1WC3A

Soluble adenylyl cyclase cyac from s. platensis in complex with alpha, beta-methylene-atp and strontium
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
198
Chain Sequence
SHMRPEPRLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFENQGTVDKFVGDAIMALYGAPEEMSPSEQVRRAIATARQMLVALEKLNQGWQERGLVGRNEVPPVRFRCGIHQGMAVVGLFGSQERSDFTAIGPSVNIAARLQEATAPNSIMVSAMVAQYVPDEEIIKREFLELKGIDEPVMTCVINPNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords ADENYLATE CYCLASE
publication title Bicarbonate Activation of Adenylyl Cyclase Via Promotion of Catalytic Active Site Closure and Metal Recruitment
pubmed doi rcsb
source organism Spirulina platensis
total genus 65
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2004-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1wc3A00
4WP3A 3G82A 5IV3A 3C15A 4OYPA 1CJTA 5D0GA 1TL7A 4OYOA 1CJUB 4CLLA 4CM0A 1YBTA 4USWA 1WC1A 4OZ2A 2GVDB 3G82B 1WC5A 4OZ3A 3C15B 4CLUA 2QV6A 1CJTB 1FX4A 3MAAA 1TL7B 4P2FA 1AZSB 5D0EA 1CS4A 1CULA 1CJVB 4OYXA 4CLKA 4P2MA 1WC6A 4CM2A 1YK9A 4CLPA 3MAAB 4OYBA 5D0RA 4WP8A 1CS4B 1CULB 4OYWA 5D0HA 1Y10A 4OYZA 1U0HA 4WPAA 3ET6A 1Y11A 2WZ1A 2GVZA 4USTA 1FX2A 3UVJA 3ET6B 1WC4A 4CLZA 4CLTA 1YBUA 1CJKA 4CLFA 4WP9A 5IV4A 4NI2A 1WC0A 4CLSA 3UVJB 1AB8A 3MR7A 3C16A 3C14A 3R5GA 1AZSA 4USVA 4CLYA 1CJKB 4OYMA 1CJVA 4OYAA 4P2XA 1WC3A 1U0HB 4CLWA 4NI2B 2W01A 5D15A 2GVZB 4OYIA 1CJUA 2BW7A 3C16B 3C14B 2GVDA 4USUA
chains in the Genus database with same CATH superfamily
5IV3A 4IUFA 4F26A 4KFBA 4DR1F 1VRTA 2UVWA 1UVKA 3RZAA 2MQLA 2BDPA 4CM0A 4EZ6A 1JK9B 1KLMB 3JB9k 1VQSA 1VC0A 4OYXA 1KQKA 2VC0A 4ZPCA 2A2CA 4B3OA 4U8VA 5SUHA 5A0YB 4HEA9 3F41A 4ETZA 4R0JA 4IG3A 3R5CA 4NLTA 4FDFA 4I2QA 5E3QA 3NG8A 1B0PA 4OZ0A 1ROFA 3E01B 3VHQA 1TMMA 4ZVEA 3QMQA 4ANCA 1V9OA 4PWUA 3PR4A 3EDRB 2BE7D 5L38A 2LP4A 3NCRA 4FF2A 2FHKA 1M5HA 2OLWA 2PO4A 4FPIA 4ANDA 4KKOB 2IJRA 1U4BA 2YNGA 3DLGA 3KDOA 1RCXB 1ZOTA 4MT1A 4RO0A 3NBPA 4YEAA 4OLPA 2M9KA 5E3CA 1FWLA 5KG0A 4X4UA 2FVQA 4RNOA 4TYBA 1FTRA 4KHPF 1ZBTA 4DV3J 2UUAF 4QZVB 3SQOP 2FZKB 2XNQA 2K1RA 4LRFA 4LRCA 4OMFG 1VLYA 1OPIA 2DR9A 1KVIA 3CCRS 4DV0J 2P6TA 4CQ1A 4NLWA 3GV7B 3UE2A 2F9DA 4RNMA 1TL7B 3PFOA 1N36F 5B0FA 4LFCF 5JUMA 2JEJA 3OLAA 5FDLA 5H9FJ 2HBYB 3VVTA 3CD5A 5CA5A 3CD0A 4M5JA 2ROPA 2RS8A 4ZCMA 2H3EB 3DRRA 1U1OA 2AGOA 2ZH8A 5DQGA 2QSWA 1YVFA 1M5SA 2R4FA 3BM7A 3US5A 1FRMA 3H2VE 4YFUA 3T41A 3MR5A 1FKOB 4FNIA 2NPIA 2IVFB 4YUDA 3FMWA 3TW0A 5GAEU 3MCSA 1AZSA 4UZBA 1AT1B 3U1LA 1RP5A 3GR1A 4UQTA 3Q86A 2XBPA 4NI2B 3RBDA 5LL6d 3CJQA 3R8YA 1HWIA 3CCJS 3MAHA 2RJZA 1PJ7A 3HCXA 1TKTB 4PG4A 4CO2A 2ZH5A 2HFNA 2IM3A 4M63A 4NMLA 4UOGA 1P1TA 2HW3A 1GTHA 4RUCA 2RS2A 4DV2J 2VPYB 1NO8A 1SL0A 3T5LA 3BKFA 4DV7J 5DGAA 2JRSA 1L3KA 2OEMA 1H7XA 5F8GA 1VQNS 2HSEB 2Z8QA 4IH5A 2UVUA 1R89A 3IBCB 3IA0A 4LBPA 1PAUB 4P10A 3D67A 4RU9A 3FJ2A 4P7VA 3N5FA 2BKPA 3D6HB 2W2NP 2CUYA 1IBMJ 1S7IA 3DKDA 1S6QA 4HH0A 3MD3A 1N52B 3DDKA 2DNNA 1APSA 2DD8S 4CLWA 5ETPA 1XERA 3Q83A 1HNIA 2GJ2A 1CJUA 2GGPA 2V8HA 2DNYA 3Q8YA 2IBKA 2JJ4D 2DGWA 4DHVA 2CQPA 2G0JA 3KLIA 5I3PA 3KLHB 2XWYA 3SCLE 4LSLB 4OZLA 3VZIA 1EKSA 4DPUA 4KPCA 2XSFA 3PR5B 2H65B 3DRXA 4PWDB 2H1YA 2MJNA 1SC1B 2HYIB 5DDPC 3TX8A 2VH7A 8ATCB 3VAGA 1QAJA 4LF6J 3NAHA 2HBQB 2L08A 3R9LA 3HVTB 2MGZB 5HQ8A 3TUPA 5D4NA 2OPQA 2MQMA 3P45B 4AD6A 2XS7A 1NK0A 5B0DA 4WFBQ 4ZPWR 3DLKA 2HRTA 2QN6B 4ED8A 4CO1A 2LECA 3HHLB 1QSSA 4F25A 1BQNA 1NJWA 1S57A 2RILA 3TARA 3SV3A 3TANA 3KMSA 1GH8A 1RAHB 4O44B 4UW2A 1QSLA 1WOOA 3OL8A 2UUWA 2JEIA 1CJVA 2GC8A 1U0HB 1KC8T 2QL5B 4DUTA 2ZD1B 5A6PA 4ILRA 1PAEX 2BM1A 1RT5A 1HNXJ 1TL3A 2X1GA 4MMOA 2CJBA 2V4RA 2JVRA 1NSAA 2L41A 4O0IA 2W4PA 3JAMU 3W7BA 4BWJA 4RUHA 4CLUA 1IJFB 3BQ2A 2GFFA 3H4DA 1Y00A 4CT8A 4C0OC 1XMBA 4KH0B 2YWGA 3KHGA 2OTLS 3OLBA 1F6TA 2BYCA 2X7IA 1MNEA 3UN5A 1TZ0A 2CPEA 1FRKA 5D0RA 4Q8FA 2LXIA 2O1PA 1TVRB 3SCJE 2M70A 3RJMB 5FLXY 4RUAA 5HMYA 4JI8J 2MQNA 2CZVC 2XC9A 3H8YA 2UUBJ 4USKA 1DTTA 1M5VC 4WE1B 2HRUA 4FXWA 3MAQA 2DR8A 4B3OB 2V94A 4GVBA 2KFYA 3K7RA 5KFWA 2QLFB 2VDHA 1FXLA 1UP1A 2K3IA 1OJ4A 3DU6A 2IA6A 3LF0A 1N5SA 2ZWPA 2DKOB 1GMUA 2Z30B 5KG1A 1KWMA 4Y28C 1SBRA 4ECUA 4CTAB 3Q2SC 4MYTA 2ZNZA 3HZGA 2QV6A 1EHWA 4OX6A 3F0NA 2LEPA 1PYSB 5E3AA 3BO3A 1LQ9A 1KN6A 5KFXA 4G1QB 4ZPBA 1S1WA 2D9PA 2FC8A 2FJBB 3VWSA 4USIA 5HVFA 1S0VA 3G8TA 2MZRA 3IRXA 2H4WB 1Y0HA 1RT4A 3S6EA 2DPIA 5ETTA 4PG5A 3HKWA 2W9CB 1FJGF 2XYPB 4Z7CA 5FDLB 2HFOA 3VR1A 4WIIA 3GCWP 1V3SA 2DISA 3DRRB 1Q79A 1S1UB 3IBFB 2HG4A 4MJKA 3J80U 1NB7A 1RTHB 3H5XA 5D15A 3HJFA 5JVGQ 2V9WA 3GCXP 3N4WA 3SDEA 4DR2J 3EXYA 3U02A 1U1LA 2HHWA 1R27B 1J5OB 4UUWA 5ETQA 2PE8A 1DFDA 3FBBA 2VASA 2J0XA 1MWYA 2XZDB 1VBKA 5F8NA 1S77D 1AZSB 4K50A 4O3OA 4P2MA 3H4BA 3BF4A 4C4WA 2J6UA 3PJ9A 1WI8A 2E66A 2C2RA 4X4QA 3GB0A 2HFUA 2OEKA 3ISNC 1S79A 4L72B 1NDCA 2B4OA 5C2CA 4DV0F 3AJDA 3EWGA 3IR6B 3ILJA 1RTJA 1LWXA 4U67Q 4QW9A 4O23A 3MPVA 4P75A 1ULRA 1F9HA 5SZTA 3LGMA 1J27A 4CH7A 3FSIA 4RW8B 2HHUA 2DTJA 3D0IE 1P27B 4IG0A 2KRBA 3QO9B 3S8SA 2DHSA 2VA2A 4DSFA 1SI9A 4CH1A 3LAKA 5IQ6A 1FRLA 2LXFA 3P8BB 1TKZB 2E7XA 4J9UE 2D3UA 3G6ES 5GMEA 2E5GA 1TL1B 4BC9A 2JOQA 3PRBA 2VG6B 1SUQA 1NDKA 4ZPVR 4JI6J 3CDWA 1RT3B 4MAKA 1S6QB 2CZ9A 1HNWF 1CS4A 2MY7A 2CQCA 4TU8A 5IWAJ 4ZITA 1B7YB 1NAQA 3KK1A 3CVKA 2YWEA 2AF6A 3DXSX 4GO7X 2YX7A 4FF1A 1ZM2A 3QWUA 1FDBA 4F36A 4NXMJ 5ETRA 3NMRA 3UR3C 4DN0A 2V2KA 4LF5J 3CMAS 3HFVA 1ZM4A 2HNZB 4AQYF 1GMWA 1X9WA 3CW2C 3DNCA 1W25A 2U1AA 3VQSA 5HN0A 2GNKA 4F67A 2C22A 4DR5F 4NLUA 2ZJPQ 2GV1A 4DV7F 2ZOGA 2UXDJ 4DL5A 3T9NA 2I5JA 4P2XA 4ICLB 2K8GA 3P6YC 4UY85 3QT8A 1RDRA 2OD6A 2C3UA 1MWQA 1D0EA 3ZZRA 4RW7A 1S6PB 1G4CA 2BJ1A 1ELOA 2CPIA 3TOQA 2V2VA 3NWRA 1XNQJ 1IBMF 1YLXA 2E1MC 1REGX 2M4MA 3M9MB 5A2QU 1CJVB 3RW6A 4QIVA 5DZ7A 3DLBA 1H2VZ 3HXMA 1S9FA 1RT5B 5KAKA 2KT2A 2KRRA 1O51A 2AJQA 5A2QY 2OPSB 3ZTOA 1QVGR 4J9PA 1UTAA 4AL6A 6FDRA 3V6HA 5CAAA 1HHSA 4LIWA 1ZAWA 3DOKA 4JI2F 1D9FA 2RHSB 2CXEA 3MFIA 2JC1A 2K06A 5J1EB 2DK2A 2XGPA 2CJ9A 1NK5A 1URNA 3BSAA 3OTCA 1TMJA 2DCUB 3TP2A 2Z4PA 1PYTA 1B70B 2E44A 2MZQA 4ZCIA 5DGBA 1C1CB 1DTTB 3TAMA 1HW9A 4ZJQA 2QA4S 2YPZA 1RHUB 4H4KC 3Q24A 5HBMA 3RRGA 5KFCA 2ZKUA 1N6QB 4YOEA 4DS4A 3MPUB 2NLWA 2DCLA 3SCIE 4OJ3A 3KKFA 3UDVA 1K0TA 1PBAA 5L9XA 3M9NB 4JI5F 2FDNA 2R8HA 2I8EA 2RSQA 4AXIA 2A3JA 3CE8A 3AB2B 4KHRA 3B6BA 5GAEI 2HNDA 3WIUA 5A8RA 1IQTA 3OL9A 4P52A 2PA3A 2CJYB 2NREA 1JMTA 2CFXA 5HP1A 3MFHA 2JLGA 4C98A 4WFXA 4AE5A 3CCWA 5F8IA 2XB2D 4OZJA 1LXJA 2GCFA 2QYGA 1RT2A 2VL1A 4JI1J 3M32A 3OQ2A 1RE1B 4DLGA 3CDEA 1IKVA 2CPHA 2IDEA 3IRXB 2ZHAA 2B4PA 1K44A 2OTJS 3O3LA 4DR6F 2YH1A 4KO0A 1AYEA 3OXLA 2LCWA 4P9SA 2RIJA 1EIYB 4Q2LA 2FLLA 4X4SA 5L1LA 1RU2A 4URGA 4DEZA 3DFEA 3UN3A 2QMUB 4M5LA 2DGXA 3BREA 5A8WB 3BS9A 5CYQA 1XN9A 2GO8A 1CULB 3R5AA 3SDEB 1Y10A 3BKUA 5L1JA 4OLOA 3OUYA 4ZIVA 1SJ3P 3DDNA 2QLJB 4QIFA 2VG7B 3WX4A 4WTOB 1RT7A 3S1TA 1YTYA 2GIRA 5H9EK 3KHHA 2GX8A 3M6VA 3BO2A 2HS3A 4N7TA 3H90A 3PIPQ 1RAOA 2IFXA 1E6VA 2R2RA 2VJVA 2FUG9 3BDPA 3VTIA 2RAQA 3B8HA 3OTDA 3BSCA 2XGQA 3EVWA 4OYIA 2HGNA 4H4MA 3EPGA 1RTJB 4KRWA 1HW8A 1GEHA 1DZ5A 3QNWB 4LT6A 3KK2B 4QQBA 1K8AT 3QIDA 1D3WA 2WVBA 3NOGA 2P9GA 4YB1P 1FESA 1IWAA 2B56A 1DQ8A 1RT6A 4KHMA 4O3NA 2C3MA 2V34A 2RRNA 5G0RA 2DGOA 2F8EX 5L39A 4ZPDA 4ANEA 1SUQB 2PDAA 1WTFA 4TLQA 1U1PA 2BQRA 2D9OA 3R27A 4U9RA 2G1DA 2Y0BB 4BWMA 5HJYA 4WP9A 3IO1A 1VBZA 3MEDB 3T1HF 4Y2MA 3HI9A 1S1XB 1DBDA 4EBDA 4MIAA 4Y6IA 2B7BB 3QSYB 2PT0A 4URSA 1GNKA 5KFGA 1K47A 3P49B 2M0GB 1P1LA 2CWXA 4HVZA 3C15A 3GIMA 2Q6CA 1LOUA 3R2DJ 3UDLA 4LSZB 2O66A 4KR0B 1NU4A 5A6WA 3LGHA 4HR2A 4ED2A 2QJ3A 4PG6A 2PMZD 4TLRA 2PFFB 3MM5A 2N3LA 4ECZA 3BQ1A 2QEXS 1OY6A 2XULA 3HJVA 4FYVB 1GMVA 5J2PA 1SJRA 2E9RX 2B8QA 2ZVSA 4JI7F 4WZQA 4O4GB 3QT5A 4DV6F 3H2LA 3TI0A 1FD8A 1FKPA 2AHOB 2AGQA 4JI6F 4HI2A 1T3NA 2AWZA 1HBOA 3DGPB 3UVJA 1HYSA 5KFDA 4B3SJ 4CLZA 3ETMA 5IWAF 3JSYA 1MSWD 4OV1A 4QCLA 3C6UA 3HSGA 1FVSA 1XMQJ 5ADZA 2B7CB 2W9BB 4NXMF 3NMAA 2J6TA 4P74A 4WF9Q 3V6KA 3AJ2A 4AXJA 2WVFA 1RBAA 3A3PB 1REVB 4CWBA 3NL0A 3MR3A 2VF3A 5K20B 2D1CA 2GAGC 1UFWA 5I42B 1Z2ZA 2VG5A 1GMWD 2CZ4A 4QPTA 2X3GA 1U1RA 2CQIA 3UQSA 4JV5F 1RXOB 2HQGA 3B4DA 5IM0A 1SPBP 4YB5A 3QLHA 2GW8A 4TYAA 3TAMB 4G1PA 4XPCA 4NA2A 1WTBA 3TJ9A 3J81Y 1RT1A 5HBMB 2MHEA 2FLPA 2HHXA 1LNQA 1R3NA 4HTJA 3ZZPA 4W90B 1RUSA 1I94J 3IR7B 1KEKA 1XK8A 2ZWOA 2VICA 2WW4A 3RB0A 1RAEB 3MM9A 5K8OA 3D2WA 3IGNA 2J7UA 1S5ZA 4B3RF 2HNDB 3SFUA 3I87A 4EFAC 3T9ZA 2LDYA 2YH0A 1WG5A 3OFGA 5F3TA 1HKAA 3PX0A 1Q8KA 2C3YA 3MURP 2DHAA 4Y2IA 1R0CB 3CGIA 2RF2B 1WF1A 2CAJA 1RT2B 4CLLA 2YWWA 4A46A 3M32B 1F9FA 3MM6A 1CJTB 4EU0A 1HQUB 2Q6BA 4I1TA 3NRBA 3KJNB 3RTVA 2C2KB 3L4BC 5KFMA 2BM0A 3O1LA 3KDNA 2HIQA 2BANB 4ATNA 2R8IA 4DUZF 3GG1A 4MIWA 4RW4A 2HBRB 1JKHA 3M8QA 4NCAA 1LWFB 3VALA 2PMHA 5AE1A 2O3DA 5BYQA 3E2EA 1G7CB 4HHJA 3MEEA 3CJ5A 2IC3A 4FVMA 1KSPA 2N4DA 5B08A 4ZLJA 1V5VA 2DNGA 1HNZJ 1U48A 1JJ2R 1WC0A 4DX8H 3P5TL 2ZZMA 4FS1A 2W1BA 5D77A 3P4UB 3S7RA 4KY3A 1X31C 1RT7B 5LJ5Y 2VQEJ 5CZXA 2QC3A 1H0HB 1LFPA 1TKDA 4A8OA 4YDXA 1WC1A 2E5LJ 4ZVTB 5HROB 1BHNA 5C7PA 3KG4A 4L73A 2ZNYA 1L3VA 5CABA 3HVAA 3GYNA 2CRLA 4EO6A 2HS0A 3M6XA 2ZZNA 2RDIA 2EPIA 2W4DA 4FYYB 1S97A 2MZTA 4RU2A 2VBYA 3C8YA 3ONQA 4AYBD 1LW2A 2E5IA 2KG1A 4PYDA 1KRPA 3JTOA 2R3VA 3CDAA 3HD1A 4ZN3A 3FBEA 1U24A 4ZVUB 5A8KA 4OZ5A 2B0GA 5IZHA 4RW6A 2NSCA 3WBZA 3GV8B 3JXOA 4DFJA 1HR0J 3QSIA 2MSSA 2V9KA 1KVKA 4YB6A 4LR8A 3TWZA 4J9NA 3C16B 1XQIA 1PG5B 3UO0A 5JJBA 4ECSA 1WG1A 3N28A 4I7FA 1D1UA 1VQ4S 4MIBA 3D5MA 4DDFA 4EO8A 3CEDA 1ZZNA 3GU0A 3AQPA 1T7PA 2MKIA 2UU9J 4OZNA 3Q8UA 3OR2B 1TUVA 1W2IA 3BQ0A 2VKRA 4R8UB 4QIGA 2WK4A 2P5VA 3MDFA 3J7AN 1IBLJ 3UNGC 3ENQA 4UZCA 3MCOA 4CZCA 5DO2A 2QLWA 2YWHA 4NLXA 2JEGA 2ZUAA 2LMIA 4BCAA 2VOOA 5RUBA 2OAUA 2OKQA 3BKTA 4DPYA 3EM1A 3GFXA 4C9DA 1R43A 1ACMB 4AUKA 1Q16B 3DN9A 2LQ8A 3A8EA 4N77A 2RQMA 4FKYA 2MB0B 1FRIA 1ZPWX 2BJEA 1WF0A 3U27A 1QAIA 2DITA 3IM8A 2HAFA 4WP3A 4LSNA 5KFBA 3EUNA 3DYAA 3L95X 3D0GE 2EFVA 3CJ3A 1U02A 2BRKA 5IXUA 4MH8A 2ASDA 3QWPA 1YJ7A 5D0EA 2F4FA 3KUEA 1W2BR 4F2RA 4QR2A 4PG7A 1UWAA 4K7QA 4N41A 4RUBA 3DHXA 2R7RA 2Y1IA 4OFZA 4P2SA 2YNHA 2WONA 1AA1B 2K2PA 5DDQC 1FNXH 2W2OP 2Q79A 4DCOB 2E7WA 3I5AA 3SZ2A 2ZM6F 4OX9J 4DF8A 4EBCA 4DX6A 4M1KA 1AXQA 2BX6A 3KLVA 2ZZTA 2CKWA 2XSJA 3PG9A 3CT9A 2HFVA 2VG5B 3QFWA 3I4PA 3IM9A 4ZKAA 2G2OA 2YKNA 1RK8A 5E7OB 3IAS9 5C24A 2XLIA 3UR0A 2HQDA 3MTJA 4B9SA 2PFDA 5MLCV 2G2ZA 3T5KA 4FYXB 3NS5A 1M1HA 2NXUA 4PZVA 2GVDA 1RQ0A 2DGVA 2PD1A 3T5JA 2G2YA 1K1QA 2J0WA 3D1HA 4QBUA 1Y3KA 1U6FA 1PC4A 5GAHI 1CQMA 2BZ2A 3JTPA 2V4QA 1DJ0A 2NUUG 4E0DA 2OUGA 3G6VA 4NLSA 3MAAB 1X9MA 3IG1A 1JLAB 5B7WA 4A8YA 1P9QC 3FRZA 1X5TA 2R7WA 1OY9A 2KT3A 4NLQA 2B5JA 2A6OA 1HPZB 3Q89A 1VR6A 3CJ8A 2RRAA 3DLEA 4RNHA 1JLGA 2M8DB 2FVRA 4G1IA 3V81A 1L3TA 3TAPA 5ETVA 1R8AA 1ZM3A 4O3PA 2DH9A 2VBWA 3M8QB 3R6LB 3C14B 4B02A 2F3JA 3UN2A 1CVJA 1TELA 3MEEB 1YZ7A 3J7YI 1B99A 2R2SA 1JJCB 3KLFA 5LJ3Y 4L3NA 3BB5A 1A9NB 2J7WA 2RVJA 5D6GA 4JI3J 3C46A 1G1XA 2OPPB 1U1QA 5H1SV 3TZYA 4DSJA 1Q5VA 4NXNJ 1N5TA 2B9XA 3QJLA 1U45A 4FN5A 2FJEB 5KFIA 5KFUA 3KLEA 4O0NA 2UV8A 4Z37A 1C0UB 4OI3A 3RRHA 3GWCA 1QAYA 1ZYQA 5AE2A 1E6YA 1YGYA 3VAIA 3SQGA 4DV1F 1HI8A 3LP1B 2MY8A 3ZTPA 2W7AA 4CLFA 1MG7A 3I4HX 2XY7A 4NYZA 3MMBA 2IA0A 2W4CA 3RRKA 1CBKA 7FDRA 5HATA 2AV5A 2CJXB 1IKYB 1PILA 1U25A 2KM8C 5M2RA 3BN4A 5K8PA 5J1PA 4K4YA 4RLEA 2BXJA 5BYRA 1RWNB 4ECTA 1LW2B 2CNLB 2I9SA 3GONA 1RKJA 2HQIA 3PYEA 3R5BA 4TKTA 2ROGA 4ZJLA 4IKAA 5CD4H 1O8BA 5A8KB 1X0PA 3W62A 4RW6B 3QGIA 2R7UA 3CJTA 2HVZA 1RU1A 1FX4A 2P6SA 3DHWC 1F5CA 3DMJA 1G3OA 4ED3A 2YKAA 5LM7E 4CM2A 2MXYA 2WSFC 2HHQA 5HL7Q 5EWEA 1MN9A 9ATCB 2VQEF 2ZOMA 4I7FB 2MKSA 4DWIA 4DMZA 1LWCA 2OMLA 2CPXA 2AP6A 2XMUA 4CYUB 3MWBA 2E29A 2ZH2A 5M2UA 3AOAA 2F4VJ 2L48A 3OTBA 3A12A 3ISZA 3IS9B 1X8DA 4IFYA 4OIXA 3TZWA 1KQFB 1XNRJ 5L1IA 3MM7A 2UVRA 2O01C 2GQ2A 3FK4A 3OVBA 3NKYA 3F73A 4DL2A 4C0HA 3M8PA 2VJUA 2O5DA 4J9SA 3I32A 4C3LA 2CDRB 2N82B 1HQ2A 3R7NB 4DR3F 1X9SA 2BABA 1NH7A 1Q8IA 2JFKA 1TP7A 4X65J 2HZCA 1HR0F 4F4WA 4NX9A 1FA0A 4MKAA 4DQIA 5LMNF 3KNAA 3O44A 1L3SA 3MCMA 1R8HA 4LSNB 2ZKTA 5E5NA 5F8LA 3E51A 4F4XA 2UV8G 3BR9A 4OJGA 1FWKA 1JLEA 1UVJA 3D54A 3D1QA 3RAQA 2XTJP 4F8RA 4DJBA 3DLLQ 4WYWA 2HZAA 2M5YA 4K4XA 4NWBA 3UCZP 5HMWA 3A3OB 2KYXA 2WONB 2YNHB 1IBLF 4ID8A 2BJ3A 3OHAA 4I67A 1WC3A 3PYFA 4KGMA 4JI4F 1SQFA 3T3FA 4GMKA 4HHHA 2DGTA 2XSJB 1QM9A 2ALYB 5GAGU 1FEEA 3GYGA 2J9CA 2OEJA 4EMDA 4HL9A 1NDPA 4I69A 2YKNB 1KHVA 4OZ2A 2I6WA 4ETXA 1B4SA 1JLFA 2V0NA 5IC4B 4KHPJ 2UUAJ 1BXNA 2GO9A 4C8YA 5B0EA 4ZHRA 4ZPAA 3A1YG 2LQBA 4XO0A 4WP8A 2O67A 4WXWA 5D4OA 3CCZA 1I1GA 1KVJA 4WXOA 4ECQA 1FWPA 1N36J 4ZVQB 2FJDB 3W2WB 4YHHJ 4XTTA 2NXCA 4DL6A 4M5DB 4NLGA 4NZ0A 1UCNA 4RX6A 3O6QA 2G4BA 2R7SA 5JXSA 3LP0B 3D1OA 2E9TA 3HHLC 3WHIA 3SSRA 3HPOA 2DY1A 1DARA 2J5AA 2V67A 5KFTA 3JSMA 2ZH4A 3T5HA 1TAQA 2CQGA 4Q44A 1S49A 4BHQA 3BV8A 2V8VA 5LXYA 2C2DA 2POKA 2IPOB 3CCTA 1UW9A 3GV5B 5HAOA 4M5MA 1RTIB 4AFFA 1KONA 4NRUA 5L46A 1FEHA 4PUOB 5GMKa 2HLTA 3H5YA 3POTB 2LQJA 3CD6S 2V68A 1N5YA 1CEZA 4U7UD 1EZZB 3RBEA 5E3PA 3N79A 3H7HB 1NXIA 1TK0A 3H5UA 3V6DB 1HARA 2QT7A 1T3OA 1F3VA 4YR0A 4DV5J 4XDDA 1KFDA 2OFHX 4OHZA 3KLFB 4DXLA 2LVWA 3NY0A 3OSPA 4GKKF 1D8YA 1VOMA 3CIMA 5HSPA 4X62J 1NK4A 4RBUA 1EQ0A 3KTQA 3V4MA 1WI6A 3AJ1A 2KH9A 3BPSP 3FC9A 1X4FA 2PSZA 1MLAA 3KLEB 1U6BA 3CMES 3M2VB 2PC6A 2W7PA 3PY8A 3HSZA 2MMYA 3HF5A 3BBBA 1SKWA 2JDJA 2MJUA 6AT1B 2DNKA 3H25A 2IDLA 1XMOF 1U7LA 2HFZA 3MMBB 3L09A 1TFWA 2DHHA 2XO7A 4RPFA 3MEGB 4URQU 1HQEA 4J9MA 1HNVA 3KNGA 3BBCA 1JX4A 2EKYA 3Q8VA 3OT9A 4EZ9A 3MF5A 1LV5A 2F8MA 1R0AA 2WBRA 5EGYA 4X66F 3I5BA 2HK2A 2YXLA 2XI2A 1RYRA 3I9V9 3BGLA 1RB0A 2E1AA 3I6PA 2EFGA 3JTNA 1UWBA 2BACA 4IOAQ 1HBMB 3Q8QB 4JI3F 3HVWA 4HT7A 1M1KT 1S12A 4ZLNA 1WKJA 1F2GA 1EARA 2HAIA 1WJ9A 2DXFA 4ID5A 4OYMA 5DQHA 2KB2A 1JJHA 4NLRA 1RI7A 3L3CA 3HO1A 1MROA 2R8KA 1XR5A 1H2UX 1MW7A 4PQUA 5HI7A 1RYSA 2H9ZA 1PSDA 3MOZA 2GMLA 2ZH6A 2WOMB 3CUNA 1RA6A 7AT1B 4PXEA 1TAUA 3CC7S 3QAUA 1MU2A 1LW0A 4J9QA 2X1BA 3BYRA 2BEFA 4USHA 5HMXA 1QJHA 4ZCKA 2ROEA 2Y3YA 1U47A 3G6XA 4RBTA 2L3MA 1RBOB 1MMLA 5ETKA 3RR8A 4S0MA 1F60B 3EGWB 2MTLA 3TQEA 4C48A 2WTFA 3PVXA 4O3SA 4Q0BA 1U09A 1VI7A 1CJKA 5EWGA 4ZS6A 4C3MA 3ISND 2VDIA 2HNYA 1VQ5S 5KG5A 3NNCA 3GJRB 4ZVFA 2DO4A 3OL7A 4TU9A 2QIFA 3D0HE 4J90A 1NLKL 5BJRA 4IR9A 2AJFE 2BE9B 2DH7A 2HGLA 1OPZA 4I6WA 2Y9HA 3D9BA 4Y34A 1RABB 3O5TB 3GTYX 2R7XA 4DSIA 3M2RA 2DVIA 4PCQA 1TL5A 5F3ZA 5LSRA 4DL7A 3DXBA 2IJFA 5GADU 5F9LA 1GX6A 4MKYA 3OFHA 2N7CA 2RQ4A 1VS3A 3CIZA 3FEZA 1QTNB 4M5NA 2OH2A 1SC6A 2GVZA 4CIOA 4N76A 1RHJB 4A8WA 1SIWB 1KTQA 2FJXA 2DNPA 4F7VA 2IRUA 2XS5A 3ITHA 4ZHRB 2B9EA 3N0VA 4ZVRB 4C8OA 2EW9A 3C19A 1U1NA 4ECRA 5C42A 3C66A 4F3OA 2EFNA 4UUXA 1YJWS 3FUYA 1VRUB 1N34F 1Q5YA 2AZ1A 4W98A 5EDWA 2PEBA 3MMAB 3IRWP 2HFSA 1FJGJ 4RNNA 4LRBA 2ZC3A 2MQQA 4DSEA 3ENAA 2Q43A 3RBZA 1RTDA 2CJQA 3SEOA 2AIRB 2OPRA 4ELUA 1VISA 3P3DA 1JXVA 1KR4A 3JSMB 4PPZA 3G8SA 3BEGB 1GXUA 2OI2A 4NCBA 5D0HA 1YG0A 4LRAA 1LFWA 4AL7A 1Z2LA 2DNZA 1ZZFA 2LA6A 1HBNA 4Q8EA 3L7PA 2MEWA 3KK3B 2KVIA 2XYGB 1YJTA 1N5YB 2AEJA 4IDKA 1HHTP 1IM6A 1O5JA 2JNJA 3DRPB 1OMSA 4C3KA 1UEKA 1NHVA 5AXNA 4KV8A 3MZIA 1RWMB 5IT0A 3CCLS 1VCTA 2DXEA 1T05B 1WDTA 3M6UA 4YHHF 1AROP 5E2QA 4BLGA 2VV5A 1TUGB 4IFVA 5E0OA 3I0RA 2E9ZA 3W63A 2XY5A 3GE9A 2GS8A 3RGIA 1IM4A 3DRSA 4J9RA 2KI2A 2A10A 1WEXA 2LU2A 1N48A 3MM8B 3R5DA 1S9EA 4K4VA 4ZMMA 4ALZA 4JBCA 1FVQA 1IR2A 4F3MA 1GT8A 2CQ0A 1JNZB 4CH0S 1HNWJ 1DQAA 2J8AA 5L8RC 2Z2LA 3M2UA 4W4MA 4NLOA 2KXNB 3O8WA 3FBCA 5CCMA 3ET6B 3VAMA 1N5VA 2WCXA 3JYTB 3CDUA 3NXZA 3CWJA 3PW4A 3LO3A 2EK6A 1JLBB 1IR1A 2HQFA 3K0JA 4M5GA 4DOZA 4JI0F 4O4RA 4G6VB 4RWXA 1N0VC 5DDOC 4AQYJ 4FVCA 3IR5B 3EGNA 4DV5F 2YPYA 2XWXA 3FVYA 5CYMA 3MMCB 1RGVA 4K8RA 4MYUA 2HMIA 1NJZA 4CO5A 4DR5J 1B0VA 3W9HA 5ITHA 2JHEA 4WFYA 2V4JB 1YRXA 2ZFHA 4X62F 3H98A 5CHCB 1TV6B 4DPOA 2VBXA 5CH7B 2VFUA 3DOLB 5K9FA 3ZZYA 2DNOA 3RB6A 1DAXA 3MUTP 1WELA 1JNRB 3PZPA 3RUBL 4XDCA 3IWLA 1HBUB 4IH6A 1RHRB 1NPPA 5F8JA 5AT1B 1QUVA 1WNEA 1HMVB 5D3GA 1UKUA 4WFZA 2R8JA 3BDEA 1YWXA 3RR7A 5GAGI 1U0SA 1T03A 2NS1B 2FB0A 2H5IB 3FDSA 3BR8A 4K4ZA 2QRRA 4TY8B 1B64A 5DG8A 4JI2J 3H5SA 1HWKA 3BGRB 3CCVS 4UOCA 2Z0GA 2RQKA 3AT1B 2OJ3A 3QFHA 1VFJA 1WHVA 4OI1A 2R9LA 5ETOA 4ILMA 4D3GA 1Z4UA 4L75A 3RW7A 2ZBQA 2GIQA 3G82B 3UCGA 2XZWA 3UDEA 2HBZB 4LJMA 1RISA 2C3PA 3QIPB 2RKIA 2ZE2A 4ZDNA 4FZVA 1EETB 4F4KA 1OIAA 4DZ6A 3FSYA 3NOCA 5K14A 1SH0A 5KFHA 1EAYC 4WYLA 1NKBA 1ZA2B 2GAHC 1WHWA 3LPYA 4PG8A 3OXFA 3PYGA 3U1MA 3QBCA 4JI5J 4QPXA 2KVQE 3CULA 1EJ7L 2JX2A 2OHDA 1JLQA 1N0UA 4LIRA 1SJFA 1FRJA 2DT9A 4ECXA 5FIIA 1FNMA 1X5OA 1NBEB 3LWMA 2EFOA 5D4LA 2JVOA 1TU0B 2GVZB 1M5KC 5FLXU 1FDDA 1NH8A 2A6MA 3AQOA 2HLUA 1HWLA 1H2TZ 4OYPA 4C11A 1S4EA 5I3UA 4ZCLA 2DNMA 4AT1B 3ITHB 4FXDA 2OELA 1ZTWA 4KFBB 3G4SS 1VRTB 1Q1KA 3PW2A 3PO5A 2Y1JA 2XLJA 4ZVPB 2YNFA 1Z1ZA 3W2VA 2ZDPA 2FZCB 1ZH5A 2E1RA 2NYHA 1OQ6A 1S1VA 4DR6J 3W1YC 3UFCX 1HI1A 3OTEA 2E5JA 2ZH3A 4OQJA 4IG3B 1LWEA 1LXNA 4LF4F 2UXBF 2WVEA 3G96A 1RTDB 4I2QB 2CPYA 4DS5A 2OPRB 1C1BA 2FZGB 5L1KA 2NXEA 1AUSL 3QZ7A 5T7LA 1UW4A 3A8JA 1AB8A 1DHMA 3TVYA 1NRKA 5JVHQ 1RWXB 2YNGB 3DLGB 1C2PA 3M7VA 5KT3A 1S1TA 2FHJA 1XTZA 4PKDB 3BYPA 3NBPB 3D68A 5FJ4A 1TKXA 3M8RA 4KSEB 1YRUA 2HK3A 2K1RB 2B8PA 5DM7Q 1T9VA 1VQLS 4KV8B 3PJXA 5KG7A 1TTHB 1VQYA 3NGDA 2RRBA 4ED6A 3HT3A 1SJQA 2BE2A 4KGZB 4OYWA 1ZA1B 3R2CJ 4MFBA 2P2CB 4WPAA 3GSIA 3K5OA 4I68A 3CC4S 2H54B 3JS9A 2WSEC 3W8PA 3B78A 2KO1A 3THPA 4KGKA 1HWJA 3SSQA 4QYRA 4KIAA 2XHCA 2B9WA 4ELTA 2D3O1 3PTWA 2HHSA 1VIOA 2V50A 1OYDA 2IAJA 5DQIA 1KLMA 3T6JA 4QWBA 1FF2A 3M8YA 4TN2A 2JFDA 1M5PC 1H74A 5U47A 3T1HJ 4NRTA 2RHQB 2I2YA 5A0YA 1M0SA 1RWWB 1YRTA 3THVA 3HHNB 2RU9A 5KFAA 2VHGA 3E01A 3LW5C 2UXCF 3TZZA 4C8LA 3W5XA 2HEKA 4KC5A 4C2MA 2HHHF 3BO4A 2N4CA 4KKOA 1UPMB 1XC9A 5HK4A 5LMUF 3FSXA 4DU8A 4LFBJ 5J1NA 2R7TA 3GG0A 4JI7J 1U2CA 2DXDA 3OR1A 2MKCA 4B9NA 1K1SA 3HHKA 4DV6J 4K5SA 1Q0NA 3HM9A 2CPDA 2WRMA 2HWIA 2G0IA 5GADI 2XM3A 4QOTA 2NSBA 1RKIA 1Q7YT 1R31A 4B9UA 4U96A 1HNIB 1TL7A 2KJVA 3GPAA 1CJUB 2GGPB 3E8OA 4B3MF 2DEIA 3KLIB 1N88A 2FY8A 2CPJA 4E8UA 1GK8A 3EVMA 2QA1A 4F4ZA 1GQEA 1VYAA 1KLNA 2AKWB 4LF1A 2MLXA 4A8MP 3JSRA 5FD1A 3KJVA 2B3TB 1BMQB 4NLYA 3GZ7A 2BR0A 2DRBA 3BBFA 2AX1A 2ATLA 2DR5A 4FXVA 2OPQB 4IQXA 1FKOA 3ZNJ1 4FF3A 1FERA 1RJJA 4JV5J 2Y1LB 2IYGA 1Q53A 1ZPVA 1NB2A 5M2PA 3I31A 3KXDA 4WU2A 3DLKB 1RHQB 4LQ3A 3GFHA 3EXCX 4NI2A 2RKIB 2ZE2B 5I3QA 4DV4J 1BQNB 5KG4A 5HQLA 2KL8A 2E1CA 4IQMA 5C5JA 2V5HG 2M88A 2RE1A 4RKUC 1TUWA 4TVAB 4QWDA 4DR7F 4KGXB 3KLGA 2QX0A 4A4JA 2UP1A 4B3RJ 4CNYA 1HLWA 4BDPA 1TL3B 3HX9A 5AJ3F 1I3OB 4FS2A 2Z2ZA 6FD1A 1H72C 2DGSA 7FD1A 1M1GA 1C0TA 3HSDA 1NK9A 2XYHB 3HZEA 4Y2AA 3WX8A 4F4AA 1Q4RA 2W9AA 1S76D 1BY9A 2WVDA 4B9LA 3VGSA 3GIRA 4Q45A 4B08A 4DQQA 2XG8A 2DHXA 3OFFA 1I51B 3W2VB 1L5UA 3NGUA 3BH6B 1NNDA 1S1VB 4DUZJ 3CJ2A 3H2UB 2XMWA 4PXCA 4DQPA 5EHHA 1WG4A 3G8QA 2OP5A 1RZMA 4LBHA 4GVBB 3X1LB 1UZDA 4LSLA 1N5QA 3TAQA 3TUIC 4L74A 4PWDA 5D0GA 2QZ8A 3PACA 2BV3A 5T7LB 4O3RA 4NL5A 1BWVA 3NNHA 4U6PA 2EVZA 3I96A 2C2ZB 2MGZA 1VHIA 2CVEA 2ZEJA 2KKHA 2OSQA 3IXQA 4LMZA 3D6MB 2ZITA 3T1AA 1YX2A 2HVHA 2C3OA 2AU0A 1DURA 2W2QP 4CRJA 1AFIA 3HHLA 4IH7A 4LVNP 4EYHB 1S10A 2VPZB 4I0WA 2J76E 2GJIA 1S1WB 3PRDA 3VQTA 3GIIA 1UA1A 1V6HA 4A8QA 4L3KA 5L9NA 3VGUA 1N32J 4ZA1A 3JQJA 5A76A 2ZD1A 1RT4B 2BE2B 4FYDA 1XR6A 2BW2A 1RAIB 1GFWB 4LF9J 2ACYA 5IS2A 2HZVA 1RTZA 2M3DA 3J81j 5KT5A 4BC7A 1N56A 3ILOA 3K8WA 4WFAQ 3BGFA 2HVEA 2MDAA 3ILIA 2ZBPA 2XLKA 5HJXA 1CSJA 2CQBA 1NSPA 4WFNQ 5DETA 4NA1A 3ZZUA 1TVRA 5GAHU 1YDLA 4QYZK 2VA3A 4C7QA 4OYBA 2IAJB 3CJ4A 1Q81T 3QRRA 4WE1A 3E3XA 3CSKA 1YJ9S 1QVFR 4E2FB 4ZIWA 3ZZ0A 1VQ6S 2FHJD 2V2QA 2AJ2A 1AUDA 2HQCA 4WKRA 1X4DA 3PX6A 1MMDA 2AJ0A 4ES2A 2J8SA 1WC4A 5F9NA 3H40A 3IGVA 2VQFF 2FVPA 1CC7A 3NLCA 1SL1A 2IMOA 2HIYA 4M8LA 2WBMA 4KQZA 4IG0B 2KM8B 2W01A 1YI2S 1QSYA 2KZMA 2DY9A 4X4NA 4ZN1A 3BGOP 4CTAA 3B82A 2YX1A 4DR4J 1R8PA 3X3UA 3OR1B 3J7YU 4G1QA 1HFEL 2J9DA 5KFYA 1RAFB 3WQPA 3GQCA 4YY3J 2BVZA 4C0BA 4R5PA 3W64A 3QJJA 1CS4B 1FE4A 1OY8A 2ILZA 4I4BA 2Z57B 3PW7A 5ETLA 3KK1B 2QLBB 1WKKA 2GQCA 3CTRA 2L9NA 1IUJA 2W9CA 2DR7A 2YQ0A 3Q8RB 3TNVA 2DBBA 3W9JA 1FE0A 3SFGA 1T94A 1NPKA 1R6YA 1S1UA 3Q23A 2G13A 1KKHA 3P5BP 1RTHA 3KJVB 3QAEA 2ZM6J 3AXKA 3OPKA 2BJDA 1WHYA 3K2YA 1PBUA 3F44A 1J5OA 1Q7LB 4QR0A 5GMDA 2M7SA 2CQHA 2I5JB 8AT1B 4DL0C 4LF2A 4U7CA 4FP9A 4GVLA 1QTMA 5IC6B 1X4BA 1B7FA 1PJ5A 3FKBA 4LFBF 5DG7A 1D09B 2CVIA 4C6AA 3ETOA 4RW7B 3M30A 4U95A 2RU3A 1HWUA 4ZLPA 1HA1A 1Q86T 1X0FA 1VJQA 2I38A 4EEYA 3A3NB 2JL9A 3KLGB 4HLBA 4FNHA 4K4SA 5C25A 3BZQA 1FX2A 1H6KX 4RW8A 2ACMA 5BR8F 3I5CA 3QO9A 1BLUA 1YJVA 3M8SA 1FFGB 2ASYA 3DOKB 3L9ZA 1FCAA 1C0TB 4HKQA 4LR7A 4F4YA 2VFVA 1FTCA 4HACA 3QPIA 1HI0P 3CJRA 1TKZA 4CCHA 3UD3P 2KZZA 2W2PP 4PRFA 3NS6A 3PNIA 4F0KA 1TL1A 4LRDA 2MHNA 2DGUA 3OL6A 3J81U 2VG6A 1KOOA 3K5NA 1K0VA 4LF7J 1RT3A 2AQ4A 3IN5A 1A6LA 5F8MA 2F63A 5DDRC 5AE3A 4E98A 2ALZA 5KG2A 2QLXA 1U2RA 2CG8A 4DV4F 2QO3A 3EVOA 1V5IB 2CNKB 4J9KA 1S7HA 5IQQA 4ZVHA 2VKZG 1DRZA 3V4IA 2HNZA 1WEYA 2ZHOA 3I9ZA 3I56S 4B9VA 2E5HA 5HVGA 1IVZA 3CJ0A 2AYBA 3EJMA 4FF4A 5A8RB 2W2MP 1G6BA 4PYAA 2OMOA 4PR6A 2VONA 2J9DE 1UPPA 5HP1B 1H7WA 3OTOF 4NZ6A 3LUYA 3VZHA 3MI7X 4ICLA 2LQ9A 4XAKA 1GXLA 5DS7A 3MR7A 2MKHA 3EYZA 1YZ6A 1QUPA 4P72A 1RWPB 1S6PA 4DPXA 1OO0B 5E3RA 4DV1J 4UQGA 2EI5A 4RL1A 1UMJA 3RAMA 3L7UA 1IKVB 2LEBA 1YBTA 2ZBCA 1SQEA 4UY8T 1CC8A 4MK9A 2FY1A 4KO0B 3WC2A 4ELVA 2C1EB 1IBCB 3THTA 1DY3A 5D8HB 3RB3A 2OPSA 3N6NA 5T14A 3M1VA 1Q82T 3UPFA 3CDBA 4DX5A 4Q43A 3GSDA 9RUBA 5BXIA 3GJSB 5CYQB 4X84A 2XMMA 5J1EA 3K89A 3JAMY 4CP5A 4KE5A 4OX8A 3OUYB 3I0SA 3FCVA 3KWMA 1S0OA 4WK3A 3TEGA 1X7VA 4RR5A 3CCUS 2X1FA 1IKWA 2B4UA 4K4WA 3OSNA 4O3QA 3PJWA 1C1CA 3W9IA 3B54A 3DDIA 2AEFA 5KFNA 2AEMA 1XIQA 1XR7A 2YKMA 4G3IA 3ENWA 1A7GE 1E6VB 5KFQA 3QATA 2GHWA 2Z56B 3H20A 1VQ7S 1N6QA 3MCNA 3LTOA 4DPTA 2M2BA 5KG3A 3AOCA 3NAIA 1WOSA 1NSKL 2AGPA 1R8CA 2OGUA 5K5MA 4H4MB 1YIJS 3HHLD 2KYZA 1N32F 5MAOA 3FQLA 1IBKJ 2FYXA 3CXCR 4I6AA 2NXNA 2XZTB 4LF9F 1KFSA 3PKMA 1RADB 1URRA 4DR3J 1QD1A 3PEJA 5B0CA 5DM6Q 2LA4A 1WSVA 3GFZA 1RT6B 5CXTA 4PWWA 3BSNA 2ZOFA 4QYZJ 2CWKA 5H9EJ 2VOPA 5G0RB 5LMNJ 4ITSA 1AFJA 3EZOA 2D74B 4ED1A 1YJRA 3W65A 4PQAA 4R5PB 2YY3A 1B3TA 3MOJB 1SVDA 3M8ZA 4DPWA 2XI3A 1FFSB 4X4RA 3GYXB 1T0TV 2RUSA 3V6JA 1KD1T 4KB7A 4ZP6A 3K5LA 4PXBA 1RWOB 4MK7A 1HHQA 1RA7A 2FJWA 2D41A 4BBYA 1WC5A 3C15B 5HANA 1VK3A 1HL6A 4X4PA 5A8WA 4P2FA 3MEKA 4AL5A 4WZMA 1T9YA 4A8FA 1CULA 1RWKB 4NLDA 4JI4J 1KBRA 2DIVA 3AOBA 3RG6A 2QMWA 3J80Y 2KHCA 2VG7A 4OI6A 3MM5B 2JLEA 3TX0A 2YQ1A 4M95A 5J2PB 3IFEA 1EP4A 3IBWA 2NCKL 4GKJJ 4EBEA 4DR4F 1NPRA 1NJIT 3RAXA 2CQ1A 1F9EB 4DV3F 3M30B 1D8ZA 1YJNS 2KFZA 2WAQD 2IHR1 3ZZTA 1FKPB 1JIHA 4LQ9A 4YY3F 5KTQA 1R8BA 4K4UA 1HBOB 3UVJB 2IBOA 1HYSB 4DUYJ 2JC0A 2C2NA 3CCMS 1GTEA 4Y00A 1SKRA 1CPZA 3C6UB 4V19J 2H48B 3KK2A 3TVKA 5C25B 5F0UA 3OVSA 4RZRA 2FPHX 1XWLA 3W5ZA 3SI8A 3W66A 3SCKE 2SXLA 5HQMA 4PEOA 3DLHA 2Q66A 4HACB 2OD4A 3QGPA 2GA7A 1OWXA 4RWWA 3OV7A 2AYEA 1FK9A 2FGOA 2CA9A 3AA9A 3AFGA 1H3DA 5IM0B 2XS2A 3G2XA 3QLHB 3PM9A 3N6LA 4MKVA 1WACA 4ECYA 3BGUA 2B51A 3ELHA 4F3QA 1RT1B 3QYYA 3ZTRA 3HMJG 3EDQB 5C2GA 1J5EJ 1RLCL 2PI4A 5B09A 3MEDA 3DC2A 1QY7A 1S1XA 2NYIA 4WCEQ 1X60A 2DNQA 2W8LA 3V4IB 1SV5A 3ENVA 2FJVA 3Q0AA 4Q2MA 1UJ5A 5IT9U 3W60A 4N5SA 3MM9B 4DV2F 1VJWA 1U49A 1SKUB 2NQPA 1IN0A 4GKKJ 3D7SB 4N56A 1FT8A 1U26A 3HFZB 1N4LA 4DF4A 5IT9Y 2L9WA 3EX7B 1A0OB 2FQQB 5ETNA 5KFSA 2ATCB 1X5SA 4JYAJ 3RYLA 4OHYA 4NCGA 1UJ4A 5KOWA 3NS7B 3C6TA 3MM6B 4O4GA 4L76A 1UVLA 3WC0A 3CMQA 3PW0A 1XMOJ 2MQPA 4LF7F 3HHEA 2EC2A 3DGPA 3T19A 4B3TJ 2LKZA 3GR0A 4RW4B 4LUBA 4DL3A 1JKHB 4MK8A 3VGVA 2Y8YA 2ZH9A 2BQUA 3M9OB 1T11A 3FMBA 3M1VB 3CJKA 4X66J 2W9BA 1FKAF 3G9CA 3A8KA 3TR5A 2MLYA 2IC3B 3CO9A 3CCES 5DLGA 1REVA 1NHKL 2EC0A 8RUCA 3R3TA 3HULA 4LF6F 2FIUA 5I42A 3I0SB 1X4EA 3HT0A 2HS4A 2ZH1A 2AW0A 3BPDA 4RNFA 1PIEA 3R6GB 4FPRA 1IKWB 2A18A 1H98A 2PIIA 2HWTA 2MKKA 2DPJA 2FTRA 1LKZA 2JLFA 3AD8C 3LAMA 2A2DA 2YKMB 2GHVC 1H73A 4N8NA 3UWTA 4KH1B 3AY0A 1NZ8A 1S6UA 3QGGA 3HDSA 3D3CJ 2H5JB 4OYZA 3OXGA 2NUHA 2FLNA 3ZXWA 1SKSA 1WD6A 4ECVA 3QT7A 2XMAA 1OS5A 5EUHA 2QMXA 4DSKA 5B0AA 4DN9A 1HNXF 1N54B 5J2NA 3PFEA 2XO6A 1QE1A 4LR9A 3W3SA 1JLCA 4M5IA 2V69A 3R97A 3K5MA 1VQ9S 3AAWB 4OYAA 1NM2A 3HKZD 3NGRA 2VU5A 3MECA 1VQMS 1YQHA 3AODA 2RF2A 1WUUA 1VC5A 5LSLA 4GO5X 1U1KA 2EEYA 1CJTA 3M05A 4EWTA 2XCPA 1Y5NB 4DFKA 1HQUA 1U2FA 5LT5A 3CNQP 4JI8F 1VQ8S 4NMXA 2OFGX 2UUBF 4JV2A 3IMQJ 2BANA 4IRKA 2DGQA 2P8IA 1LWFA 3QJPA 2BBEA 1VQPS 4DQSA 2PEHA 4IOBA 1BWEA 3Q8SB 3GJQB 2R42A 2FD2A 4ED5A 4OJHA 4ZOSA 5CQGA 1IBKF 1U6ZA 4LREA 2FHOB 3VCDA 2ZJRQ 1RWUA 2DEJA 1RSCA 2D3ZA 4OHXA 4ZVGA 1F3FA 4Y3CA 3VV2B 1DQ9A 4A8KA 4DFPA 2JSXA 1UVIA 3R1HA 2EBEA 4N47A 4M5HA 1P9YA 1YKWA 4X64J 2X3DA 4P73A 2EG1A 1KQGB 4XPEA 2IVMA 1EP4B 1NSQA 2P9CA 1D9DA 2MYFA 3WDOA 1VIXA 3DM2A 5HROA 4BS2A 1MMNA 2CG4A 1Y7PA 4YQWA 3HVRA 1FHTA 5KT2A 3OJSA 5LSOA 4KJIA 3SBMA 3DYAB 1T9TA 2MKYA 4DQRA 1N34J 2A1BA 4J37A 4W92B 4OI4A 3TZXA 2C42A 1VHFA 2HGMA 3SMZA 1QAXA 3PEHA 2BMBA 1WSRA 2V8GA 3VAJA 3DLJA 5DLFA 3QRPA 5DJBA 4DZDA 2EWHA 4HDHA 4X2BA 4DR2F 1PGZA 1RCOB 4UOFA 1FK9B 2HPUA 2WSCC 2LQ5A 3C16A 1SB6A 4ED7A 1TFYA 4NYOA 1UETA 4WTYA 1N33J 5C24B 1PO6A 4Z2XA 4JV1A 1SL2A 1O6XA 3LALA 3JQKA 4GKJF 2ZC4A 1EX8A 2WHOA 3Q2TC 1SH2A 1WKLA 1NHUA 2GJFA 3OR2A 2EFPA 2GVDB 3DCAA 4TQSA 4OZ3A 4R8UA 2MQ8A 4Y0FA 1SV5B 1VLOA 2KN4A 3IWXA 4DUYF 1WF2A 3TA0A 3IWNC 1WC6A 4JV0A 5G4DA 2R7VA 1K9MT 3TJAA 3HFKA 4A48A 2CJAA 2QA2A 5LOQA 4CO4A 1RLDA 1T9UA 3CB4A 4H4KA 2W8KA 3IG1B 2Z58B 2W25A 5I4MA 2ZBRA 2ZUGA 2NZCA 1NKCA 4NCGB 1YBUA 3O2IA 4NZ7A 5HO4A 3C6TB 2B5JB 2PN6A 5J2QA 1KP6A 4F02A 4CLYA 2MZ1A 3DLEB 1NK7A 1JLGB 4M5KA 3M4XA 1NEEA 3ZC4A 3AH6A 5AXMA 4C8ZA 3ZFVA 3V81B 1OYEA 1SJ1A 4J9VA 1FDNA 2BA9A 1WHXA 2YQ3A 2WB1D 2GMHA 5JMNA 1S0NA 1J5EF 1FXRA 2QL7B 3JSBA 2IY5B 2LDIA 5GVQA 4CI0B 3CJKB 1SJ4P 4JI0J 2VBZA 2FVCA 2GIFA 3CCSS 1BC6A 1IQZA 4LF5F 4GRSA 2IYIA 3PCOB 4NASA 4PABA 3Q8PB 2E1PA 3D6FB 2XMJA 2F40A 1FI4A 3EZUA 4HYKA 3A13A 5CYJA 3KJFB 4OI0A 3LP2A 4V1Ak 2QFJA 2KT5A 2UXDF 1ZM9A 3TO8A 2KG0A 4WWSA 3D28A 4QU6A 2I0XA 3VAHA 2H5EA 4MKBA 2B6AA 1U8SA 4JYAF 1IJEB 3CC2S 2FJAB 1IKXA 2W7OA 1E6YB 2D7SA 3SQGB 1YHQS 3W61A 3C2PA 1QDUB 1BQXA 3PIOQ 1XNQF 2XHWA 2YTCA 4P7TA 4FBUA 4ILLA 3LPEA 4QIWD 3TYTA 4B3TF 3T1YJ 3EZ5A 4QWAA 4DG1A 4J9OA 2AYGA 2APOA 5BYSA 5J2NB 3S01A 4KGVB 1QE1B 4C97A 1FRXA 4NA3A 1JLCB 2GZOA 3TQ1A 1F5BA 1XEZA 2Q1LA 3D3BJ 4DSLA 3NCPA 3MAAA 3F56A 3ICLA 1JLAA 4YR2A 2V63A 3MECB 5THWA 2OIHA 1FJCA 3HSJA 2DR6A 3DMJB 2N3OA 3Q22A 5HLFA 1HPZA 2GMJA 3UI3A 1RWVB 2AX0A 4V19X 4USMA 1KTVA 3LWLA 3MXHP 1JXEA 3TA1A 1LWCB 2XQCA 1NJYA 3BJYA 1T9WA 3ZZZA 2QYCA 1VRQC 4B9MA 3C14A 3MMJA 2Q3PA 1PKUA 3N9UC 3JQMA 4IFYB 2DRDA 1KDNA 4YS2A 3QQCD 4K0KJ 3MM7B 2ZVIA 4YMEA 2BW7A 2QSFA 3K57A 1NMEB 4USUA 2LLZA 2PGCA 5IFMA 2JEFA 4WBFA 3M8PB 3L7OA 3AD9C 3GFYA 3OJUA 3QZ8A 4USJC 4IR1A 2OPPA 1ZAVA 3PXGa 2V8DA 3KFWX 4A8SA 2YNIA 2VPWB 1EKRA 4NE9C 4F50A 2AJ1A 1I6JA 5AXKA 4GC6A 2D3OR 2R8GA 4C8NA 1C0UA 2YKPA 1RACB 3DM2B 4JI1F 1MN7A 3HLUA 1Y11A 1T02A 1ZAXA 3R7SB 3LP1A 1UFKA 1X4HA 3NP5A 5CCLA 5F0WA 2AT1B 5KFFA 4ER8A 3G71S 1Y9OA 4DFMA 3V5RA 1IKYA 2F9JA 3KOAA 1JLEB 3KMQA 5AXLA 3DU5A 3AXMA 2IVYA 3J7ZT 3MUVP 1LK5A 3NWGA 4JP8A 5IT4A 3OBIA 2BKNA 4LF4J 4WIQA 2UXBJ 2F5GA 4DI6A 4R25A 1IR0A 2DJWA 3H59A 2KTQA 5K8NA 1LK7A 3WZ0A 4TY9A 2RMLA 4ECWA 2CPFA 2V6AA 2WVCA 2HKEA 1TL4A 4UOHA 4X64F 1EB0A 1FRHA 1PCAA 3OVAA 3W5YA 3DOMA 1OSCA 1JLFB 3AHPA 4CYUA 2JZ5A 2XY6A 5KFLA 5KFZA 1S0MA 3K58A 2R2UA 2J0QD 5KFJA 3PW5A 2EFQA 3MGJA 3IS9A 3BSOA 2AD9A 2QG9B 3GMGA 2BRLA 3C3LA 2B43A 1BQMA 3GILA 1DTQA 3AD7C 4YN3B 2FC9A 1RHMB 1HD1A 5CD4A 1Q95G 3FZ2A 1WDDA 2AMCB 2RDDA 2CJKA 2CQ3A 4NLVA 3VGTA 1M90T 3SV4A 2VFSA 4YB7A 3MR2A 4ZVOB 3H0PA 1NK6A 3NNAA 5LXRA 3R5JB 4I56A 1UEUA 1I5OB 1LEOA 2M8HA 5J2QB 2UUTA 1UZHA 3D4JA 4ZLLA 1J2VA 4HT5A 1SH3A 2HURA 4CLKA 4TU7A 2HHTA 5B0GA 1CQNA 2ERRA 1N33F 2BJ9A 3FBFA 3CF5Q 2ZBIA 3NGKA 5ETSA 1SC4B 4J5OA 5T41A 2CNNB 3RBXA 3GIKA 4CNZA 1F1BB 4XK8C 1T8EA 3UNYA 3NGSA 2PMWA 4OJ1A 5KFEA 2UXCJ 3FNNA 3VVUA 4Y65A 4YP3A 2VD3A 2HHHJ 2BOPA 4CLSA 4NEYA 3M8WA 3R5GA 2WW8A 4C8MA 1QLNA 2Z2MA 3LP2B 3MHYA 3PHEA 2QL9B 4QU7A 1FD2A 3ULHA 5LMUJ 4QW8A 1SQGA 5KT7A 1VC6A 1SCJB 2B6AB 4K2JA 1IWGA 2NPFA 1V3RA 3AA8A 4TQRA 1IKXB 4I64A 1Q8LA 2B9YA 4HTIA 1WWHA 3M6WA 1PYOB 2C2MB 1KS2A 3G6YA 3HD2A 2BOAA 2PA8D 3TJ8A 3MR6A 1SC3B 4K4TA 4B3SF 1HQEB 3FFIA 2UVVA 4FBTA 5KFKA 1HNVB 4B3MJ 2D69A 3W2WA 4DG1B 2H4YB 4F2SA 1AW0A 4M5DA 1XMQF 2RUGA 5CZVA 1R0AB 4U8YA 3K59A 2FVSA 1K73T 2IM0A 3LP0A 4B9TA 2BUNA 1S9GA 4OX7A 5KOXA 5IOLA 1YJUA 1UWBB 3TRGA 3EPIA 3QRQA 5HLFB 1VBYA 3KJQB 3FGVA 3LA0A 1RAJA 4UT4A 4H4OA 2CQ2A 2K3KA 2E7VA 4WKYA 1NJXA 1RTIA 3BH7B 4ID5B 3MUMP 1HIYA 2ZHBA 5F8HA 1GX5A 1F2HA 4F04B 2F8HA 2UZAA 4PUOA 2HQ3A 4LFAJ 1MROB 3POTA 5DG9A 2XMKA 4A47A 4PQUB 3FCWA 2UUCJ 2WB4A 2NR0A 2KXFA 4F0HA 3V6DA 4L6V3 2AYMA 1I94F 2DYAA 1KHWA 1HD0A 4DR7J 1WOPA 2IRYA 3ADAC 3T1YF 2LFVA 2KHDA 1MU2B 5E33A 4PXDA 1LW0B 3KHRA 2ABYA 2XNRA 2QE5A 5AJ3J 4IYQA 1ZETA 1YBAA 2XCAA 2KFNA 2Y0SD 4C8KA 1S99A 2FHMA 5D4PA 2YNIB 2RB7A 3ZTQA 3FCHA 1Q8BA 2ASJA 2W24A 1FXDA 4I2PA 2I1RA 2AZ3A 2NZ4A 4DCPB 3M2VA 3R7BB 1DLOA 5ETMA 4Q0BB 4LVOP 1Y3JA 3CJSA 4USVA 1CJKB 2KJWA 2K7JA 4OI2A 3CCQS 3J7Z5 4CT9A 4FKXA 2CYYA 3MPWA 1UEVA 2VC1A 1KQSR 3KG1A 2HNYB 2VZ9A 5KT4A 4IO9Q 3VAFA 5KFRA 3MEGA 3PKYA 4DL4A 1UFLA 1R0BG 1JB0C 2PI5A 2BKOA 2OO4A 4LF8J 3DGVA 1ZTTA 1VBXA 1UL3A 2CQDA 1WEZA 4KPYA 4G65A 4H54A 2DB1A 2ASLA 1BGXT 3M2RB 5HVHA 4K0KF 4CO0A 2IM1A 3MPYA 4JB8B 4UTGA 4YDDB 4QWEA 1HNZF 3ZO7A 3D66A 4NPOA 2R2TA 4HDGA 1HBMA 4RW9A 2CADA 3FEXB 1FDAA 4KTQA 2EKNA 1UVMA 3SIPB 2ADCA 2A0FB 1M5OC 3GJTB 2ZJQQ 3UW1A 2LEAA 3DOMB 4KBIA 5IV4A 4ZVSB 3EMTA 2J7KA 4Y2KA 4XIUA 2J9EA 2JWNA 2E5LF 4CO3A 3QGHA 3IAM9 3AB4B 2FLOA 2Z2YB 2CNOB 2CQ4A 4M94A 3KYLA 3CD7A 3I82A 4EK2A 1VK8A 4ES1A 5C42B 4P6QA 2WOMA 3PDNA 4NLPA 1UVNA 2ADBA 1BQMB 1DTQB 3QT6A 2KXHA 3OHBA 3EICA 2LU1A 1OSDA 2CPZA 1FO1A 5J2MA 1GXTA 2R7OA 2J6SA 2L9DA 1Y5IB 2XMTA 2YWKA 2DHGA 2VUGA 4K2XA 1MWZA 3SYZA 4JUZA 2IRXA 5HMZA 1X4AA 3FZBA 1FFWB 2XEXA 2BQ3A 2C2EA 4DR1J 5DRKA 2LYVA 3TUZC 1PC5A 1HBNB 4J91A 2N7YA 1ICEB 3D6TB 3MTKA 2ZDOA 2F1FA 2BJ8A 5E41A 1X5PA 1BE4A 3I55S 2HVIA 4IDKB 3EGVA 2UU9F 3DRYA 3DI6A 5F41A 3N5BA 3LGNA 2P9EA 2YKQA 4F0MA 4ENOA 3OW2R 2VQFJ 4OYOA 4QIEA 3KUHA 4LBIA 1XJWB 4DLEA 2COLA 1Q78A 2RT3A 2DRAA 2HRYA 3U1NA 4IFVB 2G0CA 4K5RA 3I0RB 1NK8A 2YKOA 4DBQA 4DCJB 1VGYA 3DRSB 1TK5A 2EBGA 2OSRA 3U7JA 1VQKS 4OL8A 3GIJA 3SXLA 4ZJOA 1D9AA 1S9EB 1RAGB 3TVZA 5KG6A 3UD4P 3MPDA 4EI2A 2QTWA 4OHWA 4Y2CA 3OD2A 3N01A 5B0BA 2HHVA 1GAOA 3UD5A 1B0TA 1NZAA 3TUJC 3M2UB 1NDLA 4TNOA 2HVDA 1VRUA 2YWFA 3FFIB 2DH8A 3TEHB 4KT0C 3MMAA 1FJEB 1R6VA 1S59A 3PRVA 4LFCJ 3LQVA 4QJVA 2LXUA 3ZZOA 2MZJA 3J7A1 4I6YA 2MSTA 2QA4G 3PV8A 2DNRA 4DU7A 2GQQA 5K8MA 2RNEA 4Q5VA 2RH3A 5EX3A 1S9GB 4IOCQ 3CO0P 2QGFB 2V8PA 2MZSA 5H9FK 5CYMB 2X51A 1XBWA 3ILLA 4EUVA 1R7IA 2JH3A 3PO4A 3HK2A 2HMIB 2ILYA 4OX9F 1CG2A 1V3ZA 2DNLA 2DIUA 4H4OB 3PHTA 4IRDA 2RQCA 1YK9A 4X4VA 1KOHA 4FYWB 3SSSA 2YX4A 3LH2S 3GP9A 2MLZA 3KK3A 3EE3A 3BN7A 2VODA 1X4CA 2IMWP 1RHKB 2RD5C 4A8XA 1UA0A 1W7WA 3B4MA 3DRPA 3IC1A 1IXKA 3V2UC 1YSJA 4X4OA 2K7KA 3T6BA 3UDCA 2BJ7A 5D3GB 4DX7A 1T05A 1TQLA 5KFPA 3UCUP 4HHUA 4ZP8A 4HI1A 1T03B 2GHPA 1NKEA 1SIZA 1YITS 1EQMA 5DZ6A 3PX4A 2B4VA 5BR8J 3ZTSA 2EG2A 4ED4A 1SXLA 2HWHA 4ERDA 4QWCA 4JOUA 4USWA 1VDHA 1VQOS 3MM8A 4I2PB 4OV6A 1NUEA 3TA2A 1DLOB 4ES3A 3K8VA 4X4TA 1G2EA 3IP0A 3OFEA 1N8RT 3FQKA 3GLJA 3P96A 3NGTA 4RJVA 1ITPA 2F7VA 4LFAF 1CLFA 3ET6A 1BD6A 3JYTA 5EN1A 4USTA 2IJNA 5K14B 3KG0A 5KFVA 4WJBA 1TKTA 2UUCF 3H42A 1FNOA 5KFOA 1U8WA 1JLBA 3G87A 4CLTA 2M52A 4QR1A 2V2ZA 3PYDA 2YBVA 1UAWA 3RU0A 1FJ7A 3HP6A 1C4CA 3MMCA 1JLQB 1S4FA 1UJ6A 2R7QA 3KUGA 3FEYB 2G1HA 4RW9B 2VPXB 2VB6A 2V4JA 4WK1A 4PAAA 3ZNUA 2CIMA 2FGCA 3WIVA 1TV6A 3OTOJ 4PPDA 1Y4ZB 2MKJA 1X4GA 4NXNF 3DOLA 2U2FA 4NOHA 4C11B 1NCLA 3A8IA 1L3UA 4ED0A 2DO0A 5I3UB 2RDJA 4EYIB 2MPUA 2YVSA 2Y1RI 4U7UK 1S72S 4J9LA 1HBUA 4IRCA 5KT6A 2YNFB 1VMBA 2X1AA 1T9XA 1C4AA 2KU7A 4NEZA 1HMVA 1P8GA 1S6OA 1Y5LB 4CDIA 4KAIA 1BUXA 4LF8F 3W8GA 3K5PA 4ZK7M 2QFIA 3RB4A 4P71A 3KLHA 3NCQA 5EWFA 1LWEB 5J2MB 4OZ1A 4TY8A 2IIHA 2Y8WA 3BGRA 4MTPA 2AJ4A 2J0SD 5D78A 1C1BB 1RAAB 4ZP7A 1W26A 1H38A 2DNHA 4HH1A 4IO1A 2MQOA 3HVTA 4UF4A 1TK8A 1TR0A 2CDQA 3G82A 1T95A 4K59A 1S1TB 3LOUA 3R1LA 1TKXB 3G86A 2XMVA 1U1MA 1KNZA 2VFRA 2F65A 3QIPA 1JQGA 4KYZA 5EX0A 1EETA 2VFTA 2H51B 1JJ4A 2KDOA 2C2OB 1F0XA 3DI6B 4CLPA 3CPWR 4NYPA 2F4VF 3NEKA 3LANA 2EXUA 4J7CA 4O44A 4N8OA 1XNRF 4Z7YA 2EK1A 4ZPTR 4Q7AA 1U0HA 3FRYA 2NXJA 2WZ1A 2VIHA 1P6TA 4D3HA 4MFBB 2HHPA 4OHVA 3EGZA 1WORA 1OQ3A 4TXSA 1F5AA 4WU3A 4YR3A 4R0EA 1PJ6A 4GC7A 3VAKA 2ZH7A 2C28A 1RBLA 3K17A 3HHDA 3VF0B 1O0PA 3MD1A 3KHLA 2G9OA 3A4TA 4X65F 1S48A 2IM2A 1ZS6A 4B17A 4ZP9A 1JWWA 1JXLA 4EGLA 4RBVA 3N6MA
chains in the Genus database with same CATH topology
4WP3A 3G82A 5IV3A 3C15A 4OYPA 1CJTA 5D0GA 1TL7A 4OYOA 1CJUB 4CLLA 4CM0A 1YBTA 4USWA 1WC1A 4OZ2A 2GVDB 3G82B 1WC5A 4OZ3A 3C15B 4CLUA 2QV6A 1CJTB 1FX4A 3MAAA 1TL7B 4P2FA 1AZSB 5D0EA 1CS4A 1CULA 1CJVB 4OYXA 4CLKA 4P2MA 1WC6A 4CM2A 1YK9A 4CLPA 3MAAB 4OYBA 5D0RA 4WP8A 1CS4B 1CULB 4OYWA 5D0HA 1Y10A 4OYZA 1U0HA 4WPAA 3ET6A 1Y11A 2WZ1A 2GVZA 4USTA 1FX2A 3UVJA 3ET6B 1WC4A 4CLZA 4CLTA 1YBUA 1CJKA 4CLFA 4WP9A 5IV4A 4NI2A 1WC0A 4CLSA 3UVJB 1AB8A 3MR7A 3C16A 3C14A 3R5GA 1AZSA 4USVA 4CLYA 1CJKB 4OYMA 1CJVA 4OYAA 4P2XA 1WC3A 1U0HB 4CLWA 4NI2B 2W01A 5D15A 2GVZB 4OYIA 1CJUA 2BW7A 3C16B 3C14B 2GVDA 4USUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WP3 A;  3G82 A;  5IV3 A;  3C15 A;  4OYP A;  1CJT A;  5D0G A;  1TL7 A;  4OYO A;  1CJU B;  4CLL A;  4CM0 A;  1YBT A;  4USW A;  1WC1 A;  4OZ2 A;  2GVD B;  3G82 B;  1WC5 A;  4OZ3 A;  3C15 B;  4CLU A;  2QV6 A;  1CJT B;  1FX4 A;  3MAA A;  1TL7 B;  4P2F A;  1AZS B;  5D0E A;  1CS4 A;  1CUL A;  1CJV B;  4OYX A;  4CLK A;  4P2M A;  1WC6 A;  4CM2 A;  1YK9 A;  4CLP A;  3MAA B;  4OYB A;  5D0R A;  4WP8 A;  1CS4 B;  1CUL B;  4OYW A;  5D0H A;  1Y10 A;  4OYZ A;  1U0H A;  4WPA A;  3ET6 A;  1Y11 A;  2WZ1 A;  2GVZ A;  4UST A;  1FX2 A;  3UVJ A;  3ET6 B;  1WC4 A;  4CLZ A;  4CLT A;  1YBU A;  1CJK A;  4CLF A;  4WP9 A;  5IV4 A;  4NI2 A;  1WC0 A;  4CLS A;  3UVJ B;  1AB8 A;  3MR7 A;  3C16 A;  3C14 A;  3R5G A;  1AZS A;  4USV A;  4CLY A;  1CJK B;  4OYM A;  1CJV A;  4OYA A;  4P2X A;  1WC3 A;  1U0H B;  4CLW A;  4NI2 B;  2W01 A;  5D15 A;  2GVZ B;  4OYI A;  1CJU A;  2BW7 A;  3C16 B;  3C14 B;  2GVD A;  4USU A; 
#chains in the Genus database with same CATH topology
 5IV3 A;  4IUF A;  4F26 A;  4KFB A;  4DR1 F;  1VRT A;  2UVW A;  1UVK A;  3RZA A;  2MQL A;  2BDP A;  4CM0 A;  4EZ6 A;  1JK9 B;  1KLM B;  3JB9 k;  1VQS A;  1VC0 A;  4OYX A;  1KQK A;  2VC0 A;  4ZPC A;  2A2C A;  4B3O A;  4U8V A;  5SUH A;  5A0Y B;  4HEA 9;  3F41 A;  4ETZ A;  4R0J A;  4IG3 A;  3R5C A;  4NLT A;  4FDF A;  4I2Q A;  5E3Q A;  3NG8 A;  1B0P A;  4OZ0 A;  1ROF A;  3E01 B;  3VHQ A;  1TMM A;  4ZVE A;  3QMQ A;  4ANC A;  1V9O A;  4PWU A;  3PR4 A;  3EDR B;  2BE7 D;  5L38 A;  2LP4 A;  3NCR A;  4FF2 A;  2FHK A;  1M5H A;  2OLW A;  2PO4 A;  4FPI A;  4AND A;  4KKO B;  2IJR A;  1U4B A;  2YNG A;  3DLG A;  3KDO A;  1RCX B;  1ZOT A;  4MT1 A;  4RO0 A;  3NBP A;  4YEA A;  4OLP A;  2M9K A;  5E3C A;  1FWL A;  5KG0 A;  4X4U A;  2FVQ A;  4RNO A;  4TYB A;  1FTR A;  4KHP F;  1ZBT A;  4DV3 J;  2UUA F;  4QZV B;  3SQO P;  2FZK B;  2XNQ A;  2K1R A;  4LRF A;  4LRC A;  4OMF G;  1VLY A;  1OPI A;  2DR9 A;  1KVI A;  3CCR S;  4DV0 J;  2P6T A;  4CQ1 A;  4NLW A;  3GV7 B;  3UE2 A;  2F9D A;  4RNM A;  1TL7 B;  3PFO A;  1N36 F;  5B0F A;  4LFC F;  5JUM A;  2JEJ A;  3OLA A;  5FDL A;  5H9F J;  2HBY B;  3VVT A;  3CD5 A;  5CA5 A;  3CD0 A;  4M5J A;  2ROP A;  2RS8 A;  4ZCM A;  2H3E B;  3DRR A;  1U1O A;  2AGO A;  2ZH8 A;  5DQG A;  2QSW A;  1YVF A;  1M5S A;  2R4F A;  3BM7 A;  3US5 A;  1FRM A;  3H2V E;  4YFU A;  3T41 A;  3MR5 A;  1FKO B;  4FNI A;  2NPI A;  2IVF B;  4YUD A;  3FMW A;  3TW0 A;  5GAE U;  3MCS A;  1AZS A;  4UZB A;  1AT1 B;  3U1L A;  1RP5 A;  3GR1 A;  4UQT A;  3Q86 A;  2XBP A;  4NI2 B;  3RBD A;  5LL6 d;  3CJQ A;  3R8Y A;  1HWI A;  3CCJ S;  3MAH A;  2RJZ A;  1PJ7 A;  3HCX A;  1TKT B;  4PG4 A;  4CO2 A;  2ZH5 A;  2HFN A;  2IM3 A;  4M63 A;  4NML A;  4UOG A;  1P1T A;  2HW3 A;  1GTH A;  4RUC A;  2RS2 A;  4DV2 J;  2VPY B;  1NO8 A;  1SL0 A;  3T5L A;  3BKF A;  4DV7 J;  5DGA A;  2JRS A;  1L3K A;  2OEM A;  1H7X A;  5F8G A;  1VQN S;  2HSE B;  2Z8Q A;  4IH5 A;  2UVU A;  1R89 A;  3IBC B;  3IA0 A;  4LBP A;  1PAU B;  4P10 A;  3D67 A;  4RU9 A;  3FJ2 A;  4P7V A;  3N5F A;  2BKP A;  3D6H B;  2W2N P;  2CUY A;  1IBM J;  1S7I A;  3DKD A;  1S6Q A;  4HH0 A;  3MD3 A;  1N52 B;  3DDK A;  2DNN A;  1APS A;  2DD8 S;  4CLW A;  5ETP A;  1XER A;  3Q83 A;  1HNI A;  2GJ2 A;  1CJU A;  2GGP A;  2V8H A;  2DNY A;  3Q8Y A;  2IBK A;  2JJ4 D;  2DGW A;  4DHV A;  2CQP A;  2G0J A;  3KLI A;  5I3P A;  3KLH B;  2XWY A;  3SCL E;  4LSL B;  4OZL A;  3VZI A;  1EKS A;  4DPU A;  4KPC A;  2XSF A;  3PR5 B;  2H65 B;  3DRX A;  4PWD B;  2H1Y A;  2MJN A;  1SC1 B;  2HYI B;  5DDP C;  3TX8 A;  2VH7 A;  8ATC B;  3VAG A;  1QAJ A;  4LF6 J;  3NAH A;  2HBQ B;  2L08 A;  3R9L A;  3HVT B;  2MGZ B;  5HQ8 A;  3TUP A;  5D4N A;  2OPQ A;  2MQM A;  3P45 B;  4AD6 A;  2XS7 A;  1NK0 A;  5B0D A;  4WFB Q;  4ZPW R;  3DLK A;  2HRT A;  2QN6 B;  4ED8 A;  4CO1 A;  2LEC A;  3HHL B;  1QSS A;  4F25 A;  1BQN A;  1NJW A;  1S57 A;  2RIL A;  3TAR A;  3SV3 A;  3TAN A;  3KMS A;  1GH8 A;  1RAH B;  4O44 B;  4UW2 A;  1QSL A;  1WOO A;  3OL8 A;  2UUW A;  2JEI A;  1CJV A;  2GC8 A;  1U0H B;  1KC8 T;  2QL5 B;  4DUT A;  2ZD1 B;  5A6P A;  4ILR A;  1PAE X;  2BM1 A;  1RT5 A;  1HNX J;  1TL3 A;  2X1G A;  4MMO A;  2CJB A;  2V4R A;  2JVR A;  1NSA A;  2L41 A;  4O0I A;  2W4P A;  3JAM U;  3W7B A;  4BWJ A;  4RUH A;  4CLU A;  1IJF B;  3BQ2 A;  2GFF A;  3H4D A;  1Y00 A;  4CT8 A;  4C0O C;  1XMB A;  4KH0 B;  2YWG A;  3KHG A;  2OTL S;  3OLB A;  1F6T A;  2BYC A;  2X7I A;  1MNE A;  3UN5 A;  1TZ0 A;  2CPE A;  1FRK A;  5D0R A;  4Q8F A;  2LXI A;  2O1P A;  1TVR B;  3SCJ E;  2M70 A;  3RJM B;  5FLX Y;  4RUA A;  5HMY A;  4JI8 J;  2MQN A;  2CZV C;  2XC9 A;  3H8Y A;  2UUB J;  4USK A;  1DTT A;  1M5V C;  4WE1 B;  2HRU A;  4FXW A;  3MAQ A;  2DR8 A;  4B3O B;  2V94 A;  4GVB A;  2KFY A;  3K7R A;  5KFW A;  2QLF B;  2VDH A;  1FXL A;  1UP1 A;  2K3I A;  1OJ4 A;  3DU6 A;  2IA6 A;  3LF0 A;  1N5S A;  2ZWP A;  2DKO B;  1GMU A;  2Z30 B;  5KG1 A;  1KWM A;  4Y28 C;  1SBR A;  4ECU A;  4CTA B;  3Q2S C;  4MYT A;  2ZNZ A;  3HZG A;  2QV6 A;  1EHW A;  4OX6 A;  3F0N A;  2LEP A;  1PYS B;  5E3A A;  3BO3 A;  1LQ9 A;  1KN6 A;  5KFX A;  4G1Q B;  4ZPB A;  1S1W A;  2D9P A;  2FC8 A;  2FJB B;  3VWS A;  4USI A;  5HVF A;  1S0V A;  3G8T A;  2MZR A;  3IRX A;  2H4W B;  1Y0H A;  1RT4 A;  3S6E A;  2DPI A;  5ETT A;  4PG5 A;  3HKW A;  2W9C B;  1FJG F;  2XYP B;  4Z7C A;  5FDL B;  2HFO A;  3VR1 A;  4WII A;  3GCW P;  1V3S A;  2DIS A;  3DRR B;  1Q79 A;  1S1U B;  3IBF B;  2HG4 A;  4MJK A;  3J80 U;  1NB7 A;  1RTH B;  3H5X A;  5D15 A;  3HJF A;  5JVG Q;  2V9W A;  3GCX P;  3N4W A;  3SDE A;  4DR2 J;  3EXY A;  3U02 A;  1U1L A;  2HHW A;  1R27 B;  1J5O B;  4UUW A;  5ETQ A;  2PE8 A;  1DFD A;  3FBB A;  2VAS A;  2J0X A;  1MWY A;  2XZD B;  1VBK A;  5F8N A;  1S77 D;  1AZS B;  4K50 A;  4O3O A;  4P2M A;  3H4B A;  3BF4 A;  4C4W A;  2J6U A;  3PJ9 A;  1WI8 A;  2E66 A;  2C2R A;  4X4Q A;  3GB0 A;  2HFU A;  2OEK A;  3ISN C;  1S79 A;  4L72 B;  1NDC A;  2B4O A;  5C2C A;  4DV0 F;  3AJD A;  3EWG A;  3IR6 B;  3ILJ A;  1RTJ A;  1LWX A;  4U67 Q;  4QW9 A;  4O23 A;  3MPV A;  4P75 A;  1ULR A;  1F9H A;  5SZT A;  3LGM A;  1J27 A;  4CH7 A;  3FSI A;  4RW8 B;  2HHU A;  2DTJ A;  3D0I E;  1P27 B;  4IG0 A;  2KRB A;  3QO9 B;  3S8S A;  2DHS A;  2VA2 A;  4DSF A;  1SI9 A;  4CH1 A;  3LAK A;  5IQ6 A;  1FRL A;  2LXF A;  3P8B B;  1TKZ B;  2E7X A;  4J9U E;  2D3U A;  3G6E S;  5GME A;  2E5G A;  1TL1 B;  4BC9 A;  2JOQ A;  3PRB A;  2VG6 B;  1SUQ A;  1NDK A;  4ZPV R;  4JI6 J;  3CDW A;  1RT3 B;  4MAK A;  1S6Q B;  2CZ9 A;  1HNW F;  1CS4 A;  2MY7 A;  2CQC A;  4TU8 A;  5IWA J;  4ZIT A;  1B7Y B;  1NAQ A;  3KK1 A;  3CVK A;  2YWE A;  2AF6 A;  3DXS X;  4GO7 X;  2YX7 A;  4FF1 A;  1ZM2 A;  3QWU A;  1FDB A;  4F36 A;  4NXM J;  5ETR A;  3NMR A;  3UR3 C;  4DN0 A;  2V2K A;  4LF5 J;  3CMA S;  3HFV A;  1ZM4 A;  2HNZ B;  4AQY F;  1GMW A;  1X9W A;  3CW2 C;  3DNC A;  1W25 A;  2U1A A;  3VQS A;  5HN0 A;  2GNK A;  4F67 A;  2C22 A;  4DR5 F;  4NLU A;  2ZJP Q;  2GV1 A;  4DV7 F;  2ZOG A;  2UXD J;  4DL5 A;  3T9N A;  2I5J A;  4P2X A;  4ICL B;  2K8G A;  3P6Y C;  4UY8 5;  3QT8 A;  1RDR A;  2OD6 A;  2C3U A;  1MWQ A;  1D0E A;  3ZZR A;  4RW7 A;  1S6P B;  1G4C A;  2BJ1 A;  1ELO A;  2CPI A;  3TOQ A;  2V2V A;  3NWR A;  1XNQ J;  1IBM F;  1YLX A;  2E1M C;  1REG X;  2M4M A;  3M9M B;  5A2Q U;  1CJV B;  3RW6 A;  4QIV A;  5DZ7 A;  3DLB A;  1H2V Z;  3HXM A;  1S9F A;  1RT5 B;  5KAK A;  2KT2 A;  2KRR A;  1O51 A;  2AJQ A;  5A2Q Y;  2OPS B;  3ZTO A;  1QVG R;  4J9P A;  1UTA A;  4AL6 A;  6FDR A;  3V6H A;  5CAA A;  1HHS A;  4LIW A;  1ZAW A;  3DOK A;  4JI2 F;  1D9F A;  2RHS B;  2CXE A;  3MFI A;  2JC1 A;  2K06 A;  5J1E B;  2DK2 A;  2XGP A;  2CJ9 A;  1NK5 A;  1URN A;  3BSA A;  3OTC A;  1TMJ A;  2DCU B;  3TP2 A;  2Z4P A;  1PYT A;  1B70 B;  2E44 A;  2MZQ A;  4ZCI A;  5DGB A;  1C1C B;  1DTT B;  3TAM A;  1HW9 A;  4ZJQ A;  2QA4 S;  2YPZ A;  1RHU B;  4H4K C;  3Q24 A;  5HBM A;  3RRG A;  5KFC A;  2ZKU A;  1N6Q B;  4YOE A;  4DS4 A;  3MPU B;  2NLW A;  2DCL A;  3SCI E;  4OJ3 A;  3KKF A;  3UDV A;  1K0T A;  1PBA A;  5L9X A;  3M9N B;  4JI5 F;  2FDN A;  2R8H A;  2I8E A;  2RSQ A;  4AXI A;  2A3J A;  3CE8 A;  3AB2 B;  4KHR A;  3B6B A;  5GAE I;  2HND A;  3WIU A;  5A8R A;  1IQT A;  3OL9 A;  4P52 A;  2PA3 A;  2CJY B;  2NRE A;  1JMT A;  2CFX A;  5HP1 A;  3MFH A;  2JLG A;  4C98 A;  4WFX A;  4AE5 A;  3CCW A;  5F8I A;  2XB2 D;  4OZJ A;  1LXJ A;  2GCF A;  2QYG A;  1RT2 A;  2VL1 A;  4JI1 J;  3M32 A;  3OQ2 A;  1RE1 B;  4DLG A;  3CDE A;  1IKV A;  2CPH A;  2IDE A;  3IRX B;  2ZHA A;  2B4P A;  1K44 A;  2OTJ S;  3O3L A;  4DR6 F;  2YH1 A;  4KO0 A;  1AYE A;  3OXL A;  2LCW A;  4P9S A;  2RIJ A;  1EIY B;  4Q2L A;  2FLL A;  4X4S A;  5L1L A;  1RU2 A;  4URG A;  4DEZ A;  3DFE A;  3UN3 A;  2QMU B;  4M5L A;  2DGX A;  3BRE A;  5A8W B;  3BS9 A;  5CYQ A;  1XN9 A;  2GO8 A;  1CUL B;  3R5A A;  3SDE B;  1Y10 A;  3BKU A;  5L1J A;  4OLO A;  3OUY A;  4ZIV A;  1SJ3 P;  3DDN A;  2QLJ B;  4QIF A;  2VG7 B;  3WX4 A;  4WTO B;  1RT7 A;  3S1T A;  1YTY A;  2GIR A;  5H9E K;  3KHH A;  2GX8 A;  3M6V A;  3BO2 A;  2HS3 A;  4N7T A;  3H90 A;  3PIP Q;  1RAO A;  2IFX A;  1E6V A;  2R2R A;  2VJV A;  2FUG 9;  3BDP A;  3VTI A;  2RAQ A;  3B8H A;  3OTD A;  3BSC A;  2XGQ A;  3EVW A;  4OYI A;  2HGN A;  4H4M A;  3EPG A;  1RTJ B;  4KRW A;  1HW8 A;  1GEH A;  1DZ5 A;  3QNW B;  4LT6 A;  3KK2 B;  4QQB A;  1K8A T;  3QID A;  1D3W A;  2WVB A;  3NOG A;  2P9G A;  4YB1 P;  1FES A;  1IWA A;  2B56 A;  1DQ8 A;  1RT6 A;  4KHM A;  4O3N A;  2C3M A;  2V34 A;  2RRN A;  5G0R A;  2DGO A;  2F8E X;  5L39 A;  4ZPD A;  4ANE A;  1SUQ B;  2PDA A;  1WTF A;  4TLQ A;  1U1P A;  2BQR A;  2D9O A;  3R27 A;  4U9R A;  2G1D A;  2Y0B B;  4BWM A;  5HJY A;  4WP9 A;  3IO1 A;  1VBZ A;  3MED B;  3T1H F;  4Y2M A;  3HI9 A;  1S1X B;  1DBD A;  4EBD A;  4MIA A;  4Y6I A;  2B7B B;  3QSY B;  2PT0 A;  4URS A;  1GNK A;  5KFG A;  1K47 A;  3P49 B;  2M0G B;  1P1L A;  2CWX A;  4HVZ A;  3C15 A;  3GIM A;  2Q6C A;  1LOU A;  3R2D J;  3UDL A;  4LSZ B;  2O66 A;  4KR0 B;  1NU4 A;  5A6W A;  3LGH A;  4HR2 A;  4ED2 A;  2QJ3 A;  4PG6 A;  2PMZ D;  4TLR A;  2PFF B;  3MM5 A;  2N3L A;  4ECZ A;  3BQ1 A;  2QEX S;  1OY6 A;  2XUL A;  3HJV A;  4FYV B;  1GMV A;  5J2P A;  1SJR A;  2E9R X;  2B8Q A;  2ZVS A;  4JI7 F;  4WZQ A;  4O4G B;  3QT5 A;  4DV6 F;  3H2L A;  3TI0 A;  1FD8 A;  1FKP A;  2AHO B;  2AGQ A;  4JI6 F;  4HI2 A;  1T3N A;  2AWZ A;  1HBO A;  3DGP B;  3UVJ A;  1HYS A;  5KFD A;  4B3S J;  4CLZ A;  3ETM A;  5IWA F;  3JSY A;  1MSW D;  4OV1 A;  4QCL A;  3C6U A;  3HSG A;  1FVS A;  1XMQ J;  5ADZ A;  2B7C B;  2W9B B;  4NXM F;  3NMA A;  2J6T A;  4P74 A;  4WF9 Q;  3V6K A;  3AJ2 A;  4AXJ A;  2WVF A;  1RBA A;  3A3P B;  1REV B;  4CWB A;  3NL0 A;  3MR3 A;  2VF3 A;  5K20 B;  2D1C A;  2GAG C;  1UFW A;  5I42 B;  1Z2Z A;  2VG5 A;  1GMW D;  2CZ4 A;  4QPT A;  2X3G A;  1U1R A;  2CQI A;  3UQS A;  4JV5 F;  1RXO B;  2HQG A;  3B4D A;  5IM0 A;  1SPB P;  4YB5 A;  3QLH A;  2GW8 A;  4TYA A;  3TAM B;  4G1P A;  4XPC A;  4NA2 A;  1WTB A;  3TJ9 A;  3J81 Y;  1RT1 A;  5HBM B;  2MHE A;  2FLP A;  2HHX A;  1LNQ A;  1R3N A;  4HTJ A;  3ZZP A;  4W90 B;  1RUS A;  1I94 J;  3IR7 B;  1KEK A;  1XK8 A;  2ZWO A;  2VIC A;  2WW4 A;  3RB0 A;  1RAE B;  3MM9 A;  5K8O A;  3D2W A;  3IGN A;  2J7U A;  1S5Z A;  4B3R F;  2HND B;  3SFU A;  3I87 A;  4EFA C;  3T9Z A;  2LDY A;  2YH0 A;  1WG5 A;  3OFG A;  5F3T A;  1HKA A;  3PX0 A;  1Q8K A;  2C3Y A;  3MUR P;  2DHA A;  4Y2I A;  1R0C B;  3CGI A;  2RF2 B;  1WF1 A;  2CAJ A;  1RT2 B;  4CLL A;  2YWW A;  4A46 A;  3M32 B;  1F9F A;  3MM6 A;  1CJT B;  4EU0 A;  1HQU B;  2Q6B A;  4I1T A;  3NRB A;  3KJN B;  3RTV A;  2C2K B;  3L4B C;  5KFM A;  2BM0 A;  3O1L A;  3KDN A;  2HIQ A;  2BAN B;  4ATN A;  2R8I A;  4DUZ F;  3GG1 A;  4MIW A;  4RW4 A;  2HBR B;  1JKH A;  3M8Q A;  4NCA A;  1LWF B;  3VAL A;  2PMH A;  5AE1 A;  2O3D A;  5BYQ A;  3E2E A;  1G7C B;  4HHJ A;  3MEE A;  3CJ5 A;  2IC3 A;  4FVM A;  1KSP A;  2N4D A;  5B08 A;  4ZLJ A;  1V5V A;  2DNG A;  1HNZ J;  1U48 A;  1JJ2 R;  1WC0 A;  4DX8 H;  3P5T L;  2ZZM A;  4FS1 A;  2W1B A;  5D77 A;  3P4U B;  3S7R A;  4KY3 A;  1X31 C;  1RT7 B;  5LJ5 Y;  2VQE J;  5CZX A;  2QC3 A;  1H0H B;  1LFP A;  1TKD A;  4A8O A;  4YDX A;  1WC1 A;  2E5L J;  4ZVT B;  5HRO B;  1BHN A;  5C7P A;  3KG4 A;  4L73 A;  2ZNY A;  1L3V A;  5CAB A;  3HVA A;  3GYN A;  2CRL A;  4EO6 A;  2HS0 A;  3M6X A;  2ZZN A;  2RDI A;  2EPI A;  2W4D A;  4FYY B;  1S97 A;  2MZT A;  4RU2 A;  2VBY A;  3C8Y A;  3ONQ A;  4AYB D;  1LW2 A;  2E5I A;  2KG1 A;  4PYD A;  1KRP A;  3JTO A;  2R3V A;  3CDA A;  3HD1 A;  4ZN3 A;  3FBE A;  1U24 A;  4ZVU B;  5A8K A;  4OZ5 A;  2B0G A;  5IZH A;  4RW6 A;  2NSC A;  3WBZ A;  3GV8 B;  3JXO A;  4DFJ A;  1HR0 J;  3QSI A;  2MSS A;  2V9K A;  1KVK A;  4YB6 A;  4LR8 A;  3TWZ A;  4J9N A;  3C16 B;  1XQI A;  1PG5 B;  3UO0 A;  5JJB A;  4ECS A;  1WG1 A;  3N28 A;  4I7F A;  1D1U A;  1VQ4 S;  4MIB A;  3D5M A;  4DDF A;  4EO8 A;  3CED A;  1ZZN A;  3GU0 A;  3AQP A;  1T7P A;  2MKI A;  2UU9 J;  4OZN A;  3Q8U A;  3OR2 B;  1TUV A;  1W2I A;  3BQ0 A;  2VKR A;  4R8U B;  4QIG A;  2WK4 A;  2P5V A;  3MDF A;  3J7A N;  1IBL J;  3UNG C;  3ENQ A;  4UZC A;  3MCO A;  4CZC A;  5DO2 A;  2QLW A;  2YWH A;  4NLX A;  2JEG A;  2ZUA A;  2LMI A;  4BCA A;  2VOO A;  5RUB A;  2OAU A;  2OKQ A;  3BKT A;  4DPY A;  3EM1 A;  3GFX A;  4C9D A;  1R43 A;  1ACM B;  4AUK A;  1Q16 B;  3DN9 A;  2LQ8 A;  3A8E A;  4N77 A;  2RQM A;  4FKY A;  2MB0 B;  1FRI A;  1ZPW X;  2BJE A;  1WF0 A;  3U27 A;  1QAI A;  2DIT A;  3IM8 A;  2HAF A;  4WP3 A;  4LSN A;  5KFB A;  3EUN A;  3DYA A;  3L95 X;  3D0G E;  2EFV A;  3CJ3 A;  1U02 A;  2BRK A;  5IXU A;  4MH8 A;  2ASD A;  3QWP A;  1YJ7 A;  5D0E A;  2F4F A;  3KUE A;  1W2B R;  4F2R A;  4QR2 A;  4PG7 A;  1UWA A;  4K7Q A;  4N41 A;  4RUB A;  3DHX A;  2R7R A;  2Y1I A;  4OFZ A;  4P2S A;  2YNH A;  2WON A;  1AA1 B;  2K2P A;  5DDQ C;  1FNX H;  2W2O P;  2Q79 A;  4DCO B;  2E7W A;  3I5A A;  3SZ2 A;  2ZM6 F;  4OX9 J;  4DF8 A;  4EBC A;  4DX6 A;  4M1K A;  1AXQ A;  2BX6 A;  3KLV A;  2ZZT A;  2CKW A;  2XSJ A;  3PG9 A;  3CT9 A;  2HFV A;  2VG5 B;  3QFW A;  3I4P A;  3IM9 A;  4ZKA A;  2G2O A;  2YKN A;  1RK8 A;  5E7O B;  3IAS 9;  5C24 A;  2XLI A;  3UR0 A;  2HQD A;  3MTJ A;  4B9S A;  2PFD A;  5MLC V;  2G2Z A;  3T5K A;  4FYX B;  3NS5 A;  1M1H A;  2NXU A;  4PZV A;  2GVD A;  1RQ0 A;  2DGV A;  2PD1 A;  3T5J A;  2G2Y A;  1K1Q A;  2J0W A;  3D1H A;  4QBU A;  1Y3K A;  1U6F A;  1PC4 A;  5GAH I;  1CQM A;  2BZ2 A;  3JTP A;  2V4Q A;  1DJ0 A;  2NUU G;  4E0D A;  2OUG A;  3G6V A;  4NLS A;  3MAA B;  1X9M A;  3IG1 A;  1JLA B;  5B7W A;  4A8Y A;  1P9Q C;  3FRZ A;  1X5T A;  2R7W A;  1OY9 A;  2KT3 A;  4NLQ A;  2B5J A;  2A6O A;  1HPZ B;  3Q89 A;  1VR6 A;  3CJ8 A;  2RRA A;  3DLE A;  4RNH A;  1JLG A;  2M8D B;  2FVR A;  4G1I A;  3V81 A;  1L3T A;  3TAP A;  5ETV A;  1R8A A;  1ZM3 A;  4O3P A;  2DH9 A;  2VBW A;  3M8Q B;  3R6L B;  3C14 B;  4B02 A;  2F3J A;  3UN2 A;  1CVJ A;  1TEL A;  3MEE B;  1YZ7 A;  3J7Y I;  1B99 A;  2R2S A;  1JJC B;  3KLF A;  5LJ3 Y;  4L3N A;  3BB5 A;  1A9N B;  2J7W A;  2RVJ A;  5D6G A;  4JI3 J;  3C46 A;  1G1X A;  2OPP B;  1U1Q A;  5H1S V;  3TZY A;  4DSJ A;  1Q5V A;  4NXN J;  1N5T A;  2B9X A;  3QJL A;  1U45 A;  4FN5 A;  2FJE B;  5KFI A;  5KFU A;  3KLE A;  4O0N A;  2UV8 A;  4Z37 A;  1C0U B;  4OI3 A;  3RRH A;  3GWC A;  1QAY A;  1ZYQ A;  5AE2 A;  1E6Y A;  1YGY A;  3VAI A;  3SQG A;  4DV1 F;  1HI8 A;  3LP1 B;  2MY8 A;  3ZTP A;  2W7A A;  4CLF A;  1MG7 A;  3I4H X;  2XY7 A;  4NYZ A;  3MMB A;  2IA0 A;  2W4C A;  3RRK A;  1CBK A;  7FDR A;  5HAT A;  2AV5 A;  2CJX B;  1IKY B;  1PIL A;  1U25 A;  2KM8 C;  5M2R A;  3BN4 A;  5K8P A;  5J1P A;  4K4Y A;  4RLE A;  2BXJ A;  5BYR A;  1RWN B;  4ECT A;  1LW2 B;  2CNL B;  2I9S A;  3GON A;  1RKJ A;  2HQI A;  3PYE A;  3R5B A;  4TKT A;  2ROG A;  4ZJL A;  4IKA A;  5CD4 H;  1O8B A;  5A8K B;  1X0P A;  3W62 A;  4RW6 B;  3QGI A;  2R7U A;  3CJT A;  2HVZ A;  1RU1 A;  1FX4 A;  2P6S A;  3DHW C;  1F5C A;  3DMJ A;  1G3O A;  4ED3 A;  2YKA A;  5LM7 E;  4CM2 A;  2MXY A;  2WSF C;  2HHQ A;  5HL7 Q;  5EWE A;  1MN9 A;  9ATC B;  2VQE F;  2ZOM A;  4I7F B;  2MKS A;  4DWI A;  4DMZ A;  1LWC A;  2OML A;  2CPX A;  2AP6 A;  2XMU A;  4CYU B;  3MWB A;  2E29 A;  2ZH2 A;  5M2U A;  3AOA A;  2F4V J;  2L48 A;  3OTB A;  3A12 A;  3ISZ A;  3IS9 B;  1X8D A;  4IFY A;  4OIX A;  3TZW A;  1KQF B;  1XNR J;  5L1I A;  3MM7 A;  2UVR A;  2O01 C;  2GQ2 A;  3FK4 A;  3OVB A;  3NKY A;  3F73 A;  4DL2 A;  4C0H A;  3M8P A;  2VJU A;  2O5D A;  4J9S A;  3I32 A;  4C3L A;  2CDR B;  2N82 B;  1HQ2 A;  3R7N B;  4DR3 F;  1X9S A;  2BAB A;  1NH7 A;  1Q8I A;  2JFK A;  1TP7 A;  4X65 J;  2HZC A;  1HR0 F;  4F4W A;  4NX9 A;  1FA0 A;  4MKA A;  4DQI A;  5LMN F;  3KNA A;  3O44 A;  1L3S A;  3MCM A;  1R8H A;  4LSN B;  2ZKT A;  5E5N A;  5F8L A;  3E51 A;  4F4X A;  2UV8 G;  3BR9 A;  4OJG A;  1FWK A;  1JLE A;  1UVJ A;  3D54 A;  3D1Q A;  3RAQ A;  2XTJ P;  4F8R A;  4DJB A;  3DLL Q;  4WYW A;  2HZA A;  2M5Y A;  4K4X A;  4NWB A;  3UCZ P;  5HMW A;  3A3O B;  2KYX A;  2WON B;  2YNH B;  1IBL F;  4ID8 A;  2BJ3 A;  3OHA A;  4I67 A;  1WC3 A;  3PYF A;  4KGM A;  4JI4 F;  1SQF A;  3T3F A;  4GMK A;  4HHH A;  2DGT A;  2XSJ B;  1QM9 A;  2ALY B;  5GAG U;  1FEE A;  3GYG A;  2J9C A;  2OEJ A;  4EMD A;  4HL9 A;  1NDP A;  4I69 A;  2YKN B;  1KHV A;  4OZ2 A;  2I6W A;  4ETX A;  1B4S A;  1JLF A;  2V0N A;  5IC4 B;  4KHP J;  2UUA J;  1BXN A;  2GO9 A;  4C8Y A;  5B0E A;  4ZHR A;  4ZPA A;  3A1Y G;  2LQB A;  4XO0 A;  4WP8 A;  2O67 A;  4WXW A;  5D4O A;  3CCZ A;  1I1G A;  1KVJ A;  4WXO A;  4ECQ A;  1FWP A;  1N36 J;  4ZVQ B;  2FJD B;  3W2W B;  4YHH J;  4XTT A;  2NXC A;  4DL6 A;  4M5D B;  4NLG A;  4NZ0 A;  1UCN A;  4RX6 A;  3O6Q A;  2G4B A;  2R7S A;  5JXS A;  3LP0 B;  3D1O A;  2E9T A;  3HHL C;  3WHI A;  3SSR A;  3HPO A;  2DY1 A;  1DAR A;  2J5A A;  2V67 A;  5KFT A;  3JSM A;  2ZH4 A;  3T5H A;  1TAQ A;  2CQG A;  4Q44 A;  1S49 A;  4BHQ A;  3BV8 A;  2V8V A;  5LXY A;  2C2D A;  2POK A;  2IPO B;  3CCT A;  1UW9 A;  3GV5 B;  5HAO A;  4M5M A;  1RTI B;  4AFF A;  1KON A;  4NRU A;  5L46 A;  1FEH A;  4PUO B;  5GMK a;  2HLT A;  3H5Y A;  3POT B;  2LQJ A;  3CD6 S;  2V68 A;  1N5Y A;  1CEZ A;  4U7U D;  1EZZ B;  3RBE A;  5E3P A;  3N79 A;  3H7H B;  1NXI A;  1TK0 A;  3H5U A;  3V6D B;  1HAR A;  2QT7 A;  1T3O A;  1F3V A;  4YR0 A;  4DV5 J;  4XDD A;  1KFD A;  2OFH X;  4OHZ A;  3KLF B;  4DXL A;  2LVW A;  3NY0 A;  3OSP A;  4GKK F;  1D8Y A;  1VOM A;  3CIM A;  5HSP A;  4X62 J;  1NK4 A;  4RBU A;  1EQ0 A;  3KTQ A;  3V4M A;  1WI6 A;  3AJ1 A;  2KH9 A;  3BPS P;  3FC9 A;  1X4F A;  2PSZ A;  1MLA A;  3KLE B;  1U6B A;  3CME S;  3M2V B;  2PC6 A;  2W7P A;  3PY8 A;  3HSZ A;  2MMY A;  3HF5 A;  3BBB A;  1SKW A;  2JDJ A;  2MJU A;  6AT1 B;  2DNK A;  3H25 A;  2IDL A;  1XMO F;  1U7L A;  2HFZ A;  3MMB B;  3L09 A;  1TFW A;  2DHH A;  2XO7 A;  4RPF A;  3MEG B;  4URQ U;  1HQE A;  4J9M A;  1HNV A;  3KNG A;  3BBC A;  1JX4 A;  2EKY A;  3Q8V A;  3OT9 A;  4EZ9 A;  3MF5 A;  1LV5 A;  2F8M A;  1R0A A;  2WBR A;  5EGY A;  4X66 F;  3I5B A;  2HK2 A;  2YXL A;  2XI2 A;  1RYR A;  3I9V 9;  3BGL A;  1RB0 A;  2E1A A;  3I6P A;  2EFG A;  3JTN A;  1UWB A;  2BAC A;  4IOA Q;  1HBM B;  3Q8Q B;  4JI3 F;  3HVW A;  4HT7 A;  1M1K T;  1S12 A;  4ZLN A;  1WKJ A;  1F2G A;  1EAR A;  2HAI A;  1WJ9 A;  2DXF A;  4ID5 A;  4OYM A;  5DQH A;  2KB2 A;  1JJH A;  4NLR A;  1RI7 A;  3L3C A;  3HO1 A;  1MRO A;  2R8K A;  1XR5 A;  1H2U X;  1MW7 A;  4PQU A;  5HI7 A;  1RYS A;  2H9Z A;  1PSD A;  3MOZ A;  2GML A;  2ZH6 A;  2WOM B;  3CUN A;  1RA6 A;  7AT1 B;  4PXE A;  1TAU A;  3CC7 S;  3QAU A;  1MU2 A;  1LW0 A;  4J9Q A;  2X1B A;  3BYR A;  2BEF A;  4USH A;  5HMX A;  1QJH A;  4ZCK A;  2ROE A;  2Y3Y A;  1U47 A;  3G6X A;  4RBT A;  2L3M A;  1RBO B;  1MML A;  5ETK A;  3RR8 A;  4S0M A;  1F60 B;  3EGW B;  2MTL A;  3TQE A;  4C48 A;  2WTF A;  3PVX A;  4O3S A;  4Q0B A;  1U09 A;  1VI7 A;  1CJK A;  5EWG A;  4ZS6 A;  4C3M A;  3ISN D;  2VDI A;  2HNY A;  1VQ5 S;  5KG5 A;  3NNC A;  3GJR B;  4ZVF A;  2DO4 A;  3OL7 A;  4TU9 A;  2QIF A;  3D0H E;  4J90 A;  1NLK L;  5BJR A;  4IR9 A;  2AJF E;  2BE9 B;  2DH7 A;  2HGL A;  1OPZ A;  4I6W A;  2Y9H A;  3D9B A;  4Y34 A;  1RAB B;  3O5T B;  3GTY X;  2R7X A;  4DSI A;  3M2R A;  2DVI A;  4PCQ A;  1TL5 A;  5F3Z A;  5LSR A;  4DL7 A;  3DXB A;  2IJF A;  5GAD U;  5F9L A;  1GX6 A;  4MKY A;  3OFH A;  2N7C A;  2RQ4 A;  1VS3 A;  3CIZ A;  3FEZ A;  1QTN B;  4M5N A;  2OH2 A;  1SC6 A;  2GVZ A;  4CIO A;  4N76 A;  1RHJ B;  4A8W A;  1SIW B;  1KTQ A;  2FJX A;  2DNP A;  4F7V A;  2IRU A;  2XS5 A;  3ITH A;  4ZHR B;  2B9E A;  3N0V A;  4ZVR B;  4C8O A;  2EW9 A;  3C19 A;  1U1N A;  4ECR A;  5C42 A;  3C66 A;  4F3O A;  2EFN A;  4UUX A;  1YJW S;  3FUY A;  1VRU B;  1N34 F;  1Q5Y A;  2AZ1 A;  4W98 A;  5EDW A;  2PEB A;  3MMA B;  3IRW P;  2HFS A;  1FJG J;  4RNN A;  4LRB A;  2ZC3 A;  2MQQ A;  4DSE A;  3ENA A;  2Q43 A;  3RBZ A;  1RTD A;  2CJQ A;  3SEO A;  2AIR B;  2OPR A;  4ELU A;  1VIS A;  3P3D A;  1JXV A;  1KR4 A;  3JSM B;  4PPZ A;  3G8S A;  3BEG B;  1GXU A;  2OI2 A;  4NCB A;  5D0H A;  1YG0 A;  4LRA A;  1LFW A;  4AL7 A;  1Z2L A;  2DNZ A;  1ZZF A;  2LA6 A;  1HBN A;  4Q8E A;  3L7P A;  2MEW A;  3KK3 B;  2KVI A;  2XYG B;  1YJT A;  1N5Y B;  2AEJ A;  4IDK A;  1HHT P;  1IM6 A;  1O5J A;  2JNJ A;  3DRP B;  1OMS A;  4C3K A;  1UEK A;  1NHV A;  5AXN A;  4KV8 A;  3MZI A;  1RWM B;  5IT0 A;  3CCL S;  1VCT A;  2DXE A;  1T05 B;  1WDT A;  3M6U A;  4YHH F;  1ARO P;  5E2Q A;  4BLG A;  2VV5 A;  1TUG B;  4IFV A;  5E0O A;  3I0R A;  2E9Z A;  3W63 A;  2XY5 A;  3GE9 A;  2GS8 A;  3RGI A;  1IM4 A;  3DRS A;  4J9R A;  2KI2 A;  2A10 A;  1WEX A;  2LU2 A;  1N48 A;  3MM8 B;  3R5D A;  1S9E A;  4K4V A;  4ZMM A;  4ALZ A;  4JBC A;  1FVQ A;  1IR2 A;  4F3M A;  1GT8 A;  2CQ0 A;  1JNZ B;  4CH0 S;  1HNW J;  1DQA A;  2J8A A;  5L8R C;  2Z2L A;  3M2U A;  4W4M A;  4NLO A;  2KXN B;  3O8W A;  3FBC A;  5CCM A;  3ET6 B;  3VAM A;  1N5V A;  2WCX A;  3JYT B;  3CDU A;  3NXZ A;  3CWJ A;  3PW4 A;  3LO3 A;  2EK6 A;  1JLB B;  1IR1 A;  2HQF A;  3K0J A;  4M5G A;  4DOZ A;  4JI0 F;  4O4R A;  4G6V B;  4RWX A;  1N0V C;  5DDO C;  4AQY J;  4FVC A;  3IR5 B;  3EGN A;  4DV5 F;  2YPY A;  2XWX A;  3FVY A;  5CYM A;  3MMC B;  1RGV A;  4K8R A;  4MYU A;  2HMI A;  1NJZ A;  4CO5 A;  4DR5 J;  1B0V A;  3W9H A;  5ITH A;  2JHE A;  4WFY A;  2V4J B;  1YRX A;  2ZFH A;  4X62 F;  3H98 A;  5CHC B;  1TV6 B;  4DPO A;  2VBX A;  5CH7 B;  2VFU A;  3DOL B;  5K9F A;  3ZZY A;  2DNO A;  3RB6 A;  1DAX A;  3MUT P;  1WEL A;  1JNR B;  3PZP A;  3RUB L;  4XDC A;  3IWL A;  1HBU B;  4IH6 A;  1RHR B;  1NPP A;  5F8J A;  5AT1 B;  1QUV A;  1WNE A;  1HMV B;  5D3G A;  1UKU A;  4WFZ A;  2R8J A;  3BDE A;  1YWX A;  3RR7 A;  5GAG I;  1U0S A;  1T03 A;  2NS1 B;  2FB0 A;  2H5I B;  3FDS A;  3BR8 A;  4K4Z A;  2QRR A;  4TY8 B;  1B64 A;  5DG8 A;  4JI2 J;  3H5S A;  1HWK A;  3BGR B;  3CCV S;  4UOC A;  2Z0G A;  2RQK A;  3AT1 B;  2OJ3 A;  3QFH A;  1VFJ A;  1WHV A;  4OI1 A;  2R9L A;  5ETO A;  4ILM A;  4D3G A;  1Z4U A;  4L75 A;  3RW7 A;  2ZBQ A;  2GIQ A;  3G82 B;  3UCG A;  2XZW A;  3UDE A;  2HBZ B;  4LJM A;  1RIS A;  2C3P A;  3QIP B;  2RKI A;  2ZE2 A;  4ZDN A;  4FZV A;  1EET B;  4F4K A;  1OIA A;  4DZ6 A;  3FSY A;  3NOC A;  5K14 A;  1SH0 A;  5KFH A;  1EAY C;  4WYL A;  1NKB A;  1ZA2 B;  2GAH C;  1WHW A;  3LPY A;  4PG8 A;  3OXF A;  3PYG A;  3U1M A;  3QBC A;  4JI5 J;  4QPX A;  2KVQ E;  3CUL A;  1EJ7 L;  2JX2 A;  2OHD A;  1JLQ A;  1N0U A;  4LIR A;  1SJF A;  1FRJ A;  2DT9 A;  4ECX A;  5FII A;  1FNM A;  1X5O A;  1NBE B;  3LWM A;  2EFO A;  5D4L A;  2JVO A;  1TU0 B;  2GVZ B;  1M5K C;  5FLX U;  1FDD A;  1NH8 A;  2A6M A;  3AQO A;  2HLU A;  1HWL A;  1H2T Z;  4OYP A;  4C11 A;  1S4E A;  5I3U A;  4ZCL A;  2DNM A;  4AT1 B;  3ITH B;  4FXD A;  2OEL A;  1ZTW A;  4KFB B;  3G4S S;  1VRT B;  1Q1K A;  3PW2 A;  3PO5 A;  2Y1J A;  2XLJ A;  4ZVP B;  2YNF A;  1Z1Z A;  3W2V A;  2ZDP A;  2FZC B;  1ZH5 A;  2E1R A;  2NYH A;  1OQ6 A;  1S1V A;  4DR6 J;  3W1Y C;  3UFC X;  1HI1 A;  3OTE A;  2E5J A;  2ZH3 A;  4OQJ A;  4IG3 B;  1LWE A;  1LXN A;  4LF4 F;  2UXB F;  2WVE A;  3G96 A;  1RTD B;  4I2Q B;  2CPY A;  4DS5 A;  2OPR B;  1C1B A;  2FZG B;  5L1K A;  2NXE A;  1AUS L;  3QZ7 A;  5T7L A;  1UW4 A;  3A8J A;  1AB8 A;  1DHM A;  3TVY A;  1NRK A;  5JVH Q;  1RWX B;  2YNG B;  3DLG B;  1C2P A;  3M7V A;  5KT3 A;  1S1T A;  2FHJ A;  1XTZ A;  4PKD B;  3BYP A;  3NBP B;  3D68 A;  5FJ4 A;  1TKX A;  3M8R A;  4KSE B;  1YRU A;  2HK3 A;  2K1R B;  2B8P A;  5DM7 Q;  1T9V A;  1VQL S;  4KV8 B;  3PJX A;  5KG7 A;  1TTH B;  1VQY A;  3NGD A;  2RRB A;  4ED6 A;  3HT3 A;  1SJQ A;  2BE2 A;  4KGZ B;  4OYW A;  1ZA1 B;  3R2C J;  4MFB A;  2P2C B;  4WPA A;  3GSI A;  3K5O A;  4I68 A;  3CC4 S;  2H54 B;  3JS9 A;  2WSE C;  3W8P A;  3B78 A;  2KO1 A;  3THP A;  4KGK A;  1HWJ A;  3SSQ A;  4QYR A;  4KIA A;  2XHC A;  2B9W A;  4ELT A;  2D3O 1;  3PTW A;  2HHS A;  1VIO A;  2V50 A;  1OYD A;  2IAJ A;  5DQI A;  1KLM A;  3T6J A;  4QWB A;  1FF2 A;  3M8Y A;  4TN2 A;  2JFD A;  1M5P C;  1H74 A;  5U47 A;  3T1H J;  4NRT A;  2RHQ B;  2I2Y A;  5A0Y A;  1M0S A;  1RWW B;  1YRT A;  3THV A;  3HHN B;  2RU9 A;  5KFA A;  2VHG A;  3E01 A;  3LW5 C;  2UXC F;  3TZZ A;  4C8L A;  3W5X A;  2HEK A;  4KC5 A;  4C2M A;  2HHH F;  3BO4 A;  2N4C A;  4KKO A;  1UPM B;  1XC9 A;  5HK4 A;  5LMU F;  3FSX A;  4DU8 A;  4LFB J;  5J1N A;  2R7T A;  3GG0 A;  4JI7 J;  1U2C A;  2DXD A;  3OR1 A;  2MKC A;  4B9N A;  1K1S A;  3HHK A;  4DV6 J;  4K5S A;  1Q0N A;  3HM9 A;  2CPD A;  2WRM A;  2HWI A;  2G0I A;  5GAD I;  2XM3 A;  4QOT A;  2NSB A;  1RKI A;  1Q7Y T;  1R31 A;  4B9U A;  4U96 A;  1HNI B;  1TL7 A;  2KJV A;  3GPA A;  1CJU B;  2GGP B;  3E8O A;  4B3M F;  2DEI A;  3KLI B;  1N88 A;  2FY8 A;  2CPJ A;  4E8U A;  1GK8 A;  3EVM A;  2QA1 A;  4F4Z A;  1GQE A;  1VYA A;  1KLN A;  2AKW B;  4LF1 A;  2MLX A;  4A8M P;  3JSR A;  5FD1 A;  3KJV A;  2B3T B;  1BMQ B;  4NLY A;  3GZ7 A;  2BR0 A;  2DRB A;  3BBF A;  2AX1 A;  2ATL A;  2DR5 A;  4FXV A;  2OPQ B;  4IQX A;  1FKO A;  3ZNJ 1;  4FF3 A;  1FER A;  1RJJ A;  4JV5 J;  2Y1L B;  2IYG A;  1Q53 A;  1ZPV A;  1NB2 A;  5M2P A;  3I31 A;  3KXD A;  4WU2 A;  3DLK B;  1RHQ B;  4LQ3 A;  3GFH A;  3EXC X;  4NI2 A;  2RKI B;  2ZE2 B;  5I3Q A;  4DV4 J;  1BQN B;  5KG4 A;  5HQL A;  2KL8 A;  2E1C A;  4IQM A;  5C5J A;  2V5H G;  2M88 A;  2RE1 A;  4RKU C;  1TUW A;  4TVA B;  4QWD A;  4DR7 F;  4KGX B;  3KLG A;  2QX0 A;  4A4J A;  2UP1 A;  4B3R J;  4CNY A;  1HLW A;  4BDP A;  1TL3 B;  3HX9 A;  5AJ3 F;  1I3O B;  4FS2 A;  2Z2Z A;  6FD1 A;  1H72 C;  2DGS A;  7FD1 A;  1M1G A;  1C0T A;  3HSD A;  1NK9 A;  2XYH B;  3HZE A;  4Y2A A;  3WX8 A;  4F4A A;  1Q4R A;  2W9A A;  1S76 D;  1BY9 A;  2WVD A;  4B9L A;  3VGS A;  3GIR A;  4Q45 A;  4B08 A;  4DQQ A;  2XG8 A;  2DHX A;  3OFF A;  1I51 B;  3W2V B;  1L5U A;  3NGU A;  3BH6 B;  1NND A;  1S1V B;  4DUZ J;  3CJ2 A;  3H2U B;  2XMW A;  4PXC A;  4DQP A;  5EHH A;  1WG4 A;  3G8Q A;  2OP5 A;  1RZM A;  4LBH A;  4GVB B;  3X1L B;  1UZD A;  4LSL A;  1N5Q A;  3TAQ A;  3TUI C;  4L74 A;  4PWD A;  5D0G A;  2QZ8 A;  3PAC A;  2BV3 A;  5T7L B;  4O3R A;  4NL5 A;  1BWV A;  3NNH A;  4U6P A;  2EVZ A;  3I96 A;  2C2Z B;  2MGZ A;  1VHI A;  2CVE A;  2ZEJ A;  2KKH A;  2OSQ A;  3IXQ A;  4LMZ A;  3D6M B;  2ZIT A;  3T1A A;  1YX2 A;  2HVH A;  2C3O A;  2AU0 A;  1DUR A;  2W2Q P;  4CRJ A;  1AFI A;  3HHL A;  4IH7 A;  4LVN P;  4EYH B;  1S10 A;  2VPZ B;  4I0W A;  2J76 E;  2GJI A;  1S1W B;  3PRD A;  3VQT A;  3GII A;  1UA1 A;  1V6H A;  4A8Q A;  4L3K A;  5L9N A;  3VGU A;  1N32 J;  4ZA1 A;  3JQJ A;  5A76 A;  2ZD1 A;  1RT4 B;  2BE2 B;  4FYD A;  1XR6 A;  2BW2 A;  1RAI B;  1GFW B;  4LF9 J;  2ACY A;  5IS2 A;  2HZV A;  1RTZ A;  2M3D A;  3J81 j;  5KT5 A;  4BC7 A;  1N56 A;  3ILO A;  3K8W A;  4WFA Q;  3BGF A;  2HVE A;  2MDA A;  3ILI A;  2ZBP A;  2XLK A;  5HJX A;  1CSJ A;  2CQB A;  1NSP A;  4WFN Q;  5DET A;  4NA1 A;  3ZZU A;  1TVR A;  5GAH U;  1YDL A;  4QYZ K;  2VA3 A;  4C7Q A;  4OYB A;  2IAJ B;  3CJ4 A;  1Q81 T;  3QRR A;  4WE1 A;  3E3X A;  3CSK A;  1YJ9 S;  1QVF R;  4E2F B;  4ZIW A;  3ZZ0 A;  1VQ6 S;  2FHJ D;  2V2Q A;  2AJ2 A;  1AUD A;  2HQC A;  4WKR A;  1X4D A;  3PX6 A;  1MMD A;  2AJ0 A;  4ES2 A;  2J8S A;  1WC4 A;  5F9N A;  3H40 A;  3IGV A;  2VQF F;  2FVP A;  1CC7 A;  3NLC A;  1SL1 A;  2IMO A;  2HIY A;  4M8L A;  2WBM A;  4KQZ A;  4IG0 B;  2KM8 B;  2W01 A;  1YI2 S;  1QSY A;  2KZM A;  2DY9 A;  4X4N A;  4ZN1 A;  3BGO P;  4CTA A;  3B82 A;  2YX1 A;  4DR4 J;  1R8P A;  3X3U A;  3OR1 B;  3J7Y U;  4G1Q A;  1HFE L;  2J9D A;  5KFY A;  1RAF B;  3WQP A;  3GQC A;  4YY3 J;  2BVZ A;  4C0B A;  4R5P A;  3W64 A;  3QJJ A;  1CS4 B;  1FE4 A;  1OY8 A;  2ILZ A;  4I4B A;  2Z57 B;  3PW7 A;  5ETL A;  3KK1 B;  2QLB B;  1WKK A;  2GQC A;  3CTR A;  2L9N A;  1IUJ A;  2W9C A;  2DR7 A;  2YQ0 A;  3Q8R B;  3TNV A;  2DBB A;  3W9J A;  1FE0 A;  3SFG A;  1T94 A;  1NPK A;  1R6Y A;  1S1U A;  3Q23 A;  2G13 A;  1KKH A;  3P5B P;  1RTH A;  3KJV B;  3QAE A;  2ZM6 J;  3AXK A;  3OPK A;  2BJD A;  1WHY A;  3K2Y A;  1PBU A;  3F44 A;  1J5O A;  1Q7L B;  4QR0 A;  5GMD A;  2M7S A;  2CQH A;  2I5J B;  8AT1 B;  4DL0 C;  4LF2 A;  4U7C A;  4FP9 A;  4GVL A;  1QTM A;  5IC6 B;  1X4B A;  1B7F A;  1PJ5 A;  3FKB A;  4LFB F;  5DG7 A;  1D09 B;  2CVI A;  4C6A A;  3ETO A;  4RW7 B;  3M30 A;  4U95 A;  2RU3 A;  1HWU A;  4ZLP A;  1HA1 A;  1Q86 T;  1X0F A;  1VJQ A;  2I38 A;  4EEY A;  3A3N B;  2JL9 A;  3KLG B;  4HLB A;  4FNH A;  4K4S A;  5C25 A;  3BZQ A;  1FX2 A;  1H6K X;  4RW8 A;  2ACM A;  5BR8 F;  3I5C A;  3QO9 A;  1BLU A;  1YJV A;  3M8S A;  1FFG B;  2ASY A;  3DOK B;  3L9Z A;  1FCA A;  1C0T B;  4HKQ A;  4LR7 A;  4F4Y A;  2VFV A;  1FTC A;  4HAC A;  3QPI A;  1HI0 P;  3CJR A;  1TKZ A;  4CCH A;  3UD3 P;  2KZZ A;  2W2P P;  4PRF A;  3NS6 A;  3PNI A;  4F0K A;  1TL1 A;  4LRD A;  2MHN A;  2DGU A;  3OL6 A;  3J81 U;  2VG6 A;  1KOO A;  3K5N A;  1K0V A;  4LF7 J;  1RT3 A;  2AQ4 A;  3IN5 A;  1A6L A;  5F8M A;  2F63 A;  5DDR C;  5AE3 A;  4E98 A;  2ALZ A;  5KG2 A;  2QLX A;  1U2R A;  2CG8 A;  4DV4 F;  2QO3 A;  3EVO A;  1V5I B;  2CNK B;  4J9K A;  1S7H A;  5IQQ A;  4ZVH A;  2VKZ G;  1DRZ A;  3V4I A;  2HNZ A;  1WEY A;  2ZHO A;  3I9Z A;  3I56 S;  4B9V A;  2E5H A;  5HVG A;  1IVZ A;  3CJ0 A;  2AYB A;  3EJM A;  4FF4 A;  5A8R B;  2W2M P;  1G6B A;  4PYA A;  2OMO A;  4PR6 A;  2VON A;  2J9D E;  1UPP A;  5HP1 B;  1H7W A;  3OTO F;  4NZ6 A;  3LUY A;  3VZH A;  3MI7 X;  4ICL A;  2LQ9 A;  4XAK A;  1GXL A;  5DS7 A;  3MR7 A;  2MKH A;  3EYZ A;  1YZ6 A;  1QUP A;  4P72 A;  1RWP B;  1S6P A;  4DPX A;  1OO0 B;  5E3R A;  4DV1 J;  4UQG A;  2EI5 A;  4RL1 A;  1UMJ A;  3RAM A;  3L7U A;  1IKV B;  2LEB A;  1YBT A;  2ZBC A;  1SQE A;  4UY8 T;  1CC8 A;  4MK9 A;  2FY1 A;  4KO0 B;  3WC2 A;  4ELV A;  2C1E B;  1IBC B;  3THT A;  1DY3 A;  5D8H B;  3RB3 A;  2OPS A;  3N6N A;  5T14 A;  3M1V A;  1Q82 T;  3UPF A;  3CDB A;  4DX5 A;  4Q43 A;  3GSD A;  9RUB A;  5BXI A;  3GJS B;  5CYQ B;  4X84 A;  2XMM A;  5J1E A;  3K89 A;  3JAM Y;  4CP5 A;  4KE5 A;  4OX8 A;  3OUY B;  3I0S A;  3FCV A;  3KWM A;  1S0O A;  4WK3 A;  3TEG A;  1X7V A;  4RR5 A;  3CCU S;  2X1F A;  1IKW A;  2B4U A;  4K4W A;  3OSN A;  4O3Q A;  3PJW A;  1C1C A;  3W9I A;  3B54 A;  3DDI A;  2AEF A;  5KFN A;  2AEM A;  1XIQ A;  1XR7 A;  2YKM A;  4G3I A;  3ENW A;  1A7G E;  1E6V B;  5KFQ A;  3QAT A;  2GHW A;  2Z56 B;  3H20 A;  1VQ7 S;  1N6Q A;  3MCN A;  3LTO A;  4DPT A;  2M2B A;  5KG3 A;  3AOC A;  3NAI A;  1WOS A;  1NSK L;  2AGP A;  1R8C A;  2OGU A;  5K5M A;  4H4M B;  1YIJ S;  3HHL D;  2KYZ A;  1N32 F;  5MAO A;  3FQL A;  1IBK J;  2FYX A;  3CXC R;  4I6A A;  2NXN A;  2XZT B;  4LF9 F;  1KFS A;  3PKM A;  1RAD B;  1URR A;  4DR3 J;  1QD1 A;  3PEJ A;  5B0C A;  5DM6 Q;  2LA4 A;  1WSV A;  3GFZ A;  1RT6 B;  5CXT A;  4PWW A;  3BSN A;  2ZOF A;  4QYZ J;  2CWK A;  5H9E J;  2VOP A;  5G0R B;  5LMN J;  4ITS A;  1AFJ A;  3EZO A;  2D74 B;  4ED1 A;  1YJR A;  3W65 A;  4PQA A;  4R5P B;  2YY3 A;  1B3T A;  3MOJ B;  1SVD A;  3M8Z A;  4DPW A;  2XI3 A;  1FFS B;  4X4R A;  3GYX B;  1T0T V;  2RUS A;  3V6J A;  1KD1 T;  4KB7 A;  4ZP6 A;  3K5L A;  4PXB A;  1RWO B;  4MK7 A;  1HHQ A;  1RA7 A;  2FJW A;  2D41 A;  4BBY A;  1WC5 A;  3C15 B;  5HAN A;  1VK3 A;  1HL6 A;  4X4P A;  5A8W A;  4P2F A;  3MEK A;  4AL5 A;  4WZM A;  1T9Y A;  4A8F A;  1CUL A;  1RWK B;  4NLD A;  4JI4 J;  1KBR A;  2DIV A;  3AOB A;  3RG6 A;  2QMW A;  3J80 Y;  2KHC A;  2VG7 A;  4OI6 A;  3MM5 B;  2JLE A;  3TX0 A;  2YQ1 A;  4M95 A;  5J2P B;  3IFE A;  1EP4 A;  3IBW A;  2NCK L;  4GKJ J;  4EBE A;  4DR4 F;  1NPR A;  1NJI T;  3RAX A;  2CQ1 A;  1F9E B;  4DV3 F;  3M30 B;  1D8Z A;  1YJN S;  2KFZ A;  2WAQ D;  2IHR 1;  3ZZT A;  1FKP B;  1JIH A;  4LQ9 A;  4YY3 F;  5KTQ A;  1R8B A;  4K4U A;  1HBO B;  3UVJ B;  2IBO A;  1HYS B;  4DUY J;  2JC0 A;  2C2N A;  3CCM S;  1GTE A;  4Y00 A;  1SKR A;  1CPZ A;  3C6U B;  4V19 J;  2H48 B;  3KK2 A;  3TVK A;  5C25 B;  5F0U A;  3OVS A;  4RZR A;  2FPH X;  1XWL A;  3W5Z A;  3SI8 A;  3W66 A;  3SCK E;  2SXL A;  5HQM A;  4PEO A;  3DLH A;  2Q66 A;  4HAC B;  2OD4 A;  3QGP A;  2GA7 A;  1OWX A;  4RWW A;  3OV7 A;  2AYE A;  1FK9 A;  2FGO A;  2CA9 A;  3AA9 A;  3AFG A;  1H3D A;  5IM0 B;  2XS2 A;  3G2X A;  3QLH B;  3PM9 A;  3N6L A;  4MKV A;  1WAC A;  4ECY A;  3BGU A;  2B51 A;  3ELH A;  4F3Q A;  1RT1 B;  3QYY A;  3ZTR A;  3HMJ G;  3EDQ B;  5C2G A;  1J5E J;  1RLC L;  2PI4 A;  5B09 A;  3MED A;  3DC2 A;  1QY7 A;  1S1X A;  2NYI A;  4WCE Q;  1X60 A;  2DNQ A;  2W8L A;  3V4I B;  1SV5 A;  3ENV A;  2FJV A;  3Q0A A;  4Q2M A;  1UJ5 A;  5IT9 U;  3W60 A;  4N5S A;  3MM9 B;  4DV2 F;  1VJW A;  1U49 A;  1SKU B;  2NQP A;  1IN0 A;  4GKK J;  3D7S B;  4N56 A;  1FT8 A;  1U26 A;  3HFZ B;  1N4L A;  4DF4 A;  5IT9 Y;  2L9W A;  3EX7 B;  1A0O B;  2FQQ B;  5ETN A;  5KFS A;  2ATC B;  1X5S A;  4JYA J;  3RYL A;  4OHY A;  4NCG A;  1UJ4 A;  5KOW A;  3NS7 B;  3C6T A;  3MM6 B;  4O4G A;  4L76 A;  1UVL A;  3WC0 A;  3CMQ A;  3PW0 A;  1XMO J;  2MQP A;  4LF7 F;  3HHE A;  2EC2 A;  3DGP A;  3T19 A;  4B3T J;  2LKZ A;  3GR0 A;  4RW4 B;  4LUB A;  4DL3 A;  1JKH B;  4MK8 A;  3VGV A;  2Y8Y A;  2ZH9 A;  2BQU A;  3M9O B;  1T11 A;  3FMB A;  3M1V B;  3CJK A;  4X66 J;  2W9B A;  1FKA F;  3G9C A;  3A8K A;  3TR5 A;  2MLY A;  2IC3 B;  3CO9 A;  3CCE S;  5DLG A;  1REV A;  1NHK L;  2EC0 A;  8RUC A;  3R3T A;  3HUL A;  4LF6 F;  2FIU A;  5I42 A;  3I0S B;  1X4E A;  3HT0 A;  2HS4 A;  2ZH1 A;  2AW0 A;  3BPD A;  4RNF A;  1PIE A;  3R6G B;  4FPR A;  1IKW B;  2A18 A;  1H98 A;  2PII A;  2HWT A;  2MKK A;  2DPJ A;  2FTR A;  1LKZ A;  2JLF A;  3AD8 C;  3LAM A;  2A2D A;  2YKM B;  2GHV C;  1H73 A;  4N8N A;  3UWT A;  4KH1 B;  3AY0 A;  1NZ8 A;  1S6U A;  3QGG A;  3HDS A;  3D3C J;  2H5J B;  4OYZ A;  3OXG A;  2NUH A;  2FLN A;  3ZXW A;  1SKS A;  1WD6 A;  4ECV A;  3QT7 A;  2XMA A;  1OS5 A;  5EUH A;  2QMX A;  4DSK A;  5B0A A;  4DN9 A;  1HNX F;  1N54 B;  5J2N A;  3PFE A;  2XO6 A;  1QE1 A;  4LR9 A;  3W3S A;  1JLC A;  4M5I A;  2V69 A;  3R97 A;  3K5M A;  1VQ9 S;  3AAW B;  4OYA A;  1NM2 A;  3HKZ D;  3NGR A;  2VU5 A;  3MEC A;  1VQM S;  1YQH A;  3AOD A;  2RF2 A;  1WUU A;  1VC5 A;  5LSL A;  4GO5 X;  1U1K A;  2EEY A;  1CJT A;  3M05 A;  4EWT A;  2XCP A;  1Y5N B;  4DFK A;  1HQU A;  1U2F A;  5LT5 A;  3CNQ P;  4JI8 F;  1VQ8 S;  4NMX A;  2OFG X;  2UUB F;  4JV2 A;  3IMQ J;  2BAN A;  4IRK A;  2DGQ A;  2P8I A;  1LWF A;  3QJP A;  2BBE A;  1VQP S;  4DQS A;  2PEH A;  4IOB A;  1BWE A;  3Q8S B;  3GJQ B;  2R42 A;  2FD2 A;  4ED5 A;  4OJH A;  4ZOS A;  5CQG A;  1IBK F;  1U6Z A;  4LRE A;  2FHO B;  3VCD A;  2ZJR Q;  1RWU A;  2DEJ A;  1RSC A;  2D3Z A;  4OHX A;  4ZVG A;  1F3F A;  4Y3C A;  3VV2 B;  1DQ9 A;  4A8K A;  4DFP A;  2JSX A;  1UVI A;  3R1H A;  2EBE A;  4N47 A;  4M5H A;  1P9Y A;  1YKW A;  4X64 J;  2X3D A;  4P73 A;  2EG1 A;  1KQG B;  4XPE A;  2IVM A;  1EP4 B;  1NSQ A;  2P9C A;  1D9D A;  2MYF A;  3WDO A;  1VIX A;  3DM2 A;  5HRO A;  4BS2 A;  1MMN A;  2CG4 A;  1Y7P A;  4YQW A;  3HVR A;  1FHT A;  5KT2 A;  3OJS A;  5LSO A;  4KJI A;  3SBM A;  3DYA B;  1T9T A;  2MKY A;  4DQR A;  1N34 J;  2A1B A;  4J37 A;  4W92 B;  4OI4 A;  3TZX A;  2C42 A;  1VHF A;  2HGM A;  3SMZ A;  1QAX A;  3PEH A;  2BMB A;  1WSR A;  2V8G A;  3VAJ A;  3DLJ A;  5DLF A;  3QRP A;  5DJB A;  4DZD A;  2EWH A;  4HDH A;  4X2B A;  4DR2 F;  1PGZ A;  1RCO B;  4UOF A;  1FK9 B;  2HPU A;  2WSC C;  2LQ5 A;  3C16 A;  1SB6 A;  4ED7 A;  1TFY A;  4NYO A;  1UET A;  4WTY A;  1N33 J;  5C24 B;  1PO6 A;  4Z2X A;  4JV1 A;  1SL2 A;  1O6X A;  3LAL A;  3JQK A;  4GKJ F;  2ZC4 A;  1EX8 A;  2WHO A;  3Q2T C;  1SH2 A;  1WKL A;  1NHU A;  2GJF A;  3OR2 A;  2EFP A;  2GVD B;  3DCA A;  4TQS A;  4OZ3 A;  4R8U A;  2MQ8 A;  4Y0F A;  1SV5 B;  1VLO A;  2KN4 A;  3IWX A;  4DUY F;  1WF2 A;  3TA0 A;  3IWN C;  1WC6 A;  4JV0 A;  5G4D A;  2R7V A;  1K9M T;  3TJA A;  3HFK A;  4A48 A;  2CJA A;  2QA2 A;  5LOQ A;  4CO4 A;  1RLD A;  1T9U A;  3CB4 A;  4H4K A;  2W8K A;  3IG1 B;  2Z58 B;  2W25 A;  5I4M A;  2ZBR A;  2ZUG A;  2NZC A;  1NKC A;  4NCG B;  1YBU A;  3O2I A;  4NZ7 A;  5HO4 A;  3C6T B;  2B5J B;  2PN6 A;  5J2Q A;  1KP6 A;  4F02 A;  4CLY A;  2MZ1 A;  3DLE B;  1NK7 A;  1JLG B;  4M5K A;  3M4X A;  1NEE A;  3ZC4 A;  3AH6 A;  5AXM A;  4C8Z A;  3ZFV A;  3V81 B;  1OYE A;  1SJ1 A;  4J9V A;  1FDN A;  2BA9 A;  1WHX A;  2YQ3 A;  2WB1 D;  2GMH A;  5JMN A;  1S0N A;  1J5E F;  1FXR A;  2QL7 B;  3JSB A;  2IY5 B;  2LDI A;  5GVQ A;  4CI0 B;  3CJK B;  1SJ4 P;  4JI0 J;  2VBZ A;  2FVC A;  2GIF A;  3CCS S;  1BC6 A;  1IQZ A;  4LF5 F;  4GRS A;  2IYI A;  3PCO B;  4NAS A;  4PAB A;  3Q8P B;  2E1P A;  3D6F B;  2XMJ A;  2F40 A;  1FI4 A;  3EZU A;  4HYK A;  3A13 A;  5CYJ A;  3KJF B;  4OI0 A;  3LP2 A;  4V1A k;  2QFJ A;  2KT5 A;  2UXD F;  1ZM9 A;  3TO8 A;  2KG0 A;  4WWS A;  3D28 A;  4QU6 A;  2I0X A;  3VAH A;  2H5E A;  4MKB A;  2B6A A;  1U8S A;  4JYA F;  1IJE B;  3CC2 S;  2FJA B;  1IKX A;  2W7O A;  1E6Y B;  2D7S A;  3SQG B;  1YHQ S;  3W61 A;  3C2P A;  1QDU B;  1BQX A;  3PIO Q;  1XNQ F;  2XHW A;  2YTC A;  4P7T A;  4FBU A;  4ILL A;  3LPE A;  4QIW D;  3TYT A;  4B3T F;  3T1Y J;  3EZ5 A;  4QWA A;  4DG1 A;  4J9O A;  2AYG A;  2APO A;  5BYS A;  5J2N B;  3S01 A;  4KGV B;  1QE1 B;  4C97 A;  1FRX A;  4NA3 A;  1JLC B;  2GZO A;  3TQ1 A;  1F5B A;  1XEZ A;  2Q1L A;  3D3B J;  4DSL A;  3NCP A;  3MAA A;  3F56 A;  3ICL A;  1JLA A;  4YR2 A;  2V63 A;  3MEC B;  5THW A;  2OIH A;  1FJC A;  3HSJ A;  2DR6 A;  3DMJ B;  2N3O A;  3Q22 A;  5HLF A;  1HPZ A;  2GMJ A;  3UI3 A;  1RWV B;  2AX0 A;  4V19 X;  4USM A;  1KTV A;  3LWL A;  3MXH P;  1JXE A;  3TA1 A;  1LWC B;  2XQC A;  1NJY A;  3BJY A;  1T9W A;  3ZZZ A;  2QYC A;  1VRQ C;  4B9M A;  3C14 A;  3MMJ A;  2Q3P A;  1PKU A;  3N9U C;  3JQM A;  4IFY B;  2DRD A;  1KDN A;  4YS2 A;  3QQC D;  4K0K J;  3MM7 B;  2ZVI A;  4YME A;  2BW7 A;  2QSF A;  3K57 A;  1NME B;  4USU A;  2LLZ A;  2PGC A;  5IFM A;  2JEF A;  4WBF A;  3M8P B;  3L7O A;  3AD9 C;  3GFY A;  3OJU A;  3QZ8 A;  4USJ C;  4IR1 A;  2OPP A;  1ZAV A;  3PXG a;  2V8D A;  3KFW X;  4A8S A;  2YNI A;  2VPW B;  1EKR A;  4NE9 C;  4F50 A;  2AJ1 A;  1I6J A;  5AXK A;  4GC6 A;  2D3O R;  2R8G A;  4C8N A;  1C0U A;  2YKP A;  1RAC B;  3DM2 B;  4JI1 F;  1MN7 A;  3HLU A;  1Y11 A;  1T02 A;  1ZAX A;  3R7S B;  3LP1 A;  1UFK A;  1X4H A;  3NP5 A;  5CCL A;  5F0W A;  2AT1 B;  5KFF A;  4ER8 A;  3G71 S;  1Y9O A;  4DFM A;  3V5R A;  1IKY A;  2F9J A;  3KOA A;  1JLE B;  3KMQ A;  5AXL A;  3DU5 A;  3AXM A;  2IVY A;  3J7Z T;  3MUV P;  1LK5 A;  3NWG A;  4JP8 A;  5IT4 A;  3OBI A;  2BKN A;  4LF4 J;  4WIQ A;  2UXB J;  2F5G A;  4DI6 A;  4R25 A;  1IR0 A;  2DJW A;  3H59 A;  2KTQ A;  5K8N A;  1LK7 A;  3WZ0 A;  4TY9 A;  2RML A;  4ECW A;  2CPF A;  2V6A A;  2WVC A;  2HKE A;  1TL4 A;  4UOH A;  4X64 F;  1EB0 A;  1FRH A;  1PCA A;  3OVA A;  3W5Y A;  3DOM A;  1OSC A;  1JLF B;  3AHP A;  4CYU A;  2JZ5 A;  2XY6 A;  5KFL A;  5KFZ A;  1S0M A;  3K58 A;  2R2U A;  2J0Q D;  5KFJ A;  3PW5 A;  2EFQ A;  3MGJ A;  3IS9 A;  3BSO A;  2AD9 A;  2QG9 B;  3GMG A;  2BRL A;  3C3L A;  2B43 A;  1BQM A;  3GIL A;  1DTQ A;  3AD7 C;  4YN3 B;  2FC9 A;  1RHM B;  1HD1 A;  5CD4 A;  1Q95 G;  3FZ2 A;  1WDD A;  2AMC B;  2RDD A;  2CJK A;  2CQ3 A;  4NLV A;  3VGT A;  1M90 T;  3SV4 A;  2VFS A;  4YB7 A;  3MR2 A;  4ZVO B;  3H0P A;  1NK6 A;  3NNA A;  5LXR A;  3R5J B;  4I56 A;  1UEU A;  1I5O B;  1LEO A;  2M8H A;  5J2Q B;  2UUT A;  1UZH A;  3D4J A;  4ZLL A;  1J2V A;  4HT5 A;  1SH3 A;  2HUR A;  4CLK A;  4TU7 A;  2HHT A;  5B0G A;  1CQN A;  2ERR A;  1N33 F;  2BJ9 A;  3FBF A;  3CF5 Q;  2ZBI A;  3NGK A;  5ETS A;  1SC4 B;  4J5O A;  5T41 A;  2CNN B;  3RBX A;  3GIK A;  4CNZ A;  1F1B B;  4XK8 C;  1T8E A;  3UNY A;  3NGS A;  2PMW A;  4OJ1 A;  5KFE A;  2UXC J;  3FNN A;  3VVU A;  4Y65 A;  4YP3 A;  2VD3 A;  2HHH J;  2BOP A;  4CLS A;  4NEY A;  3M8W A;  3R5G A;  2WW8 A;  4C8M A;  1QLN A;  2Z2M A;  3LP2 B;  3MHY A;  3PHE A;  2QL9 B;  4QU7 A;  1FD2 A;  3ULH A;  5LMU J;  4QW8 A;  1SQG A;  5KT7 A;  1VC6 A;  1SCJ B;  2B6A B;  4K2J A;  1IWG A;  2NPF A;  1V3R A;  3AA8 A;  4TQR A;  1IKX B;  4I64 A;  1Q8L A;  2B9Y A;  4HTI A;  1WWH A;  3M6W A;  1PYO B;  2C2M B;  1KS2 A;  3G6Y A;  3HD2 A;  2BOA A;  2PA8 D;  3TJ8 A;  3MR6 A;  1SC3 B;  4K4T A;  4B3S F;  1HQE B;  3FFI A;  2UVV A;  4FBT A;  5KFK A;  1HNV B;  4B3M J;  2D69 A;  3W2W A;  4DG1 B;  2H4Y B;  4F2S A;  1AW0 A;  4M5D A;  1XMQ F;  2RUG A;  5CZV A;  1R0A B;  4U8Y A;  3K59 A;  2FVS A;  1K73 T;  2IM0 A;  3LP0 A;  4B9T A;  2BUN A;  1S9G A;  4OX7 A;  5KOX A;  5IOL A;  1YJU A;  1UWB B;  3TRG A;  3EPI A;  3QRQ A;  5HLF B;  1VBY A;  3KJQ B;  3FGV A;  3LA0 A;  1RAJ A;  4UT4 A;  4H4O A;  2CQ2 A;  2K3K A;  2E7V A;  4WKY A;  1NJX A;  1RTI A;  3BH7 B;  4ID5 B;  3MUM P;  1HIY A;  2ZHB A;  5F8H A;  1GX5 A;  1F2H A;  4F04 B;  2F8H A;  2UZA A;  4PUO A;  2HQ3 A;  4LFA J;  1MRO B;  3POT A;  5DG9 A;  2XMK A;  4A47 A;  4PQU B;  3FCW A;  2UUC J;  2WB4 A;  2NR0 A;  2KXF A;  4F0H A;  3V6D A;  4L6V 3;  2AYM A;  1I94 F;  2DYA A;  1KHW A;  1HD0 A;  4DR7 J;  1WOP A;  2IRY A;  3ADA C;  3T1Y F;  2LFV A;  2KHD A;  1MU2 B;  5E33 A;  4PXD A;  1LW0 B;  3KHR A;  2ABY A;  2XNR A;  2QE5 A;  5AJ3 J;  4IYQ A;  1ZET A;  1YBA A;  2XCA A;  2KFN A;  2Y0S D;  4C8K A;  1S99 A;  2FHM A;  5D4P A;  2YNI B;  2RB7 A;  3ZTQ A;  3FCH A;  1Q8B A;  2ASJ A;  2W24 A;  1FXD A;  4I2P A;  2I1R A;  2AZ3 A;  2NZ4 A;  4DCP B;  3M2V A;  3R7B B;  1DLO A;  5ETM A;  4Q0B B;  4LVO P;  1Y3J A;  3CJS A;  4USV A;  1CJK B;  2KJW A;  2K7J A;  4OI2 A;  3CCQ S;  3J7Z 5;  4CT9 A;  4FKX A;  2CYY A;  3MPW A;  1UEV A;  2VC1 A;  1KQS R;  3KG1 A;  2HNY B;  2VZ9 A;  5KT4 A;  4IO9 Q;  3VAF A;  5KFR A;  3MEG A;  3PKY A;  4DL4 A;  1UFL A;  1R0B G;  1JB0 C;  2PI5 A;  2BKO A;  2OO4 A;  4LF8 J;  3DGV A;  1ZTT A;  1VBX A;  1UL3 A;  2CQD A;  1WEZ A;  4KPY A;  4G65 A;  4H54 A;  2DB1 A;  2ASL A;  1BGX T;  3M2R B;  5HVH A;  4K0K F;  4CO0 A;  2IM1 A;  3MPY A;  4JB8 B;  4UTG A;  4YDD B;  4QWE A;  1HNZ F;  3ZO7 A;  3D66 A;  4NPO A;  2R2T A;  4HDG A;  1HBM A;  4RW9 A;  2CAD A;  3FEX B;  1FDA A;  4KTQ A;  2EKN A;  1UVM A;  3SIP B;  2ADC A;  2A0F B;  1M5O C;  3GJT B;  2ZJQ Q;  3UW1 A;  2LEA A;  3DOM B;  4KBI A;  5IV4 A;  4ZVS B;  3EMT A;  2J7K A;  4Y2K A;  4XIU A;  2J9E A;  2JWN A;  2E5L F;  4CO3 A;  3QGH A;  3IAM 9;  3AB4 B;  2FLO A;  2Z2Y B;  2CNO B;  2CQ4 A;  4M94 A;  3KYL A;  3CD7 A;  3I82 A;  4EK2 A;  1VK8 A;  4ES1 A;  5C42 B;  4P6Q A;  2WOM A;  3PDN A;  4NLP A;  1UVN A;  2ADB A;  1BQM B;  1DTQ B;  3QT6 A;  2KXH A;  3OHB A;  3EIC A;  2LU1 A;  1OSD A;  2CPZ A;  1FO1 A;  5J2M A;  1GXT A;  2R7O A;  2J6S A;  2L9D A;  1Y5I B;  2XMT A;  2YWK A;  2DHG A;  2VUG A;  4K2X A;  1MWZ A;  3SYZ A;  4JUZ A;  2IRX A;  5HMZ A;  1X4A A;  3FZB A;  1FFW B;  2XEX A;  2BQ3 A;  2C2E A;  4DR1 J;  5DRK A;  2LYV A;  3TUZ C;  1PC5 A;  1HBN B;  4J91 A;  2N7Y A;  1ICE B;  3D6T B;  3MTK A;  2ZDO A;  2F1F A;  2BJ8 A;  5E41 A;  1X5P A;  1BE4 A;  3I55 S;  2HVI A;  4IDK B;  3EGV A;  2UU9 F;  3DRY A;  3DI6 A;  5F41 A;  3N5B A;  3LGN A;  2P9E A;  2YKQ A;  4F0M A;  4ENO A;  3OW2 R;  2VQF J;  4OYO A;  4QIE A;  3KUH A;  4LBI A;  1XJW B;  4DLE A;  2COL A;  1Q78 A;  2RT3 A;  2DRA A;  2HRY A;  3U1N A;  4IFV B;  2G0C A;  4K5R A;  3I0R B;  1NK8 A;  2YKO A;  4DBQ A;  4DCJ B;  1VGY A;  3DRS B;  1TK5 A;  2EBG A;  2OSR A;  3U7J A;  1VQK S;  4OL8 A;  3GIJ A;  3SXL A;  4ZJO A;  1D9A A;  1S9E B;  1RAG B;  3TVZ A;  5KG6 A;  3UD4 P;  3MPD A;  4EI2 A;  2QTW A;  4OHW A;  4Y2C A;  3OD2 A;  3N01 A;  5B0B A;  2HHV A;  1GAO A;  3UD5 A;  1B0T A;  1NZA A;  3TUJ C;  3M2U B;  1NDL A;  4TNO A;  2HVD A;  1VRU A;  2YWF A;  3FFI B;  2DH8 A;  3TEH B;  4KT0 C;  3MMA A;  1FJE B;  1R6V A;  1S59 A;  3PRV A;  4LFC J;  3LQV A;  4QJV A;  2LXU A;  3ZZO A;  2MZJ A;  3J7A 1;  4I6Y A;  2MST A;  2QA4 G;  3PV8 A;  2DNR A;  4DU7 A;  2GQQ A;  5K8M A;  2RNE A;  4Q5V A;  2RH3 A;  5EX3 A;  1S9G B;  4IOC Q;  3CO0 P;  2QGF B;  2V8P A;  2MZS A;  5H9F K;  5CYM B;  2X51 A;  1XBW A;  3ILL A;  4EUV A;  1R7I A;  2JH3 A;  3PO4 A;  3HK2 A;  2HMI B;  2ILY A;  4OX9 F;  1CG2 A;  1V3Z A;  2DNL A;  2DIU A;  4H4O B;  3PHT A;  4IRD A;  2RQC A;  1YK9 A;  4X4V A;  1KOH A;  4FYW B;  3SSS A;  2YX4 A;  3LH2 S;  3GP9 A;  2MLZ A;  3KK3 A;  3EE3 A;  3BN7 A;  2VOD A;  1X4C A;  2IMW P;  1RHK B;  2RD5 C;  4A8X A;  1UA0 A;  1W7W A;  3B4M A;  3DRP A;  3IC1 A;  1IXK A;  3V2U C;  1YSJ A;  4X4O A;  2K7K A;  3T6B A;  3UDC A;  2BJ7 A;  5D3G B;  4DX7 A;  1T05 A;  1TQL A;  5KFP A;  3UCU P;  4HHU A;  4ZP8 A;  4HI1 A;  1T03 B;  2GHP A;  1NKE A;  1SIZ A;  1YIT S;  1EQM A;  5DZ6 A;  3PX4 A;  2B4V A;  5BR8 J;  3ZTS A;  2EG2 A;  4ED4 A;  1SXL A;  2HWH A;  4ERD A;  4QWC A;  4JOU A;  4USW A;  1VDH A;  1VQO S;  3MM8 A;  4I2P B;  4OV6 A;  1NUE A;  3TA2 A;  1DLO B;  4ES3 A;  3K8V A;  4X4T A;  1G2E A;  3IP0 A;  3OFE A;  1N8R T;  3FQK A;  3GLJ A;  3P96 A;  3NGT A;  4RJV A;  1ITP A;  2F7V A;  4LFA F;  1CLF A;  3ET6 A;  1BD6 A;  3JYT A;  5EN1 A;  4UST A;  2IJN A;  5K14 B;  3KG0 A;  5KFV A;  4WJB A;  1TKT A;  2UUC F;  3H42 A;  1FNO A;  5KFO A;  1U8W A;  1JLB A;  3G87 A;  4CLT A;  2M52 A;  4QR1 A;  2V2Z A;  3PYD A;  2YBV A;  1UAW A;  3RU0 A;  1FJ7 A;  3HP6 A;  1C4C A;  3MMC A;  1JLQ B;  1S4F A;  1UJ6 A;  2R7Q A;  3KUG A;  3FEY B;  2G1H A;  4RW9 B;  2VPX B;  2VB6 A;  2V4J A;  4WK1 A;  4PAA A;  3ZNU A;  2CIM A;  2FGC A;  3WIV A;  1TV6 A;  3OTO J;  4PPD A;  1Y4Z B;  2MKJ A;  1X4G A;  4NXN F;  3DOL A;  2U2F A;  4NOH A;  4C11 B;  1NCL A;  3A8I A;  1L3U A;  4ED0 A;  2DO0 A;  5I3U B;  2RDJ A;  4EYI B;  2MPU A;  2YVS A;  2Y1R I;  4U7U K;  1S72 S;  4J9L A;  1HBU A;  4IRC A;  5KT6 A;  2YNF B;  1VMB A;  2X1A A;  1T9X A;  1C4A A;  2KU7 A;  4NEZ A;  1HMV A;  1P8G A;  1S6O A;  1Y5L B;  4CDI A;  4KAI A;  1BUX A;  4LF8 F;  3W8G A;  3K5P A;  4ZK7 M;  2QFI A;  3RB4 A;  4P71 A;  3KLH A;  3NCQ A;  5EWF A;  1LWE B;  5J2M B;  4OZ1 A;  4TY8 A;  2IIH A;  2Y8W A;  3BGR A;  4MTP A;  2AJ4 A;  2J0S D;  5D78 A;  1C1B B;  1RAA B;  4ZP7 A;  1W26 A;  1H38 A;  2DNH A;  4HH1 A;  4IO1 A;  2MQO A;  3HVT A;  4UF4 A;  1TK8 A;  1TR0 A;  2CDQ A;  3G82 A;  1T95 A;  4K59 A;  1S1T B;  3LOU A;  3R1L A;  1TKX B;  3G86 A;  2XMV A;  1U1M A;  1KNZ A;  2VFR A;  2F65 A;  3QIP A;  1JQG A;  4KYZ A;  5EX0 A;  1EET A;  2VFT A;  2H51 B;  1JJ4 A;  2KDO A;  2C2O B;  1F0X A;  3DI6 B;  4CLP A;  3CPW R;  4NYP A;  2F4V F;  3NEK A;  3LAN A;  2EXU A;  4J7C A;  4O44 A;  4N8O A;  1XNR F;  4Z7Y A;  2EK1 A;  4ZPT R;  4Q7A A;  1U0H A;  3FRY A;  2NXJ A;  2WZ1 A;  2VIH A;  1P6T A;  4D3H A;  4MFB B;  2HHP A;  4OHV A;  3EGZ A;  1WOR A;  1OQ3 A;  4TXS A;  1F5A A;  4WU3 A;  4YR3 A;  4R0E A;  1PJ6 A;  4GC7 A;  3VAK A;  2ZH7 A;  2C28 A;  1RBL A;  3K17 A;  3HHD A;  3VF0 B;  1O0P A;  3MD1 A;  3KHL A;  2G9O A;  3A4T A;  4X65 F;  1S48 A;  2IM2 A;  1ZS6 A;  4B17 A;  4ZP9 A;  1JWW A;  1JXL A;  4EGL A;  4RBV A;  3N6M A; 
#chains in the Genus database with same CATH homology
 4WP3 A;  3G82 A;  5IV3 A;  3C15 A;  4OYP A;  1CJT A;  5D0G A;  1TL7 A;  4OYO A;  1CJU B;  4CLL A;  4CM0 A;  1YBT A;  4USW A;  1WC1 A;  4OZ2 A;  2GVD B;  3G82 B;  1WC5 A;  4OZ3 A;  3C15 B;  4CLU A;  2QV6 A;  1CJT B;  1FX4 A;  3MAA A;  1TL7 B;  4P2F A;  1AZS B;  5D0E A;  1CS4 A;  1CUL A;  1CJV B;  4OYX A;  4CLK A;  4P2M A;  1WC6 A;  4CM2 A;  1YK9 A;  4CLP A;  3MAA B;  4OYB A;  5D0R A;  4WP8 A;  1CS4 B;  1CUL B;  4OYW A;  5D0H A;  1Y10 A;  4OYZ A;  1U0H A;  4WPA A;  3ET6 A;  1Y11 A;  2WZ1 A;  2GVZ A;  4UST A;  1FX2 A;  3UVJ A;  3ET6 B;  1WC4 A;  4CLZ A;  4CLT A;  1YBU A;  1CJK A;  4CLF A;  4WP9 A;  5IV4 A;  4NI2 A;  1WC0 A;  4CLS A;  3UVJ B;  1AB8 A;  3MR7 A;  3C16 A;  3C14 A;  3R5G A;  1AZS A;  4USV A;  4CLY A;  1CJK B;  4OYM A;  1CJV A;  4OYA A;  4P2X A;  1WC3 A;  1U0H B;  4CLW A;  4NI2 B;  2W01 A;  5D15 A;  2GVZ B;  4OYI A;  1CJU A;  2BW7 A;  3C16 B;  3C14 B;  2GVD A;  4USU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...