4LFBF

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
b'MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lfbF00
2F4VF 1FKAF 2KJWA 1HNXF 2UU9F 4KHPF 4B3SF 1HR0F 3T1HF 4LF9F 4B3MF 1B64A 4LFBF 1CQNA 4B3RF 4JI7F 1IJEB 1VMBA 5LMNF 4DR3F 1FJGF 4DV4F 2YY3A 4LF4F 4DV1F 1F60B 4LFAF 3ZZPA 1XMOF 2UXBF 2B7CB 4JYAF 4JI8F 4B3TF 1IBKF 4JI1F 4X62F 4JI5F 4DV7F 2HHHF 1IBLF 4NXMF 1IBMF 4DR6F 1XMQF 4JI3F 1RISA 1LOUA 4LF8F 3T1YF 1I94F 4K0KF 1XNQF 4YY3F 2BVZA 4DV2F 5BR8F 2VQFF 2KJVA 4JI4F 1XNRF 2UUAF 4X64F 4YHHF 4DR1F 5LMUF 4DUYF 1N34F 2J5AA 1CQMA 4DV6F 2VQEF 4GKJF 2E5LF 4X65F 4LFCF 3OTOF 4LF5F 2UXDF 2B7BB 4DR7F 4DV0F 2ZM6F 2UXCF 4DR5F 4X66F 1GH8A 4LF6F 4JI2F 4NXNF 1N32F 2BXJA 1N33F 4OX9F 4DR4F 1G1XA 1IJFB 4DUZF 4JI6F 4DV3F 2RJZA 1HNWF 5AJ3F 2UUBF 4DV5F 4GKKF 4DR2F 4AQYF 1QJHA 1HNZF 4LF7F 2UUCF 5IWAF 1G7CB 3R3TA 1J5EF 1N36F 4JV5F 4JI0F
chains in the Genus database with same CATH superfamily
5B08A 2E1AA 3DHWC 4B3SF 4U8YA 2L08A 4QWEA 3DRSB 3G6YA 2W1BA 2QEXS 4IG3A 5K5MA 1OYEA 4DX6A 4DV4F 3V2UC 4KV8A 1PSDA 2UXBF 2QFIA 1S6PB 1FKOB 4Z2XA 2MZSA 5KFKA 4OJGA 3PFOA 1UFLA 5DDPC 4ZVFA 3W9IA 1U6BA 5L46A 1LOUA 4DCOB 3E3XA 4ECZA 3O44A 4A8XA 3FMBA 3D6HB 3MF5A 1QE1A 3C19A 2OMLA 3CTRA 2VC0A 2FVPA 1T11A 3TZXA 3P45B 1YIJS 2BJ9A 5KFUA 3TI0A 1TP7A 2RUSA 1TL5A 2FHJA 3TJ8A 2N4CA 2KTQA 3DXBA 2XBPA 2ZUAA 3PFEA 3T9ZA 2HHVA 4DSIA 4J9VA 3FEXB 1U1OA 1UAWA 2W9AA 1HNZJ 2PGCA 4P71A 1RHMB 4PPDA 3UCGA 4LF9F 3QGPA 4PWUA 4XO0A 1XQIA 4DFJA 2FJBB 4OYAA 1Q53A 1JXLA 3QJJA 5C2GA 2B7CB 4MK9A 1T02A 4IH5A 2KFNA 4ITSA 1N48A 3JSMB 3SQGB 4F4WA 4QIWD 3K5PA 3MM7A 4URQU 2VOOA 3ZZYA 2BX6A 1J5OA 2HHHJ 1S4EA 1S1UB 4Q2LA 1N0VC 4WXOA 1FXDA 5GMKa 4X64J 1WC0A 2X3DA 4PPZA 4LJMA 3LGHA 4Y28C 4Y2IA 5JMNA 3BBBA 4JI2F 4RUBA 5IT9U 3P5BP 2BE9B 1ZH5A 3JSYA 4P2FA 1TQLA 4R0EA 3TX8A 3K59A 2ZNZA 1HIYA 2Q3PA 5HLFA 4DXLA 2AWZA 1B0VA 5FJ4A 2HFOA 5CAAA 1Q8LA 2AX0A 4Y2MA 3AA8A 1RHJB 2W25A 3KUGA 2L9WA 2MKCA 1HNXF 4WFAQ 3IA0A 4YN3B 3U1MA 2YWFA 4LQ9A 1HWKA 2OPPA 2F4VJ 3W60A 4AD6A 3DNCA 4NLGA 1NK8A 2JDJA 3CJ5A 1NJWA 2IC3A 4QWCA 5HP1B 3CWJA 4OLPA 2AF6A 1WC4A 1F5AA 3KJFB 1ZS6A 4X4OA 1TKZB 5A8KA 1K0TA 4A8YA 4H4KC 2BKNA 3MEEB 2GQQA 1WHVA 3N6NA 1N4LA 2GJFA 1U2RA 3PW4A 2CQDA 3M8QA 4ED8A 2KXNB 4NCBA 2MHNA 2Q6BA 2DH8A 3OR1B 3W5ZA 4UW2A 2JEIA 3AD8C 1S1TB 2B9EA 3UNGC 2YKPA 2ACYA 1JJCB 1VQ7S 4QR2A 5DS7A 2RQMA 3KOAA 5KFRA 1G7CB 4WFBQ 3M9NB 2RDJA 2EK1A 3HD2A 6FD1A 3NGDA 4ZVRB 3H25A 2IBKA 1KP6A 1D9AA 1SL0A 1UA0A 2B6AA 2VG7A 1VC0A 1YJWS 2UVUA 4HTJA 4B3TF 4QQBA 5E3RA 4EO6A 3QSYB 3PYDA 1HLWA 2XS2A 3DLBA 3IAS9 1U1RA 4LSLA 2HBZB 4OZLA 1F1BB 1RKIA 3DDIA 5JXSA 4H4MB 3GE9A 3TEGA 2HYIB 1E6YA 4F4ZA 1CLFA 3EMTA 1RWMB 4I1TA 3EZ5A 1S6UA 2QLJB 5F8HA 2AYBA 2C1EB 2BBEA 1GXUA 2F40A 2IM2A 5A0YA 3G87A 2ZH2A 4GKJJ 4OQJA 3ZZTA 1IN0A 2HSEB 1VK8A 4DV0J 2XYHB 2J7WA 3DGPB 2DY9A 2NLWA 2O3DA 1RWNB 3I9ZA 2W9BA 1VK3A 1KR4A 2BRKA 2GAHC 4ZA1A 3N9UC 4TLQA 3TQ1A 2UUCJ 2CA9A 1J5EJ 1NK0A 1T9TA 1VQKS 3DRPA 3IBWA 1V9OA 1DBDA 3PJXA 6FDRA 2EFQA 2KI2A 1FI4A 4X4VA 3EGWB 4N77A 2OD6A 2AYGA 5KT5A 1D8ZA 1B7YB 4PR6A 1SKRA 4O3OA 2BE2A 4ZMMA 4IRCA 2RHSB 3HXMA 1YJ7A 3KHGA 5HMZA 1DARA 3W61A 2QFJA 5BR8F 4OYMA 5F3ZA 3M8RA 2QIFA 1S1VB 1N34F 4ZIWA 1SH3A 4USJC 4C4WA 4OHVA 3VALA 3OVBA 5CD4A 1U0SA 3GV8B 2F65A 4PWWA 3MEKA 3QMQA 2HIQA 2MB0B 2FY1A 1R27B 2BW7A 3BGRB 3GJRB 3LP2A 3A1YG 2YH0A 2XGQA 3C2PA 1R43A 2DR6A 3W7BA 1H0HB 1NJZA 3R1LA 1PIEA 3JTOA 2Q6CA 3BSOA 4NYOA 1NUEA 4QW9A 2DR7A 3OVSA 3HKWA 4DZ6A 2ZJRQ 2FPHX 4PCQA 2MQOA 3C15A 4FVCA 5HL7Q 4QWBA 1AB8A 4DBQA 1NJYA 3M2UA 1N8RT 3JTPA 3SSRA 3FDSA 2OPSA 1UWBA 2K3KA 3POTA 1NK4A 1ULRA 1XEZA 4DQSA 1N5VA 1IKWB 3NGUA 3P49B 4I56A 2CAJA 4DV1J 2B9XA 5J2QB 3UDVA 2PEHA 1U7LA 2WRMA 2FTRA 3KXDA 2FLLA 1Q82T 1T3OA 4NLTA 2GVDB 3JAMY 1WOPA 4ES3A 3SIPB 5KFZA 4LIWA 5HBMA 2VQFJ 5B0DA 2K2PA 3PTWA 5KFVA 2AT1B 2RNEA 2CPDA 4TQSA 1UJ4A 2V6AA 2OP5A 1M1GA 2HVEA 4DLEA 2BANB 4MIBA 1HBNB 2NSCA 2A2CA 4USWA 2WONB 3TUPA 3BS9A 4Y34A 4LF9J 1HWUA 3JQMA 3KNAA 1UFWA 1VLYA 4MKAA 1APSA 3IXQA 4TYAA 4RUAA 2V2KA 1HNVA 1BE4A 4QOTA 3QFHA 3MWBA 1OSDA 3T1AA 2LCWA 3UN5A 4I68A 4XK8C 2MHEA 2A10A 4DJBA 2VKZG 1T8EA 2DGWA 2I1RA 1I3OB 4P72A 3F56A 1IBMF 1VRUB 1O51A 2D3O1 1FJEB 1NH8A 3AJ2A 3DYAB 4KKOA 4OFZA 1VRTA 4C8NA 4RU2A 4EBEA 1UKUA 4HDGA 2N82B 4DL7A 4FYVB 1DTQB 1LFWA 2VFVA 2O5DA 2XC9A 2LXFA 1UA1A 3OTOJ 1H2VZ 1NBEB 2EK6A 1D1UA 4U95A 2PMZD 2ASYA 4C48A 4OI4A 1HNXJ 5CYMA 3IBFB 2VG5B 3WC0A 1GK8A 3MHYA 4C8ZA 5G0RB 4JI6J 3DLGB 4CLZA 2XM3A 2JH3A 1VBZA 3CPWR 4MKVA 1RAIB 5KFOA 2HBRB 2KKHA 3KLFB 1KVIA 3C6TB 4B9VA 4ZP6A 4O3RA 5ETPA 3CJ8A 2Y3YA 1IKVB 1LWFA 4WPAA 2EBEA 1UZHA 2O67A 2C3OA 2XZTB 1I94F 2J0XA 2YKAA 2RIJA 3A12A 3GONA 1HBMB 1XNRF 3FC9A 3MEGB 5HQMA 3RGIA 3KLHA 3HHEA 2GIFA 2R8IA 3HVWA 1Q1KA 2JVOA 1JLQA 4KGZB 4PKDB 4I2PA 2R3VA 3HZEA 4YS2A 1RWVB 4DQQA 4F0MA 3NCQA 3FBFA 3Q8YA 3MUVP 4U96A 1BQNA 5CXTA 3KDOA 4AQYF 3OTCA 4DSEA 3I5BA 1XTZA 1YZ7A 5KFWA 2KJWA 4HHJA 1TUGB 4LF7J 2IM1A 1M5VC 2LQ5A 1ZM3A 4ILMA 3CCWA 1K73T 2Y8WA 3SCKE 5ETOA 2HVHA 3HHLA 4N7TA 1KQFB 4YUDA 4U67Q 5GAHI 4FKXA 4GC6A 3C16A 2CZVC 4PWDA 3KLVA 2ZEJA 3KWMA 2BDPA 3GSDA 3A3PB 3CCRS 1X4GA 3D54A 3KK1A 3OUYA 1RLCL 4CLLA 4FKYA 2EFOA 2DR5A 3KHHA 4Y0FA 1S79A 3VZHA 5B0GA 2ADCA 4ZVUB 2FVQA 2CUYA 1IKXA 2BJ7A 5C24A 1LK7A 3TZYA 4YHHJ 5HI7A 3H5UA 3MURP 3UDEA 4ES2A 3KDNA 3M8PB 4ED1A 2LA4A 4QR1A 2ZZMA 3FBEA 1TVRA 4OIXA 4DR7J 1WC5A 4ED3A 1U6ZA 4IDKA 1YG0A 2HNDA 4ATNA 2AJ1A 3MMCB 1HYSA 4DL0C 4RNFA 1T9UA 1JLEB 3T19A 2W24A 3R7SB 4CT9A 1WWHA 3MMJA 4RBTA 2N7YA 2NUHA 3TVYA 3RB0A 3PVXA 3T1HJ 3S8SA 4K4TA 5L9NA 1FEHA 1EQMA 2KVIA 5J1NA 3TQEA 2R2SA 1WC6A 2Q1LA 1RA7A 3FSYA 3GYXB 3EPGA 1BXNA 1CEZA 3I96A 1R8HA 1DHMA 1U1PA 3CO0P 2OTLS 3BSAA 4BC9A 3EXYA 3CMES 2QLBB 3U02A 4NWBA 2LECA 1U8SA 4GC7A 3I0RA 3MFHA 2DGSA 3T5JA 2XMWA 2RRNA 5F8MA 1U09A 2FY8A 1P8GA 3KLEB 3I55S 2ZM6J 1VQPS 2FVSA 2B5JA 4QU7A 2D9PA 4GKKF 1IR2A 2V2VA 4PUOA 2OTJS 3IWNC 2G2OA 5LM7E 2NXJA 4ENOA 4USUA 2AV5A 5EDWA 2BRLA 1X5PA 3D1QA 2QX0A 1BY9A 3TWZA 2ILZA 4FYWB 3J7Z5 4JI5F 1ZAXA 3UDLA 3PW5A 3G4SS 5F8JA 4Q44A 3MECA 1O6XA 3N6MA 3TZWA 2IHR1 2OEJA 4MYTA 3SSQA 4GVBB 2DCUB 3D3CJ 2ZDOA 2ZHAA 2UUAF 1TL3A 4OYWA 4NMLA 3M32B 2DNNA 2MKKA 2GMHA 1OIAA 1X9MA 2V69A 2E7VA 4A48A 2EKNA 2L9NA 2FHJD 1SCJB 2H3EB 3V6DA 3MR5A 2DGOA 2W2QP 1HNWF 4OZ1A 1YWXA 2OGUA 4Y65A 4ZIVA 3GP9A 4KQZA 1XC9A 2MQLA 4UF4A 4BLGA 1S6OA 1RYSA 1MLAA 4MIWA 2CQ2A 2HLUA 1WHYA 3K8WA 1RBOB 2WSCC 2EC0A 4J9RA 1BGXT 4HI1A 3PY8A 1C1CB 5IV4A 3D2WA 1IBKF 1YZ6A 2VPXB 2O66A 1K1QA 1C4CA 4HI2A 1RWWB 5D4LA 2VFSA 4CWBA 4X62J 2IJRA 4CO0A 2DPJA 1QD1A 1TKTA 4DV7J 5D78A 4YOEA 1OJ4A 3NS5A 2OEKA 3EYZA 3DDNA 1BHNA 3B8HA 4ZHRA 5C25B 3QGGA 5HATA 5KFEA 1RKJA 5HVHA 1LWEA 1RTJA 1RE1B 4RPFA 1KWMA 3H5XA 3AOBA 3DM2A 5D0RA 4ZVTB 2OPRB 2E9TA 1KDNA 1IJFB 5AT1B 1N32J 1S1XB 4OHYA 4QCLA 3M8YA 1TK0A 5HMXA 2CQHA 4MFBB 3ETOA 2D41A 2IPOB 2HMIA 5K8PA 1HI8A 4H4OB 4RWWA 3VZIA 2MZJA 2VF3A 3GIIA 3RR8A 1OPZA 4R0JA 3AD9C 2ZVIA 2FZGB 1LWCB 4DR3J 1I94J 1TFWA 4R25A 2ZJQQ 1GNKA 3RAQA 2VG6B 3K0JA 5T7LA 4ZVHA 2MY7A 1SUQB 3HFZB 3IC1A 1UJ6A 2KO1A 2CDRB 3K89A 1VRQC 3WX4A 2DHGA 2DJWA 1SKSA 2HWHA 4W92B 2Q66A 3I31A 1REVB 5HANA 2DNYA 2AD9A 1HI0P 3MPDA 1W25A 2LQBA 3M4XA 2IMWP 1F6TA 5KG5A 3M9OB 2BR0A 2LQ9A 2XMJA 4NLVA 3DLEA 2HNYA 2YH1A 8ATCB 2NYIA 1ZOTA 1NHKL 2Y1RI 4RUCA 2MKHA 4HHUA 3ISND 1LW2A 3D9BA 1GQEA 1CJUB 5KFFA 3OL7A 3CO9A 3V5RA 3K58A 2X1GA 3NP5A 2YX4A 3G2XA 5HJYA 4QWDA 1WTFA 3BYRA 4ZP7A 4W90B 5F0WA 1QDUB 1HBOA 4B3MJ 1G4CA 3OL8A 1S59A 2DB1A 3CE8A 2MKSA 1FESA 1VJQA 2QYCA 5LXRA 4YEAA 4FF2A 2V4RA 3DRSA 2HRUA 2CPJA 3DI6B 4HHHA 2CPXA 2G4BA 3ULHA 3R2DJ 2RD5C 4FVMA 4LR7A 2E5HA 1Q0NA 1IQZA 1RAJA 3CB4A 3LP1B 1S6PA 1UW9A 1AUSL 3GLJA 1U49A 4USMA 3O2IA 2WCXA 3WX8A 3HSZA 4KGMA 4AL7A 3HPOA 3GG1A 2OFHX 2YNGB 2C2OB 2CWKA 5ITHA 4EEYA 2R2UA 3PZPA 4LUBA 2R8HA 1F5BA 1S1WB 4I67A 3HMJG 1SQEA 1WKJA 1F9FA 1ACMB 2PFFB 2V5HG 1N54B 2Z58B 2MQNA 4GO7X 2DHAA 4KIAA 5DQGA 3R6LB 1MWZA 4ZK7M 4JI1F 2MSTA 1RT1B 1NPRA 2J9DA 2OAUA 3GIMA 4KJIA 3H2UB 3R97A 3QATA 3A8JA 5K14B 4PXEA 3IN5A 4WYLA 2XMTA 1FERA 4K4UA 3P8BB 2M70A 3HD1A 2R7TA 1U2FA 2XY6A 2AGPA 2GIQA 2WSEC 4OX8A 5KG7A 3ENQA 2MY8A 2J7KA 1H98A 3JSMA 3SQGA 2DXDA 1RTDB 2XMUA 3SFGA 1QAYA 3QT5A 1Y9OA 5K8NA 4DX8H 3A8EA 2GAGC 5LT5A 2BABA 4ZP9A 2AZ3A 3ILJA 2PFDA 2G0IA 4X66J 3UN2A 1S1UA 4NXNJ 4DN0A 4QIGA 4QYZJ 2Y8YA 1KFDA 5GADI 1RAOA 2HS0A 1W2BR 5AJ3J 3QIPB 4L6V3 1I5OB 4WU2A 1KHWA 3PW7A 2ZE2B 3EVOA 1S77D 5GVQA 3FUYA 4B9MA 1BC6A 2X1BA 2PEBA 2LQJA 2CXEA 2GQ2A 3PHEA 3DXSX 2HQFA 1XMBA 1TV6B 2RHQB 4K4YA 1NDCA 4OYXA 3BGUA 3QGHA 4J9UE 4KO0B 2AKWB 1X31C 3K17A 3TUJC 3UDCA 3TNVA 3DOMB 1LXJA 5LMUF 4E0DA 5I42B 2ALZA 5HP1A 4F2RA 3TAMB 2P9GA 4DL6A 2AJQA 4CYUB 1B99A 2DT9A 3NOGA 4JB8B 2CNNB 2PMHA 2QMWA 2EC2A 2ZH5A 2GHWA 4AFFA 1TKZA 1RT2B 4RKUC 1Q86T 4A8WA 2I38A 1ZYQA 3UR0A 5JVHQ 3MEEA 4KPYA 4L76A 3AFGA 4A47A 4J9NA 4TN2A 2LEAA 4Q7AA 3TW0A 3R5CA 4O3PA 4DI6A 4DL3A 3OR1A 1VFJA 2WVEA 1S1TA 2VV5A 3SCJE 2CQIA 4X4NA 5KFBA 1U4BA 4IYQA 1KONA 3FJ2A 3OTBA 1HPZB 5JVGQ 4RO0A 3IM9A 2CADA 4JI8J 2GIRA 2R2RA 3QGIA 4NI2B 5DLFA 1MN7A 1PAUB 1Z1ZA 2H5EA 4KSEB 2GVZB 3G6VA 3E51A 3R9LA 4Q5VA 2MJNA 1QAXA 4G1QB 4LF8J 2F8HA 2W4PA 2E9ZA 2V8GA 1FK9B 5A76A 1NK9A 5I3UB 1A6LA 2AEFA 5EX0A 2DNOA 2J8SA 5HQ8A 4HH1A 1H7WA 1MSWD 4H4MA 1M0SA 8AT1B 3ITHB 3R5DA 4RNHA 2VL1A 5B0BA 4FYXB 2M88A 2HRTA 2ROPA 1T95A 2MYFA 3QT7A 2FJVA 4X4TA 1VQ6S 4R8UB 1S10A 1B64A 3IG1B 3DGPA 2AYEA 1NAQA 1WOOA 1HHSA 2ROEA 5J2NB 4CLPA 1U6FA 4EK2A 4DCJB 4LMZA 3KTQA 3IR7B 1KC8T 1HD1A 5IZHA 1NLKL 5CZXA 2AJFE 3QYYA 2DHSA 1UVMA 1NB2A 4Y2CA 2Q79A 3G8QA 4EO8A 4G65A 3HHKA 1FTCA 3GV7B 1KLMB 3MI7X 4EU0A 4DQPA 3NMRA 4EBDA 2XQCA 4ID8A 2UXCF 4ZCLA 3G8TA 3LO3A 5EWGA 4F2SA 5HSPA 3DHXA 3CD7A 1TL7B 1JLCB 3GR0A 3WBZA 2RT3A 1GT8A 1S1VA 1SI9A 2IVYA 4NOHA 4DFPA 3IAM9 1U25A 4KY3A 5LSOA 4JUZA 1Y10A 1AXQA 1KKHA 3CC4S 5HROB 4B3RF 4UOGA 1VCTA 1JLAB 2YQ3A 3V6HA 4LF4F 1IM6A 3HHLD 2RRBA 2XZDB 2B3TB 3FBBA 1L3VA 4Y2KA 1ZM4A 2QN6B 3MM9B 4ANCA 1H74A 4NCAA 2A6OA 3X3UA 1EKRA 4F3OA 2BW2A 2G1HA 4KH1B 1WKLA 3FFIB 1IKWA 2UXDF 2QT7A 2XEXA 1B70B 1SV5B 5J2QA 3CMAS 3C66A 1X4DA 1IBCB 1VQ5S 5DG7A 4IFVB 3CD5A 3RYLA 2H9ZA 2CQCA 2FLPA 4AXIA 3IRWP 2GVDA 1WD6A 2ATLA 2EW9A 2EFNA 3LA0A 1RT6B 2KN4A 2XO6A 4Q45A 3H59A 2H65B 3TAQA 4ZVQB 4ZLJA 1VQNS 1S0VA 5DZ7A 1OY8A 4JI7F 4ZPAA 2BANA 4JI1J 1ZPVA 1HBNA 2VONA 4P6QA 4HEA9 2WONA 3ZZPA 2CJ9A 2ZC4A 1RGVA 2ATCB 2VKRA 3RTVA 4FDFA 2R7XA 5KOXA 5BJRA 1TZ0A 3L09A 3THTA 4JI3F 1XR6A 2NZ4A 2PIIA 4FYDA 2FDNA 1S9GB 4F02A 4PQUB 1ITPA 1PC4A 2C2EA 1MU2B 1F2HA 4DV6F 3ZO7A 4H54A 3Q83A 3W5XA 3D67A 1VRUA 1CG2A 1U2CA 3DYAA 2V4QA 1NO8A 3PX0A 4I2QB 1FFGB 5HQLA 4M8LA 2H48B 1U1QA 2HVZA 3E2EA 3CD6S 5GMDA 4M1KA 1DTQA 2QMUB 1YJ9S 4DUZJ 2VHGA 1LEOA 4HT7A 3CCJS 3VAKA 2UVVA 4WP3A 3RW6A 2XHWA 4ZPVR 3OHAA 5ETRA 4NLRA 3UFCX 4EYHB 2VG5A 2DTJA 1HNIB 4KAIA 1OS5A 2WVCA 3OFHA 5G0RA 3RB3A 3HZGA 2ZDPA 1NKEA 3DLGA 1SB6A 3QRPA 4UOCA 2KYZA 4BHQA 4J9SA 4F4AA 5KT4A 4O4RA 3ELHA 2MLZA 2OELA 2V8HA 2NR0A 3KLFA 3C6TA 2XO7A 2W4DA 4WIIA 2OO4A 3H7HB 1UEUA 4USVA 2WVBA 1YITS 3MFIA 2VQEJ 1IKVA 5L1JA 2FGOA 3NWGA 1JLFB 5DM6Q 5ETTA 3GSIA 4ECXA 4CP5A 1WEXA 1HBMA 2V50A 4UTGA 2KM8C 4LF6J 2G2YA 3MEGA 2RE1A 4FS1A 4RU9A 5K8MA 1RT5B 4ICLB 3D0IE 2PA3A 2XG8A 3ZZUA 2HQ3A 1VHIA 3L9ZA 2IRUA 1RWUA 1UFKA 4OZJA 4QIEA 1RCOB 4F4XA 1WSRA 2WVFA 3PX4A 2DHXA 1MNEA 4DCPB 1Q78A 4FNHA 2DBBA 4NZ7A 3V6KA 2YXLA 1H73A 4ZJLA 4XIUA 2BOAA 2HZCA 4X4RA 4CLSA 2IY5B 2FLOA 3J80Y 2ZBQA 2DCLA 3T1YF 3BSCA 1VC5A 4ECRA 4NMXA 2YKMB 1JX4A 3HFKA 4IR1A 4HKQA 2GA7A 2J8AA 2RB7A 4RZRA 1UL3A 2B4VA 3T6BA 4UUXA 2GW8A 2I6WA 3FCWA 4G6VB 3PEHA 4CLWA 2VIHA 3VQSA 3NGSA 4FZVA 1NK6A 2VFTA 4FBTA 2Y1LB 2ZH8A 2VJUA 3FZ2A 4I7FB 3QAUA 2RJZA 4BDPA 4OV1A 3DC2A 3KNGA 4OX9J 3CW2C 3R2CJ 4CRJA 2D9OA 3VAJA 5CHCB 2HGLA 4DR2J 3LPEA 1ROFA 3M8PA 2R7UA 3I9V9 2QTWA 2MLXA 1B7FA 1R6VA 3UD5A 4O3QA 3MGJA 3D0GE 4X4UA 3MMCA 1PJ5A 4KGXB 2RS8A 1NSPA 4LQ3A 2KRRA 3G8SA 2NCKL 3C14B 5H9EK 3PDNA 1VQOS 1JLEA 4RBVA 5CQGA 3ENAA 2R8KA 1F3FA 2DVIA 4C0OC 1XMQJ 2AW0A 4YDDB 4DLGA 4YMEA 4KRWA 1UPMB 3M30B 1ZZFA 5KFNA 4ZDNA 2J0QD 2UXCJ 4B3OB 5L39A 1FNOA 4JI4J 4ECYA 2HKEA 4EYIB 3QSIA 2J76E 3CXCR 1JKHB 3EWGA 4P73A 2F7VA 4DPOA 5THWA 4IRDA 1R0BG 4QPXA 2ABYA 2HW3A 3UVJB 3BYPA 3S01A 4WK3A 1HNZF 5A6WA 5KG0A 3P3DA 1RWKB 3W3SA 4FF1A 4TY9A 1YJNS 3CT9A 1QUVA 4DFKA 5D15A 3PRDA 4CQ1A 3HK2A 1NHVA 1X4EA 2QYGA 4ANEA 4BBYA 1TKXB 1IQTA 2I8EA 3UE2A 2HHHF 4KPCA 3BH6B 2DIUA 1RHRB 3NAIA 4LBIA 3W2WB 5CCMA 1IBLJ 1EP4B 3CULA 2UXDJ 2NSBA 4N8NA 4X64F 5KT3A 4WFNQ 1FWPA 2J9EA 1FE0A 3L4BC 3NMAA 4NLUA 3I5AA 3A3NB 3U1LA 2IIHA 2FJAB 4DS5A 1SIZA 4IRKA 4GVBA 3R27A 5KFYA 3M32A 4ZP8A 2AEJA 5HMWA 3ZC4A 3A4TA 5KT2A 2R2TA 4PEOA 2F4VF 3BDPA 3R5GA 3OQ2A 5JUMA 3EGVA 1SL1A 3MPUB 2QSWA 3PYFA 4KHPJ 2FHKA 1SQFA 4HTIA 4P2XA 4AXJA 2LKZA 2E7WA 3OSNA 4DDFA 3IS9B 4MTPA 3LTOA 3M6UA 3KK3B 1UVNA 4B9UA 1FJGJ 2H51B 4M63A 2B4PA 3NOCA 1KHVA 2CWXA 4LT6A 2V8DA 1Z4UA 1PCAA 1ZETA 2ZKTA 1QE1B 4UY8T 1X4AA 3QPIA 2RDIA 1REGX 1NDLA 5GAGI 2VBWA 2DNZA 3W8PA 2UVRA 3O6QA 1VR6A 3OJUA 4MYUA 2D3OR 4Y3CA 3W64A 1C1CA 3R5AA 5T14A 4RNMA 4ELVA 1ICEB 4IOCQ 4X65J 2FHMA 4P9SA 3HI9A 2DGQA 2C28A 1RTIB 1KQKA 3KMQA 3CMQA 2F9DA 2CG8A 1SJ4P 2ZH6A 5H9FK 3FMWA 2QLFB 5SZTA 1EQ0A 2JL9A 4ECSA 1AW0A 5C25A 5B09A 3CJQA 2FVCA 6AT1B 3UD4P 2ADBA 2E29A 2BEFA 5EX3A 5EGYA 5D3GB 3O8WA 2FVRA 3S7RA 3B82A 4RBUA 2OPRA 4MIAA 2O1PA 3DLKB 2BQ3A 4LFBJ 1HWIA 4NPOA 4C3MA 1S1XA 2ZD1B 2DR8A 2KB2A 1YGYA 5KFDA 1XIQA 1NDPA 4TY8B 4ZN3A 3HVTB 4JYAJ 3SXLA 2XLKA 4MFBA 3F0NA 3ZTSA 3BGFA 4USIA 2ZVSA 3TA0A 4H4OA 3H98A 2W8LA 4P74A 1XBWA 3C3LA 3MR7A 5L8RC 4RW4B 4PRFA 1UWAA 2BJEA 4RJVA 4GKJF 5KFPA 4CNYA 1LWCA 4ED6A 1KTVA 2J6SA 4MH8A 4WYWA 2OSQA 2VG6A 4DV0F 3TO8A 1TUVA 1W7WA 3CJ3A 4USTA 4QIFA 1SUQA 4KGVB 2UUWA 2E44A 4K4WA 3K5OA 2LXUA 3LUYA 3RBDA 4L72B 1FF2A 3QQCD 3EX7B 1RYRA 2YVSA 4NCGA 1G6BA 2JFDA 1DLOB 2UUCF 1J5EF 2CZ4A 2FYXA 1REVA 5CD4H 1T94A 1Y7PA 5ADZA 4JI0J 3HHDA 2DNQA 1CBKA 2GC8A 2XWXA 1X5TA 5E2QA 2V63A 4YP3A 3OLBA 4J5OA 5J2PB 4WTYA 1S72S 2V0NA 3ZTOA 1UVKA 3G71S 4V19X 5E41A 1FRXA 4ZLNA 3NGRA 3FZBA 3I4PA 3ZTQA 4IOBA 3BPSP 5BXIA 1X9SA 2FJWA 2CPFA 2ERRA 2QMXA 3Q8RB 2CPYA 3LWMA 3EVWA 3RRKA 1Y3KA 4DUYJ 2BUNA 4RR5A 3VGTA 4A8KA 2OHDA 4Q43A 1U24A 1WF2A 2D1CA 2CZ9A 1JB0C 2VUGA 3QT8A 4TU9A 3DI6A 1U8WA 2C42A 4DR5J 2WZ1A 3DGVA 2IAJB 3TEHB 1UVIA 2UV8G 2PE8A 3LP1A 1FTRA 2XI2A 3TVKA 2ZH3A 1X9WA 1DTTB 2KXFA 3NL0A 4ZITA 3I87A 1FXLA 4P2MA 1SC3B 2ASLA 4RW9B 4DV1F 2YNGA 1FJ7A 4C8KA 1R0AB 5J1EB 1EKSA 4U6PA 4CO1A 3CDBA 5CCLA 1M5SA 1T9XA 5AXNA 1RSCA 2QSFA 1S1WA 5T41A 5IT0A 2VQFF 4B17A 3LAMA 3CCVS 1LQ9A 3Q2TC 3MCSA 2EFGA 2R4FA 3KUEA 2FJDB 2X1FA 5KFAA 4MT1A 1RT1A 1B4SA 3D5MA 1UZDA 4FXDA 3BBCA 4BCAA 3PJ9A 2CDQA 5K14A 3M2VA 2C3YA 1DQAA 3RAMA 3M8WA 5D77A 4MKBA 5CZVA 3QT6A 2XTJP 3IFEA 4LF2A 3M6VA 3GB0A 1MW7A 2CQBA 2YQ1A 1RTDA 4EZ6A 4FN5A 2GO8A 2XS7A 1TFYA 3NG8A 3PG9A 3LP0B 4ZPTR 1QTNB 1HD0A 2GHVC 3MZIA 3H5SA 1S7HA 2Z2LA 1GMVA 2B8QA 2CJKA 4F8RA 3FSIA 1RI7A 2APOA 4KHRA 3QIPA 4J7CA 1WG5A 2ZE2A 1X0FA 5AE1A 2RF2B 2GO9A 4LSZB 3CCZA 3SMZA 1RTZA 3W9HA 4N56A 2RQCA 1R8CA 2XMVA 4K2XA 4C0HA 1UVJA 2QA2A 2GQCA 3OBIA 3OTOF 1CC7A 1ZBTA 3PX6A 1TV6A 1X5OA 2CG4A 3ENVA 1HHTP 1M5KC 4KO0A 1Q7YT 5L1KA 2EVZA 4NLSA 3DOMA 5I3QA 2JLEA 4JI6F 5I42A 3BV8A 4OI0A 1PGZA 3BM7A 3LGNA 5F9NA 4P7VA 3TAMA 4LR8A 4CYUA 3LWLA 1VQ9S 5LOQA 2M5YA 4F50A 1D09B 3WDOA 1QAJA 3BQ2A 1IXKA 3CCSS 2OPSB 1GX6A 4Q8FA 1H6KX 1PYTA 1RT2A 2HQCA 2K7JA 3IGVA 4OMFG 1TELA 3EXCX 3FVYA 1W26A 3MR3A 4ECQA 1Y5LB 2V67A 3U1NA 3S1TA 4WP8A 5AXLA 4C3LA 2HHTA 4HL9A 5HVGA 3M9MB 3MXHP 4QZVB 3MAHA 4OL8A 5DQIA 4FPRA 1N0UA 4WP9A 1HPZA 2YNIB 2IVMA 4CO3A 3LGMA 4ZOSA 5DG8A 3MR2A 3DLJA 3FK4A 2GVZA 4NRUA 1ZZNA 3UNYA 4G1QA 1I6JA 3CJSA 4ZVOB 1FK9A 4V19J 4LF7F 7FDRA 5KAKA 3PRVA 5I3UA 1EJ7L 2F8MA 4PAAA 2BV3A 4N41A 2WBMA 3R5BA 1GTHA 4I0WA 3HVRA 1PC5A 1I1GA 4J9KA 1FXRA 1P9YA 3A13A 3ITHA 3ILIA 4OJHA 5E3CA 1AZSB 3ILOA 2HHQA 3LW5C 4LFAJ 1H3DA 1HKAA 3LAKA 4A4JA 5DDOC 4K4ZA 4R8UA 2D74B 3IO1A 3KLGB 3IG1A 2JC1A 1NXIA 1I51B 1RXOB 1M5OC 3DDKA 4YHHF 4YB6A 1RAEB 5J2NA 5J1PA 3Q22A 4K4VA 3R1HA 4DR7F 2YQ0A 2P6TA 1KVJA 5CH7B 2C2MB 1X4BA 5CYMB 3VAGA 4GVLA 1FVSA 2AU0A 2LU2A 1JMTA 4YB1P 3MD1A 3AXMA 1KLMA 3FEZA 5DO2A 2Y0BB 5B7WA 5A8WB 4OI1A 4L74A 2XMAA 3T1HF 4HR2A 1VIOA 2AGQA 4M5HA 2DO4A 3F44A 2F5GA 2CJQA 2HHXA 1TL7A 4QJVA 1JLCA 2E5IA 3FRYA 1KOOA 2NPFA 3J7A1 3G6ES 3CNQP 3CJKB 4J9LA 3B4DA 2JWNA 3EE3A 2WB4A 2DNHA 1MN9A 5BYRA 5HROA 1FRMA 4ZJOA 3DRXA 4WE1B 4LR9A 1JLAA 3SV4A 5L9XA 2XYPB 1A0OB 4U8VA 3GIKA 1G2EA 3MM9A 1WJ9A 2ZM6F 1VYAA 2ZH1A 2DISA 2ROGA 4A8SA 3IBCB 3ISNC 1FKPA 3PO4A 3ZXWA 3J81Y 4ELUA 1SH0A 2JOQA 2OFGX 3E01B 1K0VA 2Y0SD 4KGKA 2L9DA 1GAOA 2MGZB 3FFIA 2LEPA 1VOMA 1SV5A 3NBPB 1FHTA 3DFEA 3MUTP 4IFVA 2UU9J 1HR0J 1LK5A 2H54B 3EGNA 3C16B 4CI0B 4RLEA 3MAQA 3TOQA 3MD3A 2DD8S 1N5QA 1RT6A 1TKDA 2RRAA 2X3GA 3KK1B 3MMBB 1XN9A 2LXIA 3Q23A 1FFWB 4PG7A 2DXEA 3VV2B 2Z2MA 1MMDA 2HPUA 2BE7D 2QLXA 2E9RX 4IOAQ 1UEKA 1GX5A 4WK1A 5LSRA 2YKNB 3BEGB 5F41A 2FJEB 3QO9B 4XPCA 5KFQA 2Y1JA 1U1NA 5FLXY 2JLGA 3CIMA 1SJFA 2XYGB 4G1PA 2CQ3A 1HW9A 2GJ2A 4DMZA 4PQUA 4TLRA 3HSDA 4ERDA 3I5CA 4DPYA 2J0WA 3H40A 2NXNA 3HSGA 2W8KA 4CH7A 4FS2A 3Q8QB 1YJVA 2QE5A 1JJHA 2LVWA 4KFBB 2MQ8A 3GYGA 4U9RA 1ZAWA 1RABB 4CZCA 1LV5A 4I2QA 2YY3A 5H1SV 4K4SA 3VTIA 4M5NA 3I56S 2FQQB 2HFZA 4X62F 1J2VA 1KRPA 1FRHA 4DV7F 2JJ4D 2H5JB 2FHOB 3H2LA 1T05B 3RB4A 2DGVA 4NASA 2E1CA 1NZAA 4O4GB 1T9VA 1HNIA 2D3ZA 5HO4A 2ZFHA 3NCRA 4EBCA 2FZCB 1TL4A 3N28A 3W66A 1RK8A 1N32F 3MPVA 1EAYC 3GMGA 1YDLA 4NRTA 4ED7A 2JFKA 2ZZNA 1PBUA 1ZA2B 1CJKB 1Q81T 1GFWB 1QJHA 1FDDA 1S6QB 2UUTA 3TAPA 1EZZB 2WHOA 3IRXB 2DNLA 1JLFA 4AYBD 1RAGB 1UCNA 4HYKA 1KQSR 4DR3F 1X8DA 1WKKA 4NLDA 4DL5A 4TKTA 4HH0A 1RT5A 4ICLA 2QL5B 2EWHA 2KHCA 3EZUA 4MAKA 2HFSA 5GAHU 2MXYA 2HAFA 3CJ0A 1S99A 3ETMA 4ZPBA 1RTHB 1PJ7A 1WOSA 4DQIA 3ONQA 1TUWA 2HFUA 1SC1B 4K0KJ 3KG0A 3VAIA 2DHHA 2R7VA 2CVEA 4DV2J 4U7UK 3NNAA 1SJ3P 4X4QA 4F3QA 1VJWA 3OLAA 3FRZA 2W2MP 2ZKUA 2HHUA 4C2MA 3DCAA 4ED5A 3ENWA 2HVIA 5D0EA 2YKMA 3MAAB 3TX0A 4UZBA 1WF0A 4OHZA 5IT9Y 2MKYA 4G3IA 3VAHA 2QA1A 4DG1B 2NS1B 4LBPA 2XY7A 1NPKA 2VPWB 4DF4A 3RBXA 2W4CA 3CVKA 5KFJA 3FBCA 4B3MF 3OL6A 2D69A 4U7UD 4I7FA 3A8KA 4LIRA 2MJUA 2Z8QA 4CTAB 3D6FB 4B9NA 4C98A 1MMNA 1N52B 9RUBA 2LEBA 2QA4G 1TL1B 2HAIA 2WAQD 1UMJA 1NK7A 4Y6IA 2KJVA 3IR5B 1RT7B 2K8GA 2HBQB 1AFIA 4F0HA 3SDEB 1AUDA 1RTJB 2RKIB 2AP6A 3VGVA 3PKMA 3R6GB 2ASDA 3IM8A 1OY6A 3MCOA 3WQPA 3QJLA 2DY1A 2EEYA 4DN9A 3C14A 2XLIA 2QV6A 1V3SA 4U7CA 3P96A 3N6LA 2XNQA 4QU6A 3DRYA 2PC6A 4QWAA 3M8SA 2YWEA 1K9MT 1IUJA 3M30A 1ZTTA 5F8LA 4CNZA 3H4BA 4YR3A 4B3OA 4DR4J 3RG6A 5D4PA 3EICA 3PIPQ 3DMJB 5CABA 2E5JA 2ALYB 1KS2A 4F7VA 1SVDA 1L3TA 1CQNA 1JKHA 1BQXA 5KFSA 1K44A 2IVFB 2R8GA 2FD2A 2ZWPA 3UVJA 2C2NA 3SQOP 2CQPA 2COLA 3VHQA 1NJXA 1FNMA 1RAHB 3BBFA 2IM0A 3TR5A 1CC8A 3JAMU 5LXYA 3T5HA 1O8BA 3H0PA 3QNWB 3RJMB 1PYOB 3U7JA 4B9TA 1TKXA 4OI2A 8RUCA 1DQ9A 4FP9A 2E5LJ 3TRGA 1NZ8A 4X66F 2FJXA 2HBYB 2Z0GA 1KLNA 4NXNF 4CM2A 4BWJA 3W2WA 1NPPA 3CUNA 1L5UA 1EP4A 1CJVA 2B51A 3KK2B 3JSBA 5AJ3F 3CCQS 2RH3A 4Z7CA 5M2UA 4DEZA 3M6WA 2C3PA 3HHLC 3HHNB 1U48A 4RW7B 2ASJA 2XSFA 4M5GA 2Z2ZA 3L3CA 3KHRA 4ECUA 2GHPA 3JSRA 3SCIE 2BA9A 5M2RA 1CPZA 4PXCA 5CYJA 5F8GA 2O01C 3CDAA 2EBGA 4M5IA 1N5SA 3S6EA 1WTBA 3W1YC 2E7XA 3C46A 3DLHA 2KRBA 4OHWA 3A8IA 3MM6B 1MROB 3AT1B 1YQHA 4NLPA 1JNZB 4J90A 4OHXA 1V3RA 2B4UA 1MWYA 1TU0B 5E7OB 2I2YA 4OZNA 5A2QY 3IS9A 1Q8BA 3KK3A 4AL6A 4EZ9A 4H4KA 2HHSA 4CIOA 1NSKL 4HT5A 2KL8A 5IT4A 4DL2A 1KSPA 4AL5A 3CF5Q 2J6TA 5C7PA 1G1XA 4WXWA 2UP1A 3ZZOA 5HAOA 1S9EB 2DYAA 2M8HA 3M2RB 3NY0A 3HULA 4O44B 3PYEA 5IM0B 2IYGA 4WZQA 5LMNF 4BWMA 1RTIA 3AD7C 1ZM2A 3IP0A 4M95A 4CH1A 1EETB 4NLQA 3CJ4A 5MLCV 4JI8F 1D9FA 2Q43A 2D7SA 3KMSA 2OPQB 2NYHA 3EJMA 3QRRA 5KFTA 4LF8F 5D3GA 2GCFA 4ZLLA 4IKAA 4X4SA 2NZCA 2W7AA 2R7WA 2ZH9A 3DLKA 1XNQJ 3PM9A 3PW2A 1HQ2A 2KT2A 5ETKA 2ZD1A 4DSLA 3M05A 3KG1A 3BKFA 4B9LA 1R3NA 4W98A 4TY8A 2OJ3A 3HVTA 3R5JB 4DS4A 3UCZP 2JZ5A 3FQKA 2PO4A 4XDDA 5H9EJ 3W63A 5K8OA 5ETMA 2AGOA 3KG4A 4P2SA 4RW4A 2DRBA 3WHIA 3MEDB 5A8RB 3A3OB 4QR0A 3D66A 3BR8A 5KT6A 3AOAA 3VCDA 2EG2A 3H42A 2Z4PA 5ETNA 1E6VB 1D9DA 5KG2A 5F3TA 4JV0A 2WB1D 2I5JB 2J6UA 2D3UA 3ZZZA 1D8YA 2QA4S 3GJTB 1DLOA 4PABA 1M5HA 3EGZA 1XMOJ 2E1RA 1XERA 4KBIA 1HW8A 2RQKA 4I69A 1K8AT 1PO6A 4DUTA 5I3PA 1S76D 3CGIA 3VAMA 2AJ0A 1N6QB 2G9OA 3SEOA 4WFZA 1RWXB 2GFFA 3RRHA 4EUVA 5J2PA 4DR1J 1ELOA 2MDAA 3DOKB 2QL9B 2I9SA 3NCPA 3OJSA 4NYPA 4K7QA 5AXMA 4NA2A 3K7RA 5KG6A 2EKYA 3GCXP 1TMJA 1HI1A 3BGLA 5LJ5Y 3BSNA 5CYQB 4C6AA 1NU4A 3DOLB 2GJIA 2A0FB 3G86A 4CLFA 2UUBJ 2FLNA 2DIVA 4K5SA 5IWAJ 1N36J 3BO4A 4YR0A 2WW4A 2RILA 3LOUA 5J2MB 3HVAA 2DNMA 3TA2A 4KT0C 1U45A 3D3BJ 2YX1A 2VICA 1NK5A 4GMKA 2IAJA 2DR9A 2IA6A 3V81B 2X7IA 1IM4A 1DTTA 4NEYA 3W8GA 4KHMA 4CCHA 4UQTA 1FKOA 2ZOMA 2ZH7A 3K2YA 5FD1A 4DR6J 2KU7A 2RU9A 3DRRB 4RW9A 3Q8SB 4YY3J 1R0AA 5J1EA 3B6BA 2R7QA 2GV1A 3AODA 4LF5F 2P5VA 2C2KB 2CNOB 4M5LA 3EUNA 2XSJB 2RAQA 3D4JA 2CJBA 2MPUA 3OSPA 3RRGA 1FD8A 2K06A 2GNKA 2HGMA 2WW8A 3WIUA 4OX7A 3SCLE 1VGYA 2K7KA 2VDIA 3DU5A 4CLTA 3HJFA 2JEFA 2PMWA 5GADU 2ILYA 1DZ5A 5ETVA 3H90A 4DSKA 2DRAA 2YKQA 5L1IA 2WTFA 2IJNA 1JXVA 4B08A 5H9FJ 2A18A 2OKQA 1TR0A 2CPZA 5HK4A 1F9EB 3D68A 1WNEA 3NWRA 3N4WA 3LP0A 1PAEX 4DPXA 1FT8A 1S0MA 3HDSA 1VHFA 3FKBA 4ZPCA 1NDKA 1VIXA 5A2QU 4F4YA 4LVNP 1WG1A 4TVAB 3NNHA 4C11B 3F73A 3NLCA 2KT3A 2RF2A 2VD3A 4DUZF 4FF4A 4RWXA 2C2DA 4IFYB 2CPIA 3B54A 2YWGA 1YBTA 3N5BA 2IM3A 2AJ4A 3V6JA 4XTTA 3KJVB 4NZ0A 2F3JA 3PXGa 1TTHB 4PG4A 4DX7A 4B3SJ 4F0KA 2LP4A 1Z2LA 1SQGA 2RU3A 2GGPB 2XZWA 2CJAA 4DV4J 3OD2A 2UXBJ 4AT1B 4J9QA 4DSJA 3EDRB 2LLZA 2EG1A 4ZLPA 1UVLA 2CQ4A 2HVDA 4LBHA 1FWKA 2YWWA 4WFXA 3CCTA 3EDQB 3MDFA 3D0HE 2VQEF 1V6HA 1GMWA 2KM8B 2U1AA 2R42A 1RU2A 5LJ3Y 2KYXA 2GMJA 5AXKA 1OMSA 3B78A 4YDXA 1JXEA 4LF6F 2LQ8A 4LSNB 2LFVA 2IBOA 5B0CA 4TNOA 1Y5IB 3ZZ0A 3T3FA 2GMLA 5LMNJ 1JK9B 2YNIA 1N56A 3AJ1A 4UQGA 2LA6A 4ECWA 5EWEA 2YNHB 2VBXA 2KFYA 1BMQB 2ZWOA 3TANA 4WZMA 2FZKB 4OZ0A 3CSKA 1DAXA 5L38A 2XWYA 2MQQA 3PHTA 1RBLA 2Z2YB 3SI8A 1RWPB 4G1IA 4C9DA 1VDHA 3ISZA 5KFGA 5ETLA 2IFXA 5D8HB 4ZVSB 1HMVB 1LXNA 2DNGA 1RDRA 3QLHB 5DETA 2X51A 4WBFA 1AZSA 2K1RB 4Q2MA 2B8PA 1UW4A 1T03B 3MCNA 2HHWA 1PG5B 3BZQA 4S0MA 4F25A 4KB7A 4OZ2A 3KLGA 2UZAA 3BJYA 1SKWA 4OX9F 1RJJA 4JI2J 2ZZTA 4DR2F 3BN4A 1S9FA 4KR0B 4HDHA 3PO5A 3OFFA 3H5YA 1HHQA 1L3UA 1U1KA 1O0PA 4F67A 3AJDA 4EMDA 1V5VA 5DRKA 2R9LA 5FIIA 4J91A 1YKWA 2DEJA 1LFPA 4CO5A 2KVQE 4IQXA 2CQ1A 5HN0A 4ECVA 4N47A 1YHQS 4KC5A 2MZQA 5A8WA 1JLGB 3BN7A 2IDEA 4IO1A 1XMQF 3HFVA 5F8IA 5F9LA 1RHQB 3K5NA 2HS4A 2XY5A 4JI4F 1NJIT 3FGVA 4L75A 1JJ4A 2ZHOA 2ZBIA 2JX2A 3CJKA 3CDUA 3HM9A 3OXLA 1RAFB 1RT4B 2CJYB 1GH8A 4MK7A 2YPZA 4WE1A 4NLOA 1VQSA 1CULB 1WELA 3BGRA 4GO5X 2FC8A 4OI3A 1H2TZ 3VGSA 1FDBA 3G82B 3VR1A 5GAEU 3TZZA 2H4WB 1FX2A 3BH7B 1V5IB 2V4JB 2AIRB 1FKAF 2MSSA 3FEYB 3OTEA 1RT3B 3D1HA 5CA5A 4UUWA 2R7SA 4OYBA 2YBVA 3LALA 2IMOA 2W9CB 4O23A 3UR3C 3C8YA 2ZOGA 2WOMB 2C22A 3CDEA 3TUIC 3E01A 4CLUA 2HFVA 1NKCA 5DGBA 2ZUGA 2MGZA 4I64A 5KFHA 4ID5B 4LRCA 2HNZB 3N79A 3LQVA 3OR2B 1IBLF 3JQJA 5AE2A 2AHOB 2MQPA 3NBPA 3EM1A 4B3TJ 2VOPA 5C42B 5DZ6A 2BVZA 3SSSA 3NS7B 3I0SB 3MTJA 4LF5J 3W2VB 4M5DB 2M52A 2G2ZA 5FDLB 2HQGA 4ED4A 4DPUA 3ET6B 4BS2A 3L7OA 2L3MA 4ZS6A 4BC7A 3MMBA 1WDTA 1G3OA 5KFIA 3BREA 2VDHA 4MMOA 1WI8A 2KG0A 1WG4A 3GFHA 3TARA 3KLIB 3J7YU 5BYSA 2YKNA 2ZBCA 2RUGA 5IOLA 3QO9A 1PJ6A 1C0UB 4JV5F 1RU1A 4JV2A 1OO0B 2I0XA 1HBUB 3X1LB 3PCOB 4KHPF 1Q79A 3C6UB 1WHWA 2KT5A 2MZ1A 1SJ1A 1RADB 3GG0A 2L48A 1OQ3A 1NSQA 1FJGF 2OMOA 3QZ7A 4O0NA 4O3NA 4DQRA 1T9YA 1NH7A 1GMUA 3Q86A 4XAKA 1OY9A 1H72C 1C1BB 2JC0A 2YNFB 1M5PC 4KFBA 1FE4A 1A7GE 2NPIA 3KYLA 2MEWA 3T41A 4XPEA 4LRDA 2HWIA 2LU1A 3KJNB 3M8ZA 3ZTPA 5BR8J 4X65F 4LFCF 3GQCA 1N34J 2B7BB 1GTEA 1VQYA 3NRBA 3P6YC 3GFXA 1R8PA 2NUUG 1T05A 2XCAA 4DU8A 1JLBB 1LW0B 1KTQA 2V94A 2NXUA 4FF3A 3IMQJ 4ANDA 2P2CB 4DV3F 2OUGA 3OV7A 1PYSB 1HARA 4O4GA 3D7SB 3MMAB 1WEZA 1WACA 4LRBA 4HLBA 3VWSA 4YB5A 2HLTA 2VBZA 4F26A 4LFBF 1P1TA 5KFMA 1JWWA 1B0TA 3D6TB 2AMCB 5C2CA 1CJKA 4JYAF 4WCEQ 1P9QC 4D3GA 2HGNA 2XMMA 1SXLA 1S6QA 2EI5A 4WIQA 3NGTA 1CJTB 3PACA 3IRXA 2OLWA 2F63A 1BLUA 1YLXA 2RSQA 4ETXA 3THPA 1WI6A 2XCPA 2AJ2A 3H2VE 2QZ8A 1S7IA 4P75A 3ZTRA 4ZCIA 5EWFA 4IG0B 5DM7Q 2L41A 3EVMA 3KUHA 2QJ3A 2VPZB 1QUPA 3MM8B 4RW8B 1FVQA 2FC9A 2A6MA 1RTHA 4IH6A 1Z2ZA 2HZVA 3KFWX 1CS4B 3B4MA 2V2ZA 3BF4A 1TK5A 2J9CA 2CNLB 1YJUA 3K5LA 3L7UA 1HQEB 1HWJA 4JI0F 1YRTA 3I4HX 4F3MA 2AZ1A 2KDOA 2RMLA 3MAAA 1VC6A 4NX9A 4NA3A 4I6YA 1DFDA 3CC2S 1YRXA 3OHBA 4K5RA 4DG1A 1BQMB 1RHKB 2XS5A 1GXLA 2KH9A 2G13A 2WVDA 1XWLA 1IBMJ 4DSFA 4DUYF 2CJXB 3IGNA 1VI7A 2FUG9 1C0TB 4CTAA 2M9KA 5D0GA 4NE9C 3MM5B 1FJCA 1F5CA 2UVWA 4DR5F 2F4FA 1NB7A 2ZHBA 1TL1A 2P9CA 1X4FA 3K8VA 3K57A 1JJ2R 1A9NB 1Q8IA 1RT7A 4UY85 4UT4A 1IKYB 1HQUB 3P4UB 1D3WA 3SDEA 2RKIA 4WJBA 3UI3A 4WU3A 2BZ2A 3AHPA 2POKA 3QZ8A 5M2PA 4WFYA 1XK8A 1R8AA 4Q8EA 3TP2A 2MMYA 3DMJA 1KVKA 3HT0A 4XDCA 2XHCA 2CYYA 3GFYA 3GZ7A 1RISA 5K20B 2XULA 2A1BA 5IQQA 2KXHA 2LMIA 3I6PA 1NKBA 1DURA 4KE5A 1CSJA 3WC2A 1XNRJ 1AA1B 3RAXA 3VVUA 1S5ZA 2VB6A 1WC1A 1Q5VA 2B9WA 1U0HB 3V4IB 2F8EX 4NCGB 2EFPA 1N88A 3KLEA 2HURA 3M1VB 3J7ZT 1WUUA 4OX6A 1VQ8S 1MWQA 4FYYB 2J7UA 2DGUA 1FRJA 2HK3A 4PG8A 5L1LA 1O5JA 4RW6B 4AQYJ 3HJVA 2BJ3A 2HWTA 4AE5A 2WK4A 2ZBPA 4JOUA 1X60A 1QM9A 5F8NA 3K5MA 1EHWA 4DHVA 2CKWA 3KK2A 2V8PA 3P5TL 3R7BB 4Q0BB 3W9JA 3Q8VA 4ZVGA 3T6JA 1ZTWA 2BJDA 3JYTB 4KYZA 4RW7A 2XNRA 4R5PB 2IRXA 1N5YB 5RUBA 4Z37A 2WSFC 1YBAA 2YPYA 5E0OA 1YRUA 1FRLA 5A6PA 2EXUA 1RHUB 5GAGU 4HACB 2M2BA 2CPHA 3MM6A 3CIZA 1MROA 4IG3B 1N33F 1M90T 3HKZD 4JV5J 4ILLA 1SC4B 5KTQA 1C2PA 4KV8B 3N5FA 2GX8A 3AQOA 2BKPA 3BGOP 3ADAC 5KOWA 1UEVA 4C97A 1UP1A 2ZNYA 1R31A 3J81j 3NAHA 3ICLA 5K9FA 4L3KA 4ZCKA 4QPTA 1PILA 1KEKA 4ER8A 4LRAA 4PXBA 3KJQB 1W2IA 1VISA 1S9EA 2JEJA 2B0GA 4X84A 2WBRA 3M2RA 2CIMA 1NNDA 3T5LA 4O44A 2DH9A 2BKOA 4IO9Q 3SV3A 5IM0A 4CM0A 4ELTA 2H5IB 1RQ0A 2AEMA 4LFCJ 2CFXA 3D6MB 1CVJA 5LL6d 3IWXA 4W4MA 1EETA 1R7IA 1XR5A 2H1YA 3ZFVA 4C8LA 2C3MA 3RUBL 2QLWA 3BR9A 4M5MA 3ZZRA 2OPQA 2VFRA 3M2VB 3V4MA 2VPYB 1AT1B 4DV3J 1FRKA 2PA8D 3BDEA 4L73A 2YKOA 4RUHA 2PI5A 4ZPWR 4OV6A 1AROP 2W7PA 5C5JA 4F04B 4TQRA 3OVAA 4GKKJ 3MM7B 2PI4A 2NREA 4NLWA 1SC6A 3MOZA 5HMYA 2BM0A 1IWAA 1J5OB 2YWKA 3SZ2A 3MPYA 5D4NA 1QVFR 1Y00A 2BM1A 3OTDA 1YI2S 2JVRA 1U1LA 4LFAF 1R0CB 1BD6A 1U26A 3MEDA 3J80U 3AQPA 5A8RA 4EGLA 1NCLA 2CNKB 2DK2A 3QRQA 1E6VA 1S12A 4RL1A 4JI5J 1WHXA 1UJ5A 2I5JA 2HHPA 1L3KA 3IR6B 5HLFB 3BO3A 3AB2B 2UUAJ 3BPDA 1GMWD 2LYVA 3HCXA 3HF5A 1FWLA 3PNIA 4K2JA 3GR1A 1P6TA 2OD4A 2OPPB 2BXJA 4PYAA 4UOFA 4OZ5A 1PBAA 1VBYA 4C8OA 1U1MA 1N6QA 2IC3B 5B0EA 4ZPDA 4B9SA 3JB9k 3RBEA 4LRFA 1Y5NB 1HNWJ 4LREA 4DZDA 1CJUA 3DOKA 1SBRA 1UTAA 1B0PA 4B02A 1F9HA 3I82A 5A8KB 2AYMA 1P27B 3FSXA 1NSAA 3DU6A 3RB6A 2MZRA 4N8OA 4ZCMA 5CYQA 2V34A 5KG1A 5DDRC 3DOLA 2DNKA 2DITA 1YVFA 5KFCA 3M8QB 4JV1A 5B0FA 1F3VA 5KG3A 4A8MP 3DKDA 1IBKJ 2BQUA 2DKOB 1R8BA 1NM2A 1WSVA 3CEDA 3OL9A 5J2MA 4TU7A 4N5SA 2QGFB 2CPEA 1ZA1B 4E8UA 4FPIA 4JBCA 3V81A 5DQHA 4WWSA 1FX4A 2VJVA 1WEYA 3BQ1A 2KFZA 2DH7A 2QO3A 2DXFA 3Q2SC 3UN3A 4M94A 2B6AB 2VG7B 1D0EA 1F0XA 3DRRA 2YX7A 2QL7B 1MG7A 1SPBP 5LSLA 2P9EA 2UU9F 2XGPA 1HR0F 3FQLA 2XSJA 1FRIA 1Q7LB 4UZCA 4LSLB 2XLJA 1SL2A 1VMBA 2N7CA 3CJ2A 5ETSA 3MPWA 2BOPA 2P6SA 5BYQA 1E6YB 4ILRA 1DY3A 4I4BA 1BUXA 2F9JA 4K59A 2QC3A 4AUKA 4FXWA 5A0YB 1PKUA 1Q5YA 1JNRB 4NEZA 2VZ9A 2JLFA 1NMEB 3D28A 4ETZA 4KH0B 2HZAA 1TAQA 4K8RA 3HT3A 4KTQA 2DEIA 5IFMA 1OQ6A 1X7VA 2VODA 4CO2A 2W9BB 1KN6A 2OH2A 1WC3A 1DQ8A 2V2QA 3CCLS 1H2UX 3Q8UA 1Y3JA 3DRPB 1RACB 1P1LA 5KFXA 1IR1A 1FO1A 1J27A 2BMBA 1RZMA 3DLLQ 1B3TA 1ZAVA 4DV5F 3AAWB 3QWUA 4NLYA 2BE2B 3TJAA 3JS9A 2YWHA 4J9OA 3DN9A 1Q4RA 4C11A 1L3SA 3EPIA 1IJEB 3RW7A 1S0NA 1RBAA 2V9WA 3W65A 2VH7A 2W2OP 1S49A 2ZOFA 3OXFA 4IFYA 3UO0A 5D6GA 3FCVA 3Q0AA 1HFEL 3KJVA 1T9WA 2E1PA 1FA0A 1GEHA 1Q16B 2KG1A 1FFSB 4ZVEA 3LP2B 3NNCA 1NHUA 1RAAB 2Y1IA 3UD3P 3QWPA 2GGPA 4OZ3A 1KQGB 1T3NA 1N33J 3TUZC 3W62A 1FDAA 3R7NB 2M3DA 1FKPB 1H38A 3C15B 2W2PP 3JXOA 3M2UB 4WKYA 1YBUA 2CRLA 1QTMA 4ECTA 3VGUA 2G1DA 4ZJQA 1MMLA 1UWBB 3Q24A 3POTB 2A2DA 5G4DA 2RDDA 2B56A 3R3TA 7FD1A 2MKIA 1BWEA 2IYIA 1WF1A 3BO2A 4DFMA 4OI6A 5GAEI 2XB2D 3MCMA 3SYZA 3G6XA 1S4FA 3PR5B 3O5TB 4TXSA 2DRDA 4EWTA 4LSNA 1VLOA 3SBMA 1R6YA 2R7RA 1KD1T 2GZOA 4FBUA 1V3ZA 3U27A 5HBMB 4ED2A 1UETA 4PG5A 2RS2A 3KKFA 3H4DA 2IDLA 2MTLA 1QSSA 3RBZA 4TYBA 2ZC3A 4NXMF 4O0IA 3US5A 4P10A 2OEMA 1QY7A 4K0KF 3T9NA 4C8YA 4DV2F 2LDYA 2YNHA 4NL5A 4NI2A 2DO0A 3UQSA 4GRSA 4PQAA 5E3PA 1H7XA 2R7OA 2HQDA 1ZPWX 1DRZA 3GCWP 3CCES 3PV8A 1S48A 2DNPA 2OI2A 4NLXA 1HNVB 2IJFA 1JQGA 1RCXB 2VC1A 3IWLA 1N5TA 4NYZA 3UCUP 3VAFA 2C2RA 1DJ0A 5KFLA 2J0SD 3LF0A 5EHHA 4I6AA 4OLOA 3J7YI 1HMVA 1S97A 1SKUB 3QLHA 2OIHA 1YSJA 2K1RA 5DDQC 2NXEA 3QJPA 4F36A 3KHLA 1T03A 5EUHA 2SXLA 1T7PA 4KKOB 3GIJA 1VRTB 4RNNA 1FCAA 4DOZA 2HK2A 3CJRA 4IR9A 4QBUA 1S0OA 4ALZA 2PN6A 4A46A 3MUMP 1TK8A 3W5YA 1HA1A 3QBCA 2Z56B 3TJ9A 3M6XA 1K1SA 3LPYA 1KOHA 3OFEA 2RQ4A 4EI2A 1RP5A 1EB0A 3T5KA 5LMUJ 1JLGA 2MZTA 2V9KA 3MR6A 4O3SA 1R89A 2A3JA 3E8OA 2BJ8A 4P7TA 3AOCA 1VQ4S 1F2GA 4C0BA 4DR4F 2UV8A 2B9YA 2ZH4A 1K47A 2N4DA 3GIRA 3RR7A 3QAEA 3CDWA 3GTYX 3CD0A 1LKZA 4IUFA 2G0JA 1LWFB 1RT4A 4YQWA 1FDNA 1Y4ZB 5SUHA 4OYIA 2OSRA 1VQMS 5HVFA 2BJ1A 2V8VA 1CULA 2EPIA 1X4CA 1F60B 1SJQA 2ACMA 3OT9A 2VU5A 2M8DB 3G82A 4E98A 3KLHB 4LVOP 1U47A 2IRYA 2V4JA 4OYPA 3WIVA 3O3LA 1JLQB 3I32A 4I2PB 3NEKA 1RT3A 1YK9A 4PG6A 4J9PA 2ZBRA 4NZ6A 4PZVA 4C8MA 2W9CA 4OYZA 1YJTA 3Q89A 4ED0A 2CQGA 2WOMA 1RA6A 1BQNB 1YTYA 5B0AA 2DPIA 2E5LF 2ZJPQ 2QG9B 2Z30B 3AXKA 2E66A 2B4OA 3PYGA 4ID5A 3NXZA 2HNZA 2R8JA 3FNNA 3OR2A 4IQMA 4P52A 4LF1A 5C42A 2XI3A 3I0SA 3HHLB 1YJRA 1QAIA 1RLDA 3W2VA 4M5DA 4TU8A 5EN1A 5FDLA 1RB0A 3OW2R 4WF9Q 2QRRA 1EX8A 3ET6A 2W2NP 5E33A 2RVJA 4PWDB 2M4MA 3G9CA 4QIVA 4FXVA 4PXDA 5MAOA 3OUYB 5F0UA 2FIUA 4URGA 3O1LA 4CDIA 2HEKA 3KLIA 3F41A 5KT7A 4DU7A 3AA9A 4DWIA 1IKXB 5C24B 1XJWB 3GV5B 2KHDA 3H20A 1C0UA 3UWTA 2ZITA 4QYRA 2DNRA 1HBUA 3PRBA 3VF0B 3C6UA 4J9MA 1U02A 3GPAA 5E3QA 1TVRB 2HRYA 2BQRA 1OPIA 5IC6B 1IVZA 4IH7A 3RZAA 3FCHA 1S9GA 1X0PA 4F4KA 3BKUA 2N3LA 4IDKB 2HNDB 2JEGA 2VA3A 4MKYA 2PT0A 4URSA 1MU2A 2HG4A 5IV3A 2V68A 4CH0S 3G96A 3GJSB 1HYSB 1UPPA 2K3IA 4Z7YA 4A8QA 1C1BA 5DJBA 2YNFA 3QIDA 5AE3A 4DV5J 3NKYA 4MJKA 1QSLA 3PR4A 2AX1A 3HSJA 2HQIA 4USKA 1Y11A 4DL4A 5DGAA 3TA1A 4WKRA 1HWLA 2FGCA 2E1MC 4CLKA 2M7SA 1JLBA 1Q95G 1LW0A 3MTKA 4B3RJ 1WDDA 2U2FA 4LF4J 3MMAA 3I0RB 1HL6A 3GWCA 3GILA 3N0VA 1XR7A 3UW1A 2C2ZB 1XNQF 3HP6A 3PJWA 2EFVA 3VQTA 2B5JB 2J9DE 1Q8KA 2J5AA 4NA1A 4FNIA 4DPTA 2C3UA 4K4XA 1TMMA 5D0HA 1IR0A 4OYOA 4PUOB 2AQ4A 1CJTA 1URRA 1NEEA 1CJVB 2DGTA 1SIWB 5D4OA 5E5NA 1EIYB 2KZMA 5ETQA 4USHA 3HX9A 3OPKA 4X2BA 3RU0A 4IG0A 4JP8A 2P8IA 2FB0A 4OJ3A 3GJQB 4A8OA 4ZVPB 1KNZA 2H4YB 4DPWA 3GFZA 3MM8A 1VQLS 3AB4B 3MECB 3CJTA 4RW8A 2PDAA 3Q8PB 4OJ1A 3MOJB 1CS4A 1TL3B 5IQ6A 3L7PA 5DG9A 4NXMJ 4K50A 1XMOF 4JI7J 2CQ0A 2HS3A 3PW0A 1KBRA 1HQEA 3OXGA 3PKYA 3WZ0A 1OWXA 1BWVA 3NGKA 4MK8A 3CCUS 4JI3J 4N76A 5I4MA 3V6DB 4DR1F 3BQ0A 1C4AA 4ZN1A 4V1Ak 2CVIA 9ATCB 4YFUA 4M5JA 4DV6J 1TAUA 1BQMA 3BKTA 4D3HA 2G0CA 5KG4A 4PYDA 1QSYA 4HVZA 4X4PA 4J37A 3JQKA 2VASA 1GXTA 1VBXA 4Y00A 2IA0A 5E3AA 2W7OA 2YTCA 2NXCA 1M1KT 2UUBF 2MQMA 2JRSA 1C0TA 3J7AN 5IWAF 1FNXH 1N36F 5HJXA 1VS3A 2PD1A 1LWXA 1ZM9A 3HLUA 3BB5A 2M0GB 3MM5A 2Z57B 5JJBA 3L95X 1QVGR 2F1FA 4UOHA 3CCMS 4YB7A 1TKTB 1WORA 2W01A 2NQPA 4C7QA 3LH2S 3EZOA 1IKYA 1HQUA 4ZHRB 3THVA 3TVZA 4E2FB 4CT8A 1LWEB 3SFUA 4DR6F 4ZKAA 3M7VA 4C3KA 1VBKA 3DM2B 1YX2A 4YY3F 2JSXA 4Y2AA 1QLNA 3TYTA 5IXUA 4QYZK 1X5SA 1Y0HA 5U47A 4WTOB 1OSCA 1T0TV 3ILLA 3N01A 3GYNA 1URNA 3J81U 2HMIB 3R8YA 1S57A 1KFSA 4EFAC 2LDIA 1X4HA 2B43A 3NS6A 4QW8A 1NRKA 2E5GA 2JNJA 3VVTA 2MLYA 3LANA 1AYEA 4ES1A 5T7LB 2N3OA 4M5KA 5IC4B 1LNQA 3H8YA 1FD2A 1U0HA 3V4IA 2PSZA 7AT1B 3PIOQ 2GS8A 3AH6A 3M1VA 4CO4A 1AFJA 2KZZA 2Y9HA 3OFGA 4DF8A 2VFUA 4A8FA 3D1OA 1JIHA 2X1AA 2JHEA 2BACA 4RW6A 2DGXA 4L3NA 1RWOB 3DLEB 3JTNA 2HNYB 3CC7S 3UPFA 5FLXU 3PEJA 3T1YJ 1CQMA 1FEEA 1M1HA 4RNOA 1LW2B 2MKJA 4YR2A 2XMKA 3HO1A 3AY0A 4DX5A 3GU0A 4Q0BA 5IS2A 2VBYA 1OYDA 2HFNA 4RX6A 3JYTA 2BYCA 1SH2A 2HIYA 4R5PA 1HBOB 2VA2A 1N5YA 3ZNUA 1RUSA 5DLGA 1EARA 3QFWA 3ZNJ1 1IWGA 4I6WA 4CLYA 1SJRA 5GMEA 4HACA
chains in the Genus database with same CATH topology
3R5CA 5B08A 1YRTA 4O3PA 2E1AA 3I4HX 3NBPB 3DHWC 4B3SF 4DL3A 2L08A 1FHTA 3DFEA 3OR1A 1VFJA 4QWEA 4F3MA 3DRSB 3G6YA 1S1TA 3MUTP 4IFVA 2QEXS 4IG3A 5K5MA 2VV5A 2KDOA 3SCJE 2CQIA 4X4NA 2RMLA 5KFBA 1VC6A 4DV4F 3V2UC 1U4BA 4IYQA 4NX9A 1LK5A 4NA3A 1KONA 4KV8A 3EGNA 4I6YA 1DFDA 1PSDA 4CI0B 4RLEA 3CC2S 2UXBF 3MAQA 3TOQA 3MD3A 2DD8S 1N5QA 1YRXA 1RT6A 3FJ2A 3OHBA 3OTBA 1S6PB 4K5RA 1HPZB 5JVGQ 4DG1A 1TKDA 2RRAA 2X3GA 3KK1B 3MMBB 1FKOB 1XN9A 1BQMB 2MZSA 2LXIA 4Z2XA 3Q23A 2XS5A 5KFKA 4OJGA 1GXLA 3PFOA 1UFLA 5DDPC 2GIRA 4PG7A 4ZVFA 2KH9A 2R2RA 1U6BA 3QGIA 5DLFA 1LOUA 3E3XA 1Z1ZA 2H5EA 4KSEB 4ECZA 3O44A 2G13A 4A8XA 1XWLA 3FMBA 2Z2MA 1MMDA 3G6VA 2HPUA 3E51A 3MF5A 4Q5VA 2MJNA 2QLXA 1QE1A 2E9RX 1QAXA 4IOAQ 4G1QB 4DSFA 1GX5A 4WK1A 4DUYF 2F8HA 2OMLA 3CTRA 5LSRA 2W4PA 2YKNB 2E9ZA 3IGNA 1VI7A 2FUG9 2V8GA 1C0TB 2VC0A 3BEGB 5F41A 1FK9B 2FJEB 2FVPA 3QO9B 1NK9A 4XPCA 5KFQA 5I3UB 1A6LA 4CTAA 2M9KA 2Y1JA 1U1NA 1YIJS 5EX0A 5FLXY 3MM5B 2DNOA 5KFUA 1TP7A 3TI0A 1FJCA 2JLGA 1F5CA 3CIMA 1TL5A 2FHJA 2UVWA 5HQ8A 4DR5F 1SJFA 4HH1A 1NB7A 2ZHBA 4G1PA 1TL1A 2CQ3A 2N4CA 2KTQA 2P9CA 1X4FA 1HW9A 3DXBA 2GJ2A 4DMZA 3K8VA 3K57A 4PQUA 1H7WA 1JJ2R 2XBPA 1A9NB 4TLRA 1MSWD 1Q8IA 1RT7A 4UY85 4ERDA 4H4MA 1M0SA 3I5CA 3PFEA 3ITHB 1IKYB 3R5DA 2J0WA 4RNHA 1HQUB 3H40A 3T9ZA 2VL1A 1D3WA 3SDEA 5B0BA 4DSIA 2HHVA 2RKIA 3FEXB 2M88A 4WJBA 3UI3A 4WU3A 2ROPA 1T95A 2BZ2A 2W8KA 1UAWA 2MYFA 1U1OA 2W9AA 4CH7A 4FS2A 3AHPA 3Q8QB 2FJVA 4X4TA 1YJVA 2QE5A 1JJHA 2PGCA 4PPDA 3UCGA 4LF9F 4R8UB 1VQ6S 2LVWA 2POKA 3QGPA 4KFBB 1S10A 1B64A 3QZ8A 4PWUA 4U9RA 3IG1B 1ZAWA 4XO0A 5M2PA 4WFYA 2FJBB 4DFJA 4CZCA 1LV5A 4I2QA 1XK8A 2YY3A 3DGPA 2AYEA 1NAQA 5H1SV 1Q53A 1HHSA 4K4SA 1JXLA 1R8AA 2ROEA 3VTIA 5J2NB 3I56S 3QJJA 2B7CB 4MK9A 1T02A 4Q8EA 4IH5A 1U6FA 2KFNA 3TP2A 2HFZA 4ITSA 1N48A 3JSMB 2MMYA 4LMZA 3DMJA 3SQGB 4X62F 1J2VA 4F4WA 4QIWD 1KRPA 3KTQA 1FRHA 3IR7B 4DV7F 1KC8T 1HD1A 3K5PA 5IZHA 2JJ4D 5CZXA 4XDCA 3MM7A 2AJFE 2CYYA 2FHOB 3GFYA 3QYYA 4URQU 2DHSA 3GZ7A 3ZZYA 1RISA 3H2LA 2VOOA 1T05B 3RB4A 1UVMA 1J5OA 2DGVA 2XULA 2A1BA 4Y2CA 2KXHA 5IQQA 2LMIA 2Q79A 3I6PA 1S1UB 3G8QA 4EO8A 1NKBA 3HHKA 4Q2LA 1FTCA 1DURA 1N0VC 2E1CA 3GV7B 4WXOA 1KLMB 1NZAA 4KE5A 1CSJA 1FXDA 3MI7X 5GMKa 4O4GB 3WC2A 1HNIA 3RAXA 2D3ZA 4PPZA 4EU0A 5HO4A 4LJMA 4DQPA 4EBDA 3NMRA 4Y28C 2ZFHA 3NCRA 4ID8A 4EBCA 2VB6A 1TL4A 2UXCF 3N28A 4Y2IA 4ZCLA 3G8TA 4JI2F 1RK8A 3LO3A 5EWGA 3MPVA 4F2SA 2B9WA 3GMGA 3V4IB 1ZH5A 3DHXA 3JSYA 3CD7A 2F8EX 1TQLA 4NRTA 4ED7A 1JLCB 4R0EA 3GR0A 4NCGB 2EFPA 2JFKA 3WBZA 2ZZNA 1N88A 2RT3A 3KLEA 3TX8A 1GT8A 1S1VA 3M1VB 1SI9A 3J7ZT 1Q81T 2IVYA 2ZNZA 2Q3PA 4NOHA 3K59A 4DFPA 5HLFA 2AWZA 3IAM9 1U25A 1B0VA 4OX6A 1VQ8S 5FJ4A 1QJHA 2HFOA 1FDDA 1Q8LA 1S6QB 2AX0A 2J7UA 3AA8A 2DGUA 4Y2MA 5LSOA 1FRJA 4JUZA 2W25A 2UUTA 3TAPA 2L9WA 4PG8A 2MKCA 5L1LA 4WFAQ 1HNXF 1O5JA 4RW6B 1AXQA 3IA0A 2WHOA 3IRXB 3U1MA 2HWTA 2DNLA 1JLFA 2YWFA 4AE5A 2WK4A 5HROB 4AYBD 4JOUA 3CC4S 4LQ9A 1HWKA 4B3RF 2OPPA 4HYKA 1KQSR 3DNCA 4DR3F 1JLAB 1QM9A 2YQ3A 3V6HA 4NLGA 5F8NA 1X8DA 4LF4F 3K5MA 3HHLD 2RRBA 4NLDA 2JDJA 1NK8A 2B3TB 4DHVA 2CKWA 3CJ5A 4DL5A 4TKTA 2IC3A 4QWCA 5HP1B 1NJWA 3KK2A 1L3VA 4HH0A 4Y2KA 1ZM4A 1RT5A 3CWJA 4ICLA 3P5TL 4OLPA 2EWHA 2KHCA 3EZUA 2AF6A 3MM9B 4MAKA 4Q0BB 4ZVGA 3T6JA 5GAHU 2MXYA 1ZTWA 2BJDA 1F5AA 3JYTB 4NCAA 3CJ0A 1S99A 4ZPBA 1RTHB 3X3UA 4X4OA 4RW7A 2XNRA 1TKZB 5A8KA 4DQIA 4F3OA 3ONQA 4R5PB 2IRXA 2BW2A 1K0TA 4A8YA 1N5YB 3KG0A 4H4KC 4Z37A 3MEEB 3VAIA 2R7VA 2CVEA 2WSFC 2GQQA 1WHVA 1YBAA 4U7UK 3N6NA 1N4LA 3FFIB 3NNAA 5E0OA 1YRUA 1U2RA 1IKWA 1FRLA 2UXDF 5A6PA 2QT7A 2XEXA 3PW4A 1SJ3P 2CQDA 5GAGU 1SV5B 3M8QA 5J2QA 4ED8A 4X4QA 2KXNB 4F3QA 4NCBA 3CMAS 3C66A 1VJWA 1X4DA 2M2BA 2MHNA 3OLAA 2Q6BA 3FRZA 2ZKUA 1VQ5S 2DH8A 3OR1B 2CPHA 2HHUA 4C2MA 4UW2A 2JEIA 3DCAA 5DG7A 3MM6A 3CIZA 1MROA 1S1TB 4IFVB 3CD5A 4IG3B 4ED5A 3RYLA 3UNGC 2H9ZA 1N33F 3ENWA 2YKPA 2ACYA 1M90T 2HVIA 2CQCA 2FLPA 2YKMA 3HKZD 4ILLA 5KTQA 4AXIA 3IRWP 1C2PA 4KV8B 1WD6A 3N5FA 2GX8A 1WF0A 1VQ7S 4QR2A 2ATLA 2EW9A 2EFNA 3AQOA 4OHZA 5DS7A 5IT9Y 2RQMA 3KOAA 1RT6B 4G3IA 2KN4A 1G7CB 5KFRA 2QA1A 3VAHA 4DG1B 5KOWA 4WFBQ 2NS1B 3M9NB 4Q45A 2XY7A 1UEVA 4C97A 3H59A 1UP1A 2ZNYA 2VPWB 1R31A 2RDJA 4DF4A 2EK1A 2W4CA 3ICLA 3CVKA 3NAHA 5K9FA 5KFJA 3TAQA 6FD1A 3NGDA 1VQNS 4ZCKA 4B3MF 4QPTA 1S0VA 3OL6A 4JI7F 4ZPAA 2BANA 3H25A 1PILA 2IBKA 1KEKA 1SL0A 1D9AA 1HBNA 1ZPVA 1UA0A 4PXBA 2B6AA 2VG7A 1VC0A 4P6QA 2VONA 4HEA9 1W2IA 1YJWS 4I7FA 2WONA 2UVUA 4HTJA 3ZZPA 4LIRA 2CJ9A 2MJUA 2ZC4A 1RGVA 2Z8QA 1S9EA 2JEJA 2B0GA 4B3TF 2VKRA 4QQBA 4X84A 2WBRA 3M2RA 5E3RA 2CIMA 4EO6A 3RTVA 4CTAB 2R7XA 5KOXA 5BJRA 1TZ0A 3L09A 1NNDA 3T5LA 4B9NA 4C98A 3THTA 2XS2A 4O44A 1MMNA 1N52B 4JI3F 1XR6A 3DLBA 2NZ4A 2DH9A 2LEBA 2QA4G 4IO9Q 2PIIA 4FYDA 3SV3A 3IAS9 1TL1B 1S9GB 2FDNA 2HAIA 5IM0A 1U1RA 4ELTA 4F02A 1RQ0A 4LSLA 2WAQD 1UMJA 4PQUB 2CFXA 1NK7A 4Y6IA 4OZLA 2KJVA 3IR5B 1CVJA 5LL6d 1RKIA 1RT7B 2K8GA 3IWXA 5JXSA 1PC4A 4H4MB 3GE9A 2C2EA 1EETA 1MU2B 1R7IA 1XR5A 4DV6F 2HYIB 1AFIA 1E6YA 4F4ZA 1CLFA 3ZFVA 4C8LA 4I1TA 3SDEB 3EZ5A 1AUDA 1RTJB 2RKIB 2AP6A 3PKMA 2C3MA 4H54A 2QLWA 1S6UA 3BR9A 2ASDA 3ZZRA 5F8HA 2AYBA 2BBEA 1GXUA 2VFRA 2OPQA 3QJLA 3M2VB 2F40A 2VPYB 3V4MA 2IM2A 5A0YA 2ZH2A 4DN9A 1VRUA 1CG2A 2XLIA 4OQJA 2QV6A 1V3SA 4U7CA 3DYAA 1FRKA 2V4QA 3ZZTA 1IN0A 3N6LA 3P96A 2XNQA 1VK8A 2PA8D 4QU6A 3BDEA 1NO8A 3PX0A 2J7WA 3DRYA 2PC6A 2YKOA 4QWAA 4I2QB 3M8SA 4M8LA 2YWEA 1U1QA 2NLWA 2HVZA 1K9MT 3E2EA 1IUJA 2O3DA 3M30A 3CD6S 1ZTTA 5F8LA 4RUHA 2PI5A 3I9ZA 4CNZA 3H4BA 4M1KA 4YR3A 4ZPWR 1DTQA 4B3OA 1YJ9S 2W9BA 1VK3A 1KR4A 5D4PA 2BRKA 3PIPQ 3DMJB 4ZA1A 2E5JA 3N9UC 1AROP 4HT7A 3CCJS 4TLQA 3VAKA 2W7PA 2UVVA 5C5JA 1KS2A 4TQRA 3OVAA 3MM7B 2PI4A 3TQ1A 2NREA 4NLWA 1SC6A 3MOZA 5HMYA 1NK0A 1L3TA 2BM0A 1CQNA 1JKHA 1VQKS 3DRPA 1J5OB 3IBWA 3RW6A 1V9OA 1DBDA 2YWKA 3PJXA 2XHWA 6FDRA 3SZ2A 3MPYA 5D4NA 4ZPVR 2EFQA 1QVFR 1BQXA 5KFSA 2IVFB 1Y00A 2BM1A 2R8GA 3OTDA 2FD2A 2KI2A 1YI2S 3EGWB 3OHAA 2JVRA 1U1LA 4LFAF 4X4VA 2CQPA 4NLRA 1BD6A 4N77A 1U26A 2OD6A 3UFCX 2COLA 3MEDA 4EYHB 5KT5A 1NJXA 2AYGA 1FNMA 3AQPA 5A8RA 2VG5A 2DTJA 4EGLA 1HNIB 2IM0A 3TR5A 1D8ZA 1CC8A 4KAIA 4PR6A 1OS5A 3OFHA 5G0RA 3RB3A 2DK2A 1SKRA 4O3OA 3HZGA 2BE2A 2ZDPA 4ZMMA 1NKEA 3DLGA 4IRCA 1E6VA 1SB6A 5LXYA 3HXMA 3T5HA 3KHGA 4UOCA 5HMZA 1DARA 2QFJA 1WHXA 2KYZA 5BR8F 4BHQA 1UJ5A 5F3ZA 4J9SA 5KT4A 3M8RA 4O4RA 2I5JA 1O8BA 2QIFA 1S1VB 1L3KA 2HHPA 2V8HA 1N34F 2NR0A 3IR6B 3KLFA 5HLFB 3C6TA 1SH3A 2XO7A 2W4DA 3BO3A 3AB2B 4USJC 4WIIA 4C4WA 4OHVA 2OO4A 3U7JA 3VALA 4B9TA 1TKXA 3OVBA 1UEUA 4OI2A 2LYVA 3GV8B 1YITS 3MFIA 1DQ9A 3HF5A 4FP9A 3PNIA 3MEKA 1IKVA 5L1JA 2FGOA 3GR1A 3TRGA 4X66F 3NWGA 2FJXA 3QMQA 1JLFB 5DM6Q 2HIQA 2Z0GA 2MB0B 1KLNA 1R27B 2FY1A 4NXNF 4ECXA 1P6TA 2OD4A 2OPPB 2BXJA 3BGRB 4BWJA 3W2WA 4OZ5A 1WEXA 1VBYA 3CUNA 1HBMA 1L5UA 1EP4A 4C8OA 1U1MA 3LP2A 3A1YG 2YH0A 2KM8C 2XGQA 2B51A 3C2PA 1R43A 3W7BA 1N6QA 3MEGA 1H0HB 2IC3B 1NJZA 3KK2B 2RE1A 3JSBA 5B0EA 4RU9A 5AJ3F 4ZPDA 4FS1A 5K8MA 1RT5B 4ICLB 3R1LA 4B9SA 3D0IE 2PA3A 3JTOA 3JB9k 2Q6CA 2XG8A 3ZZUA 3RBEA 2HQ3A 3BSOA 4NYOA 1Y5NB 2IRUA 3CCQS 4QW9A 1RWUA 2DR7A 3OVSA 2RH3A 3HKWA 5M2UA 3DOKA 1SBRA 4DEZA 3M6WA 2C3PA 3HHLC 4OZJA 4QIEA 2ZJRQ 4F4XA 3HHNB 2FPHX 1B0PA 1U48A 4PCQA 2MQOA 4B02A 4RW7B 3PX4A 4FVCA 2ASJA 2DHXA 1MNEA 4QWBA 5HL7Q 2XSFA 3I82A 1Q78A 4FNHA 4DBQA 2AYMA 5A8KB 3L3CA 1NJYA 2DBBA 3M2UA 3KHRA 4ECUA 4NZ7A 2GHPA 1N8RT 3JSRA 1P27B 3JTPA 3SCIE 3FSXA 3SSRA 3V6KA 3FDSA 2BA9A 2OPSA 3DU6A 5M2RA 1UWBA 3RB6A 2K3KA 1CPZA 2MZRA 4PXCA 3POTA 5CYJA 1ULRA 1NK4A 4N8OA 4ZCMA 5F8GA 1XEZA 5CYQA 4DQSA 4XIUA 1N5VA 1IKWB 2O01C 3CDAA 5KG1A 4I56A 3P49B 2HZCA 3DOLA 5DDRC 4X4RA 2DNKA 2DITA 2EBGA 1YVFA 5KFCA 1N5SA 3S6EA 1WTBA 2B9XA 3M8QB 5J2QB 4JV1A 2E7XA 2PEHA 5B0FA 1U7LA 3C46A 2FLOA 2WRMA 5KG3A 3DLHA 2KRBA 3J80Y 4A8MP 2FTRA 4OHWA 3MM6B 2FLLA 1MROB 2DCLA 2BQUA 3T1YF 3BSCA 1R8BA 1VC5A 4ECRA 3CEDA 1Q82T 1T3OA 2YKMB 3OL9A 1JX4A 1YQHA 3HFKA 4NLPA 1JNZB 5J2MA 4IR1A 4NLTA 4OHXA 3JAMY 2GA7A 4HKQA 1V3RA 2B4UA 1MWYA 4TU7A