1WC3A

Soluble adenylyl cyclase cyac from s. platensis in complex with alpha, beta-methylene-atp and strontium
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
198
Chain Sequence
b'SHMRPEPRLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFENQGTVDKFVGDAIMALYGAPEEMSPSEQVRRAIATARQMLVALEKLNQGWQERGLVGRNEVPPVRFRCGIHQGMAVVGLFGSQERSDFTAIGPSVNIAARLQEATAPNSIMVSAMVAQYVPDEEIIKREFLELKGIDEPVMTCVINPNM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADENYLATE CYCLASE
publication title Bicarbonate Activation of Adenylyl Cyclase Via Promotion of Catalytic Active Site Closure and Metal Recruitment
pubmed doi rcsb
source organism Spirulina platensis
molecule tags Lyase
total genus 65
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2004-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1wc3A00
1WC6A 1WC4A 3C14B 4WPAA 5D0GA 1WC1A 1Y11A 3C15B 3C14A 3C16B 3R5GA 4CM2A 1AB8A 1WC5A 1TL7A 4CLLA 1AZSB 1U0HA 4USWA 4OYOA 2WZ1A 1YBTA 4P2MA 2W01A 1CJTA 5D0EA 3ET6A 3MR7A 4CLWA 4USUA 4CLYA 3G82B 4CLKA 4NI2B 4CLSA 3MAAB 1CJUB 3UVJB 4OYIA 1CJKB 4OYZA 3C15A 3G82A 4NI2A 3C16A 4P2XA 3MAAA 1CJUA 2GVDB 1CJKA 2QV6A 1FX2A 2GVZB 4CLFA 4WP8A 1AZSA 4USVA 4CM0A 2GVDA 4CLPA 4WP3A 4OYPA 5D15A 4OYAA 1CS4B 4OYMA 2BW7A 4OYWA 5D0HA 4CLTA 1CS4A 5IV3A 4P2FA 4OZ3A 4WP9A 3UVJA 4OYXA 4USTA 1WC3A 1CJVB 5D0RA 1CULB 1WC0A 1YK9A 1TL7B 1Y10A 5IV4A 4OZ2A 1FX4A 1CJVA 1U0HB 1CULA 2GVZA 1YBUA 4CLZA 1CJTB 4CLUA 3ET6B 4OYBA
chains in the Genus database with same CATH superfamily
4CT8A 2BMBA 2V4JA 2HHWA 1WI6A 1BE4A 4RW6B 5DS7A 2D69A 5KG7A 3H25A 3BO2A 1GMUA 1IKWA 3U7JA 5FDLA 4OMFG 1F9EB 1S9GB 2BW2A 2GFFA 5IWAJ 2BQ3A 3PX6A 3CD6S 1X7VA 2XSFA 3KXDA 2QSFA 3NG8A 2D9OA 4ZPAA 1KOHA 3GR1A 3TUJC 3J81Y 1KHWA 1LK5A 3G82B 3W2WB 4GC7A 3T1HF 5IT9Y 2G2OA 1WHWA 4IRKA 4OYZA 4PQUA 4TU8A 4KE5A 3I0SB 1KSPA 1RT2B 5MLCV 2V9WA 4UW2A 1KLNA 3HULA 4QIGA 3W60A 4NXMF 3HHLD 4J9MA 2ADCA 3D6HB 2E9RX 4PG6A 1HR0J 1AUSL 3TANA 3ZZTA 1P9YA 3I87A 1N6QB 2FVCA 1HBMB 3QNWB 3VAFA 1F3FA 3VZHA 3A3PB 1I3OB 3GFHA 2FLPA 2WSCC 4Z37A 1R6YA 1UMJA 4WTYA 2PMWA 1VC5A 4KR0B 3MF5A 1T03A 2ROGA 5B0AA 3JAMY 2AEMA 1FHTA 1HWKA 3CJKA 3U1NA 4PUOB 2M8DB 2QT7A 5KFEA 2XI3A 4LRDA 3M7VA 4WF9Q 4YB5A 2BANA 3Q83A 2ZH2A 3SSRA 3QWUA 3D3BJ 2VDHA 2BJ8A 3M2RA 3D0HE 2Y8YA 3OTEA 3HK2A 2VC1A 1GX5A 4UOFA 3D9BA 4NLSA 4KRWA 4CI0B 2HQ3A 3SXLA 4UOCA 4RW6A 1PJ5A 4F4YA 4EUVA 3DCAA 2LQ9A 4R5PB 2JEGA 4O3OA 4FYXB 1TZ0A 1KVJA 4WP8A 2DIUA 2G1DA 3QO9B 4X4QA 1PKUA 2IFXA 1HBOB 3V81B 1MROB 4X4RA 4N77A 1C0TB 2IDLA 3H4DA 4ZCMA 4JV5J 3OUYB 1XQIA 3W2WA 3HT3A 2G2ZA 1SL1A 4Q43A 4WFZA 4UY8T 3ZZZA 3BKUA 3I0SA 3K5LA 1AA1B 5SUHA 1RT2A 1R7IA 4P74A 1CJVA 2GGPB 3NL0A 3BS9A 1EKRA 3R6LB 3IGVA 2ZUAA 1N6QA 2Z57B 4ILLA 2YKQA 2W2OP 4NLTA 3J7YU 3M2UB 1NCLA 2VA2A 1PYSB 1A0OB 4Y00A 2C28A 4C98A 3OL6A 1Y0HA 4IDKA 4NYPA 5E41A 4PUOA 2I8EA 1FA0A 2E5LJ 1H74A 3PYEA 2YNFB 4URGA 3RRHA 3MAAB 2IJFA 4LFAF 3T19A 5A76A 4HVZA 3QWPA 7FD1A 4ECUA 1NSQA 2L3MA 2V4QA 1RLDA 4GVLA 3AFGA 3ZO7A 5KFXA 1RWXB 4QR0A 1QE1B 1IUJA 5EX0A 4A8FA 1F9HA 2AP6A 2HGLA 2J0SD 2NPIA 4MYUA 5F8HA 2UVWA 5LMNF 2XHCA 4OX9J 2AX1A 4R5PA 3R5JB 1PYTA 4QYZK 1YK9A 2B9YA 4K4TA 5DG8A 2F8EX 4NRUA 2VFTA 3NMAA 3QO9A 2DCLA 1N33F 5EWEA 1HBOA 3V81A 3I9ZA 1MROA 1C0TA 4CWBA 3OUYA 5J1PA 3R7SB 2VJVA 2KXFA 2HZVA 4LF9J 2OEKA 3UI3A 2GGPA 3CIMA 3GCWP 3KYLA 2HLUA 1WACA 4EI2A 3MM7B 5DQIA 2E7WA 4DU7A 1N5SA 1WKJA 3DDNA 1QVGR 3M2UA 3C2PA 2DRDA 2PN6A 4TN2A 4CM0A 3KLFB 1ZS6A 9ATCB 2OJ3A 4YHHJ 2OD4A 3A8IA 1VQLS 2YNFA 5F41A 3JQMA 5BYRA 1ZTTA 2PE8A 3OHAA 5IWAF 3R7NB 1C1CB 2AT1B 3DXBA 4RUBA 3RG6A 1KTQA 1UW4A 1TKXB 4KHPJ 3FFIA 1WC1A 4NLXA 1WUUA 2WOMB 3IGNA 2YQ0A 4CM2A 2VKZG 1U1OA 3SZ2A 3D6FB 4LMZA 1P6TA 1WSVA 3RAQA 4ECSA 1U4BA 3RB6A 5A8KB 2YWHA 2DHGA 2F8HA 1VBZA 4LR9A 2FJVA 1WJ9A 4P72A 1VBXA 2HNZB 4U67Q 1WNEA 3NGTA 1HFEL 3M8WA 3IS9A 1NUEA 4BBYA 3A1YG 2MHEA 2JJ4D 3SCKE 2KXNB 5K20B 2MZJA 3MTKA 2EFGA 1OQ6A 1S1UB 1YRUA 5GAGI 3BYPA 3F41A 3G8TA 3DGVA 3Q24A 5ETRA 4EYHB 4JYAJ 2DH8A 3MM7A 1Y3JA 2CZ9A 2XMTA 2AX0A 5C25B 3O3LA 4IRCA 2VPWB 4PG4A 1YZ6A 2ZVIA 4A8OA 2NZCA 2W8KA 3JTNA 2ERRA 1AW0A 2BQRA 2W2PP 1TFWA 2AW0A 5DQGA 2AIRB 3T5LA 4FN5A 1FKOA 3N4WA 3BSCA 2ZC3A 4X4VA 1WKLA 1RT4B 2B6AB 4LBHA 1C1CA 2A1BA 2ZZTA 1D9FA 2YWFA 2HGNA 3Q8QB 4C97A 1UVNA 2DJWA 3WIUA 4C3KA 4IO9Q 4OYIA 4MH8A 5FIIA 1UWBB 3NEKA 2WOMA 2ZHOA 1HYSA 4X4OA 1NDKA 4WJBA 1O0PA 2CKWA 3J7AN 1GAOA 5A8KA 3LF0A 2EK6A 1W26A 3NCPA 1GXTA 3PM9A 4Q2LA 1KDNA 1Q8KA 5FLXY 1RBAA 2OEMA 3KUGA 1HBNB 4QIEA 4OYWA 5G4DA 3QYYA 4FYWB 3CJ2A 2YXLA 3SQGB 1P8GA 4OQJA 2X51A 3DLGB 3FQKA 5E3RA 4F25A 1KP6A 1DQAA 2BZ2A 2D9PA 2DIVA 2RJZA 1FE4A 4P71A 1MU2B 5HI7A 2E5LF 3LPYA 3EZOA 3H20A 1M1HA 3NGDA 5F3ZA 1HI8A 1XN9A 4WK3A 1X9WA 1LEOA 2D3ZA 3M32B 1AZSB 2CDQA 3IBWA 4RX6A 4IYQA 1RAFB 1QDUB 2LEPA 3HLUA 4YEAA 4DF4A 3WX4A 1FRJA 4USIA 3RGIA 3HD1A 3D28A 4OX9F 2FUG9 1FJEB 3QT6A 4MK8A 2LCWA 3AA8A 2B6AA 4V19X 2IAJB 3D1QA 1EP4B 5I3PA 3LANA 5ETLA 4BS2A 5CHCB 2DGXA 3HXMA 2MSSA 2IHR1 4ZVHA 3N6LA 3GSIA 2VIHA 4DR3J 3MCSA 1F2GA 4RW8B 2A18A 3EUNA 2HFSA 4C0OC 2YX4A 4LF9F 2BVZA 3F56A 1RHRB 4ZLLA 4LF8J 1F2HA 3R7BB 4X64J 2HEKA 5AT1B 1K44A 3D1OA 1HI0P 1HBNA 2R4FA 3HKZD 2QA2A 2CVIA 2JSXA 3SQGA 1J5OB 2IA6A 2XZWA 3DLGA 1XNQJ 2DR9A 8RUCA 5HN0A 4USWA 3OVBA 4DPXA 4YHHF 2CPYA 2WZ1A 3LGHA 3E3XA 4CQ1A 2AGQA 1G6BA 3HCXA 1FI4A 1M5OC 4YR3A 1WDDA 4IH7A 3UW1A 2OPPB 3BR9A 4I7FB 4CO4A 4JI8F 2J0WA 4P2XA 4G1IA 1R0BG 3WZ0A 1OY8A 3POTA 1PAUB 3M32A 1AZSA 3SFUA 4DI6A 2NREA 2AWZA 4K4UA 3V6DA 2BJ7A 2MXYA 4KHPF 3BGFA 4WXWA 2JC1A 2DEJA 1DY3A 2FDNA 2BKPA 1APSA 3HO1A 4LREA 4YQWA 2XLIA 2LYVA 3MXHP 2YWKA 2B9XA 4O4RA 2DYAA 3MD1A 1GFWB 3IWXA 2IAJA 2QTWA 2RQKA 1EP4A 4GC6A 3UR3C 4FYDA 2CJAA 1SBRA 3GCXP 3LP0B 4X4NA 4AQYJ 1YJ7A 4OYBA 4DFMA 3U1LA 2JH3A 2HQIA 5H9EJ 3IR5B 2R2RA 4RW8A 2UXCJ 4HL9A 4UOHA 1M0SA 4KO0B 1RK8A 4C8YA 1R31A 2H5IB 2HBRB 2YX1A 1S7IA 2Q1LA 4TYAA 3GSDA 3OL8A 2IY5B 2OTLS 4JYAF 3OR1B 2K7KA 1YQHA 2DHSA 5J1EB 3BSOA 2HFUA 1VRQC 4USHA 5D3GB 3PO4A 3CCZA 1F5BA 4DV6J 2DNLA 1VRTB 4BC7A 2F4VJ 1RAHB 4AFFA 3EICA 1Q8IA 1SPBP 3TEGA 4AUKA 4F0KA 1XEZA 2R7QA 2OPPA 4I7FA 5D0RA 2UVRA 2OAUA 4LF6J 2GAHC 5KFCA 1NHUA 1SI9A 4ECWA 2E7VA 3EYZA 4RJVA 1S1VB 2BBEA 3O5TB 2Y1RI 5EGYA 2LA4A 1N52B 1N56A 3CJSA 1K9MT 2FJAB 5J2MB 1T3OA 1R8PA 2MQQA 5KG6A 4Y65A 4LFBJ 3NAIA 2AYGA 4WTOB 4O44B 4LF1A 4M1KA 1X4EA 1SL0A 1H72C 4CH0S 3RAMA 3LP0A 4Q7AA 4XK8C 1Q95G 1PC4A 3GIIA 1RAJA 2Z2YB 3THVA 4NLOA 2DBBA 4KO0A 1IBKJ 2Q43A 2DGOA 2YNIA 4OFZA 4P10A 4ERDA 3MI7X 3TJAA 4DQPA 3C6UA 3NLCA 4DCOB 4BLGA 1KQSR 2B5JB 2IVFB 5JVHQ 2KB2A 3CULA 1KQFB 5J1EA 2CQ3A 3Q23A 4B3RJ 3IAS9 4JB8B 1VRTA 4NA3A 3KK2B 3Q22A 3KK3B 3Q86A 1DJ0A 2FZKB 2FGCA 2Z58B 3DLKB 4U8VA 2KYZA 5KFAA 5G0RB 3Q8YA 2AMCB 5KFHA 5CD4A 2MKHA 1S6PB 4WFBQ 2V8PA 2JLFA 2GMJA 2LXIA 4O4GB 3Q8PB 4CLLA 3DI6B 4KT0C 4DR3F 4N41A 3IXQA 4U9RA 1KOOA 1S1VA 4DG1A 2H4WB 4ALZA 4ID8A 4QWEA 2E1CA 1X9SA 3FSXA 3PW7A 1OQ3A 1RTHB 4M5JA 3B6BA 1VYAA 2DR6A 1Z1ZA 3GMGA 1UZDA 4ANEA 4X64F 3OFEA 4O44A 4LF7J 5E7OB 5DQHA 2BJ3A 5ETTA 4YOEA 3BF4A 4M5LA 2H51B 4DSIA 4P73A 2ACMA 3I31A 1JLAB 5HQ8A 1V5IB 1UWAA 2BX6A 4USTA 3T5JA 2CPJA 1S48A 2HK3A 2VL1A 5LSOA 1XNQF 4DSJA 5HVHA 1FX4A 4G1PA 5F9LA 2C2KB 2CQHA 2XS7A 1WOOA 4FF2A 1U45A 2DT9A 4ZLNA 4PRFA 5LXYA 2B5JA 2UV8A 2WRMA 4NLDA 2FZCB 3RW7A 4K4XA 3JS9A 3GFXA 2IYIA 3W66A 2KVIA 1M5VC 3AAWB 1S9FA 1MN7A 1QUVA 3VAMA 2UZAA 4L73A 3KK3A 2ZKTA 1DURA 1RWMB 1T9TA 5HO4A 4QPTA 1EB0A 2XLJA 2RMLA 4LRBA 5G0RA 1JNRB 1Y00A 1I51B 3S6EA 1RZMA 1S6PA 3P96A 3DRPA 2CQIA 1FTRA 3W62A 2BJDA 2HQFA 4O4GA 4OZ1A 4WIIA 1JLCB 4U96A 4M8LA 4AQYF 1RTJB 2K3KA 3QZ7A 3WQPA 4I2QB 4X4PA 3K89A 3PJ9A 2ZJQQ 2KT2A 1RBLA 4ZK7M 1YJRA 1YDLA 3Q89A 2AJ1A 4LBIA 2L08A 2NXEA 2G4BA 2CPDA 2DVIA 1SJ4P 1NDLA 2A3JA 3NCRA 2VBXA 4NXNJ 3D7SB 2XM3A 1T11A 2FJEB 1JLAA 4WKRA 4JI7J 2N7YA 4DV6F 1JX4A 2DNQA 2D74B 3TYTA 2F4VF 1LNQA 1OWXA 1WF2A 2OSRA 4PQAA 3SBMA 4H4KC 1SVDA 3P49B 1L3UA 4H54A 1NK5A 2DO0A 4MKVA 3CXCR 2AJ2A 3MFHA 1ZAWA 4DQRA 4LF6F 4DR2J 2JWNA 2JX2A 1CG2A 2UUWA 5DM6Q 4Z2XA 3W64A 1IKVB 3H2VE 5KFLA 4CP5A 3TJ9A 1TL5A 2IRYA 4G1QB 1H2TZ 4GKKJ 2MLYA 4C0BA 2P8IA 3T1AA 2AZ1A 2ZDOA 3RTVA 3HKWA 3MPVA 3PFOA 2B7BB 2PFDA 1FKPB 2KFNA 2OHDA 1JXEA 4TU9A 3KG1A 1BWEA 4RBVA 2ZHBA 3HFVA 4ZPBA 5H9FK 3EMTA 3CJ3A 1JLCA 5L1KA 1NJIT 1RTJA 3DKDA 3EVOA 5EWFA 1U1RA 4LRCA 4I2QA 3OFGA 3LA0A 2LKZA 4PG7A 3RBEA 2YNGA 1AFJA 3PRBA 3ENQA 3UDCA 1IBKF 4MK7A 2ZNYA 1T8EA 1URNA 2MY7A 4JI4J 1X8DA 4K0KJ 1NM2A 3OTCA 3QAEA 1KR4A 3A4TA 3PJWA 2OO4A 1PIEA 4P2SA 1JNZB 3F44A 1RP5A 2KM8C 1UCNA 3UN5A 2I9SA 2DGUA 4B3RF 3LGMA 3TA0A 1JK9B 2F40A 2VUGA 3KG4A 1YRTA 3SEOA 3W5YA 2NUUG 2DY1A 4ECZA 4I6WA 2BDPA 1M5PC 2H48B 3P6YC 2FHJA 1ICEB 4N8NA 1N34J 2CQDA 1FFWB 1RT5B 4NLRA 1IKVA 1BGXT 4O3SA 5T41A 3CF5Q 4MYTA 4AYBD 4RW4B 3JTPA 3W61A 4X84A 1Z2LA 4UUWA 3P5TL 3F73A 4WU2A 4I6YA 2BEFA 4LSNB 1FKPA 3KJNB 2CAJA 4LF7F 5T14A 1NJXA 1G7CB 2C3UA 4DL0C 2V68A 4ZHRB 3CDUA 3L7PA 3LAMA 1FRXA 3CE8A 1M5SA 1VQ5S 3PY8A 4HKQA 3AY0A 3GONA 4HLBA 4NI2B 4ED7A 1WORA 4NLYA 3DM2B 2VG6B 4HI1A 3CC7S 4HDGA 3DYAB 1VQPS 1RA6A 2GVDB 3JYTB 4ZS6A 4RW7B 5J2NB 3MUVP 4J9RA 4HHHA 1RISA 4CTAB 2FTRA 3VVTA 3UDVA 1CC8A 1SJQA 3BM7A 3AODA 3L95X 2WVDA 3CWJA 2NQPA 2ZOGA 3DLEB 2EBGA 2LMIA 2HIYA 3AXKA 4O3PA 1WTFA 4C4WA 5M2UA 4ZP6A 5F8LA 2U1AA 2RUGA 2IM1A 2ADBA 2ILZA 4F26A 5HROB 1F60B 2HAFA 3M9OB 3BH6B 1RT5A 1WDTA 2KFZA 1FEEA 4FYYB 2KO1A 2VD3A 1S6UA 4CO1A 3BH7B 4RW4A 1VHIA 5A8WB 4U7UK 4B3MJ 5J2QB 2VASA 2EFPA 3CT9A 2ZC4A 2LU2A 3UDLA 1ZPVA 1S6OA 1VK8A 4NXNF 1GK8A 4RBTA 2J7UA 1S59A 2YWEA 4OX8A 5ADZA 4ZHRA 2F4FA 3HFKA 1OPZA 1RADB 2QZ8A 4NA2A 3HDSA 1BMQB 5IOLA 1RHMB 2XYGB 4JI7F 4F4AA 2IVMA 1NKBA 4HH1A 4RNOA 2VG6A 1HPZB 2XWXA 1ZZFA 1EQMA 4EO6A 3JYTA 1RKJA 3LPEA 2IBKA 4RW7A 4Q0BB 5J2NA 1XMOJ 2EFNA 9RUBA 5IXUA 3OT9A 1K0VA 4RKUC 4NCGB 2R8HA 2V34A 2O01C 4AXIA 2H1YA 3DLEA 2EFVA 3KHHA 1M1GA 4JI5J 2LVWA 1UA0A 3QJPA 2VG7B 4ZIVA 2CQCA 4ECTA 1Q86T 4O3NA 1NBEB 2XCAA 1R6VA 4HH0A 3K59A 2HVHA 1DFDA 5A6WA 2APOA 3KLGA 2DR7A 3M2VA 3QJJA 3UN3A 5F8GA 2AJ0A 4U8YA 4DZDA 2YY3A 1XR5A 4ZVQB 4OZJA 2HG4A 4ETXA 3BPDA 3K5PA 5L1IA 3AJDA 3TAQA 1LWCB 5A8WA 4DL6A 4RUAA 4NMXA 3ITHB 3I6PA 3T6BA 4LVNP 2CJQA 2DITA 5GAHU 4JI4F 1DZ5A 1L3VA 2QL5B 4PPDA 1VC6A 2HURA 3CJ8A 3IWLA 3MZIA 1C2PA 3M6VA 4FNHA 2Z4PA 1CJTB 3BDEA 4FS2A 4KHMA 2ZH9A 3CO9A 3QGGA 1HPZA 1RHQB 2NCKL 2MQ8A 1S5ZA 2UVUA 3H0PA 3TUIC 2RKIB 4Q0BA 2H5JB 1TR0A 4PXDA 4P7TA 1HBUA 1Q78A 1UETA 4FNIA 3GE9A 4YN3B 4PWWA 5HLFB 4WYLA 1RXOB 1ZA2B 3B78A 1N34F 1SKWA 1GX6A 4CO2A 3VAHA 1P1LA 2C42A 2JHEA 1H73A 1YG0A 1KWMA 2VG7A 5HMWA 3LH2S 4HTIA 2VICA 1S1WB 3A12A 2BR0A 3HFZB 2MB0B 2KG0A 2Z2MA 5EWGA 3PEJA 3OLBA 2GCFA 1T9VA 3NS6A 3AD8C 3J81U 3AB4B 2QA4S 2HWIA 1HI1A 5IT9U 4DX8H 4DXLA 1IJFB 2ZZNA 2XMKA 1WC4A 3BJYA 3SV3A 1LWCA 5BXIA 2UV8G 3ITHA 3P4UB 1GMWD 2N3LA 3G71S 2VQEF 2AJQA 2EEYA 2B7CB 1LW0B 3FJ2A 2A6MA 3W65A 4N56A 2M0GB 5HMXA 2W7PA 1KVKA 1CJTA 4ZN3A 4Z7YA 1RT7B 1T0TV 5LL6d 4MT1A 1MNEA 2DNOA 2KRBA 3ISNC 3MEKA 5F0UA 3UCZP 1WG5A 3I0RB 2K8GA 2VBZA 1VQ9S 4K4YA 3GIKA 3DGPB 1SQEA 4Y3CA 3PYDA 2RKIA 2P9CA 4ZCKA 4R25A 4WP3A 4KIAA 4N5SA 4ZJLA 5HLFA 1LW2B 2XCPA 2B3TB 4UY85 4O0IA 5E5NA 4I64A 4F4XA 2VHGA 3LGNA 4FKXA 3OVSA 3QZ8A 2XTJP 1WTBA 4NASA 2HBQB 2I2YA 2DRAA 3MAQA 4TU7A 4B3MF 4DR1F 1W2BR 2HHQA 3FRYA 2COLA 3GP9A 3A3OB 3IAM9 2MKIA 1ROFA 4GO5X 2PFFB 1RACB 1CVJA 5M2RA 3HHEA 2LP4A 1UL3A 1Y5IB 2RQMA 1HNWJ 3UN2A 2WONA 1J5EJ 3GTYX 2YWGA 4X2BA 2RT3A 3BKFA 1V3ZA 4DU8A 1MMNA 1P1TA 2EFQA 4Y0FA 2V8DA 4CLYA 1JLBB 3KWMA 3GIJA 2E1AA 3LOUA 3R5DA 4K5RA 1YJVA 3GFZA 4MKBA 2LQ8A 3J7ZT 4OIXA 3BO4A 1XMOF 1KQKA 1U1KA 1LW0A 1B7YB 1DLOB 3GJTB 1NK8A 4NYZA 3ONQA 1S12A 3S8SA 1SJFA 1RT1B 1RT7A 3TO8A 3GJSB 3ENAA 5H9EK 3PIOQ 4LJMA 1JLFB 2V6AA 2DY9A 2XQCA 3I0RA 3MPUB 3DLLQ 3H2UB 1R8BA 1TL1A 2DGVA 4NYOA 3DGPA 2HZAA 4MFBA 3NGRA 1IBCB 2XB2D 2XMVA 4PG8A 4IQXA 1N8RT 2E9ZA 4USKA 1PYOB 3PDNA 1U1NA 1LW2A 1OMSA 2P5VA 2ZM6J 4M5GA 2DXDA 3BN4A 4YB6A 3CB4A 2N4CA 4CNYA 1WHXA 1SQFA 2FHOB 3PO5A 4FBUA 2FY8A 4DSLA 1HHQA 4PXBA 2WHOA 3PKMA 1CJKB 1Q5YA 4F3MA 2H54B 4XDCA 2LQ5A 2QFIA 3BO3A 3ZTOA 3BB5A 5AXNA 3E01B 2B4OA 2CQPA 5KFJA 2B9EA 1SJ3P 1JLBA 1L5UA 4NRTA 3A8JA 5AXMA 3CSKA 3HMJG 1FERA 3DDKA 5AE2A 1S76D 4UZCA 4LF5J 1REVB 4C48A 3FK4A 3MCMA 2MKSA 2Q6BA 3O6QA 4FF1A 1RT1A 1RWWB 4Y2KA 3I56S 1JLFA 1K47A 3C16B 1RCXB 3DXSX 3VZIA 2M88A 3WC0A 3T3FA 1W25A 1NU4A 3WHIA 2A2DA 4QIVA 4UZBA 1K8AT 1F1BB 4DPOA 4K4SA 2MZ1A 4NZ0A 5EUHA 4ZA1A 4ELUA 1RT6B 2G0CA 5AXLA 4C2MA 2AQ4A 5KFNA 4J9VA 2UXBJ 3TNVA 5GAEI 3RB0A 4ENOA 3QSIA 1G1XA 2VPYB 1CS4B 4QW9A 5CAAA 3BR8A 4AE5A 3PHTA 4YR2A 2AYBA 4FPIA 4I0WA 1JLQB 2PGCA 4P52A 2HYIB 2J7WA 1DTQA 2OP5A 4AT1B 3SCLE 1BUXA 1M5HA 3E01A 5C2GA 1R89A 2XO7A 4OJGA 3ET6B 1X0PA 3HHKA 1CC7A 1XWLA 1UKUA 3FEYB 2Y3YA 4RO0A 2LDIA 2M2BA 1S10A 4A48A 2V69A 1S77D 2JLGA 3R5CA 3R5GA 4EEYA 2Z8QA 1Q7YT 2J76E 1U1MA 3M8QB 2BE2B 3GR0A 4TXSA 2D3UA 3LALA 5L46A 5KFKA 1FNMA 4YB1P 4ECYA 1TTHB 2EPIA 5K8OA 2ASYA 3QRRA 2X7IA 3DN9A 2UVVA 2CIMA 2KZZA 1VI7A 2FIUA 3TX0A 3V6HA 3C16A 5E3AA 1U8WA 1G2EA 4TLQA 3CC4S 3OPKA 2CJYB 3CW2C 2GS8A 3HSJA 2CYYA 2IDEA 1IBMJ 3W63A 1U1QA 3OXGA 2XEXA 4QPXA 2EG1A 1HNWF 4KBIA 1RT6A 1CPZA 2QLWA 4RNFA 1XMQJ 4OZ2A 3DOKB 3GPAA 1U1LA 3NAHA 1H38A 1LV5A 4MJKA 6FDRA 1HNXJ 3C14A 2V2KA 2B8QA 2HS4A 1JLQA 3LP1B 5FLXU 1BHNA 2NSCA 2KDOA 2UP1A 2ZBIA 2ATCB 3DMJA 4YFUA 4ICLB 2MZSA 3L09A 4OI2A 3MECB 4DL2A 3ET6A 2K7JA 5GVQA 5B0CA 5KT2A 2BA9A 4ZITA 4ED1A 1TUVA 4TNOA 3M1VB 1DQ8A 5KOXA 5DGBA 3M8QA 2VG5B 4QU7A 2IYGA 4CH1A 5JMNA 1FTCA 1L3KA 4V19J 5CXTA 2BRLA 3MPDA 3ELHA 2ZM6F 4DS5A 2ZD1B 1UPPA 2YTCA 1SXLA 2PSZA 4CRJA 2L9DA 3O2IA 2XMMA 4QYRA 4ES1A 4MTPA 2M4MA 3UR0A 3CDEA 5KT3A 1TU0B 4N7TA 3QSYB 1S57A 4K8RA 4MIAA 4UOGA 1TK8A 3BZQA 3MMBB 3R9LA 3FMBA 1H98A 5C7PA 5KG3A 3DOKA 5A0YB 3DFEA 2D7SA 3I5BA 3J80Y 3TW0A 1LFPA 2PI5A 2MSTA 2HHSA 4IOAQ 1SH0A 3RBZA 2C2NA 2O3DA 3ZTQA 3D4JA 2MJUA 4OZ5A 4LF2A 2C3YA 4LF5F 3LP1A 4OV1A 3W8PA 5A8RB 3W9IA 1QSSA 4QWAA 4URQU 3DNCA 3ZTPA 3MECA 4URSA 3KDOA 2C3MA 4C8MA 1NKEA 4CDIA 2YBVA 3MGJA 2EC0A 1AXQA 1CEZA 5KFOA 1SJRA 1SKRA 3M1VA 1FCAA 1F5CA 1V3RA 3HI9A 3EVWA 2VG5A 1NB2A 1FDAA 3H2LA 3M6UA 1XC9A 2XLKA 2KKHA 3AQOA 2HNDB 4CZCA 1BQXA 3BREA 2QFJA 3CD5A 3FCVA 3NWGA 3J7A1 1E6YA 3VGUA 4KV8B 2C2ZB 2KM8B 2UXBF 3H8YA 3GYNA 2WAQD 3OR2B 4RR5A 2PD1A 4OHZA 3SDEB 4HEA9 3ADAC 3UD4P 3T41A 1OYDA 4F4ZA 1VQNS 4I67A 5K8NA 4ZPVR 1CJUB 1G3OA 4QW8A 5KT5A 4IG3B 4WCEQ 5AJ3J 3MMBA 1RU1A 2YKMA 3U1MA 4MKAA 4LFAJ 2V2ZA 3DRRB 4MIWA 5A0YA 2FHJD 3H5YA 2MQNA 2OPQB 1JB0C 3R97A 1Y4ZB 1VQ8S 1YJWS 1T9XA 2XO6A 1FRKA 1TL7B 2E1MC 2N7CA 5F9NA 5LMNJ 2R8JA 4ILRA 2ZITA 1QAYA 4ZIWA 3QJLA 2DHAA 2HVEA 3RR8A 1ZM2A 3CCUS 2WBMA 1NEEA 4UQGA 4FXDA 3IWNC 3EPIA 1UJ5A 4EWTA 2ZHAA 1NKCA 4WBFA 5C42B 4WIQA 3C3LA 3MM8B 4WFAQ 1IBMF 2HNDA 4F4WA 2P6SA 3VGVA 3GV5B 5L9XA 2IRUA 3C66A 4NLPA 4FKYA 2VPXB 4KV8A 1XMQF 3MMCB 2UUTA 1TKZB 1V6HA 3TJ8A 1XIQA 3RRKA 3GG1A 1VLOA 1MG7A 1OYEA 3VGSA 4DX6A 2QEXS 1HL6A 4B9LA 1L3TA 2SXLA 2OMLA 2BW7A 1Q81T 2Y1IA 1HD1A 3BSAA 3V2UC 1YKWA 4IG3A 1SC3B 8ATCB 3JSYA 4B9UA 3RBDA 4MIBA 3N01A 2L41A 2O67A 2AU0A 1LWEB 2OPQA 1JKHB 3HSZA 2EI5A 4B17A 1FE0A 2B4UA 2C2MB 4DQIA 1SIZA 3M9MB 4YS2A 1TL7A 5KFDA 3GILA 2XSJB 4DJBA 2W01A 3OHBA 1BQMB 1Q8BA 4C7QA 4P75A 1F0XA 1YSJA 3CJ5A 3T5KA 4IR9A 3AD9C 3HX9A 2OPRA 3NS5A 3ZTSA 5D4NA 3QT7A 2XY5A 3NNAA 3CCMS 3K5NA 1DQ9A 4IFYA 2ZZMA 5C42A 2X1AA 4DPTA 1CLFA 5DDPC 2QN6B 3MM8A 3T9NA 2DK2A 2E1PA 2JEJA 5IFMA 3PW4A 3DOMB 3E8OA 4R0EA 3CO0P 4EO8A 1RHUB 5C2CA 3MTJA 3AA9A 1TKZA 4A47A 3UD3P 5H9FJ 5KAKA 2GQ2A 5HVGA 3CD7A 1UFLA 4ED3A 3JSRA 4D3GA 1JIHA 5FJ4A 3KK1B 3EDRB 4QJVA 1Y11A 3G6XA 1V5VA 3CDBA 4J9OA 2R8KA 1NPKA 2KH9A 2AF6A 3EX7B 1S9GA 2VFSA 1RHKB 5EX3A 1H3DA 3GJRB 1LWEA 1FVQA 5KOWA 2BE7D 1M5KC 3PG9A 1MMDA 3TA1A 3NKYA 4DV3J 4WKYA 2NS1B 1UJ6A 4GKJF 3OFFA 5HMZA 3G82A 1U26A 4J9KA 2F8MA 1VQ7S 1X60A 1WOSA 1ZM4A 4J5OA 4EGLA 1JLGB 4C8KA 2DHHA 3PX0A 5IC6B 2GHPA 4LFCF 3W9HA 1XTZA 1DRZA 2OIHA 3OSNA 4OZ3A 4KPYA 1HBMA 1RTDB 2ABYA 2HMIB 2GJ2A 2V4RA 5AE3A 1HQEB 3KHGA 3G4SS 1QD1A 3AJ1A 4JOUA 2CNLB 3BKTA 4LQ3A 1HHSA 2GJIA 4DUZJ 2CQ4A 2ZVSA 4XDDA 3VHQA 2J0QD 4RUCA 1KHVA 3DOMA 3NNCA 3KJFB 5AJ3F 3VAKA 3M05A 2ZEJA 2UUCF 2RIJA 3JSMB 2R2SA 3FRZA 4NLVA 4WU3A 5C24B 3I96A 1WG1A 1H2VZ 4M95A 1X31C 2GQCA 2B8PA 5U47A 2MZRA 2CRLA 2UUAJ 5KTQA 2H9ZA 2J5AA 2GX8A 4USUA 4MMOA 3AB2B 3MM6B 5DM7Q 1KONA 4ZVUB 2Y0BB 2EWHA 3X1LB 2C3PA 4PWUA 2WVEA 1UW9A 2RUSA 4DHVA 3JQKA 4ANDA 2DO4A 5DJBA 3ILJA 4X65F 3PKYA 4DV0J 3THPA 3W5ZA 3DU6A 1HW9A 1SJ1A 2AEJA 2M7SA 1C4AA 3OTDA 1N0UA 1TKTB 1CULB 2J9DA 2ZUGA 1JLEB 2EC2A 1TAUA 2HVZA 3D68A 2A0FB 1RYRA 1YBUA 4F2SA 3VQSA 2PC6A 5GMEA 4GO7X 1MWZA 5IS2A 1NB7A 2QLFB 4UTGA 1P27B 5HAOA 2HPUA 3A8KA 2W1BA 1NRKA 2LLZA 3M8YA 1RTDA 5B08A 1GNKA 5HJXA 1H7WA 2IM2A 1TP7A 1MW7A 3OJUA 1QJHA 4EZ6A 3I4HX 2GIRA 2DCUB 3MR7A 3KNGA 3CGIA 1BXNA 4JI1J 1PAEX 2DD8S 2V9KA 1S9EB 3IC1A 3BGRB 4L72B 3HHNB 3G2XA 5KFTA 3UCGA 3MAAA 2OTJS 2JRSA 3JSMA 2GV1A 3ZZUA 4JI8J 5C24A 1RUSA 1KN6A 4YMEA 1QE1A 1VRUB 1OY6A 4OJ1A 3CJQA 2OLWA 2W4CA 1NPRA 2ASJA 4CLTA 2YH0A 5KFQA 3MM6A 4LSLB 1XK8A 1KLMB 1S0VA 2F9DA 3QBCA 3UD5A 2E1RA 5GADI 4LRAA 3KG0A 8AT1B 5GAEU 4WFNQ 2YKAA 2J7KA 5HK4A 3P3DA 2F9JA 1IR0A 5HATA 2BRKA 3UNGC 5F8JA 1D8YA 1XBWA 5AE1A 1KBRA 3QLHB 1S7HA 4KH0B 1JLEA 1X5TA 2F65A 1N5YB 2XC9A 2MKYA 3NWRA 7FDRA 4ZLPA 2J8SA 2DH9A 4L75A 2HIQA 2E66A 2KN4A 1TQLA 3TVYA 3TAMB 2V8VA 3EXCX 5M2PA 3MOZA 4QWCA 3D54A 5IC4B 5KFUA 2QA4G 2W24A 5HQLA 1NSPA 1YJNS 2RS8A 3ZZ0A 2W4DA 2IBOA 5DDOC 3KLFA 1IM6A 3FUYA 1TMMA 3WDOA 3BGRA 4M5KA 4GMKA 4U7UD 2LA6A 2HBYB 4R0JA 2QMUB 1H7XA 2RQ4A 1WELA 1FRIA 4DV3F 1VRUA 3ILOA 3TA2A 2LQBA 3IP0A 1SIWB 1TKXA 3MM9B 1HIYA 4LSLA 1R8CA 1IXKA 1AT1B 4RWXA 1S1TB 3BDPA 1B0TA 2VV5A 2CPXA 3DRYA 1S0OA 3SI8A 2CVEA 2W2MP 4ZP8A 5THWA 4MAKA 2ZBPA 1ACMB 4O23A 4DV1J 1UPMB 2BYCA 2JC0A 2HNZA 2D3OR 4KH1B 1NK7A 2E7XA 3PRDA 4ZJQA 5I42B 3HVAA 5CZVA 4XIUA 4LT6A 4PKDB 1N5YA 2J9DE 3OTBA 2NUHA 4DUZF 2RRNA 4V1Ak 4KJIA 4OYMA 1S1UA 3HVWA 2FVQA 2P9EA 3AQPA 3D0IE 2K1RB 2YPZA 2H5EA 3ENWA 4U6PA 4B08A 5C25A 4X62J 3J81j 4DOZA 1KNZA 3VTIA 2UUAF 1GMWA 1X9MA 2WK4A 2IIHA 5I3UB 3OL7A 5JUMA 1O6XA 3VALA 2GW8A 2BUNA 2W2QP 4G3IA 4CH7A 1EAYC 1JJ4A 5DDRC 1RT4A 5A2QU 1XJWB 4DV0F 1FO1A 2QX0A 2HHXA 2BJEA 1SL2A 2QO3A 1YI2S 4Y2CA 3H40A 3QRPA 3MM9A 2MKKA 1UWBA 1S1TA 3MEGB 1R8AA 4XAKA 1FWPA 2XY7A 4NOHA 2O5DA 5K8PA 3PR4A 2EVZA 1XR7A 4JI6J 4F4KA 4ED4A 4F3OA 1NDCA 4ZMMA 3TQEA 2MJNA 3LP2B 1SKSA 4XO0A 5I42A 5GMKa 1X5OA 2ATLA 1ZOTA 3IFEA 4J9SA 2GMHA 2G2YA 4RL1A 2HQGA 1YTYA 4JI1F 1RTZA 3HM9A 3ZXWA 1MU2A 5E3PA 1HQ2A 4I1TA 4DMZA 1RU2A 2K1RA 3BBFA 2V0NA 2YKPA 2PDAA 5GAHI 3OL9A 4ED2A 2XMAA 1UEUA 2O1PA 3R6GB 3KHRA 2Y1JA 4CLWA 5J2PB 4JV2A 2IJRA 2BJ1A 2VBWA 2ZWPA 5I3UA 3SCJE 1CQMA 3BV8A 2UXDJ 4M5HA 1HQUB 4DLGA 4IUFA 3PEHA 4DR4J 4AL6A 1X4AA 3DU5A 1NMEB 2QRRA 5K9FA 3HJVA 3MUTP 2AV5A 3Q8SB 1NXIA 1QUPA 2CFXA 3N5FA 3MR3A 3KKFA 2OSQA 4PYDA 2MPUA 4K2XA 3RB4A 1YLXA 2HWTA 3T5HA 2HFOA 2JDJA 1Y9OA 3BGUA 3TEHB 2N3OA 2DNMA 1GTEA 2HHTA 3MEGA 2X1GA 1X4FA 2DR8A 1C4CA 3L7OA 3D0GE 2DKOB 3GQCA 4WPAA 1R8HA 2XNQA 2QGFB 1YJ9S 2XI2A 3LP2A 2VONA 5B0GA 1FFSB 3MMAB 2V63A 1J5OA 2W7AA 3ZZRA 1MSWD 3OV7A 4EFAC 2QE5A 5KFIA 2DNHA 2MY8A 5IT4A 2DNYA 2OFGX 3M8ZA 5KFFA 1RAGB 4CLSA 1IKXB 3I5AA 3C8YA 1NJWA 3C19A 3PX4A 5LJ5Y 3RAXA 2K2PA 5CABA 5HQMA 5JXSA 4JV0A 4IOBA 4I69A 5D15A 1HWJA 2W2NP 1VQSA 2BOAA 5DG7A 5J2PA 3ZTRA 4J90A 3HVTB 1OY9A 3W1YC 3NS7B 1QAXA 4Y2IA 5CCLA 1WWHA 2LEBA 2B4VA 2M9KA 2F7VA 4C0HA 4IFVB 3TZZA 4DV1F 1VQ6S 3FBEA 1WF0A 2IMWP 3I32A 3VQTA 2R42A 1NZAA 2ZKUA 1M1KT 5IQQA 2D41A 2HWHA 3D6MB 1VISA 1ULRA 5GMDA 3HP6A 4AL5A 2CNKB 1JMTA 2HFNA 1X4DA 1I1GA 1TL3B 4I6AA 3S1TA 2YKNB 1PGZA 2B0GA 3JXOA 2B51A 4IH6A 2NXUA 4UQTA 3GYXB 4TKTA 4DS4A 4A8YA 3OR1A 5KT6A 3J7Z5 4P6QA 4C3MA 1Y5NB 2QV6A 5D3GA 4X62F 3O1LA 5ITHA 2PT0A 2XBPA 1IM4A 3LWMA 1LKZA 2RSQA 1U6ZA 2JZ5A 2MKJA 2WVFA 5L38A 4F67A 3QRQA 2EXUA 2C2DA 1VJQA 3CJKB 4DPYA 5BJRA 2CJBA 2LFVA 1Q4RA 2A6OA 4ELVA 1OS5A 1QAJA 1ZPWX 1KRPA 3H5UA 2F63A 3HF5A 5J2MA 1S99A 3UDEA 1GTHA 2F1FA 4HI2A 4IFVA 1R43A 1YHQS 3RJMB 1WKKA 4ED6A 4KHRA 4JI6F 4ZVGA 3M6XA 5HSPA 2PEBA 1FF2A 4O3QA 3V4MA 1UVIA 2V94A 2OH2A 5BYSA 4HHUA 1RDRA 3DLHA 4KKOB 1ZZNA 1AROP 1HWUA 2JLEA 3NCQA 3FSYA 1TL3A 2YKNA 3PTWA 1W2IA 4AXJA 4ZVRB 5B09A 1S6QB 4CIOA 2IMOA 3IM9A 4OJ3A 2HSEB 1CJVB 3PXGa 3L3CA 3QIDA 4WFXA 2L9WA 4NLWA 2B4PA 1UEVA 1QLNA 4ELTA 3T1YF 4FXWA 5DZ7A 3KK2A 4IH5A 3MAHA 2Q79A 3DLKA 2Y8WA 3EE3A 2UXDF 2AKWB 2F5GA 1AB8A 4DR4F 4IDKB 2R7WA 2CG4A 1Q1KA 3ZNJ1 4A4JA 3KUHA 1N4LA 3DI6A 5FD1A 2V67A 1RGVA 1X4HA 1HHTP 1VBYA 4DCJB 5D4OA 5IM0B 2PA3A 2I38A 4C11B 1VMBA 1IVZA 3PW0A 3HSGA 4W4MA 1RTHA 5B0DA 3H5SA 2FYXA 2ZH6A 2FVPA 2QIFA 3OTOJ 4ZLJA 3SYZA 2DGTA 1K1SA 5CYMB 4M5NA 5DRKA 4C8NA 2W25A 3AD7C 3NOCA 5ETVA 5K8MA 3NY0A 1HNZJ 1EARA 1VQKS 3EZ5A 1GMVA 3SV4A 4W90B 4KKOA 2WSEC 3DOLB 3K7RA 2PA8D 1U6FA 1QAIA 4CT9A 3EJMA 4RU9A 2WCXA 1MWYA 4F8RA 3QGHA 3RU0A 1S6QA 4U95A 1VS3A 1FDNA 2HBZB 1FNXH 4Y6IA 1ZAXA 2J9CA 1VQMS 2C2OB 2CQ0A 2GO9A 3CCRS 1ZTWA 1WEZA 3IRXB 4L6V3 4B9TA 1N32F 1XERA 4DV2F 4DFPA 1FJ7A 3MM5B 4KYZA 2ZBQA 3HHDA 1M90T 4FS1A 2XGPA 3CDAA 2XS5A 2M70A 2FJDB 3LAKA 5EHHA 2CPEA 4Q44A 1F5AA 1UAWA 3HHLC 1TK5A 3R8YA 2BM1A 2NXNA 1NLKL 4DFJA 1RI7A 2ZJPQ 1VC0A 1B64A 4PR6A 5IV3A 5IM0A 4C11A 1N48A 4DPUA 1XR6A 5BYQA 2YKOA 4USJC 4ZP9A 1LOUA 1RWKB 3FFIB 2ZBRA 4DL5A 3CCVS 2C3OA 2KT3A 1TKDA 2R7OA 2QA1A 2XMWA 3EGWB 5CYMA 1OIAA 3IR7B 2W4PA 1UFKA 5KFGA 3GV8B 2AD9A 4PYAA 3FEZA 2CWXA 5D6GA 5GADU 2LECA 3FVYA 4J9NA 3DOLA 2R8GA 3FCWA 1NK4A 2L48A 3GV7B 3PW5A 3EXYA 3IS9B 4KAIA 1WI8A 2XMUA 3R2DJ 1T95A 1BD6A 4CNZA 3TX8A 4H4MB 5KFWA 3TUZC 1U2FA 1TVRB 2ZH5A 3FZ2A 1UZHA 1R3NA 2RDIA 3IRXA 3VR1A 5HL7Q 3HJFA 4KSEB 3MM5A 1WD6A 2FGOA 4G1QA 5KFYA 3TZXA 1UJ4A 5D8HB 4KGXB 3BSNA 4DV5F 2WW4A 1UVKA 3TRGA 1VLYA 2H4YB 3O44A 3G6ES 2MZTA 2DGWA 4RUHA 2CZ4A 1XMBA 1I5OB 3DHWC 2BXJA 3HD2A 2XYPB 3GWCA 4JI3J 2Z2ZA 3GIRA 3W3SA 1FKOB 4PCQA 3FQLA 3Q8VA 4ZVTB 4DSKA 1EQ0A 2CA9A 3SCIE 3DRXA 3AH6A 2R7XA 1U09A 2GNKA 2VBYA 2VQEJ 4M5IA 2FJBB 4ID5B 1TL4A 1WOPA 4B3SJ 3LO3A 1HYSB 1AYEA 4TY8B 4B9VA 1RBOB 3KLVA 1HR0F 5E3CA 3EGVA 2CQBA 2V2VA 1SC6A 3QPIA 3K17A 1IQZA 2D3O1 1QTMA 1VK3A 3AOAA 1BC6A 3AOCA 4PAAA 1NPPA 1LWFB 1S49A 3PYFA 3J80U 1SC4B 4OI3A 1PO6A 2ACYA 1BWVA 4H4MA 1KVIA 2FLNA 3TARA 2JVRA 1TVRA 1C1BB 1R0CB 4J7CA 3SFGA 2CWKA 4F2RA 5DGAA 5DDQC 3RBXA 2ROEA 3QGIA 1U24A 1NAQA 2LDYA 1SUQB 5JVGQ 4Z7CA 2EKNA 2PMZD 4DR1J 4IG0B 1RHJB 2E44A 3EGZA 4LSNA 1WG4A 3G96A 1Q53A 4P2MA 4HTJA 4WZMA 3OTOF 4HT5A 4OI1A 4FBTA 3A8EA 2CPFA 4CLKA 5LMUJ 1YVFA 2VFVA 4L3KA 1HNZF 5A2QY 3X3UA 4DN0A 2BM0A 4NI2A 2MQPA 5KFSA 2N82B 3CC2S 3DM2A 2M3DA 2RU3A 3DYAA 1X0FA 3OJSA 2GVDA 4JV5F 4OX7A 2VKRA 3VAIA 1DAXA 2CQGA 2RB7A 3V5RA 1N36J 3L4BC 4DWIA 1S0NA 2DH7A 4ID5A 1HARA 3N28A 4CTAA 2VB6A 4Y2AA 2W9BB 4ZPWR 3OFHA 3MPYA 2FPHX 4TY8A 3G86A 4DV7J 3P8BB 4F3QA 4LR7A 5ETNA 4LBPA 4PXCA 3W9JA 5F8NA 1WC6A 2RF2B 5DLGA 4CO5A 1LWFA 3M6WA 3FSIA 2BACA 5HMYA 5I3QA 4G65A 3C15B 3WBZA 1SQGA 3MUMP 1NK6A 1Q7LB 5HROA 1C1BA 1R0AB 4QBUA 2PIIA 3A3NB 2G0JA 2P9GA 4KY3A 1SUQA 3ISND 1GXLA 3D5MA 3POTB 1EJ7L 2ZBCA 4IG0A 2J6TA 3NMRA 3R5BA 5J2QA 5L39A 3CMQA 3V6DB 4W92B 3Q0AA 2EW9A 3KMSA 1KC8T 3UCUP 3MCOA 1UEKA 2AGOA 3KHLA 2RNEA 1VOMA 4C6AA 4FP9A 3OSPA 2E5JA 1FVSA 2Q3PA 4A8XA 1O51A 4ITSA 1N5TA 5B0EA 3OW2R 1IQTA 1VR6A 5HANA 4W98A 5D4PA 2GIFA 1TFYA 3AOBA 4NCGA 2W9BA 3KJVB 1UVLA 3Q2TC 2QMXA 5J1NA 1B4SA 1GT8A 2NPFA 2X1BA 3BN7A 3RYLA 2YH1A 3P45B 3W5XA 2C1EB 5B0FA 2XG8A 3IM8A 2RF2A 2ZOMA 4JP8A 3CCSS 4ILMA 2ROPA 3K5MA 4K4VA 1U1PA 1RTIB 1NNDA 2DTJA 2HQDA 3C15A 1FDBA 2G0IA 4LQ9A 3Q8UA 5I4MA 4A46A 1R0AA 5CQGA 2ASDA 4JI3F 4HDHA 4K7QA 4OYPA 1U25A 4FF4A 4DR7J 2ZE2B 2R7SA 5DO2A 2P6TA 2KYXA 2XNRA 4RPFA 2VH7A 4Q5VA 4UUXA 3CUNA 2HS3A 4OJHA 3MEDB 2CADA 4E98A 4KFBB 4B3SF 1RLCL 4K2JA 4XPCA 3PFEA 1U47A 1PBUA 1T3NA 2HRTA 4ECVA 3G6YA 4TVAB 1UVMA 3EM1A 4NCBA 1X4GA 1SC1B 3JB9k 2Y1LB 4NPOA 5ETMA 3DLJA 1B0PA 3PVXA 2RRAA 4NCAA 2V5HG 1OSDA 3DRSB 2GC8A 4N8OA 2QL7B 1N88A 4QR1A 3NGSA 2XS2A 2YNIB 4TY9A 1D8ZA 3MOJB 1NH7A 4LIRA 3KJVA 1ITPA 1Q0NA 1N0VC 3JSBA 3V6JA 3C6UB 4DQSA 1T9WA 4KTQA 4DLEA 2L9NA 5L9NA 2VA3A 3ZZYA 3PACA 2AYEA 1S1WA 2RHQB 2O66A 3M9NB 1RTIA 3AJ2A 1VIXA 3DC2A 4KC5A 2IRXA 2FQQB 2C2EA 2MQOA 4PZVA 4CLZA 2RHSB 4BHQA 2KZMA 2IJNA 2VODA 3G87A 3NXZA 3FBBA 5LMUF 4QCLA 1U0SA 1YGYA 2ALZA 2ZE2A 4DSEA 1NHKL 3HZEA 4IQMA 3V6KA 1YX2A 4UF4A 2DXEA 3MEDA 2WTFA 4DG1B 5H1SV 1N36F 1N54B 4OYOA 4P9SA 4A8MP 2CNOB 4KFBA 1RWOB 3BGLA 3S7RA 4H4OB 5ETPA 4WZQA 1I94J 2YWWA 2I6WA 3BEGB 3FMWA 4EMDA 3KTQA 2NR0A 2JOQA 1X5PA 4DV7F 4B02A 3MURP 2CUYA 1YIJS 3TOQA 1DBDA 1T9UA 3CD0A 4CLPA 2CPHA 5CZXA 3CPWR 1TELA 3CMAS 3IRWP 1RA7A 4E2FB 3DRSA 2B43A 4IO1A 4WP9A 1RABB 4RNMA 3G9CA 5ETSA 4LVOP 1K73T 4B3OB 4ZVEA 1RKIA 4OV6A 1DHMA 4DDFA 4DR5J 1LXNA 3HPOA 4N47A 3CCTA 4DSFA 3VAJA 2KU7A 4IR1A 2EG2A 4EK2A 4DUYJ 3FEXB 4DN9A 2QJ3A 5ETKA 3TWZA 1IWAA 4OZNA 2GMLA 2KXHA 4DL4A 3CJ0A 4MKYA 2K06A 4NA1A 5HP1B 3DRPB 3QFHA 4KGMA 2RILA 4YY3J 3D67A 2K3IA 2QG9B 1D9DA 2CXEA 4K4WA 5B0BA 1HWIA 4NX9A 1T94A 3EVMA 1FX2A 1HLWA 5HJYA 4K50A 2NSBA 1REGX 1WHYA 1DLOA 3D2WA 1SB6A 2RVJA 4H4OA 3PZPA 4B3TJ 1ZBTA 1Z4UA 4LF8F 4A8QA 1HMVB 2BQUA 6AT1B 2JFKA 1LXJA 2UUBJ 4RWWA 4DL7A 2WB4A 1FKAF 3M4XA 1S1XB 2AJ4A 1BLUA 2F3JA 3TQ1A 4PWDB 2IA0A 2OEJA 3PR5B 4JBCA 2XZTB 4JI2J 4ES2A 1RAEB 1G4CA 1U8SA 4B3OA 2J9EA 2AGPA 2FD2A 5D0EA 4DR7F 2JEIA 1FRLA 3LWLA 1KEKA 1F3VA 4ZP7A 1FWLA 1RT3B 2OD6A 1URRA 1CJKA 3K8VA 4LSZB 4BWJA 3G8SA 1VQ4S 4DBQA 2QLBB 5KFPA 3OD2A 5HP1A 4RNNA 2GZOA 1TV6B 3OLAA 2CG8A 3TZWA 3OQ2A 5DLFA 3R3TA 3BQ1A 2X3DA 2ZH7A 2UXCF 1REVA 3UPFA 4EBCA 2YNGB 2OUGA 3BQ0A 1S4FA 5KG4A 5D0GA 4DX7A 1X5SA 3K8WA 2J8AA 4OZ0A 2LXUA 4IRDA 4ZN1A 1HMVA 1JXLA 2YX7A 3NGKA 2VDIA 2XWYA 4YR0A 2RDJA 3IN5A 1YBTA 3H98A 1U7LA 1HNIB 1Q82T 1ZAVA 4EBEA 1S1XA 4OX6A 3K5OA 4YP3A 3LQVA 1S4EA 4PWDA 2MGZB 2DGSA 3KFWX 2BKNA 3FKBA 2E5IA 4E0DA 4LR8A 1SCJB 4QR2A 3QFWA 2W8LA 2PMHA 4F7VA 2OFHX 4PABA 4ZDNA 1IN0A 1YJUA 1RWVB 3I4PA 5D0HA 1CS4A 4NEYA 3OVAA 1RSCA 1RT3A 2OKQA 4Q8FA 3UO0A 5IV4A 3HT0A 5D4LA 2AZ3A 1FT8A 5SZTA 2Z56B 4A8WA 1I94F 3ZFVA 4LFBF 3ENVA 3CMES 2Y9HA 4C8OA 1QM9A 1TV6A 3LUYA 3K0JA 5KT4A 2VOPA 3TVKA 2IM0A 1U48A 4HACB 1SH2A 1HNVB 4M94A 2DNRA 2FHKA 2Z30B 2DB1A 1N5VA 4J9QA 4OHYA 2BE2A 4FZVA 3AT1B 4K59A 1OO0B 2CJXB 1YRXA 2Q6CA 3V4IB 3MPWA 2DNKA 5CCMA 3ZZPA 4A8KA 3UNYA 2EFOA 3OXLA 2WB1D 1KKHA 4M5DB 4JI0J 1F9FA 4DR5F 4J91A 2X1FA 3AXMA 1HNIA 4RBUA 2H65B 1YJTA 3M8SA 4ZCIA 4X4UA 2DNNA 1TUWA 2ZJRQ 4DUYF 2MGZA 5IQ6A 2YPYA 2JL9A 5CH7B 3CCLS 3CVKA 1KFSA 3Q2SC 1C0UB 1VIOA 4LIWA 4X4SA 4BC9A 4TQSA 2OELA 2HHHJ 4YY3F 2NYIA 1VQOS 4CYUB 1ELOA 2HFVA 2LU1A 1GXUA 3PW2A 1D9AA 2DRBA 1RWUA 4ETZA 4AD6A 5C5JA 1W7WA 5GAGU 2VC0A 2KJWA 2KTQA 4NZ6A 3B4DA 2MZQA 5KG1A 3RW6A 4ICLA 3HHLB 4B3TF 4OHVA 1D1UA 2BV3A 3K58A 2KT5A 3H5XA 3UVJB 5F8IA 4NLGA 1D3WA 4P7VA 1SKUB 5K14B 1Q16B 3BQ2A 1FD2A 4AL7A 4HACA 2HRYA 4GKJJ 1HNVA 2UUBF 2R7VA 1CQNA 1MMLA 4OYAA 4L3NA 2ZH8A 1A6LA 3UE2A 3V4IA 4LFCJ 2R2TA 4JI2F 4Q8EA 2ZD1A 5E2QA 1QSYA 4S0MA 1KD1T 1A9NB 1O8BA 3MHYA 1LK7A 1H0HB 3CNQP 4M5DA 1LWXA 4K4ZA 2BE9B 3PV8A 3PYGA 1E6VB 1VJWA 1JWWA 4H4KA 3I5CA 2VPZB 2V2QA 5LSRA 2RQCA 5HBMB 1R27B 3TVZA 3W8GA 1VGYA 5KG5A 2UUCJ 1C0UA 2MTLA 1RYSA 2E29A 1IR1A 2G9OA 4E8UA 2H3EB 3KLGB 3M2VB 1FWKA 1V9OA 1BQNB 2M8HA 4CYUA 2POKA 5L1LA 1VCTA 3TP2A 3KNAA 1RAAB 2M5YA 4OL8A 2WBRA 2GAGC 2VJUA 4RLEA 4CO3A 3EPGA 5A8RA 2QL9B 2R3VA 3HHLA 2HKEA 2HRUA 4X65J 3UVJA 4BDPA 2ALYB 5K14A 4M5MA 2MLZA 1CBKA 1PJ6A 2KVQE 4EBDA 2YNHB 2J0XA 2DPIA 4WYWA 2HHVA 2MQLA 4MK9A 1JXVA 5KG2A 2Z2LA 3QAUA 4PXEA 1IBLJ 2LQJA 2DHXA 2B56A 2I1RA 4WK1A 1JJCB 4ZVPB 4ER8A 4NLQA 1HBUB 3I9V9 1T7PA 3G8QA 1FJCA 3OR2A 2PEHA 1VBKA 5B7WA 1WSRA 4DR2F 2GO8A 3SDEA 1GH8A 3EDQB 1E6VA 3NGUA 3THTA 5EDWA 3CCES 1CJUA 4GKKF 3VGTA 2E5GA 2R9LA 2HNYB 5HBMA 3DLBA 3LTOA 3DRRA 2E5HA 4KGKA 3QQCD 2QC3A 3HZGA 3NP5A 4I56A 3RRGA 2GHVC 1BQNA 1ZYQA 2XMJA 1WC0A 5IT0A 2I5JB 2VFRA 4ATNA 2Q66A 1S97A 1RJJA 4F02A 1FRMA 5BR8J 4CLUA 5KFBA 2KHDA 4F50A 4ZVSB 3H4BA 4K0KF 3MR5A 3D6TB 3VWSA 2DR5A 3SSSA 3KJQB 1IJEB 1B7FA 4JI0F 2YNHA 4OZLA 3FCHA 1UFWA 3W2VB 1IKYB 1VDHA 2HAIA 4GVBB 3IBCB 3MWBA 1U2CA 2BKOA 3CEDA 3TZYA 4I4BA 3JTOA 4J9UE 1Y7PA 2DNPA 3I55S 2FC9A 2NLWA 2W7OA 1D0EA 4KB7A 3M8PB 1U2RA 1WEYA 1K1QA 4DV4J 2CZVC 4CLFA 2OI2A 3MMCA 2NYHA 4USVA 1I6JA 1NK9A 1Z2ZA 4ZCLA 1T9YA 2BJ9A 4RW9B 2HHHF 1LQ9A 2DEIA 1HWLA 2NXJA 3IG1B 3H42A 5AXKA 4WXOA 4NEZA 4DEZA 3LW5C 4J37A 2DGQA 6FD1A 1PSDA 2HNYA 4HYKA 2D1CA 1J27A 3K2YA 3GYGA 1FFGB 4ZPTR 3T9ZA 1FK9B 4ZPDA 3VVUA 2FY1A 2YQ3A 3L9ZA 4IOCQ 4QYZJ 4TLRA 1JKHA 3FC9A 4KQZA 2WONB 7AT1B 2I5JA 3UWTA 2IVYA 5HVFA 3TAPA 2QLJB 4ED8A 3C46A 3CJTA 2XSJA 1Y5LB 2KJVA 4M63A 1BQMA 3H7HB 1D09B 4NMLA 1QY7A 1B0VA 3EGNA 4QZVB 3DHXA 3GFYA 2A2CA 2YVSA 4QIFA 3CTRA 1NO8A 1PC5A 3CCWA 1PCAA 4ZJOA 4QWDA 3W2VA 1TAQA 4OI0A 1IKYA 4GVBA 1TMJA 4FF3A 4PG5A 3WC2A 1UP1A 2GQQA 3JAMU 3PCOB 4PPZA 5KFRA 2JFDA 2Y0SD 1TL1B 4OYXA 1J2VA 4EZ9A 1WC3A 2LXFA 4MFBB 4ECRA 3M8PA 4QOTA 2MMYA 3D1HA 3EZUA 5LSLA 1LFWA 1NJYA 2N4DA 3GJQB 4RW9A 3U27A 3Q8RB 4OLOA 2KHCA 4I2PB 3R2CJ 3IG1A 4O0NA 4HR2A 5F8MA 4NLUA 3C6TB 3EWGA 3KK1A 2HGMA 3NNHA 2MDAA 3GG0A 3KLIB 4D3HA 1HKAA 1EHWA 3D3CJ 5DETA 2MHNA 2XYHB 2I0XA 4G6VB 3B4MA 3QIPB 1FK9A 2RD5C 2ASLA 4CO0A 2FVSA 3GZ7A 1WF1A 1KS2A 2VFUA 4DUTA 3I82A 2W9CB 4OHXA 1U02A 2RU9A 1YWXA 1X4CA 4WFYA 5KFMA 1TUGB 4F0HA 2R8IA 1IBLF 2U2FA 1JLGA 3BYRA 3UQSA 5LT5A 3PHEA 2CDRB 4ES3A 4ECQA 2IPOB 4LUBA 3KLHB 1WHVA 2JEFA 3J7YI 1TK0A 5CA5A 1FXLA 4DL3A 5ETOA 4HHJA 1EETB 2HMIA 2EBEA 3MR6A 1HQEA 1FDDA 5D77A 3BGOP 2C22A 4NL5A 1EZZB 4DZ6A 2IC3B 5L8RC 2ZFHA 3MMJA 4I68A 4JI5F 3IR6B 3NBPB 2AJFE 1RWPB 2JVOA 1OSCA 3ETOA 4QIWD 3TI0A 1ZM3A 3VAGA 5LXRA 3ZNUA 2XZDB 3R27A 4TYBA 2EKYA 4I2PA 3C6TA 5F3TA 2HHPA 2GA7A 5CYJA 4TQRA 3KLIA 2ZH4A 5BR8F 4DPWA 3CJ4A 4QQBA 5CYQB 3QIPA 1GEHA 2HW3A 2KFYA 1DTQB 1Q5VA 2FLOA 3R5AA 2W9CA 1RWNB 5LOQA 1TKTA 1FJGJ 1OJ4A 1CULA 4KGZB 2VQFJ 3ILIA 3QT5A 3PRVA 4FVCA 3OXFA 3FGVA 1NSAA 3KLHA 2AYMA 4DV4F 3E51A 1XNRJ 1Y3KA 3SMZA 5LJ3Y 3IO1A 1EETA 1GQEA 2VU5A 1P9QC 4RNHA 1YBAA 4LF4J 1FD8A 1MN9A 2RDDA 1VQYA 4DX5A 3AHPA 2IC3A 1RCOB 1ZH5A 5F0WA 1U6BA 4QWBA 4L74A 4A8SA 3NBPA 5T7LB 1S9EA 4FDFA 2VZ9A 4B9NA 4B9MA 1L3SA 1UA1A 4WE1B 1IWGA 2J6SA 3MD3A 2MQMA 3ISZA 2PO4A 2YQ1A 5JJBA 2XGQA 4USMA 3PNIA 4Q45A 4OI6A 2VF3A 3KLEB 3WIVA 2ZDPA 3R1HA 1PBAA 3ILLA 2AHOB 1KLMA 1JJHA 3ZZOA 2HVDA 5CYQA 4ZPCA 2RH3A 1T05B 3N0VA 2AEFA 2QLXA 3C14B 3MFIA 2QMWA 4OI4A 4WWSA 1RAIB 1RQ0A 2FC8A 1CSJA 4ZKAA 3DMJB 4Y2MA 2FZGB 4QU6A 2JNJA 3B82A 3QLHA 4JV1A 4ZOSA 4C8ZA 3SSQA 4X66J 4B9SA 2V8HA 2BABA 1AUDA 1FXRA 3BPSP 2RRBA 4L76A 3O8WA 1NK0A 2PI4A 4FYVB 4DR6J 1KTVA 4C8LA 2LEAA 3TAMA 3VCDA 3TR5A 2UU9J 2R2UA 1DARA 2EK1A 4YDDB 3SIPB 1PILA 2FVRA 1N5QA 3ETMA 2XULA 5K5MA 2FB0A 2HHUA 5E0OA 2CQ2A 3U02A 2RAQA 1DTTB 3RZAA 2G1HA 2E9TA 1OPIA 5T7LA 4FXVA 4YDXA 1FXDA 1U0HB 3FBFA 3W7BA 4Y28C 3IMQJ 2ZNZA 4WE1A 1VFJA 2DNGA 2CPIA 3FNNA 1S79A 2MKCA 1BY9A 4BWMA 1FRHA 1Q79A 3QMQA 3H59A 3KLEA 3ZC4A 1J5EF 2MEWA 3MEEB 3IBFB 5DZ6A 1HD0A 2B9WA 2A10A 3MR2A 2QYCA 3HSDA 5EN1A 1UVJA 4X4TA 3CDWA 5D78A 1SV5B 1T05A 3M30B 2ILYA 2CQ1A 4F04B 2WVBA 2G13A 1B99A 3DDIA 2DPJA 4XTTA 3MCNA 4OLPA 1B3TA 1MLAA 4O3RA 1NH8A 3QT8A 4YB7A 2MYFA 3CIZA 3T6JA 3WX8A 2QSWA 1JJ2R 2NZ4A 3KOAA 3KDNA 3MDFA 3K57A 3P5BP 5E33A 3N5BA 1O5JA 3N6MA 1FNOA 1PG5B 3T1HJ 2FHMA 2HZCA 1Y10A 3US5A 4F0MA 4ECXA 2R7RA 4F36A 2R7TA 3VV2B 3F0NA 3N9UC 4NXMJ 4YUDA 4R8UB 2QYGA 1E6YB 3KUEA 3T1YJ 3GLJA 2IM3A 4NZ7A 1DTTA 4PEOA 1H2UX 1K0TA 2HQCA 4RU2A 3PIPQ 1U0HA 2VOOA 4OHWA 1RE1B 1S72S 1T02A 2HK2A 1KFDA 1S0MA 3BBBA 1KQGB 2ZWOA 2YKMB 4DCPB 1NZ8A 5KFZA 2Z0GA 2HLTA 4NE9C 3MEEA 1FJGF 1HA1A 5RUBA 5L1JA 4J9PA 3OBIA 2VQFF 2GVZB 4Q2MA 2ZH3A 3R1LA 5KFVA 2WVCA 2CJKA 2FJXA 1SV5A 2KL8A 3M30A 1ZETA 1FEHA 2WSFC 4P2FA 4C3LA 1XNRF 2KI2A 2X3GA 3CCQS 1JQGA 1RB0A 2HVIA 1FESA 2HFZA 2DXFA 3FDSA 5IZHA 1EIYB 4LF4F 2RE1A 2CNNB 1X4BA 4BCAA 2KRRA 1NDPA 4DF8A 3QATA 5ETQA 2OMOA 3B54A 2GIQA 2M52A 3VF0B 3G6VA 3RR7A 3JQJA 1YITS 4XPEA 5KG0A 2FJWA 1IR2A 1F6TA 3FZBA 2RS2A 1EX8A 3D66A 3BBCA 4IKAA 4R8UA 1HW8A 4CCHA 2OPSB 1H6KX 1N32J 2ZOFA 4DV2J 3PJXA 3B8HA 2CPZA 2J6UA 2NXCA 5A6PA 1Q8LA 2DISA 3CCJS 5LM7E 3RB3A 3NOGA 2DNZA 3ICLA 1HQUA 4RZRA 4HT7A 4FVMA 3SQOP 4KPCA 2V4JB 3L7UA 1NJZA 4KGVB 3TUPA 2BOPA 3N6NA 1EKSA 2R7UA 2P2CB 1IKWB 5KT7A 5FDLB 3ULHA 2MLXA 1AFIA 1V3SA 4UT4A 2WW8A 3E2EA 3IA0A 2GVZA 3QGPA 2V50A 3FBCA 4X66F 3GB0A 1QSLA 4ED5A 4U7CA 3NRBA 4ZVFA 3N79A 1UTAA 1ZM9A 3CJRA 4DR6F 4JUZA 1B70B 4LRFA 4EYIB 1QTNB 2UU9F 4PQUB 2FLLA 3GU0A 1VHFA 2ZH1A 1WC5A 1PJ7A 1SH3A 2W9AA 3MMAA 1WEXA 3KMQA 2XY6A 1MWQA 1N33J 2OPRB 4GRSA 3A13A 3H90A 3GIMA 5MAOA 2C2RA 4N76A 4IFYB 1IKXA 4NWBA 2OGUA 5E3QA 1RAOA 3HVRA 4ED0A 1T03B 3S01A 4J9LA 2V8GA 4C9DA 4ZVOB 4K5SA 1YZ7A 1U49A 2HS0A 1NSKL 2OPSA 5CD4H 5DG9A 2BANB 4ANCA 1ZA1B 4FPRA 3UFCX 1A7GE 3HVTA 2GHWA 3M2RB 4DV5J 3RUBL 1QVFR 2CJ9A 2GJFA 4DFKA 2KG1A 3M8RA 4DQQA 1NHVA 4Y34A 4EU0A 1HNXF 2XHWA
chains in the Genus database with same CATH topology
1WC6A 1WC4A 3C14B 4WPAA 5D0GA 1WC1A 1Y11A 3C15B 3C14A 3C16B 3R5GA 4CM2A 1AB8A 1WC5A 1TL7A 4CLLA 1AZSB 1U0HA 4USWA 4OYOA 2WZ1A 1YBTA 4P2MA 2W01A 1CJTA 5D0EA 3ET6A 3MR7A 4CLWA 4USUA 4CLYA 3G82B 4CLKA 4NI2B 4CLSA 3MAAB 1CJUB 3UVJB 4OYIA 1CJKB 4OYZA 3C15A 3G82A 4NI2A 3C16A 4P2XA 3MAAA 1CJUA 2GVDB 1CJKA 2QV6A 1FX2A 2GVZB 4CLFA 4WP8A 1AZSA 4USVA 4CM0A 2GVDA 4CLPA 4WP3A 4OYPA 5D15A 4OYAA 1CS4B 4OYMA 2BW7A 4OYWA 5D0HA 4CLTA 1CS4A 5IV3A 4P2FA 4OZ3A 4WP9A 3UVJA 4OYXA 4USTA 1WC3A 1CJVB 5D0RA 1CULB 1WC0A 1YK9A 1TL7B 1Y10A 5IV4A 4OZ2A 1FX4A 1CJVA 1U0HB 1CULA 2GVZA 1YBUA 4CLZA 1CJTB 4CLUA 3ET6B 4OYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WC6 A;  1WC4 A;  3C14 B;  4WPA A;  5D0G A;  1WC1 A;  1Y11 A;  3C15 B;  3C14 A;  3C16 B;  3R5G A;  4CM2 A;  1AB8 A;  1WC5 A;  1TL7 A;  4CLL A;  1AZS B;  1U0H A;  4USW A;  4OYO A;  2WZ1 A;  1YBT A;  4P2M A;  2W01 A;  1CJT A;  5D0E A;  3ET6 A;  3MR7 A;  4CLW A;  4USU A;  4CLY A;  3G82 B;  4CLK A;  4NI2 B;  4CLS A;  3MAA B;  1CJU B;  3UVJ B;  4OYI A;  1CJK B;  4OYZ A;  3C15 A;  3G82 A;  4NI2 A;  3C16 A;  4P2X A;  3MAA A;  1CJU A;  2GVD B;  1CJK A;  2QV6 A;  1FX2 A;  2GVZ B;  4CLF A;  4WP8 A;  1AZS A;  4USV A;  4CM0 A;  2GVD A;  4CLP A;  4WP3 A;  4OYP A;  5D15 A;  4OYA A;  1CS4 B;  4OYM A;  2BW7 A;  4OYW A;  5D0H A;  4CLT A;  1CS4 A;  5IV3 A;  4P2F A;  4OZ3 A;  4WP9 A;  3UVJ A;  4OYX A;  4UST A;  1WC3 A;  1CJV B;  5D0R A;  1CUL B;  1WC0 A;  1YK9 A;  1TL7 B;  1Y10 A;  5IV4 A;  4OZ2 A;  1FX4 A;  1CJV A;  1U0H B;  1CUL A;  2GVZ A;  1YBU A;  4CLZ A;  1CJT B;  4CLU A;  3ET6 B;  4OYB A; 
#chains in the Genus database with same CATH topology
 4CT8 A;  2BMB A;  2V4J A;  2HHW A;  1WI6 A;  1BE4 A;  4RW6 B;  5DS7 A;  2D69 A;  5KG7 A;  3H25 A;  3BO2 A;  1GMU A;  1IKW A;  3U7J A;  5FDL A;  4OMF G;  1F9E B;  1S9G B;  2BW2 A;  2GFF A;  5IWA J;  2BQ3 A;  3PX6 A;  3CD6 S;  1X7V A;  2XSF A;  3KXD A;  2QSF A;  3NG8 A;  2D9O A;  4ZPA A;  1KOH A;  3GR1 A;  3TUJ C;  3J81 Y;  1KHW A;  1LK5 A;  3G82 B;  3W2W B;  4GC7 A;  3T1H F;  5IT9 Y;  2G2O A;  1WHW A;  4IRK A;  4OYZ A;  4PQU A;  4TU8 A;  4KE5 A;  3I0S B;  1KSP A;  1RT2 B;  5MLC V;  2V9W A;  4UW2 A;  1KLN A;  3HUL A;  4QIG A;  3W60 A;  4NXM F;  3HHL D;  4J9M A;  2ADC A;  3D6H B;  2E9R X;  4PG6 A;  1HR0 J;  1AUS L;  3TAN A;  3ZZT A;  1P9Y A;  3I87 A;  1N6Q B;  2FVC A;  1HBM B;  3QNW B;  3VAF A;  1F3F A;  3VZH A;  3A3P B;  1I3O B;  3GFH A;  2FLP A;  2WSC C;  4Z37 A;  1R6Y A;  1UMJ A;  4WTY A;  2PMW A;  1VC5 A;  4KR0 B;  3MF5 A;  1T03 A;  2ROG A;  5B0A A;  3JAM Y;  2AEM A;  1FHT A;  1HWK A;  3CJK A;  3U1N A;  4PUO B;  2M8D B;  2QT7 A;  5KFE A;  2XI3 A;  4LRD A;  3M7V A;  4WF9 Q;  4YB5 A;  2BAN A;  3Q83 A;  2ZH2 A;  3SSR A;  3QWU A;  3D3B J;  2VDH A;  2BJ8 A;  3M2R A;  3D0H E;  2Y8Y A;  3OTE A;  3HK2 A;  2VC1 A;  1GX5 A;  4UOF A;  3D9B A;  4NLS A;  4KRW A;  4CI0 B;  2HQ3 A;  3SXL A;  4UOC A;  4RW6 A;  1PJ5 A;  4F4Y A;  4EUV A;  3DCA A;  2LQ9 A;  4R5P B;  2JEG A;  4O3O A;  4FYX B;  1TZ0 A;  1KVJ A;  4WP8 A;  2DIU A;  2G1D A;  3QO9 B;  4X4Q A;  1PKU A;  2IFX A;  1HBO B;  3V81 B;  1MRO B;  4X4R A;  4N77 A;  1C0T B;  2IDL A;  3H4D A;  4ZCM A;  4JV5 J;  3OUY B;  1XQI A;  3W2W A;  3HT3 A;  2G2Z A;  1SL1 A;  4Q43 A;  4WFZ A;  4UY8 T;  3ZZZ A;  3BKU A;  3I0S A;  3K5L A;  1AA1 B;  5SUH A;  1RT2 A;  1R7I A;  4P74 A;  1CJV A;  2GGP B;  3NL0 A;  3BS9 A;  1EKR A;  3R6L B;  3IGV A;  2ZUA A;  1N6Q A;  2Z57 B;  4ILL A;  2YKQ A;  2W2O P;  4NLT A;  3J7Y U;  3M2U B;  1NCL A;  2VA2 A;  1PYS B;  1A0O B;  4Y00 A;  2C28 A;  4C98 A;  3OL6 A;  1Y0H A;  4IDK A;  4NYP A;  5E41 A;  4PUO A;  2I8E A;  1FA0 A;  2E5L J;  1H74 A;  3PYE A;  2YNF B;  4URG A;  3RRH A;  3MAA B;  2IJF A;  4LFA F;  3T19 A;  5A76 A;  4HVZ A;  3QWP A;  7FD1 A;  4ECU A;  1NSQ A;  2L3M A;  2V4Q A;  1RLD A;  4GVL A;  3AFG A;  3ZO7 A;  5KFX A;  1RWX B;  4QR0 A;  1QE1 B;  1IUJ A;  5EX0 A;  4A8F A;  1F9H A;  2AP6 A;  2HGL A;  2J0S D;  2NPI A;  4MYU A;  5F8H A;  2UVW A;  5LMN F;  2XHC A;  4OX9 J;  2AX1 A;  4R5P A;  3R5J B;  1PYT A;  4QYZ K;  1YK9 A;  2B9Y A;  4K4T A;  5DG8 A;  2F8E X;  4NRU A;  2VFT A;  3NMA A;  3QO9 A;  2DCL A;  1N33 F;  5EWE A;  1HBO A;  3V81 A;  3I9Z A;  1MRO A;  1C0T A;  4CWB A;  3OUY A;  5J1P A;  3R7S B;  2VJV A;  2KXF A;  2HZV A;  4LF9 J;  2OEK A;  3UI3 A;  2GGP A;  3CIM A;  3GCW P;  3KYL A;  2HLU A;  1WAC A;  4EI2 A;  3MM7 B;  5DQI A;  2E7W A;  4DU7 A;  1N5S A;  1WKJ A;  3DDN A;  1QVG R;  3M2U A;  3C2P A;  2DRD A;  2PN6 A;  4TN2 A;  4CM0 A;  3KLF B;  1ZS6 A;  9ATC B;  2OJ3 A;  4YHH J;  2OD4 A;  3A8I A;  1VQL S;  2YNF A;  5F41 A;  3JQM A;  5BYR A;  1ZTT A;  2PE8 A;  3OHA A;  5IWA F;  3R7N B;  1C1C B;  2AT1 B;  3DXB A;  4RUB A;  3RG6 A;  1KTQ A;  1UW4 A;  1TKX B;  4KHP J;  3FFI A;  1WC1 A;  4NLX A;  1WUU A;  2WOM B;  3IGN A;  2YQ0 A;  4CM2 A;  2VKZ G;  1U1O A;  3SZ2 A;  3D6F B;  4LMZ A;  1P6T A;  1WSV A;  3RAQ A;  4ECS A;  1U4B A;  3RB6 A;  5A8K B;  2YWH A;  2DHG A;  2F8H A;  1VBZ A;  4LR9 A;  2FJV A;  1WJ9 A;  4P72 A;  1VBX A;  2HNZ B;  4U67 Q;  1WNE A;  3NGT A;  1HFE L;  3M8W A;  3IS9 A;  1NUE A;  4BBY A;  3A1Y G;  2MHE A;  2JJ4 D;  3SCK E;  2KXN B;  5K20 B;  2MZJ A;  3MTK A;  2EFG A;  1OQ6 A;  1S1U B;  1YRU A;  5GAG I;  3BYP A;  3F41 A;  3G8T A;  3DGV A;  3Q24 A;  5ETR A;  4EYH B;  4JYA J;  2DH8 A;  3MM7 A;  1Y3J A;  2CZ9 A;  2XMT A;  2AX0 A;  5C25 B;  3O3L A;  4IRC A;  2VPW B;  4PG4 A;  1YZ6 A;  2ZVI A;  4A8O A;  2NZC A;  2W8K A;  3JTN A;  2ERR A;  1AW0 A;  2BQR A;  2W2P P;  1TFW A;  2AW0 A;  5DQG A;  2AIR B;  3T5L A;  4FN5 A;  1FKO A;  3N4W A;  3BSC A;  2ZC3 A;  4X4V A;  1WKL A;  1RT4 B;  2B6A B;  4LBH A;  1C1C A;  2A1B A;  2ZZT A;  1D9F A;  2YWF A;  2HGN A;  3Q8Q B;  4C97 A;  1UVN A;  2DJW A;  3WIU A;  4C3K A;  4IO9 Q;  4OYI A;  4MH8 A;  5FII A;  1UWB B;  3NEK A;  2WOM A;  2ZHO A;  1HYS A;  4X4O A;  1NDK A;  4WJB A;  1O0P A;  2CKW A;  3J7A N;  1GAO A;  5A8K A;  3LF0 A;  2EK6 A;  1W26 A;  3NCP A;  1GXT A;  3PM9 A;  4Q2L A;  1KDN A;  1Q8K A;  5FLX Y;  1RBA A;  2OEM A;  3KUG A;  1HBN B;  4QIE A;  4OYW A;  5G4D A;  3QYY A;  4FYW B;  3CJ2 A;  2YXL A;  3SQG B;  1P8G A;  4OQJ A;  2X51 A;  3DLG B;  3FQK A;  5E3R A;  4F25 A;  1KP6 A;  1DQA A;  2BZ2 A;  2D9P A;  2DIV A;  2RJZ A;  1FE4 A;  4P71 A;  1MU2 B;  5HI7 A;  2E5L F;  3LPY A;  3EZO A;  3H20 A;  1M1H A;  3NGD A;  5F3Z A;  1HI8 A;  1XN9 A;  4WK3 A;  1X9W A;  1LEO A;  2D3Z A;  3M32 B;  1AZS B;  2CDQ A;  3IBW A;  4RX6 A;  4IYQ A;  1RAF B;  1QDU B;  2LEP A;  3HLU A;  4YEA A;  4DF4 A;  3WX4 A;  1FRJ A;  4USI A;  3RGI A;  3HD1 A;  3D28 A;  4OX9 F;  2FUG 9;  1FJE B;  3QT6 A;  4MK8 A;  2LCW A;  3AA8 A;  2B6A A;  4V19 X;  2IAJ B;  3D1Q A;  1EP4 B;  5I3P A;  3LAN A;  5ETL A;  4BS2 A;  5CHC B;  2DGX A;  3HXM A;  2MSS A;  2IHR 1;  4ZVH A;  3N6L A;  3GSI A;  2VIH A;  4DR3 J;  3MCS A;  1F2G A;  4RW8 B;  2A18 A;  3EUN A;  2HFS A;  4C0O C;  2YX4 A;  4LF9 F;  2BVZ A;  3F56 A;  1RHR B;  4ZLL A;  4LF8 J;  1F2H A;  3R7B B;  4X64 J;  2HEK A;  5AT1 B;  1K44 A;  3D1O A;  1HI0 P;  1HBN A;  2R4F A;  3HKZ D;  2QA2 A;  2CVI A;  2JSX A;  3SQG A;  1J5O B;  2IA6 A;  2XZW A;  3DLG A;  1XNQ J;  2DR9 A;  8RUC A;  5HN0 A;  4USW A;  3OVB A;  4DPX A;  4YHH F;  2CPY A;  2WZ1 A;  3LGH A;  3E3X A;  4CQ1 A;  2AGQ A;  1G6B A;  3HCX A;  1FI4 A;  1M5O C;  4YR3 A;  1WDD A;  4IH7 A;  3UW1 A;  2OPP B;  3BR9 A;  4I7F B;  4CO4 A;  4JI8 F;  2J0W A;  4P2X A;  4G1I A;  1R0B G;  3WZ0 A;  1OY8 A;  3POT A;  1PAU B;  3M32 A;  1AZS A;  3SFU A;  4DI6 A;  2NRE A;  2AWZ A;  4K4U A;  3V6D A;  2BJ7 A;  2MXY A;  4KHP F;  3BGF A;  4WXW A;  2JC1 A;  2DEJ A;  1DY3 A;  2FDN A;  2BKP A;  1APS A;  3HO1 A;  4LRE A;  4YQW A;  2XLI A;  2LYV A;  3MXH P;  2YWK A;  2B9X A;  4O4R A;  2DYA A;  3MD1 A;  1GFW B;  3IWX A;  2IAJ A;  2QTW A;  2RQK A;  1EP4 A;  4GC6 A;  3UR3 C;  4FYD A;  2CJA A;  1SBR A;  3GCX P;  3LP0 B;  4X4N A;  4AQY J;  1YJ7 A;  4OYB A;  4DFM A;  3U1L A;  2JH3 A;  2HQI A;  5H9E J;  3IR5 B;  2R2R A;  4RW8 A;  2UXC J;  4HL9 A;  4UOH A;  1M0S A;  4KO0 B;  1RK8 A;  4C8Y A;  1R31 A;  2H5I B;  2HBR B;  2YX1 A;  1S7I A;  2Q1L A;  4TYA A;  3GSD A;  3OL8 A;  2IY5 B;  2OTL S;  4JYA F;  3OR1 B;  2K7K A;  1YQH A;  2DHS A;  5J1E B;  3BSO A;  2HFU A;  1VRQ C;  4USH A;  5D3G B;  3PO4 A;  3CCZ A;  1F5B A;  4DV6 J;  2DNL A;  1VRT B;  4BC7 A;  2F4V J;  1RAH B;  4AFF A;  3EIC A;  1Q8I A;  1SPB P;  3TEG A;  4AUK A;  4F0K A;  1XEZ A;  2R7Q A;  2OPP A;  4I7F A;  5D0R A;  2UVR A;  2OAU A;  4LF6 J;  2GAH C;  5KFC A;  1NHU A;  1SI9 A;  4ECW A;  2E7V A;  3EYZ A;  4RJV A;  1S1V B;  2BBE A;  3O5T B;  2Y1R I;  5EGY A;  2LA4 A;  1N52 B;  1N56 A;  3CJS A;  1K9M T;  2FJA B;  5J2M B;  1T3O A;  1R8P A;  2MQQ A;  5KG6 A;  4Y65 A;  4LFB J;  3NAI A;  2AYG A;  4WTO B;  4O44 B;  4LF1 A;  4M1K A;  1X4E A;  1SL0 A;  1H72 C;  4CH0 S;  3RAM A;  3LP0 A;  4Q7A A;  4XK8 C;  1Q95 G;  1PC4 A;  3GII A;  1RAJ A;  2Z2Y B;  3THV A;  4NLO A;  2DBB A;  4KO0 A;  1IBK J;  2Q43 A;  2DGO A;  2YNI A;  4OFZ A;  4P10 A;  4ERD A;  3MI7 X;  3TJA A;  4DQP A;  3C6U A;  3NLC A;  4DCO B;  4BLG A;  1KQS R;  2B5J B;  2IVF B;  5JVH Q;  2KB2 A;  3CUL A;  1KQF B;  5J1E A;  2CQ3 A;  3Q23 A;  4B3R J;  3IAS 9;  4JB8 B;  1VRT A;  4NA3 A;  3KK2 B;  3Q22 A;  3KK3 B;  3Q86 A;  1DJ0 A;  2FZK B;  2FGC A;  2Z58 B;  3DLK B;  4U8V A;  2KYZ A;  5KFA A;  5G0R B;  3Q8Y A;  2AMC B;  5KFH A;  5CD4 A;  2MKH A;  1S6P B;  4WFB Q;  2V8P A;  2JLF A;  2GMJ A;  2LXI A;  4O4G B;  3Q8P B;  4CLL A;  3DI6 B;  4KT0 C;  4DR3 F;  4N41 A;  3IXQ A;  4U9R A;  1KOO A;  1S1V A;  4DG1 A;  2H4W B;  4ALZ A;  4ID8 A;  4QWE A;  2E1C A;  1X9S A;  3FSX A;  3PW7 A;  1OQ3 A;  1RTH B;  4M5J A;  3B6B A;  1VYA A;  2DR6 A;  1Z1Z A;  3GMG A;  1UZD A;  4ANE A;  4X64 F;  3OFE A;  4O44 A;  4LF7 J;  5E7O B;  5DQH A;  2BJ3 A;  5ETT A;  4YOE A;  3BF4 A;  4M5L A;  2H51 B;  4DSI A;  4P73 A;  2ACM A;  3I31 A;  1JLA B;  5HQ8 A;  1V5I B;  1UWA A;  2BX6 A;  4UST A;  3T5J A;  2CPJ A;  1S48 A;  2HK3 A;  2VL1 A;  5LSO A;  1XNQ F;  4DSJ A;  5HVH A;  1FX4 A;  4G1P A;  5F9L A;  2C2K B;  2CQH A;  2XS7 A;  1WOO A;  4FF2 A;  1U45 A;  2DT9 A;  4ZLN A;  4PRF A;  5LXY A;  2B5J A;  2UV8 A;  2WRM A;  4NLD A;  2FZC B;  3RW7 A;  4K4X A;  3JS9 A;  3GFX A;  2IYI A;  3W66 A;  2KVI A;  1M5V C;  3AAW B;  1S9F A;  1MN7 A;  1QUV A;  3VAM A;  2UZA A;  4L73 A;  3KK3 A;  2ZKT A;  1DUR A;  1RWM B;  1T9T A;  5HO4 A;  4QPT A;  1EB0 A;  2XLJ A;  2RML A;  4LRB A;  5G0R A;  1JNR B;  1Y00 A;  1I51 B;  3S6E A;  1RZM A;  1S6P A;  3P96 A;  3DRP A;  2CQI A;  1FTR A;  3W62 A;  2BJD A;  2HQF A;  4O4G A;  4OZ1 A;  4WII A;  1JLC B;  4U96 A;  4M8L A;  4AQY F;  1RTJ B;  2K3K A;  3QZ7 A;  3WQP A;  4I2Q B;  4X4P A;  3K89 A;  3PJ9 A;  2ZJQ Q;  2KT2 A;  1RBL A;  4ZK7 M;  1YJR A;  1YDL A;  3Q89 A;  2AJ1 A;  4LBI A;  2L08 A;  2NXE A;  2G4B A;  2CPD A;  2DVI A;  1SJ4 P;  1NDL A;  2A3J A;  3NCR A;  2VBX A;  4NXN J;  3D7S B;  2XM3 A;  1T11 A;  2FJE B;  1JLA A;  4WKR A;  4JI7 J;  2N7Y A;  4DV6 F;  1JX4 A;  2DNQ A;  2D74 B;  3TYT A;  2F4V F;  1LNQ A;  1OWX A;  1WF2 A;  2OSR A;  4PQA A;  3SBM A;  4H4K C;  1SVD A;  3P49 B;  1L3U A;  4H54 A;  1NK5 A;  2DO0 A;  4MKV A;  3CXC R;  2AJ2 A;  3MFH A;  1ZAW A;  4DQR A;  4LF6 F;  4DR2 J;  2JWN A;  2JX2 A;  1CG2 A;  2UUW A;  5DM6 Q;  4Z2X A;  3W64 A;  1IKV B;  3H2V E;  5KFL A;  4CP5 A;  3TJ9 A;  1TL5 A;  2IRY A;  4G1Q B;  1H2T Z;  4GKK J;  2MLY A;  4C0B A;  2P8I A;  3T1A A;  2AZ1 A;  2ZDO A;  3RTV A;  3HKW A;  3MPV A;  3PFO A;  2B7B B;  2PFD A;  1FKP B;  2KFN A;  2OHD A;  1JXE A;  4TU9 A;  3KG1 A;  1BWE A;  4RBV A;  2ZHB A;  3HFV A;  4ZPB A;  5H9F K;  3EMT A;  3CJ3 A;  1JLC A;  5L1K A;  1NJI T;  1RTJ A;  3DKD A;  3EVO A;  5EWF A;  1U1R A;  4LRC A;  4I2Q A;  3OFG A;  3LA0 A;  2LKZ A;  4PG7 A;  3RBE A;  2YNG A;  1AFJ A;  3PRB A;  3ENQ A;  3UDC A;  1IBK F;  4MK7 A;  2ZNY A;  1T8E A;  1URN A;  2MY7 A;  4JI4 J;  1X8D A;  4K0K J;  1NM2 A;  3OTC A;  3QAE A;  1KR4 A;  3A4T A;  3PJW A;  2OO4 A;  1PIE A;  4P2S A;  1JNZ B;  3F44 A;  1RP5 A;  2KM8 C;  1UCN A;  3UN5 A;  2I9S A;  2DGU A;  4B3R F;  3LGM A;  3TA0 A;  1JK9 B;  2F40 A;  2VUG A;  3KG4 A;  1YRT A;  3SEO A;  3W5Y A;  2NUU G;  2DY1 A;  4ECZ A;  4I6W A;  2BDP A;  1M5P C;  2H48 B;  3P6Y C;  2FHJ A;  1ICE B;  4N8N A;  1N34 J;  2CQD A;  1FFW B;  1RT5 B;  4NLR A;  1IKV A;  1BGX T;  4O3S A;  5T41 A;  3CF5 Q;  4MYT A;  4AYB D;  4RW4 B;  3JTP A;  3W61 A;  4X84 A;  1Z2L A;  4UUW A;  3P5T L;  3F73 A;  4WU2 A;  4I6Y A;  2BEF A;  4LSN B;  1FKP A;  3KJN B;  2CAJ A;  4LF7 F;  5T14 A;  1NJX A;  1G7C B;  2C3U A;  4DL0 C;  2V68 A;  4ZHR B;  3CDU A;  3L7P A;  3LAM A;  1FRX A;  3CE8 A;  1M5S A;  1VQ5 S;  3PY8 A;  4HKQ A;  3AY0 A;  3GON A;  4HLB A;  4NI2 B;  4ED7 A;  1WOR A;  4NLY A;  3DM2 B;  2VG6 B;  4HI1 A;  3CC7 S;  4HDG A;  3DYA B;  1VQP S;  1RA6 A;  2GVD B;  3JYT B;  4ZS6 A;  4RW7 B;  5J2N B;  3MUV P;  4J9R A;  4HHH A;  1RIS A;  4CTA B;  2FTR A;  3VVT A;  3UDV A;  1CC8 A;  1SJQ A;  3BM7 A;  3AOD A;  3L95 X;  2WVD A;  3CWJ A;  2NQP A;  2ZOG A;  3DLE B;  2EBG A;  2LMI A;  2HIY A;  3AXK A;  4O3P A;  1WTF A;  4C4W A;  5M2U A;  4ZP6 A;  5F8L A;  2U1A A;  2RUG A;  2IM1 A;  2ADB A;  2ILZ A;  4F26 A;  5HRO B;  1F60 B;  2HAF A;  3M9O B;  3BH6 B;  1RT5 A;  1WDT A;  2KFZ A;  1FEE A;  4FYY B;  2KO1 A;  2VD3 A;  1S6U A;  4CO1 A;  3BH7 B;  4RW4 A;  1VHI A;  5A8W B;  4U7U K;  4B3M J;  5J2Q B;  2VAS A;  2EFP A;  3CT9 A;  2ZC4 A;  2LU2 A;  3UDL A;  1ZPV A;  1S6O A;  1VK8 A;  4NXN F;  1GK8 A;  4RBT A;  2J7U A;  1S59 A;  2YWE A;  4OX8 A;  5ADZ A;  4ZHR A;  2F4F A;  3HFK A;  1OPZ A;  1RAD B;  2QZ8 A;  4NA2 A;  3HDS A;  1BMQ B;  5IOL A;  1RHM B;  2XYG B;  4JI7 F;  4F4A A;  2IVM A;  1NKB A;  4HH1 A;  4RNO A;  2VG6 A;  1HPZ B;  2XWX A;  1ZZF A;  1EQM A;  4EO6 A;  3JYT A;  1RKJ A;  3LPE A;  2IBK A;  4RW7 A;  4Q0B B;  5J2N A;  1XMO J;  2EFN A;  9RUB A;  5IXU A;  3OT9 A;  1K0V A;  4RKU C;  4NCG B;  2R8H A;  2V34 A;  2O01 C;  4AXI A;  2H1Y A;  3DLE A;  2EFV A;  3KHH A;  1M1G A;  4JI5 J;  2LVW A;  1UA0 A;  3QJP A;  2VG7 B;  4ZIV A;  2CQC A;  4ECT A;  1Q86 T;  4O3N A;  1NBE B;  2XCA A;  1R6V A;  4HH0 A;  3K59 A;  2HVH A;  1DFD A;  5A6W A;  2APO A;  3KLG A;  2DR7 A;  3M2V A;  3QJJ A;  3UN3 A;  5F8G A;  2AJ0 A;  4U8Y A;  4DZD A;  2YY3 A;  1XR5 A;  4ZVQ B;  4OZJ A;  2HG4 A;  4ETX A;  3BPD A;  3K5P A;  5L1I A;  3AJD A;  3TAQ A;  1LWC B;  5A8W A;  4DL6 A;  4RUA A;  4NMX A;  3ITH B;  3I6P A;  3T6B A;  4LVN P;  2CJQ A;  2DIT A;  5GAH U;  4JI4 F;  1DZ5 A;  1L3V A;  2QL5 B;  4PPD A;  1VC6 A;  2HUR A;  3CJ8 A;  3IWL A;  3MZI A;  1C2P A;  3M6V A;  4FNH A;  2Z4P A;  1CJT B;  3BDE A;  4FS2 A;  4KHM A;  2ZH9 A;  3CO9 A;  3QGG A;  1HPZ A;  1RHQ B;  2NCK L;  2MQ8 A;  1S5Z A;  2UVU A;  3H0P A;  3TUI C;  2RKI B;  4Q0B A;  2H5J B;  1TR0 A;  4PXD A;  4P7T A;  1HBU A;  1Q78 A;  1UET A;  4FNI A;  3GE9 A;  4YN3 B;  4PWW A;  5HLF B;  4WYL A;  1RXO B;  1ZA2 B;  3B78 A;  1N34 F;  1SKW A;  1GX6 A;  4CO2 A;  3VAH A;  1P1L A;  2C42 A;  2JHE A;  1H73 A;  1YG0 A;  1KWM A;  2VG7 A;  5HMW A;  3LH2 S;  4HTI A;  2VIC A;  1S1W B;  3A12 A;  2BR0 A;  3HFZ B;  2MB0 B;  2KG0 A;  2Z2M A;  5EWG A;  3PEJ A;  3OLB A;  2GCF A;  1T9V A;  3NS6 A;  3AD8 C;  3J81 U;  3AB4 B;  2QA4 S;  2HWI A;  1HI1 A;  5IT9 U;  4DX8 H;  4DXL A;  1IJF B;  2ZZN A;  2XMK A;  1WC4 A;  3BJY A;  3SV3 A;  1LWC A;  5BXI A;  2UV8 G;  3ITH A;  3P4U B;  1GMW D;  2N3L A;  3G71 S;  2VQE F;  2AJQ A;  2EEY A;  2B7C B;  1LW0 B;  3FJ2 A;  2A6M A;  3W65 A;  4N56 A;  2M0G B;  5HMX A;  2W7P A;  1KVK A;  1CJT A;  4ZN3 A;  4Z7Y A;  1RT7 B;  1T0T V;  5LL6 d;  4MT1 A;  1MNE A;  2DNO A;  2KRB A;  3ISN C;  3MEK A;  5F0U A;  3UCZ P;  1WG5 A;  3I0R B;  2K8G A;  2VBZ A;  1VQ9 S;  4K4Y A;  3GIK A;  3DGP B;  1SQE A;  4Y3C A;  3PYD A;  2RKI A;  2P9C A;  4ZCK A;  4R25 A;  4WP3 A;  4KIA A;  4N5S A;  4ZJL A;  5HLF A;  1LW2 B;  2XCP A;  2B3T B;  4UY8 5;  4O0I A;  5E5N A;  4I64 A;  4F4X A;  2VHG A;  3LGN A;  4FKX A;  3OVS A;  3QZ8 A;  2XTJ P;  1WTB A;  4NAS A;  2HBQ B;  2I2Y A;  2DRA A;  3MAQ A;  4TU7 A;  4B3M F;  4DR1 F;  1W2B R;  2HHQ A;  3FRY A;  2COL A;  3GP9 A;  3A3O B;  3IAM 9;  2MKI A;  1ROF A;  4GO5 X;  2PFF B;  1RAC B;  1CVJ A;  5M2R A;  3HHE A;  2LP4 A;  1UL3 A;  1Y5I B;  2RQM A;  1HNW J;  3UN2 A;  2WON A;  1J5E J;  3GTY X;  2YWG A;  4X2B A;  2RT3 A;  3BKF A;  1V3Z A;  4DU8 A;  1MMN A;  1P1T A;  2EFQ A;  4Y0F A;  2V8D A;  4CLY A;  1JLB B;  3KWM A;  3GIJ A;  2E1A A;  3LOU A;  3R5D A;  4K5R A;  1YJV A;  3GFZ A;  4MKB A;  2LQ8 A;  3J7Z T;  4OIX A;  3BO4 A;  1XMO F;  1KQK A;  1U1K A;  1LW0 A;  1B7Y B;  1DLO B;  3GJT B;  1NK8 A;  4NYZ A;  3ONQ A;  1S12 A;  3S8S A;  1SJF A;  1RT1 B;  1RT7 A;  3TO8 A;  3GJS B;  3ENA A;  5H9E K;  3PIO Q;  4LJM A;  1JLF B;  2V6A A;  2DY9 A;  2XQC A;  3I0R A;  3MPU B;  3DLL Q;  3H2U B;  1R8B A;  1TL1 A;  2DGV A;  4NYO A;  3DGP A;  2HZA A;  4MFB A;  3NGR A;  1IBC B;  2XB2 D;  2XMV A;  4PG8 A;  4IQX A;  1N8R T;  2E9Z A;  4USK A;  1PYO B;  3PDN A;  1U1N A;  1LW2 A;  1OMS A;  2P5V A;  2ZM6 J;  4M5G A;  2DXD A;  3BN4 A;  4YB6 A;  3CB4 A;  2N4C A;  4CNY A;  1WHX A;  1SQF A;  2FHO B;  3PO5 A;  4FBU A;  2FY8 A;  4DSL A;  1HHQ A;  4PXB A;  2WHO A;  3PKM A;  1CJK B;  1Q5Y A;  4F3M A;  2H54 B;  4XDC A;  2LQ5 A;  2QFI A;  3BO3 A;  3ZTO A;  3BB5 A;  5AXN A;  3E01 B;  2B4O A;  2CQP A;  5KFJ A;  2B9E A;  1SJ3 P;  1JLB A;  1L5U A;  4NRT A;  3A8J A;  5AXM A;  3CSK A;  3HMJ G;  1FER A;  3DDK A;  5AE2 A;  1S76 D;  4UZC A;  4LF5 J;  1REV B;  4C48 A;  3FK4 A;  3MCM A;  2MKS A;  2Q6B A;  3O6Q A;  4FF1 A;  1RT1 A;  1RWW B;  4Y2K A;  3I56 S;  1JLF A;  1K47 A;  3C16 B;  1RCX B;  3DXS X;  3VZI A;  2M88 A;  3WC0 A;  3T3F A;  1W25 A;  1NU4 A;  3WHI A;  2A2D A;  4QIV A;  4UZB A;  1K8A T;  1F1B B;  4DPO A;  4K4S A;  2MZ1 A;  4NZ0 A;  5EUH A;  4ZA1 A;  4ELU A;  1RT6 B;  2G0C A;  5AXL A;  4C2M A;  2AQ4 A;  5KFN A;  4J9V A;  2UXB J;  3TNV A;  5GAE I;  3RB0 A;  4ENO A;  3QSI A;  1G1X A;  2VPY B;  1CS4 B;  4QW9 A;  5CAA A;  3BR8 A;  4AE5 A;  3PHT A;  4YR2 A;  2AYB A;  4FPI A;  4I0W A;  1JLQ B;  2PGC A;  4P52 A;  2HYI B;  2J7W A;  1DTQ A;  2OP5 A;  4AT1 B;  3SCL E;  1BUX A;  1M5H A;  3E01 A;  5C2G A;  1R89 A;  2XO7 A;  4OJG A;  3ET6 B;  1X0P A;  3HHK A;  1CC7 A;  1XWL A;  1UKU A;  3FEY B;  2Y3Y A;  4RO0 A;  2LDI A;  2M2B A;  1S10 A;  4A48 A;  2V69 A;  1S77 D;  2JLG A;  3R5C A;  3R5G A;  4EEY A;  2Z8Q A;  1Q7Y T;  2J76 E;  1U1M A;  3M8Q B;  2BE2 B;  3GR0 A;  4TXS A;  2D3U A;  3LAL A;  5L46 A;  5KFK A;  1FNM A;  4YB1 P;  4ECY A;  1TTH B;  2EPI A;  5K8O A;  2ASY A;  3QRR A;  2X7I A;  3DN9 A;  2UVV A;  2CIM A;  2KZZ A;  1VI7 A;  2FIU A;  3TX0 A;  3V6H A;  3C16 A;  5E3A A;  1U8W A;  1G2E A;  4TLQ A;  3CC4 S;  3OPK A;  2CJY B;  3CW2 C;  2GS8 A;  3HSJ A;  2CYY A;  2IDE A;  1IBM J;  3W63 A;  1U1Q A;  3OXG A;  2XEX A;  4QPX A;  2EG1 A;  1HNW F;  4KBI A;  1RT6 A;  1CPZ A;  2QLW A;  4RNF A;  1XMQ J;  4OZ2 A;  3DOK B;  3GPA A;  1U1L A;  3NAH A;  1H38 A;  1LV5 A;  4MJK A;  6FDR A;  1HNX J;  3C14 A;  2V2K A;  2B8Q A;  2HS4 A;  1JLQ A;  3LP1 B;  5FLX U;  1BHN A;  2NSC A;  2KDO A;  2UP1 A;  2ZBI A;  2ATC B;  3DMJ A;  4YFU A;  4ICL B;  2MZS A;  3L09 A;  4OI2 A;  3MEC B;  4DL2 A;  3ET6 A;  2K7J A;  5GVQ A;  5B0C A;  5KT2 A;  2BA9 A;  4ZIT A;  4ED1 A;  1TUV A;  4TNO A;  3M1V B;  1DQ8 A;  5KOX A;  5DGB A;  3M8Q A;  2VG5 B;  4QU7 A;  2IYG A;  4CH1 A;  5JMN A;  1FTC A;  1L3K A;  4V19 J;  5CXT A;  2BRL A;  3MPD A;  3ELH A;  2ZM6 F;  4DS5 A;  2ZD1 B;  1UPP A;  2YTC A;  1SXL A;  2PSZ A;  4CRJ A;  2L9D A;  3O2I A;  2XMM A;  4QYR A;  4ES1 A;  4MTP A;  2M4M A;  3UR0 A;  3CDE A;  5KT3 A;  1TU0 B;  4N7T A;  3QSY B;  1S57 A;  4K8R A;  4MIA A;  4UOG A;  1TK8 A;  3BZQ A;  3MMB B;  3R9L A;  3FMB A;  1H98 A;  5C7P A;  5KG3 A;  3DOK A;  5A0Y B;  3DFE A;  2D7S A;  3I5B A;  3J80 Y;  3TW0 A;  1LFP A;  2PI5 A;  2MST A;  2HHS A;  4IOA Q;  1SH0 A;  3RBZ A;  2C2N A;  2O3D A;  3ZTQ A;  3D4J A;  2MJU A;  4OZ5 A;  4LF2 A;  2C3Y A;  4LF5 F;  3LP1 A;  4OV1 A;  3W8P A;  5A8R B;  3W9I A;  1QSS A;  4QWA A;  4URQ U;  3DNC A;  3ZTP A;  3MEC A;  4URS A;  3KDO A;  2C3M A;  4C8M A;  1NKE A;  4CDI A;  2YBV A;  3MGJ A;  2EC0 A;  1AXQ A;  1CEZ A;  5KFO A;  1SJR A;  1SKR A;  3M1V A;  1FCA A;  1F5C A;  1V3R A;  3HI9 A;  3EVW A;  2VG5 A;  1NB2 A;  1FDA A;  3H2L A;  3M6U A;  1XC9 A;  2XLK A;  2KKH A;  3AQO A;  2HND B;  4CZC A;  1BQX A;  3BRE A;  2QFJ A;  3CD5 A;  3FCV A;  3NWG A;  3J7A 1;  1E6Y A;  3VGU A;  4KV8 B;  2C2Z B;  2KM8 B;  2UXB F;  3H8Y A;  3GYN A;  2WAQ D;  3OR2 B;  4RR5 A;  2PD1 A;  4OHZ A;  3SDE B;  4HEA 9;  3ADA C;  3UD4 P;  3T41 A;  1OYD A;  4F4Z A;  1VQN S;  4I67 A;  5K8N A;  4ZPV R;  1CJU B;  1G3O A;  4QW8 A;  5KT5 A;  4IG3 B;  4WCE Q;  5AJ3 J;  3MMB A;  1RU1 A;  2YKM A;  3U1M A;  4MKA A;  4LFA J;  2V2Z A;  3DRR B;  4MIW A;  5A0Y A;  2FHJ D;  3H5Y A;  2MQN A;  2OPQ B;  1JB0 C;  3R97 A;  1Y4Z B;  1VQ8 S;  1YJW S;  1T9X A;  2XO6 A;  1FRK A;  1TL7 B;  2E1M C;  2N7C A;  5F9N A;  5LMN J;  2R8J A;  4ILR A;  2ZIT A;  1QAY A;  4ZIW A;  3QJL A;  2DHA A;  2HVE A;  3RR8 A;  1ZM2 A;  3CCU S;  2WBM A;  1NEE A;  4UQG A;  4FXD A;  3IWN C;  3EPI A;  1UJ5 A;  4EWT A;  2ZHA A;  1NKC A;  4WBF A;  5C42 B;  4WIQ A;  3C3L A;  3MM8 B;  4WFA Q;  1IBM F;  2HND A;  4F4W A;  2P6S A;  3VGV A;  3GV5 B;  5L9X A;  2IRU A;  3C66 A;  4NLP A;  4FKY A;  2VPX B;  4KV8 A;  1XMQ F;  3MMC B;  2UUT A;  1TKZ B;  1V6H A;  3TJ8 A;  1XIQ A;  3RRK A;  3GG1 A;  1VLO A;  1MG7 A;  1OYE A;  3VGS A;  4DX6 A;  2QEX S;  1HL6 A;  4B9L A;  1L3T A;  2SXL A;  2OML A;  2BW7 A;  1Q81 T;  2Y1I A;  1HD1 A;  3BSA A;  3V2U C;  1YKW A;  4IG3 A;  1SC3 B;  8ATC B;  3JSY A;  4B9U A;  3RBD A;  4MIB A;  3N01 A;  2L41 A;  2O67 A;  2AU0 A;  1LWE B;  2OPQ A;  1JKH B;  3HSZ A;  2EI5 A;  4B17 A;  1FE0 A;  2B4U A;  2C2M B;  4DQI A;  1SIZ A;  3M9M B;  4YS2 A;  1TL7 A;  5KFD A;  3GIL A;  2XSJ B;  4DJB A;  2W01 A;  3OHB A;  1BQM B;  1Q8B A;  4C7Q A;  4P75 A;  1F0X A;  1YSJ A;  3CJ5 A;  3T5K A;  4IR9 A;  3AD9 C;  3HX9 A;  2OPR A;  3NS5 A;  3ZTS A;  5D4N A;  3QT7 A;  2XY5 A;  3NNA A;  3CCM S;  3K5N A;  1DQ9 A;  4IFY A;  2ZZM A;  5C42 A;  2X1A A;  4DPT A;  1CLF A;  5DDP C;  2QN6 B;  3MM8 A;  3T9N A;  2DK2 A;  2E1P A;  2JEJ A;  5IFM A;  3PW4 A;  3DOM B;  3E8O A;  4R0E A;  3CO0 P;  4EO8 A;  1RHU B;  5C2C A;  3MTJ A;  3AA9 A;  1TKZ A;  4A47 A;  3UD3 P;  5H9F J;  5KAK A;  2GQ2 A;  5HVG A;  3CD7 A;  1UFL A;  4ED3 A;  3JSR A;  4D3G A;  1JIH A;  5FJ4 A;  3KK1 B;  3EDR B;  4QJV A;  1Y11 A;  3G6X A;  1V5V A;  3CDB A;  4J9O A;  2R8K A;  1NPK A;  2KH9 A;  2AF6 A;  3EX7 B;  1S9G A;  2VFS A;  1RHK B;  5EX3 A;  1H3D A;  3GJR B;  1LWE A;  1FVQ A;  5KOW A;  2BE7 D;  1M5K C;  3PG9 A;  1MMD A;  3TA1 A;  3NKY A;  4DV3 J;  4WKY A;  2NS1 B;  1UJ6 A;  4GKJ F;  3OFF A;  5HMZ A;  3G82 A;  1U26 A;  4J9K A;  2F8M A;  1VQ7 S;  1X60 A;  1WOS A;  1ZM4 A;  4J5O A;  4EGL A;  1JLG B;  4C8K A;  2DHH A;  3PX0 A;  5IC6 B;  2GHP A;  4LFC F;  3W9H A;  1XTZ A;  1DRZ A;  2OIH A;  3OSN A;  4OZ3 A;  4KPY A;  1HBM A;  1RTD B;  2ABY A;  2HMI B;  2GJ2 A;  2V4R A;  5AE3 A;  1HQE B;  3KHG A;  3G4S S;  1QD1 A;  3AJ1 A;  4JOU A;  2CNL B;  3BKT A;  4LQ3 A;  1HHS A;  2GJI A;  4DUZ J;  2CQ4 A;  2ZVS A;  4XDD A;  3VHQ A;  2J0Q D;  4RUC A;  1KHV A;  3DOM A;  3NNC A;  3KJF B;  5AJ3 F;  3VAK A;  3M05 A;  2ZEJ A;  2UUC F;  2RIJ A;  3JSM B;  2R2S A;  3FRZ A;  4NLV A;  4WU3 A;  5C24 B;  3I96 A;  1WG1 A;  1H2V Z;  4M95 A;  1X31 C;  2GQC A;  2B8P A;  5U47 A;  2MZR A;  2CRL A;  2UUA J;  5KTQ A;  2H9Z A;  2J5A A;  2GX8 A;  4USU A;  4MMO A;  3AB2 B;  3MM6 B;  5DM7 Q;  1KON A;  4ZVU B;  2Y0B B;  2EWH A;  3X1L B;  2C3P A;  4PWU A;  2WVE A;  1UW9 A;  2RUS A;  4DHV A;  3JQK A;  4AND A;  2DO4 A;  5DJB A;  3ILJ A;  4X65 F;  3PKY A;  4DV0 J;  3THP A;  3W5Z A;  3DU6 A;  1HW9 A;  1SJ1 A;  2AEJ A;  2M7S A;  1C4A A;  3OTD A;  1N0U A;  1TKT B;  1CUL B;  2J9D A;  2ZUG A;  1JLE B;  2EC2 A;  1TAU A;  2HVZ A;  3D68 A;  2A0F B;  1RYR A;  1YBU A;  4F2S A;  3VQS A;  2PC6 A;  5GME A;  4GO7 X;  1MWZ A;  5IS2 A;  1NB7 A;  2QLF B;  4UTG A;  1P27 B;  5HAO A;  2HPU A;  3A8K A;  2W1B A;  1NRK A;  2LLZ A;  3M8Y A;  1RTD A;  5B08 A;  1GNK A;  5HJX A;  1H7W A;  2IM2 A;  1TP7 A;  1MW7 A;  3OJU A;  1QJH A;  4EZ6 A;  3I4H X;  2GIR A;  2DCU B;  3MR7 A;  3KNG A;  3CGI A;  1BXN A;  4JI1 J;  1PAE X;  2DD8 S;  2V9K A;  1S9E B;  3IC1 A;  3BGR B;  4L72 B;  3HHN B;  3G2X A;  5KFT A;  3UCG A;  3MAA A;  2OTJ S;  2JRS A;  3JSM A;  2GV1 A;  3ZZU A;  4JI8 J;  5C24 A;  1RUS A;  1KN6 A;  4YME A;  1QE1 A;  1VRU B;  1OY6 A;  4OJ1 A;  3CJQ A;  2OLW A;  2W4C A;  1NPR A;  2ASJ A;  4CLT A;  2YH0 A;  5KFQ A;  3MM6 A;  4LSL B;  1XK8 A;  1KLM B;  1S0V A;  2F9D A;  3QBC A;  3UD5 A;  2E1R A;  5GAD I;  4LRA A;  3KG0 A;  8AT1 B;  5GAE U;  4WFN Q;  2YKA A;  2J7K A;  5HK4 A;  3P3D A;  2F9J A;  1IR0 A;  5HAT A;  2BRK A;  3UNG C;  5F8J A;  1D8Y A;  1XBW A;  5AE1 A;  1KBR A;  3QLH B;  1S7H A;  4KH0 B;  1JLE A;  1X5T A;  2F65 A;  1N5Y B;  2XC9 A;  2MKY A;  3NWR A;  7FDR A;  4ZLP A;  2J8S A;  2DH9 A;  4L75 A;  2HIQ A;  2E66 A;  2KN4 A;  1TQL A;  3TVY A;  3TAM B;  2V8V A;  3EXC X;  5M2P A;  3MOZ A;  4QWC A;  3D54 A;  5IC4 B;  5KFU A;  2QA4 G;  2W24 A;  5HQL A;  1NSP A;  1YJN S;  2RS8 A;  3ZZ0 A;  2W4D A;  2IBO A;  5DDO C;  3KLF A;  1IM6 A;  3FUY A;  1TMM A;  3WDO A;  3BGR A;  4M5K A;  4GMK A;  4U7U D;  2LA6 A;  2HBY B;  4R0J A;  2QMU B;  1H7X A;  2RQ4 A;  1WEL A;  1FRI A;  4DV3 F;  1VRU A;  3ILO A;  3TA2 A;  2LQB A;  3IP0 A;  1SIW B;  1TKX A;  3MM9 B;  1HIY A;  4LSL A;  1R8C A;  1IXK A;  1AT1 B;  4RWX A;  1S1T B;  3BDP A;  1B0T A;  2VV5 A;  2CPX A;  3DRY A;  1S0O A;  3SI8 A;  2CVE A;  2W2M P;  4ZP8 A;  5THW A;  4MAK A;  2ZBP A;  1ACM B;  4O23 A;  4DV1 J;  1UPM B;  2BYC A;  2JC0 A;  2HNZ A;  2D3O R;  4KH1 B;  1NK7 A;  2E7X A;  3PRD A;  4ZJQ A;  5I42 B;  3HVA A;  5CZV A;  4XIU A;  4LT6 A;  4PKD B;  1N5Y A;  2J9D E;  3OTB A;  2NUH A;  4DUZ F;  2RRN A;  4V1A k;  4KJI A;  4OYM A;  1S1U A;  3HVW A;  2FVQ A;  2P9E A;  3AQP A;  3D0I E;  2K1R B;  2YPZ A;  2H5E A;  3ENW A;  4U6P A;  4B08 A;  5C25 A;  4X62 J;  3J81 j;  4DOZ A;  1KNZ A;  3VTI A;  2UUA F;  1GMW A;  1X9M A;  2WK4 A;  2IIH A;  5I3U B;  3OL7 A;  5JUM A;  1O6X A;  3VAL A;  2GW8 A;  2BUN A;  2W2Q P;  4G3I A;  4CH7 A;  1EAY C;  1JJ4 A;  5DDR C;  1RT4 A;  5A2Q U;  1XJW B;  4DV0 F;  1FO1 A;  2QX0 A;  2HHX A;  2BJE A;  1SL2 A;  2QO3 A;  1YI2 S;  4Y2C A;  3H40 A;  3QRP A;  3MM9 A;  2MKK A;  1UWB A;  1S1T A;  3MEG B;  1R8A A;  4XAK A;  1FWP A;  2XY7 A;  4NOH A;  2O5D A;  5K8P A;  3PR4 A;  2EVZ A;  1XR7 A;  4JI6 J;  4F4K A;  4ED4 A;  4F3O A;  1NDC A;  4ZMM A;  3TQE A;  2MJN A;  3LP2 B;  1SKS A;  4XO0 A;  5I42 A;  5GMK a;  1X5O A;  2ATL A;  1ZOT A;  3IFE A;  4J9S A;  2GMH A;  2G2Y A;  4RL1 A;  2HQG A;  1YTY A;  4JI1 F;  1RTZ A;  3HM9 A;  3ZXW A;  1MU2 A;  5E3P A;  1HQ2 A;  4I1T A;  4DMZ A;  1RU2 A;  2K1R A;  3BBF A;  2V0N A;  2YKP A;  2PDA A;  5GAH I;  3OL9 A;  4ED2 A;  2XMA A;  1UEU A;  2O1P A;  3R6G B;  3KHR A;  2Y1J A;  4CLW A;  5J2P B;  4JV2 A;  2IJR A;  2BJ1 A;  2VBW A;  2ZWP A;  5I3U A;  3SCJ E;  1CQM A;  3BV8 A;  2UXD J;  4M5H A;  1HQU B;  4DLG A;  4IUF A;  3PEH A;  4DR4 J;  4AL6 A;  1X4A A;  3DU5 A;  1NME B;  2QRR A;  5K9F A;  3HJV A;  3MUT P;  2AV5 A;  3Q8S B;  1NXI A;  1QUP A;  2CFX A;  3N5F A;  3MR3 A;  3KKF A;  2OSQ A;  4PYD A;  2MPU A;  4K2X A;  3RB4 A;  1YLX A;  2HWT A;  3T5H A;  2HFO A;  2JDJ A;  1Y9O A;  3BGU A;  3TEH B;  2N3O A;  2DNM A;  1GTE A;  2HHT A;  3MEG A;  2X1G A;  1X4F A;  2DR8 A;  1C4C A;  3L7O A;  3D0G E;  2DKO B;  3GQC A;  4WPA A;  1R8H A;  2XNQ A;  2QGF B;  1YJ9 S;  2XI2 A;  3LP2 A;  2VON A;  5B0G A;  1FFS B;  3MMA B;  2V63 A;  1J5O A;  2W7A A;  3ZZR A;  1MSW D;  3OV7 A;  4EFA C;  2QE5 A;  5KFI A;  2DNH A;  2MY8 A;  5IT4 A;  2DNY A;  2OFG X;  3M8Z A;  5KFF A;  1RAG B;  4CLS A;  1IKX B;  3I5A A;  3C8Y A;  1NJW A;  3C19 A;  3PX4 A;  5LJ5 Y;  3RAX A;  2K2P A;  5CAB A;  5HQM A;  5JXS A;  4JV0 A;  4IOB A;  4I69 A;  5D15 A;  1HWJ A;  2W2N P;  1VQS A;  2BOA A;  5DG7 A;  5J2P A;  3ZTR A;  4J90 A;  3HVT B;  1OY9 A;  3W1Y C;  3NS7 B;  1QAX A;  4Y2I A;  5CCL A;  1WWH A;  2LEB A;  2B4V A;  2M9K A;  2F7V A;  4C0H A;  4IFV B;  3TZZ A;  4DV1 F;  1VQ6 S;  3FBE A;  1WF0 A;  2IMW P;  3I32 A;  3VQT A;  2R42 A;  1NZA A;  2ZKU A;  1M1K T;  5IQQ A;  2D41 A;  2HWH A;  3D6M B;  1VIS A;  1ULR A;  5GMD A;  3HP6 A;  4AL5 A;  2CNK B;  1JMT A;  2HFN A;  1X4D A;  1I1G A;  1TL3 B;  4I6A A;  3S1T A;  2YKN B;  1PGZ A;  2B0G A;  3JXO A;  2B51 A;  4IH6 A;  2NXU A;  4UQT A;  3GYX B;  4TKT A;  4DS4 A;  4A8Y A;  3OR1 A;  5KT6 A;  3J7Z 5;  4P6Q A;  4C3M A;  1Y5N B;  2QV6 A;  5D3G A;  4X62 F;  3O1L A;  5ITH A;  2PT0 A;  2XBP A;  1IM4 A;  3LWM A;  1LKZ A;  2RSQ A;  1U6Z A;  2JZ5 A;  2MKJ A;  2WVF A;  5L38 A;  4F67 A;  3QRQ A;  2EXU A;  2C2D A;  1VJQ A;  3CJK B;  4DPY A;  5BJR A;  2CJB A;  2LFV A;  1Q4R A;  2A6O A;  4ELV A;  1OS5 A;  1QAJ A;  1ZPW X;  1KRP A;  3H5U A;  2F63 A;  3HF5 A;  5J2M A;  1S99 A;  3UDE A;  1GTH A;  2F1F A;  4HI2 A;  4IFV A;  1R43 A;  1YHQ S;  3RJM B;  1WKK A;  4ED6 A;  4KHR A;  4JI6 F;  4ZVG A;  3M6X A;  5HSP A;  2PEB A;  1FF2 A;  4O3Q A;  3V4M A;  1UVI A;  2V94 A;  2OH2 A;  5BYS A;  4HHU A;  1RDR A;  3DLH A;  4KKO B;  1ZZN A;  1ARO P;  1HWU A;  2JLE A;  3NCQ A;  3FSY A;  1TL3 A;  2YKN A;  3PTW A;  1W2I A;  4AXJ A;  4ZVR B;  5B09 A;  1S6Q B;  4CIO A;  2IMO A;  3IM9 A;  4OJ3 A;  2HSE B;  1CJV B;  3PXG a;  3L3C A;  3QID A;  4WFX A;  2L9W A;  4NLW A;  2B4P A;  1UEV A;  1QLN A;  4ELT A;  3T1Y F;  4FXW A;  5DZ7 A;  3KK2 A;  4IH5 A;  3MAH A;  2Q79 A;  3DLK A;  2Y8W A;  3EE3 A;  2UXD F;  2AKW B;  2F5G A;  1AB8 A;  4DR4 F;  4IDK B;  2R7W A;  2CG4 A;  1Q1K A;  3ZNJ 1;  4A4J A;  3KUH A;  1N4L A;  3DI6 A;  5FD1 A;  2V67 A;  1RGV A;  1X4H A;  1HHT P;  1VBY A;  4DCJ B;  5D4O A;  5IM0 B;  2PA3 A;  2I38 A;  4C11 B;  1VMB A;  1IVZ A;  3PW0 A;  3HSG A;  4W4M A;  1RTH A;  5B0D A;  3H5S A;  2FYX A;  2ZH6 A;  2FVP A;  2QIF A;  3OTO J;  4ZLJ A;  3SYZ A;  2DGT A;  1K1S A;  5CYM B;  4M5N A;  5DRK A;  4C8N A;  2W25 A;  3AD7 C;  3NOC A;  5ETV A;  5K8M A;  3NY0 A;  1HNZ J;  1EAR A;  1VQK S;  3EZ5 A;  1GMV A;  3SV4 A;  4W90 B;  4KKO A;  2WSE C;  3DOL B;  3K7R A;  2PA8 D;  1U6F A;  1QAI A;  4CT9 A;  3EJM A;  4RU9 A;  2WCX A;  1MWY A;  4F8R A;  3QGH A;  3RU0 A;  1S6Q A;  4U95 A;  1VS3 A;  1FDN A;  2HBZ B;  1FNX H;  4Y6I A;  1ZAX A;  2J9C A;  1VQM S;  2C2O B;  2CQ0 A;  2GO9 A;  3CCR S;  1ZTW A;  1WEZ A;  3IRX B;  4L6V 3;  4B9T A;  1N32 F;  1XER A;  4DV2 F;  4DFP A;  1FJ7 A;  3MM5 B;  4KYZ A;  2ZBQ A;  3HHD A;  1M90 T;  4FS1 A;  2XGP A;  3CDA A;  2XS5 A;  2M70 A;  2FJD B;  3LAK A;  5EHH A;  2CPE A;  4Q44 A;  1F5A A;  1UAW A;  3HHL C;  1TK5 A;  3R8Y A;  2BM1 A;  2NXN A;  1NLK L;  4DFJ A;  1RI7 A;  2ZJP Q;  1VC0 A;  1B64 A;  4PR6 A;  5IV3 A;  5IM0 A;  4C11 A;  1N48 A;  4DPU A;  1XR6 A;  5BYQ A;  2YKO A;  4USJ C;  4ZP9 A;  1LOU A;  1RWK B;  3FFI B;  2ZBR A;  4DL5 A;  3CCV S;  2C3O A;  2KT3 A;  1TKD A;  2R7O A;  2QA1 A;  2XMW A;  3EGW B;  5CYM A;  1OIA A;  3IR7 B;  2W4P A;  1UFK A;  5KFG A;  3GV8 B;  2AD9 A;  4PYA A;  3FEZ A;  2CWX A;  5D6G A;  5GAD U;  2LEC A;  3FVY A;  4J9N A;  3DOL A;  2R8G A;  3FCW A;  1NK4 A;  2L48 A;  3GV7 B;  3PW5 A;  3EXY A;  3IS9 B;  4KAI A;  1WI8 A;  2XMU A;  3R2D J;  1T95 A;  1BD6 A;  4CNZ A;  3TX8 A;  4H4M B;  5KFW A;  3TUZ C;  1U2F A;  1TVR B;  2ZH5 A;  3FZ2 A;  1UZH A;  1R3N A;  2RDI A;  3IRX A;  3VR1 A;  5HL7 Q;  3HJF A;  4KSE B;  3MM5 A;  1WD6 A;  2FGO A;  4G1Q A;  5KFY A;  3TZX A;  1UJ4 A;  5D8H B;  4KGX B;  3BSN A;  4DV5 F;  2WW4 A;  1UVK A;  3TRG A;  1VLY A;  2H4Y B;  3O44 A;  3G6E S;  2MZT A;  2DGW A;  4RUH A;  2CZ4 A;  1XMB A;  1I5O B;  3DHW C;  2BXJ A;  3HD2 A;  2XYP B;  3GWC A;  4JI3 J;  2Z2Z A;  3GIR A;  3W3S A;  1FKO B;  4PCQ A;  3FQL A;  3Q8V A;  4ZVT B;  4DSK A;  1EQ0 A;  2CA9 A;  3SCI E;  3DRX A;  3AH6 A;  2R7X A;  1U09 A;  2GNK A;  2VBY A;  2VQE J;  4M5I A;  2FJB B;  4ID5 B;  1TL4 A;  1WOP A;  4B3S J;  3LO3 A;  1HYS B;  1AYE A;  4TY8 B;  4B9V A;  1RBO B;  3KLV A;  1HR0 F;  5E3C A;  3EGV A;  2CQB A;  2V2V A;  1SC6 A;  3QPI A;  3K17 A;  1IQZ A;  2D3O 1;  1QTM A;  1VK3 A;  3AOA A;  1BC6 A;  3AOC A;  4PAA A;  1NPP A;  1LWF B;  1S49 A;  3PYF A;  3J80 U;  1SC4 B;  4OI3 A;  1PO6 A;  2ACY A;  1BWV A;  4H4M A;  1KVI A;  2FLN A;  3TAR A;  2JVR A;  1TVR A;  1C1B B;  1R0C B;  4J7C A;  3SFG A;  2CWK A;  4F2R A;  5DGA A;  5DDQ C;  3RBX A;  2ROE A;  3QGI A;  1U24 A;  1NAQ A;  2LDY A;  1SUQ B;  5JVG Q;  4Z7C A;  2EKN A;  2PMZ D;  4DR1 J;  4IG0 B;  1RHJ B;  2E44 A;  3EGZ A;  4LSN A;  1WG4 A;  3G96 A;  1Q53 A;  4P2M A;  4HTJ A;  4WZM A;  3OTO F;  4HT5 A;  4OI1 A;  4FBT A;  3A8E A;  2CPF A;  4CLK A;  5LMU J;  1YVF A;  2VFV A;  4L3K A;  1HNZ F;  5A2Q Y;  3X3U A;  4DN0 A;  2BM0 A;  4NI2 A;  2MQP A;  5KFS A;  2N82 B;  3CC2 S;  3DM2 A;  2M3D A;  2RU3 A;  3DYA A;  1X0F A;  3OJS A;  2GVD A;  4JV5 F;  4OX7 A;  2VKR A;  3VAI A;  1DAX A;  2CQG A;  2RB7 A;  3V5R A;  1N36 J;  3L4B C;  4DWI A;  1S0N A;  2DH7 A;  4ID5 A;  1HAR A;  3N28 A;  4CTA A;  2VB6 A;  4Y2A A;  2W9B B;  4ZPW R;  3OFH A;  3MPY A;  2FPH X;  4TY8 A;  3G86 A;  4DV7 J;  3P8B B;  4F3Q A;  4LR7 A;  5ETN A;  4LBP A;  4PXC A;  3W9J A;  5F8N A;  1WC6 A;  2RF2 B;  5DLG A;  4CO5 A;  1LWF A;  3M6W A;  3FSI A;  2BAC A;  5HMY A;  5I3Q A;  4G65 A;  3C15 B;  3WBZ A;  1SQG A;  3MUM P;  1NK6 A;  1Q7L B;  5HRO A;  1C1B A;  1R0A B;  4QBU A;  2PII A;  3A3N B;  2G0J A;  2P9G A;  4KY3 A;  1SUQ A;  3ISN D;  1GXL A;  3D5M A;  3POT B;  1EJ7 L;  2ZBC A;  4IG0 A;  2J6T A;  3NMR A;  3R5B A;  5J2Q A;  5L39 A;  3CMQ A;  3V6D B;  4W92 B;  3Q0A A;  2EW9 A;  3KMS A;  1KC8 T;  3UCU P;  3MCO A;  1UEK A;  2AGO A;  3KHL A;  2RNE A;  1VOM A;  4C6A A;  4FP9 A;  3OSP A;  2E5J A;  1FVS A;  2Q3P A;  4A8X A;  1O51 A;  4ITS A;  1N5T A;  5B0E A;  3OW2 R;  1IQT A;  1VR6 A;  5HAN A;  4W98 A;  5D4P A;  2GIF A;  1TFY A;  3AOB A;  4NCG A;  2W9B A;  3KJV B;  1UVL A;  3Q2T C;  2QMX A;  5J1N A;  1B4S A;  1GT8 A;  2NPF A;  2X1B A;  3BN7 A;  3RYL A;  2YH1 A;  3P45 B;  3W5X A;  2C1E B;  5B0F A;  2XG8 A;  3IM8 A;  2RF2 A;  2ZOM A;  4JP8 A;  3CCS S;  4ILM A;  2ROP A;  3K5M A;  4K4V A;  1U1P A;  1RTI B;  1NND A;  2DTJ A;  2HQD A;  3C15 A;  1FDB A;  2G0I A;  4LQ9 A;  3Q8U A;  5I4M A;  4A46 A;  1R0A A;  5CQG A;  2ASD A;  4JI3 F;  4HDH A;  4K7Q A;  4OYP A;  1U25 A;  4FF4 A;  4DR7 J;  2ZE2 B;  2R7S A;  5DO2 A;  2P6T A;  2KYX A;  2XNR A;  4RPF A;  2VH7 A;  4Q5V A;  4UUX A;  3CUN A;  2HS3 A;  4OJH A;  3MED B;  2CAD A;  4E98 A;  4KFB B;  4B3S F;  1RLC L;  4K2J A;  4XPC A;  3PFE A;  1U47 A;  1PBU A;  1T3N A;  2HRT A;  4ECV A;  3G6Y A;  4TVA B;  1UVM A;  3EM1 A;  4NCB A;  1X4G A;  1SC1 B;  3JB9 k;  2Y1L B;  4NPO A;  5ETM A;  3DLJ A;  1B0P A;  3PVX A;  2RRA A;  4NCA A;  2V5H G;  1OSD A;  3DRS B;  2GC8 A;  4N8O A;  2QL7 B;  1N88 A;  4QR1 A;  3NGS A;  2XS2 A;  2YNI B;  4TY9 A;  1D8Z A;  3MOJ B;  1NH7 A;  4LIR A;  3KJV A;  1ITP A;  1Q0N A;  1N0V C;  3JSB A;  3V6J A;  3C6U B;  4DQS A;  1T9W A;  4KTQ A;  4DLE A;  2L9N A;  5L9N A;  2VA3 A;  3ZZY A;  3PAC A;  2AYE A;  1S1W A;  2RHQ B;  2O66 A;  3M9N B;  1RTI A;  3AJ2 A;  1VIX A;  3DC2 A;  4KC5 A;  2IRX A;  2FQQ B;  2C2E A;  2MQO A;  4PZV A;  4CLZ A;  2RHS B;  4BHQ A;  2KZM A;  2IJN A;  2VOD A;  3G87 A;  3NXZ A;  3FBB A;  5LMU F;  4QCL A;  1U0S A;  1YGY A;  2ALZ A;  2ZE2 A;  4DSE A;  1NHK L;  3HZE A;  4IQM A;  3V6K A;  1YX2 A;  4UF4 A;  2DXE A;  3MED A;  2WTF A;  4DG1 B;  5H1S V;  1N36 F;  1N54 B;  4OYO A;  4P9S A;  4A8M P;  2CNO B;  4KFB A;  1RWO B;  3BGL A;  3S7R A;  4H4O B;  5ETP A;  4WZQ A;  1I94 J;  2YWW A;  2I6W A;  3BEG B;  3FMW A;  4EMD A;  3KTQ A;  2NR0 A;  2JOQ A;  1X5P A;  4DV7 F;  4B02 A;  3MUR P;  2CUY A;  1YIJ S;  3TOQ A;  1DBD A;  1T9U A;  3CD0 A;  4CLP A;  2CPH A;  5CZX A;  3CPW R;  1TEL A;  3CMA S;  3IRW P;  1RA7 A;  4E2F B;  3DRS A;  2B43 A;  4IO1 A;  4WP9 A;  1RAB B;  4RNM A;  3G9C A;  5ETS A;  4LVO P;  1K73 T;  4B3O B;  4ZVE A;  1RKI A;  4OV6 A;  1DHM A;  4DDF A;  4DR5 J;  1LXN A;  3HPO A;  4N47 A;  3CCT A;  4DSF A;  3VAJ A;  2KU7 A;  4IR1 A;  2EG2 A;  4EK2 A;  4DUY J;  3FEX B;  4DN9 A;  2QJ3 A;  5ETK A;  3TWZ A;  1IWA A;  4OZN A;  2GML A;  2KXH A;  4DL4 A;  3CJ0 A;  4MKY A;  2K06 A;  4NA1 A;  5HP1 B;  3DRP B;  3QFH A;  4KGM A;  2RIL A;  4YY3 J;  3D67 A;  2K3I A;  2QG9 B;  1D9D A;  2CXE A;  4K4W A;  5B0B A;  1HWI A;  4NX9 A;  1T94 A;  3EVM A;  1FX2 A;  1HLW A;  5HJY A;  4K50 A;  2NSB A;  1REG X;  1WHY A;  1DLO A;  3D2W A;  1SB6 A;  2RVJ A;  4H4O A;  3PZP A;  4B3T J;  1ZBT A;  1Z4U A;  4LF8 F;  4A8Q A;  1HMV B;  2BQU A;  6AT1 B;  2JFK A;  1LXJ A;  2UUB J;  4RWW A;  4DL7 A;  2WB4 A;  1FKA F;  3M4X A;  1S1X B;  2AJ4 A;  1BLU A;  2F3J A;  3TQ1 A;  4PWD B;  2IA0 A;  2OEJ A;  3PR5 B;  4JBC A;  2XZT B;  4JI2 J;  4ES2 A;  1RAE B;  1G4C A;  1U8S A;  4B3O A;  2J9E A;  2AGP A;  2FD2 A;  5D0E A;  4DR7 F;  2JEI A;  1FRL A;  3LWL A;  1KEK A;  1F3V A;  4ZP7 A;  1FWL A;  1RT3 B;  2OD6 A;  1URR A;  1CJK A;  3K8V A;  4LSZ B;  4BWJ A;  3G8S A;  1VQ4 S;  4DBQ A;  2QLB B;  5KFP A;  3OD2 A;  5HP1 A;  4RNN A;  2GZO A;  1TV6 B;  3OLA A;  2CG8 A;  3TZW A;  3OQ2 A;  5DLF A;  3R3T A;  3BQ1 A;  2X3D A;  2ZH7 A;  2UXC F;  1REV A;  3UPF A;  4EBC A;  2YNG B;  2OUG A;  3BQ0 A;  1S4F A;  5KG4 A;  5D0G A;  4DX7 A;  1X5S A;  3K8W A;  2J8A A;  4OZ0 A;  2LXU A;  4IRD A;  4ZN1 A;  1HMV A;  1JXL A;  2YX7 A;  3NGK A;  2VDI A;  2XWY A;  4YR0 A;  2RDJ A;  3IN5 A;  1YBT A;  3H98 A;  1U7L A;  1HNI B;  1Q82 T;  1ZAV A;  4EBE A;  1S1X A;  4OX6 A;  3K5O A;  4YP3 A;  3LQV A;  1S4E A;  4PWD A;  2MGZ B;  2DGS A;  3KFW X;  2BKN A;  3FKB A;  2E5I A;  4E0D A;  4LR8 A;  1SCJ B;  4QR2 A;  3QFW A;  2W8L A;  2PMH A;  4F7V A;  2OFH X;  4PAB A;  4ZDN A;  1IN0 A;  1YJU A;  1RWV B;  3I4P A;  5D0H A;  1CS4 A;  4NEY A;  3OVA A;  1RSC A;  1RT3 A;  2OKQ A;  4Q8F A;  3UO0 A;  5IV4 A;  3HT0 A;  5D4L A;  2AZ3 A;  1FT8 A;  5SZT A;  2Z56 B;  4A8W A;  1I94 F;  3ZFV A;  4LFB F;  3ENV A;  3CME S;  2Y9H A;  4C8O A;  1QM9 A;  1TV6 A;  3LUY A;  3K0J A;  5KT4 A;  2VOP A;  3TVK A;  2IM0 A;  1U48 A;  4HAC B;  1SH2 A;  1HNV B;  4M94 A;  2DNR A;  2FHK A;  2Z30 B;  2DB1 A;  1N5V A;  4J9Q A;  4OHY A;  2BE2 A;  4FZV A;  3AT1 B;  4K59 A;  1OO0 B;  2CJX B;  1YRX A;  2Q6C A;  3V4I B;  3MPW A;  2DNK A;  5CCM A;  3ZZP A;  4A8K A;  3UNY A;  2EFO A;  3OXL A;  2WB1 D;  1KKH A;  4M5D B;  4JI0 J;  1F9F A;  4DR5 F;  4J91 A;  2X1F A;  3AXM A;  1HNI A;  4RBU A;  2H65 B;  1YJT A;  3M8S A;  4ZCI A;  4X4U A;  2DNN A;  1TUW A;  2ZJR Q;  4DUY F;  2MGZ A;  5IQ6 A;  2YPY A;  2JL9 A;  5CH7 B;  3CCL S;  3CVK A;  1KFS A;  3Q2S C;  1C0U B;  1VIO A;  4LIW A;  4X4S A;  4BC9 A;  4TQS A;  2OEL A;  2HHH J;  4YY3 F;  2NYI A;  1VQO S;  4CYU B;  1ELO A;  2HFV A;  2LU1 A;  1GXU A;  3PW2 A;  1D9A A;  2DRB A;  1RWU A;  4ETZ A;  4AD6 A;  5C5J A;  1W7W A;  5GAG U;  2VC0 A;  2KJW A;  2KTQ A;  4NZ6 A;  3B4D A;  2MZQ A;  5KG1 A;  3RW6 A;  4ICL A;  3HHL B;  4B3T F;  4OHV A;  1D1U A;  2BV3 A;  3K58 A;  2KT5 A;  3H5X A;  3UVJ B;  5F8I A;  4NLG A;  1D3W A;  4P7V A;  1SKU B;  5K14 B;  1Q16 B;  3BQ2 A;  1FD2 A;  4AL7 A;  4HAC A;  2HRY A;  4GKJ J;  1HNV A;  2UUB F;  2R7V A;  1CQN A;  1MML A;  4OYA A;  4L3N A;  2ZH8 A;  1A6L A;  3UE2 A;  3V4I A;  4LFC J;  2R2T A;  4JI2 F;  4Q8E A;  2ZD1 A;  5E2Q A;  1QSY A;  4S0M A;  1KD1 T;  1A9N B;  1O8B A;  3MHY A;  1LK7 A;  1H0H B;  3CNQ P;  4M5D A;  1LWX A;  4K4Z A;  2BE9 B;  3PV8 A;  3PYG A;  1E6V B;  1VJW A;  1JWW A;  4H4K A;  3I5C A;  2VPZ B;  2V2Q A;  5LSR A;  2RQC A;  5HBM B;  1R27 B;  3TVZ A;  3W8G A;  1VGY A;  5KG5 A;  2UUC J;  1C0U A;  2MTL A;  1RYS A;  2E29 A;  1IR1 A;  2G9O A;  4E8U A;  2H3E B;  3KLG B;  3M2V B;  1FWK A;  1V9O A;  1BQN B;  2M8H A;  4CYU A;  2POK A;  5L1L A;  1VCT A;  3TP2 A;  3KNA A;  1RAA B;  2M5Y A;  4OL8 A;  2WBR A;  2GAG C;  2VJU A;  4RLE A;  4CO3 A;  3EPG A;  5A8R A;  2QL9 B;  2R3V A;  3HHL A;  2HKE A;  2HRU A;  4X65 J;  3UVJ A;  4BDP A;  2ALY B;  5K14 A;  4M5M A;  2MLZ A;  1CBK A;  1PJ6 A;  2KVQ E;  4EBD A;  2YNH B;  2J0X A;  2DPI A;  4WYW A;  2HHV A;  2MQL A;  4MK9 A;  1JXV A;  5KG2 A;  2Z2L A;  3QAU A;  4PXE A;  1IBL J;  2LQJ A;  2DHX A;  2B56 A;  2I1R A;  4WK1 A;  1JJC B;  4ZVP B;  4ER8 A;  4NLQ A;  1HBU B;  3I9V 9;  1T7P A;  3G8Q A;  1FJC A;  3OR2 A;  2PEH A;  1VBK A;  5B7W A;  1WSR A;  4DR2 F;  2GO8 A;  3SDE A;  1GH8 A;  3EDQ B;  1E6V A;  3NGU A;  3THT A;  5EDW A;  3CCE S;  1CJU A;  4GKK F;  3VGT A;  2E5G A;  2R9L A;  2HNY B;  5HBM A;  3DLB A;  3LTO A;  3DRR A;  2E5H A;  4KGK A;  3QQC D;  2QC3 A;  3HZG A;  3NP5 A;  4I56 A;  3RRG A;  2GHV C;  1BQN A;  1ZYQ A;  2XMJ A;  1WC0 A;  5IT0 A;  2I5J B;  2VFR A;  4ATN A;  2Q66 A;  1S97 A;  1RJJ A;  4F02 A;  1FRM A;  5BR8 J;  4CLU A;  5KFB A;  2KHD A;  4F50 A;  4ZVS B;  3H4B A;  4K0K F;  3MR5 A;  3D6T B;  3VWS A;  2DR5 A;  3SSS A;  3KJQ B;  1IJE B;  1B7F A;  4JI0 F;  2YNH A;  4OZL A;  3FCH A;  1UFW A;  3W2V B;  1IKY B;  1VDH A;  2HAI A;  4GVB B;  3IBC B;  3MWB A;  1U2C A;  2BKO A;  3CED A;  3TZY A;  4I4B A;  3JTO A;  4J9U E;  1Y7P A;  2DNP A;  3I55 S;  2FC9 A;  2NLW A;  2W7O A;  1D0E A;  4KB7 A;  3M8P B;  1U2R A;  1WEY A;  1K1Q A;  4DV4 J;  2CZV C;  4CLF A;  2OI2 A;  3MMC A;  2NYH A;  4USV A;  1I6J A;  1NK9 A;  1Z2Z A;  4ZCL A;  1T9Y A;  2BJ9 A;  4RW9 B;  2HHH F;  1LQ9 A;  2DEI A;  1HWL A;  2NXJ A;  3IG1 B;  3H42 A;  5AXK A;  4WXO A;  4NEZ A;  4DEZ A;  3LW5 C;  4J37 A;  2DGQ A;  6FD1 A;  1PSD A;  2HNY A;  4HYK A;  2D1C A;  1J27 A;  3K2Y A;  3GYG A;  1FFG B;  4ZPT R;  3T9Z A;  1FK9 B;  4ZPD A;  3VVU A;  2FY1 A;  2YQ3 A;  3L9Z A;  4IOC Q;  4QYZ J;  4TLR A;  1JKH A;  3FC9 A;  4KQZ A;  2WON B;  7AT1 B;  2I5J A;  3UWT A;  2IVY A;  5HVF A;  3TAP A;  2QLJ B;  4ED8 A;  3C46 A;  3CJT A;  2XSJ A;  1Y5L B;  2KJV A;  4M63 A;  1BQM A;  3H7H B;  1D09 B;  4NML A;  1QY7 A;  1B0V A;  3EGN A;  4QZV B;  3DHX A;  3GFY A;  2A2C A;  2YVS A;  4QIF A;  3CTR A;  1NO8 A;  1PC5 A;  3CCW A;  1PCA A;  4ZJO A;  4QWD A;  3W2V A;  1TAQ A;  4OI0 A;  1IKY A;  4GVB A;  1TMJ A;  4FF3 A;  4PG5 A;  3WC2 A;  1UP1 A;  2GQQ A;  3JAM U;  3PCO B;  4PPZ A;  5KFR A;  2JFD A;  2Y0S D;  1TL1 B;  4OYX A;  1J2V A;  4EZ9 A;  1WC3 A;  2LXF A;  4MFB B;  4ECR A;  3M8P A;  4QOT A;  2MMY A;  3D1H A;  3EZU A;  5LSL A;  1LFW A;  1NJY A;  2N4D A;  3GJQ B;  4RW9 A;  3U27 A;  3Q8R B;  4OLO A;  2KHC A;  4I2P B;  3R2C J;  3IG1 A;  4O0N A;  4HR2 A;  5F8M A;  4NLU A;  3C6T B;  3EWG A;  3KK1 A;  2HGM A;  3NNH A;  2MDA A;  3GG0 A;  3KLI B;  4D3H A;  1HKA A;  1EHW A;  3D3C J;  5DET A;  2MHN A;  2XYH B;  2I0X A;  4G6V B;  3B4M A;  3QIP B;  1FK9 A;  2RD5 C;  2ASL A;  4CO0 A;  2FVS A;  3GZ7 A;  1WF1 A;  1KS2 A;  2VFU A;  4DUT A;  3I82 A;  2W9C B;  4OHX A;  1U02 A;  2RU9 A;  1YWX A;  1X4C A;  4WFY A;  5KFM A;  1TUG B;  4F0H A;  2R8I A;  1IBL F;  2U2F A;  1JLG A;  3BYR A;  3UQS A;  5LT5 A;  3PHE A;  2CDR B;  4ES3 A;  4ECQ A;  2IPO B;  4LUB A;  3KLH B;  1WHV A;  2JEF A;  3J7Y I;  1TK0 A;  5CA5 A;  1FXL A;  4DL3 A;  5ETO A;  4HHJ A;  1EET B;  2HMI A;  2EBE A;  3MR6 A;  1HQE A;  1FDD A;  5D77 A;  3BGO P;  2C22 A;  4NL5 A;  1EZZ B;  4DZ6 A;  2IC3 B;  5L8R C;  2ZFH A;  3MMJ A;  4I68 A;  4JI5 F;  3IR6 B;  3NBP B;  2AJF E;  1RWP B;  2JVO A;  1OSC A;  3ETO A;  4QIW D;  3TI0 A;  1ZM3 A;  3VAG A;  5LXR A;  3ZNU A;  2XZD B;  3R27 A;  4TYB A;  2EKY A;  4I2P A;  3C6T A;  5F3T A;  2HHP A;  2GA7 A;  5CYJ A;  4TQR A;  3KLI A;  2ZH4 A;  5BR8 F;  4DPW A;  3CJ4 A;  4QQB A;  5CYQ B;  3QIP A;  1GEH A;  2HW3 A;  2KFY A;  1DTQ B;  1Q5V A;  2FLO A;  3R5A A;  2W9C A;  1RWN B;  5LOQ A;  1TKT A;  1FJG J;  1OJ4 A;  1CUL A;  4KGZ B;  2VQF J;  3ILI A;  3QT5 A;  3PRV A;  4FVC A;  3OXF A;  3FGV A;  1NSA A;  3KLH A;  2AYM A;  4DV4 F;  3E51 A;  1XNR J;  1Y3K A;  3SMZ A;  5LJ3 Y;  3IO1 A;  1EET A;  1GQE A;  2VU5 A;  1P9Q C;  4RNH A;  1YBA A;  4LF4 J;  1FD8 A;  1MN9 A;  2RDD A;  1VQY A;  4DX5 A;  3AHP A;  2IC3 A;  1RCO B;  1ZH5 A;  5F0W A;  1U6B A;  4QWB A;  4L74 A;  4A8S A;  3NBP A;  5T7L B;  1S9E A;  4FDF A;  2VZ9 A;  4B9N A;  4B9M A;  1L3S A;  1UA1 A;  4WE1 B;  1IWG A;  2J6S A;  3MD3 A;  2MQM A;  3ISZ A;  2PO4 A;  2YQ1 A;  5JJB A;  2XGQ A;  4USM A;  3PNI A;  4Q45 A;  4OI6 A;  2VF3 A;  3KLE B;  3WIV A;  2ZDP A;  3R1H A;  1PBA A;  3ILL A;  2AHO B;  1KLM A;  1JJH A;  3ZZO A;  2HVD A;  5CYQ A;  4ZPC A;  2RH3 A;  1T05 B;  3N0V A;  2AEF A;  2QLX A;  3C14 B;  3MFI A;  2QMW A;  4OI4 A;  4WWS A;  1RAI B;  1RQ0 A;  2FC8 A;  1CSJ A;  4ZKA A;  3DMJ B;  4Y2M A;  2FZG B;  4QU6 A;  2JNJ A;  3B82 A;  3QLH A;  4JV1 A;  4ZOS A;  4C8Z A;  3SSQ A;  4X66 J;  4B9S A;  2V8H A;  2BAB A;  1AUD A;  1FXR A;  3BPS P;  2RRB A;  4L76 A;  3O8W A;  1NK0 A;  2PI4 A;  4FYV B;  4DR6 J;  1KTV A;  4C8L A;  2LEA A;  3TAM A;  3VCD A;  3TR5 A;  2UU9 J;  2R2U A;  1DAR A;  2EK1 A;  4YDD B;  3SIP B;  1PIL A;  2FVR A;  1N5Q A;  3ETM A;  2XUL A;  5K5M A;  2FB0 A;  2HHU A;  5E0O A;  2CQ2 A;  3U02 A;  2RAQ A;  1DTT B;  3RZA A;  2G1H A;  2E9T A;  1OPI A;  5T7L A;  4FXV A;  4YDX A;  1FXD A;  1U0H B;  3FBF A;  3W7B A;  4Y28 C;  3IMQ J;  2ZNZ A;  4WE1 A;  1VFJ A;  2DNG A;  2CPI A;  3FNN A;  1S79 A;  2MKC A;  1BY9 A;  4BWM A;  1FRH A;  1Q79 A;  3QMQ A;  3H59 A;  3KLE A;  3ZC4 A;  1J5E F;  2MEW A;  3MEE B;  3IBF B;  5DZ6 A;  1HD0 A;  2B9W A;  2A10 A;  3MR2 A;  2QYC A;  3HSD A;  5EN1 A;  1UVJ A;  4X4T A;  3CDW A;  5D78 A;  1SV5 B;  1T05 A;  3M30 B;  2ILY A;  2CQ1 A;  4F04 B;  2WVB A;  2G13 A;  1B99 A;  3DDI A;  2DPJ A;  4XTT A;  3MCN A;  4OLP A;  1B3T A;  1MLA A;  4O3R A;  1NH8 A;  3QT8 A;  4YB7 A;  2MYF A;  3CIZ A;  3T6J A;  3WX8 A;  2QSW A;  1JJ2 R;  2NZ4 A;  3KOA A;  3KDN A;  3MDF A;  3K57 A;  3P5B P;  5E33 A;  3N5B A;  1O5J A;  3N6M A;  1FNO A;  1PG5 B;  3T1H J;  2FHM A;  2HZC A;  1Y10 A;  3US5 A;  4F0M A;  4ECX A;  2R7R A;  4F36 A;  2R7T A;  3VV2 B;  3F0N A;  3N9U C;  4NXM J;  4YUD A;  4R8U B;  2QYG A;  1E6Y B;  3KUE A;  3T1Y J;  3GLJ A;  2IM3 A;  4NZ7 A;  1DTT A;  4PEO A;  1H2U X;  1K0T A;  2HQC A;  4RU2 A;  3PIP Q;  1U0H A;  2VOO A;  4OHW A;  1RE1 B;  1S72 S;  1T02 A;  2HK2 A;  1KFD A;  1S0M A;  3BBB A;  1KQG B;  2ZWO A;  2YKM B;  4DCP B;  1NZ8 A;  5KFZ A;  2Z0G A;  2HLT A;  4NE9 C;  3MEE A;  1FJG F;  1HA1 A;  5RUB A;  5L1J A;  4J9P A;  3OBI A;  2VQF F;  2GVZ B;  4Q2M A;  2ZH3 A;  3R1L A;  5KFV A;  2WVC A;  2CJK A;  2FJX A;  1SV5 A;  2KL8 A;  3M30 A;  1ZET A;  1FEH A;  2WSF C;  4P2F A;  4C3L A;  1XNR F;  2KI2 A;  2X3G A;  3CCQ S;  1JQG A;  1RB0 A;  2HVI A;  1FES A;  2HFZ A;  2DXF A;  3FDS A;  5IZH A;  1EIY B;  4LF4 F;  2RE1 A;  2CNN B;  1X4B A;  4BCA A;  2KRR A;  1NDP A;  4DF8 A;  3QAT A;  5ETQ A;  2OMO A;  3B54 A;  2GIQ A;  2M52 A;  3VF0 B;  3G6V A;  3RR7 A;  3JQJ A;  1YIT S;  4XPE A;  5KG0 A;  2FJW A;  1IR2 A;  1F6T A;  3FZB A;  2RS2 A;  1EX8 A;  3D66 A;  3BBC A;  4IKA A;  4R8U A;  1HW8 A;  4CCH A;  2OPS B;  1H6K X;  1N32 J;  2ZOF A;  4DV2 J;  3PJX A;  3B8H A;  2CPZ A;  2J6U A;  2NXC A;  5A6P A;  1Q8L A;  2DIS A;  3CCJ S;  5LM7 E;  3RB3 A;  3NOG A;  2DNZ A;  3ICL A;  1HQU A;  4RZR A;  4HT7 A;  4FVM A;  3SQO P;  4KPC A;  2V4J B;  3L7U A;  1NJZ A;  4KGV B;  3TUP A;  2BOP A;  3N6N A;  1EKS A;  2R7U A;  2P2C B;  1IKW B;  5KT7 A;  5FDL B;  3ULH A;  2MLX A;  1AFI A;  1V3S A;  4UT4 A;  2WW8 A;  3E2E A;  3IA0 A;  2GVZ A;  3QGP A;  2V50 A;  3FBC A;  4X66 F;  3GB0 A;  1QSL A;  4ED5 A;  4U7C A;  3NRB A;  4ZVF A;  3N79 A;  1UTA A;  1ZM9 A;  3CJR A;  4DR6 F;  4JUZ A;  1B70 B;  4LRF A;  4EYI B;  1QTN B;  2UU9 F;  4PQU B;  2FLL A;  3GU0 A;  1VHF A;  2ZH1 A;  1WC5 A;  1PJ7 A;  1SH3 A;  2W9A A;  3MMA A;  1WEX A;  3KMQ A;  2XY6 A;  1MWQ A;  1N33 J;  2OPR B;  4GRS A;  3A13 A;  3H90 A;  3GIM A;  5MAO A;  2C2R A;  4N76 A;  4IFY B;  1IKX A;  4NWB A;  2OGU A;  5E3Q A;  1RAO A;  3HVR A;  4ED0 A;  1T03 B;  3S01 A;  4J9L A;  2V8G A;  4C9D A;  4ZVO B;  4K5S A;  1YZ7 A;  1U49 A;  2HS0 A;  1NSK L;  2OPS A;  5CD4 H;  5DG9 A;  2BAN B;  4ANC A;  1ZA1 B;  4FPR A;  3UFC X;  1A7G E;  3HVT A;  2GHW A;  3M2R B;  4DV5 J;  3RUB L;  1QVF R;  2CJ9 A;  2GJF A;  4DFK A;  2KG1 A;  3M8R A;  4DQQ A;  1NHV A;  4Y34 A;  4EU0 A;  1HNX F;  2XHW A; 
#chains in the Genus database with same CATH homology
 1WC6 A;  1WC4 A;  3C14 B;  4WPA A;  5D0G A;  1WC1 A;  1Y11 A;  3C15 B;  3C14 A;  3C16 B;  3R5G A;  4CM2 A;  1AB8 A;  1WC5 A;  1TL7 A;  4CLL A;  1AZS B;  1U0H A;  4USW A;  4OYO A;  2WZ1 A;  1YBT A;  4P2M A;  2W01 A;  1CJT A;  5D0E A;  3ET6 A;  3MR7 A;  4CLW A;  4USU A;  4CLY A;  3G82 B;  4CLK A;  4NI2 B;  4CLS A;  3MAA B;  1CJU B;  3UVJ B;  4OYI A;  1CJK B;  4OYZ A;  3C15 A;  3G82 A;  4NI2 A;  3C16 A;  4P2X A;  3MAA A;  1CJU A;  2GVD B;  1CJK A;  2QV6 A;  1FX2 A;  2GVZ B;  4CLF A;  4WP8 A;  1AZS A;  4USV A;  4CM0 A;  2GVD A;  4CLP A;  4WP3 A;  4OYP A;  5D15 A;  4OYA A;  1CS4 B;  4OYM A;  2BW7 A;  4OYW A;  5D0H A;  4CLT A;  1CS4 A;  5IV3 A;  4P2F A;  4OZ3 A;  4WP9 A;  3UVJ A;  4OYX A;  4UST A;  1WC3 A;  1CJV B;  5D0R A;  1CUL B;  1WC0 A;  1YK9 A;  1TL7 B;  1Y10 A;  5IV4 A;  4OZ2 A;  1FX4 A;  1CJV A;  1U0H B;  1CUL A;  2GVZ A;  1YBU A;  4CLZ A;  1CJT B;  4CLU A;  3ET6 B;  4OYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...