1WC3A

Soluble adenylyl cyclase cyac from s. platensis in complex with alpha, beta-methylene-atp and strontium
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
198
Chain Sequence
SHMRPEPRLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFENQGTVDKFVGDAIMALYGAPEEMSPSEQVRRAIATARQMLVALEKLNQGWQERGLVGRNEVPPVRFRCGIHQGMAVVGLFGSQERSDFTAIGPSVNIAARLQEATAPNSIMVSAMVAQYVPDEEIIKREFLELKGIDEPVMTCVINPNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Bicarbonate Activation of Adenylyl Cyclase Via Promotion of Catalytic Active Site Closure and Metal Recruitment
pubmed doi rcsb
source organism Spirulina platensis
molecule tags Lyase
molecule keywords ADENYLATE CYCLASE
total genus 65
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2004-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1wc3A00
1U0HA 4NI2A 1CULA 4USUA 1WC5A 5D0EA 3MAAA 4WP3A 4CLLA 1Y11A 2GVDB 2GVDA 5D0HA 3UVJB 3G82A 4OZ2A 1CS4B 1WC4A 1CJKB 4OYWA 2BW7A 1FX2A 4P2XA 3C16A 4OYOA 4OYIA 3C14A 4OYBA 4CLYA 4CLZA 4CLFA 4OYMA 3ET6B 1AZSA 4OYZA 1YBTA 4P2FA 5D0RA 1AB8A 1CJUA 2GVZB 1CJUB 3C14B 4CLSA 1WC0A 1CJKA 3G82B 4CM2A 1YK9A 1CJTA 4CLUA 1CULB 1AZSB 3ET6A 1CJVB 3C15A 3R5GA 5D15A 3MR7A 4CLTA 4P2MA 1U0HB 1WC1A 4OYAA 4USTA 2GVZA 1CJTB 4OZ3A 4WP8A 4CLKA 3MAAB 1CS4A 5IV4A 3UVJA 4CM0A 5D0GA 1WC6A 2W01A 1Y10A 4WP9A 4NI2B 3C16B 4OYPA 1CJVA 3C15B 4CLWA 4CLPA 5IV3A 4USWA 1TL7B 1TL7A 1YBUA 2WZ1A 2QV6A 4USVA 4OYXA 1FX4A 1WC3A 4WPAA
chains in the Genus database with same CATH superfamily
5JXSA 3KTQA 2BUNA 5KFLA 1CULA 5LXRA 3RU0A 3UPFA 1H73A 4FF2A 1ZAXA 1MSWD 3QNWB 4Q8FA 4CLLA 2HLUA 3SCLE 3DI6A 1QJHA 2CQHA 4LF8F 3H98A 1U6FA 1S4EA 4F0KA 4C2MA 3VAIA 2IA6A 2YWGA 3ONQA 1HARA 2ZD1B 1WC4A 3NGRA 1IBKF 2J7KA 2AIRB 4O3SA 1FVSA 4G1PA 1X60A 1IQZA 3IR5B 4HACB 4Z37A 3VQTA 4DN0A 5ADZA 5BJRA 4K4VA 1ZTTA 1RT4A 2WRMA 4M63A 5KFBA 3KKFA 4N56A 4OYWA 1QDUB 2FC8A 2WB4A 2IVFB 1ZOTA 1S59A 2HLTA 2MKIA 5J2NA 4FBTA 1FEEA 2D69A 4DR2F 2VFRA 1KVIA 2Q43A 3E51A 2CPEA 1X8DA 1Q8LA 1WNEA 2V4JB 2C2MB 2W4DA 3GG1A 3AD8C 4LSZB 5F0WA 4U95A 5B0CA 1KQSR 2AX1A 5CCLA 1UWAA 1FKAF 1Q0NA 2RU9A 5K5MA 1S6PA 3WC2A 5E7OB 2HQIA 3PM9A 2NR0A 2MJUA 4URSA 1TK8A 2KZMA 1IWGA 2EKNA 5L8RC 3HSDA 4KQZA 2GVZB 2JZ5A 1NJWA 1I6JA 5JUMA 1RTDB 3FQKA 4EK2A 4C8OA 2HHWA 2AEMA 4DFPA 2QG9B 2D1CA 2M2BA 3M32A 3UD4P 5A8RA 4PZVA 2HHUA 4X84A 3Q8UA 3OL7A 3KK2B 1HMVA 4YHHJ 5EDWA 2YPYA 5LMNJ 5M2UA 1FRJA 1HPZB 3EZOA 5J1EA 3BBFA 2QLJB 1SJQA 4J9UE 4O3QA 1R43A 1PCAA 2DNZA 2WONB 2ADBA 2YTCA 1S6OA 2HFZA 5A0YB 2DR7A 1MG7A 1GK8A 3R2DJ 1PJ5A 2R2TA 4CLUA 3HCXA 4WFYA 5KT5A 3MOZA 1VQKS 5M2PA 2J0WA 1W26A 5D15A 1S6QA 1ZS6A 5BYSA 5F8LA 3FSIA 2NS1B 2DNQA 2HGMA 2EFPA 1KFSA 5J2PB 4LFBF 4KR0B 1U49A 2LLZA 2CJQA 3LALA 3PYDA 1N48A 5AJ3J 3DLHA 5DM6Q 4O4GA 1T9YA 1UEUA 1JQGA 2NZ4A 2DY1A 2KHDA 2XEXA 4HI2A 4OJHA 1S99A 1Y3KA 1Q7LB 3UNYA 2PIIA 4Z7CA 4JV1A 4O4RA 3WIUA 4Q0BB 3M2UA 3BDEA 2GS8A 3CSKA 3G8TA 1K1SA 4RBUA 5F9LA 3UCUP 1GH8A 2JC1A 2DNYA 1N54B 3DRSB 3UD5A 1SVDA 4EI2A 3KLGB 2J0QD 3NP5A 2H5JB 3GLJA 2LQ9A 2ZKTA 5KFKA 5L38A 2Z2LA 1S0NA 2LXUA 5IC6B 1HNXJ 3R5DA 2A6MA 1O6XA 2VFUA 1V3RA 3FVYA 1FDNA 2ROEA 2FJXA 2LA6A 4DF4A 2ZBQA 1RT2A 4OHZA 3HMJG 1RCXB 4TQRA 1LEOA 2E5IA 1W25A 4CTAA 2C3MA 1V3SA 1D9AA 2BJ3A 3D3BJ 4KAIA 3FQLA 2R7RA 4ECWA 3B4MA 3R2CJ 3LPYA 4FPIA 3PIPQ 1VRUA 1MWYA 1YBUA 2QA2A 2CA9A 1YITS 1DURA 2XMWA 2ZZTA 3RYLA 4RUHA 4TY9A 4U7CA 2DGOA 2QSWA 4X66F 4H4MA 3A12A 2RAQA 5CAAA 2PO4A 1IR2A 3J7ZT 4HH1A 2VDIA 3IGNA 2MSTA 1K8AT 2D3O1 1O0PA 3DLKA 2IYIA 2B8QA 2Q79A 4IDKB 3MEDA 2HBQB 4ZMMA 2DNMA 4F4YA 3WZ0A 3NMRA 5CD4H 4KYZA 3QGPA 1WHXA 4TYAA 4LR9A 3VAKA 1LWFB 2Y9HA 4KKOA 4U9RA 5B7WA 5IFMA 4R0JA 2XMUA 4O3NA 1NSAA 2HK2A 3AXMA 1NDKA 7AT1B 4QWDA 4F8RA 2G2ZA 4NWBA 4DFMA 1D9FA 3TVZA 4ER8A 1OSDA 3L7PA 2WOMA 4TLRA 2R2RA 3K5NA 4KV8A 4DR7J 3OT9A 1FRLA 3DLGB 2IM3A 3DXBA 3IMQJ 2V34A 1FE0A 4UZBA 3K0JA 1U45A 5KFCA 2MKKA 1NK4A 4JV5J 3VZIA 2QZ8A 4USKA 3W2VB 1QAIA 5T41A 2W25A 1AYEA 3D6MB 3JAMY 1M1KT 2WSFC 2OFGX 5AE1A 4YY3J 1X9WA 4KGMA 4R8UA 1BC6A 5A76A 4UQTA 1QD1A 2KG1A 4L73A 2CQDA 3VVUA 4ZHRA 1VBXA 2OGUA 1NUEA 4K8RA 2HRYA 3CJ8A 3DRYA 4LVOP 3D1OA 3KG4A 4QIEA 2BV3A 4B17A 4I6WA 4FS1A 1AROP 3RAQA 3IM8A 4TY8A 4X66J 5CYMB 3I0SB 4UW2A 5HP1B 1FXLA 1NDPA 3MM5B 4JI6F 4QOTA 2HFNA 2IRUA 4O44B 5KAKA 2XS7A 2G1HA 3TRGA 1URNA 2ZOGA 4V1Ak 3SEOA 4WU3A 1RAAB 1N36F 3MM9A 2M70A 3J81U 1SQFA 3KDOA 3RW7A 2ZM6F 2AYGA 4OZ0A 1CJKA 3C6UB 2BBEA 2B9EA 2HS3A 4ZJOA 5DQIA 3CXCR 4PG7A 2RDJA 1IKYA 1BWVA 4M94A 1SPBP 2ZNZA 4OX6A 4ZVEA 4QQBA 1EQMA 2COLA 3C3LA 3FBCA 4A46A 1IR0A 3FBEA 2ASLA 1W7WA 3B6BA 3ET6A 2J0SD 4F67A 3CJTA 1KP6A 3CJSA 3SI8A 3B4DA 1X5SA 4NYZA 4DZDA 1S77D 5JVHQ 1VHIA 4NXMJ 3HHNB 1B0TA 5E3PA 1U6ZA 1XWLA 2MZ1A 5KG5A 3I55S 1DQ9A 1TZ0A 3JAMU 4ELTA 1T0TV 4OYAA 4I2PA 3QMQA 4GO7X 2VFSA 1NLKL 3M6UA 3TZWA 2RDDA 3CO0P 3M6XA 5FLXY 1ZAWA 2DNHA 4ILLA 4IOBA 4NASA 2QEXS 5CZVA 2KI2A 4WK1A 5K14B 3Q86A 1MROA 2RVJA 5M2RA 3U02A 4CQ1A 4DL0C 3Q22A 2HHHJ 3JQMA 3Q8SB 1YTYA 4ES1A 1WD6A 5J2MB 2J6SA 4UY8T 1EETA 1VQNS 4X4PA 3TUPA 2SXLA 3SBMA 2QN6B 5DQGA 2ZOMA 3CCZA 1RHQB 2ZHOA 1Z4UA 3DU5A 4YR2A 3VAHA 1HYSB 3CCVS 2ZM6J 1N6QA 2BM1A 2IMWP 1AT1B 4P9SA 1RK8A 4CP5A 2VU5A 3S7RA 3MHYA 3QIPA 4WFXA 4PQUA 2MQQA 4LF4F 4NLXA 4YHHF 2PT0A 4QZVB 1N5QA 1MWQA 1OY9A 4FZVA 4ZVOB 4OI6A 2OH2A 2GV1A 1CEZA 1Z2ZA 2YWFA 3TQ1A 1U2RA 6AT1B 3LAMA 4PYDA 2J9DA 4ED8A 4Q44A 3TP2A 2JFDA 4QYZJ 1IKWB 4DG1B 1DBDA 3N6NA 3R1HA 4TYBA 3ZZZA 2B9XA 3ZZUA 1SBRA 2BE2A 4IH7A 3V4IA 1UA0A 2UXBF 2C3OA 1IBLJ 1SKSA 3ZTQA 2XS5A 1N4LA 2UXDJ 3ZTRA 5J2QB 4ID8A 4MKBA 1U7LA 4DSLA 4B3OB 1U26A 2ZBCA 5F8MA 2N7CA 1Y11A 5D4LA 4WXWA 2ATCB 4ZVTB 2D3UA 3WDOA 5RUBA 4AYBD 3G82A 2DTJA 1SI9A 4M5HA 2NZCA 2Z8QA 3CDAA 3SDEA 5ITHA 1YJ9S 1F9EB 3PW0A 3ITHB 4RNOA 1DTQB 1KDNA 3K59A 3DU6A 5I4MA 2Y0BB 3GCWP 1FKOB 1YSJA 4KRWA 1U09A 4YN3B 4J9OA 2O67A 4KHRA 4CWBA 4OQJA 2GMLA 2PMWA 3BGOP 1HBMA 1SXLA 2HG4A 3QRRA 1SH3A 1JLBB 5CZXA 3TUIC 1WKKA 5KFTA 3I6PA 3WHIA 3W65A 5LXYA 3H4DA 3MEGA 4ED7A 2HGNA 2PA3A 2EBEA 3MMAA 4LRDA 3CDBA 1QUVA 3OFFA 3WQPA 1OWXA 5F8IA 2XY7A 4JI4F 5IXUA 1DQAA 2A1BA 1MU2B 5IOLA 1T9WA 2ZE2B 3T9ZA 3N28A 2FZCB 1IR1A 2MKJA 3MEGB 1LWCB 4DCPB 1HNXF 2N3OA 2NQPA 3MCSA 5D0RA 2Q6CA 2DK2A 3FCVA 3BGRB 2GMJA 1JX4A 4LBIA 3CW2C 4J5OA 4G1QB 2A2DA 2R42A 4WF9Q 2V50A 3C14B 4DL2A 2PEBA 1JK9B 3CIMA 4NE9C 4NOHA 1RTIB 4DS5A 1HI0P 4NRTA 3DHXA 1WHYA 3G82B 5BR8F 4KJIA 3KHRA 2W2PP 2HGLA 1LWXA 1YK9A 2A18A 3AQPA 4JB8B 2PMZD 4I67A 2EVZA 1WDDA 1JLEA 3G8QA 1HWKA 4H4KA 3UN2A 4ANDA 4C3MA 1RHJB 4DPUA 3R7SB 4DX8H 1RT6B 1NPKA 3O44A 5J2QA 2EC0A 4Y34A 3IS9B 1Y7PA 1AZSB 4F0HA 4EBDA 2HNDA 1CJVB 3W66A 1VRTA 2Q1LA 2KZZA 1RTJB 2DGSA 2X3GA 5L1LA 1FWPA 2CAJA 1FA0A 2VBZA 4FVMA 2XMAA 2AW0A 1YHQS 5F0UA 2R8KA 4GRSA 2HW3A 2M0GB 6FD1A 1SL1A 2V69A 1F5CA 1U25A 1WG1A 3MPUB 3P45B 1XJWB 2H1YA 4K0KF 3HM9A 4PWUA 4IO9Q 5HI7A 4K2XA 2YWEA 4IRDA 4UZCA 2DR6A 4ANEA 1R8BA 2V9KA 1NK9A 1RLDA 4PQUB 1NB2A 1B64A 1WC6A 1RYSA 4ECRA 2B56A 3M8ZA 2RKIA 1RU1A 4ZVSB 3H42A 3MEKA 1U2CA 4ZIWA 1TV6B 3GR0A 2KVQE 4CI0B 1JJ4A 2UVWA 1VQMS 4LF4J 2D7SA 2DHSA 3ENWA 2KRBA 2AD9A 4A48A 2MYFA 3OVBA 5T7LA 1Q82T 2OTLS 2P5VA 2JEIA 2C3UA 3BR9A 4L76A 3AOAA 2CZ9A 3PDNA 4K4TA 1EAYC 4RUBA 5C25A 1NH8A 3QT7A 4WK3A 4DSEA 3V6HA 3DNCA 5L9XA 3TAMA 3L4BC 1S9EB 4NZ6A 1TAUA 1JLFA 3AODA 3TO8A 4UY85 2H3EB 4DPYA 1TKTA 4X4SA 3M2RA 1WSRA 2K3KA 3KG1A 3HSGA 4Q43A 1NBEB 2KH9A 3JTNA 4C11A 4PXCA 1CQMA 1WC5A 3K5MA 1HFEL 1IKVA 2RRBA 4XO0A 4ZCLA 4LF6F 4DR3J 3GIRA 4FXWA 2C22A 1Q4RA 4ITSA 3HSZA 2E1RA 4PXEA 3JTOA 2KJWA 4Y00A 1LWEB 4J90A 3UCZP 1SJRA 1VR6A 3FJ2A 3ZTSA 1K1QA 1P9QC 4PWWA 5D78A 2AF6A 3J80Y 2ZH9A 2AGOA 3R5BA 1F1BB 2QJ3A 3FFIA 4UF4A 3VWSA 4KHPJ 2J7WA 4C3KA 1D8YA 3MM9B 3F41A 3HHEA 1S1VA 3QBCA 2B4PA 3BKTA 2BQUA 1IUJA 2XSJA 1C0TA 4OJGA 2FJAB 2F7VA 4TKTA 1JXLA 1GT8A 3W9IA 2CQ1A 2WW8A 2YWHA 3CTRA 3PRDA 1P1LA 2OSRA 2DH7A 2A3JA 4X4QA 4RKUC 4JI0F 1GX5A 4QJVA 1E6VA 1HIYA 3UNGC 2BZ2A 3EWGA 3T1YF 1YLXA 1TELA 2R8JA 3JQKA 3QO9B 4MAKA 2BRLA 2W2OP 3DLJA 4OYMA 4EO6A 2GNKA 3I82A 2L08A 3ENVA 3M8PA 1C1BB 2W9CB 3HX9A 3PRBA 3IBWA 3DLBA 1GXLA 1UETA 5C7PA 2ZVIA 4F2SA 2JEFA 5DGAA 4WE1A 1UVKA 5G4DA 5IS2A 5KFRA 3ENAA 4NA1A 2ACYA 3J7AN 1HNIB 1UCNA 3ENQA 1D0EA 2BX6A 4D3HA 2XCPA 3OV7A 3SV4A 3MMCA 4RW7B 2W4PA 4DPXA 1FFWB 5FJ4A 4ALZA 4DCJB 2VUGA 1RQ0A 2XC9A 5THWA 1DLOA 2BJ9A 4B9VA 3UQSA 2UUCF 3DM2B 3EVWA 3PACA 2MZQA 4Y6IA 4OX9J 3T41A 2XMVA 3RW6A 3P8BB 2GAHC 1FRXA 9ATCB 3BB5A 4TU9A 2HHVA 4O0IA 2GQ2A 1CJTA 2VG7A 4N8NA 3FCHA 4UOGA 3PY8A 1YVFA 1RB0A 1L3VA 3OL9A 1OJ4A 2QA1A 2XZDB 1X0PA 3C15A 4IH6A 2EBGA 4XDDA 5F3TA 3TWZA 2GCFA 4CO1A 1J5OB 2NYHA 4LUBA 2HVEA 2DT9A 5CYJA 3ILJA 1NCLA 1FJGJ 3VAGA 1C1CA 1JMTA 2CQ4A 2OHDA 4KGZB 4O0NA 4G65A 5E2QA 5D4NA 2UV8G 4CO2A 3MMCB 2MLXA 3GILA 4ZCKA 3FEYB 1I1GA 3Q2SC 3ZZ0A 5GADI 1FDDA 3AOBA 3MMBA 4LSLB 1FWKA 4QIWD 2XMJA 4CLKA 2W8LA 3OTCA 1R8HA 1T05B 3GTYX 3L7OA 3QT6A 4B9NA 3A3OB 4RBVA 1H6KX 1T9XA 4JP8A 2BM0A 1WKJA 4BCAA 2VBWA 2XGPA 3VAMA 1RU2A 3DYAB 3EXYA 4XAKA 2VA2A 3KJNB 3DOLA 3NWRA 4FNIA 1TL3A 1ITPA 4C98A 3CIZA 3GJSB 5KFIA 1HBUB 3IG1B 3KWMA 4MIWA 2ZH6A 3PKMA 4PWDA 1FTCA 1PYOB 4A8SA 3FRZA 4KPCA 4ZK7M 5CQGA 3O5TB 2VASA 4MIBA 5HQLA 5I3QA 2HFOA 4KH0B 1R0AA 5HATA 4DV3J 3PIOQ 2BXJA 3I5AA 4ID5A 2KVIA 2H54B 4P73A 2BE7D 3M9OB 3UD3P 4LF9J 5H9FJ 4FYWB 1VQ5S 4AE5A 4IOAQ 2RQ4A 4LF7F 4ETXA 4I68A 1B4SA 1YWXA 1RACB 3JQJA 2OELA 3KLEB 3QSYB 1REGX 1S6QB 3AJ2A 4OHVA 4WPAA 5LSLA 1U2FA 3KNGA 5D4PA 4YFUA 1VJWA 1ZYQA 1G2EA 2DNOA 2E1AA 2JWNA 4ZOSA 2BQRA 5DG8A 5E3QA 1A9NB 3W5YA 5C2GA 3T1HF 2W2QP 5DLFA 1EIYB 4IQMA 3LTOA 3GIIA 1VQ4S 1A6LA 2I1RA 2NXNA 1CLFA 2D9PA 5ETNA 1RAFB 3MR2A 2OFHX 4C8NA 2YKPA 4B9MA 5HBMA 4RX6A 1U1PA 3KFWX 1G3OA 3G2XA 1L3UA 5A8RB 4FF3A 4X4VA 1VK3A 2OP5A 3NGTA 5DO2A 1QSYA 1SJ3P 4EZ9A 1GMVA 4K7QA 1BWEA 1OYDA 2Z56B 1NXIA 4KGXB 5LJ3Y 2FZGB 5FDLB 5C42A 1UPPA 2LEAA 2V8PA 2XNQA 3IN5A 2AP6A 2DBBA 4NEZA 4CYUA 5GMDA 4X62J 2R8HA 4NLQA 1WDTA 2CPIA 2RF2A 5L1JA 3PCOB 1B70B 2LDYA 4JI8J 1RTHB 4OI2A 5A2QU 1FO1A 1Q95G 4Z7YA 2APOA 1FNMA 2KFNA 2X1AA 4WZMA 2FVCA 4NLUA 2Q3PA 4B9TA 4NL5A 5E3AA 3UWTA 5EHHA 4B3SJ 3KLHA 3OTOJ 2L3MA 3GCXP 2CZVC 4ZVHA 4NLYA 2ZC4A 2DH8A 2YNGA 3HHLC 2MXYA 3QJJA 3AY0A 5KT6A 2UV8A 1PJ7A 4DZ6A 1XMOF 3TUZC 4FS2A 1H2VZ 2DO4A 4V19X 1K47A 2CDQA 1BHNA 1OS5A 3Q8QB 1S0OA 1LK5A 1S1UA 4DL4A 5CXTA 1CULB 2D9OA 2F8MA 2N4CA 3AH6A 1HHTP 4WU2A 4QR0A 3LGMA 3M8RA 3W64A 4ZPTR 1HBNB 1WTBA 1C1CB 4ZN1A 3BH7B 5A8WA 4J9NA 3NCRA 2C2DA 3MAHA 1K9MT 3H59A 3I5CA 1D1UA 5B0BA 2U2FA 4ED6A 3MOJB 1FRHA 1R31A 1RTZA 3ISZA 2HS4A 4K5SA 4DR3F 4Q8EA 1CJTB 1M1HA 2CQIA 1DZ5A 5I3UA 2RIJA 2CPXA 2XHCA 4Q2MA 2E5LF 3H7HB 1KLNA 1KFDA 1HQEB 2XYPB 1U1QA 4F4ZA 3BSOA 5K9FA 1HW8A 2IY5B 5HAOA 4XPEA 3MMAB 2IC3A 2BJ7A 2GGPB 2ZBPA 4EGLA 4RWWA 1FWLA 2EWHA 1F2HA 1RJJA 3D0HE 5CHCB 1JLBA 2W8KA 2D3OR 4HEA9 1RAOA 4DL3A 4KFBB 1EP4A 2WVDA 3WX4A 3W3SA 2G13A 3VF0B 5EN1A 4ILRA 3B54A 1T95A 1K73T 5HQMA 1OY6A 2R2SA 3C8YA 2RT3A 3M6VA 4AUKA 1KHVA 5DM7Q 5I42B 2UXCF 1C1BA 2IJNA 2F4VJ 2W1BA 2W9CA 1S49A 4IRKA 1SH2A 2K06A 2XGQA 3CCQS 1URRA 4O3PA 1JJ2R 4C97A 4GKJF 2J7UA 2CQBA 2EFVA 3RUBL 4B3OA 3HFVA 4KO0B 3DRPA 2OTJS 2EXUA 4W4MA 1AUSL 2HWIA 2GIFA 2IDEA 1H7XA 4ZPVR 1N0VC 1GAOA 3I0RB 3V4IB 2HQGA 4CH7A 4PEOA 3BPSP 2XSJB 4PPDA 4RNFA 1QE1A 1S1VB 4EZ6A 3L95X 1M5HA 1YRUA 5KFUA 3X3UA 5L46A 1KTQA 3BV8A 4AL7A 4O3RA 4W90B 4DV2J 3V81A 4LFBJ 2B43A 2Z2ZA 2E1MC 4LF6J 4TU8A 3QIDA 4OL8A 2C2EA 3LP1B 3M6WA 2KB2A 4DX5A 5D3GA 2O01C 1S7HA 1QUPA 1WEYA 1JLGB 4LIWA 3BREA 5LJ5Y 1LK7A 3JSBA 4DV4J 4HHHA 4P52A 1TAQA 3CJQA 2Y0SD 1PBUA 2L48A 4ZPDA 4F7VA 4IR1A 3BPDA 4HT7A 2BR0A 2OPQB 3HD1A 2CIMA 2IM1A 4B02A 3QFHA 1TKTB 2NXJA 5B0GA 5DJBA 3CF5Q 4FXDA 3C2PA 3EGZA 1HNVA 1SL0A 4M5LA 4QW9A 2AZ3A 5IC4B 5IT9Y 3MCNA 3FMBA 4NLSA 4JI3J 4DHVA 5MLCV 1RWNB 2AHOB 2B8PA 3PJ9A 3H0PA 2FLOA 4OYZA 4DFJA 4AL5A 1R89A 3PW2A 2KL8A 3G8SA 1FJCA 1NZ8A 4B9LA 1AW0A 3NBPA 2VOOA 4DV0J 1P9YA 1YZ6A 3MXHP 4I2PB 2KHCA 1TV6A 2FHMA 1F6TA 4M5MA 2RKIB 1TVRA 3Q8VA 4O3OA 4D3GA 2KYZA 1AFIA 4JI4J 2FQQB 2YH0A 1EQ0A 1FFGB 1IM4A 2DHHA 2HRTA 2OPQA 4U6PA 5GAHU 1X0FA 5GAEU 2DGUA 3OTDA 4IYQA 4JI2F 2XB2D 1EB0A 2MSSA 3G86A 2IPOB 3SCJE 4M5JA 4FVCA 3BH6B 3PKYA 2IM2A 2XBPA 3PV8A 4BHQA 4F4AA 2ASDA 4K4YA 3WIVA 1A0OB 2I2YA 2DNNA 1SJFA 1JB0C 3A13A 1L5UA 2M9KA 3OL8A 1H74A 3GYGA 4LSNB 4CLTA 3CCSS 4J9RA 2GX8A 8RUCA 4P2MA 2W9BA 1V5VA 4QYRA 1ROFA 4IKAA 2VJUA 4DR1J 2OJ3A 5L39A 5IWAJ 4MTPA 3TJ8A 4J9SA 1JLGA 3OJUA 4QU6A 4AL6A 4O44A 2QMXA 2XM3A 1U8WA 4F0MA 1S9FA 1QVFR 3RZAA 2KJVA 2GJFA 2XYHB 4DBQA 1SUQA 2V8VA 1FT8A 1X4FA 2X7IA 3AB4B 4CO0A 2XI2A 4ECSA 2JEJA 1T3OA 2DNRA 5KG4A 2B9WA 1P8GA 1RHKB 3D1QA 3QLHB 3V81B 3EM1A 2EK1A 3VQSA 4WCEQ 1X9SA 1CS4A 3VZHA 3EPIA 1VLOA 1NK0A 2JOQA 5FIIA 3H25A 3TAPA 3HHLB 2Y8YA 1Z2LA 4YP3A 2PFFB 3I0RA 4R8UB 4RNMA 2PI5A 1RTIA 5GVQA 2XO7A 4QWCA 1VGYA 1RCOB 2XMKA 4JI8F 5B09A 2YH1A 3U1NA 2BEFA 1FK9A 4A47A 1RXOB 3IA0A 2RHSB 1EP4B 4OMFG 1QAXA 8ATCB 5DG9A 2XNRA 3M2VB 3D67A 4A8WA 4ES3A 2G2YA 3CCMS 4C8YA 3EDQB 2JC0A 3QGHA 3PR4A 3H40A 2RILA 4ZVQB 4ED2A 3PVXA 5FD1A 3VGUA 2C3PA 3MPDA 4AXJA 1OQ3A 2WZ1A 4IFYB 3R6LB 2VHGA 5IT9U 3W2WB 2MPUA 3SQGA 5A2QY 5ETSA 5IQ6A 1G6BA 3NKYA 4KFBA 4NA2A 3MF5A 1ZH5A 1YDLA 3VCDA 4DCOB 1N56A 2HQFA 3CC7S 4MT1A 1UWBA 3NAHA 5LSOA 1FE4A 1T03B 2ILZA 1D9DA 2ERRA 3UN3A 2HFVA 3M7VA 3PX0A 4KH1B 2HKEA 3VHQA 5JVGQ 1LW0A 4IOCQ 2XS2A 2H5EA 3BBBA 1WHWA 2C2RA 3G6XA 3RAMA 4LFAF 1T94A 4DR6F 3HPOA 4GC6A 2DVIA 3ITHA 1VRQC 2RE1A 1BGXT 3POTB 3FCWA 4DQSA 3QWUA 2Y1JA 4IG3B 3QGGA 4WBFA 3W62A 2E9ZA 3T5LA 4KIAA 3NNAA 1RT1A 2ROGA 4NLTA 4P75A 1S1UB 1N33F 1HKAA 1OMSA 3D2WA 2V2VA 3QT5A 4CCHA 2HQ3A 2LQ5A 5AE3A 5KFOA 3ZNUA 2ABYA 2K8GA 5GADU 3GP9A 3Q24A 4RW8B 1IXKA 5KFPA 4G6VB 3ZNJ1 1KVKA 3MEEB 4OYOA 4F04B 2VQFF 1J5EJ 4LQ3A 3D68A 4DG1A 1R27B 1S1WB 1RABB 2DGQA 2QMWA 4I56A 4WYWA 1DFDA 1FXDA 5JMNA 2AQ4A 1HHSA 2UP1A 4OI1A 4JV0A 4RUAA 2CNNB 3U7JA 4FYDA 3H2UB 3BYRA 2RQCA 1IVZA 1LXNA 2YNGB 4X4NA 2F4VF 3AOCA 1VOMA 4QR2A 2E7XA 1YJ7A 2E5GA 2DYAA 2B6AA 4NLOA 1YJVA 3PZPA 3DGPA 4LJMA 3GPAA 2VQEF 2QL7B 2AYMA 1T9UA 4O4GB 1UFKA 1L3TA 2FHKA 4YR0A 1BD6A 3T1YJ 3VAFA 1SIZA 2DGTA 1HYSA 3L3CA 3BM7A 1M5KC 3K5LA 1FI4A 4DQIA 3A3PB 5GAHI 4TN2A 1Q8KA 3KHGA 1SC1B 3OFGA 4CO5A 2AX0A 1RYRA 1HNZJ 4FBUA 2QLXA 1VBZA 3BGLA 3FEXB 2IFXA 4ED1A 2HBYB 4JV2A 3D5MA 2B51A 2JSXA 3G6YA 2WONA 2VBYA 4C3LA 1B7FA 2KO1A 2V94A 4DR4F 1VISA 4ZP9A 2Z0GA 3LUYA 4GO5X 4YDDB 1U1KA 2DR8A 2VIHA 3PJWA 1CC7A 2RSQA 2KT3A 3HLUA 3ILOA 3L7UA 4CZCA 3K2YA 3QATA 3UE2A 2IMOA 2VL1A 1Q8IA 3W61A 1RTDA 2GVZA 2QYCA 4N77A 5E5NA 2AGQA 2IBKA 1UP1A 2QLBB 3T6BA 5KFYA 4WTYA 1MMDA 3GB0A 1G1XA 3MM6B 1L3KA 2EPIA 2JH3A 2B4VA 2VH7A 3GJTB 4ZVGA 2VKRA 5KFQA 3MR6A 2FVRA 3PJXA 1IKYB 4CM0A 2J8AA 3CJ3A 4R0EA 4MYTA 5AE2A 1S5ZA 3EZUA 2ZJRQ 1HI8A 1RLCL 4QIGA 5DS7A 1B3TA 3GFYA 2HPUA 2CPJA 1BY9A 4L3KA 3I87A 4AQYF 2HURA 4OIXA 1OPIA 1ZPWX 2C2ZB 2Z30B 4Q45A 1YI2S 4KT0C 2XG8A 5HO4A 2FZKB 3DC2A 3D54A 3OTOF 1UVLA 4JYAJ 4ELVA 2FVSA 5HLFA 1NK8A 4OX9F 3ICLA 5CYMA 3CCRS 1U1LA 4MFBA 4H4OB 4DUTA 4KY3A 1RWUA 4X62F 1U6BA 2J9EA 1R0AB 1RUSA 1KBRA 3DYAA 4N47A 1UW9A 5KFZA 1ZA1B 3D6TB 5D6GA 4FN5A 2ALZA 4DV1F 3CCES 2HAIA 2LQJA 1FRMA 2JLFA 3OSNA 3KLVA 1S76D 1T05A 4LR8A 3C46A 1YIJS 3OVAA 3IG1A 1WEZA 3FGVA 4MMOA 3W2VA 3BSCA 4DV5F 1QAJA 3MEEA 3PFOA 1VFJA 5ETRA 1RBOB 3IWNC 1MMLA 4NLRA 2Y1IA 4KV8B 1WOPA 1N5VA 1DQ8A 2NCKL 2WOMB 4CT8A 4DL7A 2UUBF 4B9SA 2VQFJ 4E2FB 2H5IB 2XYGB 1F0XA 3A8KA 1SIWB 3MTJA 1JLQB 2VG5B 4QR1A 4LF8J 4E98A 1TR0A 3UVJB 5K20B 2HHSA 4MKYA 2CADA 2Q6BA 2DIVA 2VG7B 1VS3A 1LWFA 3H2LA 3H4BA 3POTA 4WKYA 1YJTA 2V6AA 2M3DA 3CD7A 2H9ZA 3CWJA 3GSIA 2MB0B 4BDPA 3SSQA 1WG5A 1N5TA 3F44A 3N4WA 2HQDA 1UFLA 1OSCA 3R27A 4OYIA 4CO4A 3CD5A 1HD0A 2W7AA 2A6OA 1NJZA 2D74B 4CLYA 2MZSA 5B0DA 3CGIA 1FERA 4X64J 4M5KA 1VIOA 4PXDA 3OD2A 4F26A 1GX6A 2OLWA 1UPMB 3G87A 3QSIA 2LDIA 1YBTA 3SQGB 4LFCF 5F3ZA 4PRFA 5GMKa 1SB6A 1Y0HA 2IYGA 2YXLA 2OPRA 1NNDA 2IDLA 5DZ7A 3MPVA 5BXIA 3Q2TC 5LM7E 4BWMA 2UUAF 1WWHA 2PD1A 4FNHA 4E8UA 4RW7A 4ZN3A 3M9MB 3CJ2A 4YEAA 3KYLA 3QO9A 1GEHA 3RRKA 2BDPA 4JI6J 5LSRA 1N5SA 4ECYA 4ZPAA 4P72A 2FVPA 3ZC4A 1MN9A 4NXNF 2EFOA 3THPA 1S72S 3DRSA 2YQ3A 3G96A 3HHLA 3J7YU 3B78A 2J5AA 2FY1A 3BGFA 1JLAA 2P9GA 1X4DA 2B7CB 3RB0A 4P10A 2C2OB 4DV7J 3PW4A 4C8ZA 1NU4A 5HLFB 2M52A 4BC7A 4JV5F 3N5BA 4CNYA 4ZKAA 2V4RA 1LV5A 4K4UA 1KD1T 2BABA 4HR2A 2UXBJ 1YKWA 2QC3A 1FCAA 4OX8A 2W9BB 2O66A 1W2IA 2MJNA 3O1LA 4RW6B 1WELA 3FFIB 4IUFA 2R7SA 2RHQB 5KG7A 4DR6J 3NS5A 1KQKA 3V6JA 1OIAA 3PX6A 2IVMA 2IIHA 4GKKJ 3GONA 4XDCA 1AA1B 1SC3B 2CWKA 3MM6A 4RNNA 3TYTA 3DDIA 4ZVPB 3RB6A 2NSCA 2CJ9A 4P7VA 2JNJA 5LL6d 5KT7A 4A8MP 3A8EA 2CPFA 1VJQA 2QSFA 2AJ2A 4H54A 5D0GA 4DDFA 2LCWA 4ECVA 3SSSA 2RS2A 4I2QB 2DY9A 2POKA 5AXNA 1VQ8S 1VQYA 2YKNA 4ZPWR 4A8OA 4C7QA 5E3CA 5BYRA 4N8OA 3M32B 1EJ7L 3LANA 3DLEA 4EU0A 4WFAQ 4CH1A 4NI2B 3RAXA 3CB4A 3NGKA 1S9EA 1V9OA 3N6MA 1B0VA 5C24B 2MQPA 3TAMB 4RUCA 4X4OA 3W8PA 1Q7YT 1LKZA 2FJWA 4F2RA 1RWMB 1CVJA 1ZM4A 4TQSA 5HANA 3BQ1A 5C25B 4HTJA 2WVFA 1UJ5A 2CYYA 3CDEA 5F8HA 2RU3A 2F9DA 2VB6A 3TX0A 4QW8A 3KHLA 3HO1A 3UR3C 4QBUA 5CYQA 1RT7A 2HHHF 2V4JA 4URQU 3MECA 3WC0A 2WVBA 1RAHB 3ZZOA 5KTQA 3OL6A 2NXCA 2OPSA 2J6UA 4C8KA 3NNCA 1FX4A 2P2CB 3GV7B 3BYPA 2AZ1A 5SUHA 3SFGA 2GIRA 1WF0A 3OPKA 4LRCA 3RB3A 5HMXA 2R7XA 1XTZA 2AEJA 4ZVFA 4XIUA 4C6AA 1REVA 1YQHA 3MD1A 3N5FA 1TU0B 2ZHAA 1RHRB 4Y3CA 2KFYA 2WVCA 2FDNA 1NK6A 3IBCB 1OPZA 2FB0A 5U47A 4MKAA 1XR5A 4QWAA 3H5YA 2UU9F 2A0FB 1RA7A 3VALA 1Q81T 4DV4F 2E5JA 2JEGA 2YNHA 2ASYA 1S1WA 2KKHA 3L9ZA 3OUYA 2KFZA 1S1XB 2ZBRA 1QE1B 2DR5A 4RW8A 1VRTB 1SL2A 2QTWA 3JTPA 1FFSB 3VVTA 2AU0A 2E66A 2BW7A 2HNDB 2GZOA 2F4FA 3C6TA 2W2MP 2DH9A 4DSJA 4JYAF 2AV5A 2CJYB 3AJDA 3C14A 4KO0A 4UUXA 4WJBA 4L72B 1R8CA 3WX8A 2CJXB 4G1QA 1RT1B 2WSEC 2K1RB 1S10A 1ZPVA 2N3LA 3BGRA 1DHMA 4DN9A 1XNRF 1U8SA 4IG3A 2WVEA 4RBTA 2ZE2A 2YQ1A 5LOQA 1MU2A 3CT9A 3Q23A 2YKOA 3KJFB 4MH8A 3IWLA 2CRLA 1PAUB 2C2KB 1TTHB 1U02A 1LW0B 2BJ8A 2VDHA 2XLIA 1CSJA 3MURP 3MR3A 2RQMA 2CNKB 1JJCB 3NS7B 2F9JA 2HRUA 4B9UA 3DKDA 4PG4A 3JYTB 4J9PA 2BW2A 2R8GA 2RUSA 2C3YA 3KUHA 1M0SA 3M8SA 3JB9k 2AJ0A 1ZBTA 4J9VA 1H98A 4QIVA 1DY3A 1KSPA 2ZDPA 1R6YA 2DPIA 3D9BA 1S79A 1QVGR 1S6UA 3SDEB 2Z58B 1KLMA 3V2UC 4F4WA 2XZTB 1M5VC 2UU9J 3TOQA 3CEDA 2GAGC 2M8HA 2I6WA 4CNZA 2VA3A 5DG7A 4A8FA 4NXMF 4EO8A 3UFCX 3FMWA 3LPEA 2H4YB 5A8WB 3A8JA 3NNHA 4PG5A 2J9DE 2BE2B 2QE5A 3E3XA 3HI9A 2B4UA 4YDXA 3UO0A 1UVJA 4CH0S 1RWXB 1S1XA 5BR8J 1JIHA 3BDPA 3OUYB 2JL9A 2QRRA 2RDIA 3QLHA 4X4UA 3T1AA 4NLPA 1EKSA 1JLCB 2LA4A 4DFKA 3BJYA 3MM8A 1I94F 3OSPA 4EYIB 1PJ6A 1VC6A 2VONA 4DX6A 4RJVA 3W63A 5LMUF 2UUBJ 2P9CA 4ZLPA 3MFHA 3OTBA 1SJ4P 1TFYA 5AXMA 2HFSA 1IKWA 2FY8A 2AJQA 1FTRA 1D8ZA 5F41A 1MMNA 2VPZB 1KTVA 3IR6B 3AFGA 3QIPB 1RGVA 2ZWOA 4C0BA 3CCJS 2VKZG 4K4XA 1HR0F 2QIFA 3CCUS 1T7PA 3CC4S 5D77A 3F0NA 2CKWA 3K57A 2DNGA 4Z2XA 2HBRB 2KT2A 2CWXA 1P27B 4DF8A 5A6PA 1S0MA 1RTHA 3GSDA 3EGVA 3QAUA 5SZTA 1RT7B 2UZAA 1YRTA 2RJZA 1WI6A 1UL3A 1MROB 2ZJQQ 1R6VA 5D4OA 3PYEA 4UT4A 3HKWA 4FKXA 3DGVA 1EZZB 4LT6A 2KU7A 4URGA 5HMZA 3KG0A 2ALYB 2F63A 5HVHA 3TZXA 3SQOP 4J9LA 2R9LA 2MEWA 3HDSA 2C42A 4GVLA 1DAXA 1YZ7A 2PDAA 3NBPB 3KJVB 4NI2A 1X4CA 3NLCA 1QTNB 3V6KA 2WCXA 2YPZA 4JI5J 3SCIE 3HXMA 3DN9A 1HA1A 2CPDA 4I6AA 5EGYA 1HWJA 4ZPCA 3RR7A 1OY8A 5H9FK 1CPZA 2I5JA 2IRYA 5EWFA 4ZVUB 2VOPA 2C2NA 2EFNA 3RB4A 4HDGA 4DR4J 3JSMA 3IP0A 1GTHA 3R7BB 2E9RX 1WOSA 4I1TA 2Q66A 2CFXA 2HK3A 4K2JA 4OZNA 2MZJA 4UOHA 3C6UA 1CJKB 2YKQA 2MKSA 4L6V3 4TNOA 4DU8A 3W8GA 3T6JA 4OHWA 4DQQA 2PC6A 3PTWA 4Y65A 2FPHX 4ZJLA 3KLEA 2K7JA 4NA3A 2CQ2A 2QFIA 4Q2LA 2OEKA 4CLZA 4HL9A 2FJBB 3CMAS 4MK9A 2Z4PA 5D3GB 3MPWA 3RTVA 2IBOA 2BJ1A 4JI1J 1C2PA 3AD7C 2ZC3A 3TUJC 3PNIA 2BQ3A 1BMQB 4NLVA 1VQ7S 1SC4B 2MHNA 5DDQC 4PCQA 1XMQJ 3D4JA 2J6TA 2Y8WA 1HD1A 2V2KA 2VQEJ 3LH2S 3I32A 1WI8A 1DRZA 1XNQJ 4KE5A 1FKPA 2A2CA 3CDUA 3DRRB 4C0HA 1RP5A 1HWUA 1QM9A 2MY7A 1HBUA 1GTEA 2PGCA 3DOKB 2DEJA 2W24A 4ED5A 2EEYA 2JX2A 1TL3B 3EUNA 1RWPB 1UEKA 1G7CB 1WC0A 3HJVA 4I0WA 2EFGA 1PGZA 1N5YA 4N76A 4HVZA 4JOUA 2XWYA 2DHGA 1Q5YA 3WBZA 5I42A 4LRBA 1FDAA 2QO3A 1IBKJ 4LR7A 1RWWB 5KG3A 3JSRA 1BQXA 3MCOA 2BOAA 2Y1LB 3CDWA 3MGJA 1RWKB 2UVVA 3MCMA 2LMIA 2ZUGA 1N8RT 1EARA 1RI7A 4FXVA 4QYZK 2XTJP 3EJMA 3I4PA 3VR1A 3EMTA 1UW4A 4XPCA 2RNEA 5E0OA 5DLGA 2IC3B 1K44A 3MTKA 2FVQA 3AXKA 3ZZRA 1RSCA 1HQEA 3CJ0A 3ZTOA 4Y2CA 2HZCA 2FJEB 2FYXA 1ZM9A 2P8IA 2B0GA 5I3UB 2DRAA 3AQOA 2DGVA 3CVKA 3MFIA 4KTQA 1DJ0A 4PKDB 4L74A 3UVJA 2EG1A 5HL7Q 3HFZB 3PX4A 2W7OA 2VFTA 1JLQA 1Q8BA 1EKRA 2AMCB 4IDKA 1HI1A 4X65F 1HNWJ 4DV5J 3TZZA 3RBDA 3BF4A 1CG2A 2AYEA 4LF2A 1HBNA 1IQTA 1RT2B 1NSQA 2D41A 3IAM9 3K17A 1IJEB 1F60B 2B4OA 3PEJA 4YOEA 1Y5LB 3BEGB 5HROA 3TJAA 1F9HA 1HNIA 1KWMA 2IHR1 4GMKA 4OZ5A 3F73A 2KYXA 1VRUB 2FJVA 1C0UA 2AGPA 4F25A 5KOWA 1OYEA 4NCAA 2QLFB 3TVYA 2XY6A 5G0RA 1NJXA 3NGDA 3M8PB 2DITA 2DKOB 1MNEA 1U4BA 4WKRA 3A3NB 3FNNA 3M2UB 2IM0A 4LF1A 4MKVA 3UW1A 4Q7AA 1TMMA 4OYXA 2MGZB 3K58A 4DR7F 2VC0A 1E6VB 4FF4A 4MFBB 5HQ8A 4RNHA 3BR8A 5KFVA 1YGYA 5D0EA 1EHWA 2AT1B 5KT2A 1QSLA 1AFJA 4JI0J 3T5KA 3QJPA 4Q0BA 3P96A 2XMTA 2VICA 2GHWA 2O1PA 2DIUA 3LW5C 2NXEA 1NK7A 4JI5F 1GQEA 2JDJA 2EKYA 2NREA 2I0XA 2ZH5A 4DV2F 2ZH2A 1FXRA 4CYUB 1RKJA 1QY7A 2W9AA 1NDCA 2GO9A 1UZDA 2PN6A 2V67A 3QWPA 5C42B 1ZZNA 4Y0FA 4LF5J 4USHA 2K2PA 2QX0A 3FRYA 2U1AA 3NGUA 2FIUA 1TKDA 3CO9A 2NYIA 3HF5A 3GZ7A 1U1RA 5J1EB 1HPZA 2B3TB 3HVTA 4JI7F 2W4CA 5I3PA 1U1OA 2FHOB 2EFQA 3G9CA 2OO4A 4NZ7A 2LKZA 3M05A 2BJDA 2UUCJ 1D3WA 2LU2A 4QPXA 5HBMB 5A0YA 4QCLA 2R7OA 2DCUB 5KG0A 3QQCD 2FLPA 3EVOA 1HW9A 1TL4A 1SKUB 4M5DA 4YB6A 1JXVA 1S6PB 3N01A 4A8KA 1UA1A 3O8WA 4LFCJ 4B3RF 1HQUB 1BQMB 5IT4A 5C2CA 1YRXA 3HVTB 2LECA 5KFFA 1C4AA 3TX8A 1HR0J 2GHPA 2ZEJA 2MLYA 3EGWB 4ZVRB 2KXNB 1XNQF 3OHBA 5DETA 3FBBA 3OFHA 1JKHB 2MTLA 3Q89A 4RZRA 1VBKA 2OD4A 1VDHA 1APSA 1P1TA 3PRVA 3SMZA 4CM2A 2F8EX 2E5LJ 2L9WA 2PSZA 3JXOA 3LWLA 1WKLA 1RDRA 2B6AB 5LT5A 1Y4ZB 4LF5F 1NO8A 3D66A 3SZ2A 3GIKA 2ZH1A 3GIMA 3CJ4A 4OZ1A 4FYYB 3Q0AA 4TXSA 2CPHA 1GFWB 1KOOA 1NEEA 1PYTA 4PWDB 2LFVA 1RT4B 4YQWA 1VC5A 5T14A 5IZHA 3VV2B 1VK8A 5DGBA 2W2NP 2YKMA 2VZ9A 4BBYA 3MUVP 1M5PC 2HMIA 3IC1A 3DOLB 4L75A 2RH3A 5HK4A 2MGZA 4R25A 4USTA 2V2ZA 4ECQA 2V63A 4USMA 2Y1RI 2CJKA 3IBFB 5G0RB 3OVSA 4OI4A 2M88A 3IS9A 4OI3A 3G6VA 1S97A 2V68A 3BN7A 3QGIA 4DSIA 1HL6A 3GWCA 1S48A 3CJRA 3MMBB 4NYPA 3IM9A 3K5OA 2LQ8A 2HBZB 1GNKA 1HHQA 2HQCA 2MKYA 1UWBB 2HIYA 3QZ7A 3M30B 1IKXB 1Y9OA 1X5PA 2XHWA 2HAFA 3BBCA 4KB7A 4Y2AA 2W01A 4LREA 3KXDA 5LMNF 3TARA 4C9DA 1Y10A 5C5JA 2NUHA 1J5OA 5KFXA 1VQ9S 1HBOA 2CZ4A 3W9JA 5KFHA 4IRCA 2QYGA 3C15B 4UUWA 4ZLNA 4IG0A 3B8HA 7FD1A 2HFUA 5ETOA 4CLPA 1X5TA 3P4UB 3QAEA 1TL7B 1YBAA 2DB1A 3J7A1 2RQKA 3NEKA 4USJC 3NY0A 3CPWR 2DXDA 3DMJB 4DLGA 4J91A 1O5JA 1RHMB 3ZXWA 2R7TA 4ZP7A 2WBRA 4J37A 4E0DA 1VQ6S 4LRAA 2Y3YA 4UOFA 2VF3A 1T9VA 4AT1B 3THVA 1M5SA 3E01A 2VV5A 3TW0A 3S8SA 1I3OB 4RLEA 2PA8D 1J2VA 4HHJA 3D0GE 4DPWA 1FK9B 5CH7B 4KPYA 1NPPA 2CNLB 4J7CA 2YX7A 4WE1B 1DTQA 1SKRA 3AA9A 1JNRB 3HD2A 1RADB 1RT5B 3O6QA 3M8QB 1UTAA 3P5TL 1N5YB 4PUOA 1CS4B 5CA5A 2ZH4A 2EI5A 3GFZA 4DWIA 1QLNA 3HK2A 1K0VA 5KFDA 2BRKA 1VMBA 2NXUA 2V8DA 4DR1F 1XQIA 1SUQB 1CC8A 3EXCX 2GO8A 3AHPA 2R4FA 5HMYA 2IA0A 1FEHA 4ZS6A 1N32F 1O8BA 1WF2A 3CJKB 4KSEB 4ELUA 2ZUAA 2I9SA 2OPPB 2BA9A 3C16A 2PMHA 1UJ6A 2NLWA 4U67Q 2BANA 4M95A 4WIIA 3R8YA 4OV1A 2HEKA 5GMEA 3HP6A 1IBMF 2M7SA 4RW9B 3HT3A 1X4EA 4WFZA 4EBCA 2GA7A 3MD3A 4RU9A 3HZGA 3CCLS 2YVSA 1NMEB 3OLAA 2EW9A 4RWXA 3BO2A 3R6GB 4P2FA 5AXLA 4OHYA 4ICLB 4ED0A 2ZDOA 3NG8A 4B3RJ 1SCJB 5HMWA 1PG5B 4DXLA 3S01A 4HT5A 1XR6A 4P74A 2LYVA 3AB2B 1CJUB 3JSYA 1KKHA 4F3QA 2VPWB 3R5CA 5HN0A 5KFWA 1TVRB 3JSMB 1KVJA 3M9NB 3I9V9 3KUEA 2G1DA 1N6QB 1IM6A 1JLFB 1LQ9A 5BYQA 2I5JB 4FF1A 4XK8C 1FNXH 2ZH7A 1XNRJ 3MR5A 1F5AA 1NAQA 2FJDB 4X65J 1HNWF 3NCPA 4YR3A 3HHLD 1FRIA 1H72C 2CJBA 3GJRB 1TUWA 1IWAA 3H90A 2YY3A 4OHXA 5A8KA 1FVQA 1WG4A 4FYXB 4DI6A 5B08A 6FDRA 2MQOA 4DUYJ 1T02A 2V2QA 4WWSA 2KXFA 1TKZB 3DLLQ 1RKIA 1HNVB 1XEZA 4O23A 2F8HA 3QPIA 3E8OA 4EUVA 2B9YA 3CCTA 4PG6A 4ZA1A 3UDEA 1T9TA 3HHDA 3OR1B 5KG6A 1WC1A 2PI4A 4OI0A 3KUGA 4G1IA 4K59A 3A1YG 5CABA 4ZITA 3UR0A 5A6WA 3I56S 3KK3B 1NJIT 2G4BA 4DV6F 1VHFA 4PG8A 1P6TA 1F2GA 4NXNJ 1HWIA 1NDLA 2QT7A 2G0JA 1Q5VA 1RAEB 3LP1A 2DRBA 4GKJJ 3EGNA 4MYUA 3T5JA 3AJ1A 3LWMA 1F3FA 1JWWA 4K5RA 3TEHB 5K8MA 2DXFA 3MMJA 3LQVA 1ZA2B 1N34F 3ELHA 2E7WA 3P3DA 5HVGA 1SQGA 4K4ZA 1NHKL 1RTJA 2H48B 3C16B 1XR7A 1R3NA 9RUBA 1CJVA 1YJUA 4NZ0A 3CJKA 5DRKA 3HVWA 1H2UX 4CLWA 3H5SA 1KEKA 2M8DB 2CQ0A 1BUXA 1RT6A 1JLCA 3DRPB 3BO3A 3R3TA 4HTIA 1MWZA 4CDIA 3RRHA 4X4RA 2HWTA 4UTGA 2GJIA 3HKZD 1UFWA 3QJLA 3RRGA 3FKBA 3R97A 2FC9A 3O3LA 2ADCA 4M5IA 2BE9B 3B82A 5EX3A 5KFSA 2OEJA 1RT5A 1XMQF 1T3NA 5LMUJ 2JLGA 1N34J 4XTTA 1J5EF 2QL5B 4HH0A 1NB7A 2O3DA 2ZWPA 1PC5A 3DXSX 3DOMB 3V4MA 5KFNA 4OX7A 4RL1A 2WK4A 1GMWA 3DDKA 3DLGA 3E01B 3NGSA 1KLMB 4RO0A 4QWEA 4DV6J 3QT8A 4WP3A 3UCGA 4EFAC 4DSKA 2QGFB 2GIQA 3OR2A 1N52B 4X4TA 1BXNA 2CDRB 2DGWA 2XI3A 1HLWA 3RBZA 4CIOA 5AT1B 1U1MA 1M90T 1BE4A 2G0CA 2MQMA 3LA0A 3CE8A 2HVZA 4QIFA 2XLKA 2MLZA 1KQFB 3KK1A 1HQ2A 3JYTA 3P6YC 1N33J 1Z1ZA 4DR5F 4M5GA 5J1NA 4DUYF 4B3TJ 3P49B 1HBMB 2I38A 2QA4S 2B5JB 2HHPA 3FC9A 3P5BP 4Y2MA 3TZYA 3CMES 3EE3A 3VGVA 1S1TB 4I6YA 1A7GE 1R8PA 4P2XA 4U7UD 4M8LA 1H38A 2J8SA 5ETLA 3NAIA 2HVHA 1QAYA 4LFAJ 1Y00A 3NOCA 2WW4A 1TQLA 4H4MB 4DPOA 2CNOB 3IO1A 5KOXA 2K1RA 4IH5A 2EG2A 4OLOA 4WTOB 3CUNA 3RJMB 4Y28C 4DX7A 3HULA 3C6TB 4M5NA 1M5OC 3HFKA 2ATLA 1PYSB 1CQNA 1OO0B 3X1LB 2V9WA 2G2OA 2KM8B 2MQLA 3EVMA 3TR5A 4U7UK 3TQEA 1VQSA 2YBVA 5HJYA 4USIA 1VQOS 1T8EA 2UUAJ 2L9NA 4YB1P 4IR9A 3RG6A 2B7BB 4JBCA 3PXGa 2D3ZA 1H7WA 2KRRA 3NCQA 3KLHB 2VJVA 4MIAA 4ECTA 1RHUB 1V5IB 2ZBIA 4OV6A 3HJFA 2GHVC 2XWXA 3ILLA 4X64F 3KMSA 4DQPA 4ILMA 1S9GA 2Z2MA 7FDRA 1NKBA 2IAJA 3KLIA 3KK3A 2K7KA 2VD3A 2HZAA 2PEHA 1REVB 4FKYA 2RF2B 1YX2A 4K50A 2CQGA 3R5GA 3TNVA 2BKOA 1E6YA 1I5OB 3PHEA 4PR6A 2AYBA 3ZTPA 3LOUA 3W5XA 1HWLA 5J2PA 1TP7A 5FDLA 5L1IA 1B0PA 5F8JA 3DCAA 1F3VA 3KHHA 1XBWA 2C1EB 4K4WA 4PPZA 3QRQA 3T1HJ 1X31C 3Q8PB 1AXQA 1NSPA 1SJ1A 5J2MA 3H20A 5CYQB 2JVOA 1XK8A 5A8KB 1YJWS 1KRPA 4F3OA 3J7Z5 3TI0A 5J1PA 5K14A 1H2TZ 4U8VA 4AFFA 3V5RA 4DL6A 4JI2J 4M5DB 2HHQA 1WACA 3KJQB 2WSCC 1ZAVA 1IJFB 1WHVA 3FZ2A 3PYGA 1S7IA 4OLPA 2YWKA 1XN9A 2CQ3A 3H5UA 3O2IA 2F3JA 4LIRA 4I64A 3PFEA 4FP9A 2YNIA 1V3ZA 3DLEB 2Z57B 5L9NA 3BQ0A 2HVDA 2KDOA 1LOUA 3KK2A 1TK0A 2YKNB 3R9LA 1RAIB 2E29A 4R5PB 1ACMB 2R2UA 1PKUA 5IT0A 4DUZJ 3FBFA 3IRXA 2MKCA 2DEIA 3OXGA 2DO0A 4C48A 2XMMA 3US5A 2F65A 1YJNS 4B3MF 4F4KA 4M1KA 1WJ9A 4USWA 1VYAA 3F56A 2V4QA 3QFWA 1XERA 2ZFHA 3DRXA 2QV6A 4BWJA 4USVA 1X4BA 2ZJPQ 3BZQA 3ETMA 4RW9A 4ID5B 1EX8A 2V8GA 3AAWB 3SSRA 1FD2A 4FYVB 3H5XA 2DRDA 3SIPB 2BANB 2CXEA 1NKEA 1Q78A 5F8NA 1R8AA 3S6EA 2OPPA 5J2NB 1NPRA 4JI7J 3N79A 4QU7A 3LAKA 4BLGA 5IM0A 3J81j 3MM5A 4KHMA 1KNZA 1S12A 4DSFA 5HP1A 1U0HA 2KN4A 2BOPA 2X1BA 5ETMA 4DR2J 5AJ3F 4ERDA 1WORA 1UVNA 2MZRA 2AWZA 3MAAA 4G3IA 4HACA 1G4CA 1O51A 1MN7A 2RMLA 2UUTA 3FSXA 3MDFA 1IBCB 4LQ9A 3PR5B 1LNQA 4UQGA 3Q8RB 2G9OA 4DV7F 4J9KA 1VBYA 1FJEB 1FF2A 1X7VA 2N4DA 4ZJQA 5KFMA 4OZLA 3UDVA 2FLNA 3K89A 2H65B 1C0UB 5KFGA 2QFJA 4LSLA 3DFEA 5B0FA 1GXTA 3GMGA 2KG0A 4A8QA 1RT3A 2HYIB 3QYYA 1FJGF 2HS0A 1LW2B 2DNKA 3ZZYA 1XMBA 2ROPA 5DDOC 5EX0A 5F9NA 3TAQA 1FX2A 2RRAA 2BKPA 1Q79A 3LO3A 4PYAA 4W98A 1TMJA 3LP0B 4OYBA 3PO4A 1U1NA 2HNZA 1RWOB 2ZHBA 4N41A 1SH0A 2XZWA 3OLBA 3G71S 3DMJA 1UVIA 4P7TA 1GXUA 1JNZB 1PIEA 1SV5B 2VC1A 3A4TA 3KLFB 1TKXB 1TKXA 2I8EA 2FUG9 4KKOB 3SV3A 2AJ4A 1ZM3A 2N82B 3N9UC 4A4JA 4OZJA 2NSBA 3GQCA 1MW7A 1TL1B 1TL1A 4ECUA 2P9EA 4YB5A 2EK6A 3N6LA 3DLKB 4NRUA 1NK5A 1VC0A 2DNLA 2V5HG 3DM2A 4CLSA 3BSAA 3C19A 1DLOB 3S1TA 2LU1A 5EWEA 3CCWA 4NPOA 3RBXA 1SV5A 3NXZA 3TEGA 4N7TA 4DUZF 3T19A 3VGSA 2DISA 4TVAB 3UN5A 1NJYA 4K0KJ 2YWWA 1R7IA 2BJEA 2KT5A 3BGUA 4S0MA 1I94J 2HNZB 3KNAA 5KT4A 1AUDA 4Q5VA 2IJFA 3IGVA 1VQPS 1NHVA 3LP2B 3VGTA 1T11A 2FHJD 4KHPF 3T9NA 3MI7X 1LW2A 4C8LA 2LXIA 1RT3B 1TUVA 4Y2KA 3NRBA 2HMIB 1Q1KA 3NWGA 2YKMB 4PXBA 4Y2IA 4RR5A 4ETZA 2ZH8A 1KHWA 1U0HB 1QTMA 4MK7A 5ETKA 1Q16B 1VCTA 3KLGA 1FKPB 3DRRA 2JHEA 4NMLA 5B0AA 3EZ5A 1U48A 2E9TA 5IM0B 2ZZMA 2OAUA 4EEYA 2IRXA 1C0TB 1NSKL 2XO6A 2FGCA 4U8YA 1X4AA 1X5OA 1YJRA 3W5ZA 4ED4A 3PW7A 4ES2A 2X1GA 3W1YC 1XMOJ 4IQXA 2H51B 3K5PA 3MAAB 2HWHA 5GAGU 4H4OA 3NL0A 2YNFB 2FGOA 3M4XA 1LWEA 4KC5A 2CJAA 1N36J 2DJWA 1JKHA 1SC6A 2DGXA 4PABA 1KOHA 1RE1B 4A8XA 2C28A 2GW8A 2ZOFA 3GJQB 1IKVB 4PAAA 4C11B 5ETVA 2AJ1A 3CMQA 4AXIA 2XQCA 2PFDA 5ETQA 2AEFA 3IRXB 4ZCIA 5KFJA 1VIXA 3OJSA 3BQ2A 1BQMA 1HQUA 3M2RB 3PHTA 5IV3A 3T3FA 2F40A 4NLWA 5KG2A 1I51B 5CCMA 1IN0A 2OEMA 2YNIB 2RRNA 3MZIA 2WAQD 3HT0A 3ISND 2ZKUA 2GMHA 4I7FB 3CJ5A 3R5JB 3M8YA 4DS4A 2DNPA 5EUHA 4EYHB 1HMVB 4OFZA 4R5PA 1RZMA 1X4GA 4ECZA 2L41A 3OHAA 1ZETA 1WC3A 3LF0A 5HVFA 3A8IA 5T7LB 3H8YA 3KJVA 4ZP8A 5ETPA 1N0UA 2CVEA 4GKKF 4I4BA 1WEXA 2G0IA 3JS9A 3SCKE 2HHTA 3RBEA 3ZZTA 2CPZA 1F5BA 4NLGA 2XSFA 2UVRA 2UVUA 4OJ3A 1GMUA 3GFHA 3TANA 4DLEA 3FZBA 1QSSA 5HJXA 4DMZA 2KTQA 2GVDB 2F1FA 3V6DB 4OZ2A 2HNYA 4NEYA 3ZZPA 1FRKA 4FPRA 5K8OA 4ECXA 2IAJB 3KLIB 3UDLA 1B7YB 1PC4A 1S9GB 1VI7A 2GQQA 2CUYA 3CD0A 5DDRC 3SXLA 3Q8YA 2V8HA 2ACMA 2IJRA 3R5AA 3ZO7A 5GAEI 5EWGA 1UAWA 2XLJA 3IXQA 1E6YB 1FDBA 1H0HB 4NMXA 4WIQA 3DGPB 3TVKA 4ENOA 2X51A 1XC9A 2VODA 3IR7B 4JUZA 4WFNQ 3ILIA 3I4HX 3GYXB 3CNQP 5ETTA 4DL5A 1HNZF 4MJKA 3ZFVA 2ZD1A 4LF9F 4HLBA 4ZLJA 3MUMP 4F02A 3C66A 3GFXA 4ZIVA 1L3SA 4V19J 4IFVA 3HVAA 4DOZA 1AZSA 3UI3A 4C8MA 1K0TA 3U1MA 3I31A 1ZM2A 3DI6B 1D09B 1LFWA 1NZAA 1JLEB 3L09A 2DXEA 5HROB 4TU7A 1AB8A 1OQ6A 3K7RA 2VPXB 2QA4G 4X2BA 4AD6A 1UKUA 4CO3A 4B3MJ 3LGHA 3AD9C 2K3IA 3DDNA 4YMEA 3BN4A 5FLXU 2GFFA 2VG6B 2LXFA 2MHEA 2VPYB 1S1TA 3D1HA 3M1VB 3M8WA 1KN6A 3FEZA 1BQNB 4ATNA 2LEBA 2CG8A 2ILYA 2MZTA 2WB1D 4N5SA 4WFBQ 3KDNA 4K4SA 3J80U 4B08A 3BO4A 2JVRA 1IBMJ 4JI3F 4WXOA 1LWCA 2JJ4D 2ZVSA 4F3MA 3KK1B 3CC2S 1LXJA 5E33A 3IRWP 3AA8A 3OW2R 4QPTA 4AQYJ 4YS2A 4F4XA 1WF1A 2LP4A 4ED3A 1TK5A 2WHOA 4EMDA 1U47A 1S0VA 5IQQA 2E5HA 3W60A 4HYKA 1F9FA 1ZZFA 3MM7A 1TFWA 5D8HB 4RW4B 2B5JA 4PQAA 3OR2B 4EWTA 3PEHA 3D7SB 3ULHA 3GR1A 3K8WA 3FSYA 4LBHA 1T03A 2HIQA 3GU0A 3NOGA 2WBMA 2V0NA 3OTEA 4ANCA 2PE8A 2YKAA 2ZNYA 1IBLF 2UXDF 1Y3JA 3MM7B 3J81Y 3W2WA 3KMQA 1FKOA 4IFYA 1BLUA 3J7YI 4OZ3A 4WP8A 2BACA 2MQ8A 2LVWA 2Z2YB 4DQRA 1DTTA 4BC9A 1KR4A 4CRJA 3PG9A 5IV4A 3EX7B 3HVRA 3D0IE 3PW5A 2CVIA 3M2VA 2YX1A 3BKUA 3MAQA 1GMWD 3DOMA 1NKCA 1ZTWA 1WUUA 4ZP6A 2NUUG 3DOKA 5KG1A 4NYOA 1FJ7A 1KS2A 4DU7A 3CULA 4IO1A 4WP9A 4ZPBA 3TA0A 5DZ6A 1FNOA 2R7QA 4B3SF 4EBEA 4W92B 3GE9A 1RBLA 1VQLS 3PO5A 1LFPA 1JXEA 3FDSA 1Y5NB 3Q83A 3G4SS 2ASJA 2RS8A 4NCGB 3D6HB 3SFUA 4YUDA 2YNHB 3HZEA 4LRFA 3N0VA 2YX4A 3I9ZA 2XY5A 2CG4A 3DHWC 1H3DA 1XIQA 2MMYA 4H4KC 4IFVB 2R7WA 3OBIA 4A8YA 2IVYA 3HHKA 4TLQA 1MLAA 4ZDNA 1PO6A 5KFAA 8AT1B 5F8GA 3EYZA 4DR5J 4B3TF 2H4WB 1Q86T 2OKQA 4LSNA 2HZVA 5JJBA 1SKWA 1KONA 5IWAF 4P2SA 4HHUA 2QMUB 2N7YA 3OR1A 4USUA 1UVMA 4ZCMA 5MAOA 4KGKA 1W2BR 1NRKA 4GC7A 2OPSB 3ETOA 4YB7A 3SYZA 2FHJA 4GVBA 3E2EA 1TKZA 2EC2A 3MECB 3RGIA 1EETB 3TJ9A 2HNYB 3T5HA 3H2VE 3V6DA 2GVDA 4NCBA 1VLYA 5D0HA 2FTRA 1RBAA 2KXHA 2NPFA 1N88A 2VBXA 3R1LA 2ZZNA 2W7PA 2ZH3A 4KBIA 3ADAC 4WYLA 1RA6A 3GV8B 5GAGI 2ZITA 3D3CJ 4LF7J 1FHTA 3GG0A 1PSDA 2E44A 5C24A 1PILA 1WTFA 1B99A 4HI1A 2HHXA 1UZHA 1RAJA 1R0BG 2AJFE 2NPIA 2O5DA 2BVZA 4MK8A 1J27A 2MDAA 3W7BA 2OD6A 3VTIA 5L1KA 2E1CA 3TA1A 2RD5C 4J9QA 2J0XA 4DV3F 1N32J 4HDHA 4I2QA 2VFVA 4P71A 1UMJA 3THTA 4CLFA 4U96A 2QLWA 4DJBA 3LGNA 3MPYA 4I7FA 3ET6B 1PBAA 2RUGA 1ULRA 2WTFA 4DV1J 4GVBB 4ICLA 2JFKA 2M5YA 5H1SV 1SQEA 2XCAA 4LBPA 1Y5IB 3OQ2A 3UDCA 3GV5B 4DV0F 1M1GA 3RR8A 2BKNA 1C4CA 1CJUA 2OMLA 4I69A 2DHXA 5H9EJ 2GQCA 2MKHA 4RW6A 5H9EK 4LMZA 4C0OC 3BKFA 3NS6A 2KM8C 2DCLA 2DPJA 2YQ0A 1V6HA 2L9DA 3OFEA 4ZLLA 1RAGB 3FUYA 1WSVA 3D28A 3EPGA 3MM8B 3I0SA 2YNFA 2CQPA 2MY8A 4L3NA 4TY8B 3NMAA 4JI1F 1FD8A 1JJHA 2JRSA 4NCGA 3VAJA 1JLAB 4YY3F 4C4WA 4WZQA 5E41A 2XULA 3K8VA 4ZHRB 4KGVB 4LVNP 3HSJA 3M8QA 3GYNA 3MR7A 3ISNC 3MWBA 1X9MA 2J76E 4BS2A 1RWVB 3FK4A 3IAS9 2FD2A 3W9HA 4FDFA 1R0CB 3GIJA 1KC8T 3CD6S 3QRPA 4DPTA 4PUOB 1TUGB 1PAEX 1UEVA 1NM2A 1S57A 2AKWB 5KFEA 3LP2A 2MQNA 1UJ4A 1DTTB 1NHUA 2OPRB 5B0EA 2CPYA 3I5BA 2OI2A 1ELOA 3OXFA 1DARA 3PYFA 2J9CA 2LQBA 4OJ1A 5K8PA 2R8IA 1ICEB 2QL9B 3QZ8A 4NX9A 1WOOA 3TA2A 4F50A 3R7NB 1U0SA 1YG0A 2OMOA 5AXKA 4QWBA 2DR9A 2CQCA 3EICA 1TL5A 2GC8A 4HKQA 2E1PA 2GGPA 2P6SA 3BS9A 2R7UA 2HVIA 4IG0B 4RW4A 4OYPA 4F36A 2DHAA 1HBOB 1RISA 2GJ2A 2HSEB 1U24A 2OUGA 2RB7A 3MEDB 4RPFA 3U27A 2M4MA 2UXCJ 2JLEA 1CBKA 5KT3A 3I96A 2FLLA 2P6TA 3BSNA 5DQHA 1IKXA 4DEZA 1TL7A 1FESA 2LEPA 2UUWA 4UOCA 2X1FA 1Q53A 2R3VA 3KLFA 2R7VA 2A10A 2E7VA 3AT1B 5DDPC 5E3RA 3U1LA 3EDRB 3G6ES 1BQNA 2VG5A 2BMBA 1KQGB 3M1VA 5HSPA 2VG6A 3IWXA 1X4HA 2F5GA 4NLDA 3IFEA 2BYCA 5CD4A 4RU2A 3LP0A 4P6QA 2OIHA 3D6FB 3OXLA 3MUTP 3KOAA 4CT9A 2OSQA 4CTAB 5K8NA 3M30A 4J9MA 1NH7A 1S4FA 2X3DA 2DD8S
chains in the Genus database with same CATH topology
1U0HA 4NI2A 1CULA 4USUA 1WC5A 5D0EA 3MAAA 4WP3A 4CLLA 1Y11A 2GVDB 2GVDA 5D0HA 3UVJB 3G82A 4OZ2A 1CS4B 1WC4A 1CJKB 4OYWA 2BW7A 1FX2A 4P2XA 3C16A 4OYOA 4OYIA 3C14A 4OYBA 4CLYA 4CLZA 4CLFA 4OYMA 3ET6B 1AZSA 4OYZA 1YBTA 4P2FA 5D0RA 1AB8A 1CJUA 2GVZB 1CJUB 3C14B 4CLSA 1WC0A 1CJKA 3G82B 4CM2A 1YK9A 1CJTA 4CLUA 1CULB 1AZSB 3ET6A 1CJVB 3C15A 3R5GA 5D15A 3MR7A 4CLTA 4P2MA 1U0HB 1WC1A 4OYAA 4USTA 2GVZA 1CJTB 4OZ3A 4WP8A 4CLKA 3MAAB 1CS4A 5IV4A 3UVJA 4CM0A 5D0GA 1WC6A 2W01A 1Y10A 4WP9A 4NI2B 3C16B 4OYPA 1CJVA 3C15B 4CLWA 4CLPA 5IV3A 4USWA 1TL7B 1TL7A 1YBUA 2WZ1A 2QV6A 4USVA 4OYXA 1FX4A 1WC3A 4WPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U0H A;  4NI2 A;  1CUL A;  4USU A;  1WC5 A;  5D0E A;  3MAA A;  4WP3 A;  4CLL A;  1Y11 A;  2GVD B;  2GVD A;  5D0H A;  3UVJ B;  3G82 A;  4OZ2 A;  1CS4 B;  1WC4 A;  1CJK B;  4OYW A;  2BW7 A;  1FX2 A;  4P2X A;  3C16 A;  4OYO A;  4OYI A;  3C14 A;  4OYB A;  4CLY A;  4CLZ A;  4CLF A;  4OYM A;  3ET6 B;  1AZS A;  4OYZ A;  1YBT A;  4P2F A;  5D0R A;  1AB8 A;  1CJU A;  2GVZ B;  1CJU B;  3C14 B;  4CLS A;  1WC0 A;  1CJK A;  3G82 B;  4CM2 A;  1YK9 A;  1CJT A;  4CLU A;  1CUL B;  1AZS B;  3ET6 A;  1CJV B;  3C15 A;  3R5G A;  5D15 A;  3MR7 A;  4CLT A;  4P2M A;  1U0H B;  1WC1 A;  4OYA A;  4UST A;  2GVZ A;  1CJT B;  4OZ3 A;  4WP8 A;  4CLK A;  3MAA B;  1CS4 A;  5IV4 A;  3UVJ A;  4CM0 A;  5D0G A;  1WC6 A;  2W01 A;  1Y10 A;  4WP9 A;  4NI2 B;  3C16 B;  4OYP A;  1CJV A;  3C15 B;  4CLW A;  4CLP A;  5IV3 A;  4USW A;  1TL7 B;  1TL7 A;  1YBU A;  2WZ1 A;  2QV6 A;  4USV A;  4OYX A;  1FX4 A;  1WC3 A;  4WPA A; 
#chains in the Genus database with same CATH topology
 5JXS A;  3KTQ A;  2BUN A;  5KFL A;  1CUL A;  5LXR A;  3RU0 A;  3UPF A;  1H73 A;  4FF2 A;  1ZAX A;  1MSW D;  3QNW B;  4Q8F A;  4CLL A;  2HLU A;  3SCL E;  3DI6 A;  1QJH A;  2CQH A;  4LF8 F;  3H98 A;  1U6F A;  1S4E A;  4F0K A;  4C2M A;  3VAI A;  2IA6 A;  2YWG A;  3ONQ A;  1HAR A;  2ZD1 B;  1WC4 A;  3NGR A;  1IBK F;  2J7K A;  2AIR B;  4O3S A;  1FVS A;  4G1P A;  1X60 A;  1IQZ A;  3IR5 B;  4HAC B;  4Z37 A;  3VQT A;  4DN0 A;  5ADZ A;  5BJR A;  4K4V A;  1ZTT A;  1RT4 A;  2WRM A;  4M63 A;  5KFB A;  3KKF A;  4N56 A;  4OYW A;  1QDU B;  2FC8 A;  2WB4 A;  2IVF B;  1ZOT A;  1S59 A;  2HLT A;  2MKI A;  5J2N A;  4FBT A;  1FEE A;  2D69 A;  4DR2 F;  2VFR A;  1KVI A;  2Q43 A;  3E51 A;  2CPE A;  1X8D A;  1Q8L A;  1WNE A;  2V4J B;  2C2M B;  2W4D A;  3GG1 A;  3AD8 C;  4LSZ B;  5F0W A;  4U95 A;  5B0C A;  1KQS R;  2AX1 A;  5CCL A;  1UWA A;  1FKA F;  1Q0N A;  2RU9 A;  5K5M A;  1S6P A;  3WC2 A;  5E7O B;  2HQI A;  3PM9 A;  2NR0 A;  2MJU A;  4URS A;  1TK8 A;  2KZM A;  1IWG A;  2EKN A;  5L8R C;  3HSD A;  4KQZ A;  2GVZ B;  2JZ5 A;  1NJW A;  1I6J A;  5JUM A;  1RTD B;  3FQK A;  4EK2 A;  4C8O A;  2HHW A;  2AEM A;  4DFP A;  2QG9 B;  2D1C A;  2M2B A;  3M32 A;  3UD4 P;  5A8R A;  4PZV A;  2HHU A;  4X84 A;  3Q8U A;  3OL7 A;  3KK2 B;  1HMV A;  4YHH J;  5EDW A;  2YPY A;  5LMN J;  5M2U A;  1FRJ A;  1HPZ B;  3EZO A;  5J1E A;  3BBF A;  2QLJ B;  1SJQ A;  4J9U E;  4O3Q A;  1R43 A;  1PCA A;  2DNZ A;  2WON B;  2ADB A;  2YTC A;  1S6O A;  2HFZ A;  5A0Y B;  2DR7 A;  1MG7 A;  1GK8 A;  3R2D J;  1PJ5 A;  2R2T A;  4CLU A;  3HCX A;  4WFY A;  5KT5 A;  3MOZ A;  1VQK S;  5M2P A;  2J0W A;  1W26 A;  5D15 A;  1S6Q A;  1ZS6 A;  5BYS A;  5F8L A;  3FSI A;  2NS1 B;  2DNQ A;  2HGM A;  2EFP A;  1KFS A;  5J2P B;  4LFB F;  4KR0 B;  1U49 A;  2LLZ A;  2CJQ A;  3LAL A;  3PYD A;  1N48 A;  5AJ3 J;  3DLH A;  5DM6 Q;  4O4G A;  1T9Y A;  1UEU A;  1JQG A;  2NZ4 A;  2DY1 A;  2KHD A;  2XEX A;  4HI2 A;  4OJH A;  1S99 A;  1Y3K A;  1Q7L B;  3UNY A;  2PII A;  4Z7C A;  4JV1 A;  4O4R A;  3WIU A;  4Q0B B;  3M2U A;  3BDE A;  2GS8 A;  3CSK A;  3G8T A;  1K1S A;  4RBU A;  5F9L A;  3UCU P;  1GH8 A;  2JC1 A;  2DNY A;  1N54 B;  3DRS B;  3UD5 A;  1SVD A;  4EI2 A;  3KLG B;  2J0Q D;  3NP5 A;  2H5J B;  3GLJ A;  2LQ9 A;  2ZKT A;  5KFK A;  5L38 A;  2Z2L A;  1S0N A;  2LXU A;  5IC6 B;  1HNX J;  3R5D A;  2A6M A;  1O6X A;  2VFU A;  1V3R A;  3FVY A;  1FDN A;  2ROE A;  2FJX A;  2LA6 A;  4DF4 A;  2ZBQ A;  1RT2 A;  4OHZ A;  3HMJ G;  1RCX B;  4TQR A;  1LEO A;  2E5I A;  1W25 A;  4CTA A;  2C3M A;  1V3S A;  1D9A A;  2BJ3 A;  3D3B J;  4KAI A;  3FQL A;  2R7R A;  4ECW A;  3B4M A;  3R2C J;  3LPY A;  4FPI A;  3PIP Q;  1VRU A;  1MWY A;  1YBU A;  2QA2 A;  2CA9 A;  1YIT S;  1DUR A;  2XMW A;  2ZZT A;  3RYL A;  4RUH A;  4TY9 A;  4U7C A;  2DGO A;  2QSW A;  4X66 F;  4H4M A;  3A12 A;  2RAQ A;  5CAA A;  2PO4 A;  1IR2 A;  3J7Z T;  4HH1 A;  2VDI A;  3IGN A;  2MST A;  1K8A T;  2D3O 1;  1O0P A;  3DLK A;  2IYI A;  2B8Q A;  2Q79 A;  4IDK B;  3MED A;  2HBQ B;  4ZMM A;  2DNM A;  4F4Y A;  3WZ0 A;  3NMR A;  5CD4 H;  4KYZ A;  3QGP A;  1WHX A;  4TYA A;  4LR9 A;  3VAK A;  1LWF B;  2Y9H A;  4KKO A;  4U9R A;  5B7W A;  5IFM A;  4R0J A;  2XMU A;  4O3N A;  1NSA A;  2HK2 A;  3AXM A;  1NDK A;  7AT1 B;  4QWD A;  4F8R A;  2G2Z A;  4NWB A;  4DFM A;  1D9F A;  3TVZ A;  4ER8 A;  1OSD A;  3L7P A;  2WOM A;  4TLR A;  2R2R A;  3K5N A;  4KV8 A;  4DR7 J;  3OT9 A;  1FRL A;  3DLG B;  2IM3 A;  3DXB A;  3IMQ J;  2V34 A;  1FE0 A;  4UZB A;  3K0J A;  1U45 A;  5KFC A;  2MKK A;  1NK4 A;  4JV5 J;  3VZI A;  2QZ8 A;  4USK A;  3W2V B;  1QAI A;  5T41 A;  2W25 A;  1AYE A;  3D6M B;  3JAM Y;  1M1K T;  2WSF C;  2OFG X;  5AE1 A;  4YY3 J;  1X9W A;  4KGM A;  4R8U A;  1BC6 A;  5A76 A;  4UQT A;  1QD1 A;  2KG1 A;  4L73 A;  2CQD A;  3VVU A;  4ZHR A;  1VBX A;  2OGU A;  1NUE A;  4K8R A;  2HRY A;  3CJ8 A;  3DRY A;  4LVO P;  3D1O A;  3KG4 A;  4QIE A;  2BV3 A;  4B17 A;  4I6W A;  4FS1 A;  1ARO P;  3RAQ A;  3IM8 A;  4TY8 A;  4X66 J;  5CYM B;  3I0S B;  4UW2 A;  5HP1 B;  1FXL A;  1NDP A;  3MM5 B;  4JI6 F;  4QOT A;  2HFN A;  2IRU A;  4O44 B;  5KAK A;  2XS7 A;  2G1H A;  3TRG A;  1URN A;  2ZOG A;  4V1A k;  3SEO A;  4WU3 A;  1RAA B;  1N36 F;  3MM9 A;  2M70 A;  3J81 U;  1SQF A;  3KDO A;  3RW7 A;  2ZM6 F;  2AYG A;  4OZ0 A;  1CJK A;  3C6U B;  2BBE A;  2B9E A;  2HS3 A;  4ZJO A;  5DQI A;  3CXC R;  4PG7 A;  2RDJ A;  1IKY A;  1BWV A;  4M94 A;  1SPB P;  2ZNZ A;  4OX6 A;  4ZVE A;  4QQB A;  1EQM A;  2COL A;  3C3L A;  3FBC A;  4A46 A;  1IR0 A;  3FBE A;  2ASL A;  1W7W A;  3B6B A;  3ET6 A;  2J0S D;  4F67 A;  3CJT A;  1KP6 A;  3CJS A;  3SI8 A;  3B4D A;  1X5S A;  4NYZ A;  4DZD A;  1S77 D;  5JVH Q;  1VHI A;  4NXM J;  3HHN B;  1B0T A;  5E3P A;  1U6Z A;  1XWL A;  2MZ1 A;  5KG5 A;  3I55 S;  1DQ9 A;  1TZ0 A;  3JAM U;  4ELT A;  1T0T V;  4OYA A;  4I2P A;  3QMQ A;  4GO7 X;  2VFS A;  1NLK L;  3M6U A;  3TZW A;  2RDD A;  3CO0 P;  3M6X A;  5FLX Y;  1ZAW A;  2DNH A;  4ILL A;  4IOB A;  4NAS A;  2QEX S;  5CZV A;  2KI2 A;  4WK1 A;  5K14 B;  3Q86 A;  1MRO A;  2RVJ A;  5M2R A;  3U02 A;  4CQ1 A;  4DL0 C;  3Q22 A;  2HHH J;  3JQM A;  3Q8S B;  1YTY A;  4ES1 A;  1WD6 A;  5J2M B;  2J6S A;  4UY8 T;  1EET A;  1VQN S;  4X4P A;  3TUP A;  2SXL A;  3SBM A;  2QN6 B;  5DQG A;  2ZOM A;  3CCZ A;  1RHQ B;  2ZHO A;  1Z4U A;  3DU5 A;  4YR2 A;  3VAH A;  1HYS B;  3CCV S;  2ZM6 J;  1N6Q A;  2BM1 A;  2IMW P;  1AT1 B;  4P9S A;  1RK8 A;  4CP5 A;  2VU5 A;  3S7R A;  3MHY A;  3QIP A;  4WFX A;  4PQU A;  2MQQ A;  4LF4 F;  4NLX A;  4YHH F;  2PT0 A;  4QZV B;  1N5Q A;  1MWQ A;  1OY9 A;  4FZV A;  4ZVO B;  4OI6 A;  2OH2 A;  2GV1 A;  1CEZ A;  1Z2Z A;  2YWF A;  3TQ1 A;  1U2R A;  6AT1 B;  3LAM A;  4PYD A;  2J9D A;  4ED8 A;  4Q44 A;  3TP2 A;  2JFD A;  4QYZ J;  1IKW B;  4DG1 B;  1DBD A;  3N6N A;  3R1H A;  4TYB A;  3ZZZ A;  2B9X A;  3ZZU A;  1SBR A;  2BE2 A;  4IH7 A;  3V4I A;  1UA0 A;  2UXB F;  2C3O A;  1IBL J;  1SKS A;  3ZTQ A;  2XS5 A;  1N4L A;  2UXD J;  3ZTR A;  5J2Q B;  4ID8 A;  4MKB A;  1U7L A;  4DSL A;  4B3O B;  1U26 A;  2ZBC A;  5F8M A;  2N7C A;  1Y11 A;  5D4L A;  4WXW A;  2ATC B;  4ZVT B;  2D3U A;  3WDO A;  5RUB A;  4AYB D;  3G82 A;  2DTJ A;  1SI9 A;  4M5H A;  2NZC A;  2Z8Q A;  3CDA A;  3SDE A;  5ITH A;  1YJ9 S;  1F9E B;  3PW0 A;  3ITH B;  4RNO A;  1DTQ B;  1KDN A;  3K59 A;  3DU6 A;  5I4M A;  2Y0B B;  3GCW P;  1FKO B;  1YSJ A;  4KRW A;  1U09 A;  4YN3 B;  4J9O A;  2O67 A;  4KHR A;  4CWB A;  4OQJ A;  2GML A;  2PMW A;  3BGO P;  1HBM A;  1SXL A;  2HG4 A;  3QRR A;  1SH3 A;  1JLB B;  5CZX A;  3TUI C;  1WKK A;  5KFT A;  3I6P A;  3WHI A;  3W65 A;  5LXY A;  3H4D A;  3MEG A;  4ED7 A;  2HGN A;  2PA3 A;  2EBE A;  3MMA A;  4LRD A;  3CDB A;  1QUV A;  3OFF A;  3WQP A;  1OWX A;  5F8I A;  2XY7 A;  4JI4 F;  5IXU A;  1DQA A;  2A1B A;  1MU2 B;  5IOL A;  1T9W A;  2ZE2 B;  3T9Z A;  3N28 A;  2FZC B;  1IR1 A;  2MKJ A;  3MEG B;  1LWC B;  4DCP B;  1HNX F;  2N3O A;  2NQP A;  3MCS A;  5D0R A;  2Q6C A;  2DK2 A;  3FCV A;  3BGR B;  2GMJ A;  1JX4 A;  4LBI A;  3CW2 C;  4J5O A;  4G1Q B;  2A2D A;  2R42 A;  4WF9 Q;  2V50 A;  3C14 B;  4DL2 A;  2PEB A;  1JK9 B;  3CIM A;  4NE9 C;  4NOH A;  1RTI B;  4DS5 A;  1HI0 P;  4NRT A;  3DHX A;  1WHY A;  3G82 B;  5BR8 F;  4KJI A;  3KHR A;  2W2P P;  2HGL A;  1LWX A;  1YK9 A;  2A18 A;  3AQP A;  4JB8 B;  2PMZ D;  4I67 A;  2EVZ A;  1WDD A;  1JLE A;  3G8Q A;  1HWK A;  4H4K A;  3UN2 A;  4AND A;  4C3M A;  1RHJ B;  4DPU A;  3R7S B;  4DX8 H;  1RT6 B;  1NPK A;  3O44 A;  5J2Q A;  2EC0 A;  4Y34 A;  3IS9 B;  1Y7P A;  1AZS B;  4F0H A;  4EBD A;  2HND A;  1CJV B;  3W66 A;  1VRT A;  2Q1L A;  2KZZ A;  1RTJ B;  2DGS A;  2X3G A;  5L1L A;  1FWP A;  2CAJ A;  1FA0 A;  2VBZ A;  4FVM A;  2XMA A;  2AW0 A;  1YHQ S;  5F0U A;  2R8K A;  4GRS A;  2HW3 A;  2M0G B;  6FD1 A;  1SL1 A;  2V69 A;  1F5C A;  1U25 A;  1WG1 A;  3MPU B;  3P45 B;  1XJW B;  2H1Y A;  4K0K F;  3HM9 A;  4PWU A;  4IO9 Q;  5HI7 A;  4K2X A;  2YWE A;  4IRD A;  4UZC A;  2DR6 A;  4ANE A;  1R8B A;  2V9K A;  1NK9 A;  1RLD A;  4PQU B;  1NB2 A;  1B64 A;  1WC6 A;  1RYS A;  4ECR A;  2B56 A;  3M8Z A;  2RKI A;  1RU1 A;  4ZVS B;  3H42 A;  3MEK A;  1U2C A;  4ZIW A;  1TV6 B;  3GR0 A;  2KVQ E;  4CI0 B;  1JJ4 A;  2UVW A;  1VQM S;  4LF4 J;  2D7S A;  2DHS A;  3ENW A;  2KRB A;  2AD9 A;  4A48 A;  2MYF A;  3OVB A;  5T7L A;  1Q82 T;  2OTL S;  2P5V A;  2JEI A;  2C3U A;  3BR9 A;  4L76 A;  3AOA A;  2CZ9 A;  3PDN A;  4K4T A;  1EAY C;  4RUB A;  5C25 A;  1NH8 A;  3QT7 A;  4WK3 A;  4DSE A;  3V6H A;  3DNC A;  5L9X A;  3TAM A;  3L4B C;  1S9E B;  4NZ6 A;  1TAU A;  1JLF A;  3AOD A;  3TO8 A;  4UY8 5;  2H3E B;  4DPY A;  1TKT A;  4X4S A;  3M2R A;  1WSR A;  2K3K A;  3KG1 A;  3HSG A;  4Q43 A;  1NBE B;  2KH9 A;  3JTN A;  4C11 A;  4PXC A;  1CQM A;  1WC5 A;  3K5M A;  1HFE L;  1IKV A;  2RRB A;  4XO0 A;  4ZCL A;  4LF6 F;  4DR3 J;  3GIR A;  4FXW A;  2C22 A;  1Q4R A;  4ITS A;  3HSZ A;  2E1R A;  4PXE A;  3JTO A;  2KJW A;  4Y00 A;  1LWE B;  4J90 A;  3UCZ P;  1SJR A;  1VR6 A;  3FJ2 A;  3ZTS A;  1K1Q A;  1P9Q C;  4PWW A;  5D78 A;  2AF6 A;  3J80 Y;  2ZH9 A;  2AGO A;  3R5B A;  1F1B B;  2QJ3 A;  3FFI A;  4UF4 A;  3VWS A;  4KHP J;  2J7W A;  4C3K A;  1D8Y A;  3MM9 B;  3F41 A;  3HHE A;  1S1V A;  3QBC A;  2B4P A;  3BKT A;  2BQU A;  1IUJ A;  2XSJ A;  1C0T A;  4OJG A;  2FJA B;  2F7V A;  4TKT A;  1JXL A;  1GT8 A;  3W9I A;  2CQ1 A;  2WW8 A;  2YWH A;  3CTR A;  3PRD A;  1P1L A;  2OSR A;  2DH7 A;  2A3J A;  4X4Q A;  4RKU C;  4JI0 F;  1GX5 A;  4QJV A;  1E6V A;  1HIY A;  3UNG C;  2BZ2 A;  3EWG A;  3T1Y F;  1YLX A;  1TEL A;  2R8J A;  3JQK A;  3QO9 B;  4MAK A;  2BRL A;  2W2O P;  3DLJ A;  4OYM A;  4EO6 A;  2GNK A;  3I82 A;  2L08 A;  3ENV A;  3M8P A;  1C1B B;  2W9C B;  3HX9 A;  3PRB A;  3IBW A;  3DLB A;  1GXL A;  1UET A;  5C7P A;  2ZVI A;  4F2S A;  2JEF A;  5DGA A;  4WE1 A;  1UVK A;  5G4D A;  5IS2 A;  5KFR A;  3ENA A;  4NA1 A;  2ACY A;  3J7A N;  1HNI B;  1UCN A;  3ENQ A;  1D0E A;  2BX6 A;  4D3H A;  2XCP A;  3OV7 A;  3SV4 A;  3MMC A;  4RW7 B;  2W4P A;  4DPX A;  1FFW B;  5FJ4 A;  4ALZ A;  4DCJ B;  2VUG A;  1RQ0 A;  2XC9 A;  5THW A;  1DLO A;  2BJ9 A;  4B9V A;  3UQS A;  2UUC F;  3DM2 B;  3EVW A;  3PAC A;  2MZQ A;  4Y6I A;  4OX9 J;  3T41 A;  2XMV A;  3RW6 A;  3P8B B;  2GAH C;  1FRX A;  9ATC B;  3BB5 A;  4TU9 A;  2HHV A;  4O0I A;  2GQ2 A;  1CJT A;  2VG7 A;  4N8N A;  3FCH A;  4UOG A;  3PY8 A;  1YVF A;  1RB0 A;  1L3V A;  3OL9 A;  1OJ4 A;  2QA1 A;  2XZD B;  1X0P A;  3C15 A;  4IH6 A;  2EBG A;  4XDD A;  5F3T A;  3TWZ A;  2GCF A;  4CO1 A;  1J5O B;  2NYH A;  4LUB A;  2HVE A;  2DT9 A;  5CYJ A;  3ILJ A;  1NCL A;  1FJG J;  3VAG A;  1C1C A;  1JMT A;  2CQ4 A;  2OHD A;  4KGZ B;  4O0N A;  4G65 A;  5E2Q A;  5D4N A;  2UV8 G;  4CO2 A;  3MMC B;  2MLX A;  3GIL A;  4ZCK A;  3FEY B;  1I1G A;  3Q2S C;  3ZZ0 A;  5GAD I;  1FDD A;  3AOB A;  3MMB A;  4LSL B;  1FWK A;  4QIW D;  2XMJ A;  4CLK A;  2W8L A;  3OTC A;  1R8H A;  1T05 B;  3GTY X;  3L7O A;  3QT6 A;  4B9N A;  3A3O B;  4RBV A;  1H6K X;  1T9X A;  4JP8 A;  2BM0 A;  1WKJ A;  4BCA A;  2VBW A;  2XGP A;  3VAM A;  1RU2 A;  3DYA B;  3EXY A;  4XAK A;  2VA2 A;  3KJN B;  3DOL A;  3NWR A;  4FNI A;  1TL3 A;  1ITP A;  4C98 A;  3CIZ A;  3GJS B;  5KFI A;  1HBU B;  3IG1 B;  3KWM A;  4MIW A;  2ZH6 A;  3PKM A;  4PWD A;  1FTC A;  1PYO B;  4A8S A;  3FRZ A;  4KPC A;  4ZK7 M;  5CQG A;  3O5T B;  2VAS A;  4MIB A;  5HQL A;  5I3Q A;  2HFO A;  4KH0 B;  1R0A A;  5HAT A;  4DV3 J;  3PIO Q;  2BXJ A;  3I5A A;  4ID5 A;  2KVI A;  2H54 B;  4P73 A;  2BE7 D;  3M9O B;  3UD3 P;  4LF9 J;  5H9F J;  4FYW B;  1VQ5 S;  4AE5 A;  4IOA Q;  2RQ4 A;  4LF7 F;  4ETX A;  4I68 A;  1B4S A;  1YWX A;  1RAC B;  3JQJ A;  2OEL A;  3KLE B;  3QSY B;  1REG X;  1S6Q B;  3AJ2 A;  4OHV A;  4WPA A;  5LSL A;  1U2F A;  3KNG A;  5D4P A;  4YFU A;  1VJW A;  1ZYQ A;  1G2E A;  2DNO A;  2E1A A;  2JWN A;  4ZOS A;  2BQR A;  5DG8 A;  5E3Q A;  1A9N B;  3W5Y A;  5C2G A;  3T1H F;  2W2Q P;  5DLF A;  1EIY B;  4IQM A;  3LTO A;  3GII A;  1VQ4 S;  1A6L A;  2I1R A;  2NXN A;  1CLF A;  2D9P A;  5ETN A;  1RAF B;  3MR2 A;  2OFH X;  4C8N A;  2YKP A;  4B9M A;  5HBM A;  4RX6 A;  1U1P A;  3KFW X;  1G3O A;  3G2X A;  1L3U A;  5A8R B;  4FF3 A;  4X4V A;  1VK3 A;  2OP5 A;  3NGT A;  5DO2 A;  1QSY A;  1SJ3 P;  4EZ9 A;  1GMV A;  4K7Q A;  1BWE A;  1OYD A;  2Z56 B;  1NXI A;  4KGX B;  5LJ3 Y;  2FZG B;  5FDL B;  5C42 A;  1UPP A;  2LEA A;  2V8P A;  2XNQ A;  3IN5 A;  2AP6 A;  2DBB A;  4NEZ A;  4CYU A;  5GMD A;  4X62 J;  2R8H A;  4NLQ A;  1WDT A;  2CPI A;  2RF2 A;  5L1J A;  3PCO B;  1B70 B;  2LDY A;  4JI8 J;  1RTH B;  4OI2 A;  5A2Q U;  1FO1 A;  1Q95 G;  4Z7Y A;  2APO A;  1FNM A;  2KFN A;  2X1A A;  4WZM A;  2FVC A;  4NLU A;  2Q3P A;  4B9T A;  4NL5 A;  5E3A A;  3UWT A;  5EHH A;  4B3S J;  3KLH A;  3OTO J;  2L3M A;  3GCX P;  2CZV C;  4ZVH A;  4NLY A;  2ZC4 A;  2DH8 A;  2YNG A;  3HHL C;  2MXY A;  3QJJ A;  3AY0 A;  5KT6 A;  2UV8 A;  1PJ7 A;  4DZ6 A;  1XMO F;  3TUZ C;  4FS2 A;  1H2V Z;  2DO4 A;  4V19 X;  1K47 A;  2CDQ A;  1BHN A;  1OS5 A;  3Q8Q B;  1S0O A;  1LK5 A;  1S1U A;  4DL4 A;  5CXT A;  1CUL B;  2D9O A;  2F8M A;  2N4C A;  3AH6 A;  1HHT P;  4WU2 A;  4QR0 A;  3LGM A;  3M8R A;  3W64 A;  4ZPT R;  1HBN B;  1WTB A;  1C1C B;  4ZN1 A;  3BH7 B;  5A8W A;  4J9N A;  3NCR A;  2C2D A;  3MAH A;  1K9M T;  3H59 A;  3I5C A;  1D1U A;  5B0B A;  2U2F A;  4ED6 A;  3MOJ B;  1FRH A;  1R31 A;  1RTZ A;  3ISZ A;  2HS4 A;  4K5S A;  4DR3 F;  4Q8E A;  1CJT B;  1M1H A;  2CQI A;  1DZ5 A;  5I3U A;  2RIJ A;  2CPX A;  2XHC A;  4Q2M A;  2E5L F;  3H7H B;  1KLN A;  1KFD A;  1HQE B;  2XYP B;  1U1Q A;  4F4Z A;  3BSO A;  5K9F A;  1HW8 A;  2IY5 B;  5HAO A;  4XPE A;  3MMA B;  2IC3 A;  2BJ7 A;  2GGP B;  2ZBP A;  4EGL A;  4RWW A;  1FWL A;  2EWH A;  1F2H A;  1RJJ A;  3D0H E;  5CHC B;  1JLB A;  2W8K A;  2D3O R;  4HEA 9;  1RAO A;  4DL3 A;  4KFB B;  1EP4 A;  2WVD A;  3WX4 A;  3W3S A;  2G13 A;  3VF0 B;  5EN1 A;  4ILR A;  3B54 A;  1T95 A;  1K73 T;  5HQM A;  1OY6 A;  2R2S A;  3C8Y A;  2RT3 A;  3M6V A;  4AUK A;  1KHV A;  5DM7 Q;  5I42 B;  2UXC F;  1C1B A;  2IJN A;  2F4V J;  2W1B A;  2W9C A;  1S49 A;  4IRK A;  1SH2 A;  2K06 A;  2XGQ A;  3CCQ S;  1URR A;  4O3P A;  1JJ2 R;  4C97 A;  4GKJ F;  2J7U A;  2CQB A;  2EFV A;  3RUB L;  4B3O A;  3HFV A;  4KO0 B;  3DRP A;  2OTJ S;  2EXU A;  4W4M A;  1AUS L;  2HWI A;  2GIF A;  2IDE A;  1H7X A;  4ZPV R;  1N0V C;  1GAO A;  3I0R B;  3V4I B;  2HQG A;  4CH7 A;  4PEO A;  3BPS P;  2XSJ B;  4PPD A;  4RNF A;  1QE1 A;  1S1V B;  4EZ6 A;  3L95 X;  1M5H A;  1YRU A;  5KFU A;  3X3U A;  5L46 A;  1KTQ A;  3BV8 A;  4AL7 A;  4O3R A;  4W90 B;  4DV2 J;  3V81 A;  4LFB J;  2B43 A;  2Z2Z A;  2E1M C;  4LF6 J;  4TU8 A;  3QID A;  4OL8 A;  2C2E A;  3LP1 B;  3M6W A;  2KB2 A;  4DX5 A;  5D3G A;  2O01 C;  1S7H A;  1QUP A;  1WEY A;  1JLG B;  4LIW A;  3BRE A;  5LJ5 Y;  1LK7 A;  3JSB A;  4DV4 J;  4HHH A;  4P52 A;  1TAQ A;  3CJQ A;  2Y0S D;  1PBU A;  2L48 A;  4ZPD A;  4F7V A;  4IR1 A;  3BPD A;  4HT7 A;  2BR0 A;  2OPQ B;  3HD1 A;  2CIM A;  2IM1 A;  4B02 A;  3QFH A;  1TKT B;  2NXJ A;  5B0G A;  5DJB A;  3CF5 Q;  4FXD A;  3C2P A;  3EGZ A;  1HNV A;  1SL0 A;  4M5L A;  4QW9 A;  2AZ3 A;  5IC4 B;  5IT9 Y;  3MCN A;  3FMB A;  4NLS A;  4JI3 J;  4DHV A;  5MLC V;  1RWN B;  2AHO B;  2B8P A;  3PJ9 A;  3H0P A;  2FLO A;  4OYZ A;  4DFJ A;  4AL5 A;  1R89 A;  3PW2 A;  2KL8 A;  3G8S A;  1FJC A;  1NZ8 A;  4B9L A;  1AW0 A;  3NBP A;  2VOO A;  4DV0 J;  1P9Y A;  1YZ6 A;  3MXH P;  4I2P B;  2KHC A;  1TV6 A;  2FHM A;  1F6T A;  4M5M A;  2RKI B;  1TVR A;  3Q8V A;  4O3O A;  4D3G A;  2KYZ A;  1AFI A;  4JI4 J;  2FQQ B;  2YH0 A;  1EQ0 A;  1FFG B;  1IM4 A;  2DHH A;  2HRT A;  2OPQ A;  4U6P A;  5GAH U;  1X0F A;  5GAE U;  2DGU A;  3OTD A;  4IYQ A;  4JI2 F;  2XB2 D;  1EB0 A;  2MSS A;  3G86 A;  2IPO B;  3SCJ E;  4M5J A;  4FVC A;  3BH6 B;  3PKY A;  2IM2 A;  2XBP A;  3PV8 A;  4BHQ A;  4F4A A;  2ASD A;  4K4Y A;  3WIV A;  1A0O B;  2I2Y A;  2DNN A;  1SJF A;  1JB0 C;  3A13 A;  1L5U A;  2M9K A;  3OL8 A;  1H74 A;  3GYG A;  4LSN B;  4CLT A;  3CCS S;  4J9R A;  2GX8 A;  8RUC A;  4P2M A;  2W9B A;  1V5V A;  4QYR A;  1ROF A;  4IKA A;  2VJU A;  4DR1 J;  2OJ3 A;  5L39 A;  5IWA J;  4MTP A;  3TJ8 A;  4J9S A;  1JLG A;  3OJU A;  4QU6 A;  4AL6 A;  4O44 A;  2QMX A;  2XM3 A;  1U8W A;  4F0M A;  1S9F A;  1QVF R;  3RZA A;  2KJV A;  2GJF A;  2XYH B;  4DBQ A;  1SUQ A;  2V8V A;  1FT8 A;  1X4F A;  2X7I A;  3AB4 B;  4CO0 A;  2XI2 A;  4ECS A;  2JEJ A;  1T3O A;  2DNR A;  5KG4 A;  2B9W A;  1P8G A;  1RHK B;  3D1Q A;  3QLH B;  3V81 B;  3EM1 A;  2EK1 A;  3VQS A;  4WCE Q;  1X9S A;  1CS4 A;  3VZH A;  3EPI A;  1VLO A;  1NK0 A;  2JOQ A;  5FII A;  3H25 A;  3TAP A;  3HHL B;  2Y8Y A;  1Z2L A;  4YP3 A;  2PFF B;  3I0R A;  4R8U B;  4RNM A;  2PI5 A;  1RTI A;  5GVQ A;  2XO7 A;  4QWC A;  1VGY A;  1RCO B;  2XMK A;  4JI8 F;  5B09 A;  2YH1 A;  3U1N A;  2BEF A;  1FK9 A;  4A47 A;  1RXO B;  3IA0 A;  2RHS B;  1EP4 B;  4OMF G;  1QAX A;  8ATC B;  5DG9 A;  2XNR A;  3M2V B;  3D67 A;  4A8W A;  4ES3 A;  2G2Y A;  3CCM S;  4C8Y A;  3EDQ B;  2JC0 A;  3QGH A;  3PR4 A;  3H40 A;  2RIL A;  4ZVQ B;  4ED2 A;  3PVX A;  5FD1 A;  3VGU A;  2C3P A;  3MPD A;  4AXJ A;  1OQ3 A;  2WZ1 A;  4IFY B;  3R6L B;  2VHG A;  5IT9 U;  3W2W B;  2MPU A;  3SQG A;  5A2Q Y;  5ETS A;  5IQ6 A;  1G6B A;  3NKY A;  4KFB A;  4NA2 A;  3MF5 A;  1ZH5 A;  1YDL A;  3VCD A;  4DCO B;  1N56 A;  2HQF A;  3CC7 S;  4MT1 A;  1UWB A;  3NAH A;  5LSO A;  1FE4 A;  1T03 B;  2ILZ A;  1D9D A;  2ERR A;  3UN3 A;  2HFV A;  3M7V A;  3PX0 A;  4KH1 B;  2HKE A;  3VHQ A;  5JVG Q;  1LW0 A;  4IOC Q;  2XS2 A;  2H5E A;  3BBB A;  1WHW A;  2C2R A;  3G6X A;  3RAM A;  4LFA F;  1T94 A;  4DR6 F;  3HPO A;  4GC6 A;  2DVI A;  3ITH A;  1VRQ C;  2RE1 A;  1BGX T;  3POT B;  3FCW A;  4DQS A;  3QWU A;  2Y1J A;  4IG3 B;  3QGG A;  4WBF A;  3W62 A;  2E9Z A;  3T5L A;  4KIA A;  3NNA A;  1RT1 A;  2ROG A;  4NLT A;  4P75 A;  1S1U B;  1N33 F;  1HKA A;  1OMS A;  3D2W A;  2V2V A;  3QT5 A;  4CCH A;  2HQ3 A;  2LQ5 A;  5AE3 A;  5KFO A;  3ZNU A;  2ABY A;  2K8G A;  5GAD U;  3GP9 A;  3Q24 A;  4RW8 B;  1IXK A;  5KFP A;  4G6V B;  3ZNJ 1;  1KVK A;  3MEE B;  4OYO A;  4F04 B;  2VQF F;  1J5E J;  4LQ3 A;  3D68 A;  4DG1 A;  1R27 B;  1S1W B;  1RAB B;  2DGQ A;  2QMW A;  4I56 A;  4WYW A;  1DFD A;  1FXD A;  5JMN A;  2AQ4 A;  1HHS A;  2UP1 A;  4OI1 A;  4JV0 A;  4RUA A;  2CNN B;  3U7J A;  4FYD A;  3H2U B;  3BYR A;  2RQC A;  1IVZ A;  1LXN A;  2YNG B;  4X4N A;  2F4V F;  3AOC A;  1VOM A;  4QR2 A;  2E7X A;  1YJ7 A;  2E5G A;  2DYA A;  2B6A A;  4NLO A;  1YJV A;  3PZP A;  3DGP A;  4LJM A;  3GPA A;  2VQE F;  2QL7 B;  2AYM A;  1T9U A;  4O4G B;  1UFK A;  1L3T A;  2FHK A;  4YR0 A;  1BD6 A;  3T1Y J;  3VAF A;  1SIZ A;  2DGT A;  1HYS A;  3L3C A;  3BM7 A;  1M5K C;  3K5L A;  1FI4 A;  4DQI A;  3A3P B;  5GAH I;  4TN2 A;  1Q8K A;  3KHG A;  1SC1 B;  3OFG A;  4CO5 A;  2AX0 A;  1RYR A;  1HNZ J;  4FBU A;  2QLX A;  1VBZ A;  3BGL A;  3FEX B;  2IFX A;  4ED1 A;  2HBY B;  4JV2 A;  3D5M A;  2B51 A;  2JSX A;  3G6Y A;  2WON A;  2VBY A;  4C3L A;  1B7F A;  2KO1 A;  2V94 A;  4DR4 F;  1VIS A;  4ZP9 A;  2Z0G A;  3LUY A;  4GO5 X;  4YDD B;  1U1K A;  2DR8 A;  2VIH A;  3PJW A;  1CC7 A;  2RSQ A;  2KT3 A;  3HLU A;  3ILO A;  3L7U A;  4CZC A;  3K2Y A;  3QAT A;  3UE2 A;  2IMO A;  2VL1 A;  1Q8I A;  3W61 A;  1RTD A;  2GVZ A;  2QYC A;  4N77 A;  5E5N A;  2AGQ A;  2IBK A;  1UP1 A;  2QLB B;  3T6B A;  5KFY A;  4WTY A;  1MMD A;  3GB0 A;  1G1X A;  3MM6 B;  1L3K A;  2EPI A;  2JH3 A;  2B4V A;  2VH7 A;  3GJT B;  4ZVG A;  2VKR A;  5KFQ A;  3MR6 A;  2FVR A;  3PJX A;  1IKY B;  4CM0 A;  2J8A A;  3CJ3 A;  4R0E A;  4MYT A;  5AE2 A;  1S5Z A;  3EZU A;  2ZJR Q;  1HI8 A;  1RLC L;  4QIG A;  5DS7 A;  1B3T A;  3GFY A;  2HPU A;  2CPJ A;  1BY9 A;  4L3K A;  3I87 A;  4AQY F;  2HUR A;  4OIX A;  1OPI A;  1ZPW X;  2C2Z B;  2Z30 B;  4Q45 A;  1YI2 S;  4KT0 C;  2XG8 A;  5HO4 A;  2FZK B;  3DC2 A;  3D54 A;  3OTO F;  1UVL A;  4JYA J;  4ELV A;  2FVS A;  5HLF A;  1NK8 A;  4OX9 F;  3ICL A;  5CYM A;  3CCR S;  1U1L A;  4MFB A;  4H4O B;  4DUT A;  4KY3 A;  1RWU A;  4X62 F;  1U6B A;  2J9E A;  1R0A B;  1RUS A;  1KBR A;  3DYA A;  4N47 A;  1UW9 A;  5KFZ A;  1ZA1 B;  3D6T B;  5D6G A;  4FN5 A;  2ALZ A;  4DV1 F;  3CCE S;  2HAI A;  2LQJ A;  1FRM A;  2JLF A;  3OSN A;  3KLV A;  1S76 D;  1T05 A;  4LR8 A;  3C46 A;  1YIJ S;  3OVA A;  3IG1 A;  1WEZ A;  3FGV A;  4MMO A;  3W2V A;  3BSC A;  4DV5 F;  1QAJ A;  3MEE A;  3PFO A;  1VFJ A;  5ETR A;  1RBO B;  3IWN C;  1MML A;  4NLR A;  2Y1I A;  4KV8 B;  1WOP A;  1N5V A;  1DQ8 A;  2NCK L;  2WOM B;  4CT8 A;  4DL7 A;  2UUB F;  4B9S A;  2VQF J;  4E2F B;  2H5I B;  2XYG B;  1F0X A;  3A8K A;  1SIW B;  3MTJ A;  1JLQ B;  2VG5 B;  4QR1 A;  4LF8 J;  4E98 A;  1TR0 A;  3UVJ B;  5K20 B;  2HHS A;  4MKY A;  2CAD A;  2Q6B A;  2DIV A;  2VG7 B;  1VS3 A;  1LWF A;  3H2L A;  3H4B A;  3POT A;  4WKY A;  1YJT A;  2V6A A;  2M3D A;  3CD7 A;  2H9Z A;  3CWJ A;  3GSI A;  2MB0 B;  4BDP A;  3SSQ A;  1WG5 A;  1N5T A;  3F44 A;  3N4W A;  2HQD A;  1UFL A;  1OSC A;  3R27 A;  4OYI A;  4CO4 A;  3CD5 A;  1HD0 A;  2W7A A;  2A6O A;  1NJZ A;  2D74 B;  4CLY A;  2MZS A;  5B0D A;  3CGI A;  1FER A;  4X64 J;  4M5K A;  1VIO A;  4PXD A;  3OD2 A;  4F26 A;  1GX6 A;  2OLW A;  1UPM B;  3G87 A;  3QSI A;  2LDI A;  1YBT A;  3SQG B;  4LFC F;  5F3Z A;  4PRF A;  5GMK a;  1SB6 A;  1Y0H A;  2IYG A;  2YXL A;  2OPR A;  1NND A;  2IDL A;  5DZ7 A;  3MPV A;  5BXI A;  3Q2T C;  5LM7 E;  4BWM A;  2UUA F;  1WWH A;  2PD1 A;  4FNH A;  4E8U A;  4RW7 A;  4ZN3 A;  3M9M B;  3CJ2 A;  4YEA A;  3KYL A;  3QO9 A;  1GEH A;  3RRK A;  2BDP A;  4JI6 J;  5LSR A;  1N5S A;  4ECY A;  4ZPA A;  4P72 A;  2FVP A;  3ZC4 A;  1MN9 A;  4NXN F;  2EFO A;  3THP A;  1S72 S;  3DRS A;  2YQ3 A;  3G96 A;  3HHL A;  3J7Y U;  3B78 A;  2J5A A;  2FY1 A;  3BGF A;  1JLA A;  2P9G A;  1X4D A;  2B7C B;  3RB0 A;  4P10 A;  2C2O B;  4DV7 J;  3PW4 A;  4C8Z A;  1NU4 A;  5HLF B;  2M52 A;  4BC7 A;  4JV5 F;  3N5B A;  4CNY A;  4ZKA A;  2V4R A;  1LV5 A;  4K4U A;  1KD1 T;  2BAB A;  4HR2 A;  2UXB J;  1YKW A;  2QC3 A;  1FCA A;  4OX8 A;  2W9B B;  2O66 A;  1W2I A;  2MJN A;  3O1L A;  4RW6 B;  1WEL A;  3FFI B;  4IUF A;  2R7S A;  2RHQ B;  5KG7 A;  4DR6 J;  3NS5 A;  1KQK A;  3V6J A;  1OIA A;  3PX6 A;  2IVM A;  2IIH A;  4GKK J;  3GON A;  4XDC A;  1AA1 B;  1SC3 B;  2CWK A;  3MM6 A;  4RNN A;  3TYT A;  3DDI A;  4ZVP B;  3RB6 A;  2NSC A;  2CJ9 A;  4P7V A;  2JNJ A;  5LL6 d;  5KT7 A;  4A8M P;  3A8E A;  2CPF A;  1VJQ A;  2QSF A;  2AJ2 A;  4H54 A;  5D0G A;  4DDF A;  2LCW A;  4ECV A;  3SSS A;  2RS2 A;  4I2Q B;  2DY9 A;  2POK A;  5AXN A;  1VQ8 S;  1VQY A;  2YKN A;  4ZPW R;  4A8O A;  4C7Q A;  5E3C A;  5BYR A;  4N8O A;  3M32 B;  1EJ7 L;  3LAN A;  3DLE A;  4EU0 A;  4WFA Q;  4CH1 A;  4NI2 B;  3RAX A;  3CB4 A;  3NGK A;  1S9E A;  1V9O A;  3N6M A;  1B0V A;  5C24 B;  2MQP A;  3TAM B;  4RUC A;  4X4O A;  3W8P A;  1Q7Y T;  1LKZ A;  2FJW A;  4F2R A;  1RWM B;  1CVJ A;  1ZM4 A;  4TQS A;  5HAN A;  3BQ1 A;  5C25 B;  4HTJ A;  2WVF A;  1UJ5 A;  2CYY A;  3CDE A;  5F8H A;  2RU3 A;  2F9D A;  2VB6 A;  3TX0 A;  4QW8 A;  3KHL A;  3HO1 A;  3UR3 C;  4QBU A;  5CYQ A;  1RT7 A;  2HHH F;  2V4J A;  4URQ U;  3MEC A;  3WC0 A;  2WVB A;  1RAH B;  3ZZO A;  5KTQ A;  3OL6 A;  2NXC A;  2OPS A;  2J6U A;  4C8K A;  3NNC A;  1FX4 A;  2P2C B;  3GV7 B;  3BYP A;  2AZ1 A;  5SUH A;  3SFG A;  2GIR A;  1WF0 A;  3OPK A;  4LRC A;  3RB3 A;  5HMX A;  2R7X A;  1XTZ A;  2AEJ A;  4ZVF A;  4XIU A;  4C6A A;  1REV A;  1YQH A;  3MD1 A;  3N5F A;  1TU0 B;  2ZHA A;  1RHR B;  4Y3C A;  2KFY A;  2WVC A;  2FDN A;  1NK6 A;  3IBC B;  1OPZ A;  2FB0 A;  5U47 A;  4MKA A;  1XR5 A;  4QWA A;  3H5Y A;  2UU9 F;  2A0F B;  1RA7 A;  3VAL A;  1Q81 T;  4DV4 F;  2E5J A;  2JEG A;  2YNH A;  2ASY A;  1S1W A;  2KKH A;  3L9Z A;  3OUY A;  2KFZ A;  1S1X B;  2ZBR A;  1QE1 B;  2DR5 A;  4RW8 A;  1VRT B;  1SL2 A;  2QTW A;  3JTP A;  1FFS B;  3VVT A;  2AU0 A;  2E66 A;  2BW7 A;  2HND B;  2GZO A;  2F4F A;  3C6T A;  2W2M P;  2DH9 A;  4DSJ A;  4JYA F;  2AV5 A;  2CJY B;  3AJD A;  3C14 A;  4KO0 A;  4UUX A;  4WJB A;  4L72 B;  1R8C A;  3WX8 A;  2CJX B;  4G1Q A;  1RT1 B;  2WSE C;  2K1R B;  1S10 A;  1ZPV A;  2N3L A;  3BGR A;  1DHM A;  4DN9 A;  1XNR F;  1U8S A;  4IG3 A;  2WVE A;  4RBT A;  2ZE2 A;  2YQ1 A;  5LOQ A;  1MU2 A;  3CT9 A;  3Q23 A;  2YKO A;  3KJF B;  4MH8 A;  3IWL A;  2CRL A;  1PAU B;  2C2K B;  1TTH B;  1U02 A;  1LW0 B;  2BJ8 A;  2VDH A;  2XLI A;  1CSJ A;  3MUR P;  3MR3 A;  2RQM A;  2CNK B;  1JJC B;  3NS7 B;  2F9J A;  2HRU A;  4B9U A;  3DKD A;  4PG4 A;  3JYT B;  4J9P A;  2BW2 A;  2R8G A;  2RUS A;  2C3Y A;  3KUH A;  1M0S A;  3M8S A;  3JB9 k;  2AJ0 A;  1ZBT A;  4J9V A;  1H98 A;  4QIV A;  1DY3 A;  1KSP A;  2ZDP A;  1R6Y A;  2DPI A;  3D9B A;  1S79 A;  1QVG R;  1S6U A;  3SDE B;  2Z58 B;  1KLM A;  3V2U C;  4F4W A;  2XZT B;  1M5V C;  2UU9 J;  3TOQ A;  3CED A;  2GAG C;  2M8H A;  2I6W A;  4CNZ A;  2VA3 A;  5DG7 A;  4A8F A;  4NXM F;  4EO8 A;  3UFC X;  3FMW A;  3LPE A;  2H4Y B;  5A8W B;  3A8J A;  3NNH A;  4PG5 A;  2J9D E;  2BE2 B;  2QE5 A;  3E3X A;  3HI9 A;  2B4U A;  4YDX A;  3UO0 A;  1UVJ A;  4CH0 S;  1RWX B;  1S1X A;  5BR8 J;  1JIH A;  3BDP A;  3OUY B;  2JL9 A;  2QRR A;  2RDI A;  3QLH A;  4X4U A;  3T1A A;  4NLP A;  1EKS A;  1JLC B;  2LA4 A;  4DFK A;  3BJY A;  3MM8 A;  1I94 F;  3OSP A;  4EYI B;  1PJ6 A;  1VC6 A;  2VON A;  4DX6 A;  4RJV A;  3W63 A;  5LMU F;  2UUB J;  2P9C A;  4ZLP A;  3MFH A;  3OTB A;  1SJ4 P;  1TFY A;  5AXM A;  2HFS A;  1IKW A;  2FY8 A;  2AJQ A;  1FTR A;  1D8Z A;  5F41 A;  1MMN A;  2VPZ B;  1KTV A;  3IR6 B;  3AFG A;  3QIP B;  1RGV A;  2ZWO A;  4C0B A;  3CCJ S;  2VKZ G;  4K4X A;  1HR0 F;  2QIF A;  3CCU S;  1T7P A;  3CC4 S;  5D77 A;  3F0N A;  2CKW A;  3K57 A;  2DNG A;  4Z2X A;  2HBR B;  2KT2 A;  2CWX A;  1P27 B;  4DF8 A;  5A6P A;  1S0M A;  1RTH A;  3GSD A;  3EGV A;  3QAU A;  5SZT A;  1RT7 B;  2UZA A;  1YRT A;  2RJZ A;  1WI6 A;  1UL3 A;  1MRO B;  2ZJQ Q;  1R6V A;  5D4O A;  3PYE A;  4UT4 A;  3HKW A;  4FKX A;  3DGV A;  1EZZ B;  4LT6 A;  2KU7 A;  4URG A;  5HMZ A;  3KG0 A;  2ALY B;  2F63 A;  5HVH A;  3TZX A;  3SQO P;  4J9L A;  2R9L A;  2MEW A;  3HDS A;  2C42 A;  4GVL A;  1DAX A;  1YZ7 A;  2PDA A;  3NBP B;  3KJV B;  4NI2 A;  1X4C A;  3NLC A;  1QTN B;  3V6K A;  2WCX A;  2YPZ A;  4JI5 J;  3SCI E;  3HXM A;  3DN9 A;  1HA1 A;  2CPD A;  4I6A A;  5EGY A;  1HWJ A;  4ZPC A;  3RR7 A;  1OY8 A;  5H9F K;  1CPZ A;  2I5J A;  2IRY A;  5EWF A;  4ZVU B;  2VOP A;  2C2N A;  2EFN A;  3RB4 A;  4HDG A;  4DR4 J;  3JSM A;  3IP0 A;  1GTH A;  3R7B B;  2E9R X;  1WOS A;  4I1T A;  2Q66 A;  2CFX A;  2HK3 A;  4K2J A;  4OZN A;  2MZJ A;  4UOH A;  3C6U A;  1CJK B;  2YKQ A;  2MKS A;  4L6V 3;  4TNO A;  4DU8 A;  3W8G A;  3T6J A;  4OHW A;  4DQQ A;  2PC6 A;  3PTW A;  4Y65 A;  2FPH X;  4ZJL A;  3KLE A;  2K7J A;  4NA3 A;  2CQ2 A;  2QFI A;  4Q2L A;  2OEK A;  4CLZ A;  4HL9 A;  2FJB B;  3CMA S;  4MK9 A;  2Z4P A;  5D3G B;  3MPW A;  3RTV A;  2IBO A;  2BJ1 A;  4JI1 J;  1C2P A;  3AD7 C;  2ZC3 A;  3TUJ C;  3PNI A;  2BQ3 A;  1BMQ B;  4NLV A;  1VQ7 S;  1SC4 B;  2MHN A;  5DDQ C;  4PCQ A;  1XMQ J;  3D4J A;  2J6T A;  2Y8W A;  1HD1 A;  2V2K A;  2VQE J;  3LH2 S;  3I32 A;  1WI8 A;  1DRZ A;  1XNQ J;  4KE5 A;  1FKP A;  2A2C A;  3CDU A;  3DRR B;  4C0H A;  1RP5 A;  1HWU A;  1QM9 A;  2MY7 A;  1HBU A;  1GTE A;  2PGC A;  3DOK B;  2DEJ A;  2W24 A;  4ED5 A;  2EEY A;  2JX2 A;  1TL3 B;  3EUN A;  1RWP B;  1UEK A;  1G7C B;  1WC0 A;  3HJV A;  4I0W A;  2EFG A;  1PGZ A;  1N5Y A;  4N76 A;  4HVZ A;  4JOU A;  2XWY A;  2DHG A;  1Q5Y A;  3WBZ A;  5I42 A;  4LRB A;  1FDA A;  2QO3 A;  1IBK J;  4LR7 A;  1RWW B;  5KG3 A;  3JSR A;  1BQX A;  3MCO A;  2BOA A;  2Y1L B;  3CDW A;  3MGJ A;  1RWK B;  2UVV A;  3MCM A;  2LMI A;  2ZUG A;  1N8R T;  1EAR A;  1RI7 A;  4FXV A;  4QYZ K;  2XTJ P;  3EJM A;  3I4P A;  3VR1 A;  3EMT A;  1UW4 A;  4XPC A;  2RNE A;  5E0O A;  5DLG A;  2IC3 B;  1K44 A;  3MTK A;  2FVQ A;  3AXK A;  3ZZR A;  1RSC A;  1HQE A;  3CJ0 A;  3ZTO A;  4Y2C A;  2HZC A;  2FJE B;  2FYX A;  1ZM9 A;  2P8I A;  2B0G A;  5I3U B;  2DRA A;  3AQO A;  2DGV A;  3CVK A;  3MFI A;  4KTQ A;  1DJ0 A;  4PKD B;  4L74 A;  3UVJ A;  2EG1 A;  5HL7 Q;  3HFZ B;  3PX4 A;  2W7O A;  2VFT A;  1JLQ A;  1Q8B A;  1EKR A;  2AMC B;  4IDK A;  1HI1 A;  4X65 F;  1HNW J;  4DV5 J;  3TZZ A;  3RBD A;  3BF4 A;  1CG2 A;  2AYE A;  4LF2 A;  1HBN A;  1IQT A;  1RT2 B;  1NSQ A;  2D41 A;  3IAM 9;  3K17 A;  1IJE B;  1F60 B;  2B4O A;  3PEJ A;  4YOE A;  1Y5L B;  3BEG B;  5HRO A;  3TJA A;  1F9H A;  1HNI A;  1KWM A;  2IHR 1;  4GMK A;  4OZ5 A;  3F73 A;  2KYX A;  1VRU B;  2FJV A;  1C0U A;  2AGP A;  4F25 A;  5KOW A;  1OYE A;  4NCA A;  2QLF B;  3TVY A;  2XY6 A;  5G0R A;  1NJX A;  3NGD A;  3M8P B;  2DIT A;  2DKO B;  1MNE A;  1U4B A;  4WKR A;  3A3N B;  3FNN A;  3M2U B;  2IM0 A;  4LF1 A;  4MKV A;  3UW1 A;  4Q7A A;  1TMM A;  4OYX A;  2MGZ B;  3K58 A;  4DR7 F;  2VC0 A;  1E6V B;  4FF4 A;  4MFB B;  5HQ8 A;  4RNH A;  3BR8 A;  5KFV A;  1YGY A;  5D0E A;  1EHW A;  2AT1 B;  5KT2 A;  1QSL A;  1AFJ A;  4JI0 J;  3T5K A;  3QJP A;  4Q0B A;  3P96 A;  2XMT A;  2VIC A;  2GHW A;  2O1P A;  2DIU A;  3LW5 C;  2NXE A;  1NK7 A;  4JI5 F;  1GQE A;  2JDJ A;  2EKY A;  2NRE A;  2I0X A;  2ZH5 A;  4DV2 F;  2ZH2 A;  1FXR A;  4CYU B;  1RKJ A;  1QY7 A;  2W9A A;  1NDC A;  2GO9 A;  1UZD A;  2PN6 A;  2V67 A;  3QWP A;  5C42 B;  1ZZN A;  4Y0F A;  4LF5 J;  4USH A;  2K2P A;  2QX0 A;  3FRY A;  2U1A A;  3NGU A;  2FIU A;  1TKD A;  3CO9 A;  2NYI A;  3HF5 A;  3GZ7 A;  1U1R A;  5J1E B;  1HPZ A;  2B3T B;  3HVT A;  4JI7 F;  2W4C A;  5I3P A;  1U1O A;  2FHO B;  2EFQ A;  3G9C A;  2OO4 A;  4NZ7 A;  2LKZ A;  3M05 A;  2BJD A;  2UUC J;  1D3W A;  2LU2 A;  4QPX A;  5HBM B;  5A0Y A;  4QCL A;  2R7O A;  2DCU B;  5KG0 A;  3QQC D;  2FLP A;  3EVO A;  1HW9 A;  1TL4 A;  1SKU B;  4M5D A;  4YB6 A;  1JXV A;  1S6P B;  3N01 A;  4A8K A;  1UA1 A;  3O8W A;  4LFC J;  4B3R F;  1HQU B;  1BQM B;  5IT4 A;  5C2C A;  1YRX A;  3HVT B;  2LEC A;  5KFF A;  1C4A A;  3TX8 A;  1HR0 J;  2GHP A;  2ZEJ A;  2MLY A;  3EGW B;  4ZVR B;  2KXN B;  1XNQ F;  3OHB A;  5DET A;  3FBB A;  3OFH A;  1JKH B;  2MTL A;  3Q89 A;  4RZR A;  1VBK A;  2OD4 A;  1VDH A;  1APS A;  1P1T A;  3PRV A;  3SMZ A;  4CM2 A;  2F8E X;  2E5L J;  2L9W A;  2PSZ A;  3JXO A;  3LWL A;  1WKL A;  1RDR A;  2B6A B;  5LT5 A;  1Y4Z B;  4LF5 F;  1NO8 A;  3D66 A;  3SZ2 A;  3GIK A;  2ZH1 A;  3GIM A;  3CJ4 A;  4OZ1 A;  4FYY B;  3Q0A A;  4TXS A;  2CPH A;  1GFW B;  1KOO A;  1NEE A;  1PYT A;  4PWD B;  2LFV A;  1RT4 B;  4YQW A;  1VC5 A;  5T14 A;  5IZH A;  3VV2 B;  1VK8 A;  5DGB A;  2W2N P;  2YKM A;  2VZ9 A;  4BBY A;  3MUV P;  1M5P C;  2HMI A;  3IC1 A;  3DOL B;  4L75 A;  2RH3 A;  5HK4 A;  2MGZ A;  4R25 A;  4UST A;  2V2Z A;  4ECQ A;  2V63 A;  4USM A;  2Y1R I;  2CJK A;  3IBF B;  5G0R B;  3OVS A;  4OI4 A;  2M88 A;  3IS9 A;  4OI3 A;  3G6V A;  1S97 A;  2V68 A;  3BN7 A;  3QGI A;  4DSI A;  1HL6 A;  3GWC A;  1S48 A;  3CJR A;  3MMB B;  4NYP A;  3IM9 A;  3K5O A;  2LQ8 A;  2HBZ B;  1GNK A;  1HHQ A;  2HQC A;  2MKY A;  1UWB B;  2HIY A;  3QZ7 A;  3M30 B;  1IKX B;  1Y9O A;  1X5P A;  2XHW A;  2HAF A;  3BBC A;  4KB7 A;  4Y2A A;  2W01 A;  4LRE A;  3KXD A;  5LMN F;  3TAR A;  4C9D A;  1Y10 A;  5C5J A;  2NUH A;  1J5O A;  5KFX A;  1VQ9 S;  1HBO A;  2CZ4 A;  3W9J A;  5KFH A;  4IRC A;  2QYG A;  3C15 B;  4UUW A;  4ZLN A;  4IG0 A;  3B8H A;  7FD1 A;  2HFU A;  5ETO A;  4CLP A;  1X5T A;  3P4U B;  3QAE A;  1TL7 B;  1YBA A;  2DB1 A;  3J7A 1;  2RQK A;  3NEK A;  4USJ C;  3NY0 A;  3CPW R;  2DXD A;  3DMJ B;  4DLG A;  4J91 A;  1O5J A;  1RHM B;  3ZXW A;  2R7T A;  4ZP7 A;  2WBR A;  4J37 A;  4E0D A;  1VQ6 S;  4LRA A;  2Y3Y A;  4UOF A;  2VF3 A;  1T9V A;  4AT1 B;  3THV A;  1M5S A;  3E01 A;  2VV5 A;  3TW0 A;  3S8S A;  1I3O B;  4RLE A;  2PA8 D;  1J2V A;  4HHJ A;  3D0G E;  4DPW A;  1FK9 B;  5CH7 B;  4KPY A;  1NPP A;  2CNL B;  4J7C A;  2YX7 A;  4WE1 B;  1DTQ A;  1SKR A;  3AA9 A;  1JNR B;  3HD2 A;  1RAD B;  1RT5 B;  3O6Q A;  3M8Q B;  1UTA A;  3P5T L;  1N5Y B;  4PUO A;  1CS4 B;  5CA5 A;  2ZH4 A;  2EI5 A;  3GFZ A;  4DWI A;  1QLN A;  3HK2 A;  1K0V A;  5KFD A;  2BRK A;  1VMB A;  2NXU A;  2V8D A;  4DR1 F;  1XQI A;  1SUQ B;  1CC8 A;  3EXC X;  2GO8 A;  3AHP A;  2R4F A;  5HMY A;  2IA0 A;  1FEH A;  4ZS6 A;  1N32 F;  1O8B A;  1WF2 A;  3CJK B;  4KSE B;  4ELU A;  2ZUA A;  2I9S A;  2OPP B;  2BA9 A;  3C16 A;  2PMH A;  1UJ6 A;  2NLW A;  4U67 Q;  2BAN A;  4M95 A;  4WII A;  3R8Y A;  4OV1 A;  2HEK A;  5GME A;  3HP6 A;  1IBM F;  2M7S A;  4RW9 B;  3HT3 A;  1X4E A;  4WFZ A;  4EBC A;  2GA7 A;  3MD3 A;  4RU9 A;  3HZG A;  3CCL S;  2YVS A;  1NME B;  3OLA A;  2EW9 A;  4RWX A;  3BO2 A;  3R6G B;  4P2F A;  5AXL A;  4OHY A;  4ICL B;  4ED0 A;  2ZDO A;  3NG8 A;  4B3R J;  1SCJ B;  5HMW A;  1PG5 B;  4DXL A;  3S01 A;  4HT5 A;  1XR6 A;  4P74 A;  2LYV A;  3AB2 B;  1CJU B;  3JSY A;  1KKH A;  4F3Q A;  2VPW B;  3R5C A;  5HN0 A;  5KFW A;  1TVR B;  3JSM B;  1KVJ A;  3M9N B;  3I9V 9;  3KUE A;  2G1D A;  1N6Q B;  1IM6 A;  1JLF B;  1LQ9 A;  5BYQ A;  2I5J B;  4FF1 A;  4XK8 C;  1FNX H;  2ZH7 A;  1XNR J;  3MR5 A;  1F5A A;  1NAQ A;  2FJD B;  4X65 J;  1HNW F;  3NCP A;  4YR3 A;  3HHL D;  1FRI A;  1H72 C;  2CJB A;  3GJR B;  1TUW A;  1IWA A;  3H90 A;  2YY3 A;  4OHX A;  5A8K A;  1FVQ A;  1WG4 A;  4FYX B;  4DI6 A;  5B08 A;  6FDR A;  2MQO A;  4DUY J;  1T02 A;  2V2Q A;  4WWS A;  2KXF A;  1TKZ B;  3DLL Q;  1RKI A;  1HNV B;  1XEZ A;  4O23 A;  2F8H A;  3QPI A;  3E8O A;  4EUV A;  2B9Y A;  3CCT A;  4PG6 A;  4ZA1 A;  3UDE A;  1T9T A;  3HHD A;  3OR1 B;  5KG6 A;  1WC1 A;  2PI4 A;  4OI0 A;  3KUG A;  4G1I A;  4K59 A;  3A1Y G;  5CAB A;  4ZIT A;  3UR0 A;  5A6W A;  3I56 S;  3KK3 B;  1NJI T;  2G4B A;  4DV6 F;  1VHF A;  4PG8 A;  1P6T A;  1F2G A;  4NXN J;  1HWI A;  1NDL A;  2QT7 A;  2G0J A;  1Q5V A;  1RAE B;  3LP1 A;  2DRB A;  4GKJ J;  3EGN A;  4MYU A;  3T5J A;  3AJ1 A;  3LWM A;  1F3F A;  1JWW A;  4K5R A;  3TEH B;  5K8M A;  2DXF A;  3MMJ A;  3LQV A;  1ZA2 B;  1N34 F;  3ELH A;  2E7W A;  3P3D A;  5HVG A;  1SQG A;  4K4Z A;  1NHK L;  1RTJ A;  2H48 B;  3C16 B;  1XR7 A;  1R3N A;  9RUB A;  1CJV A;  1YJU A;  4NZ0 A;  3CJK A;  5DRK A;  3HVW A;  1H2U X;  4CLW A;  3H5S A;  1KEK A;  2M8D B;  2CQ0 A;  1BUX A;  1RT6 A;  1JLC A;  3DRP B;  3BO3 A;  3R3T A;  4HTI A;  1MWZ A;  4CDI A;  3RRH A;  4X4R A;  2HWT A;  4UTG A;  2GJI A;  3HKZ D;  1UFW A;  3QJL A;  3RRG A;  3FKB A;  3R97 A;  2FC9 A;  3O3L A;  2ADC A;  4M5I A;  2BE9 B;  3B82 A;  5EX3 A;  5KFS A;  2OEJ A;  1RT5 A;  1XMQ F;  1T3N A;  5LMU J;  2JLG A;  1N34 J;  4XTT A;  1J5E F;  2QL5 B;  4HH0 A;  1NB7 A;  2O3D A;  2ZWP A;  1PC5 A;  3DXS X;  3DOM B;  3V4M A;  5KFN A;  4OX7 A;  4RL1 A;  2WK4 A;  1GMW A;  3DDK A;  3DLG A;  3E01 B;  3NGS A;  1KLM B;  4RO0 A;  4QWE A;  4DV6 J;  3QT8 A;  4WP3 A;  3UCG A;  4EFA C;  4DSK A;  2QGF B;  2GIQ A;  3OR2 A;  1N52 B;  4X4T A;  1BXN A;  2CDR B;  2DGW A;  2XI3 A;  1HLW A;  3RBZ A;  4CIO A;  5AT1 B;  1U1M A;  1M90 T;  1BE4 A;  2G0C A;  2MQM A;  3LA0 A;  3CE8 A;  2HVZ A;  4QIF A;  2XLK A;  2MLZ A;  1KQF B;  3KK1 A;  1HQ2 A;  3JYT A;  3P6Y C;  1N33 J;  1Z1Z A;  4DR5 F;  4M5G A;  5J1N A;  4DUY F;  4B3T J;  3P49 B;  1HBM B;  2I38 A;  2QA4 S;  2B5J B;  2HHP A;  3FC9 A;  3P5B P;  4Y2M A;  3TZY A;  3CME S;  3EE3 A;  3VGV A;  1S1T B;  4I6Y A;  1A7G E;  1R8P A;  4P2X A;  4U7U D;  4M8L A;  1H38 A;  2J8S A;  5ETL A;  3NAI A;  2HVH A;  1QAY A;  4LFA J;  1Y00 A;  3NOC A;  2WW4 A;  1TQL A;  4H4M B;  4DPO A;  2CNO B;  3IO1 A;  5KOX A;  2K1R A;  4IH5 A;  2EG2 A;  4OLO A;  4WTO B;  3CUN A;  3RJM B;  4Y28 C;  4DX7 A;  3HUL A;  3C6T B;  4M5N A;  1M5O C;  3HFK A;  2ATL A;  1PYS B;  1CQN A;  1OO0 B;  3X1L B;  2V9W A;  2G2O A;  2KM8 B;  2MQL A;  3EVM A;  3TR5 A;  4U7U K;  3TQE A;  1VQS A;  2YBV A;  5HJY A;  4USI A;  1VQO S;  1T8E A;  2UUA J;  2L9N A;  4YB1 P;  4IR9 A;  3RG6 A;  2B7B B;  4JBC A;  3PXG a;  2D3Z A;  1H7W A;  2KRR A;  3NCQ A;  3KLH B;  2VJV A;  4MIA A;  4ECT A;  1RHU B;  1V5I B;  2ZBI A;  4OV6 A;  3HJF A;  2GHV C;  2XWX A;  3ILL A;  4X64 F;  3KMS A;  4DQP A;  4ILM A;  1S9G A;  2Z2M A;  7FDR A;  1NKB A;  2IAJ A;  3KLI A;  3KK3 A;  2K7K A;  2VD3 A;  2HZA A;  2PEH A;  1REV B;  4FKY A;  2RF2 B;  1YX2 A;  4K50 A;  2CQG A;  3R5G A;  3TNV A;  2BKO A;  1E6Y A;  1I5O B;  3PHE A;  4PR6 A;  2AYB A;  3ZTP A;  3LOU A;  3W5X A;  1HWL A;  5J2P A;  1TP7 A;  5FDL A;  5L1I A;  1B0P A;  5F8J A;  3DCA A;  1F3V A;  3KHH A;  1XBW A;  2C1E B;  4K4W A;  4PPZ A;  3QRQ A;  3T1H J;  1X31 C;  3Q8P B;  1AXQ A;  1NSP A;  1SJ1 A;  5J2M A;  3H20 A;  5CYQ B;  2JVO A;  1XK8 A;  5A8K B;  1YJW S;  1KRP A;  4F3O A;  3J7Z 5;  3TI0 A;  5J1P A;  5K14 A;  1H2T Z;  4U8V A;  4AFF A;  3V5R A;  4DL6 A;  4JI2 J;  4M5D B;  2HHQ A;  1WAC A;  3KJQ B;  2WSC C;  1ZAV A;  1IJF B;  1WHV A;  3FZ2 A;  3PYG A;  1S7I A;  4OLP A;  2YWK A;  1XN9 A;  2CQ3 A;  3H5U A;  3O2I A;  2F3J A;  4LIR A;  4I64 A;  3PFE A;  4FP9 A;  2YNI A;  1V3Z A;  3DLE B;  2Z57 B;  5L9N A;  3BQ0 A;  2HVD A;  2KDO A;  1LOU A;  3KK2 A;  1TK0 A;  2YKN B;  3R9L A;  1RAI B;  2E29 A;  4R5P B;  1ACM B;  2R2U A;  1PKU A;  5IT0 A;  4DUZ J;  3FBF A;  3IRX A;  2MKC A;  2DEI A;  3OXG A;  2DO0 A;  4C48 A;  2XMM A;  3US5 A;  2F65 A;  1YJN S;  4B3M F;  4F4K A;  4M1K A;  1WJ9 A;  4USW A;  1VYA A;  3F56 A;  2V4Q A;  3QFW A;  1XER A;  2ZFH A;  3DRX A;  2QV6 A;  4BWJ A;  4USV A;  1X4B A;  2ZJP Q;  3BZQ A;  3ETM A;  4RW9 A;  4ID5 B;  1EX8 A;  2V8G A;  3AAW B;  3SSR A;  1FD2 A;  4FYV B;  3H5X A;  2DRD A;  3SIP B;  2BAN B;  2CXE A;  1NKE A;  1Q78 A;  5F8N A;  1R8A A;  3S6E A;  2OPP A;  5J2N B;  1NPR A;  4JI7 J;  3N79 A;  4QU7 A;  3LAK A;  4BLG A;  5IM0 A;  3J81 j;  3MM5 A;  4KHM A;  1KNZ A;  1S12 A;  4DSF A;  5HP1 A;  1U0H A;  2KN4 A;  2BOP A;  2X1B A;  5ETM A;  4DR2 J;  5AJ3 F;  4ERD A;  1WOR A;  1UVN A;  2MZR A;  2AWZ A;  3MAA A;  4G3I A;  4HAC A;  1G4C A;  1O51 A;  1MN7 A;  2RML A;  2UUT A;  3FSX A;  3MDF A;  1IBC B;  4LQ9 A;  3PR5 B;  1LNQ A;  4UQG A;  3Q8R B;  2G9O A;  4DV7 F;  4J9K A;  1VBY A;  1FJE B;  1FF2 A;  1X7V A;  2N4D A;  4ZJQ A;  5KFM A;  4OZL A;  3UDV A;  2FLN A;  3K89 A;  2H65 B;  1C0U B;  5KFG A;  2QFJ A;  4LSL A;  3DFE A;  5B0F A;  1GXT A;  3GMG A;  2KG0 A;  4A8Q A;  1RT3 A;  2HYI B;  3QYY A;  1FJG F;  2HS0 A;  1LW2 B;  2DNK A;  3ZZY A;  1XMB A;  2ROP A;  5DDO C;  5EX0 A;  5F9N A;  3TAQ A;  1FX2 A;  2RRA A;  2BKP A;  1Q79 A;  3LO3 A;  4PYA A;  4W98 A;  1TMJ A;  3LP0 B;  4OYB A;  3PO4 A;  1U1N A;  2HNZ A;  1RWO B;  2ZHB A;  4N41 A;  1SH0 A;  2XZW A;  3OLB A;  3G71 S;  3DMJ A;  1UVI A;  4P7T A;  1GXU A;  1JNZ B;  1PIE A;  1SV5 B;  2VC1 A;  3A4T A;  3KLF B;  1TKX B;  1TKX A;  2I8E A;  2FUG 9;  4KKO B;  3SV3 A;  2AJ4 A;  1ZM3 A;  2N82 B;  3N9U C;  4A4J A;  4OZJ A;  2NSB A;  3GQC A;  1MW7 A;  1TL1 B;  1TL1 A;  4ECU A;  2P9E A;  4YB5 A;  2EK6 A;  3N6L A;  3DLK B;  4NRU A;  1NK5 A;  1VC0 A;  2DNL A;  2V5H G;  3DM2 A;  4CLS A;  3BSA A;  3C19 A;  1DLO B;  3S1T A;  2LU1 A;  5EWE A;  3CCW A;  4NPO A;  3RBX A;  1SV5 A;  3NXZ A;  3TEG A;  4N7T A;  4DUZ F;  3T19 A;  3VGS A;  2DIS A;  4TVA B;  3UN5 A;  1NJY A;  4K0K J;  2YWW A;  1R7I A;  2BJE A;  2KT5 A;  3BGU A;  4S0M A;  1I94 J;  2HNZ B;  3KNA A;  5KT4 A;  1AUD A;  4Q5V A;  2IJF A;  3IGV A;  1VQP S;  1NHV A;  3LP2 B;  3VGT A;  1T11 A;  2FHJ D;  4KHP F;  3T9N A;  3MI7 X;  1LW2 A;  4C8L A;  2LXI A;  1RT3 B;  1TUV A;  4Y2K A;  3NRB A;  2HMI B;  1Q1K A;  3NWG A;  2YKM B;  4PXB A;  4Y2I A;  4RR5 A;  4ETZ A;  2ZH8 A;  1KHW A;  1U0H B;  1QTM A;  4MK7 A;  5ETK A;  1Q16 B;  1VCT A;  3KLG A;  1FKP B;  3DRR A;  2JHE A;  4NML A;  5B0A A;  3EZ5 A;  1U48 A;  2E9T A;  5IM0 B;  2ZZM A;  2OAU A;  4EEY A;  2IRX A;  1C0T B;  1NSK L;  2XO6 A;  2FGC A;  4U8Y A;  1X4A A;  1X5O A;  1YJR A;  3W5Z A;  4ED4 A;  3PW7 A;  4ES2 A;  2X1G A;  3W1Y C;  1XMO J;  4IQX A;  2H51 B;  3K5P A;  3MAA B;  2HWH A;  5GAG U;  4H4O A;  3NL0 A;  2YNF B;  2FGO A;  3M4X A;  1LWE A;  4KC5 A;  2CJA A;  1N36 J;  2DJW A;  1JKH A;  1SC6 A;  2DGX A;  4PAB A;  1KOH A;  1RE1 B;  4A8X A;  2C28 A;  2GW8 A;  2ZOF A;  3GJQ B;  1IKV B;  4PAA A;  4C11 B;  5ETV A;  2AJ1 A;  3CMQ A;  4AXI A;  2XQC A;  2PFD A;  5ETQ A;  2AEF A;  3IRX B;  4ZCI A;  5KFJ A;  1VIX A;  3OJS A;  3BQ2 A;  1BQM A;  1HQU A;  3M2R B;  3PHT A;  5IV3 A;  3T3F A;  2F40 A;  4NLW A;  5KG2 A;  1I51 B;  5CCM A;  1IN0 A;  2OEM A;  2YNI B;  2RRN A;  3MZI A;  2WAQ D;  3HT0 A;  3ISN D;  2ZKU A;  2GMH A;  4I7F B;  3CJ5 A;  3R5J B;  3M8Y A;  4DS4 A;  2DNP A;  5EUH A;  4EYH B;  1HMV B;  4OFZ A;  4R5P A;  1RZM A;  1X4G A;  4ECZ A;  2L41 A;  3OHA A;  1ZET A;  1WC3 A;  3LF0 A;  5HVF A;  3A8I A;  5T7L B;  3H8Y A;  3KJV A;  4ZP8 A;  5ETP A;  1N0U A;  2CVE A;  4GKK F;  4I4B A;  1WEX A;  2G0I A;  3JS9 A;  3SCK E;  2HHT A;  3RBE A;  3ZZT A;  2CPZ A;  1F5B A;  4NLG A;  2XSF A;  2UVR A;  2UVU A;  4OJ3 A;  1GMU A;  3GFH A;  3TAN A;  4DLE A;  3FZB A;  1QSS A;  5HJX A;  4DMZ A;  2KTQ A;  2GVD B;  2F1F A;  3V6D B;  4OZ2 A;  2HNY A;  4NEY A;  3ZZP A;  1FRK A;  4FPR A;  5K8O A;  4ECX A;  2IAJ B;  3KLI B;  3UDL A;  1B7Y B;  1PC4 A;  1S9G B;  1VI7 A;  2GQQ A;  2CUY A;  3CD0 A;  5DDR C;  3SXL A;  3Q8Y A;  2V8H A;  2ACM A;  2IJR A;  3R5A A;  3ZO7 A;  5GAE I;  5EWG A;  1UAW A;  2XLJ A;  3IXQ A;  1E6Y B;  1FDB A;  1H0H B;  4NMX A;  4WIQ A;  3DGP B;  3TVK A;  4ENO A;  2X51 A;  1XC9 A;  2VOD A;  3IR7 B;  4JUZ A;  4WFN Q;  3ILI A;  3I4H X;  3GYX B;  3CNQ P;  5ETT A;  4DL5 A;  1HNZ F;  4MJK A;  3ZFV A;  2ZD1 A;  4LF9 F;  4HLB A;  4ZLJ A;  3MUM P;  4F02 A;  3C66 A;  3GFX A;  4ZIV A;  1L3S A;  4V19 J;  4IFV A;  3HVA A;  4DOZ A;  1AZS A;  3UI3 A;  4C8M A;  1K0T A;  3U1M A;  3I31 A;  1ZM2 A;  3DI6 B;  1D09 B;  1LFW A;  1NZA A;  1JLE B;  3L09 A;  2DXE A;  5HRO B;  4TU7 A;  1AB8 A;  1OQ6 A;  3K7R A;  2VPX B;  2QA4 G;  4X2B A;  4AD6 A;  1UKU A;  4CO3 A;  4B3M J;  3LGH A;  3AD9 C;  2K3I A;  3DDN A;  4YME A;  3BN4 A;  5FLX U;  2GFF A;  2VG6 B;  2LXF A;  2MHE A;  2VPY B;  1S1T A;  3D1H A;  3M1V B;  3M8W A;  1KN6 A;  3FEZ A;  1BQN B;  4ATN A;  2LEB A;  2CG8 A;  2ILY A;  2MZT A;  2WB1 D;  4N5S A;  4WFB Q;  3KDN A;  4K4S A;  3J80 U;  4B08 A;  3BO4 A;  2JVR A;  1IBM J;  4JI3 F;  4WXO A;  1LWC A;  2JJ4 D;  2ZVS A;  4F3M A;  3KK1 B;  3CC2 S;  1LXJ A;  5E33 A;  3IRW P;  3AA8 A;  3OW2 R;  4QPT A;  4AQY J;  4YS2 A;  4F4X A;  1WF1 A;  2LP4 A;  4ED3 A;  1TK5 A;  2WHO A;  4EMD A;  1U47 A;  1S0V A;  5IQQ A;  2E5H A;  3W60 A;  4HYK A;  1F9F A;  1ZZF A;  3MM7 A;  1TFW A;  5D8H B;  4RW4 B;  2B5J A;  4PQA A;  3OR2 B;  4EWT A;  3PEH A;  3D7S B;  3ULH A;  3GR1 A;  3K8W A;  3FSY A;  4LBH A;  1T03 A;  2HIQ A;  3GU0 A;  3NOG A;  2WBM A;  2V0N A;  3OTE A;  4ANC A;  2PE8 A;  2YKA A;  2ZNY A;  1IBL F;  2UXD F;  1Y3J A;  3MM7 B;  3J81 Y;  3W2W A;  3KMQ A;  1FKO A;  4IFY A;  1BLU A;  3J7Y I;  4OZ3 A;  4WP8 A;  2BAC A;  2MQ8 A;  2LVW A;  2Z2Y B;  4DQR A;  1DTT A;  4BC9 A;  1KR4 A;  4CRJ A;  3PG9 A;  5IV4 A;  3EX7 B;  3HVR A;  3D0I E;  3PW5 A;  2CVI A;  3M2V A;  2YX1 A;  3BKU A;  3MAQ A;  1GMW D;  3DOM A;  1NKC A;  1ZTW A;  1WUU A;  4ZP6 A;  2NUU G;  3DOK A;  5KG1 A;  4NYO A;  1FJ7 A;  1KS2 A;  4DU7 A;  3CUL A;  4IO1 A;  4WP9 A;  4ZPB A;  3TA0 A;  5DZ6 A;  1FNO A;  2R7Q A;  4B3S F;  4EBE A;  4W92 B;  3GE9 A;  1RBL A;  1VQL S;  3PO5 A;  1LFP A;  1JXE A;  3FDS A;  1Y5N B;  3Q83 A;  3G4S S;  2ASJ A;  2RS8 A;  4NCG B;  3D6H B;  3SFU A;  4YUD A;  2YNH B;  3HZE A;  4LRF A;  3N0V A;  2YX4 A;  3I9Z A;  2XY5 A;  2CG4 A;  3DHW C;  1H3D A;  1XIQ A;  2MMY A;  4H4K C;  4IFV B;  2R7W A;  3OBI A;  4A8Y A;  2IVY A;  3HHK A;  4TLQ A;  1MLA A;  4ZDN A;  1PO6 A;  5KFA A;  8AT1 B;  5F8G A;  3EYZ A;  4DR5 J;  4B3T F;  2H4W B;  1Q86 T;  2OKQ A;  4LSN A;  2HZV A;  5JJB A;  1SKW A;  1KON A;  5IWA F;  4P2S A;  4HHU A;  2QMU B;  2N7Y A;  3OR1 A;  4USU A;  1UVM A;  4ZCM A;  5MAO A;  4KGK A;  1W2B R;  1NRK A;  4GC7 A;  2OPS B;  3ETO A;  4YB7 A;  3SYZ A;  2FHJ A;  4GVB A;  3E2E A;  1TKZ A;  2EC2 A;  3MEC B;  3RGI A;  1EET B;  3TJ9 A;  2HNY B;  3T5H A;  3H2V E;  3V6D A;  2GVD A;  4NCB A;  1VLY A;  5D0H A;  2FTR A;  1RBA A;  2KXH A;  2NPF A;  1N88 A;  2VBX A;  3R1L A;  2ZZN A;  2W7P A;  2ZH3 A;  4KBI A;  3ADA C;  4WYL A;  1RA6 A;  3GV8 B;  5GAG I;  2ZIT A;  3D3C J;  4LF7 J;  1FHT A;  3GG0 A;  1PSD A;  2E44 A;  5C24 A;  1PIL A;  1WTF A;  1B99 A;  4HI1 A;  2HHX A;  1UZH A;  1RAJ A;  1R0B G;  2AJF E;  2NPI A;  2O5D A;  2BVZ A;  4MK8 A;  1J27 A;  2MDA A;  3W7B A;  2OD6 A;  3VTI A;  5L1K A;  2E1C A;  3TA1 A;  2RD5 C;  4J9Q A;  2J0X A;  4DV3 F;  1N32 J;  4HDH A;  4I2Q A;  2VFV A;  4P71 A;  1UMJ A;  3THT A;  4CLF A;  4U96 A;  2QLW A;  4DJB A;  3LGN A;  3MPY A;  4I7F A;  3ET6 B;  1PBA A;  2RUG A;  1ULR A;  2WTF A;  4DV1 J;  4GVB B;  4ICL A;  2JFK A;  2M5Y A;  5H1S V;  1SQE A;  2XCA A;  4LBP A;  1Y5I B;  3OQ2 A;  3UDC A;  3GV5 B;  4DV0 F;  1M1G A;  3RR8 A;  2BKN A;  1C4C A;  1CJU A;  2OML A;  4I69 A;  2DHX A;  5H9E J;  2GQC A;  2MKH A;  4RW6 A;  5H9E K;  4LMZ A;  4C0O C;  3BKF A;  3NS6 A;  2KM8 C;  2DCL A;  2DPJ A;  2YQ0 A;  1V6H A;  2L9D A;  3OFE A;  4ZLL A;  1RAG B;  3FUY A;  1WSV A;  3D28 A;  3EPG A;  3MM8 B;  3I0S A;  2YNF A;  2CQP A;  2MY8 A;  4L3N A;  4TY8 B;  3NMA A;  4JI1 F;  1FD8 A;  1JJH A;  2JRS A;  4NCG A;  3VAJ A;  1JLA B;  4YY3 F;  4C4W A;  4WZQ A;  5E41 A;  2XUL A;  3K8V A;  4ZHR B;  4KGV B;  4LVN P;  3HSJ A;  3M8Q A;  3GYN A;  3MR7 A;  3ISN C;  3MWB A;  1X9M A;  2J76 E;  4BS2 A;  1RWV B;  3FK4 A;  3IAS 9;  2FD2 A;  3W9H A;  4FDF A;  1R0C B;  3GIJ A;  1KC8 T;  3CD6 S;  3QRP A;  4DPT A;  4PUO B;  1TUG B;  1PAE X;  1UEV A;  1NM2 A;  1S57 A;  2AKW B;  5KFE A;  3LP2 A;  2MQN A;  1UJ4 A;  1DTT B;  1NHU A;  2OPR B;  5B0E A;  2CPY A;  3I5B A;  2OI2 A;  1ELO A;  3OXF A;  1DAR A;  3PYF A;  2J9C A;  2LQB A;  4OJ1 A;  5K8P A;  2R8I A;  1ICE B;  2QL9 B;  3QZ8 A;  4NX9 A;  1WOO A;  3TA2 A;  4F50 A;  3R7N B;  1U0S A;  1YG0 A;  2OMO A;  5AXK A;  4QWB A;  2DR9 A;  2CQC A;  3EIC A;  1TL5 A;  2GC8 A;  4HKQ A;  2E1P A;  2GGP A;  2P6S A;  3BS9 A;  2R7U A;  2HVI A;  4IG0 B;  4RW4 A;  4OYP A;  4F36 A;  2DHA A;  1HBO B;  1RIS A;  2GJ2 A;  2HSE B;  1U24 A;  2OUG A;  2RB7 A;  3MED B;  4RPF A;  3U27 A;  2M4M A;  2UXC J;  2JLE A;  1CBK A;  5KT3 A;  3I96 A;  2FLL A;  2P6T A;  3BSN A;  5DQH A;  1IKX A;  4DEZ A;  1TL7 A;  1FES A;  2LEP A;  2UUW A;  4UOC A;  2X1F A;  1Q53 A;  2R3V A;  3KLF A;  2R7V A;  2A10 A;  2E7V A;  3AT1 B;  5DDP C;  5E3R A;  3U1L A;  3EDR B;  3G6E S;  1BQN A;  2VG5 A;  2BMB A;  1KQG B;  3M1V A;  5HSP A;  2VG6 A;  3IWX A;  1X4H A;  2F5G A;  4NLD A;  3IFE A;  2BYC A;  5CD4 A;  4RU2 A;  3LP0 A;  4P6Q A;  2OIH A;  3D6F B;  3OXL A;  3MUT P;  3KOA A;  4CT9 A;  2OSQ A;  4CTA B;  5K8N A;  3M30 A;  4J9M A;  1NH7 A;  1S4F A;  2X3D A;  2DD8 S; 
#chains in the Genus database with same CATH homology
 1U0H A;  4NI2 A;  1CUL A;  4USU A;  1WC5 A;  5D0E A;  3MAA A;  4WP3 A;  4CLL A;  1Y11 A;  2GVD B;  2GVD A;  5D0H A;  3UVJ B;  3G82 A;  4OZ2 A;  1CS4 B;  1WC4 A;  1CJK B;  4OYW A;  2BW7 A;  1FX2 A;  4P2X A;  3C16 A;  4OYO A;  4OYI A;  3C14 A;  4OYB A;  4CLY A;  4CLZ A;  4CLF A;  4OYM A;  3ET6 B;  1AZS A;  4OYZ A;  1YBT A;  4P2F A;  5D0R A;  1AB8 A;  1CJU A;  2GVZ B;  1CJU B;  3C14 B;  4CLS A;  1WC0 A;  1CJK A;  3G82 B;  4CM2 A;  1YK9 A;  1CJT A;  4CLU A;  1CUL B;  1AZS B;  3ET6 A;  1CJV B;  3C15 A;  3R5G A;  5D15 A;  3MR7 A;  4CLT A;  4P2M A;  1U0H B;  1WC1 A;  4OYA A;  4UST A;  2GVZ A;  1CJT B;  4OZ3 A;  4WP8 A;  4CLK A;  3MAA B;  1CS4 A;  5IV4 A;  3UVJ A;  4CM0 A;  5D0G A;  1WC6 A;  2W01 A;  1Y10 A;  4WP9 A;  4NI2 B;  3C16 B;  4OYP A;  1CJV A;  3C15 B;  4CLW A;  4CLP A;  5IV3 A;  4USW A;  1TL7 B;  1TL7 A;  1YBU A;  2WZ1 A;  2QV6 A;  4USV A;  4OYX A;  1FX4 A;  1WC3 A;  4WPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...