4KHPJ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with de-6-msa-pactamycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Crystal Structure of a Bioactive Pactamycin Analog Bound to the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2013-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 4khpJ00
2MEWA 4JV5J 4LF4J 4B3TJ 3R2DJ 1HNWJ 5LMUJ 3JAMU 1N33J 4KY3A 4DR6J 4DV7J 4X64J 4LFBJ 1J5EJ 2UXBJ 4DR1J 1I94J 4DV1J 4JYAJ 3IMQJ 2KVQE 4YY3J 3J80U 4V1Ak 4JI6J 4DV0J 4DV2J 2HHHJ 4LF5J 4JI4J 2MQ8A 1XNQJ 4GKJJ 1XMQJ 4DV4J 4KYZA 2VQFJ 4NEYA 2VQEJ 2UU9J 4X66J 4RJVA 3T1HJ 4AQYJ 3R2CJ 5IWAJ 4DUZJ 3T1YJ 4JI8J 5FLXU 4OX9J 1FJGJ 4LF6J 4DR3J 4NEZA 4JI0J 1IBKJ 4DV5J 1IBLJ 4LF7J 2F4VJ 5IT9U 4GKKJ 4X65J 2UXCJ 2E5LJ 2UUBJ 1HNZJ 4JI3J 4LF8J 4DR4J 4KHPJ 4JI2J 4DR7J 1N36J 1XNRJ 4DV3J 3J7AN 3J81U 4B3MJ 2ZM6J 2UUAJ 5A2QU 4DUYJ 2UUCJ 4B3RJ 5AJ3J 1N32J 3D3CJ 4PWWA 1HNXJ 4X62J 1IBMJ 4NXMJ 3OTOJ 1N34J 1HR0J 4JI7J 4DV6J 1XMOJ 4K0KJ 2KL8A 4JI1J 2MTLA 4YHHJ 4NXNJ 4LFCJ 4HHUA 5BR8J 5LMNJ 4LFAJ 4DR5J 3W1YC 2UXDJ 4JI5J 4DR2J 4B3SJ 4LF9J 5LM7E 3D3BJ
chains in the Genus database with same CATH superfamily
2AEFA 4Q8FA 4OL8A 3JSMA 2R8JA 5GAGI 2RHQB 1U6BA 1EQMA 3UQSA 2IJFA 2VQEF 2GQQA 2R7TA 1R8AA 2BKPA 2O67A 4HACB 3CT9A 4OYIA 1R8CA 4ZVPB 2ZVIA 2HFUA 4ER8A 4DR7F 4ZPWR 2PC6A 3JQKA 2EVZA 3HMJG 4QJVA 4NLQA 4U96A 4A8XA 1RT5A 3PYEA 3KK1A 2OPPB 4KJIA 5I3UB 1RA6A 3M8PB 3DLJA 5KG7A 3PR5B 1KKHA 4DR5F 1RI7A 3SCLE 3AOAA 2D3UA 1S1WA 2OPQB 3RTVA 3THVA 3CJTA 3ELHA 2GO9A 4IOAQ 3MM8A 4I7FB 3S6EA 1N6QB 3FMBA 2DR8A 4LF9J 4AT1B 3VAKA 3PV8A 3HJFA 3MEDA 4G3IA 4F2SA 3FGVA 3OL7A 3KLGA 3WC0A 3MCNA 2HVDA 2R7SA 2GV1A 2GMJA 4YR0A 3QJPA 3BN7A 5J2NA 2C3MA 5E3CA 3DLKB 4P73A 4Y0FA 2H9ZA 5ETLA 1TTHB 5A0YB 1B0PA 3M9NB 3KDNA 4FPRA 2MSSA 1BGXT 4K0KF 3CUNA 1WHVA 4X65F 1RISA 3N6NA 3LPYA 4B08A 4C2MA 5LT5A 2GGPB 1RUSA 2ASDA 1HBNA 3V6DB 2I0XA 1AZSA 1RTDA 4CZCA 2QEXS 1MLAA 1F2HA 3MM6B 4B3MJ 1HNVA 1S1XB 3TZWA 4RBVA 1N34J 4JUZA 4ZITA 2V8PA 3IBWA 1QVFR 3MMCA 4M8LA 4N76A 3EDRB 4JI4F 1URRA 3H98A 1QAXA 5J2QA 3VGSA 3TX0A 4JI5J 4QIFA 1XWLA 5IV4A 2OEMA 1RWVB 2CPXA 1FRMA 4AFFA 4CLTA 2WW4A 2LVWA 5DQIA 1Y11A 5GAHU 2W2PP 3BKTA 2J9EA 1R8HA 3AXMA 3UWTA 2AJQA 2F65A 2LMIA 4A8WA 4IRCA 4NXMF 3FKBA 2XGPA 2YWFA 4OJHA 3C8YA 5A8RA 5B09A 1U24A 2IM3A 2YNHA 2DR9A 2J6SA 1IBMF 3RZAA 1WJ9A 1T05A 2K2PA 3J7AN 3CJ4A 3QNWB 4PAAA 1YBUA 2V2ZA 2RMLA 1XK8A 3N01A 4DSEA 4QZVB 3RW7A 2HHQA 1U47A 3DYAB 2K7JA 5EX0A 1U49A 2LQJA 3R5DA 5A8WB 5GMKa 3JAMU 4RW6B 5DLGA 1TELA 4CLWA 4N77A 3Q89A 3B54A 4DV0J 3RBZA 3CCWA 4RLEA 5KTQA 5KFPA 2DHXA 4X84A 3PW0A 2QMUB 3K7RA 3DDIA 4RJVA 1EQ0A 1B70B 3OR2A 3IWXA 3D28A 1JLQA 1HMVA 4NYZA 4O3SA 1M0SA 2OELA 1CC7A 2JJ4D 2W7AA 3JYTA 4C8LA 4OHVA 4A8MP 4B3TF 1DTTA 3HHLB 2IM0A 3ZTPA 4LBPA 3UNYA 1FTCA 1GX6A 3KLEA 3O1LA 2EK1A 3SFUA 2ZBRA 2IJNA 5CD4H 1F0XA 3M30B 4WP3A 2RKIA 4C8ZA 2HHTA 2ZNZA 3JSMB 2KRBA 3EGZA 3TAQA 4UQTA 1W25A 4WP8A 1RAHB 3P49B 2CQDA 5E41A 1ELOA 3SSRA 3L3CA 4LF8F 1NRKA 1WG4A 2GJ2A 1B7FA 1IKYB 4DUYF 2GVZA 4IRDA 2Y1IA 2IC3B 3M9MB 4RUCA 5J1EA 3D54A 2EFNA 4RKUC 3BDPA 1UTAA 1Y5IB 2UVRA 3KK1B 3CCLS 3GWCA 1FEEA 4HH0A 5DZ7A 5ETRA 3HK2A 1TUGB 1ZZNA 2HBRB 1Q5YA 4QPTA 4X4PA 1S7HA 5E3QA 1HNIA 1TL3A 5C25A 1FCAA 4GKJF 3KUGA 5C42B 2YNGA 1LWEB 1S4EA 4P52A 2AGQA 3CGIA 4F2RA 4W4MA 2R7RA 2OKQA 5BYRA 3GV5B 3G8TA 3MM5A 3JAMY 2KVQE 1U1KA 3BYRA 3KLGB 4L75A 2YPZA 4I6YA 1Q5VA 2R8GA 4IQXA 2IVMA 5GAEU 2FIUA 1UCNA 2RNEA 2B6AA 1BQNA 3TZYA 3HFVA 1IXKA 5AXNA 4PG7A 4FF1A 5ETNA 2POKA 2CNOB 3BM7A 2ZH5A 3BO3A 3PR4A 1R43A 2EBEA 1MN9A 4FS1A 3S8SA 2C22A 4HVZA 5HL7Q 2IPOB 1K9MT 1AZSB 1RTDB 2MJUA 1QJHA 1HNVB 3TAMA 4LF9F 2MY7A 2SXLA 1FWLA 2IMWP 4ALZA 2ZUAA 5AT1B 1C1CA 1FA0A 3MMCB 1FKOB 3MPUB 4ANDA 1TL7A 3BQ1A 4DHVA 4PXCA 1J2VA 5LJ3Y 4P6QA 2IA0A 4NE9C 4FYVB 3AQPA 4NLWA 3N28A 3V6JA 3IMQJ 4ZCMA 4YDXA 1D1UA 4ZCIA 3C15B 2VPXB 2Z57B 4ETZA 4F36A 5ITHA 1RAAB 1Q82T 2HQGA 3BZQA 2JEIA 4EWTA 1BWVA 1H3DA 3O3LA 5LJ5Y 3NGTA 3QJLA 2NR0A 4B9TA 4X66J 3BBCA 4LREA 2HFNA 4B3MF 2GCFA 1N56A 4AE5A 4RW8B 4BC9A 2AU0A 1CLFA 2K1RB 4PPDA 1N34F 1TFWA 1CBKA 2WOMB 3EICA 2B4UA 3UR3C 1QAIA 2QMWA 2KB2A 2XZWA 4C11A 3M8QB 3P3DA 1T05B 4ECUA 3QGPA 4HHJA 3A3PB 2V4JB 3SV3A 4CH7A 3EJMA 3H5UA 4JI5F 2HGNA 4WFBQ 2XSJA 2V2VA 1OSCA 4OI6A 2NCKL 1YJNS 1T7PA 4KO0A 1UVKA 3HVAA 4C48A 4DS4A 1MMDA 3OLAA 1SIZA 1RT3B 4Y2CA 2OFHX 5AE3A 3R27A 2B9EA 2X3GA 3DGPB 3HLUA 2XYPB 3EXCX 3MM9B 3D6TB 4FKYA 1SIWB 3EPGA 4DN0A 5B0BA 2HQDA 3Q8YA 2D1CA 3MGJA 4LSNA 5A8KB 4U7CA 1RAIB 2DPIA 3QYYA 1SC4B 1SC1B 5DDPC 1H6KX 1KD1T 4IG3A 4K4VA 4OZ1A 3TR5A 1IKXB 4QW9A 1GXTA 3RU0A 1UEVA 2AEMA 4FXWA 5G4DA 4O3NA 4ETXA 3VAJA 3VALA 4C8OA 2CZVC 3V4IB 3CEDA 2LDIA 3OFEA 3CD7A 4WPAA 3RR7A 1TR0A 4DSLA 1TVRA 4LRFA 1NXIA 3HULA 2DGWA 1DJ0A 3F56A 3IWLA 4F50A 2C1EB 2FUG9 2XO6A 2XCAA 2ZHAA 4F4KA 3AAWB 1S1VA 3KJQB 1UZHA 2QLBB 1L3TA 4CO3A 3BR8A 4ZJOA 3JSYA 1LOUA 3CJKB 1SJFA 1RT1A 2J5AA 3UDEA 1D3WA 4TXSA 1FI4A 3KLEB 2OAUA 3ZZUA 2EKYA 2ZE2A 3ITHB 4NRTA 2MZJA 4LBHA 2QGFB 1CJTB 2QYCA 4DCOB 2AMCB 4DV4J 4KYZA 3Q83A 3PVXA 4RW7A 4A8SA 2RRAA 4ZPAA 1JLAB 4I64A 4M5IA 2J0SD 5FDLA 3GCXP 5E2QA 3GB0A 2DYAA 4DL5A 1BWEA 2NUHA 1UVLA 3VGVA 4MFBA 3L09A 3T6BA 3R6LB 1LXNA 3I5BA 4HDGA 2ZWOA 1HNXJ 1S9EA 5HMWA 4IFVA 3OUYB 4JB8B 3PRBA 1KEKA 1GTHA 1RTHA 2JLEA 2ZJPQ 2CQ2A 4YP3A 3KJFB 1S9GB 2VHGA 2QLFB 3CMES 2AT1B 4LT6A 1FDAA 2ZZMA 3T5HA 1YTYA 2V8DA 2HK2A 2X1GA 1ICEB 1U1PA 4KRWA 2KG0A 2P9GA 5A6WA 3MM5B 2OI2A 5GMEA 3DRSA 2Q6CA 3OBIA 5ETTA 1XR6A 5KT4A 4RL1A 3IA0A 2LYVA 5SUHA 2KZZA 3EGWB 2E9RX 3DC2A 1M5KC 3HXMA 4ZCLA 2R2SA 2C2KB 4JI8J 3D66A 3G96A 4KHMA 4IG0A 4D3GA 3M2VB 3IFEA 1KONA 5F0UA 1TKTA 1RAFB 2FLPA 4O0IA 1YJVA 5IC6B 4NPOA 2WBMA 1ZS6A 3KTQA 5EN1A 4NLVA 3VAFA 4RX6A 2MZQA 4R8UA 3I31A 4TY8B 2DNHA 4H4OA 1C1CB 4EBDA 3EXYA 5L1LA 4TNOA 1RTJA 1MROB 1DLOA 3CC2S 1OQ6A 3RYLA 2VDIA 5HMYA 4JI6J 2M4MA 4FVMA 1C0UA 2ADBA 1NK6A 1KVIA 1B0TA 4CLUA 3IGVA 2V8HA 2ZH4A 4MYUA 4PQAA 3MR6A 3FBBA 2V94A 2UVVA 3Q8VA 5FLXU 1KRPA 1S1TB 2VH7A 3FQLA 4ED1A 4DBQA 5DETA 3NMRA 3DN9A 3MMJA 4O23A 3UR0A 2QLXA 4A46A 2DJWA 1WF2A 1QSLA 3AA9A 2N82B 1NKCA 1UEKA 2DNMA 1VBXA 1WF0A 4NXNJ 1LWFA 2HZCA 2BA9A 2HFZA 3K5PA 4BCAA 5I3QA 3T1AA 2XSJB 2ALZA 4M94A 4ED5A 4KV8A 4KO0B 1NK8A 3G82A 3W66A 4FXVA 1CQNA 1NCLA 1Y5LB 5T41A 1V3ZA 4DSIA 1REGX 4DL7A 5D4OA 4V1Ak 2MKIA 2VONA 1VBKA 2V63A 3PW4A 2UV8G 1U09A 4X66F 1LEOA 3BS9A 1IJFB 2LXUA 3M6VA 2VODA 1PBAA 2J76E 1H74A 3TA1A 4CQ1A 2B3TB 2MQPA 3S01A 3ZTOA 1RABB 2F9JA 1RAOA 2HK3A 4P2FA 5B0GA 1YJWS 1W7WA 3R97A 1WDTA 4RWWA 4JI3J 2VPYB 3PIPQ 4DJBA 2RF2B 2OUGA 3Q8PB 4ZDNA 2J7UA 3NCPA 4OLOA 4EYIB 4IR9A 1EKSA 3D3CJ 3CO9A 2X1FA 2GFFA 2FGOA 2OPRA 4WU2A 4LRDA 4ITSA 4UW2A 4ZVTB 3QRRA 4UUWA 5HI7A 1M5PC 4ZVSB 1JLGA 2MSTA 2L3MA 3FEZA 1UVJA 1J5EJ 3HO1A 4OYXA 2UUWA 3P96A 4Z7YA 3C6UA 3L4BC 3MEGB 1K47A 4L3KA 1RT1B 3I0RA 3BO2A 1KFDA 2HQCA 3CCUS 3RB4A 4UT4A 3QSIA 4FBUA 2ZFHA 1HBMB 3D6FB 2ACYA 1DBDA 2B9YA 1V6HA 2QLWA 4RW7B 2Z2MA 3IRWP 2H48B 1O0PA 4M5LA 5FLXY 3MDFA 1V3RA 4U95A 2DY1A 5B08A 1SJQA 2V0NA 3W2VA 4CO4A 2YKAA 2ZBIA 4D3HA 3I0SA 1XMOJ 4Q2LA 4KPCA 3W65A 2VL1A 3FSXA 2MB0B 2GZOA 5EDWA 3CSKA 2QYGA 3NGSA 4O0NA 3EX7B 1L3UA 5DDRC 2ZBPA 2NLWA 3M2RA 5IT0A 3HHDA 2J6UA 4MIBA 5L38A 4K4UA 3MEEB 4USMA 2AIRB 2XYGB 4Q2MA 2CKWA 4CLYA 3KDOA 4DV4F 5D15A 5F8MA 3H7HB 2HHHJ 4JP8A 2J9DE 2QC3A 2WONB 1RHKB 1CSJA 3DDNA 2DRDA 4DS5A 1HBOB 2B7CB 3C14A 1NK5A 1NK7A 1MMNA 2HVEA 2VG7B 1VQ4S 5CYJA 2IA6A 2J0XA 2H54B 5B0FA 2DRAA 4K7QA 3CJ5A 1WHYA 2Z4PA 3SSSA 1HNXF 4NCAA 3BPDA 4RW4B 1VRTA 2PN6A 2R7XA 4F4YA 5KFKA 1S6PA 1DQAA 4NLUA 4PUOA 2BYCA 4LVOP 1TKTB 4ZPDA 1WOSA 3M2UB 1X0FA 1T9XA 3G4SS 2DNNA 2DNPA 3HVRA 4OZNA 2R2TA 4OZ3A 1OY8A 3ISND 4LF2A 1X7VA 4R8UB 3LOUA 4K2XA 3ZZYA 5FIIA 3SFGA 2DR6A 3NGDA 2YNFB 2WRMA 1R0BG 3J80U 2VJUA 1U2CA 3MAHA 4DL4A 2A0FB 1REVA 4RR5A 4XTTA 1MG7A 2VICA 4EK2A 2U2FA 2G0JA 1RGVA 1S7IA 1MNEA 4DN9A 1QE1B 2R8IA 1CPZA 2E1RA 2DXEA 1UZDA 2LP4A 4CRJA 4CYUB 4IFYA 3CCQS 3DMJA 2X1BA 1KOOA 3DRXA 5IT9U 4ZA1A 3A1YG 4PWDB 1B3TA 1S72S 3H2LA 4WFAQ 4C98A 1IN0A 1YZ7A 4B3RJ 2OPSA 2LKZA 2DH8A 5C2GA 4FYXB 2ZZTA 1YJ7A 1S9FA 3FZ2A 1CJUA 1UWBA 3DXSX 4Q0BB 2DGSA 3CDEA 2JEJA 4LQ9A 1VIXA 4J7CA 5CCLA 1KNZA 4ECSA 1N33J 3PFOA 3GU0A 1BQXA 4KV8B 3G82B 4ED3A 2ZH9A 3R7SB 2I6WA 1TV6A 4DXLA 3EPIA 3DM2B 5I42B 4OYWA 3DLGA 1WC3A 4IUFA 4KFBA 1WI6A 2HWHA 1EP4A 2Z0GA 3LWLA 4QR1A 4WFNQ 3LWMA 5K8OA 2DGQA 4RUAA 1IBKJ 3EVWA 5I3PA 2W9BB 4ZLLA 2N7YA 1LFWA 3J81U 4NXNF 3RAMA 2JWNA 3HPOA 3Q23A 2MDAA 3GCWP 4U7UK 1S57A 3KHLA 1RCXB 3JQMA 1Q8BA 1NH8A 1GXLA 1RACB 1X4DA 2VG6B 2D9OA 2MTLA 3LP0A 4YN3B 3BYPA 3E01A 5T7LB 4I2QB 3K0JA 2XCPA 2XO7A 1LFPA 1HW9A 4C6AA 1U26A 4PEOA 3H40A 2UXBJ 2YX1A 4RW9A 2ZJRQ 3W2WA 1AW0A 2DY9A 2ZOFA 2DHHA 5D0EA 5HANA 4ZN3A 2NZ4A 1HQUA 3QWPA 2NXJA 3C6UB 3J80Y 2FGCA 2MGZB 1NJZA 2YQ1A 2WB1D 2XS5A 4QCLA 3CMAS 2E5IA 2KZMA 5K5MA 4EUVA 2HHXA 3ZNUA 2FTRA 2NZCA 4LJMA 4OJ1A 1KLMA 1PYOB 1FRIA 4UY8T 1XJWB 3TUZC 1GK8A 4ZP8A 1HYSA 2M9KA 3SDEB 4IH6A 3W3SA 3ICLA 3UPFA 5DQHA 5IT9Y 4DI6A 1K1QA 3PEHA 1YI2S 2YKNB 2HFSA 1TL1B 2WCXA 5ETOA 3AHPA 5H9FK 2HQFA 4CT9A 4DQQA 5C7PA 1X31C 2C2DA 3E3XA 1ZBTA 1A6LA 3D3BJ 5C24B 4KB7A 4RU2A 1QSSA 4M63A 3V2UC 1IKWA 3DOLA 3N6MA 3ZZPA 3M2RB 2KN4A 4WK1A 4ZVHA 2QLJB 2CQCA 3BKFA 1WELA 3IC1A 4DPUA 4YEAA 3RGIA 2J7WA 4LF5J 3U1NA 4L74A 3EGNA 3M4XA 3FCHA 2XLJA 4Y2KA 4K2JA 3GFHA 2ZH1A 3CCZA 1TUWA 3TANA 2QMXA 3UDLA 3PW2A 3CPWR 2V8GA 4USTA 1KVKA 2LDYA 4M5DA 3J81Y 2ROGA 3DDKA 3KLIA 4DF4A 1QSYA 1YRUA 5IOLA 4CT8A 4HHUA 1R8BA 2J0WA 2QIFA 3M8ZA 3EVOA 1PAEX 2LCWA 2RRBA 2F4FA 2XZTB 1CULB 5E3RA 2HAFA 3TVYA 1WORA 3RG6A 2GJIA 1ITPA 3QAUA 2KXNB 2HHHF 1GH8A 1DARA 3CD0A 4L76A 4DX5A 4LRBA 2DPJA 1FRHA 4OV1A 2GHWA 1K0VA 1S79A 2FB0A 3AXKA 1I3OB 2M5YA 2AHOB 1M5VC 4X4SA 2XHWA 2B8QA 1FDNA 3KLFA 4R5PB 3CCJS 1RKJA 4GMKA 2AYEA 1VK8A 3MMBB 7AT1B 1KLNA 3MECA 3G71S 2W7PA 3M6UA 3VAGA 5IWAJ 2YBVA 5IV3A 3FRYA 1HQEA 3QT5A 4AL6A 4QPXA 2O01C 3A3OB 1T9VA 3TUJC 2ALYB 5KT3A 4CNZA 3DMJB 2XLKA 1VOMA 1Y4ZB 2RDDA 1N5YB 2I38A 2DH9A 3C6TA 2HMIB 3NKYA 3D0GE 4FYYB 3PDNA 2KFNA 1SV5B 1Y9OA 4PG5A 1SL1A 3DLEA 4F0KA 1XNQF 4DX8H 2RSQA 2BRKA 2MKSA 2YKMA 2EBGA 4U7UD 3O44A 5CABA 2PA3A 3IN5A 3MHYA 2F63A 3J81j 2J6TA 4GC7A 2MYFA 4DG1B 3QLHA 5K8NA 1RBOB 2BQ3A 1YHQS 1VJQA 3CO0P 3ZTQA 1PSDA 2HNZB 4BHQA 2AKWB 2BKNA 4V19X 3MD1A 2DRBA 4IDKA 1TV6B 4CLKA 2MKJA 1N54B 3DLGB 1R6VA 1U1QA 2RQCA 4WTOB 2ZBCA 1X4FA 2RU9A 2Z2YB 4KFBB 4DUZJ 2M7SA 2R7QA 4B3RF 4DV5J 4Y65A 2R7OA 5KFNA 2E7XA 1AUSL 1EP4B 3FEYB 2RB7A 2O5DA 2XMWA 4JI2J 2CJYB 2VU5A 2QSFA 5F9LA 3UO0A 4P2SA 4DQPA 3RAQA 3LQVA 3V4MA 2HG4A 3H25A 4E98A 3QO9A 3UD4P 3T9NA 2YWKA 6FDRA 2P2CB 1LWCA 3SQGB 4TYAA 2Y0BB 3V6KA 1VISA 2W2OP 1HHQA 5HP1B 4B3OA 3E01B 1EETB 3BB5A 2YTCA 1V3SA 1I94J 3CDBA 1LV5A 4GKKF 4Q5VA 1VK3A 1JXVA 4C3MA 4RW9B 1RWNB 4ECYA 4N41A 3DRPA 1S6QA 1VQ7S 4I2PA 3W2WB 1M1GA 1FESA 3Q8SB 3AFGA 3FFIB 4WJBA 3SQOP 1HWIA 4Z2XA 2ZH7A 1JQGA 1U6ZA 2R4FA 1IBKF 3KWMA 1IM6A 4P10A 4P75A 4RUBA 4LFCF 1UFLA 2GQ2A 2WHOA 1IKVA 2XS2A 3IAM9 2PD1A 2XBPA 4ECWA 4PQUB 3AJDA 4ES2A 5C2CA 1S77D 4QR2A 2HHSA 2AJ4A 1KQSR 2A3JA 2V8VA 3HVTA 1JLEA 5BYSA 4OZLA 2Q79A 1CJVA 1N0UA 5LMNJ 1D9FA 5DG8A 3KUHA 4HLBA 4TQSA 4DF8A 2UXBF 4ZVOB 5E0OA 1S0MA 3TEHB 2L9DA 3B4MA 1U02A 3QRPA 1UP1A 2DXFA 2LQ5A 4OI4A 3HD1A 4KH1B 5D78A 1PKUA 2OGUA 3KK3B 3NY0A 1NSAA 3OTOF 5HVHA 5HAOA 2HWTA 4NLOA 2YWHA 5ETQA 1HPZA 5KFYA 3M6XA 3OSPA 2MLXA 4JOUA 2WVDA 2OEJA 2XMMA 4N5SA 3BF4A 1PG5B 3GIMA 2WSEC 3MAQA 4MIAA 3D68A 2HEKA 4KT0C 3ILOA 2R3VA 2EFGA 4OYPA 2RE1A 5KOXA 2VPWB 2XZDB 5F8JA 2MZSA 1H2UX 4CNYA 1CG2A 1TMMA 4UY85 2YQ0A 3ZZTA 4YB7A 1CEZA 4CLZA 2QA2A 2UXDJ 2ZWPA 6FD1A 3QGGA 3TVKA 2RQKA 3TARA 3QFHA 4ID8A 2CNLB 3AJ1A 1PGZA 4LF5F 1VR6A 2OD6A 2YWEA 2ZNYA 1HLWA 2O3DA 1SPBP 2E1PA 1RU2A 3HSJA 3VV2B 1X9MA 3KLFB 3ZTSA 4G1PA 4FVCA 1PBUA 1TQLA 3SCIE 1XQIA 1HNZJ 2XYHB 3VQTA 1HQEB 3LALA 3CJRA 2KYXA 2DCLA 1J5OA 1JLFA 3OJUA 2VC1A 1QM9A 4YY3F 5J1NA 2YQ3A 2EW9A 2F1FA 2EG1A 3FSYA 1TK5A 4KKOA 3MFHA 1HBUA 1NDLA 3PZPA 3KMSA 3QIPB 2LXFA 3JXOA 5HROA 5KFMA 4GVBA 4W98A 1F9HA 1WC4A 4MIWA 2YKMB 4NCGA 2GO8A 1IBLF 2NS1B 2OD4A 4KHRA 1MMLA 3UCUP 3GIKA 4FNIA 3M8WA 3GIJA 2B0GA 3TUPA 2KT2A 4NZ0A 2MQOA 4YDDB 2XMJA 1FVSA 3MUMP 1T8EA 1YIJS 2IMOA 3MAAB 2CYYA 4IDKB 2OO4A 2C28A 2FJVA 5DGBA 2R2UA 2VD3A 1S48A 3ENQA 1L3SA 1AFIA 3T41A 1T11A 2GHPA 1RTIA 3SYZA 4TU7A 2W2MP 2KM8B 1UJ6A 1SQFA 3FNNA 4DV3J 3C66A 5CHCB 3EZOA 2WVFA 3OR1B 2BR0A 3N79A 2HBZB 4C4WA 1LNQA 3THTA 2CPIA 3NAHA 5LXRA 3BN4A 2G13A 4ANEA 1X5OA 2ZVSA 2BE2B 2GW8A 3QO9B 4ELTA 4X4UA 2ZOMA 2DVIA 1X8DA 4OYAA 4OI0A 5CXTA 1ZM4A 2OJ3A 4I67A 1YWXA 3CIZA 4L3NA 2MZ1A 2XY6A 2FQQB 3MR2A 3CXCR 2VG5A 7FD1A 1VQ5S 3OPKA 4DFMA 2C2RA 1HKAA 4WBFA 3CJSA 3BDEA 3FUYA 2FLNA 5KAKA 2CFXA 4EBEA 3NOCA 1FK9B 4DUZF 3TJAA 3Q8UA 1RDRA 4DV5F 1N5QA 4OI1A 2PFFB 1VQKS 1R0AA 4Y00A 3UCGA 4JI2F 1VQNS 1F3VA 2ASLA 3FQKA 5LXYA 2HNDA 4ZLNA 2UZAA 1FXRA 4O3RA 3BSCA 4NA2A 2ASJA 2V4RA 5D0HA 2W2QP 3GJTB 1YVFA 4W92B 5A2QU 2ZHOA 1N32J 1M5SA 4QWEA 1HD0A 1HD1A 1ACMB 4L72B 3PO4A 1O5JA 3A8IA 2HFVA 3HT3A 2B5JB 4QU7A 4DPTA 3G6VA 4NMXA 1UW4A 4QIEA 4ECVA 5JVHQ 3IG1A 2UVWA 1Q1KA 2IAJA 2AYMA 4I56A 2E7VA 3K5OA 2K8GA 2BQRA 4MYTA 2DISA 1WKLA 3NBPB 1Z2ZA 2BANA 4EGLA 3FBEA 4O44A 4RBUA 4NYOA 3CDUA 2V6AA 1DTQB 2R7WA 1ZTTA 1G2EA 1FF2A 2XMVA 4TLQA 5BYQA 2CJXB 2HHUA 3CD6S 2AF6A 3C16A 4E0DA 2H1YA 1KC8T 3MM7B 1NK0A 4K4WA 3M6WA 2HHWA 1U2RA 3E8OA 5CYMA 3OHBA 3NLCA 2HNYA 1O51A 3CVKA 5KFHA 5L46A 1TKZB 1YJUA 3UVJA 4GO7X 2B9XA 5LMNF 1GX5A 4TQRA 2JZ5A 1WOOA 4ED8A 3GQCA 2CQ4A 3OVAA 2HW3A 4F4AA 3JS9A 4ZIVA 3MCSA 4YHHJ 2NSBA 3U1LA 1GMWA 1Y0HA 5HLFB 2G2YA 4IOBA 3RB6A 3BGUA 2DR5A 1RLDA 1LW2A 4U67Q 4CO2A 1WC1A 3CDAA 4QU6A 1BQMA 1F5BA 1H7XA 3KKFA 2DGTA 2B4PA 3H8YA 3QAEA 3AOBA 3NGRA 2E5LF 3QT7A 3IRXB 3FVYA 4WE1A 2DO4A 1VRUA 5E3PA 2DD8S 1TK0A 5D4LA 5KG5A 3OTBA 5IQQA 2R8KA 1UA1A 3OQ2A 2HAIA 2BV3A 2E1MC 2H51B 3MUVP 2MZRA 2QRRA 4NLPA 4PG4A 3AT1B 1YGYA 2O1PA 3M1VA 3KXDA 1RT2A 1EB0A 1SXLA 2QA1A 3I6PA 4RNMA 4O4GB 4E8UA 1FRXA 5KOWA 1T9YA 2CUYA 2YKPA 5A2QY 2ZH8A 3TZZA 2B4VA 4DUTA 2UXDF 2PGCA 1GMUA 1A9NB 5ADZA 2Z8QA 2GIRA 4PRFA 2HGLA 3OTCA 1X60A 2D9PA 2VBZA 1SJ4P 3OVSA 1HBUB 1ZM3A 4B3SJ 4B02A 3FBFA 3OXFA 4L6V3 1FD2A 1NAQA 1C1BB 1B64A 2BX6A 2CVEA 3ET6A 3N6LA 1JJ4A 4H54A 3HKWA 2VFTA 4K4YA 4ZOSA 3T5KA 2YWWA 1FNMA 3GIRA 1FKPA 1FNXH 5KFWA 1RLCL 4BDPA 3O5TB 2BJDA 2L9WA 4C97A 4ES3A 2GVDA 5G0RA 1BLUA 3K5LA 4OLPA 1HNZF 3T5JA 2GAHC 4ANCA 2D3ZA 3KG0A 4IOCQ 4JI0J 2M88A 3H4BA 4HYKA 1JLBA 3BKUA 2CAJA 1GTEA 3MPWA 5KFQA 2W9CA 1RQ0A 4IO1A 3MCMA 3W62A 1XN9A 1Q8KA 4UF4A 1P8GA 4BC7A 2HHVA 4KGKA 5CYQA 5GAHI 3D67A 1TMJA 3GJRB 1E6VB 1O8BA 2OSRA 2C2OB 4I6AA 1IWGA 1Q78A 2HIYA 5ETMA 5IT4A 2LLZA 4HH1A 1LW0B 1JNZB 1RSCA 5ETSA 3MMAA 3WQPA 2UU9F 4ICLB 2IJRA 1ULRA 4O3PA 2H5JB 3X3UA 4DPXA 2I5JA 4XPCA 2HHPA 1Q7LB 1ZM9A 2AZ3A 3PW7A 3KK2A 3KJVB 3TUIC 1H72C 4J9PA 3IBFB 3JQJA 5CCMA 3ZNJ1 3LA0A 3G6XA 4DU7A 3PCOB 4HTIA 2UV8A 3NNAA 4CH0S 1F6TA 4X4TA 3KNGA 9ATCB 8RUCA 4DV3F 4WZQA 1D8YA 1NK9A 3JTPA 1PILA 3PJXA 1VS3A 2DIUA 5E7OB 2UUTA 2HNDB 4FF3A 2HS3A 1HNWF 1OSDA 2KDOA 2EFOA 3H42A 5AJ3J 1QTMA 4ED7A 4X62J 1X4CA 2XC9A 2IYIA 4OJ3A 2QSWA 3WBZA 3TW0A 2VOOA 4QYZK 4HI2A 3LAMA 4ED4A 5IM0B 5IXUA 5L8RC 4C0BA 3K2YA 4KSEB 3R1HA 1YLXA 4DR2J 2KO1A 2DNQA 4URGA 4LUBA 5K8PA 2ZDPA 2YH1A 4HEA9 2G2OA 3W7BA 3BPSP 2ZDOA 3POTA 1UVNA 3THPA 2XMTA 1FO1A 2R7UA 3FK4A 3IR5B 1SBRA 3I55S 4WFYA 5KFAA 1FJ7A 3LAKA 5GMDA 1HWUA 2LEAA 3PKYA 1WEXA 3R5GA 3CCES 1QUVA 3OVBA 1VYAA 2ZC4A 5B7WA 1LK5A 4YR2A 1W26A 2L08A 2W2NP 1Q8LA 2HVIA 3BGLA 3OFHA 1JLCA 2JVOA 2XTJP 1N32F 1CJKB 2BW2A 4IKAA 4W90B 1XTZA 1P9QC 2CADA 1RAEB 1FRKA 1X4EA 5M2RA 1TKXA 1WC6A 4OX8A 4F04B 2FZKB 3EWGA 1MU2A 4NI2A 2RH3A 4MKYA 2YNIB 2N3LA 2VF3A 3RW6A 4DFJA 2PI5A 2GJFA 4G1IA 2YY3A 1F5CA 4U8YA 3GYNA 3G87A 2E29A 2X51A 3JTOA 1C4AA 1OWXA 5J2PA 1IR2A 4F7VA 4PCQA 2AJFE 3J7ZT 2V5HG 4WE1B 2V2KA 1EIYB 2Y1RI 3L9ZA 3QJJA 4N8NA 3ZZ0A 1RT6A 2DGUA 4IR1A 3K59A 3EM1A 1N5TA 1FXDA 1OPZA 4LF6J 2OTJS 1G7CB 3D1OA 2CWKA 2R7VA 2E44A 2F40A 1ZETA 3IS9B 4GO5X 4YHHF 3MXHP 3UD5A 3ZTRA 2WAQD 4DLGA 1RT2B 4C3LA 3WHIA 2ZZNA 2DT9A 2MKCA 3LP2B 5C5JA 2HWIA 4UOFA 3KLHA 4I69A 1VQYA 2JHEA 5GAEI 3SI8A 3P5TL 1NB2A 1X4AA 4AXIA 3DI6A 5CA5A 3E2EA 4LF1A 1HIYA 1WC5A 3MTJA 3EUNA 4ZPVR 1TU0B 3SEOA 1HHTP 4Y34A 1CQMA 4OI2A 3HSGA 1N0VC 1NO8A 3ENAA 2UUAF 3R6GB 2JFDA 4TN2A 1KHVA 2KHCA 1XMQJ 2D74B 1RT5B 1EX8A 1RT4A 1RHQB 4YB5A 3GG1A 5G0RB 4JV0A 4DPOA 4AQYJ 2FJBB 1F5AA 4J37A 4NA3A 4LF7J 4CO0A 2OSQA 2OEKA 2DH7A 4RZRA 5KFFA 1X0PA 3K5NA 2JRSA 1S1WB 2HRYA 2NYIA 2L41A 3HHLC 5E3AA 1R89A 1JKHA 1JLBB 2A2CA 3PACA 2Y8WA 4OI3A 3MM8B 2W9CB 2RT3A 1U1LA 2XMAA 4B3SF 4UUXA 1VFJA 2ASYA 2C42A 5B0EA 2ZJQQ 1DY3A 4LFAJ 3BH6B 1IQZA 2C2ZB 3MEDB 2VFUA 4PR6A 2RQMA 2CPHA 2ZD1A 4J90A 2N4CA 3M32A 3KYLA 4B9LA 1IR1A 4CTAA 5J2NB 3MZIA 3LP1A 1RHJB 1SL0A 2P9CA 1S6UA 1RT7A 2AJ1A 3OL9A 1S0NA 3C19A 1N4LA 3A12A 2G4BA 2ATCB 2FDNA 4YR3A 4DL0C 1HBNB 4JI0F 5DO2A 4ZP9A 3N5BA 4QWDA 2NREA 1I6JA 1RBLA 5D77A 1FE0A 1Y00A 3RBDA 4OJGA 4KR0B 1SJRA 4Y2IA 4ERDA 1VCTA 1D9DA 4Y3CA 1YK9A 1X5TA 3OJSA 3Q2TC 2ZKTA 2FJWA 4KE5A 2DEJA 5F8GA 1F1BB 1WF1A 3NEKA 2B4OA 3CJQA 1NKEA 4ZHRA 1PYSB 3PX6A 1SUQA 3O2IA 5J2QB 2JNJA 3I4PA 4MK9A 3MPVA 5EWGA 2A2DA 4KTQA 1VQ6S 1UMJA 3VAMA 1OY6A 2DHAA 4NLDA 2BDPA 5KFJA 4ZCKA 1JX4A 3AB4B 2ZKUA 3OD2A 2G2ZA 1DQ8A 4OZ5A 4OIXA 3CDWA 4RNNA 3POTB 1GMWD 5A8RB 1X4HA 5HVFA 1F2GA 2YNHB 2QL5B 2W4PA 2J7KA 2QFIA 3GR0A 1CS4A 5HATA 3I56S 1YBTA 1QTNB 4HACA 1FKAF 2FVCA 5AJ3F 4EZ9A 4PG6A 3T19A 4X62F 2BJ9A 2LQBA 2XS7A 4EO8A 1NKBA 1JLCB 3K8WA 2QJ3A 2WBRA 2DNGA 2OPPA 4CCHA 5I3UA 2FJEB 2ZITA 2CG4A 4K0KJ 3M8PA 4MH8A 4DR2F 2HGMA 5KG0A 2XMKA 2QZ8A 2YX4A 1FDBA 4KAIA 5D0GA 2G9OA 1LKZA 2OPQA 2JDJA 1OJ4A 1RB0A 4B9SA 4WU3A 3R5JB 1TAQA 5LMUJ 4I7FA 2COLA 1X4GA 4OYOA 4Y2AA 1U45A 4ILLA 3RR8A 1XEZA 1RYRA 3GILA 3MI7X 2CJKA 1HA1A 4P7VA 1PCAA 4DL6A 4M5MA 5J2PB 3OR2B 4JI4J 3I4HX 4KBIA 4DEZA 1D09B 3M05A 2LEBA 3FBCA 4U8VA 3DLKA 1JLQB 4WTYA 1HMVB 3ZFVA 5A0YA 3B78A 2V2QA 2CQHA 3P6YC 1NJIT 3G9CA 1FJGJ 2VBWA 2EC0A 2LFVA 2JC0A 2ZH2A 1SC6A 2KU7A 3JYTB 3IWNC 5CZVA 1G6BA 2Q3PA 3DOKA 1IWAA 2BJ1A 3ETOA 4WYWA 3H2UB 1DTTB 2PO4A 4NXMJ 1AT1B 4H4MA 4UZCA 4AUKA 3HI9A 3GMGA 4IO9Q 4DV0F 1VLYA 3MURP 5KG2A 2IVYA 2X1AA 4HTJA 1VDHA 5BR8J 1S1XA 3J7YU 1XR7A 1FDDA 3KJNB 2RKIB 1JJCB 3GFXA 4A8OA 3RRHA 2CNNB 1WUUA 3AA8A 4C8NA 3DI6B 1WEZA 1N8RT 4JYAJ 2BOAA 4MK7A 2HVHA 3EZ5A 4K4TA 1NHVA 3T9ZA 4ZS6A 3SMZA 5HMZA 4N8OA 4LR7A 2GVZB 4YOEA 1CVJA 3HZEA 4Q7AA 1VC6A 2VQFJ 2CXEA 1LQ9A 2W8KA 5J1EB 4P2MA 1P27B 2ERRA 4WKRA 4DR3J 3DOMA 3WC2A 3G6YA 3D0IE 1WHXA 4ECTA 4NMLA 3DU6A 3J7Z5 2B56A 5RUBA 1HNIB 1TL3B 5C25B 3VZHA 4USHA 4DX7A 4GC6A 4JI1J 2YNGB 3I5AA 3UDVA 2WW8A 1BC6A 3FZBA 2ZC3A 2K3KA 2MKHA 4USKA 1WDDA 2CPFA 3HSDA 1B99A 2BM0A 3WDOA 1SCJB 4C8KA 2QV6A 1NUEA 1UEUA 2CPDA 3L7UA 2B6AB 1BQNB 2HSEB 4ID5A 1U1OA 2KKHA 3GONA 1H38A 2PA8D 1DRZA 2HQ3A 3A13A 3IGNA 2RU3A 2HURA 1XMQF 2EPIA 5A8WA 3LP1B 3BBBA 1S1UA 3ETMA 2F8EX 1EAYC 1QAYA 4KGXB 3ADAC 1GNKA 3LGHA 4ZVRB 2BM1A 2F8HA 4LF7F 4KGVB 2E5HA 1RA7A 3A8KA 2GAGC 1YSJA 3CB4A 1RWMB 3LO3A 2Q66A 2MHEA 5F3ZA 4X4NA 1K0TA 4USUA 2JVRA 3VWSA 1UVIA 3TAMB 1KR4A 3P8BB 1IVZA 3WX8A 4LFAF 2C3YA 3W9JA 2XWYA 2MMYA 1BY9A 3IO1A 2HBQB 1K1SA 5SZTA 1WC0A 1VGYA 1TL7B 1PIEA 2PMWA 1UFKA 5KT6A 4ZP6A 2QL7B 2BJ7A 2MQLA 3W63A 4ECZA 1IM4A 3QGIA 2IHR1 1XIQA 2MQMA 3W5YA 3HHLA 2X7IA 3BGFA 2M3DA 3GG0A 5FD1A 4Q43A 4KY3A 2IDEA 1VQMS 1XC9A 2PMHA 4FS2A 1SB6A 5GVQA 5HK4A 3M30A 1LWXA 2WSFC 5HO4A 3PJ9A 2ROPA 1M1HA 4GKJJ 2BMBA 5LL6d 2F5GA 3BV8A 2HRTA 1JMTA 5H9FJ 2E5GA 5L9XA 4OX9J 4C11B 2IBKA 1CS4B 1HI1A 4WXWA 2DNYA 5F8HA 1IKYA 3QBCA 5DLFA 5KG3A 2FVQA 1JK9B 2BE9B 3MEKA 2IC3A 3FDSA 4OZ0A 4C8YA 2IYGA 4QIGA 4J91A 3X1LB 3JB9k 4HT5A 5H1SV 1FVQA 4A4JA 4EZ6A 1SKWA 2V50A 4RO0A 4MK8A 3SCKE 2Y1JA 4DSFA 3QSYB 4ED0A 1A0OB 5C42A 2IDLA 1LWEA 4LSNB 5KFVA 2A10A 3K57A 1GXUA 4FPIA 2NPIA 5LSOA 2HKEA 4IG3B 1Z2LA 3MPYA 4QW8A 3ZZOA 5KFUA 5KFLA 4Z37A 4I0WA 2AD9A 4OFZA 2OH2A 3CNQP 5GAGU 2RS8A 2XMUA 3ISNC 2IRXA 2VC0A 1H0HB 5D4NA 1TVRB 2CQIA 4J9VA 3MWBA 1HHSA 4WCEQ 1T0TV 1L5UA 4QQBA 4URQU 4PKDB 3GLJA 3PHTA 3FJ2A 2FY1A 4J5OA 1OY9A 4IYQA 4H4KC 1KQKA 1FRJA 1S1VB 3DOKB 5MLCV 1TP7A 4DQIA 2FD2A 2CJBA 4H4MB 5LMUF 3I9V9 2I1RA 2FPHX 4X4OA 3F73A 2WTFA 5D0RA 4PXEA 4ZPCA 4PWUA 1G3OA 2W7OA 3KHGA 3CCMS 2KJVA 2D3O1 2MEWA 4AD6A 2ZE2B 3NWGA 3VR1A 5IZHA 1FKOA 4DV1J 2XGQA 1WOPA 1U8SA 4F0HA 2QE5A 3ZZZA 4O4RA 5DG9A 4WK3A 2F3JA 2AYBA 5FDLB 3C15A 1FJGF 1SKUB 3E51A 3PIOQ 2MY8A 4MFBB 2CWXA 2NXCA 5HSPA 3F44A 5HJXA 3HZGA 2E9ZA 4DZ6A 4DSJA 2V69A 2UXCJ 3HX9A 4XDDA 5B0DA 3UD3P 3NGKA 3KHHA 4LQ3A 3DLHA 1S9EB 3MFIA 4ZMMA 4IFVB 3DOMB 1AXQA 3MR7A 4RW8A 3WX4A 5BR8F 2Q6BA 1RTHB 1RWXB 2K1RA 2ZHBA 2WOMA 3NS7B 4OYMA 2ILZA 4IQMA 3M8QA 1KHWA 2H65B 4LIRA 3KNAA 5L9NA 2V4JA 2KXHA 3C2PA 3IXQA 4JYAF 2AP6A 4F4WA 3K5MA 1FERA 1NZ8A 3DRSB 3V6HA 4FP9A 4C8MA 2BABA 2EFVA 4YQWA 1RT3A 3W8PA 2VQFF 1I51B 2RJZA 4ID5B 3GZ7A 3DGPA 3KLVA 1Y10A 3TJ9A 1H2TZ 3MM9A 1MSWD 1RAGB 1S1UB 1NJWA 4K4SA 3GFZA 4DR3F 3I96A 3HHKA 4IG0B 4FF2A 1DAXA 5A8KA 2JOQA 4CP5A 1Y3JA 1BMQB 4QOTA 2EKNA 4Q45A 1U0HA 1N36J 2HVZA 4JI1F 5BXIA 2DKOB 1IKXA 2EEYA 2RHSB 1I5OB 5ETVA 4R0EA 3V4IA 4E2FB 3PYFA 4PXBA 2HS0A 2XY5A 3DKDA 3P45B 1U25A 2FY8A 4H4OB 4C7QA 1VQ8S 1RTJB 1DLOB 3GPAA 3SXLA 3SIPB 3W8GA 3TQ1A 1PJ5A 4I1TA 1C0UB 1NDCA 2OP5A 4JI8F 1R27B 4JV2A 2BRLA 2WVEA 2NUUG 1L3KA 2J8AA 1YJRA 4B9VA 1JB0C 1RWKB 4CDIA 3CJKA 4B9UA 5E33A 1T3NA 3US5A 3W9IA 3NCRA 3ITHA 3BSNA 1BXNA 1SQEA 1CJTA 3TRGA 2FHJA 4A8QA 2ATLA 5K8MA 2XWXA 2Z58B 3AD7C 3D9BA 1JLAA 5B0CA 2EI5A 1T9WA 4MAKA 3FCVA 4ILMA 4KC5A 1LWFB 3OT9A 2KFZA 1T02A 2WVBA 3TOQA 3LGMA 4JI6F 3NL0A 4ZP7A 7FDRA 2CIMA 1EHWA 2RIJA 4WYLA 3OUYA 5KG4A 5LSRA 5DDOC 3BGOP 4MKVA 1RHMB 1S9GA 2U1AA 4DQSA 2KJWA 4DCJB 5AXMA 1Y3KA 4OYBA 1VI7A 3PX0A 1NM2A 2CQPA 4J9LA 2APOA 3VVTA 3D6MB 3KUEA 4OX9F 3CC7S 2BJ8A 1I1GA 2B9WA 4LSZB 3OV7A 2JLGA 1RWWB 2JEFA 2I9SA 4A48A 2W9AA 2M2BA 4WWSA 1K73T 3RB3A 1P6TA 2OPRB 4LR9A 2BBEA 1NZAA 4TLRA 4J9QA 4EI2A 4PG8A 1NH7A 4C0OC 3DLLQ 2J0QD 2A1BA 3M2VA 4XK8C 3Q8QB 4NYPA 1JLGB 1SC3B 2CPYA 2X3DA 3RJMB 4DFKA 2DIVA 3FRZA 3NG8A 2HQIA 5KFOA 1DFDA 2KFYA 4HI1A 1OYDA 3NXZA 3I0RB 3H4DA 1H73A 3SV4A 3QFWA 1X5PA 4CO5A 3MR5A 1S76D 3N4WA 2Z2ZA 1TAUA 3ENWA 4USIA 4JI3F 4EO6A 4ECRA 1VQSA 4TY8A 5IQ6A 3D1HA 5KG1A 5F8NA 2R2RA 3GE9A 4YB1P 1A7GE 3DXBA 4V19J 1T9TA 2QT7A 1MROA 4ZLPA 5H9EK 1AFJA 4J9RA 3AD9C 4I4BA 4F67A 1VBYA 1F9EB 2BZ2A 2QX0A 1PO6A 3QRQA 3PM9A 1FT8A 2Z2LA 3W2VB 3IM9A 3H59A 2P6SA 3B8HA 5EGYA 3VHQA 4F25A 1XNRJ 3I0SB 3H90A 1HFEL 4WFXA 1J5EF 1S1TA 5CH7B 3C3LA 3DRYA 4ZIWA 2DITA 4FN5A 1UJ5A 1RJJA 4ZVEA 3FEXB 2GHVC 2R9LA 1URNA 1SVDA 3EZUA 3DNCA 4DV1F 2H4WB 2PMZD 4DDFA 4K5SA 1KWMA 4S0MA 3CIMA 4JV5J 3SSQA 4ZN1A 2N7CA 3F41A 2GMHA 1DZ5A 1K44A 1T03A 1M1KT 8ATCB 2NXNA 4H4KA 2NQPA 4M1KA 3P4UB 2YWGA 3C14B 2HZVA 3CULA 2YKQA 2DGXA 3CTRA 4ZKAA 4J9OA 4DX6A 1S97A 3T6JA 1XMOF 1KTQA 2UXCF 2C2NA 2AYGA 2VZ9A 1SJ3P 1U4BA 3W64A 1S12A 1VRTB 3HHLD 2PT0A 4USWA 1FWPA 2EXUA 2EC2A 4NCBA 2IM1A 1Z1ZA 1S6PB 4PUOB 2VDHA 3NOGA 4F3QA 3EGVA 2M70A 2J9CA 4UOHA 2DTJA 1U0HB 4DPWA 1OQ3A 4FYDA 4K5RA 1UJ4A 3H0PA 2RF2A 2ZOGA 5IC4B 4CLLA 5F8IA 4ZJQA 1NEEA 2YKOA 3R5BA 3AD8C 2OIHA 4NRUA 1UPMB 2H3EB 1EJ7L 2GIQA 3OSNA 3OFGA 1REVB 4TY9A 3GTYX 2CJAA 3PW5A 3L7PA 4ES1A 4DZDA 3OXLA 4DLEA 5J1PA 4DV2J 4LRCA 1TZ0A 4TU9A 1RKIA 3OHAA 3MEGA 1YKWA 5J2MA 2PSZA 4IFYB 3OLBA 1M5HA 1W2IA 1OPIA 2W4DA 3D1QA 4QWCA 1N36F 4RUHA 2OMLA 4N56A 3V5RA 2OPSB 2IY5B 1KP6A 3R5AA 5HQLA 1HBMA 1AA1B 4DR4J 4O3QA 1CJUB 2IBOA 1UWBB 1AYEA 1SH3A 2JL9A 1APSA 5DQGA 3WIVA 2FHMA 2PEHA 4P72A 4PXDA 4F02A 1Y5NB 2KT3A 2BJEA 4ZLJA 4N47A 2MKKA 4FNHA 1UETA 2DBBA 3VAHA 2JSXA 4K4XA 1HWKA 3JSBA 1ZA2B 3MEEA 1WKKA 3TWZA 4TYBA 3TJ8A 5L1KA 1NDKA 1IR0A 2WONA 1NSQA 3HKZD 1VMBA 2W25A 5HQ8A 3QATA 1HBOA 4OZ2A 2VG7A 2RVJA 3AH6A 1N33F 1PJ6A 4RWXA 1Q86T 3LP0B 4ED2A 3RUBL 1UFWA 1YDLA 3ONQA 4M5JA 4RW4A 3I5CA 2FYXA 4X4VA 5K14A 4EYHB 3DLBA 4MJKA 5DDQC 1HW8A 1NPKA 1B7YB 2V68A 4M5KA 2PE8A 4OHZA 1FD8A 4R25A 2P6TA 2FLOA 1P1TA 2ZBQA 3M2UA 1HQUB 4PPZA 1ZTWA 3TI0A 3VGTA 2A6OA 1NJXA 4WFZA 1M5OC 4TU8A 1KLMB 3KFWX 4K59A 2RAQA 2YNFA 3OTDA 1RWUA 2XHCA 4NLXA 1HYSB 3B4DA 2KHDA 1NSPA 2PIIA 2GC8A 4WZMA 1U1NA 4TVAB 3T5LA 4QWBA 4HT7A 3HD2A 1BUXA 1QE1A 5KFDA 1VIOA 1VHFA 1JJ2R 1SKRA 4BBYA 3DRRA 5CZXA 3A3NB 2LEPA 4CYUA 2UUCJ 1LXJA 2DNOA 2VASA 4PWWA 5D4PA 3W5XA 1G1XA 4PWDA 2CPZA 3H5XA 1R8PA 1LK7A 1NSKL 1IKWB 3DOLB 1F9FA 1VQ9S 2CZ4A 2AGPA 4A8KA 3H20A 3RB0A 5KFTA 4Q0BA 3AQOA 3IR7B 4DV7J 3NGUA 3QZ7A 4PYAA 4Y6IA 3ZXWA 2M8HA 1T03B 5HMXA 2FVPA 1JNRB 1KS2A 5GADI 1N52B 3DM2A 5I42A 1XNRF 2MHNA 2CJ9A 2HLTA 1KQFB 4M5DB 2KRRA 2FC9A 1UAWA 2B7BB 1VQPS 3JTNA 1MWYA 5KFIA 4N7TA 2FJAB 1VC0A 3KLIB 1CC8A 2VB6A 2EWHA 2W9BA 1HL6A 4WKYA 2Y8YA 1VLOA 3LPEA 4HL9A 2UVUA 5EUHA 4WF9Q 2FJXA 5EWFA 5ETPA 2IFXA 5AXKA 3HSZA 4OYZA 4JV5F 4J9KA 2FHJD 3NNHA 3R7NB 2VG6A 3M9OB 2DXDA 4CI0B 2O66A 3EDQB 2Q1LA 1S0OA 3KHRA 2FVSA 3BO4A 2GIFA 2XG8A 3AB2B 4DMZA 4X64J 1IUJA 5T7LA 4I2QA 4F8RA 3CC4S 4DR1J 5KFXA 2JLFA 3ZZRA 2BQUA 2BKOA 1MWQA 2JH3A 2I2YA 1U8WA 3MECB 1AB8A 2IM2A 3S1TA 3U1MA 1ZAWA 3GYXB 5LOQA 2JFKA 3K58A 3IP0A 1RHRB 1RK8A 2C2EA 3K89A 2FJDB 1D9AA 2XULA 5J2MB 2MGZA 4AL7A 1BE4A 4QYZJ 2FZCB 4FZVA 4F3OA 3VAIA 3C6TB 2BUNA 3ILJA 3VCDA 2UUBJ 4RU9A 4DSKA 2XQCA 1QUPA 4UOGA 3Q8RB 4JBCA 1BHNA 3SDEA 2Y3YA 2DGOA 1FRLA 4QYRA 3DLEB 2C3UA 1HR0J 1R31A 4EMDA 5DM7Q 2GNKA 1R7IA 2DGVA 2YKNA 2NXEA 1Q79A 4NOHA 1TL1A 2VKZG 1KQGB 2VUGA 2C2MB 5DRKA 2UP1A 1YJ9S 3QLHB 3DU5A 2CJQA 4Y2MA 5IWAF 1VRQC 3W9HA 1OO0B 4XO0A 4DV2F 1FTRA 5L39A 4WIIA 1DHMA 5C24A 1QLNA 2BXJA 1WEYA 3LH2S 4USJC 4ZVGA 1FXLA 4TKTA 1Q95G 3MOJB 1T95A 1FFSB 4AYBD 3DCAA 2QL9B 3EMTA 4DR4F 1KTVA 1RTZA 3GSIA 4AL5A 1H7WA 1XERA 1RBAA 1YZ6A 1RYSA 1WSVA 3L7OA 2JC1A 3QZ8A 2ZM6J 2EFPA 3UN2A 3I32A 2YXLA 1LWCB 4Y28C 2WSCC 1YBAA 3CJ2A 5F0WA 3U02A 1JJHA 2W01A 4UTGA 2BEFA 3R9LA 1TL5A 2AX0A 5DJBA 4B3OB 1KOHA 3PHEA 2H5EA 3CW2C 3DHXA 3Q22A 5K14B 2MKYA 4QBUA 1AUDA 2VKRA 1D0EA 3UNGC 2G0IA 1DQ9A 5KT2A 1WI8A 4GRSA 3DRPB 4CIOA 1S6QB 4I2PB 1JXEA 5AXLA 4LMZA 1WKJA 1HI8A 2KYZA 2RD5C 4Q44A 4DL3A 1CULA 1Q8IA 1FFWB 4YFUA 1U1RA 4GVLA 4LVNP 1RAJA 3VGUA 2ROEA 1IKVB 2FC8A 5HBMA 4Q8EA 2JEGA 2KM8C 1XNQJ 2WZ1A 2VPZB 5FJ4A 5BJRA 3M8RA 4RNHA 3D5MA 3RRKA 5HQMA 3HM9A 3RRGA 4M5GA 5JMNA 4R5PA 4NEZA 2F8MA 3UDCA 3MMBA 2GMLA 2MQNA 4ENOA 3PKMA 4ATNA 3KG1A 3HVTB 1JLEB 2OLWA 2PDAA 1CJVB 1I94F 3Q86A 2CQ0A 2CNKB 3DRRB 1O6XA 3EE3A 2XEXA 2LU2A 5KFZA 1N5YA 2NSCA 4J9SA 1D8ZA 4F4ZA 2HMIA 1RXOB 3VVUA 2Y0SD 3SZ2A 3W1YC 1SV5A 4MTPA 4ZPTR 1HQ2A 3I87A 3ZC4A 2FHKA 2Y1LB 1ZYQA 3NWRA 2VV5A 2AQ4A 2DHSA 3CD5A 4UQGA 2VA2A 5D8HB 2VJVA 8AT1B 1U6FA 1QDUB 3UFCX 2IRUA 3MD3A 5A6PA 3V81A 2G1DA 2C3OA 1HPZB 3HHNB 2Y9HA 2MLZA 4DG1A 3AJ2A 4WP9A 3OL8A 4DOZA 2MQQA 5DZ6A 3FCWA 3UN3A 2HNZA 5F9NA 3QT8A 2KT5A 2CQGA 4EEYA 2D69A 4NASA 2UUCF 2Z56B 3FC9A 2HYIB 5M2UA 1T94A 1UL3A 3TZXA 4GKKJ 3P5BP 2XNRA 3K8VA 2RILA 4RNOA 2HPUA 5F3TA 1KDNA 1U0SA 2G1HA 3KOAA 4KGMA 4DV6J 3LUYA 3CJ8A 5KT7A 4MKBA 4CM2A 3Q0AA 1WD6A 4LFCJ 4DWIA 1Q16B 3TX8A 5CD4A 2R8HA 4DV7F 2CPJA 4Z7CA 2QA4G 1IBCB 4QIWD 3HP6A 2QO3A 3SQGA 3QWUA 1TL4A 1S49A 2V4QA 4MT1A 3GV7B 1WHWA 5HP1A 1YITS 5KT5A 1EETA 1FX4A 3G86A 3HJVA 4WXOA 2XI3A 4J9UE 1HWLA 5L1IA 4BS2A 3BREA 3H2VE 3EYZA 5JJBA 3FFIA 5KG6A 2W4CA 4PZVA 3TP2A 2CZ9A 3W61A 1Q7YT 3O8WA 3GV8B 1PAUB 1J5OB 1JLFB 1FFGB 5HJYA 5AE2A 1S4FA 2VFVA 2H5IB 2M52A 4K8RA 5EX3A 2RDJA 1H98A 4LSLA 2DHGA 4DU8A 3CJ3A 3FMWA 2LECA 4KKOB 2VOPA 4BWJA 4PQUA 4WIQA 3OTOJ 3HF5A 3PYDA 1SKSA 4K50A 2OHDA 3MR3A 5HROB 3U7JA 2PEBA 1B4SA 4GVBB 3KG4A 3S7RA 4M95A 4NLSA 1U48A 4NCGB 4X64F 3ISZA 3ILIA 2VFSA 5JUMA 4G65A 2QG9B 4DR1F 1UVMA 2HFOA 3G2XA 2YH0A 1IQTA 1TKDA 4DR6J 1YJTA 4LFBJ 4G6VB 2NYHA 4O3OA 3VF0B 3C46A 1XR5A 3TNVA 1HWJA 4NLTA 4DCPB 3RBXA 3GR1A 2ILYA 3NNCA 2WB4A 5KFEA 5KFRA 2ABYA 1GEHA 2CG8A 1RTIB 2D41A 2QA4S 2UUBF 3KK3A 2W8LA 2BJ3A 3HFKA 4ZJLA 4FF4A 3CWJA 1UPPA 3PRDA 3DHWC 3BQ2A 1NJYA 4ZVFA 5F8LA 3PRVA 1EARA 1M90T 1HR0F 4RNFA 3BBFA 2WVCA 4EFAC 2B8PA 3D2WA 2AWZA 5KFSA 1NK4A 3PTWA 3A8EA 1X5SA 3UCZP 3QIDA 4OV6A 2VG5B 4P2XA 1SQGA 2G0CA 3BGRA 1IJEB 4YMEA 1EKRA 1XMBA 1RADB 2VIHA 4F26A 1NHKL 5D3GA 3IM8A 5T14A 4C9DA 5CQGA 3LANA 1S10A 2CQ1A 5U47A 2W1BA 4YY3J 3BQ0A 2CDRB 1R0AB 1J27A 5A76A 2LA4A 3I9ZA 3I82A 4AXJA 1FJEB 5K9FA 1C2PA 4CO1A 4OMFG 5HBMB 1WTBA 3T1HJ 4K4ZA 5KFGA 5HVGA 2HLUA 2ZM6F 4ECXA 3TEGA 1L3VA 1GFWB 1IBLJ 4A8FA 2BVZA 2F9DA 1WWHA 1WSRA 2DNLA 2QFJA 2DNRA 1N48A 1G4CA 1GAOA 1RU1A 1SI9A 3IG1B 5I4MA 3ENVA 4I6WA 3DFEA 3MPDA 2IAJB 4B9MA 2XSFA 3GJQB 3G6ES 4OHXA 1C0TA 1MN7A 2BANB 3W60A 4O44B 1U2FA 4LF4J 3R2DJ 2AGOA 3QIPA 1ZH5A 2A18A 3WZ0A 1QD1A 5CAAA 4FBTA 4P9SA 5M2PA 2AJ2A 1JIHA 1TUVA 3PJWA 1HARA 4QR0A 3M8YA 3C16B 4DQRA 3H5SA 3V81B 1S5ZA 3R7BB 2QTWA 5DS7A 1Q0NA 4NLYA 2HBYB 5CYMB 3MCOA 1K8AT 3OL6A 3EVMA 2HNYB 2E9TA 3LTOA 3UVJB 3MUTP 4FDFA 2CQBA 2P5VA 3MAAA 4DPYA 3M8SA 2F4VJ 3HCXA 2NPFA 1R3NA 4KHPJ 1S6OA 3PX4A 2DNZA 5KFBA 2E5JA 1KBRA 2LU1A 1NHUA 5JVGQ 2R42A 4ILRA 2FZGB 2M8DB 2K3IA 9RUBA 2LQ8A 1LW2B 3CF5Q 1FEHA 3R3TA 3MOZA 1YRXA 1BQMB 3L95X 1E6YA 3OR1A 2MJNA 1WG5A 4OX7A 2VBXA 1FHTA 2KTQA 4NZ7A 4B9NA 2YPYA 4C3KA 4KH0B 1F3FA 4CWBA 2BE2A 1NPPA 1C4CA 2DEIA 1VRUB 4P74A 3TQEA 4NWBA 3N0VA 3G8SA 1RZMA 1TFYA 2MZTA 1Z4UA 2PFDA 3BEGB 2FHOB 4CH1A 4B17A 1ZPVA 3M1VB 3D0HE 1FK9A 3T1YJ 2XNQA 3N9UC 3AODA 1RP5A 3UI3A 5ETKA 1WG1A 3CMQA 1SH0A 2KG1A 4X4QA 1QVGR 2HRUA 3HVWA 1P9YA 4DV6F 3T3FA 4A47A 2W24A 1ZPWX 4RBTA 3CCTA 4LBIA 3CCSS 3TVZA 4PABA 1SJ1A 5LSLA 2DCUB 3NP5A 4LSLB 2N3OA 4JI7J 2RUSA 3D6HB 4ZK7M 2L48A 1ZA1B 3MTKA 2N4DA 3ET6B 4IH7A 3AY0A 4XIUA 2Q43A 2XB2D 1SL2A 1NMEB 2B5JA 2CDQA 1VBZA 4DFPA 2E1CA 1FKPB 2Z30B 5F41A 2CPEA 2F7VA 2XM3A 1KVJA 1NB7A 2GVDB 3PO5A 2FVRA 4OZJA 2RQ4A 4XAKA 2ZH3A 4IH5A 4FKXA 4G1QA 3NBPA 1HI0P 2P8IA 5DGAA 1UWAA 1U1MA 2MQ8A 1N5VA 1ROFA 1T9UA 4U9RA 3A4TA 1DTQA 2E7WA 1N5SA 5E5NA 3OXGA 1YG0A 5THWA 2ACMA 2AX1A 1OMSA 3GSDA 1RE1B 2K7KA 4U6PA 2DNKA 4URSA 5CYQB 2IRYA 2E5LJ 3MM7A 2K06A 3A8JA 4NL5A 1UKUA 4J9MA 1RCOB 3O6QA 5DG7A 1UW9A 1TKZA 2V9WA 3MMAB 2HZAA 4OX6A 4XDCA 2BOPA 3GP9A 2I5JB 2E66A 1U7LA 2MPUA 1YX2A 2LXIA 1KFSA 4DR6F 3Q24A 3TYTA 4LFBF 3IR6B 1YRTA 4ECQA 4OQJA 3KK2B 5HLFA 3QQCD 2H4YB 3JSRA 3NCQA 3BGRB 4YB6A 4UZBA 1MWZA 3NS5A 4I68A 1OIAA 3TAPA 1R0CB 5D3GB 4PYDA 5DM6Q 3ZO7A 2ZH6A 2KVIA 1W2BR 2V34A 3D4JA 4ELUA 3K17A 3IRXA 2LQ9A 5JXSA 1X4BA 2D3OR 3PY8A 4NEYA 2VQEJ 2LA6A 4LRAA 3MF5A 4KQZA 4R0JA 3TO8A 3BH7B 3HFZB 2L9NA 4DR7J 2ZUGA 4X2BA 2XY7A 1NLKL 4HDHA 2EG2A 2KI2A 1VC5A 1NBEB 3BR9A 4NLRA 1T3OA 4O4GA 2RDIA 2IVFB 3Q2SC 1NPRA 2AJ0A 2OMOA 3DGVA 3GJSB 4DR5J 1Y7PA 4UOCA 4RPFA 5MAOA 4NA1A 2CA9A 1JXLA 5GADU 4A8YA 2V9KA 3QPIA 3PEJA 5EWEA 3IAS9 2ADCA 3GIIA 1C0TB 1RWOB 1S99A 2IIHA 1FJCA 1QAJA 1OYEA 3H5YA 4ELVA 4NZ6A 3CCRS 1C1BA 1F60B 1PJ7A 1RWPB 5IFMA 1NU4A 2ZEJA 3T1HF 4J9NA 1FE4A 2YVSA 1KSPA 3PNIA 4NX9A 1ZZFA 1S0VA 1Q4RA 2UU9J 3G8QA 4CLSA 2P9EA 2BACA 3NS6A 4YS2A 1VQLS 2CQ3A 3B82A 3BSAA 3GFYA 1WACA 1TKXB 5EHHA 3UW1A 3J7YI 3W5ZA 4X65J 3SBMA 4M5HA 2GQCA 2C3PA 2QN6B 4NLGA 2VA3A 3VZIA 4CLPA 1V5VA 1MU2B 4QIVA 4NI2B 4CLFA 1AROP 5B0AA 2DO0A 3R8YA 2E1AA 1VHIA 2KH9A 3CE8A 2CRLA 2OTLS 1N6QA 3R1LA 3ULHA 4LF4F 2AV5A 2FLLA 1E6VA 4CM0A 1Q81T 1E6YB 1LW0A 1HNWJ 3R5CA 3M7VA 4HR2A 4EU0A 3LF0A 1FWKA 4FXDA 1B0VA 4ICLA 3OFFA 3NMAA 3OW2R 4HKQA 1GMVA 4LR8A 1RT6B 2GX8A 3NRBA 1VQOS 4YUDA 3KJVA 4KPYA 3QT6A 2GGPA 2F4VF 4XPEA 2BE7D 2RUGA 3V6DA 4KHPF 3KMQA 3CJ0A 1PC5A 3HDSA 4C0HA 3MM6A 2D7SA 4USVA 1TK8A 3OTEA 2NXUA 5IS2A 1ZAXA 2VBYA 3KLHB 1X9SA 1P1LA 3RAXA 1IBMJ 2MXYA 2AZ1A 3PYGA 2HIQA 3PG9A 3BJYA 2KXFA 3TA0A 2B43A 1ZM2A 1XBWA 3UE2A 2DB1A 4MMOA 1X9WA 2XI2A 3D7SB 1GQEA 2M0GB 3TA2A 4F4XA 5IM0A 4LF6F 1S59A 1GT8A 1DURA 2B51A 1BD6A 4ZVUB 1RT4B 4DL2A 1RHUB 3B6BA 4ZVQB 3T1YF 3QMQA 2XLIA 1UA0A 4OHWA 4G1QB 5D6GA 3AOCA 1FNOA 2AEJA 3J7A1 2EFQA 4OHYA 1JWWA 1N88A 2RRNA 3R2CJ 5HN0A 1FX2A 1JKHB 3HHEA 1MW7A 4L73A 5K20B 2YX7A 4FYWB 2OFGX 4P71A 2DR7A 4JV1A 5AE1A 4JI7F 1QY7A 2PI4A 3BSOA 1VJWA 2HS4A 2RS2A 2JX2A 1CJKA 4ZPBA 4M5NA 3VTIA 1KN6A 3QGHA 1YQHA 2ZD1B 3DYAA 2EK6A 1WNEA 2GS8A 4ED6A 3M32B 2BW7A 4QWAA 1ZAVA 4CTAB 4RW6A 4HHHA 2V67A 5LM7E 1RT7B 1V5IB 4F3MA 1R6YA 1ZOTA 2YNIA 4B3TJ 4AQYF 3N5FA 3LW5C 6AT1B 3SCJE 3PXGa 1EZZB 1Q53A 5L1JA 4KIAA 2VFRA 3GYGA 1NDPA 1PC4A 2CVIA 3HT0A 4LIWA 4X4RA 1V9OA 4F0MA 4EBCA 4MKAA 4IRKA 1H2VZ 3LGNA 2WK4A 2GA7A 2A6MA 1NNDA 3WIUA 3U27A 3PFEA 3NAIA 4LF8J 4ZHRB 1SUQB 1OS5A 2J8SA 2UUAJ 2AW0A 4DUYJ 3RBEA 3VQSA 3CCVS 1PYTA 2DK2A 4P7TA 2MLYA 3IS9A 4KGZB 2KL8A 4BWMA 1SH2A 2J9DA 1WTFA 5H9EJ 3IBCB 3FSIA 3ILLA 2I8EA 3F0NA 3LP2A 4BLGA 3UN5A 5KFCA
chains in the Genus database with same CATH topology
2MEWA 4JV5J 4LF4J 4B3TJ 3R2DJ 1HNWJ 5LMUJ 3JAMU 1N33J 4KY3A 4DR6J 4DV7J 4X64J 4LFBJ 1J5EJ 2UXBJ 4DR1J 1I94J 4DV1J 4JYAJ 3IMQJ 2KVQE 4YY3J 3J80U 4V1Ak 4JI6J 4DV0J 4DV2J 2HHHJ 4LF5J 4JI4J 2MQ8A 1XNQJ 4GKJJ 1XMQJ 4DV4J 4KYZA 2VQFJ 4NEYA 2VQEJ 2UU9J 4X66J 4RJVA 3T1HJ 4AQYJ 3R2CJ 5IWAJ 4DUZJ 3T1YJ 4JI8J 5FLXU 4OX9J 1FJGJ 4LF6J 4DR3J 4NEZA 4JI0J 1IBKJ 4DV5J 1IBLJ 4LF7J 2F4VJ 5IT9U 4GKKJ 4X65J 2UXCJ 2E5LJ 2UUBJ 1HNZJ 4JI3J 4LF8J 4DR4J 4KHPJ 4JI2J 4DR7J 1N36J 1XNRJ 4DV3J 3J7AN 3J81U 4B3MJ 2ZM6J 2UUAJ 5A2QU 4DUYJ 2UUCJ 4B3RJ 5AJ3J 1N32J 3D3CJ 4PWWA 1HNXJ 4X62J 1IBMJ 4NXMJ 3OTOJ 1N34J 1HR0J 4JI7J 4DV6J 1XMOJ 4K0KJ 2KL8A 4JI1J 2MTLA 4YHHJ 4NXNJ 4LFCJ 4HHUA 5BR8J 5LMNJ 4LFAJ 4DR5J 3W1YC 2UXDJ 4JI5J 4DR2J 4B3SJ 4LF9J 5LM7E 3D3BJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MEW A;  4JV5 J;  4LF4 J;  4B3T J;  3R2D J;  1HNW J;  5LMU J;  3JAM U;  1N33 J;  4KY3 A;  4DR6 J;  4DV7 J;  4X64 J;  4LFB J;  1J5E J;  2UXB J;  4DR1 J;  1I94 J;  4DV1 J;  4JYA J;  3IMQ J;  2KVQ E;  4YY3 J;  3J80 U;  4V1A k;  4JI6 J;  4DV0 J;  4DV2 J;  2HHH J;  4LF5 J;  4JI4 J;  2MQ8 A;  1XNQ J;  4GKJ J;  1XMQ J;  4DV4 J;  4KYZ A;  2VQF J;  4NEY A;  2VQE J;  2UU9 J;  4X66 J;  4RJV A;  3T1H J;  4AQY J;  3R2C J;  5IWA J;  4DUZ J;  3T1Y J;  4JI8 J;  5FLX U;  4OX9 J;  1FJG J;  4LF6 J;  4DR3 J;  4NEZ A;  4JI0 J;  1IBK J;  4DV5 J;  1IBL J;  4LF7 J;  2F4V J;  5IT9 U;  4GKK J;  4X65 J;  2UXC J;  2E5L J;  2UUB J;  1HNZ J;  4JI3 J;  4LF8 J;  4DR4 J;  4KHP J;  4JI2 J;  4DR7 J;  1N36 J;  1XNR J;  4DV3 J;  3J7A N;  3J81 U;  4B3M J;  2ZM6 J;  2UUA J;  5A2Q U;  4DUY J;  2UUC J;  4B3R J;  5AJ3 J;  1N32 J;  3D3C J;  4PWW A;  1HNX J;  4X62 J;  1IBM J;  4NXM J;  3OTO J;  1N34 J;  1HR0 J;  4JI7 J;  4DV6 J;  1XMO J;  4K0K J;  2KL8 A;  4JI1 J;  2MTL A;  4YHH J;  4NXN J;  4LFC J;  4HHU A;  5BR8 J;  5LMN J;  4LFA J;  4DR5 J;  3W1Y C;  2UXD J;  4JI5 J;  4DR2 J;  4B3S J;  4LF9 J;  5LM7 E;  3D3B J; 
#chains in the Genus database with same CATH topology
 2AEF A;  4Q8F A;  4OL8 A;  3JSM A;  2R8J A;  5GAG I;  2RHQ B;  1U6B A;  1EQM A;  3UQS A;  2IJF A;  2VQE F;  2GQQ A;  2R7T A;  1R8A A;  2BKP A;  2O67 A;  4HAC B;  3CT9 A;  4OYI A;  1R8C A;  4ZVP B;  2ZVI A;  2HFU A;  4ER8 A;  4DR7 F;  4ZPW R;  2PC6 A;  3JQK A;  2EVZ A;  3HMJ G;  4QJV A;  4NLQ A;  4U96 A;  4A8X A;  1RT5 A;  3PYE A;  3KK1 A;  2OPP B;  4KJI A;  5I3U B;  1RA6 A;  3M8P B;  3DLJ A;  5KG7 A;  3PR5 B;  1KKH A;  4DR5 F;  1RI7 A;  3SCL E;  3AOA A;  2D3U A;  1S1W A;  2OPQ B;  3RTV A;  3THV A;  3CJT A;  3ELH A;  2GO9 A;  4IOA Q;  3MM8 A;  4I7F B;  3S6E A;  1N6Q B;  3FMB A;  2DR8 A;  4LF9 J;  4AT1 B;  3VAK A;  3PV8 A;  3HJF A;  3MED A;  4G3I A;  4F2S A;  3FGV A;  3OL7 A;  3KLG A;  3WC0 A;  3MCN A;  2HVD A;  2R7S A;  2GV1 A;  2GMJ A;  4YR0 A;  3QJP A;  3BN7 A;  5J2N A;  2C3M A;  5E3C A;  3DLK B;  4P73 A;  4Y0F A;  2H9Z A;  5ETL A;  1TTH B;  5A0Y B;  1B0P A;  3M9N B;  3KDN A;  4FPR A;  2MSS A;  1BGX T;  4K0K F;  3CUN A;  1WHV A;  4X65 F;  1RIS A;  3N6N A;  3LPY A;  4B08 A;  4C2M A;  5LT5 A;  2GGP B;  1RUS A;  2ASD A;  1HBN A;  3V6D B;  2I0X A;  1AZS A;  1RTD A;  4CZC A;  2QEX S;  1MLA A;  1F2H A;  3MM6 B;  4B3M J;  1HNV A;  1S1X B;  3TZW A;  4RBV A;  1N34 J;  4JUZ A;  4ZIT A;  2V8P A;  3IBW A;  1QVF R;  3MMC A;  4M8L A;  4N76 A;  3EDR B;  4JI4 F;  1URR A;  3H98 A;  1QAX A;  5J2Q A;  3VGS A;  3TX0 A;  4JI5 J;  4QIF A;  1XWL A;  5IV4 A;  2OEM A;  1RWV B;  2CPX A;  1FRM A;  4AFF A;  4CLT A;  2WW4 A;  2LVW A;  5DQI A;  1Y11 A;  5GAH U;  2W2P P;  3BKT A;  2J9E A;  1R8H A;  3AXM A;  3UWT A;  2AJQ A;  2F65 A;  2LMI A;  4A8W A;  4IRC A;  4NXM F;  3FKB A;  2XGP A;  2YWF A;  4OJH A;  3C8Y A;  5A8R A;  5B09 A;  1U24 A;  2IM3 A;  2YNH A;  2DR9 A;  2J6S A;  1IBM F;  3RZA A;  1WJ9 A;  1T05 A;  2K2P A;  3J7A N;  3CJ4 A;  3QNW B;  4PAA A;  1YBU A;  2V2Z A;  2RML A;  1XK8 A;  3N01 A;  4DSE A;  4QZV B;  3RW7 A;  2HHQ A;  1U47 A;  3DYA B;  2K7J A;  5EX0 A;  1U49 A;  2LQJ A;  3R5D A;  5A8W B;  5GMK a;  3JAM U;  4RW6 B;  5DLG A;  1TEL A;  4CLW A;  4N77 A;  3Q89 A;  3B54 A;  4DV0 J;  3RBZ A;  3CCW A;  4RLE A;  5KTQ A;  5KFP A;  2DHX A;  4X84 A;  3PW0 A;  2QMU B;  3K7R A;  3DDI A;  4RJV A;  1EQ0 A;  1B70 B;  3OR2 A;  3IWX A;  3D28 A;  1JLQ A;  1HMV A;  4NYZ A;  4O3S A;  1M0S A;  2OEL A;  1CC7 A;  2JJ4 D;  2W7A A;  3JYT A;  4C8L A;  4OHV A;  4A8M P;  4B3T F;  1DTT A;  3HHL B;  2IM0 A;  3ZTP A;  4LBP A;  3UNY A;  1FTC A;  1GX6 A;  3KLE A;  3O1L A;  2EK1 A;  3SFU A;  2ZBR A;  2IJN A;  5CD4 H;  1F0X A;  3M30 B;  4WP3 A;  2RKI A;  4C8Z A;  2HHT A;  2ZNZ A;  3JSM B;  2KRB A;  3EGZ A;  3TAQ A;  4UQT A;  1W25 A;  4WP8 A;  1RAH B;  3P49 B;  2CQD A;  5E41 A;  1ELO A;  3SSR A;  3L3C A;  4LF8 F;  1NRK A;  1WG4 A;  2GJ2 A;  1B7F A;  1IKY B;  4DUY F;  2GVZ A;  4IRD A;  2Y1I A;  2IC3 B;  3M9M B;  4RUC A;  5J1E A;  3D54 A;  2EFN A;  4RKU C;  3BDP A;  1UTA A;  1Y5I B;  2UVR A;  3KK1 B;  3CCL S;  3GWC A;  1FEE A;  4HH0 A;  5DZ7 A;  5ETR A;  3HK2 A;  1TUG B;  1ZZN A;  2HBR B;  1Q5Y A;  4QPT A;  4X4P A;  1S7H A;  5E3Q A;  1HNI A;  1TL3 A;  5C25 A;  1FCA A;  4GKJ F;  3KUG A;  5C42 B;  2YNG A;  1LWE B;  1S4E A;  4P52 A;  2AGQ A;  3CGI A;  4F2R A;  4W4M A;  2R7R A;  2OKQ A;  5BYR A;  3GV5 B;  3G8T A;  3MM5 A;  3JAM Y;  2KVQ E;  1U1K A;  3BYR A;  3KLG B;  4L75 A;  2YPZ A;  4I6Y A;  1Q5V A;  2R8G A;  4IQX A;  2IVM A;  5GAE U;  2FIU A;  1UCN A;  2RNE A;  2B6A A;  1BQN A;  3TZY A;  3HFV A;  1IXK A;  5AXN A;  4PG7 A;  4FF1 A;  5ETN A;  2POK A;  2CNO B;  3BM7 A;  2ZH5 A;  3BO3 A;  3PR4 A;  1R43 A;  2EBE A;  1MN9 A;  4FS1 A;  3S8S A;  2C22 A;  4HVZ A;  5HL7 Q;  2IPO B;  1K9M T;  1AZS B;  1RTD B;  2MJU A;  1QJH A;  1HNV B;  3TAM A;  4LF9 F;  2MY7 A;  2SXL A;  1FWL A;  2IMW P;  4ALZ A;  2ZUA A;  5AT1 B;  1C1C A;  1FA0 A;  3MMC B;  1FKO B;  3MPU B;  4AND A;  1TL7 A;  3BQ1 A;  4DHV A;  4PXC A;  1J2V A;  5LJ3 Y;  4P6Q A;  2IA0 A;  4NE9 C;  4FYV B;  3AQP A;  4NLW A;  3N28 A;  3V6J A;  3IMQ J;  4ZCM A;  4YDX A;  1D1U A;  4ZCI A;  3C15 B;  2VPX B;  2Z57 B;  4ETZ A;  4F36 A;  5ITH A;  1RAA B;  1Q82 T;  2HQG A;  3BZQ A;  2JEI A;  4EWT A;  1BWV A;  1H3D A;  3O3L A;  5LJ5 Y;  3NGT A;  3QJL A;  2NR0 A;  4B9T A;  4X66 J;  3BBC A;  4LRE A;  2HFN A;  4B3M F;  2GCF A;  1N56 A;  4AE5 A;  4RW8 B;  4BC9 A;  2AU0 A;  1CLF A;  2K1R B;  4PPD A;  1N34 F;  1TFW A;  1CBK A;  2WOM B;  3EIC A;  2B4U A;  3UR3 C;  1QAI A;  2QMW A;  2KB2 A;  2XZW A;  4C11 A;  3M8Q B;  3P3D A;  1T05 B;  4ECU A;  3QGP A;  4HHJ A;  3A3P B;  2V4J B;  3SV3 A;  4CH7 A;  3EJM A;  3H5U A;  4JI5 F;  2HGN A;  4WFB Q;  2XSJ A;  2V2V A;  1OSC A;  4OI6 A;  2NCK L;  1YJN S;  1T7P A;  4KO0 A;  1UVK A;  3HVA A;  4C48 A;  4DS4 A;  1MMD A;  3OLA A;  1SIZ A;  1RT3 B;  4Y2C A;  2OFH X;  5AE3 A;  3R27 A;  2B9E A;  2X3G A;  3DGP B;  3HLU A;  2XYP B;  3EXC X;  3MM9 B;  3D6T B;  4FKY A;  1SIW B;  3EPG A;  4DN0 A;  5B0B A;  2HQD A;  3Q8Y A;  2D1C A;  3MGJ A;  4LSN A;  5A8K B;  4U7C A;  1RAI B;  2DPI A;  3QYY A;  1SC4 B;  1SC1 B;  5DDP C;  1H6K X;  1KD1 T;  4IG3 A;  4K4V A;  4OZ1 A;  3TR5 A;  1IKX B;  4QW9 A;  1GXT A;  3RU0 A;  1UEV A;  2AEM A;  4FXW A;  5G4D A;  4O3N A;  4ETX A;  3VAJ A;  3VAL A;  4C8O A;  2CZV C;  3V4I B;  3CED A;  2LDI A;  3OFE A;  3CD7 A;  4WPA A;  3RR7 A;  1TR0 A;  4DSL A;  1TVR A;  4LRF A;  1NXI A;  3HUL A;  2DGW A;  1DJ0 A;  3F56 A;  3IWL A;  4F50 A;  2C1E B;  2FUG 9;  2XO6 A;  2XCA A;  2ZHA A;  4F4K A;  3AAW B;  1S1V A;  3KJQ B;  1UZH A;  2QLB B;  1L3T A;  4CO3 A;  3BR8 A;  4ZJO A;  3JSY A;  1LOU A;  3CJK B;  1SJF A;  1RT1 A;  2J5A A;  3UDE A;  1D3W A;  4TXS A;  1FI4 A;  3KLE B;  2OAU A;  3ZZU A;  2EKY A;  2ZE2 A;  3ITH B;  4NRT A;  2MZJ A;  4LBH A;  2QGF B;  1CJT B;  2QYC A;  4DCO B;  2AMC B;  4DV4 J;  4KYZ A;  3Q83 A;  3PVX A;  4RW7 A;  4A8S A;  2RRA A;  4ZPA A;  1JLA B;  4I64 A;  4M5I A;  2J0S D;  5FDL A;  3GCX P;  5E2Q A;  3GB0 A;  2DYA A;  4DL5 A;  1BWE A;  2NUH A;  1UVL A;  3VGV A;  4MFB A;  3L09 A;  3T6B A;  3R6L B;  1LXN A;  3I5B A;  4HDG A;  2ZWO A;  1HNX J;  1S9E A;  5HMW A;  4IFV A;  3OUY B;  4JB8 B;  3PRB A;  1KEK A;  1GTH A;  1RTH A;  2JLE A;  2ZJP Q;  2CQ2 A;  4YP3 A;  3KJF B;  1S9G B;  2VHG A;  2QLF B;  3CME S;  2AT1 B;  4LT6 A;  1FDA A;  2ZZM A;  3T5H A;  1YTY A;  2V8D A;  2HK2 A;  2X1G A;  1ICE B;  1U1P A;  4KRW A;  2KG0 A;  2P9G A;  5A6W A;  3MM5 B;  2OI2 A;  5GME A;  3DRS A;  2Q6C A;  3OBI A;  5ETT A;  1XR6 A;  5KT4 A;  4RL1 A;  3IA0 A;  2LYV A;  5SUH A;  2KZZ A;  3EGW B;  2E9R X;  3DC2 A;  1M5K C;  3HXM A;  4ZCL A;  2R2S A;  2C2K B;  4JI8 J;  3D66 A;  3G96 A;  4KHM A;  4IG0 A;  4D3G A;  3M2V B;  3IFE A;  1KON A;  5F0U A;  1TKT A;  1RAF B;  2FLP A;  4O0I A;  1YJV A;  5IC6 B;  4NPO A;  2WBM A;  1ZS6 A;  3KTQ A;  5EN1 A;  4NLV A;  3VAF A;  4RX6 A;  2MZQ A;  4R8U A;  3I31 A;  4TY8 B;  2DNH A;  4H4O A;  1C1C B;  4EBD A;  3EXY A;  5L1L A;  4TNO A;  1RTJ A;  1MRO B;  1DLO A;  3CC2 S;  1OQ6 A;  3RYL A;  2VDI A;  5HMY A;  4JI6 J;  2M4M A;  4FVM A;  1C0U A;  2ADB A;  1NK6 A;  1KVI A;  1B0T A;  4CLU A;  3IGV A;  2V8H A;  2ZH4 A;  4MYU A;  4PQA A;  3MR6 A;  3FBB A;  2V94 A;  2UVV A;  3Q8V A;  5FLX U;  1KRP A;  1S1T B;  2VH7 A;  3FQL A;  4ED1 A;  4DBQ A;  5DET A;  3NMR A;  3DN9 A;  3MMJ A;  4O23 A;  3UR0 A;  2QLX A;  4A46 A;  2DJW A;  1WF2 A;  1QSL A;  3AA9 A;  2N82 B;  1NKC A;  1UEK A;  2DNM A;  1VBX A;  1WF0 A;  4NXN J;  1LWF A;  2HZC A;  2BA9 A;  2HFZ A;  3K5P A;  4BCA A;  5I3Q A;  3T1A A;  2XSJ B;  2ALZ A;  4M94 A;  4ED5 A;  4KV8 A;  4KO0 B;  1NK8 A;  3G82 A;  3W66 A;  4FXV A;  1CQN A;  1NCL A;  1Y5L B;  5T41 A;  1V3Z A;  4DSI A;  1REG X;  4DL7 A;  5D4O A;  4V1A k;  2MKI A;  2VON A;  1VBK A;  2V63 A;  3PW4 A;  2UV8 G;  1U09 A;  4X66 F;  1LEO A;  3BS9 A;  1IJF B;  2LXU A;  3M6V A;  2VOD A;  1PBA A;  2J76 E;  1H74 A;  3TA1 A;  4CQ1 A;  2B3T B;  2MQP A;  3S01 A;  3ZTO A;  1RAB B;  2F9J A;  1RAO A;  2HK3 A;  4P2F A;  5B0G A;  1YJW S;  1W7W A;  3R97 A;  1WDT A;  4RWW A;  4JI3 J;  2VPY B;  3PIP Q;  4DJB A;  2RF2 B;  2OUG A;  3Q8P B;  4ZDN A;  2J7U A;  3NCP A;  4OLO A;  4EYI B;  4IR9 A;  1EKS A;  3D3C J;  3CO9 A;  2X1F A;  2GFF A;  2FGO A;  2OPR A;  4WU2 A;  4LRD A;  4ITS A;  4UW2 A;  4ZVT B;  3QRR A;  4UUW A;  5HI7 A;  1M5P C;  4ZVS B;  1JLG A;  2MST A;  2L3M A;  3FEZ A;  1UVJ A;  1J5E J;  3HO1 A;  4OYX A;  2UUW A;  3P96 A;  4Z7Y A;  3C6U A;  3L4B C;  3MEG B;  1K47 A;  4L3K A;  1RT1 B;  3I0R A;  3BO2 A;  1KFD A;  2HQC A;  3CCU S;  3RB4 A;  4UT4 A;  3QSI A;  4FBU A;  2ZFH A;  1HBM B;  3D6F B;  2ACY A;  1DBD A;  2B9Y A;  1V6H A;  2QLW A;  4RW7 B;  2Z2M A;  3IRW P;  2H48 B;  1O0P A;  4M5L A;  5FLX Y;  3MDF A;  1V3R A;  4U95 A;  2DY1 A;  5B08 A;  1SJQ A;  2V0N A;  3W2V A;  4CO4 A;  2YKA A;  2ZBI A;  4D3H A;  3I0S A;  1XMO J;  4Q2L A;  4KPC A;  3W65 A;  2VL1 A;  3FSX A;  2MB0 B;  2GZO A;  5EDW A;  3CSK A;  2QYG A;  3NGS A;  4O0N A;  3EX7 B;  1L3U A;  5DDR C;  2ZBP A;  2NLW A;  3M2R A;  5IT0 A;  3HHD A;  2J6U A;  4MIB A;  5L38 A;  4K4U A;  3MEE B;  4USM A;  2AIR B;  2XYG B;  4Q2M A;  2CKW A;  4CLY A;  3KDO A;  4DV4 F;  5D15 A;  5F8M A;  3H7H B;  2HHH J;  4JP8 A;  2J9D E;  2QC3 A;  2WON B;  1RHK B;  1CSJ A;  3DDN A;  2DRD A;  4DS5 A;  1HBO B;  2B7C B;  3C14 A;  1NK5 A;  1NK7 A;  1MMN A;  2HVE A;  2VG7 B;  1VQ4 S;  5CYJ A;  2IA6 A;  2J0X A;  2H54 B;  5B0F A;  2DRA A;  4K7Q A;  3CJ5 A;  1WHY A;  2Z4P A;  3SSS A;  1HNX F;  4NCA A;  3BPD A;  4RW4 B;  1VRT A;  2PN6 A;  2R7X A;  4F4Y A;  5KFK A;  1S6P A;  1DQA A;  4NLU A;  4PUO A;  2BYC A;  4LVO P;  1TKT B;  4ZPD A;  1WOS A;  3M2U B;  1X0F A;  1T9X A;  3G4S S;  2DNN A;  2DNP A;  3HVR A;  4OZN A;  2R2T A;  4OZ3 A;  1OY8 A;  3ISN D;  4LF2 A;  1X7V A;  4R8U B;  3LOU A;  4K2X A;  3ZZY A;  5FII A;  3SFG A;  2DR6 A;  3NGD A;  2YNF B;  2WRM A;  1R0B G;  3J80 U;  2VJU A;  1U2C A;  3MAH A;  4DL4 A;  2A0F B;  1REV A;  4RR5 A;  4XTT A;  1MG7 A;  2VIC A;  4EK2 A;  2U2F A;  2G0J A;  1RGV A;  1S7I A;  1MNE A;  4DN9 A;  1QE1 B;  2R8I A;  1CPZ A;  2E1R A;  2DXE A;  1UZD A;  2LP4 A;  4CRJ A;  4CYU B;  4IFY A;  3CCQ S;  3DMJ A;  2X1B A;  1KOO A;  3DRX A;  5IT9 U;  4ZA1 A;  3A1Y G;  4PWD B;  1B3T A;  1S72 S;  3H2L A;  4WFA Q;  4C98 A;  1IN0 A;  1YZ7 A;  4B3R J;  2OPS A;  2LKZ A;  2DH8 A;  5C2G A;  4FYX B;  2ZZT A;  1YJ7 A;  1S9F A;  3FZ2 A;  1CJU A;  1UWB A;  3DXS X;  4Q0B B;  2DGS A;  3CDE A;  2JEJ A;  4LQ9 A;  1VIX A;  4J7C A;  5CCL A;  1KNZ A;  4ECS A;  1N33 J;  3PFO A;  3GU0 A;  1BQX A;  4KV8 B;  3G82 B;  4ED3 A;  2ZH9 A;  3R7S B;  2I6W A;  1TV6 A;  4DXL A;  3EPI A;  3DM2 B;  5I42 B;  4OYW A;  3DLG A;  1WC3 A;  4IUF A;  4KFB A;  1WI6 A;  2HWH A;  1EP4 A;  2Z0G A;  3LWL A;  4QR1 A;  4WFN Q;  3LWM A;  5K8O A;  2DGQ A;  4RUA A;  1IBK J;  3EVW A;  5I3P A;  2W9B B;  4ZLL A;  2N7Y A;  1LFW A;  3J81 U;  4NXN F;  3RAM A;  2JWN A;  3HPO A;  3Q23 A;  2MDA A;  3GCW P;  4U7U K;  1S57 A;  3KHL A;  1RCX B;  3JQM A;  1Q8B A;  1NH8 A;  1GXL A;  1RAC B;  1X4D A;  2VG6 B;  2D9O A;  2MTL A;  3LP0 A;  4YN3 B;  3BYP A;  3E01 A;  5T7L B;  4I2Q B;  3K0J A;  2XCP A;  2XO7 A;  1LFP A;  1HW9 A;  4C6A A;  1U26 A;  4PEO A;  3H40 A;  2UXB J;  2YX1 A;  4RW9 A;  2ZJR Q;  3W2W A;  1AW0 A;  2DY9 A;  2ZOF A;  2DHH A;  5D0E A;  5HAN A;  4ZN3 A;  2NZ4 A;  1HQU A;  3QWP A;  2NXJ A;  3C6U B;  3J80 Y;  2FGC A;  2MGZ B;  1NJZ A;  2YQ1 A;  2WB1 D;  2XS5 A;  4QCL A;  3CMA S;  2E5I A;  2KZM A;  5K5M A;  4EUV A;  2HHX A;  3ZNU A;  2FTR A;  2NZC A;  4LJM A;  4OJ1 A;  1KLM A;  1PYO B;  1FRI A;  4UY8 T;  1XJW B;  3TUZ C;  1GK8 A;  4ZP8 A;  1HYS A;  2M9K A;  3SDE B;  4IH6 A;  3W3S A;  3ICL A;  3UPF A;  5DQH A;  5IT9 Y;  4DI6 A;  1K1Q A;  3PEH A;  1YI2 S;  2YKN B;  2HFS A;  1TL1 B;  2WCX A;  5ETO A;  3AHP A;  5H9F K;  2HQF A;  4CT9 A;  4DQQ A;  5C7P A;  1X31 C;  2C2D A;  3E3X A;  1ZBT A;  1A6L A;  3D3B J;  5C24 B;  4KB7 A;  4RU2 A;  1QSS A;  4M63 A;  3V2U C;  1IKW A;  3DOL A;  3N6M A;  3ZZP A;  3M2R B;  2KN4 A;  4WK1 A;  4ZVH A;  2QLJ B;  2CQC A;  3BKF A;  1WEL A;  3IC1 A;  4DPU A;  4YEA A;  3RGI A;  2J7W A;  4LF5 J;  3U1N A;  4L74 A;  3EGN A;  3M4X A;  3FCH A;  2XLJ A;  4Y2K A;  4K2J A;  3GFH A;  2ZH1 A;  3CCZ A;  1TUW A;  3TAN A;  2QMX A;  3UDL A;  3PW2 A;  3CPW R;  2V8G A;  4UST A;  1KVK A;  2LDY A;  4M5D A;  3J81 Y;  2ROG A;  3DDK A;  3KLI A;  4DF4 A;  1QSY A;  1YRU A;  5IOL A;  4CT8 A;  4HHU A;  1R8B A;  2J0W A;  2QIF A;  3M8Z A;  3EVO A;  1PAE X;  2LCW A;  2RRB A;  2F4F A;  2XZT B;  1CUL B;  5E3R A;  2HAF A;  3TVY A;  1WOR A;  3RG6 A;  2GJI A;  1ITP A;  3QAU A;  2KXN B;  2HHH F;  1GH8 A;  1DAR A;  3CD0 A;  4L76 A;  4DX5 A;  4LRB A;  2DPJ A;  1FRH A;  4OV1 A;  2GHW A;  1K0V A;  1S79 A;  2FB0 A;  3AXK A;  1I3O B;  2M5Y A;  2AHO B;  1M5V C;  4X4S A;  2XHW A;  2B8Q A;  1FDN A;  3KLF A;  4R5P B;  3CCJ S;  1RKJ A;  4GMK A;  2AYE A;  1VK8 A;  3MMB B;  7AT1 B;  1KLN A;  3MEC A;  3G71 S;  2W7P A;  3M6U A;  3VAG A;  5IWA J;  2YBV A;  5IV3 A;  3FRY A;  1HQE A;  3QT5 A;  4AL6 A;  4QPX A;  2O01 C;  3A3O B;  1T9V A;  3TUJ C;  2ALY B;  5KT3 A;  4CNZ A;  3DMJ B;  2XLK A;  1VOM A;  1Y4Z B;  2RDD A;  1N5Y B;  2I38 A;  2DH9 A;  3C6T A;  2HMI B;  3NKY A;  3D0G E;  4FYY B;  3PDN A;  2KFN A;  1SV5 B;  1Y9O A;  4PG5 A;  1SL1 A;  3DLE A;  4F0K A;  1XNQ F;  4DX8 H;  2RSQ A;  2BRK A;  2MKS A;  2YKM A;  2EBG A;  4U7U D;  3O44 A;  5CAB A;  2PA3 A;  3IN5 A;  3MHY A;  2F63 A;  3J81 j;  2J6T A;  4GC7 A;  2MYF A;  4DG1 B;  3QLH A;  5K8N A;  1RBO B;  2BQ3 A;  1YHQ S;  1VJQ A;  3CO0 P;  3ZTQ A;  1PSD A;  2HNZ B;  4BHQ A;  2AKW B;  2BKN A;  4V19 X;  3MD1 A;  2DRB A;  4IDK A;  1TV6 B;  4CLK A;  2MKJ A;  1N54 B;  3DLG B;  1R6V A;  1U1Q A;  2RQC A;  4WTO B;  2ZBC A;  1X4F A;  2RU9 A;  2Z2Y B;  4KFB B;  4DUZ J;  2M7S A;  2R7Q A;  4B3R F;  4DV5 J;  4Y65 A;  2R7O A;  5KFN A;  2E7X A;  1AUS L;  1EP4 B;  3FEY B;  2RB7 A;  2O5D A;  2XMW A;  4JI2 J;  2CJY B;  2VU5 A;  2QSF A;  5F9L A;  3UO0 A;  4P2S A;  4DQP A;  3RAQ A;  3LQV A;  3V4M A;  2HG4 A;  3H25 A;  4E98 A;  3QO9 A;  3UD4 P;  3T9N A;  2YWK A;  6FDR A;  2P2C B;  1LWC A;  3SQG B;  4TYA A;  2Y0B B;  3V6K A;  1VIS A;  2W2O P;  1HHQ A;  5HP1 B;  4B3O A;  3E01 B;  1EET B;  3BB5 A;  2YTC A;  1V3S A;  1I94 J;  3CDB A;  1LV5 A;  4GKK F;  4Q5V A;  1VK3 A;  1JXV A;  4C3M A;  4RW9 B;  1RWN B;  4ECY A;  4N41 A;  3DRP A;  1S6Q A;  1VQ7 S;  4I2P A;  3W2W B;  1M1G A;  1FES A;  3Q8S B;  3AFG A;  3FFI B;  4WJB A;  3SQO P;  1HWI A;  4Z2X A;  2ZH7 A;  1JQG A;  1U6Z A;  2R4F A;  1IBK F;  3KWM A;  1IM6 A;  4P10 A;  4P75 A;  4RUB A;  4LFC F;  1UFL A;  2GQ2 A;  2WHO A;  1IKV A;  2XS2 A;  3IAM 9;  2PD1 A;  2XBP A;  4ECW A;  4PQU B;  3AJD A;  4ES2 A;  5C2C A;  1S77 D;  4QR2 A;  2HHS A;  2AJ4 A;  1KQS R;  2A3J A;  2V8V A;  3HVT A;  1JLE A;  5BYS A;  4OZL A;  2Q79 A;  1CJV A;  1N0U A;  5LMN J;  1D9F A;  5DG8 A;  3KUH A;  4HLB A;  4TQS A;  4DF8 A;  2UXB F;  4ZVO B;  5E0O A;  1S0M A;  3TEH B;  2L9D A;  3B4M A;  1U02 A;  3QRP A;  1UP1 A;  2DXF A;  2LQ5 A;  4OI4 A;  3HD1 A;  4KH1 B;  5D78 A;  1PKU A;  2OGU A;  3KK3 B;  3NY0 A;  1NSA A;  3OTO F;  5HVH A;  5HAO A;  2HWT A;  4NLO A;  2YWH A;  5ETQ A;  1HPZ A;  5KFY A;  3M6X A;  3OSP A;  2MLX A;  4JOU A;  2WVD A;  2OEJ A;  2XMM A;  4N5S A;  3BF4 A;  1PG5 B;  3GIM A;  2WSE C;  3MAQ A;  4MIA A;  3D68 A;  2HEK A;  4KT0 C;  3ILO A;  2R3V A;  2EFG A;  4OYP A;  2RE1 A;  5KOX A;  2VPW B;  2XZD B;  5F8J A;  2MZS A;  1H2U X;  4CNY A;  1CG2 A;  1TMM A;  4UY8 5;  2YQ0 A;  3ZZT A;  4YB7 A;  1CEZ A;  4CLZ A;  2QA2 A;  2UXD J;  2ZWP A;  6FD1 A;  3QGG A;  3TVK A;  2RQK A;  3TAR A;  3QFH A;  4ID8 A;  2CNL B;  3AJ1 A;  1PGZ A;  4LF5 F;  1VR6 A;  2OD6 A;  2YWE A;  2ZNY A;  1HLW A;  2O3D A;  1SPB P;  2E1P A;  1RU2 A;  3HSJ A;  3VV2 B;  1X9M A;  3KLF B;  3ZTS A;  4G1P A;  4FVC A;  1PBU A;  1TQL A;  3SCI E;  1XQI A;  1HNZ J;  2XYH B;  3VQT A;  1HQE B;  3LAL A;  3CJR A;  2KYX A;  2DCL A;  1J5O A;  1JLF A;  3OJU A;  2VC1 A;  1QM9 A;  4YY3 F;  5J1N A;  2YQ3 A;  2EW9 A;  2F1F A;  2EG1 A;  3FSY A;  1TK5 A;  4KKO A;  3MFH A;  1HBU A;  1NDL A;  3PZP A;  3KMS A;  3QIP B;  2LXF A;  3JXO A;  5HRO A;  5KFM A;  4GVB A;  4W98 A;  1F9H A;  1WC4 A;  4MIW A;  2YKM B;  4NCG A;  2GO8 A;  1IBL F;  2NS1 B;  2OD4 A;  4KHR A;  1MML A;  3UCU P;  3GIK A;  4FNI A;  3M8W A;  3GIJ A;  2B0G A;  3TUP A;  2KT2 A;  4NZ0 A;  2MQO A;  4YDD B;  2XMJ A;  1FVS A;  3MUM P;  1T8E A;  1YIJ S;  2IMO A;  3MAA B;  2CYY A;  4IDK B;  2OO4 A;  2C28 A;  2FJV A;  5DGB A;  2R2U A;  2VD3 A;  1S48 A;  3ENQ A;  1L3S A;  1AFI A;  3T41 A;  1T11 A;  2GHP A;  1RTI A;  3SYZ A;  4TU7 A;  2W2M P;  2KM8 B;  1UJ6 A;  1SQF A;  3FNN A;  4DV3 J;  3C66 A;  5CHC B;  3EZO A;  2WVF A;  3OR1 B;  2BR0 A;  3N79 A;  2HBZ B;  4C4W A;  1LNQ A;  3THT A;  2CPI A;  3NAH A;  5LXR A;  3BN4 A;  2G13 A;  4ANE A;  1X5O A;  2ZVS A;  2BE2 B;  2GW8 A;  3QO9 B;  4ELT A;  4X4U A;  2ZOM A;  2DVI A;  1X8D A;  4OYA A;  4OI0 A;  5CXT A;  1ZM4 A;  2OJ3 A;  4I67 A;  1YWX A;  3CIZ A;  4L3N A;  2MZ1 A;  2XY6 A;  2FQQ B;  3MR2 A;  3CXC R;  2VG5 A;  7FD1 A;  1VQ5 S;  3OPK A;  4DFM A;  2C2R A;  1HKA A;  4WBF A;  3CJS A;  3BDE A;  3FUY A;  2FLN A;  5KAK A;  2CFX A;  4EBE A;  3NOC A;  1FK9 B;  4DUZ F;  3TJA A;  3Q8U A;  1RDR A;  4DV5 F;  1N5Q A;  4OI1 A;  2PFF B;  1VQK S;  1R0A A;  4Y00 A;  3UCG A;  4JI2 F;  1VQN S;  1F3V A;  2ASL A;  3FQK A;  5LXY A;  2HND A;  4ZLN A;  2UZA A;  1FXR A;  4O3R A;  3BSC A;  4NA2 A;  2ASJ A;  2V4R A;  5D0H A;  2W2Q P;  3GJT B;  1YVF A;  4W92 B;  5A2Q U;  2ZHO A;  1N32 J;  1M5S A;  4QWE A;  1HD0 A;  1HD1 A;  1ACM B;  4L72 B;  3PO4 A;  1O5J A;  3A8I A;  2HFV A;  3HT3 A;  2B5J B;  4QU7 A;  4DPT A;  3G6V A;  4NMX A;  1UW4 A;  4QIE A;  4ECV A;  5JVH Q;  3IG1 A;  2UVW A;  1Q1K A;  2IAJ A;  2AYM A;  4I56 A;  2E7V A;  3K5O A;  2K8G A;  2BQR A;  4MYT A;  2DIS A;  1WKL A;  3NBP B;  1Z2Z A;  2BAN A;  4EGL A;  3FBE A;  4O44 A;  4RBU A;  4NYO A;  3CDU A;  2V6A A;  1DTQ B;  2R7W A;  1ZTT A;  1G2E A;  1FF2 A;  2XMV A;  4TLQ A;  5BYQ A;  2CJX B;  2HHU A;  3CD6 S;  2AF6 A;  3C16 A;  4E0D A;  2H1Y A;  1KC8 T;  3MM7 B;  1NK0 A;  4K4W A;  3M6W A;  2HHW A;  1U2R A;  3E8O A;  5CYM A;  3OHB A;  3NLC A;  2HNY A;  1O51 A;  3CVK A;  5KFH A;  5L46 A;  1TKZ B;  1YJU A;  3UVJ A;  4GO7 X;  2B9X A;  5LMN F;  1GX5 A;  4TQR A;  2JZ5 A;  1WOO A;  4ED8 A;  3GQC A;  2CQ4 A;  3OVA A;  2HW3 A;  4F4A A;  3JS9 A;  4ZIV A;  3MCS A;  4YHH J;  2NSB A;  3U1L A;  1GMW A;  1Y0H A;  5HLF B;  2G2Y A;  4IOB A;  3RB6 A;  3BGU A;  2DR5 A;  1RLD A;  1LW2 A;  4U67 Q;  4CO2 A;  1WC1 A;  3CDA A;  4QU6 A;  1BQM A;  1F5B A;  1H7X A;  3KKF A;  2DGT A;  2B4P A;  3H8Y A;  3QAE A;  3AOB A;  3NGR A;  2E5L F;  3QT7 A;  3IRX B;  3FVY A;  4WE1 A;  2DO4 A;  1VRU A;  5E3P A;  2DD8 S;  1TK0 A;  5D4L A;  5KG5 A;  3OTB A;  5IQQ A;  2R8K A;  1UA1 A;  3OQ2 A;  2HAI A;  2BV3 A;  2E1M C;  2H51 B;  3MUV P;  2MZR A;  2QRR A;  4NLP A;  4PG4 A;  3AT1 B;  1YGY A;  2O1P A;  3M1V A;  3KXD A;  1RT2 A;  1EB0 A;  1SXL A;  2QA1 A;  3I6P A;  4RNM A;  4O4G B;  4E8U A;  1FRX A;  5KOW A;  1T9Y A;  2CUY A;  2YKP A;  5A2Q Y;  2ZH8 A;  3TZZ A;  2B4V A;  4DUT A;  2UXD F;  2PGC A;  1GMU A;  1A9N B;  5ADZ A;  2Z8Q A;  2GIR A;  4PRF A;  2HGL A;  3OTC A;  1X60 A;  2D9P A;  2VBZ A;  1SJ4 P;  3OVS A;  1HBU B;  1ZM3 A;  4B3S J;  4B02 A;  3FBF A;  3OXF A;  4L6V 3;  1FD2 A;  1NAQ A;  1C1B B;  1B64 A;  2BX6 A;  2CVE A;  3ET6 A;  3N6L A;  1JJ4 A;  4H54 A;  3HKW A;  2VFT A;  4K4Y A;  4ZOS A;  3T5K A;  2YWW A;  1FNM A;  3GIR A;  1FKP A;  1FNX H;  5KFW A;  1RLC L;  4BDP A;  3O5T B;  2BJD A;  2L9W A;  4C97 A;  4ES3 A;  2GVD A;  5G0R A;  1BLU A;  3K5L A;  4OLP A;  1HNZ F;  3T5J A;  2GAH C;  4ANC A;  2D3Z A;  3KG0 A;  4IOC Q;  4JI0 J;  2M88 A;  3H4B A;  4HYK A;  1JLB A;  3BKU A;  2CAJ A;  1GTE A;  3MPW A;  5KFQ A;  2W9C A;  1RQ0 A;  4IO1 A;  3MCM A;  3W62 A;  1XN9 A;  1Q8K A;  4UF4 A;  1P8G A;  4BC7 A;  2HHV A;  4KGK A;  5CYQ A;  5GAH I;  3D67 A;  1TMJ A;  3GJR B;  1E6V B;  1O8B A;  2OSR A;  2C2O B;  4I6A A;  1IWG A;  1Q78 A;  2HIY A;  5ETM A;  5IT4 A;  2LLZ A;  4HH1 A;  1LW0 B;  1JNZ B;  1RSC A;  5ETS A;  3MMA A;  3WQP A;  2UU9 F;  4ICL B;  2IJR A;  1ULR A;  4O3P A;  2H5J B;  3X3U A;  4DPX A;  2I5J A;  4XPC A;  2HHP A;  1Q7L B;  1ZM9 A;  2AZ3 A;  3PW7 A;  3KK2 A;  3KJV B;  3TUI C;  1H72 C;  4J9P A;  3IBF B;  3JQJ A;  5CCM A;  3ZNJ 1;  3LA0 A;  3G6X A;  4DU7 A;  3PCO B;  4HTI A;  2UV8 A;  3NNA A;  4CH0 S;  1F6T A;  4X4T A;  3KNG A;  9ATC B;  8RUC A;  4DV3 F;  4WZQ A;  1D8Y A;  1NK9 A;  3JTP A;  1PIL A;  3PJX A;  1VS3 A;  2DIU A;  5E7O B;  2UUT A;  2HND B;  4FF3 A;  2HS3 A;  1HNW F;  1OSD A;  2KDO A;  2EFO A;  3H42 A;  5AJ3 J;  1QTM A;  4ED7 A;  4X62 J;  1X4C A;  2XC9 A;  2IYI A;  4OJ3 A;  2QSW A;  3WBZ A;  3TW0 A;  2VOO A;  4QYZ K;  4HI2 A;  3LAM A;  4ED4 A;  5IM0 B;  5IXU A;  5L8R C;  4C0B A;  3K2Y A;  4KSE B;  3R1H A;  1YLX A;  4DR2 J;  2KO1 A;  2DNQ A;  4URG A;  4LUB A;  5K8P A;  2ZDP A;  2YH1 A;  4HEA 9;  2G2O A;  3W7B A;  3BPS P;  2ZDO A;  3POT A;  1UVN A;  3THP A;  2XMT A;  1FO1 A;  2R7U A;  3FK4 A;  3IR5 B;  1SBR A;  3I55 S;  4WFY A;  5KFA A;  1FJ7 A;  3LAK A;  5GMD A;  1HWU A;  2LEA A;  3PKY A;  1WEX A;  3R5G A;  3CCE S;  1QUV A;  3OVB A;  1VYA A;  2ZC4 A;  5B7W A;  1LK5 A;  4YR2 A;  1W26 A;  2L08 A;  2W2N P;  1Q8L A;  2HVI A;  3BGL A;  3OFH A;  1JLC A;  2JVO A;  2XTJ P;  1N32 F;  1CJK B;  2BW2 A;  4IKA A;  4W90 B;  1XTZ A;  1P9Q C;  2CAD A;  1RAE B;  1FRK A;  1X4E A;  5M2R A;  1TKX A;  1WC6 A;  4OX8 A;  4F04 B;  2FZK B;  3EWG A;  1MU2 A;  4NI2 A;  2RH3 A;  4MKY A;  2YNI B;  2N3L A;  2VF3 A;  3RW6 A;  4DFJ A;  2PI5 A;  2GJF A;  4G1I A;  2YY3 A;  1F5C A;  4U8Y A;  3GYN A;  3G87 A;  2E29 A;  2X51 A;  3JTO A;  1C4A A;  1OWX A;  5J2P A;  1IR2 A;  4F7V A;  4PCQ A;  2AJF E;  3J7Z T;  2V5H G;  4WE1 B;  2V2K A;  1EIY B;  2Y1R I;  3L9Z A;  3QJJ A;  4N8N A;  3ZZ0 A;  1RT6 A;  2DGU A;  4IR1 A;  3K59 A;  3EM1 A;  1N5T A;  1FXD A;  1OPZ A;  4LF6 J;  2OTJ S;  1G7C B;  3D1O A;  2CWK A;  2R7V A;  2E44 A;  2F40 A;  1ZET A;  3IS9 B;  4GO5 X;  4YHH F;  3MXH P;  3UD5 A;  3ZTR A;  2WAQ D;  4DLG A;  1RT2 B;  4C3L A;  3WHI A;  2ZZN A;  2DT9 A;  2MKC A;  3LP2 B;  5C5J A;  2HWI A;  4UOF A;  3KLH A;  4I69 A;  1VQY A;  2JHE A;  5GAE I;  3SI8 A;  3P5T L;  1NB2 A;  1X4A A;  4AXI A;  3DI6 A;  5CA5 A;  3E2E A;  4LF1 A;  1HIY A;  1WC5 A;  3MTJ A;  3EUN A;  4ZPV R;  1TU0 B;  3SEO A;  1HHT P;  4Y34 A;  1CQM A;  4OI2 A;  3HSG A;  1N0V C;  1NO8 A;  3ENA A;  2UUA F;  3R6G B;  2JFD A;  4TN2 A;  1KHV A;  2KHC A;  1XMQ J;  2D74 B;  1RT5 B;  1EX8 A;  1RT4 A;  1RHQ B;  4YB5 A;  3GG1 A;  5G0R B;  4JV0 A;  4DPO A;  4AQY J;  2FJB B;  1F5A A;  4J37 A;  4NA3 A;  4LF7 J;  4CO0 A;  2OSQ A;  2OEK A;  2DH7 A;  4RZR A;  5KFF A;  1X0P A;  3K5N A;  2JRS A;  1S1W B;  2HRY A;  2NYI A;  2L41 A;  3HHL C;  5E3A A;  1R89 A;  1JKH A;  1JLB B;  2A2C A;  3PAC A;  2Y8W A;  4OI3 A;  3MM8 B;  2W9C B;  2RT3 A;  1U1L A;  2XMA A;  4B3S F;  4UUX A;  1VFJ A;  2ASY A;  2C42 A;  5B0E A;  2ZJQ Q;  1DY3 A;  4LFA J;  3BH6 B;  1IQZ A;  2C2Z B;  3MED B;  2VFU A;  4PR6 A;  2RQM A;  2CPH A;  2ZD1 A;  4J90 A;  2N4C A;  3M32 A;  3KYL A;  4B9L A;  1IR1 A;  4CTA A;  5J2N B;  3MZI A;  3LP1 A;  1RHJ B;  1SL0 A;  2P9C A;  1S6U A;  1RT7 A;  2AJ1 A;  3OL9 A;  1S0N A;  3C19 A;  1N4L A;  3A12 A;  2G4B A;  2ATC B;  2FDN A;  4YR3 A;  4DL0 C;  1HBN B;  4JI0 F;  5DO2 A;  4ZP9 A;  3N5B A;  4QWD A;  2NRE A;  1I6J A;  1RBL A;  5D77 A;  1FE0 A;  1Y00 A;  3RBD A;  4OJG A;  4KR0 B;  1SJR A;  4Y2I A;  4ERD A;  1VCT A;  1D9D A;  4Y3C A;  1YK9 A;  1X5T A;  3OJS A;  3Q2T C;  2ZKT A;  2FJW A;  4KE5 A;  2DEJ A;  5F8G A;  1F1B B;  1WF1 A;  3NEK A;  2B4O A;  3CJQ A;  1NKE A;  4ZHR A;  1PYS B;  3PX6 A;  1SUQ A;  3O2I A;  5J2Q B;  2JNJ A;  3I4P A;  4MK9 A;  3MPV A;  5EWG A;  2A2D A;  4KTQ A;  1VQ6 S;  1UMJ A;  3VAM A;  1OY6 A;  2DHA A;  4NLD A;  2BDP A;  5KFJ A;  4ZCK A;  1JX4 A;  3AB4 B;  2ZKU A;  3OD2 A;  2G2Z A;  1DQ8 A;  4OZ5 A;  4OIX A;  3CDW A;  4RNN A;  3POT B;  1GMW D;  5A8R B;  1X4H A;  5HVF A;  1F2G A;  2YNH B;  2QL5 B;  2W4P A;  2J7K A;  2QFI A;  3GR0 A;  1CS4 A;  5HAT A;  3I56 S;  1YBT A;  1QTN B;  4HAC A;  1FKA F;  2FVC A;  5AJ3 F;  4EZ9 A;  4PG6 A;  3T19 A;  4X62 F;  2BJ9 A;  2LQB A;  2XS7 A;  4EO8 A;  1NKB A;  1JLC B;  3K8W A;  2QJ3 A;  2WBR A;  2DNG A;  2OPP A;  4CCH A;  5I3U A;  2FJE B;  2ZIT A;  2CG4 A;  4K0K J;  3M8P A;  4MH8 A;  4DR2 F;  2HGM A;  5KG0 A;  2XMK A;  2QZ8 A;  2YX4 A;  1FDB A;  4KAI A;  5D0G A;  2G9O A;  1LKZ A;  2OPQ A;  2JDJ A;  1OJ4 A;  1RB0 A;  4B9S A;  4WU3 A;  3R5J B;  1TAQ A;  5LMU J;  4I7F A;  2COL A;  1X4G A;  4OYO A;  4Y2A A;  1U45 A;  4ILL A;  3RR8 A;  1XEZ A;  1RYR A;  3GIL A;  3MI7 X;  2CJK A;  1HA1 A;  4P7V A;  1PCA A;  4DL6 A;  4M5M A;  5J2P B;  3OR2 B;  4JI4 J;  3I4H X;  4KBI A;  4DEZ A;  1D09 B;  3M05 A;  2LEB A;  3FBC A;  4U8V A;  3DLK A;  1JLQ B;  4WTY A;  1HMV B;  3ZFV A;  5A0Y A;  3B78 A;  2V2Q A;  2CQH A;  3P6Y C;  1NJI T;  3G9C A;  1FJG J;  2VBW A;  2EC0 A;  2LFV A;  2JC0 A;  2ZH2 A;  1SC6 A;  2KU7 A;  3JYT B;  3IWN C;  5CZV A;  1G6B A;  2Q3P A;  3DOK A;  1IWA A;  2BJ1 A;  3ETO A;  4WYW A;  3H2U B;  1DTT B;  2PO4 A;  4NXM J;  1AT1 B;  4H4M A;  4UZC A;  4AUK A;  3HI9 A;  3GMG A;  4IO9 Q;  4DV0 F;  1VLY A;  3MUR P;  5KG2 A;  2IVY A;  2X1A A;  4HTJ A;  1VDH A;  5BR8 J;  1S1X A;  3J7Y U;  1XR7 A;  1FDD A;  3KJN B;  2RKI B;  1JJC B;  3GFX A;  4A8O A;  3RRH A;  2CNN B;  1WUU A;  3AA8 A;  4C8N A;  3DI6 B;  1WEZ A;  1N8R T;  4JYA J;  2BOA A;  4MK7 A;  2HVH A;  3EZ5 A;  4K4T A;  1NHV A;  3T9Z A;  4ZS6 A;  3SMZ A;  5HMZ A;  4N8O A;  4LR7 A;  2GVZ B;  4YOE A;  1CVJ A;  3HZE A;  4Q7A A;  1VC6 A;  2VQF J;  2CXE A;  1LQ9 A;  2W8K A;  5J1E B;  4P2M A;  1P27 B;  2ERR A;  4WKR A;  4DR3 J;  3DOM A;  3WC2 A;  3G6Y A;  3D0I E;  1WHX A;  4ECT A;  4NML A;  3DU6 A;  3J7Z 5;  2B56 A;  5RUB A;  1HNI B;  1TL3 B;  5C25 B;  3VZH A;  4USH A;  4DX7 A;  4GC6 A;  4JI1 J;  2YNG B;  3I5A A;  3UDV A;  2WW8 A;  1BC6 A;  3FZB A;  2ZC3 A;  2K3K A;  2MKH A;  4USK A;  1WDD A;  2CPF A;  3HSD A;  1B99 A;  2BM0 A;  3WDO A;  1SCJ B;  4C8K A;  2QV6 A;  1NUE A;  1UEU A;  2CPD A;  3L7U A;  2B6A B;  1BQN B;  2HSE B;  4ID5 A;  1U1O A;  2KKH A;  3GON A;  1H38 A;  2PA8 D;  1DRZ A;  2HQ3 A;  3A13 A;  3IGN A;  2RU3 A;  2HUR A;  1XMQ F;  2EPI A;  5A8W A;  3LP1 B;  3BBB A;  1S1U A;  3ETM A;  2F8E X;  1EAY C;  1QAY A;  4KGX B;  3ADA C;  1GNK A;  3LGH A;  4ZVR B;  2BM1 A;  2F8H A;  4LF7 F;  4KGV B;  2E5H A;  1RA7 A;  3A8K A;  2GAG C;  1YSJ A;  3CB4 A;  1RWM B;  3LO3 A;  2Q66 A;  2MHE A;  5F3Z A;  4X4N A;  1K0T A;  4USU A;  2JVR A;  3VWS A;  1UVI A;  3TAM B;  1KR4 A;  3P8B B;  1IVZ A;  3WX8 A;  4LFA F;  2C3Y A;  3W9J A;  2XWY A;  2MMY A;  1BY9 A;  3IO1 A;  2HBQ B;  1K1S A;  5SZT A;  1WC0 A;  1VGY A;  1TL7 B;  1PIE A;  2PMW A;  1UFK A;  5KT6 A;  4ZP6 A;  2QL7 B;  2BJ7 A;  2MQL A;  3W63 A;  4ECZ A;  1IM4 A;  3QGI A;  2IHR 1;  1XIQ A;  2MQM A;  3W5Y A;  3HHL A;  2X7I A;  3BGF A;  2M3D A;  3GG0 A;  5FD1 A;  4Q43 A;  4KY3 A;  2IDE A;  1VQM S;  1XC9 A;  2PMH A;  4FS2 A;  1SB6 A;  5GVQ A;  5HK4 A;  3M30 A;  1LWX A;  2WSF C;  5HO4 A;  3PJ9 A;  2ROP A;  1M1H A;  4GKJ J;  2BMB A;  5LL6 d;  2F5G A;  3BV8 A;  2HRT A;  1JMT A;  5H9F J;  2E5G A;  5L9X A;  4OX9 J;  4C11 B;  2IBK A;  1CS4 B;  1HI1 A;  4WXW A;  2DNY A;  5F8H A;  1IKY A;  3QBC A;  5DLF A;  5KG3 A;  2FVQ A;  1JK9 B;  2BE9 B;  3MEK A;  2IC3 A;  3FDS A;  4OZ0 A;  4C8Y A;  2IYG A;  4QIG A;  4J91 A;  3X1L B;  3JB9 k;  4HT5 A;  5H1S V;  1FVQ A;  4A4J A;  4EZ6 A;  1SKW A;  2V50 A;  4RO0 A;  4MK8 A;  3SCK E;  2Y1J A;  4DSF A;  3QSY B;  4ED0 A;  1A0O B;  5C42 A;  2IDL A;  1LWE A;  4LSN B;  5KFV A;  2A10 A;  3K57 A;  1GXU A;  4FPI A;  2NPI A;  5LSO A;  2HKE A;  4IG3 B;  1Z2L A;  3MPY A;  4QW8 A;  3ZZO A;  5KFU A;  5KFL A;  4Z37 A;  4I0W A;  2AD9 A;  4OFZ A;  2OH2 A;  3CNQ P;  5GAG U;  2RS8 A;  2XMU A;  3ISN C;  2IRX A;  2VC0 A;  1H0H B;  5D4N A;  1TVR B;  2CQI A;  4J9V A;  3MWB A;  1HHS A;  4WCE Q;  1T0T V;  1L5U A;  4QQB A;  4URQ U;  4PKD B;  3GLJ A;  3PHT A;  3FJ2 A;  2FY1 A;  4J5O A;  1OY9 A;  4IYQ A;  4H4K C;  1KQK A;  1FRJ A;  1S1V B;  3DOK B;  5MLC V;  1TP7 A;  4DQI A;  2FD2 A;  2CJB A;  4H4M B;  5LMU F;  3I9V 9;  2I1R A;  2FPH X;  4X4O A;  3F73 A;  2WTF A;  5D0R A;  4PXE A;  4ZPC A;  4PWU A;  1G3O A;  2W7O A;  3KHG A;  3CCM S;  2KJV A;  2D3O 1;  2MEW A;  4AD6 A;  2ZE2 B;  3NWG A;  3VR1 A;  5IZH A;  1FKO A;  4DV1 J;  2XGQ A;  1WOP A;  1U8S A;  4F0H A;  2QE5 A;  3ZZZ A;  4O4R A;  5DG9 A;  4WK3 A;  2F3J A;  2AYB A;  5FDL B;  3C15 A;  1FJG F;  1SKU B;  3E51 A;  3PIO Q;  2MY8 A;  4MFB B;  2CWX A;  2NXC A;  5HSP A;  3F44 A;  5HJX A;  3HZG A;  2E9Z A;  4DZ6 A;  4DSJ A;  2V69 A;  2UXC J;  3HX9 A;  4XDD A;  5B0D A;  3UD3 P;  3NGK A;  3KHH A;  4LQ3 A;  3DLH A;  1S9E B;  3MFI A;  4ZMM A;  4IFV B;  3DOM B;  1AXQ A;  3MR7 A;  4RW8 A;  3WX4 A;  5BR8 F;  2Q6B A;  1RTH B;  1RWX B;  2K1R A;  2ZHB A;  2WOM A;  3NS7 B;  4OYM A;  2ILZ A;  4IQM A;  3M8Q A;  1KHW A;  2H65 B;  4LIR A;  3KNA A;  5L9N A;  2V4J A;  2KXH A;  3C2P A;  3IXQ A;  4JYA F;  2AP6 A;  4F4W A;  3K5M A;  1FER A;  1NZ8 A;  3DRS B;  3V6H A;  4FP9 A;  4C8M A;  2BAB A;  2EFV A;  4YQW A;  1RT3 A;  3W8P A;  2VQF F;  1I51 B;  2RJZ A;  4ID5 B;  3GZ7 A;  3DGP A;  3KLV A;  1Y10 A;  3TJ9 A;  1H2T Z;  3MM9 A;  1MSW D;  1RAG B;  1S1U B;  1NJW A;  4K4S A;  3GFZ A;  4DR3 F;  3I96 A;  3HHK A;  4IG0 B;  4FF2 A;  1DAX A;  5A8K A;  2JOQ A;  4CP5 A;  1Y3J A;  1BMQ B;  4QOT A;  2EKN A;  4Q45 A;  1U0H A;  1N36 J;  2HVZ A;  4JI1 F;  5BXI A;  2DKO B;  1IKX A;  2EEY A;  2RHS B;  1I5O B;  5ETV A;  4R0E A;  3V4I A;  4E2F B;  3PYF A;  4PXB A;  2HS0 A;  2XY5 A;  3DKD A;  3P45 B;  1U25 A;  2FY8 A;  4H4O B;  4C7Q A;  1VQ8 S;  1RTJ B;  1DLO B;  3GPA A;  3SXL A;  3SIP B;  3W8G A;  3TQ1 A;  1PJ5 A;  4I1T A;  1C0U B;  1NDC A;  2OP5 A;  4JI8 F;  1R27 B;  4JV2 A;  2BRL A;  2WVE A;  2NUU G;  1L3K A;  2J8A A;  1YJR A;  4B9V A;  1JB0 C;  1RWK B;  4CDI A;  3CJK A;  4B9U A;  5E33 A;  1T3N A;  3US5 A;  3W9I A;  3NCR A;  3ITH A;  3BSN A;  1BXN A;  1SQE A;  1CJT A;  3TRG A;  2FHJ A;  4A8Q A;  2ATL A;  5K8M A;  2XWX A;  2Z58 B;  3AD7 C;  3D9B A;  1JLA A;  5B0C A;  2EI5 A;  1T9W A;  4MAK A;  3FCV A;  4ILM A;  4KC5 A;  1LWF B;  3OT9 A;  2KFZ A;  1T02 A;  2WVB A;  3TOQ A;  3LGM A;  4JI6 F;  3NL0 A;  4ZP7 A;  7FDR A;  2CIM A;  1EHW A;  2RIJ A;  4WYL A;  3OUY A;  5KG4 A;  5LSR A;  5DDO C;  3BGO P;  4MKV A;  1RHM B;  1S9G A;  2U1A A;  4DQS A;  2KJW A;  4DCJ B;  5AXM A;  1Y3K A;  4OYB A;  1VI7 A;  3PX0 A;  1NM2 A;  2CQP A;  4J9L A;  2APO A;  3VVT A;  3D6M B;  3KUE A;  4OX9 F;  3CC7 S;  2BJ8 A;  1I1G A;  2B9W A;  4LSZ B;  3OV7 A;  2JLG A;  1RWW B;  2JEF A;  2I9S A;  4A48 A;  2W9A A;  2M2B A;  4WWS A;  1K73 T;  3RB3 A;  1P6T A;  2OPR B;  4LR9 A;  2BBE A;  1NZA A;  4TLR A;  4J9Q A;  4EI2 A;  4PG8 A;  1NH7 A;  4C0O C;  3DLL Q;  2J0Q D;  2A1B A;  3M2V A;  4XK8 C;  3Q8Q B;  4NYP A;  1JLG B;  1SC3 B;  2CPY A;  2X3D A;  3RJM B;  4DFK A;  2DIV A;  3FRZ A;  3NG8 A;  2HQI A;  5KFO A;  1DFD A;  2KFY A;  4HI1 A;  1OYD A;  3NXZ A;  3I0R B;  3H4D A;  1H73 A;  3SV4 A;  3QFW A;  1X5P A;  4CO5 A;  3MR5 A;  1S76 D;  3N4W A;  2Z2Z A;  1TAU A;  3ENW A;  4USI A;  4JI3 F;  4EO6 A;  4ECR A;  1VQS A;  4TY8 A;  5IQ6 A;  3D1H A;  5KG1 A;  5F8N A;  2R2R A;  3GE9 A;  4YB1 P;  1A7G E;  3DXB A;  4V19 J;  1T9T A;  2QT7 A;  1MRO A;  4ZLP A;  5H9E K;  1AFJ A;  4J9R A;  3AD9 C;  4I4B A;  4F67 A;  1VBY A;  1F9E B;  2BZ2 A;  2QX0 A;  1PO6 A;  3QRQ A;  3PM9 A;  1FT8 A;  2Z2L A;  3W2V B;  3IM9 A;  3H59 A;  2P6S A;  3B8H A;  5EGY A;  3VHQ A;  4F25 A;  1XNR J;  3I0S B;  3H90 A;  1HFE L;  4WFX A;  1J5E F;  1S1T A;  5CH7 B;  3C3L A;  3DRY A;  4ZIW A;  2DIT A;  4FN5 A;  1UJ5 A;  1RJJ A;  4ZVE A;  3FEX B;  2GHV C;  2R9L A;  1URN A;  1SVD A;  3EZU A;  3DNC A;  4DV1 F;  2H4W B;  2PMZ D;  4DDF A;  4K5S A;  1KWM A;  4S0M A;  3CIM A;  4JV5 J;  3SSQ A;  4ZN1 A;  2N7C A;  3F41 A;  2GMH A;  1DZ5 A;  1K44 A;  1T03 A;  1M1K T;  8ATC B;  2NXN A;  4H4K A;  2NQP A;  4M1K A;  3P4U B;  2YWG A;  3C14 B;  2HZV A;  3CUL A;  2YKQ A;  2DGX A;  3CTR A;  4ZKA A;  4J9O A;  4DX6 A;  1S97 A;  3T6J A;  1XMO F;  1KTQ A;  2UXC F;  2C2N A;  2AYG A;  2VZ9 A;  1SJ3 P;  1U4B A;  3W64 A;  1S12 A;  1VRT B;  3HHL D;  2PT0 A;  4USW A;  1FWP A;  2EXU A;  2EC2 A;  4NCB A;  2IM1 A;  1Z1Z A;  1S6P B;  4PUO B;  2VDH A;  3NOG A;  4F3Q A;  3EGV A;  2M70 A;  2J9C A;  4UOH A;  2DTJ A;  1U0H B;  4DPW A;  1OQ3 A;  4FYD A;  4K5R A;  1UJ4 A;  3H0P A;  2RF2 A;  2ZOG A;  5IC4 B;  4CLL A;  5F8I A;  4ZJQ A;  1NEE A;  2YKO A;  3R5B A;  3AD8 C;  2OIH A;  4NRU A;  1UPM B;  2H3E B;  1EJ7 L;  2GIQ A;  3OSN A;  3OFG A;  1REV B;  4TY9 A;  3GTY X;  2CJA A;  3PW5 A;  3L7P A;  4ES1 A;  4DZD A;  3OXL A;  4DLE A;  5J1P A;  4DV2 J;  4LRC A;  1TZ0 A;  4TU9 A;  1RKI A;  3OHA A;  3MEG A;  1YKW A;  5J2M A;  2PSZ A;  4IFY B;  3OLB A;  1M5H A;  1W2I A;  1OPI A;  2W4D A;  3D1Q A;  4QWC A;  1N36 F;  4RUH A;  2OML A;  4N56 A;  3V5R A;  2OPS B;  2IY5 B;  1KP6 A;  3R5A A;  5HQL A;  1HBM A;  1AA1 B;  4DR4 J;  4O3Q A;  1CJU B;  2IBO A;  1UWB B;  1AYE A;  1SH3 A;  2JL9 A;  1APS A;  5DQG A;  3WIV A;  2FHM A;  2PEH A;  4P72 A;  4PXD A;  4F02 A;  1Y5N B;  2KT3 A;  2BJE A;  4ZLJ A;  4N47 A;  2MKK A;  4FNH A;  1UET A;  2DBB A;  3VAH A;  2JSX A;  4K4X A;  1HWK A;  3JSB A;  1ZA2 B;  3MEE A;  1WKK A;  3TWZ A;  4TYB A;  3TJ8 A;  5L1K A;  1NDK A;  1IR0 A;  2WON A;  1NSQ A;  3HKZ D;  1VMB A;  2W25 A;  5HQ8 A;  3QAT A;  1HBO A;  4OZ2 A;  2VG7 A;  2RVJ A;  3AH6 A;  1N33 F;  1PJ6 A;  4RWX A;  1Q86 T;  3LP0 B;  4ED2 A;  3RUB L;  1UFW A;  1YDL A;  3ONQ A;  4M5J A;  4RW4 A;  3I5C A;  2FYX A;  4X4V A;  5K14 A;  4EYH B;  3DLB A;  4MJK A;  5DDQ C;  1HW8 A;  1NPK A;  1B7Y B;  2V68 A;  4M5K A;  2PE8 A;  4OHZ A;  1FD8 A;  4R25 A;  2P6T A;  2FLO A;  1P1T A;  2ZBQ A;  3M2U A;  1HQU B;  4PPZ A;  1ZTW A;  3TI0 A;  3VGT A;  2A6O A;  1NJX A;  4WFZ A;  1M5O C;  4TU8 A;  1KLM B;  3KFW X;  4K59 A;  2RAQ A;  2YNF A;  3OTD A;  1RWU A;  2XHC A;  4NLX A;  1HYS B;  3B4D A;  2KHD A;  1NSP A;  2PII A;  2GC8 A;  4WZM A;  1U1N A;  4TVA B;  3T5L A;  4QWB A;  4HT7 A;  3HD2 A;  1BUX A;  1QE1 A;  5KFD A;  1VIO A;  1VHF A;  1JJ2 R;  1SKR A;  4BBY A;  3DRR A;  5CZX A;  3A3N B;  2LEP A;  4CYU A;  2UUC J;  1LXJ A;  2DNO A;  2VAS A;  4PWW A;  5D4P A;  3W5X A;  1G1X A;  4PWD A;  2CPZ A;  3H5X A;  1R8P A;  1LK7 A;  1NSK L;  1IKW B;  3DOL B;  1F9F A;  1VQ9 S;  2CZ4 A;  2AGP A;  4A8K A;  3H20 A;  3RB0 A;  5KFT A;  4Q0B A;  3AQO A;  3IR7 B;  4DV7 J;  3NGU A;  3QZ7 A;  4PYA A;  4Y6I A;  3ZXW A;  2M8H A;  1T03 B;  5HMX A;  2FVP A;  1JNR B;  1KS2 A;  5GAD I;  1N52 B;  3DM2 A;  5I42 A;  1XNR F;  2MHN A;  2CJ9 A;  2HLT A;  1KQF B;  4M5D B;  2KRR A;  2FC9 A;  1UAW A;  2B7B B;  1VQP S;  3JTN A;  1MWY A;  5KFI A;  4N7T A;  2FJA B;  1VC0 A;  3KLI B;  1CC8 A;  2VB6 A;  2EWH A;  2W9B A;  1HL6 A;  4WKY A;  2Y8Y A;  1VLO A;  3LPE A;  4HL9 A;  2UVU A;  5EUH A;  4WF9 Q;  2FJX A;  5EWF A;  5ETP A;  2IFX A;  5AXK A;  3HSZ A;  4OYZ A;  4JV5 F;  4J9K A;  2FHJ D;  3NNH A;  3R7N B;  2VG6 A;  3M9O B;  2DXD A;  4CI0 B;  2O66 A;  3EDQ B;  2Q1L A;  1S0O A;  3KHR A;  2FVS A;  3BO4 A;  2GIF A;  2XG8 A;  3AB2 B;  4DMZ A;  4X64 J;  1IUJ A;  5T7L A;  4I2Q A;  4F8R A;  3CC4 S;  4DR1 J;  5KFX A;  2JLF A;  3ZZR A;  2BQU A;  2BKO A;  1MWQ A;  2JH3 A;  2I2Y A;  1U8W A;  3MEC B;  1AB8 A;  2IM2 A;  3S1T A;  3U1M A;  1ZAW A;  3GYX B;  5LOQ A;  2JFK A;  3K58 A;  3IP0 A;  1RHR B;  1RK8 A;  2C2E A;  3K89 A;  2FJD B;  1D9A A;  2XUL A;  5J2M B;  2MGZ A;  4AL7 A;  1BE4 A;  4QYZ J;  2FZC B;  4FZV A;  4F3O A;  3VAI A;  3C6T B;  2BUN A;  3ILJ A;  3VCD A;  2UUB J;  4RU9 A;  4DSK A;  2XQC A;  1QUP A;  4UOG A;  3Q8R B;  4JBC A;  1BHN A;  3SDE A;  2Y3Y A;  2DGO A;  1FRL A;  4QYR A;  3DLE B;  2C3U A;  1HR0 J;  1R31 A;  4EMD A;  5DM7 Q;  2GNK A;  1R7I A;  2DGV A;  2YKN A;  2NXE A;  1Q79 A;  4NOH A;  1TL1 A;  2VKZ G;  1KQG B;  2VUG A;  2C2M B;  5DRK A;  2UP1 A;  1YJ9 S;  3QLH B;  3DU5 A;  2CJQ A;  4Y2M A;  5IWA F;  1VRQ C;  3W9H A;  1OO0 B;  4XO0 A;  4DV2 F;  1FTR A;  5L39 A;  4WII A;  1DHM A;  5C24 A;  1QLN A;  2BXJ A;  1WEY A;  3LH2 S;  4USJ C;  4ZVG A;  1FXL A;  4TKT A;  1Q95 G;  3MOJ B;  1T95 A;  1FFS B;  4AYB D;  3DCA A;  2QL9 B;  3EMT A;  4DR4 F;  1KTV A;  1RTZ A;  3GSI A;  4AL5 A;  1H7W A;  1XER A;  1RBA A;  1YZ6 A;  1RYS A;  1WSV A;  3L7O A;  2JC1 A;  3QZ8 A;  2ZM6 J;  2EFP A;  3UN2 A;  3I32 A;  2YXL A;  1LWC B;  4Y28 C;  2WSC C;  1YBA A;  3CJ2 A;  5F0W A;  3U02 A;  1JJH A;  2W01 A;  4UTG A;  2BEF A;  3R9L A;  1TL5 A;  2AX0 A;  5DJB A;  4B3O B;  1KOH A;  3PHE A;  2H5E A;  3CW2 C;  3DHX A;  3Q22 A;  5K14 B;  2MKY A;  4QBU A;  1AUD A;  2VKR A;  1D0E A;  3UNG C;  2G0I A;  1DQ9 A;  5KT2 A;  1WI8 A;  4GRS A;  3DRP B;  4CIO A;  1S6Q B;  4I2P B;  1JXE A;  5AXL A;  4LMZ A;  1WKJ A;  1HI8 A;  2KYZ A;  2RD5 C;  4Q44 A;  4DL3 A;  1CUL A;  1Q8I A;  1FFW B;  4YFU A;  1U1R A;  4GVL A;  4LVN P;  1RAJ A;  3VGU A;  2ROE A;  1IKV B;  2FC8 A;  5HBM A;  4Q8E A;  2JEG A;  2KM8 C;  1XNQ J;  2WZ1 A;  2VPZ B;  5FJ4 A;  5BJR A;  3M8R A;  4RNH A;  3D5M A;  3RRK A;  5HQM A;  3HM9 A;  3RRG A;  4M5G A;  5JMN A;  4R5P A;  4NEZ A;  2F8M A;  3UDC A;  3MMB A;  2GML A;  2MQN A;  4ENO A;  3PKM A;  4ATN A;  3KG1 A;  3HVT B;  1JLE B;  2OLW A;  2PDA A;  1CJV B;  1I94 F;  3Q86 A;  2CQ0 A;  2CNK B;  3DRR B;  1O6X A;  3EE3 A;  2XEX A;  2LU2 A;  5KFZ A;  1N5Y A;  2NSC A;  4J9S A;  1D8Z A;  4F4Z A;  2HMI A;  1RXO B;  3VVU A;  2Y0S D;  3SZ2 A;  3W1Y C;  1SV5 A;  4MTP A;  4ZPT R;  1HQ2 A;  3I87 A;  3ZC4 A;  2FHK A;  2Y1L B;  1ZYQ A;  3NWR A;  2VV5 A;  2AQ4 A;  2DHS A;  3CD5 A;  4UQG A;  2VA2 A;  5D8H B;  2VJV A;  8AT1 B;  1U6F A;  1QDU B;  3UFC X;  2IRU A;  3MD3 A;  5A6P A;  3V81 A;  2G1D A;  2C3O A;  1HPZ B;  3HHN B;  2Y9H A;  2MLZ A;  4DG1 A;  3AJ2 A;  4WP9 A;  3OL8 A;  4DOZ A;  2MQQ A;  5DZ6 A;  3FCW A;  3UN3 A;  2HNZ A;  5F9N A;  3QT8 A;  2KT5 A;  2CQG A;  4EEY A;  2D69 A;  4NAS A;  2UUC F;  2Z56 B;  3FC9 A;  2HYI B;  5M2U A;  1T94 A;  1UL3 A;  3TZX A;  4GKK J;  3P5B P;  2XNR A;  3K8V A;  2RIL A;  4RNO A;  2HPU A;  5F3T A;  1KDN A;  1U0S A;  2G1H A;  3KOA A;  4KGM A;  4DV6 J;  3LUY A;  3CJ8 A;  5KT7 A;  4MKB A;  4CM2 A;  3Q0A A;  1WD6 A;  4LFC J;  4DWI A;  1Q16 B;  3TX8 A;  5CD4 A;  2R8H A;  4DV7 F;  2CPJ A;  4Z7C A;  2QA4 G;  1IBC B;  4QIW D;  3HP6 A;  2QO3 A;  3SQG A;  3QWU A;  1TL4 A;  1S49 A;  2V4Q A;  4MT1 A;  3GV7 B;  1WHW A;  5HP1 A;  1YIT S;  5KT5 A;  1EET A;  1FX4 A;  3G86 A;  3HJV A;  4WXO A;  2XI3 A;  4J9U E;  1HWL A;  5L1I A;  4BS2 A;  3BRE A;  3H2V E;  3EYZ A;  5JJB A;  3FFI A;  5KG6 A;  2W4C A;  4PZV A;  3TP2 A;  2CZ9 A;  3W61 A;  1Q7Y T;  3O8W A;  3GV8 B;  1PAU B;  1J5O B;  1JLF B;  1FFG B;  5HJY A;  5AE2 A;  1S4F A;  2VFV A;  2H5I B;  2M52 A;  4K8R A;  5EX3 A;  2RDJ A;  1H98 A;  4LSL A;  2DHG A;  4DU8 A;  3CJ3 A;  3FMW A;  2LEC A;  4KKO B;  2VOP A;  4BWJ A;  4PQU A;  4WIQ A;  3OTO J;  3HF5 A;  3PYD A;  1SKS A;  4K50 A;  2OHD A;  3MR3 A;  5HRO B;  3U7J A;  2PEB A;  1B4S A;  4GVB B;  3KG4 A;  3S7R A;  4M95 A;  4NLS A;  1U48 A;  4NCG B;  4X64 F;  3ISZ A;  3ILI A;  2VFS A;  5JUM A;  4G65 A;  2QG9 B;  4DR1 F;  1UVM A;  2HFO A;  3G2X A;  2YH0 A;  1IQT A;  1TKD A;  4DR6 J;  1YJT A;  4LFB J;  4G6V B;  2NYH A;  4O3O A;  3VF0 B;  3C46 A;  1XR5 A;  3TNV A;  1HWJ A;  4NLT A;  4DCP B;  3RBX A;  3GR1 A;  2ILY A;  3NNC A;  2WB4 A;  5KFE A;  5KFR A;  2ABY A;  1GEH A;  2CG8 A;  1RTI B;  2D41 A;  2QA4 S;  2UUB F;  3KK3 A;  2W8L A;  2BJ3 A;  3HFK A;  4ZJL A;  4FF4 A;  3CWJ A;  1UPP A;  3PRD A;  3DHW C;  3BQ2 A;  1NJY A;  4ZVF A;  5F8L A;  3PRV A;  1EAR A;  1M90 T;  1HR0 F;  4RNF A;  3BBF A;  2WVC A;  4EFA C;  2B8P A;  3D2W A;  2AWZ A;  5KFS A;  1NK4 A;  3PTW A;  3A8E A;  1X5S A;  3UCZ P;  3QID A;  4OV6 A;  2VG5 B;  4P2X A;  1SQG A;  2G0C A;  3BGR A;  1IJE B;  4YME A;  1EKR A;  1XMB A;  1RAD B;  2VIH A;  4F26 A;  1NHK L;  5D3G A;  3IM8 A;  5T14 A;  4C9D A;  5CQG A;  3LAN A;  1S10 A;  2CQ1 A;  5U47 A;  2W1B A;  4YY3 J;  3BQ0 A;  2CDR B;  1R0A B;  1J27 A;  5A76 A;  2LA4 A;  3I9Z A;  3I82 A;  4AXJ A;  1FJE B;  5K9F A;  1C2P A;  4CO1 A;  4OMF G;  5HBM B;  1WTB A;  3T1H J;  4K4Z A;  5KFG A;  5HVG A;  2HLU A;  2ZM6 F;  4ECX A;  3TEG A;  1L3V A;  1GFW B;  1IBL J;  4A8F A;  2BVZ A;  2F9D A;  1WWH A;  1WSR A;  2DNL A;  2QFJ A;  2DNR A;  1N48 A;  1G4C A;  1GAO A;  1RU1 A;  1SI9 A;  3IG1 B;  5I4M A;  3ENV A;  4I6W A;  3DFE A;  3MPD A;  2IAJ B;  4B9M A;  2XSF A;  3GJQ B;  3G6E S;  4OHX A;  1C0T A;  1MN7 A;  2BAN B;  3W60 A;  4O44 B;  1U2F A;  4LF4 J;  3R2D J;  2AGO A;  3QIP A;  1ZH5 A;  2A18 A;  3WZ0 A;  1QD1 A;  5CAA A;  4FBT A;  4P9S A;  5M2P A;  2AJ2 A;  1JIH A;  1TUV A;  3PJW A;  1HAR A;  4QR0 A;  3M8Y A;  3C16 B;  4DQR A;  3H5S A;  3V81 B;  1S5Z A;  3R7B B;  2QTW A;  5DS7 A;  1Q0N A;  4NLY A;  2HBY B;  5CYM B;  3MCO A;  1K8A T;  3OL6 A;  3EVM A;  2HNY B;  2E9T A;  3LTO A;  3UVJ B;  3MUT P;  4FDF A;  2CQB A;  2P5V A;  3MAA A;  4DPY A;  3M8S A;  2F4V J;  3HCX A;  2NPF A;  1R3N A;  4KHP J;  1S6O A;  3PX4 A;  2DNZ A;  5KFB A;  2E5J A;  1KBR A;  2LU1 A;  1NHU A;  5JVG Q;  2R42 A;  4ILR A;  2FZG B;  2M8D B;  2K3I A;  9RUB A;  2LQ8 A;  1LW2 B;  3CF5 Q;  1FEH A;  3R3T A;  3MOZ A;  1YRX A;  1BQM B;  3L95 X;  1E6Y A;  3OR1 A;  2MJN A;  1WG5 A;  4OX7 A;  2VBX A;  1FHT A;  2KTQ A;  4NZ7 A;  4B9N A;  2YPY A;  4C3K A;  4KH0 B;  1F3F A;  4CWB A;  2BE2 A;  1NPP A;  1C4C A;  2DEI A;  1VRU B;  4P74 A;  3TQE A;  4NWB A;  3N0V A;  3G8S A;  1RZM A;  1TFY A;  2MZT A;  1Z4U A;  2PFD A;  3BEG B;  2FHO B;  4CH1 A;  4B17 A;  1ZPV A;  3M1V B;  3D0H E;  1FK9 A;  3T1Y J;  2XNQ A;  3N9U C;  3AOD A;  1RP5 A;  3UI3 A;  5ETK A;  1WG1 A;  3CMQ A;  1SH0 A;  2KG1 A;  4X4Q A;  1QVG R;  2HRU A;  3HVW A;  1P9Y A;  4DV6 F;  3T3F A;  4A47 A;  2W24 A;  1ZPW X;  4RBT A;  3CCT A;  4LBI A;  3CCS S;  3TVZ A;  4PAB A;  1SJ1 A;  5LSL A;  2DCU B;  3NP5 A;  4LSL B;  2N3O A;  4JI7 J;  2RUS A;  3D6H B;  4ZK7 M;  2L48 A;  1ZA1 B;  3MTK A;  2N4D A;  3ET6 B;  4IH7 A;  3AY0 A;  4XIU A;  2Q43 A;  2XB2 D;  1SL2 A;  1NME B;  2B5J A;  2CDQ A;  1VBZ A;  4DFP A;  2E1C A;  1FKP B;  2Z30 B;  5F41 A;  2CPE A;  2F7V A;  2XM3 A;  1KVJ A;  1NB7 A;  2GVD B;  3PO5 A;  2FVR A;  4OZJ A;  2RQ4 A;  4XAK A;  2ZH3 A;  4IH5 A;  4FKX A;  4G1Q A;  3NBP A;  1HI0 P;  2P8I A;  5DGA A;  1UWA A;  1U1M A;  2MQ8 A;  1N5V A;  1ROF A;  1T9U A;  4U9R A;  3A4T A;  1DTQ A;  2E7W A;  1N5S A;  5E5N A;  3OXG A;  1YG0 A;  5THW A;  2ACM A;  2AX1 A;  1OMS A;  3GSD A;  1RE1 B;  2K7K A;  4U6P A;  2DNK A;  4URS A;  5CYQ B;  2IRY A;  2E5L J;  3MM7 A;  2K06 A;  3A8J A;  4NL5 A;  1UKU A;  4J9M A;  1RCO B;  3O6Q A;  5DG7 A;  1UW9 A;  1TKZ A;  2V9W A;  3MMA B;  2HZA A;  4OX6 A;  4XDC A;  2BOP A;  3GP9 A;  2I5J B;  2E66 A;  1U7L A;  2MPU A;  1YX2 A;  2LXI A;  1KFS A;  4DR6 F;  3Q24 A;  3TYT A;  4LFB F;  3IR6 B;  1YRT A;  4ECQ A;  4OQJ A;  3KK2 B;  5HLF A;  3QQC D;  2H4Y B;  3JSR A;  3NCQ A;  3BGR B;  4YB6 A;  4UZB A;  1MWZ A;  3NS5 A;  4I68 A;  1OIA A;  3TAP A;  1R0C B;  5D3G B;  4PYD A;  5DM6 Q;  3ZO7 A;  2ZH6 A;  2KVI A;  1W2B R;  2V34 A;  3D4J A;  4ELU A;  3K17 A;  3IRX A;  2LQ9 A;  5JXS A;  1X4B A;  2D3O R;  3PY8 A;  4NEY A;  2VQE J;  2LA6 A;  4LRA A;  3MF5 A;  4KQZ A;  4R0J A;  3TO8 A;  3BH7 B;  3HFZ B;  2L9N A;  4DR7 J;  2ZUG A;  4X2B A;  2XY7 A;  1NLK L;  4HDH A;  2EG2 A;  2KI2 A;  1VC5 A;  1NBE B;  3BR9 A;  4NLR A;  1T3O A;  4O4G A;  2RDI A;  2IVF B;  3Q2S C;  1NPR A;  2AJ0 A;  2OMO A;  3DGV A;  3GJS B;  4DR5 J;  1Y7P A;  4UOC A;  4RPF A;  5MAO A;  4NA1 A;  2CA9 A;  1JXL A;  5GAD U;  4A8Y A;  2V9K A;  3QPI A;  3PEJ A;  5EWE A;  3IAS 9;  2ADC A;  3GII A;  1C0T B;  1RWO B;  1S99 A;  2IIH A;  1FJC A;  1QAJ A;  1OYE A;  3H5Y A;  4ELV A;  4NZ6 A;  3CCR S;  1C1B A;  1F60 B;  1PJ7 A;  1RWP B;  5IFM A;  1NU4 A;  2ZEJ A;  3T1H F;  4J9N A;  1FE4 A;  2YVS A;  1KSP A;  3PNI A;  4NX9 A;  1ZZF A;  1S0V A;  1Q4R A;  2UU9 J;  3G8Q A;  4CLS A;  2P9E A;  2BAC A;  3NS6 A;  4YS2 A;  1VQL S;  2CQ3 A;  3B82 A;  3BSA A;  3GFY A;  1WAC A;  1TKX B;  5EHH A;  3UW1 A;  3J7Y I;  3W5Z A;  4X65 J;  3SBM A;  4M5H A;  2GQC A;  2C3P A;  2QN6 B;  4NLG A;  2VA3 A;  3VZI A;  4CLP A;  1V5V A;  1MU2 B;  4QIV A;  4NI2 B;  4CLF A;  1ARO P;  5B0A A;  2DO0 A;  3R8Y A;  2E1A A;  1VHI A;  2KH9 A;  3CE8 A;  2CRL A;  2OTL S;  1N6Q A;  3R1L A;  3ULH A;  4LF4 F;  2AV5 A;  2FLL A;  1E6V A;  4CM0 A;  1Q81 T;  1E6Y B;  1LW0 A;  1HNW J;  3R5C A;  3M7V A;  4HR2 A;  4EU0 A;  3LF0 A;  1FWK A;  4FXD A;  1B0V A;  4ICL A;  3OFF A;  3NMA A;  3OW2 R;  4HKQ A;  1GMV A;  4LR8 A;  1RT6 B;  2GX8 A;  3NRB A;  1VQO S;  4YUD A;  3KJV A;  4KPY A;  3QT6 A;  2GGP A;  2F4V F;  4XPE A;  2BE7 D;  2RUG A;  3V6D A;  4KHP F;  3KMQ A;  3CJ0 A;  1PC5 A;  3HDS A;  4C0H A;  3MM6 A;  2D7S A;  4USV A;  1TK8 A;  3OTE A;  2NXU A;  5IS2 A;  1ZAX A;  2VBY A;  3KLH B;  1X9S A;  1P1L A;  3RAX A;  1IBM J;  2MXY A;  2AZ1 A;  3PYG A;  2HIQ A;  3PG9 A;  3BJY A;  2KXF A;  3TA0 A;  2B43 A;  1ZM2 A;  1XBW A;  3UE2 A;  2DB1 A;  4MMO A;  1X9W A;  2XI2 A;  3D7S B;  1GQE A;  2M0G B;  3TA2 A;  4F4X A;  5IM0 A;  4LF6 F;  1S59 A;  1GT8 A;  1DUR A;  2B51 A;  1BD6 A;  4ZVU B;  1RT4 B;  4DL2 A;  1RHU B;  3B6B A;  4ZVQ B;  3T1Y F;  3QMQ A;  2XLI A;  1UA0 A;  4OHW A;  4G1Q B;  5D6G A;  3AOC A;  1FNO A;  2AEJ A;  3J7A 1;  2EFQ A;  4OHY A;  1JWW A;  1N88 A;  2RRN A;  3R2C J;  5HN0 A;  1FX2 A;  1JKH B;  3HHE A;  1MW7 A;  4L73 A;  5K20 B;  2YX7 A;  4FYW B;  2OFG X;  4P71 A;  2DR7 A;  4JV1 A;  5AE1 A;  4JI7 F;  1QY7 A;  2PI4 A;  3BSO A;  1VJW A;  2HS4 A;  2RS2 A;  2JX2 A;  1CJK A;  4ZPB A;  4M5N A;  3VTI A;  1KN6 A;  3QGH A;  1YQH A;  2ZD1 B;  3DYA A;  2EK6 A;  1WNE A;  2GS8 A;  4ED6 A;  3M32 B;  2BW7 A;  4QWA A;  1ZAV A;  4CTA B;  4RW6 A;  4HHH A;  2V67 A;  5LM7 E;  1RT7 B;  1V5I B;  4F3M A;  1R6Y A;  1ZOT A;  2YNI A;  4B3T J;  4AQY F;  3N5F A;  3LW5 C;  6AT1 B;  3SCJ E;  3PXG a;  1EZZ B;  1Q53 A;  5L1J A;  4KIA A;  2VFR A;  3GYG A;  1NDP A;  1PC4 A;  2CVI A;  3HT0 A;  4LIW A;  4X4R A;  1V9O A;  4F0M A;  4EBC A;  4MKA A;  4IRK A;  1H2V Z;  3LGN A;  2WK4 A;  2GA7 A;  2A6M A;  1NND A;  3WIU A;  3U27 A;  3PFE A;  3NAI A;  4LF8 J;  4ZHR B;  1SUQ B;  1OS5 A;  2J8S A;  2UUA J;  2AW0 A;  4DUY J;  3RBE A;  3VQS A;  3CCV S;  1PYT A;  2DK2 A;  4P7T A;  2MLY A;  3IS9 A;  4KGZ B;  2KL8 A;  4BWM A;  1SH2 A;  2J9D A;  1WTF A;  5H9E J;  3IBC B;  3FSI A;  3ILL A;  2I8E A;  3F0N A;  3LP2 A;  4BLG A;  3UN5 A;  5KFC A; 
#chains in the Genus database with same CATH homology
 2MEW A;  4JV5 J;  4LF4 J;  4B3T J;  3R2D J;  1HNW J;  5LMU J;  3JAM U;  1N33 J;  4KY3 A;  4DR6 J;  4DV7 J;  4X64 J;  4LFB J;  1J5E J;  2UXB J;  4DR1 J;  1I94 J;  4DV1 J;  4JYA J;  3IMQ J;  2KVQ E;  4YY3 J;  3J80 U;  4V1A k;  4JI6 J;  4DV0 J;  4DV2 J;  2HHH J;  4LF5 J;  4JI4 J;  2MQ8 A;  1XNQ J;  4GKJ J;  1XMQ J;  4DV4 J;  4KYZ A;  2VQF J;  4NEY A;  2VQE J;  2UU9 J;  4X66 J;  4RJV A;  3T1H J;  4AQY J;  3R2C J;  5IWA J;  4DUZ J;  3T1Y J;  4JI8 J;  5FLX U;  4OX9 J;  1FJG J;  4LF6 J;  4DR3 J;  4NEZ A;  4JI0 J;  1IBK J;  4DV5 J;  1IBL J;  4LF7 J;  2F4V J;  5IT9 U;  4GKK J;  4X65 J;  2UXC J;  2E5L J;  2UUB J;  1HNZ J;  4JI3 J;  4LF8 J;  4DR4 J;  4KHP J;  4JI2 J;  4DR7 J;  1N36 J;  1XNR J;  4DV3 J;  3J7A N;  3J81 U;  4B3M J;  2ZM6 J;  2UUA J;  5A2Q U;  4DUY J;  2UUC J;  4B3R J;  5AJ3 J;  1N32 J;  3D3C J;  4PWW A;  1HNX J;  4X62 J;  1IBM J;  4NXM J;  3OTO J;  1N34 J;  1HR0 J;  4JI7 J;  4DV6 J;  1XMO J;  4K0K J;  2KL8 A;  4JI1 J;  2MTL A;  4YHH J;  4NXN J;  4LFC J;  4HHU A;  5BR8 J;  5LMN J;  4LFA J;  4DR5 J;  3W1Y C;  2UXD J;  4JI5 J;  4DR2 J;  4B3S J;  4LF9 J;  5LM7 E;  3D3B J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...