4KHPJ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4khpJ00
4KHPJ 2E5LJ 2ZM6J 5BR8J 1HNZJ 4KY3A 4DUYJ 4DV3J 3IMQJ 4AQYJ 4DR3J 4DV0J 4B3RJ 1N33J 1IBKJ 4LFBJ 1IBMJ 1HR0J 3T1HJ 4K0KJ 4JI1J 2HHHJ 2UXCJ 4PWWA 4DV1J 4JV5J 4NEZA 4LFAJ 4JI8J 3J7AN 3D3BJ 2UXBJ 4B3MJ 4RJVA 4DR5J 1I94J 4NEYA 1XMQJ 4LFCJ 2MEWA 3J81U 4LF8J 5A2QU 4JI3J 2MQ8A 5LMUJ 4KYZA 2KVQE 3J80U 5FLXU 4JI5J 4LF4J 2F4VJ 4DV4J 4HHUA 1FJGJ 2KL8A 4JI0J 4DR4J 4DR7J 4X66J 3JAMU 3D3CJ 2VQFJ 4X62J 4DR2J 4DR6J 1N36J 2MTLA 3W1YC 1N32J 5LMNJ 4LF9J 4DV6J 4V1Ak 4NXMJ 4JYAJ 4YHHJ 4JI7J 4YY3J 5AJ3J 1J5EJ 2UUBJ 4X64J 4OX9J 4LF5J 4B3TJ 5IT9U 4DV2J 4LF6J 4GKKJ 1XMOJ 4X65J 4NXNJ 3R2CJ 4DV5J 4JI4J 1HNWJ 4GKJJ 4JI6J 3T1YJ 1N34J 4B3SJ 1XNRJ 4LF7J 1IBLJ 2UUAJ 5IWAJ 1HNXJ 4DUZJ 3OTOJ 2VQEJ 4DV7J 5LM7E 4JI2J 2UU9J 2UXDJ 1XNQJ 3R2DJ 2UUCJ 4DR1J
chains in the Genus database with same CATH superfamily
3GYGA 2E5LJ 2CQ2A 3U1NA 1WELA 3MCNA 3UD4P 3PACA 4DS5A 1TL7A 1S7IA 2ZNZA 2PDAA 3UR0A 2FLPA 5DDRC 2BACA 2B5JB 1M1HA 2JLFA 1Y4ZB 4OYMA 3H4DA 2W9AA 3NWGA 2YNIA 2LVWA 3DGPA 2R7RA 1RI7A 3MEKA 5KFEA 4ZP6A 4P6QA 2ZE2A 1JKHB 1T7PA 4DFKA 4JI5J 4AQYF 3BYPA 3MMJA 2BZ2A 2AGPA 4F02A 2G0CA 4O44B 2VBXA 3ISND 1FDNA 3UD5A 3SYZA 4OI2A 1KLNA 2OO4A 1HWUA 1IKXB 1HHTP 1PC4A 2H5EA 3GJSB 2GIRA 2BJ1A 2IAJA 5K5MA 3GJTB 2M0GB 1P8GA 4ZPVR 5BYQA 2CPEA 3QFHA 1RBLA 4JYAF 4F4XA 4NCGB 5CYJA 3CMES 4Z2XA 4OYXA 3GQCA 2CPDA 4C8NA 2IMWP 1IQZA 1SKWA 2JEFA 2R7WA 3FUYA 1N52B 1SV5B 1Y0HA 3SFUA 1F5BA 5CZVA 3RR7A 4C0HA 3T6BA 3BN4A 5FIIA 1VK3A 2NPIA 2FTRA 1RA6A 4ZP8A 2IA6A 3TO8A 1RT6A 3L09A 4KHPF 4LSNA 2AEMA 3KJVB 5IV3A 1GNKA 3W2WB 1ZETA 4QZVB 5BXIA 3EZ5A 2B6AA 1FVSA 4ID8A 4GC7A 3T19A 1AA1B 2ZHBA 5D78A 4ZPTR 4B3MF 1I94F 4P72A 3UNGC 2CQ1A 4LF8F 1Q8IA 2OEKA 2FLNA 3JTPA 4W92B 1YJUA 1TR0A 3DOLB 1XC9A 2Z30B 2HBQB 4RW6B 1UZDA 5FLXY 3I5AA 3I82A 4OJGA 4RKUC 4DZ6A 4LF5F 4J9UE 1XNQJ 1WC5A 2IC3B 2PEBA 1S1TA 1VI7A 4IOCQ 1LXJA 3LALA 2HVDA 3W5ZA 2Z57B 2GC8A 3H7HB 1ACMB 4OJ1A 1YLXA 2J8AA 2UV8A 2KTQA 4CWBA 4DL0C 4O4GA 4FVMA 2VG6A 3V5RA 4OFZA 3N4WA 3OD2A 4Q0BA 4JV2A 2EFQA 1U1LA 3S7RA 4FF4A 4DMZA 3OXGA 1U09A 3G82A 4FPIA 3H2LA 5CZXA 2HHWA 2F63A 1H7XA 2ZJRQ 1NKCA 3C15A 2R8IA 1DHMA 1R8CA 1OSDA 2JHEA 2FY8A 2OFGX 4WWSA 4LF6J 1FCAA 2O3DA 3IS9A 3UR3C 1E6VB 3M2VA 3W5YA 2RVJA 1FRLA 3BDEA 3HSJA 4DSJA 3TUIC 2HMIA 2BDPA 2ACYA 4AUKA 2L41A 4UY85 4CM0A 2P9CA 3GP9A 1U6ZA 4E0DA 3PM9A 5KFAA 1FNXH 1RT1A 2FQQB 2LEAA 3F41A 3T1YF 2DJWA 2M70A 1GMVA 5CYMB 3A12A 2UUAF 4OI6A 1TK8A 1OYEA 3D54A 2OPRB 4EFAC 3WQPA 4FXDA 2DNRA 3B4MA 4QIWD 4TKTA 3E3XA 3RBDA 1GTEA 3OFEA 3VWSA 1U1QA 4HT7A 2RU3A 1IBMF 2UZAA 4HH0A 5KFGA 2FJXA 5KFSA 1S97A 4Y2AA 3FMWA 3IAM9 3OT9A 2G0JA 3BSCA 5KFOA 1U1NA 1QE1A 4IDKB 2W1BA 3KJQB 1OY9A 4ELVA 3KMQA 1LFPA 4DCPB 2IM3A 4XPCA 5B08A 5D15A 2DY1A 2CA9A 5JUMA 2UP1A 4J9PA 3M30A 1NZAA 1X0FA 3I5CA 2U2FA 4AQYJ 3MAAA 1OS5A 1RABB 2NS1B 4WBFA 3TI0A 3JYTB 1O8BA 3PKMA 3KLGB 4IR1A 3CSKA 3PIOQ 2LA4A 3IR6B 3Q8SB 1ULRA 4KGKA 3AA8A 5I4MA 1U1OA 4DF8A 1P27B 4PWDA 1I3OB 3DGVA 3PCOB 4OJHA 4JYAJ 2P9GA 2LQ5A 4MIWA 1GTHA 1XMQF 5IT9U 3DN9A 1R0AA 4USHA 1C0UB 2OI2A 4KC5A 4I68A 2Z8QA 3DRRB 5A8WB 1TKZB 1HIYA 2RJZA 2AD9A 3H5XA 2VHGA 5KFIA 1LW0A 4GO7X 1DAXA 3TAQA 2IIHA 3NBPA 2RS8A 2QL5B 4ELUA 4MK9A 4PG4A 3Q83A 1WKJA 3IFEA 2ZBPA 1M5HA 3RBXA 4KHPJ 2QX0A 4RR5A 4DU8A 2ZD1A 4CT8A 4KV8B 3W61A 2BRKA 5KFVA 3TAMB 4DX7A 2ZWOA 2HRYA 3GCXP 1RLDA 3M8QA 2HGNA 1QAJA 1VC6A 1KHVA 3KNAA 2W01A 4K50A 2RUSA 2UU9F 4KQZA 4B3MJ 1I94J 1RT4B 4NZ6A 4LF8J 5BR8F 2CQCA 1ZA1B 4DPTA 2A10A 1RT7B 2AJFE 1BGXT 3PKYA 4N8NA 4K8RA 2C2ZB 2BE2A 3QIPB 4LF5J 4O3PA 1UEKA 2YWKA 5ITHA 1S7HA 4C3KA 5KT4A 3OLBA 4LR9A 2MKKA 5KFMA 3BSNA 1CBKA 1U25A 4KPYA 2CPJA 1R6YA 3W60A 1L3SA 1VJWA 2V9KA 3VTIA 4P73A 2K7KA 2CQHA 4ES1A 3G6XA 2G13A 4O3SA 2HS3A 3QGGA 2E9TA 2AU0A 2DGQA 4DFJA 4QIEA 2QN6B 3PX6A 1Q1KA 4Y0FA 2R2RA 3FBBA 2V2QA 3DU6A 5KFYA 4MYUA 1KQSR 1DY3A 1RXOB 1B3TA 3GIRA 2PE8A 5G0RA 3AJ1A 3H40A 5J2PA 3PW4A 2M2BA 1D9AA 2IYIA 3QLHA 1IBKF 3HSZA 1BQNA 2HFNA 3P5TL 1JLFB 1JLEB 1CJVA 4JV5F 1UA0A 4CLZA 3RW7A 1RHMB 4IFYA 4H4KA 5ETPA 3J81j 4RW4A 3DU5A 5JMNA 1NH8A 4DV4F 1S6PA 4LIWA 2JDJA 4OZNA 3KK1B 1CJKA 3QT6A 3V6HA 3Q24A 2IDEA 3T1YJ 3MPYA 2F8EX 2XSFA 5KFZA 3KKFA 3LWLA 2PA3A 2UUAJ 1U6FA 3MDFA 4PG5A 5D4OA 4HLBA 1VYAA 2YQ3A 4X4RA 3AA9A 5J2NA 2CUYA 3HHLC 4CLSA 4Q45A 1PG5B 1WF1A 3MEEA 4NI2B 1QAYA 4ZP9A 1UW4A 1MROB 4DX5A 4LF1A 5C24A 2C3OA 2HNDB 1IBMJ 3FRZA 3AOCA 4C8LA 3RRGA 2XLKA 3H2VE 2ZZMA 1GFWB 1RWOB 1UL3A 4LRCA 1FDDA 2XY5A 5LT5A 2DR6A 2JEJA 4KH0B 1TMJA 3O6QA 4ZA1A 2LXIA 3VALA 2ZZTA 3AB2B 4CLTA 2JLEA 2FJEB 3P6YC 3BDPA 4F04B 1BC6A 4DL2A 4DQIA 4ETXA 1X5SA 5KG6A 2VJVA 4F4WA 1TMMA 4H4OB 4RW8A 4ZVGA 3PFEA 4F2SA 2XGQA 1RT5B 3FKBA 3TZXA 1U4BA 3W5XA 2AEFA 3QIDA 3C6UA 1NSQA 4ES3A 1G3OA 1LWXA 2YPYA 1S9FA 2I1RA 2RIJA 3CO0P 3UE2A 4FYVB 1GQEA 1U24A 1H2VZ 3JAMY 1Z2ZA 5HJYA 1M0SA 3SV3A 2IA0A 2PD1A 4C8ZA 3DOMA 3R27A 1WF0A 1FESA 5KFWA 2XMJA 2KKHA 2RNEA 4NCBA 2MHEA 2I5JA 2RQCA 5KG5A 1UWBA 4OZ2A 1IBLF 3SQGA 4WCEQ 4WTOB 1OPIA 4U96A 1XMQJ 5I3UB 1KVIA 2HW3A 1RWWB 4KO0A 2DEJA 1FNOA 2AJ1A 2YNGB 3D68A 3MOZA 1Q79A 1X9MA 1N5YB 1HPZA 4JBCA 2YKPA 2HAIA 2CPZA 2V2VA 2JL9A 4ED1A 4LVOP 3HDSA 4MIBA 4O0IA 3AQOA 3D4JA 2PI4A 2KYZA 5IFMA 3OBIA 5B09A 3QSYB 2VL1A 2HNYA 4RW9B 2UU9J 2CVEA 1X5PA 3U7JA 3JTNA 4LT6A 5BR8J 5HL7Q 2W9CB 3C46A 2GAGC 1URRA 1TVRA 3DHWC 1GT8A 4B3OA 4KHRA 3TA2A 3LGHA 3MCMA 5CH7B 2AW0A 2IRUA 4DQSA 4B9LA 4MKAA 2QYCA 1FEHA 3GONA 2V6AA 5DRKA 3G8TA 3HT0A 1X4GA 3TUZC 2LDIA 4WFXA 2BW7A 4OX7A 2V4JA 2UXBF 1U2FA 1HNIB 3LP2A 1S1XA 4QBUA 4ECUA 1VR6A 2KRBA 3TUJC 1KNZA 1VBYA 1WG1A 4X66F 4J9QA 2SXLA 3OFGA 4ZHRA 3KJFB 2DHAA 2N4CA 3Q8RB 3MM9B 1GX6A 3NLCA 4UTGA 4FDFA 3TQEA 3HHLB 1RHJB 3PW7A 1VBZA 1N54B 2VBZA 1FKAF 3RBEA 3MM5A 2EFPA 4NXNF 4O0NA 2MKSA 1MG7A 3LOUA 3WHIA 1IBKJ 2LU2A 3IN5A 1H7WA 2H48B 4JV5J 2IDLA 3LWMA 1RBAA 1VOMA 2EC2A 2XULA 2OTLS 5I3QA 4Q43A 3KLFB 2WK4A 3MMAB 4DU7A 5KFPA 4RBVA 5J2MA 4I56A 3IRWP 2ZUGA 4J9RA 1AT1B 1VHIA 4DV4J 2BYCA 5LSRA 2G4BA 2EFGA 1TKTB 1NDPA 1VS3A 1RWXB 4OYWA 5A8RB 3PO5A 4X4TA 3O2IA 2AKWB 3GG0A 3H4BA 3W2VB 2F40A 1KFDA 4S0MA 1X0PA 1U1PA 4DBQA 5E3AA 2F4VF 3AY0A 4EK2A 2DRDA 5GAHI 3K5LA 2XHCA 1UPPA 2RHSB 1HW8A 1EZZB 3FVYA 2F7VA 5M2PA 3J80Y 1YTYA 4UOCA 4ZVFA 1Q7LB 2E1PA 3PZPA 2LA6A 2RF2A 3NP5A 4R5PA 1SCJB 3BH7B 1P1TA 3GFHA 1X4BA 3FBEA 3IA0A 3OW2R 2B5JA 1WC1A 1IQTA 2ASJA 2Y1JA 1IJEB 1IVZA 3W9IA 1R0CB 4F3OA 4DUZF 5BYSA 5L38A 5J1EB 3D3BJ 4YS2A 2COLA 3RW6A 1WHYA 3E51A 3FEXB 3VZHA 4F50A 3OTEA 1BMQB 2F5GA 3KLIB 1NK8A 4O44A 3NGRA 4C3MA 1FFSB 1RB0A 1Q4RA 2ZH8A 1VIOA 4DV1F 2W7AA 5C42A 4WK1A 3CD0A 2XNRA 2HGLA 2J0WA 5A2QY 1S6QB 5AE3A 1NMEB 4E98A 2R2UA 2KFZA 3NXZA 3I6PA 4WFYA 2POKA 3MFIA 1X31C 1HBNB 1TAQA 4K5SA 2DITA 2HFSA 4JI0F 4DR6F 3MUVP 3HVWA 1KFSA 2QFIA 4NCGA 4DV6F 2DNZA 1IBLJ 3THTA 3CJ8A 4WE1A 1JLQA 2ALZA 4NLPA 4O23A 3R5CA 1ELOA 3D0IE 1SV5A 4I1TA 2KFNA 3UQSA 1U2CA 1SIWB 2R42A 4M8LA 4AE5A 1FWLA 3EGVA 3K89A 5B0EA 2QTWA 5L8RC 3W2WA 4NLQA 2UV8G 3TUPA 1EKRA 5ETLA 5KT5A 3WIUA 1S99A 2MTLA 2FHMA 1VRTA 1AUDA 1NK9A 1HWLA 4N47A 3DM2B 4CO2A 2AEJA 2VPYB 2RB7A 3MEGB 4Q5VA 3DOLA 3MEDB 4I64A 1NNDA 3JB9k 4RBUA 4BBYA 3OUYB 1IM6A 4WTYA 4WZQA 4CO3A 4RW6A 3UCZP 4MK7A 3SDEA 3PX4A 1FKOA 4OX9F 1VQ6S 2IC3A 3L7OA 1RAJA 2HKEA 2CNLB 2DGUA 3JS9A 5B0FA 3KLEB 1U8SA 2CJAA 4BWMA 4F4ZA 1B4SA 1T9UA 4BWJA 2BMBA 1V5VA 3HD1A 2GX8A 1NH7A 4LF7F 4OHYA 5K9FA 2VASA 2IJFA 1HNXF 3H5UA 1VQKS 4UUXA 2UXBJ 5IXUA 2W9BB 1I51B 1RWUA 4OV1A 1HL6A 2ZNYA 2RRAA 4DV3F 3CB4A 3CXCR 4X66J 3BF4A 5IV4A 2LKZA 3PTWA 1WC3A 3W7BA 1QM9A 3BQ2A 4QYRA 2YWWA 5GMKa 2YKAA 2JEGA 1KD1T 3ZC4A 3SZ2A 4FF2A 2JH3A 1E6VA 1L3KA 1EHWA 1MNEA 1SL0A 2W4CA 3FJ2A 3K59A 4NXNJ 3OHAA 2DXFA 2CQIA 3TZWA 2MY7A 5K14B 3KUGA 2VONA 3CCRS 2DRAA 3M1VB 5CQGA 1H0HB 5LM7E 5DO2A 1U1KA 3PHTA 4A8OA 7FDRA 1CJUA 2KG0A 2GHVC 5CYMA 1XNRF 3AOBA 1RAIB 1X4CA 4C48A 4FYWB 3MMCB 3JSMB 4I7FA 5DQIA 2OPRA 4ENOA 1QJHA 1ROFA 3BO4A 1R7IA 4KYZA 5AE1A 4TYAA 3UDLA 2F4VJ 3TJAA 1PIEA 1X9SA 3OSNA 1FD8A 4ZVUB 1KTVA 2A1BA 5IOLA 4JOUA 3D6HB 1HI8A 2HVZA 2NSCA 2GVZB 3HHDA 4IG3B 5F3ZA 4IDKA 4ECQA 4F26A 1JXVA 1NJIT 3U27A 3MWBA 3NNHA 3GFYA 2CG8A 3MR5A 3CIMA 2ZITA 2UVRA 2MLZA 3HMJG 4DUZJ 4QPXA 3F56A 5KFRA 1OY6A 4R0EA 3Q8YA 2ZBQA 3PEHA 5KFFA 2XMTA 4ZVRB 1X4FA 1V3SA 3HLUA 2RDIA 1XK8A 4WJBA 2ILZA 1T03B 5D3GB 3T6JA 2FHKA 4DV1J 4DN0A 2C1EB 1UVLA 7FD1A 1EIYB 2EG2A 2Z56B 1Q16B 2B9WA 5GMDA 4OYBA 3UCUP 2BM0A 4ZK7M 3KLGA 4QU6A 2V4QA 4A48A 4CNYA 2Y9HA 2WVFA 4JI0J 2AMCB 1NDCA 5KFTA 4DR6J 1NPPA 4HI2A 2BQRA 1QAXA 4DV6J 2FLOA 1YKWA 4ICLA 2JFKA 4KH1B 2CJYB 4ZP7A 1C0UA 3CCSS 3BH6B 3DRRA 1TKZA 3H20A 3D7SB 5B0CA 3R97A 4ZVTB 3CCLS 1Q82T 1XR7A 4NASA 5HO4A 2FIUA 1WG5A 4WKRA 5T14A 3CJ0A 2XYPB 1Y10A 2VPXB 5HQMA 4KY3A 1CJTB 4KV8A 2NREA 1DBDA 1QSLA 3FBCA 3OFFA 3TQ1A 3BN7A 2HLTA 2XY6A 4ZVHA 1RT4A 5HMXA 3OL8A 1DTQA 4ZCIA 4L75A 1RT7A 2QO3A 5FLXU 4NRUA 2AHOB 5FDLB 4PPZA 3H0PA 1YJTA 3V6DB 3W1YC 2HFUA 4PAAA 1RTDB 3QIPA 3RUBL 2DO4A 3PFOA 3R6LB 2DH8A 3OR1B 4OX9J 2HQIA 2R4FA 1N0VC 4MMOA 4KKOA 5JJBA 1FJGF 1JLAA 4QIVA 2Z58B 4ZCMA 2YKMB 3W65A 1S6UA 5E3CA 3IP0A 3ZNUA 4LF7J 4B9MA 2CNKB 4YHHF 2NCKL 1HNXJ 4QIGA 3KK3B 3LTOA 4OI3A 2PMWA 4DFPA 2LEBA 4GKKF 5B0DA 3K7RA 3QJPA 1YBUA 1TUVA 4DV3J 1H2UX 3LP0A 2PO4A 3P96A 1C1CB 3NCQA 4GO5X 9RUBA 4K59A 3DLHA 4ECZA 4Y00A 2H1YA 2HEKA 4UY8T 2PN6A 1F3VA 1RWKB 4M5HA 3C6TB 1ZZFA 2ADCA 4DFMA 4U95A 5F8JA 4HR2A 3HI9A 4G1QB 1VCTA 4DUYF 2QMWA 2QV6A 1T9YA 3M6XA 1JLFA 5L9NA 3KXDA 2GVDB 2C2NA 4HTJA 3N79A 4MKVA 3OJSA 2XGPA 2XMVA 2OEJA 2VICA 4ANEA 4DG1B 4ECXA 1TL3B 2HS4A 3C16B 2DGSA 3UVJA 3HZEA 2BR0A 1BWEA 3R7BB 1RQ0A 5C2CA 1XR6A 2W2PP 1XNRJ 4NXMF 4AD6A 3GSIA 4TY9A 2C2RA 3FC9A 5B7WA 2FGCA 4Y2MA 3V2UC 1UKUA 2V50A 3R2DJ 4MH8A 2H4WB 3MM8B 1N0UA 4NI2A 3PNIA 2AJ2A 1MROA 2NYIA 4ECSA 2HNDA 2W8LA 4CDIA 2MQOA 3QT8A 2R7OA 1S4FA 1Q7YT 2ZKTA 4U67Q 2QL9B 2CWKA 2HGMA 2EBEA 2OSQA 1NPKA 5KFDA 2WOMA 2XLIA 1KOHA 1YDLA 2CJKA 3HCXA 3CIZA 1ICEB 1LK5A 5D0HA 3SCIE 4QCLA 3DLLQ 1CULA 5HVFA 2N82B 3ZXWA 3I0RA 4NLRA 2V67A 4TNOA 3T1HF 2UXCF 1RWPB 3DRXA 4EU0A 3A4TA 4F0HA 1K0TA 3VAGA 1CS4B 4FXWA 4H4OA 2JWNA 1RT5A 2D74B 2YKNB 4PG8A 3G4SS 2OTJS 2Y8YA 5EDWA 4HACB 3RU0A 3CJ2A 3AD8C 3A1YG 1DJ0A 3N6LA 1WSRA 3FFIA 4I2PB 2WAQD 4AFFA 1RUSA 3OHBA 2V9WA 4M5KA 5I3PA 3Q22A 2J7UA 2B4OA 1PSDA 2DNNA 1H98A 2A6OA 2MKHA 3ZTRA 3B6BA 1IKVB 1EP4B 1KQFB 2XLJA 5HP1B 3DLEB 2A2CA 5CA5A 1XBWA 4RZRA 2QA4G 3UN5A 3G8SA 1S0MA 4NEZA 4WPAA 4HHJA 2PMZD 1SKRA 5I3UA 1IXKA 4XPEA 1NK4A 3I0SB 3DDNA 4CI0B 3IBCB 2EEYA 2MSSA 3DLBA 1RCOB 2NXUA 3KOAA 4UZCA 4Q8FA 4KAIA 5A0YA 4TXSA 3OVSA 1VQLS 3ELHA 1ZOTA 3MECA 1Y5NB 1SXLA 2CJXB 3ILIA 5IQ6A 3P3DA 5T41A 4N77A 5DZ6A 1VRQC 2QLJB 4RNOA 2VG7B 4YB7A 4B02A 1VBXA 2YWGA 2VPWB 5LJ5Y 4C98A 2HSEB 2W9CA 1VRUB 4PWUA 2K2PA 2RMLA 3KLVA 2VUGA 3CCWA 2CQBA 4IG0B 1KOOA 1JLCA 1S76D 4TLRA 5DGBA 4K2JA 4WP9A 5CYQB 4Y3CA 1AZSB 2I2YA 3BSAA 4EMDA 1NDLA 3VGVA 1E6YA 3WX8A 2E9ZA 3RB3A 3KK2B 2ABYA 1R8BA 4W4MA 1KKHA 1RAHB 1FJGJ 4J9LA 5KOWA 5A6PA 1TKDA 1AUSL 5EX0A 3GU0A 4YHHJ 3CMQA 1H38A 2ERRA 3H90A 1WNEA 2A6MA 1PCAA 4ATNA 3IR7B 4FYXB 4D3HA 4Z7CA 4GKKJ 2PI5A 3M2UB 4X4NA 4F4YA 5KT7A 4WU2A 5JXSA 5F9NA 2VG5B 1UVMA 2XMAA 3HHLA 5D77A 1RT3B 4G6VB 1UVNA 3RTVA 2W4DA 3TP2A 5L1JA 3JQKA 3MPVA 3TZYA 4DUYJ 4WF9Q 2OELA 4CZCA 1P6TA 4BC7A 3PJXA 2ZJPQ 1MSWD 1NB2A 3OL6A 3J7AN 4M5DB 3KLFA 3MMAA 4J37A 4MJKA 1X60A 4FZVA 4A8XA 2OEMA 4NX9A 4DWIA 3QSIA 2V68A 2B8QA 1U8WA 4K7QA 1YRUA 5A8RA 2DNGA 3IGVA 3PDNA 4NXMJ 3MOJB 3HSGA 3W2VA 1N5QA 3ZZZA 4P75A 3MPWA 5GMEA 2OPPB 3I9V9 2UVWA 4WIIA 3I4HX 4XDCA 4EI2A 1FA0A 3BKUA 3BB5A 2IFXA 3OQ2A 3MD3A 1CC8A 3BBFA 3PIPQ 5KG0A 2F65A 2JSXA 2D3ZA 1KHWA 4O3RA 4AXIA 1FRIA 3G96A 1LKZA 4ZLNA 3OSPA 3CDWA 5CAAA 1CQMA 2AX0A 3L3CA 3CD6S 3KUHA 3MXHP 3T1HJ 2UXCJ 4KGMA 2F1FA 4DSEA 3HKZD 1SUQB 3GV7B 4WP3A 2ZH4A 3W9JA 1PYSB 3KG4A 3CJSA 2HPUA 4TY8A 5M2RA 2MXYA 3I4PA 3K5PA 3JAMU 2P8IA 2HFVA 2MGZB 2ASLA 2L08A 1S6QA 3WIVA 4R8UB 1JIHA 5EGYA 4HT5A 4ZPDA 4LSZB 3MUMP 1BQXA 3D5MA 2QLXA 2KXFA 2OAUA 4DXLA 1HBNA 2HBRB 2HIYA 1VLOA 3BGRB 4DR4F 2NXCA 1WORA 1RTIA 1S6OA 1FTCA 2Q79A 3HHLD 2HVEA 2EFNA 1DTTA 4GVLA 5EX3A 3POTB 4DPUA 3GMGA 4QQBA 2YY3A 4Y2IA 4DPYA 2F9DA 2QMUB 3NL0A 2YPZA 3LA0A 2DY9A 1SQGA 1U49A 1UJ4A 3KDNA 5A8KB 3IM9A 3F73A 1T3OA 2O67A 1HBOB 1M5SA 1YSJA 4UZBA 2U1AA 4MAKA 2ACMA 2K3KA 6FD1A 5M2UA 1YBTA 2GMLA 1NHUA 2QLBB 4DV7F 2BX6A 2O66A 2CZ9A 2DT9A 2FDNA 4X4PA 2HK3A 3CJKA 4I4BA 2P6SA 4K5RA 3EVWA 1RHQB 1Q5YA 5LMNJ 1XERA 3FRYA 1R31A 4CTAB 1WOOA 2HNZB 5ETTA 1PJ5A 2KI2A 1NPRA 3CCTA 1Y5LB 3R7NB 3CCZA 3MEGA 3FCVA 3OUYA 1R43A 3M6WA 4UF4A 3LGMA 2C2OB 1UFLA 3AOAA 4ZVQB 2KHCA 2ATLA 1NKBA 4A8FA 4QWDA 3P45B 1HBMB 3U1MA 2KU7A 1NKEA 1LOUA 3QO9B 3SXLA 3ZZRA 4RBTA 2IM1A 5F8MA 5K8MA 4A8QA 2L9DA 3H2UB 5B0BA 3MAQA 1W25A 1B7FA 4PZVA 3C19A 3VZIA 5F8GA 4K4WA 3A3NB 4ALZA 2DISA 1R0BG 3EE3A 5K20B 5EWEA 3DRSB 3CT9A 4E2FB 2YX4A 1IR0A 3OVBA 4ZKAA 3J7ZT 4CH1A 4WU3A 2BANB 3JSYA 2M3DA 3MR6A 5HI7A 3T5HA 3DI6B 5K14A 2KVIA 4DR2F 4USIA 1T9XA 4L74A 2JJ4D 2QRRA 3W3SA 3NKYA 1Z2LA 2PFFB 3M1VA 3G2XA 2DIVA 2B8PA 1ZA2B 3LO3A 2YKQA 1O5JA 5KG7A 5ETRA 3QFWA 1FWPA 4RU9A 4A8WA 1WUUA 1TUWA 2B51A 2RHQB 2E1MC 3G8QA 2BQ3A 2MMYA 1X8DA 4X4VA 1Y3JA 5LOQA 1Y9OA 2OD6A 3SCJE 2BM1A 4ID5B 4LQ3A 2HLUA 5D4LA 4U7CA 4K4XA 2HZAA 4ZIWA 1Y5IB 1UFWA 2L9NA 3J80U 2Q6CA 2ZHOA 2Z2YB 2E7XA 1Q86T 5F8IA 1ZTWA 4PUOA 4RPFA 3I96A 4LSLA 2BJ3A 1M1KT 4PQUB 2Y3YA 2DNQA 2YNFB 2G2ZA 5RUBA 1T05A 4R25A 2GVZA 4IG3A 3PW0A 1RTJB 2LQBA 2YQ1A 4LF4F 1JLBB 2G2YA 5H9FK 5KFCA 2FVPA 5G4DA 1IWAA 3R1HA 2W24A 4JB8B 4P9SA 4USWA 1IWGA 4E8UA 3THVA 2OIHA 1SC1B 2C28A 2PSZA 2CPXA 3FDSA 4YR2A 4QR2A 2Y1RI 4OQJA 4GMKA 4NYZA 1RHUB 3BREA 3MHYA 1YITS 1UFKA 1ZBTA 3CUNA 4KGVB 2KJWA 2FVCA 1T0TV 4Y2KA 2UUCF 4PXCA 4FBTA 1UPMB 4ECRA 1FK9A 2HS0A 2WRMA 4DR4J 2XMWA 5KG4A 2YNIB 3JXOA 2QJ3A 3DGPB 3M8RA 1QDUB 4OMFG 5HVHA 2ZE2B 2DYAA 2XCPA 1UA1A 5KFLA 3V81B 2MJUA 1SPBP 2FY1A 4USUA 3BKFA 5F3TA 1U0HB 3CCJS 2PEHA 2BKOA 3TX8A 2CQPA 5HLFB 3VAFA 2AT1B 1N8RT 1AW0A 1KDNA 1J5EF 4Y28C 2NZCA 4DV7J 2O5DA 4USVA 2CIMA 2GGPA 2ILYA 4KIAA 2ZKUA 4NLDA 3DMJB 6FDRA 2V2ZA 4Y6IA 2VODA 4GKJF 1KRPA 2V8DA 2ZH2A 1D9FA 1MLAA 1RAAB 3HVTB 2JX2A 4FNIA 4EYHB 1CG2A 2DK2A 4CRJA 4LMZA 2CG4A 2HBZB 1L3TA 2DD8S 2Z4PA 4ZJOA 2ZBIA 4UQGA 1WEYA 2KG1A 4ZIVA 1OWXA 3R5BA 5B0GA 1WSVA 2GMJA 3V6DA 3KDOA 5HSPA 2UUTA 2XCAA 3OR1A 4TU9A 3VAKA 1K0VA 2VA3A 1RT6B 3VHQA 3T5LA 2B7BB 2K3IA 3G9CA 5I42A 1NRKA 2WSEC 2YKMA 1F2GA 1PJ7A 2KZZA 2VJUA 1HYSA 3W62A 4CYUA 2B6AB 1RA7A 4PG7A 1OSCA 4URGA 1GK8A 3NGDA 2R3VA 4EZ6A 4RL1A 4DS4A 2I38A 4ED3A 4KE5A 3KK3A 4N5SA 1QLNA 2GS8A 2AP6A 2WW8A 4Q8EA 2GAHC 2BE9B 3D0GE 4OHZA 1C1CA 2GQCA 2AZ1A 2AJ4A 3HKWA 4XK8C 4WFBQ 3K5MA 5ETNA 3C6TA 2VBWA 3CNQP 1S1TB 2NXEA 1Z1ZA 4NEYA 5GAGI 4G1QA 3M8YA 3JQJA 2XS5A 3D66A 1UMJA 4RW7B 2D9OA 4DR2J 1SKUB 5DLGA 1YZ7A 3QZ8A 3NS6A 2WZ1A 3HM9A 4DPXA 1H6KX 2GO9A 4IQMA 3C16A 2GA7A 1FVQA 3NAHA 3OR2A 4NLGA 3D67A 5D0GA 1TV6B 3PXGa 3I31A 2R2SA 1PAUB 2KDOA 3W8PA 3J81Y 3EYZA 4B9NA 3N6MA 3ZFVA 4WXWA 3CJ3A 1AFIA 3UDEA 2ZH5A 3HHNB 3C15B 2UUBF 2O1PA 3UWTA 2A18A 1VQ9S 2V63A 2AGOA 1EARA 2ZOFA 4RX6A 1T9VA 1TFYA 4RO0A 3EICA 3PEJA 2ZDOA 4F0KA 4NYPA 1F60B 3RZAA 3OLAA 3G6ES 2R8KA 4C7QA 1KVJA 3SSQA 1UVKA 1RT1B 1N5SA 4PABA 1NHKL 4L72B 1WEZA 1V5IB 4LF4J 1QY7A 1HI1A 2K1RB 1D1UA 2AZ3A 1ZM9A 1L5UA 1CS4A 1YWXA 4OI0A 2OPSB 4PYDA 3SQOP 1DRZA 1D3WA 3VCDA 2QT7A 3LF0A 4IH7A 2OHDA 2HHVA 5LMUF 1RT2A 4W98A 4OYOA 2I8EA 4RU2A 4I6WA 2VPZB 4HACA 3RRKA 5JVGQ 2XZWA 4Z37A 3OTDA 4I2PA 4I2QB 1SH3A 3NCPA 4J5OA 1Q8LA 4MK8A 2JVRA 5H1SV 3NGTA 5E7OB 1TL4A 3MI7X 4H4KC 3GE9A 4IH6A 2UUCJ 4A47A 1T94A 1S1UA 1RU1A 4CLFA 1IKVA 3SBMA 1UEUA 5HP1A 2KYXA 2Q66A 4XDDA 3FSYA 5H9FJ 3P5BP 1EETB 2QZ8A 2G9OA 4DSKA 4X4OA 5HVGA 2HVHA 2MSTA 1VBKA 1RDRA 1PKUA 2ZM6F 2G2OA 2CADA 3M30B 3FZ2A 3OFHA 2IM0A 2KT2A 4K4UA 3I0SA 3M05A 2GJ2A 3PR4A 5K8OA 2J7KA 3FQLA 1TU0B 4DOZA 5D0EA 3BEGB 5AT1B 2M8DB 4J91A 2ZH3A 1XQIA 1J5EJ 1LXNA 2DIUA 4ILRA 4EEYA 1O0PA 4ETZA 1Y7PA 4ED0A 3CWJA 1V3RA 4GKJJ 3K5NA 1DQAA 5IT4A 1IKWB 3MM7B 3BO2A 2W2QP 1W2IA 4EWTA 2HRUA 1TQLA 2W2MP 4XO0A 2JVOA 3ZTSA 3LAKA 4Q2LA 2FZKB 2B4VA 1R0AB 2HHQA 1WD6A 5F0WA 3S6EA 4CQ1A 5KFHA 3VR1A 4IG0A 1RTZA 2CJQA 2ATCB 3QAUA 1LW0B 4FVCA 2R8JA 3CW2C 1UJ5A 2XZDB 4IFVA 2MY8A 1WHXA 2VFUA 4U9RA 4NZ7A 3K5OA 1PBUA 2OD4A 3PJ9A 4NYOA 4OZ1A 1NSAA 4C11A 5LSOA 4WIQA 3QRQA 2GV1A 4QPTA 1TAUA 3PYDA 2QEXS 4EZ9A 1HWJA 3E01B 3GIJA 4ED8A 3DFEA 3M2UA 3IO1A 5GAEU 1SL1A 2VG5A 4CLWA 1U6BA 2DKOB 1LFWA 2BE2B 2BE7D 5DLFA 2HWTA 2IRYA 4OYPA 2HG4A 3Q23A 1Q78A 3TX0A 1VMBA 1D8YA 3GZ7A 3VF0B 5H9EK 1Q53A 4NMLA 2DR8A 5HMYA 2HYIB 2B4UA 3P49B 1M5VC 5HN0A 2IBKA 1ZH5A 4QWCA 2R2TA 1HW9A 4M5DA 1W26A 4XIUA 2HQFA 3CCUS 3VAHA 5D8HB 1G7CB 3EWGA 1WACA 5E0OA 1EKSA 4ZLPA 2V0NA 3PR5B 4USJC 4Z7YA 3CVKA 3AODA 4F67A 3KUEA 3D3CJ 4ILMA 4AT1B 4ZVOB 2QE5A 2OPPA 2DNOA 2UUBJ 5EHHA 1HWKA 2DNKA 2CJBA 5J2PB 1Z4UA 2DHSA 5L1IA 3U1LA 1M90T 3HFZB 4YR0A 4C8MA 3K2YA 4NA1A 2LXUA 5J2QA 4ED6A 3OJUA 2FYXA 4YMEA 5A6WA 3CC7S 4ERDA 4A8MP 2GNKA 4OYIA 5FD1A 4ZN3A 2HHUA 1C1BA 4ELTA 2GMHA 1J5OA 1CJKB 2DNYA 2HRTA 2Q43A 1K8AT 3ET6B 2B4PA 2WTFA 5L46A 2OSRA 5HQ8A 1T02A 1FTRA 2H3EB 2ZWPA 4RWWA 4RNHA 1K1QA 4OHWA 4I67A 5DG8A 4YB6A 1FX4A 1SUQA 2DNMA 3WZ0A 1Q0NA 2MLYA 2BA9A 3L95X 2MEWA 3CDAA 3H98A 3TEHB 5LMUJ 2AJQA 3MEEB 2BBEA 2R7QA 1FRXA 1YX2A 5AXKA 1KS2A 3NOCA 2FJDB 3D1QA 4R8UA 2L9WA 3DRYA 4M5GA 1ZZNA 1S9EB 2DGTA 2YKOA 5HK4A 1A9NB 4NLWA 4M1KA 1ZYQA 2FJAB 1O6XA 2WVEA 3DLKB 1NM2A 2DVIA 3NNAA 1MW7A 2A2DA 1YJ9S 4ZVPB 3THPA 4ZN1A 2EKNA 2DR5A 3GYXB 2WB4A 3POTA 1YVFA 4NA2A 3N9UC 2PA8D 1BD6A 2BUNA 3IGNA 2GO8A 1KONA 2ZM6J 2XNQA 2GCFA 1SQEA 4MFBB 2V5HG 5DDOC 1V6HA 2P9EA 2VOOA 1R8HA 3C14B 1N6QB 4PPDA 1IUJA 1ZPWX 2QA1A 4Y34A 1LWCA 1V3ZA 4MTPA 1X4HA 2RRNA 4QIFA 1T8EA 1JK9B 2IY5B 4L76A 3BSOA 2YVSA 3C66A 4P71A 1ZM2A 3QWUA 2DNLA 2CAJA 2X7IA 4P2SA 1UWBB 2AJ0A 5F41A 3SFGA 5D0RA 3LH2S 2HNZA 2E44A 3QT7A 1VQSA 4CO5A 4DL5A 2XM3A 4LQ9A 1S9GA 4K4SA 1WI8A 4ZVSB 2X1BA 3M2RB 2HHTA 3FSXA 5CD4H 4ECVA 4K2XA 3PYEA 3LW5C 3QNWB 4JP8A 1HPZB 3M32B 4OJ3A 5SZTA 3QJJA 1EX8A 4OX6A 3Q2SC 3QO9A 1APSA 2FC9A 2DNHA 3D1OA 1AROP 4LRDA 2Q1LA 2E5JA 2FHJA 4GVBA 3U02A 1SL2A 1NEEA 2HNYB 3BYRA 2IYGA 3MD1A 4YFUA 2CWXA 5K8NA 1VQPS 4R0JA 5C2GA 3IAS9 1QSYA 3UO0A 2RILA 3PYGA 2RKIB 3F0NA 2MB0B 4G1PA 1TVRB 2GQQA 5EWFA 2F4FA 3RAMA 3RAQA 1NZ8A 3QATA 2M4MA 1I6JA 2DHGA 2D7SA 1TL1B 4OV6A 2ZC3A 1SQFA 2XB2D 2NQPA 2WBRA 2VH7A 2BANA 4YDXA 1GAOA 1A6LA 4GC6A 3NGUA 2XY7A 3DI6A 3VGUA 4FPRA 2C3PA 8AT1B 2UVUA 1LWFA 2DH9A 2ZEJA 2NZ4A 4TN2A 5EN1A 2BJ9A 3BO3A 3I32A 1F9FA 2V4JB 2DH7A 3KLHB 1KVKA 1S1XB 1FXDA 3MCSA 3T5KA 2AWZA 4C97A 4CO1A 3PHEA 5KAKA 5T7LB 5CHCB 4DV5F 4ZHRB 5ETVA 2DR9A 2PIIA 3B8HA 4ID5A 2VQEF 4URSA 5DGAA 1BXNA 2GFFA 1WTFA 3Q8PB 3MMBB 3FGVA 1F5AA 3GV5B 4YB5A 3UCGA 4DV0F 4B3RF 2E29A 2CNNB 3ONQA 4PQUA 4TQRA 2Z2ZA 3H5SA 1CPZA 2EKYA 1AFJA 2YNFA 3ZTQA 3FSIA 2XSJB 3D6MB 3TA1A 1RTJA 2M9KA 3V6KA 2X51A 2XWXA 1UW9A 3W64A 1HD0A 4FS1A 2FGOA 4WYWA 3WBZA 2ZDPA 1SC3B 3JSRA 1NSPA 1RAGB 1Q95G 2C3MA 2IBOA 1SH2A 2YH0A 2FHJD 2WSFC 2N4DA 1JJ2R 1K47A 4FYDA 3TEGA 4C9DA 4YN3B 1D8ZA 2RF2B 4R5PB 4IRKA 1UVIA 1RACB 1BQMB 4EUVA 3AHPA 5GADU 4F8RA 4NRTA 2YBVA 3VV2B 3Q8QB 4DR3F 1YJ7A 4KR0B 2E1CA 4YQWA 4LFBF 5IT0A 1QVFR 3US5A 3AB4B 1VJQA 2RS2A 5AE2A 4LFAF 1FT8A 3MR3A 1SJ1A 4HDGA 2HQCA 2VZ9A 3V81A 4P10A 3DOKB 3QRRA 3HXMA 2LEPA 1U0HA 2ASYA 1ZAXA 3ZO7A 2J76E 3G86A 4X62F 1N36F 1LNQA 2UUWA 2HQGA 3DCAA 4G65A 3KFWX 5HLFA 2HHPA 5C42B 1QD1A 4NCAA 3HO1A 1A0OB 2ROPA 4QW9A 2QIFA 1LEOA 2FVQA 4L3NA 3DMJA 3PVXA 4UT4A 4MYTA 1NLKL 1KEKA 1JKHA 3BGLA 4LBHA 1JXLA 3ZTOA 4J9NA 1U26A 3GLJA 3HVTA 3CCVS 4O3QA 2VFTA 3PYFA 4F0MA 3QZ7A 4WE1B 1C4AA 1JLQB 1KQKA 1IKXA 4ED2A 3NAIA 2CQ0A 4DX6A 1R8AA 3HD2A 1MMNA 1MN7A 4RNNA 4CLLA 4KBIA 4OZLA 3ETOA 5DDQC 3EGWB 3N5BA 1P9YA 1FFGB 2IJRA 4F4KA 1A7GE 3KTQA 2QLWA 2DHXA 5D6GA 2JFDA 2RAQA 1MU2B 3MM6B 2Q3PA 4JV0A 2V8VA 5C7PA 1RTHB 2MKJA 4XAKA 3ZTPA 1FHTA 1VRTB 3R6GB 1BHNA 3QAEA 3PRVA 4F3MA 3CJQA 4OZJA 3KJVA 1S12A 4C6AA 1F9HA 3DLJA 1S4EA 5KFKA 3OPKA 2D3OR 2DCLA 3VAMA 2E1RA 4B17A 3SDEB 2DGXA 1FKOB 4PXEA 2K8GA 2GIQA 4RW7A 3MZIA 3DYAB 3MURP 1LW2B 5F8NA 2H54B 4JI1F 4LJMA 2HHHF 4FF1A 3F44A 2V34A 3E8OA 3MAHA 4DL7A 1IKYB 1WWHA 3CD7A 1I1GA 4CLUA 1YRXA 2IVYA 1H72C 1TV6A 4F36A 2C3YA 3J7YU 1UAWA 2KB2A 4DV5J 3KHGA 2HBYB 4ZVEA 2R8GA 2YX7A 2WVDA 1IJFB 4WK3A 3HP6A 4X64F 2VQEJ 2X3GA 5HATA 3AJ2A 3BZQA 4GRSA 4DPWA 4OYZA 5IQQA 1KBRA 1FF2A 4KJIA 4DV0J 4B3RJ 1HLWA 3CE8A 4N41A 1ZPVA 2WB1D 5ETOA 2QGFB 5DS7A 3MR2A 2J0SD 4JI2F 4NLSA 5CCLA 4PRFA 3MTJA 3ILLA 3N0VA 1S72S 1HNZF 1CJUB 2K1RA 2RD5C 3BPSP 1FX2A 2EI5A 1FEEA 2P2CB 3AD9C 4DZDA 1PGZA 1SJ3P 4I7FB 1HHQA 1VHFA 2OPSA 3UDVA 1VC5A 1S49A 4DR5F 3ZZTA 3RBZA 3X1LB 1SB6A 5C25B 4CT9A 4JI3F 2CJ9A 2ZZNA 2X1GA 1WC4A 3QYYA 4L3KA 4KRWA 3RG6A 1GEHA 2LCWA 2ROGA 4I2QA 4W90B 2LLZA 3M8PB 5KT2A 5ETQA 2LDYA 3IM8A 4B3TF 2MQQA 1SKSA 1OJ4A 1SVDA 4C0OC 2NLWA 5MLCV 2AV5A 2IVMA 5ADZA 4DR3J 1GXUA 3NY0A 3TJ8A 4LFBJ 1EETA 3LP1B 1M5PC 3Q86A 3H42A 2MHNA 1VQOS 3QGIA 1TL5A 4YOEA 4LFAJ 2JRSA 2M8HA 4MKYA 1JMTA 4KFBB 2DXDA 1DURA 1RBOB 3K0JA 3C3LA 2B9XA 2YH1A 3RYLA 3HVAA 4QWAA 2F3JA 3FBFA 2GQ2A 3IG1B 4X62J 4FNHA 1N36J 1RYSA 1SH0A 1YGYA 4WFNQ 5KT3A 3LQVA 1KP6A 2YNHB 4DQQA 5B0AA 4KGZB 4BLGA 3NGSA 4OZ5A 4ZPCA 2W7PA 1D9DA 2ROEA 4IKAA 2HWHA 4P52A 3PG9A 1IR1A 1IKWA 5DM6Q 5AXMA 3MM7A 4AYBD 3TNVA 1RAOA 4I69A 3K58A 4ICLB 1NU4A 2APOA 4BDPA 5J1NA 1HA1A 1DFDA 2DGOA 1TTHB 3EXYA 3AH6A 4P2XA 3JYTA 2CPIA 4K4ZA 2DRBA 2DEIA 3KG0A 4NLTA 2VKRA 2RQKA 1U2RA 5KFXA 2V94A 3N6NA 1NJXA 2IRXA 3IMQJ 1NBEB 1U48A 4USTA 3DKDA 2PC6A 4A8YA 5GAGU 2VC1A 4YUDA 4JUZA 1YZ6A 1B99A 4EO8A 3EVMA 3UPFA 4AL7A 4CIOA 3HSDA 3KMSA 2CZ4A 2MPUA 2EWHA 1U7LA 5A8WA 2ZJQQ 3GSDA 2LQ9A 5HBMB 3ZZ0A 1CLFA 3V4IB 4B08A 3E01A 2MQMA 1DTQB 1S10A 3UNYA 1RWMB 2Z2MA 3A8JA 2YX1A 3BS9A 3QPIA 2XMKA 1JXEA 4H4MB 3TAMA 2WVBA 3DLGB 1JJ4A 2XTJP 5KG3A 2E7VA 2GHPA 4PCQA 4KKOB 1JLAB 3T9ZA 4DLEA 3A8KA 1LQ9A 3SIPB 3A8EA 1VQMS 4UW2A 2N3LA 2E5HA 2VDIA 4JI1J 2HHHJ 1O51A 3N01A 1S57A 2IPOB 1WHVA 4OHXA 4YDDB 1Y00A 1RHRB 1FO1A 4J9KA 2R7UA 3ILOA 3J81U 1HNVB 3HULA 4USKA 1R8PA 3LP0B 4U7UK 3UDCA 1EQ0A 4NZ0A 1KSPA 2J0XA 2W8KA 4CNZA 4YEAA 2MZSA 3AQPA 1BWVA 4KT0C 1FKPB 3EGNA 2AYEA 1HD1A 4X64J 1F3FA 2BJ7A 3SMZA 5HJXA 2O01C 5F8HA 1HKAA 2RQMA 4L73A 3ZZPA 2EK1A 2V8GA 2KRRA 5DG7A 4X2BA 1PYTA 4C0BA 2CPYA 2NUHA 4JI2J 5ETKA 1S0VA 4RNMA 3SCLE 3UVJB 1HNZJ 2F9JA 1NK5A 3ET6A 2PT0A 2NYHA 5KT6A 3EDQB 1HHSA 1K73T 1R27B 2L3MA 3CDEA 1JLEA 2XG8A 2NPFA 3GV8B 3CDBA 2J6SA 1WDDA 4DR5J 4WYLA 2VD3A 3UW1A 2Z0GA 4JI3J 2FB0A 3EPIA 1VQ4S 2K06A 1HARA 2CQ4A 3CJ4A 2DHHA 3JQMA 2EFVA 3ZZUA 1JNZB 2OUGA 3GJRB 1OYDA 3KK1A 2MZJA 1S9EA 1IR2A 5GAEI 4RUAA 4JV1A 3ILJA 2G0IA 2WOMB 2Z2LA 3DNCA 3DLKA 3PV8A 2ZUAA 4B3TJ 2OLWA 4CLPA 4HH1A 1FE4A 3MCOA 1U0SA 2N3OA 1CULB 3I0RB 2P6TA 3HZGA 2XQCA 3SCKE 2HZCA 3CDUA 2N7CA 3QGPA 2LQJA 4LF9F 2CDQA 2Q6BA 4LIRA 2XWYA 1S48A 4XTTA 5D4PA 4QWEA 1CQNA 1ZAWA 2KH9A 2FUG9 3BR9A 2ALYB 4OHVA 4MFBA 3K57A 4CO4A 1S1VB 2RSQA 1VISA 1TK0A 4LRAA 3RJMB 2FJBB 5KFJA 2QMXA 4DI6A 3C14A 1N6QA 2FHOB 3FFIB 3OL9A 2ZC4A 3QQCD 2J6UA 3ITHB 4C4WA 4U6PA 1NJWA 2ZOGA 2QG9B 3Q89A 4CH0S 3K17A 1S77D 2VA2A 4M63A 4A8KA 2XMMA 3TJ9A 2RE1A 3RRHA 1NJYA 2W7OA 3VGSA 1N33F 2H9ZA 1VQ7S 1X7VA 3ENQA 4DDFA 1JLGB 2RH3A 4HEA9 4M95A 4ZCKA 3RAXA 2DNPA 3V6JA 5A76A 1N5VA 4LFCF 2R9LA 1YJVA 3TWZA 5KG2A 4F25A 3M2RA 3KHHA 4I6YA 3Q8VA 1NB7A 1SC4B 4N56A 3A3OB 1NK7A 4HHHA 2BKPA 3M32A 4LRFA 4PXDA 1FJEB 4YY3F 5BJRA 3B54A 1ZTTA 5A0YB 3FEZA 1RISA 3EZUA 1JWWA 2EXUA 3MECB 2IHR1 3MF5A 3L7PA 4X4QA 2H5IB 4DJBA 2AIRB 1F2HA 2EBGA 4QYZK 2YNGA 4ER8A 1WG4A 3GCWP 4P7TA 1Y3KA 5AXLA 3UN3A 5LSLA 1N5YA 1PAEX 2EVZA 1S59A 1X5OA 1KWMA 4OI4A 1PO6A 5C5JA 2MKCA 4AL5A 1NXIA 3ENWA 2RKIA 1KLMB 1NHVA 1QUVA 3Q2TC 2QA4S 1CSJA 4OLPA 1JLCB 1TL1A 1OY8A 2R7SA 2OKQA 3R3TA 3LGNA 3EDRB 5LMNF 2KO1A 4B9UA 1E6YB 3RGIA 4RW9A 4Y65A 4NMXA 1JJCB 3AXMA 4UOHA 2J6TA 1D0EA 4CLYA 1UEVA 1VFJA 3GIKA 2CQGA 2XEXA 1DQ9A 4O4RA 3KLHA 3HJFA 1PC5A 5E3RA 2E1AA 4DV2F 2M5YA 1BUXA 4OX8A 2B3TB 5T7LA 1HFEL 1H3DA 4NPOA 3CO9A 3DRPB 4X4SA 3H8YA 4ZJLA 2JOQA 2JC1A 3CF5Q 2JC0A 1B70B 3OV7A 2VFVA 2RQ4A 3M8ZA 4ZCLA 2XZTB 3MMBA 1HNIA 4C3LA 4TU7A 2C2MB 4WP8A 4M5JA 2NR0A 1FRJA 3DHXA 2CVIA 2NXJA 1HR0F 4WFZA 5L1LA 2DR7A 1N5TA 4HYKA 2XSJA 3MM9A 4PXBA 2QA2A 3VAJA 3J7Z5 3DXSX 2KM8C 1RKIA 2YXLA 4ZOSA 1MWZA 4BC9A 3D6FB 4KSEB 4J9SA 2KJVA 2C3UA 4OYAA 2BV3A 2KZMA 3W63A 4K4YA 2MQNA 3FEYB 3Q0AA 3BKTA 3HHEA 5DQHA 1XMOF 2DGVA 3ULHA 4TQSA 4UQTA 4KTQA 2GHWA 3WC0A 4DF4A 4K4VA 1TKTA 2W2NP 3M8WA 2B56A 2M88A 3TVYA 2B9YA 1C0TB 2C2DA 3S1TA 1BQMA 4TYBA 5THWA 4AXJA 3PX0A 4B9SA 1IN0A 1OO0B 1FNMA 3R5DA 4M5LA 3QJLA 1FDAA 4FN5A 1YK9A 3EPGA 4LF9J 1I5OB 2V2KA 4UOFA 2WONB 2W4PA 2FPHX 4F2RA 4TY8B 3DXBA 3DOKA 3ISNC 1YJWS 1GXTA 5HROB 1R89A 2BOAA 4DSLA 4C2MA 2HZVA 3PJWA 5E3QA 2J9CA 4IRCA 2VDHA 4NE9C 3SSSA 4YB1P 4PG6A 1C2PA 4N8OA 9ATCB 1EJ7L 2IMOA 4ANCA 3GTYX 5HMWA 1GX5A 5J1EA 4KPCA 3D28A 2B9EA 2C2EA 1RTIB 4ZS6A 1T95A 3KLIA 1N33J 3BM7A 1OQ3A 4PEOA 4I6AA 4CM2A 1DTTB 3OTCA 3H25A 4U8YA 4EO6A 2BKNA 1VQNS 4J7CA 3LAMA 5KFUA 3RR8A 4LREA 2B43A 4LFCJ 1HQUB 4FBUA 4FF3A 1M5KC 1REVB 3J7A1 1T11A 1YIJS 4NWBA 2KFYA 1HWIA 1D09B 2ZH1A 1G6BA 3NRBA 2PGCA 4B9TA 4Q44A 1FD2A 1YJRA 4YY3J 3N28A 4QWBA 3UN2A 5LL6d 2XBPA 4J9VA 1MU2A 3CJKB 3MM6A 4DQRA 3UD3P 1B0TA 1RTHA 2WCXA 3SEOA 2HURA 2CRLA 2OJ3A 1QAIA 2M7SA 5E3PA 2E5IA 3W66A 3WX4A 4LUBA 4ZITA 3CC2S 3D2WA 1C4CA 1SJRA 3T3FA 1HQEB 3H5YA 1J27A 4HDHA 2BJDA 3I56S 2XI3A 1S1WB 2HHSA 4B3SF 5HQLA 3EVOA 5GADI 5F9LA 5ETSA 5LJ3Y 2BJEA 2C22A 2ZFHA 4ZLLA 2MKIA 2GZOA 2J9DE 1DLOB 2OPQB 4P2FA 3C8YA 5F0UA 3C2PA 2IJNA 3DYAA 1LW2A 3DM2A 4QOTA 1U1RA 3MEDA 3E2EA 4ED5A 3B82A 2AYBA 2HFOA 1X4AA 2PMHA 2CPFA 2KM8B 4QYZJ 1IKYA 1XIQA 3CULA 4DV2J 3S8SA 4PKDB 2Y0SD 2AQ4A 3DDKA 3KLEA 4EYIB 2MZ1A 3R5AA 4AL6A 1REGX 5KG1A 1WHWA 1ZAVA 1FI4A 2X3DA 2E7WA 1FJCA 3AXKA 2HVIA 2CKWA 2I9SA 3NG8A 2H5JB 3SV4A 4TLQA 3M9MB 2KHDA 1X9WA 2W9BA 5DQGA 2ZOMA 2HAFA 4RLEA 1B0VA 4ZLJA 2GJIA 1NJZA 2KXNB 1YQHA 1HR0J 3S01A 4A4JA 1RJJA 5DETA 4FKXA 1OPZA 5D4NA 4A46A 2LP4A 2BVZA 3IRXB 1U1MA 2KVQE 1BE4A 4IRDA 5EUHA 4IH5A 3VQSA 1RK8A 4B9VA 3KJNB 2KT5A 1K9MT 4Q2MA 1H74A 3ENVA 2R7VA 2DPJA 2LXFA 1T9TA 5CXTA 4D3GA 5C25A 1LWEB 8ATCB 2RUGA 2CDRB 5IM0B 1XMOJ 4PUOB 3D1HA 2OGUA 2X1AA 3A13A 5IC6B 2DPIA 1Q8KA 1N32F 2DBBA 3M8PA 4LSLB 1WDTA 1Q8BA 3HFVA 1VQ8S 3ISZA 3MTKA 2YQ0A 4NLYA 1HQ2A 4HVZA 2X1FA 3MMCA 1T05B 3JSMA 1TKXB 1VQ5S 1KQGB 2N7YA 1PYOB 1VDHA 3BJYA 2EW9A 2QLFB 4KGXB 1B7YB 3LP1A 1WC0A 1GH8A 2IVFB 4ILLA 5EWGA 1L3VA 2R8HA 5U47A 4KFBA 3RB0A 2XI2A 1IM4A 2LMIA 3M8SA 2W2OP 3TVKA 3IG1A 4HHUA 1WKKA 1UWAA 1HBUB 5LXRA 3RB4A 1B64A 3HHKA 1RAEB 2YNHA 2BJ8A 2CYYA 3I55S 1TFWA 4OIXA 3G6YA 4F4AA 3J7YI 1RU2A 3GPAA 4C8YA 2RDDA 4LVNP 2BQUA 1VQYA 4BCAA 1FXRA 4RNFA 1FK9B 3QBCA 3PW2A 4O3OA 4U7UD 3BR8A 3ZZYA 4DL4A 4DUTA 3LPYA 4RUCA 1NCLA 1HMVB 1T03A 5D3GA 5E41A 2I6WA 2XS2A 4X84A 3DDIA 1K1SA 1QTNB 3GG1A 3TAPA 2NUUG 1FWKA 2DB1A 3EGZA 3CPWR 1GMUA 1TL7B 3R9LA 2D41A 2AX1A 3P4UB 1Y11A 3CC4S 3GB0A 4NL5A 4NLOA 3Q8UA 3OTOF 5F8LA 3MR7A 3T1AA 2GGPB 2JZ5A 4NLXA 4NA3A 1UP1A 1TZ0A 1JX4A 1RZMA 2BW2A 5HBMA 1WF2A 3V4IA 2AYGA 1T9WA 2J0QD 3NCRA 1H2TZ 2ZHAA 3LANA 2V8PA 1SI9A 5KOXA 4TU8A 5FJ4A 2VF3A 1KR4A 2IAJB 5IZHA 1CJTA 3FQKA 4DR7F 3OVAA 1CVJA 1RHKB 4H4MA 3KG1A 4IOAQ 4B3SJ 3DLGA 1VK8A 2WHOA 5AXNA 5BYRA 2LQ8A 1JNRB 1XN9A 2KN4A 2C42A 2MZTA 4EBCA 2XO6A 4YR3A 5I42B 3HVRA 3IBFB 4G1IA 1HYSB 1QTMA 4CYUB 5CD4A 3HX9A 3ICLA 2YWHA 3GJQB 5FDLA 2VOPA 3TANA 3AD7C 2W25A 5IT9Y 3GFZA 2VB6A 4PWWA 5IWAF 1FE0A 3AAWB 1HI0P 1RTDA 3D0HE 1HNVA 3CJRA 4LSNB 1SIZA 4FXVA 2YWFA 4N76A 3PO4A 3R7SB 2FZGB 1FKPA 4PYAA 1SBRA 3M6UA 1G1XA 2ZH7A 2QFJA 2OFHX 1RE1B 3WDOA 4X4UA 4OZ0A 3CEDA 2ZVSA 3PY8A 1VGYA 4TVAB 2LFVA 1OIAA 4IUFA 3T41A 1EAYC 3L7UA 2LU1A 3FMBA 2G1DA 3G71S 1RADB 3AJDA 1JJHA 2B0GA 4DSFA 1UJ6A 4CLKA 2MQLA 3MUTP 2P5VA 2A3JA 3A8IA 3M4XA 4Q7AA 2QSFA 2Y1LB 3OR2B 2DGWA 1VLYA 2VV5A 1HNWF 4JI6F 1F6TA 3O44A 2RU9A 2MYFA 1RWNB 2WBMA 2GVDA 3CGIA 1WJ9A 2ZVIA 1WKLA 4ZJQA 3MGJA 4IQXA 1JQGA 2R7XA 2CNOB 1G4CA 3HF5A 4MIAA 4DLGA 1IBCB 2HHXA 3HK2A 4O4GB 2FJVA 2VG6B 2MQ8A 3GWCA 4DG1A 1TL3A 3I5BA 2DCUB 1PILA 3KNGA 2YTCA 4Q0BB 4CO0A 3TRGA 4RWXA 2D3O1 1N32J 1X4EA 3TR5A 1SJ4P 3G82B 2FJWA 3KYLA 1FRHA 3R1LA 1XJWB 1S0NA 4C8OA 2HFZA 1OMSA 1GXLA 5MAOA 4UUWA 5KFQA 3MM8A 2XYGB 2UVVA 4FKYA 1ZM4A 3IS9B 1W2BR 3BBCA 3M2VB 4V19X 2FVRA 4JI7F 3W8GA 2HMIB 4MT1A 3TW0A 2H65B 1RT2B 4PQAA 4RUBA 1S1VA 4X65F 2ZH9A 1R6VA 5IS2A 3O3LA 4WKYA 1FDBA 3L4BC 3TARA 2QL7B 1BY9A 1WC6A 4P7VA 3ITHA 3KHLA 1UCNA 3CJ5A 1GMWA 2QYGA 3JSBA 2UXDF 3M7VA 1N4LA 3O1LA 4HKQA 3D6TB 4FP9A 1S1UB 3K8VA 3BGFA 2KXHA 1J2VA 1NUEA 3IWXA 3VVTA 4CCHA 2YKNA 3HFKA 2VC0A 3WC2A 1JLGA 3NNCA 3W9HA 4K0KF 1ZM3A 4RUHA 4JI8F 1YBAA 1L3UA 3BGOP 2D69A 3BQ1A 1RP5A 1FRMA 2VFRA 2VBYA 1QE1B 1EP4A 1AB8A 2MZQA 3DLEA 1X5TA 3QGHA 3OTOJ 3T9NA 2LYVA 4N7TA 2C2KB 2BXJA 3FCWA 3MPUB 3KHRA 3GR1A 4DCJB 3ETMA 2MDAA 1N34F 3MAAB 5KFNA 1QUPA 1MWYA 4M5NA 3OL7A 5JVHQ 1QSSA 3AT1B 4EBDA 3EJMA 2GW8A 3CTRA 1Q5VA 5KFBA 5DM7Q 3R5JB 3PRBA 1KLMA 2M52A 4QU7A 4DR7J 1YRTA 2HK2A 4IFVB 4L6V3 2MZRA 4YP3A 4ECWA 2VIHA 4PWDB 2KT3A 3NS5A 4LR7A 3NMAA 4ANDA 3L9ZA 1N48A 2VG7A 3R5GA 4C11B 1F5CA 2V8HA 4CH7A 2VQFF 1VRUA 5CABA 1SC6A 4WXOA 2WSCC 4ZDNA 2XYHB 3D9BA 2RT3A 5IWAJ 5DG9A 5AJ3F 4DPOA 5CYQA 3NBPB 1AZSA 1T3NA 5DZ7A 2OMOA 2ZBRA 8RUCA 1SJFA 1UZHA 1WTBA 3DRPA 3KK2A 2J5AA 1TK5A 2J9DA 2ZD1B 4DX8H 1GMWD 2E66A 3IWNC 3EXCX 3M8QB 3OXLA 4QR1A 4M5IA 4P74A 1NK0A 2H51B 1NO8A 4OI1A 4DR1F 5E33A 4QW8A 1BLUA 3M9NB 3CCQS 4NLUA 4H54A 1R3NA 4K4TA 3EZOA 3TZZA 2CQDA 1RSCA 3GFXA 3CCES 2MQPA 3SSRA 3UFCX 3H59A 2J9EA 1RCXB 1H73A 4OZ3A 1RT3A 3O5TB 5K8PA 3BBBA 3ADAC 1XWLA 3I9ZA 3DC2A 3TYTA 1N88A 4ED7A 3MFHA 4IO9Q 2ADBA 2GJFA 4ZPAA 1HNWJ 3V4MA 4JI6J 2QC3A 5GVQA 3NEKA 1PBAA 1KTQA 4O3NA 1NK6A 3LUYA 1U45A 2FLLA 3G87A 2Y8WA 1M1GA 1TP7A 4MKBA 4EBEA 1JB0C 5J2QB 4P2MA 3ENAA 5IC4B 2ZH6A 1C0TA 3GIIA 3B78A 4QR0A 2FD2A 2NSBA 5DDPC 1CEZA 1FXLA 1C1BB 2VU5A 5CCMA 2PFDA 1J5OB 5G0RB 2XHWA 2DO0A 3M6VA 2CZVC 3QWPA 3HPOA 3GILA 2KL8A 1FJ7A 1X4DA 3QLHB 1BQNB 2AGQA 4IR9A 3RB6A 1CJVB 1QVGR 4V1Ak 2WONA 4J9MA 1VC0A 4JI7J 4IFYB 3VGTA 1TUGB 3T5JA 1MWQA 4QJVA 4NLVA 3B4DA 5HROA 3N5FA 4RW4B 2CXEA 4USMA 4WZMA 2FZCB 4X65J 2BOPA 2MLXA 1SJQA 3R2CJ 1S6PB 6AT1B 4OL8A 1TELA 1P1LA 4DSIA 2CFXA 1FRKA 5KTQA 2E9RX 4OLOA 4CP5A 2UXDJ 2OP5A 4C8KA 4F7VA 5HMZA 5J2NB 1DZ5A 2HQ3A 3QMQA 4JI4F 2LECA 2BRLA 4LRBA 2E5GA 4NOHA 4LF2A 2MGZA 4K0KJ 5C24B 1U47A 4FYYB 3KWMA 4JI8J 1RWVB 1HQUA 4HL9A 1REVA 3CJTA 3JTOA 2E5LF 3AFGA 2F8MA 4ED4A 1PJ6A 2BEFA 3BGRA 2K7JA 1MN9A 2Y1IA 1LWCB 1S79A 3BQ0A 4BS2A 1NAQA 3NS7B 2JEIA 4URQU 2RDJA 3SI8A 2XS7A 3OTBA 5J1PA 2H4YB 3BPDA 3BGUA 4RW8B 1MMLA 4KB7A 4JI5F 2L48A 1VIXA 5A8KA 3NGKA 1HBOA 4FS2A 1W7WA 1N34J 3MPDA 3C6UB 4DEZA 5L1KA 3UI3A 1DQ8A 1UTAA 2Y0BB 3IXQA 1AYEA 5SUHA 1HQEA 2J8SA 1S9GB 3GR0A 2DTJA 1WI6A 1XEZA 3DOMB 4DQPA 2EG1A 2J7WA 1S1WA 2WVCA 3R8YA 2I5JB 2RRBA 4ZPWR 1UVJA 1UETA 4M94A 3TA0A 2AF6A 3SQGB 2WW4A 1DLOA 2OPQA 4RJVA 2EFOA 4V19J 4CTAA 1YI2S 4DHVA 2OH2A 4UOGA 1WEXA 3HJVA 4DL6A 4BHQA 4GVBB 4KO0B 4ECYA 2VQFJ 4IO1A 1DARA 3LPEA 2QSWA 7AT1B 3EUNA 1RAFB 1HBMA 5AJ3J 1N56A 5DJBA 1G2EA 1XMBA 1OQ6A 3IR5B 2BABA 2JLGA 3VQTA 2CQ3A 3QT5A 2MKYA 1RKJA 1CC7A 3X3UA 3EX7B 3QRPA 1NDKA 2R7TA 3K8WA 1YHQS 3CCMS 2XO7A 2D3UA 5GAHU 3EM1A 4LR8A 4LBIA 1EQMA 4A8SA 4DR1J 2XMUA 1B0PA 2IM2A 3ZNJ1 1LWFB 2G1HA 2MJNA 2GIFA 1YJNS 4F3QA 2I0XA 3VVUA 3DRSA 1ZS6A 4ECTA 3OXFA 2JNJA 3FZBA 4B3OB 3NWRA 1F1BB 4DCOB 2XC9A 1XNQF 1Q81T 5L9XA 3IC1A 3IRXA 4ES2A 2V69A 1NSKL 3NOGA 3CMAS 2D1CA 2V4RA 2B7CB 2FC8A 4J9OA 3I87A 2HWIA 2AYMA 5E2QA 1V9OA 1WOPA 3PRDA 4WFAQ 2HQDA 1LWEA 2OMLA 3FNNA 5L39A 5HANA 3EMTA 1KC8T 4HTIA 3LP2B 3IBWA 5IM0A 1FERA 4M5MA 2F8HA 2HIQA 2EPIA 4Y2CA 1S5ZA 3ZZOA 3BV8A 1M5OC 1K44A 1WOSA 1TKXA 2YWEA 5E5NA 4LF6F 1XR5A 2ZBCA 1LK7A 4J90A 1RGVA 2VKZG 2EC0A 1F9EB 2EK6A 3MM5B 1URNA 3A3PB 1RLCL 5H9EJ 3PW5A 4EGLA 4PR6A 5LXYA 3P8BB 5HAOA 4ZPBA 3G6VA 5A2QU 4KHMA 5J2MB 3GIMA 3GYNA 4HI1A 1HBUA 1JLBA 1XTZA 1AXQA 2CPHA 4IYQA 4IOBA 3VAIA 1ITPA 1EB0A 4ITSA 5ETMA 1RYRA 2FVSA 4G3IA 3IWLA 2A0FB 4U8VA 4DL3A 4I0WA 3NMRA 2D9PA 4ZMMA 3O8WA 3TVZA 3FK4A 1KN6A 2VFSA 3TOQA 1U02A 4JI4J 1HMVA 1F0XA 1P9QC 1S0OA 2NXNA 3CD5A 3M9OB 4LBPA 1LV5A 2ASDA 1FFWB 1YG0A 3HT3A 2DXEA 4DN9A 3FCHA 1MMDA
chains in the Genus database with same CATH topology
4KHPJ 2E5LJ 2ZM6J 5BR8J 1HNZJ 4KY3A 4DUYJ 4DV3J 3IMQJ 4AQYJ 4DR3J 4DV0J 4B3RJ 1N33J 1IBKJ 4LFBJ 1IBMJ 1HR0J 3T1HJ 4K0KJ 4JI1J 2HHHJ 2UXCJ 4PWWA 4DV1J 4JV5J 4NEZA 4LFAJ 4JI8J 3J7AN 3D3BJ 2UXBJ 4B3MJ 4RJVA 4DR5J 1I94J 4NEYA 1XMQJ 4LFCJ 2MEWA 3J81U 4LF8J 5A2QU 4JI3J 2MQ8A 5LMUJ 4KYZA 2KVQE 3J80U 5FLXU 4JI5J 4LF4J 2F4VJ 4DV4J 4HHUA 1FJGJ 2KL8A 4JI0J 4DR4J 4DR7J 4X66J 3JAMU 3D3CJ 2VQFJ 4X62J 4DR2J 4DR6J 1N36J 2MTLA 3W1YC 1N32J 5LMNJ 4LF9J 4DV6J 4V1Ak 4NXMJ 4JYAJ 4YHHJ 4JI7J 4YY3J 5AJ3J 1J5EJ 2UUBJ 4X64J 4OX9J 4LF5J 4B3TJ 5IT9U 4DV2J 4LF6J 4GKKJ 1XMOJ 4X65J 4NXNJ 3R2CJ 4DV5J 4JI4J 1HNWJ 4GKJJ 4JI6J 3T1YJ 1N34J 4B3SJ 1XNRJ 4LF7J 1IBLJ 2UUAJ 5IWAJ 1HNXJ 4DUZJ 3OTOJ 2VQEJ 4DV7J 5LM7E 4JI2J 2UU9J 2UXDJ 1XNQJ 3R2DJ 2UUCJ 4DR1J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP J;  2E5L J;  2ZM6 J;  5BR8 J;  1HNZ J;  4KY3 A;  4DUY J;  4DV3 J;  3IMQ J;  4AQY J;  4DR3 J;  4DV0 J;  4B3R J;  1N33 J;  1IBK J;  4LFB J;  1IBM J;  1HR0 J;  3T1H J;  4K0K J;  4JI1 J;  2HHH J;  2UXC J;  4PWW A;  4DV1 J;  4JV5 J;  4NEZ A;  4LFA J;  4JI8 J;  3J7A N;  3D3B J;  2UXB J;  4B3M J;  4RJV A;  4DR5 J;  1I94 J;  4NEY A;  1XMQ J;  4LFC J;  2MEW A;  3J81 U;  4LF8 J;  5A2Q U;  4JI3 J;  2MQ8 A;  5LMU J;  4KYZ A;  2KVQ E;  3J80 U;  5FLX U;  4JI5 J;  4LF4 J;  2F4V J;  4DV4 J;  4HHU A;  1FJG J;  2KL8 A;  4JI0 J;  4DR4 J;  4DR7 J;  4X66 J;  3JAM U;  3D3C J;  2VQF J;  4X62 J;  4DR2 J;  4DR6 J;  1N36 J;  2MTL A;  3W1Y C;  1N32 J;  5LMN J;  4LF9 J;  4DV6 J;  4V1A k;  4NXM J;  4JYA J;  4YHH J;  4JI7 J;  4YY3 J;  5AJ3 J;  1J5E J;  2UUB J;  4X64 J;  4OX9 J;  4LF5 J;  4B3T J;  5IT9 U;  4DV2 J;  4LF6 J;  4GKK J;  1XMO J;  4X65 J;  4NXN J;  3R2C J;  4DV5 J;  4JI4 J;  1HNW J;  4GKJ J;  4JI6 J;  3T1Y J;  1N34 J;  4B3S J;  1XNR J;  4LF7 J;  1IBL J;  2UUA J;  5IWA J;  1HNX J;  4DUZ J;  3OTO J;  2VQE J;  4DV7 J;  5LM7 E;  4JI2 J;  2UU9 J;  2UXD J;  1XNQ J;  3R2D J;  2UUC J;  4DR1 J; 
#chains in the Genus database with same CATH topology
 3GYG A;  2E5L J;  2CQ2 A;  3U1N A;  1WEL A;  3MCN A;  3UD4 P;  3PAC A;  4DS5 A;  1TL7 A;  1S7I A;  2ZNZ A;  2PDA A;  3UR0 A;  2FLP A;  5DDR C;  2BAC A;  2B5J B;  1M1H A;  2JLF A;  1Y4Z B;  4OYM A;  3H4D A;  2W9A A;  3NWG A;  2YNI A;  2LVW A;  3DGP A;  2R7R A;  1RI7 A;  3MEK A;  5KFE A;  4ZP6 A;  4P6Q A;  2ZE2 A;  1JKH B;  1T7P A;  4DFK A;  4JI5 J;  4AQY F;  3BYP A;  3MMJ A;  2BZ2 A;  2AGP A;  4F02 A;  2G0C A;  4O44 B;  2VBX A;  3ISN D;  1FDN A;  3UD5 A;  3SYZ A;  4OI2 A;  1KLN A;  2OO4 A;  1HWU A;  1IKX B;  1HHT P;  1PC4 A;  2H5E A;  3GJS B;  2GIR A;  2BJ1 A;  2IAJ A;  5K5M A;  3GJT B;  2M0G B;  1P8G A;  4ZPV R;  5BYQ A;  2CPE A;  3QFH A;  1RBL A;  4JYA F;  4F4X A;  4NCG B;  5CYJ A;  3CME S;  4Z2X A;  4OYX A;  3GQC A;  2CPD A;  4C8N A;  2IMW P;  1IQZ A;  1SKW A;  2JEF A;  2R7W A;  3FUY A;  1N52 B;  1SV5 B;  1Y0H A;  3SFU A;  1F5B A;  5CZV A;  3RR7 A;  4C0H A;  3T6B A;  3BN4 A;  5FII A;  1VK3 A;  2NPI A;  2FTR A;  1RA6 A;  4ZP8 A;  2IA6 A;  3TO8 A;  1RT6 A;  3L09 A;  4KHP F;  4LSN A;  2AEM A;  3KJV B;  5IV3 A;  1GNK A;  3W2W B;  1ZET A;  4QZV B;  5BXI A;  3EZ5 A;  2B6A A;  1FVS A;  4ID8 A;  4GC7 A;  3T19 A;  1AA1 B;  2ZHB A;  5D78 A;  4ZPT R;  4B3M F;  1I94 F;  4P72 A;  3UNG C;  2CQ1 A;  4LF8 F;  1Q8I A;  2OEK A;  2FLN A;  3JTP A;  4W92 B;  1YJU A;  1TR0 A;  3DOL B;  1XC9 A;  2Z30 B;  2HBQ B;  4RW6 B;  1UZD A;  5FLX Y;  3I5A A;  3I82 A;  4OJG A;  4RKU C;  4DZ6 A;  4LF5 F;  4J9U E;  1XNQ J;  1WC5 A;  2IC3 B;  2PEB A;  1S1T A;  1VI7 A;  4IOC Q;  1LXJ A;  3LAL A;  2HVD A;  3W5Z A;  2Z57 B;  2GC8 A;  3H7H B;  1ACM B;  4OJ1 A;  1YLX A;  2J8A A;  2UV8 A;  2KTQ A;  4CWB A;  4DL0 C;  4O4G A;  4FVM A;  2VG6 A;  3V5R A;  4OFZ A;  3N4W A;  3OD2 A;  4Q0B A;  4JV2 A;  2EFQ A;  1U1L A;  3S7R A;  4FF4 A;  4DMZ A;  3OXG A;  1U09 A;  3G82 A;  4FPI A;  3H2L A;  5CZX A;  2HHW A;  2F63 A;  1H7X A;  2ZJR Q;  1NKC A;  3C15 A;  2R8I A;  1DHM A;  1R8C A;  1OSD A;  2JHE A;  2FY8 A;  2OFG X;  4WWS A;  4LF6 J;  1FCA A;  2O3D A;  3IS9 A;  3UR3 C;  1E6V B;  3M2V A;  3W5Y A;  2RVJ A;  1FRL A;  3BDE A;  3HSJ A;  4DSJ A;  3TUI C;  2HMI A;  2BDP A;  2ACY A;  4AUK A;  2L41 A;  4UY8 5;  4CM0 A;  2P9C A;  3GP9 A;  1U6Z A;  4E0D A;  3PM9 A;  5KFA A;  1FNX H;  1RT1 A;  2FQQ B;  2LEA A;  3F41 A;  3T1Y F;  2DJW A;  2M70 A;  1GMV A;  5CYM B;  3A12 A;  2UUA F;  4OI6 A;  1TK8 A;  1OYE A;  3D54 A;  2OPR B;  4EFA C;  3WQP A;  4FXD A;  2DNR A;  3B4M A;  4QIW D;  4TKT A;  3E3X A;  3RBD A;  1GTE A;  3OFE A;  3VWS A;  1U1Q A;  4HT7 A;  2RU3 A;  1IBM F;  2UZA A;  4HH0 A;  5KFG A;  2FJX A;  5KFS A;  1S97 A;  4Y2A A;  3FMW A;  3IAM 9;  3OT9 A;  2G0J A;  3BSC A;  5KFO A;  1U1N A;  1QE1 A;  4IDK B;  2W1B A;  3KJQ B;  1OY9 A;  4ELV A;  3KMQ A;  1LFP A;  4DCP B;  2IM3 A;  4XPC A;  5B08 A;  5D15 A;  2DY1 A;  2CA9 A;  5JUM A;  2UP1 A;  4J9P A;  3M30 A;  1NZA A;  1X0F A;  3I5C A;  2U2F A;  4AQY J;  3MAA A;  1OS5 A;  1RAB B;  2NS1 B;  4WBF A;  3TI0 A;  3JYT B;  1O8B A;  3PKM A;  3KLG B;  4IR1 A;  3CSK A;  3PIO Q;  2LA4 A;  3IR6 B;  3Q8S B;  1ULR A;  4KGK A;  3AA8 A;  5I4M A;  1U1O A;  4DF8 A;  1P27 B;  4PWD A;  1I3O B;  3DGV A;  3PCO B;  4OJH A;  4JYA J;  2P9G A;  2LQ5 A;  4MIW A;  1GTH A;  1XMQ F;  5IT9 U;  3DN9 A;  1R0A A;  4USH A;  1C0U B;  2OI2 A;  4KC5 A;  4I68 A;  2Z8Q A;  3DRR B;  5A8W B;  1TKZ B;  1HIY A;  2RJZ A;  2AD9 A;  3H5X A;  2VHG A;  5KFI A;  1LW0 A;  4GO7 X;  1DAX A;  3TAQ A;  2IIH A;  3NBP A;  2RS8 A;  2QL5 B;  4ELU A;  4MK9 A;  4PG4 A;  3Q83 A;  1WKJ A;  3IFE A;  2ZBP A;  1M5H A;  3RBX A;  4KHP J;  2QX0 A;  4RR5 A;  4DU8 A;  2ZD1 A;  4CT8 A;  4KV8 B;  3W61 A;  2BRK A;  5KFV A;  3TAM B;  4DX7 A;  2ZWO A;  2HRY A;  3GCX P;  1RLD A;  3M8Q A;  2HGN A;  1QAJ A;  1VC6 A;  1KHV A;  3KNA A;  2W01 A;  4K50 A;  2RUS A;  2UU9 F;  4KQZ A;  4B3M J;  1I94 J;  1RT4 B;  4NZ6 A;  4LF8 J;  5BR8 F;  2CQC A;  1ZA1 B;  4DPT A;  2A10 A;  1RT7 B;  2AJF E;  1BGX T;  3PKY A;  4N8N A;  4K8R A;  2C2Z B;  2BE2 A;  3QIP B;  4LF5 J;  4O3P A;  1UEK A;  2YWK A;  5ITH A;  1S7H A;  4C3K A;  5KT4 A;  3OLB A;  4LR9 A;  2MKK A;  5KFM A;  3BSN A;  1CBK A;  1U25 A;  4KPY A;  2CPJ A;  1R6Y A;  3W60 A;  1L3S A;  1VJW A;  2V9K A;  3VTI A;  4P73 A;  2K7K A;  2CQH A;  4ES1 A;  3G6X A;  2G13 A;  4O3S A;  2HS3 A;  3QGG A;  2E9T A;  2AU0 A;  2DGQ A;  4DFJ A;  4QIE A;  2QN6 B;  3PX6 A;  1Q1K A;  4Y0F A;  2R2R A;  3FBB A;  2V2Q A;  3DU6 A;  5KFY A;  4MYU A;  1KQS R;  1DY3 A;  1RXO B;  1B3T A;  3GIR A;  2PE8 A;  5G0R A;  3AJ1 A;  3H40 A;  5J2P A;  3PW4 A;  2M2B A;  1D9A A;  2IYI A;  3QLH A;  1IBK F;  3HSZ A;  1BQN A;  2HFN A;  3P5T L;  1JLF B;  1JLE B;  1CJV A;  4JV5 F;  1UA0 A;  4CLZ A;  3RW7 A;  1RHM B;  4IFY A;  4H4K A;  5ETP A;  3J81 j;  4RW4 A;  3DU5 A;  5JMN A;  1NH8 A;  4DV4 F;  1S6P A;  4LIW A;  2JDJ A;  4OZN A;  3KK1 B;  1CJK A;  3QT6 A;  3V6H A;  3Q24 A;  2IDE A;  3T1Y J;  3MPY A;  2F8E X;  2XSF A;  5KFZ A;  3KKF A;  3LWL A;  2PA3 A;  2UUA J;  1U6F A;  3MDF A;  4PG5 A;  5D4O A;  4HLB A;  1VYA A;  2YQ3 A;  4X4R A;  3AA9 A;  5J2N A;  2CUY A;  3HHL C;  4CLS A;  4Q45 A;  1PG5 B;  1WF1 A;  3MEE A;  4NI2 B;  1QAY A;  4ZP9 A;  1UW4 A;  1MRO B;  4DX5 A;  4LF1 A;  5C24 A;  2C3O A;  2HND B;  1IBM J;  3FRZ A;  3AOC A;  4C8L A;  3RRG A;  2XLK A;  3H2V E;  2ZZM A;  1GFW B;  1RWO B;  1UL3 A;  4LRC A;  1FDD A;  2XY5 A;  5LT5 A;  2DR6 A;  2JEJ A;  4KH0 B;  1TMJ A;  3O6Q A;  4ZA1 A;  2LXI A;  3VAL A;  2ZZT A;  3AB2 B;  4CLT A;  2JLE A;  2FJE B;  3P6Y C;  3BDP A;  4F04 B;  1BC6 A;  4DL2 A;  4DQI A;  4ETX A;  1X5S A;  5KG6 A;  2VJV A;  4F4W A;  1TMM A;  4H4O B;  4RW8 A;  4ZVG A;  3PFE A;  4F2S A;  2XGQ A;  1RT5 B;  3FKB A;  3TZX A;  1U4B A;  3W5X A;  2AEF A;  3QID A;  3C6U A;  1NSQ A;  4ES3 A;  1G3O A;  1LWX A;  2YPY A;  1S9F A;  2I1R A;  2RIJ A;  3CO0 P;  3UE2 A;  4FYV B;  1GQE A;  1U24 A;  1H2V Z;  3JAM Y;  1Z2Z A;  5HJY A;  1M0S A;  3SV3 A;  2IA0 A;  2PD1 A;  4C8Z A;  3DOM A;  3R27 A;  1WF0 A;  1FES A;  5KFW A;  2XMJ A;  2KKH A;  2RNE A;  4NCB A;  2MHE A;  2I5J A;  2RQC A;  5KG5 A;  1UWB A;  4OZ2 A;  1IBL F;  3SQG A;  4WCE Q;  4WTO B;  1OPI A;  4U96 A;  1XMQ J;  5I3U B;  1KVI A;  2HW3 A;  1RWW B;  4KO0 A;  2DEJ A;  1FNO A;  2AJ1 A;  2YNG B;  3D68 A;  3MOZ A;  1Q79 A;  1X9M A;  1N5Y B;  1HPZ A;  4JBC A;  2YKP A;  2HAI A;  2CPZ A;  2V2V A;  2JL9 A;  4ED1 A;  4LVO P;  3HDS A;  4MIB A;  4O0I A;  3AQO A;  3D4J A;  2PI4 A;  2KYZ A;  5IFM A;  3OBI A;  5B09 A;  3QSY B;  2VL1 A;  2HNY A;  4RW9 B;  2UU9 J;  2CVE A;  1X5P A;  3U7J A;  3JTN A;  4LT6 A;  5BR8 J;  5HL7 Q;  2W9C B;  3C46 A;  2GAG C;  1URR A;  1TVR A;  3DHW C;  1GT8 A;  4B3O A;  4KHR A;  3TA2 A;  3LGH A;  3MCM A;  5CH7 B;  2AW0 A;  2IRU A;  4DQS A;  4B9L A;  4MKA A;  2QYC A;  1FEH A;  3GON A;  2V6A A;  5DRK A;  3G8T A;  3HT0 A;  1X4G A;  3TUZ C;  2LDI A;  4WFX A;  2BW7 A;  4OX7 A;  2V4J A;  2UXB F;  1U2F A;  1HNI B;  3LP2 A;  1S1X A;  4QBU A;  4ECU A;  1VR6 A;  2KRB A;  3TUJ C;  1KNZ A;  1VBY A;  1WG1 A;  4X66 F;  4J9Q A;  2SXL A;  3OFG A;  4ZHR A;  3KJF B;  2DHA A;  2N4C A;  3Q8R B;  3MM9 B;  1GX6 A;  3NLC A;  4UTG A;  4FDF A;  3TQE A;  3HHL B;  1RHJ B;  3PW7 A;  1VBZ A;  1N54 B;  2VBZ A;  1FKA F;  3RBE A;  3MM5 A;  2EFP A;  4NXN F;  4O0N A;  2MKS A;  1MG7 A;  3LOU A;  3WHI A;  1IBK J;  2LU2 A;  3IN5 A;  1H7W A;  2H48 B;  4JV5 J;  2IDL A;  3LWM A;  1RBA A;  1VOM A;  2EC2 A;  2XUL A;  2OTL S;  5I3Q A;  4Q43 A;  3KLF B;  2WK4 A;  3MMA B;  4DU7 A;  5KFP A;  4RBV A;  5J2M A;  4I56 A;  3IRW P;  2ZUG A;  4J9R A;  1AT1 B;  1VHI A;  4DV4 J;  2BYC A;  5LSR A;  2G4B A;  2EFG A;  1TKT B;  1NDP A;  1VS3 A;  1RWX B;  4OYW A;  5A8R B;  3PO5 A;  4X4T A;  3O2I A;  2AKW B;  3GG0 A;  3H4B A;  3W2V B;  2F40 A;  1KFD A;  4S0M A;  1X0P A;  1U1P A;  4DBQ A;  5E3A A;  2F4V F;  3AY0 A;  4EK2 A;  2DRD A;  5GAH I;  3K5L A;  2XHC A;  1UPP A;  2RHS B;  1HW8 A;  1EZZ B;  3FVY A;  2F7V A;  5M2P A;  3J80 Y;  1YTY A;  4UOC A;  4ZVF A;  1Q7L B;  2E1P A;  3PZP A;  2LA6 A;  2RF2 A;  3NP5 A;  4R5P A;  1SCJ B;  3BH7 B;  1P1T A;  3GFH A;  1X4B A;  3FBE A;  3IA0 A;  3OW2 R;  2B5J A;  1WC1 A;  1IQT A;  2ASJ A;  2Y1J A;  1IJE B;  1IVZ A;  3W9I A;  1R0C B;  4F3O A;  4DUZ F;  5BYS A;  5L38 A;  5J1E B;  3D3B J;  4YS2 A;  2COL A;  3RW6 A;  1WHY A;  3E51 A;  3FEX B;  3VZH A;  4F50 A;  3OTE A;  1BMQ B;  2F5G A;  3KLI B;  1NK8 A;  4O44 A;  3NGR A;  4C3M A;  1FFS B;  1RB0 A;  1Q4R A;  2ZH8 A;  1VIO A;  4DV1 F;  2W7A A;  5C42 A;  4WK1 A;  3CD0 A;  2XNR A;  2HGL A;  2J0W A;  5A2Q Y;  1S6Q B;  5AE3 A;  1NME B;  4E98 A;  2R2U A;  2KFZ A;  3NXZ A;  3I6P A;  4WFY A;  2POK A;  3MFI A;  1X31 C;  1HBN B;  1TAQ A;  4K5S A;  2DIT A;  2HFS A;  4JI0 F;  4DR6 F;  3MUV P;  3HVW A;  1KFS A;  2QFI A;  4NCG A;  4DV6 F;  2DNZ A;  1IBL J;  3THT A;  3CJ8 A;  4WE1 A;  1JLQ A;  2ALZ A;  4NLP A;  4O23 A;  3R5C A;  1ELO A;  3D0I E;  1SV5 A;  4I1T A;  2KFN A;  3UQS A;  1U2C A;  1SIW B;  2R42 A;  4M8L A;  4AE5 A;  1FWL A;  3EGV A;  3K89 A;  5B0E A;  2QTW A;  5L8R C;  3W2W A;  4NLQ A;  2UV8 G;  3TUP A;  1EKR A;  5ETL A;  5KT5 A;  3WIU A;  1S99 A;  2MTL A;  2FHM A;  1VRT A;  1AUD A;  1NK9 A;  1HWL A;  4N47 A;  3DM2 B;  4CO2 A;  2AEJ A;  2VPY B;  2RB7 A;  3MEG B;  4Q5V A;  3DOL A;  3MED B;  4I64 A;  1NND A;  3JB9 k;  4RBU A;  4BBY A;  3OUY B;  1IM6 A;  4WTY A;  4WZQ A;  4CO3 A;  4RW6 A;  3UCZ P;  4MK7 A;  3SDE A;  3PX4 A;  1FKO A;  4OX9 F;  1VQ6 S;  2IC3 A;  3L7O A;  1RAJ A;  2HKE A;  2CNL B;  2DGU A;  3JS9 A;  5B0F A;  3KLE B;  1U8S A;  2CJA A;  4BWM A;  4F4Z A;  1B4S A;  1T9U A;  4BWJ A;  2BMB A;  1V5V A;  3HD1 A;  2GX8 A;  1NH7 A;  4LF7 F;  4OHY A;  5K9F A;  2VAS A;  2IJF A;  1HNX F;  3H5U A;  1VQK S;  4UUX A;  2UXB J;  5IXU A;  2W9B B;  1I51 B;  1RWU A;  4OV1 A;  1HL6 A;  2ZNY A;  2RRA A;  4DV3 F;  3CB4 A;  3CXC R;  4X66 J;  3BF4 A;  5IV4 A;  2LKZ A;  3PTW A;  1WC3 A;  3W7B A;  1QM9 A;  3BQ2 A;  4QYR A;  2YWW A;  5GMK a;  2YKA A;  2JEG A;  1KD1 T;  3ZC4 A;  3SZ2 A;  4FF2 A;  2JH3 A;  1E6V A;  1L3K A;  1EHW A;  1MNE A;  1SL0 A;  2W4C A;  3FJ2 A;  3K59 A;  4NXN J;  3OHA A;  2DXF A;  2CQI A;  3TZW A;  2MY7 A;  5K14 B;  3KUG A;  2VON A;  3CCR S;  2DRA A;  3M1V B;  5CQG A;  1H0H B;  5LM7 E;  5DO2 A;  1U1K A;  3PHT A;  4A8O A;  7FDR A;  1CJU A;  2KG0 A;  2GHV C;  5CYM A;  1XNR F;  3AOB A;  1RAI B;  1X4C A;  4C48 A;  4FYW B;  3MMC B;  3JSM B;  4I7F A;  5DQI A;  2OPR A;  4ENO A;  1QJH A;  1ROF A;  3BO4 A;  1R7I A;  4KYZ A;  5AE1 A;  4TYA A;  3UDL A;  2F4V J;  3TJA A;  1PIE A;  1X9S A;  3OSN A;  1FD8 A;  4ZVU B;  1KTV A;  2A1B A;  5IOL A;  4JOU A;  3D6H B;  1HI8 A;  2HVZ A;  2NSC A;  2GVZ B;  3HHD A;  4IG3 B;  5F3Z A;  4IDK A;  4ECQ A;  4F26 A;  1JXV A;  1NJI T;  3U27 A;  3MWB A;  3NNH A;  3GFY A;  2CG8 A;  3MR5 A;  3CIM A;  2ZIT A;  2UVR A;  2MLZ A;  3HMJ G;  4DUZ J;  4QPX A;  3F56 A;  5KFR A;  1OY6 A;  4R0E A;  3Q8Y A;  2ZBQ A;  3PEH A;  5KFF A;  2XMT A;  4ZVR B;  1X4F A;  1V3S A;  3HLU A;  2RDI A;  1XK8 A;  4WJB A;  2ILZ A;  1T03 B;  5D3G B;  3T6J A;  2FHK A;  4DV1 J;  4DN0 A;  2C1E B;  1UVL A;  7FD1 A;  1EIY B;  2EG2 A;  2Z56 B;  1Q16 B;  2B9W A;  5GMD A;  4OYB A;  3UCU P;  2BM0 A;  4ZK7 M;  3KLG A;  4QU6 A;  2V4Q A;  4A48 A;  4CNY A;  2Y9H A;  2WVF A;  4JI0 J;  2AMC B;  1NDC A;  5KFT A;  4DR6 J;  1NPP A;  4HI2 A;  2BQR A;  1QAX A;  4DV6 J;  2FLO A;  1YKW A;  4ICL A;  2JFK A;  4KH1 B;  2CJY B;  4ZP7 A;  1C0U A;  3CCS S;  3BH6 B;  3DRR A;  1TKZ A;  3H20 A;  3D7S B;  5B0C A;  3R97 A;  4ZVT B;  3CCL S;  1Q82 T;  1XR7 A;  4NAS A;  5HO4 A;  2FIU A;  1WG5 A;  4WKR A;  5T14 A;  3CJ0 A;  2XYP B;  1Y10 A;  2VPX B;  5HQM A;  4KY3 A;  1CJT B;  4KV8 A;  2NRE A;  1DBD A;  1QSL A;  3FBC A;  3OFF A;  3TQ1 A;  3BN7 A;  2HLT A;  2XY6 A;  4ZVH A;  1RT4 A;  5HMX A;  3OL8 A;  1DTQ A;  4ZCI A;  4L75 A;  1RT7 A;  2QO3 A;  5FLX U;  4NRU A;  2AHO B;  5FDL B;  4PPZ A;  3H0P A;  1YJT A;  3V6D B;  3W1Y C;  2HFU A;  4PAA A;  1RTD B;  3QIP A;  3RUB L;  2DO4 A;  3PFO A;  3R6L B;  2DH8 A;  3OR1 B;  4OX9 J;  2HQI A;  2R4F A;  1N0V C;  4MMO A;  4KKO A;  5JJB A;  1FJG F;  1JLA A;  4QIV A;  2Z58 B;  4ZCM A;  2YKM B;  3W65 A;  1S6U A;  5E3C A;  3IP0 A;  3ZNU A;  4LF7 J;  4B9M A;  2CNK B;  4YHH F;  2NCK L;  1HNX J;  4QIG A;  3KK3 B;  3LTO A;  4OI3 A;  2PMW A;  4DFP A;  2LEB A;  4GKK F;  5B0D A;  3K7R A;  3QJP A;  1YBU A;  1TUV A;  4DV3 J;  1H2U X;  3LP0 A;  2PO4 A;  3P96 A;  1C1C B;  3NCQ A;  4GO5 X;  9RUB A;  4K59 A;  3DLH A;  4ECZ A;  4Y00 A;  2H1Y A;  2HEK A;  4UY8 T;  2PN6 A;  1F3V A;  1RWK B;  4M5H A;  3C6T B;  1ZZF A;  2ADC A;  4DFM A;  4U95 A;  5F8J A;  4HR2 A;  3HI9 A;  4G1Q B;  1VCT A;  4DUY F;  2QMW A;  2QV6 A;  1T9Y A;  3M6X A;  1JLF A;  5L9N A;  3KXD A;  2GVD B;  2C2N A;  4HTJ A;  3N79 A;  4MKV A;  3OJS A;  2XGP A;  2XMV A;  2OEJ A;  2VIC A;  4ANE A;  4DG1 B;  4ECX A;  1TL3 B;  2HS4 A;  3C16 B;  2DGS A;  3UVJ A;  3HZE A;  2BR0 A;  1BWE A;  3R7B B;  1RQ0 A;  5C2C A;  1XR6 A;  2W2P P;  1XNR J;  4NXM F;  4AD6 A;  3GSI A;  4TY9 A;  2C2R A;  3FC9 A;  5B7W A;  2FGC A;  4Y2M A;  3V2U C;  1UKU A;  2V50 A;  3R2D J;  4MH8 A;  2H4W B;  3MM8 B;  1N0U A;  4NI2 A;  3PNI A;  2AJ2 A;  1MRO A;  2NYI A;  4ECS A;  2HND A;  2W8L A;  4CDI A;  2MQO A;  3QT8 A;  2R7O A;  1S4F A;  1Q7Y T;  2ZKT A;  4U67 Q;  2QL9 B;  2CWK A;  2HGM A;  2EBE A;  2OSQ A;  1NPK A;  5KFD A;  2WOM A;  2XLI A;  1KOH A;  1YDL A;  2CJK A;  3HCX A;  3CIZ A;  1ICE B;  1LK5 A;  5D0H A;  3SCI E;  4QCL A;  3DLL Q;  1CUL A;  5HVF A;  2N82 B;  3ZXW A;  3I0R A;  4NLR A;  2V67 A;  4TNO A;  3T1H F;  2UXC F;  1RWP B;  3DRX A;  4EU0 A;  3A4T A;  4F0H A;  1K0T A;  3VAG A;  1CS4 B;  4FXW A;  4H4O A;  2JWN A;  1RT5 A;  2D74 B;  2YKN B;  4PG8 A;  3G4S S;  2OTJ S;  2Y8Y A;  5EDW A;  4HAC B;  3RU0 A;  3CJ2 A;  3AD8 C;  3A1Y G;  1DJ0 A;  3N6L A;  1WSR A;  3FFI A;  4I2P B;  2WAQ D;  4AFF A;  1RUS A;  3OHB A;  2V9W A;  4M5K A;  5I3P A;  3Q22 A;  2J7U A;  2B4O A;  1PSD A;  2DNN A;  1H98 A;  2A6O A;  2MKH A;  3ZTR A;  3B6B A;  1IKV B;  1EP4 B;  1KQF B;  2XLJ A;  5HP1 B;  3DLE B;  2A2C A;  5CA5 A;  1XBW A;  4RZR A;  2QA4 G;  3UN5 A;  3G8S A;  1S0M A;  4NEZ A;  4WPA A;  4HHJ A;  2PMZ D;  1SKR A;  5I3U A;  1IXK A;  4XPE A;  1NK4 A;  3I0S B;  3DDN A;  4CI0 B;  3IBC B;  2EEY A;  2MSS A;  3DLB A;  1RCO B;  2NXU A;  3KOA A;  4UZC A;  4Q8F A;  4KAI A;  5A0Y A;  4TXS A;  3OVS A;  1VQL S;  3ELH A;  1ZOT A;  3MEC A;  1Y5N B;  1SXL A;  2CJX B;  3ILI A;  5IQ6 A;  3P3D A;  5T41 A;  4N77 A;  5DZ6 A;  1VRQ C;  2QLJ B;  4RNO A;  2VG7 B;  4YB7 A;  4B02 A;  1VBX A;  2YWG A;  2VPW B;  5LJ5 Y;  4C98 A;  2HSE B;  2W9C A;  1VRU B;  4PWU A;  2K2P A;  2RML A;  3KLV A;  2VUG A;  3CCW A;  2CQB A;  4IG0 B;  1KOO A;  1JLC A;  1S76 D;  4TLR A;  5DGB A;  4K2J A;  4WP9 A;  5CYQ B;  4Y3C A;  1AZS B;  2I2Y A;  3BSA A;  4EMD A;  1NDL A;  3VGV A;  1E6Y A;  3WX8 A;  2E9Z A;  3RB3 A;  3KK2 B;  2ABY A;  1R8B A;  4W4M A;  1KKH A;  1RAH B;  1FJG J;  4J9L A;  5KOW A;  5A6P A;  1TKD A;  1AUS L;  5EX0 A;  3GU0 A;  4YHH J;  3CMQ A;  1H38 A;  2ERR A;  3H90 A;  1WNE A;  2A6M A;  1PCA A;  4ATN A;  3IR7 B;  4FYX B;  4D3H A;  4Z7C A;  4GKK J;  2PI5 A;  3M2U B;  4X4N A;  4F4Y A;  5KT7 A;  4WU2 A;  5JXS A;  5F9N A;  2VG5 B;  1UVM A;  2XMA A;  3HHL A;  5D77 A;  1RT3 B;  4G6V B;  1UVN A;  3RTV A;  2W4D A;  3TP2 A;  5L1J A;  3JQK A;  3MPV A;  3TZY A;  4DUY J;  4WF9 Q;  2OEL A;  4CZC A;  1P6T A;  4BC7 A;  3PJX A;  2ZJP Q;  1MSW D;  1NB2 A;  3OL6 A;  3J7A N;  4M5D B;  3KLF A;  3MMA A;  4J37 A;  4MJK A;  1X60 A;  4FZV A;  4A8X A;  2OEM A;  4NX9 A;  4DWI A;  3QSI A;  2V68 A;  2B8Q A;  1U8W A;  4K7Q A;  1YRU A;  5A8R A;  2DNG A;  3IGV A;  3PDN A;  4NXM J;  3MOJ B;  3HSG A;  3W2V A;  1N5Q A;  3ZZZ A;  4P75 A;  3MPW A;  5GME A;  2OPP B;  3I9V 9;  2UVW A;  4WII A;  3I4H X;  4XDC A;  4EI2 A;  1FA0 A;  3BKU A;  3BB5 A;  2IFX A;  3OQ2 A;  3MD3 A;  1CC8 A;  3BBF A;  3PIP Q;  5KG0 A;  2F65 A;  2JSX A;  2D3Z A;  1KHW A;  4O3R A;  4AXI A;  1FRI A;  3G96 A;  1LKZ A;  4ZLN A;  3OSP A;  3CDW A;  5CAA A;  1CQM A;  2AX0 A;  3L3C A;  3CD6 S;  3KUH A;  3MXH P;  3T1H J;  2UXC J;  4KGM A;  2F1F A;  4DSE A;  3HKZ D;  1SUQ B;  3GV7 B;  4WP3 A;  2ZH4 A;  3W9J A;  1PYS B;  3KG4 A;  3CJS A;  2HPU A;  4TY8 A;  5M2R A;  2MXY A;  3I4P A;  3K5P A;  3JAM U;  2P8I A;  2HFV A;  2MGZ B;  2ASL A;  2L08 A;  1S6Q A;  3WIV A;  4R8U B;  1JIH A;  5EGY A;  4HT5 A;  4ZPD A;  4LSZ B;  3MUM P;  1BQX A;  3D5M A;  2QLX A;  2KXF A;  2OAU A;  4DXL A;  1HBN A;  2HBR B;  2HIY A;  1VLO A;  3BGR B;  4DR4 F;  2NXC A;  1WOR A;  1RTI A;  1S6O A;  1FTC A;  2Q79 A;  3HHL D;  2HVE A;  2EFN A;  1DTT A;  4GVL A;  5EX3 A;  3POT B;  4DPU A;  3GMG A;  4QQB A;  2YY3 A;  4Y2I A;  4DPY A;  2F9D A;  2QMU B;  3NL0 A;  2YPZ A;  3LA0 A;  2DY9 A;  1SQG A;  1U49 A;  1UJ4 A;  3KDN A;  5A8K B;  3IM9 A;  3F73 A;  1T3O A;  2O67 A;  1HBO B;  1M5S A;  1YSJ A;  4UZB A;  2U1A A;  4MAK A;  2ACM A;  2K3K A;  6FD1 A;  5M2U A;  1YBT A;  2GML A;  1NHU A;  2QLB B;  4DV7 F;  2BX6 A;  2O66 A;  2CZ9 A;  2DT9 A;  2FDN A;  4X4P A;  2HK3 A;  3CJK A;  4I4B A;  2P6S A;  4K5R A;  3EVW A;  1RHQ B;  1Q5Y A;  5LMN J;  1XER A;  3FRY A;  1R31 A;  4CTA B;  1WOO A;  2HNZ B;  5ETT A;  1PJ5 A;  2KI2 A;  1NPR A;  3CCT A;  1Y5L B;  3R7N B;  3CCZ A;  3MEG A;  3FCV A;  3OUY A;  1R43 A;  3M6W A;  4UF4 A;  3LGM A;  2C2O B;  1UFL A;  3AOA A;  4ZVQ B;  2KHC A;  2ATL A;  1NKB A;  4A8F A;  4QWD A;  3P45 B;  1HBM B;  3U1M A;  2KU7 A;  1NKE A;  1LOU A;  3QO9 B;  3SXL A;  3ZZR A;  4RBT A;  2IM1 A;  5F8M A;  5K8M A;  4A8Q A;  2L9D A;  3H2U B;  5B0B A;  3MAQ A;  1W25 A;  1B7F A;  4PZV A;  3C19 A;  3VZI A;  5F8G A;  4K4W A;  3A3N B;  4ALZ A;  2DIS A;  1R0B G;  3EE3 A;  5K20 B;  5EWE A;  3DRS B;  3CT9 A;  4E2F B;  2YX4 A;  1IR0 A;  3OVB A;  4ZKA A;  3J7Z T;  4CH1 A;  4WU3 A;  2BAN B;  3JSY A;  2M3D A;  3MR6 A;  5HI7 A;  3T5H A;  3DI6 B;  5K14 A;  2KVI A;  4DR2 F;  4USI A;  1T9X A;  4L74 A;  2JJ4 D;  2QRR A;  3W3S A;  3NKY A;  1Z2L A;  2PFF B;  3M1V A;  3G2X A;  2DIV A;  2B8P A;  1ZA2 B;  3LO3 A;  2YKQ A;  1O5J A;  5KG7 A;  5ETR A;  3QFW A;  1FWP A;  4RU9 A;  4A8W A;  1WUU A;  1TUW A;  2B51 A;  2RHQ B;  2E1M C;  3G8Q A;  2BQ3 A;  2MMY A;  1X8D A;  4X4V A;  1Y3J A;  5LOQ A;  1Y9O A;  2OD6 A;  3SCJ E;  2BM1 A;  4ID5 B;  4LQ3 A;  2HLU A;  5D4L A;  4U7C A;  4K4X A;  2HZA A;  4ZIW A;  1Y5I B;  1UFW A;  2L9N A;  3J80 U;  2Q6C A;  2ZHO A;  2Z2Y B;  2E7X A;  1Q86 T;  5F8I A;  1ZTW A;  4PUO A;  4RPF A;  3I96 A;  4LSL A;  2BJ3 A;  1M1K T;  4PQU B;  2Y3Y A;  2DNQ A;  2YNF B;  2G2Z A;  5RUB A;  1T05 A;  4R25 A;  2GVZ A;  4IG3 A;  3PW0 A;  1RTJ B;  2LQB A;  2YQ1 A;  4LF4 F;  1JLB B;  2G2Y A;  5H9F K;  5KFC A;  2FVP A;  5G4D A;  1IWA A;  3R1H A;  2W24 A;  4JB8 B;  4P9S A;  4USW A;  1IWG A;  4E8U A;  3THV A;  2OIH A;  1SC1 B;  2C28 A;  2PSZ A;  2CPX A;  3FDS A;  4YR2 A;  4QR2 A;  2Y1R I;  4OQJ A;  4GMK A;  4NYZ A;  1RHU B;  3BRE A;  3MHY A;  1YIT S;  1UFK A;  1ZBT A;  3CUN A;  4KGV B;  2KJW A;  2FVC A;  1T0T V;  4Y2K A;  2UUC F;  4PXC A;  4FBT A;  1UPM B;  4ECR A;  1FK9 A;  2HS0 A;  2WRM A;  4DR4 J;  2XMW A;  5KG4 A;  2YNI B;  3JXO A;  2QJ3 A;  3DGP B;  3M8R A;  1QDU B;  4OMF G;  5HVH A;  2ZE2 B;  2DYA A;  2XCP A;  1UA1 A;  5KFL A;  3V81 B;  2MJU A;  1SPB P;  2FY1 A;  4USU A;  3BKF A;  5F3T A;  1U0H B;  3CCJ S;  2PEH A;  2BKO A;  3TX8 A;  2CQP A;  5HLF B;  3VAF A;  2AT1 B;  1N8R T;  1AW0 A;  1KDN A;  1J5E F;  4Y28 C;  2NZC A;  4DV7 J;  2O5D A;  4USV A;  2CIM A;  2GGP A;  2ILY A;  4KIA A;  2ZKU A;  4NLD A;  3DMJ B;  6FDR A;  2V2Z A;  4Y6I A;  2VOD A;  4GKJ F;  1KRP A;  2V8D A;  2ZH2 A;  1D9F A;  1MLA A;  1RAA B;  3HVT B;  2JX2 A;  4FNI A;  4EYH B;  1CG2 A;  2DK2 A;  4CRJ A;  4LMZ A;  2CG4 A;  2HBZ B;  1L3T A;  2DD8 S;  2Z4P A;  4ZJO A;  2ZBI A;  4UQG A;  1WEY A;  2KG1 A;  4ZIV A;  1OWX A;  3R5B A;  5B0G A;  1WSV A;  2GMJ A;  3V6D A;  3KDO A;  5HSP A;  2UUT A;  2XCA A;  3OR1 A;  4TU9 A;  3VAK A;  1K0V A;  2VA3 A;  1RT6 B;  3VHQ A;  3T5L A;  2B7B B;  2K3I A;  3G9C A;  5I42 A;  1NRK A;  2WSE C;  2YKM A;  1F2G A;  1PJ7 A;  2KZZ A;  2VJU A;  1HYS A;  3W62 A;  4CYU A;  2B6A B;  1RA7 A;  4PG7 A;  1OSC A;  4URG A;  1GK8 A;  3NGD A;  2R3V A;  4EZ6 A;  4RL1 A;  4DS4 A;  2I38 A;  4ED3 A;  4KE5 A;  3KK3 A;  4N5S A;  1QLN A;  2GS8 A;  2AP6 A;  2WW8 A;  4Q8E A;  2GAH C;  2BE9 B;  3D0G E;  4OHZ A;  1C1C A;  2GQC A;  2AZ1 A;  2AJ4 A;  3HKW A;  4XK8 C;  4WFB Q;  3K5M A;  5ETN A;  3C6T A;  2VBW A;  3CNQ P;  1S1T B;  2NXE A;  1Z1Z A;  4NEY A;  5GAG I;  4G1Q A;  3M8Y A;  3JQJ A;  2XS5 A;  3D66 A;  1UMJ A;  4RW7 B;  2D9O A;  4DR2 J;  1SKU B;  5DLG A;  1YZ7 A;  3QZ8 A;  3NS6 A;  2WZ1 A;  3HM9 A;  4DPX A;  1H6K X;  2GO9 A;  4IQM A;  3C16 A;  2GA7 A;  1FVQ A;  3NAH A;  3OR2 A;  4NLG A;  3D67 A;  5D0G A;  1TV6 B;  3PXG a;  3I31 A;  2R2S A;  1PAU B;  2KDO A;  3W8P A;  3J81 Y;  3EYZ A;  4B9N A;  3N6M A;  3ZFV A;  4WXW A;  3CJ3 A;  1AFI A;  3UDE A;  2ZH5 A;  3HHN B;  3C15 B;  2UUB F;  2O1P A;  3UWT A;  2A18 A;  1VQ9 S;  2V63 A;  2AGO A;  1EAR A;  2ZOF A;  4RX6 A;  1T9V A;  1TFY A;  4RO0 A;  3EIC A;  3PEJ A;  2ZDO A;  4F0K A;  4NYP A;  1F60 B;  3RZA A;  3OLA A;  3G6E S;  2R8K A;  4C7Q A;  1KVJ A;  3SSQ A;  1UVK A;  1RT1 B;  1N5S A;  4PAB A;  1NHK L;  4L72 B;  1WEZ A;  1V5I B;  4LF4 J;  1QY7 A;  1HI1 A;  2K1R B;  1D1U A;  2AZ3 A;  1ZM9 A;  1L5U A;  1CS4 A;  1YWX A;  4OI0 A;  2OPS B;  4PYD A;  3SQO P;  1DRZ A;  1D3W A;  3VCD A;  2QT7 A;  3LF0 A;  4IH7 A;  2OHD A;  2HHV A;  5LMU F;  1RT2 A;  4W98 A;  4OYO A;  2I8E A;  4RU2 A;  4I6W A;  2VPZ B;  4HAC A;  3RRK A;  5JVG Q;  2XZW A;  4Z37 A;  3OTD A;  4I2P A;  4I2Q B;  1SH3 A;  3NCP A;  4J5O A;  1Q8L A;  4MK8 A;  2JVR A;  5H1S V;  3NGT A;  5E7O B;  1TL4 A;  3MI7 X;  4H4K C;  3GE9 A;  4IH6 A;  2UUC J;  4A47 A;  1T94 A;  1S1U A;  1RU1 A;  4CLF A;  1IKV A;  3SBM A;  1UEU A;  5HP1 A;  2KYX A;  2Q66 A;  4XDD A;  3FSY A;  5H9F J;  3P5B P;  1EET B;  2QZ8 A;  2G9O A;  4DSK A;  4X4O A;  5HVG A;  2HVH A;  2MST A;  1VBK A;  1RDR A;  1PKU A;  2ZM6 F;  2G2O A;  2CAD A;  3M30 B;  3FZ2 A;  3OFH A;  2IM0 A;  2KT2 A;  4K4U A;  3I0S A;  3M05 A;  2GJ2 A;  3PR4 A;  5K8O A;  2J7K A;  3FQL A;  1TU0 B;  4DOZ A;  5D0E A;  3BEG B;  5AT1 B;  2M8D B;  4J91 A;  2ZH3 A;  1XQI A;  1J5E J;  1LXN A;  2DIU A;  4ILR A;  4EEY A;  1O0P A;  4ETZ A;  1Y7P A;  4ED0 A;  3CWJ A;  1V3R A;  4GKJ J;  3K5N A;  1DQA A;  5IT4 A;  1IKW B;  3MM7 B;  3BO2 A;  2W2Q P;  1W2I A;  4EWT A;  2HRU A;  1TQL A;  2W2M P;  4XO0 A;  2JVO A;  3ZTS A;  3LAK A;  4Q2L A;  2FZK B;  2B4V A;  1R0A B;  2HHQ A;  1WD6 A;  5F0W A;  3S6E A;  4CQ1 A;  5KFH A;  3VR1 A;  4IG0 A;  1RTZ A;  2CJQ A;  2ATC B;  3QAU A;  1LW0 B;  4FVC A;  2R8J A;  3CW2 C;  1UJ5 A;  2XZD B;  4IFV A;  2MY8 A;  1WHX A;  2VFU A;  4U9R A;  4NZ7 A;  3K5O A;  1PBU A;  2OD4 A;  3PJ9 A;  4NYO A;  4OZ1 A;  1NSA A;  4C11 A;  5LSO A;  4WIQ A;  3QRQ A;  2GV1 A;  4QPT A;  1TAU A;  3PYD A;  2QEX S;  4EZ9 A;  1HWJ A;  3E01 B;  3GIJ A;  4ED8 A;  3DFE A;  3M2U A;  3IO1 A;  5GAE U;  1SL1 A;  2VG5 A;  4CLW A;  1U6B A;  2DKO B;  1LFW A;  2BE2 B;  2BE7 D;  5DLF A;  2HWT A;  2IRY A;  4OYP A;  2HG4 A;  3Q23 A;  1Q78 A;  3TX0 A;  1VMB A;  1D8Y A;  3GZ7 A;  3VF0 B;  5H9E K;  1Q53 A;  4NML A;  2DR8 A;  5HMY A;  2HYI B;  2B4U A;  3P49 B;  1M5V C;  5HN0 A;  2IBK A;  1ZH5 A;  4QWC A;  2R2T A;  1HW9 A;  4M5D A;  1W26 A;  4XIU A;  2HQF A;  3CCU S;  3VAH A;  5D8H B;  1G7C B;  3EWG A;  1WAC A;  5E0O A;  1EKS A;  4ZLP A;  2V0N A;  3PR5 B;  4USJ C;  4Z7Y A;  3CVK A;  3AOD A;  4F67 A;  3KUE A;  3D3C J;  4ILM A;  4AT1 B;  4ZVO B;  2QE5 A;  2OPP A;  2DNO A;  2UUB J;  5EHH A;  1HWK A;  2DNK A;  2CJB A;  5J2P B;  1Z4U A;  2DHS A;  5L1I A;  3U1L A;  1M90 T;  3HFZ B;  4YR0 A;  4C8M A;  3K2Y A;  4NA1 A;  2LXU A;  5J2Q A;  4ED6 A;  3OJU A;  2FYX A;  4YME A;  5A6W A;  3CC7 S;  4ERD A;  4A8M P;  2GNK A;  4OYI A;  5FD1 A;  4ZN3 A;  2HHU A;  1C1B A;  4ELT A;  2GMH A;  1J5O A;  1CJK B;  2DNY A;  2HRT A;  2Q43 A;  1K8A T;  3ET6 B;  2B4P A;  2WTF A;  5L46 A;  2OSR A;  5HQ8 A;  1T02 A;  1FTR A;  2H3E B;  2ZWP A;  4RWW A;  4RNH A;  1K1Q A;  4OHW A;  4I67 A;  5DG8 A;  4YB6 A;  1FX4 A;  1SUQ A;  2DNM A;  3WZ0 A;  1Q0N A;  2MLY A;  2BA9 A;  3L95 X;  2MEW A;  3CDA A;  3H98 A;  3TEH B;  5LMU J;  2AJQ A;  3MEE B;  2BBE A;  2R7Q A;  1FRX A;  1YX2 A;  5AXK A;  1KS2 A;  3NOC A;  2FJD B;  3D1Q A;  4R8U A;  2L9W A;  3DRY A;  4M5G A;  1ZZN A;  1S9E B;  2DGT A;  2YKO A;  5HK4 A;  1A9N B;  4NLW A;  4M1K A;  1ZYQ A;  2FJA B;  1O6X A;  2WVE A;  3DLK B;  1NM2 A;  2DVI A;  3NNA A;  1MW7 A;  2A2D A;  1YJ9 S;  4ZVP B;  3THP A;  4ZN1 A;  2EKN A;  2DR5 A;  3GYX B;  2WB4 A;  3POT A;  1YVF A;  4NA2 A;  3N9U C;  2PA8 D;  1BD6 A;  2BUN A;  3IGN A;  2GO8 A;  1KON A;  2ZM6 J;  2XNQ A;  2GCF A;  1SQE A;  4MFB B;  2V5H G;  5DDO C;  1V6H A;  2P9E A;  2VOO A;  1R8H A;  3C14 B;  1N6Q B;  4PPD A;  1IUJ A;  1ZPW X;  2QA1 A;  4Y34 A;  1LWC A;  1V3Z A;  4MTP A;  1X4H A;  2RRN A;  4QIF A;  1T8E A;  1JK9 B;  2IY5 B;  4L76 A;  3BSO A;  2YVS A;  3C66 A;  4P71 A;  1ZM2 A;  3QWU A;  2DNL A;  2CAJ A;  2X7I A;  4P2S A;  1UWB B;  2AJ0 A;  5F41 A;  3SFG A;  5D0R A;  3LH2 S;  2HNZ A;  2E44 A;  3QT7 A;  1VQS A;  4CO5 A;  4DL5 A;  2XM3 A;  4LQ9 A;  1S9G A;  4K4S A;  1WI8 A;  4ZVS B;  2X1B A;  3M2R B;  2HHT A;  3FSX A;  5CD4 H;  4ECV A;  4K2X A;  3PYE A;  3LW5 C;  3QNW B;  4JP8 A;  1HPZ B;  3M32 B;  4OJ3 A;  5SZT A;  3QJJ A;  1EX8 A;  4OX6 A;  3Q2S C;  3QO9 A;  1APS A;  2FC9 A;  2DNH A;  3D1O A;  1ARO P;  4LRD A;  2Q1L A;  2E5J A;  2FHJ A;  4GVB A;  3U02 A;  1SL2 A;  1NEE A;  2HNY B;  3BYR A;  2IYG A;  3MD1 A;  4YFU A;  2CWX A;  5K8N A;  1VQP S;  4R0J A;  5C2G A;  3IAS 9;  1QSY A;  3UO0 A;  2RIL A;  3PYG A;  2RKI B;  3F0N A;  2MB0 B;  4G1P A;  1TVR B;  2GQQ A;  5EWF A;  2F4F A;  3RAM A;  3RAQ A;  1NZ8 A;  3QAT A;  2M4M A;  1I6J A;  2DHG A;  2D7S A;  1TL1 B;  4OV6 A;  2ZC3 A;  1SQF A;  2XB2 D;  2NQP A;  2WBR A;  2VH7 A;  2BAN A;  4YDX A;  1GAO A;  1A6L A;  4GC6 A;  3NGU A;  2XY7 A;  3DI6 A;  3VGU A;  4FPR A;  2C3P A;  8AT1 B;  2UVU A;  1LWF A;  2DH9 A;  2ZEJ A;  2NZ4 A;  4TN2 A;  5EN1 A;  2BJ9 A;  3BO3 A;  3I32 A;  1F9F A;  2V4J B;  2DH7 A;  3KLH B;  1KVK A;  1S1X B;  1FXD A;  3MCS A;  3T5K A;  2AWZ A;  4C97 A;  4CO1 A;  3PHE A;  5KAK A;  5T7L B;  5CHC B;  4DV5 F;  4ZHR B;  5ETV A;  2DR9 A;  2PII A;  3B8H A;  4ID5 A;  2VQE F;  4URS A;  5DGA A;  1BXN A;  2GFF A;  1WTF A;  3Q8P B;  3MMB B;  3FGV A;  1F5A A;  3GV5 B;  4YB5 A;  3UCG A;  4DV0 F;  4B3R F;  2E29 A;  2CNN B;  3ONQ A;  4PQU A;  4TQR A;  2Z2Z A;  3H5S A;  1CPZ A;  2EKY A;  1AFJ A;  2YNF A;  3ZTQ A;  3FSI A;  2XSJ B;  3D6M B;  3TA1 A;  1RTJ A;  2M9K A;  3V6K A;  2X51 A;  2XWX A;  1UW9 A;  3W64 A;  1HD0 A;  4FS1 A;  2FGO A;  4WYW A;  3WBZ A;  2ZDP A;  1SC3 B;  3JSR A;  1NSP A;  1RAG B;  1Q95 G;  2C3M A;  2IBO A;  1SH2 A;  2YH0 A;  2FHJ D;  2WSF C;  2N4D A;  1JJ2 R;  1K47 A;  4FYD A;  3TEG A;  4C9D A;  4YN3 B;  1D8Z A;  2RF2 B;  4R5P B;  4IRK A;  1UVI A;  1RAC B;  1BQM B;  4EUV A;  3AHP A;  5GAD U;  4F8R A;  4NRT A;  2YBV A;  3VV2 B;  3Q8Q B;  4DR3 F;  1YJ7 A;  4KR0 B;  2E1C A;  4YQW A;  4LFB F;  5IT0 A;  1QVF R;  3US5 A;  3AB4 B;  1VJQ A;  2RS2 A;  5AE2 A;  4LFA F;  1FT8 A;  3MR3 A;  1SJ1 A;  4HDG A;  2HQC A;  2VZ9 A;  3V81 A;  4P10 A;  3DOK B;  3QRR A;  3HXM A;  2LEP A;  1U0H A;  2ASY A;  1ZAX A;  3ZO7 A;  2J76 E;  3G86 A;  4X62 F;  1N36 F;  1LNQ A;  2UUW A;  2HQG A;  3DCA A;  4G65 A;  3KFW X;  5HLF A;  2HHP A;  5C42 B;  1QD1 A;  4NCA A;  3HO1 A;  1A0O B;  2ROP A;  4QW9 A;  2QIF A;  1LEO A;  2FVQ A;  4L3N A;  3DMJ A;  3PVX A;  4UT4 A;  4MYT A;  1NLK L;  1KEK A;  1JKH A;  3BGL A;  4LBH A;  1JXL A;  3ZTO A;  4J9N A;  1U26 A;  3GLJ A;  3HVT A;  3CCV S;  4O3Q A;  2VFT A;  3PYF A;  4F0M A;  3QZ7 A;  4WE1 B;  1C4A A;  1JLQ B;  1KQK A;  1IKX A;  4ED2 A;  3NAI A;  2CQ0 A;  4DX6 A;  1R8A A;  3HD2 A;  1MMN A;  1MN7 A;  4RNN A;  4CLL A;  4KBI A;  4OZL A;  3ETO A;  5DDQ C;  3EGW B;  3N5B A;  1P9Y A;  1FFG B;  2IJR A;  4F4K A;  1A7G E;  3KTQ A;  2QLW A;  2DHX A;  5D6G A;  2JFD A;  2RAQ A;  1MU2 B;  3MM6 B;  2Q3P A;  4JV0 A;  2V8V A;  5C7P A;  1RTH B;  2MKJ A;  4XAK A;  3ZTP A;  1FHT A;  1VRT B;  3R6G B;  1BHN A;  3QAE A;  3PRV A;  4F3M A;  3CJQ A;  4OZJ A;  3KJV A;  1S12 A;  4C6A A;  1F9H A;  3DLJ A;  1S4E A;  5KFK A;  3OPK A;  2D3O R;  2DCL A;  3VAM A;  2E1R A;  4B17 A;  3SDE B;  2DGX A;  1FKO B;  4PXE A;  2K8G A;  2GIQ A;  4RW7 A;  3MZI A;  3DYA B;  3MUR P;  1LW2 B;  5F8N A;  2H54 B;  4JI1 F;  4LJM A;  2HHH F;  4FF1 A;  3F44 A;  2V34 A;  3E8O A;  3MAH A;  4DL7 A;  1IKY B;  1WWH A;  3CD7 A;  1I1G A;  4CLU A;  1YRX A;  2IVY A;  1H72 C;  1TV6 A;  4F36 A;  2C3Y A;  3J7Y U;  1UAW A;  2KB2 A;  4DV5 J;  3KHG A;  2HBY B;  4ZVE A;  2R8G A;  2YX7 A;  2WVD A;  1IJF B;  4WK3 A;  3HP6 A;  4X64 F;  2VQE J;  2X3G A;  5HAT A;  3AJ2 A;  3BZQ A;  4GRS A;  4DPW A;  4OYZ A;  5IQQ A;  1KBR A;  1FF2 A;  4KJI A;  4DV0 J;  4B3R J;  1HLW A;  3CE8 A;  4N41 A;  1ZPV A;  2WB1 D;  5ETO A;  2QGF B;  5DS7 A;  3MR2 A;  2J0S D;  4JI2 F;  4NLS A;  5CCL A;  4PRF A;  3MTJ A;  3ILL A;  3N0V A;  1S72 S;  1HNZ F;  1CJU B;  2K1R A;  2RD5 C;  3BPS P;  1FX2 A;  2EI5 A;  1FEE A;  2P2C B;  3AD9 C;  4DZD A;  1PGZ A;  1SJ3 P;  4I7F B;  1HHQ A;  1VHF A;  2OPS A;  3UDV A;  1VC5 A;  1S49 A;  4DR5 F;  3ZZT A;  3RBZ A;  3X1L B;  1SB6 A;  5C25 B;  4CT9 A;  4JI3 F;  2CJ9 A;  2ZZN A;  2X1G A;  1WC4 A;  3QYY A;  4L3K A;  4KRW A;  3RG6 A;  1GEH A;  2LCW A;  2ROG A;  4I2Q A;  4W90 B;  2LLZ A;  3M8P B;  5KT2 A;  5ETQ A;  2LDY A;  3IM8 A;  4B3T F;  2MQQ A;  1SKS A;  1OJ4 A;  1SVD A;  4C0O C;  2NLW A;  5MLC V;  2AV5 A;  2IVM A;  5ADZ A;  4DR3 J;  1GXU A;  3NY0 A;  3TJ8 A;  4LFB J;  1EET A;  3LP1 B;  1M5P C;  3Q86 A;  3H42 A;  2MHN A;  1VQO S;  3QGI A;  1TL5 A;  4YOE A;  4LFA J;  2JRS A;  2M8H A;  4MKY A;  1JMT A;  4KFB B;  2DXD A;  1DUR A;  1RBO B;  3K0J A;  3C3L A;  2B9X A;  2YH1 A;  3RYL A;  3HVA A;  4QWA A;  2F3J A;  3FBF A;  2GQ2 A;  3IG1 B;  4X62 J;  4FNH A;  1N36 J;  1RYS A;  1SH0 A;  1YGY A;  4WFN Q;  5KT3 A;  3LQV A;  1KP6 A;  2YNH B;  4DQQ A;  5B0A A;  4KGZ B;  4BLG A;  3NGS A;  4OZ5 A;  4ZPC A;  2W7P A;  1D9D A;  2ROE A;  4IKA A;  2HWH A;  4P52 A;  3PG9 A;  1IR1 A;  1IKW A;  5DM6 Q;  5AXM A;  3MM7 A;  4AYB D;  3TNV A;  1RAO A;  4I69 A;  3K58 A;  4ICL B;  1NU4 A;  2APO A;  4BDP A;  5J1N A;  1HA1 A;  1DFD A;  2DGO A;  1TTH B;  3EXY A;  3AH6 A;  4P2X A;  3JYT A;  2CPI A;  4K4Z A;  2DRB A;  2DEI A;  3KG0 A;  4NLT A;  2VKR A;  2RQK A;  1U2R A;  5KFX A;  2V94 A;  3N6N A;  1NJX A;  2IRX A;  3IMQ J;  1NBE B;  1U48 A;  4UST A;  3DKD A;  2PC6 A;  4A8Y A;  5GAG U;  2VC1 A;  4YUD A;  4JUZ A;  1YZ6 A;  1B99 A;  4EO8 A;  3EVM A;  3UPF A;  4AL7 A;  4CIO A;  3HSD A;  3KMS A;  2CZ4 A;  2MPU A;  2EWH A;  1U7L A;  5A8W A;  2ZJQ Q;  3GSD A;  2LQ9 A;  5HBM B;  3ZZ0 A;  1CLF A;  3V4I B;  4B08 A;  3E01 A;  2MQM A;  1DTQ B;  1S10 A;  3UNY A;  1RWM B;  2Z2M A;  3A8J A;  2YX1 A;  3BS9 A;  3QPI A;  2XMK A;  1JXE A;  4H4M B;  3TAM A;  2WVB A;  3DLG B;  1JJ4 A;  2XTJ P;  5KG3 A;  2E7V A;  2GHP A;  4PCQ A;  4KKO B;  1JLA B;  3T9Z A;  4DLE A;  3A8K A;  1LQ9 A;  3SIP B;  3A8E A;  1VQM S;  4UW2 A;  2N3L A;  2E5H A;  2VDI A;  4JI1 J;  2HHH J;  1O51 A;  3N01 A;  1S57 A;  2IPO B;  1WHV A;  4OHX A;  4YDD B;  1Y00 A;  1RHR B;  1FO1 A;  4J9K A;  2R7U A;  3ILO A;  3J81 U;  1HNV B;  3HUL A;  4USK A;  1R8P A;  3LP0 B;  4U7U K;  3UDC A;  1EQ0 A;  4NZ0 A;  1KSP A;  2J0X A;  2W8K A;  4CNZ A;  4YEA A;  2MZS A;  3AQP A;  1BWV A;  4KT0 C;  1FKP B;  3EGN A;  2AYE A;  1HD1 A;  4X64 J;  1F3F A;  2BJ7 A;  3SMZ A;  5HJX A;  2O01 C;  5F8H A;  1HKA A;  2RQM A;  4L73 A;  3ZZP A;  2EK1 A;  2V8G A;  2KRR A;  5DG7 A;  4X2B A;  1PYT A;  4C0B A;  2CPY A;  2NUH A;  4JI2 J;  5ETK A;  1S0V A;  4RNM A;  3SCL E;  3UVJ B;  1HNZ J;  2F9J A;  1NK5 A;  3ET6 A;  2PT0 A;  2NYH A;  5KT6 A;  3EDQ B;  1HHS A;  1K73 T;  1R27 B;  2L3M A;  3CDE A;  1JLE A;  2XG8 A;  2NPF A;  3GV8 B;  3CDB A;  2J6S A;  1WDD A;  4DR5 J;  4WYL A;  2VD3 A;  3UW1 A;  2Z0G A;  4JI3 J;  2FB0 A;  3EPI A;  1VQ4 S;  2K06 A;  1HAR A;  2CQ4 A;  3CJ4 A;  2DHH A;  3JQM A;  2EFV A;  3ZZU A;  1JNZ B;  2OUG A;  3GJR B;  1OYD A;  3KK1 A;  2MZJ A;  1S9E A;  1IR2 A;  5GAE I;  4RUA A;  4JV1 A;  3ILJ A;  2G0I A;  2WOM B;  2Z2L A;  3DNC A;  3DLK A;  3PV8 A;  2ZUA A;  4B3T J;  2OLW A;  4CLP A;  4HH1 A;  1FE4 A;  3MCO A;  1U0S A;  2N3O A;  1CUL B;  3I0R B;  2P6T A;  3HZG A;  2XQC A;  3SCK E;  2HZC A;  3CDU A;  2N7C A;  3QGP A;  2LQJ A;  4LF9 F;  2CDQ A;  2Q6B A;  4LIR A;  2XWY A;  1S48 A;  4XTT A;  5D4P A;  4QWE A;  1CQN A;  1ZAW A;  2KH9 A;  2FUG 9;  3BR9 A;  2ALY B;  4OHV A;  4MFB A;  3K57 A;  4CO4 A;  1S1V B;  2RSQ A;  1VIS A;  1TK0 A;  4LRA A;  3RJM B;  2FJB B;  5KFJ A;  2QMX A;  4DI6 A;  3C14 A;  1N6Q A;  2FHO B;  3FFI B;  3OL9 A;  2ZC4 A;  3QQC D;  2J6U A;  3ITH B;  4C4W A;  4U6P A;  1NJW A;  2ZOG A;  2QG9 B;  3Q89 A;  4CH0 S;  3K17 A;  1S77 D;  2VA2 A;  4M63 A;  4A8K A;  2XMM A;  3TJ9 A;  2RE1 A;  3RRH A;  1NJY A;  2W7O A;  3VGS A;  1N33 F;  2H9Z A;  1VQ7 S;  1X7V A;  3ENQ A;  4DDF A;  1JLG B;  2RH3 A;  4HEA 9;  4M95 A;  4ZCK A;  3RAX A;  2DNP A;  3V6J A;  5A76 A;  1N5V A;  4LFC F;  2R9L A;  1YJV A;  3TWZ A;  5KG2 A;  4F25 A;  3M2R A;  3KHH A;  4I6Y A;  3Q8V A;  1NB7 A;  1SC4 B;  4N56 A;  3A3O B;  1NK7 A;  4HHH A;  2BKP A;  3M32 A;  4LRF A;  4PXD A;  1FJE B;  4YY3 F;  5BJR A;  3B54 A;  1ZTT A;  5A0Y B;  3FEZ A;  1RIS A;  3EZU A;  1JWW A;  2EXU A;  3MEC B;  2IHR 1;  3MF5 A;  3L7P A;  4X4Q A;  2H5I B;  4DJB A;  2AIR B;  1F2H A;  2EBG A;  4QYZ K;  2YNG A;  4ER8 A;  1WG4 A;  3GCW P;  4P7T A;  1Y3K A;  5AXL A;  3UN3 A;  5LSL A;  1N5Y A;  1PAE X;  2EVZ A;  1S59 A;  1X5O A;  1KWM A;  4OI4 A;  1PO6 A;  5C5J A;  2MKC A;  4AL5 A;  1NXI A;  3ENW A;  2RKI A;  1KLM B;  1NHV A;  1QUV A;  3Q2T C;  2QA4 S;  1CSJ A;  4OLP A;  1JLC B;  1TL1 A;  1OY8 A;  2R7S A;  2OKQ A;  3R3T A;  3LGN A;  3EDR B;  5LMN F;  2KO1 A;  4B9U A;  1E6Y B;  3RGI A;  4RW9 A;  4Y65 A;  4NMX A;  1JJC B;  3AXM A;  4UOH A;  2J6T A;  1D0E A;  4CLY A;  1UEV A;  1VFJ A;  3GIK A;  2CQG A;  2XEX A;  1DQ9 A;  4O4R A;  3KLH A;  3HJF A;  1PC5 A;  5E3R A;  2E1A A;  4DV2 F;  2M5Y A;  1BUX A;  4OX8 A;  2B3T B;  5T7L A;  1HFE L;  1H3D A;  4NPO A;  3CO9 A;  3DRP B;  4X4S A;  3H8Y A;  4ZJL A;  2JOQ A;  2JC1 A;  3CF5 Q;  2JC0 A;  1B70 B;  3OV7 A;  2VFV A;  2RQ4 A;  3M8Z A;  4ZCL A;  2XZT B;  3MMB A;  1HNI A;  4C3L A;  4TU7 A;  2C2M B;  4WP8 A;  4M5J A;  2NR0 A;  1FRJ A;  3DHX A;  2CVI A;  2NXJ A;  1HR0 F;  4WFZ A;  5L1L A;  2DR7 A;  1N5T A;  4HYK A;  2XSJ A;  3MM9 A;  4PXB A;  2QA2 A;  3VAJ A;  3J7Z 5;  3DXS X;  2KM8 C;  1RKI A;  2YXL A;  4ZOS A;  1MWZ A;  4BC9 A;  3D6F B;  4KSE B;  4J9S A;  2KJV A;  2C3U A;  4OYA A;  2BV3 A;  2KZM A;  3W63 A;  4K4Y A;  2MQN A;  3FEY B;  3Q0A A;  3BKT A;  3HHE A;  5DQH A;  1XMO F;  2DGV A;  3ULH A;  4TQS A;  4UQT A;  4KTQ A;  2GHW A;  3WC0 A;  4DF4 A;  4K4V A;  1TKT A;  2W2N P;  3M8W A;  2B56 A;  2M88 A;  3TVY A;  2B9Y A;  1C0T B;  2C2D A;  3S1T A;  1BQM A;  4TYB A;  5THW A;  4AXJ A;  3PX0 A;  4B9S A;  1IN0 A;  1OO0 B;  1FNM A;  3R5D A;  4M5L A;  3QJL A;  1FDA A;  4FN5 A;  1YK9 A;  3EPG A;  4LF9 J;  1I5O B;  2V2K A;  4UOF A;  2WON B;  2W4P A;  2FPH X;  4F2R A;  4TY8 B;  3DXB A;  3DOK A;  3ISN C;  1YJW S;  1GXT A;  5HRO B;  1R89 A;  2BOA A;  4DSL A;  4C2M A;  2HZV A;  3PJW A;  5E3Q A;  2J9C A;  4IRC A;  2VDH A;  4NE9 C;  3SSS A;  4YB1 P;  4PG6 A;  1C2P A;  4N8O A;  9ATC B;  1EJ7 L;  2IMO A;  4ANC A;  3GTY X;  5HMW A;  1GX5 A;  5J1E A;  4KPC A;  3D28 A;  2B9E A;  2C2E A;  1RTI B;  4ZS6 A;  1T95 A;  3KLI A;  1N33 J;  3BM7 A;  1OQ3 A;  4PEO A;  4I6A A;  4CM2 A;  1DTT B;  3OTC A;  3H25 A;  4U8Y A;  4EO6 A;  2BKN A;  1VQN S;  4J7C A;  3LAM A;  5KFU A;  3RR8 A;  4LRE A;  2B43 A;  4LFC J;  1HQU B;  4FBU A;  4FF3 A;  1M5K C;  1REV B;  3J7A 1;  1T11 A;  1YIJ S;  4NWB A;  2KFY A;  1HWI A;  1D09 B;  2ZH1 A;  1G6B A;  3NRB A;  2PGC A;  4B9T A;  4Q44 A;  1FD2 A;  1YJR A;  4YY3 J;  3N28 A;  4QWB A;  3UN2 A;  5LL6 d;  2XBP A;  4J9V A;  1MU2 A;  3CJK B;  3MM6 A;  4DQR A;  3UD3 P;  1B0T A;  1RTH A;  2WCX A;  3SEO A;  2HUR A;  2CRL A;  2OJ3 A;  1QAI A;  2M7S A;  5E3P A;  2E5I A;  3W66 A;  3WX4 A;  4LUB A;  4ZIT A;  3CC2 S;  3D2W A;  1C4C A;  1SJR A;  3T3F A;  1HQE B;  3H5Y A;  1J27 A;  4HDH A;  2BJD A;  3I56 S;  2XI3 A;  1S1W B;  2HHS A;  4B3S F;  5HQL A;  3EVO A;  5GAD I;  5F9L A;  5ETS A;  5LJ3 Y;  2BJE A;  2C22 A;  2ZFH A;  4ZLL A;  2MKI A;  2GZO A;  2J9D E;  1DLO B;  2OPQ B;  4P2F A;  3C8Y A;  5F0U A;  3C2P A;  2IJN A;  3DYA A;  1LW2 A;  3DM2 A;  4QOT A;  1U1R A;  3MED A;  3E2E A;  4ED5 A;  3B82 A;  2AYB A;  2HFO A;  1X4A A;  2PMH A;  2CPF A;  2KM8 B;  4QYZ J;  1IKY A;  1XIQ A;  3CUL A;  4DV2 J;  3S8S A;  4PKD B;  2Y0S D;  2AQ4 A;  3DDK A;  3KLE A;  4EYI B;  2MZ1 A;  3R5A A;  4AL6 A;  1REG X;  5KG1 A;  1WHW A;  1ZAV A;  1FI4 A;  2X3D A;  2E7W A;  1FJC A;  3AXK A;  2HVI A;  2CKW A;  2I9S A;  3NG8 A;  2H5J B;  3SV4 A;  4TLQ A;  3M9M B;  2KHD A;  1X9W A;  2W9B A;  5DQG A;  2ZOM A;  2HAF A;  4RLE A;  1B0V A;  4ZLJ A;  2GJI A;  1NJZ A;  2KXN B;  1YQH A;  1HR0 J;  3S01 A;  4A4J A;  1RJJ A;  5DET A;  4FKX A;  1OPZ A;  5D4N A;  4A46 A;  2LP4 A;  2BVZ A;  3IRX B;  1U1M A;  2KVQ E;  1BE4 A;  4IRD A;  5EUH A;  4IH5 A;  3VQS A;  1RK8 A;  4B9V A;  3KJN B;  2KT5 A;  1K9M T;  4Q2M A;  1H74 A;  3ENV A;  2R7V A;  2DPJ A;  2LXF A;  1T9T A;  5CXT A;  4D3G A;  5C25 A;  1LWE B;  8ATC B;  2RUG A;  2CDR B;  5IM0 B;  1XMO J;  4PUO B;  3D1H A;  2OGU A;  2X1A A;  3A13 A;  5IC6 B;  2DPI A;  1Q8K A;  1N32 F;  2DBB A;  3M8P A;  4LSL B;  1WDT A;  1Q8B A;  3HFV A;  1VQ8 S;  3ISZ A;  3MTK A;  2YQ0 A;  4NLY A;  1HQ2 A;  4HVZ A;  2X1F A;  3MMC A;  1T05 B;  3JSM A;  1TKX B;  1VQ5 S;  1KQG B;  2N7Y A;  1PYO B;  1VDH A;  3BJY A;  2EW9 A;  2QLF B;  4KGX B;  1B7Y B;  3LP1 A;  1WC0 A;  1GH8 A;  2IVF B;  4ILL A;  5EWG A;  1L3V A;  2R8H A;  5U47 A;  4KFB A;  3RB0 A;  2XI2 A;  1IM4 A;  2LMI A;  3M8S A;  2W2O P;  3TVK A;  3IG1 A;  4HHU A;  1WKK A;  1UWA A;  1HBU B;  5LXR A;  3RB4 A;  1B64 A;  3HHK A;  1RAE B;  2YNH A;  2BJ8 A;  2CYY A;  3I55 S;  1TFW A;  4OIX A;  3G6Y A;  4F4A A;  3J7Y I;  1RU2 A;  3GPA A;  4C8Y A;  2RDD A;  4LVN P;  2BQU A;  1VQY A;  4BCA A;  1FXR A;  4RNF A;  1FK9 B;  3QBC A;  3PW2 A;  4O3O A;  4U7U D;  3BR8 A;  3ZZY A;  4DL4 A;  4DUT A;  3LPY A;  4RUC A;  1NCL A;  1HMV B;  1T03 A;  5D3G A;  5E41 A;  2I6W A;  2XS2 A;  4X84 A;  3DDI A;  1K1S A;  1QTN B;  3GG1 A;  3TAP A;  2NUU G;  1FWK A;  2DB1 A;  3EGZ A;  3CPW R;  1GMU A;  1TL7 B;  3R9L A;  2D41 A;  2AX1 A;  3P4U B;  1Y11 A;  3CC4 S;  3GB0 A;  4NL5 A;  4NLO A;  3Q8U A;  3OTO F;  5F8L A;  3MR7 A;  3T1A A;  2GGP B;  2JZ5 A;  4NLX A;  4NA3 A;  1UP1 A;  1TZ0 A;  1JX4 A;  1RZM A;  2BW2 A;  5HBM A;  1WF2 A;  3V4I A;  2AYG A;  1T9W A;  2J0Q D;  3NCR A;  1H2T Z;  2ZHA A;  3LAN A;  2V8P A;  1SI9 A;  5KOX A;  4TU8 A;  5FJ4 A;  2VF3 A;  1KR4 A;  2IAJ B;  5IZH A;  1CJT A;  3FQK A;  4DR7 F;  3OVA A;  1CVJ A;  1RHK B;  4H4M A;  3KG1 A;  4IOA Q;  4B3S J;  3DLG A;  1VK8 A;  2WHO A;  5AXN A;  5BYR A;  2LQ8 A;  1JNR B;  1XN9 A;  2KN4 A;  2C42 A;  2MZT A;  4EBC A;  2XO6 A;  4YR3 A;  5I42 B;  3HVR A;  3IBF B;  4G1I A;  1HYS B;  1QTM A;  4CYU B;  5CD4 A;  3HX9 A;  3ICL A;  2YWH A;  3GJQ B;  5FDL A;  2VOP A;  3TAN A;  3AD7 C;  2W25 A;  5IT9 Y;  3GFZ A;  2VB6 A;  4PWW A;  5IWA F;  1FE0 A;  3AAW B;  1HI0 P;  1RTD A;  3D0H E;  1HNV A;  3CJR A;  4LSN B;  1SIZ A;  4FXV A;  2YWF A;  4N76 A;  3PO4 A;  3R7S B;  2FZG B;  1FKP A;  4PYA A;  1SBR A;  3M6U A;  1G1X A;  2ZH7 A;  2QFJ A;  2OFH X;  1RE1 B;  3WDO A;  4X4U A;  4OZ0 A;  3CED A;  2ZVS A;  3PY8 A;  1VGY A;  4TVA B;  2LFV A;  1OIA A;  4IUF A;  3T41 A;  1EAY C;  3L7U A;  2LU1 A;  3FMB A;  2G1D A;  3G71 S;  1RAD B;  3AJD A;  1JJH A;  2B0G A;  4DSF A;  1UJ6 A;  4CLK A;  2MQL A;  3MUT P;  2P5V A;  2A3J A;  3A8I A;  3M4X A;  4Q7A A;  2QSF A;  2Y1L B;  3OR2 B;  2DGW A;  1VLY A;  2VV5 A;  1HNW F;  4JI6 F;  1F6T A;  3O44 A;  2RU9 A;  2MYF A;  1RWN B;  2WBM A;  2GVD A;  3CGI A;  1WJ9 A;  2ZVI A;  1WKL A;  4ZJQ A;  3MGJ A;  4IQX A;  1JQG A;  2R7X A;  2CNO B;  1G4C A;  3HF5 A;  4MIA A;  4DLG A;  1IBC B;  2HHX A;  3HK2 A;  4O4G B;  2FJV A;  2VG6 B;  2MQ8 A;  3GWC A;  4DG1 A;  1TL3 A;  3I5B A;  2DCU B;  1PIL A;  3KNG A;  2YTC A;  4Q0B B;  4CO0 A;  3TRG A;  4RWX A;  2D3O 1;  1N32 J;  1X4E A;  3TR5 A;  1SJ4 P;  3G82 B;  2FJW A;  3KYL A;  1FRH A;  3R1L A;  1XJW B;  1S0N A;  4C8O A;  2HFZ A;  1OMS A;  1GXL A;  5MAO A;  4UUW A;  5KFQ A;  3MM8 A;  2XYG B;  2UVV A;  4FKY A;  1ZM4 A;  3IS9 B;  1W2B R;  3BBC A;  3M2V B;  4V19 X;  2FVR A;  4JI7 F;  3W8G A;  2HMI B;  4MT1 A;  3TW0 A;  2H65 B;  1RT2 B;  4PQA A;  4RUB A;  1S1V A;  4X65 F;  2ZH9 A;  1R6V A;  5IS2 A;  3O3L A;  4WKY A;  1FDB A;  3L4B C;  3TAR A;  2QL7 B;  1BY9 A;  1WC6 A;  4P7V A;  3ITH A;  3KHL A;  1UCN A;  3CJ5 A;  1GMW A;  2QYG A;  3JSB A;  2UXD F;  3M7V A;  1N4L A;  3O1L A;  4HKQ A;  3D6T B;  4FP9 A;  1S1U B;  3K8V A;  3BGF A;  2KXH A;  1J2V A;  1NUE A;  3IWX A;  3VVT A;  4CCH A;  2YKN A;  3HFK A;  2VC0 A;  3WC2 A;  1JLG A;  3NNC A;  3W9H A;  4K0K F;  1ZM3 A;  4RUH A;  4JI8 F;  1YBA A;  1L3U A;  3BGO P;  2D69 A;  3BQ1 A;  1RP5 A;  1FRM A;  2VFR A;  2VBY A;  1QE1 B;  1EP4 A;  1AB8 A;  2MZQ A;  3DLE A;  1X5T A;  3QGH A;  3OTO J;  3T9N A;  2LYV A;  4N7T A;  2C2K B;  2BXJ A;  3FCW A;  3MPU B;  3KHR A;  3GR1 A;  4DCJ B;  3ETM A;  2MDA A;  1N34 F;  3MAA B;  5KFN A;  1QUP A;  1MWY A;  4M5N A;  3OL7 A;  5JVH Q;  1QSS A;  3AT1 B;  4EBD A;  3EJM A;  2GW8 A;  3CTR A;  1Q5V A;  5KFB A;  5DM7 Q;  3R5J B;  3PRB A;  1KLM A;  2M52 A;  4QU7 A;  4DR7 J;  1YRT A;  2HK2 A;  4IFV B;  4L6V 3;  2MZR A;  4YP3 A;  4ECW A;  2VIH A;  4PWD B;  2KT3 A;  3NS5 A;  4LR7 A;  3NMA A;  4AND A;  3L9Z A;  1N48 A;  2VG7 A;  3R5G A;  4C11 B;  1F5C A;  2V8H A;  4CH7 A;  2VQF F;  1VRU A;  5CAB A;  1SC6 A;  4WXO A;  2WSC C;  4ZDN A;  2XYH B;  3D9B A;  2RT3 A;  5IWA J;  5DG9 A;  5AJ3 F;  4DPO A;  5CYQ A;  3NBP B;  1AZS A;  1T3N A;  5DZ7 A;  2OMO A;  2ZBR A;  8RUC A;  1SJF A;  1UZH A;  1WTB A;  3DRP A;  3KK2 A;  2J5A A;  1TK5 A;  2J9D A;  2ZD1 B;  4DX8 H;  1GMW D;  2E66 A;  3IWN C;  3EXC X;  3M8Q B;  3OXL A;  4QR1 A;  4M5I A;  4P74 A;  1NK0 A;  2H51 B;  1NO8 A;  4OI1 A;  4DR1 F;  5E33 A;  4QW8 A;  1BLU A;  3M9N B;  3CCQ S;  4NLU A;  4H54 A;  1R3N A;  4K4T A;  3EZO A;  3TZZ A;  2CQD A;  1RSC A;  3GFX A;  3CCE S;  2MQP A;  3SSR A;  3UFC X;  3H59 A;  2J9E A;  1RCX B;  1H73 A;  4OZ3 A;  1RT3 A;  3O5T B;  5K8P A;  3BBB A;  3ADA C;  1XWL A;  3I9Z A;  3DC2 A;  3TYT A;  1N88 A;  4ED7 A;  3MFH A;  4IO9 Q;  2ADB A;  2GJF A;  4ZPA A;  1HNW J;  3V4M A;  4JI6 J;  2QC3 A;  5GVQ A;  3NEK A;  1PBA A;  1KTQ A;  4O3N A;  1NK6 A;  3LUY A;  1U45 A;  2FLL A;  3G87 A;  2Y8W A;  1M1G A;  1TP7 A;  4MKB A;  4EBE A;  1JB0 C;  5J2Q B;  4P2M A;  3ENA A;  5IC4 B;  2ZH6 A;  1C0T A;  3GII A;  3B78 A;  4QR0 A;  2FD2 A;  2NSB A;  5DDP C;  1CEZ A;  1FXL A;  1C1B B;  2VU5 A;  5CCM A;  2PFD A;  1J5O B;  5G0R B;  2XHW A;  2DO0 A;  3M6V A;  2CZV C;  3QWP A;  3HPO A;  3GIL A;  2KL8 A;  1FJ7 A;  1X4D A;  3QLH B;  1BQN B;  2AGQ A;  4IR9 A;  3RB6 A;  1CJV B;  1QVG R;  4V1A k;  2WON A;  4J9M A;  1VC0 A;  4JI7 J;  4IFY B;  3VGT A;  1TUG B;  3T5J A;  1MWQ A;  4QJV A;  4NLV A;  3B4D A;  5HRO A;  3N5F A;  4RW4 B;  2CXE A;  4USM A;  4WZM A;  2FZC B;  4X65 J;  2BOP A;  2MLX A;  1SJQ A;  3R2C J;  1S6P B;  6AT1 B;  4OL8 A;  1TEL A;  1P1L A;  4DSI A;  2CFX A;  1FRK A;  5KTQ A;  2E9R X;  4OLO A;  4CP5 A;  2UXD J;  2OP5 A;  4C8K A;  4F7V A;  5HMZ A;  5J2N B;  1DZ5 A;  2HQ3 A;  3QMQ A;  4JI4 F;  2LEC A;  2BRL A;  4LRB A;  2E5G A;  4NOH A;  4LF2 A;  2MGZ A;  4K0K J;  5C24 B;  1U47 A;  4FYY B;  3KWM A;  4JI8 J;  1RWV B;  1HQU A;  4HL9 A;  1REV A;  3CJT A;  3JTO A;  2E5L F;  3AFG A;  2F8M A;  4ED4 A;  1PJ6 A;  2BEF A;  3BGR A;  2K7J A;  1MN9 A;  2Y1I A;  1LWC B;  1S79 A;  3BQ0 A;  4BS2 A;  1NAQ A;  3NS7 B;  2JEI A;  4URQ U;  2RDJ A;  3SI8 A;  2XS7 A;  3OTB A;  5J1P A;  2H4Y B;  3BPD A;  3BGU A;  4RW8 B;  1MML A;  4KB7 A;  4JI5 F;  2L48 A;  1VIX A;  5A8K A;  3NGK A;  1HBO A;  4FS2 A;  1W7W A;  1N34 J;  3MPD A;  3C6U B;  4DEZ A;  5L1K A;  3UI3 A;  1DQ8 A;  1UTA A;  2Y0B B;  3IXQ A;  1AYE A;  5SUH A;  1HQE A;  2J8S A;  1S9G B;  3GR0 A;  2DTJ A;  1WI6 A;  1XEZ A;  3DOM B;  4DQP A;  2EG1 A;  2J7W A;  1S1W A;  2WVC A;  3R8Y A;  2I5J B;  2RRB A;  4ZPW R;  1UVJ A;  1UET A;  4M94 A;  3TA0 A;  2AF6 A;  3SQG B;  2WW4 A;  1DLO A;  2OPQ A;  4RJV A;  2EFO A;  4V19 J;  4CTA A;  1YI2 S;  4DHV A;  2OH2 A;  4UOG A;  1WEX A;  3HJV A;  4DL6 A;  4BHQ A;  4GVB B;  4KO0 B;  4ECY A;  2VQF J;  4IO1 A;  1DAR A;  3LPE A;  2QSW A;  7AT1 B;  3EUN A;  1RAF B;  1HBM A;  5AJ3 J;  1N56 A;  5DJB A;  1G2E A;  1XMB A;  1OQ6 A;  3IR5 B;  2BAB A;  2JLG A;  3VQT A;  2CQ3 A;  3QT5 A;  2MKY A;  1RKJ A;  1CC7 A;  3X3U A;  3EX7 B;  3QRP A;  1NDK A;  2R7T A;  3K8W A;  1YHQ S;  3CCM S;  2XO7 A;  2D3U A;  5GAH U;  3EM1 A;  4LR8 A;  4LBI A;  1EQM A;  4A8S A;  4DR1 J;  2XMU A;  1B0P A;  2IM2 A;  3ZNJ 1;  1LWF B;  2G1H A;  2MJN A;  2GIF A;  1YJN S;  4F3Q A;  2I0X A;  3VVU A;  3DRS A;  1ZS6 A;  4ECT A;  3OXF A;  2JNJ A;  3FZB A;  4B3O B;  3NWR A;  1F1B B;  4DCO B;  2XC9 A;  1XNQ F;  1Q81 T;  5L9X A;  3IC1 A;  3IRX A;  4ES2 A;  2V69 A;  1NSK L;  3NOG A;  3CMA S;  2D1C A;  2V4R A;  2B7C B;  2FC8 A;  4J9O A;  3I87 A;  2HWI A;  2AYM A;  5E2Q A;  1V9O A;  1WOP A;  3PRD A;  4WFA Q;  2HQD A;  1LWE A;  2OML A;  3FNN A;  5L39 A;  5HAN A;  3EMT A;  1KC8 T;  4HTI A;  3LP2 B;  3IBW A;  5IM0 A;  1FER A;  4M5M A;  2F8H A;  2HIQ A;  2EPI A;  4Y2C A;  1S5Z A;  3ZZO A;  3BV8 A;  1M5O C;  1K44 A;  1WOS A;  1TKX A;  2YWE A;  5E5N A;  4LF6 F;  1XR5 A;  2ZBC A;  1LK7 A;  4J90 A;  1RGV A;  2VKZ G;  2EC0 A;  1F9E B;  2EK6 A;  3MM5 B;  1URN A;  3A3P B;  1RLC L;  5H9E J;  3PW5 A;  4EGL A;  4PR6 A;  5LXY A;  3P8B B;  5HAO A;  4ZPB A;  3G6V A;  5A2Q U;  4KHM A;  5J2M B;  3GIM A;  3GYN A;  4HI1 A;  1HBU A;  1JLB A;  1XTZ A;  1AXQ A;  2CPH A;  4IYQ A;  4IOB A;  3VAI A;  1ITP A;  1EB0 A;  4ITS A;  5ETM A;  1RYR A;  2FVS A;  4G3I A;  3IWL A;  2A0F B;  4U8V A;  4DL3 A;  4I0W A;  3NMR A;  2D9P A;  4ZMM A;  3O8W A;  3TVZ A;  3FK4 A;  1KN6 A;  2VFS A;  3TOQ A;  1U02 A;  4JI4 J;  1HMV A;  1F0X A;  1P9Q C;  1S0O A;  2NXN A;  3CD5 A;  3M9O B;  4LBP A;  1LV5 A;  2ASD A;  1FFW B;  1YG0 A;  3HT3 A;  2DXE A;  4DN9 A;  3FCH A;  1MMD A; 
#chains in the Genus database with same CATH homology
 4KHP J;  2E5L J;  2ZM6 J;  5BR8 J;  1HNZ J;  4KY3 A;  4DUY J;  4DV3 J;  3IMQ J;  4AQY J;  4DR3 J;  4DV0 J;  4B3R J;  1N33 J;  1IBK J;  4LFB J;  1IBM J;  1HR0 J;  3T1H J;  4K0K J;  4JI1 J;  2HHH J;  2UXC J;  4PWW A;  4DV1 J;  4JV5 J;  4NEZ A;  4LFA J;  4JI8 J;  3J7A N;  3D3B J;  2UXB J;  4B3M J;  4RJV A;  4DR5 J;  1I94 J;  4NEY A;  1XMQ J;  4LFC J;  2MEW A;  3J81 U;  4LF8 J;  5A2Q U;  4JI3 J;  2MQ8 A;  5LMU J;  4KYZ A;  2KVQ E;  3J80 U;  5FLX U;  4JI5 J;  4LF4 J;  2F4V J;  4DV4 J;  4HHU A;  1FJG J;  2KL8 A;  4JI0 J;  4DR4 J;  4DR7 J;  4X66 J;  3JAM U;  3D3C J;  2VQF J;  4X62 J;  4DR2 J;  4DR6 J;  1N36 J;  2MTL A;  3W1Y C;  1N32 J;  5LMN J;  4LF9 J;  4DV6 J;  4V1A k;  4NXM J;  4JYA J;  4YHH J;  4JI7 J;  4YY3 J;  5AJ3 J;  1J5E J;  2UUB J;  4X64 J;  4OX9 J;  4LF5 J;  4B3T J;  5IT9 U;  4DV2 J;  4LF6 J;  4GKK J;  1XMO J;  4X65 J;  4NXN J;  3R2C J;  4DV5 J;  4JI4 J;  1HNW J;  4GKJ J;  4JI6 J;  3T1Y J;  1N34 J;  4B3S J;  1XNR J;  4LF7 J;  1IBL J;  2UUA J;  5IWA J;  1HNX J;  4DUZ J;  3OTO J;  2VQE J;  4DV7 J;  5LM7 E;  4JI2 J;  2UU9 J;  2UXD J;  1XNQ J;  3R2D J;  2UUC J;  4DR1 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...