4KHPJ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4khpJ00
2UU9J 2MQ8A 4HHUA 3J81U 4YY3J 2HHHJ 4B3MJ 3R2CJ 4LFAJ 4LF5J 4KYZA 4DR4J 3JAMU 4RJVA 2F4VJ 2KVQE 3D3CJ 4PWWA 4B3SJ 4V1Ak 4NEYA 3J80U 1XNQJ 4GKJJ 2MTLA 4X66J 4LF8J 4DV1J 4DR1J 2E5LJ 5LM7E 2UXBJ 2UUCJ 2ZM6J 3OTOJ 3J7AN 4DV4J 2KL8A 4JI8J 4X62J 4JI6J 4B3RJ 4YHHJ 1IBMJ 4LFCJ 3R2DJ 1FJGJ 1J5EJ 4DR7J 4KY3A 1HR0J 1XMQJ 4DR2J 4OX9J 4GKKJ 4DR6J 4B3TJ 4X64J 1HNXJ 4DUZJ 3IMQJ 4LF9J 4JV5J 5FLXU 5A2QU 4JI5J 1HNWJ 2UXDJ 4LF7J 1I94J 3D3BJ 4DV5J 5LMUJ 3T1YJ 2VQFJ 5LMNJ 5IT9U 4KHPJ 1N34J 1N32J 2UXCJ 2MEWA 1IBKJ 4DV3J 2VQEJ 4DV6J 1N36J 4JI0J 4NXNJ 4LF6J 4DUYJ 5AJ3J 5IWAJ 4X65J 2UUBJ 4DR3J 1XMOJ 1HNZJ 3W1YC 4LF4J 4NXMJ 1IBLJ 5BR8J 4AQYJ 4JI4J 4NEZA 3T1HJ 1XNRJ 4K0KJ 4DR5J 2UUAJ 4JI7J 4JI3J 4JI2J 4JYAJ 4DV0J 4JI1J 1N33J 4DV2J 4LFBJ 4DV7J
chains in the Genus database with same CATH superfamily
3IWXA 4ID5A 3EXCX 2K7JA 3MPVA 4RUBA 2R4FA 1HI0P 2BANA 1GMWD 2ROPA 2XBPA 2KRRA 2Z58B 4LBHA 1N4LA 4OZ2A 2IA6A 1ULRA 4MIBA 4PXEA 2R7XA 4LMZA 1C4AA 1VRTA 5SZTA 2J76E 2N82B 2W25A 2NUHA 1O5JA 1KQKA 3MR5A 2GIRA 3TQ1A 3R2CJ 1LFPA 3M2VA 2R8JA 4F4WA 1ZPVA 4EMDA 3FFIA 2YPYA 3JAMU 2Z2YB 4ECTA 4LRCA 1TZ0A 3W2WA 4DQSA 1HD1A 3HHLD 4ECZA 1U1KA 1MWYA 3AAWB 3VGTA 1PBAA 1NK4A 1G3OA 4KPYA 1FE4A 2MHNA 3KK3B 3MUTP 3V4IA 2B0GA 5T7LB 3F44A 2KJVA 5BJRA 3BBBA 3IN5A 3UDEA 1FJCA 4DR1J 1IKYB 1P27B 1I5OB 2IAJA 3EZUA 3IBFB 2YWWA 4KH0B 1KQFB 2E9RX 2Y8WA 1X9WA 2HK3A 1QVFR 2IYGA 1ZM9A 3OXFA 3RZAA 5E3RA 3OTOJ 4DV4J 2J9DE 3LQVA 3J7AN 3RAQA 3B82A 2R8HA 3BQ1A 4ICLA 1RTJB 1F9HA 5LSLA 2HQCA 1S1VA 1XQIA 2FUG9 4F4AA 1NDLA 3KLHB 4DLEA 4W90B 1PBUA 2BKNA 2CQ1A 5K8OA 1YBAA 5KFNA 5IT0A 4TU9A 5LL6d 1VJQA 3BV8A 4WU3A 4ED6A 4NLGA 3HPOA 1FJGJ 4O44A 3CMAS 4J9KA 2JZ5A 4WFNQ 2HWIA 2EFGA 2JVOA 3LPEA 2CA9A 3MCMA 4HACB 1N6QB 4DR2J 1DLOB 4EGLA 5F8LA 5L1IA 2BDPA 4OX9J 1VLOA 4IG0B 2EXUA 2LXFA 4DV7F 1J5OA 2UUCF 4MK9A 5J2MA 3CTRA 4CCHA 4OZ3A 4M5IA 3W65A 4DV0F 4DFPA 2OPPB 4USIA 4NX9A 5AXMA 5GAHU 3GIIA 4CDIA 3MFHA 3MEKA 1RT5A 4DF4A 4CLLA 4IFVA 3VHQA 5HROB 4Q2LA 1RWKB 1NEEA 4J9VA 4DPXA 1RWWB 5D78A 1X31C 2VJUA 4OYBA 1HW8A 1OO0B 1LFWA 1S6UA 2OMOA 2BW7A 4M5MA 1O51A 3PJ9A 4OZ1A 4R5PB 2XQCA 1RT6A 1SJ1A 1U25A 1J2VA 2WB4A 1WC1A 4TQSA 2MKSA 2BJ8A 4ZOSA 1U2FA 1VIXA 4WFBQ 2PIIA 4FP9A 2A3JA 5ADZA 3V6JA 2HW3A 4OX9F 1V5IB 3RBEA 4NXNJ 2XWXA 1U0HB 2FJDB 1BGXT 4UF4A 3UE2A 4DUTA 3L3CA 1NJXA 2AD9A 2F4FA 2ZC4A 4NLXA 1DARA 1WHXA 2IJNA 2B3TB 2BE9B 1IKWA 3PZPA 4DZDA 2U1AA 5I3QA 1U4BA 1R8BA 1JLFA 2HQIA 3OR2B 2OPPA 1CJTA 1HIYA 4OI1A 1UWBA 5CCMA 4UQTA 3PYFA 2KH9A 3HK2A 3D6HB 4EBEA 2R7UA 2CJQA 2WOMB 3D5MA 2BABA 1I3OB 3Q89A 3QYYA 3U1LA 4OX8A 2RQCA 2J6SA 5KFCA 1KRPA 2PEBA 3HHLA 4XAKA 4ED4A 1XNRJ 2VODA 4ALZA 3QWUA 3LP1A 1FRLA 2EK6A 1WEYA 5KFVA 5J2QA 1DTQB 5HLFB 3A3PB 3DU5A 1SQFA 5E3CA 3PR5B 2FHKA 2OPSB 2FVSA 4OZJA 1QTNB 3IG1B 1IKXB 3R27A 1WUUA 5KG6A 2HBZB 4CO3A 2VBWA 3R1LA 5KG5A 1R0AA 4BS2A 3DRXA 3M30A 3MF5A 4K5RA 3QGIA 1KKHA 4ED8A 1FK9B 4B9UA 2O1PA 2ALZA 2QIFA 2H54B 4JB8B 2FDNA 1Q82T 1X4DA 4ELUA 3ILOA 4OHWA 2FGCA 4U7UD 4NZ6A 5GAGU 1EETB 1SXLA 2DKOB 3DDNA 3M6WA 1P9YA 5IQQA 2JC0A 4JP8A 3ZFVA 4CYUB 3GIKA 5H9FK 1VHFA 1RABB 3BSOA 1AYEA 1UFLA 4RJVA 4L76A 3BGLA 4RKUC 5CHCB 4CM0A 3FZBA 3E3XA 3FQKA 4ZP8A 4PWWA 2CPZA 1RJJA 3UWTA 1T9YA 3SEOA 3OL6A 1VQ4S 2KZZA 3HSJA 4R25A 3RUBL 1JLAA 4DSJA 3D0HE 1SB6A 4H54A 4LF1A 1YITS 2H51B 3W2WB 2GGPB 3L7UA 2FC8A 4ECRA 1AA1B 3D7SB 4B3OB 2MQOA 3NNAA 2RVJA 4LF6F 4ZVOB 2XB2D 3EZ5A 1JXEA 4C9DA 2RHQB 3PJWA 2AV5A 1RWPB 3QO9A 1M5VC 2PE8A 3R7NB 3N6NA 2F40A 2DNMA 4RW6A 3UN2A 2MZ1A 3CCMS 4DSFA 2VL1A 3N6LA 3H5YA 1D9DA 2DNNA 2ROEA 4F50A 1X5TA 2J6TA 2HHPA 1ZS6A 1S5ZA 3N0VA 3BYRA 4YS2A 1HNWF 3I5CA 2QMWA 2LU1A 3JYTB 2BZ2A 1QAJA 1QTMA 3B8HA 1R3NA 4DL2A 1IBLF 1S97A 2XHWA 2QC3A 2C2MB 2DIVA 4HDHA 1KEKA 3GJSB 1EKRA 3FSXA 2YWKA 4O3NA 2V6AA 4CLPA 8AT1B 1FE0A 1XMQJ 3LH2S 2HAFA 2DISA 1EJ7L 2GV1A 3FGVA 3SCJE 3MECA 3VWSA 4U8YA 5KFBA 4X64J 5K8PA 2GNKA 4NA1A 5JUMA 1ZPWX 2VKRA 4J9PA 1NNDA 1M5KC 5BXIA 4JV2A 3V6DA 1YJ7A 1FKPB 1HHSA 4NASA 1FVQA 5A6WA 2B4VA 1CBKA 3BS9A 1LW2A 1N0UA 3RW6A 1NU4A 2WW8A 2BANB 1XTZA 2RU9A 4ZJQA 1CULB 4RUAA 2MQQA 2C3MA 2PN6A 2I0XA 4IR9A 2QYCA 4Y0FA 1YBUA 3AB2B 4N56A 4M8LA 4OQJA 5DJBA 4NLVA 2KM8B 1TL1B 2UVRA 2FIUA 4EFAC 4OZ5A 1GFWB 2ZOGA 3KHGA 1RKJA 1Z2LA 3MEGB 4USUA 2VBZA 2OPQA 3EXYA 1X9MA 2ZBQA 4WF9Q 4RZRA 2LQ8A 4GC7A 4WFXA 1WDDA 3VF0B 4QIEA 1RB0A 4TXSA 4A8MP 3C15B 1HWUA 3GR1A 1X4GA 2XYHB 1DURA 1KLMB 2GAGC 2XTJP 3AOBA 1PJ5A 3HLUA 3LP0A 3TW0A 1YK9A 1WORA 3MAAA 2OJ3A 2VPYB 1QD1A 1AFJA 1DTTB 1N5VA 3KFWX 2ASYA 3A1YG 5KFPA 5M2RA 4DPTA 1N5YA 3AJDA 1W25A 3NRBA 4DV4F 4ZVRB 4CO0A 5KT2A 1BMQB 2ASJA 5L46A 3TANA 3C19A 1MROA 4DQQA 3QNWB 5HI7A 1UJ4A 4G1PA 3NS5A 3L7OA 1C1CB 1DBDA 4QYRA 2KT3A 5KFWA 4FXDA 4JYAJ 3C46A 1QSYA 5L1LA 2Y1IA 2R8GA 4DV2J 1WI8A 5E3AA 4C0HA 3N5FA 4FF2A 4GKKF 3DGPB 4G1IA 4R8UB 3C6UB 3G2XA 5I3PA 5KFOA 2J9DA 2XY6A 4KGVB 3NG8A 3DM2B 3J81U 2XCPA 1HLWA 2HNDB 1YGYA 2HHHJ 3FQLA 2IM3A 4BC9A 1MNEA 3VAMA 2VDHA 5K9FA 2UXCF 1GX6A 2KJWA 2R2TA 1D9FA 2H48B 4B3MJ 1U02A 4C97A 1UCNA 2ZE2A 2B4OA 2VPWB 3J7ZT 3BKFA 1IJFB 1H7XA 2G9OA 4J5OA 3S01A 5KFKA 3DLBA 1U6BA 1VISA 2K1RB 2RJZA 3K0JA 1RT3A 2O01C 3Q8PB 5LJ5Y 4DSKA 4QW9A 1M0SA 3JQKA 3ZTOA 2XGPA 3VAFA 3OFHA 4PG5A 2LLZA 1UPMB 4RNHA 1GXTA 5DG8A 2BQRA 4GKJJ 1DFDA 1RLDA 2D41A 2D3OR 3B4DA 2VC1A 2ACYA 4PWUA 1S0MA 5F0WA 3OUYB 2BXJA 1S99A 2RMLA 4Y2MA 4DFKA 1NKEA 1DZ5A 2B6AB 1NCLA 2YNHA 4HHJA 1FTCA 1VQYA 4BWMA 4U96A 3MMCA 3NOGA 1W2BR 3PIPQ 4OYWA 5EHHA 3UPFA 3IRWP 1H0HB 2Z2MA 3GJTB 1VR6A 3THVA 4O3SA 5JXSA 2QA4G 1PSDA 3SZ2A 4YQWA 5DQGA 1S7HA 1YJRA 4J9UE 1RTDB 1R7IA 3T19A 3R2DJ 3MPWA 1NB2A 2DBBA 1S9GB 3MOZA 1YBTA 3GJQB 3Q2TC 3DLEA 2M4MA 5E0OA 4Y2CA 3WBZA 4DR1F 1YQHA 4ZCMA 3MEEB 4WFYA 1VK8A 3H40A 3T5HA 4CT9A 4FPIA 2VKZG 2WZ1A 3ILJA 5A8KB 4UT4A 4FYXB 1LWEA 2QTWA 2XMVA 1T9VA 1HQ2A 3BGUA 1VLYA 2UXBF 3VAKA 2B9WA 5CCLA 3CXCR 1KLNA 4WCEQ 4FKYA 2W2NP 3W8GA 2KYZA 5GMEA 3HHEA 1YDLA 1QY7A 2IY5B 1UFKA 3UFCX 4DCOB 1RU1A 4CH1A 1VJWA 3BDPA 3KMQA 2GHPA 1HNVB 4C8OA 2DNGA 1TV6A 1KLMA 2J0WA 3QT5A 5D0HA 5DM6Q 1OSCA 4KE5A 4DBQA 1RT2A 1K8AT 1VQ7S 3QJJA 1S1WB 2I38A 2Z30B 1KOOA 3TA2A 5IT4A 1QSLA 5ETPA 2V2VA 3CJ4A 3FDSA 1X8DA 1NMEB 2P5VA 4GMKA 5AXLA 3TUZC 5DLGA 4DUYF 4DDFA 5A6PA 3HFKA 4RBUA 3H2UB 2D74B 1O8BA 1R89A 4B9LA 1RAOA 4PG8A 1VQPS 3TZXA 1H7WA 4H4KC 4KR0B 3KLEA 1IBKF 4PQUA 1KFDA 4K4VA 1U49A 3CWJA 3PDNA 3HVTA 3BPSP 4IFYA 1F3VA 2AGOA 4JI4J 2N3OA 1YZ6A 2Q6CA 4UOFA 1TELA 4LR9A 5C2CA 4B3OA 2DEIA 4OYPA 4QWBA 4KHPF 4K59A 3FMWA 3O44A 1IBLJ 2KFYA 1AROP 1VIOA 1YRUA 1RA7A 1RWOB 4BDPA 1O0PA 1NUEA 1XERA 2DO4A 3KDNA 3MEDA 2IM2A 3CGIA 4ZPWR 1CJKA 2HGLA 3KJNB 4X4VA 3KYLA 4JI7J 4L74A 1VQ5S 1S10A 1H74A 2RUSA 5ETKA 3UNGC 4O3PA 1U09A 4C48A 1NB7A 2IPOB 2Y1LB 3EUNA 2XLKA 3DLEB 4N47A 4ZS6A 7FD1A 3T41A 4KRWA 1VFJA 3Q23A 5J2PA 1UVJA 2R7TA 5HBMA 1X7VA 2YKNB 3H98A 1ZZFA 1ZBTA 1Y3KA 2BVZA 2E5HA 1F60B 2AJ1A 2HZAA 3JTOA 3M8ZA 4IQMA 2QA1A 3VZHA 3G8SA 2FVQA 4AL5A 2IMWP 3FJ2A 2X1FA 1K47A 3W5ZA 4YY3J 5HO4A 3MMCB 3C8YA 3D68A 1DAXA 2XC9A 1NRKA 1U0HA 4JI6F 3P6YC 5KG3A 2J6UA 4K4SA 3OV7A 4FBUA 3C6TA 1JJCB 3KG4A 4JI5F 2RRAA 1P1LA 2PMHA 4EI2A 1FKOA 2EG2A 4J7CA 4M5GA 4P7VA 3RB4A 2VDIA 1VRUA 4I2PA 2LA4A 3HHKA 2C2DA 2KXHA 3HHLB 4FVCA 1G7CB 1IUJA 4P71A 1HL6A 1QE1A 2E1PA 3GYXB 3HO1A 4O4GB 4DZ6A 1HBOA 3HKZD 4ANEA 5A8WB 1X4AA 2V2QA 4L72B 4Z7YA 3SV4A 2ZBCA 2CDRB 2E7XA 5F8HA 1FFGB 3PW5A 5IS2A 4Q43A 4TKTA 2XMJA 3JS9A 1R0BG 4OZ0A 4ECXA 3OJSA 1U7LA 3DKDA 5B0DA 3CULA 4RWWA 1WC6A 3E01A 3DI6B 1F2HA 3HX9A 5KFEA 1GT8A 1RHRB 1R31A 2JHEA 4PYAA 3CJ3A 1UPPA 1VCTA 3ZTSA 4ANCA 1IBMF 5KFLA 4PUOB 4ILLA 4K50A 5DLFA 2M9KA 1HR0F 3NGSA 5LMUF 3MMBA 4PR6A 1CSJA 5EX0A 3M30B 1U2CA 2BKOA 1QDUB 3KUGA 4HVZA 4IYQA 4GO7X 3Q8YA 2AGQA 4JV1A 2JJ4D 2W8LA 4FYVB 3R8YA 5ETOA 2ZD1A 2PMZD 3H5XA 2LU2A 2CADA 2C3OA 1HYSB 1NK7A 3PRDA 2W4PA 2X7IA 3RBDA 5J1EB 1CJVA 4A46A 3CCRS 3G4SS 2IVMA 1FKAF 2HS0A 2KU7A 1MWZA 1VQNS 4NLTA 4PEOA 4DR6F 1IJEB 3G8QA 3QATA 1UEKA 2BM0A 1B3TA 4K0KF 1T94A 1Q81T 4C6AA 1OPIA 2UXDJ 1IKYA 1FK9A 2IAJB 1IKWB 4WXOA 2CJ9A 2D3UA 1WOOA 3FZ2A 4LF2A 1RWVB 5SUHA 1IR2A 2OEKA 3T1YJ 1S1TB 5HVFA 3D1OA 2DGOA 3AXMA 3H42A 4HTJA 3KNAA 2A6OA 3MDFA 5LMNJ 4GC6A 4RNOA 5LXRA 2IRYA 3MMJA 3M4XA 2YKAA 1E6VB 4DL4A 2GVZA 4I2PB 2W01A 1KTQA 3NMAA 1YJTA 4DV0J 3FRZA 4GVBA 4FN5A 2DHGA 3CCVS 2YXLA 2Q43A 1RTJA 3J80Y 3LUYA 1OPZA 1RWXB 2CJXB 1Y7PA 1YZ7A 2KRBA 3A8KA 3N9UC 4PQAA 1FESA 3I82A 4OX6A 1YJUA 3AQPA 3LALA 4DU8A 1KVIA 5CZXA 4DLGA 2IRXA 2HWTA 4NLRA 3MPDA 4OJ1A 3UW1A 1CQNA 3HP6A 4NCBA 2BJ7A 2VC0A 5B0GA 5F9NA 2KG1A 1NJZA 4DS5A 3L95X 3HKWA 5HBMB 1XR6A 4PXBA 5T7LA 2FLNA 2JEIA 3KK3A 1KS2A 2ZH2A 4NLDA 3Q86A 2UV8G 4H4OB 2EC2A 4BLGA 4ZKAA 2KG0A 3K57A 1YG0A 4I7FB 2K3IA 1F1BB 5DQHA 4GO5X 4ECWA 4URGA 3G87A 4DCJB 4J9LA 3FCVA 2BOAA 3R5GA 5F9LA 2Z0GA 3Q8QB 4JI3J 2FVRA 1FF2A 3IM8A 1NPKA 2MQNA 2QMUB 2WOMA 2XO7A 4OLPA 4PRFA 5D0RA 3S7RA 3FBFA 3HVAA 2V8PA 2QMXA 4HT5A 4RW9B 2R7QA 1ZAVA 1XEZA 1SUQB 3Q0AA 4F36A 2NXCA 3DCAA 4B3TF 1RXOB 5KTQA 3SMZA 1TTHB 4LF8F 3U7JA 4NL5A 4L3NA 2YKNA 5EGYA 3QGPA 6FD1A 3KLEB 1SJ3P 3HMJG 2HVDA 2MQPA 4IR1A 4KTQA 4CWBA 3AFGA 3QO9B 1PAUB 3NP5A 3IBCB 4IRKA 4IO9Q 2VONA 3E01B 1FJGF 5J2MB 2IM0A 3PRBA 1PCAA 1ZYQA 4NXMF 2OPRB 1B4SA 2UVUA 1SV5B 2D9PA 2YX1A 3D6MB 2F4VJ 1SBRA 2ZHBA 1E6YB 4B3SF 1N33J 3MD3A 2HFVA 5A8WA 2V2ZA 3T9ZA 3DOLB 5CYJA 1MG7A 1UZHA 4X64F 1H6KX 3VGVA 4K4ZA 1UFWA 1JLQB 4TQRA 2FHOB 3PR4A 4QYZJ 1N5TA 3BB5A 4AYBD 2XZTB 3CT9A 1VBXA 1OMSA 4QIWD 1ZTWA 4KSEB 1EB0A 3PW2A 4B9MA 1WKJA 2XZWA 1HMVA 4Y00A 1TUVA 2ZM6J 5KT6A 3RTVA 3MAHA 1WTBA 1VQ9S 1HQUB 3LANA 4K2XA 3GE9A 2HPUA 2FLOA 3UCUP 1QAXA 3KHHA 5AE1A 2BV3A 2BR0A 1GEHA 1KTVA 1LXNA 3IAM9 1N0VC 3M2RA 2YQ1A 4JI6J 4UQGA 3QPIA 1SI9A 3T3FA 2M2BA 3HHDA 4M1KA 4NMXA 3BGOP 2LDIA 2LP4A 5E2QA 1U48A 1N56A 2V0NA 4NA2A 3G9CA 2F8EX 4P2MA 1KQSR 1SJQA 4K5SA 4A48A 1SJFA 4LFBF 4Q45A 2WONB 3W60A 4FYDA 1HNXJ 4DCPB 3MCSA 1LW0A 1RTDA 4DFMA 2C2ZB 3FCWA 4HH0A 2IDLA 3H90A 2DPIA 2LXUA 4ZVUB 3IRXB 4PZVA 3OL7A 2WBMA 2RDDA 4AXIA 5HJXA 2Z2ZA 1X0PA 3DI6A 4K2JA 2LCWA 2CQ4A 5JVHQ 3MD1A 4U7CA 4NCGB 4RW4B 4Y2AA 3IO1A 2BA9A 2E9TA 5KFZA 2UVVA 1CG2A 4B08A 1TP7A 4H4MA 2AIRB 3W7BA 3TZYA 3DMJA 3JAMY 5LMUJ 3CJTA 4J9SA 1N48A 3OVBA 4ELTA 2DO0A 1APSA 3PEJA 2V4QA 1S9GA 4U67Q 4HI2A 1Z4UA 3NAHA 3K5NA 2AYBA 1Q16B 1R8HA 3I31A 5DZ7A 2VQEJ 3LGNA 2ZZMA 2VOOA 1HBMA 2IJRA 3MEDB 1LNQA 4EYHB 4DV6J 2HVZA 2WW4A 2EW9A 5G0RB 2R2UA 1RT2B 3I0RA 2JEGA 3GJRB 4DUYJ 3I0SA 5CD4A 2HVIA 1LXJA 1Q1KA 5LOQA 1EHWA 5KT4A 2JFKA 2RQMA 4PWDA 3QLHA 1HBNB 4X4SA 1YLXA 4OYXA 2C42A 3C6UA 3P5TL 4I1TA 4GVLA 5HMWA 3ZO7A 2ADBA 2C3PA 4EO6A 1TK8A 1FDDA 4AQYJ 4CNZA 1SJ4P 3QRQA 2Q66A 1GQEA 4DV5F 4FS2A 4M5DB 3TAQA 2CZ9A 3HULA 2CNOB 3DRSB 3RJMB 3WZ0A 2OD4A 2WK4A 5T41A 5HQLA 3HDSA 3K5PA 4DR5J 4FDFA 3OT9A 2DY9A 2E5LF 2R9LA 1W2IA 1S49A 2ZD1B 2RHSB 3MM8A 3SIPB 1F9FA 4K4TA 3GILA 4IO1A 3QBCA 2EPIA 3MMAB 2CWXA 4W98A 2AJFE 2RF2A 2RS2A 2CVIA 2B43A 1B7FA 3UVJA 1JK9B 4LRDA 3PO5A 1UTAA 2LQ5A 3W3SA 3AODA 1B0TA 3KLHA 2BQUA 4MT1A 4NLOA 1BHNA 1YJVA 1PC5A 1BWVA 3A4TA 3QWPA 2RD5C 4DG1A 5I3UB 3M8YA 4RR5A 3T1YF 5LT5A 1BQXA 1D9AA 1TUGB 2VG5B 3CMQA 3L4BC 3D67A 1HARA 2D9OA 1FD2A 2DXEA 2R7OA 4IH7A 1AB8A 4USVA 1RHMB 3M6VA 1OY8A 2VQFF 2BJDA 3ILLA 4RBVA 1LKZA 1TVRB 2KVQE 2KN4A 3BYPA 1VK3A 2XEXA 3I55S 2CRLA 1FRHA 3HXMA 3R7SB 2AMCB 1FX4A 1X4HA 2ILZA 2WVEA 2FGOA 2E66A 3HCXA 2B8PA 2CDQA 4XDDA 3NEKA 2W9AA 3EYZA 3HJVA 4LF8J 1VMBA 4WJBA 5DDOC 1FKOB 1H98A 2RB7A 1HQEB 3D0GE 3HF5A 4XK8C 1T95A 3CO0P 1MSWD 2W9CA 2G2ZA 3M8SA 2HBRB 4Q0BA 4HT7A 4X84A 2NPIA 2BACA 3J7Z5 2Y0BB 3I0SB 1UVKA 2AYGA 3QIPB 1GMWA 2CYYA 1ELOA 1N52B 3W63A 2NZ4A 1SQEA 3M05A 3UD5A 3IBWA 4X62J 4WIIA 4F0KA 3OUYA 4IH6A 3WIVA 5LJ3Y 4DL6A 2HFSA 4LRAA 3M2UA 2MKHA 3CJKA 4ES3A 4Z7CA 1IBMJ 1C0TA 3OW2R 3FC9A 3MXHP 5IV4A 2G13A 4ZVPB 2DXDA 4CI0B 4YHHF 5KFTA 1OS5A 4ZCKA 3KUHA 5HSPA 4O3OA 2HHHF 2G2OA 4QWCA 1IM4A 1VBKA 3NGKA 3PHTA 1NJWA 3DMJB 4TLQA 2AF6A 2UU9F 5JMNA 5HAOA 2GO8A 3TQEA 1KD1T 3PACA 4FYWB 4KJIA 4LF9J 1ZOTA 3J7A1 1BE4A 4N8NA 2F63A 4G65A 2ZH5A 2HYIB 4DWIA 4JI5J 2UZAA 3O6QA 1Q5YA 1PYSB 3ISZA 4ZDNA 1W26A 2VFUA 4U6PA 1Y5NB 4C3LA 2B8QA 4X62F 1TKXB 1VC6A 1X60A 3MM9B 4IRCA 3GSIA 2YNIB 3ET6B 2VUGA 4J90A 1VC5A 4FPRA 4L73A 4UUXA 5L1JA 3PY8A 1V9OA 1G4CA 3ENAA 4DSEA 3F56A 3K7RA 1SKWA 2AX0A 1TVRA 1LWFB 1RHUB 2FVCA 4HKQA 4OL8A 2HLTA 1IWAA 3FEZA 2V94A 4KFBA 2HGNA 2WBRA 1F5BA 1HKAA 1RDRA 2YKOA 4TYAA 4Z2XA 2VJVA 3DC2A 4BBYA 4MKYA 2C22A 2XMUA 3H5SA 3K8WA 5E7OB 4B9SA 4KV8A 4EBDA 1X9SA 1WHVA 3D66A 3BH7B 4J9MA 1Y00A 2GVDA 4NOHA 1YSJA 5ETNA 3QGGA 1M1HA 1HBUB 3CJ5A 3MM5A 3OBIA 1HBUA 2UUBJ 2YVSA 4ITSA 3QFHA 3KDOA 1QUVA 4NCAA 4G1QB 3RBZA 2HHQA 1S1XA 2NSBA 4AFFA 1T05B 1RI7A 2C2EA 2BUNA 2FQQB 3D28A 5KFIA 4C3KA 3TEHB 1RAIB 2OPSA 4NA3A 2KTQA 4CT8A 4G6VB 1U1MA 4DSLA 4J9RA 1V3RA 4Q2MA 4K0KJ 2R7VA 5KFSA 3PW4A 2BMBA 1WHWA 2FLLA 1T03A 2NQPA 1Q7LB 1WSVA 3SDEB 1PJ7A 4USWA 1RBAA 3ZZUA 2VQEF 2BX6A 2OKQA 3DLJA 3NBPB 4ED7A 5F8NA 5I42B 4F4ZA 3OSNA 3UCZP 2J9CA 3K2YA 3W9IA 2W4CA 1IM6A 3QAUA 1G1XA 1RADB 2E44A 2KO1A 3ENWA 4DN9A 3R1HA 3OSPA 1U1PA 3X1LB 2W9CB 3LAKA 2GX8A 3GTYX 2E29A 3H2VE 2ZFHA 2AU0A 4WZQA 2RKIA 5B0BA 1R8CA 1VI7A 4DR4J 1Q0NA 1OJ4A 3E8OA 1RAJA 2JWNA 2ZOMA 2BEFA 3CJ2A 5IT9Y 3NCRA 1H72C 1U1OA 2CIMA 2HVHA 1LV5A 1UW9A 1UA0A 2GMJA 2WTFA 3JTPA 5K8MA 4GRSA 2DHSA 4RU2A 3PJXA 3OVAA 2XO6A 4CYUA 4C8MA 4RNNA 2HVEA 2JLFA 2XMMA 4ATNA 3M32A 3GLJA 1K9MT 3GFHA 4N7TA 2BKPA 1CS4B 2Z57B 4KAIA 3VZIA 3IC1A 2PMWA 2X3GA 3EICA 2DNYA 2QE5A 5I4MA 2DGWA 3N5BA 2HK2A 3DN9A 1FNMA 3P5BP 1FA0A 4WTOB 2D3O1 1SC1B 3ZZTA 2PO4A 4USJC 3IG1A 3GIMA 2DH7A 1ZTTA 2CAJA 2V5HG 3GONA 2XMAA 2V8DA 3A8EA 3IR5B 3TAMB 1FWPA 3QQCD 5AT1B 4CLYA 3DLHA 1OIAA 3RR7A 3CO9A 4PCQA 3RYLA 1F5AA 2QGFB 2HFUA 4B3TJ 2OPRA 3M2RB 3SI8A 4FYYB 3CCQS 3DRSA 1PGZA 4IG3B 1S7IA 1FNOA 3D4JA 1F6TA 2BRLA 2CPFA 1TL5A 3A3OB 4ICLB 3EVMA 4KT0C 4UW2A 4MAKA 5F8MA 5KG7A 3QZ8A 3GQCA 1EZZB 4MTPA 1X0FA 1FRJA 3MTKA 2GJFA 2IBKA 2CG8A 5A0YA 4N5SA 1U26A 3KK1A 2Q1LA 4F3QA 2RQ4A 2MLXA 5J1EA 2B9XA 2KT2A 1UMJA 2IVYA 5C5JA 5KT7A 3MOJB 4RW8B 3THPA 5ITHA 3KLIB 2RU3A 3NGDA 2P6SA 1XWLA 1SH3A 2ZDOA 3PFEA 4MYTA 1WOPA 4LF5F 4JV5F 4LIRA 2RDJA 3W2VB 1JLCB 1RT7B 2B5JB 4OHVA 2GZOA 2MKKA 2EWHA 3GV7B 2FYXA 1IBKJ 3TUJC 3RG6A 3K89A 2JL9A 1NDCA 3ZZRA 1Z2ZA 1UETA 3ISNC 3PX4A 3A8IA 5CAAA 1WELA 1KBRA 1L3KA 2MKCA 1FI4A 3PXGa 3FMBA 1RBOB 3IGNA 4A8FA 2GO9A 3KHRA 2MY7A 3T5LA 5DM7Q 5EUHA 4DN0A 4I6WA 4X4PA 1RTZA 4Y3CA 2E7WA 3P96A 4MKVA 3UO0A 3HSDA 5KT5A 1VGYA 2CZ4A 3R9LA 2DH8A 1FT8A 5HP1A 1I1GA 1HPZA 2QRRA 2FJWA 3IAS9 4LFAF 4CQ1A 2G1DA 2RDIA 1YRXA 4OMFG 2NLWA 2ZITA 4RW9A 5CABA 1RYRA 1T8EA 2MSSA 2HHVA 4ZPBA 4OYOA 3OTOF 2J5AA 3DFEA 3B54A 1FDNA 3CDEA 5K5MA 4JUZA 3W9HA 2I2YA 3DNCA 4LSZB 4MFBA 2K06A 4R0EA 1WSRA 2VFSA 4IKAA 4MFBB 2FJEB 4P72A 4YB6A 5DRKA 3SXLA 2ZJRQ 4ZVFA 2K2PA 2NSCA 3FK4A 3LAMA 5T14A 2V4RA 2N4DA 1PILA 2E1CA 4ZHRB 2F9JA 2KFZA 2ZKTA 2J7WA 1CJUB 3G82A 3KG0A 4N77A 3RAMA 1X4FA 3EGNA 3R5JB 4P6QA 5AE2A 2VA2A 2Q6BA 2UU9J 3IS9A 2QFJA 1FERA 2ZVIA 3MTJA 2AT1B 3AD9C 1YWXA 2RRNA 3AOCA 4RWXA 1YTYA 5ETQA 4JI4F 4DR5F 3IRXA 1ACMB 3OTEA 2B7CB 2KDOA 2W24A 1NJYA 3H25A 2PI4A 3BN4A 4LFAJ 3HSGA 1D1UA 1S72S 4JI8F 1XR7A 2DR8A 2OEMA 2XHCA 3TVZA 5L38A 5B09A 3D3CJ 3D9BA 4TU7A 1XNQJ 1S9EB 4A8OA 4DPOA 1HNXF 1G6BA 1VDHA 3OR1B 5GMKa 2FLPA 2CVEA 1R6VA 3CD5A 1NH8A 2EVZA 1V5VA 2AJ2A 1GMVA 2UUAF 2EBEA 2E5LJ 1EETA 1T9TA 1TFWA 4KGKA 1KQGB 2XY7A 3MCOA 3QFWA 3UDLA 2M8DB 2CZVC 3JXOA 4RU9A 4ZJLA 3MFIA 5HVHA 3PX6A 5D15A 2AKWB 1CJVB 3Q22A 2DHHA 4WWSA 4QU6A 4PAAA 1LWEB 2X1GA 5A8KA 2FHMA 3UCGA 4K7QA 1NDKA 3CSKA 2OTLS 3QAEA 4DI6A 4F0HA 3TAMA 4P2SA 3W2VA 5IWAF 5GADI 2HS3A 2XYPB 3DOKA 1QM9A 3EPGA 4C8KA 4OYAA 4NRTA 1TKXA 3PV8A 4EZ6A 3I5BA 3RAXA 2PGCA 4OJ3A 2M8HA 4CLWA 3DYAB 1SV5A 2N7CA 4HHHA 5CYQA 3KKFA 3L09A 1XIQA 2PA8D 4KQZA 4LQ9A 3OTCA 3BO4A 4F02A 4WYLA 2PFDA 1PYTA 2YY3A 4ZN1A 3K17A 5D6GA 4EBCA 1HA1A 1SPBP 4YR0A 3I9V9 2OIHA 3IMQJ 3MM7A 1LK7A 1JLFB 3GIRA 2K7KA 2K3KA 3GFZA 3M32B 5AXKA 5A2QU 3PHEA 3UD3P 2XWYA 3QT7A 2AGPA 1JQGA 2C1EB 2R8KA 2MSTA 3CC2S 1JX4A 4QZVB 4DS4A 1I6JA 3LTOA 3TVYA 2YKMA 5DETA 4I6YA 2XYGB 3IR7B 1MMNA 3J81j 1P9QC 5KFXA 4HL9A 4KHPJ 1JWWA 3CB4A 3FRYA 4P2FA 1R8PA 3WHIA 2G4BA 4H4KA 3JSRA 3MUMP 2A6MA 4XTTA 2YWEA 1U1NA 3C6TB 2HQGA 4KH1B 1K73T 1JNRB 3GG0A 3FSIA 5DG7A 4KPCA 1NXIA 3TJAA 5ETLA 3EZOA 2NR0A 1HQEA 3KHLA 4IFVB 1LEOA 2WHOA 2O5DA 4PG7A 4QPXA 5D77A 5F3ZA 1UVIA 2P8IA 4Y6IA 3OVSA 4ER8A 1VQMS 4X4UA 2E5IA 2Y1JA 5B7WA 3LP2B 3MUVP 2QG9B 4NXMJ 2XULA 4KV8B 4PABA 4I68A 3C16B 1JIHA 2UUBF 3DRYA 1JJ4A 1WHYA 2P9EA 4RO0A 2FD2A 4TLRA 3T6BA 2K1RA 3TNVA 3RRKA 2PEHA 5C24A 2V9WA 1EQ0A 3HT0A 4RW7A 3D54A 1NHKL 1MLAA 3JSYA 1D8YA 2NS1B 4ZVTB 1S57A 1S1TA 4OIXA 1DQ8A 2JRSA 1REVA 1H73A 2GCFA 1Y5LB 2CPEA 2P9GA 4TY8B 3TA1A 4RNMA 4DOZA 3D6TB 5J2NA 5K14B 3SCLE 2BQ3A 2XG8A 2Z4PA 5A0YB 2RUGA 3DRRA 1TKZA 2CQ2A 2RF2B 1UVNA 1XNRF 2LEAA 3T1HF 2M7SA 2EKNA 2V8VA 4A8XA 4IDKA 2EG1A 1RT1B 2F5GA 3OHAA 2LA6A 3NS6A 1VQLS 4F25A 3R5AA 5U47A 3NNHA 1JLEB 2YWGA 5F3TA 1PIEA 3J80U 4ZLLA 2YNIA 1TL4A 3C3LA 1KP6A 3D6FB 4NXNF 3LWLA 2VA3A 4A8QA 1WACA 2YNGA 3Q8SB 3CD7A 1F3FA 1MWQA 2P6TA 1M5OC 2QL5B 1S59A 4NPOA 1EIYB 5KT3A 1NH7A 2F1FA 4E0DA 3WX8A 2HMIA 2UXBJ 1Q8BA 1TKTB 1ZA1B 1J5EF 3ZNUA 3G86A 5KFQA 2Z8QA 3I56S 1Q8KA 3ZNJ1 4ED5A 2B4UA 2CUYA 2J9EA 1NZ8A 2BE2A 4NWBA 1RWNB 5E3PA 1HBMB 4C8NA 3NY0A 1RYSA 2AEJA 2G0JA 2MYFA 3AH6A 2CPXA 1R43A 1RSCA 1RP5A 1VOMA 2FHJA 3RGIA 3US5A 4DX7A 5C42B 2VIHA 1J5EJ 1SQGA 3BR8A 5J2PB 3CD0A 2G1HA 5AJ3F 3TARA 1PAEX 4X4OA 3NWRA 2ZWOA 2HHUA 3PM9A 1EP4B 4OV1A 3T9NA 2ZBIA 1SC6A 3A13A 4KO0A 5B0AA 4H4MB 2W7PA 2I9SA 2RKIB 1HD0A 1RUSA 1TL3A 2EKYA 2HG4A 1L5UA 4KKOA 2ZH7A 3BJYA 1J27A 3AJ1A 5L9XA 2V8HA 2YX7A 3KLGB 4A4JA 2W9BA 1QVGR 2L3MA 3M8QB 1RTHA 2FB0A 2DR7A 1ZA2B 1GNKA 1RTHB 3EGVA 3AD8C 3NKYA 2FZKB 2PA3A 4M5KA 4C0OC 3DHXA 4X4TA 3O3LA 3SQGB 3QSIA 2X3DA 4OFZA 2X1BA 4GKJF 5J2NB 1A0OB 3GV5B 4W92B 2H3EB 5EX3A 2G0CA 3C14A 4X4RA 2UXDF 2U2FA 2VG6B 1MW7A 2F9DA 4D3GA 4DV5J 5DQIA 2RNEA 2XGQA 1JLBB 4L3KA 4QW8A 1ROFA 2MPUA 3CF5Q 1OQ6A 3AOAA 2FJAB 1C1CA 1SC4B 1RT3B 3IR6B 4CM2A 3K5OA 3VCDA 1XMOF 2KVIA 2UXCJ 3CJSA 3C2PA 1B99A 1DY3A 1R0CB 2H1YA 2L9NA 3M2UB 1FNXH 2C3YA 3SBMA 2ZEJA 3MHYA 2R8IA 2HQ3A 4X4QA 3POTB 1FD8A 3JSBA 3WDOA 1WNEA 1MU2A 4AT1B 1XNQF 3LF0A 2HNDA 4KHRA 4LSLB 4CLFA 1M90T 3DM2A 4WU2A 4ZA1A 1ZM4A 2HMIB 2GMHA 5K14A 3SSRA 2KKHA 3TI0A 1NHVA 2AZ3A 4QBUA 2ZOFA 2JEJA 4JI3F 2HEKA 3FEYB 4C4WA 4LF4J 1WDTA 3I32A 4QPTA 1CPZA 1FRMA 5HVGA 3WC2A 3BO2A 2W8KA 3PNIA 2VFRA 1RAHB 3DXSX 4LRFA 2Y0SD 3PYDA 3VVUA 2HRUA 5L1KA 2C2RA 1U1QA 3J7YI 3MEGA 4C11B 2HGMA 3ETMA 4RX6A 1Y0HA 2HHTA 3F73A 4OI0A 3MZIA 5D4LA 5EDWA 4AUKA 1MMLA 2YKPA 1RE1B 3I6PA 5ETRA 1R6YA 1S6PB 2LYVA 3CJKB 2HNZB 2CQ0A 2AJQA 2ZC3A 4OI4A 4DL3A 2JNJA 1HWIA 1XBWA 4P10A 5E3QA 7AT1B 3MR3A 1EARA 4IH5A 3H4BA 4NE9C 1FJEB 1LWCB 3OXLA 3UVJB 2CJBA 2DGVA 2LECA 3PO4A 4AE5A 3Q8RB 1SKUB 2CG4A 4NI2B 4NZ7A 3R97A 3TR5A 5A8RB 2ZNYA 3I87A 2L9WA 1KVKA 1K44A 4ZP9A 1S0OA 8RUCA 2BOPA 4DXLA 2ZH4A 5BYQA 4J9NA 3QIDA 3LP1B 1UEVA 1IXKA 2RQKA 1CQMA 4O3QA 4P52A 4D3HA 2OUGA 4Y2KA 4S0MA 2ZM6F 1JKHA 1S4FA 3BBFA 3BSNA 1RU2A 5K20B 2ILYA 2VD3A 1S4EA 5C42A 3KWMA 2CNKB 5F8GA 4CH0S 1UJ5A 4HH1A 4IQXA 2IM1A 5LM7E 4ES1A 1WEZA 3KJVA 2L08A 2PFFB 4JYAF 5KFRA 2GS8A 2YNHB 1T9WA 3O5TB 1P6TA 3KXDA 2ZBRA 3P8BB 4NLUA 4OJHA 4QQBA 3T1AA 4CO2A 5E5NA 1SKSA 1U8SA 2F4VF 5DDPC 4ZPDA 2XS2A 3HD1A 1UZDA 4UOHA 2WONA 4LF7F 1W7WA 4ECVA 2E1AA 3THTA 4DPUA 2MKIA 3ZC4A 1KN6A 1F0XA 5IZHA 2B4PA 4HACA 1T0TV 1M5SA 1WG4A 1T7PA 2QL9B 4ZMMA 4NLSA 4RW7B 1X5OA 3BH6B 2OP5A 2A18A 3PFOA 1IN0A 4ES2A 2NXJA 3S6EA 4M5DA 4EEYA 4DL7A 4Q8FA 2AJ0A 3SYZA 2DPJA 1S12A 4I0WA 4DQIA 2DR9A 2MZRA 3UD4P 2LQBA 3K5MA 4MK8A 4OHZA 3I5AA 2HRTA 5C25A 2GA7A 5FLXU 2YQ3A 2AEFA 4XPEA 2DNPA 2WVFA 3HJFA 2IMOA 4CO1A 1RCXB 4B3MF 5CYQB 3AXKA 5D0EA 2UV8A 2DJWA 4TY8A 4FF1A 2MZTA 4LSLA 2NUUG 1RISA 5GAHI 2JLGA 3BM7A 1RAGB 4DR3F 1WF0A 3JTNA 5FIIA 3VAJA 5G0RA 2VV5A 2ZUAA 3MMAA 4YN3B 5LSOA 3UI3A 1GTEA 2QT7A 2MEWA 4I4BA 2A2CA 1S76D 1MROB 2ASDA 4LJMA 2LVWA 2AYEA 3H20A 3M2VB 4KB7A 2KXNB 2FY1A 3E2EA 2VU5A 2Q79A 1FRXA 4FXWA 4UOGA 3KK2A 4H4OA 2HKEA 1FWKA 2MDAA 4TN2A 5C2GA 2EC0A 1NK5A 1FEHA 5IWAJ 3M8WA 2MY8A 4XIUA 2PC6A 3SSSA 4V19X 3LP0B 1TKDA 4MMOA 4DPWA 3JSMB 1PO6A 1H38A 3ENVA 3GWCA 3SQGA 4O0IA 3VAGA 2B9YA 3BSCA 1CJUA 2D3ZA 3B4MA 4MJKA 4ZCLA 2DNHA 2COLA 4M5HA 3N01A 2FHJD 2YWHA 5FDLB 3M9MB 1D8ZA 4K4UA 3G6YA 1KR4A 3PTWA 2OPQB 4HR2A 4DX5A 1S0NA 2ZDPA 3MGJA 5B0FA 2UVWA 5HJYA 2GJ2A 1XJWB 1WI6A 2OSRA 5KOXA 1IQZA 5KFAA 4CO4A 4J9OA 2C28A 2GIQA 4YMEA 2GMLA 3NS7B 4TY9A 4F3OA 3NL0A 3KLIA 2VH7A 4QIGA 2VB6A 5GAGI 3ZZOA 1YIJS 4ECYA 5M2PA 3LGMA 4ZPVR 2QLFB 3LPYA 1VC0A 2IBOA 4X66F 1LWXA 4K8RA 2VFVA 1N5QA 4EO8A 3LO3A 1XC9A 2LFVA 1OQ3A 1RAEB 4KHMA 3WC0A 3WQPA 3UN5A 2F8MA 3W9JA 1N88A 1TL7A 4C2MA 3OHBA 3SDEA 2W1BA 2N3LA 4QIFA 2XS7A 2CNLB 8ATCB 4GVBB 3TP2A 1RAFB 1SC3B 4ERDA 5F8JA 4YFUA 1DRZA 3M9OB 5HN0A 4QWAA 1U1RA 3GFXA 4B3SJ 1TAQA 2QX0A 3LOUA 4UUWA 4FS1A 4WK3A 2GHVC 2XMWA 2DRBA 3OQ2A 2CQIA 1BC6A 1LOUA 1N54B 1S1XB 1VHIA 4ZVGA 3JYTA 2H4WB 4RW8A 3CD6S 2QLBB 3TO8A 5DDRC 5H9FJ 4LIWA 1RTIA 4IOCQ 1XMQF 1IVZA 4UOCA 3NXZA 3I9ZA 4C8YA 2OSQA 2APOA 1HQUA 2Z2LA 2CFXA 4YDXA 1P8GA 1OY9A 1UJ6A 2OELA 2ATLA 1NSPA 2KB2A 1IKVB 3AJ2A 2ZZTA 2JFDA 4IG3A 4ETZA 4RBTA 4O3RA 3U1MA 3OXGA 2RAQA 4ZVQB 4USMA 4DFJA 1UL3A 3RU0A 4QU7A 1Q5VA 3TRGA 1U1LA 2J0SD 3DOLA 3FVYA 1P1TA 1RK8A 1S48A 2E5GA 4LF4F 1FJ7A 4R0JA 2I5JB 4G3IA 4IOBA 2IRUA 2Q3PA 5DO2A 4O44B 1TK5A 2J7UA 4I64A 4ECUA 5J2QB 5HLFA 1YJ9S 1B7YB 3GYGA 3M8RA 3DLGB 4Y65A 1H2TZ 2A0FB 2DGSA 3NGTA 2EEYA 3H0PA 4FKXA 4HEA9 4OJGA 3S8SA 4DV2F 5H9EJ 4F04B 4LFBJ 4EUVA 1WG5A 1T3OA 4KGZB 1TFYA 3FEXB 4DL5A 3KLGA 2W9BB 2GFFA 3KJVB 5KFJA 2NZCA 3OTBA 4QWEA 2LEBA 2HBYB 4ID5B 4M5NA 5MLCV 2KYXA 3D3BJ 5F8IA 3OD2A 2OTJS 5DGBA 3F0NA 5I42A 1GAOA 1BUXA 2A10A 1RA6A 2D7SA 3CNQP 3G82B 3I96A 5LMNF 2MQMA 4NLYA 3RR8A 2XNRA 1HNIA 1T11A 3RB0A 4NYZA 3TYTA 1NK9A 1QAIA 1HNZF 5IT9U 1QE1B 2ZNZA 4FNHA 3VGUA 2CWKA 2CQ3A 2R7RA 3GFYA 6FDRA 4N76A 2EFQA 4ZN3A 2GVZB 4DV3J 4OHYA 4R5PA 1ITPA 4I6AA 2W2QP 1Y4ZB 1KC8T 1JLCA 1RT7A 2B56A 3GU0A 5GADU 3PIOQ 5HL7Q 1VQ6S 3IXQA 3FSYA 1T05A 2AWZA 4M63A 2AX1A 3CVKA 3RBXA 3QZ7A 1Y9OA 2OLWA 2MZSA 1RT4B 5M2UA 5D8HB 4DV3F 1FWLA 4IFYB 3HVTB 1NK8A 2W7OA 1WC0A 1RT5B 1M1GA 2WB1D 3HFZB 1S6PA 1SIZA 2G2YA 2W7AA 3GR0A 5C25B 4B9VA 4ED2A 1AT1B 2DNLA 3G71S 1SL1A 1BY9A 3MM7B 4OZLA 4ZP7A 2C3UA 2KT5A 3EGWB 4CLTA 1B64A 1DJ0A 3VGSA 4X65F 1BQNA 4F4KA 1B0PA 4YB5A 2EK1A 3CCWA 2L48A 4P2XA 2I6WA 1CJKB 1K1QA 1RT6B 2W2OP 1KOHA 3N28A 2QJ3A 3VV2B 2BW2A 2VZ9A 4MKBA 4UTGA 4FF4A 1SH0A 2AHOB 1C0UA 4LSNA 3Q83A 4LR7A 1HHQA 3D1HA 4DR4F 3BGRB 1MN7A 5DGAA 1Q78A 4OYZA 2DGUA 3H59A 1NK6A 3MI7X 6AT1B 2V34A 2CQHA 2WVBA 3FCHA 4B3RF 3POTA 1TAUA 2Y3YA 2H5JB 3X3UA 1X4EA 4U8VA 4CP5A 2IHR1 3HVWA 3ITHB 5H1SV 3J81Y 2ZH3A 1RQ0A 3NAIA 2O3DA 2XI2A 4LREA 4EU0A 1VQSA 3AHPA 3CC7S 3PW7A 2GJIA 1HI1A 1HBOB 3FKBA 1MMDA 3C16A 3ZZYA 1JLBA 2OO4A 4AD6A 4F3MA 3CCUS 2ZWPA 3EVOA 3SCIE 3M1VB 3OLBA 2UUTA 5E33A 4DV1J 4C8LA 1RZMA 5G4DA 2DR5A 2HBQB 2W2MP 3GV8B 2IFXA 4PPDA 4Y34A 1YJWS 3SFUA 4U95A 2GIFA 3CCTA 2ERRA 1A7GE 2M88A 4PQUB 1VQOS 4PUOA 4QR2A 1AZSB 2GQCA 1FDBA 2M0GB 2V67A 3M8QA 1R8AA 2V2KA 1F2GA 1LWCA 2H5IB 1T9XA 3EWGA 3K58A 2HHXA 1NKBA 4ZPCA 3CJ0A 4KFBB 5CYMA 2J7KA 2HNZA 1WKLA 1QLNA 5F41A 1LK5A 4XDCA 3DOMA 2M70A 3O1LA 4CZCA 1QUPA 5IQ6A 1S1WA 3JQMA 5J1NA 4EYIB 4KY3A 2JC1A 5GAEI 1GH8A 2DXFA 2IJFA 3ELHA 5CZVA 2MKYA 4ZJOA 3JB9k 3HZEA 3KG1A 3C14B 3FFIB 2NCKL 2IC3A 3ZZ0A 1NPPA 5D4NA 3V81B 3ZXWA 3GIJA 3QSYB 2HQFA 3AT1B 3QIPA 3CDWA 4OYIA 1FXLA 2MZJA 1AZSA 2QV6A 5IFMA 4JV5J 1C1BB 2QYGA 3BKTA 3KJFB 5IC6B 1HWLA 4DG1B 2XLIA 3M9NB 4DR2F 3V6DB 5I3UA 2FJVA 3DLLQ 3NMRA 4B9NA 1N8RT 2OMLA 1TL3B 5BR8F 3AA9A 2HLUA 1IR0A 1QAYA 2VF3A 2WSFC 2QO3A 2ZJQQ 3VAIA 4FZVA 2QLJB 4QCLA 3EDQB 4ECQA 2DVIA 2ABYA 2DCUB 1FDAA 1HW9A 1CC7A 4Y2IA 2ZH9A 3QT8A 2CPJA 3HSZA 1HNWJ 3MM8B 1FXDA 3T5KA 1N34J 1N32J 2FTRA 1UEUA 4P74A 1T03B 1URRA 2MQLA 2J8SA 4KIAA 4Q44A 3VTIA 3HT3A 4RUHA 3FUYA 3HHNB 4AL6A 3FBBA 5A76A 1WG1A 5IV3A 4ED1A 2KZMA 2HIQA 4USTA 2CQPA 2BE2B 2OFGX 2RT3A 4LF9F 2C2NA 1ZH5A 2HHWA 2EFNA 1WC4A 2MJUA 1KSPA 2G0IA 1TMMA 2QA4S 4KC5A 1HMVB 3ILIA 3TX0A 2AQ4A 4FF3A 4Q0BB 3C66A 4QR0A 3BGRA 1Q8LA 3CCSS 2XNQA 3DGVA 3H7HB 3AQOA 4HDGA 4OLOA 3HZGA 3OJUA 4A8KA 4CRJA 2MMYA 2WRMA 4UZBA 1C1BA 3CJ8A 2YNFA 1CEZA 5HQ8A 2FJXA 5BR8J 2MGZB 4YEAA 3TZWA 2XSJB 4NEZA 2DY1A 5F0UA 2CJYB 3GZ7A 3MR7A 3PYEA 4PPZA 4OX7A 3PCOB 1BD6A 2C2OB 3ZZPA 4EZ9A 4ILRA 4E2FB 1IQTA 1WD6A 2PDAA 4Q7AA 3MM6B 2ZE2B 4URQU 2OH2A 1UKUA 3BN7A 3TWZA 1NBEB 3MEEA 4DUZF 4BHQA 4X2BA 4JI2J 2MLYA 4WK1A 1NM2A 2OI2A 3RB3A 1SJRA 3ADAC 3TX8A 1WF1A 2OFHX 3W5YA 1JJ2R 5D3GB 3K8VA 3HHLC 3SQOP 5C7PA 3CMES 4NLWA 2E1MC 2VG6A 5ETSA 2HURA 3R6LB 3R6GB 3T5JA 4N41A 4I67A 3W64A 2J0XA 2MQ8A 3QLHB 2L41A 3EPIA 3NLCA 4PKDB 2QSFA 4CO5A 3DGPA 1ZM2A 2CJAA 1C0UB 4R8UA 3EJMA 2DH9A 1MU2B 4FNIA 1IKXA 4MIWA 9ATCB 1Y5IB 4AL7A 4ZHRA 2B6AA 2KHDA 4DX8H 2XSFA 4KKOB 2O66A 3L9ZA 2YH0A 3N4WA 3OPKA 2J8AA 4OHXA 3MWBA 3DDKA 5D4PA 1EKSA 3OTDA 4WP3A 1M5PC 4I7FA 4FVMA 4DMZA 2AW0A 1N5YB 1CLFA 3LP2A 4LR8A 2YKMB 3DOMB 2GQ2A 3H2LA 4DU7A 3TOQA 2X1AA 5KG1A 1L3TA 1ZAXA 1HBNA 3GCWP 4USHA 4NCGA 2Y8YA 3TVKA 1Z1ZA 2JOQA 4RL1A 1UW4A 1UVMA 2OGUA 2M52A 4O0NA 5GMDA 3C15A 3O8WA 4O23A 1FKPA 1GXUA 1K1SA 2KL8A 4LFCF 2NPFA 3P3DA 3CDBA 2HAIA 3ISND 4HTIA 3JQJA 4XPCA 2AJ4A 1U47A 4B3RJ 4F8RA 4YHHJ 1SL2A 2YNGB 2EBGA 4RUCA 2ZH8A 2CQGA 4LBIA 3R5DA 2GQQA 3NBPA 4Z37A 2JVRA 4PXCA 1YRTA 4P75A 3CJQA 1FRKA 2CNNB 1NAQA 3MM6A 3LW5C 3CCZA 3N79A 3UR3C 2BJ1A 2DHXA 3B78A 3IWNC 1RT1A 2ZKUA 2R7SA 5L39A 2QLWA 1NSKL 3LWMA 1Q86T 2VG5A 2HHSA 4CTAB 1NK0A 3RRGA 2ATCB 4YDDB 2KXFA 5KG2A 4TYBA 3GCXP 2BYCA 2H9ZA 1RKIA 2OD6A 2DEJA 2QFIA 4G1QA 4TVAB 5IOLA 5B0CA 4IRDA 4JI7F 3K59A 4C3MA 5B0EA 1SKRA 3DLGA 4FXVA 2R3VA 1SCJB 3AY0A 3DYAA 2RE1A 2XMKA 1REVB 3KLFA 1WJ9A 2GGPA 4LVNP 3VQSA 3BQ0A 3DOKB 3A8JA 4BC7A 2MXYA 1F5CA 1IBCB 1S6QB 3TZZA 3G6XA 4IUFA 3GPAA 1I51B 5HMXA 5HQMA 1IWGA 3KOAA 4WXWA 4ID8A 3DU6A 2VICA 1LWFA 1PKUA 3CE8A 1S1VB 3PX0A 3VR1A 3AB4B 4Q5VA 3PYGA 2FZGB 4LF6J 2ZHAA 2DNRA 2MZQA 3CIZA 1FXRA 2YQ0A 4YOEA 2R42A 1RWUA 3OR2A 3L7PA 3P49B 1WF2A 3EGZA 3BF4A 4RW4A 2DRAA 1JLGA 1RT4A 4LSNB 1NZAA 2BRKA 2DNQA 2CJKA 5KFMA 1NPRA 4DR7F 3W1YC 1V6HA 5HMYA 2UUWA 1A9NB 4F2RA 1S9EA 1X4BA 3FBCA 3CCES 2BM1A 2DR6A 2V69A 3QRPA 4YY3F 1PG5B 3CUNA 1ZETA 4M94A 4LQ3A 3CDUA 3KLVA 2POKA 1PJ6A 4LUBA 4YUDA 1C2PA 2CPYA 1BQNB 2RRBA 1AUDA 1WC3A 3F41A 4I56A 1TL7B 1TL1A 4WBFA 4ZLPA 2GW8A 3ULHA 1D09B 2MHEA 1PYOB 5EWEA 1KVJA 1KHWA 2EFOA 2UP1A 2I1RA 3EM1A 2JX2A 2NYIA 5HP1B 5IXUA 2DD8S 3OL8A 2CQBA 4P73A 1OSDA 4LT6A 1KWMA 3M8PA 3EMTA 4HHUA 1RGVA 3TJ8A 4C7QA 1SUQA 2BE7D 2ZHOA 2DHAA 3SSQA 3N6MA 5ETTA 3WX4A 2ASLA 1R0AB 5L9NA 2C2KB 3BREA 5KFYA 2E7VA 3DHWC 1U45A 2BJEA 2V4JA 3ZZZA 4JBCA 3H5UA 4OI2A 3TEGA 1RAAB 4K4YA 1EX8A 3CJRA 2MKJA 3V6HA 2HS4A 3D0IE 5JJBA 4B9TA 5IM0B 5MAOA 4IG0A 2RSQA 5CH7B 3CW2C 2HNYA 3DRPA 1EAYC 3IA0A 3U02A 3CIMA 1GXLA 3KLFB 3OL9A 2RS8A 4V1Ak 3KTQA 3A3NB 1TK0A 1FO1A 2YTCA 2LQJA 2P9CA 3BKUA 1OYDA 3HD2A 5HMZA 3BGFA 3GSDA 2J0QD 5B08A 2DK2A 1A6LA 3DDIA 4CNYA 2F65A 1S1UA 4M5JA 4UZCA 5HANA 3M6XA 3AA8A 4XO0A 4F7VA 3OLAA 4JV0A 4CTAA 4NYOA 3W62A 4JI8J 4PXDA 4A8SA 2FC9A 3PVXA 1GTHA 1UP1A 1HI8A 3KK2B 1MN9A 1RHQB 9RUBA 1RTIB 2X51A 1J5OB 2LQ9A 3BZQA 2LDYA 3NCQA 4UY8T 3U27A 2B5JA 1Q79A 2DT9A 3QJLA 1GMUA 1S0VA 1JXVA 1ZAWA 2XM3A 5KFDA 2E9ZA 2ZH1A 3O2IA 3T6JA 5FD1A 4ZIVA 2FVPA 3HVRA 1E6YA 5DS7A 3W61A 4DPYA 1HNVA 2QL7B 4DR6J 4PG6A 2KI2A 2WSCC 3OFGA 3TAPA 4LVOP 5HROA 5KOWA 2FZCB 1NSAA 1UWAA 4CLUA 5CA5A 1VRTB 2IA0A 3EE3A 4NZ0A 2V9KA 3ZTPA 2YBVA 2HZCA 4AXJA 2DB1A 5ETMA 5CXTA 1S1UB 3G6VA 3D1QA 5GVQA 4RLEA 1HHTP 3MCNA 2VASA 4ZVSB 2XY5A 2IDEA 2CPHA 2HFZA 3FBEA 1N6QA 2VQFJ 2IYIA 1ICEB 1HWJA 1UAWA 5JVGQ 2JEFA 4MIAA 1M1KT 3R3TA 4ZVEA 2HIYA 3KNGA 2HRYA 4DEZA 4OV6A 4W4MA 2D1CA 2IIHA 3MMBB 4P9SA 2FPHX 2H5EA 1OYEA 2ALYB 2BJ9A 1AUSL 4Q8EA 5BYSA 2F3JA 1HNIB 4NLPA 1UWBB 2HFNA 2HSEB 1CJTB 3HI9A 4ENOA 1HPZB 2N4CA 1T02A 2WAQD 1JLGB 5KG0A 4ILMA 1FFWB 3HM9A 1HYSA 3NGRA 3VAHA 3MPUB 1CVJA 3IM9A 3BPDA 1K0TA 3P4UB 5IC4B 4IOAQ 3G6ES 4P7TA 4QYZK 4PG4A 4DL0C 4ZLNA 1T3NA 3SCKE 1L3SA 1BQMA 3T1HJ 4AQYF 1FCAA 2MLZA 3A12A 3PG9A 3SV3A 2DIUA 4J37A 3UDVA 4O4RA 1KFSA 2XI3A 4QR1A 1RHJB 1E6VA 2GHWA 3VVTA 1S6QA 1VBYA 1BLUA 2E5JA 2R2RA 1L3UA 2AYMA 3LGHA 1Y11A 2M5YA 5THWA 3ENQA 2BJ3A 1YX2A 2YX4A 3BSAA 4MH8A 4RNFA 5FLXY 2HWHA 4HI1A 3MM5B 4L6V3 1Y10A 4B17A 4CLZA 4CLKA 1RLCL 3KK1B 3H8YA 2Y1RI 4WIQA 5AXNA 3RB6A 2LKZA 2ROGA 5E41A 1VQ8S 2ZH6A 4OYMA 1N34F 3ZTRA 3UR0A 1TU0B 4I69A 1M5HA 4LF5J 3M7VA 1S79A 2DTJA 3FNNA 1RACB 2DNZA 3BDEA 4KYZA 1WWHA 4C11A 7FDRA 3MURP 1PC4A 1FVSA 3UQSA 3NOCA 3OR1A 2ZZNA 3M6UA 2LXIA 2VFTA 3Q2SC 5A2QY 4ZPTR 5DG9A 2DGTA 4NEYA 2F7VA 4F26A 3IFEA 3G8TA 1YKWA 2YNFB 5BYRA 1BXNA 5LSRA 2HNYB 2MTLA 3DRPB 4A8YA 4DF8A 1T9UA 4DJBA 1VRUB 3GP9A 2L9DA 1TUWA 1VBZA 2OAUA 2OEJA 4F67A 2WSEC 4KGXB 1LQ9A 4BCAA 1YVFA 3QMQA 3V6KA 2YWFA 1RHKB 3DLKA 5HATA 4NI2A 1CS4A 3EVWA 2BBEA 3MR6A 5RUBA 1F9EB 1QSSA 3M8PB 2HFOA 3KUEA 2SXLA 4ED3A 3V81A 1REGX 2CQDA 1SL0A 1YHQS 2CPIA 4LFCJ 4U9RA 4BWJA 3TJ9A 2GC8A 3CEDA 4I2QB 3V5RA 3V4IB 1I94F 1FX2A 3U1NA 4K4WA 2EI5A 1XK8A 2VG7A 1XMBA 2RH3A 3QRRA 1UA1A 4WP9A 3RW7A 3W66A 3QJPA 1TV6B 1EQMA 5CYMB 1CULA 2YKQA 5FDLA 1U2RA 4U7UK 3OFFA 1RBLA 4DUZJ 1U6FA 1S9FA 4JI2F 1VRQC 2R2SA 4JI0F 2CXEA 3TUIC 1KHVA 3UDCA 1N36F 3PKMA 2AP6A 4LRBA 3GMGA 4ECSA 2IC3B 3CCJS 4QJVA 2ADCA 4HLBA 1EP4A 2MB0B 4YR2A 2O67A 2DGXA 4C98A 4C8ZA 1JKHB 2VBXA 1NSQA 1RCOB 3BQ2A 2EFVA 4L75A 4A47A 2N7YA 1C0TB 5FJ4A 3Q8VA 2M3DA 5KFHA 3IWLA 3ONQA 4JI1F 1IR1A 3CCLS 5KFUA 2PI5A 4YB7A 4ZLJA 3BO3A 5CQGA 2DNOA 2JSXA 4WFZA 5A8RA 1X4CA 3WIUA 4ED0A 4RW6B 4PYDA 4ZIWA 5AE3A 2KHCA 1S6OA 3DRRB 1TKTA 2NYHA 5AJ3J 4V19J 3HFVA 3EX7B 4B02A 3CC4S 1BWEA 5KFFA 1VQKS 2DRDA 5ETVA 1AFIA 2ZBPA 2RIJA 1C4CA 2GVDB 5KAKA 5EWGA 1XMOJ 4C0BA 2B9EA 4K4XA 2QLXA 5L8RC 1JLAB 1H3DA 2H65B 2CKWA 4NLQA 4WZMA 2YPZA 1JLEA 4WP8A 2RILA 3ZTQA 4OZNA 1U8WA 4CH7A 4N8OA 3ETOA 3SFGA 1WC5A 5CD4H 1JXLA 4YR3A 2K8GA 3V4MA 4DV1F 4UY85 1DQAA 2XSJA 4J91A 5D0GA 3TA0A 2MGZA 1B70B 1JB0C 1JJHA 2WVCA 4M5LA 4NYPA 1Q8IA 1U24A 2F8HA 3GG1A 4QIVA 2R7WA 1Q7YT 4JI1J 4M95A 4ETXA 2W2PP 3UNYA 1NO8A 1N32F 2LEPA 2VPZB 4DV7J 1N5SA 3S1TA 2WCXA 1X5SA 1D3WA 4ZP6A 2IVFB 4EWTA 3MAQA 1KONA 3V2UC 3CPWR 2Y9HA 1R27B 1ZZNA 3I0RB 1FTRA 3G96A 4Y28C 1OY6A 4ZVHA 4QOTA 1URNA 1VYAA 2DNKA 3W8PA 2JLEA 2ZVSA 2CPDA 3R7BB 4KO0B 4ELVA 4QWDA 4WKYA 2GAHC 2VPXB 4KBIA 4WE1B 4WE1A 3EDRB 3IGVA 2NXUA 3MPYA 1FHTA 3MM9A 3IP0A 1NKCA 4MYUA 5GAEU 4X66J 4OI3A 4DX6A 3J7YU 4KGMA 2QA2A 3NNCA 1DTTA 4WKRA 4ANDA 4F0MA 3MAAB 3MR2A 1TR0A 3UN3A 2VHGA 2XLJA 4IDKB 2Z56B 3R5CA 1LW2B 1D0EA 2UUCJ 2WVDA 4WTYA 1H2VZ 1SVDA 3CDAA 3VALA 2OHDA 1XR5A 3PRVA 3LA0A 2DITA 2HZVA 2HQDA 2PSZA 1Q53A 1U0SA 3PEHA 3MECB 2JH3A 1CC8A 2B7BB 3TUPA 1FFSB 4NMLA 3BEGB 1Q4RA 2AZ1A 3QGHA 3GB0A 1H2UX 2VG7B 1AXQA 1WTFA 2V68A 4MK7A 4TNOA 2XS5A 1XN9A 4DR7J 3K5LA 4F2SA 1TMJA 1HR0J 4HYKA 2E1RA 2B51A 2QEXS 3ICLA 4GKKJ 1ZM3A 4WPAA 4DQRA 2W4DA 1WOSA 2XMTA 3PKYA 4LBPA 3ITHA 5KG4A 1HWKA 1KDNA 1SIWB 4JOUA 2EFPA 5EWFA 3RRHA 1OWXA 4USKA 2QN6B 1YI2S 4E8UA 3H4DA 2DCLA 3B6BA 2NXNA 5K8NA 1V3ZA 2NXEA 4DV6F 1VS3A 3I4PA 2I8EA 1NDPA 3DLKB 2JDJA 2QSWA 3OFEA 5D4OA 3KJQB 4DHVA 4F4XA 4A8WA 1UVLA 4LF7J 1LW0B 4MKAA 4URSA 3P45B 1I94J 2V63A 1V3SA 4CIOA 3KMSA 2ZJPQ 3PW0A 4PWDB 2DYAA 2KFNA 3M1VA 3BBCA 1DLOA 4ZPAA 2A1BA 5HK4A 1NHUA 2A2DA 4E98A 4F4YA 3DXBA 5H9EK 5D3GA 2I5JA 2XZDB 4FBTA 1RWMB 1KNZA 1NJIT 2NREA 2V50A 1DTQA 5EN1A 1Y3JA 2FJBB 5C24B 5KFGA 3BR9A 4ZCIA 3VQTA 1N33F 2QZ8A 2DGQA 1L3VA 1BQMB 1K0VA 1X5PA 4EK2A 2XCAA 1N36J 4DQPA 4JI0J 1NLKL 2AEMA 3E51A 1IKVA 3ET6A 4DSIA 4OI6A 1JNZB 1HFEL 1O6XA 3NWGA 5LXYA 1JMTA 1TKZB 4TU8A 1SH2A 2D69A 5J1PA 3Q8UA 4X65J 2VOPA 2ZUGA 3IS9B 5DZ6A 4ZK7M 2CQCA 1YJNS 4WFAQ 1AW0A 4CLSA 2VBYA 3I4HX 1G2EA 1Q95G 2LMIA 1FRIA 3R5BA 4DR3J 3GYNA 1JLQA 1DHMA 3D2WA 4WYWA 1HNZJ 2ACMA 2P2CB 3AD7C 1WKKA 4O4GA 1QJHA 2V8GA 1B0VA 4RPFA 4YB1P 1S77D 4X4NA 1GX5A 2PT0A 3W5XA 4YP3A 3Q24A 3NGUA 2YH1A 5IM0A 2UUAJ 3QT6A 4J9QA 1U6ZA 1GK8A 2H4YB 2V4JB 3NCPA 1DQ9A 2KM8C 4I2QA 5DDQC 4ZITA 1TQLA 4NRUA 1WEXA 2PD1A 1FEEA 2FY8A 3JSMA 2MJNA
chains in the Genus database with same CATH topology
2UU9J 2MQ8A 4HHUA 3J81U 4YY3J 2HHHJ 4B3MJ 3R2CJ 4LFAJ 4LF5J 4KYZA 4DR4J 3JAMU 4RJVA 2F4VJ 2KVQE 3D3CJ 4PWWA 4B3SJ 4V1Ak 4NEYA 3J80U 1XNQJ 4GKJJ 2MTLA 4X66J 4LF8J 4DV1J 4DR1J 2E5LJ 5LM7E 2UXBJ 2UUCJ 2ZM6J 3OTOJ 3J7AN 4DV4J 2KL8A 4JI8J 4X62J 4JI6J 4B3RJ 4YHHJ 1IBMJ 4LFCJ 3R2DJ 1FJGJ 1J5EJ 4DR7J 4KY3A 1HR0J 1XMQJ 4DR2J 4OX9J 4GKKJ 4DR6J 4B3TJ 4X64J 1HNXJ 4DUZJ 3IMQJ 4LF9J 4JV5J 5FLXU 5A2QU 4JI5J 1HNWJ 2UXDJ 4LF7J 1I94J 3D3BJ 4DV5J 5LMUJ 3T1YJ 2VQFJ 5LMNJ 5IT9U 4KHPJ 1N34J 1N32J 2UXCJ 2MEWA 1IBKJ 4DV3J 2VQEJ 4DV6J 1N36J 4JI0J 4NXNJ 4LF6J 4DUYJ 5AJ3J 5IWAJ 4X65J 2UUBJ 4DR3J 1XMOJ 1HNZJ 3W1YC 4LF4J 4NXMJ 1IBLJ 5BR8J 4AQYJ 4JI4J 4NEZA 3T1HJ 1XNRJ 4K0KJ 4DR5J 2UUAJ 4JI7J 4JI3J 4JI2J 4JYAJ 4DV0J 4JI1J 1N33J 4DV2J 4LFBJ 4DV7J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UU9 J;  2MQ8 A;  4HHU A;  3J81 U;  4YY3 J;  2HHH J;  4B3M J;  3R2C J;  4LFA J;  4LF5 J;  4KYZ A;  4DR4 J;  3JAM U;  4RJV A;  2F4V J;  2KVQ E;  3D3C J;  4PWW A;  4B3S J;  4V1A k;  4NEY A;  3J80 U;  1XNQ J;  4GKJ J;  2MTL A;  4X66 J;  4LF8 J;  4DV1 J;  4DR1 J;  2E5L J;  5LM7 E;  2UXB J;  2UUC J;  2ZM6 J;  3OTO J;  3J7A N;  4DV4 J;  2KL8 A;  4JI8 J;  4X62 J;  4JI6 J;  4B3R J;  4YHH J;  1IBM J;  4LFC J;  3R2D J;  1FJG J;  1J5E J;  4DR7 J;  4KY3 A;  1HR0 J;  1XMQ J;  4DR2 J;  4OX9 J;  4GKK J;  4DR6 J;  4B3T J;  4X64 J;  1HNX J;  4DUZ J;  3IMQ J;  4LF9 J;  4JV5 J;  5FLX U;  5A2Q U;  4JI5 J;  1HNW J;  2UXD J;  4LF7 J;  1I94 J;  3D3B J;  4DV5 J;  5LMU J;  3T1Y J;  2VQF J;  5LMN J;  5IT9 U;  4KHP J;  1N34 J;  1N32 J;  2UXC J;  2MEW A;  1IBK J;  4DV3 J;  2VQE J;  4DV6 J;  1N36 J;  4JI0 J;  4NXN J;  4LF6 J;  4DUY J;  5AJ3 J;  5IWA J;  4X65 J;  2UUB J;  4DR3 J;  1XMO J;  1HNZ J;  3W1Y C;  4LF4 J;  4NXM J;  1IBL J;  5BR8 J;  4AQY J;  4JI4 J;  4NEZ A;  3T1H J;  1XNR J;  4K0K J;  4DR5 J;  2UUA J;  4JI7 J;  4JI3 J;  4JI2 J;  4JYA J;  4DV0 J;  4JI1 J;  1N33 J;  4DV2 J;  4LFB J;  4DV7 J; 
#chains in the Genus database with same CATH topology
 3IWX A;  4ID5 A;  3EXC X;  2K7J A;  3MPV A;  4RUB A;  2R4F A;  1HI0 P;  2BAN A;  1GMW D;  2ROP A;  2XBP A;  2KRR A;  2Z58 B;  4LBH A;  1N4L A;  4OZ2 A;  2IA6 A;  1ULR A;  4MIB A;  4PXE A;  2R7X A;  4LMZ A;  1C4A A;  1VRT A;  5SZT A;  2J76 E;  2N82 B;  2W25 A;  2NUH A;  1O5J A;  1KQK A;  3MR5 A;  2GIR A;  3TQ1 A;  3R2C J;  1LFP A;  3M2V A;  2R8J A;  4F4W A;  1ZPV A;  4EMD A;  3FFI A;  2YPY A;  3JAM U;  2Z2Y B;  4ECT A;  4LRC A;  1TZ0 A;  3W2W A;  4DQS A;  1HD1 A;  3HHL D;  4ECZ A;  1U1K A;  1MWY A;  3AAW B;  3VGT A;  1PBA A;  1NK4 A;  1G3O A;  4KPY A;  1FE4 A;  2MHN A;  3KK3 B;  3MUT P;  3V4I A;  2B0G A;  5T7L B;  3F44 A;  2KJV A;  5BJR A;  3BBB A;  3IN5 A;  3UDE A;  1FJC A;  4DR1 J;  1IKY B;  1P27 B;  1I5O B;  2IAJ A;  3EZU A;  3IBF B;  2YWW A;  4KH0 B;  1KQF B;  2E9R X;  2Y8W A;  1X9W A;  2HK3 A;  1QVF R;  2IYG A;  1ZM9 A;  3OXF A;  3RZA A;  5E3R A;  3OTO J;  4DV4 J;  2J9D E;  3LQV A;  3J7A N;  3RAQ A;  3B82 A;  2R8H A;  3BQ1 A;  4ICL A;  1RTJ B;  1F9H A;  5LSL A;  2HQC A;  1S1V A;  1XQI A;  2FUG 9;  4F4A A;  1NDL A;  3KLH B;  4DLE A;  4W90 B;  1PBU A;  2BKN A;  2CQ1 A;  5K8O A;  1YBA A;  5KFN A;  5IT0 A;  4TU9 A;  5LL6 d;  1VJQ A;  3BV8 A;  4WU3 A;  4ED6 A;  4NLG A;  3HPO A;  1FJG J;  4O44 A;  3CMA S;  4J9K A;  2JZ5 A;  4WFN Q;  2HWI A;  2EFG A;  2JVO A;  3LPE A;  2CA9 A;  3MCM A;  4HAC B;  1N6Q B;  4DR2 J;  1DLO B;  4EGL A;  5F8L A;  5L1I A;  2BDP A;  4OX9 J;  1VLO A;  4IG0 B;  2EXU A;  2LXF A;  4DV7 F;  1J5O A;  2UUC F;  4MK9 A;  5J2M A;  3CTR A;  4CCH A;  4OZ3 A;  4M5I A;  3W65 A;  4DV0 F;  4DFP A;  2OPP B;  4USI A;  4NX9 A;  5AXM A;  5GAH U;  3GII A;  4CDI A;  3MFH A;  3MEK A;  1RT5 A;  4DF4 A;  4CLL A;  4IFV A;  3VHQ A;  5HRO B;  4Q2L A;  1RWK B;  1NEE A;  4J9V A;  4DPX A;  1RWW B;  5D78 A;  1X31 C;  2VJU A;  4OYB A;  1HW8 A;  1OO0 B;  1LFW A;  1S6U A;  2OMO A;  2BW7 A;  4M5M A;  1O51 A;  3PJ9 A;  4OZ1 A;  4R5P B;  2XQC A;  1RT6 A;  1SJ1 A;  1U25 A;  1J2V A;  2WB4 A;  1WC1 A;  4TQS A;  2MKS A;  2BJ8 A;  4ZOS A;  1U2F A;  1VIX A;  4WFB Q;  2PII A;  4FP9 A;  2A3J A;  5ADZ A;  3V6J A;  2HW3 A;  4OX9 F;  1V5I B;  3RBE A;  4NXN J;  2XWX A;  1U0H B;  2FJD B;  1BGX T;  4UF4 A;  3UE2 A;  4DUT A;  3L3C A;  1NJX A;  2AD9 A;  2F4F A;  2ZC4 A;  4NLX A;  1DAR A;  1WHX A;  2IJN A;  2B3T B;  2BE9 B;  1IKW A;  3PZP A;  4DZD A;  2U1A A;  5I3Q A;  1U4B A;  1R8B A;  1JLF A;  2HQI A;  3OR2 B;  2OPP A;  1CJT A;  1HIY A;  4OI1 A;  1UWB A;  5CCM A;  4UQT A;  3PYF A;  2KH9 A;  3HK2 A;  3D6H B;  4EBE A;  2R7U A;  2CJQ A;  2WOM B;  3D5M A;  2BAB A;  1I3O B;  3Q89 A;  3QYY A;  3U1L A;  4OX8 A;  2RQC A;  2J6S A;  5KFC A;  1KRP A;  2PEB A;  3HHL A;  4XAK A;  4ED4 A;  1XNR J;  2VOD A;  4ALZ A;  3QWU A;  3LP1 A;  1FRL A;  2EK6 A;  1WEY A;  5KFV A;  5J2Q A;  1DTQ B;  5HLF B;  3A3P B;  3DU5 A;  1SQF A;  5E3C A;  3PR5 B;  2FHK A;  2OPS B;  2FVS A;  4OZJ A;  1QTN B;  3IG1 B;  1IKX B;  3R27 A;  1WUU A;  5KG6 A;  2HBZ B;  4CO3 A;  2VBW A;  3R1L A;  5KG5 A;  1R0A A;  4BS2 A;  3DRX A;  3M30 A;  3MF5 A;  4K5R A;  3QGI A;  1KKH A;  4ED8 A;  1FK9 B;  4B9U A;  2O1P A;  2ALZ A;  2QIF A;  2H54 B;  4JB8 B;  2FDN A;  1Q82 T;  1X4D A;  4ELU A;  3ILO A;  4OHW A;  2FGC A;  4U7U D;  4NZ6 A;  5GAG U;  1EET B;  1SXL A;  2DKO B;  3DDN A;  3M6W A;  1P9Y A;  5IQQ A;  2JC0 A;  4JP8 A;  3ZFV A;  4CYU B;  3GIK A;  5H9F K;  1VHF A;  1RAB B;  3BSO A;  1AYE A;  1UFL A;  4RJV A;  4L76 A;  3BGL A;  4RKU C;  5CHC B;  4CM0 A;  3FZB A;  3E3X A;  3FQK A;  4ZP8 A;  4PWW A;  2CPZ A;  1RJJ A;  3UWT A;  1T9Y A;  3SEO A;  3OL6 A;  1VQ4 S;  2KZZ A;  3HSJ A;  4R25 A;  3RUB L;  1JLA A;  4DSJ A;  3D0H E;  1SB6 A;  4H54 A;  4LF1 A;  1YIT S;  2H51 B;  3W2W B;  2GGP B;  3L7U A;  2FC8 A;  4ECR A;  1AA1 B;  3D7S B;  4B3O B;  2MQO A;  3NNA A;  2RVJ A;  4LF6 F;  4ZVO B;  2XB2 D;  3EZ5 A;  1JXE A;  4C9D A;  2RHQ B;  3PJW A;  2AV5 A;  1RWP B;  3QO9 A;  1M5V C;  2PE8 A;  3R7N B;  3N6N A;  2F40 A;  2DNM A;  4RW6 A;  3UN2 A;  2MZ1 A;  3CCM S;  4DSF A;  2VL1 A;  3N6L A;  3H5Y A;  1D9D A;  2DNN A;  2ROE A;  4F50 A;  1X5T A;  2J6T A;  2HHP A;  1ZS6 A;  1S5Z A;  3N0V A;  3BYR A;  4YS2 A;  1HNW F;  3I5C A;  2QMW A;  2LU1 A;  3JYT B;  2BZ2 A;  1QAJ A;  1QTM A;  3B8H A;  1R3N A;  4DL2 A;  1IBL F;  1S97 A;  2XHW A;  2QC3 A;  2C2M B;  2DIV A;  4HDH A;  1KEK A;  3GJS B;  1EKR A;  3FSX A;  2YWK A;  4O3N A;  2V6A A;  4CLP A;  8AT1 B;  1FE0 A;  1XMQ J;  3LH2 S;  2HAF A;  2DIS A;  1EJ7 L;  2GV1 A;  3FGV A;  3SCJ E;  3MEC A;  3VWS A;  4U8Y A;  5KFB A;  4X64 J;  5K8P A;  2GNK A;  4NA1 A;  5JUM A;  1ZPW X;  2VKR A;  4J9P A;  1NND A;  1M5K C;  5BXI A;  4JV2 A;  3V6D A;  1YJ7 A;  1FKP B;  1HHS A;  4NAS A;  1FVQ A;  5A6W A;  2B4V A;  1CBK A;  3BS9 A;  1LW2 A;  1N0U A;  3RW6 A;  1NU4 A;  2WW8 A;  2BAN B;  1XTZ A;  2RU9 A;  4ZJQ A;  1CUL B;  4RUA A;  2MQQ A;  2C3M A;  2PN6 A;  2I0X A;  4IR9 A;  2QYC A;  4Y0F A;  1YBU A;  3AB2 B;  4N56 A;  4M8L A;  4OQJ A;  5DJB A;  4NLV A;  2KM8 B;  1TL1 B;  2UVR A;  2FIU A;  4EFA C;  4OZ5 A;  1GFW B;  2ZOG A;  3KHG A;  1RKJ A;  1Z2L A;  3MEG B;  4USU A;  2VBZ A;  2OPQ A;  3EXY A;  1X9M A;  2ZBQ A;  4WF9 Q;  4RZR A;  2LQ8 A;  4GC7 A;  4WFX A;  1WDD A;  3VF0 B;  4QIE A;  1RB0 A;  4TXS A;  4A8M P;  3C15 B;  1HWU A;  3GR1 A;  1X4G A;  2XYH B;  1DUR A;  1KLM B;  2GAG C;  2XTJ P;  3AOB A;  1PJ5 A;  3HLU A;  3LP0 A;  3TW0 A;  1YK9 A;  1WOR A;  3MAA A;  2OJ3 A;  2VPY B;  1QD1 A;  1AFJ A;  1DTT B;  1N5V A;  3KFW X;  2ASY A;  3A1Y G;  5KFP A;  5M2R A;  4DPT A;  1N5Y A;  3AJD A;  1W25 A;  3NRB A;  4DV4 F;  4ZVR B;  4CO0 A;  5KT2 A;  1BMQ B;  2ASJ A;  5L46 A;  3TAN A;  3C19 A;  1MRO A;  4DQQ A;  3QNW B;  5HI7 A;  1UJ4 A;  4G1P A;  3NS5 A;  3L7O A;  1C1C B;  1DBD A;  4QYR A;  2KT3 A;  5KFW A;  4FXD A;  4JYA J;  3C46 A;  1QSY A;  5L1L A;  2Y1I A;  2R8G A;  4DV2 J;  1WI8 A;  5E3A A;  4C0H A;  3N5F A;  4FF2 A;  4GKK F;  3DGP B;  4G1I A;  4R8U B;  3C6U B;  3G2X A;  5I3P A;  5KFO A;  2J9D A;  2XY6 A;  4KGV B;  3NG8 A;  3DM2 B;  3J81 U;  2XCP A;  1HLW A;  2HND B;  1YGY A;  2HHH J;  3FQL A;  2IM3 A;  4BC9 A;  1MNE A;  3VAM A;  2VDH A;  5K9F A;  2UXC F;  1GX6 A;  2KJW A;  2R2T A;  1D9F A;  2H48 B;  4B3M J;  1U02 A;  4C97 A;  1UCN A;  2ZE2 A;  2B4O A;  2VPW B;  3J7Z T;  3BKF A;  1IJF B;  1H7X A;  2G9O A;  4J5O A;  3S01 A;  5KFK A;  3DLB A;  1U6B A;  1VIS A;  2K1R B;  2RJZ A;  3K0J A;  1RT3 A;  2O01 C;  3Q8P B;  5LJ5 Y;  4DSK A;  4QW9 A;  1M0S A;  3JQK A;  3ZTO A;  2XGP A;  3VAF A;  3OFH A;  4PG5 A;  2LLZ A;  1UPM B;  4RNH A;  1GXT A;  5DG8 A;  2BQR A;  4GKJ J;  1DFD A;  1RLD A;  2D41 A;  2D3O R;  3B4D A;  2VC1 A;  2ACY A;  4PWU A;  1S0M A;  5F0W A;  3OUY B;  2BXJ A;  1S99 A;  2RML A;  4Y2M A;  4DFK A;  1NKE A;  1DZ5 A;  2B6A B;  1NCL A;  2YNH A;  4HHJ A;  1FTC A;  1VQY A;  4BWM A;  4U96 A;  3MMC A;  3NOG A;  1W2B R;  3PIP Q;  4OYW A;  5EHH A;  3UPF A;  3IRW P;  1H0H B;  2Z2M A;  3GJT B;  1VR6 A;  3THV A;  4O3S A;  5JXS A;  2QA4 G;  1PSD A;  3SZ2 A;  4YQW A;  5DQG A;  1S7H A;  1YJR A;  4J9U E;  1RTD B;  1R7I A;  3T19 A;  3R2D J;  3MPW A;  1NB2 A;  2DBB A;  1S9G B;  3MOZ A;  1YBT A;  3GJQ B;  3Q2T C;  3DLE A;  2M4M A;  5E0O A;  4Y2C A;  3WBZ A;  4DR1 F;  1YQH A;  4ZCM A;  3MEE B;  4WFY A;  1VK8 A;  3H40 A;  3T5H A;  4CT9 A;  4FPI A;  2VKZ G;  2WZ1 A;  3ILJ A;  5A8K B;  4UT4 A;  4FYX B;  1LWE A;  2QTW A;  2XMV A;  1T9V A;  1HQ2 A;  3BGU A;  1VLY A;  2UXB F;  3VAK A;  2B9W A;  5CCL A;  3CXC R;  1KLN A;  4WCE Q;  4FKY A;  2W2N P;  3W8G A;  2KYZ A;  5GME A;  3HHE A;  1YDL A;  1QY7 A;  2IY5 B;  1UFK A;  3UFC X;  4DCO B;  1RU1 A;  4CH1 A;  1VJW A;  3BDP A;  3KMQ A;  2GHP A;  1HNV B;  4C8O A;  2DNG A;  1TV6 A;  1KLM A;  2J0W A;  3QT5 A;  5D0H A;  5DM6 Q;  1OSC A;  4KE5 A;  4DBQ A;  1RT2 A;  1K8A T;  1VQ7 S;  3QJJ A;  1S1W B;  2I38 A;  2Z30 B;  1KOO A;  3TA2 A;  5IT4 A;  1QSL A;  5ETP A;  2V2V A;  3CJ4 A;  3FDS A;  1X8D A;  1NME B;  2P5V A;  4GMK A;  5AXL A;  3TUZ C;  5DLG A;  4DUY F;  4DDF A;  5A6P A;  3HFK A;  4RBU A;  3H2U B;  2D74 B;  1O8B A;  1R89 A;  4B9L A;  1RAO A;  4PG8 A;  1VQP S;  3TZX A;  1H7W A;  4H4K C;  4KR0 B;  3KLE A;  1IBK F;  4PQU A;  1KFD A;  4K4V A;  1U49 A;  3CWJ A;  3PDN A;  3HVT A;  3BPS P;  4IFY A;  1F3V A;  2AGO A;  4JI4 J;  2N3O A;  1YZ6 A;  2Q6C A;  4UOF A;  1TEL A;  4LR9 A;  5C2C A;  4B3O A;  2DEI A;  4OYP A;  4QWB A;  4KHP F;  4K59 A;  3FMW A;  3O44 A;  1IBL J;  2KFY A;  1ARO P;  1VIO A;  1YRU A;  1RA7 A;  1RWO B;  4BDP A;  1O0P A;  1NUE A;  1XER A;  2DO4 A;  3KDN A;  3MED A;  2IM2 A;  3CGI A;  4ZPW R;  1CJK A;  2HGL A;  3KJN B;  4X4V A;  3KYL A;  4JI7 J;  4L74 A;  1VQ5 S;  1S10 A;  1H74 A;  2RUS A;  5ETK A;  3UNG C;  4O3P A;  1U09 A;  4C48 A;  1NB7 A;  2IPO B;  2Y1L B;  3EUN A;  2XLK A;  3DLE B;  4N47 A;  4ZS6 A;  7FD1 A;  3T41 A;  4KRW A;  1VFJ A;  3Q23 A;  5J2P A;  1UVJ A;  2R7T A;  5HBM A;  1X7V A;  2YKN B;  3H98 A;  1ZZF A;  1ZBT A;  1Y3K A;  2BVZ A;  2E5H A;  1F60 B;  2AJ1 A;  2HZA A;  3JTO A;  3M8Z A;  4IQM A;  2QA1 A;  3VZH A;  3G8S A;  2FVQ A;  4AL5 A;  2IMW P;  3FJ2 A;  2X1F A;  1K47 A;  3W5Z A;  4YY3 J;  5HO4 A;  3MMC B;  3C8Y A;  3D68 A;  1DAX A;  2XC9 A;  1NRK A;  1U0H A;  4JI6 F;  3P6Y C;  5KG3 A;  2J6U A;  4K4S A;  3OV7 A;  4FBU A;  3C6T A;  1JJC B;  3KG4 A;  4JI5 F;  2RRA A;  1P1L A;  2PMH A;  4EI2 A;  1FKO A;  2EG2 A;  4J7C A;  4M5G A;  4P7V A;  3RB4 A;  2VDI A;  1VRU A;  4I2P A;  2LA4 A;  3HHK A;  2C2D A;  2KXH A;  3HHL B;  4FVC A;  1G7C B;  1IUJ A;  4P71 A;  1HL6 A;  1QE1 A;  2E1P A;  3GYX B;  3HO1 A;  4O4G B;  4DZ6 A;  1HBO A;  3HKZ D;  4ANE A;  5A8W B;  1X4A A;  2V2Q A;  4L72 B;  4Z7Y A;  3SV4 A;  2ZBC A;  2CDR B;  2E7X A;  5F8H A;  1FFG B;  3PW5 A;  5IS2 A;  4Q43 A;  4TKT A;  2XMJ A;  3JS9 A;  1R0B G;  4OZ0 A;  4ECX A;  3OJS A;  1U7L A;  3DKD A;  5B0D A;  3CUL A;  4RWW A;  1WC6 A;  3E01 A;  3DI6 B;  1F2H A;  3HX9 A;  5KFE A;  1GT8 A;  1RHR B;  1R31 A;  2JHE A;  4PYA A;  3CJ3 A;  1UPP A;  1VCT A;  3ZTS A;  4ANC A;  1IBM F;  5KFL A;  4PUO B;  4ILL A;  4K50 A;  5DLF A;  2M9K A;  1HR0 F;  3NGS A;  5LMU F;  3MMB A;  4PR6 A;  1CSJ A;  5EX0 A;  3M30 B;  1U2C A;  2BKO A;  1QDU B;  3KUG A;  4HVZ A;  4IYQ A;  4GO7 X;  3Q8Y A;  2AGQ A;  4JV1 A;  2JJ4 D;  2W8L A;  4FYV B;  3R8Y A;  5ETO A;  2ZD1 A;  2PMZ D;  3H5X A;  2LU2 A;  2CAD A;  2C3O A;  1HYS B;  1NK7 A;  3PRD A;  2W4P A;  2X7I A;  3RBD A;  5J1E B;  1CJV A;  4A46 A;  3CCR S;  3G4S S;  2IVM A;  1FKA F;  2HS0 A;  2KU7 A;  1MWZ A;  1VQN S;  4NLT A;  4PEO A;  4DR6 F;  1IJE B;  3G8Q A;  3QAT A;  1UEK A;  2BM0 A;  1B3T A;  4K0K F;  1T94 A;  1Q81 T;  4C6A A;  1OPI A;  2UXD J;  1IKY A;  1FK9 A;  2IAJ B;  1IKW B;  4WXO A;  2CJ9 A;  2D3U A;  1WOO A;  3FZ2 A;  4LF2 A;  1RWV B;  5SUH A;  1IR2 A;  2OEK A;  3T1Y J;  1S1T B;  5HVF A;  3D1O A;  2DGO A;  3AXM A;  3H42 A;  4HTJ A;  3KNA A;  2A6O A;  3MDF A;  5LMN J;  4GC6 A;  4RNO A;  5LXR A;  2IRY A;  3MMJ A;  3M4X A;  2YKA A;  1E6V B;  4DL4 A;  2GVZ A;  4I2P B;  2W01 A;  1KTQ A;  3NMA A;  1YJT A;  4DV0 J;  3FRZ A;  4GVB A;  4FN5 A;  2DHG A;  3CCV S;  2YXL A;  2Q43 A;  1RTJ A;  3J80 Y;  3LUY A;  1OPZ A;  1RWX B;  2CJX B;  1Y7P A;  1YZ7 A;  2KRB A;  3A8K A;  3N9U C;  4PQA A;  1FES A;  3I82 A;  4OX6 A;  1YJU A;  3AQP A;  3LAL A;  4DU8 A;  1KVI A;  5CZX A;  4DLG A;  2IRX A;  2HWT A;  4NLR A;  3MPD A;  4OJ1 A;  3UW1 A;  1CQN A;  3HP6 A;  4NCB A;  2BJ7 A;  2VC0 A;  5B0G A;  5F9N A;  2KG1 A;  1NJZ A;  4DS5 A;  3L95 X;  3HKW A;  5HBM B;  1XR6 A;  4PXB A;  5T7L A;  2FLN A;  2JEI A;  3KK3 A;  1KS2 A;  2ZH2 A;  4NLD A;  3Q86 A;  2UV8 G;  4H4O B;  2EC2 A;  4BLG A;  4ZKA A;  2KG0 A;  3K57 A;  1YG0 A;  4I7F B;  2K3I A;  1F1B B;  5DQH A;  4GO5 X;  4ECW A;  4URG A;  3G87 A;  4DCJ B;  4J9L A;  3FCV A;  2BOA A;  3R5G A;  5F9L A;  2Z0G A;  3Q8Q B;  4JI3 J;  2FVR A;  1FF2 A;  3IM8 A;  1NPK A;  2MQN A;  2QMU B;  2WOM A;  2XO7 A;  4OLP A;  4PRF A;  5D0R A;  3S7R A;  3FBF A;  3HVA A;  2V8P A;  2QMX A;  4HT5 A;  4RW9 B;  2R7Q A;  1ZAV A;  1XEZ A;  1SUQ B;  3Q0A A;  4F36 A;  2NXC A;  3DCA A;  4B3T F;  1RXO B;  5KTQ A;  3SMZ A;  1TTH B;  4LF8 F;  3U7J A;  4NL5 A;  4L3N A;  2YKN A;  5EGY A;  3QGP A;  6FD1 A;  3KLE B;  1SJ3 P;  3HMJ G;  2HVD A;  2MQP A;  4IR1 A;  4KTQ A;  4CWB A;  3AFG A;  3QO9 B;  1PAU B;  3NP5 A;  3IBC B;  4IRK A;  4IO9 Q;  2VON A;  3E01 B;  1FJG F;  5J2M B;  2IM0 A;  3PRB A;  1PCA A;  1ZYQ A;  4NXM F;  2OPR B;  1B4S A;  2UVU A;  1SV5 B;  2D9P A;  2YX1 A;  3D6M B;  2F4V J;  1SBR A;  2ZHB A;  1E6Y B;  4B3S F;  1N33 J;  3MD3 A;  2HFV A;  5A8W A;  2V2Z A;  3T9Z A;  3DOL B;  5CYJ A;  1MG7 A;  1UZH A;  4X64 F;  1H6K X;  3VGV A;  4K4Z A;  1UFW A;  1JLQ B;  4TQR A;  2FHO B;  3PR4 A;  4QYZ J;  1N5T A;  3BB5 A;  4AYB D;  2XZT B;  3CT9 A;  1VBX A;  1OMS A;  4QIW D;  1ZTW A;  4KSE B;  1EB0 A;  3PW2 A;  4B9M A;  1WKJ A;  2XZW A;  1HMV A;  4Y00 A;  1TUV A;  2ZM6 J;  5KT6 A;  3RTV A;  3MAH A;  1WTB A;  1VQ9 S;  1HQU B;  3LAN A;  4K2X A;  3GE9 A;  2HPU A;  2FLO A;  3UCU P;  1QAX A;  3KHH A;  5AE1 A;  2BV3 A;  2BR0 A;  1GEH A;  1KTV A;  1LXN A;  3IAM 9;  1N0V C;  3M2R A;  2YQ1 A;  4JI6 J;  4UQG A;  3QPI A;  1SI9 A;  3T3F A;  2M2B A;  3HHD A;  4M1K A;  4NMX A;  3BGO P;  2LDI A;  2LP4 A;  5E2Q A;  1U48 A;  1N56 A;  2V0N A;  4NA2 A;  3G9C A;  2F8E X;  4P2M A;  1KQS R;  1SJQ A;  4K5S A;  4A48 A;  1SJF A;  4LFB F;  4Q45 A;  2WON B;  3W60 A;  4FYD A;  1HNX J;  4DCP B;  3MCS A;  1LW0 A;  1RTD A;  4DFM A;  2C2Z B;  3FCW A;  4HH0 A;  2IDL A;  3H90 A;  2DPI A;  2LXU A;  4ZVU B;  3IRX B;  4PZV A;  3OL7 A;  2WBM A;  2RDD A;  4AXI A;  5HJX A;  2Z2Z A;  1X0P A;  3DI6 A;  4K2J A;  2LCW A;  2CQ4 A;  5JVH Q;  3MD1 A;  4U7C A;  4NCG B;  4RW4 B;  4Y2A A;  3IO1 A;  2BA9 A;  2E9T A;  5KFZ A;  2UVV A;  1CG2 A;  4B08 A;  1TP7 A;  4H4M A;  2AIR B;  3W7B A;  3TZY A;  3DMJ A;  3JAM Y;  5LMU J;  3CJT A;  4J9S A;  1N48 A;  3OVB A;  4ELT A;  2DO0 A;  1APS A;  3PEJ A;  2V4Q A;  1S9G A;  4U67 Q;  4HI2 A;  1Z4U A;  3NAH A;  3K5N A;  2AYB A;  1Q16 B;  1R8H A;  3I31 A;  5DZ7 A;  2VQE J;  3LGN A;  2ZZM A;  2VOO A;  1HBM A;  2IJR A;  3MED B;  1LNQ A;  4EYH B;  4DV6 J;  2HVZ A;  2WW4 A;  2EW9 A;  5G0R B;  2R2U A;  1RT2 B;  3I0R A;  2JEG A;  3GJR B;  4DUY J;  3I0S A;  5CD4 A;  2HVI A;  1LXJ A;  1Q1K A;  5LOQ A;  1EHW A;  5KT4 A;  2JFK A;  2RQM A;  4PWD A;  3QLH A;  1HBN B;  4X4S A;  1YLX A;  4OYX A;  2C42 A;  3C6U A;  3P5T L;  4I1T A;  4GVL A;  5HMW A;  3ZO7 A;  2ADB A;  2C3P A;  4EO6 A;  1TK8 A;  1FDD A;  4AQY J;  4CNZ A;  1SJ4 P;  3QRQ A;  2Q66 A;  1GQE A;  4DV5 F;  4FS2 A;  4M5D B;  3TAQ A;  2CZ9 A;  3HUL A;  2CNO B;  3DRS B;  3RJM B;  3WZ0 A;  2OD4 A;  2WK4 A;  5T41 A;  5HQL A;  3HDS A;  3K5P A;  4DR5 J;  4FDF A;  3OT9 A;  2DY9 A;  2E5L F;  2R9L A;  1W2I A;  1S49 A;  2ZD1 B;  2RHS B;  3MM8 A;  3SIP B;  1F9F A;  4K4T A;  3GIL A;  4IO1 A;  3QBC A;  2EPI A;  3MMA B;  2CWX A;  4W98 A;  2AJF E;  2RF2 A;  2RS2 A;  2CVI A;  2B43 A;  1B7F A;  3UVJ A;  1JK9 B;  4LRD A;  3PO5 A;  1UTA A;  2LQ5 A;  3W3S A;  3AOD A;  1B0T A;  3KLH A;  2BQU A;  4MT1 A;  4NLO A;  1BHN A;  1YJV A;  1PC5 A;  1BWV A;  3A4T A;  3QWP A;  2RD5 C;  4DG1 A;  5I3U B;  3M8Y A;  4RR5 A;  3T1Y F;  5LT5 A;  1BQX A;  1D9A A;  1TUG B;  2VG5 B;  3CMQ A;  3L4B C;  3D67 A;  1HAR A;  2D9O A;  1FD2 A;  2DXE A;  2R7O A;  4IH7 A;  1AB8 A;  4USV A;  1RHM B;  3M6V A;  1OY8 A;  2VQF F;  2BJD A;  3ILL A;  4RBV A;  1LKZ A;  1TVR B;  2KVQ E;  2KN4 A;  3BYP A;  1VK3 A;  2XEX A;  3I55 S;  2CRL A;  1FRH A;  3HXM A;  3R7S B;  2AMC B;  1FX4 A;  1X4H A;  2ILZ A;  2WVE A;  2FGO A;  2E66 A;  3HCX A;  2B8P A;  2CDQ A;  4XDD A;  3NEK A;  2W9A A;  3EYZ A;  3HJV A;  4LF8 J;  1VMB A;  4WJB A;  5DDO C;  1FKO B;  1H98 A;  2RB7 A;  1HQE B;  3D0G E;  3HF5 A;  4XK8 C;  1T95 A;  3CO0 P;  1MSW D;  2W9C A;  2G2Z A;  3M8S A;  2HBR B;  4Q0B A;  4HT7 A;  4X84 A;  2NPI A;  2BAC A;  3J7Z 5;  2Y0B B;  3I0S B;  1UVK A;  2AYG A;  3QIP B;  1GMW A;  2CYY A;  1ELO A;  1N52 B;  3W63 A;  2NZ4 A;  1SQE A;  3M05 A;  3UD5 A;  3IBW A;  4X62 J;  4WII A;  4F0K A;  3OUY A;  4IH6 A;  3WIV A;  5LJ3 Y;  4DL6 A;  2HFS A;  4LRA A;  3M2U A;  2MKH A;  3CJK A;  4ES3 A;  4Z7C A;  1IBM J;  1C0T A;  3OW2 R;  3FC9 A;  3MXH P;  5IV4 A;  2G13 A;  4ZVP B;  2DXD A;  4CI0 B;  4YHH F;  5KFT A;  1OS5 A;  4ZCK A;  3KUH A;  5HSP A;  4O3O A;  2HHH F;  2G2O A;  4QWC A;  1IM4 A;  1VBK A;  3NGK A;  3PHT A;  1NJW A;  3DMJ B;  4TLQ A;  2AF6 A;  2UU9 F;  5JMN A;  5HAO A;  2GO8 A;  3TQE A;  1KD1 T;  3PAC A;  4FYW B;  4KJI A;  4LF9 J;  1ZOT A;  3J7A 1;  1BE4 A;  4N8N A;  2F63 A;  4G65 A;  2ZH5 A;  2HYI B;  4DWI A;  4JI5 J;  2UZA A;  3O6Q A;  1Q5Y A;  1PYS B;  3ISZ A;  4ZDN A;  1W26 A;  2VFU A;  4U6P A;  1Y5N B;  4C3L A;  2B8Q A;  4X62 F;  1TKX B;  1VC6 A;  1X60 A;  3MM9 B;  4IRC A;  3GSI A;  2YNI B;  3ET6 B;  2VUG A;  4J90 A;  1VC5 A;  4FPR A;  4L73 A;  4UUX A;  5L1J A;  3PY8 A;  1V9O A;  1G4C A;  3ENA A;  4DSE A;  3F56 A;  3K7R A;  1SKW A;  2AX0 A;  1TVR A;  1LWF B;  1RHU B;  2FVC A;  4HKQ A;  4OL8 A;  2HLT A;  1IWA A;  3FEZ A;  2V94 A;  4KFB A;  2HGN A;  2WBR A;  1F5B A;  1HKA A;  1RDR A;  2YKO A;  4TYA A;  4Z2X A;  2VJV A;  3DC2 A;  4BBY A;  4MKY A;  2C22 A;  2XMU A;  3H5S A;  3K8W A;  5E7O B;  4B9S A;  4KV8 A;  4EBD A;  1X9S A;  1WHV A;  3D66 A;  3BH7 B;  4J9M A;  1Y00 A;  2GVD A;  4NOH A;  1YSJ A;  5ETN A;  3QGG A;  1M1H A;  1HBU B;  3CJ5 A;  3MM5 A;  3OBI A;  1HBU A;  2UUB J;  2YVS A;  4ITS A;  3QFH A;  3KDO A;  1QUV A;  4NCA A;  4G1Q B;  3RBZ A;  2HHQ A;  1S1X A;  2NSB A;  4AFF A;  1T05 B;  1RI7 A;  2C2E A;  2BUN A;  2FQQ B;  3D28 A;  5KFI A;  4C3K A;  3TEH B;  1RAI B;  2OPS A;  4NA3 A;  2KTQ A;  4CT8 A;  4G6V B;  1U1M A;  4DSL A;  4J9R A;  1V3R A;  4Q2M A;  4K0K J;  2R7V A;  5KFS A;  3PW4 A;  2BMB A;  1WHW A;  2FLL A;  1T03 A;  2NQP A;  1Q7L B;  1WSV A;  3SDE B;  1PJ7 A;  4USW A;  1RBA A;  3ZZU A;  2VQE F;  2BX6 A;  2OKQ A;  3DLJ A;  3NBP B;  4ED7 A;  5F8N A;  5I42 B;  4F4Z A;  3OSN A;  3UCZ P;  2J9C A;  3K2Y A;  3W9I A;  2W4C A;  1IM6 A;  3QAU A;  1G1X A;  1RAD B;  2E44 A;  2KO1 A;  3ENW A;  4DN9 A;  3R1H A;  3OSP A;  1U1P A;  3X1L B;  2W9C B;  3LAK A;  2GX8 A;  3GTY X;  2E29 A;  3H2V E;  2ZFH A;  2AU0 A;  4WZQ A;  2RKI A;  5B0B A;  1R8C A;  1VI7 A;  4DR4 J;  1Q0N A;  1OJ4 A;  3E8O A;  1RAJ A;  2JWN A;  2ZOM A;  2BEF A;  3CJ2 A;  5IT9 Y;  3NCR A;  1H72 C;  1U1O A;  2CIM A;  2HVH A;  1LV5 A;  1UW9 A;  1UA0 A;  2GMJ A;  2WTF A;  3JTP A;  5K8M A;  4GRS A;  2DHS A;  4RU2 A;  3PJX A;  3OVA A;  2XO6 A;  4CYU A;  4C8M A;  4RNN A;  2HVE A;  2JLF A;  2XMM A;  4ATN A;  3M32 A;  3GLJ A;  1K9M T;  3GFH A;  4N7T A;  2BKP A;  1CS4 B;  2Z57 B;  4KAI A;  3VZI A;  3IC1 A;  2PMW A;  2X3G A;  3EIC A;  2DNY A;  2QE5 A;  5I4M A;  2DGW A;  3N5B A;  2HK2 A;  3DN9 A;  1FNM A;  3P5B P;  1FA0 A;  4WTO B;  2D3O 1;  1SC1 B;  3ZZT A;  2PO4 A;  4USJ C;  3IG1 A;  3GIM A;  2DH7 A;  1ZTT A;  2CAJ A;  2V5H G;  3GON A;  2XMA A;  2V8D A;  3A8E A;  3IR5 B;  3TAM B;  1FWP A;  3QQC D;  5AT1 B;  4CLY A;  3DLH A;  1OIA A;  3RR7 A;  3CO9 A;  4PCQ A;  3RYL A;  1F5A A;  2QGF B;  2HFU A;  4B3T J;  2OPR A;  3M2R B;  3SI8 A;  4FYY B;  3CCQ S;  3DRS A;  1PGZ A;  4IG3 B;  1S7I A;  1FNO A;  3D4J A;  1F6T A;  2BRL A;  2CPF A;  1TL5 A;  3A3O B;  4ICL B;  3EVM A;  4KT0 C;  4UW2 A;  4MAK A;  5F8M A;  5KG7 A;  3QZ8 A;  3GQC A;  1EZZ B;  4MTP A;  1X0F A;  1FRJ A;  3MTK A;  2GJF A;  2IBK A;  2CG8 A;  5A0Y A;  4N5S A;  1U26 A;  3KK1 A;  2Q1L A;  4F3Q A;  2RQ4 A;  2MLX A;  5J1E A;  2B9X A;  2KT2 A;  1UMJ A;  2IVY A;  5C5J A;  5KT7 A;  3MOJ B;  4RW8 B;  3THP A;  5ITH A;  3KLI B;  2RU3 A;  3NGD A;  2P6S A;  1XWL A;  1SH3 A;  2ZDO A;  3PFE A;  4MYT A;  1WOP A;  4LF5 F;  4JV5 F;  4LIR A;  2RDJ A;  3W2V B;  1JLC B;  1RT7 B;  2B5J B;  4OHV A;  2GZO A;  2MKK A;  2EWH A;  3GV7 B;  2FYX A;  1IBK J;  3TUJ C;  3RG6 A;  3K89 A;  2JL9 A;  1NDC A;  3ZZR A;  1Z2Z A;  1UET A;  3ISN C;  3PX4 A;  3A8I A;  5CAA A;  1WEL A;  1KBR A;  1L3K A;  2MKC A;  1FI4 A;  3PXG a;  3FMB A;  1RBO B;  3IGN A;  4A8F A;  2GO9 A;  3KHR A;  2MY7 A;  3T5L A;  5DM7 Q;  5EUH A;  4DN0 A;  4I6W A;  4X4P A;  1RTZ A;  4Y3C A;  2E7W A;  3P96 A;  4MKV A;  3UO0 A;  3HSD A;  5KT5 A;  1VGY A;  2CZ4 A;  3R9L A;  2DH8 A;  1FT8 A;  5HP1 A;  1I1G A;  1HPZ A;  2QRR A;  2FJW A;  3IAS 9;  4LFA F;  4CQ1 A;  2G1D A;  2RDI A;  1YRX A;  4OMF G;  2NLW A;  2ZIT A;  4RW9 A;  5CAB A;  1RYR A;  1T8E A;  2MSS A;  2HHV A;  4ZPB A;  4OYO A;  3OTO F;  2J5A A;  3DFE A;  3B54 A;  1FDN A;  3CDE A;  5K5M A;  4JUZ A;  3W9H A;  2I2Y A;  3DNC A;  4LSZ B;  4MFB A;  2K06 A;  4R0E A;  1WSR A;  2VFS A;  4IKA A;  4MFB B;  2FJE B;  4P72 A;  4YB6 A;  5DRK A;  3SXL A;  2ZJR Q;  4ZVF A;  2K2P A;  2NSC A;  3FK4 A;  3LAM A;  5T14 A;  2V4R A;  2N4D A;  1PIL A;  2E1C A;  4ZHR B;  2F9J A;  2KFZ A;  2ZKT A;  2J7W A;  1CJU B;  3G82 A;  3KG0 A;  4N77 A;  3RAM A;  1X4F A;  3EGN A;  3R5J B;  4P6Q A;  5AE2 A;  2VA2 A;  2Q6B A;  2UU9 J;  3IS9 A;  2QFJ A;  1FER A;  2ZVI A;  3MTJ A;  2AT1 B;  3AD9 C;  1YWX A;  2RRN A;  3AOC A;  4RWX A;  1YTY A;  5ETQ A;  4JI4 F;  4DR5 F;  3IRX A;  1ACM B;  3OTE A;  2B7C B;  2KDO A;  2W24 A;  1NJY A;  3H25 A;  2PI4 A;  3BN4 A;  4LFA J;  3HSG A;  1D1U A;  1S72 S;  4JI8 F;  1XR7 A;  2DR8 A;  2OEM A;  2XHC A;  3TVZ A;  5L38 A;  5B09 A;  3D3C J;  3D9B A;  4TU7 A;  1XNQ J;  1S9E B;  4A8O A;  4DPO A;  1HNX F;  1G6B A;  1VDH A;  3OR1 B;  5GMK a;  2FLP A;  2CVE A;  1R6V A;  3CD5 A;  1NH8 A;  2EVZ A;  1V5V A;  2AJ2 A;  1GMV A;  2UUA F;  2EBE A;  2E5L J;  1EET A;  1T9T A;  1TFW A;  4KGK A;  1KQG B;  2XY7 A;  3MCO A;  3QFW A;  3UDL A;  2M8D B;  2CZV C;  3JXO A;  4RU9 A;  4ZJL A;  3MFI A;  5HVH A;  3PX6 A;  5D15 A;  2AKW B;  1CJV B;  3Q22 A;  2DHH A;  4WWS A;  4QU6 A;  4PAA A;  1LWE B;  2X1G A;  5A8K A;  2FHM A;  3UCG A;  4K7Q A;  1NDK A;  3CSK A;  2OTL S;  3QAE A;  4DI6 A;  4F0H A;  3TAM A;  4P2S A;  3W2V A;  5IWA F;  5GAD I;  2HS3 A;  2XYP B;  3DOK A;  1QM9 A;  3EPG A;  4C8K A;  4OYA A;  4NRT A;  1TKX A;  3PV8 A;  4EZ6 A;  3I5B A;  3RAX A;  2PGC A;  4OJ3 A;  2M8H A;  4CLW A;  3DYA B;  1SV5 A;  2N7C A;  4HHH A;  5CYQ A;  3KKF A;  3L09 A;  1XIQ A;  2PA8 D;  4KQZ A;  4LQ9 A;  3OTC A;  3BO4 A;  4F02 A;  4WYL A;  2PFD A;  1PYT A;  2YY3 A;  4ZN1 A;  3K17 A;  5D6G A;  4EBC A;  1HA1 A;  1SPB P;  4YR0 A;  3I9V 9;  2OIH A;  3IMQ J;  3MM7 A;  1LK7 A;  1JLF B;  3GIR A;  2K7K A;  2K3K A;  3GFZ A;  3M32 B;  5AXK A;  5A2Q U;  3PHE A;  3UD3 P;  2XWY A;  3QT7 A;  2AGP A;  1JQG A;  2C1E B;  2R8K A;  2MST A;  3CC2 S;  1JX4 A;  4QZV B;  4DS4 A;  1I6J A;  3LTO A;  3TVY A;  2YKM A;  5DET A;  4I6Y A;  2XYG B;  3IR7 B;  1MMN A;  3J81 j;  1P9Q C;  5KFX A;  4HL9 A;  4KHP J;  1JWW A;  3CB4 A;  3FRY A;  4P2F A;  1R8P A;  3WHI A;  2G4B A;  4H4K A;  3JSR A;  3MUM P;  2A6M A;  4XTT A;  2YWE A;  1U1N A;  3C6T B;  2HQG A;  4KH1 B;  1K73 T;  1JNR B;  3GG0 A;  3FSI A;  5DG7 A;  4KPC A;  1NXI A;  3TJA A;  5ETL A;  3EZO A;  2NR0 A;  1HQE A;  3KHL A;  4IFV B;  1LEO A;  2WHO A;  2O5D A;  4PG7 A;  4QPX A;  5D77 A;  5F3Z A;  1UVI A;  2P8I A;  4Y6I A;  3OVS A;  4ER8 A;  1VQM S;  4X4U A;  2E5I A;  2Y1J A;  5B7W A;  3LP2 B;  3MUV P;  2QG9 B;  4NXM J;  2XUL A;  4KV8 B;  4PAB A;  4I68 A;  3C16 B;  1JIH A;  2UUB F;  3DRY A;  1JJ4 A;  1WHY A;  2P9E A;  4RO0 A;  2FD2 A;  4TLR A;  3T6B A;  2K1R A;  3TNV A;  3RRK A;  2PEH A;  5C24 A;  2V9W A;  1EQ0 A;  3HT0 A;  4RW7 A;  3D54 A;  1NHK L;  1MLA A;  3JSY A;  1D8Y A;  2NS1 B;  4ZVT B;  1S57 A;  1S1T A;  4OIX A;  1DQ8 A;  2JRS A;  1REV A;  1H73 A;  2GCF A;  1Y5L B;  2CPE A;  2P9G A;  4TY8 B;  3TA1 A;  4RNM A;  4DOZ A;  3D6T B;  5J2N A;  5K14 B;  3SCL E;  2BQ3 A;  2XG8 A;  2Z4P A;  5A0Y B;  2RUG A;  3DRR A;  1TKZ A;  2CQ2 A;  2RF2 B;  1UVN A;  1XNR F;  2LEA A;  3T1H F;  2M7S A;  2EKN A;  2V8V A;  4A8X A;  4IDK A;  2EG1 A;  1RT1 B;  2F5G A;  3OHA A;  2LA6 A;  3NS6 A;  1VQL S;  4F25 A;  3R5A A;  5U47 A;  3NNH A;  1JLE B;  2YWG A;  5F3T A;  1PIE A;  3J80 U;  4ZLL A;  2YNI A;  1TL4 A;  3C3L A;  1KP6 A;  3D6F B;  4NXN F;  3LWL A;  2VA3 A;  4A8Q A;  1WAC A;  2YNG A;  3Q8S B;  3CD7 A;  1F3F A;  1MWQ A;  2P6T A;  1M5O C;  2QL5 B;  1S59 A;  4NPO A;  1EIY B;  5KT3 A;  1NH7 A;  2F1F A;  4E0D A;  3WX8 A;  2HMI A;  2UXB J;  1Q8B A;  1TKT B;  1ZA1 B;  1J5E F;  3ZNU A;  3G86 A;  5KFQ A;  2Z8Q A;  3I56 S;  1Q8K A;  3ZNJ 1;  4ED5 A;  2B4U A;  2CUY A;  2J9E A;  1NZ8 A;  2BE2 A;  4NWB A;  1RWN B;  5E3P A;  1HBM B;  4C8N A;  3NY0 A;  1RYS A;  2AEJ A;  2G0J A;  2MYF A;  3AH6 A;  2CPX A;  1R43 A;  1RSC A;  1RP5 A;  1VOM A;  2FHJ A;  3RGI A;  3US5 A;  4DX7 A;  5C42 B;  2VIH A;  1J5E J;  1SQG A;  3BR8 A;  5J2P B;  3CD0 A;  2G1H A;  5AJ3 F;  3TAR A;  1PAE X;  4X4O A;  3NWR A;  2ZWO A;  2HHU A;  3PM9 A;  1EP4 B;  4OV1 A;  3T9N A;  2ZBI A;  1SC6 A;  3A13 A;  4KO0 A;  5B0A A;  4H4M B;  2W7P A;  2I9S A;  2RKI B;  1HD0 A;  1RUS A;  1TL3 A;  2EKY A;  2HG4 A;  1L5U A;  4KKO A;  2ZH7 A;  3BJY A;  1J27 A;  3AJ1 A;  5L9X A;  2V8H A;  2YX7 A;  3KLG B;  4A4J A;  2W9B A;  1QVG R;  2L3M A;  3M8Q B;  1RTH A;  2FB0 A;  2DR7 A;  1ZA2 B;  1GNK A;  1RTH B;  3EGV A;  3AD8 C;  3NKY A;  2FZK B;  2PA3 A;  4M5K A;  4C0O C;  3DHX A;  4X4T A;  3O3L A;  3SQG B;  3QSI A;  2X3D A;  4OFZ A;  2X1B A;  4GKJ F;  5J2N B;  1A0O B;  3GV5 B;  4W92 B;  2H3E B;  5EX3 A;  2G0C A;  3C14 A;  4X4R A;  2UXD F;  2U2F A;  2VG6 B;  1MW7 A;  2F9D A;  4D3G A;  4DV5 J;  5DQI A;  2RNE A;  2XGQ A;  1JLB B;  4L3K A;  4QW8 A;  1ROF A;  2MPU A;  3CF5 Q;  1OQ6 A;  3AOA A;  2FJA B;  1C1C A;  1SC4 B;  1RT3 B;  3IR6 B;  4CM2 A;  3K5O A;  3VCD A;  1XMO F;  2KVI A;  2UXC J;  3CJS A;  3C2P A;  1B99 A;  1DY3 A;  1R0C B;  2H1Y A;  2L9N A;  3M2U B;  1FNX H;  2C3Y A;  3SBM A;  2ZEJ A;  3MHY A;  2R8I A;  2HQ3 A;  4X4Q A;  3POT B;  1FD8 A;  3JSB A;  3WDO A;  1WNE A;  1MU2 A;  4AT1 B;  1XNQ F;  3LF0 A;  2HND A;  4KHR A;  4LSL B;  4CLF A;  1M90 T;  3DM2 A;  4WU2 A;  4ZA1 A;  1ZM4 A;  2HMI B;  2GMH A;  5K14 A;  3SSR A;  2KKH A;  3TI0 A;  1NHV A;  2AZ3 A;  4QBU A;  2ZOF A;  2JEJ A;  4JI3 F;  2HEK A;  3FEY B;  4C4W A;  4LF4 J;  1WDT A;  3I32 A;  4QPT A;  1CPZ A;  1FRM A;  5HVG A;  3WC2 A;  3BO2 A;  2W8K A;  3PNI A;  2VFR A;  1RAH B;  3DXS X;  4LRF A;  2Y0S D;  3PYD A;  3VVU A;  2HRU A;  5L1K A;  2C2R A;  1U1Q A;  3J7Y I;  3MEG A;  4C11 B;  2HGM A;  3ETM A;  4RX6 A;  1Y0H A;  2HHT A;  3F73 A;  4OI0 A;  3MZI A;  5D4L A;  5EDW A;  4AUK A;  1MML A;  2YKP A;  1RE1 B;  3I6P A;  5ETR A;  1R6Y A;  1S6P B;  2LYV A;  3CJK B;  2HNZ B;  2CQ0 A;  2AJQ A;  2ZC3 A;  4OI4 A;  4DL3 A;  2JNJ A;  1HWI A;  1XBW A;  4P10 A;  5E3Q A;  7AT1 B;  3MR3 A;  1EAR A;  4IH5 A;  3H4B A;  4NE9 C;  1FJE B;  1LWC B;  3OXL A;  3UVJ B;  2CJB A;  2DGV A;  2LEC A;  3PO4 A;  4AE5 A;  3Q8R B;  1SKU B;  2CG4 A;  4NI2 B;  4NZ7 A;  3R97 A;  3TR5 A;  5A8R B;  2ZNY A;  3I87 A;  2L9W A;  1KVK A;  1K44 A;  4ZP9 A;  1S0O A;  8RUC A;  2BOP A;  4DXL A;  2ZH4 A;  5BYQ A;  4J9N A;  3QID A;  3LP1 B;  1UEV A;  1IXK A;  2RQK A;  1CQM A;  4O3Q A;  4P52 A;  4D3H A;  2OUG A;  4Y2K A;  4S0M A;  2ZM6 F;  1JKH A;  1S4F A;  3BBF A;  3BSN A;  1RU2 A;  5K20 B;  2ILY A;  2VD3 A;  1S4E A;  5C42 A;  3KWM A;  2CNK B;  5F8G A;  4CH0 S;  1UJ5 A;  4HH1 A;  4IQX A;  2IM1 A;  5LM7 E;  4ES1 A;  1WEZ A;  3KJV A;  2L08 A;  2PFF B;  4JYA F;  5KFR A;  2GS8 A;  2YNH B;  1T9W A;  3O5T B;  1P6T A;  3KXD A;  2ZBR A;  3P8B B;  4NLU A;  4OJH A;  4QQB A;  3T1A A;  4CO2 A;  5E5N A;  1SKS A;  1U8S A;  2F4V F;  5DDP C;  4ZPD A;  2XS2 A;  3HD1 A;  1UZD A;  4UOH A;  2WON A;  4LF7 F;  1W7W A;  4ECV A;  2E1A A;  3THT A;  4DPU A;  2MKI A;  3ZC4 A;  1KN6 A;  1F0X A;  5IZH A;  2B4P A;  4HAC A;  1T0T V;  1M5S A;  1WG4 A;  1T7P A;  2QL9 B;  4ZMM A;  4NLS A;  4RW7 B;  1X5O A;  3BH6 B;  2OP5 A;  2A18 A;  3PFO A;  1IN0 A;  4ES2 A;  2NXJ A;  3S6E A;  4M5D A;  4EEY A;  4DL7 A;  4Q8F A;  2AJ0 A;  3SYZ A;  2DPJ A;  1S12 A;  4I0W A;  4DQI A;  2DR9 A;  2MZR A;  3UD4 P;  2LQB A;  3K5M A;  4MK8 A;  4OHZ A;  3I5A A;  2HRT A;  5C25 A;  2GA7 A;  5FLX U;  2YQ3 A;  2AEF A;  4XPE A;  2DNP A;  2WVF A;  3HJF A;  2IMO A;  4CO1 A;  1RCX B;  4B3M F;  5CYQ B;  3AXK A;  5D0E A;  2UV8 A;  2DJW A;  4TY8 A;  4FF1 A;  2MZT A;  4LSL A;  2NUU G;  1RIS A;  5GAH I;  2JLG A;  3BM7 A;  1RAG B;  4DR3 F;  1WF0 A;  3JTN A;  5FII A;  3VAJ A;  5G0R A;  2VV5 A;  2ZUA A;  3MMA A;  4YN3 B;  5LSO A;  3UI3 A;  1GTE A;  2QT7 A;  2MEW A;  4I4B A;  2A2C A;  1S76 D;  1MRO B;  2ASD A;  4LJM A;  2LVW A;  2AYE A;  3H20 A;  3M2V B;  4KB7 A;  2KXN B;  2FY1 A;  3E2E A;  2VU5 A;  2Q79 A;  1FRX A;  4FXW A;  4UOG A;  3KK2 A;  4H4O A;  2HKE A;  1FWK A;  2MDA A;  4TN2 A;  5C2G A;  2EC0 A;  1NK5 A;  1FEH A;  5IWA J;  3M8W A;  2MY8 A;  4XIU A;  2PC6 A;  3SSS A;  4V19 X;  3LP0 B;  1TKD A;  4MMO A;  4DPW A;  3JSM B;  1PO6 A;  1H38 A;  3ENV A;  3GWC A;  3SQG A;  4O0I A;  3VAG A;  2B9Y A;  3BSC A;  1CJU A;  2D3Z A;  3B4M A;  4MJK A;  4ZCL A;  2DNH A;  2COL A;  4M5H A;  3N01 A;  2FHJ D;  2YWH A;  5FDL B;  3M9M B;  1D8Z A;  4K4U A;  3G6Y A;  1KR4 A;  3PTW A;  2OPQ B;  4HR2 A;  4DX5 A;  1S0N A;  2ZDP A;  3MGJ A;  5B0F A;  2UVW A;  5HJY A;  2GJ2 A;  1XJW B;  1WI6 A;  2OSR A;  5KOX A;  1IQZ A;  5KFA A;  4CO4 A;  4J9O A;  2C28 A;  2GIQ A;  4YME A;  2GML A;  3NS7 B;  4TY9 A;  4F3O A;  3NL0 A;  3KLI A;  2VH7 A;  4QIG A;  2VB6 A;  5GAG I;  3ZZO A;  1YIJ S;  4ECY A;  5M2P A;  3LGM A;  4ZPV R;  2QLF B;  3LPY A;  1VC0 A;  2IBO A;  4X66 F;  1LWX A;  4K8R A;  2VFV A;  1N5Q A;  4EO8 A;  3LO3 A;  1XC9 A;  2LFV A;  1OQ3 A;  1RAE B;  4KHM A;  3WC0 A;  3WQP A;  3UN5 A;  2F8M A;  3W9J A;  1N88 A;  1TL7 A;  4C2M A;  3OHB A;  3SDE A;  2W1B A;  2N3L A;  4QIF A;  2XS7 A;  2CNL B;  8ATC B;  4GVB B;  3TP2 A;  1RAF B;  1SC3 B;  4ERD A;  5F8J A;  4YFU A;  1DRZ A;  3M9O B;  5HN0 A;  4QWA A;  1U1R A;  3GFX A;  4B3S J;  1TAQ A;  2QX0 A;  3LOU A;  4UUW A;  4FS1 A;  4WK3 A;  2GHV C;  2XMW A;  2DRB A;  3OQ2 A;  2CQI A;  1BC6 A;  1LOU A;  1N54 B;  1S1X B;  1VHI A;  4ZVG A;  3JYT A;  2H4W B;  4RW8 A;  3CD6 S;  2QLB B;  3TO8 A;  5DDR C;  5H9F J;  4LIW A;  1RTI A;  4IOC Q;  1XMQ F;  1IVZ A;  4UOC A;  3NXZ A;  3I9Z A;  4C8Y A;  2OSQ A;  2APO A;  1HQU A;  2Z2L A;  2CFX A;  4YDX A;  1P8G A;  1OY9 A;  1UJ6 A;  2OEL A;  2ATL A;  1NSP A;  2KB2 A;  1IKV B;  3AJ2 A;  2ZZT A;  2JFD A;  4IG3 A;  4ETZ A;  4RBT A;  4O3R A;  3U1M A;  3OXG A;  2RAQ A;  4ZVQ B;  4USM A;  4DFJ A;  1UL3 A;  3RU0 A;  4QU7 A;  1Q5V A;  3TRG A;  1U1L A;  2J0S D;  3DOL A;  3FVY A;  1P1T A;  1RK8 A;  1S48 A;  2E5G A;  4LF4 F;  1FJ7 A;  4R0J A;  2I5J B;  4G3I A;  4IOB A;  2IRU A;  2Q3P A;  5DO2 A;  4O44 B;  1TK5 A;  2J7U A;  4I64 A;  4ECU A;  5J2Q B;  5HLF A;  1YJ9 S;  1B7Y B;  3GYG A;  3M8R A;  3DLG B;  4Y65 A;  1H2T Z;  2A0F B;  2DGS A;  3NGT A;  2EEY A;  3H0P A;  4FKX A;  4HEA 9;  4OJG A;  3S8S A;  4DV2 F;  5H9E J;  4F04 B;  4LFB J;  4EUV A;  1WG5 A;  1T3O A;  4KGZ B;  1TFY A;  3FEX B;  4DL5 A;  3KLG A;  2W9B B;  2GFF A;  3KJV B;  5KFJ A;  2NZC A;  3OTB A;  4QWE A;  2LEB A;  2HBY B;  4ID5 B;  4M5N A;  5MLC V;  2KYX A;  3D3B J;  5F8I A;  3OD2 A;  2OTJ S;  5DGB A;  3F0N A;  5I42 A;  1GAO A;  1BUX A;  2A10 A;  1RA6 A;  2D7S A;  3CNQ P;  3G82 B;  3I96 A;  5LMN F;  2MQM A;  4NLY A;  3RR8 A;  2XNR A;  1HNI A;  1T11 A;  3RB0 A;  4NYZ A;  3TYT A;  1NK9 A;  1QAI A;  1HNZ F;  5IT9 U;  1QE1 B;  2ZNZ A;  4FNH A;  3VGU A;  2CWK A;  2CQ3 A;  2R7R A;  3GFY A;  6FDR A;  4N76 A;  2EFQ A;  4ZN3 A;  2GVZ B;  4DV3 J;  4OHY A;  4R5P A;  1ITP A;  4I6A A;  2W2Q P;  1Y4Z B;  1KC8 T;  1JLC A;  1RT7 A;  2B56 A;  3GU0 A;  5GAD U;  3PIO Q;  5HL7 Q;  1VQ6 S;  3IXQ A;  3FSY A;  1T05 A;  2AWZ A;  4M63 A;  2AX1 A;  3CVK A;  3RBX A;  3QZ7 A;  1Y9O A;  2OLW A;  2MZS A;  1RT4 B;  5M2U A;  5D8H B;  4DV3 F;  1FWL A;  4IFY B;  3HVT B;  1NK8 A;  2W7O A;  1WC0 A;  1RT5 B;  1M1G A;  2WB1 D;  3HFZ B;  1S6P A;  1SIZ A;  2G2Y A;  2W7A A;  3GR0 A;  5C25 B;  4B9V A;  4ED2 A;  1AT1 B;  2DNL A;  3G71 S;  1SL1 A;  1BY9 A;  3MM7 B;  4OZL A;  4ZP7 A;  2C3U A;  2KT5 A;  3EGW B;  4CLT A;  1B64 A;  1DJ0 A;  3VGS A;  4X65 F;  1BQN A;  4F4K A;  1B0P A;  4YB5 A;  2EK1 A;  3CCW A;  2L48 A;  4P2X A;  2I6W A;  1CJK B;  1K1Q A;  1RT6 B;  2W2O P;  1KOH A;  3N28 A;  2QJ3 A;  3VV2 B;  2BW2 A;  2VZ9 A;  4MKB A;  4UTG A;  4FF4 A;  1SH0 A;  2AHO B;  1C0U A;  4LSN A;  3Q83 A;  4LR7 A;  1HHQ A;  3D1H A;  4DR4 F;  3BGR B;  1MN7 A;  5DGA A;  1Q78 A;  4OYZ A;  2DGU A;  3H59 A;  1NK6 A;  3MI7 X;  6AT1 B;  2V34 A;  2CQH A;  2WVB A;  3FCH A;  4B3R F;  3POT A;  1TAU A;  2Y3Y A;  2H5J B;  3X3U A;  1X4E A;  4U8V A;  4CP5 A;  2IHR 1;  3HVW A;  3ITH B;  5H1S V;  3J81 Y;  2ZH3 A;  1RQ0 A;  3NAI A;  2O3D A;  2XI2 A;  4LRE A;  4EU0 A;  1VQS A;  3AHP A;  3CC7 S;  3PW7 A;  2GJI A;  1HI1 A;  1HBO B;  3FKB A;  1MMD A;  3C16 A;  3ZZY A;  1JLB A;  2OO4 A;  4AD6 A;  4F3M A;  3CCU S;  2ZWP A;  3EVO A;  3SCI E;  3M1V B;  3OLB A;  2UUT A;  5E33 A;  4DV1 J;  4C8L A;  1RZM A;  5G4D A;  2DR5 A;  2HBQ B;  2W2M P;  3GV8 B;  2IFX A;  4PPD A;  4Y34 A;  1YJW S;  3SFU A;  4U95 A;  2GIF A;  3CCT A;  2ERR A;  1A7G E;  2M88 A;  4PQU B;  1VQO S;  4PUO A;  4QR2 A;  1AZS B;  2GQC A;  1FDB A;  2M0G B;  2V67 A;  3M8Q A;  1R8A A;  2V2K A;  1F2G A;  1LWC A;  2H5I B;  1T9X A;  3EWG A;  3K58 A;  2HHX A;  1NKB A;  4ZPC A;  3CJ0 A;  4KFB B;  5CYM A;  2J7K A;  2HNZ A;  1WKL A;  1QLN A;  5F41 A;  1LK5 A;  4XDC A;  3DOM A;  2M70 A;  3O1L A;  4CZC A;  1QUP A;  5IQ6 A;  1S1W A;  3JQM A;  5J1N A;  4EYI B;  4KY3 A;  2JC1 A;  5GAE I;  1GH8 A;  2DXF A;  2IJF A;  3ELH A;  5CZV A;  2MKY A;  4ZJO A;  3JB9 k;  3HZE A;  3KG1 A;  3C14 B;  3FFI B;  2NCK L;  2IC3 A;  3ZZ0 A;  1NPP A;  5D4N A;  3V81 B;  3ZXW A;  3GIJ A;  3QSY B;  2HQF A;  3AT1 B;  3QIP A;  3CDW A;  4OYI A;  1FXL A;  2MZJ A;  1AZS A;  2QV6 A;  5IFM A;  4JV5 J;  1C1B B;  2QYG A;  3BKT A;  3KJF B;  5IC6 B;  1HWL A;  4DG1 B;  2XLI A;  3M9N B;  4DR2 F;  3V6D B;  5I3U A;  2FJV A;  3DLL Q;  3NMR A;  4B9N A;  1N8R T;  2OML A;  1TL3 B;  5BR8 F;  3AA9 A;  2HLU A;  1IR0 A;  1QAY A;  2VF3 A;  2WSF C;  2QO3 A;  2ZJQ Q;  3VAI A;  4FZV A;  2QLJ B;  4QCL A;  3EDQ B;  4ECQ A;  2DVI A;  2ABY A;  2DCU B;  1FDA A;  1HW9 A;  1CC7 A;  4Y2I A;  2ZH9 A;  3QT8 A;  2CPJ A;  3HSZ A;  1HNW J;  3MM8 B;  1FXD A;  3T5K A;  1N34 J;  1N32 J;  2FTR A;  1UEU A;  4P74 A;  1T03 B;  1URR A;  2MQL A;  2J8S A;  4KIA A;  4Q44 A;  3VTI A;  3HT3 A;  4RUH A;  3FUY A;  3HHN B;  4AL6 A;  3FBB A;  5A76 A;  1WG1 A;  5IV3 A;  4ED1 A;  2KZM A;  2HIQ A;  4UST A;  2CQP A;  2BE2 B;  2OFG X;  2RT3 A;  4LF9 F;  2C2N A;  1ZH5 A;  2HHW A;  2EFN A;  1WC4 A;  2MJU A;  1KSP A;  2G0I A;  1TMM A;  2QA4 S;  4KC5 A;  1HMV B;  3ILI A;  3TX0 A;  2AQ4 A;  4FF3 A;  4Q0B B;  3C66 A;  4QR0 A;  3BGR A;  1Q8L A;  3CCS S;  2XNQ A;  3DGV A;  3H7H B;  3AQO A;  4HDG A;  4OLO A;  3HZG A;  3OJU A;  4A8K A;  4CRJ A;  2MMY A;  2WRM A;  4UZB A;  1C1B A;  3CJ8 A;  2YNF A;  1CEZ A;  5HQ8 A;  2FJX A;  5BR8 J;  2MGZ B;  4YEA A;  3TZW A;  2XSJ B;  4NEZ A;  2DY1 A;  5F0U A;  2CJY B;  3GZ7 A;  3MR7 A;  3PYE A;  4PPZ A;  4OX7 A;  3PCO B;  1BD6 A;  2C2O B;  3ZZP A;  4EZ9 A;  4ILR A;  4E2F B;  1IQT A;  1WD6 A;  2PDA A;  4Q7A A;  3MM6 B;  2ZE2 B;  4URQ U;  2OH2 A;  1UKU A;  3BN7 A;  3TWZ A;  1NBE B;  3MEE A;  4DUZ F;  4BHQ A;  4X2B A;  4JI2 J;  2MLY A;  4WK1 A;  1NM2 A;  2OI2 A;  3RB3 A;  1SJR A;  3ADA C;  3TX8 A;  1WF1 A;  2OFH X;  3W5Y A;  1JJ2 R;  5D3G B;  3K8V A;  3HHL C;  3SQO P;  5C7P A;  3CME S;  4NLW A;  2E1M C;  2VG6 A;  5ETS A;  2HUR A;  3R6L B;  3R6G B;  3T5J A;  4N41 A;  4I67 A;  3W64 A;  2J0X A;  2MQ8 A;  3QLH B;  2L41 A;  3EPI A;  3NLC A;  4PKD B;  2QSF A;  4CO5 A;  3DGP A;  1ZM2 A;  2CJA A;  1C0U B;  4R8U A;  3EJM A;  2DH9 A;  1MU2 B;  4FNI A;  1IKX A;  4MIW A;  9ATC B;  1Y5I B;  4AL7 A;  4ZHR A;  2B6A A;  2KHD A;  4DX8 H;  2XSF A;  4KKO B;  2O66 A;  3L9Z A;  2YH0 A;  3N4W A;  3OPK A;  2J8A A;  4OHX A;  3MWB A;  3DDK A;  5D4P A;  1EKS A;  3OTD A;  4WP3 A;  1M5P C;  4I7F A;  4FVM A;  4DMZ A;  2AW0 A;  1N5Y B;  1CLF A;  3LP2 A;  4LR8 A;  2YKM B;  3DOM B;  2GQ2 A;  3H2L A;  4DU7 A;  3TOQ A;  2X1A A;  5KG1 A;  1L3T A;  1ZAX A;  1HBN A;  3GCW P;  4USH A;  4NCG A;  2Y8Y A;  3TVK A;  1Z1Z A;  2JOQ A;  4RL1 A;  1UW4 A;  1UVM A;  2OGU A;  2M52 A;  4O0N A;  5GMD A;  3C15 A;  3O8W A;  4O23 A;  1FKP A;  1GXU A;  1K1S A;  2KL8 A;  4LFC F;  2NPF A;  3P3D A;  3CDB A;  2HAI A;  3ISN D;  4HTI A;  3JQJ A;  4XPC A;  2AJ4 A;  1U47 A;  4B3R J;  4F8R A;  4YHH J;  1SL2 A;  2YNG B;  2EBG A;  4RUC A;  2ZH8 A;  2CQG A;  4LBI A;  3R5D A;  2GQQ A;  3NBP A;  4Z37 A;  2JVR A;  4PXC A;  1YRT A;  4P75 A;  3CJQ A;  1FRK A;  2CNN B;  1NAQ A;  3MM6 A;  3LW5 C;  3CCZ A;  3N79 A;  3UR3 C;  2BJ1 A;  2DHX A;  3B78 A;  3IWN C;  1RT1 A;  2ZKU A;  2R7S A;  5L39 A;  2QLW A;  1NSK L;  3LWM A;  1Q86 T;  2VG5 A;  2HHS A;  4CTA B;  1NK0 A;  3RRG A;  2ATC B;  4YDD B;  2KXF A;  5KG2 A;  4TYB A;  3GCX P;  2BYC A;  2H9Z A;  1RKI A;  2OD6 A;  2DEJ A;  2QFI A;  4G1Q A;  4TVA B;  5IOL A;  5B0C A;  4IRD A;  4JI7 F;  3K59 A;  4C3M A;  5B0E A;  1SKR A;  3DLG A;  4FXV A;  2R3V A;  1SCJ B;  3AY0 A;  3DYA A;  2RE1 A;  2XMK A;  1REV B;  3KLF A;  1WJ9 A;  2GGP A;  4LVN P;  3VQS A;  3BQ0 A;  3DOK B;  3A8J A;  4BC7 A;  2MXY A;  1F5C A;  1IBC B;  1S6Q B;  3TZZ A;  3G6X A;  4IUF A;  3GPA A;  1I51 B;  5HMX A;  5HQM A;  1IWG A;  3KOA A;  4WXW A;  4ID8 A;  3DU6 A;  2VIC A;  1LWF A;  1PKU A;  3CE8 A;  1S1V B;  3PX0 A;  3VR1 A;  3AB4 B;  4Q5V A;  3PYG A;  2FZG B;  4LF6 J;  2ZHA A;  2DNR A;  2MZQ A;  3CIZ A;  1FXR A;  2YQ0 A;  4YOE A;  2R42 A;  1RWU A;  3OR2 A;  3L7P A;  3P49 B;  1WF2 A;  3EGZ A;  3BF4 A;  4RW4 A;  2DRA A;  1JLG A;  1RT4 A;  4LSN B;  1NZA A;  2BRK A;  2DNQ A;  2CJK A;  5KFM A;  1NPR A;  4DR7 F;  3W1Y C;  1V6H A;  5HMY A;  2UUW A;  1A9N B;  4F2R A;  1S9E A;  1X4B A;  3FBC A;  3CCE S;  2BM1 A;  2DR6 A;  2V69 A;  3QRP A;  4YY3 F;  1PG5 B;  3CUN A;  1ZET A;  4M94 A;  4LQ3 A;  3CDU A;  3KLV A;  2POK A;  1PJ6 A;  4LUB A;  4YUD A;  1C2P A;  2CPY A;  1BQN B;  2RRB A;  1AUD A;  1WC3 A;  3F41 A;  4I56 A;  1TL7 B;  1TL1 A;  4WBF A;  4ZLP A;  2GW8 A;  3ULH A;  1D09 B;  2MHE A;  1PYO B;  5EWE A;  1KVJ A;  1KHW A;  2EFO A;  2UP1 A;  2I1R A;  3EM1 A;  2JX2 A;  2NYI A;  5HP1 B;  5IXU A;  2DD8 S;  3OL8 A;  2CQB A;  4P73 A;  1OSD A;  4LT6 A;  1KWM A;  3M8P A;  3EMT A;  4HHU A;  1RGV A;  3TJ8 A;  4C7Q A;  1SUQ A;  2BE7 D;  2ZHO A;  2DHA A;  3SSQ A;  3N6M A;  5ETT A;  3WX4 A;  2ASL A;  1R0A B;  5L9N A;  2C2K B;  3BRE A;  5KFY A;  2E7V A;  3DHW C;  1U45 A;  2BJE A;  2V4J A;  3ZZZ A;  4JBC A;  3H5U A;  4OI2 A;  3TEG A;  1RAA B;  4K4Y A;  1EX8 A;  3CJR A;  2MKJ A;  3V6H A;  2HS4 A;  3D0I E;  5JJB A;  4B9T A;  5IM0 B;  5MAO A;  4IG0 A;  2RSQ A;  5CH7 B;  3CW2 C;  2HNY A;  3DRP A;  1EAY C;  3IA0 A;  3U02 A;  3CIM A;  1GXL A;  3KLF B;  3OL9 A;  2RS8 A;  4V1A k;  3KTQ A;  3A3N B;  1TK0 A;  1FO1 A;  2YTC A;  2LQJ A;  2P9C A;  3BKU A;  1OYD A;  3HD2 A;  5HMZ A;  3BGF A;  3GSD A;  2J0Q D;  5B08 A;  2DK2 A;  1A6L A;  3DDI A;  4CNY A;  2F65 A;  1S1U A;  4M5J A;  4UZC A;  5HAN A;  3M6X A;  3AA8 A;  4XO0 A;  4F7V A;  3OLA A;  4JV0 A;  4CTA A;  4NYO A;  3W62 A;  4JI8 J;  4PXD A;  4A8S A;  2FC9 A;  3PVX A;  1GTH A;  1UP1 A;  1HI8 A;  3KK2 B;  1MN9 A;  1RHQ B;  9RUB A;  1RTI B;  2X51 A;  1J5O B;  2LQ9 A;  3BZQ A;  2LDY A;  3NCQ A;  4UY8 T;  3U27 A;  2B5J A;  1Q79 A;  2DT9 A;  3QJL A;  1GMU A;  1S0V A;  1JXV A;  1ZAW A;  2XM3 A;  5KFD A;  2E9Z A;  2ZH1 A;  3O2I A;  3T6J A;  5FD1 A;  4ZIV A;  2FVP A;  3HVR A;  1E6Y A;  5DS7 A;  3W61 A;  4DPY A;  1HNV A;  2QL7 B;  4DR6 J;  4PG6 A;  2KI2 A;  2WSC C;  3OFG A;  3TAP A;  4LVO P;  5HRO A;  5KOW A;  2FZC B;  1NSA A;  1UWA A;  4CLU A;  5CA5 A;  1VRT B;  2IA0 A;  3EE3 A;  4NZ0 A;  2V9K A;  3ZTP A;  2YBV A;  2HZC A;  4AXJ A;  2DB1 A;  5ETM A;  5CXT A;  1S1U B;  3G6V A;  3D1Q A;  5GVQ A;  4RLE A;  1HHT P;  3MCN A;  2VAS A;  4ZVS B;  2XY5 A;  2IDE A;  2CPH A;  2HFZ A;  3FBE A;  1N6Q A;  2VQF J;  2IYI A;  1ICE B;  1HWJ A;  1UAW A;  5JVG Q;  2JEF A;  4MIA A;  1M1K T;  3R3T A;  4ZVE A;  2HIY A;  3KNG A;  2HRY A;  4DEZ A;  4OV6 A;  4W4M A;  2D1C A;  2IIH A;  3MMB B;  4P9S A;  2FPH X;  2H5E A;  1OYE A;  2ALY B;  2BJ9 A;  1AUS L;  4Q8E A;  5BYS A;  2F3J A;  1HNI B;  4NLP A;  1UWB B;  2HFN A;  2HSE B;  1CJT B;  3HI9 A;  4ENO A;  1HPZ B;  2N4C A;  1T02 A;  2WAQ D;  1JLG B;  5KG0 A;  4ILM A;  1FFW B;  3HM9 A;  1HYS A;  3NGR A;  3VAH A;  3MPU B;  1CVJ A;  3IM9 A;  3BPD A;  1K0T A;  3P4U B;  5IC4 B;  4IOA Q;  3G6E S;  4P7T A;  4QYZ K;  4PG4 A;  4DL0 C;  4ZLN A;  1T3N A;  3SCK E;  1L3S A;  1BQM A;  3T1H J;  4AQY F;  1FCA A;  2MLZ A;  3A12 A;  3PG9 A;  3SV3 A;  2DIU A;  4J37 A;  3UDV A;  4O4R A;  1KFS A;  2XI3 A;  4QR1 A;  1RHJ B;  1E6V A;  2GHW A;  3VVT A;  1S6Q A;  1VBY A;  1BLU A;  2E5J A;  2R2R A;  1L3U A;  2AYM A;  3LGH A;  1Y11 A;  2M5Y A;  5THW A;  3ENQ A;  2BJ3 A;  1YX2 A;  2YX4 A;  3BSA A;  4MH8 A;  4RNF A;  5FLX Y;  2HWH A;  4HI1 A;  3MM5 B;  4L6V 3;  1Y10 A;  4B17 A;  4CLZ A;  4CLK A;  1RLC L;  3KK1 B;  3H8Y A;  2Y1R I;  4WIQ A;  5AXN A;  3RB6 A;  2LKZ A;  2ROG A;  5E41 A;  1VQ8 S;  2ZH6 A;  4OYM A;  1N34 F;  3ZTR A;  3UR0 A;  1TU0 B;  4I69 A;  1M5H A;  4LF5 J;  3M7V A;  1S79 A;  2DTJ A;  3FNN A;  1RAC B;  2DNZ A;  3BDE A;  4KYZ A;  1WWH A;  4C11 A;  7FDR A;  3MUR P;  1PC4 A;  1FVS A;  3UQS A;  3NOC A;  3OR1 A;  2ZZN A;  3M6U A;  2LXI A;  2VFT A;  3Q2S C;  5A2Q Y;  4ZPT R;  5DG9 A;  2DGT A;  4NEY A;  2F7V A;  4F26 A;  3IFE A;  3G8T A;  1YKW A;  2YNF B;  5BYR A;  1BXN A;  5LSR A;  2HNY B;  2MTL A;  3DRP B;  4A8Y A;  4DF8 A;  1T9U A;  4DJB A;  1VRU B;  3GP9 A;  2L9D A;  1TUW A;  1VBZ A;  2OAU A;  2OEJ A;  4F67 A;  2WSE C;  4KGX B;  1LQ9 A;  4BCA A;  1YVF A;  3QMQ A;  3V6K A;  2YWF A;  1RHK B;  3DLK A;  5HAT A;  4NI2 A;  1CS4 A;  3EVW A;  2BBE A;  3MR6 A;  5RUB A;  1F9E B;  1QSS A;  3M8P B;  2HFO A;  3KUE A;  2SXL A;  4ED3 A;  3V81 A;  1REG X;  2CQD A;  1SL0 A;  1YHQ S;  2CPI A;  4LFC J;  4U9R A;  4BWJ A;  3TJ9 A;  2GC8 A;  3CED A;  4I2Q B;  3V5R A;  3V4I B;  1I94 F;  1FX2 A;  3U1N A;  4K4W A;  2EI5 A;  1XK8 A;  2VG7 A;  1XMB A;  2RH3 A;  3QRR A;  1UA1 A;  4WP9 A;  3RW7 A;  3W66 A;  3QJP A;  1TV6 B;  1EQM A;  5CYM B;  1CUL A;  2YKQ A;  5FDL A;  1U2R A;  4U7U K;  3OFF A;  1RBL A;  4DUZ J;  1U6F A;  1S9F A;  4JI2 F;  1VRQ C;  2R2S A;  4JI0 F;  2CXE A;  3TUI C;  1KHV A;  3UDC A;  1N36 F;  3PKM A;  2AP6 A;  4LRB A;  3GMG A;  4ECS A;  2IC3 B;  3CCJ S;  4QJV A;  2ADC A;  4HLB A;  1EP4 A;  2MB0 B;  4YR2 A;  2O67 A;  2DGX A;  4C98 A;  4C8Z A;  1JKH B;  2VBX A;  1NSQ A;  1RCO B;  3BQ2 A;  2EFV A;  4L75 A;  4A47 A;  2N7Y A;  1C0T B;  5FJ4 A;  3Q8V A;  2M3D A;  5KFH A;  3IWL A;  3ONQ A;  4JI1 F;  1IR1 A;  3CCL S;  5KFU A;  2PI5 A;  4YB7 A;  4ZLJ A;  3BO3 A;  5CQG A;  2DNO A;  2JSX A;  4WFZ A;  5A8R A;  1X4C A;  3WIU A;  4ED0 A;  4RW6 B;  4PYD A;  4ZIW A;  5AE3 A;  2KHC A;  1S6O A;  3DRR B;  1TKT A;  2NYH A;  5AJ3 J;  4V19 J;  3HFV A;  3EX7 B;  4B02 A;  3CC4 S;  1BWE A;  5KFF A;  1VQK S;  2DRD A;  5ETV A;  1AFI A;  2ZBP A;  2RIJ A;  1C4C A;  2GVD B;  5KAK A;  5EWG A;  1XMO J;  4C0B A;  2B9E A;  4K4X A;  2QLX A;  5L8R C;  1JLA B;  1H3D A;  2H65 B;  2CKW A;  4NLQ A;  4WZM A;  2YPZ A;  1JLE A;  4WP8 A;  2RIL A;  3ZTQ A;  4OZN A;  1U8W A;  4CH7 A;  4N8O A;  3ETO A;  3SFG A;  1WC5 A;  5CD4 H;  1JXL A;  4YR3 A;  2K8G A;  3V4M A;  4DV1 F;  4UY8 5;  1DQA A;  2XSJ A;  4J91 A;  5D0G A;  3TA0 A;  2MGZ A;  1B70 B;  1JB0 C;  1JJH A;  2WVC A;  4M5L A;  4NYP A;  1Q8I A;  1U24 A;  2F8H A;  3GG1 A;  4QIV A;  2R7W A;  1Q7Y T;  4JI1 J;  4M95 A;  4ETX A;  2W2P P;  3UNY A;  1NO8 A;  1N32 F;  2LEP A;  2VPZ B;  4DV7 J;  1N5S A;  3S1T A;  2WCX A;  1X5S A;  1D3W A;  4ZP6 A;  2IVF B;  4EWT A;  3MAQ A;  1KON A;  3V2U C;  3CPW R;  2Y9H A;  1R27 B;  1ZZN A;  3I0R B;  1FTR A;  3G96 A;  4Y28 C;  1OY6 A;  4ZVH A;  4QOT A;  1URN A;  1VYA A;  2DNK A;  3W8P A;  2JLE A;  2ZVS A;  2CPD A;  3R7B B;  4KO0 B;  4ELV A;  4QWD A;  4WKY A;  2GAH C;  2VPX B;  4KBI A;  4WE1 B;  4WE1 A;  3EDR B;  3IGV A;  2NXU A;  3MPY A;  1FHT A;  3MM9 A;  3IP0 A;  1NKC A;  4MYU A;  5GAE U;  4X66 J;  4OI3 A;  4DX6 A;  3J7Y U;  4KGM A;  2QA2 A;  3NNC A;  1DTT A;  4WKR A;  4AND A;  4F0M A;  3MAA B;  3MR2 A;  1TR0 A;  3UN3 A;  2VHG A;  2XLJ A;  4IDK B;  2Z56 B;  3R5C A;  1LW2 B;  1D0E A;  2UUC J;  2WVD A;  4WTY A;  1H2V Z;  1SVD A;  3CDA A;  3VAL A;  2OHD A;  1XR5 A;  3PRV A;  3LA0 A;  2DIT A;  2HZV A;  2HQD A;  2PSZ A;  1Q53 A;  1U0S A;  3PEH A;  3MEC B;  2JH3 A;  1CC8 A;  2B7B B;  3TUP A;  1FFS B;  4NML A;  3BEG B;  1Q4R A;  2AZ1 A;  3QGH A;  3GB0 A;  1H2U X;  2VG7 B;  1AXQ A;  1WTF A;  2V68 A;  4MK7 A;  4TNO A;  2XS5 A;  1XN9 A;  4DR7 J;  3K5L A;  4F2S A;  1TMJ A;  1HR0 J;  4HYK A;  2E1R A;  2B51 A;  2QEX S;  3ICL A;  4GKK J;  1ZM3 A;  4WPA A;  4DQR A;  2W4D A;  1WOS A;  2XMT A;  3PKY A;  4LBP A;  3ITH A;  5KG4 A;  1HWK A;  1KDN A;  1SIW B;  4JOU A;  2EFP A;  5EWF A;  3RRH A;  1OWX A;  4USK A;  2QN6 B;  1YI2 S;  4E8U A;  3H4D A;  2DCL A;  3B6B A;  2NXN A;  5K8N A;  1V3Z A;  2NXE A;  4DV6 F;  1VS3 A;  3I4P A;  2I8E A;  1NDP A;  3DLK B;  2JDJ A;  2QSW A;  3OFE A;  5D4O A;  3KJQ B;  4DHV A;  4F4X A;  4A8W A;  1UVL A;  4LF7 J;  1LW0 B;  4MKA A;  4URS A;  3P45 B;  1I94 J;  2V63 A;  1V3S A;  4CIO A;  3KMS A;  2ZJP Q;  3PW0 A;  4PWD B;  2DYA A;  2KFN A;  3M1V A;  3BBC A;  1DLO A;  4ZPA A;  2A1B A;  5HK4 A;  1NHU A;  2A2D A;  4E98 A;  4F4Y A;  3DXB A;  5H9E K;  5D3G A;  2I5J A;  2XZD B;  4FBT A;  1RWM B;  1KNZ A;  1NJI T;  2NRE A;  2V50 A;  1DTQ A;  5EN1 A;  1Y3J A;  2FJB B;  5C24 B;  5KFG A;  3BR9 A;  4ZCI A;  3VQT A;  1N33 F;  2QZ8 A;  2DGQ A;  1L3V A;  1BQM B;  1K0V A;  1X5P A;  4EK2 A;  2XCA A;  1N36 J;  4DQP A;  4JI0 J;  1NLK L;  2AEM A;  3E51 A;  1IKV A;  3ET6 A;  4DSI A;  4OI6 A;  1JNZ B;  1HFE L;  1O6X A;  3NWG A;  5LXY A;  1JMT A;  1TKZ B;  4TU8 A;  1SH2 A;  2D69 A;  5J1P A;  3Q8U A;  4X65 J;  2VOP A;  2ZUG A;  3IS9 B;  5DZ6 A;  4ZK7 M;  2CQC A;  1YJN S;  4WFA Q;  1AW0 A;  4CLS A;  2VBY A;  3I4H X;  1G2E A;  1Q95 G;  2LMI A;  1FRI A;  3R5B A;  4DR3 J;  3GYN A;  1JLQ A;  1DHM A;  3D2W A;  4WYW A;  1HNZ J;  2ACM A;  2P2C B;  3AD7 C;  1WKK A;  4O4G A;  1QJH A;  2V8G A;  1B0V A;  4RPF A;  4YB1 P;  1S77 D;  4X4N A;  1GX5 A;  2PT0 A;  3W5X A;  4YP3 A;  3Q24 A;  3NGU A;  2YH1 A;  5IM0 A;  2UUA J;  3QT6 A;  4J9Q A;  1U6Z A;  1GK8 A;  2H4Y B;  2V4J B;  3NCP A;  1DQ9 A;  2KM8 C;  4I2Q A;  5DDQ C;  4ZIT A;  1TQL A;  4NRU A;  1WEX A;  2PD1 A;  1FEE A;  2FY8 A;  3JSM A;  2MJN A; 
#chains in the Genus database with same CATH homology
 2UU9 J;  2MQ8 A;  4HHU A;  3J81 U;  4YY3 J;  2HHH J;  4B3M J;  3R2C J;  4LFA J;  4LF5 J;  4KYZ A;  4DR4 J;  3JAM U;  4RJV A;  2F4V J;  2KVQ E;  3D3C J;  4PWW A;  4B3S J;  4V1A k;  4NEY A;  3J80 U;  1XNQ J;  4GKJ J;  2MTL A;  4X66 J;  4LF8 J;  4DV1 J;  4DR1 J;  2E5L J;  5LM7 E;  2UXB J;  2UUC J;  2ZM6 J;  3OTO J;  3J7A N;  4DV4 J;  2KL8 A;  4JI8 J;  4X62 J;  4JI6 J;  4B3R J;  4YHH J;  1IBM J;  4LFC J;  3R2D J;  1FJG J;  1J5E J;  4DR7 J;  4KY3 A;  1HR0 J;  1XMQ J;  4DR2 J;  4OX9 J;  4GKK J;  4DR6 J;  4B3T J;  4X64 J;  1HNX J;  4DUZ J;  3IMQ J;  4LF9 J;  4JV5 J;  5FLX U;  5A2Q U;  4JI5 J;  1HNW J;  2UXD J;  4LF7 J;  1I94 J;  3D3B J;  4DV5 J;  5LMU J;  3T1Y J;  2VQF J;  5LMN J;  5IT9 U;  4KHP J;  1N34 J;  1N32 J;  2UXC J;  2MEW A;  1IBK J;  4DV3 J;  2VQE J;  4DV6 J;  1N36 J;  4JI0 J;  4NXN J;  4LF6 J;  4DUY J;  5AJ3 J;  5IWA J;  4X65 J;  2UUB J;  4DR3 J;  1XMO J;  1HNZ J;  3W1Y C;  4LF4 J;  4NXM J;  1IBL J;  5BR8 J;  4AQY J;  4JI4 J;  4NEZ A;  3T1H J;  1XNR J;  4K0K J;  4DR5 J;  2UUA J;  4JI7 J;  4JI3 J;  4JI2 J;  4JYA J;  4DV0 J;  4JI1 J;  1N33 J;  4DV2 J;  4LFB J;  4DV7 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...