1WC3A

Soluble adenylyl cyclase cyac from s. platensis in complex with alpha, beta-methylene-atp and strontium
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
198
Chain Sequence
SHMRPEPRLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFENQGTVDKFVGDAIMALYGAPEEMSPSEQVRRAIATARQMLVALEKLNQGWQERGLVGRNEVPPVRFRCGIHQGMAVVGLFGSQERSDFTAIGPSVNIAARLQEATAPNSIMVSAMVAQYVPDEEIIKREFLELKGIDEPVMTCVINPNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADENYLATE CYCLASE
publication title Bicarbonate Activation of Adenylyl Cyclase Via Promotion of Catalytic Active Site Closure and Metal Recruitment
pubmed doi rcsb
source organism Spirulina platensis
molecule tags Lyase
total genus 65
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2004-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1wc3A00
4WP3A 2BW7A 3MR7A 4P2FA 1CJTB 4CM0A 4P2XA 4USUA 4WP8A 1Y11A 1CS4B 4CLWA 1AZSB 4OZ3A 4NI2B 1YBUA 5D0RA 2GVDA 4CM2A 3C14B 1WC4A 4CLZA 4NI2A 4CLPA 1WC3A 1FX2A 4OZ2A 4CLTA 1YK9A 3UVJA 1CJUA 5D0HA 4OYBA 1CJVB 3R5GA 4OYOA 1CJTA 3MAAB 2GVZB 5D0EA 3C15B 1CULB 1CS4A 1AZSA 4CLKA 4OYXA 4CLLA 1WC1A 4OYAA 4OYMA 3C15A 4CLSA 3C14A 4P2MA 5IV4A 4CLUA 3C16B 4OYIA 1CJKB 3ET6B 4OYZA 4WP9A 5IV3A 5D0GA 1YBTA 4USTA 1WC6A 1WC5A 1Y10A 2QV6A 1U0HB 1CJKA 1TL7B 1AB8A 1CJVA 1WC0A 2W01A 3MAAA 1U0HA 2GVZA 2GVDB 4CLFA 1TL7A 1FX4A 1CULA 2WZ1A 4USVA 4OYWA 4USWA 4WPAA 3G82B 3C16A 4CLYA 3UVJB 3ET6A 1CJUB 4OYPA 5D15A 3G82A
chains in the Genus database with same CATH superfamily
5JJBA 2CZ9A 1R0BG 2ILZA 4YR2A 1WACA 2HMIB 2PD1A 1ZAWA 4ZJOA 3NBPA 3GMGA 5LOQA 1T05B 4NCBA 1WTBA 4OQJA 5HO4A 3R2CJ 4K8RA 2YX4A 2RDDA 1IKWB 4ECSA 4PXDA 2ZM6F 4JV0A 3HSGA 3K89A 4KAIA 2V4RA 1TMJA 4X4UA 2IM0A 1S79A 1UVJA 3P45B 1FJGJ 4RNNA 5DG9A 3C15A 4DV0F 5FIIA 1RAOA 4Q2MA 3KNAA 4GVLA 3QLHB 4NMXA 3IA0A 2DBBA 2MHEA 1RWVB 3G2XA 4C8MA 3C46A 1JLFB 2H3EB 3UNYA 3MAAA 1FX4A 1QUPA 3A8EA 4DL2A 2XS5A 2W4PA 1V6HA 1T95A 4OI0A 4FZVA 1FDAA 2YQ1A 5J2NB 2QMXA 3MDFA 1UFLA 2J7KA 1EETB 1FRHA 3FQKA 2H5JB 4KT0C 3HDSA 2C3UA 2PC6A 4A48A 4Q0BA 1NEEA 1KOOA 1X9SA 4LF4J 3TAMB 2XULA 2XLIA 2J9DE 1NKEA 1ULRA 4NLQA 5D0HA 4L73A 1SH0A 1GAOA 4LF7J 1RA7A 3B54A 3TO8A 1K47A 1X4GA 2DNYA 2ZH9A 2DR8A 4IOCQ 4A8OA 1LK7A 1WG5A 3LAKA 3POTA 1ZS6A 2H5IB 4OYZA 1U2RA 1KVIA 4LF6J 3DRRA 3LP1A 4TKTA 3BN7A 3SFGA 3IBCB 3BQ2A 3AT1B 2KB2A 1UA0A 4MIWA 4XK8C 3PACA 2JC1A 4DDFA 5KAKA 5E0OA 4DX6A 4WXOA 1G6BA 4DZDA 4R5PB 4OV6A 1KDNA 1S6PB 3HJVA 4WP8A 2BA9A 4ED7A 4M5LA 3V81B 2D3O1 1L3VA 2CVIA 4ED3A 2XZTB 2VPXB 2JVRA 1BC6A 2IBOA 1RTIA 4ALZA 4YS2A 4F4XA 2J0SD 3CE8A 1HBUA 1DTTA 2NXNA 3MTJA 2I5JA 2ZBCA 1JMTA 5HVGA 1NH8A 1TK8A 2P2CB 4DQSA 4ECWA 3M1VB 3PW4A 1RP5A 2B5JA 4O3RA 2VBWA 1S1XB 3TYTA 3TNVA 3QZ8A 1DTQB 4WE1A 2VFSA 1Q53A 1UAWA 3BV8A 2VONA 1NK7A 2M3DA 4QW8A 3PV8A 3IRWP 2DNHA 4L3NA 2VFTA 4HHJA 5F8NA 2EFVA 3WBZA 2KKHA 1ZM9A 5A8RA 1YJWS 2MY7A 2L48A 4G1QB 4OI2A 1S12A 3KLHA 3V6DA 1RTHA 2ADCA 1KQKA 1TV6B 4FYXB 4U7UD 3SSRA 5A8WB 4EMDA 3LWMA 2CRLA 5F8IA 2GO8A 2D1CA 2B4UA 3C14B 3GFHA 1VHIA 4CM2A 3NGUA 4DWIA 1JJHA 3QFWA 4K5SA 2FLPA 4CLPA 2V67A 3R8YA 5IWAJ 1JLQA 3MMJA 2DCLA 5CYMB 5KFFA 3RRKA 1SI9A 4BBYA 5IT9Y 1RT5A 4DG1B 2GQCA 4TQRA 3D9BA 3KUEA 3F44A 4KGVB 1SIZA 3HM9A 1QTMA 2RU3A 4FYDA 5LMUF 2VC0A 3A8JA 3JSRA 4OI1A 1F5BA 1LOUA 2QA1A 2AX1A 2XSJB 2YKNA 2RS2A 4GVBA 5AE1A 4OIXA 2QL5B 4UZCA 3IO1A 2BABA 3Q8RB 4LIWA 4OLPA 3GG0A 3TVZA 2HS3A 1IBMF 1I94F 2KXNB 5ADZA 1RKJA 1N5YA 3UDCA 2D7SA 1DLOA 1PAEX 3ZTQA 2LCWA 5G0RB 1LWEB 4M63A 3PX6A 4W92B 2C2MB 3S8SA 4DPWA 2F3JA 1T9UA 2XMMA 1YHQS 4DQIA 3TEGA 1NNDA 1UMJA 3EE3A 1HNZJ 5GAGI 4DR6J 1RT1A 4UZBA 4NLRA 1X31C 1RTZA 3CJQA 4ZIVA 3IS9A 1IR0A 5ETMA 1DBDA 1RCXB 4UUXA 3JSBA 3OUYB 3KLIA 4DSJA 4AT1B 4ICLB 2QLWA 4B9VA 4JI5F 1VRTA 4UOGA 2HEKA 3IG1A 4USTA 3W60A 4AYBD 2ZZNA 1X4HA 2XHWA 2W24A 2UVWA 1OWXA 3A3OB 1X9MA 1DZ5A 4XIUA 3OFEA 3KLEB 1R0AB 3MUVP 2J6TA 3R2DJ 1JXEA 1MSWD 4AXJA 1C0UA 4J9OA 1SCJB 2AEJA 7FDRA 3LP2A 3KUGA 1WF1A 4B9TA 3MM8B 3BGUA 3U1NA 1RISA 1CSJA 1DRZA 3GZ7A 2UUBF 2BX6A 3DRSB 3T1YJ 1TUVA 5M2PA 2H4YB 4JI0J 5HN0A 4LF8F 4MYTA 2C3PA 3A13A 3NL0A 4PQAA 1MWQA 1FKAF 5GMDA 1OQ6A 5ETVA 2XO7A 3CCVS 2CQIA 1EX8A 1AYEA 2L9DA 3G8QA 3NNCA 1TZ0A 3HSJA 5BXIA 5IT0A 3B78A 3PEHA 1JK9B 4ED2A 3OTCA 1FERA 3R27A 3PNIA 3JB9k 1RWNB 2QLJB 1E6VB 4PG4A 2FJDB 3I6PA 4TVAB 5AXKA 2W9CB 1AROP 1Y00A 2DB1A 2YWHA 2B0GA 3V2UC 3CMES 5CA5A 2YXLA 4QYRA 3IXQA 2AD9A 2EFOA 2OPRA 4OI3A 3R5DA 5HJXA 2UV8G 5A0YA 3HHDA 4B3TJ 4IRKA 4CO2A 3RBDA 4KBIA 4LRFA 4I1TA 1FE0A 3OV7A 4MTPA 3LW5C 1NSKL 2F4FA 2AJQA 3T5HA 2YQ3A 5KFZA 1HR0J 3LQVA 3IR7B 2UU9F 4PCQA 1LWCB 3Q8QB 3BPDA 4M5IA 5BYSA 2KYZA 1M0SA 3I9ZA 3PO4A 4DV6F 4X4PA 2W2NP 3HCXA 2HWIA 3QRRA 2FJVA 1JNZB 5CH7B 3H8YA 3K8WA 3I5AA 4RR5A 3B4MA 4HR2A 4J9QA 1IKYB 4YN3B 3RGIA 1XNQF 4Z7YA 4J9KA 2CPYA 2B8QA 4KE5A 1TQLA 5DO2A 5J1PA 2RQ4A 2VG5A 4QOTA 3ICLA 5FD1A 1W26A 3I5CA 5J2PB 3GQCA 2ERRA 3VAFA 4YEAA 4XPEA 4B3SJ 4RNHA 4KH1B 3TZWA 3M2VB 2AIRB 3KUHA 1RT6A 3P8BB 2Z2YB 3DLEB 3DOLB 4GO7X 2COLA 2Q43A 3KHGA 2KM8C 2W8KA 4NE9C 3CJ4A 5BJRA 3EMTA 1C2PA 5B0AA 1SQFA 1FXRA 3WX8A 3B6BA 4QU7A 5LT5A 2PMHA 2BJ3A 2KHCA 4AL5A 3GSIA 4ZKAA 4M5HA 2OD4A 4LSZB 1FWKA 3QGGA 5AE2A 5CYJA 2ZE2B 2MZTA 2VA2A 2DTJA 3M30B 3L7OA 5F0UA 2EG1A 4KFBA 3BGLA 3BEGB 5HQLA 3D5MA 4ECRA 2BVZA 4WFAQ 2OPQB 4ELTA 1FK9A 2HQFA 3VZIA 3J80Y 4ZVFA 4ED6A 4ZPWR 1TVRA 1P9QC 2XQCA 3KHLA 3BQ0A 4KV8B 1PGZA 4J91A 2V2ZA 2CQDA 4RUCA 3ZZTA 3P4UB 1SUQB 5B0CA 4DLEA 4FVMA 5HROB 1D09B 4RO0A 5LSOA 4Q7AA 2R7XA 3LO3A 4NWBA 2VG6B 3W5XA 5BYRA 4RNMA 4NEZA 1NK0A 3QIDA 4K4UA 3FBCA 4PUOA 2WONB 3BDEA 3PIPQ 1L5UA 1FRLA 3UE2A 3I56S 3CT9A 3FJ2A 1NJIT 4K0KJ 3OR2A 1TKZB 2R2SA 2RU9A 4LF9J 4FBUA 5FLXU 3K17A 3RAXA 4ZDNA 1U0HA 1S49A 2VQFJ 4FDFA 4QIEA 4PQUA 4DSEA 1RHJB 1UP1A 4OMFG 1Q8KA 1N34F 1VR6A 4WPAA 1HWKA 3TW0A 2HNZA 1X5OA 4YR0A 4X65J 5I3UA 1WUUA 3N6MA 4NA3A 2E5GA 3OVSA 4J9NA 3NOGA 1FTCA 5ETRA 1JKHA 1C0TA 2BJDA 4ECTA 1M5PC 1WOSA 1K8AT 2JLGA 5E7OB 4DCOB 2CPXA 2YNIA 2MGZA 2XYGB 1FDNA 1R8BA 1TK5A 2ROGA 2L3MA 3U1LA 1HW8A 3OW2R 1JLBB 2WBMA 1Q81T 4F4YA 2IVFB 4P9SA 3CTRA 3OR1B 2HGNA 3ETOA 4J9RA 1CQNA 2AT1B 3NGKA 3SCJE 2IJRA 4PPDA 3EUNA 3ONQA 1D9FA 1FF2A 2ZFHA 3IRXB 1TAUA 2UVUA 3TAPA 3AD7C 1CJUB 2OPPA 3I82A 4M5KA 4OYPA 5T41A 3ADAC 1RAIB 2LU2A 5KFPA 3AXMA 1EKSA 3T19A 4F3OA 4M5GA 3OXFA 1IR2A 3VGTA 2ZC4A 1XMOJ 3DCAA 2PFFB 4ZCMA 4OX8A 1CC7A 5C5JA 2IRYA 4NI2A 2B9YA 1RT3B 3M8QB 5DLGA 1MN7A 5LSRA 3KJVB 1WI6A 2XZDB 2KXHA 3BR8A 2HQ3A 2I2YA 1GX5A 4PABA 4R25A 2W4CA 4QW9A 4B3RJ 3NCQA 3I9V9 2RDIA 1IQZA 1M1HA 1KTQA 1DURA 2XMAA 4PXCA 1R6YA 2EC0A 1T9TA 2HURA 1DJ0A 4K2JA 2A10A 2GFFA 3M8RA 2X1FA 2MZSA 3CO0P 4X84A 3GFYA 4C0BA 5K14A 3FCVA 2LEPA 3ZC4A 4OHYA 1VQKS 4RWWA 2CKWA 3C16A 1P8GA 3CMAS 2MQ8A 5CD4A 2A18A 2F63A 3OXGA 4USUA 2HQCA 2YX1A 3KKFA 1WEXA 2ZUAA 4NPOA 1Q86T 2ZKUA 1KFSA 3ZTPA 4LSLA 3GV8B 2VICA 4PXBA 1NDCA 1O8BA 1TL3B 2MPUA 1YJUA 3M6VA 3PFEA 3MPWA 1S1WB 1M90T 4H4OB 3RAQA 3RG6A 1RHQB 3F41A 4RNOA 6AT1B 5CQGA 2HNDB 3H59A 4Z37A 3GR0A 5DRKA 3GWCA 3A3PB 1CULB 4FKXA 4J9PA 3BBFA 1O0PA 1U6BA 1U1QA 2F4VJ 5K8NA 4MIAA 3KHRA 3PKMA 2HBYB 3HZGA 1MLAA 2HGLA 4C0HA 3NWRA 1YQHA 2OH2A 1VQ9S 3PR4A 4IUFA 4ERDA 3QO9A 3LF0A 2VKZG 1JLCA 2GW8A 3QT8A 3MZIA 1S48A 3DOMA 2DNGA 1T03B 3KDOA 1KQFB 2A2DA 3UNGC 1KONA 4DR2F 4LF5F 2CQ0A 3LGNA 4FP9A 3GTYX 4ANCA 4RBTA 1JLGB 4IH7A 3OFGA 1PKUA 2E5JA 3DOKB 2VBYA 2IRUA 2J0QD 4N5SA 2Z4PA 3O1LA 3CCZA 1SV5B 3NAIA 3TJ8A 1QAYA 2G0CA 3CCWA 3UCZP 2VPWB 1QSYA 1Q8LA 2MKHA 2CQCA 4LQ9A 3GCXP 2KFNA 4I64A 1N36J 4Y0FA 3ETMA 5GADU 3J7A1 2CQHA 2OKQA 2CPJA 3RR8A 1J5OB 2D41A 4RL1A 3WC2A 5MAOA 1VDHA 4HLBA 4M5JA 4ZPTR 3L4BC 2HNYB 2PIIA 2EK6A 4NZ7A 4DL4A 2KJWA 4F2RA 1FXDA 4L6V3 3S6EA 4ZVEA 3DLKB 2LP4A 1CEZA 4GKJF 4DV1J 1F0XA 3TJAA 1LW2B 5C42B 5BR8J 1AZSB 2HHWA 3JS9A 2AZ3A 5IM0B 2FHJA 2FY8A 5C25B 4Q5VA 2V4QA 1VOMA 4NX9A 3HT3A 4EYIB 1BUXA 4D3HA 3TEHB 4HDHA 1HQ2A 1TKTA 4YFUA 3DU5A 5CCMA 3DGVA 3BS9A 1SJQA 1UVNA 3I87A 3Q83A 3V4IA 4ZA1A 5DGAA 4NLPA 1C1BA 3ISZA 5HP1A 1N8RT 3LP0A 3TA1A 2RRAA 3D4JA 1MROB 4MK8A 1HQUB 2HQIA 4ED8A 2XZWA 4ILRA 2DKOB 3IC1A 4C97A 2OEMA 5J1EB 2LEBA 4LMZA 5A8KA 1U8SA 2OP5A 1A6LA 4OHVA 1S1UB 2E9RX 3MM9A 5HAOA 3DC2A 5D3GA 1FEHA 1Y7PA 4CI0B 3DLHA 3TUJC 1ZAVA 2C3OA 5HQ8A 3OVAA 3VGVA 3WZ0A 1U1NA 2B4VA 3UFCX 2U2FA 2PEBA 1VC5A 5HANA 4IO1A 2W9BB 1U2CA 4X64F 3E01A 2DGSA 3CD6S 1ZTTA 1BMQB 1RBAA 3DRPB 3OTOF 2ZD1B 4WBFA 1TUGB 3FEYB 1QUVA 3GB0A 1ZM3A 4LBIA 2ILYA 4DPYA 3DKDA 5LM7E 3GU0A 5K20B 3THVA 4QIGA 3N28A 5DDPC 1I6JA 1N33J 2W4DA 4ZP9A 1B7FA 3C8YA 1AA1B 4EZ9A 2K3IA 2UVVA 2VOOA 1RT7B 2Y0BB 5L1IA 1TKXA 5F3TA 2CPZA 2DGTA 5CD4H 3CVKA 1B7YB 1IBLF 4FS1A 1OJ4A 4A8KA 4LF2A 2GNKA 5KFAA 1NJXA 4DU8A 3EVOA 3QFHA 5B08A 4EBCA 5KT3A 3SCIE 4M5DB 1MWYA 2BYCA 4R8UA 1S0OA 3QNWB 2ASYA 3CDUA 2KHDA 4HACB 2R8HA 3N5FA 1VBZA 3HVTA 4KPCA 4A8MP 1K0VA 4MT1A 3AQOA 3PVXA 1HNIB 2CG8A 4HKQA 3J7ZT 1Q0NA 1MU2B 1IKVA 5KT6A 3HLUA 3DXBA 4Y6IA 2OSRA 1RWOB 4O44B 2XNRA 1CQMA 5KFCA 1I1GA 4JV5F 3PW0A 1N5SA 5KFRA 3EX7B 3T5JA 2B8PA 3QWUA 4M5MA 1XIQA 2J8SA 1RZMA 1BQMB 3AB4B 2OI2A 3EGVA 4O4GA 2DGQA 4JI4J 5THWA 2HRUA 2DISA 2WVFA 2V94A 3GIMA 4USMA 4EU0A 2AJ2A 2VA3A 2FIUA 4ZVUB 4KHMA 4QU6A 2J9DA 4KGMA 4W90B 1ACMB 4BS2A 3EZOA 4NXNF 2PGCA 4JI8F 2X1AA 3DI6A 2XTJP 5FDLB 1BWEA 2N7CA 3JAMU 3DXSX 3V6HA 3K0JA 1GXLA 4IFYA 3PYDA 4IR9A 1NH7A 2ZHOA 1H98A 5I3PA 2G9OA 2RD5C 5EDWA 3KMQA 2E66A 2YNFB 3KLGB 4B3OA 4QR1A 3T6BA 3C15B 1JQGA 3A1YG 1FA0A 3KK1B 5KT5A 4U67Q 1CBKA 4WFNQ 1FVSA 5KFVA 3FFIB 3NOCA 1FKOB 2BZ2A 5C7PA 4KJIA 1HQEA 1FO1A 1EQMA 1NM2A 2OSQA 4DV7F 4DUYJ 2QYCA 5HBMA 1Q7LB 5J2MA 1NPPA 2NREA 3W1YC 2KT3A 4RPFA 4CO4A 5KOWA 3BQ1A 4UUWA 1KD1T 2I0XA 2MDAA 3HHEA 1Q1KA 4YB5A 1OQ3A 2DGWA 4ANEA 4OZ1A 2Y0SD 2H1YA 1YGYA 3HULA 4OZ0A 3CMQA 3ZTRA 1EB0A 3D68A 3D67A 4UTGA 5D77A 1FJCA 3D0IE 3RB3A 4F0KA 2DT9A 4KPYA 2G0JA 3ZZOA 3TAQA 3GIIA 4RUBA 1I51B 2OPSA 1ZOTA 3CUNA 3ILOA 4I7FA 2QSFA 1HPZA 1VRQC 4QWAA 3POTB 4NCGB 1WSVA 1Z2LA 3DMJA 1ZTWA 4Y2KA 4K4TA 1FEEA 2KVIA 1JJ2R 2IMWP 1U2FA 4WP9A 2NUHA 3IWLA 2SXLA 1IBKF 1HBNA 4OI4A 2LA4A 3DYAA 1FRXA 1S9EA 4PG7A 3MD3A 3E51A 2CQBA 4CLFA 4OI6A 4C4WA 1XN9A 4USVA 4TU8A 1RAHB 3MCSA 2XGPA 2MY8A 3VAGA 1UCNA 3SDEB 2RB7A 3EXCX 3GONA 5SZTA 4B17A 1HWJA 2AEMA 4F4ZA 4NLUA 3QATA 4KYZA 2V4JB 1P6TA 4CH0S 6FDRA 2LQ9A 4ZLPA 2UUCF 3KK2B 4IH6A 1H38A 2QLBB 3LOUA 1DTTB 2NZ4A 2QMUB 3AY0A 4GC6A 3K5OA 3ENQA 3MEEA 4MKYA 3QT5A 9ATCB 1QAXA 4U8VA 5KG0A 3EWGA 1SIWB 1HA1A 5A2QU 3MMBB 2B5JB 1MN9A 2NPIA 1Y0HA 3CWJA 3PDNA 3AOBA 3THPA 2DR6A 2EVZA 3FKBA 3BGFA 4ZCIA 1BQNB 3EXYA 5CXTA 2J7WA 3VZHA 5LMNF 2J8AA 2KN4A 3I5BA 5A8RB 3VQTA 1SH3A 4YB1P 1GTHA 3AODA 1UWAA 2NSCA 4RW6A 2APOA 5E2QA 3QWPA 1PBUA 2C2OB 3FUYA 3NWGA 1UJ6A 5HVFA 2XYHB 1UZDA 2FVCA 4WXWA 1JLQB 4ED4A 2IJFA 1WC3A 4IG3A 2E5LF 3T1HF 3I55S 2MYFA 3RW7A 5IOLA 1X4BA 4DFJA 2BJ7A 1YJTA 5GADI 4NEYA 4ZPBA 3BB5A 2GIQA 1QD1A 3MPDA 4DV3F 3SQGA 5A6WA 2ZNZA 1BD6A 3PJ9A 5ETPA 3GYGA 1RWPB 2G2OA 2WVEA 2XI2A 3PFOA 5DZ6A 2M7SA 2K2PA 2YKNB 4DV2J 3W9JA 3EGNA 3RRGA 3K57A 4DR5F 3OBIA 2V2VA 1RUSA 3PRDA 3N6NA 2IYGA 3FDSA 2IRXA 1D8ZA 1KP6A 5CYQA 3J7YU 2CNOB 1N5YB 1F9FA 2KL8A 4C8OA 1DLOB 4UOHA 2XNQA 4IKAA 1D8YA 2FY1A 4GRSA 4DJBA 4F50A 2FB0A 3CCRS 3AOAA 3P3DA 4WFXA 4DOZA 4ECZA 1GEHA 2KXFA 5LXYA 2VFRA 2Y8WA 5KG1A 2AWZA 4FN5A 4V19X 4ELVA 4DX7A 4X2BA 3JQJA 3CB4A 3HSDA 4P74A 5K5MA 4OX7A 5IT9U 2JSXA 1VRTB 1URRA 1Z2ZA 3EDQB 4DXLA 1UWBB 1L3UA 1RHKB 4RU9A 2EBGA 2M5YA 2VG7A 2UXCJ 2P5VA 4ID5A 4JI5J 2ABYA 1HARA 2BBEA 2GMJA 1VJWA 2DXDA 3MM5B 4OJ1A 4ES3A 2L9WA 1VBYA 4JI2F 1WHWA 2XGQA 3KG1A 4DPOA 1C0UB 1QVFR 1N6QB 3M6XA 4HYKA 2UUAF 2HGMA 2RIJA 3LP2B 3CJKA 1Q5VA 5KFOA 9RUBA 1D0EA 5E3RA 5GMKa 2AX0A 1W2IA 4X4OA 5A6PA 3CCUS 2P6TA 1JLAB 2X1BA 3M8WA 1S9GA 4HH1A 3MECB 5CHCB 2YBVA 3HJFA 3C6UB 2X7IA 2ZKTA 3ZXWA 4ETZA 2UUBJ 1SKUB 2KRBA 4J9VA 2YTCA 2DHSA 1NK8A 2A6OA 2FZKB 1NHKL 4OYBA 4A47A 2AYEA 4Y2CA 2CADA 1DHMA 1B3TA 4CH7A 2CJKA 2HMIA 4UF4A 3R1LA 3KDNA 5FJ4A 1UPPA 2CG4A 2EG2A 3V5RA 5AE3A 1VIXA 1I3OB 3HD1A 1W7WA 3GPAA 3TR5A 2CQPA 1IKWA 4Z2XA 2CJAA 1S72S 1N0VC 2MJNA 3M32A 1ICEB 3W63A 4MYUA 1NSPA 2FDNA 4XDCA 3AQPA 5I4MA 3PY8A 2Z2ZA 1UZHA 2Q6BA 2B9EA 2ZOGA 2OPRB 3PTWA 2M4MA 5E33A 5A0YB 2DRAA 1CJTB 2B43A 1URNA 1SKWA 1CS4B 5IC4B 2C2DA 2Y1IA 1U1MA 1UVMA 3QSIA 1BGXT 3N6LA 4F4WA 1TU0B 3IAM9 1UW4A 4ENOA 2V68A 4LSNA 5DQGA 3GLJA 1NSQA 3M05A 1P27B 4ZP7A 2YQ0A 1RABB 2FLNA 4LF4F 2BM1A 2ZEJA 2Q66A 3W62A 4UOFA 2FGOA 2LQ5A 4Y65A 2UU9J 4ECVA 2OTJS 1R8CA 4DL5A 3MMAA 4EK2A 3K7RA 4DUTA 1WC6A 4DV6J 5DQHA 4K4VA 1RT2B 4FF2A 2HHHJ 1PYOB 2VG5B 1VQLS 5KG4A 1RU1A 3KOAA 2K3KA 4O3PA 4ETXA 3ENVA 4KGXB 4I6YA 1MMNA 5EHHA 2V50A 1S9FA 1RGVA 1Q7YT 1XERA 5DZ7A 3BKUA 3Q86A 1M5OC 4F3MA 3FC9A 5AXLA 3GYXB 2P6SA 2CPDA 4OFZA 1H2TZ 2YKQA 1VBXA 2IJNA 4R5PA 2LFVA 1S6PA 3DLJA 4UQGA 3PEJA 3BO3A 2KH9A 1T8EA 3AOCA 1VQ8S 1WD6A 3T9NA 4WFZA 1TKDA 4L74A 1S0VA 1GXTA 3C6TA 4KFBB 3LALA 2PSZA 3PW7A 3BKTA 3UD5A 2PT0A 2GVDB 2H9ZA 1TVRB 2P8IA 4ED0A 2HRTA 3HHLC 3VAHA 3I96A 2FD2A 2GQQA 1H73A 4CZCA 3MPVA 3BO4A 2F8MA 4UY85 2PFDA 1IM4A 3Q23A 3TZYA 1DTQA 1N48A 1HWLA 2HWTA 4EYHB 2MQLA 3M8YA 2DPJA 4AL6A 1F60B 4NA1A 2F7VA 1KLMB 4EUVA 1FNMA 1FFWB 4JUZA 3G87A 5F8JA 3DLLQ 4PUOB 4LFAJ 1TL4A 4JYAJ 3TZZA 4DV5J 4AL7A 3MPYA 1TV6A 5A8WA 4H54A 4H4KA 5DQIA 2OO4A 3OR2B 2AEFA 3PYFA 3Q8VA 3C14A 4AXIA 2J9CA 4DF4A 3A3NB 4KRWA 2ZHAA 3VF0B 1U0HB 3R5JB 4CO1A 2R8IA 5CYMA 2J0XA 2GIRA 3QJJA 1Y5LB 1FNOA 4IO9Q 2FUG9 4V1Ak 4DCPB 2HNZB 2DCUB 5D8HB 3H20A 3SV4A 2FJAB 1J5EF 3J80U 1N34J 2ZDPA 2HSEB 5T14A 4B3MF 4YDXA 3JSMA 2XYPB 4X4SA 2HHSA 2XSJA 5D0RA 5J1NA 3N9UC 4JI1F 3CO9A 2RQKA 2YNIB 2MGZB 3BN4A 1XR5A 2C2NA 1KRPA 1QSSA 1S0MA 1U4BA 1K9MT 2D74B 4C8NA 1SL0A 5LXRA 3MTKA 4HVZA 2YWWA 2H65B 5JUMA 3OHBA 3SSSA 1NK6A 1TP7A 2IA6A 3VVTA 2HFNA 3D7SB 5DDQC 2QIFA 2XHCA 5G0RA 2J6SA 4PRFA 3ZZ0A 1HNZF 2HZCA 4DR6F 1ZYQA 3TI0A 4J7CA 1XK8A 2M9KA 1Y3KA 3ZZPA 2IYIA 4L75A 1XMQJ 4ZVRB 4USJC 3G9CA 3M8SA 1LK5A 1RADB 3CULA 1EQ0A 4AQYJ 2X1GA 4KKOB 3CF5Q 1XNRF 3H2LA 3I4PA 4U95A 4ICLA 2QN6B 2V63A 2OPPB 4RWXA 4ZOSA 5KFMA 1KS2A 5GAHI 1O6XA 4NLVA 2HK3A 2G4BA 2MB0B 1SC3B 1FRKA 1N52B 2JOQA 4Q8FA 4CT8A 2XMVA 2Q6CA 4KGKA 2R7RA 1PCAA 3GV7B 4NI2B 4IOAQ 3T5LA 5A76A 1IJEB 1RLCL 5DGBA 3KLEA 2DRDA 1R0AA 5CZVA 3ISNC 1IWAA 2K1RA 1S0NA 1HBMB 1HI0P 4DR4J 1XWLA 4DUZF 1IN0A 1K1SA 2WB4A 4X4NA 4W98A 3QPIA 1C1CB 3MM6A 3VAMA 2RNEA 4C9DA 1YZ6A 4NLOA 4ED5A 2BKNA 2HAFA 2AHOB 4M1KA 4WK3A 1RU2A 4Q44A 3OSNA 2BQUA 3W9IA 2R8JA 3J7YI 4DBQA 4UT4A 3IR6B 2NZCA 3WDOA 3MCMA 1T9WA 5ITHA 4OYWA 1F2HA 4FYVB 3NG8A 2MLYA 3L95X 3MR5A 2M8HA 2EKNA 3RW6A 1WKJA 3R5AA 3W5ZA 1HNVB 4P2FA 2MSTA 4LSLB 3KNGA 1X9WA 3LGHA 4OHWA 4CLWA 5KG2A 1JXLA 2AYMA 3T1AA 1FKPA 2B6AB 1FDBA 4C98A 3AFGA 3FZ2A 2W9CA 3KFWX 4GKKJ 4JB8B 3FMWA 1DAXA 1EZZB 4HEA9 3R6LB 1LKZA 3NGDA 2OELA 3CC7S 1WKLA 3VV2B 3CCMS 4N77A 1JXVA 4CLKA 1KN6A 3DU6A 2P9GA 3GILA 1GMWA 2GGPA 4EWTA 1RACB 4FVCA 1FDDA 1M1GA 1S7IA 1F3FA 3FVYA 2KZMA 3KHHA 5IS2A 4NYOA 2BJ8A 1Q16B 2Z30B 1DY3A 2HLUA 2FJWA 2AJ4A 4I68A 3RYLA 2DJWA 4DR7J 4CLYA 2VHGA 2E1AA 3UVJB 4ZCKA 2DGOA 3TUZC 4DR2J 4LF5J 1R7IA 3PXGa 2N82B 1U6FA 3EM1A 3I31A 3Q8SB 4M5NA 4ZHRB 4DFMA 3QAEA 1U0SA 2HHUA 4IQMA 4WFYA 2EPIA 2HWHA 4OZ5A 2YWKA 2DR5A 3DDKA 2LXFA 1OY8A 2R9LA 2GMHA 2FHJD 4DI6A 3BSNA 5HMWA 4ZVQB 2YWFA 1H2VZ 5J2PA 2CDQA 2HBZB 4MIBA 4USHA 1F3VA 4OYMA 1YLXA 2DHXA 2QFJA 4IRCA 2NS1B 1KHWA 4QIVA 4X4VA 5L1JA 3DN9A 4CO3A 4P52A 1BLUA 1J27A 5LJ3Y 1Q78A 3IGVA 1SQGA 3FZBA 4GC7A 4F7VA 1YDLA 4C11B 3L3CA 4LRAA 2FHMA 5E3PA 1CPZA 3M4XA 1D9AA 1EARA 2W7OA 2RJZA 2R7QA 4DCJB 2JEJA 2ZBPA 2EXUA 4DV4J 3GIKA 4OX9J 1IKXB 2OD6A 1N56A 5ETTA 2OLWA 3M2RB 4N56A 2DXFA 3G82A 5ETSA 3FRZA 4I2PB 2IMOA 3MFIA 4GKJJ 3HX9A 4YB6A 1FXLA 1NU4A 2OPQA 1TKTB 3HKWA 5E5NA 2AGPA 2NUUG 2OFGX 2C42A 4F0HA 3EPGA 2YNHA 1CJVB 2AW0A 2ROEA 3L9ZA 1RA6A 2EFPA 4KV8A 1OYDA 3V4IB 2HFZA 2PEHA 2KG1A 4CP5A 2PE8A 1C1BB 3CCLS 3R3TA 5KFTA 1QE1A 3OXLA 2HRYA 1EJ7L 4F4AA 3MD1A 5HROA 5H1SV 3ET6B 2NXJA 2VV5A 3M6WA 1KSPA 3G8TA 5KOXA 2ZZMA 5A8KB 2BQRA 4AE5A 4K0KF 1WHVA 4N47A 1CC8A 3MM9B 1VQOS 5D3GB 2F9DA 4LF9F 2BOAA 2NCKL 1Q8BA 1ELOA 4WYWA 3PHEA 4E98A 1KTVA 4PYDA 1P1TA 2VQFF 5B0GA 2UUWA 2UZAA 2PA8D 4E0DA 3W64A 3W8PA 1F6TA 4YY3F 2OIHA 2F65A 4X65F 1C4CA 3NRBA 3HZEA 2DK2A 3VHQA 4X64J 2JX2A 1X60A 2K06A 1F5CA 4RUHA 3DNCA 4LR7A 3R5GA 4O0NA 3OTOJ 1YRTA 1RXOB 4UY8T 3R5CA 2R42A 5H9FJ 1VS3A 2CPHA 1RT4A 4CT9A 2WK4A 1YJ9S 2GA7A 2IY5B 2DYAA 1NDPA 3NXZA 2CFXA 3ELHA 1S4FA 1LWXA 4X4RA 5L46A 4F36A 2RRNA 3DLGB 4HDGA 2BJ9A 4OLOA 1TKXB 2GQ2A 1W25A 4UQTA 1SC4B 3CDWA 5DJBA 3G6YA 2JLFA 1SJRA 2ALYB 1QM9A 3CCSS 5DM6Q 2HZVA 2R8KA 1JLBA 3GSDA 3GIRA 5KFKA 2Z8QA 3OR1A 2B9WA 4DR3J 2V8HA 1HNXJ 3OT9A 1EP4B 5K8MA 4E2FB 4R8UB 2DEJA 3C19A 3PR5B 4J90A 5IQQA 1DARA 2MMYA 2BRLA 3O6QA 3H25A 5C24A 4IFVA 2XB2D 1EIYB 2AGQA 2HHXA 2PMZD 4QBUA 5EWGA 3QYYA 4U7CA 2POKA 1KVKA 2YKMB 2DVIA 1RAAB 1XMOF 1CJUA 1TAQA 5MLCV 3TARA 4QWDA 2B4PA 3E8OA 1RYRA 5KFYA 2XBPA 3OTEA 1NXIA 3NS7B 3VALA 3LPYA 1XTZA 3V4MA 5RUBA 2DNZA 1JLEB 3M8QA 4ZPDA 3DRYA 4JV5J 1NKCA 1HNWJ 4QPTA 3FMBA 5ETQA 4OJ3A 1SKSA 5KFJA 1R8PA 3HHNB 4O4GB 4MKAA 3H40A 4C8ZA 3QT7A 4KIAA 2GC8A 3HK2A 5EUHA 5M2RA 2G13A 4RNFA 4C8KA 3H5SA 1RK8A 1S4EA 3CDAA 1R3NA 5D4NA 3DI6B 3MAHA 1L3KA 2KT5A 3OJUA 3KK3B 3VTIA 1ZZNA 5J2QB 2BUNA 3JYTA 3H4BA 3W65A 4FF3A 5HK4A 4NXNJ 4JI8J 3ZFVA 3RB4A 1LWFB 4B3OB 3V6KA 4RW9A 2Z0GA 1KEKA 2AU0A 3Q8PB 4NASA 5D0EA 3S1TA 1S1VA 1TUWA 3B8HA 3OQ2A 3FSYA 2FGCA 3G4SS 1REVB 2F8EX 4DF8A 5K9FA 1S1WA 2LXIA 2LDYA 1PJ5A 4H4OA 4KR0B 2KM8B 2IBKA 3HFKA 3K2YA 2KVQE 2HK2A 1CULA 5HLFA 1J2VA 3FCWA 3KYLA 2E9ZA 2AYGA 1T7PA 3QRQA 4QWEA 1PAUB 1S6QB 3BBBA 4DR1J 4TU7A 3PG9A 2V6AA 1EAYC 5LSLA 1SC6A 1NPRA 1IR1A 3J81j 3K8VA 2XS7A 3BH7B 2XG8A 4XAKA 4DFKA 2M70A 2YWGA 3AB2B 3D54A 1H0HB 1YWXA 2K8GA 2MLZA 1RWXB 1S7HA 2OPSB 3HHLA 1NZAA 2HHQA 2RF2B 1VYAA 4I56A 1HPZB 3MOJB 4JV1A 2DGXA 1Q5YA 2KTQA 1VQ7S 2EW9A 2VODA 1OSCA 1SH2A 1ZM2A 3GJSB 3OLBA 3N01A 1H7XA 1VGYA 2IDLA 4NRTA 1P9YA 4MFBB 4CTAB 4B9LA 4PZVA 3UN3A 3KLFA 4USIA 1UETA 2HZAA 4F3QA 3QIPA 1LXJA 2DRBA 5GAEU 3E3XA 1NHUA 3IM9A 1HMVA 5CCLA 1TL1A 3US5A 1N36F 1IBKJ 2WAQD 4X62J 4ZLNA 1QY7A 3OTDA 1FRMA 2CZVC 2XMJA 4DL7A 1YSJA 4ZCLA 2ZVSA 4KQZA 3A8KA 2YKPA 2D69A 4J9UE 2IAJB 2HW3A 4TN2A 1V9OA 1R8AA 2BJEA 4NMLA 4MJKA 3OL8A 4YHHF 1J5OA 1UFWA 1AXQA 1RKIA 2V8DA 4KHPF 2BR0A 3BR9A 1ZPVA 2WVBA 3GG1A 2NSBA 4LJMA 2MKJA 3G6VA 3D66A 3Q89A 3J81Y 2AQ4A 1H72C 2HNYA 1JJ4A 4LFBF 3HXMA 3BPSP 2OHDA 2CPEA 2JVOA 4HHHA 1U8WA 1VQMS 3NLCA 3DLKA 2N3LA 4PWWA 2J6UA 1LW2A 5C42A 3D1HA 2E9TA 1AZSA 2JEFA 3NGTA 2W1BA 5IM0A 2FYXA 2DHAA 5C25A 4EI2A 5KFSA 2GJ2A 2G2ZA 4ZIWA 3CIMA 3EGZA 2OFHX 3H5YA 3AJ2A 2CQ1A 4FXVA 4F0MA 3V6JA 2RQCA 1CG2A 3HP6A 2GS8A 2ZJPQ 4ZN1A 4ZP8A 2WHOA 3K58A 1VQ6S 1HW9A 4PG6A 4IDKB 1MROA 4KH0B 3CJ5A 5D4PA 2HHVA 3UR0A 3W66A 3SYZA 2GO9A 2OMLA 4LR8A 2FLLA 2L08A 2FZCB 3IGNA 2QFIA 2X3DA 3FK4A 4A8WA 1H2UX 2JL9A 1S1UA 3WX4A 1HLWA 3T1HJ 4Q43A 2RKIB 3N79A 1RCOB 1RWUA 1WWHA 5K8OA 1T9YA 2WSCC 4CYUA 4YB7A 2HBQB 2W9BA 5CZXA 4DV3J 4QYZJ 2ZUGA 2ZBQA 2QGFB 2Z58B 1RWKB 3DRPA 3J7Z5 4TNOA 1M5SA 2UXBJ 2ZD1A 2CYYA 4WK1A 5CYQB 1X5PA 4KB7A 4WU2A 2XC9A 1UEKA 1XEZA 1HWUA 1N33F 2PI4A 2CJBA 1WHXA 4YR3A 4L72B 3NS6A 3D0HE 4X66J 5KFDA 3IMQJ 4F25A 2DY9A 1AFJA 4MKVA 1LW0B 3MEDB 1Q4RA 1OIAA 2JEGA 3VQSA 2QSWA 4DSLA 1RT7A 2LDIA 5HJYA 4IG0A 2E29A 1YRUA 4DS5A 2QX0A 1SPBP 2LVWA 4G1IA 4QR0A 3I0RB 3OJSA 2V9KA 4DL6A 4ECYA 2KZZA 1S57A 4RZRA 3QGIA 4M5DA 3TUPA 4JBCA 4CLSA 1LNQA 3MCNA 4KY3A 4HACA 5IV3A 2DNPA 2FVQA 2C1EB 2EK1A 2KFYA 4V19J 3CC2S 2K7KA 1HNIA 3VAJA 2E7VA 4G1PA 3UD3P 4I67A 5H9FK 2H51B 2NYIA 3CJKB 4O44A 4NXMF 4U6PA 3M2UB 3RBZA 4ZS6A 2G1DA 2R7VA 2YNGB 3IFEA 3RJMB 2DO0A 3WIUA 3R7NB 3N4WA 4BWMA 3X1LB 3FBBA 2F9JA 4JI4F 3ZTOA 4OZ3A 1SXLA 5KFQA 4E8UA 4PYAA 4I0WA 1UJ4A 1YRXA 3BSAA 1FTRA 3MF5A 1BQMA 2A0FB 4QZVB 3ZTSA 1H7WA 3ZZUA 4A8YA 1LXNA 5EX3A 1YZ7A 2A6MA 3L7PA 3W7BA 1GFWB 4OV1A 4KHRA 1B4SA 1HBOB 3AJDA 3QRPA 4ELUA 4DHVA 2GVZB 2CNKB 1Q95G 4OL8A 3EICA 3FSIA 4DSKA 4EO8A 4JV2A 2R7OA 3PX0A 3R7BB 1U24A 4HL9A 3P96A 4WIIA 3UCUP 4OYIA 4ZJLA 5FDLA 2BW2A 2DR7A 4NLDA 7AT1B 2G0IA 2QV6A 3SCLE 3PW5A 3Q8UA 3M32B 3M9OB 1QLNA 1S6UA 1KVJA 4LRBA 3WIVA 1KBRA 4K4SA 2MKCA 4LREA 4OZLA 2V5HG 1N5VA 2YNFA 3KLGA 2PMWA 1NO8A 1G7CB 2RILA 2G1HA 3KK1A 2CQ2A 2JJ4D 4B9SA 1HFEL 2KI2A 4GO5X 1KLNA 2W25A 3HFVA 1UTAA 3IN5A 1CVJA 3DDNA 3FFIA 4HI2A 1FKOA 1RE1B 3IWNC 4DUYF 1XR7A 4HTJA 1OY9A 2W2MP 4HHUA 4JI6J 5HQMA 1Z4UA 2HS0A 1HD0A 3MXHP 2GHPA 1YBUA 2IDEA 3D6HB 4ATNA 4LBHA 4LSNB 3BGRB 2RHQB 4TY8B 2VQEJ 4BWJA 5E3AA 4YP3A 1MW7A 3D0GE 2RUGA 2I9SA 2HQDA 3UW1A 3R1HA 5I3QA 3CJ3A 4IRDA 2LU1A 4BC7A 2DXEA 1JB0C 2NXCA 4LFCF 2GHWA 3EDRB 2CPFA 2XWXA 3MMAB 2XMTA 3CGIA 1GXUA 4FYYB 4I2QB 4ZVTB 3DM2B 2OEJA 1SKRA 5G4DA 3DGPA 4DEZA 3HT0A 4ER8A 2B7BB 4F67A 1R43A 3BF4A 5EWFA 2I6WA 5A2QY 3EVMA 3N5BA 1X0PA 1WEYA 2VJVA 3O2IA 2WOMA 4NCGA 1WI8A 4K4XA 4CDIA 5T7LB 4OZNA 3H98A 3QZ7A 4C0OC 2JFKA 1CLFA 5D15A 3W61A 3D2WA 1VHFA 2IFXA 2W2OP 1VRUB 1VCTA 5KFWA 1OYEA 4KO0A 2BMBA 5KG3A 4K4WA 1X5TA 3MM7A 4NA2A 3SDEA 3NNAA 4CO0A 1R6VA 2V4JA 3K59A 3HD2A 2ZWPA 1KNZA 1X5SA 3KK2A 4JI7F 5KFEA 1OY6A 3C6TB 2YX7A 4X4QA 3RBEA 3W5YA 4O3QA 1WSRA 4RW8B 1IWGA 2VASA 3KMSA 3C66A 5GVQA 1NCLA 1NBEB 3T41A 2J0WA 5HMZA 3MMBA 5B0DA 1SC1B 2QJ3A 2N7YA 1APSA 4X4TA 4PWUA 1B99A 3CCTA 2YWEA 2ZJQQ 5ETLA 3FEXB 3BZQA 1UVKA 1LFWA 1FNXH 1BQNA 2LLZA 2HVIA 2MQQA 1H6KX 3W3SA 2BEFA 1ZH5A 2MKIA 1FX2A 1VQNS 3MI7X 4IOBA 3M8PB 3ZO7A 2R7SA 1PJ6A 3D3BJ 1VLOA 3OL9A 3SI8A 4TLQA 3G6XA 3W9HA 2ASDA 1HYSB 4KGZB 4RKUC 5GAEI 2W2PP 3PRBA 7FD1A 3P6YC 3SV3A 4LQ3A 2AKWB 1FD8A 3H90A 1U45A 5KTQA 2C3MA 4F8RA 8ATCB 5I42B 1C4AA 4MKBA 3GJRB 4QJVA 3P49B 1GH8A 2PA3A 2DY1A 2KJVA 2IM3A 1B0PA 4RW7B 4TYBA 4AFFA 4URGA 4DV2F 1RTJB 3IM8A 3JSMB 1SL1A 2NXUA 4TLRA 3PKYA 4EBDA 3ZZZA 2NXEA 2RH3A 3X3UA 1J5EJ 2B7CB 5AT1B 4B3MJ 1YKWA 2DD8S 3VGSA 4ZPAA 1TFYA 4PWDA 1N0UA 2O5DA 4RLEA 3JQMA 4JI1J 3P5BP 1EKRA 5F41A 4GMKA 1RAFB 2DNQA 4HT5A 1NDKA 2BOPA 3JTPA 1RYSA 2RS8A 3S01A 1FFGB 4CLLA 1VFJA 2WBRA 2FTRA 5F9LA 3QJPA 1RSCA 3BO2A 5EGYA 1T3OA 4I6WA 3ITHB 2GCFA 1E6YB 4RU2A 2UXCF 2BANA 2JFDA 4P7VA 1YJRA 3LAMA 4H4KC 2V0NA 4FPIA 1YTYA 1RHMB 2D3UA 4QYZK 4MK7A 5AJ3J 1UVLA 3QJLA 2Y8YA 1UWBA 1T9XA 1XNRJ 1R31A 3CXCR 3FBEA 2XO6A 3NCRA 2GX8A 2ASJA 3MAQA 3SFUA 3UQSA 2BW7A 1VC6A 3MR7A 1TFWA 2ATCB 4P2XA 1BY9A 3MM5A 2Y9HA 4IQXA 1MG7A 2Q79A 2K1RB 3PM9A 4ZVHA 3VGUA 1N6QA 2Q3PA 4ITSA 1U09A 2M52A 4URQU 1U1RA 4O4RA 4PKDB 2D9OA 3QAUA 4CH1A 4RW4B 4DL3A 2JH3A 3MM6B 4DPUA 2EKYA 4ZVGA 4Y34A 4DUZJ 3L7UA 1JLAA 1WTFA 3MECA 1S10A 3TWZA 2BE2B 2L41A 4NYPA 2NR0A 2ZWOA 1O51A 1ZA2B 1TELA 3C6UA 1U1KA 1GMWD 1RI7A 1FWLA 3U02A 1Y4ZB 2IVMA 2HIQA 4XPCA 1PYSB 2DHGA 1V3RA 1WC0A 3NBPB 4C7QA 3CW2C 5KFUA 4H4MA 4LVNP 1OPZA 2R2TA 2VUGA 4G3IA 1Z1ZA 3W2WA 4BCAA 4ZN3A 1SQEA 2Y1RI 5D4OA 4K7QA 2XMUA 2K7JA 4OZJA 4WKYA 3MWBA 1S77D 1XQIA 4K4YA 3GP9A 1ZZFA 2IHR1 2W7AA 1FKPB 4M95A 3I0SA 4NLYA 2IC3A 1NUEA 4DQPA 4Y28C 3TX0A 1LQ9A 4DQRA 2ZM6J 2ZH6A 2DNNA 1JWWA 1FCAA 1VC0A 2EFQA 3F0NA 2IA0A 4IYQA 4CWBA 2HVZA 4CIOA 4ECUA 1QSLA 4ZPVR 2VFVA 2V34A 4DV0J 2RVJA 3EPIA 1CJTA 3MAAB 2GGPB 3SZ2A 4RBVA 3TX8A 1CS4A 2OUGA 4TY9A 3MEKA 3EJMA 3NMRA 2VH7A 2DGVA 2I38A 1FESA 2PDAA 4L3KA 4N76A 2VPYB 2W01A 4F02A 2YY3A 3TANA 1M5KC 3CCQS 4Q0BB 2WZ1A 3CSKA 2R4FA 3ILJA 1A9NB 1XBWA 1VK3A 3JSYA 4CRJA 1WDTA 3A8IA 1RLDA 3CIZA 1G1XA 1N32F 4C3LA 4W4MA 5DDOC 3LPEA 3CEDA 1TTHB 1S59A 2HHHF 3GIJA 5F8HA 1N4LA 2CAJA 2BDPA 2QMWA 5HSPA 3ZNJ1 2W8LA 3EGWB 4R0JA 1WJ9A 4DN0A 1RT2A 1AW0A 1UVIA 1YJ7A 3DRRB 3LP1B 5KFIA 3MGJA 3CJSA 2ALZA 3TP2A 1OSDA 1BE4A 3L09A 1T9VA 4L76A 1YBAA 4Q45A 2VKRA 2LYVA 1U26A 2EC2A 3TVYA 2ZH2A 4O3NA 2DNKA 3PW2A 2OJ3A 2ACYA 3PCOB 2FHKA 3TRGA 3SQOP 4WYLA 1NLKL 2HAIA 3W2VA 2EWHA 3BSCA 2F40A 1WORA 1CJKA 3MMCA 2PO4A 3IWXA 2CWKA 1QVGR 1BHNA 4NLXA 2B56A 2CNLB 2VFUA 3M7VA 2A3JA 4JI3F 5LJ5Y 3G82B 5B7WA 2C2RA 5JMNA 5IT4A 1RTIB 2WW4A 2IM2A 1HBUB 1R89A 2I5JB 4WTYA 3U7JA 4FF4A 1TR0A 1S1TA 1SL2A 3GV5B 1U47A 2GAGC 2NPFA 2OMOA 4ILLA 1PG5B 2GVDA 1Y5IB 2QYGA 3F73A 2B4OA 1WC4A 2DNOA 3MR2A 2YNHB 3EVWA 2QE5A 4ZLJA 1YI2S 4WE1B 3VR1A 2MXYA 4IH5A 1QE1B 2VF3A 4AD6A 3CPWR 2ZH8A 3HMJG 4N8NA 2QA2A 2FQQB 3ZZYA 3DHXA 1U1OA 3R97A 5KT2A 4LFAF 3OFFA 1KLMA 4JYAF 4O3SA 4NZ6A 2J7UA 1RB0A 4J9SA 2BRKA 4DV5F 5BYQA 3D6MB 5F3ZA 5HMXA 4J9LA 4ES1A 3KLHB 3V6DB 2WB1D 1RTHB 1JIHA 1X4EA 4LBPA 4B9UA 3I4HX 2XY6A 2N4DA 5GAHU 3FBFA 3BGOP 3TOQA 4NLWA 2ZH5A 1HI8A 2VDHA 2AP6A 3MEGA 1NKBA 3UI3A 2JC0A 2XY7A 2MQPA 4DL0C 2MHNA 1BQXA 2DHHA 1RT5B 3GFXA 1QDUB 3K5NA 1RAGB 1XC9A 4YY3J 1M5VC 1N54B 1QAJA 5ETKA 3T9ZA 4P10A 2WRMA 4MMOA 5B0EA 2MQOA 1O5JA 1RT4B 1S5ZA 2R7UA 2HIYA 3RB0A 3R5BA 4GVBB 2FHOB 5LMUJ 3GCWP 4B9MA 3VWSA 3VAKA 1V3ZA 4OYAA 4KSEB 4XDDA 2HVHA 2IVYA 1X8DA 2HFVA 2FC8A 4WJBA 1Y10A 3AHPA 3BDPA 4FPRA 3T6JA 1RTDA 1MWZA 4FNIA 3D6TB 4YOEA 1IBMJ 2QA4G 5C2CA 1I94J 1XMQF 2FVPA 3QQCD 1VQSA 2HVDA 3S7RA 4QQBA 2ZHBA 2PN6A 1RAEB 4AQYF 5L9NA 1KQGB 2UXDF 4DPTA 1RT1B 3E2EA 2ZC3A 4Y2IA 2FPHX 3PO5A 3IS9B 2QZ8A 2HQGA 4O3OA 2FC9A 2CXEA 5C24B 3K5LA 3KLIB 1SVDA 1PBAA 3EZUA 4KKOA 2QRRA 4IFVB 3J7AN 3A12A 4P71A 2GZOA 2CNNB 1L3TA 1GMUA 4DSIA 1K44A 2KU7A 1G3OA 3IP0A 3IG1B 3PRVA 4ZPCA 3TZXA 4CNYA 4M94A 3BYPA 4LT6A 3WQPA 1RBLA 3B4DA 4BDPA 3UDLA 3QBCA 3BREA 4DR4F 3HSZA 1AT1B 2LECA 3BYRA 2UV8A 2VBXA 4A4JA 1HBMA 2FJBB 4Z7CA 4C48A 3UR3C 5AXNA 3M8ZA 3RU0A 1C1CA 3NY0A 1TL7A 4PXEA 1EHWA 3IBWA 3B82A 3FEZA 2ASLA 4PG8A 3MURP 3KJQB 1FRIA 4F4KA 3CC4S 2LQ8A 4G65A 4RBUA 1X0FA 2CQ3A 2OTLS 3IAS9 2UP1A 1NJYA 3JYTB 1A7GE 2MLXA 4LF8J 3OVBA 4F04B 3KLVA 4P7TA 2M0GB 5KG7A 3MCOA 4LRDA 3R9LA 4RW9B 4M8LA 4CLTA 1T05A 1YK9A 4P72A 1S1VB 1FT8A 2BACA 3HHLD 1ZETA 1HNVA 1VQ5S 3NKYA 4QIWD 1FJGF 4DX5A 2Y1LB 4GKKF 1B0TA 1IBCB 1V5VA 1X4FA 4U96A 2B9XA 2B6AA 2QTWA 2IIHA 2VPZB 5KT4A 1ITPA 3RAMA 1GX6A 5M2UA 1TK0A 5HLFB 3I32A 3G8SA 3QLHA 2HFOA 2VZ9A 1JLFA 3NGRA 2XM3A 3MHYA 1YIJS 4WWSA 4N8OA 1SJ3P 3DDIA 2RMLA 1NK4A 4DR7F 2V9WA 2QO3A 3H5UA 4O0IA 1B0VA 3MOZA 1SJ1A 5EN1A 4NLTA 2VJUA 5J2NA 3SBMA 3UO0A 1GQEA 3HHLB 1EETA 3IR5B 3D28A 1UFKA 4OZ2A 3BSOA 1W2BR 4C3MA 4LF7F 4TU9A 4EFAC 3UVJA 5IFMA 3TAMA 4OYOA 3MR3A 2BQ3A 3UWTA 2W2QP 4OYXA 3KLFB 1WC1A 5KFNA 3QIPB 4ZHRA 3DLBA 1HMVB 4LF6F 1TL1B 3TQ1A 3RBXA 2CUYA 5D0GA 5D6GA 3M6UA 2AV5A 3NCPA 1B70B 1XNQJ 1WC5A 3A4TA 4FF1A 1WNEA 4FBTA 1ZPWX 1IXKA 2VU5A 1X4AA 2C28A 3RRHA 4Q8EA 4DLGA 1RT6B 4I69A 3LANA 3RTVA 1DFDA 3W8GA 1T11A 1N5QA 2N3OA 2HVEA 2H54B 3ILIA 2NYHA 3AA9A 2MEWA 1REGX 4YHHJ 4DV4F 3H0PA 2E5HA 3OD2A 2ZBRA 4OX9F 4C11A 1N5TA 4FS2A 2FVSA 4KHPJ 4CLZA 3V81A 3O44A 5K8PA 4N41A 3KJFB 4LFBJ 1IKXA 3KG4A 2RQMA 5C2GA 3M2RA 4I2PA 3SEOA 4C2MA 2KYXA 2ATLA 1FK9B 5DLFA 2WSFC 1H74A 1PC4A 4MK9A 2JRSA 4U8YA 2F8HA 3O8WA 3HKZD 3SIPB 3BM7A 2XMKA 2X51A 3ILLA 3M1VA 1JX4A 1SBRA 2YPYA 4DU7A 1CJVA 1KOHA 1S1XA 3ISND 4U7UK 4LIRA 4P2SA 5F8GA 1M5HA 4ECXA 3PIOQ 1I5OB 1NMEB 3ET6A 2MKYA 2YH0A 1MMDA 3AXKA 5HI7A 2MQNA 4G1QA 3OLAA 8RUCA 4B08A 4C8YA 3LTOA 5IWAF 1LV5A 2R2UA 2ZJRQ 3J81U 3VCDA 1KKHA 4JOUA 1S6OA 2LQJA 3ZNUA 2AZ1A 4WZMA 1VLYA 4CO5A 5DM7Q 4CYUB 4TYAA 1X7VA 1LEOA 4PQUB 2FJEB 4RJVA 1WELA 3FNNA 4DG1A 1Y9OA 3TQEA 4P75A 3N0VA 3FRYA 1ZM4A 2A2CA 3UPFA 2M8DB 5I3UB 5AXMA 5JVHQ 2BE9B 1AUSL 4K50A 1AB8A 1JKHB 3HPOA 3JQKA 1C0TB 3FGVA 4QWBA 3M9MB 3TA2A 4UW2A 1U49A 1HIYA 4EO6A 4NLGA 2KRRA 1X4CA 2OEKA 2ADBA 2E7XA 2VL1A 4K59A 2VIHA 2QEXS 4HT7A 2BXJA 2XWYA 3DLGA 2WVCA 2DH8A 4DN9A 1IVZA 4IG0B 3OPKA 4K5RA 4LVOP 4NLSA 4DR3F 3SXLA 3UDVA 3LA0A 2V8VA 1VQYA 1HNXF 1F9HA 4CQ1A 3NMAA 4F26A 2QA4S 1LWEA 2ZITA 3OHAA 3G86A 1HI1A 1EP4A 2Q1LA 3LGMA 2HFUA 1GNKA 4J9MA 2AF6A 2R2RA 3NGSA 5L38A 1TL5A 4K4ZA 2CWXA 3OUYA 1KC8T 4WF9Q 5DETA 1K73T 4NRUA 4D3GA 5DDRC 1UPMB 4RUAA 2YKMA 2YH1A 2FVRA 1U25A 1R27B 3FSXA 2DNMA 1Q82T 1HNWF 5B0FA 4PR6A 2E1PA 1FVQA 2MZRA 1JLEA 1WKKA 1S97A 4NXMJ 2P9CA 2XLKA 3SSQA 2O01C 3CCJS 2ZZTA 1H3DA 4B02A 4DPXA 4N7TA 3T1YF 1KR4A 4ILMA 1WHYA 4ECQA 5B0BA 2YVSA 3AD8C 3BJYA 4JI0F 2E44A 1G2EA 3MM8A 2LMIA 2EFNA 1IM6A 1FFSB 1KQSR 2VC1A 1WG1A 3JTOA 3DRSA 1PSDA 4A8XA 1WF0A 2WSEC 2ZOFA 5K14B 1F5AA 1R0CB 4ID8A 2HHPA 3CD5A 4CNZA 4I4BA 3KK3A 5J2QA 3QSYB 3C16B 4NCAA 2Z56B 1XR6A 4USKA 4ZJQA 3UN2A 2DNLA 2UVRA 1LWFA 2Y3YA 2KG0A 1PO6A 1QAIA 3JTNA 2OAUA 3CJ8A 1HHTP 2O1PA 5D4LA 1RHRB 5HMYA 2CZ4A 1U7LA 4A8SA 2AJFE 1HHSA 4OHXA 2ZH3A 2CQGA 1E6VA 1REVA 2LQBA 1VBKA 3CNQP 3ENAA 1NJZA 3AAWB 4ANDA 4OX6A 1G4CA 1Y11A 4YQWA 4LF1A 4B3TF 2J9EA 2B51A 2W9AA 3UN5A 4DR1F 5E41A 2J5AA 2LA6A 4LR9A 3KJNB 2W7PA 3TUIC 1Q79A 3TA0A 1HR0F 4KC5A 1DQ8A 1X4DA 1S6QA 3QO9B 2ZH1A 1JLCB 3DOMB 3NS5A 3ENWA 2M2BA 3CJRA 3K5MA 1NB7A 2CVEA 3DGPB 1LWCA 3Q2TC 4LFCJ 2UUTA 4YDDB 2MZ1A 1IJFB 4QCLA 1FRJA 3RUBL 2RF2A 2AGOA 4QWCA 2WOMB 4ZLLA 5F9NA 2XS2A 2RE1A 2JLEA 1VJQA 2M88A 1IKYA 4MFBA 4CTAA 1FD2A 4X62F 3OFHA 4PAAA 2XCPA 4B3SF 3R6GB 2BKPA 5E3QA 4KO0B 3O5TB 1WEZA 3ULHA 1FJ7A 3O3LA 3D1OA 2DNRA 4ZMMA 4O23A 2BE7D 2RDJA 2VB6A 3PJWA 3M9NB 2MJUA 3UCGA 3MM7B 2LXUA 3HFZB 1KHVA 3M2VA 2MKKA 4DZ6A 2H48B 2KO1A 2V8GA 3MUTP 2IAJA 4EZ6A 2QLFB 3DLEA 2JWNA 3DOLA 2MZJA 3BKFA 2D3OR 5KG5A 3CDBA 5IV4A 5L39A 4TQSA 1N88A 2MKSA 1YBTA 4JI7J 3GR1A 1RWMB 2QLXA 5FLXY 6FD1A 5SUHA 5KG6A 1XMBA 3GJQB 2P9EA 1GK8A 4MH8A 1HWIA 2AMCB 2ZE2A 4QR2A 4AUKA 1AUDA 2CIMA 3K5PA 3M30A 5JXSA 1FI4A 3KTQA 2LEAA 1GT8A 4A8QA 2QL7B 2HKEA 2YKAA 3CD7A 3CJ2A 1YX2A 3C3LA 3QGHA 3UDEA 5H9EJ 3D6FB 4NOHA 2DPIA 4ES2A 5HP1B 2BKOA 2V69A 3LP0B 2CQ4A 2ZBIA 4ZK7M 2BV3A 1SUQA 4OJHA 2N4CA 1DQ9A 1GTEA 3G6ES 2ZH7A 3CJTA 2HS4A 4DSFA 4IDKA 1U1PA 1JJCB 1UEVA 1BXNA 3RR7A 3Q0AA 2CA9A 1RHUB 2BJ1A 2I8EA 2VG6A 4YUDA 4DX8H 2WONA 4PG5A 1Y3JA 4G6VB 3IBFB 4A8FA 3H2VE 1TKZA 3H42A 2RKIA 3BH6B 1S99A 2I1RA 3E01B 3NP5A 2E1RA 2JNJA 2VDIA 2UXBF 1AFIA 1YITS 4C6AA 1U6ZA 1IQTA 1UJ5A 2GJFA 2GHVC 1NK9A 1ZAXA 3BBCA 5KFBA 1V3SA 3AD9C 4QIFA 4PWDB 4PPZA 4X66F 3SMZA 2XY5A 4FYWB 4WIQA 3CDEA 3G96A 3PYEA 3AA8A 1NSAA 1NAQA 1NHVA 1T94A 3KWMA 2GJIA 1LW0A 3MEDA 2HYIB 2C2ZB 3PHTA 1WOPA 2HLTA 2F1FA 2U1AA 2XSFA 2EI5A 2O66A 4CLUA 1NZ8A 3JXOA 3KXDA 1S76D 1VQPS 2BANB 1K1QA 2F5GA 2XI3A 2CJQA 1IBLJ 3I0RA 3PZPA 4XTTA 3QT6A 1R8HA 4USWA 3U1MA 3HVTB 4NZ0A 2CJYB 2DH9A 2V2KA 4NYZA 4ED1A 2E1MC 3IRXA 4BLGA 3KG0A 1IKVB 1WOOA 1PJ7A 2WCXA 5E3CA 1Y5NB 1OS5A 4RX6A 2DIUA 4DQQA 1UA1A 4ZP6A 2RRBA 3M2UA 2A1BA 4IR1A 2Z2MA 3EYZA 2YNGA 3T5KA 1RT3A 2YPZA 4B3RF 3EZ5A 3KJVA 3THTA 5L1KA 4OHZA 1U1LA 3MFHA 2D3ZA 1YVFA 4OJGA 4DS4A 2BM0A 1WF2A 2DGUA 3WHIA 2V2QA 1SB6A 1VK8A 4DFPA 1MNEA 1D1UA 1OMSA 4FKYA 2IM1A 5CAAA 4H4MB 5IZHA 1HBOA 3HVRA 2GVZA 4DMZA 3W2WB 4LRCA 4J37A 3RZAA 5B09A 4Y3CA 5KT7A 1GMVA 2OGUA 1YJNS 1SJ4P 4IFYB 3HI9A 2Y1JA 2ZOMA 1B64A 2DITA 1VQ4S 3LUYA 3OL7A 4WTOB 3I0SB 1NK5A 2IC3B 5DS7A 3PJXA 2XEXA 2JEIA 3PYGA 4F2SA 1U48A 3NEKA 2Z2LA 1FE4A 4YMEA 4JI6F 4P73A 3H4DA 3AH6A 4ZVPB 2AJ1A 1V5IB 2G2YA 4BC9A 3AJ1A 2XMWA 2MQMA 1HQEB 1TL3A 2CJXB 1RQ0A 2CJ9A 2DO4A 1F2GA 2R7TA 1NRKA 2C2KB 1WG4A 2VQEF 2F4VF 1FJEB 1RAJA 2HNDA 5HBMB 5J2MB 3OTBA 2CDRB 1PIEA 4BHQA 2VD3A 3BGRA 4DV7J 4TY8A 2E5IA 2QL9B 2WVDA 2X3GA 1RBOB 2QT7A 2H4WB 2HPUA 2RT3A 3MUMP 3MR6A 2DEIA 4HI1A 5EWEA 1T03A 4WFBQ 5IXUA 5L9XA 4I2QA 3DM2A 4CCHA 1TMMA 4Y00A 1N32J 1JLGA 2DR9A 4I7FB 2Z57B 3DOKA 1Q8IA 3DMJB 1YG0A 2ROPA 2ZH4A 2WW8A 3FQLA 4C3KA 8AT1B 3H7HB 2B3TB 1HL6A 5T7LA 3GJTB 4C8LA 1KWMA 1SV5A 1HBNB 3DYAB 1LFPA 3HVWA 3VAIA 1BWVA 1S9EB 5EX0A 2ZNYA 2DIVA 5F0WA 1VRUA 1JNRB 2WTFA 5GMEA 1K0TA 1QTNB 1QJHA 2ACMA 1DQAA 3W2VB 3PX4A 4I6AA 4P2MA 1KFDA 5DG7A 2EEYA 1NJWA 1CJKB 5LL6d 3MMCB 2MSSA 2MTLA 2DH7A 2J76E 3GFZA 5KFXA 3ZZRA 1UL3A 3U27A 2KDOA 2JZ5A 2CPIA 2HBRB 3Q2SC 4JI3J 4DV1F 1S1TB 3MEEB 1A0OB 2UUCJ 5BR8F 1NB2A 1UKUA 4CM0A 4Y2AA 4JP8A 4XO0A 3D3CJ 4LUBA 1T02A 5CABA 4FXWA 4RW8A 3D1QA 4Y2MA 2RHSB 4S0MA 5ETOA 2R8GA 4FXDA 2GAHC 1UW9A 2AYBA 4Q2LA 1YJVA 3NNHA 3QMQA 3FCHA 3H2UB 5U47A 3Q24A 2LKZA 2EFGA 1ZA1B 1WDDA 4J5OA 4WCEQ 1RDRA 3LWLA 5L1LA 5GAGU 4TXSA 3H5XA 1MMLA 1T3NA 4RW6B 4EGLA 4ZVOB 5LMNJ 5KFLA 2JDJA 3M8PA 4FNHA 2C2EA 3VVUA 3HO1A 1FWPA 3R7SB 4A46A 1NDLA 4KTQA 2MZQA 1HQUA 3TJ9A 3Q8YA 5JVGQ 1HYSA 3MEGB 3HVAA 1D9DA 4IG3B 2RSQA 2ZDOA 1PYTA 2JHEA 4U9RA 4UOCA 3OSPA 5J1EA 1VIOA 4WP3A 2E5LJ 2E1CA 4K2XA 3SQGB 5I42A 3WC0A 2HHTA 5L8RC 3LH2S 3QGPA 4WKRA 2GIFA 5ETNA 2RAQA 4RW7A 1RTJA 5HL7Q 2O67A 5HVHA 4HTIA 1RJJA 3P5TL 2GV1A 5H9EK 4QPXA 2R7WA 2GMLA 1OO0B 4ZITA 4EEYA 2L9NA 2RUSA 3OL6A 4DR5J 3HF5A 5HATA 1RTDB 3MPUB 1D3WA 2O3DA 4HH0A 1PC5A 3DRXA 3CCES 2V8PA 2HFSA 3F56A 1VMBA 4WU3A 1PILA 4ZVSB 2C3YA 1VISA 2IPOB 1L3SA 1XJWB 4EBEA 4PEOA 3DHWC 5F8MA 3Q22A 1OPIA 1FHTA 2UXDJ 4P6QA 2HG4A 5AJ3F 3ITHA 2XLJA 1ROFA 4URSA 1E6YA 1RWWB 1P1LA 1F9EB 5IQ6A 2NQPA 3UD4P 2YKOA 3JAMY 5KFHA 2KT2A 2VG7B 2VOPA 1HD1A 1U02A 1HHQA 1F1BB 2R3VA 4ID5B 3NAHA 2EBEA 3GE9A 5IC6B 4WZQA 2XCAA 1UEUA 1VI7A 2FZGB 1M1KT 2AJ0A 2FLOA 2QG9B 2VBZA 3G71S 3GYNA 2KFZA 4NL5A 3HHKA 5D78A 1MU2A 1T0TV 1NPKA 1ZBTA 1HKAA 3C2PA 3SCKE 2QC3A 4JI2J 3CD0A 1TL7B 2NLWA 2UUAJ 4RW4A 2PI5A 1S9GB 5KFGA 2H5EA 2D9PA 4R0EA 2C22A 3DFEA 4B9NA 2BE2A 3TVKA 3RB6A 3CJ0A 3T3FA 2E7WA 2ZVIA 1SJFA 4MAKA 1IUJA 2FJXA 5F8LA 5DG8A
chains in the Genus database with same CATH topology
4WP3A 2BW7A 3MR7A 4P2FA 1CJTB 4CM0A 4P2XA 4USUA 4WP8A 1Y11A 1CS4B 4CLWA 1AZSB 4OZ3A 4NI2B 1YBUA 5D0RA 2GVDA 4CM2A 3C14B 1WC4A 4CLZA 4NI2A 4CLPA 1WC3A 1FX2A 4OZ2A 4CLTA 1YK9A 3UVJA 1CJUA 5D0HA 4OYBA 1CJVB 3R5GA 4OYOA 1CJTA 3MAAB 2GVZB 5D0EA 3C15B 1CULB 1CS4A 1AZSA 4CLKA 4OYXA 4CLLA 1WC1A 4OYAA 4OYMA 3C15A 4CLSA 3C14A 4P2MA 5IV4A 4CLUA 3C16B 4OYIA 1CJKB 3ET6B 4OYZA 4WP9A 5IV3A 5D0GA 1YBTA 4USTA 1WC6A 1WC5A 1Y10A 2QV6A 1U0HB 1CJKA 1TL7B 1AB8A 1CJVA 1WC0A 2W01A 3MAAA 1U0HA 2GVZA 2GVDB 4CLFA 1TL7A 1FX4A 1CULA 2WZ1A 4USVA 4OYWA 4USWA 4WPAA 3G82B 3C16A 4CLYA 3UVJB 3ET6A 1CJUB 4OYPA 5D15A 3G82A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WP3 A;  2BW7 A;  3MR7 A;  4P2F A;  1CJT B;  4CM0 A;  4P2X A;  4USU A;  4WP8 A;  1Y11 A;  1CS4 B;  4CLW A;  1AZS B;  4OZ3 A;  4NI2 B;  1YBU A;  5D0R A;  2GVD A;  4CM2 A;  3C14 B;  1WC4 A;  4CLZ A;  4NI2 A;  4CLP A;  1WC3 A;  1FX2 A;  4OZ2 A;  4CLT A;  1YK9 A;  3UVJ A;  1CJU A;  5D0H A;  4OYB A;  1CJV B;  3R5G A;  4OYO A;  1CJT A;  3MAA B;  2GVZ B;  5D0E A;  3C15 B;  1CUL B;  1CS4 A;  1AZS A;  4CLK A;  4OYX A;  4CLL A;  1WC1 A;  4OYA A;  4OYM A;  3C15 A;  4CLS A;  3C14 A;  4P2M A;  5IV4 A;  4CLU A;  3C16 B;  4OYI A;  1CJK B;  3ET6 B;  4OYZ A;  4WP9 A;  5IV3 A;  5D0G A;  1YBT A;  4UST A;  1WC6 A;  1WC5 A;  1Y10 A;  2QV6 A;  1U0H B;  1CJK A;  1TL7 B;  1AB8 A;  1CJV A;  1WC0 A;  2W01 A;  3MAA A;  1U0H A;  2GVZ A;  2GVD B;  4CLF A;  1TL7 A;  1FX4 A;  1CUL A;  2WZ1 A;  4USV A;  4OYW A;  4USW A;  4WPA A;  3G82 B;  3C16 A;  4CLY A;  3UVJ B;  3ET6 A;  1CJU B;  4OYP A;  5D15 A;  3G82 A; 
#chains in the Genus database with same CATH topology
 5JJB A;  2CZ9 A;  1R0B G;  2ILZ A;  4YR2 A;  1WAC A;  2HMI B;  2PD1 A;  1ZAW A;  4ZJO A;  3NBP A;  3GMG A;  5LOQ A;  1T05 B;  4NCB A;  1WTB A;  4OQJ A;  5HO4 A;  3R2C J;  4K8R A;  2YX4 A;  2RDD A;  1IKW B;  4ECS A;  4PXD A;  2ZM6 F;  4JV0 A;  3HSG A;  3K89 A;  4KAI A;  2V4R A;  1TMJ A;  4X4U A;  2IM0 A;  1S79 A;  1UVJ A;  3P45 B;  1FJG J;  4RNN A;  5DG9 A;  3C15 A;  4DV0 F;  5FII A;  1RAO A;  4Q2M A;  3KNA A;  4GVL A;  3QLH B;  4NMX A;  3IA0 A;  2DBB A;  2MHE A;  1RWV B;  3G2X A;  4C8M A;  3C46 A;  1JLF B;  2H3E B;  3UNY A;  3MAA A;  1FX4 A;  1QUP A;  3A8E A;  4DL2 A;  2XS5 A;  2W4P A;  1V6H A;  1T95 A;  4OI0 A;  4FZV A;  1FDA A;  2YQ1 A;  5J2N B;  2QMX A;  3MDF A;  1UFL A;  2J7K A;  1EET B;  1FRH A;  3FQK A;  2H5J B;  4KT0 C;  3HDS A;  2C3U A;  2PC6 A;  4A48 A;  4Q0B A;  1NEE A;  1KOO A;  1X9S A;  4LF4 J;  3TAM B;  2XUL A;  2XLI A;  2J9D E;  1NKE A;  1ULR A;  4NLQ A;  5D0H A;  4L73 A;  1SH0 A;  1GAO A;  4LF7 J;  1RA7 A;  3B54 A;  3TO8 A;  1K47 A;  1X4G A;  2DNY A;  2ZH9 A;  2DR8 A;  4IOC Q;  4A8O A;  1LK7 A;  1WG5 A;  3LAK A;  3POT A;  1ZS6 A;  2H5I B;  4OYZ A;  1U2R A;  1KVI A;  4LF6 J;  3DRR A;  3LP1 A;  4TKT A;  3BN7 A;  3SFG A;  3IBC B;  3BQ2 A;  3AT1 B;  2KB2 A;  1UA0 A;  4MIW A;  4XK8 C;  3PAC A;  2JC1 A;  4DDF A;  5KAK A;  5E0O A;  4DX6 A;  4WXO A;  1G6B A;  4DZD A;  4R5P B;  4OV6 A;  1KDN A;  1S6P B;  3HJV A;  4WP8 A;  2BA9 A;  4ED7 A;  4M5L A;  3V81 B;  2D3O 1;  1L3V A;  2CVI A;  4ED3 A;  2XZT B;  2VPX B;  2JVR A;  1BC6 A;  2IBO A;  1RTI A;  4ALZ A;  4YS2 A;  4F4X A;  2J0S D;  3CE8 A;  1HBU A;  1DTT A;  2NXN A;  3MTJ A;  2I5J A;  2ZBC A;  1JMT A;  5HVG A;  1NH8 A;  1TK8 A;  2P2C B;  4DQS A;  4ECW A;  3M1V B;  3PW4 A;  1RP5 A;  2B5J A;  4O3R A;  2VBW A;  1S1X B;  3TYT A;  3TNV A;  3QZ8 A;  1DTQ B;  4WE1 A;  2VFS A;  1Q53 A;  1UAW A;  3BV8 A;  2VON A;  1NK7 A;  2M3D A;  4QW8 A;  3PV8 A;  3IRW P;  2DNH A;  4L3N A;  2VFT A;  4HHJ A;  5F8N A;  2EFV A;  3WBZ A;  2KKH A;  1ZM9 A;  5A8R A;  1YJW S;  2MY7 A;  2L48 A;  4G1Q B;  4OI2 A;  1S12 A;  3KLH A;  3V6D A;  1RTH A;  2ADC A;  1KQK A;  1TV6 B;  4FYX B;  4U7U D;  3SSR A;  5A8W B;  4EMD A;  3LWM A;  2CRL A;  5F8I A;  2GO8 A;  2D1C A;  2B4U A;  3C14 B;  3GFH A;  1VHI A;  4CM2 A;  3NGU A;  4DWI A;  1JJH A;  3QFW A;  4K5S A;  2FLP A;  4CLP A;  2V67 A;  3R8Y A;  5IWA J;  1JLQ A;  3MMJ A;  2DCL A;  5CYM B;  5KFF A;  3RRK A;  1SI9 A;  4BBY A;  5IT9 Y;  1RT5 A;  4DG1 B;  2GQC A;  4TQR A;  3D9B A;  3KUE A;  3F44 A;  4KGV B;  1SIZ A;  3HM9 A;  1QTM A;  2RU3 A;  4FYD A;  5LMU F;  2VC0 A;  3A8J A;  3JSR A;  4OI1 A;  1F5B A;  1LOU A;  2QA1 A;  2AX1 A;  2XSJ B;  2YKN A;  2RS2 A;  4GVB A;  5AE1 A;  4OIX A;  2QL5 B;  4UZC A;  3IO1 A;  2BAB A;  3Q8R B;  4LIW A;  4OLP A;  3GG0 A;  3TVZ A;  2HS3 A;  1IBM F;  1I94 F;  2KXN B;  5ADZ A;  1RKJ A;  1N5Y A;  3UDC A;  2D7S A;  1DLO A;  1PAE X;  3ZTQ A;  2LCW A;  5G0R B;  1LWE B;  4M63 A;  3PX6 A;  4W92 B;  2C2M B;  3S8S A;  4DPW A;  2F3J A;  1T9U A;  2XMM A;  1YHQ S;  4DQI A;  3TEG A;  1NND A;  1UMJ A;  3EE3 A;  1HNZ J;  5GAG I;  4DR6 J;  1RT1 A;  4UZB A;  4NLR A;  1X31 C;  1RTZ A;  3CJQ A;  4ZIV A;  3IS9 A;  1IR0 A;  5ETM A;  1DBD A;  1RCX B;  4UUX A;  3JSB A;  3OUY B;  3KLI A;  4DSJ A;  4AT1 B;  4ICL B;  2QLW A;  4B9V A;  4JI5 F;  1VRT A;  4UOG A;  2HEK A;  3IG1 A;  4UST A;  3W60 A;  4AYB D;  2ZZN A;  1X4H A;  2XHW A;  2W24 A;  2UVW A;  1OWX A;  3A3O B;  1X9M A;  1DZ5 A;  4XIU A;  3OFE A;  3KLE B;  1R0A B;  3MUV P;  2J6T A;  3R2D J;  1JXE A;  1MSW D;  4AXJ A;  1C0U A;  4J9O A;  1SCJ B;  2AEJ A;  7FDR A;  3LP2 A;  3KUG A;  1WF1 A;  4B9T A;  3MM8 B;  3BGU A;  3U1N A;  1RIS A;  1CSJ A;  1DRZ A;  3GZ7 A;  2UUB F;  2BX6 A;  3DRS B;  3T1Y J;  1TUV A;  5M2P A;  2H4Y B;  4JI0 J;  5HN0 A;  4LF8 F;  4MYT A;  2C3P A;  3A13 A;  3NL0 A;  4PQA A;  1MWQ A;  1FKA F;  5GMD A;  1OQ6 A;  5ETV A;  2XO7 A;  3CCV S;  2CQI A;  1EX8 A;  1AYE A;  2L9D A;  3G8Q A;  3NNC A;  1TZ0 A;  3HSJ A;  5BXI A;  5IT0 A;  3B78 A;  3PEH A;  1JK9 B;  4ED2 A;  3OTC A;  1FER A;  3R27 A;  3PNI A;  3JB9 k;  1RWN B;  2QLJ B;  1E6V B;  4PG4 A;  2FJD B;  3I6P A;  4TVA B;  5AXK A;  2W9C B;  1ARO P;  1Y00 A;  2DB1 A;  2YWH A;  2B0G A;  3V2U C;  3CME S;  5CA5 A;  2YXL A;  4QYR A;  3IXQ A;  2AD9 A;  2EFO A;  2OPR A;  4OI3 A;  3R5D A;  5HJX A;  2UV8 G;  5A0Y A;  3HHD A;  4B3T J;  4IRK A;  4CO2 A;  3RBD A;  4KBI A;  4LRF A;  4I1T A;  1FE0 A;  3OV7 A;  4MTP A;  3LW5 C;  1NSK L;  2F4F A;  2AJQ A;  3T5H A;  2YQ3 A;  5KFZ A;  1HR0 J;  3LQV A;  3IR7 B;  2UU9 F;  4PCQ A;  1LWC B;  3Q8Q B;  3BPD A;  4M5I A;  5BYS A;  2KYZ A;  1M0S A;  3I9Z A;  3PO4 A;  4DV6 F;  4X4P A;  2W2N P;  3HCX A;  2HWI A;  3QRR A;  2FJV A;  1JNZ B;  5CH7 B;  3H8Y A;  3K8W A;  3I5A A;  4RR5 A;  3B4M A;  4HR2 A;  4J9Q A;  1IKY B;  4YN3 B;  3RGI A;  1XNQ F;  4Z7Y A;  4J9K A;  2CPY A;  2B8Q A;  4KE5 A;  1TQL A;  5DO2 A;  5J1P A;  2RQ4 A;  2VG5 A;  4QOT A;  3ICL A;  5FD1 A;  1W26 A;  3I5C A;  5J2P B;  3GQC A;  2ERR A;  3VAF A;  4YEA A;  4XPE A;  4B3S J;  4RNH A;  4KH1 B;  3TZW A;  3M2V B;  2AIR B;  3KUH A;  1RT6 A;  3P8B B;  2Z2Y B;  3DLE B;  3DOL B;  4GO7 X;  2COL A;  2Q43 A;  3KHG A;  2KM8 C;  2W8K A;  4NE9 C;  3CJ4 A;  5BJR A;  3EMT A;  1C2P A;  5B0A A;  1SQF A;  1FXR A;  3WX8 A;  3B6B A;  4QU7 A;  5LT5 A;  2PMH A;  2BJ3 A;  2KHC A;  4AL5 A;  3GSI A;  4ZKA A;  4M5H A;  2OD4 A;  4LSZ B;  1FWK A;  3QGG A;  5AE2 A;  5CYJ A;  2ZE2 B;  2MZT A;  2VA2 A;  2DTJ A;  3M30 B;  3L7O A;  5F0U A;  2EG1 A;  4KFB A;  3BGL A;  3BEG B;  5HQL A;  3D5M A;  4ECR A;  2BVZ A;  4WFA Q;  2OPQ B;  4ELT A;  1FK9 A;  2HQF A;  3VZI A;  3J80 Y;  4ZVF A;  4ED6 A;  4ZPW R;  1TVR A;  1P9Q C;  2XQC A;  3KHL A;  3BQ0 A;  4KV8 B;  1PGZ A;  4J91 A;  2V2Z A;  2CQD A;  4RUC A;  3ZZT A;  3P4U B;  1SUQ B;  5B0C A;  4DLE A;  4FVM A;  5HRO B;  1D09 B;  4RO0 A;  5LSO A;  4Q7A A;  2R7X A;  3LO3 A;  4NWB A;  2VG6 B;  3W5X A;  5BYR A;  4RNM A;  4NEZ A;  1NK0 A;  3QID A;  4K4U A;  3FBC A;  4PUO A;  2WON B;  3BDE A;  3PIP Q;  1L5U A;  1FRL A;  3UE2 A;  3I56 S;  3CT9 A;  3FJ2 A;  1NJI T;  4K0K J;  3OR2 A;  1TKZ B;  2R2S A;  2RU9 A;  4LF9 J;  4FBU A;  5FLX U;  3K17 A;  3RAX A;  4ZDN A;  1U0H A;  1S49 A;  2VQF J;  4FDF A;  4QIE A;  4PQU A;  4DSE A;  1RHJ B;  1UP1 A;  4OMF G;  1Q8K A;  1N34 F;  1VR6 A;  4WPA A;  1HWK A;  3TW0 A;  2HNZ A;  1X5O A;  4YR0 A;  4X65 J;  5I3U A;  1WUU A;  3N6M A;  4NA3 A;  2E5G A;  3OVS A;  4J9N A;  3NOG A;  1FTC A;  5ETR A;  1JKH A;  1C0T A;  2BJD A;  4ECT A;  1M5P C;  1WOS A;  1K8A T;  2JLG A;  5E7O B;  4DCO B;  2CPX A;  2YNI A;  2MGZ A;  2XYG B;  1FDN A;  1R8B A;  1TK5 A;  2ROG A;  2L3M A;  3U1L A;  1HW8 A;  3OW2 R;  1JLB B;  2WBM A;  1Q81 T;  4F4Y A;  2IVF B;  4P9S A;  3CTR A;  3OR1 B;  2HGN A;  3ETO A;  4J9R A;  1CQN A;  2AT1 B;  3NGK A;  3SCJ E;  2IJR A;  4PPD A;  3EUN A;  3ONQ A;  1D9F A;  1FF2 A;  2ZFH A;  3IRX B;  1TAU A;  2UVU A;  3TAP A;  3AD7 C;  1CJU B;  2OPP A;  3I82 A;  4M5K A;  4OYP A;  5T41 A;  3ADA C;  1RAI B;  2LU2 A;  5KFP A;  3AXM A;  1EKS A;  3T19 A;  4F3O A;  4M5G A;  3OXF A;  1IR2 A;  3VGT A;  2ZC4 A;  1XMO J;  3DCA A;  2PFF B;  4ZCM A;  4OX8 A;  1CC7 A;  5C5J A;  2IRY A;  4NI2 A;  2B9Y A;  1RT3 B;  3M8Q B;  5DLG A;  1MN7 A;  5LSR A;  3KJV B;  1WI6 A;  2XZD B;  2KXH A;  3BR8 A;  2HQ3 A;  2I2Y A;  1GX5 A;  4PAB A;  4R25 A;  2W4C A;  4QW9 A;  4B3R J;  3NCQ A;  3I9V 9;  2RDI A;  1IQZ A;  1M1H A;  1KTQ A;  1DUR A;  2XMA A;  4PXC A;  1R6Y A;  2EC0 A;  1T9T A;  2HUR A;  1DJ0 A;  4K2J A;  2A10 A;  2GFF A;  3M8R A;  2X1F A;  2MZS A;  3CO0 P;  4X84 A;  3GFY A;  4C0B A;  5K14 A;  3FCV A;  2LEP A;  3ZC4 A;  4OHY A;  1VQK S;  4RWW A;  2CKW A;  3C16 A;  1P8G A;  3CMA S;  2MQ8 A;  5CD4 A;  2A18 A;  2F63 A;  3OXG A;  4USU A;  2HQC A;  2YX1 A;  3KKF A;  1WEX A;  2ZUA A;  4NPO A;  1Q86 T;  2ZKU A;  1KFS A;  3ZTP A;  4LSL A;  3GV8 B;  2VIC A;  4PXB A;  1NDC A;  1O8B A;  1TL3 B;  2MPU A;  1YJU A;  3M6V A;  3PFE A;  3MPW A;  1S1W B;  1M90 T;  4H4O B;  3RAQ A;  3RG6 A;  1RHQ B;  3F41 A;  4RNO A;  6AT1 B;  5CQG A;  2HND B;  3H59 A;  4Z37 A;  3GR0 A;  5DRK A;  3GWC A;  3A3P B;  1CUL B;  4FKX A;  4J9P A;  3BBF A;  1O0P A;  1U6B A;  1U1Q A;  2F4V J;  5K8N A;  4MIA A;  3KHR A;  3PKM A;  2HBY B;  3HZG A;  1MLA A;  2HGL A;  4C0H A;  3NWR A;  1YQH A;  2OH2 A;  1VQ9 S;  3PR4 A;  4IUF A;  4ERD A;  3QO9 A;  3LF0 A;  2VKZ G;  1JLC A;  2GW8 A;  3QT8 A;  3MZI A;  1S48 A;  3DOM A;  2DNG A;  1T03 B;  3KDO A;  1KQF B;  2A2D A;  3UNG C;  1KON A;  4DR2 F;  4LF5 F;  2CQ0 A;  3LGN A;  4FP9 A;  3GTY X;  4ANC A;  4RBT A;  1JLG B;  4IH7 A;  3OFG A;  1PKU A;  2E5J A;  3DOK B;  2VBY A;  2IRU A;  2J0Q D;  4N5S A;  2Z4P A;  3O1L A;  3CCZ A;  1SV5 B;  3NAI A;  3TJ8 A;  1QAY A;  2G0C A;  3CCW A;  3UCZ P;  2VPW B;  1QSY A;  1Q8L A;  2MKH A;  2CQC A;  4LQ9 A;  3GCX P;  2KFN A;  4I64 A;  1N36 J;  4Y0F A;  3ETM A;  5GAD U;  3J7A 1;  2CQH A;  2OKQ A;  2CPJ A;  3RR8 A;  1J5O B;  2D41 A;  4RL1 A;  3WC2 A;  5MAO A;  1VDH A;  4HLB A;  4M5J A;  4ZPT R;  3L4B C;  2HNY B;  2PII A;  2EK6 A;  4NZ7 A;  4DL4 A;  2KJW A;  4F2R A;  1FXD A;  4L6V 3;  3S6E A;  4ZVE A;  3DLK B;  2LP4 A;  1CEZ A;  4GKJ F;  4DV1 J;  1F0X A;  3TJA A;  1LW2 B;  5C42 B;  5BR8 J;  1AZS B;  2HHW A;  3JS9 A;  2AZ3 A;  5IM0 B;  2FHJ A;  2FY8 A;  5C25 B;  4Q5V A;  2V4Q A;  1VOM A;  4NX9 A;  3HT3 A;  4EYI B;  1BUX A;  4D3H A;  3TEH B;  4HDH A;  1HQ2 A;  1TKT A;  4YFU A;  3DU5 A;  5CCM A;  3DGV A;  3BS9 A;  1SJQ A;  1UVN A;  3I87 A;  3Q83 A;  3V4I A;  4ZA1 A;  5DGA A;  4NLP A;  1C1B A;  3ISZ A;  5HP1 A;  1N8R T;  3LP0 A;  3TA1 A;  2RRA A;  3D4J A;  1MRO B;  4MK8 A;  1HQU B;  2HQI A;  4ED8 A;  2XZW A;  4ILR A;  2DKO B;  3IC1 A;  4C97 A;  2OEM A;  5J1E B;  2LEB A;  4LMZ A;  5A8K A;  1U8S A;  2OP5 A;  1A6L A;  4OHV A;  1S1U B;  2E9R X;  3MM9 A;  5HAO A;  3DC2 A;  5D3G A;  1FEH A;  1Y7P A;  4CI0 B;  3DLH A;  3TUJ C;  1ZAV A;  2C3O A;  5HQ8 A;  3OVA A;  3VGV A;  3WZ0 A;  1U1N A;  2B4V A;  3UFC X;  2U2F A;  2PEB A;  1VC5 A;  5HAN A;  4IO1 A;  2W9B B;  1U2C A;  4X64 F;  3E01 A;  2DGS A;  3CD6 S;  1ZTT A;  1BMQ B;  1RBA A;  3DRP B;  3OTO F;  2ZD1 B;  4WBF A;  1TUG B;  3FEY B;  1QUV A;  3GB0 A;  1ZM3 A;  4LBI A;  2ILY A;  4DPY A;  3DKD A;  5LM7 E;  3GU0 A;  5K20 B;  3THV A;  4QIG A;  3N28 A;  5DDP C;  1I6J A;  1N33 J;  2W4D A;  4ZP9 A;  1B7F A;  3C8Y A;  1AA1 B;  4EZ9 A;  2K3I A;  2UVV A;  2VOO A;  1RT7 B;  2Y0B B;  5L1I A;  1TKX A;  5F3T A;  2CPZ A;  2DGT A;  5CD4 H;  3CVK A;  1B7Y B;  1IBL F;  4FS1 A;  1OJ4 A;  4A8K A;  4LF2 A;  2GNK A;  5KFA A;  1NJX A;  4DU8 A;  3EVO A;  3QFH A;  5B08 A;  4EBC A;  5KT3 A;  3SCI E;  4M5D B;  1MWY A;  2BYC A;  4R8U A;  1S0O A;  3QNW B;  2ASY A;  3CDU A;  2KHD A;  4HAC B;  2R8H A;  3N5F A;  1VBZ A;  3HVT A;  4KPC A;  4A8M P;  1K0V A;  4MT1 A;  3AQO A;  3PVX A;  1HNI B;  2CG8 A;  4HKQ A;  3J7Z T;  1Q0N A;  1MU2 B;  1IKV A;  5KT6 A;  3HLU A;  3DXB A;  4Y6I A;  2OSR A;  1RWO B;  4O44 B;  2XNR A;  1CQM A;  5KFC A;  1I1G A;  4JV5 F;  3PW0 A;  1N5S A;  5KFR A;  3EX7 B;  3T5J A;  2B8P A;  3QWU A;  4M5M A;  1XIQ A;  2J8S A;  1RZM A;  1BQM B;  3AB4 B;  2OI2 A;  3EGV A;  4O4G A;  2DGQ A;  4JI4 J;  5THW A;  2HRU A;  2DIS A;  2WVF A;  2V94 A;  3GIM A;  4USM A;  4EU0 A;  2AJ2 A;  2VA3 A;  2FIU A;  4ZVU B;  4KHM A;  4QU6 A;  2J9D A;  4KGM A;  4W90 B;  1ACM B;  4BS2 A;  3EZO A;  4NXN F;  2PGC A;  4JI8 F;  2X1A A;  3DI6 A;  2XTJ P;  5FDL B;  1BWE A;  2N7C A;  3JAM U;  3DXS X;  3V6H A;  3K0J A;  1GXL A;  4IFY A;  3PYD A;  4IR9 A;  1NH7 A;  2ZHO A;  1H98 A;  5I3P A;  2G9O A;  2RD5 C;  5EDW A;  3KMQ A;  2E66 A;  2YNF B;  3KLG B;  4B3O A;  4QR1 A;  3T6B A;  3C15 B;  1JQG A;  3A1Y G;  1FA0 A;  3KK1 B;  5KT5 A;  4U67 Q;  1CBK A;  4WFN Q;  1FVS A;  5KFV A;  3FFI B;  3NOC A;  1FKO B;  2BZ2 A;  5C7P A;  4KJI A;  1HQE A;  1FO1 A;  1EQM A;  1NM2 A;  2OSQ A;  4DV7 F;  4DUY J;  2QYC A;  5HBM A;  1Q7L B;  5J2M A;  1NPP A;  2NRE A;  3W1Y C;  2KT3 A;  4RPF A;  4CO4 A;  5KOW A;  3BQ1 A;  4UUW A;  1KD1 T;  2I0X A;  2MDA A;  3HHE A;  1Q1K A;  4YB5 A;  1OQ3 A;  2DGW A;  4ANE A;  4OZ1 A;  2Y0S D;  2H1Y A;  1YGY A;  3HUL A;  4OZ0 A;  3CMQ A;  3ZTR A;  1EB0 A;  3D68 A;  3D67 A;  4UTG A;  5D77 A;  1FJC A;  3D0I E;  3RB3 A;  4F0K A;  2DT9 A;  4KPY A;  2G0J A;  3ZZO A;  3TAQ A;  3GII A;  4RUB A;  1I51 B;  2OPS A;  1ZOT A;  3CUN A;  3ILO A;  4I7F A;  2QSF A;  1HPZ A;  1VRQ C;  4QWA A;  3POT B;  4NCG B;  1WSV A;  1Z2L A;  3DMJ A;  1ZTW A;  4Y2K A;  4K4T A;  1FEE A;  2KVI A;  1JJ2 R;  2IMW P;  1U2F A;  4WP9 A;  2NUH A;  3IWL A;  2SXL A;  1IBK F;  1HBN A;  4OI4 A;  2LA4 A;  3DYA A;  1FRX A;  1S9E A;  4PG7 A;  3MD3 A;  3E51 A;  2CQB A;  4CLF A;  4OI6 A;  4C4W A;  1XN9 A;  4USV A;  4TU8 A;  1RAH B;  3MCS A;  2XGP A;  2MY8 A;  3VAG A;  1UCN A;  3SDE B;  2RB7 A;  3EXC X;  3GON A;  5SZT A;  4B17 A;  1HWJ A;  2AEM A;  4F4Z A;  4NLU A;  3QAT A;  4KYZ A;  2V4J B;  1P6T A;  4CH0 S;  6FDR A;  2LQ9 A;  4ZLP A;  2UUC F;  3KK2 B;  4IH6 A;  1H38 A;  2QLB B;  3LOU A;  1DTT B;  2NZ4 A;  2QMU B;  3AY0 A;  4GC6 A;  3K5O A;  3ENQ A;  3MEE A;  4MKY A;  3QT5 A;  9ATC B;  1QAX A;  4U8V A;  5KG0 A;  3EWG A;  1SIW B;  1HA1 A;  5A2Q U;  3MMB B;  2B5J B;  1MN9 A;  2NPI A;  1Y0H A;  3CWJ A;  3PDN A;  3AOB A;  3THP A;  2DR6 A;  2EVZ A;  3FKB A;  3BGF A;  4ZCI A;  1BQN B;  3EXY A;  5CXT A;  2J7W A;  3VZH A;  5LMN F;  2J8A A;  2KN4 A;  3I5B A;  5A8R B;  3VQT A;  1SH3 A;  4YB1 P;  1GTH A;  3AOD A;  1UWA A;  2NSC A;  4RW6 A;  2APO A;  5E2Q A;  3QWP A;  1PBU A;  2C2O B;  3FUY A;  3NWG A;  1UJ6 A;  5HVF A;  2XYH B;  1UZD A;  2FVC A;  4WXW A;  1JLQ B;  4ED4 A;  2IJF A;  1WC3 A;  4IG3 A;  2E5L F;  3T1H F;  3I55 S;  2MYF A;  3RW7 A;  5IOL A;  1X4B A;  4DFJ A;  2BJ7 A;  1YJT A;  5GAD I;  4NEY A;  4ZPB A;  3BB5 A;  2GIQ A;  1QD1 A;  3MPD A;  4DV3 F;  3SQG A;  5A6W A;  2ZNZ A;  1BD6 A;  3PJ9 A;  5ETP A;  3GYG A;  1RWP B;  2G2O A;  2WVE A;  2XI2 A;  3PFO A;  5DZ6 A;  2M7S A;  2K2P A;  2YKN B;  4DV2 J;  3W9J A;  3EGN A;  3RRG A;  3K57 A;  4DR5 F;  3OBI A;  2V2V A;  1RUS A;  3PRD A;  3N6N A;  2IYG A;  3FDS A;  2IRX A;  1D8Z A;  1KP6 A;  5CYQ A;  3J7Y U;  2CNO B;  1N5Y B;  1F9F A;  2KL8 A;  4C8O A;  1DLO B;  4UOH A;  2XNQ A;  4IKA A;  1D8Y A;  2FY1 A;  4GRS A;  4DJB A;  4F50 A;  2FB0 A;  3CCR S;  3AOA A;  3P3D A;  4WFX A;  4DOZ A;  4ECZ A;  1GEH A;  2KXF A;  5LXY A;  2VFR A;  2Y8W A;  5KG1 A;  2AWZ A;  4FN5 A;  4V19 X;  4ELV A;  4DX7 A;  4X2B A;  3JQJ A;  3CB4 A;  3HSD A;  4P74 A;  5K5M A;  4OX7 A;  5IT9 U;  2JSX A;  1VRT B;  1URR A;  1Z2Z A;  3EDQ B;  4DXL A;  1UWB B;  1L3U A;  1RHK B;  4RU9 A;  2EBG A;  2M5Y A;  2VG7 A;  2UXC J;  2P5V A;  4ID5 A;  4JI5 J;  2ABY A;  1HAR A;  2BBE A;  2GMJ A;  1VJW A;  2DXD A;  3MM5 B;  4OJ1 A;  4ES3 A;  2L9W A;  1VBY A;  4JI2 F;  1WHW A;  2XGQ A;  3KG1 A;  4DPO A;  1C0U B;  1QVF R;  1N6Q B;  3M6X A;  4HYK A;  2UUA F;  2HGM A;  2RIJ A;  3LP2 B;  3CJK A;  1Q5V A;  5KFO A;  9RUB A;  1D0E A;  5E3R A;  5GMK a;  2AX0 A;  1W2I A;  4X4O A;  5A6P A;  3CCU S;  2P6T A;  1JLA B;  2X1B A;  3M8W A;  1S9G A;  4HH1 A;  3MEC B;  5CHC B;  2YBV A;  3HJF A;  3C6U B;  2X7I A;  2ZKT A;  3ZXW A;  4ETZ A;  2UUB J;  1SKU B;  2KRB A;  4J9V A;  2YTC A;  2DHS A;  1NK8 A;  2A6O A;  2FZK B;  1NHK L;  4OYB A;  4A47 A;  2AYE A;  4Y2C A;  2CAD A;  1DHM A;  1B3T A;  4CH7 A;  2CJK A;  2HMI A;  4UF4 A;  3R1L A;  3KDN A;  5FJ4 A;  1UPP A;  2CG4 A;  2EG2 A;  3V5R A;  5AE3 A;  1VIX A;  1I3O B;  3HD1 A;  1W7W A;  3GPA A;  3TR5 A;  2CQP A;  1IKW A;  4Z2X A;  2CJA A;  1S72 S;  1N0V C;  2MJN A;  3M32 A;  1ICE B;  3W63 A;  4MYU A;  1NSP A;  2FDN A;  4XDC A;  3AQP A;  5I4M A;  3PY8 A;  2Z2Z A;  1UZH A;  2Q6B A;  2B9E A;  2ZOG A;  2OPR B;  3PTW A;  2M4M A;  5E33 A;  5A0Y B;  2DRA A;  1CJT B;  2B43 A;  1URN A;  1SKW A;  1CS4 B;  5IC4 B;  2C2D A;  2Y1I A;  1U1M A;  1UVM A;  3QSI A;  1BGX T;  3N6L A;  4F4W A;  1TU0 B;  3IAM 9;  1UW4 A;  4ENO A;  2V68 A;  4LSN A;  5DQG A;  3GLJ A;  1NSQ A;  3M05 A;  1P27 B;  4ZP7 A;  2YQ0 A;  1RAB B;  2FLN A;  4LF4 F;  2BM1 A;  2ZEJ A;  2Q66 A;  3W62 A;  4UOF A;  2FGO A;  2LQ5 A;  4Y65 A;  2UU9 J;  4ECV A;  2OTJ S;  1R8C A;  4DL5 A;  3MMA A;  4EK2 A;  3K7R A;  4DUT A;  1WC6 A;  4DV6 J;  5DQH A;  4K4V A;  1RT2 B;  4FF2 A;  2HHH J;  1PYO B;  2VG5 B;  1VQL S;  5KG4 A;  1RU1 A;  3KOA A;  2K3K A;  4O3P A;  4ETX A;  3ENV A;  4KGX B;  4I6Y A;  1MMN A;  5EHH A;  2V50 A;  1S9F A;  1RGV A;  1Q7Y T;  1XER A;  5DZ7 A;  3BKU A;  3Q86 A;  1M5O C;  4F3M A;  3FC9 A;  5AXL A;  3GYX B;  2P6S A;  2CPD A;  4OFZ A;  1H2T Z;  2YKQ A;  1VBX A;  2IJN A;  4R5P A;  2LFV A;  1S6P A;  3DLJ A;  4UQG A;  3PEJ A;  3BO3 A;  2KH9 A;  1T8E A;  3AOC A;  1VQ8 S;  1WD6 A;  3T9N A;  4WFZ A;  1TKD A;  4L74 A;  1S0V A;  1GXT A;  3C6T A;  4KFB B;  3LAL A;  2PSZ A;  3PW7 A;  3BKT A;  3UD5 A;  2PT0 A;  2GVD B;  2H9Z A;  1TVR B;  2P8I A;  4ED0 A;  2HRT A;  3HHL C;  3VAH A;  3I96 A;  2FD2 A;  2GQQ A;  1H73 A;  4CZC A;  3MPV A;  3BO4 A;  2F8M A;  4UY8 5;  2PFD A;  1IM4 A;  3Q23 A;  3TZY A;  1DTQ A;  1N48 A;  1HWL A;  2HWT A;  4EYH B;  2MQL A;  3M8Y A;  2DPJ A;  4AL6 A;  1F60 B;  4NA1 A;  2F7V A;  1KLM B;  4EUV A;  1FNM A;  1FFW B;  4JUZ A;  3G87 A;  5F8J A;  3DLL Q;  4PUO B;  4LFA J;  1TL4 A;  4JYA J;  3TZZ A;  4DV5 J;  4AL7 A;  3MPY A;  1TV6 A;  5A8W A;  4H54 A;  4H4K A;  5DQI A;  2OO4 A;  3OR2 B;  2AEF A;  3PYF A;  3Q8V A;  3C14 A;  4AXI A;  2J9C A;  4DF4 A;  3A3N B;  4KRW A;  2ZHA A;  3VF0 B;  1U0H B;  3R5J B;  4CO1 A;  2R8I A;  5CYM A;  2J0X A;  2GIR A;  3QJJ A;  1Y5L B;  1FNO A;  4IO9 Q;  2FUG 9;  4V1A k;  4DCP B;  2HNZ B;  2DCU B;  5D8H B;  3H20 A;  3SV4 A;  2FJA B;  1J5E F;  3J80 U;  1N34 J;  2ZDP A;  2HSE B;  5T14 A;  4B3M F;  4YDX A;  3JSM A;  2XYP B;  4X4S A;  2HHS A;  2XSJ A;  5D0R A;  5J1N A;  3N9U C;  4JI1 F;  3CO9 A;  2RQK A;  2YNI B;  2MGZ B;  3BN4 A;  1XR5 A;  2C2N A;  1KRP A;  1QSS A;  1S0M A;  1U4B A;  1K9M T;  2D74 B;  4C8N A;  1SL0 A;  5LXR A;  3MTK A;  4HVZ A;  2YWW A;  2H65 B;  5JUM A;  3OHB A;  3SSS A;  1NK6 A;  1TP7 A;  2IA6 A;  3VVT A;  2HFN A;  3D7S B;  5DDQ C;  2QIF A;  2XHC A;  5G0R A;  2J6S A;  4PRF A;  3ZZ0 A;  1HNZ F;  2HZC A;  4DR6 F;  1ZYQ A;  3TI0 A;  4J7C A;  1XK8 A;  2M9K A;  1Y3K A;  3ZZP A;  2IYI A;  4L75 A;  1XMQ J;  4ZVR B;  4USJ C;  3G9C A;  3M8S A;  1LK5 A;  1RAD B;  3CUL A;  1EQ0 A;  4AQY J;  2X1G A;  4KKO B;  3CF5 Q;  1XNR F;  3H2L A;  3I4P A;  4U95 A;  4ICL A;  2QN6 B;  2V63 A;  2OPP B;  4RWX A;  4ZOS A;  5KFM A;  1KS2 A;  5GAH I;  1O6X A;  4NLV A;  2HK3 A;  2G4B A;  2MB0 B;  1SC3 B;  1FRK A;  1N52 B;  2JOQ A;  4Q8F A;  4CT8 A;  2XMV A;  2Q6C A;  4KGK A;  2R7R A;  1PCA A;  3GV7 B;  4NI2 B;  4IOA Q;  3T5L A;  5A76 A;  1IJE B;  1RLC L;  5DGB A;  3KLE A;  2DRD A;  1R0A A;  5CZV A;  3ISN C;  1IWA A;  2K1R A;  1S0N A;  1HBM B;  1HI0 P;  4DR4 J;  1XWL A;  4DUZ F;  1IN0 A;  1K1S A;  2WB4 A;  4X4N A;  4W98 A;  3QPI A;  1C1C B;  3MM6 A;  3VAM A;  2RNE A;  4C9D A;  1YZ6 A;  4NLO A;  4ED5 A;  2BKN A;  2HAF A;  2AHO B;  4M1K A;  4WK3 A;  1RU2 A;  4Q44 A;  3OSN A;  2BQU A;  3W9I A;  2R8J A;  3J7Y I;  4DBQ A;  4UT4 A;  3IR6 B;  2NZC A;  3WDO A;  3MCM A;  1T9W A;  5ITH A;  4OYW A;  1F2H A;  4FYV B;  3NG8 A;  2MLY A;  3L95 X;  3MR5 A;  2M8H A;  2EKN A;  3RW6 A;  1WKJ A;  3R5A A;  3W5Z A;  1HNV B;  4P2F A;  2MST A;  4LSL B;  3KNG A;  1X9W A;  3LGH A;  4OHW A;  4CLW A;  5KG2 A;  1JXL A;  2AYM A;  3T1A A;  1FKP A;  2B6A B;  1FDB A;  4C98 A;  3AFG A;  3FZ2 A;  2W9C A;  3KFW X;  4GKK J;  4JB8 B;  3FMW A;  1DAX A;  1EZZ B;  4HEA 9;  3R6L B;  1LKZ A;  3NGD A;  2OEL A;  3CC7 S;  1WKL A;  3VV2 B;  3CCM S;  4N77 A;  1JXV A;  4CLK A;  1KN6 A;  3DU6 A;  2P9G A;  3GIL A;  1GMW A;  2GGP A;  4EWT A;  1RAC B;  4FVC A;  1FDD A;  1M1G A;  1S7I A;  1F3F A;  3FVY A;  2KZM A;  3KHH A;  5IS2 A;  4NYO A;  2BJ8 A;  1Q16 B;  2Z30 B;  1DY3 A;  2HLU A;  2FJW A;  2AJ4 A;  4I68 A;  3RYL A;  2DJW A;  4DR7 J;  4CLY A;  2VHG A;  2E1A A;  3UVJ B;  4ZCK A;  2DGO A;  3TUZ C;  4DR2 J;  4LF5 J;  1R7I A;  3PXG a;  2N82 B;  1U6F A;  3EM1 A;  3I31 A;  3Q8S B;  4M5N A;  4ZHR B;  4DFM A;  3QAE A;  1U0S A;  2HHU A;  4IQM A;  4WFY A;  2EPI A;  2HWH A;  4OZ5 A;  2YWK A;  2DR5 A;  3DDK A;  2LXF A;  1OY8 A;  2R9L A;  2GMH A;  2FHJ D;  4DI6 A;  3BSN A;  5HMW A;  4ZVQ B;  2YWF A;  1H2V Z;  5J2P A;  2CDQ A;  2HBZ B;  4MIB A;  4USH A;  1F3V A;  4OYM A;  1YLX A;  2DHX A;  2QFJ A;  4IRC A;  2NS1 B;  1KHW A;  4QIV A;  4X4V A;  5L1J A;  3DN9 A;  4CO3 A;  4P52 A;  1BLU A;  1J27 A;  5LJ3 Y;  1Q78 A;  3IGV A;  1SQG A;  3FZB A;  4GC7 A;  4F7V A;  1YDL A;  4C11 B;  3L3C A;  4LRA A;  2FHM A;  5E3P A;  1CPZ A;  3M4X A;  1D9A A;  1EAR A;  2W7O A;  2RJZ A;  2R7Q A;  4DCJ B;  2JEJ A;  2ZBP A;  2EXU A;  4DV4 J;  3GIK A;  4OX9 J;  1IKX B;  2OD6 A;  1N56 A;  5ETT A;  2OLW A;  3M2R B;  4N56 A;  2DXF A;  3G82 A;  5ETS A;  3FRZ A;  4I2P B;  2IMO A;  3MFI A;  4GKJ J;  3HX9 A;  4YB6 A;  1FXL A;  1NU4 A;  2OPQ A;  1TKT B;  3HKW A;  5E5N A;  2AGP A;  2NUU G;  2OFG X;  2C42 A;  4F0H A;  3EPG A;  2YNH A;  1CJV B;  2AW0 A;  2ROE A;  3L9Z A;  1RA6 A;  2EFP A;  4KV8 A;  1OYD A;  3V4I B;  2HFZ A;  2PEH A;  2KG1 A;  4CP5 A;  2PE8 A;  1C1B B;  3CCL S;  3R3T A;  5KFT A;  1QE1 A;  3OXL A;  2HRY A;  1EJ7 L;  4F4A A;  3MD1 A;  5HRO A;  5H1S V;  3ET6 B;  2NXJ A;  2VV5 A;  3M6W A;  1KSP A;  3G8T A;  5KOX A;  2ZZM A;  5A8K B;  2BQR A;  4AE5 A;  4K0K F;  1WHV A;  4N47 A;  1CC8 A;  3MM9 B;  1VQO S;  5D3G B;  2F9D A;  4LF9 F;  2BOA A;  2NCK L;  1Q8B A;  1ELO A;  4WYW A;  3PHE A;  4E98 A;  1KTV A;  4PYD A;  1P1T A;  2VQF F;  5B0G A;  2UUW A;  2UZA A;  2PA8 D;  4E0D A;  3W64 A;  3W8P A;  1F6T A;  4YY3 F;  2OIH A;  2F65 A;  4X65 F;  1C4C A;  3NRB A;  3HZE A;  2DK2 A;  3VHQ A;  4X64 J;  2JX2 A;  1X60 A;  2K06 A;  1F5C A;  4RUH A;  3DNC A;  4LR7 A;  3R5G A;  4O0N A;  3OTO J;  1YRT A;  1RXO B;  4UY8 T;  3R5C A;  2R42 A;  5H9F J;  1VS3 A;  2CPH A;  1RT4 A;  4CT9 A;  2WK4 A;  1YJ9 S;  2GA7 A;  2IY5 B;  2DYA A;  1NDP A;  3NXZ A;  2CFX A;  3ELH A;  1S4F A;  1LWX A;  4X4R A;  5L46 A;  4F36 A;  2RRN A;  3DLG B;  4HDG A;  2BJ9 A;  4OLO A;  1TKX B;  2GQ2 A;  1W25 A;  4UQT A;  1SC4 B;  3CDW A;  5DJB A;  3G6Y A;  2JLF A;  1SJR A;  2ALY B;  1QM9 A;  3CCS S;  5DM6 Q;  2HZV A;  2R8K A;  1JLB A;  3GSD A;  3GIR A;  5KFK A;  2Z8Q A;  3OR1 A;  2B9W A;  4DR3 J;  2V8H A;  1HNX J;  3OT9 A;  1EP4 B;  5K8M A;  4E2F B;  4R8U B;  2DEJ A;  3C19 A;  3PR5 B;  4J90 A;  5IQQ A;  1DAR A;  2MMY A;  2BRL A;  3O6Q A;  3H25 A;  5C24 A;  4IFV A;  2XB2 D;  1EIY B;  2AGQ A;  2HHX A;  2PMZ D;  4QBU A;  5EWG A;  3QYY A;  4U7C A;  2POK A;  1KVK A;  2YKM B;  2DVI A;  1RAA B;  1XMO F;  1CJU A;  1TAQ A;  5MLC V;  3TAR A;  4QWD A;  2B4P A;  3E8O A;  1RYR A;  5KFY A;  2XBP A;  3OTE A;  1NXI A;  3NS7 B;  3VAL A;  3LPY A;  1XTZ A;  3V4M A;  5RUB A;  2DNZ A;  1JLE B;  3M8Q A;  4ZPD A;  3DRY A;  4JV5 J;  1NKC A;  1HNW J;  4QPT A;  3FMB A;  5ETQ A;  4OJ3 A;  1SKS A;  5KFJ A;  1R8P A;  3HHN B;  4O4G B;  4MKA A;  3H40 A;  4C8Z A;  3QT7 A;  4KIA A;  2GC8 A;  3HK2 A;  5EUH A;  5M2R A;  2G13 A;  4RNF A;  4C8K A;  3H5S A;  1RK8 A;  1S4E A;  3CDA A;  1R3N A;  5D4N A;  3DI6 B;  3MAH A;  1L3K A;  2KT5 A;  3OJU A;  3KK3 B;  3VTI A;  1ZZN A;  5J2Q B;  2BUN A;  3JYT A;  3H4B A;  3W65 A;  4FF3 A;  5HK4 A;  4NXN J;  4JI8 J;  3ZFV A;  3RB4 A;  1LWF B;  4B3O B;  3V6K A;  4RW9 A;  2Z0G A;  1KEK A;  2AU0 A;  3Q8P B;  4NAS A;  5D0E A;  3S1T A;  1S1V A;  1TUW A;  3B8H A;  3OQ2 A;  3FSY A;  2FGC A;  3G4S S;  1REV B;  2F8E X;  4DF8 A;  5K9F A;  1S1W A;  2LXI A;  2LDY A;  1PJ5 A;  4H4O A;  4KR0 B;  2KM8 B;  2IBK A;  3HFK A;  3K2Y A;  2KVQ E;  2HK2 A;  1CUL A;  5HLF A;  1J2V A;  3FCW A;  3KYL A;  2E9Z A;  2AYG A;  1T7P A;  3QRQ A;  4QWE A;  1PAU B;  1S6Q B;  3BBB A;  4DR1 J;  4TU7 A;  3PG9 A;  2V6A A;  1EAY C;  5LSL A;  1SC6 A;  1NPR A;  1IR1 A;  3J81 j;  3K8V A;  2XS7 A;  3BH7 B;  2XG8 A;  4XAK A;  4DFK A;  2M70 A;  2YWG A;  3AB2 B;  3D54 A;  1H0H B;  1YWX A;  2K8G A;  2MLZ A;  1RWX B;  1S7H A;  2OPS B;  3HHL A;  1NZA A;  2HHQ A;  2RF2 B;  1VYA A;  4I56 A;  1HPZ B;  3MOJ B;  4JV1 A;  2DGX A;  1Q5Y A;  2KTQ A;  1VQ7 S;  2EW9 A;  2VOD A;  1OSC A;  1SH2 A;  1ZM2 A;  3GJS B;  3OLB A;  3N01 A;  1H7X A;  1VGY A;  2IDL A;  4NRT A;  1P9Y A;  4MFB B;  4CTA B;  4B9L A;  4PZV A;  3UN3 A;  3KLF A;  4USI A;  1UET A;  2HZA A;  4F3Q A;  3QIP A;  1LXJ A;  2DRB A;  5GAE U;  3E3X A;  1NHU A;  3IM9 A;  1HMV A;  5CCL A;  1TL1 A;  3US5 A;  1N36 F;  1IBK J;  2WAQ D;  4X62 J;  4ZLN A;  1QY7 A;  3OTD A;  1FRM A;  2CZV C;  2XMJ A;  4DL7 A;  1YSJ A;  4ZCL A;  2ZVS A;  4KQZ A;  3A8K A;  2YKP A;  2D69 A;  4J9U E;  2IAJ B;  2HW3 A;  4TN2 A;  1V9O A;  1R8A A;  2BJE A;  4NML A;  4MJK A;  3OL8 A;  4YHH F;  1J5O A;  1UFW A;  1AXQ A;  1RKI A;  2V8D A;  4KHP F;  2BR0 A;  3BR9 A;  1ZPV A;  2WVB A;  3GG1 A;  2NSB A;  4LJM A;  2MKJ A;  3G6V A;  3D66 A;  3Q89 A;  3J81 Y;  2AQ4 A;  1H72 C;  2HNY A;  1JJ4 A;  4LFB F;  3HXM A;  3BPS P;  2OHD A;  2CPE A;  2JVO A;  4HHH A;  1U8W A;  1VQM S;  3NLC A;  3DLK A;  2N3L A;  4PWW A;  2J6U A;  1LW2 A;  5C42 A;  3D1H A;  2E9T A;  1AZS A;  2JEF A;  3NGT A;  2W1B A;  5IM0 A;  2FYX A;  2DHA A;  5C25 A;  4EI2 A;  5KFS A;  2GJ2 A;  2G2Z A;  4ZIW A;  3CIM A;  3EGZ A;  2OFH X;  3H5Y A;  3AJ2 A;  2CQ1 A;  4FXV A;  4F0M A;  3V6J A;  2RQC A;  1CG2 A;  3HP6 A;  2GS8 A;  2ZJP Q;  4ZN1 A;  4ZP8 A;  2WHO A;  3K58 A;  1VQ6 S;  1HW9 A;  4PG6 A;  4IDK B;  1MRO A;  4KH0 B;  3CJ5 A;  5D4P A;  2HHV A;  3UR0 A;  3W66 A;  3SYZ A;  2GO9 A;  2OML A;  4LR8 A;  2FLL A;  2L08 A;  2FZC B;  3IGN A;  2QFI A;  2X3D A;  3FK4 A;  4A8W A;  1H2U X;  2JL9 A;  1S1U A;  3WX4 A;  1HLW A;  3T1H J;  4Q43 A;  2RKI B;  3N79 A;  1RCO B;  1RWU A;  1WWH A;  5K8O A;  1T9Y A;  2WSC C;  4CYU A;  4YB7 A;  2HBQ B;  2W9B A;  5CZX A;  4DV3 J;  4QYZ J;  2ZUG A;  2ZBQ A;  2QGF B;  2Z58 B;  1RWK B;  3DRP A;  3J7Z 5;  4TNO A;  1M5S A;  2UXB J;  2ZD1 A;  2CYY A;  4WK1 A;  5CYQ B;  1X5P A;  4KB7 A;  4WU2 A;  2XC9 A;  1UEK A;  1XEZ A;  1HWU A;  1N33 F;  2PI4 A;  2CJB A;  1WHX A;  4YR3 A;  4L72 B;  3NS6 A;  3D0H E;  4X66 J;  5KFD A;  3IMQ J;  4F25 A;  2DY9 A;  1AFJ A;  4MKV A;  1LW0 B;  3MED B;  1Q4R A;  1OIA A;  2JEG A;  3VQS A;  2QSW A;  4DSL A;  1RT7 A;  2LDI A;  5HJY A;  4IG0 A;  2E29 A;  1YRU A;  4DS5 A;  2QX0 A;  1SPB P;  2LVW A;  4G1I A;  4QR0 A;  3I0R B;  3OJS A;  2V9K A;  4DL6 A;  4ECY A;  2KZZ A;  1S57 A;  4RZR A;  3QGI A;  4M5D A;  3TUP A;  4JBC A;  4CLS A;  1LNQ A;  3MCN A;  4KY3 A;  4HAC A;  5IV3 A;  2DNP A;  2FVQ A;  2C1E B;  2EK1 A;  2KFY A;  4V19 J;  3CC2 S;  2K7K A;  1HNI A;  3VAJ A;  2E7V A;  4G1P A;  3UD3 P;  4I67 A;  5H9F K;  2H51 B;  2NYI A;  3CJK B;  4O44 A;  4NXM F;  4U6P A;  3M2U B;  3RBZ A;  4ZS6 A;  2G1D A;  2R7V A;  2YNG B;  3IFE A;  3RJM B;  2DO0 A;  3WIU A;  3R7N B;  3N4W A;  4BWM A;  3X1L B;  3FBB A;  2F9J A;  4JI4 F;  3ZTO A;  4OZ3 A;  1SXL A;  5KFQ A;  4E8U A;  4PYA A;  4I0W A;  1UJ4 A;  1YRX A;  3BSA A;  1FTR A;  3MF5 A;  1BQM A;  2A0F B;  4QZV B;  3ZTS A;  1H7W A;  3ZZU A;  4A8Y A;  1LXN A;  5EX3 A;  1YZ7 A;  2A6M A;  3L7P A;  3W7B A;  1GFW B;  4OV1 A;  4KHR A;  1B4S A;  1HBO B;  3AJD A;  3QRP A;  4ELU A;  4DHV A;  2GVZ B;  2CNK B;  1Q95 G;  4OL8 A;  3EIC A;  3FSI A;  4DSK A;  4EO8 A;  4JV2 A;  2R7O A;  3PX0 A;  3R7B B;  1U24 A;  4HL9 A;  3P96 A;  4WII A;  3UCU P;  4OYI A;  4ZJL A;  5FDL A;  2BW2 A;  2DR7 A;  4NLD A;  7AT1 B;  2G0I A;  2QV6 A;  3SCL E;  3PW5 A;  3Q8U A;  3M32 B;  3M9O B;  1QLN A;  1S6U A;  1KVJ A;  4LRB A;  3WIV A;  1KBR A;  4K4S A;  2MKC A;  4LRE A;  4OZL A;  2V5H G;  1N5V A;  2YNF A;  3KLG A;  2PMW A;  1NO8 A;  1G7C B;  2RIL A;  2G1H A;  3KK1 A;  2CQ2 A;  2JJ4 D;  4B9S A;  1HFE L;  2KI2 A;  4GO5 X;  1KLN A;  2W25 A;  3HFV A;  1UTA A;  3IN5 A;  1CVJ A;  3DDN A;  3FFI A;  4HI2 A;  1FKO A;  1RE1 B;  3IWN C;  4DUY F;  1XR7 A;  4HTJ A;  1OY9 A;  2W2M P;  4HHU A;  4JI6 J;  5HQM A;  1Z4U A;  2HS0 A;  1HD0 A;  3MXH P;  2GHP A;  1YBU A;  2IDE A;  3D6H B;  4ATN A;  4LBH A;  4LSN B;  3BGR B;  2RHQ B;  4TY8 B;  2VQE J;  4BWJ A;  5E3A A;  4YP3 A;  1MW7 A;  3D0G E;  2RUG A;  2I9S A;  2HQD A;  3UW1 A;  3R1H A;  5I3Q A;  3CJ3 A;  4IRD A;  2LU1 A;  4BC7 A;  2DXE A;  1JB0 C;  2NXC A;  4LFC F;  2GHW A;  3EDR B;  2CPF A;  2XWX A;  3MMA B;  2XMT A;  3CGI A;  1GXU A;  4FYY B;  4I2Q B;  4ZVT B;  3DM2 B;  2OEJ A;  1SKR A;  5G4D A;  3DGP A;  4DEZ A;  3HT0 A;  4ER8 A;  2B7B B;  4F67 A;  1R43 A;  3BF4 A;  5EWF A;  2I6W A;  5A2Q Y;  3EVM A;  3N5B A;  1X0P A;  1WEY A;  2VJV A;  3O2I A;  2WOM A;  4NCG A;  1WI8 A;  4K4X A;  4CDI A;  5T7L B;  4OZN A;  3H98 A;  3QZ7 A;  4C0O C;  2JFK A;  1CLF A;  5D15 A;  3W61 A;  3D2W A;  1VHF A;  2IFX A;  2W2O P;  1VRU B;  1VCT A;  5KFW A;  1OYE A;  4KO0 A;  2BMB A;  5KG3 A;  4K4W A;  1X5T A;  3MM7 A;  4NA2 A;  3SDE A;  3NNA A;  4CO0 A;  1R6V A;  2V4J A;  3K59 A;  3HD2 A;  2ZWP A;  1KNZ A;  1X5S A;  3KK2 A;  4JI7 F;  5KFE A;  1OY6 A;  3C6T B;  2YX7 A;  4X4Q A;  3RBE A;  3W5Y A;  4O3Q A;  1WSR A;  4RW8 B;  1IWG A;  2VAS A;  3KMS A;  3C66 A;  5GVQ A;  1NCL A;  1NBE B;  3T41 A;  2J0W A;  5HMZ A;  3MMB A;  5B0D A;  1SC1 B;  2QJ3 A;  2N7Y A;  1APS A;  4X4T A;  4PWU A;  1B99 A;  3CCT A;  2YWE A;  2ZJQ Q;  5ETL A;  3FEX B;  3BZQ A;  1UVK A;  1LFW A;  1FNX H;  1BQN A;  2LLZ A;  2HVI A;  2MQQ A;  1H6K X;  3W3S A;  2BEF A;  1ZH5 A;  2MKI A;  1FX2 A;  1VQN S;  3MI7 X;  4IOB A;  3M8P B;  3ZO7 A;  2R7S A;  1PJ6 A;  3D3B J;  1VLO A;  3OL9 A;  3SI8 A;  4TLQ A;  3G6X A;  3W9H A;  2ASD A;  1HYS B;  4KGZ B;  4RKU C;  5GAE I;  2W2P P;  3PRB A;  7FD1 A;  3P6Y C;  3SV3 A;  4LQ3 A;  2AKW B;  1FD8 A;  3H90 A;  1U45 A;  5KTQ A;  2C3M A;  4F8R A;  8ATC B;  5I42 B;  1C4A A;  4MKB A;  3GJR B;  4QJV A;  3P49 B;  1GH8 A;  2PA3 A;  2DY1 A;  2KJV A;  2IM3 A;  1B0P A;  4RW7 B;  4TYB A;  4AFF A;  4URG A;  4DV2 F;  1RTJ B;  3IM8 A;  3JSM B;  1SL1 A;  2NXU A;  4TLR A;  3PKY A;  4EBD A;  3ZZZ A;  2NXE A;  2RH3 A;  3X3U A;  1J5E J;  2B7C B;  5AT1 B;  4B3M J;  1YKW A;  2DD8 S;  3VGS A;  4ZPA A;  1TFY A;  4PWD A;  1N0U A;  2O5D A;  4RLE A;  3JQM A;  4JI1 J;  3P5B P;  1EKR A;  5F41 A;  4GMK A;  1RAF B;  2DNQ A;  4HT5 A;  1NDK A;  2BOP A;  3JTP A;  1RYS A;  2RS8 A;  3S01 A;  1FFG B;  4CLL A;  1VFJ A;  2WBR A;  2FTR A;  5F9L A;  3QJP A;  1RSC A;  3BO2 A;  5EGY A;  1T3O A;  4I6W A;  3ITH B;  2GCF A;  1E6Y B;  4RU2 A;  2UXC F;  2BAN A;  2JFD A;  4P7V A;  1YJR A;  3LAM A;  4H4K C;  2V0N A;  4FPI A;  1YTY A;  1RHM B;  2D3U A;  4QYZ K;  4MK7 A;  5AJ3 J;  1UVL A;  3QJL A;  2Y8Y A;  1UWB A;  1T9X A;  1XNR J;  1R31 A;  3CXC R;  3FBE A;  2XO6 A;  3NCR A;  2GX8 A;  2ASJ A;  3MAQ A;  3SFU A;  3UQS A;  2BW7 A;  1VC6 A;  3MR7 A;  1TFW A;  2ATC B;  4P2X A;  1BY9 A;  3MM5 A;  2Y9H A;  4IQX A;  1MG7 A;  2Q79 A;  2K1R B;  3PM9 A;  4ZVH A;  3VGU A;  1N6Q A;  2Q3P A;  4ITS A;  1U09 A;  2M52 A;  4URQ U;  1U1R A;  4O4R A;  4PKD B;  2D9O A;  3QAU A;  4CH1 A;  4RW4 B;  4DL3 A;  2JH3 A;  3MM6 B;  4DPU A;  2EKY A;  4ZVG A;  4Y34 A;  4DUZ J;  3L7U A;  1JLA A;  1WTF A;  3MEC A;  1S10 A;  3TWZ A;  2BE2 B;  2L41 A;  4NYP A;  2NR0 A;  2ZWO A;  1O51 A;  1ZA2 B;  1TEL A;  3C6U A;  1U1K A;  1GMW D;  1RI7 A;  1FWL A;  3U02 A;  1Y4Z B;  2IVM A;  2HIQ A;  4XPC A;  1PYS B;  2DHG A;  1V3R A;  1WC0 A;  3NBP B;  4C7Q A;  3CW2 C;  5KFU A;  4H4M A;  4LVN P;  1OPZ A;  2R2T A;  2VUG A;  4G3I A;  1Z1Z A;  3W2W A;  4BCA A;  4ZN3 A;  1SQE A;  2Y1R I;  5D4O A;  4K7Q A;  2XMU A;  2K7J A;  4OZJ A;  4WKY A;  3MWB A;  1S77 D;  1XQI A;  4K4Y A;  3GP9 A;  1ZZF A;  2IHR 1;  2W7A A;  1FKP B;  4M95 A;  3I0S A;  4NLY A;  2IC3 A;  1NUE A;  4DQP A;  4Y28 C;  3TX0 A;  1LQ9 A;  4DQR A;  2ZM6 J;  2ZH6 A;  2DNN A;  1JWW A;  1FCA A;  1VC0 A;  2EFQ A;  3F0N A;  2IA0 A;  4IYQ A;  4CWB A;  2HVZ A;  4CIO A;  4ECU A;  1QSL A;  4ZPV R;  2VFV A;  2V34 A;  4DV0 J;  2RVJ A;  3EPI A;  1CJT A;  3MAA B;  2GGP B;  3SZ2 A;  4RBV A;  3TX8 A;  1CS4 A;  2OUG A;  4TY9 A;  3MEK A;  3EJM A;  3NMR A;  2VH7 A;  2DGV A;  2I38 A;  1FES A;  2PDA A;  4L3K A;  4N76 A;  2VPY B;  2W01 A;  4F02 A;  2YY3 A;  3TAN A;  1M5K C;  3CCQ S;  4Q0B B;  2WZ1 A;  3CSK A;  2R4F A;  3ILJ A;  1A9N B;  1XBW A;  1VK3 A;  3JSY A;  4CRJ A;  1WDT A;  3A8I A;  1RLD A;  3CIZ A;  1G1X A;  1N32 F;  4C3L A;  4W4M A;  5DDO C;  3LPE A;  3CED A;  1TTH B;  1S59 A;  2HHH F;  3GIJ A;  5F8H A;  1N4L A;  2CAJ A;  2BDP A;  2QMW A;  5HSP A;  3ZNJ 1;  2W8L A;  3EGW B;  4R0J A;  1WJ9 A;  4DN0 A;  1RT2 A;  1AW0 A;  1UVI A;  1YJ7 A;  3DRR B;  3LP1 B;  5KFI A;  3MGJ A;  3CJS A;  2ALZ A;  3TP2 A;  1OSD A;  1BE4 A;  3L09 A;  1T9V A;  4L76 A;  1YBA A;  4Q45 A;  2VKR A;  2LYV A;  1U26 A;  2EC2 A;  3TVY A;  2ZH2 A;  4O3N A;  2DNK A;  3PW2 A;  2OJ3 A;  2ACY A;  3PCO B;  2FHK A;  3TRG A;  3SQO P;  4WYL A;  1NLK L;  2HAI A;  3W2V A;  2EWH A;  3BSC A;  2F40 A;  1WOR A;  1CJK A;  3MMC A;  2PO4 A;  3IWX A;  2CWK A;  1QVG R;  1BHN A;  4NLX A;  2B56 A;  2CNL B;  2VFU A;  3M7V A;  2A3J A;  4JI3 F;  5LJ5 Y;  3G82 B;  5B7W A;  2C2R A;  5JMN A;  5IT4 A;  1RTI B;  2WW4 A;  2IM2 A;  1HBU B;  1R89 A;  2I5J B;  4WTY A;  3U7J A;  4FF4 A;  1TR0 A;  1S1T A;  1SL2 A;  3GV5 B;  1U47 A;  2GAG C;  2NPF A;  2OMO A;  4ILL A;  1PG5 B;  2GVD A;  1Y5I B;  2QYG A;  3F73 A;  2B4O A;  1WC4 A;  2DNO A;  3MR2 A;  2YNH B;  3EVW A;  2QE5 A;  4ZLJ A;  1YI2 S;  4WE1 B;  3VR1 A;  2MXY A;  4IH5 A;  1QE1 B;  2VF3 A;  4AD6 A;  3CPW R;  2ZH8 A;  3HMJ G;  4N8N A;  2QA2 A;  2FQQ B;  3ZZY A;  3DHX A;  1U1O A;  3R97 A;  5KT2 A;  4LFA F;  3OFF A;  1KLM A;  4JYA F;  4O3S A;  4NZ6 A;  2J7U A;  1RB0 A;  4J9S A;  2BRK A;  4DV5 F;  5BYQ A;  3D6M B;  5F3Z A;  5HMX A;  4J9L A;  4ES1 A;  3KLH B;  3V6D B;  2WB1 D;  1RTH B;  1JIH A;  1X4E A;  4LBP A;  4B9U A;  3I4H X;  2XY6 A;  2N4D A;  5GAH U;  3FBF A;  3BGO P;  3TOQ A;  4NLW A;  2ZH5 A;  1HI8 A;  2VDH A;  2AP6 A;  3MEG A;  1NKB A;  3UI3 A;  2JC0 A;  2XY7 A;  2MQP A;  4DL0 C;  2MHN A;  1BQX A;  2DHH A;  1RT5 B;  3GFX A;  1QDU B;  3K5N A;  1RAG B;  1XC9 A;  4YY3 J;  1M5V C;  1N54 B;  1QAJ A;  5ETK A;  3T9Z A;  4P10 A;  2WRM A;  4MMO A;  5B0E A;  2MQO A;  1O5J A;  1RT4 B;  1S5Z A;  2R7U A;  2HIY A;  3RB0 A;  3R5B A;  4GVB B;  2FHO B;  5LMU J;  3GCW P;  4B9M A;  3VWS A;  3VAK A;  1V3Z A;  4OYA A;  4KSE B;  4XDD A;  2HVH A;  2IVY A;  1X8D A;  2HFV A;  2FC8 A;  4WJB A;  1Y10 A;  3AHP A;  3BDP A;  4FPR A;  3T6J A;  1RTD A;  1MWZ A;  4FNI A;  3D6T B;  4YOE A;  1IBM J;  2QA4 G;  5C2C A;  1I94 J;  1XMQ F;  2FVP A;  3QQC D;  1VQS A;  2HVD A;  3S7R A;  4QQB A;  2ZHB A;  2PN6 A;  1RAE B;  4AQY F;  5L9N A;  1KQG B;  2UXD F;  4DPT A;  1RT1 B;  3E2E A;  2ZC3 A;  4Y2I A;  2FPH X;  3PO5 A;  3IS9 B;  2QZ8 A;  2HQG A;  4O3O A;  2FC9 A;  2CXE A;  5C24 B;  3K5L A;  3KLI B;  1SVD A;  1PBA A;  3EZU A;  4KKO A;  2QRR A;  4IFV B;  3J7A N;  3A12 A;  4P71 A;  2GZO A;  2CNN B;  1L3T A;  1GMU A;  4DSI A;  1K44 A;  2KU7 A;  1G3O A;  3IP0 A;  3IG1 B;  3PRV A;  4ZPC A;  3TZX A;  4CNY A;  4M94 A;  3BYP A;  4LT6 A;  3WQP A;  1RBL A;  3B4D A;  4BDP A;  3UDL A;  3QBC A;  3BRE A;  4DR4 F;  3HSZ A;  1AT1 B;  2LEC A;  3BYR A;  2UV8 A;  2VBX A;  4A4J A;  1HBM A;  2FJB B;  4Z7C A;  4C48 A;  3UR3 C;  5AXN A;  3M8Z A;  3RU0 A;  1C1C A;  3NY0 A;  1TL7 A;  4PXE A;  1EHW A;  3IBW A;  3B82 A;  3FEZ A;  2ASL A;  4PG8 A;  3MUR P;  3KJQ B;  1FRI A;  4F4K A;  3CC4 S;  2LQ8 A;  4G65 A;  4RBU A;  1X0F A;  2CQ3 A;  2OTL S;  3IAS 9;  2UP1 A;  1NJY A;  3JYT B;  1A7G E;  2MLX A;  4LF8 J;  3OVB A;  4F04 B;  3KLV A;  4P7T A;  2M0G B;  5KG7 A;  3MCO A;  4LRD A;  3R9L A;  4RW9 B;  4M8L A;  4CLT A;  1T05 A;  1YK9 A;  4P72 A;  1S1V B;  1FT8 A;  2BAC A;  3HHL D;  1ZET A;  1HNV A;  1VQ5 S;  3NKY A;  4QIW D;  1FJG F;  4DX5 A;  2Y1L B;  4GKK F;  1B0T A;  1IBC B;  1V5V A;  1X4F A;  4U96 A;  2B9X A;  2B6A A;  2QTW A;  2IIH A;  2VPZ B;  5KT4 A;  1ITP A;  3RAM A;  1GX6 A;  5M2U A;  1TK0 A;  5HLF B;  3I32 A;  3G8S A;  3QLH A;  2HFO A;  2VZ9 A;  1JLF A;  3NGR A;  2XM3 A;  3MHY A;  1YIJ S;  4WWS A;  4N8O A;  1SJ3 P;  3DDI A;  2RML A;  1NK4 A;  4DR7 F;  2V9W A;  2QO3 A;  3H5U A;  4O0I A;  1B0V A;  3MOZ A;  1SJ1 A;  5EN1 A;  4NLT A;  2VJU A;  5J2N A;  3SBM A;  3UO0 A;  1GQE A;  3HHL B;  1EET A;  3IR5 B;  3D28 A;  1UFK A;  4OZ2 A;  3BSO A;  1W2B R;  4C3M A;  4LF7 F;  4TU9 A;  4EFA C;  3UVJ A;  5IFM A;  3TAM A;  4OYO A;  3MR3 A;  2BQ3 A;  3UWT A;  2W2Q P;  4OYX A;  3KLF B;  1WC1 A;  5KFN A;  3QIP B;  4ZHR A;  3DLB A;  1HMV B;  4LF6 F;  1TL1 B;  3TQ1 A;  3RBX A;  2CUY A;  5D0G A;  5D6G A;  3M6U A;  2AV5 A;  3NCP A;  1B70 B;  1XNQ J;  1WC5 A;  3A4T A;  4FF1 A;  1WNE A;  4FBT A;  1ZPW X;  1IXK A;  2VU5 A;  1X4A A;  2C28 A;  3RRH A;  4Q8E A;  4DLG A;  1RT6 B;  4I69 A;  3LAN A;  3RTV A;  1DFD A;  3W8G A;  1T11 A;  1N5Q A;  2N3O A;  2HVE A;  2H54 B;  3ILI A;  2NYH A;  3AA9 A;  2MEW A;  1REG X;  4YHH J;  4DV4 F;  3H0P A;  2E5H A;  3OD2 A;  2ZBR A;  4OX9 F;  4C11 A;  1N5T A;  4FS2 A;  2FVS A;  4KHP J;  4CLZ A;  3V81 A;  3O44 A;  5K8P A;  4N41 A;  3KJF B;  4LFB J;  1IKX A;  3KG4 A;  2RQM A;  5C2G A;  3M2R A;  4I2P A;  3SEO A;  4C2M A;  2KYX A;  2ATL A;  1FK9 B;  5DLF A;  2WSF C;  1H74 A;  1PC4 A;  4MK9 A;  2JRS A;  4U8Y A;  2F8H A;  3O8W A;  3HKZ D;  3SIP B;  3BM7 A;  2XMK A;  2X51 A;  3ILL A;  3M1V A;  1JX4 A;  1SBR A;  2YPY A;  4DU7 A;  1CJV A;  1KOH A;  1S1X A;  3ISN D;  4U7U K;  4LIR A;  4P2S A;  5F8G A;  1M5H A;  4ECX A;  3PIO Q;  1I5O B;  1NME B;  3ET6 A;  2MKY A;  2YH0 A;  1MMD A;  3AXK A;  5HI7 A;  2MQN A;  4G1Q A;  3OLA A;  8RUC A;  4B08 A;  4C8Y A;  3LTO A;  5IWA F;  1LV5 A;  2R2U A;  2ZJR Q;  3J81 U;  3VCD A;  1KKH A;  4JOU A;  1S6O A;  2LQJ A;  3ZNU A;  2AZ1 A;  4WZM A;  1VLY A;  4CO5 A;  5DM7 Q;  4CYU B;  4TYA A;  1X7V A;  1LEO A;  4PQU B;  2FJE B;  4RJV A;  1WEL A;  3FNN A;  4DG1 A;  1Y9O A;  3TQE A;  4P75 A;  3N0V A;  3FRY A;  1ZM4 A;  2A2C A;  3UPF A;  2M8D B;  5I3U B;  5AXM A;  5JVH Q;  2BE9 B;  1AUS L;  4K50 A;  1AB8 A;  1JKH B;  3HPO A;  3JQK A;  1C0T B;  3FGV A;  4QWB A;  3M9M B;  3TA2 A;  4UW2 A;  1U49 A;  1HIY A;  4EO6 A;  4NLG A;  2KRR A;  1X4C A;  2OEK A;  2ADB A;  2E7X A;  2VL1 A;  4K59 A;  2VIH A;  2QEX S;  4HT7 A;  2BXJ A;  2XWY A;  3DLG A;  2WVC A;  2DH8 A;  4DN9 A;  1IVZ A;  4IG0 B;  3OPK A;  4K5R A;  4LVO P;  4NLS A;  4DR3 F;  3SXL A;  3UDV A;  3LA0 A;  2V8V A;  1VQY A;  1HNX F;  1F9H A;  4CQ1 A;  3NMA A;  4F26 A;  2QA4 S;  1LWE A;  2ZIT A;  3OHA A;  3G86 A;  1HI1 A;  1EP4 A;  2Q1L A;  3LGM A;  2HFU A;  1GNK A;  4J9M A;  2AF6 A;  2R2R A;  3NGS A;  5L38 A;  1TL5 A;  4K4Z A;  2CWX A;  3OUY A;  1KC8 T;  4WF9 Q;  5DET A;  1K73 T;  4NRU A;  4D3G A;  5DDR C;  1UPM B;  4RUA A;  2YKM A;  2YH1 A;  2FVR A;  1U25 A;  1R27 B;  3FSX A;  2DNM A;  1Q82 T;  1HNW F;  5B0F A;  4PR6 A;  2E1P A;  1FVQ A;  2MZR A;  1JLE A;  1WKK A;  1S97 A;  4NXM J;  2P9C A;  2XLK A;  3SSQ A;  2O01 C;  3CCJ S;  2ZZT A;  1H3D A;  4B02 A;  4DPX A;  4N7T A;  3T1Y F;  1KR4 A;  4ILM A;  1WHY A;  4ECQ A;  5B0B A;  2YVS A;  3AD8 C;  3BJY A;  4JI0 F;  2E44 A;  1G2E A;  3MM8 A;  2LMI A;  2EFN A;  1IM6 A;  1FFS B;  1KQS R;  2VC1 A;  1WG1 A;  3JTO A;  3DRS A;  1PSD A;  4A8X A;  1WF0 A;  2WSE C;  2ZOF A;  5K14 B;  1F5A A;  1R0C B;  4ID8 A;  2HHP A;  3CD5 A;  4CNZ A;  4I4B A;  3KK3 A;  5J2Q A;  3QSY B;  3C16 B;  4NCA A;  2Z56 B;  1XR6 A;  4USK A;  4ZJQ A;  3UN2 A;  2DNL A;  2UVR A;  1LWF A;  2Y3Y A;  2KG0 A;  1PO6 A;  1QAI A;  3JTN A;  2OAU A;  3CJ8 A;  1HHT P;  2O1P A;  5D4L A;  1RHR B;  5HMY A;  2CZ4 A;  1U7L A;  4A8S A;  2AJF E;  1HHS A;  4OHX A;  2ZH3 A;  2CQG A;  1E6V A;  1REV A;  2LQB A;  1VBK A;  3CNQ P;  3ENA A;  1NJZ A;  3AAW B;  4AND A;  4OX6 A;  1G4C A;  1Y11 A;  4YQW A;  4LF1 A;  4B3T F;  2J9E A;  2B51 A;  2W9A A;  3UN5 A;  4DR1 F;  5E41 A;  2J5A A;  2LA6 A;  4LR9 A;  3KJN B;  2W7P A;  3TUI C;  1Q79 A;  3TA0 A;  1HR0 F;  4KC5 A;  1DQ8 A;  1X4D A;  1S6Q A;  3QO9 B;  2ZH1 A;  1JLC B;  3DOM B;  3NS5 A;  3ENW A;  2M2B A;  3CJR A;  3K5M A;  1NB7 A;  2CVE A;  3DGP B;  1LWC A;  3Q2T C;  4LFC J;  2UUT A;  4YDD B;  2MZ1 A;  1IJF B;  4QCL A;  1FRJ A;  3RUB L;  2RF2 A;  2AGO A;  4QWC A;  2WOM B;  4ZLL A;  5F9N A;  2XS2 A;  2RE1 A;  2JLE A;  1VJQ A;  2M88 A;  1IKY A;  4MFB A;  4CTA A;  1FD2 A;  4X62 F;  3OFH A;  4PAA A;  2XCP A;  4B3S F;  3R6G B;  2BKP A;  5E3Q A;  4KO0 B;  3O5T B;  1WEZ A;  3ULH A;  1FJ7 A;  3O3L A;  3D1O A;  2DNR A;  4ZMM A;  4O23 A;  2BE7 D;  2RDJ A;  2VB6 A;  3PJW A;  3M9N B;  2MJU A;  3UCG A;  3MM7 B;  2LXU A;  3HFZ B;  1KHV A;  3M2V A;  2MKK A;  4DZ6 A;  2H48 B;  2KO1 A;  2V8G A;  3MUT P;  2IAJ A;  4EZ6 A;  2QLF B;  3DLE A;  2JWN A;  3DOL A;  2MZJ A;  3BKF A;  2D3O R;  5KG5 A;  3CDB A;  5IV4 A;  5L39 A;  4TQS A;  1N88 A;  2MKS A;  1YBT A;  4JI7 J;  3GR1 A;  1RWM B;  2QLX A;  5FLX Y;  6FD1 A;  5SUH A;  5KG6 A;  1XMB A;  3GJQ B;  2P9E A;  1GK8 A;  4MH8 A;  1HWI A;  2AMC B;  2ZE2 A;  4QR2 A;  4AUK A;  1AUD A;  2CIM A;  3K5P A;  3M30 A;  5JXS A;  1FI4 A;  3KTQ A;  2LEA A;  1GT8 A;  4A8Q A;  2QL7 B;  2HKE A;  2YKA A;  3CD7 A;  3CJ2 A;  1YX2 A;  3C3L A;  3QGH A;  3UDE A;  5H9E J;  3D6F B;  4NOH A;  2DPI A;  4ES2 A;  5HP1 B;  2BKO A;  2V69 A;  3LP0 B;  2CQ4 A;  2ZBI A;  4ZK7 M;  2BV3 A;  1SUQ A;  4OJH A;  2N4C A;  1DQ9 A;  1GTE A;  3G6E S;  2ZH7 A;  3CJT A;  2HS4 A;  4DSF A;  4IDK A;  1U1P A;  1JJC B;  1UEV A;  1BXN A;  3RR7 A;  3Q0A A;  2CA9 A;  1RHU B;  2BJ1 A;  2I8E A;  2VG6 A;  4YUD A;  4DX8 H;  2WON A;  4PG5 A;  1Y3J A;  4G6V B;  3IBF B;  4A8F A;  3H2V E;  1TKZ A;  3H42 A;  2RKI A;  3BH6 B;  1S99 A;  2I1R A;  3E01 B;  3NP5 A;  2E1R A;  2JNJ A;  2VDI A;  2UXB F;  1AFI A;  1YIT S;  4C6A A;  1U6Z A;  1IQT A;  1UJ5 A;  2GJF A;  2GHV C;  1NK9 A;  1ZAX A;  3BBC A;  5KFB A;  1V3S A;  3AD9 C;  4QIF A;  4PWD B;  4PPZ A;  4X66 F;  3SMZ A;  2XY5 A;  4FYW B;  4WIQ A;  3CDE A;  3G96 A;  3PYE A;  3AA8 A;  1NSA A;  1NAQ A;  1NHV A;  1T94 A;  3KWM A;  2GJI A;  1LW0 A;  3MED A;  2HYI B;  2C2Z B;  3PHT A;  1WOP A;  2HLT A;  2F1F A;  2U1A A;  2XSF A;  2EI5 A;  2O66 A;  4CLU A;  1NZ8 A;  3JXO A;  3KXD A;  1S76 D;  1VQP S;  2BAN B;  1K1Q A;  2F5G A;  2XI3 A;  2CJQ A;  1IBL J;  3I0R A;  3PZP A;  4XTT A;  3QT6 A;  1R8H A;  4USW A;  3U1M A;  3HVT B;  4NZ0 A;  2CJY B;  2DH9 A;  2V2K A;  4NYZ A;  4ED1 A;  2E1M C;  3IRX A;  4BLG A;  3KG0 A;  1IKV B;  1WOO A;  1PJ7 A;  2WCX A;  5E3C A;  1Y5N B;  1OS5 A;  4RX6 A;  2DIU A;  4DQQ A;  1UA1 A;  4ZP6 A;  2RRB A;  3M2U A;  2A1B A;  4IR1 A;  2Z2M A;  3EYZ A;  2YNG A;  3T5K A;  1RT3 A;  2YPZ A;  4B3R F;  3EZ5 A;  3KJV A;  3THT A;  5L1K A;  4OHZ A;  1U1L A;  3MFH A;  2D3Z A;  1YVF A;  4OJG A;  4DS4 A;  2BM0 A;  1WF2 A;  2DGU A;  3WHI A;  2V2Q A;  1SB6 A;  1VK8 A;  4DFP A;  1MNE A;  1D1U A;  1OMS A;  4FKY A;  2IM1 A;  5CAA A;  4H4M B;  5IZH A;  1HBO A;  3HVR A;  2GVZ A;  4DMZ A;  3W2W B;  4LRC A;  4J37 A;  3RZA A;  5B09 A;  4Y3C A;  5KT7 A;  1GMV A;  2OGU A;  1YJN S;  1SJ4 P;  4IFY B;  3HI9 A;  2Y1J A;  2ZOM A;  1B64 A;  2DIT A;  1VQ4 S;  3LUY A;  3OL7 A;  4WTO B;  3I0S B;  1NK5 A;  2IC3 B;  5DS7 A;  3PJX A;  2XEX A;  2JEI A;  3PYG A;  4F2S A;  1U48 A;  3NEK A;  2Z2L A;  1FE4 A;  4YME A;  4JI6 F;  4P73 A;  3H4D A;  3AH6 A;  4ZVP B;  2AJ1 A;  1V5I B;  2G2Y A;  4BC9 A;  3AJ1 A;  2XMW A;  2MQM A;  1HQE B;  1TL3 A;  2CJX B;  1RQ0 A;  2CJ9 A;  2DO4 A;  1F2G A;  2R7T A;  1NRK A;  2C2K B;  1WG4 A;  2VQE F;  2F4V F;  1FJE B;  1RAJ A;  2HND A;  5HBM B;  5J2M B;  3OTB A;  2CDR B;  1PIE A;  4BHQ A;  2VD3 A;  3BGR A;  4DV7 J;  4TY8 A;  2E5I A;  2QL9 B;  2WVD A;  2X3G A;  1RBO B;  2QT7 A;  2H4W B;  2HPU A;  2RT3 A;  3MUM P;  3MR6 A;  2DEI A;  4HI1 A;  5EWE A;  1T03 A;  4WFB Q;  5IXU A;  5L9X A;  4I2Q A;  3DM2 A;  4CCH A;  1TMM A;  4Y00 A;  1N32 J;  1JLG A;  2DR9 A;  4I7F B;  2Z57 B;  3DOK A;  1Q8I A;  3DMJ B;  1YG0 A;  2ROP A;  2ZH4 A;  2WW8 A;  3FQL A;  4C3K A;  8AT1 B;  3H7H B;  2B3T B;  1HL6 A;  5T7L A;  3GJT B;  4C8L A;  1KWM A;  1SV5 A;  1HBN B;  3DYA B;  1LFP A;  3HVW A;  3VAI A;  1BWV A;  1S9E B;  5EX0 A;  2ZNY A;  2DIV A;  5F0W A;  1VRU A;  1JNR B;  2WTF A;  5GME A;  1K0T A;  1QTN B;  1QJH A;  2ACM A;  1DQA A;  3W2V B;  3PX4 A;  4I6A A;  4P2M A;  1KFD A;  5DG7 A;  2EEY A;  1NJW A;  1CJK B;  5LL6 d;  3MMC B;  2MSS A;  2MTL A;  2DH7 A;  2J76 E;  3GFZ A;  5KFX A;  3ZZR A;  1UL3 A;  3U27 A;  2KDO A;  2JZ5 A;  2CPI A;  2HBR B;  3Q2S C;  4JI3 J;  4DV1 F;  1S1T B;  3MEE B;  1A0O B;  2UUC J;  5BR8 F;  1NB2 A;  1UKU A;  4CM0 A;  4Y2A A;  4JP8 A;  4XO0 A;  3D3C J;  4LUB A;  1T02 A;  5CAB A;  4FXW A;  4RW8 A;  3D1Q A;  4Y2M A;  2RHS B;  4S0M A;  5ETO A;  2R8G A;  4FXD A;  2GAH C;  1UW9 A;  2AYB A;  4Q2L A;  1YJV A;  3NNH A;  3QMQ A;  3FCH A;  3H2U B;  5U47 A;  3Q24 A;  2LKZ A;  2EFG A;  1ZA1 B;  1WDD A;  4J5O A;  4WCE Q;  1RDR A;  3LWL A;  5L1L A;  5GAG U;  4TXS A;  3H5X A;  1MML A;  1T3N A;  4RW6 B;  4EGL A;  4ZVO B;  5LMN J;  5KFL A;  2JDJ A;  3M8P A;  4FNH A;  2C2E A;  3VVU A;  3HO1 A;  1FWP A;  3R7S B;  4A46 A;  1NDL A;  4KTQ A;  2MZQ A;  1HQU A;  3TJ9 A;  3Q8Y A;  5JVG Q;  1HYS A;  3MEG B;  3HVA A;  1D9D A;  4IG3 B;  2RSQ A;  2ZDO A;  1PYT A;  2JHE A;  4U9R A;  4UOC A;  3OSP A;  5J1E A;  1VIO A;  4WP3 A;  2E5L J;  2E1C A;  4K2X A;  3SQG B;  5I42 A;  3WC0 A;  2HHT A;  5L8R C;  3LH2 S;  3QGP A;  4WKR A;  2GIF A;  5ETN A;  2RAQ A;  4RW7 A;  1RTJ A;  5HL7 Q;  2O67 A;  5HVH A;  4HTI A;  1RJJ A;  3P5T L;  2GV1 A;  5H9E K;  4QPX A;  2R7W A;  2GML A;  1OO0 B;  4ZIT A;  4EEY A;  2L9N A;  2RUS A;  3OL6 A;  4DR5 J;  3HF5 A;  5HAT A;  1RTD B;  3MPU B;  1D3W A;  2O3D A;  4HH0 A;  1PC5 A;  3DRX A;  3CCE S;  2V8P A;  2HFS A;  3F56 A;  1VMB A;  4WU3 A;  1PIL A;  4ZVS B;  2C3Y A;  1VIS A;  2IPO B;  1L3S A;  1XJW B;  4EBE A;  4PEO A;  3DHW C;  5F8M A;  3Q22 A;  1OPI A;  1FHT A;  2UXD J;  4P6Q A;  2HG4 A;  5AJ3 F;  3ITH A;  2XLJ A;  1ROF A;  4URS A;  1E6Y A;  1RWW B;  1P1L A;  1F9E B;  5IQ6 A;  2NQP A;  3UD4 P;  2YKO A;  3JAM Y;  5KFH A;  2KT2 A;  2VG7 B;  2VOP A;  1HD1 A;  1U02 A;  1HHQ A;  1F1B B;  2R3V A;  4ID5 B;  3NAH A;  2EBE A;  3GE9 A;  5IC6 B;  4WZQ A;  2XCA A;  1UEU A;  1VI7 A;  2FZG B;  1M1K T;  2AJ0 A;  2FLO A;  2QG9 B;  2VBZ A;  3G71 S;  3GYN A;  2KFZ A;  4NL5 A;  3HHK A;  5D78 A;  1MU2 A;  1T0T V;  1NPK A;  1ZBT A;  1HKA A;  3C2P A;  3SCK E;  2QC3 A;  4JI2 J;  3CD0 A;  1TL7 B;  2NLW A;  2UUA J;  4RW4 A;  2PI5 A;  1S9G B;  5KFG A;  2H5E A;  2D9P A;  4R0E A;  2C22 A;  3DFE A;  4B9N A;  2BE2 A;  3TVK A;  3RB6 A;  3CJ0 A;  3T3F A;  2E7W A;  2ZVI A;  1SJF A;  4MAK A;  1IUJ A;  2FJX A;  5F8L A;  5DG8 A; 
#chains in the Genus database with same CATH homology
 4WP3 A;  2BW7 A;  3MR7 A;  4P2F A;  1CJT B;  4CM0 A;  4P2X A;  4USU A;  4WP8 A;  1Y11 A;  1CS4 B;  4CLW A;  1AZS B;  4OZ3 A;  4NI2 B;  1YBU A;  5D0R A;  2GVD A;  4CM2 A;  3C14 B;  1WC4 A;  4CLZ A;  4NI2 A;  4CLP A;  1WC3 A;  1FX2 A;  4OZ2 A;  4CLT A;  1YK9 A;  3UVJ A;  1CJU A;  5D0H A;  4OYB A;  1CJV B;  3R5G A;  4OYO A;  1CJT A;  3MAA B;  2GVZ B;  5D0E A;  3C15 B;  1CUL B;  1CS4 A;  1AZS A;  4CLK A;  4OYX A;  4CLL A;  1WC1 A;  4OYA A;  4OYM A;  3C15 A;  4CLS A;  3C14 A;  4P2M A;  5IV4 A;  4CLU A;  3C16 B;  4OYI A;  1CJK B;  3ET6 B;  4OYZ A;  4WP9 A;  5IV3 A;  5D0G A;  1YBT A;  4UST A;  1WC6 A;  1WC5 A;  1Y10 A;  2QV6 A;  1U0H B;  1CJK A;  1TL7 B;  1AB8 A;  1CJV A;  1WC0 A;  2W01 A;  3MAA A;  1U0H A;  2GVZ A;  2GVD B;  4CLF A;  1TL7 A;  1FX4 A;  1CUL A;  2WZ1 A;  4USV A;  4OYW A;  4USW A;  4WPA A;  3G82 B;  3C16 A;  4CLY A;  3UVJ B;  3ET6 A;  1CJU B;  4OYP A;  5D15 A;  3G82 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...