3KUEA

Crystal structure of e. coli hppk(e77a)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIALQQGRVRKAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Roles of residues E77 and H115 in E. coli HPPK
rcsb
source organism Escherichia coli
total genus 46
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3kueA00
1CBKA 1IM6A 3MCOA 3MCNA 2F63A 3HSZA 4CWBA 4M5GA 2QX0A 1RU1A 4PZVA 4M5MA 3HSGA 4AD6A 5ETPA 1Q0NA 3ILLA 1EX8A 5ETVA 3ILOA 5ETKA 3KUEA 3UDEA 2BMBA 3IP0A 5ETOA 3HD2A 3ILIA 3HCXA 1F9HA 1DY3A 2CG8A 4CRJA 5ETNA 2F65A 1EQMA 3HD1A 3HSDA 1HQ2A 1TMMA 3HT0A 1G4CA 3KUHA 4M5JA 5ETRA 3QBCA 1RB0A 1RTZA 4F7VA 1EQ0A 1KBRA 4M5LA 3UDVA 4M5IA 1TMJA 3MCMA 3KUGA 5ETMA 4CYUA 5ETLA 5ETQA 1RU2A 5ETTA 4M5HA 4CYUB 3HSJA 5ETSA 4M5NA 1RAOA 4M5KA 3ILJA 1HKAA 3UD5A
chains in the Genus database with same CATH superfamily
1T03B 2GCFA 3A3NB 4BCAA 3M1VA 1S9EA 4MIAA 1T05A 2HFOA 1RAJA 2LEPA 3HT3A 4O3RA 3AHPA 2QYGA 5ETMA 2AHOB 4D3HA 3T5KA 3DMJA 3DGVA 1GK8A 1VI7A 2N82B 3RG6A 3JYTB 3E01A 2YBVA 3TUJC 3TW0A 4DWIA 2ZKTA 1E6VB 4NE9C 2LA4A 4P6QA 5M2RA 3TI0A 2FLLA 2EWHA 3TJ9A 3KOAA 1U26A 4LF6F 4P7VA 1QTNB 4WE1B 3LP2B 4DV4J 1GXLA 1VS3A 4OZ1A 1IUJA 2J7WA 4U7CA 1FRJA 4EGLA 3FEXB 5F8MA 4CLLA 3S8SA 3LQVA 3CJ0A 1NZ8A 4X4PA 1TKDA 3EZ5A 5ETKA 5F8NA 3D0GE 3BF4A 1ZPVA 3HF5A 3MMBA 2NPIA 4RW8A 5D3GA 1Y3JA 4IFVB 2V67A 3CCZA 3AD8C 1Y00A 4OHXA 5CABA 4DPOA 4I4BA 2MZ1A 3JSRA 2FLPA 1S6PB 1SH0A 2Z2MA 3T9NA 2PD1A 1HNIA 3TARA 2FDNA 2CQPA 3K7RA 1Q8KA 3LP0A 3DDNA 4U8YA 2L3MA 2KT2A 1T9YA 4FVMA 1O0PA 1CJUA 2Q79A 4C8KA 1WF1A 4LF2A 3W60A 1SH3A 3GG1A 2AJFE 2OEMA 2HK3A 4DL3A 1R6VA 4HR2A 2XY5A 2LECA 3ETOA 5AT1B 4K0KJ 5IOLA 2HQ3A 3ITHB 5KFVA 3P5BP 1NJXA 2XHCA 2UZAA 4KH0B 2YWFA 4NLGA 1VBXA 1HWJA 2BV3A 4J9KA 1FRHA 3GG0A 4NLRA 1JLFB 3TUIC 5A8WA 2H54B 2MPUA 1B7YB 5LL6d 2LA6A 4ECUA 4CCHA 4GRSA 3CSKA 1Z4UA 3PKYA 1NJIT 3OPKA 4FXVA 4DSKA 2VKRA 4FYYB 2F9JA 1H0HB 2GVDB 4WIIA 3MTKA 1ZA2B 4UT4A 1AZSB 1RHRB 1HYSA 4OLPA 4OV6A 2LKZA 1UVLA 5E3CA 5IXUA 2KKHA 4ECWA 3BR8A 2DRDA 3D3BJ 4EBDA 3HP6A 4ZKAA 5KTQA 5F3TA 3CCSS 5DQHA 2IYGA 1M5OC 3CD7A 1Q8IA 1HIYA 3GYNA 1S1VA 2JEGA 2CFXA 1B4SA 3MCSA 1RWUA 2DO4A 3GILA 1S59A 5KT4A 3N9UC 4HI1A 3DNCA 2H48B 2JEIA 5HI7A 2A2CA 3FQKA 3E51A 1TV6B 1U1NA 1RWXB 1HPZA 5BJRA 2HQGA 1CJVA 2CQ3A 1WF0A 2YKAA 2QFJA 4J9MA 4M5DB 3HKZD 4WBFA 5CYQA 1HNZJ 1EIYB 4XDDA 3I31A 4ZPBA 3W2VA 1CJTA 2R2SA 3KLHB 1HARA 4CLPA 3UCGA 4PG8A 4NMLA 3M4XA 3NOCA 4I6WA 5DG8A 4IOCQ 3SV4A 3LPYA 3AA8A 2I6WA 5LMUF 3MPWA 2YKOA 4USUA 4LFCF 3KG0A 1T0TV 4TU9A 3U1NA 3PYGA 4KV8B 1TTHB 4V19X 4K4XA 4ER8A 5D78A 1ZZNA 1QSSA 2J9DA 1UFLA 2DR8A 1UCNA 2O1PA 4HKQA 4IG0B 4JI4F 1UVJA 4DG1A 1KEKA 5DQGA 4CWBA 1IVZA 2DRBA 2VG6B 1H38A 3R7NB 1S49A 2VUGA 4KTQA 4YHHF 5B0BA 4ZHRB 4DN9A 4AT1B 1X60A 3M2UA 1H7WA 2MY8A 3SYZA 3I32A 4OI6A 3CJ2A 1KHVA 1VQ6S 3M2VA 3QGGA 4ED4A 2FLOA 3IRWP 5B0GA 3HHDA 2HHQA 4R0JA 1F9FA 3FUYA 4K4WA 3QJLA 4P7TA 3D54A 2HK2A 2B56A 2Y8YA 1SH2A 2YNGB 4LF4J 1VHFA 3W63A 1H7XA 2IIHA 2XWXA 2ZC3A 4RUBA 5KFCA 3CCWA 4PWUA 4A47A 1JLQB 3EICA 1Z1ZA 3ZZTA 4X66J 2CPYA 2JVRA 1UA1A 3GCXP 4RUAA 1HBMA 5FDLA 2EK6A 4YFUA 2R7OA 2FLNA 2P9EA 3JTNA 3ONQA 3CO9A 4X62F 5C42B 2UU9F 4Y65A 4PXDA 4I68A 2MYFA 3KKFA 1FRMA 4A48A 3MMAB 2XI2A 5ETPA 3HVWA 3OXLA 4U67Q 2KHCA 2VONA 3QMQA 3VZIA 4PQAA 4URSA 3EM1A 4A8FA 3Q8RB 3CTRA 1ZS6A 2OMLA 2VFVA 2QZ8A 1RQ0A 4E2FB 1VK3A 2JC0A 1WKJA 4CH0S 4R25A 3G96A 3GQCA 1WHVA 1T11A 3HJFA 4P9SA 1UVKA 2HS0A 2AYEA 1S10A 1ZTTA 3NY0A 2DY1A 3ISND 3EE3A 4DI6A 1WELA 3I87A 2V2ZA 2HRUA 3G8QA 5LSOA 3MDFA 1U2RA 4E8UA 3K5OA 3DKDA 1DJ0A 2V8HA 1RWPB 4ECYA 1T94A 3HD1A 4C2MA 4N8NA 1X5TA 2FJXA 1U1OA 4ED1A 2HBQB 3HKWA 4UZBA 2IYIA 2LU2A 1FD8A 2KYZA 2NUUG 3EVOA 4JI1J 2JZ5A 2XCPA 1WD6A 4HL9A 3JB9k 2YNHB 5K20B 4L74A 1Q86T 3SSQA 3RRGA 4WWSA 4GO5X 2EBGA 4ED7A 3M6UA 4ED0A 4G6VB 4O3PA 3AJDA 1IBLF 2BJ1A 1RU1A 3NLCA 3TZYA 1PC4A 1VHIA 1UZHA 3J7Z5 4NYZA 4USKA 1AUDA 2UP1A 3VALA 3B4MA 3GIRA 3KMQA 3W7BA 1YJTA 1TVRB 4TYBA 2VL1A 2LYVA 5D0HA 4FF1A 3IM8A 5KFRA 1N6QA 3I5CA 4O3SA 2W2OP 2IMOA 3PEHA 1T3NA 4QW9A 4KKOA 2ZBQA 4K4YA 1DFDA 4N7TA 2MMYA 2CQHA 3HHLB 3CMAS 4LF6J 2GIQA 1Q4RA 4ZCKA 4FYXB 4ICLA 4ZCLA 5J2QA 1SC4B 1S6UA 4K4ZA 3MZIA 2IC3B 3NOGA 2G0CA 3IA0A 2HZCA 1P9QC 3TUPA 4CO3A 4ZVGA 1QY7A 4LFBJ 1YHQS 4DUYF 2D3OR 3PRVA 4ED8A 3H20A 3CC4S 5EDWA 4MFBA 3POTA 5CYMA 3R7SB 1HNVB 4TU7A 1C4AA 3DGPB 4CYUB 4OHWA 1VQNS 3QRRA 1WTBA 1N4LA 2MJUA 2QJ3A 3HHKA 1SPBP 1KVIA 4DX5A 1R0BG 5F0UA 3ILIA 1QJHA 3OFHA 2HBYB 3QZ7A 3RGIA 3TNVA 2P8IA 1EAYC 2QRRA 3UQSA 1SL1A 2RT3A 2EFQA 4J9VA 2Y8WA 2OLWA 2VQEJ 2DR5A 3O2IA 3HDSA 1WJ9A 3NWGA 3CDBA 2ACMA 3VAKA 3DCAA 2B7BB 2N7YA 3V81B 3QWPA 3EWGA 1U1KA 2HNZB 2OGUA 5KFYA 4CH7A 4DV1F 2E1PA 2H5JB 3QGPA 3AD7C 4QPTA 5J2NB 3KLGB 3EXYA 2IVMA 1UFWA 5IZHA 1HQUA 1RTIA 5IV3A 2QG9B 1RTDB 3FFIB 4DPYA 4LSLB 4AL7A 2RU3A 5H1SV 4DF4A 4F04B 4RNOA 2MQOA 2XZWA 2QSFA 1GTHA 3MR3A 2RKIA 2UUCF 4OHVA 2R7SA 2QLFB 1Q1KA 3RAQA 3GSDA 3KK2A 5DM7Q 1TL3B 3NGRA 1U25A 2GMLA 3IMQJ 2JLEA 4DZ6A 3K58A 2DCUB 3KLIA 3BGFA 1LFWA 2HZAA 3EZUA 5GAHI 2FVSA 4UOHA 4K59A 5G0RA 3BH7B 4P52A 1YTYA 1EP4A 1RYSA 2CXEA 1S6QB 3AJ1A 4TU8A 4OYOA 1NJYA 1ZAXA 2GGPA 1T9UA 5HMZA 1NBEB 2KFYA 3NCQA 3UR0A 4DL2A 5HSPA 3R5DA 3S7RA 5A6PA 2AV5A 4LF5J 2VBZA 3IO1A 3V6DA 5JMNA 2VKZG 2RF2B 2RHQB 3TAMB 1RDRA 2LMIA 4B3RJ 4GC6A 4DV3F 1K1SA 2GQ2A 2OKQA 2C2RA 1BD6A 2GVZB 3N79A 3I5BA 4C3MA 2NQPA 4DR3F 3BQ2A 3PJ9A 3J7ZT 5C2CA 1C1CB 4DR4J 1X5OA 4NRUA 2E5IA 5KFLA 4OYXA 4KHPF 4H4MA 3GYGA 1K0VA 4DL7A 4DHVA 4QIEA 1HWIA 1NJWA 3MUTP 3NEKA 2GQCA 3CJ3A 2XMJA 1NCLA 3K0JA 2W4PA 3H2UB 3VAHA 1BUXA 4DQIA 3W62A 4F67A 5D15A 1ZPWX 1WI8A 2X1BA 5U47A 5JUMA 2RS8A 1D9DA 2A6MA 5HBMA 4JI0F 3PACA 3H2VE 2JSXA 4BS2A 3G4SS 1S9GB 1K1QA 3IG1B 8AT1B 4V19J 4UQTA 4X4RA 3OFGA 2A1BA 4UTGA 4QU7A 3IWLA 1FEHA 4OZ5A 2HHSA 2LVWA 3SQOP 4IG3B 2XYPB 1V9OA 4X4SA 4ZN3A 4QWBA 1QSYA 2ZHOA 4F4ZA 3K17A 4DS5A 5HQLA 1VQLS 4HDHA 2ASYA 3NMRA 4WP8A 1SUQB 2HYIB 4CI0B 3QSYB 3L9ZA 2D9PA 4X62J 2UU9J 5DGBA 3O8WA 4GKKJ 3HXMA 2HVIA 3A13A 1P8GA 1RT3B 1S6OA 5AJ3J 1N5YB 1J5OA 1BQMA 2JDJA 2Y1IA 4YOEA 2W9CA 1I94F 1VOMA 3TEHB 3PDNA 1XWLA 4YB7A 2ZH7A 4OYZA 4OFZA 4LQ3A 2M70A 1TUWA 5HLFB 3KLFA 5KFBA 1PC5A 4DPTA 3GJSB 2QC3A 3UD4P 3CB4A 3M8YA 1KHWA 2IM3A 2MLXA 4U8VA 3OFEA 1G7CB 2QA4G 2FVQA 1X4BA 1SKRA 1RT6B 5C25B 4WTOB 2FHKA 4CLUA 2UUAF 3OFFA 1TKXA 2E66A 3BDPA 1XQIA 3J80U 2VOPA 2UVUA 1UEVA 1RT2A 2DY9A 2GJ2A 2DPJA 1TQLA 3MEEB 3AQOA 5CHCB 4HT7A 3M9OB 4FKXA 3TA1A 1S72S 2E7XA 4DL6A 2O67A 2YH0A 2YKMA 4WFZA 4J9OA 4W92B 3J81Y 4FVCA 2ASJA 1KFDA 5IT9U 2ZZTA 1KD1T 2DIUA 1AROP 4KGKA 4EI2A 4RNFA 4ZCIA 3M30A 1RT4B 1RTJA 3A3OB 4P2FA 2W7AA 3GFHA 1LK7A 4TN2A 2R3VA 3QATA 1IM6A 4DPXA 3MPDA 4OI0A 4HYKA 1VRTA 2CWXA 4P2XA 4WU3A 1W25A 3DI6B 4CLKA 4LF7F 2YPYA 3W3SA 4F36A 2AGOA 4RZRA 7FDRA 1S1WA 3LW5C 4ZPCA 1S1UB 4GC7A 1HR0J 2ADBA 2HG4A 2DR7A 2YH1A 2L9NA 3WX8A 1UP1A 2Q1LA 2B3TB 2J5AA 4X64F 3EVMA 1REGX 4F0HA 4O44B 3OSPA 2MQLA 5B0DA 2NXEA 2ZH1A 4F3MA 3TX8A 3W5ZA 1HLWA 5F41A 3Q22A 4QJVA 1Q79A 1FA0A 1JLCB 1R8AA 1NH8A 4K4SA 3MMCA 4DUTA 4NLXA 2V9KA 1QVFR 4CO1A 3GIMA 1YSJA 3UN3A 2J7KA 1VJQA 2GAGC 2BANA 3MCOA 3LAMA 1A7GE 1FTCA 5LOQA 3L7PA 4I2QA 1BE4A 1N56A 3W2WA 2HFVA 3GV5B 4I7FA 4K4TA 4EYIB 4CLWA 1N0VC 4C8OA 2V34A 2KG0A 2DR6A 3R1HA 1XR7A 4G1PA 3ZC4A 2YVSA 3WX4A 1EQ0A 2XZTB 4ECRA 4A8SA 2E9TA 5AXMA 4DJBA 3LH2S 4NYOA 2FZKB 4DV1J 3TZWA 2XHWA 3LWLA 2A0FB 1YWXA 2P5VA 4EZ9A 4QOTA 3QJJA 2V8PA 1S9FA 3QIPB 4CIOA 3TRGA 4Y28C 2W24A 4TVAB 1RHQB 3T19A 4QPXA 1RLDA 4NI2B 1JX4A 1R8CA 2HLTA 4LIWA 1HBNB 4ED5A 1KQFB 1F9HA 2QTWA 1FFGB 2K06A 3WZ0A 5HO4A 2Q3PA 4K8RA 4FYWB 3AODA 3R5BA 3M6VA 1FDNA 2QSWA 1HBUB 2GZOA 1MMNA 4PEOA 3WDOA 1FKPA 2ZUAA 4LF9F 3FCHA 3K8VA 1EHWA 3GFYA 2JRSA 2ACYA 4RNNA 5GAHU 3QRQA 2JNJA 4J9UE 4KHMA 4DLEA 2HS3A 2K1RB 1OIAA 3VGUA 4JBCA 1UW4A 2D7SA 4NASA 2MQNA 2FGCA 2ROPA 4PUOA 2MDAA 4RNHA 1RAFB 2CQIA 4B3MJ 3KUGA 3QT6A 2FY8A 3G86A 3H5UA 4TLRA 3MR7A 1PAUB 4DV3J 1F2HA 3Q8YA 4H4OA 2FY1A 4ID8A 4L3KA 3SXLA 4QCLA 3VGTA 2J8AA 2P9GA 3RTVA 1RWMB 2YWEA 1XIQA 1X5PA 2HHWA 1E6YA 4CDIA 3V4IA 2ZVIA 4NOHA 2NSCA 4Q5VA 2PE8A 1U1PA 3NNHA 1RLCL 4KHPJ 1LK5A 1MWYA 4DU8A 2PEBA 1UETA 2IDLA 4YMEA 2DHHA 1RA7A 2ZHBA 1BWEA 3BREA 3NAHA 5GAEI 2VFRA 5LMNJ 1U4BA 1X4AA 1FFSB 1IKVA 4RL1A 4NZ0A 3D1QA 4J9PA 4ZJQA 4AE5A 4C3LA 4EU0A 3BSAA 2ATCB 4FBTA 4NLDA 3RB6A 2AYMA 2R2TA 2IJNA 4QWDA 2J0QD 2ZH8A 5KOXA 3J7YU 2KFNA 4PCQA 4DL0C 1JB0C 1M90T 3MM6B 3KHGA 2I8EA 3R5CA 2GC8A 3NGTA 3MUVP 4JI5J 2YX4A 3B4DA 1XN9A 4YQWA 1FKOB 3JSMB 1TKZB 1IKXB 4CTAB 4ECXA 2U2FA 3EMTA 3ENQA 2QLWA 2VG5B 1TL7A 2J6SA 3OHBA 3UDVA 3ET6A 1ITPA 1FK9B 1T02A 1KQGB 3ZNUA 2FB0A 2VPWB 5KFUA 2I0XA 2OPRA 3C14A 1JJHA 3E2EA 2M7SA 4QIFA 3QT5A 3R2DJ 1V5IB 2R42A 2WSEC 3LO3A 2GHVC 2JJ4D 3FBBA 1L3UA 1WEYA 1XMBA 2C3YA 2LFVA 3N6MA 3BGRA 1UW9A 2R7UA 1JJ4A 2ZNYA 4ZS6A 2KT5A 2PMWA 2DH8A 5K14B 1TKTB 3RR8A 1I94J 3V6HA 3RB0A 4Q8FA 3LA0A 4ZPWR 1HWKA 4HI2A 1F5CA 2V9WA 5LSRA 1WSRA 2B8PA 2C42A 4B3OA 2VFUA 2V8DA 4L76A 2D3O1 3MXHP 3X3UA 3C6TA 2GW8A 2YKNA 4RBTA 5HJXA 4K7QA 5DRKA 1XEZA 2CQ4A 1Y5LB 4AXIA 3KXDA 2F40A 3J81j 2WVCA 2DHAA 3RJMB 1S77D 2K2PA 4LBPA 3P8BB 4B3TF 5CCMA 5THWA 4CM2A 2XLKA 1YJUA 4DX8H 1HNXF 1P1TA 2AZ3A 5KFSA 3W5YA 5ITHA 3GFXA 2CZVC 4HTJA 3G6ES 2C3MA 1BQXA 2JVOA 3Q8UA 4F3QA 2KZZA 1NU4A 2HIQA 4OYMA 5F8JA 1M5SA 5HP1B 3UNYA 2B8QA 4ANCA 2YNFA 3L4BC 2APOA 1RTHA 3M8PA 4OZJA 4WF9Q 2BBEA 2OUGA 4OZ0A 3MEGB 3DN9A 2KL8A 5HMWA 4NLOA 2B6AB 2M8HA 2J8SA 5KFWA 3JAMY 1H72C 4CQ1A 1UVNA 1UL3A 2W01A 2R8JA 4N76A 4LSNA 2GHWA 1KNZA 2Y1LB 3KG4A 5IV4A 3BQ0A 1H3DA 3FSYA 4IDKA 4C7QA 3BN4A 1XC9A 1D0EA 4LRCA 3ZTRA 4A46A 4OHYA 3HSZA 2VBYA 3D9BA 3M1VB 1S9EB 3PYEA 1EQMA 1T05B 4KPCA 1U6BA 3DOKA 4F7VA 1Y0HA 1RAHB 5KAKA 2B0GA 2C22A 1W26A 3DMJB 5IT0A 4X64J 5BYSA 2FHMA 4RBVA 1T8EA 5HK4A 3NMAA 2WVDA 3E01B 1NXIA 3IGNA 3FZ2A 3C16A 2CPIA 1JLEA 3GWCA 3SIPB 1FXDA 3MEDA 3QT8A 2ZZNA 2ZH6A 5EX3A 3MAAA 2V8VA 3IS9A 1R3NA 3CCES 4NA2A 2B5JA 4NWBA 1M5VC 2CA9A 4P71A 3MM8A 4JI6F 2J9EA 3JQKA 1ICEB 1LV5A 3GV8B 1VC0A 1VQMS 3MMBB 3I0SA 2AYGA 5KG0A 3I5AA 3PTWA 1LW2A 4RW8B 2VG7B 3HVRA 4UZCA 1H73A 3L7UA 3ZZ0A 4KR0B 1FTRA 1WUUA 2YX1A 2BXJA 4NEYA 4OI3A 3CDWA 2M9KA 5J2MA 2HAIA 3UWTA 4DFJA 3VAJA 4GVLA 4LVOP 3QAUA 3PXGa 3M8WA 1HNIB 4WP9A 5J2PB 1SL0A 2QO3A 1L5UA 3LP0B 1U2CA 3MD3A 5F9LA 1UWAA 4DR1F 5HATA 2VBXA 3HLUA 4V1Ak 4B9VA 3UDEA 2CJXB 1WF2A 1CJUB 3BBFA 2CQCA 2W8LA 1BQNA 4F4KA 1NH7A 5IS2A 3ICLA 5KG7A 4DV0F 5MAOA 4X4NA 1T03A 2B43A 2E5LJ 5A0YA 1OQ6A 4QWEA 2EI5A 2LXIA 3BSOA 2GA7A 2RUSA 1VQ7S 1YX2A 2A3JA 4UUXA 3H7HB 4GKJJ 2WVBA 5A8WB 1JJ2R 2OJ3A 4B9SA 4ITSA 4Q2LA 4OI1A 4IQXA 3AFGA 2VA2A 2DJWA 3LAKA 2JEJA 4WIQA 1M1HA 2MSSA 4NL5A 4WE1A 3NWRA 3DM2B 1MW7A 1X9MA 4X4QA 4XO0A 1HYSB 1D9AA 2NXUA 2CQDA 3THVA 1GEHA 2D69A 3M9NB 3SI8A 1V3ZA 1QTMA 3O1LA 2QL9B 4O23A 1B0TA 7AT1B 2OPSA 1KLMA 1OSDA 2IY5B 2BX6A 1S1VB 1YGYA 2OSQA 4F2SA 4RX6A 1RAGB 4C0BA 5CYJA 4Q8EA 1MN7A 3LPEA 3FGVA 2DBBA 3PHEA 5AXKA 2WB4A 1LNQA 4TYAA 4WZMA 4RW6A 2ZBRA 4FBUA 2E5GA 4IFVA 1RKJA 5H9EK 1UA0A 5FLXY 1HPZB 4DUZF 4EBCA 2RE1A 4ILMA 1S57A 1VR6A 2MZJA 5KG2A 3DC2A 2M4MA 3D3CJ 2FD2A 3D1HA 4ECQA 2ABYA 2YNIA 4CO5A 2KXNB 3V2UC 2BJ7A 2Y0BB 4RW7A 2KZMA 1NK4A 5GAEU 3W2VB 1CJTB 1O6XA 1MWZA 4DR6F 5D4NA 2DT9A 2XO7A 2FJEB 2HS4A 2R8GA 3PJWA 3G8SA 2CNNB 3PJXA 3SFUA 1XBWA 3CCRS 1R89A 4OX6A 2PIIA 3MWBA 2QMWA 1S76D 3CVKA 4CO2A 2HHHF 1CBKA 2AX1A 2CPHA 1U1QA 1UKUA 2WBRA 1G6BA 2GHPA 2FQQB 3UD3P 5T7LA 3BO2A 4WZQA 1C0TA 4USMA 2JX2A 1SKSA 3MEKA 2F4VF 3M2UB 3TO8A 1KOOA 3IBWA 2VC1A 2DEJA 2GIRA 3CNQP 4KB7A 3T1YF 1L3VA 5DZ7A 5E3RA 2NZ4A 3MCMA 4ID5A 1GX6A 3OL9A 1NK7A 1NNDA 3K5NA 2IM2A 4LJMA 4F26A 1AZSA 2CPEA 3CJQA 2A10A 2VC0A 4AQYF 5KT3A 2COLA 1CC7A 5E41A 3OT9A 4IH7A 5HANA 4ANEA 4ZJLA 1KWMA 2Q6BA 5HVHA 5KFNA 2PO4A 1DARA 4ZN1A 3OTBA 4DV6F 3H8YA 3EJMA 2GMHA 3DLGA 2ZZMA 5ETNA 1IQTA 3RR7A 3RW6A 2EEYA 4TKTA 1HBMB 2X1GA 2AU0A 4RW9B 2GS8A 3EGWB 3BGLA 3TR5A 2LDIA 3NGSA 3WC0A 2C2ZB 5E0OA 3L09A 2ROGA 4M5GA 2CPXA 2QA1A 2KO1A 3O3LA 2VA3A 2A6OA 3MM9A 5CCLA 1B0VA 3QLHB 1TL1B 3QAEA 4M5DA 4DEZA 2XQCA 1ZH5A 1VQOS 4RUCA 2EFPA 2EBEA 3H0PA 4FNHA 2FZGB 2M52A 1EZZB 2XMAA 5EHHA 1SB6A 4DSJA 2V2KA 5I3UA 5E5NA 1N34J 4F3OA 1X5SA 1FJCA 1UEKA 4OZ3A 4HHHA 4IG0A 3A3PB 3EGNA 2VG6A 3TJAA 4ZP7A 4FN5A 1X4DA 3Q83A 2NZCA 4ZHRA 3A8EA 1RAEB 4P2MA 1YRTA 2E7WA 1FXLA 2CJQA 1J27A 3HFVA 3SZ2A 2E5JA 4AD6A 3DLBA 2BKOA 1WOOA 5A2QU 2VQFF 3DLEA 2J6UA 2CIMA 1VC6A 3UN5A 3KK3A 2YNGA 3TZZA 1BC6A 1IBMF 3KJQB 1AB8A 4UY8T 1GMUA 1EKSA 4ZLPA 2UVVA 3CT9A 2DNKA 4PWDA 1N6QB 2EG1A 3UNGC 1PBAA 4MTPA 4PYDA 4MKBA 1Q7YT 2AIRB 4KKOB 2LDYA 3Q2SC 3AXKA 4ZDNA 4WKRA 3BEGB 2HGLA 1Q8LA 2CPJA 1YJNS 3N5FA 5M2PA 2HHXA 2ZNZA 3VQTA 1VQ9S 1N32F 3U1LA 4ZITA 3ILJA 2HWHA 2MQ8A 3JXOA 2HWIA 2KRBA 1SKWA 5H9EJ 3PW5A 2NXCA 4YR2A 3C66A 4LIRA 1RADB 4NCGB 3GONA 1OY8A 3NAIA 2F7VA 3B82A 3HZGA 3VAIA 2WOMA 4WFXA 4R8UB 2CKWA 2V5HG 2HHUA 2F8EX 5L9NA 4MFBB 3POTB 4Q43A 4JI2F 4ECZA 1NM2A 3RBZA 3LGNA 5CYMB 3TOQA 2HRYA 2UUBJ 2YTCA 3FZBA 1JK9B 3OXGA 4EWTA 3BYRA 1VQ4S 1WC5A 4DV5J 2YNHA 3EGZA 1DTQB 5ETOA 1S1TA 2ZITA 5DLFA 2CQ2A 3I56S 1M5HA 4HDGA 1A6LA 2KN4A 9RUBA 4PWWA 4P2SA 3CMES 4OZ2A 4O3OA 3HVTB 4L3NA 1JMTA 1U47A 2CYYA 1B0PA 2I38A 3MD1A 4C6AA 3D28A 4N5SA 2HBZB 3Q86A 1HQUB 2HVHA 4FYVB 3QGIA 3PX4A 1TR0A 3OTCA 4CM0A 1MROA 3HSJA 3K59A 4M63A 3T5HA 1NKBA 1LW0B 2HQDA 1Y3KA 2DHGA 2RKIB 2C2OB 1VBKA 2OPQB 2V8GA 3BPSP 5LJ5Y 5D4PA 2BJEA 4DR2F 3G6YA 3DOMB 3DLKA 3W8PA 1F9EB 3ZTOA 3KK2B 2OPPB 3BBBA 2AD9A 1CULA 4AL6A 3A8KA 5FIIA 2V68A 5H9FJ 4TY8A 2Z58B 3DRPA 3S6EA 4EMDA 1YJRA 1SC6A 3HX9A 2XMWA 4K5SA 4EYHB 1GQEA 1NLKL 2W4CA 5K9FA 4NCBA 3KLIB 2IBOA 5G0RB 2UXBF 3N4WA 1WORA 4QIVA 1EP4B 4M5MA 1FHTA 1N33F 4ZP9A 2UXDJ 3RAXA 2OIHA 4JI3F 5BR8F 2GGPB 2HNYA 3G9CA 3NCRA 2FHOB 4O4RA 1IBKF 3RAMA 2R7VA 2F8MA 2AJ2A 2B9EA 2GO9A 3PR4A 3V6DB 2R7TA 4ZK7M 2V69A 4DUZJ 1HNVA 4CYUA 3FNNA 3SQGA 2OD6A 2CADA 4ILRA 4WFAQ 2H5EA 4C8NA 2NCKL 4HHUA 3H98A 1HI1A 2MKCA 1TFWA 3M9MB 1Q81T 4RU2A 4CLYA 3MECB 1Q53A 2V4QA 2ILZA 1VRQC 4DLGA 2OFHX 5AE3A 3HHNB 1U09A 1SJ3P 5DZ6A 2QEXS 1CSJA 2HNZA 3CJKA 2AJ0A 2XMTA 4KPYA 2JH3A 3DRSA 3DRXA 3MAQA 4NZ6A 2ZOGA 4LF8J 3HSGA 3GV7B 2HHHJ 3G82A 1ZM2A 5A8RA 1RTDA 2YXLA 3FFIA 4IH6A 4LSLA 2WCXA 3JTOA 3KDNA 1HL6A 2J6TA 1APSA 5K8NA 4ZVHA 3KHLA 1RYRA 2HMIA 4KGMA 3SFGA 2F4VJ 2E7VA 1RAIB 2XS2A 5HBMB 2W7OA 5KFKA 1UMJA 1SC3B 2POKA 2XG8A 3TQ1A 4I67A 3QFHA 2IM1A 2BKNA 4F4YA 3UR3C 2BJDA 2B4VA 1KTVA 1H74A 2RJZA 3VGSA 4AQYJ 1JLBA 2GX8A 4A8YA 1RISA 2HLUA 4HEA9 1FNMA 2UVRA 2DXFA 2UVWA 2ALZA 4F0KA 2YQ1A 2B7CB 3FRZA 4RLEA 3NBPA 2IVYA 1S48A 2UXCJ 2F65A 3Q8VA 1KDNA 4W98A 1JXLA 2WAQD 3W5XA 2AF6A 2RF2A 4OHZA 5A6WA 2BE9B 3TAMA 4D3GA 1SQFA 2IA0A 1D8ZA 3FJ2A 3CDUA 4DFPA 4KGXB 2LQJA 2RILA 1J5OB 2MZQA 4P74A 4LBIA 2Q66A 2HAFA 3VGVA 5CH7B 2C2KB 1QE1A 4IKAA 2BM0A 5D4LA 3SMZA 1HMVA 3GIJA 4W4MA 1ROFA 1HQEA 2NXJA 1C1CA 1WG1A 4ZPAA 1PJ6A 1M1KT 3GIKA 2ZM6F 3DHXA 1R0CB 2W9BA 5ETQA 4DCJB 5I3QA 1Y5NB 5D0EA 5A8KA 2PSZA 3N28A 4OX8A 3FSIA 1K44A 3CULA 1SQGA 5C24A 1TKXB 4DCOB 3U1MA 3W9HA 3PFEA 4DX7A 1EKRA 1LXNA 3T5LA 4FP9A 4L73A 3VF0B 2XYHB 2EW9A 4FF3A 1LXJA 4LVNP 1RT2B 1LWEA 3IWNC 2DXEA 3GPAA 1HI0P 1IWGA 4G65A 4WK3A 4TY9A 4A4JA 2VQFJ 2I5JA 1FRIA 4IFYB 1NK8A 4QIWD 1KONA 2RQCA 2XWYA 4CLTA 5BYRA 4KBIA 4X4OA 3M30B 3OL7A 3CEDA 1R0AA 1RTJB 1IBMJ 4K4UA 1PYTA 4WXOA 3QT7A 2C3OA 4Y2MA 3QZ8A 1SL2A 5HROA 2E1AA 3IXQA 2VASA 1IKYA 1NK9A 1X7VA 3OVAA 5KG3A 3UDLA 1VRTB 1NDLA 1NSQA 4NZ7A 2I9SA 1WC3A 3G8TA 3AOCA 1RBAA 1VJWA 4TQSA 1HBOA 2XZDB 2D1CA 3CCLS 1BGXT 1S1WB 2VOOA 3OR2B 1AXQA 3VV2B 5L1LA 1YJVA 2W4DA 3MGJA 4JV1A 1N88A 1HA1A 5T14A 1XK8A 3KHHA 3PV8A 2BJ3A 3BR9A 2G4BA 2IPOB 1N32J 1OO0B 3M6XA 3RBEA 2P2CB 1XNRF 2IJFA 4S0MA 2CQ1A 2MLYA 2FYXA 4QBUA 1IN0A 4USVA 3MURP 2KDOA 3EDQB 3BSCA 2RIJA 1WG5A 2EFVA 4DCPB 1RGVA 2EFGA 4DQRA 4QYZK 4FXDA 3MMCB 3SDEA 2HEKA 4NPOA 4QIGA 1RT6A 3MHYA 3N6LA 5B0FA 3RBXA 4J9RA 3TANA 3AOBA 2BKPA 3JQJA 4QYRA 5K8MA 1S1XA 2DO0A 1TP7A 5L39A 5EGYA 1IR0A 1QAJA 2MZRA 5LT5A 1M1GA 3IAS9 4I2QB 1JNRB 1FJ7A 4G3IA 2G2YA 3L3CA 1MU2A 4U6PA 4PKDB 4KE5A 4PG6A 3ZFVA 1NPRA 3NGDA 1VQ5S 2MEWA 4X65F 3Q0AA 1TELA 2PA3A 1N36F 4FKYA 4EZ6A 2W8KA 2IMWP 2OP5A 2NPFA 4N47A 5B7WA 2MJNA 3C15A 1NDCA 2W1BA 2EC0A 2XMVA 1OPIA 2CJYB 4YP3A 4DQSA 1XMOJ 4FPIA 1TAQA 1S0VA 4C8ZA 1H2UX 3HHLD 3D1OA 4Y6IA 1HNWF 3BSNA 1RP5A 1TUGB 2OTJS 1ZA1B 2DNLA 3KJVB 5SZTA 1Y9OA 4YEAA 2ZJQQ 4RBUA 1HD1A 5JVGQ 1KQSR 1LKZA 1ZETA 3ILLA 1EX8A 5E2QA 1NHVA 4FZVA 1YVFA 1V5VA 4DR5J 1SJ1A 3VAFA 2L9DA 1FKPB 4IQMA 1L3SA 4O44A 3IFEA 1NSPA 3MAHA 4HH0A 2G13A 1Q0NA 3TQEA 1F1BB 2UXBJ 4XIUA 5DQIA 1EARA 4KC5A 2MLZA 3RU0A 3RB3A 2E29A 2GIFA 3D5MA 1VBYA 3DRYA 2I2YA 1UZDA 3UW1A 2DITA 2HNDA 4C3KA 4DX6A 2XYGB 4KT0C 5KFDA 1U7LA 4PUOB 3JSBA 1K9MT 3CD0A 3ZTPA 4HACA 3NNCA 1UJ4A 1FWLA 2KXHA 3KMSA 4X4TA 4ES3A 1M5KC 1Z2LA 2V2QA 4H4OB 2BQRA 3CJ4A 2OHDA 1SVDA 2R8HA 4GO7X 3TP2A 2KH9A 1UEUA 3KLEA 3H90A 1VBZA 1YK9A 5IQQA 4QU6A 1IJEB 1FJGF 3HPOA 3ZO7A 1U1LA 2ZOFA 1E6YB 3V4IB 1Y5IB 2A18A 2FVCA 3GB0A 3PX6A 2BVZA 1J2VA 3PY8A 1SJFA 2XGQA 4DV7F 3OTOF 3E3XA 3D0HE 5DDQC 1LEOA 3I6PA 3RRHA 2EKYA 1X31C 1TMJA 3ENVA 4NI2A 5CD4H 2X1FA 4OI2A 2XY6A 2Z2LA 1PYOB 2IJRA 5J1EA 1RT1B 4G1IA 2VDHA 1OYEA 1T7PA 2C28A 5IC4B 2KHDA 4P73A 1SXLA 2L48A 4KO0B 3W8GA 2CJ9A 2VV5A 4NA3A 4ZVTB 3DYAB 3WQPA 3EYZA 1X4EA 1TL7B 2H51B 3ET6B 3ENAA 2H9ZA 3EDRB 3TUZC 2ZEJA 3IR6B 4DSEA 4RWXA 4Q45A 5I4MA 4FF2A 3C14B 2XSJA 1DTTB 2RSQA 2OI2A 4F0MA 1FCAA 1WKLA 3BGOP 3IM9A 4YB1P 5DG7A 1RSCA 1GT8A 4DU7A 2Q6CA 4C48A 3CXCR 2HVZA 3BGRB 1O51A 4RKUC 3GIIA 4P75A 4U7UD 4LMZA 3FMWA 4MIWA 4JV5F 2HWTA 5DM6Q 3D4JA 2AW0A 4MT1A 2Z4PA 2AP6A 2RQ4A 3DOLA 3CCJS 3CW2C 1Q78A 4QYZJ 4AYBD 1V3RA 4QR2A 3MFHA 2FHJD 3PW2A 1D09B 2JLFA 4NLQA 1MMDA 1NAQA 4YN3B 3ZZOA 2AJ1A 4B3OB 4ZLLA 3RB4A 4DR7F 2HHVA 2EXUA 3T3FA 2WZ1A 2OH2A 4C0OC 5HMXA 3CJRA 2ZM6J 1HNZF 4ZA1A 2YKNB 1KP6A 2DNGA 1RK8A 4PXCA 1UWBB 3SCLE 2F1FA 4NA1A 3DXSX 3QJPA 1D1UA 3TYTA 3OUYA 5EX0A 1PJ5A 3I9ZA 5FJ4A 3J80Y 3NS5A 4QWAA 2BE2A 3CJ8A 2M0GB 1FNOA 3ULHA 4KY3A 3TA2A 5KFOA 4FS2A 4M8LA 2HRTA 2Z56B 2R2RA 2UV8A 5IT9Y 2ILYA 5BYQA 3SCIE 1FKOA 4YY3F 1IKXA 3NS6A 3CCVS 1BMQB 2LQ5A 3HFZB 1FK9A 3D6HB 2MSTA 1YJWS 3ADAC 4A8MP 2MQPA 1WC1A 1JKHB 4PXBA 4PG4A 4BDPA 4LSNB 2MKJA 4L72B 4HLBA 4E98A 1UTAA 3OLAA 4IDKB 1SCJB 4OI4A 5IM0A 2OFGX 4IRCA 1S4EA 2XB2D 1PILA 1CVJA 2AKWB 4ANDA 4RU9A 3BV8A 2FJAB 3DOKB 2Y1JA 1DLOB 1TZ0A 2MGZB 1TKTA 3CC2S 5LMUJ 4ELTA 4LFCJ 2P6SA 3UI3A 4Y00A 3DFEA 4WJBA 1FRLA 4XDCA 5DDPC 2AX0A 1XNQF 4CT9A 3KUHA 2VBWA 3BKTA 2XSFA 4KGZB 1BLUA 1JLEB 2FTRA 2G0IA 4KFBA 3PIPQ 4JI4J 2DPIA 3K2YA 4J7CA 4B17A 7FD1A 2Y0SD 3ISNC 4ZP8A 1DZ5A 5E3AA 3IBCB 1X0FA 4EO8A 1YKWA 4N41A 2X7IA 3MAAB 3IS9B 4OLOA 4CLZA 2HW3A 2H4YB 4ZPVR 1X9SA 4YHHJ 4DFKA 2R8IA 2DNOA 2ADCA 4XPEA 1NSKL 3J7YI 1JQGA 3NG8A 2CPZA 2B5JB 4N77A 1GH8A 3R6LB 2HZVA 2DGWA 4ZJOA 5HQMA 6FDRA 3F44A 1X4HA 3D6FB 4NLTA 2K7KA 3SSSA 4PPZA 2GJFA 2MKHA 1R8BA 3FDSA 1KVKA 3PKMA 1Q7LB 5K8OA 2MY7A 1DURA 3QPIA 2BE7D 5C5JA 2YX7A 2KRRA 5L1KA 4Q0BA 1SIWB 3MCNA 2R7RA 2RVJA 2D74B 5J2MB 3A4TA 4DSFA 1PJ7A 1LWFA 5LXRA 1RT5A 3AH6A 5E33A 2C3PA 2HPUA 1UPMB 4AUKA 3ZTSA 5E3PA 2DGTA 3LP1A 4JI1F 2ZVSA 3B78A 2LXUA 2C2DA 4Y3CA 1MN9A 2D41A 2R7XA 1HNWJ 3EXCX 1U48A 5D4OA 2WONA 3D6TB 1BQNB 4Q7AA 2JFKA 4R5PA 3HZEA 1YJ9S 5DGAA 3N0VA 3I96A 4YR3A 4NXMF 5DDRC 4UOFA 5A0YB 2KJWA 3KUEA 3MR6A 1FNXH 1RWWB 4JV2A 1QLNA 3IGVA 1LOUA 5L38A 2XY7A 4RPFA 3PG9A 1N5VA 4ZMMA 1YRUA 2CQBA 1N5SA 2AGPA 2YKQA 3CCTA 2FGOA 2RDDA 2QFIA 2GAHC 3CC7S 3CJSA 1G1XA 1PBUA 4C98A 3OV7A 3GCWP 5JJBA 4NX9A 2PT0A 2XM3A 2ROEA 2WVEA 3Q2TC 5K8PA 2V50A 1EJ7L 1A9NB 2MTLA 4CNZA 2MKSA 2VF3A 2OPSB 1KLMB 1Q5YA 4LBHA 5CAAA 2IAJA 3OSNA 2BDPA 1T95A 3WIVA 2ZFHA 2O5DA 1HHQA 3FBEA 3IRXB 2NREA 5ETRA 1RB0A 3KK1A 3I0RA 2DGQA 3PW0A 1I3OB 2EPIA 4LFBF 1PGZA 1A0OB 1JXVA 4MK8A 4USHA 4KHRA 4RJVA 4RW6B 2KYXA 2VG7A 3W66A 3PW7A 1IBLJ 3S1TA 4I2PA 4DDFA 2M5YA 1RWNB 1T9XA 2MHNA 1FJGJ 2WHOA 5IFMA 1YIJS 5DDOC 3PYDA 3SBMA 3CMQA 3T6JA 3WIUA 4IRDA 1H2VZ 1CJKA 2YNIB 2X3DA 2ASDA 5J2PA 4RW7B 1GFWB 1SQEA 3GZ7A 4DV7J 3OTOJ 2PA8D 4TXSA 2WBMA 4Y0FA 5JVHQ 4LFAF 1IWAA 2DEIA 4A8XA 2VQEF 3PM9A 2G0JA 4DSIA 1IKWA 3SV3A 2I1RA 4F4AA 4ZVSB 2DNPA 4MKVA 1RT7A 5B0CA 1MMLA 1RBOB 3VVUA 1JLAA 4X4UA 2RS2A 1C0UB 5IC6B 2OEKA 2BZ2A 1WEZA 4LR8A 4B08A 1KS2A 2CG8A 4N8OA 4F02A 1OY9A 5GMKa 2RRBA 2F5GA 2J0SD 4M5JA 1FDAA 5T7LB 4O0NA 3A8IA 1C0TB 1VIOA 1S4FA 4PG7A 2MXYA 4ZPDA 5KFQA 1FEEA 3TVZA 1KTQA 1K47A 4DUYJ 4ZOSA 4ZVQB 5AE2A 2E9ZA 1WHYA 4MKYA 4XK8C 1RTZA 1FI4A 3PNIA 1FESA 3MM5B 1R6YA 4ID5B 3DM2A 1CG2A 2AEFA 3DRRA 1WACA 3UN2A 4R0EA 1REVA 2W2QP 3CCQS 4I69A 4WFNQ 3CD5A 1XMQF 1S97A 2C2NA 2P9CA 4YDXA 4JV5J 3K8WA 3N6NA 1FRKA 4MIBA 2BMBA 2QMXA 3IN5A 3DLGB 4OJHA 4J9SA 1H98A 3RUBL 4LF5F 4J91A 3DHWC 4PRFA 1MNEA 2PFFB 3UVJA 3W61A 5J1PA 5CD4A 1WHWA 4B3RF 3MM9B 3KG1A 4DR7J 2KFZA 2AJ4A 1K73T 5ETTA 2DH7A 5A76A 1NDPA 2ZBIA 2CZ4A 2DGUA 5GMEA 5IT4A 4CO0A 2UUCJ 5FD1A 3BDEA 1IJFB 1OMSA 1OQ3A 1WKKA 2PC6A 1G4CA 1FWKA 4A8WA 4DR4F 3D68A 1S7HA 4ZCMA 5I3UB 3T6BA 2IHR1 2MKYA 3HD2A 4ETXA 1LWXA 2SXLA 1QDUB 2X51A 5DETA 1CEZA 2DTJA 3M8QA 1SV5A 2EK1A 2JC1A 4FXWA 5E7OB 1YG0A 5HQ8A 8RUCA 3CE8A 9ATCB 4Y2IA 4YY3J 3ILOA 2B4PA 4WP3A 3D7SB 2LQ9A 1RWKB 4GMKA 2FVRA 1KRPA 3PFOA 4IH5A 1FDBA 1RU2A 3NGKA 2XMUA 2W2NP 3RBDA 1EB0A 3CO0P 2DGOA 2LU1A 3EVWA 1ACMB 3OR1B 4J37A 4BLGA 1BY9A 4J9QA 3DLHA 1DAXA 4G1QA 3DLEB 2RQKA 4Z37A 3KK3B 3M32B 4OJGA 4NLSA 4M94A 1TK5A 4MK9A 1KQKA 2VU5A 5ETLA 1JLGB 3M7VA 4DR3J 5KG4A 4C4WA 1RA6A 1AFIA 4PAAA 4DBQA 3QO9A 2J7UA 2XC9A 5HVFA 4NXNF 2IBKA 2Z8QA 4TQRA 4PWDB 2AWZA 4TLQA 4RW9A 1XNQJ 3WBZA 3BYPA 5DS7A 4XAKA 2XGPA 1OSCA 4GKKF 4DQQA 3ISZA 5CQGA 2WW4A 4YUDA 5AJ3F 2ZD1A 3QLHA 1HQ2A 1FE4A 1TL1A 2FVPA 1EETB 4EBEA 3HULA 3TJ8A 5JXSA 1UAWA 1WG4A 3GR0A 4A8QA 1WOPA 2E5HA 3MF5A 2VHGA 4JI0J 1Q95G 5LSLA 4Z2XA 4H54A 2Z2ZA 3CJ5A 2O3DA 3BKUA 4BWJA 3OTEA 4JB8B 1VGYA 3IWXA 3QIDA 1U2FA 2WOMB 3LOUA 1D8YA 3CUNA 1RHJB 4PPDA 2L9WA 3R5JB 1NPKA 2XEXA 3FKBA 4XTTA 2ZHAA 2V4RA 4H4KA 5L8RC 2QIFA 4YR0A 4RW4B 1U0HA 5B0AA 5GAGU 5KFFA 2HVEA 3K5MA 4O3NA 5I42A 2EFNA 3RW7A 2BM1A 3TAQA 4USTA 4DN0A 5B09A 2DVIA 4M1KA 4P72A 1QVGR 1ZOTA 2H65B 2D9OA 3MPYA 3OVBA 1LWCB 3BB5A 3H42A 1S1TB 3BO3A 5I3PA 1HD0A 3NXZA 4DF8A 3KFWX 4HT5A 1NEEA 1FRXA 4KIAA 5MLCV 4NXMJ 3I55S 1NRKA 1U0SA 2ZH4A 1MROB 3JS9A 2RHSB 3MM7B 4OQJA 1FWPA 1P27B 1S7IA 5KFJA 5G4DA 1S0NA 3CWJA 1F3FA 2CJKA 4ED2A 4JI8F 3HK2A 3DLKB 4ZLJA 3SCJE 1QD1A 3CCUS 1ZM9A 3IR7B 1HR0F 1KOHA 2RQMA 2F4FA 3NS7B 2UUAJ 1PSDA 1CULB 1C1BA 4U95A 1T9TA 2MQMA 1RBLA 3GJRB 2N7CA 2UUWA 1YI2S 4J5OA 4TY8B 3DRPB 4EO6A 1U24A 3AT1B 3VQSA 2J9DE 2FJBB 2CAJA 1V3SA 2CQ0A 4E0DA 2N3LA 2PMHA 3MFIA 3CGIA 3ZZYA 3I82A 3AY0A 1NPPA 3DDKA 1ELOA 4O4GB 2W2PP 4NCGA 5KT5A 4ALZA 2HNYB 4F25A 3B54A 1MSWD 3C6UA 2HQIA 2ERRA 4WTYA 5IWAF 3HMJG 4DMZA 4WKYA 2RRAA 4OX7A 1C2PA 2QX0A 4R8UA 5L9XA 4PABA 4IOAQ 2YY3A 1IBCB 2YWWA 3AOAA 3BBCA 1VMBA 3H5XA 4OYBA 2W9AA 3SQGB 4LRDA 1CS4A 3P5TL 2R7QA 3C46A 3DDIA 5EWEA 1YITS 2LEBA 3LWMA 1R8PA 1FE0A 4EEYA 4LRFA 4KQZA 6AT1B 4X2BA 4LF7J 4OYWA 1NKEA 3BKFA 3OTDA 4LFAJ 1DTQA 1FVSA 1NJZA 4XPCA 1GX5A 1N0UA 3HVTA 3CJKB 2ZE2A 1WSVA 2NLWA 1S5ZA 3DRSB 1ZBTA 3Q8QB 3G87A 4NLUA 1RXOB 2QA2A 3G82B 1KSPA 2DHXA 5A8RB 2KM8C 3W64A 4PQUA 4M5HA 4WFYA 1LW0A 3PZPA 2V4JA 2HMIB 1VRUA 3OVSA 4LRBA 4DXLA 1ULRA 2OPQA 2HSEB 2VJVA 2CZ9A 3AD9C 5KT6A 3DOMA 1QM9A 2WRMA 4C11A 2HGNA 5HN0A 2OPPA 1NHKL 2GJIA 2ZH2A 1WHXA 2B9XA 1S0OA 1OWXA 3AB4B 2B4UA 2HGMA 4IO1A 8ATCB 3ZNJ1 1JLBB 5ETSA 2IRYA 5AE1A 3R2CJ 1XMQJ 4X4VA 2ZDPA 5D3GB 1R27B 1SJRA 1ZM4A 3NBPB 4Y2CA 3M2RA 4CT8A 1U02A 2VFTA 1FVQA 4NEZA 4I0WA 4GVBA 3F41A 4ED6A 1QUVA 1CC8A 4O3QA 2LLZA 5KG5A 4B3MF 2YKPA 3LTOA 3GP9A 3H5SA 5EWGA 5M2UA 3KTQA 2ZWOA 1U1RA 2F8HA 1AFJA 1S99A 5KFMA 3C8YA 5T41A 3BQ1A 1QE1B 3MECA 1NSAA 3FBCA 1HMVB 4DSLA 3R3TA 1HQEB 2H3EB 1V6HA 1HW8A 3UFCX 1RWVB 3G2XA 2N4CA 1IM4A 5F8IA 1NKCA 1LQ9A 1U8WA 3MR2A 4ECTA 3BN7A 3MTJA 2W9BB 4LF9J 3JYTA 1VISA 2E44A 5LMNF 3QQCD 5A8KB 4OYPA 3VR1A 1SJQA 1E6VA 3LALA 3KLVA 2DNMA 4A8KA 5C24B 1I1GA 2ZJRQ 2CRLA 3HHEA 3M8ZA 1WC6A 3LP2A 1M0SA 1Y11A 1L3TA 2QT7A 1LWEB 3GR1A 4PYAA 5HVGA 1Y4ZB 5A2QY 4WYWA 2OTLS 2OELA 4NLVA 6FD1A 4WU2A 4JI5F 4PG5A 4Q2MA 1UVMA 4IO9Q 2I5JB 2M8DB 4X84A 3CCMS 2DB1A 5BXIA 2GNKA 3SCKE 3K57A 1R0AB 1DBDA 1ZAVA 3A1YG 3KJFB 4NYPA 3R7BB 4OMFG 3ZXWA 3THTA 4UY85 3R5AA 3ENWA 2DRAA 5HROB 1CJVB 1IKYB 3T41A 4W90B 1T3OA 5L1IA 4NXNJ 4QWCA 4ZVOB 3QGHA 3ZZUA 2B4OA 1DQAA 3C19A 3QRPA 3H59A 1S6PA 4RO0A 5CYQB 1NK5A 2HFSA 1HBOB 2XO6A 3DXBA 1MLAA 2P6TA 2J9CA 1SKUB 2LCWA 4U7UK 2E9RX 2NUHA 3CIMA 4K50A 3VWSA 3AQPA 2QLJB 1H6KX 5EWFA 3I4PA 2JHEA 3CF5Q 1XTZA 3IR5B 4CO4A 5KG1A 3AJ2A 3TEGA 3T1HF 2QLXA 4ELUA 3PIOQ 1KBRA 2W2MP 1I5OB 5KFIA 3PYFA 3CD6S 2QE5A 3GJTB 2UUTA 3ITHA 3BGUA 4L6V3 4DG1B 4OX9F 2ZDOA 1KFSA 2FJDB 1QUPA 5KFAA 4HH1A 1NO8A 2X1AA 3Q24A 1JLFA 4I56A 4A8OA 3SDEB 5KT2A 1YDLA 1ZTWA 3FMBA 2OAUA 2R9LA 4QW8A 5F0WA 2AEMA 1S1XB 1UJ6A 4QR1A 5HL7Q 4TNOA 3R5GA 3M2VB 2GVDA 2ZH9A 2HQCA 3Q23A 1FD2A 2PI4A 2D3ZA 1HW9A 2XMKA 2VD3A 1MU2B 3G6XA 3HM9A 4U96A 4OYAA 2EG2A 3S01A 1P6TA 4IFYA 2GMJA 3VHQA 4MK7A 3C15B 3FSXA 1PYSB 2JOQA 5H9FK 4ZLNA 5FDLB 4C8YA 1AYEA 2E1MC 1TV6A 1N52B 4AXJA 3TAPA 5CZVA 4MYTA 4CRJA 2XBPA 3ZZRA 4ED3A 3PVXA 3FCVA 1PIEA 3GE9A 2QN6B 3SEOA 1B99A 1WI6A 2NYIA 3FEYB 3K5LA 4LREA 3KLHA 4JI8J 1TFYA 3OR2A 4WPAA 3W65A 3HCXA 2CWKA 4ENOA 4B3TJ 2G1DA 2B51A 3V6JA 4ZVUB 2HBRB 1B64A 2NXNA 4KV8A 3FVYA 3GMGA 4C97A 1XJWB 4KAIA 3MPUB 1RACB 1HNXJ 4B9UA 4UOGA 1G3OA 1RAAB 1OY6A 4I6AA 5IWAJ 2IVFB 2HNDB 2O01C 1HWUA 3BS9A 3TZXA 5RUBA 4HACB 3NKYA 1BXNA 5EUHA 1YBAA 1GMWA 1FERA 1F3VA 1FXRA 4FYDA 3PR5B 4LR9A 3QWUA 1HKAA 1W2IA 3F56A 2ZKUA 3H4BA 5F3ZA 4DV2F 4ILLA 1D3WA 2LQ8A 1F5AA 3KLEB 2ATLA 3R27A 3B8HA 1JLQA 4MAKA 3GFZA 2ZBCA 5KFPA 1SJ4P 2HURA 3OBIA 4QZVB 4RNMA 5KFGA 2DK2A 5C42A 1PKUA 2G9OA 4MH8A 3MMAA 2IA6A 5KFZA 4KJIA 3BO4A 5J1EB 3TWZA 1R43A 3KJVA 3LGMA 4F2RA 3W1YC 3HFKA 5J1NA 2HHPA 4ICLB 4UF4A 2BEFA 2E5LF 4AFFA 5J2QB 3OQ2A 3F73A 2DYAA 4I1TA 4JI6J 3HSDA 2AJQA 3HO1A 3FCWA 4YB5A 1WC4A 4GKJF 4ZVFA 4IR1A 3IC1A 5DG9A 3OJSA 4M95A 2VPYB 3UPFA 2E1RA 1GTEA 3WC2A 4B9LA 2XSJB 2EFOA 1R31A 4KH1B 2CQGA 2FPHX 3JTPA 3MR5A 1TK8A 1K8AT 3D0IE 2FC9A 2C1EB 1X9WA 3HJVA 1S12A 3MMJA 2CNKB 2JLGA 3AXMA 2DHSA 1J5EF 1GXUA 4WK1A 5ADZA 2BW7A 4DR1J 4OL8A 1MG7A 2W25A 2Q43A 2Y3YA 1URNA 1VQKS 4C9DA 1N54B 3GU0A 3IBFB 4PR6A 3DOLB 1TMMA 3R6GB 4NLWA 3U02A 1RABB 2KVQE 2DGSA 3J81U 2RB7A 1VQ8S 2HFZA 3H5YA 4DV0J 2XMMA 2K3KA 1UVIA 2BOPA 3NP5A 2LXFA 4K4VA 4B9NA 2AYBA 1RTIB 4H4KC 1SI9A 2A2DA 3VCDA 1M5PC 1T9VA 5EN1A 2XLIA 4B3SF 2GFFA 1TVRA 3LUYA 4URQU 1RHUB 1VYAA 5K5MA 1YLXA 3L7OA 1NUEA 1YZ7A 3PRDA 2BYCA 3OUYB 1X4GA 2WSCC 4DOZA 4P10A 3G71S 3HHLA 2K8GA 2BE2B 3CDEA 1RT1A 3P6YC 2DCLA 2J76E 2CDRB 1NHUA 3VAMA 2RDIA 3CDAA 2Y1RI 4QQBA 3RZAA 2WTFA 3CIZA 4KO0A 1R7IA 2R8KA 3DYAA 2IC3A 1RCXB 1AT1B 2BUNA 1WEXA 5CZXA 1TU0B 4J90A 3ELHA 4O0IA 2IM0A 3K5PA 2KM8B 3VVTA 4Y34A 1DTTA 1NB7A 1WNEA 3DGPA 2DGXA 2FUG9 5IQ6A 1FJEB 4KYZA 3KNAA 3ZZPA 5IM0B 1NZAA 2YPZA 2FC8A 3EX7B 3NGUA 1RHKB 2WW8A 5HAOA 4DR6J 5HJYA 4HVZA 2Y9HA 1CQMA 1QSLA 2DNZA 2MHEA 3O44A 3VAGA 2V94A 4FF4A 4NRTA 4ES2A 1NB2A 1VK8A 4H4MB 3V81A 4ZPTR 3T1HJ 3TVYA 1HWLA 1W7WA 2DR9A 4Y2AA 2DGVA 1QAXA 3KLGA 5J2NA 4FS1A 3PO5A 4B9TA 3D67A 4KFBB 4YDDB 4OX9J 3B6BA 4OYIA 1WDDA 3PO4A 2ZH5A 1RCOB 2V63A 2PFDA 3US5A 4AL5A 2CUYA 3W9JA 1UWBA 2LEAA 5KT7A 4RWWA 1ZYQA 1Z2ZA 2M88A 3T1YJ 1HFEL 1TL3A 1N34F 1JJCB 4C8MA 3NCPA 2XLJA 1IR2A 3A12A 3BPDA 3HVAA 1DY3A 2WB1D 4ETZA 5KFEA 4IRKA 3JQMA 2VPXB 1ZZFA 2RAQA 4USIA 2YWGA 4QR0A 1FFWB 1F6TA 4UW2A 1S6QA 4Q0BB 3DU6A 4PZVA 1X4FA 4ECSA 1K0TA 3OW2R 3OL8A 1U6FA 4DV6J 3FC9A 1LWFB 3N5BA 3GTYX 3VZHA 4F4XA 1RT5B 3I9V9 4ATNA 1I6JA 1X4CA 4CH1A 1JKHA 4M5NA 4Z7YA 2KT3A 4OZLA 3LP1B 4K2XA 1Y10A 3KYLA 2MKIA 2KVIA 2U1AA 2IDEA 1FO1A 3MI7X 2XTJP 3M05A 3FK4A 1VQSA 2WONB 2VIHA 1BQMB 3BH6B 2BRKA 2W9CB 4R5PB 5E3QA 2VPZB 2GVZA 2OO4A 4ZVRB 2G2ZA 3AAWB 2XNRA 5B08A 1DLOA 2MGZA 3KLFB 2NR0A 1T9WA 2F63A 2ZC4A 1PAEX 2LP4A 3GYXB 1O5JA 3D66A 3U27A 4MYUA 5HMYA 1QAYA 2KU7A 1P9YA 1KLNA 4KSEB 2N3OA 1KR4A 2FHJA 1GMWD 2VICA 1YBUA 4U9RA 2BW2A 2BABA 3DU5A 3R1LA 3V5RA 2KG1A 3QNWB 1RE1B 3RYLA 3E8OA 1VDHA 3Q8PB 5F8GA 2MZSA 4JOUA 4OJ3A 3KHRA 1IQZA 2BJ9A 5D6GA 2LQBA 2K7JA 3DLLQ 2GO8A 3EPGA 2IAJB 2RU9A 1S9GA 1TK0A 3IG1A 2YKMB 1OJ4A 4M5IA 1GAOA 3KK1B 2ZWPA 2PDAA 3I0RB 4RR5A 3L95X 3P45B 4WYLA 2KTQA 5D8HB 1Q82T 3H4DA 3H25A 2Z0GA 3WHIA 4DV2J 4J9NA 2CNLB 4I2PB 2RMLA 4IG3A 3CJTA 2O66A 4DPWA 4BC9A 3D6MB 2BACA 2UUBF 3AA9A 2DNHA 3P49B 2RD5C 4F8RA 1CJKB 3H40A 1SUQA 5DLGA 4DV5F 3UDCA 3KDOA 1H2TZ 2JFDA 2QV6A 3JSYA 4NLPA 3PRBA 3IAM9 4USJC 1RT3A 4DZDA 1HHTP 1FX4A 4YB6A 3M6WA 1IKWB 1HI8A 1N5YA 2DIVA 2ZBPA 1RT7B 1WOSA 1GMVA 1YZ6A 2XULA 1JLAB 5KOWA 3TA0A 3J7AN 3PX0A 4JV0A 1I51B 4UUWA 3MOJB 1UJ5A 2B9WA 2HFNA 1NK6A 5HLFA 2V0NA 3V6KA 4JUZA 4MMOA 4DPUA 3P96A 2F9DA 3HT0A 1SIZA 2OEJA 2DNNA 2G2OA 2NS1B 5C25A 1O8BA 1F60B 4JI2J 4YS2A 3EUNA 4JI7F 3T5JA 2BANB 2DH9A 5B0EA 2VB6A 3DRRB 4LRAA 5AXLA 4EK2A 1CQNA 1S79A 5F9NA 5GADI 2W7PA 4LQ9A 3W2WB 1UPPA 1REVB 4I7FB 2VZ9A 1Q5VA 2ZOMA 3MEEA 1IXKA 4L75A 1J5EJ 3F0NA 2UXDF 1NMEB 2RUGA 3IRXA 2M3DA 3P3DA 2CVEA 2OSRA 4IR9A 3ZTQA 2ZH3A 4HHJA 3SSRA 2CPFA 3OD2A 2EVZA 5DJBA 1RT4A 1Q8BA 2XCAA 3PHTA 1C4CA 4URGA 3UVJB 4ERDA 4UQGA 1RI7A 1XR6A 2MB0B 4BWMA 3R8YA 3JAMU 1JWWA 4B3SJ 3QSIA 1TUVA 1GXTA 2NSBA 1W2BR 1RHMB 1WTFA 1U1MA 3DI6A 4JYAF 2XNQA 5CXTA 1WDTA 2BR0A 1N48A 1BHNA 1SC1B 4LUBA 4DR2J 3UD5A 2HIYA 1S1UA 1N5QA 1F0XA 5F8HA 2OD4A 2RNEA 2ZUGA 1RZMA 1U8SA 4DFMA 4FNIA 2NYHA 3EZOA 1C0UA 3M8QB 4LF8F 1SV5B 2PMZD 2PGCA 3ZZZA 4CP5A 4PXEA 2DISA 3IP0A 5KFHA 1N33J 3GSIA 2YQ0A 4K5RA 4JI3J 3KJNB 3UE2A 5BR8J 2KJVA 1JLCA 4DV4F 1IBKJ 2JL9A 2N4DA 1CLFA 1SBRA 2CJAA 3UO0A 2C2MB 4CLFA 4OV1A 3D2WA 3MM5A 2HVDA 2B9YA 3EPIA 2WK4A 3M8RA 2IRUA 1P1LA 4B02A 4G1QB 1VC5A 1G2EA 3K89A 4C8LA 1BWVA 3OHAA 3UCZP 2DNRA 2UV8G 2BOAA 4ELVA 2V2VA 4NMXA 2AZ1A 3H2LA 4Y2KA 3G6VA 2FJVA 5GVQA 2JEFA 3FQLA 2QGFB 2BQUA 1PG5B 1ZM3A 2UXCF 3QO9B 1TL4A 4F50A 4B9MA 4MKAA 1B70B 5C7PA 4ZVEA 4OJ1A 3R97A 2ALYB 1VLOA 1JIHA 3O5TB 5LXYA 5AXNA 2Z30B 1X8DA 5ETVA 3QIPA 3RRKA 5KFTA 1IKVB 2DNQA 1WWHA 1IR1A 2E1CA 3NNAA 2ZD1B 1RUSA 2VDIA 2MQQA 4N56A 2CPDA 1YRXA 4NCAA 1HBNA 2WSFC 3FEZA 4MJKA 4WFBQ 4J9LA 3OL6A 2CJBA 3FRYA 3TVKA 1DQ9A 4DQPA 1U49A 3NRBA 1FKAF 2DXDA 1KKHA 4RUHA 4K0KF 1OS5A 2ZJPQ 2RH3A 2JWNA 2Z57B 1FDDA 1HBUA 1N8RT 2QMUB 3T9ZA 3O6QA 3PW4A 1L3KA 1NK0A 3OLBA 2VH7A 1DQ8A 1JNZB 3Q89A 2IRXA 1VLYA 4DL5A 4EFAC 1U0HB 2OPRB 2GV1A 2K1RA 2EKNA 3I4HX 1UFKA 2FJWA 1RJJA 5I42B 5L46A 1B7FA 3N01A 1PCAA 1VFJA 3BZQA 1TL5A 2RRNA 1KC8T 1FX2A 4WCEQ 2CNOB 3OR1A 3MPVA 2YQ3A 1Y7PA 4IUFA 2HKEA 1QAIA 3M32A 2XS5A 3U7JA 2MKKA 1FF2A 1JXEA 2GQQA 4EUVA 1U45A 3V4MA 5KG6A 1VCTA 2AMCB 4LF1A 3CPWR 2YWHA 1JLGA 2KI2A 3X1LB 1D9FA 2XS7A 2BRLA 1VQYA 4KGVB 5KFXA 4I64A 2C3UA 5FLXU 4NLYA 5F8LA 2R4FA 2H5IB 1B3TA 3C6TB 5DO2A 4F4WA 2WVFA 1YJ7A 4JP8A 3T1AA 2FZCB 2J0XA 1MWQA 5L1JA 1EETA 3C3LA 4BBYA 1TAUA 1C1BB 4Z7CA 1DHMA 3HI9A 4M5LA 1F2GA 3BJYA 2EC2A 2H1YA 1Q16B 2G1HA 3MM6A 5D77A 1VQPS 3M8SA 4USWA 4KRWA 3R9LA 1XR5A 1S0MA 2RDJA 2J0WA 2AEJA 4ZIWA 4IOBA 1RAOA 3C6UB 2PI5A 3OJUA 2QYCA 3JSMA 1TKZA 3LANA 4CTAA 2DKOB 3GJQB 2CG4A 4CZCA 4CLSA 2VG5A 2YNFB 4LT6A 1RTHB 3M8PB 4CNYA 3KNGA 4OZNA 2HHTA 4WXWA 4BC7A 1GNKA 1OPZA 4ZIVA 2H4WB 1CPZA 2QA4S 3A8JA 4RW4A 1CS4B 4ECVA 1F5BA 3HHLC 2AGQA 1VIXA 2KB2A 2L08A 4UOCA 4I6YA 2PN6A 4FPRA 5SUHA 2QL5B 3C2PA 4LF4F 4ES1A 1N5TA 1LWCA 2IFXA 2BQ3A 3ETMA 3PCOB 2F3JA 2V6AA 1XERA 4IYQA 2VODA 5K14A 4X66F 1RKIA 4M5KA 4C0HA 1LFPA 2ZE2B 1FT8A 4ZP6A 1XMOF 3AB2B 3LGHA 4OIXA 1XNRJ 2L41A 2ASLA 2VFSA 4ZVPB 2CVIA 1ZAWA 2XI3A 3C16B 2YWKA 4LR7A 2Z2YB 4PQUB 1NDKA 2AT1B 3MM7A 2CDQA 3MEDB 2V4JB 4Q44A 1VRUB 5LJ3Y 3KWMA 1URRA 2FIUA 3QBCA 2QL7B 3P4UB 5D0RA 2X3GA 1R8HA 2OMOA 4C11B 1YBTA 3W9IA 3MM8B 4JI7J 3NL0A 1AUSL 3DLJA 1HHSA 4DR5F 2K3IA 2AQ4A 4LSZB 2BJ8A 1OYDA 3QYYA 5GADU 3TX0A 1AW0A 3I0SB 4BHQA 2M2BA 3MUMP 1LW2B 2DD8S 1KN6A 1DRZA 1WC0A 2PEHA 2QLBB 4O4GA 3M2RB 4X65J 2VJUA 3PEJA 1N36J 5C2GA 3BM7A 3MOZA 4DS4A 3FBFA 3EGVA 1KVJA 4DL4A 5HP1A 4K2JA 1RWOB 4GVBB 5GAGI 2C2EA 5D0GA 5CA5A 5GMDA 3OXFA 1YQHA 5LM7E 2BA9A 3MEGA 2D3UA 1U6ZA 2R7WA 3VTIA 2B6AA 4HTIA 1X0PA 2DNYA 1PO6A 2HFUA 2R2UA 3GLJA 2MZTA 2HQFA 4FDFA 3Q8SB 1AA1B 3UCUP 3QFWA 2KXFA 3LF0A 3J7A1 4JYAJ 3THPA
chains in the Genus database with same CATH topology
1CBKA 1IM6A 3MCOA 3MCNA 2F63A 3HSZA 4CWBA 4M5GA 2QX0A 1RU1A 4PZVA 4M5MA 3HSGA 4AD6A 5ETPA 1Q0NA 3ILLA 1EX8A 5ETVA 3ILOA 5ETKA 3KUEA 3UDEA 2BMBA 3IP0A 5ETOA 3HD2A 3ILIA 3HCXA 1F9HA 1DY3A 2CG8A 4CRJA 5ETNA 2F65A 1EQMA 3HD1A 3HSDA 1HQ2A 1TMMA 3HT0A 1G4CA 3KUHA 4M5JA 5ETRA 3QBCA 1RB0A 1RTZA 4F7VA 1EQ0A 1KBRA 4M5LA 3UDVA 4M5IA 1TMJA 3MCMA 3KUGA 5ETMA 4CYUA 5ETLA 5ETQA 1RU2A 5ETTA 4M5HA 4CYUB 3HSJA 5ETSA 4M5NA 1RAOA 4M5KA 3ILJA 1HKAA 3UD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CBK A;  1IM6 A;  3MCO A;  3MCN A;  2F63 A;  3HSZ A;  4CWB A;  4M5G A;  2QX0 A;  1RU1 A;  4PZV A;  4M5M A;  3HSG A;  4AD6 A;  5ETP A;  1Q0N A;  3ILL A;  1EX8 A;  5ETV A;  3ILO A;  5ETK A;  3KUE A;  3UDE A;  2BMB A;  3IP0 A;  5ETO A;  3HD2 A;  3ILI A;  3HCX A;  1F9H A;  1DY3 A;  2CG8 A;  4CRJ A;  5ETN A;  2F65 A;  1EQM A;  3HD1 A;  3HSD A;  1HQ2 A;  1TMM A;  3HT0 A;  1G4C A;  3KUH A;  4M5J A;  5ETR A;  3QBC A;  1RB0 A;  1RTZ A;  4F7V A;  1EQ0 A;  1KBR A;  4M5L A;  3UDV A;  4M5I A;  1TMJ A;  3MCM A;  3KUG A;  5ETM A;  4CYU A;  5ETL A;  5ETQ A;  1RU2 A;  5ETT A;  4M5H A;  4CYU B;  3HSJ A;  5ETS A;  4M5N A;  1RAO A;  4M5K A;  3ILJ A;  1HKA A;  3UD5 A; 
#chains in the Genus database with same CATH topology
 1T03 B;  2GCF A;  3A3N B;  4BCA A;  3M1V A;  1S9E A;  4MIA A;  1T05 A;  2HFO A;  1RAJ A;  2LEP A;  3HT3 A;  4O3R A;  3AHP A;  2QYG A;  5ETM A;  2AHO B;  4D3H A;  3T5K A;  3DMJ A;  3DGV A;  1GK8 A;  1VI7 A;  2N82 B;  3RG6 A;  3JYT B;  3E01 A;  2YBV A;  3TUJ C;  3TW0 A;  4DWI A;  2ZKT A;  1E6V B;  4NE9 C;  2LA4 A;  4P6Q A;  5M2R A;  3TI0 A;  2FLL A;  2EWH A;  3TJ9 A;  3KOA A;  1U26 A;  4LF6 F;  4P7V A;  1QTN B;  4WE1 B;  3LP2 B;  4DV4 J;  1GXL A;  1VS3 A;  4OZ1 A;  1IUJ A;  2J7W A;  4U7C A;  1FRJ A;  4EGL A;  3FEX B;  5F8M A;  4CLL A;  3S8S A;  3LQV A;  3CJ0 A;  1NZ8 A;  4X4P A;  1TKD A;  3EZ5 A;  5ETK A;  5F8N A;  3D0G E;  3BF4 A;  1ZPV A;  3HF5 A;  3MMB A;  2NPI A;  4RW8 A;  5D3G A;  1Y3J A;  4IFV B;  2V67 A;  3CCZ A;  3AD8 C;  1Y00 A;  4OHX A;  5CAB A;  4DPO A;  4I4B A;  2MZ1 A;  3JSR A;  2FLP A;  1S6P B;  1SH0 A;  2Z2M A;  3T9N A;  2PD1 A;  1HNI A;  3TAR A;  2FDN A;  2CQP A;  3K7R A;  1Q8K A;  3LP0 A;  3DDN A;  4U8Y A;  2L3M A;  2KT2 A;  1T9Y A;  4FVM A;  1O0P A;  1CJU A;  2Q79 A;  4C8K A;  1WF1 A;  4LF2 A;  3W60 A;  1SH3 A;  3GG1 A;  2AJF E;  2OEM A;  2HK3 A;  4DL3 A;  1R6V A;  4HR2 A;  2XY5 A;  2LEC A;  3ETO A;  5AT1 B;  4K0K J;  5IOL A;  2HQ3 A;  3ITH B;  5KFV A;  3P5B P;  1NJX A;  2XHC A;  2UZA A;  4KH0 B;  2YWF A;  4NLG A;  1VBX A;  1HWJ A;  2BV3 A;  4J9K A;  1FRH A;  3GG0 A;  4NLR A;  1JLF B;  3TUI C;  5A8W A;  2H54 B;  2MPU A;  1B7Y B;  5LL6 d;  2LA6 A;  4ECU A;  4CCH A;  4GRS A;  3CSK A;  1Z4U A;  3PKY A;  1NJI T;  3OPK A;  4FXV A;  4DSK A;  2VKR A;  4FYY B;  2F9J A;  1H0H B;  2GVD B;  4WII A;  3MTK A;  1ZA2 B;  4UT4 A;  1AZS B;  1RHR B;  1HYS A;  4OLP A;  4OV6 A;  2LKZ A;  1UVL A;  5E3C A;  5IXU A;  2KKH A;  4ECW A;  3BR8 A;  2DRD A;  3D3B J;  4EBD A;  3HP6 A;  4ZKA A;  5KTQ A;  5F3T A;  3CCS S;  5DQH A;  2IYG A;  1M5O C;  3CD7 A;  1Q8I A;  1HIY A;  3GYN A;  1S1V A;  2JEG A;  2CFX A;  1B4S A;  3MCS A;  1RWU A;  2DO4 A;  3GIL A;  1S59 A;  5KT4 A;  3N9U C;  4HI1 A;  3DNC A;  2H48 B;  2JEI A;  5HI7 A;  2A2C A;  3FQK A;  3E51 A;  1TV6 B;  1U1N A;  1RWX B;  1HPZ A;  5BJR A;  2HQG A;  1CJV A;  2CQ3 A;  1WF0 A;  2YKA A;  2QFJ A;  4J9M A;  4M5D B;  3HKZ D;  4WBF A;  5CYQ A;  1HNZ J;  1EIY B;  4XDD A;  3I31 A;  4ZPB A;  3W2V A;  1CJT A;  2R2S A;  3KLH B;  1HAR A;  4CLP A;  3UCG A;  4PG8 A;  4NML A;  3M4X A;  3NOC A;  4I6W A;  5DG8 A;  4IOC Q;  3SV4 A;  3LPY A;  3AA8 A;  2I6W A;  5LMU F;  3MPW A;  2YKO A;  4USU A;  4LFC F;  3KG0 A;  1T0T V;  4TU9 A;  3U1N A;  3PYG A;  4KV8 B;  1TTH B;  4V19 X;  4K4X A;  4ER8 A;  5D78 A;  1ZZN A;  1QSS A;  2J9D A;  1UFL A;  2DR8 A;  1UCN A;  2O1P A;  4HKQ A;  4IG0 B;  4JI4 F;  1UVJ A;  4DG1 A;  1KEK A;  5DQG A;  4CWB A;  1IVZ A;  2DRB A;  2VG6 B;  1H38 A;  3R7N B;  1S49 A;  2VUG A;  4KTQ A;  4YHH F;  5B0B A;  4ZHR B;  4DN9 A;  4AT1 B;  1X60 A;  3M2U A;  1H7W A;  2MY8 A;  3SYZ A;  3I32 A;  4OI6 A;  3CJ2 A;  1KHV A;  1VQ6 S;  3M2V A;  3QGG A;  4ED4 A;  2FLO A;  3IRW P;  5B0G A;  3HHD A;  2HHQ A;  4R0J A;  1F9F A;  3FUY A;  4K4W A;  3QJL A;  4P7T A;  3D54 A;  2HK2 A;  2B56 A;  2Y8Y A;  1SH2 A;  2YNG B;  4LF4 J;  1VHF A;  3W63 A;  1H7X A;  2IIH A;  2XWX A;  2ZC3 A;  4RUB A;  5KFC A;  3CCW A;  4PWU A;  4A47 A;  1JLQ B;  3EIC A;  1Z1Z A;  3ZZT A;  4X66 J;  2CPY A;  2JVR A;  1UA1 A;  3GCX P;  4RUA A;  1HBM A;  5FDL A;  2EK6 A;  4YFU A;  2R7O A;  2FLN A;  2P9E A;  3JTN A;  3ONQ A;  3CO9 A;  4X62 F;  5C42 B;  2UU9 F;  4Y65 A;  4PXD A;  4I68 A;  2MYF A;  3KKF A;  1FRM A;  4A48 A;  3MMA B;  2XI2 A;  5ETP A;  3HVW A;  3OXL A;  4U67 Q;  2KHC A;  2VON A;  3QMQ A;  3VZI A;  4PQA A;  4URS A;  3EM1 A;  4A8F A;  3Q8R B;  3CTR A;  1ZS6 A;  2OML A;  2VFV A;  2QZ8 A;  1RQ0 A;  4E2F B;  1VK3 A;  2JC0 A;  1WKJ A;  4CH0 S;  4R25 A;  3G96 A;  3GQC A;  1WHV A;  1T11 A;  3HJF A;  4P9S A;  1UVK A;  2HS0 A;  2AYE A;  1S10 A;  1ZTT A;  3NY0 A;  2DY1 A;  3ISN D;  3EE3 A;  4DI6 A;  1WEL A;  3I87 A;  2V2Z A;  2HRU A;  3G8Q A;  5LSO A;  3MDF A;  1U2R A;  4E8U A;  3K5O A;  3DKD A;  1DJ0 A;  2V8H A;  1RWP B;  4ECY A;  1T94 A;  3HD1 A;  4C2M A;  4N8N A;  1X5T A;  2FJX A;  1U1O A;  4ED1 A;  2HBQ B;  3HKW A;  4UZB A;  2IYI A;  2LU2 A;  1FD8 A;  2KYZ A;  2NUU G;  3EVO A;  4JI1 J;  2JZ5 A;  2XCP A;  1WD6 A;  4HL9 A;  3JB9 k;  2YNH B;  5K20 B;  4L74 A;  1Q86 T;  3SSQ A;  3RRG A;  4WWS A;  4GO5 X;  2EBG A;  4ED7 A;  3M6U A;  4ED0 A;  4G6V B;  4O3P A;  3AJD A;  1IBL F;  2BJ1 A;  1RU1 A;  3NLC A;  3TZY A;  1PC4 A;  1VHI A;  1UZH A;  3J7Z 5;  4NYZ A;  4USK A;  1AUD A;  2UP1 A;  3VAL A;  3B4M A;  3GIR A;  3KMQ A;  3W7B A;  1YJT A;  1TVR B;  4TYB A;  2VL1 A;  2LYV A;  5D0H A;  4FF1 A;  3IM8 A;  5KFR A;  1N6Q A;  3I5C A;  4O3S A;  2W2O P;  2IMO A;  3PEH A;  1T3N A;  4QW9 A;  4KKO A;  2ZBQ A;  4K4Y A;  1DFD A;  4N7T A;  2MMY A;  2CQH A;  3HHL B;  3CMA S;  4LF6 J;  2GIQ A;  1Q4R A;  4ZCK A;  4FYX B;  4ICL A;  4ZCL A;  5J2Q A;  1SC4 B;  1S6U A;  4K4Z A;  3MZI A;  2IC3 B;  3NOG A;  2G0C A;  3IA0 A;  2HZC A;  1P9Q C;  3TUP A;  4CO3 A;  4ZVG A;  1QY7 A;  4LFB J;  1YHQ S;  4DUY F;  2D3O R;  3PRV A;  4ED8 A;  3H20 A;  3CC4 S;  5EDW A;  4MFB A;  3POT A;  5CYM A;  3R7S B;  1HNV B;  4TU7 A;  1C4A A;  3DGP B;  4CYU B;  4OHW A;  1VQN S;  3QRR A;  1WTB A;  1N4L A;  2MJU A;  2QJ3 A;  3HHK A;  1SPB P;  1KVI A;  4DX5 A;  1R0B G;  5F0U A;  3ILI A;  1QJH A;  3OFH A;  2HBY B;  3QZ7 A;  3RGI A;  3TNV A;  2P8I A;  1EAY C;  2QRR A;  3UQS A;  1SL1 A;  2RT3 A;  2EFQ A;  4J9V A;  2Y8W A;  2OLW A;  2VQE J;  2DR5 A;  3O2I A;  3HDS A;  1WJ9 A;  3NWG A;  3CDB A;  2ACM A;  3VAK A;  3DCA A;  2B7B B;  2N7Y A;  3V81 B;  3QWP A;  3EWG A;  1U1K A;  2HNZ B;  2OGU A;  5KFY A;  4CH7 A;  4DV1 F;  2E1P A;  2H5J B;  3QGP A;  3AD7 C;  4QPT A;  5J2N B;  3KLG B;  3EXY A;  2IVM A;  1UFW A;  5IZH A;  1HQU A;  1RTI A;  5IV3 A;  2QG9 B;  1RTD B;  3FFI B;  4DPY A;  4LSL B;  4AL7 A;  2RU3 A;  5H1S V;  4DF4 A;  4F04 B;  4RNO A;  2MQO A;  2XZW A;  2QSF A;  1GTH A;  3MR3 A;  2RKI A;  2UUC F;  4OHV A;  2R7S A;  2QLF B;  1Q1K A;  3RAQ A;  3GSD A;  3KK2 A;  5DM7 Q;  1TL3 B;  3NGR A;  1U25 A;  2GML A;  3IMQ J;  2JLE A;  4DZ6 A;  3K58 A;  2DCU B;  3KLI A;  3BGF A;  1LFW A;  2HZA A;  3EZU A;  5GAH I;  2FVS A;  4UOH A;  4K59 A;  5G0R A;  3BH7 B;  4P52 A;  1YTY A;  1EP4 A;  1RYS A;  2CXE A;  1S6Q B;  3AJ1 A;  4TU8 A;  4OYO A;  1NJY A;  1ZAX A;  2GGP A;  1T9U A;  5HMZ A;  1NBE B;  2KFY A;  3NCQ A;  3UR0 A;  4DL2 A;  5HSP A;  3R5D A;  3S7R A;  5A6P A;  2AV5 A;  4LF5 J;  2VBZ A;  3IO1 A;  3V6D A;  5JMN A;  2VKZ G;  2RF2 B;  2RHQ B;  3TAM B;  1RDR A;  2LMI A;  4B3R J;  4GC6 A;  4DV3 F;  1K1S A;  2GQ2 A;  2OKQ A;  2C2R A;  1BD6 A;  2GVZ B;  3N79 A;  3I5B A;  4C3M A;  2NQP A;  4DR3 F;  3BQ2 A;  3PJ9 A;  3J7Z T;  5C2C A;  1C1C B;  4DR4 J;  1X5O A;  4NRU A;  2E5I A;  5KFL A;  4OYX A;  4KHP F;  4H4M A;  3GYG A;  1K0V A;  4DL7 A;  4DHV A;  4QIE A;  1HWI A;  1NJW A;  3MUT P;  3NEK A;  2GQC A;  3CJ3 A;  2XMJ A;  1NCL A;  3K0J A;  2W4P A;  3H2U B;  3VAH A;  1BUX A;  4DQI A;  3W62 A;  4F67 A;  5D15 A;  1ZPW X;  1WI8 A;  2X1B A;  5U47 A;  5JUM A;  2RS8 A;  1D9D A;  2A6M A;  5HBM A;  4JI0 F;  3PAC A;  3H2V E;  2JSX A;  4BS2 A;  3G4S S;  1S9G B;  1K1Q A;  3IG1 B;  8AT1 B;  4V19 J;  4UQT A;  4X4R A;  3OFG A;  2A1B A;  4UTG A;  4QU7 A;  3IWL A;  1FEH A;  4OZ5 A;  2HHS A;  2LVW A;  3SQO P;  4IG3 B;  2XYP B;  1V9O A;  4X4S A;  4ZN3 A;  4QWB A;  1QSY A;  2ZHO A;  4F4Z A;  3K17 A;  4DS5 A;  5HQL A;  1VQL S;  4HDH A;  2ASY A;  3NMR A;  4WP8 A;  1SUQ B;  2HYI B;  4CI0 B;  3QSY B;  3L9Z A;  2D9P A;  4X62 J;  2UU9 J;  5DGB A;  3O8W A;  4GKK J;  3HXM A;  2HVI A;  3A13 A;  1P8G A;  1RT3 B;  1S6O A;  5AJ3 J;  1N5Y B;  1J5O A;  1BQM A;  2JDJ A;  2Y1I A;  4YOE A;  2W9C A;  1I94 F;  1VOM A;  3TEH B;  3PDN A;  1XWL A;  4YB7 A;  2ZH7 A;  4OYZ A;  4OFZ A;  4LQ3 A;  2M70 A;  1TUW A;  5HLF B;  3KLF A;  5KFB A;  1PC5 A;  4DPT A;  3GJS B;  2QC3 A;  3UD4 P;  3CB4 A;  3M8Y A;  1KHW A;  2IM3 A;  2MLX A;  4U8V A;  3OFE A;  1G7C B;  2QA4 G;  2FVQ A;  1X4B A;  1SKR A;  1RT6 B;  5C25 B;  4WTO B;  2FHK A;  4CLU A;  2UUA F;  3OFF A;  1TKX A;  2E66 A;  3BDP A;  1XQI A;  3J80 U;  2VOP A;  2UVU A;  1UEV A;  1RT2 A;  2DY9 A;  2GJ2 A;  2DPJ A;  1TQL A;  3MEE B;  3AQO A;  5CHC B;  4HT7 A;  3M9O B;  4FKX A;  3TA1 A;  1S72 S;  2E7X A;  4DL6 A;  2O67 A;  2YH0 A;  2YKM A;  4WFZ A;  4J9O A;  4W92 B;  3J81 Y;  4FVC A;  2ASJ A;  1KFD A;  5IT9 U;  2ZZT A;  1KD1 T;  2DIU A;  1ARO P;  4KGK A;  4EI2 A;  4RNF A;  4ZCI A;  3M30 A;  1RT4 B;  1RTJ A;  3A3O B;  4P2F A;  2W7A A;  3GFH A;  1LK7 A;  4TN2 A;  2R3V A;  3QAT A;  1IM6 A;  4DPX A;  3MPD A;  4OI0 A;  4HYK A;  1VRT A;  2CWX A;  4P2X A;  4WU3 A;  1W25 A;  3DI6 B;  4CLK A;  4LF7 F;  2YPY A;  3W3S A;  4F36 A;  2AGO A;  4RZR A;  7FDR A;  1S1W A;  3LW5 C;  4ZPC A;  1S1U B;  4GC7 A;  1HR0 J;  2ADB A;  2HG4 A;  2DR7 A;  2YH1 A;  2L9N A;  3WX8 A;  1UP1 A;  2Q1L A;  2B3T B;  2J5A A;  4X64 F;  3EVM A;  1REG X;  4F0H A;  4O44 B;  3OSP A;  2MQL A;  5B0D A;  2NXE A;  2ZH1 A;  4F3M A;  3TX8 A;  3W5Z A;  1HLW A;  5F41 A;  3Q22 A;  4QJV A;  1Q79 A;  1FA0 A;  1JLC B;  1R8A A;  1NH8 A;  4K4S A;  3MMC A;  4DUT A;  4NLX A;  2V9K A;  1QVF R;  4CO1 A;  3GIM A;  1YSJ A;  3UN3 A;  2J7K A;  1VJQ A;  2GAG C;  2BAN A;  3MCO A;  3LAM A;  1A7G E;  1FTC A;  5LOQ A;  3L7P A;  4I2Q A;  1BE4 A;  1N56 A;  3W2W A;  2HFV A;  3GV5 B;  4I7F A;  4K4T A;  4EYI B;  4CLW A;  1N0V C;  4C8O A;  2V34 A;  2KG0 A;  2DR6 A;  3R1H A;  1XR7 A;  4G1P A;  3ZC4 A;  2YVS A;  3WX4 A;  1EQ0 A;  2XZT B;  4ECR A;  4A8S A;  2E9T A;  5AXM A;  4DJB A;  3LH2 S;  4NYO A;  2FZK B;  4DV1 J;  3TZW A;  2XHW A;  3LWL A;  2A0F B;  1YWX A;  2P5V A;  4EZ9 A;  4QOT A;  3QJJ A;  2V8P A;  1S9F A;  3QIP B;  4CIO A;  3TRG A;  4Y28 C;  2W24 A;  4TVA B;  1RHQ B;  3T19 A;  4QPX A;  1RLD A;  4NI2 B;  1JX4 A;  1R8C A;  2HLT A;  4LIW A;  1HBN B;  4ED5 A;  1KQF B;  1F9H A;  2QTW A;  1FFG B;  2K06 A;  3WZ0 A;  5HO4 A;  2Q3P A;  4K8R A;  4FYW B;  3AOD A;  3R5B A;  3M6V A;  1FDN A;  2QSW A;  1HBU B;  2GZO A;  1MMN A;  4PEO A;  3WDO A;  1FKP A;  2ZUA A;  4LF9 F;  3FCH A;  3K8V A;  1EHW A;  3GFY A;  2JRS A;  2ACY A;  4RNN A;  5GAH U;  3QRQ A;  2JNJ A;  4J9U E;  4KHM A;  4DLE A;  2HS3 A;  2K1R B;  1OIA A;  3VGU A;  4JBC A;  1UW4 A;  2D7S A;  4NAS A;  2MQN A;  2FGC A;  2ROP A;  4PUO A;  2MDA A;  4RNH A;  1RAF B;  2CQI A;  4B3M J;  3KUG A;  3QT6 A;  2FY8 A;  3G86 A;  3H5U A;  4TLR A;  3MR7 A;  1PAU B;  4DV3 J;  1F2H A;  3Q8Y A;  4H4O A;  2FY1 A;  4ID8 A;  4L3K A;  3SXL A;  4QCL A;  3VGT A;  2J8A A;  2P9G A;  3RTV A;  1RWM B;  2YWE A;  1XIQ A;  1X5P A;  2HHW A;  1E6Y A;  4CDI A;  3V4I A;  2ZVI A;  4NOH A;  2NSC A;  4Q5V A;  2PE8 A;  1U1P A;  3NNH A;  1RLC L;  4KHP J;  1LK5 A;  1MWY A;  4DU8 A;  2PEB A;  1UET A;  2IDL A;  4YME A;  2DHH A;  1RA7 A;  2ZHB A;  1BWE A;  3BRE A;  3NAH A;  5GAE I;  2VFR A;  5LMN J;  1U4B A;  1X4A A;  1FFS B;  1IKV A;  4RL1 A;  4NZ0 A;  3D1Q A;  4J9P A;  4ZJQ A;  4AE5 A;  4C3L A;  4EU0 A;  3BSA A;  2ATC B;  4FBT A;  4NLD A;  3RB6 A;  2AYM A;  2R2T A;  2IJN A;  4QWD A;  2J0Q D;  2ZH8 A;  5KOX A;  3J7Y U;  2KFN A;  4PCQ A;  4DL0 C;  1JB0 C;  1M90 T;  3MM6 B;  3KHG A;  2I8E A;  3R5C A;  2GC8 A;  3NGT A;  3MUV P;  4JI5 J;  2YX4 A;  3B4D A;  1XN9 A;  4YQW A;  1FKO B;  3JSM B;  1TKZ B;  1IKX B;  4CTA B;  4ECX A;  2U2F A;  3EMT A;  3ENQ A;  2QLW A;  2VG5 B;  1TL7 A;  2J6S A;  3OHB A;  3UDV A;  3ET6 A;  1ITP A;  1FK9 B;  1T02 A;  1KQG B;  3ZNU A;  2FB0 A;  2VPW B;  5KFU A;  2I0X A;  2OPR A;  3C14 A;  1JJH A;  3E2E A;  2M7S A;  4QIF A;  3QT5 A;  3R2D J;  1V5I B;  2R42 A;  2WSE C;  3LO3 A;  2GHV C;  2JJ4 D;  3FBB A;  1L3U A;  1WEY A;  1XMB A;  2C3Y A;  2LFV A;  3N6M A;  3BGR A;  1UW9 A;  2R7U A;  1JJ4 A;  2ZNY A;  4ZS6 A;  2KT5 A;  2PMW A;  2DH8 A;  5K14 B;  1TKT B;  3RR8 A;  1I94 J;  3V6H A;  3RB0 A;  4Q8F A;  3LA0 A;  4ZPW R;  1HWK A;  4HI2 A;  1F5C A;  2V9W A;  5LSR A;  1WSR A;  2B8P A;  2C42 A;  4B3O A;  2VFU A;  2V8D A;  4L76 A;  2D3O 1;  3MXH P;  3X3U A;  3C6T A;  2GW8 A;  2YKN A;  4RBT A;  5HJX A;  4K7Q A;  5DRK A;  1XEZ A;  2CQ4 A;  1Y5L B;  4AXI A;  3KXD A;  2F40 A;  3J81 j;  2WVC A;  2DHA A;  3RJM B;  1S77 D;  2K2P A;  4LBP A;  3P8B B;  4B3T F;  5CCM A;  5THW A;  4CM2 A;  2XLK A;  1YJU A;  4DX8 H;  1HNX F;  1P1T A;  2AZ3 A;  5KFS A;  3W5Y A;  5ITH A;  3GFX A;  2CZV C;  4HTJ A;  3G6E S;  2C3M A;  1BQX A;  2JVO A;  3Q8U A;  4F3Q A;  2KZZ A;  1NU4 A;  2HIQ A;  4OYM A;  5F8J A;  1M5S A;  5HP1 B;  3UNY A;  2B8Q A;  4ANC A;  2YNF A;  3L4B C;  2APO A;  1RTH A;  3M8P A;  4OZJ A;  4WF9 Q;  2BBE A;  2OUG A;  4OZ0 A;  3MEG B;  3DN9 A;  2KL8 A;  5HMW A;  4NLO A;  2B6A B;  2M8H A;  2J8S A;  5KFW A;  3JAM Y;  1H72 C;  4CQ1 A;  1UVN A;  1UL3 A;  2W01 A;  2R8J A;  4N76 A;  4LSN A;  2GHW A;  1KNZ A;  2Y1L B;  3KG4 A;  5IV4 A;  3BQ0 A;  1H3D A;  3FSY A;  4IDK A;  4C7Q A;  3BN4 A;  1XC9 A;  1D0E A;  4LRC A;  3ZTR A;  4A46 A;  4OHY A;  3HSZ A;  2VBY A;  3D9B A;  3M1V B;  1S9E B;  3PYE A;  1EQM A;  1T05 B;  4KPC A;  1U6B A;  3DOK A;  4F7V A;  1Y0H A;  1RAH B;  5KAK A;  2B0G A;  2C22 A;  1W26 A;  3DMJ B;  5IT0 A;  4X64 J;  5BYS A;  2FHM A;  4RBV A;  1T8E A;  5HK4 A;  3NMA A;  2WVD A;  3E01 B;  1NXI A;  3IGN A;  3FZ2 A;  3C16 A;  2CPI A;  1JLE A;  3GWC A;  3SIP B;  1FXD A;  3MED A;  3QT8 A;  2ZZN A;  2ZH6 A;  5EX3 A;  3MAA A;  2V8V A;  3IS9 A;  1R3N A;  3CCE S;  4NA2 A;  2B5J A;  4NWB A;  1M5V C;  2CA9 A;  4P71 A;  3MM8 A;  4JI6 F;  2J9E A;  3JQK A;  1ICE B;  1LV5 A;  3GV8 B;  1VC0 A;  1VQM S;  3MMB B;  3I0S A;  2AYG A;  5KG0 A;  3I5A A;  3PTW A;  1LW2 A;  4RW8 B;  2VG7 B;  3HVR A;  4UZC A;  1H73 A;  3L7U A;  3ZZ0 A;  4KR0 B;  1FTR A;  1WUU A;  2YX1 A;  2BXJ A;  4NEY A;  4OI3 A;  3CDW A;  2M9K A;  5J2M A;  2HAI A;  3UWT A;  4DFJ A;  3VAJ A;  4GVL A;  4LVO P;  3QAU A;  3PXG a;  3M8W A;  1HNI B;  4WP9 A;  5J2P B;  1SL0 A;  2QO3 A;  1L5U A;  3LP0 B;  1U2C A;  3MD3 A;  5F9L A;  1UWA A;  4DR1 F;  5HAT A;  2VBX A;  3HLU A;  4V1A k;  4B9V A;  3UDE A;  2CJX B;  1WF2 A;  1CJU B;  3BBF A;  2CQC A;  2W8L A;  1BQN A;  4F4K A;  1NH7 A;  5IS2 A;  3ICL A;  5KG7 A;  4DV0 F;  5MAO A;  4X4N A;  1T03 A;  2B43 A;  2E5L J;  5A0Y A;  1OQ6 A;  4QWE A;  2EI5 A;  2LXI A;  3BSO A;  2GA7 A;  2RUS A;  1VQ7 S;  1YX2 A;  2A3J A;  4UUX A;  3H7H B;  4GKJ J;  2WVB A;  5A8W B;  1JJ2 R;  2OJ3 A;  4B9S A;  4ITS A;  4Q2L A;  4OI1 A;  4IQX A;  3AFG A;  2VA2 A;  2DJW A;  3LAK A;  2JEJ A;  4WIQ A;  1M1H A;  2MSS A;  4NL5 A;  4WE1 A;  3NWR A;  3DM2 B;  1MW7 A;  1X9M A;  4X4Q A;  4XO0 A;  1HYS B;  1D9A A;  2NXU A;  2CQD A;  3THV A;  1GEH A;  2D69 A;  3M9N B;  3SI8 A;  1V3Z A;  1QTM A;  3O1L A;  2QL9 B;  4O23 A;  1B0T A;  7AT1 B;  2OPS A;  1KLM A;  1OSD A;  2IY5 B;  2BX6 A;  1S1V B;  1YGY A;  2OSQ A;  4F2S A;  4RX6 A;  1RAG B;  4C0B A;  5CYJ A;  4Q8E A;  1MN7 A;  3LPE A;  3FGV A;  2DBB A;  3PHE A;  5AXK A;  2WB4 A;  1LNQ A;  4TYA A;  4WZM A;  4RW6 A;  2ZBR A;  4FBU A;  2E5G A;  4IFV A;  1RKJ A;  5H9E K;  1UA0 A;  5FLX Y;  1HPZ B;  4DUZ F;  4EBC A;  2RE1 A;  4ILM A;  1S57 A;  1VR6 A;  2MZJ A;  5KG2 A;  3DC2 A;  2M4M A;  3D3C J;  2FD2 A;  3D1H A;  4ECQ A;  2ABY A;  2YNI A;  4CO5 A;  2KXN B;  3V2U C;  2BJ7 A;  2Y0B B;  4RW7 A;  2KZM A;  1NK4 A;  5GAE U;  3W2V B;  1CJT B;  1O6X A;  1MWZ A;  4DR6 F;  5D4N A;  2DT9 A;  2XO7 A;  2FJE B;  2HS4 A;  2R8G A;  3PJW A;  3G8S A;  2CNN B;  3PJX A;  3SFU A;  1XBW A;  3CCR S;  1R89 A;  4OX6 A;  2PII A;  3MWB A;  2QMW A;  1S76 D;  3CVK A;  4CO2 A;  2HHH F;  1CBK A;  2AX1 A;  2CPH A;  1U1Q A;  1UKU A;  2WBR A;  1G6B A;  2GHP A;  2FQQ B;  3UD3 P;  5T7L A;  3BO2 A;  4WZQ A;  1C0T A;  4USM A;  2JX2 A;  1SKS A;  3MEK A;  2F4V F;  3M2U B;  3TO8 A;  1KOO A;  3IBW A;  2VC1 A;  2DEJ A;  2GIR A;  3CNQ P;  4KB7 A;  3T1Y F;  1L3V A;  5DZ7 A;  5E3R A;  2NZ4 A;  3MCM A;  4ID5 A;  1GX6 A;  3OL9 A;  1NK7 A;  1NND A;  3K5N A;  2IM2 A;  4LJM A;  4F26 A;  1AZS A;  2CPE A;  3CJQ A;  2A10 A;  2VC0 A;  4AQY F;  5KT3 A;  2COL A;  1CC7 A;  5E41 A;  3OT9 A;  4IH7 A;  5HAN A;  4ANE A;  4ZJL A;  1KWM A;  2Q6B A;  5HVH A;  5KFN A;  2PO4 A;  1DAR A;  4ZN1 A;  3OTB A;  4DV6 F;  3H8Y A;  3EJM A;  2GMH A;  3DLG A;  2ZZM A;  5ETN A;  1IQT A;  3RR7 A;  3RW6 A;  2EEY A;  4TKT A;  1HBM B;  2X1G A;  2AU0 A;  4RW9 B;  2GS8 A;  3EGW B;  3BGL A;  3TR5 A;  2LDI A;  3NGS A;  3WC0 A;  2C2Z B;  5E0O A;  3L09 A;  2ROG A;  4M5G A;  2CPX A;  2QA1 A;  2KO1 A;  3O3L A;  2VA3 A;  2A6O A;  3MM9 A;  5CCL A;  1B0V A;  3QLH B;  1TL1 B;  3QAE A;  4M5D A;  4DEZ A;  2XQC A;  1ZH5 A;  1VQO S;  4RUC A;  2EFP A;  2EBE A;  3H0P A;  4FNH A;  2FZG B;  2M52 A;  1EZZ B;  2XMA A;  5EHH A;  1SB6 A;  4DSJ A;  2V2K A;  5I3U A;  5E5N A;  1N34 J;  4F3O A;  1X5S A;  1FJC A;  1UEK A;  4OZ3 A;  4HHH A;  4IG0 A;  3A3P B;  3EGN A;  2VG6 A;  3TJA A;  4ZP7 A;  4FN5 A;  1X4D A;  3Q83 A;  2NZC A;  4ZHR A;  3A8E A;  1RAE B;  4P2M A;  1YRT A;  2E7W A;  1FXL A;  2CJQ A;  1J27 A;  3HFV A;  3SZ2 A;  2E5J A;  4AD6 A;  3DLB A;  2BKO A;  1WOO A;  5A2Q U;  2VQF F;  3DLE A;  2J6U A;  2CIM A;  1VC6 A;  3UN5 A;  3KK3 A;  2YNG A;  3TZZ A;  1BC6 A;  1IBM F;  3KJQ B;  1AB8 A;  4UY8 T;  1GMU A;  1EKS A;  4ZLP A;  2UVV A;  3CT9 A;  2DNK A;  4PWD A;  1N6Q B;  2EG1 A;  3UNG C;  1PBA A;  4MTP A;  4PYD A;  4MKB A;  1Q7Y T;  2AIR B;  4KKO B;  2LDY A;  3Q2S C;  3AXK A;  4ZDN A;  4WKR A;  3BEG B;  2HGL A;  1Q8L A;  2CPJ A;  1YJN S;  3N5F A;  5M2P A;  2HHX A;  2ZNZ A;  3VQT A;  1VQ9 S;  1N32 F;  3U1L A;  4ZIT A;  3ILJ A;  2HWH A;  2MQ8 A;  3JXO A;  2HWI A;  2KRB A;  1SKW A;  5H9E J;  3PW5 A;  2NXC A;  4YR2 A;  3C66 A;  4LIR A;  1RAD B;  4NCG B;  3GON A;  1OY8 A;  3NAI A;  2F7V A;  3B82 A;  3HZG A;  3VAI A;  2WOM A;  4WFX A;  4R8U B;  2CKW A;  2V5H G;  2HHU A;  2F8E X;  5L9N A;  4MFB B;  3POT B;  4Q43 A;  4JI2 F;  4ECZ A;  1NM2 A;  3RBZ A;  3LGN A;  5CYM B;  3TOQ A;  2HRY A;  2UUB J;  2YTC A;  3FZB A;  1JK9 B;  3OXG A;  4EWT A;  3BYR A;  1VQ4 S;  1WC5 A;  4DV5 J;  2YNH A;  3EGZ A;  1DTQ B;  5ETO A;  1S1T A;  2ZIT A;  5DLF A;  2CQ2 A;  3I56 S;  1M5H A;  4HDG A;  1A6L A;  2KN4 A;  9RUB A;  4PWW A;  4P2S A;  3CME S;  4OZ2 A;  4O3O A;  3HVT B;  4L3N A;  1JMT A;  1U47 A;  2CYY A;  1B0P A;  2I38 A;  3MD1 A;  4C6A A;  3D28 A;  4N5S A;  2HBZ B;  3Q86 A;  1HQU B;  2HVH A;  4FYV B;  3QGI A;  3PX4 A;  1TR0 A;  3OTC A;  4CM0 A;  1MRO A;  3HSJ A;  3K59 A;  4M63 A;  3T5H A;  1NKB A;  1LW0 B;  2HQD A;  1Y3K A;  2DHG A;  2RKI B;  2C2O B;  1VBK A;  2OPQ B;  2V8G A;  3BPS P;  5LJ5 Y;  5D4P A;  2BJE A;  4DR2 F;  3G6Y A;  3DOM B;  3DLK A;  3W8P A;  1F9E B;  3ZTO A;  3KK2 B;  2OPP B;  3BBB A;  2AD9 A;  1CUL A;  4AL6 A;  3A8K A;  5FII A;  2V68 A;  5H9F J;  4TY8 A;  2Z58 B;  3DRP A;  3S6E A;  4EMD A;  1YJR A;  1SC6 A;  3HX9 A;  2XMW A;  4K5S A;  4EYH B;  1GQE A;  1NLK L;  2W4C A;  5K9F A;  4NCB A;  3KLI B;  2IBO A;  5G0R B;  2UXB F;  3N4W A;  1WOR A;  4QIV A;  1EP4 B;  4M5M A;  1FHT A;  1N33 F;  4ZP9 A;  2UXD J;  3RAX A;  2OIH A;  4JI3 F;  5BR8 F;  2GGP B;  2HNY A;  3G9C A;  3NCR A;  2FHO B;  4O4R A;  1IBK F;  3RAM A;  2R7V A;  2F8M A;  2AJ2 A;  2B9E A;  2GO9 A;  3PR4 A;  3V6D B;  2R7T A;  4ZK7 M;  2V69 A;  4DUZ J;  1HNV A;  4CYU A;  3FNN A;  3SQG A;  2OD6 A;  2CAD A;  4ILR A;  4WFA Q;  2H5E A;  4C8N A;  2NCK L;  4HHU A;  3H98 A;  1HI1 A;  2MKC A;  1TFW A;  3M9M B;  1Q81 T;  4RU2 A;  4CLY A;  3MEC B;  1Q53 A;  2V4Q A;  2ILZ A;  1VRQ C;  4DLG A;  2OFH X;  5AE3 A;  3HHN B;  1U09 A;  1SJ3 P;  5DZ6 A;  2QEX S;  1CSJ A;  2HNZ A;  3CJK A;  2AJ0 A;  2XMT A;  4KPY A;  2JH3 A;  3DRS A;  3DRX A;  3MAQ A;  4NZ6 A;  2ZOG A;  4LF8 J;  3HSG A;  3GV7 B;  2HHH J;  3G82 A;  1ZM2 A;  5A8R A;  1RTD A;  2YXL A;  3FFI A;  4IH6 A;  4LSL A;  2WCX A;  3JTO A;  3KDN A;  1HL6 A;  2J6T A;  1APS A;  5K8N A;  4ZVH A;  3KHL A;  1RYR A;  2HMI A;  4KGM A;  3SFG A;  2F4V J;  2E7V A;  1RAI B;  2XS2 A;  5HBM B;  2W7O A;  5KFK A;  1UMJ A;  1SC3 B;  2POK A;  2XG8 A;  3TQ1 A;  4I67 A;  3QFH A;  2IM1 A;  2BKN A;  4F4Y A;  3UR3 C;  2BJD A;  2B4V A;  1KTV A;  1H74 A;  2RJZ A;  3VGS A;  4AQY J;  1JLB A;  2GX8 A;  4A8Y A;  1RIS A;  2HLU A;  4HEA 9;  1FNM A;  2UVR A;  2DXF A;  2UVW A;  2ALZ A;  4F0K A;  2YQ1 A;  2B7C B;  3FRZ A;  4RLE A;  3NBP A;  2IVY A;  1S48 A;  2UXC J;  2F65 A;  3Q8V A;  1KDN A;  4W98 A;  1JXL A;  2WAQ D;  3W5X A;  2AF6 A;  2RF2 A;  4OHZ A;  5A6W A;  2BE9 B;  3TAM A;  4D3G A;  1SQF A;  2IA0 A;  1D8Z A;  3FJ2 A;  3CDU A;  4DFP A;  4KGX B;  2LQJ A;  2RIL A;  1J5O B;  2MZQ A;  4P74 A;  4LBI A;  2Q66 A;  2HAF A;  3VGV A;  5CH7 B;  2C2K B;  1QE1 A;  4IKA A;  2BM0 A;  5D4L A;  3SMZ A;  1HMV A;  3GIJ A;  4W4M A;  1ROF A;  1HQE A;  2NXJ A;  1C1C A;  1WG1 A;  4ZPA A;  1PJ6 A;  1M1K T;  3GIK A;  2ZM6 F;  3DHX A;  1R0C B;  2W9B A;  5ETQ A;  4DCJ B;  5I3Q A;  1Y5N B;  5D0E A;  5A8K A;  2PSZ A;  3N28 A;  4OX8 A;  3FSI A;  1K44 A;  3CUL A;  1SQG A;  5C24 A;  1TKX B;  4DCO B;  3U1M A;  3W9H A;  3PFE A;  4DX7 A;  1EKR A;  1LXN A;  3T5L A;  4FP9 A;  4L73 A;  3VF0 B;  2XYH B;  2EW9 A;  4FF3 A;  1LXJ A;  4LVN P;  1RT2 B;  1LWE A;  3IWN C;  2DXE A;  3GPA A;  1HI0 P;  1IWG A;  4G65 A;  4WK3 A;  4TY9 A;  4A4J A;  2VQF J;  2I5J A;  1FRI A;  4IFY B;  1NK8 A;  4QIW D;  1KON A;  2RQC A;  2XWY A;  4CLT A;  5BYR A;  4KBI A;  4X4O A;  3M30 B;  3OL7 A;  3CED A;  1R0A A;  1RTJ B;  1IBM J;  4K4U A;  1PYT A;  4WXO A;  3QT7 A;  2C3O A;  4Y2M A;  3QZ8 A;  1SL2 A;  5HRO A;  2E1A A;  3IXQ A;  2VAS A;  1IKY A;  1NK9 A;  1X7V A;  3OVA A;  5KG3 A;  3UDL A;  1VRT B;  1NDL A;  1NSQ A;  4NZ7 A;  2I9S A;  1WC3 A;  3G8T A;  3AOC A;  1RBA A;  1VJW A;  4TQS A;  1HBO A;  2XZD B;  2D1C A;  3CCL S;  1BGX T;  1S1W B;  2VOO A;  3OR2 B;  1AXQ A;  3VV2 B;  5L1L A;  1YJV A;  2W4D A;  3MGJ A;  4JV1 A;  1N88 A;  1HA1 A;  5T14 A;  1XK8 A;  3KHH A;  3PV8 A;  2BJ3 A;  3BR9 A;  2G4B A;  2IPO B;  1N32 J;  1OO0 B;  3M6X A;  3RBE A;  2P2C B;  1XNR F;  2IJF A;  4S0M A;  2CQ1 A;  2MLY A;  2FYX A;  4QBU A;  1IN0 A;  4USV A;  3MUR P;  2KDO A;  3EDQ B;  3BSC A;  2RIJ A;  1WG5 A;  2EFV A;  4DCP B;  1RGV A;  2EFG A;  4DQR A;  4QYZ K;  4FXD A;  3MMC B;  3SDE A;  2HEK A;  4NPO A;  4QIG A;  1RT6 A;  3MHY A;  3N6L A;  5B0F A;  3RBX A;  4J9R A;  3TAN A;  3AOB A;  2BKP A;  3JQJ A;  4QYR A;  5K8M A;  1S1X A;  2DO0 A;  1TP7 A;  5L39 A;  5EGY A;  1IR0 A;  1QAJ A;  2MZR A;  5LT5 A;  1M1G A;  3IAS 9;  4I2Q B;  1JNR B;  1FJ7 A;  4G3I A;  2G2Y A;  3L3C A;  1MU2 A;  4U6P A;  4PKD B;  4KE5 A;  4PG6 A;  3ZFV A;  1NPR A;  3NGD A;  1VQ5 S;  2MEW A;  4X65 F;  3Q0A A;  1TEL A;  2PA3 A;  1N36 F;  4FKY A;  4EZ6 A;  2W8K A;  2IMW P;  2OP5 A;  2NPF A;  4N47 A;  5B7W A;  2MJN A;  3C15 A;  1NDC A;  2W1B A;  2EC0 A;  2XMV A;  1OPI A;  2CJY B;  4YP3 A;  4DQS A;  1XMO J;  4FPI A;  1TAQ A;  1S0V A;  4C8Z A;  1H2U X;  3HHL D;  3D1O A;  4Y6I A;  1HNW F;  3BSN A;  1RP5 A;  1TUG B;  2OTJ S;  1ZA1 B;  2DNL A;  3KJV B;  5SZT A;  1Y9O A;  4YEA A;  2ZJQ Q;  4RBU A;  1HD1 A;  5JVG Q;  1KQS R;  1LKZ A;  1ZET A;  3ILL A;  1EX8 A;  5E2Q A;  1NHV A;  4FZV A;  1YVF A;  1V5V A;  4DR5 J;  1SJ1 A;  3VAF A;  2L9D A;  1FKP B;  4IQM A;  1L3S A;  4O44 A;  3IFE A;  1NSP A;  3MAH A;  4HH0 A;  2G13 A;  1Q0N A;  3TQE A;  1F1B B;  2UXB J;  4XIU A;  5DQI A;  1EAR A;  4KC5 A;  2MLZ A;  3RU0 A;  3RB3 A;  2E29 A;  2GIF A;  3D5M A;  1VBY A;  3DRY A;  2I2Y A;  1UZD A;  3UW1 A;  2DIT A;  2HND A;  4C3K A;  4DX6 A;  2XYG B;  4KT0 C;  5KFD A;  1U7L A;  4PUO B;  3JSB A;  1K9M T;  3CD0 A;  3ZTP A;  4HAC A;  3NNC A;  1UJ4 A;  1FWL A;  2KXH A;  3KMS A;  4X4T A;  4ES3 A;  1M5K C;  1Z2L A;  2V2Q A;  4H4O B;  2BQR A;  3CJ4 A;  2OHD A;  1SVD A;  2R8H A;  4GO7 X;  3TP2 A;  2KH9 A;  1UEU A;  3KLE A;  3H90 A;  1VBZ A;  1YK9 A;  5IQQ A;  4QU6 A;  1IJE B;  1FJG F;  3HPO A;  3ZO7 A;  1U1L A;  2ZOF A;  1E6Y B;  3V4I B;  1Y5I B;  2A18 A;  2FVC A;  3GB0 A;  3PX6 A;  2BVZ A;  1J2V A;  3PY8 A;  1SJF A;  2XGQ A;  4DV7 F;  3OTO F;  3E3X A;  3D0H E;  5DDQ C;  1LEO A;  3I6P A;  3RRH A;  2EKY A;  1X31 C;  1TMJ A;  3ENV A;  4NI2 A;  5CD4 H;  2X1F A;  4OI2 A;  2XY6 A;  2Z2L A;  1PYO B;  2IJR A;  5J1E A;  1RT1 B;  4G1I A;  2VDH A;  1OYE A;  1T7P A;  2C28 A;  5IC4 B;  2KHD A;  4P73 A;  1SXL A;  2L48 A;  4KO0 B;  3W8G A;  2CJ9 A;  2VV5 A;  4NA3 A;  4ZVT B;  3DYA B;  3WQP A;  3EYZ A;  1X4E A;  1TL7 B;  2H51 B;  3ET6 B;  3ENA A;  2H9Z A;  3EDR B;  3TUZ C;  2ZEJ A;  3IR6 B;  4DSE A;  4RWX A;  4Q45 A;  5I4M A;  4FF2 A;  3C14 B;  2XSJ A;  1DTT B;  2RSQ A;  2OI2 A;  4F0M A;  1FCA A;  1WKL A;  3BGO P;  3IM9 A;  4YB1 P;  5DG7 A;  1RSC A;  1GT8 A;  4DU7 A;  2Q6C A;  4C48 A;  3CXC R;  2HVZ A;  3BGR B;  1O51 A;  4RKU C;  3GII A;  4P75 A;  4U7U D;  4LMZ A;  3FMW A;  4MIW A;  4JV5 F;  2HWT A;  5DM6 Q;  3D4J A;  2AW0 A;  4MT1 A;  2Z4P A;  2AP6 A;  2RQ4 A;  3DOL A;  3CCJ S;  3CW2 C;  1Q78 A;  4QYZ J;  4AYB D;  1V3R A;  4QR2 A;  3MFH A;  2FHJ D;  3PW2 A;  1D09 B;  2JLF A;  4NLQ A;  1MMD A;  1NAQ A;  4YN3 B;  3ZZO A;  2AJ1 A;  4B3O B;  4ZLL A;  3RB4 A;  4DR7 F;  2HHV A;  2EXU A;  3T3F A;  2WZ1 A;  2OH2 A;  4C0O C;  5HMX A;  3CJR A;  2ZM6 J;  1HNZ F;  4ZA1 A;  2YKN B;  1KP6 A;  2DNG A;  1RK8 A;  4PXC A;  1UWB B;  3SCL E;  2F1F A;  4NA1 A;  3DXS X;  3QJP A;  1D1U A;  3TYT A;  3OUY A;  5EX0 A;  1PJ5 A;  3I9Z A;  5FJ4 A;  3J80 Y;  3NS5 A;  4QWA A;  2BE2 A;  3CJ8 A;  2M0G B;  1FNO A;  3ULH A;  4KY3 A;  3TA2 A;  5KFO A;  4FS2 A;  4M8L A;  2HRT A;  2Z56 B;  2R2R A;  2UV8 A;  5IT9 Y;  2ILY A;  5BYQ A;  3SCI E;  1FKO A;  4YY3 F;  1IKX A;  3NS6 A;  3CCV S;  1BMQ B;  2LQ5 A;  3HFZ B;  1FK9 A;  3D6H B;  2MST A;  1YJW S;  3ADA C;  4A8M P;  2MQP A;  1WC1 A;  1JKH B;  4PXB A;  4PG4 A;  4BDP A;  4LSN B;  2MKJ A;  4L72 B;  4HLB A;  4E98 A;  1UTA A;  3OLA A;  4IDK B;  1SCJ B;  4OI4 A;  5IM0 A;  2OFG X;  4IRC A;  1S4E A;  2XB2 D;  1PIL A;  1CVJ A;  2AKW B;  4AND A;  4RU9 A;  3BV8 A;  2FJA B;  3DOK B;  2Y1J A;  1DLO B;  1TZ0 A;  2MGZ B;  1TKT A;  3CC2 S;  5LMU J;  4ELT A;  4LFC J;  2P6S A;  3UI3 A;  4Y00 A;  3DFE A;  4WJB A;  1FRL A;  4XDC A;  5DDP C;  2AX0 A;  1XNQ F;  4CT9 A;  3KUH A;  2VBW A;  3BKT A;  2XSF A;  4KGZ B;  1BLU A;  1JLE B;  2FTR A;  2G0I A;  4KFB A;  3PIP Q;  4JI4 J;  2DPI A;  3K2Y A;  4J7C A;  4B17 A;  7FD1 A;  2Y0S D;  3ISN C;  4ZP8 A;  1DZ5 A;  5E3A A;  3IBC B;  1X0F A;  4EO8 A;  1YKW A;  4N41 A;  2X7I A;  3MAA B;  3IS9 B;  4OLO A;  4CLZ A;  2HW3 A;  2H4Y B;  4ZPV R;  1X9S A;  4YHH J;  4DFK A;  2R8I A;  2DNO A;  2ADC A;  4XPE A;  1NSK L;  3J7Y I;  1JQG A;  3NG8 A;  2CPZ A;  2B5J B;  4N77 A;  1GH8 A;  3R6L B;  2HZV A;  2DGW A;  4ZJO A;  5HQM A;  6FDR A;  3F44 A;  1X4H A;  3D6F B;  4NLT A;  2K7K A;  3SSS A;  4PPZ A;  2GJF A;  2MKH A;  1R8B A;  3FDS A;  1KVK A;  3PKM A;  1Q7L B;  5K8O A;  2MY7 A;  1DUR A;  3QPI A;  2BE7 D;  5C5J A;  2YX7 A;  2KRR A;  5L1K A;  4Q0B A;  1SIW B;  3MCN A;  2R7R A;  2RVJ A;  2D74 B;  5J2M B;  3A4T A;  4DSF A;  1PJ7 A;  1LWF A;  5LXR A;  1RT5 A;  3AH6 A;  5E33 A;  2C3P A;  2HPU A;  1UPM B;  4AUK A;  3ZTS A;  5E3P A;  2DGT A;  3LP1 A;  4JI1 F;  2ZVS A;  3B78 A;  2LXU A;  2C2D A;  4Y3C A;  1MN9 A;  2D41 A;  2R7X A;  1HNW J;  3EXC X;  1U48 A;  5D4O A;  2WON A;  3D6T B;  1BQN B;  4Q7A A;  2JFK A;  4R5P A;  3HZE A;  1YJ9 S;  5DGA A;  3N0V A;  3I96 A;  4YR3 A;  4NXM F;  5DDR C;  4UOF A;  5A0Y B;  2KJW A;  3KUE A;  3MR6 A;  1FNX H;  1RWW B;  4JV2 A;  1QLN A;  3IGV A;  1LOU A;  5L38 A;  2XY7 A;  4RPF A;  3PG9 A;  1N5V A;  4ZMM A;  1YRU A;  2CQB A;  1N5S A;  2AGP A;  2YKQ A;  3CCT A;  2FGO A;  2RDD A;  2QFI A;  2GAH C;  3CC7 S;  3CJS A;  1G1X A;  1PBU A;  4C98 A;  3OV7 A;  3GCW P;  5JJB A;  4NX9 A;  2PT0 A;  2XM3 A;  2ROE A;  2WVE A;  3Q2T C;  5K8P A;  2V50 A;  1EJ7 L;  1A9N B;  2MTL A;  4CNZ A;  2MKS A;  2VF3 A;  2OPS B;  1KLM B;  1Q5Y A;  4LBH A;  5CAA A;  2IAJ A;  3OSN A;  2BDP A;  1T95 A;  3WIV A;  2ZFH A;  2O5D A;  1HHQ A;  3FBE A;  3IRX B;  2NRE A;  5ETR A;  1RB0 A;  3KK1 A;  3I0R A;  2DGQ A;  3PW0 A;  1I3O B;  2EPI A;  4LFB F;  1PGZ A;  1A0O B;  1JXV A;  4MK8 A;  4USH A;  4KHR A;  4RJV A;  4RW6 B;  2KYX A;  2VG7 A;  3W66 A;  3PW7 A;  1IBL J;  3S1T A;  4I2P A;  4DDF A;  2M5Y A;  1RWN B;  1T9X A;  2MHN A;  1FJG J;  2WHO A;  5IFM A;  1YIJ S;  5DDO C;  3PYD A;  3SBM A;  3CMQ A;  3T6J A;  3WIU A;  4IRD A;  1H2V Z;  1CJK A;  2YNI B;  2X3D A;  2ASD A;  5J2P A;  4RW7 B;  1GFW B;  1SQE A;  3GZ7 A;  4DV7 J;  3OTO J;  2PA8 D;  4TXS A;  2WBM A;  4Y0F A;  5JVH Q;  4LFA F;  1IWA A;  2DEI A;  4A8X A;  2VQE F;  3PM9 A;  2G0J A;  4DSI A;  1IKW A;  3SV3 A;  2I1R A;  4F4A A;  4ZVS B;  2DNP A;  4MKV A;  1RT7 A;  5B0C A;  1MML A;  1RBO B;  3VVU A;  1JLA A;  4X4U A;  2RS2 A;  1C0U B;  5IC6 B;  2OEK A;  2BZ2 A;  1WEZ A;  4LR8 A;  4B08 A;  1KS2 A;  2CG8 A;  4N8O A;  4F02 A;  1OY9 A;  5GMK a;  2RRB A;  2F5G A;  2J0S D;  4M5J A;  1FDA A;  5T7L B;  4O0N A;  3A8I A;  1C0T B;  1VIO A;  1S4F A;  4PG7 A;  2MXY A;  4ZPD A;  5KFQ A;  1FEE A;  3TVZ A;  1KTQ A;  1K47 A;  4DUY J;  4ZOS A;  4ZVQ B;  5AE2 A;  2E9Z A;  1WHY A;  4MKY A;  4XK8 C;  1RTZ A;  1FI4 A;  3PNI A;  1FES A;  3MM5 B;  1R6Y A;  4ID5 B;  3DM2 A;  1CG2 A;  2AEF A;  3DRR A;  1WAC A;  3UN2 A;  4R0E A;  1REV A;  2W2Q P;  3CCQ S;  4I69 A;  4WFN Q;  3CD5 A;  1XMQ F;  1S97 A;  2C2N A;  2P9C A;  4YDX A;  4JV5 J;  3K8W A;  3N6N A;  1FRK A;  4MIB A;  2BMB A;  2QMX A;  3IN5 A;  3DLG B;  4OJH A;  4J9S A;  1H98 A;  3RUB L;  4LF5 F;  4J91 A;  3DHW C;  4PRF A;  1MNE A;  2PFF B;  3UVJ A;  3W61 A;  5J1P A;  5CD4 A;  1WHW A;  4B3R F;  3MM9 B;  3KG1 A;  4DR7 J;  2KFZ A;  2AJ4 A;  1K73 T;  5ETT A;  2DH7 A;  5A76 A;  1NDP A;  2ZBI A;  2CZ4 A;  2DGU A;  5GME A;  5IT4 A;  4CO0 A;  2UUC J;  5FD1 A;  3BDE A;  1IJF B;  1OMS A;  1OQ3 A;  1WKK A;  2PC6 A;  1G4C A;  1FWK A;  4A8W A;  4DR4 F;  3D68 A;  1S7H A;  4ZCM A;  5I3U B;  3T6B A;  2IHR 1;  2MKY A;  3HD2 A;  4ETX A;  1LWX A;  2SXL A;  1QDU B;  2X51 A;  5DET A;  1CEZ A;  2DTJ A;  3M8Q A;  1SV5 A;  2EK1 A;  2JC1 A;  4FXW A;  5E7O B;  1YG0 A;  5HQ8 A;  8RUC A;  3CE8 A;  9ATC B;  4Y2I A;  4YY3 J;  3ILO A;  2B4P A;  4WP3 A;  3D7S B;  2LQ9 A;  1RWK B;  4GMK A;  2FVR A;  1KRP A;  3PFO A;  4IH5 A;  1FDB A;  1RU2 A;  3NGK A;  2XMU A;  2W2N P;  3RBD A;  1EB0 A;  3CO0 P;  2DGO A;  2LU1 A;  3EVW A;  1ACM B;  3OR1 B;  4J37 A;  4BLG A;  1BY9 A;  4J9Q A;  3DLH A;  1DAX A;  4G1Q A;  3DLE B;  2RQK A;  4Z37 A;  3KK3 B;  3M32 B;  4OJG A;  4NLS A;  4M94 A;  1TK5 A;  4MK9 A;  1KQK A;  2VU5 A;  5ETL A;  1JLG B;  3M7V A;  4DR3 J;  5KG4 A;  4C4W A;  1RA6 A;  1AFI A;  4PAA A;  4DBQ A;  3QO9 A;  2J7U A;  2XC9 A;  5HVF A;  4NXN F;  2IBK A;  2Z8Q A;  4TQR A;  4PWD B;  2AWZ A;  4TLQ A;  4RW9 A;  1XNQ J;  3WBZ A;  3BYP A;  5DS7 A;  4XAK A;  2XGP A;  1OSC A;  4GKK F;  4DQQ A;  3ISZ A;  5CQG A;  2WW4 A;  4YUD A;  5AJ3 F;  2ZD1 A;  3QLH A;  1HQ2 A;  1FE4 A;  1TL1 A;  2FVP A;  1EET B;  4EBE A;  3HUL A;  3TJ8 A;  5JXS A;  1UAW A;  1WG4 A;  3GR0 A;  4A8Q A;  1WOP A;  2E5H A;  3MF5 A;  2VHG A;  4JI0 J;  1Q95 G;  5LSL A;  4Z2X A;  4H54 A;  2Z2Z A;  3CJ5 A;  2O3D A;  3BKU A;  4BWJ A;  3OTE A;  4JB8 B;  1VGY A;  3IWX A;  3QID A;  1U2F A;  2WOM B;  3LOU A;  1D8Y A;  3CUN A;  1RHJ B;  4PPD A;  2L9W A;  3R5J B;  1NPK A;  2XEX A;  3FKB A;  4XTT A;  2ZHA A;  2V4R A;  4H4K A;  5L8R C;  2QIF A;  4YR0 A;  4RW4 B;  1U0H A;  5B0A A;  5GAG U;  5KFF A;  2HVE A;  3K5M A;  4O3N A;  5I42 A;  2EFN A;  3RW7 A;  2BM1 A;  3TAQ A;  4UST A;  4DN0 A;  5B09 A;  2DVI A;  4M1K A;  4P72 A;  1QVG R;  1ZOT A;  2H65 B;  2D9O A;  3MPY A;  3OVB A;  1LWC B;  3BB5 A;  3H42 A;  1S1T B;  3BO3 A;  5I3P A;  1HD0 A;  3NXZ A;  4DF8 A;  3KFW X;  4HT5 A;  1NEE A;  1FRX A;  4KIA A;  5MLC V;  4NXM J;  3I55 S;  1NRK A;  1U0S A;  2ZH4 A;  1MRO B;  3JS9 A;  2RHS B;  3MM7 B;  4OQJ A;  1FWP A;  1P27 B;  1S7I A;  5KFJ A;  5G4D A;  1S0N A;  3CWJ A;  1F3F A;  2CJK A;  4ED2 A;  4JI8 F;  3HK2 A;  3DLK B;  4ZLJ A;  3SCJ E;  1QD1 A;  3CCU S;  1ZM9 A;  3IR7 B;  1HR0 F;  1KOH A;  2RQM A;  2F4F A;  3NS7 B;  2UUA J;  1PSD A;  1CUL B;  1C1B A;  4U95 A;  1T9T A;  2MQM A;  1RBL A;  3GJR B;  2N7C A;  2UUW A;  1YI2 S;  4J5O A;  4TY8 B;  3DRP B;  4EO6 A;  1U24 A;  3AT1 B;  3VQS A;  2J9D E;  2FJB B;  2CAJ A;  1V3S A;  2CQ0 A;  4E0D A;  2N3L A;  2PMH A;  3MFI A;  3CGI A;  3ZZY A;  3I82 A;  3AY0 A;  1NPP A;  3DDK A;  1ELO A;  4O4G B;  2W2P P;  4NCG A;  5KT5 A;  4ALZ A;  2HNY B;  4F25 A;  3B54 A;  1MSW D;  3C6U A;  2HQI A;  2ERR A;  4WTY A;  5IWA F;  3HMJ G;  4DMZ A;  4WKY A;  2RRA A;  4OX7 A;  1C2P A;  2QX0 A;  4R8U A;  5L9X A;  4PAB A;  4IOA Q;  2YY3 A;  1IBC B;  2YWW A;  3AOA A;  3BBC A;  1VMB A;  3H5X A;  4OYB A;  2W9A A;  3SQG B;  4LRD A;  1CS4 A;  3P5T L;  2R7Q A;  3C46 A;  3DDI A;  5EWE A;  1YIT S;  2LEB A;  3LWM A;  1R8P A;  1FE0 A;  4EEY A;  4LRF A;  4KQZ A;  6AT1 B;  4X2B A;  4LF7 J;  4OYW A;  1NKE A;  3BKF A;  3OTD A;  4LFA J;  1DTQ A;  1FVS A;  1NJZ A;  4XPC A;  1GX5 A;  1N0U A;  3HVT A;  3CJK B;  2ZE2 A;  1WSV A;  2NLW A;  1S5Z A;  3DRS B;  1ZBT A;  3Q8Q B;  3G87 A;  4NLU A;  1RXO B;  2QA2 A;  3G82 B;  1KSP A;  2DHX A;  5A8R B;  2KM8 C;  3W64 A;  4PQU A;  4M5H A;  4WFY A;  1LW0 A;  3PZP A;  2V4J A;  2HMI B;  1VRU A;  3OVS A;  4LRB A;  4DXL A;  1ULR A;  2OPQ A;  2HSE B;  2VJV A;  2CZ9 A;  3AD9 C;  5KT6 A;  3DOM A;  1QM9 A;  2WRM A;  4C11 A;  2HGN A;  5HN0 A;  2OPP A;  1NHK L;  2GJI A;  2ZH2 A;  1WHX A;  2B9X A;  1S0O A;  1OWX A;  3AB4 B;  2B4U A;  2HGM A;  4IO1 A;  8ATC B;  3ZNJ 1;  1JLB B;  5ETS A;  2IRY A;  5AE1 A;  3R2C J;  1XMQ J;  4X4V A;  2ZDP A;  5D3G B;  1R27 B;  1SJR A;  1ZM4 A;  3NBP B;  4Y2C A;  3M2R A;  4CT8 A;  1U02 A;  2VFT A;  1FVQ A;  4NEZ A;  4I0W A;  4GVB A;  3F41 A;  4ED6 A;  1QUV A;  1CC8 A;  4O3Q A;  2LLZ A;  5KG5 A;  4B3M F;  2YKP A;  3LTO A;  3GP9 A;  3H5S A;  5EWG A;  5M2U A;  3KTQ A;  2ZWO A;  1U1R A;  2F8H A;  1AFJ A;  1S99 A;  5KFM A;  3C8Y A;  5T41 A;  3BQ1 A;  1QE1 B;  3MEC A;  1NSA A;  3FBC A;  1HMV B;  4DSL A;  3R3T A;  1HQE B;  2H3E B;  1V6H A;  1HW8 A;  3UFC X;  1RWV B;  3G2X A;  2N4C A;  1IM4 A;  5F8I A;  1NKC A;  1LQ9 A;  1U8W A;  3MR2 A;  4ECT A;  3BN7 A;  3MTJ A;  2W9B B;  4LF9 J;  3JYT A;  1VIS A;  2E44 A;  5LMN F;  3QQC D;  5A8K B;  4OYP A;  3VR1 A;  1SJQ A;  1E6V A;  3LAL A;  3KLV A;  2DNM A;  4A8K A;  5C24 B;  1I1G A;  2ZJR Q;  2CRL A;  3HHE A;  3M8Z A;  1WC6 A;  3LP2 A;  1M0S A;  1Y11 A;  1L3T A;  2QT7 A;  1LWE B;  3GR1 A;  4PYA A;  5HVG A;  1Y4Z B;  5A2Q Y;  4WYW A;  2OTL S;  2OEL A;  4NLV A;  6FD1 A;  4WU2 A;  4JI5 F;  4PG5 A;  4Q2M A;  1UVM A;  4IO9 Q;  2I5J B;  2M8D B;  4X84 A;  3CCM S;  2DB1 A;  5BXI A;  2GNK A;  3SCK E;  3K57 A;  1R0A B;  1DBD A;  1ZAV A;  3A1Y G;  3KJF B;  4NYP A;  3R7B B;  4OMF G;  3ZXW A;  3THT A;  4UY8 5;  3R5A A;  3ENW A;  2DRA A;  5HRO B;  1CJV B;  1IKY B;  3T41 A;  4W90 B;  1T3O A;  5L1I A;  4NXN J;  4QWC A;  4ZVO B;  3QGH A;  3ZZU A;  2B4O A;  1DQA A;  3C19 A;  3QRP A;  3H59 A;  1S6P A;  4RO0 A;  5CYQ B;  1NK5 A;  2HFS A;  1HBO B;  2XO6 A;  3DXB A;  1MLA A;  2P6T A;  2J9C A;  1SKU B;  2LCW A;  4U7U K;  2E9R X;  2NUH A;  3CIM A;  4K50 A;  3VWS A;  3AQP A;  2QLJ B;  1H6K X;  5EWF A;  3I4P A;  2JHE A;  3CF5 Q;  1XTZ A;  3IR5 B;  4CO4 A;  5KG1 A;  3AJ2 A;  3TEG A;  3T1H F;  2QLX A;  4ELU A;  3PIO Q;  1KBR A;  2W2M P;  1I5O B;  5KFI A;  3PYF A;  3CD6 S;  2QE5 A;  3GJT B;  2UUT A;  3ITH A;  3BGU A;  4L6V 3;  4DG1 B;  4OX9 F;  2ZDO A;  1KFS A;  2FJD B;  1QUP A;  5KFA A;  4HH1 A;  1NO8 A;  2X1A A;  3Q24 A;  1JLF A;  4I56 A;  4A8O A;  3SDE B;  5KT2 A;  1YDL A;  1ZTW A;  3FMB A;  2OAU A;  2R9L A;  4QW8 A;  5F0W A;  2AEM A;  1S1X B;  1UJ6 A;  4QR1 A;  5HL7 Q;  4TNO A;  3R5G A;  3M2V B;  2GVD A;  2ZH9 A;  2HQC A;  3Q23 A;  1FD2 A;  2PI4 A;  2D3Z A;  1HW9 A;  2XMK A;  2VD3 A;  1MU2 B;  3G6X A;  3HM9 A;  4U96 A;  4OYA A;  2EG2 A;  3S01 A;  1P6T A;  4IFY A;  2GMJ A;  3VHQ A;  4MK7 A;  3C15 B;  3FSX A;  1PYS B;  2JOQ A;  5H9F K;  4ZLN A;  5FDL B;  4C8Y A;  1AYE A;  2E1M C;  1TV6 A;  1N52 B;  4AXJ A;  3TAP A;  5CZV A;  4MYT A;  4CRJ A;  2XBP A;  3ZZR A;  4ED3 A;  3PVX A;  3FCV A;  1PIE A;  3GE9 A;  2QN6 B;  3SEO A;  1B99 A;  1WI6 A;  2NYI A;  3FEY B;  3K5L A;  4LRE A;  3KLH A;  4JI8 J;  1TFY A;  3OR2 A;  4WPA A;  3W65 A;  3HCX A;  2CWK A;  4ENO A;  4B3T J;  2G1D A;  2B51 A;  3V6J A;  4ZVU B;  2HBR B;  1B64 A;  2NXN A;  4KV8 A;  3FVY A;  3GMG A;  4C97 A;  1XJW B;  4KAI A;  3MPU B;  1RAC B;  1HNX J;  4B9U A;  4UOG A;  1G3O A;  1RAA B;  1OY6 A;  4I6A A;  5IWA J;  2IVF B;  2HND B;  2O01 C;  1HWU A;  3BS9 A;  3TZX A;  5RUB A;  4HAC B;  3NKY A;  1BXN A;  5EUH A;  1YBA A;  1GMW A;  1FER A;  1F3V A;  1FXR A;  4FYD A;  3PR5 B;  4LR9 A;  3QWU A;  1HKA A;  1W2I A;  3F56 A;  2ZKU A;  3H4B A;  5F3Z A;  4DV2 F;  4ILL A;  1D3W A;  2LQ8 A;  1F5A A;  3KLE B;  2ATL A;  3R27 A;  3B8H A;  1JLQ A;  4MAK A;  3GFZ A;  2ZBC A;  5KFP A;  1SJ4 P;  2HUR A;  3OBI A;  4QZV B;  4RNM A;  5KFG A;  2DK2 A;  5C42 A;  1PKU A;  2G9O A;  4MH8 A;  3MMA A;  2IA6 A;  5KFZ A;  4KJI A;  3BO4 A;  5J1E B;  3TWZ A;  1R43 A;  3KJV A;  3LGM A;  4F2R A;  3W1Y C;  3HFK A;  5J1N A;  2HHP A;  4ICL B;  4UF4 A;  2BEF A;  2E5L F;  4AFF A;  5J2Q B;  3OQ2 A;  3F73 A;  2DYA A;  4I1T A;  4JI6 J;  3HSD A;  2AJQ A;  3HO1 A;  3FCW A;  4YB5 A;  1WC4 A;  4GKJ F;  4ZVF A;  4IR1 A;  3IC1 A;  5DG9 A;  3OJS A;  4M95 A;  2VPY B;  3UPF A;  2E1R A;  1GTE A;  3WC2 A;  4B9L A;  2XSJ B;  2EFO A;  1R31 A;  4KH1 B;  2CQG A;  2FPH X;  3JTP A;  3MR5 A;  1TK8 A;  1K8A T;  3D0I E;  2FC9 A;  2C1E B;  1X9W A;  3HJV A;  1S12 A;  3MMJ A;  2CNK B;  2JLG A;  3AXM A;  2DHS A;  1J5E F;  1GXU A;  4WK1 A;  5ADZ A;  2BW7 A;  4DR1 J;  4OL8 A;  1MG7 A;  2W25 A;  2Q43 A;  2Y3Y A;  1URN A;  1VQK S;  4C9D A;  1N54 B;  3GU0 A;  3IBF B;  4PR6 A;  3DOL B;  1TMM A;  3R6G B;  4NLW A;  3U02 A;  1RAB B;  2KVQ E;  2DGS A;  3J81 U;  2RB7 A;  1VQ8 S;  2HFZ A;  3H5Y A;  4DV0 J;  2XMM A;  2K3K A;  1UVI A;  2BOP A;  3NP5 A;  2LXF A;  4K4V A;  4B9N A;  2AYB A;  1RTI B;  4H4K C;  1SI9 A;  2A2D A;  3VCD A;  1M5P C;  1T9V A;  5EN1 A;  2XLI A;  4B3S F;  2GFF A;  1TVR A;  3LUY A;  4URQ U;  1RHU B;  1VYA A;  5K5M A;  1YLX A;  3L7O A;  1NUE A;  1YZ7 A;  3PRD A;  2BYC A;  3OUY B;  1X4G A;  2WSC C;  4DOZ A;  4P10 A;  3G71 S;  3HHL A;  2K8G A;  2BE2 B;  3CDE A;  1RT1 A;  3P6Y C;  2DCL A;  2J76 E;  2CDR B;  1NHU A;  3VAM A;  2RDI A;  3CDA A;  2Y1R I;  4QQB A;  3RZA A;  2WTF A;  3CIZ A;  4KO0 A;  1R7I A;  2R8K A;  3DYA A;  2IC3 A;  1RCX B;  1AT1 B;  2BUN A;  1WEX A;  5CZX A;  1TU0 B;  4J90 A;  3ELH A;  4O0I A;  2IM0 A;  3K5P A;  2KM8 B;  3VVT A;  4Y34 A;  1DTT A;  1NB7 A;  1WNE A;  3DGP A;  2DGX A;  2FUG 9;  5IQ6 A;  1FJE B;  4KYZ A;  3KNA A;  3ZZP A;  5IM0 B;  1NZA A;  2YPZ A;  2FC8 A;  3EX7 B;  3NGU A;  1RHK B;  2WW8 A;  5HAO A;  4DR6 J;  5HJY A;  4HVZ A;  2Y9H A;  1CQM A;  1QSL A;  2DNZ A;  2MHE A;  3O44 A;  3VAG A;  2V94 A;  4FF4 A;  4NRT A;  4ES2 A;  1NB2 A;  1VK8 A;  4H4M B;  3V81 A;  4ZPT R;  3T1H J;  3TVY A;  1HWL A;  1W7W A;  2DR9 A;  4Y2A A;  2DGV A;  1QAX A;  3KLG A;  5J2N A;  4FS1 A;  3PO5 A;  4B9T A;  3D67 A;  4KFB B;  4YDD B;  4OX9 J;  3B6B A;  4OYI A;  1WDD A;  3PO4 A;  2ZH5 A;  1RCO B;  2V63 A;  2PFD A;  3US5 A;  4AL5 A;  2CUY A;  3W9J A;  1UWB A;  2LEA A;  5KT7 A;  4RWW A;  1ZYQ A;  1Z2Z A;  2M88 A;  3T1Y J;  1HFE L;  1TL3 A;  1N34 F;  1JJC B;  4C8M A;  3NCP A;  2XLJ A;  1IR2 A;  3A12 A;  3BPD A;  3HVA A;  1DY3 A;  2WB1 D;  4ETZ A;  5KFE A;  4IRK A;  3JQM A;  2VPX B;  1ZZF A;  2RAQ A;  4USI A;  2YWG A;  4QR0 A;  1FFW B;  1F6T A;  4UW2 A;  1S6Q A;  4Q0B B;  3DU6 A;  4PZV A;  1X4F A;  4ECS A;  1K0T A;  3OW2 R;  3OL8 A;  1U6F A;  4DV6 J;  3FC9 A;  1LWF B;  3N5B A;  3GTY X;  3VZH A;  4F4X A;  1RT5 B;  3I9V 9;  4ATN A;  1I6J A;  1X4C A;  4CH1 A;  1JKH A;  4M5N A;  4Z7Y A;  2KT3 A;  4OZL A;  3LP1 B;  4K2X A;  1Y10 A;  3KYL A;  2MKI A;  2KVI A;  2U1A A;  2IDE A;  1FO1 A;  3MI7 X;  2XTJ P;  3M05 A;  3FK4 A;  1VQS A;  2WON B;  2VIH A;  1BQM B;  3BH6 B;  2BRK A;  2W9C B;  4R5P B;  5E3Q A;  2VPZ B;  2GVZ A;  2OO4 A;  4ZVR B;  2G2Z A;  3AAW B;  2XNR A;  5B08 A;  1DLO A;  2MGZ A;  3KLF B;  2NR0 A;  1T9W A;  2F63 A;  2ZC4 A;  1PAE X;  2LP4 A;  3GYX B;  1O5J A;  3D66 A;  3U27 A;  4MYU A;  5HMY A;  1QAY A;  2KU7 A;  1P9Y A;  1KLN A;  4KSE B;  2N3O A;  1KR4 A;  2FHJ A;  1GMW D;  2VIC A;  1YBU A;  4U9R A;  2BW2 A;  2BAB A;  3DU5 A;  3R1L A;  3V5R A;  2KG1 A;  3QNW B;  1RE1 B;  3RYL A;  3E8O A;  1VDH A;  3Q8P B;  5F8G A;  2MZS A;  4JOU A;  4OJ3 A;  3KHR A;  1IQZ A;  2BJ9 A;  5D6G A;  2LQB A;  2K7J A;  3DLL Q;  2GO8 A;  3EPG A;  2IAJ B;  2RU9 A;  1S9G A;  1TK0 A;  3IG1 A;  2YKM B;  1OJ4 A;  4M5I A;  1GAO A;  3KK1 B;  2ZWP A;  2PDA A;  3I0R B;  4RR5 A;  3L95 X;  3P45 B;  4WYL A;  2KTQ A;  5D8H B;  1Q82 T;  3H4D A;  3H25 A;  2Z0G A;  3WHI A;  4DV2 J;  4J9N A;  2CNL B;  4I2P B;  2RML A;  4IG3 A;  3CJT A;  2O66 A;  4DPW A;  4BC9 A;  3D6M B;  2BAC A;  2UUB F;  3AA9 A;  2DNH A;  3P49 B;  2RD5 C;  4F8R A;  1CJK B;  3H40 A;  1SUQ A;  5DLG A;  4DV5 F;  3UDC A;  3KDO A;  1H2T Z;  2JFD A;  2QV6 A;  3JSY A;  4NLP A;  3PRB A;  3IAM 9;  4USJ C;  1RT3 A;  4DZD A;  1HHT P;  1FX4 A;  4YB6 A;  3M6W A;  1IKW B;  1HI8 A;  1N5Y A;  2DIV A;  2ZBP A;  1RT7 B;  1WOS A;  1GMV A;  1YZ6 A;  2XUL A;  1JLA B;  5KOW A;  3TA0 A;  3J7A N;  3PX0 A;  4JV0 A;  1I51 B;  4UUW A;  3MOJ B;  1UJ5 A;  2B9W A;  2HFN A;  1NK6 A;  5HLF A;  2V0N A;  3V6K A;  4JUZ A;  4MMO A;  4DPU A;  3P96 A;  2F9D A;  3HT0 A;  1SIZ A;  2OEJ A;  2DNN A;  2G2O A;  2NS1 B;  5C25 A;  1O8B A;  1F60 B;  4JI2 J;  4YS2 A;  3EUN A;  4JI7 F;  3T5J A;  2BAN B;  2DH9 A;  5B0E A;  2VB6 A;  3DRR B;  4LRA A;  5AXL A;  4EK2 A;  1CQN A;  1S79 A;  5F9N A;  5GAD I;  2W7P A;  4LQ9 A;  3W2W B;  1UPP A;  1REV B;  4I7F B;  2VZ9 A;  1Q5V A;  2ZOM A;  3MEE A;  1IXK A;  4L75 A;  1J5E J;  3F0N A;  2UXD F;  1NME B;  2RUG A;  3IRX A;  2M3D A;  3P3D A;  2CVE A;  2OSR A;  4IR9 A;  3ZTQ A;  2ZH3 A;  4HHJ A;  3SSR A;  2CPF A;  3OD2 A;  2EVZ A;  5DJB A;  1RT4 A;  1Q8B A;  2XCA A;  3PHT A;  1C4C A;  4URG A;  3UVJ B;  4ERD A;  4UQG A;  1RI7 A;  1XR6 A;  2MB0 B;  4BWM A;  3R8Y A;  3JAM U;  1JWW A;  4B3S J;  3QSI A;  1TUV A;  1GXT A;  2NSB A;  1W2B R;  1RHM B;  1WTF A;  1U1M A;  3DI6 A;  4JYA F;  2XNQ A;  5CXT A;  1WDT A;  2BR0 A;  1N48 A;  1BHN A;  1SC1 B;  4LUB A;  4DR2 J;  3UD5 A;  2HIY A;  1S1U A;  1N5Q A;  1F0X A;  5F8H A;  2OD4 A;  2RNE A;  2ZUG A;  1RZM A;  1U8S A;  4DFM A;  4FNI A;  2NYH A;  3EZO A;  1C0U A;  3M8Q B;  4LF8 F;  1SV5 B;  2PMZ D;  2PGC A;  3ZZZ A;  4CP5 A;  4PXE A;  2DIS A;  3IP0 A;  5KFH A;  1N33 J;  3GSI A;  2YQ0 A;  4K5R A;  4JI3 J;  3KJN B;  3UE2 A;  5BR8 J;  2KJV A;  1JLC A;  4DV4 F;  1IBK J;  2JL9 A;  2N4D A;  1CLF A;  1SBR A;  2CJA A;  3UO0 A;  2C2M B;  4CLF A;  4OV1 A;  3D2W A;  3MM5 A;  2HVD A;  2B9Y A;  3EPI A;  2WK4 A;  3M8R A;  2IRU A;  1P1L A;  4B02 A;  4G1Q B;  1VC5 A;  1G2E A;  3K89 A;  4C8L A;  1BWV A;  3OHA A;  3UCZ P;  2DNR A;  2UV8 G;  2BOA A;  4ELV A;  2V2V A;  4NMX A;  2AZ1 A;  3H2L A;  4Y2K A;  3G6V A;  2FJV A;  5GVQ A;  2JEF A;  3FQL A;  2QGF B;  2BQU A;  1PG5 B;  1ZM3 A;  2UXC F;  3QO9 B;  1TL4 A;  4F50 A;  4B9M A;  4MKA A;  1B70 B;  5C7P A;  4ZVE A;  4OJ1 A;  3R97 A;  2ALY B;  1VLO A;  1JIH A;  3O5T B;  5LXY A;  5AXN A;  2Z30 B;  1X8D A;  5ETV A;  3QIP A;  3RRK A;  5KFT A;  1IKV B;  2DNQ A;  1WWH A;  1IR1 A;  2E1C A;  3NNA A;  2ZD1 B;  1RUS A;  2VDI A;  2MQQ A;  4N56 A;  2CPD A;  1YRX A;  4NCA A;  1HBN A;  2WSF C;  3FEZ A;  4MJK A;  4WFB Q;  4J9L A;  3OL6 A;  2CJB A;  3FRY A;  3TVK A;  1DQ9 A;  4DQP A;  1U49 A;  3NRB A;  1FKA F;  2DXD A;  1KKH A;  4RUH A;  4K0K F;  1OS5 A;  2ZJP Q;  2RH3 A;  2JWN A;  2Z57 B;  1FDD A;  1HBU A;  1N8R T;  2QMU B;  3T9Z A;  3O6Q A;  3PW4 A;  1L3K A;  1NK0 A;  3OLB A;  2VH7 A;  1DQ8 A;  1JNZ B;  3Q89 A;  2IRX A;  1VLY A;  4DL5 A;  4EFA C;  1U0H B;  2OPR B;  2GV1 A;  2K1R A;  2EKN A;  3I4H X;  1UFK A;  2FJW A;  1RJJ A;  5I42 B;  5L46 A;  1B7F A;  3N01 A;  1PCA A;  1VFJ A;  3BZQ A;  1TL5 A;  2RRN A;  1KC8 T;  1FX2 A;  4WCE Q;  2CNO B;  3OR1 A;  3MPV A;  2YQ3 A;  1Y7P A;  4IUF A;  2HKE A;  1QAI A;  3M32 A;  2XS5 A;  3U7J A;  2MKK A;  1FF2 A;  1JXE A;  2GQQ A;  4EUV A;  1U45 A;  3V4M A;  5KG6 A;  1VCT A;  2AMC B;  4LF1 A;  3CPW R;  2YWH A;  1JLG A;  2KI2 A;  3X1L B;  1D9F A;  2XS7 A;  2BRL A;  1VQY A;  4KGV B;  5KFX A;  4I64 A;  2C3U A;  5FLX U;  4NLY A;  5F8L A;  2R4F A;  2H5I B;  1B3T A;  3C6T B;  5DO2 A;  4F4W A;  2WVF A;  1YJ7 A;  4JP8 A;  3T1A A;  2FZC B;  2J0X A;  1MWQ A;  5L1J A;  1EET A;  3C3L A;  4BBY A;  1TAU A;  1C1B B;  4Z7C A;  1DHM A;  3HI9 A;  4M5L A;  1F2G A;  3BJY A;  2EC2 A;  2H1Y A;  1Q16 B;  2G1H A;  3MM6 A;  5D77 A;  1VQP S;  3M8S A;  4USW A;  4KRW A;  3R9L A;  1XR5 A;  1S0M A;  2RDJ A;  2J0W A;  2AEJ A;  4ZIW A;  4IOB A;  1RAO A;  3C6U B;  2PI5 A;  3OJU A;  2QYC A;  3JSM A;  1TKZ A;  3LAN A;  4CTA A;  2DKO B;  3GJQ B;  2CG4 A;  4CZC A;  4CLS A;  2VG5 A;  2YNF B;  4LT6 A;  1RTH B;  3M8P B;  4CNY A;  3KNG A;  4OZN A;  2HHT A;  4WXW A;  4BC7 A;  1GNK A;  1OPZ A;  4ZIV A;  2H4W B;  1CPZ A;  2QA4 S;  3A8J A;  4RW4 A;  1CS4 B;  4ECV A;  1F5B A;  3HHL C;  2AGQ A;  1VIX A;  2KB2 A;  2L08 A;  4UOC A;  4I6Y A;  2PN6 A;  4FPR A;  5SUH A;  2QL5 B;  3C2P A;  4LF4 F;  4ES1 A;  1N5T A;  1LWC A;  2IFX A;  2BQ3 A;  3ETM A;  3PCO B;  2F3J A;  2V6A A;  1XER A;  4IYQ A;  2VOD A;  5K14 A;  4X66 F;  1RKI A;  4M5K A;  4C0H A;  1LFP A;  2ZE2 B;  1FT8 A;  4ZP6 A;  1XMO F;  3AB2 B;  3LGH A;  4OIX A;  1XNR J;  2L41 A;  2ASL A;  2VFS A;  4ZVP B;  2CVI A;  1ZAW A;  2XI3 A;  3C16 B;  2YWK A;  4LR7 A;  2Z2Y B;  4PQU B;  1NDK A;  2AT1 B;  3MM7 A;  2CDQ A;  3MED B;  2V4J B;  4Q44 A;  1VRU B;  5LJ3 Y;  3KWM A;  1URR A;  2FIU A;  3QBC A;  2QL7 B;  3P4U B;  5D0R A;  2X3G A;  1R8H A;  2OMO A;  4C11 B;  1YBT A;  3W9I A;  3MM8 B;  4JI7 J;  3NL0 A;  1AUS L;  3DLJ A;  1HHS A;  4DR5 F;  2K3I A;  2AQ4 A;  4LSZ B;  2BJ8 A;  1OYD A;  3QYY A;  5GAD U;  3TX0 A;  1AW0 A;  3I0S B;  4BHQ A;  2M2B A;  3MUM P;  1LW2 B;  2DD8 S;  1KN6 A;  1DRZ A;  1WC0 A;  2PEH A;  2QLB B;  4O4G A;  3M2R B;  4X65 J;  2VJU A;  3PEJ A;  1N36 J;  5C2G A;  3BM7 A;  3MOZ A;  4DS4 A;  3FBF A;  3EGV A;  1KVJ A;  4DL4 A;  5HP1 A;  4K2J A;  1RWO B;  4GVB B;  5GAG I;  2C2E A;  5D0G A;  5CA5 A;  5GMD A;  3OXF A;  1YQH A;  5LM7 E;  2BA9 A;  3MEG A;  2D3U A;  1U6Z A;  2R7W A;  3VTI A;  2B6A A;  4HTI A;  1X0P A;  2DNY A;  1PO6 A;  2HFU A;  2R2U A;  3GLJ A;  2MZT A;  2HQF A;  4FDF A;  3Q8S B;  1AA1 B;  3UCU P;  3QFW A;  2KXF A;  3LF0 A;  3J7A 1;  4JYA J;  3THP A; 
#chains in the Genus database with same CATH homology
 1CBK A;  1IM6 A;  3MCO A;  3MCN A;  2F63 A;  3HSZ A;  4CWB A;  4M5G A;  2QX0 A;  1RU1 A;  4PZV A;  4M5M A;  3HSG A;  4AD6 A;  5ETP A;  1Q0N A;  3ILL A;  1EX8 A;  5ETV A;  3ILO A;  5ETK A;  3KUE A;  3UDE A;  2BMB A;  3IP0 A;  5ETO A;  3HD2 A;  3ILI A;  3HCX A;  1F9H A;  1DY3 A;  2CG8 A;  4CRJ A;  5ETN A;  2F65 A;  1EQM A;  3HD1 A;  3HSD A;  1HQ2 A;  1TMM A;  3HT0 A;  1G4C A;  3KUH A;  4M5J A;  5ETR A;  3QBC A;  1RB0 A;  1RTZ A;  4F7V A;  1EQ0 A;  1KBR A;  4M5L A;  3UDV A;  4M5I A;  1TMJ A;  3MCM A;  3KUG A;  5ETM A;  4CYU A;  5ETL A;  5ETQ A;  1RU2 A;  5ETT A;  4M5H A;  4CYU B;  3HSJ A;  5ETS A;  4M5N A;  1RAO A;  4M5K A;  3ILJ A;  1HKA A;  3UD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...