3KUEA

Crystal structure of e. coli hppk(e77a)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIALQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Roles of residues E77 and H115 in E. coli HPPK
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
total genus 46
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3kueA00
2BMBA 3MCMA 3HCXA 3MCNA 1RU2A 1F9HA 2CG8A 4F7VA 5ETKA 1HQ2A 3HSGA 1EQMA 3UDEA 1G4CA 5ETVA 5ETOA 1EX8A 4CRJA 1KBRA 3UD5A 1HKAA 3MCOA 1TMJA 1RAOA 3HT0A 3HD1A 1RB0A 3KUEA 4M5KA 4M5IA 5ETTA 5ETPA 4CYUA 1EQ0A 3ILOA 3IP0A 2F63A 2QX0A 1RU1A 1DY3A 3QBCA 3HD2A 3ILIA 3ILJA 4PZVA 3HSZA 3UDVA 5ETNA 5ETMA 4AD6A 3ILLA 3HSJA 4CYUB 3KUGA 1RTZA 2F65A 4M5GA 5ETQA 1TMMA 3KUHA 4M5MA 1IM6A 3HSDA 4M5NA 4CWBA 1CBKA 5ETLA 4M5LA 4M5JA 4M5HA 5ETSA 1Q0NA 5ETRA
chains in the Genus database with same CATH superfamily
4ZK7M 3HCXA 1C0UA 1OY9A 2E44A 2CVIA 4MKAA 3UN5A 4DLGA 4YDDB 3OTBA 2XCPA 2JLGA 3CUNA 1REVB 3JQKA 3MECB 3C14B 4OI3A 4ECSA 3BREA 4URSA 4LF1A 5F0UA 2LU2A 2A2DA 2ZJQQ 3HK2A 1H98A 1IWGA 2LQJA 5C42B 3IP0A 4NLWA 5A76A 1URRA 3H5YA 5FJ4A 1D0EA 1UEVA 1U8SA 3CMES 4NCBA 2H4WB 3HSJA 2IDLA 4AT1B 3V6DB 1FNXH 1H38A 1TL4A 4F0MA 2CPYA 1HBMB 1N34F 3QAUA 1IBMF 1KQGB 1TQLA 4OZLA 1CJKB 2CJBA 4KBIA 4ECYA 2AYBA 1LWXA 1Q8LA 2MJUA 5A6WA 5KFDA 3KDOA 1HQEB 3M8PB 2QL9B 3DYAB 3M1VA 4O0IA 1XR7A 3HVAA 3W61A 2OPQA 2RHQB 3P6YC 3TEGA 2IRYA 3H25A 3FKBA 3DHXA 4IKAA 3IBCB 3GZ7A 3H90A 3K89A 2WZ1A 1NHKL 1UTAA 4GVBB 4CQ1A 2XGQA 5J2MA 1BC6A 2YKMB 4C8NA 4CO2A 5L46A 3OL6A 1IQZA 2NCKL 4JI6F 3W9HA 5IWAF 3GV8B 2DHSA 4DL6A 5J2QB 2FC9A 3I4PA 5L1LA 2QYGA 4FF3A 1K1SA 1RACB 2EW9A 3PJWA 1NDPA 3RR7A 2OPRA 2B6AB 3ZZYA 2ACYA 4Y2AA 3V6HA 2HGNA 2RAQA 2YNIB 3BB5A 2ZHAA 1XK8A 3IMQJ 4EO6A 1I94J 4IG0B 1LFWA 4O3OA 1XNQF 2JVRA 4NLUA 2BJ3A 4LJMA 5CD4A 4FYVB 3KLFB 2ZJPQ 1HNZF 3SDEB 2ZBPA 3TX0A 4MIWA 5KFYA 2CPZA 3EZ5A 4GVBA 5J2MB 4FKXA 4EYHB 1NJIT 3THVA 1Q8KA 2B9YA 2V8HA 3JSYA 1TKXA 2DD8S 3NS7B 4DSJA 3T6BA 2V8DA 2ABYA 2IM0A 2OPQB 2ROGA 3KUEA 3ZFVA 4KO0B 5EUHA 4ED7A 4DV0F 4YFUA 2LQBA 1LW0A 3ZZZA 3C3LA 1XIQA 2GQQA 2NUUG 3MPVA 3CCUS 5KOXA 2VDHA 4A8MP 1GFWB 2NXCA 4U8VA 2IA6A 5LSRA 2Q1LA 3M2VB 4NRTA 5CYQA 3PEJA 4HI2A 1D1UA 4UY8T 2ZZMA 4DPYA 4AL6A 5HO4A 1S97A 3CIMA 4K4WA 2NXUA 1RTIB 4IH6A 1LXNA 3PO4A 1F2GA 2JLFA 3GJRB 2EC0A 4ZKAA 3EGZA 1TL3A 5L39A 3W66A 1U1QA 2ALYB 2CQGA 1U45A 5IWAJ 2CYYA 4B9UA 3VQTA 4MJKA 2MJNA 4URGA 3KOAA 3PEHA 2ZOGA 2XEXA 2ILZA 5F8NA 3OL9A 4WE1A 4KR0B 1PYSB 1HIYA 5AJ3J 2FZKB 3ZTSA 3KLHA 4OHXA 4GVLA 4WK1A 2DNHA 1HNVB 2V69A 3L95X 3TWZA 2W1BA 4C3MA 2EBGA 2CJ9A 2F4FA 4UZCA 4NWBA 2E66A 2HGMA 3RAMA 2MZSA 3BDPA 1I51B 4XAKA 1SCJB 4P7TA 4M5DA 1VQYA 3OUYA 3IWLA 2FY8A 1U2RA 3C16A 3HHLB 1ZETA 1XEZA 4X4VA 3H2UB 1Z1ZA 1K73T 3BPSP 3FRYA 1M90T 1U25A 2PD1A 1M5SA 4C98A 2UUAF 5IZHA 4ETXA 2UXCF 1SQGA 1R0AA 1MROB 3JTPA 2VBYA 5KFUA 1V3RA 5K8MA 3PIPQ 2VHGA 4DJBA 8AT1B 3DN9A 5I4MA 2PMHA 3MAAB 3QJLA 1J27A 2C3MA 4KY3A 1WUUA 4AE5A 3M8SA 3IWXA 2RJZA 3CJQA 2VFVA 1S59A 3BBBA 4JP8A 1YTYA 4NZ6A 2DCUB 3T5LA 1SL2A 2UUCF 1SJQA 2CWKA 3WDOA 4OLOA 3MR5A 1U2CA 4DV2F 2VOPA 3H98A 3Q23A 1D8YA 4OL8A 2P5VA 2OO4A 2OEMA 3QGPA 2FJAB 3DOLB 4FXVA 3UQSA 3DMJA 2K3KA 2KYXA 3OLAA 5L8RC 3AB4B 3MM5B 2H3EB 3NNCA 4J9OA 1X4GA 3CCSS 4K8RA 5B0EA 5IC6B 1R8HA 3FCVA 2FLPA 4C6AA 2CPDA 1WSVA 4A47A 3UDEA 2PSZA 1M0SA 1NKCA 3GJTB 1QD1A 4UT4A 1RWKB 2MY7A 1IQTA 1HW9A 2M8HA 2RH3A 4ZPWR 2EI5A 5BR8F 1JLQA 2MHEA 1AB8A 3NKYA 4MK9A 1B0PA 3CCZA 3TZWA 1OJ4A 2YH1A 4LBHA 1S12A 1WEYA 4QPTA 3DDNA 4QWAA 4ILMA 2HHQA 4LQ3A 5LMUJ 4HYKA 4TYBA 4X64F 4YB1P 4DL7A 1CJUB 1AFJA 1IKYA 4BWJA 1IBKJ 4B3SJ 2HNDB 1HD0A 1UZDA 5KTQA 1HI0P 2DR5A 4K4SA 1A0OB 3MEEA 2X3GA 2KZMA 3KK2B 2GNKA 1LK5A 3N5BA 4Y65A 5ETSA 4DS5A 4CT9A 1U1RA 2D9PA 3HZGA 1MSWD 3FCWA 1ZPWX 4DL4A 4J9VA 2R7VA 2EVZA 2LDYA 1KKHA 3J7Z5 5J1EA 2K3IA 3BO3A 3VAKA 4AL7A 3OSPA 3CW2C 1LW2B 2IMWP 4JOUA 3O3LA 2CNLB 1HNIA 3GYXB 5DO2A 1T11A 3TW0A 3TYTA 3NMAA 4GKKJ 3FQKA 4DV1J 3LAMA 2IDEA 4P10A 2K1RA 2AF6A 1FX2A 1SKUB 2ZUAA 3SQGB 2ZH3A 2FJVA 4PUOA 1RA7A 2OPSA 5HL7Q 3OR2A 3HJFA 2DO4A 3A3PB 1ZA2B 1IJEB 1RT6A 3R27A 3F0NA 4LIWA 3Q8RB 2R7XA 3B82A 2ZDPA 2DTJA 3MI7X 2ERRA 4ECXA 1BWEA 2BW7A 2ZD1B 4OYPA 3BYPA 3KXDA 2LQ9A 3DKDA 3MM5A 4I64A 3H5SA 1FWKA 2DNMA 4KC5A 5JVGQ 3GYNA 4C97A 1RT3A 2VG6A 4DHVA 1TFWA 2I38A 3GWCA 3ETOA 3R5AA 2G0CA 4L3NA 1TTHB 4USUA 5L9NA 3F56A 5JUMA 1FK9A 5FLXY 2Y1IA 2DB1A 3DRRA 4C0OC 3NS6A 1KRPA 3HHKA 1FFWB 2JWNA 2MMYA 3HULA 1UJ5A 2LEBA 2MQ8A 4K4ZA 2PMWA 3ZZPA 1PSDA 4NCGA 1HR0F 3ENVA 4OV6A 1OYEA 2DGQA 3TUIC 4ZVFA 1RWPB 3VGTA 2CJXB 4F4WA 1VRTA 1S76D 5F8MA 1WHYA 4DUYJ 1EETA 1HBNB 1CJUA 3IAS9 5HI7A 4XDDA 2IVYA 4F2SA 4CO1A 1NB2A 5F9NA 1YSJA 2NSBA 4O44B 1YBTA 3P45B 3CCMS 2DNRA 3H2VE 3BJYA 2XB2D 4USHA 4LSLA 1S99A 2DNYA 2GAHC 3BS9A 3AQOA 3G86A 4ANDA 3VZHA 3P4UB 4NZ7A 3U27A 5LJ5Y 2EKYA 3A8IA 1C0TA 4X4NA 5EX0A 1EB0A 2ZH2A 1J2VA 3CCLS 4EK2A 4NLPA 4EUVA 2MY8A 3BKUA 3OLBA 3LWMA 1VFJA 3D2WA 4DZ6A 1NHUA 4DOZA 2AKWB 4J9UE 2GIRA 4FP9A 4I7FA 3Q2TC 3HT0A 3SCIE 3NEKA 3LOUA 2DH7A 4Y34A 3TVKA 3UCGA 2QA4S 3D28A 1RLCL 2YKNA 3UD4P 2AHOB 3H4DA 4RUCA 4S0MA 1R89A 3FNNA 2HURA 2V5HG 1J5EF 4HHJA 4RW4A 4Y00A 3R7NB 2A18A 2K2PA 3GG0A 4IRCA 4Y28C 4IQMA 2KFZA 2MGZA 1T7PA 3U1NA 1T05A 1PAUB 2FY1A 2J8AA 2QL7B 1BQNB 4J9NA 4YR3A 4YR0A 1Q0NA 2HK3A 4NEZA 2MKHA 4BC9A 2E5LF 2KDOA 4IFYA 1RABB 1F5AA 3R3TA 3O6QA 1U1LA 5B0BA 3AXKA 1SVDA 3SCKE 2XQCA 2QMWA 5BYRA 2LVWA 4LF9J 1Q79A 2NXNA 1OIAA 4ZPTR 4USVA 5KFJA 4WU2A 1Q81T 3T1AA 2HHHJ 3BGUA 1S72S 3MD3A 2WOMA 2DR9A 4ZP9A 3GPAA 2VL1A 2ZM6J 1TV6A 3LPYA 4HI1A 3AOBA 5KFFA 2ATLA 1KOHA 1RAEB 2B9WA 4GKJJ 2B8PA 3N6LA 4RNHA 4P52A 2CQ1A 2EFQA 2CZ4A 4KQZA 1MMLA 4AQYF 1ZM4A 3M6WA 1HBUB 1RT5A 5A2QY 3KLEA 1OY6A 4FNIA 3K0JA 1M5HA 1RCOB 4Y2KA 4ECRA 1JNZB 5SZTA 2FHKA 2BW2A 4QOTA 4U6PA 1T9VA 5ETVA 1SIZA 1TVRB 3S1TA 1HNXJ 2F4VJ 3JYTA 2BBEA 2RU9A 5KFNA 4PRFA 2RS8A 1Z2LA 2Z30B 3H59A 2O01C 2HNYB 1PYOB 4NMXA 5HVGA 2RKIB 3I32A 4L74A 4TY8A 3W2WA 1YHQS 4AD6A 1YG0A 1A7GE 1N0VC 3QLHB 1MNEA 5B08A 2FIUA 2KH9A 2ZH7A 4Q44A 3LW5C 4BCAA 4CIOA 2VQFF 2RQCA 2H5EA 8RUCA 1XMQF 1OQ6A 2YKPA 2R8HA 4USMA 2WSEC 4R8UB 1FF2A 4O4GA 1F9EB 1GQEA 1FK9B 2XG8A 3C19A 3ET6A 4ZP7A 5KFTA 2WK4A 1JLEA 4NEYA 4L75A 2LQ8A 1T3OA 1AUSL 2LMIA 4QWCA 2KFYA 2YWEA 4ZVTB 5KFXA 4IH5A 1VQLS 2IJFA 1K47A 2HFNA 2FB0A 3H0PA 2SXLA 4PXEA 4MAKA 2VFSA 4OX8A 2ROEA 3R5BA 2BE7D 3NWGA 4E0DA 1F0XA 1G6BA 1GXLA 2O3DA 2VG5A 1Q16B 3OR2B 5E3RA 1SQFA 2C28A 2RRNA 2BJ7A 3MECA 2KTQA 2YNIA 2VOOA 1RE1B 3A8EA 3CJSA 3PX6A 4IUFA 2GHVC 2Y1JA 3ICLA 4H4OB 2HQFA 1C4AA 3HT3A 4QYZK 1MMNA 1RWNB 4P74A 1W7WA 2J6SA 3TZZA 1Q95G 4DLEA 2B4OA 3M8WA 1NPKA 4ECTA 1SJ4P 4ECVA 1RT1B 4LRDA 3SSQA 2ASJA 1AFIA 5M2UA 2HNZB 3K5OA 1L5UA 2RF2A 3Q83A 4ECWA 3RB4A 3OVBA 4UOCA 2A3JA 4Q7AA 2RRAA 3UD3P 2WSCC 4EU0A 3R5DA 1RB0A 1X4CA 3B78A 3KKFA 5HVFA 4KHPF 4B3SF 4DSIA 3IXQA 1P8GA 1N36F 3I4HX 3J7ZT 4YY3F 5HMZA 2OFGX 2JX2A 3QSYB 4PZVA 4AXJA 3C6UA 3HHLC 1VQNS 3Q89A 1RLDA 4KGKA 4P7VA 2IVFB 3HMJG 1SV5B 4CH7A 1HWJA 3EZUA 4ZMMA 4F02A 4ZVOB 5DG9A 1WI6A 4MKBA 4I69A 4QYRA 1JKHB 4Q45A 1N56A 1RAIB 4YEAA 3D6HB 2R9LA 4JV1A 3FZ2A 4RLEA 5JJBA 1ROFA 2CZVC 1RTJB 4RW9B 3JAMU 3A1YG 2R7WA 4F26A 5DRKA 2XHWA 5AE2A 2ZJRQ 2C3YA 1KP6A 4NL5A 2HQ3A 1RDRA 1S48A 3BZQA 2HWIA 3I5AA 5DJBA 3TJ9A 2NLWA 4ID5B 4CH1A 1N48A 4WK3A 3UN3A 5ITHA 2VH7A 1RT4B 4ZCLA 4DR5J 4MYUA 2OELA 2FGCA 3DGVA 1U24A 2FLLA 1ZM3A 2EFVA 4JI0J 4DV0J 2IY5B 2QMXA 3GQCA 4B9VA 5AXKA 2WONB 1WG4A 3FEYB 2DITA 2C1EB 3CULA 4IR9A 4I67A 1UFLA 2CQBA 3DLJA 4C8OA 3FZBA 1DQ9A 2CWXA 3TJAA 2V2QA 1HWUA 1R8AA 4ZJOA 2UP1A 4N47A 3PW5A 3AD7C 2UVRA 4QIFA 3OTOF 2MLXA 4HKQA 4NLTA 2DNLA 2JSXA 3NBPA 4USWA 3QZ8A 3UW1A 1ZTTA 3GFXA 5C24B 4PWDA 4OJGA 2CQCA 2HG4A 2HFUA 2UUTA 4EYIB 2RIJA 5CZVA 4A8OA 1FERA 3UVJA 2FLOA 2C2NA 2JLEA 2MZQA 4OJ3A 4JI6J 2PA3A 1LKZA 2CUYA 4LRFA 4PQUB 4DR4F 1TV6B 2IVMA 2R7TA 1F5BA 2DBBA 5F8HA 3OBIA 2MZTA 1AT1B 3W65A 2E1MC 4B3TF 1UW4A 4BC7A 1LWEA 2F3JA 4OI1A 1IKXB 2ZH1A 1PAEX 4RPFA 1S1XA 1S9EA 1D8ZA 2GJIA 4YN3B 3VQSA 4CO3A 2VA2A 3BM7A 4OHYA 4EBCA 3OXFA 5IV4A 1O51A 2N7CA 3DM2A 3EGWB 1C1BA 1KLMB 2XTJP 5DDQC 2KXNB 3OJUA 4EBDA 2V9WA 2HQDA 1IBKF 2V0NA 3KG1A 1F6TA 2HQCA 4NI2B 1AROP 3W8PA 4B3OB 2WVEA 3MAAA 1KQFB 4LVOP 5HMWA 1L3KA 2QSFA 2EK6A 2V67A 3GU0A 4RJVA 4JYAF 1CLFA 4M5KA 4OYOA 4UTGA 1RT6B 5IM0A 3E8OA 2W2MP 5L1IA 2MQNA 2RDIA 3ENWA 2DISA 3L4BC 2HYIB 4LF5J 2ZWPA 1OMSA 1QSYA 3PO5A 4LR7A 2BYCA 1DARA 5HROB 2IM3A 1ZPVA 5LSLA 1DFDA 1N5TA 3EZOA 2BJ8A 4RBTA 5KFVA 2IAJA 1OQ3A 1IUJA 2IA0A 4C11A 2CPIA 2DNPA 4HHUA 4P73A 3DLEB 3ZO7A 2BQRA 1NAQA 2QMUB 2HBYB 2R4FA 4ED8A 2M0GB 1ZS6A 4IYQA 4CO5A 4NXNF 4OV1A 1TR0A 4PCQA 3MAHA 5DDPC 3SFUA 1ZH5A 2FDNA 5A6PA 1SKWA 4NCAA 2OPRB 4K7QA 3G6VA 4DV1F 3MURP 4OX7A 1M5PC 3HD2A 1VRQC 3VGVA 2E5IA 4PG5A 4ED5A 4NMLA 4FNHA 5E3CA 4C3LA 3KLGB 1XR6A 4DXLA 4BS2A 2XS7A 2BJ9A 1JLEB 1VQ9S 1RT5B 1A6LA 1Y10A 3CJ3A 1TMMA 2C22A 5D15A 3M2RA 4J7CA 2HHTA 5IQ6A 1VC0A 3G8SA 1QE1B 1HYSB 2E9ZA 2V50A 1NK7A 2RDJA 1FVSA 2W4DA 1PO6A 4B02A 3DLEA 2QA4G 4A8YA 2NR0A 4RBVA 3D1HA 3FDSA 3H7HB 4KO0A 1YJRA 3RB3A 3DOKA 4IO9Q 5HQLA 1R27B 4CI0B 2KZZA 2I2YA 2KRBA 4H4KA 2P6SA 1S49A 3O44A 3OQ2A 1VYAA 1XNRJ 2B56A 3FFIA 4PG4A 2KT3A 5EDWA 1JLCA 3EPGA 1N4LA 3VAMA 4FXDA 3TAMA 3NGSA 2DHGA 4E98A 2ZOFA 2E1CA 1RZMA 3A4TA 4ZP6A 2RU3A 1K8AT 1XJWB 3AB2B 4I56A 3D9BA 4QIGA 4O3QA 4DV4J 3R97A 4PG8A 3MEDA 1CJTB 3U7JA 2UVUA 2HHUA 2V6AA 4XTTA 1XTZA 2DIVA 4M5LA 2Q79A 3OR1A 1S0VA 2D41A 4UQTA 3TA0A 2KXHA 3CIZA 1FWPA 4QYZJ 3OFHA 1ZTWA 1P9YA 2CVEA 2V8PA 1BQMB 4I2QB 4LFCJ 1NSKL 3JAMY 2CRLA 1EKSA 4OLPA 2UZAA 1R8PA 2DVIA 2AYGA 2UUBJ 1DQAA 3TZXA 1V6HA 3P3DA 3TI0A 2JNJA 1HI8A 1BQXA 1RAJA 3CMQA 3P5BP 3R7BB 3LALA 2F40A 2XBPA 4C7QA 2BJ1A 3BGRA 4RUHA 1D9DA 3R2DJ 4CH0S 1WKLA 2H54B 2RNEA 3IS9B 4LSZB 1FXDA 2RUGA 4RW6B 1M5OC 1B3TA 2W2NP 1FXRA 3V81A 4PG7A 4YB6A 1C0TB 1NDLA 4TLRA 4O3RA 4M5MA 1GMWD 2QA1A 4TVAB 4CM0A 3MPDA 2VJUA 4CLSA 4WCEQ 2M88A 1NJXA 3WIUA 1GEHA 4RWXA 1YVFA 1MN7A 3NNAA 1V3SA 2WHOA 1S6PB 5B0FA 1Y3JA 4QQBA 3CDEA 4ENOA 3MR7A 5HN0A 3NLCA 4DR3F 1ZM2A 2KXFA 2FJXA 1T9WA 2QJ3A 3C66A 5ETOA 4YY3J 2AJ0A 1S6QA 3AOAA 2W24A 1VBKA 3KWMA 2HK2A 1CJVA 1ZM9A 1GMWA 2YKNB 3B6BA 3BH7B 3BSAA 3FQLA 2WONA 5KFZA 4DU7A 1RT7A 4OI6A 4ES1A 5GMKa 3ILOA 3AD8C 3DXSX 5DLFA 2BM0A 2VODA 3V2UC 3ILJA 2O66A 3HSZA 3NS5A 1WEZA 5CYJA 1TKTB 3ILLA 5AXNA 3QZ7A 3Q8QB 2VF3A 3HHLD 4ZPDA 4DX5A 4IO1A 1P6TA 2HZCA 1C1CA 2NYIA 1IKVB 2AJ1A 2JJ4D 2B7CB 2BRLA 1MMDA 2GHWA 3AJDA 3AQPA 3HHEA 2ZD1A 3OTCA 4MK8A 4WP3A 5KG6A 1S1TB 3V4IA 1M5VC 2HW3A 2YWFA 2KM8B 3MUMP 3D5MA 2KB2A 3MEGB 1KVJA 4K4YA 4R0EA 1SC6A 3M7VA 3MMBA 3F41A 3S01A 5A0YB 2OMOA 2D74B 3ZTPA 3J81Y 3DLKB 1R6YA 2FJWA 3RRGA 4DQPA 1ZAVA 1VRTB 3PTWA 3VAFA 4K2JA 2LXFA 1E6YB 4X4QA 2Z0GA 1UVKA 4DCOB 3D6MB 3DLBA 5F0WA 4LREA 1HHQA 2MKIA 2AJ2A 2YWWA 3MDFA 4M95A 2YKMA 2DGVA 3K8VA 4ZVSB 3N9UC 3F73A 4ED1A 1H2TZ 3T3FA 3S6EA 3V6KA 4B3TJ 2RE1A 2HPUA 2CJAA 2V2ZA 4YP3A 3MR3A 9ATCB 1IKWA 3NP5A 4U67Q 1WC4A 3ZTOA 4LSNB 4DL3A 4ZLLA 5T41A 3X1LB 3PYGA 3QGIA 3SBMA 4OZJA 4QWBA 5K20B 2FTRA 3OJSA 3KK1A 5I42B 2CDQA 2CPJA 3R5GA 5HMYA 1QE1A 2B5JB 3IBFB 4NASA 4AUKA 2GFFA 2YNFA 1Q53A 5CYMA 3T9ZA 4N5SA 2O67A 4CLYA 1J5OA 2XI3A 1WNEA 2G4BA 1UAWA 3AA9A 2NYHA 3FSYA 4RU9A 2UU9F 1VR6A 1YJ7A 4KRWA 1Z4UA 1YDLA 1RCXB 2K8GA 2AGQA 2C2RA 4NRUA 1SUQB 2D1CA 2Y0SD 4ZCIA 2F5GA 4ELVA 1FKAF 2PN6A 2MHNA 4CYUB 3DU5A 1U0HA 1GTEA 1LFPA 3PCOB 4WJBA 2B51A 3PACA 2QA2A 4J9LA 1U02A 4OX6A 2XLKA 1YJNS 4UF4A 1MLAA 4JB8B 1GX6A 2FHJD 2W01A 4WPAA 4I1TA 4ZCMA 1KD1T 4FKYA 3PYDA 4DSFA 3LTOA 5D6GA 3JTNA 3Q8UA 3KG4A 2QGFB 2DGTA 2B0GA 4HDHA 4O4GB 2CPEA 5CCMA 3D1OA 2W9BA 4DUTA 1VQ4S 2RD5C 1IN0A 3GCWP 3D54A 5M2RA 3MTJA 5B0CA 2JEJA 1I5OB 1SKSA 3JSBA 1UFWA 2VJVA 4FDFA 3BO2A 2J7UA 4RUBA 2HQGA 5A8RB 2FUG9 2U2FA 2BQ3A 3QMQA 3J7YI 3ULHA 2B3TB 2VASA 3IWNC 5IM0B 2V4JA 4CP5A 9RUBA 1PJ5A 3D0IE 3QWUA 4USIA 4CNZA 2CQ3A 4DS4A 3PW4A 1MWZA 4PKDB 1EP4A 2C3OA 1QTNB 2KVIA 4AYBD 2GGPA 2RUSA 4R5PA 1DQ8A 1RQ0A 1KFDA 3FEZA 5E3AA 3WX8A 5F8JA 3K5PA 3KNAA 1N33J 4O3NA 1PGZA 1BY9A 4O4RA 2DPIA 2J7KA 4HLBA 5LM7E 4X4RA 3KLEB 4RNOA 2L41A 4WU3A 2XHCA 2M70A 1EQMA 2ZFHA 1X9WA 2HHHF 3DYAA 1X31C 3D3BJ 3M1VB 4CRJA 1KBRA 3Q86A 3MCOA 4OX9J 1RBAA 3CJRA 4DN0A 5GAGU 3GV7B 2KKHA 3HXMA 2CNKB 1P1TA 3H2LA 3IRXB 2R8IA 1U1KA 1WKKA 3HDSA 4UOGA 1PC5A 2MZRA 3CC2S 3SMZA 5ETNA 1K0VA 1E6VA 4A48A 3L09A 1NJYA 1NH8A 3G6YA 3W8GA 3C46A 4DR4J 2J9CA 2F65A 4ILLA 1B64A 2ILYA 4Q2LA 4BBYA 4JI2J 3BQ2A 1JXLA 1DTQB 3G96A 3EVWA 2QTWA 3NGRA 2ZDOA 4LFAJ 4Z2XA 3SI8A 2W4PA 2MEWA 3FK4A 3JS9A 4NE9C 2VA3A 1QY7A 2LEPA 1HBUA 2BDPA 1MWQA 3C15B 2XO7A 4KT0C 3BGRB 4WIIA 4U7CA 1SH2A 2VPYB 1EARA 2F8HA 3IGVA 2BRKA 3HP6A 1NCLA 4OZ0A 2Y3YA 4RW4B 1TL1A 4OZ5A 2D3ZA 4D3GA 5D0RA 4FS2A 4A8KA 5GAHU 4WBFA 3OFFA 2YNHA 2W2PP 5KFIA 3V5RA 2VONA 2JEFA 3QAEA 1FEHA 1SH3A 2LDIA 3A13A 3NGDA 2LECA 1LXJA 4C2MA 2V2VA 4PXCA 3UO0A 4I2PB 3W62A 4WTOB 3WQPA 4CCHA 1CC7A 1L3UA 4RZRA 4LF5F 4P9SA 4CWBA 3U1MA 3MUVP 1H6KX 2P9CA 2QG9B 4DR2J 2F8EX 2VKRA 4N56A 1DRZA 3AAWB 2R8JA 2WSFC 1WG5A 2Z4PA 2ZHBA 2MQPA 3I0SB 2CNNB 3BKFA 3MF5A 4K4UA 2EG2A 2JC1A 2DH8A 2OPPA 3HVTB 3HI9A 1S79A 3ZZRA 2DO0A 3FJ2A 3OHAA 3H4BA 1JLCB 1GNKA 3U1LA 5KFBA 3C6UB 4MT1A 4UUXA 5KT4A 4LFBF 2VFRA 1R8CA 3PKYA 1YWXA 2Z8QA 3UWTA 1D09B 2YY3A 5D77A 3BF4A 4ECQA 3MR2A 2QIFA 2R3VA 3TVYA 1NK6A 3E2EA 2AQ4A 1WTFA 1EJ7L 1PKUA 1LW0B 3GYGA 1S6OA 3Q0AA 1DZ5A 1B7YB 4DMZA 4ZVEA 4ZS6A 2YNGB 5B09A 1KFSA 2J5AA 4ICLB 4G6VB 3DRRB 3UNYA 4RUAA 4IG0A 1HD1A 1TKXB 5M2PA 5HP1A 1T9TA 1RT3B 2PA8D 3LGMA 4HTIA 5BXIA 3J80U 2B7BB 3SDEA 4QU6A 4NXMF 4DR6F 1EX8A 1NO8A 3BPDA 3M9OB 4B3MJ 4B3RF 2PFDA 1HKAA 2L48A 5U47A 4CLPA 1OWXA 1PJ6A 1S1VA 2I8EA 2MKCA 2WW8A 5CHCB 2AZ1A 5CYMB 5THWA 1BGXT 2DGSA 4F36A 4ZN1A 1REVA 3AOCA 2G9OA 4CDIA 1CC8A 2EFNA 4NLDA 2B6AA 2MSTA 2W2QP 1TUWA 5AXLA 4ELUA 5H1SV 2L9NA 3OL7A 2DPJA 4GKJF 3EGNA 3L3CA 5AE1A 5DDRC 5HSPA 1XBWA 2XNQA 3AODA 4PPDA 2R8KA 3D68A 2R7UA 3CTRA 4ILRA 2AGOA 2XZDB 4DV2J 2AEFA 4HT7A 2PEHA 1HBMA 2VBWA 2BABA 3BQ1A 1RU2A 2QRRA 3QGGA 2MKKA 3KK2A 2XZWA 3OSNA 2Z2ZA 1IBLJ 1TL5A 4A4JA 1CVJA 2N7YA 4RW8A 1E6YA 1HFEL 3ENQA 4EBEA 1UEKA 1HQEA 3LA0A 3M8PA 3J80Y 5KFEA 2YQ1A 1FJ7A 1GX5A 4RR5A 3KJVB 3I5CA 1WWHA 2R7QA 2KYZA 3OFEA 3W9JA 5BR8J 2XMJA 2OIHA 3HVRA 3PRDA 4JV2A 2M52A 1A9NB 2IJRA 2IJNA 2XMTA 3RJMB 3MUTP 2J0XA 3V4MA 1MN9A 2C2ZB 4LT6A 3E01A 2Q6BA 1FD8A 2PT0A 4N8OA 4P2MA 4ANCA 5KFWA 3VVTA 1T05B 3WHIA 4PUOB 2N3OA 3FBCA 1X60A 3FBFA 3NY0A 2J7WA 2D69A 1JLFA 2IC3B 2ZE2A 3DM2B 4MFBA 1H72C 4OHWA 2YH0A 5E7OB 1RGVA 4ZHRB 2AX1A 4TLQA 5LJ3Y 4X4OA 2YNFB 5ETLA 3VHQA 4L3KA 4WKRA 1LWEB 3MMJA 2AEJA 4H4KC 2W8LA 2UVVA 4N41A 4LBPA 5LXYA 5F8IA 5EWFA 2W9AA 3GFZA 1FD2A 3MM9B 4NYOA 5E33A 3RRKA 5L1KA 2DGOA 1YRUA 1VQ7S 1Y00A 3A3OB 2NREA 3MMAA 2H1YA 3FVYA 4Q5VA 1Q82T 2F8MA 3CJKA 4CLWA 5DM6Q 1NMEB 1RAOA 1VGYA 1OSDA 1VJWA 2HFZA 3PM9A 3NCPA 4F4YA 1H3DA 4C8LA 2NXJA 4ZCKA 4BWMA 4F3QA 1JLBB 3JXOA 3SEOA 3DC2A 4NYZA 4MH8A 5J1NA 5H9EK 2BACA 2PI4A 2HZAA 3H5XA 4MTPA 1FTCA 2QLFB 4DL2A 4X62F 2IIHA 5D78A 1QUVA 1ZZFA 4RW6A 5BYSA 3WC2A 1UVMA 4PPZA 4P2FA 2I5JB 3TO8A 1KEKA 3IR5B 4KHMA 4JI4F 4LF4J 1YGYA 2O5DA 1IBCB 1B70B 4LF6F 2BA9A 4WZMA 3SV4A 4MKVA 4B08A 2OFHX 1S5ZA 1RBLA 2L9WA 1Q4RA 2WW4A 4QR2A 3TAQA 1TKTA 2MQLA 4ID5A 1TELA 2AIRB 3GIRA 3KDNA 3LP0A 2BE2B 4DR1J 3PYFA 1NK9A 3POTB 2NS1B 3QT8A 1KOOA 1FE0A 1WORA 3H42A 3H20A 4KV8B 1Y5LB 4K0KF 2ZNZA 1JQGA 4HH1A 2P9EA 3D6FB 2G2OA 1VQSA 2DRAA 2PIIA 4FS1A 3EYZA 2Z58B 4KPCA 4JI2F 2RQ4A 3RBDA 5D3GB 4JYAJ 4MFBB 3K7RA 4ZHRA 3W3SA 4X65F 4KTQA 2XWXA 2DY1A 5E2QA 3HM9A 3EWGA 1TK8A 4EO8A 2ZZNA 2VBXA 2VG7A 2X1GA 1H2VZ 3CEDA 1YQHA 2LA6A 5IT4A 3K57A 4NLGA 3J7AN 4KB7A 1RT2A 3FGVA 3W60A 3D0HE 2WRMA 1SC1B 2HKEA 4M5IA 5EN1A 3M8ZA 4W90B 1S7IA 3HPOA 2RSQA 4B17A 4C9DA 3CJKB 3I6PA 3SZ2A 4ETZA 3WZ0A 1LV5A 1X4DA 4LSNA 4C8YA 2E7XA 1FXLA 2OUGA 1IKWB 4WWSA 3PW7A 1S1UB 4X4UA 1RTZA 3TQEA 3IRWP 5SUHA 2OGUA 1FHTA 1X0PA 3NOCA 1Y5NB 5CQGA 1CS4A 3CD5A 2YTCA 1IBMJ 1NDKA 5HQMA 3IG1A 1VMBA 2R2SA 1U1OA 3QT7A 1RTDA 3QFWA 5AT1B 5F8GA 2IBKA 1RHRB 2VG6B 3OR1B 4QIEA 2VU5A 4M8LA 1G4CA 1X4HA 1BLUA 3BGFA 5C25A 4ZLJA 2VC1A 4XO0A 4FZVA 1SL0A 3QRPA 1L3TA 3D66A 2R2RA 2ZH9A 1XMOF 2WBMA 3Q8YA 3M8RA 1ZAWA 4W92B 3VGUA 2ADBA 4NXMJ 2A1BA 4DR6J 2XCAA 4ED6A 2UU9J 1N0UA 3P5TL 1IKVA 1C2PA 3QATA 1TK0A 2GMHA 3MAQA 1JLGB 3PW0A 3KLIB 4K50A 4ATNA 2DHAA 3CWJA 2RB7A 5HROA 4PYDA 5HANA 5KG5A 1AYEA 3US5A 3EM1A 2RMLA 3DI6B 3KK3A 5JXSA 4OZ1A 1ICEB 2FHOB 4RL1A 2J0WA 4PWWA 1VIOA 3ONQA 3QO9A 1KWMA 4IFVA 3TNVA 4ZA1A 2L3MA 2GJ2A 3FMBA 4TYAA 4ECZA 2KT5A 1NK8A 2CJKA 1RJJA 5C25B 1MROA 1XMOJ 1N32J 1NK4A 2OH2A 4EFAC 5F8LA 1BD6A 2LYVA 2QC3A 2F63A 3AT1B 4F3MA 2IPOB 1KN6A 4B9NA 1UZHA 2G2YA 1NHVA 2POKA 5IQQA 3RBZA 1PCAA 1EIYB 1AZSA 3TUZC 1X0FA 1C1CB 3NGTA 1JLBA 1RISA 4A8XA 4RU2A 4DV5F 1NZAA 3RB0A 1APSA 4P2XA 3HKWA 2DK2A 4DPXA 2VUGA 1FJGF 1C0UB 1SL1A 3CMAS 3VTIA 3T1HF 4FYDA 2BMBA 2DGXA 1HR0J 4ITSA 1RWOB 4KKOB 1YJ9S 2FVQA 3OXLA 1VQPS 4WE1B 4RW7B 2J8SA 5E5NA 1Q7LB 1WOOA 1P9QC 4HH0A 1B0VA 4BHQA 1SI9A 5A8KB 1V5VA 3FCHA 2FLNA 3ITHB 5K8NA 3MD1A 3CNQP 4XK8C 1JX4A 1JLFB 2ZE2B 4KIAA 4UW2A 5KFPA 1IVZA 2BZ2A 2UUWA 3UI3A 1VBXA 1VISA 4JI1J 2DEJA 1CJTA 4J37A 1T9XA 2MQOA 4DV7J 4ER8A 4NLVA 3BYRA 1WSRA 2ZBRA 4EI2A 3CD0A 1N36J 2HLTA 3C8YA 5KFHA 1NU4A 3M2VA 4FBTA 2ROPA 3NOGA 1HQUB 1YK9A 4NA1A 3J81U 3GB0A 4CO0A 3IGNA 3QJPA 2FQQB 2VD3A 4IOAQ 2D9OA 3BSOA 1YJTA 1NJZA 2GQCA 5AJ3F 2XMUA 2DNNA 3EXYA 2QT7A 5A8KA 1SC4B 2XMVA 4KE5A 3RW7A 1LWCA 2NPIA 3W2VB 1U1MA 2CNOB 4NPOA 2DR8A 2EWHA 2JVOA 2QLXA 4I2QA 1Q86T 3X3UA 1DTTA 5FDLA 4LF6J 5KT3A 1W26A 4I68A 3RZAA 2IYIA 5HK4A 4TNOA 4A46A 2DT9A 1OPIA 2VBZA 2WBRA 3CCTA 4OMFG 5G0RB 3RYLA 3SFGA 2HVIA 4AXIA 1RI7A 3LO3A 4HACA 3BKTA 4RBUA 3HVWA 4GO5X 3I87A 3I56S 4JBCA 2EPIA 6AT1B 1T03B 3LGHA 1AZSB 4ALZA 4FF4A 1HWLA 1YJUA 3Q2SC 3SQOP 4ED4A 4F4KA 2BANB 1N32F 3O8WA 2E7VA 3T5KA 3QQCD 1JLAA 5D4NA 4LRAA 2E5JA 3RAQA 3F44A 1HL6A 3QIPA 2CQ0A 3CVKA 2A10A 1FDDA 2MSSA 4DBQA 5A8RA 1M1KT 3DOKB 3GE9A 3WBZA 4GMKA 3ISND 4WFYA 3ZC4A 1YX2A 3CCJS 4P75A 4ZDNA 2F9JA 4OZ2A 1NH7A 1R0BG 1PBUA 5EHHA 4DR5F 3GJSB 4ZJLA 1YITS 1UJ4A 2ATCB 2EK1A 2GIQA 3NG8A 1KVKA 3VAJA 1RT4A 2AU0A 2C3UA 1RWXB 1X5PA 3BR9A 2B9XA 3I5BA 1IM4A 4RKUC 4WYLA 2HHVA 3QRRA 1FKPA 1REGX 5JMNA 4M5NA 4DU8A 1JLGA 1U2FA 3UR0A 2M8DB 4QR1A 1SQEA 2CQ2A 4LQ9A 4RNNA 2GGPB 4R5PB 1UWBA 4F67A 1VRUB 3QT5A 1DLOB 2C2KB 1WELA 4HTJA 4C0BA 5KFMA 4WF9Q 4DQRA 1SC3B 2LU1A 2EEYA 3C14A 4FF1A 1JXVA 5DS7A 4TU7A 1B99A 2AJ4A 4DWIA 1AXQA 1JJHA 2MPUA 1O8BA 2OPSB 2UV8A 3IFEA 3MWBA 1TAQA 3SIPB 1NB7A 3OHBA 3VGSA 1HI1A 1WF1A 4HDGA 5LT5A 4XIUA 2KL8A 3QYYA 3SV3A 3QBCA 4LRBA 4DV6J 2NZ4A 2ZH6A 2N4CA 3QPIA 3W5XA 5DDOC 3VALA 1CS4B 3G2XA 3LP1A 4C3KA 1S1XB 4UZBA 1KC8T 1N88A 1QSLA 2V9KA 1F60B 4DX7A 2NSCA 1QAYA 2AV5A 3N6NA 3QLHA 3L9ZA 1Q5VA 4M1KA 4KHRA 2HNDA 3W5YA 1SXLA 4F7VA 4LF7F 4CLKA 3OTOJ 1WI8A 1Z2ZA 2XSJB 5C2CA 2MKSA 3UPFA 4OYXA 2BANA 5E0OA 1S9GB 4HR2A 3IO1A 4B3MF 1SUQA 2JEIA 1TMJA 1BE4A 2HFOA 4NI2A 2FZCB 4J91A 3R7SB 5A2QU 2X7IA 5KT7A 1FI4A 2XLJA 2HWHA 3MTKA 1OY8A 2CJYB 1X9MA 5H9FJ 3E3XA 4DCJB 3DDKA 4ZJQA 1JWWA 2NZCA 2Z2MA 3HLUA 3VCDA 4DUYF 1TU0B 4JUZA 1V9OA 2HVDA 1RA6A 1ZOTA 1S1WA 3AHPA 4OI2A 1Y5IB 3O1LA 3VZIA 4F2RA 4JI5J 4DFKA 4EEYA 2UXDF 1TZ0A 4DR7J 2QLJB 3B4MA 4QR0A 3MM9A 4L72B 1WF0A 4KV8A 2RS2A 1FKOB 1HNWF 3DMJB 3W2VA 1S6QB 4IH7A 1FTRA 1NK0A 3ET6B 3NL0A 1U0SA 1GK8A 1VHFA 1U48A 1WHVA 3UVJB 3I31A 4KYZA 2FJBB 4X66J 3ZNJ1 4CTAA 1UETA 5HBMA 5AE3A 5EWGA 3FMWA 3PR4A 4I4BA 2R2UA 3CCRS 1HHSA 3MXHP 4LF4F 3G9CA 4QW8A 2DKOB 2CQ4A 2R7RA 1R6VA 2ASYA 2YX4A 3C6TB 1RWWB 2KHDA 4H4MA 4KGMA 1RAGB 1S1WB 4NLRA 1LQ9A 3LH2S 4ELTA 3EUNA 4DV7F 1UP1A 2WVDA 1O5JA 2JOQA 3I0RB 4KGXB 1RAAB 2M2BA 4Y0FA 4WFAQ 3PX4A 2M4MA 3AY0A 2PI5A 2PDAA 3KUHA 3FSIA 1SH0A 2KN4A 3CSKA 3GONA 4IDKB 3NRBA 2GVDB 3W5ZA 1OO0B 3R2CJ 2MYFA 2PO4A 1FEEA 1S7HA 3R1HA 1LK7A 2XSJA 1N5SA 3MCMA 3MM7A 3VR1A 4CTAB 1QM9A 3M9MB 2XY6A 2PE8A 1RAFB 3AA8A 3D3CJ 1HA1A 3GILA 3LGNA 3PXGa 1VOMA 2HHSA 2HSEB 4NZ0A 5E3QA 5IXUA 3D4JA 2QE5A 1HBOB 1WG1A 1YRXA 2RQKA 4GRSA 1JJCB 2G2ZA 4DZDA 4U95A 1VQOS 5LMUF 2EBEA 2H51B 4X4SA 2ALZA 1YIJS 1S1VB 2AT1B 2B43A 1TUGB 2GX8A 4EMDA 4CO4A 4X64J 1TFYA 4K4TA 1N8RT 1SJ1A 2FD2A 3VF0B 5HLFB 1O6XA 2N3LA 2EC2A 2WB1D 3IR7B 4H54A 3TAMB 3D7SB 1RTIA 4E8UA 1ELOA 1PILA 4LUBA 4X62J 3DLHA 5K9FA 5HVHA 3DNCA 4IFYB 4OHVA 1FKPB 4OZNA 4OI4A 2F4VF 3MPWA 1K1QA 1URNA 1WC3A 1BQNA 2GAGC 4EWTA 3K5LA 1VRUA 3N28A 4NCGB 1D9AA 1Y11A 3D67A 2IHR1 3M8YA 4YB7A 3KK3B 4OX9F 1YKWA 2QEXS 1NXIA 2IRUA 4GC7A 1FJCA 2YPYA 3CCWA 1UWAA 2OEKA 4IOBA 5I3UA 2FVPA 5F3ZA 3NCRA 2DNQA 4JI5F 4F25A 2WCXA 5GADI 4IRKA 4WP9A 2CQPA 3K5MA 2P9GA 2E9TA 2H65B 1L3VA 4DQSA 2GS8A 5KFAA 1IXKA 5IOLA 3KLFA 4DV3F 1SIWB 2V8GA 1NUEA 1R7IA 3MMCA 5A8WB 1H7XA 3J81j 4LR9A 4QW9A 4ZLNA 2FVRA 1PYTA 5D4LA 4F04B 3PHEA 1AA1B 4B9LA 5J2PB 4LVNP 3KYLA 3QIPB 1G1XA 2AJQA 5ETRA 3MEDB 3U02A 3TANA 1B7FA 2ZWOA 4I6AA 3LQVA 3CCQS 2HRTA 4QZVB 1WF2A 1XR5A 2VG5B 3MM6A 5D8HB 4WFZA 3TOQA 3PJXA 3KHLA 4ZVPB 2V34A 2XLIA 2PC6A 1RTHB 1H7WA 2E5GA 3EE3A 1Y9OA 1FNOA 4K59A 2HEKA 2WVFA 1T9YA 2Z2LA 2B9EA 4MK7A 2BR0A 1RWUA 4R0JA 1NRKA 4ZITA 1T8EA 2CA9A 1RU1A 3M30B 4HACB 5JVHQ 2YKOA 2G1HA 3KMQA 1GH8A 3EJMA 2CQHA 3KLIA 4PXDA 2YNGA 4OYZA 1N52B 4NA3A 1HW8A 2LXIA 2C2EA 4Q8EA 2C2DA 1VBZA 1KVIA 2W2OP 4P2SA 1BUXA 4V19J 4KGVB 2CG8A 3G82A 3M2RB 2VKZG 5D0EA 3TEHB 3ELHA 1WC1A 1DTQA 3GFYA 2MTLA 2HVHA 1VDHA 3K5NA 2E1PA 2UVWA 3NAIA 2Y8WA 1TKZB 4FYXB 2G0IA 4CNYA 3CXCR 1I3OB 2R42A 4DPTA 2AWZA 4XPCA 2MB0B 1IR2A 3KTQA 1J5OB 3P96A 1HWKA 3I0SA 4NLQA 1XNRF 1VCTA 2JL9A 2OAUA 3OD2A 5LMNJ 3M32A 3MHYA 2H5JB 3RB6A 3OL8A 3OTDA 3UDCA 3C2PA 2HQIA 1FDNA 4IOCQ 3B54A 2ZITA 2Z57B 3CGIA 3TR5A 3OW2R 4K0KJ 1N6QA 3HX9A 2DNZA 1T02A 2A2CA 1VC6A 1KQSR 3QJJA 5E41A 2XY7A 4IRDA 2YBVA 3N79A 4ZPBA 5J1PA 4TKTA 4R25A 3A8JA 3MM7B 1XC9A 3JSMA 5KFOA 1S9EB 1CEZA 4C11B 4JI7F 1IKXA 1LWCB 4RW7A 1RT2B 2GVDA 4L76A 4WKYA 1FRKA 1TL1B 1BHNA 1FJEB 4QCLA 3EDQB 4P6QA 2VC0A 3GSDA 4CLTA 4JI4J 2HHXA 2K06A 3C15A 1VK3A 1OYDA 3JTOA 4C8MA 5KFRA 1N6QB 1MU2A 2DXEA 1N34J 1U4BA 1XNQJ 2ZNYA 4DSLA 3R6GB 1Y0HA 4P71A 4WIQA 4TY9A 3GSIA 1CSJA 1YZ6A 1FWLA 4MYTA 4JI1F 4DCPB 3LPEA 2MQMA 5H9FK 3DI6A 1G3OA 1OS5A 1WC6A 4DR1F 2BXJA 2OEJA 3H5UA 2COLA 4AQYJ 2OI2A 3TX8A 7FDRA 1HQ2A 1Y7PA 4KH1B 3CB4A 2GQ2A 2GHPA 3DXBA 3IRXA 1CJVB 4Q2MA 4USKA 2L08A 1HBOA 3ETMA 5T14A 3E51A 2J6UA 4Y2MA 3LP0B 4G3IA 3MOZA 1HWIA 3R5CA 4FYWB 2PMZD 1FCAA 1Q8BA 2QLWA 4U9RA 1VQ6S 2KM8C 4NOHA 3MGJA 4N8NA 1UA1A 3OXGA 4ZVQB 3KLGA 1VI7A 4ZLPA 2G13A 2VDIA 3RTVA 1DBDA 3GR0A 3SCLE 3G8QA 1KQKA 3AXMA 2AX0A 2BUNA 3LP2A 2AP6A 4J9RA 3EVMA 4QIWD 2DNOA 3IG1B 2KT2A 4DL5A 1R31A 2CZ9A 2ACMA 3IS9A 2OLWA 1MW7A 2KO1A 2YKAA 3AH6A 3MM6B 2BV3A 1H74A 3QRQA 5J2NA 2BE9B 3ADAC 2Y0BB 4UQGA 1FFSB 2GA7A 1NSQA 4J9MA 3CT9A 2BKNA 4KAIA 2R7OA 1KDNA 1FRXA 1UPMB 3CDWA 4ZP8A 5F41A 2IMOA 4YUDA 3GCXP 2C3PA 1GTHA 4KFBB 4CM2A 1EHWA 3JQMA 2W7AA 5D0HA 2Z2YB 2W9BB 4J9SA 2U1AA 4ZIWA 3MEKA 1S1UA 4O23A 3N01A 4IG3A 3TARA 1FE4A 3RUBL 2H48B 2G1DA 5B0DA 2DRBA 4A8FA 3PIOQ 1X4EA 4C48A 5I3UB 3UDLA 3DLLQ 1LWFB 2LA4A 4DSKA 4CLZA 2JC0A 3RR8A 3E01B 5J2NB 1R0CB 2YVSA 3J7A1 2FZGB 4BLGA 5LL6d 3DOMB 2CJQA 2V2KA 5DG8A 4DF8A 5CXTA 1QSSA 1U6FA 1D9FA 3PNIA 2XS2A 2YX7A 3CDBA 4NA2A 3JSRA 1JJ2R 1VK8A 2V8VA 3MCNA 5LOQA 1S10A 4YS2A 2YQ3A 1RWMB 2R2TA 2UXCJ 4QIVA 5DGAA 4X4PA 1FESA 1HNIB 2A0FB 2XSFA 2MXYA 4C8ZA 4IG3B 1J5EJ 3TUPA 3AFGA 2Z56B 5K14A 4M63A 2DHHA 4RNFA 2OD6A 4YHHF 3T5JA 3PYEA 4IQXA 3KJVA 4KHPJ 4L6V3 2HS4A 1LWFA 2QFJA 1RT7B 1F1BB 4IR1A 5KT6A 1RAHB 1Q1KA 4V19X 1HARA 1WACA 3K17A 3M8QA 3M30A 2HMIA 2EKNA 4UY85 3QT6A 1U7LA 3B8HA 3W64A 1VLOA 1F3FA 3HO1A 1CBKA 4MMOA 2BJDA 1N5QA 1HMVB 1VS3A 3GV5B 2EG1A 3O2IA 3LP2B 1RTHA 1ACMB 3UFCX 2BQUA 4EZ6A 4PWDB 4NYPA 1TVRA 3P8BB 2B4VA 2BKPA 4Q43A 5KFSA 1I94F 1B4SA 2AYEA 5DQIA 1EAYC 2HGLA 4ID8A 1KONA 2FVSA 2UV8G 4QJVA 1MU2B 3N0VA 2KJWA 5I3PA 1JK9B 3UD5A 2Y8YA 2XS5A 2H4YB 1S4FA 4WZQA 5ETPA 3I0RA 4ES2A 3PY8A 3BQ0A 2L9DA 1TKDA 3THTA 4DUZF 2Y9HA 1KTVA 2MDAA 2XC9A 4JI8F 1Y4ZB 3GIIA 1Y3KA 3GMGA 4DFPA 3ILIA 3QGHA 1RBOB 1CULA 4LIRA 1GMUA 5GAEU 3IN5A 3POTA 3ENAA 4ZVGA 3JSMB 5KFQA 3HSDA 1MG7A 4CLLA 5I3QA 4B9SA 4YDXA 1GXTA 4G1IA 3B4DA 3GP9A 5IT0A 1HNWJ 2UUBF 3FC9A 1FDAA 3FBEA 2IM1A 3TUJC 4YHHJ 4F4XA 2NUHA 4LFCF 3BN7A 3MCSA 2DR7A 4UOHA 4TY8B 1Q5YA 1SJRA 5IS2A 5LMNF 2XULA 1TL3B 2JFKA 2M5YA 1MWYA 4LF9F 1FNMA 2IM2A 3SXLA 1DURA 1VBYA 1AUDA 5KAKA 3HVTA 4HEA9 2QO3A 2OSQA 1KSPA 2FJEB 4GO7X 2HIYA 3UCZP 1SV5A 1U6BA 2XYHB 4AL5A 4DFMA 2DYAA 1QAJA 3IC1A 3RGIA 3G6ES 6FDRA 2A6OA 2KFNA 3GG1A 3ZXWA 4X2BA 1T03A 3CDAA 3CE8A 3I96A 4F8RA 1U47A 2VFUA 1LNQA 2CPFA 4ED3A 1G2EA 3V81B 1UEUA 4XPEA 3CJ5A 2JEGA 2EXUA 3G87A 1NK5A 2BX6A 4OYIA 4PG6A 3MMAB 4RW8B 5KG7A 2VQFJ 1F9HA 4JI3F 1KS2A 3BBCA 2OKQA 1VIXA 3TZYA 3ISZA 1DTTB 5FDLB 5MLCV 4JI8J 4MKYA 4LBIA 5HATA 4RNMA 3EICA 3M6XA 5FIIA 1JB0C 1KHWA 2DHXA 1XWLA 3DLGA 3LP1B 3QNWB 5ETTA 3DDIA 3T19A 1TK5A 4FF2A 1UVNA 4JV5F 1EP4B 2HAFA 4ZPVR 1RYSA 4LSLB 3BO4A 1T95A 4FYYB 2JZ5A 2BKOA 1NNDA 1BMQB 1QJHA 1YJVA 3PW2A 3PHTA 4F4AA 2GZOA 1WHXA 2KG1A 4QBUA 1WDDA 1X5SA 3DRPA 4DDFA 3RAXA 3NMRA 4G1QA 4FVCA 4A8QA 3DRYA 3M6VA 3DRSA 4FBUA 5HMXA 1I6JA 2QV6A 2N4DA 3MM8B 2ADCA 1TAUA 1T3NA 1AW0A 1TKZA 2KU7A 3CCES 1WHWA 2CXEA 3A8KA 5L1JA 1SJFA 5DQHA 2B4PA 1RHJB 2APOA 3N6MA 3VAHA 2ZVIA 3G82B 3KJNB 4FVMA 4WFNQ 5KG4A 7FD1A 1UW9A 2HBQB 4QU7A 2R7SA 2ZBQA 3ZTRA 2AEMA 3ZZUA 1BXNA 5B0GA 1V5IB 1M5KC 3BR8A 1K44A 3BEGB 5CD4H 2QX0A 2C2MB 4YQWA 1X4BA 2ZC3A 5C5JA 2WTFA 2V4QA 1H2UX 2VPWB 4PEOA 4B9MA 5DQGA 2CG4A 4Z7CA 4Q8FA 3CJ4A 2XY5A 1ULRA 3AD9C 2HLUA 2E5LJ 2E1RA 5CAAA 5HAOA 5T7LB 1CG2A 4OHZA 1X8DA 2G0JA 1ZAXA 5AXMA 1ITPA 3QWPA 2E7WA 3MMCB 2WAQD 2LCWA 4WFXA 5CABA 4C4WA 4DPWA 2FC8A 5GADU 4DV3J 4Y2IA 3NAHA 1FRMA 1LW2A 2XGPA 1HMVA 2ZH8A 2UUAJ 5GVQA 4ANEA 2FGOA 4OQJA 3S8SA 1M1GA 3OTEA 4FPIA 2NPFA 3PR5B 5BJRA 5HP1B 2HS0A 1U49A 3HKZD 2K1RB 4PABA 3SQGA 1YRTA 4QWEA 1VC5A 2B8QA 2OP5A 2P6TA 1NZ8A 3BGLA 2HAIA 4IFVB 4ZPCA 5K5MA 4FN5A 3CDUA 4JV0A 5K8OA 3BGOP 3T9NA 5DETA 2X51A 1TUVA 3OVSA 4N76A 2IAJB 1WOPA 4WXOA 1CJKA 4Y3CA 2VB6A 4UOFA 2AD9A 4Y6IA 5KFKA 4DFJA 2ZBIA 3NGUA 1PG5B 1FRHA 2X1AA 1VQ5S 4LFBJ 2A6MA 2DJWA 4OYWA 3Q24A 4DV4F 4ECUA 4Q0BA 5DG7A 3V6DA 1UVJA 3KLVA 2DGUA 2OJ3A 2CAJA 1DHMA 3DU6A 2PEBA 3RRHA 3D0GE 3RBEA 2V68A 4ES3A 1RHKB 1HQUA 4PAAA 2VV5A 1NDCA 2Q66A 4FPRA 1WD6A 4TQRA 1HNXF 2B5JA 2OHDA 1UWBB 2IFXA 6FD1A 2I0XA 3S7RA 3ISNC 1P27B 2BOAA 1FX4A 2XMMA 4USJC 2HIQA 4YOEA 1EQ0A 1YZ7A 2V63A 3M4XA 5DZ6A 5KT2A 3BSCA 3PVXA 5KFLA 2GCFA 3K58A 4X66F 2MLZA 2CPHA 5HLFA 4OIXA 5EX3A 3ITHA 2GIFA 4U96A 3HJVA 5C2GA 1OSCA 3GIJA 1WOSA 3TA2A 2EFPA 3KG0A 3NXZA 2YNHB 5IV3A 2K7KA 3PX0A 2UXBJ 3I9ZA 4PYAA 1FVQA 1RKJA 1CULB 1TP7A 1RTJA 4RW9A 4M5JA 3DOLA 4K5SA 2BJEA 2W8KA 5H9EJ 3CC7S 3KMSA 2D3OR 2XM3A 5ETKA 1DJ0A 1SBRA 5CH7B 5DM7Q 1RHMB 3CCVS 2CQIA 1T0TV 1F5CA 1WC0A 3MMBB 4CLUA 1S6PA 2K7JA 4I6YA 1KLNA 4LF8F 2J9DA 2LFVA 3NBPB 3THPA 3OPKA 4KH0B 5K8PA 3TQ1A 5C24A 4URQU 1K9MT 1HPZA 2XI2A 2YKQA 2VG7B 3HHDA 4WYWA 3EDRB 4XDCA 1F3VA 1T94A 3G8TA 2D3O1 1KHVA 1JLQB 2DXFA 4CLFA 1VHIA 2YWKA 4BDPA 2RQMA 1IJFB 4ZVUB 1JXEA 1ZZNA 1YJWS 1JMTA 5ETMA 1W2IA 1UKUA 2MKJA 4TU8A 3ZZOA 3FRZA 1NKBA 3GJQB 2VZ9A 1UPPA 3IAM9 1WC5A 2ZKUA 2RHSB 3W9IA 1X9SA 2R8GA 4ZVHA 2FVCA 2XNRA 3M2UA 2Y1RI 3PG9A 5ADZA 3IA0A 4M5DB 4DX8H 2IYGA 1CQNA 3AJ2A 5HBMB 2HRUA 3PKMA 2OMLA 3I82A 1BQMA 4W98A 2DNKA 4DUZJ 2AJFE 2VQEF 1B0TA 5K14B 1ZYQA 1QLNA 3T1YJ 3KLHB 2UUCJ 5B0AA 3DRXA 4ZPAA 1Q7YT 1ZBTA 2HHPA 1RK8A 2GVZA 1WTBA 2YX1A 2M7SA 4C0HA 2XO6A 1KTQA 2W9CB 4X84A 1YBAA 4K4VA 2LEAA 1S9GA 1YLXA 1DY3A 1U0HB 2YWGA 3GLJA 1CQMA 3TRGA 2LKZA 3DOMA 1GMVA 4UUWA 2CKWA 1JKHA 1UFKA 3QIDA 4CZCA 3BV8A 5CA5A 4DQIA 3R6LB 4PR6A 2W25A 2BM1A 4P72A 1PIEA 3CO0P 1S6UA 3SYZA 3K8WA 1UJ6A 4ZN3A 1PC4A 3A12A 3P49B 1UCNA 5CYQB 4ERDA 1S57A 5GAHI 5IT9U 2VQEJ 1LEOA 3BN4A 4JI3J 2C42A 4OYAA 2HBRB 4KKOA 2M9KA 2ZH5A 5I42A 3TP2A 3LUYA 4EGLA 2HNZA 3D1QA 3VAGA 5MAOA 3ZZTA 2F1FA 3CF5Q 2RF2B 4GC6A 2VICA 1S9FA 1QAXA 1S4EA 2FJDB 3WIVA 2ZBCA 2E1AA 4HVZA 4U7UK 4F0HA 2UXBF 1IKYB 3PRVA 2QL5B 2VPZB 2XMKA 3WX4A 2DXDA 3M32B 1K0TA 3G6XA 3Q8PB 5KFGA 1HNZJ 1FRJA 1P1LA 5J2QA 4KPYA 4G65A 4HT5A 2AGPA 5GAEI 5E3PA 1H73A 3QFHA 3DLKA 3T41A 2H9ZA 2YXLA 5T7LA 4ICLA 2JRSA 2PGCA 2HWTA 3G4SS 1X5OA 4Z7YA 3UNGC 4DPUA 4DEZA 4J9QA 5IT9Y 3VAIA 3UCUP 2IRXA 2DH9A 3FFIB 5KFCA 4QWDA 3K2YA 1RADB 3I9V9 2RVJA 2X3DA 1D3WA 1FA0A 3W7BA 4YMEA 3CJ0A 3FBBA 2MGZB 3EXCX 2HVZA 2I1RA 5HJXA 3RW6A 3MFHA 2ASDA 5B7WA 4KGZB 4HL9A 2HRYA 3T5HA 4R8UA 4OJHA 4PXBA 3MM8A 1VQMS 3NCQA 4DG1A 1WDTA 3DRSB 4NLYA 1HYSA 1UL3A 1GT8A 4K2XA 1IM6A 1XN9A 3DRPB 3T6JA 4E2FB 2WVBA 2WB4A 5KG2A 1FO1A 4G1QB 4N7TA 2VIHA 4HHHA 5KOWA 3IBWA 4B3OA 5GMEA 3HFVA 3TVZA 3EGVA 3OVAA 5J2PA 4DQQA 2E29A 2RRBA 2HNYA 4NXNJ 1Q78A 2V94A 4G1PA 1JJ4A 1QVFR 4LMZA 1PJ7A 3PV8A 4F3OA 5C42A 4X4TA 3PRBA 1IR1A 3Q8SB 4O3SA 5J1EB 4YB5A 4ZVRB 2GO9A 1N5VA 1R3NA 4LF2A 4A8WA 4FXWA 3GR1A 4RX6A 1GXUA 1NPRA 4RWWA 3TJ8A 2CFXA 2DGWA 1LOUA 2JHEA 1I1GA 1V3ZA 2HFSA 4JI7J 5KG1A 2D7SA 2QN6B 2JH3A 4PQUA 1O0PA 1C4CA 2D3UA 1IBLF 1RHQB 1UVIA 2Q3PA 2WOMB 1XMQJ 2DRDA 2VPXB 2P8IA 4MIBA 4KSEB 1WEXA 1VQKS 2B4UA 3HZEA 8ATCB 1FRLA 3ZTQA 3UN2A 1W25A 2ZZTA 4IDKA 2O1PA 5CCLA 3HSGA 3JB9k 2MKYA 2YPZA 3PDNA 5G4DA 2GMLA 2ZUGA 1NM2A 1HHTP 2J6TA 1S77D 2ZVSA 2CDRB 2LLZA 2GMJA 2ZHOA 4N77A 1F2HA 2OPPB 5RUBA 1EETB 1HBNA 1X5TA 2X1BA 2OD4A 1H0HB 4K5RA 3EX7B 4C8KA 3SSSA 4CT8A 4OYMA 5DLGA 2W9CA 5DGBA 3TAPA 1SKRA 3RG6A 3MPYA 5GAGI 1X7VA 2OSRA 2AW0A 5FD1A 4DL0C 4B9TA 3FEXB 1QTMA 2QYCA 5ETQA 2Y1LB 1JNRB 4MIAA 3VVUA 3HFZB 2WVCA 5KG3A 1S0OA 1QAIA 3CD6S 2W7PA 4ZOSA 3GTYX 2ZM6F 4J90A 1XQIA 1CPZA 1FT8A 5GMDA 5F3TA 1FKOA 3MZIA 3ZNUA 3ZZ0A 4I7FB 1U1NA 1RWVB 2E5HA 3R9LA 5KT5A 4DX6A 3AJ1A 4J5OA 3SCJE 4DI6A 2J76E 1QDUB 2J9EA 2W4CA 1EZZB 2I9SA 2YQ0A 3KHGA 3PJ9A 2DIUA 3JQJA 4NLSA 4TXSA 3KHRA 2V4JB 3IM9A 4WP8A 4F4ZA 1WJ9A 1SB6A 2DR6A 2HBZB 4ED0A 2J0SD 1ZA1B 4H4MB 3MOJB 3HHLA 4WFBQ 2LP4A 3LANA 4AFFA 5A8WA 4X65J 4J9PA 3KHHA 2VFTA 3BSNA 1IWAA 4JV5J 2EFOA 3A3NB 3FSXA 3L7OA 3OFGA 4O44A 4DN9A 2XMWA 2JDJA 4TN2A 2MZJA 4DR2F 4W4MA 2HHWA 3M8QB 5IC4B 2HMIB 3KNGA 1VJQA 3QO9B 3MEEB 1RUSA 4OZ3A 2HFVA 3UE2A 4D3HA 4I0WA 3H40A 1W2BR 5HJYA 2CADA 1UA0A 4TQSA 1EKRA 4NLOA 1IR0A 3BH6B 4A8SA 1NKEA 1G7CB 2ZEJA 1N5YB 2YWHA 1RT1A 2BVZA 3L7PA 3SSRA 2MZ1A 1S0NA 1NSPA 1WKJA 3R8YA 2AMCB 1F9FA 1HLWA 2BEFA 2KRRA 3R5JB 4CYUA 4J9KA 1KNZA 4U7UD 3DGPB 4OYBA 1TL7A 4V1Ak 2IC3A 4ZIVA 2N82B 4OI0A 1YBUA 2EFGA 2ZKTA 3CO9A 4YR2A 2QSWA 4LR8A 4DSEA 1NPPA 4NX9A 1VLYA 3KJFB 4B3RJ 3OT9A 1UVLA 5EGYA 4U8YA 2LXUA 1U1PA 4NLXA 3VWSA 5L38A 5D3GA 3GIKA 2AZ3A 1UMJA 2CPXA 3TA1A 2XZTB 3IM8A 3W63A 5LXRA 5FLXU 3CJ8A 1YI2S 4EZ9A 2QFIA 1DLOA 1NLKL 1NEEA 5CZXA 1L3SA 3KUGA 4WTYA 2CIMA 4GKKF 3J7YU 1XMBA 2DY9A 2F7VA 1N5YA 2DCLA 2GVZB 4OJ1A 3GIMA 3KK1B 3Q8VA 5D4PA 1RTDB 2FYXA 1C1BB 1KLMA 2FHJA 1TL7B 2OTJS 3RBXA 1SPBP 2ZC4A 4WXWA 2F9DA 4ED2A 2E9RX 5C7PA 3BBFA 4KFBA 3VV2B 3LWLA 3R1LA 2H5IB 2RT3A 2RDDA 1T9UA 4LRCA 4PQAA 3MFIA 2PFFB 4H4OA 1RKIA 3MPUB 2DNGA 3M9NB 3RU0A 4TU9A 2HVEA 2NXEA 3V6JA 4DV5J 1U09A 1QUPA 3G71S 2RKIA 3W2WB 5DZ7A 2I5JA 4DR3J 3LAKA 1SJ3P 1RSCA 1JLAB 1DAXA 4K4XA 3MEGA 3EMTA 5D0GA 3UR3C 3M05A 4M5HA 5A0YA 2MLYA 4F0KA 3L7UA 3W1YC 2GC8A 1RYRA 1NSAA 1VQ8S 1S1TA 3V4IB 1FRIA 3QSIA 2GV1A 3I55S 4O0NA 4Z37A 4OFZA 2DEIA 4DF4A 2BE2A 1X4AA 1PBAA 2KVQE 3DGPA 4USTA 1HNVA 1R43A 1N54B 3HD1A 1E6VB 2KI2A 2I6WA 7AT1B 5IFMA 5G0RA 2IBOA 3CPWR 2LQ5A 2JFDA 1BWVA 3DHWC 4M94A 5F9LA 3EPIA 2X1FA 4Y2CA 3CD7A 2FHMA 1U8WA 3KJQB 3N5FA 2AYMA 3EVOA 3M2UB 2KG0A 4DR7F 4I6WA 2UXDJ 3PFOA 2GJFA 1FDBA 1KR4A 5D4OA 2GO8A 5BYQA 5L9XA 5HQ8A 2ZH4A 3O5TB 4DV6F 1R8BA 2QZ8A 3LF0A 3PFEA 4DPOA 2XMAA 1FJGJ 3CJ2A 3N4WA 2J0QD 3NWRA 1RXOB 5EWEA 2QLBB 3CJTA 5KG0A 3JYTB 3M6UA 3WC0A 3BDEA 3NNHA 4LFAF 3GFHA 4PWUA 2MQQA 3HHNB 1HPZB 4O3PA 2OTLS 1OPZA 1FFGB 2C2OB 2KHCA 4F50A 1QVGR 1M1HA 3H8YA 3PZPA 2P2CB 1U6ZA 1R0AB 2CQDA 4LF7J 1X4FA 2BOPA 2W7OA 3Q22A 3OV7A 2ASLA 2J9DE 2FPHX 1NJWA 1U26A 2Q43A 4I2PA 3T1YF 1RHUB 2HS3A 2M3DA 2XYPB 3HFKA 3UDVA 3D6TB 4DG1B 3DLGB 3C6TA 3IR6B 4LF8J 1NBEB 2KJVA 3OUYB 4Q0BB 4L73A 3T1HJ 3C16B 4QPXA 3MR6A 3HF5A 1GAOA 4M5GA 2XYGB 3FUYA 4JI0F 2NQPA 2Q6CA 4RO0A 3KFWX 3DCAA 1RP5A 2RILA 2XWYA 1S0MA 1N33F 1JIHA 3DFEA 2GW8A 1XERA 3NGKA 5LSOA 2V4RA 2ZOMA 2HZVA 3CC4S 3K59A 4KJIA 1Q8IA
chains in the Genus database with same CATH topology
2BMBA 3MCMA 3HCXA 3MCNA 1RU2A 1F9HA 2CG8A 4F7VA 5ETKA 1HQ2A 3HSGA 1EQMA 3UDEA 1G4CA 5ETVA 5ETOA 1EX8A 4CRJA 1KBRA 3UD5A 1HKAA 3MCOA 1TMJA 1RAOA 3HT0A 3HD1A 1RB0A 3KUEA 4M5KA 4M5IA 5ETTA 5ETPA 4CYUA 1EQ0A 3ILOA 3IP0A 2F63A 2QX0A 1RU1A 1DY3A 3QBCA 3HD2A 3ILIA 3ILJA 4PZVA 3HSZA 3UDVA 5ETNA 5ETMA 4AD6A 3ILLA 3HSJA 4CYUB 3KUGA 1RTZA 2F65A 4M5GA 5ETQA 1TMMA 3KUHA 4M5MA 1IM6A 3HSDA 4M5NA 4CWBA 1CBKA 5ETLA 4M5LA 4M5JA 4M5HA 5ETSA 1Q0NA 5ETRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BMB A;  3MCM A;  3HCX A;  3MCN A;  1RU2 A;  1F9H A;  2CG8 A;  4F7V A;  5ETK A;  1HQ2 A;  3HSG A;  1EQM A;  3UDE A;  1G4C A;  5ETV A;  5ETO A;  1EX8 A;  4CRJ A;  1KBR A;  3UD5 A;  1HKA A;  3MCO A;  1TMJ A;  1RAO A;  3HT0 A;  3HD1 A;  1RB0 A;  3KUE A;  4M5K A;  4M5I A;  5ETT A;  5ETP A;  4CYU A;  1EQ0 A;  3ILO A;  3IP0 A;  2F63 A;  2QX0 A;  1RU1 A;  1DY3 A;  3QBC A;  3HD2 A;  3ILI A;  3ILJ A;  4PZV A;  3HSZ A;  3UDV A;  5ETN A;  5ETM A;  4AD6 A;  3ILL A;  3HSJ A;  4CYU B;  3KUG A;  1RTZ A;  2F65 A;  4M5G A;  5ETQ A;  1TMM A;  3KUH A;  4M5M A;  1IM6 A;  3HSD A;  4M5N A;  4CWB A;  1CBK A;  5ETL A;  4M5L A;  4M5J A;  4M5H A;  5ETS A;  1Q0N A;  5ETR A; 
#chains in the Genus database with same CATH topology
 4ZK7 M;  3HCX A;  1C0U A;  1OY9 A;  2E44 A;  2CVI A;  4MKA A;  3UN5 A;  4DLG A;  4YDD B;  3OTB A;  2XCP A;  2JLG A;  3CUN A;  1REV B;  3JQK A;  3MEC B;  3C14 B;  4OI3 A;  4ECS A;  3BRE A;  4URS A;  4LF1 A;  5F0U A;  2LU2 A;  2A2D A;  2ZJQ Q;  3HK2 A;  1H98 A;  1IWG A;  2LQJ A;  5C42 B;  3IP0 A;  4NLW A;  5A76 A;  1URR A;  3H5Y A;  5FJ4 A;  1D0E A;  1UEV A;  1U8S A;  3CME S;  4NCB A;  2H4W B;  3HSJ A;  2IDL A;  4AT1 B;  3V6D B;  1FNX H;  1H38 A;  1TL4 A;  4F0M A;  2CPY A;  1HBM B;  1N34 F;  3QAU A;  1IBM F;  1KQG B;  1TQL A;  4OZL A;  1CJK B;  2CJB A;  4KBI A;  4ECY A;  2AYB A;  1LWX A;  1Q8L A;  2MJU A;  5A6W A;  5KFD A;  3KDO A;  1HQE B;  3M8P B;  2QL9 B;  3DYA B;  3M1V A;  4O0I A;  1XR7 A;  3HVA A;  3W61 A;  2OPQ A;  2RHQ B;  3P6Y C;  3TEG A;  2IRY A;  3H25 A;  3FKB A;  3DHX A;  4IKA A;  3IBC B;  3GZ7 A;  3H90 A;  3K89 A;  2WZ1 A;  1NHK L;  1UTA A;  4GVB B;  4CQ1 A;  2XGQ A;  5J2M A;  1BC6 A;  2YKM B;  4C8N A;  4CO2 A;  5L46 A;  3OL6 A;  1IQZ A;  2NCK L;  4JI6 F;  3W9H A;  5IWA F;  3GV8 B;  2DHS A;  4DL6 A;  5J2Q B;  2FC9 A;  3I4P A;  5L1L A;  2QYG A;  4FF3 A;  1K1S A;  1RAC B;  2EW9 A;  3PJW A;  1NDP A;  3RR7 A;  2OPR A;  2B6A B;  3ZZY A;  2ACY A;  4Y2A A;  3V6H A;  2HGN A;  2RAQ A;  2YNI B;  3BB5 A;  2ZHA A;  1XK8 A;  3IMQ J;  4EO6 A;  1I94 J;  4IG0 B;  1LFW A;  4O3O A;  1XNQ F;  2JVR A;  4NLU A;  2BJ3 A;  4LJM A;  5CD4 A;  4FYV B;  3KLF B;  2ZJP Q;  1HNZ F;  3SDE B;  2ZBP A;  3TX0 A;  4MIW A;  5KFY A;  2CPZ A;  3EZ5 A;  4GVB A;  5J2M B;  4FKX A;  4EYH B;  1NJI T;  3THV A;  1Q8K A;  2B9Y A;  2V8H A;  3JSY A;  1TKX A;  2DD8 S;  3NS7 B;  4DSJ A;  3T6B A;  2V8D A;  2ABY A;  2IM0 A;  2OPQ B;  2ROG A;  3KUE A;  3ZFV A;  4KO0 B;  5EUH A;  4ED7 A;  4DV0 F;  4YFU A;  2LQB A;  1LW0 A;  3ZZZ A;  3C3L A;  1XIQ A;  2GQQ A;  2NUU G;  3MPV A;  3CCU S;  5KOX A;  2VDH A;  4A8M P;  1GFW B;  2NXC A;  4U8V A;  2IA6 A;  5LSR A;  2Q1L A;  3M2V B;  4NRT A;  5CYQ A;  3PEJ A;  4HI2 A;  1D1U A;  4UY8 T;  2ZZM A;  4DPY A;  4AL6 A;  5HO4 A;  1S97 A;  3CIM A;  4K4W A;  2NXU A;  1RTI B;  4IH6 A;  1LXN A;  3PO4 A;  1F2G A;  2JLF A;  3GJR B;  2EC0 A;  4ZKA A;  3EGZ A;  1TL3 A;  5L39 A;  3W66 A;  1U1Q A;  2ALY B;  2CQG A;  1U45 A;  5IWA J;  2CYY A;  4B9U A;  3VQT A;  4MJK A;  2MJN A;  4URG A;  3KOA A;  3PEH A;  2ZOG A;  2XEX A;  2ILZ A;  5F8N A;  3OL9 A;  4WE1 A;  4KR0 B;  1PYS B;  1HIY A;  5AJ3 J;  2FZK B;  3ZTS A;  3KLH A;  4OHX A;  4GVL A;  4WK1 A;  2DNH A;  1HNV B;  2V69 A;  3L95 X;  3TWZ A;  2W1B A;  4C3M A;  2EBG A;  2CJ9 A;  2F4F A;  4UZC A;  4NWB A;  2E66 A;  2HGM A;  3RAM A;  2MZS A;  3BDP A;  1I51 B;  4XAK A;  1SCJ B;  4P7T A;  4M5D A;  1VQY A;  3OUY A;  3IWL A;  2FY8 A;  1U2R A;  3C16 A;  3HHL B;  1ZET A;  1XEZ A;  4X4V A;  3H2U B;  1Z1Z A;  1K73 T;  3BPS P;  3FRY A;  1M90 T;  1U25 A;  2PD1 A;  1M5S A;  4C98 A;  2UUA F;  5IZH A;  4ETX A;  2UXC F;  1SQG A;  1R0A A;  1MRO B;  3JTP A;  2VBY A;  5KFU A;  1V3R A;  5K8M A;  3PIP Q;  2VHG A;  4DJB A;  8AT1 B;  3DN9 A;  5I4M A;  2PMH A;  3MAA B;  3QJL A;  1J27 A;  2C3M A;  4KY3 A;  1WUU A;  4AE5 A;  3M8S A;  3IWX A;  2RJZ A;  3CJQ A;  2VFV A;  1S59 A;  3BBB A;  4JP8 A;  1YTY A;  4NZ6 A;  2DCU B;  3T5L A;  1SL2 A;  2UUC F;  1SJQ A;  2CWK A;  3WDO A;  4OLO A;  3MR5 A;  1U2C A;  4DV2 F;  2VOP A;  3H98 A;  3Q23 A;  1D8Y A;  4OL8 A;  2P5V A;  2OO4 A;  2OEM A;  3QGP A;  2FJA B;  3DOL B;  4FXV A;  3UQS A;  3DMJ A;  2K3K A;  2KYX A;  3OLA A;  5L8R C;  3AB4 B;  3MM5 B;  2H3E B;  3NNC A;  4J9O A;  1X4G A;  3CCS S;  4K8R A;  5B0E A;  5IC6 B;  1R8H A;  3FCV A;  2FLP A;  4C6A A;  2CPD A;  1WSV A;  4A47 A;  3UDE A;  2PSZ A;  1M0S A;  1NKC A;  3GJT B;  1QD1 A;  4UT4 A;  1RWK B;  2MY7 A;  1IQT A;  1HW9 A;  2M8H A;  2RH3 A;  4ZPW R;  2EI5 A;  5BR8 F;  1JLQ A;  2MHE A;  1AB8 A;  3NKY A;  4MK9 A;  1B0P A;  3CCZ A;  3TZW A;  1OJ4 A;  2YH1 A;  4LBH A;  1S12 A;  1WEY A;  4QPT A;  3DDN A;  4QWA A;  4ILM A;  2HHQ A;  4LQ3 A;  5LMU J;  4HYK A;  4TYB A;  4X64 F;  4YB1 P;  4DL7 A;  1CJU B;  1AFJ A;  1IKY A;  4BWJ A;  1IBK J;  4B3S J;  2HND B;  1HD0 A;  1UZD A;  5KTQ A;  1HI0 P;  2DR5 A;  4K4S A;  1A0O B;  3MEE A;  2X3G A;  2KZM A;  3KK2 B;  2GNK A;  1LK5 A;  3N5B A;  4Y65 A;  5ETS A;  4DS5 A;  4CT9 A;  1U1R A;  2D9P A;  3HZG A;  1MSW D;  3FCW A;  1ZPW X;  4DL4 A;  4J9V A;  2R7V A;  2EVZ A;  2LDY A;  1KKH A;  3J7Z 5;  5J1E A;  2K3I A;  3BO3 A;  3VAK A;  4AL7 A;  3OSP A;  3CW2 C;  1LW2 B;  2IMW P;  4JOU A;  3O3L A;  2CNL B;  1HNI A;  3GYX B;  5DO2 A;  1T11 A;  3TW0 A;  3TYT A;  3NMA A;  4GKK J;  3FQK A;  4DV1 J;  3LAM A;  2IDE A;  4P10 A;  2K1R A;  2AF6 A;  1FX2 A;  1SKU B;  2ZUA A;  3SQG B;  2ZH3 A;  2FJV A;  4PUO A;  1RA7 A;  2OPS A;  5HL7 Q;  3OR2 A;  3HJF A;  2DO4 A;  3A3P B;  1ZA2 B;  1IJE B;  1RT6 A;  3R27 A;  3F0N A;  4LIW A;  3Q8R B;  2R7X A;  3B82 A;  2ZDP A;  2DTJ A;  3MI7 X;  2ERR A;  4ECX A;  1BWE A;  2BW7 A;  2ZD1 B;  4OYP A;  3BYP A;  3KXD A;  2LQ9 A;  3DKD A;  3MM5 A;  4I64 A;  3H5S A;  1FWK A;  2DNM A;  4KC5 A;  5JVG Q;  3GYN A;  4C97 A;  1RT3 A;  2VG6 A;  4DHV A;  1TFW A;  2I38 A;  3GWC A;  3ETO A;  3R5A A;  2G0C A;  4L3N A;  1TTH B;  4USU A;  5L9N A;  3F56 A;  5JUM A;  1FK9 A;  5FLX Y;  2Y1I A;  2DB1 A;  3DRR A;  4C0O C;  3NS6 A;  1KRP A;  3HHK A;  1FFW B;  2JWN A;  2MMY A;  3HUL A;  1UJ5 A;  2LEB A;  2MQ8 A;  4K4Z A;  2PMW A;  3ZZP A;  1PSD A;  4NCG A;  1HR0 F;  3ENV A;  4OV6 A;  1OYE A;  2DGQ A;  3TUI C;  4ZVF A;  1RWP B;  3VGT A;  2CJX B;  4F4W A;  1VRT A;  1S76 D;  5F8M A;  1WHY A;  4DUY J;  1EET A;  1HBN B;  1CJU A;  3IAS 9;  5HI7 A;  4XDD A;  2IVY A;  4F2S A;  4CO1 A;  1NB2 A;  5F9N A;  1YSJ A;  2NSB A;  4O44 B;  1YBT A;  3P45 B;  3CCM S;  2DNR A;  3H2V E;  3BJY A;  2XB2 D;  4USH A;  4LSL A;  1S99 A;  2DNY A;  2GAH C;  3BS9 A;  3AQO A;  3G86 A;  4AND A;  3VZH A;  3P4U B;  4NZ7 A;  3U27 A;  5LJ5 Y;  2EKY A;  3A8I A;  1C0T A;  4X4N A;  5EX0 A;  1EB0 A;  2ZH2 A;  1J2V A;  3CCL S;  4EK2 A;  4NLP A;  4EUV A;  2MY8 A;  3BKU A;  3OLB A;  3LWM A;  1VFJ A;  3D2W A;  4DZ6 A;  1NHU A;  4DOZ A;  2AKW B;  4J9U E;  2GIR A;  4FP9 A;  4I7F A;  3Q2T C;  3HT0 A;  3SCI E;  3NEK A;  3LOU A;  2DH7 A;  4Y34 A;  3TVK A;  3UCG A;  2QA4 S;  3D28 A;  1RLC L;  2YKN A;  3UD4 P;  2AHO B;  3H4D A;  4RUC A;  4S0M A;  1R89 A;  3FNN A;  2HUR A;  2V5H G;  1J5E F;  4HHJ A;  4RW4 A;  4Y00 A;  3R7N B;  2A18 A;  2K2P A;  3GG0 A;  4IRC A;  4Y28 C;  4IQM A;  2KFZ A;  2MGZ A;  1T7P A;  3U1N A;  1T05 A;  1PAU B;  2FY1 A;  2J8A A;  2QL7 B;  1BQN B;  4J9N A;  4YR3 A;  4YR0 A;  1Q0N A;  2HK3 A;  4NEZ A;  2MKH A;  4BC9 A;  2E5L F;  2KDO A;  4IFY A;  1RAB B;  1F5A A;  3R3T A;  3O6Q A;  1U1L A;  5B0B A;  3AXK A;  1SVD A;  3SCK E;  2XQC A;  2QMW A;  5BYR A;  2LVW A;  4LF9 J;  1Q79 A;  2NXN A;  1OIA A;  4ZPT R;  4USV A;  5KFJ A;  4WU2 A;  1Q81 T;  3T1A A;  2HHH J;  3BGU A;  1S72 S;  3MD3 A;  2WOM A;  2DR9 A;  4ZP9 A;  3GPA A;  2VL1 A;  2ZM6 J;  1TV6 A;  3LPY A;  4HI1 A;  3AOB A;  5KFF A;  2ATL A;  1KOH A;  1RAE B;  2B9W A;  4GKJ J;  2B8P A;  3N6L A;  4RNH A;  4P52 A;  2CQ1 A;  2EFQ A;  2CZ4 A;  4KQZ A;  1MML A;  4AQY F;  1ZM4 A;  3M6W A;  1HBU B;  1RT5 A;  5A2Q Y;  3KLE A;  1OY6 A;  4FNI A;  3K0J A;  1M5H A;  1RCO B;  4Y2K A;  4ECR A;  1JNZ B;  5SZT A;  2FHK A;  2BW2 A;  4QOT A;  4U6P A;  1T9V A;  5ETV A;  1SIZ A;  1TVR B;  3S1T A;  1HNX J;  2F4V J;  3JYT A;  2BBE A;  2RU9 A;  5KFN A;  4PRF A;  2RS8 A;  1Z2L A;  2Z30 B;  3H59 A;  2O01 C;  2HNY B;  1PYO B;  4NMX A;  5HVG A;  2RKI B;  3I32 A;  4L74 A;  4TY8 A;  3W2W A;  1YHQ S;  4AD6 A;  1YG0 A;  1A7G E;  1N0V C;  3QLH B;  1MNE A;  5B08 A;  2FIU A;  2KH9 A;  2ZH7 A;  4Q44 A;  3LW5 C;  4BCA A;  4CIO A;  2VQF F;  2RQC A;  2H5E A;  8RUC A;  1XMQ F;  1OQ6 A;  2YKP A;  2R8H A;  4USM A;  2WSE C;  4R8U B;  1FF2 A;  4O4G A;  1F9E B;  1GQE A;  1FK9 B;  2XG8 A;  3C19 A;  3ET6 A;  4ZP7 A;  5KFT A;  2WK4 A;  1JLE A;  4NEY A;  4L75 A;  2LQ8 A;  1T3O A;  1AUS L;  2LMI A;  4QWC A;  2KFY A;  2YWE A;  4ZVT B;  5KFX A;  4IH5 A;  1VQL S;  2IJF A;  1K47 A;  2HFN A;  2FB0 A;  3H0P A;  2SXL A;  4PXE A;  4MAK A;  2VFS A;  4OX8 A;  2ROE A;  3R5B A;  2BE7 D;  3NWG A;  4E0D A;  1F0X A;  1G6B A;  1GXL A;  2O3D A;  2VG5 A;  1Q16 B;  3OR2 B;  5E3R A;  1SQF A;  2C28 A;  2RRN A;  2BJ7 A;  3MEC A;  2KTQ A;  2YNI A;  2VOO A;  1RE1 B;  3A8E A;  3CJS A;  3PX6 A;  4IUF A;  2GHV C;  2Y1J A;  3ICL A;  4H4O B;  2HQF A;  1C4A A;  3HT3 A;  4QYZ K;  1MMN A;  1RWN B;  4P74 A;  1W7W A;  2J6S A;  3TZZ A;  1Q95 G;  4DLE A;  2B4O A;  3M8W A;  1NPK A;  4ECT A;  1SJ4 P;  4ECV A;  1RT1 B;  4LRD A;  3SSQ A;  2ASJ A;  1AFI A;  5M2U A;  2HNZ B;  3K5O A;  1L5U A;  2RF2 A;  3Q83 A;  4ECW A;  3RB4 A;  3OVB A;  4UOC A;  2A3J A;  4Q7A A;  2RRA A;  3UD3 P;  2WSC C;  4EU0 A;  3R5D A;  1RB0 A;  1X4C A;  3B78 A;  3KKF A;  5HVF A;  4KHP F;  4B3S F;  4DSI A;  3IXQ A;  1P8G A;  1N36 F;  3I4H X;  3J7Z T;  4YY3 F;  5HMZ A;  2OFG X;  2JX2 A;  3QSY B;  4PZV A;  4AXJ A;  3C6U A;  3HHL C;  1VQN S;  3Q89 A;  1RLD A;  4KGK A;  4P7V A;  2IVF B;  3HMJ G;  1SV5 B;  4CH7 A;  1HWJ A;  3EZU A;  4ZMM A;  4F02 A;  4ZVO B;  5DG9 A;  1WI6 A;  4MKB A;  4I69 A;  4QYR A;  1JKH B;  4Q45 A;  1N56 A;  1RAI B;  4YEA A;  3D6H B;  2R9L A;  4JV1 A;  3FZ2 A;  4RLE A;  5JJB A;  1ROF A;  2CZV C;  1RTJ B;  4RW9 B;  3JAM U;  3A1Y G;  2R7W A;  4F26 A;  5DRK A;  2XHW A;  5AE2 A;  2ZJR Q;  2C3Y A;  1KP6 A;  4NL5 A;  2HQ3 A;  1RDR A;  1S48 A;  3BZQ A;  2HWI A;  3I5A A;  5DJB A;  3TJ9 A;  2NLW A;  4ID5 B;  4CH1 A;  1N48 A;  4WK3 A;  3UN3 A;  5ITH A;  2VH7 A;  1RT4 B;  4ZCL A;  4DR5 J;  4MYU A;  2OEL A;  2FGC A;  3DGV A;  1U24 A;  2FLL A;  1ZM3 A;  2EFV A;  4JI0 J;  4DV0 J;  2IY5 B;  2QMX A;  3GQC A;  4B9V A;  5AXK A;  2WON B;  1WG4 A;  3FEY B;  2DIT A;  2C1E B;  3CUL A;  4IR9 A;  4I67 A;  1UFL A;  2CQB A;  3DLJ A;  4C8O A;  3FZB A;  1DQ9 A;  2CWX A;  3TJA A;  2V2Q A;  1HWU A;  1R8A A;  4ZJO A;  2UP1 A;  4N47 A;  3PW5 A;  3AD7 C;  2UVR A;  4QIF A;  3OTO F;  2MLX A;  4HKQ A;  4NLT A;  2DNL A;  2JSX A;  3NBP A;  4USW A;  3QZ8 A;  3UW1 A;  1ZTT A;  3GFX A;  5C24 B;  4PWD A;  4OJG A;  2CQC A;  2HG4 A;  2HFU A;  2UUT A;  4EYI B;  2RIJ A;  5CZV A;  4A8O A;  1FER A;  3UVJ A;  2FLO A;  2C2N A;  2JLE A;  2MZQ A;  4OJ3 A;  4JI6 J;  2PA3 A;  1LKZ A;  2CUY A;  4LRF A;  4PQU B;  4DR4 F;  1TV6 B;  2IVM A;  2R7T A;  1F5B A;  2DBB A;  5F8H A;  3OBI A;  2MZT A;  1AT1 B;  3W65 A;  2E1M C;  4B3T F;  1UW4 A;  4BC7 A;  1LWE A;  2F3J A;  4OI1 A;  1IKX B;  2ZH1 A;  1PAE X;  4RPF A;  1S1X A;  1S9E A;  1D8Z A;  2GJI A;  4YN3 B;  3VQS A;  4CO3 A;  2VA2 A;  3BM7 A;  4OHY A;  4EBC A;  3OXF A;  5IV4 A;  1O51 A;  2N7C A;  3DM2 A;  3EGW B;  1C1B A;  1KLM B;  2XTJ P;  5DDQ C;  2KXN B;  3OJU A;  4EBD A;  2V9W A;  2HQD A;  1IBK F;  2V0N A;  3KG1 A;  1F6T A;  2HQC A;  4NI2 B;  1ARO P;  3W8P A;  4B3O B;  2WVE A;  3MAA A;  1KQF B;  4LVO P;  5HMW A;  1L3K A;  2QSF A;  2EK6 A;  2V67 A;  3GU0 A;  4RJV A;  4JYA F;  1CLF A;  4M5K A;  4OYO A;  4UTG A;  1RT6 B;  5IM0 A;  3E8O A;  2W2M P;  5L1I A;  2MQN A;  2RDI A;  3ENW A;  2DIS A;  3L4B C;  2HYI B;  4LF5 J;  2ZWP A;  1OMS A;  1QSY A;  3PO5 A;  4LR7 A;  2BYC A;  1DAR A;  5HRO B;  2IM3 A;  1ZPV A;  5LSL A;  1DFD A;  1N5T A;  3EZO A;  2BJ8 A;  4RBT A;  5KFV A;  2IAJ A;  1OQ3 A;  1IUJ A;  2IA0 A;  4C11 A;  2CPI A;  2DNP A;  4HHU A;  4P73 A;  3DLE B;  3ZO7 A;  2BQR A;  1NAQ A;  2QMU B;  2HBY B;  2R4F A;  4ED8 A;  2M0G B;  1ZS6 A;  4IYQ A;  4CO5 A;  4NXN F;  4OV1 A;  1TR0 A;  4PCQ A;  3MAH A;  5DDP C;  3SFU A;  1ZH5 A;  2FDN A;  5A6P A;  1SKW A;  4NCA A;  2OPR B;  4K7Q A;  3G6V A;  4DV1 F;  3MUR P;  4OX7 A;  1M5P C;  3HD2 A;  1VRQ C;  3VGV A;  2E5I A;  4PG5 A;  4ED5 A;  4NML A;  4FNH A;  5E3C A;  4C3L A;  3KLG B;  1XR6 A;  4DXL A;  4BS2 A;  2XS7 A;  2BJ9 A;  1JLE B;  1VQ9 S;  1RT5 B;  1A6L A;  1Y10 A;  3CJ3 A;  1TMM A;  2C22 A;  5D15 A;  3M2R A;  4J7C A;  2HHT A;  5IQ6 A;  1VC0 A;  3G8S A;  1QE1 B;  1HYS B;  2E9Z A;  2V50 A;  1NK7 A;  2RDJ A;  1FVS A;  2W4D A;  1PO6 A;  4B02 A;  3DLE A;  2QA4 G;  4A8Y A;  2NR0 A;  4RBV A;  3D1H A;  3FDS A;  3H7H B;  4KO0 A;  1YJR A;  3RB3 A;  3DOK A;  4IO9 Q;  5HQL A;  1R27 B;  4CI0 B;  2KZZ A;  2I2Y A;  2KRB A;  4H4K A;  2P6S A;  1S49 A;  3O44 A;  3OQ2 A;  1VYA A;  1XNR J;  2B56 A;  3FFI A;  4PG4 A;  2KT3 A;  5EDW A;  1JLC A;  3EPG A;  1N4L A;  3VAM A;  4FXD A;  3TAM A;  3NGS A;  2DHG A;  4E98 A;  2ZOF A;  2E1C A;  1RZM A;  3A4T A;  4ZP6 A;  2RU3 A;  1K8A T;  1XJW B;  3AB2 B;  4I56 A;  3D9B A;  4QIG A;  4O3Q A;  4DV4 J;  3R97 A;  4PG8 A;  3MED A;  1CJT B;  3U7J A;  2UVU A;  2HHU A;  2V6A A;  4XTT A;  1XTZ A;  2DIV A;  4M5L A;  2Q79 A;  3OR1 A;  1S0V A;  2D41 A;  4UQT A;  3TA0 A;  2KXH A;  3CIZ A;  1FWP A;  4QYZ J;  3OFH A;  1ZTW A;  1P9Y A;  2CVE A;  2V8P A;  1BQM B;  4I2Q B;  4LFC J;  1NSK L;  3JAM Y;  2CRL A;  1EKS A;  4OLP A;  2UZA A;  1R8P A;  2DVI A;  2AYG A;  2UUB J;  1DQA A;  3TZX A;  1V6H A;  3P3D A;  3TI0 A;  2JNJ A;  1HI8 A;  1BQX A;  1RAJ A;  3CMQ A;  3P5B P;  3R7B B;  3LAL A;  2F40 A;  2XBP A;  4C7Q A;  2BJ1 A;  3BGR A;  4RUH A;  1D9D A;  3R2D J;  4CH0 S;  1WKL A;  2H54 B;  2RNE A;  3IS9 B;  4LSZ B;  1FXD A;  2RUG A;  4RW6 B;  1M5O C;  1B3T A;  2W2N P;  1FXR A;  3V81 A;  4PG7 A;  4YB6 A;  1C0T B;  1NDL A;  4TLR A;  4O3R A;  4M5M A;  1GMW D;  2QA1 A;  4TVA B;  4CM0 A;  3MPD A;  2VJU A;  4CLS A;  4WCE Q;  2M88 A;  1NJX A;  3WIU A;  1GEH A;  4RWX A;  1YVF A;  1MN7 A;  3NNA A;  1V3S A;  2WHO A;  1S6P B;  5B0F A;  1Y3J A;  4QQB A;  3CDE A;  4ENO A;  3MR7 A;  5HN0 A;  3NLC A;  4DR3 F;  1ZM2 A;  2KXF A;  2FJX A;  1T9W A;  2QJ3 A;  3C66 A;  5ETO A;  4YY3 J;  2AJ0 A;  1S6Q A;  3AOA A;  2W24 A;  1VBK A;  3KWM A;  2HK2 A;  1CJV A;  1ZM9 A;  1GMW A;  2YKN B;  3B6B A;  3BH7 B;  3BSA A;  3FQL A;  2WON A;  5KFZ A;  4DU7 A;  1RT7 A;  4OI6 A;  4ES1 A;  5GMK a;  3ILO A;  3AD8 C;  3DXS X;  5DLF A;  2BM0 A;  2VOD A;  3V2U C;  3ILJ A;  2O66 A;  3HSZ A;  3NS5 A;  1WEZ A;  5CYJ A;  1TKT B;  3ILL A;  5AXN A;  3QZ7 A;  3Q8Q B;  2VF3 A;  3HHL D;  4ZPD A;  4DX5 A;  4IO1 A;  1P6T A;  2HZC A;  1C1C A;  2NYI A;  1IKV B;  2AJ1 A;  2JJ4 D;  2B7C B;  2BRL A;  1MMD A;  2GHW A;  3AJD A;  3AQP A;  3HHE A;  2ZD1 A;  3OTC A;  4MK8 A;  4WP3 A;  5KG6 A;  1S1T B;  3V4I A;  1M5V C;  2HW3 A;  2YWF A;  2KM8 B;  3MUM P;  3D5M A;  2KB2 A;  3MEG B;  1KVJ A;  4K4Y A;  4R0E A;  1SC6 A;  3M7V A;  3MMB A;  3F41 A;  3S01 A;  5A0Y B;  2OMO A;  2D74 B;  3ZTP A;  3J81 Y;  3DLK B;  1R6Y A;  2FJW A;  3RRG A;  4DQP A;  1ZAV A;  1VRT B;  3PTW A;  3VAF A;  4K2J A;  2LXF A;  1E6Y B;  4X4Q A;  2Z0G A;  1UVK A;  4DCO B;  3D6M B;  3DLB A;  5F0W A;  4LRE A;  1HHQ A;  2MKI A;  2AJ2 A;  2YWW A;  3MDF A;  4M95 A;  2YKM A;  2DGV A;  3K8V A;  4ZVS B;  3N9U C;  3F73 A;  4ED1 A;  1H2T Z;  3T3F A;  3S6E A;  3V6K A;  4B3T J;  2RE1 A;  2HPU A;  2CJA A;  2V2Z A;  4YP3 A;  3MR3 A;  9ATC B;  1IKW A;  3NP5 A;  4U67 Q;  1WC4 A;  3ZTO A;  4LSN B;  4DL3 A;  4ZLL A;  5T41 A;  3X1L B;  3PYG A;  3QGI A;  3SBM A;  4OZJ A;  4QWB A;  5K20 B;  2FTR A;  3OJS A;  3KK1 A;  5I42 B;  2CDQ A;  2CPJ A;  3R5G A;  5HMY A;  1QE1 A;  2B5J B;  3IBF B;  4NAS A;  4AUK A;  2GFF A;  2YNF A;  1Q53 A;  5CYM A;  3T9Z A;  4N5S A;  2O67 A;  4CLY A;  1J5O A;  2XI3 A;  1WNE A;  2G4B A;  1UAW A;  3AA9 A;  2NYH A;  3FSY A;  4RU9 A;  2UU9 F;  1VR6 A;  1YJ7 A;  4KRW A;  1Z4U A;  1YDL A;  1RCX B;  2K8G A;  2AGQ A;  2C2R A;  4NRU A;  1SUQ B;  2D1C A;  2Y0S D;  4ZCI A;  2F5G A;  4ELV A;  1FKA F;  2PN6 A;  2MHN A;  4CYU B;  3DU5 A;  1U0H A;  1GTE A;  1LFP A;  3PCO B;  4WJB A;  2B51 A;  3PAC A;  2QA2 A;  4J9L A;  1U02 A;  4OX6 A;  2XLK A;  1YJN S;  4UF4 A;  1MLA A;  4JB8 B;  1GX6 A;  2FHJ D;  2W01 A;  4WPA A;  4I1T A;  4ZCM A;  1KD1 T;  4FKY A;  3PYD A;  4DSF A;  3LTO A;  5D6G A;  3JTN A;  3Q8U A;  3KG4 A;  2QGF B;  2DGT A;  2B0G A;  4HDH A;  4O4G B;  2CPE A;  5CCM A;  3D1O A;  2W9B A;  4DUT A;  1VQ4 S;  2RD5 C;  1IN0 A;  3GCW P;  3D54 A;  5M2R A;  3MTJ A;  5B0C A;  2JEJ A;  1I5O B;  1SKS A;  3JSB A;  1UFW A;  2VJV A;  4FDF A;  3BO2 A;  2J7U A;  4RUB A;  2HQG A;  5A8R B;  2FUG 9;  2U2F A;  2BQ3 A;  3QMQ A;  3J7Y I;  3ULH A;  2B3T B;  2VAS A;  3IWN C;  5IM0 B;  2V4J A;  4CP5 A;  9RUB A;  1PJ5 A;  3D0I E;  3QWU A;  4USI A;  4CNZ A;  2CQ3 A;  4DS4 A;  3PW4 A;  1MWZ A;  4PKD B;  1EP4 A;  2C3O A;  1QTN B;  2KVI A;  4AYB D;  2GGP A;  2RUS A;  4R5P A;  1DQ8 A;  1RQ0 A;  1KFD A;  3FEZ A;  5E3A A;  3WX8 A;  5F8J A;  3K5P A;  3KNA A;  1N33 J;  4O3N A;  1PGZ A;  1BY9 A;  4O4R A;  2DPI A;  2J7K A;  4HLB A;  5LM7 E;  4X4R A;  3KLE B;  4RNO A;  2L41 A;  4WU3 A;  2XHC A;  2M70 A;  1EQM A;  2ZFH A;  1X9W A;  2HHH F;  3DYA A;  1X31 C;  3D3B J;  3M1V B;  4CRJ A;  1KBR A;  3Q86 A;  3MCO A;  4OX9 J;  1RBA A;  3CJR A;  4DN0 A;  5GAG U;  3GV7 B;  2KKH A;  3HXM A;  2CNK B;  1P1T A;  3H2L A;  3IRX B;  2R8I A;  1U1K A;  1WKK A;  3HDS A;  4UOG A;  1PC5 A;  2MZR A;  3CC2 S;  3SMZ A;  5ETN A;  1K0V A;  1E6V A;  4A48 A;  3L09 A;  1NJY A;  1NH8 A;  3G6Y A;  3W8G A;  3C46 A;  4DR4 J;  2J9C A;  2F65 A;  4ILL A;  1B64 A;  2ILY A;  4Q2L A;  4BBY A;  4JI2 J;  3BQ2 A;  1JXL A;  1DTQ B;  3G96 A;  3EVW A;  2QTW A;  3NGR A;  2ZDO A;  4LFA J;  4Z2X A;  3SI8 A;  2W4P A;  2MEW A;  3FK4 A;  3JS9 A;  4NE9 C;  2VA3 A;  1QY7 A;  2LEP A;  1HBU A;  2BDP A;  1MWQ A;  3C15 B;  2XO7 A;  4KT0 C;  3BGR B;  4WII A;  4U7C A;  1SH2 A;  2VPY B;  1EAR A;  2F8H A;  3IGV A;  2BRK A;  3HP6 A;  1NCL A;  4OZ0 A;  2Y3Y A;  4RW4 B;  1TL1 A;  4OZ5 A;  2D3Z A;  4D3G A;  5D0R A;  4FS2 A;  4A8K A;  5GAH U;  4WBF A;  3OFF A;  2YNH A;  2W2P P;  5KFI A;  3V5R A;  2VON A;  2JEF A;  3QAE A;  1FEH A;  1SH3 A;  2LDI A;  3A13 A;  3NGD A;  2LEC A;  1LXJ A;  4C2M A;  2V2V A;  4PXC A;  3UO0 A;  4I2P B;  3W62 A;  4WTO B;  3WQP A;  4CCH A;  1CC7 A;  1L3U A;  4RZR A;  4LF5 F;  4P9S A;  4CWB A;  3U1M A;  3MUV P;  1H6K X;  2P9C A;  2QG9 B;  4DR2 J;  2F8E X;  2VKR A;  4N56 A;  1DRZ A;  3AAW B;  2R8J A;  2WSF C;  1WG5 A;  2Z4P A;  2ZHB A;  2MQP A;  3I0S B;  2CNN B;  3BKF A;  3MF5 A;  4K4U A;  2EG2 A;  2JC1 A;  2DH8 A;  2OPP A;  3HVT B;  3HI9 A;  1S79 A;  3ZZR A;  2DO0 A;  3FJ2 A;  3OHA A;  3H4B A;  1JLC B;  1GNK A;  3U1L A;  5KFB A;  3C6U B;  4MT1 A;  4UUX A;  5KT4 A;  4LFB F;  2VFR A;  1R8C A;  3PKY A;  1YWX A;  2Z8Q A;  3UWT A;  1D09 B;  2YY3 A;  5D77 A;  3BF4 A;  4ECQ A;  3MR2 A;  2QIF A;  2R3V A;  3TVY A;  1NK6 A;  3E2E A;  2AQ4 A;  1WTF A;  1EJ7 L;  1PKU A;  1LW0 B;  3GYG A;  1S6O A;  3Q0A A;  1DZ5 A;  1B7Y B;  4DMZ A;  4ZVE A;  4ZS6 A;  2YNG B;  5B09 A;  1KFS A;  2J5A A;  4ICL B;  4G6V B;  3DRR B;  3UNY A;  4RUA A;  4IG0 A;  1HD1 A;  1TKX B;  5M2P A;  5HP1 A;  1T9T A;  1RT3 B;  2PA8 D;  3LGM A;  4HTI A;  5BXI A;  3J80 U;  2B7B B;  3SDE A;  4QU6 A;  4NXM F;  4DR6 F;  1EX8 A;  1NO8 A;  3BPD A;  3M9O B;  4B3M J;  4B3R F;  2PFD A;  1HKA A;  2L48 A;  5U47 A;  4CLP A;  1OWX A;  1PJ6 A;  1S1V A;  2I8E A;  2MKC A;  2WW8 A;  5CHC B;  2AZ1 A;  5CYM B;  5THW A;  1BGX T;  2DGS A;  4F36 A;  4ZN1 A;  1REV A;  3AOC A;  2G9O A;  4CDI A;  1CC8 A;  2EFN A;  4NLD A;  2B6A A;  2MST A;  2W2Q P;  1TUW A;  5AXL A;  4ELU A;  5H1S V;  2L9N A;  3OL7 A;  2DPJ A;  4GKJ F;  3EGN A;  3L3C A;  5AE1 A;  5DDR C;  5HSP A;  1XBW A;  2XNQ A;  3AOD A;  4PPD A;  2R8K A;  3D68 A;  2R7U A;  3CTR A;  4ILR A;  2AGO A;  2XZD B;  4DV2 J;  2AEF A;  4HT7 A;  2PEH A;  1HBM A;  2VBW A;  2BAB A;  3BQ1 A;  1RU2 A;  2QRR A;  3QGG A;  2MKK A;  3KK2 A;  2XZW A;  3OSN A;  2Z2Z A;  1IBL J;  1TL5 A;  4A4J A;  1CVJ A;  2N7Y A;  4RW8 A;  1E6Y A;  1HFE L;  3ENQ A;  4EBE A;  1UEK A;  1HQE A;  3LA0 A;  3M8P A;  3J80 Y;  5KFE A;  2YQ1 A;  1FJ7 A;  1GX5 A;  4RR5 A;  3KJV B;  3I5C A;  1WWH A;  2R7Q A;  2KYZ A;  3OFE A;  3W9J A;  5BR8 J;  2XMJ A;  2OIH A;  3HVR A;  3PRD A;  4JV2 A;  2M52 A;  1A9N B;  2IJR A;  2IJN A;  2XMT A;  3RJM B;  3MUT P;  2J0X A;  3V4M A;  1MN9 A;  2C2Z B;  4LT6 A;  3E01 A;  2Q6B A;  1FD8 A;  2PT0 A;  4N8O A;  4P2M A;  4ANC A;  5KFW A;  3VVT A;  1T05 B;  3WHI A;  4PUO B;  2N3O A;  3FBC A;  1X60 A;  3FBF A;  3NY0 A;  2J7W A;  2D69 A;  1JLF A;  2IC3 B;  2ZE2 A;  3DM2 B;  4MFB A;  1H72 C;  4OHW A;  2YH0 A;  5E7O B;  1RGV A;  4ZHR B;  2AX1 A;  4TLQ A;  5LJ3 Y;  4X4O A;  2YNF B;  5ETL A;  3VHQ A;  4L3K A;  4WKR A;  1LWE B;  3MMJ A;  2AEJ A;  4H4K C;  2W8L A;  2UVV A;  4N41 A;  4LBP A;  5LXY A;  5F8I A;  5EWF A;  2W9A A;  3GFZ A;  1FD2 A;  3MM9 B;  4NYO A;  5E33 A;  3RRK A;  5L1K A;  2DGO A;  1YRU A;  1VQ7 S;  1Y00 A;  3A3O B;  2NRE A;  3MMA A;  2H1Y A;  3FVY A;  4Q5V A;  1Q82 T;  2F8M A;  3CJK A;  4CLW A;  5DM6 Q;  1NME B;  1RAO A;  1VGY A;  1OSD A;  1VJW A;  2HFZ A;  3PM9 A;  3NCP A;  4F4Y A;  1H3D A;  4C8L A;  2NXJ A;  4ZCK A;  4BWM A;  4F3Q A;  1JLB B;  3JXO A;  3SEO A;  3DC2 A;  4NYZ A;  4MH8 A;  5J1N A;  5H9E K;  2BAC A;  2PI4 A;  2HZA A;  3H5X A;  4MTP A;  1FTC A;  2QLF B;  4DL2 A;  4X62 F;  2IIH A;  5D78 A;  1QUV A;  1ZZF A;  4RW6 A;  5BYS A;  3WC2 A;  1UVM A;  4PPZ A;  4P2F A;  2I5J B;  3TO8 A;  1KEK A;  3IR5 B;  4KHM A;  4JI4 F;  4LF4 J;  1YGY A;  2O5D A;  1IBC B;  1B70 B;  4LF6 F;  2BA9 A;  4WZM A;  3SV4 A;  4MKV A;  4B08 A;  2OFH X;  1S5Z A;  1RBL A;  2L9W A;  1Q4R A;  2WW4 A;  4QR2 A;  3TAQ A;  1TKT A;  2MQL A;  4ID5 A;  1TEL A;  2AIR B;  3GIR A;  3KDN A;  3LP0 A;  2BE2 B;  4DR1 J;  3PYF A;  1NK9 A;  3POT B;  2NS1 B;  3QT8 A;  1KOO A;  1FE0 A;  1WOR A;  3H42 A;  3H20 A;  4KV8 B;  1Y5L B;  4K0K F;  2ZNZ A;  1JQG A;  4HH1 A;  2P9E A;  3D6F B;  2G2O A;  1VQS A;  2DRA A;  2PII A;  4FS1 A;  3EYZ A;  2Z58 B;  4KPC A;  4JI2 F;  2RQ4 A;  3RBD A;  5D3G B;  4JYA J;  4MFB B;  3K7R A;  4ZHR A;  3W3S A;  4X65 F;  4KTQ A;  2XWX A;  2DY1 A;  5E2Q A;  3HM9 A;  3EWG A;  1TK8 A;  4EO8 A;  2ZZN A;  2VBX A;  2VG7 A;  2X1G A;  1H2V Z;  3CED A;  1YQH A;  2LA6 A;  5IT4 A;  3K57 A;  4NLG A;  3J7A N;  4KB7 A;  1RT2 A;  3FGV A;  3W60 A;  3D0H E;  2WRM A;  1SC1 B;  2HKE A;  4M5I A;  5EN1 A;  3M8Z A;  4W90 B;  1S7I A;  3HPO A;  2RSQ A;  4B17 A;  4C9D A;  3CJK B;  3I6P A;  3SZ2 A;  4ETZ A;  3WZ0 A;  1LV5 A;  1X4D A;  4LSN A;  4C8Y A;  2E7X A;  1FXL A;  2OUG A;  1IKW B;  4WWS A;  3PW7 A;  1S1U B;  4X4U A;  1RTZ A;  3TQE A;  3IRW P;  5SUH A;  2OGU A;  1FHT A;  1X0P A;  3NOC A;  1Y5N B;  5CQG A;  1CS4 A;  3CD5 A;  2YTC A;  1IBM J;  1NDK A;  5HQM A;  3IG1 A;  1VMB A;  2R2S A;  1U1O A;  3QT7 A;  1RTD A;  3QFW A;  5AT1 B;  5F8G A;  2IBK A;  1RHR B;  2VG6 B;  3OR1 B;  4QIE A;  2VU5 A;  4M8L A;  1G4C A;  1X4H A;  1BLU A;  3BGF A;  5C25 A;  4ZLJ A;  2VC1 A;  4XO0 A;  4FZV A;  1SL0 A;  3QRP A;  1L3T A;  3D66 A;  2R2R A;  2ZH9 A;  1XMO F;  2WBM A;  3Q8Y A;  3M8R A;  1ZAW A;  4W92 B;  3VGU A;  2ADB A;  4NXM J;  2A1B A;  4DR6 J;  2XCA A;  4ED6 A;  2UU9 J;  1N0U A;  3P5T L;  1IKV A;  1C2P A;  3QAT A;  1TK0 A;  2GMH A;  3MAQ A;  1JLG B;  3PW0 A;  3KLI B;  4K50 A;  4ATN A;  2DHA A;  3CWJ A;  2RB7 A;  5HRO A;  4PYD A;  5HAN A;  5KG5 A;  1AYE A;  3US5 A;  3EM1 A;  2RML A;  3DI6 B;  3KK3 A;  5JXS A;  4OZ1 A;  1ICE B;  2FHO B;  4RL1 A;  2J0W A;  4PWW A;  1VIO A;  3ONQ A;  3QO9 A;  1KWM A;  4IFV A;  3TNV A;  4ZA1 A;  2L3M A;  2GJ2 A;  3FMB A;  4TYA A;  4ECZ A;  2KT5 A;  1NK8 A;  2CJK A;  1RJJ A;  5C25 B;  1MRO A;  1XMO J;  1N32 J;  1NK4 A;  2OH2 A;  4EFA C;  5F8L A;  1BD6 A;  2LYV A;  2QC3 A;  2F63 A;  3AT1 B;  4F3M A;  2IPO B;  1KN6 A;  4B9N A;  1UZH A;  2G2Y A;  1NHV A;  2POK A;  5IQQ A;  3RBZ A;  1PCA A;  1EIY B;  1AZS A;  3TUZ C;  1X0F A;  1C1C B;  3NGT A;  1JLB A;  1RIS A;  4A8X A;  4RU2 A;  4DV5 F;  1NZA A;  3RB0 A;  1APS A;  4P2X A;  3HKW A;  2DK2 A;  4DPX A;  2VUG A;  1FJG F;  1C0U B;  1SL1 A;  3CMA S;  3VTI A;  3T1H F;  4FYD A;  2BMB A;  2DGX A;  1HR0 J;  4ITS A;  1RWO B;  4KKO B;  1YJ9 S;  2FVQ A;  3OXL A;  1VQP S;  4WE1 B;  4RW7 B;  2J8S A;  5E5N A;  1Q7L B;  1WOO A;  1P9Q C;  4HH0 A;  1B0V A;  4BHQ A;  1SI9 A;  5A8K B;  1V5V A;  3FCH A;  2FLN A;  3ITH B;  5K8N A;  3MD1 A;  3CNQ P;  4XK8 C;  1JX4 A;  1JLF B;  2ZE2 B;  4KIA A;  4UW2 A;  5KFP A;  1IVZ A;  2BZ2 A;  2UUW A;  3UI3 A;  1VBX A;  1VIS A;  4JI1 J;  2DEJ A;  1CJT A;  4J37 A;  1T9X A;  2MQO A;  4DV7 J;  4ER8 A;  4NLV A;  3BYR A;  1WSR A;  2ZBR A;  4EI2 A;  3CD0 A;  1N36 J;  2HLT A;  3C8Y A;  5KFH A;  1NU4 A;  3M2V A;  4FBT A;  2ROP A;  3NOG A;  1HQU B;  1YK9 A;  4NA1 A;  3J81 U;  3GB0 A;  4CO0 A;  3IGN A;  3QJP A;  2FQQ B;  2VD3 A;  4IOA Q;  2D9O A;  3BSO A;  1YJT A;  1NJZ A;  2GQC A;  5AJ3 F;  2XMU A;  2DNN A;  3EXY A;  2QT7 A;  5A8K A;  1SC4 B;  2XMV A;  4KE5 A;  3RW7 A;  1LWC A;  2NPI A;  3W2V B;  1U1M A;  2CNO B;  4NPO A;  2DR8 A;  2EWH A;  2JVO A;  2QLX A;  4I2Q A;  1Q86 T;  3X3U A;  1DTT A;  5FDL A;  4LF6 J;  5KT3 A;  1W26 A;  4I68 A;  3RZA A;  2IYI A;  5HK4 A;  4TNO A;  4A46 A;  2DT9 A;  1OPI A;  2VBZ A;  2WBR A;  3CCT A;  4OMF G;  5G0R B;  3RYL A;  3SFG A;  2HVI A;  4AXI A;  1RI7 A;  3LO3 A;  4HAC A;  3BKT A;  4RBU A;  3HVW A;  4GO5 X;  3I87 A;  3I56 S;  4JBC A;  2EPI A;  6AT1 B;  1T03 B;  3LGH A;  1AZS B;  4ALZ A;  4FF4 A;  1HWL A;  1YJU A;  3Q2S C;  3SQO P;  4ED4 A;  4F4K A;  2BAN B;  1N32 F;  3O8W A;  2E7V A;  3T5K A;  3QQC D;  1JLA A;  5D4N A;  4LRA A;  2E5J A;  3RAQ A;  3F44 A;  1HL6 A;  3QIP A;  2CQ0 A;  3CVK A;  2A10 A;  1FDD A;  2MSS A;  4DBQ A;  5A8R A;  1M1K T;  3DOK B;  3GE9 A;  3WBZ A;  4GMK A;  3ISN D;  4WFY A;  3ZC4 A;  1YX2 A;  3CCJ S;  4P75 A;  4ZDN A;  2F9J A;  4OZ2 A;  1NH7 A;  1R0B G;  1PBU A;  5EHH A;  4DR5 F;  3GJS B;  4ZJL A;  1YIT S;  1UJ4 A;  2ATC B;  2EK1 A;  2GIQ A;  3NG8 A;  1KVK A;  3VAJ A;  1RT4 A;  2AU0 A;  2C3U A;  1RWX B;  1X5P A;  3BR9 A;  2B9X A;  3I5B A;  1IM4 A;  4RKU C;  4WYL A;  2HHV A;  3QRR A;  1FKP A;  1REG X;  5JMN A;  4M5N A;  4DU8 A;  1JLG A;  1U2F A;  3UR0 A;  2M8D B;  4QR1 A;  1SQE A;  2CQ2 A;  4LQ9 A;  4RNN A;  2GGP B;  4R5P B;  1UWB A;  4F67 A;  1VRU B;  3QT5 A;  1DLO B;  2C2K B;  1WEL A;  4HTJ A;  4C0B A;  5KFM A;  4WF9 Q;  4DQR A;  1SC3 B;  2LU1 A;  2EEY A;  3C14 A;  4FF1 A;  1JXV A;  5DS7 A;  4TU7 A;  1B99 A;  2AJ4 A;  4DWI A;  1AXQ A;  1JJH A;  2MPU A;  1O8B A;  2OPS B;  2UV8 A;  3IFE A;  3MWB A;  1TAQ A;  3SIP B;  1NB7 A;  3OHB A;  3VGS A;  1HI1 A;  1WF1 A;  4HDG A;  5LT5 A;  4XIU A;  2KL8 A;  3QYY A;  3SV3 A;  3QBC A;  4LRB A;  4DV6 J;  2NZ4 A;  2ZH6 A;  2N4C A;  3QPI A;  3W5X A;  5DDO C;  3VAL A;  1CS4 B;  3G2X A;  3LP1 A;  4C3K A;  1S1X B;  4UZB A;  1KC8 T;  1N88 A;  1QSL A;  2V9K A;  1F60 B;  4DX7 A;  2NSC A;  1QAY A;  2AV5 A;  3N6N A;  3QLH A;  3L9Z A;  1Q5V A;  4M1K A;  4KHR A;  2HND A;  3W5Y A;  1SXL A;  4F7V A;  4LF7 F;  4CLK A;  3OTO J;  1WI8 A;  1Z2Z A;  2XSJ B;  5C2C A;  2MKS A;  3UPF A;  4OYX A;  2BAN A;  5E0O A;  1S9G B;  4HR2 A;  3IO1 A;  4B3M F;  1SUQ A;  2JEI A;  1TMJ A;  1BE4 A;  2HFO A;  4NI2 A;  2FZC B;  4J91 A;  3R7S B;  5A2Q U;  2X7I A;  5KT7 A;  1FI4 A;  2XLJ A;  2HWH A;  3MTK A;  1OY8 A;  2CJY B;  1X9M A;  5H9F J;  3E3X A;  4DCJ B;  3DDK A;  4ZJQ A;  1JWW A;  2NZC A;  2Z2M A;  3HLU A;  3VCD A;  4DUY F;  1TU0 B;  4JUZ A;  1V9O A;  2HVD A;  1RA6 A;  1ZOT A;  1S1W A;  3AHP A;  4OI2 A;  1Y5I B;  3O1L A;  3VZI A;  4F2R A;  4JI5 J;  4DFK A;  4EEY A;  2UXD F;  1TZ0 A;  4DR7 J;  2QLJ B;  3B4M A;  4QR0 A;  3MM9 A;  4L72 B;  1WF0 A;  4KV8 A;  2RS2 A;  1FKO B;  1HNW F;  3DMJ B;  3W2V A;  1S6Q B;  4IH7 A;  1FTR A;  1NK0 A;  3ET6 B;  3NL0 A;  1U0S A;  1GK8 A;  1VHF A;  1U48 A;  1WHV A;  3UVJ B;  3I31 A;  4KYZ A;  2FJB B;  4X66 J;  3ZNJ 1;  4CTA A;  1UET A;  5HBM A;  5AE3 A;  5EWG A;  3FMW A;  3PR4 A;  4I4B A;  2R2U A;  3CCR S;  1HHS A;  3MXH P;  4LF4 F;  3G9C A;  4QW8 A;  2DKO B;  2CQ4 A;  2R7R A;  1R6V A;  2ASY A;  2YX4 A;  3C6T B;  1RWW B;  2KHD A;  4H4M A;  4KGM A;  1RAG B;  1S1W B;  4NLR A;  1LQ9 A;  3LH2 S;  4ELT A;  3EUN A;  4DV7 F;  1UP1 A;  2WVD A;  1O5J A;  2JOQ A;  3I0R B;  4KGX B;  1RAA B;  2M2B A;  4Y0F A;  4WFA Q;  3PX4 A;  2M4M A;  3AY0 A;  2PI5 A;  2PDA A;  3KUH A;  3FSI A;  1SH0 A;  2KN4 A;  3CSK A;  3GON A;  4IDK B;  3NRB A;  2GVD B;  3W5Z A;  1OO0 B;  3R2C J;  2MYF A;  2PO4 A;  1FEE A;  1S7H A;  3R1H A;  1LK7 A;  2XSJ A;  1N5S A;  3MCM A;  3MM7 A;  3VR1 A;  4CTA B;  1QM9 A;  3M9M B;  2XY6 A;  2PE8 A;  1RAF B;  3AA8 A;  3D3C J;  1HA1 A;  3GIL A;  3LGN A;  3PXG a;  1VOM A;  2HHS A;  2HSE B;  4NZ0 A;  5E3Q A;  5IXU A;  3D4J A;  2QE5 A;  1HBO B;  1WG1 A;  1YRX A;  2RQK A;  4GRS A;  1JJC B;  2G2Z A;  4DZD A;  4U95 A;  1VQO S;  5LMU F;  2EBE A;  2H51 B;  4X4S A;  2ALZ A;  1YIJ S;  1S1V B;  2AT1 B;  2B43 A;  1TUG B;  2GX8 A;  4EMD A;  4CO4 A;  4X64 J;  1TFY A;  4K4T A;  1N8R T;  1SJ1 A;  2FD2 A;  3VF0 B;  5HLF B;  1O6X A;  2N3L A;  2EC2 A;  2WB1 D;  3IR7 B;  4H54 A;  3TAM B;  3D7S B;  1RTI A;  4E8U A;  1ELO A;  1PIL A;  4LUB A;  4X62 J;  3DLH A;  5K9F A;  5HVH A;  3DNC A;  4IFY B;  4OHV A;  1FKP B;  4OZN A;  4OI4 A;  2F4V F;  3MPW A;  1K1Q A;  1URN A;  1WC3 A;  1BQN A;  2GAG C;  4EWT A;  3K5L A;  1VRU A;  3N28 A;  4NCG B;  1D9A A;  1Y11 A;  3D67 A;  2IHR 1;  3M8Y A;  4YB7 A;  3KK3 B;  4OX9 F;  1YKW A;  2QEX S;  1NXI A;  2IRU A;  4GC7 A;  1FJC A;  2YPY A;  3CCW A;  1UWA A;  2OEK A;  4IOB A;  5I3U A;  2FVP A;  5F3Z A;  3NCR A;  2DNQ A;  4JI5 F;  4F25 A;  2WCX A;  5GAD I;  4IRK A;  4WP9 A;  2CQP A;  3K5M A;  2P9G A;  2E9T A;  2H65 B;  1L3V A;  4DQS A;  2GS8 A;  5KFA A;  1IXK A;  5IOL A;  3KLF A;  4DV3 F;  1SIW B;  2V8G A;  1NUE A;  1R7I A;  3MMC A;  5A8W B;  1H7X A;  3J81 j;  4LR9 A;  4QW9 A;  4ZLN A;  2FVR A;  1PYT A;  5D4L A;  4F04 B;  3PHE A;  1AA1 B;  4B9L A;  5J2P B;  4LVN P;  3KYL A;  3QIP B;  1G1X A;  2AJQ A;  5ETR A;  3MED B;  3U02 A;  3TAN A;  1B7F A;  2ZWO A;  4I6A A;  3LQV A;  3CCQ S;  2HRT A;  4QZV B;  1WF2 A;  1XR5 A;  2VG5 B;  3MM6 A;  5D8H B;  4WFZ A;  3TOQ A;  3PJX A;  3KHL A;  4ZVP B;  2V34 A;  2XLI A;  2PC6 A;  1RTH B;  1H7W A;  2E5G A;  3EE3 A;  1Y9O A;  1FNO A;  4K59 A;  2HEK A;  2WVF A;  1T9Y A;  2Z2L A;  2B9E A;  4MK7 A;  2BR0 A;  1RWU A;  4R0J A;  1NRK A;  4ZIT A;  1T8E A;  2CA9 A;  1RU1 A;  3M30 B;  4HAC B;  5JVH Q;  2YKO A;  2G1H A;  3KMQ A;  1GH8 A;  3EJM A;  2CQH A;  3KLI A;  4PXD A;  2YNG A;  4OYZ A;  1N52 B;  4NA3 A;  1HW8 A;  2LXI A;  2C2E A;  4Q8E A;  2C2D A;  1VBZ A;  1KVI A;  2W2O P;  4P2S A;  1BUX A;  4V19 J;  4KGV B;  2CG8 A;  3G82 A;  3M2R B;  2VKZ G;  5D0E A;  3TEH B;  3ELH A;  1WC1 A;  1DTQ A;  3GFY A;  2MTL A;  2HVH A;  1VDH A;  3K5N A;  2E1P A;  2UVW A;  3NAI A;  2Y8W A;  1TKZ B;  4FYX B;  2G0I A;  4CNY A;  3CXC R;  1I3O B;  2R42 A;  4DPT A;  2AWZ A;  4XPC A;  2MB0 B;  1IR2 A;  3KTQ A;  1J5O B;  3P96 A;  1HWK A;  3I0S A;  4NLQ A;  1XNR F;  1VCT A;  2JL9 A;  2OAU A;  3OD2 A;  5LMN J;  3M32 A;  3MHY A;  2H5J B;  3RB6 A;  3OL8 A;  3OTD A;  3UDC A;  3C2P A;  2HQI A;  1FDN A;  4IOC Q;  3B54 A;  2ZIT A;  2Z57 B;  3CGI A;  3TR5 A;  3OW2 R;  4K0K J;  1N6Q A;  3HX9 A;  2DNZ A;  1T02 A;  2A2C A;  1VC6 A;  1KQS R;  3QJJ A;  5E41 A;  2XY7 A;  4IRD A;  2YBV A;  3N79 A;  4ZPB A;  5J1P A;  4TKT A;  4R25 A;  3A8J A;  3MM7 B;  1XC9 A;  3JSM A;  5KFO A;  1S9E B;  1CEZ A;  4C11 B;  4JI7 F;  1IKX A;  1LWC B;  4RW7 A;  1RT2 B;  2GVD A;  4L76 A;  4WKY A;  1FRK A;  1TL1 B;  1BHN A;  1FJE B;  4QCL A;  3EDQ B;  4P6Q A;  2VC0 A;  3GSD A;  4CLT A;  4JI4 J;  2HHX A;  2K06 A;  3C15 A;  1VK3 A;  1OYD A;  3JTO A;  4C8M A;  5KFR A;  1N6Q B;  1MU2 A;  2DXE A;  1N34 J;  1U4B A;  1XNQ J;  2ZNY A;  4DSL A;  3R6G B;  1Y0H A;  4P71 A;  4WIQ A;  4TY9 A;  3GSI A;  1CSJ A;  1YZ6 A;  1FWL A;  4MYT A;  4JI1 F;  4DCP B;  3LPE A;  2MQM A;  5H9F K;  3DI6 A;  1G3O A;  1OS5 A;  1WC6 A;  4DR1 F;  2BXJ A;  2OEJ A;  3H5U A;  2COL A;  4AQY J;  2OI2 A;  3TX8 A;  7FDR A;  1HQ2 A;  1Y7P A;  4KH1 B;  3CB4 A;  2GQ2 A;  2GHP A;  3DXB A;  3IRX A;  1CJV B;  4Q2M A;  4USK A;  2L08 A;  1HBO A;  3ETM A;  5T14 A;  3E51 A;  2J6U A;  4Y2M A;  3LP0 B;  4G3I A;  3MOZ A;  1HWI A;  3R5C A;  4FYW B;  2PMZ D;  1FCA A;  1Q8B A;  2QLW A;  4U9R A;  1VQ6 S;  2KM8 C;  4NOH A;  3MGJ A;  4N8N A;  1UA1 A;  3OXG A;  4ZVQ B;  3KLG A;  1VI7 A;  4ZLP A;  2G13 A;  2VDI A;  3RTV A;  1DBD A;  3GR0 A;  3SCL E;  3G8Q A;  1KQK A;  3AXM A;  2AX0 A;  2BUN A;  3LP2 A;  2AP6 A;  4J9R A;  3EVM A;  4QIW D;  2DNO A;  3IG1 B;  2KT2 A;  4DL5 A;  1R31 A;  2CZ9 A;  2ACM A;  3IS9 A;  2OLW A;  1MW7 A;  2KO1 A;  2YKA A;  3AH6 A;  3MM6 B;  2BV3 A;  1H74 A;  3QRQ A;  5J2N A;  2BE9 B;  3ADA C;  2Y0B B;  4UQG A;  1FFS B;  2GA7 A;  1NSQ A;  4J9M A;  3CT9 A;  2BKN A;  4KAI A;  2R7O A;  1KDN A;  1FRX A;  1UPM B;  3CDW A;  4ZP8 A;  5F41 A;  2IMO A;  4YUD A;  3GCX P;  2C3P A;  1GTH A;  4KFB B;  4CM2 A;  1EHW A;  3JQM A;  2W7A A;  5D0H A;  2Z2Y B;  2W9B B;  4J9S A;  2U1A A;  4ZIW A;  3MEK A;  1S1U A;  4O23 A;  3N01 A;  4IG3 A;  3TAR A;  1FE4 A;  3RUB L;  2H48 B;  2G1D A;  5B0D A;  2DRB A;  4A8F A;  3PIO Q;  1X4E A;  4C48 A;  5I3U B;  3UDL A;  3DLL Q;  1LWF B;  2LA4 A;  4DSK A;  4CLZ A;  2JC0 A;  3RR8 A;  3E01 B;  5J2N B;  1R0C B;  2YVS A;  3J7A 1;  2FZG B;  4BLG A;  5LL6 d;  3DOM B;  2CJQ A;  2V2K A;  5DG8 A;  4DF8 A;  5CXT A;  1QSS A;  1U6F A;  1D9F A;  3PNI A;  2XS2 A;  2YX7 A;  3CDB A;  4NA2 A;  3JSR A;  1JJ2 R;  1VK8 A;  2V8V A;  3MCN A;  5LOQ A;  1S10 A;  4YS2 A;  2YQ3 A;  1RWM B;  2R2T A;  2UXC J;  4QIV A;  5DGA A;  4X4P A;  1FES A;  1HNI B;  2A0F B;  2XSF A;  2MXY A;  4C8Z A;  4IG3 B;  1J5E J;  3TUP A;  3AFG A;  2Z56 B;  5K14 A;  4M63 A;  2DHH A;  4RNF A;  2OD6 A;  4YHH F;  3T5J A;  3PYE A;  4IQX A;  3KJV A;  4KHP J;  4L6V 3;  2HS4 A;  1LWF A;  2QFJ A;  1RT7 B;  1F1B B;  4IR1 A;  5KT6 A;  1RAH B;  1Q1K A;  4V19 X;  1HAR A;  1WAC A;  3K17 A;  3M8Q A;  3M30 A;  2HMI A;  2EKN A;  4UY8 5;  3QT6 A;  1U7L A;  3B8H A;  3W64 A;  1VLO A;  1F3F A;  3HO1 A;  1CBK A;  4MMO A;  2BJD A;  1N5Q A;  1HMV B;  1VS3 A;  3GV5 B;  2EG1 A;  3O2I A;  3LP2 B;  1RTH A;  1ACM B;  3UFC X;  2BQU A;  4EZ6 A;  4PWD B;  4NYP A;  1TVR A;  3P8B B;  2B4V A;  2BKP A;  4Q43 A;  5KFS A;  1I94 F;  1B4S A;  2AYE A;  5DQI A;  1EAY C;  2HGL A;  4ID8 A;  1KON A;  2FVS A;  2UV8 G;  4QJV A;  1MU2 B;  3N0V A;  2KJW A;  5I3P A;  1JK9 B;  3UD5 A;  2Y8Y A;  2XS5 A;  2H4Y B;  1S4F A;  4WZQ A;  5ETP A;  3I0R A;  4ES2 A;  3PY8 A;  3BQ0 A;  2L9D A;  1TKD A;  3THT A;  4DUZ F;  2Y9H A;  1KTV A;  2MDA A;  2XC9 A;  4JI8 F;  1Y4Z B;  3GII A;  1Y3K A;  3GMG A;  4DFP A;  3ILI A;  3QGH A;  1RBO B;  1CUL A;  4LIR A;  1GMU A;  5GAE U;  3IN5 A;  3POT A;  3ENA A;  4ZVG A;  3JSM B;  5KFQ A;  3HSD A;  1MG7 A;  4CLL A;  5I3Q A;  4B9S A;  4YDX A;  1GXT A;  4G1I A;  3B4D A;  3GP9 A;  5IT0 A;  1HNW J;  2UUB F;  3FC9 A;  1FDA A;  3FBE A;  2IM1 A;  3TUJ C;  4YHH J;  4F4X A;  2NUH A;  4LFC F;  3BN7 A;  3MCS A;  2DR7 A;  4UOH A;  4TY8 B;  1Q5Y A;  1SJR A;  5IS2 A;  5LMN F;  2XUL A;  1TL3 B;  2JFK A;  2M5Y A;  1MWY A;  4LF9 F;  1FNM A;  2IM2 A;  3SXL A;  1DUR A;  1VBY A;  1AUD A;  5KAK A;  3HVT A;  4HEA 9;  2QO3 A;  2OSQ A;  1KSP A;  2FJE B;  4GO7 X;  2HIY A;  3UCZ P;  1SV5 A;  1U6B A;  2XYH B;  4AL5 A;  4DFM A;  2DYA A;  1QAJ A;  3IC1 A;  3RGI A;  3G6E S;  6FDR A;  2A6O A;  2KFN A;  3GG1 A;  3ZXW A;  4X2B A;  1T03 A;  3CDA A;  3CE8 A;  3I96 A;  4F8R A;  1U47 A;  2VFU A;  1LNQ A;  2CPF A;  4ED3 A;  1G2E A;  3V81 B;  1UEU A;  4XPE A;  3CJ5 A;  2JEG A;  2EXU A;  3G87 A;  1NK5 A;  2BX6 A;  4OYI A;  4PG6 A;  3MMA B;  4RW8 B;  5KG7 A;  2VQF J;  1F9H A;  4JI3 F;  1KS2 A;  3BBC A;  2OKQ A;  1VIX A;  3TZY A;  3ISZ A;  1DTT B;  5FDL B;  5MLC V;  4JI8 J;  4MKY A;  4LBI A;  5HAT A;  4RNM A;  3EIC A;  3M6X A;  5FII A;  1JB0 C;  1KHW A;  2DHX A;  1XWL A;  3DLG A;  3LP1 B;  3QNW B;  5ETT A;  3DDI A;  3T19 A;  1TK5 A;  4FF2 A;  1UVN A;  4JV5 F;  1EP4 B;  2HAF A;  4ZPV R;  1RYS A;  4LSL B;  3BO4 A;  1T95 A;  4FYY B;  2JZ5 A;  2BKO A;  1NND A;  1BMQ B;  1QJH A;  1YJV A;  3PW2 A;  3PHT A;  4F4A A;  2GZO A;  1WHX A;  2KG1 A;  4QBU A;  1WDD A;  1X5S A;  3DRP A;  4DDF A;  3RAX A;  3NMR A;  4G1Q A;  4FVC A;  4A8Q A;  3DRY A;  3M6V A;  3DRS A;  4FBU A;  5HMX A;  1I6J A;  2QV6 A;  2N4D A;  3MM8 B;  2ADC A;  1TAU A;  1T3N A;  1AW0 A;  1TKZ A;  2KU7 A;  3CCE S;  1WHW A;  2CXE A;  3A8K A;  5L1J A;  1SJF A;  5DQH A;  2B4P A;  1RHJ B;  2APO A;  3N6M A;  3VAH A;  2ZVI A;  3G82 B;  3KJN B;  4FVM A;  4WFN Q;  5KG4 A;  7FD1 A;  1UW9 A;  2HBQ B;  4QU7 A;  2R7S A;  2ZBQ A;  3ZTR A;  2AEM A;  3ZZU A;  1BXN A;  5B0G A;  1V5I B;  1M5K C;  3BR8 A;  1K44 A;  3BEG B;  5CD4 H;  2QX0 A;  2C2M B;  4YQW A;  1X4B A;  2ZC3 A;  5C5J A;  2WTF A;  2V4Q A;  1H2U X;  2VPW B;  4PEO A;  4B9M A;  5DQG A;  2CG4 A;  4Z7C A;  4Q8F A;  3CJ4 A;  2XY5 A;  1ULR A;  3AD9 C;  2HLU A;  2E5L J;  2E1R A;  5CAA A;  5HAO A;  5T7L B;  1CG2 A;  4OHZ A;  1X8D A;  2G0J A;  1ZAX A;  5AXM A;  1ITP A;  3QWP A;  2E7W A;  3MMC B;  2WAQ D;  2LCW A;  4WFX A;  5CAB A;  4C4W A;  4DPW A;  2FC8 A;  5GAD U;  4DV3 J;  4Y2I A;  3NAH A;  1FRM A;  1LW2 A;  2XGP A;  1HMV A;  2ZH8 A;  2UUA J;  5GVQ A;  4ANE A;  2FGO A;  4OQJ A;  3S8S A;  1M1G A;  3OTE A;  4FPI A;  2NPF A;  3PR5 B;  5BJR A;  5HP1 B;  2HS0 A;  1U49 A;  3HKZ D;  2K1R B;  4PAB A;  3SQG A;  1YRT A;  4QWE A;  1VC5 A;  2B8Q A;  2OP5 A;  2P6T A;  1NZ8 A;  3BGL A;  2HAI A;  4IFV B;  4ZPC A;  5K5M A;  4FN5 A;  3CDU A;  4JV0 A;  5K8O A;  3BGO P;  3T9N A;  5DET A;  2X51 A;  1TUV A;  3OVS A;  4N76 A;  2IAJ B;  1WOP A;  4WXO A;  1CJK A;  4Y3C A;  2VB6 A;  4UOF A;  2AD9 A;  4Y6I A;  5KFK A;  4DFJ A;  2ZBI A;  3NGU A;  1PG5 B;  1FRH A;  2X1A A;  1VQ5 S;  4LFB J;  2A6M A;  2DJW A;  4OYW A;  3Q24 A;  4DV4 F;  4ECU A;  4Q0B A;  5DG7 A;  3V6D A;  1UVJ A;  3KLV A;  2DGU A;  2OJ3 A;  2CAJ A;  1DHM A;  3DU6 A;  2PEB A;  3RRH A;  3D0G E;  3RBE A;  2V68 A;  4ES3 A;  1RHK B;  1HQU A;  4PAA A;  2VV5 A;  1NDC A;  2Q66 A;  4FPR A;  1WD6 A;  4TQR A;  1HNX F;  2B5J A;  2OHD A;  1UWB B;  2IFX A;  6FD1 A;  2I0X A;  3S7R A;  3ISN C;  1P27 B;  2BOA A;  1FX4 A;  2XMM A;  4USJ C;  2HIQ A;  4YOE A;  1EQ0 A;  1YZ7 A;  2V63 A;  3M4X A;  5DZ6 A;  5KT2 A;  3BSC A;  3PVX A;  5KFL A;  2GCF A;  3K58 A;  4X66 F;  2MLZ A;  2CPH A;  5HLF A;  4OIX A;  5EX3 A;  3ITH A;  2GIF A;  4U96 A;  3HJV A;  5C2G A;  1OSC A;  3GIJ A;  1WOS A;  3TA2 A;  2EFP A;  3KG0 A;  3NXZ A;  2YNH B;  5IV3 A;  2K7K A;  3PX0 A;  2UXB J;  3I9Z A;  4PYA A;  1FVQ A;  1RKJ A;  1CUL B;  1TP7 A;  1RTJ A;  4RW9 A;  4M5J A;  3DOL A;  4K5S A;  2BJE A;  2W8K A;  5H9E J;  3CC7 S;  3KMS A;  2D3O R;  2XM3 A;  5ETK A;  1DJ0 A;  1SBR A;  5CH7 B;  5DM7 Q;  1RHM B;  3CCV S;  2CQI A;  1T0T V;  1F5C A;  1WC0 A;  3MMB B;  4CLU A;  1S6P A;  2K7J A;  4I6Y A;  1KLN A;  4LF8 F;  2J9D A;  2LFV A;  3NBP B;  3THP A;  3OPK A;  4KH0 B;  5K8P A;  3TQ1 A;  5C24 A;  4URQ U;  1K9M T;  1HPZ A;  2XI2 A;  2YKQ A;  2VG7 B;  3HHD A;  4WYW A;  3EDR B;  4XDC A;  1F3V A;  1T94 A;  3G8T A;  2D3O 1;  1KHV A;  1JLQ B;  2DXF A;  4CLF A;  1VHI A;  2YWK A;  4BDP A;  2RQM A;  1IJF B;  4ZVU B;  1JXE A;  1ZZN A;  1YJW S;  1JMT A;  5ETM A;  1W2I A;  1UKU A;  2MKJ A;  4TU8 A;  3ZZO A;  3FRZ A;  1NKB A;  3GJQ B;  2VZ9 A;  1UPP A;  3IAM 9;  1WC5 A;  2ZKU A;  2RHS B;  3W9I A;  1X9S A;  2R8G A;  4ZVH A;  2FVC A;  2XNR A;  3M2U A;  2Y1R I;  3PG9 A;  5ADZ A;  3IA0 A;  4M5D B;  4DX8 H;  2IYG A;  1CQN A;  3AJ2 A;  5HBM B;  2HRU A;  3PKM A;  2OML A;  3I82 A;  1BQM A;  4W98 A;  2DNK A;  4DUZ J;  2AJF E;  2VQE F;  1B0T A;  5K14 B;  1ZYQ A;  1QLN A;  3T1Y J;  3KLH B;  2UUC J;  5B0A A;  3DRX A;  4ZPA A;  1Q7Y T;  1ZBT A;  2HHP A;  1RK8 A;  2GVZ A;  1WTB A;  2YX1 A;  2M7S A;  4C0H A;  2XO6 A;  1KTQ A;  2W9C B;  4X84 A;  1YBA A;  4K4V A;  2LEA A;  1S9G A;  1YLX A;  1DY3 A;  1U0H B;  2YWG A;  3GLJ A;  1CQM A;  3TRG A;  2LKZ A;  3DOM A;  1GMV A;  4UUW A;  2CKW A;  1JKH A;  1UFK A;  3QID A;  4CZC A;  3BV8 A;  5CA5 A;  4DQI A;  3R6L B;  4PR6 A;  2W25 A;  2BM1 A;  4P72 A;  1PIE A;  3CO0 P;  1S6U A;  3SYZ A;  3K8W A;  1UJ6 A;  4ZN3 A;  1PC4 A;  3A12 A;  3P49 B;  1UCN A;  5CYQ B;  4ERD A;  1S57 A;  5GAH I;  5IT9 U;  2VQE J;  1LEO A;  3BN4 A;  4JI3 J;  2C42 A;  4OYA A;  2HBR B;  4KKO A;  2M9K A;  2ZH5 A;  5I42 A;  3TP2 A;  3LUY A;  4EGL A;  2HNZ A;  3D1Q A;  3VAG A;  5MAO A;  3ZZT A;  2F1F A;  3CF5 Q;  2RF2 B;  4GC6 A;  2VIC A;  1S9F A;  1QAX A;  1S4E A;  2FJD B;  3WIV A;  2ZBC A;  2E1A A;  4HVZ A;  4U7U K;  4F0H A;  2UXB F;  1IKY B;  3PRV A;  2QL5 B;  2VPZ B;  2XMK A;  3WX4 A;  2DXD A;  3M32 B;  1K0T A;  3G6X A;  3Q8P B;  5KFG A;  1HNZ J;  1FRJ A;  1P1L A;  5J2Q A;  4KPY A;  4G65 A;  4HT5 A;  2AGP A;  5GAE I;  5E3P A;  1H73 A;  3QFH A;  3DLK A;  3T41 A;  2H9Z A;  2YXL A;  5T7L A;  4ICL A;  2JRS A;  2PGC A;  2HWT A;  3G4S S;  1X5O A;  4Z7Y A;  3UNG C;  4DPU A;  4DEZ A;  4J9Q A;  5IT9 Y;  3VAI A;  3UCU P;  2IRX A;  2DH9 A;  3FFI B;  5KFC A;  4QWD A;  3K2Y A;  1RAD B;  3I9V 9;  2RVJ A;  2X3D A;  1D3W A;  1FA0 A;  3W7B A;  4YME A;  3CJ0 A;  3FBB A;  2MGZ B;  3EXC X;  2HVZ A;  2I1R A;  5HJX A;  3RW6 A;  3MFH A;  2ASD A;  5B7W A;  4KGZ B;  4HL9 A;  2HRY A;  3T5H A;  4R8U A;  4OJH A;  4PXB A;  3MM8 A;  1VQM S;  3NCQ A;  4DG1 A;  1WDT A;  3DRS B;  4NLY A;  1HYS A;  1UL3 A;  1GT8 A;  4K2X A;  1IM6 A;  1XN9 A;  3DRP B;  3T6J A;  4E2F B;  2WVB A;  2WB4 A;  5KG2 A;  1FO1 A;  4G1Q B;  4N7T A;  2VIH A;  4HHH A;  5KOW A;  3IBW A;  4B3O A;  5GME A;  3HFV A;  3TVZ A;  3EGV A;  3OVA A;  5J2P A;  4DQQ A;  2E29 A;  2RRB A;  2HNY A;  4NXN J;  1Q78 A;  2V94 A;  4G1P A;  1JJ4 A;  1QVF R;  4LMZ A;  1PJ7 A;  3PV8 A;  4F3O A;  5C42 A;  4X4T A;  3PRB A;  1IR1 A;  3Q8S B;  4O3S A;  5J1E B;  4YB5 A;  4ZVR B;  2GO9 A;  1N5V A;  1R3N A;  4LF2 A;  4A8W A;  4FXW A;  3GR1 A;  4RX6 A;  1GXU A;  1NPR A;  4RWW A;  3TJ8 A;  2CFX A;  2DGW A;  1LOU A;  2JHE A;  1I1G A;  1V3Z A;  2HFS A;  4JI7 J;  5KG1 A;  2D7S A;  2QN6 B;  2JH3 A;  4PQU A;  1O0P A;  1C4C A;  2D3U A;  1IBL F;  1RHQ B;  1UVI A;  2Q3P A;  2WOM B;  1XMQ J;  2DRD A;  2VPX B;  2P8I A;  4MIB A;  4KSE B;  1WEX A;  1VQK S;  2B4U A;  3HZE A;  8ATC B;  1FRL A;  3ZTQ A;  3UN2 A;  1W25 A;  2ZZT A;  4IDK A;  2O1P A;  5CCL A;  3HSG A;  3JB9 k;  2MKY A;  2YPZ A;  3PDN A;  5G4D A;  2GML A;  2ZUG A;  1NM2 A;  1HHT P;  2J6T A;  1S77 D;  2ZVS A;  2CDR B;  2LLZ A;  2GMJ A;  2ZHO A;  4N77 A;  1F2H A;  2OPP B;  5RUB A;  1EET B;  1HBN A;  1X5T A;  2X1B A;  2OD4 A;  1H0H B;  4K5R A;  3EX7 B;  4C8K A;  3SSS A;  4CT8 A;  4OYM A;  5DLG A;  2W9C A;  5DGB A;  3TAP A;  1SKR A;  3RG6 A;  3MPY A;  5GAG I;  1X7V A;  2OSR A;  2AW0 A;  5FD1 A;  4DL0 C;  4B9T A;  3FEX B;  1QTM A;  2QYC A;  5ETQ A;  2Y1L B;  1JNR B;  4MIA A;  3VVU A;  3HFZ B;  2WVC A;  5KG3 A;  1S0O A;  1QAI A;  3CD6 S;  2W7P A;  4ZOS A;  3GTY X;  2ZM6 F;  4J90 A;  1XQI A;  1CPZ A;  1FT8 A;  5GMD A;  5F3T A;  1FKO A;  3MZI A;  3ZNU A;  3ZZ0 A;  4I7F B;  1U1N A;  1RWV B;  2E5H A;  3R9L A;  5KT5 A;  4DX6 A;  3AJ1 A;  4J5O A;  3SCJ E;  4DI6 A;  2J76 E;  1QDU B;  2J9E A;  2W4C A;  1EZZ B;  2I9S A;  2YQ0 A;  3KHG A;  3PJ9 A;  2DIU A;  3JQJ A;  4NLS A;  4TXS A;  3KHR A;  2V4J B;  3IM9 A;  4WP8 A;  4F4Z A;  1WJ9 A;  1SB6 A;  2DR6 A;  2HBZ B;  4ED0 A;  2J0S D;  1ZA1 B;  4H4M B;  3MOJ B;  3HHL A;  4WFB Q;  2LP4 A;  3LAN A;  4AFF A;  5A8W A;  4X65 J;  4J9P A;  3KHH A;  2VFT A;  3BSN A;  1IWA A;  4JV5 J;  2EFO A;  3A3N B;  3FSX A;  3L7O A;  3OFG A;  4O44 A;  4DN9 A;  2XMW A;  2JDJ A;  4TN2 A;  2MZJ A;  4DR2 F;  4W4M A;  2HHW A;  3M8Q B;  5IC4 B;  2HMI B;  3KNG A;  1VJQ A;  3QO9 B;  3MEE B;  1RUS A;  4OZ3 A;  2HFV A;  3UE2 A;  4D3H A;  4I0W A;  3H40 A;  1W2B R;  5HJY A;  2CAD A;  1UA0 A;  4TQS A;  1EKR A;  4NLO A;  1IR0 A;  3BH6 B;  4A8S A;  1NKE A;  1G7C B;  2ZEJ A;  1N5Y B;  2YWH A;  1RT1 A;  2BVZ A;  3L7P A;  3SSR A;  2MZ1 A;  1S0N A;  1NSP A;  1WKJ A;  3R8Y A;  2AMC B;  1F9F A;  1HLW A;  2BEF A;  2KRR A;  3R5J B;  4CYU A;  4J9K A;  1KNZ A;  4U7U D;  3DGP B;  4OYB A;  1TL7 A;  4V1A k;  2IC3 A;  4ZIV A;  2N82 B;  4OI0 A;  1YBU A;  2EFG A;  2ZKT A;  3CO9 A;  4YR2 A;  2QSW A;  4LR8 A;  4DSE A;  1NPP A;  4NX9 A;  1VLY A;  3KJF B;  4B3R J;  3OT9 A;  1UVL A;  5EGY A;  4U8Y A;  2LXU A;  1U1P A;  4NLX A;  3VWS A;  5L38 A;  5D3G A;  3GIK A;  2AZ3 A;  1UMJ A;  2CPX A;  3TA1 A;  2XZT B;  3IM8 A;  3W63 A;  5LXR A;  5FLX U;  3CJ8 A;  1YI2 S;  4EZ9 A;  2QFI A;  1DLO A;  1NLK L;  1NEE A;  5CZX A;  1L3S A;  3KUG A;  4WTY A;  2CIM A;  4GKK F;  3J7Y U;  1XMB A;  2DY9 A;  2F7V A;  1N5Y A;  2DCL A;  2GVZ B;  4OJ1 A;  3GIM A;  3KK1 B;  3Q8V A;  5D4P A;  1RTD B;  2FYX A;  1C1B B;  1KLM A;  2FHJ A;  1TL7 B;  2OTJ S;  3RBX A;  1SPB P;  2ZC4 A;  4WXW A;  2F9D A;  4ED2 A;  2E9R X;  5C7P A;  3BBF A;  4KFB A;  3VV2 B;  3LWL A;  3R1L A;  2H5I B;  2RT3 A;  2RDD A;  1T9U A;  4LRC A;  4PQA A;  3MFI A;  2PFF B;  4H4O A;  1RKI A;  3MPU B;  2DNG A;  3M9N B;  3RU0 A;  4TU9 A;  2HVE A;  2NXE A;  3V6J A;  4DV5 J;  1U09 A;  1QUP A;  3G71 S;  2RKI A;  3W2W B;  5DZ7 A;  2I5J A;  4DR3 J;  3LAK A;  1SJ3 P;  1RSC A;  1JLA B;  1DAX A;  4K4X A;  3MEG A;  3EMT A;  5D0G A;  3UR3 C;  3M05 A;  4M5H A;  5A0Y A;  2MLY A;  4F0K A;  3L7U A;  3W1Y C;  2GC8 A;  1RYR A;  1NSA A;  1VQ8 S;  1S1T A;  3V4I B;  1FRI A;  3QSI A;  2GV1 A;  3I55 S;  4O0N A;  4Z37 A;  4OFZ A;  2DEI A;  4DF4 A;  2BE2 A;  1X4A A;  1PBA A;  2KVQ E;  3DGP A;  4UST A;  1HNV A;  1R43 A;  1N54 B;  3HD1 A;  1E6V B;  2KI2 A;  2I6W A;  7AT1 B;  5IFM A;  5G0R A;  2IBO A;  3CPW R;  2LQ5 A;  2JFD A;  1BWV A;  3DHW C;  4M94 A;  5F9L A;  3EPI A;  2X1F A;  4Y2C A;  3CD7 A;  2FHM A;  1U8W A;  3KJQ B;  3N5F A;  2AYM A;  3EVO A;  3M2U B;  2KG0 A;  4DR7 F;  4I6W A;  2UXD J;  3PFO A;  2GJF A;  1FDB A;  1KR4 A;  5D4O A;  2GO8 A;  5BYQ A;  5L9X A;  5HQ8 A;  2ZH4 A;  3O5T B;  4DV6 F;  1R8B A;  2QZ8 A;  3LF0 A;  3PFE A;  4DPO A;  2XMA A;  1FJG J;  3CJ2 A;  3N4W A;  2J0Q D;  3NWR A;  1RXO B;  5EWE A;  2QLB B;  3CJT A;  5KG0 A;  3JYT B;  3M6U A;  3WC0 A;  3BDE A;  3NNH A;  4LFA F;  3GFH A;  4PWU A;  2MQQ A;  3HHN B;  1HPZ B;  4O3P A;  2OTL S;  1OPZ A;  1FFG B;  2C2O B;  2KHC A;  4F50 A;  1QVG R;  1M1H A;  3H8Y A;  3PZP A;  2P2C B;  1U6Z A;  1R0A B;  2CQD A;  4LF7 J;  1X4F A;  2BOP A;  2W7O A;  3Q22 A;  3OV7 A;  2ASL A;  2J9D E;  2FPH X;  1NJW A;  1U26 A;  2Q43 A;  4I2P A;  3T1Y F;  1RHU B;  2HS3 A;  2M3D A;  2XYP B;  3HFK A;  3UDV A;  3D6T B;  4DG1 B;  3DLG B;  3C6T A;  3IR6 B;  4LF8 J;  1NBE B;  2KJV A;  3OUY B;  4Q0B B;  4L73 A;  3T1H J;  3C16 B;  4QPX A;  3MR6 A;  3HF5 A;  1GAO A;  4M5G A;  2XYG B;  3FUY A;  4JI0 F;  2NQP A;  2Q6C A;  4RO0 A;  3KFW X;  3DCA A;  1RP5 A;  2RIL A;  2XWY A;  1S0M A;  1N33 F;  1JIH A;  3DFE A;  2GW8 A;  1XER A;  3NGK A;  5LSO A;  2V4R A;  2ZOM A;  2HZV A;  3CC4 S;  3K59 A;  4KJI A;  1Q8I A; 
#chains in the Genus database with same CATH homology
 2BMB A;  3MCM A;  3HCX A;  3MCN A;  1RU2 A;  1F9H A;  2CG8 A;  4F7V A;  5ETK A;  1HQ2 A;  3HSG A;  1EQM A;  3UDE A;  1G4C A;  5ETV A;  5ETO A;  1EX8 A;  4CRJ A;  1KBR A;  3UD5 A;  1HKA A;  3MCO A;  1TMJ A;  1RAO A;  3HT0 A;  3HD1 A;  1RB0 A;  3KUE A;  4M5K A;  4M5I A;  5ETT A;  5ETP A;  4CYU A;  1EQ0 A;  3ILO A;  3IP0 A;  2F63 A;  2QX0 A;  1RU1 A;  1DY3 A;  3QBC A;  3HD2 A;  3ILI A;  3ILJ A;  4PZV A;  3HSZ A;  3UDV A;  5ETN A;  5ETM A;  4AD6 A;  3ILL A;  3HSJ A;  4CYU B;  3KUG A;  1RTZ A;  2F65 A;  4M5G A;  5ETQ A;  1TMM A;  3KUH A;  4M5M A;  1IM6 A;  3HSD A;  4M5N A;  4CWB A;  1CBK A;  5ETL A;  4M5L A;  4M5J A;  4M5H A;  5ETS A;  1Q0N A;  5ETR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...