2QA4G

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
126
structure length
125
Chain Sequence
RKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLEDLNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVPNDIVIPEGDTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
molecule tags Ribosome
total genus 13
structure length 125
sequence length 126
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00466 Ribosomal_L10 Ribosomal protein L10
G PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qa4G01
1ZAVA 1ZAWA 2QA4G 1ZAXA 3JSYA 5GADI 4V19J 4NWBA 5GAEI 5GAGI 5GAHI 3A1YG 3J7YI 5D8HB 3J7Z5 5D6GA 4UY85
chains in the Genus database with same CATH superfamily
3DI6A 4MAKA 4ZP6A 3W9IA 4PXEA 1HWLA 2Z56B 2R7SA 1VLOA 2Y0SD 3JQJA 4W90B 4YB7A 1Z4UA 1TL4A 4R8UB 1SQGA 2YPZA 2AT1B 3QGGA 3QIPA 5ADZA 4FYYB 3TJAA 2UUCJ 4YN3B 2QSFA 2W2NP 1TU0B 2Q6CA 2YY3A 4A8WA 4WKRA 3H5SA 5HQ8A 4M94A 3JYTB 2J8SA 3OXGA 3DRRA 1VC5A 5J1EA 2QTWA 5KFSA 2MZSA 4KBIA 4FYVB 4U8YA 3VTIA 2H51B 2IFXA 2GJIA 3BO3A 2AD9A 3TVZA 4U67Q 3V6JA 2DHSA 2XHCA 4USJC 4X62J 4IRCA 3P5TL 1SC1B 2I5JA 3GYXB 2R7XA 1BHNA 5J2PA 5IOLA 3P3DA 3FSIA 2XG8A 1IKVB 2FPHX 3EVOA 2ZE2B 3GWCA 4ECRA 2KM8C 1C1BA 1R3NA 3TEHB 3M05A 1IBKF 2CPHA 1JLCA 1EETB 2VONA 1T03A 4ZCKA 2OO4A 4M95A 5EUHA 2UVVA 3W66A 4F26A 2JH3A 3EUNA 1PBAA 4DI6A 1OMSA 3ENAA 1QAJA 1O5JA 4HH0A 3O6QA 2HQIA 4DV1F 1IR1A 2ZOFA 3QJPA 2GQCA 2H5IB 1WI8A 3QSYB 3A1YG 2W7AA 3N5BA 3D3CJ 1YJTA 2LA6A 2M2BA 3NOGA 5AJ3J 4RUBA 1DLOB 4LIRA 2J6TA 1J5EF 1F1BB 1UJ4A 2H5JB 1B99A 3OVBA 1Y11A 3M2VB 5AE3A 1HR0F 3OXFA 4JOUA 3R2CJ 3MOJB 3UN5A 3VGVA 3R3TA 3C2PA 3ITHA 1OYEA 5CHCB 3SQGA 3OTOF 2X7IA 2VFTA 2ZHOA 2OGUA 2MQQA 1HBOA 4LRCA 3CUNA 4WXWA 5MLCV 4C3KA 2W25A 3RAXA 3HO1A 2LXIA 3EZ5A 4OIXA 1C4CA 2B9WA 1HWIA 4N7TA 3VQTA 1SH0A 1CULB 2W9CB 2E5GA 2D3O1 3LP2B 4KH0B 4LBPA 4WTOB 1HQUA 3I0SB 4K4XA 1RTDB 3HSJA 3UD3P 1VRTB 1M1KT 1P27B 1QM9A 3T41A 4PWDB 2AJQA 1J5EJ 2NYIA 2C42A 3BH6B 1Q5YA 1R8HA 5J2NA 3K57A 1HR0J 2FJVA 1RHRB 2OPQB 1QAYA 1GXLA 2I38A 1CJUB 3BF4A 5I3UA 1TUWA 2GS8A 4N47A 3SSQA 3OTOJ 1JJ2R 1VBYA 2LU1A 1GTHA 3LP1B 1S0MA 2ASJA 2UXDF 1K8AT 1VQ6S 2ZZTA 1SJ1A 4N8OA 3RBXA 1RCOB 4ICLA 2GVZA 2V8HA 3EPGA 1RWWB 4HTJA 3ZTQA 1IR2A 2GZOA 4M5MA 3NNHA 1RJJA 3R6LB 1GK8A 4CIOA 3D28A 2IPOB 2DGUA 4MIWA 2Z57B 3W64A 5L38A 3M8YA 4I6WA 4IFYA 1S1TB 4I2PB 3CIZA 5KFYA 2B4PA 4ZP9A 1S5ZA 1Q78A 1VK3A 4BHQA 1K9MT 3BN7A 2QG9B 2CQ0A 1KD1T 2YXLA 5K5MA 1I1GA 4UOCA 3RGIA 3GILA 3DMJB 3H5UA 2BV3A 4NXNJ 1S77D 3M8ZA 2WOMA 1Y7PA 2XBPA 4X66F 2IVYA 1JLAA 1S6UA 1UA0A 4B3MF 1A7GE 1TTHB 1J2VA 1FWPA 1VLYA 2UXDJ 2XWYA 3CJ2A 4JV5F 3JSMA 5J2MA 4F4KA 5LXYA 2FLPA 5A8WB 1LNQA 4JI1F 3GTYX 1Q8LA 1MNEA 4B3OB 5RUBA 1WC6A 1HHSA 4Z7CA 2HQFA 1LWCB 1X5OA 5G0RB 5IT0A 3QJJA 3GB0A 2BE2B 5D77A 1FFSB 2O67A 2QFJA 3MECB 2KXNB 2MKSA 4K7QA 5HROB 3BYPA 4BWMA 3U02A 3UO0A 3J81j 2PT0A 1SCJB 4GVBB 2V34A 4WP8A 4G1PA 1BQNB 4X66J 4FF4A 5A2QY 4CM0A 1H3DA 4NLTA 4B3MJ 2MB0B 3D0IE 1CC7A 4IH7A 4MK8A 1RBOB 1SKWA 4ZKAA 3LA0A 2RUGA 1VRQC 5HATA 4X4SA 4UTGA 4JV5J 4I2QB 1HNWF 4JI1J 1IKWB 2VL1A 2HK2A 2CQIA 3GZ7A 4FS2A 1BMQB 4ZP8A 1S6PA 4DV3J 4JV1A 1U1MA 2P2CB 2VV5A 4LRDA 3HZGA 1NJZA 3KLGB 1YJRA 4JI5J 3MEDA 2JRSA 2B4OA 3CT9A 3WIVA 1FKAF 5SUHA 2QA4S 2GJ2A 4DR2F 5IQ6A 1WDTA 5JXSA 2IJNA 1TFYA 5T7LB 3MR7A 2ZE2A 2JSXA 1PC5A 1JLBB 3Q8PB 3W2WA 2ROGA 3RBDA 2CNLB 2DGQA 8ATCB 2GHVC 3PYDA 3MPYA 1NMEB 1CG2A 3CCVS 1S1WB 4AD6A 1T3NA 3GYNA 1UVNA 4DR4F 2FJEB 2MQ8A 3HJFA 5FIIA 5CYQB 1RI7A 1IM4A 3FNNA 4K5SA 1HNWJ 1IJFB 5AE1A 3Q89A 2QYCA 3PR5B 3MF5A 3TQ1A 1QDUB 2IAJA 4ERDA 2QLBB 4O4GB 3TUJC 1JLGB 2ZVIA 2BXJA 2GMJA 3M2VA 3K0JA 2DRAA 4DV4J 1IM6A 2Y1JA 4F4WA 1MN7A 2W4PA 1ZPWX 4LREA 1NK7A 1YI2S 4IQMA 2Q66A 2Q6BA 1RWVB 1HL6A 1WHVA 1UVKA 3B8HA 1SKSA 1HWKA 3CCWA 4MJKA 3EGNA 1N6QB 2J76E 2LEAA 4NLYA 4PXCA 4ECSA 2KZZA 1PIEA 2GIQA 3EZOA 2V4JB 2CRLA 3SBMA 2C2RA 2MZ1A 1NNDA 2W9CA 4LVOP 1TK5A 4NCGA 1Y5NB 2R42A 2Q43A 2DITA 3CJQA 3I0SA 1L3KA 1RTDA 3B6BA 2DB1A 3QSIA 4RW7B 1VRTA 5D15A 2F7VA 5LL6d 5HLFB 1AYEA 3IRXB 4P71A 1U24A 1ITPA 3AXMA 2NPIA 4K50A 1U8SA 2NREA 4UOFA 4L73A 2D1CA 3D67A 1N0VC 1KC8T 2OPQA 4V1Ak 3W8PA 3TVKA 3KK2A 5IC4B 1FXRA 4CT9A 1OQ3A 3PEJA 1RWPB 1VISA 3O44A 2PO4A 3LP1A 3MCOA 2W2MP 3HVTB 2DGOA 2HIQA 1YGYA 3DDIA 2ZJRQ 4DG1B 1FE0A 2KJWA 3AQOA 1S59A 4KH1B 3IGVA 3KLIA 2OPPB 4C4WA 1LW2A 2ZH3A 1S1TA 4I2PA 3HHKA 5L9NA 2H5EA 5A8KA 3PCOB 5KG7A 1T05A 2FZKB 3MMBB 2DXEA 2GO8A 3RYLA 2P9GA 1TL5A 3D1OA 2MY7A 2HVZA 1ZYQA 1MMDA 2RQMA 3ILOA 2K1RB 1YRTA 3AD9C 3HSDA 3MR5A 3L95X 3AJ1A 2JWNA 3KOAA 2ZH8A 1U49A 4WWSA 3MUVP 4U7UD 5FD1A 3BM7A 1X4HA 1SI9A 2YKNB 5A8WA 3TQEA 4ETZA 2CIMA 4B3OA 3IM9A 4DF4A 5G0RA 2ZZMA 1BQMA 2WRMA 2BE2A 3ZFVA 2A2DA 5E41A 3MURP 5LSLA 3H5XA 3HLUA 3MECA 2W01A 2MHEA 3F0NA 4ED3A 3DOMB 2GVDB 2X3DA 1RISA 2BJ9A 4NZ7A 5FLXY 2VBZA 4OX7A 1T8EA 3K59A 1N33F 4PXDA 1S6OA 2K3KA 2WTFA 1SH2A 3TUZC 2KO1A 1D8ZA 3GJSB 4RW9B 4PG7A 5KT2A 1GQEA 2CZ4A 4R5PB 3OSNA 2QL9B 4IDKA 4DFKA 3THVA 5HP1B 4KPYA 3PYEA 1WG4A 4F50A 2JZ5A 2ZFHA 3D6MB 2LEPA 1HNVA 1C0UB 2DNLA 3NCPA 5KFTA 1IKWA 3I82A 2DKOB 4Q44A 4F2RA 3RAQA 2DR9A 1ZAVA 3Q2TC 2CA9A 2NXJA 4E98A 1G3OA 4C0OC 3PIPQ 1AB8A 2ZDOA 3KLGA 4MK7A 2JL9A 1X7VA 3CD0A 1XR6A 1DQ9A 1W2BR 4UY85 5CABA 1X4BA 4DV7F 5T7LA 4PXBA 4ZVRB 5ETRA 2IC3A 4F02A 2HFSA 3OVSA 3MPUB 3RW6A 4OYAA 4A8KA 1N33J 1F5BA 3DOKB 4KKOB 4G1QA 3KJFB 4ZLJA 2XI2A 1S1WA 4HI1A 3C46A 5M2UA 3LQVA 2VZ9A 1BQXA 2CQGA 3R97A 2FVRA 3D1QA 1UVJA 2CWXA 4CWBA 2PC6A 3G96A 1DFDA 4XO0A 2I6WA 1XN9A 1WKJA 4EO6A 2AKWB 5I3PA 3LW5C 3OR2A 2UVRA 4ZPBA 3UR3C 4O4GA 1SC6A 3M6VA 3CULA 2AQ4A 1OQ6A 4GKJF 3NY0A 3W5ZA 2P6TA 2Z2LA 5LMNF 2ZKTA 3R9LA 2HHSA 2A6OA 4IYQA 1S76D 1HPZB 4URSA 3L7PA 2XB2D 1MLAA 1N6QA 4ED1A 1WF2A 4RU2A 3OL7A 4R25A 3MR2A 1M5OC 1NDKA 2XYGB 3BGRA 2HLUA 3N6NA 4BWJA 2WVDA 1SKRA 2EC2A 2W9BB 2AGPA 2VQFF 1FCAA 4NLDA 5HQLA 5E33A 3IRXA 1NLKL 2EWHA 1OY6A 4LFBJ 2F4VF 2FQQB 2QO3A 4TVAB 2GQ2A 3GR1A 3L3CA 2OELA 4GMKA 4GKJJ 3H2LA 3MMCB 1HQ2A 2KG0A 2DCLA 3MM5B 5DDPC 2CJKA 2F5GA 1ZM3A 1TV6B 1ZTTA 2FVQA 1YZ7A 1EARA 2MLZA 5LMNJ 1KQFB 4O3OA 4FYXB 2XZWA 3VF0B 4KFBB 1E6VA 1KFDA 3PNIA 3HVTA 1RU1A 4B9UA 4A8YA 3IWNC 3HSGA 1U1OA 5H9FK 4NYPA 4DSFA 2DR5A 1VJWA 4HACA 2P9CA 1H38A 2R2RA 5DGAA 2YWEA 2HNDB 1KONA 2OPPA 3N9UC 1HARA 4FXWA 2UU9F 1RHKB 2EFGA 4Y00A 2HGNA 3DLGB 2CJAA 2BJEA 2R7VA 1RWKB 2Z58B 3HHNB 3FVYA 2HFUA 1YJWS 2F4VJ 1KP6A 1FDDA 4F04B 2FGOA 1BWEA 3IO1A 2FY1A 4LR9A 3TA1A 3RB4A 3F41A 3KMSA 4LF9F 3NKYA 4ANCA 2UUWA 3GCXP 2ZD1A 4KHMA 1RT5A 4CO0A 2R2TA 4C8ZA 2GAGC 4I7FA 1RHMB 4EZ9A 4PQUB 1CEZA 4J9RA 2R2UA 2AZ1A 1QLNA 2B8QA 2B9XA 3S8SA 3PFEA 3B78A 1R7IA 3DU6A 2CJYB 3FCWA 2XMKA 3OT9A 1P1TA 4ZPCA 1R0AB 2XSJA 3LGMA 2QEXS 1IR0A 4RW9A 1M90T 5T41A 2M88A 2N3OA 4JUZA 4LUBA 1UW4A 1U02A 4ZVTB 5HP1A 4IH6A 3CWJA 4LF9J 2J7KA 1XBWA 5B0CA 1B0TA 4X4UA 4G1IA 2ZZNA 3AAWB 4X4VA 1WC1A 1TP7A 4JYAF 3BGFA 2QGFB 2VFRA 5I4MA 3NBPB 3VAFA 4Q5VA 2ZBRA 4R0JA 2B9YA 3M2UA 4LBIA 3I0RA 3O3LA 3UDVA 4DQSA 1S9GA 1RT3A 1U2RA 1RA6A 1N5YB 2IJFA 1RT6B 4RR5A 2HHHF 3TVYA 1S48A 2QN6B 3OPKA 2OD6A 3Q8UA 3DOKA 1WNEA 4KKOA 3T6JA 4QW9A 4DV5F 5B0AA 1HQEB 2FY8A 2ASDA 3C8YA 5T14A 5ITHA 1Q1KA 1R8PA 3U1MA 5IC6B 3US5A 2GC8A 1G6BA 1B4SA 1VRUA 2UVWA 2P8IA 1BXNA 3EM1A 2R8GA 1WKLA 4JYAJ 1SL2A 3FDSA 3QGHA 3MFIA 2J6UA 5I42B 2C3PA 1VQ5S 2R7QA 5DO2A 4FF1A 4CTAB 4JI3F 4EO8A 3C16B 5IM0A 4A48A 3I4HX 1QAXA 2DHXA 1H0HB 4I68A 1ZA2B 2WVCA 3MM8B 1WOSA 2CJBA 2MQPA 4IG3A 4ENOA 4UOGA 2XNRA 4LF2A 4OX9F 2PSZA 1RQ0A 3V4IA 4W98A 3HJVA 4NI2B 2HVDA 2UUTA 4YOEA 2NXNA 3VV2B 2R8KA 4DV2F 4FF2A 1RHJB 4ALZA 2ZH9A 3PX6A 4L75A 2XGPA 2E66A 1YITS 3FEZA 5F8HA 3OTDA 4OJHA 1MROB 4MKYA 4G6VB 4LSZB 3SCKE 4DQRA 1NPPA 1PAUB 4QWBA 4QIWD 1FNOA 1NM2A 2PA8D 3MMCA 3GJQB 4KHPJ 2Z2MA 5J2QB 4ZHRB 3MM5A 5GAEU 2B8PA 2CFXA 2MGZB 4EWTA 3GIIA 1WHYA 1HFEL 4JV0A 1PYSB 1EB0A 2V69A 4OX9J 3MD1A 2LLZA 1WF0A 2KT3A 3CDWA 3QRRA 4P2MA 7FDRA 4J90A 2J0WA 4NA3A 4KR0B 2MYFA 1NK0A 4QYZK 3DM2B 3H98A 4KY3A 2CPYA 4OV1A 2HNDA 3BREA 3MM7B 3T5LA 2VA3A 3P8BB 1SBRA 3MUTP 2HQGA 3DLGA 3TA0A 4B9LA 2QL5B 1FVSA 2GIRA 1VHIA 3K2YA 4IH5A 4QIFA 3O2IA 2HWIA 4Y65A 3OXLA 3HFZB 1RWOB 4C3MA 2LQ8A 3ET6B 4OZ5A 1MN9A 1R0CB 2LFVA 2BM0A 5GAEI 3NS5A 2DNGA 3H59A 2HGLA 3A3NB 3R5JB 4HR2A 5GMEA 2ZKUA 4WPAA 1FXDA 4BC7A 3CD5A 1FD8A 4RUCA 4NL5A 5JVHQ 4F4YA 2L41A 1YWXA 2D74B 3VQSA 2DHAA 2VPWB 3DCAA 2XTJP 2NR0A 2BRLA 2GMHA 2OEJA 3EPIA 1U1NA 4RW6B 1UCNA 3HFKA 4QIEA 1KLNA 1TKDA 2CQBA 5B0DA 4PQUA 2GHWA 2WZ1A 2IM1A 4K4VA 3OUYA 3WX8A 2J0XA 1FRMA 1SVDA 1JNZB 1UPPA 1P6TA 3RR7A 2LXUA 1UA1A 5KOXA 2NXCA 3AY0A 5A6PA 2RKIB 4J9PA 5D4NA 5IWAF 4JI7F 3DGPB 3PACA 5ETLA 4ED8A 1BLUA 2I8EA 1NZAA 2YNGB 4B3SF 3CCQS 4NMXA 5C25B 4M5GA 2EFVA 2O3DA 4HVZA 3MEGB 2YWGA 3V6HA 2RUSA 3M9MB 4Q2MA 1JLEB 1FTRA 4PUOA 4KB7A 4KGVB 2MPUA 2HQ3A 2JEIA 3J81Y 4WTYA 3NBPA 5BR8F 3I9V9 3ISNC 2E1AA 2LCWA 3BQ0A 4ILMA 1F5AA 2GGPB 3IMQJ 1SJ3P 2JDJA 9RUBA 5E2QA 2XLJA 5IV4A 4I4BA 1N5YA 2CJXB 4F3MA 1RT6A 4JI7J 3B4DA 2P5VA 5D0EA 5ETTA 1DTQB 4B3SJ 1RZMA 4JI4F 1HQEA 1IKXA 1CQNA 3GLJA 2J9CA 3RR8A 3J7Z5 2GAHC 3IBCB 5D0RA 1TVRB 3M6UA 3FJ2A 4RW8B 2ZJPQ 2CDRB 1URRA 4NA1A 1Q79A 2R2SA 1NDLA 1RHQB 4URGA 3GFHA 2K3IA 5ETKA 4ZCIA 4ZVOB 1KS2A 1VBXA 3W62A 3CCJS 3QGPA 5I42A 1NH8A 3BH7B 4ZVHA 4TQSA 4K0KJ 4NXMF 1LWFB 4HEA9 1R89A 4DPYA 3W63A 2PN6A 5KT4A 1IBLJ 3A3PB 5HAOA 5L39A 1TMMA 3WX4A 2CPJA 3JTNA 5LOQA 5CD4A 3G86A 2YWKA 4RL1A 4PYAA 2O1PA 2C3OA 2F65A 3H4DA 3MUMP 1MU2A 1FD2A 2J7UA 1KQGB 3SXLA 3KNAA 5C7PA 1N54B 5HMYA 2QV6A 3FBBA 1TL7A 4PEOA 1A0OB 2ATLA 2AYBA 2X1BA 3RB0A 4DSEA 3J80U 3S7RA 2POKA 4C8MA 4ED4A 4GO5X 1CLFA 3NAHA 4N8NA 4RZRA 2HYIB 5DJBA 1MROA 2KG1A 2G1HA 2F4FA 4NXMJ 4F2SA 3Q8QB 4WFAQ 1EX8A 4P52A 1RACB 2RVJA 2FJWA 1D09B 1MSWD 4A4JA 3PIOQ 3NNAA 3K5PA 4MYUA 2MGZA 1L3UA 3CCLS 3CJKA 1VQKS 1QD1A 4U95A 1CJVB 1SKUB 2DNYA 4A8QA 2CQ1A 2XM3A 1Q5VA 4LFCJ 4AUKA 2ACYA 3H90A 4ELTA 2AEMA 4LF5F 2RU3A 5K14B 1S9EA 1NU4A 4TYBA 3MM9A 5KFWA 3RTVA 2XCPA 3DM2A 1L3VA 2EI5A 1TQLA 1NBEB 4ZPVR 1RTIA 4OI3A 4DPTA 4RW4B 3U1LA 1FJEB 2YWFA 2KJVA 1NDCA 4E0DA 4WP3A 1KQKA 1M1HA 1VS3A 3SZ2A 4O3RA 3MPWA 3N79A 1CPZA 4Y2AA 1M5KC 2BKNA 2D9OA 2HHPA 5LM7E 2BMBA 3NEKA 2Y8YA 4WF9Q 5AT1B 2GQQA 4NLQA 4A8OA 1M5PC 4FBUA 2Q79A 1T11A 3W2VA 1RUSA 3ZO7A 3MEEB 5KFIA 3HDSA 1VJQA 4Y6IA 4K4YA 3GU0A 2JEJA 4X4PA 2IMWP 1IKYB 1NKCA 2GCFA 1JQGA 1OPIA 4HTIA 3I5CA 1WORA 4QYRA 3CDAA 3MAAB 2W2OP 3M7VA 1WJ9A 2Y9HA 2DVIA 5E3QA 3DRXA 1U2FA 4QYZJ 1LWEB 4TU8A 4ER8A 2CWKA 3ZZZA 2R8JA 2B6AB 4OHZA 4WXOA 5KFBA 3DLHA 2XEXA 2RKIA 4NLPA 4JI8J 2HKEA 4UQTA 2V0NA 4C2MA 2UXCF 3N4WA 5L8RC 4QBUA 4NWBA 1UZHA 3EMTA 4OZ2A 3M4XA 1NEEA 4YEAA 2HHXA 4DZ6A 4RNOA 3HHLB 2YNIA 1U6FA 4O3NA 5C25A 4JI2J 1GMWD 2IRXA 2HQCA 1OO0B 1OPZA 4RWXA 3ETMA 5THWA 5SZTA 4B9TA 4QQBA 1R0BG 1WHWA 1VMBA 2YVSA 3VR1A 1MWZA 3CCMS 1WEXA 2HS0A 3FCHA 2CQ3A 3ZC4A 1JXEA 1OY8A 5DZ7A 3ZZPA 1MMLA 3BKFA 1U2CA 4I67A 2GMLA 1HNIB 3K5OA 3JTPA 3WC2A 2FC9A 4LR7A 1RAOA 1Y00A 3BKTA 3GP9A 3UVJB 2BABA 3M6WA 1KSPA 2QLFB 3ZTRA 4N76A 2MLYA 2DY9A 5HBMA 3PJ9A 3UD4P 5M2PA 1DTQA 3GV5B 1F60B 3OFEA 4YHHJ 4C0BA 4YB1P 4EUVA 4QPXA 3MTJA 1TVRA 4RW8A 3OVAA 4O4RA 4ES1A 2YNFA 4ZVGA 4OZ1A 2DNRA 4CNYA 3C19A 4M5LA 2N3LA 4MMOA 1BWVA 3THPA 2ZC4A 2V5HG 2DD8S 4LQ3A 2EFPA 2DJWA 5L1KA 3SCLE 3ULHA 1VQOS 1HBMB 1NK8A 2UV8G 2WVEA 4NX9A 3R5BA 4CYUA 2ZHAA 2RMLA 3TYTA 4AXJA 2XS5A 3QWPA 1RWNB 4ED6A 1FRIA 5JMNA 3BBFA 3WDOA 2JEGA 1UKUA 1WHXA 1LW0B 1NJXA 2B56A 3W5YA 3QZ7A 4N56A 3HM9A 2EFOA 4LF8F 4P74A 3HFVA 3E01B 2BJ1A 2ZNZA 4UOHA 2HRYA 3DDKA 1JLQA 4OYXA 2FLOA 2NS1B 4IFVA 1HBNB 1BUXA 1KR4A 5H1SV 2KXHA 3TUIC 3KJNB 1HLWA 4RJVA 4UUXA 3SDEA 3ENVA 3ZZUA 4OQJA 3T5HA 4O0IA 4UW2A 1WC3A 2DNOA 4X84A 3E2EA 5HSPA 5HJYA 4PG8A 1CJVA 5KFOA 3MFHA 2VC1A 3ENWA 5BYQA 3OSPA 3V4MA 1TKTB 2H3EB 4QIGA 1VC0A 5BXIA 1YJUA 3IR6B 2X51A 4X4TA 3KFWX 4P2FA 4LRBA 3KK3B 1LQ9A 1RAFB 5LT5A 2DHHA 3NCRA 4DMZA 1CSJA 4RW4A 3DRSB 4Q8FA 1KVJA 1UEUA 3I32A 5FDLB 1DY3A 1XNQJ 4Q7AA 4DUZF 3E51A 2DGSA 3CEDA 4EMDA 1UFLA 2CPDA 2W1BA 1D9AA 4WFYA 1GMUA 2EG2A 3PX4A 1PG5B 4WK1A 1D9FA 1CJKB 2GFFA 2PFFB 2PE8A 2FHJA 4PAAA 5AE2A 1FEHA 3SFUA 2AGOA 4ZLLA 3ISND 4WP9A 3T1HJ 3POTB 1XR5A 3FBFA 4ED0A 1IKYA 2EBGA 3EE3A 1Y4ZB 2EPIA 1RXOB 3OLBA 3QNWB 5ETSA 5C42B 3R8YA 4IOCQ 4NLWA 1EP4A 4DV6F 2HG4A 2WCXA 5HL7Q 3FC9A 1HKAA 3PXGa 2X1FA 2B6AA 2QMWA 2UUAF 4P73A 1OSCA 3CCZA 2HZCA 4ZK7M 1ACMB 2ABYA 4DUZJ 1HYSA 1CS4A 2B4UA 3G6ES 2W7OA 3T19A 1MWYA 4ES3A 4IUFA 3HD2A 1FT8A 4L6V3 4TY9A 1GFWB 4CLZA 2ZH2A 2J6SA 3FEXB 4O3QA 3C6UA 1YRXA 2MZTA 2MZRA 4Y28C 4CRJA 1BY9A 4UQGA 3DRRB 1HWUA 3DOLA 5J1EB 1VFJA 1KTQA 1SH3A 2K2PA 1K0TA 2OSRA 4BS2A 4DR3F 4FS1A 2RH3A 2IIHA 4CLWA 3K89A 1YSJA 4I6AA 2ASLA 1URNA 4Q8EA 4DFPA 3GYGA 5J2PB 4Q0BB 3Q22A 3D6FB 2DGWA 2WBRA 4DSIA 4KSEB 4CLSA 3P4UB 1T0TV 2UUAJ 2Z2ZA 1C1BB 1RYSA 1LFPA 1U45A 2Z4PA 1QUVA 1WUUA 2RF2B 2L9WA 1JLCB 1T03B 5M2RA 2DBBA 1UW9A 4RPFA 2CQPA 3HVRA 1Q4RA 4Z37A 2YBVA 2JFDA 2CKWA 1YHQS 2C2OB 2V8PA 4TU9A 1NHUA 2RQCA 3HULA 3IR5B 3CDUA 4KT0C 2MLXA 3FQLA 4N41A 4DR3J 3FFIA 1FWLA 5IZHA 2EVZA 1T9XA 2V2ZA 4OX6A 2HVHA 4Q43A 3PZPA 1A9NB 2BUNA 1REVB 4M5DB 4PG4A 2B7CB 5DG8A 1T3OA 3ITHB 1LK5A 3M1VB 2ILZA 3SQGB 2DNZA 2ADBA 4LJMA 1XERA 5A8RB 3QFWA 2MZJA 1HBOB 1ZH5A 4P6QA 1OWXA 2ZOGA 4OL8A 1MW7A 1DTTA 1RT1B 1FKOA 1F3VA 2COLA 5HI7A 1X9SA 4DX8H 1CQMA 1HBUA 2HHQA 5IT9Y 4NRTA 1HQUB 3FEYB 3UR0A 1T95A 2HGMA 2FZCB 2IRYA 2DR6A 3AQPA 1NJYA 4O44B 6FD1A 1S1UB 1FWKA 1WSRA 2YNHA 5L1JA 5J2NB 4H4OB 1N88A 3RJMB 2WAQD 2IM0A 4OYPA 1Y10A 3PTWA 2PIIA 5I3UB 1AFIA 4ED5A 1UWBA 3H5YA 4J5OA 2MTLA 2B3TB 4OI2A 3Q86A 2PD1A 3EWGA 3LTOA 4ICLB 1N5TA 3CPWR 2DIUA 3DLLQ 2MQOA 4JI0F 1C2PA 3GPAA 2BEFA 4PZVA 3SV3A 3K58A 4XAKA 1T9YA 4U8VA 4J9SA 3HF5A 3QIDA 3NWRA 2W9AA 4B9MA 2UUBJ 3PW5A 5F8MA 1U8WA 3NG8A 4ZVPB 2H1YA 3DRSA 2PEBA 4OZJA 1CBKA 4KO0A 4EBEA 4TYAA 3IXQA 5B0FA 2DEIA 4NLOA 4Z2XA 1N52B 4FN5A 3VAHA 2RQKA 4IO1A 2WOMB 4X64F 1NK6A 3GFZA 1JLAB 2W8LA 4HI2A 1G4CA 3CC2S 2W24A 4WZMA 1NH7A 3G6VA 4USHA 4DS4A 2CDQA 2YQ3A 5B09A 4FPIA 2OH2A 2NCKL 3M2RA 1KLMA 4G3IA 1IQZA 3NMRA 3P45B 1YBUA 3FMBA 4JI0J 2EC0A 2VFUA 3IBFB 4CNZA 1FDAA 3BPSP 2MZQA 3J7YU 2XMJA 5C42A 1R43A 2B7BB 5JVGQ 3I6PA 1U6ZA 1IBCB 5KT3A 5EWGA 2Y1IA 1S57A 4DR6F 2XMUA 2E5LF 3KXDA 4LR8A 1EIYB 4ZCLA 5G4DA 2DTJA 1N8RT 2VBWA 1XMOF 3QAEA 1QTNB 2V4RA 1W2IA 3VGUA 3RW7A 1JLFB 3C14A 2EBEA 3OL8A 4U96A 4CO1A 4DL5A 2UP1A 2FYXA 3MPVA 2WB1D 1R8BA 3G2XA 4MYTA 5D4PA 3M8WA 3J7YI 4ZVFA 1WKKA 5LSOA 3MMJA 4RBUA 4LF6J 1B7FA 1S6PB 1U1QA 3KUGA 4RNHA 1QUPA 2KHCA 3MEDB 4NLVA 2ZVSA 4Q0BA 1S4EA 3KDOA 1FEEA 1JIHA 1HD0A 4DR6J 2E5LJ 1B64A 3P96A 2HSEB 1APSA 4ILLA 2LVWA 3QT7A 3W2WB 3VVTA 8AT1B 4DX5A 2RF2A 1YZ6A 2HFOA 3UPFA 1XMOJ 1TUVA 4AL6A 2IYIA 4TXSA 5KG6A 4UY8T 4ZIVA 2HBQB 1FX2A 2OD4A 1JMTA 5K20B 2BM1A 2ZUAA 3CCSS 2NUHA 3OL9A 1REGX 3DLBA 5E3CA 2HQDA 3KG0A 3NGUA 1CC8A 3HD1A 3BGLA 1RAGB 3LALA 3R7BB 1TL3A 2IAJB 3HPOA 3I5AA 4ZLPA 1RB0A 2V8VA 1REVA 4M5DA 4HYKA 4K4TA 4RU9A 2LEBA 2CJ9A 3M1VA 2Y8WA 1U47A 1OIAA 1T9TA 5DZ6A 4HT5A 5A8RA 3TX0A 4OI4A 2E7WA 5KOWA 2RS8A 4PCQA 1IBKJ 4DLGA 2YPYA 1F2HA 2E7VA 1NK9A 1KEKA 2N7YA 1RT1A 3GV8B 2BJ8A 2AYMA 4QZVB 2SXLA 1TR0A 4MKVA 5GVQA 1X0PA 4NCGB 5JJBA 1AUSL 4DV1J 2RRNA 4NLUA 5HQMA 2FUG9 1G1XA 1UTAA 1R27B 2OI2A 2YH0A 4FNHA 1K1QA 2HRUA 2AEJA 4B08A 1S1XA 4HLBA 4OHYA 2FLLA 4O44A 5E5NA 2MJUA 1S1UA 2AJ0A 1V6HA 4KGMA 4H4OA 2H54B 2HS4A 5D78A 1PCAA 3KK2B 4QWDA 3D9BA 3FKBA 2V67A 4EZ6A 1ZS6A 2NSBA 3CJ8A 3QRPA 1S0OA 3NMAA 2VODA 1K47A 4YB6A 4HHUA 4YP3A 2AU0A 1KBRA 3H2VE 2RIJA 3KLIB 1VYAA 3LF0A 1U0HB 2LQJA 3UCZP 2OEKA 1LW2B 3HXMA 4KJIA 2MXYA 4MKAA 5A8KB 3GJRB 4K4SA 2QFIA 1FRXA 1SIWB 3JAMY 1T05B 2MKIA 2OIHA 2DO0A 1Q82T 4Y2CA 3BR8A 4CO2A 5A0YA 4USMA 1S12A 3UWTA 1TKZB 3T9ZA 3DLEA 1D3WA 1N4LA 3BDPA 1YKWA 3IWXA 3K8VA 1VQ7S 5CD4H 3RZAA 4LSLB 3NLCA 4DCPB 4DQPA 4XDDA 4OHWA 5C2CA 4YS2A 1VQ4S 1XNRF 4CI0B 3NOCA 2FJBB 4YR0A 4IKAA 1BQMB 1DARA 4AL7A 3TW0A 2BJ3A 2NLWA 1YQHA 3TAPA 4E8UA 2CQ4A 3ELHA 5CYMA 3GFXA 1AT1B 2J9DE 2IBKA 3M8SA 4CLUA 1KHWA 2DHGA 5LXRA 4XK8C 5FJ4A 4M63A 9ATCB 4NYOA 4I56A 4LFAF 2E9ZA 1JLFA 5HJXA 4IDKB 2DR8A 1J27A 3IRWP 4X65F 3ADAC 3CCRS 1RBLA 1FK9A 5K8MA 1HNVB 2CPZA 2HBRB 3TUPA 3HHLC 1PSDA 1U7LA 2P6SA 5KG2A 1XNRJ 5ETQA 2BZ2A 2NUUG 2HBZB 4DHVA 4UF4A 3WZ0A 4P75A 1WI6A 2WSCC 1YG0A 1YBAA 3ZNUA 2YWWA 3I5BA 4DOZA 3PVXA 3N5FA 3P5BP 4L3KA 2E29A 2VF3A 3PJWA 1VQYA 2DNKA 1Q8IA 5J1NA 1K73T 3V6KA 3SEOA 2OFGX 1RT4B 3PJXA 3G87A 4BLGA 3OJUA 1NK5A 3VZIA 2IC3B 4KYZA 3CO0P 2MKJA 3R5DA 1JWWA 3MWBA 4G1QB 2ZH5A 4XPEA 2HFZA 4NZ0A 2DO4A 4LFAJ 2R8IA 1W26A 2M8HA 2UXBF 2DK2A 2KL8A 1U1LA 3DRPA 2VHGA 4USTA 1LFWA 3FSXA 4X65J 4YB5A 4CM2A 2XO6A 3JQKA 1NDPA 4FKXA 2HNYA 4CO4A 2FLNA 1SXLA 4DL3A 3OR2B 3RG6A 2VPYB 2OJ3A 2LQ9A 2M70A 4L74A 3GIKA 3MPDA 3UDCA 2HHWA 5CYJA 1NJWA 4DR2J 2ZOMA 1SV5B 3D7SB 3LH2S 3LANA 3S1TA 1Q81T 1N48A 2BE9B 3AXKA 2OPRB 1ZA1B 2XWXA 1RWMB 3QGIA 3V81B 2PEHA 3WQPA 4JV2A 3PRDA 3BGRB 4DR4J 4MK9A 1UVLA 4KV8B 2UVUA 2GNKA 2YX7A 3VWSA 2C2KB 2C1EB 2YX1A 4UZBA 1QJHA 2E1MC 2C3MA 3KUHA 2JOQA 4OYZA 1K0VA 1I94F 1B70B 2CNNB 1UP1A 4CCHA 2HEKA 3MAHA 4OZ0A 4CO3A 3PM9A 3Q8SB 1SJFA 4USIA 2OMOA 1E6VB 1N5QA 1VCTA 2AJ4A 4V19J 1KNZA 4LQ9A 3AD7C 1L3SA 1T94A 1XMQF 3RAMA 2NYHA 4DSJA 4HACB 2WB4A 4WK3A 5GMKa 2XLIA 2ZH7A 3NP5A 4F4XA 2AX1A 1U0HA 5GAGU 2ZNYA 4ELUA 2JEFA 2ALYB 3LAKA 3TANA 2IVMA 3BKUA 3UW1A 4ECUA 2GIFA 4MH8A 4HH1A 4M8LA 3D68A 3HVWA 4DV0F 2Z0GA 1FFGB 3A8EA 4HDGA 1I94J 2I0XA 2WONB 2EFNA 2YX4A 3DGVA 1TKZA 2VG5A 5IXUA 4W4MA 1RU2A 2EKYA 4ED2A 1RA7A 1HNXF 4CH0S 2HBYB 3FCVA 2QIFA 3KJVA 4LSLA 4A46A 2GX8A 5KG4A 5KFZA 1N32F 2ZD1B 1RT5B 2A3JA 1X4DA 2YKMB 4KGZB 1XMQJ 1S72S 3JXOA 4I7FB 3KJQB 3QAUA 5GAGI 2EEYA 3GFYA 3VAIA 5HMWA 3HX9A 4ZITA 4NEZA 4NLSA 4DX6A 4ID8A 4GRSA 2HRTA 3I56S 4PG5A 5KG1A 2R3VA 2M4MA 2DPIA 1QY7A 2VB6A 4B3RF 2XSJB 1J5OA 1WWHA 2B5JA 3OHBA 1V9OA 1VQ9S 4M5HA 5KFFA 4ECWA 4DPWA 1IWGA 4QW8A 2CPXA 1M5VC 1P9QC 1QVFR 1S7HA 4CO5A 4YQWA 3NNCA 4LIWA 3DFEA 3AB4B 2IRUA 2RT3A 3IA0A 1QE1A 1ZOTA 2HZAA 3K5MA 5D0GA 2AJFE 4EI2A 4ED7A 3M2UB 1SL0A 2F40A 3I0RB 3N6MA 3CCUS 5KTQA 1E6YB 1S0NA 2QZ8A 4B3TF 2ZH4A 1S9GB 4MKBA 1GXUA 1GEHA 1RT3B 2G0JA 2QLWA 5LJ3Y 2KHDA 1RT4A 2XY7A 4WKYA 4OZ3A 2OSQA 1NPRA 2L3MA 1O8BA 4IG0A 1XQIA 3UDLA 3PEHA 1MMNA 5KFLA 1RBAA 1FDBA 3PW4A 3OV7A 5KFNA 2HNZB 3R6GB 3W9HA 3G82A 4TLRA 4PRFA 2E9RX 4ZLNA 1I3OB 1VRUB 4DU8A 4NZ6A 1RAJA 3IWLA 2Y0BB 5KFGA 1SC4B 2RSQA 1VQLS 4EU0A 4BBYA 2M9KA 4ELVA 3J7ZT 3UE2A 2CXEA 3BO2A 2Y1RI 1M0SA 5IM0B 4K4UA 2CQHA 2KU7A 1RT2B 2X1AA 1SV5A 4B3TJ 4CQ1A 3EJMA 5GMDA 3BR9A 4WE1A 2XY6A 4FP9A 4DV7J 2XYPB 4IG3B 4ANEA 2XMTA 2JX2A 1EKRA 2OPRA 1EQ0A 2RDJA 3W60A 4M5NA 5DLFA 2ZBCA 1RAAB 3DC2A 3UQSA 4H4MA 4ZVQB 1U1PA 3V4IB 2UV8A 5DG7A 3V81A 1T9WA 2XMAA 7AT1B 4ZPAA 1KHVA 2RU9A 5L1LA 4DR7F 3V2UC 2VQEF 4JB8B 2DYAA 1N34F 1S6QA 2M7SA 1DJ0A 4FNIA 4LSNA 4ECXA 4KV8A 3RB6A 1H7WA 2DH7A 4AE5A 4KE5A 2DXFA 1HNZF 4CH1A 4DXLA 1XMBA 1Q0NA 2DGTA 1YK9A 1NJIT 1H73A 4U7UK 3AJDA 4TY8A 3KHLA 4NMLA 2NXUA 1TK0A 2E5HA 2MKHA 2WK4A 5DQIA 2VG7B 3AOAA 2IM3A 1IJEB 2NZ4A 2B51A 3VGSA 2EW9A 2W4DA 4PQAA 1H2UX 3KWMA 3D0HE 4TQRA 4TNOA 5L1IA 2JNJA 3IG1A 3KKFA 1CVJA 2FVCA 2VG6A 3IAS9 2Q1LA 2U2FA 2ERRA 2ZEJA 4C8NA 1NO8A 5B0BA 3TWZA 2HIYA 5CA5A 3ZXWA 4ZDNA 1NB2A 1KVKA 3KLVA 4EK2A 1RTZA 4WYLA 4DR7J 2VQEJ 1S79A 4ZA1A 1N34J 3MCNA 1Y3KA 2MY8A 2MEWA 3GV7B 2BQ3A 3CB4A 2IBOA 4P10A 3SCIE 5L46A 2VDHA 1N56A 2CG8A 4JBCA 4X4QA 4Y3CA 3CJ0A 2R7UA 4C11A 1HNZJ 2VQFJ 2EFQA 3H7HB 4KQZA 5MAOA 1X4GA 1YTYA 5DRKA 3MGJA 5KFQA 2C2MB 1VQ8S 3VAJA 2RE1A 2FVPA 4C98A 5E0OA 5DETA 4YMEA 2WONA 4RLEA 1TL1B 3HT3A 4FXVA 3CJRA 1I51B 1U09A 4WJBA 3HHLD 3SFGA 2XO7A 3PHTA 1WF1A 1VDHA 1WEYA 5AJ3F 4ID5B 2C2DA 3FZ2A 1NSPA 3EDQB 2EK1A 2B43A 3M32A 2YKMA 4CLFA 5EX0A 4LT6A 1VC6A 3OR1B 3VAGA 1RAIB 4OV6A 3TOQA 1Q86T 1IBMF 3Q0AA 2XNQA 5I3QA 2AWZA 4PPZA 3WHIA 3OUYB 2UU9J 3MHYA 3AA8A 1WC0A 1VQMS 4C48A 4DR1F 3Q8YA 1N36F 3BGOP 3KLEA 4DJBA 3BBCA 3NCQA 2KRBA 2R4FA 2KYZA 2XQCA 2ZBPA 4ZOSA 3FMWA 4Y2KA 4M5JA 4Y34A 2ZH6A 3ZZRA 4ZJQA 2KFYA 1RTJA 1WC4A 2XCAA 3I87A 1YRUA 4WU2A 1Y5LB 3KHHA 3H20A 3F56A 1LKZA 3ZZTA 5B08A 3PKMA 4PUOB 2MSSA 3M30A 3MI7X 5K8PA 4L72B 2G2ZA 2GO9A 2HVEA 4B9SA 4ECYA 3PG9A 1DZ5A 2C2ZB 3EXYA 1HA1A 3PO4A 4OZLA 3B82A 1JB0C 1X4EA 3R27A 1IBMJ 5CZXA 1OJ4A 1XWLA 4QR2A 2VUGA 3CIMA 2XMVA 4ZVSB 5ETOA 2QJ3A 1S9FA 1F0XA 1E6YA 4ECTA 1ELOA 2VICA 1TAUA 4YDXA 1SUQA 2VJVA 4DR1J 1N36J 1L3TA 1VOMA 5GADU 3M9OB 5D0HA 3W61A 5DDQC 3CJTA 1GXTA 3HI9A 3NAIA 1BC6A 1PYTA 2L48A 5IQQA 3C15A 3TZWA 2HNZA 1IKXB 2ZWOA 2G13A 4TLQA 3PW2A 4U9RA 3KK1A 4I0WA 3A3OB 1ZTWA 4J9QA 3D1HA 3AHPA 1TK8A 2V9WA 2RNEA 3HZEA 1SIZA 2OPSA 1RT7A 3TO8A 3W8GA 3FBCA 1KQSR 4PABA 4RX6A 4NXNF 3UN2A 1TAQA 1FF2A 4KAIA 5E7OB 2NPFA 1PAEX 1HW8A 4MIAA 4OFZA 4P9SA 1RT2A 3ZTOA 4EYHB 2R7TA 3FRZA 5GADI 2AJ1A 2LP4A 3HT0A 2XS7A 2OEMA 4NYZA 1MU2B 3DYAB 4YR2A 1LWXA 2HHHJ 5DG9A 2QRRA 1S49A 1EJ7L 4DPOA 4DSLA 3E3XA 3V6DA 2G0IA 2VPXB 1H98A 3JQMA 2ZWPA 4DV5J 1TL7B 2DPJA 2DRDA 1UJ5A 2DNMA 3UCUP 3PW0A 2H9ZA 2F63A 4F25A 1KOOA 3DKDA 3UFCX 3L4BC 4ECZA 3MR6A 5D3GB 2XS2A 3KG4A 3LWLA 2E5IA 3PHEA 4DL0C 4KGKA 2VPZB 4F36A 4M5IA 2LA4A 4OYIA 4JI3J 4QWAA 2C2EA 2KTQA 2E9TA 5LMUF 3H42A 2VG7A 3QT8A 1M5HA 5KFEA 1EAYC 4ZP7A 4DL6A 2IYGA 3LO3A 1B0PA 3CJKB 4X4NA 1FNXH 1FO1A 3UNYA 3A13A 4DV3F 1NAQA 1S99A 1TZ0A 2D3ZA 4JI5F 4E2FB 1Q7LB 3KDNA 3NWGA 4DWIA 1S9EB 1LEOA 5F8IA 3MM9B 3K17A 4DV2J 1CJTB 4HHJA 2P9EA 4EBCA 4DR5F 1RTIB 2C22A 2D9PA 3UN3A 2KKHA 4R8UA 1VHFA 3DXBA 3DLKB 1WELA 5KT7A 3OBIA 3NGKA 2R8HA 1VR6A 3LOUA 1MG7A 2HMIB 2YKQA 4ETXA 1TMJA 5LMUJ 3JAMU 3OTBA 1TL1A 3A8IA 3FRYA 5LSRA 4F8RA 2D3UA 1Y0HA 3JYTA 3JS9A 1NHVA 4IOAQ 3W2VB 4N5SA 2N7CA 2LDIA 1PBUA 2MKCA 1U26A 2C2NA 4XTTA 4ID5A 2G1DA 1YJVA 2DISA 3PX0A 3DRYA 3OR1A 4GVLA 2H48B 5BYRA 4NLGA 5CCLA 2RHSB 1NK4A 4DV4F 3CXCR 5ETNA 2RAQA 3NGSA 5ETPA 1H2TZ 1IKVA 5DDRC 1NSQA 5F8NA 4DR5J 3EX7B 3CJ3A 2KN4A 1S4FA 1UEVA 3VALA 4J9VA 2AEFA 5AXLA 3VGTA 4LMZA 4F3OA 1EETA 3BBBA 3UNGC 1D9DA 2NXEA 1GMWA 2HHVA 2HK3A 4R0EA 2W2PP 5EX3A 1PJ6A 2ROPA 5K8OA 2YNIB 2B4VA 4ZPTR 5A2QU 5GAHU 1FKPB 3AFGA 1KFSA 4K4ZA 3EZUA 2M8DB 1Q95G 4CLYA 4OYOA 1DLOA 1V3ZA 2H4WB 2D3OR 4J91A 3JTOA 2FVSA 3G9CA 2AV5A 3M8PB 3MMAB 4Y2MA 3N01A 2F9JA 1FVQA 2ASYA 3L9ZA 4AQYF 5IWAJ 1FFWB 5KG3A 4KPCA 3CMQA 4HT7A 4Q45A 3ICLA 3J80Y 3IS9B 5HBMB 1YLXA 3D6HB 3RUBL 2H4YB 2J5AA 4OI1A 1IQTA 2IA6A 1CULA 1GH8A 3LP2A 5GAHI 1QSYA 3CD7A 3MCSA 1BE4A 3OD2A 4QOTA 1PKUA 1OSDA 5HO4A 1RWUA 2YNFB 1T9UA 2BA9A 1BGXT 4PWDA 4IQXA 2OTLS 3KHGA 2KT2A 4NA2A 5BR8J 2BYCA 3ILIA 3MD3A 3T1AA 2V50A 1CJUA 2G4BA 2ACMA 1SL1A 3NGDA 2GHPA 4OYBA 3F73A 4ITSA 1HI0P 2ROEA 3K5NA 4AQYJ 3CCES 4U6PA 1RE1B 2DH8A 5KFAA 1RWXB 3DYAA 1OS5A 2W4CA 4CYUB 4KIAA 2WSFC 3GG0A 4TKTA 2U1AA 3ISZA 1HIYA 1WC5A 4JI4J 3H2UB 3QLHB 1R31A 2CPFA 3CVKA 3CMES 1R8CA 4DL2A 4CLPA 4RBTA 2D7SA 2RDDA 5D3GA 3AB2B 1JLQB 1ZAWA 4IFVB 3DMJA 3LAMA 2E1PA 5KFKA 2OUGA 5KG5A 1X0FA 1F3FA 2EXUA 1LOUA 2MQNA 2AIRB 1M1GA 3ETOA 3TZZA 5KFMA 1F2GA 3SDEB 3W1YC 4EYIB 1F5CA 2V2QA 3D3BJ 4AXIA 1XTZA 4WFNQ 1LWCA 3BYRA 2CAJA 4IR9A 4A8XA 3G8SA 3TJ9A 2IHR1 5H9EK 3IBWA 1HHTP 3IM8A 5AXNA 1TKXB 4F67A 2AMCB 1ICEB 2HVIA 2BANB 3PFOA 5HROA 1CJTA 2Y1LB 4F4ZA 1ZPVA 4H54A 1TFWA 1SJRA 2PDAA 4PWUA 3HMJG 2HAFA 4GVBA 1OYDA 2JC0A 3DLKA 2PGCA 3UI3A 1BQNA 3SSSA 2V63A 2HMIA 1FRLA 3R5CA 2VU5A 4EBDA 1Q8BA 3THTA 5EDWA 2JJ4D 4I2QA 4JI6F 3MEKA 1HW9A 4WBFA 2BACA 3VHQA 1X60A 1RAEB 2V94A 3NL0A 3EYZA 3QYYA 4LF5J 3J7AN 5KFPA 1TUGB 1FXLA 2PMWA 2KDOA 3D54A 3LP0B 4NOHA 3EVWA 1YBTA 2V8GA 4ZPDA 4YFUA 3RRHA 3E8OA 1EP4B 4QPTA 4USUA 1KRPA 3BS9A 1GT8A 4GKKF 1JLBA 5F9NA 2QMXA 2CPEA 3G6YA 1UZDA 3VAKA 5F8JA 3V5RA 3BPDA 3PYGA 4X4OA 1HYSB 2XLKA 1CS4B 1R6VA 5FLXU 1JJCB 2F8MA 4RNFA 4QCLA 3TP2A 5CYQA 3PR4A 1PC4A 4DLEA 2VBYA 3U7JA 4WFBQ 4JI6J 3C6UB 2A1BA 2O01C 3Q2SC 1FKPA 3DOLB 2M3DA 3QFHA 1BD6A 4LFBF 1F9EB 2VJUA 1JLGA 2CPIA 1FDNA 2NQPA 1Y5IB 3M8PA 3MMAA 4RUHA 5B7WA 3ZNJ1 2IDLA 1VBZA 3U27A 2XZTB 2HZVA 3RBZA 4GKKJ 1RYRA 3P49B 3WBZA 4B9NA 1UJ6A 2CADA 3NGRA 4X2BA 1XIQA 2UXCJ 3H4BA 2UZAA 5KFHA 3S01A 1FRJA 2MQMA 3IS9A 2V4JA 4NRUA 1KOHA 2M52A 1VIOA 4J9OA 1D1UA 2KVQE 5DQGA 3K7RA 4DQQA 3EVMA 4P2SA 1NRKA 3OFHA 2VASA 3QO9B 3TJ8A 2J8AA 4C0HA 4RW7A 4GC6A 2FDNA 5HLFA 2DEJA 3L7UA 2KFZA 2FB0A 4KRWA 5B0EA 2Z30B 3FFIB 5AXMA 3VAMA 3HKZD 2F8EX 4WIIA 3QJLA 4ZPWR 1Z1ZA 4N77A 5D4LA 2HWHA 2RB7A 4I64A 2QA1A 3Q8RB 4DEZA 3OFGA 4AT1B 2BOPA 2QSWA 4C8LA 2HWTA 3TR5A 4I6YA 1EHWA 4DG1A 3M8QB 5KT5A 5F8GA 4CLLA 4DPUA 1FI4A 2BKPA 3MAQA 1DTTB 1FKOB 3X3UA 1PO6A 3D6TB 5BYSA 1HBUB 3QLHA 1P1LA 3CD6S 2CYYA 3G8TA 2JLEA 1UL3A 3SQOP 1UETA 3A4TA 3K5LA 3MMBA 4OLOA 4QWEA 1X31C 1RADB 5K8NA 4NLRA 2YNHB 2K1RA 2LXFA 4WCEQ 4QIVA 5ETVA 3TARA 2W7PA 2IVFB 4DZDA 5F41A 2FIUA 1UWBB 3HSZA 2YKNA 3W65A 1JXVA 1B3TA 1UVMA 3M6XA 2RRAA 5DDOC 1S7IA 3L7OA 3O8WA 1NCLA 2OFHX 1U1KA 2BJDA 3N0VA 2KXFA 1WTFA 1X5TA 3J7A1 2Q3PA 1TKXA 2XZDB 3DOMA 1PILA 4LF8J 2BANA 2GVDA 2BX6A 2QE5A 4F4AA 2CUYA 3F44A 2BRKA 4KO0B 3O1LA 1O51A 3WIUA 1VI7A 2YH1A 3FGVA 2CVIA 3GR0A 2FHMA 1Y3JA 4NCAA 4DDFA 1ZM2A 3ILLA 4R5PA 5CCMA 2PMHA 1R6YA 3CO9A 5F3TA 2JVRA 2FHOB 1C0UA 3GE9A 4RKUC 3QWUA 1LV5A 4IRDA 4Z7YA 3M2RB 1KLMB 4ES2A 4DUYF 3JB9k 2XC9A 1GX5A 2K7KA 4LRAA 2QT7A 3LP0A 2KZMA 1MWQA 5CAAA 3CJ4A 2J7WA 2KRRA 4A8FA 5F3ZA 1SC3B 5H9EJ 1UWAA 4F7VA 1Z2LA 5DGBA 5D4OA 2HFNA 1HHQA 3H40A 2BW2A 4HKQA 2LECA 4DN0A 4DUTA 3IFEA 3K8WA 4OJGA 3H25A 3LUYA 2LU2A 1UAWA 3UD5A 3I4PA 1NKEA 4F0MA 5B0GA 3U1NA 3D2WA 4ZN1A 3C14B 2C3YA 4LF1A 2RS2A 4CZCA 4J9UE 3ZTPA 4ANDA 1N0UA 2XMMA 2DGVA 3BQ1A 1Q7YT 4DUYJ 1V5IB 4FYWB 1X8DA 5E3RA 2KYXA 4BCAA 3ONQA 3Q83A 4CP5A 3N28A 4KHPF 4DV6J 1RKIA 3TA2A 2X1GA 3WC0A 1RGVA 3MR3A 1R8AA 4NEYA 5A6WA 2YQ0A 1HPZA 4CDIA 3EGWB 1QAIA 1DQAA 2R7RA 4YR3A 2FJDB 4RO0A 5U47A 1X4CA 3OQ2A 4TU7A 3JSBA 3CMAS 2WHOA 1X5SA 4ZCMA 5E3PA 2XULA 3JSYA 4YUDA 1LXNA 4W92B 4U7CA 4NCBA 2F8HA 3QO9A 4MFBB 4B17A 2W9BA 3BSAA 2E44A 2XSFA 4L3NA 3DXSX 3TZXA 3T1YF 5DM6Q 2YQ1A 1VQPS 3KG1A 3R5GA 4BC9A 1RP5A 1TL3B 1HMVB 3KUEA 1FRHA 2HHUA 1P8GA 1NZ8A 3BZQA 1TV6A 2CNKB 1TELA 2QX0A 1H7XA 1PGZA 2RQ4A 4KFBA 4H4KA 4HHHA 1AZSB 3SI8A 3M8QA 3D5MA 2AP6A 2MDAA 2HHTA 3VZHA 1VIXA 1K44A 1X4FA 1XK8A 1AFJA 4P72A 1GNKA 2QC3A 3AOCA 3HHDA 3T5KA 3GSDA 4Y2IA 1RLCL 1Y9OA 3BGUA 2QYGA 4O0NA 4F3QA 2OAUA 5IS2A 3T1YJ 4D3HA 4RNMA 2QA4G 1S1XB 3EGZA 1UFKA 2LMIA 1N5VA 4K4WA 1VGYA 3GCWP 2HLTA 4DL7A 3G4SS 3GIRA 2V6AA 4A8MP 2FHKA 3DDNA 4P7VA 2DT9A 2GJFA 3BN4A 2AJ2A 4QJVA 3G71S 3IN5A 1ROFA 1WG1A 2DNPA 1KDNA 3CJSA 2WVBA 2K7JA 5F0UA 2CZVC 3GONA 3AA9A 4V19X 4URQU 4Y0FA 5H9FJ 3CDBA 1KKHA 3AH6A 4FVMA 1ZZFA 4XPCA 2MJNA 4AYBD 4J9MA 3BV8A 4DU7A 1VQSA 4OYMA 2OHDA 2X3GA 1ZZNA 2BDPA 3AOBA 6FDRA 2BQRA 1S1VB 1R0AA 3T9NA 2XMWA 2G2YA 5EGYA 3DLJA 2KVIA 2PI5A 1WDDA 2MKYA 1JXLA 4JP8A 2VIHA 5KG0A 4DBQA 2WSEC 4FPRA 5A0YB 1S97A 1JJHA 3O5TB 2RJZA 2OMLA 1WTBA 4ZIWA 3DLEB 2OTJS 2LDYA 4P7TA 3W7BA 1NHKL 1F9HA 2IDEA 2IJRA 3T5JA 2YWHA 4K8RA 2E5JA 1JX4A 2W8KA 4ZVUB 5LJ5Y 3CF5Q 2LKZA 2V2KA 5C5JA 4RBVA 4K5RA 4K0KF 2KB2A 5CQGA 2GW8A 2KM8B 3X1LB 1IBLF 3RRGA 3TNVA 2R9LA 1M5SA 4O23A 1G2EA 4KTQA 5CYMB 4ZJOA 1IUJA 1Q53A 1XC9A 4WU3A 4Q2LA 1DRZA 3CTRA 4O3PA 5J1PA 1F6TA 3LWMA 2F9DA 5D6GA 1KTVA 4J9KA 4CLTA 2A18A 1G7CB 1RHUB 4X64J 3M8RA 1SQEA 2VC0A 1VBKA 1FTCA 1LXJA 1O6XA 2L08A 2O66A 4NASA 4HL9A 4B02A 2FTRA 1C1CB 2J0SD 2WBMA 2VBXA 1RTHB 2BBEA 1FK9B 4K2JA 2I1RA 4MTPA 4DL4A 3MTKA 2CQ2A 4ECQA 1HI1A 3QZ8A 4CTAA 1H74A 3D4JA 1F9FA 3S6EA 3C16A 2VH7A 3J81U 3CJ5A 2MKKA 3OW2R 3MM8A 2AW0A 2LYVA 1Q16B 4OJ1A 5C2GA 3DHXA 4LFCF 2MHNA 1HD1A 2WW4A 3C66A 4NI2A 3A8JA 2VFVA 1DQ8A 4IO9Q 1VQNS 3DRPB 2AZ3A 4MFBA 3W5XA 2FJXA 2DCUB 1ZM9A 4ZN3A 2DNQA 1N5SA 2PFDA 5KAKA 1FJ7A 2HNYB 1YJNS 3BQ2A 2CNOB 5A76A 4K2XA 3R7NB 1FE4A 2EG1A 1HMVA 1K1SA 1HWJA 5J2QA 4ZJLA 1YJ7A 2QLXA 4ZHRA 1B7YB 1DHMA 4PYDA 2LQBA 1WD6A 3T3FA 2I9SA 3HK2A 1PJ7A 1H6KX 2XYHB 3BO4A 4EEYA 3PRBA 2C28A 3ENQA 2JLGA 2Z2YB 3DHWC 1V3RA 1C0TB 1DURA 1AZSA 1U25A 2KI2A 4PPDA 3AODA 4PR6A 3TX8A 1WOOA 4IRKA 2AX0A 3OLAA 4C8OA 1D0EA 3H0PA 2DR7A 3MM7A 3FK4A 5F9LA 4AL5A 1FJGF 4JI8F 3B54A 2EK6A 1EQMA 2ZITA 3BJYA 1Q8KA 3ET6A 3LPYA 5HVFA 1ZBTA 3R2DJ 4FXDA 2PI4A 4AFFA 3BSNA 3KTQA 3D0GE 1IN0A 4OHVA 4JI2F 1QVGR 4NLXA 1KN6A 2VFSA 5EN1A 2B9EA 2RHQB 3PDNA 2VKRA 3Q24A 3BSCA 4WYWA 3C6TB 2KT5A 2HAIA 1XR7A 5CXTA 1JK9B 3PY8A 3QT5A 4RW6A 2ZJQQ 5KFXA 2ZBQA 2QA2A 2AYEA 2ZHBA 3BEGB 5DLGA 3SSRA 2R7WA 1XJWB 2J9EA 1FNMA 3QATA 3PKYA 3AT1B 1FJGJ 4CLKA 4BDPA 2XGQA 2DIVA 1T02A 2YKOA 1U6BA 3DGPA 2PMZD 3CW2C 1S1VA 4J9LA 2F3JA 1FA0A 5F8LA 2Z8QA 3QT6A 2VKZG 2YNGA 4F0HA 3L09A 3FZBA 4YHHF 1AROP 2R7OA 2RDIA 3MEGA 4NE9C 2YKPA 1NSAA 4PKDB 1JLEA 2VG5B 4C9DA 2RRBA 3FUYA 4IOBA 1YX2A 2ALZA 4DFJA 3KJVB 2M0GB 4A8SA 1ZAXA 3NXZA 5E3AA 4C6AA 4LRFA 1A6LA 3MOZA 5F0WA 2GGPA 3OHAA 2XY5A 1O0PA 5C24B 1UFWA 4F0KA 4LVNP 3IR7B 3N6LA 1SQFA 2N4CA 2QMUB 3I96A 3SMZA 3GJTB 1X9WA 2VOOA 4QU6A 2W2QP 3GIMA 5HVHA 1J5OB 2B5JB 3JSRA 3CC4S 2BQUA 4RNNA 5KFVA 3KLHB 2JLFA 1NPKA 2ILYA 5CZVA 1OY9A 1C1CA 2ZC3A 2G9OA 4C7QA 2A0FB 1RTHA 4I1TA 3HCXA 4OI0A 4DPXA 4GO7X 2BJ7A 2IMOA 1LWFA 3BB5A 1FERA 4M5KA 8RUCA 1QE1B 3ILJA 2AYGA 2ATCB 3A8KA 3GSIA 1JKHB 4HDHA 3CE8A 5DQHA 1VK8A 5IV3A 2CQCA 2ZM6F 1RK8A 1FESA 6AT1B 1RCXB 4G65A 1IXKA 4DF8A 1GX6A 2FGCA 3VVUA 1KVIA 4FF3A 1GAOA 4IG0B 4P2XA 4OMFG 1NXIA 2HS3A 5KFCA 4K59A 1WOPA 1IWAA 2IY5B 1QTMA 2L9NA 5EWEA 4PWWA 3G82B 3NS6A 3NRBA 4OYWA 3PV8A 4LBHA 3G8QA 2FJAB 2NSCA 5KFDA 1UPMB 2HPUA 1P9YA 1X9MA 4UT4A 1AA1B 3OJSA 3DNCA 2D69A 3TI0A 1XNQF 4DX7A 2VOPA 4GC7A 2K06A 4L76A 4ILRA 2V9KA 3KLFB 2L9DA 2APOA 2NZCA 1U1RA 2DXDA 2MQLA 3H8YA 5L9XA 3R5AA 1X4AA 1PYOB 4UUWA 2JFKA 5IT4A 2ZM6J 4FZVA 5IFMA 4WE1B 4J9NA 3AD8C 3FBEA 2CQDA 4EFAC 1ZETA 3T1HF 3GMGA 3MM6B 4C8KA 2BKOA 1C0TA 5JUMA 3RRKA 1PJ5A 5DS7A 1UVIA 3FSYA 4H4MB 5K14A 3PO5A 5HMZA 3W3SA 4B9VA 2UXBJ 5K9FA 4H4KC 3HHEA 3OTEA 1S6QB 4OHXA 4LSNB 3TZYA 1RAHB 2A10A 2DRBA 1UMJA 3FQKA 1V5VA 1W7WA 3DU5A 1U0SA 2DNHA 2A6MA 3QMQA 2JVOA 2A2CA 2D41A 2M5YA 2OKQA 4TY8B 4WFZA 2KH9A 2H65B 5HMXA 4OZNA 3C3LA 2F1FA 3MEEA 5AXKA 3TAQA 3RBEA 5HANA 4C3LA 2J0QD 2V2VA 1X5PA 3MDFA 3G6XA 3IG1B 2VG6B 3C6TA 3OTCA 5KFUA 3OL6A 1JJ4A 3LGHA 1FHTA 1QSSA 4O3SA 3MAAA 3MZIA 4ECVA 3I31A 1LWEA 4OI6A 4KC5A 3TAMB 3VCDA 2C3UA 3DI6B 1RLDA 3OFFA 2CG4A 2GV1A 1RABB 2IM2A 1FRKA 2ZH1A 4QR1A 1IVZA 3GQCA 4C11B 2KFNA 3MXHP 3RB3A 4J37A 3CSKA 3PW7A 3QIPB 2JC1A 2LQ5A 5BJRA 3CC7S 3LPEA 5KT6A 4RWWA 1YVFA 2IA0A 3HHLA 2FD2A 3RU0A 3M9NB 4OLPA 5HVGA 2DNNA 4UZCA 4IR1A 3IAM9 3EGVA 3R1LA 5HN0A 4DCJB 1DBDA 2G0CA 1NSKL 1U48A 3CDEA 4WZQA 3AJ2A 4FVCA 3M32B 4USWA 4DFMA 2ADCA 2I5JB 2GA7A 2ZBIA 3UCGA 4EGLA 3TRGA 1HNIA 5EHHA 4LF7F 1JNRB 5C24A 3NS7B 4RUAA 4CH7A 4J7CA 2DH9A 2FC8A 1W25A 3EICA 5EWFA 3R1HA 1I5OB 2JHEA 3UVJA 2OP5A 4QU7A 3CGIA 4S0MA 2V4QA 1QSLA 5DM7Q 1WSVA 5KFRA 3KLEB 4YY3F 2CZ9A 4DV0J 1AW0A 4I69A 3SYZA 3QRQA 2WW8A 3CCTA 4DQIA 4USKA 2FZGB 3MCMA 4TN2A 1NB7A 1RTJB 3KLHA 2CVEA 3BSOA 3Q8VA 3A12A 5HK4A 4DS5A 3R7SB 4FBTA 1HNXJ 1ZM4A 3M30B 2VD3A 1N32J 4CT8A 1FX4A 3UDEA 3Q23A 1HI8A 2PA3A 4FDFA 3KHRA 4OX8A 2VA2A 5KFJA 1WG5A 4LF7J 2XI3A 4C8YA 1JKHA 1HBMA 3IC1A 4DN9A 3HKWA 7FD1A 4DSKA 1SUQB 2B0GA 1FJCA 4C97A 4YDDB 2DY1A 4YY3J 4B3RJ 1XEZA 2G2OA 3DN9A 5ETMA 1SB6A 3SCJE 4MIBA 2QLJB 3GIJA 3KYLA 1LW0A 3HP6A 1B0VA 3ZZOA 4PG6A 1L5UA 1NUEA 2MSTA 4QWCA 3C15B 2UUBF 1ULRA 2XHWA 3PRVA 3KK1B 3E01A 2HW3A 4QR0A 2N4DA 1WEZA 2BE7D 3IP0A 1S0VA 3PYFA 1HBNA 3QQCD 2OPSB 3SIPB 1RT7B 1SPBP 4FKYA 1V3SA 4X4RA 4LF4F 5CH7B 1UEKA 2OLWA 3D66A 4ZMMA 4D3GA 2O5DA 3QPIA 3KLFA 3IGNA 2BR0A 2Y3YA 5D8HB 3EXCX 3KNGA 1AUDA 3CNQP 4FYDA 1GMVA 4MT1A 2N82B 3QBCA 2ZDPA 2E1RA 2QL7B 4XIUA 2RD5C 2EKNA 2GVZB 1YDLA 3MM6A 1LK7A 1RDRA 1TKTA 1C4AA 4DCOB 2E1CA 2DGXA 2K8GA 4ATNA 4OJ3A 3V6DB 2YTCA 1NKBA 4NPOA 1D8YA 1T9VA 2HURA 3TEGA 3BDEA 1SJ4P 1H2VZ 3NGTA 4KHRA 3KK3A 1U4BA 2AF6A 4IFYB 3SV4A 2BOAA 2WVFA 1YJ9S 4WFXA 2I2YA 1DAXA 5FDLA 1EKSA 3ZTSA 5IT9U 2V8DA 4LF4J 1H72C 4ZS6A 4M1KA 3P6YC 1RSCA 2UUCF 1S10A 4XDCA 2YKAA 1CJKA 2HFVA 1T7PA 3T6BA 1WACA 3EDRB 3KMQA 2ZUGA 3I55S 3HVAA 2AHOB 1YIJS 1KWMA 1I6JA 3GG1A 3ZZYA 3JSMB 5J2MB 2MMYA 2J9DA 3B4MA 4ZVEA 2E7XA 3ZZ0A 4KGXB 1RKJA 1Z2ZA 2FHJD 2AGQA 3POTA 4WIQA 4A47A 2BW7A 2RILA 4LF6F 3I9ZA 1EZZB 1SJQA 4X62F 4USVA 2VDIA 1GTEA 1AXQA 2BVZA 2CJQA 2V68A 3LGNA 3W9JA 3TAMA
chains in the Genus database with same CATH topology
3DI6A 4MAKA 4ZP6A 3K5LA 4PXEA 1HWLA 2VPYB 4ILMA 1F5AA 3MMBA 2GGPB 2OJ3A 2R7SA 2LQ9A 1SJ3P 2M70A 2JDJA 2Y0SD 4OLOA 4QWEA 5E2QA 2XLJA 4W90B 4YB7A 1Z4UA 3GIKA 1TL4A 3UDCA 4R8UB 2HHWA 5CYJA 3QGGA 5K8NA 4I4BA 1N5YA 3QIPA 4NLRA 1NJWA 2YNHB 2ZOMA 1SV5B 4F3MA 5ADZA 2K1RA 2LXFA 3LH2S 1RT6A 4WCEQ 4QIVA 3LANA 3S1TA 3B4DA 2P5VA 1Q81T 1N48A 3TARA 2W7PA 2IVFB 2QSFA 2OPRB 2Q6CA 5F41A 1DTQB 2FIUA 2YY3A 4A8WA 4WKRA 3H5SA 1UWBB 5HQ8A 4M94A 4JI4F 3JYTB 1HQEA 2YKNA 1IKXA 2XWXA 3OXGA 3DRRA 1VC5A 1CQNA 5J1EA 1UVMA 2J9CA 3QGIA 3M6XA 2RRAA 3V81B 5DDOC 3RR8A 2PEHA 3L7OA 3J7Z5 3O8WA 2OFHX 4JV2A 5KFSA 2MZSA 4KBIA 1TVRB 3M6UA 3VTIA 3FJ2A 4RW8B 3PRDA 2ZJPQ 1U1KA 1URRA 3BGRB 2BJDA 3N0VA 4NA1A 2KXFA 1Q79A 2R2SA 1WTFA 1X5TA 2IFXA 2GJIA 4URGA 3GFHA 4MK9A 1UVLA 2K3IA 3J7A1 3BO3A 4KV8B 2Q3PA 2AD9A 3TVZA 4ZCIA 1KS2A 2UVUA 1TKXA 2GNKA 4U67Q 3V6JA 1VBXA 2DHSA 4USJC 3CCJS 2YX7A 4IRCA 3DOMA 1PILA 3P5TL 3QGPA 2BANA 5I42A 2I5JA 3GYXB 1NH8A 2QE5A 4ZVHA 4TQSA 2R7XA 5J2PA 4NXMF 3P3DA 1LWFB 3VWSA 4HEA9 3FSIA 2XG8A 2YX1A 3F44A 1R89A 1IKVB 2BRKA 1QJHA 2PN6A 2E1MC 5KT4A 2FPHX 2C3MA 4KO0B 3O1LA 1O51A 5L39A 2JOQA 1VI7A 2CPJA 3WX4A 3JTNA 2ZE2B 3GWCA 2YH1A 4ECRA 3FGVA 1K0VA 2KM8C 2CVIA 3G86A 1I94F 2YWKA 1C1BA 3GR0A 2FHMA 1Y3JA 1R3NA 4NCAA 4DDFA 2O1PA 1ZM2A 2C3OA 1IBKF 3M05A 3H4DA 1UP1A 2CPHA 3MUMP 4CCHA 1JLCA 1MU2A 1FD2A 2J7UA 3MAHA 1KQGB 1EETB 4OZ0A 4CO3A 1T03A 4ZCKA 2VONA 4R5PA 3SXLA 3PM9A 2OO4A 2PMHA 5CCMA 4M95A 5EUHA 3Q8SB 1SJFA 2UVVA 1R6YA 3CO9A 4F26A 2JH3A 3EUNA 5F3TA 1QAJA 3KNAA 1O5JA 4HH0A 2JVRA 2FHOB 1C0UA 4USIA 2OMOA 1E6VB 1N54B 1N5QA 2AJ4A 3O6QA 4V19J 3GE9A 5HMYA 1KNZA 2QV6A 2HQIA 4DV1F 4LQ9A 4RKUC 2ZOFA 3QWUA 1LV5A 1L3SA 3QJPA 1T94A 2GQCA 1XMQF 2ATLA 2AYBA 2X1BA 1WI8A 3RB0A 3RAMA 4IRDA 4DSEA 4DSJA 3M2RB 3A1YG 2W7AA 1KLMB 3N5BA 4ES2A 2WB4A 4WK3A 4DUYF 3S7RA 1YJTA 2LA6A 2M2BA 2POKA 3JB9k 4C8MA 5GMKa 2XLIA 2ZH7A 2XC9A 1GX5A 3NP5A 4F4XA 4GO5X 2AX1A 1CLFA 1DLOB 2K7KA 4LIRA 5GAGU 3NAHA 2J6TA 1J5EF 4N8NA 2ZNYA 4ELUA 2QT7A 1UJ4A 3LP0A 2JEFA 2KZMA 4RZRA 3LAKA 3TANA 3CJ4A 2J7WA 2KRRA 2HYIB 5F3ZA 4A8FA 3OVBA 5DJBA 1MROA 3M2VB 5AE3A 2KG1A 5H9EJ 1HR0F 1Z2LA 5DGBA 5D4OA 2IVMA 2HFNA 3OXFA 3UW1A 4ECUA 4JOUA 4F2SA 3Q8QB 4WFAQ 3MOJB 3H40A 4MH8A 2BW2A 4HKQA 3R3TA 4HH1A 2LECA 4DN0A 3C2PA 3IFEA 3ITHA 3K8WA 4M8LA 4OJGA 5CHCB 3SQGA 3H25A 3HVWA 4DV0F 2RVJA 2FJWA 2Z0GA 3OTOF 2VFTA 1MSWD 3LUYA 2ZHOA 3A8EA 4HDGA 2LU2A 1UAWA 2I0XA 2WONB 4A4JA 3PIOQ 3NNAA 3K5PA 1HBOA 2MQQA 4MYUA 2EFNA 2YX4A 3I4PA 3CUNA 1TKZA 2MGZA 2VG5A 4WXWA 5IXUA 5MLCV 1NKEA 1L3UA 4C3KA 2W25A 3CCLS 3CJKA 1VQKS 5B0GA 3U1NA 3RAXA 3HO1A 3D2WA 2EKYA 2LXIA 2DNYA 4A8QA 2CQ1A 3EZ5A 4ED2A 1RA7A 4OIXA 1HNXF 1C4CA 4CH0S 2QIFA 2B9WA 4AUKA 1HWIA 3KJVA 2ACYA 4LSLA 4F3OA 3VQTA 4A46A 1SH0A 2GX8A 4ELTA 5KG4A 5KFZA 1N32F 2C3YA 2RS2A 2ZD1B 2W9CB 4LF5F 2E5GA 1RT5B 2A3JA 3LP2B 2RU3A 5K14B 1S9EA 1NU4A 4CZCA 4TYBA 1X4DA 2YKMB 3MM9A 5KFWA 3RTVA 1HQUA 3I0SB 4K4XA 2XCPA 1S72S 1RTDB 3DM2A 4I7FB 1L3VA 1N0UA 2EI5A 3UD3P 1TQLA 1VRTB 4ZPVR 2XMMA 3QAUA 2DGVA 1P27B 3BQ1A 1Q7YT 1M1KT 1RTIA 1X8DA 4OI3A 5GAGI 1QM9A 3GFYA 5E3RA 3VAIA 5HMWA 4RW4B 2KYXA 3HX9A 3U1LA 4BCAA 1FJEB 2YWFA 4PWDB 2KJVA 2AJQA 3ONQA 4NLSA 4E0DA 1KQKA 1VS3A 4ID8A 3SZ2A 2NYIA 3MPWA 3N79A 3I56S 4O3RA 2C42A 4PG5A 1CPZA 3N28A 4Y2AA 1R8HA 5KG1A 5J2NA 1M5KC 4KHPF 3K57A 1RKIA 2D9OA 2HHPA 3TA2A 2FJVA 2X1GA 2M4MA 2DPIA 1QY7A 2OPQB 3WC0A 1QAYA 1GXLA 1RGVA 2I38A 3MR3A 3BF4A 2VB6A 1R8AA 4WF9Q 5I3UA 4B3RF 2GQQA 4N47A 2XSJB 5A6WA 3SSQA 4NLQA 4A8OA 1J5OA 1HPZA 1WWHA 2B5JA 3OHBA 1M5PC 1JJ2R 1V9OA 1VBYA 4FBUA 2LU1A 1VQ9S 3EGWB 1GTHA 2Q79A 3LP1B 5KFFA 1QAIA 1DQAA 4ECWA 2ASJA 1S0MA 2UXDF 1K8AT 3W2VA 2R7RA 4YR3A 2FJDB 5U47A 1VQ6S 1SJ1A 4N8OA 1X4CA 3OQ2A 4TU7A 3MEEB 3JSBA 4QW8A 5KFIA 3HDSA 3CMAS 4ICLA 2V8HA 2WHOA 3EPGA 1X5SA 2CPXA 4Y6IA 4ZCMA 1M5VC 4HTJA 5E3PA 2XULA 1P9QC 3NNHA 1RJJA 3JSYA 1QVFR 4K4YA 4YUDA 1LXNA 4CIOA 1S7HA 4W92B 2JEJA 4CO5A 3D28A 4U7CA 4NCBA 2F8HA 4YQWA 3NNCA 3QO9A 4MFBB 4LIWA 2DGUA 4X4PA 4B17A 2IMWP 1IKYB 3DFEA 3AB4B 2IRUA 2W9BA 2GCFA 1NKCA 4MIWA 3BSAA 1OPIA 4HTIA 2E44A 3I5CA 2XSFA 1JWWA 4L3NA 5L38A 2RT3A 4QYRA 3IA0A 3CDAA 4I6WA 4IFYA 1S1TB 1QE1A 1ZOTA 3CIZA 3DXSX 4I2PB 5KFYA 2B4PA 2DVIA 5E3QA 3K5MA 4ZP9A 3DRXA 3T1YF 5DM6Q 1U2FA 2AJFE 4QYZJ 1Q78A 1VQPS 1LWEB 4TU8A 3KG1A 1VK3A 4BHQA 1K9MT 3BN7A 4BC9A 1RP5A 3ZZZA 4ED7A 2CQ0A 2R8JA 3M2UB 1SL0A 2F40A 1TL3B 2B6AB 1KD1T 1HMVB 3I0RB 3N6MA 1FRHA 4OHZA 4WXOA 5KFBA 3DLHA 3CCUS 5K5MA 2HHUA 2XEXA 2RKIA 1P8GA 1I1GA 1E6YB 4UOCA 5KTQA 3GILA 4NLPA 1S0NA 3DMJB 3H5UA 2BV3A 1S77D 2QZ8A 2WOMA 4UQTA 1Y7PA 1S9GB 4MKBA 2ZH4A 1GXUA 4B3TF 2XBPA 1RT3B 4X66F 2IVYA 2QLWA 2V0NA 4C2MA 5LJ3Y 3BZQA 2KHDA 2UXCF 1TV6A 3N4WA 1JLAA 5L8RC 4QBUA 1S6UA 4NWBA 1RT4A 1UA0A 4B3MF 2XY7A 3M4XA 1H7XA 1A7GE 4WKYA 1PGZA 1NEEA 2RQ4A 4KFBA 1J2VA 2OSQA 4YEAA 2L3MA 1O8BA 2HHXA 4RNOA 4IG0A 3HHLB 1VLYA 2YNIA 1U6FA 3UDLA 4O3NA 5C25A 3PEHA 1MMNA 2XWYA 4H4KA 3CJ2A 4JV5F 2IRXA 5KFLA 3SI8A 1FDBA 3JSMA 5J2MA 4F4KA 3PW4A 1OO0B 5LXYA 5KFNA 3OV7A 1OPZA 2FLPA 2HNZB 4RWXA 3M8QA 5A8WB 4JI1F 3D5MA 1Q8LA 2AP6A 5THWA 5SZTA 4TLRA 2MDAA 4B9TA 1MNEA 4QQBA 4B3OB 2HHTA 3VZHA 1WHWA 1VIXA 1HHSA 1VMBA 2YVSA 1LWCB 1X5OA 4PRFA 1X4FA 5G0RB 3VR1A 5IT0A 1MWZA 1XK8A 3CCMS 3QJJA 1AFJA 3GB0A 2BE2B 5D77A 1WEXA 2E9RX 2HS0A 3FCHA 2O67A 1VRUB 2CQ3A 1GNKA 3ZC4A 1JXEA 2QFJA 3MECB 4NZ6A 2KXNB 1RAJA 3IWLA 3HHDA 3T5KA 3ZZPA 2MKSA 5KFGA 3GSDA 1MMLA 4Y2IA 2RSQA 1Y9OA 1VQLS 3BGUA 4EU0A 5HROB 4I67A 4F3QA 2OAUA 4BWMA 5IS2A 4D3HA 2GMLA 4RNMA 2QA4G 1HNIB 4BBYA 2M9KA 4ELVA 1S1XB 3K5OA 3EGZA 3JTPA 3J7ZT 3UE2A 3U02A 2LMIA 2Y1RI 3BO2A 1N5VA 3WC2A 1M0SA 2PT0A 5IM0B 4K4UA 2FC9A 2CQHA 1VGYA 4K4WA 2HLTA 4DL7A 3G4SS 2KU7A 1RT2B 1Y00A 2X1AA 1SV5A 4A8MP 4G1PA 4CQ1A 2BABA 2FHKA 3BR9A 1BQNB 3DDNA 4P7VA 3M6WA 4WE1A 5A2QY 2XY6A 1KSPA 4FF4A 1H3DA 2DT9A 4NLTA 4FP9A 4N76A 2MB0B 3D0IE 4IG3B 5HBMA 2XMTA 2JX2A 3BN4A 1CC7A 4IH7A 2OPRA 4MK8A 4QJVA 3UD4P 2RDJA 5M2PA 1DTQA 5DLFA 3G71S 3IN5A 2ZBCA 1SKWA 3DC2A 4ZKAA 3GV5B 3UQSA 1ROFA 1F60B 1WG1A 3OFEA 4C0BA 2RUGA 4H4MA 4YB1P 1U1PA 3V4IB 2DNPA 2UV8A 4X4SA 5DG7A 3V81A 4EUVA 4I2QB 1HNWF 4QPXA 4ZPAA 2K7JA 1KHVA 3MTJA 5F0UA 1IKWB 2RU9A 2CZVC 1TVRA 3AA9A 4RW8A 5L1LA 3OVAA 2VL1A 4DR7F 3V2UC 2VQEF 4O4RA 4URQU 2CQIA 4Y0FA 4V19X 4ES1A 2YNFA 3GZ7A 4ZVGA 5H9FJ 1S6QA 3CDBA 1N34F 4FS2A 4OZ1A 3AH6A 2DNRA 2M7SA 1DJ0A 4FNIA 4LSNA 4CNYA 4FVMA 4ZP8A 2N3LA 1S6PA 4KV8A 4ECXA 4JV1A 1U1MA 4MMOA 2VV5A 3RB6A 1H7WA 2DH7A 1ZZFA 4XPCA 3HZGA 1NJZA 4AE5A 4KE5A 3KLGB 1YJRA 3MEDA 2JRSA 2MJNA 3THPA 4AYBD 2B4OA 4J9MA 4CH1A 1HNZF 3CT9A 2ZC4A 1XMBA 5SUHA 1VQSA 2V5HG 1FKAF 2DGTA 2X3GA 2QA4S 1ZZNA 2BDPA 2DD8S 2GJ2A 4DR2F 1NJIT 6FDRA 2BQRA 5IQ6A 4LQ3A 4U7UK 2EFPA 1S1VB 1R0AA 3T9NA 2XMWA 2DJWA 5EGYA 5L1KA 4TY8A 2IJNA 5JXSA 3KHLA 3SCLE 5T7LB 1TFYA 4NMLA 2ZE2A 2JSXA 3DLJA 2NXUA 2KVIA 2PI5A 1TK0A 2E5HA 2MKHA 1PC5A 1JLBB 3ULHA 3Q8PB 1VQOS 1HBMB 3W2WA 2ROGA 2WK4A 1NK8A 1JXLA 2UV8G 5DQIA 2VG7B 3RBDA 2IM3A 1IJEB 2NZ4A 5KG0A 2B51A 2DGQA 2EW9A 4NX9A 2WSEC 4FPRA 4DBQA 5A0YB 2W4DA 3R5BA 4PQAA 2GHVC 2ZHAA 1S97A 1JJHA 3O5TB 1H2UX 2RMLA 3KWMA 3MPYA 1CG2A 3TYTA 3D0HE 2RJZA 2OMLA 4AXJA 1S1WB 4TQRA 3CCVS 1WTBA 2XS5A 1T3NA 4TNOA 5L1IA 3DLEB 3OR2B 3QWPA 2OTJS 3IG1A 3KKFA 1CVJA 2LDYA 2FVCA 2VG6A 4P7TA 3IAS9 3W7BA 4ED6A 3GYNA 1FRIA 1UVNA 2Q1LA 2U2FA 4DR4F 2ERRA 4C8NA 2FJEB 3T5JA 1NO8A 3HJFA 2YWHA 5FIIA 5B0BA 3WDOA 5CYQB 1RI7A 1IM4A 2E5JA 3FNNA 4K5SA 2JEGA 1UKUA 1WHXA 5CA5A 1JX4A 1LW0B 4ZDNA 1NJXA 2W8KA 2B56A 1IJFB 3QZ7A 4N56A 5LJ5Y 3KLVA 3HM9A 2EFOA 5AE1A 3CF5Q 4LF8F 2LKZA 2V2KA 4WYLA 5C5JA 4RBVA 4K5RA 4K0KF 2KB2A 2QYCA 1S79A 3PR5B 4ZA1A 3E01B 1Y3KA 2MY8A 5CQGA 3GV7B 2ZNZA 2BQ3A 2HRYA 3CB4A 3MF5A 2IBOA 3SCIE 3TQ1A 2GW8A 2IAJA 2KM8B 3DDKA 1N56A 3X1LB 4ERDA 4O4GB 1IBLF 4JBCA 4X4QA 1JLQA 3RRGA 3TNVA 3TUJC 4Y3CA 1JLGB 1M5SA 2R9LA 3CJ0A 2FLOA 2NS1B 4IFVA 1HBNB 2BXJA 2GMJA 2R7UA 4O23A 3M2VA 4C11A 1G2EA 4KTQA 3K0JA 2DRAA 1KR4A 2EFQA 5H1SV 5CYMB 2KXHA 4KQZA 3TUIC 1IUJA 5MAOA 2Y1JA 4F4WA 1X4GA 1YTYA 1Q53A 1XC9A 5DRKA 3MGJA 2W4PA 5KFQA 4WU3A 4Q2LA 1DRZA 1ZPWX 3CTRA 1NK7A 1YI2S 4IQMA 1VQ8S 3VAJA 4O3PA 2RE1A 2FVPA 4UUXA 2Q66A 4C98A 5E0OA 3SDEA 5J1PA 2Q6BA 5DETA 3LWMA 2F9DA 4YMEA 1HL6A 5D6GA 2WONA 3ENVA 1WHVA 1KTVA 4RLEA 1TL1B 1UVKA 3HT3A 4FXVA 4J9KA 3B8HA 1SKSA 1HWKA 3ZZUA 3CCWA 1U09A 2A18A 4MJKA 1G7CB 4OQJA 3T5HA 3EGNA 4UW2A 4O0IA 4WJBA 1N6QB 2DNOA 4X84A 3M8RA 2J76E 2LEAA 3E2EA 3HHLD 4NLYA 1SQEA 4PXCA 4PG8A 2VC0A 3SFGA 2XO7A 4ECSA 2KZZA 2GIQA 1WF1A 1FTCA 5KFOA 3MFHA 1LXJA 2V4JB 2L08A 2O66A 2VC1A 3ENWA 2CRLA 4HL9A 2C2RA 5BYQA 3OSPA 4B02A 3V4MA 2MZ1A 1TKTB 1WEYA