4LFBF

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lfbF00
4LF4F 2UUAF 4DV4F 4LF8F 4X65F 2KJWA 1CQNA 3R3TA 4DV2F 1HNZF 4NXNF 1J5EF 4X62F 4JI3F 4DV6F 3T1YF 1IBLF 4DR2F 4DUYF 1XNQF 2YY3A 1I94F 4JI0F 4DR6F 4LF6F 5AJ3F 1XNRF 4JI5F 3OTOF 2HHHF 1HR0F 4B3MF 4JI2F 4LF5F 1HNWF 4LFCF 2J5AA 1XMOF 1N33F 1VMBA 4K0KF 5IWAF 2BXJA 4JI8F 2UU9F 2BVZA 4B3TF 2UXCF 1QJHA 4LF7F 2VQFF 4GKJF 2UXBF 1LOUA 1N36F 4LF9F 1GH8A 4OX9F 1FKAF 1RISA 4X64F 1IJFB 1G7CB 4DR4F 4NXMF 2VQEF 4KHPF 4LFBF 4DV0F 1XMQF 4JI1F 1FJGF 4LFAF 4DV3F 1IJEB 5LMUF 4DUZF 1B64A 1HNXF 4B3SF 4YHHF 2B7CB 4YY3F 2UXDF 4DV7F 3ZZPA 1IBMF 4AQYF 4GKKF 4DR1F 2KJVA 1CQMA 4JI4F 4JI7F 4JYAF 4B3RF 4JI6F 5BR8F 2RJZA 1IBKF 1G1XA 4DR7F 2ZM6F 4DR5F 1N34F 4X66F 1F60B 2UUBF 2UUCF 3T1HF 4DV1F 1N32F 4JV5F 4DR3F 5LMNF 2E5LF 2B7BB 4DV5F 2F4VF
chains in the Genus database with same CATH superfamily
1S0NA 1SKSA 3SI8A 4UTGA 2LQ8A 2KJWA 3TEGA 1DHMA 1TKTB 4Q45A 2AEFA 1HFEL 2RDDA 2FLNA 2XYPB 3T5HA 3LO3A 4KO0B 3IR7B 2RE1A 1WF0A 1K1SA 4WU2A 1VQLS 2DISA 3MZIA 3CMQA 1JJCB 3D6MB 2MKSA 2ZBCA 5CABA 2DCUB 3NMAA 3CD5A 3W3SA 1TKZA 3CVKA 2OPRB 2VJVA 2YVSA 2GQ2A 6FDRA 2XULA 2VH7A 4ZLLA 3LPYA 4EYHB 3KYLA 4NCGB 4AXIA 5LMUF 4ETXA 4N47A 3KLHA 1WACA 4RJVA 2YX7A 1LXNA 2XLJA 2ROEA 3JSMA 1H38A 3OL9A 4LRCA 1KVJA 3HVTB 1RT4A 5A2QY 4M5HA 2DGUA 2GQQA 4RU2A 1RT2A 3P6YC 1HR0J 4U67Q 2ACMA 4EUVA 1ZYQA 1WF2A 3UDVA 3KUEA 3MCOA 3PRDA 4DR2F 2F7VA 1U02A 2CUYA 2I0XA 4ED5A 3MDFA 1SC6A 2CQHA 1D8YA 3MUMP 2KG0A 2QJ3A 1HPZA 3V81A 2KHCA 4U8VA 3IG1B 2CPHA 2Z58B 4I7FB 2YWEA 1RT7A 3KG0A 2Q1LA 5AXLA 4ILRA 1Q95G 2CPEA 4EZ6A 1D1UA 3MEEA 5J2NB 1HQEA 3OTCA 4A8WA 2HVDA 2VQFJ 5CD4A 5AE1A 3W62A 2LEBA 2GIRA 3AOAA 4JI1F 1S97A 3CMAS 3RAXA 4DSKA 1F3FA 2CWKA 1XR7A 1SJ3P 4LRDA 3NP5A 2L48A 2BX6A 3BDEA 2CDQA 5G0RA 3GP9A 1RAEB 2D74B 5A2QU 3RR8A 2VODA 3CJ8A 1NKEA 3UN3A 3KK2A 4DV6F 1R7IA 3C15A 1QDUB 4L3KA 4FBTA 2KXFA 4H4MA 1I94F 4K0KJ 2A18A 5MLCV 2G9OA 3MGJA 1UVJA 4ED0A 2LQJA 2M9KA 3GV5B 3E3XA 3NGDA 4JI8F 1PGZA 3MMBA 2N4CA 2R7TA 2WVDA 2B4UA 4PXDA 1S6PB 2YKQA 2ZBPA 4RBUA 1N36F 2UXDJ 3GTYX 2PIIA 3H8YA 1RTZA 4ZCMA 1URNA 1C1BA 2DCLA 3G6XA 2VUGA 1U2CA 2G2YA 2DNHA 2Z2LA 2CQ4A 4FYWB 2XY6A 2F4FA 2R7SA 2RHQB 1G1XA 2HHSA 1R27B 2BJDA 3PJWA 3R8YA 4J9UE 3I82A 2CA9A 4RBVA 2XI3A 4UW2A 3CGIA 4HHUA 1VC5A 1OO0B 1NK4A 4TLQA 2IMOA 3I5AA 1NK8A 1U1KA 4DQSA 4QYRA 3HFVA 5E3CA 4LSLA 2DH8A 2A6MA 3KHLA 1B7FA 1IKVB 3W5ZA 5GADI 4USVA 1Y7PA 5HROB 5BYSA 3ENAA 3C16A 2GFFA 5IV3A 3VR1A 5ETSA 3JTOA 4M5KA 2LDYA 1SQFA 4C48A 2HVZA 1FE0A 4OHYA 2MQLA 1SH2A 4DL5A 3NCRA 2J0SD 2QYCA 1HYSB 5L46A 2P9EA 1TQLA 4J37A 3R7BB 2DR6A 3KTQA 3ENWA 4ZHRB 1R8HA 4DLEA 4DUZF 4W92B 3B6BA 1V6HA 5C42B 5E3QA 2WVCA 1QAYA 2RQ4A 2QLXA 1HWJA 1S1VA 1WC6A 2QLWA 2B4PA 3R1LA 5FJ4A 2KFYA 2GMLA 2Q6CA 2QFJA 2DNGA 3DDIA 4ZVTB 4IFVB 3D1QA 5GAGU 1CS4A 1OWXA 4UQGA 1SQGA 1HBNB 4DU8A 1ZPVA 4IYQA 3D66A 2IC3B 2BV3A 1O5JA 2IIHA 5KFKA 2XY5A 4HACB 1FE4A 4J9SA 1HLWA 3J7YU 3QSIA 1CJVA 4WXWA 4WYWA 2RDJA 4NMLA 4OX8A 1IJFB 4B3RJ 1LK5A 4RNHA 2VQEF 5ETRA 1HBMB 2VPYB 5I42B 4RUHA 5C5JA 1Q5VA 4JI6F 4UT4A 2JNJA 4OI2A 3GIJA 4CM0A 2QZ8A 1X5OA 1IKWA 3T9ZA 2CNLB 1OPZA 3R5JB 1N4LA 4EMDA 5DRKA 4B3OB 1WHYA 1UMJA 3T1YF 2YKOA 1RB0A 5D4NA 1QUPA 2R2RA 2D41A 4RW6A 3QNWB 1VQ4S 2FHOB 2PFDA 5K8NA 3TQEA 1E6VA 1O8BA 2OO4A 3PV8A 1FEHA 2F8MA 1NJWA 2HFNA 4N56A 2AJQA 4ZVUB 5KFMA 1VQ5S 1RBLA 2MKIA 3M8QB 1HI0P 4J9QA 3Q2TC 4NMXA 1REGX 3KLIB 1WDTA 1YKWA 2GO8A 5E0OA 3FBBA 1Q0NA 4YB1P 3G6YA 3SYZA 1NPPA 3KMQA 4NLOA 4NEYA 3EICA 4M94A 1KBRA 1FNOA 4WXOA 2C1EB 1VC0A 4WP3A 1CPZA 4ZLPA 3A8EA 2X1BA 4L72B 1Q5YA 1KVKA 1FDNA 2ALZA 3F41A 2ZITA 3MAAB 1WF1A 2ATLA 4N41A 2LQBA 5A8KB 2HHWA 2HAIA 1X9MA 2DR5A 3BSCA 3IXQA 4QWEA 3I0RA 3QRPA 1VRQC 2L9DA 4ZPDA 2FLPA 4ZJQA 2V34A 4OFZA 5J2MB 3I55S 3D67A 1WHVA 2Y1RI 2ASYA 2XGPA 1WUUA 4LR7A 1RTJA 2VOPA 4USJC 3FEXB 4D3HA 1XNQJ 2MY8A 3ZTPA 2P9GA 3M6VA 3NMRA 4HT7A 4DCOB 3OTOJ 4JI2J 2BVZA 3GCWP 2BZ2A 2YNGB 3T5LA 5E3AA 2XSFA 4I0WA 3M7VA 3CD7A 3RBEA 4P74A 2FVSA 2FHMA 5EDWA 2HQFA 4DV3F 1FHTA 1TUGB 4CCHA 4NLTA 5GAHU 1N32J 2CVEA 3K17A 3OV7A 1TL7A 2LKZA 5KT3A 1SKUB 2NZ4A 2MZRA 2GGPB 2CG4A 2V50A 3TWZA 3OLAA 3S7RA 2MQNA 4CLFA 1A0OB 3MTJA 1Y3KA 5K14A 2XNQA 3T3FA 2EXUA 4DR6F 4KGVB 3IN5A 2ZH7A 3D0GE 3HM9A 3M2VA 3OR2A 1EJ7L 3KHHA 3HHLC 4KC5A 3VAHA 2GC8A 8AT1B 5SZTA 1X4AA 3OQ2A 2HK2A 9ATCB 4B9NA 4X4UA 3A3OB 3M32A 5HBMB 3D2WA 3LP0A 2R7WA 4CP5A 2AGOA 1X0PA 5HANA 5B0BA 4G1PA 1R8CA 2NZCA 2YKNB 4J9OA 1F2HA 1HBUB 1NK9A 2K3KA 4IRCA 3TUPA 3V5RA 2W2NP 2DY9A 3SFUA 3HJVA 1GTHA 3RAQA 2PN6A 5HK4A 4CO3A 1NJYA 3DDNA 2HAFA 1FFSB 4DV1F 4CRJA 2IA6A 3RR7A 3M9OB 2HNDA 2LMIA 4A4JA 4ALZA 1OS5A 4LF4F 2CNNB 2DB1A 4PG6A 2EK6A 3MCNA 1IQTA 1CQNA 2CDRB 1HQ2A 4FP9A 2AYGA 2I5JB 2FJDB 2XCPA 2YNIA 2YPZA 4RZRA 2CQ1A 1UW9A 4X4OA 1TZ0A 5IWAJ 4OX7A 4ECSA 3NBPB 2PGCA 1D9AA 4DJBA 1OIAA 5F0WA 1C0UA 2FVCA 1UFWA 3WZ0A 3BR9A 3P5TL 3R6LB 4KHPJ 2CJXB 2OKQA 4L6V3 3X3UA 2OFGX 4TYAA 1PYOB 2HHTA 3HSZA 3RTVA 3FFIB 3CT9A 4K4YA 2AWZA 1TFWA 4KHMA 4ECWA 2XQCA 1X5TA 3M8YA 4PWWA 4R5PB 2MHNA 3BYPA 1RTDB 1C0TB 4DV2J 2NSCA 4DR7J 2HIQA 1H73A 4I56A 1SL2A 2MKCA 2W9CA 3H59A 4F0HA 3NRBA 2HHHJ 5LT5A 1TKTA 5FDLB 4TQSA 2Y0SD 1JIHA 1YBAA 2P9CA 4DV4J 2XO6A 4BDPA 2O5DA 3GR0A 4Q8EA 4IQXA 2VG5B 4NWBA 4KO0A 4LR8A 3GFXA 3MAHA 2XC9A 1S6OA 3OTDA 1VCTA 5M2PA 1WG4A 1NSKL 3CF5Q 2J6SA 2AHOB 5C24A 5J1EB 2MKHA 2KHDA 3EVWA 2RT3A 1Z2LA 2RB7A 3K0JA 1MMDA 5DO2A 2IVFB 4DPXA 3AT1B 4F3QA 1TL5A 4NCGA 4C3LA 2MGZB 1RWKB 4CLUA 1J2VA 3FEYB 4FKYA 2LYVA 2VDHA 2D3ZA 2Q6BA 4A48A 2H9ZA 3I0SB 3L09A 4TU8A 1YRUA 1HNZJ 3DU6A 2IJFA 3QO9B 2FC9A 3TUZC 1BQNB 1P1TA 2W2MP 1LW0A 1SKRA 3D7SB 5HP1B 5CHCB 4QR0A 4OL8A 2AQ4A 3M8ZA 4KTQA 4C8LA 4I68A 3KLVA 4P2MA 5L1IA 2BJ3A 3MOJB 1U1PA 1RHKB 3IWNC 2VFTA 2M70A 1HR0F 1JMTA 4NYZA 3MEDB 1TK8A 3BGRB 4K4ZA 4FDFA 4OLOA 4AT1B 2KKHA 2Y8WA 1IKXB 3MM5A 4UY8T 3ZNUA 3GIIA 1CSJA 5J2NA 2EC2A 2V9KA 4OYIA 2OTJS 1WORA 3DLLQ 2V4JB 2V8VA 1SJ4P 1UPMB 4GVLA 1XEZA 2G4BA 4A8XA 3W64A 2RJZA 5E3RA 1NSPA 2F5GA 3R97A 1F60B 4DX7A 1WD6A 3IWLA 2OAUA 3MFHA 5A76A 5DDPC 2CPDA 2UUBJ 4WWSA 2HG4A 2WSCC 2ZDOA 5KFEA 3NOCA 3SDEA 3J7AN 2C3OA 5D3GA 2KB2A 3IRXA 2J0WA 1T9XA 3EVMA 2ZVIA 1U2FA 3M8WA 1RWVB 3QIPA 3HF5A 1X5SA 3SFGA 3EXCX 2IRXA 4UUXA 2VONA 4K0KF 5F3ZA 1PJ7A 3M6WA 4UZBA 1FJEB 1YGYA 4B3TJ 2QT7A 4FYYB 2CJBA 1IBMJ 4IDKA 3IS9B 3UDEA 2FJEB 2VG7A 1CJTB 1EETB 1ROFA 1FJGF 2UXDF 2J9EA 2DNQA 4GC6A 1TUVA 1TELA 3VGVA 4HHJA 3BF4A 2PMHA 1XJWB 4CTAB 4TY8B 2QA2A 2FC8A 4UY85 3NGKA 2XHWA 4YR0A 2VOOA 1FKOB 5K20B 2HQIA 4ZP7A 4I2PB 4RR5A 4FKXA 4PKDB 2UUTA 1ITPA 1YLXA 2V67A 7FDRA 2Y9HA 5HROA 4C8NA 2EFVA 4KH1B 3FQLA 2EKNA 4Q7AA 1LEOA 4HLBA 1CJKB 2ZUGA 1JLGB 2FJWA 1ZAVA 3RBXA 1RWOB 5ETOA 2JEIA 3MCMA 2KYZA 2AJ0A 5DGAA 2HFSA 4USIA 3LUYA 3DRSB 4YDXA 2YWHA 1CBKA 1SJFA 4OLPA 4KT0C 2DNNA 3FVYA 1B64A 4GMKA 3B54A 4UZCA 1TV6A 2RH3A 4B9SA 2ZWPA 3FK4A 3G86A 3Q8VA 2LQ5A 1RT6B 4C8OA 3M6UA 4F25A 1VRTB 1BC6A 2A2CA 3PYEA 4WK1A 3E2EA 3W2VB 4J91A 4ZCKA 4OJHA 4Y2MA 5HN0A 5KFWA 1IBLJ 2IDLA 2WRMA 2N7YA 2AMCB 4EO6A 1EX8A 4C9DA 3T6BA 3F0NA 2WW4A 1UVMA 1S1UB 3EGNA 2DR7A 4ZP8A 1FWPA 3NNHA 1YRTA 2FD2A 2ZWOA 2YX4A 1SJQA 3POTB 3ZXWA 2IC3A 1JLCB 4DXLA 1FNXH 3C66A 3BH6B 4FXWA 3RBZA 2MZTA 3ISND 2ZKUA 2DNKA 5J2PB 4AE5A 3GPAA 5C25B 2AEJA 1RT3A 2H54B 3MF5A 4S0MA 3M2RA 4Z7YA 4RW8A 2FJBB 1EKRA 1XMQJ 3GSIA 1SV5A 4IH7A 2RQKA 2CQBA 3M30A 1ZOTA 4C11A 3I9V9 1Y10A 1NJIT 2YKPA 2ZJPQ 2X1AA 3I5BA 4QCLA 1Q7LB 4UQTA 4B3RF 4PABA 3PO5A 1RWPB 4F26A 1O6XA 4LIWA 1NLKL 3W5XA 1N5YB 3VZHA 4QIVA 1DTTB 1GXTA 3A12A 3JYTB 1IQZA 1J5EJ 2O1PA 5HI7A 2CJQA 2QA4S 2V0NA 3G71S 2JL9A 3IA0A 4CH0S 4DUYJ 4YS2A 3PW5A 5EN1A 2N82B 4KBIA 3CCTA 3TA1A 1VQYA 4P7TA 4B3OA 3TZWA 3CSKA 2KZMA 2ZH4A 3H98A 2HZAA 2C3YA 1K0TA 3QYYA 2DYAA 1ZAWA 2G13A 3NGRA 3OJSA 3S8SA 3BO3A 4HDHA 3MECA 4ZVOB 3KUHA 1N0VC 3RRHA 3HHDA 2R7VA 4IG0B 1NAQA 5F9NA 3C3LA 2PMWA 1NM2A 3RB4A 1LWCA 1S0VA 4ANCA 3M8QA 2BYCA 5H9FJ 4J7CA 2ZD1B 1C4CA 2DXDA 1RA6A 3H20A 3DRYA 3KLIA 3MPUB 4B3SJ 1VQ7S 1NXIA 1M1HA 1JLAB 2R8IA 2ZBQA 1JKHA 1R6VA 5I3PA 4MIWA 4FPIA 3GB0A 3ZZPA 2VFVA 4PG8A 1VOMA 2IRUA 2WZ1A 1U24A 2GHPA 3CW2C 2ZVSA 3QJPA 2ZC4A 3BPDA 1SUQB 1CVJA 3G6VA 2E7WA 2RNEA 4N5SA 3UVJB 3DMJB 5KFFA 4KJIA 3ZZTA 4C3KA 2BUNA 2HS3A 4WE1A 2XHCA 5J2MA 3LANA 3BO2A 3R5CA 3QWPA 2YY3A 2YPYA 2IRYA 2AX0A 1ZH5A 4RWXA 2AV5A 1HNVB 5SUHA 3V6KA 2H1YA 1GEHA 1YJWS 3US5A 5K8OA 3EPGA 2JFDA 3QJLA 4GRSA 4ANEA 2YNGA 4K5RA 1V9OA 2QYGA 1RCOB 4P71A 5D8HB 2VC0A 1IM4A 4M8LA 3UD3P 1FKAF 1HKAA 3DLGA 5I3UA 2V5HG 1G7CB 1YDLA 2XG8A 3DU5A 3A3PB 4JV0A 3W2WA 1PYSB 2JC1A 2GX8A 3C6UA 1YHQS 1N54B 3TARA 3LALA 1FDAA 5DJBA 1V5IB 3AAWB 4OV6A 1HBOB 4ZCIA 3FSXA 4A47A 3EWGA 1N32F 2GGPA 3W1YC 3U1MA 1ZPWX 1MWZA 5GAEU 4LUBA 4ZN3A 3PX6A 3QWUA 2ZH3A 1IM6A 3VV2B 3CC4S 3PW7A 2N3OA 1UFLA 1HL6A 1IBCB 1VQPS 1TU0B 4V19X 2IHR1 5G4DA 2Q43A 1KP6A 1RWWB 1WOSA 3V4IB 1VRUA 1EZZB 2GMJA 3M6XA 1FRHA 4K2XA 1FJCA 2Z2YB 4OZ5A 3H2VE 4QIEA 4PPDA 1WKJA 2XMJA 1N5TA 5D77A 1UVLA 2XYGB 4QU6A 2DY1A 2MLYA 2H4WB 1M5PC 2BRLA 4LBHA 3QGGA 3QGIA 2C42A 1M5HA 3H5UA 2CAJA 3IFEA 5KOWA 2W8KA 5BYQA 2XMWA 3TVKA 4LVOP 3PR5B 4X62J 3T1HF 3FCVA 1EKSA 1IWAA 3V6DB 2ALYB 1N48A 3SBMA 1TUWA 4ZCLA 3PO4A 4EZ9A 3GG1A 1A7GE 4DI6A 3QIDA 2CPIA 3VAFA 1KTQA 2C2NA 2AGPA 4EWTA 3NBPA 5J1NA 1FF2A 2IM0A 4OYZA 2HQ3A 3G8SA 1BE4A 4XDCA 5IWAF 2KDOA 4FNIA 3GJQB 1H98A 1TL4A 1N6QA 2NR0A 3P49B 1HNIA 3NL0A 3K5OA 1UETA 1GMUA 5JJBA 5KFPA 3OXGA 3PTWA 4DQIA 5KG6A 4KHPF 2UVRA 1T11A 3GFZA 3W63A 3DXSX 4LFAJ 1K73T 1Q81T 3CJKB 4PUOA 2JRSA 2NSBA 5F8NA 3E01A 2F9DA 3BS9A 4O3NA 1C0TA 1FKPB 3IC1A 3IWXA 4IR1A 4DR3F 1A6LA 3NS7B 3VQTA 1Y0HA 4Z2XA 1D9DA 1FD2A 1WC3A 4DV2F 4DMZA 3DM2A 5FDLA 3M8PA 3CC7S 4LF5J 1RWUA 1NDKA 4OJ3A 2LEPA 1LWEB 1JLBB 1SKWA 4K4SA 1N33J 2BA9A 4NPOA 2WB4A 2HMIA 2HHHF 3DOLB 4M95A 4GO7X 2MZQA 1B0PA 2MZSA 4F7VA 2A2DA 3HX9A 1RKIA 1UZDA 1K8AT 3LP1B 4O0NA 3BGUA 4O4GA 1CULA 1RGVA 4DX5A 3M2UB 3GIKA 4B9MA 1PG5B 2B56A 1T3OA 3VCDA 5IQ6A 1BHNA 1P9YA 2WOMB 1KKHA 5F8JA 2MGZA 4MJKA 2JLGA 4CH7A 2HBYB 2OHDA 4MYTA 5EWFA 1AT1B 1TMMA 2J7WA 2W2QP 2DXEA 1KD1T 4CLWA 4XIUA 2BQUA 3KJVA 3BJYA 1N5VA 2YBVA 2G0IA 1HI8A 4Q0BB 2AZ3A 3QBCA 1S1TA 5KFSA 3TZXA 1RWXB 2H65B 1HNZF 2E5JA 4XO0A 4DFKA 3PR4A 2K06A 5D15A 4PZVA 4FXDA 3SZ2A 1X7VA 4ZVQB 4F50A 4C4WA 4O3RA 1X9SA 4NRUA 1S4EA 1RWNB 4RU9A 4FYVB 4YFUA 2E5IA 1QE1B 4NI2A 3QZ7A 3K7RA 5H9FK 2DRDA 5L9NA 3WHIA 2FDNA 1UL3A 4WU3A 3D28A 3VF0B 2CZVC 4RNFA 2EFOA 2D3O1 2AF6A 2B5JB 2K2PA 4QR2A 3AFGA 3CCUS 1VBXA 4DV7J 1FRJA 2NREA 1EP4B 4Y2KA 2ASJA 5K8MA 3D3CJ 3SQGB 2VB6A 2VL1A 3AD7C 3C6TA 3B82A 4B17A 4TNOA 1VHFA 3CULA 3SCLE 5BR8F 4Q2MA 2B9YA 1HIYA 2BANA 4JI4J 1P27B 4N76A 2AP6A 1RA7A 4UOGA 3EDRB 4IOBA 3WQPA 2DGQA 1FXDA 1GT8A 4CLSA 2X7IA 2V69A 1WNEA 2VG6B 4YDDB 2V6AA 2HLTA 2CPYA 3D54A 1VQ6S 4MK7A 1FDBA 1R31A 1WC1A 2J6UA 2A1BA 3CCJS 4KRWA 4J9KA 2IFXA 4QQBA 4RL1A 3RRGA 3VGUA 4ZIVA 4WZQA 4NLRA 2HBRB 5K8PA 3PKMA 3IGVA 1QTNB 2M3DA 1VFJA 2OEJA 2DR8A 5ADZA 5RUBA 1U6ZA 4PQUB 2FVRA 2M0GB 5KFNA 3IS9A 3OUYA 4HKQA 3OSNA 3TX8A 1FD8A 2NLWA 3GFHA 1EETA 4HH0A 3THPA 4USKA 1RT1B 4EFAC 1ZBTA 1IBMF 2HGMA 4AQYF 4ZKAA 4RLEA 5KT6A 4YHHJ 2DH9A 3C19A 3FMBA 3LAMA 2E7XA 1LWXA 1NK7A 4DSIA 2AYBA 5F8GA 3PVXA 2C22A 2F8EX 3SSQA 4IFYA 1RZMA 4I2PA 2HZCA 3KDOA 3OXFA 4PAAA 2PA3A 1KN6A 2C2MB 2ZH9A 3IR6B 3DHWC 1T05A 2H48B 3THTA 5KFUA 1OY8A 1MROB 5IT4A 3H4DA 1LWFA 3KK1A 1WDDA 4V1Ak 2W4CA 1MG7A 4DPYA 5A8RA 2HS4A 3CO0P 2XM3A 4OZ2A 2OMLA 3EXYA 3MCSA 3DOMA 4KHRA 2R8JA 2FLOA 3ZTQA 3UD5A 2A6OA 5EX3A 4F4WA 1BWVA 1U1OA 2CQ3A 2DHSA 3RUBL 1I6JA 3W5YA 3BN4A 4NLQA 2IYIA 4CYUA 2WB1D 4EK2A 1CQMA 2H4YB 3H42A 1MU2B 4KYZA 3HSDA 3KHRA 2MQQA 1IBKF 3F44A 1NEEA 3ZTRA 2VPZB 1JXLA 1Q16B 2ILYA 3V4MA 4NXNJ 3OTBA 1NNDA 1F6TA 1WELA 3MR5A 1K44A 2MKKA 4K59A 1SJRA 1WEYA 2RF2B 4JV5J 2B6AB 4TLRA 3CJTA 4PQAA 5HAOA 2XTJP 4NYPA 3HHEA 4MK9A 1RQ0A 1IBLF 4L73A 3NCPA 1YZ6A 2H5EA 3MD3A 2DNPA 2CQ2A 1TL1B 3VGSA 3CCVS 4LBPA 1R0AB 4OZNA 4CH1A 5C25A 2XMMA 3DFEA 1UWAA 3VALA 1F5AA 3UCUP 2BXJA 3DGPB 3TX0A 1EARA 2CKWA 4H54A 1IR1A 2JEJA 2B9EA 3GJSB 5HLFA 3FBCA 4C0HA 4I67A 5JUMA 3CC2S 1R43A 1XBWA 2W8LA 3LA0A 1DY3A 4NOHA 1XK8A 2XS7A 2CQDA 1GMVA 2QL7B 4C8KA 5DQGA 2HKEA 1NHVA 5DQIA 4DV0F 1XMQF 1JLEA 3G87A 1MN7A 3QLHB 2IM2A 1KNZA 4YY3J 4J5OA 1S9FA 1R8AA 2C3PA 2DPJA 3PHEA 4ES3A 5JXSA 4PXEA 2AYEA 2QO3A 3RB3A 3FDSA 1U1MA 5E7OB 5M2RA 4PXBA 2CRLA 1T7PA 4GVBB 1HW8A 1B0TA 1J5EF 2RD5C 4K5SA 1KSPA 3R5AA 2DXFA 1S5ZA 4NLUA 3UD4P 4DUYF 4KIAA 3K5PA 2PI5A 5T7LB 1KRPA 3DKDA 1OYDA 1A9NB 1UJ5A 2RIJA 2Z4PA 3HHLD 4R8UA 3CCRS 4YB7A 5GAEI 2EFQA 3G8QA 1S12A 4LFCJ 1HMVA 2PC6A 2NUUG 2MMYA 3MAQA 2ZD1A 4DSFA 2XY7A 5IT0A 2ZEJA 1R8BA 3DOKB 2HURA 3UN2A 3KDNA 4JYAJ 3R7NB 2HNZA 3MHYA 2RU3A 4B3SF 2G1DA 3KLGB 3H40A 1NH7A 5CCLA 3K8WA 5LXYA 1IUJA 4NLYA 4J9MA 2AYMA 4OYWA 3BGLA 4P6QA 3BKFA 3TQ1A 1JX4A 1FTRA 3HI9A 1WC0A 4U7UK 1F1BB 2F1FA 2DT9A 2OEMA 2HPUA 1YK9A 4NL5A 1V3SA 5CH7B 3T19A 1U0HB 4ZPCA 4Z7CA 3MPVA 1FK9A 3PM9A 4ATNA 2HFZA 3PZPA 3LP2B 2RKIA 2CJYB 3DYAB 4NYOA 2JX2A 1QM9A 1S9GB 1FRMA 3PX0A 2VBZA 5J2QB 4RW7B 2IDEA 4QR1A 4ELVA 1UVKA 2EVZA 2QGFB 1KFDA 4KGXB 2WVFA 3N6LA 4EBCA 1JLQB 3BKTA 1C1CA 4BC7A 1TTHB 2BJEA 3J7ZT 1M5VC 4LIRA 1GH8A 2NS1B 3TZYA 1UWBB 4V19J 1VI7A 4PG4A 1KLMB 3QT6A 3FJ2A 3VAMA 3V6JA 3FNNA 2QRRA 3N4WA 2WVBA 4ZITA 3MI7X 2EPIA 1K47A 1HQUB 2LLZA 3QRRA 3CWJA 1DJ0A 2IMWP 1T9UA 4ED6A 1HBOA 1T03B 3DRRA 2ZM6J 2MYFA 2HGLA 4QIFA 2FHKA 5DS7A 3MR6A 1NDCA 4OI3A 3ENVA 1BGXT 3MTKA 4RW4A 2C2OB 1GTEA 1NJXA 4A46A 2HQDA 3KK3A 3BYRA 3BKUA 2IY5B 2XWXA 2C2EA 2J7KA 2DHGA 3MUVP 2V2QA 3V4IA 1XNRJ 3BH7B 3AD9C 4OX9J 2JJ4D 2ZJQQ 4DF4A 3KLEB 1WG5A 5T14A 1H7WA 4URSA 3TAMB 4NLPA 2CYYA 2AW0A 4DQQA 3P8BB 2H3EB 3TNVA 1RUSA 4USUA 4DBQA 5ETVA 3G6ES 2CQGA 1L3SA 1RHQB 1FRKA 3T1AA 4F67A 2QIFA 3NAHA 1U6BA 5KG0A 1ZS6A 3MM7A 2RILA 5LJ3Y 1DFDA 4NLGA 1QSYA 4O3SA 1FESA 1QAJA 1NK6A 2HQCA 5LSRA 3J7Z5 1M1KT 1X5PA 1FWKA 3MM9B 4X62F 4O4RA 3AOCA 3RYLA 1BXNA 2QG9B 5K9FA 2WBMA 3NWRA 3HHLB 2K1RA 4TQRA 3Q23A 2QA4G 3MM6A 5AJ3F 3DI6B 2ZH6A 4ZLJA 2IBKA 3L9ZA 4NLDA 5E33A 1M0SA 2DHHA 4QW9A 4M63A 1HD1A 1RLCL 1H3DA 2EWHA 4MFBB 3C46A 3X1LB 3VWSA 2KRRA 3I31A 2BE2A 2UXCJ 4K4XA 4FBUA 2ZZMA 1URRA 3FMWA 3BBCA 3H0PA 3JSYA 1AFJA 4Q44A 2IAJA 2ZE2B 3OR1A 4G1QB 2HEKA 4CLZA 2OPQA 4HTIA 4WYLA 3GIMA 1S9EB 4O44A 2XSJB 1FRLA 4BWJA 1Y00A 3CJKA 1JK9B 5C2GA 5DDOC 2GNKA 2OFHX 1D3WA 4C8ZA 2ZOMA 3R2CJ 4DL2A 1RT5B 2H51B 1ACMB 4FVMA 3PHTA 5KT5A 3CIZA 2WBRA 3TA0A 4DX6A 1LWEA 3EZUA 1N5SA 2KU7A 2DO4A 3CCLS 3HD1A 1CJUB 1VK3A 3MMAA 3RW6A 3DOLA 2CG8A 4LF5F 1KQGB 1U6FA 3BBBA 1IKYB 3NEKA 3JQJA 4ID5B 1N33F 3QGHA 1FFGB 2M5YA 3ULHA 5KG7A 2OEKA 4DR4J 2K7KA 1NPKA 2ZZTA 2RUSA 1LKZA 4UF4A 3D68A 1WTFA 3GG0A 2LA6A 3JB9k 4RNMA 1RJJA 3VAIA 5DM7Q 3UR0A 2RQMA 5CYMA 3ZZYA 4WTOB 4FZVA 2V8PA 3RGIA 4M5DB 1ULRA 1Q1KA 3AHPA 4PWDA 1D9FA 1SIZA 1QY7A 2ZC3A 2PO4A 5D78A 2D3UA 2LVWA 1Y4ZB 4OYPA 2NXJA 2P6TA 1S6QA 4JI0J 2C3UA 2HVIA 4JV2A 3R7SB 1B70B 1TFYA 3QFHA 2MKYA 4F4AA 1T02A 4K4TA 2HW3A 3TJ9A 4P7VA 3Q89A 3WC0A 3FSIA 4MTPA 1MNEA 2C28A 2L41A 4ENOA 4BCAA 4RPFA 2UV8A 1S6UA 1R89A 3IO1A 1NZAA 3DLBA 3D4JA 1V3ZA 4CLPA 4EI2A 3LAKA 1PO6A 2BW7A 2XNRA 4DFPA 1TKZB 4DV7F 3I4HX 4PCQA 4U6PA 2V2ZA 2B0GA 1YQHA 2F4VJ 3MURP 3J81Y 3N28A 4RW9A 1L5UA 1MLAA 1VQSA 5D6GA 2IVMA 2P2CB 1H72C 2NYHA 4U7CA 4I1TA 2JLEA 3O6QA 3LWMA 3KLHB 3KJFB 2YNHA 3TO8A 3JSMB 3ZZZA 2DBBA 4I2QA 2VA3A 1ZA1B 1VLOA 1AZSA 1RT4B 2FY1A 1FVSA 1REVB 2L9NA 4ED1A 2M8HA 1I1GA 4KAIA 5KFHA 1U0SA 3WIVA 2OI2A 3PW4A 1AROP 3PACA 2HHUA 2EFPA 1S1XA 1Z4UA 2QL9B 4M5NA 5IT9Y 2OD4A 1RHMB 2MJUA 3GCXP 4AD6A 5KOXA 2CPFA 1LQ9A 3DGVA 2F65A 1PBAA 1B3TA 2HWHA 1LOUA 4RNOA 4I69A 5LSLA 1HPZB 3V81B 4J9RA 5HMXA 2CJKA 2VFRA 2VPWB 2R7QA 1DTQB 1RT1A 4DR5J 5ETNA 1PCAA 2HBQB 4QWDA 2C2DA 3PEJA 4JI1J 2W9BB 5A6PA 3PYDA 3MEEB 1HQEB 4AFFA 1G4CA 4YOEA 3UPFA 1QSLA 2C3MA 3PIPQ 4ICLB 4E0DA 3J81U 4BS2A 1DARA 4CDIA 3ZO7A 2M2BA 4KPCA 4F36A 4LF6J 3U7JA 1H7XA 4C8MA 2O01C 4K8RA 4DUTA 1FDDA 4HTJA 1T9WA 5F8HA 4FF2A 4DV6J 1NRKA 5G0RB 2FB0A 1SB6A 1FXLA 1R3NA 2E66A 1VMBA 5IFMA 4RX6A 3C15B 3DCAA 4NZ0A 2QMWA 4MMOA 2I8EA 5JVHQ 4CO0A 3ELHA 5IT9U 3L3CA 1VJQA 1KEKA 1EIYB 3EGVA 4Y6IA 2HYIB 1T8EA 3B4MA 3OFGA 3PXGa 2ZHAA 4WKYA 2RSQA 2N3LA 2VA2A 4F4KA 2D69A 3K5LA 1J27A 1C1BB 3JXOA 2C2ZB 5F9LA 2DRBA 4ZPTR 1NDLA 3D6TB 1VGYA 4OHXA 1BY9A 1H6KX 1N0UA 4NXNF 2KTQA 2GHWA 2J0XA 2FYXA 1NMEB 3PY8A 4B9LA 2E9ZA 3TUJC 4X4NA 3CD6S 1QTMA 1TL1A 3O5TB 1XWLA 2XEXA 3HHNB 4PG5A 2HHQA 2LEAA 2AJ2A 4R0JA 5HQMA 5HMZA 5CZVA 3CJ0A 3OHBA 2FJAB 4FYDA 2GHVC 3G82A 4YEAA 4DSJA 2J8AA 3C16B 4LSNA 3K5MA 4DL4A 1Q53A 2Q79A 4XPCA 1NB7A 1R6YA 3ZNJ1 1Y5IB 2D9OA 2V63A 4NCAA 2UUCJ 4DUZJ 3K58A 1TKXA 2OPPA 4MIAA 2J6TA 2XMVA 3CMES 5L39A 4IKAA 4M1KA 2UVUA 1YG0A 3HD2A 2BW2A 4LJMA 2W1BA 2OJ3A 2RHSB 4PEOA 1KR4A 2XZDB 5K5MA 3HULA 5LM7E 1FRXA 1S1VB 3QAEA 3PKYA 2QLJB 2V2VA 5T7LA 4LQ3A 2GVDA 2VFSA 3OVAA 3KOAA 2FJVA 4ZVSB 2X3DA 2JWNA 2HHXA 1EQMA 2R8GA 2LDIA 4QWAA 1JLFA 2MQOA 2GVZA 3TR5A 3EPIA 3G4SS 3AB4B 5CD4H 2RRAA 5LSOA 2KH9A 3FGVA 1TKDA 3N6MA 2DD8S 4WBFA 3U02A 3UI3A 2RS8A 3IP0A 3VZIA 3Q86A 2RVJA 3UNYA 2YQ1A 1OQ6A 1N34J 3B78A 2Z30B 2VQEJ 5GMEA 3PX4A 4JYAF 1DLOA 2E5LJ 3I4PA 1T94A 4HVZA 4P52A 1BUXA 1WKLA 3NLCA 3JTPA 2MEWA 2CJ9A 2QN6B 5D4LA 5EHHA 3IGNA 2YKAA 3QQCD 2E1AA 4LRBA 1IVZA 4B02A 2LXIA 2B3TB 2Y1LB 2V2KA 3T1YJ 1VQ9S 2W2OP 3TJAA 4H4OA 4ECUA 1IKWB 3HT3A 1HWUA 1K1QA 3DNCA 1HNWF 2HRYA 5D4OA 2VIHA 3CCWA 2B8PA 1UPPA 4IG3A 1OSDA 2XB2D 2E44A 3L4BC 5J2QA 3JS9A 4P10A 4JV1A 5IV4A 3FC9A 1JLQA 3UCZP 4L75A 1E6VB 1AXQA 2EFGA 2HNYB 3NG8A 2WONA 3DC2A 1G2EA 1NCLA 1PC5A 2HWIA 2QE5A 3BN7A 4BC9A 4DWIA 2KVQE 5BYRA 3MEKA 1T03A 4WFYA 3AOBA 4E2FB 2B7BB 1HHQA 2FHJA 1BD6A 2MLXA 2VICA 5LOQA 3WIUA 5KG4A 1WEZA 2PSZA 4ECVA 1M5KC 2R7XA 3GWCA 4L74A 5D0EA 2DH7A 5D4PA 4IUFA 2KXNB 1O0PA 1RTJB 2HS0A 3QJJA 2ZHOA 1VIXA 3EGWB 4OX9F 2MZJA 2ZH2A 2JZ5A 2YNFA 3PJ9A 1YVFA 3NWGA 3ISNC 5L1KA 1NH8A 3RB0A 4BHQA 4K7QA 2I1RA 3H5SA 2PD1A 5HL7Q 4PR6A 5B0DA 4WPAA 1VIOA 4KR0B 3N5BA 1OQ3A 4MT1A 4F8RA 1TL3A 5DG8A 2J8SA 1TVRA 3MM9A 3QFWA 3I32A 5EUHA 2DRAA 1XN9A 1RWMB 2EBGA 4IQMA 5LXRA 1TL7B 5DLFA 3N5FA 1KQFB 2BOAA 4OHVA 1FFWB 2VHGA 4ERDA 2Q3PA 3OL6A 4F3MA 3BB5A 2HFUA 1S0OA 3UO0A 1DRZA 4O0IA 4DR6J 1WOOA 1Q79A 1PKUA 2MXYA 2OP5A 2HIYA 3HDSA 4NRTA 2R7RA 1ZETA 2OIHA 6FD1A 2JLFA 1CC8A 4CZCA 3OTEA 1SCJB 2KI2A 1NU4A 2OSQA 2PI4A 4U8YA 2XCAA 3ITHA 1RISA 4X64F 1RU1A 1X4EA 3OD2A 4C97A 1RU2A 2ZE2A 4KGKA 3KFWX 2RQCA 2HK3A 1S9EA 1WSVA 2CPZA 2N4DA 1I51B 3LP0B 2YWGA 3MFIA 1N56A 4I6AA 4DS4A 2LA4A 1D8ZA 1W2IA 4F2SA 5KFCA 2YWWA 1RT5A 1Y9OA 4C0BA 3KG1A 2ZJRQ 4KGMA 1KWMA 3HVWA 5H9EJ 1AFIA 4A8KA 4WIIA 4I6YA 3U1NA 2QLBB 4KB7A 1P1LA 2OPRA 3CDWA 2VD3A 2RDIA 2OPSB 1NJZA 1IKYA 2KL8A 4ID5A 3EUNA 4DSEA 1RK8A 3DLJA 1X9WA 5KFOA 3BZQA 4USTA 3K2YA 1W7WA 4OI6A 2XLKA 3FUYA 4WTYA 4WFAQ 3CCMS 2I6WA 1C0UB 2LECA 3HVTA 2WAQD 1Q86T 4DR4F 1WWHA 2E29A 4N7TA 2W25A 2GO9A 1RAFB 2W7AA 4AL6A 3HKWA 3MOZA 1L3KA 2MB0B 2QX0A 1OJ4A 1ELOA 1SQEA 5KFDA 2Z56B 3T5KA 1U25A 4ZK7M 2MTLA 2BR0A 3T41A 1RAJA 2JEGA 2CIMA 4H4KA 1SVDA 3IG1A 4MKAA 4OJ1A 2FUG9 3PJXA 4I7FA 4ED8A 4K2JA 4JI0F 4OZJA 4EU0A 3CDUA 3LWLA 1ZTWA 3SSRA 1E6YB 3ZZRA 2W9CB 3K8VA 5GVQA 3PNIA 3SSSA 2M7SA 5L8RC 4F04B 2XMAA 3GYNA 2DGSA 2KM8C 3S6EA 4J9PA 2GV1A 3E51A 4TU7A 1NHUA 2VQFF 5GMKa 2R4FA 5A0YB 2LCWA 1XERA 4DR1J 2PA8D 3PYGA 3PG9A 1RP5A 2W4PA 4QPTA 4X4PA 3J7A1 1VQMS 2KRBA 1AA1B 4X66J 3CCSS 5C24B 4LQ9A 2NXNA 2KJVA 1O51A 2BE9B 4W98A 3ONQA 4ZVEA 1WHWA 4ECRA 3VAKA 4Q5VA 2V8DA 2DITA 4DDFA 4O3QA 2KT3A 5E3PA 2R2SA 4DPWA 1HWIA 4N77A 1SXLA 2F4VF 1QVGR 3MR3A 3HT0A 2OUGA 5ETTA 2PEBA 1QLNA 1ZM9A 4C2MA 4OV1A 3GMGA 1VBYA 2BKPA 1SBRA 1REVA 3FCWA 5GAGI 3ICLA 2XLIA 1S6PA 1QAIA 2RRBA 3UE2A 3PYFA 1LW0B 3MMJA 4ZP9A 1NK5A 2FPHX 1FCAA 3T6JA 5EX0A 4ECTA 4CIOA 3VVUA 4LF2A 2MSSA 2KYXA 2CQIA 3PW0A 3J7YI 1FI4A 4K4WA 4OQJA 5AE3A 3ZC4A 2HRUA 1DTQA 2C2KB 2E1RA 2NXUA 2VBWA 3MM5B 2B7CB 3PRVA 2L9WA 4QZVB 2W9BA 2UVVA 5A8WB 2M8DB 5CCMA 4DR5F 1M5OC 1TK5A 3OXLA 3GV8B 2F9JA 2W4DA 1IKVA 4ICLA 3Q83A 2UVWA 5I4MA 3AB2B 3M8RA 2E1PA 2WHOA 4U9RA 4ZVGA 4WIQA 1U49A 2HZVA 3TP2A 4UOCA 3O3LA 2LXUA 4J9NA 4LF6F 2M52A 2Y0BB 3Q0AA 1RAHB 1F5BA 1HYSA 2FZGB 2NPIA 3CE8A 4TVAB 5KT4A 2KFZA 5CA5A 1Z2ZA 4LRAA 3C8YA 4ED4A 4DFMA 4LF9J 3SDEB 5D3GB 3VVTA 4ZHRA 3IRXB 3PFEA 5C42A 2KT2A 2DNMA 1UP1A 3ZTSA 1Y11A 3R1HA 1LK7A 2H5IB 3FBEA 4MAKA 3QIPB 1PBUA 1NKBA 5ITHA 3GV7B 1VBZA 1SH0A 3GYXB 1SC3B 2BJ1A 5KAKA 4Z37A 2J76E 1FJGJ 3UN5A 4IFVA 3DLHA 3D6HB 4IDKB 4G6VB 3Q8RB 4Q43A 2VG7B 3NNAA 1HBNA 4DX8H 2GIQA 2LFVA 2APOA 3ILLA 1NZ8A 5CYQB 1ZA2B 1D0EA 2CJAA 4PG7A 3J80Y 3MR7A 1S7HA 2WSFC 1PJ6A 3BQ1A 2XZTB 2JC0A 2MLZA 3RZAA 3OPKA 3CJQA 1RXOB 1LV5A 4HACA 2WK4A 2G2OA 4Q8FA 1PILA 2FGCA 4CLYA 5CAAA 3CJ3A 4F2RA 2MJNA 4CLLA 3Q22A 3IM9A 1VISA 3IBCB 3CNQP 1JNZB 3RG6A 4GKJJ 3CJ2A 1WJ9A 1HBMA 4KFBB 5I42A 3A4TA 4A8QA 4QIGA 4FXVA 4KH0B 1UA0A 2BOPA 2YX1A 3QSYB 1X4GA 3T9NA 3ILIA 1FEEA 4NA2A 2ZH8A 1RAOA 1L3TA 2HSEB 2ZH5A 2V9WA 2MQMA 5GAHI 4ZMMA 1PJ5A 2V94A 1UJ6A 4IH6A 1S4FA 3KG4A 2YH0A 3TW0A 2UUCF 3MEGB 4HEA9 2HQGA 3LPEA 2GAHC 4OIXA 3SQOP 1TV6B 1XIQA 5ETLA 5H9EK 1Q7YT 1X0FA 2J7UA 1KOOA 4OX6A 3J80U 1NHKL 1RI7A 3TAPA 5AXMA 4X4SA 4LF7J 3BSNA 1S0MA 2AX1A 2QTWA 4TKTA 4CO4A 4K4VA 3JTNA 4A8MP 4OJGA 2CQCA 2D7SA 3IMQJ 5E5NA 4P9SA 5ETQA 4OYXA 3V6HA 5HVFA 2VU5A 3MAAA 2IA0A 3O44A 5A8KA 2JSXA 5KFYA 3LGHA 2FVQA 1RT3B 1YITS 2EG1A 3BSOA 5AT1B 3M2RB 1IR2A 4NLXA 3R6GB 3BGOP 3UFCX 4RW8B 2PDAA 3H4BA 2MZ1A 3BBFA 1IWGA 2W9AA 1SV5B 3OFHA 5DG7A 1F0XA 1T9VA 3L95X 3M30B 4C11B 4P2FA 1N34F 1C2PA 3C2PA 2UZAA 4RO0A 3TANA 2E5LF 1WOPA 2X1FA 1RYSA 2V4RA 2OGUA 3DLKB 2A0FB 2EBEA 3TEHB 3H25A 2GS8A 3D5MA 2FY8A 2RS2A 3AH6A 2R2TA 1XNQF 4DL7A 3AJ1A 2B9XA 1SJ1A 3OTOF 3KXDA 3N0VA 4JI2F 1UEKA 1XR6A 4DF8A 5KFTA 4QU7A 4IOCQ 4F02A 5IOLA 5B0EA 4C98A 1N52B 3P4UB 3RAMA 3EM1A 2KT5A 2ADCA 3R5BA 1YJVA 5KFJA 4CNZA 1S49A 3MECB 3SCIE 4A8SA 4AYBD 2HNYA 4YR3A 2A3JA 3T5JA 4FF4A 2UV8G 4ZVHA 3M1VB 3HJFA 2BJ7A 4LRFA 1LWCB 2DK2A 4ELUA 3KLFB 4BLGA 3PW2A 4Y2AA 4JBCA 3LTOA 1FVQA 1JKHB 1FX4A 1S59A 2D3OR 2FGOA 2YTCA 1PAEX 3GONA 3L7OA 2POKA 2VFUA 4WF9Q 2DGTA 1KHWA 4X4QA 2MKJA 4XPEA 1VC6A 4MH8A 2BJ9A 1NSQA 2FVPA 5HBMA 3Q8PB 1CLFA 5BXIA 4WE1B 2Y1JA 2VBYA 2EEYA 4CT9A 4D3GA 2YKNA 1Q8LA 1HBUA 2GZOA 1TAQA 4B08A 2CQPA 2AT1B 3N6NA 4WKRA 2XO7A 1HNXJ 1XMBA 1J5OB 2OH2A 2YQ0A 1MWYA 1HW9A 4M5LA 4ZPBA 4WK3A 5LJ5Y 2DO0A 2AU0A 3UDLA 3J81j 1BWEA 2U1AA 4IRDA 4NLWA 1N88A 1HWKA 2I5JA 3DLGB 5I3UB 1KQKA 1KDNA 2H5JB 4JI3J 3W2WB 3EZOA 1WSRA 1F2GA 3C6UB 4ZPVR 1TMJA 3A8IA 2PEHA 4JI5J 3AQPA 3OVBA 3K59A 1RABB 2NXCA 1RHJB 5HJXA 5KG2A 3ZZ0A 4ES1A 4O3PA 4RUCA 5B09A 1GMWD 2WSEC 4PYDA 1WC4A 3HK2A 4USMA 3EX7B 4ZP6A 3I9ZA 3QGPA 2P6SA 2BBEA 3I5CA 4JUZA 1YZ7A 1FWLA 3FFIA 1T3NA 4RNNA 2BQ3A 1DQ8A 3KWMA 3GSDA 2AJ4A 2QSWA 2IJRA 1B7YB 1P6TA 1VYAA 1HA1A 2XMTA 1YBUA 4M5JA 1VRUB 4HH1A 4R5PA 5HMWA 1RTDA 3WBZA 3H5XA 3UNGC 4HL9A 1R0BG 3ENQA 3VAGA 4TN2A 4X4TA 1NK0A 5KFIA 2GJFA 5CQGA 4Y0FA 4L3NA 1AYEA 4DR7F 3AD8C 2GW8A 1S1WB 3NY0A 2OLWA 5DZ7A 1S79A 4O23A 2VG5A 4ZVRB 1X60A 3T1HJ 1PIEA 1I5OB 4DV4F 4WP9A 4PXCA 4HDGA 7FD1A 2B4OA 4RBTA 5HSPA 1CC7A 4OYMA 1K0VA 4KKOB 3RJMB 3AODA 1YJ9S 5J1EA 2W7OA 3NAIA 2XBPA 1MMLA 1S76D 3VHQA 2OPSA 3TOQA 3SIPB 4DFJA 3EE3A 3QAUA 2KO1A 2EW9A 1KQSR 3CO9A 2HFVA 4K4UA 2AGQA 4KY3A 1VJWA 1FERA 2FZKB 4W4MA 4EO8A 4M5IA 3I0SA 2WVEA 1CG2A 4QPXA 2ZBIA 5F8IA 3QO9A 1YRXA 1BQNA 3WX4A 3LF0A 3OJUA 3A8KA 4RUAA 2DNRA 1N6QB 4OYAA 1NB2A 1X8DA 2KXHA 1HNIB 3BPSP 1VLYA 1OMSA 5HP1A 9RUBA 1KOHA 3WX8A 3LOUA 4FF1A 4CM2A 4IH5A 5IM0B 1VS3A 2CNOB 3M9NB 3HXMA 2DJWA 4YP3A 5C7PA 4DR3J 4ZVFA 3MEDA 1JQGA 4PUOB 2DHAA 3E01B 3BGRA 2YXLA 2COLA 3NKYA 1IKXA 2JEFA 5D0HA 2VPXB 2AKWB 3NS6A 2F40A 3JSBA 1E6YA 1NBEB 4OZ3A 2IM1A 3DM2B 4CO5A 3M8PB 2ATCB 2V4JA 1LFWA 1WI6A 4ANDA 2RRNA 4LFBJ 3CXCR 4H4KC 4NEZA 2HMIB 3Q8UA 5A0YA 4LT6A 3GU0A 4JI7J 1U48A 2BKOA 1Q82T 1RADB 4O4GB 1CULB 3MR2A 4DL3A 4CWBA 4AUKA 4DR1F 4DQPA 1XTZA 3HPOA 2YWFA 1AW0A 4X66F 2UUBF 5U47A 1M5SA 2MPUA 1NO8A 1KLNA 1DURA 2QV6A 3NXZA 2XWYA 3GR1A 2ZHBA 2ERRA 4B3MJ 1LXJA 1RTIB 3KJVB 4Y2CA 3F73A 2CFXA 2ZNYA 3ZTOA 3H5YA 1S1TB 5DG9A 3ET6B 4ZN1A 5JVGQ 5GMDA 1RHUB 2OTLS 1CJTA 1ZM4A 2U2FA 4B3TF 1YX2A 3SV4A 1T9YA 1H2UX 4HYKA 4ZS6A 1AB8A 1MN9A 2X3GA 4CTAA 4TY8A 3AJ2A 1UA1A 5KFXA 4NI2B 2J0QD 4J9LA 1GX5A 1SC4B 3I87A 3F56A 2XI2A 3I96A 1FKOA 3R27A 4WFNQ 4JP8A 3PRBA 5A8WA 5KFAA 3C14B 1M1GA 4QJVA 4DCJB 2HHPA 1QVFR 3JAMY 5BR8J 1OSCA 3C6TB 4Y2IA 2D1CA 4LVNP 5HO4A 3KJQB 2BANB 3G8TA 2FQQB 1CJKA 1JLGA 2EKYA 3GLJA 3HCXA 1C4AA 4QOTA 1Q8BA 4DS5A 1UEVA 2VDIA 1GQEA 1B0VA 1S48A 2Y1IA 1F9HA 3DRSA 2PMZD 5H1SV 1JXVA 5IQQA 6AT1B 4URQU 3MD1A 2FLLA 4YN3B 1RT6A 3TJ8A 5IS2A 3K57A 3SCJE 4LF9F 1VRTA 2BEFA 3W2VA 1OY9A 4ETZA 1YJ7A 2EC0A 1BQMB 3GZ7A 1S1UA 5HMYA 1JXEA 4AQYJ 3OUYB 2GQCA 4ZJOA 1U1QA 4GO5X 3W61A 2NQPA 3POTA 5CYQA 4TXSA 1JLCA 3W66A 3JAMU 1RCXB 5J2PA 4F0KA 4CT8A 3QT8A 4EBEA 2VJUA 1YIJS 3ISZA 4MKBA 4EYIB 2VKRA 4IFYB 3R2DJ 3SV3A 2UXBJ 3ZZOA 4KGZB 3QPIA 4Y3CA 4KFBA 2R42A 2M4MA 1RAAB 2ACYA 1KONA 3VTIA 4GKJF 1T05B 4NE9C 3VAJA 2V8GA 2OELA 1VBKA 1LWFB 1N5YA 3KK1B 1DTTA 3JYTA 5A8RB 2VV5A 3N79A 5EGYA 4XAKA 3IAM9 1IXKA 3DOMB 3V2UC 1W25A 4P2XA 3W9IA 2DNZA 3HMJG 4ZIWA 2OMOA 5AXKA 1JB0C 3MPDA 4A8OA 2LP4A 5MAOA 3NNCA 3THVA 5ETPA 3MEGA 4KV8B 2CXEA 1IBKJ 2BJ8A 4ID8A 2DHXA 4CYUB 3ADAC 3MWBA 1G3OA 2K3IA 4IG0A 2DIUA 3NOGA 3H7HB 4USWA 1XMOJ 4OHWA 1RTHB 2FIUA 4DZ6A 3FZ2A 4N8OA 3W9HA 1XR5A 5C2CA 5HQ8A 3KMSA 2YH1A 3Q2SC 4WJBA 1JLAA 2RMLA 4DLGA 4TU9A 3W8GA 3QATA 4FNHA 4LF7F 3DRPB 1SI9A 3Q8SB 1ICEB 1UZHA 4CQ1A 3G9CA 2ZOGA 3W65A 2YKMB 1S10A 4WFBQ 3P96A 3M05A 1ZZFA 1KC8T 2DNLA 1SUQA 2E1MC 5HLFB 1YJRA 2M88A 3P5BP 3OW2R 3UVJA 1HI1A 2GIFA 3DMJA 3W8PA 4DV0J 2JFKA 5J1PA 2G0CA 5KG5A 3PIOQ 3RU0A 4PYAA 3UWTA 1IN0A 3RRKA 1GXUA 1NPRA 4QW8A 5F8MA 2R9LA 1HNVA 1JLEB 4PPZA 1DZ5A 3MMCB 2HBZB 4NCBA 2NXEA 3DLKA 1NUEA 3MM8B 4FS2A 2Y3YA 3U27A 4DN9A 3FRZA 3G2XA 1JJ4A 2L3MA 3DLEB 5EWGA 2XMUA 2BMBA 4ECQA 4FS1A 1LW2B 1TP7A 2JH3A 2DEJA 4W90B 3EYZA 1SH3A 4JOUA 2DKOB 4KPYA 5F8LA 2VC1A 1ZM2A 5JMNA 5KG1A 4C3MA 1HHSA 3CCES 3QMQA 5B0CA 2Z2ZA 4NX9A 5B08A 1TAUA 4R8UB 2JVRA 3BGFA 3UW1A 4NZ7A 3OBIA 3M1VA 1HMVB 3A8JA 3QZ8A 4MKYA 1RDRA 1UJ4A 3OSPA 4LREA 3KLFA 1NKCA 5CXTA 3HFKA 1YJTA 4BWMA 3HHKA 2HNZB 1EQ0A 3CUNA 1JNRB 4DL0C 4NASA 4Y65A 4J90A 4A8FA 1U45A 4Q2LA 4G65A 2G1HA 2VKZG 2ZH1A 4CI0B 2VBXA 3SXLA 2UU9J 1OYEA 2E7VA 2QMXA 4NA1A 4CO1A 4NLVA 2NPFA 1U8SA 2IM3A 4DQRA 2UUWA 4ILMA 4UUWA 3TRGA 2X1GA 2N7CA 2Y8YA 3NCQA 3KNGA 1FK9B 3BQ2A 1SPBP 4QYZJ 1Q8KA 1Q4RA 2RKIB 4LSZB 3A1YG 3HZEA 1J5OA 4EBDA 1Q78A 4GKKJ 3D6FB 3D9BA 3TI0A 2E9TA 1U4BA 4OHZA 1QAXA 1M90T 2BABA 2W01A 3BQ0A 1HNXF 3V6DA 3GIRA 4F3OA 1HD0A 4MYUA 4IRKA 2DIVA 1C1CB 2L08A 4I6WA 3D0IE 5DZ6A 3TVYA 2HHVA 2QLFB 5HQLA 4UOHA 2ADBA 4FF3A 4X65J 4WFXA 5KFVA 1FNMA 3D1OA 4HT5A 3PDNA 2B9WA 3DHXA 2I38A 4DOZA 1VR6A 4DPTA 3CJ4A 3EJMA 2XGQA 1P9QC 2NCKL 3SCKE 2DR9A 2JVOA 4ITSA 4JI3F 2Q66A 2ASLA 4F4XA 3H2LA 4P73A 4LF1A 3OLBA 5D0RA 2CPJA 3DRRB 2MSTA 3CJRA 5HVHA 4JI5F 5KT2A 3MUTP 4DZDA 3LGNA 3TZZA 3ZZUA 2VZ9A 2I9SA 4ZDNA 4CLKA 3BM7A 5AXNA 3BREA 4RW4B 2FTRA 1FRIA 3KK3B 1RE1B 4OI4A 2J9DE 1PYTA 3BSAA 2ZBRA 1WTBA 1R0CB 2MY7A 1FKPA 5B0GA 4G3IA 1LFPA 3RBDA 4OZ0A 4LFAF 1L3VA 3GE9A 1L3UA 3W9JA 4WFZA 4R25A 1YSJA 3HZGA 5DDQC 5LMNJ 2E5GA 3LQVA 2V8HA 2QSFA 1FJ7A 2UUAJ 4LF8J 2XS2A 1UW4A 3CPWR 1B99A 4CNYA 4DL6A 1JLBA 3NS5A 4ZLNA 1S1WA 3O8WA 2GA7A 3LGMA 3B8HA 2MQPA 1RACB 1U26A 4FN5A 3MPWA 3MM7B 2UP1A 4HI1A 2YWKA 3N01A 4RUBA 2AIRB 1U2RA 2Z0GA 3LP1A 4DSLA 1H74A 2YQ3A 4KKOA 4DG1B 2DGOA 1YJNS 1H2VZ 3M2UA 3O1LA 2PE8A 3HVAA 2F3JA 5AJ3J 1FT8A 2WOMA 4MKVA 5IXUA 4N8NA 3FEZA 1UKUA 5A6WA 4KQZA 3AA8A 4X4VA 1KVIA 4J9VA 4NXMJ 2K1RB 2QFIA 3BEGB 4ZPWR 4RWWA 3H2UB 3MM6B 1D09B 1WHXA 4CO2A 8ATCB 3A13A 4FYXB 2JDJA 5B0FA 1GK8A 3GYGA 5CYJA 3JQKA 4Q0BA 1OPIA 5KFRA 5I3QA 2BE2B 3NGUA 4DV5J 2HLUA 5DQHA 3IR5B 4FVCA 3JSRA 1PSDA 3FZBA 4ZPAA 1JJ2R 5IM0A 3EMTA 2IAJB 3OR1B 3HKZD 4PWUA 3Q24A 2F8HA 2OPQB 4HR2A 1SL0A 4O44B 5AE2A 1KTVA 1MMNA 1MW7A 1UVNA 3MPYA 1QE1A 2P5VA 3KKFA 2X51A 2BKNA 2DTJA 2C2RA 1ZTTA 3HP6A 3TYTA 1W26A 4EGLA 4G1IA 2DNOA 2B5JA 3IRWP 1EP4A 1X4FA 5FLXY 4M5GA 5L1JA 3SQGA 4U96A 1X31C 1U1LA 3KUGA 1DBDA 2DVIA 2LU2A 1WG1A 5LMUJ 3AJDA 3MMAB 4YR2A 1ZM3A 2IYGA 1BMQB 4B9VA 3DN9A 5E2QA 4LFBF 3WC2A 1VHIA 1U47A 1Z1ZA 4ES2A 3UDCA 4OMFG 1YI2S 4JI4F 4JI7F 1FO1A 2HWTA 3EDQB 2R3VA 2VG6A 3KNAA 2I2YA 5CYMB 2BQRA 2W24A 1AUSL 1EB0A 4IR9A 2R8KA 4DR2J 3JQMA 3DXBA 1GAOA 5F3TA 2A10A 4PWDB 4DHVA 2VF3A 1RT2B 4AL5A 2R7OA 2V68A 4GC7A 2WTFA 4ZVPB 1X4DA 1RTIA 1JJHA 3RB6A 3L7PA 1GMWA 1VQ8S 1UVIA 2ZUAA 1YBTA 2QA1A 1YJUA 4PQUA 5EWEA 1S6QB 4B3MF 2KM8B 4HHHA 1VQKS 3ET6A 2CVIA 1V5VA 2BDPA 5THWA 2WW8A 2OSRA 3OFFA 4B9UA 4F4YA 5FLXU 4P72A 2V4QA 1RT7B 1UAWA 3BDPA 3TUIC 2EK1A 4P2SA 1S72S 2EI5A 4YB5A 2FZCB 3HSJA 2DGWA 4ZOSA 3OT9A 1Y3JA 1RBAA 5DETA 5B7WA 4YHHF 1XC9A 4AL7A 1FTCA 1S77D 1QD1A 3GJRB 2XMKA 3C14A 2K7JA 3NGTA 2HVEA 1H2TZ 1PAUB 5KFGA 2ABYA 1GFWB 1MROA 1I94J 5KT7A 2ZKTA 3TVZA 3CJ5A 3CDEA 3KK2B 3MXHP 5IC6B 4IOAQ 2ZOFA 4RW9B 2MQ8A 2SXLA 4H4MB 2CZ4A 4PRFA 5KFQA 2O3DA 4JI8J 4ED3A 1KFSA 2R2UA 1UFKA 4ELTA 2EFNA 3N9UC 1JWWA 4QYZK 1T0TV 3SEOA 2YNHB 2OD6A 1N36J 1RYRA 4I2QB 5DM6Q 2ZDPA 3MMBB 1AZSB 3KJNB 4FPRA 5KFZA 1P8GA 1MU2A 5DLGA 5HATA 4NZ6A 3CCZA 3U1LA 2ROPA 1S1XB 2XZWA 4YB6A 2CWXA 2KN4A 1FA0A 2RF2A 2B6AA 5HVGA 5HJYA 3A3NB 4R0EA 1BQMA 1U7LA 3PFOA 1WC5A 1ZAXA 4JV5F 2AD9A 3WDOA 4I4BA 5L9XA 1R0AA 3TA2A 3CCQS 4U7UD 2XS5A 5KFLA 3EZ5A 4A8YA 3DGPA 1VQNS 1AUDA 2B8QA 3BR8A 4LSLB 1TK0A 3FBFA 1UCNA 4DPUA 3QRQA 2K8GA 3M4XA 2AJ1A 4URGA 4IO9Q 4QBUA 2FJXA 1RHRB 2Z57B 3PEHA 3IBFB 4WZMA 5IC4B 3SMZA 1H0HB 3I56S 1FXRA 4LMZA 4ECYA 4ILLA 3QLHA 2UXBF 2AEMA 2DPIA 3P3DA 3FCHA 3E8OA 3CD0A 2KFNA 2J9DA 2Z8QA 1Y5LB 4I64A 4MIBA 1YTYA 1EAYC 4YY3F 4GVBA 2B51A 1DQAA 1U8WA 3CJSA 2BM1A 3AXMA 1T9TA 4XTTA 4KV8A 2ZNZA 2QC3A 2KG1A 3EVOA 2RU9A 4OYBA 4TYBA 4C7QA 4NA3A 3VGTA 3QT5A 2LXFA 4QIWD 2ZFHA 1CS4B 3OFEA 3FRYA 2Z2MA 3UQSA 1RTHA 1DQ9A 3DOKA 5LL6d 2CQ0A 4E8UA 2QMUB 1GXLA 1S7IA 3HSGA 4LFCF 2RUGA 3R5GA 1XMOF 2FHJD 4DU7A 4DCPB 4C6AA 1QJHA 3KLGA 4YMEA 3DRPA 3OVSA 1NDPA 3CIMA 1CJVB 1DAXA 3GJTB 2MDAA 3S01A 2ZZNA 1SIWB 2YKMA 1SC1B 1QSSA 8RUCA 2BM0A 2JOQA 4JI6J 2E1CA 2ROGA 5DDRC 2HGNA 1IJEB 2G0JA 5F41A 3PCOB 1HHTP 4XK8C 2WCXA 4U95A 1LNQA 4AXJA 1SL1A 3G82B 4C8YA 1RBOB 1U0HA 1F3VA 4LSNB 2BRKA 2JHEA 5GADU 3IBWA 3I6PA 3LP2A 2R8HA 3MMCA 3DYAA 4JB8B 1S9GA 3R3TA 3MM8A 5CZXA 2BACA 1TKXB 2OPPB 3BO4A 4RW7A 2PT0A 1U09A 4TY9A 1EHWA 4RW6B 2HVHA 4ED2A 4QWBA 3DLEA 3R9LA 3IM8A 1LW2A 1UWBA 3ETMA 1KLMA 1WKKA 4M5MA 2DGVA 1N5QA 4IO1A 1UEUA 1UTAA 3S1TA 1YWXA 1V3RA 1VK8A 1HQUA 2GVDB 1K9MT 3OHAA 3W60A 4X2BA 1T95A 1JLFB 4UOFA 3ZFVA 1I3OB 2GVZB 1MSWD 1FX2A 2QEXS 5FIIA 5BJRA 4Y00A 4KSEB 1PC4A 2CZ9A 2GCFA 2HFOA 4OI1A 2ZM6F 1Y5NB 1S57A 3HFZB 2R7UA 3CEDA 2W2PP 2IVYA 2NYIA 1RKJA 3I0RB 3UR3C 4F4ZA 2PFFB 3O2IA 5ETKA 3DDKA 1DLOB 2CPXA 2MHEA 1HWLA 1GNKA 1CEZA 2GJ2A 3KLEA 3M8SA 4YUDA 4P75A 4OYOA 3VQSA 3W7BA 5D0GA 4LR9A 3TAMA 1XNRF 1RAIB 5IZHA 2KVIA 2W7PA 4WP8A 4ECZA 3K5NA 2J5AA 3OL7A 4USHA 5F0UA 2IPOB 3D0HE 5B0AA 3K89A 4QWCA 2HRTA 2UU9F 1HNWJ 3FQKA 2AJFE 2XYHB 3BV8A 5FD1A 3L7UA 2J9CA 4H4OB 4DV3J 4WCEQ 2B43A 3NGSA 2GAGC 3LW5C 4IG3B 2E9RX 3UCGA 1F9EB 4ZJLA 5KFBA 1X4CA 3FKBA 2DNYA 4GKKF 3Q8YA 5ETMA 3TAQA 7AT1B 5DGBA 3CDBA 3CB4A 3P45B 4LBIA 3ETOA 2AZ1A 2RAQA 2VASA 4F0MA 1W2BR 3EGZA 4ECXA 3HHLA 2E5HA 2P8IA 1RSCA 3AA9A 2WONB 1RLDA 3DI6A 1R8PA 1WI8A 1BQXA 4X65F 1VDHA 1G6BA 3HO1A 3AXKA 1ZZNA 4RKUC 2G2ZA 5K14B 3AY0A 2O66A 1B4SA 1WEXA 3ILJA 5L38A 4MFBA 4DPOA 4DN0A 1HARA 1VQOS 5M2UA 2BE7D 4C0OC 3M2VB 1U1NA 4OI0A 3OR2B 2DGXA 1F9FA 4E98A 5KTQA 4G1QA 2UXCF 2NUHA 4DEZA 1U1RA 2XSJA 2D9PA 3ILOA 3M32B 2DEIA 4HI2A 2IJNA 5E41A 1F5CA 2EG2A 4NLSA 3G96A 4KE5A 1BLUA 2CADA 1OY6A 4CLTA 1TR0A 4OZ1A 1XQIA 2ILZA 3GILA 1X4HA 4DV1J 1X4BA 4L76A 1RAGB 1QUVA 4LF4J 2YNFB 3AQOA 1S99A 1APSA 1GX6A 2HNDB 5LMNF 2F63A 1CJUA 1IR0A 2O67A 2UUAF 4LF8F 3LH2S 4Y28C 3M9MB 4BBYA 3H90A 1MWQA 4B9TA 4MK8A 4O3OA 2YNIB 3DRXA 2KZZA 4DG1A 2QL5B 3FSYA 1TL3B 2GMHA 3HVRA 1TVRB 2CNKB 3GFYA 3R5DA 4K50A 3GQCA 4ER8A 2IBOA 4X4RA 1KS2A 1Q8IA 4M5DA 3Q8QB 3OL8A 2B4VA 3RW7A 3QT7A 3D1HA 1NSAA 2LU1A 4NXMF 4X64J 2GJIA 2ASDA 5KG3A 4ED7A 5L1LA 1KHVA 3CTRA 4EEYA 2LQ9A 3KHGA 3B4DA 3D3BJ 3CDAA 3HLUA 4YQWA 3ITHB 4ZA1A 4X84A 1N8RT 4XDDA 4OZLA 5T41A 3IAS9 4Y34A 4DV5F
chains in the Genus database with same CATH topology
5GAEU 1S0NA 1SKSA 3SI8A 4LUBA 2KJWA 4Y2IA 1KR4A 1DHMA 2D1CA 3PX6A 3QWUA 4LVNP 5HO4A 1TKTB 4Q45A 5K5MA 2ZH3A 1FRXA 1S1VB 2BANB 3G8TA 3QAEA 1HFEL 3CC4S 3PW7A 2N3OA 1JLGA 2EKYA 1UFLA 1HL6A 3PKYA 2FLNA 1VQPS 5T7LA 4LQ3A 3T5HA 3OVAA 2VFSA 1C4AA 4QOTA 4V19X 2FJVA 2IHR1 5G4DA 3KOAA 1Q8BA 2JWNA 3LO3A 4KO0B 3IR7B 2R8GA 2HHXA 2LDIA 1UEVA 4DS5A 2Q43A 1GQEA 2RE1A 1JLFA 1WF0A 1B0VA 4QWAA 1K1SA 4WU2A 3V4IB 1VQLS 1S48A 2Y1IA 2MQOA 1VRUA 2DISA 3TR5A 3DRSA 3MZIA 2PMZD 5H1SV 2MKSA 2ZBCA 3EPIA 3G4SS 3AB4B 5IQQA 2DCUB 2GMJA 4URQU 5CD4H 3NMAA 3CD5A 3M6XA 3MD1A 1FRHA 3W3SA 2RRAA 4K2XA 5LSOA 1FJCA 1TKZA 2FLLA 3CVKA 4OZ5A 3H2VE 4QIEA 3FGVA 2KH9A 1RT6A 5IS2A 2OPRB 3K57A 1TKDA 2YVSA 3N6MA 4PPDA 2XMJA 3SCJE 2DD8S 4LF9F 2GQ2A 1N5TA 1VRTA 3U02A 6FDRA 3UI3A 2RS8A 2XULA 5D77A 2VH7A 3W2VA 1UVLA 4QU6A 4ETZA 3LPYA 4EYHB 1M5PC 3KYLA 4NCGB 3VZIA 2BRLA 4AXIA 3QGGA 5LMUF 2RVJA 4ETXA 3QGIA 1OQ6A 3B78A 4N47A 2C42A 1M5HA 2EC0A 3KLHA 1WACA 3PX4A 4JYAF 3H5UA 2YX7A 1LXNA 2XLJA 1DLOA 3IFEA 5KOWA 2W8KA 2ROEA 3I4PA 3JSMA 5BYQA 1BQMB 3GZ7A 1S1UA 5HMYA 1H38A 1JXEA 1T94A 3OL9A 3OUYB 4HVZA 2XMWA 2GQCA 3TVKA 1KVJA 3HVTB 1RT4A 4LVOP 1U1QA 3PR5B 5A2QY 3T1HF 3NLCA 4GO5X 2NQPA 3POTA 2DGUA 3JTPA 5CYQA 3V6DB 2GQQA 4TXSA 1JLCA 2CJ9A 4RU2A 5D4LA 1N48A 5EHHA 5J2PA 3IGNA 4ZCLA 1RT2A 2YKAA 4CT8A 3PO4A 3P6YC 4U67Q 4EUVA 4EZ9A 1ZYQA 1WF2A 3GG1A 4EBEA 2E1AA 3PRDA 4DR2F 2F7VA 1A7GE 1YIJS 2I0XA 4B02A 2LXIA 2B3TB 2V2KA 4ED5A 3MDFA 3QIDA 1VQ9S 1SC6A 3ISZA 4MKBA 2CQHA 2CPIA 3VAFA 1KTQA 4H4OA 4ECUA 4EYIB 2AGPA 1D8YA 1IKWB 4EWTA 3MUMP 3HT3A 1HWUA 3NBPA 1K1QA 5J1NA 3DNCA 1FF2A 1HNWF 2HRYA 2IM0A 2KG0A 2VKRA 5D4OA 4IFYB 1HPZA 3CCWA 3V81A 2KHCA 3SV3A 2HQ3A 3ZZOA 3G8SA 4IG3A 1OSDA 2XB2D 2E44A 4XDCA 3IG1B 5J2QA 3QPIA 5IWAF 4Y3CA 2KDOA 2CPHA 4KFBA 4FNIA 4I7FB 4JV1A 2M4MA 1H98A 2YWEA 1TL4A 2ACYA 1KONA 1JLQA 1RT7A 3KG0A 1N6QA 2Q1LA 3VTIA 5AXLA 4ILRA 2NR0A 2CPEA 4EZ6A 3P49B 4GKJF 1T05B 3VAJA 3UCZP 1D1UA 1HNIA 3MEEA 5J2NB 1HQEA 2V8GA 3NL0A 3OTCA 4A8WA 3K5OA 1UETA 1LWFB 1N5YA 1E6VB 1AXQA 3KK1B 5JJBA 5KFPA 1DTTA 3JYTA 2EFGA 3OXGA 4DQIA 2HNYB 5A8RB 5KG6A 2VV5A 3N79A 5AE1A 5EGYA 2LEBA 2GIRA 3NG8A 4KHPF 4JI1F 1S97A 2WONA 2UVRA 4XAKA 3IAM9 3CMAS 1IXKA 3RAXA 3GFZA 4DSKA 3DC2A 3V2UC 1W25A 1G2EA 3DXSX 1PC5A 2HWIA 2QE5A 1K73T 1Q81T 3BN7A 3CJKB 2DNZA 4BC9A 4PUOA 1XR7A 2JRSA 2NSBA 1SJ3P 4DWIA 3HMJG 3E01A 5F8NA 2OMOA 5AXKA 5BYRA 1JB0C 2F9DA 3BS9A 3MEKA 4O3NA 4A8OA 5MAOA 3THVA 3NNCA 1C0TA 1T03A 1FKPB 3IC1A 3IWXA 3MEGA 3NP5A 4KV8B 4WFYA 2L48A 4ID8A 4IR1A 3BDEA 4DR3F 2CDQA 5G0RA 1A6LA 2B7BB 2DHXA 3VQTA 1Y0HA 2D74B 4Z2XA 3RR8A 3MWBA 1D9DA 1FD2A 2FHJA 2VODA 1G3OA 4DV2F 1NKEA 4DMZA 2K3IA 1BD6A 3DM2A 5FDLA 4IG0A 3KK2A 3M8PA 1R7IA 2DIUA 4DV6F 3CC7S 1RWUA 4OJ3A 5KG4A 2LEPA 1LWEB 1JLBB 4FBTA 2KXFA 1SKWA 1WEZA 4H4MA 2PSZA 4K4SA 1I94F 2BA9A 4OHWA 4ECVA 4NPOA 2A18A 1RTHB 1M5KC 5MLCV 2G9OA 2WB4A 2FIUA 3MGJA 2R7XA 3FZ2A 2HMIA 1UVJA 2HHHF 4N8OA 4ED0A 3GWCA 3DOLB 4M95A 2LQJA 4GO7X 2MZQA 1XR5A 1B0PA 5HQ8A 3KMSA 2MZSA 2YH1A 3Q2SC 2M9KA 1JLAA 2RMLA 2A2DA 3HX9A 4WJBA 1RKIA 2DH7A 3GV5B 4DLGA 5D4PA 4IUFA 2KXNB 3E3XA 4TU9A 3NGDA 4JI8F 1K8AT 1PGZA 3LP1B 4O4GA 3BGUA 3MMBA 2N4CA 4FNHA 2R7TA 1RGVA 4LF7F 1O0PA 3DRPB 1RTJB 2B4UA 4PXDA 1SI9A 2HS0A 3Q8SB 1S6PB 3QJJA 4B9MA 3M2UB 2YKQA 2ZHOA 3GIKA 1VIXA 3EGWB 4RBUA 1N36F 4OX9F 4CQ1A 2B56A 3G9CA 1T3OA 2MZJA 2ZOGA 3VCDA 2ZH2A 2YKMB 2PIIA 4WFBQ 1S10A 2JZ5A 3H8YA 4ZCMA 5IQ6A 2YNFA 3P96A 3M05A 1URNA 1C1BA 2DCLA 2WOMB 3G6XA 1YVFA 2VUGA 1ZZFA 3ISNC 3NWGA 1KC8T 2DNLA 5L1KA 5F8JA 1NH8A 3RB0A 1SUQA 2MGZA 2DNHA 2E1MC 4BHQA 2Z2LA 5HLFB 2I1RA 3H5SA 4MJKA 2CQ4A 2XY6A 1YJRA 2PD1A 2M88A 5HL7Q 2JLGA 4CH7A 3OW2R 1HI1A 4MYTA 3DMJA 2JFKA 5J1PA 4PR6A 2G0CA 5B0DA 5KG5A 2R7SA 5EWFA 3PIOQ 2J7WA 1VIOA 3RU0A 4KR0B 1G1XA 2HHSA 1KD1T 1R27B 2BJDA 3N5BA 4XIUA 3UWTA 1OQ3A 1IN0A 3RRKA 2BQUA 3PJWA 3KJVA 3BJYA 1GXUA 1N5VA 3I82A 4QW8A 5F8MA 4F8RA 2R9LA 1HNVA 1JLEB 1TL3A 4RBVA 5DG8A 1HI8A 1TVRA 4PPZA 1DZ5A 3MMCB 4Q0BB 2XI3A 1S1TA 4NCBA 3MM9A 5KFSA 3DLKA 3I32A 4UW2A 3MM8B 1HNZF 5EUHA 2DRAA 1XN9A 3CGIA 1VC5A 1OO0B 1NK4A 2E5JA 2EBGA 4IQMA 4TLQA 5LXRA 4XO0A 5DLFA 2IMOA 3I5AA 3N5FA 1KQFB 3PR4A 4FS2A 4DFKA 1NK8A 1U1KA 4DQSA 4QYRA 3U27A 4DN9A 3FRZA 4OHVA 5E3CA 4LSLA 2DH8A 3KHLA 4ERDA 1B7FA 1IKVB 1JJ4A 4FXDA 2Q3PA 3OL6A 3SZ2A 4F3MA 3BB5A 5GADI 2L3MA 1X7VA 1Y7PA 3DLEB 5HROB 5EWGA 1S0OA 4F50A 2XMUA 5BYSA 4ECQA 4FS1A 4C4WA 4O3RA 1DRZA 4O0IA 1LW2B 1TP7A 2JH3A 1Q79A 2GFFA 1X9SA 4NRUA 4W90B 3EYZA 1SH3A 2MXYA 2OP5A 4JOUA 4RU9A 3VR1A 3HDSA 4KPYA 3JTOA 4YFUA 2E5IA 1QE1B 2LDYA 3QZ7A 5F8LA 2VC1A 4NRTA 2R7RA 1ZM2A 3K7RA 1ZETA 2HVZA 2OIHA 5L9NA 1FE0A 5KG1A 4C3MA 1HHSA 3CCES 3QMQA 6FD1A 2JLFA 4OHYA 2FDNA 1CC8A 1UL3A 2MQLA 5B0CA 4CZCA 4WU3A 3D28A 3VF0B 3OTEA 4NX9A 2CZVC 2KI2A 4RNFA 2EFOA 2AF6A 1SH2A 2B5JB 2K2PA 4DL5A 3NCRA 1NU4A 2OSQA 2PI4A 2J0SD 4B3OB 4QR2A 5B08A 2XCAA 3CCUS 1TAUA 4R8UB 1VBXA 2QYCA 1FRJA 1HYSB 2JVRA 3ITHA 1RISA 4X64F 2NREA 1EP4B 1X4EA 3BGFA 2P9EA 1TQLA 4J37A 4Y2KA 3UW1A 4C97A 2ASJA 5K8MA 4NZ7A 3SQGB 3KTQA 3OBIA 2VB6A 2ZE2A 3ENWA 3M1VA 3KFWX 4KGKA 4ZHRB 2RQCA 1R8HA 4DLEA 1HMVB 4DUZF 2VL1A 3QZ8A 4W92B 4MKYA 3C6TA 3B82A 4B17A 1V6HA 1RDRA 5C42B 4TNOA 1S9EA 2CPZA 5E3QA 1UJ4A 3OSPA 2N4DA 1VHFA 3CULA 3KLFA 1QAYA 2RQ4A 2QLXA 3SCLE 1NKCA 5BR8F 4Q2MA 2B9YA 1HWJA 3LP0B 5CXTA 2YWGA 3HFKA 3MFIA 1N56A 1S1VA 2BANA 4I6AA 4DS4A 1P27B 1YJTA 2LA4A 2AP6A 4N76A 1RA7A 2QLWA 1D8ZA 1W2IA 4F2SA 2B4PA 4BWMA 5KFCA 3R1LA 3HHKA 5FJ4A 2HNZB 4IOBA 1RT5A 2DGQA 1FXDA 1Y9OA 4C0BA 3KG1A 1GT8A 2GMLA 2KFYA 2Q6CA 1JNRB 2DNGA 3CUNA 2QFJA 4IFVB 4DL0C 4Y65A 2ZJRQ 4A8FA 3D1QA 4KGMA 1U45A 4Q2LA 3HVWA 1WNEA 5H9EJ 2VG6B 4YDDB 1AFIA 2VKZG 3D54A 2HLTA 2CPYA 5GAGU 2ZH1A 4A8KA 1VQ6S 4MK7A 1FDBA 1OWXA 2VBXA 1R31A 4WIIA 4I6YA 4CI0B 4UQGA 1HBNB 3U1NA 1ZPVA 2J6UA 2A1BA 4IYQA 4KB7A 3CCJS 1P1LA 4KRWA 3SXLA 2OPRA 3CDWA 2QMXA 4J9KA 2IC3B 4NA1A 4CO1A 2IFXA 2BV3A 4NLVA 1O5JA 4QQBA 2VD3A 2NPFA 1U8SA 3RRGA 2RDIA 2OPSB 2IM3A 4DQRA 1NJZA 4WZQA 2UUWA 5KFKA 1IKYA 4ILMA 4ID5A 4UUWA 2X1GA 3EUNA 3TRGA 2N7CA 2XY5A 4NLRA 4DSEA 1RK8A 3NCQA 3DLJA 1X9WA 3KNGA 1FK9B 5K8PA 3BQ2A 4QYZJ 5KFOA 3BZQA 3PKMA 3IGVA 1Q4RA 3K2YA 1FE4A 1VFJA 2M3DA 4J9SA 3J7YU 2RKIB 4OI6A 2DR8A 2XLKA 5ADZA 1U6ZA 4PQUB 4WTYA 3A1YG 2FVRA 4WXWA 3HZEA 4WYWA 4WFAQ 2RDJA 3CCMS 4EBDA 1Q78A 1J5OA 4NMLA 2M0GB 5KFNA 4OX8A 3IS9A 3OUYA 4HKQA 1C0UB 1IJFB 3TI0A 3OSNA 2LECA 3HVTA 1LK5A 2WAQD 1Q86T 4DR4F 3TX8A 4RNHA 1FD8A 1WWHA 2E9TA 2E29A 2VQEF 4OHZA 1U4BA 2NLWA 3GFHA 1EETA 1QAXA 1HBMB 1M90T 2W25A 2BABA 4HH0A 3THPA 2VPYB 4EFAC 1RT1B 3BQ0A 1HNXF 2GO9A 3V6DA 5I42B 4F3OA 1HD0A 4MYUA 2W7AA 4IRKA 1ZBTA 4AL6A 2HGMA 4RUHA 2DIVA 1C1CB 4ZKAA 5C5JA 4AQYF 1IBMF 3HKWA 3MOZA 2L08A 4I6WA 1L3KA 3D0IE 4RLEA 3TVYA 5KT6A 4JI6F 2MB0B 2DH9A 2HHVA 3FMBA 1ELOA 1SQEA 5KFDA 3T5KA 4OI2A 2ADBA 4FF3A 3GIJA 4WFXA 3LAMA 5KFVA 1FNMA 3D1OA 4HT5A 1U25A 2E7XA 2B9WA 3PDNA 3DHXA 4ZK7M 2QZ8A 1NK7A 2I38A 4DSIA 2AYBA 1X5OA 4DOZA 5F8GA 1IKWA 3T9ZA 3PVXA 1OPZA 2C22A 2F8EX 3CJ4A 1N4LA 2BR0A 3SSQA 2XGQA 1P9QC 1RAJA 4IFYA 2JEGA 2CIMA 5DRKA 4H4KA 4I2PA 3SCKE 2JVOA 4ITSA 1WHYA 2DR9A 2HZCA 2ASLA 4JI3F 2Q66A 1UMJA 3IG1A 2YKOA 3OXFA 4MKAA 4F4XA 4OJ1A 3T1YF 2PA3A 2FUG9 5D4NA 3PJXA 1KN6A 3H2LA 4I7FA 4ED8A 1QUPA 2ZH9A 4JI0F 2R2RA 2D41A 4RW6A 3IR6B 3OLBA 4OZJA 4EU0A 2CPJA 3DHWC 3CDUA 3DRRB 2MSTA 1T05A 4JI5F 3LWLA 1VQ4S 2FHOB 5KT2A 3THTA 5KFUA 1ZTWA 3MUTP 1MROB 3LGNA 3SSRA 5IT4A 3ZZUA 1E6YB 3ZZRA 5K8NA 2W9CB 3K8VA 2VZ9A 3H4DA 1LWFA 1E6VA 2I9SA 3KK1A 4ZDNA 2W4CA 5GVQA 3PNIA 3BM7A 1O8BA 5AXNA 2OO4A 3BREA 3SSSA 3PV8A 1FEHA 4RW4B 2M7SA 2F8MA 5A8RA 5L8RC 1NJWA 2HFNA 4N56A 2FTRA 2HS4A 3GYNA 1FRIA 2AJQA 2DGSA 5KFMA 2KM8C 1VQ5S 3S6EA 4J9PA 2GV1A 2OMLA 3EXYA 3E51A 3MCSA 4TU7A 2MKIA 3DOMA 3KK3B 1NHUA 4KHRA 3M8QB 2VQFF 1HI0P 4OI4A 2R8JA 2J9DE 5GMKa 2FLOA 2R4FA 4J9QA 3Q2TC 3KLIB 5EX3A 5A0YB 3BSAA 4F4WA 2GO8A 2LCWA 1U1OA 5E0OA 2CQ3A 1XERA 4YB1P 2PA8D 3G6YA 1WTBA 2DHSA 3SYZA 3KMQA 2MY7A 1FKPA 5B0GA 4NLOA 1I6JA 1LFPA 4G3IA 1RP5A 4M94A