 5DQGA 3QSYB 1C0UB 2KYXA 4JI4J 2ZH6A 3PJ9A 1FE4A 4WXWA 4WK1A 2RJZA 4ECQA 4HI2A 3MMAB 1YBUA 2KT2A 1C1BB 4E98A 1IKWA 2XMKA 4CTAA 5J2NB 3VWSA 3N5FA 1U1RA 3GSDA 3IRXB 3CJ3A 5D4LA 4JI4F 5THWA 1K1QA 3MWBA 2ZH4A 2XB2D 2IY5B 5AXKA 4IG3B 5C42A 5KFEA 3ETMA 2BJ1A 2GIQA 1HNXJ 3HHDA 4ZVOB 4CCHA 2Y1IA 2FQQB 3HI9A 2WVBA 2ZOFA 3CD5A 2E7VA 1REVA 3MR5A 2NLWA 3ELHA 2Q43A 2W8LA 2ZZTA 2W24A 5H9EJ 2WSEC 1DURA 3R1LA 4DFJA 1B70B 2H51B 2IYIA 1NAQA 1NPPA 1VJWA 5GAEI 3US5A 2BQRA 5J2PB 4KH0B 2B5JB 1WSRA 2O5DA 5K8MA 3GJSB 4JBCA 2C22A 1KLMA 1Q86T 1JJCB 1UA1A 1LWCA 5A6PA 3MR3A 2MKHA 2UXBJ 3K8VA 4FF4A 3TEGA 3S7RA 3HMJG 4KO0B 4QIEA 5F0UA 1L3KA 2WSCC 2ZH7A 2Q79A 4RW4A 2VF3A 2NXCA 2ZH9A 2H9ZA 5D6GA 1HBMB 3WC0A 1JLBA 3QO9B 2YNIA 4NCBA 2UXBF 3ZZYA 3H4BA 1LW2B 4Z2XA 2F8EX 4AUKA 2ZUAA 2J5AA 1URNA 2VZ9A 1F5BA 3I5BA 3MMBB 5LMUJ 1IR2A 3M8YA 1VIOA 3MDFA 4CH0S 2EKYA 4MH8A 4FF1A 4HHJA 5FLXU 3MFIA 3HXMA 4ZS6A 3QZ7A 5L38A 1FXLA 3FQKA 3PO5A 1N0VC 2MLZA 1L3UA 1K0TA 2MQOA 1QUVA 2UVUA 5DDRC 3BQ0A 2DJWA 5LMUF 2ASJA 1LOUA 2I5JB 5E3AA 5GADU 4Y34A 2FHOB 2C2EA 2Y1JA 1OMSA 1TL1A 4DV2J 4EGLA 5E3CA 1R7IA 4QZVB 4K4WA 2VQFJ 2YH0A 2MZSA 4BWJA 2UUCJ 4AL5A 5CCMA 2CPXA 2RNEA 1MMNA 1PYOB 2H5IB 2CZ4A 4USVA 4HI1A 4DV2F 3ZZZA 3D1OA 4PYAA 1SL0A 4UY8T 4FXDA 3W61A 4UOHA 2NSBA 2DGTA 2G2ZA 1WACA 1WG5A 1VQMS 2ZHBA 3LF0A 1EAYC 3ZNJ1 2UUCF 3Q86A 2J9DE 2CG8A 4JI1J 2HHTA 3D67A 1WC1A 4K50A 4HTIA 4LJMA 2VA2A 4J9RA 2W2NP 5CQGA 4NI2B 4F2RA 3KK3B 1AB8A 4EO8A 1UVNA 4KHMA 2ZM6J 5KOWA 4F4AA 4JI1F 2HEKA 4XPEA 1IQTA 1IJFB 1MLAA 1U6FA 4NRTA 5G4DA 3FQLA 5EWFA 1RA7A 2B6AB 1KHVA 4DSLA 1VRTB 4DUTA 2E5GA 3NAHA 4DR6J 1FNXH 4O4GA 3FCHA 4ZN1A 4PWUA 2ZM6F 3KJVB 4MK7A 3ITHB 3LH2S 3BREA 3QT6A 1NNDA 4ZP7A 3HJVA 2JEGA 5F8GA 4ED6A 1JLFB 4CQ1A 4DR6F 3DNCA 1KQFB 2UU9F 4B9VA 1WDDA 3RBEA 3C15B 2GJIA 1MSWD 1T9TA 2KHCA 4CLKA 1FX4A 1VBZA 2FYXA 4QOTA 4FYDA 3M8WA 1VLOA 2UUAJ 4UTGA 4I0WA 4X4PA 2GJ2A 4QJVA 1VRUA 1M5SA 1WKLA 1RA6A 1RCOB 4HKQA 1NJYA 3D0GE 5GMDA 2ABYA 4CH7A 2BA9A 1HR0J 2ZD1A 1BY9A 2NYIA 1YRUA 4R8UB 2N3LA 1BMQB 3AOAA 5CD4A 2UUAF 3ENVA 2MJUA 3C3LA 2QFJA 3PVXA 2K3KA 2HFVA 3QRPA 3MM9B 3RRKA 1LWXA 4ILRA 3TJ8A 3NOCA 1TV6A 2CQ0A 1YJUA 1HR0F 2VFUA 3EVOA 1O5JA 2R8IA 1GXLA 1TUGB 3NKYA 1FJGJ 1U4BA 2I2YA 2XC9A 2DT9A 4KFBA 4DR5J 4DN0A 3FJ2A 3S01A 2PD1A 2WW4A 4HT7A 5K14A 3RW7A 5HQMA 2NZ4A 3GONA 3DRPA 2KZZA 1U48A 2V34A 4PWWA 4F4WA 2N82B 5LSLA 1FJGF 4DR5F 2HFSA 4WP8A 2V2VA 1OWXA 5C2GA 4DPTA 3C6UB 3DLHA 3QRRA 2CQ3A 3JTOA 3LOUA 2BE7D 2XYHB 1X4AA 4CLPA 4X4OA 1FEHA 4RL1A 1UWBA 2FVSA 1U1MA 1R27B 3T19A 4F4XA 4NLGA 3CGIA 1EP4B 2BKOA 1HBUA 1Q8LA 4DV1F 1RWUA 4ECWA 5BYRA 3ULHA 5T14A 3P49B 1U1LA 1A0OB 3R2CJ 3FK4A 3W8PA 1TVRA 2MGZB 3UD4P 3PIPQ 2CNNB 2GGPB 3WX8A 4W4MA 1WKKA 3I31A 3U1NA 3QJJA 1HWUA 1H7XA 3UDCA 4F0HA 3QGPA 2FVRA 1CJKB 4ZVTB 4G1QA 2Y1LB 3EZOA 2IC3B 3GJTB 5HP1A 2ZNYA 3V6DA 2YBVA 1DFDA 2GCFA 2DITA 2IM0A 1YGYA 2KJWA 1WEZA 1QVGR 1X0FA 1C0UA 2FVPA 3CCES 2POKA 2D9PA 2B8PA 4C98A 3MMAA 4KYZA 5DO2A 2NZCA 3HT0A 5J2NA 1KQGB 1ZBTA 3MCSA 2DNYA 3NG8A 3IRXA 1EQ0A 1GTEA 3M30A 1XNQJ 4X64J 1EHWA 3EGNA 4X4NA 1ZZNA 5KT4A 2V4JB 1CPZA 2CADA 1S6UA 3E8OA 2EBGA 2L9WA 2DHGA 1FEEA 4MAKA 1WD6A 4X64F 4PRFA 4NL5A 1DHMA 3ENAA 1KQKA 4ECTA 2CNKB 1GTHA 5T7LA 1KWMA 2VBYA 1RU2A 2AJFE 4PYDA 3UCUP 4LSNB 5I3QA 1M90T 2PMHA 2EK1A 4DR1J 2R8GA 2ZC4A 2BQUA 1B64A 3CJ2A 2XG8A 2QA1A 4WZQA 1SC1B 1N8RT 4OYOA 1ZA2B 2QC3A 1XR7A 3GILA 4DCJB 3VALA 3VAKA 4QW9A 3O5TB 4DR1F 3JAMY 2OELA 2M4MA 1HI8A 1LV5A 4QW8A 3M2UB 4ZP9A 1FKOA 4RLEA 2RH3A 4ES3A 1LW2A 4IRDA 1XR5A 3KLVA 3MMBA 1Y5IB 3BZQA 3QSIA 8RUCA 4ZK7M 3T5KA 3E3XA 2KXHA 4DX5A 1PCAA 4I6YA 3CE8A 2HW3A 1D09B 4L76A 3TJ9A 1EKSA 2V4QA 4CT8A 4CH1A 4LSLB 1JLEB 3VAHA 2LLZA 2I5JA 3GWCA 5KG5A 3BO2A 1YJ7A 3DRRB 3TX8A 3PNIA 1CEZA 3HLUA 1S9GA 2DGXA 1FDAA 1S97A 2OPSB 3GZ7A 4A8WA 3A13A 2ZZNA 1RHJB 5IV3A 4NLDA 3KTQA 3KOAA 4YUDA 2ZOMA 2HHQA 1H72C 1M1GA 4OZ5A 5D77A 3VGUA 3DC2A 4EK2A 1QSYA 4NLOA 3DOLA 2BUNA 1HPZB 4UQTA 3AQPA 2FJVA 3O1LA 3KK1A 3IG1B 1P9YA 4DBQA 1NHUA 2A0FB 1RB0A 4QR2A 1AZSA 2CDRB 3SDEA 4NI2A 1Q5YA 5CHCB 3KK3A 3WHIA 3Q8PB 1SB6A 2G4BA 2VFTA 1UEKA 3IA0A 1HD0A 4ELVA 3O2IA 4HH0A 4F02A 4USHA 4DV5J 3CO9A 4JYAF 2B6AA 1D8YA 4RNOA 2FZCB 2GO9A 3FMBA 3KJVA 5C25B 4Y2AA 2XZWA 2HBQB 3IC1A 2Q6BA 2IJNA 4CWBA 2FLPA 4ZLJA 1S10A 4DV5F 4ZPDA 2MZJA 3EM1A 2KXFA 3NL0A 1JLFA 2MQ8A 3ICLA 3KG1A 3TQ1A 2LXIA 2IBOA 2Z57B 4MMOA 2DR8A 4AE5A 1CC7A 1PBUA 4MFBB 3GV5B 4Q44A 4NLXA 3C15A 1VGYA 1Q8IA 3HHKA 3M4XA 1RSCA 2AKWB 5KFHA 3PYDA 3VGTA 3ZZRA 2FY8A 4GKJJ 2Y0BB 2YVSA 3BH6B 1GMVA 2AWZA 1LQ9A 1L3VA 4JOUA 4DXLA 2K8GA 1WOSA 1U26A 2XS7A 1R8HA 1ELOA 2R8JA 2P6SA 1HHQA 4R8UA 3HFZB 1FXRA 2C42A 3GQCA 3GIRA 4GKJF 3OTEA 3MM9A 3HO1A 2ZVSA 1JB0C 1SUQB 2EFQA 1YG0A 3QIDA 3MEDB 5J2QB 2IVMA 2VQEJ 2WZ1A 1SQEA 3OBIA 3HD1A 2DXEA 4A47A 4PQUB 7AT1B 4QPXA 1EETB 3H5XA 4ZVSB 3R9LA 4LF4J 3LW5C 4PR6A 2VQEF 3VAFA 1E6VB 2NSCA 1EB0A 1WC3A 2L9NA 3D0IE 2IM1A 1N33J 5A0YB 3ADAC 4JI8J 5BYQA 2MKKA 3TW0A 1CULB 5DQIA 4LF4F 4DPXA 3NGSA 2Q1LA 4V19J 1QD1A 3H42A 3NGKA 1DTQB 1TU0B 2BJEA 1EP4A 3ILJA 3CVKA 3J81Y 2BX6A 4JI8F 4A8KA 2KVIA 4KHPJ 2KTQA 4DLGA 2EPIA 4ZVPB 4B3OA 4KKOB 3UCZP 5EWEA 2KVQE 5F9LA 2J0SD 3M9OB 2AGPA 1DAXA 1DRZA 1YJTA 2N7CA 4FVMA 2GGPA 3F56A 5F8LA 3CJTA 1D3WA 1P1TA 4KHPF 3D6HB 1NK4A 3P4UB 1SH3A 2ZH1A 1CJKA 1Z2ZA 3OL7A 1VK3A 4UT4A 3PRDA 1TKDA 1VQ7S 1O8BA 2VC1A 1WKJA 3RZAA 2K1RA 1HHTP 4XIUA 2DEJA 1S9EA 2W9BA 4IOBA 4X66J 2QMXA 2FJDB 5EN1A 3JSRA 4ZCMA 2VPYB 4X4TA 3C66A 1SJ1A 1KOOA 1N4LA 5H1SV 3IO1A 2IAJB 2RILA 4FXWA 3UD5A 4KIAA 4X66F 4NX9A 4O3SA 4O3QA 4C3MA 4D3GA 4NZ7A 1U47A 1Q4RA 1YZ6A 1BQNB 1XERA 4MIBA 3IBFB 4RW9A 1UVKA 4P7TA 1HMVA 1GXTA 1UFLA 4P2XA 2HHXA 2KXNB 4GVLA 2V4JA 2C2ZB 1Y10A 4UW2A 4ID5B 5M2PA 2DR9A 2HFZA 3CCRS 3SSRA 3SV3A 1F2HA 2V5HG 4MIAA 3NGUA 1FO1A 4USKA 5CYQA 2YX4A 3ZZOA 2ZWOA 2GMHA 4GMKA 2HGNA 4X4QA 5HO4A 2MKSA 4DDFA 3K5PA 3H5UA 3PYFA 2CRLA 4M5IA 1O0PA 3GR1A 7FD1A 4W98A 4R25A 1QAYA 2MHEA 4CLUA 5DDPC 3FBCA 4I4BA 1XN9A 4KB7A 5CYMA 2OD4A 1UCNA 4IQXA 3HCXA 1XC9A 4P52A 1Q95G 3BKFA 2BE2B 3AB2B 4UY85 5D15A 3K5MA 2DVIA 3W66A 3OJSA 3M2UA 5ETVA 2MZQA 1RDRA 2LVWA 1XMQJ 4C48A 3AJ1A 4P2MA 3PRVA 2W2PP 2QYGA 1S7HA 9RUBA 2DGOA 1WWHA 2HVEA 1D0EA 1S1VA 5E7OB 2KDOA 1PJ7A 5F3ZA 4EYIB 2VDIA 4Q8FA 1WTBA 2Y8YA 3H2VE 1WUUA 1XMQF 4UZCA 3HX9A 5LT5A 3HT3A 3P45B 4IOCQ 4M94A 4FF2A 2A2DA 1I51B 2JEJA 4ZVQB 4Z37A 1YKWA 3KNGA 3ETOA 3CIMA 3M8QA 5I42B 1JLAB 3GR0A 4K4UA 2QMUB 3KHRA 4W90B 1RAHB 3IM8A 2MJNA 1DTTB 3MI7X 2QFIA 1N0UA 4U8YA 4TYAA 4Y0FA 1RHQB 3OHAA 5D4PA 2HBRB 1FRHA 3GPAA 4OJGA 1F0XA 4UQGA 3MOJB 3TAPA 2AYGA 4ZN3A 1HNWJ 1HPZA 3SCLE 1TZ0A 4EZ6A 1X9WA 2QLJB 2XMVA 1IWAA 4DR7J 1IM4A 5BYSA 4TY9A 4OYXA 2LEBA 1VS3A 2J9DA 3A8EA 3R6LB 1TR0A 3GTYX 1CQNA 5AE2A 1WC0A 4UUWA 1HNWF 4ZHRB 1T03B 1M5PC 3D5MA 4X4SA 2BQ3A 4DR7F 3C14B 4J91A 3F0NA 5D0HA 4KSEB 5GAHU 1CLFA 2ZH8A 3LALA 1NSQA 4QIVA 2RQCA 2XWYA 3MURP 1QY7A 1NMEB 2F63A 2W4CA 5ETOA 2GO8A 3TAMA 2V69A 5C25A 2JNJA 2R7UA 4K5SA 5EDWA 2PA3A 3EMTA 1ZM2A 5DLFA 1KC8T 4LF2A 3EZUA 5IFMA 3TA1A 5DZ7A 3MD1A 2MZ1A 1PO6A 3CIZA 3BQ2A 2CQ4A 3W3SA 2G1HA 1BQXA 3JXOA 3FCWA 4MFBA 1HWKA 5SZTA 1TAUA 1UAWA 2V8PA 2MKIA 1JXVA 4HDGA 5CCLA 3CCWA 4WP9A 3CULA 5GADI 4OYPA 1LWEB 4ES1A 2DRAA 4NRUA 2FB0A 4RZRA 3KJQB 2ZVIA 3IM9A 2F9JA 4NLUA 4U67Q 4ZVRB 2VIHA 4DZ6A 3NGDA 2Z0GA 1L3SA 3NBPB 4NA3A 2CG4A 3JAMU 5ETSA 2YKNB 4ALZA 4C0BA 2XNRA 2ZDPA 4NLVA 1PGZA 1W25A 4KJIA 4ES2A 5A8RB 2DH8A 2CWXA 1VK8A 2DGQA 1SUQA 4Y2KA 1GEHA 2NYHA 5LL6d 3IGNA 2R2UA 4B3RJ 2BE9B 2OH2A 3FEXB 2LA4A 4OYMA 1VC5A 2C2MB 3POTA 4WXOA 3H8YA 2GMLA 4PQUA 4Y2MA 3UWTA 3IS9B 4QWCA 4FKYA 4FYXB 4B3RF 4YMEA 2VOPA 2R4FA 2AP6A 4B08A 4PUOB 1JLGB 1Q7LB 1KTQA 5BXIA 1T9WA 4YHHF 4TY8B 3GB0A 4NCGA 2HVDA 4FP9A 4DL4A 1H98A 1LWFB 4ZMMA 4ELUA 2YWHA 3ZTRA 5CA5A 3C8YA 4DUYJ 4NXMJ 2NPIA 3SXLA 4QWEA 4N47A 1DTQA 1QM9A 1U2RA 4R0EA 3MEEB 4ED0A 5K5MA 1R43A 3E2EA 3HVRA 2HS3A 1ZPVA 2VG6B 2OI2A 5MAOA 4DUYF 4NXMF 2R7VA 5J1EB 4RBVA 3LGHA 4KKOA 5DGBA 3PV8A 3TVYA 1SXLA 3DN9A 1U2CA 4O3OA 4RUAA 3X3UA 3FFIA 3OR2A 1ZTTA 1MMLA 2XI2A 1UVMA 5KFMA 1TMMA 3KMQA 1QTNB 2DNGA 4LBHA 3B54A 4L72B 4N76A 2BJ8A 3RAXA 3BB5A 2RQKA 2QLXA 3FSIA 2Z2MA 4ZIVA 4OX9J 2J0WA 2AGOA 2NUUG 3W5YA 2R2SA 5J2MB 2CQIA 5JMNA 2CJAA 5DLGA 2KHDA 3LUYA 4NPOA 1BWVA 3HHEA 5KT5A 1OPIA 3H59A 4OX9F 4PABA 2VONA 2FJAB 1Q7YT 2GAGC 3DRYA 5IV4A 2VC0A 1FI4A 3BYRA 3R8YA 4NEYA 1ZTWA 4N7TA 2Q66A 1B99A 3C46A 3JSMB 4F4YA 2JH3A 5KFRA 3OW2R 2IM2A 4ID5A 2QGFB 1YBTA 4LMZA 1HBNB 2GVDA 2W9CB 4P72A 3H5YA 1HYSB 2IJFA 4HVZA 2D74B 1RT3B 4NLWA 2UXDJ 4J9OA 2D3O1 1YIJS 3V4IB 3R7SB 3BS9A 3LO3A 3GP9A 3N9UC 4K2JA 5IT4A 2WW8A 2EFOA 3QRQA 2D3UA 2ATCB 4YY3F 2UV8G 2HQFA 2YWFA 2UXDF 4IQMA 4PG5A 3PJXA 2RSQA 1J5EJ 3NNAA 3DGPA 4N77A 3CJ4A 4IYQA 2R7RA 2OGUA 1RWPB 2E7XA 3G8SA 1IKVB 1IM6A 2VA3A 3VVTA 2BE2A 1WC4A 2AYBA 2DR7A 3K5NA 1G2EA 2CQPA 2ZBQA 3T1YF 3TUPA 1J5EF 1R8CA 2GQQA 3LQVA 4E2FB 5E41A 1N5YB 5KFGA 1RT1B 4M5DB 2YWEA 3GCWP 2BVZA 3ZTPA 2DCUB 3PDNA 3FEZA 3IWNC 2M2BA 5HANA 4NMLA 5B08A 4BCAA 1TKTB 4J7CA 5HL7Q 3J81U 2BACA 1DBDA 2YWGA 3HHLB 3Q8SB 1IXKA 4RX6A 3KLEB 1KKHA 4C4WA 2DCLA 5AJ3J 2MSSA 4TYBA 3O6QA 3L7OA 4DSEA 2HIQA 1SIWB 1RU1A 2HQ3A 2VJVA 2HNDB 2AU0A 1SH0A 4RU9A 2OP5A 2HVZA 3RRGA 1DTTA 2DNOA 2I9SA 5ETQA 2FGOA 2BRKA 2OTLS 5AJ3F 1SKUB 1VMBA 5KT6A 1S0OA 4B3MJ 2A10A 4I69A 1VQ9S 4W92B 4LF7F 2UZAA 2DPJA 4OLOA 3CD7A 4P71A 5KFTA 3HSZA 2BMBA 3ZZPA 3HSDA 4OHZA 2WBRA 1IKYB 1PILA 1SPBP 1CJVB 3PFOA 2VPWB 3U7JA 4B3MF 1RI7A 1VC6A 4G3IA 1F9HA 2QIFA 5KFNA 2ROEA 2XBPA 4ETZA 5JJBA 4ZHRA 1T03A 1U09A 2XY7A 1YQHA 3M32B 3BGLA 2DTJA 1S79A 4YB7A 3C14A 3M7VA 4DSFA 4ZVFA 3LP2B 3W5ZA 2XULA 3HFVA 3R5DA 3DRXA 4K4YA 4GO5X 1SBRA 3OR1B 1M5OC 3UR0A 4TU9A 1SL1A 2D1CA 3EZ5A 2LMIA 2DRDA 1KN6A 4HDHA 4U7CA 1R6YA 5DZ6A 2W01A 1RT6B 2W4PA 5U47A 1EKRA 1UVJA 1J2VA 1VHFA 2RD5C 1RACB 3I9ZA 3R5AA 2W8KA 1FFSB 1FFGB 2VB6A 5A8WB 4L3KA 3B6BA 3PM9A 2FDNA 1G6BA 1UZHA 1LWEA 2Z8QA 4GKKJ 2H5EA 4JI3J 1FKAF 3HZEA 3FMWA 1JX4A 3RG6A 4KHRA 1OJ4A 1WF0A 2AJ4A 4AFFA 1YJWS 5EWGA 5KFQA 2VICA 4DSJA 3NBPA 1E6YB 4YN3B 3K5OA 2GIRA 2YKNA 3ZTOA 1X4FA 4DQQA 2HQCA 5L1IA 3IBCB 4GKKF 2UV8A 2XMUA 4JI3F 1U2FA 3BBCA 2OEMA 4FYYB 5A8RA 3D2WA 3GMGA 3NNCA 2OJ3A 1YX2A 2KI2A 1R8AA 2Y8WA 3GIIA 1D1UA 3QLHA 2Y0SD 4BC7A 3ILOA 3OSPA 2XY6A 4E8UA 3BKUA 3H7HB 4F3QA 1NO8A 4PXCA 5ETNA 4DMZA 4KY3A 2EBEA 3HHLD 4PUOA 3HJFA 1JLGA 2FVCA 4NWBA 4ED8A 2RU9A 1RTDB 3R5CA 4H4KA 2KU7A 4TY8A 2KH9A 3BEGB 1U1QA 2HRTA 3OXGA 4LR9A 2AIRB 1LWFA 1T11A 3T6JA 3HPOA 2J7WA 1VHIA 4ENOA 4LUBA 3MCOA 5F8MA 1NK6A 2LEPA 4UF4A 4ZPVR 4IFYA 1X4BA 4LIRA 3MEEA 3GU0A 1IKXB 2D3ZA 4QQBA 2AEFA 3OTBA 2CYYA 2JRSA 4LVOP 2Z2YB 4TU8A 2VG6A 1MROB 2QL5B 2V8VA 1NH7A 3Q8RB 5KFWA 3CCVS 3DU6A 2BZ2A 2IRYA 1GFWB 2V67A 2RHQB 1JIHA 1QVFR 1S0VA 1Y11A 3BR8A 3MM8A 4MIWA 5GMEA 3NXZA 2CPHA 3G86A 1ICEB 1HWJA 2FLLA 2WOMA 2DNHA 4C3LA 4QWDA 4DR3J 2RDDA 2F8MA 4LF5J 2CQHA 2W4DA 4ZVGA 2B9YA 2NQPA 1RT7B 3R5GA 5D8HB 1RTIB 4CO1A 2CA9A 2DXDA 2V0NA 4DR3F 4WYWA 2XLKA 4LF5F 3K5LA 5J2MA 4O44A 4DV7F 3TYTA 3FDSA 2ACYA 3OL8A 3T9ZA 4Q45A 3HF5A 3DDIA 5L46A 2GQCA 3QT8A 3WIVA 2HWHA 3SBMA 1PC5A 1D9AA 4ZOSA 4RW6B 1UP1A 3MTKA 3I4PA 4UUXA 2VD3A 3VTIA 3MD3A 4I56A 1S76D 1RTJB 3JSMA 1AFIA 3BKTA 3OVSA 1ZYQA 4JUZA 2CFXA 2IHR1 1LWCB 3H4DA 1UA0A 4I6AA 2IBKA 1NKBA 2MZRA 4M5LA 2H3EB 1XNRJ 5DS7A 1HYSA 3QPIA 1S6PB 4UOCA 3VHQA 2GVZB 1KD1T 3DDNA 3V4IA 3KLIB 4DL6A 3PIOQ 1HI0P 4YEAA 3JQJA 1TELA 1JLBB 2YNIB 1FF2A 1HBOB 1AXQA 2IRXA 4IRKA 1XNRF 3OFEA 3RAMA 3M8RA 2QA4G 1LNQA 2FC8A 4U6PA 1EJ7L 1CJTB 3PEHA 1NBEB 1H3DA 3DFEA 3BGUA 3WDOA 1WF1A 3FUYA 3CDWA 4KT0C 4A8OA 4N56A 1VC0A 1R89A 1RHKB 3PCOB 3D0HE 3PZPA 1IKVA 1TKZB 5ETPA 5DG7A 4M95A 2YXLA 3IMQJ 1U0SA 3I0SA 4B17A 3HP6A 2W2QP 2HVHA 2EG1A 2HS0A 3WC2A 2P5VA 5KFYA 2DNQA 4OI1A 3J7Z5 1WNEA 5E33A 1NJWA 1TK5A 4M5DA 4C8MA 2V68A 1KTVA 2XHCA 1K1SA 2LQBA 3NGRA 3G71S 1X31C 1FJCA 4MYTA 1PKUA 2JEIA 3HHLA 1X5SA 1UW9A 3UN3A 1U25A 2IIHA 4XK8C 3KLEA 3MGJA 3QMQA 2ROPA 1FWKA 2YNHB 5KG4A 3CDAA 4PKDB 3B4DA 4B02A 3KJNB 1W7WA 4GC6A 3EPGA 1FTCA 3N0VA 3JTPA 2XI3A 5HVFA 1X0PA 2HNDA 3TAQA 5K8NA 3DLJA 3ZO7A 3DU5A 1N48A 4RNFA 3FEYB 4WKRA 1FRXA 4LRAA 4DCPB 2P9EA 4DQPA 1NSPA 1HQEA 4A46A 3IWXA 3T1HJ 4WCEQ 4QYZK 3V6JA 3OUYB 1J5OB 2AT1B 5DM6Q 3EDRB 1LW0A 3M8PA 1FESA 1RHRB 4U8VA 1XTZA 2E44A 3ZZTA 3T1HF 3GFYA 3RR7A 1EQMA 4YFUA 1RWNB 5LXYA 2BANA 2I0XA 1UTAA 3B8HA 2IMOA 3M32A 2C28A 2FHJA 4ANDA 5D0RA 1V5VA 1VCTA 2CUYA 2P6TA 3LP2A 5L1LA 4L6V3 3D68A 2M5YA 5BJRA 1CG2A 2YKQA 3D6MB 1RWOB 4JI0J 3OR1A 4DSKA 2QN6B 1VRUB 3UDLA 4OYWA 5I4MA 2X51A 3PYGA 1QAIA 2ZUGA 5E0OA 4FKXA 3FKBA 1T3OA 2E1CA 3W1YC 4PG6A 1QAXA 4DLEA 1KFSA 4PCQA 1RT6A 3IBWA 4JI0F 2UVVA 2RIJA 3G8QA 2K2PA 4TU7A 1SKSA 1SQFA 2J6UA 2KJVA 5A8WA 4JI5F 3KK2A 1H73A 1S49A 1T05B 2HHVA 1GQEA 4IR1A 4ECVA 2VPXB 1WDTA 2NCKL 4DJBA 4CM0A 2AJ1A 2DB1A 3OLAA 1FTRA 3IGVA 2JLEA 1SL2A 4V1Ak 4DU7A 3LP1B 2FLOA 1JNZB 4OFZA 1E6YA 1UFKA 2LQ5A 3W5XA 2MDAA 1P27B 1GMUA 1V3ZA 4CNZA 1G3OA 4QIGA 3HVWA 5KFPA 1T02A 1YRTA 2BJ9A 1GT8A 2COLA 1UWBB 3PY8A 1OS5A 4JV0A 3H5SA 2CPFA 4F4KA 4BWMA 5AXMA 1VOMA 1NLKL 4ATNA 4C0HA 1AT1B 1LK5A 3DLEA 1UKUA 2UVWA 3D1HA 1RTDA 4KV8A 3P3DA 1S1UA 5GAHI 1V6HA 4ZPAA 2V8DA 4A8FA 4RJVA 3JTNA 5LXRA 6FDRA 5ETTA 3M9MB 4KAIA 1PJ5A 2J0QD 4LRFA 3VF0B 1TL7B 2DBBA 1WTFA 4O3RA 3H98A 4ECSA 3OQ2A 3P6YC 2BOAA 3H25A 2ATLA 1IQZA 1IKXA 4RKUC 2U1AA 5ITHA 1FRKA 1MROA 2C3OA 4J37A 2ZH5A 4RUCA 3Q2TC 4L3NA 4DWIA 1KVKA 2HGLA 2G2OA 4DZDA 1SCJB 4TXSA 2HURA 2B9EA 4X62J 5HAOA 2JL9A 3DLBA 2YKMB 3F44A 4I2QA 3QAEA 1HWLA 2BM1A 3Q8UA 4BC9A 3M30B 1YTYA 4USWA 2HQGA 5A8KB 1HL6A 1RT7A 2HBZB 1RTIA 5IWAJ 4KGVB 2YKOA 2RE1A 2LQJA 1QUPA 2W9AA 1FCAA 3Q23A 4HR2A 3IAM9 3HVTB 3V81B 5CZVA 2B7BB 1SJQA 2BBEA 4N41A 2GZOA 5IWAF 1TL5A 3C16A 1HNXF 1LEOA 3MPYA 1I5OB 5T7LB 1KDNA 3MAQA 2BYCA 2DHHA 4RW6A 3T1AA 3VAGA 5LOQA 3PXGa 3ZZUA 3BBBA 4U7UK 4CIOA 4DV0J 4FVCA 2KFNA 3THPA 1XJWB 1RTJA 3RYLA 4MT1A 1N52B 2B0GA 4RUBA 4CO4A 4CRJA 2FGCA 5CH7B 1KNZA 2V6AA 2J6SA 4LBIA 3MAAB 4RBUA 4DV0F 1S6PA 3R5BA 1WI6A 2CKWA 4TNOA 3IR7B 2GVZA 2XMWA 1K73T 2FIUA 2AMCB 2XZDB 1FKOB 3KLIA 2WCXA 2MTLA 2Z58B 5KFUA 3IR6B 1UZDA 1VIXA 4P6QA 2J0XA 6AT1B 1HBOA 2UUBJ 1TMJA 5GAGU 2JVRA 3ET6B 1YDLA 4B9UA 3UDVA 1IBLJ 2Y9HA 2E29A 1CJTA 1JJ4A 4J9QA 1KP6A 3KMSA 4J9PA 2YWKA 2GV1A 3KDOA 4LFBJ 4WFNQ 2E9TA 4EFAC 2IA6A 3ISZA 2YNFB 2UUBF 4QU6A 4QBUA 2ASDA 1TKZA 5KT3A 3W8GA 4ZIWA 1MWQA 3GLJA 4ICLB 5IT9Y 1CS4A 2GS8A 2EC0A 3CMAS 3HVAA 1IBLF 1Q16B 1NUEA 1PYTA 3BGFA 3SCJE 1S9GB 4LFBF 2OEJA 2N4CA 5A76A 1S99A 5HSPA 3KUEA 3TA0A 4Q2MA 2X3DA 4A8XA 4ZVEA 1FRMA 2JWNA 4WP3A 4LRCA 4CLFA 2VQFF 4ZCIA 4OL8A 2DY9A 3HKZD 4OI4A 4F3MA 4PQAA 3DOLB 1SJFA 1GNKA 4J9NA 1KHWA 4K4SA 4EBDA 3KK1B 5HROB 4V19X 2YNHA 5D4NA 3TQEA 1Q5VA 5HQLA 1AZSB 4ZLLA 3SDEB 4PAAA 1OY8A 2DIVA 4CO3A 3AQOA 2DO4A 1HNVB 3QGHA 5A2QU 3Q83A 1FDNA 2HNZA 3GIJA 1WC6A 3TOQA 2Z56B 3KHHA 2UXCJ 2OPPB 1RT2A 2FC9A 2ZEJA 3WZ0A 2QSWA 3PKYA 3K58A 2FJBB 2RRNA 3OUYA 1J5OA 4IOAQ 3W2VA 3DRSB 4FN5A 1JK9B 1A9NB 4CLWA 3H2UB 3CJKB 2PT0A 2DPIA 4K4ZA 3HFKA 2R7OA 4WBFA 1HFEL 2FTRA 1RWXB 3BF4A 1FNMA 3NS5A 2B4UA 1HHSA 3NWGA 2FJWA 5IC4B 2L08A 4J9KA 1NHKL 2QJ3A 1U7LA 3C2PA 1KRPA 2I6WA 5F8IA 3OFFA 2AQ4A 1RAJA 2IDEA 4CLLA 1M1KT 4DU8A 2B3TB 2PFFB 4K5RA 1FKPB 2ALYB 3Q8YA 1HW9A 2G0CA 2JOQA 4CLYA 4PXBA 1NDPA 1IUJA 3QBCA 3ZNUA 3K57A 2J6TA 3LPYA 2X1GA 4M1KA 1NPKA 1JWWA 4ITSA 3PKMA 3UNYA 3BGOP 4PG7A 2GW8A 2NR0A 2XEXA 3GJQB 3MM5A 3V2UC 2CQDA 3AODA 4QR1A 2LU2A 3TR5A 5B0AA 2L48A 1T05A 4LF9J 4DX6A 2PA8D 5KFFA 2CIMA 3T5JA 5K9FA 3CD6S 3Q24A 3CNQP 3LP1A 4C8NA 2L9DA 4WE1B 4JI7J 5E5NA 2CWKA 4LF9F 1Y3KA 3CCZA 3MPWA 2ILYA 3SYZA 1TP7A 1TKXB 1XWLA 4QYZJ 4KQZA 2RUGA 1RHMB 3CCJS 4JI7F 5HLFB 4CO0A 4QU7A 1X4HA 4GRSA 1OSCA 1FDBA 4KR0B 1KSPA 4B3SJ 2FZKB 2F3JA 4WFXA 3KG0A 1B3TA 3J7AN 1ZM4A 1VBKA 2QV6A 3AJDA 1FE0A 4MK9A 4URQU 4Q5VA 2EW9A 1ZOTA 1DARA 3PR4A 1YSJA 2XS5A 5KFLA 5JUMA 5HI7A 5D4OA 4B3OB 1NZ8A 2AX1A 1VQOS 3HULA 1RT4B 4B3SF 4DOZA 2EEYA 4O3NA 2J76E 4QPTA 4HACB 3UCGA 4EI2A 2ZH2A 1TL7A 1RKIA 5D0EA 3EGWB 2MZTA 3OPKA 3T9NA 3DHXA 2DEIA 3G6YA 1R3NA 5KFBA 1U49A 1WEXA 2K1RB 3K2YA 4FZVA 2QL7B 3NP5A 1XIQA 1S9EB 2VFSA 1SC6A 2W9BB 5LJ3Y 2VDHA 4LRDA 2A3JA 2RS2A 1U1KA 1XEZA 2PDAA 1Q82T 4CT9A 2YKMA 1AYEA 5IC6B 1W26A 2ZH3A 3RRHA 2AX0A 4AXIA 4CM2A 2RKIB 1JXEA 3S1TA 1OPZA 1IBMJ 1U0HB 3P8BB 3I82A 5A8KA 3TI0A 1FNOA 1Y9OA 1RT5B 4RW9B 1HMVB 1FXDA 2WRMA 2V4RA 3W62A 1WF2A 2DGUA 2EKNA 3W65A 2N7YA 1N5TA 3U27A 2CJ9A 3DOKA 4LQ3A 4CLSA 3HVTA 3V81A 3CJSA 2HZVA 2E1RA 2QT7A 5GVQA 1IBMF 1XNQF 1SIZA 3I96A 5HJYA 2RT3A 2ZJQQ 5CYQB 2VJUA 4NYZA 1YI2S 1WHYA 2M88A 1IBKJ 2C2NA 4F3OA 2DHAA 2DHSA 4IDKB 2P2CB 1FWPA 3L09A 2FUG9 1V3RA 3W64A 1MMDA 4OZJA 2X1FA 1PG5B 2CQGA 4A4JA 2PFDA 4NLRA 5CYMB 3UFCX 3KLFB 2NPFA 4FXVA 4MKVA 2O01C 1IBKF 3MAAA 2R8HA 2KB2A 1I94J 3C19A 1UJ6A 4H4MA 4B3TJ 1HLWA 5FDLB 5B0FA 2LA6A 1F5AA 1M1HA 1RTHB 1SVDA 3DLGB 5E2QA 3T5HA 2R42A 1X4CA 4ED1A 1G4CA 1CBKA 1SC3B 1RWVB 3MR7A 4BHQA 3IN5A 3ET6A 2XM3A 1I94F 3AT1B 1JXLA 3NLCA 2GHPA 1S1VB 4OHVA 4B3TF 1PAUB 5CABA 1MU2B 2DGWA 2Z2LA 4UOFA 1VLYA 3JS9A 1U02A 4OYAA 1TL3B 2X1BA 2YNFA 1FK9B 1Q8BA 3THVA 1M5HA 4ICLA 1RK8A 2RHSB 1FJ7A 4P73A 4DL3A 2CQCA 3PRBA 2YH1A 3N6LA 2K3IA 3Q8QB 3W9IA 4K0KJ 4GO7X 3M8QB 4F36A 4KTQA 4I7FB 4ZJQA 3VGSA 2BEFA 4ELTA 3MMJA 1KONA 5DDOC 2O67A 2YQ1A 3MCMA 1Y7PA 1RISA 1XK8A 3LAKA 4YR2A 2MSTA 4K0KF 1S4EA 5FJ4A 3TARA 2HHWA 2D69A 3PG9A 9ATCB 3TNVA 4DV4J 1VI7A 4OYIA 2DYAA 4NEZA 1ZS6A 3FBBA 3EPIA 3P5BP 3W2WA 1S1WA 1HWIA 5HROA 4ZPTR 1WI8A 5IOLA 2YPYA 4HHUA 2CNOB 3NRBA 3N5BA 1PJ6A 1ACMB 2M7SA 3HSGA 4HL9A 3ZFVA 2ZBIA 3KLGB 3B78A 4DV4F 3FC9A 1ZETA 3LTOA 2WONB 4PPDA 3PW2A 3C6TB 4EEYA 1VDHA 2B4OA 2HK3A 1HNVA 3RUBL 4FNHA 4PWDA 5ADZA 2F5GA 4USIA 1RYRA 2EFPA 2OPPA 2FHMA 1LXNA 3IFEA 4OHWA 4F8RA 4KPYA 1X9SA 2CPYA 2OLWA 4LVNP 1VJQA 3TAMB 3DRSA 4LREA 3TANA 3O8WA 4OI3A 2ZNZA 3CJKA 5IQ6A 3OVAA 3OHBA 3HDSA 4X4RA 3KXDA 1YJRA 4TVAB 5KFSA 4DPWA 2M0GB 4K7QA 1M0SA 1PYSB 1Z4UA 1JJHA 2WB1D 1FVQA 3V6KA 1BQMA 2MMYA 3VR1A 4E0DA 3KYLA 2GHWA 4NOHA 5L39A 3BM7A 1FKPA 5D3GB 3LAMA 4OZLA 3MEKA 1X5TA 1HD1A 4DX7A 4HT5A 4H4KC 2EXUA 4Q2LA 1U8WA 2JZ5A 2Y3YA 3T41A 3B82A 2M9KA 1APSA 1H7WA 3DKDA 5IXUA 3PW5A 2R7SA 3A3OB 5HVGA 1LFPA 4RU2A 4YDXA 2BXJA 5L9NA 2CXEA 3A3NB 2ZJRQ 2IA0A 4OYBA 4K2XA 4ZP8A 2IM3A 3RB3A 4RO0A 3QFWA 2MXYA 3POTB 4DQIA 2GHVC 4Y6IA 3OXFA 4WE1A 4RNMA 3BO3A 4ZVHA 2VODA 5DRKA 2M52A 5IT9U 1T9YA 1SKRA 4B9MA 4BLGA 3VCDA 3P5TL 1PBAA 5C2CA 1BD6A 4XTTA 2I1RA 5KFAA 2RF2B 1S12A 4NZ6A 4N5SA 2GJFA 4K8RA 4NCGB 1TKXA 4USUA 1RCXB 3FRYA 4M8LA 2ZJPQ 4ZDNA 5HLFA 3KUGA 2B43A 1UETA 3CMES 3EVWA 2M3DA 3L9ZA 1FX2A 1DY3A 1N33F 5DM7Q 3DCAA 2XHWA 3JQKA 4C11A 5C24B 4IO9Q 1S6OA 2CJXB 4EBEA 1T95A 2XMMA 3I0RB 3FVYA 3LWLA 4IUFA 3QFHA 5F8NA 2B4PA 1UL3A 1RT4A 3M8SA 5HN0A 4RPFA 4KH1B 1RBOB 3D9BA 4PEOA 3FFIB 1RAOA 5KG6A 4QYRA 2DD8S 3OR2B 2CJKA 2C3YA 1S6QA 2AV5A 3QWUA 4HACA 5KT2A 4JV5J 5ETKA 5L8RC 1B4SA 1HQUA 4B9SA 3OJUA 1Y5NB 2V50A 2GX8A 3IRWP 4OZ3A 3IXQA 4ZPBA 3GG1A 4JV5F 4P74A 1EX8A 1WJ9A 5D78A 3UW1A 3RR8A 2W7AA 4KGMA 4LR8A 3G9CA 3ZXWA 1DQ9A 1GK8A 1SQGA 4DF4A 1C0TB 4H54A 4PZVA 4X4VA 1VQYA 4DS5A 3UN5A 3FNNA 1RBAA 3QT5A 2RKIA 3SSSA 1VQLS 1VQPS 1U0HA 2RDIA 2MKYA 4NMXA 1RT5A 3X1LB 3MMCA 1NHVA 3U02A 3TWZA 3NOGA 3M2RA 2HKEA 2LQ9A 7FDRA 3DGVA 4OHYA 2B9WA 4CYUB 2GVDB 3AFGA 1NK8A 2AJQA 3MM6A 2GQ2A 3BQ1A 1F9EB 1CJUB 5IM0B 3MHYA 3GV8B 1D8ZA 1OO0B 2D3OR 2HZAA 2OMLA 3D6FB 3TUIC 2JHEA 4YB1P 3QAUA 2KO1A 2VKZG 1IWGA 4IDKA 2VG7B 3HHLC 2ROGA 1CVJA 5J1NA 4M5JA 1Q78A 1OY6A 1C4CA 2HLTA 1H74A 3DGPB 2P9GA 4RW8A 4FPRA 3KLFA 1SV5B 2OIHA 2AJ0A 4TN2A 4RNHA 3TJAA 3MPDA 4OJ1A 5LSOA 2BV3A 2KKHA 1HIYA 1NRKA 2ALZA 3W9HA 5FDLA 4Q0BA 2FLNA 1SC4B 1RTHA 3DLGA 4F7VA 4FS1A 1VQ4S 2DXFA 2ACMA 1P8GA 3D7SB 1T94A 2IVFB 1UVIA 5GMKa 3BH7B 3NAIA 2R8KA 2GNKA 2HRYA 2NXEA 4NLQA 1MU2A 5CYJA 1FFWB 1CQMA 3FCVA 3TP2A 1TL3A 2SXLA 3GIKA 1FK9A 3A4TA 1FD8A 2KG0A 2OMOA 1S72S 2ZITA 2QX0A 2H5JB 1ZZFA 2JLFA 1RWMB 4O0NA 4I7FA 3G6VA 4J9SA 3D4JA 2WVCA 2NREA 1S59A 3L3CA 3IAS9 1IJEB 3G6ES 3D28A 2XMAA 1N36J 1ZH5A 5KOXA 3M05A 1KR4A 1VQ8S 3BN7A 2C3MA 3G96A 4RW7A 2KRBA 3J7ZT 2E66A 4HH1A 1BE4A 2QG9B 3CCQS 2CPZA 4Z7CA 2V9WA 3I55S 1N36F 5G0RB 4YP3A 4IO1A 2UU9J 3KLGA 2D9OA 3D3BJ 4ZLPA 2XSJB 1HARA 2WONA 3C6TA 5KFXA 3SQGB 2DNZA 1KQSR 1Y4ZB 4KPCA 3RBXA 5BR8J 4JI6J 2EC2A 3QGIA 2GAHC 4C8KA 3CT9A 1RABB 2P8IA 1NK7A 1NK9A 1M5VC 2V94A 1HW8A 4G65A 5BR8F 3FBFA 3MAHA 4JI6F 3TVZA 2ZBPA 5GAGI 1LFWA 2V8GA 3MR2A 2XMJA 2BABA 4M5GA 1DZ5A 1EIYB 1H2TZ 2N4DA 1VBXA 2XYPB 5IQQA 1DQ8A 4BDPA 2ZFHA 4FYWB 2ASLA 1Y5LB 4L74A 4J9VA 5F8HA 4CZCA 5M2UA 1F60B 1F3FA 5D3GA 2BR0A 1NPRA 1VRQC 3MR6A 1WG4A 4KBIA 2N3OA 3K59A 3GCXP 4O3PA 3AHPA 4IH7A 2MLXA 3M2VB 2LKZA 3AA9A 3OD2A 2ADBA 2CQ2A 3P96A 2M8HA 2RUSA 4ANEA 2YQ0A 2OPRB 2IYGA 2OSRA 3M9NB 2DHXA 2H65B 2QLBB 3MUTP 1BGXT 2HQIA 3CUNA 1WORA 2G1DA 1GXUA 3OLBA 3NS7B 1VQ6S 4EBCA 3K17A 4EU0A 3RBDA 4DV1J 2F9DA 1Q79A 3CXCR 4MKBA 3AD9C 1N6QA 1WHWA 3QLHB 4Y28C 3CF5Q 3V4MA 2XWXA 2VKRA 2W2MP 4OX6A 2JC0A 1YVFA 5DGAA 1HNIB 3A8IA 3SI8A 3BDEA 1BUXA 3H90A 2RF2A 1DLOB 5KG3A 1N5QA 1JLCA 2CPJA 4C6AA 3VQTA 3Q22A 1YRXA 1GH8A 3I9V9 4YQWA 3NY0A 4J9LA 3CDEA 3J7A1 3QGGA 4IFYB 4Q8EA 5LM7E 1VISA 3V6HA 3G82B 1NKEA 1NCLA 5C24A 3QZ8A 4ZPWR 3FSYA 3WX4A 1KBRA 2RQ4A 4ED7A 2CAJA 4WIIA 3I0RA 1Q0NA 4WZMA 2CQ1A 4ETXA 5HMWA 1RHUB 2CVEA 4A8SA 3LPEA 5HVHA 3N6MA 1RTZA 3MOZA 3MM8B 4LR7A 2J7UA 2MHNA 3EE3A 1RE1B 2WOMB 3M6VA 4KRWA 2GMJA 3GFXA 4DQSA 1C1BA 1OQ3A 4RWXA 3J7YU 2CVIA 2RQMA 4ZJLA 4PG4A 1F3VA 2HHSA 3SEOA 2W25A 1O51A 1NEEA 4NLTA 3AOBA 1B0VA 3UR3C 3G6XA 3L7UA 5H9FK 3JSYA 4IG3A 4EO6A 2HFNA 2NXJA 2J8AA 4P75A 3H0PA 2YNGB 3BPDA 4O44B 3UD3P 1ROFA 1ULRA 3DXSX 1AFJA 1F6TA 2FJEB 2RVJA 1C0TA 4F26A 2OPQB 2JFDA 4ID8A 5A6WA 3M8ZA 2J9EA 1OIAA 1NB7A 2HQDA 3VZIA 2DGSA 4Y2IA 2VFVA 3ZTQA 3PW0A 1U45A 4I1TA 4OQJA 2HMIB 1O6XA 4HLBA 2HK2A 5J2PA 4LFCJ 2B5JA 1JJ2R 2JEFA 1URRA 2F7VA 1CSJA 1JLQB 2HFUA 4CYUA 1C4AA 3U1MA 2D41A 2RU3A 1S1TB 1RADB 5KFIA 3OFHA 2EVZA 2VH7A 1CJUA 5IM0A 3MM7B 4ED5A 1NSKL 2RB7A 3KLHB 4LFCF 4DEZA 2IVYA 3CCTA 2E9RX 4KO0A 1OSDA 3UO0A 3SCIE 2VG7A 1HBMA 3JYTB 4DV6J 3N01A 2YPZA 1X4DA 3QO9A 2ADCA 1P1LA 3S8SA 4EMDA 2G13A 4OLPA 2LEAA 1SV5A 2Y1RI 5AXLA 2HWTA 1N5VA 5C5JA 3H2LA 3DXBA 4WPAA 1NK0A 2E1PA 3PTWA 2ILZA 1N5SA 4DV6F 2ZHAA 3I0SB 2IPOB 5I3UB 3VZHA 1RBLA 1VBYA 3ILIA 3BR9A 1UEUA 1IR0A 3ISNC 2J7KA 3GIMA 5K8OA 4WKYA 2ZC3A 4DCOB 2WAQD 3K7RA 4UZBA 1FA0A 1TFYA 4F04B 4ZKAA 4JV2A 1SJRA 3KHGA 3PR5B 2YWWA 2XMTA 3BGRB 4OX8A 3Q2SC 4ED4A 1NDCA 3D3CJ 1D9FA 3JSBA 4FNIA 2V2ZA 3KUHA 2APOA 3CO0P 3R5JB 5HATA 3ZTSA 4DF8A 3MPVA 3UVJB 2P9CA 2C3UA 4OZ0A 4CLZA 1MN7A 1TK8A 3AXMA 3F41A 4MYUA 2R7XA 2HYIB 2XZTB 4LF6J 4USMA 3GYGA 4JYAJ 3OL9A 3TZYA 4ILMA 1HQEB 2RAQA 4QWAA 3LGNA 3O44A 4DX8H 1NKCA 4KGKA 1NJIT 2DNKA 3UQSA 4K59A 2JFKA 4NA2A 1TUWA 1TQLA 3SZ2A 4LF6F 2E1AA 1LW0B 3M8PB 2CNLB 4WU2A 4OI6A 3I56S 1VRTA 2XLIA 5IZHA 5G0RA 4CO5A 3AAWB 1S48A 3ITHA 2V8HA 2VBWA 2BANB 2XSJA 5IT0A 4NZ0A 4PG8A 3SQGA 2KT5A 1FRLA 2DH7A 2PSZA 3GFZA 1VR6A 4D3HA 1ZAWA 3N4WA 1U8SA 2R3VA 2QO3A 3MUMP 4F50A 1FDDA 4C8LA 2J8SA 3QT7A 2VBXA 4YR0A 2DH9A 2H4WB 4CNYA 3FZ2A 4F4ZA 2IDLA 5HBMB 3K0JA 4C0OC 2BW2A 1KS2A 2HBYB 2ZBCA 1HKAA 1UWAA 3OL6A 1RJJA 2YKPA 2PC6A 1H0HB 5SUHA 3CB4A 4USJC 2KFZA 3B4MA 1NSAA 3UN2A 3R2DJ 2FD2A 2MPUA 4BBYA 3ENQA 1QSLA 3KK2B 3AD8C 1HA1A 1BXNA 2OAUA 1WELA 4IH6A 2YY3A 4FS2A 5B7WA 2KFYA 2HG4A 1KLNA 3BBFA 1SKWA 1RQ0A 1NM2A 2ZE2B 1D9DA 4S0MA 4QCLA 3M2VA 1TK0A 1YJ9S 4M63A 2ZKTA 2OPRA 1FERA 4NCAA 4ED2A 5DDQC 4Y3CA 2NS1B 4Y65A 4DHVA 1TAQA 5K8PA 3O3LA 2NXNA 2EG2A 1JNRB 2OHDA 2M70A 2I8EA 2VASA 2E1MC 2R7WA 2KG1A 3TA2A 1F9FA 4XDCA 3DM2B 1N56A 3C6UA 4AL7A 4YB5A 5F0WA 3I5CA 4C7QA 5DQHA 2XY5A 3BYPA 2HSEB 1S0NA 3MZIA 3CCMS 1HNIA 3OTDA 3DLEB 5LJ5Y 4DR4J 1S9FA 2OFHX 3MTJA 4KV8B 1S1UB 2QRRA 1DLOA 2C1EB 2QA2A 2IRUA 4NASA 1FRIA 1H6KX 2MGZA 1K8AT 4P2FA 4Q43A 2K7KA 3CJRA 4C9DA 4DR2J 4DR4F 2BJ7A 2LDIA 2HAFA 4A48A 2CPDA 2JJ4D 3G82A 2F4VJ 3QATA 3FSXA 4DG1B 2E5LJ 2OUGA 2DO0A 1R0BG 2EI5A 5E3PA 4X4UA 2MKCA 2IC3A 2BM0A 3EXCX 3QIPB 3BN4A 5KFJA 4DR2F 4O0IA 1RWWB 2HZCA 3PJWA 2YKAA 4OZ1A 2F4VF 3AXKA 3TZWA 4WFZA 2E5LF 5CD4H 4I2QB 1B0TA 2LCWA 5A2QY 2DNLA 3D6TB 5HK4A 4IG0B 2ZDOA 2FHJD 4YDDB 2MKJA 3DOMB 4JB8B 3M6UA 3CEDA 1I6JA 2B8QA 4OV1A 1X4GA 2HS4A 5KFDA 2BW7A 1LKZA 2YNGA 2U2FA 2XO7A 4WFBQ 4M5NA 4C3KA 4ZA1A 1FWLA 3BSCA 4BS2A 5HJXA 4YR3A 3C16B 1XR6A 3MECB 2OPQA 4A8YA 4EYHB 2ZZMA 5DJBA 2LYVA 2BRLA 3A8KA 2YX1A 4NLPA 4IR9A 3Q89A 3CTRA 1AROP 2L41A 3RB0A 2HMIA 4LSNA 1QLNA 3KNAA 4WF9Q 4GVBB 2QMWA 4Y00A 1JLQA 1R0CB 1S1TA 4KC5A 1G1XA 2CZ9A 2FHKA 5ETMA 2HLUA 3MUVP 2A2CA 1NJZA 2E5IA 2CQBA 3MM7A 3KLHA 1H2VZ 1MN9A 1X4EA 2HHUA 2ASYA 3EDQB 1YHQS 1MNEA 4URSA 3TUZC 2NUHA 1VQNS 3I6PA 2OTJS 1LK7A 2R2RA 1RKJA 5KG2A 3JYTA 1S5ZA 3I87A 4U95A 4U7UD 1MG7A 1CS4B 1FVSA 2E7WA 2VFRA 4YS2A 3HD2A 4UOGA 4LSLA 1JLEA 5CXTA 1NDLA 5I3UA 1F2GA 3LA0A 2VPZB 4RWWA 2RRAA 3DRRA 3DMJB 1S1XB 5H9FJ 4TQRA 3NWRA 3WBZA 5LSRA 4ECZA 2OPSA 4NXNJ 2XGQA 2BJDA 4P7VA 3BGRA 3EYZA 2WSFC 3SV4A 1J27A 1YITS 3S6EA 1X5PA 4C8ZA 1K9MT 3R3TA 4DFMA 2O66A 2LU1A 4XDDA 5F8JA 1N34J 1HI1A 3IR5B 1DJ0A 1ZPWX 4B9NA 2R2TA 4NXNF 1NDKA 3KHLA 2AEMA 2FVQA 2AEJA 3UVJA 2H1YA 3EX7B 4OYZA 1U1OA 1KOHA 3IG1A 3ILLA 1N34F 4LF8J 1VFJA 2VG5B 8AT1B 5B0GA 2HNZB 2C3PA 3KDNA 4HHHA 1RT2B 3RTVA 1GX6A 2CJBA 1ZM3A 4MTPA 1KVIA 3A1YG 2ZWPA 2QEXS 2KL8A 2XCAA 3T5LA 3W2VB 4LF8F 1OYDA 1RAAB 2H54B 3SSQA 4XPCA 3R1HA 2OD6A 3H40A 2KT3A 2Z30B 1YJVA 4DN9A 2YX7A 2LDYA 1M5KC 4ECUA 1UEVA 2OSQA 5KG0A 2HHPA 1T9UA 2F40A 2PMZD 2EFGA 3FGVA 2R9LA 1KFDA 2R7TA 2XLJA 3Q8VA 2UP1A 5KFZA 3G2XA 2MQPA 3IWLA 2XCPA 1UVLA 4OZNA 3A8JA 3GFHA 2QE5A 2X1AA 2DIUA 2CPEA 5HBMA 1BHNA 4J9UE 4B9LA 3CC2S 4N8NA 1WHVA 4USTA 4ZP6A 3CD0A 1I1GA 2FJXA 5EX3A 3CJQA 3RW6A 2CZVC 3BV8A 3BDPA 2W7OA 3MM5B 2V2QA 3RB6A 3PO4A 4F0KA 2AHOB 4FF3A 2VL1A 2IMWP 4X2BA 1C2PA 4LF1A 3E01B 4P9SA 1XBWA 3VVUA 4IFVB 2F8HA 2GFFA 4QIWD 2XO6A 5B0CA 3MEDA 1Q8KA 5J2QA 3HHNB 2ZE2A 3WIUA 5EX0A 5AE1A 5GAEU 4YHHJ 8ATCB 3RBZA 1EETA 2V2KA 4EZ9A 3GYXB 2DY1A 3PW4A 4XO0A 4DS4A 4EUVA 1MWYA 3G8TA 4DI6A 3LP0B 3KWMA 3CWJA 4CO2A 3VGVA 1E6VA 3M6XA 5EHHA 5A0YA 2H48B 3DLLQ 3CCUS 4DFKA 3DM2A 3L7PA 2FY1A 4AT1B 2VUGA 1CULA 3DHWC 2XS2A 4DL0C 2DNRA 5LMNJ 4L75A 5L1KA 2D7SA 1QSSA 1T3NA 1RZMA 2WVEA 1SJ3P 4LBPA 2OFGX 1FRJA 4I68A 4OI2A 2PI4A 5LMNF 2K06A 2DKOB 4DPOA 3OFGA 2EWHA 1BWEA 4OIXA 3QNWB 2C2KB 5E3QA 1JMTA 2RS8A 3KG4A 3VAIA 4NA1A 3FZBA 3RGIA 4DG1A 2HHHJ 3ISND 4TLRA 1IBCB 1SI9A 2EFVA 5B0BA 2HGMA 1IN0A 1Y0HA 3QIPA 2G0JA 3OVBA 3OTOJ 4ZPCA 1L5UA 1JQGA 4C8OA 2MEWA 3GJRB 3EGZA 1EZZB 2HHHF 4I2PB 5KFVA 3LWMA 4C97A 3CSKA 3VV2B 4AL6A 3SFUA 2PO4A 4DL7A 4IG0A 1UPMB 2IJRA 3A3PB 3OTOF 1Y00A 3KFWX 4NYPA 4X62F 4CLTA 4R0JA 3L95X 4EWTA 3J80Y 2IAJA 1RLCL 3DOMA 2PMWA 1G7CB 4ERDA 2Q6CA 3MF5A 3DOKB 1BQNA 4WWSA 3HKWA 4I64A 4CDIA 3OSNA 5DG9A 4WK3A 2MY8A 2W7PA 3EVMA 3N6NA 3WQPA 4U96A 1RGVA 4YY3J 1U6BA 4J9MA 5D0GA 1R8BA 2B51A 3MECA 4TQSA 3NGTA 1KEKA 1A6LA 1U6ZA 1R8PA 2KM8C 4P2SA 5AXNA 3CJ0A 4U9RA 4DV3J 5KG1A 1Z1ZA 4ER8A 1NZAA 4H4OB 5KFKA 4WIQA 4GVBA 3D54A 4OI0A 4X84A 3GSIA 3PEJA 3T1YJ 2WB4A 4OHXA 1Y3JA 2HIYA 4H4MB 2YQ3A 3V5RA 2B4VA 3MPUB 5JVGQ 4DV3F 2C2DA 3CCLS 2QTWA 2ZKUA 2KRRA 4P10A 4I6WA 4QIFA 2DNNA 3DLKB 3VAMA 2QLFB 3T6BA 2BKNA 2VHGA 1RAFB 3AOCA 5EGYA 2AW0A 1IVZA 3ONQA 3NMRA 4LIWA 2A1BA 2F4FA 3UI3A 4A8QA 4ED3A 1T0TV 4X65J 2RRBA 2MYFA 4IKAA 3J7YI 4Z7YA 2G2YA 4J5OA 4WJBA 4FPIA 5DG8A 3DMJA 3FRZA 3ZC4A 1S1XA 1NXIA 3PACA 2X7IA 1YLXA 3M1VB 3EWGA 4LF7J 4G1PA 5I42A 1JLAA 4X65F 3RB4A 5KFOA 2AD9A 2MY7A 2QL9B 2QZ8A 3TEHB 3NMAA 4ECYA 2HAIA 5B09A 3EGVA 1ZAVA 4L73A 4DSIA 3PW7A 3BSNA 3W2WB 3SMZA 1S1WB 4K4TA 2E5JA 2LECA 1GX5A 3I32A 2AF6A 6FD1A 2GA7A 2UVRA 1WG1A 2ZBRA 1MW7A 3E51A 1C1CB 2Z4PA 5K20B 4PWDB 1RP5A 2VG5A 2MLYA 2WHOA 3R7NB 1V5IB 1QE1B 3CJ5A 2RMLA 4OV6A 1RAIB 1VQ5S 1BLUA 3MEGB 2B9XA 2O3DA 3CCSS 2WK4A 4ANCA 2WTFA 2AGQA 3W63A 1WSVA 3EXYA 3W60A 2UXCF 1OYEA 3TVKA 3GE9A 3I5AA 1WHXA 1R6VA 2JC1A 3PHEA 1WC5A 1T7PA 4NE9C 4C8YA 1N88A 2DNMA 2KN4A 3UDEA 2IFXA 2HNYB 3RU0A 2DK2A 1BQMB 3BPSP 4WFYA 4WYLA 2ERRA 1T9VA 1RLDA 1EARA 1Q53A 1TTHB 1V3SA 1GAOA 4DUZJ 1QAJA 4YOEA 5F9NA 5T41A 4OJHA 4F2SA 3HSJA 3TO8A 1R0AB 2GIFA 1SJ4P 3MXHP 2VU5A 2LFVA 4CI0B 2DR5A 3CDUA 1CC8A 2MQNA 4DUZF 2OKQA 1S57A 5ETRA 1X9MA 1B7FA 1U24A 3KJFB 2C2RA 3TZZA 5RUBA 2AYMA 2G9OA 3BO4A 5KTQA 1AUDA 1T9XA 3EJMA 4DPUA 1JKHB 1V9OA 2X3GA 3E01A 4LSZB 5CAAA 3FBEA 1RWKB 4IFVA 1LXJA 2ZOGA 1PIEA 3UE2A 1HNZJ 5FLXY 3AH6A 1YK9A 1VQSA 4A8MP 5H9EK 1XMBA 4JV1A 4CP5A 2MQLA 5HQ8A 5JXSA 3R6GB 4O4RA 2HPUA 4ILLA 1B0PA 2PEBA 3CDBA 3IS9A 5C7PA 3ENWA 1HNZF 2XQCA 2W1BA 4R5PB 2R7QA 4ZJOA 3LP0A 5IS2A 3VQSA 3DI6B 3CC4S 2BDPA 1RAEB 2PI5A 2KZMA 3HZGA 4DL2A 2J9CA 2WVFA 3AB4B 4PXEA 4C11B 1AW0A 4WTOB 4KGZB 2EK6A 2LQ8A 3CW2C 5B0EA 3DYAB 4M5HA 1FT8A 1OY9A 4AYBD 2DR6A 3JQMA 4WU3A 5J1EA 4YB6A 2HRUA 3W9JA 1S6QB 4ZITA 1ZM9A 3EICA 1T8EA 3TRGA 1XMOJ 1HQUB 4B9TA 5I3PA 3SFGA 5KT7A 2A18A 1IKWB 3UNGC 1RXOB 4CTAB 4AD6A 2LP4A 1N54B 2PE8A 2B7CB 1ITPA 1NH8A 3F73A 3HK2A 2HFOA 1XMOF 2YTCA 4DV7J 2E9ZA 2QA4S 1PAEX 5C42B 2ZHOA 2V63A 2OEKA 4FBTA 1K47A 4N8OA 2A6MA 5CZXA 3NCPA 2QLWA 3OT9A 1REVB 4I2PA 1NK5A 3KKFA 1PSDA 3U1LA 2LXFA 1TL4A 2DRBA 4OZ2A 4Y2CA 4ZCLA 1WOOA 1FHTA 4M5KA 5F3TA 5KAKA 2I38A 3W7BA 1IR1A 3SIPB 3EUNA 3AY0A 2MQQA 1X7VA 3MMCB 2W2OP 3M2RB 3D1QA 1U1NA 5ETLA 1REGX 3QYYA 4K4XA 1KLMB 3UPFA 1P6TA 3R97A 2F1FA 4ECRA 1H2UX 1W2IA 3MM6B 1BC6A 1X5OA 2XNQA 1HBNA 1K44A 1X60A 2W9CA 3I4HX 1RT3A 4DQRA 4G6VB 4F25A 5KG7A 1UPPA 1N32J 4NLYA 4RW4B 1UW4A 4G1IA 4AQYJ 3IP0A 3OV7A 4DL5A 3HM9A 3QWPA 3CPWR 5MLCV 4H4OA 4RW8B 2AZ1A 5B0DA 3CJ8A 2O1PA 4RUHA 1WOPA 1N32F 2PEHA 3K8WA 2E5HA 4AQYF 3PX6A 5L1JA 4C2MA 2JLGA 1F5CA 2QYCA 5HMZA 4Q0BB 4JI2J 2DGVA 1YJNS 2BOPA 2AZ3A 5HMXA 4RBTA 2JDJA 2UUWA 3QQCD 3QJPA 1UJ4A 1TL1B 1NB2A 4KGXB 3DLKA 2A6OA 1N5YA 2VBZA 5M2RA 3L4BC 4URGA 3GYNA 2JVOA 3SCKE 1RT1A 4JI2F 1PC4A 2JSXA 2BKPA 3K89A 2KM8B 3G4SS 1Q81T 1VYAA 2AYEA 3BSOA 1TFWA 5AT1B 5DETA 2V9KA 3NEKA 2HVIA 1NJXA 3J81j 1TKTA 4TLQA 1AUSL 4ZCKA 1GMWD 4F67A 2OO4A 5J1PA 2XSFA 2QSFA 4MK8A 3VAJA 1S0MA 1H38A 5E3RA 3AA8A 3Q0AA 4O23A 2H4YB 4ZVUB 3CMQA 5AE3A 3TUJC 3M1VA 4DPYA 3OTCA 5FIIA 2FZGB 3D66A 4OJ3A 1MWZA 3NNHA 3N79A 4FYVB 2CPIA 4F0MA 1S7IA 1XQIA 2VV5A 5KFCA 4LFAJ 5F41A 3GV7B 3TX0A 2XYGB 4RW7B 2G0IA 3AD7C 3DDKA 4HYKA 4I67A 4GC7A 1UJ5A 2UUTA 3T3FA 1TUVA 4TKTA 4O4GB 4PXDA 3SQOP 1X8DA 4LQ9A 1U1PA 4LFAF 1IKYA 1CJVA 2BJ3A 1C1CA 3H20A 1UMJA 4NYOA 3AJ2A 3TZXA 2F65A 2CDQA 1QE1A 3JB9k 2C2OB 5FD1A 3MFHA
chains in the Genus database with same CATH topology
3BSAA 2ZH8A 3LALA 2VBWA 3H2UB 4QIVA 2BANB 2XSJA 5IT0A 3CJKB 1YBAA 4NZ0A 2RQCA 2XWYA 2PT0A 4PG8A 3MURP 2DPIA 4K4ZA 1QY7A 3SQGA 2KT5A 3HFKA 2R7OA 1FRLA 2DH7A 2PSZA 4ECXA 2W4CA 1HFEL 3MEGA 2FTRA 2GO8A 3GFZA 1OQ6A 3TAMA 4D3HA 1ZAWA 1L3TA 3N4WA 1U8SA 5L9XA 3BF4A 1QTMA 1FNMA 3NS5A 2B4UA 5C25A 1HHSA 2QO3A 3MUMP 4F50A 1FDDA 2R7UA 4C8LA 4K5SA 4OMFG 3NWGA 5EDWA 2FJWA 3LANA 2PA3A 2L08A 4J9KA 1WEYA 1ZM2A 2VBXA 1SH2A 4YR0A 2DH9A 4NLSA 5DLFA 1KC8T 1U7LA 3EZUA 3FZ2A 4CNYA 3TA1A 5IFMA 3CC7S 4F4ZA 5HBMB 3MD1A 3C2PA 1KRPA 3K0JA 4C0OC 2BW2A 5F8IA 2MZ1A 1KS2A 1PO6A 3RAQA 3CIZA 1A7GE 3OFFA 2AQ4A 3BQ2A 2ZBCA 2CQ4A 1RAJA 5HMYA 3W3SA 1P9QC 2JX2A 1M1KT 1KVJA 2B3TB 1BQXA 2PFFB 2FPHX 4K5RA 1RJJA 2YKPA 1FKPB 2ZD1B 4MFBA 3OL6A 2GC8A 1FD2A 1HWKA 5SZTA 1HW9A 3PX4A 2G0CA 2PC6A 1TAUA 1UAWA 4QWBA 2MKIA 2JOQA 1H0HB 4HDGA 3ZZ0A 3NCQA 2HNYA 4PXBA 3CCWA 5CCLA 4IRCA 5SUHA 3GG0A 2LXUA 3CB4A 4USJC 5GADI 3CULA 2KFZA 1IUJA 1LWEB 4ES1A 3B4MA 2DRAA 4NRUA 3M6WA 3K57A 2FB0A 2J6TA 3LPYA 2X1GA 3PFEA 4RZRA 4M1KA 3N28A 1S77D 1JWWA 1TV6B 2F9JA 4NLUA 4U67Q 1YWXA 2FD2A 2MPUA 4ITSA 4BBYA 3ENQA 3PKMA 3NGDA 1QSLA 1QJHA 3KK2B 1R0AA 2Z0GA 1L3SA 4PG7A 2GW8A 2NR0A 3NBPB 2XEXA 4LT6A 4NA3A 1Z2LA 3MM5A 2CG4A 3NCRA 1HA1A 3V2UC 4KFBB 2YKNB 2CQDA 2CJQA 2OAUA 4QR1A 1WELA 4ALZA 4K4VA 2LU2A 4C0BA 2XNRA 3TR5A 1DQAA 1Q1KA 2K7JA 2ZDPA 4NLVA 1K0VA 4IH6A 2YY3A 1PGZA 2MB0B 4FS2A 5B0AA 1W25A 4KE5A 2L48A 5K14B 4KJIA 1T05A 4ES2A 2WBMA 5A8RB 5B7WA 2KFYA 2DH8A 2HG4A 2PGCA 2EFNA 3DRPB 1KLNA 2PA8D 1SKWA 1RQ0A 1VK8A 5KFFA 2ZE2B 1D9DA 2CIMA 4QCLA 3T5JA 3M2VA 3QJLA 2DGQA 2DNPA 1TK0A 2L3MA 3LGMA 1YJ9S 5K9FA 1RYSA 1SUQA 4Y2KA 4M63A 1S4FA 2ZKTA 2OPRA 3CD6S 3Q24A 5LL6d 3IGNA 2R2UA 1FERA 3LP1A 4C8NA 4NCAA 2OH2A 2L9DA 1JKHA 2PIIA 4ED2A 3PX0A 2Q3PA 3FEXB 2LA4A 4WE1B 2NS1B 4Y3CA 4Y65A 1NU4A 5DDQC 5E5NA 4DHVA 1TAQA 4MJKA 5K8PA 3O3LA 1VC5A 5EUHA 1N6QB 3OXLA 2EG2A 3THTA 4PPZA 1ZAXA 4LF9F 3POTA 4WXOA 2B56A 1JNRB 1Y3KA 3BJYA 3CCZA 2M70A 2I8EA 3H8YA 2VASA 2E1MC 2GMLA 2R7WA 2KG1A 3MPWA 2ILYA 4Y2MA 3TA2A 3UWTA 1F9FA 4PQUA 3IS9B 3SYZA 4QWCA 4XAKA 4XDCA 3DM2B 1N56A 1TP7A 3C6UA 4AL7A 1TKXB 1XWLA 4B3RF 4YMEA 4WFAQ 2VOPA 4QYZJ 2R4FA 2AP6A 4YB5A 2PN6A 4KQZA 1HBUB 5F0WA 4B08A 4PUOB 1JLGB 3I5CA 3NS6A 4C7QA 5DQHA 2XY5A 2RUGA 3CCJS 4JI7F 1Q7LB 2VOOA 5HLFB 4CO0A 1KTQA 4QU7A 4HEA9 1X4HA 1OSCA 1FDBA 4YHHF 4TY8B 4KR0B 1S0NA 1FJEB 3GB0A 4NCGA 4FP9A 3MZIA 1KSPA 4DL4A 4R5PA 1H98A 1JLCB 3CCMS 1HNIA 2F3JA 3DLEB 3KG0A 3OTDA 4WFXA 1LWFB 1TVRB 4ZMMA 2YWHA 5LJ5Y 4ELUA 5CA5A 3C8YA 1ZM4A 2QV6A 2RDJA 1S9FA 4MKYA 2OFHX 3MTJA 4KV8B 3DI6A 1S1UB 4HTJA 2QRRA 2MQMA 2XGPA 1DLOA 1FE0A 2KYZA 4MK9A 2NPIA 4URQU 4Q5VA 2EW9A 3SXLA 4QWEA 1VQKS 1ZOTA 1DARA 4N47A 3PR4A 1YSJA 1DTQA 1QM9A 2IRUA 2QA2A 4RNNA 5KFLA 2XS5A 1FRIA 1U2RA 1H6KX 4R0EA 4FBUA 5JUMA 5HI7A 5D4OA 2MGZA 2AX1A 3MEEB 4ED0A 4B3OB 2NXUA 5K5MA 4MKAA 1UFWA 4Q43A 1VQOS 1R43A 5JVHQ 4OX7A 1K8AT 3E2EA 2K7KA 1RT4B 3HVRA 4Q7AA 4B3SF 2HS3A 4DOZA 4C9DA 4O3NA 1ZPVA 2DISA 2VG6B 2M8DB 4G1QB 4DR4F 5MAOA 2LDIA 4DUYF 4NXMF 2R7VA 5J1EB 2HWIA 2J76E 4RBVA 4WTYA 1W2BR 3DYAA 4QPTA 4A48A 4AXJA 5HP1B 3R27A 3UCGA 2CPDA 1R31A 4DFPA 4KKOA 3V6DB 4IH5A 2JJ4D 2ZH2A 5DGBA 4QR0A 3PV8A 3TVYA 3FSXA 4DG1B 1SXLA 3DN9A 4O3OA 4RUAA 2DO0A 3X3UA 1RKIA 2EI5A 5DQGA 3EGWB 3FFIA 2MZTA 3OPKA 5E3PA 4X4UA 1C0UB 2KYXA 3T9NA 2MKCA 3OR2A 2IC3A 2BM0A 3DHXA 3EXCX 3G6YA 2ZH6A 3QIPB 3BN4A 1ZTTA 5KFJA 4DR2F 1MMLA 1R3NA 5KFBA 1FE4A 4WXWA 2XI2A 4O0IA 1UVMA 4WK1A 1U49A 2HZCA 5KFMA 1WEXA 2K1RB 2RJZA 3PJWA 4ECQA 3KMQA 2YKAA 3MMAB 4HI2A 3K2YA 2KT2A 1C1BB 4E98A 4OZ1A 4FZVA 2DNGA 1IKWA 2F4VF 3NP5A 2XMKA 1S9EB 2VFSA 4L72B 1SC6A 4CTAA 2W9BB 4N76A 4WFZA 3RAXA 5J2NB 4I2QB 5LJ3Y 5CD4H 1B0TA 2E5LF 3VWSA 3N5FA 2LCWA 3BB5A 1U1RA 3GSDA 2A3JA 3IRXB 5A2QY 3CJ3A 2RS2A 5D4LA 2RQKA 1U1KA 1XEZA 2DNLA 2QLXA 2PDAA 5THWA 3FSIA 4JI4F 1Q82T 4CT9A 1K1QA 2Z2MA 3MWBA 4IG0B 2ZDOA 2ZH4A 2XB2D 2YKMA 5AXKA 2J0WA 4IG3B 2AGOA 5C42A 2FHJD 2ZH3A 3RRHA 2AX0A 5KFEA 2NUUG 2R2SA 4AXIA 5J2MB 2CQIA 4YDDB 2GIQA 3HHDA 2MKJA 4CCHA 2Y1IA 2CJAA 5DLGA 3HI9A 2ZOFA 2RKIB 3M6UA 2KHDA 3CD5A 1JXEA 3LUYA 4NPOA 3S1TA 1REVA 1OPZA 3HHEA 3CEDA 1I6JA 3I82A 4OV1A 5A8KA 1X4GA 2HS4A 5KFDA 3TI0A 1FNOA 5KT5A 1Y9OA 1OPIA 1RT5B 2NLWA 3MR5A 4RW9B 1HMVB 1LKZA 3H59A 4OX9F 1FXDA 2YNGA 2U2FA 2Q43A 2WRMA 2XO7A 4WFBQ 2VONA 2V4RA 2W8LA 4C3KA 1WF2A 2DGUA 2FJAB 4ZA1A 1Q7YT 3BSCA 2W24A 4BS2A 3DRYA 2VC0A 5H9EJ 2WSEC 2N7YA 1DURA 1N5TA 3R1LA 4DFJA 3U27A 2IYIA 1NAQA 4YR3A 2CJ9A 1ZTWA 3DOKA 4LQ3A 2Q66A 1XR6A 3C46A 3HVTA 3V81A 3JSMB 3MECB 2E1RA 2QT7A 2OPQA 5GVQA 1VJWA 5GAEI 4A8YA 1IBMF 1XNQF 1SIZA 2JH3A 3US5A 4F4YA 4EYHB 2BQRA 2ZZMA 3I96A 5J2PB 5KFRA 5DJBA 2RT3A 2ZJQQ 2LYVA 3OW2R 2BRLA 2IM2A 2B5JB 4ID5A 2YX1A 5CYQB 2O5DA 4NLPA 5K8MA 4IR9A 4LMZA 4NYZA 1HBNB 3CTRA 4JBCA