4X62J

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4x62J00
4JI4J 4RJVA 5AJ3J 4DUZJ 2KVQE 4DV1J 2VQEJ 4KY3A 2HHHJ 4JI2J 5A2QU 4LFAJ 4LF4J 4DR5J 4DV2J 2MQ8A 2KL8A 5FLXU 1XNRJ 1J5EJ 3OTOJ 4DV3J 5IWAJ 4DR3J 2MTLA 4B3RJ 4NXNJ 5LM7E 2UUBJ 4JI8J 1IBLJ 1FJGJ 4JYAJ 4LF9J 4B3MJ 2F4VJ 4DV0J 4JI0J 4JI3J 4DR2J 1HNZJ 4JI1J 5LMUJ 1XMOJ 2UU9J 4KYZA 4DR1J 4GKKJ 4DV5J 4YHHJ 4NEZA 1IBMJ 4DR7J 3D3CJ 1N34J 2UUAJ 3T1YJ 4V1Ak 2UXBJ 1XMQJ 4JI5J 4JI6J 2E5LJ 4JI7J 4YY3J 4JV5J 2ZM6J 4DUYJ 4LFBJ 4K0KJ 4X66J 3T1HJ 2UXDJ 4DV7J 4LF7J 4NEYA 3J81U 3IMQJ 4LF6J 1XNQJ 1HR0J 4LF8J 4LFCJ 4B3TJ 4PWWA 5BR8J 1HNWJ 3J80U 4DV4J 4X65J 3J7AN 1N36J 4LF5J 1I94J 1HNXJ 3R2DJ 3D3BJ 4NXMJ 4HHUA 3JAMU 1N32J 4X62J 4KHPJ 3R2CJ 2MEWA 4X64J 4B3SJ 1IBKJ 4GKJJ 4DR6J 1N33J 4OX9J 2VQFJ 4AQYJ 5LMNJ 2UXCJ 3W1YC 2UUCJ 5IT9U 4DV6J 4DR4J
chains in the Genus database with same CATH superfamily
3LH2S 4LSZB 1TMJA 1EETB 2ZH6A 5HMWA 4P7TA 3ZFVA 3OVAA 1T94A 3B4DA 3ISZA 1SJRA 4DV2F 3PVXA 1RP5A 2KU7A 1J5EJ 2FGCA 1U1RA 4RLEA 1VFJA 1HD1A 3SEOA 4B3MJ 2R42A 5KAKA 4KC5A 4LSLB 1LW2A 3P4UB 3W2VA 4MJKA 4OI2A 4DCJB 3RR7A 2G0CA 4GC7A 4O3SA 3G82A 4RBUA 1NUEA 4ED3A 5DDPC 3ISND 1UWAA 1RTJA 3RBEA 4KGZB 4FS1A 3FBBA 2WSFC 3KK3B 3M32B 3K58A 1RTDB 5B0CA 5L1LA 1CEZA 1WF0A 5M2RA 1WHYA 4X4VA 1REVB 5HVGA 3QZ7A 4ZLPA 3BB5A 2DNPA 2HQGA 1KQSR 1XC9A 2AX0A 1T0TV 2MQOA 3NGUA 4OZJA 8AT1B 4CO0A 3P5TL 2WHOA 5CZVA 2VL1A 5IFMA 1EARA 4LRBA 1KFSA 4DL4A 2GVDB 4F2RA 4B02A 1WI8A 4P72A 5KG6A 3DHWC 3MCMA 2F9DA 3CJKB 2GQQA 4DR1J 1ZM9A 3FVYA 4NEZA 2KXNB 2ZJPQ 2OFHX 3BYPA 2RUSA 5HANA 2C1EB 1WNEA 4K59A 2PMZD 5A8KA 5FJ4A 4Q45A 4OX6A 4ENOA 3KJNB 5ETSA 3TOQA 2CJQA 4DUTA 1WHWA 2VIHA 1WJ9A 4HDGA 3BR9A 3MI7X 2EG2A 2O67A 2WB4A 3BPSP 1U6ZA 3THPA 2MGZA 1RK8A 4G1QA 3LGHA 5D78A 2XS5A 3FQLA 4KSEB 3I32A 4DX5A 1Q8IA 5J1NA 2RAQA 3CJ8A 4ATNA 5J1EA 1IBKF 3GYXB 2G1DA 2G4BA 4YB6A 4UT4A 1HI8A 5EWGA 4C48A 2VFRA 1GEHA 5E2QA 1K9MT 2OKQA 1TKZB 3P45B 2IVFB 1ZAVA 2ASYA 1TTHB 1YZ7A 5EN1A 3ADAC 5ETMA 3MECB 3DOKA 1S1UB 4EZ6A 4I64A 2EFNA 2BBEA 4UOFA 5FIIA 3Q23A 5CYJA 2VFSA 2WVBA 3BSCA 4FPRA 2OEMA 2W2NP 4DSIA 1WUUA 2GQCA 3SDEB 3E01A 4F4AA 2VFTA 2ADCA 4IDKB 1NK8A 1Y5IB 3O2IA 3M8QB 3D0HE 2QRRA 2DEJA 4TQSA 3MCNA 2MQQA 3CDUA 3IGVA 4WYWA 4B3TJ 4MK8A 1GAOA 5D77A 3JYTB 1GK8A 2R7XA 2EC2A 4JUZA 1JLBB 1REGX 3FSYA 1GMUA 5D0EA 2CG4A 2ZE2A 2VBZA 3I9ZA 3SCIE 2C3UA 2UVVA 4J9SA 3AY0A 1F9HA 1NMEB 2A6MA 4ZN3A 5CQGA 2BANA 4EK2A 4QZVB 5GAGI 3BZQA 1RGVA 2FTRA 2HQIA 3O6QA 2CQGA 3M9NB 1W25A 1WOSA 5J2MA 5G0RA 4WFYA 1IR0A 4ZP7A 2HBRB 4MKAA 2ADBA 4DOZA 1RBLA 4ETXA 1VI7A 2R2RA 5A8RB 3CCJS 4XO0A 1RT7B 5GAEI 2NUHA 2COLA 4LSNA 3PW5A 1S49A 2GO8A 1UVIA 2IC3B 1HW8A 2ATLA 2VD3A 1NJZA 5KFKA 3IC1A 4PR6A 1J27A 3FRZA 3O5TB 3OTEA 1UVNA 4IH6A 4ZP8A 2M70A 2ZHAA 4N77A 4OIXA 4R25A 3AH6A 4GKJJ 4OL8A 1QLNA 2B4VA 5L9NA 5C25A 1NZ8A 1UMJA 1Q86T 1Z2LA 2HQ3A 2CFXA 2KVQE 4LVNP 3CO9A 2HHHF 2JC0A 1N48A 3R7BB 2J8AA 3H2UB 1KOHA 1SC6A 1TKDA 2HBYB 1N0UA 1NXIA 2V34A 3GG1A 4PQUA 5KFFA 1ELOA 1VRQC 2RQMA 1GX5A 3D1HA 2YKQA 2Y1LB 2KVIA 3KK2B 1JNRB 2JVOA 1XMQJ 1W26A 2HYIB 1JB0C 1QSYA 4K0KJ 1HNZF 1EJ7L 1HWJA 3UDVA 5AXMA 5LXYA 1KOOA 3MMCA 3MEGA 3ZZRA 5B0EA 3MR7A 3R2DJ 2IM0A 3UD4P 1SUQA 3W3SA 2KH9A 3POTA 1NDLA 3GFZA 1VIXA 1FX4A 3NEKA 3OR2A 4KAIA 4OX9F 4RX6A 4F25A 3OT9A 1QDUB 1HIYA 1LW0A 2C2ZB 1NKBA 1AZSA 1D3WA 1JXVA 1KWMA 2B5JA 2B9YA 4KY3A 4OYZA 3HHLA 5LOQA 1VC5A 4HR2A 2KG1A 3GJRB 2QLBB 4CO5A 4GVBA 1BE4A 2KDOA 5KFDA 2Y0SD 5IT0A 3Q86A 5DRKA 2ALZA 3PW2A 3U1LA 3PW4A 3SI8A 4JI6F 1RT5A 5CABA 4EFAC 4H4MB 4I7FB 2UXDF 2HNYB 1JQGA 3RBXA 2IM2A 2E44A 2HHWA 2I5JB 4RNNA 3Q8PB 7FD1A 3M6XA 1M5VC 2NQPA 1R8PA 5A6PA 3CTRA 4FZVA 3PO5A 3OR1B 2VB6A 3TRGA 2AP6A 2KFZA 3D9BA 2CJXB 2CJBA 3RB0A 3Q0AA 4B3OB 2ZKTA 1Q7LB 3TA1A 1VJQA 2Y1RI 4MKYA 4YN3B 2C22A 4B3RF 2AJ0A 3MM7B 2UUBF 2NZ4A 4RW7B 1HWLA 4NMXA 3M6VA 3JQKA 3CPWR 3FGVA 1GTHA 2DIVA 1IJEB 3H5YA 3K8WA 2F7VA 4MH8A 4JI5J 3SQGB 1NB7A 4ZVOB 3T41A 1DLOB 4X66J 3PW0A 4DR1F 1UA1A 3H5UA 1FI4A 1UFLA 3FEXB 3RRKA 4RO0A 5ETKA 3C66A 1HNXJ 2RU9A 1N32J 2HHUA 4EO8A 4FVCA 4RNHA 2AZ1A 1KQFB 4FPIA 1KLMA 1S99A 2HHPA 2FVCA 3T5JA 2WVFA 5F3TA 2HHSA 2AGOA 2N3LA 3DRXA 3DFEA 2LU1A 4I2QB 2IBKA 1C1BB 4IG3A 2G2YA 4J9RA 2FVQA 1VLOA 2HS0A 1NDCA 4DV3F 4I4BA 5KFTA 3GLJA 5I3QA 3RRGA 2HRYA 2EFPA 4R0EA 4BBYA 4ELTA 3QLHB 5HBMA 5LSLA 1NJXA 3KDNA 4DV5J 2BJEA 3CE8A 2QSFA 5A8WA 4X4UA 1CJUA 2UXBJ 1QE1B 2E1RA 3SIPB 2EC0A 4DL7A 2BA9A 3LP2B 3TA0A 3IM8A 1O0PA 1QTNB 2D3O1 5KT2A 1SV5A 3WIUA 2CPIA 3L9ZA 1KQGB 2YWWA 2RD5C 4DQQA 2XY7A 5KFVA 2R8KA 2CPJA 1CS4B 4DCOB 3ILJA 4N41A 3KHLA 3GR0A 1WC4A 3OJUA 4R8UB 1HI0P 3H7HB 4K2JA 3ZO7A 2OPPB 2BJDA 3BS9A 1UA0A 3QO9B 4WTYA 2YWGA 1RA6A 3OPKA 5FDLB 4N8OA 3EVMA 3VGTA 4J37A 1PKUA 1X9SA 4TYBA 3ITHA 3AODA 2IMOA 3A13A 1SQGA 3MFHA 4TQRA 4PZVA 1E6VB 3ZZYA 4I69A 3BBFA 2CPXA 1AFJA 4FBUA 4OHVA 3PRVA 2GZOA 2H5JB 2VOPA 1T03B 2HZCA 4OMFG 1S6OA 2R8HA 2Z0GA 4NLOA 4DUYJ 4YB1P 2GJ2A 1F5CA 3M8PB 1VC6A 2HNZA 4QYZK 2CIMA 4KO0A 3R6GB 2MPUA 3NCRA 2CJKA 2MY8A 3I0SA 3JAMU 4ZDNA 5A76A 1T7PA 1VISA 2DY1A 1U25A 5E5NA 3CJSA 3KLFA 4Y2MA 2H5EA 3LTOA 1JJ4A 4C0BA 1PO6A 1Z2ZA 4AFFA 4B9LA 2CXEA 2XO6A 3N5BA 4HACA 4AYBD 1OSCA 3NLCA 1F5BA 4LF4J 4GKJF 1SKRA 4CCHA 1FRLA 2FVSA 1WOOA 2DIUA 3M2UB 5EDWA 1O5JA 2APOA 3BO4A 4H4OA 4PXBA 1U26A 3MPUB 4AD6A 3CW2C 4A8KA 1F3VA 2VJVA 4DR7F 3MM8A 1I5OB 3D3CJ 2Z58B 4OJ1A 3WC0A 1VQ9S 3JB9k 1UWBA 2YQ1A 4C3KA 1FERA 1HQEB 2BEFA 3DRRB 1XNQJ 3PFOA 3PRDA 1IM4A 4KIAA 3FFIB 3H0PA 1WC0A 1XMQF 1MLAA 3UD3P 1FESA 1Y10A 1X9MA 1VK3A 1IN0A 4Y28C 1BQMB 3KLGA 1RU2A 2LQ8A 1FRXA 2DNRA 1RWVB 3CMQA 4KBIA 3OQ2A 5E3PA 2CA9A 4DUZJ 2KM8B 2I6WA 2QL7B 3LP1A 5DLFA 4DR5J 5H1SV 2D7SA 2DH7A 4JI0F 5J2NB 5A0YA 1HLWA 4P73A 1XMOJ 2VG6B 2K06A 2G2OA 2XY5A 2VBYA 2VC0A 4Y34A 4BS2A 4RU9A 4URQU 2CQ0A 2HFNA 3CCMS 2UV8A 1RAEB 1VR6A 3T5KA 4CLSA 4LMZA 6AT1B 2RVJA 1AYEA 2ZKUA 5K14B 4DN0A 5D6GA 4IG0A 2ACYA 1BWVA 3PNIA 4Y2IA 4MTPA 1X9WA 1S48A 3ILIA 2EXUA 5M2UA 1N36J 3DRPB 5IQ6A 5JMNA 1P1LA 2R7RA 1S1WA 1TV6B 2FJWA 2LA6A 3AD9C 3OHBA 3H4DA 1YJWS 4DL0C 1JKHA 2IVYA 3T9NA 4J90A 1UPMB 4U67Q 3MTJA 4UOHA 1IWAA 5ETQA 1VQPS 1WC3A 3JSMA 2W7OA 5AJ3F 5I42A 2OEJA 4PEOA 4USUA 3VV2B 1VQ7S 4WTOB 3GFYA 3A1YG 1NH7A 5CA5A 1FRJA 2JC1A 4MAKA 3MTKA 2C2OB 3KFWX 1EZZB 3I5AA 3DMJA 3BQ0A 2GGPB 3LO3A 2ZD1A 1CC8A 3GB0A 2L9WA 2XLKA 3EPIA 1D9FA 3CCSS 3M7VA 4F02A 3DLGB 1C1CB 1YIJS 2BKPA 4R5PB 2JVRA 3I4HX 4WPAA 3T1AA 3BEGB 4M95A 4OLOA 1QUPA 1YRXA 1MMNA 2WSEC 3J81U 3BGRB 4URSA 2QZ8A 4AT1B 2FC9A 3SMZA 2E1MC 1S6UA 2F40A 2R7SA 3M6WA 3PHTA 1SJFA 1RDRA 3H90A 4FN5A 4PAAA 3CDAA 4OJHA 1HBUA 2CQPA 5L8RC 1S9FA 1A0OB 1DBDA 1S4EA 2PGCA 3E51A 3BF4A 2EVZA 5F8LA 4EEYA 2XB2D 3P8BB 2E7XA 3AD7C 4JI4F 2DH9A 4F2SA 3P49B 4I6AA 3IWXA 5K8OA 4LFAJ 1QAYA 2E1AA 4TN2A 1DHMA 1KFDA 4OZLA 5IWAJ 4J9KA 3UFCX 5F9LA 3KK1B 1HNVB 2B6AA 3US5A 4FF2A 1HQ2A 4KFBB 4KYZA 4DL5A 2IJRA 4HKQA 2K2PA 2DNQA 1KQKA 2PSZA 1E6YA 3EYZA 2DJWA 2YPZA 5JXSA 1T05B 2NPIA 3D6MB 1K0VA 1WC1A 4WU2A 2UXBF 1DARA 1RJJA 2P5VA 2YQ3A 3IP0A 1Q8LA 1BUXA 2IYIA 2MKYA 1C4CA 2HK2A 5CXTA 1Q78A 4GC6A 2QJ3A 4OX7A 4I67A 3D6FB 2CQ2A 2QMUB 1PBUA 2VH7A 2RIJA 4NLVA 3KJVB 1YITS 3F41A 2RDIA 2AEJA 1VHIA 3KK3A 3M32A 2LEAA 1RTDA 4G1IA 3GU0A 1F9EB 2V8PA 1REVA 3G2XA 1NJWA 2OIHA 2RU3A 1NKCA 3TVKA 4JI3J 3EJMA 2QIFA 4IH7A 4KH1B 1OPZA 1Q81T 1SXLA 4CLYA 2XMJA 1N34J 3FC9A 3SSRA 1XTZA 4JI7J 3QJLA 2PA3A 2GVDA 2FD2A 3U27A 3HDSA 2FZCB 2MZ1A 2HSEB 1VHFA 2R3VA 2HVIA 4EYHB 3CJKA 3RRHA 3CCES 2DRAA 1X4DA 1XMBA 4NRTA 3M30B 4OJGA 4X64F 1YRUA 2UV8G 2M52A 1X0FA 1IKYB 2VQFJ 1KSPA 1XERA 2HMIB 4K5RA 3VGVA 2RMLA 2AEFA 4TVAB 2E9ZA 1AROP 3LQVA 1TUWA 2D3UA 2MQPA 3BBCA 4W90B 2XNRA 4ZJQA 4ZVUB 1NSAA 3MF5A 3HPOA 1T3OA 1AXQA 2OP5A 1ZPWX 4ZVPB 3H2VE 3VAGA 3G86A 3AT1B 2CQDA 3UCZP 4A8QA 2J7WA 2UZAA 5GMDA 2AWZA 1FXRA 4IOBA 3FEYB 1WKJA 4C8OA 4JV0A 4LFBJ 3TVZA 4I6WA 5L46A 4J9NA 3HT0A 4A46A 1CC7A 3MMBA 3MECA 2OLWA 2KFNA 5KT5A 4CLWA 4ID5B 2E5IA 2KI2A 5E33A 4WF9Q 2AF6A 1NEEA 3W63A 1S12A 1HPZA 2CVEA 1I3OB 3SDEA 1X5SA 4IDKA 4Y65A 3HZEA 1TFWA 2J76E 2EK1A 1KLNA 2N4DA 2Q3PA 4DV6J 3TEHB 3PJWA 1KS2A 3TJAA 3IR7B 2ZH3A 1UTAA 4GRSA 1JLFB 1R7IA 1U24A 1LWFA 1JLBA 4ED1A 2HWTA 1NK9A 3Q24A 1JJ2R 5F8HA 1K8AT 2G1HA 1PAUB 2IJNA 1VRTA 4GVLA 3HF5A 3DLEB 2W9BA 4ZVGA 4F3OA 3UQSA 3LP0B 1TL3A 5KG3A 4YFUA 1FKPB 1KR4A 4X4RA 1OWXA 1XMOF 5JVGQ 3N01A 1U7LA 3LOUA 2OSRA 5B0AA 5KG7A 1BGXT 3GILA 1JLGB 1X4GA 1CG2A 1OYDA 3K57A 3D3BJ 4LT6A 3KMSA 2RKIB 4QYRA 4WBFA 1S1TA 2MEWA 2MLYA 4I56A 3F73A 1Q8KA 5J2PB 4RPFA 5CCLA 2UUCJ 2IC3A 4GO7X 1U1QA 1GXUA 1T3NA 3VHQA 4U7UD 3TAPA 2OEKA 4IFYA 2V8HA 2RF2A 1T9WA 3CNQP 3MM9B 5F41A 4NE9C 2ZJQQ 2KFYA 5H9FJ 4BLGA 3L7UA 2BOAA 3DC2A 2AGPA 3NBPA 4H4KA 3PRBA 1VBZA 3HT3A 1N8RT 2Z8QA 4EO6A 3V6KA 3LUYA 5AXNA 4BC7A 5KG0A 2VA2A 4XPCA 1NKEA 4LF8F 1H2TZ 1B4SA 5M2PA 2XSFA 2GO9A 4YDDB 5IC6B 2OPQA 4LRDA 3MUTP 3FMBA 4LR8A 3H4BA 5DGAA 3KK2A 7AT1B 3QQCD 4X4OA 1RTHB 1FKOB 3RBZA 4ANCA 4TU8A 4AXIA 3EICA 3CULA 4ER8A 2CDQA 1UP1A 1WACA 1VQ6S 4WIIA 2XY6A 5DG8A 1A9NB 3IWNC 4KGMA 1WTFA 3RB3A 1TAQA 4NXNF 3I5BA 4HH0A 5MLCV 5D3GB 3ENAA 1UW9A 3QIDA 1RBAA 4EMDA 4ZMMA 2W2QP 3OVBA 1X4BA 4CYUB 5I4MA 4QWCA 2CKWA 5DG9A 3R5BA 5FD1A 3A3NB 4UW2A 4ES1A 1XN9A 1T9XA 1CULA 3D66A 1JK9B 1HMVB 3GFHA 2FB0A 4IRKA 3T1HJ 3VGUA 2WW4A 1FF2A 3IMQJ 5GADU 5T41A 3ZZUA 4P2FA 2OTLS 3IR5B 4LF5F 1UVLA 2QFIA 3J80Y 2ZVSA 2LEPA 2J9CA 3BN4A 1PC5A 1SQEA 3A12A 1NPPA 1Q0NA 1WDTA 4M5DB 4H4MA 2BACA 1ZPVA 2WONA 2HGLA 2OMOA 4ZKAA 1HNIB 1R0BG 4RL1A 3M8ZA 1K47A 3M8SA 5D0HA 5IT9Y 3FKBA 2CPHA 1HQUA 2BR0A 1YSJA 3W5YA 2I5JA 2G2ZA 3GZ7A 2QYGA 3G71S 5KOWA 3X3UA 2W9AA 1PBAA 4TKTA 2DK2A 2XULA 3GSDA 3V6HA 1H74A 3HJFA 3JS9A 4GKKJ 4A8MP 1FFWB 1H38A 1XR6A 1RWNB 4G6VB 4M5GA 4B3OA 1B70B 4JV5F 3MAQA 5KG1A 1NK7A 2DYAA 4OZNA 4JI3F 3I87A 4RW4B 2HK3A 1MWQA 3VR1A 1NLKL 4RW7A 2DXDA 2AMCB 3B54A 1TKTA 3T3FA 2A2DA 2DNYA 1F60B 5E3CA 2KM8C 1JLCB 4X62F 1R89A 4KHPF 3V4IB 2FLOA 1S1XB 1FJCA 4OZ5A 3SQGA 4CT8A 1WI6A 5K8PA 3CGIA 1PILA 1P8GA 2JEJA 5D0RA 3IRXA 2W9CB 4ZCKA 3Q8YA 4AE5A 4QU7A 1U6FA 5HSPA 2HVDA 1KONA 5KFZA 4XIUA 1D8ZA 2EFQA 4KGVB 3TAMA 2NSBA 1WKKA 2U2FA 1DTQB 4PKDB 3NG8A 2UUWA 1CJTA 2UVWA 1VBKA 2LQJA 3M6UA 4KHRA 3JXOA 5BYQA 3B8HA 2F9JA 4C98A 4I2QA 1C1BA 4CQ1A 1PJ6A 2PFDA 4MT1A 3IAM9 1TL7A 2YNIB 1WHXA 2A6OA 3C6UA 4P2MA 2B9WA 3CCWA 3QLHA 2V68A 3UR3C 2L08A 2W7AA 3GMGA 1S0MA 1U1OA 5CYQA 1QE1A 2QE5A 3BSAA 1CJVB 2QMXA 3QMQA 1NB2A 1DJ0A 2MQNA 3SCKE 4P10A 1YI2S 2HHQA 4RNMA 4ZA1A 4RJVA 1S97A 5AE3A 2M88A 3ZTRA 4OYOA 5IZHA 2W24A 5K8NA 4PWDA 4I2PB 2OHDA 2ZH8A 3EZOA 1IKVB 4MFBB 1P1TA 1TKXB 3L3CA 4J9UE 3CJ2A 4IYQA 2HBQB 1R31A 1CS4A 4B9TA 4LF9J 3MEDB 2F4VJ 2LCWA 4X2BA 2LEBA 4JBCA 2MKCA 1S0OA 2PMHA 3QRRA 4NCGB 1OS5A 2OPPA 2OD6A 2AHOB 3QSIA 3QO9A 3KHRA 3MOJB 3OL6A 3SCJE 4LF7F 4ZLJA 1EB0A 2F8HA 3EE3A 1RT4B 1EP4B 1S6PA 3KG0A 2EWHA 5ETNA 5KG5A 3THVA 1U2FA 2R2UA 2M7SA 3DLJA 2PI4A 2R7VA 1T03A 1P27B 3CXCR 3DM2A 3P3DA 1VJWA 2I38A 4KR0B 2YBVA 3AHPA 4DCPB 2UXCF 3R9LA 1RA7A 1DFDA 1M90T 2VONA 2FGOA 2AGQA 3M8PA 3K5LA 4RBVA 2W2OP 4Q0BB 5A2QU 4LVOP 1NPRA 1NO8A 2HFSA 1ZH5A 1ZAXA 3AQPA 4FXVA 3VCDA 1RWKB 2RH3A 4J9QA 4DHVA 5SUHA 5K8MA 4UTGA 4DQSA 4Y0FA 1IBMJ 1U1NA 3HHNB 4OV6A 1YGYA 4B17A 3HHKA 3MOZA 1N54B 5C5JA 2NXUA 3O44A 3TZXA 2Y8YA 1RT6A 2YKMB 3I82A 3CB4A 3M2UA 2B56A 4FP9A 1X31C 4F04B 4X65F 1OJ4A 1VS3A 1H7WA 1Q79A 4NXMF 2AYEA 2Q79A 1K44A 4PYDA 4K4YA 1BXNA 1IVZA 3ETMA 2D69A 1G3OA 2XMKA 2FIUA 3DRSB 2HNDA 2QTWA 3NNAA 3PEHA 4WP8A 1G1XA 3MM5B 1HQEA 2MKKA 1EKRA 3DRRA 3C6TB 3LA0A 4HHHA 2F65A 4ED6A 2AU0A 1HBMB 3TJ8A 2XZDB 3NMRA 3RGIA 2JWNA 4DWIA 1AT1B 1BQMA 2V4QA 1F9FA 3AXKA 3FUYA 2MSTA 3TNVA 4HYKA 3RUBL 2HLTA 1U1KA 5HP1B 5L1KA 2C3YA 2IAJB 5AXLA 2JSXA 3GJQB 4RW6A 4NI2A 5D4NA 2QL5B 4PWUA 3Q8UA 3OUYA 2J0SD 3VALA 4LQ3A 2ZM6F 4NYOA 2AJ2A 3UDCA 4I1TA 4C0OC 4USKA 1D9DA 1TL4A 4O4RA 1R0AB 2WOMA 2PFFB 1T9TA 3QRQA 2LP4A 3IN5A 5J2NA 4EBDA 2VG6A 4QWAA 3GV8B 2XMWA 3UR0A 5DZ7A 4QIWD 2VPZB 3KYLA 2HQCA 3Q8RB 2HIYA 1BLUA 2AKWB 3IO1A 2CZ9A 2QSWA 3PYFA 1RLCL 3MM6A 3JSRA 3ONQA 2XQCA 1UVMA 3QGIA 3NNHA 2E5HA 3BDPA 1RABB 3KG1A 2P6SA 4OYWA 4IKAA 3F56A 4M5NA 4CRJA 3HMJG 1UETA 5C2GA 2FJDB 1ZTWA 3C3LA 1B0PA 2DTJA 4F50A 2N7CA 4KGXB 3MR5A 4CLKA 1TUGB 2FY8A 1C0TB 4ZLLA 1CJKA 3ZZTA 4NLGA 1RYSA 5F8GA 2UUTA 1RISA 3W8PA 2YNGB 4DV4F 3L09A 2GGPA 1RHJB 2HQFA 1KVJA 5C24B 4OHYA 4DEZA 1TUVA 4LF2A 3DLGA 3V4MA 2AYMA 2F5GA 1C1CA 5DJBA 4A8OA 4DSEA 3AA9A 2MYFA 4KV8A 3CF5Q 1Y7PA 5D0GA 3FSIA 5EUHA 5LMNJ 3DDNA 3VAFA 3OSNA 1EQMA 4DR4F 1X4EA 1IKWB 1NCLA 5KFYA 3TJ9A 2B7CB 3ZZOA 4DU8A 2YKNB 3CJ3A 3T6BA 4MYUA 1SC3B 4CO3A 4OLPA 4BC9A 1DAXA 2DNZA 4PUOA 5KT3A 2HHTA 3VAKA 4DV0F 1B99A 1JJCB 5GMEA 3W66A 2VICA 2GX8A 1M5SA 3V6DB 3G96A 2QL9B 1U0SA 4ALZA 1VDHA 2M2BA 2MZRA 3T1YJ 4V1Ak 3I56S 2Z4PA 2GHVC 3GP9A 4TY9A 3R8YA 4RKUC 3F44A 3K17A 1NDPA 1HWUA 4DFMA 1HI1A 5KFNA 1D0EA 2BE7D 5CHCB 2E9TA 1S7IA 4WJBA 2GW8A 3QWUA 3RR8A 1HNWJ 2W4CA 3OLAA 2ZHBA 1CSJA 3EGNA 2DXFA 3KK1A 3EVOA 1YRTA 1HNVA 1FO1A 4OV1A 4M63A 2F8MA 4KFBA 3SSQA 2C2RA 5JUMA 5IQQA 2ZDPA 4P74A 1S10A 1SQFA 2K1RA 2LXFA 4UUXA 4F26A 4JV1A 4WXWA 3IR6B 2NS1B 2ZC4A 4RZRA 2MZQA 2OD4A 2N7YA 2FHKA 2R2SA 3DKDA 2UP1A 2RQCA 3IS9A 3N6MA 1LW2B 1OMSA 3G8QA 1V6HA 4NLXA 4YP3A 3I0RB 2NR0A 4O0NA 5LMUF 2X51A 4ZPVR 2IJFA 1H3DA 3BQ1A 1W2IA 1RTJB 1VGYA 1AA1B 5LXRA 3K5OA 2UUAJ 2QG9B 2F4VF 5HK4A 4DF8A 1T95A 3CCVS 3BBBA 2D1CA 4FKYA 2FJXA 3FRYA 2OPRA 4RUHA 2HPUA 3R7NB 2POKA 2KRRA 3MPYA 3Q2TC 4Y3CA 3RW6A 1K0TA 1Q1KA 3M8WA 2EFVA 3R27A 3FJ2A 2R8GA 4USIA 1Q8BA 3EDRB 5GVQA 4F4WA 4LJMA 1SBRA 5BYSA 2M5YA 1MU2A 1PAEX 3U1NA 1VRUA 4RNFA 1DTTB 4ECTA 1DRZA 2V2VA 3BN7A 2H9ZA 3KLIA 3C16A 3MDFA 1FEEA 1UJ6A 4IO1A 1RAHB 4IR9A 2NSCA 3QT5A 1OQ6A 4KH0B 4MIWA 4JI1J 1IKYA 2GS8A 5DG7A 5A8KB 1Y5NB 2MSSA 3A8JA 3GJTB 2RDDA 3UDLA 3UI3A 5T14A 5IV3A 3LWLA 2HEKA 2FJVA 5CCMA 3HFVA 1H7XA 2GMJA 2DVIA 4RUAA 2MGZB 2DRDA 2X7IA 3ET6A 1YG0A 5I3UA 1AW0A 1ZS6A 4LFCF 3RAXA 2XGPA 5BR8J 2HBZB 2Y3YA 1OO0B 3NMAA 4F8RA 5ITHA 1SI9A 3TI0A 3FZ2A 2A0FB 2GC8A 1NRKA 5IM0A 4B3SF 1ULRA 2WAQD 4CLZA 3AD8C 2ZNYA 1MSWD 4A4JA 2VASA 3M2RB 3NGRA 2B4PA 2L9DA 2HRTA 4WP3A 4WFZA 4A8XA 3D1QA 3M8YA 5EX3A 1ITPA 4ID5A 4KJIA 3J7A1 4RBTA 5L1JA 3RAQA 1SIZA 4QWBA 2BV3A 2W4PA 3V81B 2E5GA 4ZN1A 3E01B 1F0XA 1FD2A 4IQMA 4YHHJ 4IUFA 5DDQC 1IJFB 2D3OR 2ASLA 4DL2A 4DQRA 4ZIWA 2FJAB 1JLFA 1HYSB 1TQLA 3U1MA 4WK1A 1NH8A 3G4SS 1TAUA 3B78A 4QWEA 3UWTA 1HR0J 5F0WA 1IUJA 2CVIA 1OY8A 4UOCA 3J7AN 2K7JA 2P9EA 1GXTA 2HVEA 5D4PA 1S1VB 3DLEA 2DGSA 2BZ2A 3VWSA 2CWXA 3PX0A 2RUGA 3LP0A 1VQNS 4QIVA 5EX0A 4DG1B 4DR6J 2BANB 1KNZA 5RUBA 4MK9A 3BKFA 5DM6Q 2BE2B 3R6LB 5AE2A 1X4AA 1L3VA 1YBAA 2CPZA 5J2MB 1JLGA 3GWCA 5G0RB 3GE9A 2R2TA 5JJBA 5ETPA 5KT6A 2L41A 2NXJA 1YTYA 1U1MA 4RWWA 5FLXY 1M1KT 1U8SA 2ZWPA 2FHJD 3G6XA 1FJGJ 2XLIA 2Q6BA 4LSNB 4L75A 2KRBA 5KFOA 4ERDA 2RQKA 4YY3F 3DDKA 5E0OA 2ZZMA 5HI7A 3BH6B 2W4DA 1FXDA 1RT3B 3TZWA 3QSYB 5B0BA 3E2EA 1HHSA 4RU2A 2XMTA 3CCQS 4BHQA 4AXJA 5HLFA 1MWZA 3EUNA 5J2QB 1M5KC 3O8WA 2QC3A 5HROA 1LQ9A 1MROA 4GO5X 5C25B 4IRCA 1KTQA 2CAJA 4AQYF 3IAS9 2MQMA 2M4MA 2DGQA 4MYTA 3IXQA 3CJ5A 5KFMA 2OO4A 2QLFB 1V5IB 2B7BB 4WP9A 4YQWA 3HFKA 2CQIA 3RJMB 2LVWA 4NLWA 5LMNF 2HG4A 4J7CA 2DRBA 1KP6A 2ZZNA 1YJTA 3MAAA 4K4XA 2QMWA 4ED2A 1SL1A 3H42A 2MZTA 5GAHU 3ENVA 1SL0A 5IS2A 1Y00A 4A8FA 3BM7A 3DLBA 4WXOA 1SCJB 3Q89A 1GH8A 1TU0B 4EUVA 3H5SA 4YEAA 2NUUG 1QVFR 2N3OA 3K59A 3DXSX 4RUBA 5D4LA 4OI1A 2H1YA 1S57A 4LR7A 3W8GA 2OMLA 5D3GA 4UQGA 3T1YF 1RKJA 4NMLA 3OFHA 2NZCA 2YY3A 4HHUA 1FWKA 1RXOB 1LK5A 1FDNA 2AX1A 5EGYA 1EHWA 2WRMA 1RSCA 2XMUA 2B5JB 4FYXB 3HHLB 1HMVA 4C11B 3CJ0A 2CDRB 4ECXA 2LDIA 4GVBB 2W2MP 1X4CA 1N5YA 4W92B 3OTOJ 3OSPA 2DHHA 2CQCA 3OHAA 4TY8B 4JI8J 2DGVA 1VC0A 4ECWA 1OY6A 4DR2J 3M4XA 2PA8D 3L7OA 4LBIA 3LGMA 3QT7A 1Q5VA 2MY7A 1JNZB 1FX2A 3MXHP 1M1GA 2Z2MA 4CLTA 4O3NA 3WZ0A 1GMVA 3C2PA 5KFHA 2KB2A 2PN6A 2FLLA 4OYAA 5KFEA 2C42A 4W98A 3FCHA 4HT5A 4NLRA 4ECVA 3GYNA 2XLJA 1L3SA 1RTIB 4L6V3 1VQSA 1ZZFA 4O44B 2VPYB 2JLGA 4RW4A 3DLHA 4H54A 4ZPTR 2NXEA 3S1TA 2VQEF 1U02A 2IPOB 2XBPA 2E1CA 1NPKA 2DBBA 1M5HA 4ILMA 2GA7A 3QAEA 4RW8A 4ZITA 3OJSA 1UEUA 2GAHC 2O3DA 1JLCA 1NSQA 3V4IA 4JYAF 2WK4A 1IBLJ 2CYYA 2MDAA 3MEEA 4FYYB 4DFJA 2XSJA 4HEA9 2R7WA 4KPYA 4NYZA 2MHNA 4LBPA 2QA2A 2E5LF 2G13A 3D5MA 3K7RA 4TU9A 3CUNA 4NASA 1FDDA 4OHZA 4K50A 4DSLA 3M05A 1DTQA 2K8GA 1VIOA 3NWRA 1I94J 1U09A 1UVJA 2JL9A 4DS5A 4DF4A 2I2YA 1V3ZA 3TUZC 3R5GA 2HAIA 4IG3B 4F3MA 4NX9A 3DU6A 3T5LA 1QJHA 2MLXA 1N88A 1XR7A 4FYVB 4LIRA 1A7GE 4YMEA 3NAIA 4N7TA 1N52B 3E3XA 3TX0A 2XEXA 2B0GA 3AB2B 2GFFA 3JSYA 3CO0P 5DQHA 4DV2J 3UNYA 3C15B 3UVJB 1HBOA 1J5EF 3CCZA 4ILRA 2ILYA 3MUMP 1CLFA 4B3MF 1I1GA 3DYAA 2PD1A 3EZ5A 2V67A 3PV8A 3THTA 1WDDA 1Q82T 1MN9A 1Q4RA 4TNOA 5I3PA 2DNKA 1FFSB 1F2HA 3JTOA 2VOOA 4ED0A 1YQHA 3KG4A 2PEHA 4CO1A 1IKVA 4MFBA 2MB0B 2DH8A 3MD3A 3MEDA 3MMAB 1RZMA 3PX6A 2DNOA 3PHEA 4CDIA 1KEKA 2DGTA 4KKOA 4NCGA 1G4CA 2H3EB 1SKUB 2JHEA 2JZ5A 3V2UC 3V5RA 1RWXB 4DDFA 4TU7A 1SJ1A 1W2BR 4ZHRA 3OVSA 4ECUA 2M3DA 1ZA2B 2DD8S 3ITHB 4DV1J 3RW7A 2R7OA 4U9RA 1RT4A 1EP4A 3VQSA 2KL8A 2YKPA 5AE1A 5C2CA 3KOAA 3C46A 2E66A 2GAGC 2RS2A 2GQ2A 4K4TA 2RT3A 1L3UA 4URGA 4UY8T 2FJEB 4YUDA 2OUGA 2XG8A 3M2VB 1F5AA 1PGZA 2ZH4A 4Q0BA 4KO0B 4G3IA 3OD2A 5KFQA 3W9IA 1YVFA 4NCAA 4CH7A 1L5UA 3UW1A 1UZHA 4YOEA 3HVTA 2CZ4A 4KTQA 2VC1A 2RHQB 4L76A 5DQIA 2NLWA 2Z2LA 1FHTA 1U2CA 4HHJA 4N56A 1IBKJ 3JSBA 4HACB 3PR5B 2YKMA 2OGUA 3CJTA 3W62A 4ELUA 4QIGA 2Z30B 2QFJA 4QJVA 4H4OB 3D28A 1FNMA 1QVGR 1YK9A 5E3AA 2P9CA 3LPEA 2BQUA 4KQZA 1D09B 4E2FB 1QAIA 2CJAA 2JFDA 3GJSB 3UN2A 4K2XA 4B9UA 1SC1B 4O3PA 3MM5A 4K4VA 2XS2A 4HL9A 3D1OA 2NYHA 4P52A 1RE1B 3VQTA 2H4WB 2OTJS 3D4JA 3M9MB 2X1GA 1SIWB 1UEKA 2M8DB 1HBMA 2WCXA 4B3TF 2IVMA 2V4JA 3KLGB 2FDNA 4O3RA 4DX6A 3CCTA 2BDPA 5HP1A 4OI3A 1EKSA 5CYMA 4PXCA 4A8WA 1HBNA 1IXKA 3DU5A 2WBMA 4WCEQ 2ZZTA 3HP6A 3V6JA 2ZOGA 3AOBA 5KFJA 2JNJA 3KMQA 3R5AA 3HI9A 1HWIA 2H4YB 3D7SB 4PG7A 5A0YB 5G4DA 4CLLA 2GMHA 5L38A 5CD4H 2BM1A 4PPDA 1R43A 2WVEA 2GIRA 2LKZA 2VV5A 1RACB 4ES3A 2HQDA 1FNXH 4ECYA 3ZZZA 1VCTA 2J6TA 1DY3A 2PE8A 3EGVA 1C0UB 2DITA 3PCOB 4ZOSA 1PYSB 3FMWA 2IA6A 3RZAA 1NZAA 4IG0B 4YB5A 4S0MA 1RWUA 3M1VB 2HFUA 1UJ5A 1ZBTA 4OHXA 1ZAWA 5DETA 1KRPA 4V19X 3PJXA 2F8EX 2VBWA 3HO1A 3NGSA 1Q16B 4CLFA 3HM9A 4AL6A 4QW8A 1PIEA 5I42B 2WSCC 4KRWA 3TA2A 4DU7A 2X1BA 1YWXA 2JLFA 2J7UA 1FEHA 4QBUA 1JLEA 4J5OA 4U96A 1K73T 2HHHJ 1X4FA 4FYWB 3DMJB 1DQ9A 1PG5B 5B0GA 2QA1A 4QYZJ 1B0TA 3UN5A 1RWPB 1PJ7A 2QA4G 2KYXA 2IDEA 2QLXA 5EHHA 4C7QA 4I6YA 3RG6A 1S6QA 2KHDA 3DGPA 4X4NA 1MNEA 4MK7A 1IBLF 1Y3KA 3DOLA 4K0KF 5HQ8A 2DXEA 2YX7A 2H51B 1UAWA 1WG1A 1BHNA 1G2EA 4C8ZA 1U0HA 2L9NA 1KD1T 3AB4B 1HBUB 3HSZA 1FVQA 1Y5LB 4TLRA 1H98A 3UO0A 4Z37A 4XAKA 3DI6A 3KLHA 2RRBA 1LEOA 3ZNUA 3O1LA 2XMAA 1N33J 4OX9J 3J7YU 1H2VZ 3CJRA 1XBWA 1I94F 3H5XA 2D9PA 2FQQB 4ZPDA 3VGSA 2HHVA 2D74B 2X3GA 3HJVA 2CNKB 5B0FA 3OTBA 2J9DA 2OSQA 3HZGA 2AJFE 5E3QA 2B6AB 2D9OA 2K3IA 3IG1B 5DM7Q 4QOTA 1SL2A 1J5OB 2O66A 4P71A 5C7PA 1HWKA 1WKLA 3TAQA 2UU9J 3IA0A 1E6YB 1VK8A 3R3TA 3WIVA 3ZC4A 3DLKB 1U2RA 2BJ8A 2ZH7A 5HO4A 4MIBA 4JI6J 4EU0A 2M0GB 2Q66A 1OPIA 2UXDJ 3TW0A 2KTQA 1KTVA 2HFOA 2J0WA 2ERRA 3I0RA 1R8AA 4A8YA 3OXLA 4I68A 4C8MA 3QT8A 1NDKA 4FS2A 1RT1B 1FK9B 1S5ZA 3G87A 4MMOA 2QEXS 1TK8A 2J0QD 2IM1A 1FD8A 5D8HB 2BJ7A 2BXJA 5CD4A 4ZVSB 3RB4A 1G6BA 4FBTA 1RAOA 1PYOB 2YH0A 4DI6A 2JFKA 1NAQA 1YJNS 4N8NA 1JIHA 3FEZA 4FXWA 2RDJA 2FHJA 1RADB 1WSRA 5HATA 1A6LA 2BJ1A 4B3RJ 1ZYQA 3G6VA 3VAJA 3KWMA 4LR9A 2UUBJ 3ZTPA 1VOMA 4K8RA 2BE9B 2XYGB 4RNOA 4QIFA 4NLPA 1Y3JA 1OY9A 4DV1F 2XNQA 5KT4A 1XWLA 3JQJA 3LAKA 3HX9A 4QQBA 2IRYA 4JI5F 1DTTA 3FCVA 4IFVA 1FDAA 1WC5A 4Z7YA 1RUSA 1XEZA 1U6BA 4X66F 2N4CA 4FVMA 2KT2A 3BDEA 4RWXA 2ROEA 1KDNA 5ETOA 4C2MA 3HHLC 2P9GA 1HNXF 1FRKA 1F6TA 3H2LA 4MIAA 4ZJLA 3GIIA 1N32F 4CO4A 2LQ5A 4OYBA 3CVKA 1APSA 1VQ5S 2VFUA 3C8YA 2WTFA 2AIRB 1SH0A 5T7LA 2VPWB 3D68A 1NHKL 3VAHA 1BQXA 3MUVP 4J9LA 1R8BA 1T02A 2I8EA 3D2WA 1U8WA 1ZTTA 4WU3A 1Z1ZA 2YVSA 4LQ9A 1LWEB 4DPWA 3M8RA 3DCAA 4DV3J 3AQOA 1JJHA 1EETA 3ZTOA 3W5XA 3CD7A 5HL7Q 3CMES 2FZGB 2MXYA 4C4WA 4U95A 3CD6S 4DV5F 3S8SA 3MWBA 4L3KA 2VDHA 2VG7B 5KOXA 2L48A 2V9KA 2BKNA 2A3JA 3M2RA 2EKNA 3VVTA 1YBTA 2BW2A 3MMBB 1FTCA 1N4LA 4LSLA 3E8OA 3PYDA 3VF0B 3BQ2A 2GVZB 5DZ6A 4NZ6A 1RWMB 5F3ZA 3V81A 1HPZB 3GYGA 2V69A 3IM9A 4NL5A 1UEVA 2OJ3A 4B9MA 4U6PA 1ZETA 1RYRA 1BQNB 4OZ0A 1WTBA 1S72S 2ZH1A 2J6UA 2M8HA 1SJ4P 3DNCA 1HYSA 1LWFB 2XYPB 2RILA 3H8YA 4UOGA 2YNFB 2V50A 4K7QA 1LWCB 5HVHA 3WC2A 2DNNA 1JMTA 3BGUA 3KUEA 1GFWB 4M8LA 5GADI 1S1VA 1VRTB 3RYLA 1FFGB 3K8VA 3GIRA 2W9BB 4FNIA 3TVYA 5KG4A 1TL3B 4FDFA 4DG1A 3RBDA 1M1HA 3EDQB 3EZUA 3QGPA 5IXUA 2KJVA 2ZEJA 1RHQB 2BE2A 1WG5A 5BXIA 1O6XA 1JLAB 1QM9A 4DUYF 3GR1A 3I31A 2XZWA 2VHGA 3B6BA 3HSDA 3H20A 3D6HB 2Y1JA 1S1TB 3PKYA 2GNKA 3SFUA 4P75A 2VBXA 2HGMA 3OV7A 3I9V9 4QW9A 3W64A 3B82A 4UQTA 2ZH2A 2EEYA 3JAMY 3NOGA 5DO2A 2JX2A 4I0WA 3R97A 1RHUB 1Q5YA 3T5HA 2RHSB 1N5SA 4IFYB 2RF2B 1LXJA 1RT3A 4KB7A 1YKWA 3R5JB 4JI2J 4LF4F 4YB7A 4LREA 2OI2A 2CNOB 5EWEA 4HDHA 2AEMA 3NBPB 5J2QA 1Q95G 4DR3J 3MR2A 5LM7E 1TKZA 5KFIA 1UJ4A 4M94A 2WBRA 3D0IE 1URNA 1X5OA 2DNGA 1S1UA 2MZSA 2CUYA 3AXMA 1I6JA 3CT9A 4DR7J 2EBEA 2Y1IA 2UVUA 1IQZA 4IOCQ 3D0GE 2IHR1 2IA0A 3R7SB 3QGHA 5LJ3Y 2HVHA 4OI0A 3QNWB 2VG5B 2JJ4D 4HH1A 3FBEA 4ID8A 2ACMA 1N5QA 2OPQB 1XNQF 4PG5A 4C6AA 3G8SA 1YDLA 4RW9B 3M8QA 3MEKA 4X4PA 3GCXP 4ZVHA 2IMWP 3QYYA 3NS5A 3GPAA 4LRFA 1NJYA 3JYTA 4JB8B 5EWFA 1DQ8A 5HAOA 1D1UA 2YX1A 4ZPCA 4HLBA 1L3KA 4O0IA 4Z2XA 3UNGC 1B7YB 1SJ3P 2AJ4A 2GCFA 1FRMA 4DUZF 5F8MA 2DGWA 1PYTA 1GMWD 4DR5F 3GV5B 7FDRA 2LU2A 1X7VA 4CO2A 1N33F 1Y11A 2XI2A 1XNRJ 2C3OA 3GG0A 3N6NA 1EAYC 4N5SA 2F1FA 4Q8FA 3N5FA 2GHWA 4JI0J 3TR5A 4DPTA 1CULB 1IM6A 4F4YA 4IR1A 2V2QA 1M0SA 4C11A 1FWPA 2HHXA 3DOMB 3MCSA 4ZCMA 4P2XA 4CNYA 1P9YA 4B9NA 4CZCA 2DPJA 2CQ1A 5A8RA 4DXLA 4X4SA 1VQYA 2ROGA 2UU9F 4NLTA 4NLUA 1RT7A 2GIQA 1FKAF 1HKAA 4TY8A 4NCBA 3DDIA 2E7WA 1D8YA 4OJ3A 1N36F 2ASDA 1FRHA 1TVRB 4EYIB 1WHVA 2WONB 2LFVA 1Y4ZB 3KLEB 3D67A 3R2CJ 1V5VA 4ECSA 2AV5A 4PXDA 4ZIVA 2ATCB 5F8JA 2B4UA 1HQUB 2NCKL 1FWLA 2DGOA 2C2NA 4YR0A 2AJ1A 3NS6A 2XMVA 5AJ3J 1FTRA 5BJRA 4XPEA 5KT7A 2FC8A 1NK5A 4FNHA 3R5CA 2C28A 2DB1A 1S9EB 4BWJA 2LECA 5HN0A 5L9XA 3ILOA 2PI5A 2ALYB 4YR2A 3BV8A 1RTIA 4P9SA 2J9EA 3O3LA 4O44A 1MN7A 2GIFA 2YKAA 2YNHB 3HKWA 2VFVA 1KHVA 1TKTB 2CQ3A 4NA3A 3VTIA 1OYEA 1X5TA 4DPXA 1X8DA 4RR5A 3J81Y 4USWA 1H2UX 3OXGA 3HXMA 1U1LA 1N6QB 1YZ6A 2CPDA 3IRXB 3P96A 2DGXA 3ISNC 3R1HA 4ECZA 4JI4J 4JOUA 3TAMB 3NS7B 1X60A 3N6LA 3UDEA 1QTMA 3IBCB 3SQOP 4LFAF 3PIPQ 2DNHA 1K1QA 3GIJA 1CJTB 5IWAF 1P9QC 1ICEB 3NOCA 2HVZA 3S6EA 4ED5A 1RAFB 5KG2A 2FJBB 5K9FA 4LRCA 3NGTA 3PFEA 4HTIA 1TL7B 4U7CA 2DISA 1WG4A 2DT9A 4DL6A 2RRAA 2PC6A 3W60A 1RU1A 3C6UB 1F2GA 1B0VA 2OELA 4F4ZA 3N9UC 2HS3A 3C15A 4JV2A 3UVJA 5GAGU 1FJEB 6FD1A 2BMBA 4NEYA 1WWHA 4F0KA 4X4QA 3OTCA 1EQ0A 2DO0A 2RRNA 4PWWA 2W8LA 3HK2A 1FDBA 2CWKA 4CTAB 4I7FA 5CYQB 4DFKA 2DGUA 2HNYA 3H59A 3OL8A 4UF4A 1S9GB 3CDBA 3A3PB 1BD6A 3PYEA 2D3ZA 2CG8A 3KUGA 5GAEU 2BJ9A 1HA1A 4PWDB 3OR1A 4A8SA 1L3TA 1QSSA 3AOAA 3KNGA 3FBFA 2A1BA 5L1IA 4PABA 3MMAA 3BJYA 5JVHQ 4MKVA 2BRKA 3QGGA 2ZHOA 3RAMA 1F3FA 1SH3A 2BM0A 3MM7A 1N34F 3ILLA 4YR3A 4JI7F 1XIQA 1AB8A 2ZFHA 4LUBA 2P8IA 3A3OB 1S6PB 3HVAA 1IR1A 4M5MA 3L95X 4DV7J 3P6YC 1WELA 2JLEA 3PDNA 4DQPA 1HW9A 1D9AA 4Q2MA 1S77D 1IKXB 5E41A 3A8KA 1YBUA 1DLOA 2FUG9 1RAJA 3DM2B 3CCUS 2Z56B 1JLQB 3W5ZA 4ES2A 1OQ3A 4F4KA 3Q22A 3QT6A 5J1PA 4X64J 2VPXB 5IT4A 1FCAA 3M2VA 1G7CB 2VQFF 3HD1A 2ZH9A 5HMXA 2KKHA 3JTNA 2YX4A 1U45A 1RWWB 5K5MA 4PG6A 2Z57B 1WEZA 5IC4B 1WEYA 3QZ8A 2VJUA 4G1PA 3SZ2A 2HLUA 2V4RA 2DKOB 2F3JA 4A48A 4O4GB 2Y9HA 4EBEA 3ZZ0A 4BCAA 3VZIA 2SXLA 1XQIA 3CCLS 1R3NA 4JI2F 1RT6B 3CEDA 3NCQA 5B7WA 2BVZA 4DR3F 2ZVIA 1WSVA 3CC7S 4ICLB 2QO3A 4LFBF 1MG7A 1JXEA 1T9YA 2DCUB 2QN6B 2MJNA 2W25A 3JQMA 2AJQA 2KXHA 3N0VA 3C14B 3LWMA 3T9ZA 4J91A 3LP2A 1B7FA 2MLZA 3PACA 3TX8A 2MKHA 1RI7A 1S0VA 2MMYA 2HNDB 2RS8A 4DL3A 4WZMA 3MAHA 3NP5A 3QIPB 3BR8A 4DV6F 2WW8A 3W9HA 3ICLA 2BX6A 3LANA 3ETOA 3L7PA 2XWYA 4R8UA 2FLNA 5DDRC 1TL1B 3ZNJ1 4J9MA 3D54A 4RW6B 4NI2B 2HURA 4USVA 2KO1A 3OUYB 5FDLA 3PJ9A 5KFGA 4CM0A 4DPUA 2HWHA 2KG0A 1XNRF 4Y00A 2FY1A 4L74A 2HZAA 1E6VA 2WOMB 1S0NA 1QAXA 3W2WB 1K1SA 5LSOA 3HSJA 3H40A 2ABYA 3EGZA 4X4TA 3K2YA 1OIAA 2QX0A 1NM2A 3Q8QB 3I55S 2YQ0A 5E3RA 3H98A 2LMIA 4CP5A 2RQ4A 1RB0A 3KUHA 1C0UA 3HKZD 2JEFA 1YJVA 5MAOA 2X1AA 2MHEA 1NK0A 4UZBA 5KFWA 4XK8C 5AT1B 2V5HG 3RTVA 3M1VA 3OL9A 3MM6B 1B64A 2DHAA 2UUCF 2DPIA 3R1LA 3MPWA 5DGBA 4OX8A 1TMMA 1R6YA 2MTLA 2HGNA 3VZHA 2J6SA 4AUKA 2EBGA 4CIOA 4NRUA 3FQKA 1QSLA 1CJKB 2AW0A 3AOCA 4M5JA 2NXNA 4B9VA 3I96A 3BSNA 3BREA 1MMLA 3I6PA 3HHEA 4Q43A 3PEJA 2QT7A 2KZMA 3CC4S 3RU0A 4C8LA 4OHWA 2K3KA 4WE1B 4LF6J 4LF8J 1TFYA 3CIZA 3HVRA 3K0JA 3AFGA 4KV8B 3R5DA 2KT3A 2KYZA 2R7TA 4CI0B 2BUNA 3FFIA 3NNCA 2A18A 5GMKa 3N4WA 1R8CA 3TO8A 3TUJC 3PX4A 4O23A 2YTCA 3QRPA 3FSXA 3LAMA 1VQMS 1J2VA 3CMAS 3J81j 1N56A 4PUOB 4N76A 2B43A 3NY0A 2YKOA 3C19A 1UL3A 1NU4A 4ZPAA 5KFLA 2EK6A 1FJ7A 4NXNJ 2G0IA 3H25A 5H9EK 1M5OC 4IQXA 2LLZA 3EM1A 3EGWB 1WD6A 2D41A 1LXNA 3TYTA 1B3TA 1Z4UA 1SB6A 3SFGA 5K20B 2B51A 2PDAA 3HLUA 3T6JA 4W4MA 3BYRA 3T1HF 1WF1A 3IG1A 4BDPA 1CPZA 3Q2SC 4Y6IA 3TWZA 2E9RX 1VLYA 4OFZA 1J5OA 3J80U 2ZH5A 2K1RB 1KC8T 4WYLA 4RUCA 1NBEB 3OFFA 4LF5J 4YDXA 4DSKA 5K14A 5LSRA 4AL5A 2BQRA 3DLKA 5DQGA 3FCWA 4XTTA 4ZVQB 4M5LA 2E29A 3DRPA 3QFWA 4D3HA 4H4KC 1FXLA 3IS9B 1TV6A 5IT9U 5C42B 3MMJA 5H9EJ 2Q6CA 1Y9OA 3KJFB 1FNOA 5ETRA 2RJZA 5IV4A 3PYGA 3GIMA 3MFIA 2LA4A 4P2SA 1SKWA 1RT1A 1FK9A 2Y0BB 2DHXA 2OPSB 2KZZA 3GQCA 3NGKA 4GKKF 2P6TA 4KE5A 3BGLA 1ZM3A 9ATCB 2B9EA 2OPRB 4PCQA 2EKYA 1YX2A 4JV5J 3A4TA 2ZBRA 4DLGA 2B8PA 2P2CB 1LKZA 3G9CA 4J9VA 4DFPA 2CADA 4KT0C 4R5PA 1V3SA 3BKUA 3TZYA 2HS4A 4C0HA 1WC6A 4GMKA 3IWLA 2DHSA 4ZPBA 3BGRA 5HJYA 2CJ9A 3KHHA 2R8IA 2R9LA 3PTWA 1MU2B 4DV7F 4X62J 4KHPJ 3TZZA 1VRUB 1NK4A 4NOHA 3BGOP 4C3MA 4DSFA 4J9PA 1BY9A 2Q43A 1RAIB 1R0CB 3KLIB 3C16B 3CDWA 4CM2A 5HJXA 9RUBA 1RHRB 3MZIA 4IOAQ 4WIQA 3MPVA 4A47A 1RT2B 1HHTP 2XZTB 3W65A 2MQ8A 1SJQA 2JEGA 1MMDA 4E98A 1SC4B 3OTDA 5HMZA 2G9OA 2KHCA 4WFAQ 2M9KA 4FXDA 3N79A 3NCPA 1H6KX 2PMWA 3EXYA 2IFXA 2XYHB 3CD5A 4XDCA 4WZQA 3ET6B 2O5DA 5I3UB 1IQTA 1MW7A 2F63A 3OFEA 2PO4A 1U1PA 1LWEA 2DR8A 4USTA 2ZOMA 2V2KA 4IH5A 1S7HA 4DBQA 2YPYA 4R0JA 2CZVC 4QR2A 5IM0B 3MR6A 1YHQS 2VG7A 1T05A 2V94A 4TLQA 3QATA 5GAHI 3AJDA 3VVUA 1FVSA 3W2VB 4ZVTB 1HHQA 4OYMA 1Q53A 3MURP 3W1YC 2AD9A 1X4HA 2GVZA 3DGVA 4MKBA 1GMWA 1DQAA 2XO7A 3G82B 4L73A 1VBYA 2XHWA 4PG8A 2BW7A 4USHA 3J7Z5 2J8SA 3KJVA 4B9SA 1RLDA 3MCOA 2GJFA 1RBOB 2AZ3A 4N47A 2JDJA 2OFGX 1QAJA 3IFEA 1DZ5A 4LF9F 4TYAA 5D15A 1BQNA 3Q83A 3QPIA 3KLVA 2ASJA 3AAWB 2Q1LA 2LDYA 1TELA 2YWEA 1H73A 2YNFA 1LWCA 1V9OA 2ZNZA 3KKFA 3OW2R 5KFUA 2VDIA 4NA1A 3ZTSA 4L72B 4LF7J 3HVWA 4C8NA 2W7PA 2CQBA 3SV3A 2VF3A 2ZUAA 2RB7A 4ZCLA 2RSQA 3ENQA 4B08A 5H9FK 1IBCB 1O51A 3VAMA 2HAFA 3WDOA 3VAIA 3MPDA 4NZ0A 5A6WA 4E0DA 2HZVA 1JLAA 3K89A 3BO2A 2UXCJ 3M30A 2W2PP 2GV1A 4WFNQ 2A2CA 4ANDA 3AA8A 3WBZA 4KHMA 2V8VA 1IR2A 2DR6A 4ZCIA 2HMIA 4DZDA 4BWMA 4Z7CA 4UZCA 5A2QY 2PEBA 2CNNB 2NPFA 2FPHX 3D6TB 1BMQB 3EWGA 1UW4A 3IBWA 3OL7A 4G1QB 2Z2ZA 4OQJA 4C8YA 2JH3A 3L4BC 3CWJA 3UN3A 1IBMF 4OZ1A 3QJPA 5J1EB 3HFZB 5ETLA 5LJ5Y 3LW5C 4QIEA 5HVFA 2BQ3A 4QWDA 5HLFB 3GTYX 3GCWP 1O8BA 5HROB 2UVRA 1MROB 2ZBCA 5KFCA 1NSKL 3DXBA 4X65J 1OSDA 4NXMJ 1UZDA 1H0HB 3DOKB 4FF3A 1U4BA 1N5VA 2I1RA 2JRSA 3FZBA 4M1KA 4LF6F 2FZKB 2YXLA 1YLXA 4ZLNA 2QYCA 1UVKA 2VG5A 2CPEA 2NXCA 2ZJRQ 2DNMA 5KFSA 4RW9A 3RB6A 5B09A 4Y2KA 4QR1A 3KJQB 2X1FA 3MAAB 4K4WA 2XI3A 1GX6A 5HQLA 1U49A 2XM3A 3IGNA 2XWXA 1KN6A 2ZBPA 3IRWP 1VQ8S 3ENWA 2WZ1A 3ELHA 4PRFA 5KFAA 1PCAA 2IIHA 2ZE2B 4EZ9A 2ZM6J 1S79A 2LQBA 1XR5A 3PXGa 1FKPA 1X0PA 4DX7A 4ZVRB 4ELVA 3Q8SB 1FE0A 3SYZA 2EW9A 2BYCA 3DOMA 2LXUA 5KFPA 3QFHA 4IRDA 4M5HA 1FT8A 1LOUA 4EGLA 2CNLB 2RKIA 1N5YB 4ZP9A 1CQMA 4G65A 4CLPA 5DLGA 1RHKB 5J2PA 3UPFA 2FVRA 4TXSA 4USMA 3KDOA 2O1PA 4Y2CA 1LWXA 2XCPA 1TVRA 3GSIA 3PR4A 4ITSA 2J5AA 3KLEA 4ZVEA 2LYVA 4C97A 1EIYB 2DO4A 3OFGA 3NL0A 4NLDA 3MM9A 3UE2A 2DNLA 2ZWOA 1PC4A 1R6VA 2MQLA 1KVKA 4QPTA 2I0XA 1I51B 4FF4A 1S9EA 4PG4A 1XK8A 1WF2A 4OYPA 3KNAA 4ILLA 4CNZA 2KXFA 2VKZG 1M5PC 2R7QA 1TR0A 4DV4J 2WB1D 2MKSA 2CQ4A 5THWA 2ROPA 2K7KA 4EWTA 1U47A 1AFIA 4DN9A 2MZJA 3HHDA 2IBOA 4PQUB 2YNHA 1UPPA 4DR4J 1ZA1B 2V63A 3PKMA 4RW8B 2I9SA 4F7VA 3QJJA 1RTHA 1FKOA 1TK0A 1VQ4S 5CAAA 4FKXA 3CDEA 3ULHA 4HI2A 2V0NA 1N6QA 3MEEB 3SCLE 1WORA 3MMCB 4HT7A 2HFZA 3MEGB 2XSJB 4WK3A 3WX4A 1VQLS 5KTQA 4DV0J 4WKYA 3TUIC 2Z2YB 3G6ES 1SUQB 4E8UA 3F0NA 5HQMA 3POTB 3KXDA 3NRBA 3OR2B 2V2ZA 4CYUA 4F67A 1CBKA 3TUPA 2W1BA 5KFRA 4Q7AA 1LW0B 4ZS6A 1AZSB 3BGFA 1HNWF 1YJUA 1BC6A 3AJ1A 2NREA 5B0DA 3PW7A 1RKIA 2VKRA 3MGJA 5LT5A 3BO3A 3EVWA 3OBIA 4O3QA 3QWPA 3U02A 2WVCA 1U48A 1LNQA 3LPYA 3DHXA 4DS4A 2LQ9A 1BWEA 5LL6d 2X3DA 4O3OA 1HBOB 4OZ3A 1S59A 3W61A 1WOPA 1RT5B 4M5DA 1GT8A 2FLPA 2V6AA 4CTAA 3DYAB 1HNIA 1S9GA 3M9OB 1N0VC 2N82B 1NHUA 4CLUA 2H48B 5LMUJ 2PT0A 1UFWA 4M5IA 2A10A 2R7UA 2B4OA 1IWGA 2V8GA 2UUAF 3ZZPA 3ZXWA 5B08A 2CPYA 2XMMA 1HL6A 4C3LA 4NPOA 5U47A 2OH2A 1VBXA 1AUDA 2B8QA 2PIIA 2QGFB 4KKOB 4CT9A 4OI6A 4ED4A 1JXLA 2RE1A 1ZM2A 4PQAA 4ZHRB 3DN9A 2XGQA 3KHGA 1TL5A 4DX8H 3LF0A 4ECRA 2VU5A 3CD0A 3HULA 4CH0S 1T11A 1UFKA 2NYIA 1FA0A 3HCXA 1S1XA 2F4FA 1KKHA 4NLSA 3WHIA 3MHYA 4OYXA 4ZP6A 1Q7YT 2HWIA 1IKXA 1ZM4A 4V19J 2FVPA 3CIMA 4M5KA 1HD0A 2ZBIA 2W9CA 3CCRS 3UCUP 1JLQA 2QA4S 1SVDA 5L39A 5DS7A 3FBCA 2DR5A 3QAUA 4C9DA 4JI1F 2BJ3A 4ZK7M 3PO4A 3DLLQ 3G6YA 2E1PA 2XCAA 1RAAB 1KLMB 4AL7A 2IDLA 1NSPA 4F0MA 1HARA 3HVTB 2V8DA 3BH7B 3TARA 2DHGA 3UD5A 4O4GA 2GHPA 4IO9Q 5BR8F 4LFCJ 1TK5A 2DY9A 4LF1A 2YNIA 4ZVFA 2ZOFA 1NK6A 2VUGA 3FDSA 3PIOQ 2FHMA 1QUVA 3OLBA 2ZITA 4B3SJ 5F8IA 3B4MA 1R27B 5HBMB 1URRA 1NJIT 4ICLA 1DURA 2FYXA 5A8WB 1CJUB 3SV4A 2MKJA 1CJVA 3C14A 5F8NA 1UCNA 5CZXA 2VZ9A 2IRXA 2L3MA 2GMLA 1SV5B 2DCLA 1N5TA 3HHLD 3DRYA 2W8KA 4UUWA 3X1LB 2H5IB 3CSKA 4ETZA 2KJWA 3K5MA 1S4FA 2QV6A 3PG9A 4Y2AA 1TP7A 2IYGA 3QIPA 4I2PA 1KHWA 3CJQA 4LRAA 4YHHF 5E7OB 1TKXA 2XS7A 5SZTA 8RUCA 4DPOA 2CJYB 1YJ9S 1VMBA 3J7YI 2IRUA 3NAHA 2YWKA 5AXKA 1C4AA 3TP2A 1HFEL 2V4JB 3A8EA 1TL1A 2J7KA 5CYMB 1HR0F 4F3QA 4Q2LA 1HBNB 2HRUA 4FYDA 4ED7A 1JWWA 1QY7A 2IM3A 2XC9A 4OZ2A 1T9VA 1YJRA 2B9XA 4Q8EA 4DR6F 3BPDA 2EI5A 3GFXA 2YH1A 3WQPA 4JP8A 2HIQA 2EG1A 4NWBA 2C3MA 4OI4A 3W2WA 1ZOTA 3T19A 4ZPWR 1QD1A 2QLJB 1LK7A 5FLXU 1GXLA 2KT5A 1LFPA 2HNZB 1H72C 2KN4A 4DLEA 1NHVA 1FJGF 3LGNA 2ZDOA 4DSJA 2C2EA 3W7BA 3Q8VA 4K4SA 3I0SB 4KPCA 4XDDA 3K5PA 2JEIA 4WFBQ 1X5PA 1R8HA 4YY3J 3KLFB 4PPZA 1XJWB 5KFBA 4Q44A 1W7WA 1PSDA 2CPFA 2R4FA 4K4UA 1GNKA 2E7VA 2XHCA 3HSGA 1RCXB 1LV5A 2HKEA 5KFXA 5BYRA 4C8KA 2DR9A 1RHMB 2BKOA 1TZ0A 4USJC 1KBRA 3OXFA 4WFXA 5IOLA 1WEXA 3MD1A 1JLEB 4AQYJ 2DR7A 3PZPA 1P6TA 3QBCA 2Y8WA 3MM8B 4DJBA 2YWFA 1NNDA 3JTPA 4WE1A 3DRSA 2MJUA 4HVZA 2AQ4A 4NA2A 1VQKS 1FRIA 4F4XA 2C2MB 1RTZA 3HD2A 1UWBB 3FNNA 3J7ZT 1CQNA 4NLQA 4NZ7A 8ATCB 3C6TA 2BRLA 5DDOC 1S6QB 2BABA 4CWBA 4EI2A 3DGPB 3G8TA 1AUSL 2AT1B 4QCLA 4U8VA 3GONA 3PM9A 4J9OA 1CVJA 5D4OA 4ANEA 3NXZA 3DOLB 3ZTQA 2R8JA 3BSOA 4NYPA 4LBHA 4F0HA 3NGDA 2OAUA 1U0HB 1V3RA 2IY5B 2IAJA 3TQEA 2C3PA 3DI6B 3K5NA 5F0UA 4PXEA 3KLHB 2VA3A 4UY85 3TANA 1JX4A 4QPXA 5ETVA 3LP1B 2MKIA 2EFGA 4P7VA 4ZJOA 4D3GA 4L3NA 2LXIA 1R0AA 1ZZNA 2J0XA 1RQ0A 3GV7B 2JOQA 3NKYA 2B3TB 2J9DE 1KVIA 5ETTA 1PJ5A 4Q5VA 3U7JA 2E5JA 2H65B 1F1BB 3I5CA 2DEIA 3SXLA 3I4PA 2G0JA 3PY8A 2W01A 3N28A 3OTOF 1SPBP 2H54B 3TEGA 4X84A 1SKSA 3S7RA 4JI8F 3AJ2A 4QU6A 4DR2F 4WKRA 4DZ6A 3KTQA 1C2PA 2BOPA 1Y0HA 4ED8A 4U8YA 3LALA 1S1WB 1ACMB 2CQHA 5C42A 4PYAA 1JKHB 4U7UK 3NWGA 3TQ1A 3IBFB 1VYAA 2EFOA 3FK4A 3JSMB 5F9NA 1C0TA 1SH2A 2XTJP 1FE4A 4K5SA 2OPSA 4K4ZA 1S76D 4FF1A 1GTEA 1RAGB 2WVDA 2YNGA 2EPIA 3EX7B 2ZC3A 2GJIA 2ZD1B 1LFWA 5C24A 5CH7B 2FHOB 3EMTA 4P6QA 4WWSA 4NLYA 3GIKA 1MWYA 3SBMA 3UCGA 4YS2A 1T9UA 4LIWA 2VQEJ 3EXCX 3EPGA 3CJ4A 4QR0A 6FDRA 2RNEA 1IKWA 2U1AA 1UKUA 2O01C 2YKNA 4OYIA 2VODA 4HTJA 4JYAJ 4F36A 2QLWA 4IFVB 1HNZJ 3SSSA 1RWOB 2AYBA 4ECQA 1GQEA 5ADZA 2C2KB 2E5LJ 3BKTA 3V6DA 2ILZA 2YWHA 1RCOB 1RT2A 4KGKA 1EX8A 4EBCA 2V9WA 2HFVA 2AYGA 3CC2S 3MR3A 3S01A 4DMZA 1T8EA 2CRLA 5T7LB 4HI1A 3WX8A 1ROFA 5HMYA 4DQIA 1YJ7A 2ZUGA 4DPYA 4CH1A 3W9JA 3A8IA 2C2DA 1VQOS 3P5BP 2HW3A 2ZBQA
chains in the Genus database with same CATH topology
4JI4J 4RJVA 5AJ3J 4DUZJ 2KVQE 4DV1J 2VQEJ 4KY3A 2HHHJ 4JI2J 5A2QU 4LFAJ 4LF4J 4DR5J 4DV2J 2MQ8A 2KL8A 5FLXU 1XNRJ 1J5EJ 3OTOJ 4DV3J 5IWAJ 4DR3J 2MTLA 4B3RJ 4NXNJ 5LM7E 2UUBJ 4JI8J 1IBLJ 1FJGJ 4JYAJ 4LF9J 4B3MJ 2F4VJ 4DV0J 4JI0J 4JI3J 4DR2J 1HNZJ 4JI1J 5LMUJ 1XMOJ 2UU9J 4KYZA 4DR1J 4GKKJ 4DV5J 4YHHJ 4NEZA 1IBMJ 4DR7J 3D3CJ 1N34J 2UUAJ 3T1YJ 4V1Ak 2UXBJ 1XMQJ 4JI5J 4JI6J 2E5LJ 4JI7J 4YY3J 4JV5J 2ZM6J 4DUYJ 4LFBJ 4K0KJ 4X66J 3T1HJ 2UXDJ 4DV7J 4LF7J 4NEYA 3J81U 3IMQJ 4LF6J 1XNQJ 1HR0J 4LF8J 4LFCJ 4B3TJ 4PWWA 5BR8J 1HNWJ 3J80U 4DV4J 4X65J 3J7AN 1N36J 4LF5J 1I94J 1HNXJ 3R2DJ 3D3BJ 4NXMJ 4HHUA 3JAMU 1N32J 4X62J 4KHPJ 3R2CJ 2MEWA 4X64J 4B3SJ 1IBKJ 4GKJJ 4DR6J 1N33J 4OX9J 2VQFJ 4AQYJ 5LMNJ 2UXCJ 3W1YC 2UUCJ 5IT9U 4DV6J 4DR4J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI4 J;  4RJV A;  5AJ3 J;  4DUZ J;  2KVQ E;  4DV1 J;  2VQE J;  4KY3 A;  2HHH J;  4JI2 J;  5A2Q U;  4LFA J;  4LF4 J;  4DR5 J;  4DV2 J;  2MQ8 A;  2KL8 A;  5FLX U;  1XNR J;  1J5E J;  3OTO J;  4DV3 J;  5IWA J;  4DR3 J;  2MTL A;  4B3R J;  4NXN J;  5LM7 E;  2UUB J;  4JI8 J;  1IBL J;  1FJG J;  4JYA J;  4LF9 J;  4B3M J;  2F4V J;  4DV0 J;  4JI0 J;  4JI3 J;  4DR2 J;  1HNZ J;  4JI1 J;  5LMU J;  1XMO J;  2UU9 J;  4KYZ A;  4DR1 J;  4GKK J;  4DV5 J;  4YHH J;  4NEZ A;  1IBM J;  4DR7 J;  3D3C J;  1N34 J;  2UUA J;  3T1Y J;  4V1A k;  2UXB J;  1XMQ J;  4JI5 J;  4JI6 J;  2E5L J;  4JI7 J;  4YY3 J;  4JV5 J;  2ZM6 J;  4DUY J;  4LFB J;  4K0K J;  4X66 J;  3T1H J;  2UXD J;  4DV7 J;  4LF7 J;  4NEY A;  3J81 U;  3IMQ J;  4LF6 J;  1XNQ J;  1HR0 J;  4LF8 J;  4LFC J;  4B3T J;  4PWW A;  5BR8 J;  1HNW J;  3J80 U;  4DV4 J;  4X65 J;  3J7A N;  1N36 J;  4LF5 J;  1I94 J;  1HNX J;  3R2D J;  3D3B J;  4NXM J;  4HHU A;  3JAM U;  1N32 J;  4X62 J;  4KHP J;  3R2C J;  2MEW A;  4X64 J;  4B3S J;  1IBK J;  4GKJ J;  4DR6 J;  1N33 J;  4OX9 J;  2VQF J;  4AQY J;  5LMN J;  2UXC J;  3W1Y C;  2UUC J;  5IT9 U;  4DV6 J;  4DR4 J; 
#chains in the Genus database with same CATH topology
 3LH2 S;  4LSZ B;  1TMJ A;  1EET B;  2ZH6 A;  5HMW A;  4P7T A;  3ZFV A;  3OVA A;  1T94 A;  3B4D A;  3ISZ A;  1SJR A;  4DV2 F;  3PVX A;  1RP5 A;  2KU7 A;  1J5E J;  2FGC A;  1U1R A;  4RLE A;  1VFJ A;  1HD1 A;  3SEO A;  4B3M J;  2R42 A;  5KAK A;  4KC5 A;  4LSL B;  1LW2 A;  3P4U B;  3W2V A;  4MJK A;  4OI2 A;  4DCJ B;  3RR7 A;  2G0C A;  4GC7 A;  4O3S A;  3G82 A;  4RBU A;  1NUE A;  4ED3 A;  5DDP C;  3ISN D;  1UWA A;  1RTJ A;  3RBE A;  4KGZ B;  4FS1 A;  3FBB A;  2WSF C;  3KK3 B;  3M32 B;  3K58 A;  1RTD B;  5B0C A;  5L1L A;  1CEZ A;  1WF0 A;  5M2R A;  1WHY A;  4X4V A;  1REV B;  5HVG A;  3QZ7 A;  4ZLP A;  3BB5 A;  2DNP A;  2HQG A;  1KQS R;  1XC9 A;  2AX0 A;  1T0T V;  2MQO A;  3NGU A;  4OZJ A;  8AT1 B;  4CO0 A;  3P5T L;  2WHO A;  5CZV A;  2VL1 A;  5IFM A;  1EAR A;  4LRB A;  1KFS A;  4DL4 A;  2GVD B;  4F2R A;  4B02 A;  1WI8 A;  4P72 A;  5KG6 A;  3DHW C;  3MCM A;  2F9D A;  3CJK B;  2GQQ A;  4DR1 J;  1ZM9 A;  3FVY A;  4NEZ A;  2KXN B;  2ZJP Q;  2OFH X;  3BYP A;  2RUS A;  5HAN A;  2C1E B;  1WNE A;  4K59 A;  2PMZ D;  5A8K A;  5FJ4 A;  4Q45 A;  4OX6 A;  4ENO A;  3KJN B;  5ETS A;  3TOQ A;  2CJQ A;  4DUT A;  1WHW A;  2VIH A;  1WJ9 A;  4HDG A;  3BR9 A;  3MI7 X;  2EG2 A;  2O67 A;  2WB4 A;  3BPS P;  1U6Z A;  3THP A;  2MGZ A;  1RK8 A;  4G1Q A;  3LGH A;  5D78 A;  2XS5 A;  3FQL A;  4KSE B;  3I32 A;  4DX5 A;  1Q8I A;  5J1N A;  2RAQ A;  3CJ8 A;  4ATN A;  5J1E A;  1IBK F;  3GYX B;  2G1D A;  2G4B A;  4YB6 A;  4UT4 A;  1HI8 A;  5EWG A;  4C48 A;  2VFR A;  1GEH A;  5E2Q A;  1K9M T;  2OKQ A;  1TKZ B;  3P45 B;  2IVF B;  1ZAV A;  2ASY A;  1TTH B;  1YZ7 A;  5EN1 A;  3ADA C;  5ETM A;  3MEC B;  3DOK A;  1S1U B;  4EZ6 A;  4I64 A;  2EFN A;  2BBE A;  4UOF A;  5FII A;  3Q23 A;  5CYJ A;  2VFS A;  2WVB A;  3BSC A;  4FPR A;  2OEM A;  2W2N P;  4DSI A;  1WUU A;  2GQC A;  3SDE B;  3E01 A;  4F4A A;  2VFT A;  2ADC A;  4IDK B;  1NK8 A;  1Y5I B;  3O2I A;  3M8Q B;  3D0H E;  2QRR A;  2DEJ A;  4TQS A;  3MCN A;  2MQQ A;  3CDU A;  3IGV A;  4WYW A;  4B3T J;  4MK8 A;  1GAO A;  5D77 A;  3JYT B;  1GK8 A;  2R7X A;  2EC2 A;  4JUZ A;  1JLB B;  1REG X;  3FSY A;  1GMU A;  5D0E A;  2CG4 A;  2ZE2 A;  2VBZ A;  3I9Z A;  3SCI E;  2C3U A;  2UVV A;  4J9S A;  3AY0 A;  1F9H A;  1NME B;  2A6M A;  4ZN3 A;  5CQG A;  2BAN A;  4EK2 A;  4QZV B;  5GAG I;  3BZQ A;  1RGV A;  2FTR A;  2HQI A;  3O6Q A;  2CQG A;  3M9N B;  1W25 A;  1WOS A;  5J2M A;  5G0R A;  4WFY A;  1IR0 A;  4ZP7 A;  2HBR B;  4MKA A;  2ADB A;  4DOZ A;  1RBL A;  4ETX A;  1VI7 A;  2R2R A;  5A8R B;  3CCJ S;  4XO0 A;  1RT7 B;  5GAE I;  2NUH A;  2COL A;  4LSN A;  3PW5 A;  1S49 A;  2GO8 A;  1UVI A;  2IC3 B;  1HW8 A;  2ATL A;  2VD3 A;  1NJZ A;  5KFK A;  3IC1 A;  4PR6 A;  1J27 A;  3FRZ A;  3O5T B;  3OTE A;  1UVN A;  4IH6 A;  4ZP8 A;  2M70 A;  2ZHA A;  4N77 A;  4OIX A;  4R25 A;  3AH6 A;  4GKJ J;  4OL8 A;  1QLN A;  2B4V A;  5L9N A;  5C25 A;  1NZ8 A;  1UMJ A;  1Q86 T;  1Z2L A;  2HQ3 A;  2CFX A;  2KVQ E;  4LVN P;  3CO9 A;  2HHH F;  2JC0 A;  1N48 A;  3R7B B;  2J8A A;  3H2U B;  1KOH A;  1SC6 A;  1TKD A;  2HBY B;  1N0U A;  1NXI A;  2V34 A;  3GG1 A;  4PQU A;  5KFF A;  1ELO A;  1VRQ C;  2RQM A;  1GX5 A;  3D1H A;  2YKQ A;  2Y1L B;  2KVI A;  3KK2 B;  1JNR B;  2JVO A;  1XMQ J;  1W26 A;  2HYI B;  1JB0 C;  1QSY A;  4K0K J;  1HNZ F;  1EJ7 L;  1HWJ A;  3UDV A;  5AXM A;  5LXY A;  1KOO A;  3MMC A;  3MEG A;  3ZZR A;  5B0E A;  3MR7 A;  3R2D J;  2IM0 A;  3UD4 P;  1SUQ A;  3W3S A;  2KH9 A;  3POT A;  1NDL A;  3GFZ A;  1VIX A;  1FX4 A;  3NEK A;  3OR2 A;  4KAI A;  4OX9 F;  4RX6 A;  4F25 A;  3OT9 A;  1QDU B;  1HIY A;  1LW0 A;  2C2Z B;  1NKB A;  1AZS A;  1D3W A;  1JXV A;  1KWM A;  2B5J A;  2B9Y A;  4KY3 A;  4OYZ A;  3HHL A;  5LOQ A;  1VC5 A;  4HR2 A;  2KG1 A;  3GJR B;  2QLB B;  4CO5 A;  4GVB A;  1BE4 A;  2KDO A;  5KFD A;  2Y0S D;  5IT0 A;  3Q86 A;  5DRK A;  2ALZ A;  3PW2 A;  3U1L A;  3PW4 A;  3SI8 A;  4JI6 F;  1RT5 A;  5CAB A;  4EFA C;  4H4M B;  4I7F B;  2UXD F;  2HNY B;  1JQG A;  3RBX A;  2IM2 A;  2E44 A;  2HHW A;  2I5J B;  4RNN A;  3Q8P B;  7FD1 A;  3M6X A;  1M5V C;  2NQP A;  1R8P A;  5A6P A;  3CTR A;  4FZV A;  3PO5 A;  3OR1 B;  2VB6 A;  3TRG A;  2AP6 A;  2KFZ A;  3D9B A;  2CJX B;  2CJB A;  3RB0 A;  3Q0A A;  4B3O B;  2ZKT A;  1Q7L B;  3TA1 A;  1VJQ A;  2Y1R I;  4MKY A;  4YN3 B;  2C22 A;  4B3R F;  2AJ0 A;  3MM7 B;  2UUB F;  2NZ4 A;  4RW7 B;  1HWL A;  4NMX A;  3M6V A;  3JQK A;  3CPW R;  3FGV A;  1GTH A;  2DIV A;  1IJE B;  3H5Y A;  3K8W A;  2F7V A;  4MH8 A;  4JI5 J;  3SQG B;  1NB7 A;  4ZVO B;  3T41 A;  1DLO B;  4X66 J;  3PW0 A;  4DR1 F;  1UA1 A;  3H5U A;  1FI4 A;  1UFL A;  3FEX B;  3RRK A;  4RO0 A;  5ETK A;  3C66 A;  1HNX J;  2RU9 A;  1N32 J;  2HHU A;  4EO8 A;  4FVC A;  4RNH A;  2AZ1 A;  1KQF B;  4FPI A;  1KLM A;  1S99 A;  2HHP A;  2FVC A;  3T5J A;  2WVF A;  5F3T A;  2HHS A;  2AGO A;  2N3L A;  3DRX A;  3DFE A;  2LU1 A;  4I2Q B;  2IBK A;  1C1B B;  4IG3 A;  2G2Y A;  4J9R A;  2FVQ A;  1VLO A;  2HS0 A;  1NDC A;  4DV3 F;  4I4B A;  5KFT A;  3GLJ A;  5I3Q A;  3RRG A;  2HRY A;  2EFP A;  4R0E A;  4BBY A;  4ELT A;  3QLH B;  5HBM A;  5LSL A;  1NJX A;  3KDN A;  4DV5 J;  2BJE A;  3CE8 A;  2QSF A;  5A8W A;  4X4U A;  1CJU A;  2UXB J;  1QE1 B;  2E1R A;  3SIP B;  2EC0 A;  4DL7 A;  2BA9 A;  3LP2 B;  3TA0 A;  3IM8 A;  1O0P A;  1QTN B;  2D3O 1;  5KT2 A;  1SV5 A;  3WIU A;  2CPI A;  3L9Z A;  1KQG B;  2YWW A;  2RD5 C;  4DQQ A;  2XY7 A;  5KFV A;  2R8K A;  2CPJ A;  1CS4 B;  4DCO B;  3ILJ A;  4N41 A;  3KHL A;  3GR0 A;  1WC4 A;  3OJU A;  4R8U B;  1HI0 P;  3H7H B;  4K2J A;  3ZO7 A;  2OPP B;  2BJD A;  3BS9 A;  1UA0 A;  3QO9 B;  4WTY A;  2YWG A;  1RA6 A;  3OPK A;  5FDL B;  4N8O A;  3EVM A;  3VGT A;  4J37 A;  1PKU A;  1X9S A;  4TYB A;  3ITH A;  3AOD A;  2IMO A;  3A13 A;  1SQG A;  3MFH A;  4TQR A;  4PZV A;  1E6V B;  3ZZY A;  4I69 A;  3BBF A;  2CPX A;  1AFJ A;  4FBU A;  4OHV A;  3PRV A;  2GZO A;  2H5J B;  2VOP A;  1T03 B;  2HZC A;  4OMF G;  1S6O A;  2R8H A;  2Z0G A;  4NLO A;  4DUY J;  4YB1 P;  2GJ2 A;  1F5C A;  3M8P B;  1VC6 A;  2HNZ A;  4QYZ K;  2CIM A;  4KO0 A;  3R6G B;  2MPU A;  3NCR A;  2CJK A;  2MY8 A;  3I0S A;  3JAM U;  4ZDN A;  5A76 A;  1T7P A;  1VIS A;  2DY1 A;  1U25 A;  5E5N A;  3CJS A;  3KLF A;  4Y2M A;  2H5E A;  3LTO A;  1JJ4 A;  4C0B A;  1PO6 A;  1Z2Z A;  4AFF A;  4B9L A;  2CXE A;  2XO6 A;  3N5B A;  4HAC A;  4AYB D;  1OSC A;  3NLC A;  1F5B A;  4LF4 J;  4GKJ F;  1SKR A;  4CCH A;  1FRL A;  2FVS A;  1WOO A;  2DIU A;  3M2U B;  5EDW A;  1O5J A;  2APO A;  3BO4 A;  4H4O A;  4PXB A;  1U26 A;  3MPU B;  4AD6 A;  3CW2 C;  4A8K A;  1F3V A;  2VJV A;  4DR7 F;  3MM8 A;  1I5O B;  3D3C J;  2Z58 B;  4OJ1 A;  3WC0 A;  1VQ9 S;  3JB9 k;  1UWB A;  2YQ1 A;  4C3K A;  1FER A;  1HQE B;  2BEF A;  3DRR B;  1XNQ J;  3PFO A;  3PRD A;  1IM4 A;  4KIA A;  3FFI B;  3H0P A;  1WC0 A;  1XMQ F;  1MLA A;  3UD3 P;  1FES A;  1Y10 A;  1X9M A;  1VK3 A;  1IN0 A;  4Y28 C;  1BQM B;  3KLG A;  1RU2 A;  2LQ8 A;  1FRX A;  2DNR A;  1RWV B;  3CMQ A;  4KBI A;  3OQ2 A;  5E3P A;  2CA9 A;  4DUZ J;  2KM8 B;  2I6W A;  2QL7 B;  3LP1 A;  5DLF A;  4DR5 J;  5H1S V;  2D7S A;  2DH7 A;  4JI0 F;  5J2N B;  5A0Y A;  1HLW A;  4P73 A;  1XMO J;  2VG6 B;  2K06 A;  2G2O A;  2XY5 A;  2VBY A;  2VC0 A;  4Y34 A;  4BS2 A;  4RU9 A;  4URQ U;  2CQ0 A;  2HFN A;  3CCM S;  2UV8 A;  1RAE B;  1VR6 A;  3T5K A;  4CLS A;  4LMZ A;  6AT1 B;  2RVJ A;  1AYE A;  2ZKU A;  5K14 B;  4DN0 A;  5D6G A;  4IG0 A;  2ACY A;  1BWV A;  3PNI A;  4Y2I A;  4MTP A;  1X9W A;  1S48 A;  3ILI A;  2EXU A;  5M2U A;  1N36 J;  3DRP B;  5IQ6 A;  5JMN A;  1P1L A;  2R7R A;  1S1W A;  1TV6 B;  2FJW A;  2LA6 A;  3AD9 C;  3OHB A;  3H4D A;  1YJW S;  4DL0 C;  1JKH A;  2IVY A;  3T9N A;  4J90 A;  1UPM B;  4U67 Q;  3MTJ A;  4UOH A;  1IWA A;  5ETQ A;  1VQP S;  1WC3 A;  3JSM A;  2W7O A;  5AJ3 F;  5I42 A;  2OEJ A;  4PEO A;  4USU A;  3VV2 B;  1VQ7 S;  4WTO B;  3GFY A;  3A1Y G;  1NH7 A;  5CA5 A;  1FRJ A;  2JC1 A;  4MAK A;  3MTK A;  2C2O B;  3KFW X;  1EZZ B;  3I5A A;  3DMJ A;  3BQ0 A;  2GGP B;  3LO3 A;  2ZD1 A;  1CC8 A;  3GB0 A;  2L9W A;  2XLK A;  3EPI A;  1D9F A;  3CCS S;  3M7V A;  4F02 A;  3DLG B;  1C1C B;  1YIJ S;  2BKP A;  4R5P B;  2JVR A;  3I4H X;  4WPA A;  3T1A A;  3BEG B;  4M95 A;  4OLO A;  1QUP A;  1YRX A;  1MMN A;  2WSE C;  3J81 U;  3BGR B;  4URS A;  2QZ8 A;  4AT1 B;  2FC9 A;  3SMZ A;  2E1M C;  1S6U A;  2F40 A;  2R7S A;  3M6W A;  3PHT A;  1SJF A;  1RDR A;  3H90 A;  4FN5 A;  4PAA A;  3CDA A;  4OJH A;  1HBU A;  2CQP A;  5L8R C;  1S9F A;  1A0O B;  1DBD A;  1S4E A;  2PGC A;  3E51 A;  3BF4 A;  2EVZ A;  5F8L A;  4EEY A;  2XB2 D;  3P8B B;  2E7X A;  3AD7 C;  4JI4 F;  2DH9 A;  4F2S A;  3P49 B;  4I6A A;  3IWX A;  5K8O A;  4LFA J;  1QAY A;  2E1A A;  4TN2 A;  1DHM A;  1KFD A;  4OZL A;  5IWA J;  4J9K A;  3UFC X;  5F9L A;  3KK1 B;  1HNV B;  2B6A A;  3US5 A;  4FF2 A;  1HQ2 A;  4KFB B;  4KYZ A;  4DL5 A;  2IJR A;  4HKQ A;  2K2P A;  2DNQ A;  1KQK A;  2PSZ A;  1E6Y A;  3EYZ A;  2DJW A;  2YPZ A;  5JXS A;  1T05 B;  2NPI A;  3D6M B;  1K0V A;  1WC1 A;  4WU2 A;  2UXB F;  1DAR A;  1RJJ A;  2P5V A;  2YQ3 A;  3IP0 A;  1Q8L A;  1BUX A;  2IYI A;  2MKY A;  1C4C A;  2HK2 A;  5CXT A;  1Q78 A;  4GC6 A;  2QJ3 A;  4OX7 A;  4I67 A;  3D6F B;  2CQ2 A;  2QMU B;  1PBU A;  2VH7 A;  2RIJ A;  4NLV A;  3KJV B;  1YIT S;  3F41 A;  2RDI A;  2AEJ A;  1VHI A;  3KK3 A;  3M32 A;  2LEA A;  1RTD A;  4G1I A;  3GU0 A;  1F9E B;  2V8P A;  1REV A;  3G2X A;  1NJW A;  2OIH A;  2RU3 A;  1NKC A;  3TVK A;  4JI3 J;  3EJM A;  2QIF A;  4IH7 A;  4KH1 B;  1OPZ A;  1Q81 T;  1SXL A;  4CLY A;  2XMJ A;  1N34 J;  3FC9 A;  3SSR A;  1XTZ A;  4JI7 J;  3QJL A;  2PA3 A;  2GVD A;  2FD2 A;  3U27 A;  3HDS A;  2FZC B;  2MZ1 A;  2HSE B;  1VHF A;  2R3V A;  2HVI A;  4EYH B;  3CJK A;  3RRH A;  3CCE S;  2DRA A;  1X4D A;  1XMB A;  4NRT A;  3M30 B;  4OJG A;  4X64 F;  1YRU A;  2UV8 G;  2M52 A;  1X0F A;  1IKY B;  2VQF J;  1KSP A;  1XER A;  2HMI B;  4K5R A;  3VGV A;  2RML A;  2AEF A;  4TVA B;  2E9Z A;  1ARO P;  3LQV A;  1TUW A;  2D3U A;  2MQP A;  3BBC A;  4W90 B;  2XNR A;  4ZJQ A;  4ZVU B;  1NSA A;  3MF5 A;  3HPO A;  1T3O A;  1AXQ A;  2OP5 A;  1ZPW X;  4ZVP B;  3H2V E;  3VAG A;  3G86 A;  3AT1 B;  2CQD A;  3UCZ P;  4A8Q A;  2J7W A;  2UZA A;  5GMD A;  2AWZ A;  1FXR A;  4IOB A;  3FEY B;  1WKJ A;  4C8O A;  4JV0 A;  4LFB J;  3TVZ A;  4I6W A;  5L46 A;  4J9N A;  3HT0 A;  4A46 A;  1CC7 A;  3MMB A;  3MEC A;  2OLW A;  2KFN A;  5KT5 A;  4CLW A;  4ID5 B;  2E5I A;  2KI2 A;  5E33 A;  4WF9 Q;  2AF6 A;  1NEE A;  3W63 A;  1S12 A;  1HPZ A;  2CVE A;  1I3O B;  3SDE A;  1X5S A;  4IDK A;  4Y65 A;  3HZE A;  1TFW A;  2J76 E;  2EK1 A;  1KLN A;  2N4D A;  2Q3P A;  4DV6 J;  3TEH B;  3PJW A;  1KS2 A;  3TJA A;  3IR7 B;  2ZH3 A;  1UTA A;  4GRS A;  1JLF B;  1R7I A;  1U24 A;  1LWF A;  1JLB A;  4ED1 A;  2HWT A;  1NK9 A;  3Q24 A;  1JJ2 R;  5F8H A;  1K8A T;  2G1H A;  1PAU B;  2IJN A;  1VRT A;  4GVL A;  3HF5 A;  3DLE B;  2W9B A;  4ZVG A;  4F3O A;  3UQS A;  3LP0 B;  1TL3 A;  5KG3 A;  4YFU A;  1FKP B;  1KR4 A;  4X4R A;  1OWX A;  1XMO F;  5JVG Q;  3N01 A;  1U7L A;  3LOU A;  2OSR A;  5B0A A;  5KG7 A;  1BGX T;  3GIL A;  1JLG B;  1X4G A;  1CG2 A;  1OYD A;  3K57 A;  3D3B J;  4LT6 A;  3KMS A;  2RKI B;  4QYR A;  4WBF A;  1S1T A;  2MEW A;  2MLY A;  4I56 A;  3F73 A;  1Q8K A;  5J2P B;  4RPF A;  5CCL A;  2UUC J;  2IC3 A;  4GO7 X;  1U1Q A;  1GXU A;  1T3N A;  3VHQ A;  4U7U D;  3TAP A;  2OEK A;  4IFY A;  2V8H A;  2RF2 A;  1T9W A;  3CNQ P;  3MM9 B;  5F41 A;  4NE9 C;  2ZJQ Q;  2KFY A;  5H9F J;  4BLG A;  3L7U A;  2BOA A;  3DC2 A;  2AGP A;  3NBP A;  4H4K A;  3PRB A;  1VBZ A;  3HT3 A;  1N8R T;  2Z8Q A;  4EO6 A;  3V6K A;  3LUY A;  5AXN A;  4BC7 A;  5KG0 A;  2VA2 A;  4XPC A;  1NKE A;  4LF8 F;  1H2T Z;  1B4S A;  5M2P A;  2XSF A;  2GO9 A;  4YDD B;  5IC6 B;  2OPQ A;  4LRD A;  3MUT P;  3FMB A;  4LR8 A;  3H4B A;  5DGA A;  3KK2 A;  7AT1 B;  3QQC D;  4X4O A;  1RTH B;  1FKO B;  3RBZ A;  4ANC A;  4TU8 A;  4AXI A;  3EIC A;  3CUL A;  4ER8 A;  2CDQ A;  1UP1 A;  1WAC A;  1VQ6 S;  4WII A;  2XY6 A;  5DG8 A;  1A9N B;  3IWN C;  4KGM A;  1WTF A;  3RB3 A;  1TAQ A;  4NXN F;  3I5B A;  4HH0 A;  5MLC V;  5D3G B;  3ENA A;  1UW9 A;  3QID A;  1RBA A;  4EMD A;  4ZMM A;  2W2Q P;  3OVB A;  1X4B A;  4CYU B;  5I4M A;  4QWC A;  2CKW A;  5DG9 A;  3R5B A;  5FD1 A;  3A3N B;  4UW2 A;  4ES1 A;  1XN9 A;  1T9X A;  1CUL A;  3D66 A;  1JK9 B;  1HMV B;  3GFH A;  2FB0 A;  4IRK A;  3T1H J;  3VGU A;  2WW4 A;  1FF2 A;  3IMQ J;  5GAD U;  5T41 A;  3ZZU A;  4P2F A;  2OTL S;  3IR5 B;  4LF5 F;  1UVL A;  2QFI A;  3J80 Y;  2ZVS A;  2LEP A;  2J9C A;  3BN4 A;  1PC5 A;  1SQE A;  3A12 A;  1NPP A;  1Q0N A;  1WDT A;  4M5D B;  4H4M A;  2BAC A;  1ZPV A;  2WON A;  2HGL A;  2OMO A;  4ZKA A;  1HNI B;  1R0B G;  4RL1 A;  3M8Z A;  1K47 A;  3M8S A;  5D0H A;  5IT9 Y;  3FKB A;  2CPH A;  1HQU A;  2BR0 A;  1YSJ A;  3W5Y A;  2I5J A;  2G2Z A;  3GZ7 A;  2QYG A;  3G71 S;  5KOW A;  3X3U A;  2W9A A;  1PBA A;  4TKT A;  2DK2 A;  2XUL A;  3GSD A;  3V6H A;  1H74 A;  3HJF A;  3JS9 A;  4GKK J;  4A8M P;  1FFW B;  1H38 A;  1XR6 A;  1RWN B;  4G6V B;  4M5G A;  4B3O A;  1B70 B;  4JV5 F;  3MAQ A;  5KG1 A;  1NK7 A;  2DYA A;  4OZN A;  4JI3 F;  3I87 A;  4RW4 B;  2HK3 A;  1MWQ A;  3VR1 A;  1NLK L;  4RW7 A;  2DXD A;  2AMC B;  3B54 A;  1TKT A;  3T3F A;  2A2D A;  2DNY A;  1F60 B;  5E3C A;  2KM8 C;  1JLC B;  4X62 F;  1R89 A;  4KHP F;  3V4I B;  2FLO A;  1S1X B;  1FJC A;  4OZ5 A;  3SQG A;  4CT8 A;  1WI6 A;  5K8P A;  3CGI A;  1PIL A;  1P8G A;  2JEJ A;  5D0R A;  3IRX A;  2W9C B;  4ZCK A;  3Q8Y A;  4AE5 A;  4QU7 A;  1U6F A;  5HSP A;  2HVD A;  1KON A;  5KFZ A;  4XIU A;  1D8Z A;  2EFQ A;  4KGV B;  3TAM A;  2NSB A;  1WKK A;  2U2F A;  1DTQ B;  4PKD B;  3NG8 A;  2UUW A;  1CJT A;  2UVW A;  1VBK A;  2LQJ A;  3M6U A;  4KHR A;  3JXO A;  5BYQ A;  3B8H A;  2F9J A;  4C98 A;  4I2Q A;  1C1B A;  4CQ1 A;  1PJ6 A;  2PFD A;  4MT1 A;  3IAM 9;  1TL7 A;  2YNI B;  1WHX A;  2A6O A;  3C6U A;  4P2M A;  2B9W A;  3CCW A;  3QLH A;  2V68 A;  3UR3 C;  2L08 A;  2W7A A;  3GMG A;  1S0M A;  1U1O A;  5CYQ A;  1QE1 A;  2QE5 A;  3BSA A;  1CJV B;  2QMX A;  3QMQ A;  1NB2 A;  1DJ0 A;  2MQN A;  3SCK E;  4P10 A;  1YI2 S;  2HHQ A;  4RNM A;  4ZA1 A;  4RJV A;  1S97 A;  5AE3 A;  2M88 A;  3ZTR A;  4OYO A;  5IZH A;  2W24 A;  5K8N A;  4PWD A;  4I2P B;  2OHD A;  2ZH8 A;  3EZO A;  1IKV B;  4MFB B;  1P1T A;  1TKX B;  3L3C A;  4J9U E;  3CJ2 A;  4IYQ A;  2HBQ B;  1R31 A;  1CS4 A;  4B9T A;  4LF9 J;  3MED B;  2F4V J;  2LCW A;  4X2B A;  2LEB A;  4JBC A;  2MKC A;  1S0O A;  2PMH A;  3QRR A;  4NCG B;  1OS5 A;  2OPP A;  2OD6 A;  2AHO B;  3QSI A;  3QO9 A;  3KHR A;  3MOJ B;  3OL6 A;  3SCJ E;  4LF7 F;  4ZLJ A;  1EB0 A;  2F8H A;  3EE3 A;  1RT4 B;  1EP4 B;  1S6P A;  3KG0 A;  2EWH A;  5ETN A;  5KG5 A;  3THV A;  1U2F A;  2R2U A;  2M7S A;  3DLJ A;  2PI4 A;  2R7V A;  1T03 A;  1P27 B;  3CXC R;  3DM2 A;  3P3D A;  1VJW A;  2I38 A;  4KR0 B;  2YBV A;  3AHP A;  4DCP B;  2UXC F;  3R9L A;  1RA7 A;  1DFD A;  1M90 T;  2VON A;  2FGO A;  2AGQ A;  3M8P A;  3K5L A;  4RBV A;  2W2O P;  4Q0B B;  5A2Q U;  4LVO P;  1NPR A;  1NO8 A;  2HFS A;  1ZH5 A;  1ZAX A;  3AQP A;  4FXV A;  3VCD A;  1RWK B;  2RH3 A;  4J9Q A;  4DHV A;  5SUH A;  5K8M A;  4UTG A;  4DQS A;  4Y0F A;  1IBM J;  1U1N A;  3HHN B;  4OV6 A;  1YGY A;  4B17 A;  3HHK A;  3MOZ A;  1N54 B;  5C5J A;  2NXU A;  3O44 A;  3TZX A;  2Y8Y A;  1RT6 A;  2YKM B;  3I82 A;  3CB4 A;  3M2U A;  2B56 A;  4FP9 A;  1X31 C;  4F04 B;  4X65 F;  1OJ4 A;  1VS3 A;  1H7W A;  1Q79 A;  4NXM F;  2AYE A;  2Q79 A;  1K44 A;  4PYD A;  4K4Y A;  1BXN A;  1IVZ A;  3ETM A;  2D69 A;  1G3O A;  2XMK A;  2FIU A;  3DRS B;  2HND A;  2QTW A;  3NNA A;  3PEH A;  4WP8 A;  1G1X A;  3MM5 B;  1HQE A;  2MKK A;  1EKR A;  3DRR A;  3C6T B;  3LA0 A;  4HHH A;  2F65 A;  4ED6 A;  2AU0 A;  1HBM B;  3TJ8 A;  2XZD B;  3NMR A;  3RGI A;  2JWN A;  4DWI A;  1AT1 B;  1BQM A;  2V4Q A;  1F9F A;  3AXK A;  3FUY A;  2MST A;  3TNV A;  4HYK A;  3RUB L;  2HLT A;  1U1K A;  5HP1 B;  5L1K A;  2C3Y A;  2IAJ B;  5AXL A;  2JSX A;  3GJQ B;  4RW6 A;  4NI2 A;  5D4N A;  2QL5 B;  4PWU A;  3Q8U A;  3OUY A;  2J0S D;  3VAL A;  4LQ3 A;  2ZM6 F;  4NYO A;  2AJ2 A;  3UDC A;  4I1T A;  4C0O C;  4USK A;  1D9D A;  1TL4 A;  4O4R A;  1R0A B;  2WOM A;  2PFF B;  1T9T A;  3QRQ A;  2LP4 A;  3IN5 A;  5J2N A;  4EBD A;  2VG6 A;  4QWA A;  3GV8 B;  2XMW A;  3UR0 A;  5DZ7 A;  4QIW D;  2VPZ B;  3KYL A;  2HQC A;  3Q8R B;  2HIY A;  1BLU A;  2AKW B;  3IO1 A;  2CZ9 A;  2QSW A;  3PYF A;  1RLC L;  3MM6 A;  3JSR A;  3ONQ A;  2XQC A;  1UVM A;  3QGI A;  3NNH A;  2E5H A;  3BDP A;  1RAB B;  3KG1 A;  2P6S A;  4OYW A;  4IKA A;  3F56 A;  4M5N A;  4CRJ A;  3HMJ G;  1UET A;  5C2G A;  2FJD B;  1ZTW A;  3C3L A;  1B0P A;  2DTJ A;  4F50 A;  2N7C A;  4KGX B;  3MR5 A;  4CLK A;  1TUG B;  2FY8 A;  1C0T B;  4ZLL A;  1CJK A;  3ZZT A;  4NLG A;  1RYS A;  5F8G A;  2UUT A;  1RIS A;  3W8P A;  2YNG B;  4DV4 F;  3L09 A;  2GGP A;  1RHJ B;  2HQF A;  1KVJ A;  5C24 B;  4OHY A;  4DEZ A;  1TUV A;  4LF2 A;  3DLG A;  3V4M A;  2AYM A;  2F5G A;  1C1C A;  5DJB A;  4A8O A;  4DSE A;  3AA9 A;  2MYF A;  4KV8 A;  3CF5 Q;  1Y7P A;  5D0G A;  3FSI A;  5EUH A;  5LMN J;  3DDN A;  3VAF A;  3OSN A;  1EQM A;  4DR4 F;  1X4E A;  1IKW B;  1NCL A;  5KFY A;  3TJ9 A;  2B7C B;  3ZZO A;  4DU8 A;  2YKN B;  3CJ3 A;  3T6B A;  4MYU A;  1SC3 B;  4CO3 A;  4OLP A;  4BC9 A;  1DAX A;  2DNZ A;  4PUO A;  5KT3 A;  2HHT A;  3VAK A;  4DV0 F;  1B99 A;  1JJC B;  5GME A;  3W66 A;  2VIC A;  2GX8 A;  1M5S A;  3V6D B;  3G96 A;  2QL9 B;  1U0S A;  4ALZ A;  1VDH A;  2M2B A;  2MZR A;  3T1Y J;  4V1A k;  3I56 S;  2Z4P A;  2GHV C;  3GP9 A;  4TY9 A;  3R8Y A;  4RKU C;  3F44 A;  3K17 A;  1NDP A;  1HWU A;  4DFM A;  1HI1 A;  5KFN A;  1D0E A;  2BE7 D;  5CHC B;  2E9T A;  1S7I A;  4WJB A;  2GW8 A;  3QWU A;  3RR8 A;  1HNW J;  2W4C A;  3OLA A;  2ZHB A;  1CSJ A;  3EGN A;  2DXF A;  3KK1 A;  3EVO A;  1YRT A;  1HNV A;  1FO1 A;  4OV1 A;  4M63 A;  2F8M A;  4KFB A;  3SSQ A;  2C2R A;  5JUM A;  5IQQ A;  2ZDP A;  4P74 A;  1S10 A;  1SQF A;  2K1R A;  2LXF A;  4UUX A;  4F26 A;  4JV1 A;  4WXW A;  3IR6 B;  2NS1 B;  2ZC4 A;  4RZR A;  2MZQ A;  2OD4 A;  2N7Y A;  2FHK A;  2R2S A;  3DKD A;  2UP1 A;  2RQC A;  3IS9 A;  3N6M A;  1LW2 B;  1OMS A;  3G8Q A;  1V6H A;  4NLX A;  4YP3 A;  3I0R B;  2NR0 A;  4O0N A;  5LMU F;  2X51 A;  4ZPV R;  2IJF A;  1H3D A;  3BQ1 A;  1W2I A;  1RTJ B;  1VGY A;  1AA1 B;  5LXR A;  3K5O A;  2UUA J;  2QG9 B;  2F4V F;  5HK4 A;  4DF8 A;  1T95 A;  3CCV S;  3BBB A;  2D1C A;  4FKY A;  2FJX A;  3FRY A;  2OPR A;  4RUH A;  2HPU A;  3R7N B;  2POK A;  2KRR A;  3MPY A;  3Q2T C;  4Y3C A;  3RW6 A;  1K0T A;  1Q1K A;  3M8W A;  2EFV A;  3R27 A;  3FJ2 A;  2R8G A;  4USI A;  1Q8B A;  3EDR B;  5GVQ A;  4F4W A;  4LJM A;  1SBR A;  5BYS A;  2M5Y A;  1MU2 A;  1PAE X;  3U1N A;  1VRU A;  4RNF A;  1DTT B;  4ECT A;  1DRZ A;  2V2V A;  3BN7 A;  2H9Z A;  3KLI A;  3C16 A;  3MDF A;  1FEE A;  1UJ6 A;  4IO1 A;  1RAH B;  4IR9 A;  2NSC A;  3QT5 A;  1OQ6 A;  4KH0 B;  4MIW A;  4JI1 J;  1IKY A;  2GS8 A;  5DG7 A;  5A8K B;  1Y5N B;  2MSS A;  3A8J A;  3GJT B;  2RDD A;  3UDL A;  3UI3 A;  5T14 A;  5IV3 A;  3LWL A;  2HEK A;  2FJV A;  5CCM A;  3HFV A;  1H7X A;  2GMJ A;  2DVI A;  4RUA A;  2MGZ B;  2DRD A;  2X7I A;  3ET6 A;  1YG0 A;  5I3U A;  1AW0 A;  1ZS6 A;  4LFC F;  3RAX A;  2XGP A;  5BR8 J;  2HBZ B;  2Y3Y A;  1OO0 B;  3NMA A;  4F8R A;  5ITH A;  1SI9 A;  3TI0 A;  3FZ2 A;  2A0F B;  2GC8 A;  1NRK A;  5IM0 A;  4B3S F;  1ULR A;  2WAQ D;  4CLZ A;  3AD8 C;  2ZNY A;  1MSW D;  4A4J A;  2VAS A;  3M2R B;  3NGR A;  2B4P A;  2L9D A;  2HRT A;  4WP3 A;  4WFZ A;  4A8X A;  3D1Q A;  3M8Y A;  5EX3 A;  1ITP A;  4ID5 A;  4KJI A;  3J7A 1;  4RBT A;  5L1J A;  3RAQ A;  1SIZ A;  4QWB A;  2BV3 A;  2W4P A;  3V81 B;  2E5G A;  4ZN1 A;  3E01 B;  1F0X A;  1FD2 A;  4IQM A;  4YHH J;  4IUF A;  5DDQ C;  1IJF B;  2D3O R;  2ASL A;  4DL2 A;  4DQR A;  4ZIW A;  2FJA B;  1JLF A;  1HYS B;  1TQL A;  3U1M A;  4WK1 A;  1NH8 A;  3G4S S;  1TAU A;  3B78 A;  4QWE A;  3UWT A;  1HR0 J;  5F0W A;  1IUJ A;  2CVI A;  1OY8 A;  4UOC A;  3J7A N;  2K7J A;  2P9E A;  1GXT A;  2HVE A;  5D4P A;  1S1V B;  3DLE A;  2DGS A;  2BZ2 A;  3VWS A;  2CWX A;  3PX0 A;  2RUG A;  3LP0 A;  1VQN S;  4QIV A;  5EX0 A;  4DG1 B;  4DR6 J;  2BAN B;  1KNZ A;  5RUB A;  4MK9 A;  3BKF A;  5DM6 Q;  2BE2 B;  3R6L B;  5AE2 A;  1X4A A;  1L3V A;  1YBA A;  2CPZ A;  5J2M B;  1JLG A;  3GWC A;  5G0R B;  3GE9 A;  2R2T A;  5JJB A;  5ETP A;  5KT6 A;  2L41 A;  2NXJ A;  1YTY A;  1U1M A;  4RWW A;  5FLX Y;  1M1K T;  1U8S A;  2ZWP A;  2FHJ D;  3G6X A;  1FJG J;  2XLI A;  2Q6B A;  4LSN B;  4L75 A;  2KRB A;  5KFO A;  4ERD A;  2RQK A;  4YY3 F;  3DDK A;  5E0O A;  2ZZM A;  5HI7 A;  3BH6 B;  2W4D A;  1FXD A;  1RT3 B;  3TZW A;  3QSY B;  5B0B A;  3E2E A;  1HHS A;  4RU2 A;  2XMT A;  3CCQ S;  4BHQ A;  4AXJ A;  5HLF A;  1MWZ A;  3EUN A;  5J2Q B;  1M5K C;  3O8W A;  2QC3 A;  5HRO A;  1LQ9 A;  1MRO A;  4GO5 X;  5C25 B;  4IRC A;  1KTQ A;  2CAJ A;  4AQY F;  3IAS 9;  2MQM A;  2M4M A;  2DGQ A;  4MYT A;  3IXQ A;  3CJ5 A;  5KFM A;  2OO4 A;  2QLF B;  1V5I B;  2B7B B;  4WP9 A;  4YQW A;  3HFK A;  2CQI A;  3RJM B;  2LVW A;  4NLW A;  5LMN F;  2HG4 A;  4J7C A;  2DRB A;  1KP6 A;  2ZZN A;  1YJT A;  3MAA A;  4K4X A;  2QMW A;  4ED2 A;  1SL1 A;  3H42 A;  2MZT A;  5GAH U;  3ENV A;  1SL0 A;  5IS2 A;  1Y00 A;  4A8F A;  3BM7 A;  3DLB A;  4WXO A;  1SCJ B;  3Q89 A;  1GH8 A;  1TU0 B;  4EUV A;  3H5S A;  4YEA A;  2NUU G;  1QVF R;  2N3O A;  3K59 A;  3DXS X;  4RUB A;  5D4L A;  4OI1 A;  2H1Y A;  1S57 A;  4LR7 A;  3W8G A;  2OML A;  5D3G A;  4UQG A;  3T1Y F;  1RKJ A;  4NML A;  3OFH A;  2NZC A;  2YY3 A;  4HHU A;  1FWK A;  1RXO B;  1LK5 A;  1FDN A;  2AX1 A;  5EGY A;  1EHW A;  2WRM A;  1RSC A;  2XMU A;  2B5J B;  4FYX B;  3HHL B;  1HMV A;  4C11 B;  3CJ0 A;  2CDR B;  4ECX A;  2LDI A;  4GVB B;  2W2M P;  1X4C A;  1N5Y A;  4W92 B;  3OTO J;  3OSP A;  2DHH A;  2CQC A;  3OHA A;  4TY8 B;  4JI8 J;  2DGV A;  1VC0 A;  4ECW A;  1OY6 A;  4DR2 J;  3M4X A;  2PA8 D;  3L7O A;  4LBI A;  3LGM A;  3QT7 A;  1Q5V A;  2MY7 A;  1JNZ B;  1FX2 A;  3MXH P;  1M1G A;  2Z2M A;  4CLT A;  4O3N A;  3WZ0 A;  1GMV A;  3C2P A;  5KFH A;  2KB2 A;  2PN6 A;  2FLL A;  4OYA A;  5KFE A;  2C42 A;  4W98 A;  3FCH A;  4HT5 A;  4NLR A;  4ECV A;  3GYN A;  2XLJ A;  1L3S A;  1RTI B;  4L6V 3;  1VQS A;  1ZZF A;  4O44 B;  2VPY B;  2JLG A;  4RW4 A;  3DLH A;  4H54 A;  4ZPT R;  2NXE A;  3S1T A;  2VQE F;  1U02 A;  2IPO B;  2XBP A;  2E1C A;  1NPK A;  2DBB A;  1M5H A;  4ILM A;  2GA7 A;  3QAE A;  4RW8 A;  4ZIT A;  3OJS A;  1UEU A;  2GAH C;  2O3D A;  1JLC A;  1NSQ A;  3V4I A;  4JYA F;  2WK4 A;  1IBL J;  2CYY A;  2MDA A;  3MEE A;  4FYY B;  4DFJ A;  2XSJ A;  4HEA 9;  2R7W A;  4KPY A;  4NYZ A;  2MHN A;  4LBP A;  2QA2 A;  2E5L F;  2G13 A;  3D5M A;  3K7R A;  4TU9 A;  3CUN A;  4NAS A;  1FDD A;  4OHZ A;  4K50 A;  4DSL A;  3M05 A;  1DTQ A;  2K8G A;  1VIO A;  3NWR A;  1I94 J;  1U09 A;  1UVJ A;  2JL9 A;  4DS5 A;  4DF4 A;  2I2Y A;  1V3Z A;  3TUZ C;  3R5G A;  2HAI A;  4IG3 B;  4F3M A;  4NX9 A;  3DU6 A;  3T5L A;  1QJH A;  2MLX A;  1N88 A;  1XR7 A;  4FYV B;  4LIR A;  1A7G E;  4YME A;  3NAI A;  4N7T A;  1N52 B;  3E3X A;  3TX0 A;  2XEX A;  2B0G A;  3AB2 B;  2GFF A;  3JSY A;  3CO0 P;  5DQH A;  4DV2 J;  3UNY A;  3C15 B;  3UVJ B;  1HBO A;  1J5E F;  3CCZ A;  4ILR A;  2ILY A;  3MUM P;  1CLF A;  4B3M F;  1I1G A;  3DYA A;  2PD1 A;  3EZ5 A;  2V67 A;  3PV8 A;  3THT A;  1WDD A;  1Q82 T;  1MN9 A;  1Q4R A;  4TNO A;  5I3P A;  2DNK A;  1FFS B;  1F2H A;  3JTO A;  2VOO A;  4ED0 A;  1YQH A;  3KG4 A;  2PEH A;  4CO1 A;  1IKV A;  4MFB A;  2MB0 B;  2DH8 A;  3MD3 A;  3MED A;  3MMA B;  1RZM A;  3PX6 A;  2DNO A;  3PHE A;  4CDI A;  1KEK A;  2DGT A;  4KKO A;  4NCG A;  1G4C A;  2H3E B;  1SKU B;  2JHE A;  2JZ5 A;  3V2U C;  3V5R A;  1RWX B;  4DDF A;  4TU7 A;  1SJ1 A;  1W2B R;  4ZHR A;  3OVS A;  4ECU A;  2M3D A;  1ZA2 B;  2DD8 S;  3ITH B;  4DV1 J;  3RW7 A;  2R7O A;  4U9R A;  1RT4 A;  1EP4 A;  3VQS A;  2KL8 A;  2YKP A;  5AE1 A;  5C2C A;  3KOA A;  3C46 A;  2E66 A;  2GAG C;  2RS2 A;  2GQ2 A;  4K4T A;  2RT3 A;  1L3U A;  4URG A;  4UY8 T;  2FJE B;  4YUD A;  2OUG A;  2XG8 A;  3M2V B;  1F5A A;  1PGZ A;  2ZH4 A;  4Q0B A;  4KO0 B;  4G3I A;  3OD2 A;  5KFQ A;  3W9I A;  1YVF A;  4NCA A;  4CH7 A;  1L5U A;  3UW1 A;  1UZH A;  4YOE A;  3HVT A;  2CZ4 A;  4KTQ A;  2VC1 A;  2RHQ B;  4L76 A;  5DQI A;  2NLW A;  2Z2L A;  1FHT A;  1U2C A;  4HHJ A;  4N56 A;  1IBK J;  3JSB A;  4HAC B;  3PR5 B;  2YKM A;  2OGU A;  3CJT A;  3W62 A;  4ELU A;  4QIG A;  2Z30 B;  2QFJ A;  4QJV A;  4H4O B;  3D28 A;  1FNM A;  1QVG R;  1YK9 A;  5E3A A;  2P9C A;  3LPE A;  2BQU A;  4KQZ A;  1D09 B;  4E2F B;  1QAI A;  2CJA A;  2JFD A;  3GJS B;  3UN2 A;  4K2X A;  4B9U A;  1SC1 B;  4O3P A;  3MM5 A;  4K4V A;  2XS2 A;  4HL9 A;  3D1O A;  2NYH A;  4P52 A;  1RE1 B;  3VQT A;  2H4W B;  2OTJ S;  3D4J A;  3M9M B;  2X1G A;  1SIW B;  1UEK A;  2M8D B;  1HBM A;  2WCX A;  4B3T F;  2IVM A;  2V4J A;  3KLG B;  2FDN A;  4O3R A;  4DX6 A;  3CCT A;  2BDP A;  5HP1 A;  4OI3 A;  1EKS A;  5CYM A;  4PXC A;  4A8W A;  1HBN A;  1IXK A;  3DU5 A;  2WBM A;  4WCE Q;  2ZZT A;  3HP6 A;  3V6J A;  2ZOG A;  3AOB A;  5KFJ A;  2JNJ A;  3KMQ A;  3R5A A;  3HI9 A;  1HWI A;  2H4Y B;  3D7S B;  4PG7 A;  5A0Y B;  5G4D A;  4CLL A;  2GMH A;  5L38 A;  5CD4 H;  2BM1 A;  4PPD A;  1R43 A;  2WVE A;  2GIR A;  2LKZ A;  2VV5 A;  1RAC B;  4ES3 A;  2HQD A;  1FNX H;  4ECY A;  3ZZZ A;  1VCT A;  2J6T A;  1DY3 A;  2PE8 A;  3EGV A;  1C0U B;  2DIT A;  3PCO B;  4ZOS A;  1PYS B;  3FMW A;  2IA6 A;  3RZA A;  1NZA A;  4IG0 B;  4YB5 A;  4S0M A;  1RWU A;  3M1V B;  2HFU A;  1UJ5 A;  1ZBT A;  4OHX A;  1ZAW A;  5DET A;  1KRP A;  4V19 X;  3PJX A;  2F8E X;  2VBW A;  3HO1 A;  3NGS A;  1Q16 B;  4CLF A;  3HM9 A;  4AL6 A;  4QW8 A;  1PIE A;  5I42 B;  2WSC C;  4KRW A;  3TA2 A;  4DU7 A;  2X1B A;  1YWX A;  2JLF A;  2J7U A;  1FEH A;  4QBU A;  1JLE A;  4J5O A;  4U96 A;  1K73 T;  2HHH J;  1X4F A;  4FYW B;  3DMJ B;  1DQ9 A;  1PG5 B;  5B0G A;  2QA1 A;  4QYZ J;  1B0T A;  3UN5 A;  1RWP B;  1PJ7 A;  2QA4 G;  2KYX A;  2IDE A;  2QLX A;  5EHH A;  4C7Q A;  4I6Y A;  3RG6 A;  1S6Q A;  2KHD A;  3DGP A;  4X4N A;  1MNE A;  4MK7 A;  1IBL F;  1Y3K A;  3DOL A;  4K0K F;  5HQ8 A;  2DXE A;  2YX7 A;  2H51 B;  1UAW A;  1WG1 A;  1BHN A;  1G2E A;  4C8Z A;  1U0H A;  2L9N A;  1KD1 T;  3AB4 B;  1HBU B;  3HSZ A;  1FVQ A;  1Y5L B;  4TLR A;  1H98 A;  3UO0 A;  4Z37 A;  4XAK A;  3DI6 A;  3KLH A;  2RRB A;  1LEO A;  3ZNU A;  3O1L A;  2XMA A;  1N33 J;  4OX9 J;  3J7Y U;  1H2V Z;  3CJR A;  1XBW A;  1I94 F;  3H5X A;  2D9P A;  2FQQ B;  4ZPD A;  3VGS A;  2HHV A;  2D74 B;  2X3G A;  3HJV A;  2CNK B;  5B0F A;  3OTB A;  2J9D A;  2OSQ A;  3HZG A;  2AJF E;  5E3Q A;  2B6A B;  2D9O A;  2K3I A;  3IG1 B;  5DM7 Q;  4QOT A;  1SL2 A;  1J5O B;  2O66 A;  4P71 A;  5C7P A;  1HWK A;  1WKL A;  3TAQ A;  2UU9 J;  3IA0 A;  1E6Y B;  1VK8 A;  3R3T A;  3WIV A;  3ZC4 A;  3DLK B;  1U2R A;  2BJ8 A;  2ZH7 A;  5HO4 A;  4MIB A;  4JI6 J;  4EU0 A;  2M0G B;  2Q66 A;  1OPI A;  2UXD J;  3TW0 A;  2KTQ A;  1KTV A;  2HFO A;  2J0W A;  2ERR A;  3I0R A;  1R8A A;  4A8Y A;  3OXL A;  4I68 A;  4C8M A;  3QT8 A;  1NDK A;  4FS2 A;  1RT1 B;  1FK9 B;  1S5Z A;  3G87 A;  4MMO A;  2QEX S;  1TK8 A;  2J0Q D;  2IM1 A;  1FD8 A;  5D8H B;  2BJ7 A;  2BXJ A;  5CD4 A;  4ZVS B;  3RB4 A;  1G6B A;  4FBT A;  1RAO A;  1PYO B;  2YH0 A;  4DI6 A;  2JFK A;  1NAQ A;  1YJN S;  4N8N A;  1JIH A;  3FEZ A;  4FXW A;  2RDJ A;  2FHJ A;  1RAD B;  1WSR A;  5HAT A;  1A6L A;  2BJ1 A;  4B3R J;  1ZYQ A;  3G6V A;  3VAJ A;  3KWM A;  4LR9 A;  2UUB J;  3ZTP A;  1VOM A;  4K8R A;  2BE9 B;  2XYG B;  4RNO A;  4QIF A;  4NLP A;  1Y3J A;  1OY9 A;  4DV1 F;  2XNQ A;  5KT4 A;  1XWL A;  3JQJ A;  3LAK A;  3HX9 A;  4QQB A;  2IRY A;  4JI5 F;  1DTT A;  3FCV A;  4IFV A;  1FDA A;  1WC5 A;  4Z7Y A;  1RUS A;  1XEZ A;  1U6B A;  4X66 F;  2N4C A;  4FVM A;  2KT2 A;  3BDE A;  4RWX A;  2ROE A;  1KDN A;  5ETO A;  4C2M A;  3HHL C;  2P9G A;  1HNX F;  1FRK A;  1F6T A;  3H2L A;  4MIA A;  4ZJL A;  3GII A;  1N32 F;  4CO4 A;  2LQ5 A;  4OYB A;  3CVK A;  1APS A;  1VQ5 S;  2VFU A;  3C8Y A;  2WTF A;  2AIR B;  1SH0 A;  5T7L A;  2VPW B;  3D68 A;  1NHK L;  3VAH A;  1BQX A;  3MUV P;  4J9L A;  1R8B A;  1T02 A;  2I8E A;  3D2W A;  1U8W A;  1ZTT A;  4WU3 A;  1Z1Z A;  2YVS A;  4LQ9 A;  1LWE B;  4DPW A;  3M8R A;  3DCA A;  4DV3 J;  3AQO A;  1JJH A;  1EET A;  3ZTO A;  3W5X A;  3CD7 A;  5HL7 Q;  3CME S;  2FZG B;  2MXY A;  4C4W A;  4U95 A;  3CD6 S;  4DV5 F;  3S8S A;  3MWB A;  4L3K A;  2VDH A;  2VG7 B;  5KOX A;  2L48 A;  2V9K A;  2BKN A;  2A3J A;  3M2R A;  2EKN A;  3VVT A;  1YBT A;  2BW2 A;  3MMB B;  1FTC A;  1N4L A;  4LSL A;  3E8O A;  3PYD A;  3VF0 B;  3BQ2 A;  2GVZ B;  5DZ6 A;  4NZ6 A;  1RWM B;  5F3Z A;  3V81 A;  1HPZ B;  3GYG A;  2V69 A;  3IM9 A;  4NL5 A;  1UEV A;  2OJ3 A;  4B9M A;  4U6P A;  1ZET A;  1RYR A;  1BQN B;  4OZ0 A;  1WTB A;  1S72 S;  2ZH1 A;  2J6U A;  2M8H A;  1SJ4 P;  3DNC A;  1HYS A;  1LWF B;  2XYP B;  2RIL A;  3H8Y A;  4UOG A;  2YNF B;  2V50 A;  4K7Q A;  1LWC B;  5HVH A;  3WC2 A;  2DNN A;  1JMT A;  3BGU A;  3KUE A;  1GFW B;  4M8L A;  5GAD I;  1S1V A;  1VRT B;  3RYL A;  1FFG B;  3K8V A;  3GIR A;  2W9B B;  4FNI A;  3TVY A;  5KG4 A;  1TL3 B;  4FDF A;  4DG1 A;  3RBD A;  1M1H A;  3EDQ B;  3EZU A;  3QGP A;  5IXU A;  2KJV A;  2ZEJ A;  1RHQ B;  2BE2 A;  1WG5 A;  5BXI A;  1O6X A;  1JLA B;  1QM9 A;  4DUY F;  3GR1 A;  3I31 A;  2XZW A;  2VHG A;  3B6B A;  3HSD A;  3H20 A;  3D6H B;  2Y1J A;  1S1T B;  3PKY A;  2GNK A;  3SFU A;  4P75 A;  2VBX A;  2HGM A;  3OV7 A;  3I9V 9;  4QW9 A;  3W64 A;  3B82 A;  4UQT A;  2ZH2 A;  2EEY A;  3JAM Y;  3NOG A;  5DO2 A;  2JX2 A;  4I0W A;  3R97 A;  1RHU B;  1Q5Y A;  3T5H A;  2RHS B;  1N5S A;  4IFY B;  2RF2 B;  1LXJ A;  1RT3 A;  4KB7 A;  1YKW A;  3R5J B;  4JI2 J;  4LF4 F;  4YB7 A;  4LRE A;  2OI2 A;  2CNO B;  5EWE A;  4HDH A;  2AEM A;  3NBP B;  5J2Q A;  1Q95 G;  4DR3 J;  3MR2 A;  5LM7 E;  1TKZ A;  5KFI A;  1UJ4 A;  4M94 A;  2WBR A;  3D0I E;  1URN A;  1X5O A;  2DNG A;  1S1U A;  2MZS A;  2CUY A;  3AXM A;  1I6J A;  3CT9 A;  4DR7 J;  2EBE A;  2Y1I A;  2UVU A;  1IQZ A;  4IOC Q;  3D0G E;  2IHR 1;  2IA0 A;  3R7S B;  3QGH A;  5LJ3 Y;  2HVH A;  4OI0 A;  3QNW B;  2VG5 B;  2JJ4 D;  4HH1 A;  3FBE A;  4ID8 A;  2ACM A;  1N5Q A;  2OPQ B;  1XNQ F;  4PG5 A;  4C6A A;  3G8S A;  1YDL A;  4RW9 B;  3M8Q A;  3MEK A;  4X4P A;  3GCX P;  4ZVH A;  2IMW P;  3QYY A;  3NS5 A;  3GPA A;  4LRF A;  1NJY A;  3JYT A;  4JB8 B;  5EWF A;  1DQ8 A;  5HAO A;  1D1U A;  2YX1 A;  4ZPC A;  4HLB A;  1L3K A;  4O0I A;  4Z2X A;  3UNG C;  1B7Y B;  1SJ3 P;  2AJ4 A;  2GCF A;  1FRM A;  4DUZ F;  5F8M A;  2DGW A;  1PYT A;  1GMW D;  4DR5 F;  3GV5 B;  7FDR A;  2LU2 A;  1X7V A;  4CO2 A;  1N33 F;  1Y11 A;  2XI2 A;  1XNR J;  2C3O A;  3GG0 A;  3N6N A;  1EAY C;  4N5S A;  2F1F A;  4Q8F A;  3N5F A;  2GHW A;  4JI0 J;  3TR5 A;  4DPT A;  1CUL B;  1IM6 A;  4F4Y A;  4IR1 A;  2V2Q A;  1M0S A;  4C11 A;  1FWP A;  2HHX A;  3DOM B;  3MCS A;  4ZCM A;  4P2X A;  4CNY A;  1P9Y A;  4B9N A;  4CZC A;  2DPJ A;  2CQ1 A;  5A8R A;  4DXL A;  4X4S A;  1VQY A;  2ROG A;  2UU9 F;  4NLT A;  4NLU A;  1RT7 A;  2GIQ A;  1FKA F;  1HKA A;  4TY8 A;  4NCB A;  3DDI A;  2E7W A;  1D8Y A;  4OJ3 A;  1N36 F;  2ASD A;  1FRH A;  1TVR B;  4EYI B;  1WHV A;  2WON B;  2LFV A;  1Y4Z B;  3KLE B;  3D67 A;  3R2C J;  1V5V A;  4ECS A;  2AV5 A;  4PXD A;  4ZIV A;  2ATC B;  5F8J A;  2B4U A;  1HQU B;  2NCK L;  1FWL A;  2DGO A;  2C2N A;  4YR0 A;  2AJ1 A;  3NS6 A;  2XMV A;  5AJ3 J;  1FTR A;  5BJR A;  4XPE A;  5KT7 A;  2FC8 A;  1NK5 A;  4FNH A;  3R5C A;  2C28 A;  2DB1 A;  1S9E B;  4BWJ A;  2LEC A;  5HN0 A;  5L9X A;  3ILO A;  2PI5 A;  2ALY B;  4YR2 A;  3BV8 A;  1RTI A;  4P9S A;  2J9E A;  3O3L A;  4O44 A;  1MN7 A;  2GIF A;  2YKA A;  2YNH B;  3HKW A;  2VFV A;  1KHV A;  1TKT B;  2CQ3 A;  4NA3 A;  3VTI A;  1OYE A;  1X5T A;  4DPX A;  1X8D A;  4RR5 A;  3J81 Y;  4USW A;  1H2U X;  3OXG A;  3HXM A;  1U1L A;  1N6Q B;  1YZ6 A;  2CPD A;  3IRX B;  3P96 A;  2DGX A;  3ISN C;  3R1H A;  4ECZ A;  4JI4 J;  4JOU A;  3TAM B;  3NS7 B;  1X60 A;  3N6L A;  3UDE A;  1QTM A;  3IBC B;  3SQO P;  4LFA F;  3PIP Q;  2DNH A;  1K1Q A;  3GIJ A;  1CJT B;  5IWA F;  1P9Q C;  1ICE B;  3NOC A;  2HVZ A;  3S6E A;  4ED5 A;  1RAF B;  5KG2 A;  2FJB B;  5K9F A;  4LRC A;  3NGT A;  3PFE A;  4HTI A;  1TL7 B;  4U7C A;  2DIS A;  1WG4 A;  2DT9 A;  4DL6 A;  2RRA A;  2PC6 A;  3W60 A;  1RU1 A;  3C6U B;  1F2G A;  1B0V A;  2OEL A;  4F4Z A;  3N9U C;  2HS3 A;  3C15 A;  4JV2 A;  3UVJ A;  5GAG U;  1FJE B;  6FD1 A;  2BMB A;  4NEY A;  1WWH A;  4F0K A;  4X4Q A;  3OTC A;  1EQ0 A;  2DO0 A;  2RRN A;  4PWW A;  2W8L A;  3HK2 A;  1FDB A;  2CWK A;  4CTA B;  4I7F A;  5CYQ B;  4DFK A;  2DGU A;  2HNY A;  3H59 A;  3OL8 A;  4UF4 A;  1S9G B;  3CDB A;  3A3P B;  1BD6 A;  3PYE A;  2D3Z A;  2CG8 A;  3KUG A;  5GAE U;  2BJ9 A;  1HA1 A;  4PWD B;  3OR1 A;  4A8S A;  1L3T A;  1QSS A;  3AOA A;  3KNG A;  3FBF A;  2A1B A;  5L1I A;  4PAB A;  3MMA A;  3BJY A;  5JVH Q;  4MKV A;  2BRK A;  3QGG A;  2ZHO A;  3RAM A;  1F3F A;  1SH3 A;  2BM0 A;  3MM7 A;  1N34 F;  3ILL A;  4YR3 A;  4JI7 F;  1XIQ A;  1AB8 A;  2ZFH A;  4LUB A;  2P8I A;  3A3O B;  1S6P B;  3HVA A;  1IR1 A;  4M5M A;  3L95 X;  4DV7 J;  3P6Y C;  1WEL A;  2JLE A;  3PDN A;  4DQP A;  1HW9 A;  1D9A A;  4Q2M A;  1S77 D;  1IKX B;  5E41 A;  3A8K A;  1YBU A;  1DLO A;  2FUG 9;  1RAJ A;  3DM2 B;  3CCU S;  2Z56 B;  1JLQ B;  3W5Z A;  4ES2 A;  1OQ3 A;  4F4K A;  3Q22 A;  3QT6 A;  5J1P A;  4X64 J;  2VPX B;  5IT4 A;  1FCA A;  3M2V A;  1G7C B;  2VQF F;  3HD1 A;  2ZH9 A;  5HMX A;  2KKH A;  3JTN A;  2YX4 A;  1U45 A;  1RWW B;  5K5M A;  4PG6 A;  2Z57 B;  1WEZ A;  5IC4 B;  1WEY A;  3QZ8 A;  2VJU A;  4G1P A;  3SZ2 A;  2HLU A;  2V4R A;  2DKO B;  2F3J A;  4A48 A;  4O4G B;  2Y9H A;  4EBE A;  3ZZ0 A;  4BCA A;  3VZI A;  2SXL A;  1XQI A;  3CCL S;  1R3N A;  4JI2 F;  1RT6 B;  3CED A;  3NCQ A;  5B7W A;  2BVZ A;  4DR3 F;  2ZVI A;  1WSV A;  3CC7 S;  4ICL B;  2QO3 A;  4LFB F;  1MG7 A;  1JXE A;  1T9Y A;  2DCU B;  2QN6 B;  2MJN A;  2W25 A;  3JQM A;  2AJQ A;  2KXH A;  3N0V A;  3C14 B;  3LWM A;  3T9Z A;  4J91 A;  3LP2 A;  1B7F A;  2MLZ A;  3PAC A;  3TX8 A;  2MKH A;  1RI7 A;  1S0V A;  2MMY A;  2HND B;  2RS8 A;  4DL3 A;  4WZM A;  3MAH A;  3NP5 A;  3QIP B;  3BR8 A;  4DV6 F;  2WW8 A;  3W9H A;  3ICL A;  2BX6 A;  3LAN A;  3ETO A;  3L7P A;  2XWY A;  4R8U A;  2FLN A;  5DDR C;  1TL1 B;  3ZNJ 1;  4J9M A;  3D54 A;  4RW6 B;  4NI2 B;  2HUR A;  4USV A;  2KO1 A;  3OUY B;  5FDL A;  3PJ9 A;  5KFG A;  4CM0 A;  4DPU A;  2HWH A;  2KG0 A;  1XNR F;  4Y00 A;  2FY1 A;  4L74 A;  2HZA A;  1E6V A;  2WOM B;  1S0N A;  1QAX A;  3W2W B;  1K1S A;  5LSO A;  3HSJ A;  3H40 A;  2ABY A;  3EGZ A;  4X4T A;  3K2Y A;  1OIA A;  2QX0 A;  1NM2 A;  3Q8Q B;  3I55 S;  2YQ0 A;  5E3R A;  3H98 A;  2LMI A;  4CP5 A;  2RQ4 A;  1RB0 A;  3KUH A;  1C0U A;  3HKZ D;  2JEF A;  1YJV A;  5MAO A;  2X1A A;  2MHE A;  1NK0 A;  4UZB A;  5KFW A;  4XK8 C;  5AT1 B;  2V5H G;  3RTV A;  3M1V A;  3OL9 A;  3MM6 B;  1B64 A;  2DHA A;  2UUC F;  2DPI A;  3R1L A;  3MPW A;  5DGB A;  4OX8 A;  1TMM A;  1R6Y A;  2MTL A;  2HGN A;  3VZH A;  2J6S A;  4AUK A;  2EBG A;  4CIO A;  4NRU A;  3FQK A;  1QSL A;  1CJK B;  2AW0 A;  3AOC A;  4M5J A;  2NXN A;  4B9V A;  3I96 A;  3BSN A;  3BRE A;  1MML A;  3I6P A;  3HHE A;  4Q43 A;  3PEJ A;  2QT7 A;  2KZM A;  3CC4 S;  3RU0 A;  4C8L A;  4OHW A;  2K3K A;  4WE1 B;  4LF6 J;  4LF8 J;  1TFY A;  3CIZ A;  3HVR A;  3K0J A;  3AFG A;  4KV8 B;  3R5D A;  2KT3 A;  2KYZ A;  2R7T A;  4CI0 B;  2BUN A;  3FFI A;  3NNC A;  2A18 A;  5GMK a;  3N4W A;  1R8C A;  3TO8 A;  3TUJ C;  3PX4 A;  4O23 A;  2YTC A;  3QRP A;  3FSX A;  3LAM A;  1VQM S;  1J2V A;  3CMA S;  3J81 j;  1N56 A;  4PUO B;  4N76 A;  2B43 A;  3NY0 A;  2YKO A;  3C19 A;  1UL3 A;  1NU4 A;  4ZPA A;  5KFL A;  2EK6 A;  1FJ7 A;  4NXN J;  2G0I A;  3H25 A;  5H9E K;  1M5O C;  4IQX A;  2LLZ A;  3EM1 A;  3EGW B;  1WD6 A;  2D41 A;  1LXN A;  3TYT A;  1B3T A;  1Z4U A;  1SB6 A;  3SFG A;  5K20 B;  2B51 A;  2PDA A;  3HLU A;  3T6J A;  4W4M A;  3BYR A;  3T1H F;  1WF1 A;  3IG1 A;  4BDP A;  1CPZ A;  3Q2S C;  4Y6I A;  3TWZ A;  2E9R X;  1VLY A;  4OFZ A;  1J5O A;  3J80 U;  2ZH5 A;  2K1R B;  1KC8 T;  4WYL A;  4RUC A;  1NBE B;  3OFF A;  4LF5 J;  4YDX A;  4DSK A;  5K14 A;  5LSR A;  4AL5 A;  2BQR A;  3DLK A;  5DQG A;  3FCW A;  4XTT A;  4ZVQ B;  4M5L A;  2E29 A;  3DRP A;  3QFW A;  4D3H A;  4H4K C;  1FXL A;  3IS9 B;  1TV6 A;  5IT9 U;  5C42 B;  3MMJ A;  5H9E J;  2Q6C A;  1Y9O A;  3KJF B;  1FNO A;  5ETR A;  2RJZ A;  5IV4 A;  3PYG A;  3GIM A;  3MFI A;  2LA4 A;  4P2S A;  1SKW A;  1RT1 A;  1FK9 A;  2Y0B B;  2DHX A;  2OPS B;  2KZZ A;  3GQC A;  3NGK A;  4GKK F;  2P6T A;  4KE5 A;  3BGL A;  1ZM3 A;  9ATC B;  2B9E A;  2OPR B;  4PCQ A;  2EKY A;  1YX2 A;  4JV5 J;  3A4T A;  2ZBR A;  4DLG A;  2B8P A;  2P2C B;  1LKZ A;  3G9C A;  4J9V A;  4DFP A;  2CAD A;  4KT0 C;  4R5P A;  1V3S A;  3BKU A;  3TZY A;  2HS4 A;  4C0H A;  1WC6 A;  4GMK A;  3IWL A;  2DHS A;  4ZPB A;  3BGR A;  5HJY A;  2CJ9 A;  3KHH A;  2R8I A;  2R9L A;  3PTW A;  1MU2 B;  4DV7 F;  4X62 J;  4KHP J;  3TZZ A;  1VRU B;  1NK4 A;  4NOH A;  3BGO P;  4C3M A;  4DSF A;  4J9P A;  1BY9 A;  2Q43 A;  1RAI B;  1R0C B;  3KLI B;  3C16 B;  3CDW A;  4CM2 A;  5HJX A;  9RUB A;  1RHR B;  3MZI A;  4IOA Q;  4WIQ A;  3MPV A;  4A47 A;  1RT2 B;  1HHT P;  2XZT B;  3W65 A;  2MQ8 A;  1SJQ A;  2JEG A;  1MMD A;  4E98 A;  1SC4 B;  3OTD A;  5HMZ A;  2G9O A;  2KHC A;  4WFA Q;  2M9K A;  4FXD A;  3N79 A;  3NCP A;  1H6K X;  2PMW A;  3EXY A;  2IFX A;  2XYH B;  3CD5 A;  4XDC A;  4WZQ A;  3ET6 B;  2O5D A;  5I3U B;  1IQT A;  1MW7 A;  2F63 A;  3OFE A;  2PO4 A;  1U1P A;  1LWE A;  2DR8 A;  4UST A;  2ZOM A;  2V2K A;  4IH5 A;  1S7H A;  4DBQ A;  2YPY A;  4R0J A;  2CZV C;  4QR2 A;  5IM0 B;  3MR6 A;  1YHQ S;  2VG7 A;  1T05 A;  2V94 A;  4TLQ A;  3QAT A;  5GAH I;  3AJD A;  3VVU A;  1FVS A;  3W2V B;  4ZVT B;  1HHQ A;  4OYM A;  1Q53 A;  3MUR P;  3W1Y C;  2AD9 A;  1X4H A;  2GVZ A;  3DGV A;  4MKB A;  1GMW A;  1DQA A;  2XO7 A;  3G82 B;  4L73 A;  1VBY A;  2XHW A;  4PG8 A;  2BW7 A;  4USH A;  3J7Z 5;  2J8S A;  3KJV A;  4B9S A;  1RLD A;  3MCO A;  2GJF A;  1RBO B;  2AZ3 A;  4N47 A;  2JDJ A;  2OFG X;  1QAJ A;  3IFE A;  1DZ5 A;  4LF9 F;  4TYA A;  5D15 A;  1BQN A;  3Q83 A;  3QPI A;  3KLV A;  2ASJ A;  3AAW B;  2Q1L A;  2LDY A;  1TEL A;  2YWE A;  1H73 A;  2YNF A;  1LWC A;  1V9O A;  2ZNZ A;  3KKF A;  3OW2 R;  5KFU A;  2VDI A;  4NA1 A;  3ZTS A;  4L72 B;  4LF7 J;  3HVW A;  4C8N A;  2W7P A;  2CQB A;  3SV3 A;  2VF3 A;  2ZUA A;  2RB7 A;  4ZCL A;  2RSQ A;  3ENQ A;  4B08 A;  5H9F K;  1IBC B;  1O51 A;  3VAM A;  2HAF A;  3WDO A;  3VAI A;  3MPD A;  4NZ0 A;  5A6W A;  4E0D A;  2HZV A;  1JLA A;  3K89 A;  3BO2 A;  2UXC J;  3M30 A;  2W2P P;  2GV1 A;  4WFN Q;  2A2C A;  4AND A;  3AA8 A;  3WBZ A;  4KHM A;  2V8V A;  1IR2 A;  2DR6 A;  4ZCI A;  2HMI A;  4DZD A;  4BWM A;  4Z7C A;  4UZC A;  5A2Q Y;  2PEB A;  2CNN B;  2NPF A;  2FPH X;  3D6T B;  1BMQ B;  3EWG A;  1UW4 A;  3IBW A;  3OL7 A;  4G1Q B;  2Z2Z A;  4OQJ A;  4C8Y A;  2JH3 A;  3L4B C;  3CWJ A;  3UN3 A;  1IBM F;  4OZ1 A;  3QJP A;  5J1E B;  3HFZ B;  5ETL A;  5LJ5 Y;  3LW5 C;  4QIE A;  5HVF A;  2BQ3 A;  4QWD A;  5HLF B;  3GTY X;  3GCW P;  1O8B A;  5HRO B;  2UVR A;  1MRO B;  2ZBC A;  5KFC A;  1NSK L;  3DXB A;  4X65 J;  1OSD A;  4NXM J;  1UZD A;  1H0H B;  3DOK B;  4FF3 A;  1U4B A;  1N5V A;  2I1R A;  2JRS A;  3FZB A;  4M1K A;  4LF6 F;  2FZK B;  2YXL A;  1YLX A;  4ZLN A;  2QYC A;  1UVK A;  2VG5 A;  2CPE A;  2NXC A;  2ZJR Q;  2DNM A;  5KFS A;  4RW9 A;  3RB6 A;  5B09 A;  4Y2K A;  4QR1 A;  3KJQ B;  2X1F A;  3MAA B;  4K4W A;  2XI3 A;  1GX6 A;  5HQL A;  1U49 A;  2XM3 A;  3IGN A;  2XWX A;  1KN6 A;  2ZBP A;  3IRW P;  1VQ8 S;  3ENW A;  2WZ1 A;  3ELH A;  4PRF A;  5KFA A;  1PCA A;  2IIH A;  2ZE2 B;  4EZ9 A;  2ZM6 J;  1S79 A;  2LQB A;  1XR5 A;  3PXG a;  1FKP A;  1X0P A;  4DX7 A;  4ZVR B;  4ELV A;  3Q8S B;  1FE0 A;  3SYZ A;  2EW9 A;  2BYC A;  3DOM A;  2LXU A;  5KFP A;  3QFH A;  4IRD A;  4M5H A;  1FT8 A;  1LOU A;  4EGL A;  2CNL B;  2RKI A;  1N5Y B;  4ZP9 A;  1CQM A;  4G65 A;  4CLP A;  5DLG A;  1RHK B;  5J2P A;  3UPF A;  2FVR A;  4TXS A;  4USM A;  3KDO A;  2O1P A;  4Y2C A;  1LWX A;  2XCP A;  1TVR A;  3GSI A;  3PR4 A;  4ITS A;  2J5A A;  3KLE A;  4ZVE A;  2LYV A;  4C97 A;  1EIY B;  2DO4 A;  3OFG A;  3NL0 A;  4NLD A;  3MM9 A;  3UE2 A;  2DNL A;  2ZWO A;  1PC4 A;  1R6V A;  2MQL A;  1KVK A;  4QPT A;  2I0X A;  1I51 B;  4FF4 A;  1S9E A;  4PG4 A;  1XK8 A;  1WF2 A;  4OYP A;  3KNA A;  4ILL A;  4CNZ A;  2KXF A;  2VKZ G;  1M5P C;  2R7Q A;  1TR0 A;  4DV4 J;  2WB1 D;  2MKS A;  2CQ4 A;  5THW A;  2ROP A;  2K7K A;  4EWT A;  1U47 A;  1AFI A;  4DN9 A;  2MZJ A;  3HHD A;  2IBO A;  4PQU B;  2YNH A;  1UPP A;  4DR4 J;  1ZA1 B;  2V63 A;  3PKM A;  4RW8 B;  2I9S A;  4F7V A;  3QJJ A;  1RTH A;  1FKO A;  1TK0 A;  1VQ4 S;  5CAA A;  4FKX A;  3CDE A;  3ULH A;  4HI2 A;  2V0N A;  1N6Q A;  3MEE B;  3SCL E;  1WOR A;  3MMC B;  4HT7 A;  2HFZ A;  3MEG B;  2XSJ B;  4WK3 A;  3WX4 A;  1VQL S;  5KTQ A;  4DV0 J;  4WKY A;  3TUI C;  2Z2Y B;  3G6E S;  1SUQ B;  4E8U A;  3F0N A;  5HQM A;  3POT B;  3KXD A;  3NRB A;  3OR2 B;  2V2Z A;  4CYU A;  4F67 A;  1CBK A;  3TUP A;  2W1B A;  5KFR A;  4Q7A A;  1LW0 B;  4ZS6 A;  1AZS B;  3BGF A;  1HNW F;  1YJU A;  1BC6 A;  3AJ1 A;  2NRE A;  5B0D A;  3PW7 A;  1RKI A;  2VKR A;  3MGJ A;  5LT5 A;  3BO3 A;  3EVW A;  3OBI A;  4O3Q A;  3QWP A;  3U02 A;  2WVC A;  1U48 A;  1LNQ A;  3LPY A;  3DHX A;  4DS4 A;  2LQ9 A;  1BWE A;  5LL6 d;  2X3D A;  4O3O A;  1HBO B;  4OZ3 A;  1S59 A;  3W61 A;  1WOP A;  1RT5 B;  4M5D A;  1GT8 A;  2FLP A;  2V6A A;  4CTA A;  3DYA B;  1HNI A;  1S9G A;  3M9O B;  1N0V C;  2N82 B;  1NHU A;  4CLU A;  2H48 B;  5LMU J;  2PT0 A;  1UFW A;  4M5I A;  2A10 A;  2R7U A;  2B4O A;  1IWG A;  2V8G A;  2UUA F;  3ZZP A;  3ZXW A;  5B08 A;  2CPY A;  2XMM A;  1HL6 A;  4C3L A;  4NPO A;  5U47 A;  2OH2 A;  1VBX A;  1AUD A;  2B8Q A;  2PII A;  2QGF B;  4KKO B;  4CT9 A;  4OI6 A;  4ED4 A;  1JXL A;  2RE1 A;  1ZM2 A;  4PQA A;  4ZHR B;  3DN9 A;  2XGQ A;  3KHG A;  1TL5 A;  4DX8 H;  3LF0 A;  4ECR A;  2VU5 A;  3CD0 A;  3HUL A;  4CH0 S;  1T11 A;  1UFK A;  2NYI A;  1FA0 A;  3HCX A;  1S1X A;  2F4F A;  1KKH A;  4NLS A;  3WHI A;  3MHY A;  4OYX A;  4ZP6 A;  1Q7Y T;  2HWI A;  1IKX A;  1ZM4 A;  4V19 J;  2FVP A;  3CIM A;  4M5K A;  1HD0 A;  2ZBI A;  2W9C A;  3CCR S;  3UCU P;  1JLQ A;  2QA4 S;  1SVD A;  5L39 A;  5DS7 A;  3FBC A;  2DR5 A;  3QAU A;  4C9D A;  4JI1 F;  2BJ3 A;  4ZK7 M;  3PO4 A;  3DLL Q;  3G6Y A;  2E1P A;  2XCA A;  1RAA B;  1KLM B;  4AL7 A;  2IDL A;  1NSP A;  4F0M A;  1HAR A;  3HVT B;  2V8D A;  3BH7 B;  3TAR A;  2DHG A;  3UD5 A;  4O4G A;  2GHP A;  4IO9 Q;  5BR8 F;  4LFC J;  1TK5 A;  2DY9 A;  4LF1 A;  2YNI A;  4ZVF A;  2ZOF A;  1NK6 A;  2VUG A;  3FDS A;  3PIO Q;  2FHM A;  1QUV A;  3OLB A;  2ZIT A;  4B3S J;  5F8I A;  3B4M A;  1R27 B;  5HBM B;  1URR A;  1NJI T;  4ICL A;  1DUR A;  2FYX A;  5A8W B;  1CJU B;  3SV4 A;  2MKJ A;  1CJV A;  3C14 A;  5F8N A;  1UCN A;  5CZX A;  2VZ9 A;  2IRX A;  2L3M A;  2GML A;  1SV5 B;  2DCL A;  1N5T A;  3HHL D;  3DRY A;  2W8K A;  4UUW A;  3X1L B;  2H5I B;  3CSK A;  4ETZ A;  2KJW A;  3K5M A;  1S4F A;  2QV6 A;  3PG9 A;  4Y2A A;  1TP7 A;  2IYG A;  3QIP A;  4I2P A;  1KHW A;  3CJQ A;  4LRA A;  4YHH F;  5E7O B;  1TKX A;  2XS7 A;  5SZT A;  8RUC A;  4DPO A;  2CJY B;  1YJ9 S;  1VMB A;  3J7Y I;  2IRU A;  3NAH A;  2YWK A;  5AXK A;  1C4A A;  3TP2 A;  1HFE L;  2V4J B;  3A8E A;  1TL1 A;  2J7K A;  5CYM B;  1HR0 F;  4F3Q A;  4Q2L A;  1HBN B;  2HRU A;  4FYD A;  4ED7 A;  1JWW A;  1QY7 A;  2IM3 A;  2XC9 A;  4OZ2 A;  1T9V A;  1YJR A;  2B9X A;  4Q8E A;  4DR6 F;  3BPD A;  2EI5 A;  3GFX A;  2YH1 A;  3WQP A;  4JP8 A;  2HIQ A;  2EG1 A;  4NWB A;  2C3M A;  4OI4 A;  3W2W A;  1ZOT A;  3T19 A;  4ZPW R;  1QD1 A;  2QLJ B;  1LK7 A;  5FLX U;  1GXL A;  2KT5 A;  1LFP A;  2HNZ B;  1H72 C;  2KN4 A;  4DLE A;  1NHV A;  1FJG F;  3LGN A;  2ZDO A;  4DSJ A;  2C2E A;  3W7B A;  3Q8V A;  4K4S A;  3I0S B;  4KPC A;  4XDD A;  3K5P A;  2JEI A;  4WFB Q;  1X5P A;  1R8H A;  4YY3 J;  3KLF B;  4PPZ A;  1XJW B;  5KFB A;  4Q44 A;  1W7W A;  1PSD A;  2CPF A;  2R4F A;  4K4U A;  1GNK A;  2E7V A;  2XHC A;  3HSG A;  1RCX B;  1LV5 A;  2HKE A;  5KFX A;  5BYR A;  4C8K A;  2DR9 A;  1RHM B;  2BKO A;  1TZ0 A;  4USJ C;  1KBR A;  3OXF A;  4WFX A;  5IOL A;  1WEX A;  3MD1 A;  1JLE B;  4AQY J;  2DR7 A;  3PZP A;  1P6T A;  3QBC A;  2Y8W A;  3MM8 B;  4DJB A;  2YWF A;  1NND A;  3JTP A;  4WE1 A;  3DRS A;  2MJU A;  4HVZ A;  2AQ4 A;  4NA2 A;  1VQK S;  1FRI A;  4F4X A;  2C2M B;  1RTZ A;  3HD2 A;  1UWB B;  3FNN A;  3J7Z T;  1CQN A;  4NLQ A;  4NZ7 A;  8ATC B;  3C6T A;  2BRL A;  5DDO C;  1S6Q B;  2BAB A;  4CWB A;  4EI2 A;  3DGP B;  3G8T A;  1AUS L;  2AT1 B;  4QCL A;  4U8V A;  3GON A;  3PM9 A;  4J9O A;  1CVJ A;  5D4O A;  4ANE A;  3NXZ A;  3DOL B;  3ZTQ A;  2R8J A;  3BSO A;  4NYP A;  4LBH A;  4F0H A;  3NGD A;  2OAU A;  1U0H B;  1V3R A;  2IY5 B;  2IAJ A;  3TQE A;  2C3P A;  3DI6 B;  3K5N A;  5F0U A;  4PXE A;  3KLH B;  2VA3 A;  4UY8 5;  3TAN A;  1JX4 A;  4QPX A;  5ETV A;  3LP1 B;  2MKI A;  2EFG A;  4P7V A;  4ZJO A;  4D3G A;  4L3N A;  2LXI A;  1R0A A;  1ZZN A;  2J0X A;  1RQ0 A;  3GV7 B;  2JOQ A;  3NKY A;  2B3T B;  2J9D E;  1KVI A;  5ETT A;  1PJ5 A;  4Q5V A;  3U7J A;  2E5J A;  2H65 B;  1F1B B;  3I5C A;  2DEI A;  3SXL A;  3I4P A;  2G0J A;  3PY8 A;  2W01 A;  3N28 A;  3OTO F;  1SPB P;  2H54 B;  3TEG A;  4X84 A;  1SKS A;  3S7R A;  4JI8 F;  3AJ2 A;  4QU6 A;  4DR2 F;  4WKR A;  4DZ6 A;  3KTQ A;  1C2P A;  2BOP A;  1Y0H A;  4ED8 A;  4U8Y A;  3LAL A;  1S1W B;  1ACM B;  2CQH A;  5C42 A;  4PYA A;  1JKH B;  4U7U K;  3NWG A;  3TQ1 A;  3IBF B;  1VYA A;  2EFO A;  3FK4 A;  3JSM B;  5F9N A;  1C0T A;  1SH2 A;  2XTJ P;  1FE4 A;  4K5S A;  2OPS A;  4K4Z A;  1S76 D;  4FF1 A;  1GTE A;  1RAG B;  2WVD A;  2YNG A;  2EPI A;  3EX7 B;  2ZC3 A;  2GJI A;  2ZD1 B;  1LFW A;  5C24 A;  5CH7 B;  2FHO B;  3EMT A;  4P6Q A;  4WWS A;  4NLY A;  3GIK A;  1MWY A;  3SBM A;  3UCG A;  4YS2 A;  1T9U A;  4LIW A;  2VQE J;  3EXC X;  3EPG A;  3CJ4 A;  4QR0 A;  6FDR A;  2RNE A;  1IKW A;  2U1A A;  1UKU A;  2O01 C;  2YKN A;  4OYI A;  2VOD A;  4HTJ A;  4JYA J;  4F36 A;  2QLW A;  4IFV B;  1HNZ J;  3SSS A;  1RWO B;  2AYB A;  4ECQ A;  1GQE A;  5ADZ A;  2C2K B;  2E5L J;  3BKT A;  3V6D A;  2ILZ A;  2YWH A;  1RCO B;  1RT2 A;  4KGK A;  1EX8 A;  4EBC A;  2V9W A;  2HFV A;  2AYG A;  3CC2 S;  3MR3 A;  3S01 A;  4DMZ A;  1T8E A;  2CRL A;  5T7L B;  4HI1 A;  3WX8 A;  1ROF A;  5HMY A;  4DQI A;  1YJ7 A;  2ZUG A;  4DPY A;  4CH1 A;  3W9J A;  3A8I A;  2C2D A;  1VQO S;  3P5B P;  2HW3 A;  2ZBQ A; 
#chains in the Genus database with same CATH homology
 4JI4 J;  4RJV A;  5AJ3 J;  4DUZ J;  2KVQ E;  4DV1 J;  2VQE J;  4KY3 A;  2HHH J;  4JI2 J;  5A2Q U;  4LFA J;  4LF4 J;  4DR5 J;  4DV2 J;  2MQ8 A;  2KL8 A;  5FLX U;  1XNR J;  1J5E J;  3OTO J;  4DV3 J;  5IWA J;  4DR3 J;  2MTL A;  4B3R J;  4NXN J;  5LM7 E;  2UUB J;  4JI8 J;  1IBL J;  1FJG J;  4JYA J;  4LF9 J;  4B3M J;  2F4V J;  4DV0 J;  4JI0 J;  4JI3 J;  4DR2 J;  1HNZ J;  4JI1 J;  5LMU J;  1XMO J;  2UU9 J;  4KYZ A;  4DR1 J;  4GKK J;  4DV5 J;  4YHH J;  4NEZ A;  1IBM J;  4DR7 J;  3D3C J;  1N34 J;  2UUA J;  3T1Y J;  4V1A k;  2UXB J;  1XMQ J;  4JI5 J;  4JI6 J;  2E5L J;  4JI7 J;  4YY3 J;  4JV5 J;  2ZM6 J;  4DUY J;  4LFB J;  4K0K J;  4X66 J;  3T1H J;  2UXD J;  4DV7 J;  4LF7 J;  4NEY A;  3J81 U;  3IMQ J;  4LF6 J;  1XNQ J;  1HR0 J;  4LF8 J;  4LFC J;  4B3T J;  4PWW A;  5BR8 J;  1HNW J;  3J80 U;  4DV4 J;  4X65 J;  3J7A N;  1N36 J;  4LF5 J;  1I94 J;  1HNX J;  3R2D J;  3D3B J;  4NXM J;  4HHU A;  3JAM U;  1N32 J;  4X62 J;  4KHP J;  3R2C J;  2MEW A;  4X64 J;  4B3S J;  1IBK J;  4GKJ J;  4DR6 J;  1N33 J;  4OX9 J;  2VQF J;  4AQY J;  5LMN J;  2UXC J;  3W1Y C;  2UUC J;  5IT9 U;  4DV6 J;  4DR4 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...