4KHPJ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
b'KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4khpJ00
3D3BJ 4LFBJ 4LF8J 3JAMU 5AJ3J 5A2QU 4X66J 2UU9J 4DR3J 3OTOJ 4AQYJ 4KYZA 4B3SJ 1N36J 2MTLA 4JI7J 1HNWJ 2UUAJ 2UUCJ 5IWAJ 2MEWA 4JI2J 4B3MJ 4YY3J 5FLXU 4LF4J 4NEYA 4DR4J 4B3TJ 4RJVA 4JV5J 4LF5J 2F4VJ 2VQEJ 4JI8J 1XMOJ 3W1YC 1N33J 2MQ8A 3T1HJ 1N34J 1N32J 2ZM6J 4GKKJ 1J5EJ 1XMQJ 4JI6J 4DR7J 4NXMJ 2UXBJ 5LMNJ 3J81U 3T1YJ 4NXNJ 1HNZJ 1IBMJ 3R2DJ 4JI4J 2HHHJ 4JI1J 4JI5J 3J80U 4DR6J 4DV4J 4JYAJ 4V1Ak 4HHUA 4DV2J 4LF7J 4B3RJ 1XNQJ 4LF9J 4DUYJ 2UUBJ 4DR2J 1HNXJ 4DR5J 4X65J 4LFCJ 4YHHJ 5IT9U 4DV6J 4LFAJ 4OX9J 5LMUJ 1FJGJ 4DUZJ 4X64J 2KL8A 4KY3A 4JI3J 5BR8J 2KVQE 4LF6J 4DV0J 4DV5J 4K0KJ 4PWWA 4KHPJ 4DV1J 3J7AN 4NEZA 2E5LJ 1IBLJ 2UXDJ 1I94J 3R2CJ 4DV3J 3IMQJ 1IBKJ 1HR0J 3D3CJ 1XNRJ 4GKJJ 4DR1J 2VQFJ 4DV7J 5LM7E 4X62J 4JI0J 2UXCJ
chains in the Genus database with same CATH superfamily
2AHOB 3BN4A 2IAJB 3WIUA 1N36F 4LRAA 3AAWB 2R2RA 5C42B 2GAGC 1YVFA 1OSDA 5JXSA 3GIJA 5H1SV 2YWGA 2Z57B 2QG9B 4RX6A 1F3VA 3TO8A 3KLFB 5LXRA 4B9UA 3IS9A 3OL9A 1ZM3A 2E9RX 3BGRB 2R8GA 2QLFB 3TEHB 3WIVA 1VI7A 3KNGA 3AA9A 1HWUA 2ZZNA 4WKRA 4A4JA 3M2UB 4ZVPB 1UCNA 2EKNA 4DL5A 4YQWA 1FRHA 3ICLA 2BBEA 1I3OB 4OZ0A 1TTHB 4DCOB 4C3MA 5F0WA 5K14B 2CQCA 4WYWA 2CNOB 4DG1A 2Y9HA 2B9WA 3OV7A 5AXNA 1QJHA 1UFKA 1AFIA 3QRQA 1YX2A 3FSIA 3MM9B 3VV2B 3OUYA 3ZFVA 5GVQA 3D0GE 3O5TB 3RBZA 3LH2S 4CO1A 2Z30B 3WZ0A 3CD7A 3KG4A 2IDEA 1T9WA 3JTNA 3OR2B 2YKOA 1JWWA 3GP9A 4OHYA 5FJ4A 5HSPA 4CDIA 5LMNJ 1D3WA 1ZYQA 1L3KA 4Q0BA 1ZAVA 2OHDA 2W4PA 2PO4A 5L1LA 2DR7A 4RW9B 4RWWA 4NYOA 2M8DB 7FD1A 1ZM4A 5A8KA 3M8SA 4YB6A 4YN3B 4MFBA 1R8PA 4NA2A 1RT6B 4LFAJ 3JSYA 2W9BB 5F8IA 4RU2A 3QMQA 2KRBA 3V4IA 2QV6A 4K0KJ 4IO9Q 1H2UX 4ZP9A 4O3QA 3QBCA 1ZETA 5F8MA 4AUKA 3UCUP 1U0HA 4ZPAA 1BMQB 4FF2A 3VZIA 3C46A 2LXIA 5I42A 1UVIA 2ZH7A 1WHXA 1FXDA 1X9MA 4F8RA 2N4CA 4ICLA 2R42A 2WAQD 2Y1LB 5KFMA 2CQIA 1T05A 1RQ0A 3M8YA 4G3IA 3QT7A 3BGFA 1FE4A 4BWMA 3G86A 1Q8BA 2XNRA 4ECYA 4TLRA 1KSPA 2UUBF 1Y5NB 1NM2A 5CYMA 2GZOA 3CC7S 1QAJA 1YZ6A 4OQJA 4D3GA 3BJYA 4UQTA 2V50A 2X1GA 5EHHA 3J7A1 1QUPA 5DM6Q 3GSIA 2CJYB 3BQ0A 1RKIA 2W9CA 4LR9A 2CIMA 1X4GA 2ALZA 4PUOA 3H2VE 5LSOA 2V67A 1WEXA 3BGLA 1JJ2R 5E41A 3TP2A 5F9LA 4Q7AA 4PEOA 2LECA 1SC6A 3H7HB 2ZOMA 3D1QA 3OJUA 1P8GA 3JSBA 2QE5A 1VHFA 5MAOA 1S1VB 2Y0SD 3EM1A 4NZ7A 2XWYA 3L4BC 1HW8A 1JLFA 3IFEA 3JAMU 4BHQA 1K47A 2VBXA 2CNLB 1RXOB 3EVMA 2H3EB 2MLYA 5K8MA 1YQHA 1GQEA 1X8DA 5HJXA 1WC4A 3UWTA 3QO9A 1U7LA 2VU5A 2G2ZA 1FCAA 4KPCA 4Q5VA 3J80Y 1PIEA 1JLGA 1J5EJ 1KOOA 4LRBA 2OKQA 5KT2A 2P6SA 3BF4A 4A46A 5KTQA 1T11A 5AXKA 2YNGB 4X4NA 1C0TA 4OHZA 2VZ9A 3D6FB 2G2OA 4CLWA 3RAXA 2OGUA 2VOOA 3MEKA 2JOQA 1DARA 3BYPA 1LW0A 4DCJB 4P2XA 2OD4A 1XMBA 4FBTA 3D6TB 3MFIA 1YRXA 3PJ9A 3CC2S 4ZS6A 3QLHA 1OJ4A 2FQQB 1U6BA 2LEPA 3HJFA 2FC8A 1LWFA 2WSFC 3C6UB 4HTIA 2RF2A 3QAEA 2EVZA 3NWGA 2EBEA 3F56A 2EG2A 1Z4UA 5D4NA 2MKKA 1NMEB 4R8UB 2KXNB 1MN7A 3ZZZA 1N32F 3M8ZA 4KH1B 2HVZA 1B99A 1UVNA 2ILYA 1KR4A 1FDAA 2DGQA 3JQMA 3V81A 2MMYA 4C8MA 4C11B 1LNQA 3GG0A 2OPRA 2QZ8A 5HQMA 3K59A 1KVKA 4HACA 3PYGA 3VR1A 4PPDA 3HVWA 1DHMA 1RZMA 1RB0A 1FT8A 1SI9A 3QPIA 2W2QP 4TVAB 3B82A 1EP4A 4QOTA 3KJVB 3H40A 1VQPS 2FHMA 3M30A 4QQBA 3SXLA 3CCQS 1L3UA 1AFJA 5HLFB 2I0XA 4OZ5A 1VQMS 1D9FA 4YR3A 3FC9A 1CJUA 2MGZA 2KG0A 3OSNA 2FHJD 4DL3A 1F0XA 4KH0B 3KJFB 4BCAA 4OYZA 1HWKA 2WONA 2HHTA 4WU3A 3PHTA 1MROA 1CJKB 2CZ9A 2WB1D 3ZNJ1 4UQGA 2DRDA 1MWZA 3NBPA 2EC2A 1RT3A 1S1UA 3THTA 2L41A 1HYSA 3GV8B 1RHRB 3H0PA 1OYEA 1VJQA 1Q79A 2HZVA 3U02A 1NKEA 3SSSA 2B3TB 3BZQA 2CYYA 1VCTA 4DU8A 1T95A 3TANA 2WZ1A 2DBBA 2X1BA 4OI2A 2B7BB 1FDDA 4YB7A 3PYEA 2DPJA 3M2RA 3CCWA 6FD1A 3C15A 3TZWA 3E8OA 2I8EA 3RB4A 3FSXA 4B3SJ 1U8WA 2GVZA 4YR0A 2YX7A 5M2RA 3ILIA 5KFNA 4LQ9A 4B3TJ 3OTBA 5KFSA 3I96A 3K8VA 3SMZA 4ZJLA 2ZH8A 2BV3A 1VBKA 2XGQA 3KLIA 2VC0A 4K4WA 1FF2A 1LFWA 5CCLA 4OYPA 3LP2A 1TFYA 1HNVA 2W25A 4K4XA 4WFZA 5I4MA 1LWXA 1TMMA 3CJQA 4IG0B 1N0VC 1MMNA 2GJFA 5KFZA 2HVEA 1CULA 1TUVA 4HH0A 1VQYA 2KT3A 3M8WA 4CLUA 2BJ9A 2CDQA 2NPFA 3SQOP 4I6AA 2COLA 4J9NA 3IG1B 3HM9A 1LQ9A 1JLEB 1GX5A 2R9LA 2G13A 4B3MF 3UN3A 4JBCA 3UD3P 3DCAA 1HKAA 1RT5A 5CHCB 4ECRA 3GV7B 4DPXA 4C8LA 4ZLJA 5J2NB 2LQ5A 1GXTA 4ZN3A 5IT4A 3H4BA 2VPZB 4KYZA 3CCJS 3IRXB 2MKCA 1UVMA 1CS4A 1HD1A 1TL3A 3A4TA 1RT2B 5E3PA 3GE9A 4PQAA 5KFKA 1IN0A 1WC6A 3OTCA 3J81j 4CWBA 3JS9A 1HBMA 2NR0A 1NHUA 1S76D 2BQRA 4J37A 1MLAA 2J0SD 1K44A 3PKMA 2CQ1A 1DY3A 2PFDA 4P73A 4ER8A 3S1TA 1RHMB 1ZZNA 1RTHB 3GFYA 3M6WA 1RGVA 3NGKA 1M5VC 3BR9A 5HK4A 1FXLA 3AOCA 4ILMA 3AFGA 4Y6IA 4HHHA 1NLKL 3DLGA 3EZOA 5KFAA 1JLAA 4KE5A 3GZ7A 3HHDA 5F41A 5CYQA 3MEEB 4PPZA 2AZ1A 1K73T 3W9HA 4J9PA 1JKHA 2X7IA 5F3TA 3TI0A 4F3MA 2FJVA 4F0KA 4IR9A 5B0EA 2P8IA 2RVJA 3MEGB 1DRZA 3V6DB 1SH2A 4I2PB 2XEXA 5HI7A 3SCKE 1GEHA 1HQEB 1I6JA 1RT7A 2KG1A 4PQUB 3G82B 2M4MA 1DQAA 4QYZK 2XY6A 3D9BA 2CQ3A 5AT1B 2J6UA 5A8WB 3ZTQA 2O1PA 4DV0F 3R7SB 3NS6A 3EWGA 1QTNB 1SC4B 2FY8A 1RTIA 2ZDPA 2F9JA 4PYDA 1RWUA 1T0TV 2D9PA 1R0AB 2J9DA 2CNKB 4BC9A 3DRYA 4DV5J 1QSSA 4PWWA 5G0RA 1MMLA 2YPYA 1R6YA 4O0NA 2V34A 2BXJA 1ACMB 5C25B 3GCXP 3R7NB 2GVDB 1FJ7A 2KXFA 1XN9A 4X4SA 4IG3A 2BACA 2CVEA 3SV3A 4NI2A 5KFVA 1EJ7L 1VQ6S 4WU2A 2CG4A 4LBIA 3W1YC 3MOZA 4LSNA 1FDBA 2OPSA 4WP3A 5JMNA 2BABA 1WC3A 3WHIA 5F8NA 4G1QB 2F1FA 4DV6F 1YLXA 4KR0B 4JI3F 3JSRA 2R7XA 1TAUA 4OHXA 3C8YA 1SV5B 2K7JA 1U6FA 1YWXA 3H98A 1W25A 5IFMA 3PIPQ 4N76A 4YHHJ 4Y2MA 3IS9B 4B02A 2DY9A 1UP1A 3I82A 2CPHA 5F8JA 1IBLJ 5CXTA 5A0YA 3QGPA 4KGZB 3FFIA 2ZM6F 3O8WA 2CPIA 1RWKB 2NXCA 4CQ1A 4O4RA 1YKWA 3J7Z5 4JI1F 4JI8J 4KPYA 5KFRA 3RB0A 4F02A 2KZZA 2GNKA 2IYIA 5ETPA 3DXSX 2Q6BA 4DG1B 1JLQA 2XY7A 3BKFA 4FPRA 2RUGA 4PG8A 3KDNA 2J9EA 4WK3A 1QUVA 2QO3A 4L72B 2YNIA 3ZZ0A 5I3PA 2WK4A 4H4KC 2OEMA 3HD1A 3MPUB 4Q2LA 1X4EA 2HFSA 5A6WA 4J9MA 2IRUA 3KLHA 2V8DA 2IM3A 3BO2A 5IQQA 1U2CA 2JLGA 4PZVA 1MMDA 4IDKA 1FRLA 3VHQA 1B7YB 3FUYA 2J9DE 5D0EA 2FIUA 2C3UA 2UZAA 3MCMA 3M6UA 3BV8A 3GILA 1VIOA 2J8SA 4Q0BB 2HHVA 4UOFA 1AROP 4JP8A 4EZ6A 2PT0A 3OTEA 2WVDA 2XZWA 2QFIA 5A8KB 1BXNA 4MFBB 1WELA 4DUTA 3NCQA 3R9LA 1XR5A 4YR2A 3D6HB 5LOQA 2CRLA 2HBQB 5J2PA 2Y3YA 1JNRB 1RI7A 1VBXA 5LJ5Y 3V4IB 1Q8LA 3W7BA 2MQ8A 1IWGA 3MM8A 2FZGB 4F4KA 1AZSB 2ADCA 4JI6F 1U0HB 5L9NA 3TZYA 3TWZA 2DGOA 4DFKA 4HR2A 4P7TA 3FBCA 3WX8A 5I42B 3W2WB 2BR0A 1KVJA 1RAAB 3C14A 4ICLB 1T9XA 3S7RA 2VQFF 1BE4A 3CJRA 1T05B 4KJIA 3NAIA 2K2PA 2IA6A 2NSBA 1F1BB 5CYMB 4ZPTR 4X84A 5D6GA 3IMQJ 3W2VB 4Q43A 2B6AA 5HO4A 5KT3A 2VIHA 5HQ8A 2W9CB 2F40A 3M9MB 2OEJA 4PUOB 2XMMA 2MDAA 1FWPA 5HMZA 1NH7A 3NS5A 2PI5A 4E98A 3J81Y 4ZLLA 5GAHI 1XK8A 1FWLA 2H4WB 3L7PA 2HHWA 1FA0A 3D68A 3EDQB 1IUJA 1VJWA 2DHAA 3BPSP 3TAPA 2R8KA 1WOSA 2CJXB 1X0FA 3AT1B 2ZFHA 2MKJA 3IXQA 2LU1A 3UR0A 5DG9A 1JLFB 2I2YA 8ATCB 1Q1KA 4DV1F 3KXDA 5KFPA 2VFVA 2UUBJ 2KHDA 3QO9B 3H8YA 1J2VA 2IMOA 2V69A 1TKDA 5KT6A 1KONA 2KL8A 1RTJA 4ZPWR 1JLGB 4RNHA 2KM8B 5JJBA 1X4BA 1CLFA 4OI4A 1U1NA 2HGLA 3DC2A 2F63A 1C0TB 1PYOB 3GYXB 5GMDA 3D3BJ 3TOQA 4KO0A 2IDLA 4LRCA 1U2RA 2CPZA 3OFEA 3TARA 1XQIA 1Q4RA 2C3OA 5IC6B 4NXMF 2B4VA 3BSNA 4GO5X 3BR8A 1I5OB 1LW0B 4O3OA 1RHUB 1IKXA 3NLCA 4M5HA 2NYIA 3M4XA 3QLHB 1EX8A 3SZ2A 1K8AT 1DAXA 5D3GA 1UWBA 2E1PA 3A8JA 5HP1A 2E1RA 4QW8A 4CH1A 1LWFB 3QWUA 2RF2B 3VVUA 4PXEA 2JL9A 3POTA 5HMXA 3SI8A 1EETA 2ZEJA 1EIYB 4KC5A 2ROPA 2ZDOA 3HHLB 3SQGA 1SKSA 4ZVUB 4BWJA 2YQ1A 1KQGB 3EPIA 3MM6B 2HNZA 1FK9A 1KNZA 2K1RB 3V81B 5LSRA 1TUGB 2AEFA 4DPUA 2VQEF 3AOBA 2GHPA 2NXNA 3HFKA 3E2EA 1ZZFA 3OVAA 8AT1B 3M05A 1L3VA 3FEZA 1HBNA 1GXLA 5DETA 2YKMA 2QL5B 1FRKA 4OZ3A 1X9SA 4DQQA 5IM0A 1EP4B 2B7CB 4P7VA 1NK8A 1YIJS 2DXEA 3M30B 1QD1A 1NDPA 2HMIB 4YDDB 4QWBA 4DX6A 3BS9A 1WORA 3GJTB 3CD5A 3GONA 1NDKA 1CJUB 2KT2A 4OHWA 3QFHA 1CJTA 1A7GE 3CJKA 2F8HA 3RBDA 1HR0F 1UMJA 4Q45A 3W8PA 4L74A 2HFZA 4OV6A 2WONB 1JXVA 2U2FA 1OO0B 3OSPA 3DM2A 1MROB 5CH7B 4Y28C 2ZWOA 2D3O1 2Y1JA 3B4DA 4ANCA 3NBPB 3GLJA 1SQGA 1RT3B 1S1UB 3R5JB 1N5QA 5GAEI 2F4VF 2MJNA 2AWZA 2QA4G 4F3OA 1SJRA 2LQ9A 3VAMA 4PCQA 3N5BA 4FS1A 4WP8A 1S9FA 1C2PA 2MY7A 2KM8C 4HTJA 1S4FA 4UY85 4MAKA 5E3CA 5HMYA 3VF0B 3OL7A 2XNQA 3M2RB 3M6XA 1T9TA 3C15B 3KWMA 3PXGa 4WZQA 2AKWB 2FZKB 5AXMA 1L3SA 4KHPF 4FKYA 3CIZA 1FX4A 3M7VA 4N5SA 2BQUA 2FYXA 1R0CB 3OR1A 4LF9F 1T7PA 1RT4B 5HVHA 1SKRA 1APSA 4K4SA 2C2NA 4JOUA 3ITHA 4QYRA 3W5YA 4DI6A 2AJ0A 3KLIB 1SCJB 2ZH9A 3DKDA 3NY0A 3VAIA 3MPWA 3HMJG 1CQNA 3NMAA 5LT5A 4R5PA 3M8RA 4ERDA 3HHEA 1RWWB 1ELOA 5KG3A 1GMUA 3LP2B 1HNVB 2VL1A 3RB3A 2C22A 1QAIA 2LQJA 4Q44A 4ED5A 4ECVA 3HHLC 1FNMA 3VVTA 2RB7A 3HHLD 3NGTA 1CULB 4ANEA 2L9DA 3FMBA 1ZS6A 1H7WA 2QJ3A 2HG4A 2JEFA 2N82B 2G0IA 1EQ0A 4RJVA 1LFPA 1VFJA 2WVCA 4CO3A 1X0PA 3MFHA 4ATNA 1GNKA 3BDEA 1EKSA 4N41A 1RT5B 4I0WA 1PJ5A 3RZAA 3N79A 1NJXA 5H9EJ 4JV1A 2MSTA 3EDRB 4DV4F 1EHWA 1CS4B 1TL3B 4OX6A 3UVJA 3DGPA 4X64J 2DNOA 5BR8J 1R27B 4RUCA 1UPPA 3V6HA 1KHVA 2MLXA 4P2FA 2V8HA 4MJKA 2JLFA 4ZKAA 4I2QA 2N7CA 4NLQA 1WACA 1F2HA 1S6PA 3EZUA 3KK3A 4ZHRB 2PMHA 2QA4S 4JI7F 4ED3A 2ZZMA 2BW2A 3PM9A 5LJ3Y 4JI2F 1GFWB 1SBRA 1RAIB 4B3MJ 2CQ0A 3UDLA 3K5MA 3SSQA 1VC6A 3SV4A 1X9WA 3MUMP 4MIAA 2RKIA 2DVIA 3DLGB 1IKVB 4Z7YA 2QA1A 1EB0A 5IV3A 4YOEA 2CPDA 5CYQB 4Y2AA 2DO0A 4DUYF 4DR7F 2BANA 1UW9A 4C0OC 3P45B 4OYAA 5IS2A 5B09A 2AJ1A 5RUBA 4TQSA 3G8TA 1X4AA 1JKHB 4ES1A 3AXMA 3J80U 3KLFA 4AYBD 3TJ9A 4P2MA 2MKSA 3OVSA 4GKJF 4CH7A 3W60A 1VRUA 5DGBA 4X62F 4U9RA 1CVJA 2MKYA 1RT7B 4MIWA 1N48A 4LBHA 4GO7X 1LKZA 4UOHA 3K5NA 4ELUA 3K89A 4K8RA 4HT5A 1N4LA 2Y8YA 3KKFA 2G9OA 4WCEQ 3KLGA 1IBKJ 2D1CA 3PVXA 2HQGA 1RAEB 4NX9A 5F9NA 2PE8A 5T41A 3OT9A 4WKYA 1N34F 4UUWA 2AYBA 1RTIB 4YMEA 1P27B 2IRYA 4LUBA 4FNHA 2QSFA 5K5MA 2RT3A 3BSCA 4A8XA 3DNCA 4OIXA 5KFHA 1KRPA 1OMSA 2VASA 4DL7A 2ALYB 4GC7A 3MXHP 3OHBA 2MQLA 5G0RB 4FZVA 3C16B 2ZJQQ 2ZC4A 3VAKA 2MHNA 1FWKA 4FF4A 3UE2A 1TZ0A 1F5AA 2Y0BB 5KFJA 2KJWA 2EFNA 4NLOA 2AYEA 1N88A 4IG3B 8RUCA 4NI2B 4LRFA 4F04B 4RW6A 1UPMB 4RZRA 4OI1A 3IGVA 4LSNB 1WUUA 1R8HA 4DV0J 2OPSB 3LGMA 4QU7A 1S57A 2Z2ZA 2R7VA 3GU0A 1HHQA 4OYMA 2XB2D 5FDLA 5EWEA 1RT6A 2M52A 1ZH5A 2D69A 1V6HA 1LV5A 2GS8A 2ROGA 3P96A 1KKHA 5DDRC 4NZ0A 3CJTA 1IM6A 3TUZC 4XPEA 3CJ5A 1NJIT 4WE1B 3Q89A 2GFFA 2CQ2A 1XBWA 2KU7A 1S10A 5L9XA 3D4JA 2N3LA 3JYTA 5I3UA 3IBFB 2ZC3A 2HRTA 5A0YB 2OFHX 2KH9A 3KUHA 3FFIB 4J9UE 5BJRA 1FFGB 4QR2A 4TY8B 1T9YA 3R1HA 4K4UA 1KLMB 4BS2A 5AE2A 5K9FA 1Y7PA 3IRWP 2AJQA 2Z4PA 4ZP6A 4DV6J 1U48A 4LFBF 2MSSA 2G0CA 2DGVA 4JI3J 2XTJP 1GT8A 5DZ6A 1WC1A 1JLQB 4LQ3A 1NB7A 5KFOA 5HVFA 1CBKA 2W7AA 2ZBQA 2YNIB 3ENQA 4IQMA 4NYPA 3DHXA 1V3ZA 1UWAA 4YEAA 3DLKA 4KHRA 4USTA 1N0UA 3KLHB 3OFGA 1YRUA 1NPRA 4OMFG 4YB1P 4E8UA 4CNZA 2M3DA 4F3QA 4NLRA 1TL7A 3D1HA 2DIUA 2ZM6J 4B3RF 3MURP 1YK9A 3FDSA 5KT5A 4J9LA 1A9NB 4DN9A 2V63A 1OPIA 1Y5LB 4FVMA 3D54A 1L5UA 3Q22A 4JI1J 4NPOA 4IYQA 2M70A 3ZC4A 5GAEU 4B17A 4DR2J 4IH6A 1TK5A 2WBMA 3KFWX 4J91A 2YNGA 1RAOA 3MM8B 3TRGA 4C8ZA 2XMAA 1FEEA 1T03B 2E5LF 2NUUG 3MCOA 5ITHA 4ECQA 2QA2A 1FD2A 3SFGA 3ISNC 3CD0A 1PAUB 3I4HX 2AJ4A 3ISND 4I64A 2GGPA 3ETMA 3L7OA 4LBPA 1H98A 2JC0A 1F6TA 2HPUA 3QT8A 4P2SA 3OFHA 4H4MA 2EFGA 3MPDA 2KXHA 3D7SB 3ONQA 3C14B 4LSZB 4NLYA 1WF2A 1U1QA 3TZXA 1TELA 2ZITA 2Z2LA 5KFDA 3AY0A 3K17A 4K5SA 4X4RA 2KFZA 3G8QA 4DLGA 4S0MA 3J7YI 4NASA 2Y1RI 3EJMA 4MKAA 2YNFA 1JXLA 2B6AB 2HQDA 4EK2A 3BH6B 1TL1A 1A0OB 2KO1A 2AMCB 2JH3A 4Y2CA 2IVMA 2RQMA 5E3AA 2VJUA 3BEGB 4FXWA 3NWRA 1KOHA 2E1CA 2AZ3A 1S0OA 2YX1A 2YWHA 3DFEA 2UUAF 4FXDA 2JVOA 3FVYA 1TK8A 1CQMA 1S4EA 2VQFJ 5LM7E 2C2RA 1M1HA 3DYAA 2RIJA 3LW5C 2MYFA 1BUXA 3HJVA 3VQTA 4HEA9 2MEWA 4NXNF 3VTIA 4J9OA 4AD6A 5BYRA 1RTJB 4KT0C 3W62A 3A12A 4P10A 3ZZTA 5HLFA 5F8HA 2ADBA 4TXSA 5L1JA 2PMWA 1GTHA 3OJSA 1YHQS 2C2EA 4KO0B 1OSCA 1KDNA 4CTAA 1QTMA 2X1AA 2PD1A 4XIUA 3DRSA 4HHUA 5C24A 2PI4A 3HI9A 2MZJA 2KB2A 3NRBA 3C2PA 5AJ3F 4CLPA 4DWIA 1QLNA 1HMVB 2GO9A 1IKXB 5GAGI 1HHSA 4J90A 1N6QA 2E5JA 4DV1J 2C3PA 3HKZD 2GMHA 2JWNA 5D3GB 1UWBB 4M5GA 5HP1B 1OQ6A 3A3OB 1QDUB 3OW2R 4CO4A 4DN0A 3Q8RB 3OLBA 3POTB 1WI6A 3UNYA 4C6AA 2HNDB 2P9EA 3TAQA 1KBRA 1EETB 2LA6A 2QMXA 2OSQA 2MQNA 2ZJRQ 1HPZA 2P9GA 4ZK7M 2N7YA 3MEDA 3CMAS 3SQGB 2GHWA 1N54B 2WSCC 1BC6A 4L76A 2HNZB 1H2VZ 1FK9B 2BMBA 2JEIA 2FPHX 4WBFA 2RMLA 3SBMA 5LSLA 3OFFA 4NXMJ 2ZBRA 3ZTSA 1LXNA 2V2QA 4KGKA 2B43A 4IOCQ 1JLBA 2HHXA 4ZPVR 4UOGA 1I94F 1HBNB 2Q79A 4RBVA 2YKMB 2HBYB 5KG4A 5GADI 3MUVP 5IM0B 1X60A 4EZ9A 5IV4A 4FDFA 5D4OA 1VQNS 3BH7B 4IG0A 2H51B 4M63A 4M5DA 2GO8A 2XSJA 4MH8A 3CCSS 3G4SS 1LW2B 2HVHA 2CQ4A 3UNGC 3IM9A 2DB1A 2F8EX 1WI8A 2D7SA 3GFXA 2KZMA 3IG1A 1CJTB 2AT1B 4Z2XA 1VC5A 2A6MA 1SJ3P 2BZ2A 2DGSA 3DM2B 2VQEJ 1BWVA 5J2NA 2UP1A 2MLZA 2FLPA 2OTJS 2PEHA 4TNOA 3FQKA 4KB7A 3ZZRA 4QIVA 1XR6A 1KQKA 3CEDA 1LK5A 2DXFA 2J7KA 2O01C 3PW2A 2R7RA 3K7RA 2HEKA 1MWQA 1G2EA 1GMWD 4OI6A 3A3PB 1RTHA 3KUGA 3MMCA 3JB9k 3JQKA 1HR0J 3I31A 2DR5A 3H5YA 4DL2A 2V9WA 1LXJA 3N4WA 3PFEA 2UU9F 5KFIA 5KOXA 4XPCA 3OR1B 2D74B 3ADAC 2IC3A 1S6OA 2CWXA 5KFLA 4M8LA 2R4FA 4KAIA 2IPOB 2C3YA 2HSEB 3CDEA 3EPGA 1R8CA 1FD8A 1GX6A 3MEEA 3ITHB 3S6EA 2EI5A 2F4VJ 1S12A 2V2VA 3IC1A 2OEKA 4R5PB 3T3FA 3UD5A 4DS5A 2OSRA 5KG7A 1HI8A 1VLYA 1FJGF 3GMGA 2F5GA 4H4KA 5BXIA 3P49B 3M6VA 3G82A 3AJ2A 4WXOA 2J9CA 2POKA 3R5GA 4DU7A 1UJ6A 4OJ3A 5LMUJ 2E5IA 3Q8SB 2EK6A 2SXLA 3WQPA 2ZH1A 3GCWP 1U1MA 4KHPJ 4CYUA 3FZ2A 4O23A 1UA0A 4QBUA 1KVIA 4QIEA 4FYVB 5FLXY 2VODA 2FVPA 2DNRA 1N33F 2IY5B 3QGIA 1Q86T 5D8HB 3OXLA 2DTJA 4L3KA 3NNHA 2FVRA 2YWEA 2HFVA 2O67A 2FZCB 2HS3A 3UVJB 3SYZA 1NO8A 2E7WA 1LWCA 4YB5A 2DNYA 2ZOFA 3G8SA 2XLJA 2VKRA 2DIVA 4FPIA 4Q8EA 1N5VA 1HBUB 4DX7A 2RILA 1QVGR 1KTVA 5HATA 4I2QB 4LVNP 1MSWD 1WC5A 1JLCA 3DOKA 3J81U 1YBUA 3SCLE 4DQRA 3G87A 3ENVA 1S6PB 5H9EK 3KK3B 4MYTA 4F25A 3GQCA 1M5PC 3IAS9 5AE1A 2MQMA 3VQSA 1RP5A 2XI2A 4B9MA 3E3XA 2HAIA 4PKDB 1S6UA 1F2GA 3SFUA 2J7UA 2AIRB 4EBCA 2J8AA 4C9DA 2ASLA 3JQJA 2EG1A 1BHNA 2MY8A 2BANB 2MQQA 4NE9C 2FLNA 4Q2MA 2XYPB 1SV5A 2W7PA 2H5JB 1VHIA 4ECUA 2EKYA 2HWHA 2X1FA 2R2UA 1HQ2A 1U0SA 4ILRA 3J7YU 5FD1A 3DRPA 2RQCA 2AP6A 2AJFE 4O44A 4GKKF 4OZJA 1U1RA 2XHWA 3OL8A 5DQHA 2MTLA 1VRUB 1PBAA 2BOPA 5IWAJ 4FF3A 4QIFA 1BQMB 1K1SA 3DI6A 5EX0A 2HW3A 2WW8A 3DDKA 3PV8A 2A2CA 2NS1B 4A48A 4JYAF 4DX5A 4H54A 3KLGB 4BBYA 4FNIA 4ZVSB 2MZQA 3KJNB 2AEMA 2G4BA 4ECWA 4OX9F 2GIFA 3PYFA 1IBMJ 2XMUA 3CCLS 3W66A 4N8NA 2HURA 3W9JA 3N0VA 2DNPA 2PA3A 4RO0A 1WG5A 3G6ES 1VGYA 4ELVA 4DUYJ 1X5OA 4M5LA 2UXCF 1TKXB 2BEFA 2HK2A 2YH0A 4LF8F 1VBZA 3AD8C 1QAXA 4KBIA 3TJAA 2XCPA 1SC3B 2CG8A 3QJLA 4GKJJ 2XY5A 2QYGA 4X62J 1NXIA 1X5PA 4DQPA 4X4TA 4WP9A 1XMOF 3MI7X 5L8RC 2IFXA 4G1PA 2E9TA 3RG6A 4RW6B 3QWPA 3K5PA 2VG7A 1IVZA 1MNEA 1X4CA 3IAM9 1XEZA 2B9XA 4B3OB 2BJEA 1D9DA 1RWVB 3OXGA 1N34J 1KS2A 1S1XB 1G6BA 3PCOB 3UD4P 1RHQB 5LMNF 5FDLB 1XC9A 4ZIWA 2D3UA 2V9KA 2W4DA 3KMQA 2HQ3A 5CQGA 1R3NA 1AZSA 3HHKA 2AD9A 2YKQA 1H3DA 1NHVA 1JX4A 2P6TA 1HI0P 2RS2A 1RWPB 3JYTB 5I3UB 5HMWA 3SDEB 1FRXA 3NL0A 1S9EA 1SL2A 3W2WA 3FEXB 2HIYA 3CT9A 1DTTA 4I1TA 3HCXA 3TZZA 1XNRJ 2X51A 3PTWA 3RAQA 4ECSA 4F2RA 2DO4A 4MK7A 5C5JA 4ZCLA 4TKTA 1XMQF 1KC8T 3I5CA 2NQPA 3KOAA 1TMJA 2ZH3A 1XERA 1UL3A 3W2VA 2DK2A 1RWXB 1U1LA 4JI5F 3I55S 5ETRA 3R5AA 2XC9A 4OZ1A 4DR5F 4R0EA 4U6PA 4ES3A 5T14A 4TYAA 4ID5A 3UW1A 3I87A 1H6KX 3DLKB 5DG8A 1VQ7S 3ZTOA 3LP1A 1QY7A 3M2VA 5ETQA 4DV3F 1VBYA 4ILLA 4G1IA 2Y1IA 4DR1F 2R8HA 3EGWB 1EKRA 4DFPA 3AB4B 1FVSA 3CJ2A 2DR9A 1TL7B 3N6NA 3RR8A 4DPTA 2GJIA 2HNYA 1VIXA 3BGUA 3QATA 4V19J 1GK8A 3DN9A 2JHEA 1P9YA 3PEJA 3D0IE 4LFBJ 2LDIA 5JUMA 2EWHA 1NPPA 1NDLA 3OQ2A 2VPWB 1T3OA 1PYSB 4TU9A 4RNMA 2IJFA 4C8OA 2RSQA 1H73A 1NDCA 3AD9C 2CPJA 2CZ4A 1FX2A 3MAAA 2BJDA 1HQUA 3PX0A 2E66A 3MR6A 2A18A 2GGPB 3K57A 2LKZA 3CJ3A 1KLNA 2DNMA 2NREA 4H4MB 5K8PA 4J7CA 5ETMA 5HN0A 2BM1A 2CQDA 4CLZA 4DUZF 4FBUA 4DPOA 2HLUA 3CF5Q 1AYEA 4PYAA 3N6MA 1RUSA 4CNYA 2F9DA 1P1LA 2GQQA 4B3RJ 3DU5A 2V8GA 4ECTA 4ZLNA 4A8QA 1U24A 2UVRA 1XJWB 3I5AA 2X3GA 4M94A 4TQRA 1XTZA 2YNFB 2WOMA 4WIQA 1M90T 1NJYA 1TL1B 3OPKA 2L9WA 2A6OA 3HHLA 4ZVOB 4U7UK 5E3QA 2R7WA 2RHQB 1SL1A 1D8ZA 4EEYA 3MM6A 2DNKA 1WEYA 3G9CA 2K1RA 2E7XA 4NLPA 3IWXA 1SH0A 2YPZA 1SJFA 3PNIA 4KGVB 4ITSA 2IBKA 3MDFA 3GJSB 1BQNA 2K3IA 1K0TA 3M8QA 5LXYA 4CCHA 4AL5A 1UFLA 1RWOB 3ELHA 2B8PA 2M7SA 3R5BA 3DYAB 2B4UA 2CVIA 3PR5B 2FJDB 3NGSA 3W3SA 2QFJA 1SVDA 1HBOA 2HQFA 3CXCR 4K50A 1XIQA 2ZKUA 1VISA 6AT1B 2HMIA 3TX8A 4DR3F 3DOMA 2RQ4A 3I0SA 1RT1B 2BE9B 3QZ7A 4CLLA 1SPBP 2E1AA 1Y3KA 4JV5F 4CTAB 2K06A 3B8HA 3HF5A 4FYYB 4HI1A 3QFWA 1DQ8A 3DRSB 2ZOGA 3UDEA 5C24B 2E5HA 1HFEL 3AQPA 4FYXB 5F8GA 3T5LA 4Y0FA 4PG7A 3CCMS 1X4FA 2UUAJ 3H5SA 1F9EB 4NRTA 1RBOB 1RWMB 4DLEA 5DDPC 4KKOA 1O5JA 1N6QB 3KG0A 3M32A 2DNLA 4DEZA 1Q7LB 3CJSA 3GB0A 3DLEA 3WX4A 2PIIA 4CO2A 4NXNJ 4A8OA 3R2DJ 2LQ8A 3JTPA 4UOCA 4ED0A 4NMXA 1Y9OA 2W7OA 1UA1A 1HPZB 3MEDB 4RPFA 3GR1A 4F4WA 4DSIA 2C3MA 1C1CA 4L73A 2OELA 3MECA 3WC0A 2AW0A 3MMAB 1DTQA 3CCES 1NK5A 3C3LA 2YX4A 4Y34A 3HLUA 3NNCA 2GIRA 2ZNYA 2BDPA 3EGZA 5CD4A 2DEJA 1RT4A 3I9V9 1JLBB 3GV5B 2Q66A 4NA1A 1DBDA 5AJ3J 1TV6A 3CMQA 3ZZUA 1NB2A 2FJEB 4QU6A 4I6WA 2HBRB 3M1VA 2L48A 2Z0GA 2GJ2A 4P52A 2CPEA 1FJEB 3CDWA 4FN5A 2WHOA 4URQU 4XDCA 3VGUA 3HFVA 4F4YA 2M5YA 3RTVA 1XNQF 4M5DB 2XSJB 1M5OC 2HS0A 3R7BB 4QWAA 3P5TL 3AXKA 4F0HA 3V6KA 4LF2A 1JMTA 2GV1A 3DMJA 2G2YA 3T1AA 2BKNA 4USJC 5B0BA 2ABYA 4DV7F 5F3ZA 4ZPBA 3L95X 4OI3A 2QL9B 3KLEA 3ILJA 1YSJA 1PC4A 3UDCA 1S7HA 3WC2A 2EPIA 4NLSA 4DOZA 4C8YA 3EUNA 3IN5A 3J7AN 1F60B 3LP0A 1I94J 2FJBB 2K7KA 2C2OB 3T5HA 4M5JA 1RYRA 1B0VA 2CDRB 1KD1T 2LU2A 2CKWA 3PIOQ 1NZAA 3TVYA 3PG9A 1T3NA 2P9CA 3R27A 2YWKA 2HGNA 4NRUA 3G2XA 4WF9Q 2RQKA 4F26A 2IBOA 1PYTA 3NOCA 4WWSA 1S6QB 4ZJQA 2XLIA 3O1LA 4ZHRA 3G6XA 3L9ZA 4O3SA 3MMCB 1EAYC 4UF4A 4WYLA 4O3NA 2DY1A 5J1PA 3MTJA 4GRSA 2VFRA 1X31C 3PKYA 2YWFA 4LF6F 2OPQA 3IGNA 3AH6A 1IKVA 1I51B 2IC3B 1UJ4A 3UFCX 1EARA 1RDRA 3RAMA 2HQCA 2J0QD 2E44A 5CZXA 3IR7B 1L3TA 1QE1B 2EFVA 1NPKA 2DNGA 2W8LA 3CIMA 5D0HA 5AXLA 4C4WA 2KVQE 2GQ2A 3DLLQ 2J0WA 1SKUB 1D09B 2V0NA 4L75A 4U7UD 4WZMA 2RRBA 2L08A 2JLEA 4PR6A 1WG1A 3TJ8A 4A8KA 1ZAWA 3KK1A 5HANA 4PWUA 1Y00A 5B0AA 1TAQA 2DGTA 1FRIA 3H42A 1PC5A 1F3FA 1TVRA 2GMJA 4CYUB 4Z37A 1NEEA 4IQXA 4N7TA 2LA4A 2OI2A 5M2PA 2QGFB 3MAQA 3P4UB 3HDSA 2EXUA 4U8VA 2E9ZA 2E7VA 5AE3A 2G1HA 3IWNC 2RDJA 4WJBA 5B0FA 1O51A 4ED4A 2ILZA 3C16A 3GIKA 4DV2J 1IKWA 2IYGA 3MOJB 2D3ZA 1PKUA 3HKWA 3HZEA 2I38A 1LWCB 1B3TA 1FJGJ 3NS7B 2BRKA 3AA8A 4X66F 2YKNA 1XWLA 2DD8S 3GFZA 1D9AA 1FHTA 5K20B 2NLWA 4ETZA 4NEZA 3HVRA 2OUGA 1FVQA 1JLCB 2Z56B 3DOKB 5CABA 1NCLA 2ZBIA 5E5NA 4B9SA 4WXWA 4DX8H 2XO7A 2FTRA 3TW0A 5KG5A 3TUPA 4NCGA 1JNZB 3R8YA 4A8YA 1VQOS 3E51A 1F9HA 1S1WB 3QYYA 2NCKL 1N33J 5JVHQ 1TFWA 2C2DA 3BSAA 3KTQA 5KG0A 5C2CA 4YFUA 3KUEA 5DLFA 2KTQA 1X7VA 3N28A 4GVBA 3DRPB 4WE1A 2VHGA 4P6QA 2N3OA 2I9SA 1R31A 1ZA2B 4ZCMA 4O44B 2U1AA 4NOHA 4RUBA 2UXDF 2C2MB 5KG2A 1HA1A 4M1KA 1RTZA 3DI6B 2FLOA 3MPYA 3MCNA 4J9SA 1ZTWA 2HVIA 4USKA 5J2QA 1V3RA 4TY8A 4DXLA 4DDFA 1O8BA 1IBLF 4LREA 2DNHA 1Q0NA 1KLMA 3A3NB 4DR4F 4MK8A 2VKZG 1SXLA 2C42A 2AEJA 3FNNA 2DCLA 4DHVA 4CO0A 5MLCV 2KYXA 2Q6CA 1N36J 3ZZYA 4OZ2A 5U47A 1YJ9S 2QTWA 4U8YA 2HHPA 4HVZA 1A6LA 2AGQA 4OJGA 4XDDA 1S97A 1C1BA 4GKKJ 3GTYX 1MWYA 3RRKA 2I1RA 4X65F 5B08A 3UQSA 3MR7A 4CRJA 2VV5A 1TUWA 3H25A 1NNDA 1Q95G 4L6V3 4E0DA 3CW2C 4LRDA 4QCLA 1NSAA 4JYAJ 3DRRA 2KT5A 2GX8A 3NNAA 2VG7B 3H2LA 2BX6A 4P71A 2FJWA 4WFBQ 4EYIB 4OX9J 2MXYA 1CC8A 5HJYA 1WOOA 3R5CA 3FSYA 2DGWA 3K5LA 4ZN1A 2XMVA 3PRVA 1VK8A 1NHKL 4O3RA 5HL7Q 2UXCJ 1G7CB 1YGYA 4F2SA 4ZVRB 4LF8J 2WCXA 1IM4A 2YQ3A 5ETOA 5E0OA 3U7JA 5L1KA 1T03A 4UT4A 2R7TA 1SJ4P 3PDNA 5D78A 1FKPA 3TA0A 4N77A 2MZTA 4RLEA 1XMOJ 4DR6F 4NLUA 1S9EB 2QN6B 4ELTA 5HBMA 1DTTB 2VD3A 4C0HA 3IBWA 3LF0A 2AGOA 2BW7A 5DRKA 1TP7A 2H9ZA 4PXBA 1K0VA 2VG6A 2CADA 3PW7A 3EZ5A 4YP3A 4HDGA 5IC4B 2W01A 2OMOA 5A6PA 2L9NA 2KKHA 4O4GB 4IRDA 4C98A 3QJJA 2DGXA 5D0GA 3W5XA 1DQ9A 1DJ0A 2RRAA 1K1QA 2IIHA 3BO4A 3PFOA 3CO0P 1N5TA 3FGVA 3FRZA 2B56A 2YXLA 3RRGA 4HYKA 5B7WA 1FFWB 1M5HA 2E29A 2AYMA 3WDOA 4ID5B 3LA0A 3HSGA 2XZTB 4DQIA 3T9ZA 3FBFA 3LP1B 1B7FA 2FVCA 3M2VB 3BREA 2KHCA 1WKLA 1HNZF 2L3MA 4FS2A 1T9UA 1RBAA 2DJWA 2HNYB 4EFAC 3OTDA 4USUA 2O3DA 1H7XA 4ZVQB 4PG4A 2CNNB 2DNNA 1RLCL 1XMQJ 3CTRA 2CQBA 2AU0A 1KN6A 2WW4A 1O6XA 3MTKA 3NGUA 2GA7A 4DFMA 4AL6A 1WD6A 4J5OA 4JI5J 3C6TB 3W61A 2RU3A 4DR5J 4JI0F 1PBUA 4CM2A 1F5CA 3PEHA 2C2KB 1WG4A 4OL8A 2V4QA 3MAAB 1GMWA 4J9RA 1HQUB 2BJ3A 1UJ5A 2EFPA 3G71S 2K8GA 2CPXA 1AUSL 2EW9A 2IA0A 3R6GB 3EGVA 1UEUA 4FKXA 3PX4A 4ZVGA 5KFBA 4DV3J 3SCJE 2EBGA 2BE2A 4DR1J 3UCZP 2XBPA 5EX3A 4PRFA 3IBCB 2IM2A 2FGCA 1HMVA 4WFNQ 4ZA1A 3R1LA 1KFSA 1CG2A 2OLWA 3MMBA 2B9YA 2OPPB 5A8RA 3UCGA 1N5YA 3PO5A 5FLXU 4P75A 2B0GA 4J9QA 2HNDA 9RUBA 4XTTA 2WOMB 4LF7F 4K2XA 5HVGA 4DPWA 3W9IA 3MR2A 4DL6A 2HHQA 2W2PP 2W8KA 1M0SA 4L3NA 1AT1B 3ENAA 3FJ2A 2DISA 4ANDA 3QGHA 2UVUA 2J6TA 1LEOA 2ASJA 2BE7D 3LOUA 5KFUA 2LXUA 1VLOA 1CJVB 1RCOB 1BQNB 4IKAA 2NZCA 2W24A 4DUZJ 2YBVA 3GJQB 3M8QB 2ZE2A 1YDLA 2DH7A 1S79A 4LIWA 4MKBA 4N8OA 3V4MA 2HAFA 2IM1A 3IA0A 3G6YA 1HI1A 1P1TA 2PN6A 2V8PA 5DQIA 1HBOB 2AQ4A 3J7ZT 1PJ7A 3CSKA 5DG7A 3CCTA 3T1YF 1YJUA 9ATCB 2QMUB 3V2UC 3DOMB 1LW2A 2FGOA 3I0SB 2XO6A 2HQIA 1N32J 2YQ0A 3U1MA 3KK2B 5C7PA 3LPYA 1VQ4S 2RS8A 1FE0A 3HT3A 5GMKa 2M88A 3LAMA 5D4PA 3NAHA 5B0DA 1FKAF 3HXMA 4NLDA 1YJVA 5DGAA 4W90B 1TKZA 1RAHB 1AXQA 1YJWS 3B4MA 3L3CA 2DRAA 1RACB 2ZZTA 1K9MT 1UEVA 4KKOB 4P74A 1E6YA 1U49A 3M32B 2GMLA 1F9FA 5J2MA 3HFZB 2WSEC 3TVZA 1H38A 4KV8A 1VC0A 3DLEB 1WJ9A 3ZZOA 1FI4A 1PCAA 4LF4F 1WHWA 5KFQA 1NUEA 4IFYA 2XWXA 2DHSA 3JSMA 3Q8UA 1IKYA 3T1HF 2ACMA 4DR3J 1URRA 2KI2A 2XMTA 5L1IA 3U1NA 1V5VA 2Q43A 4YDXA 2LMIA 4NLXA 1DFDA 1C1CB 3EVOA 3BBFA 3MECB 4N47A 2ZH4A 2LFVA 1DTQB 1P6TA 5GMEA 4JV5J 2HHHF 5IQ6A 4TU8A 2RDIA 3R3TA 1ZOTA 4JB8B 4WFYA 2FVQA 2WVEA 3MCSA 2H5EA 4CT9A 2ZD1A 3KLVA 4LJMA 3H2UB 5KT7A 2MB0B 4HLBA 3ILLA 4RW7A 1TV6B 1KQFB 2KDOA 3QT6A 3IWLA 3D2WA 3A8IA 1HNIB 2LP4A 4IRKA 2J7WA 4DCPB 3M1VB 3CGIA 1CPZA 1UTAA 1B0TA 3ILOA 2OAUA 2MPUA 3HSJA 1FDNA 2A0FB 2QYCA 2APOA 3PACA 1FTRA 4AQYF 1URNA 1RE1B 1SJ1A 4USMA 2B8QA 2FC9A 3GYNA 5KOWA 3NKYA 2VONA 1U6ZA 5SZTA 1UVJA 4ZJOA 1MW7A 3OLAA 1TL5A 1Q8IA 4EYHB 3DMJB 1JXEA 4Y00A 3KMSA 4C8KA 3KLEB 4DL4A 3IR5B 2EEYA 3MM5A 4OYOA 3KHGA 4JV2A 2A2DA 4WTYA 3LP0B 5T7LA 2MZ1A 3GWCA 4ENOA 4J9KA 2V8VA 3ZO7A 4E2FB 4Y2IA 3Q23A 3A13A 2YWWA 3HSDA 2CJAA 3Q8QB 2FJAB 1ZA1B 2DHGA 3UDVA 1HBUA 5F8LA 1Z2ZA 1XNQJ 4ZVTB 3ZNUA 2ATLA 5KFWA 4YUDA 4C7QA 2KFNA 1V9OA 3H90A 4TYBA 1UAWA 5E2QA 1IR0A 1G3OA 3RW6A 4X64F 5BR8F 3OTOF 1Q5VA 1IQZA 3TX0A 4WFXA 5L38A 1R8BA 5E7OB 1FRJA 2H5IB 1ZPWX 4DV7J 5ETNA 3TNVA 1YG0A 4W4MA 2ATCB 2OPQB 2PMZD 4X4QA 2XI3A 1CC7A 4FYDA 4ZPCA 4WIIA 1BQXA 2XULA 2M0GB 1LOUA 2YH1A 1HW9A 3RJMB 1XR7A 1R89A 5K8OA 4RW4A 3HSZA 3T6BA 1ITPA 2D3OR 1RTDA 1Q53A 4RUHA 3MM7A 2XS2A 4W98A 2HBZB 1P9QC 3KK1B 5D15A 1BQMA 2H65B 2NYHA 5IT9Y 1U1KA 4F4XA 1N8RT 2JFDA 3LWMA 4WTOB 4K5RA 5DZ7A 5GAHU 4EO6A 4CIOA 2DEIA 2R8IA 1TVRB 3I56S 3PR4A 5DDOC 2KFYA 4P9SA 1ICEB 5FIIA 3Q8PB 3CPWR 4LF6J 1YITS 3FZBA 2DITA 1HIYA 2V6AA 2ZVSA 3HVAA 1RAJA 4AL7A 1IBKF 2W2OP 1FTCA 1HHTP 5KAKA 4EMDA 1Y0HA 1YJNS 2PGCA 1TKXA 4IO1A 1AA1B 4OYIA 1EQMA 1IKWB 4B08A 3K2YA 2B5JA 3K8WA 2NZ4A 3UR3C 3VAGA 2LVWA 2YKNB 1UFWA 1VRTA 1YBAA 2V2ZA 2JNJA 5B0GA 2XM3A 4QR1A 3NG8A 1VMBA 4OX8A 3RUBL 3RU0A 2YNHA 3H5UA 3T19A 4TU7A 4FP9A 5ETVA 1UZDA 4MMOA 2OO4A 5D0RA 1ULRA 1UKUA 1M5KC 4DSFA 4B3OA 2CQGA 4GMKA 4NCGB 5M2UA 1PG5B 1S1XA 1QM9A 1JQGA 2IM0A 1NJWA 4Y65A 3I4PA 3AQOA 2JJ4D 1Y5IB 1J5OA 2CUYA 4F4ZA 3AHPA 2CJBA 2KYZA 2FHOB 2LEBA 1S49A 1DLOA 4A8SA 4DPYA 1U4BA 2ERRA 1X5TA 4PWDA 4GVBB 1ROFA 1AUDA 2XLKA 1OQ3A 2BJ8A 3RYLA 4I7FB 4RWXA 4X66J 3SDEA 3QIPA 4UY8T 4RW8B 1IBCB 2JSXA 4K4VA 3ENWA 2DNQA 1KEKA 2GIQA 3W64A 4Q8FA 2R7SA 2NSCA 5J2QB 1JIHA 2JC1A 2XHCA 4KRWA 3TUIC 3M8PB 4ID8A 4C2MA 3CDAA 5DQGA 2MKHA 4C0BA 2PDAA 4OJ1A 5KFXA 1UVKA 1S48A 2G0JA 4USIA 1MU2A 3IM8A 3UN2A 2QT7A 4DFJA 2CQHA 1SQFA 1Y4ZB 3DRXA 1WEZA 3F73A 3PRDA 1ZTTA 3JTOA 4C97A 2OTLS 3TQEA 3MGJA 4LR8A 4PABA 1WSVA 3QZ8A 3CDBA 1H72C 1SH3A 2NXUA 1X5SA 3G6VA 1WTBA 4RR5A 1C1BB 3CULA 1PILA 3V5RA 4OYXA 3VWSA 1KFDA 4NLGA 3MHYA 3C19A 5CAAA 2UXDJ 4K4TA 4G65A 2CJ9A 1R0BG 3QT5A 2BJ1A 4U96A 2YVSA 4IOBA 2BVZA 4TLQA 2ASYA 1OYDA 3DRRB 5HROA 1ZM9A 4LIRA 1C0UA 2HZAA 3DOLA 3L09A 2DRBA 4LSLA 1R8AA 4ED2A 4JI4F 4DR4J 1FXRA 1VQSA 3CWJA 2BKPA 4OV1A 5E33A 2WVBA 2E1MC 5DS7A 4OJHA 4CLSA 3TUJC 4U7CA 1T94A 3NXZA 3GFHA 2CXEA 3D5MA 4DSEA 1RLDA 2RHSB 5F0UA 3IP0A 2JEGA 3QGGA 4F67A 1S0MA 4IFVA 1FKPB 4DR2F 1JJCB 3NGRA 1ZBTA 4QIWD 4HL9A 4X65J 4QPTA 3AJ1A 4YS2A 5HBMB 1KP6A 2KJVA 3N9UC 3OUYB 2VG6B 3HZGA 1Q5YA 4J9VA 1RA6A 3KHRA 2HLTA 3DLJA 4TN2A 2VJVA 7AT1B 1U26A 1IWAA 4XK8C 2R2TA 2UVVA 4M5IA 2MQOA 1BD6A 1RWNB 2OIHA 1WHVA 2UVWA 1S7IA 1JJHA 1C4AA 4RUAA 2ROEA 4LT6A 5EWFA 1NSPA 4USHA 4UZCA 2D9OA 4Y2KA 3GIMA 2ASDA 1YI2S 2Z8QA 2HRYA 1BLUA 4O0IA 4JI6J 3S8SA 2DXDA 1YJRA 4LFCF 2AGPA 1S1TA 4AXIA 4QW9A 2FY1A 1D8YA 4U95A 2XGPA 2ZH2A 2NXEA 2VA3A 4DR6J 2DT9A 4B9TA 3CJ4A 2Z2MA 2A1BA 1RU2A 2CPYA 3TAMA 3W8GA 1LWEA 2BOAA 4PG6A 3GIRA 2JDJA 2LEAA 4ECZA 4ED8A 3DDIA 2JVRA 2H4YB 3R2CJ 4YY3F 1B70B 4I68A 2FB0A 3N5FA 3LALA 2I5JA 4CZCA 1NK7A 1RT1A 4UW2A 2BQ3A 1U1OA 5IT0A 1VQ8S 2VG5A 1KHWA 2YY3A 3ZZPA 4CI0B 4RBTA 3GIIA 3HULA 4XO0A 3G96A 1U8SA 4KGXB 2BE2B 2VFSA 4KHMA 2RD5C 2BM0A 3KNAA 1HNZJ 4EUVA 3MMBB 1N5SA 1WNEA 2CJKA 4MT1A 5A8RB 1N5YB 2VPYB 2YKPA 4X2BA 2RDDA 1E6VA 4PXDA 1PO6A 1Y10A 2LLZA 3FEYB 4QPXA 5HAOA 4B9LA 1I1GA 5C2GA 3KG1A 4KGMA 3KHHA 5KFGA 1W2IA 4OX7A 3LPEA 4JI0J 1Q78A 3B6BA 4LF5F 3GR0A 2ZHOA 2GC8A 2AV5A 3MMAA 5A2QU 5B0CA 2I6WA 3N6LA 4UTGA 3RBEA 1HD0A 1QAYA 2MJUA 3R5DA 2BA9A 1HL6A 2ZE2B 1V3SA 3NEKA 3HX9A 1NKBA 3VAHA 2R8JA 2JEJA 1RYSA 3OL6A 2VF3A 1SUQA 2ZNZA 4TY9A 3EVWA 3I32A 2VDHA 1NK9A 5LL6d 1RAFB 2VFUA 4BLGA 4WK1A 3MD3A 2BYCA 3ZTRA 2HHSA 4LF7J 1B4SA 1OY9A 2HZCA 5H9FJ 5THWA 1HWLA 4C3LA 1Y11A 4IRCA 2HHUA 3TYTA 3ISZA 3H4DA 4EI2A 4UUXA 5KT4A 3V6JA 1HNWF 2UUCF 4ZCIA 2XMJA 2VH7A 1UZHA 3L7UA 1FNOA 1SB6A 4KFBA 2GQCA 3I0RA 1RU1A 2M8HA 3FBEA 4RL1A 1WDDA 5ETKA 4ZVFA 1SKWA 1S59A 2IVFB 1TKZB 3BQ2A 3CCRS 2IVYA 2RNEA 2YTCA 4EWTA 4V19X 4I69A 2LCWA 1E6YB 1WF0A 2OPRB 5J2MB 3O2IA 3CDUA 3GJRB 1RSCA 4ZP7A 1BGXT 4B9VA 4HACB 4KV8B 5CCMA 4MKVA 5EDWA 3O44A 4AXJA 4IFYB 4FYWB 4ZP8A 5BYQA 3T1YJ 1IR1A 4RBUA 3JSMB 1IKYB 3RBXA 2W4CA 5EN1A 3T9NA 1WWHA 1W7WA 3CVKA 3ET6A 1S6QA 4QZVB 2HFNA 2B9EA 1VK3A 5DLGA 2V4RA 2MZSA 2LDYA 4K4ZA 2W2MP 1VQLS 4M5NA 2F7VA 2CAJA 1OWXA 2RU9A 1IJFB 2ZD1B 2LXFA 5IXUA 2MGZB 4F0MA 1UVLA 2FVSA 5EUHA 3M9NB 3VGVA 4A8MP 4K4YA 4RW7B 2AF6A 2R7UA 5A76A 4HDHA 1QE1A 2W2NP 1FKOA 4AT1B 4CM0A 3BPDA 1N52B 3D66A 4NL5A 3GG1A 3F0NA 3ZXWA 3W65A 5SUHA 1FEHA 3BBBA 1WSRA 4LF4J 2VBYA 2MHEA 2XS5A 1DURA 1HYSB 3TR5A 2DH9A 3T1HJ 3SCIE 4H4OA 2RH3A 1KWMA 3CJ8A 2ZHAA 2V94A 2V4JA 4CO5A 3CNQP 3EGNA 4ETXA 2X3DA 2HHHJ 4RNFA 4B9NA 1NK4A 2V5HG 4LF9J 5EWGA 5DO2A 4MTPA 4JV0A 5LMUF 1WC0A 3MM5B 3BSOA 1Y3JA 2CZVC 4DJBA 4URSA 4R25A 1TKTA 3CMES 5T7LB 2GVZB 3JAMY 1WDTA 2P5VA 2KVIA 4WPAA 2UV8G 3BGOP 3NGDA 2AJ2A 5IOLA 2RE1A 3ETOA 3BKTA 2ZKTA 4ED6A 1S72S 1BY9A 4AQYJ 5BYSA 2IMWP 1IXKA 1T9VA 3CC4S 2DCUB 3HHNB 2BRLA 2UXBF 2DH8A 3MWBA 3VAJA 2F65A 4C48A 1FRMA 3JXOA 2G1DA 2E5GA 1N56A 2IRXA 1HNXF 2XMKA 2OD6A 3PW4A 1S9GA 4EBDA 3EYZA 3W5ZA 2XQCA 1X4HA 3UPFA 1S1WA 3U1LA 5J1EA 4ALZA 4DV4J 5CA5A 2J76E 3S01A 2QLBB 2VA2A 4RW4B 1RADB 3NP5A 4ZIVA 1G4CA 3CO9A 2DYAA 1RTDB 3MM7B 4I56A 3NCPA 4X4VA 2DR8A 2HFUA 4NLTA 4NLVA 5KFFA 3MR3A 4ZVEA 1TU0B 3UI3A 3A8KA 5HQLA 3Q86A 1HBMB 3IR6B 3TA2A 2PC6A 4X4OA 3OTOJ 1S99A 4JI7J 5IWAF 3RB6A 4JI2J 3D0HE 3M9OB 4O3PA 2IJNA 3HVTA 2ZBPA 4P72A 5ETTA 1TR0A 4USVA 3E01A 1REVA 4DZ6A 2R7QA 1F5BA 2JZ5A 4DR7J 2R7OA 3MUTP 4K7QA 4DS4A 3KDOA 1IBMF 2WB4A 5ETSA 1VQ9S 1JLAB 3SIPB 2HGMA 3BBCA 1JB0C 2IAJA 2ZH5A 2B5JB 4LR7A 3NMRA 4ZDNA 3P8BB 4F4AA 5C42A 2J6SA 1VRTB 1RHJB 3Q8VA 3QRPA 4BDPA 3ULHA 3AD7C 3LGHA 2YNHB 1B64A 4LVOP 2PEBA 3PRBA 4RKUC 3KYLA 3BGRA 2Z58B 4ZOSA 4HKQA 2VFTA 4K59A 1VS3A 1REGX 4M95A 1U09A 2XS7A 2FHKA 2H1YA 4K2JA 4MK9A 3AB2B 1RHKB 1SIWB 5D4LA 1J5OB 5GAGU 3GYGA 4A8WA 3NCRA 1DLOB 3M2UA 2HIQA 3PHEA 4ZMMA 3RR7A 3FCWA 3BYRA 4RNOA 4ECXA 2O66A 1HARA 4PWDB 2DHXA 4DSKA 1FESA 1U25A 4LFAF 3VAFA 2CA9A 5K14A 4QJVA 1PGZA 4NZ6A 2CFXA 4K0KF 1TL4A 3QIPB 1Z2LA 4HHJA 5KFCA 3A1YG 3EXCX 4DMZA 3MM9A 2ACYA 3N01A 2HKEA 3VALA 1U1PA 2DNZA 4F36A 2CJQA 3Q83A 2VPXB 4PG5A 4IH7A 3OR2A 1WHYA 4O4GA 4NCAA 3TA1A 3SSRA 1XNRF 1MU2B 1S5ZA 3THVA 3CJ0A 1NH8A 4QWEA 3THPA 1VR6A 3FCVA 1VDHA 4RW9A 4OFZA 2OFGX 3AOAA 3TVKA 1YTYA 4OLOA 4A47A 1U02A 5GADU 4OLPA 3B54A 4G6VB 3KJQB 3EX7B 1KQSR 3PX6A 2JX2A 3DU6A 4OYBA 2A10A 2GHVC 1M1KT 2W9BA 3QAUA 5E3RA 1H74A 5G4DA 2DHHA 4DSJA 2WRMA 3MF5A 4A8FA 1NSQA 1U45A 3DXBA 2Q3PA 3CE8A 1YRTA 4MKYA 5JVGQ 5HROB 1FO1A 2LYVA 1C0UB 3DOLB 4NWBA 4LSLB 3BKUA 3UO0A 4GVLA 4I67A 3MPVA 1WKJA 3C6TA 2M2BA 3PW5A 3Q2TC 3PJWA 1T8EA 3B78A 1ZM2A 3DHWC 4CLKA 4UZBA 1SC1B 1TK0A 4IFVB 4D3HA 1J5EF 1UEKA 3I5BA 2FJXA 4DQSA 3KHLA 1MN9A 4DL0C 3FMWA 3QIDA 3DLHA 2QX0A 1YBTA 3BDPA 5EGYA 2XSFA 2HK3A 2NXJA 2FLLA 2FHJA 4AFFA 6FDRA 1GTEA 1M1GA 5I3QA 4OYWA 1OPZA 1FERA 3PO4A 4KQZA 2OPPA 2AYGA 2FD2A 3H20A 4IDKB 2QMWA 2CPFA 2W1BA 5L39A 1S1VA 1Q16B 4JI4J 4ZPDA 1JK9B 4RNNA 4RU9A 1W2BR 2HS4A 1VQ5S 3HT0A 3F41A 4V1Ak 5L46A 4W92B 2YKAA 1RKJA 3X1LB 2HWIA 1FNXH 1D0EA 2AX1A 2DGUA 3P5BP 3T41A 1OIAA 1GAOA 2XG8A 4HH1A 3DGVA 3Q2SC 3QJPA 2E5LJ 2UUWA 3D1OA 1S1TB 4DSLA 1SJQA 3MD1A 1RA7A 3D3CJ 5J2PB 2HRUA 3HK2A 1AW0A 3HO1A 4N56A 1CJVA 2BJ7A 2DR6A 2OJ3A 4C3KA 2OH2A 3I9ZA 1QSYA 1T02A 1Q81T 2WVFA 2VUGA 4IUFA 2XZDB 2C2ZB 2HYIB 1RISA 3TAMB 1LWEB 3CCUS 4F7VA 1C4CA 4Z7CA 4KIAA 3RRHA 1TQLA 4Y3CA 1IJEB 1PJ6A 2KN4A 4GC6A 3FQLA 3HP6A 4U67Q 2GW8A 1UETA 2ZWPA 2EFOA 2EK1A 1WKKA 2A3JA 2I5JB 2VDIA 4QWCA 3C6UA 1LK7A 1UW4A 2PSZA 3FBBA 4OZNA 2F4FA 2VG5B 4CT8A 2ZUGA 3KK2A 1WOPA 4CH0S 4LFCJ 5IT9U 3X3UA 4EU0A 4ED7A 1Q7YT 2BUNA 1FJCA 4R8UA 1SIZA 2H54B 1MG7A 4CP5A 1NZ8A 3ZTPA 1OY8A 2O5DA 4FVCA 1DZ5A 2B51A 4ZCKA 1KTQA 1RBLA 4C11A 2QLXA 3BB5A 5DM7Q 1CEZA 3O6QA 3DDNA 4M5KA 4IR1A 4NA3A 3LUYA 3U27A 3T5JA 4QIGA 1E6VB 4YY3J 3O3LA 1HWJA 3EICA 2DKOB 3CB4A 3HPOA 3OVBA 2FUG9 2ZHBA 4OHVA 1OY6A 2RAQA 2MZRA 4AE5A 2N4DA 3KJVA 1NK6A 3MZIA 1HWIA 2JFKA 3QRRA 5KG6A 4MYUA 4LMZA 1M5SA 2QLWA 1SQEA 3H59A 2ZJPQ 1RAGB 3I6PA 2RUSA 3PY8A 4F50A 3PZPA 1AB8A 4JUZA 3WBZA 1WTFA 3IO1A 2Y8WA 2QIFA 2XYHB 3PYDA 1SL0A 2OMLA 4KY3A 4B3SF 1U47A 3K0JA 2WTFA 2W9AA 3P3DA 1SUQB 1CJKA 1VRQC 1HNIA 3VGSA 1B0PA 4URGA 2BKOA 4FXVA 3CCVS 1O0PA 4B3TF 3AODA 3QNWB 1ZPVA 2ZUAA 2HVDA 5KFYA 2J5AA 5DDQC 2Q1LA 3EE3A 2NUHA 1R7IA 2VOPA 2ZVIA 1X4DA 1RK8A 4CLYA 2RJZA 4KSEB 1S0VA 5D77A 2HFOA 4NEYA 3EXYA 1RCXB 4LF5J 3RGIA 3R97A 1IR2A 2QSWA 1W26A 2UV8A 4DBQA 1HLWA 4KFBB 2RRNA 3I0RB 3K58A 3MR5A 1OS5A 4ES2A 4HT7A 4EBEA 3FCHA 1VQKS 3VCDA 5H9FK 1U2FA 3HD2A 1YJ7A 3P6YC 5ETLA 2R2SA 5J1NA 4C8NA 3BQ1A 3OBIA 3FKBA 4CLFA 1QSLA 4OI0A 5CD4H 3CUNA 2XYGB 1VOMA 4IH5A 2QC3A 3US5A 4NYZA 3ET6B 5CZVA 2VC1A 3OXFA 1J27A 4ZLPA 1HNWJ 4BC7A 2UUCJ 1IQTA 3RW7A 3AJDA 1NSKL 2FDNA 2B4OA 5K8NA 4QWDA 4DZDA 1GXUA 1CSJA 3A8EA 4I4BA 4M5MA 3OHAA 2XMWA 3PJXA 2EFQA 3VGTA 1JLEA 2B4PA 3CJKB 2OP5A 2MKIA 4OZLA 1FKOB 3BO3A 1NU4A 2QLJB 4QR0A 3CCZA 3Q8YA 3Q0AA 3CD6S 2F8MA 3IRXA 3BM7A 2DPIA 3EMTA 4X4UA 3MAHA 1Q82T 3FK4A 4HI2A 4MIBA 2QRRA 2ZBCA 3LWLA 3UN5A 3TQ1A 1S77D 1RT2A 2V2KA 2PFFB 4ZVHA 4H4OB 4LF1A 3Q24A 2J0XA 3GSDA 4PAAA 4USWA 3LGNA 1YZ7A 2V4JB 2IHR1 4NLWA 5ADZA 3W63A 3D6MB 2GCFA 2UU9J 1FFSB 1NAQA 4I6YA 2K3KA 1R43A 3T5KA 2NPIA 1Q8KA 2XCAA 2EC0A 1PAEX 1GH8A 1TKTB 3GPAA 4QYZJ 2F3JA 2KRRA 3OD2A 3LAKA 2C28A 5KFTA 2D41A 7FDRA 2P2CB 4EGLA 2ZH6A 1RJJA 2CWKA 4DV5F 2C1EB 1S0NA 1YJTA 5KFEA 4PXCA 5A2QY 2H48B 1NRKA 4DV2F 2JRSA 3K5OA 4R0JA 3QSYB 2VBWA 3MEGA 3V6DA 3H5XA 3LQVA 4I2PA 2PA8D 2WBRA 4X4PA 1D1UA 1HQEA 1Z1ZA 2V68A 5IZHA 1EZZB 3D67A 4PQUA 5KG1A 1S9GB 2AX0A 4EO8A 2M9KA 1NKCA 3NOGA 1GMVA 5A8WA 4DF4A 5J1EB 3LO3A 1BWEA 3F44A 4IOAQ 4FF1A 3DLBA 3SEOA 1H0HB 1ZAXA 3TEGA 1NK0A 1QVFR 2QL7B 1RABB 3LTOA 1G1XA 4NMLA 3VZHA 1R0AA 1V5IB 5DJBA 4ZITA 4XAKA 4I7FA 2CQPA 4RW8A 4ED1A 2VICA 2GAHC 4YHHF 2UXBJ 1R6VA 3DGPB 3PW0A 2R3VA 1NJZA 4DF8A 4CLTA 2VBZA 4KTQA 5CYJA 3R6LB 5C25A 2LQBA 1H2TZ 3FRYA 3M8PA 3D28A 1VYAA 3T6JA 2GVDA 2HWTA 1HNXJ 3QSIA 1WF1A 3HVTB 3LANA 3C66A 4NCBA 3E01B 1NBEB 1REVB 3QQCD 2IJRA 1JJ4A 4WFAQ 2Z2YB 3BN7A 2UUTA 2VB6A 3MMJA 1PSDA 2MQPA 2QEXS 4G1QA 2RKIB 4JI8F
chains in the Genus database with same CATH topology
3D3BJ 4LFBJ 4LF8J 3JAMU 5AJ3J 5A2QU 4X66J 2UU9J 4DR3J 3OTOJ 4AQYJ 4KYZA 4B3SJ 1N36J 2MTLA 4JI7J 1HNWJ 2UUAJ 2UUCJ 5IWAJ 2MEWA 4JI2J 4B3MJ 4YY3J 5FLXU 4LF4J 4NEYA 4DR4J 4B3TJ 4RJVA 4JV5J 4LF5J 2F4VJ 2VQEJ 4JI8J 1XMOJ 3W1YC 1N33J 2MQ8A 3T1HJ 1N34J 1N32J 2ZM6J 4GKKJ 1J5EJ 1XMQJ 4JI6J 4DR7J 4NXMJ 2UXBJ 5LMNJ 3J81U 3T1YJ 4NXNJ 1HNZJ 1IBMJ 3R2DJ 4JI4J 2HHHJ 4JI1J 4JI5J 3J80U 4DR6J 4DV4J 4JYAJ 4V1Ak 4HHUA 4DV2J 4LF7J 4B3RJ 1XNQJ 4LF9J 4DUYJ 2UUBJ 4DR2J 1HNXJ 4DR5J 4X65J 4LFCJ 4YHHJ 5IT9U 4DV6J 4LFAJ 4OX9J 5LMUJ 1FJGJ 4DUZJ 4X64J 2KL8A 4KY3A 4JI3J 5BR8J 2KVQE 4LF6J 4DV0J 4DV5J 4K0KJ 4PWWA 4KHPJ 4DV1J 3J7AN 4NEZA 2E5LJ 1IBLJ 2UXDJ 1I94J 3R2CJ 4DV3J 3IMQJ 1IBKJ 1HR0J 3D3CJ 1XNRJ 4GKJJ 4DR1J 2VQFJ 4DV7J 5LM7E 4X62J 4JI0J 2UXCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D3B J;  4LFB J;  4LF8 J;  3JAM U;  5AJ3 J;  5A2Q U;  4X66 J;  2UU9 J;  4DR3 J;  3OTO J;  4AQY J;  4KYZ A;  4B3S J;  1N36 J;  2MTL A;  4JI7 J;  1HNW J;  2UUA J;  2UUC J;  5IWA J;  2MEW A;  4JI2 J;  4B3M J;  4YY3 J;  5FLX U;  4LF4 J;  4NEY A;  4DR4 J;  4B3T J;  4RJV A;  4JV5 J;  4LF5 J;  2F4V J;  2VQE J;  4JI8 J;  1XMO J;  3W1Y C;  1N33 J;  2MQ8 A;  3T1H J;  1N34 J;  1N32 J;  2ZM6 J;  4GKK J;  1J5E J;  1XMQ J;  4JI6 J;  4DR7 J;  4NXM J;  2UXB J;  5LMN J;  3J81 U;  3T1Y J;  4NXN J;  1HNZ J;  1IBM J;  3R2D J;  4JI4 J;  2HHH J;  4JI1 J;  4JI5 J;  3J80 U;  4DR6 J;  4DV4 J;  4JYA J;  4V1A k;  4HHU A;  4DV2 J;  4LF7 J;  4B3R J;  1XNQ J;  4LF9 J;  4DUY J;  2UUB J;  4DR2 J;  1HNX J;  4DR5 J;  4X65 J;  4LFC J;  4YHH J;  5IT9 U;  4DV6 J;  4LFA J;  4OX9 J;  5LMU J;  1FJG J;  4DUZ J;  4X64 J;  2KL8 A;  4KY3 A;  4JI3 J;  5BR8 J;  2KVQ E;  4LF6 J;  4DV0 J;  4DV5 J;  4K0K J;  4PWW A;  4KHP J;  4DV1 J;  3J7A N;  4NEZ A;  2E5L J;  1IBL J;  2UXD J;  1I94 J;  3R2C J;  4DV3 J;  3IMQ J;  1IBK J;  1HR0 J;  3D3C J;  1XNR J;  4GKJ J;  4DR1 J;  2VQF J;  4DV7 J;  5LM7 E;  4X62 J;  4JI0 J;  2UXC J; 
#chains in the Genus database with same CATH topology
 2AHO B;  3BN4 A;  2IAJ B;  3WIU A;  1N36 F;  4LRA A;  3AAW B;  2R2R A;  5C42 B;  2GAG C;  1YVF A;  1OSD A;  5JXS A;  3GIJ A;  5H1S V;  2YWG A;  2Z57 B;  2QG9 B;  4RX6 A;  1F3V A;  3TO8 A;  3KLF B;  5LXR A;  4B9U A;  3IS9 A;  3OL9 A;  1ZM3 A;  2E9R X;  3BGR B;  2R8G A;  2QLF B;  3TEH B;  3WIV A;  1VI7 A;  3KNG A;  3AA9 A;  1HWU A;  2ZZN A;  4WKR A;  4A4J A;  3M2U B;  4ZVP B;  1UCN A;  2EKN A;  4DL5 A;  4YQW A;  1FRH A;  3ICL A;  2BBE A;  1I3O B;  4OZ0 A;  1TTH B;  4DCO B;  4C3M A;  5F0W A;  5K14 B;  2CQC A;  4WYW A;  2CNO B;  4DG1 A;  2Y9H A;  2B9W A;  3OV7 A;  5AXN A;  1QJH A;  1UFK A;  1AFI A;  3QRQ A;  1YX2 A;  3FSI A;  3MM9 B;  3VV2 B;  3OUY A;  3ZFV A;  5GVQ A;  3D0G E;  3O5T B;  3RBZ A;  3LH2 S;  4CO1 A;  2Z30 B;  3WZ0 A;  3CD7 A;  3KG4 A;  2IDE A;  1T9W A;  3JTN A;  3OR2 B;  2YKO A;  1JWW A;  3GP9 A;  4OHY A;  5FJ4 A;  5HSP A;  4CDI A;  5LMN J;  1D3W A;  1ZYQ A;  1L3K A;  4Q0B A;  1ZAV A;  2OHD A;  2W4P A;  2PO4 A;  5L1L A;  2DR7 A;  4RW9 B;  4RWW A;  4NYO A;  2M8D B;  7FD1 A;  1ZM4 A;  5A8K A;  3M8S A;  4YB6 A;  4YN3 B;  4MFB A;  1R8P A;  4NA2 A;  1RT6 B;  4LFA J;  3JSY A;  2W9B B;  5F8I A;  4RU2 A;  3QMQ A;  2KRB A;  3V4I A;  2QV6 A;  4K0K J;  4IO9 Q;  1H2U X;  4ZP9 A;  4O3Q A;  3QBC A;  1ZET A;  5F8M A;  4AUK A;  3UCU P;  1U0H A;  4ZPA A;  1BMQ B;  4FF2 A;  3VZI A;  3C46 A;  2LXI A;  5I42 A;  1UVI A;  2ZH7 A;  1WHX A;  1FXD A;  1X9M A;  4F8R A;  2N4C A;  4ICL A;  2R42 A;  2WAQ D;  2Y1L B;  5KFM A;  2CQI A;  1T05 A;  1RQ0 A;  3M8Y A;  4G3I A;  3QT7 A;  3BGF A;  1FE4 A;  4BWM A;  3G86 A;  1Q8B A;  2XNR A;  4ECY A;  4TLR A;  1KSP A;  2UUB F;  1Y5N B;  1NM2 A;  5CYM A;  2GZO A;  3CC7 S;  1QAJ A;  1YZ6 A;  4OQJ A;  4D3G A;  3BJY A;  4UQT A;  2V50 A;  2X1G A;  5EHH A;  3J7A 1;  1QUP A;  5DM6 Q;  3GSI A;  2CJY B;  3BQ0 A;  1RKI A;  2W9C A;  4LR9 A;  2CIM A;  1X4G A;  2ALZ A;  4PUO A;  3H2V E;  5LSO A;  2V67 A;  1WEX A;  3BGL A;  1JJ2 R;  5E41 A;  3TP2 A;  5F9L A;  4Q7A A;  4PEO A;  2LEC A;  1SC6 A;  3H7H B;  2ZOM A;  3D1Q A;  3OJU A;  1P8G A;  3JSB A;  2QE5 A;  1VHF A;  5MAO A;  1S1V B;  2Y0S D;  3EM1 A;  4NZ7 A;  2XWY A;  3L4B C;  1HW8 A;  1JLF A;  3IFE A;  3JAM U;  4BHQ A;  1K47 A;  2VBX A;  2CNL B;  1RXO B;  3EVM A;  2H3E B;  2MLY A;  5K8M A;  1YQH A;  1GQE A;  1X8D A;  5HJX A;  1WC4 A;  3UWT A;  3QO9 A;  1U7L A;  2VU5 A;  2G2Z A;  1FCA A;  4KPC A;  4Q5V A;  3J80 Y;  1PIE A;  1JLG A;  1J5E J;  1KOO A;  4LRB A;  2OKQ A;  5KT2 A;  2P6S A;  3BF4 A;  4A46 A;  5KTQ A;  1T11 A;  5AXK A;  2YNG B;  4X4N A;  1C0T A;  4OHZ A;  2VZ9 A;  3D6F B;  2G2O A;  4CLW A;  3RAX A;  2OGU A;  2VOO A;  3MEK A;  2JOQ A;  1DAR A;  3BYP A;  1LW0 A;  4DCJ B;  4P2X A;  2OD4 A;  1XMB A;  4FBT A;  3D6T B;  3MFI A;  1YRX A;  3PJ9 A;  3CC2 S;  4ZS6 A;  3QLH A;  1OJ4 A;  2FQQ B;  1U6B A;  2LEP A;  3HJF A;  2FC8 A;  1LWF A;  2WSF C;  3C6U B;  4HTI A;  2RF2 A;  3QAE A;  2EVZ A;  3NWG A;  2EBE A;  3F56 A;  2EG2 A;  1Z4U A;  5D4N A;  2MKK A;  1NME B;  4R8U B;  2KXN B;  1MN7 A;  3ZZZ A;  1N32 F;  3M8Z A;  4KH1 B;  2HVZ A;  1B99 A;  1UVN A;  2ILY A;  1KR4 A;  1FDA A;  2DGQ A;  3JQM A;  3V81 A;  2MMY A;  4C8M A;  4C11 B;  1LNQ A;  3GG0 A;  2OPR A;  2QZ8 A;  5HQM A;  3K59 A;  1KVK A;  4HAC A;  3PYG A;  3VR1 A;  4PPD A;  3HVW A;  1DHM A;  1RZM A;  1RB0 A;  1FT8 A;  1SI9 A;  3QPI A;  2W2Q P;  4TVA B;  3B82 A;  1EP4 A;  4QOT A;  3KJV B;  3H40 A;  1VQP S;  2FHM A;  3M30 A;  4QQB A;  3SXL A;  3CCQ S;  1L3U A;  1AFJ A;  5HLF B;  2I0X A;  4OZ5 A;  1VQM S;  1D9F A;  4YR3 A;  3FC9 A;  1CJU A;  2MGZ A;  2KG0 A;  3OSN A;  2FHJ D;  4DL3 A;  1F0X A;  4KH0 B;  3KJF B;  4BCA A;  4OYZ A;  1HWK A;  2WON A;  2HHT A;  4WU3 A;  3PHT A;  1MRO A;  1CJK B;  2CZ9 A;  2WB1 D;  3ZNJ 1;  4UQG A;  2DRD A;  1MWZ A;  3NBP A;  2EC2 A;  1RT3 A;  1S1U A;  3THT A;  2L41 A;  1HYS A;  3GV8 B;  1RHR B;  3H0P A;  1OYE A;  1VJQ A;  1Q79 A;  2HZV A;  3U02 A;  1NKE A;  3SSS A;  2B3T B;  3BZQ A;  2CYY A;  1VCT A;  4DU8 A;  1T95 A;  3TAN A;  2WZ1 A;  2DBB A;  2X1B A;  4OI2 A;  2B7B B;  1FDD A;  4YB7 A;  3PYE A;  2DPJ A;  3M2R A;  3CCW A;  6FD1 A;  3C15 A;  3TZW A;  3E8O A;  2I8E A;  3RB4 A;  3FSX A;  4B3S J;  1U8W A;  2GVZ A;  4YR0 A;  2YX7 A;  5M2R A;  3ILI A;  5KFN A;  4LQ9 A;  4B3T J;  3OTB A;  5KFS A;  3I96 A;  3K8V A;  3SMZ A;  4ZJL A;  2ZH8 A;  2BV3 A;  1VBK A;  2XGQ A;  3KLI A;  2VC0 A;  4K4W A;  1FF2 A;  1LFW A;  5CCL A;  4OYP A;  3LP2 A;  1TFY A;  1HNV A;  2W25 A;  4K4X A;  4WFZ A;  5I4M A;  1LWX A;  1TMM A;  3CJQ A;  4IG0 B;  1N0V C;  1MMN A;  2GJF A;  5KFZ A;  2HVE A;  1CUL A;  1TUV A;  4HH0 A;  1VQY A;  2KT3 A;  3M8W A;  4CLU A;  2BJ9 A;  2CDQ A;  2NPF A;  3SQO P;  4I6A A;  2COL A;  4J9N A;  3IG1 B;  3HM9 A;  1LQ9 A;  1JLE B;  1GX5 A;  2R9L A;  2G13 A;  4B3M F;  3UN3 A;  4JBC A;  3UD3 P;  3DCA A;  1HKA A;  1RT5 A;  5CHC B;  4ECR A;  3GV7 B;  4DPX A;  4C8L A;  4ZLJ A;  5J2N B;  2LQ5 A;  1GXT A;  4ZN3 A;  5IT4 A;  3H4B A;  2VPZ B;  4KYZ A;  3CCJ S;  3IRX B;  2MKC A;  1UVM A;  1CS4 A;  1HD1 A;  1TL3 A;  3A4T A;  1RT2 B;  5E3P A;  3GE9 A;  4PQA A;  5KFK A;  1IN0 A;  1WC6 A;  3OTC A;  3J81 j;  4CWB A;  3JS9 A;  1HBM A;  2NR0 A;  1NHU A;  1S76 D;  2BQR A;  4J37 A;  1MLA A;  2J0S D;  1K44 A;  3PKM A;  2CQ1 A;  1DY3 A;  2PFD A;  4P73 A;  4ER8 A;  3S1T A;  1RHM B;  1ZZN A;  1RTH B;  3GFY A;  3M6W A;  1RGV A;  3NGK A;  1M5V C;  3BR9 A;  5HK4 A;  1FXL A;  3AOC A;  4ILM A;  3AFG A;  4Y6I A;  4HHH A;  1NLK L;  3DLG A;  3EZO A;  5KFA A;  1JLA A;  4KE5 A;  3GZ7 A;  3HHD A;  5F41 A;  5CYQ A;  3MEE B;  4PPZ A;  2AZ1 A;  1K73 T;  3W9H A;  4J9P A;  1JKH A;  2X7I A;  5F3T A;  3TI0 A;  4F3M A;  2FJV A;  4F0K A;  4IR9 A;  5B0E A;  2P8I A;  2RVJ A;  3MEG B;  1DRZ A;  3V6D B;  1SH2 A;  4I2P B;  2XEX A;  5HI7 A;  3SCK E;  1GEH A;  1HQE B;  1I6J A;  1RT7 A;  2KG1 A;  4PQU B;  3G82 B;  2M4M A;  1DQA A;  4QYZ K;  2XY6 A;  3D9B A;  2CQ3 A;  5AT1 B;  2J6U A;  5A8W B;  3ZTQ A;  2O1P A;  4DV0 F;  3R7S B;  3NS6 A;  3EWG A;  1QTN B;  1SC4 B;  2FY8 A;  1RTI A;  2ZDP A;  2F9J A;  4PYD A;  1RWU A;  1T0T V;  2D9P A;  1R0A B;  2J9D A;  2CNK B;  4BC9 A;  3DRY A;  4DV5 J;  1QSS A;  4PWW A;  5G0R A;  1MML A;  2YPY A;  1R6Y A;  4O0N A;  2V34 A;  2BXJ A;  1ACM B;  5C25 B;  3GCX P;  3R7N B;  2GVD B;  1FJ7 A;  2KXF A;  1XN9 A;  4X4S A;  4IG3 A;  2BAC A;  2CVE A;  3SV3 A;  4NI2 A;  5KFV A;  1EJ7 L;  1VQ6 S;  4WU2 A;  2CG4 A;  4LBI A;  3W1Y C;  3MOZ A;  4LSN A;  1FDB A;  2OPS A;  4WP3 A;  5JMN A;  2BAB A;  1WC3 A;  3WHI A;  5F8N A;  4G1Q B;  2F1F A;  4DV6 F;  1YLX A;  4KR0 B;  4JI3 F;  3JSR A;  2R7X A;  1TAU A;  4OHX A;  3C8Y A;  1SV5 B;  2K7J A;  1U6F A;  1YWX A;  3H98 A;  1W25 A;  5IFM A;  3PIP Q;  4N76 A;  4YHH J;  4Y2M A;  3IS9 B;  4B02 A;  2DY9 A;  1UP1 A;  3I82 A;  2CPH A;  5F8J A;  1IBL J;  5CXT A;  5A0Y A;  3QGP A;  4KGZ B;  3FFI A;  2ZM6 F;  3O8W A;  2CPI A;  1RWK B;  2NXC A;  4CQ1 A;  4O4R A;  1YKW A;  3J7Z 5;  4JI1 F;  4JI8 J;  4KPY A;  5KFR A;  3RB0 A;  4F02 A;  2KZZ A;  2GNK A;  2IYI A;  5ETP A;  3DXS X;  2Q6B A;  4DG1 B;  1JLQ A;  2XY7 A;  3BKF A;  4FPR A;  2RUG A;  4PG8 A;  3KDN A;  2J9E A;  4WK3 A;  1QUV A;  2QO3 A;  4L72 B;  2YNI A;  3ZZ0 A;  5I3P A;  2WK4 A;  4H4K C;  2OEM A;  3HD1 A;  3MPU B;  4Q2L A;  1X4E A;  2HFS A;  5A6W A;  4J9M A;  2IRU A;  3KLH A;  2V8D A;  2IM3 A;  3BO2 A;  5IQQ A;  1U2C A;  2JLG A;  4PZV A;  1MMD A;  4IDK A;  1FRL A;  3VHQ A;  1B7Y B;  3FUY A;  2J9D E;  5D0E A;  2FIU A;  2C3U A;  2UZA A;  3MCM A;  3M6U A;  3BV8 A;  3GIL A;  1VIO A;  2J8S A;  4Q0B B;  2HHV A;  4UOF A;  1ARO P;  4JP8 A;  4EZ6 A;  2PT0 A;  3OTE A;  2WVD A;  2XZW A;  2QFI A;  5A8K B;  1BXN A;  4MFB B;  1WEL A;  4DUT A;  3NCQ A;  3R9L A;  1XR5 A;  4YR2 A;  3D6H B;  5LOQ A;  2CRL A;  2HBQ B;  5J2P A;  2Y3Y A;  1JNR B;  1RI7 A;  1VBX A;  5LJ5 Y;  3V4I B;  1Q8L A;  3W7B A;  2MQ8 A;  1IWG A;  3MM8 A;  2FZG B;  4F4K A;  1AZS B;  2ADC A;  4JI6 F;  1U0H B;  5L9N A;  3TZY A;  3TWZ A;  2DGO A;  4DFK A;  4HR2 A;  4P7T A;  3FBC A;  3WX8 A;  5I42 B;  3W2W B;  2BR0 A;  1KVJ A;  1RAA B;  3C14 A;  4ICL B;  1T9X A;  3S7R A;  2VQF F;  1BE4 A;  3CJR A;  1T05 B;  4KJI A;  3NAI A;  2K2P A;  2IA6 A;  2NSB A;  1F1B B;  5CYM B;  4ZPT R;  4X84 A;  5D6G A;  3IMQ J;  3W2V B;  4Q43 A;  2B6A A;  5HO4 A;  5KT3 A;  2VIH A;  5HQ8 A;  2W9C B;  2F40 A;  3M9M B;  2OEJ A;  4PUO B;  2XMM A;  2MDA A;  1FWP A;  5HMZ A;  1NH7 A;  3NS5 A;  2PI5 A;  4E98 A;  3J81 Y;  4ZLL A;  5GAH I;  1XK8 A;  1FWL A;  2H4W B;  3L7P A;  2HHW A;  1FA0 A;  3D68 A;  3EDQ B;  1IUJ A;  1VJW A;  2DHA A;  3BPS P;  3TAP A;  2R8K A;  1WOS A;  2CJX B;  1X0F A;  3AT1 B;  2ZFH A;  2MKJ A;  3IXQ A;  2LU1 A;  3UR0 A;  5DG9 A;  1JLF B;  2I2Y A;  8ATC B;  1Q1K A;  4DV1 F;  3KXD A;  5KFP A;  2VFV A;  2UUB J;  2KHD A;  3QO9 B;  3H8Y A;  1J2V A;  2IMO A;  2V69 A;  1TKD A;  5KT6 A;  1KON A;  2KL8 A;  1RTJ A;  4ZPW R;  1JLG B;  4RNH A;  2KM8 B;  5JJB A;  1X4B A;  1CLF A;  4OI4 A;  1U1N A;  2HGL A;  3DC2 A;  2F63 A;  1C0T B;  1PYO B;  3GYX B;  5GMD A;  3D3B J;  3TOQ A;  4KO0 A;  2IDL A;  4LRC A;  1U2R A;  2CPZ A;  3OFE A;  3TAR A;  1XQI A;  1Q4R A;  2C3O A;  5IC6 B;  4NXM F;  2B4V A;  3BSN A;  4GO5 X;  3BR8 A;  1I5O B;  1LW0 B;  4O3O A;  1RHU B;  1IKX A;  3NLC A;  4M5H A;  2NYI A;  3M4X A;  3QLH B;  1EX8 A;  3SZ2 A;  1K8A T;  1DAX A;  5D3G A;  1UWB A;  2E1P A;  3A8J A;  5HP1 A;  2E1R A;  4QW8 A;  4CH1 A;  1LWF B;  3QWU A;  2RF2 B;  3VVU A;  4PXE A;  2JL9 A;  3POT A;  5HMX A;  3SI8 A;  1EET A;  2ZEJ A;  1EIY B;  4KC5 A;  2ROP A;  2ZDO A;  3HHL B;  3SQG A;  1SKS A;  4ZVU B;  4BWJ A;  2YQ1 A;  1KQG B;  3EPI A;  3MM6 B;  2HNZ A;  1FK9 A;  1KNZ A;  2K1R B;  3V81 B;  5LSR A;  1TUG B;  2AEF A;  4DPU A;  2VQE F;  3AOB A;  2GHP A;  2NXN A;  3HFK A;  3E2E A;  1ZZF A;  3OVA A;  8AT1 B;  3M05 A;  1L3V A;  3FEZ A;  1HBN A;  1GXL A;  5DET A;  2YKM A;  2QL5 B;  1FRK A;  4OZ3 A;  1X9S A;  4DQQ A;  5IM0 A;  1EP4 B;  2B7C B;  4P7V A;  1NK8 A;  1YIJ S;  2DXE A;  3M30 B;  1QD1 A;  1NDP A;  2HMI B;  4YDD B;  4QWB A;  4DX6 A;  3BS9 A;  1WOR A;  3GJT B;  3CD5 A;  3GON A;  1NDK A;  1CJU B;  2KT2 A;  4OHW A;  3QFH A;  1CJT A;  1A7G E;  3CJK A;  2F8H A;  3RBD A;  1HR0 F;  1UMJ A;  4Q45 A;  3W8P A;  4L74 A;  2HFZ A;  4OV6 A;  2WON B;  1JXV A;  2U2F A;  1OO0 B;  3OSP A;  3DM2 A;  1MRO B;  5CH7 B;  4Y28 C;  2ZWO A;  2D3O 1;  2Y1J A;  3B4D A;  4ANC A;  3NBP B;  3GLJ A;  1SQG A;  1RT3 B;  1S1U B;  3R5J B;  1N5Q A;  5GAE I;  2F4V F;  2MJN A;  2AWZ A;  2QA4 G;  4F3O A;  1SJR A;  2LQ9 A;  3VAM A;  4PCQ A;  3N5B A;  4FS1 A;  4WP8 A;  1S9F A;  1C2P A;  2MY7 A;  2KM8 C;  4HTJ A;  1S4F A;  4UY8 5;  4MAK A;  5E3C A;  5HMY A;  3VF0 B;  3OL7 A;  2XNQ A;  3M2R B;  3M6X A;  1T9T A;  3C15 B;  3KWM A;  3PXG a;  4WZQ A;  2AKW B;  2FZK B;  5AXM A;  1L3S A;  4KHP F;  4FKY A;  3CIZ A;  1FX4 A;  3M7V A;  4N5S A;  2BQU A;  2FYX A;  1R0C B;  3OR1 A;  4LF9 F;  1T7P A;  1RT4 B;  5HVH A;  1SKR A;  1APS A;  4K4S A;  2C2N A;  4JOU A;  3ITH A;  4QYR A;  3W5Y A;  4DI6 A;  2AJ0 A;  3KLI B;  1SCJ B;  2ZH9 A;  3DKD A;  3NY0 A;  3VAI A;  3MPW A;  3HMJ G;  1CQN A;  3NMA A;  5LT5 A;  4R5P A;  3M8R A;  4ERD A;  3HHE A;  1RWW B;  1ELO A;  5KG3 A;  1GMU A;  3LP2 B;  1HNV B;  2VL1 A;  3RB3 A;  2C22 A;  1QAI A;  2LQJ A;  4Q44 A;  4ED5 A;  4ECV A;  3HHL C;  1FNM A;  3VVT A;  2RB7 A;  3HHL D;  3NGT A;  1CUL B;  4ANE A;  2L9D A;  3FMB A;  1ZS6 A;  1H7W A;  2QJ3 A;  2HG4 A;  2JEF A;  2N82 B;  2G0I A;  1EQ0 A;  4RJV A;  1LFP A;  1VFJ A;  2WVC A;  4CO3 A;  1X0P A;  3MFH A;  4ATN A;  1GNK A;  3BDE A;  1EKS A;  4N41 A;  1RT5 B;  4I0W A;  1PJ5 A;  3RZA A;  3N79 A;  1NJX A;  5H9E J;  4JV1 A;  2MST A;  3EDR B;  4DV4 F;  1EHW A;  1CS4 B;  1TL3 B;  4OX6 A;  3UVJ A;  3DGP A;  4X64 J;  2DNO A;  5BR8 J;  1R27 B;  4RUC A;  1UPP A;  3V6H A;  1KHV A;  2MLX A;  4P2F A;  2V8H A;  4MJK A;  2JLF A;  4ZKA A;  4I2Q A;  2N7C A;  4NLQ A;  1WAC A;  1F2H A;  1S6P A;  3EZU A;  3KK3 A;  4ZHR B;  2PMH A;  2QA4 S;  4JI7 F;  4ED3 A;  2ZZM A;  2BW2 A;  3PM9 A;  5LJ3 Y;  4JI2 F;  1GFW B;  1SBR A;  1RAI B;  4B3M J;  2CQ0 A;  3UDL A;  3K5M A;  3SSQ A;  1VC6 A;  3SV4 A;  1X9W A;  3MUM P;  4MIA A;  2RKI A;  2DVI A;  3DLG B;  1IKV B;  4Z7Y A;  2QA1 A;  1EB0 A;  5IV3 A;  4YOE A;  2CPD A;  5CYQ B;  4Y2A A;  2DO0 A;  4DUY F;  4DR7 F;  2BAN A;  1UW9 A;  4C0O C;  3P45 B;  4OYA A;  5IS2 A;  5B09 A;  2AJ1 A;  5RUB A;  4TQS A;  3G8T A;  1X4A A;  1JKH B;  4ES1 A;  3AXM A;  3J80 U;  3KLF A;  4AYB D;  3TJ9 A;  4P2M A;  2MKS A;  3OVS A;  4GKJ F;  4CH7 A;  3W60 A;  1VRU A;  5DGB A;  4X62 F;  4U9R A;  1CVJ A;  2MKY A;  1RT7 B;  4MIW A;  1N48 A;  4LBH A;  4GO7 X;  1LKZ A;  4UOH A;  3K5N A;  4ELU A;  3K89 A;  4K8R A;  4HT5 A;  1N4L A;  2Y8Y A;  3KKF A;  2G9O A;  4WCE Q;  3KLG A;  1IBK J;  2D1C A;  3PVX A;  2HQG A;  1RAE B;  4NX9 A;  5F9N A;  2PE8 A;  5T41 A;  3OT9 A;  4WKY A;  1N34 F;  4UUW A;  2AYB A;  1RTI B;  4YME A;  1P27 B;  2IRY A;  4LUB A;  4FNH A;  2QSF A;  5K5M A;  2RT3 A;  3BSC A;  4A8X A;  3DNC A;  4OIX A;  5KFH A;  1KRP A;  1OMS A;  2VAS A;  4DL7 A;  2ALY B;  4GC7 A;  3MXH P;  3OHB A;  2MQL A;  5G0R B;  4FZV A;  3C16 B;  2ZJQ Q;  2ZC4 A;  3VAK A;  2MHN A;  1FWK A;  4FF4 A;  3UE2 A;  1TZ0 A;  1F5A A;  2Y0B B;  5KFJ A;  2KJW A;  2EFN A;  4NLO A;  2AYE A;  1N88 A;  4IG3 B;  8RUC A;  4NI2 B;  4LRF A;  4F04 B;  4RW6 A;  1UPM B;  4RZR A;  4OI1 A;  3IGV A;  4LSN B;  1WUU A;  1R8H A;  4DV0 J;  2OPS B;  3LGM A;  4QU7 A;  1S57 A;  2Z2Z A;  2R7V A;  3GU0 A;  1HHQ A;  4OYM A;  2XB2 D;  5FDL A;  5EWE A;  1RT6 A;  2M52 A;  1ZH5 A;  2D69 A;  1V6H A;  1LV5 A;  2GS8 A;  2ROG A;  3P96 A;  1KKH A;  5DDR C;  4NZ0 A;  3CJT A;  1IM6 A;  3TUZ C;  4XPE A;  3CJ5 A;  1NJI T;  4WE1 B;  3Q89 A;  2GFF A;  2CQ2 A;  1XBW A;  2KU7 A;  1S10 A;  5L9X A;  3D4J A;  2N3L A;  3JYT A;  5I3U A;  3IBF B;  2ZC3 A;  2HRT A;  5A0Y B;  2OFH X;  2KH9 A;  3KUH A;  3FFI B;  4J9U E;  5BJR A;  1FFG B;  4QR2 A;  4TY8 B;  1T9Y A;  3R1H A;  4K4U A;  1KLM B;  4BS2 A;  5AE2 A;  5K9F A;  1Y7P A;  3IRW P;  2AJQ A;  2Z4P A;  4ZP6 A;  4DV6 J;  1U48 A;  4LFB F;  2MSS A;  2G0C A;  2DGV A;  4JI3 J;  2XTJ P;  1GT8 A;  5DZ6 A;  1WC1 A;  1JLQ B;  4LQ3 A;  1NB7 A;  5KFO A;  5HVF A;  1CBK A;  2W7A A;  2ZBQ A;  2YNI B;  3ENQ A;  4IQM A;  4NYP A;  3DHX A;  1V3Z A;  1UWA A;  4YEA A;  3DLK A;  4KHR A;  4UST A;  1N0U A;  3KLH B;  3OFG A;  1YRU A;  1NPR A;  4OMF G;  4YB1 P;  4E8U A;  4CNZ A;  2M3D A;  4F3Q A;  4NLR A;  1TL7 A;  3D1H A;  2DIU A;  2ZM6 J;  4B3R F;  3MUR P;  1YK9 A;  3FDS A;  5KT5 A;  4J9L A;  1A9N B;  4DN9 A;  2V63 A;  1OPI A;  1Y5L B;  4FVM A;  3D54 A;  1L5U A;  3Q22 A;  4JI1 J;  4NPO A;  4IYQ A;  2M70 A;  3ZC4 A;  5GAE U;  4B17 A;  4DR2 J;  4IH6 A;  1TK5 A;  2WBM A;  3KFW X;  4J91 A;  2YNG A;  1RAO A;  3MM8 B;  3TRG A;  4C8Z A;  2XMA A;  1FEE A;  1T03 B;  2E5L F;  2NUU G;  3MCO A;  5ITH A;  4ECQ A;  2QA2 A;  1FD2 A;  3SFG A;  3ISN C;  3CD0 A;  1PAU B;  3I4H X;  2AJ4 A;  3ISN D;  4I64 A;  2GGP A;  3ETM A;  3L7O A;  4LBP A;  1H98 A;  2JC0 A;  1F6T A;  2HPU A;  3QT8 A;  4P2S A;  3OFH A;  4H4M A;  2EFG A;  3MPD A;  2KXH A;  3D7S B;  3ONQ A;  3C14 B;  4LSZ B;  4NLY A;  1WF2 A;  1U1Q A;  3TZX A;  1TEL A;  2ZIT A;  2Z2L A;  5KFD A;  3AY0 A;  3K17 A;  4K5S A;  4X4R A;  2KFZ A;  3G8Q A;  4DLG A;  4S0M A;  3J7Y I;  4NAS A;  2Y1R I;  3EJM A;  4MKA A;  2YNF A;  1JXL A;  2B6A B;  2HQD A;  4EK2 A;  3BH6 B;  1TL1 A;  1A0O B;  2KO1 A;  2AMC B;  2JH3 A;  4Y2C A;  2IVM A;  2RQM A;  5E3A A;  2VJU A;  3BEG B;  4FXW A;  3NWR A;  1KOH A;  2E1C A;  2AZ3 A;  1S0O A;  2YX1 A;  2YWH A;  3DFE A;  2UUA F;  4FXD A;  2JVO A;  3FVY A;  1TK8 A;  1CQM A;  1S4E A;  2VQF J;  5LM7 E;  2C2R A;  1M1H A;  3DYA A;  2RIJ A;  3LW5 C;  2MYF A;  1BUX A;  3HJV A;  3VQT A;  4HEA 9;  2MEW A;  4NXN F;  3VTI A;  4J9O A;  4AD6 A;  5BYR A;  1RTJ B;  4KT0 C;  3W62 A;  3A12 A;  4P10 A;  3ZZT A;  5HLF A;  5F8H A;  2ADB A;  4TXS A;  5L1J A;  2PMW A;  1GTH A;  3OJS A;  1YHQ S;  2C2E A;  4KO0 B;  1OSC A;  1KDN A;  4CTA A;  1QTM A;  2X1A A;  2PD1 A;  4XIU A;  3DRS A;  4HHU A;  5C24 A;  2PI4 A;  3HI9 A;  2MZJ A;  2KB2 A;  3NRB A;  3C2P A;  5AJ3 F;  4CLP A;  4DWI A;  1QLN A;  1HMV B;  2GO9 A;  1IKX B;  5GAG I;  1HHS A;  4J90 A;  1N6Q A;  2E5J A;  4DV1 J;  2C3P A;  3HKZ D;  2GMH A;  2JWN A;  5D3G B;  1UWB B;  4M5G A;  5HP1 B;  1OQ6 A;  3A3O B;  1QDU B;  3OW2 R;  4CO4 A;  4DN0 A;  3Q8R B;  3OLB A;  3POT B;  1WI6 A;  3UNY A;  4C6A A;  2HND B;  2P9E A;  3TAQ A;  1KBR A;  1EET B;  2LA6 A;  2QMX A;  2OSQ A;  2MQN A;  2ZJR Q;  1HPZ A;  2P9G A;  4ZK7 M;  2N7Y A;  3MED A;  3CMA S;  3SQG B;  2GHW A;  1N54 B;  2WSC C;  1BC6 A;  4L76 A;  2HNZ B;  1H2V Z;  1FK9 B;  2BMB A;  2JEI A;  2FPH X;  4WBF A;  2RML A;  3SBM A;  5LSL A;  3OFF A;  4NXM J;  2ZBR A;  3ZTS A;  1LXN A;  2V2Q A;  4KGK A;  2B43 A;  4IOC Q;  1JLB A;  2HHX A;  4ZPV R;  4UOG A;  1I94 F;  1HBN B;  2Q79 A;  4RBV A;  2YKM B;  2HBY B;  5KG4 A;  5GAD I;  3MUV P;  5IM0 B;  1X60 A;  4EZ9 A;  5IV4 A;  4FDF A;  5D4O A;  1VQN S;  3BH7 B;  4IG0 A;  2H51 B;  4M63 A;  4M5D A;  2GO8 A;  2XSJ A;  4MH8 A;  3CCS S;  3G4S S;  1LW2 B;  2HVH A;  2CQ4 A;  3UNG C;  3IM9 A;  2DB1 A;  2F8E X;  1WI8 A;  2D7S A;  3GFX A;  2KZM A;  3IG1 A;  1CJT B;  2AT1 B;  4Z2X A;  1VC5 A;  2A6M A;  1SJ3 P;  2BZ2 A;  2DGS A;  3DM2 B;  2VQE J;  1BWV A;  5J2N A;  2UP1 A;  2MLZ A;  2FLP A;  2OTJ S;  2PEH A;  4TNO A;  3FQK A;  4KB7 A;  3ZZR A;  4QIV A;  1XR6 A;  1KQK A;  3CED A;  1LK5 A;  2DXF A;  2J7K A;  2O01 C;  3PW2 A;  2R7R A;  3K7R A;  2HEK A;  1MWQ A;  1G2E A;  1GMW D;  4OI6 A;  3A3P B;  1RTH A;  3KUG A;  3MMC A;  3JB9 k;  3JQK A;  1HR0 J;  3I31 A;  2DR5 A;  3H5Y A;  4DL2 A;  2V9W A;  1LXJ A;  3N4W A;  3PFE A;  2UU9 F;  5KFI A;  5KOX A;  4XPC A;  3OR1 B;  2D74 B;  3ADA C;  2IC3 A;  1S6O A;  2CWX A;  5KFL A;  4M8L A;  2R4F A;  4KAI A;  2IPO B;  2C3Y A;  2HSE B;  3CDE A;  3EPG A;  1R8C A;  1FD8 A;  1GX6 A;  3MEE A;  3ITH B;  3S6E A;  2EI5 A;  2F4V J;  1S12 A;  2V2V A;  3IC1 A;  2OEK A;  4R5P B;  3T3F A;  3UD5 A;  4DS5 A;  2OSR A;  5KG7 A;  1HI8 A;  1VLY A;  1FJG F;  3GMG A;  2F5G A;  4H4K A;  5BXI A;  3P49 B;  3M6V A;  3G82 A;  3AJ2 A;  4WXO A;  2J9C A;  2POK A;  3R5G A;  4DU7 A;  1UJ6 A;  4OJ3 A;  5LMU J;  2E5I A;  3Q8S B;  2EK6 A;  2SXL A;  3WQP A;  2ZH1 A;  3GCW P;  1U1M A;  4KHP J;  4CYU A;  3FZ2 A;  4O23 A;  1UA0 A;  4QBU A;  1KVI A;  4QIE A;  4FYV B;  5FLX Y;  2VOD A;  2FVP A;  2DNR A;  1N33 F;  2IY5 B;  3QGI A;  1Q86 T;  5D8H B;  3OXL A;  2DTJ A;  4L3K A;  3NNH A;  2FVR A;  2YWE A;  2HFV A;  2O67 A;  2FZC B;  2HS3 A;  3UVJ B;  3SYZ A;  1NO8 A;  2E7W A;  1LWC A;  4YB5 A;  2DNY A;  2ZOF A;  3G8S A;  2XLJ A;  2VKR A;  2DIV A;  4FPI A;  4Q8E A;  1N5V A;  1HBU B;  4DX7 A;  2RIL A;  1QVG R;  1KTV A;  5HAT A;  4I2Q B;  4LVN P;  1MSW D;  1WC5 A;  1JLC A;  3DOK A;  3J81 U;  1YBU A;  3SCL E;  4DQR A;  3G87 A;  3ENV A;  1S6P B;  5H9E K;  3KK3 B;  4MYT A;  4F25 A;  3GQC A;  1M5P C;  3IAS 9;  5AE1 A;  2MQM A;  3VQS A;  1RP5 A;  2XI2 A;  4B9M A;  3E3X A;  2HAI A;  4PKD B;  1S6U A;  1F2G A;  3SFU A;  2J7U A;  2AIR B;  4EBC A;  2J8A A;  4C9D A;  2ASL A;  3JQJ A;  2EG1 A;  1BHN A;  2MY8 A;  2BAN B;  2MQQ A;  4NE9 C;  2FLN A;  4Q2M A;  2XYP B;  1SV5 A;  2W7P A;  2H5J B;  1VHI A;  4ECU A;  2EKY A;  2HWH A;  2X1F A;  2R2U A;  1HQ2 A;  1U0S A;  4ILR A;  3J7Y U;  5FD1 A;  3DRP A;  2RQC A;  2AP6 A;  2AJF E;  4O44 A;  4GKK F;  4OZJ A;  1U1R A;  2XHW A;  3OL8 A;  5DQH A;  2MTL A;  1VRU B;  1PBA A;  2BOP A;  5IWA J;  4FF3 A;  4QIF A;  1BQM B;  1K1S A;  3DI6 A;  5EX0 A;  2HW3 A;  2WW8 A;  3DDK A;  3PV8 A;  2A2C A;  2NS1 B;  4A48 A;  4JYA F;  4DX5 A;  4H54 A;  3KLG B;  4BBY A;  4FNI A;  4ZVS B;  2MZQ A;  3KJN B;  2AEM A;  2G4B A;  4ECW A;  4OX9 F;  2GIF A;  3PYF A;  1IBM J;  2XMU A;  3CCL S;  3W66 A;  4N8N A;  2HUR A;  3W9J A;  3N0V A;  2DNP A;  2PA3 A;  4RO0 A;  1WG5 A;  3G6E S;  1VGY A;  4ELV A;  4DUY J;  1X5O A;  4M5L A;  2UXC F;  1TKX B;  2BEF A;  2HK2 A;  2YH0 A;  4LF8 F;  1VBZ A;  3AD8 C;  1QAX A;  4KBI A;  3TJA A;  2XCP A;  1SC3 B;  2CG8 A;  3QJL A;  4GKJ J;  2XY5 A;  2QYG A;  4X62 J;  1NXI A;  1X5P A;  4DQP A;  4X4T A;  4WP9 A;  1XMO F;  3MI7 X;  5L8R C;  2IFX A;  4G1P A;  2E9T A;  3RG6 A;  4RW6 B;  3QWP A;  3K5P A;  2VG7 A;  1IVZ A;  1MNE A;  1X4C A;  3IAM 9;  1XEZ A;  2B9X A;  4B3O B;  2BJE A;  1D9D A;  1RWV B;  3OXG A;  1N34 J;  1KS2 A;  1S1X B;  1G6B A;  3PCO B;  3UD4 P;  1RHQ B;  5LMN F;  5FDL B;  1XC9 A;  4ZIW A;  2D3U A;  2V9K A;  2W4D A;  3KMQ A;  2HQ3 A;  5CQG A;  1R3N A;  1AZS A;  3HHK A;  2AD9 A;  2YKQ A;  1H3D A;  1NHV A;  1JX4 A;  2P6T A;  1HI0 P;  2RS2 A;  1RWP B;  3JYT B;  5I3U B;  5HMW A;  3SDE B;  1FRX A;  3NL0 A;  1S9E A;  1SL2 A;  3W2W A;  3FEX B;  2HIY A;  3CT9 A;  1DTT A;  4I1T A;  3HCX A;  3TZZ A;  1XNR J;  2X51 A;  3PTW A;  3RAQ A;  4ECS A;  4F2R A;  2DO4 A;  4MK7 A;  5C5J A;  4ZCL A;  4TKT A;  1XMQ F;  1KC8 T;  3I5C A;  2NQP A;  3KOA A;  1TMJ A;  2ZH3 A;  1XER A;  1UL3 A;  3W2V A;  2DK2 A;  1RWX B;  1U1L A;  4JI5 F;  3I55 S;  5ETR A;  3R5A A;  2XC9 A;  4OZ1 A;  4DR5 F;  4R0E A;  4U6P A;  4ES3 A;  5T14 A;  4TYA A;  4ID5 A;  3UW1 A;  3I87 A;  1H6K X;  3DLK B;  5DG8 A;  1VQ7 S;  3ZTO A;  3LP1 A;  1QY7 A;  3M2V A;  5ETQ A;  4DV3 F;  1VBY A;  4ILL A;  4G1I A;  2Y1I A;  4DR1 F;  2R8H A;  3EGW B;  1EKR A;  4DFP A;  3AB4 B;  1FVS A;  3CJ2 A;  2DR9 A;  1TL7 B;  3N6N A;  3RR8 A;  4DPT A;  2GJI A;  2HNY A;  1VIX A;  3BGU A;  3QAT A;  4V19 J;  1GK8 A;  3DN9 A;  2JHE A;  1P9Y A;  3PEJ A;  3D0I E;  4LFB J;  2LDI A;  5JUM A;  2EWH A;  1NPP A;  1NDL A;  3OQ2 A;  2VPW B;  1T3O A;  1PYS B;  4TU9 A;  4RNM A;  2IJF A;  4C8O A;  2RSQ A;  1H73 A;  1NDC A;  3AD9 C;  2CPJ A;  2CZ4 A;  1FX2 A;  3MAA A;  2BJD A;  1HQU A;  3PX0 A;  2E66 A;  3MR6 A;  2A18 A;  2GGP B;  3K57 A;  2LKZ A;  3CJ3 A;  1KLN A;  2DNM A;  2NRE A;  4H4M B;  5K8P A;  4J7C A;  5ETM A;  5HN0 A;  2BM1 A;  2CQD A;  4CLZ A;  4DUZ F;  4FBU A;  4DPO A;  2HLU A;  3CF5 Q;  1AYE A;  4PYA A;  3N6M A;  1RUS A;  4CNY A;  2F9D A;  1P1L A;  2GQQ A;  4B3R J;  3DU5 A;  2V8G A;  4ECT A;  4ZLN A;  4A8Q A;  1U24 A;  2UVR A;  1XJW B;  3I5A A;  2X3G A;  4M94 A;  4TQR A;  1XTZ A;  2YNF B;  2WOM A;  4WIQ A;  1M90 T;  1NJY A;  1TL1 B;  3OPK A;  2L9W A;  2A6O A;  3HHL A;  4ZVO B;  4U7U K;  5E3Q A;  2R7W A;  2RHQ B;  1SL1 A;  1D8Z A;  4EEY A;  3MM6 A;  2DNK A;  1WEY A;  3G9C A;  2K1R A;  2E7X A;  4NLP A;  3IWX A;  1SH0 A;  2YPZ A;  1SJF A;  3PNI A;  4KGV B;  4ITS A;  2IBK A;  3MDF A;  3GJS B;  1BQN A;  2K3I A;  1K0T A;  3M8Q A;  5LXY A;  4CCH A;  4AL5 A;  1UFL A;  1RWO B;  3ELH A;  2B8P A;  2M7S A;  3R5B A;  3DYA B;  2B4U A;  2CVI A;  3PR5 B;  2FJD B;  3NGS A;  3W3S A;  2QFJ A;  1SVD A;  1HBO A;  2HQF A;  3CXC R;  4K50 A;  1XIQ A;  2ZKU A;  1VIS A;  6AT1 B;  2HMI A;  3TX8 A;  4DR3 F;  3DOM A;  2RQ4 A;  3I0S A;  1RT1 B;  2BE9 B;  3QZ7 A;  4CLL A;  1SPB P;  2E1A A;  1Y3K A;  4JV5 F;  4CTA B;  2K06 A;  3B8H A;  3HF5 A;  4FYY B;  4HI1 A;  3QFW A;  1DQ8 A;  3DRS B;  2ZOG A;  3UDE A;  5C24 B;  2E5H A;  1HFE L;  3AQP A;  4FYX B;  5F8G A;  3T5L A;  4Y0F A;  4PG7 A;  3CCM S;  1X4F A;  2UUA J;  3H5S A;  1F9E B;  4NRT A;  1RBO B;  1RWM B;  4DLE A;  5DDP C;  4KKO A;  1O5J A;  1N6Q B;  3KG0 A;  3M32 A;  2DNL A;  4DEZ A;  1Q7L B;  3CJS A;  3GB0 A;  3DLE A;  3WX4 A;  2PII A;  4CO2 A;  4NXN J;  4A8O A;  3R2D J;  2LQ8 A;  3JTP A;  4UOC A;  4ED0 A;  4NMX A;  1Y9O A;  2W7O A;  1UA1 A;  1HPZ B;  3MED B;  4RPF A;  3GR1 A;  4F4W A;  4DSI A;  2C3M A;  1C1C A;  4L73 A;  2OEL A;  3MEC A;  3WC0 A;  2AW0 A;  3MMA B;  1DTQ A;  3CCE S;  1NK5 A;  3C3L A;  2YX4 A;  4Y34 A;  3HLU A;  3NNC A;  2GIR A;  2ZNY A;  2BDP A;  3EGZ A;  5CD4 A;  2DEJ A;  1RT4 A;  3I9V 9;  1JLB B;  3GV5 B;  2Q66 A;  4NA1 A;  1DBD A;  5AJ3 J;  1TV6 A;  3CMQ A;  3ZZU A;  1NB2 A;  2FJE B;  4QU6 A;  4I6W A;  2HBR B;  3M1V A;  2L48 A;  2Z0G A;  2GJ2 A;  4P52 A;  2CPE A;  1FJE B;  3CDW A;  4FN5 A;  2WHO A;  4URQ U;  4XDC A;  3VGU A;  3HFV A;  4F4Y A;  2M5Y A;  3RTV A;  1XNQ F;  4M5D B;  2XSJ B;  1M5O C;  2HS0 A;  3R7B B;  4QWA A;  3P5T L;  3AXK A;  4F0H A;  3V6K A;  4LF2 A;  1JMT A;  2GV1 A;  3DMJ A;  2G2Y A;  3T1A A;  2BKN A;  4USJ C;  5B0B A;  2ABY A;  4DV7 F;  5F3Z A;  4ZPB A;  3L95 X;  4OI3 A;  2QL9 B;  3KLE A;  3ILJ A;  1YSJ A;  1PC4 A;  3UDC A;  1S7H A;  3WC2 A;  2EPI A;  4NLS A;  4DOZ A;  4C8Y A;  3EUN A;  3IN5 A;  3J7A N;  1F60 B;  3LP0 A;  1I94 J;  2FJB B;  2K7K A;  2C2O B;  3T5H A;  4M5J A;  1RYR A;  1B0V A;  2CDR B;  1KD1 T;  2LU2 A;  2CKW A;  3PIO Q;  1NZA A;  3TVY A;  3PG9 A;  1T3N A;  2P9C A;  3R27 A;  2YWK A;  2HGN A;  4NRU A;  3G2X A;  4WF9 Q;  2RQK A;  4F26 A;  2IBO A;  1PYT A;  3NOC A;  4WWS A;  1S6Q B;  4ZJQ A;  2XLI A;  3O1L A;  4ZHR A;  3G6X A;  3L9Z A;  4O3S A;  3MMC B;  1EAY C;  4UF4 A;  4WYL A;  4O3N A;  2DY1 A;  5J1P A;  3MTJ A;  4GRS A;  2VFR A;  1X31 C;  3PKY A;  2YWF A;  4LF6 F;  2OPQ A;  3IGN A;  3AH6 A;  1IKV A;  1I51 B;  2IC3 B;  1UJ4 A;  3UFC X;  1EAR A;  1RDR A;  3RAM A;  2HQC A;  2J0Q D;  2E44 A;  5CZX A;  3IR7 B;  1L3T A;  1QE1 B;  2EFV A;  1NPK A;  2DNG A;  2W8L A;  3CIM A;  5D0H A;  5AXL A;  4C4W A;  2KVQ E;  2GQ2 A;  3DLL Q;  2J0W A;  1SKU B;  1D09 B;  2V0N A;  4L75 A;  4U7U D;  4WZM A;  2RRB A;  2L08 A;  2JLE A;  4PR6 A;  1WG1 A;  3TJ8 A;  4A8K A;  1ZAW A;  3KK1 A;  5HAN A;  4PWU A;  1Y00 A;  5B0A A;  1TAQ A;  2DGT A;  1FRI A;  3H42 A;  1PC5 A;  1F3F A;  1TVR A;  2GMJ A;  4CYU B;  4Z37 A;  1NEE A;  4IQX A;  4N7T A;  2LA4 A;  2OI2 A;  5M2P A;  2QGF B;  3MAQ A;  3P4U B;  3HDS A;  2EXU A;  4U8V A;  2E9Z A;  2E7V A;  5AE3 A;  2G1H A;  3IWN C;  2RDJ A;  4WJB A;  5B0F A;  1O51 A;  4ED4 A;  2ILZ A;  3C16 A;  3GIK A;  4DV2 J;  1IKW A;  2IYG A;  3MOJ B;  2D3Z A;  1PKU A;  3HKW A;  3HZE A;  2I38 A;  1LWC B;  1B3T A;  1FJG J;  3NS7 B;  2BRK A;  3AA8 A;  4X66 F;  2YKN A;  1XWL A;  2DD8 S;  3GFZ A;  1D9A A;  1FHT A;  5K20 B;  2NLW A;  4ETZ A;  4NEZ A;  3HVR A;  2OUG A;  1FVQ A;  1JLC B;  2Z56 B;  3DOK B;  5CAB A;  1NCL A;  2ZBI A;  5E5N A;  4B9S A;  4WXW A;  4DX8 H;  2XO7 A;  2FTR A;  3TW0 A;  5KG5 A;  3TUP A;  4NCG A;  1JNZ B;  3R8Y A;  4A8Y A;  1VQO S;  3E51 A;  1F9H A;  1S1W B;  3QYY A;  2NCK L;  1N33 J;  5JVH Q;  1TFW A;  2C2D A;  3BSA A;  3KTQ A;  5KG0 A;  5C2C A;  4YFU A;  3KUE A;  5DLF A;  2KTQ A;  1X7V A;  3N28 A;  4GVB A;  3DRP B;  4WE1 A;  2VHG A;  4P6Q A;  2N3O A;  2I9S A;  1R31 A;  1ZA2 B;  4ZCM A;  4O44 B;  2U1A A;  4NOH A;  4RUB A;  2UXD F;  2C2M B;  5KG2 A;  1HA1 A;  4M1K A;  1RTZ A;  3DI6 B;  2FLO A;  3MPY A;  3MCN A;  4J9S A;  1ZTW A;  2HVI A;  4USK A;  5J2Q A;  1V3R A;  4TY8 A;  4DXL A;  4DDF A;  1O8B A;  1IBL F;  4LRE A;  2DNH A;  1Q0N A;  1KLM A;  3A3N B;  4DR4 F;  4MK8 A;  2VKZ G;  1SXL A;  2C42 A;  2AEJ A;  3FNN A;  2DCL A;  4DHV A;  4CO0 A;  5MLC V;  2KYX A;  2Q6C A;  1N36 J;  3ZZY A;  4OZ2 A;  5U47 A;  1YJ9 S;  2QTW A;  4U8Y A;  2HHP A;  4HVZ A;  1A6L A;  2AGQ A;  4OJG A;  4XDD A;  1S97 A;  1C1B A;  4GKK J;  3GTY X;  1MWY A;  3RRK A;  2I1R A;  4X65 F;  5B08 A;  3UQS A;  3MR7 A;  4CRJ A;  2VV5 A;  1TUW A;  3H25 A;  1NND A;  1Q95 G;  4L6V 3;  4E0D A;  3CW2 C;  4LRD A;  4QCL A;  1NSA A;  4JYA J;  3DRR A;  2KT5 A;  2GX8 A;  3NNA A;  2VG7 B;  3H2L A;  2BX6 A;  4P71 A;  2FJW A;  4WFB Q;  4EYI B;  4OX9 J;  2MXY A;  1CC8 A;  5HJY A;  1WOO A;  3R5C A;  3FSY A;  2DGW A;  3K5L A;  4ZN1 A;  2XMV A;  3PRV A;  1VK8 A;  1NHK L;  4O3R A;  5HL7 Q;  2UXC J;  1G7C B;  1YGY A;  4F2S A;  4ZVR B;  4LF8 J;  2WCX A;  1IM4 A;  2YQ3 A;  5ETO A;  5E0O A;  3U7J A;  5L1K A;  1T03 A;  4UT4 A;  2R7T A;  1SJ4 P;  3PDN A;  5D78 A;  1FKP A;  3TA0 A;  4N77 A;  2MZT A;  4RLE A;  1XMO J;  4DR6 F;  4NLU A;  1S9E B;  2QN6 B;  4ELT A;  5HBM A;  1DTT B;  2VD3 A;  4C0H A;  3IBW A;  3LF0 A;  2AGO A;  2BW7 A;  5DRK A;  1TP7 A;  2H9Z A;  4PXB A;  1K0V A;  2VG6 A;  2CAD A;  3PW7 A;  3EZ5 A;  4YP3 A;  4HDG A;  5IC4 B;  2W01 A;  2OMO A;  5A6P A;  2L9N A;  2KKH A;  4O4G B;  4IRD A;  4C98 A;  3QJJ A;  2DGX A;  5D0G A;  3W5X A;  1DQ9 A;  1DJ0 A;  2RRA A;  1K1Q A;  2IIH A;  3BO4 A;  3PFO A;  3CO0 P;  1N5T A;  3FGV A;  3FRZ A;  2B56 A;  2YXL A;  3RRG A;  4HYK A;  5B7W A;  1FFW B;  1M5H A;  2E29 A;  2AYM A;  3WDO A;  4ID5 B;  3LA0 A;  3HSG A;  2XZT B;  4DQI A;  3T9Z A;  3FBF A;  3LP1 B;  1B7F A;  2FVC A;  3M2V B;  3BRE A;  2KHC A;  1WKL A;  1HNZ F;  2L3M A;  4FS2 A;  1T9U A;  1RBA A;  2DJW A;  2HNY B;  4EFA C;  3OTD A;  4USU A;  2O3D A;  1H7X A;  4ZVQ B;  4PG4 A;  2CNN B;  2DNN A;  1RLC L;  1XMQ J;  3CTR A;  2CQB A;  2AU0 A;  1KN6 A;  2WW4 A;  1O6X A;  3MTK A;  3NGU A;  2GA7 A;  4DFM A;  4AL6 A;  1WD6 A;  4J5O A;  4JI5 J;  3C6T B;  3W61 A;  2RU3 A;  4DR5 J;  4JI0 F;  1PBU A;  4CM2 A;  1F5C A;  3PEH A;  2C2K B;  1WG4 A;  4OL8 A;  2V4Q A;  3MAA B;  1GMW A;  4J9R A;  1HQU B;  2BJ3 A;  1UJ5 A;  2EFP A;  3G71 S;  2K8G A;  2CPX A;  1AUS L;  2EW9 A;  2IA0 A;  3R6G B;  3EGV A;  1UEU A;  4FKX A;  3PX4 A;  4ZVG A;  5KFB A;  4DV3 J;  3SCJ E;  2EBG A;  2BE2 A;  4DR1 J;  3UCZ P;  2XBP A;  5EX3 A;  4PRF A;  3IBC B;  2IM2 A;  2FGC A;  1HMV A;  4WFN Q;  4ZA1 A;  3R1L A;  1KFS A;  1CG2 A;  2OLW A;  3MMB A;  2B9Y A;  2OPP B;  5A8R A;  3UCG A;  1N5Y A;  3PO5 A;  5FLX U;  4P75 A;  2B0G A;  4J9Q A;  2HND A;  9RUB A;  4XTT A;  2WOM B;  4LF7 F;  4K2X A;  5HVG A;  4DPW A;  3W9I A;  3MR2 A;  4DL6 A;  2HHQ A;  2W2P P;  2W8K A;  1M0S A;  4L3N A;  1AT1 B;  3ENA A;  3FJ2 A;  2DIS A;  4AND A;  3QGH A;  2UVU A;  2J6T A;  1LEO A;  2ASJ A;  2BE7 D;  3LOU A;  5KFU A;  2LXU A;  1VLO A;  1CJV B;  1RCO B;  1BQN B;  4IKA A;  2NZC A;  2W24 A;  4DUZ J;  2YBV A;  3GJQ B;  3M8Q B;  2ZE2 A;  1YDL A;  2DH7 A;  1S79 A;  4LIW A;  4MKB A;  4N8O A;  3V4M A;  2HAF A;  2IM1 A;  3IA0 A;  3G6Y A;  1HI1 A;  1P1T A;  2PN6 A;  2V8P A;  5DQI A;  1HBO B;  2AQ4 A;  3J7Z T;  1PJ7 A;  3CSK A;  5DG7 A;  3CCT A;  3T1Y F;  1YJU A;  9ATC B;  2QMU B;  3V2U C;  3DOM B;  1LW2 A;  2FGO A;  3I0S B;  2XO6 A;  2HQI A;  1N32 J;  2YQ0 A;  3U1M A;  3KK2 B;  5C7P A;  3LPY A;  1VQ4 S;  2RS8 A;  1FE0 A;  3HT3 A;  5GMK a;  2M88 A;  3LAM A;  5D4P A;  3NAH A;  5B0D A;  1FKA F;  3HXM A;  4NLD A;  1YJV A;  5DGA A;  4W90 B;  1TKZ A;  1RAH B;  1AXQ A;  1YJW S;  3B4M A;  3L3C A;  2DRA A;  1RAC B;  2ZZT A;  1K9M T;  1UEV A;  4KKO B;  4P74 A;  1E6Y A;  1U49 A;  3M32 B;  2GML A;  1F9F A;  5J2M A;  3HFZ B;  2WSE C;  3TVZ A;  1H38 A;  4KV8 A;  1VC0 A;  3DLE B;  1WJ9 A;  3ZZO A;  1FI4 A;  1PCA A;  4LF4 F;  1WHW A;  5KFQ A;  1NUE A;  4IFY A;  2XWX A;  2DHS A;  3JSM A;  3Q8U A;  1IKY A;  3T1H F;  2ACM A;  4DR3 J;  1URR A;  2KI2 A;  2XMT A;  5L1I A;  3U1N A;  1V5V A;  2Q43 A;  4YDX A;  2LMI A;  4NLX A;  1DFD A;  1C1C B;  3EVO A;  3BBF A;  3MEC B;  4N47 A;  2ZH4 A;  2LFV A;  1DTQ B;  1P6T A;  5GME A;  4JV5 J;  2HHH F;  5IQ6 A;  4TU8 A;  2RDI A;  3R3T A;  1ZOT A;  4JB8 B;  4WFY A;  2FVQ A;  2WVE A;  3MCS A;  2H5E A;  4CT9 A;  2ZD1 A;  3KLV A;  4LJM A;  3H2U B;  5KT7 A;  2MB0 B;  4HLB A;  3ILL A;  4RW7 A;  1TV6 B;  1KQF B;  2KDO A;  3QT6 A;  3IWL A;  3D2W A;  3A8I A;  1HNI B;  2LP4 A;  4IRK A;  2J7W A;  4DCP B;  3M1V B;  3CGI A;  1CPZ A;  1UTA A;  1B0T A;  3ILO A;  2OAU A;  2MPU A;  3HSJ A;  1FDN A;  2A0F B;  2QYC A;  2APO A;  3PAC A;  1FTR A;  4AQY F;  1URN A;  1RE1 B;  1SJ1 A;  4USM A;  2B8Q A;  2FC9 A;  3GYN A;  5KOW A;  3NKY A;  2VON A;  1U6Z A;  5SZT A;  1UVJ A;  4ZJO A;  1MW7 A;  3OLA A;  1TL5 A;  1Q8I A;  4EYH B;  3DMJ B;  1JXE A;  4Y00 A;  3KMS A;  4C8K A;  3KLE B;  4DL4 A;  3IR5 B;  2EEY A;  3MM5 A;  4OYO A;  3KHG A;  4JV2 A;  2A2D A;  4WTY A;  3LP0 B;  5T7L A;  2MZ1 A;  3GWC A;  4ENO A;  4J9K A;  2V8V A;  3ZO7 A;  4E2F B;  4Y2I A;  3Q23 A;  3A13 A;  2YWW A;  3HSD A;  2CJA A;  3Q8Q B;  2FJA B;  1ZA1 B;  2DHG A;  3UDV A;  1HBU A;  5F8L A;  1Z2Z A;  1XNQ J;  4ZVT B;  3ZNU A;  2ATL A;  5KFW A;  4YUD A;  4C7Q A;  2KFN A;  1V9O A;  3H90 A;  4TYB A;  1UAW A;  5E2Q A;  1IR0 A;  1G3O A;  3RW6 A;  4X64 F;  5BR8 F;  3OTO F;  1Q5V A;  1IQZ A;  3TX0 A;  4WFX A;  5L38 A;  1R8B A;  5E7O B;  1FRJ A;  2H5I B;  1ZPW X;  4DV7 J;  5ETN A;  3TNV A;  1YG0 A;  4W4M A;  2ATC B;  2OPQ B;  2PMZ D;  4X4Q A;  2XI3 A;  1CC7 A;  4FYD A;  4ZPC A;  4WII A;  1BQX A;  2XUL A;  2M0G B;  1LOU A;  2YH1 A;  1HW9 A;  3RJM B;  1XR7 A;  1R89 A;  5K8O A;  4RW4 A;  3HSZ A;  3T6B A;  1ITP A;  2D3O R;  1RTD A;  1Q53 A;  4RUH A;  3MM7 A;  2XS2 A;  4W98 A;  2HBZ B;  1P9Q C;  3KK1 B;  5D15 A;  1BQM A;  2H65 B;  2NYH A;  5IT9 Y;  1U1K A;  4F4X A;  1N8R T;  2JFD A;  3LWM A;  4WTO B;  4K5R A;  5DZ7 A;  5GAH U;  4EO6 A;  4CIO A;  2DEI A;  2R8I A;  1TVR B;  3I56 S;  3PR4 A;  5DDO C;  2KFY A;  4P9S A;  1ICE B;  5FII A;  3Q8P B;  3CPW R;  4LF6 J;  1YIT S;  3FZB A;  2DIT A;  1HIY A;  2V6A A;  2ZVS A;  3HVA A;  1RAJ A;  4AL7 A;  1IBK F;  2W2O P;  1FTC A;  1HHT P;  5KAK A;  4EMD A;  1Y0H A;  1YJN S;  2PGC A;  1TKX A;  4IO1 A;  1AA1 B;  4OYI A;  1EQM A;  1IKW B;  4B08 A;  3K2Y A;  2B5J A;  3K8W A;  2NZ4 A;  3UR3 C;  3VAG A;  2LVW A;  2YKN B;  1UFW A;  1VRT A;  1YBA A;  2V2Z A;  2JNJ A;  5B0G A;  2XM3 A;  4QR1 A;  3NG8 A;  1VMB A;  4OX8 A;  3RUB L;  3RU0 A;  2YNH A;  3H5U A;  3T19 A;  4TU7 A;  4FP9 A;  5ETV A;  1UZD A;  4MMO A;  2OO4 A;  5D0R A;  1ULR A;  1UKU A;  1M5K C;  4DSF A;  4B3O A;  2CQG A;  4GMK A;  4NCG B;  5M2U A;  1PG5 B;  1S1X A;  1QM9 A;  1JQG A;  2IM0 A;  1NJW A;  4Y65 A;  3I4P A;  3AQO A;  2JJ4 D;  1Y5I B;  1J5O A;  2CUY A;  4F4Z A;  3AHP A;  2CJB A;  2KYZ A;  2FHO B;  2LEB A;  1S49 A;  1DLO A;  4A8S A;  4DPY A;  1U4B A;  2ERR A;  1X5T A;  4PWD A;  4GVB B;  1ROF A;  1AUD A;  2XLK A;  1OQ3 A;  2BJ8 A;  3RYL A;  4I7F B;  4RWX A;  4X66 J;  3SDE A;  3QIP A;  4UY8 T;  4RW8 B;  1IBC B;  2JSX A;  4K4V A;  3ENW A;  2DNQ A;  1KEK A;  2GIQ A;  3W64 A;  4Q8F A;  2R7S A;  2NSC A;  5J2Q B;  1JIH A;  2JC1 A;  2XHC A;  4KRW A;  3TUI C;  3M8P B;  4ID8 A;  4C2M A;  3CDA A;  5DQG A;  2MKH A;  4C0B A;  2PDA A;  4OJ1 A;  5KFX A;  1UVK A;  1S48 A;  2G0J A;  4USI A;  1MU2 A;  3IM8 A;  3UN2 A;  2QT7 A;  4DFJ A;  2CQH A;  1SQF A;  1Y4Z B;  3DRX A;  1WEZ A;  3F73 A;  3PRD A;  1ZTT A;  3JTO A;  4C97 A;  2OTL S;  3TQE A;  3MGJ A;  4LR8 A;  4PAB A;  1WSV A;  3QZ8 A;  3CDB A;  1H72 C;  1SH3 A;  2NXU A;  1X5S A;  3G6V A;  1WTB A;  4RR5 A;  1C1B B;  3CUL A;  1PIL A;  3V5R A;  4OYX A;  3VWS A;  1KFD A;  4NLG A;  3MHY A;  3C19 A;  5CAA A;  2UXD J;  4K4T A;  4G65 A;  2CJ9 A;  1R0B G;  3QT5 A;  2BJ1 A;  4U96 A;  2YVS A;  4IOB A;  2BVZ A;  4TLQ A;  2ASY A;  1OYD A;  3DRR B;  5HRO A;  1ZM9 A;  4LIR A;  1C0U A;  2HZA A;  3DOL A;  3L09 A;  2DRB A;  4LSL A;  1R8A A;  4ED2 A;  4JI4 F;  4DR4 J;  1FXR A;  1VQS A;  3CWJ A;  2BKP A;  4OV1 A;  5E33 A;  2WVB A;  2E1M C;  5DS7 A;  4OJH A;  4CLS A;  3TUJ C;  4U7C A;  1T94 A;  3NXZ A;  3GFH A;  2CXE A;  3D5M A;  4DSE A;  1RLD A;  2RHS B;  5F0U A;  3IP0 A;  2JEG A;  3QGG A;  4F67 A;  1S0M A;  4IFV A;  1FKP B;  4DR2 F;  1JJC B;  3NGR A;  1ZBT A;  4QIW D;  4HL9 A;  4X65 J;  4QPT A;  3AJ1 A;  4YS2 A;  5HBM B;  1KP6 A;  2KJV A;  3N9U C;  3OUY B;  2VG6 B;  3HZG A;  1Q5Y A;  4J9V A;  1RA6 A;  3KHR A;  2HLT A;  3DLJ A;  4TN2 A;  2VJV A;  7AT1 B;  1U26 A;  1IWA A;  4XK8 C;  2R2T A;  2UVV A;  4M5I A;  2MQO A;  1BD6 A;  1RWN B;  2OIH A;  1WHV A;  2UVW A;  1S7I A;  1JJH A;  1C4A A;  4RUA A;  2ROE A;  4LT6 A;  5EWF A;  1NSP A;  4USH A;  4UZC A;  2D9O A;  4Y2K A;  3GIM A;  2ASD A;  1YI2 S;  2Z8Q A;  2HRY A;  1BLU A;  4O0I A;  4JI6 J;  3S8S A;  2DXD A;  1YJR A;  4LFC F;  2AGP A;  1S1T A;  4AXI A;  4QW9 A;  2FY1 A;  1D8Y A;  4U95 A;  2XGP A;  2ZH2 A;  2NXE A;  2VA3 A;  4DR6 J;  2DT9 A;  4B9T A;  3CJ4 A;  2Z2M A;  2A1B A;  1RU2 A;  2CPY A;  3TAM A;  3W8G A;  1LWE A;  2BOA A;  4PG6 A;  3GIR A;  2JDJ A;  2LEA A;  4ECZ A;  4ED8 A;  3DDI A;  2JVR A;  2H4Y B;  3R2C J;  4YY3 F;  1B70 B;  4I68 A;  2FB0 A;  3N5F A;  3LAL A;  2I5J A;  4CZC A;  1NK7 A;  1RT1 A;  4UW2 A;  2BQ3 A;  1U1O A;  5IT0 A;  1VQ8 S;  2VG5 A;  1KHW A;  2YY3 A;  3ZZP A;  4CI0 B;  4RBT A;  3GII A;  3HUL A;  4XO0 A;  3G96 A;  1U8S A;  4KGX B;  2BE2 B;  2VFS A;  4KHM A;  2RD5 C;  2BM0 A;  3KNA A;  1HNZ J;  4EUV A;  3MMB B;  1N5S A;  1WNE A;  2CJK A;  4MT1 A;  5A8R B;  1N5Y B;  2VPY B;  2YKP A;  4X2B A;  2RDD A;  1E6V A;  4PXD A;  1PO6 A;  1Y10 A;  2LLZ A;  3FEY B;  4QPX A;  5HAO A;  4B9L A;  1I1G A;  5C2G A;  3KG1 A;  4KGM A;  3KHH A;  5KFG A;  1W2I A;  4OX7 A;  3LPE A;  4JI0 J;  1Q78 A;  3B6B A;  4LF5 F;  3GR0 A;  2ZHO A;  2GC8 A;  2AV5 A;  3MMA A;  5A2Q U;  5B0C A;  2I6W A;  3N6L A;  4UTG A;  3RBE A;  1HD0 A;  1QAY A;  2MJU A;  3R5D A;  2BA9 A;  1HL6 A;  2ZE2 B;  1V3S A;  3NEK A;  3HX9 A;  1NKB A;  3VAH A;  2R8J A;  2JEJ A;  1RYS A;  3OL6 A;  2VF3 A;  1SUQ A;  2ZNZ A;  4TY9 A;  3EVW A;  3I32 A;  2VDH A;  1NK9 A;  5LL6 d;  1RAF B;  2VFU A;  4BLG A;  4WK1 A;  3MD3 A;  2BYC A;  3ZTR A;  2HHS A;  4LF7 J;  1B4S A;  1OY9 A;  2HZC A;  5H9F J;  5THW A;  1HWL A;  4C3L A;  1Y11 A;  4IRC A;  2HHU A;  3TYT A;  3ISZ A;  3H4D A;  4EI2 A;  4UUX A;  5KT4 A;  3V6J A;  1HNW F;  2UUC F;  4ZCI A;  2XMJ A;  2VH7 A;  1UZH A;  3L7U A;  1FNO A;  1SB6 A;  4KFB A;  2GQC A;  3I0R A;  1RU1 A;  2M8H A;  3FBE A;  4RL1 A;  1WDD A;  5ETK A;  4ZVF A;  1SKW A;  1S59 A;  2IVF B;  1TKZ B;  3BQ2 A;  3CCR S;  2IVY A;  2RNE A;  2YTC A;  4EWT A;  4V19 X;  4I69 A;  2LCW A;  1E6Y B;  1WF0 A;  2OPR B;  5J2M B;  3O2I A;  3CDU A;  3GJR B;  1RSC A;  4ZP7 A;  1BGX T;  4B9V A;  4HAC B;  4KV8 B;  5CCM A;  4MKV A;  5EDW A;  3O44 A;  4AXJ A;  4IFY B;  4FYW B;  4ZP8 A;  5BYQ A;  3T1Y J;  1IR1 A;  4RBU A;  3JSM B;  1IKY B;  3RBX A;  2W4C A;  5EN1 A;  3T9N A;  1WWH A;  1W7W A;  3CVK A;  3ET6 A;  1S6Q A;  4QZV B;  2HFN A;  2B9E A;  1VK3 A;  5DLG A;  2V4R A;  2MZS A;  2LDY A;  4K4Z A;  2W2M P;  1VQL S;  4M5N A;  2F7V A;  2CAJ A;  1OWX A;  2RU9 A;  1IJF B;  2ZD1 B;  2LXF A;  5IXU A;  2MGZ B;  4F0M A;  1UVL A;  2FVS A;  5EUH A;  3M9N B;  3VGV A;  4A8M P;  4K4Y A;  4RW7 B;  2AF6 A;  2R7U A;  5A76 A;  4HDH A;  1QE1 A;  2W2N P;  1FKO A;  4AT1 B;  4CM0 A;  3BPD A;  1N52 B;  3D66 A;  4NL5 A;  3GG1 A;  3F0N A;  3ZXW A;  3W65 A;  5SUH A;  1FEH A;  3BBB A;  1WSR A;  4LF4 J;  2VBY A;  2MHE A;  2XS5 A;  1DUR A;  1HYS B;  3TR5 A;  2DH9 A;  3T1H J;  3SCI E;  4H4O A;  2RH3 A;  1KWM A;  3CJ8 A;  2ZHA A;  2V94 A;  2V4J A;  4CO5 A;  3CNQ P;  3EGN A;  4ETX A;  2X3D A;  2HHH J;  4RNF A;  4B9N A;  1NK4 A;  2V5H G;  4LF9 J;  5EWG A;  5DO2 A;  4MTP A;  4JV0 A;  5LMU F;  1WC0 A;  3MM5 B;  3BSO A;  1Y3J A;  2CZV C;  4DJB A;  4URS A;  4R25 A;  1TKT A;  3CME S;  5T7L B;  2GVZ B;  3JAM Y;  1WDT A;  2P5V A;  2KVI A;  4WPA A;  2UV8 G;  3BGO P;  3NGD A;  2AJ2 A;  5IOL A;  2RE1 A;  3ETO A;  3BKT A;  2ZKT A;  4ED6 A;  1S72 S;  1BY9 A;  4AQY J;  5BYS A;  2IMW P;  1IXK A;  1T9V A;  3CC4 S;  2DCU B;  3HHN B;  2BRL A;  2UXB F;  2DH8 A;  3MWB A;  3VAJ A;  2F65 A;  4C48 A;  1FRM A;  3JXO A;  2G1D A;  2E5G A;  1N56 A;  2IRX A;  1HNX F;  2XMK A;  2OD6 A;  3PW4 A;  1S9G A;  4EBD A;  3EYZ A;  3W5Z A;  2XQC A;  1X4H A;  3UPF A;  1S1W A;  3U1L A;  5J1E A;  4ALZ A;  4DV4 J;  5CA5 A;  2J76 E;  3S01 A;  2QLB B;  2VA2 A;  4RW4 B;  1RAD B;  3NP5 A;  4ZIV A;  1G4C A;  3CO9 A;  2DYA A;  1RTD B;  3MM7 B;  4I56 A;  3NCP A;  4X4V A;  2DR8 A;  2HFU A;  4NLT A;  4NLV A;  5KFF A;  3MR3 A;  4ZVE A;  1TU0 B;  3UI3 A;  3A8K A;  5HQL A;  3Q86 A;  1HBM B;  3IR6 B;  3TA2 A;  2PC6 A;  4X4O A;  3OTO J;  1S99 A;  4JI7 J;  5IWA F;  3RB6 A;  4JI2 J;  3D0H E;  3M9O B;  4O3P A;  2IJN A;  3HVT A;  2ZBP A;  4P72 A;  5ETT A;  1TR0 A;  4USV A;  3E01 A;  1REV A;  4DZ6 A;  2R7Q A;  1F5B A;  2JZ5 A;  4DR7 J;  2R7O A;  3MUT P;  4K7Q A;  4DS4 A;  3KDO A;  1IBM F;  2WB4 A;  5ETS A;  1VQ9 S;  1JLA B;  3SIP B;  2HGM A;  3BBC A;  1JB0 C;  2IAJ A;  2ZH5 A;  2B5J B;  4LR7 A;  3NMR A;  4ZDN A;  3P8B B;  4F4A A;  5C42 A;  2J6S A;  1VRT B;  1RHJ B;  3Q8V A;  3QRP A;  4BDP A;  3ULH A;  3AD7 C;  3LGH A;  2YNH B;  1B64 A;  4LVO P;  2PEB A;  3PRB A;  4RKU C;  3KYL A;  3BGR A;  2Z58 B;  4ZOS A;  4HKQ A;  2VFT A;  4K59 A;  1VS3 A;  1REG X;  4M95 A;  1U09 A;  2XS7 A;  2FHK A;  2H1Y A;  4K2J A;  4MK9 A;  3AB2 B;  1RHK B;  1SIW B;  5D4L A;  1J5O B;  5GAG U;  3GYG A;  4A8W A;  3NCR A;  1DLO B;  3M2U A;  2HIQ A;  3PHE A;  4ZMM A;  3RR7 A;  3FCW A;  3BYR A;  4RNO A;  4ECX A;  2O66 A;  1HAR A;  4PWD B;  2DHX A;  4DSK A;  1FES A;  1U25 A;  4LFA F;  3VAF A;  2CA9 A;  5K14 A;  4QJV A;  1PGZ A;  4NZ6 A;  2CFX A;  4K0K F;  1TL4 A;  3QIP B;  1Z2L A;  4HHJ A;  5KFC A;  3A1Y G;  3EXC X;  4DMZ A;  3MM9 A;  2ACY A;  3N01 A;  2HKE A;  3VAL A;  1U1P A;  2DNZ A;  4F36 A;  2CJQ A;  3Q83 A;  2VPX B;  4PG5 A;  4IH7 A;  3OR2 A;  1WHY A;  4O4G A;  4NCA A;  3TA1 A;  3SSR A;  1XNR F;  1MU2 B;  1S5Z A;  3THV A;  3CJ0 A;  1NH8 A;  4QWE A;  3THP A;  1VR6 A;  3FCV A;  1VDH A;  4RW9 A;  4OFZ A;  2OFG X;  3AOA A;  3TVK A;  1YTY A;  4OLO A;  4A47 A;  1U02 A;  5GAD U;  4OLP A;  3B54 A;  4G6V B;  3KJQ B;  3EX7 B;  1KQS R;  3PX6 A;  2JX2 A;  3DU6 A;  4OYB A;  2A10 A;  2GHV C;  1M1K T;  2W9B A;  3QAU A;  5E3R A;  1H74 A;  5G4D A;  2DHH A;  4DSJ A;  2WRM A;  3MF5 A;  4A8F A;  1NSQ A;  1U45 A;  3DXB A;  2Q3P A;  3CE8 A;  1YRT A;  4MKY A;  5JVG Q;  5HRO B;  1FO1 A;  2LYV A;  1C0U B;  3DOL B;  4NWB A;  4LSL B;  3BKU A;  3UO0 A;  4GVL A;  4I67 A;  3MPV A;  1WKJ A;  3C6T A;  2M2B A;  3PW5 A;  3Q2T C;  3PJW A;  1T8E A;  3B78 A;  1ZM2 A;  3DHW C;  4CLK A;  4UZB A;  1SC1 B;  1TK0 A;  4IFV B;  4D3H A;  1J5E F;  1UEK A;  3I5B A;  2FJX A;  4DQS A;  3KHL A;  1MN9 A;  4DL0 C;  3FMW A;  3QID A;  3DLH A;  2QX0 A;  1YBT A;  3BDP A;  5EGY A;  2XSF A;  2HK3 A;  2NXJ A;  2FLL A;  2FHJ A;  4AFF A;  6FDR A;  1GTE A;  1M1G A;  5I3Q A;  4OYW A;  1OPZ A;  1FER A;  3PO4 A;  4KQZ A;  2OPP A;  2AYG A;  2FD2 A;  3H20 A;  4IDK B;  2QMW A;  2CPF A;  2W1B A;  5L39 A;  1S1V A;  1Q16 B;  4JI4 J;  4ZPD A;  1JK9 B;  4RNN A;  4RU9 A;  1W2B R;  2HS4 A;  1VQ5 S;  3HT0 A;  3F41 A;  4V1A k;  5L46 A;  4W92 B;  2YKA A;  1RKJ A;  3X1L B;  2HWI A;  1FNX H;  1D0E A;  2AX1 A;  2DGU A;  3P5B P;  3T41 A;  1OIA A;  1GAO A;  2XG8 A;  4HH1 A;  3DGV A;  3Q2S C;  3QJP A;  2E5L J;  2UUW A;  3D1O A;  1S1T B;  4DSL A;  1SJQ A;  3MD1 A;  1RA7 A;  3D3C J;  5J2P B;  2HRU A;  3HK2 A;  1AW0 A;  3HO1 A;  4N56 A;  1CJV A;  2BJ7 A;  2DR6 A;  2OJ3 A;  4C3K A;  2OH2 A;  3I9Z A;  1QSY A;  1T02 A;  1Q81 T;  2WVF A;  2VUG A;  4IUF A;  2XZD B;  2C2Z B;  2HYI B;  1RIS A;  3TAM B;  1LWE B;  3CCU S;  4F7V A;  1C4C A;  4Z7C A;  4KIA A;  3RRH A;  1TQL A;  4Y3C A;  1IJE B;  1PJ6 A;  2KN4 A;  4GC6 A;  3FQL A;  3HP6 A;  4U67 Q;  2GW8 A;  1UET A;  2ZWP A;  2EFO A;  2EK1 A;  1WKK A;  2A3J A;  2I5J B;  2VDI A;  4QWC A;  3C6U A;  1LK7 A;  1UW4 A;  2PSZ A;  3FBB A;  4OZN A;  2F4F A;  2VG5 B;  4CT8 A;  2ZUG A;  3KK2 A;  1WOP A;  4CH0 S;  4LFC J;  5IT9 U;  3X3U A;  4EU0 A;  4ED7 A;  1Q7Y T;  2BUN A;  1FJC A;  4R8U A;  1SIZ A;  2H54 B;  1MG7 A;  4CP5 A;  1NZ8 A;  3ZTP A;  1OY8 A;  2O5D A;  4FVC A;  1DZ5 A;  2B51 A;  4ZCK A;  1KTQ A;  1RBL A;  4C11 A;  2QLX A;  3BB5 A;  5DM7 Q;  1CEZ A;  3O6Q A;  3DDN A;  4M5K A;  4IR1 A;  4NA3 A;  3LUY A;  3U27 A;  3T5J A;  4QIG A;  1E6V B;  4YY3 J;  3O3L A;  1HWJ A;  3EIC A;  2DKO B;  3CB4 A;  3HPO A;  3OVB A;  2FUG 9;  2ZHB A;  4OHV A;  1OY6 A;  2RAQ A;  2MZR A;  4AE5 A;  2N4D A;  3KJV A;  1NK6 A;  3MZI A;  1HWI A;  2JFK A;  3QRR A;  5KG6 A;  4MYU A;  4LMZ A;  1M5S A;  2QLW A;  1SQE A;  3H59 A;  2ZJP Q;  1RAG B;  3I6P A;  2RUS A;  3PY8 A;  4F50 A;  3PZP A;  1AB8 A;  4JUZ A;  3WBZ A;  1WTF A;  3IO1 A;  2Y8W A;  2QIF A;  2XYH B;  3PYD A;  1SL0 A;  2OML A;  4KY3 A;  4B3S F;  1U47 A;  3K0J A;  2WTF A;  2W9A A;  3P3D A;  1SUQ B;  1CJK A;  1VRQ C;  1HNI A;  3VGS A;  1B0P A;  4URG A;  2BKO A;  4FXV A;  3CCV S;  1O0P A;  4B3T F;  3AOD A;  3QNW B;  1ZPV A;  2ZUA A;  2HVD A;  5KFY A;  2J5A A;  5DDQ C;  2Q1L A;  3EE3 A;  2NUH A;  1R7I A;  2VOP A;  2ZVI A;  1X4D A;  1RK8 A;  4CLY A;  2RJZ A;  4KSE B;  1S0V A;  5D77 A;  2HFO A;  4NEY A;  3EXY A;  1RCX B;  4LF5 J;  3RGI A;  3R97 A;  1IR2 A;  2QSW A;  1W26 A;  2UV8 A;  4DBQ A;  1HLW A;  4KFB B;  2RRN A;  3I0R B;  3K58 A;  3MR5 A;  1OS5 A;  4ES2 A;  4HT7 A;  4EBE A;  3FCH A;  1VQK S;  3VCD A;  5H9F K;  1U2F A;  3HD2 A;  1YJ7 A;  3P6Y C;  5ETL A;  2R2S A;  5J1N A;  4C8N A;  3BQ1 A;  3OBI A;  3FKB A;  4CLF A;  1QSL A;  4OI0 A;  5CD4 H;  3CUN A;  2XYG B;  1VOM A;  4IH5 A;  2QC3 A;  3US5 A;  4NYZ A;  3ET6 B;  5CZV A;  2VC1 A;  3OXF A;  1J27 A;  4ZLP A;  1HNW J;  4BC7 A;  2UUC J;  1IQT A;  3RW7 A;  3AJD A;  1NSK L;  2FDN A;  2B4O A;  5K8N A;  4QWD A;  4DZD A;  1GXU A;  1CSJ A;  3A8E A;  4I4B A;  4M5M A;  3OHA A;  2XMW A;  3PJX A;  2EFQ A;  3VGT A;  1JLE A;  2B4P A;  3CJK B;  2OP5 A;  2MKI A;  4OZL A;  1FKO B;  3BO3 A;  1NU4 A;  2QLJ B;  4QR0 A;  3CCZ A;  3Q8Y A;  3Q0A A;  3CD6 S;  2F8M A;  3IRX A;  3BM7 A;  2DPI A;  3EMT A;  4X4U A;  3MAH A;  1Q82 T;  3FK4 A;  4HI2 A;  4MIB A;  2QRR A;  2ZBC A;  3LWL A;  3UN5 A;  3TQ1 A;  1S77 D;  1RT2 A;  2V2K A;  2PFF B;  4ZVH A;  4H4O B;  4LF1 A;  3Q24 A;  2J0X A;  3GSD A;  4PAA A;  4USW A;  3LGN A;  1YZ7 A;  2V4J B;  2IHR 1;  4NLW A;  5ADZ A;  3W63 A;  3D6M B;  2GCF A;  2UU9 J;  1FFS B;  1NAQ A;  4I6Y A;  2K3K A;  1R43 A;  3T5K A;  2NPI A;  1Q8K A;  2XCA A;  2EC0 A;  1PAE X;  1GH8 A;  1TKT B;  3GPA A;  4QYZ J;  2F3J A;  2KRR A;  3OD2 A;  3LAK A;  2C28 A;  5KFT A;  2D41 A;  7FDR A;  2P2C B;  4EGL A;  2ZH6 A;  1RJJ A;  2CWK A;  4DV5 F;  2C1E B;  1S0N A;  1YJT A;  5KFE A;  4PXC A;  5A2Q Y;  2H48 B;  1NRK A;  4DV2 F;  2JRS A;  3K5O A;  4R0J A;  3QSY B;  2VBW A;  3MEG A;  3V6D A;  3H5X A;  3LQV A;  4I2P A;  2PA8 D;  2WBR A;  4X4P A;  1D1U A;  1HQE A;  1Z1Z A;  2V68 A;  5IZH A;  1EZZ B;  3D67 A;  4PQU A;  5KG1 A;  1S9G B;  2AX0 A;  4EO8 A;  2M9K A;  1NKC A;  3NOG A;  1GMV A;  5A8W A;  4DF4 A;  5J1E B;  3LO3 A;  1BWE A;  3F44 A;  4IOA Q;  4FF1 A;  3DLB A;  3SEO A;  1H0H B;  1ZAX A;  3TEG A;  1NK0 A;  1QVF R;  2QL7 B;  1RAB B;  3LTO A;  1G1X A;  4NML A;  3VZH A;  1R0A A;  1V5I B;  5DJB A;  4ZIT A;  4XAK A;  4I7F A;  2CQP A;  4RW8 A;  4ED1 A;  2VIC A;  2GAH C;  4YHH F;  2UXB J;  1R6V A;  3DGP B;  3PW0 A;  2R3V A;  1NJZ A;  4DF8 A;  4CLT A;  2VBZ A;  4KTQ A;  5CYJ A;  3R6L B;  5C25 A;  2LQB A;  1H2T Z;  3FRY A;  3M8P A;  3D28 A;  1VYA A;  3T6J A;  2GVD A;  2HWT A;  1HNX J;  3QSI A;  1WF1 A;  3HVT B;  3LAN A;  3C66 A;  4NCB A;  3E01 B;  1NBE B;  1REV B;  3QQC D;  2IJR A;  1JJ4 A;  4WFA Q;  2Z2Y B;  3BN7 A;  2UUT A;  2VB6 A;  3MMJ A;  1PSD A;  2MQP A;  2QEX S;  4G1Q A;  2RKI B;  4JI8 F; 
#chains in the Genus database with same CATH homology
 3D3B J;  4LFB J;  4LF8 J;  3JAM U;  5AJ3 J;  5A2Q U;  4X66 J;  2UU9 J;  4DR3 J;  3OTO J;  4AQY J;  4KYZ A;  4B3S J;  1N36 J;  2MTL A;  4JI7 J;  1HNW J;  2UUA J;  2UUC J;  5IWA J;  2MEW A;  4JI2 J;  4B3M J;  4YY3 J;  5FLX U;  4LF4 J;  4NEY A;  4DR4 J;  4B3T J;  4RJV A;  4JV5 J;  4LF5 J;  2F4V J;  2VQE J;  4JI8 J;  1XMO J;  3W1Y C;  1N33 J;  2MQ8 A;  3T1H J;  1N34 J;  1N32 J;  2ZM6 J;  4GKK J;  1J5E J;  1XMQ J;  4JI6 J;  4DR7 J;  4NXM J;  2UXB J;  5LMN J;  3J81 U;  3T1Y J;  4NXN J;  1HNZ J;  1IBM J;  3R2D J;  4JI4 J;  2HHH J;  4JI1 J;  4JI5 J;  3J80 U;  4DR6 J;  4DV4 J;  4JYA J;  4V1A k;  4HHU A;  4DV2 J;  4LF7 J;  4B3R J;  1XNQ J;  4LF9 J;  4DUY J;  2UUB J;  4DR2 J;  1HNX J;  4DR5 J;  4X65 J;  4LFC J;  4YHH J;  5IT9 U;  4DV6 J;  4LFA J;  4OX9 J;  5LMU J;  1FJG J;  4DUZ J;  4X64 J;  2KL8 A;  4KY3 A;  4JI3 J;  5BR8 J;  2KVQ E;  4LF6 J;  4DV0 J;  4DV5 J;  4K0K J;  4PWW A;  4KHP J;  4DV1 J;  3J7A N;  4NEZ A;  2E5L J;  1IBL J;  2UXD J;  1I94 J;  3R2C J;  4DV3 J;  3IMQ J;  1IBK J;  1HR0 J;  3D3C J;  1XNR J;  4GKJ J;  4DR1 J;  2VQF J;  4DV7 J;  5LM7 E;  4X62 J;  4JI0 J;  2UXC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...