3KUEA

Crystal structure of e. coli hppk(e77a)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIALQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Roles of residues E77 and H115 in E. coli HPPK
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 46
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3kueA00
4M5IA 1EQMA 3IP0A 4CYUB 3HT0A 3HD2A 3HSGA 3UDVA 4F7VA 5ETTA 3HSJA 4M5MA 1TMMA 4CWBA 1RU2A 4M5KA 3HCXA 2F63A 3KUGA 1F9HA 5ETMA 5ETPA 4CRJA 5ETNA 4M5LA 3QBCA 4CYUA 3HD1A 4AD6A 1HKAA 1EQ0A 5ETLA 1RTZA 3ILJA 1TMJA 1KBRA 1DY3A 4M5HA 2F65A 4M5GA 3UDEA 2CG8A 2QX0A 3MCOA 3MCNA 1Q0NA 1CBKA 1RAOA 3HSZA 3ILOA 5ETOA 5ETQA 5ETVA 3HSDA 1RB0A 5ETKA 3ILLA 3KUHA 4M5NA 3ILIA 3MCMA 1G4CA 1IM6A 4PZVA 3UD5A 3KUEA 5ETRA 2BMBA 1HQ2A 1RU1A 5ETSA 1EX8A 4M5JA
chains in the Genus database with same CATH superfamily
1QUPA 2HVZA 1S1VA 4NRUA 1NSKL 1FRJA 4IFYA 1VYAA 1LWEB 2KHDA 1JLCA 2HBYB 2WONB 4DFJA 1SC1B 3V6DA 3FVYA 4LR7A 4ANEA 2PN6A 4CO1A 4MTPA 2R8HA 3EDRB 5EUHA 3BSCA 5KT6A 3OR2B 2MXYA 2BKPA 3OXGA 3EWGA 3RYLA 4F50A 4P7VA 4ECTA 5B0DA 2YPYA 4N41A 2JOQA 3FSXA 3TX8A 5EX0A 4OZLA 3EYZA 3KFWX 5HMYA 3H40A 1VISA 5FD1A 1KQKA 2FLLA 2I8EA 5KFAA 2R7XA 1T9YA 2CNOB 1WHVA 2RS2A 2HNYB 1R8BA 2YQ3A 2DGOA 2Q79A 4Y2MA 4YR0A 3HVRA 1U1OA 3VAHA 1LK5A 3POTB 4WK1A 2NYHA 2JFKA 3R7BB 1JB0C 3IWLA 1OYDA 4PYDA 3NRBA 4RPFA 2VC1A 2ALYB 2QT7A 2JWNA 3CCMS 4UZCA 2PGCA 3VAJA 3BGUA 4X62F 4PAAA 3SZ2A 1HNZJ 1EQMA 2J6SA 2K3IA 2LQBA 5ETNA 2IHR1 4NMXA 1K1SA 1X4DA 4UTGA 4J5OA 3HHLC 3TEGA 2CQPA 2KI2A 2IJFA 1WKLA 4NCGA 2AD9A 2OPSB 1HMVB 5IM0A 1EKSA 3M9OB 2E5LF 3VGTA 3NCRA 2HLUA 4TLQA 4DF8A 1ZAWA 4A8YA 2EWHA 4E0DA 4WP9A 2VG5A 2WVCA 3CO9A 3NGDA 1TMMA 3D9BA 1JLQA 3E51A 1IR0A 1C4AA 3NAHA 1TELA 3DYAA 2ZITA 1FNXH 3A8KA 4MIBA 4IQXA 4FF4A 2BE2B 1JX4A 2J9CA 2V8VA 2VF3A 1ZZFA 1QAXA 4DV2J 3PX0A 4IOAQ 1SV5B 3TRGA 5HROA 1VQYA 5L1KA 2NPIA 2V8DA 2KRBA 1M5OC 2LA4A 3OXFA 4IG3A 3FBCA 3I5AA 2DEIA 3ENQA 2FB0A 2DGSA 2L9NA 2JEGA 2CDRB 4DG1A 3ZZTA 3IWNC 3JSBA 4E2FB 3ZFVA 2DITA 5FDLA 4I2QB 1S9FA 2RRBA 2YTCA 4IDKB 2GO8A 5GAEU 4B3TF 5LOQA 2XY7A 1OIAA 5L8RC 1XNRJ 3W2WA 5DLGA 4O3SA 4RW7B 3RR7A 3L7PA 4RW9A 4U7CA 3R6GB 2KTQA 2M88A 3T5JA 4F4ZA 3BQ2A 2D9OA 3D1OA 2RKIB 3LAKA 1QUVA 1KRPA 5KAKA 2A6MA 2ADCA 2G2ZA 3MUMP 2QRRA 3C6UB 1CJTA 2GX8A 2RVJA 3MPDA 4K4ZA 4YQWA 1KR4A 2XMJA 2HIYA 1YJ9S 2K1RA 3GPAA 5IC6B 2Z57B 2XSFA 2FVSA 1IBCB 3F41A 4OYMA 1GMWD 1TVRB 1S1UB 3DLJA 5J2MA 2B4VA 4NCBA 3MEEA 4QIWD 2FY1A 4ZPCA 3H5UA 4Q2MA 1TL1A 3K57A 4FP9A 2I2YA 1C4CA 1VQOS 3N79A 5JUMA 1BQNB 3LWLA 5AE3A 1FWLA 3GR1A 3JTNA 1TKXA 2NCKL 3MCNA 3RAQA 5H9FJ 3KOAA 1HYSA 3PFEA 3KK2A 1Q8IA 1WC4A 2IVFB 3RW6A 2BJ7A 4ZS6A 4DPUA 3W2VB 4WE1B 3SIPB 1W26A 2W9CB 4YDDB 4DL7A 1PAUB 1RT5A 3C14B 5JVGQ 2EKYA 1Q79A 1FK9B 3J7A1 4LRFA 4HYKA 4UQTA 3QZ8A 3DRRA 5IOLA 5J2PB 3TVYA 1RWOB 1CJKB 3K89A 2JNJA 3W5ZA 3LALA 2RB7A 4IRDA 2ZKTA 3PXGa 4KPCA 4FVCA 3OFEA 2C2MB 5CYMA 2B4OA 4R0EA 5F8GA 1RHMB 2O5DA 5CYQA 3PW4A 1RHRB 3UI3A 3EUNA 1PGZA 1UETA 4GKKJ 5C2GA 3U27A 4JOUA 1JKHB 2J0WA 2FD2A 2P5VA 2XS7A 2HFVA 4FYYB 5L39A 1LOUA 3CCQS 3SFUA 3T6JA 1HQEA 3GJSB 3DU5A 5HL7Q 2CJAA 2ZZTA 1TKDA 1ITPA 3QJPA 3KMQA 4YMEA 2ZUGA 1HNZF 1Q8LA 1PKUA 2ZZMA 1S1TA 2AT1B 2JVRA 1PILA 2BOPA 1F60B 2XWXA 5ETRA 2XMUA 1U24A 1QJHA 1KOHA 2FJBB 2GV1A 1M0SA 2C2EA 3V6HA 1UJ6A 1JLGA 2UXBF 4QWEA 2E9TA 3CCLS 2V67A 3U7JA 3S8SA 4RL1A 1HHSA 2VD3A 4Z2XA 3QT7A 1FKAF 4ENOA 2BOAA 2X3DA 2WBRA 2MHNA 2KZZA 2IAJA 3QIPA 3VV2B 2VL1A 2Z2YB 2R7SA 4K5RA 4H54A 2QTWA 4B17A 1VK8A 3Q22A 4AL6A 2PI4A 2FHJA 1O6XA 4QWBA 3US5A 1HBMB 3CJ4A 1C1BA 3M2VB 3BREA 2KXNB 1S0VA 5CYJA 1P1TA 5CD4H 1LXJA 2HBQB 3RAXA 4MK9A 1RT7A 1M1KT 5EHHA 1NJZA 2HZVA 2C2KB 2XMTA 4DV2F 4DR6J 3TWZA 3VGSA 3BR8A 3R2CJ 5D3GB 1RT4B 2JLFA 3L3CA 1C2PA 2JJ4D 3WIVA 4NZ6A 3PEHA 4FZVA 1WSRA 1K8AT 1OY6A 1YGYA 5D4OA 4PWWA 4DPXA 2ZZNA 2HHXA 3CTRA 4P73A 3SCKE 1CVJA 2P8IA 2BJEA 3GP9A 3SCLE 2X1AA 1RA6A 5A8KB 1IKYA 1U02A 2Q6BA 3GU0A 4CH1A 2ACMA 3D5MA 7FD1A 2Y0SD 2W4CA 1XNRF 2MGZA 1J5OB 1O8BA 2KVIA 5DM6Q 4EO8A 2LEAA 2I5JB 1DQ9A 3HP6A 4L75A 4PWDB 5GAHU 4TYAA 1OO0B 5LXRA 1KP6A 1GX5A 1PJ5A 4DQIA 4OJ1A 1HQ2A 3ETMA 2OPPB 1KSPA 2QA4G 5KFIA 2WB1D 3LA0A 1X60A 2A2DA 1M5VC 3THPA 3V4IB 3C15A 3CJRA 3T5HA 2Z2LA 3DMJB 1U26A 3WC2A 3N01A 2AJ0A 2QL5B 4FYVB 2MQPA 3WDOA 1PSDA 2ZH7A 2D9PA 2DNNA 5KFOA 3FUYA 3L9ZA 4KH1B 4CLWA 3MF5A 2GNKA 2ZFHA 3CUNA 2RD5C 3LGMA 3ZTQA 4DL3A 4H4OB 5A8WA 4O3OA 2OH2A 3KDOA 5T7LA 4ED6A 4RNHA 3MEGB 3LUYA 2W25A 2W1BA 2GVZB 2HMIB 1XR6A 4OI3A 1DAXA 1JJHA 1SC3B 4RW4A 3HD1A 3M8RA 4HDGA 1X4BA 3TAMB 2XO7A 2NQPA 5I3UA 4Y2CA 3BSOA 2VFUA 4OZ3A 5K14B 1A9NB 2V8HA 1B0PA 4J37A 3GE9A 1IBMJ 4G6VB 2F63A 5HVGA 1HI8A 2HS4A 3H42A 2A1BA 3MR7A 2A2CA 1NUEA 5J1EB 3MM6B 3UD5A 2ZD1B 2LECA 4IRCA 2EFPA 2JLGA 1NDPA 4NLOA 1RACB 2E5IA 4WCEQ 1JXEA 2C3OA 1Q0NA 3C3LA 2E7WA 3GFZA 3MMBB 5IS2A 3NNHA 4HVZA 4LRCA 3MURP 4I7FB 5HBMA 4JB8B 4OYWA 2QLWA 3QWUA 3S1TA 3TYTA 4LREA 3TAQA 1CQMA 5C42A 3O5TB 2DHSA 1LXNA 1HBNA 2YNGB 3MM9A 1YI2S 4B02A 4GKKF 4KR0B 1BXNA 2GC8A 3MD3A 2BA9A 1BE4A 3PY8A 4J9MA 3TA0A 3R5AA 2GW8A 5K5MA 3DU6A 4DLGA 2AEJA 4O4RA 2E7VA 2MKHA 1EIYB 4IOCQ 2IVMA 1ULRA 2XCPA 2VODA 1UEVA 1NSQA 3M2RB 3H8YA 2ASYA 2XC9A 4DF4A 1FESA 2V69A 4NLVA 2V68A 2MKKA 5LJ3Y 2DRAA 4FNIA 1DJ0A 1NBEB 2ZH2A 3UQSA 1WEZA 4C3MA 3KK3A 3SXLA 1V5IB 1UA0A 2EPIA 2XLKA 1UZDA 1X4AA 2HAIA 2AEFA 4TQRA 3J7AN 4I69A 4WBFA 4PCQA 2L9DA 5IV3A 5D8HB 2CQ0A 3A3PB 2XMWA 2DKOB 1KVJA 3GB0A 3CF5Q 2HURA 2ZH9A 1CS4A 3NOGA 4K2XA 3KLGB 4C48A 1N52B 2CQ4A 3E8OA 4KV8A 4L76A 4DR6F 1JLBB 1KN6A 3PO4A 3NGSA 3OHAA 3PYFA 4X4RA 4OYBA 2FJWA 1RTIA 3FCVA 5D4NA 2J9DA 4ED7A 3HXMA 1Q81T 1SJQA 3DRYA 4M5MA 3C66A 2KG0A 4H4KA 4KIAA 3CJ2A 4I56A 1YJNS 3M6UA 1N6QB 1Q82T 1TL3A 5A8RB 4OHYA 1YHQS 4ZPAA 3DNCA 2OPRB 3SSRA 3UW1A 4P7TA 3ZZUA 4KGKA 4ILLA 3W1YC 4QPTA 1F1BB 1ZBTA 1N5YA 3RU0A 2R7OA 1NB7A 4DV6J 4ECUA 3QJJA 3M32A 2ATCB 5B0GA 2Y9HA 1DHMA 4U6PA 2ASDA 3I0SB 3MM7B 4PQUB 2B8PA 5F8NA 1ZM9A 3OJUA 2IYGA 4AL7A 3FCHA 3AA8A 5KOXA 3S01A 2UUBJ 2L48A 4WYWA 3VVTA 1LW2A 1MMNA 1VDHA 1CC7A 2M0GB 2L9WA 1S49A 4FXVA 1RE1B 3BO3A 3MPWA 1MU2A 3E3XA 4ZVFA 3OR1B 2DGUA 1TL5A 4ZVUB 4XPCA 2EFQA 1ZM4A 4JI3J 3T3FA 2Y8YA 4FVMA 2UVUA 2RMLA 1F9EB 4ZHRA 4GC6A 5A6PA 5DDOC 2A10A 2CUYA 1YZ7A 2M70A 2LXUA 4C9DA 2NR0A 1Z1ZA 1NK7A 3EX7B 3R97A 2MLXA 4LFBJ 3B8HA 2YX7A 2AIRB 3M2UA 3VAKA 2JH3A 3TUJC 2WVDA 2AKWB 1RISA 2VPZB 1RU1A 2I0XA 4IG0A 1YRUA 4HT5A 3AOAA 1NU4A 4EMDA 5DS7A 2CPDA 2ATLA 1IBMF 4DLEA 5KFSA 1HBOA 2L41A 2OHDA 1EAYC 3P49B 2MZQA 5IFMA 4OI4A 4WTYA 3KLHB 1JLEA 2MQLA 4ELUA 1N48A 1S1XB 3EZOA 2B4UA 2D3ZA 1FDAA 1DRZA 2HK2A 2XS5A 3D68A 4ECVA 4CYUB 4WFNQ 3DOLB 3DDIA 2GZOA 2MEWA 1KBRA 2XLIA 1RABB 4K59A 3N9UC 1FXDA 5HQ8A 1UVJA 2F1FA 2GAHC 2IDEA 3KG0A 1MWQA 2D1CA 1Y3JA 3MEDA 3A3NB 4PRFA 1YRTA 2RH3A 2FZGB 2HVDA 4RNOA 1RI7A 4PPDA 1VRTB 2KO1A 2R2SA 2Y1IA 1HNIB 4ED3A 2XEXA 4R0JA 2ZDOA 1YK9A 3OJSA 1FRKA 1DQ8A 1IQZA 3OVSA 4HACB 1RT1A 2OMLA 3EGVA 2GVDA 2O01C 3GJQB 5B0FA 1FD2A 4DS4A 1IUJA 3RBXA 3UN3A 5LMNJ 4USKA 1R31A 1L5UA 3HHEA 5J2QB 3OT9A 3UN2A 5D4LA 3HT3A 3M1VA 1X9MA 3KK1B 1T9VA 2ZOMA 1BGXT 2J7KA 3K59A 3CMQA 1BMQB 4C11B 5KFZA 1NH8A 3BQ0A 4DCPB 4M5NA 4NLYA 4USHA 1MNEA 1RWNB 1P9QC 4UF4A 4P2SA 3F73A 1RGVA 1CSJA 4ICLA 2AJFE 2Y1JA 3QAUA 4DU7A 2BANB 3DGPB 3WBZA 4PZVA 4L72B 1YDLA 3AQOA 4QIFA 3OD2A 3AOCA 1T05B 4OFZA 3AB2B 4TQSA 1P8GA 1UJ4A 1I5OB 5KFNA 3AA9A 2MQMA 2YWFA 3QLHB 5DLFA 4DPWA 3HHLB 1WORA 1OS5A 3SDEB 4JI1J 4R5PA 4YR2A 3P5TL 2D3O1 2PIIA 3KJQB 2C3PA 1SC4B 4OYPA 3L7UA 2KT3A 4ES3A 2OUGA 3D67A 1GMUA 1NHUA 3O2IA 2EC2A 4ILMA 1UVIA 2HFNA 3SQOP 3LGHA 4YB7A 2OTLS 2B5JA 2QGFB 2J5AA 5L9XA 1H2TZ 3DLBA 5GAGU 4OI2A 1V9OA 3AHPA 1LWFA 4KYZA 2QEXS 4YS2A 5IWAJ 5F8HA 4MH8A 4L3KA 3JQMA 2VIHA 3ZZPA 4FYWB 1NAQA 2JVOA 2VG6A 3NG8A 3P3DA 2UUBF 3T1AA 4DFKA 3MZIA 4LJMA 1C0TB 3KJVB 2W8LA 3O3LA 3D6TB 4CQ1A 1TKTA 4NLXA 2A0FB 4KH0B 1SVDA 1DTTA 1B7YB 4JI3F 3G6XA 4F04B 2LXFA 3M9NB 3DDNA 3CC2S 1P27B 4A8FA 2RF2A 2CWXA 2VKRA 2MDAA 4GVBA 4USTA 1RB0A 1FFWB 1K9MT 4LMZA 4YEAA 4M95A 4LFBF 5FJ4A 2CKWA 3BO2A 4FNHA 1NJYA 4QCLA 4C98A 2OD4A 1TQLA 2WW4A 2NYIA 2VB6A 2JHEA 2LDYA 4DL4A 4FDFA 1LEOA 1XMBA 5F8MA 2KJWA 4JI2J 1H38A 4M5KA 1IKWB 3CXCR 4PUOA 1T03A 3K2YA 5LXYA 3AD8C 2ZBRA 2RNEA 3V81B 1BUXA 1REVA 2XSJA 1R8HA 3NS7B 4DV7J 4DX7A 4F0HA 2W2QP 4CO0A 5G0RA 1Z2ZA 2B6AB 4ZVSB 3J7YU 3LGNA 3VAGA 2AJ2A 3J81Y 4U8VA 2GMJA 3K5NA 4EZ9A 4TU8A 1LK7A 2L08A 1ZAXA 2YQ0A 5F8JA 3N5BA 3D3BJ 1VMBA 3B4DA 2MZJA 2VBYA 1BY9A 3AB4B 1B70B 2ZH5A 4F2SA 3MAHA 4O3PA 1RLDA 5K20B 2RU3A 2JEIA 4H4KC 5GADI 4QZVB 3L95X 1NSAA 3N6MA 4O44A 2GQQA 3Q8YA 4OLPA 2CJXB 1PYOB 1A6LA 3UDLA 1XMOJ 3MGJA 3PJXA 3CJ5A 3LP0B 1E6VB 2QLXA 4F4YA 4RO0A 3U1LA 1N33J 3SV3A 2RDDA 2DH8A 3B82A 3IS9A 1SJ3P 1RUSA 1SH2A 1X4FA 5DDRC 4B9SA 4OL8A 4ZCMA 3TUZC 1TZ0A 2BJDA 2LA6A 1RT6A 2NS1B 1JJ4A 1RADB 2IJNA 1WI6A 4X65J 4ECWA 2B7BB 2YH1A 5B08A 2B8QA 4NYZA 2JEFA 3JAMY 2HQCA 1RTDA 2GHWA 3IBCB 4NZ7A 2E9ZA 4Z7YA 3EVWA 2W2MP 5LMNF 1O51A 1FJCA 5M2PA 1FKOA 4EWTA 4O3RA 1UMJA 2H4YB 2UU9J 5KT2A 3TARA 2G0CA 2NXNA 3CC7S 1HI1A 3NGKA 3GMGA 2H9ZA 2NLWA 2OO4A 1S9GB 2AX0A 1FJ7A 2XYPB 3KYLA 4EZ6A 2QMUB 4LF8J 2KM8C 4V19J 5IT9Y 3CJ3A 3IA0A 3MMAB 2ZKUA 5GMDA 2IM0A 1AT1B 2CPYA 4I64A 3UR0A 1YSJA 5C2CA 2VJUA 1U0HB 2F65A 1CJVA 3A8EA 1JXLA 4C0BA 1FX4A 1J2VA 2Y8WA 2BW7A 2AGQA 3Q8QB 3BN7A 3BGRA 5I42B 3BGOP 4JI1F 4M8LA 3N6NA 1NZAA 3JQJA 1Q5VA 4R8UA 3NGRA 4R25A 1F3VA 3BDEA 4RNMA 3DLHA 3NBPB 3KG1A 3KLVA 2EK1A 3FZ2A 1BD6A 3GIMA 1URNA 2DR9A 1SKUB 4F2RA 5F0UA 3J81U 4TY8B 3FFIB 5KFCA 4ED0A 1S1WB 3A12A 4LF7J 5HO4A 1FRMA 5FIIA 4KGXB 4OZ1A 5EGYA 2AW0A 2IC3B 5IWAF 3GTYX 3K7RA 1EHWA 2AWZA 4JI7J 4K4YA 2RT3A 2FHOB 3N4WA 1DY3A 3ZXWA 1FDDA 3RB4A 2HNZA 1ZOTA 4C0OC 2AJ4A 1S1VB 4PG7A 5KFQA 2DVIA 5C24A 4I4BA 3K5OA 4IFYB 3ZZYA 1GEHA 2MKYA 2ZBCA 1JLCB 3CJ8A 2V50A 3V6DB 4OI1A 1IKXA 1L3SA 5DM7Q 1NH7A 3ZTRA 1EARA 2OEKA 4RR5A 5E3PA 4J9LA 1JIHA 2ZVIA 5L1JA 5CXTA 2ABYA 4HH1A 1UL3A 3M8PA 2CJKA 1MLAA 1ZA2B 4ZPVR 3TANA 2GAGC 3IC1A 2QX0A 1QTNB 5BYRA 1I94J 4ER8A 2ILZA 2X7IA 2V2VA 3H2UB 4CTAA 1Y00A 1VQ7S 2ZWPA 2AEMA 5AT1B 3JAMU 1VC0A 1F2GA 1AW0A 1GTEA 2W8KA 4USMA 4RNNA 5E33A 4FKYA 3ZZOA 1A0OB 2Z58B 3M6XA 4JI2F 3FJ2A 4DMZA 3M8ZA 5KFLA 4RW6A 4ZJOA 5LSOA 2RJZA 1R89A 5LL6d 2VFTA 4PXBA 3RJMB 4PPZA 4M63A 4C8NA 4DV7F 2IA0A 5IT9U 2GFFA 2IA6A 5A0YA 5F0WA 1KHWA 3GIJA 3OFFA 4Y65A 2OP5A 4B9NA 3CD6S 3FEYB 2VBZA 1F5BA 2GHVC 2CG8A 4FS2A 4NCGB 3HZGA 1WC5A 1T9UA 9RUBA 4OLOA 1HWUA 2PSZA 2AX1A 3MR2A 1KLMA 2EC0A 4DR2J 3FZBA 2XCAA 2J0QD 1U25A 6AT1B 1XMOF 2MQOA 2VG5B 4J7CA 4ZP8A 3KHLA 1HWJA 2CQCA 4DFMA 3FSYA 5IT0A 1JLQB 4DX5A 5CA5A 2AGOA 1N33F 3DYAB 1TKZA 1VQ6S 5B0CA 3BF4A 3BKFA 3VQTA 2PA8D 4DPOA 2CPFA 5KG1A 4NYPA 5CAAA 2GIFA 5D0EA 4CM2A 4X65F 5H9FK 4M5LA 3OTDA 2COLA 2DRDA 4EO6A 3QZ7A 2FDNA 5HMXA 5A6WA 2HRTA 2PEHA 5DGBA 4IG3B 3KUEA 4LSLA 4IOBA 3QT6A 2R7VA 1X9WA 2UU9F 4DG1B 3EVOA 2V4JA 8ATCB 4M5DA 1WHWA 3KWMA 3UDCA 3RBEA 4QWCA 2PFDA 4LSNA 2BX6A 3KKFA 3H59A 4CP5A 4LF8F 4MK8A 2QJ3A 1B0VA 3W2WB 3GG1A 5AE1A 3EXCX 2B0GA 4ZIWA 4IYQA 5KG6A 4B9UA 4RW9B 2C2OB 2J6TA 4DX8H 4PXDA 2AU0A 3KG4A 3S6EA 1RT3B 3R7SB 1D3WA 1UFWA 1H0HB 2DGQA 2DRBA 5KG0A 1CJUA 1Y3KA 1CJTB 4XIUA 1HWLA 3CDEA 3OQ2A 1D09B 1FWKA 2YX4A 4E98A 3CDBA 1T11A 4USIA 4IFVA 2W2NP 2NUHA 1RAEB 2VASA 2VG7A 1RTZA 4X84A 2K1RB 1UFKA 2KXHA 3J81j 1UPMB 1Y11A 4LFCJ 3MEEB 4L3NA 1X4CA 1CLFA 5DETA 4UUXA 3TX0A 3W9IA 2WOMA 2ZC3A 1TL1B 1AYEA 2HKEA 1XC9A 3CCTA 4LIWA 2G2OA 3FSIA 4FBTA 2XMVA 1C1CA 3CEDA 4OI6A 1TKXB 1AXQA 3MPVA 2DXFA 3MWBA 3TZWA 1PC4A 1HYSB 4JI7F 3KLFB 1QVGR 2RQMA 2R8JA 2FUG9 4C6AA 3KK2B 1LW0A 1IKVA 4WYLA 5HATA 1FHTA 3RR8A 3IGVA 4CLUA 4BS2A 5KFMA 1EP4B 4LVOP 2QIFA 1RT5B 2POKA 3UNGC 4ZVQB 5M2RA 2DXEA 4IO1A 2XQCA 3CJ0A 4B3OA 1URRA 2UXCJ 3E2EA 3BH6B 5ETQA 2CZVC 3DRRB 3RRGA 1I94F 4QYZK 2H5IB 2YVSA 4YY3J 3GSDA 4NXMJ 2KFZA 2KB2A 1YJVA 3W63A 2JZ5A 5JJBA 4OYZA 1N54B 1VLYA 3OLAA 3B4MA 2M7SA 2AP6A 2MKCA 1TR0A 2RAQA 1KFDA 3A1YG 5KFDA 5F3ZA 3CD7A 2KRRA 3JQKA 4CZCA 2E44A 4RUHA 3HHDA 2OFHX 1HQUA 1WG1A 2R2TA 4KAIA 2W9CA 2A3JA 2D41A 4YR3A 1WUUA 2W2PP 4UUWA 5KT7A 2DK2A 1IM4A 3W61A 3C14A 5CCMA 4WIIA 1HQEB 3GILA 1AB8A 4DCOB 1UKUA 3PKYA 1OQ3A 1AZSB 3Q24A 4K2JA 1RAHB 2C3MA 3D54A 4AE5A 1S1TB 3OSNA 2VQEJ 1DARA 2P2CB 1K47A 3V2UC 3N28A 1KVKA 1CJKA 2JC0A 2BMBA 1JLGB 2N4DA 1FRLA 4PR6A 2CPXA 4DR2F 3I9ZA 4KHMA 2YXLA 5HJYA 3D6MB 1IJEB 2IAJB 1F5CA 4OX9J 3NL0A 1TK0A 2OLWA 4F25A 1IVZA 4ZP7A 3CCZA 1LKZA 3DRSA 3CCUS 2B56A 3GIIA 1C1BB 1NSPA 4KGMA 2Q66A 4OYOA 2U1AA 4JV5J 4I2PA 3AH6A 3DXSX 5GMEA 1RT7B 2IY5B 1JNRB 1B64A 1RKIA 4HL9A 5A2QY 4X4SA 4ID8A 4NL5A 3HZEA 4ZKAA 3TJ8A 2F9DA 4ECSA 3GIRA 3DLLQ 4Z7CA 2KJVA 1S76D 5E3RA 4LT6A 4QBUA 4Q45A 3P4UB 4OZNA 3MXHP 3G9CA 2CQHA 2ZM6J 3D2WA 2CDQA 3KLEA 4EEYA 2Q6CA 2AHOB 3HHNB 3BJYA 3Q89A 1RHQB 3NXZA 2QYCA 2VKZG 4RU9A 3VGVA 1MWYA 3UE2A 2IDLA 3PRVA 2H4WB 5CD4A 3I9V9 1BWVA 1OY9A 4P72A 3BR9A 3TQ1A 4LF1A 4QPXA 2XY6A 3N5FA 4PWUA 4CCHA 4BWMA 1G3OA 1N36J 3MFHA 1T0TV 1YITS 1EB0A 2G13A 5JXSA 2F9JA 2CQBA 2HS0A 3C15B 4DR4J 1N5TA 3P6YC 2WCXA 4EBEA 1EKRA 4URSA 3MCMA 2V8GA 1V6HA 4WJBA 4N77A 2RQCA 5DG7A 3DLKA 2W9BB 3GONA 4J9SA 4LFCF 4I6AA 1XJWB 1XERA 4DV3J 1J5EJ 2C42A 1NK9A 1FXRA 5J2NA 2FC8A 2BRLA 2QV6A 2RQ4A 4DZ6A 5A8WB 2HVIA 2NREA 5T7LB 4DBQA 4RJVA 5A8KA 4IH6A 4OX7A 3W66A 2V94A 3EZUA 1X0PA 4WFYA 2CPEA 1S59A 3R1HA 2PC6A 4PKDB 2YWEA 5EWEA 1OJ4A 2I5JA 2YNIA 3EXYA 3H5SA 3KLIA 3CD0A 1FDNA 4RW4B 4HI1A 4P9SA 5IQQA 2AZ3A 3WIUA 4FN5A 5C25A 4JI0J 3RRHA 3CO0P 5LT5A 2BE9B 4ECYA 5I3UB 3BBBA 1VBXA 1D0EA 2HS3A 1YKWA 1WWHA 4UZBA 4HH0A 2Y1LB 1FE4A 3Q8PB 2OELA 3FBFA 2BUNA 3DRXA 4MKVA 1KC8T 2DJWA 3A13A 3M8YA 4BCAA 2UXCF 5HN0A 3BSAA 3CVKA 4DL6A 3FEZA 1RCXB 1RK8A 5SUHA 1XWLA 1SC6A 2LLZA 4YY3F 5KFGA 3H4DA 3Q2SC 4NXMF 5I3PA 5A2QU 3VALA 4DV1J 4BC9A 4LQ3A 1YBAA 2W4PA 3PVXA 2LKZA 4F02A 2PMWA 4UQGA 2E1PA 1GXLA 1WOOA 4O3QA 3ISND 4GC7A 2E1RA 1UW9A 2HHPA 5C42B 5KFFA 5ETOA 5L9NA 3MM5A 1HBNB 3MM9B 5JMNA 3GFYA 3CB4A 2ZVSA 1D8YA 1SXLA 4TYBA 2EK6A 4FYDA 3QBCA 4BDPA 2ROGA 1PYSB 1PAEX 3KJNB 4A8KA 2DNYA 1RT2B 4GVLA 1XQIA 2BYCA 1W2BR 3UNYA 2M8DB 2IIHA 4LSZB 1G1XA 1AROP 4B3MJ 1G2EA 3LANA 1GH8A 3QATA 3RRKA 4CDIA 2KFNA 2VQEF 4K4SA 2EFVA 2K3KA 1J27A 2QLJB 1SUQB 3QO9A 3QAEA 1RWMB 5KFUA 2KYZA 5KTQA 2XS2A 1IJFB 4F3QA 1RU2A 2HVEA 2FLOA 1TAQA 1WC0A 3SMZA 3AXKA 2EFOA 3PKMA 2XB2D 3UCZP 2K7JA 2ZNZA 3A4TA 4KHPJ 1VI7A 1VIOA 1NKEA 3LAMA 1TAUA 2N82B 5JVHQ 2V9WA 3O1LA 2ZDPA 1H98A 5L38A 5D0RA 4OX9F 4NX9A 2VDHA 4Q43A 5ETVA 4UY8T 1H7XA 3BPSP 2OKQA 4DI6A 1CQNA 1VJWA 2CZ4A 2ALZA 4RBVA 2SXLA 2UUTA 4JV5F 2YNHA 1FTRA 1ZTWA 4KV8B 1HBUB 1MMLA 2IM2A 5IQ6A 4YFUA 2DYAA 3C16B 3EE3A 3EPGA 2CVEA 3OSPA 4LBHA 1FDBA 1RSCA 1VGYA 3PHTA 3QRQA 2F8MA 1Y9OA 1HLWA 3DCAA 1RA7A 2UXBJ 2V5HG 1GMVA 2ZM6F 2DGVA 4CO5A 2IMWP 4IQMA 2YWWA 1RTHA 3OXLA 1FRIA 3ET6A 1TL3B 1XTZA 4I6YA 3KUHA 2GJIA 2UVRA 4ZCLA 2YKMA 3T19A 3KJFB 4EYHB 3MMCA 2IM3A 1N5YB 1Q8KA 4O4GA 2AF6A 5L1IA 4Y2AA 4BHQA 3KLGA 2W7OA 1JLFA 1IQTA 1N36F 3IRWP 1RWUA 4NLTA 2E29A 1HR0J 1VQSA 3ETOA 4OJGA 2HQ3A 3G86A 1WF0A 2DIVA 2HNDA 1H2VZ 1LW2B 1WJ9A 4YB5A 4KO0A 1OSCA 1RP5A 1RAOA 3R8YA 2FLPA 2EG1A 4DR4F 1YQHA 1VBKA 4FF1A 3LP2A 2VBWA 2LU2A 2B3TB 1L3UA 1CEZA 3QGHA 3F44A 4K4UA 1ICEB 2D69A 1S6OA 3B6BA 1TK5A 1U09A 4ZHRB 1U48A 3G71S 1GMWA 4DV3F 4NLDA 1J5EF 1VK3A 4F4KA 2VC0A 4OV1A 4L6V3 5E3QA 1ZETA 4I68A 3HJVA 4XAKA 1JMTA 2ZHOA 4NA3A 4TVAB 2KM8B 3GFHA 1MMDA 4WFXA 1IR2A 2YX1A 3CJSA 3V6KA 4EBDA 3M2UB 2F7VA 4TY9A 1NZ8A 1M5SA 4F3MA 4FF3A 1UTAA 3JB9k 5KFJA 1VHIA 4QWAA 2HWIA 2BJ8A 4JI0F 3T9ZA 3KNAA 4QYRA 4OJHA 1PJ6A 3TA2A 2V34A 4GO7X 1RXOB 2ZOFA 3FC9A 1S6PA 5KFPA 1HBOB 1XK8A 3WX8A 1JLEB 2Q3PA 5C7PA 4KFBA 3QFHA 1NKCA 2VH7A 2VFSA 5F8IA 1OSDA 1AUDA 2PEBA 4DSFA 2DNZA 1NDKA 4DV1F 2FVQA 2CPZA 4DL0C 1KTQA 5IC4B 3VAFA 1R6YA 2WVFA 1KVIA 2HFSA 3HO1A 1UWBB 3W3SA 1YJ7A 3CJKB 5DJBA 4J91A 4USUA 3T6BA 4C4WA 4NEZA 2JC1A 4Q0BB 3MEDB 3SBMA 4NXNJ 3GSIA 3I6PA 1YWXA 1ZH5A 1M5KC 1D9AA 3IN5A 1U45A 5IXUA 2HHTA 4MYTA 4KKOA 2UVWA 1OQ6A 1S6QA 3I96A 3GV7B 5HP1A 1Q86T 5CCLA 4ZA1A 2Z8QA 2R7QA 4B3MF 4DSKA 3RBDA 1F0XA 5HQMA 3M6VA 3DRPA 3T9NA 1HA1A 2GVDB 4S0MA 3QSYB 4ECXA 2Y1RI 4DSEA 3ICLA 2RS8A 3DGVA 3HSDA 1TUGB 3M1VB 3U1MA 4JI4J 5FLXY 2DIUA 3G6VA 2FGOA 1NPKA 1DURA 4KHPF 3IBFB 2VICA 1JJCB 5KFXA 3PJWA 2XMMA 4ICLB 3OL9A 4DCJB 1WEXA 3ISNC 3M7VA 2J9EA 4KGVB 1X4GA 2CJYB 3W60A 4PG6A 2A18A 3D0HE 5AXKA 4OYAA 5THWA 4NCAA 1MN7A 4O0NA 3Q0AA 2IYIA 2DNLA 2DH7A 1S72S 2LQ5A 2CNLB 4RX6A 1PYTA 4R5PB 3NGUA 3SSSA 1RYRA 2FGCA 4BC7A 1S48A 4DR5J 3KK1A 4FKXA 3W5XA 3MAAA 1Q4RA 3PYDA 1CULA 2PFFB 4WKRA 4C0HA 2ERRA 4IR1A 1N0VC 4ANDA 2XZTB 2DR8A 4DR1J 5C5JA 3CDAA 4ZITA 2BQUA 1WC6A 2B5JB 2OEMA 4Y00A 2N4CA 1NK0A 2KG1A 1FWPA 1LWFB 2MB0B 4ZPBA 2DT9A 4A8WA 2G9OA 5H9EJ 3SYZA 4EGLA 2FVPA 1SJRA 4DQRA 2YKPA 3Q8VA 1W2IA 1VQPS 1S0OA 4I67A 1HR0F 2ZOGA 3I55S 3H20A 2C2ZB 4OX6A 2G2YA 2J7WA 2VUGA 1TKTB 3CJQA 1YJTA 1Q53A 3EGNA 1X8DA 2D3UA 1DTTB 1QY7A 4HLBA 3IG1A 4WKYA 5BJRA 2M4MA 2F4FA 2RF2B 2MZRA 3JSMA 1VFJA 1VQMS 4GVBB 1UVLA 1X7VA 1NLKL 3JSYA 1U2FA 3LOUA 1TMJA 5E3AA 3OW2R 1RBAA 1S9EA 3HDSA 3G6YA 1R6VA 2B9XA 3P5BP 1RHJB 1QSSA 3C6TA 1YZ6A 2YBVA 5B7WA 4NOHA 5GADU 1FEEA 2HFUA 3HX9A 3KHGA 5FLXU 1EZZB 2YKQA 1AUSL 4PUOB 1T03B 2OGUA 4QR1A 4AD6A 2HQDA 1REVB 2HHUA 2XSJB 3HHLD 1NCLA 3J7Z5 2R8KA 1AFIA 3MDFA 1LWXA 3TEHB 3THTA 2VPXB 1HNVA 2G1DA 2QA2A 1M90T 1YG0A 5KG4A 3GZ7A 3RUBL 1SQFA 3BM7A 3ILOA 4RU2A 5L1LA 1T9WA 2RDIA 4JV0A 4ES1A 4AXJA 4ZLJA 4ERDA 1WOSA 3PRBA 5F8LA 2GS8A 4ZVTB 4MIWA 7FDRA 2LEBA 3CT9A 2DXDA 3GCWP 4DQSA 2HAFA 4O44B 1PO6A 1FFSB 2J9DE 3D4JA 2UUCJ 1HPZA 3OBIA 2GJ2A 4OHZA 1TL4A 3R1LA 3PIOQ 1FO1A 4NXNF 1D9DA 2WTFA 4ZVRB 2IRUA 1HW8A 2GHPA 3QWPA 2OPQA 2CFXA 4E8UA 5HI7A 3UCGA 3IS9B 3BN4A 2EI5A 1GK8A 3R3TA 3HCXA 2Z30B 2IRXA 1S4FA 1WI8A 1S5ZA 4M5HA 4Z37A 1RT6B 1U2CA 5DGAA 2XZDB 2RUSA 1SKWA 5T14A 2J8AA 1RTDB 4TU7A 2ZUAA 1E6YA 2P6SA 1NHVA 1G7CB 2MSSA 2DNGA 4CO4A 4AL5A 3QSIA 2HWTA 4CLZA 2MZTA 3HI9A 2GA7A 2MHEA 2CPJA 3SSQA 1FKOB 1S7IA 3QGPA 4HT7A 2WVBA 2FHMA 3DLEA 2HGLA 3MD1A 4JI4F 2OAUA 3AQPA 4F36A 4XPEA 1R0BG 2PI5A 4DV0J 3RGIA 3LP0A 1RBLA 1OYEA 4QJVA 4G65A 2MLYA 4WP3A 1RAFB 2J0SD 2QLFB 1WHYA 5CH7B 3D28A 4WFAQ 2DISA 1YBUA 3GYNA 1OWXA 1CJVB 2BW2A 1HNWJ 3GJRB 2B9EA 3GLJA 3IRXA 1F6TA 2DR5A 2IJRA 1HWKA 1VQ9S 4QU7A 1IBLJ 3DXBA 3PFOA 3AY0A 1FJGJ 3LPYA 3RG6A 3BGRB 4QQBA 5HLFA 2V4RA 4C3LA 3CMES 3O6QA 3QQCD 1JJ2R 2VDIA 4R8UB 3VWSA 1JQGA 4DR5F 4WU2A 1TL7A 1Y5IB 4NASA 3KHRA 5ITHA 4K4XA 3HT0A 4DR1F 2DBBA 1FE0A 4A46A 1XEZA 4B3SJ 3IWXA 3PW2A 4QU6A 1UWAA 2HHWA 3K5PA 2E1CA 4YHHJ 5KFEA 2AYGA 3GYXB 1S12A 4A48A 3D3CJ 3I5CA 2CNNB 2HNZB 1ZM3A 1BLUA 3AXMA 2CQDA 2XWYA 3C2PA 4OYXA 3HSZA 3I0RA 2BJ1A 4MMOA 1NJXA 4J9PA 3SCJE 4AYBD 1NK4A 1XR5A 5K8PA 1QM9A 4JI5J 4G1QA 4TU9A 3PW5A 3OTBA 1IKXB 4W92B 2DH9A 3G8TA 4QW9A 4LR8A 3W64A 5I42A 4A8XA 1M1HA 4OJ3A 3N0VA 3MCSA 2RUGA 3TZYA 2C28A 3TJ9A 1FNMA 2ZC4A 3M8PB 3BPDA 2LXIA 1QE1A 3BBCA 2KZMA 3VTIA 2YWKA 4ZLPA 2CQ3A 3NNAA 4CTAB 1VBYA 1F3FA 1VQKS 1GNKA 3RZAA 2W7PA 2V8PA 4UOHA 4RKUC 5B0EA 4HDHA 4RUBA 2W2OP 3CIZA 4ZOSA 2BV3A 2H51B 2WW8A 4CLSA 2J7UA 2HYIB 4CLLA 2E5HA 2CQ1A 4A8MP 4X4QA 2F5GA 1U8WA 4NMLA 1B7FA 4CO3A 4Q7AA 4CH0S 5IZHA 1UEKA 3K8VA 1VQ4S 3D0IE 4YP3A 4RW6B 2X1FA 3CCRS 2R7RA 4IO9Q 5K8MA 3HJFA 2BDPA 3WX4A 3OV7A 4EK2A 1VCTA 4NLRA 5A0YB 3RB0A 3J80Y 2DHGA 1L3VA 2IPOB 4DV5J 1SL0A 2QL7B 3CW2C 3H98A 5HMZA 2F8EX 3BH7B 2DHHA 2QYGA 4CWBA 1LV5A 4ED1A 3IR6B 2I38A 1ZA1B 2GGPA 2C2DA 3EZ5A 4EYIB 2OJ3A 2E9RX 3I32A 5D78A 1KLMB 1S97A 2UUCF 2HEKA 1LWCA 1UPPA 2FY8A 4LF9J 3ISZA 2UVVA 2ZH4A 1C0UB 1H74A 4C8ZA 1U1RA 4ZIVA 5E41A 1WD6A 1RWKB 1JLAA 2AYMA 4ZJLA 3MOJB 5G4DA 1KNZA 1BWEA 2DNPA 2VBXA 3W9HA 1TKZB 2JLEA 4MFBA 3VAIA 1I1GA 3CC4S 4DFPA 3ZZRA 3AD7C 1R0AB 3JYTA 3I4HX 4A8OA 4FPIA 2LVWA 3SQGA 4W90B 4XO0A 1H7WA 2ZJRQ 1VQ8S 2EG2A 2MYFA 3CSKA 1NM2A 3LH2S 1YX2A 2OD6A 1KOOA 3KNGA 1K44A 4RW8A 3AODA 5KFVA 1SL1A 1PBUA 3GQCA 5U47A 4LSLB 3IGNA 4C8KA 4MYUA 4FXDA 3LF0A 1MG7A 1SIWB 4AT1B 2V4JB 2YKNB 2E1AA 3PJ9A 4M5DB 2K2PA 5M2UA 4HR2A 1HD0A 3NAIA 4LSNB 2X3GA 4DSIA 3HKZD 4DV0F 5I4MA 2FJXA 2MLZA 1R8PA 2BRKA 2HHHJ 1GTHA 1KFSA 2JX2A 3RAMA 2EXUA 1MW7A 4WFZA 3FRZA 2MQ8A 4P74A 3HD2A 2R7WA 1G6BA 1KQFB 4Y34A 4CRJA 1CJUB 1WC3A 2KFYA 1RWVB 2OTJS 2M3DA 1T02A 3I87A 1HNWF 1DQAA 1HI0P 2V9KA 5B09A 3R2DJ 1PIEA 4YOEA 2XGQA 1IBLF 2D7SA 4IFVB 2C22A 2MPUA 2QC3A 3M8WA 1FJGF 1VRUA 2VG7B 3MM8A 4LVNP 2B9WA 2VHGA 2Z2MA 2BKNA 2RQKA 2OIHA 4YB6A 2BBEA 1XIQA 5LSLA 1K0TA 2KKHA 1SIZA 2WOMB 1TTHB 3J80U 3EGZA 3G6ES 2CPHA 4QWDA 5AXNA 2X51A 3PX4A 3FBBA 4B3SF 1TU0B 3LWMA 1C1CB 2NSCA 1B3TA 1UFLA 2EEYA 3JXOA 3IM8A 3R6LB 3U1NA 4YHHF 1RZMA 3R9LA 5HSPA 1LW0B 1RT3A 3AAWB 1IKVB 3OVAA 4RBUA 1GXTA 5B0BA 1QAJA 4P6QA 1FCAA 2PDAA 3F0NA 3CCWA 4OHXA 1SJ4P 2KYXA 1IBKJ 4JI5F 2Q1LA 1YRXA 2DPIA 1VQNS 2F4VJ 2DPJA 3O8WA 1S79A 4B3OB 2IBKA 3DLGA 1ZYQA 4YN3B 2QFIA 1H73A 4FYXB 3PM9A 2NXUA 1SQGA 3IO1A 1Q1KA 2EFNA 1RWPB 2FJEB 4OI0A 4BLGA 5HVFA 1RTJA 5D0HA 1OPIA 4LBPA 3DOMA 3FDSA 2Z2ZA 2U2FA 1NDLA 2KDOA 2R7TA 5LM7E 3G2XA 3QIDA 3NWGA 1FTCA 1TV6A 4O0IA 2BABA 5HMWA 3KLFA 5J1NA 1NPRA 2QFJA 3OL6A 3TNVA 1BQXA 2A6OA 2G0IA 1Q7YT 1HQUB 3G4SS 1RAAB 3DM2A 3OLBA 3QYYA 1EP4A 2QA1A 1EETB 3H5YA 4DWIA 4C97A 3RW7A 1U47A 1VC6A 4ID5A 3LW5C 1NPPA 3CE8A 4PEOA 2R8GA 3M30B 2BQ3A 1SJ1A 2W7AA 2ZWOA 4DN9A 4I1TA 4DV5F 4UT4A 1SB6A 4DSLA 1FVSA 2HK3A 2JL9A 3DOKA 4M1KA 4K4TA 3OTCA 4J9UE 3K0JA 1N0UA 2RRAA 1SH0A 1X9SA 2QA4S 1TK8A 3BSNA 4P52A 1FI4A 1T3NA 3GIKA 3TJAA 3G82A 2EW9A 1QLNA 4WZQA 2R7UA 4LR9A 1UEUA 1WKJA 3A3OB 3UCUP 4LF9F 4IKAA 2DR7A 2RSQA 1X0FA 3ELHA 2E1MC 2DGXA 3BS9A 3TUIC 2V4QA 3GV5B 4DQQA 3HVTA 2ZH1A 2ROEA 3DRSB 3GG0A 3DC2A 5ETLA 4NA2A 2GIRA 3MFIA 1O5JA 4GKJJ 1LNQA 3ULHA 4I2PB 1SKSA 2JRSA 1PJ7A 4C8YA 4QW8A 1AZSA 3BV8A 4ZJQA 4CM0A 2O1PA 3NLCA 4ZVOB 4PG5A 5HJXA 5D6GA 1QD1A 4JYAJ 3MTJA 4GMKA 1I3OB 2IFXA 3IMQJ 4X4PA 7AT1B 2NZCA 2ZH3A 4X4OA 3MMJA 5DRKA 4LQ9A 2HBZB 2KT2A 1ROFA 3KLEB 1GX6A 2ZNYA 5KOWA 1VHFA 3VZHA 2XG8A 1S10A 3B54A 2YNFA 3I82A 4ZCIA 2AMCB 3W8PA 4LF2A 2HHHF 1DTQA 4C2MA 2XBPA 2BM1A 3EVMA 2XMAA 1U4BA 1KDNA 3CGIA 4ANCA 4LF4J 3QNWB 4CH7A 3K17A 1V3RA 4HTJA 1B4SA 1MROB 1W7WA 3R5JB 4QYZJ 3IAS9 5GMKa 4QIGA 2CPIA 1SKRA 4Y3CA 3Q8UA 3ENVA 4NI2B 3PYEA 5H1SV 3T1HJ 1D8ZA 6FDRA 2JFDA 3MECA 3Q8RB 1DFDA 2ZBPA 3KXDA 1GAOA 4F67A 4F3OA 4KTQA 3DLKB 2JSXA 3MTKA 3DI6A 2DGTA 1KEKA 3KMSA 3C46A 4TLRA 3MOZA 5J2NB 3OUYA 4HTIA 3BB5A 2E7XA 2B43A 2ZH6A 1X5OA 3KDNA 3EMTA 4ETZA 1JK9B 4Q8FA 1RHKB 2J8SA 5DDPC 2P9GA 3UVJA 2YNIB 2FHJD 3LTOA 2DNKA 2NXEA 3KLIB 8RUCA 5DZ7A 1UA1A 3T41A 3NWRA 2QLBB 1S4EA 1PG5B 3VAMA 3H2LA 5KFKA 2XYGB 3A8JA 1B99A 5C25B 2YWHA 4EI2A 1KQGB 1WTBA 2FZKB 4IRKA 3M8QA 2UUWA 4NLWA 2D3OR 1U1NA 3K8WA 3ITHA 2DTJA 1DLOA 3JSRA 2KH9A 2V6AA 1IBKF 1X5SA 3R27A 2F4VF 3UO0A 1R8CA 2DHXA 4WXOA 4WWSA 1T94A 2W9BA 4KQZA 2EKNA 1UJ5A 2HQIA 2CJQA 1YJWS 4H4MA 4X2BA 1N5QA 5AXMA 3VR1A 2YH0A 2F3JA 4CLKA 2QE5A 2RHSB 2CRLA 1Y5LB 4K8RA 5D4PA 3LP1A 4DJBA 4CI0B 3DFEA 3PG9A 2HLTA 1FKPB 3MM5B 1S99A 4DUZJ 2ZEJA 4XDCA 1HHTP 4I0WA 2HFOA 1M5HA 5LJ5Y 3GYGA 2C1EB 3ZNUA 4KHRA 3E01A 4X66J 1FA0A 2ZE2A 1RHUB 1Y10A 2UV8G 4K4VA 1WG4A 2N3LA 4PG8A 1L3TA 2V2ZA 1T7PA 2EBGA 2M2BA 4URQU 2ZH8A 1Y0HA 5ETKA 3QO9B 3AOBA 4CIOA 5DO2A 1BQMA 3UD4P 4ZVGA 4D3HA 3CJTA 5GVQA 1EQ0A 2HFZA 4IR9A 2XMKA 3WC0A 1XN9A 2E5GA 1RAJA 3M4XA 1KONA 1VIXA 3QPIA 3GFXA 1Q7LB 4TKTA 3P8BB 2ZBIA 4DV4J 1QSLA 1X4EA 2PD1A 1LWEA 3DHXA 2FJVA 2WONA 4P2FA 2RRNA 2AZ1A 1RT2A 4GKJF 2YNHB 3GR0A 1PC5A 2VOOA 2FZCB 2WSEC 3OR2A 1QAIA 2DHAA 3RTVA 1KTVA 3VHQA 4ZMMA 4JYAF 3HLUA 2ZJPQ 2CQGA 3HF5A 1SUQA 2DO0A 2H1YA 2V2QA 4ELVA 2DNMA 5E5NA 3PR5B 2MKJA 5IM0B 3Q8SB 1WEYA 2BE7D 1Q5YA 2H3EB 4IH7A 3HVWA 4P75A 2MSTA 1SBRA 2LP4A 4K7QA 1RTHB 1VJQA 2W4DA 3ET6B 1VLOA 2OFGX 5EWFA 1U6ZA 3TVKA 2C3UA 2HNYA 1Y7PA 4RBTA 2YKMB 1RDRA 1NKBA 4X4UA 3MMCB 4W4MA 3CCVS 4DUTA 3POTA 4O4GB 4CLTA 4D3GA 2WRMA 4NLGA 4AUKA 4LF4F 2HHVA 4JBCA 1WHXA 4NYOA 3PYGA 1ACMB 2MJUA 4Q2LA 2F8HA 1N34J 1JLFB 2I6WA 5MLCV 5CQGA 1XMQJ 1HBUA 4X4VA 4ED5A 4LUBA 2HNDB 2P9CA 4M5JA 4O23A 2XNRA 3IFEA 4KO0B 2DCLA 4LIRA 3C16A 2FVCA 5HROB 3T1HF 1YBTA 3CCES 1SJFA 2DO4A 2CJBA 3BBFA 2RIJA 3LP2B 2O67A 3ZTPA 3HVAA 3D1QA 8AT1B 4NLPA 4B9TA 4ECQA 2OPSA 2RDJA 1HMVA 2J76E 1V3SA 2G4BA 1XBWA 4DUYJ 5FDLB 1NEEA 1WC1A 3IM9A 3NNCA 2EVZA 3JS9A 4F4XA 1KWMA 2YWGA 1NK6A 3D6FB 3VF0B 2KU7A 3HSGA 4KGZB 4U95A 4B9MA 1SH3A 4ZK7M 3TVZA 2XI3A 2QN6B 2XI2A 4U7UD 2XTJP 2KN4A 4JI8J 2N7CA 5KG7A 3P96A 4WPAA 2MKIA 2BE2A 5K8NA 1QVFR 1H3DA 4NA1A 5CZVA 1YJUA 3PDNA 4BWJA 1KD1T 1SV5A 2GQCA 4F0KA 2W01A 3MUTP 3FBEA 2R2UA 2UP1A 1KLNA 3WQPA 3NS5A 1S6PB 5CABA 3EDQB 4CNYA 3H25A 2H65B 1UZHA 4KFBB 4ECRA 5J2MB 2J6UA 4IUFA 3G96A 1ZPWX 4I2QA 5ETMA 5ETPA 3K5LA 4IDKA 5KFHA 2VONA 2GQ2A 3JTPA 1ZZNA 1UVMA 3HPOA 1NB2A 4DPTA 2Z56B 3D6HB 4RW7A 2BQRA 2BXJA 4CLYA 2G1HA 2MY7A 5KT3A 2FJAB 3KHHA 3H0PA 3EJMA 4TN2A 2RKIA 4XK8C 5F41A 2FQQB 1UVNA 2FTRA 1TUVA 4U8YA 4C3KA 3VZIA 2MQNA 4DUZF 4NZ0A 4USVA 3C6UA 1L3KA 3D7SB 5E0OA 2GCFA 4RWXA 4KKOB 2VPYB 4J9QA 1S6QB 2RILA 2MY8A 4NE9C 2KXFA 1QAYA 5HP1B 4ZVPB 5KT4A 2DCUB 3HK2A 4X66F 3ZTOA 1R27B 2R9LA 3GWCA 6FD1A 1QSYA 4Y2KA 4JV2A 2YKOA 3DRPB 1TVRA 5GAEI 1SPBP 4P10A 3FEXB 3NKYA 3QJLA 1S1UA 5H9EK 1CBKA 1RJJA 4YUDA 4WK3A 1VC5A 2AYEA 5EN1A 4HI2A 4HHUA 1WKKA 1RYSA 3FNNA 4MKYA 1BQNA 3C19A 1UWBA 1K1QA 2CNKB 3CJKA 2HHSA 3NY0A 5CYMB 2FLNA 4Q0BA 5BR8J 2DY9A 3HSJA 4TXSA 5CYQB 2LCWA 3BKTA 2VFRA 4N47A 4P2MA 4CT8A 2P9EA 3BQ1A 3W2VA 4DV4F 2B4PA 4WE1A 4A4JA 2MTLA 5CZXA 2HW3A 1KS2A 4BBYA 4AQYJ 2HIQA 2LEPA 4ZLLA 3ONQA 2DEJA 1NO8A 2OI2A 3OVBA 4ZVEA 3U02A 1FK9A 4M5IA 4DSJA 3NOCA 1BHNA 2HGMA 3M8SA 4DPYA 1M5PC 5J2PA 2UZAA 1Q8BA 1RBOB 2K8GA 4DX6A 4RNFA 2AJ1A 2V63A 2C2NA 2LQ9A 3NMRA 3MAAB 3BYPA 2OEJA 1CULB 3FMWA 1S77D 4K50A 4G3IA 1PCAA 2JDJA 4AXIA 4F8RA 4MJKA 3DN9A 3QIPB 5DZ6A 3O44A 1HL6A 1IR1A 3KUGA 4NRTA 1U1QA 5RUBA 1JKHA 2HG4A 2WSCC 1P1LA 1N34F 5KG5A 2GO9A 3L4BC 1XMQF 3ZZ0A 3CNQP 5IV4A 3T5KA 3QRRA 4DR7J 2Y0BB 3TZZA 4MIAA 1U0SA 2VA2A 2MZ1A 5D15A 4OX8A 3GJTB 3IR7B 3QFWA 2P6TA 3IG1B 1WSVA 2D74B 2L3MA 3JSMB 4JV1A 4DUYF 2M9KA 1HWIA 2FJDB 3IR5B 3BGLA 3IBWA 1S0MA 4KBIA 2FPHX 4ATNA 1HKAA 1S9EB 2IRYA 1IKYB 3AT1B 4Q8EA 2BR0A 2Z4PA 4EU0A 2K7KA 4ED8A 2MGZB 1I6JA 4NEYA 4RUAA 1WDDA 3C6TB 4DL2A 4DV6F 4FF2A 4JI8F 4DZDA 1HBMA 1T3OA 4IH5A 5DG9A 4UOFA 3R5DA 3M2VA 3TI0A 4RZRA 3UDEA 4U67Q 4C8LA 1FEHA 4EUVA 4W98A 3W9JA 1O0PA 3SFGA 2FYXA 4OYIA 2B9YA 4X64J 3HFVA 2PA3A 5D3GA 4LRDA 1HFEL 1RT4A 2GMLA 1HNVB 2QMWA 4ES2A 2CIMA 3MHYA 1UAWA 1NXIA 1F5AA 2R3VA 4LRAA 2ZJQQ 2MJNA 4KSEB 1IWGA 3OFHA 4QR0A 3AJ2A 4Y2IA 3QGGA 5HQLA 1Q95G 1DZ5A 4DQPA 2B51A 2QO3A 1R0CB 1R43A 4N8OA 1J5OA 3Q23A 3EICA 1NDCA 1HPZB 2APOA 4PWDA 2HQGA 2FC9A 4WF9Q 2HRUA 2BVZA 2LDIA 2ACYA 2E5JA 4DL5A 3UN5A 1V5VA 4KC5A 1YVFA 2OPPA 3R5GA 4A8SA 2JEJA 2MQQA 4J9OA 1CG2A 1WTFA 3PO5A 2OPQB 4PYAA 1FFGB 3V4IA 3R5CA 3DMJA 4KT0C 1HNXJ 3PHEA 3FMBA 4C8MA 1NK5A 3CWJA 1EJ7L 3CDWA 1U1KA 3PV8A 1RCOB 5KFBA 1WOPA 2LU1A 4DR3J 3FK4A 1G4CA 2XULA 1E6YB 4ILRA 2VA3A 4LF5J 4XTTA 1S7HA 2CQ2A 3PRDA 4H4OA 2NSBA 5E2QA 5A76A 4C7QA 2AGPA 5GAHI 4EFAC 3H5XA 2AV5A 3RBZA 4JUZA 5AXLA 3PTWA 3DLEB 2XZWA 3MEGA 3I31A 1FD8A 3B78A 1DBDA 1EX8A 4A8QA 5HBMB 1R8AA 2O3DA 3TAPA 2GVZA 5KFTA 2HMIA 1WNEA 5AJ3J 5BR8F 2ROPA 1Y5NB 4PQAA 3UPFA 4LFAJ 1WF2A 3TAMA 4B3RJ 4L74A 3ENWA 3W65A 5I3QA 1K73T 3OPKA 3UDVA 5K14A 4U7UK 3D66A 4AQYF 2LQ8A 3QGIA 4RWWA 4B9VA 5J1EA 4NPOA 3MM6A 4CLPA 2ZD1A 3MR3A 4CO2A 3G87A 2OSRA 3IRXB 4J9KA 2B7CB 1OY8A 5F9LA 3QRPA 1U1PA 3BZQA 1N32J 1RWXB 2WBMA 5HLFB 4CT9A 4Q5VA 5EWGA 1HIYA 1VRQC 4HKQA 3MMBA 3PR4A 1FERA 4OIXA 4OZ2A 1TL7B 4NLUA 1W25A 5E7OB 4I6WA 3FRYA 4I7FA 4DXLA 3FGVA 3KK3B 2PMHA 3OHBA 3R5BA 3LQVA 4K5SA 2HSEB 4EBCA 4WIQA 4ED4A 3TO8A 2H5EA 2YNGA 4B08A 1NJIT 1LQ9A 5DQGA 1FXLA 3IAM9 2WB4A 3V6JA 1WDTA 4ETXA 2IVYA 4NLQA 4ITSA 4MKBA 1CS4B 2ZHBA 4ZP9A 3JTOA 4WFBQ 3I0RB 3HFKA 4QOTA 4P71A 1F9FA 1TP7A 1U6FA 1M1GA 1P9YA 2R8IA 4F0MA 3MR6A 4DR7F 5ETSA 3HHKA 4G1QB 2Q43A 1FF2A 1UW4A 1RTIB 3RB3A 4UOCA 2PO4A 4ZP6A 2GIQA 3M2RA 3IXQA 4LF6J 4TNOA 4ZPTR 2KL8A 3UD3P 3TP2A 1X31C 1QE1B 3VVUA 1F9HA 4OV6A 2ZHAA 4OHVA 4MK7A 3H7HB 2CQIA 2YQ1A 2M5YA 2CADA 1IN0A 2LYVA 2EFGA 1NHKL 3OTOJ 3I56S 3M32B 1IXKA 2XNQA 2PT0A 5AE2A 3I5BA 4FPRA 4ALZA 1SL2A 1IWAA 1UP1A 2HVHA 5KFRA 1H6KX 4ZPDA 3ZTSA 1S0NA 1JLBA 1S57A 3L09A 2BACA 3CD5A 2KVQE 3X3UA 2QZ8A 4X64F 1ELOA 2CVIA 1MU2B 3FKBA 4WU3A 3WHIA 3GCXP 2CAJA 2OMOA 4ZCKA 1ZAVA 2VFVA 1F2HA 2LMIA 5KT5A 1GQEA 4HHHA 3KTQA 3CMAS 3R7NB 1N5SA 1N6QA 5A8RA 1RAGB 5K9FA 4DDFA 2OPRA 2GGPB 5DDQC 3TZXA 2MKSA 1YTYA 1XNQJ 4F26A 4Y28C 1LWCB 5DG8A 5BYQA 1SQEA 5ADZA 4CNZA 2NUUG 4N8NA 2YY3A 4RUCA 2AQ4A 2UXDJ 2HRYA 4OZ5A 3I0SA 1JLAB 4HHJA 4PQUA 3MM7A 9ATCB 4DS5A 1FT8A 1T8EA 1Y4ZB 1HARA 1FNOA 4IG0B 4DN0A 3A8IA 1RWWB 4MFBB 3TA1A 4F7VA 3SEOA 4KE5A 2N7YA 3I4PA 1GFWB 1HNXF 3JYTB 3Q83A 3MEKA 3SQGB 5LMUJ 3OR1A 4X4NA 2M8HA 3CPWR 3CIMA 2XLJA 4DR3F 1WG5A 3TW0A 3N6LA 4RW8B 3ZNJ1 4Y6IA 2G0JA 4LF5F 2DNRA 3THVA 1H72C 2K06A 2R2RA 3PIPQ 3VQSA 4K0KJ 1K0VA 1OPZA 5BXIA 4U9RA 5ETTA 4M94A 2QSWA 5KG2A 4X4TA 1C0UA 2CWKA 5AJ3F 1OMSA 1IM6A 4LFAF 1VQ5S 3RB6A 4B3RF 1N5VA 4USJC 1SCJB 3DDKA 4J9VA 2I9SA 3MAQA 2O66A 1WACA 2XO6A 1KHVA 3VGUA 2FHKA 1LFPA 4OMFG 1R0AA 3PX6A 1MWZA 3PW0A 3EM1A 2XHWA 2VQFJ 4OZ0A 2BJ9A 2CXEA 3KLHA 4AFFA 4RLEA 1HW9A 1RT1B 1U1LA 1N88A 1S1XA 5KG3A 1N32F 1VRUB 3MM8B 3BYRA 3LO3A 5LSRA 4NLSA 3SI8A 3BDPA 1KQSR 2DB1A 5T41A 4WZMA 2DNHA 1FVQA 2QSFA 4CYUA 4KRWA 3V4MA 4KJIA 3DOLA 1ZS6A 2VOPA 2J0XA 4V19X 2YKNA 4OZJA 2VPWB 1VQLS 5HAOA 4F4AA 3CDUA 4WTOB 3TQEA 2H5JB 3PZPA 2BZ2A 4ZVHA 2H54B 5KFYA 4PABA 2I1RA 3MCOA 5HANA 4GO5X 2HZAA 1HD1A 2C3YA 3V5RA 2MZSA 3NGTA 1U7LA 1VRTA 2NPFA 4USWA 2ILYA 2RU9A 4ZPWR 1RLCL 1S6UA 2HGNA 3CCSS 1A7GE 4PXCA 5F9NA 4HEA9 1HNIA 3QMQA 1Q16B 2X1BA 2W24A 2AYBA 1AFJA 4JI6J 1YIJS 3OL7A 2XGPA 4WP8A 4HACA 2YKAA 1UCNA 2ADBA 2EBEA 2X1GA 3ZZZA 1X5TA 3QT8A 1N8RT 1ZPVA 4KPYA 2DNOA 2Z0GA 1FRHA 1QDUB 4UW2A 1VOMA 2MMYA 3T1YJ 2W9AA 4Y0FA 3GV8B 1GXUA 3DLGB 2NXCA 2CYYA 3H2VE 1T95A 4LF6F 5J2QA 2H48B 5CHCB 3PW7A 4A47A 5K8OA 5D0GA 3ILJA 1BC6A 1N4LA 4N7TA 1RTJB 2HWHA 3HM9A 3D0GE 4C11A 3DOMB 4LF7F 2Y3YA 3ADAC 1U6BA 2IM1A 3HKWA 2DY1A 2VU5A 3DKDA 1TV6B 4YDXA 4K4WA 3NEKA 5HVHA 2UUAJ 5EX3A 1MSWD 3OTOF 3BO4A 2BANA 3DGPA 2HHQA 4OQJA 3NMAA 1VBZA 1AA1B 2DR6A 2BKOA 3DM2B 1RAIB 2VG6B 3OFGA 1T05A 4ID5B 4QIEA 5B0AA 2HQFA 4FS1A 3QLHA 1TFYA 3HHLA 3D1HA 3SDEA 1NRKA 3MPUB 1LFWA 1YJRA 2ASJA 3S7RA 3DOKB 3QT5A 3NS6A 2WHOA 4FXWA 2WVEA 3SCIE 3Q2TC 2DD8S 3G82B 2CA9A 3M05A 2F40A 3PEJA 1XNQF 2UV8A 2N3OA 1ZTTA 4KB7A 4OHWA 4O3NA 1RQ0A 4WXWA 3LPEA 5SZTA 2WSFC 3OL8A 4M5GA 2XM3A 2UXDF 1HHQA 1T9XA 1H2UX 1P6TA 4DOZA 1I51B 3TOQA 2HZCA 4U96A 4DU8A 1B0TA 1GT8A 3HVTB 2RE1A 1EETA 1U2RA 1NMEB 2GMHA 5BYSA 3KJVA 1C0TA 4NWBA 2RHQB 2OSQA 5G0RB 3DHWC 3ZC4A 3M30A 5LMUF 2FIUA 2BM0A 4N76A 1X4HA 3FQKA 3PACA 3EGWB 2QL9B 4P2XA 1QTMA 2LQJA 1NJWA 3C8YA 5GAGI 3MUVP 3G8QA 2KT5A 4K0KF 2IMOA 3NCQA 3HMJG 3PNIA 4QIVA 2DNQA 5E3CA 1YLXA 1U1MA 3ILIA 1R7IA 2WK4A 2YNFB 2R42A 2NZ4A 1DTQB 3BKUA 5MAOA 4UOGA 4URGA 1IKWA 3AD9C 2VJVA 3NP5A 1N56A 5DQIA 3V81A 3W7BA 3HULA 2DGWA 4YB1P 2B6AA 4V1Ak 1JXVA 2VQFF 5J1PA 5HK4A 4X62J 4CLFA 1REGX 4J90A 4LRBA 3ZO7A 1Z2LA 1ZM2A 4LBIA 3W8GA 1KKHA 1NK8A 3MECB 3H4BA 1U8SA 3X1LB 3H90A 5L46A 3T5LA 3UR3C 2HPUA 2ASLA 3W5YA 3DI6B 3G8SA 2V0NA 4ED2A 1VS3A 3OUYB 3J7ZT 2E66A 2E5LJ 2VZ9A 4J9NA 4MAKA 1Q78A 4J9RA 2VV5A 3BGFA 2BJ3A 3FCWA 1E6VA 3W62A 3UVJB 4PG4A 4FBUA 1WELA 2M52A 3J7YI 3AJ1A 3P45B 3TUPA 1D9FA 5KFWA 1MROA 4ZDNA 1TUWA 3MI7X 4B9LA 4ZN3A 3M8QB 4JI6F 1MN9A 2FVRA 3HFZB 4G1PA 3PCOB 3ITHB 4NI2A 1DLOB 1CC8A 2CZ9A 3WZ0A 3ENAA 1NNDA 1VR6A 4XDDA 1FJEB 1WF1A 1V3ZA 3T1YF 4DHVA 1D1UA 3VCDA 4F4WA 3AJDA 4H4MB 2GJFA 3AFGA 2QMXA 3K58A 2PMZD 4ECZA 2AJQA 5IT4A 1S9GA 1TFWA 1Z4UA 3IP0A 1APSA 4B3TJ 1R3NA 2ZBQA 4G1IA 3NCPA 3F56A 1U49A 2R4FA 4L73A 4C8OA 2PE8A 1FRXA 3LP1B 1FX2A 5D77A 3MMAA 2UUAF 1CPZA 1PBAA 2NXJA 4PXEA 1UVKA 3CULA 3FQLA 4ZN1A 4MT1A 3L7OA 5C24B 3OTEA 1U0HA 2XY5A 2WAQD 1XR7A 2LFVA 4JP8A 4ZLNA 4MKAA 3CCJS 1X5PA 3E01B 2HBRB 5DQHA 2WZ1A 2ZE2B 3K5MA 4ELTA 2KHCA 2YPZA 3M6WA 3MPYA 1T9TA 2CJ9A 2QG9B 4GRSA 4Q44A 3BEGB 2BEFA 3M9MB 3EPIA 4KY3A 3NBPA 4UY85 3Q86A 2IBOA 5EDWA 4TY8A 3FFIA 4N5SA 1BQMB 3TR5A 1S1WA 2CG4A 2XYHB 1RKJA 3UFCX 4DEZA 4QR2A 5F3TA 1SI9A 3SV4A 2XHCA 4N56A 2IC3A 1JNZB 1JWWA 3MR5A 2C2RA 2V2KA 3ILLA 1FKPA 3UWTA
chains in the Genus database with same CATH topology
4M5IA 1EQMA 3IP0A 4CYUB 3HT0A 3HD2A 3HSGA 3UDVA 4F7VA 5ETTA 3HSJA 4M5MA 1TMMA 4CWBA 1RU2A 4M5KA 3HCXA 2F63A 3KUGA 1F9HA 5ETMA 5ETPA 4CRJA 5ETNA 4M5LA 3QBCA 4CYUA 3HD1A 4AD6A 1HKAA 1EQ0A 5ETLA 1RTZA 3ILJA 1TMJA 1KBRA 1DY3A 4M5HA 2F65A 4M5GA 3UDEA 2CG8A 2QX0A 3MCOA 3MCNA 1Q0NA 1CBKA 1RAOA 3HSZA 3ILOA 5ETOA 5ETQA 5ETVA 3HSDA 1RB0A 5ETKA 3ILLA 3KUHA 4M5NA 3ILIA 3MCMA 1G4CA 1IM6A 4PZVA 3UD5A 3KUEA 5ETRA 2BMBA 1HQ2A 1RU1A 5ETSA 1EX8A 4M5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M5I A;  1EQM A;  3IP0 A;  4CYU B;  3HT0 A;  3HD2 A;  3HSG A;  3UDV A;  4F7V A;  5ETT A;  3HSJ A;  4M5M A;  1TMM A;  4CWB A;  1RU2 A;  4M5K A;  3HCX A;  2F63 A;  3KUG A;  1F9H A;  5ETM A;  5ETP A;  4CRJ A;  5ETN A;  4M5L A;  3QBC A;  4CYU A;  3HD1 A;  4AD6 A;  1HKA A;  1EQ0 A;  5ETL A;  1RTZ A;  3ILJ A;  1TMJ A;  1KBR A;  1DY3 A;  4M5H A;  2F65 A;  4M5G A;  3UDE A;  2CG8 A;  2QX0 A;  3MCO A;  3MCN A;  1Q0N A;  1CBK A;  1RAO A;  3HSZ A;  3ILO A;  5ETO A;  5ETQ A;  5ETV A;  3HSD A;  1RB0 A;  5ETK A;  3ILL A;  3KUH A;  4M5N A;  3ILI A;  3MCM A;  1G4C A;  1IM6 A;  4PZV A;  3UD5 A;  3KUE A;  5ETR A;  2BMB A;  1HQ2 A;  1RU1 A;  5ETS A;  1EX8 A;  4M5J A; 
#chains in the Genus database with same CATH topology
 1QUP A;  2HVZ A;  1S1V A;  4NRU A;  1NSK L;  1FRJ A;  4IFY A;  1VYA A;  1LWE B;  2KHD A;  1JLC A;  2HBY B;  2WON B;  4DFJ A;  1SC1 B;  3V6D A;  3FVY A;  4LR7 A;  4ANE A;  2PN6 A;  4CO1 A;  4MTP A;  2R8H A;  3EDR B;  5EUH A;  3BSC A;  5KT6 A;  3OR2 B;  2MXY A;  2BKP A;  3OXG A;  3EWG A;  3RYL A;  4F50 A;  4P7V A;  4ECT A;  5B0D A;  2YPY A;  4N41 A;  2JOQ A;  3FSX A;  3TX8 A;  5EX0 A;  4OZL A;  3EYZ A;  3KFW X;  5HMY A;  3H40 A;  1VIS A;  5FD1 A;  1KQK A;  2FLL A;  2I8E A;  5KFA A;  2R7X A;  1T9Y A;  2CNO B;  1WHV A;  2RS2 A;  2HNY B;  1R8B A;  2YQ3 A;  2DGO A;  2Q79 A;  4Y2M A;  4YR0 A;  3HVR A;  1U1O A;  3VAH A;  1LK5 A;  3POT B;  4WK1 A;  2NYH A;  2JFK A;  3R7B B;  1JB0 C;  3IWL A;  1OYD A;  4PYD A;  3NRB A;  4RPF A;  2VC1 A;  2ALY B;  2QT7 A;  2JWN A;  3CCM S;  4UZC A;  2PGC A;  3VAJ A;  3BGU A;  4X62 F;  4PAA A;  3SZ2 A;  1HNZ J;  1EQM A;  2J6S A;  2K3I A;  2LQB A;  5ETN A;  2IHR 1;  4NMX A;  1K1S A;  1X4D A;  4UTG A;  4J5O A;  3HHL C;  3TEG A;  2CQP A;  2KI2 A;  2IJF A;  1WKL A;  4NCG A;  2AD9 A;  2OPS B;  1HMV B;  5IM0 A;  1EKS A;  3M9O B;  2E5L F;  3VGT A;  3NCR A;  2HLU A;  4TLQ A;  4DF8 A;  1ZAW A;  4A8Y A;  2EWH A;  4E0D A;  4WP9 A;  2VG5 A;  2WVC A;  3CO9 A;  3NGD A;  1TMM A;  3D9B A;  1JLQ A;  3E51 A;  1IR0 A;  1C4A A;  3NAH A;  1TEL A;  3DYA A;  2ZIT A;  1FNX H;  3A8K A;  4MIB A;  4IQX A;  4FF4 A;  2BE2 B;  1JX4 A;  2J9C A;  2V8V A;  2VF3 A;  1ZZF A;  1QAX A;  4DV2 J;  3PX0 A;  4IOA Q;  1SV5 B;  3TRG A;  5HRO A;  1VQY A;  5L1K A;  2NPI A;  2V8D A;  2KRB A;  1M5O C;  2LA4 A;  3OXF A;  4IG3 A;  3FBC A;  3I5A A;  2DEI A;  3ENQ A;  2FB0 A;  2DGS A;  2L9N A;  2JEG A;  2CDR B;  4DG1 A;  3ZZT A;  3IWN C;  3JSB A;  4E2F B;  3ZFV A;  2DIT A;  5FDL A;  4I2Q B;  1S9F A;  2RRB A;  2YTC A;  4IDK B;  2GO8 A;  5GAE U;  4B3T F;  5LOQ A;  2XY7 A;  1OIA A;  5L8R C;  1XNR J;  3W2W A;  5DLG A;  4O3S A;  4RW7 B;  3RR7 A;  3L7P A;  4RW9 A;  4U7C A;  3R6G B;  2KTQ A;  2M88 A;  3T5J A;  4F4Z A;  3BQ2 A;  2D9O A;  3D1O A;  2RKI B;  3LAK A;  1QUV A;  1KRP A;  5KAK A;  2A6M A;  2ADC A;  2G2Z A;  3MUM P;  2QRR A;  3C6U B;  1CJT A;  2GX8 A;  2RVJ A;  3MPD A;  4K4Z A;  4YQW A;  1KR4 A;  2XMJ A;  2HIY A;  1YJ9 S;  2K1R A;  3GPA A;  5IC6 B;  2Z57 B;  2XSF A;  2FVS A;  1IBC B;  3F41 A;  4OYM A;  1GMW D;  1TVR B;  1S1U B;  3DLJ A;  5J2M A;  2B4V A;  4NCB A;  3MEE A;  4QIW D;  2FY1 A;  4ZPC A;  3H5U A;  4Q2M A;  1TL1 A;  3K57 A;  4FP9 A;  2I2Y A;  1C4C A;  1VQO S;  3N79 A;  5JUM A;  1BQN B;  3LWL A;  5AE3 A;  1FWL A;  3GR1 A;  3JTN A;  1TKX A;  2NCK L;  3MCN A;  3RAQ A;  5H9F J;  3KOA A;  1HYS A;  3PFE A;  3KK2 A;  1Q8I A;  1WC4 A;  2IVF B;  3RW6 A;  2BJ7 A;  4ZS6 A;  4DPU A;  3W2V B;  4WE1 B;  3SIP B;  1W26 A;  2W9C B;  4YDD B;  4DL7 A;  1PAU B;  1RT5 A;  3C14 B;  5JVG Q;  2EKY A;  1Q79 A;  1FK9 B;  3J7A 1;  4LRF A;  4HYK A;  4UQT A;  3QZ8 A;  3DRR A;  5IOL A;  5J2P B;  3TVY A;  1RWO B;  1CJK B;  3K89 A;  2JNJ A;  3W5Z A;  3LAL A;  2RB7 A;  4IRD A;  2ZKT A;  3PXG a;  4KPC A;  4FVC A;  3OFE A;  2C2M B;  5CYM A;  2B4O A;  4R0E A;  5F8G A;  1RHM B;  2O5D A;  5CYQ A;  3PW4 A;  1RHR B;  3UI3 A;  3EUN A;  1PGZ A;  1UET A;  4GKK J;  5C2G A;  3U27 A;  4JOU A;  1JKH B;  2J0W A;  2FD2 A;  2P5V A;  2XS7 A;  2HFV A;  4FYY B;  5L39 A;  1LOU A;  3CCQ S;  3SFU A;  3T6J A;  1HQE A;  3GJS B;  3DU5 A;  5HL7 Q;  2CJA A;  2ZZT A;  1TKD A;  1ITP A;  3QJP A;  3KMQ A;  4YME A;  2ZUG A;  1HNZ F;  1Q8L A;  1PKU A;  2ZZM A;  1S1T A;  2AT1 B;  2JVR A;  1PIL A;  2BOP A;  1F60 B;  2XWX A;  5ETR A;  2XMU A;  1U24 A;  1QJH A;  1KOH A;  2FJB B;  2GV1 A;  1M0S A;  2C2E A;  3V6H A;  1UJ6 A;  1JLG A;  2UXB F;  4QWE A;  2E9T A;  3CCL S;  2V67 A;  3U7J A;  3S8S A;  4RL1 A;  1HHS A;  2VD3 A;  4Z2X A;  3QT7 A;  1FKA F;  4ENO A;  2BOA A;  2X3D A;  2WBR A;  2MHN A;  2KZZ A;  2IAJ A;  3QIP A;  3VV2 B;  2VL1 A;  2Z2Y B;  2R7S A;  4K5R A;  4H54 A;  2QTW A;  4B17 A;  1VK8 A;  3Q22 A;  4AL6 A;  2PI4 A;  2FHJ A;  1O6X A;  4QWB A;  3US5 A;  1HBM B;  3CJ4 A;  1C1B A;  3M2V B;  3BRE A;  2KXN B;  1S0V A;  5CYJ A;  1P1T A;  5CD4 H;  1LXJ A;  2HBQ B;  3RAX A;  4MK9 A;  1RT7 A;  1M1K T;  5EHH A;  1NJZ A;  2HZV A;  2C2K B;  2XMT A;  4DV2 F;  4DR6 J;  3TWZ A;  3VGS A;  3BR8 A;  3R2C J;  5D3G B;  1RT4 B;  2JLF A;  3L3C A;  1C2P A;  2JJ4 D;  3WIV A;  4NZ6 A;  3PEH A;  4FZV A;  1WSR A;  1K8A T;  1OY6 A;  1YGY A;  5D4O A;  4PWW A;  4DPX A;  2ZZN A;  2HHX A;  3CTR A;  4P73 A;  3SCK E;  1CVJ A;  2P8I A;  2BJE A;  3GP9 A;  3SCL E;  2X1A A;  1RA6 A;  5A8K B;  1IKY A;  1U02 A;  2Q6B A;  3GU0 A;  4CH1 A;  2ACM A;  3D5M A;  7FD1 A;  2Y0S D;  2W4C A;  1XNR F;  2MGZ A;  1J5O B;  1O8B A;  2KVI A;  5DM6 Q;  4EO8 A;  2LEA A;  2I5J B;  1DQ9 A;  3HP6 A;  4L75 A;  4PWD B;  5GAH U;  4TYA A;  1OO0 B;  5LXR A;  1KP6 A;  1GX5 A;  1PJ5 A;  4DQI A;  4OJ1 A;  1HQ2 A;  3ETM A;  2OPP B;  1KSP A;  2QA4 G;  5KFI A;  2WB1 D;  3LA0 A;  1X60 A;  2A2D A;  1M5V C;  3THP A;  3V4I B;  3C15 A;  3CJR A;  3T5H A;  2Z2L A;  3DMJ B;  1U26 A;  3WC2 A;  3N01 A;  2AJ0 A;  2QL5 B;  4FYV B;  2MQP A;  3WDO A;  1PSD A;  2ZH7 A;  2D9P A;  2DNN A;  5KFO A;  3FUY A;  3L9Z A;  4KH1 B;  4CLW A;  3MF5 A;  2GNK A;  2ZFH A;  3CUN A;  2RD5 C;  3LGM A;  3ZTQ A;  4DL3 A;  4H4O B;  5A8W A;  4O3O A;  2OH2 A;  3KDO A;  5T7L A;  4ED6 A;  4RNH A;  3MEG B;  3LUY A;  2W25 A;  2W1B A;  2GVZ B;  2HMI B;  1XR6 A;  4OI3 A;  1DAX A;  1JJH A;  1SC3 B;  4RW4 A;  3HD1 A;  3M8R A;  4HDG A;  1X4B A;  3TAM B;  2XO7 A;  2NQP A;  5I3U A;  4Y2C A;  3BSO A;  2VFU A;  4OZ3 A;  5K14 B;  1A9N B;  2V8H A;  1B0P A;  4J37 A;  3GE9 A;  1IBM J;  4G6V B;  2F63 A;  5HVG A;  1HI8 A;  2HS4 A;  3H42 A;  2A1B A;  3MR7 A;  2A2C A;  1NUE A;  5J1E B;  3MM6 B;  3UD5 A;  2ZD1 B;  2LEC A;  4IRC A;  2EFP A;  2JLG A;  1NDP A;  4NLO A;  1RAC B;  2E5I A;  4WCE Q;  1JXE A;  2C3O A;  1Q0N A;  3C3L A;  2E7W A;  3GFZ A;  3MMB B;  5IS2 A;  3NNH A;  4HVZ A;  4LRC A;  3MUR P;  4I7F B;  5HBM A;  4JB8 B;  4OYW A;  2QLW A;  3QWU A;  3S1T A;  3TYT A;  4LRE A;  3TAQ A;  1CQM A;  5C42 A;  3O5T B;  2DHS A;  1LXN A;  1HBN A;  2YNG B;  3MM9 A;  1YI2 S;  4B02 A;  4GKK F;  4KR0 B;  1BXN A;  2GC8 A;  3MD3 A;  2BA9 A;  1BE4 A;  3PY8 A;  4J9M A;  3TA0 A;  3R5A A;  2GW8 A;  5K5M A;  3DU6 A;  4DLG A;  2AEJ A;  4O4R A;  2E7V A;  2MKH A;  1EIY B;  4IOC Q;  2IVM A;  1ULR A;  2XCP A;  2VOD A;  1UEV A;  1NSQ A;  3M2R B;  3H8Y A;  2ASY A;  2XC9 A;  4DF4 A;  1FES A;  2V69 A;  4NLV A;  2V68 A;  2MKK A;  5LJ3 Y;  2DRA A;  4FNI A;  1DJ0 A;  1NBE B;  2ZH2 A;  3UQS A;  1WEZ A;  4C3M A;  3KK3 A;  3SXL A;  1V5I B;  1UA0 A;  2EPI A;  2XLK A;  1UZD A;  1X4A A;  2HAI A;  2AEF A;  4TQR A;  3J7A N;  4I69 A;  4WBF A;  4PCQ A;  2L9D A;  5IV3 A;  5D8H B;  2CQ0 A;  3A3P B;  2XMW A;  2DKO B;  1KVJ A;  3GB0 A;  3CF5 Q;  2HUR A;  2ZH9 A;  1CS4 A;  3NOG A;  4K2X A;  3KLG B;  4C48 A;  1N52 B;  2CQ4 A;  3E8O A;  4KV8 A;  4L76 A;  4DR6 F;  1JLB B;  1KN6 A;  3PO4 A;  3NGS A;  3OHA A;  3PYF A;  4X4R A;  4OYB A;  2FJW A;  1RTI A;  3FCV A;  5D4N A;  2J9D A;  4ED7 A;  3HXM A;  1Q81 T;  1SJQ A;  3DRY A;  4M5M A;  3C66 A;  2KG0 A;  4H4K A;  4KIA A;  3CJ2 A;  4I56 A;  1YJN S;  3M6U A;  1N6Q B;  1Q82 T;  1TL3 A;  5A8R B;  4OHY A;  1YHQ S;  4ZPA A;  3DNC A;  2OPR B;  3SSR A;  3UW1 A;  4P7T A;  3ZZU A;  4KGK A;  4ILL A;  3W1Y C;  4QPT A;  1F1B B;  1ZBT A;  1N5Y A;  3RU0 A;  2R7O A;  1NB7 A;  4DV6 J;  4ECU A;  3QJJ A;  3M32 A;  2ATC B;  5B0G A;  2Y9H A;  1DHM A;  4U6P A;  2ASD A;  3I0S B;  3MM7 B;  4PQU B;  2B8P A;  5F8N A;  1ZM9 A;  3OJU A;  2IYG A;  4AL7 A;  3FCH A;  3AA8 A;  5KOX A;  3S01 A;  2UUB J;  2L48 A;  4WYW A;  3VVT A;  1LW2 A;  1MMN A;  1VDH A;  1CC7 A;  2M0G B;  2L9W A;  1S49 A;  4FXV A;  1RE1 B;  3BO3 A;  3MPW A;  1MU2 A;  3E3X A;  4ZVF A;  3OR1 B;  2DGU A;  1TL5 A;  4ZVU B;  4XPC A;  2EFQ A;  1ZM4 A;  4JI3 J;  3T3F A;  2Y8Y A;  4FVM A;  2UVU A;  2RML A;  1F9E B;  4ZHR A;  4GC6 A;  5A6P A;  5DDO C;  2A10 A;  2CUY A;  1YZ7 A;  2M70 A;  2LXU A;  4C9D A;  2NR0 A;  1Z1Z A;  1NK7 A;  3EX7 B;  3R97 A;  2MLX A;  4LFB J;  3B8H A;  2YX7 A;  2AIR B;  3M2U A;  3VAK A;  2JH3 A;  3TUJ C;  2WVD A;  2AKW B;  1RIS A;  2VPZ B;  1RU1 A;  2I0X A;  4IG0 A;  1YRU A;  4HT5 A;  3AOA A;  1NU4 A;  4EMD A;  5DS7 A;  2CPD A;  2ATL A;  1IBM F;  4DLE A;  5KFS A;  1HBO A;  2L41 A;  2OHD A;  1EAY C;  3P49 B;  2MZQ A;  5IFM A;  4OI4 A;  4WTY A;  3KLH B;  1JLE A;  2MQL A;  4ELU A;  1N48 A;  1S1X B;  3EZO A;  2B4U A;  2D3Z A;  1FDA A;  1DRZ A;  2HK2 A;  2XS5 A;  3D68 A;  4ECV A;  4CYU B;  4WFN Q;  3DOL B;  3DDI A;  2GZO A;  2MEW A;  1KBR A;  2XLI A;  1RAB B;  4K59 A;  3N9U C;  1FXD A;  5HQ8 A;  1UVJ A;  2F1F A;  2GAH C;  2IDE A;  3KG0 A;  1MWQ A;  2D1C A;  1Y3J A;  3MED A;  3A3N B;  4PRF A;  1YRT A;  2RH3 A;  2FZG B;  2HVD A;  4RNO A;  1RI7 A;  4PPD A;  1VRT B;  2KO1 A;  2R2S A;  2Y1I A;  1HNI B;  4ED3 A;  2XEX A;  4R0J A;  2ZDO A;  1YK9 A;  3OJS A;  1FRK A;  1DQ8 A;  1IQZ A;  3OVS A;  4HAC B;  1RT1 A;  2OML A;  3EGV A;  2GVD A;  2O01 C;  3GJQ B;  5B0F A;  1FD2 A;  4DS4 A;  1IUJ A;  3RBX A;  3UN3 A;  5LMN J;  4USK A;  1R31 A;  1L5U A;  3HHE A;  5J2Q B;  3OT9 A;  3UN2 A;  5D4L A;  3HT3 A;  3M1V A;  1X9M A;  3KK1 B;  1T9V A;  2ZOM A;  1BGX T;  2J7K A;  3K59 A;  3CMQ A;  1BMQ B;  4C11 B;  5KFZ A;  1NH8 A;  3BQ0 A;  4DCP B;  4M5N A;  4NLY A;  4USH A;  1MNE A;  1RWN B;  1P9Q C;  4UF4 A;  4P2S A;  3F73 A;  1RGV A;  1CSJ A;  4ICL A;  2AJF E;  2Y1J A;  3QAU A;  4DU7 A;  2BAN B;  3DGP B;  3WBZ A;  4PZV A;  4L72 B;  1YDL A;  3AQO A;  4QIF A;  3OD2 A;  3AOC A;  1T05 B;  4OFZ A;  3AB2 B;  4TQS A;  1P8G A;  1UJ4 A;  1I5O B;  5KFN A;  3AA9 A;  2MQM A;  2YWF A;  3QLH B;  5DLF A;  4DPW A;  3HHL B;  1WOR A;  1OS5 A;  3SDE B;  4JI1 J;  4R5P A;  4YR2 A;  3P5T L;  2D3O 1;  2PII A;  3KJQ B;  2C3P A;  1SC4 B;  4OYP A;  3L7U A;  2KT3 A;  4ES3 A;  2OUG A;  3D67 A;  1GMU A;  1NHU A;  3O2I A;  2EC2 A;  4ILM A;  1UVI A;  2HFN A;  3SQO P;  3LGH A;  4YB7 A;  2OTL S;  2B5J A;  2QGF B;  2J5A A;  5L9X A;  1H2T Z;  3DLB A;  5GAG U;  4OI2 A;  1V9O A;  3AHP A;  1LWF A;  4KYZ A;  2QEX S;  4YS2 A;  5IWA J;  5F8H A;  4MH8 A;  4L3K A;  3JQM A;  2VIH A;  3ZZP A;  4FYW B;  1NAQ A;  2JVO A;  2VG6 A;  3NG8 A;  3P3D A;  2UUB F;  3T1A A;  4DFK A;  3MZI A;  4LJM A;  1C0T B;  3KJV B;  2W8L A;  3O3L A;  3D6T B;  4CQ1 A;  1TKT A;  4NLX A;  2A0F B;  4KH0 B;  1SVD A;  1DTT A;  1B7Y B;  4JI3 F;  3G6X A;  4F04 B;  2LXF A;  3M9N B;  3DDN A;  3CC2 S;  1P27 B;  4A8F A;  2RF2 A;  2CWX A;  2VKR A;  2MDA A;  4GVB A;  4UST A;  1RB0 A;  1FFW B;  1K9M T;  4LMZ A;  4YEA A;  4M95 A;  4LFB F;  5FJ4 A;  2CKW A;  3BO2 A;  4FNH A;  1NJY A;  4QCL A;  4C98 A;  2OD4 A;  1TQL A;  2WW4 A;  2NYI A;  2VB6 A;  2JHE A;  2LDY A;  4DL4 A;  4FDF A;  1LEO A;  1XMB A;  5F8M A;  2KJW A;  4JI2 J;  1H38 A;  4M5K A;  1IKW B;  3CXC R;  4PUO A;  1T03 A;  3K2Y A;  5LXY A;  3AD8 C;  2ZBR A;  2RNE A;  3V81 B;  1BUX A;  1REV A;  2XSJ A;  1R8H A;  3NS7 B;  4DV7 J;  4DX7 A;  4F0H A;  2W2Q P;  4CO0 A;  5G0R A;  1Z2Z A;  2B6A B;  4ZVS B;  3J7Y U;  3LGN A;  3VAG A;  2AJ2 A;  3J81 Y;  4U8V A;  2GMJ A;  3K5N A;  4EZ9 A;  4TU8 A;  1LK7 A;  2L08 A;  1ZAX A;  2YQ0 A;  5F8J A;  3N5B A;  3D3B J;  1VMB A;  3B4D A;  2MZJ A;  2VBY A;  1BY9 A;  3AB4 B;  1B70 B;  2ZH5 A;  4F2S A;  3MAH A;  4O3P A;  1RLD A;  5K20 B;  2RU3 A;  2JEI A;  4H4K C;  5GAD I;  4QZV B;  3L95 X;  1NSA A;  3N6M A;  4O44 A;  2GQQ A;  3Q8Y A;  4OLP A;  2CJX B;  1PYO B;  1A6L A;  3UDL A;  1XMO J;  3MGJ A;  3PJX A;  3CJ5 A;  3LP0 B;  1E6V B;  2QLX A;  4F4Y A;  4RO0 A;  3U1L A;  1N33 J;  3SV3 A;  2RDD A;  2DH8 A;  3B82 A;  3IS9 A;  1SJ3 P;  1RUS A;  1SH2 A;  1X4F A;  5DDR C;  4B9S A;  4OL8 A;  4ZCM A;  3TUZ C;  1TZ0 A;  2BJD A;  2LA6 A;  1RT6 A;  2NS1 B;  1JJ4 A;  1RAD B;  2IJN A;  1WI6 A;  4X65 J;  4ECW A;  2B7B B;  2YH1 A;  5B08 A;  2B8Q A;  4NYZ A;  2JEF A;  3JAM Y;  2HQC A;  1RTD A;  2GHW A;  3IBC B;  4NZ7 A;  2E9Z A;  4Z7Y A;  3EVW A;  2W2M P;  5LMN F;  1O51 A;  1FJC A;  5M2P A;  1FKO A;  4EWT A;  4O3R A;  1UMJ A;  2H4Y B;  2UU9 J;  5KT2 A;  3TAR A;  2G0C A;  2NXN A;  3CC7 S;  1HI1 A;  3NGK A;  3GMG A;  2H9Z A;  2NLW A;  2OO4 A;  1S9G B;  2AX0 A;  1FJ7 A;  2XYP B;  3KYL A;  4EZ6 A;  2QMU B;  4LF8 J;  2KM8 C;  4V19 J;  5IT9 Y;  3CJ3 A;  3IA0 A;  3MMA B;  2ZKU A;  5GMD A;  2IM0 A;  1AT1 B;  2CPY A;  4I64 A;  3UR0 A;  1YSJ A;  5C2C A;  2VJU A;  1U0H B;  2F65 A;  1CJV A;  3A8E A;  1JXL A;  4C0B A;  1FX4 A;  1J2V A;  2Y8W A;  2BW7 A;  2AGQ A;  3Q8Q B;  3BN7 A;  3BGR A;  5I42 B;  3BGO P;  4JI1 F;  4M8L A;  3N6N A;  1NZA A;  3JQJ A;  1Q5V A;  4R8U A;  3NGR A;  4R25 A;  1F3V A;  3BDE A;  4RNM A;  3DLH A;  3NBP B;  3KG1 A;  3KLV A;  2EK1 A;  3FZ2 A;  1BD6 A;  3GIM A;  1URN A;  2DR9 A;  1SKU B;  4F2R A;  5F0U A;  3J81 U;  4TY8 B;  3FFI B;  5KFC A;  4ED0 A;  1S1W B;  3A12 A;  4LF7 J;  5HO4 A;  1FRM A;  5FII A;  4KGX B;  4OZ1 A;  5EGY A;  2AW0 A;  2IC3 B;  5IWA F;  3GTY X;  3K7R A;  1EHW A;  2AWZ A;  4JI7 J;  4K4Y A;  2RT3 A;  2FHO B;  3N4W A;  1DY3 A;  3ZXW A;  1FDD A;  3RB4 A;  2HNZ A;  1ZOT A;  4C0O C;  2AJ4 A;  1S1V B;  4PG7 A;  5KFQ A;  2DVI A;  5C24 A;  4I4B A;  3K5O A;  4IFY B;  3ZZY A;  1GEH A;  2MKY A;  2ZBC A;  1JLC B;  3CJ8 A;  2V50 A;  3V6D B;  4OI1 A;  1IKX A;  1L3S A;  5DM7 Q;  1NH7 A;  3ZTR A;  1EAR A;  2OEK A;  4RR5 A;  5E3P A;  4J9L A;  1JIH A;  2ZVI A;  5L1J A;  5CXT A;  2ABY A;  4HH1 A;  1UL3 A;  3M8P A;  2CJK A;  1MLA A;  1ZA2 B;  4ZPV R;  3TAN A;  2GAG C;  3IC1 A;  2QX0 A;  1QTN B;  5BYR A;  1I94 J;  4ER8 A;  2ILZ A;  2X7I A;  2V2V A;  3H2U B;  4CTA A;  1Y00 A;  1VQ7 S;  2ZWP A;  2AEM A;  5AT1 B;  3JAM U;  1VC0 A;  1F2G A;  1AW0 A;  1GTE A;  2W8K A;  4USM A;  4RNN A;  5E33 A;  4FKY A;  3ZZO A;  1A0O B;  2Z58 B;  3M6X A;  4JI2 F;  3FJ2 A;  4DMZ A;  3M8Z A;  5KFL A;  4RW6 A;  4ZJO A;  5LSO A;  2RJZ A;  1R89 A;  5LL6 d;  2VFT A;  4PXB A;  3RJM B;  4PPZ A;  4M63 A;  4C8N A;  4DV7 F;  2IA0 A;  5IT9 U;  2GFF A;  2IA6 A;  5A0Y A;  5F0W A;  1KHW A;  3GIJ A;  3OFF A;  4Y65 A;  2OP5 A;  4B9N A;  3CD6 S;  3FEY B;  2VBZ A;  1F5B A;  2GHV C;  2CG8 A;  4FS2 A;  4NCG B;  3HZG A;  1WC5 A;  1T9U A;  9RUB A;  4OLO A;  1HWU A;  2PSZ A;  2AX1 A;  3MR2 A;  1KLM A;  2EC0 A;  4DR2 J;  3FZB A;  2XCA A;  2J0Q D;  1U25 A;  6AT1 B;  1XMO F;  2MQO A;  2VG5 B;  4J7C A;  4ZP8 A;  3KHL A;  1HWJ A;  2CQC A;  4DFM A;  3FSY A;  5IT0 A;  1JLQ B;  4DX5 A;  5CA5 A;  2AGO A;  1N33 F;  3DYA B;  1TKZ A;  1VQ6 S;  5B0C A;  3BF4 A;  3BKF A;  3VQT A;  2PA8 D;  4DPO A;  2CPF A;  5KG1 A;  4NYP A;  5CAA A;  2GIF A;  5D0E A;  4CM2 A;  4X65 F;  5H9F K;  4M5L A;  3OTD A;  2COL A;  2DRD A;  4EO6 A;  3QZ7 A;  2FDN A;  5HMX A;  5A6W A;  2HRT A;  2PEH A;  5DGB A;  4IG3 B;  3KUE A;  4LSL A;  4IOB A;  3QT6 A;  2R7V A;  1X9W A;  2UU9 F;  4DG1 B;  3EVO A;  2V4J A;  8ATC B;  4M5D A;  1WHW A;  3KWM A;  3UDC A;  3RBE A;  4QWC A;  2PFD A;  4LSN A;  2BX6 A;  3KKF A;  3H59 A;  4CP5 A;  4LF8 F;  4MK8 A;  2QJ3 A;  1B0V A;  3W2W B;  3GG1 A;  5AE1 A;  3EXC X;  2B0G A;  4ZIW A;  4IYQ A;  5KG6 A;  4B9U A;  4RW9 B;  2C2O B;  2J6T A;  4DX8 H;  4PXD A;  2AU0 A;  3KG4 A;  3S6E A;  1RT3 B;  3R7S B;  1D3W A;  1UFW A;  1H0H B;  2DGQ A;  2DRB A;  5KG0 A;  1CJU A;  1Y3K A;  1CJT B;  4XIU A;  1HWL A;  3CDE A;  3OQ2 A;  1D09 B;  1FWK A;  2YX4 A;  4E98 A;  3CDB A;  1T11 A;  4USI A;  4IFV A;  2W2N P;  2NUH A;  1RAE B;  2VAS A;  2VG7 A;  1RTZ A;  4X84 A;  2K1R B;  1UFK A;  2KXH A;  3J81 j;  1UPM B;  1Y11 A;  4LFC J;  3MEE B;  4L3N A;  1X4C A;  1CLF A;  5DET A;  4UUX A;  3TX0 A;  3W9I A;  2WOM A;  2ZC3 A;  1TL1 B;  1AYE A;  2HKE A;  1XC9 A;  3CCT A;  4LIW A;  2G2O A;  3FSI A;  4FBT A;  2XMV A;  1C1C A;  3CED A;  4OI6 A;  1TKX B;  1AXQ A;  3MPV A;  2DXF A;  3MWB A;  3TZW A;  1PC4 A;  1HYS B;  4JI7 F;  3KLF B;  1QVG R;  2RQM A;  2R8J A;  2FUG 9;  4C6A A;  3KK2 B;  1LW0 A;  1IKV A;  4WYL A;  5HAT A;  1FHT A;  3RR8 A;  3IGV A;  4CLU A;  4BS2 A;  5KFM A;  1EP4 B;  4LVO P;  2QIF A;  1RT5 B;  2POK A;  3UNG C;  4ZVQ B;  5M2R A;  2DXE A;  4IO1 A;  2XQC A;  3CJ0 A;  4B3O A;  1URR A;  2UXC J;  3E2E A;  3BH6 B;  5ETQ A;  2CZV C;  3DRR B;  3RRG A;  1I94 F;  4QYZ K;  2H5I B;  2YVS A;  4YY3 J;  3GSD A;  4NXM J;  2KFZ A;  2KB2 A;  1YJV A;  3W63 A;  2JZ5 A;  5JJB A;  4OYZ A;  1N54 B;  1VLY A;  3OLA A;  3B4M A;  2M7S A;  2AP6 A;  2MKC A;  1TR0 A;  2RAQ A;  1KFD A;  3A1Y G;  5KFD A;  5F3Z A;  3CD7 A;  2KRR A;  3JQK A;  4CZC A;  2E44 A;  4RUH A;  3HHD A;  2OFH X;  1HQU A;  1WG1 A;  2R2T A;  4KAI A;  2W9C A;  2A3J A;  2D41 A;  4YR3 A;  1WUU A;  2W2P P;  4UUW A;  5KT7 A;  2DK2 A;  1IM4 A;  3W61 A;  3C14 A;  5CCM A;  4WII A;  1HQE B;  3GIL A;  1AB8 A;  4DCO B;  1UKU A;  3PKY A;  1OQ3 A;  1AZS B;  3Q24 A;  4K2J A;  1RAH B;  2C3M A;  3D54 A;  4AE5 A;  1S1T B;  3OSN A;  2VQE J;  1DAR A;  2P2C B;  1K47 A;  3V2U C;  3N28 A;  1KVK A;  1CJK A;  2JC0 A;  2BMB A;  1JLG B;  2N4D A;  1FRL A;  4PR6 A;  2CPX A;  4DR2 F;  3I9Z A;  4KHM A;  2YXL A;  5HJY A;  3D6M B;  1IJE B;  2IAJ B;  1F5C A;  4OX9 J;  3NL0 A;  1TK0 A;  2OLW A;  4F25 A;  1IVZ A;  4ZP7 A;  3CCZ A;  1LKZ A;  3DRS A;  3CCU S;  2B56 A;  3GII A;  1C1B B;  1NSP A;  4KGM A;  2Q66 A;  4OYO A;  2U1A A;  4JV5 J;  4I2P A;  3AH6 A;  3DXS X;  5GME A;  1RT7 B;  2IY5 B;  1JNR B;  1B64 A;  1RKI A;  4HL9 A;  5A2Q Y;  4X4S A;  4ID8 A;  4NL5 A;  3HZE A;  4ZKA A;  3TJ8 A;  2F9D A;  4ECS A;  3GIR A;  3DLL Q;  4Z7C A;  2KJV A;  1S76 D;  5E3R A;  4LT6 A;  4QBU A;  4Q45 A;  3P4U B;  4OZN A;  3MXH P;  3G9C A;  2CQH A;  2ZM6 J;  3D2W A;  2CDQ A;  3KLE A;  4EEY A;  2Q6C A;  2AHO B;  3HHN B;  3BJY A;  3Q89 A;  1RHQ B;  3NXZ A;  2QYC A;  2VKZ G;  4RU9 A;  3VGV A;  1MWY A;  3UE2 A;  2IDL A;  3PRV A;  2H4W B;  5CD4 A;  3I9V 9;  1BWV A;  1OY9 A;  4P72 A;  3BR9 A;  3TQ1 A;  4LF1 A;  4QPX A;  2XY6 A;  3N5F A;  4PWU A;  4CCH A;  4BWM A;  1G3O A;  1N36 J;  3MFH A;  1T0T V;  1YIT S;  1EB0 A;  2G13 A;  5JXS A;  2F9J A;  2CQB A;  2HS0 A;  3C15 B;  4DR4 J;  1N5T A;  3P6Y C;  2WCX A;  4EBE A;  1EKR A;  4URS A;  3MCM A;  2V8G A;  1V6H A;  4WJB A;  4N77 A;  2RQC A;  5DG7 A;  3DLK A;  2W9B B;  3GON A;  4J9S A;  4LFC F;  4I6A A;  1XJW B;  1XER A;  4DV3 J;  1J5E J;  2C42 A;  1NK9 A;  1FXR A;  5J2N A;  2FC8 A;  2BRL A;  2QV6 A;  2RQ4 A;  4DZ6 A;  5A8W B;  2HVI A;  2NRE A;  5T7L B;  4DBQ A;  4RJV A;  5A8K A;  4IH6 A;  4OX7 A;  3W66 A;  2V94 A;  3EZU A;  1X0P A;  4WFY A;  2CPE A;  1S59 A;  3R1H A;  2PC6 A;  4PKD B;  2YWE A;  5EWE A;  1OJ4 A;  2I5J A;  2YNI A;  3EXY A;  3H5S A;  3KLI A;  3CD0 A;  1FDN A;  4RW4 B;  4HI1 A;  4P9S A;  5IQQ A;  2AZ3 A;  3WIU A;  4FN5 A;  5C25 A;  4JI0 J;  3RRH A;  3CO0 P;  5LT5 A;  2BE9 B;  4ECY A;  5I3U B;  3BBB A;  1VBX A;  1D0E A;  2HS3 A;  1YKW A;  1WWH A;  4UZB A;  4HH0 A;  2Y1L B;  1FE4 A;  3Q8P B;  2OEL A;  3FBF A;  2BUN A;  3DRX A;  4MKV A;  1KC8 T;  2DJW A;  3A13 A;  3M8Y A;  4BCA A;  2UXC F;  5HN0 A;  3BSA A;  3CVK A;  4DL6 A;  3FEZ A;  1RCX B;  1RK8 A;  5SUH A;  1XWL A;  1SC6 A;  2LLZ A;  4YY3 F;  5KFG A;  3H4D A;  3Q2S C;  4NXM F;  5I3P A;  5A2Q U;  3VAL A;  4DV1 J;  4BC9 A;  4LQ3 A;  1YBA A;  2W4P A;  3PVX A;  2LKZ A;  4F02 A;  2PMW A;  4UQG A;  2E1P A;  1GXL A;  1WOO A;  4O3Q A;  3ISN D;  4GC7 A;  2E1R A;  1UW9 A;  2HHP A;  5C42 B;  5KFF A;  5ETO A;  5L9N A;  3MM5 A;  1HBN B;  3MM9 B;  5JMN A;  3GFY A;  3CB4 A;  2ZVS A;  1D8Y A;  1SXL A;  4TYB A;  2EK6 A;  4FYD A;  3QBC A;  4BDP A;  2ROG A;  1PYS B;  1PAE X;  3KJN B;  4A8K A;  2DNY A;  1RT2 B;  4GVL A;  1XQI A;  2BYC A;  1W2B R;  3UNY A;  2M8D B;  2IIH A;  4LSZ B;  1G1X A;  1ARO P;  4B3M J;  1G2E A;  3LAN A;  1GH8 A;  3QAT A;  3RRK A;  4CDI A;  2KFN A;  2VQE F;  4K4S A;  2EFV A;  2K3K A;  1J27 A;  2QLJ B;  1SUQ B;  3QO9 A;  3QAE A;  1RWM B;  5KFU A;  2KYZ A;  5KTQ A;  2XS2 A;  1IJF B;  4F3Q A;  1RU2 A;  2HVE A;  2FLO A;  1TAQ A;  1WC0 A;  3SMZ A;  3AXK A;  2EFO A;  3PKM A;  2XB2 D;  3UCZ P;  2K7J A;  2ZNZ A;  3A4T A;  4KHP J;  1VI7 A;  1VIO A;  1NKE A;  3LAM A;  1TAU A;  2N82 B;  5JVH Q;  2V9W A;  3O1L A;  2ZDP A;  1H98 A;  5L38 A;  5D0R A;  4OX9 F;  4NX9 A;  2VDH A;  4Q43 A;  5ETV A;  4UY8 T;  1H7X A;  3BPS P;  2OKQ A;  4DI6 A;  1CQN A;  1VJW A;  2CZ4 A;  2ALZ A;  4RBV A;  2SXL A;  2UUT A;  4JV5 F;  2YNH A;  1FTR A;  1ZTW A;  4KV8 B;  1HBU B;  1MML A;  2IM2 A;  5IQ6 A;  4YFU A;  2DYA A;  3C16 B;  3EE3 A;  3EPG A;  2CVE A;  3OSP A;  4LBH A;  1FDB A;  1RSC A;  1VGY A;  3PHT A;  3QRQ A;  2F8M A;  1Y9O A;  1HLW A;  3DCA A;  1RA7 A;  2UXB J;  2V5H G;  1GMV A;  2ZM6 F;  2DGV A;  4CO5 A;  2IMW P;  4IQM A;  2YWW A;  1RTH A;  3OXL A;  1FRI A;  3ET6 A;  1TL3 B;  1XTZ A;  4I6Y A;  3KUH A;  2GJI A;  2UVR A;  4ZCL A;  2YKM A;  3T19 A;  3KJF B;  4EYH B;  3MMC A;  2IM3 A;  1N5Y B;  1Q8K A;  4O4G A;  2AF6 A;  5L1I A;  4Y2A A;  4BHQ A;  3KLG A;  2W7O A;  1JLF A;  1IQT A;  1N36 F;  3IRW P;  1RWU A;  4NLT A;  2E29 A;  1HR0 J;  1VQS A;  3ETO A;  4OJG A;  2HQ3 A;  3G86 A;  1WF0 A;  2DIV A;  2HND A;  1H2V Z;  1LW2 B;  1WJ9 A;  4YB5 A;  4KO0 A;  1OSC A;  1RP5 A;  1RAO A;  3R8Y A;  2FLP A;  2EG1 A;  4DR4 F;  1YQH A;  1VBK A;  4FF1 A;  3LP2 A;  2VBW A;  2LU2 A;  2B3T B;  1L3U A;  1CEZ A;  3QGH A;  3F44 A;  4K4U A;  1ICE B;  2D69 A;  1S6O A;  3B6B A;  1TK5 A;  1U09 A;  4ZHR B;  1U48 A;  3G71 S;  1GMW A;  4DV3 F;  4NLD A;  1J5E F;  1VK3 A;  4F4K A;  2VC0 A;  4OV1 A;  4L6V 3;  5E3Q A;  1ZET A;  4I68 A;  3HJV A;  4XAK A;  1JMT A;  2ZHO A;  4NA3 A;  4TVA B;  2KM8 B;  3GFH A;  1MMD A;  4WFX A;  1IR2 A;  2YX1 A;  3CJS A;  3V6K A;  4EBD A;  3M2U B;  2F7V A;  4TY9 A;  1NZ8 A;  1M5S A;  4F3M A;  4FF3 A;  1UTA A;  3JB9 k;  5KFJ A;  1VHI A;  4QWA A;  2HWI A;  2BJ8 A;  4JI0 F;  3T9Z A;  3KNA A;  4QYR A;  4OJH A;  1PJ6 A;  3TA2 A;  2V34 A;  4GO7 X;  1RXO B;  2ZOF A;  3FC9 A;  1S6P A;  5KFP A;  1HBO B;  1XK8 A;  3WX8 A;  1JLE B;  2Q3P A;  5C7P A;  4KFB A;  3QFH A;  1NKC A;  2VH7 A;  2VFS A;  5F8I A;  1OSD A;  1AUD A;  2PEB A;  4DSF A;  2DNZ A;  1NDK A;  4DV1 F;  2FVQ A;  2CPZ A;  4DL0 C;  1KTQ A;  5IC4 B;  3VAF A;  1R6Y A;  2WVF A;  1KVI A;  2HFS A;  3HO1 A;  1UWB B;  3W3S A;  1YJ7 A;  3CJK B;  5DJB A;  4J91 A;  4USU A;  3T6B A;  4C4W A;  4NEZ A;  2JC1 A;  4Q0B B;  3MED B;  3SBM A;  4NXN J;  3GSI A;  3I6P A;  1YWX A;  1ZH5 A;  1M5K C;  1D9A A;  3IN5 A;  1U45 A;  5IXU A;  2HHT A;  4MYT A;  4KKO A;  2UVW A;  1OQ6 A;  1S6Q A;  3I96 A;  3GV7 B;  5HP1 A;  1Q86 T;  5CCL A;  4ZA1 A;  2Z8Q A;  2R7Q A;  4B3M F;  4DSK A;  3RBD A;  1F0X A;  5HQM A;  3M6V A;  3DRP A;  3T9N A;  1HA1 A;  2GVD B;  4S0M A;  3QSY B;  4ECX A;  2Y1R I;  4DSE A;  3ICL A;  2RS8 A;  3DGV A;  3HSD A;  1TUG B;  3M1V B;  3U1M A;  4JI4 J;  5FLX Y;  2DIU A;  3G6V A;  2FGO A;  1NPK A;  1DUR A;  4KHP F;  3IBF B;  2VIC A;  1JJC B;  5KFX A;  3PJW A;  2XMM A;  4ICL B;  3OL9 A;  4DCJ B;  1WEX A;  3ISN C;  3M7V A;  2J9E A;  4KGV B;  1X4G A;  2CJY B;  3W60 A;  4PG6 A;  2A18 A;  3D0H E;  5AXK A;  4OYA A;  5THW A;  4NCA A;  1MN7 A;  4O0N A;  3Q0A A;  2IYI A;  2DNL A;  2DH7 A;  1S72 S;  2LQ5 A;  2CNL B;  4RX6 A;  1PYT A;  4R5P B;  3NGU A;  3SSS A;  1RYR A;  2FGC A;  4BC7 A;  1S48 A;  4DR5 J;  3KK1 A;  4FKX A;  3W5X A;  3MAA A;  1Q4R A;  3PYD A;  1CUL A;  2PFF B;  4WKR A;  4C0H A;  2ERR A;  4IR1 A;  1N0V C;  4AND A;  2XZT B;  2DR8 A;  4DR1 J;  5C5J A;  3CDA A;  4ZIT A;  2BQU A;  1WC6 A;  2B5J B;  2OEM A;  4Y00 A;  2N4C A;  1NK0 A;  2KG1 A;  1FWP A;  1LWF B;  2MB0 B;  4ZPB A;  2DT9 A;  4A8W A;  2G9O A;  5H9E J;  3SYZ A;  4EGL A;  2FVP A;  1SJR A;  4DQR A;  2YKP A;  3Q8V A;  1W2I A;  1VQP S;  1S0O A;  4I67 A;  1HR0 F;  2ZOG A;  3I55 S;  3H20 A;  2C2Z B;  4OX6 A;  2G2Y A;  2J7W A;  2VUG A;  1TKT B;  3CJQ A;  1YJT A;  1Q53 A;  3EGN A;  1X8D A;  2D3U A;  1DTT B;  1QY7 A;  4HLB A;  3IG1 A;  4WKY A;  5BJR A;  2M4M A;  2F4F A;  2RF2 B;  2MZR A;  3JSM A;  1VFJ A;  1VQM S;  4GVB B;  1UVL A;  1X7V A;  1NLK L;  3JSY A;  1U2F A;  3LOU A;  1TMJ A;  5E3A A;  3OW2 R;  1RBA A;  1S9E A;  3HDS A;  3G6Y A;  1R6V A;  2B9X A;  3P5B P;  1RHJ B;  1QSS A;  3C6T A;  1YZ6 A;  2YBV A;  5B7W A;  4NOH A;  5GAD U;  1FEE A;  2HFU A;  3HX9 A;  3KHG A;  5FLX U;  1EZZ B;  2YKQ A;  1AUS L;  4PUO B;  1T03 B;  2OGU A;  4QR1 A;  4AD6 A;  2HQD A;  1REV B;  2HHU A;  2XSJ B;  3HHL D;  1NCL A;  3J7Z 5;  2R8K A;  1AFI A;  3MDF A;  1LWX A;  3TEH B;  3THT A;  2VPX B;  1HNV A;  2G1D A;  2QA2 A;  1M90 T;  1YG0 A;  5KG4 A;  3GZ7 A;  3RUB L;  1SQF A;  3BM7 A;  3ILO A;  4RU2 A;  5L1L A;  1T9W A;  2RDI A;  4JV0 A;  4ES1 A;  4AXJ A;  4ZLJ A;  4ERD A;  1WOS A;  3PRB A;  5F8L A;  2GS8 A;  4ZVT B;  4MIW A;  7FDR A;  2LEB A;  3CT9 A;  2DXD A;  3GCW P;  4DQS A;  2HAF A;  4O44 B;  1PO6 A;  1FFS B;  2J9D E;  3D4J A;  2UUC J;  1HPZ A;  3OBI A;  2GJ2 A;  4OHZ A;  1TL4 A;  3R1L A;  3PIO Q;  1FO1 A;  4NXN F;  1D9D A;  2WTF A;  4ZVR B;  2IRU A;  1HW8 A;  2GHP A;  3QWP A;  2OPQ A;  2CFX A;  4E8U A;  5HI7 A;  3UCG A;  3IS9 B;  3BN4 A;  2EI5 A;  1GK8 A;  3R3T A;  3HCX A;  2Z30 B;  2IRX A;  1S4F A;  1WI8 A;  1S5Z A;  4M5H A;  4Z37 A;  1RT6 B;  1U2C A;  5DGA A;  2XZD B;  2RUS A;  1SKW A;  5T14 A;  2J8A A;  1RTD B;  4TU7 A;  2ZUA A;  1E6Y A;  2P6S A;  1NHV A;  1G7C B;  2MSS A;  2DNG A;  4CO4 A;  4AL5 A;  3QSI A;  2HWT A;  4CLZ A;  2MZT A;  3HI9 A;  2GA7 A;  2MHE A;  2CPJ A;  3SSQ A;  1FKO B;  1S7I A;  3QGP A;  4HT7 A;  2WVB A;  2FHM A;  3DLE A;  2HGL A;  3MD1 A;  4JI4 F;  2OAU A;  3AQP A;  4F36 A;  4XPE A;  1R0B G;  2PI5 A;  4DV0 J;  3RGI A;  3LP0 A;  1RBL A;  1OYE A;  4QJV A;  4G65 A;  2MLY A;  4WP3 A;  1RAF B;  2J0S D;  2QLF B;  1WHY A;  5CH7 B;  3D28 A;  4WFA Q;  2DIS A;  1YBU A;  3GYN A;  1OWX A;  1CJV B;  2BW2 A;  1HNW J;  3GJR B;  2B9E A;  3GLJ A;  3IRX A;  1F6T A;  2DR5 A;  2IJR A;  1HWK A;  1VQ9 S;  4QU7 A;  1IBL J;  3DXB A;  3PFO A;  3AY0 A;  1FJG J;  3LPY A;  3RG6 A;  3BGR B;  4QQB A;  5HLF A;  2V4R A;  4C3L A;  3CME S;  3O6Q A;  3QQC D;  1JJ2 R;  2VDI A;  4R8U B;  3VWS A;  1JQG A;  4DR5 F;  4WU2 A;  1TL7 A;  1Y5I B;  4NAS A;  3KHR A;  5ITH A;  4K4X A;  3HT0 A;  4DR1 F;  2DBB A;  1FE0 A;  4A46 A;  1XEZ A;  4B3S J;  3IWX A;  3PW2 A;  4QU6 A;  1UWA A;  2HHW A;  3K5P A;  2E1C A;  4YHH J;  5KFE A;  2AYG A;  3GYX B;  1S12 A;  4A48 A;  3D3C J;  3I5C A;  2CNN B;  2HNZ B;  1ZM3 A;  1BLU A;  3AXM A;  2CQD A;  2XWY A;  3C2P A;  4OYX A;  3HSZ A;  3I0R A;  2BJ1 A;  4MMO A;  1NJX A;  4J9P A;  3SCJ E;  4AYB D;  1NK4 A;  1XR5 A;  5K8P A;  1QM9 A;  4JI5 J;  4G1Q A;  4TU9 A;  3PW5 A;  3OTB A;  1IKX B;  4W92 B;  2DH9 A;  3G8T A;  4QW9 A;  4LR8 A;  3W64 A;  5I42 A;  4A8X A;  1M1H A;  4OJ3 A;  3N0V A;  3MCS A;  2RUG A;  3TZY A;  2C28 A;  3TJ9 A;  1FNM A;  2ZC4 A;  3M8P B;  3BPD A;  2LXI A;  1QE1 A;  3BBC A;  2KZM A;  3VTI A;  2YWK A;  4ZLP A;  2CQ3 A;  3NNA A;  4CTA B;  1VBY A;  1F3F A;  1VQK S;  1GNK A;  3RZA A;  2W7P A;  2V8P A;  4UOH A;  4RKU C;  5B0E A;  4HDH A;  4RUB A;  2W2O P;  3CIZ A;  4ZOS A;  2BV3 A;  2H51 B;  2WW8 A;  4CLS A;  2J7U A;  2HYI B;  4CLL A;  2E5H A;  2CQ1 A;  4A8M P;  4X4Q A;  2F5G A;  1U8W A;  4NML A;  1B7F A;  4CO3 A;  4Q7A A;  4CH0 S;  5IZH A;  1UEK A;  3K8V A;  1VQ4 S;  3D0I E;  4YP3 A;  4RW6 B;  2X1F A;  3CCR S;  2R7R A;  4IO9 Q;  5K8M A;  3HJF A;  2BDP A;  3WX4 A;  3OV7 A;  4EK2 A;  1VCT A;  4NLR A;  5A0Y B;  3RB0 A;  3J80 Y;  2DHG A;  1L3V A;  2IPO B;  4DV5 J;  1SL0 A;  2QL7 B;  3CW2 C;  3H98 A;  5HMZ A;  2F8E X;  3BH7 B;  2DHH A;  2QYG A;  4CWB A;  1LV5 A;  4ED1 A;  3IR6 B;  2I38 A;  1ZA1 B;  2GGP A;  2C2D A;  3EZ5 A;  4EYI B;  2OJ3 A;  2E9R X;  3I32 A;  5D78 A;  1KLM B;  1S97 A;  2UUC F;  2HEK A;  1LWC A;  1UPP A;  2FY8 A;  4LF9 J;  3ISZ A;  2UVV A;  2ZH4 A;  1C0U B;  1H74 A;  4C8Z A;  1U1R A;  4ZIV A;  5E41 A;  1WD6 A;  1RWK B;  1JLA A;  2AYM A;  4ZJL A;  3MOJ B;  5G4D A;  1KNZ A;  1BWE A;  2DNP A;  2VBX A;  3W9H A;  1TKZ B;  2JLE A;  4MFB A;  3VAI A;  1I1G A;  3CC4 S;  4DFP A;  3ZZR A;  3AD7 C;  1R0A B;  3JYT A;  3I4H X;  4A8O A;  4FPI A;  2LVW A;  3SQG A;  4W90 B;  4XO0 A;  1H7W A;  2ZJR Q;  1VQ8 S;  2EG2 A;  2MYF A;  3CSK A;  1NM2 A;  3LH2 S;  1YX2 A;  2OD6 A;  1KOO A;  3KNG A;  1K44 A;  4RW8 A;  3AOD A;  5KFV A;  1SL1 A;  1PBU A;  3GQC A;  5U47 A;  4LSL B;  3IGN A;  4C8K A;  4MYU A;  4FXD A;  3LF0 A;  1MG7 A;  1SIW B;  4AT1 B;  2V4J B;  2YKN B;  2E1A A;  3PJ9 A;  4M5D B;  2K2P A;  5M2U A;  4HR2 A;  1HD0 A;  3NAI A;  4LSN B;  2X3G A;  4DSI A;  3HKZ D;  4DV0 F;  5I4M A;  2FJX A;  2MLZ A;  1R8P A;  2BRK A;  2HHH J;  1GTH A;  1KFS A;  2JX2 A;  3RAM A;  2EXU A;  1MW7 A;  4WFZ A;  3FRZ A;  2MQ8 A;  4P74 A;  3HD2 A;  2R7W A;  1G6B A;  1KQF B;  4Y34 A;  4CRJ A;  1CJU B;  1WC3 A;  2KFY A;  1RWV B;  2OTJ S;  2M3D A;  1T02 A;  3I87 A;  1HNW F;  1DQA A;  1HI0 P;  2V9K A;  5B09 A;  3R2D J;  1PIE A;  4YOE A;  2XGQ A;  1IBL F;  2D7S A;  4IFV B;  2C22 A;  2MPU A;  2QC3 A;  3M8W A;  1FJG F;  1VRU A;  2VG7 B;  3MM8 A;  4LVN P;  2B9W A;  2VHG A;  2Z2M A;  2BKN A;  2RQK A;  2OIH A;  4YB6 A;  2BBE A;  1XIQ A;  5LSL A;  1K0T A;  2KKH A;  1SIZ A;  2WOM B;  1TTH B;  3J80 U;  3EGZ A;  3G6E S;  2CPH A;  4QWD A;  5AXN A;  2X51 A;  3PX4 A;  3FBB A;  4B3S F;  1TU0 B;  3LWM A;  1C1C B;  2NSC A;  1B3T A;  1UFL A;  2EEY A;  3JXO A;  3IM8 A;  3R6L B;  3U1N A;  4YHH F;  1RZM A;  3R9L A;  5HSP A;  1LW0 B;  1RT3 A;  3AAW B;  1IKV B;  3OVA A;  4RBU A;  1GXT A;  5B0B A;  1QAJ A;  4P6Q A;  1FCA A;  2PDA A;  3F0N A;  3CCW A;  4OHX A;  1SJ4 P;  2KYX A;  1IBK J;  4JI5 F;  2Q1L A;  1YRX A;  2DPI A;  1VQN S;  2F4V J;  2DPJ A;  3O8W A;  1S79 A;  4B3O B;  2IBK A;  3DLG A;  1ZYQ A;  4YN3 B;  2QFI A;  1H73 A;  4FYX B;  3PM9 A;  2NXU A;  1SQG A;  3IO1 A;  1Q1K A;  2EFN A;  1RWP B;  2FJE B;  4OI0 A;  4BLG A;  5HVF A;  1RTJ A;  5D0H A;  1OPI A;  4LBP A;  3DOM A;  3FDS A;  2Z2Z A;  2U2F A;  1NDL A;  2KDO A;  2R7T A;  5LM7 E;  3G2X A;  3QID A;  3NWG A;  1FTC A;  1TV6 A;  4O0I A;  2BAB A;  5HMW A;  3KLF A;  5J1N A;  1NPR A;  2QFJ A;  3OL6 A;  3TNV A;  1BQX A;  2A6O A;  2G0I A;  1Q7Y T;  1HQU B;  3G4S S;  1RAA B;  3DM2 A;  3OLB A;  3QYY A;  1EP4 A;  2QA1 A;  1EET B;  3H5Y A;  4DWI A;  4C97 A;  3RW7 A;  1U47 A;  1VC6 A;  4ID5 A;  3LW5 C;  1NPP A;  3CE8 A;  4PEO A;  2R8G A;  3M30 B;  2BQ3 A;  1SJ1 A;  2W7A A;  2ZWO A;  4DN9 A;  4I1T A;  4DV5 F;  4UT4 A;  1SB6 A;  4DSL A;  1FVS A;  2HK3 A;  2JL9 A;  3DOK A;  4M1K A;  4K4T A;  3OTC A;  4J9U E;  3K0J A;  1N0U A;  2RRA A;  1SH0 A;  1X9S A;  2QA4 S;  1TK8 A;  3BSN A;  4P52 A;  1FI4 A;  1T3N A;  3GIK A;  3TJA A;  3G82 A;  2EW9 A;  1QLN A;  4WZQ A;  2R7U A;  4LR9 A;  1UEU A;  1WKJ A;  3A3O B;  3UCU P;  4LF9 F;  4IKA A;  2DR7 A;  2RSQ A;  1X0F A;  3ELH A;  2E1M C;  2DGX A;  3BS9 A;  3TUI C;  2V4Q A;  3GV5 B;  4DQQ A;  3HVT A;  2ZH1 A;  2ROE A;  3DRS B;  3GG0 A;  3DC2 A;  5ETL A;  4NA2 A;  2GIR A;  3MFI A;  1O5J A;  4GKJ J;  1LNQ A;  3ULH A;  4I2P B;  1SKS A;  2JRS A;  1PJ7 A;  4C8Y A;  4QW8 A;  1AZS A;  3BV8 A;  4ZJQ A;  4CM0 A;  2O1P A;  3NLC A;  4ZVO B;  4PG5 A;  5HJX A;  5D6G A;  1QD1 A;  4JYA J;  3MTJ A;  4GMK A;  1I3O B;  2IFX A;  3IMQ J;  4X4P A;  7AT1 B;  2NZC A;  2ZH3 A;  4X4O A;  3MMJ A;  5DRK A;  4LQ9 A;  2HBZ B;  2KT2 A;  1ROF A;  3KLE B;  1GX6 A;  2ZNY A;  5KOW A;  1VHF A;  3VZH A;  2XG8 A;  1S10 A;  3B54 A;  2YNF A;  3I82 A;  4ZCI A;  2AMC B;  3W8P A;  4LF2 A;  2HHH F;  1DTQ A;  4C2M A;  2XBP A;  2BM1 A;  3EVM A;  2XMA A;  1U4B A;  1KDN A;  3CGI A;  4ANC A;  4LF4 J;  3QNW B;  4CH7 A;  3K17 A;  1V3R A;  4HTJ A;  1B4S A;  1MRO B;  1W7W A;  3R5J B;  4QYZ J;  3IAS 9;  5GMK a;  4QIG A;  2CPI A;  1SKR A;  4Y3C A;  3Q8U A;  3ENV A;  4NI2 B;  3PYE A;  5H1S V;  3T1H J;  1D8Z A;  6FDR A;  2JFD A;  3MEC A;  3Q8R B;  1DFD A;  2ZBP A;  3KXD A;  1GAO A;  4F67 A;  4F3O A;  4KTQ A;  3DLK B;  2JSX A;  3MTK A;  3DI6 A;  2DGT A;  1KEK A;  3KMS A;  3C46 A;  4TLR A;  3MOZ A;  5J2N B;  3OUY A;  4HTI A;  3BB5 A;  2E7X A;  2B43 A;  2ZH6 A;  1X5O A;  3KDN A;  3EMT A;  4ETZ A;  1JK9 B;  4Q8F A;  1RHK B;  2J8S A;  5DDP C;  2P9G A;  3UVJ A;  2YNI B;  2FHJ D;  3LTO A;  2DNK A;  2NXE A;  3KLI B;  8RUC A;  5DZ7 A;  1UA1 A;  3T41 A;  3NWR A;  2QLB B;  1S4E A;  1PG5 B;  3VAM A;  3H2L A;  5KFK A;  2XYG B;  3A8J A;  1B99 A;  5C25 B;  2YWH A;  4EI2 A;  1KQG B;  1WTB A;  2FZK B;  4IRK A;  3M8Q A;  2UUW A;  4NLW A;  2D3O R;  1U1N A;  3K8W A;  3ITH A;  2DTJ A;  1DLO A;  3JSR A;  2KH9 A;  2V6A A;  1IBK F;  1X5S A;  3R27 A;  2F4V F;  3UO0 A;  1R8C A;  2DHX A;  4WXO A;  4WWS A;  1T94 A;  2W9B A;  4KQZ A;  2EKN A;  1UJ5 A;  2HQI A;  2CJQ A;  1YJW S;  4H4M A;  4X2B A;  1N5Q A;  5AXM A;  3VR1 A;  2YH0 A;  2F3J A;  4CLK A;  2QE5 A;  2RHS B;  2CRL A;  1Y5L B;  4K8R A;  5D4P A;  3LP1 A;  4DJB A;  4CI0 B;  3DFE A;  3PG9 A;  2HLT A;  1FKP B;  3MM5 B;  1S99 A;  4DUZ J;  2ZEJ A;  4XDC A;  1HHT P;  4I0W A;  2HFO A;  1M5H A;  5LJ5 Y;  3GYG A;  2C1E B;  3ZNU A;  4KHR A;  3E01 A;  4X66 J;  1FA0 A;  2ZE2 A;  1RHU B;  1Y10 A;  2UV8 G;  4K4V A;  1WG4 A;  2N3L A;  4PG8 A;  1L3T A;  2V2Z A;  1T7P A;  2EBG A;  2M2B A;  4URQ U;  2ZH8 A;  1Y0H A;  5ETK A;  3QO9 B;  3AOB A;  4CIO A;  5DO2 A;  1BQM A;  3UD4 P;  4ZVG A;  4D3H A;  3CJT A;  5GVQ A;  1EQ0 A;  2HFZ A;  4IR9 A;  2XMK A;  3WC0 A;  1XN9 A;  2E5G A;  1RAJ A;  3M4X A;  1KON A;  1VIX A;  3QPI A;  3GFX A;  1Q7L B;  4TKT A;  3P8B B;  2ZBI A;  4DV4 J;  1QSL A;  1X4E A;  2PD1 A;  1LWE A;  3DHX A;  2FJV A;  2WON A;  4P2F A;  2RRN A;  2AZ1 A;  1RT2 A;  4GKJ F;  2YNH B;  3GR0 A;  1PC5 A;  2VOO A;  2FZC B;  2WSE C;  3OR2 A;  1QAI A;  2DHA A;  3RTV A;  1KTV A;  3VHQ A;  4ZMM A;  4JYA F;  3HLU A;  2ZJP Q;  2CQG A;  3HF5 A;  1SUQ A;  2DO0 A;  2H1Y A;  2V2Q A;  4ELV A;  2DNM A;  5E5N A;  3PR5 B;  2MKJ A;  5IM0 B;  3Q8S B;  1WEY A;  2BE7 D;  1Q5Y A;  2H3E B;  4IH7 A;  3HVW A;  4P75 A;  2MST A;  1SBR A;  2LP4 A;  4K7Q A;  1RTH B;  1VJQ A;  2W4D A;  3ET6 B;  1VLO A;  2OFG X;  5EWF A;  1U6Z A;  3TVK A;  2C3U A;  2HNY A;  1Y7P A;  4RBT A;  2YKM B;  1RDR A;  1NKB A;  4X4U A;  3MMC B;  4W4M A;  3CCV S;  4DUT A;  3POT A;  4O4G B;  4CLT A;  4D3G A;  2WRM A;  4NLG A;  4AUK A;  4LF4 F;  2HHV A;  4JBC A;  1WHX A;  4NYO A;  3PYG A;  1ACM B;  2MJU A;  4Q2L A;  2F8H A;  1N34 J;  1JLF B;  2I6W A;  5MLC V;  5CQG A;  1XMQ J;  1HBU A;  4X4V A;  4ED5 A;  4LUB A;  2HND B;  2P9C A;  4M5J A;  4O23 A;  2XNR A;  3IFE A;  4KO0 B;  2DCL A;  4LIR A;  3C16 A;  2FVC A;  5HRO B;  3T1H F;  1YBT A;  3CCE S;  1SJF A;  2DO4 A;  2CJB A;  3BBF A;  2RIJ A;  3LP2 B;  2O67 A;  3ZTP A;  3HVA A;  3D1Q A;  8AT1 B;  4NLP A;  4B9T A;  4ECQ A;  2OPS A;  2RDJ A;  1HMV A;  2J76 E;  1V3S A;  2G4B A;  1XBW A;  4DUY J;  5FDL B;  1NEE A;  1WC1 A;  3IM9 A;  3NNC A;  2EVZ A;  3JS9 A;  4F4X A;  1KWM A;  2YWG A;  1NK6 A;  3D6F B;  3VF0 B;  2KU7 A;  3HSG A;  4KGZ B;  4U95 A;  4B9M A;  1SH3 A;  4ZK7 M;  3TVZ A;  2XI3 A;  2QN6 B;  2XI2 A;  4U7U D;  2XTJ P;  2KN4 A;  4JI8 J;  2N7C A;  5KG7 A;  3P96 A;  4WPA A;  2MKI A;  2BE2 A;  5K8N A;  1QVF R;  1H3D A;  4NA1 A;  5CZV A;  1YJU A;  3PDN A;  4BWJ A;  1KD1 T;  1SV5 A;  2GQC A;  4F0K A;  2W01 A;  3MUT P;  3FBE A;  2R2U A;  2UP1 A;  1KLN A;  3WQP A;  3NS5 A;  1S6P B;  5CAB A;  3EDQ B;  4CNY A;  3H25 A;  2H65 B;  1UZH A;  4KFB B;  4ECR A;  5J2M B;  2J6U A;  4IUF A;  3G96 A;  1ZPW X;  4I2Q A;  5ETM A;  5ETP A;  3K5L A;  4IDK A;  5KFH A;  2VON A;  2GQ2 A;  3JTP A;  1ZZN A;  1UVM A;  3HPO A;  1NB2 A;  4DPT A;  2Z56 B;  3D6H B;  4RW7 A;  2BQR A;  2BXJ A;  4CLY A;  2G1H A;  2MY7 A;  5KT3 A;  2FJA B;  3KHH A;  3H0P A;  3EJM A;  4TN2 A;  2RKI A;  4XK8 C;  5F41 A;  2FQQ B;  1UVN A;  2FTR A;  1TUV A;  4U8Y A;  4C3K A;  3VZI A;  2MQN A;  4DUZ F;  4NZ0 A;  4USV A;  3C6U A;  1L3K A;  3D7S B;  5E0O A;  2GCF A;  4RWX A;  4KKO B;  2VPY B;  4J9Q A;  1S6Q B;  2RIL A;  2MY8 A;  4NE9 C;  2KXF A;  1QAY A;  5HP1 B;  4ZVP B;  5KT4 A;  2DCU B;  3HK2 A;  4X66 F;  3ZTO A;  1R27 B;  2R9L A;  3GWC A;  6FD1 A;  1QSY A;  4Y2K A;  4JV2 A;  2YKO A;  3DRP B;  1TVR A;  5GAE I;  1SPB P;  4P10 A;  3FEX B;  3NKY A;  3QJL A;  1S1U A;  5H9E K;  1CBK A;  1RJJ A;  4YUD A;  4WK3 A;  1VC5 A;  2AYE A;  5EN1 A;  4HI2 A;  4HHU A;  1WKK A;  1RYS A;  3FNN A;  4MKY A;  1BQN A;  3C19 A;  1UWB A;  1K1Q A;  2CNK B;  3CJK A;  2HHS A;  3NY0 A;  5CYM B;  2FLN A;  4Q0B A;  5BR8 J;  2DY9 A;  3HSJ A;  4TXS A;  5CYQ B;  2LCW A;  3BKT A;  2VFR A;  4N47 A;  4P2M A;  4CT8 A;  2P9E A;  3BQ1 A;  3W2V A;  4DV4 F;  2B4P A;  4WE1 A;  4A4J A;  2MTL A;  5CZX A;  2HW3 A;  1KS2 A;  4BBY A;  4AQY J;  2HIQ A;  2LEP A;  4ZLL A;  3ONQ A;  2DEJ A;  1NO8 A;  2OI2 A;  3OVB A;  4ZVE A;  3U02 A;  1FK9 A;  4M5I A;  4DSJ A;  3NOC A;  1BHN A;  2HGM A;  3M8S A;  4DPY A;  1M5P C;  5J2P A;  2UZA A;  1Q8B A;  1RBO B;  2K8G A;  4DX6 A;  4RNF A;  2AJ1 A;  2V63 A;  2C2N A;  2LQ9 A;  3NMR A;  3MAA B;  3BYP A;  2OEJ A;  1CUL B;  3FMW A;  1S77 D;  4K50 A;  4G3I A;  1PCA A;  2JDJ A;  4AXI A;  4F8R A;  4MJK A;  3DN9 A;  3QIP B;  5DZ6 A;  3O44 A;  1HL6 A;  1IR1 A;  3KUG A;  4NRT A;  1U1Q A;  5RUB A;  1JKH A;  2HG4 A;  2WSC C;  1P1L A;  1N34 F;  5KG5 A;  2GO9 A;  3L4B C;  1XMQ F;  3ZZ0 A;  3CNQ P;  5IV4 A;  3T5K A;  3QRR A;  4DR7 J;  2Y0B B;  3TZZ A;  4MIA A;  1U0S A;  2VA2 A;  2MZ1 A;  5D15 A;  4OX8 A;  3GJT B;  3IR7 B;  3QFW A;  2P6T A;  3IG1 B;  1WSV A;  2D74 B;  2L3M A;  3JSM B;  4JV1 A;  4DUY F;  2M9K A;  1HWI A;  2FJD B;  3IR5 B;  3BGL A;  3IBW A;  1S0M A;  4KBI A;  2FPH X;  4ATN A;  1HKA A;  1S9E B;  2IRY A;  1IKY B;  3AT1 B;  4Q8E A;  2BR0 A;  2Z4P A;  4EU0 A;  2K7K A;  4ED8 A;  2MGZ B;  1I6J A;  4NEY A;  4RUA A;  1WDD A;  3C6T B;  4DL2 A;  4DV6 F;  4FF2 A;  4JI8 F;  4DZD A;  1HBM A;  1T3O A;  4IH5 A;  5DG9 A;  4UOF A;  3R5D A;  3M2V A;  3TI0 A;  4RZR A;  3UDE A;  4U67 Q;  4C8L A;  1FEH A;  4EUV A;  4W98 A;  3W9J A;  1O0P A;  3SFG A;  2FYX A;  4OYI A;  2B9Y A;  4X64 J;  3HFV A;  2PA3 A;  5D3G A;  4LRD A;  1HFE L;  1RT4 A;  2GML A;  1HNV B;  2QMW A;  4ES2 A;  2CIM A;  3MHY A;  1UAW A;  1NXI A;  1F5A A;  2R3V A;  4LRA A;  2ZJQ Q;  2MJN A;  4KSE B;  1IWG A;  3OFH A;  4QR0 A;  3AJ2 A;  4Y2I A;  3QGG A;  5HQL A;  1Q95 G;  1DZ5 A;  4DQP A;  2B51 A;  2QO3 A;  1R0C B;  1R43 A;  4N8O A;  1J5O A;  3Q23 A;  3EIC A;  1NDC A;  1HPZ B;  2APO A;  4PWD A;  2HQG A;  2FC9 A;  4WF9 Q;  2HRU A;  2BVZ A;  2LDI A;  2ACY A;  2E5J A;  4DL5 A;  3UN5 A;  1V5V A;  4KC5 A;  1YVF A;  2OPP A;  3R5G A;  4A8S A;  2JEJ A;  2MQQ A;  4J9O A;  1CG2 A;  1WTF A;  3PO5 A;  2OPQ B;  4PYA A;  1FFG B;  3V4I A;  3R5C A;  3DMJ A;  4KT0 C;  1HNX J;  3PHE A;  3FMB A;  4C8M A;  1NK5 A;  3CWJ A;  1EJ7 L;  3CDW A;  1U1K A;  3PV8 A;  1RCO B;  5KFB A;  1WOP A;  2LU1 A;  4DR3 J;  3FK4 A;  1G4C A;  2XUL A;  1E6Y B;  4ILR A;  2VA3 A;  4LF5 J;  4XTT A;  1S7H A;  2CQ2 A;  3PRD A;  4H4O A;  2NSB A;  5E2Q A;  5A76 A;  4C7Q A;  2AGP A;  5GAH I;  4EFA C;  3H5X A;  2AV5 A;  3RBZ A;  4JUZ A;  5AXL A;  3PTW A;  3DLE B;  2XZW A;  3MEG A;  3I31 A;  1FD8 A;  3B78 A;  1DBD A;  1EX8 A;  4A8Q A;  5HBM B;  1R8A A;  2O3D A;  3TAP A;  2GVZ A;  5KFT A;  2HMI A;  1WNE A;  5AJ3 J;  5BR8 F;  2ROP A;  1Y5N B;  4PQA A;  3UPF A;  4LFA J;  1WF2 A;  3TAM A;  4B3R J;  4L74 A;  3ENW A;  3W65 A;  5I3Q A;  1K73 T;  3OPK A;  3UDV A;  5K14 A;  4U7U K;  3D66 A;  4AQY F;  2LQ8 A;  3QGI A;  4RWW A;  4B9V A;  5J1E A;  4NPO A;  3MM6 A;  4CLP A;  2ZD1 A;  3MR3 A;  4CO2 A;  3G87 A;  2OSR A;  3IRX B;  4J9K A;  2B7C B;  1OY8 A;  5F9L A;  3QRP A;  1U1P A;  3BZQ A;  1N32 J;  1RWX B;  2WBM A;  5HLF B;  4CT9 A;  4Q5V A;  5EWG A;  1HIY A;  1VRQ C;  4HKQ A;  3MMB A;  3PR4 A;  1FER A;  4OIX A;  4OZ2 A;  1TL7 B;  4NLU A;  1W25 A;  5E7O B;  4I6W A;  3FRY A;  4I7F A;  4DXL A;  3FGV A;  3KK3 B;  2PMH A;  3OHB A;  3R5B A;  3LQV A;  4K5S A;  2HSE B;  4EBC A;  4WIQ A;  4ED4 A;  3TO8 A;  2H5E A;  2YNG A;  4B08 A;  1NJI T;  1LQ9 A;  5DQG A;  1FXL A;  3IAM 9;  2WB4 A;  3V6J A;  1WDT A;  4ETX A;  2IVY A;  4NLQ A;  4ITS A;  4MKB A;  1CS4 B;  2ZHB A;  4ZP9 A;  3JTO A;  4WFB Q;  3I0R B;  3HFK A;  4QOT A;  4P71 A;  1F9F A;  1TP7 A;  1U6F A;  1M1G A;  1P9Y A;  2R8I A;  4F0M A;  3MR6 A;  4DR7 F;  5ETS A;  3HHK A;  4G1Q B;  2Q43 A;  1FF2 A;  1UW4 A;  1RTI B;  3RB3 A;  4UOC A;  2PO4 A;  4ZP6 A;  2GIQ A;  3M2R A;  3IXQ A;  4LF6 J;  4TNO A;  4ZPT R;  2KL8 A;  3UD3 P;  3TP2 A;  1X31 C;  1QE1 B;  3VVU A;  1F9H A;  4OV6 A;  2ZHA A;  4OHV A;  4MK7 A;  3H7H B;  2CQI A;  2YQ1 A;  2M5Y A;  2CAD A;  1IN0 A;  2LYV A;  2EFG A;  1NHK L;  3OTO J;  3I56 S;  3M32 B;  1IXK A;  2XNQ A;  2PT0 A;  5AE2 A;  3I5B A;  4FPR A;  4ALZ A;  1SL2 A;  1IWA A;  1UP1 A;  2HVH A;  5KFR A;  1H6K X;  4ZPD A;  3ZTS A;  1S0N A;  1JLB A;  1S57 A;  3L09 A;  2BAC A;  3CD5 A;  2KVQ E;  3X3U A;  2QZ8 A;  4X64 F;  1ELO A;  2CVI A;  1MU2 B;  3FKB A;  4WU3 A;  3WHI A;  3GCX P;  2CAJ A;  2OMO A;  4ZCK A;  1ZAV A;  2VFV A;  1F2H A;  2LMI A;  5KT5 A;  1GQE A;  4HHH A;  3KTQ A;  3CMA S;  3R7N B;  1N5S A;  1N6Q A;  5A8R A;  1RAG B;  5K9F A;  4DDF A;  2OPR A;  2GGP B;  5DDQ C;  3TZX A;  2MKS A;  1YTY A;  1XNQ J;  4F26 A;  4Y28 C;  1LWC B;  5DG8 A;  5BYQ A;  1SQE A;  5ADZ A;  4CNZ A;  2NUU G;  4N8N A;  2YY3 A;  4RUC A;  2AQ4 A;  2UXD J;  2HRY A;  4OZ5 A;  3I0S A;  1JLA B;  4HHJ A;  4PQU A;  3MM7 A;  9ATC B;  4DS5 A;  1FT8 A;  1T8E A;  1Y4Z B;  1HAR A;  1FNO A;  4IG0 B;  4DN0 A;  3A8I A;  1RWW B;  4MFB B;  3TA1 A;  4F7V A;  3SEO A;  4KE5 A;  2N7Y A;  3I4P A;  1GFW B;  1HNX F;  3JYT B;  3Q83 A;  3MEK A;  3SQG B;  5LMU J;  3OR1 A;  4X4N A;  2M8H A;  3CPW R;  3CIM A;  2XLJ A;  4DR3 F;  1WG5 A;  3TW0 A;  3N6L A;  4RW8 B;  3ZNJ 1;  4Y6I A;  2G0J A;  4LF5 F;  2DNR A;  3THV A;  1H72 C;  2K06 A;  2R2R A;  3PIP Q;  3VQS A;  4K0K J;  1K0V A;  1OPZ A;  5BXI A;  4U9R A;  5ETT A;  4M94 A;  2QSW A;  5KG2 A;  4X4T A;  1C0U A;  2CWK A;  5AJ3 F;  1OMS A;  1IM6 A;  4LFA F;  1VQ5 S;  3RB6 A;  4B3R F;  1N5V A;  4USJ C;  1SCJ B;  3DDK A;  4J9V A;  2I9S A;  3MAQ A;  2O66 A;  1WAC A;  2XO6 A;  1KHV A;  3VGU A;  2FHK A;  1LFP A;  4OMF G;  1R0A A;  3PX6 A;  1MWZ A;  3PW0 A;  3EM1 A;  2XHW A;  2VQF J;  4OZ0 A;  2BJ9 A;  2CXE A;  3KLH A;  4AFF A;  4RLE A;  1HW9 A;  1RT1 B;  1U1L A;  1N88 A;  1S1X A;  5KG3 A;  1N32 F;  1VRU B;  3MM8 B;  3BYR A;  3LO3 A;  5LSR A;  4NLS A;  3SI8 A;  3BDP A;  1KQS R;  2DB1 A;  5T41 A;  4WZM A;  2DNH A;  1FVQ A;  2QSF A;  4CYU A;  4KRW A;  3V4M A;  4KJI A;  3DOL A;  1ZS6 A;  2VOP A;  2J0X A;  4V19 X;  2YKN A;  4OZJ A;  2VPW B;  1VQL S;  5HAO A;  4F4A A;  3CDU A;  4WTO B;  3TQE A;  2H5J B;  3PZP A;  2BZ2 A;  4ZVH A;  2H54 B;  5KFY A;  4PAB A;  2I1R A;  3MCO A;  5HAN A;  4GO5 X;  2HZA A;  1HD1 A;  2C3Y A;  3V5R A;  2MZS A;  3NGT A;  1U7L A;  1VRT A;  2NPF A;  4USW A;  2ILY A;  2RU9 A;  4ZPW R;  1RLC L;  1S6U A;  2HGN A;  3CCS S;  1A7G E;  4PXC A;  5F9N A;  4HEA 9;  1HNI A;  3QMQ A;  1Q16 B;  2X1B A;  2W24 A;  2AYB A;  1AFJ A;  4JI6 J;  1YIJ S;  3OL7 A;  2XGP A;  4WP8 A;  4HAC A;  2YKA A;  1UCN A;  2ADB A;  2EBE A;  2X1G A;  3ZZZ A;  1X5T A;  3QT8 A;  1N8R T;  1ZPV A;  4KPY A;  2DNO A;  2Z0G A;  1FRH A;  1QDU B;  4UW2 A;  1VOM A;  2MMY A;  3T1Y J;  2W9A A;  4Y0F A;  3GV8 B;  1GXU A;  3DLG B;  2NXC A;  2CYY A;  3H2V E;  1T95 A;  4LF6 F;  5J2Q A;  2H48 B;  5CHC B;  3PW7 A;  4A47 A;  5K8O A;  5D0G A;  3ILJ A;  1BC6 A;  1N4L A;  4N7T A;  1RTJ B;  2HWH A;  3HM9 A;  3D0G E;  4C11 A;  3DOM B;  4LF7 F;  2Y3Y A;  3ADA C;  1U6B A;  2IM1 A;  3HKW A;  2DY1 A;  2VU5 A;  3DKD A;  1TV6 B;  4YDX A;  4K4W A;  3NEK A;  5HVH A;  2UUA J;  5EX3 A;  1MSW D;  3OTO F;  3BO4 A;  2BAN A;  3DGP A;  2HHQ A;  4OQJ A;  3NMA A;  1VBZ A;  1AA1 B;  2DR6 A;  2BKO A;  3DM2 B;  1RAI B;  2VG6 B;  3OFG A;  1T05 A;  4ID5 B;  4QIE A;  5B0A A;  2HQF A;  4FS1 A;  3QLH A;  1TFY A;  3HHL A;  3D1H A;  3SDE A;  1NRK A;  3MPU B;  1LFW A;  1YJR A;  2ASJ A;  3S7R A;  3DOK B;  3QT5 A;  3NS6 A;  2WHO A;  4FXW A;  2WVE A;  3SCI E;  3Q2T C;  2DD8 S;  3G82 B;  2CA9 A;  3M05 A;  2F40 A;  3PEJ A;  1XNQ F;  2UV8 A;  2N3O A;  1ZTT A;  4KB7 A;  4OHW A;  4O3N A;  1RQ0 A;  4WXW A;  3LPE A;  5SZT A;  2WSF C;  3OL8 A;  4M5G A;  2XM3 A;  2UXD F;  1HHQ A;  1T9X A;  1H2U X;  1P6T A;  4DOZ A;  1I51 B;  3TOQ A;  2HZC A;  4U96 A;  4DU8 A;  1B0T A;  1GT8 A;  3HVT B;  2RE1 A;  1EET A;  1U2R A;  1NME B;  2GMH A;  5BYS A;  3KJV A;  1C0T A;  4NWB A;  2RHQ B;  2OSQ A;  5G0R B;  3DHW C;  3ZC4 A;  3M30 A;  5LMU F;  2FIU A;  2BM0 A;  4N76 A;  1X4H A;  3FQK A;  3PAC A;  3EGW B;  2QL9 B;  4P2X A;  1QTM A;  2LQJ A;  1NJW A;  3C8Y A;  5GAG I;  3MUV P;  3G8Q A;  2KT5 A;  4K0K F;  2IMO A;  3NCQ A;  3HMJ G;  3PNI A;  4QIV A;  2DNQ A;  5E3C A;  1YLX A;  1U1M A;  3ILI A;  1R7I A;  2WK4 A;  2YNF B;  2R42 A;  2NZ4 A;  1DTQ B;  3BKU A;  5MAO A;  4UOG A;  4URG A;  1IKW A;  3AD9 C;  2VJV A;  3NP5 A;  1N56 A;  5DQI A;  3V81 A;  3W7B A;  3HUL A;  2DGW A;  4YB1 P;  2B6A A;  4V1A k;  1JXV A;  2VQF F;  5J1P A;  5HK4 A;  4X62 J;  4CLF A;  1REG X;  4J90 A;  4LRB A;  3ZO7 A;  1Z2L A;  1ZM2 A;  4LBI A;  3W8G A;  1KKH A;  1NK8 A;  3MEC B;  3H4B A;  1U8S A;  3X1L B;  3H90 A;  5L46 A;  3T5L A;  3UR3 C;  2HPU A;  2ASL A;  3W5Y A;  3DI6 B;  3G8S A;  2V0N A;  4ED2 A;  1VS3 A;  3OUY B;  3J7Z T;  2E66 A;  2E5L J;  2VZ9 A;  4J9N A;  4MAK A;  1Q78 A;  4J9R A;  2VV5 A;  3BGF A;  2BJ3 A;  3FCW A;  1E6V A;  3W62 A;  3UVJ B;  4PG4 A;  4FBU A;  1WEL A;  2M52 A;  3J7Y I;  3AJ1 A;  3P45 B;  3TUP A;  1D9F A;  5KFW A;  1MRO A;  4ZDN A;  1TUW A;  3MI7 X;  4B9L A;  4ZN3 A;  3M8Q B;  4JI6 F;  1MN9 A;  2FVR A;  3HFZ B;  4G1P A;  3PCO B;  3ITH B;  4NI2 A;  1DLO B;  1CC8 A;  2CZ9 A;  3WZ0 A;  3ENA A;  1NND A;  1VR6 A;  4XDD A;  1FJE B;  1WF1 A;  1V3Z A;  3T1Y F;  4DHV A;  1D1U A;  3VCD A;  4F4W A;  3AJD A;  4H4M B;  2GJF A;  3AFG A;  2QMX A;  3K58 A;  2PMZ D;  4ECZ A;  2AJQ A;  5IT4 A;  1S9G A;  1TFW A;  1Z4U A;  3IP0 A;  1APS A;  4B3T J;  1R3N A;  2ZBQ A;  4G1I A;  3NCP A;  3F56 A;  1U49 A;  2R4F A;  4L73 A;  4C8O A;  2PE8 A;  1FRX A;  3LP1 B;  1FX2 A;  5D77 A;  3MMA A;  2UUA F;  1CPZ A;  1PBA A;  2NXJ A;  4PXE A;  1UVK A;  3CUL A;  3FQL A;  4ZN1 A;  4MT1 A;  3L7O A;  5C24 B;  3OTE A;  1U0H A;  2XY5 A;  2WAQ D;  1XR7 A;  2LFV A;  4JP8 A;  4ZLN A;  4MKA A;  3CCJ S;  1X5P A;  3E01 B;  2HBR B;  5DQH A;  2WZ1 A;  2ZE2 B;  3K5M A;  4ELT A;  2KHC A;  2YPZ A;  3M6W A;  3MPY A;  1T9T A;  2CJ9 A;  2QG9 B;  4GRS A;  4Q44 A;  3BEG B;  2BEF A;  3M9M B;  3EPI A;  4KY3 A;  3NBP A;  4UY8 5;  3Q86 A;  2IBO A;  5EDW A;  4TY8 A;  3FFI A;  4N5S A;  1BQM B;  3TR5 A;  1S1W A;  2CG4 A;  2XYH B;  1RKJ A;  3UFC X;  4DEZ A;  4QR2 A;  5F3T A;  1SI9 A;  3SV4 A;  2XHC A;  4N56 A;  2IC3 A;  1JNZ B;  1JWW A;  3MR5 A;  2C2R A;  2V2K A;  3ILL A;  1FKP A;  3UWT A; 
#chains in the Genus database with same CATH homology
 4M5I A;  1EQM A;  3IP0 A;  4CYU B;  3HT0 A;  3HD2 A;  3HSG A;  3UDV A;  4F7V A;  5ETT A;  3HSJ A;  4M5M A;  1TMM A;  4CWB A;  1RU2 A;  4M5K A;  3HCX A;  2F63 A;  3KUG A;  1F9H A;  5ETM A;  5ETP A;  4CRJ A;  5ETN A;  4M5L A;  3QBC A;  4CYU A;  3HD1 A;  4AD6 A;  1HKA A;  1EQ0 A;  5ETL A;  1RTZ A;  3ILJ A;  1TMJ A;  1KBR A;  1DY3 A;  4M5H A;  2F65 A;  4M5G A;  3UDE A;  2CG8 A;  2QX0 A;  3MCO A;  3MCN A;  1Q0N A;  1CBK A;  1RAO A;  3HSZ A;  3ILO A;  5ETO A;  5ETQ A;  5ETV A;  3HSD A;  1RB0 A;  5ETK A;  3ILL A;  3KUH A;  4M5N A;  3ILI A;  3MCM A;  1G4C A;  1IM6 A;  4PZV A;  3UD5 A;  3KUE A;  5ETR A;  2BMB A;  1HQ2 A;  1RU1 A;  5ETS A;  1EX8 A;  4M5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...