2QA4G

A more complete structure of the the l7/l12 stalk of the haloarcula marismortui 50s large ribosomal subunit
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
126
structure length
125
Chain Sequence
RKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLEDLNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVPNDIVIPEGDTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RIBOSOMAL RNA
publication title Structure of the base of the L7/L12 stalk of the Haloarcula marismortui large ribosomal subunit: Analysis of L11 movements
pubmed doi rcsb
total genus 13
structure length 125
sequence length 126
ec nomenclature
pdb deposition date 2007-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00466 Ribosomal_L10 Ribosomal protein L10
G PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1730 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qa4G01
5GADI 2QA4G 5D6GA 5GAHI 1ZAXA 3J7YI 1ZAVA 4V19J 5GAEI 3JSYA 5GAGI 1ZAWA 5D8HB 4NWBA 3A1YG 3J7Z5 4UY85
chains in the Genus database with same CATH superfamily
1U48A 3MPVA 1ICEB 3D6TB 1IWAA 2IAJA 5E3PA 4F25A 2MPUA 4QZVB 1IKVB 2KN4A 3DCAA 2QA4G 4JI8F 1ZTTA 2NPFA 1QTNB 3G6XA 2WZ1A 1M1KT 2LQ9A 2R7XA 4IFVB 1RKJA 5CXTA 3TUIC 3H4BA 5LJ3Y 3RW6A 3IAS9 2OELA 3FC9A 2XI2A 4OYMA 4ZPAA 6FDRA 1R0AB 4KR0B 1NJZA 2AGPA 2BW2A 5ETQA 4NCGB 5DDQC 3H0PA 4L72B 2N7CA 1UFKA 3I56S 2ZHOA 1RXOB 3CJ8A 4F3OA 4KV8B 5HK4A 1HNIB 3D3CJ 1XQIA 5M2UA 3V2UC 4C0HA 3TI0A 2P9GA 1UVIA 3DHXA 1I6JA 3IBCB 4K2JA 3LA0A 1TMJA 4GKJJ 2HLUA 1NUEA 1KVKA 2FY1A 4JB8B 1Q4RA 1MWZA 3J7Z5 5HO4A 1OYDA 4MFBA 2LECA 4Y0FA 4MMOA 2R2SA 4DV3J 2ZBRA 4A8OA 1ELOA 3W1YC 3TP2A 5KAKA 4QR2A 2L9DA 4AQYJ 4ZN3A 4AXIA 4ECYA 1TL7A 2AJ1A 2ZJQQ 1JKHB 4ZPVR 4C8YA 2ZHBA 3BO4A 1V3SA 3H59A 4K0KF 4D3GA 1SH3A 3TA0A 4ECWA 2HZCA 3R5JB 1GK8A 8RUCA 4JI5J 2QL5B 2BJEA 1Q7LB 3SFGA 4UTGA 3W61A 3DOMB 2BEFA 3NGTA 5ETSA 3H5UA 4YB6A 3TA1A 1HR0J 3OD2A 4GRSA 2YKAA 4LBIA 4RNMA 3GPAA 1QTMA 3KLIA 2IHR1 3TRGA 1NBEB 2B43A 1TL3B 2LDYA 2CJXB 2U1AA 2DD8S 3MUVP 4DR7J 2VASA 3BM7A 2VDHA 4NEZA 2I8EA 5CYMA 1PC5A 2QFIA 5JUMA 4DR1J 4HVZA 2W2QP 2XWYA 1KNZA 3PNIA 1T9XA 2KZZA 2QL9B 3EJMA 3BSCA 3OT9A 2WAQD 3OHAA 1VBYA 1RCXB 2YKNB 2KVIA 5K8OA 3GFZA 4RW7A 2DCLA 5D0GA 3EGZA 4DS4A 3IWLA 4WKRA 1VI7A 4Q7AA 4RW4B 2DGSA 2FHJD 4MIAA 4WFNQ 4DXLA 1R7IA 2BE7D 4BHQA 5FLXY 2AU0A 2KYXA 4QWBA 3EX7B 3R8YA 1I1GA 4OV6A 5CYJA 3VGSA 1ZAVA 4IDKB 2ZKUA 1KVJA 4RUCA 4NMLA 2XLKA 2XZTB 2RVJA 4QIVA 1MMLA 2DGUA 2QGFB 3TQEA 4OX7A 1T0TV 3OL8A 2CJKA 3UW1A 1N32F 3GFHA 2HFVA 5J1PA 1JXVA 2WB1D 3BBCA 3HCXA 2AW0A 3HI9A 1TFWA 4C0OC 1T03A 1B0TA 3ZTQA 4J9MA 1KLMB 4ES3A 4N47A 1X5TA 3K58A 3PM9A 1NSKL 3R5AA 3HJVA 4DG1A 4JV2A 1YTYA 3R7NB 2BM0A 2COLA 4ZVUB 1UP1A 2C3UA 1E6YA 3R9LA 1VR6A 2PD1A 3MEDB 5KOXA 4Y2CA 4U7UK 1YJNS 1P6TA 2R8HA 2HVEA 2HIQA 3CSKA 3KNAA 5GAHI 2CQIA 3AB4B 4ZVEA 5IC6B 4DX6A 1N88A 1UVMA 1TVRA 1ZOTA 2XZWA 4C8ZA 3QSIA 3HULA 3AQPA 5FD1A 3KFWX 4HL9A 3RB0A 4RU9A 3OFHA 4K5SA 4M5HA 2QX0A 3M8YA 4ALZA 4ED8A 3B6BA 2HNDB 1NDCA 4JI2F 2DR8A 2MQPA 2DBBA 2LP4A 1SQGA 2ROEA 3MM9A 1VQ7S 5LSLA 2F8HA 3W5YA 4C11A 2GW8A 3ZO7A 4QOTA 1M5HA 4M5DA 2HFOA 3JXOA 2NSBA 2DXFA 4ZA1A 2BJ3A 3EGWB 1HNVB 4JI0J 2R9LA 5AXMA 5KG5A 4ECVA 1CEZA 1SH0A 3CNQP 2J76E 4DR4J 2ZDOA 4HH0A 1Q81T 4CQ1A 5KFTA 1RWXB 3DDKA 2EI5A 4ZPDA 4USIA 4Q0BB 5AT1B 3PY8A 3I4HX 2WOMB 4NLOA 1UJ6A 4N76A 1JWWA 3OLAA 2YX1A 1WJ9A 2YNGB 4R0EA 2CNKB 3HSZA 2JVOA 1F2HA 2NXUA 2DXDA 4XO0A 1QSSA 4IRKA 3DDNA 3M9OB 4M8LA 3HSDA 1RAEB 1WC0A 3C14A 3TEGA 1XJWB 1PILA 1VQ4S 4PUOA 4F26A 3OJUA 1SH2A 1B64A 4LVNP 1KR4A 1BHNA 3CE8A 3HKWA 5MAOA 4R0JA 3W64A 4CWBA 4CH1A 1TAUA 4G3IA 4DX7A 1S6UA 3GIIA 3SZ2A 4TLRA 1U1PA 1S5ZA 1DHMA 4KGKA 5J2QA 3A4TA 3AA9A 4KO0A 4QPXA 4MJKA 4OI4A 1RSCA 1TP7A 2DRAA 1DQ8A 4OZ0A 2N3LA 1G1XA 3M1VA 3G8TA 2HQGA 2XHWA 4R8UB 3CCSS 1NKEA 5G0RA 2GGPA 2VIHA 1RT6A 1XEZA 4NA3A 2DR9A 3VZIA 4FS2A 2DHSA 1VK8A 4I67A 4PEOA 3I5BA 5L1KA 5KFXA 4LVOP 4NZ7A 1AROP 3T5JA 4J9SA 2RRAA 4OL8A 3NBPB 1JLFB 3W9IA 2H3EB 4RX6A 2MKKA 2VH7A 1UEKA 3DLLQ 3ZZPA 4DOZA 1FD2A 4DI6A 1RHJB 3WZ0A 2YX7A 3N6NA 2GIRA 1TKTA 3BF4A 4RUAA 4U67Q 4CT8A 3R2CJ 4A8KA 5F9NA 1VBKA 4CLTA 2N82B 1JLAA 4OYBA 4F0KA 1NDLA 4DSLA 2DGQA 3MM7A 1EETA 5LMUF 2P9EA 2BR0A 3VAKA 5AJ3F 3CDAA 3RAXA 2UUTA 1RTHA 5EWGA 4UUXA 2RQMA 2CA9A 1FERA 4OZNA 4LFAJ 1S6QA 5D8HB 1FK9A 4P71A 4OX6A 4RW8B 1NPKA 4G1PA 1JX4A 1CC7A 2JNJA 1Z2LA 2KM8B 2IRXA 1BC6A 3LW5C 4BLGA 1HQUA 5KFIA 3V4MA 1UETA 3KXDA 1RWWB 5FDLA 1RT1A 5L1IA 1L5UA 1IKWB 2ILYA 2ZC3A 3DXBA 1N6QA 1O8BA 1PCAA 2V5HG 1RTZA 2BOPA 1DBDA 2WSEC 1UA1A 3MD1A 4QU7A 3AD9C 3K17A 3DU6A 2VFVA 3OTCA 2H51B 2R2TA 3JYTA 3DOLA 5L8RC 3TEHB 2D7SA 1S0MA 2A2DA 4NLDA 4LIWA 2G13A 3G6VA 2DNZA 3M9NB 3MAAA 2HSEB 2VPZB 3I0SB 3I6PA 2PMZD 4KIAA 3PJ9A 3PKMA 2GHPA 1NK9A 3BSNA 4M63A 5HLFA 1NPPA 2PN6A 3GCWP 4MYUA 5HSPA 1FE4A 1RCOB 2M7SA 3GYGA 2IMWP 4B3MF 1XNQF 1F0XA 3HF5A 1S76D 3NNCA 4KY3A 3N6LA 3E8OA 3F41A 1HIYA 3OUYA 4J9LA 3HP6A 2Q6CA 2RDJA 3Q8UA 2YNIA 1KQFB 2Y1RI 2IDEA 2W7PA 1RT5B 5B0GA 2A3JA 1Z2ZA 1K0TA 1FWPA 3SSQA 3K2YA 1HHSA 2HNYA 3H42A 1VRQC 2GHVC 2YX4A 3ZTRA 2BKOA 3N5FA 3PV8A 1K73T 4GC6A 1QVGR 3EZ5A 2FC8A 1M5PC 3CIMA 3CC4S 4V19X 3S8SA 4DX8H 3QJPA 1U1KA 1PBAA 1JXLA 2AJ2A 3PHEA 1FNOA 4Y2KA 3J81j 2ATLA 4ENOA 4RZRA 1KQKA 2PDAA 2FJVA 2DISA 4B17A 2W2MP 4B3OB 3BYRA 3H5YA 1T9TA 3AODA 4C48A 2ZBIA 3J7A1 1ZZNA 1TUVA 4NE9C 4R25A 1JK9B 3N01A 5DDOC 5KG7A 4IFVA 1HWIA 1RT4B 2V68A 3TZXA 4UOGA 4P7VA 2QO3A 3QLHA 1UW4A 1R8CA 1HMVB 3TZWA 4N8NA 1BXNA 5EGYA 1R0AA 4ED5A 4NCGA 3VGVA 5GAHU 4NLTA 1UEVA 1VBZA 2YWFA 1X0FA 2RF2B 1TMMA 4YHHJ 4WWSA 5KFMA 4KV8A 4DV3F 1HNIA 5E5NA 1XNRJ 1APSA 4DQQA 1KBRA 2CADA 2LVWA 2L48A 1Q5VA 3CWJA 1CBKA 4AQYF 2RIJA 4H4OA 4ZVFA 1WG5A 2O01C 3G8QA 4A8FA 2JEGA 4BC7A 2VQFJ 2DGOA 1YJRA 3KDOA 4DL2A 2BOAA 4YR2A 1C0UB 1T94A 4IO9Q 1LWFA 1BUXA 1MU2A 4PWDB 1L3KA 1QSLA 3LP1B 2OIHA 2DNRA 2ABYA 3DNCA 1EARA 2KT5A 4DS5A 1KTQA 4QYRA 4C8NA 4YY3J 4I56A 1OQ6A 4CH0S 2AZ1A 1T8EA 2IA6A 3AXKA 4FP9A 1XWLA 3W5ZA 2DH7A 3V81A 1NH8A 4DR7F 1UL3A 1O51A 2C2NA 1R8BA 3NEKA 2X1GA 4F4AA 4URSA 4DCPB 2MKSA 4F36A 3O6QA 3RR7A 1R31A 2HBYB 3C66A 1ITPA 4A4JA 5CCLA 5HJYA 1NK0A 2L08A 3PJWA 1X4FA 4DEZA 4DR1F 3B4MA 1REVA 3MI7X 4DV2F 1A9NB 3OR1B 4OZLA 2ZH3A 1E6VB 3ZXWA 5D3GB 3HVWA 4LSZB 2KT2A 2NREA 5A6PA 4FF2A 2GJ2A 3U1LA 4QU6A 2FLNA 4EBEA 2F40A 2HQ3A 5KFZA 4CO2A 4NYZA 1RLCL 2ZJRQ 4HHUA 1DY3A 1FEHA 1FX2A 3L9ZA 2JOQA 2UVVA 3NGDA 1UZDA 1RWNB 4PG5A 2W24A 2QMUB 2Y3YA 3UD5A 3D0GE 3CGIA 4OZ2A 5FIIA 4HR2A 3DOKB 3FEXB 2SXLA 2YQ3A 2AX0A 2Y8YA 3NXZA 1IM6A 3TWZA 3CCJS 1QDUB 1NK4A 1PJ5A 1GH8A 2DEJA 1A7GE 4DLEA 4F2RA 1SUQB 3T6BA 1IBCB 3RRHA 1S0VA 1VHIA 4RNNA 1QJHA 3CDBA 4CZCA 1RGVA 3OTOF 1IQTA 1QVFR 4YOEA 4O3NA 3JSMB 4IDKA 3DC2A 2GX8A 4O3SA 1EIYB 1U6BA 5SUHA 1YHQS 2ZBPA 1H0HB 3L95X 4DMZA 2AGQA 4J9PA 3VR1A 2V69A 1FESA 2V6AA 2E1CA 1GMWA 3Q8QB 1X5OA 3CCZA 4I1TA 2AZ3A 2DHAA 4TYAA 5D15A 5CQGA 5KT7A 3UR0A 4FZVA 4HT5A 2CQ0A 2FHKA 5H9FJ 4ELVA 4ZJLA 5B08A 2HK3A 2DKOB 2ZBCA 1H72C 3NOCA 5F0UA 1WG4A 1N5TA 2HBQB 2OI2A 3Q8YA 1N34J 5K20B 4C7QA 3MMCB 5EHHA 3Q8RB 4LSLB 2GQCA 4NOHA 2GJIA 3TR5A 2ZH1A 4PQUB 2CQCA 4WU2A 4PWUA 4LREA 1CULA 5C25B 2WVEA 5I3UB 2DPJA 1U2FA 2MGZB 4ZDNA 2CPEA 4L6V3 2EEYA 3MEDA 2NXEA 1BWVA 2DH8A 1NK6A 4KYZA 2CJAA 2XM3A 2CG4A 4ZP6A 2HAFA 1JMTA 3KG1A 2Z58B 1VS3A 3RAMA 1ZM9A 4X4NA 4P73A 3QGIA 2C2RA 1M5KC 3UR3C 1TK0A 3M2VB 3ZZUA 5L1JA 5IC4B 2D74B 3GSDA 2DY9A 4ZVRB 3KYLA 2HNDA 5LJ5Y 1UMJA 3FUYA 4NRTA 1QY7A 4DR4F 4ZJOA 1S10A 4FVMA 1NSQA 1NMEB 3NAHA 3FQLA 1HNVA 5KTQA 2MSSA 1JJ4A 3TYTA 2RE1A 2FJEB 2YNHB 4FVCA 1FKPA 2XTJP 1FDAA 2M88A 3DLGA 4PRFA 2QTWA 4I4BA 2IM1A 2U2FA 3QO9B 2Z2ZA 2F4VF 1FJ7A 4ILRA 1X5SA 2N3OA 2VBZA 1D9DA 4RUBA 3EZUA 2WOMA 1KQGB 2OEKA 3ZZ0A 2E9RX 1HKAA 1Y10A 4HT7A 2MJNA 4UOHA 3RU0A 3M30B 1RU1A 4JBCA 3UN5A 1YI2S 4DCOB 4N77A 4Y00A 4A47A 2C28A 1SJRA 2DHGA 4TY8A 2B9WA 1RHQB 1Y9OA 3LP2B 4QWAA 2JH3A 2F3JA 2KG1A 4KGZB 2H4WB 1D09B 2R4FA 2XY7A 1IJFB 2C42A 2QYCA 2OH2A 1V5IB 4RO0A 2ZD1B 3QFHA 3IBWA 5CYQB 4DPOA 1EQ0A 4CCHA 1QM9A 4ILLA 1K0VA 4DFJA 2XNQA 4NWBA 2BE2A 3D3BJ 2YXLA 2KFZA 2VFTA 3OL9A 2I1RA 2LDIA 4JI7F 2RU9A 4EBCA 3K59A 3GCXP 3CTRA 3D67A 4P2MA 3VQTA 5LSRA 1F5CA 5FJ4A 3PFOA 2V8GA 4KC5A 3SCKE 4EK2A 2OPPB 1U47A 4R8UA 3M6WA 4ZPWR 2VJUA 3KHHA 2JHEA 2BA9A 1HBOB 4MK9A 4UOFA 5C2CA 4OI1A 2KXFA 2CNLB 2ZZTA 4UQGA 2NYIA 2DR7A 3NBPA 1FRIA 2B9EA 4Q2MA 4PG7A 3GIKA 4G1QB 1VQSA 5C2GA 4TU7A 2N4CA 5KFQA 5LSOA 1IKYB 4N41A 4K50A 1NU4A 3BN4A 1AA1B 1C0TA 4HYKA 2BJ7A 4JYAJ 2FVRA 2VD3A 3W8GA 2G1DA 4LFAF 3Q8SB 3LAKA 3MMBB 4U6PA 3BKUA 3M6XA 2OTLS 1U26A 1FJEB 4OX9J 2BW7A 4OMFG 4ZIWA 1S57A 1WD6A 3QWPA 2HVIA 1U8SA 2JRSA 1Q5YA 2P6TA 3TQ1A 3KLHB 2K3IA 2H5JB 1GXTA 1FRJA 5EUHA 5DQIA 3G8SA 4RW8A 3MR6A 3K5MA 4DSEA 1R27B 3BN7A 2XCPA 1D0EA 4USWA 2DIUA 1BGXT 2DGTA 5L46A 1FFSB 1HBNB 2VOPA 1S4FA 2UUCJ 3GWCA 3MR5A 4I68A 1EP4B 5HVHA 1S1WB 2X1FA 1IKWA 3RB3A 3VAMA 1CJVB 2MQLA 1N36J 2GAGC 2IVMA 4CTAB 1RAOA 3M8QB 1YLXA 1YIJS 2YNFB 2X3DA 4WF9Q 4K4SA 4E0DA 5EX3A 2NUHA 4DLGA 4ZPCA 5K9FA 1P27B 3I0SA 4CO0A 2GNKA 4ECQA 4EO6A 3C6TB 1F9EB 2R7UA 2E7VA 2I9SA 3D1OA 4F4XA 1QD1A 1X8DA 3HSJA 2JZ5A 3VF0B 1PJ7A 4I6YA 1LXJA 2KVQE 3THTA 5KG6A 3A1YG 2GVDB 2KYZA 1RA6A 5CD4A 2W4DA 2HNZB 3GB0A 4F7VA 1RWPB 3HMJG 3DLBA 1SKRA 1VQMS 3TA2A 3PKYA 3NP5A 1RAIB 3W3SA 2HFSA 4U9RA 3AT1B 1RT5A 3NMAA 1RHMB 5IS2A 3PVXA 3KK1B 2LU2A 3FK4A 1QUPA 3MOJB 4IFYB 2ZOFA 3BGLA 2UVRA 4OYWA 2AYGA 3O8WA 2BKNA 4JI6J 2KXNB 2DO0A 1S77D 1OO0B 3D6FB 4HEA9 2FJXA 3VALA 1V3RA 1RQ0A 3CCUS 4ANCA 2GVZB 5AXLA 2QL7B 1FKOB 2B5JB 1C1CA 1DJ0A 3R27A 3BH6B 4B02A 1Q8IA 1S79A 3LP0B 1VC0A 1RTDB 4ANDA 1SI9A 1FVSA 3PEHA 1RWKB 4TQSA 3ISZA 3BSAA 1LFWA 2CJQA 1RT4A 4IKAA 2ADBA 4YHHF 3MDFA 2EVZA 2Y8WA 1XNRF 2FYXA 4WFZA 1HMVA 2QMWA 2PA3A 1NZAA 2AMCB 1EKRA 3T1YJ 3BZQA 3I5CA 3Q86A 1Y3JA 1YRUA 3PW7A 1FCAA 4NLQA 4J9UE 3DRSB 1H73A 1W2IA 3LALA 4GVLA 5ETPA 5F8NA 2VQFF 4IG0A 2RKIA 4AD6A 3PX4A 1K1QA 1ZETA 4EI2A 5I3PA 3K57A 1X4HA 6FD1A 2V8VA 3W2VB 2O66A 3BGRB 4ZLLA 3HFKA 4YY3F 4C8KA 4Q2LA 1L3UA 4BS2A 1U1OA 4Z37A 4OI6A 3HZEA 1YJUA 5KFNA 2R7VA 1HL6A 2B51A 2QSWA 1JJCB 1YJ9S 3CF5Q 4OX8A 3C3LA 3CCMS 1GTEA 1UPPA 2UUWA 5HATA 5DG8A 4PG8A 3WIVA 2BJDA 2CDQA 3OHBA 4E2FB 5FLXU 1RISA 4E8UA 2W9CB 3CXCR 4ICLA 1Y4ZB 3PXGa 2ZNYA 2BRLA 4QYZK 4ES1A 4USTA 4M5KA 2MHNA 4GKKJ 2LKZA 4K2XA 3F44A 4LF2A 4TYBA 3M32A 3VGTA 3O44A 3R5CA 4J9VA 4HDHA 1H98A 4DR2J 3Q0AA 3BPSP 5L1LA 5A8RB 2NYHA 3F56A 2DNHA 3VCDA 2CQ2A 2LMIA 4M1KA 2M8HA 1O0PA 2LEAA 4JI1J 4YQWA 1E6VA 3ITHB 3R5DA 1SJFA 4V19J 3T5KA 3THPA 2CPJA 1HBUB 4I7FA 3IGNA 2VJVA 2D9PA 3DLEB 1G2EA 1CJKB 4OHVA 2PO4A 3OR2B 4KHMA 4DL7A 1TKXB 1H7XA 2K7JA 2QZ8A 2KHCA 5A8KA 1X4GA 3CIZA 4LT6A 2ZHAA 2Z4PA 3R6GB 1BLUA 5J2PB 1YBTA 3D0HE 3H98A 3P96A 3LO3A 1KFDA 1X5PA 5J2MB 1LKZA 4MYTA 2JFKA 3P5TL 5KFUA 1Q95G 3AD8C 5DZ6A 3K0JA 2W8KA 4F67A 2CQHA 2ZH9A 2CPFA 5ETRA 4DR3J 2XO7A 3UPFA 3C2PA 4IH5A 3EYZA 3MM6B 2PI5A 1SUQA 5GADI 3Q83A 3QNWB 3D4JA 2M9KA 3OXFA 4ZP9A 2ZH8A 4W92B 4NLPA 2XS2A 1T95A 3RBDA 2PC6A 3FSIA 4JV5J 3CCLS 1N33J 3JSMA 1HD0A 4B3RJ 2C3YA 3TVKA 3Q2SC 2JEIA 1S9EA 3FEZA 4OZ1A 3IBFB 4LRDA 1N4LA 3QIDA 4X4SA 3J7YI 1HQEB 2RQCA 3MR2A 4NZ6A 1D9FA 4Y34A 4DQIA 3CJKB 2M5YA 5KFJA 4KKOB 3UWTA 2BQ3A 4Y2MA 5HMXA 3GV5B 1N34F 2KH9A 3OFEA 3AY0A 3FFIA 2VFSA 2RQKA 5KFDA 5ETMA 1YZ6A 2KRBA 4ZKAA 2YPZA 1N8RT 4B9TA 2K2PA 1FWKA 3G6YA 2HURA 4QJVA 1M90T 2QSFA 4O0NA 1T05B 1JLEA 1GAOA 3MMCA 4CIOA 2ZKTA 1WACA 3PYDA 3PO5A 2HZVA 2E1MC 4AL5A 1LWEB 5ETVA 1QE1A 4PQUA 1N5SA 1JIHA 2Z30B 3VAGA 1WF0A 1YZ7A 5C25A 5I3UA 4PPDA 2QFJA 3G82B 3E01B 1KWMA 3C16B 1HNWJ 1TL4A 4JI3J 1FD8A 4PXCA 4LR9A 3GJQB 4AFFA 1RHKB 1IBLF 2FHOB 4NXNJ 1LFPA 3SSRA 3HFVA 3W66A 2AJQA 2OO4A 2E66A 4DF4A 3I31A 1V3ZA 4KJIA 3WQPA 1GX6A 3MMAA 4LUBA 5DM6Q 4ID8A 1M1HA 2MZRA 3M8PB 2GHWA 3TAMA 4WYLA 2YNHA 3ZZRA 4NYPA 1BQMB 4PZVA 2B9YA 4O4RA 4DSFA 2BBEA 1JLGA 4FDFA 3RBZA 3UNYA 2PEHA 1I3OB 3Q8PB 1AXQA 5KFFA 2UXDJ 1CLFA 4F8RA 4Y28C 2RQ4A 2DNQA 4PQAA 1IN0A 2IYGA 1VLOA 2H5IB 4LRCA 4TXSA 4QIWD 3D1HA 2GZOA 2OEJA 1RTJB 2GAHC 2GIQA 3UN3A 4DX5A 1UCNA 1MLAA 4WE1B 1FA0A 1H6KX 3RTVA 2HAIA 3AD7C 3MEEB 4DR6J 3CDUA 4X66J 4ZCIA 3QAEA 1VQKS 1PBUA 3W9JA 1UJ4A 1TL1A 2K3KA 3DLHA 1Y5LB 1J27A 1WEYA 3P45B 1ZM2A 5ETTA 5AE1A 5IWAJ 4EBDA 4YDXA 3KDNA 2C2ZB 1BQXA 4X65F 2KFYA 2FLOA 1Q8BA 4GMKA 5AE2A 2FZCB 4WFBQ 2VQEJ 4LR7A 4ES2A 1IXKA 4NLGA 3KWMA 4NA2A 1S48A 3IM9A 4C2MA 4OI2A 4ED4A 4ZHRB 1XR6A 5LM7E 4KE5A 1QAJA 4U96A 4NEYA 2QIFA 4QCLA 1HBOA 3FZ2A 4YS2A 1XIQA 1GMUA 4JUZA 4USKA 2MQQA 3CD6S 3F73A 4WIIA 2J8AA 1KLNA 1S6OA 4ZCKA 1NJYA 4A8QA 1SL1A 4NMXA 5LL6d 2FHMA 1HLWA 3A3OB 4EUVA 2FVPA 1WC3A 2AP6A 1C2PA 3NGSA 3I9ZA 4WFXA 5HANA 2VG6B 3RZAA 3GE9A 4TN2A 4GC7A 4G1QA 2XYHB 4QR1A 1JNZB 3QYYA 1T11A 4FYDA 3EVOA 2Q43A 1IKYA 4FPIA 1KQSR 2NZ4A 3BGUA 2YWWA 2C3PA 2RD5C 1O6XA 4RW6B 1RWMB 1DQ9A 1BQNA 3TOQA 2ERRA 3JB9k 1VRUB 2GQQA 4OYPA 4KGMA 1Q7YT 4DL6A 2CQ1A 2UUCF 4R5PB 4DFKA 3KLHA 2VV5A 4Q8EA 1U8WA 2LQJA 1N36F 2KKHA 4K8RA 2CWXA 2VPXB 2H65B 2V50A 4M5GA 3LWLA 3PW0A 4OYZA 3L3CA 2EK1A 1HBNA 1SKSA 1WEXA 5I42B 2V8DA 4EWTA 3MR3A 3MAHA 4KT0C 1VLYA 5KFPA 3AH6A 2XMWA 3R3TA 1SL2A 3C19A 3S7RA 1Y0HA 2F9DA 3US5A 5E0OA 1RT7B 4OJ1A 3M8QA 2BDPA 2FY8A 2IFXA 2YNFA 4CP5A 2YWGA 2IMOA 3CJ5A 3BDPA 3GJRB 3ZZYA 3NNAA 5AE3A 3G2XA 1FWLA 1VQYA 1NHKL 5KG0A 5I3QA 3KK3B 4YR3A 5D4LA 1RAFB 1IR0A 4CLUA 1ZBTA 3C6TA 1FJGJ 2CJBA 4FBUA 3IR5B 2H9ZA 3FBFA 3UDEA 2H54B 4ZVOB 4XAKA 3RR8A 1J5OB 4K4VA 3B54A 2OPRB 1FKAF 4UY8T 1KOOA 4RBVA 5EX0A 3SFUA 2PA8D 4M5JA 3KG0A 3UDCA 5LOQA 5A8WB 5GADU 2VKRA 2HNZA 2OFGX 3KHRA 2CAJA 3QGHA 2L3MA 3TARA 3CVKA 2OPSB 3VAIA 2NQPA 2QRRA 3FSYA 1SC1B 2JEFA 1FNMA 1U2RA 3JTPA 2BX6A 2RT3A 4H4KA 3J7YU 3DHWC 3T6JA 4LQ9A 4CRJA 2DGXA 3GQCA 4XTTA 2LU1A 4XPCA 4IFYA 1S7IA 4JV0A 2E5LJ 2E1RA 1N5QA 1XMQJ 2ZOGA 2Q6BA 2GCFA 2ZFHA 3HHLB 3MPDA 2AJ4A 3HD1A 1O5JA 1VDHA 3W8PA 1A6LA 4WP8A 4LIRA 4TVAB 3OVAA 3ICLA 2CNOB 3SIPB 2F4FA 3P3DA 2XEXA 4OI0A 2HHPA 3VV2B 1N5YB 2OD4A 3MEGA 2B5JA 4HLBA 4S0MA 3EDQB 4WBFA 4B9UA 2E1PA 4FS1A 4WZQA 3DGVA 1S59A 2ASYA 2MLZA 5DS7A 4U8VA 1OS5A 1UWAA 4XDCA 4ZLJA 1KTVA 3PRVA 4WZMA 4LF9J 4IQMA 4ZPBA 1SXLA 3THVA 3E3XA 2C22A 2UUAJ 1LWXA 3CCES 3V6DA 3UVJB 1DTQB 1RU2A 2XMKA 2R8IA 3IO1A 3ADAC 4LRFA 9RUBA 2XS5A 4DL0C 1S1VB 2G0CA 4ETZA 4KRWA 1QAYA 1HHTP 2ZNZA 1DZ5A 3VWSA 3KJVB 4YB7A 4B3SJ 3IN5A 3H5SA 1RYSA 2KB2A 2MY8A 1URRA 2NLWA 3W65A 1DTTB 3SQGB 2HQFA 1ACMB 5H9FK 5L39A 4DV1J 5DO2A 2AYMA 1WKJA 4ZCMA 3FVYA 1C1BA 3OSNA 3W2VA 2J0QD 3M6VA 3BGRA 3SDEA 6AT1B 3BKFA 3T41A 2Z2MA 3HHNB 2A0FB 1TKZB 4WPAA 2CDRB 2C2OB 1HPZB 5BR8J 4NXMF 3M6UA 4TLQA 4OHWA 2V8HA 4IH6A 2W9CA 2ZE2B 3M2RB 3VAJA 2ZZNA 3MR7A 4DR2F 2HGNA 1F9HA 3CJ2A 3NAIA 3QRQA 2K7KA 2JC0A 5GMEA 3W2WB 4JI1F 2VPYB 3OVBA 3FMBA 2Y9HA 5CD4H 2CPHA 2CYYA 5GAGI 3FGVA 4LF6F 1S72S 2RAQA 3NCRA 1JJ2R 5A8RA 2HHUA 2AEJA 4C8OA 2ATCB 4DL4A 1V6HA 4X64F 4XDDA 3TO8A 4WFAQ 1GXUA 4WU3A 2B56A 4PYAA 2F8EX 1RUSA 1CJKA 4IUFA 4DUZJ 3BSOA 3SYZA 4J5OA 4MAKA 2LXUA 1TKXA 2YKMB 1L3TA 2XNRA 2Z2LA 3BV8A 5IOLA 1RT3A 5D4OA 2A6OA 4WFYA 2G4BA 4U8YA 2QLFB 5J2PA 2QLBB 2JLFA 4JOUA 1OPZA 3HVTB 3HSGA 4PAAA 3GG1A 3D1QA 4X4OA 3OL7A 2RH3A 1HI1A 4CLFA 2ASDA 2AQ4A 1GTHA 5J2MA 4JV5F 3OSPA 1TKDA 2O5DA 3MCSA 1U25A 2JJ4D 4ZVHA 3K7RA 2OD6A 1HW8A 2VZ9A 3MM6A 4B9NA 4DZ6A 1UPMB 4OLOA 1YX2A 3NCPA 3UD4P 3AJDA 2VHGA 4O44B 3T9NA 3OL6A 2Z2YB 2Z0GA 2UV8A 2B4VA 5J2NB 1HQEA 2GMLA 3BGOP 3GR1A 4DF8A 3BEGB 3CCTA 3CJKA 1UEUA 2VG5A 3IC1A 5AXNA 4KKOA 4PCQA 1F60B 3PG9A 2KJWA 1URNA 3VQSA 3V6JA 3JTOA 1HYSB 3KJQB 5F8JA 4LFCJ 5KT6A 1YVFA 1ZYQA 4RLEA 2RB7A 2BXJA 2EXUA 3P49B 1MROB 5C5JA 2BRKA 1Y7PA 1B7FA 1WOSA 4MKBA 4DL3A 2PSZA 7FD1A 1HNWF 3JQKA 3ZNJ1 4P2XA 2XYGB 4JI3F 3A8IA 1G3OA 4OI3A 3LWMA 1UKUA 1KHVA 1WUUA 2G1HA 1WI8A 2ZBQA 3IMQJ 2IJNA 4A8MP 3EGVA 3D6HB 2W25A 4LRAA 1Y11A 3BO2A 3G9CA 4DPWA 1NLKL 3G82A 5HI7A 2ACMA 1HBMA 2QG9B 2XGPA 2XSFA 1FXLA 4K4YA 5CYMB 1MMNA 4ZLNA 2Q66A 4C8LA 5HROB 1QSYA 3FZBA 2ROGA 3M8WA 3BQ2A 5KFGA 3AA8A 3KLFB 4UT4A 4BWMA 2AT1B 2HG4A 5T7LA 2F8MA 2EG1A 3SV3A 4RNFA 4BCAA 2PE8A 3ZNUA 4HTIA 2FLPA 2NCKL 2MQNA 4I2QA 4J9QA 4A8SA 4Y65A 2XQCA 2FJDB 1JJHA 2UXDF 2FD2A 1JXEA 1T7PA 3EXYA 2V4QA 5D77A 4Q44A 1BQMA 1CJUB 4QW8A 2AV5A 3BDEA 5GMKa 2VDIA 3DLJA 3WC0A 3ET6B 5LXRA 5ETKA 3K5LA 4DR6F 1GMWD 4X66F 1VBXA 4KGXB 1W2BR 2F65A 1VK3A 5KFCA 2R8JA 3QZ7A 4O4GB 2ZH6A 5HBMA 1RTJA 1Y5IB 4QQBA 2PMHA 2G2ZA 5IWAF 2D41A 2AYBA 5H1SV 1BMQB 3UCZP 3TVZA 5EDWA 2KM8C 2HMIA 2HBRB 1I94J 3OW2R 3CD5A 2YWHA 4DV5F 1OQ3A 1SPBP 4OHXA 2FZGB 2ADCA 2DRDA 1HWKA 2WK4A 5KT3A 3EZOA 1JNRB 4FKYA 3B82A 2HLTA 3NKYA 1N32J 4DG1B 2W7AA 1IKXB 3QIPB 1B99A 4RWWA 2FIUA 5KFWA 3FRZA 2HHHF 4MIBA 2EBGA 1UTAA 3BB5A 3IWNC 2CQ4A 3TJAA 2XLJA 3OXLA 1WC1A 4ED1A 2DNOA 1X4CA 2QJ3A 2FUG9 4NI2A 1IBMJ 4ZHRA 4LQ3A 2UP1A 5F3ZA 1NHVA 4OJGA 1GX5A 4ECSA 5E3RA 2HBZB 5K14B 2MQOA 1G6BA 4WP9A 2K8GA 3MOZA 4UZCA 3V6HA 4RL1A 3H20A 4MT1A 5L9NA 2BQRA 4F0MA 3NWGA 3FKBA 4O3RA 3MM9B 2OUGA 4QBUA 4QWCA 5GMDA 4I69A 2VG6A 2A2CA 4DR5J 2UUBF 2MDAA 2QMXA 3ENWA 3MZIA 1U2CA 1LW0A 2HVZA 3M8ZA 5BYQA 2HWIA 3AB2B 1X31C 4JI2J 3IFEA 3FNNA 3NG8A 3GV8B 2FDNA 3FBBA 5THWA 2R2RA 4C3KA 2CQ3A 1XERA 4K5RA 3LH2S 3EMTA 4ECUA 4CYUB 4DV7F 2JEJA 2DITA 2B9XA 1RBAA 2CPZA 3U27A 1S1UB 1CPZA 3SCJE 3OTDA 5GAGU 1KFSA 4KFBA 4DV6F 2IC3B 3JQJA 4WTYA 4O23A 4DQPA 3CD7A 4DCJB 1YGYA 5I42A 3D2WA 2QC3A 3C14B 1LXNA 4K4WA 1F3VA 2BANA 1HWJA 1TV6A 3ILOA 3UQSA 4PPZA 2LEPA 4PXBA 1BE4A 3X1LB 4EZ9A 1FI4A 3K8VA 1RT7A 4EZ6A 1ZA2B 1FJGF 1YJTA 1WWHA 2KFNA 1RADB 2ZH4A 4LF1A 5IM0B 4AL6A 4ED7A 1ZAXA 4NLRA 4IG3B 2UXBF 3KK3A 2KHDA 2W7OA 4L3KA 2P6SA 1DQAA 2MKJA 2MTLA 2GGPB 1R3NA 3MF5A 4Q8FA 1VIXA 1HNXF 2I5JA 1NCLA 1J5OA 2MZSA 3J7ZT 1MW7A 3I5AA 2WHOA 2HK2A 3CDEA 3QJLA 4AT1B 3QBCA 1NXIA 1KSPA 2QA2A 3CJ0A 3RJMB 4HACA 1XMQF 4WXOA 5KT4A 3J7AN 5IT0A 1HI0P 1JLCB 2OPSA 1HI8A 2J7UA 1S0NA 3FBCA 3MCMA 1AZSB 4JI4F 1R8HA 1U02A 2K1RB 1RTIB 5B0FA 2WVCA 2LQ8A 4DU8A 2MQ8A 1U0SA 1GXLA 4MKAA 2F5GA 1U6ZA 2NUUG 3TVYA 1TKTB 2JWNA 5CCMA 3CULA 1DAXA 3MPWA 1VYAA 5E3QA 3QPIA 3HHLA 5IXUA 3DM2B 1RP5A 1YJVA 2OSQA 3AJ1A 2MHEA 4C3MA 2W9BB 1JLAB 1X9SA 4JP8A 2GA7A 3C46A 3KJNB 1FDBA 4PG6A 4LF9F 1UWBA 2KO1A 3V6KA 2FJWA 4CLKA 2ZEJA 2UUAF 2PI4A 1S6QB 2GJFA 2OEMA 1FK9B 5B09A 2B7BB 4USVA 2AYEA 3RUBL 3HHDA 3NGKA 1HQUB 3RYLA 2FTRA 1VIOA 2NS1B 4O3OA 3BBFA 3FMWA 3D6MB 1RAGB 1IKVA 5DETA 3UVJA 1DTQA 2ZDPA 3LAMA 3R1HA 4A8XA 2EWHA 4CM0A 1N6QB 1VOMA 1V5VA 3NS6A 2E7XA 1FTRA 4PR6A 1K47A 3KJVA 1PC4A 1U7LA 2APOA 3P6YC 3DOLB 1KEKA 2H48B 2BYCA 2D3O1 4IR9A 1VMBA 5BR8F 1XC9A 4GKJF 4FYYB 3I4PA 1QAXA 2Z8QA 2HRTA 2IIHA 4JV1A 1SCJB 2J6TA 1CQNA 3WX8A 3U1MA 4P6QA 4U7CA 2KI2A 1TKZA 5DDRC 1ULRA 3N4WA 5HLFB 3J81U 2EFPA 3CCWA 1HPZA 4L73A 3KUHA 3I0RB 2RNEA 2HHWA 4AUKA 4KSEB 4H4MB 1TK8A 3JAMU 2DRBA 4OJ3A 2RSQA 2YNIB 1M5SA 3M2RA 1ZS6A 4I2PB 3TJ8A 4JI5F 1R8PA 3GU0A 4C3LA 4ZP8A 2XI3A 1CJTB 2V2KA 3MEKA 1SBRA 4B3MJ 1NH7A 3OVSA 2FQQB 1JKHA 1HR0F 1NJIT 1TUWA 4AE5A 4KHPJ 1VC5A 4EU0A 1IWGA 4X62J 3ETOA 3PO4A 3Q24A 4J9RA 3IP0A 2DJWA 1PG5B 4MTPA 5D6GA 1LK7A 3DOMA 4EEYA 1KD1T 2CPDA 1XTZA 3UDLA 4I6AA 5C42B 3MMJA 3OTEA 3HVAA 3DDIA 1PSDA 3IR6B 4OYXA 3BPDA 2HS4A 1ZZFA 4F3MA 4W90B 1TL3A 2ZWOA 4I0WA 5HQ8A 2LQBA 3WIUA 2W2NP 3Q22A 4DPUA 1B4SA 2IPOB 2YKMA 2HQIA 2HHQA 2J9DE 4URQU 4QWEA 3JSYA 4PXDA 5CHCB 3CCRS 1W7WA 3QLHB 1H3DA 3H5XA 3HVTA 3R5BA 2G0IA 3TUPA 2CPIA 5JJBA 1U1MA 2XWXA 3POTB 3S01A 1OSCA 5IQ6A 3EPGA 2NR0A 1A0OB 1HNZJ 3BO3A 2R8KA 2M0GB 2RJZA 2EFOA 5D4NA 4X4QA 1AUSL 2F63A 2DNGA 1P9YA 2NZCA 1QLNA 2YKNA 4F02A 4DWIA 1T3OA 5HQMA 3ENVA 1H74A 5I4MA 4Z7CA 3BJYA 1FRHA 1YG0A 4J37A 3W5XA 2M8DB 4X4VA 1RYRA 4H4OB 2KXHA 4FYXB 4O44A 4IQXA 2WONB 2DNMA 2DNNA 2R3VA 2XULA 1LOUA 4RW4A 4LFCF 1NDKA 4DPTA 1FVQA 5J2NA 2XCAA 5IV3A 4J9OA 3K89A 4CNZA 2XMTA 4C9DA 1N0VC 1LWFB 1MU2B 4X4RA 5F8HA 4IOAQ 4N56A 1U4BA 5LMNJ 4OFZA 4QWDA 3HK2A 3QMQA 2IJRA 5IT9Y 3ZZZA 1NKBA 4LBHA 1HYSA 3AQOA 4F4YA 2C1EB 1VQPS 4MH8A 2J7WA 2RUGA 3V81B 1MROA 8AT1B 5GAEI 4I6WA 3S1TA 1EJ7L 3LGNA 2MKHA 2CQBA 1X4EA 2JSXA 5J1EB 4CLLA 1S9FA 1KLMA 1Y5NB 1SQFA 3IR7B 4ZVPB 5CAAA 2PFFB 1NEEA 3M8RA 5B0BA 1REVB 3GYXB 4OZ3A 3P4UB 2WRMA 4DPXA 4PKDB 3EPIA 2VBYA 3JSBA 3PHTA 2WW4A 3OJSA 4Z2XA 2FVSA 2RMLA 5HROA 3PYFA 5DLFA 1OJ4A 2ZVIA 3KLFA 3GMGA 2BV3A 4NA1A 3LPYA 2VBWA 1IR1A 4DV2J 1S1XB 2QN6B 5F9LA 1WI6A 2PIIA 5M2PA 3TANA 2A10A 3HT0A 3UNGC 3L4BC 1VQ5S 2R7WA 3CPWR 3KNGA 5HMYA 2MLXA 2G2OA 3DRRB 4UOCA 1TZ0A 3DRXA 4JI0F 2NXJA 4C97A 1EKSA 1Z1ZA 3CMES 4A8WA 3ILIA 1Y3KA 1CJUA 1C4AA 1MSWD 5KFHA 3ET6A 2GFFA 5F8IA 2MY7A 3MGJA 3M8SA 4QIEA 1I94F 1YWXA 2V8PA 3N5BA 3PRDA 3A8JA 3WHIA 3FQKA 5A76A 3MAQA 4CO1A 3ETMA 4O4GA 1NK8A 2WBRA 4DHVA 3PX0A 2H4YB 1WHVA 5H9EK 2YVSA 1FO1A 4Q0BA 3OTOJ 1M5VC 2DT9A 1RZMA 4WCEQ 4F2SA 4M5LA 4OYOA 3H2UB 1NHUA 2WSCC 3NNHA 2YNGA 3HDSA 3LGHA 5D4PA 3EWGA 3B8HA 2CJYB 3CEDA 3G86A 4OHZA 1HA1A 1UJ5A 2AWZA 2MMYA 2XO6A 1ZPVA 3UCGA 2UVUA 2MKIA 5A2QY 1Q53A 1IBMF 2PEBA 1IKXA 3QIPA 2C3OA 2I0XA 2R42A 1WOPA 2UXCJ 1KN6A 1UVLA 3CJ4A 3QT6A 3Q2TC 1M1GA 2W2PP 3E51A 5KG1A 1CULB 2IA0A 2J9EA 3K5OA 5F8LA 3SCLE 4QYZJ 2C2MB 4DV4J 2AJ0A 2OHDA 1LWCB 1KC8T 2LXFA 4WXWA 4J91A 1OY8A 1PIEA 4DR5F 1LK5A 1SJ1A 4HI1A 5K14A 3ZZOA 4P2FA 4UUWA 2EFNA 2V0NA 4A46A 4UZBA 3S6EA 2IVYA 3EUNA 2N7YA 1RLDA 2HHXA 2GIFA 1WSRA 5JMNA 2C2EA 1LQ9A 1RAAB 3N0VA 4TNOA 1U45A 2FC9A 1Q16B 3QAUA 1RB0A 4NX9A 4H4KC 3ILLA 4QPTA 4ED0A 2MB0B 4DN0A 1JLFA 3CW2C 1AFIA 1FKPB 5AXKA 2MKCA 1GEHA 3DLGB 2CJ9A 1VJWA 1UAWA 2BABA 4K59A 3C6UB 4Q43A 3B78A 1YJ7A 4CYUA 1VGYA 1R43A 4F4WA 1ZM3A 3LOUA 1LW2B 5M2RA 1S1UA 2EG2A 3QFWA 4M94A 1IBKJ 4HTJA 2DEIA 2IC3A 5HP1B 1GT8A 4EGLA 3MURP 1VQ6S 2DK2A 2F4VJ 3GSIA 4TY8B 3T3FA 2BUNA 4K7QA 4PWWA 4ERDA 4BBYA 5ADZA 4CLWA 4YR0A 3TX8A 3GYNA 2YKPA 1UVNA 4ZLPA 3U1NA 3NGUA 2Q79A 1S9GB 3RAQA 3VAHA 2AGOA 4CLPA 3TNVA 3BH7B 1EZZB 1UVKA 4WK3A 4PXEA 4CO4A 1RHUB 5IM0A 2DTJA 2JFDA 2BE2B 2XMUA 4TY9A 3GFYA 5L9XA 4IG3A 5HVGA 3CMQA 1WOOA 2XY6A 2BMBA 3GR0A 3AFGA 1Z4UA 2P8IA 1S49A 1IVZA 2H1YA 2IJFA 1VHFA 2D69A 5JXSA 2ZC4A 3ZZTA 2W4PA 3W9HA 3CC2S 3NL0A 3M7VA 4JI7J 3H25A 2LA6A 3PR5B 5ETLA 4F50A 8ATCB 3N9UC 4FXWA 2D1CA 1CS4B 5IV4A 4ZJQA 1JLCA 2YQ1A 2FB0A 5EN1A 2R7TA 3D9BA 2HFZA 3WC2A 1AZSA 1F2GA 4MKYA 2GMJA 3T1HJ 3EXCX 1B0PA 4EFAC 5DLGA 2K1RA 1RTIA 2M2BA 2EFQA 5B0AA 5KOWA 7AT1B 2ILZA 1C0TB 1F3FA 3RG6A 3I55S 3KUGA 4P7TA 1D9AA 4DUYJ 1GFWB 2ASLA 2NXCA 3LGMA 1PYOB 2RS2A 4EYIB 3MTJA 3DM2A 5KT2A 1WTBA 2WVBA 4WYWA 5IT4A 2ZUGA 4DU7A 2W9BA 1HFEL 1SC3B 2DR5A 3R7BB 2XYPB 2J7KA 1NAQA 3M4XA 4RUHA 4YP3A 1TFYA 2CFXA 3VVTA 3UI3A 2HVHA 5GAEU 3A12A 1NJWA 3DRPB 2B8QA 5KFAA 2VG7B 4FN5A 4K4XA 4DSIA 2JLGA 1C4CA 1N5VA 4F0HA 3H2VE 2J6UA 4LMZA 4B3OA 4OIXA 4KBIA 4A48A 3JSRA 1S6PB 4LF5J 2D9OA 3GJTB 2EKNA 2LLZA 2EC2A 2C3MA 3I96A 4CH7A 1FJCA 1MG7A 3KKFA 1NB2A 4C8MA 1JLBB 2DPIA 2YKQA 1IQZA 3G71S 3MPYA 3DRYA 2RF2A 1HW9A 2M3DA 2F1FA 4B9LA 2XSJB 4DV0J 1P8GA 2ZH2A 5DQHA 1CVJA 3RBXA 2FVQA 3T19A 2HEKA 4W98A 1WTFA 1IJEB 1MNEA 1PAEX 1RT2B 3RB6A 2CZ4A 4LF7J 3I0RA 2ACYA 2IM0A 1RAJA 2HHTA 4H4MA 4KHPF 3BR8A 5CZXA 4X62F 3I9V9 2P2CB 1C0UA 4ZVSB 3GONA 5A0YB 2HZAA 4I2PA 1SJ3P 4P9SA 4PWDA 2YTCA 3LP1A 4KGVB 4NL5A 3U02A 1WDTA 2B7CB 1CJTA 3NS7B 4X84A 2CZ9A 2DNPA 4LFBJ 1V9OA 3CJTA 1KVIA 5SZTA 3MHYA 4ZN1A 4L74A 2XZDB 2D3ZA 3D0IE 3KLEB 3HD2A 1ROFA 1NDPA 1U1NA 2XMMA 5DZ7A 2P5VA 3SI8A 4WP3A 3PZPA 2GV1A 3QT7A 1WC6A 4HHHA 5KFKA 1IM4A 5C42A 5KFEA 3IS9B 4DFMA 2OFHX 2I38A 2LEBA 3IRXB 3DYAB 4DDFA 2W8LA 1J5EJ 1C1CB 5BYRA 2MXYA 3QGGA 4Y2IA 4FBTA 2CQPA 3KHGA 3FCWA 3UD3P 3LPEA 3OR1A 2W4CA 2X3GA 1HNZF 5D3GA 5DGAA 1FHTA 1X4AA 3BGFA 4ZVGA 4ECRA 3IGVA 1NSPA 3HT3A 4E98A 1X9WA 1K1SA 1OPIA 1VISA 3VAFA 3SMZA 1OYEA 4WJBA 1YBAA 3POTA 1F5AA 5CZVA 1VQLS 5BJRA 3MD3A 2XY5A 2XG8A 5K8NA 3OXGA 1X4BA 2E9TA 3EGNA 3G87A 1UFLA 4LF8J 4ZMMA 4IG0B 2RKIB 5C7PA 1SC6A 4RPFA 2ALZA 2MKYA 3N28A 3MFHA 1PYSB 2B0GA 2BZ2A 4U7UD 2YY3A 1PAUB 2LFVA 1XMOJ 5JVHQ 1T9UA 3DOKA 1HHQA 5LMNF 1WNEA 4ZP7A 2QT7A 1K44A 4RR5A 5F41A 4F4ZA 3MTKA 3C15B 2WONA 1Q0NA 1HD1A 5HJXA 1RWUA 3BS9A 3OPKA 3A8KA 3JTNA 2DYAA 2IM3A 2BM1A 3J80Y 3AHPA 4UW2A 2IRYA 1YJWS 3P5BP 3KMQA 5E33A 2FHJA 4ICLB 1FFWB 4UF4A 3QATA 1TL5A 1M0SA 2H5EA 2DIVA 1RBLA 1YK9A 3IG1B 2M4MA 2KT3A 5RUBA 4LF4J 1S12A 2EFGA 1YBUA 4CI0B 3EVWA 3DMJB 3M32B 1EX8A 2WB4A 3T9ZA 4QR0A 3LANA 4XK8C 5J1EA 2QLXA 1Q1KA 3ELHA 4KH0B 1SVDA 2OGUA 2R8GA 1Q8LA 3PACA 3VHQA 3E2EA 3ONQA 2HS3A 3EDRB 4ELUA 2RHQB 4OZ5A 2IM2A 3GIRA 3QGPA 4EMDA 2FZKB 2RRBA 1W26A 4LSLA 3ZTPA 1N0UA 4I7FB 4P2SA 1F9FA 4GO7X 1AUDA 4TU9A 2MGZA 4IYQA 2R7QA 4KHRA 4RBTA 4L75A 1R6YA 4O0IA 3JQMA 1OWXA 3NRBA 1S1XA 1YRXA 5A8KB 3K5PA 2EFVA 2Q3PA 1MWQA 1S1TB 4ECXA 2YPYA 3CUNA 4IR1A 3BQ1A 1N56A 2E5HA 4K4UA 3RW7A 3PW5A 2L9NA 5D0HA 3FRYA 2Y1IA 1JQGA 3M2VA 2J6SA 3DRRA 2OMOA 2RS8A 1N52B 3GP9A 4ED2A 2AHOB 1TELA 4YUDA 4QW9A 3FCHA 2O67A 4ANEA 3CO0P 2E5GA 3DXSX 2B4UA 3TAQA 1TUGB 3VZHA 1NNDA 5L38A 3M2UB 1XN9A 5HMZA 1AYEA 1S97A 1NK7A 1QUVA 2MQMA 3W7BA 1U1RA 1S9EB 4B9MA 2ZITA 4MKVA 2KRRA 3OQ2A 2LQ5A 3V5RA 2A6MA 5EWFA 1DFDA 1D8ZA 1TTHB 2IRUA 3KLGB 4NLUA 3QO9A 1PYTA 3ZC4A 2IVFB 4FYVB 4WK1A 2M52A 5DJBA 2CXEA 3KLVA 1SV5B 5KG2A 3OTBA 2UXCF 3FFIB 5J1NA 4ECZA 3M30A 3R6LB 1K8AT 3HHKA 2YWEA 3GV7B 3KK2B 5KFRA 2HRUA 4CO3A 4NLSA 3CCQS 1RDRA 1U09A 2VPWB 5HMWA 3LP2A 1JLEB 4DV4F 1SC4B 2L41A 2KG0A 3HX9A 2AIRB 2HFNA 3C8YA 4WKYA 2V34A 4RBUA 1QE1B 2EK6A 3GIJA 3IAM9 4YN3B 2VKZG 2P9CA 5K5MA 2XGQA 2ZD1A 4IOCQ 5CYQA 2V9KA 3RGIA 3H90A 2VC1A 2A1BA 1LWCA 4QIGA 2CZVC 2DY1A 2OPQB 4FXDA 1XBWA 1G7CB 2HW3A 1NPRA 4Y3CA 1NSAA 2DXEA 2OPPA 3KHLA 3O2IA 3PYEA 5DGBA 2HWTA 2VONA 1T02A 3KG4A 2BQUA 3LUYA 2VFRA 4PYDA 5C24B 1T3NA 4MK7A 3CDWA 1R89A 3MMAB 1SJQA 2UZAA 2HIYA 1YDLA 4IO1A 2ZH5A 2D3UA 3T5LA 4JYAF 5JVGQ 2ZWPA 3UCUP 4RW9B 2A18A 1IBLJ 4P52A 2OMLA 3HFZB 4DFPA 2OTJS 3TAMB 2VF3A 3OFGA 4OX9F 2HGMA 3TW0A 4XPEA 2AX1A 1WG1A 1IBKF 1JLGB 3HHLC 5KT5A 1XR7A 3CT9A 4GVBB 1DURA 3C6UA 1DRZA 1YITS 2EKYA 1ZA1B 2XMVA 3ULHA 4B3TJ 2ZOMA 4X2BA 1F5BA 3Q8VA 3MMBA 1H2TZ 3D66A 1LW2A 2CVIA 1H2UX 5HP1A 1EQMA 5ETOA 5ITHA 3CJRA 4ED6A 1XR5A 3QZ8A 3WX4A 2E5IA 3NOGA 3MM5B 3G6ES 2QEXS 2PMWA 1U0HB 1TL1B 5D0RA 2HGLA 2BKPA 3PFEA 2UV8G 4N8OA 5D0EA 1JLQB 2V9WA 1S9GA 1EB0A 3W63A 1P9QC 2MEWA 4HKQA 2ASJA 2V4RA 5F3TA 1ZH5A 1SL0A 4USHA 3GTYX 2VL1A 1EP4A 5E3AA 2HYIB 3I87A 1S1WA 2LA4A 1RK8A 1T9YA 1CJVA 1OY6A 1UFWA 3CD0A 1S0OA 3GLJA 4CTAA 1TQLA 3VTIA 1RKIA 2W9AA 3A3NB 1EAYC 4X65J 1HWUA 4G1IA 1KS2A 1U49A 3W60A 2RU3A 3AOAA 1VQNS 4U95A 4RWXA 1CC8A 3T1HF 4KQZA 1NKCA 3AOCA 1XK8A 3A3PB 2G9OA 5DQGA 2HRYA 5DG9A 4DUYF 4N5SA 3O5TB 1CS4A 2E7WA 3NGRA 2Y0BB 3H4DA 2V2QA 1SKUB 3DI6B 1I5OB 4FF4A 4RNHA 1FE0A 2RUSA 3IXQA 4B9VA 4CLZA 4G65A 1FRMA 2GVDA 2N4DA 2FJBB 2CPYA 2Y0SD 3N79A 4OYIA 3R1LA 2RRNA 2RDDA 1X4DA 4DBQA 4Y2AA 2VICA 4JI6F 3NCQA 3KK1A 1D8YA 3MM8B 1BQNB 2CNNB 3MECB 3HM9A 1WDDA 1UZHA 5E3CA 3R2DJ 3DU5A 3R5GA 4L3NA 1K9MT 2X7IA 1CG2A 4O3QA 2B6AB 5ETNA 3SBMA 4CLYA 1AFJA 3CCVS 4J9NA 1D1UA 3QQCD 4K4TA 4PABA 4LF5F 3DRPA 3DGPB 5A6WA 4M5NA 1Q79A 3I32A 2VG7A 2C2KB 1FRKA 4FNHA 2UU9J 3SSSA 2GVZA 2AD9A 2CPXA 4AXJA 4EYHB 5KFSA 3QRRA 1FKOA 3MCOA 5T14A 3T1YF 2IDLA 4KH1B 1WC5A 2Y1JA 1LV5A 1RA7A 3LP0A 1WELA 1S6PA 2OKQA 1RTDA 2NPIA 2PGCA 4DQRA 1VCTA 1ZPWX 2BVZA 3M05A 4DV0F 2B4OA 2G0JA 2X51A 4LR8A 2FGCA 1OMSA 1VRTB 5B0DA 2J0XA 2V94A 5E41A 1JLBA 4LF7F 2ZZMA 3ZTSA 2QE5A 2JX2A 3VGUA 4NYOA 2Y1LB 3SCIE 3HJFA 3DRSA 1W25A 5LT5A 5B0EA 1U24A 2XSJA 5E7OB 3OV7A 4NCBA 2PFDA 3RRKA 1WHYA 4RKUC 2NSCA 2ZM6J 2RILA 3OBIA 1RT2A 4LFBF 2LYVA 1KOHA 3CB4A 3D5MA 3EVMA 2R7OA 2Q1LA 1KP6A 3QJJA 3V4IB 3T1AA 5A0YA 2L9WA 4X4TA 4GKKF 3HHLD 2IY5B 3H40A 5DRKA 4FKXA 2JLEA 4RU2A 1DLOB 1FNXH 2GS8A 2DVIA 4F3QA 5DDPC 3ENQA 3DLKB 4FYWB 3FBEA 3A8EA 2E29A 3TUJC 2MLYA 4OQJA 3KLEA 1J5EF 1N48A 5B7WA 1VC6A 1ZAWA 5BXIA 3X3UA 5IT9U 2CUYA 2QLWA 1B70B 2XHCA 3F0NA 4USJC 1NO8A 3N6MA 1FDDA 1FT8A 3IWXA 1SIZA 2V4JB 3IS9A 2AEFA 4NZ0A 1Q86T 3U7JA 1PGZA 3IRXA 3DYAA 3MEGB 2J9DA 4LSNB 2K06A 2WW8A 3UDVA 2BJ1A 1L3VA 1SKWA 4ID5B 2V2ZA 1X0PA 3ITHA 4W4MA 1YSJA 4K4ZA 1HBUA 4LF8F 2QYGA 1NRKA 3TJ9A 2IAJB 3DLEA 2XBPA 3GILA 5KFOA 2E9ZA 3KOAA 4ZCLA 3AXMA 3PX6A 4OJHA 3OR2A 2FVCA 3V6DB 4TU8A 3G96A 1XMOF 1FXRA 4QIFA 2DHXA 4DR3F 3EM1A 2F9JA 1GNKA 3BYPA 2VU5A 4LBPA 4URGA 4ILMA 4OYAA 1QAIA 1FDNA 1Q78A 3Q23A 4JI8J 2ROPA 3L09A 3KJFB 2J0WA 4CO5A 1N33F 4TQRA 4B3RF 1C1BB 1RBOB 3PCOB 4PG4A 3C15A 1KKHA 3SDEB 2HPUA 4C6AA 1RWOB 1FRLA 4OHYA 1R0CB 3TAPA 2MZQA 4UQTA 3TX0A 4LF4F 3FSXA 1U6FA 4DSKA 4YMEA 3PIOQ 3EE3A 2R7SA 3OFFA 4DPYA 2WTFA 1RAHB 3OLBA 5HQLA 4UY85 2J8SA 4MFBB 5KFLA 3R97A 4I64A 3FCVA 4USMA 3IG1A 1U1QA 1PJ6A 4NXMJ 1TL7B 2QV6A 4NRUA 2FPHX 3DMJA 4P75A 3MWBA 5CA5A 2YQ0A 3ZTOA 1OY9A 4KTQA 5K8MA 3UO0A 4D3HA 4G6VB 1KONA 9ATCB 5EWEA 4NLVA 1WHWA 2KU7A 2VA2A 3TZYA 4DJBA 3BQ0A 1T05A 4F04B 3EICA 7FDRA 4J90A 1KDNA 1TR0A 1NM2A 1UW9A 1LWEA 2MZ1A 4K0KJ 4LF6J 3KLIB 3PEJA 2QLJB 2GQ2A 2MJUA 3ISNC 5A2QU 4KPCA 3KUEA 2KTQA 4NXNF 3HLUA 3E01A 4LRBA 2M70A 4NPOA 5F0WA 3C16A 2AJFE 2WVFA 1RT3B 4X64J 2OJ3A 2XMAA 4FPRA 2O3DA 2YBVA 3T5HA 1S1TA 4P74A 1BD6A 1RE1B 2VC0A 2ZUAA 1UA0A 1OIAA 2UVWA 2HHSA 2DCUB 3DN9A 3J81Y 2AF6A 2ZH7A 1PO6A 3GFXA 2HQDA 4N7TA 4IRDA 5KFYA 3FDSA 1AW0A 4F4KA 4NLYA 1OSDA 3JAMY 4M5MA 1Y00A 5IZHA 5D78A 2GMHA 3M2UA 4RW7B 5IQQA 2J5AA 2MZJA 1VQ9S 2E44A 2XMJA 1J2VA 1X9MA 2LCWA 2OAUA 3MUMP 3M8PA 4CNYA 4KPYA 1X7VA 1B0VA 2HQCA 1FTCA 3O3LA 5HAOA 1WKKA 4DN9A 2EW9A 1NZ8A 4DQSA 1SIWB 5HL7Q 1RWVB 4J7CA 1S7HA 1X60A 3KLGA 1FFGB 2VG5B 2J0SD 2OLWA 3RB4A 2VODA 1SV5A 4M95A 1CQMA 4NLXA 3DFEA 4L76A 4ZOSA 1H2VZ 1IUJA 4WE1A 4Q5VA 3NY0A 3KK2A 3AAWB 4RJVA 3BBBA 2DNKA 3CJSA 4ER8A 3B4DA 2CWKA 4XIUA 2VQEF 3MEEA 1FRXA 3VVUA 1T03B 3BR9A 2MYFA 4AL7A 4RNOA 3PW4A 3K5NA 1G4CA 1WKLA 3AJ2A 2VBXA 1SQEA 4TKTA 5HN0A 4Q45A 3PYGA 2EC0A 3HHEA 2NXNA 3A13A 3UFCX 3NMRA 3ILJA 5B0CA 2ZVSA 2XS7A 1XMBA 2DHHA 3HVRA 2HVDA 1HBMB 4OZJA 2MZTA 2HFUA 2IYIA 4X4UA 1B7YB 4YB5A 2W2OP 1E6YB 2JVRA 4ZVTB 3PW2A 5BYSA 5F8MA 2OPQA 4C0BA 2V63A 2R7RA 3D28A 3NS5A 2FLLA 5IFMA 4WIQA 4FNIA 5E2QA 5T7LB 1WC4A 2ALYB 3D68A 3QT8A 1NB7A 3LF0A 3R7SB 1SJ4P 1TVRB 3GIMA 3QSYB 4O3PA 1NJXA 3MCNA 3D7SB 5C24A 4I2QB 1EHWA 1T9VA 1FXDA 5U47A 3L7UA 2DNLA 4FXVA 4ZVQB 4M5IA 4NASA 1VQOS 1KRPA 1TAQA 4RW9A 4B3TF 3CJ3A 4HDGA 3GZ7A 2D3OR 1GQEA 3P8BB 4C11B 3TUZC 1MN7A 4M5DB 1RACB 3I82A 3UN2A 4ATNA 1AB8A 2ZJPQ 4ZS6A 2BACA 2VFUA 3IM8A 2B4PA 4ETXA 4GVBA 1WF2A 2OSRA 3NLCA 1KHWA 2AKWB 2DB1A 2BE9B 1WORA 3PIPQ 4RW6A 1TK5A 4Z7YA 4OLPA 5HBMB 3MPUB 4DUTA 2IBOA 4CLSA 3FJ2A 1VRUA 2Z57B 4LJMA 5KG4A 3SV4A 1LNQA 2MSTA 1DARA 4B9SA 1F6TA 2HMIB 4R5PA 5GVQA 3HO1A 3TZZA 1YRTA 2FGOA 3MM5A 2WBMA 1S99A 2LXIA 1U0HA 3H7HB 2YWKA 1WEZA 1JLQA 3SEOA 4ZPTR 2IBKA 2DGVA 2X1AA 4DSJA 3NWRA 4BC9A 4CM2A 3ISND 3HKZD 3G4SS 4DV5J 1WSVA 2JDJA 4PUOB 2CG8A 4P72A 5F8GA 5K8PA 1B3TA 4HHJA 2VA3A 2EPIA 1R6VA 3CC7S 3RBEA 2B8PA 2YH0A 4NI2B 3IA0A 2CRLA 2HS0A 4C98A 2OP5A 1RI7A 1M5OC 5J2QB 4B08A 4KO0B 2QA1A 2HHHJ 4FF1A 3LTOA 1PKUA 4NCAA 3HZGA 4EO8A 1WHXA 2J9CA 4MIWA 2V2VA 3M1VB 4WTOB 2R2UA 2W1BA 4CDIA 1SB6A 4BDPA 2G2YA 1S4EA 5G0RB 2GC8A 3K8WA 1RT6B 3GG0A 1CSJA 4YEAA 3ZFVA 2VB6A 2OPRA 3DI6A 1RHRB 2VOOA 5T41A 1RABB 1N54B 2VUGA 5A8WA 1T9WA 4ITSA 2E5LF 3SXLA 2I2YA 1YQHA 1JB0C 1TU0B 1LW0B 2DR6A 5LXYA 1UVJA 2WSFC 1WF1A 3WBZA 1NK5A 2YH1A 1VFJA 1VQ8S 1ZM4A 2POKA 2AEMA 4IOBA 4C4WA 4ECTA 3MM8A 4FF3A 2FJAB 2JL9A 2W01A 3MECA 2BJ9A 2B3TB 2DO4A 4AYBD 2UU9F 2UUBJ 2EBEA 5HVFA 4P10A 4A8YA 3CJQA 3RRGA 2B6AA 4V1Ak 1Q82T 4DZDA 1HQ2A 4IH7A 3DGPA 2JC1A 3L7PA 2CQDA 4KFBB 3MM7B 1EETB 3UE2A 1AT1B 3Q89A 3BREA 4KB7A 2O1PA 2XB2D 3GJSB 3MUTP 3ENAA 4ELTA 1F1BB 1RTHB 1N5YA 3SQOP 1P1LA 4CT9A 4DV7J 2E1AA 2XLIA 2PT0A 3CO9A 2WVDA 2BANB 4J9KA 4KAIA 1MWYA 1TV6B 4ZIVA 4DV6J 5LMUJ 3HPOA 4B3SF 5AJ3J 2BJ8A 2GO8A 5FDLB 1RT1B 4OV1A 1P1TA 1VRTA 2CIMA 1GMVA 3FEYB 1REGX 1U1LA 4DV1F 5H9EJ 2ZM6F 3IRWP 3D54A 3PRBA 3KMSA 2XC9A 2KDOA 1S1VA 4MK8A 1ZTWA 4BWJA 4DL5A 1HARA 4YDDB 2C2DA 3PTWA 4NLWA 2DH9A 3KTQA 3JYTB 4GO5X 5DG7A 1L3SA 1DTTA 3SQGA 1LEOA 3CMAS 1FEEA 4HI2A 2WCXA 1H7WA 2I5JB 3H8YA 4YFUA 3MAAB 1MMDA 1I51B 3JS9A 2UXBJ 2E5JA 5CABA 2GO9A 3L7OA 4ED3A 4HACB 1R8AA 3V4IA 4USUA 3PDNA 3M9MB 1FF2A 3PJXA 2KZMA 4X4PA 1FX4A 1DLOA 3LQVA 1H38A 1HNXJ 2X1BA 5CH7B 3OUYB 1YKWA 3QRPA 2KJVA 2F7VA 3HXMA 2V67A 3DLKA 5KFVA 3MFIA 2CVEA 2DGWA 1RJJA 2CQGA 2ZE2A 5KG3A 2DNYA 4HH1A 3J80U 3PR4A 3AOBA 2HWHA 2HKEA 4IRCA 2QA4S 2CKWA 2Z56B 1BY9A 3H2LA 1BWEA 1D3WA 3W2WA 1XNQJ 1MN9A 2RDIA 3BKTA 4YB1P 2HNYB 4JI4J 5G4DA 2HHVA 3QT5A 2V4JA 2RHSB 3WDOA 1UWBB 3MXHP 4DUZF 1VJQA 2YKOA 1R0BG 1Q8KA 5KFBA 3DKDA 3O1LA 4LSNA 2I6WA 1HWLA 4H54A 4ZITA 4Y6IA 5MLCV 3QWUA 4ID5A 2KL8A 3W62A 5DM7Q 4ZK7M 1IR2A
chains in the Genus database with same CATH topology
1U48A 2RRBA 3MPVA 1S4FA 1IKXB 3QIPB 4LSLA 4RWWA 2FIUA 5KFWA 2IAJA 1N0UA 4I7FB 5E3PA 3GWCA 3MR5A 4P2SA 4I68A 4F25A 3FRZA 1EP4B 2MPUA 4QZVB 1F9FA 2HHHF 1IKVB 2KN4A 1S1WB 4GO7X 1IKWA 3DCAA 2QA4G 2X1FA 3RB3A 4MIBA 1AUDA 4TU9A 4JI8F 2EBGA 2NPFA 2MGZA 2MQLA 3VAMA 3G6XA 1ZTTA 4IYQA 1M1KT 2LQ9A 2R7QA 3BB5A 4KHRA 2IVMA 4RBTA 3IWNC 2CQ4A 4CTAB 2R7XA 2XLJA 4IFVB 1R6YA 3OXLA 4O0IA 4ED1A 3M8QB 2DNOA 1OWXA 1X4CA 1RKJA 3NRBA 2FUG9 1YIJS 2YNFB 1S1XA 1YRXA 5A8KB 3K5PA 5CXTA 2EFVA 3TUIC 3H4BA 4ZHRA 2Q3PA 5LJ3Y 4LQ3A 3RW6A 3IAS9 2UP1A 5F3ZA 1S1TB 2XI2A 4ECXA 1NHVA 4OJGA 4ZPAA 1GX5A 6FDRA 4ECSA 4WF9Q 3CUNA 1R0AB 4IR1A 4KR0B 3BQ1A 1NJZA 4K4SA 2AGPA 2BW2A 5E3RA 4NCGB 4E0DA 5K14B 1N56A 2E5HA 5DDQC 4K4UA 3RW7A 5EX3A 2L9NA 2MQOA 3PW5A 3FRYA 1G6BA 2NUHA 2Y1IA 4L72B 3M2VA 2J6SA 2N7CA 3DRRA 2K8GA 4DLGA 2OMOA 4ZPCA 2RS8A 1P27B 3I0SA 5K9FA 3I56S 3MOZA 2GNKA 2ZHOA 4CO0A 4ECQA 3V6HA 1N52B 4EO6A 4ED2A 3C6TB 2R7UA 3D1OA 2I9SA 3H20A 4YUDA 5L9NA 2BQRA 4F3OA 4QW9A 4F4XA 3NWGA 3FCHA 4KV8B 1HNIB 2O67A 4O3RA 1X8DA 5M2UA 2JZ5A 3VF0B 3V2UC 4C0HA 3MM9B 2E5GA 3TI0A 3DXSX 2P9GA 1UVIA 4I6YA 1LXJA 4QBUA 3DHXA 1I6JA 4QWCA 2B4UA 3TAQA 4I69A 2VG6A 3VZHA 1NNDA 3THTA 4QU6A 2A2CA 5L38A 5KG6A 3M2UB 2UUBF 3A1YG 2MDAA 2QMXA 3ENWA 2HLUA 1XN9A 1RA6A 2KYZA 3MZIA 2FY1A 1Q4RA 2HNZB 1MWZA 2W4DA 3GB0A 1LW0A 5HMZA 2HVZA 3HMJG 3DLBA 1S97A 5BYQA 3J7Z5 2HWIA 1NK7A 3AB2B 1QUVA 1SKRA 2MQMA 3W7BA 1VQMS 3TA2A 3PKYA 5HO4A 3NP5A 1U1RA 3W3SA 1S9EB 4B9MA 4MFBA 2LECA 2ZITA 4Y0FA 4MMOA 2R2SA 3IFEA 4U9RA 4A8OA 1RT5A 2KRRA 3FNNA 3OQ2A 3NMAA 2LQ5A 3V5RA 1ELOA 3NG8A 3GV8B 5EWFA 1DFDA 1D8ZA 5IS2A 3PVXA 3TP2A 5KAKA 3KK1B 4QR2A 2FDNA 2LU2A 2IRUA 2L9DA 5THWA 4NLUA 3KLGB 2R2RA 4C3KA 3QO9A 3ZC4A 1QUPA 2IVFB 2CQ3A 2M52A 4WK1A 3MOJB 5DJBA 4AXIA 1XERA 4K5RA 4ECYA 3KLVA 2AJ1A 4IFYB 3LH2S 2ZJQQ 1JKHB 4ZPVR 2ZOFA 4C8YA 2ZHBA 4ECUA 3BGLA 3BO4A 1SV5B 5KG2A 1V3SA 4DV7F 2JEJA 2UVRA 3H59A 3OTBA 2DITA 2AYGA 4K0KF 2B9XA 2UXCF 4D3GA 1SH3A 3O8WA 3TA0A 3FFIB 4ECWA 2HZCA 5J1NA 2CPZA 3U27A 4ECZA 1S1UB 1CPZA 3M30A 3SCJE 1K8AT 3OTDA 3HHKA 2BJEA 5GAGU 1KFSA 4KFBA 1Q7LB 2KXNB 2DO0A 2YWEA 4DV6F 2IC3B 3GV7B 3KK2B 3SFGA 5KFRA 2HRUA 4CO3A 1S77D 4WTYA 1OO0B 4NLSA 4HEA9 4O23A 3CCQS 2FJXA 3VALA 4DQPA 1RDRA 1U09A 2VPWB 3H5UA 1V3RA 4YB6A 5HMWA 3TA1A 1RQ0A 3LP2A 3CD7A 3CCUS 1YGYA 1JLEB 5I42A 5AXLA 4DV4F 3D2WA 2YKAA 1FKOB 2L41A 2KG0A 3HX9A 4RNMA 2B5JB 1C1CA 1QTMA 1DJ0A 2HFNA 3C8YA 3KLIA 3R27A 4WKYA 1LXNA 2IHR1 4K4WA 3TRGA 4RBUA 3GIJA 1QE1B 2EK6A 4B02A 3IAM9 1Q8IA 1S79A 3LP0B 2BANA 1VC0A 2VKZG 1HWJA 1TV6A 1TL3B 2B43A 2LDYA 4PPZA 1SI9A 3UQSA 1RTDB 1FVSA 2U1AA 2LEPA 3PEHA 4PXBA 2DD8S 2P9CA 3MUVP 4TQSA 3X1LB 2VASA 5K5MA 3ISZA 2XGQA 2ZD1A 4EZ9A 3BM7A 1LFWA 1RT7A 3BSAA 3K8VA 5CYQA 4IOCQ 2CJQA 1RT4A 4EZ6A 1FJGF 1YJTA 4IKAA 1WWHA 2ADBA 2I8EA 2KFNA 5CYMA 3MDFA 4YHHF 2V9KA 2EVZA 2VC1A 1XNRF 2ZH4A 4WFZA 1HMVA 2A1BA 2QMWA 1PC5A 1LWCA 2PA3A 2CZVC 1NZAA 4QIGA 5IM0B 4AL6A 5JUMA 2OPQB 3BZQA 4FXDA 4ED7A 3I5CA 1Y3JA 1ZAXA 4NLRA 1YRUA 4IG3B 3PW7A 1FCAA 1XBWA 2UXBF 1G7CB 4HVZA 2HW3A 4NLQA 2XWYA 4Y3CA 3KK3A 1KNZA 3PNIA 2KZZA 2OPPA 3BSCA 3KHLA 2KHDA 3O2IA 3DRSB 2W7OA 1W2IA 3LALA 5DGBA 2P6SA 2WAQD 3OHAA 5F8NA 2VQFF 2HWTA 4IG0A 2RKIA 2VONA 1VBYA 1T02A 1DQAA 3PX4A 2MKJA 1K1QA 3KG4A 2BQUA 2GGPB 2YKNB 1ZETA 5I3PA 1R3NA 3MF5A 4Q8FA 3LUYA 1VIXA 3K57A 1HNXF 2I5JA 2VFRA 2KVIA 5C24B 1T3NA 4MK7A 5K8OA 2MZSA 3J7ZT 1J5OA 1MW7A 1X4HA 3I5AA 2WHOA 3CDWA 1R89A 3MMAB 1SJQA 3CDEA 3QJLA 2UZAA 3GFZA 4RW7A 6FD1A 2V8VA 4IO1A 2DCLA 2ZH5A 3EGZA 2D3UA 3T5LA 4JYAF 4DS4A 3IWLA 2O66A 3W2VB 3BGRB 5JVGQ 1KSPA 4WKRA 3HFKA 4YY3F 3UCUP 4C8KA 1VI7A 4RW9B 2QA2A 2A18A 4Q2LA 3CJ0A 1L3UA 4Q7AA 4BS2A 1U1OA 1XMQF 4WXOA 2OMLA 4OI6A 4Z37A 4DFPA 5KT4A 3HZEA 2OTJS 3TAMB 4RW4B 5IT0A 1HI0P 2DGSA 1YJUA 2FHJD 4MIAA 3OFGA 5KFNA 1JLCB 4WFNQ 2R7VA 1R7IA 4OX9F 2OPSA 1HI8A 2HGMA 3TW0A 1HL6A 2J7UA 4XPEA 4BHQA 2B51A 5FLXY 2AU0A 2AX1A 2KYXA 2QSWA 1S0NA 1WG1A 1YJ9S 1IBKF 4QWBA 3CF5Q 4OX8A 4JI4F 1JLGB 3EX7B 3C3LA 3HHLC 1R8HA 1I1GA 5CYJA 3CCMS 1GTEA 2UUWA 1ZAVA 5KT5A 2K1RB 1RTIB 1XR7A 5B0FA 5DG8A 3CT9A 4PG8A 1GXLA 4IDKB 4MKAA 1DURA 2ZKUA 3C6UA 1DRZA 1U6ZA 1YITS 2BJDA 2CDQA 2NUUG 3OHBA 2EKYA 1KVJA 4RUCA 3TVYA 1TKTB 4NMLA 1RISA 2XLKA 4E8UA 2W9CB 3CXCR 2XMVA 3ULHA 4X2BA 2ZOMA 4ICLA 2RVJA 1Y4ZB 1F5BA 3PXGa 2ZNYA 3MMBA 1H2TZ 2JWNA 2BRLA 5CCMA 3CULA 1DAXA 3MPWA 4ES1A 4QIVA 5E3QA 1MMLA 3HHLA 3QPIA 1LW2A 2DGUA 2CVIA 5IXUA 1H2UX 2MHNA 3DM2B 1RP5A 4OX7A 1YJVA 2LKZA 2OSQA 4K2XA 3OL8A 3AJ1A 2CJKA 2MHEA 4C3MA 2W9BB 1JLAB 3UW1A 5HP1A 3F44A 1N32F 1X9SA 3GFHA 5J1PA 4TYBA 5ITHA 2GA7A 3M32A 2WB1D 3C46A 1FDBA 4PG6A 4ED6A 4LF9F 1XR5A 1UWBA 2AW0A 2KO1A 3V6KA 2FJWA 3HI9A 1TFWA 4C0OC 1T03A 3O44A 3QZ8A 1B0TA 3WX4A 3R5CA 2E5IA 4HDHA 2UUAF 1H98A 3MM5B 4J9MA 3G6ES 1KLMB 3Q0AA 2QEXS 4ES3A 5L1LA 1TL1B 2HGLA 5A8RB 3F56A 1S6QB 2PI4A 2DNHA 3VCDA 1FK9B 3PFEA 2CQ2A 2LMIA 5B09A 4N47A 4M1KA 1X5TA 2B7BB 2M8HA 2UV8G 4N8OA 3K58A 1O0PA 1JLQB 2LEAA 2AYEA 3PM9A 2V9WA 3HHDA 1S9GA 3NGKA 1P9QC 4YQWA 1E6VA 3R5AA 4DG1A 4JV2A 3ITHB 3R5DA 1YTYA 1SJFA 4HKQA 1HQUB 3RYLA 2ASJA 4V19J 2FTRA 1VIOA 2BM0A 3T5KA 3THPA 2V4RA 2NS1B 5F3TA 2CPJA 4O3OA 1ZH5A 1HBUB 4I7FA 1SL0A 4USHA 3FMWA 3IGNA 2VL1A 2COLA 1EP4A 2D9PA 5E3AA 3DLEB 2HYIB 3I87A 1G2EA 1IKVA 5DETA 1S1WA 2LA4A 1RK8A 4OHVA 1UP1A 2C3UA 1E6YA 1DTQA 2PO4A 2ZDPA 3OR2B 4KHMA 3LAMA 1UFWA 3R1HA 4DL7A 1TKXB 1H7XA 3CD0A 4A8XA 2EWHA 1S0OA 4CTAA 2PD1A 2K7JA 3MEDB 2QZ8A 5KOXA 1TQLA 3VTIA 1N6QB 1RKIA 2W9AA 2KHCA 1VOMA 3NS6A 4Y2CA 4U7UK 5A8KA 1X4GA 3CIZA 1YJNS 1HWUA 4LT6A 4G1IA 1P6TA 2R8HA 2ZHAA 1KS2A 2E7XA 2HIQA 1FTRA 2Z4PA 3CSKA 1BLUA 1U49A 2RU3A 3KNAA 4PR6A 5J2PB 5GAHI 2CQIA 3AB4B 4ZVEA 3KJVA 1PC4A 1U7LA 1N88A 1UVMA 1TVRA 2APOA 3P6YC 3DOLB 1ZOTA 3D0HE 1KEKA 2XZWA 3H98A 1VQNS 4C8ZA 2BYCA 3P96A 4IR9A 4RWXA 1VMBA 5BR8F 3LO3A 1XC9A 1CC8A 1KFDA 3AQPA 5FD1A 1X5PA 4GKJF 3T1HF 3KFWX 4HL9A 3I4PA 4KQZA 3RB0A 1QAXA 5J2MB 1LKZA 1NKCA 2Z8QA 4RU9A 3OFHA 1XK8A 4MYTA 2JFKA 4K5SA 3P5TL 5KFUA 4JV1A 2J6TA 2G9OA 4ALZA 3K0JA 5DQGA 2W8KA 2HRYA 4ED8A 4F67A 2CQHA 1CQNA 2ZH9A 2CPFA 2HNDB 5DG9A 4JI2F 3U1MA 2XO7A 4P6QA 3UPFA 2MQPA 4U7CA 4DUYF 2DBBA 2DR8A 3C2PA 4N5SA 3O5TB 2ROEA 2KI2A 3MM9A 4IH5A 3EYZA 1VQ7S 1TKZA 3MM6B 2E7WA 5LSLA 1ULRA 2F8HA 5DDRC 2PI5A 4C11A 3N4WA 2GW8A 5HLFB 1SUQA 5GADI 3H4DA 4QOTA 2EFPA 3DI6B 1M5HA 2M9KA 4M5DA 4FF4A 3CCWA 3OXFA 4RNHA 1FE0A 4ZP9A 1HPZA 2ZH8A 4W92B 3IXQA 4NLPA 4B9VA 2HFOA 2XS2A 3I0RB 1FRMA 1T95A 2RNEA 2N4DA 3RBDA 2HHWA 2NSBA 2FJBB 2PC6A 4AUKA 3FSIA 4KSEB 4ZA1A 3EGWB 4H4MB 3CCLS 1HNVB 3JSMA 2CPYA 1HD0A 1TK8A 2Y0SD 2C3YA 2R9LA 3N79A 5AXMA 3TVKA 5KG5A 3Q2SC 4ECVA 2DRBA 2JEIA 1S9EA 3FEZA 4OJ3A 2RSQA 4OZ1A 1SH0A 2YNIB 3R1LA 2RRNA 1CEZA 1M5SA 3M2RA 1X4DA 2J76E 3QIDA 4X4SA 4DBQA 3J7YI 1N4LA 1HQEB 4I2PB 4JI5F 4Y2AA 4JI6F 1R8PA 2RQCA 3MR2A 2ZDOA 3NCQA 4NZ6A 4ZP8A 4C3LA 4HH0A 2XI3A 3KK1A 1D8YA 1D9FA 1Q81T 4Y34A 3MM8B 3CJKB 4CQ1A 4DQIA 2V2KA 2M5YA 1BQNB 5KFTA 3DDKA 5KFJA 2EI5A 3MECB 4ZPDA 3MEKA 3HM9A 1SBRA 4USIA 4KKOB 1NH7A 3OVSA 3UWTA 2BQ3A 5E3CA 1JKHA 4Q0BB 1HR0F 3DU5A 4Y2MA 5HMXA 1NJIT 4L3NA 4AE5A 1K9MT 3GV5B 1N34F 3PY8A 1CG2A 2KH9A 4O3QA 1VC5A 3I4HX 2WOMB 2B6AB 4NLOA 1AFJA 3OFEA 4EU0A 3AY0A 3ETOA 3FFIA 3CCVS 1UJ6A 4J9NA 1D1UA 3PO4A 4N76A 1JWWA 3Q24A 3OLAA 4K4TA 2VFSA 4J9RA 2YX1A 2DJWA 4LF5F 2YNGB 3DRPA 2RQKA 4MTPA 5KFDA 4R0EA 5D6GA 2JVOA 1LK7A 5A6WA 2NXUA 1Q79A 2KRBA 3I32A 2VG7A 4ZKAA 3DOMA 4XO0A 4EEYA 1N8RT 1FRKA 1KD1T 2CPDA 2K2PA 4FNHA 4B9TA 1XTZA 1QSSA 3G6YA 4IRKA 3DDNA 3UDLA 4QJVA 1M90T 2QSFA 4I6AA 3SSSA 2AD9A 2CPXA 4AXJA 5C42B 1JLEA 3M9OB 3MMJA 4EYHB 3OTEA 3HVAA 1T05B 5KFSA 1GAOA 1PSDA 3IR6B 3MMCA 1FKOA 5T14A 4M8LA 4CIOA 2HS4A 2ZKTA 1WACA 3PO5A 2E1MC 4AL5A 3T1YF 1ZZFA 4F3MA 1LWEB 1PILA 4W90B 1VQ4S 2Y1JA 1QE1A 1LV5A 4PQUA 1RA7A 3LP0A 1WELA 1N5SA 1S6PA 4PUOA 1TL3A 2OKQA 4F26A 1RTDA 4I0WA 1JIHA 3OJUA 3VAGA 1SH2A 1WF0A 1B64A 4LVNP 2NPIA 2LQBA 5HQ8A 1KR4A 5C25A 5I3UA 3Q22A 2YKMA 3CE8A 3HKWA 2HQIA 5MAOA 4PPDA 4R0JA 2PGCA 2QFJA 4CH1A 1TAUA 4DQRA 3E01B 1ZPWX 2BVZA 4G3IA 3M05A 4DV0F 2HHQA 1S6UA 3GIIA 2B4OA 3SZ2A 2X51A 2J9DE 4URQU 4QWEA 3JSYA 4PXDA 4TLRA 5CHCB 1U1PA 1TL4A 3CCRS 1DHMA 3QLHB 1H3DA 2FGCA 3H5XA 1VRTB 5B0DA 3HVTA 4KGKA 1FD8A 3R5BA 2CPIA 2J0XA 4PXCA 5J2QA 3AA9A 5JJBA 4KO0A 1U1MA 4QPXA 2XWXA 4MJKA 4OI4A 2V94A 4AFFA 5E41A 1JLBA 1TP7A 3POTB 4LF7F 3S01A 2ZZMA 1OSCA 5IQ6A 3EPGA 2DRAA 2QE5A 1DQ8A 2JX2A 4OZ0A 2NR0A 2N3LA 1G1XA 3M1VA 3G8TA 1IBLF 4NYOA 3SCIE 3HJFA 2FHOB 3DRSA 1W25A 5LT5A 5B0EA 2XHWA 3BO3A 2R8KA 2M0GB 1LFPA 1U24A 2RJZA 3SSRA 4R8UB 3CCSS 2EFOA 2XSJA 5D4NA 5E7OB 2AJQA 4X4QA 3OV7A 1NKEA 2OO4A 5G0RA