4DUZF

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u13c, bound with streptomycin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 22
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4duzF00
2UUAF 2UUBF 4AQYF 2ZM6F 5LMUF 1B64A 2E5LF 4OX9F 1XMQF 2HHHF 1XNQF 4LFAF 4JI1F 1IJFB 4X66F 1IBKF 1IBMF 4B3RF 4DR2F 4LF8F 4DR4F 3ZZPA 2UXCF 2KJVA 4X64F 4DV5F 5AJ3F 2UXDF 3R3TA 4JI0F 1HNXF 4NXMF 4JI5F 2VQEF 1FKAF 4DR6F 4KHPF 4B3TF 2BXJA 4GKKF 4DR5F 4JI4F 2RJZA 1N32F 4GKJF 4JI7F 4LF4F 4YHHF 1G1XA 1N33F 2VQFF 1CQNA 2UUCF 2F4VF 4JI6F 1IJEB 2BVZA 4LF7F 3OTOF 1N34F 1J5EF 4DV6F 4DUYF 5BR8F 1HNZF 4X65F 4NXNF 2YY3A 4DUZF 4LFCF 2B7BB 4LF6F 5IWAF 1F60B 2B7CB 4JV5F 1HR0F 1G7CB 1VMBA 4X62F 4B3SF 1I94F 4LF5F 4DV3F 1N36F 4LF9F 1CQMA 4DV0F 4LFBF 5LMNF 1RISA 4DR3F 4JI3F 1GH8A 4DV7F 4B3MF 1HNWF 2KJWA 3T1YF 1FJGF 4JI8F 4JI2F 4K0KF 2UU9F 4DV2F 1IBLF 1XMOF 1LOUA 4DR7F 2UXBF 4JYAF 1XNRF 4DV4F 2J5AA 4YY3F 3T1HF 1QJHA 4DV1F 4DR1F
chains in the Genus database with same CATH superfamily
1AFIA 4CIOA 2ZM6F 1D09B 3I56S 2G1DA 2HWIA 5A76A 1RCOB 3GCWP 2GHWA 2I0XA 2CQIA 3QRPA 4B3RF 1YTYA 2QYCA 1NK0A 4M5IA 2XYHB 4GO5X 1ULRA 3SQGA 2VG6A 5A0YB 2P2CB 4IRKA 4O44B 4R8UB 1QSSA 2BXJA 2ZKTA 3AY0A 2HFNA 2VPWB 5G0RA 3GWCA 2KFZA 4UQGA 1FTRA 3MEGA 3DLBA 3GSDA 4RUCA 1RYSA 3KLIA 2GW8A 2JFKA 2PA8D 1T9WA 2MZRA 2W9CB 1I94F 1SJ1A 4DR5J 1IKXA 2PA3A 4IDKB 1BC6A 1U4BA 2LQJA 1JJ4A 1S0VA 1FE0A 1M5KC 1T94A 1Q81T 4DX6A 2CPYA 1MW7A 2DNYA 3ISNC 3B4DA 4HLBA 5KT7A 4NLWA 1M5PC 2W2OP 5DM6Q 5B09A 1WC3A 4JI2J 2XY7A 1Q8KA 4WU3A 3PX0A 5ETPA 5IFMA 1KQGB 2R7TA 3UCGA 4ENOA 5K8PA 1L3VA 4RWXA 1S1VA 3E01B 1T9TA 1W26A 2VG7B 5FDLB 3FSIA 1RT2B 3HT3A 2JOQA 1D3WA 3ENWA 4OYZA 1EETB 1J5OB 3DOLB 3GZ7A 2Y1LB 2A18A 4XAKA 1RT1B 1LW2A 3ZO7A 1CC8A 2BACA 2AKWB 4OYAA 1FKOA 4K4WA 1FX4A 3M9MB 1TTHB 4WPAA 4FBTA 4N8NA 2MJUA 1CLFA 1ZOTA 4NI2B 2Y1RI 4DMZA 3MFIA 3KG4A 2DTJA 5DRKA 4PXCA 2VD3A 1SB6A 1S6QB 3KJNB 2X7IA 1VQLS 4X4QA 3VAHA 2BDPA 4HTJA 1VR6A 1KRPA 4USKA 2N7YA 1JLQB 2H1YA 1UL3A 3CEDA 4YHHF 1PIEA 3CD5A 2CQPA 2PN6A 2BJEA 3D2WA 3J81U 2CA9A 1RT5A 2L48A 4KPCA 2CPHA 1TKZA 4C6AA 4NXNF 4C8YA 3Q2TC 1Z1ZA 1V6HA 3M1VA 1NJWA 3VZHA 4HKQA 1V9OA 2ZZTA 2NUHA 2HVHA 4RWWA 3EE3A 4BCAA 2QX0A 1RTHA 1NZ8A 4DV7F 3VAIA 4ES2A 5BR8J 1WJ9A 1WELA 3T5LA 3LP2A 2E1PA 5A2QY 2NQPA 3SCKE 4BHQA 3MCSA 4ZPDA 2ZJPQ 2ZFHA 3PIPQ 4QR2A 3CCTA 3NS7B 3RB0A 4WFZA 4DL7A 3TI0A 4OZ2A 2B9XA 2WAQD 4PYDA 2N3OA 2DRAA 4C8ZA 5A6WA 5IOLA 4N76A 2FHOB 4A8KA 2UUBJ 4RBUA 5IZHA 1SI9A 2H5IB 5AXLA 1SXLA 4HH1A 4FZVA 2D74B 2ZH9A 4ECQA 1NNDA 2P5VA 2CPDA 4YR2A 2YNHB 4RR5A 1WSVA 2CQDA 2R2UA 3G96A 1NB2A 4GMKA 4IG0A 4P9SA 2B6AA 4ECRA 3V6KA 3DRSB 1ZETA 4CH7A 2B7BB 2YQ0A 3ET6B 4OI2A 4IR9A 3NP5A 5IT0A 2PDAA 1S0MA 3SBMA 3TA2A 2FC9A 1OPZA 1JLCA 1AYEA 4IG0B 2WVBA 1HNVA 3W8GA 4ED7A 2WB4A 3TYTA 1TK5A 2XMAA 3GJQB 1PAUB 5KG6A 2HS4A 2ALZA 3H90A 3IWNC 2EFGA 3R5CA 2XI2A 2JVRA 4C11A 5C25B 1CJVB 5J2NB 1YDLA 3KLEA 2ILYA 1FNOA 1VBKA 2FUG9 4HI2A 3ZTSA 5EUHA 3L09A 4I4BA 1RHRB 4UOGA 1S9GA 3I32A 4C8NA 3HHEA 5J1EB 4DLEA 3H59A 2X51A 4RW4B 1XMQJ 2ZKUA 5KFYA 3G6XA 1Y5IB 1IKYB 2AJ4A 4DF8A 4YEAA 4DCJB 3PW7A 1BD6A 2EFQA 3W7BA 1QLNA 4JOUA 1REVA 2Q6CA 4A4JA 3AD7C 4RKUC 4X4SA 4H4OB 3GMGA 2EK6A 2HMIA 2M4MA 2BE9B 4BWMA 2CDRB 4J9MA 4LFBF 4ECYA 3WDOA 3C19A 4EYIB 4FDFA 2GIQA 3DKDA 3UWTA 3VTIA 2DRDA 3BBFA 4NX9A 1QD1A 4KV8B 2K8GA 2IFXA 2KHDA 4YFUA 1ROFA 3ZTOA 4EWTA 4M94A 3MM6B 1VIOA 2NZCA 2JHEA 1FDAA 2N7CA 3ZZOA 1WDTA 2ZWPA 2QFJA 4CLFA 3GIKA 4NMXA 5CYMA 4X64F 4KKOA 5IXUA 2VBXA 4USUA 5KFNA 4Y0FA 3PEJA 5D4LA 4I1TA 4MKVA 2CUYA 5T14A 1N33F 5I3PA 1H7XA 2GCFA 2QA2A 2QMWA 2DB1A 5IM0B 4X4OA 3W64A 1FWKA 1FJEB 5D77A 4JBCA 1VBYA 4B9TA 4KY3A 3FBFA 4OLPA 3GJRB 4OHYA 2PGCA 2AGOA 2AV5A 4RNMA 1VBXA 2D3O1 2H4WB 1FFGB 3HK2A 4PWUA 2OEKA 3I82A 4DV4F 1O8BA 2J8SA 4M5MA 1KQSR 2HQIA 1C0UA 2L08A 3CJKB 3SCLE 1SL0A 3R5BA 4R0EA 5F3TA 4OX6A 2RF2A 4P72A 2RRBA 4UF4A 3P3DA 5K14A 4DG1A 3C8YA 2MTLA 5T7LB 4OQJA 3QAEA 1P1LA 4NE9C 2IYGA 1X5SA 2DNLA 3L7PA 2QT7A 3BGLA 2DNNA 1JLBA 2KT5A 4P2SA 5KFAA 1IBKJ 3R5JB 2V69A 1VDHA 3LP1B 1RT4A 4JV0A 4FYYB 3A4TA 4ITSA 2C3PA 4OFZA 1VRUA 2XEXA 4DQQA 2W4PA 4ANDA 4DV0F 1RT6A 1GH8A 1HW8A 1BXNA 1DQAA 2HGNA 1UEUA 3KK1A 3CD0A 1PKUA 3FMBA 2GAHC 4YB1P 3MMBB 2LA6A 3DOMA 4X4UA 1NK8A 3BSAA 4K4YA 3M2VB 2KI2A 3C3LA 1HBOA 4JV1A 3BSOA 3HMJG 2C28A 2ZZMA 1WF0A 4BLGA 3RAMA 1DURA 4RO0A 1VRQC 4CCHA 2KXFA 1HIYA 4WKRA 2W1BA 4ECTA 4YY3J 2BM0A 5F8HA 2MY7A 3RBZA 2OTJS 5ITHA 3D7SB 1S77D 1U1RA 1NH8A 1UZHA 4W98A 4Y28C 1T95A 5KFKA 2OJ3A 4CO0A 1QVFR 4ED1A 3IRXA 4CNYA 3PEHA 3KWMA 2D3OR 2IA0A 3PVXA 2F9DA 1HMVA 1S57A 4JUZA 1BWVA 1C4CA 2QL5B 2XZWA 4LF1A 3CJ8A 2W01A 3BYPA 3BN4A 1TFWA 2Z58B 3AB4B 4J9NA 2H4YB 4J9SA 1Z2LA 3AOBA 1RISA 2V2VA 3BO2A 3T1AA 2UVUA 2KJWA 4TN2A 2Z2LA 3IC1A 3CCMS 2PMWA 3CPWR 1NAQA 1PYTA 1QJHA 4FYVB 2DPJA 1PC4A 2K3KA 5LMNJ 3QSIA 3KMQA 4M5DB 3WC0A 3HHDA 3EZ5A 4NZ6A 5LT5A 1VYAA 4KBIA 2J9EA 1JLFA 1FXLA 4QIVA 4CQ1A 2M8DB 2ZBCA 4PQUA 3DDIA 2MZQA 3EVOA 3W65A 1T05A 2ZOGA 1HHTP 3WIVA 1NJYA 1KWMA 1X4FA 1RA7A 1R31A 1N32F 2FY1A 3AQOA 4LRBA 4W90B 1IBCB 1VQ7S 1F2GA 1FJCA 4B3RJ 1KVIA 5C24A 2HLTA 1U6BA 2VB6A 4RBVA 2JJ4D 1X5PA 3QQCD 1UKUA 4LFCF 1T05B 3KG0A 1QE1B 1APSA 4PYAA 2FVCA 4DEZA 1VQNS 2M3DA 1CQMA 1XR6A 3DLGB 1VQSA 2XZTB 2RNEA 2E5GA 1VQPS 4F4KA 3GR0A 1L3TA 3EVMA 1RBAA 5HLFA 2JC0A 2KB2A 3D1QA 2KXNB 1I94J 4O4GB 5F8GA 4O0IA 3DCAA 3IR6B 4DV6J 3U7JA 2YH0A 1BGXT 1UJ5A 1WF2A 2NLWA 5FIIA 4OI0A 2XO7A 3DYAA 2O3DA 4P73A 3P49B 1WDDA 5A8WA 1XERA 2Y0SD 2JEGA 3NAIA 2KJVA 3E51A 4LR7A 5A8RB 4I7FA 3CUNA 1XR7A 4MYTA 1ZTWA 3SDEB 1RTIA 3DLHA 1X4HA 3MM8A 5HVFA 2NXUA 5J2PB 5AE2A 4U7UD 1KLMA 1TL1B 3FNNA 5L39A 1UFWA 2LFVA 4P2FA 2AQ4A 1UFKA 2Z2MA 2HHHJ 2HWTA 1LK7A 2W2QP 1LQ9A 1CSJA 1AW0A 3W66A 4E8UA 3TQ1A 5SUHA 1M90T 4U7UK 1M0SA 4P2MA 3R2DJ 1HFEL 3M7VA 2AYBA 3R97A 4EZ6A 4KJIA 1Q79A 1WI8A 1YGYA 5DLGA 4ID5A 3W62A 1A0OB 3ZZRA 3UDLA 2G0IA 4CO3A 4ZP7A 3KTQA 5C42A 4B9SA 1DLOB 4ZN1A 3UD3P 2YNFB 2V4RA 1X7VA 3SXLA 2M8HA 2KM8C 2BQUA 2BOPA 3GU0A 4GKKF 5D0RA 2WBMA 2V2QA 5KFDA 4YB6A 4C2MA 2F8MA 3OTBA 3FQKA 3WX4A 3Q2SC 4L74A 4DPYA 2ROEA 1M1GA 1IKWA 1RWXB 1VBZA 4FYXB 5IV3A 4KGMA 5E3PA 1S1TB 4YHHJ 3TZYA 2MKHA 4Z2XA 4WU2A 3Q8SB 4F36A 4NXNJ 3IWXA 2V2ZA 3MMAA 1HNIA 5J1PA 3MR5A 1I5OB 3IG1B 2DEJA 2HPUA 4X4RA 4O3SA 1OSDA 1S1WB 4C3KA 2NXCA 2EXUA 5KFTA 4DV7J 1U6ZA 1K44A 4M5JA 3AJDA 2AJ1A 3DHWC 3RTVA 1HBUB 1ELOA 2JDJA 1FI4A 3CJ5A 3MAHA 2XYPB 4ZCLA 4HEA9 3DLEB 2B8PA 3H0PA 1QDUB 1TL3B 1E6VA 1U0HA 3M8QA 3EPIA 4B02A 1UPMB 4F7VA 2ZJQQ 4I6AA 1S76D 2V9WA 1RGVA 5L1KA 3D3CJ 3SQOP 4DSFA 1N6QB 3NGKA 2GZOA 2V9KA 4F26A 4QQBA 2HQDA 1F2HA 2O1PA 2LLZA 1X4GA 1YZ6A 2A2DA 3NOGA 1U2CA 4CTAA 2YPZA 2D3UA 5M2UA 4O3OA 2R8HA 3DLLQ 1BMQB 4YQWA 1R8PA 3HVRA 2KM8B 3D1OA 1H2UX 2MPUA 1TV6A 5D3GB 1S1UA 3PX4A 3SI8A 3KG1A 4PAAA 1LXNA 3TZZA 3G6VA 2UUAF 2KT2A 3EX7B 3QAUA 3CC2S 1DRZA 2DNZA 5KG7A 1R3NA 5HK4A 2OPPB 3S1TA 4K2XA 1H38A 3EDRB 1KOOA 4CLPA 4PG4A 1IJFB 4X66F 1EIYB 3KLFB 2J0QD 2UUWA 2AP6A 2KYXA 1VRTB 2V63A 1CBKA 1FWLA 5DDPC 3POTB 3UVJA 4R0JA 1WI6A 3Q8QB 2MQPA 4DCPB 2PMZD 1MN9A 1N5VA 2HFVA 2RDDA 4C7QA 5DZ7A 2RRNA 3D0HE 2XSFA 3IAM9 4EO6A 3VQSA 3TP2A 4X4NA 5IWAF 2QA1A 3W5YA 2CPFA 4N7TA 3K0JA 1D9AA 2HAFA 2G0CA 4OZ5A 1G6BA 2ZH4A 1GMWA 3CSKA 1U45A 1T03A 4RW6A 1C0TB 1S0NA 2C3OA 8ATCB 4N41A 3DNCA 4KHPJ 2VDIA 2CQBA 4WF9Q 3UN2A 3BGRA 1U1LA 5CXTA 2OPRB 2PIIA 4LFBJ 2E7XA 3HCXA 1CJTB 3ILLA 4RNOA 1HQ2A 2HRUA 3D66A 2NSCA 2YBVA 5IC4B 3R7NB 2FVRA 4IQXA 1XN9A 4LIRA 1OSCA 1RXOB 4DPUA 2H9ZA 4ZIVA 1T8EA 4V19X 2G1HA 2BMBA 3SSQA 1SQGA 3LWMA 1X0PA 5KFLA 2CPZA 3OTOF 3RW7A 3GIIA 4X64J 1N0UA 2DCUB 3D6TB 1GMVA 4C3LA 3N6NA 3G9CA 3N01A 1K0VA 2YH1A 1BQMA 2I9SA 2V4JA 2EK1A 2X1FA 4OZ0A 4BWJA 7FD1A 4ECUA 1N33J 2OEMA 5KFUA 2FHKA 1ZM3A 1TK0A 4DFJA 3SSSA 4Q8FA 2AX1A 3I4PA 3PZPA 1ZPWX 2V0NA 3OSPA 2BE7D 2IIHA 2BM1A 3I0RB 4DFPA 5IT9U 2R8JA 4LVNP 4Z7CA 1OQ6A 1UCNA 5KG5A 3KJVB 1GNKA 2MLXA 2DNPA 4KO0A 4ILLA 4DV4J 2RQ4A 1S6PA 1RQ0A 1SL2A 1IR2A 2OKQA 2YWEA 2HWHA 3EZUA 3PG9A 4A47A 3JSRA 3CF5Q 4DR4F 4MKBA 3BYRA 4LQ9A 2IDLA 2AYMA 4CLSA 1DFDA 5DO2A 1RAHB 3RR8A 1XC9A 4C3MA 3HHNB 4F3QA 3DRRA 4WYWA 4OL8A 1UW4A 3W5ZA 3IM8A 2XLIA 4TU8A 4J9KA 5GAGU 3US5A 5I3UB 1MWYA 1UEKA 1IQZA 1JLAB 5KG1A 3GP9A 2V4QA 2YKOA 2FJXA 5CD4A 4DV1F 2M52A 3I4HX 4IFYA 1FNXH 1U1QA 4L6V3 1R0AB 2DGVA 1CJKA 1U02A 1QUVA 2E5LF 4Y2KA 1K0TA 3EWGA 2J9DE 5FLXU 1RWNB 2ZVIA 4OI1A 3KUEA 1F5AA 1BQNB 2KYZA 1S99A 2E29A 3V4IB 1KD1T 2BANB 4DQRA 4WP3A 1D8ZA 5HQMA 4EEYA 3EGZA 3D68A 4OHWA 1VI7A 3K57A 1U24A 5HN0A 2F8HA 1K73T 3MTKA 2PC6A 4KH0B 1UETA 1A6LA 4LSLA 1D1UA 5K8NA 4ZVPB 3IS9A 2DHAA 4LR9A 3T9ZA 3VALA 3OL6A 1X4DA 3MMCA 4MIWA 2HHQA 4FPIA 3GYGA 5EWFA 4LIWA 3HFKA 2MLYA 1L3UA 2YNGA 3KMSA 4WKYA 1HQEB 1EX8A 1WNEA 1U1NA 5IQQA 3ULHA 4DOZA 3I31A 4FNIA 3MMCB 1ZZNA 3N5FA 3L3CA 4GVLA 1N52B 4TYBA 1CPZA 4N5SA 3LGMA 1XEZA 1YVFA 4XPEA 2F7VA 1MMLA 5KFGA 1FRXA 1DTQA 2MQNA 4DX5A 3PJ9A 5ADZA 5G4DA 1LWFA 5KFJA 2E44A 5L1LA 2UP1A 2H3EB 1FKAF 3PRDA 3W2WB 2XULA 3FBBA 4PKDB 3D5MA 3RRGA 4ECSA 4AUKA 4LF4F 3I96A 2VQFF 1S9FA 1MNEA 4CLWA 3TZXA 4KGVB 2EEYA 4V1Ak 4F4ZA 4ZJOA 3VVTA 1SJRA 4NCGA 3T6JA 2W2PP 3AAWB 2D7SA 1N32J 4UY85 1VJQA 4Q7AA 4WFXA 5DETA 3V81A 1XWLA 4LFCJ 5HVHA 3KHHA 4EI2A 3K7RA 3G82A 1T7PA 5C7PA 1S1XB 3TEGA 2CVIA 2DISA 4GO7X 4DSJA 1S7IA 5BYRA 4WK3A 1B64A 3O8WA 3CDAA 2AHOB 1WSRA 3J80U 3QNWB 3BKTA 4RBTA 5KT6A 5H9FJ 2IAJB 2ZH7A 5JMNA 4NLRA 2HHTA 2AMCB 3H8YA 3NXZA 5GADU 5K5MA 2YVSA 3GPAA 1W2BR 1SUQA 3OR2B 1VIXA 2F5GA 1Y9OA 4JI7F 4QR0A 1VC5A 2Z8QA 4K8RA 2AX0A 2VFSA 2YY3A 3JYTA 4PABA 2XO6A 3DFEA 2VFVA 3PHEA 4MIAA 5LSLA 3I9V9 3OR1A 5HMWA 1HHSA 3DOKB 4WFAQ 1RLDA 3ISND 3MUTP 1LFPA 3A3PB 2QSWA 2KHCA 2MLZA 3P6YC 4Y6IA 2BKNA 4QYZJ 3M8WA 1OYEA 2UV8A 1CJUB 4AE5A 1T0TV 3M9NB 1VQOS 2MXYA 4OX9F 4IUFA 2DH8A 1F6TA 3L7UA 5D0GA 4ECXA 5D0HA 3MM5A 2ZHBA 1UTAA 2HYIB 2D3ZA 4R5PA 1FERA 1OYDA 3C16A 4WIIA 4RUBA 3CJTA 1RT3A 1ZPVA 3C15B 2IYIA 1JXVA 3OVBA 4OYXA 3JAMU 4HI1A 3NAHA 5K9FA 4EUVA 4RW7A 1IWAA 2VDHA 4TQRA 1S7HA 2OSRA 1LWEB 3U1MA 2BE2B 1WC0A 4DBQA 4JI3F 2JLGA 3BM7A 1ZAWA 1GXLA 1XMOF 2MQLA 1IXKA 1YRUA 3A8JA 4USWA 2ZBPA 1F3VA 3K8WA 3UO0A 1Y0HA 4FYWB 1HQUA 3RAQA 3T5KA 3HDSA 3S8SA 3FRYA 4AFFA 2CRLA 1RTDA 2FJBB 1QTMA 1NBEB 5E3CA 4DR2F 3MM9B 1N4LA 2YKAA 3UPFA 2XMWA 3OSNA 3LH2S 2ACMA 4BS2A 2JEIA 2Y8YA 2N4DA 5B08A 3DDKA 5J2QB 3NG8A 1RTDB 4PEOA 3LO3A 4ZJQA 1LWCB 2DXFA 4YB7A 2NS1B 5LL6d 2HW3A 2OH2A 1JLEB 2B4PA 4RUAA 5IT4A 4Z37A 2J0SD 2V2KA 3QSYB 3ILIA 3DLJA 3I0SB 2DJWA 2DR5A 1HHQA 5F8IA 1I51B 1WG5A 2A6MA 2VONA 1G2EA 4QZVB 2HK2A 2YXLA 3DMJB 4ED5A 3PNIA 4LBPA 2Z30B 3GTYX 4G1QB 2BJDA 3BDEA 2IM2A 3DI6A 4E0DA 1XJWB 3FFIB 1JKHB 1NU4A 2GJFA 2ACYA 3VCDA 1S97A 4TY8A 3M05A 2QFIA 4X4VA 4Y3CA 3C6TA 4NYZA 3TVKA 2UUAJ 3FCHA 3AH6A 3FEYB 1YJ9S 3AA8A 5MAOA 2V67A 3G8QA 4ECVA 3KLGA 3M30A 1SJQA 1CULA 2CPJA 4P74A 2Y1IA 3PHTA 4X66J 1KEKA 3MCOA 5I4MA 4ED2A 5HMXA 2UVVA 3M8YA 1WD6A 2GGPA 1FFWB 3EDQB 1UEVA 3D4JA 7AT1B 2KFNA 1YQHA 1HPZA 3GJTB 3W9JA 2KH9A 1RWKB 2V68A 2HRTA 4A46A 1A7GE 2VFRA 2DPIA 3GFZA 2DCLA 2HFUA 2JVOA 3LPYA 1HI0P 4FS1A 5IWAJ 3UR0A 3TUPA 3FQLA 1FA0A 1A9NB 3UDCA 4FXVA 2WOMA 3ZC4A 4G1IA 2WVEA 3VVUA 2H5JB 4ANEA 3G87A 1EKSA 2CQ4A 4J9VA 4NLQA 3H40A 3DRPA 3M2UA 1K1SA 4Q0BA 3BSCA 3VQTA 4J9LA 3CJ4A 3FBEA 2UXDF 4HACA 2DNMA 4U8VA 3TOQA 3B4MA 3GCXP 4PUOA 1O6XA 1SJ4P 4FXDA 1RHMB 2B4VA 2E1MC 4ED8A 3HJVA 2YWGA 1TL7A 3I5BA 1MROB 2WONA 1LW0A 4CYUB 2GS8A 1RACB 3CC4S 4LRDA 3Q8VA 3JQMA 4LF5F 1SPBP 3OL7A 3BS9A 4B9UA 4KFBB 4I68A 2CZ9A 4I0WA 3AQPA 4CZCA 3OTOJ 1X31C 1NLKL 3RG6A 1CS4A 3KNAA 4I67A 4I2QA 4DR7F 5KFOA 2W9BB 4DR1F 4I2PB 3ITHA 3O44A 2VBYA 4WE1A 2QLBB 4DSIA 5AXKA 4MFBA 2XMUA 2Z56B 2FLOA 1NSPA 2KL8A 2DKOB 4IFVB 2GAGC 3G8SA 1P9YA 3VWSA 3JTPA 5DLFA 3HLUA 4Q44A 2Y1JA 2BQ3A 2GA7A 3ONQA 2KZZA 3WQPA 4PCQA 2FD2A 1S0OA 4NCAA 5HSPA 3QIPA 2HVEA 3W9HA 4DDFA 1KFSA 3SFUA 2XMMA 2KZMA 4AT1B 1XBWA 5I3QA 3E8OA 1R8CA 2VV5A 5KG2A 3HVAA 5H9EJ 3KK2A 2VBWA 4X4PA 2HRYA 4DR4J 1KFDA 4DLGA 3NNAA 3PRBA 2ILZA 1X0FA 1W25A 2HGLA 5E0OA 4UZCA 1VOMA 5GMEA 1S72S 2LA4A 4J91A 1QM9A 5B0AA 4PRFA 4K5RA 3L7OA 2D41A 2XMJA 3H7HB 1YX2A 2O66A 2YWWA 3QIDA 2OPSB 1EB0A 1MWQA 4XIUA 2F1FA 3OXLA 3HPOA 3ISZA 4GVBB 4Q2MA 1F0XA 2LXIA 5A8KB 2AEMA 3TUJC 3ILOA 4LSNB 1TKXB 3H2VE 2ADCA 1RAJA 3MUVP 4LQ3A 2GHPA 1PJ7A 1H6KX 2KVIA 2E5LJ 3MHYA 5HP1B 3M32B 2OPQB 3TX8A 1QAXA 4X4TA 1H98A 4LF6F 5HANA 3SMZA 3UD5A 2XY5A 3GYNA 1Q8IA 3DLKA 3S6EA 2ZD1A 5KOXA 1Y5LB 2AF6A 1ZS6A 2VPYB 1RCXB 3TA1A 1R7IA 2OI2A 1YG0A 2J7WA 2GMJA 4MK7A 1C1BA 2LQ9A 2EKYA 1TR0A 1HBMA 1U7LA 2DY1A 1U25A 3ZNJ1 2QG9B 4P52A 1NUEA 1FK9B 1TL5A 3PM9A 4C0OC 3RJMB 4ZA1A 1MMNA 3K58A 2IJNA 4KTQA 4IO9Q 2JSXA 1Q0NA 3SYZA 4JP8A 3ILJA 4C8OA 2A3JA 3OFGA 4ZPTR 4KYZA 1SVDA 1TKTA 3CCJS 3V6JA 1FKPA 2JZ5A 1VLYA 2NCKL 1L5UA 1JXEA 5KFFA 4QIWD 2OSQA 2YKMB 3CW2C 1N5SA 3F56A 4KE5A 1SQFA 2UUCF 3R8YA 5GMKa 1X4BA 2YKNB 1ZYQA 4KSEB 1PBUA 3OUYA 1OQ3A 4KHMA 1NJXA 4K7QA 1PILA 1NEEA 1JK9B 5D15A 1IM4A 2HNYB 1FFSB 1S9EB 4NLYA 5RUBA 5LOQA 4ER8A 3PFOA 3A13A 1R89A 4TNOA 6AT1B 4LF4J 2VQFJ 1JLGB 5E7OB 3OFHA 2ZJRQ 4U8YA 2Y8WA 1FDNA 3QRRA 2UU9F 3CO0P 2ZNYA 2GIRA 4ELVA 1JB0C 3K89A 3D6FB 3MOJB 3N0VA 3BN7A 2UVRA 4HVZA 1MSWD 2HKEA 3KHGA 2D9PA 3BKUA 1NK4A 4KAIA 5KFSA 1RKIA 4IOAQ 1IM6A 4EZ9A 3JSMB 5HBMB 3Q22A 3BDPA 3S01A 3GIRA 1I6JA 3A12A 2H51B 3QGGA 2EG2A 5F8MA 2HHSA 3ZZYA 2F4VF 2DGOA 3QO9A 4ZHRB 4HDHA 4M5NA 3F73A 4OYWA 2DO4A 2VHGA 2JL9A 2LQBA 3BZQA 4JI7J 5ETMA 2C22A 5KT2A 1JWWA 7FDRA 4F2SA 1TVRB 2EKNA 4C9DA 3NMAA 3FEXB 4GC7A 9ATCB 2XHCA 1N8RT 3ZZ0A 1RT7B 3K59A 2JC1A 1REGX 4DL6A 2VF3A 2F40A 2DHXA 4PQAA 3OXFA 4QWBA 2R42A 4DN0A 3IBWA 5KFBA 1FEEA 3MEDA 1MWZA 4C98A 3QJLA 2LEBA 5JJBA 2F4FA 1JQGA 3DGPA 1T9YA 1AA1B 4J9PA 1ZA2B 5L9NA 4ICLB 1F1BB 3MF5A 5KFRA 2Z57B 4DV5F 5D78A 1UPPA 4LMZA 4NXMF 4HH0A 3J7ZT 4OX9J 2ZE2B 1T9XA 1XR5A 1PC5A 2IJFA 2OEJA 3OJSA 3CDWA 4FP9A 4QU7A 2FZKB 2NREA 4H4MB 4WBFA 1NRKA 4TY9A 3D9BA 2QL9B 2QYGA 3T19A 4PWDA 3LF0A 3O1LA 4DUTA 2N4CA 3QT8A 4MKYA 3G6YA 2K2PA 2A1BA 3HHKA 2HZCA 3LTOA 1KVJA 1EP4B 1HBNB 2HLUA 3GV7B 4PWWA 2FGCA 4MK8A 3MEEB 1VK3A 2E5IA 5ETVA 2PEHA 2CQCA 3FZBA 1FHTA 4TQSA 4DS5A 3MPYA 4JI3J 3CC7S 2CJYB 2IM0A 3Q86A 3BBCA 5CA5A 3FKBA 2CPXA 2HNZA 2RUGA 1WTBA 1XMOJ 1IVZA 3D0IE 3MAAA 3AJ2A 3RZAA 5D0EA 4FKYA 5KFCA 4FN5A 1C1CA 2XNQA 2FHMA 1FX2A 3IRWP 1RHUB 3SQGB 1SH2A 4UUXA 2VG6B 3T9NA 5E41A 3FZ2A 2Q79A 3MGJA 2ABYA 5EX3A 4ZPCA 2AWZA 3LP0A 1PG5B 3DXSX 4I6YA 4L3NA 1D8YA 4TKTA 5G0RB 4DR2J 3SV3A 2ZOFA 4DV6F 4ES1A 3MEGB 4DX7A 4R25A 2WHOA 1S4FA 2ASLA 2ZDPA 4O3RA 3KLIB 1T11A 2GNKA 3ZTRA 4Z7YA 1RBOB 5LSOA 3Q8PB 1B70B 4M8LA 1IKXB 4AYBD 4WZQA 2KT3A 1VHIA 3UFCX 3QLHA 1HLWA 4CLYA 4BDPA 1EHWA 3PTWA 2HNDA 4WXWA 4LRCA 2IBKA 1XNRF 4CDIA 4RZRA 2FB0A 1NMEB 1UMJA 3MCNA 2MYFA 1F3FA 5KFMA 3OLAA 1V3SA 1D0EA 2VG5A 2HHHF 4JB8B 3ADAC 2IVMA 2B43A 1NK7A 1KTVA 1PYOB 1GMWD 5BXIA 2GQ2A 2UXCF 2XY6A 3KK3A 3Q24A 1YK9A 3C6UA 1XQIA 1NHVA 2IC3A 1IKVA 4Q5VA 1BY9A 1WC4A 3CTRA 1RAFB 1H2TZ 1UVLA 1MU2A 2IM1A 3U02A 4JI6F 3V6DA 3TRGA 1S1VB 3NLCA 2BJ9A 2M9KA 4RW8A 3AHPA 3J81j 4J9QA 3P8BB 2PFFB 4NA2A 1HD0A 4UOCA 2RIJA 1S59A 3E2EA 5K8OA 3KLHA 3BEGB 3N28A 1N0VC 2ZWOA 4OJ1A 2YNIA 1LW2B 4M5HA 5L38A 1RJJA 2HGMA 1IBLF 3GQCA 3C66A 3MOZA 1FKOB 2DD8S 2ZH1A 2CJAA 4IH6A 1WTFA 2HHXA 5F8LA 3O3LA 3K2YA 1SKWA 1SJ3P 5C2CA 4ZP8A 1H73A 2B3TB 3KNGA 3CJQA 3AOAA 4Y2AA 2CAJA 2V8DA 3MPUB 1TFYA 4CT9A 2LEAA 2DXDA 2MMYA 3D6HB 3MPDA 3HVTA 4L76A 4DU7A 1T3OA 2V6AA 1RT5B 1SIWB 1NH7A 1TKZB 2UXDJ 1VFJA 3H42A 1F60B 2AYEA 1P1TA 4ALZA 3PW4A 2J76E 3B78A 3M1VB 3SZ2A 1U1OA 2CQHA 1VQ6S 3TVYA 5D4NA 1YJNS 1RTHB 3EGNA 1JMTA 2P9EA 3AB2B 3N6LA 1DBDA 3LP2B 5KOWA 1FDBA 2ZH6A 4IG3A 3UE2A 3VGVA 1RU2A 1E6YA 3TJAA 4ZJLA 4LF5J 3SIPB 5H9EK 2EG1A 4UT4A 2DGSA 5K8MA 4AL6A 1ZBTA 1NKBA 1H3DA 1R8AA 3QT6A 2U2FA 1XNQF 1ICEB 1WACA 3VAFA 1S5ZA 4DR7J 1XMBA 4H54A 4BC9A 4NLOA 2BBEA 5B0DA 2G9OA 4DR1J 2PI4A 3ZZPA 2ROPA 2DVIA 2K1RA 3NGTA 2OGUA 4CH0S 4HT5A 3RB3A 2C2OB 3CB4A 3PXGa 4OLOA 3BV8A 3M2RA 3LANA 4W4MA 2M88A 1J5EF 2B6AB 4QIGA 4IO1A 4U67Q 1ZM2A 3MTJA 4QYRA 3QMQA 3W60A 4BC7A 4DQSA 3TAMA 2EFOA 4OYOA 5LJ5Y 5A6PA 3QGHA 2RT3A 4QW9A 2BV3A 1FRHA 1T3NA 1N5YA 1S79A 1Y00A 1JLCB 2VKZG 1HNVB 1YBTA 3EXYA 2QA4G 2GVDA 3BGOP 4LT6A 4YR0A 1HKAA 2VICA 3T1HF 1RWUA 2KDOA 1TELA 1Q5YA 2C2RA 4RNNA 2I38A 1NDPA 2Q43A 3CJ2A 1RAEB 2DGTA 2Z2ZA 2XWXA 4WFYA 2QV6A 4C11B 5JUMA 5EWGA 4ZDNA 3KLEB 3C14A 2LKZA 4RUHA 5KT5A 1FRJA 1VLOA 1UVMA 1GFWB 1WKKA 2BABA 1QTNB 1S9GB 3EYZA 4YP3A 2CG4A 3NBPA 2AU0A 2L9WA 3EM1A 2Y0BB 4KHPF 2DH7A 4FS2A 3MM7A 5HQLA 3V4MA 2F8EX 4WP8A 1U8SA 1CEZA 2ZOMA 2CJQA 3R5AA 1FCAA 1IR1A 2C2KB 4NEZA 2ASYA 1CVJA 1REVB 5KG4A 3KFWX 3D1HA 3P5BP 3VAMA 2HMIB 1SC4B 2IPOB 2V94A 1SC3B 1FO1A 4I6WA 4DL3A 4JI8F 4LF6J 4K0KF 3OHBA 3MECA 1FXRA 1CC7A 1RTJA 1VCTA 2CQ2A 5HROA 3RYLA 2FZCB 2CNLB 3V6HA 3TVZA 2QMUB 4ZPVR 1GMUA 4YDDB 1YJUA 1Y3JA 3EUNA 4N77A 3RBEA 5ETNA 4J5OA 2VASA 1WEXA 1LNQA 1U8WA 4N8OA 3FSXA 3PO4A 1KSPA 4LF8F 4PXBA 1TQLA 3M6VA 1YZ7A 5CYMB 1ZZFA 4KKOB 2NSBA 4ZN3A 2OAUA 3HSDA 2RQMA 2R2SA 1Q4RA 3W9IA 1Q16B 1AZSA 1Q7LB 2XHWA 2QIFA 1EQMA 5DQHA 2E9RX 2DITA 2F65A 2AGQA 2RH3A 2HIQA 1NZAA 2HQGA 4DZDA 1ZAXA 2UUCJ 3G2XA 3RRHA 1DQ9A 1KP6A 1WOPA 3R5DA 4F4XA 3QZ8A 3RGIA 3D28A 1C0UB 2X1BA 1HNZJ 2I5JA 1WOSA 2PI5A 2QTWA 2RF2B 2UU9J 4WTOB 5K14B 4DG1B 4MYUA 5EN1A 4LUBA 4ERDA 4OIXA 5CHCB 1GX5A 1PAEX 3G8TA 2FPHX 3T1YJ 3FEZA 1B7YB 4F25A 1JLBB 4I56A 2VPXB 1QY7A 4AL7A 2J7KA 3W8PA 3ZXWA 4MTPA 4F04B 4U6PA 1WWHA 4DHVA 4DUZF 1R0CB 4EGLA 2CWXA 3ZTQA 1RT4B 1TZ0A 3GV8B 3L4BC 1DTTA 4CI0B 4CLTA 1WEYA 2Z2YB 2IBOA 1VRUB 3PDNA 3TW0A 3R2CJ 1RT6B 2F4VJ 2MKSA 4USHA 2WBRA 1QAJA 2RB7A 3KK1B 2L9NA 2MGZA 3TNVA 1FF2A 3DOMB 4NYOA 2BX6A 4IOCQ 1LV5A 1FVSA 5I42A 1YLXA 3HSJA 2K3IA 3VAKA 1HBOB 3JTNA 3G6ES 2VOOA 4B3OA 2NYHA 1PYSB 2JEFA 2QRRA 2HQ3A 5CYQA 4AD6A 4DZ6A 2AJQA 1HI1A 2H54B 2XNRA 3CVKA 2LECA 1UZDA 3CMAS 2KVQE 4OZ1A 2XZDB 1RDRA 3JQJA 2QC3A 2VFTA 2CPEA 2GJ2A 5HAOA 4ZVOB 2YX1A 2UZAA 1SCJB 3NS5A 3JSYA 3DDNA 3IRXB 2I6WA 1NSKL 4DV5J 3VR1A 3I5CA 1HMVB 5AE3A 2KU7A 1XIQA 3M8PA 4IKAA 4TVAB 4NXMJ 5GAHU 1UWBA 4QWEA 3HP6A 2CZVC 2A6OA 1VQKS 1BLUA 2VH7A 5BYQA 5J2MA 3J7A1 3UN3A 2YX4A 2M2BA 3DC2A 2AIRB 4UOFA 1YRTA 5B0FA 1NK9A 5KFHA 4ZVGA 1X9WA 2HAIA 2VC0A 2OD6A 1LXJA 2DNGA 2X1GA 1NPPA 3W2VA 3Q0AA 1RZMA 3D67A 3K5NA 2B56A 4IH5A 2XM3A 1JJCB 4ED4A 3GG1A 3W63A 3KOAA 4ZLPA 2BZ2A 5IS2A 4ZVUB 1JLFB 2RMLA 2I8EA 2GVZA 4PQUB 3AD9C 4QU6A 3CJ0A 1AROP 4LJMA 2D9OA 4QWAA 1LKZA 5BJRA 2BYCA 2XLJA 2W9AA 4DFMA 1RWPB 2R7OA 3CNQP 5D6GA 1Q53A 5JVHQ 4LVOP 1KDNA 5B0CA 5C24B 4L72B 3L95X 4RW9A 4X65F 2R7WA 5CZXA 1HWIA 3PYDA 1FEHA 3RB6A 1PBAA 5HO4A 1VMBA 3L9ZA 2VA2A 2E1RA 2QN6B 3JXOA 5E2QA 3NGSA 2C2MB 1GXTA 5HVGA 3N5BA 3D6MB 2B5JA 2XTJP 4ZVHA 4IOBA 4J9RA 5HLFB 4ES3A 2Z4PA 1TMMA 1U1MA 4XK8C 1NDCA 4ETXA 5LSRA 3ENQA 4F3OA 1HYSA 3GFYA 4A8QA 2ZHOA 1NM2A 3MI7X 3MWBA 2CJKA 4QCLA 1R8BA 2HIYA 5ETSA 1XNRJ 3D3BJ 4NZ0A 1TMJA 2J6SA 2CPIA 3DYAB 3H4DA 5A8WB 3RR7A 1OPIA 3CCLS 1L3KA 2DGWA 2RQKA 4JI0F 4I7FB 3LGNA 1WHYA 3HXMA 4LRFA 1UW9A 4DPOA 2HBQB 2ERRA 1RTIB 4GC6A 3MM8B 2HBYB 3HHLA 3FBCA 3KHLA 2CDQA 2CIMA 2JFDA 3A3NB 2E7VA 1KLMB 2M0GB 2UXCJ 1VQ5S 3I87A 4QPXA 3G86A 1ZM9A 3PYEA 1G7CB 1VQMS 4X62F 3QBCA 5C5JA 3K5OA 4HYKA 1Y4ZB 1KN6A 4JI6J 1J2VA 4FBUA 1RHQB 3KUGA 2GMLA 4J9UE 4ID5B 1IBLJ 1KNZA 2MDAA 2JRSA 5DDQC 5C42B 1S12A 4FKXA 5A0YA 5KFWA 3T41A 2EW9A 4O44A 5JXSA 4R8UA 2HVDA 3U1LA 3G71S 2AYGA 2BA9A 3NKYA 3S7RA 1FJ7A 1O51A 1B4SA 3T5JA 3C2PA 3TZWA 3P4UB 2R7VA 1EKRA 4J7CA 2X3DA 1Y10A 4NLGA 2CADA 4DI6A 3BQ1A 1IKWB 1OY6A 5B7WA 4PR6A 2W9CA 1FESA 1T02A 4ZPBA 2YQ3A 5ETKA 1X4CA 2GC8A 4IDKA 2WK4A 4O3NA 1NHUA 5M2RA 4NLSA 3EMTA 2IMOA 4ZP9A 4YOEA 2GO8A 4CNZA 2W4DA 3BBBA 5EX0A 3MMAB 1HNIB 4CM2A 1N88A 3AXMA 4G1PA 3VV2B 2I1RA 4JI4J 3CD7A 3RAXA 3TX0A 3BSNA 6FD1A 3ZTPA 1DZ5A 1PGZA 2O67A 1RUSA 1Z2ZA 2R9LA 3EJMA 4QR1A 5K20B 4NA1A 3NL0A 2ZH3A 3R27A 2IHR1 4B9MA 4KB7A 3CDEA 1RAOA 3OV7A 1NKCA 3Q8YA 4OI6A 1YHQS 2NYIA 3C46A 2ZUGA 1QSYA 1HWUA 4K5SA 1E6VB 3M8RA 4RLEA 2KFYA 1U0HB 3M8QB 4NPOA 1XNQJ 1BE4A 2H48B 2VJVA 2CNOB 2P9CA 4Y65A 3RBDA 3E01A 3KDOA 3RU0A 4ZIWA 3GIMA 2VG7A 5FDLA 1R6YA 8AT1B 2JNJA 4NLTA 1RT2A 1RU1A 3OL9A 4U95A 1DQ8A 1WC1A 1B99A 1EETA 1J5OA 2FY8A 3SCJE 3DOLA 4NWBA 4NRUA 1NJZA 1S4EA 1RT1A 4P2XA 3KXDA 4CTAB 1J5EJ 1YJRA 5KFQA 2BR0A 3GJSB 1JNZB 2EBEA 5GVQA 3AOCA 3MR6A 3PY8A 1TV6B 1S1UB 2Y9HA 2RQCA 3PIOQ 3F44A 3IWLA 4NI2A 2Q3PA 1K9MT 2K7KA 2QJ3A 1LEOA 1GTEA 2VA3A 5HI7A 4EO8A 1HI8A 2QA4S 4D3GA 3DM2A 1UA0A 4NA3A 4K2JA 4ELTA 2WSFC 3T1HJ 1S6QA 4DL2A 3H2LA 1YKWA 2R2RA 2CKWA 2FYXA 4KIAA 1HNXF 3UVJB 5GAHI 1LK5A 1T9VA 1BUXA 4F3MA 1JLQA 1ACMB 2W24A 3V5RA 2YKQA 1KKHA 3DM2B 2DRBA 4EU0A 2KKHA 1NPRA 1N34F 3QFHA 4C8LA 3OBIA 4TXSA 2B7CB 3PO5A 4OX7A 3AODA 1H0HB 3M9OB 2G2OA 3ZZTA 4RL1A 1RYRA 1WHVA 5J1NA 2LXUA 1T03B 5E3AA 5L9XA 4RW6B 3IR5B 2DY9A 3I6PA 2NR0A 3IP0A 4I69A 1NJIT 2Y3YA 3BGRB 2AT1B 2JX2A 5SZTA 4C0BA 4AQYF 4O3PA 8RUCA 2G13A 2HQFA 4CLKA 4RNHA 4JI8J 2MEWA 4K0KJ 4FNHA 4JI1F 3BQ0A 2EVZA 5GAEI 1WHXA 3NGUA 4ZVSB 3H5XA 4A48A 3KLVA 2YNHA 2DR7A 3NS6A 1WKLA 3OHAA 4W92B 1UVNA 4LF8J 3D54A 4USIA 2BRKA 3DRSA 2WCXA 1OS5A 3ET6A 4OX8A 1VQYA 4IR1A 5E33A 1BQMB 2V4JB 4F8RA 4DV3F 2QZ8A 1S10A 3KJQB 2HSEB 4N56A 1GEHA 4G6VB 1QSLA 5KFXA 2QGFB 1FJGF 1RLCL 2YQ1A 5DS7A 2MZJA 5MLCV 2ZNZA 3LAMA 5CCLA 3PJWA 4P71A 3CCSS 1ZAVA 2OFGX 5C25A 1CJVA 5J2NA 3HF5A 4WWSA 4LFAF 3QWUA 3NWRA 4KO0B 1HWLA 1RSCA 3TUZC 1S6PB 3MEKA 1RWWB 2RRAA 4F0HA 2CNNB 2W8LA 4EBCA 2CZ4A 5J1EA 3HX9A 2V8HA 4KC5A 4RW4A 1FTCA 1M5VC 1M1HA 5THWA 4C8MA 1IKYA 5U47A 1RB0A 2E1AA 2AGPA 4QW8A 2CG8A 1KVKA 1UWAA 3DRRB 2IRYA 2RU3A 3CMQA 1O5JA 4H4OA 4NCBA 2DGXA 2DNOA 5ETRA 3QPIA 1EJ7L 1MMDA 4CT8A 2OLWA 3FSYA 4L75A 2MZTA 5ETLA 2A2CA 2KG1A 1HNWF 2J6TA 4YMEA 3IAS9 4FF4A 4DUZJ 1AT1B 3HULA 4KV8A 1IUJA 1JXLA 3GFXA 5FD1A 1FDDA 1HARA 3TEHB 2C2DA 2K7JA 4IFYB 3MM6A 3QGPA 1CJKB 2E7WA 3LPEA 5DQGA 4DUYJ 1KONA 3ETMA 2Q1LA 4DX8H 1QAYA 2ZBRA 1W2IA 1VC6A 2VKRA 4MIBA 4OYBA 1JNRB 3IXQA 2XBPA 1NSAA 1N5TA 2IJRA 2BQRA 1HL6A 4HT7A 4A8XA 3DU5A 2LDYA 3QT7A 2MKCA 2WSCC 3AXKA 1Q82T 2L41A 3ZZUA 5IM0A 4PPDA 5KT3A 1KQFB 2WW8A 2E66A 4YDXA 1MG7A 4LSLB 4QIEA 2R7RA 4O4RA 1XK8A 3IS9B 3THPA 2PT0A 1P27B 4URGA 3OTDA 2HHUA 3HVWA 1S48A 4WCEQ 3PR5B 4A8MP 4Y34A 4NLXA 3MAQA 4HHJA 3OPKA 1V5IB 1ZTTA 3IBCB 1VQ9S 2YNGB 3UCUP 5CCMA 2P8IA 3CXCR 1P6TA 1KLNA 2B4UA 3CJKA 4WTYA 2VC1A 3IR7B 2YPYA 5T7LA 1UVKA 1DTQB 2DK2A 1K8AT 4WXOA 4OHZA 1LWFB 3CCUS 4JI5F 3ENAA 4G65A 1Y3KA 4UY8T 2EPIA 2RU9A 2YKPA 4FF1A 3LP1A 3OXGA 2VOPA 2HBRB 1TL4A 1IN0A 4LBIA 4HL9A 4NCGB 3R6LB 2JLFA 4ECZA 2R4FA 1TAQA 2FLNA 2OUGA 1FWPA 2GO9A 4F4AA 2RDIA 3B82A 2E5JA 4ZLNA 3ZNUA 2MKYA 4X65J 3V81B 3MCMA 3MMBA 4UUWA 1N5QA 4USMA 2G2YA 2XGPA 3G82B 3UW1A 3M2VA 3N4WA 2PE8A 3THVA 2VJUA 2V34A 4MH8A 4OZLA 4ATNA 5KT4A 3H25A 2DXEA 3FCWA 2C2NA 2V8VA 4NLVA 4CH1A 2MKJA 1WUUA 1N56A 4ZCKA 4ZP6A 1NPKA 1P8GA 4ZVRB 2FJAB 1U09A 2RS8A 5DM7Q 3R5GA 1LWXA 4TLQA 4B3TF 1SUQB 5KFIA 3CCVS 3GONA 3TJ9A 1VJWA 4LSZB 4WP9A 1QAIA 5IC6B 1P9QC 3DHXA 3P96A 1SC1B 3CIMA 3JYTB 4JI0J 1X9SA 2HG4A 4OI3A 3OR1B 2EFPA 4Y2CA 2B9YA 2DHGA 1WORA 3P5TL 4QJVA 2VPZB 4ED6A 2QSFA 4OHVA 2CWKA 4X62J 3R3TA 3X3UA 5LM7E 4KQZA 1TUWA 1RWOB 5HQ8A 4OHXA 2MQQA 4M5DA 3JTOA 1NDKA 5KTQA 4DFKA 2J6UA 3CJ3A 1GAOA 1IBMF 3MM5B 2P6SA 2L9DA 4B17A 3NNCA 1HWJA 1SV5A 1MN7A 4R5PB 2WSEC 1OJ4A 5LXYA 2NXJA 4PG5A 1IR0A 2U1AA 3C16B 2O5DA 4DWIA 3VHQA 3ZZZA 1RT3B 2MHEA 4OZNA 4DSKA 2D69A 4FVCA 1UJ6A 4LF7F 1RE1B 3ZFVA 1SV5B 4ZMMA 1QE1A 2J9DA 2HS3A 2ZM6J 1Q78A 1W7WA 2CXEA 5KFVA 4RW7B 2HVIA 1QUPA 2ZEJA 4ZPAA 3DLGA 3CDBA 3A1YG 3T6BA 2RE1A 6FDRA 1NHKL 1KHWA 4MMOA 3VGSA 1UVIA 1QVGR 3WHIA 1NXIA 2IVFB 1X5OA 2G0JA 2AZ3A 2ZHAA 4O4GA 2MSSA 4CP5A 3N79A 2PO4A 3LA0A 4NRTA 3OQ2A 4YR3A 4ZOSA 3CCRS 4ZVFA 1DHMA 1RABB 1RBLA 3TO8A 1HQUB 2W25A 1NK6A 3BPDA 4Y2IA 1B0TA 3J81Y 5A8RA 2FJVA 2FZGB 1D9FA 4DL0C 3F0NA 2DEIA 3EVWA 2C3YA 3Q23A 3SDEA 1G4CA 2BKPA 2LQ8A 5J2PA 2ZBQA 5KAKA 3OD2A 3DXBA 4OYPA 1TL1A 4IQMA 2CNKB 3PW5A 3WX8A 3M6WA 3LW5C 2F63A 2XI3A 1HR0F 4QIFA 2X1AA 2CQGA 3B8HA 2AJ2A 3RB4A 4DF4A 1J27A 3EGWB 2BRLA 1R6VA 2MJNA 2ZZNA 3FK4A 4HTIA 3PYGA 3MZIA 4DV2F 1U2FA 4DSLA 5DZ6A 4CO5A 4CO1A 2ROGA 5T41A 5IV4A 3EZOA 1S6OA 3WBZA 3QATA 2Q6BA 4OV6A 4D3HA 3DI6B 3VF0B 4NASA 3THTA 4TU7A 1T9UA 3PJXA 3MR7A 4TY8B 3H5UA 3C6TB 2MKIA 1FD2A 1DLOA 5AJ3F 2YNFA 3PCOB 2WZ1A 3SFGA 2HFOA 2P9GA 2MB0B 4E2FB 3KLGB 2AD9A 3M30B 2DBBA 1G3OA 1CULB 4ANCA 2DNRA 2ZC3A 1VHFA 3BKFA 2E1CA 2GJIA 2AJ0A 1B7FA 4OYMA 4OJ3A 2FHJA 2K06A 1AUDA 2DIUA 1HNXJ 2GGPB 4JV5F 1HPZB 2LP4A 4KH1B 1PCAA 3Q8RB 3H5YA 4EBEA 1S1TA 3GB0A 2B9WA 3OFEA 1U48A 1N34J 3VAGA 1NDLA 2MQOA 3IBFB 3MD3A 1PJ6A 3MFHA 3IG1A 4JYAF 4PPZA 3NOCA 2WOMB 2C2EA 2YWKA 4FF2A 2XS5A 1S1WA 3M6UA 4P7VA 1X8DA 2M70A 3V2UC 4EMDA 3UN5A 2A10A 4OZ3A 1U1PA 3DRPB 4DU8A 4DS4A 4KPYA 2HS0A 1HBUA 3M2UB 2CYYA 4Q0BB 4YN3B 3HKWA 4MT1A 4Q8EA 3DLEA 4AQYJ 4RU9A 4HACB 1TL3A 3SSRA 2V8GA 4B08A 4DPWA 2PSZA 1AUSL 4PUOB 1JJ2R 2YX7A 4JI1J 3GV5B 3KJFB 5HMYA 3JS9A 2WVDA 4A8SA 1FT8A 2NUUG 1N6QA 3CULA 3BQ2A 1X4AA 1U1KA 1TL7B 2VZ9A 1I3OB 5B0BA 2WONB 1LW0B 2IDEA 3GSIA 1WC6A 2E5HA 2PMHA 1N36F 2AEFA 3NWGA 2B4OA 1CS4B 2ALYB 2RKIA 5EGYA 3UDVA 3LWLA 4I2QB 5D3GA 1SBRA 3TR5A 2FLPA 2DNQA 4DV3J 3ITHB 3R9LA 1KC8T 1Q8LA 1CG2A 4WE1B 4K4XA 1N48A 3I9ZA 4MFBB 3MURP 4K4UA 2OPPA 5DDRC 1FJGJ 3W1YC 2WVFA 4F67A 2ATCB 2EC2A 2RKIB 3KLFA 4X2BA 4DXLA 1VRTA 2R7XA 3POTA 1F9HA 4P10A 3QIPB 2R8IA 3VGTA 2XB2D 2HHVA 3BR9A 3TQEA 2ZBIA 1V3RA 4DN9A 2RJZA 3CT9A 4LFAJ 4WIQA 1Q86T 2V8PA 1G1XA 1BWEA 4XPCA 5L8RC 4F0KA 3WZ0A 3KK2B 3NY0A 1F9FA 4CO4A 1M1KT 2BJ8A 4ILRA 1KTQA 1B0PA 3BO4A 3OTCA 3CCWA 3NRBA 1UFLA 2ZH2A 1C0TA 4B3MF 5HJXA 2LU2A 1OWXA 2WB1D 1EQ0A 3QGIA 3W3SA 1SKUB 1KBRA 4M63A 1I1GA 3Q83A 2OPRA 1YJWS 3UR3C 2HZAA 1CJTA 4M5GA 3MPVA 1HNWJ 4F4WA 2COLA 3CWJA 3BF4A 4ZPWR 3SCIE 4U96A 1KQKA 1B3TA 1SKRA 4X84A 3BR8A 2E9ZA 2C3MA 4HR2A 2DIVA 4EK2A 2C2ZB 2MQMA 4EFAC 2ZITA 4QPTA 4G3IA 4B9VA 1FE4A 4ED3A 3KHRA 2LEPA 3RBXA 3UDEA 3JB9k 1RAAB 2BKOA 4U9RA 4LRAA 1GXUA 3D0GE 2CQ1A 2UUTA 5HL7Q 4OYIA 3U1NA 4IRDA 4PG7A 3DRXA 3K17A 4B3SF 3DLKB 2G2ZA 4UOHA 3TANA 2ZVSA 3CMES 2ZD1B 4NZ7A 2XLKA 3H98A 3MPWA 1HD1A 4F02A 1RI7A 2FVPA 1FVQA 2EC0A 2UXBF 2R8KA 1C1BB 2VBZA 2I2YA 1HBMB 3I0RA 3DRYA 4RX6A 4HHHA 3RUBL 4WFNQ 4N47A 1DJ0A 2BW7A 3KJVA 1GT8A 2W8KA 4IYQA 1U49A 2B0GA 4QWCA 3EPGA 5FJ4A 1TAUA 1TKDA 5E3QA 3MMJA 3IGVA 2FJEB 1TKTB 1FKPB 4I64A 5H9FK 3IM9A 2FQQB 2PEBA 3U27A 2WTFA 2R8GA 1AFJA 2HVZA 1HNZF 2GMHA 3OUYB 2B8QA 4JI5J 3HSZA 3PYFA 2LYVA 1KHVA 4QOTA 5D4PA 5I3UA 3BH7B 4DJBA 4LF9F 3KUHA 4DR3F 1JLAA 5CYJA 4HHUA 4K4VA 1WC5A 5KG0A 3T1YF 2XYGB 3HT0A 1YWXA 3GG0A 2HHWA 3IGNA 3NMRA 1LOUA 4C48A 3JSBA 3OT9A 1VC0A 3HHLD 3BJYA 1R0AA 2H5EA 2LU1A 3NCPA 3VAJA 3IA0A 2OELA 1NCLA 2FJDB 2XCPA 1UA1A 4QYZK 4QWDA 5F0UA 4NEYA 1BQNA 4FYDA 3V4IA 3VZIA 2BANA 4DV0J 3EGVA 3PACA 3PKMA 2RVJA 4PG6A 2XMTA 2QLFB 3NEKA 2FGOA 4J90A 2C42A 4AXJA 5CABA 1YI2S 1CQNA 4P6QA 1EAYC 5B0EA 3QO9B 2M5YA 1JIHA 2DHSA 4ZK7M 1VK8A 2AZ1A 2PD1A 3HD2A 2W4CA 2MQ8A 2B51A 4B3TJ 1GQEA 2IM3A 2DR9A 2ASJA 3QYYA 4B9LA 1F5CA 2FC8A 2EWHA 3R1LA 4OV1A 4CWBA 4KGKA 1M5OC 3O6QA 3RW6A 3LQVA 4A8WA 3ETOA 1MLAA 1HQEA 1URRA 4UTGA 4PZVA 3P45B 3T3FA 2W2NP 2BJ7A 3F41A 1TUGB 4AXIA 1U2RA 2QLJB 3CE8A 3IMQJ 3MEDB 2YWHA 4Q45A 3DGPB 4CLUA 3FDSA 1H74A 2LMIA 1Z4UA 3UI3A 3H5SA 1AXQA 3HZGA 5CZVA 3J7YU 1RP5A 3W2WA 1ZH5A 3M4XA 4DPXA 4GKJF 1ITPA 2XGQA 1IBMJ 2LDIA 3CGIA 1GTHA 2QEXS 3OL8A 1KS2A 4C0HA 4U7CA 5AXNA 2XMVA 3OW2R 1VQ8S 3G4SS 4PWDB 4JV2A 3PR4A 3BO3A 2CFXA 1WG4A 2Z0GA 2OMLA 3CCES 4LF7J 1SH0A 3UCZP 1S1XA 3GR1A 3W5XA 1TP7A 2KN4A 1YRXA 4NL5A 1Y7PA 3Q8UA 1EZZB 2ATLA 2B9EA 2DGQA 1HWKA 1R43A 2BOAA 5E3RA 4F0MA 2YWFA 2KG0A 4ZCMA 4FXWA 2XG8A 2HNZB 2IAJA 3BGFA 4A8YA 3MAAB 1K1QA 1KOHA 1DAXA 2HK3A 3ICLA 4BBYA 1C1CB 2NZ4A 5EHHA 2VQEF 3OR2A 1DARA 2G4BA 5DQIA 3LP0B 5HMZA 2CVEA 2VIHA 4WK1A 2HFSA 4UZBA 2DT9A 4PXDA 4FVMA 3VGUA 3IO1A 3NCRA 3GIJA 2MKKA 5L1JA 2DO0A 2JWNA 1H2VZ 5HATA 1Q95G 3K5MA 5DG8A 4A8OA 2J0XA 3BH6B 1S6UA 3O2IA 4ED0A 3DOKA 2OD4A 4XTTA 2WW4A 2ZDOA 4KT0C 5E5NA 2IRUA 3QLHB 3GYXB 2HNDB 4F50A 4WZMA 1HR0J 2QLXA 1CJUA 2MZ1A 1SL1A 5ETQA 4MJKA 2PFDA 5LMUF 5EDWA 5KFEA 2RSQA 3B6BA 4DL5A 3J7AN 1SIZA 2VG5B 4DV2J 2NXNA 5HJYA 4OJHA 4V19J 2BJ1A 2AJFE 2DH9A 3KK3B 1FRLA 2FVSA 5C2GA 3C6UB 1LFWA 3LGHA 2IC3B 1IKVB 4DR6F 2VFUA 3LALA 4O0NA 4Y2MA 1MU2B 5DGAA 3C15A 3V6DB 2WRMA 2BW2A 5AJ3J 5DG9A 2RDJA 4CM0A 4Y00A 4RW8B 5DJBA 3X1LB 3LAKA 2IVYA 3AA9A 1X60A 2FJWA 1LWEA 3KLHB 1R8HA 2BE2A 3PFEA 4LBHA 3DU6A 3MUMP 2YNIB 4XDCA 5AT1B 3TA0A 4DSEA 4JV5J 5IQ6A 3ENVA 5CQGA 1YJVA 4NYPA 4GKKJ 3R7SB 1SKSA 5H1SV 2DNKA 2LCWA 2MSTA 2RHQB 1S49A 2RHSB 4E98A 4K4ZA 2JLEA 2BJ3A 3H4BA 2UV8G 5L1IA 1OY8A 3M8SA 4JYAJ 1WF1A 3MM9A 4ZVQB 1OMSA 5D8HB 1GK8A 2Q66A 4NLUA 2LQ5A 3DN9A 1RAGB 4FPRA 1DY3A 1WKJA 3QRQA 2MY8A 5J2QA 4ZKAA 4DR5F 4JI4F 1WG1A 5F8NA 1VS3A 3GLJA 3HVTB 4ILMA 1LWCA 2EFVA 3OLBA 1IJEB 4DPTA 1TUVA 2HEKA 1L3SA 1JLEA 2HFZA 2HBZB 1RA6A 2OTLS 2IA6A 1HW9A 3DGVA 5GAGI 3I0SA 3LOUA 4WFBQ 2RUSA 2N82B 1FRIA 2A0FB 4JI2F 3DMJA 3OFFA 4IG3B 4H4KC 1E6YB 4ZVEA 1RAIB 4G1QA 1N36J 1FRKA 1KR4A 3PW2A 1OO0B 3B54A 2BEFA 3BGUA 3FFIA 1JKHA 1URNA 1H72C 4RNFA 3CD6S 1NK5A 3IN5A 4LREA 3GILA 3UD4P 2DYAA 2K1RB 1SC6A 2HQCA 4Q43A 1O0PA 2VU5A 5F3ZA 3TAPA 4YUDA 3BPSP 3H2UB 4PXEA 3M2RB 2V50A 2ADBA 4XDDA 2XCAA 2QLWA 4O23A 5KG3A 2E9TA 2XMKA 2FDNA 3QT5A 4DQPA 3TAMB 3HO1A 1Q7YT 5IT9Y 2P6TA 3UNYA 1N5YB 1ZM4A 5F8JA 4B9NA 3AJ1A 1R27B 1GX6A 2GVDB 2N3LA 4YS2A 4K4TA 1YITS 1YJTA 3MR2A 2ZH8A 3HM9A 3J7YI 5CH7B 4C4WA 4OJGA 4B3MJ 1IQTA 1RK8A 5BYSA 5M2PA 1F9EB 3NGDA 1OIAA 3C14B 3LUYA 3W61A 2OHDA 2CJXB 4H4KA 3I5AA 4IH7A 2R7UA 2AEJA 2XS7A 4QBUA 3HKZD 3O5TB 1HA1A 5KFPA 3CO9A 3NBPB 4ELUA 3R6GB 3UQSA 2XWYA 3MM7B 1VISA 1RHJB 2EBGA 4J37A 1Y5NB 4LF2A 3KDNA 1UAWA 5BR8F 3M8ZA 3TARA 1OY9A 1MROA 2W7AA 4M1KA 5F9NA 4AL5A 1Q8BA 4CYUA 2APOA 1RKJA 3N6MA 5JVGQ 4KFBA 4MKAA 1PJ5A 4O3QA 3R7BB 2NXEA 4ZITA 4USVA 1VQ4S 5FLXY 1UJ4A 4J9OA 3MECB 1NB7A 3E3XA 2NPFA 1RTJB 2DGUA 2W9BA 3FGVA 4B3SJ 4I2PA 5HROB 3SV4A 4K4SA 2UUBF 4ETZA 2QL7B 5LJ3Y 5AXMA 4IFVA 2C1EB 4ZLJA 2MHNA 2WVCA 4CRJA 4C97A 2UXBJ 2KTQA 4P7TA 1U0SA 1UVJA 2W7PA 1X9MA 3RRKA 4KRWA 4FF3A 5GADI 1ZA1B 4L73A 4LR8A 2VUGA 3BREA 1YSJA 2J8AA 1PO6A 5CD4H 5F9LA 3HFZB 2LVWA 3PV8A 1AZSB 2HHPA 3A8KA 1SJFA 5GMDA 4DCOB 4M95A 4MK9A 3JQKA 2OO4A 4ZCIA 2QE5A 1RWVB 1TU0B 3OJUA 2AW0A 2C3UA 3HSGA 3QZ7A 5DGBA 1JJHA 2F9JA 2XS2A 2H65B 2OPSA 2GV1A 2XQCA 1XTZA 4LF9J 1R0BG 3FVYA 2W7OA 1N54B 4DR3J 5LXRA 1RWMB 4RPFA 4TU9A 3PRVA 2I5JB 1XMQF 1NSQA 4CLLA 3NNHA 4HDGA 1SH3A 4GVBA 2DNHA 4USTA 1BHNA 2RS2A 1YJ7A 3FCVA 1U47A 2CQ0A 5A8KA 3HFVA 4LSNA 4IRCA 3KKFA 2GHVC 1TKXA 3HD1A 2L3MA 2VODA 4TLRA 2D1CA 3GFHA 3R1HA 3QJJA 2ZH5A 1UP1A 2LXFA 5HP1A 5A2QU 3M32A 2OPQA 3OVAA 5EWEA 2FIUA 3CJSA 4DV1J 1TK8A 2BVZA 3N9UC 4DUYF 2ZUAA 2GFFA 3K5LA 1VGYA 2O01C 4S0MA 2JH3A 1FRMA 3KYLA 2IY5B 1DTTB 3PKYA 2IMWP 3TWZA 3BB5A 4WYLA 2JEJA 3FUYA 2RD5C 2F3JA 4DQIA 2MGZB 2VL1A 2W2MP 3J80Y 1B0VA 2POKA 2QMXA 4EBDA 3EXCX 4NOHA 1X4EA 5I42B 4URQU 1FK9A 3SEOA 4K59A 4A8FA 3Q89A 1FD8A 3WC2A 4B3OB 3FRZA 2KRBA 5L46A 1PSDA 5CYQB 2J7UA 3GE9A 3PW0A 4ZVTB 4PG8A 3TAQA 1RADB 2V5HG 1C4AA 1YBUA 1V5VA 3A8IA 4KHRA 4XO0A 4RU2A 2YKMA 3M6XA 3TUIC 2XC9A 2FLLA 2CJ9A 2YKNA 3FMWA 2UVWA 2ZC4A 4USJC 2R3VA 2BUNA 3M8PB 4NLPA 1FNMA 2HNYA 2DR6A 2HZVA 1S9EA 1UWBB 1WEZA 5J2MB 4GKJJ 2X3GA 4M5KA 1JLGA 2QO3A 1IWGA 4OMFG 3AT1B 2CJBA 4P75A 4CO2A 2CQ3A 5F41A 2FVQA 3HHLC 2J5AA 2YTCA 3A8EA 4UQTA 3NGRA 3W2VB 2EFNA 1WHWA 4DL4A 2GX8A 3CJRA 5GAEU 1IBKF 3CDUA 1RTZA 2J9CA 1BQXA 4F4YA 2GVZB 1F5BA 1U26A 2GIFA 4NMLA 3JSMA 5HBMA 5DG7A 4OI4A 3MDFA 4WJBA 1Y11A 2IRXA 2SXLA 3JAMY 3UNGC 4KGXB 2GQQA 2J0WA 1YBAA 2RILA 4Q2LA 4F2RA 1SQEA 1AB8A 3CCZA 2OIHA 1WOOA 4OZJA 4RW9B 4ZHRA 1V3ZA 2VQEJ 3HI9A 3FJ2A 3OTEA 4CLZA 5AE1A 3I55S 4ID8A 1TVRA 5ETOA 1Q5VA 3ELHA 4KR0B 2B5JB 3T5HA 1X5TA 2HURA 1K47A 1RHKB 2KRRA 1U6FA 1RT7A 2KO1A 2MZSA 4YY3F 1NO8A 2RAQA 4URSA 4L3KA 3MR3A 4GRSA 1HYSB 4TYAA 4UW2A 2R7QA 2OP5A 5B0GA 1M5HA 1Q1KA 2FHJD 4NLDA 5KFZA 2KXHA 2XSJA 2GQCA 3AFGA 3NCQA 3HJFA 4ICLA 9RUBA 3AD8C 4RJVA 3IFEA 1NKEA 1D9DA 5LMUJ 3PX6A 2ZE2A 5DDOC 2OMOA 5ETTA 3TJ8A 1FXDA 3QFWA 3MD1A 2R2TA 5F0WA 2XSJB 3CIZA 2ASDA 3HHLB 2EI5A 2FTRA 3EICA 1YIJS 1C2PA 4H4MA 4KGZB 4C8KA 4EYHB 2R7SA 4ZLLA 3K5PA 4DR6J 3K8VA 3J7Z5 3OVSA 3CCQS 1H7WA 4MAKA 3WIUA 3QJPA 3QWPA 5D4OA 3H20A 3A3OB 3HZEA 5LMNF 1JX4A 2OFHX 2NPIA 4K50A 5CAAA 1EP4A 1M5SA 1HBNA 2DHHA 2DR8A 4M5LA 1EARA 4ZS6A 2M7SA 3FC9A 3MEEA 4YB5A 4ECWA 3MXHP
chains in the Genus database with same CATH topology
2WOMB 4FNIA 3V6HA 3MMCB 1ZZNA 2C2EA 3N5FA 2YWKA 1AFIA 3TVZA 4FF2A 4CIOA 2XS5A 3L3CA 1S1WA 4ZPVR 3M6UA 2ZM6F 4YDDB 1N52B 4P7VA 4TYBA 1YJUA 4N5SA 3I56S 1Y3JA 1CPZA 3EUNA 4N77A 2G1DA 1X8DA 2M70A 3V2UC 3LGMA 2HWIA 1XEZA 1YVFA 3RBEA 2A10A 4XPEA 1U1PA 4J5OA 2F7VA 1MMLA 2VASA 1WEXA 2GHWA 3DRPB 5KFGA 4DS4A 4KPYA 2HS0A 4N8OA 2I0XA 1HBUA 1FRXA 3M2UB 3FSXA 2CQIA 1KSPA 3PO4A 4B3RF 1DTQA 2CYYA 4Q0BB 4LF8F 1YTYA 2MQNA 2QYCA 1NK0A 3HKWA 4PXBA 1TQLA 4Q8EA 3M6VA 5ADZA 5G4DA 5CYMB 1LWFA 5KFJA 3DLEA 2E44A 4GO5X 1ZZFA 1ULRA 4RU9A 5L1LA 3SQGA 2VG6A 4KKOB 5A0YB 2UP1A 1TL3A 3SSRA 2V8GA 4B08A 2NSBA 2OAUA 3PRDA 3W2WB 1FKAF 2PSZA 4O44B 4IRKA 2XULA 4R8UB 4PKDB 3D5MA 3RRGA 1QSSA 4PUOB 2BXJA 1JJ2R 4ECSA 2ZKTA 2YX7A 2RQMA 4AUKA 3AY0A 3GV5B 2HFNA 4LF4F 3I96A 2R2SA 2VPWB 5HMYA 5G0RA 2VQFF 1S9FA 1MNEA 3GWCA 1Q4RA 2KFZA 4UQGA 1FTRA 3MEGA 3DLBA 4A8SA 1FT8A 2NUUG 4F4ZA 1N6QA 3GSDA 3CULA 4RUCA 1RYSA 1Q16B 3KLIA 1X4AA 3BQ2A 2GW8A 1Q7LB 1U1KA 2VZ9A 1SJRA 4NCGA 2JFKA 2XHWA 2QIFA 2PA8D 5B0BA 2WONB 2MZRA 1LW0B 3T6JA 2W9CB 5DQHA 2E9RX 1I94F 2DITA 1SJ1A 2D7SA 3AAWB 2AGQA 2RH3A 2E5HA 2PMHA 2HIQA 1N36F 4UY85 1IKXA 2PA3A 4IDKB 1NZAA 3NWGA 1BC6A 1ZAXA 3RRHA 4Q7AA 1U4BA 4WFXA 2LQJA 1JJ4A 1DQ9A 5DETA 2B4OA 3V81A 1XWLA 1S0VA 1FE0A 3KHHA 1M5KC 3K7RA 1T94A 1Q81T 3R5DA 1T7PA 2CPYA 2RKIA 5EGYA 3LWLA 4I2QB 1S1XB 5D3GA 1MW7A 2CVIA 2DNYA 1SBRA 3TR5A 2DISA 4F4XA 2FLPA 3QZ8A 2DNQA 3ISNC 4GO7X 3B4DA 3ITHB 4HLBA 5KT7A 1KC8T 1Q8LA 4NLWA 1CG2A 1M5PC 4WE1B 4DSJA 4K4XA 3D28A 1N48A 5BYRA 3I9ZA 4MFBB 1C0UB 4WK3A 2X1BA 3O8WA 3MURP 4K4UA 1B64A 2OPPA 5DM6Q 2I5JA 5B09A 3CDAA 5DDRC 2PI5A 2RF2B 4F67A 4RBTA 5KT6A 2RKIB 5H9FJ 2IAJB 3KLFA 5K14B 4DG1B 2XY7A 4WU3A 4X2BA 2ZH7A 4MYUA 5EN1A 1VRTA 4NLRA 2R7XA 4LUBA 3PX0A 2HHTA 4ERDA 3POTA 4OIXA 3H8YA 5CHCB 5IFMA 1GX5A 1KQGB 4IRCA 5GADU 3QIPB 2R8IA 3G8TA 2FPHX 2XB2D 2HHVA 3BR9A 5K5MA 2YVSA 2R7TA 2ZBIA 1V3RA 1W2BR 3UCGA 1SUQA 3FEZA 3OR2B 4F25A 1VIXA 4DN9A 1JLBB 4I56A 2VPXB 2RJZA 3CT9A 1QY7A 4AL7A 2J7KA 1Y9OA 4JI7F 5K8PA 1Q86T 4QR0A 1L3VA 1G1XA 1VC5A 1BWEA 2Z8QA 4XPCA 2AX0A 2VFSA 4MTPA 1S1VA 3E01B 1WWHA 4RWXA 4U6PA 5L8RC 4DHVA 3WZ0A 3KK2B 2YY3A 3JYTA 4DUZF 4EGLA 2VG7B 5FDLB 3FSIA 3DFEA 1RT4B 1TZ0A 1F9FA 3GV8B 1RT2B 2VFVA 3PHEA 3HT3A 2JOQA 1DTTA 4CO4A 4CI0B 1M1KT 1D3WA 3ENWA 1WEYA 4MIAA 4ILRA 2IBOA 1EETB 1VRUB 1J5OB 1KTQA 3PDNA 5LSLA 3I9V9 3DOLB 3OR1A 1B0PA 3TW0A 3BO4A 3GZ7A 5HMWA 3OTCA 4XAKA 2A18A 1HHSA 3CCWA 3DOKB 1RT1B 1RT6B 4WFAQ 3NRBA 1LW2A 1UFLA 3ISND 1C0TA 2MKSA 2WBRA 4USHA 3MUTP 1LFPA 2ZH2A 4B3MF 1QAJA 2RB7A 3KK1B 2QSWA 2KHCA 3P6YC 2L9NA 2LU2A 1OWXA 2WB1D 2MGZA 4Y6IA 1CC8A 3QGIA 2BACA 3W3SA 1FKOA 4K4WA 3TNVA 1FF2A 4NYOA 4QYZJ 3M9MB 4IOCQ 1LV5A 1FVSA 5I42A 4M63A 1I1GA 2K3IA 3VAKA 2UV8A 4FBTA 2OPRA 4N8NA 2MJUA 1YJWS 1HBOB 3JTNA 1CLFA 3G6ES 4AE5A 3UR3C 2VOOA 4B3OA 1ZOTA 3M9NB 2Y1RI 3MPVA 1VQOS 2MXYA 2JEFA 2QRRA 4OX9F 4DMZA 2COLA 4F4WA 4IUFA 2HQ3A 5CYQA 3MFIA 2AJQA 3CWJA 3KG4A 3BF4A 4ZPWR 1HI1A 3SCIE 2XNRA 2DH8A 2DTJA 3CVKA 2LECA 5DRKA 4ECXA 4PXCA 3MM5A 1KQKA 3CMAS 2ZHBA 1SKRA 4X84A 2VD3A 3BR8A 4OZ1A 2C3MA 2E9ZA 1SB6A 1S6QB 2HYIB 2DIVA 1VQLS 2D3ZA 4R5PA 1RDRA 4X4QA 3VAHA 1FERA 2MQMA 4EFAC 2BDPA 2VFTA 2CPEA 4HTJA 4WIIA 2ZITA 2GJ2A 4QPTA 2YX1A 4G3IA 1KRPA 4B9VA 2N7YA 2UZAA 1JLQB 3NS5A 1UL3A 3CEDA 1RT3A 4YHHF 1FE4A 3CD5A 2CQPA 4ED3A 2PN6A 3JSYA 2BJEA 3D2WA 3KHRA 1RT5A 1ZPVA 3DDNA 3IRXB 2LEPA 3JB9k 2L48A 2CPHA 2IYIA 1TKZA 4NXNF 4U9RA 1GXUA 3VR1A 3OVBA 3D0GE 2CQ1A 4C8YA 3I5CA 3Q2TC 1HMVB 2UUTA 5AE3A 5HL7Q 1Z1ZA 2KU7A 4HI1A 1V6HA 3M8PA 4IKAA 3U1NA 4IRDA 5GAHU 3NAHA 5K9FA 4EUVA 4RW7A 3M1VA 1NJWA 1UWBA 4PG7A 3VZHA 3DRXA 4QWEA 4B3SF 3HP6A 2CZVC 1VQKS 4HKQA 1V9OA 1BLUA 2VH7A 5BYQA 4TQRA 1S7HA 5J2MA 2NUHA 2HVHA 4RWWA 3DLKB 4BCAA 2OSRA 3J7A1 3TANA 1LWEB 2ZVSA 3CMES 3U1MA 1RTHA 2ZD1B 4NZ7A 2YX4A 2BE2B 2M2BA 3DC2A 2XLKA 3H98A 3MPWA 4DBQA 4JI3F 1YRTA 4DV7F 2JLGA 3VAIA 4ES2A 3BM7A 5B0FA 1HD1A 1ZAWA 1RI7A 1NK9A 4F02A 5KFHA 1WELA 4ZVGA 3T5LA 3LP2A 1X9WA 2FVPA 1FVQA 2HAIA 1GXLA 2VC0A 1XMOF 2EC0A 2MQLA 2UXBF 1IXKA 2R8KA 1C1BB 2OD6A 2VBZA 2I2YA 1LXJA 1HBMB 1YRUA 5A2QY 3I0RA 3DRYA 4RX6A 2NQPA 3SCKE 2DNGA 2X1GA 4BHQA 3W2VA 3MCSA 4ZPDA 4WFNQ 4N47A 3Q0AA 2ZJPQ 2ZFHA 3K8WA 3PIPQ 1DJ0A 4QR2A 1Y0HA 3CCTA 3KJVA 1HQUA 3K5NA 3RB0A 4WFZA 3RAQA 1GT8A 4DL7A 3T5KA 3TI0A 2B56A 2B9XA 4IH5A 3HDSA 2W8KA 3S8SA 2WAQD 3GG1A 2N3OA 3FRYA 3KOAA 4IYQA 4ZLPA 2BZ2A 2CRLA 4AFFA 1U49A 2B0GA 2FJBB 1RTDA 1QTMA 2DRAA 5IS2A 5E3CA 1JLFB 4C8ZA 4QWCA 2RMLA 4DR2F 5A6WA 2I8EA 3MM9B 1N4LA 3EPGA 4N76A 2FHOB 5FJ4A 4PQUB 2YKAA 4A8KA 1TAUA 1TKDA 5E3QA 2XMWA 4RBUA 3UPFA 3OSNA 3CJ0A 5IZHA 3LH2S 3MMJA 1SI9A 3IGVA 1AROP 4LJMA 2D9OA 2FJEB 1TKTB 4QWAA 4BS2A 5AXLA 1FKPB 1SXLA 4HH1A 2JEIA 1LKZA 2N4DA 4FZVA 4I64A 2D74B 2BYCA 5BJRA 2XLJA 2W9AA 2ZH9A 4ECQA 1NNDA 4DFMA 2P5VA 2R7OA 5B08A 2CPDA 4YR2A 3DDKA 5J2QB 2YNHB 5D6GA 3NG8A 1Q53A 2CQDA 2R2UA 3G96A 5JVHQ 3U27A 1RTDB 3LO3A 2WTFA 1LWCB 4LVOP 4GMKA 4YB7A 2R8GA 2NS1B 4IG0A 2B6AA 5B0CA 5C24B 4ECRA 5LL6d 2HVZA 3V6KA 2HW3A 1AFJA 1HNZF 4L72B 3DRSB 3L95X 4RW9A 4X65F 2R7WA 1ZETA 4CH7A 2B7BB 2GMHA 5CZXA 2OH2A 1JLEB 2B4PA 4RUAA 1HWIA 3OUYB 5IT4A 1FEHA 4Z37A 3RB6A 4OI2A 5HO4A 4IR9A 3NP5A 2J0SD 5IT0A 1VMBA 2VA2A 2V2KA 2LYVA 1KHVA 2E1RA 2PDAA 1S0MA 4QOTA 5D4PA 5I3UA 4DJBA 3DLJA 3I0SB 4LF9F 3TA2A 2DJWA 2DR5A 5E2QA 2FC9A 4DR3F 5F8IA 1JLAA 1OPZA 5CYJA 1JLCA 1GXTA 1WG5A 4IG0B 3N5BA 4K4VA 2VONA 1HNVA 5KG0A 3T1YF 2B5JA 1G2EA 4QZVB 4ZVHA 4ED7A 1YWXA 4IOBA 3GG0A 4J9RA 2HHWA 5HLFB 3IGNA 4ES3A 2WB4A 2Z4PA 3NMRA 3DMJB 3TYTA 1LOUA 4ED5A 1TK5A 3PNIA 1U1MA 4XK8C 3JSBA 5KG6A 4ETXA 2HS4A 1VC0A 2ALZA 3HHLD 5LSRA 3BJYA 1R0AA 3IWNC 3ENQA 2EFGA 2H5EA 4F3OA 2LU1A 4G1QB 2BJDA 1HYSA 3BDEA 3GFYA 3NCPA 3VAJA 3IA0A 3R5CA 2FJDB 2IM2A 2XI2A 4A8QA 2ZHOA 2JVRA 2XCPA 4C11A 5C25B 3DI6A 3MI7X 3MWBA 1UA1A 4E0DA 3FFIB 1JKHB 2CJKA 4QCLA 1NU4A 1R8BA 5J2NB 4QWDA 3KLEA 2ILYA 1FNOA 2ACYA 5F0UA 3VCDA 4NZ0A 1S97A 1BQNA 4FYDA 2FUG9 4TY8A 3M05A 4HI2A 5EUHA 2J6SA 2CPIA 4Y3CA 3DYAB 3C6TA 3L09A 4NYZA 3VZIA 3V4IA 4X4VA 3TVKA 3H4DA 4I4BA 5A8WB 3RR7A 1OPIA 3CCLS 2BANA 3FCHA 3PACA 3PKMA 1L3KA 1S9GA 2DGWA 2RQKA 2RVJA 3AH6A 3FEYB 4JI0F 3I32A 4I7FB 2XMTA 4PG6A 4C8NA 3HHEA 5J1EB 4DLEA 1YJ9S 3H59A 3AA8A 5MAOA 3LGNA 2X51A 1WHYA 3HXMA 3G8QA 2FGOA 4RW4B 2ZKUA 5KFYA 4ECVA 3KLGA 3M30A 4DPOA 1SJQA 2C42A 4AXJA 3G6XA 2ERRA 1RTIB 4GC6A 3MM8B 1Y5IB 3HHLA 2CPJA 3KHLA 2Y1IA 1YI2S 2CDQA 1IKYB 1KEKA 1CQNA 2AJ4A 4DF8A 4YEAA 3PW7A 2CIMA 1BD6A 5I4MA 2JFDA 4P6QA 4ED2A 5B0EA 1KLMB 3QO9B 2M0GB 2M5YA 1JIHA 5HMXA 2UVVA 2DHSA 2EFQA 1VQ5S 4ZK7M 3W7BA 1QLNA 1VK8A 3I87A 1WD6A 1REVA 2GGPA 4JOUA 2PD1A 4QPXA 1UEVA 3G86A 2W4CA 2Q6CA 4A4JA 2KFNA 1YQHA 1ZM9A 1HPZA 2B51A 4RKUC 1G7CB 1VQMS 4X4SA 4H4OB 4X62F 3GMGA 2EK6A 2KH9A 5C5JA 2HMIA 1GQEA 2IM3A 2M4MA 4BWMA 3K5OA 4A46A 2DR9A 2ASJA 1A7GE 3QYYA 4J9MA 4B9LA 1F5CA 2FC8A 2EWHA 2VFRA 4HYKA 3R1LA 2DPIA 4LFBF 3GFZA 1Y4ZB 3WDOA 4ECYA 4OV1A 2DCLA 1KN6A 4EYIB 4KGKA 1M5OC 2JVOA 2GIQA 3LPYA 3UWTA 3O6QA 3VTIA 1J2VA 4FS1A 1HI0P 4FBUA 3RW6A 3LQVA 4A8WA 3ETOA 3UR0A 1HQEA 3FQLA 4NX9A 1FA0A 1URRA 2K8GA 4KV8B 1A9NB 3UDCA 2IFXA 4FXVA 2KHDA 3T3FA 2WOMA 4YFUA 1ROFA 3ZC4A 4EWTA 4G1IA 3F41A 4M94A 3MM6B 4AXIA 1VIOA 1IBKF 1U2RA 2CQ4A 2GMLA 3CE8A 4NLQA 3MEDB 2JHEA 2YWHA 4ID5B 1FDAA 2N7CA 3H40A 3DRPA 4Q45A 3ZZOA 1KNZA 2MDAA 3M2UA 2QFJA 1K1SA 4Q0BA 3FDSA 3GIKA 3BSCA 2JRSA 3VQTA 4J9LA 2LMIA 5CYMA 1Z4UA 5DDQC 3UI3A 3H5SA 4X64F 5C42B 1AXQA 3HZGA 3CJ4A 2UXDF 5A0YA 4KKOA 5CZVA 3J7YU 5IXUA 1RP5A 2DNMA 2VBXA 5KFWA 3TOQA 3W2WA 2EW9A 4O44A 5JXSA 4R8UA 1ZH5A 3B4MA 3U1LA 3G71S 5KFNA 3M4XA 4PUOA 4Y0FA 3PEJA 2AYGA 2BA9A 5D4LA 1SJ4P 4FXDA 3NKYA 4I1TA 3S7RA 4GKJF 1FJ7A 1O51A 5T14A 1N33F 3T5JA 5I3PA 2B4VA 2E1MC 2XGQA 1H7XA 2LDIA 2GCFA 3C2PA 4ED8A 2QA2A 2R7VA 2QMWA 3CGIA 2DB1A 5IM0B 4X4OA 1GTHA 2YWGA 5D77A 1FJEB 4JBCA 2QEXS 4NLGA 3I5BA 1VBYA 3OL8A 4B9TA 1KS2A 4C0HA 1MROB 4U7CA 5AXNA 2XMVA 3BQ1A 3OW2R 2WONA 1IKWB 1LW0A 5B7WA 4PR6A 2W9CA 4OLPA 1VQ8S 3G4SS 1FESA 4PWDB 1T02A 4ZPBA 3CC4S </