4DUZF

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome/antibiotic
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4duzF00
4DV0F 2UXBF 4DV4F 1HNWF 4JI7F 4JI0F 1G1XA 4K0KF 2B7CB 4JI6F 4NXMF 4KHPF 3ZZPA 2UUAF 4DR5F 4B3RF 4JI5F 1CQMA 4B3MF 4JI2F 2UUBF 2J5AA 4DUYF 1XMQF 4DUZF 4DV7F 1FKAF 2B7BB 4JI4F 4JYAF 1IJFB 1I94F 5LMNF 3R3TA 4YY3F 4LF6F 5LMUF 2KJVA 4JI3F 1XNRF 4LF4F 1QJHA 4DV6F 1J5EF 4X64F 4DR1F 2BXJA 1HNZF 1VMBA 4DR4F 1N32F 4LF7F 1IJEB 1B64A 4DR7F 4X62F 2VQEF 1IBLF 1GH8A 4LF9F 4AQYF 4LF8F 2UXCF 4GKKF 2VQFF 1IBMF 1XNQF 2RJZA 4B3SF 1LOUA 2KJWA 1N33F 4JI8F 2BVZA 4LF5F 2E5LF 2YY3A 4LFBF 4JV5F 4GKJF 2ZM6F 4X65F 4LFAF 4OX9F 1IBKF 4X66F 4JI1F 4YHHF 4DV5F 2UU9F 3OTOF 1N34F 3T1YF 1RISA 4LFCF 1N36F 1CQNA 4DV2F 5AJ3F 5IWAF 4DR3F 4B3TF 1HR0F 4DV1F 4NXNF 4DV3F 1XMOF 2F4VF 3T1HF 2HHHF 1G7CB 5BR8F 4DR2F 2UXDF 1F60B 4DR6F 1HNXF 1FJGF 2UUCF
chains in the Genus database with same CATH superfamily
3KG4A 4Q7AA 3AY0A 1N88A 3K5LA 3MR5A 1LWCB 2V2KA 4WKRA 4LUBA 4RW6A 4RW9A 2LA6A 3K59A 2HK3A 1U1RA 3I5CA 3BPSP 3VGUA 3FGVA 1U45A 1FKAF 1B3TA 1HHQA 4NLOA 5A0YA 4OIXA 5LMUF 2J9CA 2PO4A 4KSEB 2DGUA 2L9DA 5CH7B 1S76D 2B5JA 1MNEA 3BB5A 4MK8A 4B9VA 2YY3A 2CQIA 4BCAA 3NGRA 2AJ2A 5G0RA 4UUWA 2IC3B 2MQPA 2F63A 3QSIA 1MU2A 2UUCJ 1S1WB 2V6AA 2IRXA 2W8KA 3G9CA 1RYSA 3HP6A 5AT1B 4ZPTR 2EFGA 1H2TZ 4MIWA 1TUVA 2KO1A 2MHEA 1S9EA 4WP3A 4JBCA 5KFLA 5LSLA 2BKOA 1HNWF 1KR4A 3MTKA 1VHIA 4JUZA 5F8HA 4EFAC 3SCJE 5M2PA 4YDXA 1H74A 1I1GA 3DKDA 4PXBA 2KJVA 1XNRF 2ZJPQ 2GNKA 2QA2A 1TL3B 3MCSA 3GIMA 1NH8A 1N48A 1DJ0A 1BQMA 2HHWA 4MH8A 2V8DA 4FP9A 2PSZA 5T41A 3ZTSA 1AZSA 5DG8A 4FF2A 1S12A 3RBDA 3LQVA 2A6OA 3FRYA 1PCAA 4A4JA 3I0SA 3BN7A 3BEGB 1M90T 1X5SA 2RF2B 1S1TB 2V63A 2D74B 2KL8A 2X1BA 1HFEL 1P8GA 1JLGB 4KJIA 2A2CA 1S5ZA 5J2QA 2V9WA 1HW9A 4CLPA 4WK1A 3L9ZA 3PXGa 4WWSA 2MQLA 1RQ0A 2I6WA 1ZPVA 1AXQA 4PXEA 5EX3A 5DZ7A 2XBPA 1FWKA 1LK5A 2HNZB 1UEKA 1KKHA 3GILA 2LEBA 1PGZA 4J9KA 1NK0A 3U02A 4QR1A 2YNGA 4XDCA 5KFIA 3KDOA 4E8UA 4AQYJ 1NH7A 5IXUA 2B4PA 2E5LJ 3MM5A 2QA4S 3ILIA 4TU9A 3UR0A 3TX8A 2IVFB 1N8RT 3OUYA 4DPXA 1M1GA 2FLPA 2QYCA 1RU1A 3HFKA 4H4MA 1R43A 5ADZA 3GIKA 1R0CB 1RISA 1TELA 4CRJA 5C2GA 4Y2IA 1KQGB 2CJAA 3GFZA 3JYTA 5CQGA 4DV0J 1JLQB 2U2FA 4BWMA 2ALZA 2DNOA 2XMKA 2CUYA 2DR6A 2D3OR 4RU2A 4O3RA 1KOHA 3W5XA 5KG2A 2DNHA 3CCQS 1VQMS 3W7BA 2BV3A 3QYYA 1M5VC 4ZKAA 4U95A 1X0PA 4CO1A 2HURA 1T03A 2Y8WA 2W9BA 5KOWA 4IRKA 1S9GB 4JI4F 1IKYB 2BKPA 1C4CA 5LMNF 3JSMA 5D8HB 3MAAA 3RB0A 3R7NB 4IUFA 3IWNC 2B56A 2RIJA 3VV2B 2B6AB 2B9YA 3CD0A 2XO7A 2GQQA 2B9EA 3CIZA 3U1NA 4ECTA 2HBZB 2WSCC 2LFVA 3M8QA 3QZ7A 2NXNA 5HJYA 3P3DA 5B0GA 3TRGA 2AJ0A 4H4OA 1VQNS 1U4BA 1OYDA 2A18A 2JJ4D 1G4CA 4J9RA 1EP4A 2A10A 5DQHA 1QTMA 4DG1A 1I6JA 2FLNA 2CPHA 3PFOA 1OJ4A 1KFSA 3QJJA 2R7QA 3DU6A 2HAIA 2KG0A 3KLIB 4DQSA 4FXDA 1R7IA 1SKRA 4OJ1A 3TJ8A 2BQ3A 4J9QA 4RPFA 2DNYA 5H9FJ 3BO2A 3M2UA 1PILA 2YPYA 1O0PA 2OPSB 1DQ9A 1PAUB 3OTBA 3EZUA 5KFGA 2PGCA 2W7OA 3IS9A 1WC6A 3R5GA 1XBWA 4B3SJ 4WFZA 3C15B 1B0VA 2WK4A 1S9FA 1FX4A 3V81A 4JI8F 5IT0A 1U7LA 2QZ8A 3R5AA 2CQ1A 2ZKTA 1XMOJ 1KVIA 3THPA 3GPAA 4KE5A 1UJ5A 2WVBA 3K58A 1U49A 5KG7A 5H9EK 2E9ZA 3SQGA 2DTJA 1SL0A 2AEJA 4NLYA 3H5XA 3MCNA 5M2UA 3KK3B 5KFAA 2CQHA 5CD4A 4ZLJA 4MK7A 5KAKA 1TQLA 5GADU 3HVTB 3NAIA 4FNIA 3LGNA 2KZMA 3KUGA 3H5YA 1TL7A 2E44A 1XMQF 1UJ6A 1BQNB 2R8IA 4K4TA 4KO0B 2R7UA 4YY3F 1RI7A 2GJIA 3QWPA 3CCVS 3HSGA 1VGYA 4OZNA 4DR4F 3DLHA 3FJ2A 2MQNA 3OHBA 1CS4A 3GTYX 4LFBJ 2VDHA 1YJUA 3BM7A 4F02A 2GMLA 5JUMA 4FYWB 4CO3A 2XWXA 4QWAA 3JAMU 1S6PA 1WG1A 3M8ZA 3PR5B 1RAFB 4DPWA 1HNVA 3H8YA 1HPZB 2PDAA 1EQ0A 3CC7S 2OPRA 4FVMA 4A46A 1OSCA 2JVRA 1NRKA 3GV8B 5IQQA 3I5BA 4B9UA 2DNGA 3KNAA 1BHNA 3UNGC 4J9PA 1UETA 3MAHA 1S6QB 2V69A 3OXFA 3DRPA 1NDCA 4OFZA 3D1OA 4ZN1A 5K8PA 1NSKL 2XS5A 1RZMA 3TVZA 3QJLA 3B6BA 2DR8A 4B3RF 7AT1B 1HW8A 1MWZA 4U7CA 5KFVA 3AT1B 3PRBA 2DNQA 3ULHA 3V6JA 2F65A 4KFBA 1M1HA 4KIAA 4OYOA 3R2CJ 1L3UA 2LQ8A 4NZ6A 3RB6A 4YY3J 1JLCB 2BQUA 3CULA 3DRSB 4PG7A 4QBUA 1TL4A 1S0OA 1SB6A 4LF5F 2QA1A 3I5AA 2QLWA 5H1SV 3KK2B 4G1IA 1DQAA 4CO5A 4A8OA 2R3VA 5JVHQ 3M30A 2MZJA 1WORA 1TK0A 4HKQA 1W2IA 1OS5A 2O5DA 2AJ1A 5HMXA 2BJEA 3CDUA 4AXIA 1HBMA 4NLDA 5HBMA 4MAKA 3PX6A 3DOLB 3CO9A 4I2PA 4NLUA 2NYIA 2RSQA 4L75A 3DLEB 2XYPB 3MFIA 4DR5F 1H0HB 3PJWA 2V67A 3CJ0A 1VQOS 2BJ3A 3H25A 2Q79A 1LK7A 2QFJA 3ISZA 3GG1A 3CJKA 1R0AB 4ED3A 3HT3A 4HL9A 1IQZA 1REGX 2HNDA 4WXWA 2RDJA 3Q8PB 1ZTTA 2WONB 7FD1A 4CLWA 3IWLA 4LRCA 2KTQA 2HW3A 4A8YA 2RU9A 3KLEA 1RWPB 4I68A 2LKZA 1UMJA 3LA0A 1Z2ZA 2EKYA 1WDTA 3BKUA 3BSCA 2LXFA 3TW0A 1RK8A 4GC6A 5D0GA 4PWDA 1G3OA 4OX7A 2ASYA 1Y5IB 5L46A 5F8GA 5GAHU 5D3GB 3UNYA 4GMKA 1BXNA 1FWPA 1YRTA 1U2CA 3N0VA 3V6HA 1Q8BA 2RHSB 1RP5A 4O3QA 1QD1A 2XZDB 3T41A 5IV4A 2GA7A 5HL7Q 5D4OA 3HMJG 2YKNA 1S1UB 3TX0A 4DZ6A 1Y00A 4M1KA 3W1YC 2EC2A 2R2UA 3UDCA 3FKBA 3TNVA 1RTDB 3TEGA 5J1EB 3P8BB 1IJEB 1KBRA 1BUXA 2V50A 2E5IA 2ZH2A 3X1LB 4P2SA 3CCMS 4KAIA 3IN5A 1K1SA 2WSEC 3K2YA 1ZA2B 5E2QA 4CM2A 2C2NA 4JV5F 3PX0A 5IWAJ 3J7AN 2PMWA 4HDHA 4EEYA 4K4SA 3GR0A 3I6PA 2ZBRA 1SCJB 1WKLA 2DNZA 4WBFA 3HJFA 3KLVA 4DV4J 3ENQA 3QSYB 1RSCA 3EPIA 2AMCB 1XK8A 2CJ9A 4CNZA 3SYZA 1T7PA 3MUVP 4LR8A 2HMIA 1CULA 1FE0A 1NJXA 3OR1A 1X4DA 4TXSA 4DUZJ 1IQTA 3C3LA 3W2WA 1RYRA 3B54A 3NAHA 2HK2A 1EARA 4USHA 3QIPB 5HK4A 4C0OC 4JB8B 2PEHA 2NR0A 2J9DA 1CJUA 2ZHOA 3K57A 4O44B 3R5DA 4QU7A 1U1MA 2OD6A 1RT3A 2AWZA 3GR1A 5F8IA 4ZVPB 1ZA1B 1S59A 4KRWA 1PJ5A 5IT9Y 3VR1A 2IA0A 3MUMP 2BW2A 2L08A 2XQCA 3LTOA 3HZEA 3EM1A 1YG0A 3CWJA 4X65F 3ILLA 4IH6A 4FKYA 3MD1A 1GQEA 2RS2A 2OSRA 3GFHA 4JV5J 5LJ3Y 1WACA 4LFCF 4K59A 3RR8A 3QJPA 4B3OA 4WKYA 2ZITA 1VBXA 3D6MB 2F8EX 5A6PA 3I87A 1RBAA 1S1XA 4U8VA 1S1VB 2GMJA 4QOTA 2GAGC 1YX2A 3UVJA 5HROA 3GIIA 2IJFA 1WC4A 3G82A 2GGPA 1N0VC 3DYAA 3MR7A 5HMWA 5J2NA 4IRDA 2DD8S 5DM7Q 5HVGA 1Q5VA 3BBFA 4PAAA 3EDQB 4PABA 2EK1A 2GX8A 1NDPA 5C25A 4B9MA 3J7A1 3LUYA 3G8QA 4RW8A 4FS2A 4PYDA 1IR1A 1IWGA 1D8YA 2R2TA 4IG0A 2LU2A 2HGLA 4DMZA 1LW0B 4LQ9A 2K3IA 2NQPA 4C8NA 1WSVA 4JV0A 2PIIA 1SXLA 3J81j 3TEHB 2I0XA 1VC6A 2MXYA 4HTJA 2F4VJ 2KVQE 1KWMA 4PUOA 1XERA 2CZ4A 2CQGA 2ZH7A 3DGPB 4JV2A 1QSYA 3ZTQA 4LRDA 4HHHA 4FXVA 1HNXF 3SV3A 1Y3KA 2YWWA 1N6QB 3GU0A 4IFVB 4ZK7M 1G1XA 3IM9A 4F3MA 1L3TA 1R8AA 3AD9C 2UUBF 1E6YA 1VDHA 5A8KB 2ZE2A 3ZZRA 4LBIA 2Y0SD 4DR1J 3AJ2A 3DU5A 2NXCA 3LOUA 2AP6A 1XN9A 1KEKA 4DN9A 2KI2A 1B64A 1HWJA 3U1LA 2R4FA 4FF3A 5KFOA 2CZVC 4DPOA 5F8JA 3VCDA 1VBZA 4DSIA 3M1VB 2H9ZA 4W90B 3DDNA 4HDGA 3I0RA 3EPGA 1PIEA 3M8WA 2BE2B 2FGOA 3G8TA 1NK7A 4DL5A 3M2RB 3MPYA 4ILMA 2GZOA 2FJDB 2DGOA 4K2JA 2GS8A 1Y7PA 2MQ8A 4AL5A 4XK8C 3MMAB 4QR2A 1UVJA 1NB2A 2QLJB 1S6UA 4I6YA 1IKVA 2VKRA 1Q53A 4IFYB 1JQGA 4W4MA 1RAJA 1WC3A 1V9OA 3O3LA 2PI5A 4KC5A 4FF1A 1NMEB 3SMZA 3ENWA 4A8WA 2VQEJ 5C24B 1IBLJ 1DTTB 2JFDA 1D9DA 1RT6A 3J7YI 3W9IA 1KLMB 1QAXA 4MK9A 3PACA 2HBRB 2YPZA 1KTQA 2UZAA 1JJHA 2W2OP 3K8WA 2XY5A 2ZNYA 3R9LA 4FF4A 3VWSA 4NEYA 5KFKA 3AQOA 1WHYA 2HVHA 1N36F 5M2RA 4OJHA 2HZVA 4RNNA 3R8YA 2MZSA 1N4LA 2VG7B 4PKDB 3M4XA 1ZPWX 4IDKA 4ANCA 4ZP8A 3HHKA 3FFIB 2BBEA 1S99A 1XR7A 3FEXB 4M5KA 2KH9A 4F4WA 4OI6A 2Z4PA 1KLNA 2HHVA 5B0FA 2WBMA 2J8SA 5J2PA 5HP1B 3T6JA 3NKYA 4HI1A 4F04B 4FVCA 4X84A 2IJNA 4KKOB 3DLGB 5EWFA 2MQMA 3Q22A 1URRA 4RR5A 2UXCJ 3MFHA 1Q7LB 2EW9A 4FN5A 2DGXA 4W98A 3P4UB 1VQ8S 2IY5B 1NK9A 2FDNA 2DCUB 5HVHA 1H72C 3CJSA 4Z7YA 1F0XA 4NCGA 1XMBA 1FJ7A 3MAQA 3N4WA 2FTRA 4KHMA 4CLSA 2ZD1A 4DSKA 1F9EB 3DLJA 4TY8B 1QE1B 2HGMA 4QIWD 3OL9A 3DOKA 3IM8A 2H4YB 4P75A 4CLYA 1JKHB 3FCHA 5C7PA 4C8MA 3IMQJ 1RAOA 1TTHB 3B8HA 3M9MB 4F7VA 2KFYA 4Y34A 1O51A 3GCWP 2K2PA 3SSSA 1UEUA 3BGRA 2M70A 5DDQC 4CT8A 3BDEA 4CTAA 1HBOA 5GMEA 2M9KA 3CCES 1T9VA 1U24A 5KFSA 1KD1T 4A48A 3IGNA 4LF8J 2VFRA 4OHVA 3BGFA 2HRTA 5LSRA 3RRHA 3LH2S 3FC9A 1HI0P 4AE5A 1V3SA 4CLKA 1IVZA 5KFMA 5I3PA 1UVKA 3L4BC 1NDKA 5HSPA 1U1LA 5MAOA 3S8SA 4F4ZA 3IA0A 1V5IB 2AD9A 3PO4A 3KLFB 4O3NA 2BJ8A 3UDVA 2AGPA 2MY7A 4JI7J 4DBQA 2VPWB 2NLWA 4OHXA 4O3SA 2L41A 2MQOA 1FO1A 2AEMA 4IQMA 3QAUA 3SFUA 3NGSA 4A8KA 1OPZA 2R7RA 3DGVA 3QFHA 3PJ9A 2VV5A 1FKPB 1LWFB 4ZP6A 5DG9A 3WX4A 3PYEA 3ZZ0A 4DUYF 4XAKA 1U48A 4MFBB 4C8ZA 1VRUB 6FDRA 3NL0A 2AGQA 4X62J 2B3TB 2M5YA 2V9KA 3PVXA 5J2MB 3ET6B 1SJQA 3M9OB 4C3KA 1Y11A 1GX6A 4ZLNA 2GO8A 3PW0A 3I55S 2Z0GA 3MM7A 1TKXB 2J76E 4Q2MA 5D6GA 4TQRA 2OGUA 2FZCB 4L6V3 4JI1F 1Z1ZA 2CJKA 1TUGB 3IRXA 2AQ4A 2OAUA 2XHCA 1FJGJ 3Q83A 2UP1A 4AFFA 1JLEB 1V3ZA 2UXBJ 1D9FA 4JI0J 2BOAA 1KRPA 5E41A 3W65A 2QSFA 4TLRA 2OHDA 4PG5A 4QIEA 1FKOA 1SC6A 1W7WA 4ECYA 2DNRA 3IR6B 1SUQB 4LF4J 4O3OA 4K4UA 4USUA 2GMHA 3QLHA 1J5EJ 4X64J 2W2QP 3T6BA 2ILZA 4DCJB 4YB7A 4IQXA 2BR0A 3M8PA 4N8OA 4CH7A 4X4OA 2V4JB 1IBMJ 3MMCB 3Q2SC 4P72A 2W7PA 1HBNB 2VFSA 1FXLA 3EWGA 3LGHA 1MWQA 1N33F 5E3CA 4W92B 1ZZFA 4DR3J 3KHHA 1M5OC 3EJMA 1IBKF 2EEYA 2EKNA 2BDPA 1T94A 4WIQA 3IBFB 4NZ0A 1F2GA 4NEZA 2DNNA 4DFJA 2PD1A 5A6WA 3EMTA 3BH7B 4K4ZA 5CYQA 5IOLA 4DQPA 2OELA 4J5OA 1RTZA 2W25A 2YKPA 5DQIA 2OEJA 3V6DB 3AA8A 5A8RB 1QAJA 4NWBA 4K0KF 2VBWA 4FYVB 3CW2C 2MLYA 5F8MA 1Y0HA 3DLKB 1U8WA 2DJWA 1D09B 1CJKA 2HS0A 1DFDA 3J81U 3D6TB 4N47A 2C2MB 3BREA 3MECB 4B02A 5DGBA 4A8XA 5C42B 1HNZJ 1C1CA 4ZCMA 4KQZA 2EXUA 1HLWA 1N5TA 4DR7J 3D1QA 2MZRA 1PSDA 2DH9A 3TVKA 5LOQA 5KFJA 2D7SA 4CO2A 3R97A 1AUSL 3HVRA 4RUBA 3ONQA 3KJVB 4GKKF 4X4SA 2FJWA 3R5BA 3BQ0A 2F1FA 1RWMB 3RB4A 2YH1A 3DFEA 4CQ1A 4DV1J 2M4MA 1CPZA 3AH6A 1B99A 5AJ3F 2XI2A 3BQ2A 2RB7A 4Q45A 1FTRA 2OI2A 2HHHF 2DYAA 4ZMMA 3EUNA 4F3QA 2ZBQA 3W9HA 4I2QB 1RT4B 3IP0A 2NXJA 1BLUA 4EI2A 4I64A 1CJTB 2WSFC 1C1BB 5U47A 5A2QU 4ZJLA 3A4TA 1SI9A 4UOCA 2UVUA 4J7CA 1RAGB 4HYKA 4EYHB 1RE1B 4LVNP 3MMJA 4CZCA 1JLGA 1VIXA 1TVRA 3CJRA 2W4DA 2HPUA 2I38A 4TYAA 3RB3A 2WAQD 3K5MA 3HPOA 1S57A 4TVAB 4ZVGA 3F73A 2YKMB 2I5JA 3MPWA 3QRPA 2GCFA 5LXYA 2WW8A 2W2MP 4MTPA 4UZBA 2DPJA 4P6QA 2HIQA 4QYZJ 3DI6A 3BSOA 3EXYA 1TKTA 4OZ1A 3H4BA 5GMKa 3N5FA 4QJVA 1WC1A 3FNNA 4OLOA 3BN4A 1UJ4A 2D9OA 3LPEA 2DRAA 4Y65A 1JLBA 3HFZB 1ZAXA 4LREA 1HHSA 1ROFA 2KRRA 3BDPA 4ZVOB 4R8UB 4X2BA 2B0GA 1WWHA 5T7LA 2OSQA 5KFXA 4H54A 2VBYA 4JI5F 1NBEB 1G6BA 2LVWA 4JI2F 3TUIC 3H40A 4X4UA 5HJXA 3LP0B 4ECQA 2DPIA 2FVSA 4ES1A 1MMDA 3ITHA 2OPQA 3GJTB 4Q0BA 2YVSA 3EZ5A 1S0NA 3KK1B 1U0HB 1OPIA 1PG5B 2PEBA 3E01A 4DS4A 3MXHP 4FDFA 2VG6B 3NNAA 3NNHA 3CD5A 3RBXA 5KFRA 2WTFA 4LF9F 4DLEA 1C4AA 2FLOA 4G1PA 1N34J 4RU9A 3OT9A 2LDYA 3K17A 3CCLS 4P73A 1N5SA 2VJUA 3DRXA 2M0GB 2XYGB 2FUG9 2QTWA 2EVZA 1HQUA 5KTQA 1D9AA 2V8GA 5HANA 1F2HA 3JAMY 2EFOA 3CCZA 1FRHA 3R6GB 1JMTA 1REVA 4KHPJ 3OSPA 2KYXA 4DR6F 5FLXU 4YR0A 4RBVA 2JVOA 3AFGA 1RAEB 3KUEA 5IM0B 2DISA 4JYAJ 4URGA 1NZ8A 3BYPA 3W5ZA 4AUKA 4DI6A 5ETVA 2NREA 2DEIA 4DPTA 3QO9A 3TUJC 3G2XA 1NPKA 1T3NA 2ZWPA 4DL4A 2P6SA 2Y1LB 3HD2A 2LQBA 4YS2A 4YR2A 1RU2A 3M6WA 1GXLA 2VQFJ 3CMAS 2BXJA 2BZ2A 3J7ZT 3NWRA 4F4XA 3CCWA 2YKQA 4QYZK 3BO4A 2B4OA 2BE7D 4DJBA 1N0UA 4AL6A 2Q43A 3UN2A 4O4GA 3DDKA 3DMJB 3RGIA 2OMLA 5AE1A 3D2WA 2NYHA 2P6TA 3UDEA 2DHSA 4BC7A 1RHQB 1UA0A 2G4BA 4U96A 3QAEA 2YNFB 1UWBA 4RW6B 4RW9B 4NXNF 3L09A 2QL9B 5AE3A 4C8LA 3K5PA 2GVZA 1YSJA 4LSLA 4X4RA 4DR6J 3FUYA 5A0YB 4YDDB 4QWDA 1P9YA 2OO4A 2MLXA 2DR5A 3ZC4A 3R5JB 3DDIA 4ZVTB 5GVQA 2B5JB 4FBUA 2I2YA 5FIIA 1ZYQA 2E1AA 4ZHRA 2YWHA 3D4JA 2C3PA 3N28A 1WHXA 4EBDA 1WOPA 1BY9A 5G0RB 1R6VA 3CCJS 5F3TA 3M2VA 2IYGA 3Q8UA 4EWTA 3OXLA 1JB0C 3D0GE 2QMXA 1S9EB 3EGWB 2JHEA 3TAMA 2IHR1 4J9UE 3T1YF 1U1KA 2IRUA 4ZVRB 4RNHA 4J9VA 3ZZTA 2BRKA 3FK4A 3MOJB 3HVAA 1VK8A 3VTIA 1UW9A 4NX9A 3TQ1A 3MEGA 1HI8A 2JDJA 1RTJA 4DX7A 1WEYA 2V2ZA 1OMSA 5KG5A 4OYIA 1K0TA 4A8QA 1RB0A 2ATCB 1RBLA 3AJDA 3NOCA 3R6LB 4X4PA 3D9BA 1NM2A 5K9FA 1RWNB 4LRAA 2DH8A 1H7WA 3DXBA 1O5JA 2J5AA 3WIVA 2CJXB 1C0UB 4U67Q 2KT5A 5A76A 3W2VA 2PA3A 1HIYA 1AZSB 3VGSA 4LF7J 3FQLA 3FBFA 1YITS 3W62A 2AW0A 3I0SB 5DZ6A 2BRLA 2X3GA 3NNCA 4PG4A 3M7VA 3H90A 4USVA 1HQEB 3PEJA 2VOPA 4WYLA 1RT7A 1ZOTA 2G13A 3OTOJ 3J7Z5 1RUSA 5LL6d 1FRKA 4PG8A 1TU0B 1VCTA 5J2QB 4IO1A 3W9JA 2ZM6F 4K4VA 2GAHC 5KG6A 1FRXA 4ILRA 4KV8A 4G65A 4CWBA 1YRXA 1T11A 4Q8FA 3CDAA 2O1PA 2P2CB 3F44A 1RT2A 2NPFA 3KJFB 4ZPDA 4F0MA 1Q8KA 4C2MA 2XSJB 5KFCA 2H65B 3DRSA 3ZTPA 1YHQS 1Y10A 4NLSA 1NCLA 2KN4A 4NXMF 4QIVA 3DN9A 4M5GA 1T02A 3HF5A 1XTZA 3KK2A 3HI9A 3RU0A 2BACA 2RQMA 1L3SA 2DB1A 5A8WA 3OUYB 2IA6A 2QLXA 1QAYA 4XDDA 1TV6A 4L3NA 4DV6F 2XLKA 2Y1IA 1Q79A 5AXMA 4H4MB 1URNA 3NP5A 1T8EA 1UEVA 4OYZA 4NCBA 2BOPA 2RNEA 1JWWA 2DGWA 3JYTB 5JVGQ 3BQ1A 2K8GA 2AGOA 1HKAA 4X66F 4D3HA 3CGIA 4KHRA 4OJ3A 3H4DA 4UZCA 2ZJRQ 1RT1A 1X4EA 1ZETA 3ISND 2K3KA 4AXJA 2CJYB 1WKKA 1T03B 2W9BB 5L1IA 2HQ3A 5KT3A 2BM0A 2YTCA 3BV8A 3JSBA 5LJ5Y 5K20B 4DL6A 2UUAF 3RR7A 1SH2A 1PYSB 1RKIA 1IUJA 4K4YA 3MMBB 5AE2A 1GEHA 3F0NA 3FVYA 2C2DA 2YWFA 2ZH5A 4ZP9A 4QIFA 2K7KA 3Q8VA 1CG2A 3M8QB 5IV3A 3OLBA 2K06A 4QWBA 2UUWA 3R2DJ 4NMXA 3IWXA 1QJHA 1VRTA 3KHGA 4H4OB 5ETLA 2FY1A 5D3GA 1S49A 2H5JB 2J9EA 4G1QA 1MROA 5BYSA 3BSAA 4DV6J 1SJ1A 4ED6A 4Y28C 5G4DA 2FJXA 4C11B 1RTHB 3W60A 3KJNB 2AYGA 4ZN3A 2ZJQQ 4L3KA 1NUEA 1U8SA 1M5HA 5CCMA 5DDPC 1EZZB 2OPPB 1S1UA 4QPXA 2CQBA 4B3TF 3BPDA 5E3AA 4ES3A 2V2VA 2JEJA 1IR2A 1X8DA 3VGTA 5J1EA 2IDEA 3IR7B 2IMWP 3M2UB 3H2VE 3EGZA 4ECWA 2KG1A 2GVDA 2H51B 2G2OA 5E3RA 4K4XA 5KFWA 5B0AA 1RA7A 3IS9B 1UA1A 1CBKA 3LPYA 3UN3A 1FRMA 2XZWA 1UCNA 4F4YA 1I94F 3CNQP 3Q23A 3V81B 4HVZA 2W7AA 1SIWB 4YB1P 2GV1A 1HA1A 3IFEA 5GADI 2MSSA 3FZ2A 3T1AA 5C5JA 1DURA 4PEOA 3R27A 3WIUA 1T0TV 1RWUA 1XQIA 3ETOA 2PN6A 1TKZA 2Z57B 1BWEA 3BJYA 1FFWB 3T5JA 3HXMA 1RKJA 2GHVC 1L3VA 3SQGB 5KFPA 4YHHF 3UFCX 3TAPA 3AAWB 3OBIA 1R8BA 2XYHB 4F36A 4ID5B 4P74A 1U2RA 3CJTA 1UW4A 2M7SA 3ZZOA 2LEPA 1TL7B 3KMSA 5DLFA 4YOEA 3D0HE 2HFOA 4XPEA 4LF6J 2KYZA 3THVA 3H5UA 1CS4B 4ZCIA 1GX5A 2DGSA 4OHZA 2Y0BB 4ECXA 2HVZA 2AZ1A 2KFZA 3DHWC 5JJBA 3G6ES 4NLPA 3PCOB 4C8OA 1XC9A 4QYRA 1S6PB 3M6UA 3D7SB 1NK8A 1RA6A 4C8YA 5L9NA 1HNVB 4U7UD 4C0BA 3N6LA 2OPRB 3RYLA 4WE1B 2D41A 1SKSA 4CM0A 3R7SB 3MM9A 2FYXA 2NSBA 1NAQA 3C6TA 4NI2B 5I3UB 4DR2J 2CIMA 2LP4A 2BM1A 3C2PA 1R0BG 4IH7A 3MM8A 3BYRA 1WC0A 3H2UB 3I4PA 4JI6J 3ZNUA 2J6TA 5CA5A 2EBEA 5FJ4A 2NPIA 4Z7CA 3HSZA 1EB0A 4KFBB 2VOOA 3CXCR 4G6VB 3GIRA 4UOGA 4DCOB 1VQKS 1O6XA 2ZHBA 1FK9B 2A3JA 2G9OA 2J0SD 3F41A 3GFYA 5E7OB 4ELUA 2AJQA 3MUTP 4PXDA 3C14A 2C1EB 4DS5A 3DGPA 5E0OA 2Y3YA 1N32F 4WP9A 4GKJJ 3M30B 1N6QA 2WRMA 1HNIA 2XSFA 3LP1A 2F9DA 3LALA 2IYIA 4QIGA 2VA3A 2WBRA 4LSZB 1VQYA 4KR0B 1QSSA 1HBMB 3GYXB 5HBMB 5J1NA 3BR8A 3S1TA 3JTNA 2ADBA 2QX0A 2LQJA 4I2PB 1CQNA 2VPYB 3H42A 1NJZA 4UY85 4ED8A 4DV3F 3H20A 3R1HA 1R3NA 3GE9A 3RW6A 3CJKB 1PC5A 3G96A 3T5KA 1FA0A 3BZQA 1VBYA 2HNDB 3CMES 2DH7A 2WVCA 3OVSA 1WOSA 2YNHB 2XMAA 1F9FA 4ATNA 3QPIA 1S77D 5LMUJ 1Q5YA 3BGLA 4PXCA 2DVIA 3R1LA 4I69A 4GO7X 4F3OA 1W26A 3HD1A 2C2KB 4DSEA 3VQTA 2XMUA 4K50A 3M2RA 4OYAA 1CJVA 1I3OB 1FNOA 1JK9B 1TL5A 2R42A 2HG4A 1YRUA 1D3WA 5DJBA 2QLBB 1TAQA 1WOOA 4NMLA 3RAXA 2LA4A 4IOAQ 1YDLA 2CADA 3DNCA 4FS1A 1V6HA 3DLLQ 4DPYA 5CAAA 1RXOB 4OQJA 4PCQA 1U6BA 4IFYA 1UVNA 4EUVA 1TKDA 4NPOA 1FJCA 2F3JA 1A0OB 2HZAA 3KLGB 2ZH8A 1HNWJ 5C24A 1DTTA 1RHUB 4I67A 4ZVFA 2VG5A 2VPZB 2BX6A 4EZ6A 3T19A 3BGOP 2YKNB 5AXLA 1NSPA 2DGVA 1BWVA 4Q2LA 3E51A 2NCKL 3FEZA 1TZ0A 4EMDA 3JSRA 4USMA 2ALYB 2VUGA 1XNRJ 4DX8H 4NLWA 3AA9A 3K89A 4DU7A 4IG3B 1QSLA 1Q4RA 1SBRA 4J37A 4S0MA 4KH0B 4ZPVR 3G4SS 1RCXB 3ETMA 5KFEA 1M5SA 3HDSA 1LWXA 3J7YU 2UUTA 3W63A 1S97A 3TR5A 2QE5A 4U8YA 3AB4B 3FFIA 3SCKE 2VICA 4KH1B 4DN0A 2RILA 5HP1A 2UU9F 2G1DA 1CULB 5H9EJ 1KNZA 1O8BA 4RKUC 4J9NA 3DLGA 9ATCB 1RT5A 4DCPB 3AD7C 4UUXA 5BR8F 5EWEA 3M8YA 3AOBA 2GC8A 5FDLA 3VVUA 3SSQA 2VJVA 3SBMA 4OL8A 4C3LA 2ZFHA 1CJUB 4GVLA 5ETNA 4B9NA 2RQ4A 1VQ5S 2FZKB 4C3MA 4USWA 1RT3B 3CT9A 1OWXA 3EVMA 4CCHA 4PR6A 3TZWA 3GLJA 5SUHA 3ZTOA 4RUHA 1QE1A 1M5KC 3PZPA 4KTQA 3DHXA 1UFWA 3B78A 1R8HA 2D3ZA 2Y8YA 2DHHA 3O44A 1VQ7S 4B3OB 4ENOA 4RW4B 2R7XA 3FBBA 4OZ3A 4OZ2A 4DV5F 1NHKL 3OQ2A 3UVJB 1U1PA 5HROB 1GNKA 3JSYA 2B4UA 4TN2A 4DFMA 4OHYA 3DYAB 5K14A 1WEZA 5CABA 1XWLA 2UU9J 1AA1B 2V94A 1MN7A 1S6OA 1F3VA 1FNMA 2XLIA 2Z2YB 1CC8A 3QT7A 1H3DA 5GAEU 4U7UK 3VZHA 3TO8A 4WCEQ 1KVKA 3KHLA 2HHQA 3OTEA 5F8NA 4JI4J 4RW8B 4B3MF 1RJJA 5LMNJ 3ZO7A 2J0XA 4IG0B 4IR9A 3TZYA 2HLUA 1BE4A 5HATA 2RRAA 1X0FA 2WOMA 2W24A 3KLFA 1WTFA 3J81Y 2KXFA 2WVEA 3BO3A 3GYGA 1VI7A 1U09A 2FD2A 1WHVA 1WF2A 3PW2A 2D1CA 2J8AA 3TQEA 4DF4A 3DOMA 1FKPA 2DHAA 4NE9C 1T05B 1HQ2A 4ZVEA 3MCOA 4OX9F 5FD1A 3CDEA 3PR4A 4MFBA 4MKAA 1D1UA 1VRUA 4F4KA 2OEMA 3A12A 2VA2A 2G0JA 4RW7B 1DRZA 3BF4A 5KFQA 4Q8EA 5KFZA 2DCLA 3N01A 4L72B 4RBTA 5KT2A 3UD4P 4Y6IA 3OL6A 4QCLA 4J9SA 3OR2A 4ECRA 2DKOB 3KLHA 3G6VA 1TKXA 1S4FA 1HYSA 3TA0A 2M8DB 1M5PC 1HBUB 1VJQA 4K8RA 4M5DA 4F25A 1FNXH 5A2QY 1TR0A 4MT1A 1PJ6A 2RUSA 2HHUA 1NHUA 1S4EA 4JI8J 2CVIA 2MHNA 5EUHA 3I56S 4LRBA 1I5OB 3I0RB 2OFHX 2PE8A 2WB4A 3KTQA 2D9PA 3Q8YA 1NPPA 3RAQA 4DWIA 2NZCA 3B4DA 2G2YA 5L1LA 1RWXB 3QQCD 4L76A 4DV2F 4BS2A 3OVAA 4B9SA 1PO6A 2QL5B 4GVBB 4V19J 4IRCA 5ETPA 1XMQJ 2FIUA 3ZZPA 3CJ5A 1VQPS 4DL2A 2ZDOA 2Z2ZA 1RT6B 3S6EA 2KXHA 1NB7A 1RTIA 4OZJA 1YBAA 1TAUA 2CQ3A 2M88A 4DR4J 2V0NA 2OFGX 3AB2B 4F0KA 1S10A 2QIFA 3LP2B 3AQPA 5A8RA 3NCPA 3CCUS 1TL1A 2MKHA 3CVKA 2XMTA 4CLTA 4OV1A 1XNQF 3NBPA 4NLRA 3DLKA 1RHJB 2MKYA 3LAMA 3IXQA 4IDKB 3GP9A 2R2RA 2GJ2A 3MI7X 4LT6A 4E98A 3MECA 4RJVA 3KFWX 2V4RA 5C42A 4HTIA 4K5SA 3RG6A 4AL7A 2JH3A 2YKAA 1YGYA 2AYMA 2L48A 3UWTA 4YQWA 3KNGA 2XZTB 2K1RA 4TU7A 3D5MA 4B3RJ 2UV8A 2HFNA 1Q1KA 2BE9B 2E66A 4NOHA 3CMQA 4ED1A 3KJVA 3TP2A 5FLXY 1WEXA 3ICLA 1W2BR 2HFUA 3BBBA 2JLFA 1N5QA 2FZGB 1ZM9A 3TANA 3T9NA 3AD8C 1SJRA 3IO1A 2B7BB 4KT0C 2ZKUA 1EETA 4M5JA 4JI3F 5CZVA 3CD7A 4NCGB 1WUUA 1KP6A 5GMDA 3QT8A 4QW8A 4LF5J 4BWJA 5I4MA 2W9AA 3OFFA 3JTOA 1U1QA 2QMWA 2E1CA 1WF1A 3C16A 3N79A 3MEDA 3W61A 3D3BJ 3H0PA 4K2XA 1C1BA 3DOKB 4LFAF 4A47A 1HWUA 3CDBA 1FDNA 1J2VA 3MF5A 1F5BA 5KT5A 5T14A 4DF8A 1HR0F 4CP5A 3GV7B 1DARA 4QU6A 2X1GA 6FD1A 2IAJB 5I42B 1S48A 3BGRB 2IM3A 3PM9A 2YNIB 4OV6A 4DR5J 4G3IA 4CTAB 3SCLE 1FFGB 2KT3A 3M32A 4LBPA 5D4LA 1YZ6A 3T9ZA 3UR3C 2BKNA 1R89A 2BJ1A 4DU8A 3IAM9 4Y00A 4LIRA 3IGVA 3QIDA 4OZLA 2MKKA 3HHNB 1UZDA 2XMJA 4AD6A 2A6MA 2C2ZB 2KM8C 4OZ5A 4R5PA 2YQ3A 2F8MA 2W4PA 4YUDA 4UTGA 3RRKA 2V34A 4UOFA 4R8UA 4O0IA 4NZ7A 2MTLA 1UFKA 3NG8A 2JEFA 2W2PP 2XB2D 2F4FA 2O3DA 2E9RX 2DY1A 3MM6A 3UE2A 1HI1A 1BD6A 4ZPCA 1KN6A 5F9LA 2MEWA 3DRRB 2HQIA 1SH3A 4OI4A 4XPCA 3LWMA 3T1HF 1JLAA 3KK1A 1U0HA 2UXDF 5KT6A 2AT1B 3SV4A 3A13A 2BA9A 4NLTA 2JLGA 4NCAA 4C48A 2K7JA 2B7CB 2ASLA 1MMNA 4WYWA 1N54B 2HNYA 1X60A 5KG4A 1IN0A 4F4AA 1T9WA 5L39A 4CLLA 4N5SA 1S0VA 4NL5A 2N4CA 4DL7A 2UVRA 2BJ7A 2KFNA 5HLFA 3G6XA 1SQEA 3MM7B 2ZC3A 3MPVA 4HHJA 2XNQA 3JTPA 2XLJA 1H73A 1FF2A 1HWLA 2JRSA 2DIUA 2XMVA 3L7PA 5HQ8A 4OYWA 3ELHA 2DBBA 4O4RA 4IH5A 2KHDA 3MEKA 1PAEX 5E5NA 2RDIA 1FKOB 5KFBA 3QNWB 1U02A 2HVDA 3MZIA 9RUBA 2M8HA 2IVYA 3JQMA 4X4TA 1RDRA 3LF0A 1GTEA 3OL7A 1NO8A 3BS9A 2Q6BA 2UUCF 2IJRA 4KY3A 4OX6A 3HHLA 2QN6B 4LQ3A 2CNKB 3QLHB 2Q3PA 1DTQB 4CYUA 4Q44A 2MQQA 1RLCL 2Y9HA 2CG8A 4WTYA 3M8PB 4LF1A 3US5A 3DMJA 4XO0A 2ZBCA 1UVLA 2YNFA 3CDWA 1LFWA 1H6KX 4ED2A 3EX7B 4P2MA 1QVFR 3G87A 5AXNA 1FFSB 2Z30B 1WDDA 2IM2A 2W9CA 3H2LA 5DG7A 2QGFB 2JSXA 4X65J 2CDQA 4J9MA 4X4VA 1NJYA 1XR5A 1NKEA 4LFCJ 2CQ4A 3CC2S 2MLZA 4KGZB 5CYQB 3FBCA 2RD5C 1SVDA 4H4KA 3AOCA 5ETSA 4DEZA 2CKWA 2FY8A 2RUGA 1RBOB 2AJ4A 3M05A 4CIOA 4LJMA 1CJKB 1F60B 2HIYA 1LW2A 3Q2TC 2F9JA 1H2UX 3CCRS 2QC3A 3CJQA 2HHXA 1C1CB 5CYMA 2DNKA 2ZH6A 5D4PA 2VL1A 4RLEA 2ZEJA 1P27B 4YFUA 1C0TA 4ETZA 1GMWD 4RX6A 4RUCA 1SKUB 1LXJA 4ZVHA 5B0EA 1OY9A 4OI1A 3H59A 2HGNA 3KXDA 2HHPA 3I32A 5KFDA 1K1QA 2X7IA 2CYYA 5LT5A 2J7KA 4QWEA 4AQYF 2UVWA 2ZOMA 2CPEA 2F7VA 2E5LF 4P52A 2GJFA 2N3OA 3UDLA 4PZVA 2DITA 1C0UA 4WP8A 1OY6A 4JV1A 2KB2A 2CPZA 1HNXJ 1UL3A 1VQ4S 1KQSR 5THWA 3OJSA 4FPIA 2JWNA 3ENAA 1HWKA 2D3UA 4TNOA 3NY0A 4DV0F 2UUBJ 3K7RA 1HQEA 3N5BA 2W2NP 3V6KA 1GXTA 4MJKA 1T9XA 1YBUA 3MR2A 1TVRB 1BC6A 1GT8A 3HKZD 2YQ0A 4DX6A 2JEGA 2C2EA 2HLTA 5I3QA 2XCAA 1YIJS 3CC4S 2QT7A 3HT0A 1RAAB 1UVIA 2FVCA 3C19A 1IKWA 2I5JB 3A1YG 2VPXB 2COLA 2CAJA 2VZ9A 2NZ4A 2HQDA 1WG5A 4P2XA 1B0TA 2CFXA 3DI6B 1FDBA 1TKTB 4NYPA 2XSJA 2RDDA 2ACYA 1X5PA 2CRLA 3QT5A 2MGZB 3FQKA 3GIJA 2DO4A 5CHCB 4LSNB 1JLBB 2LECA 3MEEA 1ZZNA 1WSRA 2NXEA 1FEEA 1NSQA 4F0HA 1X4GA 3VAGA 4BBYA 1SV5B 5T7LB 2FLLA 4F2RA 2HS4A 2M3DA 3M6XA 1IKXB 3L7UA 4USIA 4WFBQ 5HVFA 2W4CA 2VDIA 4KPCA 4C4WA 2W8LA 4IR1A 3ITHB 2OPQB 5KFYA 4Q0BB 4LF2A 1VOMA 2CPJA 3DC2A 4M5IA 2KM8B 4I6AA 4RUAA 3E01B 2VBXA 3P6YC 1B7YB 4O3PA 3NGDA 3J80U 3B82A 4YP3A 2RQKA 2B51A 4WFYA 5KG3A 3Q8SB 2ACMA 2XY6A 1TUWA 2RRBA 5LSOA 2R7OA 2QYGA 4PQUB 1JXVA 1Y9OA 4ICLA 4CO4A 1HQUB 2XO6A 1KQKA 1NLKL 3IAS9 5ETQA 4B3SF 1S79A 4V19X 3P49B 1N36J 2CG4A 1C2PA 1MWYA 1REVB 3HKWA 3MMBA 2VD3A 3FEYB 4HACA 1MMLA 4NLXA 2JFKA 4CLUA 2AX1A 2E7WA 2E5HA 4ELTA 2ZVIA 2XEXA 4BLGA 2IVMA 3G6YA 2QV6A 1FHTA 1GFWB 2IIHA 1XMOF 3JQJA 3KG0A 2J9DE 4CLZA 5HMZA 1NK4A 1X5OA 1U26A 2Y1JA 3QO9B 2OTLS 2PT0A 3RAMA 3K0JA 5KFNA 3HCXA 3A3NB 4C11A 2Q6CA 5IFMA 1RTHA 3THTA 1A6LA 3P5BP 2AYEA 2NSCA 2EFQA 1N5YB 1J5OA 3E8OA 3O1LA 1R31A 4XTTA 2OPPA 1RAHB 3GV5B 2MY8A 1IM4A 3A8KA 3IG1B 4M63A 2FHKA 1QTNB 4O4GB 3SDEA 2XGPA 5CYJA 1LV5A 1EKRA 1IWAA 1UPPA 3IBWA 3MDFA 1X4BA 5E3PA 3PW4A 1UWBB 2BANA 4OMFG 4ED4A 4LFBF 4FYXB 3OJUA 1J27A 2GVZB 2JZ5A 5L38A 8RUCA 3QGPA 4LSLB 2ZOFA 4F26A 3PW5A 4RWXA 2H5EA 2R7SA 1YJ9S 4DUTA 1LWEB 2C2RA 4YMEA 3AOAA 1TMJA 3M6VA 3MD3A 2YBVA 2RT3A 2DXDA 2E29A 2XNRA 4ZHRB 3PV8A 2DNPA 1EX8A 4KGKA 5BXIA 1U6FA 3M2VB 4OJGA 2E7XA 4HI2A 5C2CA 2G0IA 3ZNJ1 1ITPA 4HT7A 4TU8A 4ID5A 3SXLA 2HHTA 1SPBP 3POTA 3CJ4A 4R0JA 1VHFA 2RH3A 3TAMB 4J91A 4ZITA 1WNEA 2MYFA 2NUUG 1YJTA 3UD5A 2WHOA 4GO5X 2MSTA 2HFSA 4KGXB 1HHTP 2QEXS 3D28A 4HR2A 2UVVA 1AUDA 2ASJA 3MEGB 4J9LA 1RTJB 2APOA 1EQMA 3NGTA 3V4IB 1A9NB 3W8GA 2MZTA 4ID8A 1FRIA 4CO0A 5EDWA 3W2VB 3KUHA 1NXIA 4C7QA 4EYIB 4WE1A 4DUYJ 1GXUA 3O6QA 3DM2B 1NPRA 3PKYA 4K7QA 3UW1A 4I7FA 2MZQA 1VIOA 3PRVA 1VRQC 2RKIB 1RWKB 3OSNA 4RWWA 4NI2A 5I3UA 3RBZA 1B7FA 1LWCA 4WPAA 3PIOQ 1RT7B 5H9FK 2IFXA 3C6UB 5BJRA 4WTOB 1RADB 3CPWR 2GIQA 2FJAB 2GQ2A 1Q8IA 1GAOA 1T9YA 4KV8B 3EDRB 3DXSX 4JI1J 1RHRB 5GAGU 1RT2B 3QGIA 5D4NA 2HFZA 4FYYB 1E6VB 2XHWA 1FK9A 4F8RA 2G2ZA 2DO0A 2B9XA 4C6AA 4QQBA 4P9SA 2EFVA 2CPYA 2AV5A 3GJSB 3C46A 1M0SA 1HMVB 4U9RA 2V68A 1IM6A 2MKJA 4TLQA 2IC3A 1Y3JA 5CD4H 4IO9Q 1PYTA 3LAKA 2ILYA 2ZBPA 3A8IA 1YKWA 1S1WA 4KYZA 3P5TL 3QRQA 4Q43A 5A8WB 4ZOSA 3O8WA 2QO3A 1TV6B 2XG8A 5F8LA 1JLFB 4ITSA 3CJ8A 2YX7A 4CT9A 2MJNA 4CH1A 3MWBA 2A1BA 3D54A 1T9UA 2YWKA 2VFUA 1Q95G 1FERA 1CEZA 3HM9A 1VC5A 4ZP7A 1N33J 3S01A 1FTCA 1FT8A 1IBKJ 3U7JA 2FHJA 3PY8A 1F9HA 1RT1B 2XTJP 1TL3A 1KTVA 1APSA 2VB6A 2YNHA 2QJ3A 4DL3A 3EGVA 2MMYA 3AHPA 1QVGR 4I0WA 1VQSA 2UV8G 5IWAF 4OYMA 4URQU 4Y2MA 1KVJA 4XIUA 4HLBA 1R27B 2WW4A 4OYXA 4AYBD 2J0QD 4K0KJ 4DSLA 3HVWA 4UW2A 2H48B 3P45B 2H4WB 2RF2A 1S1TA 1EIYB 2HS3A 4DV4F 3NEKA 1UZHA 3QT6A 4UQTA 1JIHA 3NS5A 3VAHA 3KMQA 4PYAA 4DQRA 1VRTB 1NDLA 5L1JA 1YVFA 1YLXA 4EK2A 1Q82T 2DXFA 4RL1A 1Y5NB 4OYPA 4DUZF 3A3PB 4G1QB 1MROB 1VBKA 2Y1RI 5ETKA 3KLGA 3AXKA 2HNZA 3UQSA 1JJCB 4GKKJ 2R8HA 1F5AA 3UPFA 3GFXA 5B0BA 1A7GE 1DZ5A 1ZAVA 3OTDA 2C3YA 1SC3B 1ACMB 5F3ZA 5SZTA 3HHEA 1CVJA 5AJ3J 2GQCA 4ANEA 2ZNZA 3FMWA 2FPHX 1UP1A 1VJWA 4N7TA 2DGQA 3GJRB 2HHHJ 3CIMA 2H5IB 1FCAA 2C42A 4IG3A 2GVDB 1KQFB 3HULA 2X3DA 3OHAA 4V1Ak 2EC0A 1G7CB 4F67A 5DDOC 1SH0A 2HYIB 1SJ4P 4RBUA 3R5CA 2R8KA 5BYQA 2CPIA 4UF4A 3EGNA 1N52B 1D8ZA 3FBEA 1JLQA 2CQDA 5B7WA 1S0MA 1KFDA 3DCAA 3Q24A 2DNMA 4B17A 2ZC4A 1EKSA 3GWCA 4QR0A 2MKIA 3GQCA 2ATLA 4ZA1A 5K8NA 3BGUA 4PWWA 1VYAA 2VU5A 1TKZB 2J7WA 1KDNA 2YXLA 3B4MA 4MKBA 2E5JA 4YEAA 2OEKA 1YQHA 1KHWA 3S7RA 1S9GA 2AIRB 1IKYA 2EBGA 1OSDA 3SIPB 1LOUA 1GMUA 3G86A 2AU0A 3TZZA 2I8EA 2B6AA 2VKZG 1NK5A 4D3GA 3BR9A 3OFEA 1YI2S 3CUNA 2ZUAA 2QFIA 3M8SA 2CWKA 2F4VF 1WELA 3PHEA 4WFNQ 3O2IA 4JI5J 3EYZA 4JI2J 2G1HA 1R8CA 2CJBA 1HD0A 2C28A 5D15A 1U1OA 4NLVA 2OP5A 4ZPAA 4RW4A 3BH6B 3N6MA 2YX1A 3TUPA 3ZZUA 3LGMA 1FRLA 3CTRA 3N9UC 1WF0A 3KLIA 4K5RA 2BJDA 4USKA 1IJFB 3TARA 4OI2A 1DLOB 2FQQB 2LYVA 3DRYA 4LF9J 1I51B 5D77A 5HQMA 3WC2A 2Z2LA 4DR1F 3MM9B 4PPZA 4WZMA 2RS8A 4I1TA 4EO6A 1BQXA 3C6TB 2FGCA 2OPSA 4ERDA 2QLFB 3I4HX 3L3CA 1HWIA 4QPTA 3MURP 3OVBA 1QM9A 3MM8B 4WU3A 1U0SA 3W64A 1ZS6A 3TA1A 5DDRC 2MKSA 2XS2A 2EG1A 1JX4A 1WJ9A 1RWWB 3C15A 4ECUA 1MW7A 3H7HB 2IM0A 3JXOA 4R25A 2KHCA 4MYTA 2YQ1A 4TQSA 3SQOP 1OIAA 3CE8A 3RJMB 2C3UA 3HK2A 4DQIA 2BJ9A 4ALZA 1DQ8A 2Z56B 2E1RA 1K73T 4GRSA 1X4HA 1QLNA 2CNLB 4OI0A 3C14B 3KOAA 1F3FA 2EWHA 1T05A 4NLGA 1SQGA 3BBCA 1ZAWA 1FVQA 3KK3A 1MU2B 1VK3A 1R8PA 2V8HA 1HNIB 3LP1B 2PFFB 1FXDA 3HVTA 5L9XA 4RW7A 3HJVA 5F41A 1KC8T 2QSWA 3FSIA 1RWOB 1BQNA 2VQEF 1IBLF 4KO0A 2E9TA 4X4NA 2Q1LA 3Q0AA 2KJWA 3KWMA 4NYOA 2BVZA 1Q0NA 2MKCA 2GHWA 1LNQA 4HEA9 1RAIB 1SC1B 3D6FB 4NXNJ 1HBUA 2BMBA 2OTJS 1UVMA 4NA3A 1MLAA 3PNIA 4X4QA 2Q66A 2FVRA 3UI3A 2ZUGA 1BQMB 4MKVA 1HPZA 1GTHA 4O0NA 1H2VZ 2HBQB 2JC1A 4RNOA 3CCSS 1CJVB 3VGVA 1YZ7A 1NK6A 1S6QA 2JNJA 3L7OA 2BABA 1Y4ZB 4QZVB 2R8JA 2P5VA 2XY7A 1S7IA 1UTAA 3VZIA 2QMUB 2HWHA 1KOOA 4NRUA 3WBZA 2JC0A 1YWXA 3PFEA 4GVBA 4DXLA 3WZ0A 2HQCA 3RUBL 2UXCF 4GC7A 2C22A 3OPKA 5EWGA 3HHDA 3UD3P 3MPUB 4KGMA 3T1YJ 3TWZA 3VQSA 2VG5B 1JLCA 7FDRA 3QWUA 2AHOB 4E0DA 2YNGB 1L3KA 4C98A 1X4FA 3N6NA 3D1HA 1OYEA 2DGTA 5D0HA 2ZZMA 4ZCKA 3MM5B 3LP2A 4ELVA 3TJ9A 1TMMA 2OMOA 3ADAC 4JP8A 2CPFA 2XWYA 2FB0A 4DDFA 5CCLA 1CQMA 2XC9A 2LEAA 1EJ7L 1RCOB 5HMYA 4USTA 2RMLA 4LVOP 3A3OB 3DOLA 5B0DA 2V4QA 2OUGA 3KDNA 4FNHA 4PPDA 3DLEA 2XMWA 3OTCA 5IC4B 3I96A 2DR7A 2DXEA 1SL2A 5JXSA 3FSXA 5B08A 1R0AA 3NMAA 3PEHA 2ZM6J 4LF8F 4M5LA 3GZ7A 5F0WA 1QDUB 2FC8A 2WONA 4WU2A 1AFIA 1RT5B 1LKZA 6AT1B 4Y3CA 5EHHA 1UPMB 3MPDA 3K8VA 5FDLB 1CSJA 2P8IA 3JSMB 3MAAB 3GSDA 2X1FA 3PW7A 4NXMJ 2AX0A 3PDNA 2KT2A 2ROEA 2RVJA 3QZ8A 3PG9A 3JQKA 5J1PA 4JI7F 1XR6A 4CLFA 2DHXA 1NKBA 4EBCA 4L73A 5K5MA 5B0CA 2DK2A 2KU7A 3HSDA 2DR9A 4MIAA 2Z58B 1W25A 3G8SA 1QAIA 2E1MC 5GAEI 3I31A 2JEIA 1EP4B 4HH1A 4DG1B 2XGQA 4FYDA 3OL8A 5K8OA 1NSAA 2VC0A 5HO4A 2IAJA 3PYDA 5I42A 4NYZA 2YNIA 2V2QA 2F8HA 2QA4G 1JNRB 2CDRB 3CEDA 4X62F 3NCRA 1CC7A 2EI5A 5KFUA 4X66J 4FZVA 5K14B 3QRRA 4P2FA 3LWLA 1RTDA 3TA2A 4DOZA 2PC6A 4DFPA 5ETTA 3WQPA 5DO2A 5RUBA 3H98A 2O67A 3VAMA 4HH0A 4OLPA 4P7VA 1UFLA 4AT1B 4K4WA 3HO1A 2W01A 2CXEA 3M8RA 1FESA 2UUAJ 1FJGF 2ZHAA 4FBTA 1AB8A 1T9TA 1ZBTA 3PO5A 1UAWA 2ZWOA 2UXBF 3Q8QB 4JI0F 2WOMB 2FC9A 4B9TA 4TYBA 2GHPA 5KT4A 1WI8A 3CSKA 3TJAA 1PYOB 1X4CA 4QW9A 3PYGA 2WVFA 3HZGA 1WHWA 2L9NA 3NRBA 3O5TB 4LF4F 5DRKA 3DOMB 4ZVUB 3DRRA 3ZZYA 3CJ3A 2EFNA 3CB4A 1J5EF 4X64F 3SEOA 1VMBA 3QIPA 4MIBA 2VF3A 3VAJA 2V8PA 2R7TA 5CZXA 2E1PA 3P96A 1IBMF 1F1BB 4O44A 3K5NA 2VASA 2AYBA 4B3TJ 3GYNA 3D67A 5E33A 2BQRA 3EICA 3Q8RB 3WHIA 3ZZZA 3LW5C 4B9LA 3PJXA 2KDOA 4DR3F 2N4DA 3QMQA 3OR2B 2J6SA 5HI7A 3KLHB 3NCQA 2OLWA 2VBZA 2QL7B 3HHLC 1HYSB 3L95X 4M5DB 4RZRA 2LLZA 2RHQB 2XS7A 4FXWA 3T5HA 2ZDPA 3MR3A 3HHLD 2CJQA 1I94J 5KFHA 1S1VA 3QATA 2MZ1A 2C3OA 2R7VA 2V5HG 1Z2LA 2ASDA 3QGGA 1ZM4A 3U27A 2JL9A 2RRNA 3HSJA 1M1KT 3NWGA 3M9NB 4NA2A 1HNZF 3FSYA 4ETXA 3DRPB 2ZH1A 1FWLA 4DR7F 2B8PA 1DTQA 1JJ2R 4YHHJ 3W5YA 2YKOA 4WF9Q 2XULA 3AXMA 2NS1B 4M94A 4H4KC 2XI3A 1LW0A 2OIHA 2DIVA 1FD2A 4NLQA 3BKTA 4ZPWR 5D0RA 4DV1F 5EGYA 2DEJA 2YWEA 1RTIB 4ER8A 3OXGA 3JS9A 2GIFA 4DSFA 5HQLA 2Z8QA 2D3O1 1YJVA 2CPDA 1PJ7A 3K5OA 1NNDA 2CQ2A 2GFFA 1U6ZA 3UN5A 2FJEB 3W66A 3UCGA 4CH0S 3V5RA 1SL1A 4IFVA 1FVSA 3LO3A 4L74A 2CQPA 1TL1B 3NBPB 2WVDA 2POKA 2A0FB 2VHGA 1QY7A 1LXNA 1VQLS 1ICEB 5KG0A 1WKJA 1WG4A 1JXEA 4OYBA 5A8KA 2PI4A 3J80Y 1V3RA 1WTBA 5DS7A 2FHOB 2ZVSA 2KRBA 2VODA 4OX8A 2CQCA 2YWGA 2IDLA 2R2SA 3FCWA 1ZTWA 2K1RB 5IQ6A 5KFTA 3CCTA 1DBDA 1DHMA 5L8RC 3RRGA 3SZ2A 5L1KA 5GAHI 4Y2KA 5KOXA 4UOHA 4ZVSB 3M1VA 5D0EA 1YTYA 1PC4A 1FRJA 1U47A 1RHMB 5IT4A 5ETMA 3KLEB 2HKEA 2YH0A 4FPRA 3W8PA 2HQGA 1EETB 3A8JA 2BE2A 4TY9A 4RO0A 5K8MA 3GMGA 3DLBA 1EAYC 1RABB 5IZHA 2FHMA 2VC1A 1V5VA 3QFWA 1Q7YT 1FDDA 1B4SA 2XM3A 1S72S 3TI0A 3ZXWA 2HQFA 4WZQA 3WX8A 3ILJA 2MDAA 3MMAA 3KG1A 4ZJQA 4PWDB 3C16B 3MEDB 1TFWA 4PWUA 4ZCLA 1N32J 5IC6B 2IM1A 1MG7A 2J7UA 4QWCA 4EZ9A 4O23A 4DHVA 2IPOB 2M52A 3UCZP 4KB7A 3I9V9 4HT5A 4P7TA 4ZIWA 1GH8A 3WDOA 1VISA 3OFHA 3OLAA 2IBKA 4N56A 1FE4A 1VLYA 1NJWA 1K8AT 2MPUA 2DRBA 2BW7A 1SKWA 2BEFA 1KLMA 3Q89A 3TVYA 3NXZA 4DV3J 5DM6Q 2DY9A 3M32B 3IRWP 1N34F 3D66A 1YJNS 4M5HA 4ZS6A 3EVOA 2ROGA 3I82A 2GIRA 3MOZA 3TUZC 4LMZA 2ZBIA 2N7CA 2KZZA 4Y0FA 3OV7A 2R9LA 4KHPF 3GONA 2MGZA 2L3MA 4R5PB 2VG7A 1NZAA 4LSNA 1X9SA 2YX4A 4KPYA 3IC1A 1X31C 2P9GA 4JYAF 2AZ3A 5B09A 5DGAA 2J6UA 2JLEA 3VAIA 2ROPA 3RZAA 2ZOGA 2CA9A 1SV5A 1UWAA 1MSWD 2FVQA 1IKXA 2EPIA 2LQ5A 2H1YA 2CNOB 2IMOA 3MM6B 2ZH3A 3F56A 3X3UA 2HMIB 2B9WA 4RNFA 4LR9A 2ZZTA 1XEZA 3OR1B 1SC4B 3OD2A 4KKOA 2VQFF 2U1AA 1AYEA 3W2WB 2A2DA 3KYLA 1JLAB 4Z37A 1FEHA 4PQAA 1Q8LA 1N56A 5KG1A 2BYCA 5KFFA 1FI4A 3FDSA 5LXRA 1VLOA 2B8QA 3FCVA 2HNYB 2NXUA 4BC9A 3E2EA 3MGJA 2B43A 1AFJA 4C8KA 4PQUA 4ZLLA 3OFGA 2HVIA 4HHUA 5HN0A 2OD4A 3GJQB 3TOQA 2FJBB 3EVWA 4TY8A 1DAXA 5HLFB 1PBUA 2WB1D 1U25A 2PA8D 4ANDA 1NU4A 2HRUA 1WC5A 4Y2AA 1JKHA 2HAFA 1F5CA 4DV7F 3I9ZA 3HX9A 1Q16B 5IS2A 3VHQA 5AXKA 1XIQA 1S1XB 1U1NA 4NRTA 3D6HB 3UO0A 3RTVA 4TKTA 1KSPA 3G82B 1TK8A 2GGPB 2CZ9A 1P9QC 2RJZA 5J2NB 2J0WA 3GG0A 4C0HA 3VAFA 4M5NA 2KVIA 1N5YA 2ZH4A 2FJVA 1D0EA 2VONA 5BR8J 3HHLB 5C25B 4CYUB 3KHRA 4P10A 2Z2MA 4ZPBA 3PIPQ 3IG1A 3PRDA 1T3OA 2KXNB 2LXUA 3G71S 2HZCA 3C66A 3TAQA 2QRRA 4IOCQ 2O01C 4WXOA 1YJWS 4OZ0A 2L9WA 3PKMA 1WD6A 2LQ9A 4J90A 3CO0P 1YJ7A 4OI3A 2PFDA 4A8SA 4URSA 1NHVA 1G2EA 2W9CB 4DL0C 4PUOB 2D69A 2C2OB 3IBCB 3R3TA 4I56A 4DV7J 1LWFA 1LWEA 2R8GA 1SJ3P 4IOBA 5ITHA 4LF7F 3VVTA 5F0UA 1VC0A 1YK9A 1TFYA 4DV5J 2ZH9A 3MCMA 2AJFE 5F9NA 4OHWA 4C97A 1E6YB 4F2SA 2ZE2B 2IRYA 1LW2B 2CQ0A 1Q86T 5J2MA 2HRYA 3ET6A 2ZZNA 4DSJA 2PMHA 3OTOF 5D78A 2VH7A 5CYMB 4N77A 2KKHA 2CVEA 1OQ3A 2R7WA 1U2FA 1ZH5A 4DZDA 2HFVA 2H54B 3BSNA 1C0TB 4B3MJ 3NLCA 4LBHA 4ZIVA 4MMOA 3ZTRA 4EO8A 1JLEA 2I9SA 2JX2A 2AKWB 4J9OA 2FVPA 1LEOA 5JMNA 4ECZA 4U6PA 5ETRA 3V4IA 5IT9U 4Z2XA 1VR6A 1GMWA 1SUQA 4N8NA 1X4AA 4EGLA 1L5UA 2HWTA 3D3CJ 1X5TA 3GSIA 4PG6A 1FX2A 5DQGA 3GB0A 1TK5A 2EFPA 4OX9J 8ATCB 3NGUA 1B0PA 1IKVB 1RLDA 1NEEA 4F50A 3DM2A 4ZJOA 2V4JA 2CWXA 3MMCA 1JNZB 2RKIA 2LDIA 1ULRA 1UKUA 1HBNA 2BUNA 4I4BA 4MYUA 1F6TA 2RQCA 4UQGA 3RBEA 2DHGA 3C8YA 3C6UA 3EZOA 2EG2A 4BHQA 1NJIT 2HHSA 1MN9A 3PTWA 3W3SA 2HWIA 3Q86A 1NKCA 2N7YA 1SQFA 3H5SA 4R0EA 1IKWB 1ELOA 1VS3A 1DY3A 3WC0A 5HAOA 3NS7B 4PRFA 1E6VA 1Y5LB 1OQ6A 3T3FA 3QGHA 4WFAQ 1P1TA 3AODA 1X9MA 3V6DA 3AJ1A 2SXLA 2MJUA 2XMMA 2VFTA 3MTJA 2OJ3A 1HMVA 4WIIA 2LMIA 2P9EA 2CNNB 2GO9A 2WZ1A 3MEEB 1QUPA 1K0VA 4EU0A 4Y2CA 3SCIE 4IYQA 4N76A 3LANA 3ENVA 3E3XA 4ECSA 1GK8A 3V2UC 2NUHA 1K44A 4DV2J 5J2PB 1FDAA 4I6WA 3FRZA 2FHJD 4WK3A 4CDIA 4A8FA 1SIZA 1JLFA 2C3MA 3VF0B 2LXIA 3EXCX 2N82B 1BMQB 4KBIA 3A8EA 3D68A 3GCXP 2VFVA 2X1AA 4YN3B 4ILLA 2EK6A 4USJC 2I1RA 3ISNC 1KONA 1H38A 2IBOA 4NASA 1FXRA 4N41A 2AEFA 3SFGA 3MR6A 4Q5VA 2HVEA 1QUVA 3HFVA 2PMZD 1JJ4A 4ED0A 4WFXA 2M2BA 4I2QA 4ICLB 1RT4A 3T5LA 2ZD1B 3PHTA 3QBCA 1CJTA 1HARA 2OH2A 2W1BA 4ZDNA 4IKAA 4JOUA 1XNQJ 4HACB 1RACB 3VALA 1CLFA 1HL6A 4DPUA 3CD6S 5CXTA 4WJBA 2JOQA 4LR7A 3IR5B 2G0CA 1B70B 3HLUA 4KGVB 4DFKA 3NMRA 1Z4UA 1RGVA 3VAKA 1KHVA 2QG9B 1P1LA 1ZM3A 1IXKA 3FMBA 4EBEA 2XCPA 5MLCV 2VIHA 1HBOB 3V4MA 3D0IE 4ZLPA 3FZBA 2O66A 2YKMA 1LFPA 1IR0A 2F5GA 4BDPA 3NS6A 1KS2A 2N3LA 2AF6A 1J5OB 4C9DA 4M95A 1LQ9A 4RNMA 1K47A 4P71A 1GMVA 2DRDA 5EX0A 2OKQA 4ED7A 2LCWA 2RU3A 2HSEB 5KT7A 4UT4A 1Q81T 3SDEB 4JI3J 1X7VA 2GW8A 2ADCA 4DQQA 1FD8A 2B4VA 3JB9k 1X9WA 1R6YA 4LF6F 4A8MP 1P6TA 2F40A 3U1MA 3UCUP 2BANB 1HD1A 3CJ2A 1JXLA 1YJRA 3KKFA 3LP0A 3PX4A 3SSRA 4FKXA 1N5VA 4LFAJ 1IBCB 2P9CA 2HBYB 1AT1B 5DETA 1K9MT 1S7HA 2E5GA 1HR0J 3NGKA 2E7VA 3R7BB 4CI0B 4B08A 2WCXA 2VG6A 2LU1A 1OO0B 4ZVQB 1EHWA 5ETOA 3ILOA 4YB6A 4DX5A 1FJEB 4YR3A 4DR2F 4DLGA 4NA1A 4UY8T 1YBTA 1OY8A 3RW7A 2MB0B 3NOGA 4YB5A 4LRFA 1BGXT 1T95A 3PYFA 4JI6F 1SJFA 2X51A 8AT1B 1Q78A 1AW0A 1ZM2A 3ZFVA 4M8LA 4M5MA 3SI8A 3POTB 1TP7A 1VQ9S 4LIWA 4E2FB 3IRXB 5IM0A 1H98A 3CF5Q 1H7XA 3MHYA 1PKUA 1PBAA 1VQ6S 2RE1A 5BYRA 1RWVB 2ERRA 2ABYA 1XJWB 1RHKB 2HEKA 5E3QA 4GKJF 4MKYA 3TZXA 3BKFA 3T1HJ 2V8VA 4ES2A 2H3EB 5LM7E 2UXDJ 2DT9A 5DLGA 3KJQB 1DLOA 4ED5A 1WI6A 5GAGI 1AROP 3EE3A 4I7FB 2DNLA 3TYTA 4CNYA 3OW2R 2RAQA 1VFJA 5EN1A 4ECVA 2CPXA
chains in the Genus database with same CATH topology
3KG4A 4Q7AA 1FKOA 1N88A 3AY0A 5KT2A 1SC6A 1DQ8A 4ALZA 2E1RA 3K5LA 3MR5A 1K73T 1LWCB 3UD4P 4Y6IA 3OL6A 2V2KA 1X4HA 1QLNA 4WKRA 4LUBA 4RW6A 4J9SA 4ECYA 4QCLA 4RW9A 2LA6A 4OI0A 3OR2A 3KOAA 4ECRA 3K59A 2DNRA 3KLHA 2EWHA 1T05A 3IR6B 1SUQB 4NLGA 3G6VA 1TKXA 1U1RA 1S4FA 3I5CA 4O3OA 1HYSA 4K4UA 3TA0A 2M8DB 1ZAWA 1M5PC 1HBUB 3FGVA 1U45A 4M5DA 1FKAF 2GMHA 3QLHA 1FVQA 3KK3A 1MU2B 1VK3A 4NLOA 1R8PA 4F25A 2V8HA 5A0YA 1HNIB 1FNXH 3LP1B 4OIXA 5LMUF 3T6BA 2PFFB 5A2QY 2ILZA 1TR0A 2J9CA 4YB7A 1FXDA 3HVTA 4IQXA 2BR0A 3M8PA 4N8OA 5L9XA 4CH7A 4RW7A 2PO4A 4X4OA 4KSEB 2V4JB 5F41A 1KC8T 2HHUA 1NHUA 2DGUA 3MMCB 2L9DA 2CVIA 2QSWA 3Q2SC 5CH7B 2MHNA 3FSIA 2W7PA 1HBNB 2VFSA 1BQNA 1S76D 5EUHA 1FXLA 2VQEF 1IBLF 4KO0A 3I56S 2B5JA 2E9TA 3I0RB 2OFHX 2PE8A 4X4NA 2WB4A 3KTQA 2D9PA 2Q1LA 3Q0AA 1MNEA 2KJWA 3KWMA 4NYOA 1N33F 2BVZA 3RAQA 5E3CA 2MKCA 2GHWA 3BB5A 4MK8A 1ZZFA 4B9VA 4DWIA 4W92B 2YY3A 4HEA9 2CQIA 4BCAA 3KHHA 3B4DA 1M5OC 5G0RA 4UUWA 2IC3B 1IBKF 5L1LA 2MQPA 1HBUA 2OTJS 1MU2A 1UVMA 4DV2F 2BDPA 4NA3A 3PNIA 4X4QA 1S1WB 1T94A 4NZ0A 4BS2A 1F2GA 2IRXA 2W8KA 3G9CA 1RYSA 2DNNA 3HP6A 4DFJA 2PD1A 2Q66A 2FVRA 5A6WA 2ZUGA 4ZPTR 2EFGA 3UI3A 1H2TZ 4MIWA 3OVAA 1BQMB 1TUVA 4B9SA 2KO1A 4K4ZA 5CYQA 2MHEA 1S9EA 4DQPA 1HPZA 1PO6A 4J5OA 4JBCA 5KFLA 2W25A 2YKPA 5DQIA 1GTHA 5LSLA 4V19J 3V6DB 4IRCA 3AA8A 1HNWF 1KR4A 5A8RB 1QAJA 4NWBA 4K0KF 2VBWA 3MTKA 4JUZA 1H2VZ 2FIUA 5F8MA 5F8HA 4EFAC 1Y0HA 3DLKB 3ZZPA 3CJ5A 3SCJE 2JC1A 4RNOA 1VQPS 2DJWA 3CCSS 4DL2A 2ZDOA 2HS0A 1RT6B 1DFDA 5M2PA 4YDXA 1I1GA 2KXHA 4N47A 3S6EA 1NB7A 1NK6A 1RTIA 4OZJA 1YBAA 1TAUA 1S6QA 3L7OA 2BABA 1Y4ZB 3BREA 3MECB 4B02A 4QZVB 4A8XA 5DGBA 4PXBA 5C42B 2CQ3A 2R8JA 2P5VA 1C1CA 2M88A 4ZCMA 2V0NA 4KQZA 2XY7A 2KJVA 1XNRF 2ZJPQ 1N5TA 2OFGX 3VZIA 2GNKA 2QA2A 2UXCF 1TL3B 3MCSA 3AB2B 3D1QA 4GC7A 3GIMA 1NH8A 2MZRA 1N48A 1PSDA 1DJ0A 2DH9A 2HWHA 1KOOA 4NRUA 3TVKA 1BQMA 1S10A 3WBZA 2JC0A 2HHWA 5KFJA 2QIFA 1YWXA 4MH8A 2D7SA 4CO2A 3PFEA 2V8DA 3LP2B 4FP9A 2PSZA 3AQPA 5T41A 3WZ0A 3HVRA 5A8RA 3NCPA 3CCUS 1TL1A 2MKHA 3ONQA 3CVKA 3OPKA 2XMTA 5DG8A 4OV1A 5EWGA 4X4SA 3KJVB 3NBPA 3RBDA 3HHDA 3LQVA 3UD3P 4NLRA 2FJWA 3DLKA 3FRYA 4KGMA 4A4JA 3LAMA 3VQSA 3I0SA 3BN7A 3R5BA 3IXQA 3BQ0A 3BEGB 2VG5B 1M90T 2F1FA 1JLCA 4IDKB 1X5SA 2R2RA 2GJ2A 2RF2B 3RB4A 2YH1A 3DFEA 4CQ1A 7FDRA 3MI7X 2M4MA 1S1TB 3QWUA 4LT6A 3AH6A 4E98A 1CPZA 3MECA 4E0DA 2D74B 3KFWX 2V4RA 5C42A 2X1BA 1HFEL 1P8GA 4HTIA 4K5SA 4AL7A 2JH3A 5AJ3F 1JLGB 2XI2A 2YKAA 2YNGB 1YGYA 2AYMA 3BQ2A 1L3KA 2L48A 4C98A 2RB7A 4KJIA 2A2CA 3UWTA 4YQWA 1X4FA 3N6NA 4Q45A 1FTRA 5J2QA 2HHHF 2V9WA 1HW9A 3KNGA 4ZMMA 2K1RA 4WK1A 4TU7A 3D1HA 3EUNA 4F3QA 2DGTA 3D5MA 3PXGa 2UV8A 2MQLA 2ZZMA 4ZCKA 2HFNA 3MM5B 4I2QB 3LP2A 1RQ0A 4ELVA 1ZPVA 1Q1KA 2E66A 1AXQA 1RT4B 4PXEA 4NOHA 2OMOA 5EX3A 1BLUA 4I64A 4ED1A 3KJVA 2XBPA 3TP2A 2CPFA 2XWYA 5FLXY 2WSFC 2FB0A 4DDFA 5CCLA 1C1BB 1WEXA 3ICLA 1CQMA 1W2BR 1LK5A 5U47A 2JLFA 2XC9A 2HNZB 2LEAA 1N5QA 1ZM9A 5HMYA 3GILA 2RMLA 2LEBA 1SI9A 4UOCA 3TANA 3T9NA 2UVUA 1PGZA 4LVOP 1SJRA 3IO1A 3DOLA 5B0DA 2V4QA 2B7BB 4J9KA 4HYKA 4EYHB 4KT0C 4FNHA 1NK0A 2ZKUA 4LVNP 4PPDA 3U02A 1EETA 3DLEA 3MMJA 4CZCA 4QR1A 1JLGA 2YNGA 2XMWA 4JI3F 3OTCA 1VIXA 4XDCA 5CZVA 1TVRA 3I96A 5KFIA 2DR7A 4E8UA 2W4DA 2HPUA 3CD7A 2I38A 4NCGB 1SL2A 4TYAA 3RB3A 1NH7A 2WAQD 3K5MA 5JXSA 3FSXA 4QW8A 5B08A 3HPOA 1R0AA 5IXUA 4ZVGA 2B4PA 4BWJA 5I4MA 3F73A 3NMAA 2W9AA 3OFFA 3MM5A 3JTOA 1U1QA 3PEHA 2QA4S 2QMWA 4TU9A 2E1CA 1WF1A 4LF8F 3N79A 3UR0A 3MEDA 3GZ7A 5F0WA 2YKMB 2FC8A 2I5JA 2WONA 3MPWA 4WU2A 1AFIA 3TX8A 1RT5B 2IVFB 1LKZA 2GCFA 3OUYA 1N8RT 4K2XA 5LXYA 1C1BA 2WW8A 2FLPA 4Y3CA 2QYCA 3DOKB 4MTPA 5EHHA 4P6QA 2HIQA 2DPJA 3DI6A 4QYZJ 3BSOA 3EXYA 4LFAF 1TKTA 4A47A 1HWUA 3HFKA 4OZ1A 3H4BA 4H4MA 1R43A 5ADZA 5GMKa 3GIKA 3K8VA 3N5FA 5FDLB 1CSJA 1RISA 3CDBA 1FDNA 3JSMB 4QJVA 1J2VA 3MF5A 3FNNA 3GSDA 1F5BA 1KQGB 4OLOA 4Y2IA 5KT5A 3BN4A 5T14A 2CJAA 4DF8A 1HR0F 3GFZA 3JYTA 5CQGA 2X1FA 1JLQB 1UJ4A 3GV7B 2D9OA 1DARA 2U2FA 4BWMA 3PW7A 2ALZA 2X1GA 4QU6A 2DNOA 2IAJB 2XMKA 6FD1A 2DRAA 2AX0A 4Y65A 1JLBA 5I42B 1S48A 3PDNA 1ZAXA 2KT2A 1HHSA 1ROFA 2IM3A 3BGRB 2KRRA 2YNIB 3PM9A 2D3OR 4RU2A 3BDPA 4G3IA 4CTAB 4O3RA 2ROEA 2RVJA 1KOHA 3SCLE 3QZ8A 3M32A 2KT3A 4R8UB 5KG2A 5J1PA 2DNHA 4JI7F 1XR6A 4X2BA 3CCQS 5D4LA 2B0GA 1VQMS 3T9ZA 1WWHA 3UR3C 3W7BA 2BV3A 2DHXA 3QYYA 5T7LA 1M5VC 2OSQA 4ZKAA 1NKBA 4EBCA 5KFXA 4H54A 1X0PA 2VBYA 1R89A 4CO1A 4JI5F 5K5MA 5B0CA 1G6BA 2DK2A 2LVWA 4JI2F 3TUIC 2KU7A 3H40A 2DR9A 4X4UA 3IAM9 1T03A 4Y00A 2W9BA 5KOWA 4LIRA 3IGVA 4MIAA 4IRKA 3QIDA 1S9GB 1W25A 3LP0B 4ECQA 2DPIA 2FVSA 4OZLA 4ES1A 2MKKA 1IKYB 3G8SA 1QAIA 1C4CA 4JI4F 2E1MC 5GAEI 3HHNB 5LMNF 3I31A 2JEIA 1MMDA 3JSMA 1EP4B 2XMJA 2OPQA 3ITHA 3RB0A 4HH1A 5D8HB 4DG1B 2XGQA 4IUFA 4FYDA 4Q0BA 2KM8C 4OZ5A 4R5PA 2YQ3A 2F8MA 3OL8A 2YVSA 5K8OA 3EZ5A 2VC0A 3IWNC 1S0NA 2B56A 2W4PA 4YUDA 2RIJA 3KK1B 5HO4A 1OPIA 2IAJA 5I42A 2B6AB 4NYZA 3RRKA 3E01A 2YNIA 2B9YA 3CD0A 2F8HA 4DS4A 3MXHP 2QA4G 1JNRB 2XO7A 2GQQA 2VG6B 3CEDA 3NNAA 3CIZA 3CD5A 3U1NA 4ECTA 3NNHA 5KFRA 4R8UA 2WTFA 4X62F 2WSCC 4O0IA 3NCRA 3M8QA 4NZ7A 1CC7A 2EI5A 3QZ7A 4LF9F 5KFUA 4DLEA 4FZVA 3NG8A 5K14B 2JEFA 1C4AA 3P3DA 2XB2D 5B0GA 2FLOA 4G1PA 3TRGA 2AJ0A 3LWLA 4RU9A 2O3DA 2E9RX 2LDYA 4H4OA 1RTDA 3MM6A 3TA2A 3CCLS 3UE2A 4DOZA 2PC6A 1N5SA 1HI1A 1VQNS 1U4BA 4DFPA 1BD6A 3DRXA 4ZPCA 2M0GB 5DO2A 2FUG9 2A18A 1HQUA 2EVZA 5KTQA 1D9AA 3H98A 2O67A 2V8GA 3VAMA 1KN6A 4HH0A 2JJ4D 5F9LA 4OLPA 4P7VA 3JAMY 4J9RA 1EP4A 2A10A 5DQHA 1QTMA 2EFOA 4DG1A 1UFLA 3CCZA 1FRHA 2HQIA 3DRRB 1SH3A 4OI4A 1I6JA 2FLNA 2CPHA 3PFOA 4XPCA 4K4WA 3LWMA 3T1HF 1JMTA 1JLAA 3HO1A 1REVA 3KK1A 3M8RA 3OSPA 2UXDF 5KT6A 2KYXA 3SV4A 1KFSA 4DR6F 1FESA 1FJGF 2BA9A 4NLTA 2ZHAA 4YR0A 4FBTA 3QJJA 1ZBTA 2JLGA 4NCAA 2R7QA 3DU6A 3PO5A 2HAIA 1UAWA 2KG0A 3KLIB 4RBVA 2JVOA 3Q8QB 4DQSA 4FXDA 2UXBF 2K7JA 4JI0F 2WOMB 2B7CB 5IM0B 2ASLA 1MMNA 2DISA 2FC9A 4B9TA 1R7IA 4WYWA 4TYBA 1N54B 2GHPA 5KT4A 1WI8A 1SKRA 3CSKA 2HNYA 1X4CA 4OJ1A 4QW9A 5KG4A 2BQ3A 1IN0A 4URGA 5L39A 4J9QA 2DNYA 5H9FJ 3HZGA 3BO2A 4AUKA 3M2UA 1PILA 1WHWA 2NREA 1O0PA 2OPSB 4N5SA 3QO9A 3TUJC 2L9NA 1DQ9A 3NRBA 1T3NA 4NL5A 1S0VA 2N4CA 3OTBA 4DL7A 3O5TB 4DL4A 2UVRA 3EZUA 4LF4F 5DRKA 5KFGA 2P6SA 2PGCA 3DRRA 2W7OA 2KFNA 5HLFA 2LQBA 3IS9A 3G6XA 1SQEA 4YR2A 3MM7B 3ZZYA 3M6WA 3CJ3A 1GXLA 1XBWA 2ZC3A 3MPVA 2EFNA 3CB4A 1J5EF 4X64F 3CMAS 3SEOA 2BXJA 2BZ2A 4HHJA 1VMBA 3J7ZT 3QIPA 4WFZA 4F4XA 4MIBA 3VAJA 2XNQA 3JTPA 1B0VA 3CCWA 2WK4A 2YKQA 2XLJA 1S9FA 2R7TA 1FF2A 1HWLA 2JRSA 5CZXA 2DIUA 3BO4A 2B4OA 4DJBA 3P96A 3V81A 2XMVA 1IBMF 1N0UA 4AL6A 3L7PA 5HQ8A 2Q43A 4JI8F 2DBBA 4O4RA 4O44A 4O4GA 3K5NA 2VASA 3DDKA 3DMJB 2AYBA 2OMLA 5AE1A 5IT0A 3D2WA 4IH5A 1U7LA 2QZ8A 3GYNA 2P6TA 5E33A 2BQRA 2KHDA 3MEKA 3R5AA 2CQ1A 2ZKTA 5E5NA 3Q8RB 1KVIA 3ZZZA 2DHSA 3LW5C 4BC7A 2RDIA 1UA0A 1FKOB 3THPA 4KE5A 4B9LA 5KFBA 2G4BA 1UJ5A 3MZIA 3PJXA 2KDOA 3QAEA 4DR3F 2M8HA 2YNFB 1UWBA 2IVYA 3K58A 4RW6B 1U49A 2N4DA 3QMQA 4RW9B 5KG7A 4X4TA 3OR2B 3L09A 2J6SA 4NXNF 5HI7A 1RDRA 3LF0A 3KLHB 3NCQA 5AE3A 2E9ZA 2OLWA 1GTEA 2VBZA 3SQGA 3OL7A 2DTJA 4C8LA 3K5PA 3HHLC 1SL0A 1HYSB 1NO8A 4NLYA 3BS9A 3L95X 1YSJA 2Q6BA 2UUCF 3H5XA 4LSLA 4X4RA 4M5DB 4OX6A 3HHLA 4LQ3A 3QLHB 4RZRA 2Q3PA 1DTQB 5M2UA 2LLZA 3KK3B 5KFAA 2XS7A 4FXWA 4Q44A 2MQQA 3T5HA 2CQHA 2ZDPA 4YDDB 5A0YB 3MR3A 4QWDA 4MK7A 5KAKA 1TQLA 5GADU 4WTYA 3HHLD 2CJQA 3HVTB 3M8PB 5KFHA 1S1VA 3NAIA 2MZ1A 2OO4A 3LGNA 4FNIA 3US5A 3DMJA 4XO0A 2KZMA 2C3OA 2R7VA 2V5HG 3H5YA 2DR5A 2ZBCA 2E44A 1XMQF 1Z2LA 2ASDA 3QGGA 1UJ6A 1BQNB 2R8IA 1ZM4A 4K4TA 3ZC4A 4KO0B 5GVQA 2R7UA 3U27A 1UVLA 2B5JB 2JL9A 4YY3F 4FBUA 2I2YA 2RRNA 5FIIA 1RI7A 1ZYQA 2E1AA 2GJIA 2YNFA 4ZHRA 2YWHA 1M1KT 3NWGA 2C3PA 1LFWA 1H6KX 3CDWA 3QWPA 3N28A 1WHXA 4NA2A 3M9NB 3CCVS 4EBDA 4ED2A 1VGYA 3EX7B 1QVFR 5AXNA 1HNZF 1BY9A 4OZNA 4DR4F 5G0RB 3FSYA 3DLHA 3FJ2A 3CCJS 2MQNA 5F3TA 4ETXA 3DRPB 3OHBA 2ZH1A 2W9CA 2IM2A 1YJUA 3BM7A 4DR7F 3M2VA 3H2LA 2IYGA 4F02A 5DG7A 2GMLA 5JUMA 1DTQA 4EWTA 2JSXA 1JJ2R 2CDQA 3OXLA