1X8DA

Crystal structure of e. coli yiil protein containing l-rhamnose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
104
Chain Sequence
MIRKAFVMQVNPDAHEEYQRRHNPIWPELEAVLKSHGAHNYAIYLDKARNLLFAMVEIESEERWNAVASTDVCQRWWKYMTDVMPANPDNSPVSSELQEVFYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yiiL
publication title Structural Insights into the Monosaccharide Specificity of Escherichia coli Rhamnose Mutarotase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 28
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.32: L-rhamnose mutarotase.
pdb deposition date 2004-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05336 rhaM L-rhamnose mutarotase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x8dA01
1JWWA 5T7LA 2IYGA 2LDIA 2OD6A 1Q8BA 2RILA 1RJJA 5B0CA 2K7JA 2K7KA 2W4DA 1X0PA 1CPZA 1V3ZA 2OP5A 1N5SA 4YDXA 1VQSA 1TL5A 5T7LB 2LQBA 3FMBA 2N4CA 1KVIA 1N5QA 1N5VA 1Y3KA 2GV1A 3KNGA 2BBEA 5F0WA 5B0GA 1YRXA 1SQEA 5B0DA 2ACYA 1FEEA 2HIQA 3TOQA 3HHLD 2RU9A 3HHLC 3HX9A 4U9RA 2RMLA 3TNVA 1FVQA 2K1RB 4OJ3A 1YJUA 3QGPA 1YJVA 2KKHA 2IYIA 3HFKA 4YEAA 1GXUA 4F67A 5B09A 5B0BA 1TL4A 2GGPB 2ZDPA 1FE4A 2AW0A 3HDSA 1Q4RA 1FE0A 2QLXA 4A48A 2ROPA 2LXFA 1FD8A 2CRLA 3DCAA 3FGVA 4A4JA 2HQIA 1U7LA 2BYCA 5K9FA 3WDOA 1OQ3A 1P8GA 4QOTA 1OPZA 3K7RA 4EFAC 1X7VA 5A6WA 4A46A 3LO3A 3MCSA 4Y2MA 4ZOSA 2GFFA 4HH0A 2VV5A 2ZDOA 4Y2IA 1Q53A 2LQ9A 1CC7A 2GA7A 2XMKA 2QIFA 4NPOA 4DL0C 1Y3JA 1IUJA 4FNIA 4HL9A 4ZA1A 1AFIA 1WD6A 1YJRA 1YG0A 1W2IA 3FRYA 3BR8A 1URRA 4HI1A 1P6TA 1FVSA 2OAUA 1TUVA 4HH1A 2FHMA 3BN7A 4FNHA 2BJDA 2Q3PA 2EW9A 5F0UA 3LGNA 4Y2KA 2FTRA 3T9NA 2N7YA 2BJEA 3CJKA 4DPOA 2OD4A 1KQKA 2KT3A 2IFXA 3BM7A 3HF5A 1AFJA 2XMWA 3BB5A 3HHLA 5KAKA 1MWYA 2HLTA 1SI9A 1S6OA 2JDJA 1YJTA 2K2PA 2PGCA 3E8OA 2PD1A 1XBWA 4OJHA 2GCFA 4OJ1A 1APSA 2KT2A 1N5TA 1R6YA 1GXTA 2XMMA 3DXSX 5B0AA 2OFHX 3F44A 3MZIA 1SB6A 2W4CA 4A47A 3HHLB 3BGUA 5B0FA 3BF4A 3BDEA 5A6PA 1MWZA 1VQYA 2W4PA 5B08A 5IXUA 1JK9B 1TZ0A 2XMVA 2OMOA 1ULRA 1TR0A 1AW0A 3IWLA 2ROEA 1KVJA 2FIUA 1K0VA 2QLWA 3VTIA 4HI2A 1S6UA 2FB0A 2XMJA 3TRGA 4OIXA 2XMUA 5B0EA 1Q8LA 2AP6A 1LQ9A 2VH7A 2KYZA 4OJGA 1OQ6A 4Q2LA 3UDCA 2RSQA 1X8DA 3LGMA 2ASYA 3IWXA 2K1RA 2HFOA 1Y0HA 3KKFA 2AJ1A 2N4DA 2GO8A 4NL5A 2HLUA 3KG1A 2QYCA 2G9OA 3CJKB 4DN9A 1Y9OA 3QMQA 2OFGX 2GGPA 1QUPA 4Q2MA 2L3MA 2BUNA 2XMTA 3GZ7A 3I9ZA 1CC8A 2OKQA 2AJ0A 2ROGA 3KG0A 2HFNA 1OSDA 1FESA
chains in the Genus database with same CATH superfamily
3MPWA 4OYAA 2E5LJ 1OYDA 2CQIA 3IO1A 4IYQA 5ADZA 1X4GA 1YRUA 2B4PA 5KFEA 2WW8A 4EBDA 1N5VA 5ETTA 4B02A 3CF5Q 2CNNB 3DRSB 4RLEA 3HX9A 1TTHB 4DR4F 4WFXA 1EHWA 1VFJA 1NK9A 3MM7B 1FKPA 4L76A 1F6TA 2HRTA 2DR5A 5JXSA 2OPSB 4ZOSA 4LREA 3SFUA 4ECXA 2JEGA 3EXCX 4HKQA 1CULB 3I4PA 2UUCJ 2OPPA 5THWA 3G96A 2R7SA 3R5GA 1SKWA 3QRPA 4PUOA 5IXUA 4PYAA 1H7WA 2I6WA 1T9WA 3DC2A 4CM0A 4ICLB 4P2MA 3VHQA 2ALZA 4NYOA 3UFCX 1RISA 3TYTA 2L3MA 3UR3C 1YIJS 3QGIA 3LALA 4EYIB 2DIUA 5BYQA 2YNHA 3EE3A 3Q86A 2MZQA 3D1HA 4NASA 4CH1A 2E5GA 2YBVA 4QWCA 2B4VA 3HHLC 4CLLA 2IRYA 4PPDA 2KM8B 1C0TA 1HL6A 3V6DA 2YY3A 3HDSA 2MKKA 4ZPVR 3DM2A 5IZHA 1OQ3A 3OL7A 1SJRA 2K3IA 1ZM2A 1D9DA 5ETVA 2IRXA 1IKXA 4B9SA 1ZAWA 1T94A 1UEVA 2J0XA 2OAUA 1RT3A 5F0UA 3C16A 2Z8QA 2Z30B 3NCQA 1UWBA 4DZ6A 3DU5A 4QWAA 1REVB 1NUEA 1NDKA 2E1PA 4XPCA 3WC2A 3GFXA 1AT1B 2VPYB 1N0VC 2QEXS 2MZTA 2V6AA 3LAKA 4M5LA 4DL4A 2O67A 1VQ8S 2LXIA 1WF1A 3H5SA 3T19A 4TY8B 2LKZA 1NPRA 2IDEA 3QO9B 2J9DA 3W9HA 1IBCB 3FZ2A 4DV3F 1S99A 4DU7A 3ISZA 3A3PB 4O3SA 1SH0A 2ZBCA 3CSKA 9RUBA 5D0EA 1JLGA 2YKNB 4W92B 1TKXB 2QT7A 3MM5A 2EI5A 2HG4A 2YKQA 2DNMA 3M8QA 1HNXJ 2XY7A 4NLYA 5J1EA 3EVOA 4RUCA 2RKIB 2D9PA 3QBCA 2ZNYA 3GYNA 1HBUA 4G6VB 3MM9B 2ZE2A 3G6ES 2HZVA 5HMYA 2R2TA 4ZA1A 2BKPA 3KYLA 4GKJF 2G4BA 2KYXA 3VZIA 2DTJA 5J2MA 1N36J 1IJEB 3JAMY 1RB0A 3DI6B 3I55S 1RYSA 3WQPA 4ZDNA 1TFYA 1VK3A 3Q83A 4QQBA 2RF2A 2XLIA 4YY3F 3P5TL 3BGLA 1JLBB 1BE4A 1K0TA 3VR1A 2WOMB 1SQGA 1FT8A 3LGMA 1CJVA 2DNOA 4JI0J 1RBLA 3LOUA 2X51A 3K5LA 2EFPA 2HHUA 3HD2A 1KR4A 2V94A 1DLOA 4L75A 1LKZA 4UOGA 3A13A 2JRSA 3B8HA 1F0XA 3BREA 4CTAB 2FC8A 5KT3A 3TNVA 2DHGA 1EP4A 5D78A 2MGZA 4RPFA 3PKMA 3CJ4A 4ED3A 2DJWA 4MKYA 2GHPA 4K4UA 3U1NA 1QDUB 2P6SA 2FVSA 3QT6A 5ETRA 1HQ2A 1UVMA 4DLEA 2HGNA 4J9PA 2VBXA 4P10A 2IAJA 3KLVA 3Q0AA 2HVZA 1FHTA 3DXSX 4DV0F 5K20B 2HHHF 3IM9A 2QLBB 1YJ7A 2ZNZA 1XEZA 4ZJQA 3PR4A 2MDAA 5I3UA 3NCRA 2MZSA 4YR2A 1JLFA 1K73T 2UUAF 2GO8A 3HLUA 2OFGX 4NI2B 1QUPA 4ZLPA 1LWCA 2DCUB 2G2OA 2MHNA 4FZVA 3CDUA 3CCQS 1D3WA 2GQ2A 2DH9A 2BZ2A 4WYWA 2KJWA 3JTPA 1S1UA 2HFVA 2WRMA 1K9MT 4DG1A 4PWDB 2UVUA 1FX4A 1RUSA 3SMZA 2FVPA 3FKBA 3TAPA 1WF0A 4QR0A 3THVA 3OUYA 3QLHB 5C2CA 1R8CA 3GYXB 1S0NA 4ECVA 3SZ2A 3AB4B 1JJHA 2RJZA 2P2CB 3OV7A 2BJ9A 2EK1A 3HF5A 1N33J 3OXLA 3MGJA 5D8HB 1BQMA 3RZAA 3W2VA 5KFWA 2V2KA 1PYSB 4USJC 1S1WA 4M5DA 1WELA 5DO2A 3MR3A 1Y7PA 1P9YA 2OI2A 1X8DA 4JV5F 1RU2A 2FHJA 2P9EA 4DPUA 4M5IA 5A8KA 1UVKA 3KG1A 4ED5A 3Q23A 1NEEA 1Y4ZB 4K0KF 1C1BB 2VG6B 3AY0A 1CJUA 5KFAA 3DDKA 4KO0B 1VQLS 1S0MA 4G3IA 2ZKTA 1MMNA 2ACYA 3KLFA 4OQJA 4FDFA 4RW8A 3IMQJ 4CZCA 2ACMA 2ZH7A 4IOAQ 4ZVHA 4UUXA 3N4WA 3DCAA 4DUZF 4B9TA 1HNZJ 5AXLA 3DOKB 4OX8A 3RJMB 3IGNA 4V19J 2Q3PA 1D0EA 1RT1A 4N76A 2KFZA 1SVDA 3LP2A 3UDVA 4NCAA 3VAIA 2W9BB 2BR0A 3DOMB 2ZH4A 2VPXB 2MJNA 4KBIA 4WXOA 1RAHB 4RZRA 1GXLA 1R8BA 3KXDA 2XSJB 2AV5A 2ALYB 4DR1J 2V4RA 3RBDA 4IG0A 3HSGA 4HTJA 2NS1B 5RUBA 2RE1A 1IKYB 2EG1A 3OQ2A 1X5OA 5M2PA 4TLRA 3AOBA 3D28A 3A1YG 1GEHA 4WBFA 3PTWA 4DLGA 4ZVSB 1BWVA 3M6VA 2O1PA 1RLDA 1Y10A 2P5VA 2MSSA 2KG0A 4FYYB 1U1KA 1C4AA 3MEEA 4FBTA 5LMNJ 3R97A 5J2PA 1VRTB 4RBTA 2CPYA 4B3TF 3BN7A 1B99A 4TKTA 5DDQC 1EQ0A 5HJYA 2K2PA 4MFBA 4O4RA 3ZZZA 4ECZA 2AEJA 1H0HB 4BBYA 4W98A 1M5VC 1NXIA 3MD1A 1QTMA 4EBCA 4JBCA 5LSOA 1S79A 4C98A 3G6XA 2PMWA 3SDEA 1B3TA 5FIIA 5GAEU 4V1Ak 4DFPA 3GQCA 4ED0A 1NDCA 4DCPB 4RNMA 1RTDB 3AFGA 2Y0BB 1BQNB 2WVFA 1S1VA 1KLMB 3DYAA 3HD1A 1A0OB 3TZWA 1WKLA 3H2VE 2DGTA 1N88A 4UUWA 1R8PA 2E1AA 2E1MC 3I56S 1F3FA 1YJUA 2OJ3A 1KEKA 1X4BA 5KFLA 4DQIA 2ZH9A 3M8PA 2W2MP 2GO9A 4XTTA 3M2VB 1NSQA 2DK2A 4UOFA 3J7AN 1AFIA 2YKMA 2RUSA 1RP5A 1Y5LB 1JLQB 4LFAJ 4KHPJ 3GG1A 3TW0A 2CG4A 5B08A 4C0HA 2V9WA 1TL1B 2QGFB 5HVHA 2VOOA 3S7RA 4C8LA 3J80U 4O3QA 4C2MA 3BQ1A 4G1QA 1O0PA 1R0AA 3CCWA 3CCZA 2ZWOA 1N48A 3EGZA 3Q89A 4DV7J 4YS2A 4JB8B 2HRUA 3LW5C 4KFBA 4ZMMA 3CCUS 1WC4A 2ZKUA 1I3OB 4U8VA 3QJLA 1VHFA 1ZAXA 1NLKL 4I2QB 2ZVSA 1M1KT 3JQKA 2HHXA 1HQUA 3M6XA 4DV2F 5MLCV 4MIAA 3IR6B 4ECQA 1S9FA 1N32J 3BBBA 1RTIB 1RGVA 2DYAA 2M70A 2E9RX 3HHNB 4B3OA 5I4MA 2HQ3A 4PG8A 3BPDA 1X7VA 1RWPB 2JH3A 4HI1A 3LQVA 2YQ0A 3C14B 3M7VA 3K2YA 3MOZA 4I56A 5FD1A 2HNDA 2YWHA 4N7TA 4QPXA 2VPZB 3PW2A 3UD5A 1PJ5A 3LUYA 1I1GA 4DX6A 2XC9A 4ZLNA 4HEA9 3MPDA 3P45B 3W1YC 4RW6B 2WBRA 1SC4B 3T1HJ 4JI4F 2UXBF 4U7UD 2UV8G 1JKHB 4DMZA 2VFSA 4LMZA 4O4GB 5DJBA 3OVAA 4X84A 2AJ4A 1L5UA 1U26A 1N52B 4K4TA 4ZVGA 1Y5NB 4JI5F 4TQRA 4ZP6A 3C6UA 2VBYA 4QWEA 5KFDA 2YKPA 4CLZA 1UPPA 4HH1A 4YHHF 5DETA 2CWXA 1FFSB 1FNXH 2HNYB 4NLDA 3BQ2A 1HA1A 3QJJA 3EDRB 3EX7B 4LFCF 1S5ZA 4A8QA 2HBYB 1Q7YT 5D0HA 4OI6A 1VIXA 1WKJA 1PBAA 4I69A 3PZPA 1EIYB 4URQU 3UVJA 6AT1B 4M5NA 3CCES 1FRIA 5MAOA 1CC8A 2ZM6F 1RLCL 2CYYA 3NY0A 5IT4A 1HKAA 4PUOB 3OFHA 3BH7B 4NEYA 2W1BA 3TJAA 2F4FA 4HACA 4Q8FA 4IUFA 1YJVA 3PCOB 1U2RA 1CLFA 2OHDA 2POKA 3LP1A 3LP0A 1QAJA 5D4LA 4ZPDA 2LDYA 3NS5A 3ENQA 2YNHB 4GKKJ 1JXLA 2V5HG 4QBUA 1RT4B 1FTRA 3KJVA 2VHGA 3FSIA 5LL6d 3DRRB 3CJ0A 3E8OA 3KJFB 1HBOA 4IH7A 1P1TA 4FN5A 4A47A 3DM2B 1SV5A 2AHOB 1J27A 1JMTA 2QA2A 3RB0A 1N56A 4DSKA 2W25A 5B0EA 1IKXB 2HVDA 4I7FB 4YB6A 3BQ0A 2FYXA 3C16B 3HULA 2FZKB 1V5IB 3GB0A 1UWBB 3RW6A 1V6HA 4ZVRB 3PW4A 2UUTA 4NRUA 3Q8UA 3EJMA 2GNKA 3IRXA 1ICEB 4YFUA 3BKTA 4E2FB 2DBBA 5K8PA 3W8PA 5BXIA 3Q2TC 3G82A 2YVSA 1S6PB 3JTNA 2QLJB 2IPOB 1YQHA 4H4KC 1AUSL 2FUG9 4TXSA 1U24A 1JLGB 1HD0A 4B3RJ 3MM5B 5ETKA 3L9ZA 1QUVA 1HNIA 5H9FK 3M8QB 2HS4A 5J1EB 2D9OA 2HBRB 2UZAA 1GMWD 4ED1A 4DSLA 2W9CA 1M90T 1MMLA 1YDLA 5K8MA 1NSKL 2AJFE 3HHLB 1LW0B 4ZN3A 2WCXA 3AXMA 3PIOQ 2HAIA 1R3NA 1K1QA 2BQUA 2DNGA 2RSQA 5J2MB 1Y11A 2CJAA 4CQ1A 1YZ7A 4WTOB 4LSLA 5CYJA 1HR0J 3DRPA 3TARA 1FFGB 4OZ1A 1J5OA 2FJVA 4BC9A 5IQ6A 3GR1A 3IWNC 1FCAA 2XLKA 2FJEB 1UMJA 4N56A 4LF5J 1PYTA 4RO0A 5L9XA 3VVUA 4IRKA 3PKYA 3W65A 2WVEA 1RTHB 2W2QP 1ZH5A 2XHWA 1GX6A 1DTTB 2R8JA 2DGQA 3MEGB 4KGKA 2Q6CA 2SXLA 2UUBJ 3CJ2A 2MQMA 3V4IA 5E7OB 4MTPA 1OIAA 3E01A 5IC4B 2QSFA 4ECRA 4Z7YA 3T1AA 5L8RC 5A2QY 1EP4B 3OPKA 4C9DA 1H2TZ 1XR5A 1Q86T 1FWKA 4ID8A 3RR7A 2IY5B 2H5IB 4PG5A 3TWZA 1VS3A 3GCWP 2YXLA 3TRGA 5F8NA 2X3GA 3MWBA 2E7WA 2MKIA 2IAJB 4JYAF 3KDOA 4J9KA 4NLWA 4YN3B 1LWXA 3TX0A 4YMEA 3GR0A 4LBIA 1FTCA 3HMJG 1TKDA 1TL5A 3CCMS 2N4CA 3DKDA 5I3UB 3D2WA 3ADAC 2JL9A 1JLFB 3JAMU 2H4YB 4NLXA 1RZMA 3I0SA 5CQGA 1M5HA 5DG7A 1XMQJ 5D3GA 3KOAA 2MQLA 2BQ3A 2EFGA 4LFBJ 4QWBA 3OXGA 3B6BA 2QIFA 2DO4A 2ZBPA 4BLGA 4FF2A 3ZFVA 3HZGA 4LF2A 5AE2A 5KG6A 2VFTA 1XWLA 4BDPA 4K2JA 3D54A 4DS4A 3M4XA 2YPZA 2MEWA 5EX0A 1RWXB 2CQ2A 2V8PA 3FCHA 3BO2A 4P52A 2XMJA 4DR7F 4C11B 1Q5YA 5GMEA 2KI2A 4ELVA 3R5JB 3TO8A 4RW9B 4GVBA 2QYCA 2C2DA 2HURA 1VC5A 1VK8A 1HNWJ 1KP6A 2VKZG 3W2VB 4TNOA 2E5JA 2WBMA 3OTCA 1B7FA 1NM2A 1S1WB 5H1SV 3TJ8A 2JC1A 2HS0A 4MK7A 4PXCA 2F9JA 1PSDA 2PA8D 4KKOA 2W2OP 4OYIA 3P49B 4FYDA 1SC3B 5LOQA 3PW5A 2FJAB 1RKJA 1B64A 1JX4A 4O23A 3S1TA 5A8KB 4WIIA 3MCOA 2GVDA 4A48A 1FE0A 3TA2A 3VAHA 4MJKA 2HK3A 4KH0B 2DNZA 4ID5B 3Q8VA 3LO3A 2D3O1 1B0VA 1L3UA 3WHIA 2GS8A 3KK1B 3C2PA 4AYBD 1DY3A 3A8JA 1CEZA 1NNDA 4DUYJ 4DV6F 3HCXA 1LWFA 4RX6A 4KQZA 3CMQA 5HMXA 5BJRA 2KT5A 2AGPA 3R5CA 2DITA 2W4CA 1S77D 1IKVA 1WC6A 3MI7X 5GAGU 2WAQD 2G13A 2ZFHA 2QSWA 3H5UA 4ZVFA 1KRPA 1QTNB 4FKYA 4IDKB 5KFQA 2HVIA 2HLUA 2I5JA 2GGPA 4J9RA 1TAQA 3M2RA 4AD6A 5LJ5Y 2CUYA 3LP2B 1Q79A 4NLQA 1Q16B 3DHWC 3D1OA 4Y34A 1KTVA 4LF9J 3AOAA 3PNIA 4OMFG 3TA1A 3B82A 1EAYC 4RUHA 1U47A 1HMVB 1TV6A 3PY8A 5B0BA 4IG0B 1WWHA 4W4MA 1AROP 4A8WA 5SZTA 1I94F 3KUEA 3V2UC 2G1HA 1U1QA 3LPYA 3MURP 4DL3A 2FHMA 1HWUA 3PX0A 3TX8A 3PO5A 2UXDF 4IFYB 3AQPA 4KGVB 4U8YA 5KG1A 2IVFB 2XM3A 3F44A 3W2WB 5C24A 3MEEB 5J2PB 4FYVB 1FO1A 2FB0A 3WC0A 2C2NA 2ZH3A 1YBUA 2ABYA 3IS9A 3R1LA 4CO5A 2XCAA 1WC0A 2W24A 5KFHA 1GT8A 2XMTA 2CWKA 2VKRA 4IO9Q 2IHR1 4IG3B 4NZ6A 1ACMB 5M2UA 2VQEF 1HWJA 1NKEA 2K7JA 2FGCA 4OYZA 2K06A 2QC3A 3SDEB 2CA9A 5DG8A 2QMXA 2VBWA 1T0TV 3K5MA 2FLPA 2QLXA 4WJBA 2KTQA 3TAQA 2V0NA 1ZTTA 2GW8A 4LVNP 3C6TA 4LIRA 2RS8A 3K5OA 1GH8A 4C97A 4X65J 3H40A 2V2QA 2FLOA 3BSOA 3SCLE 3NMAA 1U8WA 1UJ5A 1RABB 1SH3A 2PGCA 2AGQA 3TR5A 3OT9A 1GAOA 3M8PB 1OYEA 2U1AA 1FRLA 1RT6B 3NS6A 2B56A 4L74A 5D4NA 2UP1A 1LNQA 1PJ7A 1DFDA 4U6PA 3KLEB 2C3OA 2BABA 1Y9OA 4PRFA 2YH1A 4S0MA 2EXUA 5CAAA 4M5GA 4UOCA 3C3LA 2OIHA 2M8DB 3VGUA 4KAIA 2MYFA 4NXNF 4ZIWA 2EFQA 2QTWA 4G1QB 1FDDA 1ITPA 4LR9A 2HHTA 2R4FA 2JWNA 2KXNB 4DSIA 2OH2A 2CQGA 1RAFB 3OTOJ 4KFBB 2C2RA 2FVCA 3UW1A 3JSYA 3B4MA 4QOTA 2KRBA 2YKOA 5HANA 3NGSA 3FUYA 4NLTA 3DGPA 3BO4A 2FHKA 1HQUB 1RT5A 2GMJA 5E41A 3S6EA 2UXCJ 5BR8J 2FVRA 4B3OB 3HHEA 5F3TA 3GIIA 2HS3A 4TU8A 4C3MA 2L48A 2CDRB 3ZC4A 2RUGA 5M2RA 3UR0A 5GAGI 1KD1T 4KGZB 2HNDB 4Q2MA 2BUNA 3I9ZA 5CZXA 2M0GB 1C1CB 5HMWA 2ZZMA 3EGVA 2FLLA 4K4WA 5K5MA 5J2NB 2MKYA 2OP5A 1VRUB 2I2YA 4DL7A 1XN9A 2NQPA 4XIUA 4PXEA 2CKWA 1NDPA 1IBMF 3FEXB 3SEOA 2YNIA 2HQIA 2D3ZA 1P8GA 1X4CA 1M5KC 3KHRA 2VG7A 2A18A 4H4MA 4OZ2A 1WOSA 1TUVA 2PSZA 5EDWA 1KFDA 2R7QA 2MSTA 3PX6A 1HBNB 4DV5F 1U1NA 1Q0NA 3OR2A 4I6WA 5A6PA 1SC1B 4WFAQ 3C6UB 3QIPB 3OFGA 4UZBA 3HKZD 5IWAJ 5G0RB 5JVHQ 3GJTB 3PM9A 1WC3A 2Y1LB 1IM6A 3PYGA 3ZTPA 3RB3A 1KNZA 5HATA 4FYWB 4PZVA 3H4BA 2IDLA 2HAFA 3G6YA 1Z4UA 3EGNA 4QYRA 1TQLA 2M2BA 1RA6A 1DTQA 2HMIA 5J2QA 4BC7A 4IKAA 4ENOA 2LYVA 1RT2A 2E1CA 2PO4A 4IOBA 3BSCA 1U7LA 2R2RA 3DLLQ 2GFFA 5D4PA 1WHVA 1R43A 1WG5A 4ETXA 3R27A 5KFTA 3VF0B 2BQRA 1VBXA 1IBKF 1YHQS 3JSBA 4DPWA 4ZK7M 2DT9A 3LP0B 3RRGA 1S76D 1U1RA 3BYPA 3PFEA 3TVKA 4I4BA 4QIWD 2OUGA 4CYUA 2YNGB 5HK4A 4RKUC 6FDRA 4M1KA 1G4CA 3UCZP 3F41A 5JJBA 3PW0A 4RUBA 4DV4F 3GIMA 2CPEA 2AX1A 1GTHA 2ZJPQ 2WB4A 5ETPA 1U4BA 1P1LA 1LV5A 1RHKB 3L09A 4FVCA 1SV5B 5B0GA 3FFIA 5GADU 4DSEA 3PJWA 2M9KA 3BN4A 2ZH6A 3T1YJ 2KKHA 8RUCA 5AJ3J 4LJMA 4WZQA 2UU9F 2CNKB 3RAMA 3RB4A 2CIMA 4OHXA 3N6MA 1T03A 2CZ9A 3Q8SB 1OY9A 2EKYA 2Z57B 5EN1A 1XNQF 1IWAA 2GQCA 1F9FA 3G82B 3H42A 3PJ9A 1AZSA 1VCTA 1KQKA 2CPHA 1DQAA 1YJ9S 1EETB 3KLHB 3MR6A 3UD4P 2V4JA 1V3SA 2CJKA 3PX4A 4DR4J 2NPFA 4I6YA 1HI8A 1PKUA 2Z2YB 1UVIA 3AB2B 3E2EA 1G3OA 3FVYA 5E2QA 2CZVC 4ZCLA 2F40A 1HNIB 3K5NA 4KHRA 2W01A 2B7BB 4K4VA 2UV8A 1T3NA 3M30A 4WK3A 5CYMB 1LOUA 2W9CB 1IXKA 4F26A 2HHVA 5DLGA 2R9LA 2LDIA 3HFVA 5F8LA 1LEOA 3JS9A 4DV1F 4LBPA 4DF8A 2BBEA 3D4JA 1KBRA 1VGYA 2HIQA 5F8MA 2AD9A 1KLNA 3CD5A 1NB2A 1WHWA 3FQKA 3DRPB 1WSRA 1PO6A 3E51A 3WDOA 1SUQA 3MMAA 2DRAA 3GE9A 3ZTQA 2XYGB 2BANA 4LQ3A 2DNPA 3L95X 1QVGR 3PJXA 3GILA 2BJEA 1MWYA 2DHAA 4KY3A 1REGX 2EBEA 2OEMA 4RU9A 3R5BA 4RBVA 2IIHA 8AT1B 4EI2A 5CH7B 3V4IB 3QQCD 1RBAA 2E7XA 2DPJA 4RNHA 3T5HA 1JLAA 1T9YA 3AXKA 3OL9A 5A8RA 3IGVA 3P4UB 5HP1A 4BWMA 2KRRA 1HQEA 4CDIA 3NP5A 3AQOA 1HNZF 3UDLA 1T8EA 4URSA 2V69A 2KXFA 2MLYA 2WB1D 4CNZA 3CW2C 1RBOB 1WI8A 3ZZUA 3HFKA 1TL3A 5GMKa 1X9WA 2L9WA 2OO4A 2VC0A 5KFOA 1PILA 4DV3J 2IC3A 4NPOA 2KN4A 1H72C 1VQ5S 4FXWA 1URRA 2BE7D 4USIA 3KLGA 2IFXA 4M5MA 2AYMA 1N5TA 4WFZA 1T9TA 5D3GB 4JI8F 4DR1F 4DFJA 2Y9HA 3W60A 4XPEA 4DS5A 3BPSP 2QA1A 2MKHA 4DXLA 3GSIA 3IC1A 1CJTA 3OLBA 3DMJB 3K59A 1FI4A 1ZOTA 3PRBA 5ITHA 3KK3B 1RWMB 4GKJJ 2CFXA 2FLNA 3MDFA 4TLQA 3KK2A 3K0JA 2KXHA 2YNFA 2Q6BA 5KT6A 2XY6A 3QAUA 2LXUA 3KHHA 4F8RA 2YKAA 2RHQB 4M63A 3D66A 2XYPB 2UVRA 2VUGA 5HN0A 2MB0B 4QZVB 4LF8F 5HJXA 2ZH5A 5A2QU 3QRRA 4JI7F 1JB0C 2K8GA 4MT1A 4ZITA 1R6VA 1U49A 3D0GE 4KKOB 4RU2A 3NMRA 3VAKA 3LGNA 5C42A 3ENAA 2FVQA 1D1UA 1S6OA 1SQFA 2HFZA 5DGAA 1OPIA 2XNQA 2GVDB 2CJ9A 1GMVA 1JK9B 1KHVA 2I38A 3Q8PB 2FJWA 3L4BC 3OSPA 4F4KA 1AA1B 3GCXP 5F8HA 3AAWB 1MMDA 2JHEA 1LWFB 5LSLA 1NZ8A 4RNFA 5KFVA 2DGSA 2M52A 3CC4S 2LEPA 3L3CA 1H6KX 2E44A 3CDEA 4P9SA 2LCWA 3J7YI 1RAOA 6FD1A 2PEBA 3BGRA 4D3GA 1UA1A 3R9LA 5C25A 4RUAA 4DV0J 3C8YA 1F9HA 4WFBQ 4ZJOA 1YRTA 1NPPA 2GGPB 3I32A 3VZHA 2V34A 1PJ6A 2PMHA 5LXRA 3PFOA 2QO3A 2XGPA 3DHXA 2BJ1A 2GX8A 3O44A 1G7CB 4ES2A 2UUAJ 1UKUA 1WEXA 2L9NA 4J9OA 2DH8A 4ED4A 4KHPF 5KG3A 4DR5F 1H2VZ 4LF7J 1ZPVA 3GLJA 5A76A 3PRDA 4OLPA 1TV6B 3M2UA 4IRCA 2XS5A 2E5IA 2DISA 4ECWA 1T05A 2NREA 4DL2A 1H98A 1B7YB 1WNEA 3OTEA 2FD2A 3KTQA 3OVBA 1FXRA 2ZITA 1E6YA 2Y1IA 1X4HA 2L9DA 1YBTA 2BOPA 5A0YA 3KHGA 2G2ZA 4CT8A 1Y0HA 1EARA 3CUNA 2QJ3A 1XQIA 3VALA 4WTYA 2XTJP 2VODA 2PFFB 1HNVB 1JLCB 2VF3A 3ZNUA 2QV6A 3MFIA 1VRQC 3WX8A 3HZEA 3NOGA 5KFIA 5C24B 4KE5A 4PWWA 4WP8A 4ZS6A 1ZBTA 2FHOB 1WG1A 1RHJB 5CYQB 3LGHA 2DVIA 1RADB 4KH1B 4Y28C 1SL1A 1GQEA 3IS9B 1ZYQA 1QAYA 1R8HA 3ETOA 1LW2B 1Q8IA 4QU7A 1S59A 2QZ8A 5IV3A 5IFMA 3M8YA 4CO0A 1DHMA 2A6MA 3PEHA 2EBGA 5KG7A 4JI2F 4K0KJ 4NRTA 2WSEC 3RTVA 4TYAA 1RWUA 4B08A 1AFJA 1H3DA 5KAKA 3G86A 1XBWA 2BE2A 1NPKA 3ET6A 3FNNA 1NKBA 3GSDA 1S1TB 4WFNQ 2YX1A 4PXDA 3HO1A 1R7IA 2R2SA 4DUZJ 2CQ4A 3QSIA 4LRBA 3R5AA 3FZBA 1OSDA 3OL8A 5F8GA 1J5EF 3G2XA 3G8QA 4OHWA 1RTJA 5H9EK 4XDCA 1Q78A 4USMA 2F5GA 5B0DA 4HHHA 1UJ6A 1KDNA 3CCSS 1NO8A 5GMDA 3VQSA 4PKDB 2RRAA 1NSAA 3TAMB 4B9LA 4HTIA 1N6QB 3CXCR 4IFVA 4RW7A 5KG2A 2V8DA 2JZ5A 4RW4A 4A8OA 1SIZA 2XZTB 5HQ8A 2ZBIA 3BB5A 3T9ZA 3OD2A 4B9MA 1CS4A 2GCFA 1NBEB 3ZZRA 4ZVEA 1R6YA 3H25A 2V8HA 2YWWA 1ZM3A 1FWPA 1QLNA 4FS2A 1B70B 3M8ZA 4M8LA 3DGPB 3T6BA 4J90A 2O3DA 3F0NA 1U2CA 2YH0A 2YPYA 2C3PA 2B9YA 2LU1A 1V3RA 2J7KA 1QE1A 3NAIA 1N5YA 2DY1A 3D6FB 4B3TJ 3C15B 3N6LA 3NEKA 5T7LA 1WKKA 3IAM9 4N41A 2MY8A 1AYEA 3M6UA 2FPHX 1RYRA 5IM0A 4GKKF 1LK7A 3IFEA 4TU7A 2E9TA 2L08A 2RQMA 1BLUA 2XY5A 4WCEQ 3QGHA 1U25A 5I3QA 2DRBA 3DLHA 2OGUA 1OPZA 4WP3A 3OTDA 4ZPCA 4FF1A 3HM9A 2B7CB 1NDLA 2QFIA 1HYSA 2HBZB 5DG9A 4XAKA 4CLUA 4PEOA 3FC9A 2AU0A 2OTJS 2IRUA 3S8SA 1UCNA 5A8WB 4NA3A 2Q43A 1QD1A 1ULRA 3MMCA 2HEKA 2VG7B 2R7TA 4H4MB 2IVMA 4CLKA 1QM9A 4DX7A 3QFHA 5DLFA 1RA7A 4RWXA 1U48A 3R2DJ 3QT8A 4O0NA 1XR6A 1S12A 3OR2B 1CPZA 1N5SA 3DRSA 1F5AA 4X62F 3SCIE 8ATCB 1X4DA 1OSCA 1X31C 2X1FA 3TUJC 1UVJA 5GVQA 1Y5IB 3LANA 1LWEB 3RAQA 3IRWP 1MSWD 2ROPA 2OPSA 2RS2A 3GWCA 4F2RA 3RAXA 3VCDA 2DHXA 3JQMA 4Y2IA 2LU2A 1M1GA 3JXOA 3P96A 1CULA 4O0IA 3A4TA 2BJDA 4F3MA 1DTQB 4N8NA 2PI4A 5J2QB 3BM7A 1JNRB 4DV2J 1M5PC 1RT2B 2W8KA 2DR8A 2YWGA 1TZ0A 2VJVA 3UN3A 3R8YA 4UTGA 4AXJA 2VH7A 5KFUA 2QFJA 2OPRB 2RT3A 4USTA 1IBLJ 1VHIA 5FDLA 2ZHBA 4HLBA 4WE1A 5KFBA 3I0RA 1F2GA 4YR3A 1X4AA 3GFYA 4TYBA 4USUA 2J9EA 3KMQA 2VFUA 1Y3KA 3WZ0A 4CYUB 2LEAA 2R8IA 3BYRA 1WTFA 2BW7A 1S1XA 3U1MA 3QGPA 3U27A 4B3MF 4N5SA 4FBUA 3RBZA 3ICLA 5JMNA 2ZHAA 2MXYA 3A8EA 2P9CA 2AYEA 1S9GA 2A10A 3JQJA 1YG0A 4BWJA 4G65A 4ZPAA 4JI4J 3FBBA 2UXBJ 1KS2A 3AA8A 3SXLA 4EK2A 4LIWA 5KFRA 3SI8A 4ILMA 2FQQB 3LA0A 1F5BA 2O01C 2AZ1A 2MZ1A 4UW2A 4TY8A 1F9EB 2HWTA 4K7QA 2FIUA 2QG9B 1TMMA 3CT9A 7AT1B 4X64F 1JXEA 2HZAA 4JI5J 3R7SB 1AZSB 1U1LA 3GZ7A 4AL5A 4KHMA 5KFGA 2E29A 2YKNA 2KU7A 2IYGA 4YHHJ 1TKXA 4K5RA 1WC5A 4X4PA 3VAGA 5KG0A 4CLPA 2R8GA 3HHLD 4LFCJ 4GVLA 4LSNB 4LFBF 4OJ3A 2BKOA 3MXHP 3VVTA 4KYZA 3MM9A 2CJYB 4Q0BA 1XTZA 2DIVA 2R7XA 3OLAA 3M9NB 3H7HB 2GZOA 4J9LA 2H4WB 1Q95G 4HH0A 3GFHA 3DI6A 1S97A 1UA0A 2Y0SD 3AD9C 3HPOA 2J7WA 2XYHB 3HT0A 4F50A 4Y6IA 2VL1A 2G0IA 1SB6A 3CCJS 2W4PA 1SUQB 4EU0A 2QMWA 2BANB 3H0PA 4WU3A 4G1PA 1OQ6A 4K4XA 3HJVA 4BHQA 2MLXA 2GVZA 2WSCC 4I2PB 3CCLS 4CTAA 3QJPA 2COLA 4WPAA 4F3OA 4N8OA 1TP7A 2A2CA 2BW2A 1SL2A 2OPQB 3BH6B 1RHMB 5CCMA 4U9RA 3CDWA 1FJGF 5IT9Y 4ZN1A 4QIVA 1JLAB 4PPZA 4ZVOB 3MECA 4OZJA 3M8SA 1BXNA 3ZNJ1 1CQMA 3CE8A 5ETLA 5HP1B 2RIJA 3A8IA 5A6WA 2R7VA 2A3JA 2J8AA 3UN5A 1HQEB 2K3KA 2PIIA 3CJTA 2ZJRQ 3ZZOA 2EEYA 5D77A 1S7HA 1JLEA 3CIZA 1HD1A 5HVGA 4KV8A 3NL0A 2DEIA 4DCOB 4K50A 3US5A 2BV3A 3LH2S 4ED8A 1HARA 1YJTA 4IR9A 4K2XA 1MLAA 3DOLB 1S57A 2CPFA 4Z37A 4F7VA 2RQCA 4B3SF 4UQTA 1FDAA 1X9SA 2OSRA 1UL3A 2IC3B 5KT5A 2WTFA 3AODA 3TZZA 3CTRA 4NI2A 2KL8A 1RQ0A 1GK8A 2PE8A 1A6LA 2CPJA 3OSNA 1FK9B 1MNEA 1TKZB 1VQSA 2RDIA 4WWSA 2HFUA 1NJWA 2FC9A 1FEHA 2HNZA 2IM0A 5LMUJ 4OZ0A 3NNAA 1W25A 5H9FJ 2EFOA 4ANDA 2XI3A 2RNEA 3CEDA 2W9AA 3KK2B 1UVNA 4ERDA 4FPRA 4DR3F 2V68A 4KGMA 4IQXA 2C2OB 1W2BR 2JJ4D 1CBKA 3NGTA 3MM8A 1VQMS 2AGOA 1TL7A 2KZMA 1KQFB 4OJHA 2DR6A 5DDOC 4OLOA 1HWKA 5DM6Q 3GG0A 2XMMA 2H3EB 2KFNA 4OL8A 2FHJD 1E6VA 3SQGA 2XMVA 3RRKA 3CD6S 2HWHA 5ETOA 3GMGA 3ZTOA 2R7RA 3PHTA 1DRZA 2AZ3A 5F8IA 1RK8A 4NL5A 1U09A 4GMKA 5C42B 1C1BA 2VG6A 5SUHA 4GC7A 4USKA 3MCNA 2F8HA 4J5OA 4L72B 4KO0A 1K47A 5DDPC 3U02A 2GJ2A 1Q8BA 2C42A 1KTQA 4X4NA 1VQKS 1VI7A 3Q24A 3H5YA 1CQNA 1NH7A 4E8UA 4X66F 2IA0A 4U7UK 3W63A 2MQOA 2YX4A 2MTLA 3PEJA 2VU5A 3DOKA 4EUVA 2ASJA 4F0MA 4JYAJ 3BGRB 2JLEA 1IUJA 2R7WA 5C25B 1X9MA 3SBMA 3LWLA 4H54A 3TJ9A 2XO6A 4WXWA 4MK8A 5AE3A 3JYTA 3TI0A 3QGGA 4WK1A 1YVFA 3DOMA 4R8UB 2W7AA 1FD2A 3ZZPA 2XSJA 3D7SB 4QW9A 3CJ8A 1IR2A 1I5OB 2GIQA 2APOA 1A7GE 3QAEA 1DURA 1IKYA 3OVSA 1IWGA 2F8EX 3M2UB 3HVTB 1T05B 1RWWB 2ASDA 5B7WA 3OTOF 1U0HA 3KNGA 1SJFA 2YWKA 2RU9A 4LF6F 3KLIB 4J9UE 1U45A 2FDNA 3AD8C 3H5XA 4ZHRB 4DR7J 2ZDPA 2C1EB 1KC8T 2PEHA 3VQTA 1VRTA 1FKAF 3OBIA 3NBPA 5LSRA 5LT5A 1IKWB 2CQBA 4PABA 4H4OB 2XNRA 3TP2A 3D3BJ 2HVEA 2EPIA 3HVWA 2HQCA 3D67A 3RRHA 1IJFB 2QMUB 2AQ4A 2FZGB 2HHQA 3G8TA 4C4WA 4WP9A 4XO0A 4PG6A 3DRYA 3KJQB 2ZOGA 4DQPA 1JJCB 1RTDA 1VMBA 2CQ3A 2D41A 1BQNA 3RW7A 1KLMA 4O3RA 4NXMF 1M5SA 1T9VA 2VICA 4CCHA 2NXNA 4MIWA 2BE2B 4DV6J 2XQCA 5KFCA 4PQUB 3G71S 1TU0B 1TKTA 4B17A 2DKOB 3WIUA 1VC6A 4ZIVA 4QJVA 2ZZTA 4L6V3 4QU6A 3W5YA 3KUHA 2F4VF 2Y8YA 1NJYA 4J7CA 2GHVC 1WOPA 4X4UA 4DDFA 1S9EB 1HBMA 5KFMA 1RTJB 2Y1JA 3PV8A 5DQGA 2JVOA 4HL9A 2V8VA 1C0UA 3C19A 4RL1A 2G1DA 1KONA 1RCXB 3MFHA 1SBRA 1XK8A 3C66A 5CZVA 3A8KA 3AJDA 5B0AA 2D7SA 2NSBA 2A2DA 4NOHA 1FJEB 3KHLA 4GC6A 1VBKA 2V9KA 2IMWP 1BUXA 1OO0B 2XEXA 1NK6A 4F3QA 2XMUA 4IFVB 4RW7B 2ZWPA 3BV8A 2HFOA 4RW4B 4NA2A 4P2SA 1I94J 1F60B 1HWIA 3CGIA 5E3QA 2ROGA 3KG0A 2HFNA 4I2QA 3IBWA 3FQLA 3VAFA 3CD0A 2UXDJ 2BMBA 1I51B 4P73A 4YDXA 2KB2A 2VQFF 4YOEA 2BVZA 2KHDA 2VBZA 4YB7A 1X0FA 1QE1B 3PHEA 2OMLA 2AW0A 5LXYA 4JI1F 1UFKA 3CCVS 3FGVA 4UQGA 2KZZA 3K7RA 2X1BA 2EG2A 1FKPB 3C14A 3V81A 1NHKL 2HHPA 3BBFA 1N54B 1VBZA 5IM0B 2VQEJ 3EDQB 5HLFA 4Z2XA 2M3DA 2KH9A 2CPXA 1JXVA 3I9V9 4QYZK 1N34J 4MK9A 2OPPB 3ONQA 4K59A 1TR0A 2EKNA 1SJ3P 1YJWS 1CVJA 4C0OC 3BEGB 3WBZA 1DBDA 4DL6A 4C7QA 1HYSB 2BJ3A 4RNNA 4ZPWR 4RW6A 4DN9A 4DCJB 2ZOMA 1MW7A 4B9VA 4M5JA 5C2GA 3MR7A 3MM6A 3NWGA 3MMBA 4JI3F 3G9CA 1JKHA 3T1YF 5HSPA 1KSPA 1RHUB 5AJ3F 2LFVA 2U2FA 2VZ9A 2ATLA 4ELTA 1YLXA 1FEEA 2AJ2A 3W9JA 2F63A 2VB6A 3EICA 1M0SA 2IYIA 1WG4A 2BOAA 2DXDA 3OW2R 3TEGA 3IM8A 2GAHC 4OI1A 1C0TB 2BYCA 3V6DB 4PYDA 2OSQA 4ALZA 1RCOB 4AQYF 4NYZA 4MH8A 3L7OA 1HLWA 4AUKA 1C4CA 2VG5A 3EZUA 2EW9A 3K8VA 2M8HA 2HNYA 3J7Z5 1Q7LB 2CJQA 4DR6F 1SH2A 2B43A 4IH6A 1RT3B 4C48A 2Z2LA 4NXNJ 3N6NA 7FDRA 4N47A 2QLWA 2WONA 4NEZA 1YTYA 5ETNA 2IVYA 4OZ3A 1G6BA 3CJ5A 2HPUA 3POTA 5IV4A 3MMJA 4DR2F 2ADCA 2VPWB 2B8PA 1RT7A 4MYTA 3PXGa 4E0DA 2XCPA 2O5DA 4YB1P 3IP0A 4IQMA 5IT0A 2RD5C 2E7VA 4KT0C 4LRDA 2D1CA 3D0HE 1FRXA 1SIWB 1ELOA 2BE9B 2XZDB 5FDLB 2ZOFA 7FD1A 4WE1B 2LXFA 5F9NA 3I0RB 4Q7AA 1RT4A 2XS2A 2BM1A 2DNHA 4DPYA 1HBUB 4NZ0A 4P74A 1RHRB 4LT6A 3DRRA 3R5DA 2ZE2B 3MEKA 1S1XB 2N3LA 1D9AA 1PAUB 2KT3A 1YZ6A 2Z0GA 4CLYA 1VLOA 3MUMP 5D0RA 4F25A 1P27B 2RF2B 1WC1A 4LF1A 3TQEA 5D15A 1S9GB 4I7FA 4GO5X 2F1FA 1IBMJ 4C3KA 1XNRF 3ILIA 2NPIA 1ZM9A 4J37A 4ZCIA 3D1QA 3MAAA 3BDPA 4KSEB 2JFDA 1CJVB 2DB1A 1SJ1A 3IN5A 3DLBA 3D5MA 1YX2A 4OHYA 4DHVA 4DV5J 1DLOB 3J7ZT 2KVQE 2Z58B 1T9XA 3LAMA 1S6PA 2XI2A 3BS9A 2RMLA 1TUGB 2AF6A 3N01A 3UI3A 2VONA 1EQMA 2MGZB 1IVZA 4HDHA 4ECSA 1SKUB 2MHEA 1UAWA 2MKJA 1Y3JA 2Q66A 3CWJA 3J81Y 2EK6A 1BMQB 3CO9A 1LK5A 3HHLA 1SI9A 1LW0A 4ED7A 4Q8EA 4Q0BB 2NZCA 2BRLA 4URGA 1MWZA 2H54B 1FDNA 4KB7A 4V19X 2J9CA 2AEFA 5ETSA 2P6TA 4F4YA 2B8QA 4YP3A 3OFEA 2GIRA 1UW9A 2CJXB 5KFNA 3Q22A 3GV7B 3SSQA 1LWCB 2BA9A 3MF5A 4P2XA 9ATCB 1IBKJ 3TUPA 4BCAA 3K5PA 1U0SA 3NGDA 2HBQB 1RTHA 4OZNA 5KT2A 2WHOA 3BGFA 5AT1B 5KFYA 3ZXWA 2CNOB 3FEYB 1DTTA 3H4DA 2GVZB 1S1UB 3ILOA 3KUGA 3MEGA 3UNYA 3D3CJ 5B09A 3KWMA 4DG1B 4NLRA 4A8FA 2NUUG 2XWXA 3CDBA 4EGLA 3PYFA 3GONA 4DV4J 4AL6A 1SL0A 4LRCA 5KT7A 3DNCA 2XZWA 4EBEA 1PIEA 2DHSA 3OUYB 1HI0P 2VDHA 3BR8A 3HVRA 4C8ZA 3EPGA 4PG7A 3T9NA 1NB7A 3CJKA 1KQGB 2XB2D 3D0IE 1RI7A 5DQHA 2Q1LA 3MECB 4CP5A 2F3JA 4ZCMA 4DOZA 1VC0A 5HVFA 4CO4A 1BQMB 1VQOS 2UU9J 2A0FB 3MPVA 4ZP7A 4OIXA 4M5DB 4LUBA 4UY85 3B54A 4Q2LA 1JLEB 5AXMA 4LRAA 3HT3A 2XS7A 4KV8B 1OWXA 3TZXA 4X4RA 1ZA1B 1R31A 1XNQJ 4U67Q 3HHDA 2RAQA 2P8IA 4FS1A 1PC5A 4HHUA 2UUWA 5F9LA 4O3PA 1BD6A 2CQ1A 4NCGA 1CJUB 2EWHA 4F02A 3DLKA 1RKIA 1FDBA 2BJ8A 3I31A 2HW3A 3KLFB 4LF7F 1PAEX 4RW8B 1ZAVA 5KOWA 2WSFC 3JSRA 1N8RT 4OZLA 4DX8H 4NLVA 4X4TA 4E98A 4CNYA 4KPYA 3UCGA 4DV1J 2M7SA 3IR7B 3N28A 5DM7Q 2HNZB 2I1RA 4GRSA 3F73A 3ZZTA 1RT1B 3W7BA 4LF4F 5D6GA 1B0PA 2DPIA 1JIHA 4DI6A 2HHSA 4C11A 2EC0A 1ZETA 1K0VA 1T11A 4RW9A 4YDDB 3P3DA 3V5RA 4PCQA 5DGBA 1EX8A 4AL7A 4XK8C 3KDNA 2Z4PA 3MM8B 4X4SA 5E3PA 1MU2A 1U6ZA 5IT9U 1TL7B 1RWNB 3GV8B 4CI0B 4FVMA 2AIRB 2DNKA 4ES1A 4OX9F 1FRJA 3ZTRA 1UWAA 1UZDA 3THPA 4YR0A 2WW4A 4EZ9A 1LXJA 1E6VB 3IAS9 3SQGB 2MPUA 1GMUA 1G1XA 2Z56B 1DQ8A 5HO4A 5F41A 3TQ1A 3MHYA 3JB9k 1QSYA 4ID5A 4LSZB 3WX4A 2ZC3A 3KK1A 3MCMA 4UY8T 3MUTP 5EGYA 4JI6F 2JLFA 5GAHU 1M5OC 4CLSA 2YQ3A 1ZZFA 2PC6A 3M32A 4FP9A 3RG6A 2DXFA 2B6AA 4ZP9A 4OZ5A 2CQDA 2HGLA 4MFBB 3W64A 4IDKA 1JNZB 2ZBRA 2QN6B 1HHTP 2V2VA 3LPEA 3RYLA 4X4OA 1HIYA 1CJKA 3K58A 2G0JA 3J7A1 4B9UA 4J9NA 3JYTB 1RSCA 1FESA 2RILA 1NK5A 1TFWA 4NE9C 4P71A 3DYAB 2MKCA 1S1VB 2RH3A 2EFNA 1HMVA 2DXEA 2GHWA 5HAOA 2NXEA 4NLPA 2XLJA 3GIKA 2D74B 3HHKA 1UP1A 1OMSA 4JI8J 2ZEJA 4HT5A 2JVRA 1U6BA 1RU1A 4YEAA 2B4OA 1TL4A 1Z1ZA 4MKVA 2HYIB 3O3LA 1L3SA 3NWRA 4OHVA 3NOCA 2M4MA 2JFKA 3UO0A 1NU4A 1LXNA 3QSYB 4NLSA 4K4SA 1U0HB 4Z7CA 4IFYA 4DPXA 2NCKL 2E5LF 1TK5A 1QSSA 1WDDA 4ANEA 2YWEA 3BGOP 4TVAB 3W2WA 1KVKA 4AFFA 4YQWA 2YKMB 4JUZA 4USHA 1UW4A 2BX6A 2DGVA 1NZAA 3LWMA 4LF8J 4CRJA 4ZP8A 3NBPB 4R25A 4JI7J 1CG2A 2AP6A 4F4AA 2DD8S 1WI6A 3ENVA 4MKBA 4IG3A 3PYDA 3O5TB 4Y65A 1R0AB 1KHWA 1RWOB 2DNLA 3RBXA 4J9QA 1D8YA 1BY9A 3U7JA 2HVHA 2UUCF 1N5QA 1YITS 2D69A 3GV5B 3OFFA 4OYMA 3SFGA 3VAMA 1RAIB 4USWA 2CRLA 2D3OR 4WZMA 5E0OA 4MAKA 5EWGA 3M1VA 2MQNA 1TKTB 2NXJA 1PGZA 2XMKA 4IOCQ 1PYOB 4WF9Q 3OR1A 4IO1A 2Z2MA 4DQQA 3VAJA 1FVSA 4MMOA 3CCRS 1NK0A 4CM2A 3QIDA 1QY7A 4CO3A 1V5VA 1WF2A 3V4MA 3M9OB 2WVBA 2RVJA 1RT6A 5FLXY 2KVIA 3CD7A 1HBMB 3IWLA 1BC6A 1VQNS 3KLEA 2B9EA 4F2SA 1C0UB 4MIBA 2DGOA 5E3RA 3CB4A 4L3NA 4DR5J 4K8RA 4DF4A 2W7OA 4LVOP 4HVZA 3ITHA 2CJBA 5HL7Q 2YTCA 1JJ4A 4KGXB 1FX2A 1EJ7L 3D9BA 3JSMA 4OI4A 3I6PA 1S72S 1W26A 3R2CJ 3ENWA 3DU6A 2PFDA 2HGMA 2XG8A 3KJNB 4WU2A 1OY6A 1HI1A 4Y2MA 2QRRA 1Q53A 4C3LA 1XMOJ 2EC2A 3D6MB 5C5JA 1WJ9A 2UVVA 2ZD1A 3NAHA 1WEZA 5GAHI 1IBLF 4ZVTB 1HNXF 4P7VA 1VQYA 1RWKB 2C2EA 3EXYA 1M1HA 1X60A 3V81B 4I64A 3OHAA 3OJSA 1AB8A 1JJ2R 1TELA 1C1CA 3KKFA 5IC6B 2KHCA 3MEDA 5HLFB 3I82A 3TZYA 3UVJB 5J2NA 4JI2J 4OX6A 2VFRA 5L1JA 2DNNA 2X3DA 1N36F 3K57A 3UN2A 3HVAA 3UE2A 1VRUA 2ZUAA 1YGYA 3AD7C 3DLGA 3FMBA 2H51B 3HSDA 2CPZA 4U95A 1D9FA 2LA4A 4HACB 3MM6B 2MY7A 3MMBB 4KJIA 2V8GA 3T6JA 2BRKA 4O44A 2E1RA 3LP1B 4JI0F 3KNAA 1IQTA 2J6TA 1HBNA 3CC2S 1J5EJ 2XBPA 1K1SA 5D4OA 4CO2A 2ZZNA 3KJVB 5JUMA 1QAIA 4U7CA 3HXMA 4D3HA 2CVIA 1GXTA 1NRKA 2FJXA 3KG4A 1WEYA 3QRQA 3HI9A 1HBOB 3QIPA 2R8HA 1Q8KA 5G0RA 4QR1A 3GU0A 2BM0A 3QFWA 3M9MB 2VG5B 2W8LA 2K1RA 5H9EJ 1P9QC 3NCPA 2NYIA 1FXDA 1TAUA 1QSLA 4FXVA 3BO3A 3EZOA 5E5NA 5CA5A 3QWPA 1VR6A 3NGRA 1AUDA 2WONB 3IRXB 4P7TA 3I5BA 3POTB 3CCTA 1GX5A 3NNHA 1Q82T 3AA9A 2JEFA 2C28A 1VQ7S 5IQQA 4PXBA 1RT7B 5GAEI 4OI0A 4DU8A 2QA4S 3NXZA 1Q81T 1VYAA 5CHCB 3OL6A 4FNHA 1XR7A 1UZHA 2J9DE 4ANCA 3J7YU 5L1KA 2AYGA 1FJCA 2YNGA 4I6AA 1TVRA 1GMWA 4J9VA 4TY9A 2VIHA 1MROA 4OV1A 2MQPA 3QZ8A 4J91A 2I0XA 2CDQA 5KT4A 4UZCA 2IMOA 5CXTA 2QYGA 4DUTA 4X4QA 1DZ5A 4LSLB 2NR0A 2OLWA 2NUHA 4Q44A 2AKWB 2IM1A 1J5OB 2ZVIA 1N33F 3A12A 3BKFA 5AE1A 1FERA 1IN0A 1EZZB 1A9NB 5KFKA 3QPIA 5I42A 3MAAB 1S49A 2FGOA 3CNQP 3P6YC 2NXUA 3FDSA 1RE1B 3FBEA 2JOQA 2HRYA 5K14A 3CJSA 2EVZA 4RBUA 1W2IA 3UPFA 1EETA 3KLHA 2B5JA 4LQ9A 4X62J 4FKXA 3E01B 4C8OA 2KT2A 1Q5VA 1Z2ZA 4Y3CA 1MWQA 3MAHA 4QW8A 2W2NP 1O5JA 3PVXA 2C22A 1G2EA 2KYZA 3R7BB 3DDNA 5CYMA 5HQMA 2QL7B 3V6KA 2C3UA 4PQAA 3E3XA 5LMUF 2ADBA 1MN9A 1RXOB 2AT1B 3AOCA 2VJUA 4NLUA 2VA3A 4NA1A 2J0QD 3DLEA 1N4LA 3P5BP 1NK7A 3KFWX 2JEJA 1FXLA 1VQPS 4DX5A 1LFPA 1H2UX 2BJ7A 4I0WA 3EZ5A 4O3NA 2DH7A 1OY8A 3L7UA 3L7PA 4DEZA 3I0SB 2IM3A 3MD3A 2NLWA 3RUBL 3GJRB 3EGWB 2D3UA 2GMLA 5E3AA 2DNRA 3DGVA 3ZO7A 4NLGA 5ETQA 3OTBA 4Y2AA 1KOHA 1WUUA 4QR2A 1IQZA 1U1MA 2DY9A 3QZ7A 4A8KA 3BGUA 2FJDB 4PAAA 4C6AA 4B3MJ 3GIRA 4H4KA 2WVCA 5KG5A 2J6UA 5EUHA 3RU0A 1R0BG 2X1GA 4YY3J 3CJKB 1HHSA 2Y3YA 3HKWA 5LMNF 4DFKA 2OELA 4Y00A 4GVBB 4C8KA 3R3TA 3W62A 1X4EA 4C0BA 4ZJLA 4JV1A 5DZ6A 3NS7B 3AHPA 2ZH8A 2QL5B 4PWUA 1BHNA 2OEJA 4DZDA 3IA0A 2HSEB 1FVQA 1Z2LA 3IBFB 3J81U 4WIQA 3I87A 4X64J 2HZCA 4OYOA 4ITSA 3N5BA 1XERA 2F8MA 4ZCKA 3S01A 2LVWA 5DRKA 4NCGB 3FBCA 5EX3A 1URNA 4AE5A 3DLKB 3HSJA 3UD3P 2FTRA 3NKYA 2N7YA 1GTEA 4HR2A 4CH0S 2DO0A 1EKSA 4CH7A 5EWEA 1X4FA 2I8EA 3QWUA 4M5HA 3BDEA 5IS2A 2OMOA 5HQLA 1H38A 2ZUGA 1IKVB 1NK8A 1U02A 1VISA 3DMJA 1NK4A 3K89A 3KK3A 3B4DA 1DJ0A 1W7WA 4DFMA 2HHHJ 3K8WA 3O1LA 1YWXA 3GYGA 1S6QA 5HROA 2I5JB 3M2RB 4OV6A 5I3PA 1KWMA 1JQGA 4F0KA 1U1PA 4LR8A 1HHQA 1SQEA 4LFAF 4DBQA 4P2FA 2N82B 3IXQA 1MU2B 1ZA2B 1Q4RA 3GPAA 3CC7S 4NMLA 4HYKA 4M95A 2BXJA 2JEIA 2H65B 4A46A 5KFFA 4IRDA 4OI3A 4CLFA 4DV7F 4FNIA 2RDDA 4F36A 2DGUA 3QATA 2LP4A 3DDIA 2OD4A 1FKOA 2FY8A 1RWVB 2G0CA 2PD1A 2MZRA 1NCLA 3ETMA 2J76E 5DS7A 2F7VA 1F1BB 1FJGJ 1N32F 3CIMA 1KVJA 1NH8A 3RBEA 3VTIA 3FSXA 1Q8LA 1ZM4A 3HFZB 1SJ4P 1ZPWX 2CPIA 3M32B 4QIGA 1S10A 1DAXA 3R7NB 2B6AB 2RHSB 4HDGA 4TQSA 1SC6A 3W5XA 2XSFA 2K7KA 1UJ4A 1PCAA 1X0PA 4JV5J 1O8BA 1VQ6S 4CO1A 3CJRA 2X7IA 1KKHA 4B3SJ 4ZPBA 1CJKB 2CZ4A 4QCLA 2KJVA 1HPZA 4CLWA 3A3OB 4C8YA 2GAGC 2J0SD 1FJ7A 4EEYA 2LQ9A 3C6TB 3KMSA 4ILRA 3T1HF 2MQQA 2CQPA 3FCWA 1S0OA 2R42A 5FJ4A 4EYHB 4R0JA 4ZKAA 4RJVA 2XMAA 1OS5A 5HBMA 1DQ9A 1LQ9A 1DARA 4DJBA 2W2PP 4DR3J 1JLCA 1HNVA 3AJ1A 3ULHA 2UVWA 3EWGA 2ATCB 3QMQA 2GJIA 4OYPA 2HKEA 1R89A 2RRBA 1WDTA 3NG8A 1BQXA 2AYBA 2AEMA 3DXBA 5CYQA 3ILJA 1KVIA 1J2VA 2B9XA 5DDRC 3FJ2A 1RAJA 3BJYA 2DHHA 4YUDA 2V4QA 1NJZA 1CSJA 1LW2A 3Q8QB 2GMHA 2YWFA 2DR9A 3O6QA 5KOXA 4R5PA 5F3ZA 2IA6A 3AT1B 3BSAA 1SJQA 3U1LA 4EO8A 1NKCA 2GA7A 1N34F 5L46A 2YQ1A 4OYBA 5JVGQ 2QA4G 3RGIA 4K4ZA 1S1TA 1RT5B 2JDJA 3FMWA 2C3YA 4X66J 4A8XA 5CD4H 3MZIA 5L38A 4DQSA 5B0FA 1FFWB 1VJWA 4AT1B 4NWBA 3R1HA 1BWEA 2N3OA 2H5JB 3M1VB 4L3KA 4WKYA 3MTJA 3OR1B 3FBFA 1NHUA 2KFYA 1XMBA 1WHYA 4FF4A 3QT5A 1QAXA 1XIQA 2HK2A 2R7OA 2OKQA 4Y2CA 4USVA 2OD6A 2J7UA 2H5EA 2O66A 1V3ZA 3IG1A 1HW8A 4F0HA 1RDRA 3HSZA 4O3OA 4QWDA 3TAMA 3H2UB 3O8WA 1N6QA 2PN6A 3PO4A 4BS2A 1FD8A 2AWZA 2ZH1A 3M8RA 4P72A 3FK4A 2BKNA 2KG1A 1U1OA 3VGTA 2YNIB 4TN2A 2BDPA 3ITHB 2V2ZA 1L3VA 5KFPA 4U96A 2JX2A 5L39A 2E5HA 3JSMB 2HLTA 4NMXA 3Q8RB 4WFYA 4LF6J 2LEBA 1R0CB 2KM8C 1WTBA 1YSJA 2FY1A 4PR6A 4J9MA 4OFZA 4PG4A 1FWLA 1RAGB 4MKAA 5D0GA 3BBCA 2XHCA 1VQ4S 3C15A 2NZ4A 3MOJB 2LQ8A 5L9NA 1D8ZA 3QYYA 3OXFA 2CQHA 3MM7A 4B3RF 2ZD1B 1LFWA 1RAAB 5T41A 3VGSA 3I4HX 3IR5B 2M88A 3NLCA 3SQOP 1EB0A 1NAQA 2C2MB 2NYHA 2WVDA 3MEDB 1VOMA 5IOLA 4QPTA 2HMIB 1NMEB 1MN7A 4ECTA 3I5CA 2ZH2A 1TK0A 1T9UA 5FLXU 4NXMJ 2MMYA 2ZDOA 4EWTA 1HR0F 2F65A 2XWYA 1S7IA 3DLGB 4A8YA 4ICLA 3QNWB 3CMES 3ISND 2KDOA 5A8WA 4LF5F 2CQCA 4LBHA 2NSCA 4F04B 3X3UA 4F4ZA 4UF4A 1U8SA 2ILYA 4O44B 4ATNA 2MKSA 2ZHOA 2F4VJ 3UQSA 5AXNA 1VQ9S 3MTKA 1YKWA 3FCVA 2UUBF 3PDNA 4ECYA 2GIFA 2ASLA 4K4YA 3UCUP 5EHHA 2IBOA 5B0CA 3GFZA 4ED6A 5KFZA 3NGKA 1FRHA 2ZC4A 3N79A 4IH5A 5DZ7A 1LWEA 3SV4A 4FYXB 2K1RB 1EKRA 3FFIB 1REVA 2MLZA 1T02A 5CCLA 1UEKA 4LRFA 4NCBA 1X5SA 2QLFB 3G6VA 2CXEA 3RR8A 2G2YA 2RU3A 3PIPQ 4C8NA 3BKUA 4ER8A 3PG9A 1T03B 1SKRA 2P9GA 2V67A 3QO9A 3ZZ0A 4OYXA 4ELUA 4I1TA 2DNQA 2IBKA 4J9SA 3H20A 4OX7A 4P6QA 2VQFJ 3FEZA 3P8BB 4FPIA 1RACB 4A8SA 5J1NA 2V4JB 2OPRA 4I67A 4JI1J 4DSFA 5C7PA 1XMQF 2RQKA 1X5TA 1OJ4A 4KPCA 2RKIA 2WZ1A 2PA3A 3M30B 4NX9A 1T7PA 5KFJA 3MUVP 1S4FA 5BYSA 2QL9B 1TVRB 1GFWB 5KG4A 1MROB 4GO7X 1O6XA 2XULA 3C46A 2ZM6J 2DGXA 2QX0A 5G4DA 2E9ZA 2PI5A 1GXUA 2MQ8A 3DRXA 3ZZYA 1VLYA 5T14A 2FZCB 3M8WA 1JLBA 1C2PA 3MCSA 1FF2A 1VDHA 3GIJA 2DNYA 2XO7A 4QYZJ 2JSXA 3MMAB 2WOMA 4JI3J 1HNWF 1YJRA 5DQIA 3EM1A 2DCLA 4FXDA 3T41A 4CIOA 3DFEA 4JP8A 3SIPB 3N9UC 2C2KB 3W8GA 1F2HA 5I42B 3TEHB 4YB5A 3BZQA 3UDEA 1S48A 2DEJA 3CDAA 1XC9A 1D09B 3TVYA 4DWIA 1L3KA 2R8KA 2RB7A 2AJQA 1S6UA 5K14B 4OJGA 3VWSA 1H73A 2B0GA 3IWXA 2DGWA 4B9NA 2H9ZA 4AQYJ 3IBCB 2B5JB 1HW9A 2AX0A 2VD3A 3GP9A 2JLGA 3W66A 4DUYF 5A8RB 2LECA 4DR6J 4QIFA 2R2UA 3LTOA 4LR7A 4LSNA 2RQ4A 1FRMA 1Q1KA 5EWFA 2OTLS 4DQRA 4WKRA 3CO0P 1TL3B 4M5KA 3VGVA 3R6LB 4KTQA 4DR2J 3CVKA 2VV5A 4ETZA 1IM4A 1CC7A 3DLEB 1WD6A 4MYUA 2PDAA 3T5JA 1I6JA 5HI7A 1YBAA 4XDDA 5J1PA 2DR7A 4Y2KA 5ETMA 4DPOA 3TUZC 4LF9F 3FSYA 4RR5A 2PT0A 3KLGB 5U47A 3BF4A 4NLOA 4ZPTR 2ROEA 4UOHA 3NRBA 1YJNS 3V6JA 2CNLB 1WSVA 3DLJA 4NZ7A 4PWDA 4I2PA 1CJTB 2H48B 4EO6A 1NJXA 3TVZA 1WACA 3MPYA 1ZTWA 5CD4A 3MR5A 1UVLA 3QLHA 2RDJA 2OPQA 4DPTA 1KN6A 3UWTA 1U6FA 3MR2A 2LQBA 2OEKA 4CT9A 2YNFB 4N77A 4OI2A 2GQQA 4CLTA 4JV2A 5CABA 3Q8YA 2W7PA 3OJUA 1FE4A 3DN9A 3EMTA 1XNRJ 2RRNA 3ELHA 1KQSR 3H59A 1AXQA 1VIOA 2R7UA 2J8SA 3F56A 4DL0C 4ED2A 3FRYA 5E33A 3R6GB 1K8AT 3T5KA 4KIAA 1O51A 1NJIT 2CG8A 3DOLA 2B3TB 3HK2A 4C8MA 3EYZA 2B4UA 3O2IA 1NSPA 3EPIA 4ZLJA 3W9IA 4FF3A 3B78A 4ZVQB 3MAQA 2J5AA 3SCKE 1SXLA 3TANA 1UETA 2A1BA 4M94A 4JV0A 5K8OA 3Q2SC 4W90B 2MZJA 3T5LA 1PC4A 4ZLLA 1WHXA 2G9OA 1FK9A 1TKZA 2VDIA 2AJ0A 1HFEL 4K5SA 2LA6A 4X65F 2F9DA 1UPMB 1JWWA 5L1LA 3THTA 5BYRA 3M05A 3AJ2A 2ZBQA 4EZ6A 1RJJA 4RWWA 2EFVA 3PYEA 1UFWA 2LQ5A 5F0WA 4G1IA 3T3FA 1HWLA 3ZTSA 1R8AA 1T95A 2GJFA 4WYLA 4JOUA 3D6HB 3UNGC 1FA0A 4ILLA 1S6QB 2W9BA 5HROB 5K9FA 3BR9A 4TU9A 2HFSA 3RB6A 1MG7A 3V6HA 1FNOA 3K17A 4I68A 2R3VA 5KFSA 1S0VA 3SYZA 2AMCB 2Y8WA 3G87A 2ILZA 2V63A 2YX7A 4OJ1A 5GADI 1Y00A 1YI2S 5KFXA 1XJWB 1SCJB 3HJFA 1NHVA 2KO1A 4IR1A 2CPDA 3BSNA 5KTQA 1E6YB 1BGXT 3EVMA 4DSJA 5A0YB 3I5AA 1FKOB 4ZVUB 4UT4A 1WORA 1FNMA 3M6WA 2W4DA 2CAJA 4EMDA 3J80Y 3CJQA 3HP6A 4KRWA 2GV1A 2UXCF 5BR8F 3NGUA 3N5FA 2JNJA 2CQ0A 5F8JA 3H8YA 3W61A 2VC1A 1IR1A 4F67A 4Q5VA 2Y1RI 2CVEA 1ZZNA 1RAEB 3WIVA 4ES3A 4A4JA 3CPWR 4EFAC 3W3SA 2WK4A 1X5PA 4DL5A 1GNKA 2V50A 2GC8A 2LLZA 1H74A 1P6TA 1QVFR 5AXKA 4R0EA 1S4EA 4X2BA 1VBYA 4QIEA 2QE5A 4R8UA 1APSA 1U2FA 3PR5B 3A3NB 1HPZB 3SSSA 1V9OA 2HWIA 4DN0A 5LJ3Y 3GJQB 1UFLA 1UTAA 3ET6B 2LMIA 5L1IA 2A6OA 4KR0B 1PG5B 2AJ1A 1B0TA 3HVTA 3EUNA 3GTYX 3X1LB 4X4VA 3SSRA 3M2VA 2HHWA 3TA0A 3KLIA 3H90A 5HBMB 2VOPA 1RHQB 4LF4J 1F5CA 4ZHRA 3CULA 4Q43A 1FRKA 3CJ3A 3W5ZA 1XMOF 3I96A 1JLQA 2PMZD 2HIYA 2B51A 1IKWA 3GJSB 5IWAF 1TL1A 1TMJA 1R27B 1H7XA 4Q45A 2HQDA 2J6SA 4H4OA 5K8NA 2Z2ZA 3H2LA 2XGQA 4OX9J 2B9WA 1QJHA 4NYPA 1ZS6A 2NXCA 2H1YA 1UEUA 4OHZA 2IJFA 4ECUA 3TUIC 2OFHX 5E3CA 4R5PB 2J0WA 2ZJQQ 1CS4B 2FJBB 1T3OA 4ZVPB 2L41A 4L73A 3D6TB 2ERRA 4RNOA 2ASYA 1RTIA 3PRVA 2HQFA 3H98A 3SV3A 4JI6J 3NNCA 4AXIA 1N0UA 4PQUA 3N0VA 3G8SA 1B4SA 4KC5A 3MPUB 1N5YB 2LQJA 1YK9A 3ILLA 2VFVA 4A8MP 3EVWA 1TK8A 5T7LB 5LM7E 2IM2A 2HQGA 2BEFA 1YRXA 2N7CA 2I9SA 3TOQA 1ROFA 2CADA 3D68A 1KFSA 5HMZA 3QT7A 3J81j 1S9EA 2BACA 1KOOA 3FRZA 3OHBA 2E66A 3PACA 2IJRA 2VASA 3IG1B 2X1AA 2JC0A 2M5YA 3CMAS 1SPBP 3JTOA 4HT7A 4OYWA 3PW7A 2C3MA 1VJQA 3AH6A 3SCJE 4F4XA 2XMWA 1SKSA 4F4WA 2IJNA 2Q79A 2VA2A 2MJUA 1IR0A 3LF0A 2C2ZB 1RTZA 4HHJA 1TUWA 1AW0A 1F3VA 3VV2B 4HI2A 1PBUA 4O4GA 3UDCA 3MMCB 1WOOA 3ISNC 2N4DA 1L3TA 4CWBA 4Y0FA 2DRDA 1K44A 4P75A 3G4SS
chains in the Genus database with same CATH topology
3MPWA 1FK9B 4LSLB 2NR0A 1MNEA 1TKZB 4NZ6A 2OLWA 5M2UA 2CQIA 2NUHA 2VQEF 3IO1A 4Q44A 4IYQA 1HWJA 1NKEA 5ADZA 2K7JA 2FGCA 2IM1A 1X4GA 1YRUA 2B4PA 1J5OB 1VQSA 5KFEA 1N33F 2WW8A 4EBDA 2RDIA 1N5VA 4B02A 5AE1A 1FERA 3CF5Q 1IN0A 1A9NB 3SDEB 3DRSB 4RLEA 5KFKA 3HX9A 5DG8A 2QMXA 2VBWA 3QPIA 3K5MA 1NJWA 4WFXA 2FC9A 1S49A 5I42A 4DR4F 2FGOA 1FEHA 2HNZA 2IM0A 4OZ0A 2FLPA 3NNAA 1W25A 3P6YC 5H9FJ 2QLXA 2EFOA 1VFJA 2NXUA 1NK9A 4WJBA 3MM7B 2KTQA 1FKPA 3TAQA 2V0NA 2XI3A 2RNEA 3CEDA 2W9AA 1ZTTA 2GW8A 3FDSA 3C6TA 4LVNP 3KK2B 2DR5A 1UVNA 4LIRA 4ERDA 5JXSA 2RS8A 4FPRA 4DR3F 4KGMA 4IQXA 2OPSB 4ZOSA 1W2BR 3K5OA 1GH8A 2JOQA 4C97A 2HRYA 5K14A 3SFUA 2JJ4D 4ECXA 2JEGA 2EVZA 4RBUA 3H40A 1W2IA 3EXCX 2FLOA 3UPFA 3BSOA 4HKQA 3MM8A 3SCLE 3NMAA 1UJ5A 1VQMS 1EETA 3KLHA 2AGOA 2B5JA 4LQ9A 3I4PA 2KZMA 1SH3A 1KQFB 4OJHA 2PGCA 2OPPA 3E01B 1HWKA 4OLOA 5THWA 5DDOC 3G96A 4C8OA 2KT2A 2AGQA 3TR5A 5DM6Q 3GG0A 2XMMA 1GAOA 2KFNA 1Z2ZA 4Y3CA 1SKWA 3M8PB 4OL8A 4PUOA 5IXUA 2FHJD 1E6VA 3MAHA 2XMVA 3RRKA 3SQGA 1H7WA 3CD6S 2HWHA 2U1AA 1FRLA 1RT6B 4QW8A 3NS6A 2B56A 3GMGA 2R7RA 1O5JA 3PVXA 2C22A 1DRZA 5D4NA 1G2EA 2KYZA 3DC2A 2UP1A 3DDNA 5CYMA 4ICLB 5F8IA 2ALZA 1DFDA 4U6PA 1RK8A 4NL5A 1U09A 4GMKA 4NYOA 3UFCX 5C42B 3KLEB 1C1BA 3V6KA 1RISA 2VG6A 2C3OA 2BABA 1Y9OA 5FJ4A 4PRFA 3TYTA 2L3MA 5SUHA 4GC7A 2YH1A 2C3UA 3UR3C 1YIJS 3QGIA 4PQAA 2F8HA 3LALA 4J5OA 4L72B 3E3XA 4KO0A 4EYIB 4UOCA 2DIUA 3C3LA 5DDPC 3U02A 2GJ2A 5BYQA 2YNHA 1Q8BA 5LMUF 2OIHA 2ADBA 2M8DB 2C42A 2MZQA 3D1HA 1KTQA 4NLUA 4X4NA 1VQKS 2VA3A 4NA1A 1VI7A 3Q24A 4KAIA 4CH1A 2J0QD 3DLEA 3H5YA 1N4LA 1CQNA 1NH7A 2E5GA 4E8UA 2MYFA 4X66F 4NXNF 2EFQA 2IA0A 4U7UK 1NK7A 3KFWX 4QWCA 4G1QB 2JEJA 1FDDA 2B4VA 3HHLC 2MQOA 2IRYA 4PPDA 2YX4A 1FXLA 2HHTA 2KM8B 1VQPS 2R4FA 3PEJA 1C0TA 2JWNA 2KXNB 1HL6A 1LFPA 1H2UX 3V6DA 4DSIA 2YY3A 2OH2A 4I0WA 3HDSA 2MKKA 3EZ5A 2CQGA 2DH7A 3DOKA 4O3NA 4KFBB 2C2RA 4ZPVR 3L7PA 4DEZA 2FVCA 3DM2A 3UW1A 3I0SB 5IZHA 3JSYA 1OQ3A 2IM3A 3B4MA 4QOTA 1SJRA 4EUVA 3OL7A 2ASJA 2K3IA 3MD3A 1ZM2A 2NLWA 3EGWB 2D3UA 2GMLA 2KRBA 2YKOA 4NLTA 3DGPA 3BO4A 3BGRB 1D9DA 5E3AA 2IRXA 2JLEA 2DNRA 1IUJA 1IKXA 2FHKA 4B9SA 1ZAWA 1T94A 1HQUB 2R7WA 4NLGA 1UEVA 2J0XA 5C25B 1X9MA 2OAUA 1RT5A 3OTBA 3LWLA 4Y2AA 1RT3A 4H54A 1KOHA 4QR2A 5F0UA 2Z8QA 2GMJA 3NCQA 5E41A 1UWBA 3DU5A 1IQZA 4QWAA 4WXWA 1REVB 4MK8A 3S6EA 5AE3A 1U1MA 3JYTA 4XPCA 3TI0A 3QGGA 4WK1A 1YVFA 3WC2A 3DOMA 3GFXA 2FVRA 3QZ7A 4B3OB 4A8KA 2VPYB 3HHEA 3BGUA 2FJDB 4R8UB 1N0VC 2QEXS 5F3TA 2MZTA 3GIIA 2HS3A 3LAKA 4TU8A 4DL4A 2O67A 1VQ8S 4H4KA 2LXIA 1WF1A 4C3MA 2L48A 3H5SA 2W7AA 3T19A 1FD2A 4TY8B 3ZC4A 3ZZPA 2LKZA 2XSJA 5KG5A 2J6UA 4QW9A 2RUGA 5EUHA 2GIQA 5M2RA 3RU0A 2APOA 3QO9B 3UR0A 2J9DA 1A7GE 3QAEA 2X1GA 5GAGI 3CJKB 1KD1T 1HHSA 3FZ2A 1DURA 1IKYA 3HKWA 5LMNF 2HNDB 4Q2MA 2BUNA 3I9ZA 5CZXA 4DV3F 4DFKA 1S99A 3ISZA 4Y00A 2M0GB 1C1CB 5HMWA 4C8KA 2ZZMA 3OVSA 3R3TA 2FLLA 2F8EX 3M2UB 4K4WA 4O3SA 5K5MA 1X4EA 3HVTB 1SH0A 5J2NB 1T05B 2ZBCA 3CSKA 4C0BA 2ASDA 5B7WA 4JV1A 1JLGA 2OP5A 2YKNB 3AHPA 4W92B 3OTOF 2ZH8A 1TKXB 2QT7A 3KNGA 3MM5A 4PWUA 2EI5A 2HG4A 2YKQA 1VRUB 2DNMA 1SJFA 2YWKA 2RU9A 3M8QA 2XY7A 3IA0A 4LF6F 4NLYA 3KLIB 5J1EA 1FVQA 2I2YA 1Z2LA 1U45A 2FDNA 4DL7A 3H5XA 4RUCA 1XN9A 2RKIB 4ZHRB 2NQPA 2ZDPA 3I87A 2D9PA 4XIUA 1KC8T 2HZCA 4PXEA 2PEHA 3VQTA 2CKWA 2ZNYA 1IBMF 3FEXB 3SEOA 4ITSA 3GYNA 1HBUA 2YNIA 4G6VB 2HQIA 2D3ZA 3N5BA 1XERA 1P8GA 1VRTA 2F8MA 3MM9B 4ZCKA 2ZE2A 1FKAF 3G6ES 3OBIA 3NBPA 1X4CA 1M5KC 3S01A 2LVWA 5LSRA 3KHRA 5DRKA 2VG7A 5HMYA 5LT5A 4ZA1A 2A18A 4H4MA 4NCGB 1IKWB 3KYLA 2R2TA 5EX3A 1URNA 2G4BA 2KYXA 2CQBA 3VZIA 4AE5A 1TUVA 2DTJA 5J2MA 2PSZA 1IJEB 3DLKB 3JAMY 5EDWA 3UD3P 1KFDA 3DI6B 2FTRA 3I55S 2R7QA 2N7YA 3NKYA 2MSTA 4H4OB 1RYSA 3PX6A 1HBNB 1GTEA 2XNRA 4ZDNA 1TFYA 1VK3A 4QQBA 3TP2A 4DV5F 4CH0S 2RF2A 1U1NA 2DO0A 4CH7A 5EWEA 1X4FA 2EPIA 2I8EA 2XLIA 3OR2A 3HVWA 3QWUA 4I6WA 4YY3F 3P5TL 3BGLA 5A6PA 3BDEA 3RRHA 1IJFB 5IS2A 2AQ4A 2OMOA 4WFAQ 1JLBB 1H38A 3C6UB 2ZUGA 1IKVB 2HHQA 1NK8A 1K0TA 3DMJA 3G8TA 4C4WA 3VR1A 2WOMB 4XO0A 4PG6A 1FT8A 3QIPB 3DRYA 3LGMA 1NK4A 2ZOGA 4DQPA 2DNOA 3OFGA 3KK3A 1VMBA 3B4DA 2CQ3A 2D41A 1RTDA 1DJ0A 3HKZD 1BQNA 3RW7A 1KLMA 3LOUA 2X51A 5G0RB 4O3RA 4NXMF 5JVHQ 4DFMA 1M5SA 3K8WA 3O1LA 3K5LA 1YWXA 4CCHA 3PM9A 2EFPA 1S6QA 2BE2B 4MIWA 5HROA 2I5JB 2HHUA 1KR4A 2V94A 1DLOA 3M2RB 5I3PA 5KFCA 3RB3A 4PQUB 1KNZA 3G71S 1LKZA 1TKTA 2JRSA 3B8HA 4B17A 1F0XA 3BREA 3H4BA 1U1PA 3G6YA 1Z4UA 1SQEA 4CTAB 3EGNA 1VC6A 2FC8A 4QJVA 4QYRA 1TQLA 4LFAF 2M2BA 1RA6A 5KT3A 1DTQA 4L6V3 3TNVA 2HMIA 4DBQA 5J2QA 4QU6A 2DHGA 2N82B 1EP4A 5D78A 4BC7A 4IKAA 3IXQA 2MGZA 2F4VF 3PKMA 1MU2B 1NJYA 2LYVA 1RT2A 2E1CA 1Q4RA 2GHVC 3CJ4A 2PO4A 4X4UA 4IOBA 4DDFA 3BSCA 4ED3A 1S9EB 1U7LA 3CC7S 1HBMA 4NMLA 2DJWA 4HYKA 4M95A 2R2RA 4MKYA 2BXJA 2JEIA 3DLLQ 4A46A 2GHPA 5KFMA 4K4UA 5KFFA 1RTJB 2Y1JA 2GFFA 4IRDA 5D4PA 3U1NA 2P6SA 3PV8A 2FVSA 4OI3A 1WHVA 5DQGA 4DV7F 1R43A 2JVOA 4FNIA 1WG5A 4HL9A 2V8VA 4ETXA 3R27A 1C0UA 5KFTA 3VF0B 2DGUA 2BQRA 1UVMA 4DLEA 2HGNA 2G1DA 1KONA 4J9PA 2VBXA 1VBXA 3MFHA 1SBRA 1XK8A 2OD4A 1IBKF 3C66A 2IAJA 1FKOA 1YHQS 3JSBA 2G0CA 3KLVA 2PD1A 4ZK7M 5CZVA 3Q0AA 2MZRA 2DT9A 2HVZA 5B0AA 3DXSX 3LP0B 3RRGA 1FHTA 1S76D 4DV0F 2D7SA 2J76E 1U1RA 5DS7A 2NSBA 3PFEA 2F7VA 2A2DA 3TVKA 2HHHF 4I4BA 4NOHA 1N32F 2ZNZA 3KHLA 4GC6A 1FJEB 2V9KA 3CIMA 4QIWD 1XEZA 2IMWP 1KVJA 3PR4A 1OO0B 2XEXA 2MDAA 1NH8A 2YNGB 3VTIA 4RKUC 4F3QA 6FDRA 5I3UA 3FSXA 4M1KA 3RBEA 3NCRA 2XMUA 4IFVB 4RW7B 3UCZP 3F41A 1Q8LA 1ZM4A 5JJBA 2MZSA 4YR2A 4DV4F 3PW0A 2HFOA 3GIMA 1JLFA 2CPEA 2AX1A 1K73T 2GO8A 4RW4B 2UUAF 1GTHA 4NA2A 1ZPWX 1SJ4P 4P2SA 3HLUA 2OFGX 4ZLPA 1QUPA 2ZJPQ 2CPIA 1F60B 2WB4A 1LWCA 3M32B 4QIGA 1U4BA 1HWIA 3CGIA 5E3QA 1P1LA 2DCUB 1S10A 2ROGA 3KG0A 2HFNA 1DAXA 1LV5A 2B6AB 2MHNA 4I2QA 4FZVA 3IBWA 3FQLA 4HDGA 3CDUA 3VAFA 4TQSA 1SC6A 3L09A 4FVCA 3CCQS 3CD0A 1D3WA 4X4VA 2XSFA 2K7KA 1UJ4A 1X0PA 2DH9A 2GQ2A 2BZ2A 1SV5B 4YDXA 4WYWA 2KJWA 3JTPA 1O8BA 5B0GA 1VQ6S 1S1UA 3FFIA 2KB2A 4CO1A 2VQFF 5GADU 4DSEA 2WRMA 3PJWA 1K9MT 4YOEA 2M9KA 4DG1A 3BN4A 2BVZA 2KHDA 2VBZA 4ZPBA 2ZH6A 4YB7A 4PWDB 1X0FA 1QE1B 2KKHA 3PHEA 2UVUA 2CZ4A 4QCLA 2KJVA 2OMLA 3SMZA 4LJMA 4WZQA 2UU9F 2AW0A 2FVPA 1HPZA 5LXYA 1WF0A 3TAPA 4JI1F 3CCVS 3RAMA 4QR0A 3FGVA 4UQGA 3RB4A 2CIMA 4OHXA 3THVA 2KZZA 3N6MA 4C8YA 1T03A 3K7RA 3OUYA 3Q8SB 3QLHB 2J0SD 1FJ7A 2X1BA 2EG2A 1R8CA 4EEYA 1FKPB 2LQ9A 3GYXB 3V81A 3C6TB 3KMSA 2EKYA 2HHPA 1S0NA 1N54B 5EN1A 1XNQF 1VBZA 4ILRA 2GQCA 5IM0B 4ECVA 1F9FA 3SZ2A 3AB4B 1JJHA 2RJZA 3OV7A 5HLFA 4Z2XA 3T1HF 2EK1A 2MQQA 1KQKA 2CQPA 2M3DA 2KH9A 3HF5A 2CPHA 3OXLA 1DQAA 1YJ9S 2CPXA 1S0OA 3MGJA 5D8HB 1BQMA 1EETB 3RZAA 3KLHB 3MR6A 3W2VA 3I9V9 5A8KA 5KFWA 4EYHB 4R0JA 4ZKAA 2V2KA 3UD4P 2V4JA 4MK9A 4USJC 1V3SA 2OPPB 1S1WA 3ONQA 4M5DA 3PX4A 2CJKA 1OS5A 4K59A 2NPFA 1TR0A 1SJ3P 1YJWS 1CVJA 4C0OC 4I6YA 1HI8A 5HBMA 1UVIA 1WELA 3BEGB 3WBZA 3AB2B 1DQ9A 5DO2A 3MR3A 3E2EA 1Y7PA 1LQ9A 1DARA 1G3OA 1DBDA 1X8DA 3FVYA 5E2QA 4DJBA 4JV5F 2CZVC 4DL6A 4ZCLA 4C7QA 2F40A 1HNIB 3K5NA 4KHRA 1HYSB 2FHJA