4LFBF

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lfbF00
4LFAF 1XNQF 4DR3F 4LFBF 4DR2F 4JI6F 4X64F 1IBKF 1HNXF 4LF8F 1IJFB 1N34F 4B3RF 1N36F 1HNZF 4DV0F 3R3TA 1F60B 4X62F 4B3MF 4DV4F 5LMUF 4JI5F 4DR1F 2BXJA 4NXMF 5IWAF 4DV6F 3ZZPA 1N32F 1XNRF 2F4VF 4JI0F 2UUBF 5AJ3F 2UXDF 2J5AA 4GKKF 4DR6F 4DV1F 3T1YF 4OX9F 1IBLF 4YHHF 4DV3F 1XMQF 4X66F 1FKAF 4JYAF 4LF5F 1G7CB 1VMBA 4X65F 4JI3F 2E5LF 4DR5F 4DR7F 4KHPF 2YY3A 4YY3F 2B7BB 1HR0F 4K0KF 4DV2F 4JI7F 4LFCF 2UU9F 2ZM6F 4DUYF 4JV5F 1GH8A 5BR8F 4NXNF 4LF9F 4JI1F 1J5EF 2KJWA 3T1HF 4DV5F 1RISA 1I94F 3OTOF 2HHHF 1FJGF 4DUZF 4DR4F 1CQNA 1HNWF 4AQYF 1IJEB 2KJVA 1N33F 2UXBF 4JI8F 2UUCF 2B7CB 4LF7F 4B3TF 2UXCF 1LOUA 2VQFF 1B64A 2UUAF 1CQMA 2VQEF 1XMOF 4B3SF 2BVZA 4LF4F 4JI2F 4DV7F 1IBMF 4LF6F 4GKJF 4JI4F 1QJHA 5LMNF 2RJZA 1G1XA
chains in the Genus database with same CATH superfamily
3ZZZA 1REVB 5AXKA 2W2OP 4U67Q 3SDEB 4B3MJ 4K4XA 3MZIA 3K5PA 1OYEA 4K5RA 2XGPA 4NX9A 3ITHB 3JAMY 4RW6A 2I0XA 1F6TA 2BABA 4LFCJ 3WX4A 1REVA 2QV6A 3UDEA 2HRTA 4DPTA 1FRHA 2ZJQQ 4NLRA 1K44A 3LA0A 3CO9A 1VQYA 4B9NA 2YNFB 4PCQA 4FXWA 2NUHA 4ZN1A 3IP0A 1NK0A 2YKPA 2CVEA 2WW8A 5IV4A 1S49A 4DEZA 3CF5Q 3CDBA 1VK3A 3RTVA 4Y34A 1DQAA 1MW7A 1LFWA 5F8JA 1S6UA 4WWSA 3DDIA 4DF4A 4ZHRA 1G3OA 3MEDA 5HQ8A 4FF2A 4EGLA 5L8RC 4DR2F 3NRBA 3G6YA 4I6WA 1KVIA 1U48A 2GO9A 2ZE2A 3MEKA 2CKWA 2N3OA 1FHTA 5J1EB 1EB0A 1WTBA 4U95A 3CCMS 2HVEA 3RAMA 2RT3A 5HO4A 3PW7A 2QO3A 4NOHA 3HD2A 5J2PB 3MM8A 5KFBA 2X1BA 1XMBA 3TRGA 1I51B 2W9BA 5J1EA 1T05B 3HLUA 1JLGB 3MM9B 1DLOA 2YY3A 1JJCB 1WEZA 2AGQA 1OJ4A 4CM0A 1U0HA 3CMQA 3ZZUA 4LF9F 1J5EF 2RF2A 2H5JB 3MM9A 5IM0B 2MKYA 2DISA 2IM0A 4RBTA 2C2DA 3M2UA 1HIYA 1UPPA 4DDFA 4G1QB 3ZTOA 3JTPA 5F3ZA 5HROB 4RBVA 5IM0A 4HT7A 3MMBB 3EPIA 4X4NA 2EK6A 4B3OB 4XDDA 4G1QA 4LF8F 4JYAJ 1VRQC 2QG9B 4ICLB 1HQ2A 2CQIA 1IR2A 2IMOA 4OI2A 3M9NB 4MIBA 2VKZG 5AE3A 1R8PA 4H54A 3OV7A 4L72B 4BHQA 3J7Z5 4DS4A 2C2KB 1ZM4A 2ZDPA 1HYSB 1JJ2R 1TMMA 3BH7B 3TANA 4KKOB 2ERRA 4DFPA 1ZTWA 3LPYA 2CQHA 3SZ2A 1IBCB 3SXLA 2GIQA 4K0KF 3BSOA 1HBUB 3EJMA 2PI5A 3T6BA 3FBBA 4TU9A 4OX6A 1R43A 4Y65A 4L3KA 5I3QA 4NCBA 4ED3A 1N48A 5CA5A 3DRPA 1XBWA 3G6XA 3MFHA 4ZP7A 3OLAA 1NKCA 3E3XA 3FRYA 1IJEB 4QU6A 3KHGA 4Q43A 2FY1A 3WBZA 1XQIA 3FSXA 3UNYA 2B6AA 3AJ2A 2KT2A 4HACB 4GVBB 3C66A 5JUMA 4FS2A 4NCAA 1UFLA 2GVZA 1RHJB 3WIUA 1MROB 4GO7X 3D68A 1TKZB 2AJ4A 2J9CA 1HFEL 4DV0F 1NPKA 1H98A 4OL8A 4HACA 4NXMJ 4Q8FA 3CTRA 1TVRB 4DSKA 3MAAB 1XERA 3R6LB 2ZM6J 3GV8B 3QRPA 5KFUA 1D9DA 4LT6A 3C15B 1MWYA 4LUBA 1W26A 1GX6A 3L3CA 3W3SA 3OVBA 1MSWD 1O6XA 3RRHA 2QSFA 3MAAA 5ITHA 2WZ1A 1JLEB 3BBBA 2MLZA 4CM2A 3FRZA 2DNRA 3SEOA 3HHLC 1X5OA 1VQLS 3BGUA 4F8RA 1JLEA 3DRXA 4RW9A 3CJ8A 1HARA 5HMXA 1LWEB 2IBOA 2CPHA 3JSMA 3EM1A 5CAAA 3BJYA 4WXWA 3FEZA 1VIXA 1BC6A 1RXOB 3P5BP 2CQPA 4QQBA 1FI4A 3KMQA 2DR8A 2LXIA 2HNYB 4K8RA 3PIOQ 2UVUA 4B3MF 4QZVB 3I96A 2VC1A 2ZH8A 2QT7A 3M7VA 4OYOA 5T14A 2CJAA 3QIPB 2JJ4D 3I0SA 2GGPB 3HSJA 4WKRA 3VZIA 1B70B 2X3DA 2PD1A 2OP5A 1NRKA 5IT4A 3QIPA 2GGPA 3GONA 3JQKA 4DUTA 2QLJB 3DRRB 1X9SA 3KXDA 2P6TA 5LSRA 2Y1IA 2JEFA 3M8YA 2BJDA 4N5SA 2B7CB 1RTJA 4Y6IA 1RT7A 3M1VA 3J81Y 4TN2A 4OZ2A 2NPIA 3PW5A 3BGRA 3CD6S 4OX8A 1DZ5A 4PG4A 2B5JA 2AX1A 3D1OA 2DK2A 2LQ5A 2MHEA 3C16A 2H3EB 2CPYA 3M30B 1K0TA 4QIWD 3CJ4A 4HDGA 2RUSA 2E1CA 3G71S 2BQ3A 1K47A 3BF4A 4TYAA 5SZTA 1CJKB 3O6QA 2DY9A 2HAIA 4E0DA 2Z30B 2FLNA 1FEEA 1OS5A 1S1XB 4B9MA 5CYQB 4C2MA 3FEYB 5KFIA 1VMBA 3KLEB 3PX4A 2FHMA 4RW4B 4J9QA 4PG8A 1E6YB 1SKUB 1IKXB 3S01A 2YNGA 1NHVA 4EBEA 2EFNA 2WVDA 3EVMA 4YB6A 1VHFA 2OSRA 2MXYA 4ZVOB 3M9OB 1E6YA 2VQFJ 4ED0A 1KQSR 2HNDA 3I5BA 1SJFA 4JI2J 3CJKB 2QJ3A 3QIDA 4CNZA 3NGTA 1WDTA 3SQGB 5H9EJ 3KHLA 5B0CA 4O3QA 2AD9A 1XR6A 2FIUA 2Q6CA 4UQTA 2G2ZA 3O8WA 2K06A 2BZ2A 2LQJA 4ZA1A 3K17A 2ASLA 2OEMA 4CO3A 4PABA 3V4IB 1LWCA 4ALZA 1HBOA 3U27A 4E8UA 3D6TB 2EK1A 1OPIA 2F4VF 2W2MP 2I5JB 2LCWA 2ZFHA 4DPXA 3OL8A 3QGHA 4KY3A 3SSQA 4FNHA 5IT9U 2MSTA 1H38A 1QAXA 4GRSA 2E1AA 2OTLS 5FLXU 1S1TA 2IRXA 1IKYB 1F2GA 1JNZB 1Y3KA 5KAKA 3MR3A 2O3DA 2W4DA 3PFEA 1FA0A 1X4CA 3W2VA 5HANA 3EZ5A 3VAGA 4DQRA 1YKWA 3CCZA 2RRBA 1YIJS 3DOKB 1KQGB 4FNIA 2CADA 1Q86T 2PEHA 3GSDA 1RI7A 4Z7CA 4JI4J 2W25A 3GR0A 4A4JA 3RAXA 4XTTA 1X7VA 1CJVA 1M5VC 1XR5A 1XNQF 5CD4H 3GFHA 2LECA 4QW9A 5DDPC 3O3LA 2KKHA 2HHXA 5IWAJ 1RAFB 2NR0A 4I67A 1OY6A 4RUHA 4NXMF 2Y1JA 2C22A 4OYXA 2HWIA 3EPGA 3JTNA 4ECUA 2BRKA 3DLKB 3VGTA 4EWTA 3MMJA 2VONA 3DLGB 5HN0A 3DGPA 1EETB 4QWBA 4OQJA 3M2RB 2BM0A 3AAWB 3R7SB 1YBAA 1YJRA 4M5LA 2XQCA 1WOOA 4A8WA 2WB1D 1EETA 5LXYA 1FJEB 4CO5A 1A0OB 4TXSA 2IAJA 3BZQA 3FSYA 2HMIA 1HHTP 5C5JA 3MEEB 3ZZOA 1NK5A 5HQLA 3D2WA 4IDKA 4ZVRB 1RWOB 4PQUA 2AYMA 2BYCA 3P8BB 1RWNB 5C7PA 5T7LB 3AJ1A 2R8IA 2AU0A 4ZLNA 1DFDA 1IKWA 1KTVA 2GC8A 3FBEA 5D3GA 3NWRA 1S7HA 1T8EA 4C8NA 3SQOP 4WCEQ 1NBEB 2WB4A 3DLEA 2UUTA 3F44A 4OHZA 5J2MA 3UN5A 4DR6J 2ASDA 5C24A 2CPEA 4OFZA 1P6TA 3L09A 4RW7B 2CQ4A 1RDRA 2HLUA 2HK2A 1NDKA 5CYJA 2M7SA 3V6JA 3A13A 3CCQS 4OV6A 2ZC4A 2G9OA 1AUDA 1OIAA 3ISZA 3BM7A 1N0VC 2MLYA 3PEJA 4JI8J 4LF7J 2IBKA 3CCRS 3PX0A 3FQKA 2ZBRA 1YX2A 3KOAA 4HT5A 2PI4A 2DHSA 1R0BG 1JLFB 3GLJA 2W8LA 2RQ4A 3IMQJ 5AJ3J 2CZ9A 1R7IA 2LEBA 5FDLB 3HULA 2PFDA 1R8BA 3OPKA 4I2QA 2XMAA 2X1FA 3HZGA 3LAMA 4USWA 5J2NB 5A8KA 3T1YJ 2Z4PA 4R0EA 3SIPB 2JFKA 4P73A 3LGNA 2RKIA 4RKUC 4LSNB 3PW4A 1NH7A 3HZEA 3OL9A 1HNIB 3T6JA 5J2NA 3D0GE 3BO3A 3W5XA 2DNGA 1JNRB 2NXCA 2QLXA 4AXIA 4HHJA 1GAOA 4O44B 2KXNB 2V8DA 3CCTA 2RVJA 2R8GA 4C3MA 3IGVA 4LSNA 1S72S 3I56S 3B8HA 1HNIA 1PC5A 1A7GE 3ELHA 3AOBA 4W98A 3LP2A 3BQ1A 2AYBA 5F8NA 4XPEA 1C1CB 4DFMA 4UW2A 2VQFF 3I82A 4CTAA 4QU7A 4JI2F 2O1PA 3KLHB 1KHVA 2IJNA 5IC6B 1ZS6A 1REGX 4NCGA 4RWWA 3ILOA 2EFVA 1C1CA 1M1GA 3FJ2A 2XGQA 2UV8G 1WF0A 4NLXA 1NZ8A 2MZRA 3ULHA 3MM7A 3GJRB 3ISND 4K5SA 1RABB 2NSCA 3KLHA 1RSCA 2QL9B 1WEYA 2ZWPA 9ATCB 2APOA 1ZPWX 4NEZA 4NA3A 4GC6A 2VIHA 2VPYB 2OIHA 2MQMA 1CULA 2QEXS 1TKXB 1MWZA 1R0AB 2FTRA 3A8JA 4DCJB 5CABA 5LL6d 1N5SA 1YQHA 2PGCA 2BE7D 4DSLA 2JEIA 2BKNA 4LQ9A 2VFSA 3FNNA 4IO1A 2BM1A 1PYOB 4ENOA 2N7YA 5G0RB 2GO8A 1Q8KA 3AXKA 3TUZC 3CNQP 4DR4J 4DS5A 3NMRA 4HYKA 1RACB 4A8OA 2UXCJ 3KJVB 4B3RJ 3AT1B 1IBMJ 1B64A 1JKHB 3D5MA 1YVFA 3HO1A 2RDIA 2CFXA 4U96A 4JI4F 2E5HA 2B9YA 1X8DA 5D77A 2VOPA 3CCVS 1KC8T 4CLFA 4WFNQ 4UZCA 2CXEA 2LFVA 1KFSA 1JKHA 3OTEA 3SCJE 1TL5A 1BLUA 4IR9A 1VBXA 1PO6A 1VBKA 5IWAF 4K50A 4IG3B 5K9FA 2DXEA 4ECYA 2LYVA 3RR8A 3K59A 2BA9A 2DCLA 3IR7B 1UA1A 5F8LA 1FDDA 4LRAA 2YWKA 3HKZD 4D3GA 1W2BR 4WFZA 4P74A 3I6PA 1NHUA 2UVVA 4TY8B 1N8RT 5ETMA 4O4RA 1JK9B 1Q1KA 1X5TA 4OI4A 1SIZA 2AJ1A 3KK1A 5HATA 3ET6B 3GV7B 4LMZA 4WE1B 4EBCA 3ONQA 4RUAA 1S76D 2AZ3A 1XNRJ 3Q2SC 3JTOA 4W92B 2GMJA 3ET6A 4P2SA 3EVWA 3VAFA 4UOHA 3S8SA 3W7BA 4ES3A 4AL6A 2DGSA 4Y2CA 1JB0C 4CLTA 4DPUA 1P1TA 3CCES 3KUGA 2RQKA 2Q66A 5B0AA 3A8KA 4L75A 4O0NA 3TR5A 4ZCIA 2HRYA 1TMJA 2XYPB 4MJKA 2HIYA 2DNZA 3IS9B 4DR6F 3O44A 3LWLA 3WIVA 4H4OA 1EARA 3RB6A 3FCHA 3D4JA 5GMEA 1F3VA 4DQIA 3UWTA 2R2TA 4KHPJ 4YY3J 4DV2J 5CQGA 1AZSA 3TUPA 1FX4A 2F7VA 4IG0B 4ED6A 3T1HJ 1UEUA 1FRIA 1OO0B 2Y1RI 1EAYC 2W9AA 1F5BA 3I31A 4V19X 4N47A 3P4UB 1NJYA 2QA4S 5F8HA 4JI8F 2RNEA 4DQQA 1BHNA 1XMOJ 4LF7F 2HFVA 3J7ZT 2HVZA 2YWWA 1JLQA 5BYSA 3CC7S 3Q83A 1LQ9A 3KJQB 1VR6A 1QY7A 2E5GA 2V8GA 3DMJB 1UW9A 2FVQA 4I2PA 1NPPA 4LSLA 2V8HA 5L1IA 1FRKA 1CLFA 3V6KA 2JL9A 3J80Y 1D9AA 2YKNA 2MDAA 4XPCA 2ZOGA 2C3MA 3IWXA 5L38A 2WONB 2CG8A 4NWBA 2DR7A 3DMJA 1VI7A 3BN4A 2LA4A 3H2UB 5B09A 3T1YF 4OX9F 2NXEA 2M70A 4X66F 4I4BA 4PZVA 4J9LA 3E01B 2R8JA 1RHQB 4MFBA 1NJXA 4LRFA 1U4BA 2H54B 1VQ9S 5CZVA 4Z7YA 3BS9A 1N6QB 3IXQA 2WBRA 3N79A 3M6UA 2F9DA 1YJ7A 3UDVA 1V9OA 4QYRA 4MK8A 3LAKA 4K2JA 4U7CA 1FFSB 1OPZA 3UQSA 3I0RB 5F0WA 3LPEA 3G82B 5F8GA 1CPZA 3N28A 3CVKA 3HFZB 4PWDA 2P6SA 1B4SA 4YR3A 2UXDJ 3KLIB 1JJHA 1N0UA 1R8AA 5A2QU 2KHDA 1SBRA 3H5XA 1WF1A 2A10A 4B17A 5LT5A 4M5HA 3CMES 1BGXT 1PILA 5ETNA 3ZZPA 1U2FA 1AYEA 2ZH2A 2HS0A 3FFIB 4NI2B 2IC3B 3GG1A 2IYGA 3EZOA 4DWIA 2FJWA 2VBYA 4IFYA 4EMDA 2PMWA 5MAOA 1SB6A 1YDLA 4QIGA 4JI7J 3K58A 3PYDA 4ZJLA 3FFIA 5BR8J 4KO0A 3M8SA 1H0HB 1GX5A 1SJ1A 5DLGA 1RT1B 5HJYA 1X0PA 2DNLA 4DR4F 1FK9B 5DJBA 1RCXB 4O0IA 3HJVA 2N3LA 2UXCF 4IQMA 3AJDA 3NNHA 2B9WA 3R5GA 1KNZA 3CSKA 1IBMF 4K4VA 4K4TA 3SFGA 4DQPA 2D69A 2QX0A 1SV5B 1FK9A 3A3NB 3G8SA 2VPWB 5K14A 1DBDA 2J8SA 5FLXY 4FF1A 6FD1A 4FVMA 3W65A 3LGMA 2ZH7A 2HGLA 4NLUA 2YVSA 1N32J 4NLSA 1SV5A 1WNEA 3H98A 3UCUP 1SVDA 2YBVA 4R5PB 1AA1B 3KHHA 2BJ7A 3KKFA 3IA0A 2C2OB 1T94A 2C3YA 5C42A 2CPJA 3MD1A 3O2IA 2C2NA 2QZ8A 1S6QB 4Z37A 1D0EA 1RLCL 2YKOA 3BQ0A 3MM5A 5F9NA 4F04B 1HI1A 1S4EA 1BQXA 2KT5A 2HHHJ 3TW0A 2FHOB 5IZHA 2NUUG 1R3NA 2P5VA 3AQPA 2I8EA 4KH0B 1JLAA 4ECVA 4DSFA 4M5IA 1RT3B 1Q8LA 4QPXA 3PX6A 1WC4A 2V68A 3M8QB 4G3IA 3DYAA 1UW4A 3A8EA 5E3RA 3SI8A 1NDCA 2SXLA 1U26A 2ZZMA 3HHLA 4X4RA 1M5OC 1O0PA 1K1SA 5D4PA 3V5RA 4X4UA 2X51A 2ZBIA 1RTIA 4KGZB 2EXUA 4C48A 4YS2A 4ZLLA 4WPAA 2XZDB 1P9QC 5I3PA 2DIUA 3QMQA 3QLHB 2UVWA 1MWQA 2MKJA 2PMZD 2UXBJ 3M8RA 1H6KX 3B78A 2YNIA 3IM9A 4KHPF 2XCPA 4YY3F 5MLCV 2PA8D 4DV2F 2LQ9A 1QDUB 4FZVA 1DAXA 3T1HF 1BY9A 1RISA 1FKPB 2NZCA 4HI2A 4C7QA 2DD8S 2XO6A 4H4MA 1RAJA 1HI0P 4KPCA 2ZNZA 5KFGA 1XMOF 1TV6A 3TA2A 2HFOA 3BV8A 1FKPA 3IBCB 3VGSA 4KHMA 3HSGA 3HSZA 4DL6A 2E1PA 2YWHA 5I42A 4YR2A 3RW7A 1M1KT 3MPDA 4Q8EA 4USKA 1MU2B 3P5TL 4LRDA 4C8MA 3UI3A 3IRWP 2GMHA 1C4AA 2R3VA 1LW2A 1NCLA 1HNWJ 3NAIA 2G4BA 3CJTA 3VALA 4DG1B 2W1BA 4H4KC 4P75A 2V2QA 2QL7B 3ZNJ1 2VA2A 3EICA 3U7JA 4UOFA 1URRA 1S0OA 3P3DA 4J9NA 2MQQA 1FRJA 4DG1A 1V6HA 1KN6A 3QJPA 1KFDA 3X3UA 2N82B 3RBDA 1F9FA 1B3TA 3GV5B 1X60A 3TNVA 4YR0A 4CCHA 1WI8A 2MQPA 2F40A 5LSOA 2BACA 4KAIA 2XMJA 1L3TA 2OUGA 4I7FA 2KZMA 5DQHA 2OPSA 1MMDA 2V4JB 3H8YA 2HW3A 4C9DA 2AEJA 3VZHA 5A8WA 2KO1A 2D3O1 4DL0C 3JXOA 3ZTPA 4KFBA 4PG7A 4QIEA 3G96A 1IXKA 3BR8A 3RB4A 1QLNA 5AXMA 4ZN3A 2QA2A 3N6NA 3J7A1 5HI7A 4LBIA 4JI7F 2DRBA 4V19J 3UDCA 5BR8F 3VGUA 3ENQA 1L5UA 1H72C 1FJGF 1UCNA 3OUYA 1WF2A 1U25A 1DY3A 1OY9A 2OMLA 3CD7A 3V81B 1Y00A 4RNHA 3MF5A 2CA9A 5B0EA 1LNQA 3QWUA 2KI2A 3W62A 2WRMA 1GTHA 1TUWA 3M32B 2AEFA 1SL2A 3OXFA 2CQBA 1WACA 1ZM9A 2H48B 1SXLA 2BEFA 3DXBA 4OHXA 2DEJA 2MKIA 1N32F 4OI6A 1P27B 4R0JA 1SPBP 2ZHBA 4NLVA 2GIRA 4YP3A 1HKAA 4MAKA 1GFWB 3PRBA 3MM6B 2W2NP 1NH8A 3BSAA 1FNOA 1EJ7L 2CQ2A 3G6VA 5M2UA 4EFAC 2G1HA 3IRXA 4E98A 2VDHA 5DDQC 1S0MA 1WD6A 1GTEA 2D74B 4XO0A 1KD1T 1WUUA 2MQ8A 1S9GA 2CPXA 3VF0B 2V50A 1R31A 2ABYA 2HHHF 1RT2A 2YPZA 1HWUA 2CJ9A 2ASYA 1G4CA 4A46A 1L3VA 4AE5A 2CG4A 2KB2A 2M52A 3CDEA 2K1RB 4DR1J 4HEA9 1HD0A 4C8YA 4P9SA 4OLOA 5ETPA 1KLNA 4AD6A 2HVHA 2NYHA 3BO2A 2GW8A 1PGZA 2BV3A 2M3DA 2RILA 4FYVB 5LMUJ 3GIJA 4X62F 3H40A 4OYWA 2G1DA 2WW4A 3OLBA 4JI5F 2BXJA 4ID5B 4QWEA 3CXCR 1RHRB 1S6PB 5DO2A 2DGVA 1ZZNA 1TTHB 2LQBA 3NCPA 2BW2A 2C2ZB 1NXIA 4JV0A 4ID5A 5ETTA 1ZAWA 2HQGA 2KYXA 3HP6A 2LU2A 4OHWA 4NXNJ 3DHXA 3DN9A 1HQEA 3RBZA 3PVXA 3DOLA 2RUGA 1PKUA 4S0MA 4A8FA 1J2VA 3GWCA 1RE1B 2ZWOA 3RRGA 1U49A 2CPFA 1JXEA 2K7JA 3VWSA 1WHWA 2OPRA 3MEGB 1G2EA 4ATNA 2RQCA 3JYTA 1D8ZA 4HI1A 4FXDA 4NYOA 2VV5A 3FBCA 1MLAA 4F3QA 4URQU 3OSPA 4USHA 1IJFB 3OTBA 3DM2A 3MEGA 3TUIC 5IOLA 2XTJP 1H2VZ 4OYZA 1VIOA 4CLSA 1GQEA 4BWJA 1S9EB 4U7UK 4OZ3A 4FS1A 3GIKA 1TUGB 1S10A 4X65J 3Q86A 2R7SA 1MNEA 2QN6B 1F9HA 1VLYA 2FGOA 3MFIA 1S9EA 1JLCB 2DO4A 1HLWA 1KLMA 3KK2B 3LP0A 4YUDA 3DOMB 4EI2A 1SL0A 4A8MP 1OY8A 3M8PB 4F3MA 3PFOA 3QJLA 4AQYJ 3OFEA 2AV5A 4USVA 5C25A 3ENAA 5KFKA 2F65A 2FVPA 3SV3A 5KFPA 2COLA 2HZCA 2GV1A 3H2VE 4ZS6A 3MMCB 4HTJA 4ZJOA 4IFVA 1MMLA 2QTWA 2G13A 2XY7A 6AT1B 5L46A 2YH1A 4X64J 3RUBL 3AA9A 2PO4A 2I38A 1WEXA 4PG5A 2WCXA 1ZM3A 4DR5J 5B0BA 2AZ1A 3MMAB 3I4PA 3TJAA 3LWMA 2D9PA 2JLFA 3GFZA 3M2VB 2J0QD 4LF2A 2V67A 2Y1LB 4HL9A 3W9HA 2LP4A 3UR3C 3UPFA 3MMAA 4USUA 4K59A 4PRFA 2VB6A 1RGVA 2VJVA 3HMJG 2OD6A 1WC0A 4RZRA 1IWGA 3HHLD 3FZ2A 2CPDA 2XNRA 1F5AA 1T03A 2YX7A 5F3TA 1RKJA 3HJFA 3CW2C 2MY8A 4A8QA 1SH3A 4WYLA 3QYYA 1RT4B 4PPDA 4MK7A 4DV7J 2YNHB 2ZZTA 4PXBA 2XY6A 3OXLA 3PHTA 3C46A 1RT6B 1I3OB 4DR3J 3ENWA 5E7OB 1TKTB 5KT3A 3OR1A 2XEXA 5HJXA 1QSSA 2D41A 1LV5A 1UVIA 4PAAA 5JXSA 2IM1A 2JNJA 4DPYA 1BQNA 2KU7A 2KRBA 3H42A 2A6MA 1TKTA 2LU1A 3MR6A 4ILRA 1UJ6A 2Z56B 2D7SA 1Y0HA 3KK3B 1PYSB 1A9NB 2BJEA 1Z1ZA 3QRRA 4IYQA 4ED5A 2W9CB 2MYFA 3J81j 1G7CB 2DNNA 4EO6A 2HHSA 4F4KA 1S9FA 1C1BB 3RYLA 3MPYA 1UFKA 4K4ZA 3G8QA 4M5MA 4YB7A 4DV5J 2R7WA 1OQ6A 2W9CA 3OR2A 3BEGB 1IM6A 2MZ1A 5G4DA 4BBYA 4DR2J 4C11B 2J9DE 5GAGI 4PYDA 4MTPA 2RQMA 2F3JA 2VQEJ 2DITA 5KFVA 4KGKA 1XEZA 3UN2A 4A47A 4CH7A 1WG5A 1SC4B 1X4BA 2D3UA 3AB4B 4JI6J 1FERA 1FE4A 4R8UB 4FYYB 4RPFA 1HW8A 2JLEA 3K5NA 3IBFB 2G2OA 2GAGC 3OSNA 3QT5A 3PM9A 5LMUF 4P7TA 2AJFE 2YXLA 5DDRC 4RWXA 5KG5A 1JXVA 5KFFA 4ZPVR 4Q5VA 2YKAA 4N77A 3OFGA 3BYRA 1XMQJ 1J5EJ 2AIRB 3JQMA 2I2YA 3MR5A 5DG8A 4B9VA 1GEHA 4KGVB 4CLKA 5EGYA 3OBIA 2AP6A 2DNQA 1XWLA 4BLGA 1FVQA 2ZOFA 1HMVB 2ZDOA 3BREA 5HBMB 2M8HA 2QIFA 4ELTA 4DFKA 1XJWB 5JMNA 4NXNF 5CD4A 2FZCB 4F0MA 3BKTA 3EZUA 3G2XA 2R7XA 1CJUA 4IR1A 2MKCA 1HMVA 5K20B 5HVGA 5HBMA 3G86A 5EUHA 1JWWA 2CJQA 2XY5A 4ITSA 3DRSA 3GTYX 2BJ1A 4ZPDA 3OVSA 1WC5A 4OZNA 3Q0AA 1X4FA 4WFAQ 2QSWA 5EX0A 3LF0A 3HKWA 3R5AA 3HDSA 2RJZA 3NBPB 1JX4A 5DRKA 5GAEU 3OJUA 2KFNA 1QAJA 1VGYA 2WVBA 2LEAA 1QUVA 2HBZB 2B51A 3D3CJ 5GADI 1SC1B 2Y9HA 1T0TV 1C0UB 1TQLA 2CNOB 3D7SB 1BQMA 1K8AT 1R0CB 5GMDA 3BSCA 5FIIA 4X65F 2XZWA 2MY7A 2LLZA 1YHQS 1C0UA 2R8HA 4CZCA 1SUQA 3RB3A 1EX8A 4IKAA 2FLOA 4NMLA 1VRTB 2C3PA 5HL7Q 2Z0GA 2DB1A 2IIHA 4J37A 2BANB 3OTOJ 2GVDA 4UUWA 4OX7A 4IH5A 3PKYA 2ZVSA 2UUCJ 4AQYF 2M0GB 5DZ7A 1NEEA 4CH1A 1CS4A 3WX8A 3ETMA 1ZYQA 3CJ5A 4ECQA 1SH2A 3FMBA 1UVLA 5DS7A 5JVHQ 4MYTA 4X64F 3GB0A 4OJGA 1NK6A 1ZBTA 1KOHA 3PR4A 1DJ0A 2XWYA 1U2RA 3BGOP 1U6FA 1UFWA 3ETOA 2AKWB 2ZBPA 1HL6A 1S1VB 2M2BA 3CCSS 3T41A 2NYIA 1HBMB 2HZAA 1ZTTA 4FYDA 1NKEA 4CLLA 3I5AA 2L3MA 1RTDA 1LKZA 1U45A 3FMWA 3AD9C 1HBMA 3V6DA 1I94F 4HHHA 1N33J 1FO1A 3MECB 5KFDA 4C8LA 3OXGA 1DTQB 1WHVA 1X4DA 2XMUA 4DV7F 1N56A 2GHWA 4ZP9A 3R1HA 4RX6A 5DDOC 3QQCD 5A6PA 2MZTA 1QSLA 4DR3F 5IT0A 3NOCA 3SDEA 2AGPA 1TUVA 1HI8A 2J7KA 3ITHA 1TL3B 1QVFR 2DPJA 2J7WA 1ZH5A 1FRLA 1YJNS 2D3OR 1ZOTA 1V5IB 1RCOB 1IBLJ 5KFZA 2W01A 5A8RB 4ZMMA 2ZHAA 2RS2A 2R7OA 3UFCX 3AOAA 1TL3A 4O4GB 1Q82T 2DH9A 1FFGB 2YNFA 1NK7A 4ANDA 1AFIA 4ZLJA 2X7IA 1VFJA 1WC3A 2J76E 1IQTA 2X3GA 4C97A 4P2FA 1WWHA 1FDNA 3RU0A 2BQRA 2HBQB 1M90T 4DV5F 1VK8A 1PJ7A 2P9GA 3K5LA 3H90A 4WZQA 3CULA 1SQEA 3SBMA 2KJVA 2C28A 3MURP 1KHWA 2BRLA 3T9ZA 2VQEF 4MKYA 1K1QA 5LJ3Y 2OEJA 4K4SA 2EWHA 3IM8A 2AJQA 3QT6A 4ZJQA 1Z2ZA 1KRPA 3QNWB 4JI6F 3UCZP 2HLTA 4WTOB 3I5CA 4J90A 2CPIA 1TAUA 3KUHA 1YK9A 5AXLA 4PUOB 5SUHA 1NNDA 1UWAA 4Q44A 1Q95G 3WHIA 3BBFA 5J2PA 1XMQF 2KFYA 3EUNA 1T05A 3HD1A 4L76A 3HHDA 1T9XA 1SH0A 2XMWA 4PWUA 1JLGA 2CZVC 3ZTRA 1RBAA 2B7BB 2ATLA 5CXTA 1T9WA 4M5NA 3ZZTA 3ZZRA 1X5SA 3ZTSA 2MB0B 4WYWA 4NPOA 2VU5A 2J0SD 3TWZA 2V94A 1D1UA 4QOTA 1Q5VA 3JAMU 1R27B 1TKDA 3POTB 4B3SJ 1OSDA 2IJFA 2GX8A 1EHWA 2K8GA 5E2QA 5LMNJ 5HROA 1R6VA 2R7RA 2F4VJ 5D78A 4RNFA 2BJ9A 4CO0A 1KS2A 4EYIB 3NLCA 3MMBA 3NY0A 3KYLA 4B3OA 5L1KA 1KQFB 5KG4A 3T5JA 2OFHX 4ICLA 8ATCB 3DDKA 1N34F 2HBRB 2B4PA 2F8MA 2CZ4A 4DL4A 4HR2A 1NSPA 2H65B 1WOSA 3I9ZA 2MKKA 4J9KA 4I56A 2WVCA 1HYSA 4TLRA 4WK3A 1TL1B 2WOMB 4KKOA 2XNQA 4ZCMA 4F4WA 2EC2A 2XBPA 2VG7B 1NB7A 4CQ1A 3QJJA 4A8KA 1LEOA 3VGVA 1WKLA 1HBUA 2UP1A 2JEJA 4NE9C 1JXLA 1X5PA 1VQOS 3RG6A 5DGAA 4RUBA 4TVAB 5L9XA 2AEMA 4UQGA 1XNQJ 5M2RA 4A8XA 3OTOF 3CIZA 2UUCF 3G4SS 1UVJA 4UT4A 4PXDA 3TJ8A 1X4AA 1SJRA 1FJ7A 2RH3A 4LF4F 4GVBA 2J0WA 4M5DB 2FGCA 3GE9A 4H4KA 2HFSA 3B4MA 3QFWA 1U1LA 1UJ5A 3ZNUA 1MROA 2AYEA 2BE2B 5D0GA 4OI0A 4ID8A 1YBTA 1TKZA 4I6YA 2L41A 2DHGA 1S77D 3I4HX 1TVRA 4M5DA 2IY5B 3IBWA 3NNCA 2YWGA 1ACMB 3GFYA 2QLBB 5IV3A 4NYPA 3HT3A 2CNKB 1TK8A 3C15A 5KFEA 3N5BA 4LVNP 4LSZB 3A8IA 2Y0SD 2DHHA 1HR0F 1RTHB 5E33A 3IO1A 3ICLA 2XCAA 2ZH9A 3L95X 3DGVA 4DL5A 3H59A 3CC2S 2MHNA 3RZAA 3GYXB 1ZZFA 3GFXA 3LO3A 1B0TA 3BPSP 1PCAA 1FDAA 1N5VA 3KLGB 1LWEA 1N33F 2HHUA 2HHTA 4USMA 4UF4A 1Y11A 5LOQA 5CCLA 3HI9A 2QL5B 4MKAA 4OLPA 1WHXA 4DCPB 1VQ8S 1D9FA 3HK2A 3ZZYA 2B4VA 4DJBA 1JLBB 2L9NA 2HNYA 4AYBD 3M8ZA 3D28A 3ZO7A 1OYDA 1HNZF 1CC7A 2LXUA 2XLJA 4ZK7M 5L1JA 3EDQB 2OO4A 3QT7A 4YFUA 5KFHA 1URNA 1IBLF 2M4MA 3HCXA 3NS6A 2WSEC 4IOCQ 1Y5NB 2M9KA 3QZ7A 3BN7A 3P6YC 4DUYJ 2V0NA 1V3ZA 1HWJA 3DRRA 3RW6A 5IXUA 1FXLA 2ILZA 3D6FB 5EDWA 1GXUA 1FVSA 2EVZA 1S12A 4UOCA 4CLPA 1L3KA 1FNMA 4TNOA 4YQWA 5D0EA 4JV1A 1RBLA 1YI2S 3JSBA 3RBEA 1SKWA 3OJSA 1JIHA 1VHIA 2JDJA 3QZ8A 1HPZB 4K4YA 1N52B 3DKDA 5KFXA 3UW1A 2OKQA 5KFLA 2YWFA 3JSYA 3M30A 2CUYA 3R3TA 2VF3A 2GQ2A 2XS7A 2VH7A 5THWA 3C2PA 2XC9A 1TL7B 1HPZA 1RQ0A 1CJKA 1T9UA 2Y8YA 4AUKA 2C1EB 2IFXA 3NG8A 3O1LA 1S1XA 5CYQA 1UWBB 1S1WB 3RBXA 3C6UB 5I3UB 3KLEA 4RW4A 3JQJA 3PZPA 4Y28C 3UVJB 1IKXA 2RS8A 3MXHP 4F2RA 2KDOA 3DDNA 4P7VA 4U8VA 4OIXA 4ED7A 4FXVA 3C6UA 5I3UA 3EGNA 4WTYA 5EWEA 3GYNA 4B08A 1T9TA 1DARA 3CJKA 2V34A 4B3SF 1R6YA 3SQGA 5F8IA 1KEKA 5LMNF 4CT9A 5F41A 2YX1A 2QGFB 1Y5LB 3LP1B 3GIRA 1HHQA 2KN4A 1Q79A 3V4IA 2DBBA 1ZETA 2AX0A 2OI2A 1UVMA 4YEAA 3GYGA 3LP1A 5KFJA 2I5JA 2XB2D 1VLOA 1EKSA 4DZ6A 4CO2A 1Q7YT 4MIWA 4WFBQ 1P8GA 2H5IB 1IKYA 1B7FA 2KVIA 3VAKA 2YX4A 1EP4B 3MAQA 3G6ES 1T7PA 4LIRA 1O8BA 1GMWA 2ATCB 4JI1J 3VAIA 1FRMA 2YKQA 3DOKA 4M1KA 3HT0A 1NUEA 4C3KA 2L9DA 4F02A 3OFHA 3QO9B 5J2QB 1K73T 1Q81T 1LOUA 1M0SA 1AW0A 1NAQA 2FB0A 4QWDA 4G1PA 2JHEA 3LANA 4FN5A 4KT0C 1QJHA 3QO9A 1RA6A 3CWJA 2VG5B 1SCJB 5AT1B 8AT1B 4ZITA 3CUNA 3TQEA 2E9ZA 2KRRA 1PC4A 3Q23A 4FYXB 1PBUA 5KG3A 3HHEA 2PEBA 2B8PA 3AH6A 1IWAA 1FRXA 2F63A 3DLKA 5BXIA 4P2XA 4IH7A 3CCWA 1LK7A 2DNHA 5BYRA 2A1BA 3DLGA 2YQ0A 4F7VA 3CC4S 2R2SA 3M2RA 3OD2A 4N56A 4NZ7A 1WHYA 1FKOB 4K4WA 4USIA 1GH8A 4A8SA 2DGOA 3F41A 3MUVP 5E3PA 2NPFA 3P45B 3KNAA 2YWEA 4EO8A 1R89A 3NOGA 3OHBA 4IH6A 1FKOA 1YBUA 1DQ9A 3MEEA 2IVFB 3MPUB 3D3BJ 3TVKA 1RU2A 5T7LA 2ZHOA 4XDCA 3PACA 2Z2LA 3DI6B 4CI0B 2IRUA 2XYGB 3HF5A 4DV4J 1Y5IB 4WP8A 5M2PA 3FGVA 3I87A 3R9LA 3NGDA 2EKYA 2AT1B 1VQ4S 4RW7A 1FJCA 1RWMB 3PIPQ 2R7TA 3CDAA 4KH1B 1PYTA 5K8NA 2HQFA 4TQRA 5HMYA 1KP6A 4NZ6A 3L7OA 3FC9A 2R4FA 2IDLA 4RO0A 3N6LA 1KSPA 4DUYF 2MTLA 4WFXA 5GAGU 1DHMA 1KWMA 1FF2A 4WFYA 2R9LA 5HMZA 1LWFB 3TEGA 4ZPWR 3JB9k 1VYAA 1UEKA 2DRAA 1R8CA 2DR9A 2DHXA 4QPTA 2PDAA 3UDLA 1JLFA 3I32A 1LWFA 2Z58B 4C0OC 5E3AA 3TA1A 4FPIA 5FDLA 1HNXJ 4OX9J 3Q22A 4RJVA 4KC5A 3B6BA 3GPAA 4X66J 1VC0A 2V5HG 4LQ3A 2CJKA 2XSFA 1H3DA 3DU6A 4ECTA 2EKNA 2MLXA 1EQ0A 1RWWB 2B8QA 3AXMA 5D4OA 3D1QA 1YTYA 3AODA 2F8HA 2PSZA 2GS8A 4ETZA 4DSIA 3MPWA 2V8PA 4MT1A 2CNNB 4DXLA 1UVNA 3U02A 5HLFB 5E3QA 3MCNA 2V2KA 2QE5A 4QBUA 4TU8A 2XLKA 4O44A 2FC9A 1PBAA 4TYBA 2ZH6A 2B4UA 4CP5A 4DUZJ 1E6VB 2FHJA 1DTTB 3ZZ0A 2J6SA 4F25A 1NO8A 1RWPB 4EYHB 4DX7A 2W4PA 4RLEA 2JX2A 3ZXWA 3C14B 2AQ4A 4NA2A 4HVZA 5B7WA 1Z4UA 1RHMB 4YB1P 1YRXA 1WDDA 3PR5B 2DHAA 3RR7A 4WIIA 3D0IE 1NK9A 2VASA 4B9SA 3C14A 4MIAA 3E8OA 4ZVFA 3PNIA 1WSRA 3W9IA 4CLYA 3VTIA 5GADU 2PIIA 4YMEA 2DXDA 3PDNA 3RJMB 2Q3PA 4RW6B 1PSDA 2XLIA 4GKKJ 2ACMA 4Q7AA 1TKXA 2QLWA 1R0AA 3O5TB 4TQSA 3GILA 4U6PA 1RK8A 1MN9A 3D6MB 2ZJPQ 4Y2KA 3AHPA 1XC9A 5ETOA 1NKBA 4NLTA 3OW2R 4FVCA 1FWLA 5EX3A 5G0RA 4JI1F 4KGMA 3K8WA 3Q8SB 3KG0A 1U1QA 3KJVA 4LIWA 4RL1A 4KTQA 3TAPA 1JQGA 4Q2MA 2HAFA 1QTNB 3PY8A 2VJUA 4ZHRB 3MEDB 1KDNA 4HDHA 3HVAA 4CRJA 4J9MA 3GMGA 4ZPBA 2OSQA 1QM9A 2NCKL 5F9LA 2CIMA 2ZE2B 1L3SA 3FQLA 4ELUA 4IG3A 2U2FA 2OAUA 3TEHB 1C0TB 3MPVA 4OJ1A 1EZZB 4ECZA 2AF6A 3W8PA 1SKSA 1S48A 1TZ0A 4ANEA 3MM8B 1F2HA 3TA0A 4A48A 5T41A 5HVHA 2W9BB 4ER8A 3GSIA 1VJQA 1C0TA 2V69A 1DLOB 3D0HE 4TY8A 3NMAA 3NWGA 4MKVA 3FCWA 4F50A 1U0HB 4RR5A 2LKZA 1N54B 1Q7LB 2VBZA 2EBEA 4NZ0A 2RF2B 2N4CA 3MAHA 4WE1A 4PXCA 4B3TF 2ZKTA 3M2UB 3NS7B 3D67A 4I69A 3THPA 4IUFA 4G6VB 1KTQA 2ZEJA 2H1YA 3N6MA 5A76A 2ADCA 3GCXP 2HBYB 4DF8A 1RYRA 1T9YA 4DV4F 1NK4A 4ILMA 3W8GA 2MQNA 3RAQA 4GC7A 4ECRA 1VQ7S 4RNOA 1OWXA 1VC6A 3IS9A 2OH2A 3K57A 3QGPA 2V9WA 4OYMA 3W2WB 3W60A 2KXHA 2VFRA 1NMEB 2EG2A 2EPIA 1X4GA 2GJ2A 4LRBA 3HVRA 4F3OA 7AT1B 5KG6A 4IG0A 3W2WA 1Z2LA 2V6AA 4J9PA 2PT0A 1RWUA 3LQVA 2W7PA 3KDNA 3VVTA 5KG7A 2DKOB 1RWVB 3DRPB 1U1RA 2POKA 4C6AA 5ETQA 3TX0A 1HD1A 3TAMB 2B6AB 1AB8A 4P6QA 2MJNA 1TR0A 3CO0P 4LF1A 4A8YA 2ZUGA 1SJ4P 3K8VA 2GVZB 1FD8A 2G0IA 3CDUA 2Q79A 3UD5A 3W61A 2HURA 1HNXF 4U8YA 3T1AA 3AOCA 1KVJA 3H4BA 1NDPA 1GMWD 4ECXA 1BE4A 1FXDA 4L73A 4NYZA 3TAMA 2WONA 1U8SA 1NZAA 4X4QA 1U24A 4NA1A 1I6JA 3R5DA 2ZUAA 3ILJA 3CPWR 4OJ3A 3VQTA 4C98A 3E01A 4G1IA 3HM9A 2E7VA 3THVA 2W7OA 4HHUA 2MGZB 3Q2TC 1T3OA 1YJ9S 1SKRA 2FJBB 4JV5J 2C2EA 1N6QA 4DZDA 4DX5A 3PO5A 1L3UA 2QLFB 2FVCA 2XWXA 3MI7X 2MGZA 3DU5A 4DUZF 3I0RA 4RW9B 2GHVC 1S0NA 3G82A 3TO8A 2UUAJ 1UEVA 3PYGA 3TUJC 4URGA 4YDDB 1U6BA 3JSMB 1YJTA 2NS1B 1SQGA 2QMUB 3KLIA 1S0VA 3CJ3A 1IBKJ 4PPZA 2DEIA 1UPMB 4KE5A 3Q89A 1U7LA 1RT5B 3R5JB 3NGRA 2WSFC 4J9VA 4QW8A 4DN0A 1UL3A 4ZVQB 2VOOA 1M5PC 3PEHA 3UN3A 4NI2A 2LDYA 1U1PA 2IC3A 2RD5C 4LR8A 1WG4A 2O01C 4GKKF 3KG1A 4ZCKA 1RT5A 1EIYB 3AD8C 2HS3A 3I0SB 1FKAF 2BX6A 2A3JA 1FJGJ 3Q8RB 2O66A 2WAQD 2E5LJ 1U47A 2P9EA 1S97A 4LREA 4C8KA 4C4WA 4LFCF 1RT1A 4ED1A 4K4UA 4PYAA 5KFMA 1RADB 3J80U 2GJIA 2C3UA 1GXLA 5IT9Y 1Y3JA 1BD6A 2GHPA 1RTJB 1T95A 3GJTB 4FYWB 1RT7B 3M1VB 2CQ0A 1B0PA 1S5ZA 1TELA 3BGRB 3EXCX 1HWKA 4WJBA 2J7UA 1Y7PA 2B5JB 2LA6A 4ZKAA 1KR4A 2M8DB 1S1UB 4DX8H 1WORA 1JMTA 3C16B 2R42A 2AGOA 2E5JA 2RU3A 3GZ7A 4I1TA 3Q8UA 1TU0B 4KV8B 4WZMA 1FWKA 1FD2A 2HRUA 1W7WA 4R5PA 1S1UA 4IQXA 1S79A 1NJWA 1WI6A 1F3FA 4N7TA 4BCAA 1AT1B 1S6QA 2RMLA 4DI6A 1YLXA 4F4YA 4KV8A 1GK8A 2R7QA 2CYYA 1K9MT 3IAS9 4F4AA 3DRYA 2V63A 2RHSB 1IM4A 2YNGB 2QYGA 3M6VA 2CJBA 3OTCA 1R8HA 2VDIA 3SMZA 4DQSA 2HVDA 2V9KA 5K8MA 2PC6A 5HMWA 4M5JA 1RT3A 4IRDA 4X62J 2HNDB 2J6UA 4TU7A 4JI5J 2GAHC 3M8QA 2ROEA 1UZHA 5E0OA 3NS5A 1D09B 3OL7A 4NLDA 3W64A 1Q0NA 1IQZA 2KG0A 3EXYA 9RUBA 4WP3A 3DC2A 1DRZA 3Q8VA 1XN9A 3QSIA 5KOWA 1O51A 1LWCB 4BC7A 1HBOB 2RIJA 2RHQB 2FHJD 4F0KA 2FVSA 3PW2A 1M5KC 1RYSA 2HHQA 1LWXA 2EG1A 4G65A 2C2MB 4JYAF 3QLHA 2B0GA 1S1TB 1U2CA 3TZXA 4CH0S 2E1MC 2X1GA 4OZ1A 4JBCA 2Y3YA 1V3RA 2H4WB 3UD3P 1QE1B 2VUGA 1MMNA 2DRDA 2IDEA 1GMUA 3W2VB 3OL6A 4O3SA 3ADAC 1KQKA 4FBTA 2AHOB 3K0JA 4GO5X 1XK8A 4PEOA 1YSJA 1Q53A 2CRLA 4X4TA 1QE1A 2BOAA 4I68A 1CBKA 3L7PA 2N7CA 5AXNA 5H9EK 2AJ0A 2FYXA 1Q16B 4I0WA 4NEYA 1CJVB 2KYZA 4MMOA 2IVYA 4ZVHA 1TAQA 1VRUB 1B99A 2BOPA 3E51A 2EFOA 1FDBA 2EFQA 4KB7A 2H5EA 3FDSA 1MU2A 5IQ6A 5EN1A 5EWGA 1VRUA 1XR7A 1N5TA 3SCKE 2PA3A 5D4LA 3IGNA 5H9FJ 4Q45A 5DG7A 3VQSA 2CAJA 2KXFA 2BKPA 3DGPB 2DPIA 1CG2A 2ZM6F 4JV5F 5KT5A 2XHCA 3SCIE 2L48A 3N5FA 3KNGA 2AJ2A 1ITPA 1VOMA 3DLLQ 2UUAF 2LVWA 2IAJB 2HMIB 4OJHA 3PV8A 4OMFG 1X4EA 3MTJA 1HNVB 4IDKB 1FT8A 4PQUB 1RHKB 2ASJA 1IBKF 4N8OA 2ALYB 4M5GA 3KG4A 1IKWB 2V4JA 4AL7A 3DLBA 5D3GB 2HK3A 4J7CA 2NSBA 1QAIA 2ZVIA 1HNVA 3PXGa 3DLEB 3PO4A 5J2MB 1HWLA 3H5YA 5C24B 1PJ6A 3ILIA 2J9DA 4O3OA 3PRVA 5KT2A 2VKRA 1TFWA 2FHKA 3BDPA 4FP9A 1UKUA 1HBNB 1TFYA 2E5LF 4OYBA 3Q8QB 1VQSA 5F8MA 5ETVA 4B9TA 2BW7A 3ENVA 3FZBA 2BE9B 2GZOA 7FD1A 3M6XA 4ZVEA 4EZ6A 2K7KA 5E3CA 5KFYA 2KG1A 3R5CA 1WKJA 1HBNA 4FBUA 1MG7A 3L7UA 2A18A 3AA8A 1KONA 3V81A 3W63A 1IN0A 2D1CA 4FF3A 1FTRA 5JJBA 4LF6J 4OYAA 2HHPA 4FDFA 3H5SA 2DR6A 2DY1A 2HHVA 2MSSA 3MCMA 5L9NA 3M32A 4MK9A 5J1NA 1QVGR 4HH0A 3CB4A 2JEGA 4PR6A 4I2QB 2CNLB 2KT3A 4JI0J 2VODA 1WC1A 4RBUA 5GAHI 3AB2B 2Z2MA 5A8KB 1I1GA 3BYPA 2W24A 2PN6A 3MM6A 3MUMP 2RKIB 7FDRA 4ECWA 1DURA 1VQNS 3OT9A 2K2PA 1FTCA 3NGSA 2KVQE 2E5IA 5B0GA 3WQPA 3IN5A 2A6OA 3GCWP 2FJEB 1S6OA 1M5SA 1U6ZA 1RWXB 1YZ6A 4DSJA 1WG1A 3L9ZA 3T5KA 4PG6A 3TZZA 2CQ3A 2HS4A 3LP2B 2ROGA 2IPOB 4QR1A 2YPYA 3GR1A 2QYCA 4J9SA 2WVEA 2K1RA 3K7RA 2GNKA 1Q5YA 4CTAB 3T5HA 3W9JA 2UZAA 4LFAJ 2HKEA 3F56A 1I5OB 4YOEA 4YB5A 4NCGB 3D1HA 2FZGB 1F1BB 5DM7Q 1T9VA 4PKDB 4Z2XA 2D3ZA 4J5OA 1YG0A 3MM7B 3DXSX 2VA3A 1S6PA 3LUYA 2LEPA 3NXZA 4LBHA 5H1SV 2FJAB 1CULB 5C2GA 2MJUA 4DFJA 2QA4G 1SIWB 4O3NA 3MR7A 1F5CA 1RAIB 2BKOA 1V5VA 3PJ9A 4WU3A 4W90B 4MH8A 2HIQA 1GNKA 2JVOA 2L08A 2VFTA 4P2MA 3T5LA 3MUTP 2ZBCA 2K3IA 1LXNA 4WBFA 4B9LA 1QTMA 5C2CA 1UAWA 3H7HB 1RLDA 1RZMA 4CO1A 1HQUB 1S59A 2FQQB 4PWWA 3MTKA 2VL1A 2HFUA 2XYHB 3WC0A 5D15A 3DLHA 1NDLA 4LFBJ 3QPIA 3D54A 4WF9Q 5L1LA 4EUVA 2RDDA 4ZCLA 1FNXH 3PJWA 3BPDA 1N36J 1HQUA 3R7NB 4ILLA 3N01A 4WXOA 4KIAA 3W66A 2FPHX 4IO9Q 3CJ2A 3FUYA 1G6BA 3CGIA 2P2CB 5KT6A 4N76A 4Y0FA 4F2SA 3HXMA 4KJIA 4DLGA 4LF5J 3B54A 4J91A 4JP8A 2WK4A 2MQLA 3QSYB 2O5DA 3J7YI 3A12A 2ZH3A 3B4DA 1JLCA 3KK2A 2W2PP 4B02A 2E7WA 3FK4A 3DOMA 2V8VA 3M8PA 2FVRA 5FJ4A 3HFVA 2XS5A 4NLPA 2QRRA 2MZJA 1FFWB 4OI1A 2KM8B 4KHRA 3HFKA 2OEKA 3KK1B 1UZDA 1SC6A 1HA1A 3W5ZA 4V1Ak 1UMJA 3QBCA 2F8EX 1CQMA 3MMCA 1AUSL 2GMLA 5K8OA 4DSEA 4X4OA 1AROP 2EFPA 4ANCA 3UR0A 2R8KA 3US5A 4UTGA 3SSSA 4X4PA 3CEDA 1F9EB 1X4HA 1U0SA 5KFQA 3EDRB 2XSJB 3VR1A 1VQ6S 4XIUA 4OZ0A 4DV6J 2LDIA 3NGUA 2KTQA 1WOPA 1VBYA 1DQ8A 3A1YG 4F0HA 2XM3A 3AFGA 2NZ4A 4CWBA 3BH6B 4IOAQ 4DV3J 2ZBQA 1GT8A 4X4VA 2XSJA 1JJ4A 4MYUA 1I94J 4H4OB 5DQGA 3M2VA 4AFFA 4JV2A 1BUXA 2IRYA 1WJ9A 5A2QY 1OMSA 3P96A 2ZJRQ 3TJ9A 4NASA 2W8KA 2I9SA 2P8IA 1AZSB 4OZ5A 3PW0A 1C2PA 2JFDA 4Q2LA 3U1MA 5KFCA 3NAHA 2ZH5A 1LK5A 2IM2A 4BC9A 1VQPS 4ZVUB 2O67A 1RT4A 1CQNA 4QIVA 3GQCA 2N4DA 1ZM2A 2YTCA 2YNHA 4OV1A 1JLQB 1V3SA 4ZP6A 1YJWS 1RT6A 3AQOA 4LF6F 4DPOA 2XS2A 1AFJA 2B43A 2VPZB 4U9RA 1IVZA 4I2PB 4LSLB 3V6HA 4F4XA 2DT9A 2YKNB 1QAYA 2WHOA 2R7VA 4EK2A 2DNOA 2CJXB 1LW0B 2K3KA 4JI0F 1SQFA 2HFNA 2F5GA 4AXJA 2G2YA 5AJ3F 3KK3A 4CLUA 1H2UX 3KJNB 1S4FA 4CT8A 2LXFA 4F26A 1O5JA 5GAEI 5DGBA 3N4WA 4MFBB 1LW0A 1Q8BA 2DNPA 2MZQA 1C1BA 1IR0A 3IR5B 2UU9J 4ZP8A 3KDOA 5D8HB 2H51B 3FEXB 2FJVA 2J9EA 4C11A 4DLEA 1ULRA 5HP1B 3UNGC 3TOQA 4U7UD 1WSVA 3SCLE 1RAEB 2GJFA 2CVIA 3BO4A 2VFVA 4NLOA 2BJ8A 3S1TA 2G0CA 1WELA 4WKYA 2MMYA 2FD2A 2CPZA 5KFAA 4P71A 4PWDB 4FKYA 5HP1A 4R8UA 4CDIA 4M95A 4LFAF 4HKQA 4OHYA 3OQ2A 3LW5C 4JUZA 4L74A 2HVIA 2B9XA 4L3NA 3VAMA 5ETSA 2E44A 3F0NA 1EQMA 4LR7A 4M63A 1J5OB 1BWVA 2FZKB 2W7AA 3KHRA 3NL0A 3QGIA 3DNCA 5CYMB 4PQAA 2BBEA 1ICEB 2Z8QA 4IFYB 2DGWA 4KR0B 4CO4A 1X31C 1J5OA 5IFMA 5KFSA 3CJQA 4Q0BB 3ZC4A 3M4XA 4ZLPA 5DG9A 5CYMA 5K5MA 2PMHA 2JRSA 2DGTA 4KO0B 2XG8A 4TLQA 2KJWA 3ILLA 5KG2A 3U1LA 3CE8A 1ZA2B 4C8ZA 4ES2A 4J9OA 4Q0BA 2MZSA 3MOJB 1N34J 4DBQA 3S7RA 4GKJJ 4QWAA 4LR9A 3KJFB 4F36A 2NXJA 2R2RA 2R2UA 3NBPA 3S6EA 4QYZJ 4KGXB 3L4BC 5E5NA 5K14B 4LFBF 2BDPA 2AWZA 2B4OA 5KFOA 2IA0A 4NRUA 2IVMA 4B3RF 1N36F 2JVRA 2RRAA 4N41A 4OYPA 1RAHB 2EBGA 3WZ0A 1VQMS 1NM2A 3CCLS 1IKVB 4J9UE 5DQIA 3MD3A 2QMXA 4DN9A 4LF5F 5C42B 3C3LA 4JI3J 4DR7J 2FLPA 2OPPB 4J9RA 2UV8A 1M1HA 3QATA 3EGVA 4QR2A 3R6GB 3UE2A 2F9JA 2HWHA 1IKVA 1VRTA 3MM5B 4LF4J 3HVWA 3LOUA 2VBXA 2BANA 3CT9A 3T3FA 5KTQA 4RNNA 2OPPA 3BKFA 4Y3CA 4JB8B 4LVOP 5KFNA 1CVJA 1JLAB 2JWNA 3I55S 5BJRA 4DL7A 2Q43A 3R2DJ 2V4QA 1FCAA 2JSXA 3M8WA 3DYAB 4ETXA 5K8PA 5KG1A 5ETRA 4RW8B 5B0DA 5KFWA 4RU9A 2HPUA 3R8YA 3HHLB 4EU0A 1D3WA 3CDWA 2NREA 2UVRA 1HR0J 4UY85 1B0VA 4DV6F 1IR1A 2UUWA 1XNRF 2CJYB 2EW9A 4RW8A 4X4SA 2F1FA 2J5AA 3VHQA 2ZZNA 1S1VA 1RTIB 3R97A 2OHDA 4CLZA 2BJ3A 4XK8C 4DV3F 2DYAA 2BQUA 1LXJA 3NNAA 1RJJA 4RUCA 2HGNA 3A3OB 1ZPVA 2YNIB 4HTIA 3H20A 1RKIA 2DNYA 2XULA 4HH1A 4LBPA 5EHHA 3BB5A 4FF4A 1NK8A 1FEHA 2GQQA 1MN7A 2A0FB 3MECA 2DTJA 2Z57B 1DTQA 4H4MB 1HNZJ 1NJZA 3H4DA 3K5OA 2XZTB 1TV6B 4ZVPB 2FJXA 2C42A 5HK4A 4NLYA 1CJTB 1PG5B 4KQZA 3VAJA 4GMKA 1N88A 4ZPTR 2HHWA 2OGUA 4C0HA 4EZ9A 4EEYA 3Q24A 2FC8A 2BUNA 4BDPA 1C4CA 3MWBA 3KFWX 1QD1A 4C0BA 2VG6B 2HSEB 4DOZA 3QAUA 2J6TA 4AL5A 5A0YB 5I42B 2XO7A 1CJTA 3BQ2A 1PJ5A 3IFEA 2HFZA 2CQCA 2E1RA 2AMCB 3D9BA 5A8RA 1U1KA 1KKHA 3K5MA 1U1MA 2VG6A 4O4GA 1LW2B 4OYIA 2M88A 5A0YA 4QJVA 1RAOA 3HHKA 3R27A 4ZIWA 5HQMA 1TL4A 4UZBA 2DGXA 1TK0A 2GQCA 2UU9F 3I9V9 1N4LA 3QGGA 2EFGA 5IS2A 4ZVSB 2HEKA 5LJ5Y 3ZTQA 2GIFA 2RB7A 3IR6B 1TK5A 5HVFA 3KTQA 2Y8WA 1S57A 5ETKA 3SV4A 5CZXA 2VPXB 4IRKA 3VCDA 3PG9A 1G1XA 2OELA 2JC0A 2OD4A 3KLFB 4NLQA 4Y2AA 3U1NA 3ISNC 3DHWC 4I7FB 2OPSB 4ECSA 4Y2MA 4PUOA 1OQ3A 4WU2A 2DJWA 1ZAVA 3T19A 2GFFA 3EWGA 3D6HB 3GIMA 2ZH4A 4RU2A 5KT7A 2E7XA 3V4MA 3KLFA 2UXDF 5A8WB 3R1LA 3MGJA 3CJSA 3C6TB 4KFBB 3EVOA 4WIQA 1GXTA 2ALZA 3IAM9 1WC6A 2HNZB 2YQ1A 1BWEA 1EKRA 3NKYA 4OZLA 4F67A 3FKBA 4OHVA 1TP7A 4DX6A 3C6TA 3D66A 3M05A 4BWMA 5H9FK 1B7YB 1Q8IA 1M5HA 3KUEA 2HNZA 2XHWA 3TX8A 4WK1A 4QWCA 3TP2A 4UOGA 3OUYB 3VVUA 2DH7A 3POTA 3TZWA 2RDJA 1U09A 1FXRA 3PJXA 5U47A 3T9NA 3OFFA 2D9OA 3BR9A 1VBZA 2JC1A 4GKJF 2GCFA 1BXNA 5A6WA 2DNMA 2V2VA 5CH7B 1RAAB 1W2IA 3EE3A 3EYZA 3BGLA 5DZ6A 1F60B 3MCSA 1X9WA 2RU9A 2XI3A 4CNYA 1AXQA 2WVFA 4DL2A 5CHCB 2ZH1A 4DV1J 1UP1A 4YHHJ 3GJSB 2MQOA 1PAUB 1TL1A 2ADBA 1LFPA 1RHUB 2WOMA 5GMKa 4I6AA 2FDNA 3QWPA 2ZD1B 3EMTA 3Q8PB 3N9UC 4F4ZA 2VG7A 4B9UA 2IA6A 2FY8A 4KSEB 4JI3F 4DR7F 4O3RA 1Y9OA 1K0VA 4MKBA 1WKKA 2IMWP 2VHGA 3CIMA 3IRXB 4Y2IA 3WC2A 4I64A 3RRKA 2ZD1A 2RSQA 3NCRA 4ZPCA 5IC4B 1NLKL 1S9GB 3IG1B 5JVGQ 2Q6BA 2NXUA 1RT2B 5IQQA 4DMZA 4W4MA 3HPOA 2KH9A 5KFTA 3IG1A 2EC0A 3TVZA 5I4MA 2BE2A 2MEWA 3CJRA 3H2LA 2HYIB 5KT4A 4NL5A 3CCJS 4KBIA 3IC1A 2YQ3A 2B9EA 5GVQA 1SL1A 3PTWA 2DXFA 2C2RA 4XAKA 3V2UC 3IWLA 1H2TZ 5KFRA 3BDEA 5LM7E 4QCLA 3QRQA 1BMQB 1YJUA 2JOQA 3QFHA 4DU8A 2VD3A 1RP5A 3WDOA 1RTHA 2E9RX 1U1OA 1UTAA 3N0VA 1YRTA 2OFGX 5D6GA 3R5BA 2MKHA 3TAQA 3F73A 3Q8YA 1ROFA 2OMOA 3PCOB 1HQEB 3TVYA 2I1RA 1KOOA 3DOLB 2JLGA 3H5UA 3PYEA 4ED4A 4O3PA 3KLGA 2IJRA 2UXBF 1W25A 2G0JA 1WTFA 3ZFVA 3DCAA 4P52A 5HAOA 1UA0A 3PYFA 2KFZA 2OPRB 1ZA1B 4ED2A 1Q78A 1P1LA 1HWIA 3TYTA 5BYQA 2Z2YB 1JLBA 3JYTB 3P49B 4CYUB 2DR5A 2HG4A 2MPUA 1PAEX 2HQDA 3FCVA 2R7UA 1KBRA 5GAHU 2DH8A 4KRWA 2VC0A 3DM2B 4L6V3 1RA7A 4LRCA 2UUBJ 1U02A 4BS2A 2Q1LA 4CYUA 5FD1A 2XMMA 4DCOB 3KLVA 1YJVA 2OJ3A 1J27A 1ZAXA 4D3HA 4CIOA 1UVKA 1F0XA 2HQIA 5L39A 2KZZA 3JSRA 4NMXA 4M8LA 1HW9A 4YN3B 2ZC3A 1YZ7A 2YKMB 2HGMA 1KLMB 2M5YA 3LP0B 3G9CA 3FSIA 2C3OA 2VICA 2X1AA 3AD7C 4YDXA 4USTA 1HNWF 2BR0A 2OLWA 4OZJA 5C25B 2YKMA 2JZ5A 2GA7A 1NJIT 1CEZA 2XMTA 2OTJS 3BBCA 4IFVB 2U1AA 4HLBA 3E2EA 4GVLA 5LXRA 5D0HA 2PFFB 2IHR1 1APSA 1SJQA 3SFUA 1Q4RA 2QFJA 1OSCA 3QT8A 2V4RA 1VC5A 1TL7A 2NLWA 2DVIA 3TQ1A 3GIIA 4ED8A 1UWBA 1S1WA 4DHVA 1NHKL 2FUG9 4ZOSA 2QA1A 1X0FA 3NCQA 2WSCC 3MCOA 5B0FA 4DPWA 1VDHA 1D8YA 3VV2B 3UVJA 3VAHA 2HQCA 3C19A 2FJDB 2MKSA 1RAGB 3GJQB 2RAQA 3GP9A 5AE1A 2Z2ZA 4TY9A 2KL8A 1T03B 1CSJA 2PE8A 1RB0A 1VISA 4OI3A 1U8WA 2NXNA 4ZIVA 1UJ4A 1A6LA 3H25A 3OTDA 4M5KA 5B08A 2Y0BB 3RB0A 1QSYA 5D0RA 4K7QA 3OR1B 3UCGA 1RTZA 4ZVGA 3CD0A 3PHEA 3DFEA 3TARA 4IRCA 1CC8A 2QMWA 3MHYA 4X84A 2IM3A 3JS9A 3J81U 1NB2A 1BQNB 2ILYA 3TZYA 3K2YA 4PXEA 3HX9A 4DV1F 4NRTA 3J7YU 1NPRA 4YHHF 5RUBA 3LALA 2W4CA 4R25A 2CDQA 4ZVTB 2V2ZA 1FX2A 1EP4A 2ZNYA 2EI5A 2KHCA 2RE1A 1XTZA 4N8NA 2IYIA 1GMVA 5AE2A 1U1NA 3OHAA 2HQ3A 3OR2B 2CQGA 5KOXA 2DNKA 5DM6Q 5J2QA 3PKMA 3EGZA 1NSQA 2LMIA 1N5YB 5KG0A 4UUXA 2XMVA 3M6WA 1RBOB 4ZPAA 2H9ZA 6FDRA 8RUCA 2ACYA 4ELVA 4EBDA 2AW0A 5HSPA 2VG5A 4P72A 2QFIA 1N5YA 1YWXA 1P9YA 1Y10A 3MR2A 4DR1F 2FLLA 2HZVA 3SSRA 1NU4A 2B56A 1FE0A 3FVYA 2JH3A 1RU1A 2E66A 2VZ9A 3LTOA 3GU0A 1YITS 2EEYA 1KVKA 3LH2S 2ZKUA 2CDRB 1RWKB 3M9MB 4X2BA 4B3TJ 4AT1B 3RGIA 4USJC 3H0PA 2A2CA 4ES1A 4LF9J 3G8TA 3R7BB 1T3NA 2VBWA 4QR0A 2E29A 1CJUB 1X9MA 2LQ8A 2CQDA 2DGUA 3NGKA 1N5QA 4IOBA 2ZITA 3SYZA 3DRSB 4NLWA 3UD4P 3THTA 3HHNB 1NSAA 3PRDA 2CWKA 3BKUA 2J8AA 2CWXA 2QC3A 3W5YA 3CD5A 4LF8J 4ERDA 2P9CA 3NEKA 4KYZA 3DI6A 4NLGA 3EGWB 1H74A 1VQ5S 2L9WA 2ROPA 2DCUB 1HHSA 3KMSA 5DLFA 3BGFA 3A4TA 4FKXA 2UUBF 5EWFA 2VFUA 4K2XA 2DO0A 4URSA 1BQMB 5F0UA 2W2QP 2E9TA 4M94A 2OPQB 3BSNA 3J7AN 5E41A 3B82A 1PIEA 5J1PA 2NQPA 4LJMA 2B3TB 3EX7B 4K0KJ 4Y00A 1T02A 4FPRA 2DGQA 3MOZA 1SUQB 3HVTB 2I6WA 3NP5A 1S99A 3G87A 2CQ1A 1VCTA 2OPQA 4O23A 1H73A 1UETA 1YGYA 2H4YB 2GVDB 1YRUA 3LGHA 3FBFA 3CMAS 2WTFA 2F4FA 3X1LB 3HVTA 3KWMA 5LSLA 1SC3B 4RNMA 1S7IA 1SI9A 3W1YC 5ETLA 1VQKS 1CS4B 1ELOA 3OVAA 3R2CJ 1VS3A 1NSKL 1VJWA 1QUPA 3CJ0A 4DV0J 3QAEA 3AY0A 3K89A 4DU7A 4KPYA 4CLWA 3UO0A 2A2DA 4QYZK 3TI0A 2KM8C 3A3PB 2WBMA 1T11A 4C3LA 3CCUS 3DLJA 2HWTA 2RRNA 1H7WA 2BMBA 3IWNC 3HSDA 5CCMA 4QIFA 1SJ3P 3MDFA 5HLFA 4DR5F 5DETA 1RTDB 2YH0A 2XMKA 1Y4ZB 2XI2A 1E6VA 3V6DB 1DTTA 4C8OA 2J0XA 1RUSA 4TKTA 4UY8T 5ADZA 4DL3A 3C8YA 4JOUA 1H7XA 1XIQA 4P10A 2AYGA 4E2FB 1FWPA 1IUJA 2DIVA 2BVZA 1FESA 4ZDNA 5D4NA 2ZOMA 4WP9A 3GG0A
chains in the Genus database with same CATH topology
3SI8A 1HPZB 3D54A 4K4YA 1N52B 2SXLA 4WF9Q 5KFXA 3UW1A 5L1LA 1U26A 3ZZZA 4EUVA 4ZCLA 2OKQA 1FNXH 1REVB 2ZZMA 3HHLA 3PJWA 4X4RA 5AXKA 5KFLA 2YWFA 1M5OC 4U67Q 3SDEB 3JSYA 1O0PA 3M30A 1K1SA 1HQUA 4ILLA 4K4XA 3MZIA 3R3TA 5D4PA 3K5PA 3V5RA 3N01A 4K5RA 4WXOA 2GQ2A 4NX9A 2XGPA 4KIAA 3ITHB 3JAMY 2XS7A 2FPHX 4IO9Q 2VH7A 3CJ2A 5THWA 3C2PA 4RW6A 2XC9A 1G6BA 4X4UA 1HPZA 2X51A 3CGIA 2I0XA 1RQ0A 2BABA 5KT6A 4AUKA 4N76A 2ZBIA 1RTIA 3WX4A 1REVA 2IFXA 2QV6A 4Y0FA 4F2SA 3NG8A 3HXMA 3O1LA 4KJIA 4DLGA 1S1XA 5CYQA 1UWBB 1S1WB 2WK4A 2MQLA 1FRHA 1P9QC 2O5DA 2DIUA 5I3PA 2ZJQQ 3C6UB 4NLRA 3QMQA 5I3UB 3J7YI 3KLEA 3QLHB 2UVWA 2MKJA 4RW4A 2ZH3A 2PMZD 3M8RA 1H6KX 3CO9A 1VQYA 3B78A 3PZPA 2YNIA 4Y28C 3B4DA 2XCPA 1JLCA 4YY3F 4KHPF 4B9NA 2YNFB 1IKXA 2RS8A 5MLCV 3KK2A 3MXHP 2PA8D 4B02A 2E7WA 4PCQA 4DV2F 3DOMA 4FXWA 2NUHA 4F2RA 2KDOA 2LQ9A 3DDNA 4FZVA 2V8VA 4P7VA 1NK0A 4OIXA 3M8PA 2YKPA 2CVEA 1DAXA 4ED7A 2WW8A 2FVRA 5FJ4A 4FXVA 1S49A 3T1HF 1BY9A 2XS5A 4NLPA 4DEZA 2QRRA 3C6UA 5I3UA 2MZJA 3CF5Q 3EGNA 4OI1A 1RISA 3CDBA 4WTYA 1FKPB 2KM8B 4KHRA 1VK3A 4HI2A 4C7QA 2DD8S 3RTVA 5EWEA 3HFKA 4Y34A 3KK1B 1DQAA 3GYNA 1MW7A 1SC6A 1HA1A 1LFWA 4H4MA 4B08A 1RAJA 1HI0P 1DARA 5F8JA 3CJKA 2ZNZA 1UMJA 5KFGA 2F8EX 1S6UA 1CQMA 1XMOF 3MMCA 1TV6A 4B3SF 3TA2A 1R6YA 2HFOA 2GMLA 3SQGA 5F8IA 4DF4A 5K8OA 4DSEA 1FKPA 4ZHRA 4X4OA 1G3OA 3MEDA 1AROP 2EFPA 1KEKA 5LMNF 4CT9A 5HQ8A 5F41A 3UR0A 4FF2A 2YX1A 2R8KA 1Y5LB 4EGLA 5L8RC 3LP1B 3US5A 4KHMA 4X4PA 3SSSA 2KN4A 4DR2F 3CEDA 3NRBA 3G6YA 1X4HA 5KFQA 1Q79A 2XSJB 3VR1A 4DL6A 1VQ6S 4I6WA 1KVIA 3V4IA 2DBBA 1U48A 4XIUA 2GO9A 2YWHA 5I42A 1ZETA 2ZE2A 3MEKA 4OZ0A 4YR2A 2CKWA 2LDIA 2N3OA 2KTQA 1FHTA 5J1EB 2AX0A 1VBYA 1WTBA 1DQ8A 1UVMA 4YEAA 3A1YG 3RW7A 1M1KT 3CCMS 3LP1A 2NZ4A 5KFJA 2I5JA 4Q8EA 2XB2D 3RAMA 4IOAQ 2RT3A 1MU2B 5HO4A 3P5TL 3PW7A 1GT8A 2QO3A 4X4VA 4C8MA 2XSJA 4NOHA 1JJ4A 4CO2A 1Q7YT 3UI3A 3IRWP 2GMHA 1C4AA 3MM8A 4MYUA 2X1BA 1LW2A 1XMBA 4H4OB 4MIWA 5DQGA 5KFBA 4WFBQ 1P8GA 3TRGA 3M2VA 1IKYA 4AFFA 1B7FA 4JV2A 2W9BA 5J1EA 2KVIA 1T05B 2IRYA 5A2QY 3HLUA 1JLGB 3VAKA 3NAIA 2G4BA 3P96A 2YX4A 2ZJRQ 3MM9B 1DLOA 3VALA 1EP4B 2YY3A 4DG1B 3MAQA 4H4KC 3G6ES 2I9SA 2W8KA 1WEZA 4LIRA 1T7PA 1O8BA 2AGQA 4OZ5A 3ZZUA 2VA2A 3VAIA 3PW0A 4LF9F 1C2PA 2JFDA 1J5EF 4Q2LA 1FRMA 3U7JA 3U1MA 2YKQA 3DOKA 1URRA 5KFCA 3NAHA 4M1KA 1LK5A 2ZH5A 3P3DA 1S0OA 2RF2A 2IM2A 4BC9A 4J9NA 2MQQA 1VQPS 4C3KA 2L9DA 3MM9A 5IM0B 1FRJA 2O67A 4DG1A 1V6HA 4F02A 2DISA 3OFHA 1RT4A 1CQNA 4QIVA 3GQCA 3QO9B 5J2QB 2IM0A 1K73T 1KN6A 4RBTA 2C2DA 1Q81T 3M2UA 2N4DA 1ZM2A 2YTCA 1LOUA 2YNHA 3QJPA 4DDFA 1KFDA 4G1QB 1M0SA 3X3UA 2N82B 4OV1A 3RBDA 1F9FA 1AW0A 1NAQA 3JTPA 2FB0A 4QWDA 4G1PA 1JLQB 3GV5B 5F3ZA 1V3SA 4ZP6A 1YJWS 3TNVA 1RT6A 3AQOA 4YR0A 4LF6F 5HROB 4DPOA 2JHEA 3LANA 4FN5A 4CCHA 4RBVA 4KT0C 1WI8A 1QJHA 5IM0A 2XS2A 1AFJA 4HT7A 3QO9A 2B43A 2MQPA 2F40A 1RA6A 3MMBB 3EPIA 4X4NA 5LSOA 2BACA 2VPZB 2EK6A 3CWJA 4U9RA 2VG5B 4B3OB 4KAIA 4XDDA 4G1QA 4LF8F 2XMJA 4I2PB 4LSLB 1L3TA 3V6HA 4ICLB 4I7FA 2KZMA 3CUNA 2CQIA 5DQHA 2OPSA 1MMDA 4F4XA 2V4JB 2IMOA 3H8YA 2DT9A 2YKNB 2E9ZA 1QAYA 2KRRA 2WHOA 1PC4A 4OI2A 3M9NB 2R7VA 4MIBA 2HW3A 3Q23A 2DNOA 4C9DA 2VKZG 5AE3A 5KG3A 1LW0B 3HHEA 1R8PA 2K3KA 3VZHA 4JI0F 4H54A 5A8WA 3OV7A 2HFNA 4L72B 4BHQA 2KO1A 3AH6A 4AXJA 5AJ3F 3J7Z5 3KK3A 4DS4A 1HYSB 1ZM4A 2ZDPA 1FRXA 1H2UX 4DL0C 1S4FA 4CT8A 4KFBA 4PG7A 2LXFA 3DLKA 4QIEA 4F26A 1O5JA 4IH7A 5GAEI 1JJ2R 3CCWA 1LK7A 2DNHA 3G96A 5BYRA 2A1BA 3TANA 1IXKA 4KKOB 2ERRA 3DLGA 3BR8A 3RB4A 5DGBA 4DFPA 1ZTWA 3N4WA 3LPYA 2CQHA 4MFBB 5E3RA 1LW0A 1QLNA 1Q8BA 3SZ2A 5AXMA 2DNPA 2MZQA 3CC4S 3SXLA 1C1BA 2R2SA 2QA2A 3M2RA 3N6NA 1IR0A 3IR5B 4N56A 3J7A1 2GIQA 5HI7A 4K0KF 4NZ7A 4ZP8A 4JI7F 3BSOA 1HBUB 1WHYA 2DRBA 4V19J 1FKOB 4K4WA 3UDCA 5D8HB 4USIA 3T6BA 2PI5A 1GH8A 4A8SA 5BR8F 4TU9A 4OX6A 1R43A 4Y65A 2DGOA 3F41A 3FEXB 5I3QA 2FJVA 4NCBA 4ED3A 3ENQA 1N48A 1L5UA 2J9EA 5CA5A 4C11A 3MUVP 5E3PA 2NPFA 3DRPA 1XBWA 3G6XA 3KNAA 1FJGF 4DLEA 1ULRA 5HP1B 3UNGC 3MFHA 3OUYA 3TOQA 4ZP7A 3OLAA 1NKCA 3E3XA 2YWEA 3FRYA 3SCLE 1WF2A 1IJEB 1R89A 1U25A 4EO8A 4QU6A 3OHBA 4IH6A 3KHGA 4Q43A 2OMLA 1FKOA 3CD7A 3V81B 2FY1A 2CVIA 1DQ9A 1Y00A 4RNHA 3WBZA 2VFVA 3BO4A 3MEEA 4NLOA 2IVFB 2G0CA 3FSXA 3S1TA 3MF5A 1WELA 5J2PB 2B6AA 5B0EA 3AJ2A 2KT2A 3QWUA 2KI2A 2FD2A 2CPZA 2MMYA 2WRMA 3C66A 5KFAA 3TVKA 4WKYA 5JUMA 4FS2A 4NCAA 1GTHA 5HP1A 5T7LA 1UFLA 2ZHOA 4R8UA 4XDCA 3M32B 4M95A 3PACA 4LFAF 4HKQA 4OHYA 3OQ2A 1MROB 2Z2LA 3LW5C 4GO7X 1SL2A 3OXFA 3DI6B 4JUZA 4CI0B 2IRUA 1TKZB 2CQBA 2AJ4A 2B9XA 3HF5A 2HVIA 4L3NA 3VAMA 1WACA 2J9CA 1ZM9A 1HFEL 4DV0F 1Y5IB 1H98A 4OL8A 1SXLA 4Q8FA 3CTRA 5M2PA 2E44A 3DXBA 1TVRB 4OHXA 3FGVA 3I87A 4DSKA 1XERA 3NGDA 2MKIA 4M63A 1N32F 2EKYA 1J5OB 2W7AA 3KHRA 3NL0A 3GV8B 4OI6A 1P27B 3QGIA 5KFUA 4R0JA 1D9DA 1VQ4S 4LT6A 3DNCA 4RW7A 5CYMB 2ZHBA 1FJCA 3PIPQ 4NLVA 1MWYA 4PQAA 2GIRA 2BBEA 2R7TA 4YP3A 3CDAA 4LUBA 3L3CA 1GX6A 4MAKA 3PRBA 3W3SA 3OVBA 3MM6B 5K8NA 1MSWD 2Z8QA 4IFYB 4TQRA 2DGWA 1NH8A 2QSFA 4KR0B 3RRHA 3BSAA 1FNOA 5HMYA 5ITHA 4CO4A 1J5OA 4NZ6A 2CQ2A 1JLEB 5IFMA 5KFSA 4Q0BB 3L7OA 3G6VA 3ZC4A 5M2UA 4EFAC 3IRXA 3M4XA 4ZLPA 2R4FA 4E98A 3N6LA 1KSPA 5DG9A 5CYMA 5K5MA 3FRZA 2PMHA 5DDQC 2DNRA 2JRSA 4DUYF 1S0MA 1WD6A 3SEOA 1GTEA 2D74B 2DGTA 4XO0A 4KO0B 1KD1T 3HHLC 2XG8A 4TLQA 2KJWA 5KG2A 1X5OA 1S9GA 4WFXA 3U1LA 1VQLS 2CPXA 1DHMA 3CE8A 3BGUA 5GAGU 1FF2A 4WFYA 2R9LA 3VF0B 5HMZA 1LWFB 1R31A 2ABYA 4ES2A 2HHHF 4F8RA 4C8ZA 1RT2A 1JLEA 4J9OA 3DRXA 4RW9A 1HWUA 4Q0BA 4ZPWR 2MZSA 1HARA 3MOJB 5HMXA 3JB9k 2CJ9A 2ASYA 4A46A 1LWEB 1L3VA 2IBOA 4AE5A 2DRAA 2CG4A 2KB2A 1R8CA 2M52A 4DBQA 2CPHA 3S7RA 2DR9A 3CDEA 2DHXA 2K1RB 2PDAA 4QPTA 3UDLA 4HEA9 1JLFA 3JSMA 1HD0A 3BJYA 4C8YA 4QWAA 3I32A 4WXWA 4OLOA 3FEZA 1VIXA 1LWFA 1KLNA 1BC6A 2R2RA 4C0OC 2R2UA 3NBPA 3S6EA 4QYZJ 5E3AA 3TA1A 2HVHA 5FDLA 2CQPA 4QQBA 5E5NA 5K14B 4LFBF 3Q22A 3BO2A 2BDPA 3KMQA 2DR8A 4KC5A 2AWZA 2GW8A 1PGZA 2B4OA 2BV3A 2LXIA 1VC0A 5KFOA 2M3DA 2IA0A 2HNYB 2RILA 2V5HG 2IVMA 4NRUA 3PIOQ 4B3RF 1N36F 4LQ3A 2CJKA 3GIJA 2UVUA 4X62F 2XSFA 1H3DA 3H40A 4B3MF 2G1DA 3DU6A 3OLBA 2JVRA 4JI5F 2RRAA 2BXJA 4N41A 4ECTA 4ID5B 4QZVB 3I96A 4QWEA 2EBGA 3WZ0A 2VC1A 3CXCR 5D4OA 2QT7A 2ZH8A 1VQMS 3D1QA 1YTYA 1S6PB 5DO2A 3CCLS 2F8HA 1IKVB 2PSZA 2CJAA 5T14A 5DQIA 3MD3A 2DGVA 2QMXA 3QIPB 2JJ4D 3I0SA 4ETZA 1ZZNA 4DSIA 2GGPB 3MPWA 2LQBA 3NCPA 4DN9A 4LF5F 2BW2A 5C42B 3C3LA 4JV0A 2FLPA 2OPPB 4J9RA 4ID5A 2UV8A 1UVNA 4WKRA 3U02A 3VZIA 4QR2A 1ZAWA 5HLFB 2PD1A 2KYXA 5E3QA 2V2KA 2OP5A 2QE5A 3UE2A 3HP6A 2LU2A 2F9JA 4OHWA 4QBUA 4TU8A 2XLKA 2HWHA 1IKVA 1VRTA 3MM5B 4O44A 3HVWA 3LOUA 1NRKA 5IT4A 3QIPA 2VBXA 3DHXA 2FC9A 3DN9A 2BANA 3CT9A 4TYBA 3T3FA 2GGPA 1HQEA 5KTQA 2ZH6A 2B4UA 3PVXA 3DOLA 2RUGA 4RNNA 3DRRB 2OPPA 1X9SA 1E6VB 2FHJA 4A8FA 1J2VA 1DTTB 3GWCA 3ZZ0A 2P6TA 4Y3CA 4F25A 2J6SA 1NO8A 4LVOP 5LSRA 4EYHB 2Y1IA 2JEFA 3RRGA 1U49A 2BJDA 5KFNA 2CPFA 2W4PA 1JXEA 2B7CB 2JX2A 1RTJA 2K7JA 4RLEA 4Y6IA 4N5SA 3VWSA 1RT7A 3M1VA 2AQ4A 3J81Y 1JLAB 2JWNA 4TN2A 1CVJA 4NA2A 3I55S 5BJRA 4DL7A 2Q43A 2NPIA 1WHWA 4HVZA 3PW5A 5B7WA 2OPRA 1Z4UA 2V4QA 1FCAA 3BGRA 4OX8A 3CD6S 2JSXA 3MEGB 1DZ5A 4PG4A 4YB1P 1G2EA 4ATNA 1YRXA 2B5JA 2AX1A 3D1OA 3DYAB 1D8ZA 3PR5B 2RQCA 4HI1A 4ETXA 3JYTA 3QZ8A 2DHAA 3RR7A 4WIIA 4FXDA 2DK2A 3D0IE 4NYOA 2VV5A 5K8PA 2LQ5A 5KG1A 1NK9A 2VASA 4F3QA 4URQU 3OSPA 4RW8B 4USHA 5B0DA 2MHEA 4B9SA 5KFWA 4MIAA 4RU9A 1IJFB 2HPUA 3E8OA 3HHLB 4ZVFA 4EU0A 3PNIA 3VTIA 5GADU 2PIIA 2CPYA 3M30B 3OTBA 3DM2A 3MEGA 3TUIC 1D3WA 1K0TA 3CDWA 4QIWD 3CJ4A 2NREA 4YMEA 2UVRA 4HDGA 1H2VZ 4UY85 1B0VA 3PDNA 1VIOA 4DV6F 2UUWA 2E1CA 1GQEA 2Q3PA 4BWJA 1XNRF 4RW6B 2EW9A 1PSDA 2XLIA 3G71S 2BQ3A 3BF4A 4RW8A 4TYAA 4X4SA 1S9EB 4Q7AA 5SZTA 4U7UK 2F1FA 2J5AA 2HAIA 1S1VA 1RTIB 1TKXA 3O6QA 4E0DA 2ZZNA 4FS1A 2QLWA 2FLNA 1R0AA 3O5TB 3GIKA 1FEEA 1OS5A 4XK8C 4TQSA 4DV3F 1S1XB 3GILA 4B9MA 2BQUA 4U6PA 1LXJA 1RK8A 5CYQB 4C2MA 1S10A 3FEYB 2ZJPQ 4Y2KA 5KFIA 3NNAA 1MNEA 2R7SA 3AHPA 1RJJA 1XC9A 4RUCA 1VLYA 1VMBA 2FGOA 3KLEB 3PX4A 2FHMA 2HGNA