1X8DA

Crystal structure of e. coli yiil protein containing l-rhamnose
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
104
structure length
104
Chain Sequence
MIRKAFVMQVNPDAHEEYQRRHNPIWPELEAVLKSHGAHNYAIYLDKARNLLFAMVEIESEERWNAVASTDVCQRWWKYMTDVMPANPDNSPVSSELQEVFYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Monosaccharide Specificity of Escherichia coli Rhamnose Mutarotase
pubmed doi rcsb
source organism Escherichia coli
molecule tags Biosynthetic protein
molecule keywords Hypothetical protein yiiL
total genus 28
structure length 104
sequence length 104
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.32: L-rhamnose mutarotase.
pdb deposition date 2004-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05336 rhaM L-rhamnose mutarotase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1x8dA01
1QUPA 2GO8A 2XMTA 1OQ6A 2RILA 2OKQA 2RSQA 1Y9OA 3HF5A 2QIFA 1K0VA 4HI1A 1W2IA 4A4JA 2XMMA 2FHMA 3LGMA 2N7YA 4EFAC 1AFIA 2HFOA 2PGCA 3QGPA 1OQ3A 5A6WA 2FTRA 2IYGA 3DXSX 5B0GA 4HL9A 3KNGA 1N5VA 3HHLB 1AFJA 2K7KA 1SQEA 4OJ1A 4YDXA 3GZ7A 3HX9A 1CPZA 1N5TA 4ZOSA 3KG0A 1Q4RA 2EW9A 4OJHA 1GXTA 2IYIA 3T9NA 2LDIA 2BJEA 2GA7A 1VQSA 3HHLD 2OD6A 2HIQA 4A48A 1P6TA 1V3ZA 1N5QA 3VTIA 2ROEA 1FEEA 1FE4A 2BJDA 2IFXA 1S6UA 2XMWA 3DCAA 5B0AA 2ROPA 2K7JA 2OAUA 2OP5A 4HH1A 1S6OA 2KYZA 3K7RA 2OFGX 2BYCA 1FESA 2PD1A 4Q2LA 1LQ9A 2ASYA 2KT3A 3MCSA 4NPOA 2QLWA 1CC7A 1SI9A 3BB5A 1YJVA 2LXFA 1IUJA 1JK9B 2XMJA 2HLUA 4Y2MA 3TNVA 3BN7A 1XBWA 1FVSA 3FRYA 5B0EA 2AJ0A 5T7LA 3HHLA 4DN9A 2OMOA 2K2PA 2ACYA 5T7LB 2LQBA 1CC8A 1YJTA 4Y2KA 4A47A 3BGUA 1WD6A 1RJJA 2K1RB 3BF4A 3F44A 5K9FA 1KQKA 1YJRA 2W4DA 4F67A 3QMQA 4HH0A 2W4CA 3TOQA 1AW0A 4OJ3A 1Q8BA 2N4CA 4A46A 3BDEA 2HFNA 2XMVA 2GV1A 2ZDOA 3FMBA 3LGNA 2GGPB 3IWLA 1OPZA 1KVIA 2OD4A 2BUNA 3UDCA 1OSDA 1N5SA 1Q8LA 1TR0A 2XMKA 3BR8A 1SB6A 2HQIA 2OFHX 2QYCA 1FE0A 1YG0A 2BBEA 1JWWA 2AJ1A 2RU9A 2FIUA 5F0UA 3E8OA 1GXUA 4HI2A 3CJKB 1VQYA 5B08A 4Q2MA 5B0BA 3KKFA 1YRXA 1X8DA 2XMUA 1TZ0A 2L3MA 1Y3KA 3HDSA 2RMLA 1URRA 1YJUA 3HFKA 3WDOA 2Q3PA 2FB0A 2G9OA 2GFFA 2N4DA 2LQ9A 5A6PA 1TL4A 1Q53A 4FNIA 1APSA 5B0FA 1U7LA 3BM7A 2JDJA 2VH7A 2AP6A 1TUVA 2K1RA 2ZDPA 5IXUA 1Y3JA 4QOTA 4OIXA 1TL5A 3I9ZA 3FGVA 1KVJA 3IWXA 4DPOA 2HLTA 5F0WA 4U9RA 1FD8A 1MWZA 2KKHA 3CJKA 1ULRA 3LO3A 2GCFA 2VV5A 1R6YA 1X7VA 2AW0A 2ROGA 4DL0C 5B0CA 4YEAA 4FNHA 2W4PA 1MWYA 4OJGA 3MZIA 5B09A 1P8GA 2GGPA 1X0PA 2QLXA 2CRLA 3HHLC 4ZA1A 3TRGA 1FVQA 2KT2A 4NL5A 4Y2IA 5B0DA 1Y0HA 5KAKA 3KG1A
chains in the Genus database with same CATH superfamily
1Z1ZA 2APOA 2CQ4A 2H65B 3FCHA 1S0OA 2FJXA 2AMCB 2KI2A 1MMNA 3HF5A 4DG1A 2BE2A 3KLGB 1U2CA 1VBXA 4ZVPB 2HG4A 1RTIA 1ROFA 2HAIA 4BWJA 3RJMB 1NHUA 3LAMA 3J81j 2DNZA 2G13A 3DXSX 2MY7A 2MLXA 1N5VA 4LJMA 2BQRA 1LXJA 2KXFA 3GZ7A 4DR6F 2VQFJ 2X1FA 2F7VA 1WSRA 2EW9A 3TZZA 4JI7J 3Q8UA 3C6UB 3BH7B 2CDQA 4LRBA 5ETKA 1WHVA 3H0PA 1HBOA 2OSQA 1KC8T 5KG7A 2R8IA 1JNZB 2QZ8A 4NRTA 4DV0J 1S4FA 4TLQA 4UOGA 2VQEJ 2J0WA 2CJBA 3QNWB 3LP1A 2W9BB 1F6TA 3BGOP 2K7JA 3RW6A 2CPJA 2I2YA 3CD7A 4K4ZA 3F0NA 4TU8A 2F40A 2PD1A 3QZ7A 1LQ9A 4C4WA 4HKQA 2CNOB 1DURA 1VRUB 2C3PA 5BR8J 1TKDA 1JLGB 4YB6A 5DDQC 4C0BA 3DRRB 4CM0A 2DGXA 2RS2A 2QLWA 3K59A 5K8MA 4O3RA 2EBEA 4LF1A 3TA2A 1JLBA 5HVFA 3O1LA 1RT5B 2NXCA 3N28A 2FQQB 4C97A 1GMWA 4MKVA 5HO4A 3RYLA 3TQEA 3V5RA 4MKYA 5DDOC 4MIBA 4UOCA 3OTDA 3KHLA 1WJ9A 3NAHA 5KFMA 1BUXA 3OTOF 1U1RA 3BBCA 1WC6A 1JXEA 2YWWA 3DYAA 3MM8A 4V19X 5FDLB 3SBMA 2W4CA 4B9TA 3MD3A 1MNEA 4A46A 1LNQA 3CT9A 2RHQB 1Y5NB 2LXIA 3TP2A 4ZCMA 4X64F 1SH2A 4Q45A 4DUZJ 2YKMB 2EBGA 4JI2F 5LSLA 1T8EA 2BUNA 1RKIA 5BR8F 1PAUB 1WORA 1ZZNA 4ILMA 3LTOA 3H2LA 1BY9A 5LMNJ 5KFRA 2ZBCA 4AFFA 4E0DA 2HK3A 3NY0A 5C42A 2KXNB 1SQGA 4Z7CA 1R0BG 1XIQA 2YKOA 1Q5YA 4DV5J 2WHOA 1YG0A 2HFSA 4F2SA 1K47A 3CJKB 4ED8A 4RW6B 4ECUA 4NEZA 5B08A 4ES2A 1GX6A 3ETOA 1YRXA 3D0HE 3NKYA 1O5JA 2V4JB 2DKOB 3M9NB 4HT5A 2ATCB 2W2MP 3GR0A 3GILA 2R7RA 1N33F 1VDHA 1VISA 2DPIA 3PIPQ 4OX6A 2VUGA 1UVMA 2MQ8A 1MN9A 2IM2A 1W2BR 1ZPVA 4N41A 1EJ7L 3UFCX 2R2UA 3CMQA 3SDEA 2LEBA 3OHAA 4I0WA 3M8RA 3OXGA 3SQGA 1M0SA 2ZDPA 3LPEA 1MU2B 2ZBQA 3CDEA 3IWXA 4X4QA 1EIYB 2QGFB 8RUCA 2FC8A 3GG1A 3PHTA 2MKYA 2HRTA 1XMQF 1T9UA 1CS4B 5LJ3Y 2D41A 2FJDB 4ZVTB 1HBUB 3OVSA 1R6VA 1X4DA 2RKIA 4WXWA 3UQSA 1YSJA 4DFMA 2QL7B 4C8MA 5KOWA 2FLOA 2XNRA 1O6XA 4DR1J 3TJ9A 4MIAA 5EDWA 1N33J 2NPFA 1MWYA 3C6UA 4F36A 4USVA 3HCXA 2N7CA 2QJ3A 3KK1A 4J9RA 4B3TF 2VASA 3DRPB 3S6EA 2ZWOA 3JTPA 2DH8A 2GGPA 4K59A 4ZA1A 2W9BA 3DDIA 2DD8S 1RAFB 3LF0A 2GX8A 7FD1A 2FY1A 3W9HA 3BEGB 2XZWA 1QUPA 1VFJA 3M2UA 4ES3A 3G8SA 2VFRA 2DNLA 3ZC4A 1YZ6A 3R6LB 1MWQA 1S1TA 2AYGA 1KFDA 3FFIB 3AJ2A 1QAXA 1JJ4A 1GK8A 2V4QA 3GQCA 2LCWA 3PYGA 2XMAA 4KO0B 1T9TA 2IIHA 2BJ8A 2R2RA 1AZSA 2H1YA 3FJ2A 3HJVA 5SZTA 1I6JA 2ABYA 1RT4B 1RGVA 5GMKa 4M5NA 1KSPA 3CO9A 3C6TB 4C8LA 5HROA 4B3TJ 3CD6S 1LW2B 3LWMA 2OD6A 4FF2A 3KXDA 1S0NA 3TVKA 1NB2A 3W8GA 1FEEA 3M7VA 3PY8A 1PAEX 1XQIA 4CLZA 1SJFA 1N32F 1SPBP 1FKAF 4OZ0A 1U8WA 4NLRA 2ROPA 4OX8A 5B0AA 3JSMB 4ZMMA 3L95X 3AOBA 4Q8FA 5F8LA 4P75A 2CJAA 3ULHA 4QR2A 1UCNA 3ICLA 4DQSA 3IG1B 2Y1LB 4D3HA 2X1GA 1CC7A 1RHQB 1S10A 1YJVA 3SFGA 5A8WB 1VCTA 1X9MA 1UVLA 1S5ZA 2H9ZA 5CD4A 4JI0F 5J2NA 2YKMA 5KT2A 1DHMA 4LF4J 2Z56B 2V2KA 3C8YA 3DLEA 3SSSA 4ZHRA 1Y5LB 1S6PA 3PVXA 2OH2A 1FTCA 3M32A 4DV4F 4LSNA 5J2QA 4LRAA 1VRTB 3ELHA 2O3DA 4O0NA 3EGNA 3OFFA 2M7SA 4OYXA 4ZP9A 1VQMS 4DR6J 4P2MA 5CYJA 1D0EA 2B9YA 5IV4A 1D9FA 1JLQA 2IA6A 1QLNA 2ZZNA 3BDEA 1CULA 2A2DA 4DQRA 2YNHB 3PYFA 1RA7A 4TKTA 2DNMA 3HHKA 2R7QA 4JI4F 1SJ4P 2R7VA 3HXMA 1JNRB 1HLWA 2HQ3A 3T1AA 1D8ZA 4BHQA 1HL6A 2KU7A 2YWFA 3PEHA 4O4GB 4CLSA 3MR2A 3NS7B 1ACMB 4EBCA 1PG5B 4AD6A 2ADCA 4V19J 3QAEA 3ZNJ1 1HBOB 3DXBA 1MMDA 2Y0SD 3EGVA 3LH2S 3T3FA 4NZ0A 2FVQA 1IKYA 1WKJA 3UE2A 1EP4A 3PW7A 3NMAA 4K50A 4QIFA 3WHIA 4ZN1A 2RKIB 1KFSA 4NXMJ 4H4KC 2HS4A 4PQAA 1HMVB 4C2MA 1UP1A 3KLVA 2VQFF 1FDAA 3A13A 4DPYA 3VAFA 2R7XA 3WC0A 2CQDA 5E5NA 4LBHA 4J9QA 1JX4A 3I0RB 1HBMA 1FRLA 2VD3A 1RWNB 1YJUA 2HWTA 2JRSA 4GVLA 2E9ZA 2JJ4D 4ZDNA 4YY3J 5LSRA 1J5EF 3Q83A 2QMXA 3HSDA 4TU7A 2EKNA 3NOCA 3C2PA 5IOLA 1LK7A 1TL3B 4I6AA 2CQIA 1RABB 3BSOA 4JI2J 2CQ3A 1GH8A 4NA1A 4ITSA 4BC7A 5HQMA 2Y1IA 4EO6A 3K5OA 1V5VA 2RQCA 2I5JB 2LEAA 1ZAVA 4CRJA 2B56A 4OX7A 1LFPA 1IM4A 3L3CA 4WYWA 4DUYJ 2OPPB 2YNIB 2XEXA 4AUKA 1W7WA 3VAKA 5BYRA 2BM0A 3M2UB 1EAYC 2PC6A 4CLTA 3OTOJ 3DM2A 3V6DB 1DBDA 4BS2A 4C11A 1LFWA 1RI7A 1M1KT 5K20B 3CC7S 2J0SD 5CXTA 4DR4J 4B3OB 3UD3P 5KFEA 3OD2A 4I68A 3CUNA 2JSXA 5BYSA 2VHGA 2G2YA 3H20A 2DT9A 1A7GE 5E41A 4C8KA 4OYOA 4U8VA 1FVQA 3MPWA 1OPZA 1PBAA 3IBCB 5L1JA 2JFDA 4DF8A 4WFXA 5B7WA 4F3OA 5D4PA 3N0VA 4DL6A 4R5PA 1J5OA 4QBUA 2I38A 4MK8A 2B5JA 2IC3A 1OSCA 3MTJA 1BQNB 4DX6A 2HMIA 4ANEA 1AFIA 1UFLA 2NCKL 1RSCA 1CULB 3SQOP 4W98A 2Y9HA 1SH0A 3KNAA 2BOPA 1CPZA 2RD5C 4P2SA 3HD2A 1B3TA 2D3UA 1T05B 1VRTA 4DR4F 2HHQA 4XPCA 1RT7A 4HR2A 1KTVA 4OJHA 4LQ9A 4LF8F 1CBKA 2CQ0A 2NUHA 3TAMA 2UXDJ 5M2PA 4YOEA 4F0KA 4C8YA 5J2NB 5JXSA 3J7AN 2MQLA 4U7UK 1ITPA 1JLFB 5HMYA 4X66F 2I1RA 2V8PA 2F8HA 3HVRA 3GYXB 3BO3A 1FK9A 4ECVA 1X31C 5J2QB 2KL8A 1RTJA 4NZ7A 1M5HA 1S6QB 3RUBL 1C0UA 2XZTB 1RAEB 2QTWA 1SJQA 1OWXA 2OHDA 2BA9A 3SEOA 4EEYA 3N6NA 2IDEA 2WVFA 1F3VA 1NHKL 2R3VA 3KUEA 2IHR1 3G82A 3GIJA 2K2PA 4HLBA 3BSAA 4OZLA 1FDDA 1Q79A 1NK9A 3GV7B 1N36F 3H7HB 2UXDF 1RTIB 2W4DA 2R4FA 2OEMA 4CO1A 2AV5A 4I7FB 1L5UA 4OJ3A 4OI1A 3UNYA 4ZPDA 4O3OA 4M1KA 2HPUA 4RUAA 2OPSB 1N6QA 1ZA2B 4J9LA 1ZAXA 2RT3A 2ZBRA 2ILYA 3DMJA 2ZD1A 3PM9A 5I3PA 3W9JA 4BDPA 1OSDA 4IRKA 2FZGB 4DV6F 1B0VA 2AZ3A 4QR1A 2CKWA 3BKFA 1O8BA 3NP5A 2N3OA 4DR7J 1VK3A 2F4FA 2VFUA 2AJ1A 4WBFA 3G87A 3WIUA 4BCAA 4CQ1A 4QWAA 3EVWA 4OL8A 1N0VC 2OPQA 3T1HJ 1NK6A 1HQUB 2F65A 2WSFC 2QEXS 1VRUA 1VI7A 2EPIA 3IR5B 4X4VA 4EUVA 4KAIA 1HD1A 4USHA 3RW7A 1RAIB 2K06A 2HZAA 3G96A 2FGOA 1FJGJ 4C8ZA 2V50A 1SC3B 3PW4A 4ANCA 4RLEA 3EPIA 2NLWA 1WNEA 1T95A 4LUBA 5AXKA 3UDLA 5J2PA 3NMRA 2M2BA 1U2RA 3PW2A 1LEOA 4WPAA 3AOAA 3IM8A 1FNOA 4RW8A 1IR0A 1S9GB 1X4BA 4HACB 2BKPA 1XK8A 3QATA 3BBBA 3U1LA 1NKEA 1SC6A 2ALYB 2YKAA 4Q8EA 2IRUA 3HHDA 4EYIB 4F4ZA 1HNWF 3OL9A 3ZNUA 4TU9A 3Q89A 1KOHA 2BE7D 3N9UC 4KGZB 4DL0C 3SYZA 3H25A 2RDDA 1UEUA 3N79A 4IDKA 4TQRA 1LKZA 2RQMA 2DVIA 5FD1A 4JI3F 3TO8A 3AD7C 3DRSB 2WB1D 5B09A 4C48A 4GKJF 2WVBA 1Q78A 2MKHA 2KJVA 2JLEA 2QLXA 2MKJA 4ICLA 1T11A 3ZZUA 2VG6B 4EMDA 3CCRS 5IZHA 2PMHA 2QA4S 2GAHC 2ZNZA 2BANB 3FQLA 2N3LA 2OKQA 1C0TB 1FXRA 2BMBA 1U25A 5F8GA 4DV6J 4HYKA 1LW0A 1FKOB 1KKHA 2FZKB 2HRYA 2IDLA 2MZTA 3GJQB 3MI7X 4HT7A 3GPAA 4CYUB 4DZDA 2WBRA 3Q0AA 3LUYA 5A6WA 1RBLA 2GQQA 3CGIA 3KK3A 1V9OA 1WG1A 2FTRA 1HFEL 1SXLA 4P7VA 1VQ9S 3DHXA 1JLEA 3B54A 5B0GA 3ZZZA 3KMSA 1HW8A 3FCWA 4AQYJ 2UVWA 2X7IA 1N5TA 3DHWC 4IFYA 1Y4ZB 3I0SA 3B4MA 2P9CA 1GXTA 2VA2A 1NRKA 2CPEA 2GA7A 3BQ1A 2DR6A 1SH3A 2HZVA 3QRRA 4ZVEA 4CLLA 1NCLA 2BJDA 1IWGA 2DK2A 2IFXA 3AXMA 3DCAA 3H90A 3HSJA 4OYPA 4PPZA 3PKYA 2YKNB 3CVKA 2I0XA 4UF4A 1QTNB 4AL7A 4RO0A 1UPPA 3FBEA 4K4SA 1JLGA 5DJBA 1SUQB 2ZFHA 4ID8A 2GIRA 1IM6A 3R8YA 4EBEA 1VQ5S 1CJUB 3C3LA 5DRKA 5G0RB 1U48A 5HQLA 1CJUA 1XN9A 3A8EA 1F9HA 4UZCA 4ED2A 4EWTA 3UCUP 4X64J 2WTFA 2AEJA 3MPVA 2AJ0A 5T7LA 5T7LB 3A12A 1UW9A 3HHNB 4DDFA 4A47A 4U95A 1YJRA 3HVTA 3I9V9 1X0FA 1SBRA 2R9LA 2C3MA 2CZVC 2R2TA 5HBMB 1NDPA 1ZOTA 1QVGR 3DDKA 4EZ9A 3U1MA 1UA1A 1L3UA 3NNHA 4K7QA 5KG2A 3ILJA 2IMOA 3QQCD 2UUBF 2E7WA 3QIPA 3MR6A 2V6AA 2VB6A 1VLYA 3DOMA 3QFHA 4IUFA 3P96A 2V4JA 4WTYA 2CPHA 3J80U 1MROB 2JWNA 1DLOA 3UNGC 1R0AB 2RJZA 2NUUG 3RB6A 1REVA 2HQIA 2K3IA 3K17A 2CQCA 4GO7X 3KLFA 4ECWA 3QBCA 1U49A 2UUAF 4OYBA 2DH7A 2HVZA 4QYZJ 2NYHA 4BWMA 3CDUA 3FBCA 3G82B 3N5FA 3D9BA 1Q95G 4N76A 5IS2A 3NWGA 5EX0A 2MQPA 1T9WA 1K9MT 4MTPA 4LF7F 3AODA 3RZAA 2PSZA 4F26A 1VQOS 2FLPA 3DRSA 1HWIA 5A8RA 3FC9A 3ZZPA 4UY85 4NXNF 2DXDA 1GTHA 4DV4J 2G9OA 4RKUC 4O44B 2DHGA 2XLIA 1C4CA 1VIXA 1D9DA 1RU2A 4IQMA 4NA2A 1IBCB 1RWVB 1TL1B 4ALZA 3OLAA 2L41A 2HHHF 4DV1J 2AP6A 5DS7A 5DLFA 2HBZB 1WACA 2IM1A 3R6GB 3R7NB 3A8IA 4JOUA 4PG4A 2B4OA 3MR7A 3UI3A 5K8NA 2Q6BA 1SIWB 2JNJA 4Y6IA 3O44A 5E3RA 5KFOA 1RWMB 1FD8A 2HAFA 3IRWP 3MM6B 3V4IA 3MM7B 1TKTA 3MMJA 1U02A 3PW0A 1TMJA 1G1XA 3DN9A 1S0MA 2WK4A 3CNQP 2ACMA 2AW0A 2WONB 4OZNA 4H4OB 2RQKA 1TELA 2ZBPA 3THTA 1GX5A 3JSYA 4M5HA 3W64A 4CLKA 1Y00A 1BQNA 5CD4H 2VJUA 3MZIA 1RT3A 4DQPA 3GFYA 3CSKA 4ID5B 3M30B 1VRQC 3NXZA 1P8GA 4DCJB 5FLXU 1A9NB 2B9WA 3G6XA 2J9DA 3DLLQ 1KNZA 3M8WA 1BXNA 4AXJA 3J81Y 2RUSA 3BR9A 1HPZA 1IN0A 4WWSA 1TKXA 2VG7B 4K5RA 3SZ2A 2GO8A 1V3SA 1UFKA 3TUZC 1IWAA 2X1BA 2IVFB 1OYDA 4YUDA 1XNQF 2VOPA 1UVNA 4QWCA 3OVBA 2YWGA 3BZQA 3QT7A 5G0RA 2WRMA 2EVZA 4CLPA 4I2PB 4RNFA 2ZJRQ 1CS4A 3KJQB 1LWCB 1H6KX 3T6JA 1QSLA 4TYAA 4X4NA 3I56S 3C46A 3HZEA 4OJ1A 3R7BB 3CF5Q 2L9NA 2QMUB 1Y11A 2BACA 4PZVA 1XEZA 5F8MA 2XGPA 2B43A 3ZZ0A 4JI6F 4F4WA 3KUGA 2I5JA 2RVJA 3L9ZA 2C42A 3W60A 5KFNA 4NI2A 3LP0A 3OL6A 1TK0A 4A8FA 4LF6J 2E1PA 2P9EA 1BLUA 1Q8IA 1RHJB 2UV8A 2YQ1A 2CWKA 2XMWA 3HZGA 3KLIB 1CQNA 5KG5A 3CMAS 1XMOJ 3MCNA 4WP8A 4KFBB 2ZD1B 1WOPA 2KM8B 1P9YA 1UJ4A 2QO3A 2XZDB 3THVA 2XHWA 1NH8A 2EFNA 4DCOB 2B0GA 1DRZA 1YBAA 4FVMA 2XHCA 1X60A 3NNCA 1SI9A 1FX2A 3MOZA 4DBQA 3KJVB 1J5EJ 4F3QA 3AJ1A 2VBZA 3Q22A 4WFAQ 4B9UA 1F9FA 2QSFA 4FYWB 2OI2A 5CZXA 1NK4A 5ETMA 1U1QA 1SKWA 1VR6A 4JI6J 5C42B 4QR0A 4LF5J 3BKTA 4MKAA 4QIGA 3TR5A 3PNIA 3FCVA 4LF7J 2R7SA 1BC6A 4YR2A 1TV6A 3M6WA 4BC9A 2RS8A 1H73A 1LWFB 2XY7A 1IBLJ 2ZDOA 3PJWA 1N88A 1UTAA 4ELUA 3H5XA 3RBEA 4F4YA 4IFVA 1FK9B 3ZZOA 1T05A 2J9EA 2RU3A 2W24A 3JSBA 3OL7A 1RT1B 2HNZB 2BEFA 4ED0A 1WTFA 4TLRA 2DR7A 2AGOA 3VQSA 2BW7A 1SKUB 4DR5F 1YLXA 3TAMB 2MKKA 3H4DA 2UUTA 4LF9F 1F3FA 4J9UE 5ETNA 4FF3A 1Q82T 2OELA 3WBZA 3MECA 4DV0F 3MM7A 2V8HA 3HFVA 3MM6A 1P27B 4P7TA 3V4IB 2HVEA 2FPHX 1JQGA 2W2PP 1RTHB 4HDHA 2J7WA 2XBPA 4AL5A 2UXCJ 1EQ0A 2GVZA 3W63A 4RUCA 2E5GA 1IKWA 1RTZA 1S9EB 1TKZA 4UUXA 2M70A 5GMDA 4TQSA 4PAAA 4DV2F 4DSKA 1WI6A 1N5YA 2YQ0A 2CNNB 2CIMA 3DU5A 3GONA 4RW7A 2HHSA 4LVOP 7FDRA 3W2WA 2PE8A 3LP1B 4UTGA 4ETZA 1I94F 4IOAQ 2FB0A 1GAOA 2H54B 2N4DA 2W9AA 3BQ2A 3IRXB 3KJNB 5A0YA 3EZUA 5KFVA 2MY8A 4KH1B 4UW2A 2MGZA 2RQ4A 3VZHA 3MEDA 1X5TA 2MZRA 5LMUJ 4DR3F 4KT0C 1KVJA 1Q0NA 2CNLB 4CO5A 2GMJA 2CUYA 5DO2A 3M2RA 4MJKA 1UL3A 1VGYA 3AB4B 4R0JA 4WK3A 2B8PA 2HKEA 3LAKA 3JYTA 1KONA 4F4XA 2ZUGA 1ULRA 3LO3A 3H5YA 4DL4A 3TI0A 5DZ7A 4L6V3 2OEJA 3GU0A 3H2VE 4PXEA 5A8KA 3TX8A 3KYLA 4DG1B 2JFKA 3RRHA 4R0EA 1NB7A 2E66A 1FRJA 4OI3A 2VU5A 3BYRA 5KFDA 2IPOB 1RA6A 3E2EA 1WHWA 3T1HF 3R5BA 4ZVRB 2AEMA 4RNOA 2BJ9A 4Z37A 2R42A 4JI1J 1NK7A 4JI8F 2E5LF 2KT2A 1CJKA 1IKVB 2HVDA 4OFZA 2NXJA 5THWA 3X1LB 4WE1B 2UXBF 3BGRA 2PI5A 4ECQA 3SCLE 4Z7YA 2RILA 3D6TB 3ENQA 3NBPA 4KRWA 4WXOA 2CADA 4B9MA 1R3NA 4A4JA 4J5OA 2GHWA 5CHCB 5GAHU 1VC6A 5DETA 4F4KA 1EETB 1Z4UA 4K4TA 5KFXA 1U1NA 1WDDA 1HQ2A 3TVYA 1FX4A 3HX9A 2CQ1A 4CTAB 1T03B 4L76A 4ZOSA 1KR4A 3H2UB 1H2TZ 5KFLA 4RBTA 2RE1A 1S57A 4MKBA 1Q8KA 1VQSA 2HHPA 4LVNP 1NK5A 2ZBIA 4A8SA 1N5QA 3VTIA 5EWFA 1VK8A 4ZPCA 3F56A 1UEKA 1TAQA 3BBFA 1GT8A 3L09A 5RUBA 3CC4S 1YWXA 3V6KA 4IFVB 2L9DA 3KHRA 4LSNB 1ZPWX 4M5MA 3M32B 2BYCA 2XO6A 2UXBJ 1WWHA 1RE1B 2QYGA 4N47A 1VC0A 4DV1F 1WKLA 3UD5A 3V4MA 5C2CA 4USTA 2KG1A 4X65J 2FLLA 2D3O1 3CB4A 1JK9B 5E3CA 4YR0A 4MYUA 3ILIA 2DXFA 4JI4J 2KVIA 1RBAA 2BR0A 2EG2A 3T5JA 2GIFA 1UZHA 1NBEB 1PC5A 2F5GA 3BF4A 3O8WA 5AXNA 1ZYQA 1L3SA 1NO8A 1OJ4A 1S49A 2QX0A 4J91A 2X1AA 2YX4A 2KYXA 2DNQA 2GIQA 3D5MA 1MW7A 1BQMA 2LYVA 4LREA 2PDAA 4O44A 2VODA 1E6YA 4LR7A 4JI0J 2KJWA 3KDOA 1QJHA 1RT4A 2YQ3A 2BXJA 4Y28C 2ZJPQ 2YPZA 2BJ7A 5CH7B 1YZ7A 3BR8A 1LOUA 1SB6A 1ZZFA 5E2QA 2Q43A 4RL1A 5U47A 4LT6A 4P72A 2LLZA 2UUCF 3TVZA 2MQOA 1NAQA 3UDVA 2VPYB 3KLEB 3NGKA 2NSCA 3GYGA 4OHVA 4J9SA 1TK5A 1HNZJ 3NNAA 1KLMA 1VQYA 2D7SA 2WSEC 5D6GA 3MMCA 2BX6A 5DGAA 3O6QA 3HVTB 5LT5A 5KFPA 4TNOA 2M88A 3Q2SC 2QMWA 4HTJA 4FS2A 1VQ4S 2J6SA 4PG5A 1URRA 2O1PA 1Q7LB 3M6UA 3PEJA 1N8RT 1UPMB 2V2VA 5D0HA 1HPZB 4FNIA 1RWPB 4FN5A 2JLGA 4KQZA 4MIWA 4DSLA 1KVKA 2PFDA 4UQTA 1DAXA 1QE1A 2PO4A 2HFZA 3J7ZT 3RBDA 2A1BA 2ATLA 4O4RA 1IJFB 1U2FA 1YRUA 4ZLJA 5MAOA 1NDLA 5F9LA 5GAGI 3HM9A 1AA1B 1MWZA 2WOMA 3CTRA 1S1WB 4L3NA 4OI4A 4E2FB 5DQHA 3DOLA 4EZ6A 3R1LA 1WF1A 5FIIA 1NJXA 4K4XA 4JI5J 5B0CA 2E1AA 1WEYA 2XI2A 1HHQA 3UN5A 4DS4A 1S72S 1EX8A 3EUNA 4ZIWA 1S1XB 5H1SV 2HS0A 5T41A 3X3UA 4ELTA 3W5XA 4ZJQA 5CCMA 3BJYA 4PPDA 4NLDA 3FSYA 5HMXA 5B0DA 1Y0HA 2DO4A 4NLTA 4IOCQ 2C2MB 5DDRC 2KT5A 1HNXJ 2DXEA 2W9CB 2ZH7A 2CXEA 1RBOB 2ZKTA 4CYUA 4WTOB 5J1EB 2G1HA 2BABA 4WU3A 1WC3A 3SIPB 3LGMA 4C6AA 2O67A 4IG0B 3D66A 4EFAC 3M2RB 1QSYA 4B3MF 3MOJB 2PT0A 3OXLA 1AFJA 2LU2A 4O3SA 2F9DA 4OZ1A 4DSJA 4LIWA 4B17A 4CO3A 1WHXA 2MQMA 4Q5VA 1C0TA 4IDKB 4KHMA 5KFQA 1UMJA 1V3ZA 4DF4A 1HNWJ 2E9TA 2ROEA 4ENOA 2UXCF 4WYLA 3GIRA 3ZTQA 1T9VA 1WF2A 5D3GB 2J8SA 1FESA 3JS9A 1FFSB 2ASYA 2DNYA 2JX2A 1B7YB 2KT3A 2QL5B 4MFBA 2HZCA 3D1QA 3MAAA 3S01A 2IAJA 3FNNA 4QW9A 2CVIA 2KVQE 4NLQA 4PWWA 1DJ0A 1RT5A 1GTEA 1QM9A 3R1HA 2NREA 1WOSA 1UETA 2VFTA 3NCRA 4LQ3A 2DJWA 4RW9A 2AQ4A 1RCOB 1SC1B 5HVHA 3CJ5A 2OMOA 2OSRA 3OLBA 1RT1A 2NXNA 3AJDA 4CM2A 1C1CA 1RACB 3MUMP 1S9FA 1IBKJ 1WD6A 3F44A 4M5DB 2I6WA 3H5SA 5A6PA 4NXNJ 3IAM9 2DEIA 2XI3A 1T02A 3TOQA 3ZTOA 1FWLA 2N4CA 3FVYA 3QLHA 5CYQB 2YWKA 5IT0A 3MFHA 2DEJA 4DR2F 4UT4A 2ZM6J 2NXUA 2OPQB 5E3AA 1S99A 2B4VA 2XS2A 2MLZA 1YDLA 3UDCA 3A3OB 4DWIA 4P9SA 3ETMA 5GAGU 1L3TA 4O23A 3H42A 3QGHA 4C11B 4PABA 1IQZA 1R8CA 2AGQA 4OZJA 2Q1LA 3M8SA 2DY1A 3UN2A 1WHYA 4WFNQ 3G8QA 1JLAB 3EMTA 4G6VB 2AYBA 1L3KA 1FRHA 1FT8A 3DOKB 3G6ES 2P8IA 3OSPA 2LDYA 3BGRB 3VAHA 3AT1B 4LIRA 5D0GA 4DN0A 1G2EA 2A0FB 2CZ4A 2JLFA 2LVWA 1HNIA 2CQBA 2XSJB 2ZE2B 4MMOA 3S7RA 3Q23A 2MXYA 3C66A 1U26A 3FEXB 3MM5A 1GQEA 1LWEA 2HIYA 2L48A 3CCSS 1KWMA 1ZETA 2KB2A 1F5CA 4DEZA 1QUVA 4UZBA 2DGWA 2VG6A 3GG0A 5MLCV 1IBMF 1VQKS 4LMZA 5IWAJ 3QJJA 3N6MA 1P9QC 4IOBA 1LV5A 4F0HA 4B9SA 2DGSA 5LM7E 5HMWA 1LW0B 2ZJQQ 2HQDA 3I9ZA 2ASLA 2HEKA 5CQGA 4ZVGA 5I3UB 1Z2LA 3DI6A 3R5CA 4KBIA 2CPXA 3ILLA 4ZS6A 1IVZA 1CLFA 1K8AT 1RYRA 1HD0A 5HMZA 4NLOA 5H9FK 2C2KB 3MWBA 1S4EA 2FHKA 2DTJA 3T9ZA 5K8OA 4LBIA 1IKWB 4ZVUB 3T19A 5A0YB 3CCQS 2VJVA 1IBKF 3KJFB 3ENAA 2FC9A 5F8HA 4CH1A 3EJMA 4OI2A 3UCGA 2Y8YA 5JVGQ 4Y0FA 4ZPWR 5GAHI 2B51A 2KN4A 5I4MA 3PO5A 1WTBA 4FPRA 2RF2B 2C1EB 1FNXH 1UW4A 3KG1A 2GVZB 5ETRA 4XDCA 5FJ4A 2V8GA 3MR5A 1K0VA 4J37A 4OX9F 2QE5A 2JEGA 2DR8A 1FDNA 2Z8QA 3H8YA 2PGCA 4HHHA 3QGIA 1VQ6S 2WOMB 4YB7A 1WF0A 2UUBJ 2Y8WA 3VZIA 6FDRA 1SQEA 2A3JA 2LQ5A 3LOUA 2W2NP 1D09B 4P52A 1NSQA 4RBUA 3OL8A 1U47A 2ZOFA 3TAPA 5DGBA 1AXQA 3CIZA 1DQAA 3HI9A 4OZ2A 6AT1B 4HDGA 3ZTSA 2HNDA 4H54A 1JIHA 2CAJA 4X4TA 1TV6B 3RR7A 2MHEA 4R8UA 1HYSB 1S6UA 4KYZA 2CVEA 2DR9A 1BQXA 4KB7A 2OFGX 4OMFG 5IC4B 4Q2LA 1FFWB 1RK8A 2B8QA 2HURA 1UJ6A 1RISA 5ETLA 4B3OA 3MCSA 4NPOA 4YDDB 4FXWA 1T9YA 3HHEA 1FXDA 1KQSR 2I8EA 3MFIA 1JJ2R 3P49B 2HW3A 3G6VA 1KLNA 5T14A 2XC9A 3KLEA 4OI6A 3DMJB 1SCJB 4GKKF 2OUGA 2K3KA 4QPTA 2KZMA 2G0JA 3DOKA 3MD1A 1DY3A 4I64A 3HULA 2C2OB 1ZS6A 2AX1A 3ZZYA 3AAWB 3PG9A 1NK8A 1W25A 4LFBJ 1UVJA 4F67A 1NJYA 2HVHA 1RADB 2J6UA 2HHTA 4HH0A 1BWEA 3OR2A 1C0UB 1SC4B 1ZM4A 2AKWB 3FEZA 4XO0A 2XMVA 3CCVS 1KEKA 3LANA 2B7CB 2KRRA 4FVCA 4NCAA 1FFGB 4ZK7M 3IP0A 1TKZB 3WZ0A 3D67A 2KDOA 3M4XA 1Y7PA 3LGHA 4IO1A 1N56A 2J9DE 5E0OA 1ZBTA 3CCZA 5EX3A 2DHSA 3C14A 1TVRB 1JWWA 3CD0A 4I2QB 1AROP 3E8OA 3MECB 3PZPA 4KGMA 2CPFA 1KOOA 1YKWA 2VPZB 3SXLA 2MJUA 4JI7F 1S9EA 4H4OA 3KHGA 3QZ8A 8ATCB 2AZ1A 4ZVQB 4K4VA 1XWLA 2E7XA 3FSXA 3FZ2A 3TYTA 3HDSA 5HL7Q 4Y3CA 3VR1A 4ECTA 2WBMA 5H9EJ 1X9WA 3WX8A 1P1LA 5CYMB 1HKAA 2Q3PA 5DG9A 2JH3A 1M5KC 1FRMA 2IM3A 2OPRA 1TL4A 2XY5A 1Q53A 4KR0B 2LU1A 4URQU 5D3GA 1U7LA 4H4MA 2ASJA 2DB1A 2HNZA 5J1NA 4U7UD 2K1RA 3C15A 3HP6A 2MTLA 4ILLA 3QO9B 4ZLPA 4KPYA 2XB2D 1JKHA 4DPOA 1Q7YT 2ZOMA 1F5BA 1RHMB 2AJ4A 4B9NA 1IJEB 4ZIVA 2VIHA 4Q0BB 1D3WA 2Q6CA 3HT0A 4IH7A 4LRFA 1H0HB 3GYNA 1NJZA 4JP8A 2BW2A 4PXBA 3B82A 5DZ6A 2AJQA 1I3OB 2OPPA 2YNIA 3K2YA 1VYAA 1R6YA 2BANA 2C2ZB 1ZH5A 3GB0A 2Z2LA 4WF9Q 1OO0B 4YB5A 1Q5VA 4YEAA 3T5LA 5HLFA 3PX6A 2DGTA 2PIIA 3AD8C 2LKZA 4ZLLA 2C22A 4QYRA 5HANA 2B9EA 4OJGA 4QJVA 2CPYA 1R43A 1YITS 2QA1A 4XDDA 2WZ1A 4J9OA 3HK2A 1X0PA 2CG4A 3HHLC 1M5SA 4DR7F 1QTMA 3R2CJ 4OYWA 3QYYA 3BH6B 2FVRA 1RAOA 4J9KA 1LW2A 4KGXB 2ZH8A 3A3PB 1S1TB 4ZLNA 5FDLA 4DV7F 3V6HA 3DYAB 2H5EA 3MM8B 2GO9A 3MM5B 2XMMA 5F8JA 2ZITA 1MG7A 4C8OA 1SJ3P 5IT4A 2IA0A 4JI1F 3KNGA 3UW1A 1WKKA 1RAHB 1IKXB 2CG8A 1FJGF 3BDPA 3QT5A 3W1YC 1RXOB 3KG0A 4A8WA 3MURP 2LDIA 4FKXA 3KTQA 4KHPJ 3TUJC 3U7JA 5C7PA 1P6TA 3IM9A 4AL6A 3RR8A 3K5NA 3DKDA 3OFGA 2ZH9A 3IN5A 2LA4A 2V8DA 2QA4G 2J7KA 5E33A 4LFCF 2MMYA 2E44A 2FVCA 2V34A 5KT3A 2DBBA 2Z2MA 4IG3B 5C5JA 3GIIA 2ZH1A 3A8JA 1JLQB 3HSGA 2OGUA 5CYQA 2IRXA 3I87A 1Y5IB 4USUA 3BB5A 4K5SA 1PILA 3ZXWA 1X5SA 3QIDA 3I55S 3VAGA 1AB8A 2XMJA 3NEKA 5IT9Y 1HBUA 2PEHA 5IWAF 2VICA 1FVSA 2KHCA 1S6PB 1KHVA 4LF2A 4ILRA 4LRCA 5KG4A 2L9WA 4J90A 4DN9A 4ZHRB 5KFBA 4ED7A 2LFVA 1BWVA 3W5YA 2IMWP 2E5IA 1TU0B 2B5JB 1FCAA 2IC3B 3D1OA 4QW8A 3SQGB 4GVBB 2HMIB 1M1GA 2UVVA 1AW0A 4CH0S 3D6MB 1NDKA 3WX4A 1FA0A 3IMQJ 3QPIA 2FJVA 4RUHA 3UCZP 2XS5A 1NHVA 2XLKA 2XTJP 1LWFA 4PWUA 3BO4A 3IWLA 3V2UC 1X4EA 3I5AA 2MZQA 3I0SB 1N5SA 1Q8LA 2MZSA 3OFHA 4DOZA 1VQ7S 4Z2XA 1JLCA 3PV8A 2W8LA 4Y65A 1T94A 2RRNA 1REGX 4DV7J 1OS5A 2GHPA 2QYCA 3R5GA 2ZWPA 1FE0A 2CPIA 2BBEA 2Y0BB 3DGVA 3HD1A 1RLDA 3OPKA 3KG4A 2ZHAA 1IBLF 2V8VA 5KG6A 1F60B 3K8WA 2GQ2A 1OY9A 4CDIA 5G4DA 3ET6B 3DLHA 3MCMA 1BHNA 1X8DA 3PCOB 1YBUA 2XYPB 3VAMA 1TZ0A 5HROB 4OLPA 1RWXB 1Y3KA 1TMMA 2AF6A 2HGNA 3THPA 1WEXA 3ZO7A 4DLGA 3IC1A 3MEGA 3P8BB 3KLIA 4PEOA 5LXYA 5KFCA 1DTTB 3J7Z5 1RYSA 5LL6d 2H5IB 3W9IA 3H59A 4F8RA 1AZSB 3FK4A 4WZMA 1NU4A 2V69A 3NGUA 2DNRA 1U45A 4X4RA 1S76D 2V2QA 3H40A 4NYOA 1S7HA 2AHOB 5IXUA 1Y3JA 1CJVB 3US5A 1S12A 1R89A 1TL5A 1UFWA 5K8PA 4KTQA 2QV6A 1FKPB 1RT2B 2VOOA 1ELOA 3SFUA 2YX1A 1HI1A 3DDNA 3EZ5A 2AJ2A 4CO2A 4I2QA 3GIKA 4J9NA 4WFYA 2PI4A 3MM9B 2AEFA 4XTTA 4CTAA 3OTCA 2F4VJ 3LALA 4KIAA 3M8PA 2CQHA 3GJRB 1SJRA 3AQOA 4O3PA 7AT1B 1GMWD 5KTQA 1QSSA 1HNZF 4DI6A 2QN6B 4A8YA 1J2VA 3IS9A 4C3LA 3FZBA 5DM7Q 2E1RA 2R7OA 4RWWA 1NLKL 3B8HA 4ID5A 4AT1B 2EFQA 1YBTA 2LQJA 4U6PA 3P3DA 3PJ9A 2RRBA 1FNMA 4F0MA 2ZOGA 3WDOA 3J81U 2UU9J 2B6AA 3NL0A 1CJKB 1SV5A 1NJWA 1O51A 1VIOA 2XULA 1SKSA 5EGYA 1UEVA 1W26A 2KHDA 2CJYB 1H2UX 1MU2A 4P74A 5DG7A 2FHMA 1YRTA 3OVAA 1XMBA 1UAWA 5BYQA 2DNKA 3A1YG 3QGPA 2M8DB 1F2GA 1OQ3A 3K57A 4M5JA 5HJXA 3VVUA 2RB7A 4YDXA 4WZQA 4TY9A 4M5IA 2LEPA 5E3QA 1YIJS 3QSYB 3GSIA 4M8LA 2W1BA 3QAUA 1G4CA 2IY5B 3UR0A 3PX4A 2FDNA 1ZTWA 1NDCA 4KY3A 1U0HB 2YTCA 2AU0A 5AXLA 3N5BA 2JC0A 3JTOA 5KFWA 2MJNA 2FVSA 2NQPA 1HBMB 1N54B 4RW4A 3UR3C 3UVJA 3WIVA 2XS7A 4C0OC 5HP1A 4PKDB 2OP5A 5E3PA 4PR6A 4YB1P 2KYZA 1K1QA 4X4PA 1HI8A 3RG6A 3TQ1A 5HP1B 2YVSA 2W8KA 1HMVA 4NLGA 2PFFB 5KFHA 3PO4A 3Q86A 4LFAJ 4CZCA 4X4SA 3CJ2A 3HSZA 4PG8A 4YR3A 4GVBA 4WIQA 1X4CA 2NS1B 4ED5A 2OEKA 3DC2A 4IG0A 1IBMJ 4L72B 4KPCA 4URGA 2HWHA 4ECSA 2FJWA 4USMA 3NCPA 3TZYA 4DU8A 2DISA 3PFOA 3VGTA 2OPRB 4F7VA 3V81B 1XMOF 4GKJJ 3N01A 2ACYA 2EFOA 3GSDA 5KFFA 1URNA 2M0GB 2Z4PA 5D78A 3BGUA 4PG7A 2B9XA 3PR5B 3FFIA 2B4PA 5HSPA 1PGZA 3T5HA 2ALZA 3HKWA 3DRXA 1NMEB 4A8OA 1DZ5A 1BMQB 2HQFA 1Z2ZA 4F3MA 5HJYA 1KBRA 4ZPTR 1C4AA 1PO6A 2R7TA 1KVIA 4DQQA 4NE9C 3RB0A 3AFGA 1B0TA 3TEGA 1X4AA 2D1CA 2QLBB 5M2RA 1RAGB 3L4BC 5IFMA 5F8IA 4GMKA 2XCPA 2ZH5A 1QAIA 2VBXA 2IJFA 2D74B 5L39A 5D4NA 5A2QU 3CDBA 4PXCA 5F0UA 2YH1A 4B3RF 5ETPA 1S48A 1IKXA 4NYPA 5EHHA 4X62F 3LA0A 1T03A 2VDHA 3MM9A 5D0EA 5DQGA 1NH7A 4Y2AA 1B99A 4WE1A 2V0NA 4MYTA 4Y00A 3M1VA 4DX7A 2GJFA 3MMAA 5D0RA 2DR5A 2KH9A 5F3ZA 2XMUA 3KJVA 4YQWA 3W62A 1CJTB 2BE2B 3KLGA 1ZAWA 1VBZA 3Q8RB 5EN1A 2GMHA 4ANDA 4USJC 4CLUA 3B4DA 3TJAA 4IKAA 4HEA9 2E5LJ 3PW5A 2YBVA 2DRBA 4X84A 2VF3A 1RWUA 5B0FA 3DM2B 4K0KJ 4TYBA 2VH7A 3PX0A 3DU6A 2CYYA 4C8NA 4QOTA 3R2DJ 4OIXA 3TA1A 1EARA 3OTBA 2EK1A 3DLKA 3KK2A 2GAGC 4A8XA 2LXUA 2OO4A 1TQLA 1HR0F 4H4KA 2J6TA 2RNEA 4IH6A 4ED4A 2Y1JA 1SJ1A 1D8YA 5ETVA 3RAQA 1SQFA 2VG5B 4MAKA 4G3IA 1FWPA 4FZVA 4P2FA 1N36J 2ROGA 4JI3J 1WEZA 3QRQA 4L73A 2LA6A 4DLEA 2CJ9A 1NZAA 2BVZA 2F63A 1BD6A 3MPUB 4K2XA 4F2RA 1EP4B 1WDTA 1IKYB 2J5AA 3DRPA 3D28A 1X5PA 3E01A 1AYEA 3IRXA 4NMLA 3R9LA 4NOHA 3HVAA 1HQEB 3GTYX 1RTJB 3NCQA 4PXDA 2BE9B 2MQNA 3DLGA 3KK3B 4DCPB 2J8AA 2RSQA 5LMNF 4LFCJ 3CJ8A 4DV3F 4X4UA 1WELA 4RW7B 3VQTA 1H3DA 3L7OA 3IGNA 1DQ8A 3VVTA 3DFEA 1HNVA 2QC3A 5KFUA 4C0HA 5F9NA 1PJ5A 4MK9A 4DPUA 3KMQA 1WC5A 3NRBA 2DH9A 3Q8SB 3L7PA 1N4LA 5L38A 3BREA 3SCKE 3FSIA 3DLGB 4ZJOA 1KRPA 2RAQA 3QFWA 2IBKA 1UWBA 1F5AA 2JEJA 1VJQA 1FE4A 3EM1A 1P1TA 1HNVB 1T3OA 3N4WA 3EE3A 4LF9J 4DMZA 3A4TA 4O3QA 4OZ3A 2BKOA 2DGQA 2IJNA 2HBYB 2QA2A 3I6PA 4RW6A 3NWRA 2WW8A 5IV3A 2W2QP 5J1PA 4WCEQ 4DUZF 3SSRA 1YJWS 3CMES 4LSLA 4NMXA 4DL7A 3M8YA 1NSAA 2ILZA 1FRXA 3TNVA 3E51A 3PJXA 4YHHF 4IH5A 2C3UA 2CJKA 5JJBA 1F9EB 1XC9A 5GAEI 1VJWA 3TWZA 3DGPA 2F4VF 3CCTA 2XQCA 1TL3A 1K1SA 3OR2B 3PYEA 5J1EA 4A8QA 3LPYA 3KLFB 2N82B 4EO8A 4NI2B 1UA0A 4KO0A 4NLXA 4WFZA 3FMBA 4JV2A 3G8TA 2FHOB 3RBXA 3DLJA 1OIAA 3DOMB 3TZWA 2ZVIA 3MAQA 2HQGA 3MDFA 1KDNA 2XWXA 4KE5A 3MMAB 1QVFR 1HNIB 3CJTA 3UD4P 4U67Q 5J2MB 4QIEA 4J9MA 2VL1A 4M95A 2ZZMA 3MTKA 4AXIA 2C2EA 3DRYA 1S1WA 4ZCKA 3VALA 4C3MA 5H9EK 1B64A 1JLAA 3BGLA 1X5OA 3MMBB 2VZ9A 5AE1A 1EB0A 2NPIA 5HATA 1XJWB 4EU0A 3M2VB 4ZPAA 1MSWD 2P6TA 2BQ3A 1S6QA 4N56A 5D4OA 2HBRB 3OUYB 1JKHB 4B02A 2KG0A 1U1LA 3EDRB 3NAIA 1JLFA 1R8AA 2CDRB 1EQMA 4D3GA 2ASDA 1S97A 5CA5A 4CNZA 3O2IA 2HNYB 5H9FJ 2XGQA 4OHWA 2RF2A 4WFBQ 1APSA 2WONA 3IAS9 1XERA 5AT1B 3OV7A 2Z58B 1RTHA 4B3MJ 1JJHA 2B7BB 2GVDB 2XYGB 4O4GA 2KXHA 1TUVA 1NSPA 5FLXY 4W90B 3FRZA 3SSQA 2O66A 2UU9F 4K0KF 1RT3B 2HLTA 5F0WA 2R7WA 2H4WB 2R8JA 1AUDA 2MSSA 3AY0A 2XM3A 1AT1B 5JUMA 4DX5A 4CLWA 3MR3A 1RB0A 1X7VA 3VGUA 3GMGA 3GIMA 3ET6A 2EG1A 2EXUA 1D9AA 1R8BA 2IAJB 3CJQA 4PUOB 1TP7A 5DDPC 4WK1A 4CWBA 1ICEB 2HQCA 3RRGA 5A8WA 4LSZB 4GKKJ 3D6FB 1RTDA 2XSFA 2W7AA 1WC1A 3C16A 4NLUA 2GJIA 5I42B 2RUGA 2CQGA 3C16B 4QWBA 3RTVA 1CQMA 4IQXA 3C6TA 2UV8G 1Y9OA 3V6DA 1M5VC 2C28A 1R7IA 4HI1A 4NLPA 3OR1A 2ZHBA 2MB0B 1HA1A 1WC0A 3CWJA 2UP1A 4OYMA 1REVB 4DSEA 3ENVA 4PCQA 2ZH6A 4CH7A 4K4WA 1NJIT 4U7CA 2YNGA 3N6LA 4ATNA 4TXSA 4M5GA 4KH0B 2V67A 4CO0A 4XIUA 1I94J 4JV5J 4LF6F 2ZM6F 3HVWA 3IBWA 4OYAA 4OQJA 4ZPVR 3T9NA 4O0IA 2CPDA 4DV2J 2YNFA 4F4AA 3J7A1 3HKZD 3HHLD 2Z2ZA 4HACA 5KT4A 4FF1A 1WG5A 1OY6A 2D9PA 2P5VA 2OMLA 2VC0A 2HFUA 4NXMF 4USWA 1H7WA 4WKRA 3Q8QB 4JUZA 2Q66A 3CDAA 5C25A 3O3LA 1TL7A 2H5JB 2A6MA 2QL9B 2X3GA 3QIPB 4G1IA 4LBPA 4WP3A 1HBNA 4DJBA 3D2WA 2UVUA 4FYVB 4W92B 1PJ6A 2QLFB 3M8PB 1U8SA 3M1VB 3VWSA 3K0JA 5AJ3J 3MPYA 5M2UA 3EYZA 2MDAA 1RAJA 1Q81T 1KTQA 2LXFA 3PDNA 3P4UB 2W01A 3PTWA 1N52B 1FO1A 3CCWA 3GLJA 5DG8A 4DR2J 4A8MP 1JXLA 3TAQA 4KV8A 5GMEA 3K5LA 1VBYA 2H48B 4B9LA 3EWGA 5I3QA 1QDUB 1TKXB 2VG7A 5D77A 4URSA 2M9KA 1J27A 1KQKA 5IM0B 3JAMY 1H2VZ 1DTQA 3M30A 1Q8BA 2CA9A 3KDNA 2I9SA 2W7OA 3RAMA 1B70B 3UO0A 3LGNA 1KS2A 2YNHA 3NGRA 1TK8A 2KZZA 4DR3J 1UZDA 4IFYB 1H72C 5HK4A 5DLGA 2C3OA 3LW5C 3I31A 3H4BA 1SKRA 3IGVA 1GXLA 1MLAA 2JHEA 4E98A 2XMKA 5LSOA 5L9NA 3ILOA 1I5OB 2HBQB 1NZ8A 2DRDA 2DNHA 1S7IA 4PYAA 3NOGA 4KKOA 2RU9A 2FIUA 4NRUA 4IR1A 3JYTB 4I6YA 1E6YB 4RPFA 3T41A 2HHUA 1HWKA 1U24A 3R27A 4FP9A 4QIVA 3ONQA 1CSJA 1XTZA 5B0BA 5HLFB 1X4FA 4MT1A 1OY8A 2G2ZA 2BDPA 3BPSP 1YTYA 5KOXA 1ZM2A 5EWEA 3W5ZA 2ZH4A 4R8UB 1H98A 4UOHA 4RNMA 1UKUA 2PA8D 3TZXA 4GC6A 1Q86T 2HNDB 1NK0A 1I1GA 3PHEA 2LQ9A 2DGUA 4HHUA 1S1VB 2GQCA 5I42A 4H4MB 4NLSA 5DQIA 4NCBA 3IFEA 4NLWA 3LWLA 2F9JA 5KT6A 4IRCA 2GW8A 1KD1T 1GFWB 2DIVA 2VBYA 3UDEA 3OQ2A 3WQPA 4DQIA 3EVOA 3FUYA 3MUTP 2FZCB 3NG8A 1Y10A 2H51B 5IC6B 5K14B 2XYHB 3AD9C 1RT6B 3MGJA 3R5AA 3BKUA 4CIOA 4U96A 3M9MB 2FLNA 3JSRA 2E1CA 4FYYB 5HBMA 1S9GA 3VAJA 2P9GA 2WW4A 1TVRA 3T5KA 1M5PC 2HHVA 2V5HG 4ED1A 3T1YJ 4GRSA 1FDBA 3JQKA 3R5JB 2F8MA 4UUWA 4QU7A 3M8QA 1JB0C 2YKQA 4WJBA 2BM1A 5LOQA 2XMTA 1OQ6A 2ZC3A 3OHBA 4ES1A 2J9CA 2YWHA 1WOOA 2W7PA 3C14B 2VQEF 2N7YA 2HFOA 2ZVSA 4QZVB 2R2SA 2EWHA 2IYGA 1F1BB 1WG4A 4RZRA 4DUTA 4LR8A 4HL9A 1IR2A 1RHKB 1SVDA 2WSCC 3GE9A 3HHLB 1Q16B 2VG5A 1HBNB 3M2VA 3MMBA 2DHAA 4DPWA 2C2NA 2H3EB 3AOCA 1PCAA 1CJVA 1N0UA 1Q4RA 4RX6A 2DNPA 2IYIA 2EFVA 1EZZB 3HFZB 5HN0A 3CEDA 2PMZD 3KHHA 3AHPA 1V6HA 3POTB 4ZP8A 4CLFA 3TUPA 2V63A 4RUBA 2NZCA 4DXLA 1S1UA 1LWEB 2P2CB 1K0TA 1HW9A 1PKUA 3CJ3A 3K8VA 1PIEA 2OAUA 2MKIA 1S6OA 2NYIA 4JI8J 3DGPB 1U1PA 1PSDA 2DNNA 1VQ8S 1EHWA 4YS2A 3OJSA 4ED3A 2GNKA 2BQUA 4QPXA 4ER8A 3U02A 5JMNA 2OIHA 1TUGB 2MEWA 5L8RC 4M94A 5L9XA 2E9RX 5HVGA 4OV1A 5D15A 3SCIE 1LWCA 4JYAJ 4KJIA 2FGCA 1LXNA 2XLJA 1K73T 2A18A 1SIZA 1VHFA 4J9PA 3E3XA 2LQBA 4JI5F 1YJTA 3KLHA 4M5KA 3CXCR 2D9OA 2K1RB 3C15B 2BJ1A 1YQHA 2H4YB 1YK9A 1EKRA 2HSEB 3CE8A 3ITHB 1NSKL 4V1Ak 3C19A 4CLYA 1SL0A 4OZ5A 4UY8T 4Q7AA 2AT1B 1FF2A 1UWBB 1RWWB 2FHJA 1HYSA 3QLHB 4B3RJ 1FWKA 2DHXA 4EYHB 2VKZG 2YWEA 1VQLS 2OD4A 4ZCLA 4ZITA 5KFKA 3AH6A 4L3KA 2JVRA 4DX8H 2UUCJ 4RJVA 5AE3A 4KGVB 3FBFA 1B4SA 4M5LA 3EGZA 3MEKA 2QFJA 3OFEA 4G1QA 3TX0A 1PJ7A 2HS3A 4P73A 3G6YA 3I5CA 1GXUA 3CO0P 4NX9A 4OYIA 4ECZA 4G1PA 3EPGA 3DOLB 5ADZA 1RLCL 2GVDA 4F02A 2BKNA 2MKSA 1RWOB 2Q79A 2MQQA 4C3KA 3CCUS 5SUHA 4YMEA 3BGFA 3DRRA 1FEHA 1UWAA 3I82A 3RAXA 1MMLA 2YH0A 2HVIA 1NXIA 4MK7A 2UUWA 2VBWA 4ERDA 3NBPB 4C98A 4QIWD 1FXLA 3G71S 3ZTPA 2RMLA 4K4YA 2NXEA 1E6VB 3HFKA 1SL1A 1GMVA 2GFFA 1RCXB 4NLYA 1XR6A 4DL5A 4DU7A 4DSIA 4GO5X 1EETA 4JV1A 3GCXP 5GAEU 1YJ7A 2PA3A 3BM7A 3KUHA 4NZ6A 3NGDA 3JSMA 1S77D 1XR7A 2O01C 3I32A 3IO1A 3PACA 2V4RA 4EBDA 2V9KA 4X65F 4N5SA 4ECRA 2R8HA 3G4SS 2A6OA 1XNQJ 5AJ3F 3D54A 1MN7A 4DSFA 3W66A 1T3NA 1T7PA 3QJPA 3NLCA 2HGMA 3QWUA 5F3TA 1R0CB 3TA0A 3UWTA 3GCWP 5ETSA 2OTLS 1IKVA 3GJSB 1YJ9S 4FKYA 1RUSA 2WAQD 2EC0A 1UVKA 2DCUB 4QWDA 1FJEB 2VV5A 1A6LA 3PRDA 5EUHA 1YI2S 3SV4A 4X2BA 2F1FA 1FJCA 1F0XA 4FBUA 4FYXB 2G4BA 1RP5A 2W4PA 1AUSL 2DO0A 3BV8A 3POTA 4FYDA 2RHSB 5E7OB 2ZNYA 1R31A 3I0RA 5IQQA 5D8HB 3TRGA 1NKBA 4NL5A 2DNOA 2JEFA 3S8SA 1PC4A 1IR1A 2U2FA 3CIMA 1KQFB 1R8HA 1V5IB 3MEEB 5KFSA 2BJ3A 4CO4A 5LMUF 3OTEA 2G0IA 4KSEB 2QIFA 3TUIC 3F73A 3MCOA 2X51A 3Q2TC 4ZVFA 2VFSA 3EICA 3KK1B 5GVQA 1H74A 2AYMA 1HIYA 5ITHA 1X4GA 5KG0A 2DGVA 4K2JA 2OJ3A 1FD2A 2ZKUA 2CWXA 2O5DA 5IQ6A 1YX2A 4HHJA 1VQNS 2K7KA 4XAKA 3MHYA 2JC1A 1N34F 4K8RA 2C3YA 4P2XA 1N48A 1KHWA 1KP6A 3B6BA 3QO9A 3GV8B 1N32J 1CEZA 2JZ5A 3LQVA 1N5YB 2BJEA 2VDIA 1G6BA 2JOQA 1FI4A 3QWPA 1G7CB 3B78A 1FKPA 1RT2A 2A10A 3NGTA 4A48A 3CCLS 4RW9B 4S0MA 2V2ZA 5CZVA 4LF4F 2MZ1A 5CYMA 4FF4A 4NYZA 3W2VA 1U1KA 2IBOA 1NUEA 3GWCA 3PRBA 3K7RA 4HH1A 4U8YA 3W2VB 4DZ6A 3D1HA 1TUWA 4B3SF 2BRLA 4RWXA 1U1OA 1KLMB 4IO9Q 4N8NA 2UVRA 4PG6A 4ZP7A 3GFHA 2V94A 4QCLA 1GMUA 3J7YI 2QLJB 2KFNA 4HTIA 1RKJA 1HHSA 2KRBA 4C7QA 3EX7B 4Y2MA 3FRYA 3W8PA 4YP3A 1VHIA 2HGLA 3AXKA 3BSCA 3IBFB 2WVEA 2D3ZA 3JTNA 1HQEA 5LXRA 3DNCA 1U4BA 3U27A 3V81A 5F8NA 2XY6A 3D0GE 3JQJA 5K9FA 5L1KA 3ISZA 2RDJA 3R3TA 2ZC4A 3TW0A 4J9VA 2R7UA 4TY8A 3TJ8A 2AD9A 4PQUA 5DM6Q 4FPIA 2YPYA 1K44A 2R8KA 4W4MA 2P6SA 4NASA 2E5JA 2HRUA 1IXKA 4ZN3A 4KFBA 4GC7A 1L3VA 1WUUA 2VONA 2XWYA 2HHXA 3PXGa 3ADAC 3VGVA 1LK5A 3TARA 4ZKAA 3G86A 2XSJA 2ZE2A 4I1TA 3KFWX 2DY9A 2FD2A 3HLUA 1MROA 1U0HA 4I6WA 2OFHX 4I69A 1HHTP 4LRDA 3DLKB 2W25A 4TVAB 3KK2B 2ZH3A 2ERRA 2JEIA 2FJAB 5A2QY 2KTQA 1S1XA 1KN6A 2HFVA 4NEYA 2R8GA 4HI2A 1H38A 1NEEA 3M05A 2MHNA 2DRAA 3CW2C 3QJLA 4DFPA 1FJ7A 4B08A 4JV5F 3KKFA 4F25A 4NWBA 2WVCA 3VF0B 4OHYA 4X4OA 4DS5A 2L3MA 2YX7A 1QY7A 2J0XA 3IS9B 5L1IA 2QG9B 1CJTA 4AQYF 1QAYA 4E8UA 2VFVA 2JVOA 1RDRA 4ZCIA 1B7FA 2GHVC 2CZ9A 1HWUA 3M8QB 4CNYA 2B6AB 3WC2A 3RBZA 5C24A 1VC5A 2IM0A 1HNXF 5IM0A 1RAAB 2G2OA 2AGPA 2GMLA 2Y3YA 3FGVA 3PR4A 3W7BA 2CNKB 2X3DA 1B0PA 4ECYA 3GP9A 4ECXA 4EI2A 3I4HX 3ZZRA 5HQ8A 3FQKA 5ETTA 1T9XA 5A76A 1ZTTA 3SDEB 2WCXA 4M5DA 1BGXT 3IR7B 5HI7A 1WSVA 5C24B 3PIOQ 3HT3A 4NLVA 1C1CB 3MAAB 2W2OP 4WP9A 4MFBB 3JAMU 5J2MA 2EK6A 3D4JA 4XK8C 2WVDA 4PRFA 3Q24A 3PKMA 3JQMA 4WKYA 1OPIA 1C1BB 4LR9A 4P10A 2FY8A 3OSNA 2HYIB 1TKTB 4X62J 3OXFA 1JXVA 1R8PA 2CJQA 3MMCB 2GS8A 3NS5A 3GV5B 5A8KB 4NCGA 1NKCA 2YNFB 2DPJA 3SV3A 4O3NA 4DFJA 3EXYA 1W2IA 2A2CA 2D69A 3D6HB 2FVPA 4CI0B 2F8EX 2DITA 1V3RA 2YNGB 3KWMA 2V9WA 4PQUB 4RU9A 1UVIA 1U6FA 1S1VA 2FJBB 1XR5A 3D0IE 2DHHA 4DPTA 4WIIA 2PMWA 2WB4A 4PYDA 4PWDA 4Y34A 4N7TA 2RRAA 4CP5A 2E7VA 2W9CA 2ZZTA 4ZVSB 9RUBA 4DL3A 2E5HA 4PUOA 3VHQA 3M6VA 3NGSA 2XNQA 2M5YA 4CCHA 4TY8B 3R7SB 2VKRA 4YHHJ 2LMIA 1C1BA 1NPKA 2CJXB 4UQGA 3CJRA 3BS9A 2D3OR 3FEYB 1U1MA 4RU2A 5CAAA 1H7XA 1U0SA 4F04B 4A8KA 2VA3A 1ZM3A 3U1NA 2FHJD 2M8HA 1XMQJ 4OV6A 4NCGB 2MSTA 3D3CJ 3ISND 4OX9J 3CJ0A 1DLOB 1R0AA 1RT7B 1DTQB 2DIUA 2Z2YB 3TANA 2M3DA 1YJNS 5ETOA 3BSNA 5L46A 1RZMA 4G1QB 3CPWR 1IUJA 4KHRA 3SCJE 2HHHJ 4K4UA 5BXIA 3BN7A 3LP2A 4CT8A 2GC8A 1PYSB 1S79A 1GEHA 2AJFE 4RR5A 4ZVHA 3HHLA 1CG2A 3ZZTA 1U09A 1SV5B 4ZVOB 1XNRJ 3QSIA 2OTJS 1M5OC 4R5PB 2G0CA 5GADI 4ZP6A 1PYTA 1N34J 2LQ8A 3QMQA 1HWLA 3I5BA 1TFWA 4DPXA 3O5TB 3VGSA 3GFXA 2QT7A 3AB2B 2GV1A 2ZH2A 2C2DA 4Y2CA 2HNYA 4QU6A 1NPRA 4KV8B 3ISNC 3BYPA 1PBUA 2EC2A 3JXOA 4CT9A 2KFZA 3IXQA 3J80Y 5JVHQ 2IVMA 2MKCA 3MEEA 1QD1A 4N77A 4OYZA 3ZTRA 3OUYA 3JB9k 1HI0P 4JV0A 1DFDA 3CCES 2YY3A 4IR9A 1O0PA 2POKA 3W61A 3D68A 3FMWA 3Q8VA 3LP2B 4FXVA 4HVZA 4I56A 1TL7B 3Q8PB 2KO1A 2YKNA 4IRDA 3GFZA 3Q8YA 3OJUA 2Z57B 2DYAA 5CABA 2BV3A 4Q2MA 4LFBF 1FERA 1T0TV 2C2RA 1YVFA 4J7CA 1LWXA 4C9DA 4KHPF 1IQTA 2CQ2A 1FKOA 3MEGB 2LECA 2UUAJ 2RIJA 1A0OB 3T6BA 1N6QB 1HR0J 2OPSA 2VPWB 3AA9A 3QT6A 1JLEB 3FDSA 3TEHB 4P71A 4ICLB 4EGLA 3W65A 1NM2A 2BRKA 4DUYF 1SL2A 3ENWA 4DV5F 1YHQS 2JDJA 2YKPA 3I4PA 2MGZB 4NA3A 4DL2A 4LSLB 5ETQA 4DR5J 5K5MA 4PWDB 4MH8A 3BO2A 4Q0BA 3MPDA 5D4LA 1TTHB 4AYBD 1QAJA 4I2PA 1BQMB 3KOAA 4BLGA 1DARA 3W2WB 4EK2A 5IT9U 1I51B 3GR1A 3UN3A 2BZ2A 5F41A 1S59A 4YY3F 3CJ4A 4KC5A 1RU1A 2MLYA 2QRRA 1R27B 1CVJA 2PN6A 2RH3A 2ZEJA 3F41A 4L75A 4RBVA 4FNHA 4ZJLA 3DLBA 3P45B 3CC2S 1XNRF 1FRIA 2PEBA 3CDWA 5LJ5Y 4IYQA 4TN2A 1M1HA 1C2PA 3EZOA 3HPOA 1YGYA 2IRYA 3QGGA 2CRLA 1JJCB 1Q1KA 2Z30B 1F2HA 1VOMA 2AYEA 4Y2IA 2V68A 1G3OA 1OYEA 1UJ5A 2MYFA 4N8OA 4ETXA 4JB8B 3G9CA 2GJ2A 3W3SA 2NZ4A 5C2GA 4RW8B 1TAUA 3J7YU 2OLWA 1JLBB 2VPXB 4B3SJ 3OT9A 3P6YC 1OMSA 5BJRA 2SXLA 2M4MA 2F3JA 5J2PB 1U6ZA 3E01B 3H98A 2U1AA 4IG3A 2MPUA 2RDIA 4R25A 4YFUA 3MAHA 4I4BA 5KFGA 2J0QD 1QE1B 3KLHB 3MUVP 2CFXA 3PYDA 3EVMA 2FUG9 1HARA 3DI6B 2HIQA 4BBYA 4FBTA 2IVYA 2K8GA 3CCMS 4ED6A 2ZHOA 3H5UA 5KFIA 3QRPA 3R5DA 5A8RB 5CCLA 4LF5F 2Z0GA 3NS6A 6FD1A 1VMBA 2UZAA 4RW4B 3UVJB 5KFYA 5EWGA 3RB4A 5AXMA 4M63A 4P6QA 5KFTA 2HWIA 2E1MC 5C25B 4Q44A 4QWEA 2EFGA 3M8ZA 4USIA 3D3BJ 3QT8A 2G1DA 3MF5A 3P5TL 3CULA 2B3TB 4FS1A 1NPPA 8AT1B 2HLUA 4OHXA 1S1UB 2EFPA 5KG1A 4XPEA 3VAIA 4YN3B 1XBWA 2L08A 2CPZA 2XG8A 3G2XA 5B0EA 3VV2B 4X66J 1JMTA 3OW2R 3BQ0A 4DR1F 1BE4A 1CC8A 1WI8A 1HWJA 3S1TA 2DGOA 4Y2KA 1VBKA 4FXDA 1RJJA 3MEDB 4I7FA 4AE5A 2HHWA 3SMZA 3IR6B 3OR1B 3EXCX 4USKA 4WU2A 3VCDA 1VQPS 1RHRB 1TFYA 4I67A 4L74A 3RRKA 3M6XA 3K5MA 2HFNA 3LP0B 3PRVA 2AIRB 1FTRA 2FYXA 2Y1RI 2MZJA 1X4HA 2ZUAA 2GGPB 3PFEA 4UOFA 4RNNA 5KFJA 2KFYA 1RTDB 1U6BA 4OLOA 3IWNC 1TR0A 2ADBA 3K89A 1NNDA 2KM8C 3CCJS 4OI0A 1PYOB 5KFAA 2HK2A 1RHUB 3FBBA 1E6VA 2EEYA 3P5BP 3T1YF 3HO1A 3R97A 2XO7A 4LF8J 1X9SA 1GNKA 1FHTA 4RNHA 2IJRA 3A3NB 1SUQA 1WC4A 2CQPA 4F50A 2J76E 3AA8A 2J7UA 4KGKA 2AX0A 3I96A 4ZPBA 4QQBA 2DNGA 5L1LA 1M90T 1J5OB 1VLOA 2BOAA 3FKBA 2E29A 3UPFA 2LP4A 1DQ9A 1KQGB 2GZOA 4ELVA 3K58A 2QSWA 1DTTA 1RQ0A 4QYZK 1D1UA 3RGIA 1RT6A 5K14A 5KT7A 3EDQB 3HJFA 3ITHA 4LFAF 1RWKB 3SI8A 5AE2A 2NSBA 5KT5A 3RB3A 2DCLA 3IA0A 3MXHP 3CJSA 3IG1A 2FJEB 4FDFA 4B9VA 3HMJG 2XCAA 2M52A 4U9RA 5KFZA 3EGWB 3DLEB 2AWZA 4JBCA 2KKHA 1FRKA 3CJKA 3AQPA 5GADU 4DFKA 1HQUA 1ZA1B 2QFIA 3BPDA 2GCFA 9ATCB 3A8KA 1EKSA 2COLA 3K5PA 4G65A 3ZFVA 3V6JA 1ZM9A 1TL1A 3M9OB 3OBIA 5HAOA 4OHZA 1JLCB 3BN4A 3RU0A 2EI5A 5I3UA 2NR0A 4Q43A 3GJTB 5KG3A 4KKOB 2EKYA 4DHVA 2YXLA 4JYAF 3L7UA 3D7SB 1VS3A 1S0VA 2JL9A 3CD5A 2VC1A 5KAKA 2B4UA 4DV3J
chains in the Genus database with same CATH topology
1Z1ZA 2APOA 2CQ4A 1S0OA 3FCHA 2FJXA 2KI2A 1MMNA 3HF5A 4DG1A 2BE2A 3KLGB 1VBXA 2HG4A 1RTIA 1ROFA 2HAIA 4BWJA 1NHUA 3LAMA 2DNZA 2G13A 3DXSX 2MY7A 4LJMA 1N5VA 2BQRA 1LXJA 2KXFA 3GZ7A 4DR6F 2X1FA 2F7VA 2EW9A 3C6UB 2CDQA 1KC8T 1WHVA 1HBOA 2OSQA 5KG7A 2R8IA 1JNZB 2QZ8A 4NRTA 1S4FA 4TLQA 2J0WA 2CJBA 2W9BB 3LP1A 3RW6A 2K7JA 2CPJA 2I2YA 3CD7A 4K4ZA 4TU8A 2F40A 2PD1A 3QZ7A 1LQ9A 4C4WA 4HKQA 1DURA 1VRUB 2C3PA 1TKDA 1JLGB 4YB6A 5DDQC 4C0BA 3DRRB 2RS2A 2DGXA 2QLWA 3K59A 5K8MA 4O3RA 2EBEA 3TA2A 1JLBA 3O1LA 1RT5B 3N28A 4C97A 5HO4A 4MKYA 3RYLA 3V5RA 5DDOC 4MIBA 4UOCA 3OTDA 3KHLA 3NAHA 5KFMA 3OTOF 1U1RA 1JXEA 4V19X 3DYAA 3MM8A 5FDLB 2W4CA 4B9TA 3MD3A 1MNEA 4A46A 3CT9A 1Y5NB 2LXIA 3TP2A 4ZCMA 4X64F 1SH2A 4Q45A 2YKMB 2EBGA 4JI2F 5LSLA 1T8EA 2BUNA 1RKIA 5BR8F 1ZZNA 4ILMA 3H2LA 1BY9A 5KFRA 2ZBCA 4AFFA 4E0DA 5C42A 2KXNB 2YKOA 2WHOA 1YG0A 4F2SA 3CJKB 4ED8A 4RW6B 4ECUA 5B08A 4ES2A 1GX6A 3ETOA 1YRXA 3D0HE 3NKYA 1O5JA 2V4JB 3M9NB 4HT5A 3GR0A 3GILA 1N33F 2DPIA 3PIPQ 4OX6A 2VUGA 1UVMA 4N41A 2IM2A 1W2BR 1ZPVA 3UFCX 2R2UA 3SDEA 2LEBA 3OHAA 4I0WA 3M8RA 3OXGA 3SQGA 1M0SA 2ZDPA 1MU2B 3CDEA 3IWXA 4X4QA 2FC8A 3GG1A 1XMQF 5LJ3Y 2D41A 2FJDB 1HBUB 3OVSA 4WXWA 1X4DA 2RKIA 3UQSA 1YSJA 4DFMA 4C8MA 5KOWA 2FLOA 2XNRA 4MIAA 5EDWA 2NPFA 1MWYA 3C6UA 4J9RA 2N7CA 3KK1A 4B3TF 2VASA 3DRPB 3S6EA 3JTPA 2DH8A 2GGPA 4K59A 4ZA1A 2W9BA 2DD8S 3LF0A 2GX8A 7FD1A 2FY1A 3BEGB 2XZWA 1QUPA 1VFJA 3M2UA 4ES3A 3G8SA 2VFRA 2DNLA 3ZC4A 1S1TA 2AYGA 1KFDA 3FFIB 3AJ2A 1QAXA 1JJ4A 2V4QA 3GQCA 2LCWA 4KO0B 2R2RA 3FJ2A 5SZTA 1I6JA 2ABYA 1RT4B 1RGVA 5GMKa 1KSPA 3CO9A 3C6TB 4C8LA 5HROA 3CD6S 1LW2B 3LWMA 2OD6A 4FF2A 1S0NA 3TVKA 3PY8A 1FEEA 1N32F 1SJFA 1FKAF 4OZ0A 5B0AA 4NLRA 2ROPA 4OX8A 3JSMB 4ZMMA 3L95X 4Q8FA 5F8LA 2CJAA 3ULHA 4QR2A 3ICLA 4DQSA 3IG1B 4D3HA 2X1GA 1CC7A 1S10A 1YJVA 3SFGA 5A8WB 1X9MA 1UVLA 2H9ZA 5J2NA 4JI0F 2YKMA 5KT2A 1DHMA 3C8YA 2V2KA 3DLEA 3SSSA 4ZHRA 1Y5LB 1S6PA 3PVXA 2OH2A 1FTCA 3M32A 4DV4F 4LSNA 5J2QA 1SJ4P 1VRTB 2O3DA 3EGNA 3OFFA 2M7SA 4ZP9A 1VQMS 5CYJA 1D0EA 1QLNA 2B9YA 1D9FA 1JLQA 2IA6A 3BDEA 2A2DA 4DQRA 2YNHB 1RA7A 4TKTA 2DNMA 3HHKA 2R7QA 4JI4F 2R7VA 3HXMA 1JNRB 3T1AA 2HQ3A 4BHQA 1D8ZA 3KK3A 1HL6A 2KU7A 2YWFA 3PEHA 4O4GB 4EBCA 3MR2A 2ADCA 4V19J 3QAEA 1HBOB 3DXBA 1MMDA 2Y0SD 3LH2S 3T3FA 4NZ0A 2FVQA 1IKYA 3NMAA 3UE2A 1EP4A 3PW7A 4K50A 4QIFA 2RKIB 1KFSA 4H4KC 2HS4A 4PQAA 1HMVB 4C2MA 1UP1A 3KLVA 2VQFF 1FDAA 3VAFA 2R7XA 3WC0A 2CQDA 5E5NA 4J9QA 1JX4A 3I0RB 1HBMA 1FRLA 2VD3A 1YJUA 2JRSA 2HWTA 2E9ZA 2JJ4D 4ZDNA 5LSRA 1J5EF 2QMXA 4TU7A 3C2PA 1LK7A 1TL3B 4I6AA 2CQIA 3BSOA 2CQ3A 1GH8A 4NA1A 4ITSA 4BC7A 2Y1IA 4EO6A 3K5OA 2RQCA 2I5JB 2LEAA 1ZAVA 2B56A 4OX7A 1IM4A 1LFPA 3L3CA 4WYWA 2OPPB 2YNIB 2XEXA 4AUKA 3VAKA 5BYRA 2BM0A 3M2UB 2PC6A 3V6DB 3DM2A 1DBDA 4BS2A 4C11A 1RI7A 1LFWA 1M1KT 3CC7S 2J0SD 4B3OB 5CXTA 3UD3P 5KFEA 4I68A 3CUNA 2JSXA 5BYSA 3H20A 2DT9A 1A7GE 5E41A 4C8KA 1FVQA 3MPWA 1OPZA 5L1JA 4DF8A 2JFDA 4WFXA 5B7WA 4F3OA 5D4PA 3N0VA 4DL6A 4R5PA 1J5OA 4QBUA 2I38A 4MK8A 2B5JA 2IC3A 1OSCA 3MTJA 1BQNB 2HMIA 1AFIA 1UFLA 1SH0A 3KNAA 2BOPA 1CPZA 2RD5C 4P2SA 2HHQA 2D3UA 1T05B 1VRTA 4DR4F 4XPCA 1RT7A 4OJHA 1KTVA 4LQ9A 4LF8F 2CQ0A 2NUHA 3TAMA 4YOEA 5M2PA 4C8YA 5J2NB 5JXSA 2MQLA 4U7UK 1JLFB 5HMYA 4X66F 2I1RA 2F8HA 3HVRA 3GYXB 3BO3A 1FK9A 4ECVA 5J2QB 1RTJA 4NZ7A 1M5HA 1S6QB 1C0UA 1SJQA 1OWXA 2BA9A 3SEOA 4EEYA 3N6NA 3GIJA 2IHR1 2K2PA 4HLBA 3BSAA 4OZLA 1FDDA 1Q79A 1NK9A 3GV7B 1N36F 2UXDF 1RTIB 2W4DA 2R4FA 4CO1A 1L5UA 2AV5A 4I7FB 4OJ3A 4OI1A 4ZPDA 4O3OA 4M1KA 2HPUA 4RUAA 2OPSB 1N6QA 4J9LA 1ZAXA 2RT3A 3DMJA 2ILYA 3PM9A 2ZD1A 5I3PA 4BDPA 1OSDA 4IRKA 4DV6F 1B0VA 4QR1A 2CKWA 1O8BA 3NP5A 2N3OA 1VK3A 2VFUA 2AJ1A 4BCAA 4CQ1A 4QWAA 2NZ4A 4OL8A 1N0VC 2OPQA 1NK6A 1HQUB 2WSFC 2QEXS 1VRUA 1VI7A 2EPIA 3IR5B 4X4VA 4EUVA 4KAIA 1HD1A 4USHA 3RW7A 3G96A 2FGOA 4C8ZA 3PW4A 4RLEA 3EPIA 2NLWA 1WNEA 1T95A 4LUBA 5AXKA 3UDLA 5J2PA 3NMRA 2M2BA 1U2RA 3PW2A 4RW8A 1FNOA 1IR0A 1S9GB 1X4BA 1XK8A 3U1LA 1NKEA 1SC6A 2YKAA 4Q8EA 2IRUA 3HHDA 4EYIB 4F4ZA 1HNWF 3OL9A 4TU9A 1KOHA 3N9UC 4DL0C 3SYZA 3H25A 1UEUA 3N79A 4IDKA 4TQRA 1LKZA 2RQMA 2DVIA 5FD1A 4JI3F 3TO8A 5B09A 3DRSB 2WB1D 4GKJF 1Q78A 2MKHA 2KJVA 2JLEA 2QLXA 2MKJA 4ICLA 3CCRS 3ZZUA 2VG6B 1PGZA 5IZHA 2PMHA 2QA4S 3FQLA 2ZNZA 2BANB 2N3LA 2OKQA 1C0TB 1FXRA 5F8GA 1U25A 4HYKA 4DL2A 4B9SA 1LW0A 1FKOB 2HRYA 2MZTA 3HMJG 3Q0AA 3MI7X 4HT7A 2WBRA 3LUYA 5A6WA 2GQQA 3CGIA 1DZ5A 1V9OA 1WG1A 2FTRA 1HFEL 1SXLA 4P7VA 1VQ9S 3DHXA 1JLEA 5B0GA 3ZZZA 3KMSA 1HW8A 2UVWA 3DHWC 1N5TA 4IFYA 1Y4ZB 3I0SA 3B4MA 2P9CA 1GXTA 2VA2A 1NRKA 2CPEA 2GA7A 3BQ1A 1SH3A 4ZVEA 2BJDA 2DK2A 2IFXA 4PPZA 3DCAA 1X9WA 2NQPA 3PKYA 2YKNB 3CVKA 2I0XA 4AL7A 4K4SA 1JLGA 5DJBA 1SUQB 2ZFHA 4ID8A 2GIRA 4EBEA 1VQ5S 3C3LA 5DRKA 5G0RB 1U48A 1XN9A 3A8EA 3UCUP 4ED2A 4EWTA 2WTFA 3MPVA 2AJ0A 5T7LA 5T7LB 3HHNB 4DDFA 4A47A 1YJRA 3HVTA 3I9V9 1X0FA 1SBRA 2R9LA 2C3MA 2CZVC 2R2TA 5HBMB 1ZOTA 1QVGR 3DDKA 4EZ9A 3U1MA 1UA1A 3NNHA 5KG2A 2IMOA 2UUBF 2E7WA 3QIPA 3MR6A 3DOMA 2VB6A 1VLYA 4IUFA 3P96A 2V4JA 4WTYA 2CPHA 1MROB 2JWNA 1DLOA 3UNGC 1R0AB 2RJZA 2NUUG 3RB6A 1REVA 2HQIA 2K3IA 3KLFA 2CQCA 4GO7X 4ECWA 1U49A 2UUAF 2DH7A 2HVZA 4QYZJ 4BWMA 3CDUA 3N5FA 4N76A 5IS2A 3NWGA 5EX0A 2MQPA 4LF7F 1K9MT 4MTPA 3RZAA 1VQOS 2PSZA 4F26A 2FLPA 3DRSA 1HWIA 5A8RA 3ZZPA 4UY85 1GTHA 2G9OA 4RKUC 4O44B 2DHGA 2XLIA 1C4CA 1VIXA 1D9DA 4IQMA 4NA2A 1TL1B 4ALZA 3OLAA 2L41A 2HHHF 5DLFA 2AP6A 5DS7A 2IM1A 1WACA 4PG4A 4JOUA 2B4OA 3UI3A 5K8NA 2Q6BA 1SIWB 5E3RA 4Y6IA 3O44A 5KFOA 3IRWP 1FD8A 3MM6B 3V4IA 3MM7B 1TKTA 3MMJA 3PW0A 1G1XA 3DN9A 1S0MA 2WK4A 4OZNA 2AW0A 2WONB 4H4OB 2RQKA 3THTA 5CD4H 1GX5A 3JSYA 1Y00A 1BQNA 3MZIA 1RT3A 4DQPA 3GFYA 3CSKA 3M30B 1A9NB 1P8GA 2B9WA 3G6XA 2J9DA 3DLLQ 1KNZA 4AXJA 3J81Y 3BR9A 1HPZA 1IN0A 1TKXA 2VG7B 4K5RA 3SZ2A 2GO8A 1V3SA 3TUZC 2X1BA 1XNQF 2IVFB 2VOPA 4YUDA 1UVNA 4QWCA 2YWGA 3BZQA 5G0RA 2WRMA 2EVZA 4I2PB 4RNFA 2ZJRQ 1LWCB 1H6KX 3T6JA 1QSLA 4TYAA 4X4NA 3I56S 3C46A 3HZEA 4OJ1A 3CF5Q 2L9NA 2BACA 1XEZA 5F8MA 2XGPA 2B43A 3ZZ0A 4JI6F 4F4WA 2I5JA 2RVJA 5KFNA 2C42A 3OL6A 1TK0A 3LP0A 4A8FA 2P9EA 4CO3A 1Q8IA 1BLUA 2UV8A 5KG5A 3CMAS 3HZGA 2XMWA 3KLIB 2R7RA 1CQNA 2BDPA 4KFBB 2ZD1B 2KM8B 1UJ4A 2QO3A 3THVA 2XHWA 1NH8A 2EFNA 2B0GA 1DRZA 1YBAA 4FVMA 3NNCA 1SI9A 3MOZA 4DBQA 3KJVB 4F3QA 3AJ1A 2VBZA 3Q22A 4WFAQ 4B9UA 1F9FA 2QSFA 1NK4A 5CZXA 1U1QA 1SKWA 5C42B 4QR0A 4MKAA 4QIGA 3TR5A 3PNIA 2R7SA 1BC6A 4YR2A 1TV6A 3M6WA 4BC9A 2RS8A 4ELUA 1LWFB 2XY7A 3H5XA 2ZDOA 3PJWA 1N88A 3RBEA 4F4YA 4IFVA 1FK9B 3ZZOA 1T05A 2J9EA 2RU3A 2W24A 3JSBA 3OL7A 1RT1B 2HNZB 4ED0A 1WTFA 4TLRA 2DR7A 2AGOA 3VQSA 4DR5F 3TAMB 2MKKA 4LF9F 3H4DA 2UUTA 4FF3A 2ZZNA 1Q82T 3WBZA 3MECA 4DV0F 3MM7A 2V8HA 3MM6A 4P7TA 1P27B 3V4IB 2FPHX 4AL5A 1RTHB 4HDHA 2J7WA 2XBPA 4RUCA 2E5GA 1IKWA 1S9EB 1TKZA 4UUXA 2M70A 4TQSA 4DSKA 4DV2F 1WI6A 1N5YA 2CIMA 3DU5A 4RW7A 2HHSA 4LVOP 7FDRA 3W2WA 2PE8A 3LP1B 4ETZA 1I94F 4IOAQ 4JV5F 2FB0A 1GAOA 2N4DA 3BQ2A 2W9AA 3IRXB 5A0YA 3EZUA 5KFVA 2MY8A 4UW2A 2MGZA 2RQ4A 3VZHA 3MEDA 1X5TA 2MZRA 4DR3F 4KT0C 1KVJA