1X8DA

Crystal structure of e. coli yiil protein containing l-rhamnose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
104
Chain Sequence
MIRKAFVMQVNPDAHEEYQRRHNPIWPELEAVLKSHGAHNYAIYLDKARNLLFAMVEIESEERWNAVASTDVCQRWWKYMTDVMPANPDNSPVSSELQEVFYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Hypothetical protein yiiL
publication title Structural Insights into the Monosaccharide Specificity of Escherichia coli Rhamnose Mutarotase
pubmed doi rcsb
source organism Escherichia coli
total genus 28
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.32: L-rhamnose mutarotase.
pdb deposition date 2004-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05336 rhaM L-rhamnose mutarotase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x8dA01
3LO3A 5A6PA 4DL0C 2KYZA 4QOTA 3KNGA 2XMKA 2GGPA 1MWYA 2GCFA 2LXFA 1Q8BA 2EW9A 1FEEA 1TZ0A 4FNHA 1Y9OA 3KKFA 2ACYA 3FRYA 4DN9A 1FESA 2GFFA 2L3MA 1KVJA 4NL5A 4ZA1A 1X7VA 2FIUA 4A47A 1ULRA 1YJTA 1Q8LA 4HI2A 2ROGA 3HDSA 1MWZA 4YDXA 3MZIA 5B0GA 1XBWA 2HFNA 1P6TA 3GZ7A 1GXUA 3BDEA 2VH7A 4FNIA 3CJKA 2QLWA 3TNVA 1FE0A 2FHMA 2HFOA 3LGMA 3K7RA 1SI9A 2OKQA 3DXSX 2K1RB 1N5TA 2OD6A 1KQKA 1X0PA 2OMOA 1VQSA 2AJ0A 2XMTA 4HL9A 4NPOA 2OAUA 2VV5A 3T9NA 3HF5A 5B09A 2KT3A 2XMVA 3UDCA 2K2PA 1JK9B 1WD6A 2BUNA 2ROEA 3TRGA 2HQIA 1JWWA 4YEAA 1CC7A 1OQ3A 4OJ1A 4OJ3A 2GV1A 1GXTA 2BYCA 4Y2KA 2JDJA 3WDOA 5B0FA 1N5QA 4EFAC 3HX9A 2AW0A 1P8GA 2QYCA 5B0AA 2HLTA 3FMBA 4Q2MA 1YJVA 2K1RA 2GO8A 3BM7A 4Q2LA 5B0EA 2Q3PA 1AFJA 1Q53A 3BGUA 1AFIA 1SQEA 5K9FA 3BB5A 1X8DA 2XMMA 5F0UA 1YG0A 1YJRA 1FD8A 3HFKA 3KG1A 3KG0A 2QLXA 4HH0A 1APSA 1S6UA 4Y2IA 2N7YA 5T7LB 1IUJA 2BJEA 5IXUA 1FVQA 2FTRA 1URRA 1KVIA 5B0DA 1AW0A 3I9ZA 2G9OA 1TL5A 3IWXA 2ZDOA 2LQ9A 1FE4A 2XMUA 4ZOSA 2IYIA 1Y0HA 2AJ1A 2GA7A 2XMJA 3LGNA 5B08A 2K7JA 2QIFA 1N5SA 2W4PA 4OJGA 3HHLA 4A48A 2RU9A 1Y3KA 4DPOA 2RILA 1LQ9A 3DCAA 2N4DA 3QMQA 1VQYA 1CPZA 2HLUA 4A4JA 2KKHA 3HHLB 2ASYA 1S6OA 1Q4RA 1YRXA 1TL4A 2IFXA 1V3ZA 3CJKB 1K0VA 2BJDA 2N4CA 2ZDPA 5T7LA 4A46A 3BF4A 2RSQA 1Y3JA 1U7LA 1YJUA 2OD4A 3HHLD 4U9RA 3BN7A 3QGPA 2W4CA 4OIXA 2OFHX 1FVSA 2PGCA 1CC8A 4HH1A 2IYGA 2KT2A 5KAKA 2GGPB 1OQ6A 1SB6A 2BBEA 2RMLA 2ROPA 4HI1A 4OJHA 3F44A 3IWLA 3TOQA 3HHLC 3MCSA 1TR0A 1N5VA 1QUPA 2HIQA 5A6WA 3BR8A 2K7KA 2FB0A 1OSDA 5B0BA 3VTIA 5B0CA 2AP6A 3E8OA 2LQBA 2CRLA 2LDIA 2OP5A 4F67A 2W4DA 1TUVA 3FGVA 1R6YA 2OFGX 2XMWA 1OPZA 4Y2MA 5F0WA 1W2IA 1RJJA 2PD1A
chains in the Genus database with same CATH superfamily
4CO4A 1F5CA 2I5JA 3GLJA 4E98A 1PC5A 1QE1A 3ZC4A 2H3EB 3FSXA 3HDSA 5D0RA 3DLBA 1IN0A 5C24B 3CJ4A 4DZDA 1RT3B 1X0PA 4J9RA 1WOOA 4P10A 4DR6J 2P9GA 1R8AA 4GRSA 1VC0A 3BSCA 3OUYB 3MEDB 2QA4G 3OFFA 4RUHA 3V4IB 5B0EA 2VBYA 1Q53A 3BGUA 1NBEB 3SXLA 1HPZB 2W9BB 4WF9Q 1UVMA 3CPWR 3BGFA 1RWUA 2JC1A 2FGOA 4CWBA 1B7YB 3DLKB 4CM2A 1X5SA 3FMWA 1UWAA 3K5LA 1I6JA 4J9SA 2YPYA 1K0TA 1UVLA 3LP2A 5DM6Q 3AOAA 4QIEA 3MPVA 2IA6A 1DBDA 3SCIE 4C98A 2ZKUA 1OS5A 3GV7B 3PNIA 2OPQA 2CJAA 3DRPA 2BXJA 3NLCA 3MI7X 4N41A 3CDBA 3UD5A 3HKWA 2W01A 3NWGA 1RAFB 2HRTA 2MDAA 5D3GB 4JP8A 2CQHA 4UOCA 1FXDA 1TL1A 2D74B 2MLZA 4NPOA 1X0FA 5A8WB 2GMHA 1U24A 3CJTA 4WFNQ 3MOZA 5F8JA 4DU8A 4FP9A 4JV0A 1N52B 4DX8H 5DG8A 1IKWA 2N82B 2QA4S 3NNHA 1CJTA 3I9ZA 1T7PA 2V94A 3QRRA 2DHXA 2UP1A 4JV1A 4FVMA 5AXNA 4GC7A 1VOMA 4WE1A 1TTHB 1J5OA 2QLBB 4P2XA 2DHGA 3T1HJ 4DR7J 4ED0A 1GNKA 1PILA 1N32F 1SB6A 3TX0A 1F3VA 2WOMB 1FJEB 4LSNA 1WF1A 3SI8A 3SFGA 4I2QA 1YRUA 3RAQA 3CJ5A 3BSNA 4F4YA 3GILA 1LWCA 3BYRA 4ZVOB 2CG8A 2ATCB 4F3QA 2UUTA 2DNOA 4ZJOA 3UO0A 1DLOB 2BW2A 1PJ7A 1S6QB 1YIJS 4QU7A 3R5AA 3QWUA 4E0DA 2KFYA 3OTCA 2ADBA 4LFBJ 2WONA 4OYOA 1HI8A 4M95A 1VRUB 4U7UK 3OHAA 5FDLB 3GR1A 3M2VA 1X8DA 2KZZA 4RU2A 5ETVA 2GVZB 3ENQA 3OTDA 5D4OA 4OFZA 1FK9A 4M8LA 1MWQA 4CLFA 2CJKA 1GX6A 1EAYC 2IRXA 2ZDPA 4TY9A 1FKPA 3ILJA 4DFPA 2OI2A 2BRLA 1JLEA 4X2BA 4X4UA 3MMAA 3MEGB 5D0EA 1SBRA 4CLTA 1UZHA 4I64A 2UXBJ 4KB7A 3N6MA 2BQ3A 4CTAA 4OZ0A 3MXHP 4F04B 1VDHA 4AQYF 2JFKA 3KLGA 4NEYA 3UD3P 3QJJA 2PDAA 1H2TZ 1RTIB 1EQMA 5KFAA 4DL3A 1TKTB 3EWGA 4NLRA 1CEZA 1LFWA 1HKAA 2GV1A 2QA2A 2P6SA 2R8IA 2DCLA 3HHKA 3PEHA 5F3TA 4LR9A 5IWAJ 3MECA 2DRBA 1KTVA 3PFEA 3R5GA 2I9SA 2W7AA 1X4AA 1H98A 1RCOB 1N6QB 1AW0A 3W5YA 3RBXA 4ZLLA 2W4PA 4IKAA 3GIKA 1T03B 4DV0J 1TL4A 3GG1A 3DHXA 3DYAA 4JI4F 4OJHA 1R27B 2BACA 1TR0A 2C3PA 3OFHA 4USTA 2KT5A 3MEKA 2RQMA 5HROA 2PSZA 1NH8A 4YMEA 5JMNA 3SCLE 3I0RA 4DN9A 1U09A 2KB2A 2ZH1A 3UCGA 3PTWA 1HNIB 4YR3A 4OYAA 1DHMA 1WELA 3CCSS 4OI6A 2DPJA 2R8JA 1UVKA 1UVJA 1WI8A 1EIYB 3WDOA 3KDNA 3H98A 1GQEA 1N5YB 2H48B 2DNRA 2I1RA 1RT6A 2V0NA 5M2UA 1TMJA 4U7CA 3PFOA 3PYFA 2EFGA 1OMSA 3C14A 1IKVB 3KUEA 4NX9A 3BO4A 1QAJA 3GFZA 2P2CB 1JNRB 5LL6d 5AE2A 1I1GA 5KFGA 2BX6A 4G1QB 3ZXWA 1RABB 2HVZA 3I4HX 3CTRA 1Y5NB 1W2IA 3JSRA 1KNZA 3HHNB 2E5IA 1YZ6A 2E1CA 3I55S 4CZCA 1P1LA 3T3FA 2MY8A 2HFNA 4WFXA 4FBTA 4UY85 5DG7A 1ZM3A 4C0BA 1IKXB 2E7VA 2HWIA 3C19A 3OHBA 2KXFA 1IWGA 3KK3A 1RAAB 5C2GA 3RB0A 1WEXA 1TMMA 4V19J 2VDHA 1Q5VA 3BV8A 2XCPA 2XY6A 2CWKA 2W2PP 4WJBA 2ASDA 1QSLA 1RYRA 2R2TA 5GAGI 3G82B 4K59A 1G4CA 1JLAB 1BLUA 1VQOS 1RWWB 3OL6A 2Y1LB 1JNZB 1HNWF 1AT1B 3P6YC 3ILIA 3IR7B 1QDUB 2EK6A 1NKCA 1YJUA 4ECYA 4RW7A 2KDOA 3QIPA 2N3OA 1HWIA 4OV1A 5A6WA 1FT8A 1HBMB 2LECA 2FUG9 2LDYA 1Y10A 4Z7CA 4Y2MA 1HWJA 4LFAJ 1E6YB 3OJUA 1N34J 4N76A 3DGPB 1HBNB 1LXJA 4DSKA 3CD6S 2LXFA 1RYSA 3CW2C 3PO4A 1RAJA 1WORA 3VVUA 3GJQB 1FNXH 5E2QA 5LMUJ 1EETB 2DGUA 3BS9A 2MSSA 2QV6A 4NLGA 1R8PA 4ETZA 2Z4PA 2IBOA 3CIMA 5HQMA 4RUCA 4XDCA 4WYWA 2BE7D 5IFMA 3T6JA 3RB6A 1WUUA 3A3NB 5C24A 4FF3A 2OEKA 1RT3A 5IC6B 2YX1A 2GMJA 3GSDA 4I1TA 3PDNA 3CC4S 3W7BA 2XGPA 1NK7A 3GIIA 4DV2F 3IWXA 2IYIA 3GV8B 3NAIA 3R1LA 1DAXA 3HP6A 1HPZA 1VQYA 2MKIA 5KOXA 3CCZA 3KNAA 2W9BA 2J9DA 2HNDA 3C8YA 1RAOA 2UXCJ 2R7SA 1H2VZ 3DLKA 1ZAWA 3P3DA 2J0WA 2MB0B 4DV6F 1KOHA 1XNQF 2VDIA 3R6GB 1R6YA 4A8YA 1W25A 3MPUB 5LSLA 2RS2A 3RAXA 5LJ3Y 1S57A 1FFWB 3CC7S 4YDXA 1EZZB 3GZ7A 2DO4A 4FKYA 2CDRB 4NRUA 2OD6A 2OJ3A 3MR3A 1WOPA 2OMOA 4C48A 4U67Q 3H5UA 2NSBA 4J9QA 3G4SS 1S9EB 2YWWA 2GJIA 1RK8A 4LSZB 4OZNA 3UN2A 3T5JA 3IS9B 2UUWA 3RGIA 4AT1B 4B9MA 1K47A 5A8WA 3Q2SC 3BSAA 4DX5A 1S7IA 2J9DE 2PFDA 3OTOF 3MPYA 1HR0J 1WHXA 3GE9A 4O44B 2C1EB 2BANB 3IGVA 3MFIA 4CT9A 2OMLA 3M1VB 2AJQA 3HZEA 3BBFA 3F56A 2HBQB 3TOQA 1D8YA 2BJ3A 2EG1A 2VQEJ 4WKRA 1J5EF 3CD0A 1GH8A 4F7VA 3IRXB 4P73A 5I4MA 3T41A 3LA0A 3U1LA 3NRBA 2WOMA 2L3MA 2IVYA 1FX4A 2C2EA 1DFDA 2JHEA 1NJZA 1P6TA 4KHRA 1RHUB 3ENAA 4WKYA 1SL2A 3LGMA 4ZPDA 3KK2B 3PJWA 3PW0A 1WC5A 3I31A 1F1BB 4NLVA 2K8GA 2FVSA 2QJ3A 1AYEA 2VZ9A 3KHGA 2Y8YA 1GXTA 1DLOA 3MMCB 1S6QA 1T0TV 4RWWA 2MKHA 1FHTA 2P5VA 4DL2A 3MR2A 1S6UA 1Y5LB 4TKTA 2DNLA 5HQLA 1VRUA 1GAOA 5CYJA 2AJ1A 2XGQA 5FDLA 2VJVA 4KFBB 2ALZA 2DH8A 4HYKA 4NI2B 5DS7A 2LU2A 2GVZA 2IFXA 2FJAB 4KIAA 4D3GA 2RSQA 3TJ8A 1L3KA 5U47A 4HH1A 2VA3A 1X9MA 2H5JB 2E5LF 4RBVA 2P9EA 2ZFHA 4LFCJ 3AB4B 4USUA 4C97A 3IM9A 2DCUB 2V2ZA 4CIOA 2RUSA 2K3IA 1F9EB 3O6QA 3MEGA 3NG8A 5BYRA 2JNJA 4NXMJ 3Q8QB 4MIBA 1S4EA 3EVWA 3MR7A 4ENOA 3DC2A 4M5MA 3KLFB 1G3OA 5KG7A 3N0VA 4C7QA 4YEAA 4OZ5A 4Y3CA 3FMBA 1TKTA 3IBCB 1SXLA 2XLJA 1SQEA 2JLFA 5CH7B 1NDPA 3VGVA 2O01C 2ZC3A 2BA9A 3D54A 1YLXA 2WBRA 3WX8A 3HHLB 3MAQA 1LW2B 1N6QA 3MAAB 8ATCB 3TO8A 3X3UA 2HWHA 1RLCL 1T03A 4XO0A 3KMSA 1HNVB 2UVVA 4C0OC 5KFLA 3H4DA 4DFJA 4CO3A 2HZAA 1RWPB 4LF8F 4EZ6A 2B9YA 1FKOB 4URQU 2AT1B 1S48A 2LU1A 2RRBA 1S10A 2EFPA 4PABA 3T1YF 2I6WA 1VJWA 2E5HA 4E2FB 3M2RB 3M6XA 2FQQB 2VH7A 2KJWA 1FRXA 1JLGB 1BUXA 1VIXA 4M5LA 3B4DA 1YVFA 2V50A 2L9NA 1S1TA 4B3RF 4N8NA 3L7UA 3QYYA 1OQ3A 4AL5A 2BYCA 1HNIA 1XMQF 5GAEU 1KQFB 2QZ8A 2FJDB 2W25A 3DM2B 2YWEA 3VCDA 2J9EA 3EXYA 3DDNA 1FVQA 2C3YA 2LXUA 4J5OA 3G6VA 4A8WA 4C11B 1Q95G 2QN6B 3N6NA 1DZ5A 3R7SB 2KKHA 2F8EX 1DJ0A 5BJRA 2JRSA 3PZPA 4UF4A 3NL0A 4K4SA 2YH0A 4OZ2A 4CH1A 4PYDA 1SKUB 3CMES 3FJ2A 2HNZB 5IT4A 2FB0A 4LF6J 1WG5A 2DR8A 2PI5A 2RS8A 1IKVA 2W1BA 4G1IA 2CPIA 2DNNA 4GKKJ 4DS4A 2CNLB 3HD2A 1KFDA 1XMOF 4LVNP 4G1QA 5EDWA 1L3TA 4DI6A 2CPJA 3H5SA 4ICLB 2VG5B 4ZVGA 1JXLA 1FRLA 1ZOTA 4EO6A 2F65A 1S1WB 3TVZA 5CZXA 1MMLA 2E1AA 4CLZA 2XY7A 3W9HA 3M8QB 4PCQA 3TA2A 1CC7A 3R5DA 1S7HA 2NXUA 1JMTA 1K1SA 1LNQA 3AOCA 1ZZNA 2WVFA 1OSCA 4IH6A 1IKXA 5BR8F 3HM9A 2BVZA 4EI2A 3M05A 3MM7B 1UL3A 4DPYA 4JI2F 3JB9k 1EKSA 3ZO7A 2POKA 2X1FA 3N79A 1H2UX 3BREA 3RZAA 2BJDA 2V6AA 2NYHA 2APOA 1FO1A 2HHQA 1CC8A 2V4JB 3G82A 1JLAA 3D4JA 3TR5A 3POTB 3AXMA 4OI3A 2Y3YA 4MKVA 5HANA 4F67A 1NZ8A 1HA1A 3J7YU 1P9YA 3IBWA 4WCEQ 2PA8D 3RG6A 2IMOA 4JI1J 4OZ3A 1HBMA 3FBCA 1L5UA 1X31C 2GMLA 4LR8A 1UVIA 1E6YA 4J9OA 1U6FA 3DGPA 1SH3A 1S12A 4O0IA 2FJEB 2UUCJ 4JI4J 2CUYA 2DXEA 3U1NA 1VC6A 3AJ1A 3GWCA 4ZPAA 1EETA 4WU3A 5CABA 2QLJB 1N5QA 1YSJA 2VB6A 4ZVRB 3CD5A 3CDUA 3PYDA 3D5MA 3NOGA 4I6AA 1HL6A 5HL7Q 2N7YA 3LUYA 3ZFVA 2XS7A 5I3UB 2G4BA 3HCXA 1P1TA 3CO0P 2G1DA 2NCKL 3LAMA 2F7VA 3ZZPA 1S1UB 2DYAA 3GR0A 5KAKA 5HAOA 4WXOA 4DX7A 3D0HE 3VGSA 2MEWA 3HLUA 4USWA 1IJEB 2VG6A 4RNOA 5L9XA 2PD1A 4QBUA 1BXNA 5IS2A 2VF3A 3PKMA 3GSIA 2R7VA 4QWDA 2DR7A 4WIQA 2MKCA 5EUHA 4ZVTB 3RUBL 1WDTA 3W8GA 2HFOA 5A76A 2DXFA 1UEVA 3GJTB 2NYIA 2J0QD 1UEUA 3Q86A 4J37A 5E41A 3THPA 5HI7A 1EQ0A 2XSFA 4ZP8A 4B3SJ 2NR0A 2XZWA 2NSCA 2DO0A 3LGHA 2B43A 2IVFB 4CRJA 1OYDA 2NPIA 2D3O1 1WHVA 1S9EA 2DEIA 2C2ZB 4ES1A 4CO5A 3IS9A 1SVDA 2M52A 4DPWA 2ZZTA 2HHHJ 4DV1F 4A4JA 3Q23A 5HBMA 2YKPA 2Z57B 1CG2A 4UT4A 5D4PA 1R7IA 2HGMA 4K5SA 5M2RA 2PGCA 6AT1B 2IC3B 3QWPA 2D69A 2HQFA 2KHDA 4LF2A 3AA8A 4PG7A 2V2KA 1U1KA 4DR4F 4O44A 4K4ZA 2BANA 3EVOA 4FXVA 1RUSA 3M1VA 3PR5B 1BC6A 4RUAA 3WC0A 1KONA 5GMDA 2FY8A 4FS1A 3V6JA 2DISA 3IRXA 1FXRA 2H5IB 1C4CA 3IN5A 4RW9B 4X62J 3B78A 4DDFA 2HK2A 2HQIA 5BXIA 3KK2A 5CAAA 2HVHA 1R8HA 5IT0A 1DTQB 1B0VA 4WBFA 5D0GA 5F0UA 4DPUA 3VAHA 1M90T 2DNYA 2AYGA 3I5AA 4HTJA 1IBKJ 1P9QC 3MMCA 1S77D 3MM5B 2B4UA 1Q8KA 4P7VA 3QZ7A 4Q45A 3PR4A 3U02A 2V4RA 2G2ZA 1XN9A 3QSIA 3IRWP 4KFBA 2F4FA 4NI2A 4DR1F 3MUMP 2LQBA 1BMQB 2UV8A 1FF2A 1O6XA 2ZITA 3ETOA 4OHWA 1FESA 4X66F 2NZ4A 2VBZA 4PG5A 4WXWA 3GP9A 3WHIA 4AL6A 2EFQA 3DXSX 3VQTA 2CQCA 4RW6B 3Q8RB 1BHNA 3VAGA 2HRYA 4L74A 2IAJB 4WK1A 4OYWA 3NCPA 1K8AT 4FYYB 1OY9A 4OYPA 3VAMA 2MHEA 3H42A 2ZKTA 4X4QA 4ZVQB 3C16B 3SSSA 2R8GA 3KDOA 2XMUA 4Q5VA 3QNWB 3OPKA 2CAJA 1QAXA 4YY3J 1UJ4A 1SC4B 3CO9A 2ZBIA 4UY8T 4LF7J 2HS3A 3CIZA 4ZLJA 4FPRA 3D66A 4DUYJ 2PMWA 1J27A 1H0HB 4Y6IA 1U02A 3CDEA 2ZD1B 4N47A 4Z2XA 1U49A 2CPYA 2MQ8A 1Q81T 3MAAA 4WFBQ 2VFTA 4ECUA 3OTOJ 2M7SA 3KKFA 1S59A 1HNVA 4ECRA 2WVCA 2MZSA 5AXMA 1FKOA 3GFYA 3TQ1A 1F3FA 1WEZA 1NSQA 1MU2B 3WBZA 3B82A 1YGYA 1J5EJ 3N5BA 3AODA 4QR0A 2K06A 3M2RA 4U8YA 3K58A 1FDNA 2RRAA 2QYCA 3HK2A 1JLGA 3HI9A 1T11A 4DG1B 2QL7B 3I5BA 2KXHA 4IO9Q 3NNAA 4MFBB 4PPZA 3W65A 4DWIA 2HHTA 2VHGA 2A2CA 3H8YA 1GEHA 3IBFB 3EPIA 1MW7A 4LF4F 5KFNA 1TQLA 1IBMJ 5KT2A 1HD1A 4DFKA 3TZZA 2A1BA 3VAIA 3OTBA 5DLFA 1QAIA 1T02A 4ZPWR 4USMA 2GVDB 1YQHA 4ES3A 1GTHA 3RB3A 3KTQA 1EJ7L 5J1NA 2IVMA 5SZTA 5AXLA 4XDDA 2XCAA 2M8DB 2ZZMA 2DIVA 3E3XA 5LSRA 1WF0A 2AD9A 1NAQA 5L38A 2FD2A 5CZVA 2E5LJ 2R8HA 4ICLA 4BS2A 2VG5A 4TU7A 3CD7A 1S1WA 3QIDA 3PKYA 4J90A 3CNQP 3S01A 1JJCB 3CUNA 5HJYA 2V2VA 1F6TA 3RBDA 3M8QA 4IG0B 3UCUP 3KJNB 3PRDA 1VJQA 2OH2A 1TAUA 1N5SA 2NXNA 4A48A 1V5VA 1SV5B 2EI5A 3PHTA 4DV4J 3C15B 3D28A 3BF4A 3MM7A 3QT5A 3OT9A 2B0GA 4B08A 2GC8A 4OIXA 3VGTA 4JB8B 2C3MA 5E3PA 1WWHA 4O4RA 1U45A 1CSJA 2RJZA 2ZE2B 2HHUA 3MCSA 1ZZFA 2ZH6A 2XS2A 4R5PA 3RW7A 4Z7YA 2W4DA 4M5DB 1N36J 1GT8A 2V4JA 5A2QU 2RNEA 3POTA 5KG5A 1FWPA 3N4WA 2XM3A 3KMQA 4ILLA 4JI3F 2HZVA 3Q24A 3CGIA 3BYPA 3W5XA 4DZ6A 2BOPA 1BQNB 3BDPA 3ZZOA 3T9NA 4DSFA 4ZVEA 4QWBA 3W5ZA 3MTJA 2G1HA 2RKIB 4IRKA 5D4NA 5A2QY 4RW4B 4KH0B 1VK3A 4KYZA 5H1SV 4DR6F 1YRTA 5AJ3J 2WRMA 1KVKA 3O8WA 1N56A 2DGWA 1KRPA 3OFEA 4B3RJ 2YNGB 1Y3JA 4DR2J 5I3UA 3U27A 1B99A 4K2JA 2IYGA 1XMQJ 3A3PB 4KPYA 3IG1B 3TX8A 4F4WA 3EICA 1N5VA 3BR8A 2I2YA 4O3SA 4C9DA 3KG1A 1S1UA 4B9TA 2KG1A 2DGOA 1RAGB 4BWJA 1OWXA 2XG8A 5CA5A 3V5RA 2W2QP 4ZCLA 2GO9A 4X4NA 1XBWA 3KLIB 1RDRA 1FRIA 1I51B 4ED8A 2V34A 2NUHA 5LJ5Y 3A8IA 2OGUA 3E01B 4OI4A 1U0SA 3SDEB 2HQGA 2AGPA 1VS3A 4QIVA 2K3KA 1KP6A 4ANCA 5I3QA 3DKDA 1TL7B 2XQCA 1MG7A 4OL8A 4MIWA 3QJPA 4O3OA 3GFXA 3H59A 3P4UB 3AJ2A 3PY8A 2I8EA 5AXKA 2BKOA 4OHYA 5D4LA 1Y3KA 2QT7A 2PA3A 3I5CA 2MY7A 3CCLS 3JSMB 2CQ2A 3US5A 1Q86T 2YVSA 4LT6A 2M3DA 1CQMA 3K5OA 1YZ7A 3TZXA 2RD5C 5L39A 2VD3A 5IXUA 2OIHA 2IC3A 3MUTP 4M5JA 1Y9OA 1YJNS 3W63A 3AQOA 3TUIC 4A8KA 1NK6A 2YKQA 4LQ3A 4FF2A 1T3NA 2MKYA 2RDJA 3I6PA 2BZ2A 4AFFA 2XZDB 4DLGA 4ZVSB 2LA4A 3FNNA 2BUNA 1FI4A 3EGWB 1WSVA 3BKTA 1VBYA 1GMUA 2F8MA 1S5ZA 1B7FA 3VR1A 1HWUA 3BB5A 1M1GA 4RW9A 2OTLS 4DSLA 2HZCA 2HK3A 2CYYA 1KQGB 3UDLA 3R5CA 3L3CA 4M5GA 4CQ1A 1I3OB 2VPZB 4IH5A 4LFBF 1M1KT 2LQJA 1CQNA 2DRAA 2XYPB 3OSNA 3KUGA 4A46A 1R0AB 3NGKA 2NS1B 2YX7A 3MM5A 4WWSA 4PYAA 1REGX 1FWLA 3FZ2A 3CVKA 1NB7A 2M2BA 1OY8A 1WHWA 3M8YA 3THTA 1U1RA 3M6UA 4NYOA 1FX2A 1KKHA 4UUXA 2WBMA 2EEYA 1IJFB 1K73T 4HHHA 1NUEA 4ELTA 3DLGB 4OYIA 2FIUA 3P45B 5EHHA 3FEZA 3G8TA 2P9CA 4FXWA 2DY9A 3MFHA 5L1KA 1EARA 3QBCA 2FZKB 5F8GA 3HF5A 3RR7A 1N0UA 2GAHC 3OVBA 1XJWB 2UXBF 3V6KA 2C3OA 3IA0A 4NZ7A 4KV8B 2HEKA 1JKHB 2HHWA 1RGVA 1RHRB 1VISA 4RW6A 4UOHA 2B51A 1RLDA 5CXTA 2IAJA 2JEJA 2CIMA 3AD8C 1S9GB 2LQ9A 3QRPA 2DH7A 5KFXA 1JXVA 1MN9A 2UUBJ 2IM3A 3C16A 4J91A 4C2MA 2ZH2A 4CCHA 5C42B 1IBCB 5J2MB 2HWTA 2Q79A 3H40A 1NU4A 1G7CB 2B4OA 2CQ3A 2C2RA 1F0XA 3H7HB 2CQBA 2H5EA 1FEEA 1QY7A 1C4AA 2RF2B 1T8EA 2ZD1A 2PIIA 2KVIA 4DQRA 2NUUG 3PM9A 4ITSA 1GXUA 1FJ7A 3QJLA 4EEYA 3CJ3A 2H9ZA 4AXIA 4DR4J 2NXEA 4Q8FA 2P6TA 3LOUA 3TW0A 5LXYA 3QT6A 2Z2YB 2Q3PA 1MU2A 4FYDA 3DRXA 2VL1A 4M94A 4GMKA 2R8KA 2B6AB 3W64A 4DL6A 1YBUA 5DGBA 5K5MA 1PYSB 4DG1A 4DR3J 5HLFB 4MFBA 1PKUA 2V9KA 4MT1A 3FQLA 4GO7X 3M2UA 4YB6A 5J1PA 1L3UA 5HMXA 2U1AA 3ZZZA 3K57A 4O3RA 2LDIA 2CQGA 3DOKB 1IR2A 5A6PA 2IY5B 4OYMA 4DCOB 2EKYA 2Y1IA 3BH6B 1VQPS 1HFEL 1KFSA 2GHVC 2CADA 2GVDA 3QQCD 1F5AA 1ZM9A 3CJ0A 2B9EA 3M9OB 4JV5J 4DR1J 2V4QA 1UKUA 1S0OA 3FQKA 1S76D 3N01A 3QT8A 3NGSA 5I42B 3TUPA 2VFUA 2W9AA 3ICLA 4OI2A 2Q43A 1APSA 1F9FA 2D3OR 2BR0A 5F8IA 4N77A 3PV8A 3CB4A 4K50A 5GAEI 3HSJA 4R25A 4NCAA 1SPBP 1XR5A 4F2SA 3TVYA 5CYQB 2C2NA 4TVAB 4WP3A 4QU6A 3V81B 3MWBA 4BDPA 2NQPA 4CNZA 2UVRA 1SV5A 1VQ4S 3CCTA 2AV5A 1QJHA 2YKOA 4FXDA 2F9DA 2R7RA 3P5BP 1RT5B 5KFDA 2U2FA 2CKWA 3GCWP 2ZE2A 4UQTA 5E3AA 3UW1A 5JJBA 4O3PA 3KLHB 4IR9A 4FPIA 4J9LA 4R8UB 1HQEB 3MGJA 1NK8A 6FD1A 4M5DA 4RJVA 4WPAA 3D1OA 4DS5A 1UETA 2ZH7A 3BQ0A 3E51A 2BEFA 1N88A 1ZH5A 2WB4A 4LFAF 3IR6B 1C1CA 2H51B 3CDWA 3PYEA 1IBLF 2R2SA 1HARA 1BQNA 4R0EA 2KRRA 1D09B 5HO4A 2G0IA 3KLVA 1VCTA 4U96A 2HHSA 4OYZA 2RKIA 2M88A 4P7TA 2MZQA 1HQUA 3VZIA 2PI4A 4D3HA 1TV6B 4ILRA 2QLFB 4HI1A 4U8VA 4N5SA 4OHVA 2VBXA 2J7KA 2CRLA 1BWEA 2YNGA 2YNIB 1JXEA 4HLBA 2ZBPA 4LF4J 2HBZB 3IG1A 2PEHA 2CXEA 2UXCF 5C2CA 4A8FA 1BD6A 5C7PA 5KFSA 2MMYA 3J7YI 1S97A 1UJ5A 3PHEA 1VQ7S 5ETPA 4PR6A 4XIUA 3KLIA 2JDJA 1XR7A 2IRYA 2XHWA 5FJ4A 2IIHA 4TY8B 2MJNA 4LQ9A 4I2PB 3E01A 3HJFA 2VIHA 9RUBA 2G9OA 4NLSA 1YJ9S 2MJUA 2HURA 2QTWA 3LGNA 5HMWA 1TL7A 2ZOGA 3O1LA 2QL5B 3S1TA 4WTOB 2IHR1 2R7QA 4L3KA 4CH0S 2DK2A 3JSBA 1XNRJ 1XC9A 1NK4A 5ETOA 5AE1A 3HVRA 1OQ6A 3SBMA 3R2CJ 4K4TA 2GJ2A 3UE2A 2FJWA 2F8HA 2HVDA 3DFEA 2COLA 2XI2A 2C28A 3JSMA 2AGQA 3F41A 4HDGA 4ZPCA 2FHOB 3ULHA 2QA1A 1X5OA 4HACB 4PWDB 4EUVA 3M6VA 4KGKA 2F63A 1UW9A 3PX4A 2E5JA 2B4VA 2LQ5A 5DQIA 3TJAA 3SSQA 5D78A 3QAEA 3L95X 2VQEF 4ILMA 2K1RB 1FDDA 3KXDA 4KO0B 2W9CB 5A0YB 3A4TA 2ZWPA 3PW4A 3MPDA 3J80U 3D0IE 3W2WB 3I9V9 1SJ4P 2J7UA 4JI3J 1IKYA 1GTEA 2A18A 1VHFA 3EM1A 3G6YA 4IOAQ 3W2VB 2J0SD 4OJGA 2RU9A 4WK3A 3KHLA 5CHCB 4TU8A 1GK8A 2ZNYA 3DRSB 1RCXB 3LPYA 4QYRA 1N8RT 1QD1A 5BYSA 2VBWA 1RZMA 3J80Y 1UEKA 3BGOP 1GMVA 2RB7A 4PQAA 2DR9A 1RT7A 1JJHA 1D1UA 3LO3A 3TZYA 2VPYB 4NE9C 2W2MP 2EFVA 4J9UE 1X7VA 2JFDA 2PFFB 3PO5A 1UAWA 4P75A 2ILYA 1FE0A 2GQ2A 3ELHA 4LFCF 4CLUA 4WFYA 3Q2TC 1TL3A 3DLGA 4CLPA 5GADU 2KVQE 4ZCMA 5DQHA 3K0JA 1Y5IB 1HLWA 2X51A 3BQ1A 5DRKA 1H38A 5KG2A 5BYQA 2CZVC 2QGFB 3TAMB 4NXMF 1F2HA 4QW9A 3BGRB 4KY3A 1HHQA 4H4MA 4DQPA 2ASJA 1JKHA 3FBBA 1NJYA 2DEJA 1NPRA 2X1BA 1C1BB 1YHQS 1AXQA 2HS0A 4CP5A 1BQXA 2W4CA 1FCAA 1S9GA 2HQDA 1PG5B 1VQ5S 1PBAA 3QLHB 3GYXB 3FFIB 5C42A 3TYTA 5J2MA 4RBTA 2YNHB 2VPWB 1RISA 1AZSB 3AD7C 2CQ1A 1NMEB 1ZPVA 1MROB 1SI9A 4JOUA 3OL8A 1VQNS 3J81j 2DNHA 2RF2A 1DQ8A 4MIAA 1RTDB 2Q6BA 3CEDA 4RWXA 2DITA 4B9LA 3RTVA 1AFIA 4O3NA 2XB2D 1QUVA 4YQWA 3NY0A 3S6EA 3DLHA 4G1PA 2MQMA 5LOQA 1SJ1A 3Q83A 5J2NB 2KH9A 4DF4A 7FDRA 4QIWD 1CBKA 5LM7E 4H4KC 3HJVA 4WP9A 5KFMA 1ZBTA 3PCOB 1HNZF 4KHMA 4MAKA 3W3SA 3MUVP 3V2UC 4URSA 2B6AA 3O44A 5L8RC 4DV7F 5EWGA 2RMLA 3CCMS 4I7FB 5HLFA 4K4UA 2JLGA 2BRKA 4PXBA 5KT6A 4C8YA 3PXGa 4DL0C 4ECWA 2QFJA 4X84A 3I0SB 1ZAXA 5ETSA 2FC9A 1JQGA 4RNFA 2KRBA 2V8VA 3GJRB 1ROFA 1GMWA 3O5TB 4KR0B 3DOKA 1XR6A 1WC0A 4FN5A 4LF6F 4B3MJ 1IR0A 1R8CA 2RHSB 5DDRC 4ECVA 1M5KC 3BJYA 2FLOA 2MQOA 4GKKF 5H9FK 1VBZA 1L3VA 3HX9A 2DR6A 1UZDA 2X3GA 3SV3A 3HFKA 3ITHB 3M6WA 4Y2IA 2Z0GA 2KFNA 3MHYA 2CQDA 5I42A 1LOUA 5KFTA 5ETTA 1IVZA 3TAPA 4EGLA 2N4CA 3U1MA 3OLBA 3FZBA 2RQCA 4QJVA 4IOCQ 4RBUA 4FF1A 4F26A 2FVCA 5HVHA 2A6MA 3H5XA 3Q8VA 2Y1JA 2ZBCA 3V81A 1QLNA 2O1PA 5ITHA 1NJIT 1HNXF 1MLAA 5E3CA 1FERA 2MZJA 3ET6B 1ULRA 2VPXB 3ZTPA 3NMRA 3QGIA 1TKXB 1VLYA 1YI2S 5LT5A 3UD4P 3KLHA 3OL9A 1VRQC 2K2PA 4FS2A 4R8UA 1HQEA 3GFHA 4JI1F 2F4VJ 1WG4A 1EKRA 5A8KB 3BPSP 4DR5F 1IUJA 4OHXA 2UUCF 4NASA 1U2FA 1HMVB 5M2PA 4CLLA 1PO6A 2C42A 1CPZA 1JLBB 3DMJB 3EYZA 3CC2S 3ONQA 2AEJA 5K8OA 2XY5A 1TUWA 3IFEA 1KN6A 1JLQB 3W66A 4ANEA 4DOZA 1TV6A 2X3DA 1TVRB 2FHJD 3ISND 1XWLA 2RIJA 3LTOA 4OX8A 1D9AA 1VGYA 3IO1A 1KR4A 1XK8A 1RA7A 2YNIA 3BSOA 2R4FA 3JQMA 3JTPA 4DBQA 2FY1A 4KTQA 4WP8A 3KWMA 4AYBD 2KT3A 2N7CA 3OD2A 2IRUA 3B54A 2WSCC 2HMIB 1C0TB 2W8KA 3VF0B 1R0BG 4Q7AA 3M8PB 5GMEA 4CLSA 2UZAA 2JH3A 4ID5B 2KO1A 5KT3A 1RP5A 2VASA 3ETMA 4TY8A 3WQPA 2WZ1A 4UUWA 2FJVA 1PAEX 4B3SF 4DV3J 2XULA 1YBAA 1QAYA 2PT0A 4B9SA 4LIRA 2YQ1A 3UR0A 3CCVS 1U1OA 2ZH9A 3HHLC 1FA0A 1SQGA 1UFKA 1HWKA 2B9WA 2L9DA 3K5NA 3DRPB 1ZA1B 1U1QA 2HHHF 2L08A 3HSGA 2DPIA 2EW9A 5HP1B 5KG0A 4P6QA 4QR1A 1I5OB 4JBCA 2BKNA 2UVUA 5MLCV 2D3ZA 3PW2A 2JEGA 2G0CA 4X64F 2D9OA 3IM8A 4LBPA 3VWSA 1LWEB 4HACA 2AMCB 4PWDA 4HDHA 1RHKB 2ZM6F 2YTCA 2KM8C 3NMAA 3MM6A 1Q5YA 3OTEA 5G4DA 1SL1A 2HLTA 2MQLA 2K1RA 2ZHAA 4N56A 2MXYA 2DNGA 4KO0A 3BH7B 1HW9A 3R5BA 5ETRA 4J9PA 1BQMB 5A0YA 1Y0HA 4X62F 1CJKB 3ENVA 3NGUA 4B02A 2N3LA 2DNQA 3CE8A 2JL9A 4WE1B 2JOQA 3OVAA 4DPTA 2ZHBA 3CCUS 1PGZA 2D9PA 5KFQA 1SIZA 4RX6A 1IBLJ 3W2VA 1RWNB 2JLEA 3V6HA 1N33F 1IBKF 4NLDA 3DRSA 2ZJPQ 1VMBA 2XMWA 1Q7LB 3K2YA 1X4DA 4KBIA 4IO1A 4TQSA 3I96A 2D7SA 4F02A 3D1HA 4YOEA 1LWCB 1VLOA 4WZMA 4ED7A 4ED3A 4Y00A 4IQXA 3GTYX 3EPGA 4OYBA 4H54A 3D6MB 4YS2A 3OUYA 5B09A 3MEDA 2KG0A 4X4TA 5HJXA 1SKRA 1NH7A 4WU2A 3V4IA 3I32A 4KJIA 1YITS 3K5PA 1ZS6A 2MLXA 2WONB 1M0SA 5E3QA 4K8RA 4KAIA 2DY1A 4C8ZA 3MM9B 3M30B 2ZHOA 1WG1A 3O2IA 2GA7A 4DSIA 1U6ZA 1KD1T 4YB5A 3TAMA 1U1MA 3UFCX 2RT3A 3BGRA 1IQZA 5KTQA 5EWFA 3IWLA 2XBPA 1C1BA 2BM0A 2HIQA 1RKJA 3ZTOA 3SQGB 1JLEB 1KLMB 4YY3F 2B7CB 1ITPA 4LF7F 5D3GA 1A6LA 2J8AA 4OI0A 4DUYF 3DDKA 3KLGB 1S0MA 2QG9B 5F9LA 4YDDB 3FFIA 3K7RA 3GQCA 2E29A 4NLXA 2OPSB 1FJCA 2YNHA 2MSTA 1AZSA 3FKBA 4DEZA 1L3SA 4FKXA 2QX0A 3GCXP 3H90A 1IR1A 1MROA 4J7CA 4DL4A 2ERRA 5DJBA 5ETNA 3O3LA 4DL5A 4A8QA 5K8MA 5KT4A 5ETLA 4K2XA 1RTDA 4NA1A 4QWCA 4TU9A 1TL5A 4MMOA 2ZVSA 4ZVHA 3BBCA 3WZ0A 4QWAA 5LXRA 3SFUA 1MNEA 3MOJB 5HN0A 4QQBA 3TVKA 5J2NA 3DYAB 3BO3A 3SZ2A 1S6PB 2WK4A 3OR1B 2J6UA 2ZVIA 2BE2B 1WI6A 1VQ9S 1LFPA 7AT1B 1RJJA 1IBMF 2MGZB 2CJ9A 3VHQA 2PC6A 4I7FA 5HSPA 2WVDA 2BABA 4ETXA 4OV6A 3PW5A 1TFWA 4ZA1A 5KFRA 2R2UA 1RACB 2ROGA 3DGVA 3D0GE 4F3MA 2NZCA 3JXOA 4ZPTR 2BV3A 2EFOA 3I0SA 4HL9A 4EBDA 5DZ7A 5RUBA 1NDLA 2CG4A 3CCRS 2J9CA 1IM6A 3GYNA 3CMQA 1ZETA 2FLNA 2LCWA 3G6XA 2KZMA 1U47A 1X60A 1W26A 2VKRA 4F0MA 1LWFB 1NK5A 1B3TA 1B4SA 5KFUA 1NPKA 5D15A 2RE1A 1RTJB 3C3LA 1JLCB 4U9RA 2PEBA 3A13A 2NLWA 1K44A 1SC1B 3NCQA 3CULA 2HW3A 3L7OA 1ZM4A 3EZOA 4HT5A 4GVBB 3JSYA 1WTFA 3W60A 3P49B 3OBIA 2FHJA 1XMBA 1LK5A 1NEEA 2KU7A 4DV4F 4DQSA 3GPAA 3G8QA 3TWZA 4WFZA 4B3TJ 3J7ZT 2Y0BB 1KOOA 1RTIA 1NHVA 4EYHB 2Q1LA 2AJ2A 2AX1A 3AOBA 3H20A 1KHVA 2ZH4A 2QMWA 1N36F 3G86A 1ZA2B 2NREA 1KLNA 4B9UA 3GIRA 2UXDJ 1YDLA 3ET6A 3Q8UA 4TNOA 1P8GA 2BOAA 2AJFE 4ZP9A 1TKXA 2IJRA 5ETMA 3PX0A 3G71S 5KFHA 2ZC4A 2WW8A 1VYAA 5L1JA 3DOMB 4YUDA 3IAS9 5F8MA 3EJMA 5IQ6A 1G6BA 4P2SA 3HXMA 1HYSB 2XI3A 1HMVA 1Q78A 2CVIA 2KM8B 1JLBA 3DMJA 5B0BA 1SJQA 1WEYA 4I6WA 4ZN3A 2HNYB 3HKZD 3PYGA 1KDNA 5AJ3F 3T5LA 3M9MB 2HFUA 1S79A 3B6BA 1RTZA 3LPEA 4DR2F 3U7JA 4AUKA 1HNZJ 4WFAQ 1YWXA 1JLQA 2GJFA 4X4OA 4LRAA 4IUFA 3GJSB 4DV7J 4NXNJ 2AJ0A 4ATNA 1TVRA 4MKBA 3TRGA 3S7RA 2VC0A 4URGA 1N5YA 2Z2LA 1RWVB 1U2RA 1IWAA 4ZLPA 4KE5A 4UW2A 2XMMA 1RKIA 2HHVA 3E2EA 2EC2A 2OPPB 1MSWD 3D6HB 3D7SB 2HMIA 1V3RA 5E3RA 1C0TA 2WTFA 3UI3A 3M8PA 4MK9A 3FK4A 2V67A 3GG0A 3FSYA 2ASYA 1Q82T 2EBGA 4GC6A 3HHLD 4ID5A 5C25B 2UU9J 2HNDB 1NZAA 1OPIA 1OSDA 5KFZA 2DGQA 4ZVPB 4DJBA 3DRRB 1PYTA 3TEGA 2DGVA 2YQ0A 3FGVA 3QFHA 3KOAA 1S72S 4PWWA 1UCNA 4RPFA 2F40A 3Q89A 2HFVA 5CD4A 4DPXA 5KFBA 2B8PA 5IC4B 1ACMB 4MH8A 2DJWA 5HATA 2MLYA 1JIHA 2I38A 5HP1A 1RADB 3D6TB 4LREA 1S1VB 2M9KA 1CJUB 5D77A 1Y00A 3L9ZA 3EZUA 2DTJA 1WDDA 5KFYA 4ZP7A 3D68A 5G0RB 3OVSA 1NNDA 2DIUA 2PMZD 2XLKA 1HW8A 4Q44A 2CQPA 3LALA 1LWEA 4WTYA 1CS4B 1QTMA 1FXLA 2EG2A 1B0PA 4JI0F 1YJRA 1HNXJ 1URRA 2ZUGA 4C3KA 3NGDA 3NKYA 4P2FA 1IXKA 4DSEA 1FNMA 1T9VA 2AYEA 1SKSA 4DPOA 3DN9A 4O23A 3PG9A 1FJGF 2XWXA 1LXNA 2V8GA 3JTNA 2MZRA 3MMJA 1BQMA 2IA0A 2CZ9A 1CJKA 3QGHA 3NS7B 1R31A 4LF9J 4MYTA 4OX9J 1O5JA 2AP6A 2MKJA 4L72B 4DR5J 1HBNA 2ZBRA 4I67A 3N5FA 2HIYA 5DM7Q 5DDPC 1KWMA 4L73A 5B7WA 3GU0A 3RR8A 5L1LA 1NK0A 1PC4A 3QRQA 1KC8T 1X4CA 1UFWA 4JI5J 3QATA 4YB1P 4IQMA 3UDVA 2F5GA 2HHPA 2A3JA 3AH6A 2IJNA 4KSEB 2XMTA 4K4WA 2CPXA 2LFVA 2J5AA 2ROEA 4PKDB 1VQ6S 2Z58B 4U6PA 4H4KA 4Q2MA 1WC1A 4Q2LA 2MQQA 3K17A 3MCMA 4RKUC 2ZJQQ 4F2RA 3GMGA 2UUAF 2QMUB 4F50A 2OPRB 1U6BA 5KG3A 3K59A 1DY3A 1KHWA 2W8LA 4CDIA 2C3UA 3G9CA 1NJXA 1RAIB 1FFGB 4UZBA 4MKYA 1RAHB 3MM9A 4DLEA 1MN7A 3M30A 2FLLA 2JJ4D 2GGPB 1RE1B 1Q7YT 2DD8S 5HMZA 3T19A 1VBKA 1QUPA 3KJQB 2SXLA 2YKMB 3BGLA 1SH2A 4X65F 2IM0A 2W2NP 2UUBF 5LMNF 2MQPA 1QSYA 3TAQA 2HHXA 2DHHA 5GAHU 3SQGA 2CPDA 5D8HB 2Z56B 2BDPA 1KLMA 3TNVA 2KHCA 3M7VA 2DGSA 1JX4A 3CSKA 4ZIVA 1RWOB 2VV5A 1REVB 3HSDA 1SCJB 3RBZA 5HVGA 3SYZA 5KFIA 2FLPA 2C2MB 3VQSA 3HVTB 4PZVA 3A8EA 4G3IA 2OPSA 4DUZJ 3MDFA 1NRKA 4LMZA 2DVIA 3OJSA 5GADI 1FE4A 1UWBB 4X64J 2YXLA 2JZ5A 4EBEA 2ZM6J 1TUGB 1ZYQA 5GVQA 2G2YA 2O66A 4PG4A 5KG4A 3PJXA 2F3JA 2RHQB 2E66A 3P5TL 5FIIA 4QOTA 4BHQA 4ZJQA 4DR3F 1S6PA 3WX4A 4DF8A 3AJDA 4QW8A 3OR1A 2BE2A 5B0GA 3EGZA 2QLWA 2MGZA 2CPZA 2YWGA 3R1HA 3NS6A 4ZLNA 4I0WA 2V69A 5F3ZA 2X7IA 1N33J 3SCJE 4OHZA 1DRZA 1OO0B 5DDQC 1S1TB 2EK1A 4QYZJ 1AFJA 3D1QA 4B9NA 3KFWX 4LJMA 2DH9A 4NLTA 1IM4A 2J6TA 1KSPA 4JV5F 2BE9B 1R8BA 3I56S 1LQ9A 1DQAA 2XNQA 2B4PA 2HGNA 3UNYA 3LP0B 2RRNA 4LRCA 4LIWA 1WKJA 1LWFA 4AXJA 2KFZA 2OLWA 3JYTB 3CXCR 2IM1A 1RU1A 1RTJA 4A8MP 1JLCA 1AB8A 2KYZA 1UA0A 3OLAA 3EDRB 1C2PA 1H7XA 2MYFA 4GVBA 3N28A 3UQSA 5EX0A 4P52A 3KLFA 2BQRA 2VOOA 4L75A 4QIFA 3HZGA 3ZTRA 2H4YB 4DQIA 1JWWA 2XMAA 4KH1B 4XAKA 4OZLA 1TK5A 4ID8A 1P27B 4P74A 1FD8A 3EVMA 2AX0A 5GMKa 3AQPA 4IH7A 2DBBA 3WIUA 2A6OA 2JEIA 2OHDA 1FWKA 1FEHA 3MCNA 4DU7A 3HHLA 3QMQA 2J76E 2JWNA 3EGNA 4AL7A 1LW2A 4W90B 4DX6A 3HHDA 4JI7J 1SJRA 4ZCKA 4EMDA 2O67A 4OQJA 2KT2A 3DOMA 3MMBB 4ES2A 4FYWB 3DRYA 2HQCA 4JI6J 2LA6A 1XERA 5D6GA 4F4AA 1HYSA 3K8WA 4ZMMA 5D0HA 4JI8F 2ACYA 3UDEA 4USJC 1NSKL 3FDSA 1RWXB 4EZ9A 2R7UA 2Y8WA 1OIAA 5J1EB 1Q8LA 2HNYA 4X4RA 4TXSA 3TEHB 2Y9HA 3BZQA 1T9YA 3LP1B 1URNA 3UVJB 2M70A 4DXLA 4AE5A 2DNZA 2ZOMA 5LSOA 2XMVA 3C46A 2H1YA 2PN6A 2B9XA 4BWMA 3CJQA 2KXNB 3PACA 3DM2A 1D3WA 2QE5A 4YN3B 2CPFA 4CH7A 4C11A 4UOGA 2D3UA 2M4MA 2B56A 2HAFA 2XMJA 3EX7B 1ICEB 1BGXT 5H9EJ 3KHHA 3FRZA 2BKPA 2ZH3A 5KFOA 4G65A 4IFYB 5CCLA 2OPPA 3BN7A 3QGPA 4M5HA 4DCJB 2LEAA 4KKOB 3FEXB 3VV2B 2HNZA 4NCBA 3QPIA 1S4FA 2GHWA 1VQLS 5THWA 1EB0A 3T1AA 4RNMA 5CQGA 5K14B 5C25A 5J2PB 3KNGA 2VG6B 2R42A 1YX2A 4TYAA 3QO9B 4FNHA 3H2UB 1T9TA 1XNRF 6FDRA 2Y0SD 2DKOB 4UZCA 2EC0A 3C6UB 2IM2A 3W62A 3DRRA 3DHWC 1U8WA 3NXZA 2CJXB 3DLLQ 4K0KF 1NO8A 1B70B 1H73A 4K4XA 1U1NA 4K4VA 3DOLB 2YNFB 2FYXA 3KYLA 2LVWA 4FVCA 1S49A 2AW0A 3BM7A 1S1VA 5C5JA 5K20B 1CJUA 3UNGC 2RQKA 2KTQA 1X4HA 2GZOA 3GIJA 4NMXA 3H2LA 5G0RA 2ZDOA 2VODA 4Y28C 1CS4A 1NHUA 3F73A 3S8SA 1TKZB 2CQ0A 1Y7PA 1YRXA 2VICA 2BMBA 5HBMB 4TN2A 2IJFA 2HBRB 2V5HG 5AT1B 3CCWA 4A8XA 1U4BA 1HHTP 5DETA 1FTCA 4JV2A 4V1Ak 2W24A 5DO2A 1T9WA 5F0WA 1SC6A 5T14A 2ABYA 3A3OB 4UOFA 3DNCA 3L09A 3W1YC 1FFSB 2PO4A 4EK2A 5F8LA 1X4EA 3VALA 1JLFB 1BWVA 4EU0A 2DGXA 4ECTA 1RT4B 1PJ5A 1NB2A 1RHMB 1YJVA 4IDKB 1UA1A 4I6YA 3ILOA 4OZJA 3ZZ0A 1LWXA 1YJWS 2XZTB 3VAFA 1RT2B 2WB1D 1NSAA 3RRHA 1WKKA 3SQOP 1RWMB 3DU6A 5H9FJ 4CO1A 5A8RB 3HHEA 4GKJF 3OR2B 4ERDA 3BQ2A 3UPFA 4PG6A 4CO2A 2OPRA 4J9MA 5DDOC 4ECZA 4NLYA 4C8NA 2QYGA 4XPCA 2DHSA 3AXKA 3CCQS 1PBUA 2ZBQA 5KT5A 2QC3A 3SCKE 4WZQA 4ED5A 2GGPA 4FYVB 2VJUA 1YBTA 2RQ4A 5KG1A 1SQFA 3G87A 4A47A 4ELUA 4B17A 1EHWA 2YKMA 3PW7A 3EE3A 2IDEA 4NLOA 3KHRA 4F0HA 3ZZUA 2ASLA 2ZH5A 1CULB 4WYLA 5IOLA 2A2DA 4F36A 1DURA 1S9FA 1BY9A 4ED1A 2ZZNA 3QSYB 3R7NB 4LBIA 1SC3B 1KTQA 2QLXA 1R3NA 1REVA 2RUGA 2H65B 1RU2A 4DV5F 4U7UD 2FVPA 3TARA 2E1RA 3HVTA 3ILLA 4R0JA 2RILA 3MD3A 1A0OB 2F9JA 4FDFA 4ZVUB 3CJSA 1S0VA 1B64A 4YB7A 3H25A 3VAKA 1FVSA 3FCWA 1UWBA 5KT7A 4EYIB 1XIQA 4W4MA 3IMQJ 4JI0J 2AHOB 2K7KA 2ZH8A 3FBFA 2J6SA 4ZJLA 1HI0P 2OFGX 3DLEB 5DGAA 3LW5C 2CA9A 4CLYA 2DNPA 3C6TB 2G13A 1FJGJ 2WW4A 1RQ0A 1M1HA 1PYOB 4O4GB 2EKNA 1JB0C 2M0GB 3TI0A 3IWNC 4YR2A 1KS2A 2FHKA 4WIIA 1NDCA 4L76A 4OJ1A 3G8SA 4PRFA 1DTQA 5KOWA 1U25A 4OI1A 4MJKA 1RXOB 1N32J 1WKLA 1X5TA 1VQMS 4B3MF 3UWTA 4PG8A 1K1QA 1UW4A 4ECXA 1FRJA 3R7BB 3H0PA 4BC9A 3RRGA 2BJ7A 2XTJP 3FC9A 1R89A 3LWLA 2WAQD 1F60B 4NCGB 4K5RA 3CMAS 1HBUB 4MK7A 4ECQA 1H3DA 1C0UB 3IC1A 2A0FB 1HHSA 1TK8A 1FDAA 3LP0A 1TUVA 3IR5B 1TFYA 3M32B 2E1PA 2UUAJ 5DQGA 2YKAA 2XSJB 2ILZA 2GAGC 5E0OA 1Q8BA 3JYTA 4N7TA 2AWZA 3MTKA 3BR9A 3CWJA 5HVFA 2XO6A 3PX6A 1S99A 2E9RX 4FNIA 1FDBA 1S1XB 1NM2A 3KJVB 1X4GA 2EVZA 3TANA 1AUDA 2R7XA 5FLXU 2BJ9A 1X4FA 1TELA 4CLWA 1AA1B 2XNRA 2HS4A 4X65J 4E8UA 5LMNJ 4C8OA 5KFJA 2IPOB 4LRDA 3KG0A 2Z8QA 3B4MA 2FTRA 2VONA 5F8NA 5HK4A 2C22A 2QSWA 4NOHA 2G2OA 1RBOB 2DNKA 2F4VF 5FLXY 1D8ZA 3NS5A 2MTLA 1U7LA 4ELVA 4OLOA 2OEJA 4AQYJ 4EO8A 4ZCIA 1Q0NA 3EMTA 1LEOA 3NOCA 2WVEA 2KL8A 1WACA 2O5DA 4R5PB 4UTGA 1X9SA 3PRVA 2XS5A 4ZVFA 3AHPA 3Q22A 2AZ3A 3MMBA 2JVRA 1NKBA 3UR3C 2ZOFA 3MM8B 4HI2A 1RTHB 1UJ6A 4OX6A 2MZ1A 2HVEA 3FCHA 2VFSA 1DTTB 3BBBA 1BE4A 3NWRA 4LUBA 3NNCA 2KI2A 2ZEJA 5J1EA 1HBOB 1U26A 3H5YA 1SH0A 4F4XA 1Q79A 2IBKA 3T9ZA 4EFAC 5E7OB 3LP1A 2HRUA 3UVJA 8AT1B 3A1YG 4RNNA 1F9HA 4QCLA 4IR1A 5EX3A 5F8HA 1NXIA 4UQGA 4J9NA 2JEFA 1SL0A 4P9SA 3M8RA 2YKNB 3K89A 2ROPA 1UP1A 1AROP 3RJMB 1U0HB 2B5JB 2I0XA 2XYHB 1OYEA 3E8OA 2KJVA 1D9FA 4IFYA 1VRTB 3HD1A 5F9NA 4KKOA 3M9NB 3L4BC 4DV3F 1RWKB 1WJ9A 4OLPA 2M8HA 4NL5A 2G0JA 5KFFA 3HT0A 5K14A 2NXJA 4ED4A 1SJFA 5J2PA 4YR0A 4LBHA 1M5PC 2GS8A 1JJ4A 3QO9A 1O0PA 1JJ2R 1NJWA 4YHHF 3C6UA 2EFNA 2AGOA 2JSXA 4QIGA 4IG0A 3DOLA 2YNFA 4FZVA 1LV5A 4ZN1A 3SEOA 3ZTSA 2K7JA 2UVWA 4FF4A 4X4SA 3C15A 1RBLA 3GB0A 4LSLB 1T9XA 4Y65A 2V8HA 2CPEA 5EWEA 4RO0A 1EP4B 1HWLA 1Z2ZA 4ED6A 4ZITA 2FC8A 5JXSA 2UV8G 3SV4A 1VK8A 3LF0A 2J8SA 2WCXA 1TKZA 4PWUA 2V68A 2HAIA 5L46A 3OV7A 2GHPA 3ZNJ1 4RLEA 1GMWD 2CNKB 1ZPWX 2ZWOA 1K9MT 4ZPVR 2AJ4A 3NGTA 3FEYB 1Q1KA 1NPPA 4Y2CA 1QSSA 1KBRA 2AIRB 4QPXA 2FHMA 2E9TA 2CPHA 5KFPA 2FDNA 2L9WA 3HMJG 2QL9B 3G2XA 1WD6A 3VGUA 1HNWJ 1Q8IA 3BKFA 4Y2KA 4RW4A 1JLFA 4JI8J 3DXBA 4RNHA 3EXCX 3G6ES 1RT4A 4ANDA 2YY3A 2O3DA 4ZOSA 4RL1A 4IDKA 2DXDA 3CCES 1I94F 2HLUA 3KG4A 4Q43A 1RT2A 1RB0A 3TUJC 4H4OB 3A12A 2VUGA 5A8RA 3F44A 4HEA9 3OR2A 3V4MA 4JYAF 5HMYA 4QYZK 1CLFA 4M63A 4XK8C 4Z37A 3HPOA 3X1LB 2D1CA 1NKEA 4L3NA 3IGNA 2XLIA 2CQIA 1NLKL 1VBXA 1SKWA 3J7AN 2LXIA 1RSCA 2R3VA 2LQ8A 1U8SA 5IQQA 4DV2J 3SDEA 5KFCA 5K8PA 1WSRA 4HKQA 5K9FA 4ZKAA 5KFVA 1U1LA 2YWHA 1CULA 4DV6J 4C0HA 3OQ2A 1XNQJ 2HPUA 5CCMA 2FJBB 3DCAA 3JS9A 4K0KJ 1V3ZA 1K0VA 3RB4A 2QRRA 4KGXB 4Q0BB 1AUSL 2AQ4A 2AF6A 3KLEB 3VTIA 3HVWA 3IAM9 3TP2A 2HSEB 2QO3A 4M5NA 4USVA 3V6DB 3IXQA 4I68A 5KFKA 2E9ZA 3H4BA 2RAQA 2V8PA 1MWZA 2FZCB 3MZIA 4K7QA 3DLEA 4F4ZA 1VQSA 3C6TA 1U1PA 3PIOQ 4MK8A 5GAHI 5T41A 4I56A 4LRBA 2WSFC 5IM0B 4O4GA 2GO8A 1H6KX 2DB1A 2GQCA 4KGMA 1F5BA 3JQJA 5T7LB 4C6AA 3EZ5A 3TUZC 3C2PA 4CYUB 3BEGB 4HHJA 1SIWB 3JTOA 4P2MA 5ETKA 5B08A 4ZHRB 1W2BR 2N4DA 2CFXA 2IMWP 1R0AA 5ADZA 2XYGB 4NLPA 3KK1B 3D3CJ 4M5IA 2ALYB 3M2UB 4M5KA 2HFSA 1WHYA 1N4LA 1QM9A 1R43A 3LH2S 4NCGA 2VFRA 1HBUA 2ZUAA 4MYUA 4J9KA 2LP4A 3NBPB 1C0UA 1V3SA 4DQQA 3P96A 3RRKA 4GKJJ 2CVEA 5H9EK 2M5YA 1CJVB 2AU0A 3M32A 1LW0B 2XSJA 1PIEA 2D41A 4LF5F 4LVOP 3MR5A 1HQ2A 4KV8A 2CQ4A 4B3TF 1FTRA 1S1XA 3MCOA 3R3TA 4XPEA 4C8MA 3KJVA 5I3PA 3CCJS 5J2QB 1UTAA 9ATCB 1SUQB 1X5PA 3R27A 5B0DA 1E6VB 1WOSA 4NMLA 2QIFA 5KFWA 2UXDF 2Z2MA 2C2OB 3KUHA 2HVIA 5EN1A 1H72C 3FBEA 2Z30B 4DCPB 3CJRA 1PSDA 4A8SA 4PXDA 2EXUA 4QZVB 3I87A 2JVOA 2QMXA 1Y11A 1HIYA 1VHIA 2VQFF 3F0NA 3W61A 2ATLA 4DV5J 2GQQA 2GCFA 2VA2A 4JUZA 1N0VC 3G96A 4PQUB 3AY0A 1U2CA 3ISZA 3OXGA 4KHPF 2IDLA 2C2KB 2L41A 3MEEB 4NZ0A 3LWMA 2EBEA 2YH1A 4RU9A 2V2QA 2VG7B 4PEOA 5MAOA 1FRMA 4NLWA 2OAUA 2A10A 1FNOA 4BCAA 3UDCA 3MM8A 1C1CB 1RTHA 4MTPA 4YFUA 2E5GA 2J0XA 4F3OA 1DTTA 1RT1B 3GYGA 4NXNF 1HBOA 1OY6A 1N54B 1F2GA 4LF8J 4ZS6A 2CNOB 3MPWA 4KPCA 4C4WA 3T1YJ 4NEZA 4BLGA 1FRKA 1HQUB 2VFVA 3OL7A 3NEKA 2HGLA 4KGZB 3B8HA 3NP5A 2FJXA 4TLQA 3RYLA 2B8QA 3C66A 5JUMA 3CJKB 2YKNA 1HI1A 1VFJA 2CJQA 3W9JA 4W98A 2H54B 1U0HA 2B5JA 4B3OB 2UU9F 1KVJA 4HT7A 3I82A 4IG3B 1PCAA 1VRTA 1D9DA 3W9IA 1PAUB 1M5VC 1WF2A 2LMIA 2CDQA 2KYXA 1T3OA 3TJ9A 2DGTA 5GAGU 2E1MC 3CF5Q 1J2VA 3D3BJ 3VVTA 1T05B 4PUOB 4HH0A 4Q8EA 4TQRA 3HO1A 2OSQA 1NSPA 2X1GA 3T6BA 2H4WB 3D9BA 3DI6B 5AE3A 3AD9C 3W8PA 4F25A 4TYBA 2JX2A 4RZRA 1QVFR 5L1IA 3FUYA 2ACMA 3TA1A 5CYQA 4AD6A 3FSIA 3D6FB 1S0NA 4BBYA 1XMOJ 1TP7A 1Q16B 3ZZYA 2BM1A 2GNKA 3HSZA 2MPUA 2BBEA 4BC7A 3Q8SB 2YX4A 4XTTA 3OXFA 3MAHA 1N48A 1LK7A 4LSLA 4IYQA 4S0MA 2GIFA 2CNNB 5B0CA 2E7WA 1TAQA 3ZTQA 1RT5A 1EP4A 2RH3A 5IZHA 3K5MA 4PAAA 2XMKA 3AAWB 1EX8A 1WTBA 1R6VA 2FGCA 2GFFA 4KC5A 4F4KA 4PXCA 1YJ7A 1R0CB 5BR8J 4IFVB 3KJFB 2HQ3A 4LF9F 4OX9F 4LRFA 1UMJA 2QSFA 1D0EA 2CZ4A 3OFGA 4P71A 4I4BA 4JI2J 3D2WA 2P8IA 3ZZRA 3T1HF 4DR7F 4NA2A 5CYMB 3DU5A 3OW2R 3T5HA 4B9VA 4DHVA 4JI5F 2MZTA 4M1KA 1UVNA 1FD2A 2VOPA 3LQVA 2CWXA 4X4VA 4OMFG 4KGVB 1IKYB 4PPDA 1YKWA 1H74A 1ZAVA 2GIRA 1DQ9A 4RW8B 1A7GE 2B7BB 5FD1A 4NA3A 3BPDA 3ENWA 2I5JB 1Y4ZB 1QE1B 5E33A 4DFMA 4LF1A 2Y1RI 4F8RA 3OXLA 1WC3A 4H4OA 2EWHA 3HT3A 3CT9A 1RT7B 1G2EA 2V9WA 2AYMA 5IT9U 3QAUA 1YJTA 1WC6A 4Y2AA 1OJ4A 5IV3A 5JVHQ 4C8LA 4O0NA 2X1AA 2HG4A 2YBVA 1M5OC 2ADCA 1JK9B 3A8KA 2XC9A 3HULA 1TL3B 4FBUA 5B0FA 2R9LA 1U48A 5EGYA 1VC5A 2OTJS 4I2PA 5L9NA 4NLUA 3GIMA 3LP2B 2DRDA 5IT9Y 4TLRA 3Q0AA 2ZNZA 3R97A 4H4MB 3AFGA 4QR2A 2OPQB 2JC0A 4YHHJ 3L7PA 4DMZA 2FPHX 2OD4A 2GW8A 2OFHX 1H7WA 4DUZF 1RA6A 2ZJRQ 2VC1A 2XHCA 4NYZA 1A9NB 4W92B 1TKDA 3JQKA 3T5KA 2OP5A 2V8DA 1TL1B 1X4BA 1KEKA 4CM0A 5IWAF 4Q0BA 3FRYA 3NAHA 4USIA 1M5SA 3KLEA 2Z2ZA 4C3MA 4QPTA 4ALZA 2XEXA 4CLKA 2V63A 4NWBA 1WNEA 2GIQA 1M5HA 1KQKA 1HD0A 4DV0F 4HVZA 1LKZA 2MHNA 3V6DA 3ADAC 4IOBA 5F41A 2W9CA 1IKWB 5E5NA 2PE8A 4USHA 3SIPB 1CJTB 4DV1J 2RU3A 2B3TB 2QEXS 1UFLA 4C8KA 5B0AA 3W2WA 3MD1A 1V9OA 1IQTA 2AKWB 3CJ2A 1J5OB 2HBYB 4YP3A 5IM0A 4ER8A 4DL7A 3MF5A 4LSNB 1Z1ZA 1Q4RA 1RBAA 5T7LA 4I2QB 4EBCA 4L6V3 5KG6A 1W7WA 4NYPA 2PMHA 4DN0A 4CYUA 1V5IB 1X9WA 4ZHRA 1GX5A 2OEMA 4Y0FA 1MMNA 5DLGA 3QFWA 3KK1A 3QGGA 1XQIA 1VIOA 2E44A 1UPMB 3H2VE 3N6LA 3UN5A 1VI7A 1GFWB 2MKKA 1I94J 4CI0B 4K4YA 2OO4A 3WC2A 4PXEA 2YWFA 2MKSA 2W7OA 5DG9A 4V19X 3M2VB 3NBPA 1CVJA 2YQ3A 3SSRA 4JYAJ 4O3QA 2OUGA 1CJVA 3Q8YA 2Q66A 3I4PA 2DHAA 4KRWA 1LW0A 1PJ6A 1RAEB 1FK9B 3LANA 2KN4A 7FD1A 4NLQA 3BO2A 4GO5X 1RI7A 3AA9A 5CD4H 1FKPB 3EUNA 1T9UA 4OX7A 3R6LB 4G6VB 4U95A 5J2QA 2C2DA 3MMAB 4I69A 1S6OA 1SUQA 3VAJA 3IP0A 1E6VA 4X66J 4KQZA 3NGRA 4CTAB 3QLHA 1ZM2A 3R2DJ 3M8SA 3AB2B 3VZHA 2QFIA 3OSPA 4A8OA 1MMDA 1MWYA 3M8ZA 4JI7F 2L48A 2RVJA 4DSJA 2VU5A 4IRDA 3BDEA 5HQ8A 1RHQB 3SMZA 2OKQA 1N5TA 3MECB 4OYXA 4JI6F 3PVXA 1NK9A 2DT9A 3PEJA 4NZ6A 2AZ1A 4MKAA 4PQUA 2FZGB 4ZPBA 5IV4A 2VKZG 4ZK7M 3ZNUA 1T95A 3MEEA 4OJ3A 3PRBA 4RR5A 2VG7A 2R7TA 2F1FA 1GXLA 1QTNB 1RHJB 3HVAA 2OSRA 2EPIA 3FVYA 1NDKA 3R9LA 3MR6A 2WHOA 3J81U 3PJ9A 1N34F 3NCRA 4CT8A 2W7PA 3MURP 2AYBA 3QT7A 2HFZA 4LR7A 3TA0A 2Q6CA 4GVLA 4HHUA 1RT1A 2AEMA 4N8OA 1ELOA 2BW7A 3BKUA 2XWYA 2RDIA 3EGVA 5LMUF 3N9UC 1B0TA 1VR6A 5HROB 4OZ1A 5K8NA 2FVQA 3J7A1 2BQUA 2DR5A 3I0RB 2HYIB 2YPZA 2XO7A 1TU0B 3DDIA 3TZWA 3J81Y 4ECSA 3RW6A 2AEFA 1TZ0A 1DARA 3R8YA 3THVA 4NRTA 1YTYA 2DNMA 3HFVA 1VQ8S 1XTZA 3TQEA 3CJKA 3CDAA 1FKAF 1YK9A 1NCLA 2NXCA 3D67A 3ZZTA 3DLJA 2BJ1A 3UN3A 3GV5B 4B3OA 3RU0A 1RT6B 2E7XA 4IG3A 2LLZA 1T94A 2BJ8A 4CNYA 1UPPA 2LEBA 3ITHA 3ISNC 1YG0A 1V6HA 2GX8A 2R7OA 3C14B 1SJ3P 2R2RA 4C3LA 1KVIA 1XEZA 3RAMA 1FRHA 4DUTA 2RDDA 1T05A 4ED2A 3Q8PB 4PUOA 4LF5J 2LKZA 1ZTTA 2LEPA 4FYXB 5DZ6A 3J7Z5 3DI6A 3M4XA 2WVBA 4ZP6A 3BN4A 4HTIA 3M8WA 4F0KA 1OPZA 2LYVA 2MQNA 5ETQA 1NHKL 3LAKA 3EDQB 3JAMU 2FVRA 2CJBA 1O8BA 3UCZP 3KK3B 3GONA 5SUHA 4IRCA 2YWKA 1Z2LA 4Y34A 1HR0F 1VQKS 3CJ8A 2VQFJ 2HKEA 1O51A 4J9VA 4RUBA 4USKA 3WIVA 3QZ8A 4IFVA 3MM6B 2CJYB 3AT1B 4KT0C 5A8KA 2WSEC 8RUCA 4ZDNA 2NPFA 3JAMY 3PIPQ 2BJEA 4P72A 4ZIWA 1WC4A 4KHPJ 4RW7B 3K8VA 3HFZB 5CYMA 1Z4UA 1ZTWA 3QIPB 3A8JA 5JVGQ 1QVGR 1TK0A 2R7WA 4EWTA 1KQSR 2J7WA 3R5JB 5KFEA 2W2OP 4HR2A 4CO0A 3P8BB 3FCVA 4RW8A 4QWEA 2OELA 3RBEA 4X4PA 1G1XA
chains in the Genus database with same CATH topology
2YKAA 2HHHF 4CO4A 1F5CA 2XSJB 4WFBQ 2VFTA 2I5JA 2ILZA 2L08A 4ECUA 5E0OA 2DPIA 1Q8BA 2EW9A 5HP1B 5KG0A 2M7SA 3JYTA 3KKFA 4P6QA 4E98A 1PC5A 4QR1A 1QE1A 3ZC4A 4JBCA 2UVUA 2AWZA 5MLCV 3MTKA 1HNVA 3BR9A 3CWJA 3FSXA 3PX6A 2D3ZA 3PW2A 2JEGA 3HDSA 1S99A 4ECRA 2E9RX 4FNIA 1FDBA 2G0CA 4X64F 1S1XB 2D9OA 2MZSA 5AXMA 3DLBA 1IN0A 3VWSA 1FKOA 3GFYA 5C24B 3TQ1A 1LWEB 3CJ4A 1RT3B 1X0PA 3KJVB 4J9RA 1X4GA 2EVZA 4PWDA 4HDHA 1WEZA 3TANA 1AUDA 2P9GA 2R7XA 1MU2B 2ZM6F 1R8AA 2YTCA 3WBZA 2KM8C 1X4FA 3B82A 3NMAA 1VC0A 3BSCA 3MM6A 3OUYB 1YGYA 3OTEA 3MEDB 3N5BA 4QR0A 3K58A 3M2RA 1FDNA 2QA4G 5G4DA 2XNRA 2RRAA 2HS4A 3OFFA 2QYCA 1SL1A 2HLTA 2MQLA 4E8UA 4RUHA 2K1RA 2ZHAA 3V4IB 4C8OA 3HK2A 4N56A 5B0EA 1JLGA 2VBYA 5KFJA 1Q53A 3BGUA 3HI9A 2MXYA 3SXLA 1HPZB 2DNGA 4DG1B 3I5BA 4KO0A 2KXHA 4IO9Q 3NNAA 3KG0A 4MFBB 2Z8QA 1HW9A 2W9BB 4PPZA 4WF9Q 3B4MA 3R5BA 4DWIA 2HHTA 1UVMA 3CPWR 2FTRA 4J9PA 2A2CA 3H8YA 2VONA 3BGFA 1BQMB 1RWUA 5A0YA 3EPIA 5F8NA 2JC1A 2FGOA 1MW7A 4LF4F 5KFNA 3DLKB 1Y0HA 4X62F 1X5SA 2C22A 2QSWA 3FMWA 3ENVA 4NOHA 3K5LA 4B02A 1I6JA 4J9SA 1TQLA 2N3LA 1K0TA 1UVLA 3LP2A 5DM6Q 5KT2A 2DNQA 3CE8A 2JL9A 2DNKA 1HD1A 4QIEA 4WE1B 2JOQA 4DFKA 3OVAA 5FLXY 2F4VF 1D8ZA 3MPVA 3NS5A 2ZHBA 3CCUS 1U7LA 2A1BA 3VAIA 4OLOA 4ELVA 3OTBA 1PGZA 2D9PA 5KFQA 1SIZA 4RX6A 5DLFA 2IA6A 4EO8A 3W2VA 1DBDA 3SCIE 1QAIA 4ZCIA 4C98A 2ZKUA 1OS5A 3GV7B 2JLEA 3V6HA 3PNIA 2OPQA 2CJAA 3DRPA 1N33F 2BXJA 3NLCA 3MI7X 1IBKF 4N41A 3CDBA 4NLDA 1T02A 4ZPWR 3DRSA 1WACA 3HKWA 2ZJPQ 1VMBA 2XMWA 2O5DA 1Q7LB 3K2YA 1X4DA 4R5PB 4KBIA 4IO1A 4TQSA 3I96A 3NWGA 1YQHA 1X9SA 2D7SA 4F02A 4ES3A 2XS5A 1GTHA 3D1HA 4ZVFA 3RB3A 3AHPA 3Q22A 3KTQA 5J1NA 2IVMA 4YOEA 3MMBA 2JVRA 2MDAA 5SZTA 1NKBA 3UR3C 1LWCB 5D3GB 5AXLA 4WZMA 2ZOFA 2CQHA 3MM8B 4XDDA 4HI2A 4UOCA 1FXDA 1TL1A 2XCAA 2M8DB 1RTHB 1UJ6A 2D74B 4ED7A 4OX6A 4Y00A 2MZ1A 2DIVA 4ED3A 4IQXA 2ZZMA 3E3XA 5LSRA 3EPGA 1WF0A 3FCHA 2AD9A 4H54A 2VFSA 1NAQA 4NPOA 1DTTB 3OUYA 1X0FA 5A8WB 5B09A 3MEDA 5L38A 4LUBA 2GMHA 2KG0A 4X4TA 3NNCA 2FD2A 2KI2A 5CZVA 2R8HA 1SKRA 1U24A 5J1EA 4ICLA 1NH7A 4BS2A 2VG5A 1HBOB 1U26A 3H5YA 4WU2A 1SH0A 3I32A 3V4IA 1YITS 4WFNQ 3K5PA 4TU7A 3CD7A 1Q79A 4F4XA 2IBKA 4KJIA 3T9ZA 1S1WA 3QIDA 4EFAC 3MOZA 3PKYA 2WONB 1M0SA 3LP1A 2HRUA 5E7OB 5F8JA 4FP9A 5E3QA 3S01A 3CUNA 3A1YG 4JV0A 4KAIA 1N52B 4DX8H 5DG8A 3RBDA 3M8QA 4C8ZA 1IKWA 2N82B 2QA4S 4RNNA 4IG0B 3UCUP 3NNHA 3PRDA 3MM9B 3M30B 3I9ZA 2OH2A 1T7PA 2V94A 2ZHOA 1WG1A 2DHXA 4QCLA 3O2IA 4IR1A 1TAUA 2GA7A 5EX3A 4DSIA 1N5SA 2UP1A 5F8HA 4FVMA 4A48A 4UQGA 5AXNA 1U6ZA 4J9NA 4GC7A 2JEFA 4JV1A 1SV5B 1VOMA 4WE1A 1SL0A 2EI5A 1KD1T 4YB5A 3TAMA 3M8RA 1J5OA 1U1MA 2DHGA 3D28A 3BF4A 3MM7A 3UFCX 2RT3A 2B0GA 3BGRA 4B08A 2GC8A 4OIXA 1IQZA 2YKNB 4ED0A 2C3MA 1GNKA 5E3PA 1WWHA 5KTQA 1PILA 5EWFA 1SB6A 4O4RA 1N32F 2ROPA 1UP1A 1U45A 1CSJA 2RJZA 3IWLA 2ZE2B 1AROP 2XBPA 3MCSA 1ZZFA 2ZH6A 2HHUA 1C1BA 2BM0A 2XS2A 2HIQA 2B5JB 2WOMB 2I0XA 1RKJA 1FJEB 4LSNA 1WF1A 4R5PA 3RW7A 3SQGB 1JLEB 3SI8A 3SFGA 3E8OA 2KJVA 2W4DA 4M5DB 1KLMB 4I2QA 1D9FA 4IFYA 1VRTB 1YRUA 1GT8A 4YY3F 3RAQA 3CJ5A 3BSNA 4F4YA 2V4JA 5F9NA 2B7CB 4KKOA 2RNEA 3M9NB 4LF7F 3POTA 3GILA 5KG5A 4DV3F 1LWCA 5D3GA 3N4WA 3KMQA 4OLPA 2M8HA 4ILLA 1A6LA 4NL5A 4JI3F 2J8AA 4F3QA 5KFFA 4OI0A 4DUYF 3DDKA 3Q24A 3CGIA 2UUTA 2DNOA 5K14A 3KLGB 1S0MA 5F9LA 1SJFA 4YDDB 5J2PA 1DLOB 2BW2A 3FFIA 4YR0A 1S6QB 3K7RA 3GQCA 1M5PC 1YIJS 4QU7A 2E29A 1JJ4A 2BOPA 3R5AA 4NLXA 3QO9A 1BQNB 2OPSB 3BDPA 1O0PA 1FJCA 3ZZOA 1JJ2R 3T9NA 1NJWA 3QWUA 4YHHF 2YNHA 4DSFA 2MSTA 4E0DA 4ZVEA 4QWBA 4DEZA 2KFYA 1L3SA 3OTCA 2ADBA 3C6UA 2WONA 3MTJA 1HI8A 2EFNA 1VRUB 4M95A 1MROA 4U7UK 2AGOA 3OHAA 2RKIB 4DL4A 2ERRA 5FDLB 2JSXA 4QIGA 5DJBA 5D4NA 4IRKA 3GR1A 3M2VA 5A2QY 4IG0A 1X8DA 3O3LA 4DL5A 4RU2A 2KZZA 4A8QA 5K8MA 4RW4B 3DOLA 2YNFA 4FZVA 5KT4A 1LV5A 3ENQA 3OTDA 4K2XA 1VK3A 1RTDA 4NA1A 4QWCA 5H1SV 3SEOA 4TU9A 1TL5A 5D4OA 4DR6F 2K7JA 4OFZA 1FK9A 2ZVSA 4MMOA 4ZVHA 2UVWA 1YRTA 4M8LA 4X4SA 4FF4A 3GB0A 4LSLB 2CJKA 2WRMA 1GX6A 4Y65A 2V8HA 3WZ0A 2CPEA 3O8WA 5EWEA 4QWAA 1N56A 2DGWA 5LXRA 2IRXA 1KRPA 2ZDPA 1EP4B 1HWLA 1Z2ZA 3OFEA 4TY9A 3SFUA 2YNGB 4ED6A 1Y3JA 1FKPA 1MNEA 5HN0A 3MOJB 2FC8A 4QQBA 5JXSA 2UV8G 3U27A 3TVKA 3SV4A 3DYAB 4DFPA 5J2NA 5I3UA 3BO3A 3SZ2A 2IYGA 1S6PB 4KPYA 2BRLA 3IG1B 1VK8A 2WK4A 3LF0A 1JLEA 3TX8A 2WCXA 4F4WA 1TKZA 4PWUA 4X2BA 1N5VA 3OR1B 4X4UA 3BR8A 3MMAA 2I2YA 2J6UA 3MEGB 2BE2B 2HAIA 1WI6A 4O3SA 3OV7A 1VQ9S 1SBRA 2GHPA 1LFPA 3KG1A 4C9DA 1RJJA 1S1UA 4RLEA 4B9TA 4I64A 1IBMF 2MGZB 2KG1A 2DGOA 2CJ9A 2PC6A 4BWJA 4KB7A 3N6MA 1ZPWX 2BQ3A 4CTAA 1OWXA 4OZ0A 4I7FA 2XG8A 3MXHP 1K9MT 4ZPVR 2AJ4A 2BABA 4AQYF 4ETXA 2JFKA 1TFWA 5CA5A 3PW5A 4ZA1A 3V5RA 3KLGA 5KFRA 4ZCLA 3FEYB 3UD3P 2R2UA 2ROGA 1Q1KA 2GO9A 3D0GE 1XBWA 4F3MA 3QJJA 4X4NA 4Y2CA 3KLIB 1QSSA 2PDAA 1H2TZ 4QPXA 1RDRA 1RTIB 2FHMA 5KFAA 2E9TA 2CPHA 4DL3A 1FRIA 1TKTB 4ED8A 5KFPA 2FDNA 2L9WA 4ZPTR 2BV3A 2EFOA 3I0SA 4HL9A 4EBDA 4NLRA 3HMJG 2NUHA 5LJ5Y 3E01B 1WD6A 4OI4A 1Q8IA 2CG4A 1CEZA 1LFWA 3SDEB 3CCRS 2GV1A 1VS3A 2QA2A 2P6SA 3HHKA 2DCLA 3PEHA 4QIVA 4Y2KA 5F3TA 2R8IA 2K3KA 5I3QA 2J9CA 4RW4A 3MECA 2DRBA 4OL8A 1KTVA 3GYNA 4MIWA 1JLFA 3PFEA 3DXBA 1ZETA 3QJPA 2I9SA 2FLNA 4O3OA 2W7AA 1X4AA 3GFXA 2LCWA 3H59A 3G6XA 1H98A 3AJ2A 4RNHA 3EXCX 3G6ES 3PY8A 1RT4A 2I8EA 1N6QB 5AXKA 1AW0A 2KZMA 1U47A 2YY3A 2O3DA 4ZOSA 2VKRA 4OHYA 1LWFB 1NK5A 4IDKA 2W4PA 5D4LA 4IKAA 1Y3KA 2QT7A 3GIKA 1T03B 3CCES 5KFUA 1I94F 2HLUA 2PA3A 3KG4A 3I5CA 1TL4A 2MY7A 2RE1A 3GG1A 1RTJB 3DHXA 3DYAA 3C3LA 3CCLS 4Q43A 1JLCB 1RT2A 4U9RA 3TUJC 4H4OB 3JSMB 2CQ2A 2VUGA 3US5A 1Q86T 5A8RA 4JI4F 2NLWA 4OJHA 3F44A 2YVSA 1R27B 3NCQA 3CULA 2BACA 4LT6A 2HW3A 1TR0A 2C3PA 3L7OA 2M3DA 1ZM4A 3OFHA 4HT5A 4HEA9 3OR2A 3V4MA 3JSYA 4JYAF 2KT5A 1CQMA 3MEKA 5HMYA 3K5OA 1CLFA 1WTFA 2RD5C 4M63A 3OBIA 3P49B 5L39A 2FHJA 2VD3A 1XMBA 1LK5A 4XK8C 4Z37A 5IXUA 2OIHA 3HPOA 2RQMA 3X1LB 1NEEA 2KU7A 5HROA 2PSZA 2IC3A 2D1CA 1NH8A 4DV4F 3MUTP 4DQSA 4YMEA 1NKEA 3G8QA 1Y9OA 4WFZA 3SCLE 1YJNS 3J7ZT 3I0RA 4DN9A 4L3NA 3AQOA 3IGNA 2XLIA 3TUIC 1U09A 2CQIA 4A8KA 2KB2A 2ZH1A 3UCGA 1KOOA 1NK6A 1VBXA 1SKWA 1RTIA 1NHVA 4EYHB 2LXIA 2Q1LA 2YKQA 4LQ3A 1HNIB 4YR3A 4FF2A 1T3NA 1DHMA 1U8SA 2RDJA 2AX1A 1WELA 3I6PA 5IQQA 3CCSS 3H20A 4OI6A 1KHVA 2ZH4A 2DPJA 2QMWA 2BZ2A 3G86A 4AFFA 4DLGA 1N36F 2R8JA 2NREA 1UVKA 2LA4A 3SDEA 3FNNA 1KLNA 4B9UA 1UVJA 5KFCA 2BUNA 1WI8A 3EGWB 4TNOA 5K8PA 3WDOA 3H98A 1GQEA 1VBYA 1P8GA 2F8MA 1B7FA 2AJFE 4HKQA 3VR1A 4ZP9A 1N5YB 5K9FA 1TKXA 1HWUA 2DNRA 3BB5A 4ZKAA 3PX0A 4RW9A 2I1RA 2OTLS 4DSLA 2HZCA 3G71S 5KFHA 1RT6A 2CYYA 1KQGB 3UDLA 3R5CA 5KFVA 1U1LA 2V0NA 2ZC4A 2YWHA 3L3CA 2WW8A 4CQ1A 2VPZB 4IH5A 4C0HA 3OQ2A 5M2UA 4U7CA 3PFOA 5L1JA 2EFGA 2HPUA 5CCMA 2FJBB 4YUDA 3DCAA 4LFBF 1M1KT 3IAS9 2LQJA 1CQNA 2DRAA 5F8MA 3OSNA 1V3ZA 5IQ6A 1K0VA 3RB4A 1IKVB 3BO4A 4NX9A 4A46A 1G6BA 4P2SA 3HXMA 2QRRA 1QAJA 3GFZA 1R0AB 3NGKA 4Q0BB 2NS1B 1HYSB 1JNRB 2XI3A 2YX7A 5LL6d 5AE2A 1HMVA 3MM5A 1Q78A 2AQ4A 1I1GA 2CVIA 5KFGA 4G1QB 2AF6A 3FZ2A 2KM8B 1JLBA 3CVKA 1NB7A 2M2BA 3KLEB 3DMJA 2HVZA