4X62J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4x62J00
4JI5J 2UU9J 4V1Ak 4DV6J 1J5EJ 4B3TJ 4JI1J 5A2QU 3D3BJ 5LMNJ 4DV2J 4DR6J 4DUYJ 4DR7J 4DV4J 1FJGJ 4DV5J 4HHUA 4DR3J 3R2DJ 4B3RJ 4AQYJ 2MQ8A 5IT9U 4X62J 4JI2J 1I94J 1HNWJ 2UXDJ 2HHHJ 4JYAJ 1IBMJ 1N34J 4PWWA 4JV5J 4LF9J 4DR1J 4DV7J 5LM7E 2F4VJ 4LFCJ 4DV0J 4LFAJ 5IWAJ 1HNZJ 4JI0J 4DR5J 3D3CJ 3T1HJ 3J7AN 2UXCJ 4B3SJ 4YY3J 2MTLA 4X64J 4K0KJ 3R2CJ 1XNRJ 1IBKJ 4KY3A 1XNQJ 4RJVA 4X65J 3IMQJ 4LFBJ 4LF8J 4LF6J 4KYZA 4JI6J 4DV3J 3J80U 4GKJJ 4NEYA 4LF4J 3W1YC 5LMUJ 4B3MJ 1HR0J 4GKKJ 5BR8J 1XMQJ 4DUZJ 1N32J 4LF7J 2ZM6J 4NEZA 3OTOJ 4DR2J 4DR4J 2UUBJ 5FLXU 2KL8A 4JI7J 2E5LJ 4JI3J 3JAMU 2UUCJ 2MEWA 4X66J 4DV1J 1IBLJ 3J81U 2VQEJ 2UXBJ 2UUAJ 1XMOJ 4JI4J 4NXNJ 4KHPJ 4JI8J 4LF5J 2VQFJ 1N33J 4OX9J 2KVQE 5AJ3J 4NXMJ 1N36J 1HNXJ 3T1YJ 4YHHJ
chains in the Genus database with same CATH superfamily
1Q5VA 5JUMA 2YKOA 4DF4A 2I0XA 4ID5A 4UUXA 4ECZA 2IAJB 4DV5J 3HM9A 2GVZA 4YP3A 2IM2A 1RUSA 2R8HA 2CQHA 5L1JA 2MLYA 3QFHA 3DLGA 4ZIVA 4JI6F 5I3QA 3EX7B 4PQUA 5C7PA 2RDIA 2W9BA 5CCMA 3BSAA 4OYAA 3V4IB 3R6GB 4RWXA 2OH2A 3VV2B 3DLJA 1X5TA 1R0AA 4LF1A 3FZ2A 1RT6A 1RHKB 2WOMB 3SCKE 3A8EA 2BBEA 2MLZA 4RUBA 1MU2A 4XPCA 3ZZYA 2BUNA 2J7UA 4DR2J 3G96A 5LMNF 3PW0A 4JI7J 4RUAA 3KLFA 3W2VB 4DX5A 3MEGB 2ZBIA 3OL6A 5IC4B 1YRTA 4EUVA 1WOOA 2HHVA 4DX7A 4WCEQ 1IKYA 5HBMB 3QIPB 5K5MA 3W9IA 5FIIA 2IRUA 2BDPA 2ZUAA 2NUUG 4I68A 1C2PA 4WXOA 3DLHA 2IBOA 3OBIA 4FVMA 3PHTA 5J2MA 2HQFA 3GMGA 2V9KA 3V5RA 1BMQB 1HBOA 4JYAJ 3RZAA 1ULRA 3N01A 4I64A 2VU5A 2BJDA 2B6AA 3NXZA 3NOCA 3TWZA 2QN6B 3GR0A 4DWIA 5GAEU 3LF0A 2LYVA 4K4VA 4FN5A 3I4PA 3H5YA 2OD4A 3D0IE 4OMFG 1EZZB 4LSNA 1WC6A 1LW0A 2WSFC 3SYZA 4A8KA 3ISND 2GX8A 4DV3J 2VG7A 2C28A 2E7VA 1R7IA 1YBTA 4DPOA 1T3OA 2F3JA 3KMQA 3DHWC 4TY8B 1H2UX 3AY0A 3M6VA 5KFIA 2C3PA 2CG4A 4X4UA 4DL4A 1A0OB 1LWXA 5LOQA 1U0SA 3M8WA 2U2FA 2W7AA 3NCQA 4LREA 3Q8SB 4OZ2A 3ENVA 3PNIA 4F8RA 2JC0A 5AJ3J 4O3PA 3KJVB 1HNXJ 3OVAA 1S1TA 2BYCA 3MZIA 1QE1A 2H4YB 3EVMA 3PR4A 1FFGB 1MWQA 1FDAA 2WVDA 2FJWA 4ID8A 4QIFA 3FUYA 4ECQA 4X62J 4RZRA 4F4WA 4QZVB 4J9UE 2CVEA 2QA4G 3BH6B 4DEZA 2X3DA 4RBVA 4QWBA 5KOWA 4DV0J 2OPPB 4ZHRB 1X31C 4I2PA 1YVFA 2MTLA 1JXLA 1VQLS 3O6QA 1U8SA 5CZXA 2RKIB 2XYGB 5T7LB 1HNVB 2WK4A 1WOPA 1RT3B 2WBMA 3TZZA 2MQLA 3UVJB 5DG7A 3VALA 5KFLA 5BYRA 5F8GA 2EWHA 1JMTA 4DMZA 2COLA 3M8ZA 1WEZA 2XO7A 3OVBA 2WZ1A 2ZOMA 4DV4F 2AV5A 4X2BA 4XAKA 5EX0A 5F8NA 1XNRF 2DH7A 5GMKa 2YWKA 5U47A 3FBEA 3NBPA 1SKSA 1GH8A 1RWWB 3S6EA 1VQPS 2YX4A 4DSEA 4DL5A 2FLPA 2PE8A 3MUMP 2ZH3A 3E2EA 1DBDA 1A9NB 4DU7A 4WTYA 2JX2A 1LFPA 4ZVRB 4V19J 3C19A 4ZVOB 3H25A 5H9FK 1LK5A 2DTJA 3DGPA 4FKYA 1U0HB 4WP9A 4N8OA 4O4GA 4KGVB 4ZOSA 2LDYA 2M70A 1NBEB 3ISNC 3OXLA 3KTQA 1SL0A 4B9LA 1CJUA 3UWTA 2E9TA 4XPEA 1VQ4S 5CD4H 1NU4A 2VJUA 1S9FA 4DUZJ 2WONA 3TJAA 1BQMA 2FVCA 3ZO7A 3IRWP 3W66A 4DL3A 5I42A 1PBUA 2CPXA 3UNYA 3JB9k 2N3OA 4OI1A 2HHHF 2HHTA 2YY3A 5AE1A 1FHTA 1NNDA 1OSDA 5HMZA 6AT1B 2MZQA 3ZNUA 4RKUC 4IG3A 5DETA 1W25A 4HHJA 4MK8A 3PO4A 4B02A 1XNQF 4AXJA 3BEGB 1KTVA 1S6UA 4A8MP 5AXKA 4PUOB 3GP9A 3D6FB 3MM6A 5IFMA 2VPWB 2VHGA 5IWAJ 2IVYA 3LP2A 3HD1A 2DNMA 4E8UA 3OTOF 1TAQA 3OUYA 5GAHU 3DYAB 3K8WA 4OLOA 2IIHA 1RQ0A 1Z2LA 2JFDA 5HI7A 2UXBF 1DTTB 4K4TA 3D0HE 5C25B 3MMCA 4GKJJ 2KH9A 1N52B 3MECA 4F36A 1N36F 2O67A 3PTWA 4WIIA 2G0CA 1NDPA 3DXSX 1HFEL 2EI5A 4PYAA 3DDNA 4TQSA 2HK3A 4R8UA 3PFOA 2QO3A 3MEEA 4YR2A 3BGFA 1YJRA 3UNGC 2XMAA 5RUBA 1OPZA 1UVIA 1NK6A 4M1KA 3KK1A 5A8WB 3IG1B 3BPDA 4B3MF 3DM2A 4NZ6A 3HHLC 2FD2A 2H5JB 4B9SA 5HVFA 2OPRA 4ENOA 2WTFA 1KOOA 1F5CA 1N34J 1IBMJ 3RAMA 1I6JA 3QT7A 4LIRA 2XI3A 3N4WA 5A6WA 4K4ZA 1FJCA 1YJ9S 2FVRA 4ELTA 3Q8UA 3R5CA 1UPMB 3D1QA 3FC9A 4ZLNA 2OIHA 3C46A 2ZH6A 1RWPB 1U1RA 1WNEA 2IYGA 1TKXB 2XBPA 2C3OA 3I55S 2GIQA 1ACMB 3VQSA 2AHOB 3CJ3A 3OFHA 2A18A 3R3TA 2QLXA 2D3UA 5KT4A 4EYIB 1Y11A 1X5SA 3MAAA 1NHUA 1LWEB 3GB0A 3PXGa 1VC0A 1S6QB 5D3GB 2GIRA 1WORA 4NWBA 4UUWA 3I96A 2H5IB 5L38A 5HATA 1ICEB 3BB5A 3GU0A 3I0RB 4IRDA 2RJZA 4J7CA 1YX2A 2K7KA 5FDLA 1FT8A 2WW4A 1VIOA 5F8JA 5HJYA 3J7A1 1WC5A 3ZZRA 1L3KA 1QAXA 2V8GA 3RRGA 2YKNB 5IXUA 5IT0A 3U1MA 2XZWA 4FXDA 1FXDA 4FYXB 5LM7E 2MY7A 5K9FA 3CDUA 3A4TA 1NAQA 3AT1B 1F3VA 3JTOA 1RTJA 1WF2A 4F04B 1B7FA 1ZM2A 1VBYA 3CWJA 1RB0A 4NI2A 2V4JB 5HAOA 1GNKA 2HFOA 1CULA 1FRIA 4P7TA 1S57A 3R7BB 4G3IA 4WE1B 5B0AA 3KG4A 2Z57B 3CJ0A 4F0MA 2EXUA 4USMA 4DPYA 4O23A 1KVJA 2LEBA 4F4KA 2BJ1A 3Q83A 2DNQA 2P6TA 1VQ8S 3N6MA 1R8PA 2OPSA 2CQGA 4L73A 2EPIA 4NYPA 3MMAB 4HHUA 4RR5A 4CYUA 3AOCA 4B3OA 2W24A 4LF6F 2E29A 4ZLJA 1UWBB 1XQIA 1R6VA 4Y65A 1HQUB 1SL1A 1UETA 3T1AA 3G8TA 2BXJA 3M9MB 1S1WB 2I2YA 1HWJA 2M52A 3U27A 2J0SD 4X66F 4DG1B 2LXIA 1KR4A 4GO7X 5J2NB 3JQJA 1RWXB 1G6BA 1NJWA 2HQDA 3J80U 5KFWA 2ADCA 2UVRA 2LLZA 2J9CA 4LUBA 2QX0A 4I56A 2KZZA 2CJAA 4NOHA 2XY5A 3VGSA 5DLGA 1X0PA 1PKUA 2KRBA 3TVYA 4CRJA 4F26A 3UN5A 2DNLA 3OT9A 3CJ2A 1JIHA 3WHIA 2OPQB 3TA2A 3SQGA 2IM0A 4JI1J 4Z7CA 3KLHA 5IV4A 4FBTA 4JV1A 2RUSA 4Q5VA 1R27B 1VQNS 2XC9A 2AYEA 1R0CB 4DR3J 2RQCA 2CDRB 3JS9A 3MXHP 4XIUA 4YMEA 1ZTTA 2EC0A 1GQEA 2X7IA 1R43A 4KC5A 2E5IA 1T9XA 3BBFA 4KKOB 4Y2MA 4WK3A 1JNRB 4NASA 2E1AA 2PGCA 3PM9A 2F9DA 3TA0A 2J0QD 1P27B 1YSJA 2XHWA 3H2LA 3H2VE 1CJKB 4DSJA 1SC3B 4CDIA 3DRRB 5LMUJ 1WHXA 3L7UA 3T9NA 1Q8BA 2Z4PA 2BABA 5K8OA 7AT1B 2HS3A 2VUGA 4PKDB 4ZITA 1EIYB 1NDKA 4AQYF 4ZCMA 1TL7B 1UKUA 2ZNYA 4J9OA 2CRLA 2HMIB 1EJ7L 1RK8A 3IBCB 2YBVA 4V1Ak 5E3QA 1Z4UA 3CCRS 3TEHB 1S0NA 1SUQA 4IDKA 5B0BA 5J1PA 3RYLA 1HMVB 1UL3A 2LKZA 2DHAA 2DYAA 3SMZA 2OEMA 2R7VA 3F44A 3LALA 1OY9A 1ZS6A 5A0YB 5CD4A 1NSAA 1UZDA 3G6VA 3RBDA 4N41A 3B8HA 2QZ8A 3M1VA 4QR1A 4NLSA 4HACA 4ZCKA 4HL9A 5HQLA 3Q89A 1TMJA 2FC8A 4KHRA 1JJ4A 1HI8A 4DV1F 3OXFA 2ZOGA 1S76D 1TL1B 4MYUA 2OTLS 3R5AA 5CYMB 4P73A 3LAMA 3H5XA 1PILA 3W2WB 2J6SA 2HKEA 4LRBA 3H7HB 4OYXA 2RRNA 5HQMA 4IQMA 4J9MA 4MJKA 1VS3A 4M5LA 3HSZA 2CQDA 2J9DE 1PSDA 1Q79A 1RAEB 1LW2B 3D4JA 3NOGA 2XGQA 3MM8A 2B7CB 5L1IA 4ICLA 3MI7X 5CABA 2XYPB 2QMXA 2B5JA 4EU0A 4L6V3 5E3CA 4YFUA 3O1LA 2E9RX 2JRSA 1WD6A 2H1YA 1LK7A 3I5AA 2XSJA 1TKTB 3CCES 5GAGU 3GG1A 2NQPA 3UDEA 1RAGB 1RJJA 4N7TA 3FGVA 2Z30B 5A8KA 1BQNB 4ZIWA 3ENAA 1ZAVA 4MKBA 1IWGA 2HHQA 4JI8F 2N82B 2C2ZB 4WWSA 4C3MA 3OSNA 5ETMA 1TUVA 1XMQJ 4NCAA 3CT9A 3SSQA 1S77D 3IWLA 3BKTA 1K47A 2CFXA 2LCWA 5KFOA 3DOKA 1YDLA 2PA8D 4IG0B 4IO9Q 3PKYA 2XULA 2JNJA 4LF5J 3K5OA 3DRYA 3A8JA 1YTYA 4USVA 3T6JA 3M2RB 2V4QA 1WKJA 2EEYA 2F4VF 4W4MA 4OJGA 1V5IB 2WRMA 1IN0A 1FNXH 2HHUA 2ZM6F 4DJBA 2UVWA 2M88A 1U6FA 4JV0A 2O5DA 1VISA 4L76A 4DF8A 5J2PB 4DR5J 3FEYB 3L3CA 1RWVB 4NLOA 5K8PA 4PWUA 2VONA 2PI5A 4NA1A 2XLIA 4WU3A 2JZ5A 1HBOB 3ETMA 3FBFA 4IQXA 1S9GB 2BM1A 3WX8A 3VAGA 3G6ES 1K0VA 3ENWA 2XMVA 4XDDA 4PXDA 3MM7A 4QQBA 3K58A 4ES2A 4OHVA 2YKAA 4M5NA 2VG7B 4FYYB 1KFDA 4NXMJ 4HYKA 3RGIA 4MAKA 3OL9A 5LL6d 3D68A 3MAHA 1WSRA 4Y00A 4CI0B 2BE2B 3GV7B 1GXTA 4CLZA 2AX1A 1X60A 2UXDJ 4QU6A 3M8RA 3R5JB 4HT7A 3K5NA 3PW4A 2F8MA 3ZC4A 1C1BA 1TFWA 4N8NA 4LF4F 1EQ0A 4D3HA 5HROA 1UZHA 3CXCR 2RAQA 3DKDA 3I87A 4FF2A 1N8RT 3F56A 5LSRA 2VBYA 3ENQA 2Y0BB 4Y2IA 2QT7A 5KFVA 1P6TA 4C11B 2CUYA 2I6WA 1HBUB 4WP8A 2UU9F 2RQMA 3AJDA 2DNNA 2NSBA 2VKZG 3GIKA 2KN4A 3KXDA 1T7PA 3ITHA 3KLVA 5G4DA 2X1GA 1URRA 3BGUA 5AXNA 4MMOA 2M4MA 1SL2A 3HVAA 1JLBA 3FDSA 3T41A 2Y1IA 3Q8YA 2LDIA 3A13A 3GG0A 2AJ0A 3OTCA 5A2QU 1DURA 2ZHAA 4ES3A 2QFIA 4ZPAA 1RAIB 4Q8FA 2DO0A 2JEGA 2Q6CA 3MFHA 3L4BC 5AE3A 2PO4A 3M2UA 3KNAA 3K7RA 3DN9A 2R42A 3FVYA 3DLKA 4JOUA 1EP4B 2G4BA 2NR0A 2IYIA 4RWWA 2EG1A 4W98A 4PZVA 1AFJA 3N28A 3RB3A 3AXKA 3MR5A 3IS9B 2BMBA 4FF4A 2DIVA 3TRGA 4YY3J 2W9CA 3T9ZA 1MMDA 3BGRA 5F8MA 2DGWA 3VGVA 3BJYA 1YIJS 5GADU 1NXIA 2YXLA 2G2OA 2HBYB 1UEUA 2OMOA 3L9ZA 2B8QA 2DBBA 2UZAA 4A8WA 4TQRA 3M6UA 3THTA 2GAHC 4O4GB 4CO0A 2UUBJ 2E5LJ 1DTQA 2R7TA 2XEXA 4H4MB 3D1OA 3AD8C 3HZEA 4ZVEA 2DNPA 4PG5A 3I4HX 3I0SA 1TKZA 2QLBB 4WK1A 4QYZK 3RU0A 2Q43A 3DGVA 1IKWA 2A6OA 3TX0A 3NL0A 2AGQA 3CO9A 1C1CA 3NGTA 2MQ8A 1ZM3A 4P10A 2G2YA 4M5DA 1TL5A 2VC1A 2H65B 5HLFA 4MKYA 3WDOA 4RW8A 4LRDA 3TUIC 1F5AA 1D9DA 1Q0NA 3R8YA 2YKPA 2VC0A 2M9KA 2V4RA 1U26A 2ZOFA 3LH2S 2Z58B 1IVZA 2RVJA 4RBTA 1FWLA 1O5JA 3JSBA 2C3YA 1TZ0A 1VQ9S 3C66A 3BSNA 1ITPA 4QIWD 2YQ0A 4G1IA 2WB1D 1BWVA 2EVZA 4DPWA 2IVMA 3KDOA 4KJIA 2X1BA 2LA4A 4HI1A 2KDOA 2BZ2A 3ONQA 5KFNA 1VRTA 3M9NB 2XG8A 4KGKA 2Y8WA 2DIUA 3C6TA 4OHYA 4I6YA 4FXVA 3GPAA 2LXUA 1KN6A 3JSMA 3JYTA 4WZQA 5KT5A 4X4RA 3M8SA 3MCNA 1ZH5A 3R6LB 4KH1B 1ZPVA 5KFHA 3IR7B 3PW7A 3KHGA 2KT5A 2BR0A 4MIWA 3CDAA 1QVFR 2D3ZA 4KTQA 1BD6A 3N5FA 2DCLA 1S1UA 4KV8B 3H5UA 3UPFA 5GVQA 5LSOA 1R0BG 2BJEA 2UUCF 4IOBA 3IMQJ 5F0WA 1NK5A 4DL2A 1U1OA 4YN3B 4KR0B 1N33F 4DPUA 2ILZA 3GILA 2VH7A 4LF7J 2YWGA 1G7CB 4A48A 4PG6A 4O0NA 1HBNB 1H38A 3TAQA 4DUYF 1UJ5A 3DFEA 2V69A 2V5HG 3VWSA 2VQFJ 5D0RA 2CZVC 1NRKA 2BQUA 1EB0A 1ZAXA 2NXUA 3DU6A 1IR1A 4OJHA 5C42A 4NZ0A 4Q8EA 2K1RB 4Y3CA 5DRKA 4JI2J 4LIWA 1I94J 2W4DA 3CTRA 2QRRA 4NLVA 2UVUA 3FQKA 2ZHOA 3B54A 1CLFA 2E66A 5BYQA 4BLGA 1VQ7S 1RTDA 1Y3KA 1Y9OA 3Q22A 1WHYA 2Q6BA 3LGNA 4TU8A 3J7AN 4KAIA 2IAJA 3RTVA 2CQCA 3M8PB 4NCBA 3Q24A 5D0EA 3TJ8A 2PI4A 2HVDA 3D5MA 1QSLA 1FX4A 1NZ8A 1IJFB 3NAHA 1M1KT 1U6BA 3SFUA 1MLAA 1XJWB 3V4IA 5EN1A 1TL4A 4OYIA 4UF4A 4Q2LA 2VBWA 4XK8C 2WBRA 4O44A 1DQ8A 4A8OA 4KHPJ 4YB7A 3TJ9A 4JP8A 2WOMA 3DOLA 1S1XB 3CCMS 1CULB 3KJFB 5DGBA 3J81Y 3BR9A 1HD0A 2FJEB 3W5XA 2MGZB 3J7YU 2RS8A 4ZN3A 1FFSB 4B9UA 1I3OB 2W2QP 2FB0A 1ZZFA 5DZ6A 3W2VA 3MEGA 1T0TV 3PV8A 1RU2A 1UVKA 5HBMA 3A8KA 2VF3A 1F9EB 1HNZJ 1LNQA 2BKOA 3W64A 3RJMB 4M5JA 3CJQA 3CC2S 4MTPA 2CJYB 1SH2A 4D3GA 1PC5A 5KFQA 1RA7A 4QR0A 1D8ZA 3PX0A 3AOAA 4DV6F 3EDQB 1NK7A 2W2MP 1ZM4A 2DY9A 4ECVA 3NWRA 5DGAA 2MSSA 3KUEA 2X1AA 2AP6A 1QUPA 3IRXB 1O8BA 2UUAJ 3CGIA 3UI3A 3G82B 3QAEA 3BO2A 4N56A 1OQ6A 1YK9A 1RWOB 1SH3A 1S10A 2QLWA 3I32A 3KJQB 2G9OA 5KFDA 1P1TA 4QIEA 2XMKA 3D67A 3KK2B 4PYDA 2FZCB 4TY8A 1VQYA 3HHDA 1OO0B 3OR1B 2HZVA 1C4AA 1U49A 1F0XA 3UR0A 1NPPA 3DOMB 3TX8A 3BS9A 3CJKB 2Q3PA 1HPZB 4CH0S 1S59A 3I31A 1BHNA 1IBKJ 2JFKA 5EWEA 2HGNA 2C3UA 2D74B 2HFUA 4B9NA 2B0GA 3G8QA 2NXJA 1C0TB 3H20A 1YWXA 4PAAA 4X4PA 2OPPA 4PXCA 3QGPA 1FTRA 4ZHRA 2RIJA 2NZ4A 3OHBA 3KFWX 2V68A 1FJ7A 5DLFA 2NYIA 4CLSA 4DL0C 2RKIA 1M0SA 5T7LA 1HNVA 2R2TA 4NE9C 1VK3A 2OGUA 4P71A 1XR7A 2BV3A 1AZSB 3IM8A 1RT3A 3EXCX 1FO1A 2FC9A 3UVJA 4QOTA 2E1CA 2MY8A 3T1HF 4P6QA 4MT1A 4NLDA 5J2QB 3P5TL 3IWNC 1X8DA 1F1BB 2ILYA 4LF2A 1WEXA 3DRXA 4G1QB 1SIWB 3NP5A 3ADAC 3QJJA 3TUZC 5B0GA 4P2XA 3J7Z5 1MMNA 4CO4A 3Q0AA 1KP6A 1AT1B 2KYZA 2FPHX 2VKRA 1D9FA 1XNRJ 5E3AA 4YDDB 7FD1A 1OMSA 2AKWB 1VMBA 5CYJA 4DFMA 2MKHA 4EK2A 3TZXA 3HXMA 1PYTA 3ZZTA 2MKCA 2EKNA 1TMMA 5ETQA 4DQPA 1OS5A 3GJQB 4HACB 1U0HA 3ILJA 1FRXA 1NKEA 1XMBA 5H1SV 1VBKA 3H40A 4I6AA 2AZ3A 1RE1B 5IT4A 3TEGA 5HP1B 1MROA 4JV5F 4J9LA 2PMHA 3HJVA 2W8LA 3CJ8A 3QPIA 1JJCB 4OYMA 4NX9A 2DHSA 3TAMB 4DL7A 1PAEX 3MTJA 3DLLQ 3VAJA 3GWCA 1H7WA 2ZC4A 4M5HA 2CQ4A 5JXSA 1SJ1A 2FDNA 1SJQA 4DS4A 1S9EA 3ILLA 4RPFA 1IWAA 3QT5A 2MDAA 2KFNA 2ZITA 1ZOTA 1O0PA 1IBLF 3NGSA 1L3VA 3AFGA 2QYGA 4PXBA 2C2DA 2KYXA 4ZVUB 4LR7A 1B99A 3I9ZA 1JLAB 2PFDA 4PUOA 5ETKA 1YKWA 4K7QA 2H4WB 3FCVA 2DNGA 1CS4A 3BBCA 3TANA 3OJSA 2W9AA 5B7WA 5D78A 3CDWA 3C14A 3OFFA 3K89A 1SJRA 3DYAA 4BBYA 2ABYA 2CPYA 4OX9J 3TW0A 3UD3P 5T14A 1DTTA 5C25A 2NLWA 4ZPWR 1KLNA 4P9SA 4A8QA 2H54B 3D66A 2OTJS 2AF6A 3KLGB 2FHKA 2RDDA 2R8KA 3FSIA 3GFZA 2CQPA 2IY5B 1X4AA 3Q2TC 3OL8A 1S1VA 2F8EX 4K59A 1KFSA 3CC7S 2KVIA 4C8ZA 4KQZA 2ZE2B 4ZP8A 3PFEA 3MMBB 1BXNA 4DR2F 3G87A 5A8WA 3IG1A 3P6YC 4JI7F 2Y1LB 5ETPA 3HP6A 3BDPA 2QTWA 3LPEA 4HDGA 1ZA1B 1WACA 1FXLA 4ZVTB 3TVKA 1XERA 4B3MJ 1RHJB 5KFPA 2M8DB 3CIMA 2BQRA 1KKHA 3SXLA 2LA6A 3C16B 2M7SA 1CEZA 2KHDA 4IOAQ 2MZ1A 4JYAF 2LP4A 1KVIA 2N4CA 2BANA 2F7VA 4RL1A 4ED3A 1ZYQA 4DR7J 4CLKA 3HI9A 4P7VA 4ED4A 5IT9U 1E6VA 2N4DA 5KFJA 2OD6A 1LWEA 2GMLA 4OYWA 3C15B 4QWEA 4DV3F 3NMRA 1S6QA 2E7WA 3H59A 5D3GA 5HMWA 3TZYA 4TYAA 3VAMA 1TV6B 2CADA 4KFBB 1T11A 3UD5A 3I0RA 2HRYA 4LBPA 2Z56B 4X65J 4USJC 2BJ8A 2WCXA 1QSYA 1U25A 3D54A 2YKNA 5AJ3F 4CNZA 1HNXF 3FCWA 5HROB 5AT1B 1EKRA 4EBEA 2FVQA 1APSA 2Z2YB 3UD4P 1JB0C 2W4CA 4X62F 4Z7YA 1TU0B 1GTEA 3Q8PB 1M5KC 2JVRA 5KG7A 3CD7A 4CLFA 3QNWB 3FK4A 4NL5A 4CH7A 2V4JA 2IA0A 1RT1B 1Q7LB 3CJSA 4MKAA 3GFYA 4DSLA 4PPDA 4WE1A 4OYZA 1WC3A 4M63A 2WSEC 1QAJA 1FX2A 4J91A 4USTA 1X9SA 3ELHA 2M8HA 3UDLA 3CJTA 5DS7A 4HDHA 4LQ3A 1F6TA 3VZHA 4NMLA 1BE4A 1H0HB 2HAIA 4K5RA 3Q2SC 4C7QA 4U7UD 4RJVA 3MMAA 5LXRA 5KFMA 3M2UB 4LBIA 4C98A 2H5EA 5HMXA 1WDTA 2LEAA 2CJQA 3FNNA 1HI0P 2H9ZA 1KQKA 4WFBQ 5KFXA 5GAHI 1UVMA 1HQUA 4Y0FA 3GQCA 1KQSR 4JUZA 1HWUA 5KG0A 2EG2A 3AJ2A 4IRKA 2ZJPQ 2V9WA 1S1WA 2RDJA 1HBMB 4ZN1A 4ECXA 2FYXA 3OTDA 4DG1A 2YWHA 2CJXB 4CQ1A 3M8QB 1KOHA 1Y5IB 1RYRA 3W65A 3UQSA 2OEKA 4ANCA 4C97A 2DHHA 3T3FA 2ZVSA 1YI2S 4C8MA 3R2DJ 3G9CA 1WTBA 1ZA2B 2MXYA 2FJDB 1KLMB 3VAIA 2JDJA 4DR1J 3DDKA 3I0SB 2AD9A 4LFCJ 3KKFA 3KDNA 2GCFA 3DRSB 5F41A 3SFGA 3BYRA 4K4SA 3V6DB 2OPQA 3CD5A 6FDRA 1PYSB 1X4BA 5H9FJ 3QLHB 1K44A 1D3WA 5DM7Q 5KG2A 2DNZA 1X4HA 2ACMA 1N54B 1WI6A 3RBEA 5HSPA 2ZNZA 3PDNA 1N32J 4NLQA 4ED6A 4KKOA 1DZ5A 3HX9A 2MKYA 2Y0SD 2VG5B 5L8RC 4RBUA 2P6SA 1R89A 2AT1B 4W92B 3THPA 3N0VA 1UPPA 1I1GA 1X9WA 2BX6A 2FZGB 2FTRA 1DY3A 1CJKA 3MD1A 3DLBA 1TP7A 3DRRA 5IWAF 2J0XA 2W2NP 4OI4A 3SDEB 3M7VA 3US5A 3G6YA 3LP1B 3GYNA 3SCIE 1UA1A 1UJ4A 4MFBB 1TL7A 5CAAA 2L9DA 1R8CA 3PRBA 2A2CA 1EETB 4GKJF 4RX6A 3BPSP 2ZDOA 2HMIA 2CPDA 1CJTA 4YHHF 3OLBA 5EUHA 1S5ZA 2L9WA 4QIGA 3GCXP 4CO5A 2AEMA 1J5OB 2IFXA 1CQNA 1HMVA 1S6PB 3PO5A 2UV8A 1LWCB 2HS4A 1GTHA 2ZBQA 4M94A 4A46A 5A0YA 4DPTA 2Y9HA 1QVGR 3FEXB 3R5GA 2V67A 3E3XA 3DXBA 1N34F 1IBMF 2R8GA 2YH1A 1M5OC 2WB4A 1CJVB 4B3TJ 4UY85 4DV2J 4DFPA 2PSZA 2HNZB 5CYMA 5AXLA 1X5OA 4CH1A 2HBRB 3KUHA 3W2WA 3RAQA 1LOUA 1XR5A 1SC1B 2YKQA 3QSIA 2ZJRQ 2E44A 3HVTB 2QFJA 3RW6A 4AD6A 4NLTA 4DPXA 2Z2MA 3WX4A 1YBAA 2ZDPA 2Z2ZA 2KM8C 5C42B 1MN7A 4DQRA 3C2PA 4OYOA 1Z2ZA 3QQCD 4K4WA 1YHQS 1LW2A 3GE9A 1U1KA 2K7JA 2AW0A 1VQKS 1N0UA 1U1PA 3CW2C 2X51A 4R5PB 2P9GA 4GRSA 2PMWA 1TK8A 3KOAA 4L74A 4DR4J 5FLXU 1K73T 1TKTA 4EI2A 8AT1B 3G4SS 3EE3A 1VOMA 3SZ2A 3TOQA 2YTCA 1A7GE 1IQTA 4WFNQ 4ECTA 1OY8A 4Q2MA 4M5IA 4CP5A 4PQAA 2J8AA 1GAOA 3UDVA 1BQNA 2ROPA 4FBUA 3GIRA 1W7WA 3W63A 4JV2A 3PYEA 4FXWA 4YR0A 1UA0A 4A8XA 1WTFA 3GFHA 4J9PA 4I1TA 2V8DA 5DDOC 4O44B 5JJBA 2ZUGA 2HW3A 2CPZA 1HD1A 5JVHQ 4IG0A 4LF9J 3IA0A 1N6QB 2QMWA 3DOLB 2DNKA 1JLEB 2P5VA 4PEOA 1EARA 2AYMA 1FERA 3M2RA 3ZZZA 1KHWA 2KJWA 1LWFB 4IH7A 1SJ4P 3T5LA 2J9EA 4ELUA 4Q7AA 3PIOQ 3EGWB 4LRAA 3HVRA 3N6LA 1RI7A 2IPOB 1H2TZ 3NKYA 1XTZA 2ZM6J 4CIOA 2BM0A 3WIUA 1VDHA 5J2PA 2J76E 3KUGA 1W2BR 3CJ5A 4PCQA 3SSRA 3T6BA 4X4OA 1UAWA 3QFWA 2RU3A 2XY6A 3QBCA 3MR2A 1YLXA 2VJVA 2RT3A 1S9GA 2D9PA 3LTOA 1MWYA 4M5MA 3MR3A 2Z8QA 1S6OA 2LU1A 1FESA 3RRHA 3CMAS 1HWLA 2OFGX 3QGHA 4OI6A 2IMWP 1G3OA 3QWPA 1JLQB 5IV3A 3D3CJ 3MDFA 4ERDA 2HK2A 3QSYB 2N7CA 4CT9A 2L48A 3HZGA 1F2HA 2A10A 3F73A 2D41A 2BE2A 1FRHA 2ZZNA 2V2ZA 4Q43A 1PO6A 1FRJA 3NS7B 3UCGA 1TUWA 1Q5YA 3HD2A 3VVTA 5I3UB 4JI1F 1FEHA 1FNOA 2V63A 5C5JA 3SBMA 1SI9A 2KFYA 2J9DA 4DR3F 4X64F 3L7PA 1DJ0A 1RGVA 4A4JA 4EYHB 1HQEB 1RYSA 1X0FA 5LXYA 1T95A 1CVJA 1PCAA 2KTQA 2HIYA 2L9NA 5CYQB 4AXIA 1H6KX 4C11A 3A3PB 1HBUA 3ZNJ1 1UEVA 2HQIA 2H48B 2GHPA 2XNRA 4R25A 4DBQA 3KMSA 2XY7A 2G2ZA 4YUDA 3OVSA 2B9XA 5DG9A 3UW1A 4OI2A 1O51A 4C0OC 1IKVB 5AXMA 2NREA 3NGUA 5LMUF 2VA2A 5F8HA 1LXNA 4FYDA 1FFWB 1T05B 3D9BA 5B0CA 3QATA 5GAGI 3I56S 1EP4A 3AB2B 5DDRC 4ZMMA 1X4CA 1VC5A 3G86A 2D1CA 4I0WA 3CJRA 3OW2R 1DQAA 4Q44A 1R31A 1RTIB 4WTOB 3U02A 3IS9A 5KAKA 1AUSL 2W2OP 4P2MA 3GJTB 2AU0A 3HK2A 3C6UB 3M32B 3HHLD 4LR8A 3OR2A 1N5QA 3W9HA 1J27A 2BKNA 3TI0A 2HVIA 2FZKB 2X3GA 1HA1A 1J2VA 3FEZA 1VLOA 2FQQB 3F41A 5K8NA 1MROB 2AQ4A 4H4MA 1ZZNA 3RBXA 1MNEA 2HHWA 1U2FA 1UVJA 2GHWA 2C2RA 2VPYB 3CPWR 2XQCA 4C8KA 1O6XA 1IKXB 4UZCA 2DT9A 2W1BA 1S4FA 4NYOA 5B09A 3G6XA 2OI2A 3AODA 2M5YA 1EKSA 2HLTA 4CO3A 5IS2A 5F9NA 1XWLA 5ITHA 3MUTP 1VFJA 3IO1A 2KO1A 1S9EB 2CA9A 5D4PA 4OL8A 5DM6Q 2AYBA 4DFKA 3LWMA 2DD8S 3EXYA 3JAMU 4JI0F 4FS1A 2VFSA 3ZTQA 2FJVA 1S12A 1RU1A 2JL9A 2YNFB 2FY8A 2BE7D 7FDRA 1NDCA 4X4VA 3EVOA 2G13A 4X4TA 2KG0A 5ETOA 1CS4B 1D9AA 1TFYA 2LQ9A 2HNYA 1FJGJ 3Q8QB 2V6AA 3C14B 3E8OA 5F9LA 3H2UB 3OL7A 2CPEA 4J9SA 2ROGA 2B4PA 2VQEF 3BH7B 4OZLA 2AJFE 5K14B 4CLLA 5F3TA 4LFAJ 3BO3A 2BA9A 4P2FA 2B43A 2DH9A 1U09A 2BJ3A 3K8VA 4TY9A 2HSEB 3M6XA 4USKA 1F9HA 5DZ7A 3TVZA 1S1VB 3UCUP 5KT7A 1S72S 4LF5F 3ZTPA 1NCLA 2W7OA 1B64A 3PRVA 4OYBA 1Q16B 1RT5B 5EWFA 1HHQA 2IDLA 2MPUA 4J9VA 3TP2A 1Q78A 4Y28C 4RNNA 4ED5A 4KV8A 3SSSA 1OPIA 2RE1A 5LT5A 1FWKA 1H7XA 4YEAA 2B9WA 3DI6B 1PIEA 1N5TA 1ZTWA 4UOHA 3QZ8A 4LF8F 1S0MA 1SQEA 4J37A 4DR5F 1G2EA 2BEFA 5HMYA 1GFWB 1HBNA 3PEJA 4DCOB 3IR6B 3PZPA 4OX6A 1IJEB 1WF0A 3M2VA 3QWUA 3NNCA 2EFPA 2BANB 1TELA 4TLQA 2V34A 1SQFA 4O3NA 4ECWA 2EK6A 4PABA 3ZTSA 2DB1A 3I9V9 4RNMA 4ZLLA 4DI6A 2C3MA 5KTQA 4B9TA 1E6VB 2D3OR 3FKBA 2CQIA 2BQ3A 1QM9A 5I3PA 2ZH2A 1QAIA 1CG2A 2K1RA 4DSKA 4WFZA 4NYZA 3I82A 1S99A 2E9ZA 4NXMF 1H2VZ 4DUTA 2GGPA 4RU2A 4FVCA 4YB6A 5GADI 2RSQA 4UOCA 1BLUA 4S0MA 1FE0A 1VQOS 2R2SA 4JI4J 4K2XA 2UXDF 2QA2A 1L3TA 3Q86A 3A12A 1OYEA 3M8PA 4N77A 4I69A 2BRKA 4DR6J 4MH8A 3K5PA 4PXEA 4ILRA 2FY1A 4MKVA 4U6PA 2CQ2A 3HHLB 4YOEA 1HNWJ 1T94A 1WUUA 3W7BA 2FIUA 4AFFA 3K59A 4PWDB 3R5DA 2VIHA 1W26A 3ZTOA 3OPKA 1K0TA 1XK8A 5DQHA 4FZVA 1S1XA 5HK4A 4B3SJ 3ILOA 5KFYA 5B0EA 3NCRA 2KXFA 5J1EB 2CPJA 2MGZA 2HRUA 4QIVA 4MK7A 5ETRA 1XEZA 2GZOA 2DO4A 3HHEA 4CLYA 4UZBA 1M5SA 2RHQB 4M5KA 4ED1A 1GEHA 3QRPA 5F0UA 4O3QA 3SCLE 2KXNB 5IQQA 2LU2A 1F5BA 4RW7B 4NXNJ 3LP0B 1SKWA 3MCSA 2LQBA 4DCPB 3FBBA 5C24A 4IRCA 2LEPA 3NGKA 3D3BJ 4ALZA 2PEBA 3U7JA 3W62A 4DSIA 4YY3F 2ALZA 3PY8A 2DNYA 2LXFA 1TVRB 4OYPA 3BSOA 3LGMA 3KLIB 2NCKL 3B6BA 1FA0A 2XO6A 3IRXA 4ELVA 3P49B 3K17A 3G82A 2Z0GA 1RHUB 3VGTA 1WHVA 2DR6A 3HKWA 1FWPA 2HBZB 2K3IA 1JXEA 4K0KJ 2UUBF 5E5NA 1FDDA 4IFVB 2E5LF 3AQPA 2HFSA 2I8EA 4F0KA 2CIMA 3KK2A 1RLCL 1BWEA 1VLYA 5G0RB 4DLEA 2HVZA 1RHQB 3OR1A 4DS5A 3CMQA 4DQSA 1KNZA 3GSDA 3D0GE 3IXQA 1TQLA 3FMBA 2DXEA 1JJHA 3DOMA 3G8SA 1RAOA 4I67A 4HT5A 3CJKA 1RXOB 4OQJA 1HPZA 1HI1A 3HKZD 2HIQA 4N76A 4HKQA 1SB6A 1M5HA 1XMOJ 4OZNA 4OV1A 5D6GA 2VODA 2DCUB 3K57A 1NM2A 1C0TA 5F8LA 3OFGA 4B08A 4OV6A 3TAPA 4HI2A 4Y2CA 3VGUA 3KLEB 2HQ3A 5A6PA 1XIQA 4QJVA 4F4AA 2QJ3A 4QYZJ 2WW8A 1SV5B 2FGOA 4IFYA 4ECRA 2B51A 5CCLA 1T03B 2CNLB 1DHMA 3AA9A 1AZSA 4OZ1A 2RH3A 2EFNA 4I6WA 4KH0B 4JBCA 5J2QA 3A1YG 2B3TB 3CDBA 3NS5A 4G1PA 3CCUS 2AEJA 3MPWA 2MZSA 4G1QA 2MKSA 1CJTB 2DNRA 4TU7A 5H9EK 3EGZA 2PC6A 3A3NB 5CH7B 4ZPBA 4OIXA 3J80Y 1U02A 1IQZA 3BSCA 4F2SA 1SCJB 4ZCIA 3VVUA 1N4LA 3HDSA 2DXFA 1J5EJ 3P96A 3EUNA 3FZBA 2POKA 4B3RJ 2A2DA 1EHWA 2F1FA 2RNEA 4PWWA 1VI7A 3J7YI 5HP1A 4WKYA 4Q0BB 5IM0B 3CUNA 4I7FB 2RF2B 2MQPA 1G4CA 1HHTP 4LF7F 1S7HA 3DMJB 1WC4A 3TAMA 3SV4A 2AMCB 2XLJA 3KG0A 1Z1ZA 5L39A 3MOZA 1IM4A 4H4OB 2VQFF 2EBEA 3GIIA 3RAXA 3W1YC 1HLWA 4ED2A 2EC2A 4BC7A 2BW2A 1DLOB 3CCZA 4JI2F 3ULHA 1I94F 4FP9A 2IDEA 1F9FA 1UW9A 5K20B 2HGLA 4J90A 3WZ0A 3OQ2A 1JLAA 2HWHA 5EWGA 4ZDNA 3EZ5A 3DC2A 3QRQA 3VTIA 4ILMA 3IAM9 5CHCB 3BREA 1CBKA 3KNGA 2MMYA 2ROEA 1NUEA 1BGXT 1FK9A 1WJ9A 1ZETA 4ZPVR 2E1RA 2EFQA 2FLNA 4DOZA 2VBXA 3MOJB 4X4NA 3KLGA 2DGUA 3MGJA 1TL3B 3K2YA 4KHPF 1T02A 2L41A 3VZIA 5ETSA 3L7OA 1I5OB 4GKKJ 4CT8A 1JLCB 3H8YA 2V2QA 4NA2A 4K50A 4GC6A 2GFFA 2ZE2A 1IM6A 4A8SA 3MMBA 1WOSA 5HANA 3ZZUA 2QMUB 5B08A 5MAOA 1UFWA 4F50A 3NY0A 4ZVPB 1VQ6S 2DJWA 2YWEA 4PRFA 1FD8A 1KD1T 1P9QC 4QR2A 2NYHA 3AOBA 4O3RA 1HNZF 1LQ9A 4RW6A 3H5SA 2GS8A 2YX7A 4P75A 1V9OA 2VD3A 3D1HA 1RKJA 3C16A 2R7WA 1X9MA 1UVNA 2DPJA 4DXLA 3HSJA 2W8KA 3D6HB 5MLCV 3GV8B 2RHSB 2W25A 4TKTA 1VBZA 4FPIA 1RCXB 5E3PA 1D0EA 4L72B 3BZQA 4EZ6A 2XMMA 4F4YA 3I5BA 3R2CJ 1KS2A 4UOGA 5IZHA 4WBFA 1X4GA 4UOFA 2UUAF 1UMJA 1NH7A 4I2QA 4N5SA 2XB2D 2ZZTA 3C15A 2H3EB 2E5HA 4NEZA 1HARA 3X1LB 3PIPQ 2LQJA 4FF3A 1XR6A 3IC1A 1TV6A 1RTHA 1TKDA 4KFBA 3MMJA 3UR3C 2KHCA 1RWKB 5BXIA 3T1YJ 2ZBRA 1U2CA 5HVHA 2CPIA 1PC4A 2MKJA 4ZJOA 1HR0F 2CPFA 2G1HA 2GJ2A 3C8YA 3M9OB 2MJUA 1T8EA 1RT7A 1IBKF 3VF0B 1WG5A 3FRYA 1HL6A 5EHHA 5D0GA 1N5SA 3EPGA 4U7CA 3KWMA 1ZM9A 2MQOA 2G0IA 3SCJE 1FRKA 1RT1A 2BOPA 2NSCA 2GV1A 4BCAA 2J6UA 1FDBA 2CWXA 1M90T 1RT2B 1UJ6A 1D1UA 4OX8A 4RW4B 3E01B 2OLWA 1TUGB 1WKLA 3QO9B 3LA0A 1U1MA 2WHOA 3MM9B 2Y8YA 4AUKA 4F4ZA 1SC6A 2ATLA 2XWYA 2CJ9A 1YGYA 2DGQA 4QCLA 4IUFA 9ATCB 4CNYA 4NCGB 3GTYX 2VBZA 3R9LA 3JTNA 3IAS9 4JB8B 4ER8A 1WG4A 4OX7A 1SH0A 2EFOA 2O3DA 3L09A 5HQ8A 1HBMA 3OR2B 3IFEA 2HRTA 1RABB 5KFEA 4LQ9A 4CLPA 3M8QA 2KZMA 3KG1A 4FF1A 2UXCJ 2R7XA 3GONA 1VR6A 2VFTA 2ZKTA 2QYCA 1QLNA 1YZ7A 1GMWD 2EW9A 5DDPC 1WC1A 2EK1A 3V6JA 2K3KA 1HW8A 4XO0A 1KLMA 1VRQC 3DRPB 4DHVA 1G1XA 3DRSA 2BJ9A 2P8IA 4JI3J 3M8YA 3V6DA 2I5JB 2Q66A 3LPYA 3QLHA 5CXTA 1SXLA 4Z2XA 3QMQA 2HPUA 1E6YB 2X1FA 3WC0A 1JLGB 4CO2A 4NLRA 1OJ4A 2NXCA 4K4UA 2CZ9A 2JEFA 2XGPA 4ETXA 1SJFA 2GW8A 2DHGA 5A2QY 4NZ7A 1YBUA 1SIZA 2VG5A 1RAAB 1V3ZA 2CJKA 4RNOA 4ANEA 4WFYA 4DLGA 4AT1B 3D28A 3OJUA 1D09B 1C4CA 2HNYB 3O3LA 3FSYA 1IUJA 3SDEA 2ZBPA 3FBCA 1S0VA 3BKFA 3DLEB 1PJ5A 4IH5A 2O01C 4XDCA 5BJRA 1FKOB 2JJ4D 3LP1A 2B7BB 4OX9F 3H98A 4MFBA 3V4MA 2YPZA 1EETA 5IQ6A 1KVKA 2HURA 1HHSA 3IGVA 3PJXA 5KG5A 2HS0A 2VPZB 2R8IA 1KONA 5DJBA 2VG6B 2KRRA 1JWWA 2DRDA 3EZUA 3TUJC 2AGOA 3GYGA 4P74A 2VDHA 2DY1A 1VYAA 1J5OA 3OHAA 1RHMB 4YHHJ 1S6PA 2OUGA 4JI5J 2MYFA 3J7ZT 5KFGA 3CD6S 4J9KA 4W90B 1LWCA 2OO4A 1RT4B 4QWCA 1JLFA 1LXJA 2Q79A 2XNQA 1YJTA 2IJRA 3GCWP 2UVVA 3PHEA 4QWAA 1DRZA 1RDRA 2QLJB 3V6HA 4DV7J 2PFFB 3B4MA 2IA6A 3DHXA 4PG8A 2YQ1A 3R27A 5LJ5Y 4WKRA 1CJVA 2V94A 3IM9A 2DR9A 5HVGA 1FCAA 4KY3A 2HNZA 1VRUB 4LFBJ 4ED0A 2ZBCA 1NJIT 1JJ2R 1FKAF 4A8FA 2HBQB 3M2VB 4QYRA 1RP5A 3ILIA 1YRUA 4RW9B 3HVTA 3LQVA 1XC9A 4ZVSB 1H73A 2N7YA 4DR7F 1YJNS 2HG4A 3QJPA 2QSWA 3LO3A 5KOXA 3R1LA 3PYFA 2LECA 5EX3A 1HYSA 2XI2A 3TR5A 3SQOP 4CCHA 1I51B 1MW7A 5KFCA 2GGPB 2OP5A 1NJYA 5HJXA 4G65A 2HFNA 1FRMA 3TQ1A 4R5PA 3HFZB 4KO0B 2ZEJA 4WXWA 2V50A 1FTCA 4X65F 3CVKA 3D6TB 1WELA 3E51A 4BS2A 2FLLA 1Q4RA 1BUXA 1S7IA 4URSA 2E1MC 2GMHA 3QT8A 1YRXA 5I4MA 1RBAA 3KHHA 3OFEA 4OJ1A 3NMAA 4KPCA 4Y6IA 5LSLA 3BM7A 5ADZA 5KFSA 1U48A 2J7KA 1WHWA 3N6NA 2XLKA 1KBRA 4JI6J 2PT0A 1VGYA 2E1PA 5EDWA 1QAYA 5KG3A 3NG8A 1U47A 2WVFA 1KRPA 2KXHA 1JX4A 2ZD1A 1FE4A 2VFUA 1N6QA 3MM5B 1JLEA 3PW2A 1AFIA 2DHXA 4Z37A 2CKWA 5HO4A 1LWFA 2YPYA 4K5SA 3MUVP 4OLPA 3KYLA 2ZKUA 2CWKA 3FFIB 2OFHX 2QV6A 4HH1A 1U24A 5SZTA 5LMNJ 5ETTA 4F4XA 5EGYA 5BR8F 1ROFA 1WEYA 1KHVA 3M30B 4H4KA 4C3KA 1U8WA 3BQ1A 1HWKA 3R7SB 1S97A 1NK9A 2Z2LA 5C24B 3D6MB 3UE2A 3HPOA 2RQ4A 1KEKA 5E7OB 3M4XA 2XMWA 3LANA 5GMEA 2IC3B 4GVLA 2MLXA 2DPIA 4NLYA 3JSRA 3R7NB 1H98A 1C0UB 1GMUA 4FNHA 1NB7A 2HZAA 3TARA 3U1LA 2XS7A 2ZHBA 1W2IA 1Y3JA 3O2IA 2F8HA 3AHPA 1JLQA 1QD1A 1RISA 3KK3A 3C3LA 4DR1F 2HFZA 2I38A 4LFCF 3BQ0A 3LUYA 3AH6A 2AX0A 5JVGQ 1AUDA 2YVSA 5I3UA 3HF5A 5KFAA 4E98A 1OY6A 4X4SA 2WAQD 3UDCA 2QL5B 4EEYA 4O3OA 3HLUA 5SUHA 1FKPB 3HFVA 3L95X 1HQEA 2MHNA 1FDNA 1N32F 3IGNA 3JQKA 3JTPA 4NA3A 5CYQA 4X64J 2EFGA 4USIA 2YNIB 4WJBA 1RLDA 4F2RA 3PW5A 1U6ZA 2F40A 1WI8A 2B9EA 4IFYB 3DCAA 5LJ3Y 3ET6A 1IKVA 3AB4B 3MPDA 2HYIB 3NNHA 5E33A 3KJNB 5E2QA 2YNGB 2HNDA 1M1HA 3BGOP 4IH6A 1X7VA 1U4BA 2MZRA 2HVHA 1H72C 1URNA 2KVQE 1T05A 3TA1A 4C6AA 2G1DA 2GAGC 2XCPA 4NLXA 1B70B 1FF2A 3P3DA 4F7VA 4DV4J 4YS2A 4GVBB 1RCOB 4EMDA 1T9WA 2VFRA 2M3DA 1NPRA 3EDRB 1RTIA 1NJXA 1S48A 3MTKA 5KFZA 3H4DA 4U8VA 4F25A 2NUHA 3C6UA 3M32A 3K5LA 2ALYB 1B4SA 3N79A 3QGIA 2YWFA 1Q8LA 2XMTA 3PRDA 1YJ7A 2ZH4A 3MR7A 4ZP9A 1TK0A 2APOA 2NPIA 2B56A 1RHRB 4B3TF 2CAJA 2GNKA 4KT0C 2DNOA 5A8RB 3UFCX 4DV2F 5KFTA 3Q8RB 2L08A 1BC6A 1IKXA 3MURP 1FVQA 4J5OA 5KFUA 2R7OA 3TQEA 2LMIA 1UVLA 4LSLB 4LJMA 4B9MA 2GVDB 4WFXA 1CC7A 2C1EB 1EAYC 3RBZA 2K06A 2JLGA 2NS1B 2GIFA 2R8JA 2JEIA 1L3SA 4OZ5A 2VPXB 3BYPA 2CQ1A 2BJ7A 4TYBA 2V8HA 2XS2A 2HHHJ 3AJ1A 4MK9A 3O8WA 1RKIA 2VZ9A 3QJLA 4QPTA 3GIJA 5GAEI 2YNFA 2R7QA 4JI0J 3POTB 2B8PA 3NRBA 4UT4A 4DR4F 2V2VA 2LFVA 3NLCA 5DG8A 1QY7A 1NH8A 1VK8A 1XNQJ 3SV3A 4DV5F 1FK9B 3HSDA 2B4VA 1JKHB 4U96A 3WC2A 4C48A 2JEJA 4NEYA 4DX6A 1UFKA 4ID5B 5D0HA 2GVZB 3OTOJ 5K14A 4RUHA 2BW7A 3MCMA 3DLGB 5DDQC 2VQEJ 2UXBJ 4PQUB 2PEHA 4K4XA 4CM2A 4USUA 2MKKA 2D9OA 2W9BB 1FD2A 2MZTA 2NZCA 1KWMA 2MSTA 4LF9F 6FD1A 3NWGA 1N36J 5E0OA 3W61A 2K8GA 5KG1A 2R3VA 2ATCB 3UN2A 4GC7A 1RT5A 3K5MA 1R0AB 3W8PA 1V3SA 1RT6B 3WQPA 4ZPTR 4UTGA 1Q81T 2DXDA 2R7UA 1MU2B 3DI6A 4MYTA 2FUG9 1AA1B 2JWNA 1U1LA 3KLFB 2VFVA 1KQFB 4RW6B 3FQLA 2W4PA 3M6WA 3S01A 5M2UA 3AXMA 4O3SA 4U9RA 2EFVA 2UUTA 1IKYB 2IM3A 1TK5A 4LF8J 1MWZA 1MN9A 4J9NA 1N5YA 3OTEA 2CQBA 3BF4A 4NLPA 1JNZB 1LV5A 2OELA 1VJQA 4NLWA 4UY8T 4QW9A 5IC6B 1NK0A 3MPYA 3CE8A 5J2MB 1OQ3A 3CCTA 1Q86T 1GX6A 2ZH7A 1SJ3P 4AL5A 5ETLA 5KFRA 1TR0A 1SPBP 2B6AB 1N48A 3NEKA 1MMLA 4I2QB 2DEJA 4CTAA 3I6PA 3RRKA 3PR5B 3MEDA 3ZFVA 3EJMA 1GXLA 3CDEA 4LSNB 4X84A 1YZ6A 3A8IA 1LW0B 1RTHB 2CG8A 2ZJQQ 5JMNA 1DQ9A 4C0HA 2V0NA 4WU2A 3CD0A 4R0JA 2PN6A 2HQGA 2DR8A 2F5GA 3CF5Q 3TNVA 3Q8VA 2DH8A 4LT6A 1RT7B 2CNOB 2CPHA 1K8AT 1NB2A 2FVSA 3HHLA 1EX8A 2YKMA 1S1TB 2R2UA 1QE1B 5DQGA 3PG9A 4A47A 4DDFA 4PWDA 3JSYA 3P5BP 1MG7A 3MPUB 3P4UB 4DV0F 4F0HA 2DGOA 1AYEA 4RNHA 4P2SA 2CNKB 4IKAA 1YG0A 2HWIA 5J1EA 2E5GA 1K1QA 1N88A 4NPOA 4I2PB 2R7RA 3AAWB 2IVFB 2HEKA 4KBIA 2DISA 4EO8A 2GQ2A 1IBCB 5F3ZA 4ZCLA 3NGDA 4NRUA 4B9VA 4WYWA 3Q23A 3EYZA 1NHKL 4ED8A 1YJUA 1NKCA 4RW7A 4OFZA 3LP0A 2BKPA 1NO8A 2N3LA 5IT9Y 4I4BA 3THVA 1Q82T 2BACA 2MQNA 4U8YA 2WVCA 1V3RA 4ANDA 2OJ3A 4LF6J 4FDFA 3NBPB 4LR9A 1TVRA 9RUBA 3KLIA 1VBXA 4A8YA 1F2GA 2HGMA 2GJFA 1XN9A 3CEDA 3DU5A 4ZP6A 1RAFB 4X66J 3QYYA 3RG6A 1KTQA 4IFVA 3B4DA 4IO1A 2JHEA 3DGPB 2KKHA 2GO8A 2J0WA 1YJWS 2A6MA 4ZVHA 4J9QA 2KU7A 4BDPA 5G0RA 4QPXA 3K0JA 2L3MA 2Y3YA 1QJHA 5B0DA 4DUZF 1CPZA 5KFKA 4NRTA 1CJUB 1QUVA 2GQQA 1Q8KA 3BN7A 5ETNA 4UQGA 4ZK7M 3HFKA 2A1BA 2WONB 3V6KA 2C2EA 2HLUA 2D3O1 2ZH9A 1BQMB 2IRYA 3W9JA 1R8AA 2UP1A 2YWWA 3LOUA 2RB7A 2J5AA 1QDUB 5I42B 1U7LA 1LEOA 3KLEA 2MB0B 4ZKAA 1VJWA 1QSSA 2ASDA 2RU9A 4EFAC 5KG6A 2ZWPA 2GHVC 2F4FA 2E5JA 2WVBA 4NLGA 1RACB 1RBLA 5KT3A 1SV5A 4IG3B 2CDQA 3DNCA 3S8SA 1HW9A 5KT6A 5CA5A 1T03A 2HHSA 1Y10A 1QTMA 1AXQA 2FJXA 5ETVA 4ZJQA 3ZZ0A 4AE5A 4KB7A 1FJGF 3QIDA 1IR0A 2KT3A 1EQMA 3OV7A 3MM6B 2QSFA 2KI2A 1T9UA 3EM1A 1RSCA 3LP2B 4DL6A 2ACYA 1WSVA 1F3FA 3OUYB 4TLRA 4LFAF 5L9XA 3T5HA 4AQYJ 2C2OB 3V81A 1NHVA 1PBAA 1GMVA 3MMCB 4G6VB 1R8HA 3MECB 8RUCA 1UCNA 2CQ3A 5E41A 1NEEA 4FYVB 2A0FB 2XZDB 1R3NA 1HWIA 5HL7Q 4RUCA 4R8UB 2XYHB 3EZOA 3AD7C 3GZ7A 3B82A 2DKOB 1JLFB 2YNHA 2C22A 3BR8A 3MEEB 2CXEA 4IR9A 2G0JA 4C2MA 2NPFA 1PJ6A 2GO9A 3KK1B 4Y2KA 5L1LA 3W8GA 5F8IA 3B78A 3EGVA 1FI4A 3DM2B 3LWLA 1LFWA 1HNIA 1UEKA 3IN5A 4Q0BA 5IM0A 3PVXA 4I7FA 2RF2A 4BWMA 2OPRB 4BHQA 2AYGA 4DV1J 1PAUB 1RWNB 2KFZA 3DMJA 3J81U 4MIAA 4ZA1A 5IOLA 2MZJA 1K9MT 4FYWB 3T19A 1KC8T 4H4OA 5A76A 1T9YA 4AYBD 3W60A 2AJ4A 2QE5A 4IOCQ 3EWGA 4WF9Q 4ILLA 3D7SB 1Q95G 5L9NA 3RB4A 2XWXA 2FVPA 1UWAA 3PACA 3MR6A 2HVEA 1BY9A 2C2KB 2IM1A 3OSPA 4ES1A 3KHLA 1HYSB 1DLOA 4KIAA 1KDNA 1NSPA 2FJAB 3MAAB 3D2WA 2KB2A 2JLFA 3SEOA 4YDXA 1AB8A 4HLBA 3VAFA 3CMES 4Y2AA 2ZVIA 2V8VA 2ZFHA 4N47A 2DRAA 4OZ0A 2RILA 3M05A 1REVA 2M0GB 3CIZA 2FHMA 3BV8A 2SXLA 4JI4F 3H42A 4DQQA 4B17A 1SBRA 3VCDA 4GO5X 1CQMA 5FDLB 2GC8A 1VQMS 3QGGA 1Y00A 2JOQA 2GQCA 4USHA 4LVNP 4DR6F 1P8GA 3PKMA 5GMDA 1UTAA 1OYDA 2K2PA 1NLKL 3OTBA 1H74A 3CO0P 5KFBA 1HNWF 4JI8J 1GXUA 1TL3A 2ZD1B 3PCOB 2DK2A 3W5ZA 4CLTA 1RTJB 1FRLA 2OSQA 1JLCA 4B3SF 2I1RA 4MIBA 1WC0A 4NI2B 4URQU 2VOPA 4C4WA 4U67Q 2DR7A 3G71S 2PA3A 5D15A 2VL1A 2FHJA 4CZCA 4M95A 4ZVQB 3PJWA 2F4VJ 3MEKA 1Y5NB 2GA7A 4HEA9 4USWA 4ZLPA 4K2JA 1N56A 1Q7YT 1TAUA 5DO2A 2KM8B 1SQGA 2F9JA 2YX1A 4Y34A 5B0FA 4CWBA 3QIPA 4NXNF 2OPSB 4BC9A 3IWXA 1P9YA 4DQIA 4NMXA 3N5BA 2VB6A 4QW8A 2AEFA 4CYUB 1VHFA 3CCSS 3FMWA 3VHQA 4B3OB 2MQQA 2CNNB 2D7SA 1R6YA 2M2BA 2EKYA 2QEXS 3H90A 5KFFA 1T9VA 2B4UA 4EBDA 2Q1LA 5FLXY 4ITSA 2VDIA 5L1KA 2OSRA 3V2UC 1Q1KA 3UN3A 4K8RA 3SIPB 1RZMA 2GJIA 4K0KF 2BRLA 1SC4B 3KK3B 2H51B 4C3LA 4EGLA 2MHEA 3BBBA 3FJ2A 4WYLA 3HHNB 3WBZA 3RW7A 4CLWA 2PD1A 4TVAB 4HR2A 5M2PA 1N5VA 5D4NA 2QLFB 2JSXA 3MD3A 4LSZB 4ETZA 4C8LA 2RS2A 2IBKA 1M1GA 1WG1A 4WFAQ 2AJ1A 1OIAA 2F65A 4CO1A 2VASA 4H54A 4XTTA 1FNMA 3EPIA 1XMOF 3SQGB 3MPVA 3KLHB 3FCHA 3KJVA 4LF4J 3H0PA 3H4BA 4F3OA 1HR0J 3CSKA 3JXOA 2DEIA 4AL6A 2ERRA 4RU9A 4DZ6A 2YH0A 2I9SA 3MF5A 2D69A 3GYXB 1T9TA 4YB1P 3CCLS 3ETOA 5J1NA 4GMKA 1T3NA 4KHMA 4C9DA 4OHZA 2ZH5A 4KGXB 2W2PP 3VAHA 2HHXA 4ZP7A 3IBWA 3ET6B 3CCVS 2UU9J 1RT2A 2V2KA 4DN9A 1CC8A 2EBGA 4OZ3A 3GFXA 2OKQA 4E0DA 1PYOB 3IBFB 4RW4A 3UCZP 2HNDB 3E01A 3CCQS 3P45B 1RAHB 3QO9A 2RMLA 3BO4A 3MM9A 5K8MA 4ZS6A 5E3RA 4LRCA 4F67A 1Y0HA 4C8OA 2R2RA 2QG9B 1B0VA 2ASYA 3R1HA 4HH0A 2AJQA 3RB6A 3PYGA 2B9YA 1Q53A 4NCGA 4U7UK 1PG5B 4YQWA 4TN2A 2PMZD 4K4YA 4FKXA 2MJNA 4TNOA 2MQMA 1X4FA 1SUQB 4IDKB 5D8HB 3FRZA 1J5EF 3ZTRA 4TXSA 2XHCA 5M2RA 1UW4A 4B3RF 2JH3A 2ZWOA 5H9EJ 4URGA 1KQGB 3M1VB 2BE9B 4FNIA 3O44A 4WZMA 2CVIA 1R8BA 3DRPA 4DZDA 1RWUA 4CM0A 4L3KA 2PDAA 4HTIA 1AROP 2I5JA 2Y1RI 4E2FB 1VHIA 2OMLA 1H3DA 1E6YA 2P2CB 3O5TB 2FLOA 1AW0A 1JLGA 4LMZA 2XMJA 1NK8A 1Y7PA 3CCJS 2AWZA 3QAUA 5D4OA 3AA8A 2R7SA 1S0OA 1NMEB 2OAUA 3HCXA 3GJSB 3F0NA 5T41A 2FGCA 3CJ4A 3S7RA 2CYYA 4IR1A 2UUWA 5HN0A 1L3UA 3MM8B 3GSIA 4ICLB 4EWTA 4OHXA 4YB5A 2B5JB 2DGTA 3LAKA 2RQKA 2RD5C 2XSJB 4Q45A 2DNHA 2MKIA 3DLEA 4C8NA 4RLEA 1FKOA 3MCOA 1YQHA 3A3OB 2ZH1A 1B3TA 5C2CA 4LBHA 1U1QA 1XMQF 2J7WA 1NDLA 5A8KB 4LRFA 8ATCB 1NZAA 1FEEA 1N0VC 2VG6A 4WPAA 4RNFA 4F3QA 2E7XA 4X4QA 4GKKF 1VC6A 3DOKB 4DU8A 1RBOB 4HHHA 1GK8A 4ECSA 1U45A 3VQTA 1RT4A 3ICLA 2ZH8A 1GT8A 2ASJA 1DFDA 4FS2A 4ZVFA 3PYDA 1FJEB 5DQIA 2R9LA 1U1NA 1ZPWX 1NJZA 2NXEA 3BN4A 1NSQA 3BDEA 2DRBA 2HZCA 2UUCJ 3RB0A 4PG7A 4PR6A 1N5YB 2P9EA 4C8YA 1N33J 4DN0A 3R97A 1GX5A 1VRUA 2BVZA 3VAKA 1ZAWA 3ZXWA 3PJ9A 3JAMY 3NGRA 4ED7A 4KRWA 2HHPA 3GR1A 2OEJA 4DUYJ 3G2XA 2GMJA 3W3SA 4RW9A 4EBCA 3VR1A 2KJVA 1TKXA 2O1PA 3LW5C 1BQXA 4IYQA 2W01A 2ZC3A 4BWJA 4CTAB 3MEDB 1B0TA 1RAJA 3FSXA 3X3UA 3MM7B 2ADBA 1UP1A 3OD2A 3QZ7A 4KO0A 2QC3A 3AQOA 4KPYA 2CJBA 3BKUA 3HVWA 3PX6A 1M5PC 3U1NA 3T1YF 2IMOA 2QL7B 1IXKA 3EGNA 3CCWA 2XM3A 2AIRB 3QT6A 1S49A 3GIMA 4O0IA 3GLJA 2RRAA 2QA1A 2QA4S 2QGFB 3QRRA 1HKAA 4KGMA 1C1BB 2YKMB 2LVWA 4ZVGA 5CZVA 4UQTA 2XTJP 4AL7A 2HAFA 2J8SA 2C2MB 3MM5A 5BYSA 4ATNA 4QBUA 4OJ3A 1GMWA 1WWHA 2XZTB 3CULA 2DGXA 1S4EA 4L75A 2QIFA 1NSKL 1X4DA 1X4EA 2BOAA 1JK9B 4PG4A 3FFIA 1B0PA 1A6LA 2HFVA 2JC1A 3HJFA 3ITHB 3RUBL 3MWBA 2W7PA 2NXNA 2A3JA 1V6HA 3R5BA 2C42A 1TTHB 2VOOA 2ASLA 2KT2A 5CQGA 1PJ7A 1JLBB 5L46A 4OI0A 4QU7A 3M30A 4LVOP 2JVOA 4ZPDA 5BR8J 1SKRA 3ISZA 1VCTA 4F02A 2V8PA 3HSGA 2LQ5A 1WF1A 1OSCA 3HMJG 2P9CA 2IRXA 5FD1A 3DLKB 1VQSA 2IHR1 3TO8A 2HQCA 2J6TA 3SI8A 2IC3A 4OI3A 4ECYA 4EZ9A 1UWBA 3T5JA 1YJVA 3HHKA 2RRBA 1F60B 3MHYA 3BQ2A 1C0UA 4DV6J 2W9CB 4PPZA 3WIVA 3BGRB 2R4FA 5D4LA 2UXCF 2VA3A 4ZJLA 4WP3A 1DARA 1KSPA 4WIQA 1MSWD 1B7YB 5C2GA 3GV5B 2OHDA 5KG4A 5J2NA 4FPRA 3I5CA 4M8LA 1K1SA 3CB4A 1RA6A 1HQ2A 5KT2A 2FHJD 3PX4A 4F3MA 1DTQB 4C0BA 1Y5LB 3PEHA 2DITA 4RO0A 4JI3F 2O66A 1V5VA 5FJ4A 4R0EA 5D77A 3HO1A 1REGX 3NS6A 1TKZB 3UO0A 3N9UC 1IKWB 2DR5A 4EO6A 1M5VC 1VIXA 1NKBA 1FKPA 3TZWA 1C1CB 3EICA 4KSEB 1SKUB 1QTNB 4QWDA 3RR8A 4M5DB 3P8BB 2MEWA 5HLFB 2YNIA 4DSFA 3S1TA 4RW8B 2C2NA 3LGHA 4UW2A 2AZ1A 4O4RA 4CLUA 2XSFA 3RR7A 2RUGA 2UV8G 3ZZOA 3CNQP 4DCJB 4DFJA 4OHWA 1DAXA 2YNGA 1IR2A 2CZ4A 3TYTA 2FHOB 4V19X 3DDIA 3W5YA 1UFLA 2LQ8A 3T1HJ 2WVEA 1VRTB 2XMUA 3JQMA 2WSCC 3AD9C 1XBWA 3V81B 3NNAA 3C6TB 4ZPCA 2F63A 4GVBA 3HT0A 1JQGA 3JSMB 3JYTB 2HWTA 2KG1A 4J9RA 3EMTA 1JXVA 5THWA 4ECUA 4JI5F 4U95A 1RTZA 2YNHB 2KL8A 2DGSA 1FXRA 4NLUA 4OZJA 1NPKA 2DVIA 1FVSA 1RADB 3HT3A 1CSJA 1HIYA 3BGLA 1VQ5S 3HULA 4P52A 2XS5A 1ZBTA 3MFIA 1S1UB 2FJBB 4L3NA 4DV7F 3MAQA 3OLAA 4KE5A 1HNIB 3NAIA 2IJFA 3ZZPA 1S79A 3CC4S 2PIIA 3IP0A 2U1AA 5A8RA 1RWMB 2YQ3A 1WDDA 1OWXA 4LFBF 4HTJA 2VV5A 2JLEA 4JV5J 3EVWA 1TL1A 1Y4ZB 4LSLA 2GVDA 3IR5B 4M5GA 1L5UA 3TUPA 4HVZA 1Q8IA 2CQ0A 4KYZA 3OXGA 4P72A 2Y1JA 2IJNA 2AJ2A 4DX8H 1X5PA 2B4OA 3KHRA 2QL9B 1LKZA 1U2RA 2AGPA 4KGZB 3GJRB 5AE2A 4YR3A 2XCAA 3NCPA 1WKKA 4H4KC 3POTA 3J81j 2ZZMA 1SVDA 1IBLJ 3T5KA 2VICA 1YITS 1P1LA 1D8YA 1NK4A 2DGVA 1REVB 1RTDB 1ELOA 1JKHA 1PGZA 4TU9A
chains in the Genus database with same CATH topology
4JI5J 2UU9J 4V1Ak 4DV6J 1J5EJ 4B3TJ 4JI1J 5A2QU 3D3BJ 5LMNJ 4DV2J 4DR6J 4DUYJ 4DR7J 4DV4J 1FJGJ 4DV5J 4HHUA 4DR3J 3R2DJ 4B3RJ 4AQYJ 2MQ8A 5IT9U 4X62J 4JI2J 1I94J 1HNWJ 2UXDJ 2HHHJ 4JYAJ 1IBMJ 1N34J 4PWWA 4JV5J 4LF9J 4DR1J 4DV7J 5LM7E 2F4VJ 4LFCJ 4DV0J 4LFAJ 5IWAJ 1HNZJ 4JI0J 4DR5J 3D3CJ 3T1HJ 3J7AN 2UXCJ 4B3SJ 4YY3J 2MTLA 4X64J 4K0KJ 3R2CJ 1XNRJ 1IBKJ 4KY3A 1XNQJ 4RJVA 4X65J 3IMQJ 4LFBJ 4LF8J 4LF6J 4KYZA 4JI6J 4DV3J 3J80U 4GKJJ 4NEYA 4LF4J 3W1YC 5LMUJ 4B3MJ 1HR0J 4GKKJ 5BR8J 1XMQJ 4DUZJ 1N32J 4LF7J 2ZM6J 4NEZA 3OTOJ 4DR2J 4DR4J 2UUBJ 5FLXU 2KL8A 4JI7J 2E5LJ 4JI3J 3JAMU 2UUCJ 2MEWA 4X66J 4DV1J 1IBLJ 3J81U 2VQEJ 2UXBJ 2UUAJ 1XMOJ 4JI4J 4NXNJ 4KHPJ 4JI8J 4LF5J 2VQFJ 1N33J 4OX9J 2KVQE 5AJ3J 4NXMJ 1N36J 1HNXJ 3T1YJ 4YHHJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 J;  2UU9 J;  4V1A k;  4DV6 J;  1J5E J;  4B3T J;  4JI1 J;  5A2Q U;  3D3B J;  5LMN J;  4DV2 J;  4DR6 J;  4DUY J;  4DR7 J;  4DV4 J;  1FJG J;  4DV5 J;  4HHU A;  4DR3 J;  3R2D J;  4B3R J;  4AQY J;  2MQ8 A;  5IT9 U;  4X62 J;  4JI2 J;  1I94 J;  1HNW J;  2UXD J;  2HHH J;  4JYA J;  1IBM J;  1N34 J;  4PWW A;  4JV5 J;  4LF9 J;  4DR1 J;  4DV7 J;  5LM7 E;  2F4V J;  4LFC J;  4DV0 J;  4LFA J;  5IWA J;  1HNZ J;  4JI0 J;  4DR5 J;  3D3C J;  3T1H J;  3J7A N;  2UXC J;  4B3S J;  4YY3 J;  2MTL A;  4X64 J;  4K0K J;  3R2C J;  1XNR J;  1IBK J;  4KY3 A;  1XNQ J;  4RJV A;  4X65 J;  3IMQ J;  4LFB J;  4LF8 J;  4LF6 J;  4KYZ A;  4JI6 J;  4DV3 J;  3J80 U;  4GKJ J;  4NEY A;  4LF4 J;  3W1Y C;  5LMU J;  4B3M J;  1HR0 J;  4GKK J;  5BR8 J;  1XMQ J;  4DUZ J;  1N32 J;  4LF7 J;  2ZM6 J;  4NEZ A;  3OTO J;  4DR2 J;  4DR4 J;  2UUB J;  5FLX U;  2KL8 A;  4JI7 J;  2E5L J;  4JI3 J;  3JAM U;  2UUC J;  2MEW A;  4X66 J;  4DV1 J;  1IBL J;  3J81 U;  2VQE J;  2UXB J;  2UUA J;  1XMO J;  4JI4 J;  4NXN J;  4KHP J;  4JI8 J;  4LF5 J;  2VQF J;  1N33 J;  4OX9 J;  2KVQ E;  5AJ3 J;  4NXM J;  1N36 J;  1HNX J;  3T1Y J;  4YHH J; 
#chains in the Genus database with same CATH topology
 1Q5V A;  5JUM A;  2YKO A;  4DF4 A;  2I0X A;  4ID5 A;  4UUX A;  4ECZ A;  2IAJ B;  4DV5 J;  3HM9 A;  2GVZ A;  4YP3 A;  2IM2 A;  1RUS A;  2R8H A;  2CQH A;  5L1J A;  2MLY A;  3QFH A;  3DLG A;  4ZIV A;  4JI6 F;  5I3Q A;  3EX7 B;  4PQU A;  5C7P A;  2RDI A;  2W9B A;  5CCM A;  3BSA A;  4OYA A;  3V4I B;  3R6G B;  4RWX A;  2OH2 A;  3VV2 B;  3DLJ A;  1X5T A;  1R0A A;  4LF1 A;  3FZ2 A;  1RT6 A;  1RHK B;  2WOM B;  3SCK E;  3A8E A;  2BBE A;  2MLZ A;  4RUB A;  1MU2 A;  4XPC A;  3ZZY A;  2BUN A;  2J7U A;  4DR2 J;  3G96 A;  5LMN F;  3PW0 A;  4JI7 J;  4RUA A;  3KLF A;  3W2V B;  4DX5 A;  3MEG B;  2ZBI A;  3OL6 A;  5IC4 B;  1YRT A;  4EUV A;  1WOO A;  2HHV A;  4DX7 A;  4WCE Q;  1IKY A;  5HBM B;  3QIP B;  5K5M A;  3W9I A;  5FII A;  2IRU A;  2BDP A;  2ZUA A;  2NUU G;  4I68 A;  1C2P A;  4WXO A;  3DLH A;  2IBO A;  3OBI A;  4FVM A;  3PHT A;  5J2M A;  2HQF A;  3GMG A;  2V9K A;  3V5R A;  1BMQ B;  1HBO A;  4JYA J;  3RZA A;  1ULR A;  3N01 A;  4I64 A;  2VU5 A;  2BJD A;  2B6A A;  3NXZ A;  3NOC A;  3TWZ A;  2QN6 B;  3GR0 A;  4DWI A;  5GAE U;  3LF0 A;  2LYV A;  4K4V A;  4FN5 A;  3I4P A;  3H5Y A;  2OD4 A;  3D0I E;  4OMF G;  1EZZ B;  4LSN A;  1WC6 A;  1LW0 A;  2WSF C;  3SYZ A;  4A8K A;  3ISN D;  2GX8 A;  4DV3 J;  2VG7 A;  2C28 A;  2E7V A;  1R7I A;  1YBT A;  4DPO A;  1T3O A;  2F3J A;  3KMQ A;  3DHW C;  4TY8 B;  1H2U X;  3AY0 A;  3M6V A;  5KFI A;  2C3P A;  2CG4 A;  4X4U A;  4DL4 A;  1A0O B;  1LWX A;  5LOQ A;  1U0S A;  3M8W A;  2U2F A;  2W7A A;  3NCQ A;  4LRE A;  3Q8S B;  4OZ2 A;  3ENV A;  3PNI A;  4F8R A;  2JC0 A;  5AJ3 J;  4O3P A;  3KJV B;  1HNX J;  3OVA A;  1S1T A;  2BYC A;  3MZI A;  1QE1 A;  2H4Y B;  3EVM A;  3PR4 A;  1FFG B;  1MWQ A;  1FDA A;  2WVD A;  2FJW A;  4ID8 A;  4QIF A;  3FUY A;  4ECQ A;  4X62 J;  4RZR A;  4F4W A;  4QZV B;  4J9U E;  2CVE A;  2QA4 G;  3BH6 B;  4DEZ A;  2X3D A;  4RBV A;  4QWB A;  5KOW A;  4DV0 J;  2OPP B;  4ZHR B;  1X31 C;  4I2P A;  1YVF A;  2MTL A;  1JXL A;  1VQL S;  3O6Q A;  1U8S A;  5CZX A;  2RKI B;  2XYG B;  5T7L B;  1HNV B;  2WK4 A;  1WOP A;  1RT3 B;  2WBM A;  3TZZ A;  2MQL A;  3UVJ B;  5DG7 A;  3VAL A;  5KFL A;  5BYR A;  5F8G A;  2EWH A;  1JMT A;  4DMZ A;  2COL A;  3M8Z A;  1WEZ A;  2XO7 A;  3OVB A;  2WZ1 A;  2ZOM A;  4DV4 F;  2AV5 A;  4X2B A;  4XAK A;  5EX0 A;  5F8N A;  1XNR F;  2DH7 A;  5GMK a;  2YWK A;  5U47 A;  3FBE A;  3NBP A;  1SKS A;  1GH8 A;  1RWW B;  3S6E A;  1VQP S;  2YX4 A;  4DSE A;  4DL5 A;  2FLP A;  2PE8 A;  3MUM P;  2ZH3 A;  3E2E A;  1DBD A;  1A9N B;  4DU7 A;  4WTY A;  2JX2 A;  1LFP A;  4ZVR B;  4V19 J;  3C19 A;  4ZVO B;  3H25 A;  5H9F K;  1LK5 A;  2DTJ A;  3DGP A;  4FKY A;  1U0H B;  4WP9 A;  4N8O A;  4O4G A;  4KGV B;  4ZOS A;  2LDY A;  2M70 A;  1NBE B;  3ISN C;  3OXL A;  3KTQ A;  1SL0 A;  4B9L A;  1CJU A;  3UWT A;  2E9T A;  4XPE A;  1VQ4 S;  5CD4 H;  1NU4 A;  2VJU A;  1S9F A;  4DUZ J;  2WON A;  3TJA A;  1BQM A;  2FVC A;  3ZO7 A;  3IRW P;  3W66 A;  4DL3 A;  5I42 A;  1PBU A;  2CPX A;  3UNY A;  3JB9 k;  2N3O A;  4OI1 A;  2HHH F;  2HHT A;  2YY3 A;  5AE1 A;  1FHT A;  1NND A;  1OSD A;  5HMZ A;  6AT1 B;  2MZQ A;  3ZNU A;  4RKU C;  4IG3 A;  5DET A;  1W25 A;  4HHJ A;  4MK8 A;  3PO4 A;  4B02 A;  1XNQ F;  4AXJ A;  3BEG B;  1KTV A;  1S6U A;  4A8M P;  5AXK A;  4PUO B;  3GP9 A;  3D6F B;  3MM6 A;  5IFM A;  2VPW B;  2VHG A;  5IWA J;  2IVY A;  3LP2 A;  3HD1 A;  2DNM A;  4E8U A;  3OTO F;  1TAQ A;  3OUY A;  5GAH U;  3DYA B;  3K8W A;  4OLO A;  2IIH A;  1RQ0 A;  1Z2L A;  2JFD A;  5HI7 A;  2UXB F;  1DTT B;  4K4T A;  3D0H E;  5C25 B;  3MMC A;  4GKJ J;  2KH9 A;  1N52 B;  3MEC A;  4F36 A;  1N36 F;  2O67 A;  3PTW A;  4WII A;  2G0C A;  1NDP A;  3DXS X;  1HFE L;  2EI5 A;  4PYA A;  3DDN A;  4TQS A;  2HK3 A;  4R8U A;  3PFO A;  2QO3 A;  3MEE A;  4YR2 A;  3BGF A;  1YJR A;  3UNG C;  2XMA A;  5RUB A;  1OPZ A;  1UVI A;  1NK6 A;  4M1K A;  3KK1 A;  5A8W B;  3IG1 B;  3BPD A;  4B3M F;  3DM2 A;  4NZ6 A;  3HHL C;  2FD2 A;  2H5J B;  4B9S A;  5HVF A;  2OPR A;  4ENO A;  2WTF A;  1KOO A;  1F5C A;  1N34 J;  1IBM J;  3RAM A;  1I6J A;  3QT7 A;  4LIR A;  2XI3 A;  3N4W A;  5A6W A;  4K4Z A;  1FJC A;  1YJ9 S;  2FVR A;  4ELT A;  3Q8U A;  3R5C A;  1UPM B;  3D1Q A;  3FC9 A;  4ZLN A;  2OIH A;  3C46 A;  2ZH6 A;  1RWP B;  1U1R A;  1WNE A;  2IYG A;  1TKX B;  2XBP A;  2C3O A;  3I55 S;  2GIQ A;  1ACM B;  3VQS A;  2AHO B;  3CJ3 A;  3OFH A;  2A18 A;  3R3T A;  2QLX A;  2D3U A;  5KT4 A;  4EYI B;  1Y11 A;  1X5S A;  3MAA A;  1NHU A;  1LWE B;  3GB0 A;  3PXG a;  1VC0 A;  1S6Q B;  5D3G B;  2GIR A;  1WOR A;  4NWB A;  4UUW A;  3I96 A;  2H5I B;  5L38 A;  5HAT A;  1ICE B;  3BB5 A;  3GU0 A;  3I0R B;  4IRD A;  2RJZ A;  4J7C A;  1YX2 A;  2K7K A;  5FDL A;  1FT8 A;  2WW4 A;  1VIO A;  5F8J A;  5HJY A;  3J7A 1;  1WC5 A;  3ZZR A;  1L3K A;  1QAX A;  2V8G A;  3RRG A;  2YKN B;  5IXU A;  5IT0 A;  3U1M A;  2XZW A;  4FXD A;  1FXD A;  4FYX B;  5LM7 E;  2MY7 A;  5K9F A;  3CDU A;  3A4T A;  1NAQ A;  3AT1 B;  1F3V A;  3JTO A;  1RTJ A;  1WF2 A;  4F04 B;  1B7F A;  1ZM2 A;  1VBY A;  3CWJ A;  1RB0 A;  4NI2 A;  2V4J B;  5HAO A;  1GNK A;  2HFO A;  1CUL A;  1FRI A;  4P7T A;  1S57 A;  3R7B B;  4G3I A;  4WE1 B;  5B0A A;  3KG4 A;  2Z57 B;  3CJ0 A;  4F0M A;  2EXU A;  4USM A;  4DPY A;  4O23 A;  1KVJ A;  2LEB A;  4F4K A;  2BJ1 A;  3Q83 A;  2DNQ A;  2P6T A;  1VQ8 S;  3N6M A;  1R8P A;  2OPS A;  2CQG A;  4L73 A;  2EPI A;  4NYP A;  3MMA B;  4HHU A;  4RR5 A;  4CYU A;  3AOC A;  4B3O A;  2W24 A;  4LF6 F;  2E29 A;  4ZLJ A;  1UWB B;  1XQI A;  1R6V A;  4Y65 A;  1HQU B;  1SL1 A;  1UET A;  3T1A A;  3G8T A;  2BXJ A;  3M9M B;  1S1W B;  2I2Y A;  1HWJ A;  2M52 A;  3U27 A;  2J0S D;  4X66 F;  4DG1 B;  2LXI A;  1KR4 A;  4GO7 X;  5J2N B;  3JQJ A;  1RWX B;  1G6B A;  1NJW A;  2HQD A;  3J80 U;  5KFW A;  2ADC A;  2UVR A;  2LLZ A;  2J9C A;  4LUB A;  2QX0 A;  4I56 A;  2KZZ A;  2CJA A;  4NOH A;  2XY5 A;  3VGS A;  5DLG A;  1X0P A;  1PKU A;  2KRB A;  3TVY A;  4CRJ A;  4F26 A;  3UN5 A;  2DNL A;  3OT9 A;  3CJ2 A;  1JIH A;  3WHI A;  2OPQ B;  3TA2 A;  3SQG A;  2IM0 A;  4JI1 J;  4Z7C A;  3KLH A;  5IV4 A;  4FBT A;  4JV1 A;  2RUS A;  4Q5V A;  1R27 B;  1VQN S;  2XC9 A;  2AYE A;  1R0C B;  4DR3 J;  2RQC A;  2CDR B;  3JS9 A;  3MXH P;  4XIU A;  4YME A;  1ZTT A;  2EC0 A;  1GQE A;  2X7I A;  1R43 A;  4KC5 A;  2E5I A;  1T9X A;  3BBF A;  4KKO B;  4Y2M A;  4WK3 A;  1JNR B;  4NAS A;  2E1A A;  2PGC A;  3PM9 A;  2F9D A;  3TA0 A;  2J0Q D;  1P27 B;  1YSJ A;  2XHW A;  3H2L A;  3H2V E;  1CJK B;  4DSJ A;  1SC3 B;  4CDI A;  3DRR B;  5LMU J;  1WHX A;  3L7U A;  3T9N A;  1Q8B A;  2Z4P A;  2BAB A;  5K8O A;  7AT1 B;  2HS3 A;  2VUG A;  4PKD B;  4ZIT A;  1EIY B;  1NDK A;  4AQY F;  4ZCM A;  1TL7 B;  1UKU A;  2ZNY A;  4J9O A;  2CRL A;  2HMI B;  1EJ7 L;  1RK8 A;  3IBC B;  2YBV A;  4V1A k;  5E3Q A;  1Z4U A;  3CCR S;  3TEH B;  1S0N A;  1SUQ A;  4IDK A;  5B0B A;  5J1P A;  3RYL A;  1HMV B;  1UL3 A;  2LKZ A;  2DHA A;  2DYA A;  3SMZ A;  2OEM A;  2R7V A;  3F44 A;  3LAL A;  1OY9 A;  1ZS6 A;  5A0Y B;  5CD4 A;  1NSA A;  1UZD A;  3G6V A;  3RBD A;  4N41 A;  3B8H A;  2QZ8 A;  3M1V A;  4QR1 A;  4NLS A;  4HAC A;  4ZCK A;  4HL9 A;  5HQL A;  3Q89 A;  1TMJ A;  2FC8 A;  4KHR A;  1JJ4 A;  1HI8 A;  4DV1 F;  3OXF A;  2ZOG A;  1S76 D;  1TL1 B;  4MYU A;  2OTL S;  3R5A A;  5CYM B;  4P73 A;  3LAM A;  3H5X A;  1PIL A;  3W2W B;  2J6S A;  2HKE A;  4LRB A;  3H7H B;  4OYX A;  2RRN A;  5HQM A;  4IQM A;  4J9M A;  4MJK A;  1VS3 A;  4M5L A;  3HSZ A;  2CQD A;  2J9D E;  1PSD A;  1Q79 A;  1RAE B;  1LW2 B;  3D4J A;  3NOG A;  2XGQ A;  3MM8 A;  2B7C B;  5L1I A;  4ICL A;  3MI7 X;  5CAB A;  2XYP B;  2QMX A;  2B5J A;  4EU0 A;  4L6V 3;  5E3C A;  4YFU A;  3O1L A;  2E9R X;  2JRS A;  1WD6 A;  2H1Y A;  1LK7 A;  3I5A A;  2XSJ A;  1TKT B;  3CCE S;  5GAG U;  3GG1 A;  2NQP A;  3UDE A;  1RAG B;  1RJJ A;  4N7T A;  3FGV A;  2Z30 B;  5A8K A;  1BQN B;  4ZIW A;  3ENA A;  1ZAV A;  4MKB A;  1IWG A;  2HHQ A;  4JI8 F;  2N82 B;  2C2Z B;  4WWS A;  4C3M A;  3OSN A;  5ETM A;  1TUV A;  1XMQ J;  4NCA A;  3CT9 A;  3SSQ A;  1S77 D;  3IWL A;  3BKT A;  1K47 A;  2CFX A;  2LCW A;  5KFO A;  3DOK A;  1YDL A;  2PA8 D;  4IG0 B;  4IO9 Q;  3PKY A;  2XUL A;  2JNJ A;  4LF5 J;  3K5O A;  3DRY A;  3A8J A;  1YTY A;  4USV A;  3T6J A;  3M2R B;  2V4Q A;  1WKJ A;  2EEY A;  2F4V F;  4W4M A;  4OJG A;  1V5I B;  2WRM A;  1IN0 A;  1FNX H;  2HHU A;  2ZM6 F;  4DJB A;  2UVW A;  2M88 A;  1U6F A;  4JV0 A;  2O5D A;  1VIS A;  4L76 A;  4DF8 A;  5J2P B;  4DR5 J;  3FEY B;  3L3C A;  1RWV B;  4NLO A;  5K8P A;  4PWU A;  2VON A;  2PI5 A;  4NA1 A;  2XLI A;  4WU3 A;  2JZ5 A;  1HBO B;  3ETM A;  3FBF A;  4IQX A;  1S9G B;  2BM1 A;  3WX8 A;  3VAG A;  3G6E S;  1K0V A;  3ENW A;  2XMV A;  4XDD A;  4PXD A;  3MM7 A;  4QQB A;  3K58 A;  4ES2 A;  4OHV A;  2YKA A;  4M5N A;  2VG7 B;  4FYY B;  1KFD A;  4NXM J;  4HYK A;  3RGI A;  4MAK A;  3OL9 A;  5LL6 d;  3D68 A;  3MAH A;  1WSR A;  4Y00 A;  4CI0 B;  2BE2 B;  3GV7 B;  1GXT A;  4CLZ A;  2AX1 A;  1X60 A;  2UXD J;  4QU6 A;  3M8R A;  3R5J B;  4HT7 A;  3K5N A;  3PW4 A;  2F8M A;  3ZC4 A;  1C1B A;  1TFW A;  4N8N A;  4LF4 F;  1EQ0 A;  4D3H A;  5HRO A;  1UZH A;  3CXC R;  2RAQ A;  3DKD A;  3I87 A;  4FF2 A;  1N8R T;  3F56 A;  5LSR A;  2VBY A;  3ENQ A;  2Y0B B;  4Y2I A;  2QT7 A;  5KFV A;  1P6T A;  4C11 B;  2CUY A;  2I6W A;  1HBU B;  4WP8 A;  2UU9 F;  2RQM A;  3AJD A;  2DNN A;  2NSB A;  2VKZ G;  3GIK A;  2KN4 A;  3KXD A;  1T7P A;  3ITH A;  3KLV A;  5G4D A;  2X1G A;  1URR A;  3BGU A;  5AXN A;  4MMO A;  2M4M A;  1SL2 A;  3HVA A;  1JLB A;  3FDS A;  3T41 A;  2Y1I A;  3Q8Y A;  2LDI A;  3A13 A;  3GG0 A;  2AJ0 A;  3OTC A;  5A2Q U;  1DUR A;  2ZHA A;  4ES3 A;  2QFI A;  4ZPA A;  1RAI B;  4Q8F A;  2DO0 A;  2JEG A;  2Q6C A;  3MFH A;  3L4B C;  5AE3 A;  2PO4 A;  3M2U A;  3KNA A;  3K7R A;  3DN9 A;  2R42 A;  3FVY A;  3DLK A;  4JOU A;  1EP4 B;  2G4B A;  2NR0 A;  2IYI A;  4RWW A;  2EG1 A;  4W98 A;  4PZV A;  1AFJ A;  3N28 A;  3RB3 A;  3AXK A;  3MR5 A;  3IS9 B;  2BMB A;  4FF4 A;  2DIV A;  3TRG A;  4YY3 J;  2W9C A;  3T9Z A;  1MMD A;  3BGR A;  5F8M A;  2DGW A;  3VGV A;  3BJY A;  1YIJ S;  5GAD U;  1NXI A;  2YXL A;  2G2O A;  2HBY B;  1UEU A;  2OMO A;  3L9Z A;  2B8Q A;  2DBB A;  2UZA A;  4A8W A;  4TQR A;  3M6U A;  3THT A;  2GAH C;  4O4G B;  4CO0 A;  2UUB J;  2E5L J;  1DTQ A;  2R7T A;  2XEX A;  4H4M B;  3D1O A;  3AD8 C;  3HZE A;  4ZVE A;  2DNP A;  4PG5 A;  3I4H X;  3I0S A;  1TKZ A;  2QLB B;  4WK1 A;  4QYZ K;  3RU0 A;  2Q43 A;  3DGV A;  1IKW A;  2A6O A;  3TX0 A;  3NL0 A;  2AGQ A;  3CO9 A;  1C1C A;  3NGT A;  2MQ8 A;  1ZM3 A;  4P10 A;  2G2Y A;  4M5D A;  1TL5 A;  2VC1 A;  2H65 B;  5HLF A;  4MKY A;  3WDO A;  4RW8 A;  4LRD A;  3TUI C;  1F5A A;  1D9D A;  1Q0N A;  3R8Y A;  2YKP A;  2VC0 A;  2M9K A;  2V4R A;  1U26 A;  2ZOF A;  3LH2 S;  2Z58 B;  1IVZ A;  2RVJ A;  4RBT A;  1FWL A;  1O5J A;  3JSB A;  2C3Y A;  1TZ0 A;  1VQ9 S;  3C66 A;  3BSN A;  1ITP A;  4QIW D;  2YQ0 A;  4G1I A;  2WB1 D;  1BWV A;  2EVZ A;  4DPW A;  2IVM A;  3KDO A;  4KJI A;  2X1B A;  2LA4 A;  4HI1 A;  2KDO A;  2BZ2 A;  3ONQ A;  5KFN A;  1VRT A;  3M9N B;  2XG8 A;  4KGK A;  2Y8W A;  2DIU A;  3C6T A;  4OHY A;  4I6Y A;  4FXV A;  3GPA A;  2LXU A;  1KN6 A;  3JSM A;  3JYT A;  4WZQ A;  5KT5 A;  4X4R A;  3M8S A;  3MCN A;  1ZH5 A;  3R6L B;  4KH1 B;  1ZPV A;  5KFH A;  3IR7 B;  3PW7 A;  3KHG A;  2KT5 A;  2BR0 A;  4MIW A;  3CDA A;  1QVF R;  2D3Z A;  4KTQ A;  1BD6 A;  3N5F A;  2DCL A;  1S1U A;  4KV8 B;  3H5U A;  3UPF A;  5GVQ A;  5LSO A;  1R0B G;  2BJE A;  2UUC F;  4IOB A;  3IMQ J;  5F0W A;  1NK5 A;  4DL2 A;  1U1O A;  4YN3 B;  4KR0 B;  1N33 F;  4DPU A;  2ILZ A;  3GIL A;  2VH7 A;  4LF7 J;  2YWG A;  1G7C B;  4A48 A;  4PG6 A;  4O0N A;  1HBN B;  1H38 A;  3TAQ A;  4DUY F;  1UJ5 A;  3DFE A;  2V69 A;  2V5H G;  3VWS A;  2VQF J;  5D0R A;  2CZV C;  1NRK A;  2BQU A;  1EB0 A;  1ZAX A;  2NXU A;  3DU6 A;  1IR1 A;  4OJH A;  5C42 A;  4NZ0 A;  4Q8E A;  2K1R B;  4Y3C A;  5DRK A;  4JI2 J;  4LIW A;  1I94 J;  2W4D A;  3CTR A;  2QRR A;  4NLV A;  2UVU A;  3FQK A;  2ZHO A;  3B54 A;  1CLF A;  2E66 A;  5BYQ A;  4BLG A;  1VQ7 S;  1RTD A;  1Y3K A;  1Y9O A;  3Q22 A;  1WHY A;  2Q6B A;  3LGN A;  4TU8 A;  3J7A N;  4KAI A;  2IAJ A;  3RTV A;  2CQC A;  3M8P B;  4NCB A;  3Q24 A;  5D0E A;  3TJ8 A;  2PI4 A;  2HVD A;  3D5M A;  1QSL A;  1FX4 A;  1NZ8 A;  1IJF B;  3NAH A;  1M1K T;  1U6B A;  3SFU A;  1MLA A;  1XJW B;  3V4I A;  5EN1 A;  1TL4 A;  4OYI A;  4UF4 A;  4Q2L A;  2VBW A;  4XK8 C;  2WBR A;  4O44 A;  1DQ8 A;  4A8O A;  4KHP J;  4YB7 A;  3TJ9 A;  4JP8 A;  2WOM A;  3DOL A;  1S1X B;  3CCM S;  1CUL B;  3KJF B;  5DGB A;  3J81 Y;  3BR9 A;  1HD0 A;  2FJE B;  3W5X A;  2MGZ B;  3J7Y U;  2RS8 A;  4ZN3 A;  1FFS B;  4B9U A;  1I3O B;  2W2Q P;  2FB0 A;  1ZZF A;  5DZ6 A;  3W2V A;  3MEG A;  1T0T V;  3PV8 A;  1RU2 A;  1UVK A;  5HBM A;  3A8K A;  2VF3 A;  1F9E B;  1HNZ J;  1LNQ A;  2BKO A;  3W64 A;  3RJM B;  4M5J A;  3CJQ A;  3CC2 S;  4MTP A;  2CJY B;  1SH2 A;  4D3G A;  1PC5 A;  5KFQ A;  1RA7 A;  4QR0 A;  1D8Z A;  3PX0 A;  3AOA A;  4DV6 F;  3EDQ B;  1NK7 A;  2W2M P;  1ZM4 A;  2DY9 A;  4ECV A;  3NWR A;  5DGA A;  2MSS A;  3KUE A;  2X1A A;  2AP6 A;  1QUP A;  3IRX B;  1O8B A;  2UUA J;  3CGI A;  3UI3 A;  3G82 B;  3QAE A;  3BO2 A;  4N56 A;  1OQ6 A;  1YK9 A;  1RWO B;  1SH3 A;  1S10 A;  2QLW A;  3I32 A;  3KJQ B;  2G9O A;  5KFD A;  1P1T A;  4QIE A;  2XMK A;  3D67 A;  3KK2 B;  4PYD A;  2FZC B;  4TY8 A;  1VQY A;  3HHD A;  1OO0 B;  3OR1 B;  2HZV A;  1C4A A;  1U49 A;  1F0X A;  3UR0 A;  1NPP A;  3DOM B;  3TX8 A;  3BS9 A;  3CJK B;  2Q3P A;  1HPZ B;  4CH0 S;  1S59 A;  3I31 A;  1BHN A;  1IBK J;  2JFK A;  5EWE A;  2HGN A;  2C3U A;  2D74 B;  2HFU A;  4B9N A;  2B0G A;  3G8Q A;  2NXJ A;  1C0T B;  3H20 A;  1YWX A;  4PAA A;  4X4P A;  2OPP A;  4PXC A;  3QGP A;  1FTR A;  4ZHR A;  2RIJ A;  2NZ4 A;  3OHB A;  3KFW X;  2V68 A;  1FJ7 A;  5DLF A;  2NYI A;  4CLS A;  4DL0 C;  2RKI A;  1M0S A;  5T7L A;  1HNV A;  2R2T A;  4NE9 C;  1VK3 A;  2OGU A;  4P71 A;  1XR7 A;  2BV3 A;  1AZS B;  3IM8 A;  1RT3 A;  3EXC X;  1FO1 A;  2FC9 A;  3UVJ A;  4QOT A;  2E1C A;  2MY8 A;  3T1H F;  4P6Q A;  4MT1 A;  4NLD A;  5J2Q B;  3P5T L;  3IWN C;  1X8D A;  1F1B B;  2ILY A;  4LF2 A;  1WEX A;  3DRX A;  4G1Q B;  1SIW B;  3NP5 A;  3ADA C;  3QJJ A;  3TUZ C;  5B0G A;  4P2X A;  3J7Z 5;  1MMN A;  4CO4 A;  3Q0A A;  1KP6 A;  1AT1 B;  2KYZ A;  2FPH X;  2VKR A;  1D9F A;  1XNR J;  5E3A A;  4YDD B;  7FD1 A;  1OMS A;  2AKW B;  1VMB A;  5CYJ A;  4DFM A;  2MKH A;  4EK2 A;  3TZX A;  3HXM A;  1PYT A;  3ZZT A;  2MKC A;  2EKN A;  1TMM A;  5ETQ A;  4DQP A;  1OS5 A;  3GJQ B;  4HAC B;  1U0H A;  3ILJ A;  1FRX A;  1NKE A;  1XMB A;  5H1S V;  1VBK A;  3H40 A;  4I6A A;  2AZ3 A;  1RE1 B;  5IT4 A;  3TEG A;  5HP1 B;  1MRO A;  4JV5 F;  4J9L A;  2PMH A;  3HJV A;  2W8L A;  3CJ8 A;  3QPI A;  1JJC B;  4OYM A;  4NX9 A;  2DHS A;  3TAM B;  4DL7 A;  1PAE X;  3MTJ A;  3DLL Q;  3VAJ A;  3GWC A;  1H7W A;  2ZC4 A;  4M5H A;  2CQ4 A;  5JXS A;  1SJ1 A;  2FDN A;  1SJQ A;  4DS4 A;  1S9E A;  3ILL A;  4RPF A;  1IWA A;  3QT5 A;  2MDA A;  2KFN A;  2ZIT A;  1ZOT A;  1O0P A;  1IBL F;  3NGS A;  1L3V A;  3AFG A;  2QYG A;  4PXB A;  2C2D A;  2KYX A;  4ZVU B;  4LR7 A;  1B99 A;  3I9Z A;  1JLA B;  2PFD A;  4PUO A;  5ETK A;  1YKW A;  4K7Q A;  2H4W B;  3FCV A;  2DNG A;  1CS4 A;  3BBC A;  3TAN A;  3OJS A;  2W9A A;  5B7W A;  5D78 A;  3CDW A;  3C14 A;  3OFF A;  3K89 A;  1SJR A;  3DYA A;  4BBY A;  2ABY A;  2CPY A;  4OX9 J;  3TW0 A;  3UD3 P;  5T14 A;  1DTT A;  5C25 A;  2NLW A;  4ZPW R;  1KLN A;  4P9S A;  4A8Q A;  2H54 B;  3D66 A;  2OTJ S;  2AF6 A;  3KLG B;  2FHK A;  2RDD A;  2R8K A;  3FSI A;  3GFZ A;  2CQP A;  2IY5 B;  1X4A A;  3Q2T C;  3OL8 A;  1S1V A;  2F8E X;  4K59 A;  1KFS A;  3CC7 S;  2KVI A;  4C8Z A;  4KQZ A;  2ZE2 B;  4ZP8 A;  3PFE A;  3MMB B;  1BXN A;  4DR2 F;  3G87 A;  5A8W A;  3IG1 A;  3P6Y C;  4JI7 F;  2Y1L B;  5ETP A;  3HP6 A;  3BDP A;  2QTW A;  3LPE A;  4HDG A;  1ZA1 B;  1WAC A;  1FXL A;  4ZVT B;  3TVK A;  1XER A;  4B3M J;  1RHJ B;  5KFP A;  2M8D B;  3CIM A;  2BQR A;  1KKH A;  3SXL A;  2LA6 A;  3C16 B;  2M7S A;  1CEZ A;  2KHD A;  4IOA Q;  2MZ1 A;  4JYA F;  2LP4 A;  1KVI A;  2N4C A;  2BAN A;  2F7V A;  4RL1 A;  4ED3 A;  1ZYQ A;  4DR7 J;  4CLK A;  3HI9 A;  4P7V A;  4ED4 A;  5IT9 U;  1E6V A;  2N4D A;  5KFJ A;  2OD6 A;  1LWE A;  2GML A;  4OYW A;  3C15 B;  4QWE A;  4DV3 F;  3NMR A;  1S6Q A;  2E7W A;  3H59 A;  5D3G A;  5HMW A;  3TZY A;  4TYA A;  3VAM A;  1TV6 B;  2CAD A;  4KFB B;  1T11 A;  3UD5 A;  3I0R A;  2HRY A;  4LBP A;  2Z56 B;  4X65 J;  4USJ C;  2BJ8 A;  2WCX A;  1QSY A;  1U25 A;  3D54 A;  2YKN A;  5AJ3 F;  4CNZ A;  1HNX F;  3FCW A;  5HRO B;  5AT1 B;  1EKR A;  4EBE A;  2FVQ A;  1APS A;  2Z2Y B;  3UD4 P;  1JB0 C;  2W4C A;  4X62 F;  4Z7Y A;  1TU0 B;  1GTE A;  3Q8P B;  1M5K C;  2JVR A;  5KG7 A;  3CD7 A;  4CLF A;  3QNW B;  3FK4 A;  4NL5 A;  4CH7 A;  2V4J A;  2IA0 A;  1RT1 B;  1Q7L B;  3CJS A;  4MKA A;  3GFY A;  4DSL A;  4PPD A;  4WE1 A;  4OYZ A;  1WC3 A;  4M63 A;  2WSE C;  1QAJ A;  1FX2 A;  4J91 A;  4UST A;  1X9S A;  3ELH A;  2M8H A;  3UDL A;  3CJT A;  5DS7 A;  4HDH A;  4LQ3 A;  1F6T A;  3VZH A;  4NML A;  1BE4 A;  1H0H B;  2HAI A;  4K5R A;  3Q2S C;  4C7Q A;  4U7U D;  4RJV A;  3MMA A;  5LXR A;  5KFM A;  3M2U B;  4LBI A;  4C98 A;  2H5E A;  5HMX A;  1WDT A;  2LEA A;  2CJQ A;  3FNN A;  1HI0 P;  2H9Z A;  1KQK A;  4WFB Q;  5KFX A;  5GAH I;  1UVM A;  1HQU A;  4Y0F A;  3GQC A;  1KQS R;  4JUZ A;  1HWU A;  5KG0 A;  2EG2 A;  3AJ2 A;  4IRK A;  2ZJP Q;  2V9W A;  1S1W A;  2RDJ A;  1HBM B;  4ZN1 A;  4ECX A;  2FYX A;  3OTD A;  4DG1 A;  2YWH A;  2CJX B;  4CQ1 A;  3M8Q B;  1KOH A;  1Y5I B;  1RYR A;  3W65 A;  3UQS A;  2OEK A;  4ANC A;  4C97 A;  2DHH A;  3T3F A;  2ZVS A;  1YI2 S;  4C8M A;  3R2D J;  3G9C A;  1WTB A;  1ZA2 B;  2MXY A;  2FJD B;  1KLM B;  3VAI A;  2JDJ A;  4DR1 J;  3DDK A;  3I0S B;  2AD9 A;  4LFC J;  3KKF A;  3KDN A;  2GCF A;  3DRS B;  5F41 A;  3SFG A;  3BYR A;  4K4S A;  3V6D B;  2OPQ A;  3CD5 A;  6FDR A;  1PYS B;  1X4B A;  5H9F J;  3QLH B;  1K44 A;  1D3W A;  5DM7 Q;  5KG2 A;  2DNZ A;  1X4H A;  2ACM A;  1N54 B;  1WI6 A;  3RBE A;  5HSP A;  2ZNZ A;  3PDN A;  1N32 J;  4NLQ A;  4ED6 A;  4KKO A;  1DZ5 A;  3HX9 A;  2MKY A;  2Y0S D;  2VG5 B;  5L8R C;  4RBU A;  2P6S A;  1R89 A;  2AT1 B;  4W92 B;  3THP A;  3N0V A;  1UPP A;  1I1G A;  1X9W A;  2BX6 A;  2FZG B;  2FTR A;  1DY3 A;  1CJK A;  3MD1 A;  3DLB A;  1TP7 A;  3DRR A;  5IWA F;  2J0X A;  2W2N P;  4OI4 A;  3SDE B;  3M7V A;  3US5 A;  3G6Y A;  3LP1 B;  3GYN A;  3SCI E;  1UA1 A;  1UJ4 A;  4MFB B;  1TL7 A;  5CAA A;  2L9D A;  1R8C A;  3PRB A;  2A2C A;  1EET B;  4GKJ F;  4RX6 A;  3BPS P;  2ZDO A;  2HMI A;  2CPD A;  1CJT A;  4YHH F;  3OLB A;  5EUH A;  1S5Z A;  2L9W A;  4QIG A;  3GCX P;  4CO5 A;  2AEM A;  1J5O B;  2IFX A;  1CQN A;  1HMV A;  1S6P B;  3PO5 A;  2UV8 A;  1LWC B;  2HS4 A;  1GTH A;  2ZBQ A;  4M94 A;  4A46 A;  5A0Y A;  4DPT A;  2Y9H A;  1QVG R;  3FEX B;  3R5G A;  2V67 A;  3E3X A;  3DXB A;  1N34 F;  1IBM F;  2R8G A;  2YH1 A;  1M5O C;  2WB4 A;  1CJV B;  4B3T J;  4UY8 5;  4DV2 J;  4DFP A;  2PSZ A;  2HNZ B;  5CYM A;  5AXL A;  1X5O A;  4CH1 A;  2HBR B;  3KUH A;  3W2W A;  3RAQ A;  1LOU A;  1XR5 A;  1SC1 B;  2YKQ A;  3QSI A;  2ZJR Q;  2E44 A;  3HVT B;  2QFJ A;  3RW6 A;  4AD6 A;  4NLT A;  4DPX A;  2Z2M A;  3WX4 A;  1YBA A;  2ZDP A;  2Z2Z A;  2KM8 C;  5C42 B;  1MN7 A;  4DQR A;  3C2P A;  4OYO A;  1Z2Z A;  3QQC D;  4K4W A;  1YHQ S;  1LW2 A;  3GE9 A;  1U1K A;  2K7J A;  2AW0 A;  1VQK S;  1N0U A;  1U1P A;  3CW2 C;  2X51 A;  4R5P B;  2P9G A;  4GRS A;  2PMW A;  1TK8 A;  3KOA A;  4L74 A;  4DR4 J;  5FLX U;  1K73 T;  1TKT A;  4EI2 A;  8AT1 B;  3G4S S;  3EE3 A;  1VOM A;  3SZ2 A;  3TOQ A;  2YTC A;  1A7G E;  1IQT A;  4WFN Q;  4ECT A;  1OY8 A;  4Q2M A;  4M5I A;  4CP5 A;  4PQA A;  2J8A A;  1GAO A;  3UDV A;  1BQN A;  2ROP A;  4FBU A;  3GIR A;  1W7W A;  3W63 A;  4JV2 A;  3PYE A;  4FXW A;  4YR0 A;  1UA0 A;  4A8X A;  1WTF A;  3GFH A;  4J9P A;  4I1T A;  2V8D A;  5DDO C;  4O44 B;  5JJB A;  2ZUG A;  2HW3 A;  2CPZ A;  1HD1 A;  5JVH Q;  4IG0 A;  4LF9 J;  3IA0 A;  1N6Q B;  2QMW A;  3DOL B;  2DNK A;  1JLE B;  2P5V A;  4PEO A;  1EAR A;  2AYM A;  1FER A;  3M2R A;  3ZZZ A;  1KHW A;  2KJW A;  1LWF B;  4IH7 A;  1SJ4 P;  3T5L A;  2J9E A;  4ELU A;  4Q7A A;  3PIO Q;  3EGW B;  4LRA A;  3HVR A;  3N6L A;  1RI7 A;  2IPO B;  1H2T Z;  3NKY A;  1XTZ A;  2ZM6 J;  4CIO A;  2BM0 A;  3WIU A;  1VDH A;  5J2P A;  2J76 E;  3KUG A;  1W2B R;  3CJ5 A;  4PCQ A;  3SSR A;  3T6B A;  4X4O A;  1UAW A;  3QFW A;  2RU3 A;  2XY6 A;  3QBC A;  3MR2 A;  1YLX A;  2VJV A;  2RT3 A;  1S9G A;  2D9P A;  3LTO A;  1MWY A;  4M5M A;  3MR3 A;  2Z8Q A;  1S6O A;  2LU1 A;  1FES A;  3RRH A;  3CMA S;  1HWL A;  2OFG X;  3QGH A;  4OI6 A;  2IMW P;  1G3O A;  3QWP A;  1JLQ B;  5IV3 A;  3D3C J;  3MDF A;  4ERD A;  2HK2 A;  3QSY B;  2N7C A;  4CT9 A;  2L48 A;  3HZG A;  1F2H A;  2A10 A;  3F73 A;  2D41 A;  2BE2 A;  1FRH A;  2ZZN A;  2V2Z A;  4Q43 A;  1PO6 A;  1FRJ A;  3NS7 B;  3UCG A;  1TUW A;  1Q5Y A;  3HD2 A;  3VVT A;  5I3U B;  4JI1 F;  1FEH A;  1FNO A;  2V63 A;  5C5J A;  3SBM A;  1SI9 A;  2KFY A;  2J9D A;  4DR3 F;  4X64 F;  3L7P A;  1DJ0 A;  1RGV A;  4A4J A;  4EYH B;  1HQE B;  1RYS A;  1X0F A;  5LXY A;  1T95 A;  1CVJ A;  1PCA A;  2KTQ A;  2HIY A;  2L9N A;  5CYQ B;  4AXI A;  1H6K X;  4C11 A;  3A3P B;  1HBU A;  3ZNJ 1;  1UEV A;  2HQI A;  2H48 B;  2GHP A;  2XNR A;  4R25 A;  4DBQ A;  3KMS A;  2XY7 A;  2G2Z A;  4YUD A;  3OVS A;  2B9X A;  5DG9 A;  3UW1 A;  4OI2 A;  1O51 A;  4C0O C;  1IKV B;  5AXM A;  2NRE A;  3NGU A;  5LMU F;  2VA2 A;  5F8H A;  1LXN A;  4FYD A;  1FFW B;  1T05 B;  3D9B A;  5B0C A;  3QAT A;  5GAG I;  3I56 S;  1EP4 A;  3AB2 B;  5DDR C;  4ZMM A;  1X4C A;  1VC5 A;  3G86 A;  2D1C A;  4I0W A;  3CJR A;  3OW2 R;  1DQA A;  4Q44 A;  1R31 A;  1RTI B;  4WTO B;  3U02 A;  3IS9 A;  5KAK A;  1AUS L;  2W2O P;  4P2M A;  3GJT B;  2AU0 A;  3HK2 A;  3C6U B;  3M32 B;  3HHL D;  4LR8 A;  3OR2 A;  1N5Q A;  3W9H A;  1J27 A;  2BKN A;  3TI0 A;  2HVI A;  2FZK B;  2X3G A;  1HA1 A;  1J2V A;  3FEZ A;  1VLO A;  2FQQ B;  3F41 A;  5K8N A;  1MRO B;  2AQ4 A;  4H4M A;  1ZZN A;  3RBX A;  1MNE A;  2HHW A;  1U2F A;  1UVJ A;  2GHW A;  2C2R A;  2VPY B;  3CPW R;  2XQC A;  4C8K A;  1O6X A;  1IKX B;  4UZC A;  2DT9 A;  2W1B A;  1S4F A;  4NYO A;  5B09 A;  3G6X A;  2OI2 A;  3AOD A;  2M5Y A;  1EKS A;  2HLT A;  4CO3 A;  5IS2 A;  5F9N A;  1XWL A;  5ITH A;  3MUT P;  1VFJ A;  3IO1 A;  2KO1 A;  1S9E B;  2CA9 A;  5D4P A;  4OL8 A;  5DM6 Q;  2AYB A;  4DFK A;  3LWM A;  2DD8 S;  3EXY A;  3JAM U;  4JI0 F;  4FS1 A;  2VFS A;  3ZTQ A;  2FJV A;  1S12 A;  1RU1 A;  2JL9 A;  2YNF B;  2FY8 A;  2BE7 D;  7FDR A;  1NDC A;  4X4V A;  3EVO A;  2G13 A;  4X4T A;  2KG0 A;  5ETO A;  1CS4 B;  1D9A A;  1TFY A;  2LQ9 A;  2HNY A;  1FJG J;  3Q8Q B;  2V6A A;  3C14 B;  3E8O A;  5F9L A;  3H2U B;  3OL7 A;  2CPE A;  4J9S A;  2ROG A;  2B4P A;  2VQE F;  3BH7 B;  4OZL A;  2AJF E;  5K14 B;  4CLL A;  5F3T A;  4LFA J;  3BO3 A;  2BA9 A;  4P2F A;  2B43 A;  2DH9 A;  1U09 A;  2BJ3 A;  3K8V A;  4TY9 A;  2HSE B;  3M6X A;  4USK A;  1F9H A;  5DZ7 A;  3TVZ A;  1S1V B;  3UCU P;  5KT7 A;  1S72 S;  4LF5 F;  3ZTP A;  1NCL A;  2W7O A;  1B64 A;  3PRV A;  4OYB A;  1Q16 B;  1RT5 B;  5EWF A;  1HHQ A;  2IDL A;  2MPU A;  4J9V A;  3TP2 A;  1Q78 A;  4Y28 C;  4RNN A;  4ED5 A;  4KV8 A;  3SSS A;  1OPI A;  2RE1 A;  5LT5 A;  1FWK A;  1H7X A;  4YEA A;  2B9W A;  3DI6 B;  1PIE A;  1N5T A;  1ZTW A;  4UOH A;  3QZ8 A;  4LF8 F;  1S0M A;  1SQE A;  4J37 A;  4DR5 F;  1G2E A;  2BEF A;  5HMY A;  1GFW B;  1HBN A;  3PEJ A;  4DCO B;  3IR6 B;  3PZP A;  4OX6 A;  1IJE B;  1WF0 A;  3M2V A;  3QWU A;  3NNC A;  2EFP A;  2BAN B;  1TEL A;  4TLQ A;  2V34 A;  1SQF A;  4O3N A;  4ECW A;  2EK6 A;  4PAB A;  3ZTS A;  2DB1 A;  3I9V 9;  4RNM A;  4ZLL A;  4DI6 A;  2C3M A;  5KTQ A;  4B9T A;  1E6V B;  2D3O R;  3FKB A;  2CQI A;  2BQ3 A;  1QM9 A;  5I3P A;  2ZH2 A;  1QAI A;  1CG2 A;  2K1R A;  4DSK A;  4WFZ A;  4NYZ A;  3I82 A;  1S99 A;  2E9Z A;  4NXM F;  1H2V Z;  4DUT A;  2GGP A;  4RU2 A;  4FVC A;  4YB6 A;  5GAD I;  2RSQ A;  4UOC A;  1BLU A;  4S0M A;  1FE0 A;  1VQO S;  2R2S A;  4JI4 J;  4K2X A;  2UXD F;  2QA2 A;  1L3T A;  3Q86 A;  3A12 A;  1OYE A;  3M8P A;  4N77 A;  4I69 A;  2BRK A;  4DR6 J;  4MH8 A;  3K5P A;  4PXE A;  4ILR A;  2FY1 A;  4MKV A;  4U6P A;  2CQ2 A;  3HHL B;  4YOE A;  1HNW J;  1T94 A;  1WUU A;  3W7B A;  2FIU A;  4AFF A;  3K59 A;  4PWD B;  3R5D A;  2VIH A;  1W26 A;  3ZTO A;  3OPK A;  1K0T A;  1XK8 A;  5DQH A;  4FZV A;  1S1X A;  5HK4 A;  4B3S J;  3ILO A;  5KFY A;  5B0E A;  3NCR A;  2KXF A;  5J1E B;  2CPJ A;  2MGZ A;  2HRU A;  4QIV A;  4MK7 A;  5ETR A;  1XEZ A;  2GZO A;  2DO4 A;  3HHE A;  4CLY A;  4UZB A;  1M5S A;  2RHQ B;  4M5K A;  4ED1 A;  1GEH A;  3QRP A;  5F0U A;  4O3Q A;  3SCL E;  2KXN B;  5IQQ A;  2LU2 A;  1F5B A;  4RW7 B;  4NXN J;  3LP0 B;  1SKW A;  3MCS A;  2LQB A;  4DCP B;  3FBB A;  5C24 A;  4IRC A;  2LEP A;  3NGK A;  3D3B J;  4ALZ A;  2PEB A;  3U7J A;  3W62 A;  4DSI A;  4YY3 F;  2ALZ A;  3PY8 A;  2DNY A;  2LXF A;  1TVR B;  4OYP A;  3BSO A;  3LGM A;  3KLI B;  2NCK L;  3B6B A;  1FA0 A;  2XO6 A;  3IRX A;  4ELV A;  3P49 B;  3K17 A;  3G82 A;  2Z0G A;  1RHU B;  3VGT A;  1WHV A;  2DR6 A;  3HKW A;  1FWP A;  2HBZ B;  2K3I A;  1JXE A;  4K0K J;  2UUB F;  5E5N A;  1FDD A;  4IFV B;  2E5L F;  3AQP A;  2HFS A;  2I8E A;  4F0K A;  2CIM A;  3KK2 A;  1RLC L;  1BWE A;  1VLY A;  5G0R B;  4DLE A;  2HVZ A;  1RHQ B;  3OR1 A;  4DS5 A;  3CMQ A;  4DQS A;  1KNZ A;  3GSD A;  3D0G E;  3IXQ A;  1TQL A;  3FMB A;  2DXE A;  1JJH A;  3DOM A;  3G8S A;  1RAO A;  4I67 A;  4HT5 A;  3CJK A;  1RXO B;  4OQJ A;  1HPZ A;  1HI1 A;  3HKZ D;  2HIQ A;  4N76 A;  4HKQ A;  1SB6 A;  1M5H A;  1XMO J;  4OZN A;  4OV1 A;  5D6G A;  2VOD A;  2DCU B;  3K57 A;  1NM2 A;  1C0T A;  5F8L A;  3OFG A;  4B08 A;  4OV6 A;  3TAP A;  4HI2 A;  4Y2C A;  3VGU A;  3KLE B;  2HQ3 A;  5A6P A;  1XIQ A;  4QJV A;  4F4A A;  2QJ3 A;  4QYZ J;  2WW8 A;  1SV5 B;  2FGO A;  4IFY A;  4ECR A;  2B51 A;  5CCL A;  1T03 B;  2CNL B;  1DHM A;  3AA9 A;  1AZS A;  4OZ1 A;  2RH3 A;  2EFN A;  4I6W A;  4KH0 B;  4JBC A;  5J2Q A;  3A1Y G;  2B3T B;  3CDB A;  3NS5 A;  4G1P A;  3CCU S;  2AEJ A;  3MPW A;  2MZS A;  4G1Q A;  2MKS A;  1CJT B;  2DNR A;  4TU7 A;  5H9E K;  3EGZ A;  2PC6 A;  3A3N B;  5CH7 B;  4ZPB A;  4OIX A;  3J80 Y;  1U02 A;  1IQZ A;  3BSC A;  4F2S A;  1SCJ B;  4ZCI A;  3VVU A;  1N4L A;  3HDS A;  2DXF A;  1J5E J;  3P96 A;  3EUN A;  3FZB A;  2POK A;  4B3R J;  2A2D A;  1EHW A;  2F1F A;  2RNE A;  4PWW A;  1VI7 A;  3J7Y I;  5HP1 A;  4WKY A;  4Q0B B;  5IM0 B;  3CUN A;  4I7F B;  2RF2 B;  2MQP A;  1G4C A;  1HHT P;  4LF7 F;  1S7H A;  3DMJ B;  1WC4 A;  3TAM A;  3SV4 A;  2AMC B;  2XLJ A;  3KG0 A;  1Z1Z A;  5L39 A;  3MOZ A;  1IM4 A;  4H4O B;  2VQF F;  2EBE A;  3GII A;  3RAX A;  3W1Y C;  1HLW A;  4ED2 A;  2EC2 A;  4BC7 A;  2BW2 A;  1DLO B;  3CCZ A;  4JI2 F;  3ULH A;  1I94 F;  4FP9 A;  2IDE A;  1F9F A;  1UW9 A;  5K20 B;  2HGL A;  4J90 A;  3WZ0 A;  3OQ2 A;  1JLA A;  2HWH A;  5EWG A;  4ZDN A;  3EZ5 A;  3DC2 A;  3QRQ A;  3VTI A;  4ILM A;  3IAM 9;  5CHC B;  3BRE A;  1CBK A;  3KNG A;  2MMY A;  2ROE A;  1NUE A;  1BGX T;  1FK9 A;  1WJ9 A;  1ZET A;  4ZPV R;  2E1R A;  2EFQ A;  2FLN A;  4DOZ A;  2VBX A;  3MOJ B;  4X4N A;  3KLG A;  2DGU A;  3MGJ A;  1TL3 B;  3K2Y A;  4KHP F;  1T02 A;  2L41 A;  3VZI A;  5ETS A;  3L7O A;  1I5O B;  4GKK J;  4CT8 A;  1JLC B;  3H8Y A;  2V2Q A;  4NA2 A;  4K50 A;  4GC6 A;  2GFF A;  2ZE2 A;  1IM6 A;  4A8S A;  3MMB A;  1WOS A;  5HAN A;  3ZZU A;  2QMU B;  5B08 A;  5MAO A;  1UFW A;  4F50 A;  3NY0 A;  4ZVP B;  1VQ6 S;  2DJW A;  2YWE A;  4PRF A;  1FD8 A;  1KD1 T;  1P9Q C;  4QR2 A;  2NYH A;  3AOB A;  4O3R A;  1HNZ F;  1LQ9 A;  4RW6 A;  3H5S A;  2GS8 A;  2YX7 A;  4P75 A;  1V9O A;  2VD3 A;  3D1H A;  1RKJ A;  3C16 A;  2R7W A;  1X9M A;  1UVN A;  2DPJ A;  4DXL A;  3HSJ A;  2W8K A;  3D6H B;  5MLC V;  3GV8 B;  2RHS B;  2W25 A;  4TKT A;  1VBZ A;  4FPI A;  1RCX B;  5E3P A;  1D0E A;  4L72 B;  3BZQ A;  4EZ6 A;  2XMM A;  4F4Y A;  3I5B A;  3R2C J;  1KS2 A;  4UOG A;  5IZH A;  4WBF A;  1X4G A;  4UOF A;  2UUA F;  1UMJ A;  1NH7 A;  4I2Q A;  4N5S A;  2XB2 D;  2ZZT A;  3C15 A;  2H3E B;  2E5H A;  4NEZ A;  1HAR A;  3X1L B;  3PIP Q;  2LQJ A;  4FF3 A;  1XR6 A;  3IC1 A;  1TV6 A;  1RTH A;  1TKD A;  4KFB A;  3MMJ A;  3UR3 C;  2KHC A;  1RWK B;  5BXI A;  3T1Y J;  2ZBR A;  1U2C A;  5HVH A;  2CPI A;  1PC4 A;  2MKJ A;  4ZJO A;  1HR0 F;  2CPF A;  2G1H A;  2GJ2 A;  3C8Y A;  3M9O B;  2MJU A;  1T8E A;  1RT7 A;  1IBK F;  3VF0 B;  1WG5 A;  3FRY A;  1HL6 A;  5EHH A;  5D0G A;  1N5S A;  3EPG A;  4U7C A;  3KWM A;  1ZM9 A;  2MQO A;  2G0I A;  3SCJ E;  1FRK A;  1RT1 A;  2BOP A;  2NSC A;  2GV1 A;  4BCA A;  2J6U A;  1FDB A;  2CWX A;  1M90 T;  1RT2 B;  1UJ6 A;  1D1U A;  4OX8 A;  4RW4 B;  3E01 B;  2OLW A;  1TUG B;  1WKL A;  3QO9 B;  3LA0 A;  1U1M A;  2WHO A;  3MM9 B;  2Y8Y A;  4AUK A;  4F4Z A;  1SC6 A;  2ATL A;  2XWY A;  2CJ9 A;  1YGY A;  2DGQ A;  4QCL A;  4IUF A;  9ATC B;  4CNY A;  4NCG B;  3GTY X;  2VBZ A;  3R9L A;  3JTN A;  3IAS 9;  4JB8 B;  4ER8 A;  1WG4 A;  4OX7 A;  1SH0 A;  2EFO A;  2O3D A;  3L09 A;  5HQ8 A;  1HBM A;  3OR2 B;  3IFE A;  2HRT A;  1RAB B;  5KFE A;  4LQ9 A;  4CLP A;  3M8Q A;  2KZM A;  3KG1 A;  4FF1 A;  2UXC J;  2R7X A;  3GON A;  1VR6 A;  2VFT A;  2ZKT A;  2QYC A;  1QLN A;  1YZ7 A;  1GMW D;  2EW9 A;  5DDP C;  1WC1 A;  2EK1 A;  3V6J A;  2K3K A;  1HW8 A;  4XO0 A;  1KLM A;  1VRQ C;  3DRP B;  4DHV A;  1G1X A;  3DRS A;  2BJ9 A;  2P8I A;  4JI3 J;  3M8Y A;  3V6D A;  2I5J B;  2Q66 A;  3LPY A;  3QLH A;  5CXT A;  1SXL A;  4Z2X A;  3QMQ A;  2HPU A;  1E6Y B;  2X1F A;  3WC0 A;  1JLG B;  4CO2 A;  4NLR A;  1OJ4 A;  2NXC A;  4K4U A;  2CZ9 A;  2JEF A;  2XGP A;  4ETX A;  1SJF A;  2GW8 A;  2DHG A;  5A2Q Y;  4NZ7 A;  1YBU A;  1SIZ A;  2VG5 A;  1RAA B;  1V3Z A;  2CJK A;  4RNO A;  4ANE A;  4WFY A;  4DLG A;  4AT1 B;  3D28 A;  3OJU A;  1D09 B;  1C4C A;  2HNY B;  3O3L A;  3FSY A;  1IUJ A;  3SDE A;  2ZBP A;  3FBC A;  1S0V A;  3BKF A;  3DLE B;  1PJ5 A;  4IH5 A;  2O01 C;  4XDC A;  5BJR A;  1FKO B;  2JJ4 D;  3LP1 A;  2B7B B;  4OX9 F;  3H98 A;  4MFB A;  3V4M A;  2YPZ A;  1EET A;  5IQ6 A;  1KVK A;  2HUR A;  1HHS A;  3IGV A;  3PJX A;  5KG5 A;  2HS0 A;  2VPZ B;  2R8I A;  1KON A;  5DJB A;  2VG6 B;  2KRR A;  1JWW A;  2DRD A;  3EZU A;  3TUJ C;  2AGO A;  3GYG A;  4P74 A;  2VDH A;  2DY1 A;  1VYA A;  1J5O A;  3OHA A;  1RHM B;  4YHH J;  1S6P A;  2OUG A;  4JI5 J;  2MYF A;  3J7Z T;  5KFG A;  3CD6 S;  4J9K A;  4W90 B;  1LWC A;  2OO4 A;  1RT4 B;  4QWC A;  1JLF A;  1LXJ A;  2Q79 A;  2XNQ A;  1YJT A;  2IJR A;  3GCW P;  2UVV A;  3PHE A;  4QWA A;  1DRZ A;  1RDR A;  2QLJ B;  3V6H A;  4DV7 J;  2PFF B;  3B4M A;  2IA6 A;  3DHX A;  4PG8 A;  2YQ1 A;  3R27 A;  5LJ5 Y;  4WKR A;  1CJV A;  2V94 A;  3IM9 A;  2DR9 A;  5HVG A;  1FCA A;  4KY3 A;  2HNZ A;  1VRU B;  4LFB J;  4ED0 A;  2ZBC A;  1NJI T;  1JJ2 R;  1FKA F;  4A8F A;  2HBQ B;  3M2V B;  4QYR A;  1RP5 A;  3ILI A;  1YRU A;  4RW9 B;  3HVT A;  3LQV A;  1XC9 A;  4ZVS B;  1H73 A;  2N7Y A;  4DR7 F;  1YJN S;  2HG4 A;  3QJP A;  2QSW A;  3LO3 A;  5KOX A;  3R1L A;  3PYF A;  2LEC A;  5EX3 A;  1HYS A;  2XI2 A;  3TR5 A;  3SQO P;  4CCH A;  1I51 B;  1MW7 A;  5KFC A;  2GGP B;  2OP5 A;  1NJY A;  5HJX A;  4G65 A;  2HFN A;  1FRM A;  3TQ1 A;  4R5P A;  3HFZ B;  4KO0 B;  2ZEJ A;  4WXW A;  2V50 A;  1FTC A;  4X65 F;  3CVK A;  3D6T B;  1WEL A;  3E51 A;  4BS2 A;  2FLL A;  1Q4R A;  1BUX A;  1S7I A;  4URS A;  2E1M C;  2GMH A;  3QT8 A;  1YRX A;  5I4M A;  1RBA A;  3KHH A;  3OFE A;  4OJ1 A;  3NMA A;  4KPC A;  4Y6I A;  5LSL A;  3BM7 A;  5ADZ A;  5KFS A;  1U48 A;  2J7K A;  1WHW A;  3N6N A;  2XLK A;  1KBR A;  4JI6 J;  2PT0 A;  1VGY A;  2E1P A;  5EDW A;  1QAY A;  5KG3 A;  3NG8 A;  1U47 A;  2WVF A;  1KRP A;  2KXH A;  1JX4 A;  2ZD1 A;  1FE4 A;  2VFU A;  1N6Q A;  3MM5 B;  1JLE A;  3PW2 A;  1AFI A;  2DHX A;  4Z37 A;  2CKW A;  5HO4 A;  1LWF A;  2YPY A;  4K5S A;  3MUV P;  4OLP A;  3KYL A;  2ZKU A;  2CWK A;  3FFI B;  2OFH X;  2QV6 A;  4HH1 A;  1U24 A;  5SZT A;  5LMN J;  5ETT A;  4F4X A;  5EGY A;  5BR8 F;  1ROF A;  1WEY A;  1KHV A;  3M30 B;  4H4K A;  4C3K A;  1U8W A;  3BQ1 A;  1HWK A;  3R7S B;  1S97 A;  1NK9 A;  2Z2L A;  5C24 B;  3D6M B;  3UE2 A;  3HPO A;  2RQ4 A;  1KEK A;  5E7O B;  3M4X A;  2XMW A;  3LAN A;  5GME A;  2IC3 B;  4GVL A;  2MLX A;  2DPI A;  4NLY A;  3JSR A;  3R7N B;  1H98 A;  1C0U B;  1GMU A;  4FNH A;  1NB7 A;  2HZA A;  3TAR A;  3U1L A;  2XS7 A;  2ZHB A;  1W2I A;  1Y3J A;  3O2I A;  2F8H A;  3AHP A;  1JLQ A;  1QD1 A;  1RIS A;  3KK3 A;  3C3L A;  4DR1 F;  2HFZ A;  2I38 A;  4LFC F;  3BQ0 A;  3LUY A;  3AH6 A;  2AX0 A;  5JVG Q;  1AUD A;  2YVS A;  5I3U A;  3HF5 A;  5KFA A;  4E98 A;  1OY6 A;  4X4S A;  2WAQ D;  3UDC A;  2QL5 B;  4EEY A;  4O3O A;  3HLU A;  5SUH A;  1FKP B;  3HFV A;  3L95 X;  1HQE A;  2MHN A;  1FDN A;  1N32 F;  3IGN A;  3JQK A;  3JTP A;  4NA3 A;  5CYQ A;  4X64 J;  2EFG A;  4USI A;  2YNI B;  4WJB A;  1RLD A;  4F2R A;  3PW5 A;  1U6Z A;  2F40 A;  1WI8 A;  2B9E A;  4IFY B;  3DCA A;  5LJ3 Y;  3ET6 A;  1IKV A;  3AB4 B;  3MPD A;  2HYI B;  3NNH A;  5E33 A;  3KJN B;  5E2Q A;  2YNG B;  2HND A;  1M1H A;  3BGO P;  4IH6 A;  1X7V A;  1U4B A;  2MZR A;  2HVH A;  1H72 C;  1URN A;  2KVQ E;  1T05 A;  3TA1 A;  4C6A A;  2G1D A;  2GAG C;  2XCP A;  4NLX A;  1B70 B;  1FF2 A;  3P3D A;  4F7V A;  4DV4 J;  4YS2 A;  4GVB B;  1RCO B;  4EMD A;  1T9W A;  2VFR A;  2M3D A;  1NPR A;  3EDR B;  1RTI A;  1NJX A;  1S48 A;  3MTK A;  5KFZ A;  3H4D A;  4U8V A;  4F25 A;  2NUH A;  3C6U A;  3M32 A;  3K5L A;  2ALY B;  1B4S A;  3N79 A;  3QGI A;  2YWF A;  1Q8L A;  2XMT A;  3PRD A;  1YJ7 A;  2ZH4 A;  3MR7 A;  4ZP9 A;  1TK0 A;  2APO A;  2NPI A;  2B56 A;  1RHR B;  4B3T F;  2CAJ A;  2GNK A;  4KT0 C;  2DNO A;  5A8R B;  3UFC X;  4DV2 F;  5KFT A;  3Q8R B;  2L08 A;  1BC6 A;  1IKX A;  3MUR P;  1FVQ A;  4J5O A;  5KFU A;  2R7O A;  3TQE A;  2LMI A;  1UVL A;  4LSL B;  4LJM A;  4B9M A;  2GVD B;  4WFX A;  1CC7 A;  2C1E B;  1EAY C;  3RBZ A;  2K06 A;  2JLG A;  2NS1 B;  2GIF A;  2R8J A;  2JEI A;  1L3S A;  4OZ5 A;  2VPX B;  3BYP A;  2CQ1 A;  2BJ7 A;  4TYB A;  2V8H A;  2XS2 A;  2HHH J;  3AJ1 A;  4MK9 A;  3O8W A;  1RKI A;  2VZ9 A;  3QJL A;  4QPT A;  3GIJ A;  5GAE I;  2YNF A;  2R7Q A;  4JI0 J;  3POT B;  2B8P A;  3NRB A;  4UT4 A;  4DR4 F;  2V2V A;  2LFV A;  3NLC A;  5DG8 A;  1QY7 A;  1NH8 A;  1VK8 A;  1XNQ J;  3SV3 A;  4DV5 F;  1FK9 B;  3HSD A;  2B4V A;  1JKH B;  4U96 A;  3WC2 A;  4C48 A;  2JEJ A;  4NEY A;  4DX6 A;  1UFK A;  4ID5 B;  5D0H A;  2GVZ B;  3OTO J;  5K14 A;  4RUH A;  2BW7 A;  3MCM A;  3DLG B;  5DDQ C;  2VQE J;  2UXB J;  4PQU B;  2PEH A;  4K4X A;  4CM2 A;  4USU A;  2MKK A;  2D9O A;  2W9B B;  1FD2 A;  2MZT A;  2NZC A;  1KWM A;  2MST A;  4LF9 F;  6FD1 A;  3NWG A;  1N36 J;  5E0O A;  3W61 A;  2K8G A;  5KG1 A;  2R3V A;  2ATC B;  3UN2 A;  4GC7 A;  1RT5 A;  3K5M A;  1R0A B;  3W8P A;  1V3S A;  1RT6 B;  3WQP A;  4ZPT R;  4UTG A;  1Q81 T;  2DXD A;  2R7U A;  1MU2 B;  3DI6 A;  4MYT A;  2FUG 9;  1AA1 B;  2JWN A;  1U1L A;  3KLF B;  2VFV A;  1KQF B;  4RW6 B;  3FQL A;  2W4P A;  3M6W A;  3S01 A;  5M2U A;  3AXM A;  4O3S A;  4U9R A;  2EFV A;  2UUT A;  1IKY B;  2IM3 A;  1TK5 A;  4LF8 J;  1MWZ A;  1MN9 A;  4J9N A;  1N5Y A;  3OTE A;  2CQB A;  3BF4 A;  4NLP A;  1JNZ B;  1LV5 A;  2OEL A;  1VJQ A;  4NLW A;  4UY8 T;  4QW9 A;  5IC6 B;  1NK0 A;  3MPY A;  3CE8 A;  5J2M B;  1OQ3 A;  3CCT A;  1Q86 T;  1GX6 A;  2ZH7 A;  1SJ3 P;  4AL5 A;  5ETL A;  5KFR A;  1TR0 A;  1SPB P;  2B6A B;  1N48 A;  3NEK A;  1MML A;  4I2Q B;  2DEJ A;  4CTA A;  3I6P A;  3RRK A;  3PR5 B;  3MED A;  3ZFV A;  3EJM A;  1GXL A;  3CDE A;  4LSN B;  4X84 A;  1YZ6 A;  3A8I A;  1LW0 B;  1RTH B;  2CG8 A;  2ZJQ Q;  5JMN A;  1DQ9 A;  4C0H A;  2V0N A;  4WU2 A;  3CD0 A;  4R0J A;  2PN6 A;  2HQG A;  2DR8 A;  2F5G A;  3CF5 Q;  3TNV A;  3Q8V A;  2DH8 A;  4LT6 A;  1RT7 B;  2CNO B;  2CPH A;  1K8A T;  1NB2 A;  2FVS A;  3HHL A;  1EX8 A;  2YKM A;  1S1T B;  2R2U A;  1QE1 B;  5DQG A;  3PG9 A;  4A47 A;  4DDF A;  4PWD A;  3JSY A;  3P5B P;  1MG7 A;  3MPU B;  3P4U B;  4DV0 F;  4F0H A;  2DGO A;  1AYE A;  4RNH A;  4P2S A;  2CNK B;  4IKA A;  1YG0 A;  2HWI A;  5J1E A;  2E5G A;  1K1Q A;  1N88 A;  4NPO A;  4I2P B;  2R7R A;  3AAW B;  2IVF B;  2HEK A;  4KBI A;  2DIS A;  4EO8 A;  2GQ2 A;  1IBC B;  5F3Z A;  4ZCL A;  3NGD A;  4NRU A;  4B9V A;  4WYW A;  3Q23 A;  3EYZ A;  1NHK L;  4ED8 A;  1YJU A;  1NKC A;  4RW7 A;  4OFZ A;  3LP0 A;  2BKP A;  1NO8 A;  2N3L A;  5IT9 Y;  4I4B A;  3THV A;  1Q82 T;  2BAC A;  2MQN A;  4U8Y A;  2WVC A;  1V3R A;  4AND A;  2OJ3 A;  4LF6 J;  4FDF A;  3NBP B;  4LR9 A;  1TVR A;  9RUB A;  3KLI A;  1VBX A;  4A8Y A;  1F2G A;  2HGM A;  2GJF A;  1XN9 A;  3CED A;  3DU5 A;  4ZP6 A;  1RAF B;  4X66 J;  3QYY A;  3RG6 A;  1KTQ A;  4IFV A;  3B4D A;  4IO1 A;  2JHE A;  3DGP B;  2KKH A;  2GO8 A;  2J0W A;  1YJW S;  2A6M A;  4ZVH A;  4J9Q A;  2KU7 A;  4BDP A;  5G0R A;  4QPX A;  3K0J A;  2L3M A;  2Y3Y A;  1QJH A;  5B0D A;  4DUZ F;  1CPZ A;  5KFK A;  4NRT A;  1CJU B;  1QUV A;  2GQQ A;  1Q8K A;  3BN7 A;  5ETN A;  4UQG A;  4ZK7 M;  3HFK A;  2A1B A;  2WON B;  3V6K A;  2C2E A;  2HLU A;  2D3O 1;  2ZH9 A;  1BQM B;  2IRY A;  3W9J A;  1R8A A;  2UP1 A;  2YWW A;  3LOU A;  2RB7 A;  2J5A A;  1QDU B;  5I42 B;  1U7L A;  1LEO A;  3KLE A;  2MB0 B;  4ZKA A;  1VJW A;  1QSS A;  2ASD A;  2RU9 A;  4EFA C;  5KG6 A;  2ZWP A;  2GHV C;  2F4F A;  2E5J A;  2WVB A;  4NLG A;  1RAC B;  1RBL A;  5KT3 A;  1SV5 A;  4IG3 B;  2CDQ A;  3DNC A;  3S8S A;  1HW9 A;  5KT6 A;  5CA5 A;  1T03 A;  2HHS A;  1Y10 A;  1QTM A;  1AXQ A;  2FJX A;  5ETV A;  4ZJQ A;  3ZZ0 A;  4AE5 A;  4KB7 A;  1FJG F;  3QID A;  1IR0 A;  2KT3 A;  1EQM A;  3OV7 A;  3MM6 B;  2QSF A;  2KI2 A;  1T9U A;  3EM1 A;  1RSC A;  3LP2 B;  4DL6 A;  2ACY A;  1WSV A;  1F3F A;  3OUY B;  4TLR A;  4LFA F;  5L9X A;  3T5H A;  4AQY J;  2C2O B;  3V81 A;  1NHV A;  1PBA A;  1GMV A;  3MMC B;  4G6V B;  1R8H A;  3MEC B;  8RUC A;  1UCN A;  2CQ3 A;  5E41 A;  1NEE A;  4FYV B;  2A0F B;  2XZD B;  1R3N A;  1HWI A;  5HL7 Q;  4RUC A;  4R8U B;  2XYH B;  3EZO A;  3AD7 C;  3GZ7 A;  3B82 A;  2DKO B;  1JLF B;  2YNH A;  2C22 A;  3BR8 A;  3MEE B;  2CXE A;  4IR9 A;  2G0J A;  4C2M A;  2NPF A;  1PJ6 A;  2GO9 A;  3KK1 B;  4Y2K A;  5L1L A;  3W8G A;  5F8I A;  3B78 A;  3EGV A;  1FI4 A;  3DM2 B;  3LWL A;  1LFW A;  1HNI A;  1UEK A;  3IN5 A;  4Q0B A;  5IM0 A;  3PVX A;  4I7F A;  2RF2 A;  4BWM A;  2OPR B;  4BHQ A;  2AYG A;  4DV1 J;  1PAU B;  1RWN B;  2KFZ A;  3DMJ A;  3J81 U;  4MIA A;  4ZA1 A;  5IOL A;  2MZJ A;  1K9M T;  4FYW B;  3T19 A;  1KC8 T;  4H4O A;  5A76 A;  1T9Y A;  4AYB D;  3W60 A;  2AJ4 A;  2QE5 A;  4IOC Q;  3EWG A;  4WF9 Q;  4ILL A;  3D7S B;  1Q95 G;  5L9N A;  3RB4 A;  2XWX A;  2FVP A;  1UWA A;  3PAC A;  3MR6 A;  2HVE A;  1BY9 A;  2C2K B;  2IM1 A;  3OSP A;  4ES1 A;  3KHL A;  1HYS B;  1DLO A;  4KIA A;  1KDN A;  1NSP A;  2FJA B;  3MAA B;  3D2W A;  2KB2 A;  2JLF A;  3SEO A;  4YDX A;  1AB8 A;  4HLB A;  3VAF A;  3CME S;  4Y2A A;  2ZVI A;  2V8V A;  2ZFH A;  4N47 A;  2DRA A;  4OZ0 A;  2RIL A;  3M05 A;  1REV A;  2M0G B;  3CIZ A;  2FHM A;  3BV8 A;  2SXL A;  4JI4 F;  3H42 A;  4DQQ A;  4B17 A;  1SBR A;  3VCD A;  4GO5 X;  1CQM A;  5FDL B;  2GC8 A;  1VQM S;  3QGG A;  1Y00 A;  2JOQ A;  2GQC A;  4USH A;  4LVN P;  4DR6 F;  1P8G A;  3PKM A;  5GMD A;  1UTA A;  1OYD A;  2K2P A;  1NLK L;  3OTB A;  1H74 A;  3CO0 P;  5KFB A;  1HNW F;  4JI8 J;  1GXU A;  1TL3 A;  2ZD1 B;  3PCO B;  2DK2 A;  3W5Z A;  4CLT A;  1RTJ B;  1FRL A;  2OSQ A;  1JLC A;  4B3S F;  2I1R A;  4MIB A;  1WC0 A;  4NI2 B;  4URQ U;  2VOP A;  4C4W A;  4U67 Q;  2DR7 A;  3G71 S;  2PA3 A;  5D15 A;  2VL1 A;  2FHJ A;  4CZC A;  4M95 A;  4ZVQ B;  3PJW A;  2F4V J;  3MEK A;  1Y5N B;  2GA7 A;  4HEA 9;  4USW A;  4ZLP A;  4K2J A;  1N56 A;  1Q7Y T;  1TAU A;  5DO2 A;  2KM8 B;  1SQG A;  2F9J A;  2YX1 A;  4Y34 A;  5B0F A;  4CWB A;  3QIP A;  4NXN F;  2OPS B;  4BC9 A;  3IWX A;  1P9Y A;  4DQI A;  4NMX A;  3N5B A;  2VB6 A;  4QW8 A;  2AEF A;  4CYU B;  1VHF A;  3CCS S;  3FMW A;  3VHQ A;  4B3O B;  2MQQ A;  2CNN B;  2D7S A;  1R6Y A;  2M2B A;  2EKY A;  2QEX S;  3H90 A;  5KFF A;  1T9V A;  2B4U A;  4EBD A;  2Q1L A;  5FLX Y;  4ITS A;  2VDI A;  5L1K A;  2OSR A;  3V2U C;  1Q1K A;  3UN3 A;  4K8R A;  3SIP B;  1RZM A;  2GJI A;  4K0K F;  2BRL A;  1SC4 B;  3KK3 B;  2H51 B;  4C3L A;  4EGL A;  2MHE A;  3BBB A;  3FJ2 A;  4WYL A;  3HHN B;  3WBZ A;  3RW7 A;  4CLW A;  2PD1 A;  4TVA B;  4HR2 A;  5M2P A;  1N5V A;  5D4N A;  2QLF B;  2JSX A;  3MD3 A;  4LSZ B;  4ETZ A;  4C8L A;  2RS2 A;  2IBK A;  1M1G A;  1WG1 A;  4WFA Q;  2AJ1 A;  1OIA A;  2F65 A;  4CO1 A;  2VAS A;  4H54 A;  4XTT A;  1FNM A;  3EPI A;  1XMO F;  3SQG B;  3MPV A;  3KLH B;  3FCH A;  3KJV A;  4LF4 J;  3H0P A;  3H4B A;  4F3O A;  1HR0 J;  3CSK A;  3JXO A;  2DEI A;  4AL6 A;  2ERR A;  4RU9 A;  4DZ6 A;  2YH0 A;  2I9S A;  3MF5 A;  2D69 A;  3GYX B;  1T9T A;  4YB1 P;  3CCL S;  3ETO A;  5J1N A;  4GMK A;  1T3N A;  4KHM A;  4C9D A;  4OHZ A;  2ZH5 A;  4KGX B;  2W2P P;  3VAH A;  2HHX A;  4ZP7 A;  3IBW A;  3ET6 B;  3CCV S;  2UU9 J;  1RT2 A;  2V2K A;  4DN9 A;  1CC8 A;  2EBG A;  4OZ3 A;  3GFX A;  2OKQ A;  4E0D A;  1PYO B;  3IBF B;  4RW4 A;  3UCZ P;  2HND B;  3E01 A;  3CCQ S;  3P45 B;  1RAH B;  3QO9 A;  2RML A;  3BO4 A;  3MM9 A;  5K8M A;  4ZS6 A;  5E3R A;  4LRC A;  4F67 A;  1Y0H A;  4C8O A;  2R2R A;  2QG9 B;  1B0V A;  2ASY A;  3R1H A;  4HH0 A;  2AJQ A;  3RB6 A;  3PYG A;  2B9Y A;  1Q53 A;  4NCG A;  4U7U K;  1PG5 B;  4YQW A;  4TN2 A;  2PMZ D;  4K4Y A;  4FKX A;  2MJN A;  4TNO A;  2MQM A;  1X4F A;  1SUQ B;  4IDK B;  5D8H B;  3FRZ A;  1J5E F;  3ZTR A;  4TXS A;  2XHC A;  5M2R A;  1UW4 A;  4B3R F;  2JH3 A;  2ZWO A;  5H9E J;  4URG A;  1KQG B;  3M1V B;  2BE9 B;  4FNI A;  3O44 A;  4WZM A;  2CVI A;  1R8B A;  3DRP A;  4DZD A;  1RWU A;  4CM0 A;  4L3K A;  2PDA A;  4HTI A;  1ARO P;  2I5J A;  2Y1R I;  4E2F B;  1VHI A;  2OML A;  1H3D A;  1E6Y A;  2P2C B;  3O5T B;  2FLO A;  1AW0 A;  1JLG A;  4LMZ A;  2XMJ A;  1NK8 A;  1Y7P A;  3CCJ S;  2AWZ A;  3QAU A;  5D4O A;  3AA8 A;  2R7S A;  1S0O A;  1NME B;  2OAU A;  3HCX A;  3GJS B;  3F0N A;  5T41 A;  2FGC A;  3CJ4 A;  3S7R A;  2CYY A;  4IR1 A;  2UUW A;  5HN0 A;  1L3U A;  3MM8 B;  3GSI A;  4ICL B;  4EWT A;  4OHX A;  4YB5 A;  2B5J B;  2DGT A;  3LAK A;  2RQK A;  2RD5 C;  2XSJ B;  4Q45 A;  2DNH A;  2MKI A;  3DLE A;  4C8N A;  4RLE A;  1FKO A;  3MCO A;  1YQH A;  3A3O B;  2ZH1 A;  1B3T A;  5C2C A;  4LBH A;  1U1Q A;  1XMQ F;  2J7W A;  1NDL A;  5A8K B;  4LRF A;  8ATC B;  1NZA A;  1FEE A;  1N0V C;  2VG6 A;  4WPA A;  4RNF A;  4F3Q A;  2E7X A;  4X4Q A;  4GKK F;  1VC6 A;  3DOK B;  4DU8 A;  1RBO B;  4HHH A;  1GK8 A;  4ECS A;  1U45 A;  3VQT A;  1RT4 A;  3ICL A;  2ZH8 A;  1GT8 A;  2ASJ A;  1DFD A;  4FS2 A;  4ZVF A;  3PYD A;  1FJE B;  5DQI A;  2R9L A;  1U1N A;  1ZPW X;  1NJZ A;  2NXE A;  3BN4 A;  1NSQ A;  3BDE A;  2DRB A;  2HZC A;  2UUC J;  3RB0 A;  4PG7 A;  4PR6 A;  1N5Y B;  2P9E A;  4C8Y A;  1N33 J;  4DN0 A;  3R97 A;  1GX5 A;  1VRU A;  2BVZ A;  3VAK A;  1ZAW A;  3ZXW A;  3PJ9 A;  3JAM Y;  3NGR A;  4ED7 A;  4KRW A;  2HHP A;  3GR1 A;  2OEJ A;  4DUY J;  3G2X A;  2GMJ A;  3W3S A;  4RW9 A;  4EBC A;  3VR1 A;  2KJV A;  1TKX A;  2O1P A;  3LW5 C;  1BQX A;  4IYQ A;  2W01 A;  2ZC3 A;  4BWJ A;  4CTA B;  3MED B;  1B0T A;  1RAJ A;  3FSX A;  3X3U A;  3MM7 B;  2ADB A;  1UP1 A;  3OD2 A;  3QZ7 A;  4KO0 A;  2QC3 A;  3AQO A;  4KPY A;  2CJB A;  3BKU A;  3HVW A;  3PX6 A;  1M5P C;  3U1N A;  3T1Y F;  2IMO A;  2QL7 B;  1IXK A;  3EGN A;  3CCW A;  2XM3 A;  2AIR B;  3QT6 A;  1S49 A;  3GIM A;  4O0I A;  3GLJ A;  2RRA A;  2QA1 A;  2QA4 S;  2QGF B;  3QRR A;  1HKA A;  4KGM A;  1C1B B;  2YKM B;  2LVW A;  4ZVG A;  5CZV A;  4UQT A;  2XTJ P;  4AL7 A;  2HAF A;  2J8S A;  2C2M B;  3MM5 A;  5BYS A;  4ATN A;  4QBU A;  4OJ3 A;  1GMW A;  1WWH A;  2XZT B;  3CUL A;  2DGX A;  1S4E A;  4L75 A;  2QIF A;  1NSK L;  1X4D A;  1X4E A;  2BOA A;  1JK9 B;  4PG4 A;  3FFI A;  1B0P A;  1A6L A;  2HFV A;  2JC1 A;  3HJF A;  3ITH B;  3RUB L;  3MWB A;  2W7P A;  2NXN A;  2A3J A;  1V6H A;  3R5B A;  2C42 A;  1TTH B;  2VOO A;  2ASL A;  2KT2 A;  5CQG A;  1PJ7 A;  1JLB B;  5L46 A;  4OI0 A;  4QU7 A;  3M30 A;  4LVO P;  2JVO A;  4ZPD A;  5BR8 J;  1SKR A;  3ISZ A;  1VCT A;  4F02 A;  2V8P A;  3HSG A;  2LQ5 A;  1WF1 A;  1OSC A;  3HMJ G;  2P9C A;  2IRX A;  5FD1 A;  3DLK B;  1VQS A;  2IHR 1;  3TO8 A;  2HQC A;  2J6T A;  3SI8 A;  2IC3 A;  4OI3 A;  4ECY A;  4EZ9 A;  1UWB A;  3T5J A;  1YJV A;  3HHK A;  2RRB A;  1F60 B;  3MHY A;  3BQ2 A;  1C0U A;  4DV6 J;  2W9C B;  4PPZ A;  3WIV A;  3BGR B;  2R4F A;  5D4L A;  2UXC F;  2VA3 A;  4ZJL A;  4WP3 A;  1DAR A;  1KSP A;  4WIQ A;  1MSW D;  1B7Y B;  5C2G A;  3GV5 B;  2OHD A;  5KG4 A;  5J2N A;  4FPR A;  3I5C A;  4M8L A;  1K1S A;  3CB4 A;  1RA6 A;  1HQ2 A;  5KT2 A;  2FHJ D;  3PX4 A;  4F3M A;  1DTQ B;  4C0B A;  1Y5L B;  3PEH A;  2DIT A;  4RO0 A;  4JI3 F;  2O66 A;  1V5V A;  5FJ4 A;  4R0E A;  5D77 A;  3HO1 A;  1REG X;  3NS6 A;  1TKZ B;  3UO0 A;  3N9U C;  1IKW B;  2DR5 A;  4EO6 A;  1M5V C;  1VIX A;  1NKB A;  1FKP A;  3TZW A;  1C1C B;  3EIC A;  4KSE B;  1SKU B;  1QTN B;  4QWD A;  3RR8 A;  4M5D B;  3P8B B;  2MEW A;  5HLF B;  2YNI A;  4DSF A;  3S1T A;  4RW8 B;  2C2N A;  3LGH A;  4UW2 A;  2AZ1 A;  4O4R A;  4CLU A;  2XSF A;  3RR7 A;  2RUG A;  2UV8 G;  3ZZO A;  3CNQ P;  4DCJ B;  4DFJ A;  4OHW A;  1DAX A;  2YNG A;  1IR2 A;  2CZ4 A;  3TYT A;  2FHO B;  4V19 X;  3DDI A;  3W5Y A;  1UFL A;  2LQ8 A;  3T1H J;  2WVE A;  1VRT B;  2XMU A;  3JQM A;  2WSC C;  3AD9 C;  1XBW A;  3V81 B;  3NNA A;  3C6T B;  4ZPC A;  2F63 A;  4GVB A;  3HT0 A;  1JQG A;  3JSM B;  3JYT B;  2HWT A;  2KG1 A;  4J9R A;  3EMT A;  1JXV A;  5THW A;  4ECU A;  4JI5 F;  4U95 A;  1RTZ A;  2YNH B;  2KL8 A;  2DGS A;  1FXR A;  4NLU A;  4OZJ A;  1NPK A;  2DVI A;  1FVS A;  1RAD B;  3HT3 A;  1CSJ A;  1HIY A;  3BGL A;  1VQ5 S;  3HUL A;  4P52 A;  2XS5 A;  1ZBT A;  3MFI A;  1S1U B;  2FJB B;  4L3N A;  4DV7 F;  3MAQ A;  3OLA A;  4KE5 A;  1HNI B;  3NAI A;  2IJF A;  3ZZP A;  1S79 A;  3CC4 S;  2PII A;  3IP0 A;  2U1A A;  5A8R A;  1RWM B;  2YQ3 A;  1WDD A;  1OWX A;  4LFB F;  4HTJ A;  2VV5 A;  2JLE A;  4JV5 J;  3EVW A;  1TL1 A;  1Y4Z B;  4LSL A;  2GVD A;  3IR5 B;  4M5G A;  1L5U A;  3TUP A;  4HVZ A;  1Q8I A;  2CQ0 A;  4KYZ A;  3OXG A;  4P72 A;  2Y1J A;  2IJN A;  2AJ2 A;  4DX8 H;  1X5P A;  2B4O A;  3KHR A;  2QL9 B;  1LKZ A;  1U2R A;  2AGP A;  4KGZ B;  3GJR B;  5AE2 A;  4YR3 A;  2XCA A;  3NCP A;  1WKK A;  4H4K C;  3POT A;  3J81 j;  2ZZM A;  1SVD A;  1IBL J;  3T5K A;  2VIC A;  1YIT S;  1P1L A;  1D8Y A;  1NK4 A;  2DGV A;  1REV B;  1RTD B;  1ELO A;  1JKH A;  1PGZ A;  4TU9 A; 
#chains in the Genus database with same CATH homology
 4JI5 J;  2UU9 J;  4V1A k;  4DV6 J;  1J5E J;  4B3T J;  4JI1 J;  5A2Q U;  3D3B J;  5LMN J;  4DV2 J;  4DR6 J;  4DUY J;  4DR7 J;  4DV4 J;  1FJG J;  4DV5 J;  4HHU A;  4DR3 J;  3R2D J;  4B3R J;  4AQY J;  2MQ8 A;  5IT9 U;  4X62 J;  4JI2 J;  1I94 J;  1HNW J;  2UXD J;  2HHH J;  4JYA J;  1IBM J;  1N34 J;  4PWW A;  4JV5 J;  4LF9 J;  4DR1 J;  4DV7 J;  5LM7 E;  2F4V J;  4LFC J;  4DV0 J;  4LFA J;  5IWA J;  1HNZ J;  4JI0 J;  4DR5 J;  3D3C J;  3T1H J;  3J7A N;  2UXC J;  4B3S J;  4YY3 J;  2MTL A;  4X64 J;  4K0K J;  3R2C J;  1XNR J;  1IBK J;  4KY3 A;  1XNQ J;  4RJV A;  4X65 J;  3IMQ J;  4LFB J;  4LF8 J;  4LF6 J;  4KYZ A;  4JI6 J;  4DV3 J;  3J80 U;  4GKJ J;  4NEY A;  4LF4 J;  3W1Y C;  5LMU J;  4B3M J;  1HR0 J;  4GKK J;  5BR8 J;  1XMQ J;  4DUZ J;  1N32 J;  4LF7 J;  2ZM6 J;  4NEZ A;  3OTO J;  4DR2 J;  4DR4 J;  2UUB J;  5FLX U;  2KL8 A;  4JI7 J;  2E5L J;  4JI3 J;  3JAM U;  2UUC J;  2MEW A;  4X66 J;  4DV1 J;  1IBL J;  3J81 U;  2VQE J;  2UXB J;  2UUA J;  1XMO J;  4JI4 J;  4NXN J;  4KHP J;  4JI8 J;  4LF5 J;  2VQF J;  1N33 J;  4OX9 J;  2KVQ E;  5AJ3 J;  4NXM J;  1N36 J;  1HNX J;  3T1Y J;  4YHH J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...