3HD2A

Crystal structure of e. coli hppk(q50a) in complex with mgampcpp and pterin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDAPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Role of loop coupling in enzymatic catalysis and conformational dynamics
rcsb
source organism Escherichia coli k-12
molecule tags Transferase
total genus 43
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2009-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3hd2A00
1HKAA 3HD1A 5ETLA 3UDVA 5ETTA 3HSJA 3KUHA 5ETKA 4CYUA 3MCMA 1F9HA 1RTZA 4PZVA 2BMBA 5ETOA 4CWBA 1RU1A 2QX0A 3UDEA 3HSGA 4M5JA 3UD5A 1Q0NA 2F63A 3HSDA 1RAOA 1EX8A 2CG8A 3HD2A 3ILJA 1EQ0A 3ILLA 1RB0A 4M5MA 5ETRA 4CRJA 4M5NA 2F65A 3HT0A 1DY3A 3ILOA 3HCXA 1HQ2A 1RU2A 5ETSA 5ETNA 4M5GA 3HSZA 1TMJA 1G4CA 5ETPA 5ETMA 5ETQA 3MCNA 4M5IA 4F7VA 4M5HA 1IM6A 3MCOA 3KUEA 4M5LA 5ETVA 1CBKA 1KBRA 1EQMA 1TMMA 3QBCA 4CYUB 4AD6A 3KUGA 3ILIA 3IP0A 4M5KA
chains in the Genus database with same CATH superfamily
2NLWA 3TOQA 1QAXA 2DISA 2V4QA 2YWEA 4AUKA 3OHAA 3CCUS 3MM6B 2P9CA 4PQUA 5AE1A 5HQ8A 2HHHF 4OZ0A 1RT5B 3M8QA 4FBUA 1HWLA 5KT5A 2V94A 1G3OA 3MAHA 5HROB 2F4VJ 4RNMA 3QNWB 3MTJA 2XSFA 1YBUA 5HAOA 1HWIA 5HSPA 2LEAA 1OWXA 2YKQA 1HQUA 3R9LA 3HSDA 1UW9A 3LP1A 5EDWA 5K8NA 3GR1A 4LREA 1JLQB 2XC9A 1N56A 3B82A 2W2NP 4ECYA 3A8EA 2JVRA 1NDLA 3AJ2A 4I7FA 2ZH4A 1CJVB 2G2YA 2RQ4A 3VAFA 4N5SA 4WYWA 3KLIA 1ITPA 1MMLA 4P7VA 3GV5B 1F9FA 2COLA 2B7CB 5A8RA 4PWDA 4RBUA 1Q4RA 5J2PB 1G6BA 4ZVTB 4WE1A 2IY5B 1YJNS 2V4RA 3I9ZA 4ILLA 2FQQB 1ZYQA 1RT4B 3DRXA 2VJUA 4NCAA 2UUAJ 2MY7A 2OPPB 3R2CJ 1VQPS 5SUHA 1XMOJ 1RHQB 2R7RA 4OI6A 3C66A 4MK8A 4IH7A 4OYPA 2J7UA 3GJRB 3QWPA 5BYSA 2CQ4A 2OD4A 1PKUA 4TY9A 3V4IB 2CYYA 2J0SD 2CKWA 2JVOA 1N4LA 1BUXA 2BXJA 1CQNA 4UZCA 5HP1B 2MGZB 4X4OA 2M8DB 4PPZA 2DGTA 4LSZB 3FBEA 3BYPA 3UO0A 4K4UA 3BYRA 1RE1B 2B6AA 4ZDNA 4CTAA 1IQZA 1JLAA 3LP0A 2DR5A 2WVBA 3FGVA 4KR0B 1H7XA 2WSCC 5HMWA 3DXSX 1TMJA 4Y34A 2YXLA 4DV7J 3IWXA 4OZLA 1KKHA 4OQJA 1T05A 4L76A 4EWTA 1NKCA 3M8YA 2B7BB 3M6XA 2XMMA 3BKUA 1TL7B 4DPXA 2HQIA 3W65A 3PYEA 4OYOA 3T1YJ 4V1Ak 1RZMA 4JI5F 2UVWA 1T9VA 4OI0A 1OPZA 1WEXA 3ONQA 4YY3J 2H4YB 4DL5A 2V6AA 2A10A 1NRKA 1VJQA 2NS1B 1WI6A 4FF3A 1TV6B 3ETMA 1UEUA 3CSKA 1PO6A 4A8QA 1CJTA 2XHCA 3NMAA 3AQOA 1WUUA 1S1XA 1JXVA 1IBLF 3TUJC 4LSLA 1HLWA 3H42A 2XMUA 4O3RA 1T11A 3EZOA 1RUSA 1Z4UA 1T3NA 1U02A 1APSA 2NCKL 4XO0A 4QOTA 3DMJB 1FVQA 3ZTOA 4NLSA 2FLOA 1U6ZA 4B17A 4PYAA 1PAUB 3DRSB 3K17A 4U96A 2ASJA 4RKUC 3OTEA 2YKNB 1S9FA 4DFMA 2H51B 4WP8A 5F9LA 4TLRA 3MM9A 3GG0A 4PG5A 4DSFA 2FHKA 2L41A 1NJXA 2R7UA 3UD5A 3ET6A 3C6TA 5A8KB 2E7WA 3KWMA 2ALZA 4IRKA 3HJVA 2A2CA 2LA6A 1M5SA 5KT3A 4AD6A 3GIJA 5DQGA 3ZZTA 1NH8A 2XQCA 2MKKA 2AJ0A 2PSZA 2BOPA 4EUVA 3HVWA 5ETNA 1LV5A 3V5RA 3DLKB 4LF6J 3THVA 1L3VA 4B9NA 3N4WA 3T9NA 1RWPB 3AD9C 3W64A 4ZK7M 3KJVB 4LR7A 2HBRB 4YQWA 1YX2A 2R7OA 2WBRA 2KI2A 2IVYA 2QMXA 1WKJA 4YOEA 4DV2J 2I8EA 2XCAA 1SCJB 5C5JA 1VYAA 1W25A 1HL6A 3M7VA 3ENQA 3S01A 3CDWA 3N6NA 2RS8A 2R7QA 1DQAA 4C0HA 4DS5A 3JYTB 2MSSA 1SC6A 3LWLA 4M5KA 2BE7D 3GCWP 2XO7A 3DI6B 3W8GA 1UCNA 2CG8A 3ILLA 4A8OA 2GCFA 4IOAQ 2XYGB 2NUUG 4WWSA 2PI5A 3DRPB 2JEIA 5KOXA 5J2NA 3N9UC 3DDIA 2Q6CA 2YNHA 3W62A 4CLWA 4PCQA 5A6WA 3TJAA 3CPWR 4DV1F 1WHXA 5HQLA 2ZWPA 1RBLA 3M32A 3W9JA 1PILA 2IJFA 4M5LA 1N36J 3SSRA 1WDTA 3CDUA 4DV0F 4YFUA 2DGUA 3AXKA 3HDSA 3SYZA 3SZ2A 1OY6A 3MURP 3R27A 3CVKA 3FEZA 2MTLA 4UOHA 1UWAA 1DLOA 1GT8A 2CADA 4ED2A 2OMOA 4R0EA 5ETTA 4DPUA 3RRKA 3PTWA 4DDFA 2VUGA 3QT7A 2Q66A 1RT5A 3VV2B 1QUPA 2I9SA 4DV6J 4NL5A 2LLZA 2DT9A 1RP5A 4NA1A 4OYWA 4WIQA 2CUYA 5LM7E 2NPIA 3KLGA 2CRLA 2EK1A 4ANCA 2HFVA 2CPHA 3PYGA 3SCIE 1S0OA 4GKJF 2V2QA 3I4HX 5H9FK 4PUOB 3SXLA 1D0EA 1RHMB 3KMQA 5B0CA 3D6MB 5KT7A 3W2WB 2J9EA 4RUAA 1VFJA 4QPTA 3UWTA 2ZH6A 2QA1A 2F3JA 1D9AA 5GVQA 4RZRA 2KYXA 4L73A 1P1LA 3LO3A 2HEKA 4IQMA 3IM8A 3AOAA 4F3QA 1GQEA 1CJVA 4ED5A 3BPSP 3I82A 2AZ3A 3TQEA 3P5BP 2CAJA 1WHYA 2ILZA 1HWKA 3SDEB 4R0JA 3GIMA 1Q8KA 2DNQA 4YN3B 2VG7A 3J7YI 2V63A 5J2PA 4ZVEA 4NXNF 1LW0A 4DR7J 4C6AA 3CULA 4Y6IA 3G6XA 2IHR1 2GMJA 2P2CB 3CDEA 2OPPA 2XMTA 3IG1B 1WC4A 2EEYA 1UTAA 1M5PC 2C3YA 5F3TA 5BR8F 1YZ6A 5DDQC 2UUCJ 2CWKA 3D1HA 4DSKA 2DRDA 3D5MA 3V4IA 5IWAJ 3N79A 1C0UB 1TUWA 2DR9A 2B51A 1HYSB 3D54A 5HP1A 5D8HB 2MGZA 1H7WA 1V3RA 3GZ7A 2DXFA 4ZPDA 3PW0A 4U67Q 9ATCB 3CUNA 2UVUA 3FRYA 4NLXA 3M8ZA 5E2QA 2J9DE 2FJEB 4QW8A 2YNGB 3TI0A 3KK1B 4DR5J 1AUDA 1TKDA 1RADB 4GVLA 1S7IA 2DGXA 1MSWD 4OLPA 1TR0A 2C2ZB 2VFTA 3A3NB 4NZ7A 1PC5A 1VMBA 5ETVA 2BJ9A 3CCQS 1TFYA 1TL7A 4B3TF 3J7AN 1JXLA 1JLBB 4C8YA 2LEBA 3G9CA 4OHYA 3MUTP 3JB9k 4USUA 4LF8F 4DQPA 4OMFG 3KG4A 1PJ6A 3GJTB 2VBZA 2UXDJ 1AZSA 2VQFF 2F7VA 2DNHA 2M7SA 5KFUA 3CCWA 3MD1A 1TV6A 3HHEA 3K5PA 4Y2MA 4DR3F 1EETB 4JI1F 3U1LA 4AYBD 1KVJA 4RW7A 5EN1A 1YRXA 1F1BB 3CCES 2HNYA 1UVNA 2GFFA 2GQCA 4F26A 1SJ1A 8ATCB 1LWFB 2OGUA 5F8MA 1T95A 1VOMA 2XGPA 1IM4A 1QD1A 2MKHA 1K9MT 4WZQA 2QG9B 2VHGA 4ELTA 1NK4A 3IAM9 1GXUA 1CC7A 5B0GA 2ATCB 4USHA 1I6JA 3DRSA 1X4CA 1RT6B 5IXUA 3UCGA 2KRRA 2FVSA 1CLFA 3J81U 3WX8A 3SCJE 4X4NA 3OFEA 1NMEB 4NCGB 3A12A 3JSMB 3CD0A 2CQIA 2D3ZA 3B8HA 3JS9A 3K58A 3CC4S 5CCMA 3C15B 1OY8A 1H3DA 2LA4A 1XEZA 3G8QA 2GO8A 2KJVA 1IKWA 1ZZNA 4PG6A 2LQ8A 3RU0A 1P1TA 1SIZA 4JI6J 5KFDA 2QSFA 4USMA 2UVRA 3CJKB 3QMQA 2PEBA 3NS7B 5IS2A 3KJVA 3K0JA 3G2XA 5THWA 2E9RX 3D0HE 4ED7A 1TAUA 2FY1A 2VG6A 1Q5VA 3T1HJ 3GFYA 1IKXA 2A18A 2ZH5A 4DQRA 2AYBA 4X4PA 4UQGA 2YPYA 3TRGA 3IP0A 5IT0A 3EYZA 2KB2A 3ZTQA 3KOAA 2W9CB 1WD6A 1WJ9A 3DRRA 2L9DA 3TA0A 1PYSB 2Q6BA 2V8PA 3KNAA 4A8YA 2N4DA 4GVBB 2FLNA 2OPRA 1EAYC 1MNEA 3DRPA 3P96A 4P6QA 2Q79A 5LSRA 4F2SA 4CLTA 4DN0A 2CPIA 4A8WA 3J7YU 2JOQA 1ZAWA 1BHNA 2M88A 4O4RA 3GYNA 1Q7YT 4K2JA 3D9BA 3TUPA 1TMMA 1X4GA 1RT3B 3X3UA 2M9KA 4JI2F 4TQSA 2YH0A 4I6YA 2RQCA 1NDKA 3QLHB 3PRDA 2EK6A 1HQ2A 2VDHA 3VHQA 3KKFA 1JJCB 1S6QB 2HWHA 5EWFA 2WCXA 2Z2LA 5D4PA 3BQ1A 3VGVA 4A48A 4LRCA 1WI8A 2WAQD 4OI1A 3WC0A 1NKBA 2IBKA 3UFCX 4P2XA 3HHLB 2DEIA 4ECVA 3ZZUA 3PCOB 5C24B 1FE4A 2CQGA 2XS2A 1TUVA 2KDOA 4C9DA 4JYAF 2QN6B 2ACYA 4X4VA 3FZBA 1N0VC 1KHWA 2ZUAA 3Q83A 3N5BA 2L48A 2Y0BB 3W2WA 4DR2F 5KG2A 4J9RA 2DTJA 4P73A 4K5RA 2GQQA 3J80U 4USJC 5BJRA 3K8WA 3AB4B 2Q1LA 2MB0B 1JMTA 2WW4A 3FCWA 4LF4F 2F8MA 4KH0B 3BN4A 4ZHRB 4AXJA 2DPIA 2LDYA 1XR6A 5ETMA 2HWTA 3MCNA 3SDEA 1J27A 1NNDA 1WOPA 1UJ4A 1FDAA 2JEGA 4FF2A 2JFKA 3SEOA 3PFOA 1VRUA 4BDPA 5HJYA 3MAAB 4O3NA 2QIFA 1UWBB 4JI4J 5EGYA 1AFJA 4M5IA 2LXUA 1UVKA 3G87A 5IT9U 3I32A 2E66A 2KXFA 5KFYA 5MLCV 1RTZA 3FEYB 4ZVFA 5CZXA 1L3KA 2VODA 1SC3B 2GV1A 5E7OB 3PEJA 4QW9A 1SJ3P 3A3OB 2HHHJ 1HBOB 1NU4A 2HFZA 1SQEA 1FFWB 2HS3A 3MDFA 1NSPA 1S0VA 1HI8A 5HVHA 4IQXA 2H9ZA 1NKEA 1DRZA 3S7RA 3CMQA 2RAQA 2VQEJ 1WC6A 4YR2A 1G7CB 2X1FA 3KK1A 1NDCA 5L39A 1NB7A 3MMJA 3BEGB 1ZH5A 2R7XA 3NAHA 3K5LA 2OLWA 1GEHA 2DD8S 3BBCA 1G1XA 2ZBIA 5EUHA 5A8WB 1JLBA 2M3DA 2UXBF 3P49B 2OD6A 1S0MA 4ES3A 2DNNA 3PO4A 1TL3B 4F7VA 1GH8A 2B4UA 4KQZA 3G71S 4HLBA 2RKIB 2C2RA 4RL1A 4IDKA 2WOMB 1LW2B 4TY8B 2OMLA 3BM7A 5B0AA 4LF2A 1Q53A 2NXCA 3LP2B 1EETA 4UOCA 4I67A 2B4VA 5F8LA 3FK4A 1RAHB 3UDVA 3OTOF 2BJ7A 2LP4A 4X4RA 3GILA 1MN9A 3M9OB 4K0KJ 2BQ3A 5KFFA 1R8AA 3FCHA 2ROPA 2DNZA 3NNHA 4DL7A 3WIVA 3DU6A 3QFWA 4HDGA 2HGNA 3FQLA 3CCMS 4Y2CA 4DMZA 1N5YB 3GPAA 4ID8A 1HNZJ 2QLBB 3OUYB 3UDCA 1X5TA 4NLPA 5KOWA 2QEXS 3UD4P 3M2VB 1X9WA 2WZ1A 3OLBA 3V6HA 3PVXA 4NCGA 1I3OB 1RXOB 4ZVUB 2IDLA 1C0TB 2B0GA 3JSMA 1BWEA 1VQYA 4ES1A 2SXLA 2PGCA 5FIIA 4HT5A 4ID5B 4DCPB 3BKTA 3C15A 4ZOSA 1S72S 3ELHA 3JQMA 3VZHA 1O0PA 4JI0J 1TVRB 2BE2B 2NYHA 2EG1A 2ZBQA 4X65F 3DOLB 2I38A 2RU9A 1NJIT 1X60A 2XNRA 2R7TA 3KUEA 2CQBA 1XMQJ 3NGSA 3M2UB 2BUNA 5KFRA 1KRPA 5J2QB 2CZ4A 1S97A 2BW2A 3H2VE 2R2RA 1HIYA 4DUYJ 1N6QB 5DG8A 1TFWA 4P10A 1T03A 3K5MA 3ENAA 2DNRA 3MM5A 2QLJB 2E1RA 3K7RA 2W9CA 5C2GA 3AD7C 3D0IE 5DDRC 2W9BA 4HDHA 2B9WA 2ZJPQ 4ECRA 3LTOA 4O0IA 4WK1A 1N33J 2EFQA 4CO3A 1NK6A 2GVDB 2NR0A 3I0RB 3CXCR 1QY7A 1KTVA 4LQ3A 1SJRA 1Y9OA 2CVEA 2RU3A 2C2MB 1S4EA 1RT3A 2CPZA 4HYKA 3CJ5A 3H90A 4ECQA 2A6OA 4DOZA 3RAQA 1YJ9S 1S6QA 2EKNA 3RZAA 2LU2A 2V8HA 4ZLJA 5I4MA 3KLFB 1V6HA 2YNFA 1X5PA 4C8NA 2GNKA 4J9PA 4NA2A 1HNXF 2XYPB 1CSJA 3QT6A 4J9NA 4YP3A 2HPUA 4QJVA 2AT1B 3PG9A 2OUGA 2V2KA 4C3LA 3FSIA 2CJKA 3HF5A 1YGYA 3G82B 3HHLA 1OJ4A 2WTFA 3QT5A 3NNAA 1PBUA 5C24A 4ELUA 4QWAA 1YDLA 4WFZA 2FLLA 3MR5A 4CLKA 1RT1A 5K5MA 5GAHI 3NGDA 4G6VB 3KUGA 2BW7A 3MEEB 4UZBA 4DLGA 2ASYA 2LDIA 3IM9A 1O51A 4DFJA 2DB1A 5HLFA 4BS2A 4H54A 1LKZA 1IKVB 3OL6A 3MXHP 4JI7F 2C1EB 3H25A 2IYGA 2XZDB 2M52A 5JMNA 3WDOA 5KAKA 3FCVA 1T0TV 3ZZPA 4J9MA 3A1YG 5BYQA 1QVFR 4YDXA 4K4WA 3TZYA 2JEJA 3TVYA 3HVTB 4I2PA 3Q8QB 4U8YA 4P2SA 2LQBA 3CO0P 1KN6A 1VISA 3BH6B 3T5JA 2ZC4A 2Y1LB 1UWBA 3JTPA 3J81j 3MMBB 1WWHA 1BMQB 1YSJA 4HEA9 1E6YB 2EFVA 4F3OA 4OYXA 1N8RT 4RNOA 2DNPA 2KH9A 4V19X 3MPVA 2HNZB 2JHEA 1SB6A 3V6JA 1DFDA 1HBOA 3JAMY 2XGQA 3AD8C 2XS5A 4UUXA 2F4VF 4NA3A 4LRFA 1MU2A 1H6KX 1A0OB 4ZKAA 5LJ3Y 3CT9A 4UT4A 3BV8A 5T14A 2ADCA 3QYYA 1YWXA 2IVFB 1NDPA 1VBXA 3CIMA 4U8VA 2IM1A 2HYIB 3RAXA 4UW2A 4PXEA 1ZBTA 4PR6A 4ZJOA 3OFHA 3BGRB 1JKHA 1S1TB 4RW9B 3NCQA 3I56S 1TUGB 2UUTA 2FHMA 5IC4B 5J1EB 4YR0A 2RS2A 3DOKB 2FTRA 2IPOB 4NLGA 2B4OA 3LANA 2VC0A 5HMYA 1TL3A 2GVZA 1SUQB 2RKIA 3M30A 4Z37A 4Y0FA 1FTRA 1ZOTA 3FKBA 4KPYA 4TY8A 2EXUA 4RBTA 2P9EA 3V6DB 5M2UA 4O3QA 3DOMB 1B3TA 4RWWA 1JQGA 2HURA 2IM2A 3TAMA 2A3JA 3KLEB 2AX0A 4BWJA 1CULB 4KSEB 4OI3A 3M6VA 1XMOF 4M1KA 1X31C 3NP5A 4D3GA 1NJWA 2YPZA 4WFAQ 2R3VA 4Q43A 1DURA 1MWZA 4AQYJ 1NSAA 1Y10A 5AXLA 5HO4A 3RR8A 3NWGA 3H20A 1BQMB 1TL5A 4CYUB 5I3PA 1Q8IA 2HAFA 4RUHA 5CYMB 4OHWA 2DH7A 4NZ6A 1KNZA 3OUYA 1WTFA 4DV7F 1REGX 3EGZA 5DETA 4Q2MA 3POTB 1X4HA 1EJ7L 5GMKa 1JLFB 3EICA 1U1PA 5ETSA 4ID5A 4MIBA 1NSQA 5G0RB 2Y9HA 2QL7B 3C16A 1GMVA 3T1YF 3S1TA 4KB7A 2GC8A 2BE2A 1ZTTA 1WNEA 3DDKA 3TZZA 5HK4A 2ZNZA 3DOLA 2VV5A 2C2DA 4RW8B 1B7FA 2CQ2A 3QBCA 2W7OA 2E5HA 1U2RA 2ZDOA 3RUBL 2J9CA 5HL7Q 1NXIA 3AA8A 3M2UA 3T5HA 4O3SA 1RU2A 3LAKA 4UUWA 1N6QA 3PW7A 3DLLQ 4FZVA 4KH1B 5IV3A 5LOQA 3KXDA 4DF4A 2K7KA 6FDRA 1H72C 5ETRA 4DL3A 2ACMA 4TU8A 2BQRA 2HS4A 5LT5A 4QR1A 1RT2A 3H7HB 1H2UX 2KG0A 3HO1A 4DQIA 3H98A 1VK3A 5A0YA 5DLFA 4QWBA 2BKOA 4USTA 3I0RA 1SL2A 1EP4B 1HHTP 2KN4A 2BANB 3AJ1A 2IMWP 1RTIB 4KT0C 1GTHA 1F2HA 1YBTA 3GTYX 1NK5A 1BGXT 4XDCA 1V5VA 3NS6A 3IC1A 4J9KA 2D3O1 2E29A 3DU5A 3UNYA 3KK2A 2MKYA 4Q45A 3HPOA 4IH5A 4GC6A 1NJZA 3R2DJ 4CNYA 3F0NA 2KG1A 4X62J 2W8LA 3FEXB 2I6WA 4LF6F 3GIKA 2F9JA 2AKWB 2DGOA 1S9GB 3BPDA 4ENOA 3AB2B 1GAOA 3QGHA 2RHQB 1KTQA 2BM0A 1R8BA 4Q8FA 2QJ3A 4CLLA 2MEWA 7FD1A 4ZPVR 4TQRA 4MFBB 3ZO7A 1Y0HA 1V9OA 5I42B 4WFXA 3MMAB 2HHTA 2MLXA 2HHSA 4XDDA 3MEEA 4AL6A 4AL7A 1KSPA 4DHVA 3TX8A 4ETXA 4X66J 4RU9A 4PABA 3PJXA 4WF9Q 2LXIA 1IKVA 4CDIA 2AEMA 1QM9A 1UP1A 1S5ZA 2E7VA 4KV8B 3CGIA 1TKXB 3TNVA 4I68A 2HFUA 2D1CA 2JFDA 3D7SB 3VWSA 4DFKA 2FDNA 3M9MB 7AT1B 4OZNA 5KFEA 2EBEA 1Y5IB 3RYLA 3VTIA 2MKIA 2YWHA 3VZIA 4J90A 2RF2B 1B0PA 1N36F 3MMBA 2GIFA 4ZP6A 1ZM4A 1E6YA 2EFPA 2N7YA 3QRRA 1VDHA 2ALYB 1IBCB 1WHVA 2APOA 5AE2A 2CQ3A 2GGPB 3MD3A 1IR0A 2OEKA 2LYVA 3K5NA 4OX9J 3PR5B 3SMZA 5A2QY 2Z2YB 1A6LA 5DDPC 4Q2LA 1ZS6A 2MKCA 4FPIA 4DV6F 1IJFB 4AL5A 3I0SA 3KLHB 2KVIA 1FRKA 4OLOA 4I56A 1JNRB 3ZZRA 1X4FA 3GMGA 4CNZA 2QC3A 1UAWA 4XAKA 4F0KA 3R5BA 3M1VB 1F5CA 2M0GB 6AT1B 2H48B 4R8UA 4MIWA 3RB3A 3MZIA 2AJFE 1S1TA 1RCXB 1JJ2R 4OJHA 3H5UA 4B3MJ 3FRZA 5D4LA 4B08A 2OIHA 1FVSA 4ECTA 5J1EA 1LWEB 1HI1A 1DTQA 2RRAA 1Q5YA 1SUQA 2R2UA 2B3TB 2BV3A 2CNKB 3V6DA 3I96A 2P6TA 2RSQA 4DR7F 4FDFA 1WSVA 1KVKA 4IFVA 5DZ6A 2VH7A 4ZA1A 1C2PA 1CULA 4L72B 2YX7A 1SH3A 1K44A 4IO9Q 1IKYA 3HFZB 1N5VA 2DGWA 2UUCF 3Q8UA 3EDRB 1C1CB 2OPQA 3MM8B 2IC3B 1EIYB 2IRXA 5IM0B 4TN2A 5IWAF 3R6GB 5HATA 4BBYA 2MZRA 3H4DA 4MYTA 2LXFA 5M2RA 2FGCA 4S0MA 4CYUA 1EB0A 4OL8A 1GK8A 2VG5B 3TJ8A 5CYMA 1CG2A 3RBZA 3MOJB 3VAJA 2ZFHA 4PG4A 1FDNA 4J9LA 2CQHA 2MKJA 3POTA 4WZMA 2ADBA 3PHEA 3W5ZA 3DCAA 4DL2A 2YWKA 1K8AT 2CDQA 2OSRA 3T5KA 5D0EA 3RGIA 1LWCB 2DK2A 3CJ4A 5G0RA 2E5LJ 1VQKS 1HNWJ 1N54B 4LSNB 5M2PA 2EW9A 4U7UD 2GIRA 3NGRA 4ZP8A 4N76A 3AFGA 2DHSA 2EC2A 2UXDF 2OJ3A 3QATA 5HANA 2ZKTA 1UFWA 3WIUA 4C3KA 4A8XA 2B4PA 3H40A 1R0AB 2DGVA 3OXFA 4Y00A 5BYRA 3OHBA 2YKMA 4CI0B 4WCEQ 2CQCA 3FDSA 4YMEA 3ZNUA 3HXMA 1JLGB 3HJFA 4CLZA 5GAGI 2BM1A 2ZBPA 2BJ1A 1WOOA 3UCUP 4NMXA 4HH0A 3SCKE 4WTYA 4ZLNA 3EUNA 4ILRA 3BSCA 1GMWD 2QYGA 2BANA 1VLYA 1RTIA 3AH6A 4F0MA 4HH1A 5AXNA 2QZ8A 1K73T 1VIOA 4WU2A 3Q8VA 3Q8SB 1RT7B 4ZIWA 4P7TA 2AEJA 1YKWA 3V81B 4Q44A 1Y5LB 4RW4B 2ZOMA 5CYQA 2PO4A 4B9UA 4WPAA 1E6VB 4V19J 4OV1A 3BSNA 2O66A 5C25A 3TVZA 2R8GA 4GO5X 1AYEA 1IR2A 2XCPA 1RAAB 2HBQB 3EVOA 4YEAA 3C19A 1HHSA 1UJ5A 3D6HB 3UVJB 3QSYB 4JI6F 1UVLA 1S9GA 4FVCA 1KFDA 3M8PB 3JQKA 4OZ3A 2NQPA 1CBKA 4H4MB 4TYBA 3W8PA 1S10A 3MF5A 4F4XA 1O5JA 2IA6A 5I42A 3T1HF 2MHNA 1YJWS 3MMAA 3ISZA 1W2BR 2JC1A 3EZ5A 1FF2A 3MR2A 1FX2A 4ZIVA 1UA0A 1C1BA 1X9SA 4Y28C 4DV5J 4P72A 2DNYA 1QDUB 1UFKA 3FBCA 2HZVA 1FCAA 2XY5A 1KVIA 4ETZA 2CPFA 1TKXA 2OAUA 2G1DA 3JSYA 3GIRA 1AUSL 1SI9A 1IXKA 5A2QU 3L7OA 4PG7A 1RACB 1JB0C 1GTEA 1SPBP 2UU9J 5HJXA 4PXBA 3B4MA 2JLGA 2IAJB 2RF2A 4ZPTR 4LRAA 2IRUA 5F3ZA 4OFZA 4CRJA 3PX4A 1F60B 4ATNA 2FHJA 1U24A 2KT5A 3G8TA 1XN9A 3JXOA 2QLWA 3HVRA 3OVBA 2FB0A 4CM0A 4CH7A 1U49A 2MLYA 2GGPA 4KKOA 1FD8A 5I3UA 2ZUGA 3I5BA 4X64J 3EVWA 4O44B 1YVFA 3OBIA 1KHVA 1FXDA 4BC7A 1FE0A 4BC9A 4F36A 4OYZA 3MAQA 1FFGB 4USWA 4DSEA 5ETPA 2NXUA 4WFNQ 3M1VA 3R5GA 2HMIB 1CEZA 1VQNS 1KR4A 3WZ0A 1TAQA 2J7WA 2V2ZA 4MYUA 1VQ8S 1KOOA 2D3OR 3S6EA 1AT1B 1RK8A 2DNOA 2FJWA 1KWMA 3VAMA 4NEZA 4MK7A 2MSTA 3TEGA 3R7NB 2NZCA 3NRBA 2BBEA 2C3OA 3OSPA 1Q1KA 2ZH3A 2MQ8A 5D0GA 3DYAB 3HX9A 2IJRA 4F4KA 2RMLA 1BY9A 3ZTRA 4NRUA 1QTNB 2AX1A 5KG7A 5KFAA 1IBMJ 1FKAF 1NM2A 3WX4A 5DGBA 2KO1A 1Y7PA 1BD6A 3CDBA 1F5AA 4F4ZA 4FS2A 1WDDA 2K1RA 4ZVQB 1JK9B 5RUBA 3MPYA 4JI4F 4ZVRB 4Q0BB 2UZAA 4YHHJ 2NREA 1T7PA 3X1LB 1BQNA 1S1VB 5GAGU 1RCOB 1R8HA 2IVMA 4NYPA 1Q78A 5CABA 3I87A 3MM8A 2AV5A 5IM0A 1Q7LB 5FDLA 2K7JA 3N6MA 4LF5J 2GAHC 3GB0A 2XEXA 3ILOA 2VQEF 5EHHA 1U1OA 4C0BA 2DO0A 4NLWA 4PXDA 2PI4A 5JXSA 4EZ9A 2WRMA 3PFEA 1UPPA 3OPKA 4RU2A 3KTQA 2OO4A 4M8LA 4PQAA 5T7LB 4W98A 1M1HA 1RLCL 1B0TA 3TUZC 2M4MA 3EVMA 2VKZG 4LQ9A 3DKDA 2WVEA 2ZITA 4JB8B 5GMEA 5KG6A 4DG1B 4H4OA 4USKA 4QR0A 1TL1B 4USVA 3SBMA 1LWCA 2WSEC 2YNIB 2IDEA 5KG0A 4ALZA 1U2CA 1DY3A 1UZHA 2LQ5A 4QPXA 4LSNA 4D3HA 3LUYA 3TVKA 4DR6J 3W2VA 3ZZZA 1WKKA 3MGJA 1R0AA 3TX0A 1S1UB 4DEZA 4YDDB 2WVFA 5L1KA 3LH2S 5AXMA 4QIVA 2E5JA 1FKOB 1XNRJ 2DIUA 3EGWB 3HHLC 1S9EB 4K0KF 4Y2KA 1RHJB 3W60A 1ZPWX 5F0UA 4WKRA 1ICEB 1U48A 3ZXWA 2ZM6J 1ULRA 2QRRA 3RRHA 1QJHA 1R0BG 1S76D 3NG8A 2BZ2A 2L3MA 4U6PA 4J9VA 2DR7A 2PEHA 4JV2A 1HNZF 2ZE2B 5B7WA 4DU8A 3R5AA 4NI2A 3NL0A 1NEEA 1M5VC 2AYEA 3OVAA 3OV7A 4B9MA 2HFSA 4FYDA 5D4NA 2YKPA 3V81A 3RW7A 4XTTA 5D4OA 1HQEB 1SL1A 1SL0A 4RW4A 1LXNA 3W9HA 2BX6A 2XMAA 2CZVC 3ENWA 4ED6A 4QIGA 5FLXU 3MFHA 3IBFB 4KJIA 1XIQA 4DBQA 4EGLA 2UUWA 4JI0F 3UVJA 1DHMA 3F73A 1ZAVA 4AT1B 4HKQA 2JH3A 2AYMA 4LF1A 3M8PA 1XMQF 1N48A 2DYAA 5B0BA 1NPPA 2RQKA 3D28A 2KJWA 2VBYA 4K59A 4DUYF 2DBBA 5A76A 4GMKA 2G13A 2UV8A 3PJWA 3T41A 4WYLA 2DY9A 2YX4A 1JNZB 4ECWA 3QIPB 2PMHA 1HBNB 1FK9A 1WELA 2XZTB 1ZM3A 2AW0A 1N33F 4P75A 2JRSA 4TLQA 4FVMA 1NZAA 3AA9A 3KK3B 4KO0A 1T02A 3Q8PB 3SCLE 2QV6A 2YWWA 3KUHA 2H1YA 4DN9A 2IAJA 3MEKA 4YS2A 2CJXB 1REVB 2EFNA 2F8HA 1YG0A 4JP8A 2NSBA 5IFMA 2B8QA 3E01A 3BH7B 4ED8A 4F0HA 2WHOA 3K59A 2IMOA 1VQ9S 5B09A 5DM6Q 4E0DA 3BBFA 2VF3A 2OKQA 2CXEA 2HHVA 3NCPA 1OPIA 2DH8A 2DRBA 4CO5A 2UVVA 1M5KC 1UVJA 3H2UB 3J81Y 3DN9A 1FKPA 1NK7A 5L1JA 4TXSA 2JWNA 1U0SA 3FFIB 1U1QA 1P8GA 2J8SA 1TK0A 4UQTA 3IWNC 3NGUA 1VBZA 2HMIA 4NXMJ 2B5JB 2BQUA 4DLEA 1OSCA 4DJBA 1KQFB 2EVZA 3KDNA 4TU9A 1CJUB 4C11B 1B7YB 4WU3A 2DGQA 5E3RA 1RTDB 4ZCIA 2XY6A 4DL0C 1DARA 4F2RA 3VAKA 2Z0GA 4N56A 3DYAA 4URQU 1BE4A 5AJ3J 2L9WA 2Z30B 3QO9B 5LMNJ 1KFSA 3IGVA 4DL6A 3WBZA 3R6LB 2PC6A 2GJFA 5KFMA 5DGAA 2L08A 5KFOA 1BLUA 2F9DA 3NY0A 3K89A 2CPJA 4KTQA 4K4XA 5KFIA 3FMWA 1VLOA 1R0CB 3OVSA 3TO8A 3MPDA 3ILIA 5B0DA 3DNCA 4OYBA 5IQ6A 4ZCLA 1H0HB 1JXEA 1VHIA 2A2DA 1U6BA 2ROEA 2W4CA 3OXGA 2JJ4D 2CIMA 3MM6A 2AQ4A 3LF0A 3TZXA 2D9PA 4DCJB 4NASA 3CD7A 3DLHA 1N5SA 2GMLA 3VAHA 2V4JB 5HROA 1TKTB 1A7GE 2Y1IA 5F0WA 2HHQA 3Q2SC 4CZCA 3VVTA 4QIEA 5E3CA 3L4BC 3ZTPA 5KFPA 1ZM2A 3DGPB 5H1SV 4A8KA 2V5HG 4UF4A 3A8KA 3SIPB 4LF9J 2CA9A 2I0XA 1PGZA 3L3CA 2QA2A 2K2PA 4DG1A 1JLQA 2FJXA 3PM9A 2HVHA 2PMWA 4BHQA 3MPUB 4IRCA 1RB0A 4LFCJ 2RD5C 2YNIA 3HZGA 2KM8C 2R7VA 2RIJA 2ZKUA 3R8YA 1EKSA 2KL8A 2VFSA 3KMSA 2WVDA 1KQSR 2O3DA 1YRTA 2WB1D 3BJYA 1PG5B 4KY3A 1UVMA 5K8OA 1NPRA 4TKTA 2UUBJ 4GC7A 3ULHA 1S1UA 2YKOA 2XMVA 4JUZA 5F8JA 3TA1A 3KLVA 1FKOA 2LQ9A 1SXLA 3UW1A 1RT4A 1NBEB 3RR7A 4OYMA 1LXJA 3J80Y 3EPIA 4IOCQ 1S9EA 1SJQA 3T3FA 3UN3A 2VOOA 3KJFB 3T1AA 2KXHA 1JJHA 1HQUB 1PJ7A 2V68A 3LP1B 1KLNA 4C7QA 4K5SA 4AQYF 4EFAC 3A3PB 2HK2A 5A6PA 3DDNA 1IVZA 2PFDA 1RBAA 5D3GB 1XTZA 2ILYA 3T6BA 3G8SA 2DJWA 3ETOA 3FBBA 4I7FB 2PN6A 1FJGJ 4UY8T 5DG7A 2D74B 4P74A 5IT9Y 5J2MB 5IOLA 3HKZD 4DF8A 1U1KA 2XWXA 5A8RB 2PT0A 1HMVB 1HQEA 3QZ8A 4Q5VA 5F41A 2V9WA 1ZETA 5EX3A 4WE1B 1BQXA 2D3UA 2ZVIA 1X5OA 4QWDA 4AE5A 4LMZA 1VCTA 4CO2A 3ZC4A 1TZ0A 2QFIA 2JX2A 3IR7B 2QE5A 2HLUA 2GMHA 4PG8A 1VQ6S 1XERA 1Y3JA 2MJUA 4CO4A 3QRQA 3NOGA 5HMXA 1SKWA 3MTKA 3O5TB 2CDRB 1NLKL 4URGA 4DFPA 4LVOP 1YRUA 4BLGA 3EX7B 3SQGB 2B6AB 1S7HA 5D6GA 2NUHA 2R42A 1SJFA 4CTAB 2QMWA 3UNGC 3CJTA 3OLAA 3LP0B 1R31A 3MOZA 3BB5A 3D1OA 3W1YC 3L95X 4OJ1A 5E41A 4O4GB 1RISA 1H74A 4NRTA 4Q7AA 1T05B 4C8KA 3ICLA 3DMJA 2KFNA 2HHXA 3SFGA 1EHWA 1LNQA 3L7UA 4CT8A 1U4BA 2VIHA 1SC4B 4IH6A 3KK3A 2YKNA 3E51A 1DJ0A 4LF7J 5AXKA 2XWYA 2QA4S 1LWXA 2RJZA 4HVZA 3KYLA 2QTWA 3ZZ0A 1FEHA 3RB6A 1AROP 2CNOB 5A8KA 4FF4A 1B70B 3QAEA 4X2BA 4RX6A 5IQQA 1KBRA 3DHWC 4AFFA 1U26A 1IUJA 1F2GA 3HFVA 2HBYB 5CYJA 3D6FB 1CJTB 2RUSA 2GW8A 2ZZMA 4X62F 1UKUA 3RB4A 2CQ0A 3DLKA 4Y65A 3C3LA 2FJAB 2PA3A 5JJBA 2V9KA 1CC8A 3PV8A 2D7SA 1QSSA 4CH0S 3HK2A 5KFNA 3RG6A 2XNQA 2PIIA 3JQJA 5CD4A 1NJYA 4J9UE 4ZPCA 1OS5A 2NXEA 5KFHA 3MECB 4RUBA 4X66F 2AWZA 1U2FA 4CLYA 3H8YA 2B5JA 4E98A 1R3NA 3JYTA 2POKA 1CJUA 1RHUB 2FPHX 3CJ2A 1VHFA 2MPUA 3DI6A 4IG0B 1IBKJ 4FBTA 3ZNJ1 4CO1A 4ZVPB 3T9ZA 3BSOA 1FHTA 2RB7A 2YQ3A 1NCLA 1RHKB 4ZITA 2AF6A 2CQ1A 5E3PA 2ZH1A 3TR5A 4IG3B 3KHGA 1YQHA 1J5EJ 2J0WA 1WC3A 4DSJA 5L1LA 4WFBQ 4FKXA 7FDRA 1Z2LA 4MTPA 1OYEA 1XK8A 4WJBA 2HFOA 5KFSA 4HHJA 3RTVA 1QSLA 2X3DA 3CCRS 2N3LA 3B78A 2JL9A 2DCUB 1X4DA 1B99A 2IYIA 2E7XA 4K4YA 3T5LA 1AFIA 2O67A 5SZTA 4OX9F 2OELA 2PMZD 1RABB 4L74A 5B0EA 3CF5Q 2MKSA 2XM3A 3OTBA 4K8RA 2BKPA 1RWVB 3IWLA 2F65A 3DLJA 4DR1J 2CJBA 1D9DA 2J9DA 2C3UA 3QWUA 1VC0A 5F8HA 4PUOA 4P9SA 2BA9A 2O5DA 1T8EA 4DR4J 2YNHB 5DS7A 1QE1B 3D66A 3UCZP 2CJQA 1CJKB 3GIIA 2OH2A 3THPA 2WONB 2LMIA 4K4VA 2EBGA 4M5GA 4TU7A 2CJAA 1WF0A 2ZDPA 4B3MF 1RYRA 2G9OA 4I4BA 5HI7A 1Q81T 1QAJA 3HT0A 5LMUJ 1PYTA 3VF0B 1XWLA 1DLOB 3V2UC 5C7PA 3EWGA 3C6UB 3RBEA 3GWCA 2IBOA 4J5OA 4DPOA 4JI3J 2NZ4A 1YJTA 3QIDA 3AODA 4RLEA 3FVYA 2I5JB 1NB2A 1HHQA 4O0NA 3DFEA 2MYFA 2E5GA 3IG1A 3KLGB 4LT6A 1RAEB 2Y1JA 2LEPA 3GG1A 4OIXA 3UPFA 3R7SB 2XLJA 3PO5A 4I0WA 1SBRA 1C0UA 1ROFA 2DKOB 4QWEA 3GJQB 1HYSA 3OFFA 3DRYA 3N01A 4PWUA 2HQFA 3GU0A 5D3GA 2BVZA 2V67A 2ZH8A 4K50A 1QAYA 1DTTB 2AJ4A 5B08A 3GQCA 3JTNA 2E5IA 3OR1B 4U9RA 3EMTA 1GX6A 3SSQA 4LRBA 2YNGA 4JV5J 1SIWB 4J91A 5J2MA 2KXNB 4NLUA 3MCMA 4PZVA 5KG4A 5ITHA 2BEFA 4FYWB 3G4SS 1HMVA 3FBFA 2VG7B 3R7BB 1U45A 1TP7A 2DEJA 4OHZA 1DQ9A 5GAEU 1LW0B 4KGMA 1HW9A 2ZBRA 1YTYA 2KT2A 2E5LF 1HNWF 1GNKA 1IN0A 5C42B 4QBUA 3PZPA 2HHUA 2MHEA 5L9XA 5KG3A 1FA0A 1MMDA 2EG2A 1HKAA 2N3OA 3CCJS 2I2YA 2FZKB 3TAQA 3D2WA 2W8KA 4EO6A 3LGMA 4ES2A 3CMAS 3WQPA 3PKMA 2FVPA 3SQGA 1F9EB 1URRA 2MXYA 4O23A 4RNNA 2A6MA 5KFQA 2W2MP 1DBDA 3Q8RB 4DUTA 3CCSS 3EZUA 1VJWA 4DUZJ 1H2VZ 1LWFA 1IJEB 2B9YA 2GJIA 4KAIA 4O4GA 1HD0A 2CPXA 3CEDA 5IT4A 1GX5A 2XSJB 3CJ8A 2MZSA 2HLTA 3HHLD 2IM0A 1FX4A 2BABA 3R1LA 4YB6A 3F44A 1WSRA 4QU7A 4DPWA 4PAAA 1R7IA 4P52A 1RT6A 2FC8A 1KOHA 4PKDB 4WXOA 1FI4A 2EFOA 3MMCB 2FC9A 4H4KA 2DHAA 2XULA 3NKYA 1NUEA 2QLFB 3AQPA 5K14B 1AZSB 2FYXA 4N8OA 2C22A 3M4XA 1SH2A 4LFBJ 4FXDA 4EU0A 2KZMA 1FD2A 1QLNA 2XZWA 5KT6A 3MR3A 2AIRB 5IZHA 3KNGA 3TQ1A 3SV3A 3R5DA 1SVDA 3IR5B 4DSLA 4RW7B 3W3SA 4DS4A 1M5HA 1FERA 3W61A 2VFVA 1S49A 2YTCA 5E5NA 4ANDA 2LFVA 2HNYB 3DHXA 4HHHA 5B0FA 1HR0J 4F04B 3BN7A 3CJKA 4ZS6A 2G4BA 4KRWA 1UL3A 3VR1A 2E1PA 5KFLA 2RVJA 2XY7A 4PPDA 4N47A 3I5CA 2YKAA 3P3DA 3HKWA 3P5TL 1WTBA 1ZA2B 1D8ZA 3D4JA 4L75A 5EWEA 1VBYA 4N77A 2GIQA 4WFYA 4PRFA 4FF1A 2IA0A 4ZMMA 2C2NA 2HQGA 3MECA 1YJVA 2DR6A 1LEOA 1YITS 4DPYA 3EXCX 4FYYB 2HIYA 3OSNA 4DV5F 5F8GA 2FVRA 3HHKA 3PXGa 3PIPQ 4YR3A 4IG0A 6FD1A 4IOBA 4GVBA 3NBPB 1SV5B 4ZPAA 1JLCB 1NZ8A 3IS9B 4EZ6A 2GS8A 2FHOB 2RQMA 4ICLB 1IKWB 2Y8WA 1X5SA 2KT3A 1KP6A 2KKHA 3CE8A 2UU9F 4OZ5A 3B4DA 4KYZA 1Y4ZB 4F25A 2BYCA 2HQ3A 4IG3A 2VONA 2HVEA 1Y5NB 1Q82T 4ANEA 1WF1A 3QLHA 3NLCA 1XC9A 3TW0A 2ZZNA 3GFZA 1WEYA 2J6TA 5DZ7A 3SV4A 2VG6B 3FJ2A 3TZWA 5HQMA 1RWOB 1F3FA 1IKXB 3MEDB 4WBFA 2I1RA 1TK5A 2CPYA 3DXBA 2VA3A 3OQ2A 3TWZA 3H5SA 4X64F 4ZJLA 2M8HA 5K8PA 3DRRB 4BCAA 1U47A 1X7VA 2FVCA 1EARA 4QWCA 1JIHA 2XMWA 2ZHBA 3QGIA 3AJDA 1VBKA 2OPRB 3AAWB 1RA7A 1D3WA 4CO0A 1NHVA 3D67A 3LAMA 2OFGX 1NK8A 3R97A 3G6ES 4I1TA 3ITHB 1QE1A 2G2OA 1CJKA 1RYSA 3LGHA 2WONA 5F8IA 1I51B 2E1MC 1VC6A 1S99A 2HGLA 4GKKJ 4A4JA 4ZHRA 3H59A 3IMQJ 3OXLA 8RUCA 1K0VA 3D1QA 4ER8A 5CCLA 4EBCA 2RH3A 1EQMA 3QPIA 1IBMF 3C6UA 1IWGA 5DO2A 2HFNA 1SKSA 1VR6A 3K8VA 1U1RA 2XYHB 4AXIA 4EO8A 3BO3A 3MAAA 4NLOA 2I5JA 1R89A 2V8DA 3FSXA 4YHHF 1QUVA 3DLGB 5CAAA 3OTDA 4EBEA 4DX5A 3IFEA 4ZCKA 4MKAA 4EBDA 1G2EA 2HKEA 4X84A 3HP6A 2MQMA 2HVDA 2FJVA 4M63A 1S6PB 1UW4A 4GRSA 4LF5F 2Z8QA 1DTTA 1KS2A 1FT8A 2CG4A 2GAGC 1DQ8A 4C48A 3OR1A 2D41A 4W92B 2XO6A 5ETLA 2YQ0A 5G4DA 2N82B 4UY85 1NAQA 2WK4A 1OQ3A 3LA0A 3D6TB 4DZ6A 4A46A 4MIAA 2MQPA 2ZWOA 1VRUB 3H4BA 2V69A 2RT3A 5A8WA 4QYZK 1S59A 1RGVA 3GYXB 5CXTA 5C42A 1MG7A 1YHQS 1HD1A 1UZDA 4LIWA 2HRUA 4DR6F 2YWGA 1FNXH 4J7CA 4XPCA 2WOMA 1LW2A 1N32J 1VGYA 4KHPJ 3H5YA 1XBWA 4IFYB 3LP2A 2H5JB 5J1NA 4ZN1A 4P71A 2MZTA 4M94A 4IR9A 1XNRF 1NK9A 1FRMA 4ITSA 1FO1A 2N4CA 3CC7S 3EE3A 2CJYB 1UPMB 3N0VA 1R27B 2XSJA 2ZM6F 1VRQC 4Q8EA 3HHNB 4ELVA 4ZP7A 4LBHA 2DHXA 3I4PA 1VQOS 4MT1A 1LFPA 4JV0A 5H9FJ 1D1UA 1FTCA 1S77D 2MZ1A 1UJ6A 1FRHA 3UN5A 1N5YA 4J9SA 4ECXA 3MMCA 1NO8A 3NAIA 4HI2A 1T9YA 3M2VA 1S1WB 2W9AA 2LU1A 5K14A 1SKRA 2KU7A 4IDKB 4C98A 5GMDA 1VRTB 3M9NB 3EPGA 2F5GA 1VQ7S 1OYDA 1C0TA 5HVFA 1FNMA 1BXNA 4ED4A 4NZ0A 2K06A 3LWMA 2WW8A 2XS7A 1I94J 2L9NA 3PKYA 1N0UA 3LQVA 4NE9C 2OTJS 2YWFA 1PIEA 3GONA 1TVRA 4Z2XA 1N88A 4PWWA 4F02A 2PA8D 3C14B 4QYZJ 4F4AA 4KPCA 2UXCJ 3CO9A 2ZOFA 3CCTA 4IUFA 3J7A1 2R4FA 2JLFA 1FJ7A 2CNNB 2OFHX 3TUIC 5L1IA 1LQ9A 2E44A 5D78A 5J2QA 5HBMB 1Q0NA 1RI7A 2C2OB 2VICA 3LGNA 3HULA 2VPWB 2BACA 4OZ2A 4EK2A 4ERDA 1J2VA 4NLDA 2EKYA 3RW6A 2HNDB 2AGPA 4CWBA 2MQNA 2W1BA 1VQ4S 3NS5A 2MZQA 3GFHA 4HHUA 3GR0A 2RRBA 3W5XA 2UP1A 1PBAA 4OZJA 3UN2A 4LBPA 3NBPA 1SV5A 1JLCA 4ILMA 3IS9A 2O01C 1P6TA 5L8RC 2GVDA 2RDJA 2ATLA 3P6YC 2P8IA 4ICLA 2U2FA 1QAIA 5D77A 3AOBA 3UD3P 2YX1A 3HSGA 2X3GA 4ZVGA 1YK9A 2D9OA 4OYIA 3PW4A 3BQ2A 1LFWA 2C2EA 2RILA 2ZZTA 4B3RF 2MDAA 3KLFA 1LK5A 4I69A 4WXWA 2HW3A 1PC4A 2W2OP 5D15A 2CNLB 1MWYA 2HG4A 1HA1A 3MEDA 1KC8T 4K4ZA 1N34J 3G96A 1Q79A 4IRDA 1T03B 1FWKA 3U1NA 3MM5B 4B3SJ 2B8PA 4G1IA 2ZJQQ 1JWWA 2NXJA 2E9TA 1C4AA 3P45B 3F41A 3G82A 4KGKA 2W9BB 1X9MA 5CQGA 3A8IA 5KFCA 3TP2A 5E0OA 4OX8A 2DXEA 3VQSA 5HN0A 4KFBB 4O3PA 3PHTA 1F9HA 1RJJA 1Y11A 1OY9A 1FJCA 3ISNC 3Q2TC 1B0VA 1ZZFA 3ITHA 3IRXB 4NXMF 2W2QP 2VPXB 1RWMB 3K57A 2VDIA 4OZ1A 4JI8J 2R7WA 3FNNA 4E2FB 3HZEA 1XNQJ 1K47A 4DX8H 1PCAA 4CLPA 2W01A 4DV4J 2OSQA 3MHYA 3LOUA 5AJ3F 5GADI 3AXMA 4G1PA 1OSDA 5LMNF 3HVTA 2YNFB 5DM7Q 4U7UK 1ZA1B 4NLTA 1RWKB 1EQ0A 4RNFA 4NEYA 2FY8A 3G86A 3ENVA 4KC5A 2FZGB 1YI2S 5AT1B 5KFVA 2EFGA 1HNVB 4LVNP 2X51A 3UE2A 3MCSA 2LECA 3DLGA 2YY3A 4CLSA 1KONA 1WC0A 4ZVHA 3SFUA 4MJKA 1F5BA 2ZNYA 3PRBA 1RT1B 2WB4A 3FC9A 3PNIA 3MCOA 2HNZA 1FESA 2G0JA 2HSEB 4I2QB 3R5JB 4HT7A 1OO0B 2H54B 1S6PA 3LW5C 4W4MA 3O1LA 4KGZB 1UEKA 5HLFB 2V8VA 4PYDA 3Q24A 2FJDB 3A4TA 3OJSA 3Q22A 3CJRA 2KYZA 4LFAJ 1RTJB 3CWJA 5CHCB 3CJSA 2KZZA 3M05A 2AHOB 1V5IB 4DV3J 2VPYB 3AHPA 2O1PA 4I2PB 3H5XA 2M2BA 3P4UB 4LF9F 1FJEB 4U95A 2V8GA 4NLVA 2XG8A 3BGRA 3E2EA 2K8GA 1HW8A 4EYHB 4RW9A 4LFCF 4NMLA 1NH7A 4C8OA 3DOKA 3AT1B 3D3CJ 4QQBA 3LPEA 1XQIA 1SJ4P 4LIRA 3B54A 1F6TA 4EMDA 4ECSA 3D68A 5KFXA 4M5NA 1FRIA 1WF2A 3THTA 3KHHA 2UUBF 1LOUA 2VASA 2XB2D 2VPZB 4IFYA 3GV8B 3MR7A 4ZVSB 3DOMA 2P9GA 1KQKA 4NX9A 1U09A 5DQHA 2H65B 2G0IA 1UETA 4A8MP 2JEFA 2A1BA 3EJMA 3T6JA 3KLEA 1MU2B 5KFKA 1XJWB 2CWXA 4F4WA 1HPZB 3GP9A 3HD1A 2RNEA 1Q95G 2AMCB 1WG5A 2JLEA 3KG0A 4C8MA 2J76E 4B9TA 3JSBA 1XR7A 4NLRA 1MWQA 1RA6A 1Y00A 4RO0A 1NPKA 1YJRA 5KG1A 1HWJA 3LPYA 1JKHB 1BQMA 1H98A 2VBWA 2MQLA 1R43A 2HIQA 4QIFA 2YVSA 8AT1B 1F3VA 3KHLA 2E9ZA 1FJGF 1S4FA 4RJVA 4CLUA 1S1WA 3QQCD 2GVZB 1FWPA 2B9XA 3M30B 3PDNA 1VRTA 1ZAXA 4FYXB 5LSLA 2BOAA 1JLFA 2K3KA 2ZH2A 5ETQA 2H3EB 2DNKA 4WP9A 3IGNA 3TAMB 3PR4A 2XBPA 2J0XA 3U1MA 4NCBA 3IN5A 2W2PP 1O8BA 3UQSA 1GXLA 2ZH7A 2QL9B 2IRYA 3C14A 4FN5A 4WIIA 4RW8A 3VCDA 4HI1A 4DU7A 1EZZB 5LSOA 5CH7B 4J9OA 3CD5A 3G6VA 2KFZA 3QGPA 1YLXA 1T94A 3CB4A 3PJ9A 4MKBA 5HBMA 3J7ZT 2FHJD 1KLMB 2VFUA 4F4YA 2DNMA 4QR2A 2KHDA 3TA2A 3MR6A 2HZAA 1NK0A 3FUYA 1RLDA 1RU1A 4RUCA 2RE1A 2HNDA 4RW6B 1HARA 3NCRA 4IYQA 3GYGA 3OL8A 4B3OB 2VOPA 2VU5A 4RWXA 2NSCA 3H2LA 5LJ5Y 3M2RB 3M6WA 4MMOA 4LBIA 2VB6A 4XPEA 2YQ1A 5GADU 3KHRA 1URNA 1FXRA 3FMBA 2BRKA 2DCLA 4M5HA 1ZPVA 3C16B 4RR5A 2KRBA 2X1GA 4LF7F 1EP4A 1K0TA 2R8JA 4JI5J 4B9VA 1PAEX 2LVWA 4XK8C 4DWIA 1ZTWA 1EX8A 2HGMA 1U8SA 4DCOB 3S8SA 2VJVA 5KT2A 5L46A 1GFWB 4OI2A 1S48A 4HACB 2R7SA 2W4PA 2DXDA 3UDEA 2DPJA 1TTHB 4CIOA 2FUG9 4UOGA 5CZVA 1IBLJ 3PRVA 1FNOA 1HBUB 1FEEA 3CCVS 4KGXB 3D0GE 2BJEA 3HCXA 2MY8A 1IQTA 2V0NA 1TQLA 2Z2ZA 1RT2B 4ZJQA 5K20B 3O44A 4DXLA 4MFBA 4KE5A 3E3XA 4LR9A 4KFBA 4OX6A 5A0YB 1P9QC 4CM2A 1YJ7A 2J5AA 5FD1A 1UMJA 1U7LA 1VIXA 4QCLA 2F40A 3IRXA 5FLXY 4OJ3A 3BZQA 3Q0AA 2NXNA 2VL1A 4HTJA 1W7WA 2QMUB 2NPFA 2KM8B 4U7CA 3BR8A 5CD4H 2WBMA 3ZFVA 3O8WA 4LUBA 2XMKA 3VQTA 2W24A 2Y3YA 1IBKF 2QYCA 3KJNB 4KV8A 2Y1RI 5I3QA 5HVGA 3HMJG 3KK2B 1MMNA 5KFTA 2NYIA 1FXLA 5KFWA 1BC6A 2HZCA 3HD2A 5DRKA 1C4CA 1VI7A 3HLUA 2QSWA 3OL7A 4YB1P 4B9LA 1K1SA 2KFYA 2K3IA 1KDNA 4G1QB 4C8ZA 3KJQB 3EXYA 2ASLA 1HNVA 2RUGA 2DH9A 1FFSB 1TELA 3BDEA 1J5EF 2QLXA 4X4TA 3BREA 3W9IA 4MKVA 4Z7CA 4R5PB 2M5YA 1RDRA 2ZD1B 1YIJS 1L3TA 3GSIA 5L9NA 2DVIA 2YH1A 1QSYA 4I2QA 1W2IA 2LQJA 2CQPA 1JLEB 2H5EA 4C0OC 4RNHA 1TK8A 3PYDA 4K4TA 1HNIB 1PSDA 1FDBA 4LR8A 1R6YA 1Y3KA 2CQDA 3KLHA 4X4QA 1O6XA 9RUBA 3BKFA 2CVIA 2B43A 1RTJA 2VFRA 2MMYA 2IJNA 3NEKA 4DR1F 4F8RA 3I31A 2R2SA 2BKNA 1P27B 4DX7A 4DR4F 3CMES 2ZHAA 2VBXA 4KGVB 4FKYA 2RDIA 4DV1J 2Z56B 4M5MA 4H4KC 3HFKA 3PIOQ 3FSYA 1U0HB 2Y8YA 3K2YA 4DV0J 2Z58B 1V3SA 2GA7A 1LWEA 2C3PA 2X7IA 4QU6A 3CD6S 3TAPA 4X4UA 4FP9A 2E1AA 2DHHA 3ZTSA 1IR1A 3OJUA 5LMUF 4IO1A 3I5AA 5KFGA 3R3TA 5KTQA 5AE3A 3W63A 1L3UA 1HFEL 4ZLPA 4I6WA 1Q86T 4JI3F 4M5DB 2R8KA 3BF4A 1TL4A 3I0SB 1X4BA 1H2TZ 2J8AA 1VQ5S 3IAS9 3BGLA 2CPEA 3RJMB 1HPZA 3CCLS 5F9NA 2J6UA 2QFJA 3TYTA 4GKJJ 2MJNA 1C1CA 1X4AA 2IC3A 1RWUA 2QGFB 4R8UB 5LXYA 1RTHB 1Z2ZA 2AJ2A 2IFXA 2ZJRQ 2C42A 4QIWD 1VQSA 1H38A 4Z7YA 1H73A 3Q8YA 2VG5A 2MQOA 3MM7B 4ED1A 1FRXA 3V6KA 3PEHA 1U8WA 2QO3A 4USIA 4JV5F 5D0HA 1JJ4A 4OJGA 3CJ0A 1DTQB 4YB5A 2DHGA 1CS4B 1Q16B 2HK3A 5DG9A 3O6QA 1X0FA 4C3MA 4YB7A 4X4SA 1NHUA 4NXNJ 2X1BA 1N52B 3SI8A 4J9QA 2V2VA 3QAUA 4IFVB 4A47A 1RAJA 3UR3C 3VALA 1RAFB 2UUAF 1OMSA 1OQ6A 4ECUA 2P5VA 2XMJA 5BR8J 1U1NA 4MK9A 1HI0P 2PFFB 2Q3PA 3TEHB 1IKYB 3L7PA 3OFGA 3VGUA 1S6OA 3IA0A 5ETKA 2OPQB 4CCHA 4OYAA 2HQCA 1OIAA 2QA4G 2AYGA 1NSKL 4ECZA 1BWVA 4JV1A 1R8CA 3KDOA 3V4MA 2YBVA 2ZH9A 2F4FA 2H4WB 2OEMA 4IR1A 4M95A 4FNHA 1KLMA 3MUMP 2FZCB 3U02A 3H0PA 4RW6A 2V50A 4DUZF 1JLGA 4P2MA 4B3OA 1J5OB 3M2RA 3I9V9 2U1AA 3HI9A 4K4SA 5IC6B 3CC2S 5EWGA 1L5UA 4B3TJ 3VGTA 2GZOA 2OHDA 2HQDA 4FXVA 4LF8J 4DQQA 5FJ4A 2OPSB 3CDAA 4YY3F 4DL4A 2GX8A 3HSZA 2RRNA 4P2FA 2QL5B 2VQFJ 4BWMA 1RT7A 4ZN3A 3U7JA 4LFBF 2XI2A 4HR2A 4CQ1A 3QGGA 4J37A 4HACA 2AJ1A 3NOCA 4DR3J 5GAHU 4JI1J 1E6VA 2YKMB 3FQKA 2QT7A 2BR0A 2FD2A 2G0CA 3G6YA 3AOCA 3DLEB 4FXWA 1VS3A 1HBUA 1M5OC 3L09A 3L9ZA 3MFIA 4NLQA 5K8MA 1HR0F 2UV8G 2GHPA 3NMRA 1LK7A 3M8WA 5DLGA 3O3LA 1WORA 1W26A 3BQ0A 3US5A 4H4MA 4TNOA 3CJ3A 4MAKA 1YBAA 2ZHOA 5CA5A 2X1AA 2LKZA 3NWRA 5E3AA 1SC1B 2ZBCA 4NWBA 2DNLA 2HS0A 5EX0A 3N5FA 4OHVA 4N8NA 5ETOA 1TKZB 1T9UA 3N6LA 2RHSB 3MUVP 2RDDA 1EKRA 4QYRA 3SQOP 2HAIA 1IM6A 3DC2A 1FDDA 1X8DA 3GE9A 5CYQB 2CJ9A 1JX4A 1XR5A 2ERRA 2R2TA 4DI6A 3PX0A 2XTJP 1VK8A 3A8JA 5C25B 2W7PA 1KD1T 1ELOA 4ZCMA 4WTOB 3GCXP 5MAOA 4G1QA 3UR0A 2J6SA 4DPTA 4C8LA 3MEGB 5JVHQ 1Z1ZA 4E8UA 4A8SA 1N5TA 4QZVB 4WK3A 2BDPA 3TJ9A 1UA1A 4R5PA 2JDJA 4B3RJ 2HRYA 2ZD1A 4DV2F 2JC0A 2R8IA 4G65A 1FRJA 2ASDA 2N7CA 1D09B 4HTIA 2B56A 2GHWA 1JLEA 4JOUA 1C1BB 2Y0SD 4O44A 4Y2IA 2DRAA 1HNIA 1AA1B 4CP5A 3GLJA 2AZ1A 1Q8LA 3JSRA 4MH8A 1WOSA 3OR2B 1WACA 5DJBA 3C2PA 3QFHA 3D3BJ 4F3MA 1R8PA 1SKUB 3OTCA 3DM2B 1MROB 3JAMU 5U47A 3T19A 2MQQA 2J0QD 3CJQA 4CT9A 2FIUA 2E1CA 4DQSA 3P8BB 2EI5A 2PDAA 5DQIA 4KBIA 4MKYA 4OI4A 4JI2J 1A9NB 1U0HA 3BDPA 1MW7A 3ISND 3KG1A 3RAMA 2WVCA 5KFBA 3O2IA 3VAIA 4GKKF 3UDLA 3BBBA 2BRLA 3MPWA 2F8EX 2HWIA 1F0XA 3QT8A 1S12A 4ZP9A 4OX7A 4XIUA 1WHWA 1PJ5A 2BE9B 4KKOB 2BMBA 2VKRA 1VQLS 3OT9A 5I3UB 1CPZA 3NNCA 4M5DA 2HVZA 1RSCA 2OP5A 1I5OB 2ABYA 3BGFA 3IR6B 4N7TA 4Q0BA 4C97A 3RBXA 2KVQE 4Y3CA 4JYAJ 3PYFA 1Q8BA 1S1VA 2HRTA 4URSA 3CTRA 2HVIA 1XMBA 4UOFA 1RWWB 2OTLS 3E8OA 1WEZA 3W66A 3N28A 4DR2J 1RTHA 2C3MA 3IBWA 2PE8A 5ADZA 2GO9A 3EDQB 2JZ5A 1T9XA 3MM7A 4HL9A 1HBMB 2DO4A 4G3IA 4Y2AA 4RPFA 1RKIA 4LF4J 4WP3A 2BJ8A 2QX0A 1M1GA 2AJQA 1CS4A 1MN7A 5T7LA 2KTQA 4IKAA 1P9YA 3M8SA 4C2MA 1T9WA 2EC0A 1RQ0A 5KFJA 1D8YA 4PXCA 4JBCA 1TL1A 4CH1A 2R9LA 3NGTA 4F67A 2HHPA 2K1RB 2Z2MA 1M0SA 2GHVC 3A13A 2ZOGA 5DDOC 2OI2A 2ROGA 3W7BA 2IIHA 5F8NA 2A0FB 1BQNB 2PD1A 2LCWA 1SQFA 1T3OA 1L3SA 4KIAA 2EWHA 3F56A 2DNGA 1B4SA 1K1QA 3SSSA 4L3NA 1N32F 3GV7B 4PQUB 4EYIB 4KHPF 3M8QB 1S79A 5FDLB 2IM3A 3CCZA 3OD2A 4NLYA 3QJLA 1RHRB 3J7Z5 2DIVA 1U1LA 2C28A 2B9EA 3IO1A 1FWLA 1TU0B 2G1HA 5JUMA 4W90B 2MLZA 1HWUA 3HVAA 2AD9A 3C46A 4DR5F 4R25A 3K5OA 3JTOA 3QJJA 4I6AA 2WSFC 1J5OA 5D0RA 3VAGA 4GO7X 4B02A 5E3QA 3BGUA 5JVGQ 2HHWA 1D9FA 1VC5A 4H4OB 4RBVA 2VD3A 3QSIA 3NGKA 4N41A 2UXBJ 1M90T 2ZE2A 4KHMA 3ILJA 2Q43A 2VZ9A 2EPIA 4KHRA 3GFXA 4OV6A 3OL9A 2OPSA 1RWNB 3KLIB 5BXIA 4ZPWR 1VQMS 3W2VB 1S57A 5C2CA 4PWDB 3RB0A 2AP6A 1U1MA 1PYOB 2D69A 3I6PA 3OW2R 2H5IB 2C2KB 5KFZA 2CZ9A 1I94F 2DGSA 3OTOJ 3TANA 1M1KT 3GJSB 3DLEA 2BJDA 3MI7X 3FZ2A 2ZVSA 1WKLA 2UXCF 4DZDA 3HSJA 5KG5A 1DAXA 5K9FA 1YZ7A 3VGSA 1KEKA 1UVIA 3PACA 3RRGA 2BJ3A 1QVGR 4C4WA 3M6UA 3ZZOA 4FS1A 1KQGB 4UTGA 4EI2A 4CLFA 3EM1A 3PW2A 3Q89A 1JLAB 3BS9A 1AW0A 5LXRA 1WC1A 4NI2B 1RKJA 4TVAB 4TYAA 4I64A 1TKZA 3VVUA 4WKYA 1SQGA 3QIPA 1HBNA 1AXQA 1NHKL 2JNJA 4YUDA 1UEVA 2GQ2A 5HMZA 2GJ2A 3DLBA 1I1GA 4FPRA 1SH0A 1DZ5A 3C8YA 4FYVB 4ED3A 1ACMB 5IV4A 1IWAA 4FNIA 3PY8A 3M8RA 2XI3A 5KT4A 2R8HA 3QRPA 2CFXA 2FGOA 1CQMA 4X65J 4ZLLA 1X4EA 3MEGA 3CW2C 1REVA 5L38A 3W5YA 2M70A 4ZPBA 2DY1A 3IRWP 3CNQP 1WG1A 3EGNA 4ZVOB 1UFLA 1T9TA 4NOHA 5GAEI 2AEFA 4LRDA 1G4CA 1S1XB 1N34F 4A8FA 2XLKA 4LSLB 4K2XA 3ADAC 3LALA 1WC5A 2P6SA 3UI3A 4B3SF 3I55S 1X0PA 3QJPA 1FK9B 1V3ZA 4F50A 4NYZA 5T41A 4L6V3 1ZM9A 4OHXA 3DGVA 3OR2A 1QTMA 2HBZB 3FFIA 2JSXA 4DX6A 3DM2A 1MROA 5H9EK 2F63A 4KO0B 4K7QA 3MM9B 3U27A 3IBCB 4JI8F 1U25A 4DSIA 3R1HA 4LJMA 2DR8A 2FLPA 4C11A 1MLAA 3ET6B 3C6TB 3PW5A 1XNQF 1B64A 1RTDA 1FRLA 3KFWX 3ZZYA 3TARA 3E01B 1R6VA 3HHDA 3BGOP 3BO2A 4DV4F 3QZ7A 1GMUA 2V34A 2ZC3A 2KHCA 3Q23A 3BSAA 3QO9A 4ED0A 2J7KA 1S6UA 1RBOB 4M5JA 3MWBA 1WG4A 5LL6d 2FVQA 1HNXJ 1CVJA 4NYOA 3Q86A 3AY0A 2AGQA 2G2ZA 1AB8A 2DITA 3B6BA 2W4DA 1FKPB 1RWXB 1N5QA 2XLIA 2W7AA 2F1FA 2VA2A 3IXQA 2VC1A 3WC2A 2OEJA 4B9SA 2FJBB 3WHIA 1GMWA 3BR9A 5J1PA 1S0NA 3NXZA 1RAIB 2CPDA 2AGOA 4PEOA 4L3KA 3RBDA 2V4JA 3EGVA 2AU0A 1TKTA 2Z57B 2ZEJA 4JI7J 1HBMA 4LFAF 4NPOA 3HT3A 1RAOA 1U6FA 2Z4PA 3R5CA 3GSDA 4DV3F 5J2NB 3DGPA 2XHWA 1RAGB 3HM9A 5E33A 2MZJA 3PX6A 3CIZA 2W25A 5H9EJ 3M32B 4O3OA 1YJUA 1GXTA 4EEYA 3BO4A
chains in the Genus database with same CATH topology
1HKAA 3HD1A 5ETLA 3UDVA 5ETTA 3HSJA 3KUHA 5ETKA 4CYUA 3MCMA 1F9HA 1RTZA 4PZVA 2BMBA 5ETOA 4CWBA 1RU1A 2QX0A 3UDEA 3HSGA 4M5JA 3UD5A 1Q0NA 2F63A 3HSDA 1RAOA 1EX8A 2CG8A 3HD2A 3ILJA 1EQ0A 3ILLA 1RB0A 4M5MA 5ETRA 4CRJA 4M5NA 2F65A 3HT0A 1DY3A 3ILOA 3HCXA 1HQ2A 1RU2A 5ETSA 5ETNA 4M5GA 3HSZA 1TMJA 1G4CA 5ETPA 5ETMA 5ETQA 3MCNA 4M5IA 4F7VA 4M5HA 1IM6A 3MCOA 3KUEA 4M5LA 5ETVA 1CBKA 1KBRA 1EQMA 1TMMA 3QBCA 4CYUB 4AD6A 3KUGA 3ILIA 3IP0A 4M5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HKA A;  3HD1 A;  5ETL A;  3UDV A;  5ETT A;  3HSJ A;  3KUH A;  5ETK A;  4CYU A;  3MCM A;  1F9H A;  1RTZ A;  4PZV A;  2BMB A;  5ETO A;  4CWB A;  1RU1 A;  2QX0 A;  3UDE A;  3HSG A;  4M5J A;  3UD5 A;  1Q0N A;  2F63 A;  3HSD A;  1RAO A;  1EX8 A;  2CG8 A;  3HD2 A;  3ILJ A;  1EQ0 A;  3ILL A;  1RB0 A;  4M5M A;  5ETR A;  4CRJ A;  4M5N A;  2F65 A;  3HT0 A;  1DY3 A;  3ILO A;  3HCX A;  1HQ2 A;  1RU2 A;  5ETS A;  5ETN A;  4M5G A;  3HSZ A;  1TMJ A;  1G4C A;  5ETP A;  5ETM A;  5ETQ A;  3MCN A;  4M5I A;  4F7V A;  4M5H A;  1IM6 A;  3MCO A;  3KUE A;  4M5L A;  5ETV A;  1CBK A;  1KBR A;  1EQM A;  1TMM A;  3QBC A;  4CYU B;  4AD6 A;  3KUG A;  3ILI A;  3IP0 A;  4M5K A; 
#chains in the Genus database with same CATH topology
 2NLW A;  3TOQ A;  1QAX A;  2DIS A;  2V4Q A;  2YWE A;  4AUK A;  3OHA A;  3CCU S;  3MM6 B;  2P9C A;  4PQU A;  5AE1 A;  5HQ8 A;  2HHH F;  4OZ0 A;  1RT5 B;  3M8Q A;  4FBU A;  1HWL A;  5KT5 A;  2V94 A;  1G3O A;  3MAH A;  5HRO B;  2F4V J;  4RNM A;  3QNW B;  3MTJ A;  2XSF A;  1YBU A;  5HAO A;  1HWI A;  5HSP A;  2LEA A;  1OWX A;  2YKQ A;  1HQU A;  3R9L A;  3HSD A;  1UW9 A;  3LP1 A;  5EDW A;  5K8N A;  3GR1 A;  4LRE A;  1JLQ B;  2XC9 A;  1N56 A;  3B82 A;  2W2N P;  4ECY A;  3A8E A;  2JVR A;  1NDL A;  3AJ2 A;  4I7F A;  2ZH4 A;  1CJV B;  2G2Y A;  2RQ4 A;  3VAF A;  4N5S A;  4WYW A;  3KLI A;  1ITP A;  1MML A;  4P7V A;  3GV5 B;  1F9F A;  2COL A;  2B7C B;  5A8R A;  4PWD A;  4RBU A;  1Q4R A;  5J2P B;  1G6B A;  4ZVT B;  4WE1 A;  2IY5 B;  1YJN S;  2V4R A;  3I9Z A;  4ILL A;  2FQQ B;  1ZYQ A;  1RT4 B;  3DRX A;  2VJU A;  4NCA A;  2UUA J;  2MY7 A;  2OPP B;  3R2C J;  1VQP S;  5SUH A;  1XMO J;  1RHQ B;  2R7R A;  4OI6 A;  3C66 A;  4MK8 A;  4IH7 A;  4OYP A;  2J7U A;  3GJR B;  3QWP A;  5BYS A;  2CQ4 A;  2OD4 A;  1PKU A;  4TY9 A;  3V4I B;  2CYY A;  2J0S D;  2CKW A;  2JVO A;  1N4L A;  1BUX A;  2BXJ A;  1CQN A;  4UZC A;  5HP1 B;  2MGZ B;  4X4O A;  2M8D B;  4PPZ A;  2DGT A;  4LSZ B;  3FBE A;  3BYP A;  3UO0 A;  4K4U A;  3BYR A;  1RE1 B;  2B6A A;  4ZDN A;  4CTA A;  1IQZ A;  1JLA A;  3LP0 A;  2DR5 A;  2WVB A;  3FGV A;  4KR0 B;  1H7X A;  2WSC C;  5HMW A;  3DXS X;  1TMJ A;  4Y34 A;  2YXL A;  4DV7 J;  3IWX A;  4OZL A;  1KKH A;  4OQJ A;  1T05 A;  4L76 A;  4EWT A;  1NKC A;  3M8Y A;  2B7B B;  3M6X A;  2XMM A;  3BKU A;  1TL7 B;  4DPX A;  2HQI A;  3W65 A;  3PYE A;  4OYO A;  3T1Y J;  4V1A k;  1RZM A;  4JI5 F;  2UVW A;  1T9V A;  4OI0 A;  1OPZ A;  1WEX A;  3ONQ A;  4YY3 J;  2H4Y B;  4DL5 A;  2V6A A;  2A10 A;  1NRK A;  1VJQ A;  2NS1 B;  1WI6 A;  4FF3 A;  1TV6 B;  3ETM A;  1UEU A;  3CSK A;  1PO6 A;  4A8Q A;  1CJT A;  2XHC A;  3NMA A;  3AQO A;  1WUU A;  1S1X A;  1JXV A;  1IBL F;  3TUJ C;  4LSL A;  1HLW A;  3H42 A;  2XMU A;  4O3R A;  1T11 A;  3EZO A;  1RUS A;  1Z4U A;  1T3N A;  1U02 A;  1APS A;  2NCK L;  4XO0 A;  4QOT A;  3DMJ B;  1FVQ A;  3ZTO A;  4NLS A;  2FLO A;  1U6Z A;  4B17 A;  4PYA A;  1PAU B;  3DRS B;  3K17 A;  4U96 A;  2ASJ A;  4RKU C;  3OTE A;  2YKN B;  1S9F A;  4DFM A;  2H51 B;  4WP8 A;  5F9L A;  4TLR A;  3MM9 A;  3GG0 A;  4PG5 A;  4DSF A;  2FHK A;  2L41 A;  1NJX A;  2R7U A;  3UD5 A;  3ET6 A;  3C6T A;  5A8K B;  2E7W A;  3KWM A;  2ALZ A;  4IRK A;  3HJV A;  2A2C A;  2LA6 A;  1M5S A;  5KT3 A;  4AD6 A;  3GIJ A;  5DQG A;  3ZZT A;  1NH8 A;  2XQC A;  2MKK A;  2AJ0 A;  2PSZ A;  2BOP A;  4EUV A;  3HVW A;  5ETN A;  1LV5 A;  3V5R A;  3DLK B;  4LF6 J;  3THV A;  1L3V A;  4B9N A;  3N4W A;  3T9N A;  1RWP B;  3AD9 C;  3W64 A;  4ZK7 M;  3KJV B;  4LR7 A;  2HBR B;  4YQW A;  1YX2 A;  2R7O A;  2WBR A;  2KI2 A;  2IVY A;  2QMX A;  1WKJ A;  4YOE A;  4DV2 J;  2I8E A;  2XCA A;  1SCJ B;  5C5J A;  1VYA A;  1W25 A;  1HL6 A;  3M7V A;  3ENQ A;  3S01 A;  3CDW A;  3N6N A;  2RS8 A;  2R7Q A;  1DQA A;  4C0H A;  4DS5 A;  3JYT B;  2MSS A;  1SC6 A;  3LWL A;  4M5K A;  2BE7 D;  3GCW P;  2XO7 A;  3DI6 B;  3W8G A;  1UCN A;  2CG8 A;  3ILL A;  4A8O A;  2GCF A;  4IOA Q;  2XYG B;  2NUU G;  4WWS A;  2PI5 A;  3DRP B;  2JEI A;  5KOX A;  5J2N A;  3N9U C;  3DDI A;  2Q6C A;  2YNH A;  3W62 A;  4CLW A;  4PCQ A;  5A6W A;  3TJA A;  3CPW R;  4DV1 F;  1WHX A;  5HQL A;  2ZWP A;  1RBL A;  3M32 A;  3W9J A;  1PIL A;  2IJF A;  4M5L A;  1N36 J;  3SSR A;  1WDT A;  3CDU A;  4DV0 F;  4YFU A;  2DGU A;  3AXK A;  3HDS A;  3SYZ A;  3SZ2 A;  1OY6 A;  3MUR P;  3R27 A;  3CVK A;  3FEZ A;  2MTL A;  4UOH A;  1UWA A;  1DLO A;  1GT8 A;  2CAD A;  4ED2 A;  2OMO A;  4R0E A;  5ETT A;  4DPU A;  3RRK A;  3PTW A;  4DDF A;  2VUG A;  3QT7 A;  2Q66 A;  1RT5 A;  3VV2 B;  1QUP A;  2I9S A;  4DV6 J;  4NL5 A;  2LLZ A;  2DT9 A;  1RP5 A;  4NA1 A;  4OYW A;  4WIQ A;  2CUY A;  5LM7 E;  2NPI A;  3KLG A;  2CRL A;  2EK1 A;  4ANC A;  2HFV A;  2CPH A;  3PYG A;  3SCI E;  1S0O A;  4GKJ F;  2V2Q A;  3I4H X;  5H9F K;  4PUO B;  3SXL A;  1D0E A;  1RHM B;  3KMQ A;  5B0C A;  3D6M B;  5KT7 A;  3W2W B;  2J9E A;  4RUA A;  1VFJ A;  4QPT A;  3UWT A;  2ZH6 A;  2QA1 A;  2F3J A;  1D9A A;  5GVQ A;  4RZR A;  2KYX A;  4L73 A;  1P1L A;  3LO3 A;  2HEK A;  4IQM A;  3IM8 A;  3AOA A;  4F3Q A;  1GQE A;  1CJV A;  4ED5 A;  3BPS P;  3I82 A;  2AZ3 A;  3TQE A;  3P5B P;  2CAJ A;  1WHY A;  2ILZ A;  1HWK A;  3SDE B;  4R0J A;  3GIM A;  1Q8K A;  2DNQ A;  4YN3 B;  2VG7 A;  3J7Y I;  2V63 A;  5J2P A;  4ZVE A;  4NXN F;  1LW0 A;  4DR7 J;  4C6A A;  3CUL A;  4Y6I A;  3G6X A;  2IHR 1;  2GMJ A;  2P2C B;  3CDE A;  2OPP A;  2XMT A;  3IG1 B;  1WC4 A;  2EEY A;  1UTA A;  1M5P C;  2C3Y A;  5F3T A;  5BR8 F;  1YZ6 A;  5DDQ C;  2UUC J;  2CWK A;  3D1H A;  4DSK A;  2DRD A;  3D5M A;  3V4I A;  5IWA J;  3N79 A;  1C0U B;  1TUW A;  2DR9 A;  2B51 A;  1HYS B;  3D54 A;  5HP1 A;  5D8H B;  2MGZ A;  1H7W A;  1V3R A;  3GZ7 A;  2DXF A;  4ZPD A;  3PW0 A;  4U67 Q;  9ATC B;  3CUN A;  2UVU A;  3FRY A;  4NLX A;  3M8Z A;  5E2Q A;  2J9D E;  2FJE B;  4QW8 A;  2YNG B;  3TI0 A;  3KK1 B;  4DR5 J;  1AUD A;  1TKD A;  1RAD B;  4GVL A;  1S7I A;  2DGX A;  1MSW D;  4OLP A;  1TR0 A;  2C2Z B;  2VFT A;  3A3N B;  4NZ7 A;  1PC5 A;  1VMB A;  5ETV A;  2BJ9 A;  3CCQ S;  1TFY A;  1TL7 A;  4B3T F;  3J7A N;  1JXL A;  1JLB B;  4C8Y A;  2LEB A;  3G9C A;  4OHY A;  3MUT P;  3JB9 k;  4USU A;  4LF8 F;  4DQP A;  4OMF G;  3KG4 A;  1PJ6 A;  3GJT B;  2VBZ A;  2UXD J;  1AZS A;  2VQF F;  2F7V A;  2DNH A;  2M7S A;  5KFU A;  3CCW A;  3MD1 A;  1TV6 A;  3HHE A;  3K5P A;  4Y2M A;  4DR3 F;  1EET B;  4JI1 F;  3U1L A;  4AYB D;  1KVJ A;  4RW7 A;  5EN1 A;  1YRX A;  1F1B B;  3CCE S;  2HNY A;  1UVN A;  2GFF A;  2GQC A;  4F26 A;  1SJ1 A;  8ATC B;  1LWF B;  2OGU A;  5F8M A;  1T95 A;  1VOM A;  2XGP A;  1IM4 A;  1QD1 A;  2MKH A;  1K9M T;  4WZQ A;  2QG9 B;  2VHG A;  4ELT A;  1NK4 A;  3IAM 9;  1GXU A;  1CC7 A;  5B0G A;  2ATC B;  4USH A;  1I6J A;  3DRS A;  1X4C A;  1RT6 B;  5IXU A;  3UCG A;  2KRR A;  2FVS A;  1CLF A;  3J81 U;  3WX8 A;  3SCJ E;  4X4N A;  3OFE A;  1NME B;  4NCG B;  3A12 A;  3JSM B;  3CD0 A;  2CQI A;  2D3Z A;  3B8H A;  3JS9 A;  3K58 A;  3CC4 S;  5CCM A;  3C15 B;  1OY8 A;  1H3D A;  2LA4 A;  1XEZ A;  3G8Q A;  2GO8 A;  2KJV A;  1IKW A;  1ZZN A;  4PG6 A;  2LQ8 A;  3RU0 A;  1P1T A;  1SIZ A;  4JI6 J;  5KFD A;  2QSF A;  4USM A;  2UVR A;  3CJK B;  3QMQ A;  2PEB A;  3NS7 B;  5IS2 A;  3KJV A;  3K0J A;  3G2X A;  5THW A;  2E9R X;  3D0H E;  4ED7 A;  1TAU A;  2FY1 A;  2VG6 A;  1Q5V A;  3T1H J;  3GFY A;  1IKX A;  2A18 A;  2ZH5 A;  4DQR A;  2AYB A;  4X4P A;  4UQG A;  2YPY A;  3TRG A;  3IP0 A;  5IT0 A;  3EYZ A;  2KB2 A;  3ZTQ A;  3KOA A;  2W9C B;  1WD6 A;  1WJ9 A;  3DRR A;  2L9D A;  3TA0 A;  1PYS B;  2Q6B A;  2V8P A;  3KNA A;  4A8Y A;  2N4D A;  4GVB B;  2FLN A;  2OPR A;  1EAY C;  1MNE A;  3DRP A;  3P96 A;  4P6Q A;  2Q79 A;  5LSR A;  4F2S A;  4CLT A;  4DN0 A;  2CPI A;  4A8W A;  3J7Y U;  2JOQ A;  1ZAW A;  1BHN A;  2M88 A;  4O4R A;  3GYN A;  1Q7Y T;  4K2J A;  3D9B A;  3TUP A;  1TMM A;  1X4G A;  1RT3 B;  3X3U A;  2M9K A;  4JI2 F;  4TQS A;  2YH0 A;  4I6Y A;  2RQC A;  1NDK A;  3QLH B;  3PRD A;  2EK6 A;  1HQ2 A;  2VDH A;  3VHQ A;  3KKF A;  1JJC B;  1S6Q B;  2HWH A;  5EWF A;  2WCX A;  2Z2L A;  5D4P A;  3BQ1 A;  3VGV A;  4A48 A;  4LRC A;  1WI8 A;  2WAQ D;  4OI1 A;  3WC0 A;  1NKB A;  2IBK A;  3UFC X;  4P2X A;  3HHL B;  2DEI A;  4ECV A;  3ZZU A;  3PCO B;  5C24 B;  1FE4 A;  2CQG A;  2XS2 A;  1TUV A;  2KDO A;  4C9D A;  4JYA F;  2QN6 B;  2ACY A;  4X4V A;  3FZB A;  1N0V C;  1KHW A;  2ZUA A;  3Q83 A;  3N5B A;  2L48 A;  2Y0B B;  3W2W A;  4DR2 F;  5KG2 A;  4J9R A;  2DTJ A;  4P73 A;  4K5R A;  2GQQ A;  3J80 U;  4USJ C;  5BJR A;  3K8W A;  3AB4 B;  2Q1L A;  2MB0 B;  1JMT A;  2WW4 A;  3FCW A;  4LF4 F;  2F8M A;  4KH0 B;  3BN4 A;  4ZHR B;  4AXJ A;  2DPI A;  2LDY A;  1XR6 A;  5ETM A;  2HWT A;  3MCN A;  3SDE A;  1J27 A;  1NND A;  1WOP A;  1UJ4 A;  1FDA A;  2JEG A;  4FF2 A;  2JFK A;  3SEO A;  3PFO A;  1VRU A;  4BDP A;  5HJY A;  3MAA B;  4O3N A;  2QIF A;  1UWB B;  4JI4 J;  5EGY A;  1AFJ A;  4M5I A;  2LXU A;  1UVK A;  3G87 A;  5IT9 U;  3I32 A;  2E66 A;  2KXF A;  5KFY A;  5MLC V;  1RTZ A;  3FEY B;  4ZVF A;  5CZX A;  1L3K A;  2VOD A;  1SC3 B;  2GV1 A;  5E7O B;  3PEJ A;  4QW9 A;  1SJ3 P;  3A3O B;  2HHH J;  1HBO B;  1NU4 A;  2HFZ A;  1SQE A;  1FFW B;  2HS3 A;  3MDF A;  1NSP A;  1S0V A;  1HI8 A;  5HVH A;  4IQX A;  2H9Z A;  1NKE A;  1DRZ A;  3S7R A;  3CMQ A;  2RAQ A;  2VQE J;  1WC6 A;  4YR2 A;  1G7C B;  2X1F A;  3KK1 A;  1NDC A;  5L39 A;  1NB7 A;  3MMJ A;  3BEG B;  1ZH5 A;  2R7X A;  3NAH A;  3K5L A;  2OLW A;  1GEH A;  2DD8 S;  3BBC A;  1G1X A;  2ZBI A;  5EUH A;  5A8W B;  1JLB A;  2M3D A;  2UXB F;  3P49 B;  2OD6 A;  1S0M A;  4ES3 A;  2DNN A;  3PO4 A;  1TL3 B;  4F7V A;  1GH8 A;  2B4U A;  4KQZ A;  3G71 S;  4HLB A;  2RKI B;  2C2R A;  4RL1 A;  4IDK A;  2WOM B;  1LW2 B;  4TY8 B;  2OML A;  3BM7 A;  5B0A A;  4LF2 A;  1Q53 A;  2NXC A;  3LP2 B;  1EET A;  4UOC A;  4I67 A;  2B4V A;  5F8L A;  3FK4 A;  1RAH B;  3UDV A;  3OTO F;  2BJ7 A;  2LP4 A;  4X4R A;  3GIL A;  1MN9 A;  3M9O B;  4K0K J;  2BQ3 A;  5KFF A;  1R8A A;  3FCH A;  2ROP A;  2DNZ A;  3NNH A;  4DL7 A;  3WIV A;  3DU6 A;  3QFW A;  4HDG A;  2HGN A;  3FQL A;  3CCM S;  4Y2C A;  4DMZ A;  1N5Y B;  3GPA A;  4ID8 A;  1HNZ J;  2QLB B;  3OUY B;  3UDC A;  1X5T A;  4NLP A;  5KOW A;  2QEX S;  3UD4 P;  3M2V B;  1X9W A;  2WZ1 A;  3OLB A;  3V6H A;  3PVX A;  4NCG A;  1I3O B;  1RXO B;  4ZVU B;  2IDL A;  1C0T B;  2B0G A;  3JSM A;  1BWE A;  1VQY A;  4ES1 A;  2SXL A;  2PGC A;  5FII A;  4HT5 A;  4ID5 B;  4DCP B;  3BKT A;  3C15 A;  4ZOS A;  1S72 S;  3ELH A;  3JQM A;  3VZH A;  1O0P A;  4JI0 J;  1TVR B;  2BE2 B;  2NYH A;  2EG1 A;  2ZBQ A;  4X65 F;  3DOL B;  2I38 A;  2RU9 A;  1NJI T;  1X60 A;  2XNR A;  2R7T A;  3KUE A;  2CQB A;  1XMQ J;  3NGS A;  3M2U B;  2BUN A;  5KFR A;  1KRP A;  5J2Q B;  2CZ4 A;  1S97 A;  2BW2 A;  3H2V E;  2R2R A;  1HIY A;  4DUY J;  1N6Q B;  5DG8 A;  1TFW A;  4P10 A;  1T03 A;  3K5M A;  3ENA A;  2DNR A;  3MM5 A;  2QLJ B;  2E1R A;  3K7R A;  2W9C A;  5C2G A;  3AD7 C;  3D0I E;  5DDR C;  2W9B A;  4HDH A;  2B9W A;  2ZJP Q;  4ECR A;  3LTO A;  4O0I A;  4WK1 A;  1N33 J;  2EFQ A;  4CO3 A;  1NK6 A;  2GVD B;  2NR0 A;  3I0R B;  3CXC R;  1QY7 A;  1KTV A;  4LQ3 A;  1SJR A;  1Y9O A;  2CVE A;  2RU3 A;  2C2M B;  1S4E A;  1RT3 A;  2CPZ A;  4HYK A;  3CJ5 A;  3H90 A;  4ECQ A;  2A6O A;  4DOZ A;  3RAQ A;  1YJ9 S;  1S6Q A;  2EKN A;  3RZA A;  2LU2 A;  2V8H A;  4ZLJ A;  5I4M A;  3KLF B;  1V6H A;  2YNF A;  1X5P A;  4C8N A;  2GNK A;  4J9P A;  4NA2 A;  1HNX F;  2XYP B;  1CSJ A;  3QT6 A;  4J9N A;  4YP3 A;  2HPU A;  4QJV A;  2AT1 B;  3PG9 A;  2OUG A;  2V2K A;  4C3L A;  3FSI A;  2CJK A;  3HF5 A;  1YGY A;  3G82 B;  3HHL A;  1OJ4 A;  2WTF A;  3QT5 A;  3NNA A;  1PBU A;  5C24 A;  4ELU A;  4QWA A;  1YDL A;  4WFZ A;  2FLL A;  3MR5 A;  4CLK A;  1RT1 A;  5K5M A;  5GAH I;  3NGD A;  4G6V B;  3KUG A;  2BW7 A;  3MEE B;  4UZB A;  4DLG A;  2ASY A;  2LDI A;  3IM9 A;  1O51 A;  4DFJ A;  2DB1 A;  5HLF A;  4BS2 A;  4H54 A;  1LKZ A;  1IKV B;  3OL6 A;  3MXH P;  4JI7 F;  2C1E B;  3H25 A;  2IYG A;  2XZD B;  2M52 A;  5JMN A;  3WDO A;  5KAK A;  3FCV A;  1T0T V;  3ZZP A;  4J9M A;  3A1Y G;  5BYQ A;  1QVF R;  4YDX A;  4K4W A;  3TZY A;  2JEJ A;  3TVY A;  3HVT B;  4I2P A;  3Q8Q B;  4U8Y A;  4P2S A;  2LQB A;  3CO0 P;  1KN6 A;  1VIS A;  3BH6 B;  3T5J A;  2ZC4 A;  2Y1L B;  1UWB A;  3JTP A;  3J81 j;  3MMB B;  1WWH A;  1BMQ B;  1YSJ A;  4HEA 9;  1E6Y B;  2EFV A;  4F3O A;  4OYX A;  1N8R T;  4RNO A;  2DNP A;  2KH9 A;  4V19 X;  3MPV A;  2HNZ B;  2JHE A;  1SB6 A;  3V6J A;  1DFD A;  1HBO A;  3JAM Y;  2XGQ A;  3AD8 C;  2XS5 A;  4UUX A;  2F4V F;  4NA3 A;  4LRF A;  1MU2 A;  1H6K X;  1A0O B;  4ZKA A;  5LJ3 Y;  3CT9 A;  4UT4 A;  3BV8 A;  5T14 A;  2ADC A;  3QYY A;  1YWX A;  2IVF B;  1NDP A;  1VBX A;  3CIM A;  4U8V A;  2IM1 A;  2HYI B;  3RAX A;  4UW2 A;  4PXE A;  1ZBT A;  4PR6 A;  4ZJO A;  3OFH A;  3BGR B;  1JKH A;  1S1T B;  4RW9 B;  3NCQ A;  3I56 S;  1TUG B;  2UUT A;  2FHM A;  5IC4 B;  5J1E B;  4YR0 A;  2RS2 A;  3DOK B;  2FTR A;  2IPO B;  4NLG A;  2B4O A;  3LAN A;  2VC0 A;  5HMY A;  1TL3 A;  2GVZ A;  1SUQ B;  2RKI A;  3M30 A;  4Z37 A;  4Y0F A;  1FTR A;  1ZOT A;  3FKB A;  4KPY A;  4TY8 A;  2EXU A;  4RBT A;  2P9E A;  3V6D B;  5M2U A;  4O3Q A;  3DOM B;  1B3T A;  4RWW A;  1JQG A;  2HUR A;  2IM2 A;  3TAM A;  2A3J A;  3KLE B;  2AX0 A;  4BWJ A;  1CUL B;  4KSE B;  4OI3 A;  3M6V A;  1XMO F;  4M1K A;  1X31 C;  3NP5 A;  4D3G A;  1NJW A;  2YPZ A;  4WFA Q;  2R3V A;  4Q43 A;  1DUR A;  1MWZ A;  4AQY J;  1NSA A;  1Y10 A;  5AXL A;  5HO4 A;  3RR8 A;  3NWG A;  3H20 A;  1BQM B;  1TL5 A;  4CYU B;  5I3P A;  1Q8I A;  2HAF A;  4RUH A;  5CYM B;  4OHW A;  2DH7 A;  4NZ6 A;  1KNZ A;  3OUY A;  1WTF A;  4DV7 F;  1REG X;  3EGZ A;  5DET A;  4Q2M A;  3POT B;  1X4H A;  1EJ7 L;  5GMK a;  1JLF B;  3EIC A;  1U1P A;  5ETS A;  4ID5 A;  4MIB A;  1NSQ A;  5G0R B;  2Y9H A;  2QL7 B;  3C16 A;  1GMV A;  3T1Y F;  3S1T A;  4KB7 A;  2GC8 A;  2BE2 A;  1ZTT A;  1WNE A;  3DDK A;  3TZZ A;  5HK4 A;  2ZNZ A;  3DOL A;  2VV5 A;  2C2D A;  4RW8 B;  1B7F A;  2CQ2 A;  3QBC A;  2W7O A;  2E5H A;  1U2R A;  2ZDO A;  3RUB L;  2J9C A;  5HL7 Q;  1NXI A;  3AA8 A;  3M2U A;  3T5H A;  4O3S A;  1RU2 A;  3LAK A;  4UUW A;  1N6Q A;  3PW7 A;  3DLL Q;  4FZV A;  4KH1 B;  5IV3 A;  5LOQ A;  3KXD A;  4DF4 A;  2K7K A;  6FDR A;  1H72 C;  5ETR A;  4DL3 A;  2ACM A;  4TU8 A;  2BQR A;  2HS4 A;  5LT5 A;  4QR1 A;  1RT2 A;  3H7H B;  1H2U X;  2KG0 A;  3HO1 A;  4DQI A;  3H98 A;  1VK3 A;  5A0Y A;  5DLF A;  4QWB A;  2BKO A;  4UST A;  3I0R A;  1SL2 A;  1EP4 B;  1HHT P;  2KN4 A;  2BAN B;  3AJ1 A;  2IMW P;  1RTI B;  4KT0 C;  1GTH A;  1F2H A;  1YBT A;  3GTY X;  1NK5 A;  1BGX T;  4XDC A;  1V5V A;  3NS6 A;  3IC1 A;  4J9K A;  2D3O 1;  2E29 A;  3DU5 A;  3UNY A;  3KK2 A;  2MKY A;  4Q45 A;  3HPO A;  4IH5 A;  4GC6 A;  1NJZ A;  3R2D J;  4CNY A;  3F0N A;  2KG1 A;  4X62 J;  2W8L A;  3FEX B;  2I6W A;  4LF6 F;  3GIK A;  2F9J A;  2AKW B;  2DGO A;  1S9G B;  3BPD A;  4ENO A;  3AB2 B;  1GAO A;  3QGH A;  2RHQ B;  1KTQ A;  2BM0 A;  1R8B A;  4Q8F A;  2QJ3 A;  4CLL A;  2MEW A;  7FD1 A;  4ZPV R;  4TQR A;  4MFB B;  3ZO7 A;  1Y0H A;  1V9O A;  5I42 B;  4WFX A;  3MMA B;  2HHT A;  2MLX A;  2HHS A;  4XDD A;  3MEE A;  4AL6 A;  4AL7 A;  1KSP A;  4DHV A;  3TX8 A;  4ETX A;  4X66 J;  4RU9 A;  4PAB A;  3PJX A;  4WF9 Q;  2LXI A;  1IKV A;  4CDI A;  2AEM A;  1QM9 A;  1UP1 A;  1S5Z A;  2E7V A;  4KV8 B;  3CGI A;  1TKX B;  3TNV A;  4I68 A;  2HFU A;  2D1C A;  2JFD A;  3D7S B;  3VWS A;  4DFK A;  2FDN A;  3M9M B;  7AT1 B;  4OZN A;  5KFE A;  2EBE A;  1Y5I B;  3RYL A;  3VTI A;  2MKI A;  2YWH A;  3VZI A;  4J90 A;  2RF2 B;  1B0P A;  1N36 F;  3MMB A;  2GIF A;  4ZP6 A;  1ZM4 A;  1E6Y A;  2EFP A;  2N7Y A;  3QRR A;  1VDH A;  2ALY B;  1IBC B;  1WHV A;  2APO A;  5AE2 A;  2CQ3 A;  2GGP B;  3MD3 A;  1IR0 A;  2OEK A;  2LYV A;  3K5N A;  4OX9 J;  3PR5 B;  3SMZ A;  5A2Q Y;  2Z2Y B;  1A6L A;  5DDP C;  4Q2L A;  1ZS6 A;  2MKC A;  4FPI A;  4DV6 F;  1IJF B;  4AL5 A;  3I0S A;  3KLH B;  2KVI A;  1FRK A;  4OLO A;  4I56 A;  1JNR B;  3ZZR A;  1X4F A;  3GMG A;  4CNZ A;  2QC3 A;  1UAW A;  4XAK A;  4F0K A;  3R5B A;  3M1V B;  1F5C A;  2M0G B;  6AT1 B;  2H48 B;  4R8U A;  4MIW A;  3RB3 A;  3MZI A;  2AJF E;  1S1T A;  1RCX B;  1JJ2 R;  4OJH A;  3H5U A;  4B3M J;  3FRZ A;  5D4L A;  4B08 A;  2OIH A;  1FVS A;  4ECT A;  5J1E A;  1LWE B;  1HI1 A;  1DTQ A;  2RRA A;  1Q5Y A;  1SUQ A;  2R2U A;  2B3T B;  2BV3 A;  2CNK B;  3V6D A;  3I96 A;  2P6T A;  2RSQ A;  4DR7 F;  4FDF A;  1WSV A;  1KVK A;  4IFV A;  5DZ6 A;  2VH7 A;  4ZA1 A;  1C2P A;  1CUL A;  4L72 B;  2YX7 A;  1SH3 A;  1K44 A;  4IO9 Q;  1IKY A;  3HFZ B;  1N5V A;  2DGW A;  2UUC F;  3Q8U A;  3EDR B;  1C1C B;  2OPQ A;  3MM8 B;  2IC3 B;  1EIY B;  2IRX A;  5IM0 B;  4TN2 A;  5IWA F;  3R6G B;  5HAT A;  4BBY A;  2MZR A;  3H4D A;  4MYT A;  2LXF A;  5M2R A;  2FGC A;  4S0M A;  4CYU A;  1EB0 A;  4OL8 A;  1GK8 A;  2VG5 B;  3TJ8 A;  5CYM A;  1CG2 A;  3RBZ A;  3MOJ B;  3VAJ A;  2ZFH A;  4PG4 A;  1FDN A;  4J9L A;  2CQH A;  2MKJ A;  3POT A;  4WZM A;  2ADB A;  3PHE A;  3W5Z A;  3DCA A;  4DL2 A;  2YWK A;  1K8A T;  2CDQ A;  2OSR A;  3T5K A;  5D0E A;  3RGI A;  1LWC B;  2DK2 A;  3CJ4 A;  5G0R A;  2E5L J;  1VQK S;  1HNW J;  1N54 B;  4LSN B;  5M2P A;  2EW9 A;  4U7U D;  2GIR A;  3NGR A;  4ZP8 A;  4N76 A;  3AFG A;  2DHS A;  2EC2 A;  2UXD F;  2OJ3 A;  3QAT A;  5HAN A;  2ZKT A;  1UFW A;  3WIU A;  4C3K A;  4A8X A;  2B4P A;  3H40 A;  1R0A B;  2DGV A;  3OXF A;  4Y00 A;  5BYR A;  3OHB A;  2YKM A;  4CI0 B;  4WCE Q;  2CQC A;  3FDS A;  4YME A;  3ZNU A;  3HXM A;  1JLG B;  3HJF A;  4CLZ A;  5GAG I;  2BM1 A;  2ZBP A;  2BJ1 A;  1WOO A;  3UCU P;  4NMX A;  4HH0 A;  3SCK E;  4WTY A;  4ZLN A;  3EUN A;  4ILR A;  3BSC A;  1GMW D;  2QYG A;  2BAN A;  1VLY A;  1RTI A;  3AH6 A;  4F0M A;  4HH1 A;  5AXN A;  2QZ8 A;  1K73 T;  1VIO A;  4WU2 A;  3Q8V A;  3Q8S B;  1RT7 B;  4ZIW A;  4P7T A;  2AEJ A;  1YKW A;  3V81 B;  4Q44 A;  1Y5L B;  4RW4 B;  2ZOM A;  5CYQ A;  2PO4 A;  4B9U A;  4WPA A;  1E6V B;  4V19 J;  4OV1 A;  3BSN A;  2O66 A;  5C25 A;  3TVZ A;  2R8G A;  4GO5 X;  1AYE A;  1IR2 A;  2XCP A;  1RAA B;  2HBQ B;  3EVO A;  4YEA A;  3C19 A;  1HHS A;  1UJ5 A;  3D6H B;  3UVJ B;  3QSY B;  4JI6 F;  1UVL A;  1S9G A;  4FVC A;  1KFD A;  3M8P B;  3JQK A;  4OZ3 A;  2NQP A;  1CBK A;  4H4M B;  4TYB A;  3W8P A;  1S10 A;  3MF5 A;  4F4X A;  1O5J A;  2IA6 A;  5I42 A;  3T1H F;  2MHN A;  1YJW S;  3MMA A;  3ISZ A;  1W2B R;  2JC1 A;  3EZ5 A;  1FF2 A;  3MR2 A;  1FX2 A;  4ZIV A;  1UA0 A;  1C1B A;  1X9S A;  4Y28 C;  4DV5 J;  4P72 A;  2DNY A;  1QDU B;  1UFK A;  3FBC A;  2HZV A;  1FCA A;  2XY5 A;  1KVI A;  4ETZ A;  2CPF A;  1TKX A;  2OAU A;  2G1D A;  3JSY A;  3GIR A;  1AUS L;  1SI9 A;  1IXK A;  5A2Q U;  3L7O A;  4PG7 A;  1RAC B;  1JB0 C;  1GTE A;  1SPB P;  2UU9 J;  5HJX A;  4PXB A;  3B4M A;  2JLG A;  2IAJ B;  2RF2 A;  4ZPT R;  4LRA A;  2IRU A;  5F3Z A;  4OFZ A;  4CRJ A;  3PX4 A;  1F60 B;  4ATN A;  2FHJ A;  1U24 A;  2KT5 A;  3G8T A;  1XN9 A;  3JXO A;  2QLW A;  3HVR A;  3OVB A;  2FB0 A;  4CM0 A;  4CH7 A;  1U49 A;  2MLY A;  2GGP A;  4KKO A;  1FD8 A;  5I3U A;  2ZUG A;  3I5B A;  4X64 J;  3EVW A;  4O44 B;  1YVF A;  3OBI A;  1KHV A;  1FXD A;  4BC7 A;  1FE0 A;  4BC9 A;  4F36 A;  4OYZ A;  3MAQ A;  1FFG B;  4USW A;  4DSE A;  5ETP A;  2NXU A;  4WFN Q;  3M1V A;  3R5G A;  2HMI B;  1CEZ A;  1VQN S;  1KR4 A;  3WZ0 A;  1TAQ A;  2J7W A;  2V2Z A;  4MYU A;  1VQ8 S;  1KOO A;  2D3O R;  3S6E A;  1AT1 B;  1RK8 A;  2DNO A;  2FJW A;  1KWM A;  3VAM A;  4NEZ A;  4MK7 A;  2MST A;  3TEG A;  3R7N B;  2NZC A;  3NRB A;  2BBE A;  2C3O A;  3OSP A;  1Q1K A;  2ZH3 A;  2MQ8 A;  5D0G A;  3DYA B;  3HX9 A;  2IJR A;  4F4K A;  2RML A;  1BY9 A;  3ZTR A;  4NRU A;  1QTN B;  2AX1 A;  5KG7 A;  5KFA A;  1IBM J;  1FKA F;  1NM2 A;  3WX4 A;  5DGB A;  2KO1 A;  1Y7P A;  1BD6 A;  3CDB A;  1F5A A;  4F4Z A;  4FS2 A;  1WDD A;  2K1R A;  4ZVQ B;  1JK9 B;  5RUB A;  3MPY A;  4JI4 F;  4ZVR B;  4Q0B B;  2UZA A;  4YHH J;  2NRE A;  1T7P A;  3X1L B;  1BQN A;  1S1V B;  5GAG U;  1RCO B;  1R8H A;  2IVM A;  4NYP A;  1Q78 A;  5CAB A;  3I87 A;  3MM8 A;  2AV5 A;  5IM0 A;  1Q7L B;  5FDL A;  2K7J A;  3N6M A;  4LF5 J;  2GAH C;  3GB0 A;  2XEX A;  3ILO A;  2VQE F;  5EHH A;  1U1O A;  4C0B A;  2DO0 A;  4NLW A;  4PXD A;  2PI4 A;  5JXS A;  4EZ9 A;  2WRM A;  3PFE A;  1UPP A;  3OPK A;  4RU2 A;  3KTQ A;  2OO4 A;  4M8L A;  4PQA A;  5T7L B;  4W98 A;  1M1H A;  1RLC L;  1B0T A;  3TUZ C;  2M4M A;  3EVM A;  2VKZ G;  4LQ9 A;  3DKD A;  2WVE A;  2ZIT A;  4JB8 B;  5GME A;  5KG6 A;  4DG1 B;  4H4O A;  4USK A;  4QR0 A;  1TL1 B;  4USV A;  3SBM A;  1LWC A;  2WSE C;  2YNI B;  2IDE A;  5KG0 A;  4ALZ A;  1U2C A;  1DY3 A;  1UZH A;  2LQ5 A;  4QPX A;  4LSN A;  4D3H A;  3LUY A;  3TVK A;  4DR6 J;  3W2V A;  3ZZZ A;  1WKK A;  3MGJ A;  1R0A A;  3TX0 A;  1S1U B;  4DEZ A;  4YDD B;  2WVF A;  5L1K A;  3LH2 S;  5AXM A;  4QIV A;  2E5J A;  1FKO B;  1XNR J;  2DIU A;  3EGW B;  3HHL C;  1S9E B;  4K0K F;  4Y2K A;  1RHJ B;  3W60 A;  1ZPW X;  5F0U A;  4WKR A;  1ICE B;  1U48 A;  3ZXW A;  2ZM6 J;  1ULR A;  2QRR A;  3RRH A;  1QJH A;  1R0B G;  1S76 D;  3NG8 A;  2BZ2 A;  2L3M A;  4U6P A;  4J9V A;  2DR7 A;  2PEH A;  4JV2 A;  1HNZ F;  2ZE2 B;  5B7W A;  4DU8 A;  3R5A A;  4NI2 A;  3NL0 A;  1NEE A;  1M5V C;  2AYE A;  3OVA A;  3OV7 A;  4B9M A;  2HFS A;  4FYD A;  5D4N A;  2YKP A;  3V81 A;  3RW7 A;  4XTT A;  5D4O A;  1HQE B;  1SL1 A;  1SL0 A;  4RW4 A;  1LXN A;  3W9H A;  2BX6 A;  2XMA A;  2CZV C;  3ENW A;  4ED6 A;  4QIG A;  5FLX U;  3MFH A;  3IBF B;  4KJI A;  1XIQ A;  4DBQ A;  4EGL A;  2UUW A;  4JI0 F;  3UVJ A;  1DHM A;  3F73 A;  1ZAV A;  4AT1 B;  4HKQ A;  2JH3 A;  2AYM A;  4LF1 A;  3M8P A;  1XMQ F;  1N48 A;  2DYA A;  5B0B A;  1NPP A;  2RQK A;  3D28 A;  2KJW A;  2VBY A;  4K59 A;  4DUY F;  2DBB A;  5A76 A;  4GMK A;  2G13 A;  2UV8 A;  3PJW A;  3T41 A;  4WYL A;  2DY9 A;  2YX4 A;  1JNZ B;  4ECW A;  3QIP B;  2PMH A;  1HBN B;  1FK9 A;  1WEL A;  2XZT B;  1ZM3 A;  2AW0 A;  1N33 F;  4P75 A;  2JRS A;  4TLQ A;  4FVM A;  1NZA A;  3AA9 A;  3KK3 B;  4KO0 A;  1T02 A;  3Q8P B;  3SCL E;  2QV6 A;  2YWW A;  3KUH A;  2H1Y A;  4DN9 A;  2IAJ A;  3MEK A;  4YS2 A;  2CJX B;  1REV B;  2EFN A;  2F8H A;  1YG0 A;  4JP8 A;  2NSB A;  5IFM A;  2B8Q A;  3E01 A;  3BH7 B;  4ED8 A;  4F0H A;  2WHO A;  3K59 A;  2IMO A;  1VQ9 S;  5B09 A;  5DM6 Q;  4E0D A;  3BBF A;  2VF3 A;  2OKQ A;  2CXE A;  2HHV A;  3NCP A;  1OPI A;  2DH8 A;  2DRB A;  4CO5 A;  2UVV A;  1M5K C;  1UVJ A;  3H2U B;  3J81 Y;  3DN9 A;  1FKP A;  1NK7 A;  5L1J A;  4TXS A;  2JWN A;  1U0S A;  3FFI B;  1U1Q A;  1P8G A;  2J8S A;  1TK0 A;  4UQT A;  3IWN C;  3NGU A;  1VBZ A;  2HMI A;  4NXM J;  2B5J B;  2BQU A;  4DLE A;  1OSC A;  4DJB A;  1KQF B;  2EVZ A;  3KDN A;  4TU9 A;  1CJU B;  4C11 B;  1B7Y B;  4WU3 A;  2DGQ A;  5E3R A;  1RTD B;  4ZCI A;  2XY6 A;  4DL0 C;  1DAR A;  4F2R A;  3VAK A;  2Z0G A;  4N56 A;  3DYA A;  4URQ U;  1BE4 A;  5AJ3 J;  2L9W A;  2Z30 B;  3QO9 B;  5LMN J;  1KFS A;  3IGV A;  4DL6 A;  3WBZ A;  3R6L B;  2PC6 A;  2GJF A;  5KFM A;  5DGA A;  2L08 A;  5KFO A;  1BLU A;  2F9D A;  3NY0 A;  3K89 A;  2CPJ A;  4KTQ A;  4K4X A;  5KFI A;  3FMW A;  1VLO A;  1R0C B;  3OVS A;  3TO8 A;  3MPD A;  3ILI A;  5B0D A;  3DNC A;  4OYB A;  5IQ6 A;  4ZCL A;  1H0H B;  1JXE A;  1VHI A;  2A2D A;  1U6B A;  2ROE A;  2W4C A;  3OXG A;  2JJ4 D;  2CIM A;  3MM6 A;  2AQ4 A;  3LF0 A;  3TZX A;  2D9P A;  4DCJ B;  4NAS A;  3CD7 A;  3DLH A;  1N5S A;  2GML A;  3VAH A;  2V4J B;  5HRO A;  1TKT B;  1A7G E;  2Y1I A;  5F0W A;  2HHQ A;  3Q2S C;  4CZC A;  3VVT A;  4QIE A;  5E3C A;  3L4B C;  3ZTP A;  5KFP A;  1ZM2 A;  3DGP B;  5H1S V;  4A8K A;  2V5H G;  4UF4 A;  3A8K A;  3SIP B;  4LF9 J;  2CA9 A;  2I0X A;  1PGZ A;  3L3C A;  2QA2 A;  2K2P A;  4DG1 A;  1JLQ A;  2FJX A;  3PM9 A;  2HVH A;  2PMW A;  4BHQ A;  3MPU B;  4IRC A;  1RB0 A;  4LFC J;  2RD5 C;  2YNI A;  3HZG A;  2KM8 C;  2R7V A;  2RIJ A;  2ZKU A;  3R8Y A;  1EKS A;  2KL8 A;  2VFS A;  3KMS A;  2WVD A;  1KQS R;  2O3D A;  1YRT A;  2WB1 D;  3BJY A;  1PG5 B;  4KY3 A;  1UVM A;  5K8O A;  1NPR A;  4TKT A;  2UUB J;  4GC7 A;  3ULH A;  1S1U A;  2YKO A;  2XMV A;  4JUZ A;  5F8J A;  3TA1 A;  3KLV A;  1FKO A;  2LQ9 A;  1SXL A;  3UW1 A;  1RT4 A;  1NBE B;  3RR7 A;  4OYM A;  1LXJ A;  3J80 Y;  3EPI A;  4IOC Q;  1S9E A;  1SJQ A;  3T3F A;  3UN3 A;  2VOO A;  3KJF B;  3T1A A;  2KXH A;  1JJH A;  1HQU B;  1PJ7 A;  2V68 A;  3LP1 B;  1KLN A;  4C7Q A;  4K5S A;  4AQY F;  4EFA C;  3A3P B;  2HK2 A;  5A6P A;  3DDN A;  1IVZ A;  2PFD A;  1RBA A;  5D3G B;  1XTZ A;  2ILY A;  3T6B A;  3G8S A;  2DJW A;  3ETO A;  3FBB A;  4I7F B;  2PN6 A;  1FJG J;  4UY8 T;  5DG7 A;  2D74 B;  4P74 A;  5IT9 Y;  5J2M B;  5IOL A;  3HKZ D;  4DF8 A;  1U1K A;  2XWX A;  5A8R B;  2PT0 A;  1HMV B;  1HQE A;  3QZ8 A;  4Q5V A;  5F41 A;  2V9W A;  1ZET A;  5EX3 A;  4WE1 B;  1BQX A;  2D3U A;  2ZVI A;  1X5O A;  4QWD A;  4AE5 A;  4LMZ A;  1VCT A;  4CO2 A;  3ZC4 A;  1TZ0 A;  2QFI A;  2JX2 A;  3IR7 B;  2QE5 A;  2HLU A;  2GMH A;  4PG8 A;  1VQ6 S;  1XER A;  1Y3J A;  2MJU A;  4CO4 A;  3QRQ A;  3NOG A;  5HMX A;  1SKW A;  3MTK A;  3O5T B;  2CDR B;  1NLK L;  4URG A;  4DFP A;  4LVO P;  1YRU A;  4BLG A;  3EX7 B;  3SQG B;  2B6A B;  1S7H A;  5D6G A;  2NUH A;  2R42 A;  1SJF A;  4CTA B;  2QMW A;  3UNG C;  3CJT A;  3OLA A;  3LP0 B;  1R31 A;  3MOZ A;  3BB5 A;  3D1O A;  3W1Y C;  3L95 X;  4OJ1 A;  5E41 A;  4O4G B;  1RIS A;  1H74 A;  4NRT A;  4Q7A A;  1T05 B;  4C8K A;  3ICL A;  3DMJ A;  2KFN A;  2HHX A;  3SFG A;  1EHW A;  1LNQ A;  3L7U A;  4CT8 A;  1U4B A;  2VIH A;  1SC4 B;  4IH6 A;  3KK3 A;  2YKN A;  3E51 A;  1DJ0 A;  4LF7 J;  5AXK A;  2XWY A;  2QA4 S;  1LWX A;  2RJZ A;  4HVZ A;  3KYL A;  2QTW A;  3ZZ0 A;  1FEH A;  3RB6 A;  1ARO P;  2CNO B;  5A8K A;  4FF4 A;  1B70 B;  3QAE A;  4X2B A;  4RX6 A;  5IQQ A;  1KBR A;  3DHW C;  4AFF A;  1U26 A;  1IUJ A;  1F2G A;  3HFV A;  2HBY B;  5CYJ A;  3D6F B;  1CJT B;  2RUS A;  2GW8 A;  2ZZM A;  4X62 F;  1UKU A;  3RB4 A;  2CQ0 A;  3DLK A;  4Y65 A;  3C3L A;  2FJA B;  2PA3 A;  5JJB A;  2V9K A;  1CC8 A;  3PV8 A;  2D7S A;  1QSS A;  4CH0 S;  3HK2 A;  5KFN A;  3RG6 A;  2XNQ A;  2PII A;  3JQJ A;  5CD4 A;  1NJY A;  4J9U E;  4ZPC A;  1OS5 A;  2NXE A;  5KFH A;  3MEC B;  4RUB A;  4X66 F;  2AWZ A;  1U2F A;  4CLY A;  3H8Y A;  2B5J A;  4E98 A;  1R3N A;  3JYT A;  2POK A;  1CJU A;  1RHU B;  2FPH X;  3CJ2 A;  1VHF A;  2MPU A;  3DI6 A;  4IG0 B;  1IBK J;  4FBT A;  3ZNJ 1;  4CO1 A;  4ZVP B;  3T9Z A;  3BSO A;  1FHT A;  2RB7 A;  2YQ3 A;  1NCL A;  1RHK B;  4ZIT A;  2AF6 A;  2CQ1 A;  5E3P A;  2ZH1 A;  3TR5 A;  4IG3 B;  3KHG A;  1YQH A;  1J5E J;  2J0W A;  1WC3 A;  4DSJ A;  5L1L A;  4WFB Q;  4FKX A;  7FDR A;  1Z2L A;  4MTP A;  1OYE A;  1XK8 A;  4WJB A;  2HFO A;  5KFS A;  4HHJ A;  3RTV A;  1QSL A;  2X3D A;  3CCR S;  2N3L A;  3B78 A;  2JL9 A;  2DCU B;  1X4D A;  1B99 A;  2IYI A;  2E7X A;  4K4Y A;  3T5L A;  1AFI A;  2O67 A;  5SZT A;  4OX9 F;  2OEL A;  2PMZ D;  1RAB B;  4L74 A;  5B0E A;  3CF5 Q;  2MKS A;  2XM3 A;  3OTB A;  4K8R A;  2BKP A;  1RWV B;  3IWL A;  2F65 A;  3DLJ A;  4DR1 J;  2CJB A;  1D9D A;  2J9D A;  2C3U A;  3QWU A;  1VC0 A;  5F8H A;  4PUO A;  4P9S A;  2BA9 A;  2O5D A;  1T8E A;  4DR4 J;  2YNH B;  5DS7 A;  1QE1 B;  3D66 A;  3UCZ P;  2CJQ A;  1CJK B;  3GII A;  2OH2 A;  3THP A;  2WON B;  2LMI A;  4K4V A;  2EBG A;  4M5G A;  4TU7 A;  2CJA A;  1WF0 A;  2ZDP A;  4B3M F;  1RYR A;  2G9O A;  4I4B A;  5HI7 A;  1Q81 T;  1QAJ A;  3HT0 A;  5LMU J;  1PYT A;  3VF0 B;  1XWL A;  1DLO B;  3V2U C;  5C7P A;  3EWG A;  3C6U B;  3RBE A;  3GWC A;  2IBO A;  4J5O A;  4DPO A;  4JI3 J;  2NZ4 A;  1YJT A;  3QID A;  3AOD A;  4RLE A;  3FVY A;  2I5J B;  1NB2 A;  1HHQ A;  4O0N A;  3DFE A;  2MYF A;  2E5G A;  3IG1 A;  3KLG B;  4LT6 A;  1RAE B;  2Y1J A;  2LEP A;  3GG1 A;  4OIX A;  3UPF A;  3R7S B;  2XLJ A;  3PO5 A;  4I0W A;  1SBR A;  1C0U A;  1ROF A;  2DKO B;  4QWE A;  3GJQ B;  1HYS A;  3OFF A;  3DRY A;  3N01 A;  4PWU A;  2HQF A;  3GU0 A;  5D3G A;  2BVZ A;  2V67 A;  2ZH8 A;  4K50 A;  1QAY A;  1DTT B;  2AJ4 A;  5B08 A;  3GQC A;  3JTN A;  2E5I A;  3OR1 B;  4U9R A;  3EMT A;  1GX6 A;  3SSQ A;  4LRB A;  2YNG A;  4JV5 J;  1SIW B;  4J91 A;  5J2M A;  2KXN B;  4NLU A;  3MCM A;  4PZV A;  5KG4 A;  5ITH A;  2BEF A;  4FYW B;  3G4S S;  1HMV A;  3FBF A;  2VG7 B;  3R7B B;  1U45 A;  1TP7 A;  2DEJ A;  4OHZ A;  1DQ9 A;  5GAE U;  1LW0 B;  4KGM A;  1HW9 A;  2ZBR A;  1YTY A;  2KT2 A;  2E5L F;  1HNW F;  1GNK A;  1IN0 A;  5C42 B;  4QBU A;  3PZP A;  2HHU A;  2MHE A;  5L9X A;  5KG3 A;  1FA0 A;  1MMD A;  2EG2 A;  1HKA A;  2N3O A;  3CCJ S;  2I2Y A;  2FZK B;  3TAQ A;  3D2W A;  2W8K A;  4EO6 A;  3LGM A;  4ES2 A;  3CMA S;  3WQP A;  3PKM A;  2FVP A;  3SQG A;  1F9E B;  1URR A;  2MXY A;  4O23 A;  4RNN A;  2A6M A;  5KFQ A;  2W2M P;  1DBD A;  3Q8R B;  4DUT A;  3CCS S;  3EZU A;  1VJW A;  4DUZ J;  1H2V Z;  1LWF A;  1IJE B;  2B9Y A;  2GJI A;  4KAI A;  4O4G A;  1HD0 A;  2CPX A;  3CED A;  5IT4 A;  1GX5 A;  2XSJ B;  3CJ8 A;  2MZS A;  2HLT A;  3HHL D;  2IM0 A;  1FX4 A;  2BAB A;  3R1L A;  4YB6 A;  3F44 A;  1WSR A;  4QU7 A;  4DPW A;  4PAA A;  1R7I A;  4P52 A;  1RT6 A;  2FC8 A;  1KOH A;  4PKD B;  4WXO A;  1FI4 A;  2EFO A;  3MMC B;  2FC9 A;  4H4K A;  2DHA A;  2XUL A;  3NKY A;  1NUE A;  2QLF B;  3AQP A;  5K14 B;  1AZS B;  2FYX A;  4N8O A;  2C22 A;  3M4X A;  1SH2 A;  4LFB J;  4FXD A;  4EU0 A;  2KZM A;  1FD2 A;  1QLN A;  2XZW A;  5KT6 A;  3MR3 A;  2AIR B;  5IZH A;  3KNG A;  3TQ1 A;  3SV3 A;  3R5D A;  1SVD A;  3IR5 B;  4DSL A;  4RW7 B;  3W3S A;  4DS4 A;  1M5H A;  1FER A;  3W61 A;  2VFV A;  1S49 A;  2YTC A;  5E5N A;  4AND A;  2LFV A;  2HNY B;  3DHX A;  4HHH A;  5B0F A;  1HR0 J;  4F04 B;  3BN7 A;  3CJK A;  4ZS6 A;  2G4B A;  4KRW A;  1UL3 A;  3VR1 A;  2E1P A;  5KFL A;  2RVJ A;  2XY7 A;  4PPD A;  4N47 A;  3I5C A;  2YKA A;  3P3D A;  3HKW A;  3P5T L;  1WTB A;  1ZA2 B;  1D8Z A;  3D4J A;  4L75 A;  5EWE A;  1VBY A;  4N77 A;  2GIQ A;  4WFY A;  4PRF A;  4FF1 A;  2IA0 A;  4ZMM A;  2C2N A;  2HQG A;  3MEC A;  1YJV A;  2DR6 A;  1LEO A;  1YIT S;  4DPY A;  3EXC X;  4FYY B;  2HIY A;  3OSN A;  4DV5 F;  5F8G A;  2FVR A;  3HHK A;  3PXG a;  3PIP Q;  4YR3 A;  4IG0 A;  6FD1 A;  4IOB A;  4GVB A;  3NBP B;  1SV5 B;  4ZPA A;  1JLC B;  1NZ8 A;  3IS9 B;  4EZ6 A;  2GS8 A;  2FHO B;  2RQM A;  4ICL B;  1IKW B;  2Y8W A;  1X5S A;  2KT3 A;  1KP6 A;  2KKH A;  3CE8 A;  2UU9 F;  4OZ5 A;  3B4D A;  4KYZ A;  1Y4Z B;  4F25 A;  2BYC A;  2HQ3 A;  4IG3 A;  2VON A;  2HVE A;  1Y5N B;  1Q82 T;  4ANE A;  1WF1 A;  3QLH A;  3NLC A;  1XC9 A;  3TW0 A;  2ZZN A;  3GFZ A;  1WEY A;  2J6T A;  5DZ7 A;  3SV4 A;  2VG6 B;  3FJ2 A;  3TZW A;  5HQM A;  1RWO B;  1F3F A;  1IKX B;  3MED B;  4WBF A;  2I1R A;  1TK5 A;  2CPY A;  3DXB A;  2VA3 A;  3OQ2 A;  3TWZ A;  3H5S A;  4X64 F;  4ZJL A;  2M8H A;  5K8P A;  3DRR B;  4BCA A;  1U47 A;  1X7V A;  2FVC A;  1EAR A;  4QWC A;  1JIH A;  2XMW A;  2ZHB A;  3QGI A;  3AJD A;  1VBK A;  2OPR B;  3AAW B;  1RA7 A;  1D3W A;  4CO0 A;  1NHV A;  3D67 A;  3LAM A;  2OFG X;  1NK8 A;  3R97 A;  3G6E S;  4I1T A;  3ITH B;  1QE1 A;  2G2O A;  1CJK A;  1RYS A;  3LGH A;  2WON A;  5F8I A;  1I51 B;  2E1M C;  1VC6 A;  1S99 A;  2HGL A;  4GKK J;  4A4J A;  4ZHR A;  3H59 A;  3IMQ J;  3OXL A;  8RUC A;  1K0V A;  3D1Q A;  4ER8 A;  5CCL A;  4EBC A;  2RH3 A;  1EQM A;  3QPI A;  1IBM F;  3C6U A;  1IWG A;  5DO2 A;  2HFN A;  1SKS A;  1VR6 A;  3K8V A;  1U1R A;  2XYH B;  4AXI A;  4EO8 A;  3BO3 A;  3MAA A;  4NLO A;  2I5J A;  1R89 A;  2V8D A;  3FSX A;  4YHH F;  1QUV A;  3DLG B;  5CAA A;  3OTD A;  4EBE A;  4DX5 A;  3IFE A;  4ZCK A;  4MKA A;  4EBD A;  1G2E A;  2HKE A;  4X84 A;  3HP6 A;  2MQM A;  2HVD A;  2FJV A;  4M63 A;  1S6P B;  1UW4 A;  4GRS A;  4LF5 F;  2Z8Q A;  1DTT A;  1KS2 A;  1FT8 A;  2CG4 A;  2GAG C;  1DQ8 A;  4C48 A;  3OR1 A;  2D41 A;  4W92 B;  2XO6 A;  5ETL A;  2YQ0 A;  5G4D A;  2N82 B;  4UY8 5;  1NAQ A;  2WK4 A;  1OQ3 A;  3LA0 A;  3D6T B;  4DZ6 A;  4A46 A;  4MIA A;  2MQP A;  2ZWO A;  1VRU B;  3H4B A;  2V69 A;  2RT3 A;  5A8W A;  4QYZ K;  1S59 A;  1RGV A;  3GYX B;  5CXT A;  5C42 A;  1MG7 A;  1YHQ S;  1HD1 A;  1UZD A;  4LIW A;  2HRU A;  4DR6 F;  2YWG A;  1FNX H;  4J7C A;  4XPC A;  2WOM A;  1LW2 A;  1N32 J;  1VGY A;  4KHP J;  3H5Y A;  1XBW A;  4IFY B;  3LP2 A;  2H5J B;  5J1N A;  4ZN1 A;  4P71 A;  2MZT A;  4M94 A;  4IR9 A;  1XNR F;  1NK9 A;  1FRM A;  4ITS A;  1FO1 A;  2N4C A;  3CC7 S;  3EE3 A;  2CJY B;  1UPM B;  3N0V A;  1R27 B;  2XSJ A;  2ZM6 F;  1VRQ C;  4Q8E A;  3HHN B;  4ELV A;  4ZP7 A;  4LBH A;  2DHX A;  3I4P A;  1VQO S;  4MT1 A;  1LFP A;  4JV0 A;  5H9F J;  1D1U A;  1FTC A;  1S77 D;  2MZ1 A;  1UJ6 A;  1FRH A;  3UN5 A;  1N5Y A;  4J9S A;  4ECX A;  3MMC A;  1NO8 A;  3NAI A;  4HI2 A;  1T9Y A;  3M2V A;  1S1W B;  2W9A A;  2LU1 A;  5K14 A;  1SKR A;  2KU7 A;  4IDK B;  4C98 A;  5GMD A;  1VRT B;  3M9N B;  3EPG A;  2F5G A;  1VQ7 S;  1OYD A;  1C0T A;  5HVF A;  1FNM A;  1BXN A;  4ED4 A;  4NZ0 A;  2K06 A;  3LWM A;  2WW8 A;  2XS7 A;  1I94 J;  2L9N A;  3PKY A;  1N0U A;  3LQV A;  4NE9 C;  2OTJ S;  2YWF A;  1PIE A;  3GON A;  1TVR A;  4Z2X A;  1N88 A;  4PWW A;  4F02 A;  2PA8 D;  3C14 B;  4QYZ J;  4F4A A;  4KPC A;  2UXC J;  3CO9 A;  2ZOF A;  3CCT A;  4IUF A;  3J7A 1;  2R4F A;  2JLF A;  1FJ7 A;  2CNN B;  2OFH X;  3TUI C;  5L1I A;  1LQ9 A;  2E44 A;  5D78 A;  5J2Q A;  5HBM B;  1Q0N A;  1RI7 A;  2C2O B;  2VIC A;  3LGN A;  3HUL A;  2VPW B;  2BAC A;  4OZ2 A;  4EK2 A;  4ERD A;  1J2V A;  4NLD A;  2EKY A;  3RW6 A;  2HND B;  2AGP A;  4CWB A;  2MQN A;  2W1B A;  1VQ4 S;  3NS5 A;  2MZQ A;  3GFH A;  4HHU A;  3GR0 A;  2RRB A;  3W5X A;  2UP1 A;  1PBA A;  4OZJ A;  3UN2 A;  4LBP A;  3NBP A;  1SV5 A;  1JLC A;  4ILM A;  3IS9 A;  2O01 C;  1P6T A;  5L8R C;  2GVD A;  2RDJ A;  2ATL A;  3P6Y C;  2P8I A;  4ICL A;  2U2F A;  1QAI A;  5D77 A;  3AOB A;  3UD3 P;  2YX1 A;  3HSG A;  2X3G A;  4ZVG A;  1YK9 A;  2D9O A;  4OYI A;  3PW4 A;  3BQ2 A;  1LFW A;  2C2E A;  2RIL A;  2ZZT A;  4B3R F;  2MDA A;  3KLF A;  1LK5 A;  4I69 A;  4WXW A;  2HW3 A;  1PC4 A;  2W2O P;  5D15 A;  2CNL B;  1MWY A;  2HG4 A;  1HA1 A;  3MED A;  1KC8 T;  4K4Z A;  1N34 J;  3G96 A;  1Q79 A;  4IRD A;  1T03 B;  1FWK A;  3U1N A;  3MM5 B;  4B3S J;  2B8P A;  4G1I A;  2ZJQ Q;  1JWW A;  2NXJ A;  2E9T A;  1C4A A;  3P45 B;  3F41 A;  3G82 A;  4KGK A;  2W9B B;  1X9M A;  5CQG A;  3A8I A;  5KFC A;  3TP2 A;  5E0O A;  4OX8 A;  2DXE A;  3VQS A;  5HN0 A;  4KFB B;  4O3P A;  3PHT A;  1F9H A;  1RJJ A;  1Y11 A;  1OY9 A;  1FJC A;  3ISN C;  3Q2T C;  1B0V A;  1ZZF A;  3ITH A;  3IRX B;  4NXM F;  2W2Q P;  2VPX B;  1RWM B;  3K57 A;  2VDI A;  4OZ1 A;  4JI8 J;  2R7W A;  3FNN A;  4E2F B;  3HZE A;  1XNQ J;  1K47 A;  4DX8 H;  1PCA A;  4CLP A;  2W01 A;  4DV4 J;  2OSQ A;  3MHY A;  3LOU A;  5AJ3 F;  5GAD I;  3AXM A;  4G1P A;  1OSD A;  5LMN F;  3HVT A;  2YNF B;  5DM7 Q;  4U7U K;  1ZA1 B;  4NLT A;  1RWK B;  1EQ0 A;  4RNF A;  4NEY A;  2FY8 A;  3G86 A;  3ENV A;  4KC5 A;  2FZG B;  1YI2 S;  5AT1 B;  5KFV A;  2EFG A;  1HNV B;  4LVN P;  2X51 A;  3UE2 A;  3MCS A;  2LEC A;  3DLG A;  2YY3 A;  4CLS A;  1KON A;  1WC0 A;  4ZVH A;  3SFU A;  4MJK A;  1F5B A;  2ZNY A;  3PRB A;  1RT1 B;  2WB4 A;  3FC9 A;  3PNI A;  3MCO A;  2HNZ A;  1FES A;  2G0J A;  2HSE B;  4I2Q B;  3R5J B;  4HT7 A;  1OO0 B;  2H54 B;  1S6P A;  3LW5 C;  4W4M A;  3O1L A;  4KGZ B;  1UEK A;  5HLF B;  2V8V A;  4PYD A;  3Q24 A;  2FJD B;  3A4T A;  3OJS A;  3Q22 A;  3CJR A;  2KYZ A;  4LFA J;  1RTJ B;  3CWJ A;  5CHC B;  3CJS A;  2KZZ A;  3M05 A;  2AHO B;  1V5I B;  4DV3 J;  2VPY B;  3AHP A;  2O1P A;  4I2P B;  3H5X A;  2M2B A;  3P4U B;  4LF9 F;  1FJE B;  4U95 A;  2V8G A;  4NLV A;  2XG8 A;  3BGR A;  3E2E A;  2K8G A;  1HW8 A;  4EYH B;  4RW9 A;  4LFC F;  4NML A;  1NH7 A;  4C8O A;  3DOK A;  3AT1 B;  3D3C J;  4QQB A;  3LPE A;  1XQI A;  1SJ4 P;  4LIR A;  3B54 A;  1F6T A;  4EMD A;  4ECS A;  3D68 A;  5KFX A;  4M5N A;  1FRI A;  1WF2 A;  3THT A;  3KHH A;  2UUB F;  1LOU A;  2VAS A;  2XB2 D;  2VPZ B;  4IFY A;  3GV8 B;  3MR7 A;  4ZVS B;  3DOM A;  2P9G A;  1KQK A;  4NX9 A;  1U09 A;  5DQH A;  2H65 B;  2G0I A;  1UET A;  4A8M P;  2JEF A;  2A1B A;  3EJM A;  3T6J A;  3KLE A;  1MU2 B;  5KFK A;  1XJW B;  2CWX A;  4F4W A;  1HPZ B;  3GP9 A;  3HD1 A;  2RNE A;  1Q95 G;  2AMC B;  1WG5 A;  2JLE A;  3KG0 A;  4C8M A;  2J76 E;  4B9T A;  3JSB A;  1XR7 A;  4NLR A;  1MWQ A;  1RA6 A;  1Y00 A;  4RO0 A;  1NPK A;  1YJR A;  5KG1 A;  1HWJ A;  3LPY A;  1JKH B;  1BQM A;  1H98 A;  2VBW A;  2MQL A;  1R43 A;  2HIQ A;  4QIF A;  2YVS A;  8AT1 B;  1F3V A;  3KHL A;  2E9Z A;  1FJG F;  1S4F A;  4RJV A;  4CLU A;  1S1W A;  3QQC D;  2GVZ B;  1FWP A;  2B9X A;  3M30 B;  3PDN A;  1VRT A;  1ZAX A;  4FYX B;  5LSL A;  2BOA A;  1JLF A;  2K3K A;  2ZH2 A;  5ETQ A;  2H3E B;  2DNK A;  4WP9 A;  3IGN A;  3TAM B;  3PR4 A;  2XBP A;  2J0X A;  3U1M A;  4NCB A;  3IN5 A;  2W2P P;  1O8B A;  3UQS A;  1GXL A;  2ZH7 A;  2QL9 B;  2IRY A;  3C14 A;  4FN5 A;  4WII A;  4RW8 A;  3VCD A;  4HI1 A;  4DU7 A;  1EZZ B;  5LSO A;  5CH7 B;  4J9O A;  3CD5 A;  3G6V A;  2KFZ A;  3QGP A;  1YLX A;  1T94 A;  3CB4 A;  3PJ9 A;  4MKB A;  5HBM A;  3J7Z T;  2FHJ D;  1KLM B;  2VFU A;  4F4Y A;  2DNM A;  4QR2 A;  2KHD A;  3TA2 A;  3MR6 A;  2HZA A;  1NK0 A;  3FUY A;  1RLD A;  1RU1 A;  4RUC A;  2RE1 A;  2HND A;  4RW6 B;  1HAR A;  3NCR A;  4IYQ A;  3GYG A;  3OL8 A;  4B3O B;  2VOP A;  2VU5 A;  4RWX A;  2NSC A;  3H2L A;  5LJ5 Y;  3M2R B;  3M6W A;  4MMO A;  4LBI A;  2VB6 A;  4XPE A;  2YQ1 A;  5GAD U;  3KHR A;  1URN A;  1FXR A;  3FMB A;  2BRK A;  2DCL A;  4M5H A;  1ZPV A;  3C16 B;  4RR5 A;  2KRB A;  2X1G A;  4LF7 F;  1EP4 A;  1K0T A;  2R8J A;  4JI5 J;  4B9V A;  1PAE X;  2LVW A;  4XK8 C;  4DWI A;  1ZTW A;  1EX8 A;  2HGM A;  1U8S A;  4DCO B;  3S8S A;  2VJV A;  5KT2 A;  5L46 A;  1GFW B;  4OI2 A;  1S48 A;  4HAC B;  2R7S A;  2W4P A;  2DXD A;  3UDE A;  2DPJ A;  1TTH B;  4CIO A;  2FUG 9;  4UOG A;  5CZV A;  1IBL J;  3PRV A;  1FNO A;  1HBU B;  1FEE A;  3CCV S;  4KGX B;  3D0G E;  2BJE A;  3HCX A;  2MY8 A;  1IQT A;  2V0N A;  1TQL A;  2Z2Z A;  1RT2 B;  4ZJQ A;  5K20 B;  3O44 A;  4DXL A;  4MFB A;  4KE5 A;  3E3X A;  4LR9 A;  4KFB A;  4OX6 A;  5A0Y B;  1P9Q C;  4CM2 A;  1YJ7 A;  2J5A A;  5FD1 A;  1UMJ A;  1U7L A;  1VIX A;  4QCL A;  2F40 A;  3IRX A;  5FLX Y;  4OJ3 A;  3BZQ A;  3Q0A A;  2NXN A;  2VL1 A;  4HTJ A;  1W7W A;  2QMU B;  2NPF A;  2KM8 B;  4U7C A;  3BR8 A;  5CD4 H;  2WBM A;  3ZFV A;  3O8W A;  4LUB A;  2XMK A;  3VQT A;  2W24 A;  2Y3Y A;  1IBK F;  2QYC A;  3KJN B;  4KV8 A;  2Y1R I;  5I3Q A;  5HVG A;  3HMJ G;  3KK2 B;  1MMN A;  5KFT A;  2NYI A;  1FXL A;  5KFW A;  1BC6 A;  2HZC A;  3HD2 A;  5DRK A;  1C4C A;  1VI7 A;  3HLU A;  2QSW A;  3OL7 A;  4YB1 P;  4B9L A;  1K1S A;  2KFY A;  2K3I A;  1KDN A;  4G1Q B;  4C8Z A;  3KJQ B;  3EXY A;  2ASL A;  1HNV A;  2RUG A;  2DH9 A;  1FFS B;  1TEL A;  3BDE A;  1J5E F;  2QLX A;  4X4T A;  3BRE A;  3W9I A;  4MKV A;  4Z7C A;  4R5P B;  2M5Y A;  1RDR A;  2ZD1 B;  1YIJ S;  1L3T A;  3GSI A;  5L9N A;  2DVI A;  2YH1 A;  1QSY A;  4I2Q A;  1W2I A;  2LQJ A;  2CQP A;  1JLE B;  2H5E A;  4C0O C;  4RNH A;  1TK8 A;  3PYD A;  4K4T A;  1HNI B;  1PSD A;  1FDB A;  4LR8 A;  1R6Y A;  1Y3K A;  2CQD A;  3KLH A;  4X4Q A;  1O6X A;  9RUB A;  3BKF A;  2CVI A;  2B43 A;  1RTJ A;  2VFR A;  2MMY A;  2IJN A;  3NEK A;  4DR1 F;  4F8R A;  3I31 A;  2R2S A;  2BKN A;  1P27 B;  4DX7 A;  4DR4 F;  3CME S;  2ZHA A;  2VBX A;  4KGV B;  4FKY A;  2RDI A;  4DV1 J;  2Z56 B;  4M5M A;  4H4K C;  3HFK A;  3PIO Q;  3FSY A;  1U0H B;  2Y8Y A;  3K2Y A;  4DV0 J;  2Z58 B;  1V3S A;  2GA7 A;  1LWE A;  2C3P A;  2X7I A;  4QU6 A;  3CD6 S;  3TAP A;  4X4U A;  4FP9 A;  2E1A A;  2DHH A;  3ZTS A;  1IR1 A;  3OJU A;  5LMU F;  4IO1 A;  3I5A A;  5KFG A;  3R3T A;  5KTQ A;  5AE3 A;  3W63 A;  1L3U A;  1HFE L;  4ZLP A;  4I6W A;  1Q86 T;  4JI3 F;  4M5D B;  2R8K A;  3BF4 A;  1TL4 A;  3I0S B;  1X4B A;  1H2T Z;  2J8A A;  1VQ5 S;  3IAS 9;  3BGL A;  2CPE A;  3RJM B;  1HPZ A;  3CCL S;  5F9N A;  2J6U A;  2QFJ A;  3TYT A;  4GKJ J;  2MJN A;  1C1C A;  1X4A A;  2IC3 A;  1RWU A;  2QGF B;  4R8U B;  5LXY A;  1RTH B;  1Z2Z A;  2AJ2 A;  2IFX A;  2ZJR Q;  2C42 A;  4QIW D;  1VQS A;  1H38 A;  4Z7Y A;  1H73 A;  3Q8Y A;  2VG5 A;  2MQO A;  3MM7 B;  4ED1 A;  1FRX A;  3V6K A;  3PEH A;  1U8W A;  2QO3 A;  4USI A;  4JV5 F;  5D0H A;  1JJ4 A;  4OJG A;  3CJ0 A;  1DTQ B;  4YB5 A;  2DHG A;  1CS4 B;  1Q16 B;  2HK3 A;  5DG9 A;  3O6Q A;  1X0F A;  4C3M A;  4YB7 A;  4X4S A;  1NHU A;  4NXN J;  2X1B A;  1N52 B;  3SI8 A;  4J9Q A;  2V2V A;  3QAU A;  4IFV B;  4A47 A;  1RAJ A;  3UR3 C;  3VAL A;  1RAF B;  2UUA F;  1OMS A;  1OQ6 A;  4ECU A;  2P5V A;  2XMJ A;  5BR8 J;  1U1N A;  4MK9 A;  1HI0 P;  2PFF B;  2Q3P A;  3TEH B;  1IKY B;  3L7P A;  3OFG A;  3VGU A;  1S6O A;  3IA0 A;  5ETK A;  2OPQ B;  4CCH A;  4OYA A;  2HQC A;  1OIA A;  2QA4 G;  2AYG A;  1NSK L;  4ECZ A;  1BWV A;  4JV1 A;  1R8C A;  3KDO A;  3V4M A;  2YBV A;  2ZH9 A;  2F4F A;  2H4W B;  2OEM A;  4IR1 A;  4M95 A;  4FNH A;  1KLM A;  3MUM P;  2FZC B;  3U02 A;  3H0P A;  4RW6 A;  2V50 A;  4DUZ F;  1JLG A;  4P2M A;  4B3O A;  1J5O B;  3M2R A;  3I9V 9;  2U1A A;  3HI9 A;  4K4S A;  5IC6 B;  3CC2 S;  5EWG A;  1L5U A;  4B3T J;  3VGT A;  2GZO A;  2OHD A;  2HQD A;  4FXV A;  4LF8 J;  4DQQ A;  5FJ4 A;  2OPS B;  3CDA A;  4YY3 F;  4DL4 A;  2GX8 A;  3HSZ A;  2RRN A;  4P2F A;  2QL5 B;  2VQF J;  4BWM A;  1RT7 A;  4ZN3 A;  3U7J A;  4LFB F;  2XI2 A;  4HR2 A;  4CQ1 A;  3QGG A;  4J37 A;  4HAC A;  2AJ1 A;  3NOC A;  4DR3 J;  5GAH U;  4JI1 J;  1E6V A;  2YKM B;  3FQK A;  2QT7 A;  2BR0 A;  2FD2 A;  2G0C A;  3G6Y A;  3AOC A;  3DLE B;  4FXW A;  1VS3 A;  1HBU A;  1M5O C;  3L09 A;  3L9Z A;  3MFI A;  4NLQ A;  5K8M A;  1HR0 F;  2UV8 G;  2GHP A;  3NMR A;  1LK7 A;  3M8W A;  5DLG A;  3O3L A;  1WOR A;  1W26 A;  3BQ0 A;  3US5 A;  4H4M A;  4TNO A;  3CJ3 A;  4MAK A;  1YBA A;  2ZHO A;  5CA5 A;  2X1A A;  2LKZ A;  3NWR A;  5E3A A;  1SC1 B;  2ZBC A;  4NWB A;  2DNL A;  2HS0 A;  5EX0 A;  3N5F A;  4OHV A;  4N8N A;  5ETO A;  1TKZ B;  1T9U A;  3N6L A;  2RHS B;  3MUV P;  2RDD A;  1EKR A;  4QYR A;  3SQO P;  2HAI A;  1IM6 A;  3DC2 A;  1FDD A;  1X8D A;  3GE9 A;  5CYQ B;  2CJ9 A;  1JX4 A;  1XR5 A;  2ERR A;  2R2T A;  4DI6 A;  3PX0 A;  2XTJ P;  1VK8 A;  3A8J A;  5C25 B;  2W7P A;  1KD1 T;  1ELO A;  4ZCM A;  4WTO B;  3GCX P;  5MAO A;  4G1Q A;  3UR0 A;  2J6S A;  4DPT A;  4C8L A;  3MEG B;  5JVH Q;  1Z1Z A;  4E8U A;  4A8S A;  1N5T A;  4QZV B;  4WK3 A;  2BDP A;  3TJ9 A;  1UA1 A;  4R5P A;  2JDJ A;  4B3R J;  2HRY A;  2ZD1 A;  4DV2 F;  2JC0 A;  2R8I A;  4G65 A;  1FRJ A;  2ASD A;  2N7C A;  1D09 B;  4HTI A;  2B56 A;  2GHW A;  1JLE A;  4JOU A;  1C1B B;  2Y0S D;  4O44 A;  4Y2I A;  2DRA A;  1HNI A;  1AA1 B;  4CP5 A;  3GLJ A;  2AZ1 A;  1Q8L A;  3JSR A;  4MH8 A;  1WOS A;  3OR2 B;  1WAC A;  5DJB A;  3C2P A;  3QFH A;  3D3B J;  4F3M A;  1R8P A;  1SKU B;  3OTC A;  3DM2 B;  1MRO B;  3JAM U;  5U47 A;  3T19 A;  2MQQ A;  2J0Q D;  3CJQ A;  4CT9 A;  2FIU A;  2E1C A;  4DQS A;  3P8B B;  2EI5 A;  2PDA A;  5DQI A;  4KBI A;  4MKY A;  4OI4 A;  4JI2 J;  1A9N B;  1U0H A;  3BDP A;  1MW7 A;  3ISN D;  3KG1 A;  3RAM A;  2WVC A;  5KFB A;  3O2I A;  3VAI A;  4GKK F;  3UDL A;  3BBB A;  2BRL A;  3MPW A;  2F8E X;  2HWI A;  1F0X A;  3QT8 A;  1S12 A;  4ZP9 A;  4OX7 A;  4XIU A;  1WHW A;  1PJ5 A;  2BE9 B;  4KKO B;  2BMB A;  2VKR A;  1VQL S;  3OT9 A;  5I3U B;  1CPZ A;  3NNC A;  4M5D A;  2HVZ A;  1RSC A;  2OP5 A;  1I5O B;  2ABY A;  3BGF A;  3IR6 B;  4N7T A;  4Q0B A;  4C97 A;  3RBX A;  2KVQ E;  4Y3C A;  4JYA J;  3PYF A;  1Q8B A;  1S1V A;  2HRT A;  4URS A;  3CTR A;  2HVI A;  1XMB A;  4UOF A;  1RWW B;  2OTL S;  3E8O A;  1WEZ A;  3W66 A;  3N28 A;  4DR2 J;  1RTH A;  2C3M A;  3IBW A;  2PE8 A;  5ADZ A;  2GO9 A;  3EDQ B;  2JZ5 A;  1T9X A;  3MM7 A;  4HL9 A;  1HBM B;  2DO4 A;  4G3I A;  4Y2A A;  4RPF A;  1RKI A;  4LF4 J;  4WP3 A;  2BJ8 A;  2QX0 A;  1M1G A;  2AJQ A;  1CS4 A;  1MN7 A;  5T7L A;  2KTQ A;  4IKA A;  1P9Y A;  3M8S A;  4C2M A;  1T9W A;  2EC0 A;  1RQ0 A;  5KFJ A;  1D8Y A;  4PXC A;  4JBC A;  1TL1 A;  4CH1 A;  2R9L A;  3NGT A;  4F67 A;  2HHP A;  2K1R B;  2Z2M A;  1M0S A;  2GHV C;  3A13 A;  2ZOG A;  5DDO C;  2OI2 A;  2ROG A;  3W7B A;  2IIH A;  5F8N A;  2A0F B;  1BQN B;  2PD1 A;  2LCW A;  1SQF A;  1T3O A;  1L3S A;  4KIA A;  2EWH A;  3F56 A;  2DNG A;  1B4S A;  1K1Q A;  3SSS A;  4L3N A;  1N32 F;  3GV7 B;  4PQU B;  4EYI B;  4KHP F;  3M8Q B;  1S79 A;  5FDL B;  2IM3 A;  3CCZ A;  3OD2 A;  4NLY A;  3QJL A;  1RHR B;  3J7Z 5;  2DIV A;  1U1L A;  2C28 A;  2B9E A;  3IO1 A;  1FWL A;  1TU0 B;  2G1H A;  5JUM A;  4W90 B;  2MLZ A;  1HWU A;  3HVA A;  2AD9 A;  3C46 A;  4DR5 F;  4R25 A;  3K5O A;  3JTO A;  3QJJ A;  4I6A A;  2WSF C;  1J5O A;  5D0R A;  3VAG A;  4GO7 X;  4B02 A;  5E3Q A;  3BGU A;  5JVG Q;  2HHW A;  1D9F A;  1VC5 A;  4H4O B;  4RBV A;  2VD3 A;  3QSI A;  3NGK A;  4N41 A;  2UXB J;  1M90 T;  2ZE2 A;  4KHM A;  3ILJ A;  2Q43 A;  2VZ9 A;  2EPI A;  4KHR A;  3GFX A;  4OV6 A;  3OL9 A;  2OPS A;  1RWN B;  3KLI B;  5BXI A;  4ZPW R;  1VQM S;  3W2V B;  1S57 A;  5C2C A;  4PWD B;  3RB0 A;  2AP6 A;  1U1M A;  1PYO B;  2D69 A;  3I6P A;  3OW2 R;  2H5I B;  2C2K B;  5KFZ A;  2CZ9 A;  1I94 F;  2DGS A;  3OTO J;  3TAN A;  1M1K T;  3GJS B;  3DLE A;  2BJD A;  3MI7 X;  3FZ2 A;  2ZVS A;  1WKL A;  2UXC F;  4DZD A;  3HSJ A;  5KG5 A;  1DAX A;  5K9F A;  1YZ7 A;  3VGS A;  1KEK A;  1UVI A;  3PAC A;  3RRG A;  2BJ3 A;  1QVG R;  4C4W A;  3M6U A;  3ZZO A;  4FS1 A;  1KQG B;  4UTG A;  4EI2 A;  4CLF A;  3EM1 A;  3PW2 A;  3Q89 A;  1JLA B;  3BS9 A;  1AW0 A;  5LXR A;  1WC1 A;  4NI2 B;  1RKJ A;  4TVA B;  4TYA A;  4I64 A;  1TKZ A;  3VVU A;  4WKY A;  1SQG A;  3QIP A;  1HBN A;  1AXQ A;  1NHK L;  2JNJ A;  4YUD A;  1UEV A;  2GQ2 A;  5HMZ A;  2GJ2 A;  3DLB A;  1I1G A;  4FPR A;  1SH0 A;  1DZ5 A;  3C8Y A;  4FYV B;  4ED3 A;  1ACM B;  5IV4 A;  1IWA A;  4FNI A;  3PY8 A;  3M8R A;  2XI3 A;  5KT4 A;  2R8H A;  3QRP A;  2CFX A;  2FGO A;  1CQM A;  4X65 J;  4ZLL A;  1X4E A;  3MEG A;  3CW2 C;  1REV A;  5L38 A;  3W5Y A;  2M70 A;  4ZPB A;  2DY1 A;  3IRW P;  3CNQ P;  1WG1 A;  3EGN A;  4ZVO B;  1UFL A;  1T9T A;  4NOH A;  5GAE I;  2AEF A;  4LRD A;  1G4C A;  1S1X B;  1N34 F;  4A8F A;  2XLK A;  4LSL B;  4K2X A;  3ADA C;  3LAL A;  1WC5 A;  2P6S A;  3UI3 A;  4B3S F;  3I55 S;  1X0P A;  3QJP A;  1FK9 B;  1V3Z A;  4F50 A;  4NYZ A;  5T41 A;  4L6V 3;  1ZM9 A;  4OHX A;  3DGV A;  3OR2 A;  1QTM A;  2HBZ B;  3FFI A;  2JSX A;  4DX6 A;  3DM2 A;  1MRO A;  5H9E K;  2F63 A;  4KO0 B;  4K7Q A;  3MM9 B;  3U27 A;  3IBC B;  4JI8 F;  1U25 A;  4DSI A;  3R1H A;  4LJM A;  2DR8 A;  2FLP A;  4C11 A;  1MLA A;  3ET6 B;  3C6T B;  3PW5 A;  1XNQ F;  1B64 A;  1RTD A;  1FRL A;  3KFW X;  3ZZY A;  3TAR A;  3E01 B;  1R6V A;  3HHD A;  3BGO P;  3BO2 A;  4DV4 F;  3QZ7 A;  1GMU A;  2V34 A;  2ZC3 A;  2KHC A;  3Q23 A;  3BSA A;  3QO9 A;  4ED0 A;  2J7K A;  1S6U A;  1RBO B;  4M5J A;  3MWB A;  1WG4 A;  5LL6 d;  2FVQ A;  1HNX J;  1CVJ A;  4NYO A;  3Q86 A;  3AY0 A;  2AGQ A;  2G2Z A;  1AB8 A;  2DIT A;  3B6B A;  2W4D A;  1FKP B;  1RWX B;  1N5Q A;  2XLI A;  2W7A A;  2F1F A;  2VA2 A;  3IXQ A;  2VC1 A;  3WC2 A;  2OEJ A;  4B9S A;  2FJB B;  3WHI A;  1GMW A;  3BR9 A;  5J1P A;  1S0N A;  3NXZ A;  1RAI B;  2CPD A;  2AGO A;  4PEO A;  4L3K A;  3RBD A;  2V4J A;  3EGV A;  2AU0 A;  1TKT A;  2Z57 B;  2ZEJ A;  4JI7 J;  1HBM A;  4LFA F;  4NPO A;  3HT3 A;  1RAO A;  1U6F A;  2Z4P A;  3R5C A;  3GSD A;  4DV3 F;  5J2N B;  3DGP A;  2XHW A;  1RAG B;  3HM9 A;  5E33 A;  2MZJ A;  3PX6 A;  3CIZ A;  2W25 A;  5H9E J;  3M32 B;  4O3O A;  1YJU A;  1GXT A;  4EEY A;  3BO4 A; 
#chains in the Genus database with same CATH homology
 1HKA A;  3HD1 A;  5ETL A;  3UDV A;  5ETT A;  3HSJ A;  3KUH A;  5ETK A;  4CYU A;  3MCM A;  1F9H A;  1RTZ A;  4PZV A;  2BMB A;  5ETO A;  4CWB A;  1RU1 A;  2QX0 A;  3UDE A;  3HSG A;  4M5J A;  3UD5 A;  1Q0N A;  2F63 A;  3HSD A;  1RAO A;  1EX8 A;  2CG8 A;  3HD2 A;  3ILJ A;  1EQ0 A;  3ILL A;  1RB0 A;  4M5M A;  5ETR A;  4CRJ A;  4M5N A;  2F65 A;  3HT0 A;  1DY3 A;  3ILO A;  3HCX A;  1HQ2 A;  1RU2 A;  5ETS A;  5ETN A;  4M5G A;  3HSZ A;  1TMJ A;  1G4C A;  5ETP A;  5ETM A;  5ETQ A;  3MCN A;  4M5I A;  4F7V A;  4M5H A;  1IM6 A;  3MCO A;  3KUE A;  4M5L A;  5ETV A;  1CBK A;  1KBR A;  1EQM A;  1TMM A;  3QBC A;  4CYU B;  4AD6 A;  3KUG A;  3ILI A;  3IP0 A;  4M5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...