1X8DA

Crystal structure of e. coli yiil protein containing l-rhamnose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
104
Chain Sequence
b'MIRKAFVMQVNPDAHEEYQRRHNPIWPELEAVLKSHGAHNYAIYLDKARNLLFAMVEIESEERWNAVASTDVCQRWWKYMTDVMPANPDNSPVSSELQEVFYLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein yiiL
publication title Structural Insights into the Monosaccharide Specificity of Escherichia coli Rhamnose Mutarotase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
total genus 28
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.32: L-rhamnose mutarotase.
pdb deposition date 2004-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05336 rhaM L-rhamnose mutarotase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x8dA01
2JDJA 1FVQA 1TUVA 5T7LB 1YJTA 1N5QA 2PGCA 1Y3JA 2N4CA 2OFGX 2Q3PA 2GCFA 2ROGA 2FB0A 2ASYA 2RU9A 3QGPA 4NL5A 4A48A 1OPZA 1ULRA 2FHMA 1X7VA 1TZ0A 2W4DA 4A47A 4YDXA 4Y2IA 5KAKA 2KT2A 2VV5A 2AJ1A 3HDSA 3K7RA 5B0GA 1JWWA 2XMTA 1XBWA 2HIQA 3MZIA 1WD6A 2ROEA 4HI1A 3IWXA 2OAUA 5IXUA 2ACYA 3BDEA 3LO3A 4OJ1A 1AW0A 2IYIA 4HH1A 1X0PA 2GV1A 4QOTA 1VQYA 1CC8A 3BB5A 1LQ9A 1YRXA 4FNHA 4FNIA 1VQSA 2OD6A 2PD1A 1RJJA 2LXFA 2KT3A 1X8DA 2OMOA 2HFOA 4A46A 5B0DA 4HI2A 3GZ7A 4OJHA 4U9RA 3VTIA 2GO8A 2RSQA 4OJ3A 4EFAC 5A6PA 1OQ3A 2LQ9A 4Y2MA 5T7LA 3KKFA 3T9NA 3CJKB 2XMJA 1Y9OA 1URRA 2OP5A 2ZDOA 2FIUA 2GGPA 2HFNA 2QLXA 3HHLD 3QMQA 5K9FA 1FE0A 4F67A 1SQEA 2LQBA 3HHLB 1YJRA 1FVSA 3E8OA 4OJGA 1N5VA 1GXUA 2KYZA 2BJDA 2GA7A 2K7JA 3BM7A 3BF4A 2LDIA 3DXSX 3WDOA 2QLWA 4OIXA 2BYCA 2GFFA 3MCSA 2RMLA 1AFJA 2K7KA 2QIFA 1TR0A 2K1RA 1K0VA 2W4PA 3KG0A 1FD8A 5A6WA 3TRGA 2VH7A 3FGVA 3KG1A 1P6TA 3BN7A 2AP6A 1R6YA 1SI9A 4Q2LA 2QYCA 2XMWA 2XMUA 1CC7A 1S6OA 2BBEA 1IUJA 2EW9A 2OFHX 2HLUA 3BR8A 3F44A 2OKQA 3LGMA 3HF5A 3BGUA 4HL9A 4Y2KA 5B0AA 2OD4A 4DN9A 1Q4RA 2W4CA 4ZA1A 4DPOA 1QUPA 1AFIA 3FMBA 3HHLA 1GXTA 2XMMA 1APSA 1TL5A 2XMVA 3HX9A 1N5TA 1SB6A 1Q53A 2IYGA 2N4DA 1Y0HA 2FTRA 2N7YA 3DCAA 3KNGA 1YJUA 4HH0A 4Q2MA 4NPOA 2BJEA 1S6UA 1U7LA 5B0BA 2GGPB 1FEEA 2AW0A 5B0EA 1FE4A 4ZOSA 5B08A 2CRLA 2ROPA 1KVJA 3TOQA 1MWYA 1OQ6A 2IFXA 2RILA 3IWLA 3HHLC 4YEAA 1P8GA 3LGNA 2BUNA 2K2PA 3I9ZA 1KQKA 4DL0C 1KVIA 5B09A 2HQIA 5F0UA 1CPZA 1YG0A 2ZDPA 2L3MA 3CJKA 1W2IA 1FESA 2KKHA 1YJVA 2G9OA 2XMKA 4A4JA 3TNVA 1OSDA 1MWZA 5B0FA 1N5SA 1Y3KA 1V3ZA 5B0CA 2K1RB 3FRYA 5F0WA 1Q8BA 1TL4A 1Q8LA 1JK9B 2AJ0A 3UDCA 3HFKA 2HLTA
chains in the Genus database with same CATH superfamily
5H1SV 2HQCA 3CCZA 2E9RX 4NL5A 4N8NA 3FMWA 2XWYA 3C15A 3BO3A 4JI7F 5DLGA 3KK2B 4QYZJ 2IM1A 1S0MA 4HHUA 1FJGJ 5HMXA 1UEVA 1SJFA 4CLFA 1DAXA 3BO4A 4NWBA 2QE5A 4TQRA 2XSJA 3FUYA 4BC9A 5M2RA 4B3SF 5A8WB 1ACMB 3S6EA 3DXSX 3IXQA 4P2XA 3CO0P 1WTBA 3KK2A 2LYVA 2P9EA 1TP7A 1U6BA 4DF8A 2CPXA 2VH7A 3FGVA 4DDFA 3KYLA 1S4FA 2LA4A 1YTYA 1DHMA 4I64A 3DI6B 4TLRA 5A8WA 3VQTA 5I3PA 2GJFA 1WKJA 1RTDA 4TY9A 1P8GA 1RWUA 1L3TA 2E5LJ 1QJHA 4USTA 3FBCA 1I51B 1EQMA 3B78A 3UN5A 4DR4J 3NGDA 4MIBA 1M1GA 4A8YA 1KFDA 2X1FA 3JQKA 1ICEB 3R5DA 3OL6A 4NRTA 2DPJA 4CWBA 4F0KA 2ERRA 3W1YC 2FC8A 5KG5A 2YQ0A 3R5GA 5KFFA 4ECWA 4U7UK 5F8IA 3HXMA 2LECA 4DL5A 3QGIA 4DWIA 4D3HA 2W24A 5KFZA 2MGZB 2XS7A 4QPTA 3NG8A 2DNOA 1UZDA 2MLZA 1HWUA 3GB0A 1T9TA 4DSIA 5B0AA 2VBXA 1DTTB 2N7CA 4B3RF 3TARA 4KY3A 3QBCA 2PE8A 2MGZA 5ETVA 4EUVA 2R7UA 4P74A 2G9OA 3D1HA 2E7XA 4IOBA 1DTTA 3CF5Q 4YOEA 2CG4A 2WK4A 4ZLNA 4UF4A 3W9JA 2W2PP 3OTBA 1S1WA 4DBQA 4FN5A 4JI0J 3D28A 4C8OA 3UR3C 1VQKS 2DCUB 2CZ9A 3AOAA 2FY8A 2Z57B 2XLKA 5HVFA 2XTJP 3ENQA 3MCOA 1U2FA 3R5CA 1VFJA 3X3UA 4M95A 2WB4A 5C2GA 4ZPAA 2Z58B 2CQCA 1CJKB 2JWNA 5CZVA 1HNVA 3VCDA 1MWQA 4N56A 1SH3A 1QSLA 3LP2B 1WG4A 1V5IB 1UFWA 4YB5A 4KAIA 4TKTA 4PG7A 4X4VA 1BLUA 1P6TA 4B17A 3JTOA 2POKA 4CO1A 4DXLA 1RISA 4NX9A 4DPOA 4ZDNA 3BZQA 2XWXA 3KLGA 3KOAA 2CKWA 8RUCA 5BYRA 3LALA 1YRTA 1SKRA 4LF7F 3LP2A 4K0KF 1TKTB 2MZJA 4DJBA 4LFBJ 4ECXA 1ZAXA 1WHWA 3CC7S 3ZZRA 1W2IA 1N6QB 1RB0A 4DR3J 2MXYA 4PYDA 5FDLB 1GXLA 1VQ9S 4F02A 3CIZA 4UY8T 1E6VB 3SCIE 2YH1A 3MEEB 2ALYB 3Q8VA 3TI0A 2BX6A 5KG0A 1DLOB 3A8JA 1WC1A 1TKTA 1Y5NB 2V6AA 3J81U 1UJ4A 5LMUF 5MAOA 1R0AB 1N6QA 5KFKA 1X9SA 5FDLA 2D3OR 1YITS 4Y34A 1E6VA 3I5BA 3MEEA 1IBMF 1CVJA 3V6JA 4QWCA 1RT7B 1DLOA 1N32F 3UN2A 3M7VA 4ANEA 1FERA 2K7JA 4UZCA 4ANCA 5C2CA 2Z2MA 2CPIA 1R0AA 1PJ7A 1NJYA 1R31A 3R1LA 3IFEA 2W2OP 3B6BA 1RT7A 1OJ4A 4NXMJ 2ALZA 3OTDA 1WKKA 4OV1A 3OLAA 1U7LA 1QSYA 2IPOB 4X4NA 3TUJC 4LIRA 2J6TA 1L3KA 3HHDA 4DL0C 2IMWP 3TX0A 2VHGA 4GVBA 1RA6A 2GW8A 4A48A 4G1IA 1RYSA 2NPFA 4FZVA 3GTYX 3FCVA 2YKQA 3UDVA 3QFHA 3MZIA 3OPKA 2OTLS 4DUYF 3ILIA 3DM2B 3UN3A 1KQGB 3AT1B 3O2IA 2AEFA 5DG7A 4KGKA 3D1OA 4CYUA 3OTEA 4ZLJA 1YJWS 1T94A 2BKOA 4HR2A 1IBCB 2C28A 2AQ4A 5ETQA 1KHWA 3NGRA 4OHXA 3DM2A 2KXFA 5DS7A 3FRZA 2W8KA 2MB0B 3DLEB 4XK8C 4ECYA 4ECQA 2VZ9A 4CLTA 2HVHA 1WG1A 3H40A 1S76D 4B08A 3DCAA 1H72C 4W90B 4WTYA 1SL1A 1GFWB 2ZH7A 2XLIA 1MWYA 5D4NA 1NPPA 3TUIC 1N33F 5D0EA 3N5FA 4GVLA 4ECTA 2QA1A 1XMOF 3W8GA 4QCLA 2HIYA 1R43A 1Y3KA 2HBYB 5HMZA 4YB7A 3Q24A 1UPMB 1U2RA 4Q45A 5E33A 1FJEB 2XYPB 3GCXP 5F3ZA 2UV8A 2BW2A 3M9OB 1SBRA 3CGIA 1F6TA 4IG3A 3KLVA 2EVZA 3UD4P 4ZCKA 2AF6A 1VJQA 3DRYA 1FCAA 1Y00A 1RGVA 5KFNA 3DFEA 1DQ8A 2WAQD 4OIXA 2FJWA 1QY7A 1R8BA 1L3UA 4ZHRB 4JI5J 3KLFB 5CYMB 5HI7A 2V5HG 4ZPWR 3HD2A 4ZPBA 2PI5A 2VFRA 1Q8IA 4UOHA 5DQHA 3CWJA 3CDBA 2YKAA 2UXDJ 2H4WB 4DL3A 4A8KA 4DSFA 2F63A 2K2PA 1YG0A 2ZDPA 3P3DA 2B5JB 2H51B 1T9XA 1B4SA 2FHOB 2V2KA 3CJ5A 2YX1A 3PYGA 3HVAA 5BR8J 2U1AA 3IWNC 3Q8RB 2N3OA 3A13A 4MYTA 3N6LA 3T9ZA 4CLUA 2JVRA 3CMAS 2B5JA 4B02A 2H54B 2KM8C 5HQMA 2V0NA 2NZ4A 2GGPA 1X9MA 3N4WA 4B3TF 1R3NA 2BJ3A 2ZWPA 4GKKJ 4DR7J 2C42A 3GYNA 5L1KA 3W66A 3PIPQ 4OYAA 1O51A 2UUCF 5K8NA 5DM7Q 3PO5A 2Y0BB 5E3AA 4M5KA 3M8SA 3MPWA 2R7WA 4PAAA 2DNZA 3IBCB 1FF2A 1GQEA 1Z1ZA 2DY9A 3BKUA 4ILLA 2OSRA 4K4UA 2M4MA 1YJUA 1NPKA 3RBZA 2MHNA 1I3OB 1FE4A 4LR9A 3OVBA 2MZQA 3HHLC 3FNNA 2I9SA 4EGLA 1F2HA 2VFUA 2VKZG 1NJXA 3I5CA 4O0NA 3MEGB 1V5VA 5KT5A 3CT9A 3AJ1A 1HWLA 3MWBA 4NOHA 2XCPA 4PUOB 2HRUA 3DOKA 3G86A 1HQEB 4DV2J 3RB6A 3MEGA 4ED6A 4DU8A 2VFVA 3M4XA 1S9EB 4PRFA 3C16A 5EX0A 4PUOA 2RF2B 4OFZA 4DFKA 2WCXA 1FJCA 1F2GA 2W9BB 2E1PA 4U67Q 4B9SA 2HNYA 3A4TA 1HQEA 5KFOA 3OTCA 2CDRB 5A6WA 4CO4A 2X7IA 4YB1P 4DL6A 1KRPA 1SC1B 1CC7A 4TY8B 1S9EA 1M5HA 4DZDA 2VBWA 2ZHAA 3UPFA 1Q4RA 2W4CA 4IOCQ 1RAAB 1Q86T 4IQMA 2W9BA 4IQXA 2CQDA 2OEKA 2MQOA 3UD3P 5GAEU 2CQIA 3W5ZA 1KQKA 1L5UA 4AYBD 3KHRA 2KT5A 4ILMA 1XNQJ 3NGUA 3PW0A 3R7SB 1FDNA 3LP1B 1WC5A 2GZOA 2OUGA 3BJYA 1LWXA 4DUZJ 2X1GA 2EFQA 5KFVA 2EWHA 4DPYA 4F4YA 3LANA 3AB4B 1A9NB 1X4DA 3HZGA 4LF5F 1T9UA 2X51A 4ES3A 5J2NA 2CAJA 2HGNA 5D15A 3D0HE 4JI1J 4HLBA 2J8AA 4FKYA 3W62A 1RAGB 2J7UA 3WBZA 3R7NB 1S1XB 4F67A 1RAFB 1UZHA 3W61A 3BDPA 4LF1A 4DX8H 2GS8A 3Q22A 2RVJA 2JX2A 4DSLA 4MKYA 3RBXA 3QJPA 3KMSA 2XMUA 1IUJA 3OFGA 1QAYA 5F8HA 1J5EJ 4Z2XA 1S1XA 5T14A 3EZ5A 4OZ0A 4NLRA 3P6YC 2DNYA 2P8IA 2KVQE 4P10A 2HZVA 1FKOB 2NUHA 1FRXA 1TK0A 1K47A 3NWGA 3GIJA 2LXUA 2JLEA 3ICLA 5KG1A 1HMVB 3KJNB 4A4JA 1NH8A 3H0PA 2JOQA 1EIYB 1WHVA 1G6BA 4PPDA 3DDKA 1VIXA 5ETPA 3I0SB 2GJ2A 2ZH5A 4EYHB 1UFKA 4J9UE 3J7A1 1FKOA 5ETSA 1H98A 4PYAA 3IM9A 2IC3B 1HMVA 4DUTA 3D66A 4KJIA 3HSJA 4C7QA 2WW8A 1Y9OA 4LVNP 1VR6A 3KDOA 2EFVA 5GAHI 1D9FA 3DC2A 2I5JB 4FS2A 1C1CB 2H65B 2IC3A 3BO2A 5GAEI 5EX3A 1OY9A 3MTKA 2ASJA 5IV3A 2KHDA 2OELA 1T0TV 4QR0A 1CJUA 3CDWA 2I5JA 2PA3A 5IC6B 4YR0A 1FRLA 4Y6IA 3VVUA 1C1CA 3PR5B 2ZOGA 5L1IA 2HQGA 4HACA 3OFFA 4DL4A 4E98A 3VHQA 4F7VA 4DV3J 1PILA 1FT8A 3HFKA 1VK3A 4I6AA 1TU0B 4ED7A 3OQ2A 2IAJB 2BJ9A 1JLEB 2DGUA 4JP8A 3UR0A 4MAKA 4OJ1A 2CNOB 3PW2A 2E5JA 1R8AA 1UWAA 4RW7B 1IWAA 1JNZB 3CCUS 4FBUA 3OD2A 2IAJA 1X5SA 4P6QA 2VQEF 2Y1RI 3NNCA 2NPIA 1JLEA 2Z2ZA 3GJSB 2GX8A 1RXOB 1SKSA 3BS9A 4RW7A 4JI8F 1Y11A 2NUUG 1RA7A 3QT8A 2MZTA 2BR0A 2R2UA 4MYUA 3HZEA 3OR2B 3R5AA 1UA0A 2V8DA 4O3RA 2YX4A 3M8PB 2R8KA 2KN4A 4ZIWA 3H7HB 1TMJA 4OI4A 3AOCA 4Y3CA 1FK9A 2DHHA 5D4OA 3W2VB 3I4HX 1SKUB 1EX8A 3SXLA 4P2FA 1JLFB 4WU3A 4R5PB 1ZM4A 2DO0A 2HBRB 2J9CA 2Y3YA 2CDQA 2OJ3A 4AL7A 1VI7A 1WD6A 2HHVA 4ZPVR 1VHIA 5AJ3J 2DGOA 3W2VA 4QOTA 4FF3A 1SVDA 3BSNA 4PCQA 3RRGA 3T5LA 3C6TB 5KFQA 1JLFA 3FK4A 4R5PA 2FJEB 1WC6A 3EWGA 5L38A 5HVGA 5F41A 1HL6A 2D9PA 5AE2A 3N9UC 3SV4A 2D41A 4J5OA 1FD2A 4S0MA 4P7TA 3IBWA 1E6YA 1M1HA 4NXNJ 1M5SA 2ADBA 3EXCX 5EDWA 4EMDA 1F60B 2VONA 4O4GA 2BEFA 1NK9A 2J9EA 3IBFB 1NK4A 2HGLA 2ACMA 4IO9Q 4FXVA 2RE1A 1TKXA 3FBEA 3MDFA 2QLFB 4Y2CA 1KVJA 1LWEB 3PXGa 1ZOTA 2XNQA 2MKKA 3PX0A 1WELA 3THTA 2E9ZA 3QSIA 3PFOA 5GADI 4IH7A 1JXEA 3T1YJ 1LWEA 5J2MB 3QT6A 2J0XA 1WJ9A 2PMZD 4JI6J 3GLJA 4DV1J 1D1UA 3HKZD 1RJJA 3S01A 3R6GB 3K5NA 4ZVHA 4FF2A 3U7JA 4OZNA 2V8VA 3C3LA 4RO0A 4DV5F 3MAAA 4KFBB 2XZWA 5J2MA 2BJDA 3JTPA 1SQFA 1Y4ZB 4P73A 1WC4A 2ZZTA 1WG5A 2Y1JA 2FLNA 2DR6A 1SKWA 3KUHA 3NAIA 4TNOA 2B4OA 2XMWA 5LOQA 4E0DA 4DPUA 3DRPB 2QJ3A 1U1MA 4KC5A 3KDNA 3FMBA 4KFBA 1ZETA 3CDEA 4BBYA 3TVZA 3AD9C 3KK3B 2CZ4A 1IBLF 4USKA 3QZ8A 1H2VZ 5CYJA 1UEKA 2KXNB 4NLTA 3EZOA 3AD8C 5FLXY 3NOCA 3MI7X 2HWIA 2QT7A 2YNIB 4P7VA 4RUHA 2YWGA 3UCUP 3RR7A 1FRHA 1VLOA 3RGIA 2V69A 3IRXB 2KT2A 3KK3A 3KHLA 4LF8J 1N56A 4K7QA 1ZZNA 4CLZA 4WFXA 1I5OB 2PD1A 3CCTA 4X65F 3OXGA 4JV5F 3I6PA 5SZTA 5LXYA 1OQ3A 2YNIA 1VQLS 4MK9A 2KHCA 1RTHB 1RAOA 1F9EB 3C2PA 3IRXA 1IKVB 2EK6A 5J2PA 4X62J 3MD3A 3QNWB 1A0OB 3BN7A 1VQMS 2M52A 1VYAA 3EVMA 4LFAF 3ZTOA 4CNYA 2RT3A 3T1AA 1Q82T 2MZSA 3TQEA 1IKVA 2AJ4A 1KHVA 3HVRA 4LF6F 3BPSP 2QA4S 3V6KA 3HCXA 4DF4A 4URQU 1J5OA 2R7VA 3UDLA 4C97A 2DR7A 5DJBA 5L1LA 1OSDA 1RLCL 3CDAA 3PYEA 2B9WA 3OW2R 4FS1A 4H4KA 4I67A 1HLWA 4HVZA 4GRSA 2CPYA 2BM0A 1J27A 1N34J 3ENWA 3EMTA 4HI1A 2GHWA 3OFEA 2XNRA 4IH6A 3RR8A 4F4XA 1CBKA 4HH1A 2E5GA 2OEJA 1S0VA 4QWEA 3PNIA 1N33J 3GZ7A 2CQHA 5D0GA 3L95X 3OVSA 1RK8A 4I7FB 2FVCA 2FIUA 2WOMB 3VGTA 1OSCA 2DEIA 3IP0A 5KG7A 3VALA 3MCSA 3QJJA 4X64J 4K4TA 4TQSA 3VGUA 4W4MA 3RU0A 4L74A 4QWAA 1F5AA 2XG8A 2HQ3A 3CTRA 5ETTA 3QIDA 4I7FA 1YJNS 1BHNA 4WWSA 3FVYA 2WOMA 1YX2A 1NSQA 4FXDA 3BV8A 3IGNA 3IC1A 1KWMA 4I2QB 2ZJRQ 4ZCLA 3K5OA 4TN2A 2JHEA 3GCWP 1WACA 5IOLA 3HMJG 1TMMA 4DMZA 4KPYA 2KL8A 4RW6B 4FF4A 5E41A 3PEHA 4KTQA 3NMAA 4BWMA 3D1QA 4I2QA 2DIVA 3IO1A 3JSRA 1S7IA 4WK3A 4IRCA 2CWXA 2YNHA 4RW6A 3I87A 3KUEA 2OGUA 3V2UC 1IM6A 1S1VB 3PW5A 1EARA 3PM9A 4RUAA 1I94J 1DRZA 4WBFA 1DBDA 1NZ8A 2HS0A 2E1CA 3K5PA 2MTLA 4QBUA 2GJIA 2XO7A 3OVAA 4QU6A 4FP9A 2QYCA 5HO4A 1KFSA 1S1VA 2WZ1A 3I32A 4JI3F 3U27A 4DZ6A 3OSPA 2W01A 4DR1F 4A8MP 1RHJB 4BLGA 3LWMA 5HROB 2B43A 1FA0A 2FVSA 2LKZA 3MM7B 1B99A 5DDRC 3MR2A 2QMXA 1LV5A 2FYXA 3SYZA 4IDKB 1NPRA 4B3OB 2OPRB 5B0DA 2IDLA 1NHKL 2IM3A 2UU9F 3H5UA 3MM7A 1UJ6A 4URSA 1N8RT 3C6UB 3HHLB 3PTWA 2CQ0A 4DFMA 1HNIB 5LJ5Y 4G3IA 2VIHA 3SSQA 2QO3A 3D6TB 4ZP9A 1VQ7S 4IDKA 4YY3J 2OPRA 4IUFA 2DTJA 1YJ7A 1C2PA 4LSLA 3DOMB 4YUDA 1VRQC 3HHLA 2FY1A 2V4JB 3H59A 3GJTB 1HNIA 2L9DA 1RBAA 1S1TB 4PQAA 2EFPA 4WK1A 2MSTA 3C8YA 1IKWB 2W8LA 5F3TA 3H90A 3DOMA 3HJVA 4OI0A 2VICA 2XBPA 2V4JA 4M5LA 3THPA 1P9QC 1S1TA 2BJ7A 1IKWA 1HW8A 2AV5A 3B82A 3M8RA 5HMWA 4KHPJ 2W7AA 3MECA 1U6FA 4BCAA 1RWXB 2CXEA 3JAMY 1CQNA 2CJ9A 2DKOB 2QL5B 5DM6Q 1VLYA 5K9FA 1N48A 2DXDA 1NH7A 1DURA 1HARA 3WDOA 4L72B 2PEBA 1JJ2R 4JB8B 3DLLQ 4OI6A 3LAMA 1LW0B 4KT0C 2LLZA 3G9CA 5K8PA 5A8RB 2ZOFA 2AKWB 3DMJB 3M32A 2KRRA 3NCPA 4USVA 4ZA1A 1RAHB 1MU2B 1Q7YT 1X4EA 1XR6A 5L8RC 3FC9A 5KG2A 1D8YA 5D6GA 2PT0A 1EP4B 4MKBA 1RBLA 5A8RA 2XLJA 5F8MA 3EGWB 3DMJA 4WYWA 4JV2A 2YWHA 2B56A 4DI6A 2GCFA 1MU2A 2G0JA 1ZS6A 3JSBA 3M8WA 2O5DA 9RUBA 2JEGA 1TV6B 3PJXA 2HIQA 1XK8A 1QLNA 2KYXA 3HK2A 2AEMA 4F4AA 5E0OA 4DOZA 1VRTB 2MJNA 4TU8A 2KI2A 1MN9A 4DV6J 2NREA 2RD5C 1TV6A 3RB3A 1RAJA 2DCLA 4A8QA 4KGVB 1TR0A 2QSFA 4OZ2A 1VRTA 3I4PA 2AYGA 5HJXA 1TVRB 5CD4A 3OJUA 2LQ5A 1G4CA 2C3OA 2O66A 2CADA 1QUPA 1BC6A 1QVFR 3TVKA 3W3SA 4L76A 1HR0J 4CT8A 2C3PA 5L9XA 4LQ3A 4ZOSA 2LU1A 1T7PA 3DYAB 2D3O1 1XERA 1TVRA 2RS8A 3D68A 4GO5X 3NOGA 2JEJA 1NK6A 4F25A 4URGA 1CSJA 2JLGA 4LT6A 4PEOA 4IYQA 3PKYA 4B3MF 5J2QB 5B0GA 1U0HB 1G7CB 4KIAA 4ELTA 3ZZPA 3IWXA 2HHHF 3B4DA 2DGVA 1XR5A 3SFGA 5FLXU 1NK7A 2MQNA 4L75A 2DT9A 4YR3A 4FYDA 4NA2A 4P75A 4DR2F 4Y2MA 3GONA 3EXYA 1ZPWX 3DRSA 1VQ5S 3BR9A 5J2QA 4ZCIA 1QM9A 1U0HA 3O44A 3MEKA 4JYAF 2Q66A 1TK5A 4RX6A 2MJUA 1FXRA 3H98A 1N36J 1YBUA 3CD7A 3N0VA 1EKSA 2HEKA 1S97A 3F44A 2L08A 3NL0A 1RHMB 4NLUA 1FO1A 3T5HA 4ZJLA 1VQOS 4CI0B 2CYYA 3M2RB 1RWVB 2ZZMA 5B09A 2HQIA 1FKAF 2DEJA 5IT9Y 2JZ5A 1TL1B 3HKWA 4ED0A 3IR5B 4JI8J 2AYMA 3WC2A 1YJTA 1Q16B 2OFGX 4X66F 4XPEA 1VQNS 4F04B 2NQPA 3M2RA 1EZZB 2AJ1A 3EZUA 3SCJE 5KFRA 5M2PA 2DK2A 1YBTA 2IVFB 1NEEA 2B8QA 1U45A 2FGOA 3N28A 2R2SA 3HHEA 3S1TA 5KFSA 4M94A 5HQLA 1S10A 3BEGB 3PHTA 2YXLA 5KFHA 4TU9A 3WX4A 2GIFA 3NWRA 2G2OA 3HI9A 4AUKA 3FQLA 2HKEA 2P9GA 2ZH9A 2XGQA 2HHXA 3GFZA 2ZH1A 2AEJA 2SXLA 1S79A 1RABB 1QSSA 4ZP6A 1UVNA 3KNGA 3ENAA 3LPYA 1WEXA 4JI2J 2KJVA 1FNOA 2VU5A 3D2WA 5CYQB 3I9ZA 1AZSB 2HQDA 4NLWA 3H5XA 2CA9A 3SMZA 1VS3A 2XM3A 2QL9B 1VIOA 2CIMA 3A3PB 4NCBA 4K5RA 2YPZA 3UVJB 4JV1A 4I2PB 3GV5B 2HS4A 1HNXJ 4PR6A 2GMJA 4C0BA 5CYQA 2V4QA 1AZSA 1RTZA 1TUGB 3SI8A 3NS6A 2H1YA 4I68A 5DETA 3PCOB 5E3CA 4DQIA 2IJNA 1REVB 3CJ8A 2AIRB 4EFAC 3T9NA 1VDHA 2GVZB 2OP5A 2P9CA 3L09A 3UVJA 3NAHA 5KFGA 5GAGI 1HNZJ 3G6ES 1IVZA 3EUNA 1CJTB 4J37A 3RYLA 5THWA 1VJWA 2E29A 1REVA 4J9NA 2VJUA 2GVZA 5DDQC 2CJQA 2DNGA 5ETRA 2E5IA 1SXLA 3M8ZA 2F3JA 2KG0A 1LWFB 2VFTA 1CJTA 1FRMA 4Z7CA 2MEWA 4EBEA 4F8RA 4ER8A 3K58A 1HW9A 4DFPA 2H48B 1RWWB 1Y3JA 3FQKA 1LWFA 1UKUA 2CQ4A 4E2FB 3BBFA 2H5IB 2BW7A 2VV5A 3WZ0A 3ZZ0A 2ILZA 2QYGA 3Q2TC 1RCOB 5L1JA 1IBLJ 3R27A 1EKRA 2Y0SD 2QA4G 4F2SA 2WB1D 3MMBA 1EQ0A 1UW4A 4ZVTB 1PC4A 1U6ZA 1ZZFA 1D9DA 1VHFA 3K5MA 2UUAF 2V2ZA 4Y65A 4RLEA 4RKUC 4O4RA 2ZZNA 1WF0A 2OKQA 1QAIA 3SV3A 1KOOA 3TQ1A 4JV5J 4LFCJ 3HULA 3PACA 4DR6F 4DEZA 3WQPA 4MMOA 3S7RA 2IHR1 1SC6A 3OTOF 3LWLA 3O3LA 2J5AA 1GX6A 4NEZA 3JSYA 4B9TA 1TL7A 4HYKA 2UXBJ 3AODA 5BYQA 3KK1B 1N0UA 2J0QD 1KKHA 5LMNJ 4J7CA 3AOBA 2AD9A 2YBVA 1UETA 3VGVA 3HT3A 2ZHOA 1R8PA 1WDDA 2B7CB 4N47A 3D3BJ 1XJWB 3HJFA 1WSVA 3BN4A 4OZLA 4P2SA 3KK1A 1RI7A 3E3XA 1UTAA 2JC0A 1U1QA 4XDDA 5HSPA 1NZAA 5JMNA 1NDPA 3RRKA 1TL5A 4IKAA 2QN6B 2ZVIA 4DX6A 2UXCJ 3LTOA 2FLPA 1TUWA 2FJDB 3NGKA 2XULA 3FSXA 3W7BA 2XS2A 4NCAA 3OR1B 4F4WA 1ZPVA 1NSKL 2OAUA 5H9FJ 1H0HB 4NZ7A 2ASDA 4NZ0A 3NKYA 4AXIA 2IA0A 3GQCA 4QPXA 3OR1A 2RDIA 1GNKA 1T8EA 1SQEA 1T3OA 1NK8A 4KB7A 3TO8A 3PDNA 2XCAA 4PZVA 1JQGA 2Z0GA 5ETOA 2HW3A 1UCNA 2KJWA 4YP3A 2ZEJA 3PRVA 1S9GB 4F4ZA 3AA9A 4OYBA 3BQ1A 1NHUA 3L4BC 5IWAJ 3GV8B 5ETMA 5LT5A 1Q53A 3D3CJ 1S1UB 2N7YA 1FNXH 5KFTA 1W7WA 1MMNA 3GSDA 2AJFE 5B08A 3BSAA 2P6SA 1U49A 1LKZA 2FD2A 2RHQB 3H4BA 3WIVA 3A8EA 4Q44A 2M3DA 1S9GA 3U1LA 2CJBA 2Z4PA 5CQGA 4ICLB 3UI3A 1WI6A 2V8HA 1S1UA 3PR4A 4OYOA 4Y00A 2KFYA 5HVHA 4UQGA 5DDPC 3AJDA 3O5TB 1G1XA 1FTCA 1TELA 4LF2A 1LFPA 4YHHJ 5K8MA 2V8GA 4ICLA 3SIPB 2CNLB 1ZM9A 1K73T 1X4FA 5D4PA 3DXBA 4C8MA 4FVMA 4ECSA 5KT7A 2F4FA 5MLCV 4ZCMA 4P9SA 3EGZA 4F3QA 1LW2B 3CNQP 1OY6A 4NLPA 4FYXB 2IIHA 2UUBF 2JVOA 3D6FB 3JYTB 1VC5A 3MD1A 1AT1B 5C42A 3OFHA 4DN0A 1F5CA 2C1EB 3V5RA 3IR6B 4P52A 4YEAA 1DTQB 1LW2A 3EGNA 4LREA 5KT3A 3BBCA 1A7GE 1JJHA 2MLXA 4J90A 1V3SA 3AD7C 4HDGA 1HI8A 3LA0A 3JYTA 4OYIA 4XTTA 2FHMA 2HS3A 1X7VA 3G82B 3MR3A 1RHQB 1DTQA 2J9DA 1Q0NA 2RAQA 5GMEA 1UEUA 3BB5A 4N77A 3G8QA 4EI2A 5KG4A 2HAFA 2CPZA 4EEYA 1FXLA 2LQ9A 1KSPA 3G82A 4WZQA 4ES2A 2U2FA 1UVIA 3TUPA 2M88A 4LR7A 5AXLA 3ZFVA 2Q6CA 1U25A 1H2UX 2GIRA 4K5SA 2JSXA 5CABA 2RDDA 5E3PA 4J9SA 3TVYA 4X4RA 1TK8A 2DGWA 4QIFA 2VQFF 1TKZB 1PGZA 2XSJB 2LEBA 3MCNA 4YDDB 2ZE2B 2B7BB 1OQ6A 2IM0A 3C46A 3GU0A 3GV7B 1IR1A 3F56A 4AQYJ 4X4QA 4OZ3A 1SIZA 5B0FA 2WSFC 3RJMB 1TUVA 6FD1A 1TKZA 1XN9A 3KG4A 2HMIA 1TZ0A 2H3EB 2ZD1B 2ZE2A 1T9VA 3PG9A 4QYRA 3LO3A 2OH2A 3NCRA 4ELVA 2DB1A 3JSMB 1RTDB 1X60A 2HNDB 3PW7A 1FFGB 5E5NA 4MK7A 2ZD1A 1RWPB 2IM2A 1XNRF 3E8OA 4UQTA 4F4KA 4DS4A 2NXCA 1YZ7A 2HRYA 5IT0A 4C3LA 1HWIA 3JSMA 3TA1A 2HNDA 4CRJA 1TQLA 3D6MB 2ZC3A 4NYZA 5A76A 1HPZB 2B3TB 3T6JA 3HF5A 4C3KA 1JLCA 2AT1B 2RQ4A 2E7VA 4DN9A 3SSSA 1HNWF 2C2EA 2DHAA 2RH3A 3K89A 1Y0HA 4UUXA 2YNFB 3HVWA 4RBTA 5DZ6A 5JVGQ 4LF9J 4QIWD 3T1HJ 2FVQA 2M7SA 1HPZA 2OTJS 3KJVB 2PDAA 3M30A 1Q8LA 4WFAQ 1OS5A 4Q0BB 4UW2A 1YKWA 4QW9A 1GAOA 2CUYA 4MFBB 2YNFA 1FJGF 4NYPA 3GFYA 5IT4A 2ZH8A 1TAUA 2XC9A 2V4RA 2BOAA 3BQ0A 3OL9A 1X8DA 3KJVA 2AJ2A 4Q0BA 3JXOA 3MMCB 2CZVC 3MAQA 2FVPA 4MFBA 2ZUAA 5L9NA 4ZLLA 1YJRA 1D8ZA 4KE5A 4KO0A 2R7QA 3MPVA 3BF4A 2BJ8A 4JV0A 3MURP 3J7YU 3EE3A 1S1WB 3KG1A 2DO4A 3MMCA 1T03B 1PSDA 2AGOA 4LSZB 1PBUA 2YTCA 3NNAA 3MHYA 2E5LF 4K4SA 4DR4F 1WF1A 1BE4A 2DR8A 1NSAA 1RACB 2IFXA 1SV5B 4DS5A 1CS4B 4DSKA 1EETB 1HNVB 3R2DJ 4USJC 4ZVRB 4OYXA 4ED4A 4DSEA 3V6DA 1GMWD 3MMAB 1U2CA 4YB6A 1T03A 1JXVA 2RRAA 1TL4A 2MHEA 4DFJA 5D77A 4LBHA 4OHYA 1D3WA 2RJZA 1RKIA 1QE1B 4LVOP 1SV5A 2FZGB 3RB0A 2YQ3A 3KLGB 1CS4A 3J7ZT 1EETA 2F9DA 3ELHA 2ATLA 3MMAA 1XQIA 1RAEB 2ZM6J 3BGOP 1M5PC 1OY8A 4FNIA 4C2MA 2ZH6A 1U24A 1HBUB 1DQ9A 2RIJA 3A8KA 1VQPS 2ZBPA 2R7XA 5I3QA 1QE1A 1RTIB 3CXCR 1AB8A 1Y5IB 2BDPA 1PJ6A 1U48A 5D78A 4G6VB 2OPQA 3E01B 4C9DA 1HBUA 2JL9A 3QO9B 2KFNA 4RJVA 4DPTA 4EO8A 3GYXB 1RTIA 1TFYA 1APSA 1UVKA 1S77D 4YMEA 2E66A 3E01A 4UT4A 4Q43A 1CPZA 4DL7A 2R3VA 4V1Ak 1YRUA 3QO9A 3AA8A 3M6XA 4FXWA 3QYYA 4JI0F 1ZAWA 4AL6A 4M5HA 4GKJJ 2AZ3A 1PYSB 4A47A 5JJBA 4DLEA 3MUTP 2VASA 3TYTA 5DQIA 1KC8T 1S4EA 2IRYA 3J7YI 2KT3A 1NB2A 1RQ0A 2F65A 4ZN3A 4WXWA 2R2RA 5F9NA 2G0IA 4MT1A 1S5ZA 2AX0A 4K4YA 1VK8A 2XYGB 4PXEA 4GVBB 2R7TA 2R8HA 1R89A 2BE7D 1UP1A 4E8UA 1EB0A 1REGX 3MM8A 3UE2A 2QIFA 1QD1A 3MF5A 4JI4J 1TTHB 1FRIA 2XS5A 4ZP8A 4V19X 4WPAA 4LFBF 4CYUB 1GXTA 7FDRA 1RT1A 4DR3F 2OLWA 2ROPA 5U47A 4D3GA 1H3DA 3BYRA 1MN7A 4HKQA 1GEHA 5DRKA 1H6KX 2LQ8A 3CW2C 4H4KC 2CPFA 3SSRA 4CLWA 4NLSA 4Q8EA 4AL5A 3R2CJ 4ZN1A 2D7SA 3DN9A 1NM2A 1XMQJ 3D67A 1SJ1A 4LSNA 1IBKJ 4RNOA 2J7WA 2GV1A 2LMIA 3UO0A 3BBBA 3HSGA 1PKUA 2GO8A 4ETXA 4J9KA 2ZHBA 1IR0A 4F0HA 4NYOA 1U26A 1FWLA 3ZNJ1 3I0RB 2K1RA 3M6UA 4NXMF 3EDQB 2EFOA 3W8PA 5HBMB 4IG3B 2B9EA 5CXTA 2C2RA 5LSOA 1RKJA 2DPIA 3R5JB 5GMKa 4JBCA 1RT5B 2ZH3A 3QGHA 2G4BA 2AW0A 3I0RA 4IO1A 3DKDA 4DQSA 5J1PA 2HHWA 3CJKA 2MSSA 3HHKA 5HBMA 4RU9A 1N88A 1WEZA 4K2JA 5T7LB 1RT5A 1FTRA 2CWKA 3Q83A 2F8EX 2MDAA 4NLGA 2QG9B 2W2MP 3SBMA 2Y8YA 3ZZUA 2F8MA 3EGVA 4RL1A 3AB2B 2BE9B 2I38A 1PBAA 2Q79A 1RLDA 3K5LA 4LRBA 4P71A 5T7LA 3F0NA 2VF3A 1RWNB 1HI1A 2R42A 1N5VA 2EI5A 4WJBA 5LSLA 3SCLE 3NCQA 4FKXA 1P1LA 2F5GA 4AFFA 2W4PA 2VPWB 2O01C 2MQPA 1WOSA 3NNHA 1WDTA 1VC6A 2E7WA 5I3UB 1CJVB 4DV0J 4ED1A 2N4DA 1URNA 2GGPB 4ETZA 1F9FA 2QLJB 5KT4A 4WFYA 1HHTP 1AXQA 2RUSA 1RWOB 1LK7A 3OXLA 2RKIB 1U47A 5B0CA 1AYEA 5F0WA 1NSPA 3ULHA 1JK9B 5I3UA 1CJVA 2B6AA 1N5QA 1IM4A 4ITSA 2DJWA 3THVA 5IS2A 3Q89A 2WTFA 2GAHC 4IOAQ 3W2WB 2VBZA 2RKIA 3POTA 5G4DA 1W25A 4KQZA 4J9RA 3QT5A 3JQJA 2HVDA 2YPYA 3K17A 1HWJA 3C66A 3D5MA 4JI5F 1KR4A 5D0HA 4FYYB 4OZ1A 2EBEA 3CC4S 2J8SA 4L73A 3W2WA 1JNRB 3TA2A 3CCVS 2MZRA 3TRGA 4MK8A 2MLYA 3DOKB 3DDNA 3CVKA 3UNYA 3SQGB 2GC8A 2OEMA 3QJLA 2UXDF 3M6WA 1SQGA 2FJBB 2P5VA 2O67A 3Q8UA 4O44B 3CD0A 5B0BA 2FLOA 3UD5A 4BS2A 3C16B 1SIWB 1KTVA 3KLEA 4B9MA 2F4VJ 1TKDA 4KGZB 2D69A 1K1SA 1Q5YA 1YJVA 3SQGA 5FJ4A 2HNYB 5BR8F 4K59A 3LQVA 1MROB 2AMCB 1BWVA 2N4CA 4LRFA 4TLQA 2OO4A 4O44A 5DGBA 3TJ9A 3QQCD 4EO6A 2KFZA 1XC9A 3R7BB 2M8HA 4C8KA 4ZPCA 1ITPA 1M5OC 2XZDB 4GKKF 3CMES 1L3SA 4DR7F 1MROA 2BVZA 5CCLA 2BKPA 1NDKA 2HFNA 4DV4J 4ALZA 1K9MT 5GAHU 4CQ1A 3TZXA 4PG6A 1IN0A 4OJGA 3GSIA 2WONB 5K5MA 4J9QA 3G96A 1P27B 2H4YB 3MM5B 4C6AA 3BYPA 2RMLA 1K0VA 3IN5A 1S6OA 5J2NB 4Y2AA 3BKTA 2IVYA 4USMA 2L9NA 2WONA 1XR7A 2IDEA 4FPIA 3MM5A 1F9HA 3E51A 4LJMA 2RILA 3L7UA 1HBMA 5C24B 2IRUA 1RAIB 1FESA 2FPHX 1T05A 3OLBA 2YKNA 1X9WA 5HANA 1U02A 1R27B 3PHEA 2HG4A 3KLHB 2VD3A 4DV2F 3DNCA 2F8HA 2J9DE 4G1QB 4X4SA 3CJ2A 1T95A 5IXUA 5C24A 2DRBA 1A6LA 2OMOA 5CAAA 2FHKA 1GTEA 2CPHA 4O3OA 2I6WA 3KLHA 2P6TA 1Q81T 3K0JA 4G1QA 1CG2A 1T9WA 4USIA 1LNQA 2CG8A 4FPRA 4UOGA 2VOPA 2BQ3A 3OHBA 5IZHA 3ET6B 5LSRA 2JLFA 4C0HA 3A12A 2JEFA 3DLBA 2OD4A 4USHA 4M5NA 3W60A 4DR5J 1XNQF 4WXOA 2EPIA 1NDLA 2HSEB 2XGPA 1W26A 4KHRA 2L9WA 3WX8A 4H4MB 4DUZF 3ET6A 3HFVA 4KPCA 4C8ZA 4X2BA 4IRKA 3BH6B 2B8PA 4IFVB 4DPWA 1X5PA 3UDEA 2YWKA 2EKYA 4LRAA 2FJAB 2FB0A 1NNDA 4JI1F 1RUSA 3AXMA 2DNHA 2CVEA 1CJUB 2A2CA 3AQOA 4H4MA 1EJ7L 1DFDA 1FNMA 3CJ0A 1SPBP 5T41A 2GAGC 2GMHA 4JI7J 2HZAA 4U9RA 4OJ3A 4IFVA 4HACB 2ZDOA 3GWCA 2QLXA 3RUBL 2CJKA 1LFWA 3VVTA 3W64A 3BM7A 3M8QB 4TXSA 3OT9A 2MZ1A 5H9FK 4ID8A 5G0RB 2UVUA 4FDFA 4B3SJ 4I56A 2A6OA 3CD5A 4MTPA 1QDUB 3NBPB 3MPYA 2DXEA 3RTVA 3KLIB 1D0EA 1T3NA 2NS1B 1QUVA 1RSCA 2M0GB 4AD6A 3M8QA 1K1QA 3PJWA 2R9LA 4WF9Q 1CEZA 4WIIA 3W65A 5G0RA 5A0YA 2D9OA 3KMQA 3CIMA 3KUGA 3OXFA 5DG9A 3TNVA 5KFCA 2BOPA 2CVIA 3NBPA 4F0MA 3K8WA 2EK1A 3KLIA 1VBXA 1SC3B 2J7KA 5GADU 2XY5A 1VQ6S 3US5A 2MQLA 5ETKA 4F26A 4ZMMA 4FYWB 5CD4H 4PWWA 3ILJA 2HBZB 2UVWA 2HURA 3BREA 3QRQA 2F1FA 2R7RA 3ILLA 2VB6A 1FK9B 1X5TA 3A3OB 2VC1A 3FEYB 3FFIB 1YJ9S 1OYDA 1N0VC 3EJMA 4WYLA 3UQSA 4ED2A 2VG5B 4DG1A 4Z7YA 1S9FA 2UV8G 3BPDA 2HZCA 3RBEA 2B9XA 3OBIA 5DDOC 3KHGA 1B70B 2CQ3A 3FFIA 4C98A 1FWKA 4W98A 1YLXA 3BGRB 1IKXB 1NXIA 1FJ7A 2VG5A 4CLLA 3CCLS 2CRLA 2QFIA 4OQJA 4DV3F 4TYAA 2O1PA 4OHVA 1SUQB 4KSEB 4B3RJ 3LP0B 2C2DA 2W2NP 1E6YB 4LMZA 3CJQA 3BGRA 1IKXA 1RBOB 2HHUA 2ASYA 1B3TA 2ADCA 3PEJA 4O4GB 4C8NA 3GR0A 4K4XA 3N79A 1ZA2B 5EN1A 1SUQA 3LP0A 1TKXB 2F40A 1BQNB 3I55S 5CH7B 3DI6A 3NS7B 4V19J 1RWMB 2EKNA 1RADB 4NEYA 4LBPA 4OX6A 3PVXA 2LQBA 5AXMA 4R25A 2ZC4A 2CJAA 2HAIA 2HK3A 2WVCA 5GMDA 5KFWA 3M8YA 1BQNA 2DISA 2MKHA 2FVRA 1KVKA 3DLKB 4L3NA 5KFAA 3IRWP 2D3ZA 3LGMA 4OLPA 2R7OA 3FZ2A 2IYGA 1UJ5A 3P96A 2WBRA 4R0JA 1CULB 3RRHA 3MAAB 2MYFA 4DPXA 3I5AA 1JLAB 3DLKA 1JLQB 3LPEA 4LF7J 3HM9A 3NXZA 3CCES 1VQ4S 2EXUA 5CCMA 3H20A 4K0KJ 4PG8A 3QSYB 1HKAA 5F8LA 5AJ3F 2W9CB 3K7RA 4ZIVA 1CULA 2KDOA 4WIQA 1JLAA 1JLQA 4KH1B 5H9EK 3A3NB 3MPUB 4NE9C 1YRXA 5HQ8A 1U09A 1IQTA 4NLOA 4QIEA 1YQHA 3KKFA 5KFPA 4MKAA 5LMUJ 4C3MA 3O8WA 4NXNF 2W9CA 3U02A 1MNEA 3TX8A 1D9AA 4XAKA 2YKOA 5FD1A 1IBMJ 2IVMA 4B9LA 1N32J 4Y28C 5CHCB 2HLUA 1M0SA 1HD0A 5F9LA 2W25A 4UZBA 4UOCA 4WFBQ 1T11A 4YS2A 5LL6d 1QAXA 3TEHB 3C14B 4N5SA 1N54B 3EPIA 4OYWA 2J6SA 3ZO7A 5HAOA 2OIHA 3DLJA 1RYRA 4ECZA 2GO9A 3GG1A 3MR5A 2MKYA 1NBEB 3T1YF 2DHXA 5J2PB 4N7TA 1RT6B 1XMBA 1CJKA 4RW8B 3PYFA 4L3KA 2DNLA 1SC4B 2PGCA 4JI6F 2Q3PA 4DV1F 3DHWC 3C14A 2BM1A 3G6YA 2RDJA 2W1BA 2MQMA 3CCQS 1XBWA 3AH6A 3X1LB 1IR2A 3TANA 4G1PA 4A8FA 2DR9A 2E44A 1HI0P 2CQ1A 2K06A 1RT6A 1S12A 1PO6A 5L39A 3FSYA 3K57A 4RW8A 4DUYJ 1J5OB 1WORA 3MCMA 1ZTWA 5KT2A 4DSJA 1B64A 2V50A 1FHTA 2YKPA 3KWMA 1NJZA 2B4PA 2F7VA 1RTJB 5LXRA 3MGJA 3DLHA 2QA2A 2EC2A 3PKMA 4WP8A 4EZ6A 2YKMB 4NZ6A 4XIUA 3QATA 2E1AA 3QLHB 2E1RA 4QIVA 3HP6A 4UTGA 1J2VA 2AGPA 1RTJA 2QMWA 3BGLA 2BKNA 3AXKA 4ZP7A 2E9TA 1HYSB 3LH2S 1MMLA 4LF8F 1IKYB 3UDCA 2YKMA 4B9NA 2R7SA 3WIUA 2CNKB 1XMOJ 1WTFA 2IJFA 3CJTA 1U1NA 2WSCC 5KAKA 2V9KA 2B51A 3QLHA 1JKHB 2BJ1A 1Q79A 4ZPDA 3E2EA 3M2VB 1HYSA 5BYSA 1IKYA 2DHGA 4OJHA 4CH1A 2JH3A 5I4MA 4KV8B 3KTQA 1GK8A 4X62F 1F0XA 3Q2SC 4RPFA 1FI4A 1QAJA 1SL0A 1JKHA 5KT6A 2GFFA 3GFHA 3M2VA 1H7WA 3P4UB 4IG0B 1NCLA 2AP6A 3P45B 1F5BA 4I4BA 2ZFHA 4KV8A 3BR8A 3AJ2A 1B7YB 3IS9B 1OPIA 2YNHB 5KFEA 2VC0A 3HHNB 2ZBQA 2G13A 4IG0A 3B8HA 4NCGB 3OV7A 2MY8A 5E3RA 5E7OB 4F36A 2VL1A 1N34F 5SUHA 1N5SA 2ZNZA 4NLVA 1NLKL 2QX0A 1S49A 3IS9A 4NI2B 2RNEA 1C1BB 1RT4B 3FSIA 2C2KB 1WC0A 6AT1B 4O3QA 2ZNYA 2GNKA 1DQAA 3DLEA 4NCGA 1U4BA 2XI3A 1DARA 4J9LA 1CC8A 2UUTA 5FIIA 4HEA9 5CA5A 3ETOA 3QMQA 4NI2A 4YR2A 4X64F 1L3VA 4PXCA 4RWWA 1C1BA 1ZM3A 1RT4A 2RHSB 1JLGB 3MM6B 2XZTB 4RZRA 1ZA1B 2NSBA 3G6VA 1RCXB 2XMAA 4B3TJ 3GIIA 2H5EA 1YDLA 4Q2LA 4FBTA 3TAPA 2CJXB 2UUCJ 3V6HA 2YVSA 2FHJD 1JLGA 3MM6A 1BXNA 2QGFB 3GPAA 3ZXWA 2PFDA 5KFMA 4NASA 3MTJA 5IV4A 3CUNA 2DVIA 4Y0FA 2OSQA 5I42B 1GMUA 3CMQA 1H74A 2DNNA 1KLMB 1MMDA 3B54A 4LSLB 1ZH5A 2V9WA 4ED3A 4ZHRA 3KLFA 5CYMA 1HHQA 4MIAA 2QZ8A 4QWDA 3EVWA 1VQSA 2PEHA 5I42A 2HFOA 4ID5B 1F1BB 1KLMA 1I94F 2A3JA 3ZZYA 3M6VA 2C2OB 2BV3A 3D54A 3FCWA 1U8SA 4EU0A 1RP5A 4AT1B 2C22A 4WZMA 3OL8A 4C8YA 3F41A 1V3RA 4RUBA 1VBZA 1FD8A 2A0FB 3M9MB 3VAGA 4A8SA 3AAWB 2LDYA 4ID5A 5K20B 2ZBIA 3MXHP 3MECB 5K8OA 3MOZA 2DH8A 5CZXA 1ZBTA 1VBYA 1U1RA 4Q7AA 1WF2A 4ZS6A 3NMRA 4KKOB 4A8WA 1IXKA 3VR1A 4CT9A 3SEOA 3W5XA 3HD1A 1D09B 3M32B 3K8VA 1PAEX 2XHCA 4ERDA 3ZNUA 2BXJA 1JWWA 3VV2B 4C8LA 4DL2A 4NLQA 5B7WA 4LR8A 1RE1B 2YWFA 4KKOA 1X0PA 4LRDA 2DRAA 5EWEA 3ZTQA 4LF5J 4C11B 1SJ3P 1R7IA 2C3UA 4RNFA 1SH0A 4YY3F 3GILA 4CH7A 1S0NA 1KQSR 4U95A 4DCOB 4FVCA 5EUHA 2KG1A 4RU2A 3T3FA 4HHJA 4C11A 2EW9A 4LF4F 2WVEA 5ETLA 2GVDB 3FCHA 2X3DA 4OYZA 3G87A 1WHXA 3OL7A 2I2YA 1SB6A 2YY3A 5DZ7A 4EYIB 4CLYA 1FEEA 3EM1A 2ZJPQ 4KHMA 3MAHA 1BWEA 2JRSA 3G6XA 4K4VA 3J80Y 2V94A 3N01A 2CPEA 2HFSA 2GVDA 2ZJQQ 2RF2A 2HFVA 1I1GA 5IQ6A 3RAXA 4ZVPB 4KHPF 1RHUB 2HNZB 2VOOA 2DITA 2HFUA 1R0CB 1VQ8S 2IYIA 4YN3B 1PC5A 3P49B 4TY8A 3GJQB 3TJ8A 5D8HB 2HYIB 1FE0A 4X4TA 4P2MA 2HNZA 1YSJA 4RNHA 5JXSA 3EDRB 1OYEA 1OO0B 2ABYA 1VCTA 3J7Z5 3KG0A 3LP1A 1R6YA 5KFJA 1SJRA 3DGVA 4C48A 3OSNA 1ZM2A 4CH0S 1S99A 3PX6A 2NXEA 4X4UA 4P72A 4NPOA 1FKPB 2ZWOA 4ECUA 3BSOA 3DRSB 2AJQA 1TFWA 2R8JA 2VG6B 3PJ9A 2XO6A 3C19A 4KGXB 4K4WA 3BSCA 2CJYB 3D9BA 2B0GA 3Q8SB 2DXFA 4UUWA 4RBVA 2GHPA 2WHOA 5IQQA 1U1OA 3PY8A 1FKPA 2W4DA 1RHKB 4UY85 3MM9B 1NJIT 1IQZA 2C2NA 3VWSA 2B4VA 2WRMA 3H8YA 4USWA 4PQUB 2FC9A 1PJ5A 2VG6A 2AZ1A 1PYTA 1AW0A 4DV6F 1HFEL 2X1BA 2ZITA 1BMQB 2EEYA 3ILOA 2QC3A 2CPJA 1XIQA 4OLOA 2QL7B 3T5KA 3FKBA 2J76E 2FJXA 1UL3A 4QU7A 1HD1A 3FBBA 3AQPA 3AHPA 3MM9A 5GAGU 2M70A 4PQUA 3V81B 2HVZA 2JNJA 2VQEJ 4F3MA 1M5KC 1F3VA 3IR7B 1HR0F 3MUVP 2IMOA 3I0SA 1O8BA 3QFWA 2C2ZB 1VISA 3PRBA 4GC7A 3VAIA 3ZZOA 1WI8A 3H4DA 3O1LA 3IGVA 2DD8S 2DBBA 1K0TA 1IWGA 3V81A 2W9AA 1S59A 2Q6BA 4QIGA 4ZITA 3RBDA 3ITHB 3K2YA 3MMJA 2DNMA 2JDJA 4U96A 2RQCA 5AXKA 3W9IA 3OHAA 3HPOA 3CPWR 4WP9A 3HDSA 2UVVA 5C7PA 2ACYA 2RUGA 2QFJA 4A46A 1GMWA 3ITHA 4XO0A 3N6MA 2KO1A 1N36F 3LF0A 4OX7A 1RT3B 3N5BA 1AFJA 4KYZA 3MEDB 1SI9A 2ZVSA 2OFHX 2IBKA 3BKFA 5EWGA 3R97A 4ZJQA 2BQUA 3HO1A 4WKRA 5E3QA 1RT3A 3MEDA 3DU5A 3QPIA 2EG1A 5KTQA 4OX9F 2KXHA 2Q43A 2XB2D 3GP9A 2CQGA 2Z2LA 4K2XA 2KRBA 4YQWA 1MG7A 4I69A 1X5OA 3HSZA 2ZOMA 1UA1A 5KFIA 1SL2A 4IR1A 2E1MC 3H5YA 1NJWA 4CZCA 5F8NA 1GH8A 4RW4B 2QV6A 3TZWA 3OR2A 1HWKA 2VJVA 3LW5C 2XYHB 4EBDA 3M8PA 2XY6A 2B4UA 1NMEB 3QWPA 1JXLA 1Y5LB 2QSWA 3H42A 4WTOB 1S7HA 1U1PA 4ANDA 2C2MB 4O23A 4DV5J 2G1DA 1OWXA 4RW4A 1Q8KA 2PN6A 1KD1T 4AXJA 3G8SA 4JI2F 1FRKA 3IM8A 5KOXA 2ZBCA 2XY7A 4NLYA 3MMBB 3QWUA 4BWJA 2RS2A 3TOQA 4HTJA 3C6TA 1Y7PA 4RNMA 1X4HA 2L3MA 1S6PB 1V9OA 2XMKA 1BGXT 2YH0A 1HNXF 4O3SA 3U1NA 4USUA 2HHTA 1R8CA 1ULRA 2JC1A 2A2DA 4PABA 3PO4A 1JX4A 5KFYA 1NKBA 1S6PA 5DG8A 2V8PA 3KHHA 2DNPA 1HNZF 4OI2A 2YNGB 3D4JA 2FQQB 1W2BR 1WHYA 2DRDA 3SFUA 4X65J 2DGQA 2HHPA 1KONA 1QTMA 2V67A 3NGSA 1EAYC 2BRLA 3VF0B 2ZKTA 4ATNA 2GQ2A 2HFZA 2QLWA 1TL7B 2F9JA 1GTHA 4DCJB 2I1RA 4PG5A 2AYBA 5LM7E 2FJVA 2NXJA 2YNGA 3BGUA 3ONQA 2DH7A 1CQMA 3TR5A 5KFDA 1N5TA 4LFAJ 1S6UA 3VAMA 3MOJB 1O6XA 4QYZK 5JUMA 4ZVFA 1HIYA 4HT5A 1VMBA 4DV7F 3LOUA 1QVGR 5HATA 4LF6J 3NY0A 1X4CA 1HA1A 1NAQA 2DGSA 4KBIA 2Y1IA 2AU0A 3HT0A 3HVTB 5A8KB 4QQBA 1HBOB 4RWXA 3DRPA 7FD1A 1ZTTA 1FRJA 2VDIA 5HMYA 4DHVA 2LEPA 3JAMU 2FDNA 3R5BA 3VGSA 2EG2A 3D7SB 3HVTA 3GMGA 5A8KA 2IY5B 3CO9A 3PYDA 1HBOA 3W5YA 4LFCF 2NXUA 1FX4A 4HL9A 4I0WA 4C4WA 4PG4A 4RW9B 1AFIA 5KFLA 4QR1A 5DGAA 4O0IA 2VODA 1RWKB 2FTRA 1PCAA 4ECRA 4NA3A 2RRBA 2YWWA 1NB7A 3T6BA 4J9PA 1MLAA 2JJ4D 1FDDA 1Z2ZA 2PSZA 1RTHA 1UVMA 1VRUB 2UXBF 1UVLA 1O5JA 2ATCB 5RUBA 4RW9A 4ZVUB 5LMNF 3ISND 4ZPTR 4LUBA 3FEZA 3CCSS 2OMLA 3IAM9 3J80U 4IFYB 3EPGA 2OI2A 2A1BA 1VRUA 1NO8A 4WP3A 2VG7B 4M1KA 2CQPA 1TAQA 5A6PA 2EFGA 2DNKA 1KQFB 3DLGB 2K3IA 2JFDA 2AYEA 1N4LA 1U1KA 4ECVA 2R8GA 1GXUA 4IFYA 5BXIA 2DNRA 2G0CA 2K7KA 4M8LA 2G1HA 3RZAA 2VG7A 3R8YA 2HHQA 2FLLA 1K44A 3DLGA 2UXCF 3M1VB 4Y2KA 2PI4A 2KU7A 2LEAA 5AXNA 4CM0A 3PIOQ 3Q8PB 2NLWA 4NLDA 2LQJA 4NMXA 2Y8WA 1JMTA 4JI3J 3SCKE 3NGTA 4ZKAA 3G71S 2VPZB 2XEXA 2LVWA 4F50A 4OZ5A 1HHSA 2KH9A 2MY7A 1MWZA 5EGYA 3M1VA 2AJ0A 5KOWA 2OHDA 4DR1J 3GR1A 3RG6A 2RU9A 1YZ6A 4ES1A 2ASLA 4CO0A 1R8HA 2WW4A 4JUZA 3PW4A 1AUSL 3O6QA 5C42B 2BMBA 4TVAB 2LXFA 4XPCA 3NEKA 1JB0C 5EWFA 4CO3A 3NP5A 3T19A 2NZCA 4LBIA 2UU9J 3QZ7A 5AE3A 2BYCA 1KS2A 2M9KA 4J9OA 5IWAF 3EICA 5J1EB 4WE1B 2N82B 1BD6A 3ADAC 4EK2A 3M2UB 3I9V9 4QJVA 1RDRA 2QMUB 2KKHA 5J1EA 5IT9U 1KP6A 4WE1A 2WSEC 3G8TA 1YI2S 2MKIA 2J6UA 2X1AA 3PX4A 1XEZA 4PWDB 3M2UA 4R8UB 2CQBA 1QTNB 2KM8B 4YHHF 2Y9HA 2DGXA 5HL7Q 3EYZA 4OL8A 1WSRA 3QGGA 2LU2A 1BUXA 1VQYA 3CJSA 4M5GA 3RAMA 4NRUA 1X31C 3W63A 4PWDA 4U6PA 4R8UA 1LWCB 2JFKA 1N52B 4PXDA 3AFGA 2UP1A 2RRNA 4NA1A 3MPDA 4M5IA 4KH0B 3CCJS 2X3GA 1O0PA 4WFNQ 3CCMS 3UCZP 4DLGA 4M63A 5HP1B 2HMIB 1SCJB 1RU1A 5HROA 1KDNA 5H9EJ 3L7PA 1IJFB 4H54A 1WEYA 2GHVC 1R0BG 1LWCA 2QRRA 2VA3A 4N41A 4J9MA 5B0EA 5HP1A 4B3OA 3W9HA 2VPYB 4ZVGA 4CLPA 2R4FA 3QAUA 2VDHA 3C6UA 4EZ9A 2HVIA 3M05A 4RBUA 4BC7A 4LF4J 2MMYA 4X4OA 1LK5A 1JLCB 3P5TL 3KJQB 2G2YA 2LP4A 2KZMA 3BDEA 4IH5A 4OYPA 4IR9A 3DU6A 5BJRA 2FZKB 2WBMA 3KNAA 5DO2A 3MR6A 2XMJA 5ETNA 3HFZB 3M30B 3NLCA 3I82A 4I6WA 1ELOA 4DQRA 1UAWA 5ITHA 1RZMA 4GC6A 2AWZA 2Q1LA 4OYMA 2CQ2A 3VQSA 5AT1B 1JJCB 2H9ZA 1Q5VA 3DGPB 4AE5A 1R6VA 4NMLA 1IJEB 2BABA 4CDIA 3FDSA 5A2QY 2PC6A 2AHOB 3HX9A 2LA6A 3CJ4A 4AQYF 4BDPA 1Q95G 5K14B 3ZTRA 3LGNA 4KO0B 3L3CA 4U7UD 2V2QA 4GO7X 3GE9A 4UOFA 2XQCA 3DGPA 1UFLA 3P8BB 4N76A 5KFXA 2VKRA 3TUZC 2CNNB 5M2UA 1S0OA 1LW0A 5K14A 4KRWA 1NHVA 1FEHA 3TP2A 1S72S 4O3PA 1WC3A 4HTIA 2V2VA 1LQ9A 4B3MJ 1WKLA 3A8IA 1ROFA 2DHSA 5IC4B 2C3YA 2G2ZA 3ZTPA 2HHHJ 3V6DB 4HT7A 3G2XA 3JB9k 3H2UB 2K8GA 1EP4A 2P2CB 3QT7A 4DR2J 2C3MA 2Z56B 4QZVB 5AE1A 1RU2A 2BACA 4ZVSB 3I96A 3RW7A 1SH2A 1BQMB 2PMHA 3VAFA 4CIOA 1HQUB 4JYAJ 2QTWA 3I56S 5KG6A 4WKYA 3CDUA 3U1MA 4LRCA 2MKSA 4WU2A 4RUCA 3MR7A 2DIUA 4LF9F 3T1HF 4ELUA 4F3OA 2BJEA 3EVOA 3T5JA 3FJ2A 1LXNA 1BQMA 1HQUA 5KFUA 2NCKL 2E5HA 2OPQB 3R1HA 3FRYA 5C25B 3CJ3A 2M2BA 1VBKA 2D1CA 4CTAB 2HGMA 1YGYA 1Y10A 4Y2IA 4HDHA 2W7OA 2BZ2A 4EWTA 4X66J 2Z8QA 2YQ1A 3M9NB 4F2RA 1PAUB 5C25A 1VOMA 4CTAA 3TAMB 3DYAA 1C4CA 3Q8QB 2KYZA 1DJ0A 3LAKA 1FXDA 3K59A 1MSWD 3UFCX 3UWTA 2M8DB 1FWPA 4DU7A 3CD6S 3ZC4A 2YX7A 3PRDA 4K4ZA 2PMWA 2VUGA 2HK2A 3TAMA 1H2TZ 3CJRA 2FGCA 1T9YA 4X84A 1UPPA 3DDIA 4OX8A 1NU4A 1PIEA 3DHXA 3IMQJ 3QRRA 2DYAA 1AROP 5JVHQ 2VPXB 3I31A 1F3FA 4A8OA 3NS5A 8AT1B 1M1KT 3MM8B 1OMSA 3BGFA 2GMLA 2AGQA 1Z4UA 2QLBB 3CB4A 4KGMA 2K3KA 5IFMA 4QR2A 1C4AA 2ZUGA 3CSKA 1XTZA 2ZM6F 2VFSA 1XWLA 1Q1KA 1RT1B 3V4IB 2BRKA 3TEGA 3MUMP 2R8IA 3DRXA 2NSCA 4ENOA 9ATCB 4ED8A 2MQ8A 4OX9J 3SQOP 1ZYQA 1UVJA 2W7PA 3R9LA 2HQFA 3TZZA 1TL1A 5KG3A 3V4IA 1GX5A 1PG5B 2PIIA 4LSNB 2WVDA 2M5YA 2JEIA 1KN6A 4HHHA 1LOUA 5HLFB 3AY0A 3NRBA 1OIAA 1M90T 1I6JA 2XI2A 1Q78A 4DX7A 4GKJF 1U0SA 1UWBB 4CM2A 2LFVA 1H73A 4MJKA 2K1RB 1RT2B 1FVQA 3IG1B 2APOA 5F8JA 4OI1A 3CCRS 4OHZA 3QGPA 5HLFA 4CLKA 3J81j 3WHIA 4LQ9A 3CULA 1Q7LB 2NR0A 3H2VE 2IBOA 1C0UB 2I0XA 1UWBA 2OD6A 5DQGA 1LXJA 2PO4A 4J91A 1RT2A 3IG1A 3CJKB 4YFUA 1HQ2A 1FFWB 2XHWA 3D6HB 4JI4F 1FVSA 4CO5A 3LGHA 2IRXA 3TAQA 1HBNB 1JJ4A 3DOLB 1C0UA 3R6LB 4K8RA 1AA1B 2MQQA 4K50A 1B0PA 3T41A 3ETMA 1T02A 2UUAJ 4I2PA 1UMJA 1VC0A 3SZ2A 2N3LA 3SDEB 1FFSB 3PV8A 3FEXB 4I1TA 1HBNA 3DOLA 3Q8YA 4GMKA 2MKJA 2A6MA 3KJFB 3Q0AA 5F0UA 5L46A 4DR6J 2IJRA 2D3UA 3Q23A 3CC2S 2Z2YB 1XMQF 3OTOJ 1IBKF 3SDEA 3MFHA 3VAJA 3FBFA 1YWXA 1OPZA 1P1TA 4FF1A 2Y1LB 4OHWA 3JS9A 3WC0A 1YVFA 2HBQB 1JIHA 1MW7A 1FDAA 3UCGA 3G4SS 3BH7B 1KNZA 4OI3A 2GIQA 4I6YA 1ZAVA 2OPSB 4DQPA 2OPPB 1X0FA 4DV7J 4MKVA 1S57A 1GMVA 4ZLPA 2ZH2A 2FUG9 1NDCA 2B6AB 4U8VA 4M5JA 4O3NA 2NYHA 1KBRA 3ISNC 3QAEA 2W2QP 4N8OA 2OPSA 3LUYA 2OPPA 3GJRB 2BBEA 3POTB 3GG0A 1S6QB 5GVQA 3GIRA 4Z37A 3V4MA 4L6V3 3H25A 2LCWA 3IWLA 3CEDA 2NYIA 4DCPB 3MFIA 4ZK7M 4QW8A 4DX5A 2BANB 1S6QA 2V68A 1VGYA 5C5JA 3P5BP 4NLXA 4PKDB 3A1YG 4A8XA 4G65A 2PFFB 1FDBA 3TW0A 3PFEA 2ROEA 2RQKA 4BHQA 1NK0A 1PYOB 1UW9A 2NXNA 3J7AN 2J0WA 2BE2B 4R0EA 2CFXA 1H7XA 5HN0A 1FX2A 3KLEB 2RSQA 5KFBA 2CPDA 2BANA 4M5DB 4MH8A 5LJ3Y 1KEKA 2A10A 4C0OC 3GFXA 2V63A 1GT8A 2GA7A 3GIKA 2LDIA 5HK4A 4PWUA 2UUWA 2HWTA 3L7OA 1SJQA 2BE2A 4RR5A 3Q86A 4DV0F 2BQRA 3H5SA 4M5DA 4JOUA 2HPUA 4CO2A 2XMMA 3H2LA 3IAS9 1WOPA 4OZJA 4HH0A 2HRTA 1NUEA 4EBCA 4Q8FA 2LXIA 3L9ZA 2BUNA 1Z2LA 4U7CA 3J81Y 2RU3A 2GQCA 2HWHA 2D74B 2DY1A 2EBGA 1Q8BA 2RQMA 4ZVOB 1YIJS 5A2QU 5F8GA 2HVEA 2WVFA 2ZH4A 3DRRB 5HJYA 2FHJA 4OV6A 2XMTA 3F73A 1X4BA 1X4GA 3QIPB 2FZCB 2IA6A 3HSDA 3CE8A 3OJSA 2O3DA 4OMFG 2YWEA 4FNHA 4XDCA 1WOOA 3VTIA 1HBMB 1JLBB 4MIWA 1G2EA 1URRA 2ZKUA 4TYBA 3DRRA 3JTNA 1T05B 2YKNB 1AUDA 1RHRB 4ILRA 3QIPA 4X4PA 1N5YB 4CLSA 2V34A 3VZIA 1B0TA 3ZTSA 1K8AT 2DH9A 1JLBA 3ENVA 2UZAA 4Q5VA 2HHSA 2F4VF 3TJAA 3RB4A 4Q2MA 1WNEA 2B9YA 1N5YA 3UNGC 4B9UA 4U8YA 2DNQA 1YBAA 3FZBA 2UUBJ 4J9VA 1WWHA 4LIWA 1KVIA 3TA0A 3GYGA 3ISZA 3UW1A 1H38A 2AX1A 4ED5A 4WFZA 5D0RA 4H4OB 4CNZA 5J1NA 3IA0A 2VA2A 1U8WA 3CCWA 2L41A 4TU7A 3VAHA 2ROGA 5ADZA 1EHWA 3R3TA 3RAQA 4YDXA 4ZVEA 2UVRA 3VZHA 1LEOA 2KTQA 2MKCA 2KB2A 2KVIA 1NK5A 4DV4F 1X4AA 4H4OA 1KTQA 5IM0B 4QWBA 6FDRA 1YK9A 2H5JB 3HHLD 3EX7B 2GQQA 3RW6A 3B4MA 1CLFA 4RNNA 1TL3B 3JQMA 3KFWX 1DZ5A 4WCEQ 4KR0B 3S8SA 2MPUA 1SJ4P 2ILYA 2EC0A 1G3OA 3GIMA 2COLA 3ZZZA 5IM0A 7AT1B 3HLUA 3N6NA 2R2TA 1TL3A 2EFNA 1V6HA 4CCHA 5DLFA 2A18A 3D0IE 1S48A 2VQFJ 2Z30B 1BY9A 3BQ2A 1NKCA 2XSFA 2HLTA 3D0GE 3ZZTA 1U1LA 3OUYB 8ATCB 1NKEA 4ZVQB 1NRKA 1J5EF 4HI2A 4ZJOA 2RB7A 4IRDA 2WVBA 5D3GB 5A0YB 1YHQS 4CP5A 2DGTA 2VBYA 2QEXS 4PPZA 5EHHA 1KOHA 1DY3A 3QRPA 1C0TB 5E2QA 3OUYA 3PZPA 2L48A 2KZZA 4B9VA 1XNRJ 3VAKA 3TZYA 4DR5F 5D3GA 1P9YA 1M5VC 4M5MA 5D4LA 1KLNA 2XMVA 2DR5A 4W92B 1B7FA 1C0TA 1B0VA 2PA8D 4PXBA 3C15B 2I8EA 1HNWJ 4DQQA 3KXDA 2ZBRA 4DG1B 3TWZA 2BA9A 1WUUA 2J0SD 1V3ZA 4FYVB 1BQXA
chains in the Genus database with same CATH topology
2LKZA 2CQGA 2Z2LA 4K2XA 5T7LB 5H1SV 2KRBA 1RT5A 3MM7B 4YQWA 3CCZA 2E9RX 4NL5A 5DDRC 1FTRA 4N8NA 3MR2A 3FMWA 2F8EX 2MDAA 2XWYA 2QMXA 1LV5A 4I69A 3BO3A 4JI7F 4NLGA 1X5OA 3ZZUA 3SYZA 2F8MA 5DLGA 3KK2B 2ZOMA 1UA1A 4QYZJ 4IDKB 3AB2B 5KFIA 1SL2A 2E1MC 2IM1A 4IR1A 3H5YA 1NJWA 4CZCA 5F8NA 2I38A 1S0MA 1GH8A 4RW4B 4B3OB 2Q79A 2QV6A 2OPRB 5B0DA 5HMXA 1UEVA 3OR2A 1SJFA 1DAXA 3K5LA 3BO4A 4NWBA 2QE5A 5T7LA 1HWKA 2IM3A 4TQRA 2UU9F 3H5UA 2XSJA 3MM7A 3LW5C 4BC9A 4EBDA 1UJ6A 4URSA 3M8PA 5M2RA 1N8RT 2XY6A 3C6UB 3HHLB 4B3SF 5A8WB 1HI1A 2CQ0A 4DFMA 1N5VA 2EI5A 4WJBA 2B4UA 5LSLA 3QWPA 3SCLE 3NCQA 1HNIB 1Y5LB 2QSWA 3DXSX 3IXQA 3S6EA 5LJ5Y 1WTBA 1JXLA 4G3IA 3SSQA 3KK2A 2LYVA 2QO3A 2P9EA 1S7HA 4ZP9A 1VQ7S 1U1PA 4IDKA 4O23A 1TP7A 1P1LA 1U6BA 4AFFA 2G1DA 1OWXA 2W4PA 2PN6A 4RW4A 2VPWB 2OPRA 2CPXA 2VH7A 2DTJA 2O01C 3FGVA 4DF8A 4IUFA 2MQPA 1KD1T 1C2PA 4DDFA 3NNHA 4AXJA 3KYLA 4LSLA 3G8SA 1VC6A 1S4FA 2LA4A 1YTYA 1DHMA 4JI2F 1FRKA 4I64A 2E7WA 4YUDA 5KOXA 5I3UB 2ZBCA 3DI6B 2XY7A 4NLYA 3HHLA 2FY1A 4TLRA 5A8WA 2V4JB 3H59A 4ED1A 2N4DA 3VQTA 5I3PA 1URNA 1HNIA 2L9DA 3MMBB 3QWUA 4BWJA 2GGPB 4ETZA 2RS2A 1S1TB 4PQAA 1RTDA 2EFPA 1F9FA 3TOQA 4HTJA 4WK1A 2MSTA 3C8YA 4TY9A 3C6TA 1Y7PA 1IKWB 1P8GA 5KT4A 1RWUA 4WFYA 4RNMA 1L3TA 1HHTP 1AXQA 1QJHA 2W8LA 1X4HA 2L3MA 1LK7A 5F3TA 3OXLA 1S6PB 3B78A 2RKIB 1V9OA 2XMKA 3DOMA 1U47A 1BGXT 3NGDA 5B0CA 2YH0A 5F0WA 1HNXF 3ULHA 1JK9B 4OI0A 4O3SA 3U1NA 5I3UA 2XBPA 4MIBA 4A8YA 2B6AA 1KFDA 2V4JA 2X1FA 1N5QA 3THPA 2HHTA 1R8CA 1IM4A 4ITSA 1ULRA 3R5DA 2DJWA 3THVA 3OL6A 1P9QC 4NRTA 1S1TA 2JC1A 2A2DA 5IS2A 2DPJA 1IKWA 1HW8A 2WTFA 3PO4A 2AV5A 3B82A 4IOAQ 3M8RA 3W2WB 1JX4A 2VBZA 2ERRA 5KFYA 1NKBA 1S6PA 5HMWA 2RKIA 2W7AA 3MECA 3POTA 5G4DA 1W25A 1U6FA 2FC8A 4KQZA 5DG8A 4BCAA 5KG5A 4J9RA 3JAMY 3KHHA 2DNPA 1HNZF 1CQNA 2CJ9A 4OI2A 1HWJA 3C66A 2YNGB 3D5MA 5DM6Q 4ECWA 5KFFA 1W2BR 1VLYA 1WHYA 5K9FA 4U7UK 4JI5F 1KR4A 1N48A 5F8IA 3HXMA 2LECA 3SFUA 4DL5A 1NH7A 2DGQA 2HHPA 1KONA 1DURA 3QGIA 4OZ1A 1QTMA 4DWIA 1HARA 2BRLA 2EBEA 3VF0B 3WDOA 2ZKTA 3CC4S 4ATNA 2GQ2A 2HFZA 4L72B 2QLWA 3W2WA 1JJ2R 4D3HA 1JNRB 3TA2A 3DLLQ 2W24A 4OI6A 5KFZA 3CCVS 2F9JA 1GTHA 3LAMA 1LW0B 2I1RA 4KT0C 2LLZA 4PG5A 2MGZB 2XS7A 2MZRA 4QPTA 3TRGA 3G9CA 4MK8A 2AYBA 3NG8A 3DOKB 2DNOA 1HWUA 2FJVA 5K8PA 3GB0A 5A8RB 3DDNA 2ZOFA 3M32A 3CVKA 2YNGA 3DMJB 2GC8A 2KRRA 3BGUA 3ONQA 3SQGB 2DH7A 4DSIA 1CQMA 3NCPA 3TR5A 5KFDA 5B0AA 2UXDF 3QJLA 2VBXA 1DTTB 4ZA1A 3M6WA 2N7CA 2FJBB 2P5VA 2O67A 1N5TA 1MU2B 1Q7YT 4B3RF 3TARA 1S6UA 4O44B 3CD0A 5B0BA 3VAMA 2FLOA 3MOJB 1X4EA 1XR6A 5L8RC 4BS2A 5JUMA 4ZVFA 2PE8A 1SIWB 5KG2A 1KTVA 5D6GA 2PT0A 1EP4B 2MGZA 1D8YA 3KLEA 4MKBA 4B9MA 4HT5A 1TKDA 4EUVA 2R7UA 1VMBA 1K1SA 4DV7F 5A8RA 2XLJA 3LOUA 5F8MA 1QVGR 1YJVA 2G9OA 3D1HA 3EGWB 3DMJA 3SQGA 5FJ4A 2E7XA 2HNYB 1X4CA 4WYWA 4IOBA 5BR8F 4K59A 1HA1A 1NAQA 3LQVA 2DGSA 1MROB 4JV2A 2YWHA 2B56A 4KBIA 1DTTA 3CF5Q 4YOEA 2CG4A 2Y1IA 2N4CA 2GCFA 1MU2A 2WK4A 2AU0A 4TLQA 2OO4A 3JSBA 4O44A 2O5DA 5DGBA 2JEGA 1TV6B 3HVTB 3OTBA 1S1WA 4EO6A 4DBQA 3PJXA 2KFZA 1XC9A 4FN5A 2HIQA 3D28A 4C8OA 3UR3C 1XK8A 5A8KB 4QQBA 1VQKS 1QLNA 2M8HA 2DCUB 2KYXA 4C8KA 4ZPCA 3HK2A 1HBOB 4RWXA 3DRPA 7FD1A 1ZTTA 2XLKA 3ENQA 5E0OA 1M5OC 4DOZA 1VRTB 1FRJA 2MJNA 4TU8A 4GKKF 3CMES 1L3SA 4DR7F 1MROA 2KI2A 5HMYA 2BVZA 1U2FA 3R5CA 4DHVA 5CCLA 2LEPA 1VFJA 2FDNA 3R5BA 3X3UA 4M95A 2WB4A 2EG2A 2HFNA 4ALZA 1K9MT 4ZPAA 5GAHU 4CQ1A 2NREA 2RD5C 1TV6A 2CQCA 4PG6A 1IN0A 3RB3A 3HVTA 4OJGA 2JWNA 2FVSA 3GMGA 5CZVA 1HNVA 2WONB 3VCDA 5A8KA 5K5MA 4N56A 1SH3A 1QSLA 4J9QA 3LP2B 3CO9A 3G96A 1P27B 1WG4A 1RAJA 3MM5B 2DCLA 1HBOA 2RMLA 4A8QA 1UFWA 4YB5A 1TR0A 2QSFA 4KAIA 4TKTA 1K0VA 1VRTA 3I4PA 4PG7A 3IN5A 4X4VA 1BLUA 2AYGA 4LFCF 1P6TA 2NXUA 1TVRB 4B17A 3JTOA 2POKA 4CO1A 3OJUA 2LQ5A 2C3OA 1S6OA 4HL9A 4I0WA 1RISA 2O66A 5J2NB 4C4WA 4NX9A 4PG4A 4RW9B 4Y2AA 1AFIA 4DPOA 2IVYA 4ZDNA 1QUPA 3BZQA 2XWXA 4QR1A 5KFLA 5DGAA 3KLGA 1QVFR 3TVKA 4O0IA 3W3SA 2VODA 3KOAA 2CKWA 5BYRA 2L9NA 2FTRA 2WONA 1YRTA 3LALA 4CT8A 1XR7A 2C3PA 5L9XA 1SKRA 4LF7F 3LP2A 4ECRA 4NA3A 4LQ3A 4ZOSA 3MM5A 2RRBA 4K0KF 3E51A 2LU1A 1T7PA 4LJMA 2RILA 3DYAB 1NB7A 1TKTB 2MZJA 4DJBA 3T6BA 4ECXA 1XERA 4J9PA 1ZAXA 2JJ4D 1FDDA 1HBMA 1WHWA 2IRUA 5C24B 1TVRA 1Z2ZA 2PSZA 3CC7S 3ZZRA 1W2IA 1FESA 1RTHA 2RS8A 1N6QB 1UVMA 4GO5X 2MXYA 1VRUB 2FPHX 2UXBF 5FDLB 1GXLA 1UVLA 1T05A 3OLBA 2JEJA 1NK6A 2YKNA 1VQ9S 4F02A 1O5JA 1X9WA 4F25A 3CIZA 4RW9A 4URGA 1CSJA 2JLGA 4UY8T 4LT6A 1R27B 3PHEA 5LMNF 3ISND 1E6VB 3SCIE 2HG4A 4ZPTR 3MEEB 2YH1A 4LUBA 3TI0A 3KLHB 3FEZA 4IYQA 3PKYA 2VD3A 1DLOB 5KG0A 3CCSS 4DV2F 3DNCA 4B3MF 5J2QB 2OMLA 5B0GA 2F8HA 2J9DE 1G7CB 3IAM9 4G1QB 4KIAA 1TKTA 4X4SA 4ELTA 1Y5NB 3CJ2A 3IWXA 3ZZPA 1T95A 5IXUA 5C24A 4IFYB 3B4DA 3EPGA 2HHHF 1UJ4A 2DGVA 5LMUF 2A1BA 2DRBA 5MAOA 1XR5A 3SFGA 1R0AB 1N6QA 5KFKA 1A6LA 1X9SA 1NK7A 2MQNA 1VRUA 1NO8A 2VG7B 4M1KA 5FDLA 2D3OR 2OMOA 1YITS 4Y34A 2CQPA 2DT9A 4YR3A 2FHKA 1GTEA 1TAQA 4FYDA 5A6PA 2EFGA 4NA2A 2CPHA 2DNKA 4DR2F 4Y2MA 4O3OA 1KQFB 3DLGB 2K3IA 2JFDA 1E6VA 2AYEA 3I5BA 3MEEA 1IBMF 1CVJA 3EXYA 3V6JA 4QWCA 1N4LA 3KLHA 1U1KA 1RT7B 1ZPWX 3DRSA 2P6TA 1DLOA 1N32F 1VQ5S 3BR9A 4ECVA 5J2QA 4ZCIA 1Q81T 1QM9A 2R8GA 3K0JA 1GXUA 1FERA 4G1QA 2K7JA 3O44A 1CG2A 3MEKA 4JYAF 4USIA 2Q66A 1TK5A 4IFYA 2Z2MA 2CPIA 2DNRA 4FPRA 1R0AA 2G0CA 2K7KA 4M8LA 4RX6A 3RZAA 1NJYA 2MJUA 2VOPA 1FXRA 3H98A 2BQ3A 2VG7A 3OHBA 5IZHA 3CD7A 3N0VA 1R31A 2HHQA 5LSRA 2FLLA 3R1LA 3IFEA 2JLFA 3F44A 1S97A 2L08A 3DLGA 2UXCF 4C0HA 3NL0A 3M1VB 2JEFA 3DLBA 4Y2KA 2PI4A 1RT7A 2OD4A 2KU7A 2LEAA 4USHA 5AXNA 3PIOQ 3Q8PB 2NLWA 4NLUA 4NLDA 2ALZA 3OTDA 1FO1A 2LQJA 3T5HA 4OV1A 3OLAA 1U7LA 1VQOS 4CI0B 1QSYA 4X4NA 2CYYA 3M2RB 1XNQF 1JMTA 4LIRA 3TUJC 4WXOA 2EPIA 2J6TA 3SCKE 1L3KA 3HHDA 2ZZMA 2XGPA 4DL0C 4KHRA 2L9WA 4ZKAA 3G71S 5B09A 2HQIA 2VPZB 4H4MB 4DUZF 2XEXA 1FKAF 2LVWA 5IT9Y 4F50A 4OZ5A 2JZ5A 1HHSA 4C8ZA 2IMWP 2KH9A 4IRKA 4X2BA 1TL1B 2MY7A 1MWZA 3HKWA 5EGYA 4ED0A 3M1VA 3IR5B 2AJ0A 5KOWA 4IFVB 2AYMA 1RA6A 1X5PA 3GR1A 3WC2A 1YJTA 2YWKA 1Q16B 2EKYA 2GW8A 2OFGX 4X66F 2FJAB 4A48A 2RU9A 2FB0A 4XPEA 1BC6A 4G1IA 1NNDA 1VQNS 1RYSA 4ES1A 2NPFA 2ASLA 4FZVA 4CO0A 1R8HA 2NQPA 4JI1F 3M2RA 2YKQA 2AJ1A 3EZUA 2DNHA 4JUZA 3MZIA 3SCJE 2CVEA 3OPKA 5KFRA 5M2PA 3PW4A 2OTLS 4DUYF 2A2CA 3AQOA 2DK2A 4H4MA 3DM2B 1KQGB 3O6QA 1DFDA 3O2IA 5DG7A 5C42B 1FNMA 4KGKA 1NEEA 3CJ0A 3D1OA 5T41A 2IVFB 1U45A 2FGOA 2GMHA 3N28A 2LXFA 2R2SA 4XPCA 3OTEA 4U9RA 4OJ3A 4IFVA 3HHEA 3S1TA 5KFSA 1YJWS 4M94A 1T94A 2ZDOA 1JB0C 3GWCA 2QLXA 1S10A 3BEGB 5EWFA 4CO3A 2CJKA 3NP5A 5KFHA 3T19A 1LFWA 2C28A 2AQ4A 4TU9A 3WX4A 3BM7A 3M8QB 3HI9A 4TXSA 4AUKA 1KHWA 3FQLA 3QZ7A 2P9GA 4OHXA 3DM2A 2KXFA 5AE3A 5DS7A 2BYCA 2ZH9A 2MZ1A 1KS2A 2M9KA 4ID8A 2XGQA 2HHXA 5G0RB 4J9OA 3FRZA 3GFZA 2UVUA 2W8KA 5IWAF 4I56A 2ZH1A 2MB0B 3DLEB 5J1EB 3CD5A 4MTPA 2SXLA 4WE1B 2N82B 1S79A 4XK8C 1BD6A 4ECYA 4ECQA 2VZ9A 3NBPB 3MPYA 3RTVA 3KLIB 1D0EA 1T3NA 2HVHA 1QSSA 2NS1B 1WG1A 1QUVA 3H40A 4ZP6A 1UVNA 1S76D 2M0GB 4B08A 3DCAA 3KNGA 3M2UB 3I9V9 3M8QA 4W90B 3LPYA 1K1QA 4