1X8DA

Crystal structure of e. coli yiil protein containing l-rhamnose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
104
Chain Sequence
MIRKAFVMQVNPDAHEEYQRRHNPIWPELEAVLKSHGAHNYAIYLDKARNLLFAMVEIESEERWNAVASTDVCQRWWKYMTDVMPANPDNSPVSSELQEVFYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Monosaccharide Specificity of Escherichia coli Rhamnose Mutarotase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
molecule keywords Hypothetical protein yiiL
total genus 28
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.32: L-rhamnose mutarotase.
pdb deposition date 2004-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05336 rhaM L-rhamnose mutarotase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x8dA01
1TL5A 2FIUA 4Y2IA 3K7RA 3LO3A 5B0GA 1FVQA 2N4CA 1VQSA 4OIXA 4YDXA 3IWXA 3GZ7A 2XMVA 1Y9OA 4HI2A 1QUPA 4A46A 2CRLA 1N5QA 1Y3KA 4A48A 2QYCA 3DCAA 2XMWA 3E8OA 5F0WA 4FNIA 4U9RA 5B09A 2W4CA 1CPZA 2BBEA 1X7VA 3CJKA 2GO8A 2ROEA 1MWYA 1YJUA 1SI9A 1TR0A 1VQYA 3UDCA 4DPOA 1Q53A 2OD4A 2BYCA 3KNGA 1S6OA 2L3MA 1MWZA 1N5SA 1N5VA 1URRA 2XMMA 3BDEA 2QLWA 3VTIA 2KYZA 3QMQA 5B0CA 1V3ZA 4HI1A 3DXSX 2Q3PA 1SQEA 2G9OA 2ROGA 3HFKA 2OKQA 3HHLC 3HHLB 4OJGA 2AJ1A 2N4DA 2RILA 3QGPA 4NL5A 1JWWA 4FNHA 1Q8BA 5T7LA 3LGMA 1P8GA 1YG0A 4Y2MA 2RU9A 3HHLA 2VH7A 4HH1A 1AW0A 2IFXA 1K0VA 3KKFA 2AW0A 2AJ0A 2AP6A 1AFJA 5A6WA 5KAKA 3KG0A 1N5TA 5T7LB 4A4JA 1CC7A 2QLXA 5A6PA 2LDIA 1IUJA 1KQKA 1TUVA 3MZIA 3FGVA 2XMJA 1JK9B 2OMOA 3BB5A 2PGCA 1Y3JA 1SB6A 1AFIA 2K7JA 2KT3A 2XMUA 1X0PA 1FESA 5B0AA 4YEAA 1FD8A 1LQ9A 2FB0A 3BM7A 4EFAC 2GGPA 1TL4A 3HX9A 1U7LA 1YRXA 2IYGA 1WD6A 3LGNA 1OPZA 2ZDPA 2LQBA 1Q4RA 4ZOSA 2GGPB 2KKHA 4QOTA 2XMKA 3BR8A 5B0FA 1APSA 2HFNA 5F0UA 3KG1A 2QIFA 4ZA1A 4DL0C 2BUNA 3FRYA 3T9NA 2OFHX 1FE0A 3IWLA 1GXTA 2BJDA 3BN7A 3TRGA 2K1RB 2IYIA 2GCFA 4OJ3A 2GFFA 1R6YA 2OAUA 4HL9A 4F67A 4NPOA 4A47A 2K2PA 1FVSA 4OJ1A 3WDOA 1S6UA 2W4DA 5B0BA 2XMTA 2KT2A 3BF4A 3TNVA 5IXUA 3I9ZA 1P6TA 3TOQA 2RMLA 3HHLD 3BGUA 1OQ3A 3MCSA 2JDJA 4OJHA 1OQ6A 2HFOA 4Q2MA 2BJEA 2HIQA 1XBWA 3HDSA 5B0EA 1CC8A 2HLTA 2ROPA 3HF5A 4DN9A 5B08A 2ACYA 1KVJA 2GA7A 1GXUA 1Q8LA 2LXFA 1YJVA 2FHMA 1FEEA 2ZDOA 2PD1A 1FE4A 1ULRA 1Y0HA 1YJTA 2ASYA 1OSDA 2LQ9A 2OP5A 2OD6A 3FMBA 5B0DA 3F44A 2RSQA 2VV5A 4Q2LA 4Y2KA 2W4PA 2K1RA 1KVIA 2EW9A 2N7YA 1TZ0A 2HLUA 1W2IA 2FTRA 4HH0A 2GV1A 5K9FA 3CJKB 2K7KA 2HQIA 2OFGX 1RJJA 1YJRA 1X8DA
chains in the Genus database with same CATH superfamily
3LQVA 1H2TZ 3SI8A 1X4BA 2I0XA 1S9FA 3NGKA 2A1BA 2XWXA 3SCJE 1TU0B 4WIIA 3G6VA 1KTQA 2F4VF 2PDAA 4CO4A 3K5NA 1HHSA 1UPMB 4QYZK 1QUPA 4OHZA 1QD1A 3MMJA 1R8PA 4MK7A 4DL7A 3U02A 1TL3A 3W9JA 2UU9J 4OZLA 3CJKA 1JXLA 1VQYA 1RHJB 3OBIA 1U1KA 2A0FB 1H3DA 2J9CA 2OD4A 1FDAA 5AT1B 3QLHA 3IRWP 3RB4A 3OTCA 4GKJF 4QR1A 1EP4A 4KIAA 2RUSA 2XS7A 1RT1B 1R8HA 1P27B 4LRBA 4ENOA 3QMQA 4DL2A 1I94F 2ZKUA 4J9LA 4C8KA 2VOOA 4F36A 1KSPA 3JTNA 4RNFA 3I6PA 3G4SS 3KHHA 2OJ3A 3MDFA 4K4ZA 2HFVA 2VBWA 2HFUA 2FGCA 3C16A 4NLDA 4ANCA 1T11A 2AJ1A 3JAMY 3G71S 2ZH4A 1TKDA 2MZJA 4ICLB 4NL5A 2FJWA 3PG9A 2AZ3A 2BDPA 1DQ8A 3ZNJ1 2RU9A 4HH1A 4HDHA 2LCWA 1AW0A 3PW5A 1C4CA 1M1GA 1U02A 2AW0A 1I51B 1VCTA 3D4JA 2IJFA 1KR4A 1YLXA 2EC2A 1N5TA 2F63A 3R5CA 4DCJB 4DDFA 4TU9A 1N4LA 1Q5VA 2FVSA 4K0KJ 4Y6IA 2HRYA 4LFCF 2AGOA 1KQKA 4ANDA 1B7YB 2MMYA 3OXLA 4UUXA 2ASJA 2W01A 2WZ1A 3TZWA 1P1LA 2EBEA 1N8RT 1QAIA 4JI3J 1UVIA 3QT8A 5DGBA 4JV2A 2BZ2A 2CJXB 3GTYX 2BOAA 2EG1A 3BM7A 1UFLA 1GMVA 1UZHA 3AODA 5G0RA 1O6XA 1YRTA 1TL4A 2VBYA 3UW1A 2DGTA 4RJVA 1A7GE 2DNLA 1SBRA 1RTDA 4PQUB 3C46A 2BE2B 2Q43A 4J7CA 2ZH6A 3MM8A 5J1EB 3Q22A 1SC3B 3BR8A 2JLEA 3O2IA 1S77D 1HPZA 3P6YC 2E9TA 2V67A 3AJ1A 1BQXA 1SV5B 4UF4A 4N5SA 2VG7B 2RQCA 2XYHB 1VC6A 3G87A 1YDLA 3DLGA 5KG5A 3SSQA 4CLLA 4O3QA 2ZWPA 4J9NA 1OY8A 1S0VA 4I2PA 1QY7A 4WP8A 3T19A 2EPIA 2PSZA 4ED7A 4F67A 2XHCA 2L41A 2VHGA 3MUTP 2XMTA 3AJDA 4RNHA 3RBEA 4KRWA 5LSRA 1EIYB 3TA2A 2XS2A 1F3VA 4QYRA 3L7UA 2XLIA 3NNHA 2VG5B 2LXIA 2OPQA 5JXSA 3TJ9A 1RU1A 2WCXA 3HM9A 3NXZA 4B9UA 1R8AA 5KFSA 3CD6S 5ETPA 3IAM9 3HF5A 4DN9A 5F8NA 3FQLA 3VAJA 1UPPA 4YB1P 3QRQA 1HWJA 3RW7A 2W2QP 4DL3A 5D8HB 3BGFA 3QGIA 3QPIA 4G6VB 1BWVA 4GC7A 2M8DB 4IOBA 4YY3F 2DH9A 2XLJA 5KFPA 5K14A 1CJTA 5I42B 3BO4A 5J2QB 3RW6A 1AT1B 1TP7A 2VV5A 2RJZA 3NKYA 3ET6B 4RW4A 4C98A 2EW9A 3NP5A 4FZVA 1T9XA 1HWUA 1FCAA 3TUPA 4DSJA 4KGXB 3DN9A 1G6BA 1NU4A 2DYAA 4R25A 1TTHB 3K7RA 5ETTA 1FEHA 1X4CA 1TKXA 3SFGA 4BCAA 4DCPB 1RT5B 2K3KA 3C6TB 4L75A 4OYIA 5M2PA 4ZHRB 1ZYQA 1K47A 2JX2A 5IC6B 3MM6A 4DV3J 1BY9A 3PVXA 1U49A 4DF4A 1XMQF 1JX4A 2CG4A 1REGX 2RUGA 2H3EB 1DBDA 2R7OA 4NLSA 3A8JA 4C8MA 4A46A 4CO5A 5CYMB 1ZPVA 3G6ES 4LMZA 3LOUA 3VVTA 2OEMA 2B7BB 1S9GB 1IKYA 2MY7A 3C15B 3DOMB 4M5GA 4NMLA 4OLPA 4R8UA 2ZH9A 2N3OA 4DF8A 2H51B 4F4WA 1GMUA 2BM1A 2JVRA 4Z2XA 1N34F 1Y5NB 1NPPA 1YSJA 2L3MA 3NS6A 4IO9Q 4OYXA 2C28A 1U0SA 5A0YB 4KO0A 1R8CA 3T3FA 3PYGA 1VJWA 3QSIA 2I5JA 3LALA 1QTNB 1T9YA 3VTIA 5KG4A 2XC9A 2BJ3A 2G0CA 2IM3A 3DXSX 1SUQA 2DHXA 4UW2A 3BPDA 1PJ6A 2OKQA 3IS9B 2NXNA 2MLYA 1JLQB 2B5JA 3M32B 3K59A 3U27A 4ELUA 4X62J 1JWWA 2A18A 3EWGA 1WC6A 1QVFR 1SIZA 2CWKA 1X5TA 1JKHA 1SKUB 1V5IB 2GJFA 2NYIA 2OPPA 3R5GA 4OHVA 3V6KA 2DGWA 3CJTA 2EK6A 3EDQB 4DU8A 2DB1A 5A6WA 5G4DA 1S59A 1JLEB 2WVFA 3GJTB 2W7AA 3HD1A 4WTYA 2HAFA 3UD5A 3VVUA 2X3DA 4G65A 2F65A 1U26A 4JI8F 2M9KA 5DQIA 3PX6A 1UKUA 2YNIB 3GFXA 2J0WA 2E7VA 3SFUA 4P6QA 4F2SA 2ZUAA 3EGNA 4NZ7A 5I3QA 3T1YJ 5A8RA 5AE3A 1T03B 2XS5A 1BXNA 2NUUG 4DQPA 2R7QA 2W2MP 2ABYA 2RHSB 2O1PA 2RRNA 1Y7PA 3L4BC 3M4XA 1TFWA 4B08A 2ZBIA 4TLQA 1MLAA 4FXDA 1TVRA 3QO9A 1IBLJ 3K89A 4YHHJ 1VRUA 5LMUF 1S1UB 2XMKA 1NBEB 3M8PB 1PO6A 2FZCB 2GMLA 2DR5A 4ZIWA 1IKVB 1N32J 2NSCA 2R7SA 2I9SA 2VU5A 3TVKA 2CNKB 3QZ7A 1F3FA 3FFIB 4UY85 4IO1A 3MEGB 1BQNA 2JWNA 4LVNP 3W5XA 3T1YF 1UVJA 2J0SD 5THWA 5E33A 3AHPA 4Q45A 4EBCA 1B0PA 4PG5A 1S6UA 1M0SA 3MTJA 2PC6A 3PKMA 1HNVB 3CDAA 3TNVA 2BMBA 3TAPA 5EUHA 1WG5A 4JI8J 2VBXA 1JJHA 1HYSB 2KH9A 3EZ5A 1JB0C 3MM9A 1J27A 2HFOA 3QNWB 4WTOB 2B9WA 2HHPA 2EKNA 3F73A 1NSKL 1KLMA 1S1XB 2POKA 3HSDA 3L9ZA 4USVA 2CJBA 5AXLA 2FLOA 4WFAQ 2E5GA 1ZS6A 3EJMA 5B08A 2HURA 4NEZA 1JLCA 5KFZA 4QW9A 2C3PA 5L1IA 4EYIB 1WC5A 1YJVA 2UUWA 1XERA 4MAKA 3ZZPA 3MGJA 4V19X 3QJLA 1RT4A 2M0GB 1S1WA 1RWWB 2M88A 1W2BR 1U1PA 3I96A 2ZOFA 1PGZA 4DSIA 5MLCV 4RU2A 1FXLA 2E66A 2ZJRQ 4C11B 2A2CA 1DAXA 3DRPA 2HYIB 4H4MA 3M8ZA 1UVMA 2NS1B 1TL1B 2EEYA 2YKNA 2Z8QA 5DO2A 4EZ9A 3FUYA 2AZ1A 2QMWA 3NRBA 3Q86A 4LJMA 2W2NP 3P3DA 5FDLA 1Q7LB 2ZD1A 1P9YA 3AA8A 3DI6B 2H4YB 3C2PA 4LREA 2X3GA 1XMOJ 5IV4A 1MN7A 1S1TB 2G1DA 4ZCMA 3MR2A 4AL6A 1S10A 5B09A 1HHTP 3M8QA 3RG6A 4B3TJ 2FPHX 2F8EX 4LF8F 1LWCB 2ROEA 3HXMA 1S97A 4LF9F 3DOLB 1Q53A 5J1PA 2XY7A 1HQEA 2V2VA 3NLCA 1WKJA 3BH7B 2VQFJ 5D78A 1Y11A 4QZVB 2R2SA 1NJZA 4F4ZA 4GMKA 4QPXA 1LFPA 4CWBA 4ECUA 4JI1F 1QE1A 2RT3A 5HATA 3FSXA 3EYZA 4YB7A 4GO7X 3E3XA 4PRFA 3N5BA 3NS5A 1F9EB 1HBNB 1R43A 2ALYB 2N4DA 3N6MA 4ECWA 3J7A1 4OX8A 1EB0A 4TNOA 1YTYA 1Z4UA 4M5NA 2JRSA 3DLHA 5HQLA 4JV5J 3PACA 2XO7A 2YWHA 1X9SA 1YG0A 3LP1A 4DBQA 4Y2MA 4FYDA 1HHQA 2P9EA 2R4FA 4L3NA 4O4GB 5E3QA 3EM1A 4OI0A 1LW2A 2R8HA 1OSCA 4OI2A 1RBOB 4BDPA 4I4BA 1OMSA 2HVIA 1FRLA 1FRHA 3TO8A 1RI7A 3DYAA 3C8YA 4RW9B 3GYGA 5L38A 2XMUA 4DV4J 1RU2A 1X9WA 1SKWA 4XPCA 2IY5B 3SCLE 1SC4B 4E0DA 1WTFA 3Q83A 4WFNQ 2HHQA 2G2OA 3KJVB 2LU2A 2GZOA 3T6JA 3OL8A 1YRXA 3GFZA 3S1TA 4IH5A 1LOUA 1VRTB 2PEHA 2V69A 2ZDPA 2V2QA 3AD8C 5AXMA 5C7PA 4IRCA 5HANA 4ZJLA 4USHA 2VPXB 2DIVA 4I2QA 2HMIA 2QIFA 1ZETA 3GILA 1TKTB 2YQ0A 2DNKA 2ZVIA 4L76A 3Q8RB 1GXTA 1NK7A 2E5LJ 1MSWD 4ZPCA 3T1HF 4IG0B 1GNKA 3BDPA 2HS3A 2A3JA 2GAHC 2W4DA 1YI2S 4F8RA 2DITA 2HS4A 1C2PA 4Q8FA 3CE8A 2NPFA 3PW4A 3HJVA 2DNZA 5ETRA 1HQUB 3VAKA 1X31C 1RT3A 2YNHA 1IWAA 4ZVQB 1KEKA 1U1QA 2CQHA 2QA1A 3D28A 3OVBA 4LIWA 1XEZA 1HFEL 1N54B 2H5JB 2YWWA 4B9MA 1EARA 4PWWA 5KG3A 4IR9A 2RU3A 4PXBA 1RWKB 5M2UA 4GVLA 4ZVHA 4DL4A 1YIJS 3CD0A 5LL6d 4W92B 1WOSA 2F3JA 3MCMA 1Q7YT 2MKCA 1ZAVA 2GA7A 2F8HA 1RXOB 5CCLA 3GLJA 3CJ8A 5J2PA 4NEYA 2AQ4A 1K9MT 3CC7S 4B9LA 5ETNA 2ZZTA 1YJ7A 4HHUA 4H4OA 3WC0A 2XY6A 3FCWA 2W9AA 2OP5A 3SQGA 4JI7J 2XSJB 3EZUA 2JZ5A 3DDIA 4ZVSB 4QIGA 2GJ2A 4F4XA 2VPYB 1HNXJ 4OHYA 4Y2KA 2B56A 1MROB 2HNDB 2DT9A 4HT5A 4UTGA 4WZMA 4WCEQ 3CIZA 3W62A 3W8GA 2OFGX 4IFVA 3K17A 1S79A 4AUKA 1N52B 4CTAA 2C1EB 4GVBB 4DV6F 1RT7A 2KRRA 2VIHA 1XWLA 4U67Q 2C2DA 1N36J 1IR0A 1VQSA 4RZRA 3H2LA 4YDXA 4B3TF 5DG8A 4PCQA 5IM0B 5E3CA 1E6VB 1VHFA 5D0EA 2XNQA 1GT8A 3M2RA 4C3LA 1VQ8S 3DGVA 3KLIB 3H98A 1S1VB 3MCOA 1LWEA 2W4CA 5AJ3F 4J9UE 3KK2B 1UWBB 1WELA 4L72B 2CPEA 4XPEA 3KNAA 2DH7A 4V1Ak 3M2RB 5U47A 2D69A 2OTJS 1E6VA 4WF9Q 4P74A 1S6PA 2KJVA 3HZEA 3MECB 1CJVB 2A2DA 4B9SA 4DV5J 1JLBA 1YZ6A 2YX7A 3SEOA 3VZHA 5DDPC 2Y8WA 2GIRA 1YRUA 2Z2LA 3VAGA 1PBUA 1M5VC 3W9IA 2LEPA 4MK9A 2NPIA 3J81U 2Q3PA 3QYYA 1JQGA 3P45B 4CZCA 5JUMA 4NWBA 1SC1B 2MZ1A 1SL0A 2G0IA 3AQPA 1MROA 1R89A 1FWPA 1TUGB 3VAHA 2FGOA 2HSEB 1OY9A 3MPYA 5HMXA 1NDKA 1VFJA 2JFKA 2DNMA 5IQQA 4BC9A 3KLFB 1P8GA 2MGZA 4IKAA 1C1BB 2F1FA 3GIIA 5IC4B 1NHVA 2I6WA 2V8DA 2HWIA 1C0UB 3MD1A 3UDVA 5JJBA 4YN3B 3H40A 2AJ0A 2AP6A 2OPSB 3FSYA 2G1HA 2M70A 4J9MA 1VQKS 3KG0A 3A3PB 3FRZA 4DN0A 1PC5A 3DRSA 2CQ4A 3DKDA 1JLAB 4X4QA 4UQGA 4HHJA 3I0SB 4FYWB 4HT7A 3PRDA 2JNJA 2J6SA 2EKYA 1RB0A 2WBRA 4RW7A 1XK8A 3SBMA 1A9NB 4WKRA 2VICA 1FI4A 4X65J 1Y3JA 2RNEA 3KUEA 4X4TA 3QQCD 4PWDB 2B4VA 1RT3B 2YNHB 1FESA 1N6QB 2B6AA 4KV8A 3IXQA 2Z4PA 1F2HA 2CWXA 2GGPA 4ZK7M 1M5OC 1SVDA 1N48A 4ECTA 4OX9F 1B64A 3I82A 2HHVA 1Q4RA 1HW8A 1UW9A 2XI3A 4MKVA 5D4LA 4A8MP 3LTOA 5AE2A 1RT2B 3D9BA 3KK1A 4JI6F 2IA6A 3FVYA 1URNA 4LUBA 1S48A 5IT9Y 5A8WB 5CCMA 1REVB 1YK9A 2UV8A 3TARA 4IFYB 2BVZA 2HHSA 2HWHA 3IBWA 2PMWA 3DDNA 1HARA 1T9VA 1D1UA 1T9TA 4A47A 3OUYA 2YBVA 5FJ4A 1FTRA 3Q8UA 2XZDB 3PYEA 1V3RA 2QGFB 2V6AA 1RTIB 2GMHA 1KFSA 4ED0A 1EQ0A 1S5ZA 4NYPA 3US5A 3BGUA 3VQTA 5KFEA 4TQSA 1NJIT 1AZSB 4IDKA 1F5AA 2V4JB 2I2YA 3OXGA 3DYAB 5DQGA 4DR6J 4DX7A 3EXYA 5E3AA 2JH3A 2ZJPQ 2HGMA 2ZBCA 3MM7A 4P2XA 1WSVA 1WKKA 3IRXA 1RWXB 2GIFA 4NLOA 4RNOA 5H1SV 4DR5F 4DR7F 4J9QA 4AYBD 2QX0A 2BX6A 2F4VJ 2IBOA 4ZCLA 4DV1J 1IKWB 2ZH3A 2XZWA 1NJWA 1NK6A 3MEDB 3PM9A 1IBKJ 5F3TA 5LSLA 4AFFA 2HGNA 4WJBA 3PIPQ 1YJNS 4Y2CA 2OTLS 3R2DJ 1NMEB 3IRXB 2XYPB 5H9FK 2U1AA 2VUGA 3GV5B 1RLDA 2BE7D 1WI8A 1R31A 2FTRA 4O44A 4V19J 1DTTA 1JLGA 2CPJA 2GNKA 1A6LA 2HQIA 1E6YB 3CMQA 2EG2A 4PZVA 3D1QA 5F0UA 3H8YA 2RRBA 3M9OB 4MK8A 2I8EA 1RTIA 1R0AA 3H4BA 5BYQA 3ZTOA 3WC2A 4RW6B 1T05B 5B0GA 1RYSA 2N4CA 2R2RA 1V5VA 4B9VA 2QFIA 2XEXA 4NCAA 1HMVA 3IWXA 5IV3A 1HQEB 1KLNA 1UA0A 3B6BA 4HI2A 1HKAA 4C9DA 1KP6A 3DOLA 8AT1B 2CQ3A 2CRLA 3FEXB 4BBYA 1N0VC 3B4MA 3R7SB 2HBRB 2CZVC 1REVA 3IA0A 1EZZB 1QJHA 3MAHA 3UDCA 3K0JA 2DXDA 2V68A 4X65F 2UUAF 2J5AA 4YB5A 4CO0A 3MPDA 1FKPA 3V6DB 2IRYA 2VB6A 1NK8A 1UWAA 1IBMJ 4F3OA 4WE1B 3HJFA 4ILMA 3UDLA 2V5HG 2VL1A 5B0CA 2A6MA 4K7QA 4ECVA 2UUCJ 1VQ6S 4KV8B 4M95A 3PFOA 1RAAB 2LYVA 4KHMA 1VQNS 2YKMB 3LPEA 4UQTA 1TL1A 4LR7A 4NLTA 1H2UX 3O5TB 4H4MB 3L7PA 3MCNA 3NGTA 5KFGA 2NXJA 3FBBA 5A2QY 2MKYA 3GIMA 2RS2A 4IUFA 1BLUA 4RX6A 2IAJB 3CMES 4FPRA 4HDGA 3I0SA 3TZZA 4ECZA 4M5MA 3JS9A 2OEJA 3CVKA 5EX3A 3ZC4A 1RT4B 1NUEA 2HNZA 3MMBB 4WBFA 2AKWB 4A4JA 3BGRA 4DR5J 2W25A 1FWKA 5KFOA 2RRAA 2E1RA 3G8SA 2MGZB 1I94J 3R8YA 2HWTA 2HVDA 3HSJA 3D0GE 3IN5A 1S4EA 4JI4F 1UTAA 3KHGA 2J0QD 5F3ZA 3NOCA 3UCGA 4A8KA 1HYSA 1RTHB 3CCLS 2QLBB 2X1BA 4WE1A 5B0AA 3LP2B 3CCMS 4ZVEA 4OI6A 7FD1A 3V6DA 2V94A 1ZH5A 3QFWA 4BC7A 5ETOA 1ZAXA 5HQMA 1CJVA 2UP1A 1CLFA 4OZ2A 3CIMA 2OGUA 2LQBA 2RE1A 1RKJA 4ZOSA 1BQNB 2W24A 4J90A 4QJVA 4W98A 4JYAJ 4CCHA 4WP3A 3FFIA 3QT5A 2ZZMA 2GJIA 4DUZF 3KG1A 2PI4A 3GR0A 3DRXA 1UWBA 3H5SA 4U8VA 3CEDA 1S1VA 4B17A 3KLIA 3DHXA 2K3IA 2BJDA 1S1UA 4USKA 2DPJA 2JJ4D 4LBHA 1GH8A 1JJ2R 3DDKA 1R0AB 1NDPA 4OHXA 2VPZB 1E6YA 4FVCA 4RNNA 2O5DA 3QGGA 4GVBA 3DLBA 2DEJA 2EFNA 1G1XA 4CTAB 4EUVA 4YMEA 3C3LA 2RMLA 4FVMA 3M8YA 3MAQA 2B8PA 5LM7E 1KQSR 5DDOC 5HK4A 1OQ6A 2QSWA 3PO5A 1M5HA 4XDDA 3B54A 1WC3A 4Q2MA 2KL8A 3PYDA 6FD1A 3VGSA 2HIQA 3ZZ0A 3OV7A 1IKWA 5B0EA 4KKOA 4HR2A 4R0JA 5KT3A 2MHNA 4NI2B 4H4OB 4Z7YA 2NUHA 3MMAB 2LU1A 2YTCA 3AXKA 5IT0A 2YPZA 2ZDOA 4FYYB 4RO0A 3MM7B 3W7BA 3NGUA 2H4WB 2QLFB 4CP5A 5HMYA 5CD4A 1LWFA 4MIAA 5HO4A 3ADAC 4IDKB 3D3BJ 4M5HA 2MQQA 3VWSA 3CULA 3NWRA 1SKRA 3IFEA 4HLBA 1XR5A 3M32A 4ZVUB 3OTOF 3HLUA 2WVBA 1W2IA 2IJRA 1MWQA 4DPYA 4ZMMA 3RB3A 1NH8A 3GSIA 1H98A 3OUYB 3KLHB 4Q8EA 1CEZA 3DGPB 1M5SA 1UZDA 2ZEJA 4CO1A 1NB2A 3DOKB 1UJ4A 4OYOA 4OZNA 1S49A 1Y9OA 3O8WA 1VQMS 1RTJA 4YY3J 1XMQJ 4P73A 1RT2A 5BR8J 2JVOA 1CPZA 1O0PA 5HROA 1QM9A 2GO8A 4I2QB 3R9LA 4U7CA 2HAIA 1H7WA 1YJUA 5LSOA 2NXEA 1DLOA 2CQ1A 1CBKA 4NZ6A 5L9XA 3Q0AA 4EEYA 4P72A 4K5SA 1WC1A 3JSBA 2VC1A 2OH2A 2ZZNA 2AGQA 1QTMA 1RABB 1B3TA 3VCDA 5EX0A 3H20A 3HHLB 4RWWA 1NK5A 5KFQA 4K4UA 3VZIA 2XG8A 4FS1A 1MU2B 4DFMA 4U95A 1RAOA 2QO3A 3RRKA 1PSDA 1VISA 4RBTA 4QWCA 2W9CB 5H9EJ 2ADCA 4BLGA 4DR4J 4XDCA 1MMDA 4MKAA 3K2YA 5DJBA 1ELOA 3M2VA 1TV6B 2FUG9 3MMAA 1W7WA 2VH7A 1K0VA 4X62F 4KPYA 3RRGA 1OO0B 3MWBA 2VDIA 3MR7A 4KKOB 4JUZA 4DQRA 1IBLF 1OWXA 2GVDA 5D4OA 3UN5A 1WEYA 3A1YG 4WYLA 2QYGA 2WB1D 4G3IA 3TAQA 2UZAA 3BS9A 4YR0A 1KWMA 5LXYA 2CJ9A 2IIHA 2VASA 1JK9B 3FDSA 3ICLA 1DY3A 1IQZA 4XO0A 1I3OB 4X4SA 4FS2A 1WF0A 2K7JA 2KT3A 2OPQB 2YY3A 2VG5A 4KYZA 5KG0A 1U1RA 1JLBB 2DGSA 5KFXA 4TYBA 1HNZJ 4ECRA 1FDDA 2FHOB 1QE1B 2CDRB 4EFAC 1BWEA 4OHWA 2L9WA 3QWPA 1PAUB 1NO8A 4CLPA 1XC9A 4W4MA 1Q81T 2PFDA 4F4KA 3D1OA 2F40A 4QOTA 4ZP9A 3RAXA 3CCQS 1LWCA 2GHWA 1UVNA 1RAHB 5DG9A 5GMEA 1FE0A 1U1NA 3PX0A 1HPZB 1WSRA 3IWLA 3PEHA 3TVZA 3U1NA 4NASA 5J1EA 4UZBA 2GCFA 2JEIA 2HVZA 3CW2C 3W2VA 3BV8A 2KTQA 2V34A 3DI6A 1ZOTA 4JBCA 5CH7B 4TVAB 1KQFB 2YQ1A 4BWJA 3KMQA 1FJ7A 4M5DA 1N34J 4LFCJ 4GO5X 2XZTB 5IQ6A 2Q6BA 4I69A 3W1YC 2LFVA 3J81j 4L73A 2XSJA 3HMJG 4ZIVA 2WONB 5KT6A 2KFZA 2X1FA 4LBIA 3LANA 4NLXA 3M2VB 3NGRA 2R7UA 3DU5A 1R6VA 2NCKL 4WWSA 3S7RA 3NAIA 4R0EA 3ZZYA 5CD4H 5KFAA 1WORA 3JB9k 2UVRA 2GHVC 2YWEA 4URSA 3WHIA 3GFYA 2ZC4A 2KXHA 3D0IE 3G9CA 2ASYA 5HLFA 4JV5F 4CI0B 2ATCB 4OI4A 4EZ6A 4JI5F 2ZBQA 4LQ3A 2BACA 4Z37A 2AIRB 4ICLA 4TYAA 1TZ0A 2LEAA 1OYDA 4FBUA 1ZBTA 2RH3A 1OPIA 3UR3C 5ETLA 5GADI 2P8IA 3FRYA 5DS7A 1RJJA 3BKUA 3AY0A 3DLEA 3M8WA 2ZITA 4NYZA 3DU6A 4Y2IA 5AXKA 1YJ9S 3H5UA 3BREA 1HR0J 4LRAA 2AYGA 3QT6A 1PYTA 3MAAA 3PX4A 3ETOA 2DHHA 2IA0A 3N0VA 1N32F 1NZ8A 1V6HA 2MJNA 4FXVA 4XK8C 2JEGA 1X4FA 2HMIB 2WAQD 3X3UA 1YX2A 1N5QA 2Y0SD 3ENAA 4PXDA 4Y2AA 2HZCA 2WW4A 3UI3A 4DS4A 4O3SA 2IVYA 3FMWA 3RYLA 1SJ1A 3NL0A 3ISZA 1X7VA 1HMVB 3L95X 3OFHA 2ZHBA 3IGVA 1D9AA 4NLUA 3C66A 3C14A 5LMNJ 2DGOA 3D6TB 2E1CA 2Q79A 3KHLA 4B3OB 1FHTA 2WOMB 4MFBB 1U6ZA 2MEWA 4WK3A 4Y00A 2VQFF 1VQLS 4LF4J 1V3ZA 3K5OA 4JI2F 1AB8A 1FRKA 3UCUP 2AHOB 1LW0A 5HVFA 3V2UC 4P75A 4F26A 3GQCA 2RDIA 3FKBA 2IM1A 2W7PA 1J5OA 4DL5A 4C0HA 1S9EB 3BYPA 5DLGA 3M6XA 4PG6A 2ASDA 1R8BA 2MYFA 1LW2B 3J7Z5 3PW2A 1HBUA 4P9SA 1S57A 1YZ7A 5D4PA 5GAGU 1S76D 2E44A 3BBFA 2Z56B 9RUBA 3DMJA 4ES1A 3AH6A 1X0FA 3M30A 3MTKA 3OR1B 3M1VA 4PPZA 2ZNYA 5KAKA 1PG5B 2FLPA 4LVOP 2WSFC 3CJ4A 4LT6A 2EFVA 3AQOA 4OZJA 1ZM4A 2OELA 2LDIA 4LRDA 2HFZA 3SCKE 5LJ3Y 3VAMA 4E2FB 2R9LA 1AXQA 2WOMA 3FGVA 4MFBA 1BHNA 1R7IA 1J5EF 2DR8A 1R3NA 2DO4A 1U4BA 2QL7B 3TJ8A 2CXEA 1BQMA 1UJ6A 4OX6A 4WP9A 4MJKA 2X1AA 3HSZA 1IXKA 1HWKA 3SMZA 2CPXA 2DY1A 2MZQA 3PW7A 2LQ8A 4WK1A 2BEFA 1C4AA 2I5JB 3HKWA 5A0YA 4KPCA 2CPFA 3TP2A 2DR7A 4OMFG 4NXNF 3I56S 2B43A 3WQPA 3R7BB 4DR2J 1LNQA 4DR1J 3ILOA 4IG3B 1NSPA 4F04B 4N8OA 3UNYA 4KSEB 2JLGA 2ZOGA 4ED1A 1LWXA 3DOMA 4MT1A 2CJKA 3V5RA 3LAKA 4YFUA 1YHQS 2FDNA 2QEXS 3GE9A 1FFWB 2KG0A 3DLEB 1WEZA 2MKIA 5IS2A 1UFKA 3QJJA 4EO6A 4NE9C 5DZ7A 3Q89A 4BHQA 3PJWA 4NPOA 1FVSA 1U2RA 1WNEA 1HWLA 2CQ2A 3O6QA 3C6TA 3BH6B 3FZ2A 4DLEA 3JYTB 3AOCA 2XCPA 3IR7B 4CLTA 3MPUB 4OI3A 2MZRA 3FEYB 3CTRA 2J8AA 2HK2A 3ET6A 3E51A 4JB8B 4RW4B 4ZLNA 4FF2A 1IM6A 2F8MA 2V8PA 1VC0A 4M5IA 4F0KA 5CYJA 5J2QA 2ROPA 3EUNA 1K0TA 5K14B 3V6HA 2L48A 1C0UA 3MR5A 2LA6A 3N01A 4CLSA 2DGXA 4LFBJ 2LXFA 1Q8LA 2WONA 5DGAA 4DUYF 1RQ0A 5EHHA 5L8RC 2AJ2A 4JI6J 2FJEB 1ULRA 1Y0HA 3Q8PB 3AOAA 3FCHA 2WVCA 2R2TA 5M2RA 4FP9A 3MM9B 1JIHA 2Q66A 2RSQA 1YKWA 4DMZA 2MKHA 1KVIA 1KNZA 3W2VB 1U45A 1NSAA 5KFIA 2HHTA 2K7KA 4ELVA 1RCXB 2QG9B 1X8DA 1MMNA 1FFSB 5MAOA 2LEBA 2GIQA 3R6LB 2D9PA 1B7FA 2ZE2B 2VFRA 3GP9A 2EXUA 3OL6A 1MN9A 2J6UA 4DV2J 1U0HA 1NK4A 1D0EA 1WJ9A 3LGHA 4C0OC 5LXRA 2DPIA 3Q2TC 4I6WA 1KVKA 3M8PA 4PG4A 4N76A 1VRUB 2KO1A 4ZJQA 5IM0A 4RW6A 5GAGI 1SV5A 1LK5A 1WDTA 3QJPA 2GMJA 5C5JA 2R8JA 4QCLA 8ATCB 3R5DA 2YWFA 3T5KA 5F41A 1T03A 1RTDB 3CT9A 5KFRA 4KGMA 3RB6A 1KKHA 5G0RB 1Y10A 3OR1A 5KFMA 4HI1A 3CC4S 5K8NA 2HNDA 1OS5A 3IO1A 4IRDA 2IHR1 1RZMA 3J7AN 4QYZJ 4S0MA 5J2MB 2YNGA 3OHAA 1RWUA 3A8IA 3I87A 1K1SA 3MPWA 1TELA 4CLWA 1FK9B 1U6BA 2PT0A 3EE3A 4LF7J 3LGMA 2FY8A 1J5OB 1FDBA 3CJQA 2BA9A 1LW0B 2DGUA 4HHHA 2O67A 5KFJA 2DKOB 3M05A 1VQ9S 3D66A 4USIA 1FRXA 1AFJA 2OPPB 3I4PA 4OX9J 1CS4B 2RVJA 1D09B 1GK8A 1KC8T 2XYGB 2ZNZA 1O8BA 1F6TA 3C14B 4PYAA 1FRJA 1R0BG 1RAEB 3CCTA 4A8OA 3AJ2A 2KM8B 1NK9A 1KD1T 2BJ1A 4ID8A 2KHCA 4B3MJ 1AFIA 3VF0B 1S0NA 5SZTA 2AGPA 4ZPBA 1SJRA 2H9ZA 3MD3A 4KO0B 3PHEA 3TQEA 1DLOB 4IFYA 2YWGA 1YWXA 2XLKA 3CB4A 3GCWP 4ZDNA 1EKRA 3M6WA 3HX9A 5KFKA 3HD2A 4FKXA 2PA8D 2Z58B 1U6FA 4AXJA 1RTJB 1VK8A 3MAAB 5JMNA 1PYOB 4Y34A 2JHEA 2BKOA 3G8QA 4LIRA 2VQEJ 3GG0A 1APSA 5IT4A 4ZS6A 4AQYJ 1WACA 2EFOA 2DHAA 2C3YA 4DR7J 2CPDA 2V8HA 4ED6A 1VRTA 1T94A 3EZOA 3QSYB 3KLHA 1U1OA 4OJ3A 4PQAA 4K2JA 2NLWA 3QWUA 2GFFA 5I4MA 3EPGA 5EWGA 4R5PA 2VKZG 4LRCA 3R3TA 2UVWA 4P7VA 2KRBA 3RB0A 2CG8A 3BSAA 1WOOA 4RW7B 4PG8A 2R42A 1T0TV 4RW9A 3S6EA 1P6TA 5KG1A 4TQRA 1RHKB 2IM2A 2EFPA 2VC0A 3MUVP 2MXYA 4U8YA 3NG8A 5BR8F 3KJFB 2HZVA 1FK9A 2NXUA 3HDSA 2HLTA 3SSSA 2MTLA 1X4AA 3HULA 2IVFB 3LUYA 2HHHJ 5IOLA 4DU7A 2UXDF 2V9KA 3LP1B 1WG1A 2QA2A 2GO9A 2IRXA 4M5DB 3CCZA 4P7TA 4WFXA 4WPAA 3GMGA 5BYRA 4CH0S 2J76E 3D6FB 3IBFB 2PD1A 1SJQA 3HKZD 3KUGA 4HTIA 3T6BA 3UCZP 5F8LA 1RAFB 4L6V3 2DHGA 3JSYA 4O3OA 1RWNB 3PFEA 3OLAA 3D3CJ 4ETXA 1WF2A 1Y00A 2Z30B 4EBDA 1IBCB 3TX0A 4URGA 1PIEA 1FA0A 1GMWD 4YQWA 2ZUGA 3R2CJ 3I0RA 3ZZZA 1SIWB 3DLJA 4HACB 3OSNA 2QLWA 1YJRA 4GRSA 1TL5A 1VK3A 4J37A 3K57A 3LW5C 3JTPA 3QT7A 4KB7A 1D8YA 4IRKA 3KK2A 1SQFA 3SXLA 1LWEB 4KGVB 4PAAA 4YR3A 2KHDA 1B0TA 1NHKL 3FQKA 3PRBA 3VAIA 1K8AT 3TUJC 1XNRF 8RUCA 2XMVA 2FC8A 3JTOA 2KB2A 5K20B 4K4SA 1Z1ZA 2ILZA 2XMWA 1UW4A 2G2YA 2ZH1A 1XMBA 2BBEA 3HHDA 4P10A 4NOHA 4CQ1A 3ZZOA 3X1LB 1TR0A 4J91A 4DPOA 1AROP 4CT8A 5KT7A 3UWTA 5KFHA 2VD3A 2IMWP 5FDLB 2CADA 1FJEB 3VQSA 1BMQB 2DJWA 3A3NB 2YXLA 1SL1A 3IM8A 1VLYA 2CNOB 2CQ0A 2F7VA 1N5VA 2D41A 2LA4A 4NLQA 4DZ6A 2CQPA 1GFWB 4RBUA 3ZNUA 4WFBQ 3BYRA 1UL3A 2MHEA 3KMSA 2J9EA 4MH8A 4J9PA 3G96A 3DRPB 2W2OP 3BGRB 2BW2A 2PA3A 1TV6A 1MNEA 2E9ZA 2XCAA 2VBZA 2HNZB 2RILA 3MMBA 1RKIA 3A8EA 3HI9A 1D3WA 4H54A 1IKXB 2P2CB 2DR9A 5C42A 1XNQF 2JEJA 2FJBB 2UU9F 2MKJA 3PW0A 4MMOA 2PO4A 3TI0A 1JLCB 3BKFA 3HHLA 2B9XA 4PPDA 4JP8A 1SCJB 3Q23A 1HI8A 1U8WA 4ZLLA 3QGHA 5HVHA 4H4KC 3RJMB 3CC2S 1IR2A 1CC7A 5CHCB 3RBZA 4LF2A 1YGYA 1F5CA 3J80U 3CCJS 1HNWJ 4J9VA 1T95A 1DFDA 4WKYA 2NZ4A 3THVA 2OIHA 4M1KA 3PJXA 5KT2A 1M1KT 1WHWA 1WG4A 4JI4J 2DNQA 1EP4B 3UFCX 3J7YI 3MHYA 1EQMA 4G1IA 5LT5A 3TA0A 1GTEA 1I6JA 1S7IA 3FSIA 2R7TA 3C6UB 2WK4A 4K4VA 1K1QA 3DOKA 5HBMA 5L1JA 1FNXH 1FNMA 2B4PA 2M8HA 1TL3B 1NKEA 4C6AA 4HKQA 1B0VA 4ZKAA 4LR8A 1HIYA 3GONA 4K8RA 3KJVA 4CNYA 2MSTA 4USWA 2Y1IA 1JLFA 3BN7A 4FPIA 1A0OB 1VS3A 4F7VA 2NQPA 2HQFA 1Y5LB 3KDNA 2COLA 2DGVA 3NEKA 1UEKA 2YVSA 1U48A 4OYBA 5D0HA 1DZ5A 5DM6Q 3AD7C 2EBGA 5IXUA 3HK2A 3I9ZA 3EGZA 2V4QA 4F4YA 1NPKA 2PN6A 3MEDA 4NI2A 3OTOJ 3G8TA 2ASLA 3NGSA 3MURP 1HBUB 5D77A 4DSLA 2ZBPA 4Q0BB 3MMCB 3R7NB 2DXFA 4YOEA 2MSSA 2QV6A 3GYNA 1Q0NA 2Y9HA 2DNOA 1FJCA 2HS0A 4UOFA 3WIUA 5HROB 6AT1B 3SYZA 4DQIA 1JKHB 2FHMA 3RBDA 3A13A 3KFWX 4RUBA 5E41A 1XIQA 3OR2B 1YJTA 3H42A 4KGZB 3OVAA 4A8FA 4LF5F 4X4VA 2AMCB 2OD6A 1RACB 2E5JA 3D67A 4DZDA 3J7YU 3UVJB 3IS9A 2SXLA 4LSZB 4M5LA 1RWOB 5A8KB 2DCUB 2N3LA 1WEXA 1WI6A 3SZ2A 4O0NA 1VQ5S 1IM4A 2UXBJ 1TKZB 3QRRA 3GG1A 5ADZA 4DQQA 4KC5A 1PC4A 2RIJA 2ROGA 2AWZA 2DXEA 4TN2A 1LK7A 4K5RA 4PXEA 2HIYA 2CZ4A 3FCVA 1FRMA 3LO3A 5KFUA 3M8QB 1NPRA 2XI2A 4CLFA 5CQGA 2BRLA 3JQJA 3R5JB 2KXNB 3KK1B 3GZ7A 5RUBA 2QTWA 2VPWB 3TWZA 4R8UB 3TUZC 1NCLA 2RD5C 4N41A 1YBTA 2HZAA 2YKOA 3DCAA 5SUHA 4OYPA 4ECSA 1VC5A 1UEUA 2F9JA 2ZD1B 2D3UA 3THTA 3DM2A 1YITS 1HL6A 5F8IA 2WW8A 4J9KA 1N5YA 2R8KA 3T1AA 2G2ZA 3M6VA 2UUTA 5HLFB 3FK4A 4OZ3A 1R0CB 1X5SA 2F5GA 2ZHOA 3OVSA 4DWIA 4I56A 3DRSB 4U96A 2CQBA 4ZN1A 2OPSA 3AOBA 2ZM6F 3RUBL 3NOGA 3M2UA 4G1QB 3NCPA 3VR1A 2J0XA 2R3VA 2HBYB 3W63A 3V81A 1KRPA 1NH7A 2KVQE 3TVYA 4DSFA 5DLFA 4QIWD 1S1XA 2VFSA 2YKMA 3CO9A 3HFZB 4QU7A 4LF6J 1CJUA 3VAFA 2UUBJ 2OMLA 2Y1JA 2YX1A 1H7XA 3OTEA 3HSGA 4ZLPA 1NB7A 2QRRA 4I0WA 2HBZB 4KY3A 2B51A 2V63A 4L74A 1IUJA 2KT5A 3D5MA 3MZIA 4X4OA 3RAQA 3U1MA 2AX1A 2Z2YB 1JNRB 1H72C 1FF2A 4I6YA 1VQOS 2A6OA 1KBRA 1T3NA 3FJ2A 5K8OA 1RDRA 3AB4B 3ILLA 2D9OA 2M4MA 3ELHA 1IKVA 4C3MA 3PDNA 3DHWC 1UMJA 3DLGB 2XTJP 4QIEA 3DLLQ 2YPYA 2ZOMA 2C2RA 2FJVA 2VG7A 5F9NA 2KKHA 5ETSA 3CCUS 2AJQA 5KG6A 4DLGA 4TU8A 3TUIC 2OI2A 4DR1F 5GMKa 4FBTA 3FEZA 3N4WA 5F8GA 1CSJA 4O44B 3G2XA 2XHWA 1HBOA 4M5KA 5H9FJ 2K8GA 2D3OR 4IFVB 3PJ9A 5HJXA 3W3SA 2E5IA 2PE8A 1N33J 3VV2B 2DHSA 3CSKA 3A3OB 1RLCL 4LSNB 3EICA 3ULHA 1FKOB 2L9DA 3MF5A 4MIBA 4QR0A 2CQDA 3V4MA 4F50A 3H2VE 1H0HB 3W5ZA 2GVDB 3CDBA 1UFWA 1U24A 3TEGA 2Y3YA 1EKSA 1RHUB 4U7UK 5E3PA 1FTCA 2B0GA 5LJ5Y 4LF6F 3H90A 5J2PB 4X4PA 1RP5A 3RR8A 3I32A 3UD4P 5HP1A 2EC0A 1IVZA 3TW0A 2NZCA 3OFFA 1MU2A 3TYTA 4EWTA 1AZSA 2GVZB 4M5JA 4OZ5A 4XAKA 4DX5A 1L3KA 1TAQA 4KT0C 2QFJA 4A8WA 2U2FA 2MB0B 2ZM6J 4PG7A 4FN5A 4IYQA 4RL1A 1Q79A 2WRMA 3IGNA 4KAIA 3J7ZT 2J9DA 1HQUA 2Z2MA 3BO3A 4JI2J 2WBMA 5DRKA 5B0DA 3UPFA 2D3ZA 5T14A 2WSEC 1I1GA 3C16B 1S99A 2APOA 3TA1A 1RGVA 2HGLA 3CGIA 3GSDA 1G3OA 2ZKTA 3PNIA 2QA4S 2BQ3A 1N56A 4IG0A 2FVRA 2Y8YA 2D3O1 2ZH7A 1WHXA 2Z0GA 2GV1A 3HHKA 4MYUA 4F4AA 5LMNF 1RAIB 1Z2LA 1JMTA 4NLVA 3J81Y 4HYKA 2D1CA 2AYMA 3C15A 1AYEA 1S9GA 5KOWA 4KHRA 1NEEA 1TK5A 3H0PA 1B70B 4K2XA 3MFHA 2ZC3A 2QMXA 2M52A 3K8WA 3OW2R 2FC9A 3G6XA 4ED4A 4M94A 2KM8C 4J9OA 3B78A 3R27A 2JLFA 3ZTSA 5HQ8A 2HKEA 2QYCA 2LQJA 2FYXA 3DGPA 1NDCA 4FNIA 5F0WA 3MM6B 3S01A 4DV0F 2DH8A 1K44A 2AJ4A 4ZHRA 4ZLJA 3VGVA 1NRKA 2GW8A 1MWYA 1TKXB 3LWLA 3O44A 3D2WA 5CYQB 1KN6A 3BEGB 4ZVFA 3OXFA 3W2WB 1TFYA 1SH0A 3ILIA 4DCOB 1WC0A 1LWFB 3U7JA 3AFGA 4NLGA 2W1BA 3ZO7A 1URRA 1F0XA 3KLGB 2P6SA 2XMAA 4LF5J 3QZ8A 4FYXB 3CDEA 1CJTB 1N33F 1SQEA 3A4TA 1C1BA 2JC0A 2ZVSA 3CJRA 3T1HJ 2DR6A 2LECA 3KLFA 1QSYA 3H5XA 4OI1A 2IBKA 2CA9A 4ZN3A 3QATA 4ZCIA 1ROFA 4FNHA 3HT3A 4X2BA 1VI7A 3G86A 3TEHB 2IJNA 1HI0P 3MOZA 4BS2A 1NJXA 1XR7A 3TANA 2X7IA 3IC1A 3N6NA 3PYFA 1CQNA 4AL5A 5T7LB 1TMMA 4ID5A 2FQQB 3FBCA 4DI6A 4XIUA 1J5EJ 2DNYA 5A6PA 1VMBA 1WOPA 6FDRA 1TUVA 3D68A 4DV4F 2IC3B 3LPYA 3BB5A 5ETMA 5DZ6A 2W9BB 2BJ9A 7FDRA 1RWPB 4UT4A 4Q5VA 3BZQA 4OYMA 4NLYA 4ER8A 2WSCC 3I9V9 2AEMA 1DRZA 3DC2A 1PCAA 1CJKB 4FXWA 4C0BA 3JSRA 1X4EA 1FD8A 2VDHA 4D3GA 1RAJA 1KHVA 3PIOQ 2QL5B 4RUAA 1QLNA 3ENQA 1RK8A 2QC3A 2K06A 7AT1B 4WXWA 4KH0B 4MIWA 5HI7A 4DOZA 3RRHA 1ZM3A 3FBFA 2Q1LA 4OYAA 3E01B 5A76A 2KFYA 1SJ3P 1F1BB 1X4GA 3OQ2A 1Q82T 1D9DA 4B9NA 4O3RA 2MQ8A 3LP2A 1SXLA 4USMA 4ZA1A 1RTHA 3P5TL 5JVHQ 3N28A 1N0UA 3T9ZA 4ERDA 3Q24A 2V50A 3GCXP 1T3OA 3TRGA 2IYIA 5FLXY 1R27B 1L3TA 2KU7A 4YP3A 3PRVA 1FJGF 2V0NA 1X9MA 2CJAA 4DV6J 4QWAA 1QSSA 2C2ZB 1NDLA 4ALZA 3WDOA 1VHIA 2G0JA 4DG1B 1Y4ZB 1WDDA 1FJGJ 4MTPA 4F3QA 4KFBB 2ERRA 2DCLA 1EETA 2C3MA 3DLKA 1GMWA 3HVWA 1PKUA 1O5JA 1AUDA 2FVPA 1ITPA 1XN9A 4PUOB 3AA9A 1RHMB 2IAJA 5GADU 2HG4A 1RWVB 2DVIA 4Q43A 4RW8A 2N7CA 3L09A 2RQ4A 2W7OA 1B4SA 4DFKA 2DD8S 1OIAA 3BPSP 5D15A 3UO0A 1YJWS 5F8JA 3PR4A 2H5IB 2V9WA 2EFGA 4Y28C 2C2OB 1HWIA 3RU0A 3B82A 2MZSA 4O3NA 4B9TA 3LF0A 4LF7F 1FKPB 3F44A 5E0OA 3L3CA 3V6JA 2MLXA 5KG7A 1VQPS 1DURA 4JI7F 1CQMA 1RCOB 4OX7A 2Z2ZA 1S0OA 1TKTA 4X66F 2LKZA 2D74B 4LBPA 1QSLA 1HA1A 5E5NA 1WTBA 2MPUA 5CABA 2BV3A 4X64J 1CULB 3UNGC 4ANEA 3J80Y 2VA3A 2GQQA 3W5YA 3HHNB 3NY0A 3TZXA 4DV0J 1WC4A 2M5YA 1H74A 2LLZA 4USUA 1N88A 1T05A 1S12A 3PHTA 3NCQA 2E5LF 4NLRA 3OT9A 1F9HA 2W9CA 2ZBRA 4U9RA 4QPTA 1EJ7L 2FLNA 1DTTB 1JLGB 1FT8A 4FKYA 2MQOA 5KFCA 4ED2A 5C25A 4A8XA 5HJYA 2FD2A 5A8RB 5IWAJ 1YBAA 1F5BA 1H6KX 2BRKA 3MM5A 4L3KA 2VKRA 4DQSA 2YH0A 1S6OA 2JC1A 2CDQA 4UOHA 3CCSS 5HL7Q 2AU0A 4NRTA 4AE5A 2XNRA 4IH7A 4O4GA 2DRBA 4CM0A 1RBLA 2HK3A 1MW7A 2I38A 4Y65A 4J9SA 2CQCA 3FZBA 3KUHA 1BUXA 1Q95G 3NMAA 4JI0F 3BGLA 5E7OB 2YNFB 2BABA 1VGYA 2QSFA 3QGPA 3R97A 3KYLA 4CH7A 2XM3A 2AJFE 3W60A 4NCGB 5AJ3J 2CKWA 2V4JA 1HBNA 1VQ7S 2RAQA 3Q8VA 3QIDA 1S6QB 3EPIA 1JLQA 2B5JB 2DEIA 1QUVA 3BSOA 2BR0A 4DR6F 1RA6A 4ZPTR 4X66J 1ICEB 4YS2A 4ED3A 4QIFA 1SUQB 2C3UA 3JSMB 3VGTA 4CYUA 1SJFA 4OV6A 1HNIB 1KOOA 5KFDA 5I3UB 4ZPVR 1Q16B 3M9MB 1X5OA 4U7UD 1XQIA 4LSLA 2PIIA 2KI2A 5I3PA 2PGCA 2MQLA 1V3SA 2AEFA 2AV5A 3LP0A 5A8WA 1S7HA 3NAHA 4YEAA 2DNGA 2FB0A 4ZPDA 2HEKA 3OPKA 3RTVA 1WD6A 3LGNA 3UE2A 1FRIA 4NZ0A 4C3KA 4ES3A 1MMLA 3D7SB 3N9UC 3BSCA 5AXNA 3DXBA 4X4UA 2DO0A 2GGPB 3CJ5A 3D0HE 4USTA 5B0FA 4M63A 1IWGA 2B6AB 4DFJA 5CZXA 2NSBA 1N6QA 5HSPA 2ZH2A 4DL0C 3MOJB 2BUNA 4PWDA 4KH1B 4OZ1A 3B4DA 4CM2A 5DQHA 2B9EA 2MQPA 3CJ0A 3IMQJ 3DRRB 2Y0BB 3IR5B 4FF1A 3HHEA 2UXBF 3GJRB 4NRUA 4C11A 5HVGA 2R7WA 3E01A 3ZZRA 2GQ2A 3BR9A 3NNCA 2P9GA 1JLAA 5B0BA 3O1LA 4NX9A 2J7UA 3WBZA 1BGXT 2P9CA 4DPTA 1W25A 3BF4A 5H9EK 3CCRS 1T7PA 4ITSA 1VBZA 5GVQA 5IWAF 1W26A 2BW7A 2VFTA 2G4BA 3Q2SC 3OL9A 2V8GA 1BE4A 3CWJA 4PABA 4DV5F 1IN0A 3UR0A 2KN4A 3IG1A 2BJEA 3P8BB 2CPIA 2ILYA 3DRYA 5ETKA 1O51A 3G82B 5FLXU 1NXIA 3H7HB 2R2UA 4ED5A 4LFAF 1S72S 4K50A 2ACYA 3ITHA 3IP0A 1T02A 1ZM9A 5KOXA 3CDWA 2VZ9A 2OSQA 2XB2D 5KFLA 3OFGA 1M90T 4JI3F 3ITHB 1FE4A 4N8NA 3MECA 1SH3A 2ACMA 1OSDA 1S6PB 1L3VA 2P6TA 3G82A 2CJYB 1TAUA 1LFWA 1X60A 2RF2A 2FJDB 5D3GA 2VJUA 2ADBA 1RAGB 4I2PB 2V4RA 1FX4A 3GWCA 3Q8QB 2MQMA 1UA1A 2YQ3A 3BN4A 3NNAA 1OYEA 3SIPB 3ZXWA 2HHXA 2GX8A 2R7VA 4RNMA 1TVRB 3QO9B 4A8YA 1UP1A 2AYEA 3OJSA 4DL6A 4CO3A 4D3HA 3H5YA 2VA2A 3MM8B 2E7XA 1RT7B 2JOQA 3JXOA 4QQBA 5CYQA 2BE2A 3THPA 5L1KA 1Y3KA 3EGVA 5HN0A 3E8OA 2CNNB 5KT5A 2M2BA 4DV3F 2Y1RI 3NS7B 4RWXA 1U1LA 1C1CA 4EGLA 1F60B 3F56A 2HRTA 1RUSA 2HQ3A 4O4RA 4JYAF 2CZ9A 2LVWA 1M5PC 4WXOA 4OV1A 2CYYA 3AT1B 3SQGB 3OTBA 4G1PA 3UD3P 3KTQA 1JXVA 4ZP7A 3M8SA 2YKQA 4IH6A 1Q5YA 1H73A 3KLEA 1IBKF 2QJ3A 1HNZF 3I55S 3I5AA 3HHLC 4UZCA 2MKKA 4CRJA 3HT0A 2XO6A 2E5HA 4K4XA 1FNOA 2JSXA 1FXRA 2J9DE 4LSLB 1RT6A 4AQYF 4P2SA 3TR5A 2H1YA 4IOCQ 1HNIA 3I31A 3K58A 5FIIA 3D54A 2M3DA 1HW9A 2IFXA 3GJQB 3KKFA 3RAMA 1VDHA 2FVCA 2WVDA 3UQSA 2XGQA 4J9RA 2KZMA 1RT6B 4RUCA 3A12A 1ZAWA 1ZZFA 3ILJA 2RDDA 2QN6B 3DNCA 2DTJA 1EX8A 2E1MC 2E1PA 2BANB 2I1RA 3DFEA 3NBPA 4NA2A 3TJAA 5GAHU 4YB6A 4NCGA 3FBEA 3KLEB 2UVVA 3ZTRA 4RR5A 5EDWA 1M1HA 2BJ8A 1MG7A 2EVZA 3HVAA 4I68A 4F2RA 1HD0A 4TXSA 4LF1A 2LXUA 2FVQA 3F0NA 4KE5A 2IYGA 4CLKA 2OHDA 3H25A 1H38A 4I6AA 1HBMA 1FKOA 5DETA 2YX4A 4N77A 4OL8A 1GTHA 4UUWA 1FFGB 3K5PA 1QAJA 4JI0J 1VR6A 2HFNA 3BO2A 4AT1B 4Z7CA 4YR2A 4NLWA 1YVFA 2NREA 4CIOA 1SPBP 1F2GA 4QWDA 2ZH5A 3T5JA 2BQRA 3T41A 4NXMF 2A10A 2NYHA 1GAOA 3R5BA 2KZZA 4RPFA 1X4DA 1Z2ZA 3GFHA 3IAS9 2OAUA 4HL9A 2XSFA 2BKPA 1S0MA 1NKBA 3QIPA 1CULA 3H59A 4Q7AA 2KT2A 2MLZA 5IZHA 4ZVOB 3PZPA 2XY5A 1VJQA 1VOMA 2B9YA 3TZYA 4AD6A 3OFEA 3TOQA 5EWEA 1DQ9A 5EGYA 2VF3A 2HVEA 4P71A 5DM7Q 1HNWF 1VQ4S 3NMRA 2UXDJ 3PXGa 2UUBF 5K8PA 2ZWOA 1Y5IB 4X84A 3SDEB 3UN3A 1XBWA 3CJSA 3O3LA 1CC8A 4NA3A 4C2MA 3PO4A 5D6GA 2HFSA 2QL9B 2HW3A 1DQAA 3Q8SB 5D0RA 4DR3F 4YHHF 1DTQA 2LMIA 3FNNA 4DR4F 5F9LA 1CJUB 2C2MB 1EHWA 2CPHA 1GEHA 2GAGC 3IG1B 5C24A 5L39A 5L46A 3OL7A 3CMAS 1RBAA 1T9UA 1PJ5A 3AAWB 2KDOA 2HQCA 2VQEF 2CFXA 2MQNA 3H2UB 3KJNB 3R1HA 2UVUA 3NGDA 2O01C 2VODA 4G1QA 3W61A 1UETA 4HVZA 2HRUA 2DISA 2H65B 2DNPA 2KJWA 2RKIA 4WYWA 1D8ZA 2EFQA 3JAMU 1UVLA 1TK0A 2R7XA 1KHWA 2IM0A 1KOHA 1S1TA 4KFBA 3ENVA 3BBBA 2F4FA 3KK3B 1EAYC 1FVQA 4CO2A 5BYSA 1ACMB 2Q6CA 1RISA 1VBKA 2PMHA 4FF3A 1RWMB 4PQUA 1N5YB 3MEKA 4N47A 4YDDB 4E98A 4A48A 5B7WA 4JV0A 5KFNA 4K4TA 1WHYA 1ZZNA 2DNRA 4K0KF 2XBPA 2J7KA 1VIOA 2YKNB 3A8KA 1FO1A 1NLKL 2PEBA 1T8EA 2CAJA 4I1TA 1ZM2A 4LFAJ 2FLLA 2C2KB 4DR2F 4URQU 3HVRA 4F25A 3PKYA 2BYCA 2FY1A 3KNGA 1RTZA 1U25A 4O23A 1T9WA 3QAUA 3D6MB 4N7TA 4U6PA 1L3SA 3LP0B 4LF9J 1S1WB 2RKIB 2XMMA 3WIVA 4K4YA 1P9QC 3R1LA 3IWNC 1WUUA 2OO4A 3OHBA 2ALZA 1AA1B 4XTTA 3CXCR 5D4NA 2G9OA 2QA4G 3EDRB 1TKZA 3HFKA 4ILRA 1RA7A 2L9NA 4M8LA 3SV4A 1K73T 3UN2A 1P1TA 1Q8KA 1FKAF 1KLMB 4PWUA 1JXEA 4KR0B 5KT4A 3JSMA 4CNZA 2IC3A 2YH1A 4TY8B 4CLUA 3PEJA 2BM0A 3ZFVA 3OD2A 5F8HA 2H54B 2QLJB 4DHVA 2RS8A 2N82B 3OR2A 2NR0A 2B8QA 4TU7A 3CCES 2B3TB 1HNVA 5JVGQ 1QVGR 3IR6B 4DSKA 5FD1A 4ETZA 5KFWA 2DNNA 2DRDA 2QLXA 3QLHB 3P96A 2YNFA 3BJYA 4ZVRB 2WHOA 3MEGA 1F9FA 2QZ8A 4KGKA 4C8OA 3KWMA 1LXJA 2QT7A 2UUAJ 4K59A 2AF6A 2V2ZA 5KFBA 1PAEX 4HTJA 3TX8A 2BJ7A 4PKDB 1QAXA 4AL7A 2CQGA 2JFDA 4Y3CA 1J2VA 2L08A 1U7LA 2CUYA 3MR3A 1VYAA 4CLYA 1NNDA 1QAYA 3W64A 2PI5A 4IR1A 3PR5B 3KJQB 1JLFB 3WX8A 5J1NA 1ZTWA 2VONA 1IJEB 4QR2A 1LV5A 4ES2A 2MKSA 3N79A 1PILA 3CPWR 3TQ1A 3AB2B 3HO1A 2K1RB 5CXTA 1VLOA 2YNIA 3GR1A 1TK8A 2GC8A 4DX6A 2AEJA 5HBMB 2ATLA 1R6YA 1JJCB 4CLZA 1HI1A 3C6UA 4TKTA 4ZP8A 1IR1A 1IQTA 4USJC 1JLEA 4B02A 2JEFA 2CVEA 4DPUA 2QE5A 3PTWA 4OYZA 1OQ3A 2BANA 2HQDA 1OY6A 2MDAA 3MCSA 3NBPB 2CJQA 2VG6A 1FDNA 4OJHA 3AXMA 3L7OA 1UCNA 5LMUJ 1G2EA 1ZA2B 2FHJD 3AD9C 4TY9A 3ZZUA 3MPVA 4DR3J 4FF4A 1VBXA 4B3SJ 4TY8A 1V9OA 3N6LA 1XNRJ 3ISNC 4W90B 1KVJA 4P52A 1U09A 3QFHA 1FEEA 2H48B 5L9NA 4C8YA 2GQCA 2HQGA 4RW8B 3POTA 4QWBA 2LQ9A 4WFYA 4EYHB 2GVZA 4WFZA 2B4UA 2BOPA 1SH2A 2FHKA 3OJUA 5CA5A 5HP1B 2C2EA 2HLUA 3N5FA 4HH0A 1IKYB 3GU0A 3ZZTA 1FX2A 4DG1A 1DHMA 2DNHA 2J7WA 1XJWB 4WIQA 2FIUA 1TQLA 5CYMA 2UXCF 5CZVA 1NJYA 2E9RX 3BQ1A 3MEEB 1UVKA 1PBAA 3ISND 4OIXA 3V4IA 3CD7A 1JJ4A 1RHRB 1U1MA 1H2VZ 1RT5A 2OSRA 5K5MA 5J2NA 3MUMP 1HBOB 4EMDA 4JOUA 5EN1A 4ZVTB 5KFFA 4ZITA 3KK3A 1Q86T 4NXNJ 2ZH8A 4X4NA 1SI9A 1NZAA 5K8MA 2FZGB 1QDUB 4RLEA 5CAAA 1DJ0A 1PJ7A 4C8NA 5LOQA 3S8SA 2PFFB 3MFIA 4DPXA 3GYXB 5I42A 2IMOA 2DY9A 1Q78A 1CJKA 1X5PA 2RQMA 4F02A 3BKTA 3P4UB 5GMDA 2KYZA 3VALA 2HBQB 3PV8A 2HHUA 4MKBA 3KOAA 3CNQP 2RF2B 5D3GB 3QRPA 5HMWA 5IT9U 1G7CB 2CNLB 3LA0A 4LF4F 3I0RB 4OJGA 2KFNA 4NA1A 3ZTPA 3MXHP 3IM9A 2KG1A 3ENWA 2MJUA 4ID5B 1FERA 4NMXA 4P2FA 5T7LA 4DPWA 4RUHA 3CF5Q 4X64F 3EX7B 1U2CA 1GQEA 3SDEA 2UXCJ 5BJRA 3EVOA 5C2CA 4KHPF 3SSRA 3LWMA 4NLPA 4I7FA 4ZPWR 3K5LA 1NKCA 2R7RA 2M7SA 2BKNA 2GHPA 5BXIA 3HCXA 4WU2A 3H4DA 2RDJA 4JV1A 4I67A 1U2FA 1IJFB 9ATCB 4B3MF 2LQ5A 2J8SA 3KDOA 4ZPAA 4DV7J 2CQIA 4QIVA 2C22A 2XMJA 4PEOA 2OMOA 3EVMA 3CJ3A 2WTFA 3M7VA 3ETMA 4DV7F 2BXJA 1X0PA 4F0HA 1SC6A 2BQUA 1HLWA 3GV8B 4ECXA 4C8LA 1LXNA 5KFTA 1LQ9A 3W2WA 3K8VA 3OTDA 4DUYJ 4IQMA 1U47A 4B3SF 2D7SA 3QAEA 3DRRA 4LF8J 4R5PB 4KHPJ 3C19A 5J2NB 4Q44A 3LAMA 1KQGB 1YQHA 3BQ2A 4O0IA 5E3RA 4IQXA 4GKKJ 4NYOA 5AE1A 4ZCKA 3V4IB 4DFPA 1D9FA 1HBMB 5ITHA 2X1GA 2DGQA 2E29A 3DM2B 4OYWA 2W8LA 1L3UA 2C3OA 1N36F 2LP4A 4B3RF 4JI1J 2CVIA 3CO0P 3R6GB 3P49B 3T5HA 5E2QA 5DDQC 1XTZA 4FDFA 3KLVA 3G6YA 4IOAQ 5ETVA 1TL7B 4FYVB 4OFZA 4ZJOA 1LKZA 2XWYA 2PMZD 4QU6A 1TUWA 4DXLA 2MZTA 3GIJA 1HD1A 4TLRA 1HQ2A 1HNXF 2EWHA 3RGIA 3F41A 4KTQA 3POTB 2KVIA 3SCIE 5KTQA 2FHJA 1CVJA 2EI5A 3KG4A 5A8KA 4DEZA 3T5LA 2UV8G 2AD9A 2ZHAA 1OJ4A 3UVJA 2KXFA 3GIRA 1RHQB 3QBCA 3M9NB 3GIKA 1UEVA 2R8IA 1S6QA 3BQ0A 1Q1KA 4Y0FA 3EXCX 2P5VA 1CS4A 2IDLA 2VG6B 2ZJQQ 2DK2A 1SKSA 3PCOB 2WB4A 4PXCA 1RT1A 3P5BP 1KDNA 2RB7A 3FMBA 3LH2S 4X4RA 5ETQA 1G4CA 2IVMA 3JQKA 2UUCF 4GKKF 2MY8A 3GJSB 1TL7A 3NCRA 4WU3A 2AX0A 4ZP6A 4QWEA 2OLWA 1S4FA 1VRQC 4Q2LA 3MMCA 5HMZA 4ED8A 3CD5A 2VFUA 3WZ0A 5F8MA 1SJ4P 3W66A 1RYRA 2YNGB 3BBCA 1ZA1B 5K9FA 3CJKB 5J2MA 5DG7A 5IFMA 5C2GA 2YWKA 4K4WA 2VFVA 1VBYA 4LSNA 3OSPA 4B3OA 1XR6A 2O3DA 1WWHA 3MM5B 1C1CB 2F9DA 3W9HA 1KS2A 5D0GA 3R5AA 3W8PA 3E2EA 4B3RJ 5C25B 3ONQA 4UOGA 4O3PA 5GAEU 1LEOA 1NHUA 4P2MA 2IRUA 5KFYA 4C8ZA 4HEA9 2JL9A 4E8UA 1KONA 2KYXA 4DX8H 2FZKB 2C42A 2W2PP 1C0TA 2AT1B 2C2NA 4LR9A 2IDEA 1JNZB 4ZVGA 3TAMA 2XULA 3GB0A 2H5EA 2BE9B 4C4WA 1WKLA 1TMJA 3CDUA 2QMUB 3RR7A 1U0HB 2RQKA 1X4HA 4UOCA 1WF1A 3EMTA 1NAQA 1FWLA 5A2QU 2ZE2A 3W65A 2HNYA 2E7WA 3PY8A 1DARA 1KFDA 1MWZA 1N5SA 2G13A 3BDEA 2X51A 4I7FB 3U1LA 2IPOB 4UY8T 4DJBA 5EWFA 4OQJA 3HFVA 2OUGA 5HAOA 2Y1LB 1FXDA 3EVWA 3EGWB 1YBUA 3VGUA 4LFBF 3FC9A 3HPOA 1SQGA 2OEKA 3I5BA 4QW8A 3K5MA 4DV1F 2DIUA 2W8KA 1Q8BA 3RBXA 3HVTA 1SL2A 2DBBA 3IBCB 3CCWA 1GX5A 3SQOP 4JI5J 1KTVA 2CPZA 2XGPA 3SV3A 4NXMJ 3D6HB 1BC6A 3I4HX 1AUSL 2GS8A 2YKAA 4RBVA 4MKYA 1XNQJ 2B4OA 3BGOP 1XMOF 2VOPA 1U8SA 2OPRA 3CJ2A 3V81B 4EK2A 4CH1A 1GX6A 3M2UB 5DDRC 4LQ9A 4EBEA 4C97A 2Z57B 3KHRA 4CDIA 4EU0A 4PUOA 4C7QA 1PYSB 2V2KA 4I64A 4OZ0A 1IKXA 3UDEA 1B99A 3D1HA 1EETB 3DLKB 2E1AA 1SB6A 5KG2A 4KJIA 3MI7X 3M8RA 3CUNA 2HHWA 5GAEI 4RU9A 4DS5A 1FD2A 1ZPWX 5T41A 3JYTA 1VIXA 3HZGA 1CG2A 4PR6A 3VHQA 2HVHA 3Q8YA 1NK0A 2LDYA 4YUDA 1M5KC 2RHQB 1OPZA 4N56A 3MEEA 2V8VA 3KXDA 3OLBA 1UJ5A 4QBUA 3GV7B 2VJVA 4DSEA 4OLOA 1NM2A 3ZTQA 2O66A 4ILLA 2EK1A 5KFVA 2CPYA 4EI2A 3MR6A 3T9NA 2OFHX 2YKPA 5GAHI 4DV2F 2XQCA 1RSCA 2FJXA 1RADB 2ZFHA 4PYDA 2NXCA 4KBIA 4ZVPB 4CT9A 4IG3A 4F0MA 4GC6A 4C48A 3JQMA 3B8HA 4ECQA 4ELTA 5C42B 4J5OA 2CIMA 4EO8A 2K2PA 4OJ1A 3CCVS 3RZAA 3BSNA 4MYTA 2OPRB 4ATNA 2B7CB 5L1LA 5I3UA 3I5CA 1WHVA 4AXIA 4CYUB 3HHLD 2W9BA 2R8GA 4HACA 5C24B 4A8SA 1L5UA 4DUTA 1BQMB 2JDJA 1DTQB 4F3MA 1IBMF 3HVTB 3NWGA 1BD6A 1I5OB 2FJAB 4RKUC 1HR0F 2HHHF 4WZQA 2AYBA 4LRFA 4BWMA 2DRAA 2WVEA 1NSQA 3M6UA 3WX4A 4H4KA 1GXUA 3M1VB 4A8QA 2HPUA 4ECYA 1RE1B 3M30B 3DMJB 4DUZJ 3GPAA 4Q0BA 4NCBA 1Q8IA 2HNYB 4KQZA 2W4PA 2K1RA 3QIPB 1S9EA 2N7YA 3HP6A 1ZTTA 2J6TA 3KLGA 3TAMB 1GXLA 4GKJJ 1C0TB 1UAWA
chains in the Genus database with same CATH topology
3LQVA 1H2TZ 3SI8A 1X4BA 2I0XA 1S9FA 3NGKA 2A1BA 2XWXA 3SCJE 4WIIA 3G6VA 1KTQA 2F4VF 2PDAA 4CO4A 3K5NA 1HHSA 1QUPA 4OHZA 3MMJA 4MK7A 1R8PA 4DL7A 3U02A 1TL3A 4OZLA 3CJKA 1JXLA 1VQYA 3OBIA 1U1KA 2J9CA 1H3DA 2OD4A 3RB4A 1FDAA 3IRWP 3QLHA 4GKJF 3OTCA 4QR1A 1EP4A 4KIAA 2XS7A 1RT1B 1R8HA 1P27B 1I94F 4N41A 3QMQA 4DL2A 4C8KA 2ZKUA 4J9LA 2VOOA 1KSPA 3JTNA 4RNFA 3I6PA 3G4SS 3KHHA 2OJ3A 3MDFA 4K4ZA 2VBWA 4NLDA 2ZH4A 2FGCA 3JAMY 4A8WA 4ECZA 1TKDA 2AJ1A 2FJWA 2MZJA 4ICLB 4NL5A 2BDPA 1DQ8A 2RU9A 4HH1A 4HDHA 2LCWA 1AW0A 3PW5A 1C4CA 2AW0A 2IJFA 1KR4A 1N4LA 3R5CA 1N5TA 4TU9A 4DDFA 2FVSA 4Y6IA 2HRYA 4LFCF 2AGOA 1KQKA 2MMYA 3OXLA 4UUXA 2ASJA 1QAIA 1P1LA 2EBEA 1UVIA 5DGBA 4JV2A 2BZ2A 2EG1A 3BM7A 1UFLA 3UW1A 2Q66A 5G0RA 1YRTA 1TL4A 2VBYA 2DGTA 1RTDA 1A7GE 2DNLA 1SBRA 4PQUB 3C46A 2BE2B 2Q43A 2ZH6A 3MM8A 5J1EB 3Q22A 3BR8A 3O2IA 2JLEA 1S77D 1HPZA 3P6YC 3AJ1A 1BQXA 1SV5B 4N5SA 2RQCA 2VG7B 1VC6A 5KG5A 3DLGA 3SSQA 4J9NA 4O3QA 1S0VA 4I2PA 1QY7A 3T19A 2EPIA 2PSZA 4ED7A 4F67A 3MUTP 2XMTA 4RNHA 3RBEA 4KRWA 5LSRA 2XS2A 3TA2A 4QYRA 2XLIA 3NNHA 2VG5B 2LXIA 2OPQA 5JXSA 2WCXA 3HM9A 4B9UA 1R8AA 5KFSA 3CD6S 3IAM9 3HF5A 4DN9A 5F8NA 3FQLA 3VAJA 4YB1P 1HWJA 3RW7A 4DL3A 5D8HB 3BGFA 3QGIA 3QPIA 4G6VB 4GC7A 2M8DB 4IOBA 4YY3F 2DH9A 2XLJA 5KFPA 5K14A 5I42B 3BO4A 5J2QB 3RW6A 1TP7A 2VV5A 2RJZA 3NKYA 4RW4A 4C98A 2EW9A 3NP5A 4FZVA 1HWUA 1FCAA 4DSJA 3DN9A 1G6BA 1NU4A 4BCAA 4R25A 3K7RA 7FD1A 1FEHA 1X4CA 1TKXA 3SFGA 1RT5B 2K3KA 3C6TB 5M2PA 4ZHRB 1ZYQA 2JX2A 3PVXA 3MM6A 1BY9A 1U49A 4DF4A 1XMQF 1JX4A 2CG4A 2RUGA 4C8MA 4NLSA 1DBDA 2R7OA 4A46A 4CO5A 3G6ES 5CYMB 1ZPVA 4LMZA 3LOUA 2B7BB 1S9GB 1IKYA 2MY7A 4NMLA 4OLPA 4R8UA 4CT8A 2ZH9A 2BQRA 2N3OA 4DF8A 4F4WA 2BM1A 2JVRA 4Z2XA 1N34F 1Y5NB 1YSJA 4IO9Q 2L3MA 3NS6A 2C28A 5A0YB 4KO0A 1R8CA 3T3FA 2XC9A 1VJWA 3VTIA 2I5JA 3LALA 5KG4A 2G0CA 2IM3A 3DXSX 1SUQA 2DHXA 4UW2A 2OKQA 3IS9B 1JLQB 2B5JA 3M32B 3K59A 3U27A 4ELUA 1JWWA 2A18A 1QVFR 1SIZA 2OPPA 1X5TA 1JKHA 4ZPCA 2NYIA 4OHVA 3V6KA 2DGWA 2EK6A 2DB1A 5A6WA 5G4DA 1JLEB 2W7AA 4WTYA 1U26A 4JI8F 2M9KA 5DQIA 3PX6A 1UKUA 2YNIB 3GFXA 2J0WA 3SFUA 4P6QA 4F2SA 3EGNA 4NZ7A 5I3QA 5A8RA 5AE3A 1T03B 2XS5A 2NUUG 4DQPA 2R7QA 2ABYA 2O1PA 2RRNA 1Y7PA 3M4XA 1TFWA 4B08A 2ZBIA 4TLQA 4FXDA 1TVRA 3QO9A 1VRUA 5LMUF 1S1UB 2XMKA 3M8PB 2GMLA 2DR5A 1IKVB 2NSCA 2R7SA 2I9SA 3TVKA 3FFIB 4UY85 4IO1A 3MEGB 1BQNA 2JWNA 4LVNP 3T1YF 1UVJA 2J0SD 5THWA 5E33A 3AHPA 4Q45A 4EBCA 1B0PA 4PG5A 1S6UA 1M0SA 3MTJA 2PC6A 3PKMA 1HNVB 3CDAA 3TNVA 3TAPA 5EUHA 1WG5A 2VBXA 1JJHA 1HYSB 2KH9A 3EZ5A 1JB0C 3MM9A 2HFOA 2B9WA 2HHPA 3F73A 1S1XB 1KLMA 2POKA 5AXLA 2CJBA 4WFAQ 2FLOA 2E5GA 5B08A 5KFZA 1JLCA 4QW9A 1YIJS 2C3PA 5L1IA 4EYIB 1YJVA 1NJXA 2UUWA 1XERA 4MAKA 3ZZPA 3MGJA 4V19X 3QJLA 1RT4A 2M0GB 1S1WA 2M88A 1W2BR 1U1PA 3I96A 2ZOFA 1PGZA 4DSIA 5MLCV 4RU2A 1FXLA 2E66A 2ZJRQ 4C11B 2A2CA 1DAXA 3DRPA 2HYIB 4H4MA 1UVMA 2NS1B 1TL1B 2YKNA 2Z8QA 5DO2A 4EZ9A 2QMWA 3NRBA 4LJMA 3P3DA 5FDLA 1Q7LB 2ZD1A 3AA8A 3DI6B 3C2PA 2X3GA 2G1DA 1S1TB 4ZCMA 3MR2A 4AL6A 1S10A 5B09A 1HHTP 3M8QA 2FPHX 2F8EX 4LF8F 1LWCB 2ROEA 3HXMA 1S97A 4LF9F 3DOLB 1Q53A 5J1PA 2XY7A 1HQEA 3NLCA 5D78A 4QZVB 2R2SA 1NJZA 4F4ZA 4GMKA 4QPXA 1LFPA 4JI1F 4ECUA 1QE1A 2RT3A 3FSXA 3EYZA 4YB7A 4GO7X 3E3XA 4PRFA 3N5BA 3NS5A 3N6MA 1HBNB 1R43A 2N4DA 4ECWA 3J7A1 4OX8A 4TNOA 1YTYA 1Z4UA 2JRSA 3DLHA 3PACA 2XO7A 2YWHA 1X9SA 1YG0A 3LP1A 4DBQA 4Y2MA 4FYDA 2P9EA 2R4FA 4L3NA 4O4GB 5E3QA 4OI0A 1LW2A 2R8HA 1OSCA 4OI2A 4BDPA 4I4BA 2HVIA 1FRLA 1FRHA 3TO8A 1RI7A 3DYAA 3C8YA 4RW9B 5L38A 2XMUA 1X9WA 4XPCA 3SCLE 4E0DA 1WTFA 4WFNQ 2HHQA 3KJVB 2LU2A 3OL8A 3T6JA 1YRXA 3GFZA 3S1TA 4IH5A 1LOUA 1VRTB 2PEHA 2ZDPA 5AXMA 4IRCA 4USHA 2VPXB 2DIVA 4I2QA 2HMIA 2QIFA 1ZETA 3GILA 1TKTB 1NK7A 2DNKA 3Q8RB 1GXTA 1MSWD 3T1HF 4IG0B 1GNKA 3BDPA 2HS3A 2A3JA 2W4DA 4F8RA 2DITA 2HS4A 1C2PA 4Q8FA 3CE8A 2NPFA 3PW4A 2DNZA 1HQUB 3VAKA 1RT3A 2YNHA 1KEKA 1U1QA 2CQHA 2QA1A 3D28A 3OVBA 4LIWA 1XEZA 1HFEL 1N54B 4B9MA 4IR9A 5KG3A 2RU3A 4PXBA 5M2UA 4DL4A 4ZVHA 3CD0A 5LL6d 2F3JA 1Q7YT 2MKCA 1ZAVA 2GA7A 2F8HA 5CCLA 5J2PA 2AQ4A 1K9MT 3CC7S 4B9LA 3WC0A 4H4OA 2XY6A 2W9AA 2OP5A 3SQGA 2XSJB 3EZUA 2JZ5A 4QIGA 2GJ2A 4F4XA 2VPYB 4Y2KA 2B56A 1MROB 2HNDB 2DT9A 4HT5A 4WZMA 4WCEQ 3CIZA 2OFGX 4IFVA 4AUKA 1S79A 1N52B 4CTAA 4DV6F 1RT7A 2KRRA 1XWLA 4U67Q 2C2DA 1IR0A 1VQSA 4RZRA 3H2LA 4YDXA 4B3TF 5DG8A 4PCQA 5IM0B 5E3CA 1E6VB 1VHFA 2XNQA 1GT8A 3M2RA 4C3LA 1VQ8S 3KLIB 5AJ3F 3H98A 1S1VB 1LWEA 2W4CA 3KK2B 1UWBB 1WELA 4L72B 2CPEA 2DH7A 3M2RB 5U47A 2OTJS 1E6VA 4WF9Q 2KJVA 1S6PA 3HZEA 3MECB 4B9SA 2A2DA 1JLBA 2YX7A 3VZHA 3SEOA 5DDPC 2GIRA 1YRUA 2Z2LA 3VAGA 1M5VC 2LEPA 4MK9A 2NPIA 4W92B 2Q3PA 3QYYA 4CZCA 5JUMA 4NWBA 1SL0A 3AQPA 1MROA 1R89A 3VAHA 2FGOA 3MPYA 5HMXA 2JFKA 1VFJA 2DNMA 5IQQA 4BC9A 3KLFB 1P8GA 2MGZA 4IKAA 1C1BB 2F1FA 3GIIA 2JEJA 1NHVA 2V8DA 2HWIA 1C0UB 3MD1A 5JJBA 3H40A 2AJ0A 2AP6A 2OPSB 3FSYA 2M70A 4J9MA 1VQKS 3KG0A 3FRZA 4DN0A 1PC5A 3DRSA 2CQ4A 4X4QA 1JLAB 2W9CA 4UQGA 4HHJA 3I0SB 2JLGA 4HT7A 3PRDA 2J6SA 2EKYA 2WBRA 4RW7A 1XK8A 4WKRA 1Y3JA 2RNEA 4X4TA 4PWDB 2B4VA 1RT3B 2YNHB 1FESA 1N6QB 2B6AA 4KV8A 3IXQA 2Z4PA 4ZK7M 1M5OC 2GGPA 1N48A 4ECTA 4OX9F 1B64A 3I82A 2HHVA 1Q4RA 1HW8A 2XI3A 5D4LA 4A8MP 5AE2A 1RT2B 3KK1A 4JI6F 2IA6A 3FVYA 4LUBA 1S48A 5IT9Y 5A8WB 5CCMA 1REVB 2UV8A 3TARA 4IFYB 2BVZA 2HHSA 2HWHA 3IBWA 3DDNA 1HARA 1D1UA 4A47A 3OUYA 5FJ4A 1FTRA 1V3RA 1RTIB 2GMHA 1KFSA 4ED0A 4TQSA 4NYPA 3US5A 3BGUA 3VQTA 5KFEA 1NJIT 2I2YA 4IDKA 1F5AA 2V4JB 3OXGA 3DYAB 5DQGA 3EXYA 5E3AA 2JH3A 2ZJPQ 2HGMA 2ZBCA 3MM7A 5HROA 3IRXA 4DR7F 4NLOA 4DR5F 4RNOA 5H1SV 4J9QA 4AYBD 2IBOA 4ZCLA 1IKWB 2ZH3A 2XZWA 1NK6A 3MEDB 3PM9A 5F3TA 5LSLA 4AFFA 2HGNA 4WJBA 3PIPQ 1YJNS 4Y2CA 2OTLS 3IRXB 2U1AA 2VUGA 3GV5B 1WI8A 1R31A 2FTRA 4O44A 4V19J 1DTTA 1JLGA 2CPJA 2GNKA 1A6LA 2HQIA 1E6YB 3RR8A 2EG2A 5F0UA 3D1QA 3M9OB 3H8YA 2RRBA 1PO6A 4MK8A 2I8EA 1RTIA 1R0AA 3H4BA 5BYQA 3WC2A 4RW6B 1T05B 5B0GA 1RYSA 2N4CA 2R2RA 4B9VA 2XEXA 4NCAA 1HMVA 3IWXA 1HQEB 1KLNA 1UA0A 4HI2A 4C9DA 3DOLA 2CQ3A 2CRLA 3FEXB 4BBYA 1N0VC 3B4MA 2CZVC 1REVA 3IA0A 1QJHA 3MAHA 3UDCA 4X65F 2UUAF 2J5AA 4YB5A 4CO0A 3V6DB 1FKPA 1NK8A 2IRYA 2VB6A 4F3OA 3HJFA 4ILMA 4WE1B 3UDLA 2V5HG 2VL1A 5B0CA 4ECVA 1VQ6S 4KV8B 4M95A 3PFOA 2LYVA 4KHMA 1VQNS 2YKMB 4UQTA 1TL1A 4NLTA 1H2UX 3O5TB 4H4MB 3L7PA 5KFGA 5A2QY 4IUFA 3GIMA 2RS2A 1BLUA 4RX6A 2IAJB 3CMES 4FPRA 4HDGA 3I0SA 3CVKA 5EX3A 3ZC4A 1RT4B 2HNZA 3MMBB 4A4JA 3BGRA 2W25A 5KFOA 2RRAA 2E1RA 3G8SA 2MGZB 2HWTA 3IN5A 3D0GE 4JI4F 3KHGA 2J0QD 5F3ZA 3UCGA 4A8KA 1HYSA 1RTHB 3CCLS 5B0AA 2X1BA 4WE1A 3CCMS 3LP2B 4ZVEA 4OI6A 3V6DA 2V94A 1ZH5A 4BC7A 1ZAXA 1CLFA 2UP1A 3CIMA 2RE1A 2LQBA 1RKJA 4ZOSA 1BQNB 2W24A 4QJVA 4CCHA 3FFIA 2ZZMA 2GJIA 4DUZF 3KG1A 2PI4A 3GR0A 3DRXA 1UWBA 3H5SA 3CEDA 1S1VA 4B17A 3KLIA 3DHXA 2K3IA 2BJDA 1S1UA 2DPJA 2JJ4D 1GH8A 1JJ2R 3DDKA 1R0AB 4OHXA 2VPZB 1E6YA 4FVCA 4RNNA 2O5DA 3QGGA 3DLBA 2EFNA 1G1XA 4CTAB 4EUVA 4YMEA 3C3LA 2RMLA 4FVMA 3MAQA 1KQSR 5DDOC 1OQ6A 2QSWA 3PO5A 1M5HA 4XDDA 4Q2MA 6FD1A 2HIQA 3ZZ0A 3OV7A 1IKWA 5B0EA