1WC3A

Soluble adenylyl cyclase cyac from s. platensis in complex with alpha, beta-methylene-atp and strontium
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
198
structure length
198
Chain Sequence
SHMRPEPRLITILFSDIVGFTRMSNALQSQGVAELLNEYLGEMTRAVFENQGTVDKFVGDAIMALYGAPEEMSPSEQVRRAIATARQMLVALEKLNQGWQERGLVGRNEVPPVRFRCGIHQGMAVVGLFGSQERSDFTAIGPSVNIAARLQEATAPNSIMVSAMVAQYVPDEEIIKREFLELKGIDEPVMTCVINPNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADENYLATE CYCLASE
publication title Bicarbonate Activation of Adenylyl Cyclase Via Promotion of Catalytic Active Site Closure and Metal Recruitment
pubmed doi rcsb
source organism Spirulina platensis
molecule tags Lyase
total genus 65
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 4.6.1.1: Adenylate cyclase.
pdb deposition date 2004-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 1wc3A00
4CLYA 4CLSA 1WC5A 4CM2A 2QV6A 3MR7A 4USWA 2W01A 4OYMA 2GVZB 4CLPA 2WZ1A 5D15A 4WPAA 4OYXA 1WC0A 1CS4B 4OYOA 1CULB 4CLUA 1FX2A 4WP3A 1FX4A 4USVA 4P2XA 2GVZA 4OYWA 3C15B 4OZ3A 1AB8A 1CJKB 3C16B 1CULA 4CLWA 5D0EA 1CJTB 2BW7A 4OYBA 3C15A 4CLTA 1CJKA 5D0RA 5IV3A 4CM0A 4USTA 3C16A 2GVDB 3ET6B 4NI2B 1YK9A 3C14B 3MAAB 4OYIA 1CJUB 1WC4A 1WC6A 1CJTA 4OYPA 1Y10A 5D0HA 1CS4A 4P2FA 4P2MA 4USUA 4CLZA 4OZ2A 2GVDA 3ET6A 1Y11A 4NI2A 3C14A 3R5GA 3MAAA 1TL7B 1CJUA 5D0GA 4CLFA 3G82B 1YBUA 1CJVB 4WP8A 4CLKA 1AZSB 1U0HB 3UVJB 1WC1A 1TL7A 5IV4A 4OYAA 3G82A 4OYZA 1CJVA 1WC3A 4WP9A 1YBTA 4CLLA 1AZSA 1U0HA 3UVJA
chains in the Genus database with same CATH superfamily
2YQ1A 1I51B 2YWKA 2I1RA 1S79A 2LU2A 5L46A 4QBUA 1RTDB 1WDDA 2AJFE 2CFXA 3ZZRA 1GMVA 1HWJA 4H4MA 2NXNA 1RB0A 4HDHA 2I8EA 4F4AA 2J6SA 1OQ3A 5K14B 2MPUA 5E7OB 2HZCA 2A6OA 4MTPA 2ZC3A 5L9NA 4WFBQ 2RUGA 5L1KA 3C15A 3KLEB 4Q8EA 4XDDA 2E1AA 4DG1A 1DHMA 3HD1A 2ROGA 2HFUA 1PYOB 2EK6A 4M8LA 3RYLA 1YHQS 3V6JA 5CXTA 1KQFB 3KJNB 1K44A 3PW2A 5IZHA 1ZZFA 1U45A 1RWKB 2QFJA 4L74A 1SC6A 2B8QA 3HFKA 2HHHJ 3NNAA 3KLVA 2YH1A 2YWGA 2HNYB 4ICLB 3TNVA 3MPDA 3DLKA 4ZP8A 3M8RA 5HBMA 1T7PA 4L6V3 1TKTB 4FYVB 2BR0A 1IBKF 3G8QA 4YB7A 1UA0A 1OMSA 1U02A 1N0VC 3R27A 2AJ1A 5CAAA 4ZHRA 2CPDA 1JKHB 3RR7A 4OV6A 1L3SA 2JNJA 2YWEA 3AD9C 5KG5A 2BXJA 5IT4A 2HHHF 2RS8A 3M9OB 5IC6B 4LBIA 4NA2A 2V0NA 3KTQA 1RADB 3GIMA 1Y4ZB 2LQ9A 1YJNS 3Q22A 3TUIC 5F9LA 3GJTB 4FXDA 4GVBB 2H4YB 2H54B 1R8BA 4DN9A 3RZAA 1RP5A 3MM7B 4QR0A 2DXFA 4J5OA 3P49B 4H54A 2CYYA 4OI6A 1ZPWX 3CE8A 4KV8B 1HI1A 1FKAF 3B82A 4X66J 3EGWB 2ZH8A 2L48A 1KLMA 5J2MA 4W90B 4B9UA 2AYMA 3WBZA 3A8IA 4QIFA 3WQPA 4RNHA 1LW0B 3IMQJ 3HT3A 1FT8A 3DHWC 5DQGA 3BSCA 3GP9A 2HS3A 4F3OA 4QIEA 4DR5J 3SQGA 1JQGA 1YLXA 1M1HA 3G6YA 4ED7A 2RU3A 4KHRA 2DR7A 1JLEA 1XNRJ 2VOPA 5J2QB 3MM6B 4X66F 1WUUA 3HHKA 1SKSA 5GAEI 5L1LA 3BGRB 4C8KA 3N79A 1B0TA 4PABA 4DPTA 4B3MJ 2UVWA 1S12A 4JI1J 3DLHA 1H38A 1REVB 3KK1A 5M2RA 1RAHB 3GIIA 4LSLB 1PBAA 2VDHA 4JUZA 3LALA 3DLLQ 2ZZNA 2QL7B 5A8WB 1DLOB 4DN0A 3POTA 1ACMB 4GO5X 3OHBA 2D74B 2IM0A 4QIVA 1N5YB 4OYAA 1RKIA 3PIPQ 1F9FA 4YDDB 3VCDA 1RJJA 1C1BB 1SV5A 4I0WA 4JV0A 3MM8A 1RBLA 5DS7A 3UVJA 4JI1F 2Q1LA 1NDCA 3I9V9 1EZZB 2DNHA 1F3FA 2MQNA 3MOJB 2BOPA 3QSIA 3SCLE 3HSJA 2BJ3A 2YKNB 4PCQA 2CNNB 4C3KA 1TAQA 3OFHA 1AUDA 2FC8A 1VJWA 2VFUA 2HLUA 1I6JA 2E9RX 3M05A 2P9GA 1KSPA 2LMIA 2LU1A 5FJ4A 3D67A 5IQ6A 2MXYA 1JLCA 4CO5A 2J7WA 2HHPA 2HHWA 4IG0A 4OHZA 2I5JB 4GKKJ 3FUYA 1FFGB 2M5YA 4DSKA 3OBIA 4DV2J 4NLYA 1CJVB 2EBEA 2YKAA 4NZ6A 3FEYB 4ZITA 2F63A 3CD5A 2FJBB 2KFZA 3MOZA 1XBWA 4CP5A 2HHTA 2AD9A 1JXVA 2VASA 1LWFA 1VIXA 1ZM4A 2A2CA 4CLSA 3PDNA 3PM9A 1RAEB 4DR1J 2DRAA 4NZ0A 5D15A 4JYAF 4WK1A 3IXQA 4O3QA 4GKKF 4B3OA 1CS4B 2HQIA 4Y2AA 1R89A 2EFPA 4AQYJ 5HMZA 4NASA 4P2SA 5HMWA 4DV2F 4ZVFA 2CJKA 2WB1D 2DIVA 3GMGA 5AT1B 2ZH3A 2ZUAA 4ZN1A 3GB0A 1EQ0A 1RZMA 5EHHA 4CM0A 2VG5B 4O0IA 2V63A 2HIYA 2M88A 1K0TA 1S1TB 3JSYA 2R2RA 2K8GA 2BA9A 1WOPA 2XZDB 3I55S 3K5MA 4B9SA 3HXMA 3K57A 1R8AA 4MKAA 3TA1A 4DR1F 4USUA 2H65B 4LQ3A 4K0KF 4OI3A 2KVQE 1TZ0A 4K4TA 4I2PA 4AQYF 4NYZA 8RUCA 1VQPS 2ZWPA 3SCKE 3DRSA 3MCNA 1H72C 1MROB 1U8SA 1IN0A 1DJ0A 1RHRB 4O3OA 4F26A 4LSNB 4J9UE 3MEDA 4J9OA 2EK1A 2XWYA 4XTTA 3G96A 5IT0A 3PKYA 1U48A 3K5LA 1HWKA 1VRUB 4RW4A 2DNGA 1TELA 3Q89A 1LWEA 1U49A 2IJRA 3THPA 1RKJA 3TAQA 1XNQF 3RW7A 1VQNS 4ZJQA 1BLUA 1BC6A 2GS8A 4DJBA 2QG9B 3ISZA 4CLWA 2XMMA 1NH7A 3CIZA 1GTHA 5BR8F 3J81j 2YVSA 4M94A 1RWOB 2UVVA 1NJIT 3AHPA 7FDRA 3OL6A 1T11A 1U1PA 1UMJA 2E5LJ 4G1PA 1V3SA 3TI0A 1S76D 3HT0A 2DEIA 4HYKA 2L3MA 5I4MA 3ZZZA 2KJVA 3JAMY 2DK2A 5KFCA 4EUVA 2EWHA 5D3GA 3NKYA 1IR2A 4D3HA 2DGUA 2AYEA 4WKYA 3OW2R 1MN7A 4QQBA 3H5YA 3Q8YA 2XMJA 2FD2A 2BQ3A 4IDKB 3ITHB 2V68A 4J91A 5HVFA 2E66A 4RO0A 3BSOA 4WPAA 1NK6A 1X0PA 3QGIA 3EM1A 2L9DA 5HQLA 1VS3A 3KNAA 4YR2A 1E6VA 3N01A 3HSZA 3Q2SC 3RRGA 2CNKB 1LFPA 5KG0A 1CEZA 4ANCA 2FLOA 2XMVA 4JI4F 1B0VA 3X1LB 3TAMA 3N6NA 2M3DA 1V3ZA 3C66A 2Z8QA 3W9JA 1S72S 5U47A 1FEHA 2A1BA 4PWDB 2HAIA 5D6GA 1UJ5A 1X5OA 2FDNA 5HI7A 3RG6A 5CA5A 2XYGB 4CLFA 2HBYB 2KN4A 2HFSA 2UUAJ 4A8MP 2Y1RI 2BRKA 3ZC4A 4Q0BA 5ETLA 3MTKA 4RWWA 4NRUA 4PYDA 4M5KA 2YPZA 3ZZOA 3CDBA 3C8YA 1WC3A 4QOTA 2RSQA 3D28A 1XR7A 3ZXWA 2R8GA 4Q43A 1RI7A 1W7WA 1N36F 1FRIA 2NYIA 1S1WB 2CZVC 1KS2A 2UUAF 5LJ5Y 2YKOA 1IWGA 2ZD1A 3Q83A 3H20A 2MQPA 2UVUA 1OSDA 3HP6A 4KFBB 4KR0B 1VJQA 2IDLA 4ELUA 2C2DA 2YKMA 2GVDA 5LL6d 2CNLB 4J9QA 4K4XA 1G6BA 1RT1A 3DLEA 3D0HE 2OTJS 3Q8QB 1C2PA 2W2NP 3MECA 3O6QA 2UUBJ 4LVOP 4ED4A 1F9HA 1AZSA 2KXNB 1ZPVA 5EX0A 1UEUA 3M2VA 4USWA 2FY1A 1VQ6S 4ECZA 3UN5A 3HVAA 2GV1A 2MQMA 2WOMB 4IO9Q 5LJ3Y 2IRUA 1WHVA 3PV8A 3ZO7A 2Q3PA 4KB7A 4C8NA 4YY3J 4QU6A 2GO9A 2BW2A 4EK2A 1UJ4A 5JMNA 4UF4A 4HVZA 6FD1A 1I94J 3ILJA 4KAIA 4NA1A 3QZ7A 3I31A 1X4AA 1TV6B 3ENWA 4M5DA 2OPRB 2DH8A 3CDUA 3N9UC 1TL7B 3QFHA 3NEKA 1NJWA 1JNRB 1DRZA 5C24A 1J5OA 5F41A 3W66A 1LOUA 1QAYA 3NS5A 1SCJB 3H5XA 1S57A 3BGUA 1NHKL 3PZPA 1FRLA 2XHCA 1B4SA 1KHWA 1RSCA 4K5RA 3DMJA 2FB0A 3E2EA 1RLCL 2HVZA 2Z2LA 1I94F 1RYRA 1UPPA 4ES2A 2N4CA 2FTRA 4B3RJ 2RILA 3OLAA 4GVLA 2VG7A 3NGDA 2HWHA 2N3OA 1RWUA 1Y5LB 2W2PP 4ECXA 1UETA 2Y8YA 3R2CJ 4LF1A 1SBRA 4RKUC 4B08A 2XSJA 1FI4A 1KRPA 2HNDA 1JLAB 5KFMA 2AJ4A 4WWSA 2FHKA 1JWWA 4ED0A 3NOGA 1OY6A 2HQDA 2BKOA 5K8PA 4P72A 2MGZB 4IFVB 4ED6A 1BY9A 3E3XA 2DNPA 3L7UA 4B3RF 2OI2A 2E29A 2E1RA 2VKZG 1L5UA 2RQKA 4LQ9A 2QA1A 2ZWOA 2B5JA 2KB2A 2RUSA 3BR9A 4UOHA 1ZZNA 2V2VA 3ENVA 2I9SA 2W9AA 1FXRA 1MU2A 2VFRA 3PRBA 3RB6A 4PWUA 1WI6A 2XGQA 1FDBA 3KYLA 1RU1A 2W4CA 1TK5A 2E7VA 2MQ8A 5DQIA 1NAQA 2KI2A 4IR9A 3PRVA 2KL8A 1BQNA 4DV4J 1U7LA 3H42A 4C98A 2QV6A 2ASLA 4FZVA 4TXSA 2CPIA 2OP5A 3KJVA 3BSNA 1HWLA 1F2GA 4FP9A 3PYFA 2GNKA 5HJXA 4LF7J 3I6PA 4OZLA 1IVZA 4J9NA 5KFHA 4JV5J 4FKYA 4GC7A 2MHNA 2QLBB 2LQ8A 1UVLA 3NNHA 2Y9HA 1ZH5A 1H74A 4I68A 1DQAA 3KK2A 4DV4F 2ERRA 1CJTA 2DEJA 4OZ5A 2IVFB 1YX2A 1NU4A 5B0BA 3HZGA 2UVRA 2PN6A 2X3DA 4MIAA 2HK3A 2DO0A 4LF7F 1I3OB 2AZ3A 1QE1A 4JV5F 3VHQA 2CPXA 1I5OB 4X4OA 2WBRA 5IV4A 2FC9A 1ZM2A 4LSZB 2ZHOA 2K06A 1QSSA 2VFSA 3NGRA 5HO4A 4YR3A 2MJNA 1DARA 2FUG9 2C2ZB 3R7BB 3TVYA 3SIPB 2M4MA 2CG8A 2D3O1 1RTHA 2JOQA 2V69A 3W64A 2BBEA 1UA1A 3KJQB 3KG4A 3MEKA 2CUYA 2K2PA 2FHMA 2GJFA 4IH6A 3VGVA 2EKYA 2W2QP 4J9KA 2XULA 4C9DA 2FHJD 3ZNJ1 3GE9A 4MIWA 5DDRC 1YZ6A 5F8HA 2R7WA 5EX3A 2CVIA 3DM2B 4RW9B 2VA3A 1M5OC 3GFHA 3CD6S 2QFIA 1ZTWA 1RT6A 4RW8A 2V9WA 2QL5B 3WDOA 2RRAA 4NXMJ 3GLJA 5KFUA 3T3FA 4I67A 2CQCA 2XYHB 3PYDA 2C42A 4YQWA 1NB7A 3PYGA 1R3NA 3NCQA 3JXOA 3A12A 3SSQA 2MQLA 2YWHA 4O4GB 2LCWA 1FF2A 2HW3A 3OL8A 4RNMA 1DAXA 5G0RA 1A0OB 1C0UA 2ZBQA 1RTJB 4QR2A 3PKMA 2XMTA 1RTIA 2J7UA 3DOMA 1KQGB 1H7WA 4NXMF 2NQPA 2HFVA 2OTLS 1YJ9S 4F0MA 4OYXA 2Z58B 1WOSA 3O8WA 2XSFA 2ZJRQ 1KKHA 4DS5A 4WP3A 2EFQA 2DRBA 4DL0C 3UDEA 2QLXA 2D41A 1TFWA 4U7CA 2LYVA 5EDWA 3BREA 2B4PA 4C8MA 2IM3A 3D1OA 5CYQA 1IM4A 1JXLA 3RGIA 3DU6A 3KLGB 3H98A 4HH0A 1CJUB 3I0SB 3LWLA 3U1NA 3GIKA 4DX7A 4TU9A 2KHCA 3AA9A 4A8YA 3QIDA 3QAEA 3A13A 1JNZB 4AFFA 2AU0A 1LFWA 2XLJA 3MPYA 1X9SA 2YNFA 4N56A 1RABB 2XI2A 4QIGA 3MUTP 4MFBA 5CZXA 3LP1A 1VQ5S 1XTZA 3FFIB 3MAQA 4LF9J 3ZZ0A 4UUWA 4QPXA 3JSMB 3CCMS 1BQMA 2BDPA 1T03B 4CLUA 3ZZYA 4NYOA 3JQJA 4NLSA 4W4MA 1S9FA 1N0UA 4USHA 1A9NB 2PMHA 4FVMA 4WE1A 1WEZA 2RHQB 5GAGI 5FLXU 3MM9A 3TA2A 1P8GA 2R7TA 3LP2B 2R7UA 2AYBA 2RU9A 4A8QA 2R7QA 4JI7J 1BGXT 2AJQA 3BO4A 4NL5A 5DG9A 3GG1A 2BJEA 3KFWX 3W65A 2HHVA 2HZVA 3V6DA 4IO1A 4HACA 2HK2A 5KFSA 4Z7YA 4JV1A 1HLWA 4WFAQ 2F8HA 2XI3A 5KFIA 5K20B 2HS0A 1WTFA 1HYSA 5AXMA 2I2YA 1FEEA 3TVZA 2JRSA 3CCUS 1VQKS 3OV7A 2CZ9A 4R8UA 5SUHA 1WG5A 2VB6A 1YTYA 4JI7F 1YJWS 2QGFB 4H4MB 1SI9A 2D3OR 2KYZA 1ZS6A 2BM1A 4QR1A 2F7VA 3W2VA 5MLCV 4LRBA 1O51A 4DI6A 2E44A 2A18A 2P6TA 4O3PA 1X4CA 1S9EA 4P2XA 3C15B 3VAMA 1AB8A 3NCPA 3DGVA 4DG1B 3BQ2A 1OPZA 5IFMA 5A6PA 1PYTA 4J90A 2JEGA 2POKA 3EGZA 4BC9A 4N8NA 3MR6A 2B4VA 2AV5A 1GH8A 1EP4A 5GVQA 3C46A 2VBZA 1IR1A 3VAGA 1LXNA 3Q2TC 1TAUA 2EG1A 1YJTA 2WW4A 5E5NA 3QRQA 4RW6A 3H7HB 1N52B 4ANEA 3DLKB 5HBMB 2DH9A 3A8JA 4DUZF 1RHQB 2MLZA 1P1TA 1VOMA 4PXDA 3SZ2A 2X3GA 1RUSA 1RHJB 3ZZPA 2DNZA 1UPMB 2LFVA 1B64A 4ZHRB 3V4IA 4MKYA 4DBQA 2LDYA 1GAOA 1WC0A 3OHAA 1MWQA 4ZA1A 2FZKB 1WSRA 1IBLJ 4UUXA 3M7VA 4WIIA 3DGPA 4K4UA 4DR7F 1FKPA 2OGUA 3LA0A 2VPWB 4CDIA 2F4VJ 4QYZJ 1N88A 1HBMA 3C16A 2ATCB 4N77A 3FVYA 3LGHA 2RDIA 3MMBA 3PNIA 3T1AA 3K7RA 3RUBL 4EBDA 2WW8A 4IFYA 4FN5A 2RRNA 3NOCA 1KLMB 5J2MB 1IBLF 2ZZMA 1S0OA 3LAMA 1TUVA 2QYCA 1U0SA 4NCBA 1OPIA 1B99A 3G2XA 1KEKA 4ZLLA 4CO0A 1NZ8A 2BX6A 1NPRA 5KG3A 3H2LA 2WSEC 4LFBJ 4LR7A 3D1QA 4ID5A 1U2FA 1ICEB 3SQGB 2HG4A 3PHEA 1QUPA 1N54B 3GIJA 5LM7E 1JLEB 2VC1A 4USJC 2OHDA 3US5A 3UPFA 3FEZA 2LA6A 1FNMA 2G1HA 1S4FA 2Q6BA 3HM9A 4KC5A 1P27B 3NRBA 3KK1B 1M90T 5FIIA 3GCXP 1HPZA 4AL5A 4GRSA 3G71S 4AXJA 4OL8A 5F9NA 1T0TV 3BF4A 2CDQA 2QC3A 1K1SA 2LDIA 3POTB 1CVJA 1A6LA 2PC6A 1NHUA 1WOOA 4IQMA 4CI0B 2E1MC 5CCMA 1SV5B 4ZVTB 4ZKAA 1ROFA 3MM8B 3OVSA 2K7KA 1HBOA 3UVJB 4ALZA 4ZCKA 3EMTA 4IH7A 3O5TB 5T7LA 3P4UB 1HARA 3EXYA 2XYPB 4YR0A 4I6YA 1TFYA 4KH1B 2EKNA 3RAXA 4NLRA 1T3OA 4CO2A 2DBBA 1G4CA 3AOAA 3QT6A 4CLPA 3L9ZA 3MPVA 2P2CB 5IC4B 1QY7A 2CPJA 2HQCA 4DUYJ 2CPEA 5L1JA 1G3OA 4PG8A 2IJFA 1M1KT 2GAHC 4I2QA 1JLCB 3BV8A 4CZCA 4QW8A 1ELOA 4JI3J 4IG0B 2QYGA 2DT9A 1TK0A 1HW8A 3RB4A 4ZPWR 4PAAA 1L3VA 1UP1A 3M32A 4P2MA 1FE0A 1RU2A 3C14A 1WSVA 1VRTA 3OT9A 4DV1J 4OJHA 2Z0GA 1FNOA 1F9EB 5KOWA 2HMIA 1CQNA 1LWFB 3AQPA 3PX0A 2W24A 4DX8H 4JI3F 4OQJA 4HI1A 4A8KA 4FXVA 1QAIA 2FVRA 3QGHA 1U0HA 2OEKA 4B3OB 2CKWA 4CLYA 2BJ9A 5J1EA 2L41A 3K59A 2F9DA 4OI2A 4RX6A 1VBYA 4E98A 3QPIA 1IJEB 5MAOA 5J2NA 4DV1F 2F4FA 4K2JA 3OTOF 1YRXA 2ZNYA 2HS4A 2IA6A 5A2QU 3IAM9 3W2WA 1Y3JA 3CW2C 1WWHA 2KRRA 3H0PA 3LO3A 1IQTA 4LREA 1PAEX 4R0EA 5GAHI 3VGUA 2HIQA 1X9WA 3EJMA 4ECVA 4I2PB 2B56A 5KFBA 2QSFA 4F4WA 1SPBP 3DRSB 4TQRA 4FYYB 1FDAA 3IAS9 2ZE2A 3T19A 3UQSA 3KLHA 1KVKA 3ZTPA 2H48B 4ILRA 3MEDB 3PR5B 4DV7J 2DNNA 4LF8J 2CJXB 2W7AA 3P5TL 1ZOTA 4RW4B 1IKWA 4IRCA 1W25A 1LWEB 2HVIA 1K1QA 1WACA 3AB4B 5GMDA 1Y0HA 4EEYA 1HNVA 4BBYA 2A6MA 4ZP9A 1HHTP 4P9SA 1BMQB 4TKTA 1KQKA 2PA8D 4QZVB 4ZVSB 2YX7A 5KFOA 5E41A 4LF8F 2BW7A 4X64J 1TP7A 4TNOA 2OFHX 2ZJQQ 2GCFA 2KVIA 2LKZA 4CRJA 5M2PA 5ADZA 4X65F 1KP6A 4UOGA 4CCHA 2JEIA 5D3GB 2XS5A 2JH3A 4PR6A 4J7CA 4CIOA 1LNQA 3TVKA 1U6ZA 1D8ZA 4ZPVR 2ZVIA 2YX4A 4NLWA 3CJ5A 2ZDPA 3VZIA 4X64F 4CTAA 2YNHA 2VZ9A 2IDEA 2C2OB 4IG3A 1CC8A 2J7KA 2JLEA 2BOAA 3QRRA 1DQ8A 3GZ7A 1YG0A 1E6VB 3PXGa 2R42A 5IM0A 5E0OA 4WXWA 3TAMB 1U1RA 2A2DA 2WVDA 3CCQS 1CLFA 4HH1A 1CG2A 3N5BA 4KPCA 1J27A 2ACYA 4Q7AA 2D3UA 2QMUB 3TO8A 3SMZA 5HQ8A 3PW0A 1R7IA 1KVIA 3MFIA 3DN9A 3MWBA 2CJAA 4FS2A 4AXIA 1YK9A 4DL3A 1PGZA 1OO0B 4X4NA 1XMBA 1AW0A 2KXHA 3J81U 2XY7A 2Y1JA 3EUNA 2ZH1A 3WZ0A 2OPSA 4IQXA 5LSOA 4Q0BB 4M95A 3NWGA 2KHDA 2FLLA 5EN1A 4IOAQ 1UTAA 1T9XA 2HGLA 1RBOB 1UWAA 1VISA 5ETKA 3MMAA 3T9NA 5KFQA 1HNZJ 3NS7B 1K0VA 2ROPA 2HKEA 4YMEA 3FBEA 1XR6A 4DSJA 3OLBA 2ZD1B 1HQ2A 2B9YA 4L75A 4HL9A 2FHOB 2N3LA 2AMCB 2KT5A 2B0GA 1HMVA 3RB0A 2VIHA 2HFNA 2XMUA 4L3KA 1NKCA 3GJSB 2AJ2A 1FD8A 3LWMA 2E7XA 4S0MA 5AXKA 2YKMB 5F3TA 2UUCJ 2GVDB 1RT1B 3DLEB 3GSIA 3I82A 4DSFA 2K3KA 1HNZF 1KR4A 3AA8A 1TUWA 3EDQB 3H2UB 4RNNA 3NMRA 3A1YG 4NPOA 3VV2B 3IG1A 4LRDA 5A0YA 1SUQA 1HQEA 2IC3A 1H0HB 1AZSB 3RAMA 2ZKTA 3AQOA 1DTTA 3M2VB 3QFWA 4TN2A 1WHYA 1HNIA 1CSJA 1M5HA 2UUCF 1G7CB 4FYWB 2V4RA 1LW2A 4IRDA 1PILA 2C2EA 4NLDA 1OY8A 4CNYA 3NWRA 3CCVS 1PC4A 1QD1A 4XAKA 3BB5A 1T05A 2XO7A 4M5DB 4V19X 1YITS 4FYXB 4FF3A 3R5DA 4C2MA 4ES1A 4ERDA 4FDFA 5C24B 2MKSA 1J5OB 5C2CA 1AFIA 1SXLA 1XIQA 2ZEJA 2ZH6A 3TJ8A 2J0XA 1X5SA 3DMJB 2ZH9A 3FMWA 2RB7A 3GJQB 3AOCA 5I3PA 3K17A 4MAKA 4JI8F 2XHWA 5KAKA 4YB6A 2KU7A 4X4SA 5KFWA 3R3TA 4PXBA 1VQLS 2VG7B 4QYZK 2VJVA 4OZJA 4ZLNA 1N34F 4CWBA 2ZOMA 3W9IA 2KZMA 5KT4A 4Y34A 4AE5A 5B0AA 2XSJB 5D78A 5HVGA 4DR2F 2HNDB 1P9QC 3QT8A 3FQKA 1PSDA 2XBPA 2V8PA 1EX8A 4X4QA 4X4PA 3R2DJ 3OXFA 2J8AA 3RAQA 3IN5A 2LEAA 1FDNA 3N28A 2C28A 2IMOA 4NX9A 3TR5A 4DR6J 2N4DA 2B5JB 3F44A 3TX0A 5KG6A 3ILLA 1HW9A 3KKFA 3DDKA 3TRGA 1ZETA 1TMJA 4H4KA 1MU2B 3DHXA 2H9ZA 3ZNUA 2ZHBA 2C3OA 1K73T 5D0GA 4F0HA 2EVZA 2F9JA 4KGZB 2C1EB 3GU0A 1RAOA 1BQNB 1AROP 3MR3A 4U7UK 5IXUA 1FVSA 3D6TB 4EFAC 2D7SA 2YH0A 3KJVB 2JFKA 5HATA 2VONA 2KT2A 3EZ5A 1NHVA 1KLNA 3HVTA 2XS2A 3GFYA 1X7VA 3OSNA 3HKWA 4ZIVA 3OVAA 4NZ7A 2VG6A 4EYIB 3H40A 1N8RT 5ETRA 3WX4A 1EB0A 1H2UX 3O2IA 1ZTTA 4IOBA 5HROA 2KRBA 3KK2B 2W2MP 4KGMA 1R0BG 1CJTB 1X4EA 1NO8A 3HX9A 2QN6B 2O66A 3NAHA 5CD4H 2DY1A 3CC4S 5DLGA 4ECUA 3B4DA 4NE9C 4A8WA 5I3UA 2CQDA 4OJGA 4LFCJ 3DOLA 1QE1B 2IIHA 1ITPA 2MYFA 5D8HB 4NWBA 4QW9A 2CQHA 2E7WA 2PT0A 3CB4A 2WONA 3SFUA 2MZSA 1NJYA 3I9ZA 1NDKA 1SQEA 4FS1A 2NSCA 4ZVGA 4J9RA 4F50A 2KFNA 3PJWA 5KFNA 3BBFA 4R5PA 2HGNA 1RTHB 3ZFVA 4F4ZA 2QMXA 4LFCF 2MQQA 1YJRA 1O8BA 2RMLA 1VQMS 1VBZA 3CD0A 4TVAB 1DTQA 3QMQA 1F5BA 2BE2A 2UV8G 1HHSA 3R6GB 2G2YA 4C11A 3TZXA 1J5EJ 1RT6B 4RW8B 3TEHB 2KG0A 5GADU 4BS2A 2LECA 2L08A 4ZMMA 2EC2A 3NMAA 1T3NA 3H4DA 2CQ0A 2JFDA 4F7VA 2Y1LB 2GIQA 3M8ZA 2CVEA 4DV5F 5HMYA 4P7VA 5LMUJ 3LQVA 4MH8A 2R7RA 3C3LA 4X4TA 1SJ4P 2XWXA 3G8SA 5G0RB 3CJ2A 2AIRB 4QIWD 4NLPA 2VV5A 1C0UB 3VAIA 1RTIB 5KFTA 2NYHA 2FLPA 3DOMB 3BN7A 1GX6A 2UXCJ 1VC6A 2ILZA 3ILOA 3KXDA 5J2PA 2ASYA 3HK2A 1CC7A 3AJDA 1V5VA 1U1QA 1DLOA 5LMUF 4ECWA 3FQLA 2XZWA 2ACMA 1FX2A 2R8IA 1NDLA 1OYEA 3QWPA 2RDDA 5CYQB 4LF5F 3PJ9A 3JSBA 4B3SJ 3LW5C 5I42A 2DNQA 2HURA 2UXCF 4NEZA 2WVEA 2O1PA 3LTOA 1OWXA 4WTOB 2GMLA 3T5JA 3UCZP 4LIRA 4WYLA 2EFOA 4K4VA 2YNFB 2G4BA 1MN9A 1C4CA 2QZ8A 4MFBB 4OJ1A 1VFJA 1UL3A 3LP1B 4PWWA 4A8XA 4EYHB 4YOEA 1TR0A 3S01A 3U1MA 1Q8LA 2DHAA 5KG7A 2R8KA 2AJ0A 2LQJA 2NREA 4RW7A 2RQ4A 4N7TA 4JI6J 1YIJS 4HT7A 1TKXA 1BQMB 4FKXA 4ZJLA 1RAIB 3J80Y 2LXUA 4LMZA 2VBXA 2AEJA 2OH2A 3R7NB 1EETA 5RUBA 2BQRA 4WE1B 2G0CA 4DL4A 4ZPBA 3MM9B 4G6VB 4E2FB 5DRKA 1URNA 4USIA 2UUTA 3BDPA 4V1Ak 3FRYA 4F0KA 4NYPA 4UQGA 2W7PA 2J6TA 3N6MA 4U9RA 4JI6F 2MKCA 4I6AA 1BD6A 4K2XA 3GYNA 4HACB 1CS4A 1YDLA 1UWBA 2X1BA 4KQZA 1HYSB 1VQ4S 4JI5J 3TA0A 3I56S 4DLGA 1WEXA 2GQQA 3G87A 1PIEA 4R8UB 2LLZA 2IJNA 3OUYA 3NBPA 1LWXA 2J5AA 3EDRB 2C2MB 3W2VB 3O44A 2DCUB 2J6UA 2ZH4A 2RKIA 3UFCX 3CJRA 2KXFA 1K8AT 2V8HA 1S9EB 2R7OA 4NLGA 1RWVB 5B0EA 2V94A 4WXOA 3I5CA 4JBCA 3Q24A 4JI5F 3CCTA 2NXEA 1VYAA 4TQSA 3MMCA 1Y3KA 3FGVA 5FD1A 1QVGR 3ENAA 2FJAB 2XY6A 4X2BA 4RJVA 4MYUA 1LV5A 3MEEA 4ZK7M 1EP4B 1TTHB 5CYMA 4ZPCA 3WIVA 5IV3A 2JZ5A 4P52A 3M6XA 2DKOB 3BS9A 1Y10A 4RW6B 4HTIA 1Q4RA 2HVHA 1RLDA 3CJKA 2W8KA 2XEXA 3OFFA 4OZ2A 3ELHA 2XMWA 1S1VA 3AAWB 1HBNA 1B3TA 2J0SD 4C3MA 4KT0C 3HHLA 4M5HA 1KONA 3KMSA 2JVRA 4QPTA 2RNEA 3V4IB 1WD6A 2D1CA 2N7YA 4TY9A 4OX7A 2VHGA 4USKA 5KFEA 3LGNA 2UXDJ 2RE1A 5AXNA 1Q8BA 3LP0A 4BHQA 3THVA 3KNGA 3DGPB 3GV8B 1FVQA 1FKPB 2NLWA 2Z56B 1X5PA 2R8JA 2BM0A 5F8LA 1FRHA 4QU7A 2K1RA 1Q1KA 2H4WB 2HYIB 1HBMB 3C16B 5GAGU 3FEXB 4ZJOA 2PE8A 3MFHA 4C0HA 3MMBB 1RCXB 4DR5F 4NLUA 3TZWA 2GAGC 3IO1A 2QO3A 4WYWA 3C6TA 4IFYB 4KHMA 5F0UA 1XNRF 2M9KA 1JLQA 4FXWA 5K8OA 3OPKA 3M9NB 3M8QA 1VC5A 2PDAA 3KLFA 2ZHAA 2VU5A 2UV8A 4B3MF 1NJXA 3UR0A 3BPSP 3I0RA 2IM1A 1HNWJ 4ID5B 2YWWA 2ZKUA 2WSFC 4ZPAA 4DHVA 4NLTA 4WFNQ 4DL2A 2M70A 4MT1A 3HKZD 1VK3A 4FF1A 3D3CJ 1MLAA 3MR7A 4NLOA 2WZ1A 2B7BB 2DB1A 1S59A 2XS7A 1S49A 2O67A 3UD5A 4DZDA 2K3IA 2OKQA 1HPZB 2OEJA 2QX0A 4AT1B 3F0NA 2KFYA 1M5VC 1TK8A 4TYAA 1FRJA 3JQKA 3F41A 1HNWF 2OUGA 2ZBCA 1DURA 4TU8A 1H7XA 4MKBA 3T5LA 4F04B 4I4BA 2KH9A 3CMQA 3MCSA 4OYIA 2QIFA 2OSRA 2QJ3A 3CJ0A 2G13A 4U7UD 3CGIA 1NSAA 1U1NA 3FCWA 4RBUA 4IOCQ 3Q86A 1HBOB 1KN6A 3DRPA 5T7LB 3Q8PB 1XJWB 1DZ5A 5CZVA 1AA1B 4KE5A 2CNOB 2JSXA 4MJKA 4B9TA 3CO9A 2VUGA 1Y7PA 2YPYA 3MR5A 3NP5A 3KLIA 4LF2A 2YQ0A 3RRKA 2Q43A 3IRXA 1C4AA 3HD2A 1BUXA 3KG1A 2FVSA 5KFZA 3CVKA 3LOUA 4XPEA 2BJ7A 4H4OA 4DF8A 4I2QB 4DSEA 1B7FA 4RNOA 1XN9A 3O3LA 2M8DB 1FWPA 3ZTRA 1U6BA 3GONA 3H90A 3DOKA 2QTWA 2F8MA 3BKTA 1JMTA 3M32B 2ZH2A 2C22A 2B43A 4EI2A 2CQBA 5ETPA 3C14B 1HA1A 1VRTB 4DUTA 4P74A 5IOLA 3GWCA 2ZBIA 1SL2A 4DZ6A 1N6QA 2BKPA 2HMIB 3DLBA 4CLZA 2Q66A 2H5JB 2ZH5A 5F8JA 4BWMA 2XLIA 4ZPDA 3DXSX 4G65A 3BZQA 2CQ4A 2R7SA 1R27B 4UZCA 4CLKA 1U0HB 3IBFB 5J1EB 3Q8SB 4YB1P 1D9FA 3OFEA 1VRQC 2R7VA 4EZ9A 2VPZB 1FCAA 2CQ2A 3D0GE 2OO4A 5J2NB 1HI8A 1PC5A 3W5XA 5E3AA 2U2FA 1PCAA 3FSYA 3ZZTA 1SJ3P 4QWBA 1GXLA 3W2WB 1VQ8S 2PO4A 1UFLA 2CQPA 3IWLA 4DDFA 2R2SA 3CD7A 8AT1B 4Q2MA 1IJFB 5E3CA 1W26A 2CDRB 1EHWA 3BDEA 4Q45A 1D9AA 5D4LA 3DXBA 2JC1A 2KT3A 3PW4A 5HMXA 2AX1A 2YY3A 3KLHB 3ET6A 2GC8A 3M1VA 5K9FA 1U24A 3RBEA 2DNKA 2X1GA 1WJ9A 1IKWB 4Z7CA 2GX8A 5KT5A 2E5LF 1U1MA 4ZDNA 2DR5A 2CPYA 3E01A 2OJ3A 3IWXA 2OELA 3L95X 2LEBA 2MGZA 2XGPA 1HNVB 1UVIA 2YTCA 1HKAA 1XR5A 3IR6B 1UKUA 1SC4B 3W61A 2XNRA 4P73A 4QWEA 1X4HA 4B02A 1PAUB 1FESA 4WIQA 3R6LB 4URQU 2ZJPQ 3THTA 3JAMU 3HI9A 3OTCA 3QRPA 2CA9A 3WX8A 2BACA 5CQGA 2U1AA 3P8BB 2VA2A 3MUVP 3MR2A 3TW0A 4MK8A 3AJ1A 1KBRA 2DXDA 3QGPA 1XMOJ 2W4DA 3I87A 3LGMA 2MZTA 3MCOA 5KG1A 1RWPB 4ECSA 4IR1A 2DYAA 2QT7A 2K7JA 2W9CA 2IHR1 4WZQA 2FJWA 3LUYA 4U95A 2DNLA 3BQ0A 3GSDA 2DIUA 1P6TA 3TQ1A 3CJ8A 2W2OP 1IKVA 3MM5A 4CTAB 2LVWA 2OSQA 5C2GA 2YNHB 3AD8C 3N4WA 4IG3B 2V2KA 1RT3A 1HD1A 3G82A 2F5GA 4ZCLA 1XMOF 2RT3A 1YRUA 3KUEA 4CLLA 3IP0A 1Q82T 5IM0B 4EBEA 1GNKA 1WC5A 3JSRA 4FF4A 3W9HA 4X4VA 4OX9J 4F25A 3HHDA 4JB8B 4HHJA 2HZAA 4PYAA 3DRRA 3DLGA 3M2RA 1IQZA 2X1AA 3NNCA 1R8CA 1FX4A 2MZQA 3GFZA 4DQSA 2E9ZA 4O44A 1U09A 1XWLA 2RIJA 1BWEA 2DITA 2XM3A 2ZH7A 3D54A 3TYTA 2VF3A 2R2UA 3U1LA 2JC0A 2YXLA 1SH0A 1CJKA 5GAHU 2OPSB 3SFGA 3TZZA 3VWSA 4ZIWA 3ISND 2W25A 4YB5A 5LMNJ 4OX9F 1GTEA 3MF5A 2W1BA 4C8OA 5F8NA 4LR9A 2JEFA 4QWCA 1S9GA 3EPGA 1RWMB 3PIOQ 4K4YA 3KHLA 1NK0A 1S6QB 2JDJA 1RT2A 3CCES 3CCJS 2CRLA 1JK9B 3BR8A 3L3CA 3MMAB 3EZOA 1VHFA 4KBIA 2X1FA 3B4MA 1AFJA 1T9YA 3NS6A 1AXQA 2AGPA 3SEOA 1SQFA 5LMNF 3AXKA 2QRRA 3M4XA 2DNYA 4GO7X 2QEXS 2RDJA 2HWIA 2UUBF 1HMVB 1SC3B 1WHXA 3HHLC 4OHVA 2Z2YB 1A7GE 5KOXA 2AP6A 2V8GA 4ETXA 1S48A 5IWAJ 5BYSA 7FD1A 3HHLD 2DHXA 2BKNA 3JTOA 4ATNA 4YHHJ 2HVDA 2DGVA 3I96A 4MIBA 2PIIA 3PVXA 4YY3F 3CDWA 1SB6A 1MWZA 3IG1B 5A0YB 3PHTA 2EPIA 4ZP6A 4FVCA 1SUQB 1TL4A 5AXLA 1HQEB 2IC3B 2OPQA 3M8WA 4Y00A 3R5GA 3UCUP 4C0OC 1DTTB 5IQQA 2WVFA 3H2VE 1APSA 1HNIB 5IWAF 3IA0A 4KPYA 3A3OB 3P45B 3QYYA 1LW2B 2AYGA 4NRTA 2CG4A 4WKRA 2CPZA 2KM8B 3EVWA 1Z2ZA 5BYRA 3V6HA 2QMWA 1VIOA 4CM2A 5LXRA 3UE2A 2AT1B 3QAUA 1U26A 1XERA 4DXLA 2A10A 1UZHA 4U6PA 5GADI 5ETOA 1WKLA 3DRYA 1T05B 2MLXA 4V19J 1IBCB 3VGTA 2ZFHA 2VODA 3IC1A 1JXEA 1JJ4A 4DFJA 4ZS6A 3IR5B 1RT7B 3DI6A 2DJWA 5KFAA 2HFOA 3HF5A 2WK4A 3QNWB 1S7IA 2P6SA 4DV3J 3OL7A 2B3TB 5D0HA 1YWXA 2MTLA 3OTBA 2YNIA 1Z1ZA 2C2NA 2HEKA 3SXLA 4PEOA 1L3TA 2IAJA 4OV1A 4C3LA 1H98A 4RZRA 1TL1A 1NCLA 1L3UA 4DMZA 1X60A 1LWCA 5ETMA 2JX2A 1VBKA 2OIHA 1C1CA 4OMFG 2GO8A 3FBCA 3VQTA 4MMOA 3EGNA 3HO1A 4AD6A 4DV3F 4AL6A 2EBGA 3OFGA 1ZAVA 4ID8A 4OX8A 3Q8VA 5D4OA 1QTMA 2CQIA 2JLFA 5B0CA 1UVNA 2AW0A 2E5JA 4LUBA 4CYUA 2J9DE 2PMWA 4OYWA 4PXEA 2VFTA 2ZBRA 5BJRA 4U67Q 4PUOA 3MPUB 3AT1B 4ZN3A 3CSKA 1RDRA 2WAQD 2VJUA 1MMNA 5E3PA 1U6FA 2M52A 4NEYA 4ED1A 1X31C 1GXUA 3IM8A 2Y0BB 2IYGA 3JB9k 4LF6J 2AGOA 2J0QD 2GIRA 4HHUA 1UJ6A 3ADAC 3T1HJ 2PA3A 4NCAA 4KKOA 1U1LA 1F0XA 5KFKA 2MB0B 2BJDA 1KWMA 2DY9A 3AFGA 1IBKJ 1S6PA 2R3VA 3C6UA 1NMEB 3A4TA 2C2KB 4DWIA 1TU0B 5K8NA 3HVTB 2NUHA 4EWTA 2GIFA 1FKOA 1YKWA 2ILYA 4OYZA 4PG6A 1YBTA 2VG6B 2RQMA 1T9WA 4ZVPB 3ZTQA 2IRYA 3W8PA 3D6HB 4ER8A 1PJ5A 4RU9A 5HROB 4LF6F 4LR8A 3DLJA 3CF5Q 2GJ2A 1Q8IA 3DYAA 3T1HF 2B4OA 3NLCA 4IRKA 4NMLA 5DLFA 2B6AA 3T5KA 1S1XA 2KTQA 4QYRA 5D0EA 1FE4A 5I3UB 2Y3YA 3DOLB 2NR0A 3MAHA 1VC0A 3L4BC 1RT4A 5A8RA 5BYQA 2WONB 3RR8A 4M5LA 1SL1A 4DQPA 2IRXA 3B8HA 3V2UC 2UXBJ 3AODA 4LVNP 3PX6A 4HLBA 3JYTA 3BEGB 1F3VA 4F3MA 4N5SA 2H1YA 4R5PB 1YSJA 4OX6A 1F6TA 1NBEB 3PACA 1SJFA 1VQOS 1S0VA 2RJZA 3PX4A 3FKBA 2UU9J 2H5EA 2RRBA 5DO2A 2FVQA 4U96A 1VQSA 3D7SB 1NXIA 3IS9A 1NUEA 1PKUA 3TQEA 3EVOA 1DTQB 3GIRA 1RHKB 1SKUB 2UXBF 2BE2B 2DTJA 2BYCA 2YX1A 3TWZA 2FJEB 4TYBA 4C11B 1PO6A 1YI2S 3BSAA 1NSPA 2QLWA 4DCJB 1KQSR 1NPKA 1Q7YT 2QL9B 5KFRA 2XMAA 1R8HA 2DGWA 3FC9A 5L8RC 2UU9F 1N5TA 3EICA 1SKRA 5KFVA 2GMHA 4OYBA 3J7A1 2JEJA 3QJPA 3J7YI 1RISA 4O3SA 1JJHA 3Q0AA 3W60A 2V2QA 4DCOB 5DM6Q 3W5ZA 5H9EJ 3CPWR 4UQTA 5JUMA 2ADBA 5J1NA 4KSEB 2BE7D 2XLKA 2GQ2A 3NG8A 2JWNA 1R0AA 3SCJE 4ECYA 3BO3A 5DG8A 4GC6A 3R7SB 4N76A 4W92B 5J2PB 2DNRA 2QA4G 3BBCA 1YJVA 4ZPTR 3DU5A 1FDDA 5KFYA 2FVCA 2VICA 1VMBA 4BWJA 3IFEA 3SYZA 5HLFA 1UEVA 2QSWA 3MDFA 3QZ8A 2XG8A 3HVWA 1QJHA 3OTEA 3MHYA 5I42B 3M2UA 2PD1A 3R1HA 2QLJB 3M30A 1NEEA 1UAWA 2ZNZA 4P71A 4PPDA 4AUKA 3PJXA 2LQBA 4LF9F 1AT1B 1WKJA 3AY0A 5C42A 4URSA 4MYTA 4ZVOB 3DRXA 1N5QA 2R8HA 2R7XA 4CO4A 2MMYA 2JLGA 2G9OA 2IPOB 1U1OA 2ZITA 1NSQA 4L73A 3W1YC 3ETOA 3OVBA 4J37A 1N48A 5H9FK 4NI2A 2GFFA 4LF4J 4RUBA 3SBMA 1GFWB 4ETZA 3D3BJ 4DX5A 1ZBTA 1YBUA 4RW7B 2MKYA 3RW6A 1J2VA 2ASDA 1TKXB 5LXYA 4TY8A 1HHQA 4RNFA 4JYAJ 1ZYQA 3FNNA 3AOBA 1R6VA 1EETB 1YVFA 2CZ4A 4CH1A 3K8VA 5GMKa 2M7SA 1TVRA 2Y0SD 1SJRA 3HLUA 3HCXA 1Q7LB 4LF4F 2FJVA 4OHWA 2RH3A 2V6AA 2BANA 1UZDA 4DV0J 1CQMA 2BUNA 1S1UA 3QQCD 2J0WA 1QTNB 4PZVA 2YKPA 4C8YA 4K0KJ 3SDEA 9RUBA 5D0RA 5KT6A 1UWBB 1FJ7A 1FTRA 2VBWA 4C8LA 3U27A 3UCGA 5AJ3J 1IR0A 4P2FA 2YKQA 3N5FA 1B7YB 3CTRA 2W7OA 1VR6A 1KHVA 1UVKA 3OUYB 3NBPB 4KO0A 2P9EA 4QWDA 4DPWA 1SKWA 4DV0F 3M6WA 1MSWD 2R9LA 2Z30B 3HFZB 4QWAA 3DNCA 2RKIB 2OFGX 1VBXA 3M8PA 3GFXA 2NZ4A 4KGVB 2DHGA 2GGPA 4PKDB 4KRWA 4FPIA 1XNQJ 1SVDA 3QGGA 1TMMA 3BJYA 2FHJA 4URGA 3MMCB 1D09B 5AJ3F 4RUHA 5BR8J 5C25A 1YJ7A 1X5TA 2FGCA 3MEEB 4RBTA 5CYMB 1OSCA 3MZIA 5L39A 2LA4A 1U1KA 3GPAA 5DGBA 3CJKB 3NCRA 2IM2A 3R97A 2NXCA 2DPIA 5HAOA 1Q53A 1ZA2B 3GILA 1UEKA 2VBYA 1S1VB 2ZM6J 1X4FA 4PPZA 1RAJA 1HBNB 5FDLA 3J7AN 1FXDA 5HANA 2YBVA 4RUAA 3HHLB 3TUJC 3S1TA 2XCPA 1NK9A 2MSSA 5G4DA 2F4VF 2YQ3A 4OZNA 2QA2A 1QVFR 1L3KA 3KDOA 1OS5A 4DL7A 3DDIA 2W8LA 1NDPA 4NOHA 3KJFB 3GQCA 2MKHA 2A3JA 3SSSA 2CADA 3AH6A 3LP0B 2F3JA 4RR5A 1KOHA 3AD7C 4PQUA 2RF2A 2ZM6F 1KNZA 1OQ6A 2V50A 2CQGA 2VC0A 4O3RA 2K1RB 2DRDA 4JI4J 2PEHA 2X51A 1D8YA 3VVUA 2GA7A 3VAKA 3H5UA 4LFBF 1G2EA 4DPXA 3Q23A 2AEMA 3I5BA 5C7PA 5B0DA 2F1FA 4F2SA 3C6TB 2O01C 1SC1B 2E9TA 4LBHA 2VFVA 1JLQB 2DCLA 4K8RA 2DGQA 1Q79A 3M8QB 2NUUG 1HBUA 3CJ4A 2N82B 1JLBA 3KLFB 5LOQA 2DD8S 1N32J 3HSGA 2YNGA 1KC8T 4LIWA 3I0RB 5HJYA 3V81A 4WTYA 1IKYA 3CT9A 1FRMA 4ANDA 3UNYA 3FCVA 3QO9A 3JTNA 1KTQA 1N36J 3RRHA 2HWTA 4R0JA 4OI0A 4HKQA 5IS2A 2GMJA 2E5HA 1JJ2R 1F2HA 2YWFA 1N32F 2V4JA 3N0VA 4Q44A 2DGXA 2BABA 4PG7A 1VHIA 1S77D 3P5BP 3M8YA 5CH7B 3OR1A 4RWXA 1VGYA 3CMES 5A8KA 3CJSA 3T6BA 2RAQA 1S97A 1VDHA 2CQ3A 3TANA 1HD0A 2BRLA 1CULA 2M0GB 4ZP7A 5ITHA 1S99A 4ZVEA 5KT7A 1TKZA 1ZAWA 4ECRA 1SL0A 1T9VA 3KK3A 4DUYF 3DRPB 4CT8A 1TL3A 2CJ9A 3M6VA 2DR9A 2XCAA 4NLQA 4FF2A 1V3RA 5CCLA 3OR2A 3GR0A 1OIAA 3KLIB 4E0DA 3IRXB 3BGOP 4F36A 4A8OA 5L38A 1T95A 3VGSA 3HJVA 4ED8A 4H4OB 4F3QA 3BM7A 3OSPA 4DFKA 2HRYA 4WU2A 2MZJA 5E3RA 3ULHA 2KYXA 1NK4A 4KYZA 2AGQA 4X62J 5B08A 3DOKB 1DBDA 4DQRA 2ABYA 4OFZA 4HTJA 2VD3A 3VF0B 1B70B 2D9OA 3FMBA 3BH6B 1RTZA 3O1LA 1N6QB 1E6YA 3MXHP 3EYZA 2NXUA 1MW7A 1N5SA 4UW2A 1FK9A 3CJTA 2AEFA 4ZVHA 2WHOA 4X62F 3D9BA 1UVJA 1IKXA 5EGYA 2GW8A 3U7JA 3G6VA 1NH8A 2B9XA 5F0WA 1MG7A 1T9TA 4YDXA 3JTPA 1U4BA 3K2YA 1CPZA 1GMWA 2Z4PA 2C3YA 3FK4A 1V5IB 1M5PC 5F3ZA 3LF0A 2CXEA 4O0NA 5ETVA 4WU3A 4DV7F 1HQUA 1FJGJ 2I0XA 3S7RA 1KFDA 1NK7A 2WVCA 1H6KX 3PW5A 2VKRA 3BH7B 5B09A 1Q16B 1WDTA 1BXNA 2ZOFA 2EI5A 4DF4A 3UN2A 2MEWA 3V6KA 4K4SA 4K59A 3NGTA 1VCTA 5HP1A 4WF9Q 4I1TA 2D69A 1EIYB 3PEJA 3ET6B 4RBVA 3M1VB 1Y5IB 2XB2D 5KFDA 1LKZA 1FJGF 3MD1A 1VQYA 1RT5A 3D0IE 1U2RA 2C3PA 4NXNJ 1REGX 4OI4A 2ASJA 3E01B 2W9BA 4AL7A 3CMAS 4A8FA 2OAUA 4E8UA 1N5VA 4X4UA 4Z2XA 3CJ3A 2DGOA 4P10A 4LFAJ 3BKUA 2R2TA 4P75A 3D5MA 4FBTA 4DX6A 3PTWA 4G1QA 2RD5C 1NK5A 1XQIA 2B4UA 5H9EK 3QIPA 4KY3A 2BJ8A 2ROEA 1FWLA 4NXNF 1Z2LA 1RA7A 4OJ3A 2MZRA 3D66A 3QJJA 5KFFA 4N41A 4IUFA 2PEBA 5B0FA 4ECTA 1GMUA 4LRFA 4YP3A 1IUJA 4WK3A 2W9CB 2FY8A 1BWVA 4LFAF 4I7FA 5DJBA 1HR0J 1QAXA 4I56A 4KIAA 4NCGA 1LK5A 1IKVB 1Y9OA 3MM5B 3SQOP 2HHUA 1TL5A 4KGKA 2APOA 1RT3B 4ENOA 3G82B 3WHIA 2VDIA 1X4DA 2DGSA 2UUWA 3LPYA 1WORA 3KUGA 1EAYC 2JL9A 2KG1A 2JVOA 5CABA 1FNXH 5K8MA 1PJ6A 2HBZB 5ETQA 5HL7Q 3DRRB 3DLGB 9ATCB 1HR0F 3M2RB 2MY7A 4WFYA 4A4JA 5B7WA 2I38A 3UD4P 4Y2IA 3ZZUA 4O44B 3QSYB 2PI5A 1JLFA 2CPHA 4B9LA 4ZLJA 1C0TA 3W7BA 1JLGA 2L9WA 1O5JA 2OPPA 2IA0A 4USMA 4X84A 1CJKB 3VAJA 3UO0A 3CUNA 2WBMA 4HT5A 3G8TA 3TEGA 2HGMA 3CXCR 2J9EA 3MECB 1S9GB 2HNZA 2NS1B 4N47A 1NKEA 2WSCC 2M2BA 3MPWA 2F65A 1WG1A 3NAIA 2XTJP 1RT2B 3FJ2A 4DQIA 3MAAA 2Q79A 1FWKA 1UW4A 5DDQC 1Q95G 4NLVA 4J9SA 2DO4A 1Q81T 1IWAA 2ZC4A 5LT5A 2ALYB 4QJVA 3HULA 1TKDA 3CCLS 4B3TJ 4I64A 4ZVRB 5J1PA 1WEYA 4ZOSA 2V9KA 5DG7A 3T9ZA 3S8SA 3MD3A 3SV3A 1OYDA 2CWXA 4HHHA 4USVA 4DPUA 3I5AA 7AT1B 2LP4A 2GVZA 2BE9B 1X8DA 1P9YA 1QSYA 4OI1A 4DR4J 1D3WA 3V4MA 3VAHA 1S7HA 4MK7A 2BJ1A 1WF1A 1FJCA 5F8IA 4ZVUB 4XDCA 2OPQB 1SIZA 3PO4A 1W2IA 4B3TF 3OTDA 3U02A 3L7PA 4JOUA 4CQ1A 2VH7A 1RAFB 1FFSB 3CO0P 3QLHA 2P8IA 3QT7A 1ZA1B 4K4WA 4M5MA 3KHRA 2DXEA 4K5SA 1B0PA 4DR4F 3MEGA 4B9MA 2E1PA 4ED2A 5FLXY 3X3UA 1YRTA 2PFDA 1KD1T 2HVEA 5IT9U 3ONQA 5ETTA 4JP8A 3CWJA 1NNDA 2HPUA 2MY8A 2HHSA 2IBKA 2EW9A 2J9DA 2NXJA 3DI6B 1RTDA 3Q8RB 4F4XA 4DFMA 4HDGA 5DGAA 3L7OA 2XY5A 5T14A 4O3NA 3P3DA 3FBFA 2MKJA 5K14A 5EWGA 3KOAA 4ITSA 2YNIB 4AYBD 4OZ0A 2FVPA 4EZ6A 3BYRA 2IAJB 3PRDA 3K58A 3NGSA 1TL1B 4WJBA 1QLNA 3KLEA 4PRFA 3IM9A 1LWCB 3GJRB 2DR6A 1S10A 1Q5VA 4DR6F 1C1CB 3JQMA 4U8YA 4DEZA 2DGTA 5KFLA 1O0PA 3LANA 2MJUA 1PBUA 1SIWB 4LT6A 1ZM3A 1OJ4A 4DCPB 1QUVA 3UNGC 4EO8A 3WC2A 3FDSA 3PO5A 4CYUB 3HPOA 3L09A 2HNYA 4OYMA 4ICLA 2OMOA 2IFXA 3TP2A 4PUOB 2WTFA 1TKTA 2DH7A 1TUGB 1IXKA 1G1XA 2E5IA 4U8VA 3KG0A 3V5RA 3R5BA 1HIYA 4DS4A 1DY3A 1JKHA 1XMQJ 3SCIE 3D6MB 1KFSA 2RVJA 4Y2MA 3R5JB 1GXTA 1MMLA 4ZCIA 4OHYA 4KKOB 2EXUA 3IBWA 1GT8A 1N56A 4DUZJ 4UY85 5L1IA 3WC0A 1S6PB 3C6UB 3M8SA 3CDEA 3CCWA 4DU7A 1RA6A 1QAJA 4C4WA 4GVBA 1FKOB 3EZUA 4CO1A 2XZTB 3DFEA 3HVRA 2HHXA 3PFEA 4CO3A 2DNMA 3MM7A 1SH2A 5KT2A 5KFPA 2BV3A 3EE3A 1XMQF 4KV8A 3IBCB 2CWKA 1UCNA 5LSRA 2HQGA 4PQAA 3DYAB 3I4HX 2BMBA 1NRKA 2EC0A 5DETA 4M5NA 4DR7J 2OLWA 3TZYA 2B6AB 4BDPA 1BHNA 1RHUB 1S1XB 2OMLA 4DLEA 3HFVA 2V67A 1LW0A 1N33J 4RL1A 1SH3A 2Z2ZA 4GMKA 5CYJA 4LRCA 4KGXB 1NM2A 1RT4B 5A8RB 4ELTA 2GHVC 5E33A 2Z57B 4KJIA 1GMWD 2IVYA 1R31A 3JYTB 2HRUA 5J2QA 2FJDB 3K89A 3MM6A 1J5EF 1RK8A 3FSXA 4NA3A 3EGVA 3BGRA 3J7Z5 3H8YA 3R1LA 2N7CA 1VK8A 2MKKA 1AUSL 1REVA 3TUPA 1N33F 3PR4A 3BO2A 4LSLA 5I3QA 2VQFJ 3AJ2A 3MTJA 3I4PA 3F73A 3IS9B 2PFFB 3A3PB 3MCMA 5A8WA 1F5AA 3W62A 4TLRA 3G6ES 1FTCA 4Y65A 4WP9A 5C5JA 1PG5B 5JVGQ 1N5YA 2O3DA 2HAFA 1NK8A 1C1BA 2OEMA 2VOOA 3W8GA 1VLOA 5M2UA 3KMQA 3H5SA 4Y6IA 2VQFF 2DISA 3BYPA 1R8PA 5SZTA 1T94A 2C3MA 3KDNA 3UN3A 2C2RA 2YKNA 3CCRS 2WCXA 2LXFA 3UI3A 1H2TZ 1T8EA 4X4RA 1R0AB 4B3SF 2ZOGA 1RXOB 5JJBA 3C19A 3UW1A 2AQ4A 1FRXA 3F56A 4LBPA 4DV6J 1BQXA 3OD2A 1KTVA 3P96A 2Z2MA 1JX4A 1RGVA 2I5JA 2P9CA 1YJUA 5HLFB 3ZTSA 3BPDA 4J9MA 1R43A 4RPFA 1H3DA 2W4PA 1CJVA 2I6WA 3VQSA 4L3NA 3P6YC 2B51A 3M2UB 1GX5A 3M30B 3CCZA 2QLFB 1Y5NB 3CDAA 2WRMA 2MKIA 3GCWP 1M5SA 3EVMA 5C42B 3OJUA 2MZ1A 1RHMB 3EPIA 4DV6F 2CAJA 1X0FA 8ATCB 1T02A 2XMKA 4OZ1A 4Y3CA 3V6DB 4NMXA 4J9VA 4OLPA 2FLNA 5L9XA 4C7QA 1MNEA 3QBCA 3T6JA 1NZAA 2Y1IA 1DFDA 2HQ3A 4O23A 1RAGB 3J80U 4A46A 4NI2B 4C97A 2DPJA 4FNHA 1GK8A 2ZDOA 1S0MA 2ALZA 2VG5A 5K5MA 3BBBA 1S1TA 1Y11A 4TY8B 4RUCA 2J9CA 5DDPC 4TLQA 5HK4A 2H3EB 4ES3A 2FQQB 3G9CA 4XO0A 4BLGA 1TVRB 2HFZA 3BKFA 1PJ7A 5A2QY 3KHGA 1M5KC 3ZTOA 2B9EA 3K8WA 4DU8A 3R5CA 3K0JA 3OTOJ 4CH0S 3MURP 2PSZA 2PMZD 2WB4A 1EJ7L 2BANB 1MROA 5KFGA 5F8MA 4LSNA 3OXGA 1S1UB 4M5JA 1GEHA 1X4BA 2IMWP 4M5IA 2KM8C 1NKBA 3W63A 1VRUA 3SDEB 3B78A 4OZ3A 4ED5A 1WHWA 3PFOA 2KZZA 2P5VA 2EFVA 2HRTA 1FXLA 3RU0A 3J7YU 1MMDA 1HWIA 4CH7A 2AF6A 2G0JA 2IBOA 3KHHA 1EKSA 1T9UA 4OYPA 1EKRA 1JIHA 1QSLA 4KO0B 4EMDA 3VALA 4XPCA 5GAEU 4I6WA 2GHWA 3TAPA 3CC7S 1XEZA 3M8PB 1KOOA 2F40A 2GGPB 3IWNC 4DOZA 4Z37A 3CULA 2NSBA 4C6AA 1OY9A 3HHNB 4Q8FA 4MKVA 4WCEQ 1H73A 2CIMA 1IBMJ 2ZUGA 5CD4A 5BXIA 3A3NB 3QJLA 1RAAB 5C25B 3E51A 3UD3P 2AKWB 1I1GA 3GYXB 5KG2A 3WIUA 3IGNA 4IDKA 2V4QA 3ITHA 3M9MB 4L76A 4DPOA 2DVIA 2UXDF 3MI7X 3VAFA 4O4RA 1WELA 4X65J 3CNQP 3NGKA 1R0CB 2GQCA 5FDLB 1UVMA 3B6BA 3UDVA 1F5CA 2G1DA 4USTA 1IBMF 4DQQA 4KHPJ 3K5PA 1WC4A 4D3GA 3H25A 1JJCB 4WFXA 1D9DA 2OD6A 1NJZA 3GV5B 2VPXB 2BEFA 5DDOC 2RQCA 1VQ9S 2PGCA 4H4KC 3SV4A 3ETMA 4PWDA 3NXZA 4XIUA 1LXJA 2GJIA 3UWTA 4PQUB 2RF2B 2Q6CA 4LRAA 2NPFA 3QT5A 1S4EA 3K5NA 4F4YA 1JB0C 1EARA 4KHPF 4WZMA 5KFJA 3PG9A 4EU0A 2E1CA 2NPIA 5DM7Q 4OLOA 4A47A 2UP1A 3J81Y 4OYOA 3DKDA 5A6WA 3T5HA 4KTQA 1F1BB 1DQ9A 2LEPA 1HBUB 4FYDA 1S1WA 1JLBB 3FSIA 4F02A 2YNGB 5DQHA 1HI0P 4YUDA 3V81B 1F60B 4B17A 1IKYB 1WC6A 4L72B 1YGYA 5AE3A 4G1IA 3ILIA 3G4SS 3FZBA 4KFBA 3FBBA 3GV7B 3QO9B 2XQCA 1WF2A 4ILMA 2D9PA 1VI7A 3R9LA 2NCKL 3GTYX 2V4JB 2QE5A 2H51B 3OXLA 1M1GA 3QWUA 2SXLA 4Q5VA 2DHSA 4MK9A 3TUZC 2JHEA 5ETSA 3QATA 3TOQA 3H59A 2M8HA 3A8KA 3OR1B 1Q0NA 3I32A 5A8KB 1U25A 2MHEA 2BZ2A 2CJYB 3CIMA 2GZOA 4OHXA 1RQ0A 3JS9A 1CULB 1FERA 5D77A 3RB3A 1S6QA 4F67A 4A48A 3W5YA 5EWFA 1X9MA 5E3QA 1TKZB 3MUMP 5CHCB 2WOMA 4OIXA 2ATLA 4RLEA 3KK3B 5JXSA 2V2ZA 1LK7A 2EG2A 1TL3B 4BCAA 2EEYA 2CJBA 4DL5A 6AT1B 3D1HA 4Y0FA 2GHPA 1WKKA 1SQGA 4J9LA 1AYEA 1SJQA 1LQ9A 4WFZA 3OR2B 2HBRB 3FCHA 1URRA 1WTBA 2G2OA 2B7CB 3OL9A 3HJFA 2AX0A 5A76A 1TV6A 4YS2A 3LAKA 2KKHA 2OPRA 2VQEJ 3MGJA 4B9VA 1TL7A 2A0FB 3NL0A 4K7QA 4HI2A 4TU7A 2PI4A 3N6LA 6FDRA 1H2VZ 3D4JA 5GMEA 3VZHA 1R6YA 4F8RA 2L9NA 3BGFA 4DSLA 1RBAA 4FNIA 3FZ2A 2X7IA 5JVHQ 2KDOA 4ECQA 4Y28C 1Z4UA 2ZVSA 2UZAA 2CJQA 1E6YB 2VQEF 4JI0J 2ZE2B 5HSPA 5D4NA 1YBAA 1WG4A 4ZVQB 1FK9B 3PW7A 4G3IA 4Q2LA 2KO1A 4PXCA 1RWXB 1JLAA 1IKXB 4K50A 3S6EA 5T41A 5H1SV 3RBDA 1ULRA 3PEHA 4JI8J 2EFGA 3TJAA 3SI8A 4IFVA 4ZCMA 2QA4S 1Y00A 4ILLA 4FBUA 4UZBA 3TARA 5EWEA 4YFUA 4YEAA 5H9FJ 1RT7A 5DZ7A 4JI0F 1IM6A 5IT9Y 1N34J 2R4FA 2RS2A 2RHSB 1K47A 1FO1A 3IRWP 1HQUB 1NSKL 5EUHA 3UDCA 3E8OA 4W98A 2FZCB 1Q78A 4DR2J 3HMJG 1X4GA 3DDNA 4HEA9 2W01A 2LQ5A 1UFKA 2CQ1A 2ZZTA 5HN0A 3PYEA 4DPYA 2XC9A 3EWGA 3DCAA 5HP1B 3D68A 2MQOA 3D2WA 4WBFA 4IH5A 1U2CA 4KH0B 3MMJA 3HZEA 2AZ1A 3R5AA 1Q86T 3GG0A 1FRKA 4PG5A 4I69A 2HBQB 5B0GA 2V8DA 3BN4A 3CEDA 1RT5B 4P6QA 1KVJA 5AE1A 4M1KA 2FPHX 2W9BB 3K5OA 1FHTA 2FJXA 2XNQA 3A8EA 3HSDA 2HQFA 3NY0A 3T1YJ 1FA0A 4M63A 4FPRA 1WNEA 1MWYA 1NPPA 3LH2S 4UY8T 2HHQA 5KG4A 2B8PA 1QM9A 2MLYA 1D0EA 3DC2A 4WP8A 2E5GA 4QCLA 2G0IA 4JI2J 4G1QB 1RCOB 1FJEB 5THWA 4EGLA 3QIPB 3CC2S 3EXCX 2IYIA 3RTVA 3IGVA 2ZBPA 2HSEB 1QDUB 3SSRA 1CBKA 2V34A 4Y2CA 1RACB 3ISNC 2DR8A 4JV2A 1ZAXA 2IVMA 3T1YF 2CPFA 5KFXA 1W2BR 3B54A 1V9OA 2IY5B 4I7FB 2DHHA 1P1LA 1WI8A 3HHEA 3RBZA 4JI2F 3GR1A 4NCGB 1HNXJ 1S6UA 3KUHA 3BQ1A 3DM2A 4RW9A 1K9MT 2MSTA 3LPEA 5ETNA 2O5DA 3J7ZT 1FFWB 2BQUA 3RBXA 1S5ZA 4CT9A 2F8EX 2G2ZA 2HLTA 2Y8WA 1WC1A 1TQLA 3ICLA 3NGUA 1S0NA 2AHOB 4DR3J 1HNXF 1RWNB 4EBCA 1UFWA 1BE4A 1JLFB 5HQMA 1XC9A 4O4GA 1C0TB 4NLXA 1JLGB 3PY8A 3UR3C 2C3UA 2OPPB 5KTQA 2BVZA 3RJMB 1LEOA 1RTJA 1U8WA 1KDNA 1WF0A 4GKJJ 3AXMA 4UOFA 1YQHA 1YZ7A 5AE2A 4N8OA 4C8ZA 1HL6A 2AWZA 2HNZB 3VVTA 4DV5J 4C48A 2B9WA 4C0BA 4DR3F 3H4BA 4Y2KA 4CLTA 5LSLA 1EQMA 5DZ6A 5F8GA 4PG4A 3VR1A 4F4KA 3MAAB 1RYSA 4UOCA 3T41A 3BGLA 3CJQA 1NLKL 3D6FB 2COLA 1UW9A 3KWMA 3KLGA 1N4LA 2MDAA 3CCSS 1HFEL 4YHHF 1CJUA 3I0SA 1VQ7S 1M0SA 2DNOA 4CNZA 4GKJF 4LJMA 1NB2A 4R25A 1RE1B 2XO6A 3OQ2A 5HVHA 1ZM9A 4F2RA 3UDLA 2FIUA 2VL1A 3FRZA 5KT3A 2FYXA 2J8SA 4ELVA 4DSIA 4LF5J 3EX7B 2KJWA 4YN3B 1XK8A 3HDSA 5E2QA 2GVZB 2FGOA 2VPYB 4ZLPA 1Q5YA 5D4PA 2EFNA 1PYSB 3FFIA 4UTGA 3G6XA 1U47A 4DFPA 3VTIA 3TJ9A 3JSMA 3M6UA 1S6OA 3R8YA 1Q8KA 1GQEA 2V5HG 1T03A 3PCOB 1FD2A 1SJ1A 4P7TA 4ED3A 1O6XA 3GYGA 2WVBA 4IYQA 3QLHB 2FZGB 2V8VA 1V6HA 3IR7B 2JJ4D 2J76E 3AB2B 3G86A 3MEGB 3LP2A 4J9PA 4DL6A 3Q8UA 3W3SA 4BC7A 2D3ZA 3TX8A 4M5GA 3C2PA 4A8SA 4EO6A 4HR2A 2OD4A 1D1UA 2ADCA 1RWWB 2H5IB 2NZCA 3OJSA 4K4ZA 1HWUA 3ENQA 4IKAA 1VLYA 4XK8C 2LXIA 4UT4A 4RU2A 4B9NA
chains in the Genus database with same CATH topology
4CLYA 4CLSA 1WC5A 4CM2A 2QV6A 3MR7A 4USWA 2W01A 4OYMA 2GVZB 4CLPA 2WZ1A 5D15A 4WPAA 4OYXA 1WC0A 1CS4B 4OYOA 1CULB 4CLUA 1FX2A 4WP3A 1FX4A 4USVA 4P2XA 2GVZA 4OYWA 3C15B 4OZ3A 1AB8A 1CJKB 3C16B 1CULA 4CLWA 5D0EA 1CJTB 2BW7A 4OYBA 3C15A 4CLTA 1CJKA 5D0RA 5IV3A 4CM0A 4USTA 3C16A 2GVDB 3ET6B 4NI2B 1YK9A 3C14B 3MAAB 4OYIA 1CJUB 1WC4A 1WC6A 1CJTA 4OYPA 1Y10A 5D0HA 1CS4A 4P2FA 4P2MA 4USUA 4CLZA 4OZ2A 2GVDA 3ET6A 1Y11A 4NI2A 3C14A 3R5GA 3MAAA 1TL7B 1CJUA 5D0GA 4CLFA 3G82B 1YBUA 1CJVB 4WP8A 4CLKA 1AZSB 1U0HB 3UVJB 1WC1A 1TL7A 5IV4A 4OYAA 3G82A 4OYZA 1CJVA 1WC3A 4WP9A 1YBTA 4CLLA 1AZSA 1U0HA 3UVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLY A;  4CLS A;  1WC5 A;  4CM2 A;  2QV6 A;  3MR7 A;  4USW A;  2W01 A;  4OYM A;  2GVZ B;  4CLP A;  2WZ1 A;  5D15 A;  4WPA A;  4OYX A;  1WC0 A;  1CS4 B;  4OYO A;  1CUL B;  4CLU A;  1FX2 A;  4WP3 A;  1FX4 A;  4USV A;  4P2X A;  2GVZ A;  4OYW A;  3C15 B;  4OZ3 A;  1AB8 A;  1CJK B;  3C16 B;  1CUL A;  4CLW A;  5D0E A;  1CJT B;  2BW7 A;  4OYB A;  3C15 A;  4CLT A;  1CJK A;  5D0R A;  5IV3 A;  4CM0 A;  4UST A;  3C16 A;  2GVD B;  3ET6 B;  4NI2 B;  1YK9 A;  3C14 B;  3MAA B;  4OYI A;  1CJU B;  1WC4 A;  1WC6 A;  1CJT A;  4OYP A;  1Y10 A;  5D0H A;  1CS4 A;  4P2F A;  4P2M A;  4USU A;  4CLZ A;  4OZ2 A;  2GVD A;  3ET6 A;  1Y11 A;  4NI2 A;  3C14 A;  3R5G A;  3MAA A;  1TL7 B;  1CJU A;  5D0G A;  4CLF A;  3G82 B;  1YBU A;  1CJV B;  4WP8 A;  4CLK A;  1AZS B;  1U0H B;  3UVJ B;  1WC1 A;  1TL7 A;  5IV4 A;  4OYA A;  3G82 A;  4OYZ A;  1CJV A;  1WC3 A;  4WP9 A;  1YBT A;  4CLL A;  1AZS A;  1U0H A;  3UVJ A; 
#chains in the Genus database with same CATH topology
 2YQ1 A;  1I51 B;  2YWK A;  2I1R A;  1S79 A;  2LU2 A;  5L46 A;  4QBU A;  1RTD B;  1WDD A;  2AJF E;  2CFX A;  3ZZR A;  1GMV A;  1HWJ A;  4H4M A;  2NXN A;  1RB0 A;  4HDH A;  2I8E A;  4F4A A;  2J6S A;  1OQ3 A;  5K14 B;  2MPU A;  5E7O B;  2HZC A;  2A6O A;  4MTP A;  2ZC3 A;  5L9N A;  4WFB Q;  2RUG A;  5L1K A;  3C15 A;  3KLE B;  4Q8E A;  4XDD A;  2E1A A;  4DG1 A;  1DHM A;  3HD1 A;  2ROG A;  2HFU A;  1PYO B;  2EK6 A;  4M8L A;  3RYL A;  1YHQ S;  3V6J A;  5CXT A;  1KQF B;  3KJN B;  1K44 A;  3PW2 A;  5IZH A;  1ZZF A;  1U45 A;  1RWK B;  2QFJ A;  4L74 A;  1SC6 A;  2B8Q A;  3HFK A;  2HHH J;  3NNA A;  3KLV A;  2YH1 A;  2YWG A;  2HNY B;  4ICL B;  3TNV A;  3MPD A;  3DLK A;  4ZP8 A;  3M8R A;  5HBM A;  1T7P A;  4L6V 3;  1TKT B;  4FYV B;  2BR0 A;  1IBK F;  3G8Q A;  4YB7 A;  1UA0 A;  1OMS A;  1U02 A;  1N0V C;  3R27 A;  2AJ1 A;  5CAA A;  4ZHR A;  2CPD A;  1JKH B;  3RR7 A;  4OV6 A;  1L3S A;  2JNJ A;  2YWE A;  3AD9 C;  5KG5 A;  2BXJ A;  5IT4 A;  2HHH F;  2RS8 A;  3M9O B;  5IC6 B;  4LBI A;  4NA2 A;  2V0N A;  3KTQ A;  1RAD B;  3GIM A;  1Y4Z B;  2LQ9 A;  1YJN S;  3Q22 A;  3TUI C;  5F9L A;  3GJT B;  4FXD A;  4GVB B;  2H4Y B;  2H54 B;  1R8B A;  4DN9 A;  3RZA A;  1RP5 A;  3MM7 B;  4QR0 A;  2DXF A;  4J5O A;  3P49 B;  4H54 A;  2CYY A;  4OI6 A;  1ZPW X;  3CE8 A;  4KV8 B;  1HI1 A;  1FKA F;  3B82 A;  4X66 J;  3EGW B;  2ZH8 A;  2L48 A;  1KLM A;  5J2M A;  4W90 B;  4B9U A;  2AYM A;  3WBZ A;  3A8I A;  4QIF A;  3WQP A;  4RNH A;  1LW0 B;  3IMQ J;  3HT3 A;  1FT8 A;  3DHW C;  5DQG A;  3BSC A;  3GP9 A;  2HS3 A;  4F3O A;  4QIE A;  4DR5 J;  3SQG A;  1JQG A;  1YLX A;  1M1H A;  3G6Y A;  4ED7 A;  2RU3 A;  4KHR A;  2DR7 A;  1JLE A;  1XNR J;  2VOP A;  5J2Q B;  3MM6 B;  4X66 F;  1WUU A;  3HHK A;  1SKS A;  5GAE I;  5L1L A;  3BGR B;  4C8K A;  3N79 A;  1B0T A;  4PAB A;  4DPT A;  4B3M J;  2UVW A;  1S12 A;  4JI1 J;  3DLH A;  1H38 A;  1REV B;  3KK1 A;  5M2R A;  1RAH B;  3GII A;  4LSL B;  1PBA A;  2VDH A;  4JUZ A;  3LAL A;  3DLL Q;  2ZZN A;  2QL7 B;  5A8W B;  1DLO B;  4DN0 A;  3POT A;  1ACM B;  4GO5 X;  3OHB A;  2D74 B;  2IM0 A;  4QIV A;  1N5Y B;  4OYA A;  1RKI A;  3PIP Q;  1F9F A;  4YDD B;  3VCD A;  1RJJ A;  1C1B B;  1SV5 A;  4I0W A;  4JV0 A;  3MM8 A;  1RBL A;  5DS7 A;  3UVJ A;  4JI1 F;  2Q1L A;  1NDC A;  3I9V 9;  1EZZ B;  2DNH A;  1F3F A;  2MQN A;  3MOJ B;  2BOP A;  3QSI A;  3SCL E;  3HSJ A;  2BJ3 A;  2YKN B;  4PCQ A;  2CNN B;  4C3K A;  1TAQ A;  3OFH A;  1AUD A;  2FC8 A;  1VJW A;  2VFU A;  2HLU A;  1I6J A;  2E9R X;  3M05 A;  2P9G A;  1KSP A;  2LMI A;  2LU1 A;  5FJ4 A;  3D67 A;  5IQ6 A;  2MXY A;  1JLC A;  4CO5 A;  2J7W A;  2HHP A;  2HHW A;  4IG0 A;  4OHZ A;  2I5J B;  4GKK J;  3FUY A;  1FFG B;  2M5Y A;  4DSK A;  3OBI A;  4DV2 J;  4NLY A;  1CJV B;  2EBE A;  2YKA A;  4NZ6 A;  3FEY B;  4ZIT A;  2F63 A;  3CD5 A;  2FJB B;  2KFZ A;  3MOZ A;  1XBW A;  4CP5 A;  2HHT A;  2AD9 A;  1JXV A;  2VAS A;  1LWF A;  1VIX A;  1ZM4 A;  2A2C A;  4CLS A;  3PDN A;  3PM9 A;  1RAE B;  4DR1 J;  2DRA A;  4NZ0 A;  5D15 A;  4JYA F;  4WK1 A;  3IXQ A;  4O3Q A;  4GKK F;  4B3O A;  1CS4 B;  2HQI A;  4Y2A A;  1R89 A;  2EFP A;  4AQY J;  5HMZ A;  4NAS A;  4P2S A;  5HMW A;  4DV2 F;  4ZVF A;  2CJK A;  2WB1 D;  2DIV A;  3GMG A;  5AT1 B;  2ZH3 A;  2ZUA A;  4ZN1 A;  3GB0 A;  1EQ0 A;  1RZM A;  5EHH A;  4CM0 A;  2VG5 B;  4O0I A;  2V63 A;  2HIY A;  2M88 A;  1K0T A;  1S1T B;  3JSY A;  2R2R A;  2K8G A;  2BA9 A;  1WOP A;  2XZD B;  3I55 S;  3K5M A;  4B9S A;  3HXM A;  3K57 A;  1R8A A;  4MKA A;  3TA1 A;  4DR1 F;  4USU A;  2H65 B;  4LQ3 A;  4K0K F;  4OI3 A;  2KVQ E;  1TZ0 A;  4K4T A;  4I2P A;  4AQY F;  4NYZ A;  8RUC A;  1VQP S;  2ZWP A;  3SCK E;  3DRS A;  3MCN A;  1H72 C;  1MRO B;  1U8S A;  1IN0 A;  1DJ0 A;  1RHR B;  4O3O A;  4F26 A;  4LSN B;  4J9U E;  3MED A;  4J9O A;  2EK1 A;  2XWY A;  4XTT A;  3G96 A;  5IT0 A;  3PKY A;  1U48 A;  3K5L A;  1HWK A;  1VRU B;  4RW4 A;  2DNG A;  1TEL A;  3Q89 A;  1LWE A;  1U49 A;  2IJR A;  3THP A;  1RKJ A;  3TAQ A;  1XNQ F;  3RW7 A;  1VQN S;  4ZJQ A;  1BLU A;  1BC6 A;  2GS8 A;  4DJB A;  2QG9 B;  3ISZ A;  4CLW A;  2XMM A;  1NH7 A;  3CIZ A;  1GTH A;  5BR8 F;  3J81 j;  2YVS A;  4M94 A;  1RWO B;  2UVV A;  1NJI T;  3AHP A;  7FDR A;  3OL6 A;  1T11 A;  1U1P A;  1UMJ A;  2E5L J;  4G1P A;  1V3S A;  3TI0 A;  1S76 D;  3HT0 A;  2DEI A;  4HYK A;  2L3M A;  5I4M A;  3ZZZ A;  2KJV A;  3JAM Y;  2DK2 A;  5KFC A;  4EUV A;  2EWH A;  5D3G A;  3NKY A;  1IR2 A;  4D3H A;  2DGU A;  2AYE A;  4WKY A;  3OW2 R;  1MN7 A;  4QQB A;  3H5Y A;  3Q8Y A;  2XMJ A;  2FD2 A;  2BQ3 A;  4IDK B;  3ITH B;  2V68 A;  4J91 A;  5HVF A;  2E66 A;  4RO0 A;  3BSO A;  4WPA A;  1NK6 A;  1X0P A;  3QGI A;  3EM1 A;  2L9D A;  5HQL A;  1VS3 A;  3KNA A;  4YR2 A;  1E6V A;  3N01 A;  3HSZ A;  3Q2S C;  3RRG A;  2CNK B;  1LFP A;  5KG0 A;  1CEZ A;  4ANC A;  2FLO A;  2XMV A;  4JI4 F;  1B0V A;  3X1L B;  3TAM A;  3N6N A;  2M3D A;  1V3Z A;  3C66 A;  2Z8Q A;  3W9J A;  1S72 S;  5U47 A;  1FEH A;  2A1B A;  4PWD B;  2HAI A;  5D6G A;  1UJ5 A;  1X5O A;  2FDN A;  5HI7 A;  3RG6 A;  5CA5 A;  2XYG B;  4CLF A;  2HBY B;  2KN4 A;  2HFS A;  2UUA J;  4A8M P;  2Y1R I;  2BRK A;  3ZC4 A;  4Q0B A;  5ETL A;  3MTK A;  4RWW A;  4NRU A;  4PYD A;  4M5K A;  2YPZ A;  3ZZO A;  3CDB A;  3C8Y A;  1WC3 A;  4QOT A;  2RSQ A;  3D28 A;  1XR7 A;  3ZXW A;  2R8G A;  4Q43 A;  1RI7 A;  1W7W A;  1N36 F;  1FRI A;  2NYI A;  1S1W B;  2CZV C;  1KS2 A;  2UUA F;  5LJ5 Y;  2YKO A;  1IWG A;  2ZD1 A;  3Q83 A;  3H20 A;  2MQP A;  2UVU A;  1OSD A;  3HP6 A;  4KFB B;  4KR0 B;  1VJQ A;  2IDL A;  4ELU A;  2C2D A;  2YKM A;  2GVD A;  5LL6 d;  2CNL B;  4J9Q A;  4K4X A;  1G6B A;  1RT1 A;  3DLE A;  3D0H E;  2OTJ S;  3Q8Q B;  1C2P A;  2W2N P;  3MEC A;  3O6Q A;  2UUB J;  4LVO P;  4ED4 A;  1F9H A;  1AZS A;  2KXN B;  1ZPV A;  5EX0 A;  1UEU A;  3M2V A;  4USW A;  2FY1 A;  1VQ6 S;  4ECZ A;  3UN5 A;  3HVA A;  2GV1 A;  2MQM A;  2WOM B;  4IO9 Q;  5LJ3 Y;  2IRU A;  1WHV A;  3PV8 A;  3ZO7 A;  2Q3P A;  4KB7 A;  4C8N A;  4YY3 J;  4QU6 A;  2GO9 A;  2BW2 A;  4EK2 A;  1UJ4 A;  5JMN A;  4UF4 A;  4HVZ A;  6FD1 A;  1I94 J;  3ILJ A;  4KAI A;  4NA1 A;  3QZ7 A;  3I31 A;  1X4A A;  1TV6 B;  3ENW A;  4M5D A;  2OPR B;  2DH8 A;  3CDU A;  3N9U C;  1TL7 B;  3QFH A;  3NEK A;  1NJW A;  1JNR B;  1DRZ A;  5C24 A;  1J5O A;  5F41 A;  3W66 A;  1LOU A;  1QAY A;  3NS5 A;  1SCJ B;  3H5X A;  1S57 A;  3BGU A;  1NHK L;  3PZP A;  1FRL A;  2XHC A;  1B4S A;  1KHW A;  1RSC A;  4K5R A;  3DMJ A;  2FB0 A;  3E2E A;  1RLC L;  2HVZ A;  2Z2L A;  1I94 F;  1RYR A;  1UPP A;  4ES2 A;  2N4C A;  2FTR A;  4B3R J;  2RIL A;  3OLA A;  4GVL A;  2VG7 A;  3NGD A;  2HWH A;  2N3O A;  1RWU A;  1Y5L B;  2W2P P;  4ECX A;  1UET A;  2Y8Y A;  3R2C J;  4LF1 A;  1SBR A;  4RKU C;  4B08 A;  2XSJ A;  1FI4 A;  1KRP A;  2HND A;  1JLA B;  5KFM A;  2AJ4 A;  4WWS A;  2FHK A;  1JWW A;  4ED0 A;  3NOG A;  1OY6 A;  2HQD A;  2BKO A;  5K8P A;  4P72 A;  2MGZ B;  4IFV B;  4ED6 A;  1BY9 A;  3E3X A;  2DNP A;  3L7U A;  4B3R F;  2OI2 A;  2E29 A;  2E1R A;  2VKZ G;  1L5U A;  2RQK A;  4LQ9 A;  2QA1 A;  2ZWO A;  2B5J A;  2KB2 A;  2RUS A;  3BR9 A;  4UOH A;  1ZZN A;  2V2V A;  3ENV A;  2I9S A;  2W9A A;  1FXR A;  1MU2 A;  2VFR A;  3PRB A;  3RB6 A;  4PWU A;  1WI6 A;  2XGQ A;  1FDB A;  3KYL A;  1RU1 A;  2W4C A;  1TK5 A;  2E7V A;  2MQ8 A;  5DQI A;  1NAQ A;  2KI2 A;  4IR9 A;  3PRV A;  2KL8 A;  1BQN A;  4DV4 J;  1U7L A;  3H42 A;  4C98 A;  2QV6 A;  2ASL A;  4FZV A;  4TXS A;  2CPI A;  2OP5 A;  3KJV A;  3BSN A;  1HWL A;  1F2G A;  4FP9 A;  3PYF A;  2GNK A;  5HJX A;  4LF7 J;  3I6P A;  4OZL A;  1IVZ A;  4J9N A;  5KFH A;  4JV5 J;  4FKY A;  4GC7 A;  2MHN A;  2QLB B;  2LQ8 A;  1UVL A;  3NNH A;  2Y9H A;  1ZH5 A;  1H74 A;  4I68 A;  1DQA A;  3KK2 A;  4DV4 F;  2ERR A;  1CJT A;  2DEJ A;  4OZ5 A;  2IVF B;  1YX2 A;  1NU4 A;  5B0B A;  3HZG A;  2UVR A;  2PN6 A;  2X3D A;  4MIA A;  2HK3 A;  2DO0 A;  4LF7 F;  1I3O B;  2AZ3 A;  1QE1 A;  4JV5 F;  3VHQ A;  2CPX A;  1I5O B;  4X4O A;  2WBR A;  5IV4 A;  2FC9 A;  1ZM2 A;  4LSZ B;  2ZHO A;  2K06 A;  1QSS A;  2VFS A;  3NGR A;  5HO4 A;  4YR3 A;  2MJN A;  1DAR A;  2FUG 9;  2C2Z B;  3R7B B;  3TVY A;  3SIP B;  2M4M A;  2CG8 A;  2D3O 1;  1RTH A;  2JOQ A;  2V69 A;  3W64 A;  2BBE A;  1UA1 A;  3KJQ B;  3KG4 A;  3MEK A;  2CUY A;  2K2P A;  2FHM A;  2GJF A;  4IH6 A;  3VGV A;  2EKY A;  2W2Q P;  4J9K A;  2XUL A;  4C9D A;  2FHJ D;  3ZNJ 1;  3GE9 A;  4MIW A;  5DDR C;  1YZ6 A;  5F8H A;  2R7W A;  5EX3 A;  2CVI A;  3DM2 B;  4RW9 B;  2VA3 A;  1M5O C;  3GFH A;  3CD6 S;  2QFI A;  1ZTW A;  1RT6 A;  4RW8 A;  2V9W A;  2QL5 B;  3WDO A;  2RRA A;  4NXM J;  3GLJ A;  5KFU A;  3T3F A;  4I67 A;  2CQC A;  2XYH B;  3PYD A;  2C42 A;  4YQW A;  1NB7 A;  3PYG A;  1R3N A;  3NCQ A;  3JXO A;  3A12 A;  3SSQ A;  2MQL A;  2YWH A;  4O4G B;  2LCW A;  1FF2 A;  2HW3 A;  3OL8 A;  4RNM A;  1DAX A;  5G0R A;  1A0O B;  1C0U A;  2ZBQ A;  1RTJ B;  4QR2 A;  3PKM A;  2XMT A;  1RTI A;  2J7U A;  3DOM A;  1KQG B;  1H7W A;  4NXM F;  2NQP A;  2HFV A;  2OTL S;  1YJ9 S;  4F0M A;  4OYX A;  2Z58 B;  1WOS A;  3O8W A;  2XSF A;  2ZJR Q;  1KKH A;  4DS5 A;  4WP3 A;  2EFQ A;  2DRB A;  4DL0 C;  3UDE A;  2QLX A;  2D41 A;  1TFW A;  4U7C A;  2LYV A;  5EDW A;  3BRE A;  2B4P A;  4C8M A;  2IM3 A;  3D1O A;  5CYQ A;  1IM4 A;  1JXL A;  3RGI A;  3DU6 A;  3KLG B;  3H98 A;  4HH0 A;  1CJU B;  3I0S B;  3LWL A;  3U1N A;  3GIK A;  4DX7 A;  4TU9 A;  2KHC A;  3AA9 A;  4A8Y A;  3QID A;  3QAE A;  3A13 A;  1JNZ B;  4AFF A;  2AU0 A;  1LFW A;  2XLJ A;  3MPY A;  1X9S A;  2YNF A;  4N56 A;  1RAB B;  2XI2 A;  4QIG A;  3MUT P;  4MFB A;  5CZX A;  3LP1 A;  1VQ5 S;  1XTZ A;  3FFI B;  3MAQ A;  4LF9 J;  3ZZ0 A;  4UUW A;  4QPX A;  3JSM B;  3CCM S;  1BQM A;  2BDP A;  1T03 B;  4CLU A;  3ZZY A;  4NYO A;  3JQJ A;  4NLS A;  4W4M A;  1S9F A;  1N0U A;  4USH A;  1A9N B;  2PMH A;  4FVM A;  4WE1 A;  1WEZ A;  2RHQ B;  5GAG I;  5FLX U;  3MM9 A;  3TA2 A;  1P8G A;  2R7T A;  3LP2 B;  2R7U A;  2AYB A;  2RU9 A;  4A8Q A;  2R7Q A;  4JI7 J;  1BGX T;  2AJQ A;  3BO4 A;  4NL5 A;  5DG9 A;  3GG1 A;  2BJE A;  3KFW X;  3W65 A;  2HHV A;  2HZV A;  3V6D A;  4IO1 A;  4HAC A;  2HK2 A;  5KFS A;  4Z7Y A;  4JV1 A;  1HLW A;  4WFA Q;  2F8H A;  2XI3 A;  5KFI A;  5K20 B;  2HS0 A;  1WTF A;  1HYS A;  5AXM A;  2I2Y A;  1FEE A;  3TVZ A;  2JRS A;  3CCU S;  1VQK S;  3OV7 A;  2CZ9 A;  4R8U A;  5SUH A;  1WG5 A;  2VB6 A;  1YTY A;  4JI7 F;  1YJW S;  2QGF B;  4H4M B;  1SI9 A;  2D3O R;  2KYZ A;  1ZS6 A;  2BM1 A;  4QR1 A;  2F7V A;  3W2V A;  5MLC V;  4LRB A;  1O51 A;  4DI6 A;  2E44 A;  2A18 A;  2P6T A;  4O3P A;  1X4C A;  1S9E A;  4P2X A;  3C15 B;  3VAM A;  1AB8 A;  3NCP A;  3DGV A;  4DG1 B;  3BQ2 A;  1OPZ A;  5IFM A;  5A6P A;  1PYT A;  4J90 A;  2JEG A;  2POK A;  3EGZ A;  4BC9 A;  4N8N A;  3MR6 A;  2B4V A;  2AV5 A;  1GH8 A;  1EP4 A;  5GVQ A;  3C46 A;  2VBZ A;  1IR1 A;  3VAG A;  1LXN A;  3Q2T C;  1TAU A;  2EG1 A;  1YJT A;  2WW4 A;  5E5N A;  3QRQ A;  4RW6 A;  3H7H B;  1N52 B;  4ANE A;  3DLK B;  5HBM B;  2DH9 A;  3A8J A;  4DUZ F;  1RHQ B;  2MLZ A;  1P1T A;  1VOM A;  4PXD A;  3SZ2 A;  2X3G A;  1RUS A;  1RHJ B;  3ZZP A;  2DNZ A;  1UPM B;  2LFV A;  1B64 A;  4ZHR B;  3V4I A;  4MKY A;  4DBQ A;  2LDY A;  1GAO A;  1WC0 A;  3OHA A;  1MWQ A;  4ZA1 A;  2FZK B;  1WSR A;  1IBL J;  4UUX A;  3M7V A;  4WII A;  3DGP A;  4K4U A;  4DR7 F;  1FKP A;  2OGU A;  3LA0 A;  2VPW B;  4CDI A;  2F4V J;  4QYZ J;  1N88 A;  1HBM A;  3C16 A;  2ATC B;  4N77 A;  3FVY A;  3LGH A;  2RDI A;  3MMB A;  3PNI A;  3T1A A;  3K7R A;  3RUB L;  4EBD A;  2WW8 A;  4IFY A;  4FN5 A;  2RRN A;  3NOC A;  1KLM B;  5J2M B;  1IBL F;  2ZZM A;  1S0O A;  3LAM A;  1TUV A;  2QYC A;  1U0S A;  4NCB A;  1OPI A;  1B99 A;  3G2X A;  1KEK A;  4ZLL A;  4CO0 A;  1NZ8 A;  2BX6 A;  1NPR A;  5KG3 A;  3H2L A;  2WSE C;  4LFB J;  4LR7 A;  3D1Q A;  4ID5 A;  1U2F A;  1ICE B;  3SQG B;  2HG4 A;  3PHE A;  1QUP A;  1N54 B;  3GIJ A;  5LM7 E;  1JLE B;  2VC1 A;  4USJ C;  2OHD A;  3US5 A;  3UPF A;  3FEZ A;  2LA6 A;  1FNM A;  2G1H A;  1S4F A;  2Q6B A;  3HM9 A;  4KC5 A;  1P27 B;  3NRB A;  3KK1 B;  1M90 T;  5FII A;  3GCX P;  1HPZ A;  4AL5 A;  4GRS A;  3G71 S;  4AXJ A;  4OL8 A;  5F9N A;  1T0T V;  3BF4 A;  2CDQ A;  2QC3 A;  1K1S A;  2LDI A;  3POT B;  1CVJ A;  1A6L A;  2PC6 A;  1NHU A;  1WOO A;  4IQM A;  4CI0 B;  2E1M C;  5CCM A;  1SV5 B;  4ZVT B;  4ZKA A;  1ROF A;  3MM8 B;  3OVS A;  2K7K A;  1HBO A;  3UVJ B;  4ALZ A;  4ZCK A;  3EMT A;  4IH7 A;  3O5T B;  5T7L A;  3P4U B;  1HAR A;  3EXY A;  2XYP B;  4YR0 A;  4I6Y A;  1TFY A;  4KH1 B;  2EKN A;  3RAX A;  4NLR A;  1T3O A;  4CO2 A;  2DBB A;  1G4C A;  3AOA A;  3QT6 A;  4CLP A;  3L9Z A;  3MPV A;  2P2C B;  5IC4 B;  1QY7 A;  2CPJ A;  2HQC A;  4DUY J;  2CPE A;  5L1J A;  1G3O A;  4PG8 A;  2IJF A;  1M1K T;  2GAH C;  4I2Q A;  1JLC B;  3BV8 A;  4CZC A;  4QW8 A;  1ELO A;  4JI3 J;  4IG0 B;  2QYG A;  2DT9 A;  1TK0 A;  1HW8 A;  3RB4 A;  4ZPW R;  4PAA A;  1L3V A;  1UP1 A;  3M32 A;  4P2M A;  1FE0 A;  1RU2 A;  3C14 A;  1WSV A;  1VRT A;  3OT9 A;  4DV1 J;  4OJH A;  2Z0G A;  1FNO A;  1F9E B;  5KOW A;  2HMI A;  1CQN A;  1LWF B;  3AQP A;  3PX0 A;  2W24 A;  4DX8 H;  4JI3 F;  4OQJ A;  4HI1 A;  4A8K A;  4FXV A;  1QAI A;  2FVR A;  3QGH A;  1U0H A;  2OEK A;  4B3O B;  2CKW A;  4CLY A;  2BJ9 A;  5J1E A;  2L41 A;  3K59 A;  2F9D A;  4OI2 A;  4RX6 A;  1VBY A;  4E98 A;  3QPI A;  1IJE B;  5MAO A;  5J2N A;  4DV1 F;  2F4F A;  4K2J A;  3OTO F;  1YRX A;  2ZNY A;  2HS4 A;  2IA6 A;  5A2Q U;  3IAM 9;  3W2W A;  1Y3J A;  3CW2 C;  1WWH A;  2KRR A;  3H0P A;  3LO3 A;  1IQT A;  4LRE A;  1PAE X;  4R0E A;  5GAH I;  3VGU A;  2HIQ A;  1X9W A;  3EJM A;  4ECV A;  4I2P B;  2B56 A;  5KFB A;  2QSF A;  4F4W A;  1SPB P;  3DRS B;  4TQR A;  4FYY B;  1FDA A;  3IAS 9;  2ZE2 A;  3T19 A;  3UQS A;  3KLH A;  1KVK A;  3ZTP A;  2H48 B;  4ILR A;  3MED B;  3PR5 B;  4DV7 J;  2DNN A;  4LF8 J;  2CJX B;  2W7A A;  3P5T L;  1ZOT A;  4RW4 B;  1IKW A;  4IRC A;  1W25 A;  1LWE B;  2HVI A;  1K1Q A;  1WAC A;  3AB4 B;  5GMD A;  1Y0H A;  4EEY A;  1HNV A;  4BBY A;  2A6M A;  4ZP9 A;  1HHT P;  4P9S A;  1BMQ B;  4TKT A;  1KQK A;  2PA8 D;  4QZV B;  4ZVS B;  2YX7 A;  5KFO A;  5E41 A;  4LF8 F;  2BW7 A;  4X64 J;  1TP7 A;  4TNO A;  2OFH X;  2ZJQ Q;  2GCF A;  2KVI A;  2LKZ A;  4CRJ A;  5M2P A;  5ADZ A;  4X65 F;  1KP6 A;  4UOG A;  4CCH A;  2JEI A;  5D3G B;  2XS5 A;  2JH3 A;  4PR6 A;  4J7C A;  4CIO A;  1LNQ A;  3TVK A;  1U6Z A;  1D8Z A;  4ZPV R;  2ZVI A;  2YX4 A;  4NLW A;  3CJ5 A;  2ZDP A;  3VZI A;  4X64 F;  4CTA A;  2YNH A;  2VZ9 A;  2IDE A;  2C2O B;  4IG3 A;  1CC8 A;  2J7K A;  2JLE A;  2BOA A;  3QRR A;  1DQ8 A;  3GZ7 A;  1YG0 A;  1E6V B;  3PXG a;  2R42 A;  5IM0 A;  5E0O A;  4WXW A;  3TAM B;  1U1R A;  2A2D A;  2WVD A;  3CCQ S;  1CLF A;  4HH1 A;  1CG2 A;  3N5B A;  4KPC A;  1J27 A;  2ACY A;  4Q7A A;  2D3U A;  2QMU B;  3TO8 A;  3SMZ A;  5HQ8 A;  3PW0 A;  1R7I A;  1KVI A;  3MFI A;  3DN9 A;  3MWB A;  2CJA A;  4FS2 A;  4AXI A;  1YK9 A;  4DL3 A;  1PGZ A;  1OO0 B;  4X4N A;  1XMB A;  1AW0 A;  2KXH A;  3J81 U;  2XY7 A;  2Y1J A;  3EUN A;  2ZH1 A;  3WZ0 A;  2OPS A;  4IQX A;  5LSO A;  4Q0B B;  4M95 A;  3NWG A;  2KHD A;  2FLL A;  5EN1 A;  4IOA Q;  1UTA A;  1T9X A;  2HGL A;  1RBO B;  1UWA A;  1VIS A;  5ETK A;  3MMA A;  3T9N A;  5KFQ A;  1HNZ J;  3NS7 B;  1K0V A;  2ROP A;  2HKE A;  4YME A;  3FBE A;  1XR6 A;  4DSJ A;  3OLB A;  2ZD1 B;  1HQ2 A;  2B9Y A;  4L75 A;  4HL9 A;  2FHO B;  2N3L A;  2AMC B;  2KT5 A;  2B0G A;  1HMV A;  3RB0 A;  2VIH A;  2HFN A;  2XMU A;  4L3K A;  1NKC A;  3GJS B;  2AJ2 A;  1FD8 A;  3LWM A;  2E7X A;  4S0M A;  5AXK A;  2YKM B;  5F3T A;  2UUC J;  2GVD B;  1RT1 B;  3DLE B;  3GSI A;  3I82 A;  4DSF A;  2K3K A;  1HNZ F;  1KR4 A;  3AA8 A;  1TUW A;  3EDQ B;  3H2U B;  4RNN A;  3NMR A;  3A1Y G;  4NPO A;  3VV2 B;  3IG1 A;  4LRD A;  5A0Y A;  1SUQ A;  1HQE A;  2IC3 A;  1H0H B;  1AZS B;  3RAM A;  2ZKT A;  3AQO A;  1DTT A;  3M2V B;  3QFW A;  4TN2 A;  1WHY A;  1HNI A;  1CSJ A;  1M5H A;  2UUC F;  1G7C B;  4FYW B;  2V4R A;  1LW2 A;  4IRD A;  1PIL A;  2C2E A;  4NLD A;  1OY8 A;  4CNY A;  3NWR A;  3CCV S;  1PC4 A;  1QD1 A;  4XAK A;  3BB5 A;  1T05 A;  2XO7 A;  4M5D B;  4V19 X;  1YIT S;  4FYX B;  4FF3 A;  3R5D A;  4C2M A;  4ES1 A;  4ERD A;  4FDF A;  5C24 B;  2MKS A;  1J5O B;  5C2C A;  1AFI A;  1SXL A;  1XIQ A;  2ZEJ A;  2ZH6 A;  3TJ8 A;  2J0X A;  1X5S A;  3DMJ B;  2ZH9 A;  3FMW A;  2RB7 A;  3GJQ B;  3AOC A;  5I3P A;  3K17 A;  4MAK A;  4JI8 F;  2XHW A;  5KAK A;  4YB6 A;  2KU7 A;  4X4S A;  5KFW A;  3R3T A;  4PXB A;  1VQL S;  2VG7 B;  4QYZ K;  2VJV A;  4OZJ A;  4ZLN A;  1N34 F;  4CWB A;  2ZOM A;  3W9I A;  2KZM A;  5KT4 A;  4Y34 A;  4AE5 A;  5B0A A;  2XSJ B;  5D78 A;  5HVG A;  4DR2 F;  2HND B;  1P9Q C;  3QT8 A;  3FQK A;  1PSD A;  2XBP A;  2V8P A;  1EX8 A;  4X4Q A;  4X4P A;  3R2D J;  3OXF A;  2J8A A;  3RAQ A;  3IN5 A;  2LEA A;  1FDN A;  3N28 A;  2C28 A;  2IMO A;  4NX9 A;  3TR5 A;  4DR6 J;  2N4D A;  2B5J B;  3F44 A;  3TX0 A;  5KG6 A;  3ILL A;  1HW9 A;  3KKF A;  3DDK A;  3TRG A;  1ZET A;  1TMJ A;  4H4K A;  1MU2 B;  3DHX A;  2H9Z A;  3ZNU A;  2ZHB A;  2C3O A;  1K73 T;  5D0G A;  4F0H A;  2EVZ A;  2F9J A;  4KGZ B;  2C1E B;  3GU0 A;  1RAO A;  1BQN B;  1ARO P;  3MR3 A;  4U7U K;  5IXU A;  1FVS A;  3D6T B;  4EFA C;  2D7S A;  2YH0 A;  3KJV B;  2JFK A;  5HAT A;  2VON A;  2KT2 A;  3EZ5 A;  1NHV A;  1KLN A;  3HVT A;  2XS2 A;  3GFY A;  1X7V A;  3OSN A;  3HKW A;  4ZIV A;  3OVA A;  4NZ7 A;  2VG6 A;  4EYI B;  3H40 A;  1N8R T;  5ETR A;  3WX4 A;  1EB0 A;  1H2U X;  3O2I A;  1ZTT A;  4IOB A;  5HRO A;  2KRB A;  3KK2 B;  2W2M P;  4KGM A;  1R0B G;  1CJT B;  1X4E A;  1NO8 A;  3HX9 A;  2QN6 B;  2O66 A;  3NAH A;  5CD4 H;  2DY1 A;  3CC4 S;  5DLG A;  4ECU A;  3B4D A;  4NE9 C;  4A8W A;  5I3U A;  2CQD A;  4OJG A;  4LFC J;  3DOL A;  1QE1 B;  2IIH A;  1ITP A;  2MYF A;  5D8H B;  4NWB A;  4QW9 A;  2CQH A;  2E7W A;  2PT0 A;  3CB4 A;  2WON A;  3SFU A;  2MZS A;  1NJY A;  3I9Z A;  1NDK A;  1SQE A;  4FS1 A;  2NSC A;  4ZVG A;  4J9R A;  4F50 A;  2KFN A;  3PJW A;  5KFN A;  3BBF A;  4R5P A;  2HGN A;  1RTH B;  3ZFV A;  4F4Z A;  2QMX A;  4LFC F;  2MQQ A;  1YJR A;  1O8B A;  2RML A;  1VQM S;  1VBZ A;  3CD0 A;  4TVA B;  1DTQ A;  3QMQ A;  1F5B A;  2BE2 A;  2UV8 G;  1HHS A;  3R6G B;  2G2Y A;  4C11 A;  3TZX A;  1J5E J;  1RT6 B;  4RW8 B;  3TEH B;  2KG0 A;  5GAD U;  4BS2 A;  2LEC A;  2L08 A;  4ZMM A;  2EC2 A;  3NMA A;  1T3N A;  3H4D A;  2CQ0 A;  2JFD A;  4F7V A;  2Y1L B;  2GIQ A;  3M8Z A;  2CVE A;  4DV5 F;  5HMY A;  4P7V A;  5LMU J;  3LQV A;  4MH8 A;  2R7R A;  3C3L A;  4X4T A;  1SJ4 P;  2XWX A;  3G8S A;  5G0R B;  3CJ2 A;  2AIR B;  4QIW D;  4NLP A;  2VV5 A;  1C0U B;  3VAI A;  1RTI B;  5KFT A;  2NYH A;  2FLP A;  3DOM B;  3BN7 A;  1GX6 A;  2UXC J;  1VC6 A;  2ILZ A;  3ILO A;  3KXD A;  5J2P A;  2ASY A;  3HK2 A;  1CC7 A;  3AJD A;  1V5V A;  1U1Q A;  1DLO A;  5LMU F;  4ECW A;  3FQL A;  2XZW A;  2ACM A;  1FX2 A;  2R8I A;  1NDL A;  1OYE A;  3QWP A;  2RDD A;  5CYQ B;  4LF5 F;  3PJ9 A;  3JSB A;  4B3S J;  3LW5 C;  5I42 A;  2DNQ A;  2HUR A;  2UXC F;  4NEZ A;  2WVE A;  2O1P A;  3LTO A;  1OWX A;  4WTO B;  2GML A;  3T5J A;  3UCZ P;  4LIR A;  4WYL A;  2EFO A;  4K4V A;  2YNF B;  2G4B A;  1MN9 A;  1C4C A;  2QZ8 A;  4MFB B;  4OJ1 A;  1VFJ A;  1UL3 A;  3LP1 B;  4PWW A;  4A8X A;  4EYH B;  4YOE A;  1TR0 A;  3S01 A;  3U1M A;  1Q8L A;  2DHA A;  5KG7 A;  2R8K A;  2AJ0 A;  2LQJ A;  2NRE A;  4RW7 A;  2RQ4 A;  4N7T A;  4JI6 J;  1YIJ S;  4HT7 A;  1TKX A;  1BQM B;  4FKX A;  4ZJL A;  1RAI B;  3J80 Y;  2LXU A;  4LMZ A;  2VBX A;  2AEJ A;  2OH2 A;  3R7N B;  1EET A;  5RUB A;  2BQR A;  4WE1 B;  2G0C A;  4DL4 A;  4ZPB A;  3MM9 B;  4G6V B;  4E2F B;  5DRK A;  1URN A;  4USI A;  2UUT A;  3BDP A;  4V1A k;  3FRY A;  4F0K A;  4NYP A;  4UQG A;  2W7P A;  2J6T A;  3N6M A;  4U9R A;  4JI6 F;  2MKC A;  4I6A A;  1BD6 A;  4K2X A;  3GYN A;  4HAC B;  1CS4 A;  1YDL A;  1UWB A;  2X1B A;  4KQZ A;  1HYS B;  1VQ4 S;  4JI5 J;  3TA0 A;  3I56 S;  4DLG A;  1WEX A;  2GQQ A;  3G87 A;  1PIE A;  4R8U B;  2LLZ A;  2IJN A;  3OUY A;  3NBP A;  1LWX A;  2J5A A;  3EDR B;  2C2M B;  3W2V B;  3O44 A;  2DCU B;  2J6U A;  2ZH4 A;  2RKI A;  3UFC X;  3CJR A;  2KXF A;  1K8A T;  2V8H A;  1S9E B;  2R7O A;  4NLG A;  1RWV B;  5B0E A;  2V94 A;  4WXO A;  3I5C A;  4JBC A;  3Q24 A;  4JI5 F;  3CCT A;  2NXE A;  1VYA A;  4TQS A;  3MMC A;  1Y3K A;  3FGV A;  5FD1 A;  1QVG R;  3ENA A;  2FJA B;  2XY6 A;  4X2B A;  4RJV A;  4MYU A;  1LV5 A;  3MEE A;  4ZK7 M;  1EP4 B;  1TTH B;  5CYM A;  4ZPC A;  3WIV A;  5IV3 A;  2JZ5 A;  4P52 A;  3M6X A;  2DKO B;  3BS9 A;  1Y10 A;  4RW6 B;  4HTI A;  1Q4R A;  2HVH A;  1RLD A;  3CJK A;  2W8K A;  2XEX A;  3OFF A;  4OZ2 A;  3ELH A;  2XMW A;  1S1V A;  3AAW B;  1HBN A;  1B3T A;  2J0S D;  4C3M A;  4KT0 C;  3HHL A;  4M5H A;  1KON A;  3KMS A;  2JVR A;  4QPT A;  2RNE A;  3V4I B;  1WD6 A;  2D1C A;  2N7Y A;  4TY9 A;  4OX7 A;  2VHG A;  4USK A;  5KFE A;  3LGN A;  2UXD J;  2RE1 A;  5AXN A;  1Q8B A;  3LP0 A;  4BHQ A;  3THV A;  3KNG A;  3DGP B;  3GV8 B;  1FVQ A;  1FKP B;  2NLW A;  2Z56 B;  1X5P A;  2R8J A;  2BM0 A;  5F8L A;  1FRH A;  4QU7 A;  2K1R A;  1Q1K A;  2H4W B;  2HYI B;  1HBM B;  3C16 B;  5GAG U;  3FEX B;  4ZJO A;  2PE8 A;  3MFH A;  4C0H A;  3MMB B;  1RCX B;  4DR5 F;  4NLU A;  3TZW A;  2GAG C;  3IO1 A;  2QO3 A;  4WYW A;  3C6T A;  4IFY B;  4KHM A;  5F0U A;  1XNR F;  2M9K A;  1JLQ A;  4FXW A;  5K8O A;  3OPK A;  3M9N B;  3M8Q A;  1VC5 A;  2PDA A;  3KLF A;  2ZHA A;  2VU5 A;  2UV8 A;  4B3M F;  1NJX A;  3UR0 A;  3BPS P;  3I0R A;  2IM1 A;  1HNW J;  4ID5 B;  2YWW A;  2ZKU A;  2WSF C;  4ZPA A;  4DHV A;  4NLT A;  4WFN Q;  4DL2 A;  2M70 A;  4MT1 A;  3HKZ D;  1VK3 A;  4FF1 A;  3D3C J;  1MLA A;  3MR7 A;  4NLO A;  2WZ1 A;  2B7B B;  2DB1 A;  1S59 A;  2XS7 A;  1S49 A;  2O67 A;  3UD5 A;  4DZD A;  2K3I A;  2OKQ A;  1HPZ B;  2OEJ A;  2QX0 A;  4AT1 B;  3F0N A;  2KFY A;  1M5V C;  1TK8 A;  4TYA A;  1FRJ A;  3JQK A;  3F41 A;  1HNW F;  2OUG A;  2ZBC A;  1DUR A;  4TU8 A;  1H7X A;  4MKB A;  3T5L A;  4F04 B;  4I4B A;  2KH9 A;  3CMQ A;  3MCS A;  4OYI A;  2QIF A;  2OSR A;  2QJ3 A;  3CJ0 A;  2G13 A;  4U7U D;  3CGI A;  1NSA A;  1U1N A;  3FCW A;  4RBU A;  4IOC Q;  3Q86 A;  1HBO B;  1KN6 A;  3DRP A;  5T7L B;  3Q8P B;  1XJW B;  1DZ5 A;  5CZV A;  1AA1 B;  4KE5 A;  2CNO B;  2JSX A;  4MJK A;  4B9T A;  3CO9 A;  2VUG A;  1Y7P A;  2YPY A;  3MR5 A;  3NP5 A;  3KLI A;  4LF2 A;  2YQ0 A;  3RRK A;  2Q43 A;  3IRX A;  1C4A A;  3HD2 A;  1BUX A;  3KG1 A;  2FVS A;  5KFZ A;  3CVK A;  3LOU A;  4XPE A;  2BJ7 A;  4H4O A;  4DF8 A;  4I2Q B;  4DSE A;  1B7F A;  4RNO A;  1XN9 A;  3O3L A;  2M8D B;  1FWP A;  3ZTR A;  1U6B A;  3GON A;  3H90 A;  3DOK A;  2QTW A;  2F8M A;  3BKT A;  1JMT A;  3M32 B;  2ZH2 A;  2C22 A;  2B43 A;  4EI2 A;  2CQB A;  5ETP A;  3C14 B;  1HA1 A;  1VRT B;  4DUT A;  4P74 A;  5IOL A;  3GWC A;  2ZBI A;  1SL2 A;  4DZ6 A;  1N6Q A;  2BKP A;  2HMI B;  3DLB A;  4CLZ A;  2Q66 A;  2H5J B;  2ZH5 A;  5F8J A;  4BWM A;  2XLI A;  4ZPD A;  3DXS X;  4G65 A;  3BZQ A;  2CQ4 A;  2R7S A;  1R27 B;  4UZC A;  4CLK A;  1U0H B;  3IBF B;  5J1E B;  3Q8S B;  4YB1 P;  1D9F A;  3OFE A;  1VRQ C;  2R7V A;  4EZ9 A;  2VPZ B;  1FCA A;  2CQ2 A;  3D0G E;  2OO4 A;  5J2N B;  1HI8 A;  1PC5 A;  3W5X A;  5E3A A;  2U2F A;  1PCA A;  3FSY A;  3ZZT A;  1SJ3 P;  4QWB A;  1GXL A;  3W2W B;  1VQ8 S;  2PO4 A;  1UFL A;  2CQP A;  3IWL A;  4DDF A;  2R2S A;  3CD7 A;  8AT1 B;  4Q2M A;  1IJF B;  5E3C A;  1W26 A;  2CDR B;  1EHW A;  3BDE A;  4Q45 A;  1D9A A;  5D4L A;  3DXB A;  2JC1 A;  2KT3 A;  3PW4 A;  5HMX A;  2AX1 A;  2YY3 A;  3KLH B;  3ET6 A;  2GC8 A;  3M1V A;  5K9F A;  1U24 A;  3RBE A;  2DNK A;  2X1G A;  1WJ9 A;  1IKW B;  4Z7C A;  2GX8 A;  5KT5 A;  2E5L F;  1U1M A;  4ZDN A;  2DR5 A;  2CPY A;  3E01 A;  2OJ3 A;  3IWX A;  2OEL A;  3L95 X;  2LEB A;  2MGZ A;  2XGP A;  1HNV B;  1UVI A;  2YTC A;  1HKA A;  1XR5 A;  3IR6 B;  1UKU A;  1SC4 B;  3W61 A;  2XNR A;  4P73 A;  4QWE A;  1X4H A;  4B02 A;  1PAU B;  1FES A;  4WIQ A;  3R6L B;  4URQ U;  2ZJP Q;  3THT A;  3JAM U;  3HI9 A;  3OTC A;  3QRP A;  2CA9 A;  3WX8 A;  2BAC A;  5CQG A;  2U1A A;  3P8B B;  2VA2 A;  3MUV P;  3MR2 A;  3TW0 A;  4MK8 A;  3AJ1 A;  1KBR A;  2DXD A;  3QGP A;  1XMO J;  2W4D A;  3I87 A;  3LGM A;  2MZT A;  3MCO A;  5KG1 A;  1RWP B;  4ECS A;  4IR1 A;  2DYA A;  2QT7 A;  2K7J A;  2W9C A;  2IHR 1;  4WZQ A;  2FJW A;  3LUY A;  4U95 A;  2DNL A;  3BQ0 A;  3GSD A;  2DIU A;  1P6T A;  3TQ1 A;  3CJ8 A;  2W2O P;  1IKV A;  3MM5 A;  4CTA B;  2LVW A;  2OSQ A;  5C2G A;  2YNH B;  3AD8 C;  3N4W A;  4IG3 B;  2V2K A;  1RT3 A;  1HD1 A;  3G82 A;  2F5G A;  4ZCL A;  1XMO F;  2RT3 A;  1YRU A;  3KUE A;  4CLL A;  3IP0 A;  1Q82 T;  5IM0 B;  4EBE A;  1GNK A;  1WC5 A;  3JSR A;  4FF4 A;  3W9H A;  4X4V A;  4OX9 J;  4F25 A;  3HHD A;  4JB8 B;  4HHJ A;  2HZA A;  4PYA A;  3DRR A;  3DLG A;  3M2R A;  1IQZ A;  2X1A A;  3NNC A;  1R8C A;  1FX4 A;  2MZQ A;  3GFZ A;  4DQS A;  2E9Z A;  4O44 A;  1U09 A;  1XWL A;  2RIJ A;  1BWE A;  2DIT A;  2XM3 A;  2ZH7 A;  3D54 A;  3TYT A;  2VF3 A;  2R2U A;  3U1L A;  2JC0 A;  2YXL A;  1SH0 A;  1CJK A;  5GAH U;  2OPS B;  3SFG A;  3TZZ A;  3VWS A;  4ZIW A;  3ISN D;  2W25 A;  4YB5 A;  5LMN J;  4OX9 F;  1GTE A;  3MF5 A;  2W1B A;  4C8O A;  5F8N A;  4LR9 A;  2JEF A;  4QWC A;  1S9G A;  3EPG A;  1RWM B;  3PIO Q;  4K4Y A;  3KHL A;  1NK0 A;  1S6Q B;  2JDJ A;  1RT2 A;  3CCE S;  3CCJ S;  2CRL A;  1JK9 B;  3BR8 A;  3L3C A;  3MMA B;  3EZO A;  1VHF A;  4KBI A;  2X1F A;  3B4M A;  1AFJ A;  1T9Y A;  3NS6 A;  1AXQ A;  2AGP A;  3SEO A;  1SQF A;  5LMN F;  3AXK A;  2QRR A;  3M4X A;  2DNY A;  4GO7 X;  2QEX S;  2RDJ A;  2HWI A;  2UUB F;  1HMV B;  1SC3 B;  1WHX A;  3HHL C;  4OHV A;  2Z2Y B;  1A7G E;  5KOX A;  2AP6 A;  2V8G A;  4ETX A;  1S48 A;  5IWA J;  5BYS A;  7FD1 A;  3HHL D;  2DHX A;  2BKN A;  3JTO A;  4ATN A;  4YHH J;  2HVD A;  2DGV A;  3I96 A;  4MIB A;  2PII A;  3PVX A;  4YY3 F;  3CDW A;  1SB6 A;  1MWZ A;  3IG1 B;  5A0Y B;  3PHT A;  2EPI A;  4ZP6 A;  4FVC A;  1SUQ B;  1TL4 A;  5AXL A;  1HQE B;  2IC3 B;  2OPQ A;  3M8W A;  4Y00 A;  3R5G A;  3UCU P;  4C0O C;  1DTT B;  5IQQ A;  2WVF A;  3H2V E;  1APS A;  1HNI B;  5IWA F;  3IA0 A;  4KPY A;  3A3O B;  3P45 B;  3QYY A;  1LW2 B;  2AYG A;  4NRT A;  2CG4 A;  4WKR A;  2CPZ A;  2KM8 B;  3EVW A;  1Z2Z A;  5BYR A;  3V6H A;  2QMW A;  1VIO A;  4CM2 A;  5LXR A;  3UE2 A;  2AT1 B;  3QAU A;  1U26 A;  1XER A;  4DXL A;  2A10 A;  1UZH A;  4U6P A;  5GAD I;  5ETO A;  1WKL A;  3DRY A;  1T05 B;  2MLX A;  4V19 J;  1IBC B;  3VGT A;  2ZFH A;  2VOD A;  3IC1 A;  1JXE A;  1JJ4 A;  4DFJ A;  4ZS6 A;  3IR5 B;  1RT7 B;  3DI6 A;  2DJW A;  5KFA A;  2HFO A;  3HF5 A;  2WK4 A;  3QNW B;  1S7I A;  2P6S A;  4DV3 J;  3OL7 A;  2B3T B;  5D0H A;  1YWX A;  2MTL A;  3OTB A;  2YNI A;  1Z1Z A;  2C2N A;  2HEK A;  3SXL A;  4PEO A;  1L3T A;  2IAJ A;  4OV1 A;  4C3L A;  1H98 A;  4RZR A;  1TL1 A;  1NCL A;  1L3U A;  4DMZ A;  1X60 A;  1LWC A;  5ETM A;  2JX2 A;  1VBK A;  2OIH A;  1C1C A;  4OMF G;  2GO8 A;  3FBC A;  3VQT A;  4MMO A;  3EGN A;  3HO1 A;  4AD6 A;  4DV3 F;  4AL6 A;  2EBG A;  3OFG A;  1ZAV A;  4ID8 A;  4OX8 A;  3Q8V A;  5D4O A;  1QTM A;  2CQI A;  2JLF A;  5B0C A;  1UVN A;  2AW0 A;  2E5J A;  4LUB A;  4CYU A;  2J9D E;  2PMW A;  4OYW A;  4PXE A;  2VFT A;  2ZBR A;  5BJR A;  4U67 Q;  4PUO A;  3MPU B;  3AT1 B;  4ZN3 A;  3CSK A;  1RDR A;  2WAQ D;  2VJU A;  1MMN A;  5E3P A;  1U6F A;  2M52 A;  4NEY A;  4ED1 A;  1X31 C;  1GXU A;  3IM8 A;  2Y0B B;  2IYG A;  3JB9 k;  4LF6 J;  2AGO A;  2J0Q D;  2GIR A;  4HHU A;  1UJ6 A;  3ADA C;  3T1H J;  2PA3 A;  4NCA A;  4KKO A;  1U1L A;  1F0X A;  5KFK A;  2MB0 B;  2BJD A;  1KWM A;  2DY9 A;  3AFG A;  1IBK J;  1S6P A;  2R3V A;  3C6U A;  1NME B;  3A4T A;  2C2K B;  4DWI A;  1TU0 B;  5K8N A;  3HVT B;  2NUH A;  4EWT A;  2GIF A;  1FKO A;  1YKW A;  2ILY A;  4OYZ A;  4PG6 A;  1YBT A;  2VG6 B;  2RQM A;  1T9W A;  4ZVP B;  3ZTQ A;  2IRY A;  3W8P A;  3D6H B;  4ER8 A;  1PJ5 A;  4RU9 A;  5HRO B;  4LF6 F;  4LR8 A;  3DLJ A;  3CF5 Q;  2GJ2 A;  1Q8I A;  3DYA A;  3T1H F;  2B4O A;  3NLC A;  4IRK A;  4NML A;  5DLF A;  2B6A A;  3T5K A;  1S1X A;  2KTQ A;  4QYR A;  5D0E A;  1FE4 A;  5I3U B;  2Y3Y A;  3DOL B;  2NR0 A;  3MAH A;  1VC0 A;  3L4B C;  1RT4 A;  5A8R A;  5BYQ A;  2WON B;  3RR8 A;  4M5L A;  1SL1 A;  4DQP A;  2IRX A;  3B8H A;  3V2U C;  2UXB J;  3AOD A;  4LVN P;  3PX6 A;  4HLB A;  3JYT A;  3BEG B;  1F3V A;  4F3M A;  4N5S A;  2H1Y A;  4R5P B;  1YSJ A;  4OX6 A;  1F6T A;  1NBE B;  3PAC A;  1SJF A;  1VQO S;  1S0V A;  2RJZ A;  3PX4 A;  3FKB A;  2UU9 J;  2H5E A;  2RRB A;  5DO2 A;  2FVQ A;  4U96 A;  1VQS A;  3D7S B;  1NXI A;  3IS9 A;  1NUE A;  1PKU A;  3TQE A;  3EVO A;  1DTQ B;  3GIR A;  1RHK B;  1SKU B;  2UXB F;  2BE2 B;  2DTJ A;  2BYC A;  2YX1 A;  3TWZ A;  2FJE B;  4TYB A;  4C11 B;  1PO6 A;  1YI2 S;  3BSA A;  1NSP A;  2QLW A;  4DCJ B;  1KQS R;  1NPK A;  1Q7Y T;  2QL9 B;  5KFR A;  2XMA A;  1R8H A;  2DGW A;  3FC9 A;  5L8R C;  2UU9 F;  1N5T A;  3EIC A;  1SKR A;  5KFV A;  2GMH A;  4OYB A;  3J7A 1;  2JEJ A;  3QJP A;  3J7Y I;  1RIS A;  4O3S A;  1JJH A;  3Q0A A;  3W60 A;  2V2Q A;  4DCO B;  5DM6 Q;  3W5Z A;  5H9E J;  3CPW R;  4UQT A;  5JUM A;  2ADB A;  5J1N A;  4KSE B;  2BE7 D;  2XLK A;  2GQ2 A;  3NG8 A;  2JWN A;  1R0A A;  3SCJ E;  4ECY A;  3BO3 A;  5DG8 A;  4GC6 A;  3R7S B;  4N76 A;  4W92 B;  5J2P B;  2DNR A;  2QA4 G;  3BBC A;  1YJV A;  4ZPT R;  3DU5 A;  1FDD A;  5KFY A;  2FVC A;  2VIC A;  1VMB A;  4BWJ A;  3IFE A;  3SYZ A;  5HLF A;  1UEV A;  2QSW A;  3MDF A;  3QZ8 A;  2XG8 A;  3HVW A;  1QJH A;  3OTE A;  3MHY A;  5I42 B;  3M2U A;  2PD1 A;  3R1H A;  2QLJ B;  3M30 A;  1NEE A;  1UAW A;  2ZNZ A;  4P71 A;  4PPD A;  4AUK A;  3PJX A;  2LQB A;  4LF9 F;  1AT1 B;  1WKJ A;  3AY0 A;  5C42 A;  4URS A;  4MYT A;  4ZVO B;  3DRX A;  1N5Q A;  2R8H A;  2R7X A;  4CO4 A;  2MMY A;  2JLG A;  2G9O A;  2IPO B;  1U1O A;  2ZIT A;  1NSQ A;  4L73 A;  3W1Y C;  3ETO A;  3OVB A;  4J37 A;  1N48 A;  5H9F K;  4NI2 A;  2GFF A;  4LF4 J;  4RUB A;  3SBM A;  1GFW B;  4ETZ A;  3D3B J;  4DX5 A;  1ZBT A;  1YBU A;  4RW7 B;  2MKY A;  3RW6 A;  1J2V A;  2ASD A;  1TKX B;  5LXY A;  4TY8 A;  1HHQ A;  4RNF A;  4JYA J;  1ZYQ A;  3FNN A;  3AOB A;  1R6V A;  1EET B;  1YVF A;  2CZ4 A;  4CH1 A;  3K8V A;  5GMK a;  2M7S A;  1TVR A;  2Y0S D;  1SJR A;  3HLU A;  3HCX A;  1Q7L B;  4LF4 F;  2FJV A;  4OHW A;  2RH3 A;  2V6A A;  2BAN A;  1UZD A;  4DV0 J;  1CQM A;  2BUN A;  1S1U A;  3QQC D;  2J0W A;  1QTN B;  4PZV A;  2YKP A;  4C8Y A;  4K0K J;  3SDE A;  9RUB A;  5D0R A;  5KT6 A;  1UWB B;  1FJ7 A;  1FTR A;  2VBW A;  4C8L A;  3U27 A;  3UCG A;  5AJ3 J;  1IR0 A;  4P2F A;  2YKQ A;  3N5F A;  1B7Y B;  3CTR A;  2W7O A;  1VR6 A;  1KHV A;  1UVK A;  3OUY B;  3NBP B;  4KO0 A;  2P9E A;  4QWD A;  4DPW A;  1SKW A;  4DV0 F;  3M6W A;  1MSW D;  2R9L A;  2Z30 B;  3HFZ B;  4QWA A;  3DNC A;  2RKI B;  2OFG X;  1VBX A;  3M8P A;  3GFX A;  2NZ4 A;  4KGV B;  2DHG A;  2GGP A;  4PKD B;  4KRW A;  4FPI A;  1XNQ J;  1SVD A;  3QGG A;  1TMM A;  3BJY A;  2FHJ A;  4URG A;  3MMC B;  1D09 B;  5AJ3 F;  4RUH A;  5BR8 J;  5C25 A;  1YJ7 A;  1X5T A;  2FGC A;  3MEE B;  4RBT A;  5CYM B;  1OSC A;  3MZI A;  5L39 A;  2LA4 A;  1U1K A;  3GPA A;  5DGB A;  3CJK B;  3NCR A;  2IM2 A;  3R97 A;  2NXC A;  2DPI A;  5HAO A;  1Q53 A;  1ZA2 B;  3GIL A;  1UEK A;  2VBY A;  1S1V B;  2ZM6 J;  1X4F A;  4PPZ A;  1RAJ A;  1HBN B;  5FDL A;  3J7A N;  1FXD A;  5HAN A;  2YBV A;  4RUA A;  3HHL B;  3TUJ C;  3S1T A;  2XCP A;  1NK9 A;  2MSS A;  5G4D A;  2F4V F;  2YQ3 A;  4OZN A;  2QA2 A;  1QVF R;  1L3K A;  3KDO A;  1OS5 A;  4DL7 A;  3DDI A;  2W8L A;  1NDP A;  4NOH A;  3KJF B;  3GQC A;  2MKH A;  2A3J A;  3SSS A;  2CAD A;  3AH6 A;  3LP0 B;  2F3J A;  4RR5 A;  1KOH A;  3AD7 C;  4PQU A;  2RF2 A;  2ZM6 F;  1KNZ A;  1OQ6 A;  2V50 A;  2CQG A;  2VC0 A;  4O3R A;  2K1R B;  2DRD A;  4JI4 J;  2PEH A;  2X51 A;  1D8Y A;  3VVU A;  2GA7 A;  3VAK A;  3H5U A;  4LFB F;  1G2E A;  4DPX A;  3Q23 A;  2AEM A;  3I5B A;  5C7P A;  5B0D A;  2F1F A;  4F2S A;  3C6T B;  2O01 C;  1SC1 B;  2E9T A;  4LBH A;  2VFV A;  1JLQ B;  2DCL A;  4K8R A;  2DGQ A;  1Q79 A;  3M8Q B;  2NUU G;  1HBU A;  3CJ4 A;  2N82 B;  1JLB A;  3KLF B;  5LOQ A;  2DD8 S;  1N32 J;  3HSG A;  2YNG A;  1KC8 T;  4LIW A;  3I0R B;  5HJY A;  3V81 A;  4WTY A;  1IKY A;  3CT9 A;  1FRM A;  4AND A;  3UNY A;  3FCV A;  3QO9 A;  3JTN A;  1KTQ A;  1N36 J;  3RRH A;  2HWT A;  4R0J A;  4OI0 A;  4HKQ A;  5IS2 A;  2GMJ A;  2E5H A;  1JJ2 R;  1F2H A;  2YWF A;  1N32 F;  2V4J A;  3N0V A;  4Q44 A;  2DGX A;  2BAB A;  4PG7 A;  1VHI A;  1S77 D;  3P5B P;  3M8Y A;  5CH7 B;  3OR1 A;  4RWX A;  1VGY A;  3CME S;  5A8K A;  3CJS A;  3T6B A;  2RAQ A;  1S97 A;  1VDH A;  2CQ3 A;  3TAN A;  1HD0 A;  2BRL A;  1CUL A;  2M0G B;  4ZP7 A;  5ITH A;  1S99 A;  4ZVE A;  5KT7 A;  1TKZ A;  1ZAW A;  4ECR A;  1SL0 A;  1T9V A;  3KK3 A;  4DUY F;  3DRP B;  4CT8 A;  1TL3 A;  2CJ9 A;  3M6V A;  2DR9 A;  2XCA A;  4NLQ A;  4FF2 A;  1V3R A;  5CCL A;  3OR2 A;  3GR0 A;  1OIA A;  3KLI B;  4E0D A;  3IRX B;  3BGO P;  4F36 A;  4A8O A;  5L38 A;  1T95 A;  3VGS A;  3HJV A;  4ED8 A;  4H4O B;  4F3Q A;  3BM7 A;  3OSP A;  4DFK A;  2HRY A;  4WU2 A;  2MZJ A;  5E3R A;  3ULH A;  2KYX A;  1NK4 A;  4KYZ A;  2AGQ A;  4X62 J;  5B08 A;  3DOK B;  1DBD A;  4DQR A;  2ABY A;  4OFZ A;  4HTJ A;  2VD3 A;  3VF0 B;  1B70 B;  2D9O A;  3FMB A;  3BH6 B;  1RTZ A;  3O1L A;  1N6Q B;  1E6Y A;  3MXH P;  3EYZ A;  2NXU A;  1MW7 A;  1N5S A;  4UW2 A;  1FK9 A;  3CJT A;  2AEF A;  4ZVH A;  2WHO A;  4X62 F;  3D9B A;  1UVJ A;  1IKX A;  5EGY A;  2GW8 A;  3U7J A;  3G6V A;  1NH8 A;  2B9X A;  5F0W A;  1MG7 A;  1T9T A;  4YDX A;  3JTP A;  1U4B A;  3K2Y A;  1CPZ A;  1GMW A;  2Z4P A;  2C3Y A;  3FK4 A;  1V5I B;  1M5P C;  5F3Z A;  3LF0 A;  2CXE A;  4O0N A;  5ETV A;  4WU3 A;  4DV7 F;  1HQU A;  1FJG J;  2I0X A;  3S7R A;  1KFD A;  1NK7 A;  2WVC A;  1H6K X;  3PW5 A;  2VKR A;  3BH7 B;  5B09 A;  1Q16 B;  1WDT A;  1BXN A;  2ZOF A;  2EI5 A;  4DF4 A;  3UN2 A;  2MEW A;  3V6K A;  4K4S A;  4K59 A;  3NGT A;  1VCT A;  5HP1 A;  4WF9 Q;  4I1T A;  2D69 A;  1EIY B;  3PEJ A;  3ET6 B;  4RBV A;  3M1V B;  1Y5I B;  2XB2 D;  5KFD A;  1LKZ A;  1FJG F;  3MD1 A;  1VQY A;  1RT5 A;  3D0I E;  1U2R A;  2C3P A;  4NXN J;  1REG X;  4OI4 A;  2ASJ A;  3E01 B;  2W9B A;  4AL7 A;  3CMA S;  4A8F A;  2OAU A;  4E8U A;  1N5V A;  4X4U A;  4Z2X A;  3CJ3 A;  2DGO A;  4P10 A;  4LFA J;  3BKU A;  2R2T A;  4P75 A;  3D5M A;  4FBT A;  4DX6 A;  3PTW A;  4G1Q A;  2RD5 C;  1NK5 A;  1XQI A;  2B4U A;  5H9E K;  3QIP A;  4KY3 A;  2BJ8 A;  2ROE A;  1FWL A;  4NXN F;  1Z2L A;  1RA7 A;  4OJ3 A;  2MZR A;  3D66 A;  3QJJ A;  5KFF A;  4N41 A;  4IUF A;  2PEB A;  5B0F A;  4ECT A;  1GMU A;  4LRF A;  4YP3 A;  1IUJ A;  4WK3 A;  2W9C B;  2FY8 A;  1BWV A;  4LFA F;  4I7F A;  5DJB A;  1HR0 J;  1QAX A;  4I56 A;  4KIA A;  4NCG A;  1LK5 A;  1IKV B;  1Y9O A;  3MM5 B;  3SQO P;  2HHU A;  1TL5 A;  4KGK A;  2APO A;  1RT3 B;  4ENO A;  3G82 B;  3WHI A;  2VDI A;  1X4D A;  2DGS A;  2UUW A;  3LPY A;  1WOR A;  3KUG A;  1EAY C;  2JL9 A;  2KG1 A;  2JVO A;  5CAB A;  1FNX H;  5K8M A;  1PJ6 A;  2HBZ B;  5ETQ A;  5HL7 Q;  3DRR B;  3DLG B;  9ATC B;  1HR0 F;  3M2R B;  2MY7 A;  4WFY A;  4A4J A;  5B7W A;  2I38 A;  3UD4 P;  4Y2I A;  3ZZU A;  4O44 B;  3QSY B;  2PI5 A;  1JLF A;  2CPH A;  4B9L A;  4ZLJ A;  1C0T A;  3W7B A;  1JLG A;  2L9W A;  1O5J A;  2OPP A;  2IA0 A;  4USM A;  4X84 A;  1CJK B;  3VAJ A;  3UO0 A;  3CUN A;  2WBM A;  4HT5 A;  3G8T A;  3TEG A;  2HGM A;  3CXC R;  2J9E A;  3MEC B;  1S9G B;  2HNZ A;  2NS1 B;  4N47 A;  1NKE A;  2WSC C;  2M2B A;  3MPW A;  2F65 A;  1WG1 A;  3NAI A;  2XTJ P;  1RT2 B;  3FJ2 A;  4DQI A;  3MAA A;  2Q79 A;  1FWK A;  1UW4 A;  5DDQ C;  1Q95 G;  4NLV A;  4J9S A;  2DO4 A;  1Q81 T;  1IWA A;  2ZC4 A;  5LT5 A;  2ALY B;  4QJV A;  3HUL A;  1TKD A;  3CCL S;  4B3T J;  4I64 A;  4ZVR B;  5J1P A;  1WEY A;  4ZOS A;  2V9K A;  5DG7 A;  3T9Z A;  3S8S A;  3MD3 A;  3SV3 A;  1OYD A;  2CWX A;  4HHH A;  4USV A;  4DPU A;  3I5A A;  7AT1 B;  2LP4 A;  2GVZ A;  2BE9 B;  1X8D A;  1P9Y A;  1QSY A;  4OI1 A;  4DR4 J;  1D3W A;  3V4M A;  3VAH A;  1S7H A;  4MK7 A;  2BJ1 A;  1WF1 A;  1FJC A;  5F8I A;  4ZVU B;  4XDC A;  2OPQ B;  1SIZ A;  3PO4 A;  1W2I A;  4B3T F;  3OTD A;  3U02 A;  3L7P A;  4JOU A;  4CQ1 A;  2VH7 A;  1RAF B;  1FFS B;  3CO0 P;  3QLH A;  2P8I A;  3QT7 A;  1ZA1 B;  4K4W A;  4M5M A;  3KHR A;  2DXE A;  4K5S A;  1B0P A;  4DR4 F;  3MEG A;  4B9M A;  2E1P A;  4ED2 A;  5FLX Y;  3X3U A;  1YRT A;  2PFD A;  1KD1 T;  2HVE A;  5IT9 U;  3ONQ A;  5ETT A;  4JP8 A;  3CWJ A;  1NND A;  2HPU A;  2MY8 A;  2HHS A;  2IBK A;  2EW9 A;  2J9D A;  2NXJ A;  3DI6 B;  1RTD A;  3Q8R B;  4F4X A;  4DFM A;  4HDG A;  5DGA A;  3L7O A;  2XY5 A;  5T14 A;  4O3N A;  3P3D A;  3FBF A;  2MKJ A;  5K14 A;  5EWG A;  3KOA A;  4ITS A;  2YNI B;  4AYB D;  4OZ0 A;  2FVP A;  4EZ6 A;  3BYR A;  2IAJ B;  3PRD A;  3K58 A;  3NGS A;  1TL1 B;  4WJB A;  1QLN A;  3KLE A;  4PRF A;  3IM9 A;  1LWC B;  3GJR B;  2DR6 A;  1S10 A;  1Q5V A;  4DR6 F;  1C1C B;  3JQM A;  4U8Y A;  4DEZ A;  2DGT A;  5KFL A;  1O0P A;  3LAN A;  2MJU A;  1PBU A;  1SIW B;  4LT6 A;  1ZM3 A;  1OJ4 A;  4DCP B;  1QUV A;  3UNG C;  4EO8 A;  3WC2 A;  3FDS A;  3PO5 A;  4CYU B;  3HPO A;  3L09 A;  2HNY A;  4OYM A;  4ICL A;  2OMO A;  2IFX A;  3TP2 A;  4PUO B;  2WTF A;  1TKT A;  2DH7 A;  1TUG B;  1IXK A;  1G1X A;  2E5I A;  4U8V A;  3KG0 A;  3V5R A;  3R5B A;  1HIY A;  4DS4 A;  1DY3 A;  1JKH A;  1XMQ J;  3SCI E;  3D6M B;  1KFS A;  2RVJ A;  4Y2M A;  3R5J B;  1GXT A;  1MML A;  4ZCI A;  4OHY A;  4KKO B;  2EXU A;  3IBW A;  1GT8 A;  1N56 A;  4DUZ J;  4UY8 5;  5L1I A;  3WC0 A;  1S6P B;  3C6U B;  3M8S A;  3CDE A;  3CCW A;  4DU7 A;  1RA6 A;  1QAJ A;  4C4W A;  4GVB A;  1FKO B;  3EZU A;  4CO1 A;  2XZT B;  3DFE A;  3HVR A;  2HHX A;  3PFE A;  4CO3 A;  2DNM A;  3MM7 A;  1SH2 A;  5KT2 A;  5KFP A;  2BV3 A;  3EE3 A;  1XMQ F;  4KV8 A;  3IBC B;  2CWK A;  1UCN A;  5LSR A;  2HQG A;  4PQA A;  3DYA B;  3I4H X;  2BMB A;  1NRK A;  2EC0 A;  5DET A;  4M5N A;  4DR7 J;  2OLW A;  3TZY A;  2B6A B;  4BDP A;  1BHN A;  1RHU B;  1S1X B;  2OML A;  4DLE A;  3HFV A;  2V67 A;  1LW0 A;  1N33 J;  4RL1 A;  1SH3 A;  2Z2Z A;  4GMK A;  5CYJ A;  4LRC A;  4KGX B;  1NM2 A;  1RT4 B;  5A8R B;  4ELT A;  2GHV C;  5E33 A;  2Z57 B;  4KJI A;  1GMW D;  2IVY A;  1R31 A;  3JYT B;  2HRU A;  5J2Q A;  2FJD B;  3K89 A;  3MM6 A;  1J5E F;  1RK8 A;  3FSX A;  4NA3 A;  3EGV A;  3BGR A;  3J7Z 5;  3H8Y A;  3R1L A;  2N7C A;  1VK8 A;  2MKK A;  1AUS L;  1REV A;  3TUP A;  1N33 F;  3PR4 A;  3BO2 A;  4LSL A;  5I3Q A;  2VQF J;  3AJ2 A;  3MTJ A;  3I4P A;  3F73 A;  3IS9 B;  2PFF B;  3A3P B;  3MCM A;  5A8W A;  1F5A A;  3W62 A;  4TLR A;  3G6E S;  1FTC A;  4Y65 A;  4WP9 A;  5C5J A;  1PG5 B;  5JVG Q;  1N5Y A;  2O3D A;  2HAF A;  1NK8 A;  1C1B A;  2OEM A;  2VOO A;  3W8G A;  1VLO A;  5M2U A;  3KMQ A;  3H5S A;  4Y6I A;  2VQF F;  2DIS A;  3BYP A;  1R8P A;  5SZT A;  1T94 A;  2C3M A;  3KDN A;  3UN3 A;  2C2R A;  2YKN A;  3CCR S;  2WCX A;  2LXF A;  3UI3 A;  1H2T Z;  1T8E A;  4X4R A;  1R0A B;  4B3S F;  2ZOG A;  1RXO B;  5JJB A;  3C19 A;  3UW1 A;  2AQ4 A;  1FRX A;  3F56 A;  4LBP A;  4DV6 J;  1BQX A;  3OD2 A;  1KTV A;  3P96 A;  2Z2M A;  1JX4 A;  1RGV A;  2I5J A;  2P9C A;  1YJU A;  5HLF B;  3ZTS A;  3BPD A;  4J9M A;  1R43 A;  4RPF A;  1H3D A;  2W4P A;  1CJV A;  2I6W A;  3VQS A;  4L3N A;  3P6Y C;  2B51 A;  3M2U B;  1GX5 A;  3M30 B;  3CCZ A;  2QLF B;  1Y5N B;  3CDA A;  2WRM A;  2MKI A;  3GCW P;  1M5S A;  3EVM A;  5C42 B;  3OJU A;  2MZ1 A;  1RHM B;  3EPI A;  4DV6 F;  2CAJ A;  1X0F A;  8ATC B;  1T02 A;  2XMK A;  4OZ1 A;  4Y3C A;  3V6D B;  4NMX A;  4J9V A;  4OLP A;  2FLN A;  5L9X A;  4C7Q A;  1MNE A;  3QBC A;  3T6J A;  1NZA A;  2Y1I A;  1DFD A;  2HQ3 A;  4O23 A;  1RAG B;  3J80 U;  4A46 A;  4NI2 B;  4C97 A;  2DPJ A;  4FNH A;  1GK8 A;  2ZDO A;  1S0M A;  2ALZ A;  2VG5 A;  5K5M A;  3BBB A;  1S1T A;  1Y11 A;  4TY8 B;  4RUC A;  2J9C A;  5DDP C;  4TLQ A;  5HK4 A;  2H3E B;  4ES3 A;  2FQQ B;  3G9C A;  4XO0 A;  4BLG A;  1TVR B;  2HFZ A;  3BKF A;  1PJ7 A;  5A2Q Y;  3KHG A;  1M5K C;  3ZTO A;  2B9E A;  3K8W A;  4DU8 A;  3R5C A;  3K0J A;  3OTO J;  4CH0 S;  3MUR P;  2PSZ A;  2PMZ D;  2WB4 A;  1EJ7 L;  2BAN B;  1MRO A;  5KFG A;  5F8M A;  4LSN A;  3OXG A;  1S1U B;  4M5J A;  1GEH A;  1X4B A;  2IMW P;  4M5I A;  2KM8 C;  1NKB A;  3W63 A;  1VRU A;  3SDE B;  3B78 A;  4OZ3 A;  4ED5 A;  1WHW A;  3PFO A;  2KZZ A;  2P5V A;  2EFV A;  2HRT A;  1FXL A;  3RU0 A;  3J7Y U;  1MMD A;  1HWI A;  4CH7 A;  2AF6 A;  2G0J A;  2IBO A;  3KHH A;  1EKS A;  1T9U A;  4OYP A;  1EKR A;  1JIH A;  1QSL A;  4KO0 B;  4EMD A;  3VAL A;  4XPC A;  5GAE U;  4I6W A;  2GHW A;  3TAP A;  3CC7 S;  1XEZ A;  3M8P B;  1KOO A;  2F40 A;  2GGP B;  3IWN C;  4DOZ A;  4Z37 A;  3CUL A;  2NSB A;  4C6A A;  1OY9 A;  3HHN B;  4Q8F A;  4MKV A;  4WCE Q;  1H73 A;  2CIM A;  1IBM J;  2ZUG A;  5CD4 A;  5BXI A;  3A3N B;  3QJL A;  1RAA B;  5C25 B;  3E51 A;  3UD3 P;  2AKW B;  1I1G A;  3GYX B;  5KG2 A;  3WIU A;  3IGN A;  4IDK A;  2V4Q A;  3ITH A;  3M9M B;  4L76 A;  4DPO A;  2DVI A;  2UXD F;  3MI7 X;  3VAF A;  4O4R A;  1WEL A;  4X65 J;  3CNQ P;  3NGK A;  1R0C B;  2GQC A;  5FDL B;  1UVM A;  3B6B A;  3UDV A;  1F5C A;  2G1D A;  4UST A;  1IBM F;  4DQQ A;  4KHP J;  3K5P A;  1WC4 A;  4D3G A;  3H25 A;  1JJC B;  4WFX A;  1D9D A;  2OD6 A;  1NJZ A;  3GV5 B;  2VPX B;  2BEF A;  5DDO C;  2RQC A;  1VQ9 S;  2PGC A;  4H4K C;  3SV4 A;  3ETM A;  4PWD A;  3NXZ A;  4XIU A;  1LXJ A;  2GJI A;  3UWT A;  4PQU B;  2RF2 B;  2Q6C A;  4LRA A;  2NPF A;  3QT5 A;  1S4E A;  3K5N A;  4F4Y A;  1JB0 C;  1EAR A;  4KHP F;  4WZM A;  5KFJ A;  3PG9 A;  4EU0 A;  2E1C A;  2NPI A;  5DM7 Q;  4OLO A;  4A47 A;  2UP1 A;  3J81 Y;  4OYO A;  3DKD A;  5A6W A;  3T5H A;  4KTQ A;  1F1B B;  1DQ9 A;  2LEP A;  1HBU B;  4FYD A;  1S1W A;  1JLB B;  3FSI A;  4F02 A;  2YNG B;  5DQH A;  1HI0 P;  4YUD A;  3V81 B;  1F60 B;  4B17 A;  1IKY B;  1WC6 A;  4L72 B;  1YGY A;  5AE3 A;  4G1I A;  3ILI A;  3G4S S;  3FZB A;  4KFB A;  3FBB A;  3GV7 B;  3QO9 B;  2XQC A;  1WF2 A;  4ILM A;  2D9P A;  1VI7 A;  3R9L A;  2NCK L;  3GTY X;  2V4J B;  2QE5 A;  2H51 B;  3OXL A;  1M1G A;  3QWU A;  2SXL A;  4Q5V A;  2DHS A;  4MK9 A;  3TUZ C;  2JHE A;  5ETS A;  3QAT A;  3TOQ A;  3H59 A;  2M8H A;  3A8K A;  3OR1 B;  1Q0N A;  3I32 A;  5A8K B;  1U25 A;  2MHE A;  2BZ2 A;  2CJY B;  3CIM A;  2GZO A;  4OHX A;  1RQ0 A;  3JS9 A;  1CUL B;  1FER A;  5D77 A;  3RB3 A;  1S6Q A;  4F67 A;  4A48 A;  3W5Y A;  5EWF A;  1X9M A;  5E3Q A;  1TKZ B;  3MUM P;  5CHC B;  2WOM A;  4OIX A;  2ATL A;  4RLE A;  3KK3 B;  5JXS A;  2V2Z A;  1LK7 A;  2EG2 A;  1TL3 B;  4BCA A;  2EEY A;  2CJB A;  4DL5 A;  6AT1 B;  3D1H A;  4Y0F A;  2GHP A;  1WKK A;  1SQG A;  4J9L A;  1AYE A;  1SJQ A;  1LQ9 A;  4WFZ A;  3OR2 B;  2HBR B;  3FCH A;  1URR A;  1WTB A;  2G2O A;  2B7C B;  3OL9 A;  3HJF A;  2AX0 A;  5A76 A;  1TV6 A;  4YS2 A;  3LAK A;  2KKH A;  2OPR A;  2VQE J;  3MGJ A;  4B9V A;  1TL7 A;  2A0F B;  3NL0 A;  4K7Q A;  4HI2 A;  4TU7 A;  2PI4 A;  3N6L A;  6FDR A;  1H2V Z;  3D4J A;  5GME A;  3VZH A;  1R6Y A;  4F8R A;  2L9N A;  3BGF A;  4DSL A;  1RBA A;  4FNI A;  3FZ2 A;  2X7I A;  5JVH Q;  2KDO A;  4ECQ A;  4Y28 C;  1Z4U A;  2ZVS A;  2UZA A;  2CJQ A;  1E6Y B;  2VQE F;  4JI0 J;  2ZE2 B;  5HSP A;  5D4N A;  1YBA A;  1WG4 A;  4ZVQ B;  1FK9 B;  3PW7 A;  4G3I A;  4Q2L A;  2KO1 A;  4PXC A;  1RWX B;  1JLA A;  1IKX B;  4K50 A;  3S6E A;  5T41 A;  5H1S V;  3RBD A;  1ULR A;  3PEH A;  4JI8 J;  2EFG A;  3TJA A;  3SI8 A;  4IFV A;  4ZCM A;  2QA4 S;  1Y00 A;  4ILL A;  4FBU A;  4UZB A;  3TAR A;  5EWE A;  4YFU A;  4YEA A;  5H9F J;  1RT7 A;  5DZ7 A;  4JI0 F;  1IM6 A;  5IT9 Y;  1N34 J;  2R4F A;  2RS2 A;  2RHS B;  1K47 A;  1FO1 A;  3IRW P;  1HQU B;  1NSK L;  5EUH A;  3UDC A;  3E8O A;  4W98 A;  2FZC B;  1Q78 A;  4DR2 J;  3HMJ G;  1X4G A;  3DDN A;  4HEA 9;  2W01 A;  2LQ5 A;  1UFK A;  2CQ1 A;  2ZZT A;  5HN0 A;  3PYE A;  4DPY A;  2XC9 A;  3EWG A;  3DCA A;  5HP1 B;  3D68 A;  2MQO A;  3D2W A;  4WBF A;  4IH5 A;  1U2C A;  4KH0 B;  3MMJ A;  3HZE A;  2AZ1 A;  3R5A A;  1Q86 T;  3GG0 A;  1FRK A;  4PG5 A;  4I69 A;  2HBQ B;  5B0G A;  2V8D A;  3BN4 A;  3CED A;  1RT5 B;  4P6Q A;  1KVJ A;  5AE1 A;  4M1K A;  2FPH X;  2W9B B;  3K5O A;  1FHT A;  2FJX A;  2XNQ A;  3A8E A;  3HSD A;  2HQF A;  3NY0 A;  3T1Y J;  1FA0 A;  4M63 A;  4FPR A;  1WNE A;  1MWY A;  1NPP A;  3LH2 S;  4UY8 T;  2HHQ A;  5KG4 A;  2B8P A;  1QM9 A;  2MLY A;  1D0E A;  3DC2 A;  4WP8 A;  2E5G A;  4QCL A;  2G0I A;  4JI2 J;  4G1Q B;  1RCO B;  1FJE B;  5THW A;  4EGL A;  3QIP B;  3CC2 S;  3EXC X;  2IYI A;  3RTV A;  3IGV A;  2ZBP A;  2HSE B;  1QDU B;  3SSR A;  1CBK A;  2V34 A;  4Y2C A;  1RAC B;  3ISN C;  2DR8 A;  4JV2 A;  1ZAX A;  2IVM A;  3T1Y F;  2CPF A;  5KFX A;  1W2B R;  3B54 A;  1V9O A;  2IY5 B;  4I7F B;  2DHH A;  1P1L A;  1WI8 A;  3HHE A;  3RBZ A;  4JI2 F;  3GR1 A;  4NCG B;  1HNX J;  1S6U A;  3KUH A;  3BQ1 A;  3DM2 A;  4RW9 A;  1K9M T;  2MST A;  3LPE A;  5ETN A;  2O5D A;  3J7Z T;  1FFW B;  2BQU A;  3RBX A;  1S5Z A;  4CT9 A;  2F8E X;  2G2Z A;  2HLT A;  2Y8W A;  1WC1 A;  1TQL A;  3ICL A;  3NGU A;  1S0N A;  2AHO B;  4DR3 J;  1HNX F;  1RWN B;  4EBC A;  1UFW A;  1BE4 A;  1JLF B;  5HQM A;  1XC9 A;  4O4G A;  1C0T B;  4NLX A;  1JLG B;  3PY8 A;  3UR3 C;  2C3U A;  2OPP B;  5KTQ A;  2BVZ A;  3RJM B;  1LEO A;  1RTJ A;  1U8W A;  1KDN A;  1WF0 A;  4GKJ J;  3AXM A;  4UOF A;  1YQH A;  1YZ7 A;  5AE2 A;  4N8O A;  4C8Z A;  1HL6 A;  2AWZ A;  2HNZ B;  3VVT A;  4DV5 J;  4C48 A;  2B9W A;  4C0B A;  4DR3 F;  3H4B A;  4Y2K A;  4CLT A;  5LSL A;  1EQM A;  5DZ6 A;  5F8G A;  4PG4 A;  3VR1 A;  4F4K A;  3MAA B;  1RYS A;  4UOC A;  3T41 A;  3BGL A;  3CJQ A;  1NLK L;  3D6F B;  2COL A;  1UW9 A;  3KWM A;  3KLG A;  1N4L A;  2MDA A;  3CCS S;  1HFE L;  4YHH F;  1CJU A;  3I0S A;  1VQ7 S;  1M0S A;  2DNO A;  4CNZ A;  4GKJ F;  4LJM A;  1NB2 A;  4R25 A;  1RE1 B;  2XO6 A;  3OQ2 A;  5HVH A;  1ZM9 A;  4F2R A;  3UDL A;  2FIU A;  2VL1 A;  3FRZ A;  5KT3 A;  2FYX A;  2J8S A;  4ELV A;  4DSI A;  4LF5 J;  3EX7 B;  2KJW A;  4YN3 B;  1XK8 A;  3HDS A;  5E2Q A;  2GVZ B;  2FGO A;  2VPY B;  4ZLP A;  1Q5Y A;  5D4P A;  2EFN A;  1PYS B;  3FFI A;  4UTG A;  3G6X A;  1U47 A;  4DFP A;  3VTI A;  3TJ9 A;  3JSM A;  3M6U A;  1S6O A;  3R8Y A;  1Q8K A;  1GQE A;  2V5H G;  1T03 A;  3PCO B;  1FD2 A;  1SJ1 A;  4P7T A;  4ED3 A;  1O6X A;  3GYG A;  2WVB A;  4IYQ A;  3QLH B;  2FZG B;  2V8V A;  1V6H A;  3IR7 B;  2JJ4 D;  2J76 E;  3AB2 B;  3G86 A;  3MEG B;  3LP2 A;  4J9P A;  4DL6 A;  3Q8U A;  3W3S A;  4BC7 A;  2D3Z A;  3TX8 A;  4M5G A;  3C2P A;  4A8S A;  4EO6 A;  4HR2 A;  2OD4 A;  1D1U A;  2ADC A;  1RWW B;  2H5I B;  2NZC A;  3OJS A;  4K4Z A;  1HWU A;  3ENQ A;  4IKA A;  1VLY A;  4XK8 C;  2LXI A;  4UT4 A;  4RU2 A;  4B9N A; 
#chains in the Genus database with same CATH homology
 4CLY A;  4CLS A;  1WC5 A;  4CM2 A;  2QV6 A;  3MR7 A;  4USW A;  2W01 A;  4OYM A;  2GVZ B;  4CLP A;  2WZ1 A;  5D15 A;  4WPA A;  4OYX A;  1WC0 A;  1CS4 B;  4OYO A;  1CUL B;  4CLU A;  1FX2 A;  4WP3 A;  1FX4 A;  4USV A;  4P2X A;  2GVZ A;  4OYW A;  3C15 B;  4OZ3 A;  1AB8 A;  1CJK B;  3C16 B;  1CUL A;  4CLW A;  5D0E A;  1CJT B;  2BW7 A;  4OYB A;  3C15 A;  4CLT A;  1CJK A;  5D0R A;  5IV3 A;  4CM0 A;  4UST A;  3C16 A;  2GVD B;  3ET6 B;  4NI2 B;  1YK9 A;  3C14 B;  3MAA B;  4OYI A;  1CJU B;  1WC4 A;  1WC6 A;  1CJT A;  4OYP A;  1Y10 A;  5D0H A;  1CS4 A;  4P2F A;  4P2M A;  4USU A;  4CLZ A;  4OZ2 A;  2GVD A;  3ET6 A;  1Y11 A;  4NI2 A;  3C14 A;  3R5G A;  3MAA A;  1TL7 B;  1CJU A;  5D0G A;  4CLF A;  3G82 B;  1YBU A;  1CJV B;  4WP8 A;  4CLK A;  1AZS B;  1U0H B;  3UVJ B;  1WC1 A;  1TL7 A;  5IV4 A;  4OYA A;  3G82 A;  4OYZ A;  1CJV A;  1WC3 A;  4WP9 A;  1YBT A;  4CLL A;  1AZS A;  1U0H A;  3UVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...