4LFBF

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 24
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4lfbF00
3T1YF 1HNXF 4DV6F 2VQEF 1N34F 4JI1F 4JI3F 5BR8F 1IJFB 2BVZA 3T1HF 4JI6F 4X62F 1J5EF 1XNQF 4JYAF 4YHHF 1CQMA 5LMUF 5LMNF 4AQYF 4DUZF 1RISA 2UXDF 1HNZF 1N32F 4GKKF 1LOUA 2YY3A 4JI8F 4LFCF 4DV4F 1G7CB 4JI7F 1F60B 1XMOF 2E5LF 4DR3F 4B3SF 1FJGF 4K0KF 2BXJA 4X66F 4DR5F 2B7CB 4B3TF 4B3RF 1B64A 4LFAF 1FKAF 1QJHA 4LF7F 4DV3F 4LF6F 1G1XA 3OTOF 1IJEB 1IBMF 4LF5F 2F4VF 4JV5F 4DR6F 2HHHF 2ZM6F 4DR7F 4X64F 2UU9F 4DR2F 4JI4F 1XNRF 2UUBF 4B3MF 1CQNA 4YY3F 4GKJF 1N36F 2UUCF 4DV7F 4NXNF 5AJ3F 2UXBF 1GH8A 4X65F 4NXMF 4LFBF 1IBLF 4LF9F 1HR0F 2UXCF 4DR1F 2VQFF 3ZZPA 2RJZA 4LF4F 4DUYF 1I94F 2UUAF 4KHPF 4DV5F 4OX9F 1N33F 5IWAF 2J5AA 4DV2F 4DV0F 1HNWF 4JI2F 1XMQF 1VMBA 1IBKF 3R3TA 2KJVA 4JI0F 4DV1F 2KJWA 4JI5F 4LF8F 4DR4F 2B7BB
chains in the Genus database with same CATH superfamily
4RX6A 1P1TA 3QPIA 1U26A 3P6YC 1N34F 1OY9A 1Q79A 5JUMA 4FZVA 4IYQA 2LQBA 3RRKA 1V3RA 1YHQS 2FY1A 2RUGA 1KS2A 1YRTA 3GP9A 3CJKA 5B0DA 3K0JA 2RD5C 2BYCA 3IXQA 3MM8B 1U1OA 4KGKA 2Z57B 2FYXA 1XQIA 4NA1A 5GVQA 1RCOB 4ZJOA 3VQTA 4N5SA 2BOPA 3UE2A 2FGOA 3OLBA 2E1MC 4KPYA 1QE1A 4NLYA 2YX1A 1AW0A 5C5JA 3QAEA 4CH7A 4AQYF 1NEEA 1G4CA 1P6TA 5B0AA 4QWDA 1QUVA 4GVBA 4AQYJ 1LW2A 1S1WB 3UN3A 1H38A 1WDTA 1VRTB 3HHLB 4KFBB 5L8RC 4WFAQ 3G6XA 4N77A 3LGNA 2R8IA 2U2FA 4RUAA 3SCKE 1SC1B 1RWPB 1U4BA 2R4FA 3AODA 1YX2A 2OAUA 4LR8A 1GMUA 1LWEB 5ETPA 3SIPB 2J6UA 2YNFA 3J7AN 5JVGQ 3JAMY 5C25A 2OP5A 4ANEA 1X4GA 2BQUA 3MPUB 1V3ZA 2OSQA 3PKMA 3FEXB 4A8YA 4TLQA 1VQKS 2UVRA 1FJCA 3RJMB 1ZTTA 1T9TA 3MEEB 4F2RA 2XMUA 4KYZA 3ILLA 4UOFA 1PG5B 5IQ6A 1MMNA 3PKYA 1T05B 1UWBA 1BQXA 2FDNA 3QLHA 4Y3CA 1T9YA 3CCSS 1T3NA 4MKAA 3M9MB 3VVUA 3PRBA 3HPOA 3MMAB 2DH8A 4CO1A 2DGTA 3HHDA 3ET6A 4KIAA 3RAMA 2F40A 4CT9A 2V67A 3H2VE 1NB7A 1FWLA 3K5PA 4RW7B 4NLXA 2HRUA 1TKXB 1HNVA 3BM7A 2GCFA 4RKUC 3DLBA 2MMYA 3RBEA 4B3MJ 1X4HA 1FKAF 4I69A 3G9CA 2GHWA 4R0EA 3NBPA 3JAMU 1WKKA 2KVQE 2OTLS 2RU3A 2VPWB 4V19J 4BBYA 2RQKA 4M63A 1IJEB 4EBEA 3BV8A 1GX6A 3UDLA 1TL1A 4R0JA 4RNOA 1RT2A 1QUPA 3LWMA 1NK9A 3CCZA 3IG1B 3FQKA 1S9EB 3RGIA 5IC6B 3TZZA 3CEDA 2RILA 4ES3A 4DV6J 3HI9A 3PR5B 2E5IA 4NLOA 3ELHA 5L39A 2YWFA 2QLWA 1MN7A 4WFZA 1IQZA 3SDEA 1H2VZ 5CYQA 4ZN1A 3LPYA 4MYUA 4NLQA 1TELA 3BSNA 3NNCA 5KFXA 2Y0BB 4DFPA 2BABA 3FFIB 4C11B 2QTWA 4ZLPA 1RACB 2DNGA 4A8QA 1S0OA 1HR0F 1CC7A 3R5DA 2IC3A 4C3KA 4CTAA 4W90B 3K5LA 1R8BA 1YBAA 4ZP7A 4PWUA 3EVWA 5G4DA 1S9GA 3FKBA 2HVIA 1X4AA 3MPYA 1QSYA 3R2CJ 1O5JA 5CYMA 2VBWA 1BQMA 2EBGA 1VISA 2BW2A 2B9WA 3VTIA 4DV5F 3RAXA 5M2RA 3MD1A 2AX1A 5BYSA 3JQJA 2KB2A 3D6HB 5E41A 2YTCA 5FLXU 2VPYB 2JOQA 4N56A 4ED2A 1JWWA 4P75A 1HL6A 2W4PA 1SJ4P 3DLEB 4ATNA 1RQ0A 3DYAB 5EWGA 2IRUA 4ZPDA 2JL9A 3C3LA 1LQ9A 1FHTA 4QIVA 5K20B 2CVEA 5KFQA 1Q81T 1RU2A 1OMSA 4IQMA 1PCAA 3OXGA 4LSLB 4CT8A 3JSYA 3MUMP 2JC0A 1TL3B 3Q86A 1RWOB 2CFXA 2WBRA 1QVGR 1NDLA 3KLIA 1FE0A 5KFMA 1L3VA 1I94J 1GXTA 4LF8F 4DI6A 1N5YA 3MM5A 1DFDA 3CIMA 3LO3A 2OGUA 3BSCA 4FKXA 1PAEX 3TZWA 2GQ2A 1WOSA 4JI1F 2XMWA 2KU7A 2RT3A 3ISND 3TP2A 4PWDB 2BVZA 1VHFA 2C22A 2MZTA 3DRRA 1OSCA 4ED7A 1UJ6A 3FJ2A 3FBEA 2D1CA 3G82A 3IS9B 2B56A 4X62F 1H98A 3OBIA 5C2CA 2XM3A 3TANA 4MYTA 1NK4A 1FD2A 4NX9A 3N28A 4H4KA 1Y0HA 5ETQA 1DQ8A 5I3UA 2XC9A 3JSBA 3MEGA 4OI4A 1HYSA 4OZ0A 2EFQA 2R7QA 3QIPA 3MR7A 5LMNF 4X2BA 3QO9B 2DKOB 3ENWA 3NCRA 1B7YB 1NZAA 2AP6A 4O44A 4Q7AA 4ECSA 3QSYB 2C2DA 2VFTA 1FJEB 4ED4A 5HLFA 4JV5J 2BEFA 1AUSL 5K9FA 3WZ0A 5B0GA 3FC9A 4IR9A 3W66A 2FJDB 1HBOB 4CLKA 1W26A 1FFGB 2UZAA 4WIQA 3MTKA 2M52A 3LGMA 3CUNA 3MEKA 2HS4A 5DM6Q 2ERRA 3I0SB 4DV4J 3HVWA 2NSBA 1JXVA 2W4CA 2WVEA 3IBCB 1NJYA 1TFWA 4U7UK 4A48A 1JLGA 1DTTB 1TV6B 2C2KB 2F65A 2PIIA 2V8HA 1RWKB 2WW4A 4CDIA 3OFFA 2HGLA 3K59A 2AZ1A 4RL1A 5EGYA 1FDAA 1RTDB 1S6PB 4DFMA 2CIMA 2CDQA 2I1RA 3BH6B 3KLHB 3D1QA 3J81j 1RTJB 3OPKA 2DR8A 1IKWB 1WOPA 1F3VA 1CULB 2LEPA 2W7OA 3TOQA 4ECYA 4TLRA 1LWCA 3HSJA 4BDPA 2R2UA 4ED6A 2UUTA 2GGPB 1M0SA 2J8AA 5HN0A 1S72S 5IQQA 2KTQA 5CZVA 1YJVA 1FWPA 3HHNB 1FX2A 4CLFA 1SJRA 3EYZA 3ZZ0A 2XYGB 1PC5A 3DU6A 4F4KA 3KLGA 3KJNB 1NBEB 2FHOB 2QZ8A 3BSOA 1VC5A 4IOAQ 3NCPA 2Y1JA 2LEBA 4U96A 3UDEA 3MUVP 4IG0B 5A6PA 3UCGA 2HQCA 5L1IA 2CZ9A 4DG1B 4ELTA 1SB6A 4KHRA 2HURA 5GAEI 2NR0A 2QYGA 4OYWA 4JI4F 3CDWA 4WJBA 4MTPA 1DAXA 1FKOB 5C42B 3AD9C 1LW0B 4WFBQ 1YJUA 2XGPA 1RWVB 2V34A 3G8QA 1M90T 3MMCA 3T1HJ 2RQCA 3HLUA 3NS7B 3RB0A 1K44A 1QVFR 2XI3A 2UV8A 1U48A 2YX7A 3CW2C 3L3CA 4USJC 1ZPVA 2AYGA 2Y1RI 1HNXJ 4G1QA 1N5VA 2HQIA 5KG4A 2E7VA 3T19A 1BUXA 2BJ3A 1UEKA 2UUAF 3DLGA 2PA3A 2NXEA 3I31A 1FDNA 2VG5B 3R5JB 4AE5A 5J2QA 3AB2B 1WDDA 3M8RA 3M8QB 2H54B 4NLUA 3HSZA 1AFJA 2OMLA 3I6PA 2CJXB 5AJ3J 1RCXB 4EO6A 3LW5C 2QA2A 1RT4A 4RW4A 4J5OA 2BOAA 1OPIA 4FXVA 3VGUA 3T5KA 2LQ9A 1Y10A 5G0RB 1JLFA 3B6BA 2WVBA 3AOBA 3MCSA 1NM2A 4WZMA 5CZXA 4CM0A 1FE4A 3LH2S 3PYFA 1RT7A 1S1UB 3TA0A 5AE3A 3SQGA 4PWWA 3CJRA 3EPGA 2W24A 3LF0A 4ZPAA 4Q45A 2CADA 2XMKA 2BR0A 4DX7A 2UVVA 1RWMB 3ITHB 1X4EA 2OTJS 5HROB 1PIEA 5D8HB 4NZ7A 1HW9A 2H5JB 2VFUA 3C15B 2BRLA 2JFKA 4GC7A 5LL6d 4C3MA 1IJFB 4DSKA 2YXLA 3I9V9 4JV2A 4R5PB 2ZBRA 2POKA 3PYEA 2VC0A 3L9ZA 4UY8T 3EGNA 3MPDA 4ED0A 1S99A 2RUSA 5RUBA 4YHHF 4ECZA 1HBNA 4C9DA 1RAEB 4ZPCA 5LMUF 1CS4A 3R9LA 1KRPA 2X3GA 4EBDA 3DOKB 3H2LA 2F5GA 5A6WA 5U47A 5IV4A 2YWKA 4ANCA 3NXZA 3HXMA 4DQRA 4F3OA 2BUNA 2VODA 2D41A 4WFXA 2DNRA 3UVJA 3DHWC 3JYTB 2W9CB 1GNKA 1S9FA 2CPIA 4LT6A 1UETA 3DFEA 3SYZA 2A18A 2JX2A 1VQ9S 2ZH5A 3CJQA 1LOUA 5ETLA 1QM9A 2Z4PA 3W63A 5HJYA 2HIQA 2R7OA 1SL1A 3OTEA 1FERA 1WHXA 2OJ3A 3CJTA 4FYYB 2J9EA 4A46A 5JXSA 4S0MA 4DV1J 2X3DA 2K8GA 3K7RA 2RSQA 1NK6A 1M1KT 2OO4A 2DNLA 1UEVA 2KT5A 4F7VA 5LMNJ 1C4AA 4C8LA 4WCEQ 4I2QB 2YNGB 3QYYA 1T9UA 1XN9A 5GAGU 5F3ZA 1RT6B 2XBPA 3PFOA 2ZH9A 4M5HA 4DV0J 5GADI 1HNWJ 1RHJB 2CNOB 4L3KA 3DRPB 4ILMA 4NXMJ 4ZHRA 2DH7A 3LAMA 1XTZA 3E01A 3DGVA 5KG7A 1S7IA 3J7A1 1KVJA 4NYPA 2ADCA 9ATCB 2MZJA 4OFZA 5E7OB 2LDIA 1OSDA 2DITA 3CSKA 3FBFA 3OTOF 1RAIB 3FBCA 4DCOB 2BA9A 3UNYA 2W9BA 2DNHA 3IGVA 4ID5B 3THTA 3B8HA 3KDOA 3IC1A 3I4HX 4WXWA 3BYRA 1PO6A 2F4VF 4Q2LA 1WTBA 1F6TA 3K57A 4JI0J 2DHXA 4OI3A 2YH0A 2QSFA 3P5TL 2CQPA 3T3FA 1EARA 5GMDA 2XMJA 2RRNA 4X64F 5L1LA 3MUTP 2J6SA 2HBQB 3ENQA 3MMBB 4ERDA 4UW2A 3K8WA 4ELVA 4AT1B 3QFHA 2QA4G 2ZH7A 1H2TZ 2C2ZB 3HF5A 2QL7B 4OZLA 3R5BA 4DCPB 4QYZK 4IOBA 3B82A 3T5JA 4FVCA 4LSNB 3CO9A 4IH6A 1SQFA 2YKAA 4RW8A 3MM9B 2PEHA 1IKYB 2BACA 4NI2A 4DFKA 5KOXA 2PMHA 1VQ8S 4IR1A 3L7PA 4YB1P 4JP8A 1WG4A 1IR1A 4LQ9A 4USUA 4ZVTB 4U8YA 3KJQB 1AXQA 1WI8A 4P7TA 1M5OC 1UJ5A 2B8QA 3M8PA 1SV5B 1J2VA 2E5JA 3CMQA 3DOMB 3S01A 1RA7A 2GMHA 4IUFA 3GYNA 5BR8J 3H5YA 2GZOA 1ZH5A 3NNAA 5C24B 2K7JA 4JI8J 5I4MA 2H5IB 2H4YB 4IQXA 1FRLA 2JVRA 4DN0A 2CVIA 1NDPA 3QWUA 5LSLA 4TU9A 1XMQF 2O01C 1V6HA 3PRDA 3RG6A 2H4WB 3GSDA 4J9KA 2KT2A 1R7IA 1ACMB 1YDLA 1K47A 3AJ1A 5KFVA 1MLAA 1BE4A 2CDRB 5AE1A 3H7HB 2KJWA 2OKQA 1JJ2R 1FRJA 1N5SA 2JHEA 1TKTB 1WF2A 1DURA 2B4UA 4LREA 2HNYB 4ALZA 1HBUB 2VICA 3TUJC 3LP1A 2DPIA 2YKOA 4IG3B 3SDEB 1UVIA 2WVDA 3WIUA 5BR8F 3H5XA 4U7CA 2C42A 2GVDA 2GIQA 1EJ7L 2JH3A 2ZUAA 1SQEA 4F67A 2VUGA 3A13A 3PXGa 3T5HA 1YBUA 4EU0A 1J5EF 4PXBA 4ES2A 2DR5A 1CJTA 4L72B 2D3OR 2V69A 3D0GE 2IBKA 2V2KA 4PYDA 4PYAA 2EFVA 4JOUA 2NSCA 5IT9U 5D4LA 3HJFA 1RSCA 1DLOB 4IFVB 3D68A 5H9FJ 1S1VA 3E8OA 2NXCA 3QFWA 3JB9k 2KZMA 2XCPA 3OJUA 1RT5B 4AL5A 3G87A 4LBHA 5F8JA 2OPQA 3C14B 3BBCA 1YKWA 1X4CA 4KGMA 2VFVA 4JI3J 2CQDA 4YFUA 2B9YA 1H0HB 4RNHA 1OQ6A 2B9XA 2FC8A 2DIUA 1L5UA 1VCTA 3J80Y 2FLPA 2OELA 1JB0C 3D6MB 2QMUB 5L1JA 3RBZA 4A8WA 2JEIA 1GXLA 1RAOA 4DL0C 1F60B 1Y3KA 4LFBJ 4WE1B 3D3BJ 2MZ1A 2ZVIA 2XSJB 3F0NA 2XWXA 1H7WA 3JQKA 3CPWR 2GO9A 2I0XA 2HPUA 1RWNB 5T7LB 4AXIA 4RW9A 1MSWD 4A8KA 4FF2A 2YH1A 1Q95G 1RHKB 1UVKA 3M8WA 1UCNA 1OO0B 5EWFA 2FVPA 4FYWB 2UXBJ 2CG8A 1SUQB 3A1YG 3V6JA 3DRRB 2I5JB 2DTJA 2CJKA 3NGKA 3RR8A 1TP7A 5DDRC 1E6YA 2AF6A 3KK3B 1NK7A 4ZA1A 3BN7A 2MKJA 3VGSA 5I3UB 2X1GA 4RBTA 1W7WA 2M4MA 4HI1A 1YZ7A 3T6JA 3OR2B 2IJRA 3NG8A 3W5YA 1XIQA 4MK7A 3FZ2A 1IBLJ 1HI1A 4DUYJ 2BE2B 1RYSA 4DR6F 3LUYA 1FWKA 1S79A 4YP3A 4IFYA 3DGPB 3Q83A 1VI7A 1LWXA 1NSAA 2VBYA 3UPFA 2CQHA 2DGXA 4ED5A 2GMLA 4YY3J 3ISZA 4M5KA 1AT1B 3R5GA 5IC4B 4Y00A 3GJTB 4MT1A 1A6LA 4Y2MA 4PRFA 5E3PA 4OYBA 3CCES 4O3SA 3IWXA 1VRQC 5AE2A 1NH7A 2B5JB 3FEYB 5CD4H 1KFSA 5FIIA 1RA6A 2G13A 2ZEJA 3FRYA 1WJ9A 2BV3A 2VPZB 4IDKA 4YHHJ 3PEHA 4QWAA 2LA4A 4I6AA 4Q2MA 1VK8A 2HBRB 5B0CA 3HKZD 4XDCA 1UZDA 2FLOA 2K06A 3Q8RB 1RTDA 2V6AA 1TKZA 3AD7C 2BRKA 4DUYF 4U7UD 2MSSA 4I1TA 2JSXA 1P9YA 1IKWA 4O4GB 2DGOA 4LF4J 2VDIA 1RB0A 1YG0A 1LWCB 1H72C 2YNIA 1B0TA 2IJNA 2HG4A 1KVKA 1KHVA 2QG9B 2QT7A 2XULA 3WX8A 2BZ2A 1T3OA 2IRYA 2WZ1A 4QOTA 4WF9Q 1JKHA 3P8BB 1IBKF 3CO0P 1D0EA 2Y0SD 4X62J 4E98A 4IKAA 1BY9A 2PN6A 4K5RA 3RB6A 2PFFB 3PHEA 4RLEA 3MZIA 3PRVA 1XERA 3KLEA 1RYRA 3ZFVA 5F3TA 2IYIA 4P2SA 4IG0A 4LF5J 2GV1A 1VBKA 4FBTA 2V4RA 3V6HA 3DLJA 4MIWA 2AW0A 2BE7D 1HLWA 2D3ZA 1NZ8A 2YWHA 3T1AA 4A47A 2LQ8A 4K4YA 1U1RA 2ZH8A 3OL8A 3HFVA 2CQ1A 2J0WA 3TW0A 4JUZA 4BWJA 2RVJA 2IM2A 4O4RA 3LALA 1WELA 2GA7A 2AJ2A 3HHLA 5D4OA 5DDQC 4Y0FA 3OJSA 2Q66A 3GQCA 5A76A 2ZOFA 4LVNP 2AJ4A 1MU2B 4IOCQ 4LJMA 4O3QA 2KFYA 2JEJA 5E5NA 3K2YA 4DUZF 1QTNB 1TU0B 2CG4A 4UUXA 1X4DA 3W8PA 1X9WA 2M2BA 2VPXB 3M8QA 1AA1B 3UN2A 4F4WA 3D28A 3IR7B 5LXRA 3OFEA 2ZOMA 3QLHB 1C0TB 3BBFA 2YY3A 4PG4A 4RW4B 1YI2S 1YIJS 1R0AA 1M5VC 1UVJA 1XR6A 4H4KC 2P6SA 2MGZA 3G96A 3MR6A 3PO5A 3IO1A 4NEYA 2DCLA 4ECUA 3NRBA 4ZVEA 2W7AA 2MLXA 3V4MA 4NA3A 3H5UA 3WHIA 4UZCA 4Y65A 3H42A 2J7WA 1U1KA 3OR1B 4DX5A 3Q22A 2D69A 2VBXA 3BEGB 3DLKA 2RRBA 1OY6A 2IM3A 1S12A 3CVKA 1N32J 1OS5A 3GTYX 3NBPB 2GJ2A 5K14A 4X4TA 4BS2A 1R0BG 4CI0B 4DXLA 1RT2B 1VJWA 3D1OA 4XPEA 1CLFA 2GAGC 5HBMA 3TA1A 4P73A 1S9EA 4O23A 5A8RB 3JTOA 4WKRA 3VV2B 4BWMA 1XC9A 2NPFA 1SKSA 4J9NA 1JLAA 1SXLA 2XI2A 2ZH3A 1AYEA 3I0RB 5D77A 1U0SA 1VBZA 5D0RA 3RB4A 3UCUP 2DJWA 2QMWA 4WYLA 2B3TB 4H4MA 4DPYA 2RHSB 4TU7A 3M32A 4ZIWA 2BX6A 5HQMA 3V81A 4QCLA 3MR3A 5J2NB 5HATA 2UU9F 5D0HA 2W9AA 2ZD1B 4P9SA 4ECQA 1WOOA 3JQMA 4NCGB 5D3GA 2DPJA 4C8ZA 4BLGA 1WEXA 1VDHA 1KC8T 3MAHA 2L9NA 2Z56B 3GG0A 1EETA 1S10A 2V4JA 1ZAVA 2GW8A 4WPAA 5IM0A 3W65A 5F8IA 2UUCJ 4AYBD 5E0OA 1S97A 2NQPA 4KGXB 4A8FA 5DRKA 1XMOJ 2CQ4A 2EFPA 2OHDA 2YQ3A 3BGRA 3P96A 4I2QA 4P2MA 5CQGA 1JLEA 3DYAA 1IBCB 1PBUA 4KO0B 3TEHB 4RU9A 3OSNA 2IAJA 2QFIA 5F41A 3BQ2A 2DR9A 2F4VJ 1FJ7A 2XO6A 3D9BA 2MY8A 2ZNZA 1JJHA 2DD8S 1S5ZA 1V9OA 3SSRA 4YR0A 1YTYA 2ZZNA 1X5TA 1MWYA 1RTZA 4NRUA 4OX6A 3PW2A 3DC2A 2AHOB 4NEZA 2IPOB 3HJVA 2RF2B 2Z2LA 3FMBA 1RWWB 3R3TA 3RU0A 5KG2A 1VLOA 1HHSA 2W9BB 2XTJP 2DB1A 3DOLA 5FLXY 1A7GE 3MM8A 4PXEA 4OIXA 5F9NA 3Q8SB 2G9OA 3DU5A 5DGBA 3QSIA 3OVAA 2UUAJ 1VJQA 4QU7A 1W25A 4ZVSB 1TVRB 1EIYB 2ZDOA 1DRZA 3SQOP 1HNXF 4KPCA 3MURP 4KBIA 4OX8A 1NAQA 3OFGA 4JI3F 1Q8IA 5EHHA 3EXCX 4B9SA 4O44B 4KFBA 4NE9C 4X66J 4OX7A 2C3OA 2K1RA 2V94A 3PIPQ 3T1HF 2BJ1A 2HS3A 3US5A 3SV4A 4OI2A 2AYEA 1LWEA 4LF7J 1IKYA 1HPZB 2LXIA 1DTQB 3DRSB 3PW7A 2E7XA 2IYGA 2MDAA 1NJIT 2FJWA 4BC9A 4ICLA 1D1UA 1EQ0A 4P72A 3JSMB 3AHPA 1KOHA 4RPFA 4ZCLA 2JC1A 4L6V3 1U8WA 2IY5B 5CAAA 2HBZB 3FUYA 1A9NB 4XO0A 2EVZA 3OQ2A 3G71S 1C0UA 1Y4ZB 4N8OA 3ET6B 2DYAA 1VIOA 1NUEA 1E6VB 1KTVA 1Y3JA 1HNVB 2YKQA 3NOGA 1VHIA 3LTOA 2XGQA 1FKPB 3VALA 2GS8A 2FZKB 4A8OA 4LR7A 2ZVSA 1HI8A 4OZNA 1HWLA 2Z2YB 2ZDPA 4USWA 3TA2A 4UQGA 1WACA 1TKTA 2OPSA 3PTWA 2LMIA 4MH8A 2Q6CA 2DO4A 1RE1B 5A2QU 1C1CB 2HLTA 1EHWA 3CCJS 3RBDA 1ZA2B 2XHCA 2ZFHA 3IR5B 3WC2A 4I4BA 5KFAA 2APOA 2KKHA 1OPZA 3HMJG 3J80U 4LF7F 4CM2A 3IA0A 4LVOP 2AU0A 4LF6F 3QRPA 2R42A 4YB7A 1RK8A 4DV3J 5FJ4A 2VASA 1TZ0A 2ZHBA 2VD3A 1DLOA 3GYGA 3MMCB 1VRUA 1S1VB 4IH7A 4DR5J 2X1BA 2V0NA 3RYLA 4B3OA 1R6VA 4MK9A 4OJ1A 5SUHA 3Q8VA 4CNYA 4TXSA 3Q8PB 4DR2F 5L9XA 2YNHB 2KFNA 2LXUA 2YVSA 3R27A 4YY3F 2QYCA 1NSPA 3GIJA 1YWXA 4NLSA 3RW7A 3VAJA 4G1QB 4Q8FA 4OI0A 2UXBF 5ADZA 1URNA 3Q2SC 3ZNJ1 1V3SA 3N5FA 1IBLF 2B6AA 2VG5A 2BDPA 2JRSA 2GJFA 3ZTOA 3KHLA 2A1BA 2G0IA 4NA2A 1SC4B 3HZGA 2FTRA 5DDOC 2KG1A 1FXLA 2E5LJ 1RT4B 3I55S 1Q8BA 3CCVS 3W2WB 3H40A 1LEOA 3GIRA 3OUYA 4MAKA 1GMWD 3IRXB 1I94F 1PSDA 1Z1ZA 2EFOA 1HMVA 2EG2A 3CJ8A 1S1UA 5IWAF 3LP2A 1N54B 3E51A 3CCLS 4A8XA 2EPIA 1U45A 1GTHA 1XK8A 3DXBA 3VQSA 3I56S 1O51A 1U0HA 1Y5IB 2Q1LA 1RTIB 3DN9A 4PWDA 4WP9A 2DNYA 3ILOA 3KK3A 1XNQJ 3C15A 2IRXA 2KJVA 2PMWA 2KFZA 4R25A 1EAYC 2HHHJ 2W1BA 3TX0A 4F0HA 1ELOA 4WK3A 2QLXA 4KGZB 1NSKL 4DEZA 1GEHA 1H3DA 4HH0A 1AZSB 1YJ9S 3UD5A 5A0YB 4DR2J 3PYDA 2OPPB 1LK5A 3QIPB 2JDJA 3TARA 1Q86T 1TK5A 4OYIA 2M0GB 4HDHA 1RT1B 3KDNA 3PACA 4YB6A 4ZP6A 3OW2R 4DL2A 2GC8A 1VYAA 2B4PA 4MFBB 4C0OC 3OSPA 5HLFB 2FZGB 1ZYQA 4LRAA 3DM2B 1HIYA 2DXFA 1Y9OA 4ECTA 3R5CA 5HMZA 4TKTA 4KKOA 2ZOGA 3GZ7A 3JYTA 2CPFA 4DHVA 2MEWA 4M94A 1UEUA 1RKJA 2HFOA 3DHXA 2Z8QA 4DL4A 1DJ0A 2X51A 1EZZB 2QLBB 2VIHA 1NK0A 3RZAA 1ZS6A 3I0SA 3KWMA 1HBMB 4DU7A 4PAAA 3TJAA 1AB8A 2FVCA 2UXDF 1B0PA 2M70A 4USKA 1FFSB 3HSDA 2HGNA 2A3JA 1ZBTA 3VWSA 4B9NA 1HI0P 2FJVA 2GHVC 4USTA 2HAIA 4OZ5A 2PO4A 3CD7A 3TO8A 3LA0A 2LYVA 4NPOA 4PZVA 2PDAA 4W4MA 1FI4A 1CULA 4O0IA 4EZ6A 4OHVA 4DV4F 4ECXA 1J5OA 3DRPA 1URRA 4DSFA 1HFEL 4EO8A 1YQHA 2EG1A 2CNLB 3BB5A 3I5BA 1UP1A 3PJ9A 4HVZA 3KLEB 5KFZA 2AQ4A 3KLGB 4ER8A 1U47A 2COLA 3GMGA 4GRSA 4UF4A 2N7YA 5ETNA 4ZP8A 1VGYA 2VG6A 4ZVPB 3CJKB 1SC6A 4A4JA 4O3NA 3SMZA 3ZTRA 5KFFA 1F5AA 4C7QA 2RKIB 3PY8A 5M2PA 3FSXA 4URSA 1B64A 2ZC3A 2RS8A 3SBMA 4HYKA 2WSCC 4HLBA 4DSIA 3TAMA 1SKRA 2XWYA 1RTHB 3LP0B 3OVSA 2R9LA 2VHGA 2YPZA 4G6VB 1S6OA 2FJBB 4J9PA 4HT5A 4F04B 4D3HA 3T9ZA 1QSSA 5I42B 4ED1A 3W64A 1U09A 5D78A 2ROPA 2UV8G 1RP5A 4OYAA 2F8HA 7AT1B 1R8CA 4DLEA 1EKRA 4OJ3A 4I56A 2GMJA 1FRXA 3EWGA 6FDRA 2UUBF 3TUPA 3OLAA 3OTBA 5J1PA 2Z0GA 3CJ5A 4M5MA 1SJ3P 5MLCV 1CG2A 2CPEA 8AT1B 3NAHA 3VAKA 1JJCB 3MEEA 3O44A 1UW9A 4OJGA 1X0FA 1T05A 4NOHA 5HP1A 2P9GA 1R8HA 2E5GA 2HNZB 1UPMB 1MNEA 2O67A 2I6WA 1X8DA 1N4LA 1CJKB 4OZ1A 4Y2KA 3R1LA 2GVZA 1YLXA 4DN9A 2N4CA 5D4PA 2BANA 3GCWP 4RUCA 4ECRA 4DR4J 1O0PA 4PG5A 4PKDB 1RZMA 4DS4A 2CPJA 4WKYA 2YKNA 4EGLA 2OSRA 2CQCA 2VDHA 3AFGA 3VGVA 5HROA 3UCZP 2BJEA 2F9DA 3OTDA 5HBMB 2VOPA 5J2PB 3H98A 1K1SA 2ZJPQ 1NNDA 2OEKA 4ZVGA 7FD1A 2VU5A 4K4UA 2I38A 2W8LA 5GMKa 1D09B 2HNYA 3BKUA 3F44A 3IM9A 3MM7B 1JLAB 2QL5B 3LP1B 5E3QA 3NS5A 1NKEA 3PX6A 4NLTA 4R5PA 4WP8A 5FD1A 4IRDA 4DV1F 3J81Y 4CQ1A 3C16A 3V81B 2PC6A 3WQPA 3KJVA 2XMAA 1ZA1B 3HT0A 3ZZYA 1S1TB 1U24A 2D9OA 3JSRA 4GVLA 3S1TA 4FYVB 3FFIA 2AX0A 4C11A 1F2GA 2A2DA 4MK8A 1G2EA 3N0VA 1Y5NB 2KO1A 3UVJB 1ZZNA 3IWNC 2WOMA 1FCAA 3EZOA 2CWXA 4N7TA 1N8RT 4XDDA 3V6DB 1NKBA 1N6QB 5IM0B 2RQMA 2N3OA 2HFSA 3WBZA 3QRQA 4JYAF 3ZZTA 1WORA 1X4BA 3A8JA 3FVYA 3GWCA 1VC6A 5LXYA 1K73T 5H9EK 2ZBIA 3C19A 2CQ0A 1N88A 2CPYA 1F3FA 2DHAA 3BGRB 4A8MP 2ZHOA 3P49B 5CXTA 2HW3A 2WSEC 1CSJA 1HNIB 1RISA 4CWBA 1S4EA 3H4DA 4FNIA 2VOOA 1KHWA 2QN6B 2JLEA 1N32F 2AEJA 4DQSA 4Z7CA 1SH3A 5KFEA 3T1YJ 3HHKA 3K5OA 4Q5VA 1UTAA 4DSJA 4ZHRB 2GQCA 4J9SA 4NZ6A 1TL3A 4G65A 3E01B 1Q53A 1FXDA 2BKNA 3A8KA 4C8MA 4CZCA 1G7CB 4HR2A 2HLUA 3IRWP 1FX4A 2UVUA 3DOLB 8ATCB 2J76E 3MM5B 4ELUA 1XMOF 5CCMA 1U02A 4I6YA 4WP3A 3FEZA 2I5JA 3IAM9 2P9CA 3OVBA 2VBZA 1TUWA 1TVRA 1JIHA 2ZKUA 2A0FB 4OYPA 1FRKA 2MLYA 1I3OB 3S6EA 9RUBA 1JNZB 1VQPS 2HFVA 2H1YA 4TVAB 3J81U 3BR8A 3CNQP 1EB0A 3VZIA 3M2UB 2ZJQQ 3W5ZA 3I5CA 2MPUA 4ZPWR 2V8VA 3BQ1A 3MMBA 2XZTB 2XG8A 3UR3C 3DGPA 3NGTA 3O2IA 5KG5A 1RAJA 1NLKL 2BKPA 4CH0S 1GFWB 3O3LA 4P71A 3EJMA 3FRZA 1DTQA 3DRSA 3Q2TC 3KXDA 5LM7E 1WKJA 3I5AA 3BGFA 2W2QP 3MR2A 1TAUA 3JSMA 2E1AA 3K8VA 2RDJA 3TX8A 3RR7A 1N34J 1RKIA 2JJ4D 1F5BA 2V2VA 3KG1A 1J27A 3EGVA 3SEOA 1L3TA 1HHTP 4L74A 4DZ6A 1N48A 3M8PB 2YWWA 4GKJF 2ZBQA 1JLQB 1TTHB 1ZPWX 2ROEA 3DOMA 2QIFA 1E6VA 3GV5B 4QR1A 5C24A 2RHQB 4TQSA 3KUGA 1DTTA 5L1KA 2LXFA 4DV2J 2WAQD 3ENAA 2UXCF 1FKPA 5E3CA 4K4VA 3HHEA 3DDKA 4PQAA 1IBMJ 2RDDA 4NCAA 5K5MA 3ZZZA 3MMJA 2HHPA 4B3SF 2CJQA 2ABYA 2DH9A 4Q44A 4CLYA 4LF4F 1UAWA 4N76A 2CPDA 1UL3A 3PHTA 1YGYA 2FC9A 4KHPF 2EKNA 2DIVA 4NLDA 4F25A 2HHSA 2CQIA 2GGPA 2HZCA 3KG0A 4CO4A 3P5BP 4DV2F 2IM0A 3L7OA 3U1MA 3TEGA 4USVA 2JEFA 2HHTA 1NPKA 1RXOB 4GKJJ 3AQPA 2HS0A 4IG3A 3WC0A 1TFYA 1OY8A 2GVDB 4QWEA 4M5LA 2BJ7A 1TL5A 4C48A 3GYXB 3CCRS 1BLUA 3IP0A 3Q8QB 1SL2A 3NP5A 2BKOA 3R7SB 1EP4A 4KV8A 4RW6B 2DISA 1HQUA 4PPZA 1BWVA 3W5XA 4ZN3A 1HQEA 2PT0A 5KFYA 3MM6A 5LOQA 2DXEA 3TVKA 2HBYB 1RAFB 3KK2B 3CCUS 2HMIB 5T41A 3ICLA 3DXSX 4JV0A 2YNHA 1ICEB 2IA0A 3R8YA 1YJNS 3CTRA 2DGSA 2OPQB 6AT1B 3GLJA 3IBFB 3VAGA 1FT8A 1HKAA 1RBAA 3IBWA 5KT7A 3MR5A 4DWIA 4X4RA 3OTOJ 3EX7B 1VR6A 4DSEA 3VAMA 3O5TB 5T14A 3KK1A 1SH0A 1P1LA 2XYPB 3UD3P 1B7FA 2EKYA 5K8PA 1BC6A 1PJ6A 4HL9A 5AT1B 1SIZA 1ZM3A 3F56A 1SCJB 4C3LA 2CPHA 1QDUB 2BM1A 2KXHA 4LBPA 4P7VA 5HJXA 2RS2A 2W01A 2MGZB 5D0EA 4WE1A 4ZDNA 3DI6A 2XSJA 3QAUA 1ZETA 2IM1A 4EBCA 1DHMA 3LP2B 3TNVA 1K0TA 4N8NA 1SVDA 4MMOA 3N01A 5G0RA 1F9EB 2G1HA 3A3OB 2XZDB 5HVGA 4F2SA 4Q0BB 2QJ3A 4OYMA 3GV8B 2NS1B 5J1EA 4BC7A 4UOGA 1GMWA 1VQ5S 4YEAA 2HWHA 1SUQA 1WNEA 5K14B 4ZVHA 4B17A 2CJBA 2DT9A 5K8OA 3ITHA 5LT5A 1NHKL 3CCQS 1UA1A 2VJVA 2LP4A 2Y3YA 4DBQA 4USMA 5DZ7A 3W61A 1PJ7A 3DCAA 4NMXA 1DQ9A 4TY8A 3QZ8A 1IR2A 3M9OB 1U6ZA 3S8SA 4LIRA 3CF5Q 3TR5A 3M1VA 4ZLNA 4C6AA 3HO1A 3G4SS 3I0RA 3UDCA 2BE2A 2DEJA 1LKZA 3BZQA 3GJSB 3M8ZA 4MFBA 1R8AA 2B7CB 4PABA 2I8EA 4CP5A 4F4AA 4QW8A 4Z37A 3NY0A 4P2XA 3DM2A 4U6PA 1YJWS 2HEKA 2XMVA 3U02A 2B8PA 4CLLA 2J0SD 3CMAS 2VB6A 5K8NA 4YS2A 4I0WA 2FIUA 3VCDA 2Y1IA 2ZWPA 4B9VA 5IV3A 1KDNA 4JI7J 2L41A 4UUWA 1CJUA 1KFDA 4DJBA 5HVFA 5AXMA 4R8UB 2E9ZA 3IMQJ 4NL5A 1HBMA 1EX8A 2N3LA 2NUHA 3NAIA 4H4OB 3V5RA 2PGCA 3N5BA 4IDKB 2UVWA 2CZ4A 2MKYA 3W3SA 2NUUG 3FDSA 1D9FA 4C8YA 3AOCA 4QWBA 2ZC4A 1YSJA 4K4XA 2Q43A 5DS7A 4EK2A 1R3NA 2SXLA 3MFIA 4JI2J 4Y2AA 2HNDA 3MECB 1N36F 2HFNA 4DLGA 1T03A 2VA3A 3BDEA 1S76D 5ETMA 3W60A 4LR9A 2R7TA 2DRDA 4DX8H 2E7WA 3I82A 4LUBA 3NKYA 4OZ3A 1RLDA 4WTYA 5KFDA 2RNEA 2F3JA 2C2OB 3R5AA 2VQFF 2G2ZA 5ETOA 2C3YA 2DHHA 2HHXA 3OL9A 2XEXA 4I6WA 2IVYA 1U25A 4NYOA 4K2XA 3B4MA 5DETA 1FTCA 1HD0A 3TUZC 4DMZA 1R8PA 2F1FA 2XCAA 2R2SA 3CWJA 3FGVA 3PDNA 3QIDA 4QBUA 3M7VA 4TN2A 3LAKA 3UI3A 4CNZA 1Q7YT 3BDPA 1GMVA 1GXUA 3C6UA 2IIHA 3GJRB 1X4FA 1RTHA 1VOMA 3W62A 4RNFA 2WHOA 4ID5A 5F8MA 4B9LA 5KT5A 2P6TA 1IR0A 1G6BA 4UOHA 4FVMA 2HHUA 2V68A 2MZSA 3M6WA 3ZO7A 5KFCA 1T11A 1XMBA 2MHEA 4DUZJ 3M9NB 4DQPA 2XS5A 4OV1A 2FHJD 4K0KJ 1KLMB 4XIUA 1XEZA 2IBOA 2ZH6A 1X9MA 4DQIA 1Z2LA 4M5IA 4ZP9A 5MAOA 3MOZA 3JTNA 2F8MA 2CXEA 5KG3A 2VQEF 4HHHA 3R2DJ 4DPUA 3RBXA 4DX6A 1WSRA 1I51B 3M2RA 4RW8B 3BKFA 4M1KA 3P3DA 5LJ3Y 4O0NA 3ENVA 2H5EA 4RWXA 4F36A 4M8LA 2N4DA 3QNWB 3QT5A 2L9DA 1GAOA 5F0UA 1JQGA 1S7HA 2ATCB 3SCLE 2VL1A 2P9EA 3PM9A 3O6QA 4MIAA 1QTMA 2R8GA 2FPHX 4UOCA 1DY3A 1NHUA 1S1XB 2BANB 1RT3B 1SJQA 1VQ6S 1IM4A 4DPTA 1WTFA 3CCWA 1SH2A 2UUCF 3OR1A 1V5IB 2CJAA 3L09A 2MY7A 1U1LA 1LV5A 1QAIA 1BGXT 3ILJA 1RWXB 2AV5A 3F41A 3JS9A 3VGTA 4URGA 5BXIA 4X4PA 2GQQA 3HVRA 3FCVA 4AUKA 1T9VA 2VQFJ 4K4WA 3KNAA 1WKLA 2BQ3A 5AXKA 1NKCA 3BN4A 2XB2D 4KJIA 1OYEA 1MROB 1PKUA 1C1CA 2J9DA 2YKMB 4JI7F 1UFLA 5HI7A 2MTLA 3TQ1A 2XMMA 3CDBA 1UVLA 2GHPA 2AWZA 3K58A 4JB8B 3EGWB 5GAHU 2M9KA 2F7VA 3QQCD 1X5OA 3SCJE 2MZQA 1TL7A 1S1TA 2PEBA 3NLCA 5IOLA 3U7JA 2KN4A 4OYOA 5HMXA 1HHQA 2I9SA 4PG7A 4FPIA 3KLFA 3G6YA 4B3TF 1N33J 3KMSA 5IT9Y 3W2VA 4F3MA 1VRUB 3M30B 2ZD1A 1KQSR 5DQIA 3RUBL 4FXWA 2HZAA 1FA0A 3DMJB 5JMNA 3MI7X 2ILZA 1JLBB 2JNJA 3AH6A 4TYAA 4FF4A 1Z4UA 1JLCB 5KFGA 1LNQA 5L38A 6FD1A 1ULRA 2Q79A 3N6NA 4FDFA 1RT5A 1T7PA 1U6BA 3EZUA 1FRIA 3KJFB 3PNIA 1T0TV 2WONB 3KHGA 4JV5F 2E5HA 5JVHQ 4JI1J 2ZHAA 1N0UA 1K1QA 3A8EA 4C0HA 5GADU 1FRHA 1SC3B 2J8SA 2V9KA 3HD2A 2BQRA 4W92B 5A8WB 1G3OA 1I5OB 2FHMA 4NXNF 4RNMA 4CH1A 3OFHA 4LF1A 3W2WA 1UVMA 3BKTA 1YRUA 4K8RA 5D15A 3MHYA 1QD1A 3DLLQ 4FS2A 4QIWD 3QMQA 2K2PA 3HZEA 3HVTA 4DR1F 2A6OA 3IWLA 4G3IA 2DNZA 4PQUB 1IVZA 5T7LA 2B0GA 2RF2A 3HKWA 2DGVA 1TR0A 3R97A 4EYHB 4LF8J 1JX4A 1QE1B 1KKHA 1NPPA 2QMXA 3H90A 4PXDA 2ZJRQ 2M8DB 3J7ZT 4L76A 3GV7B 2J5AA 3UFCX 3T41A 1D8YA 1S1WA 4OYZA 1X5PA 4C98A 1PYTA 4DV0F 1E6YB 1FK9A 2YQ0A 1HNWF 1AZSA 2AJQA 1U6FA 2QFJA 4ZOSA 5IT0A 3OR2A 4UTGA 1C1BA 1HR0J 2C3PA 5DDPC 1RT1A 2HFZA 4ZVQB 4EZ9A 1NXIA 4YN3B 2NCKL 1KQFB 4MKYA 3UQSA 4ZMMA 2DO0A 3TJ9A 1IKVB 1B70B 5CD4A 5CABA 3FMWA 2YKPA 3D3CJ 3KG4A 2DHSA 4JI4J 1B99A 2ZE2B 1D8ZA 1GK8A 1TUGB 2FJXA 1N56A 2LQJA 4KAIA 3ZZUA 2R3VA 2JWNA 2HSEB 3TYTA 2MKSA 4J9RA 2B5JA 3CDEA 4KQZA 4L73A 4OHWA 1TAQA 1GT8A 3EM1A 4Y28C 4PG6A 1WHWA 4AL6A 4HTJA 2MQPA 1MWZA 3OD2A 1F1BB 4X4QA 3PW4A 1ZTWA 1JJ4A 4LRFA 5LMUJ 1FNMA 3A12A 1UA0A 2UXCJ 3NWGA 2A10A 2NXNA 3L7UA 3NGUA 5HMWA 2EFNA 2F9JA 2EXUA 2DR6A 4GMKA 4P52A 4CLPA 1PC4A 1SJ1A 4UT4A 3BSAA 4TQRA 4CLSA 2ASDA 1P27B 1ZM9A 3CDAA 1U1MA 3MDFA 1KWMA 5GMEA 2OEJA 1VIXA 2DRBA 5K8MA 2OMOA 2HRTA 2VH7A 3ONQA 4JI6J 2CUYA 4JI8F 2J7UA 4KHMA 2V2ZA 5CYQB 1NJWA 2VG6B 1I1GA 4WU2A 2OI2A 1ITPA 3V4IB 4DL5A 4X84A 4C8OA 3P4UB 2D7SA 2E5LF 1NU4A 1KR4A 2ASYA 1T9WA 4KH1B 4RW6A 3K5MA 2EBEA 4CTAB 3M2VB 3TAMB 1W2BR 1FJGJ 3D5MA 2UUWA 3MM6B 2CRLA 3GFZA 2UUBJ 2HK3A 1BHNA 4K0KF 4UQTA 2WVCA 1YRXA 5CHCB 2JVOA 2L9WA 2DNMA 2IVFB 3CJ3A 2CPZA 2CAJA 3KHHA 2FVQA 2NZCA 2MB0B 2DRAA 2Y8YA 1VQ4S 4HEA9 4B3OB 5I42A 1APSA 1N5TA 2HIYA 5ETSA 3DKDA 3ISNC 1XBWA 4F0KA 2MJUA 4NLWA 4CLZA 3CJ4A 2ZKTA 3ILIA 3KK1B 3FCHA 3KNGA 3OXLA 4DL6A 1IKXA 5THWA 4F4YA 5KT3A 4I2PA 2XNRA 1G1XA 3MPWA 1U1QA 2PI4A 3TZXA 3ZXWA 4ZCIA 3KUHA 4E2FB 5KAKA 2HHHF 4IRCA 4YDXA 5F8NA 4QIGA 2W25A 1REVB 1NSQA 3MEDA 5B08A 4V19X 4X4UA 1FD8A 2G0JA 3CDUA 3HM9A 3VVTA 1XNRF 3O8WA 3X3UA 2FLLA 1N5YB 2E1PA 3OUYB 1F2HA 1YBTA 3NEKA 3GONA 4QYRA 1U2FA 2RIJA 3LPEA 2DY1A 3QT7A 4J90A 5FDLB 4Q0BA 3FK4A 2H51B 2QRRA 3H59A 4KH0B 5C2GA 2Z30B 1KTQA 5IS2A 1BQNB 2YKNB 2V9WA 1D3WA 3DLKB 1RAAB 2ZH4A 3TI0A 3TVZA 3P45B 2FZCB 5J2PA 3WIVA 3QRRA 1FF2A 2MQMA 3D2WA 1VQNS 3D6FB 3TAPA 3B4DA 1RHQB 2B4VA 2XS2A 3MM7A 1M5HA 4RZRA 1VQMS 5EWEA 4XTTA 3EPIA 3UW1A 4BHQA 5A8RA 2W2OP 2OPPA 4WIIA 2L3MA 3UN5A 3W1YC 3Q8YA 1EQMA 3SFGA 2O66A 2QV6A 2E44A 3C16B 4JI2F 3R7NB 1DZ5A 3Q0AA 3QT6A 1DARA 1Q1KA 4OZJA 4H4MB 1Q4RA 2CWKA 4F4ZA 5KFOA 1D9AA 3PJWA 2MKIA 2VG7B 3FZBA 1RHRB 2HHQA 3PX4A 3MCNA 1S4FA 2MQQA 3M8SA 3NMAA 2VF3A 3HVAA 1ZAWA 3OV7A 2HVHA 3POTA 1SBRA 1JLGB 1TV6A 1WG1A 2C1EB 4DR3J 3V6DA 4NCGA 5GAEU 1N6QA 3AB4B 5D3GB 4CYUA 5A8KB 4I7FB 3OT9A 3KLHA 5DM7Q 1S49A 1L3UA 4CIOA 2MLZA 4LF9J 1Y11A 2PFDA 3KYLA 2KVIA 1SJFA 2HHWA 3PG9A 1XNQF 1WF0A 2HQGA 1X31C 3FSIA 4FN5A 4B08A 5GAHI 2FLNA 4ZCMA 1BD6A 2J7KA 1OIAA 3Q89A 4ZPTR 1H73A 5A2QY 4FYXB 4Y2IA 2K7KA 3K5NA 1TKDA 2AD9A 4M5DB 3SQGB 2ZITA 2CJ9A 3M4XA 4WZQA 4ECWA 1SL0A 3BO2A 2P8IA 1M1GA 2IFXA 3M6VA 5KFHA 2ZH1A 1KLNA 1H7XA 2BMBA 2H3EB 3C6UB 3TWZA 3C8YA 4ZS6A 2YBVA 4QPTA 1S57A 4YMEA 3MD3A 5M2UA 3CCMS 1BMQB 1PYSB 3MOJB 2B4OA 5EN1A 1UZHA 1QSLA 4PXCA 4GVBB 3HFZB 2LCWA 1KP6A 2ILYA 2Y1LB 3G8TA 1PBAA 3G86A 4ZLLA 5KFSA 3BGOP 5CH7B 3W8GA 2XLIA 3HP6A 2PD1A 4EEYA 2WK4A 1YJTA 5IXUA 5KG6A 2EFGA 4B3RF 2HVDA 4DR5F 4ZPVR 3AOAA 2WTFA 2HQ3A 3HK2A 4LFAF 4N47A 4LFCJ 4C8NA 1QJHA 3EDRB 5BJRA 4DV3F 1NJZA 1UWBB 2EW9A 4ETZA 4ICLB 1R31A 2QE5A 5I3QA 3Q24A 3V6KA 1RI7A 1VQSA 4O3PA 4XPCA 1K9MT 1M5PC 2F4FA 2G1DA 3BJYA 3N9UC 4ETXA 4LF5F 3SCIE 4L3NA 3AA8A 3IAS9 4I64A 5IFMA 4ILLA 1F5CA 2HNZA 3CB4A 1YJRA 1RT3A 4OMFG 1Q78A 3MAAB 1TUVA 2X7IA 1B4SA 4CO3A 4CO2A 5CYJA 4U67Q 4EMDA 1C0UB 5H9EJ 1TKXA 3MFHA 1T9XA 4NZ0A 2GVZB 2CJYB 2OD6A 2C2RA 4QR2A 3HDSA 1CJVA 3PIOQ 2AT1B 3VR1A 3T5LA 2V2QA 2JEGA 4B3MF 1CQNA 2B9EA 2NZ4A 3F73A 3FBBA 4A8SA 4FNHA 5B09A 1PILA 2HWIA 3ADAC 3GG1A 4OI6A 4OLOA 5H1SV 1TL1B 3ZZOA 2C3MA 2VV5A 4CLTA 4W98A 4E0DA 3IG1A 3MCOA 5KFTA 2XS7A 1Q7LB 2LVWA 3CD5A 5KOWA 4HDGA 1WC6A 1NDCA 2RB7A 3D6TB 3MTJA 2OPSB 3VAIA 4RU2A 3QGIA 3RW6A 3GB0A 1T94A 3CJ2A 5HMYA 1LWFB 4K4ZA 5B0EA 2ALZA 5DQHA 3MF5A 1AUDA 1R89A 1RDRA 3KFWX 2OFGX 1CS4B 1ZM4A 2OEMA 3TRGA 3MAQA 2HGMA 3MXHP 1PAUB 2D74B 2RDIA 1N33F 5KTQA 2UXDJ 4Y6IA 2OPRB 5F9LA 1ZZFA 4MKBA 3PFEA 3AT1B 4XK8C 2QO3A 2FB0A 3C46A 2ZZMA 3KTQA 1H6KX 3W9HA 1HQUB 2VA2A 3NGRA 2RRAA 2ADBA 3TUIC 2VKZG 3EGZA 4LFAJ 4M95A 4Z7YA 3LWLA 3JTPA 2WOMB 1BQMB 1RADB 2E1RA 4EI2A 2CKWA 3T6BA 4YDDB 2U1AA 2W2MP 4DR6J 4FP9A 4F26A 3FCWA 3CC2S 2WONA 2GIFA 4Y34A 8RUCA 5D6GA 5KFJA 1L3SA 2E1CA 1NH8A 2DXDA 1VQ7S 2FQQB 2B7BB 1RAHB 5HANA 5J2MA 1KOOA 1D9DA 3C6TB 2WSFC 3H5SA 1WC0A 1RT6A 1HNIA 3I96A 3AY0A 4RBUA 5KFWA 1IUJA 1K8AT 2G0CA 2B6AB 2W8KA 1OQ3A 2V8GA 1IM6A 4MJKA 2FVSA 5IT4A 1S77D 3BPDA 3ZNUA 1S0VA 4I68A 3J7Z5 2FY8A 3D66A 3EVOA 2V5HG 2CQGA 2IA6A 1K0VA 1FEEA 3M05A 5GAGI 1CQMA 2IJFA 2D9PA 2NYHA 2X1AA 3HD1A 5F8LA 4DR7J 4OQJA 1I6JA 3KKFA 5E3AA 4ED8A 4DL7A 5J1EB 2NREA 3PYGA 3CULA 3L4BC 4K4TA 2C2NA 1VQYA 4H54A 4K59A 4WXOA 1DQAA 1NK8A 1TK8A 1HNZF 1U0HB 1Z2ZA 5LSOA 4RO0A 4OV6A 2H9ZA 3W9IA 3RTVA 2AGQA 4K4SA 1HYSB 3GCXP 3D0HE 2C3UA 3OXFA 4GKKF 4QIEA 3SFUA 1UFKA 4TY9A 4UZBA 4MKVA 2GNKA 1VS3A 1QY7A 5AXLA 3A3PB 4J37A 3M2UA 4M5GA 4X4OA 1FDDA 4QW9A 1VRTA 2KRBA 3IR6B 3CMES 4I67A 3KUEA 5A0YA 4X4SA 4NASA 4J9MA 2H65B 4LSNA 1TQLA 3E2EA 3NMRA 5HQ8A 1MW7A 4DR3F 1IKVA 4ECVA 5B0FA 4NI2B 1JXLA 5DLFA 3MPVA 2QLJB 5C25B 4YR2A 1HBOA 3I4PA 4HTIA 2ZH2A 1FJGF 1BWEA 1VK3A 3KLVA 1T95A 4J91A 2DGUA 1M1HA 1MN9A 2FJEB 2Q6BA 4G1PA 4M5NA 4EFAC 5F8HA 5KT4A 2AJ0A 2X1FA 4R8UA 2HFUA 3DNCA 2B51A 4FYDA 5D0GA 4ED3A 2R7RA 2R2TA 1NRKA 3H20A 4CLWA 5D4NA 4J9OA 2QL9B 2V8DA 3EXYA 4LF6J 2J9DE 2MKKA 1L3KA 2OLWA 1S6PA 4WWSA 1A0OB 4J9UE 1X0PA 3R1HA 1WC1A 2CNNB 5F8GA 4J9LA 2DEIA 2DY9A 1T03B 2EC0A 1FVQA 2GO8A 1R43A 2BE9B 3U1NA 1Q0NA 1Q5VA 1VLYA 4DOZA 2AGOA 1TK0A 1S0MA 4B3RJ 2CNKB 2HWTA 4C4WA 1JK9B 4G1IA 3SI8A 1VBXA 4FXDA 1J5OB 4NLRA 1HBUA 3LANA 2M8HA 3BF4A 3Q23A 4X65F 5DG9A 1DBDA 4WTOB 1O8BA 3PVXA 2YPYA 3FSYA 5EDWA 3V4IA 1M5SA 3HHLD 4ZJLA 4ZLJA 4DU8A 3CE8A 1UPPA 3GIIA 4Q8EA 4DG1A 1JXEA 2EWHA 2EI5A 3AQOA 4QWCA 2RJZA 4KY3A 2FD2A 3M2VA 4LRDA 3GFXA 3GR0A 5I3PA 1T02A 2RKIA 1NCLA 3C66A 1QLNA 3GR1A 2IC3B 4HACB 4YUDA 3UR0A 2VFRA 4Y2CA 1HQEB 2DNPA 3LP0A 2AEFA 4ZVFA 5LJ5Y 2HMIA 4KE5A 1WSVA 1S9GB 1WHVA 2MKHA 3CD0A 3UO0A 2XYHB 4ZVUB 2LFVA 4PUOA 5CYMB 2NYIA 1Q5YA 2ALYB 4KB7A 4KR0B 1UMJA 2PSZA 2XY7A 3KMQA 5L9NA 4CCHA 4OHXA 3THVA 1VMBA 3A8IA 1IKXB 3NOCA 1CVJA 1OYDA 2W2NP 2MHNA 3D4JA 1SKUB 2M5YA 3M2RB 3W7BA 5CA5A 3DLHA 3O1LA 2NLWA 2P2CB 4E8UA 5DG7A 4LRBA 3WX4A 2OFHX 3DLEA 1T8EA 1R27B 2C2EA 3I32A 1AFIA 2XY6A 3MCMA 3PZPA 3W9JA 2K3IA 3GFYA 1AROP 2ACYA 4LSLA 2E66A 5ITHA 1LFWA 5ETTA 1JLFB 5HP1B 2J6TA 5FDLA 1S1XA 2OD4A 3M6UA 2I2YA 1XJWB 1UKUA 3KLIB 1UWAA 1NDKA 5KFKA 2R8HA 2XZWA 4JI6F 1CJKA 2AZ3A 1FDBA 2DHGA 2VFSA 1BQNA 1IBKJ 3PO4A 3E3XA 2LU1A 3LOUA 5E2QA 3SSSA 1GTEA 3NGDA 2XY5A 2OUGA 2FUG9 4DL3A 1RU1A 3CXCR 3I9ZA 3SXLA 2R7XA 1PJ5A 3G82B 3IS9A 3N79A 1Y5LB 2G2YA 1YVFA 2ZZTA 1RAGB 4KHPJ 3TVYA 1LK7A 1S6QA 4DDFA 4N41A 4DUTA 4WYWA 1UW4A 2BJ9A 3MEGB 4HH1A 4IFYB 1FTRA 2MQNA 2YX4A 3M1VB 4B3SJ 3QO9A 5JJBA 1PGZA 3OHBA 4O3RA 4OJHA 3GIKA 4WFNQ 2QGFB 2HVZA 3GFHA 4XAKA 1TL7B 2ROGA 1MG7A 4YQWA 1OJ4A 3KJVB 2MSTA 1VFJA 4P74A 3H2UB 4JV1A 4WU3A 5KFRA 3W2VB 1M5KC 3POTB 1NB2A 2MZRA 3M30A 4OI1A 1WD6A 2NPIA 4NMLA 5ETVA 4K7QA 2QX0A 5AXNA 4DF4A 3SSQA 2ASLA 2R8JA 1KBRA 2DVIA 2UU9J 2L08A 2BM0A 1H74A 2GX8A 3ZTSA 4CYUB 5A8KA 2QA4S 4H4OA 1HD1A 1FNXH 1ZOTA 4OZ2A 3IGNA 4OX9J 4C8KA 3H0PA 1SI9A 3ZTQA 3OL6A 2Z2ZA 4O4GA 4IRKA 1CEZA 3J7YU 3CD6S 3VF0B 2E29A 3X1LB 2YNIB 4CO0A 5CCLA 2HNDB 3L95X 1WEZA 3GSIA 4FPRA 4RUBA 2P5VA 1IBMF 3BGLA 1LXJA 3D54A 4B02A 5KFLA 2LDYA 4WBFA 3QGPA 2HQFA 1HWKA 2M7SA 4PEOA 4M5DA 1HW8A 4V1Ak 2FGCA 1ZM2A 3D0IE 3HVTB 4U8VA 2NXUA 5KG0A 3GILA 4ZJQA 1SIWB 3UNGC 3OHAA 1XNRJ 2C28A 4PQUA 3CJ0A 5ETRA 5EX0A 1FXRA 3I87A 3TAQA 1KSPA 2XNQA 5DJBA 5KT6A 3NS6A 4J9QA 4NXMF 2NXJA 5IWAJ 1NK5A 4LQ3A 4K2JA 1KVIA 2ASJA 2Z2MA 4NXNJ 4ZPBA 2XLKA 2GJIA 3GU0A 4HT7A 3NL0A 4X4NA 2XHWA 1QAXA 1FKOA 1Y00A 3BS9A 5C42A 4WK1A 3FNNA 2DNQA 4TYBA 3U1LA 1X60A 1FK9B 1V5VA 3PW0A 5KFNA 2YWEA 2AJFE 3ZTPA 4HI2A 1MU2A 3D67A 1LW2B 1C1BB 4F0MA 4RUHA 4U9RA 1FVSA 3OL7A 3G6VA 3OTCA 4WFYA 4B9TA 3HCXA 1UJ4A 1HWUA 4PR6A 3AA9A 2QA1A 1IXKA 3TQEA 4DV7J 2IHR1 4RR5A 2YNFB 2AYMA 2FHJA 2WB4A 2MQOA 4NLGA 4FF1A 1RBLA 2IDEA 2JFDA 5KFPA 4MIBA 1HWJA 3NNHA 3DLGB 5J2QB 1KONA 2Q3PA 1J5EJ 3SZ2A 4X65J 4JI0F 5DG8A 2J0XA 3DDIA 1U2RA 4ZKAA 2VJUA 4HHUA 2CZVC 4DSLA 3IN5A 2GIRA 4P6QA 4CO5A 1Q82T 2KDOA 1NMEB 3MMAA 1SQGA 2QEXS 2H48B 5EUHA 4ANDA 3T1YF 1JLQA 4DV6F 5DO2A 3MGJA 3U27A 2XQCA 1RT7B 1CJVB 1CPZA 3ZC4A 5KFUA 4RW7A 3VZHA 3BGUA 2V8PA 4TU8A 2Y8WA 4K50A 3CJSA 5KT2A 2HRYA 3PW5A 4X4VA 4PCQA 3EICA 1RHUB 2W2PP 4C0BA 1KNZA 3TZYA 4ES1A 2DNOA 1OWXA 1RJJA 1KEKA 2DGQA 2AJ1A 3UD4P 3M8YA 2XO7A 4ILRA 3BQ0A 1P8GA 3A3NB 2F63A 3BO3A 2CA9A 4M5JA 2DGWA 3IFEA 2WVFA 4QQBA 1FESA 2ATLA 3PCOB 2UP1A 3EMTA 3RAQA 4Q43A 1HBNB 4K5SA 3CGIA 4O3OA 2VKRA 3B54A 4YOEA 1MWQA 3DOKA 3RB3A 4DS5A 2DNKA 3QWPA 4QZVB 3J7YI 4NLPA 4ZK7M 1O6XA 2DK2A 2R8KA 1EP4B 2JLFA 3EUNA 4KV8B 1LXNA 5HSPA 5F0WA 3A4TA 3KK2A 3DMJA 2J9CA 1EETB 4USHA 2CQBA 2KZZA 4C97A 2DBBA 5KFBA 3TJ8A 1GX5A 1JLCA 4GC6A 3HHLC 1U1PA 1X9SA 1WC5A 1HNZJ 4ZIVA 5SZTA 2EK1A 2EEYA 2CPXA 3C6TA 2EC2A 3QT8A 4LSZB 4X64J 2DR7A 3DRYA 4F02A 4X66F 2IAJB 1U8SA 3CC7S 4IH5A 1R0CB 2R7VA 2ZBPA 3PR4A 4J7CA 1WC4A 2YNGA 1B0VA 2MKCA 3NWRA 3V2UC 1TL4A 3QATA 4QPXA 1FNOA 1RLCL 1QAYA 2RE1A 2AMCB 4LIWA 4KTQA 2HHVA 2WBMA 1UFWA 1CC8A 1NPRA 4URQU 4DQQA 4CLUA 4DR1J 4RW9B 5C7PA 3DI6B 5H9FK 3HFKA 2R2RA 2W7PA 1EKSA 2QSWA 5L46A 2VQEJ 1FRMA 5HO4A 3BO4A 2FVRA 4B9MA 4NCBA 3BH7B 4DR7F 2HVEA 2IDLA 3NGSA 3N6LA 1WHYA 1HA1A 2RAQA 1U7LA 2KT3A 2VC1A 4F4XA 2AEMA 4NRTA 4DV7F 1TMJA 2ZNYA 4NWBA 2CQ3A 3SV3A 2KYZA 3R6LB 5AJ3F 4Z2XA 2CYYA 2D3UA 4FKYA 4LFBF 3LGHA 4AXJA 3NCQA 3CCTA 1S0NA 2N82B 1NO8A 1N36J 5DGAA 3GE9A 2V50A 4TY8B 4QIFA 5HL7Q 2K1RB 5LSRA 1PYOB 2KI2A 2AIRB 1F9FA 3MWBA 4ID8A 5E3RA 4DCJB 2KXNB 1N0VC 2V63A 1MMLA 3UDVA 2MXYA 1SKWA 4NLVA 2JLGA 2VZ9A 1HPZA 1FEHA 4EUVA 4C2MA 3CIZA 1C4CA 1FO1A 4OX9F 1XR7A 2RU9A 2RMLA 3MM9A 2MQ8A 2WW8A 2VG7A 2ZE2A 2LQ5A 2ZWOA 4LRCA 3H25A 1S59A 4EWTA 1U49A 2HAFA 1VC0A 2ZUGA 4OL8A 5HAOA 2K3KA 2KHCA 2MQLA 1CJUB 3JXOA 3Q8UA 2A2CA 1SV5A 3PJXA 4RBVA 4ENOA 5HVHA 4B9UA 3LQVA 4CRJA 4DPOA 4OLPA 1TKZB 3QBCA 3AAWB 2LEAA 3T9NA 4TNOA 5DZ6A 1YJ7A 4OHYA 3N6MA 3M6XA 3S7RA 4QU6A 2F8EX 3QJPA 5HK4A 2KRRA 3EE3A 3CC4S 2Y9HA 3FQLA 3MECA 4FS1A 1RTJA 4KRWA 2ZM6J 3R7BB 2FHKA 1KQGB 2WRMA 4GO5X 1VQLS 2HYIB 2E9TA 1XR5A 2IMWP 4OHZA 3C2PA 1Y7PA 2MJNA 4F50A 1RHMB 4OYXA 4KT0C 4DFJA 2M88A 3K89A 4J9VA 4QYZJ 1YITS 4AL7A 2BJDA 2D3O1 4DPWA 1XWLA 4RWWA 3KHRA 1Q8LA 3VAHA 3R6GB 1XMQJ 1UVNA 2EK6A 1NHVA 2PMZD 2J0QD 5BYRA 2LU2A 2YQ1A 3DRXA 4KSEB 4YB5A 1SPBP 4DPXA 3AXKA 5B0BA 2KYXA 1B3TA 3AJ2A 1Q8KA 1WUUA 4LMZA 3ULHA 1CJTB 1U2CA 4PPDA 3HT3A 1LFPA 1S6UA 4HACA 4AFFA 2DNNA 2OIHA 1WF1A 2GAHC 1JNRB 2LLZA 4ZITA 5HQLA 4F8RA 1LW0A 1VQOS 2PA8D 1IN0A 3EDQB 1YK9A 4IFVA 3UWTA 2KM8B 2QC3A 2C2MB 2KXFA 4BCAA 4QR0A 5KFIA 4PUOB 2BBEA 2KG0A 4LFCF 2XMTA 3BPSP 4JBCA 3PX0A 1ZAXA 4ZCKA 1KLMA 3C14A 1C2PA 1HARA 2DCUB 2KL8A 2L48A 3GJQB 4ZVRB 4AD6A 3QGHA 3PEJA 2AKWB 4U95A 3QZ7A 2V4QA 2M3DA 2VONA 4EYIB 1N52B 4RJVA 2LKZA 4I2PB 4F3QA 4KC5A 5DLGA 3N4WA 3THPA 1U1NA 1W2IA 3B78A 1X7VA 3GIMA 1IQTA 1C0TA 1R0AB 2OH2A 2QLFB 4B3TJ 4PG8A 3KOAA 3VAFA 4DZDA 1RWUA 2BXJA 2W4DA 3QJJA 2HQDA 1REVA 1WWHA 3IRXA 3MEDB 1Q16B 4L75A 1HMVB 4GO7X 3MAAA 5J1NA 2LECA 5ETKA 4IO9Q 3G2XA 3G6ES 2JZ5A 2KHDA 3HX9A 4ZVOB 2BW7A 2KM8C 2BJ8A 4KGVB 3H8YA 4NYZA 1RTIA 1IWAA 1WC3A 4JI5J 2A6MA 3K17A 4DV5J 4ITSA 3AXMA 5KG1A 1ROFA 2N7CA 5EX3A 1RGVA 5IZHA 1VBYA 1REGX 1RUSA 2O5DA 2WB1D 2ZM6F 1X5SA 5B7WA 1IWGA 1RABB 3QJLA 3D7SB 4USIA 3CT9A 1S6QB 4D3GA 2XSFA 1FFWB 3HULA 2O1PA 3BYPA 5BYQA 2FJAB 4FBUA 3ETOA 2R7UA 2B43A 3BBBA 1WI6A 1LWFA 5E33A 1YZ6A 4JYAJ 1GH8A 1MROA 2ACMA 2YKMA 7FDRA 1CBKA 2ZBCA 3D1HA 4LF9F 1WG5A 4LBIA 3M32B 1KQKA 2GFFA 2HZVA 2Z58B 1TMMA 3AJDA 2OPRA 2E9RX 3VHQA 4RNNA 2IMOA 2MYFA 3ETMA 5J2NA 2R7SA 2PI5A 3QGGA 2HK2A 2RQ4A 4KKOB 3ZZPA 3RRHA 1RBOB 4HHJA 1MMDA 3EVMA 2KH9A 4UY85 1JMTA 1F0XA 2G4BA 1F9HA 3KLFB 3PV8A 3RRGA 2CQ2A 2O3DA 4P10A 4IO1A 1P9QC 3BR9A 1S48A 2G2OA 3HSGA 1GQEA 2R7WA 2W9CA 2XLJA 1KN6A 2HKEA 2WCXA 3WDOA 4HKQA 2LA6A 2V4JB 4GKKJ 1HQ2A 1JLBA 4DF8A 1H2UX 1N5QA 3GPAA 3AD8C 4I7FA 4FF3A 3DDNA 2PE8A 1R6YA 4QJVA 5J2MB 3IM8A 2RH3A 2AYBA 2IVMA 5DQGA 1JLEB 4KO0A 3G8SA 4LF2A 1KD1T 4P2FA 1QAJA 1BXNA 3EZ5A 1NJXA 1HWIA 2YWGA 3H4BA 4JI5F 4YR3A 2AGPA 4DR4F 3ZZRA 5A8WA 1WEYA 3BREA 1JKHB
chains in the Genus database with same CATH topology
4RX6A 1P1TA 3QPIA 1U26A 3P6YC 1N34F 1Q79A 5JUMA 4FZVA 4IYQA 2LQBA 3RRKA 1V3RA 1YHQS 2FY1A 2RUGA 1KS2A 1YRTA 3CJKA 5B0DA 3K0JA 2RD5C 2BYCA 3IXQA 3MM8B 1U1OA 4KGKA 4NA1A 2BOPA 5GVQA 4N5SA 3VQTA 3UE2A 2FGOA 3OLBA 2E1MC 4KPYA 1QE1A 4NLYA 2YX1A 5C5JA 3QAEA 4CH7A 4AQYF 1NEEA 5B0AA 1P6TA 4QWDA 1QUVA 1LW2A 1S1WB 1H38A 5L8RC 1VRTB 3HHLB 4KFBB 3G6XA 4WFAQ 2R8IA 4N77A 3LGNA 2U2FA 4RUAA 3SCKE 1U4BA 2R4FA 2OAUA 2J6UA 1LWEB 2YNFA 5JVGQ 3JAMY 5C25A 2OP5A 2BQUA 1X4GA 1V3ZA 2OSQA 3PKMA 3FEXB 4A8YA 4TLQA 1VQKS 2UVRA 1FJCA 1ZTTA 3MEEB 4F2RA 2XMUA 5IQ6A 1MMNA 3PKYA 1T05B 1UWBA 1BQXA 2FDNA 3QLHA 4Y3CA 3CCSS 1T3NA 4MKAA 3M9MB 3PRBA 3MMAB 2DH8A 4CO1A 2DGTA 3HHDA 4KIAA 3RAMA 2F40A 4CT9A 3H2VE 1NB7A 3K5PA 4RW7B 4NLXA 2HRUA 1TKXB 1HNVA 3BM7A 2GCFA 4RKUC 3DLBA 2MMYA 3RBEA 1X4HA 1FKAF 4I69A 3G9CA 2GHWA 4R0EA 3NBPA 2OTLS 2RU3A 2VPWB 4V19J 4BBYA 2RQKA 4M63A 1IJEB 4EBEA 3UDLA 1GX6A 4RNOA 1TL1A 4R0JA 3LWMA 1RT2A 1QUPA 1NK9A 3CCZA 3IG1B 3FQKA 1S9EB 3CEDA 2RILA 4ES3A 3HI9A 3PR5B 2E5IA 4NLOA 5L39A 2YWFA 2QLWA 3SDEA 4WFZA 1IQZA 1H2VZ 5CYQA 3LPYA 4MYUA 4NLQA 3BSNA 3NNCA 5KFXA 4DFPA 2BABA 3FFIB 4C11B 4ZLPA 2DNGA 4A8QA 1HR0F 1CC7A 3R5DA 2IC3A 4C3KA 4CTAA 4W90B 3K5LA 1R8BA 1YBAA 4ZP7A 4PWUA 5G4DA 1S9GA 2HVIA 1X4AA 3MPYA 1QSYA 1O5JA 5CYMA 2VBWA 1BQMA 2EBGA 2BW2A 2B9WA 3VTIA 4DV5F 3RAXA 5M2RA 3MD1A 2AX1A 5BYSA 2KB2A 4ED2A 5E41A 2YTCA 2VPYB 2JOQA 4N56A 1JWWA 1HL6A 2W4PA 1SJ4P 3DLEB 4ATNA 1RQ0A 3DYAB 5EWGA 2IRUA 4ZPDA 2JL9A 3C3LA 1LQ9A 1FHTA 4QIVA 5KFQA 2CVEA 1Q81T 4IQMA 3OXGA 4LSLB 4CT8A 3JSYA 3MUMP 2JC0A 1TL3B 2CFXA 2WBRA 1QVGR 3KLIA 1FE0A 5KFMA 1L3VA 1GXTA 4LF8F 1N5YA 3MM5A 1DFDA 3CIMA 3LO3A 3BSCA 2GQ2A 4JI1F 2XMWA 2KU7A 2RT3A 3ISND 3TP2A 4PWDB 2BVZA 1VHFA 2C22A 2MZTA 3DRRA 1OSCA 4ED7A 1UJ6A 3FJ2A 3IS9B 2D1CA 4X62F 2B56A 1H98A 3OBIA 1NK4A 3TANA 4MYTA 1FD2A 4NX9A 3N28A 4H4KA 1Y0HA 1DQ8A 5I3UA 2XC9A 3JSBA 3MEGA 4OI4A 1HYSA 4OZ0A 2EFQA 2R7QA 3QIPA 5LMNF 4X2BA 3QO9B 4O44A 3ENWA 3NCRA 4Q7AA 1NZAA 2AP6A 4ECSA 2C2DA 2VFTA 1FJEB 5HLFA 3WZ0A 5K9FA 5B0GA 4IR9A 2FJDB 1HBOB 2UZAA 3MTKA 2M52A 3LGMA 3CUNA 3MEKA 2HS4A 5DM6Q 2ERRA 3I0SB 3HVWA 2NSBA 2W4CA 1NJYA 1TFWA 4U7UK 4A48A 1JLGA 1DTTB 1TV6B 2V8HA 2PIIA 3K59A 3OFFA 2HGLA 5EGYA 1FDAA 1RTDB 1S6PB 4DFMA 2CIMA 2CDQA 2I1RA 3KLHB 3D1QA 1RTJB 3OPKA 2DR8A 1IKWB 1AW0A 2LEPA 2W7OA 3TOQA 4ECYA 4TLRA 1LWCA 4BDPA 2R2UA 4ED6A 2UUTA 2GGPB 1M0SA 2J8AA 5HN0A 1S72S 5IQQA 2KTQA 5CZVA 1YJVA 3HHNB 1SJRA 3EYZA 3ZZ0A 1PC5A 3DU6A 4F4KA 3KLGA 2FHOB 2QZ8A 3BSOA 1VC5A 4IOAQ 3NCPA 2Y1JA 2LEBA 3MUVP 4IG0B 5A6PA 3UCGA 5L1IA 4ELTA 4DG1B 1SB6A 4KHRA 5GAEI 2NR0A 4JI4F 3CDWA 4WJBA 4MTPA 1DAXA 1FKOB 5C42B 1LW0B 4WFBQ 1YJUA 2XGPA 3G8QA 1M90T 3MMCA 2RQCA 3HLUA 3RB0A 2XI3A 2UV8A 1U48A 2YX7A 3L3CA 4USJC 1ZPVA 2AYGA 2Y1RI 4G1QA 1N5VA 2HQIA 5KG4A 3T19A 2UUAF 3DLGA 2PA3A 3I31A 4AE5A 1FDNA 2VG5B 5J2QA 3AB2B 3M8RA 3M8QB 1AFJA 4NLUA 2OMLA 3I6PA 4EO6A 3LW5C 2QA2A 1RT4A 4RW4A 4J5OA 4FXVA 1OPIA 3T5KA 2LQ9A 5G0RB 1JLFA 3MCSA 4WZMA 5CZXA 1FE4A 3LH2S 1RT7A 1S1UB 3TA0A 5AE3A 3EPGA 2W24A 3LF0A 4ZPAA 4Q45A 2XMKA 2BR0A 2UVVA 3ITHB 2OTJS 1X4EA 5HROB 5D8HB 4NZ7A 1HW9A 2VFUA 2BRLA 2JFKA 4GC7A 5LL6d 4C3MA 1IJFB 4DSKA 3I9V9 4JV2A 4R5PB 2POKA 2VC0A 4UY8T 3EGNA 4ED0A 1S99A 4YHHF 4ECZA 1HBNA 4C9DA 4ZPCA 5LMUF 1KRPA 2X3GA 4EBDA 3DOKB 3H2LA 5A6WA 5U47A 2YWKA 4DQRA 3HXMA 4F3OA 2BUNA 2VODA 2D41A 4WFXA 2DNRA 3JYTB 3DHWC 2W9CB 1GNKA 1S9FA 2CPIA 4LT6A 1UETA 3DFEA 3SYZA 2A18A 2JX2A 1VQ9S 2ZH5A 1LOUA 1SL1A 1QM9A 2Z4PA 2HIQA 2R7OA 3OTEA 1FERA 1WHXA 2OJ3A 2J9EA 4A46A 5JXSA 2K8GA 3K7RA 2RSQA 1NK6A 1M1KT 2OO4A 2DNLA 1UEVA 2KT5A 1C4AA 4C8LA 4WCEQ 4I2QB 2YNGB 3QYYA 1XN9A 5GAGU 5F3ZA 1RT6B 2XBPA 3PFOA 2ZH9A 5GADI 4ILMA 3DRPB 4ZHRA 2DH7A 3LAMA 1XTZA 3E01A 5KG7A 3J7A1 1KVJA 4NYPA 2ADCA 2MZJA 4OFZA 5E7OB 2LDIA 1OSDA 2DITA 3CSKA 3OTOF 2W9BA 2BA9A 2DNHA 3IGVA 4ID5B 3THTA 3B8HA 3IC1A 3I4HX 4WXWA 2F4VF 1PO6A 4Q2LA 1WTBA 2DHXA 4OI3A 2YH0A 2QSFA 3P5TL 2CQPA 3T3FA 4X64F 5L1LA 2XMJA 2RRNA 3MUTP 2J6SA 3ENQA 3MMBB 4ERDA 4UW2A 3K8WA 4ELVA 2QA4G 2ZH7A 1H2TZ 3HF5A 4OZLA 3R5BA 4IOBA 3B82A 3T5JA 4FVCA 4LSNB 3CO9A 4IH6A 2YKAA 4RW8A 3MM9B 2PEHA 1IKYB 2BACA 4DFKA 5KOXA 2PMHA 1VQ8S 4IR1A 3L7PA 4YB1P 1WG4A 4LQ9A 1AXQA 1WI8A 4P7TA 1M5OC 1UJ5A 3M8PA 1SV5B 1J2VA 2E5JA 3S01A 4IUFA 1RA7A 2GMHA 3GYNA 3H5YA 1ZH5A 3NNAA 5C24B 2K7JA 5I4MA 4IQXA 1FRLA 2JVRA 4DN0A 2CVIA 3QWUA 5LSLA 4TU9A 1XMQF 2O01C 1V6HA 3PRDA 3GSDA 4J9KA 2KT2A 1R7IA 3AJ1A 5KFVA 5AE1A 2KJWA 2OKQA 1JJ2R 1FRJA 1N5SA 2JHEA 1TKTB 1WF2A 1DURA 2B4UA 2HNYB 4ALZA 1HBUB 3TUJC 3LP1A 2DPIA 2YKOA 4IG3B 3SDEB 1UVIA 5BR8F 3H5XA 4U7CA 2C42A 2GIQA 2JH3A 1SQEA 4F67A 2VUGA 3PXGa 3T5HA 4EU0A 1J5EF 4PXBA 4ES2A 2DR5A 2D3OR 4L72B 2IBKA 3D0GE 2V2KA 2EFVA 4JOUA 2NSCA 5D4LA 3HJFA 1DLOB 4IFVB 5H9FJ 1S1VA 3E8OA 2KZMA 3JB9k 2XCPA 3OJUA 1RT5B 4AL5A 5F8JA 2OPQA 1X4CA 4KGMA 2VFVA 2CQDA 4YFUA 2B9YA 1H0HB 4RNHA 1OQ6A 2B9XA 2FC8A 2DIUA 1L5UA 3J80Y 2FLPA 1JB0C 5L1JA 4A8WA 2JEIA 1GXLA 4DL0C 1F60B 1Y3KA 4WE1B 2MZ1A 2XSJB 2XWXA 1H7WA 3CPWR 2GO9A 2I0XA 2HPUA 5T7LB 4AXIA 4RW9A 1MSWD 4A8KA 4FF2A 5EWFA 1UVKA 2FVPA 1OO0B 1SUQB 3A1YG 3V6JA 3DRRB 2I5JB 2DTJA 2CJKA 3NGKA 3RR8A 1TP7A 5DDRC 1E6YA 2AF6A 3KK3B 1NK7A 4ZA1A 3BN7A 2MKJA 5I3UB 2X1GA 4RBTA 2M4MA 4HI1A 3T6JA 1HYSB 3OR2B 3NG8A 4MK7A 3FZ2A 1HI1A 1RYSA 2BE2B 4DR6F 3LUYA 1S79A 4YP3A 4IFYA 3UPFA 1VI7A 2VBYA 4ED5A 2CQHA 2DGXA 2GMLA 3ISZA 4Y00A 1A6LA 4Y2MA 4PRFA 5E3PA 3CCES 4O3SA 3IWXA 5AE2A 1NH7A 2B5JB 3FEYB 5CD4H 1KFSA 5FIIA 1RA6A 2G13A 3FRYA 1QVFR 2VPZB 2BV3A 4IDKA 4QWAA 3PEHA 2LA4A 4I6AA 4Q2MA 1VK8A 5B0CA 3HKZD 4XDCA 1RTDA 2FLOA 3Q8RB 3RRGA 1TKZA 4DUYF 2BRKA 2MSSA 4I1TA 2JSXA 1IKWA 4O4GB 2DGOA 1YG0A 1LWCB 2YNIA 1B0TA 2IJNA 2HG4A 1KHVA 2QT7A 2XULA 2BZ2A 1T3OA 2IRYA 4QOTA 4WF9Q 1JKHA 1IBKF 1D0EA 2Y0SD 4E98A 4IKAA 1BY9A 2PN6A 4K5RA 3RB6A 2PFFB 3PHEA 4RLEA 3MZIA 1XERA 3KLEA 1RYRA 3ZFVA 5F3TA 2IYIA 4P2SA 4IG0A 2GV1A 4FBTA 2V4RA 3V6HA 3DLJA 4MIWA 2AW0A 2D3ZA 2YWHA 3T1AA 4A47A 4K4YA 1U1RA 2ZH8A 3OL8A 2CQ1A 2J0WA 3TW0A 4JUZA 4BWJA 2RVJA 2IM2A 4O4RA 3LALA 1WELA 2GA7A 3HHLA 5D4OA 5DDQC 4Y0FA 3OJSA 2Q66A 3GQCA 2ZOFA 4LVNP 2AJ4A 1MU2B 4IOCQ 4LJMA 4O3QA 2KFYA 2JEJA 5E5NA 3K2YA 4DUZF 2CG4A 4UUXA 1X4DA 1X9WA 2M2BA 2VPXB 3M8QA 4F4WA 3D28A 3IR7B 5LXRA 3OFEA 2ZOMA 3QLHB 1C0TB 4PG4A 2YY3A 1YI2S 4RW4B 1YIJS 1R0AA 1UVJA 1M5VC 1XR6A 4H4KC 2P6SA 2MGZA 3G96A 3MR6A 3PO5A 3IO1A 4ECUA 2DCLA 3NRBA 4ZVEA 2W7AA 3V4MA 4NA3A 3H5UA 4Y65A 1U1KA 2J7WA 3OR1B 3Q22A 2VBXA 3BEGB 3DLKA 2RRBA 2IM3A 3CVKA 1OS5A 3NBPB 2GJ2A 5K14A 4X4TA 4BS2A 4CI0B 4XPEA 1RT2B 1VJWA 3D1OA 1CLFA 5HBMA 3TA1A 1S9EA 4O23A 5A8RB 3JTOA 4WKRA 4BWMA 1XC9A 2NPFA 1SKSA 4J9NA 1JLAA 1SXLA 2XI2A 2ZH3A 3I0RB 5D77A 1VBZA 3RB4A 3UCUP 2DJWA 2QMWA 4WYLA 2B3TB 4H4MA 4TU7A 3M32A 3V81A 4QCLA 3MR3A 5J2NB 2UU9F 2W9AA 2ZD1B 4ECQA 4NCGB 5D3GA 2DPJA 4C8ZA 1WEXA 1KC8T 3MAHA 2L9NA 3GG0A 1EETA 1S10A 2V4JA 1ZAVA 2GW8A 5IM0A 5F8IA 4AYBD 5E0OA 1S97A 2NQPA 4A8FA 5DRKA 2CQ4A 2EFPA 2YQ3A 3BGRA 1X9MA 3P96A 4I2QA 5CQGA 1S0OA 1JLEA 3DYAA 4KO0B 3OSNA 3BQ2A 2DR9A 4RU9A 2IAJA 5F41A 1FJ7A 2MY8A 2ZNZA 1JJHA 2DD8S 1V9OA 3SSRA 4YR0A 1YTYA 2ZZNA 1X5TA 1MWYA 4NRUA 4OX6A 3PW2A 3DC2A 2RF2B 2Z2LA 3FMBA 3R3TA 3RU0A 5KG2A 1HHSA 2W9BB 2DB1A 3DOLA 5FLXY 1A7GE 3MM8A 4PXEA 4OIXA 5F9NA 3Q8SB 2G9OA 3DU5A 5DGBA 3OVAA 4QU7A 1W25A 1TVRB 2ZDOA 1DRZA 1HNXF 3MURP 4KBIA 4OX8A 1NAQA 3OFGA 4JI3F 1Q8IA 5EHHA 3EXCX 4B9SA 4O44B 4KFBA 4OX7A 2C3OA 2K1RA 2V94A 3PIPQ 3T1HF 2HS3A 3US5A 3SV4A 4OI2A 2AYEA 1LWEA 1IKYA 1HPZB 2LXIA 1DTQB 3DRSB 3PW7A 2E7XA 2IYGA 2MDAA 1NJIT 2FJWA 4BC9A 4ICLA 1D1UA 3JSMB 3AHPA 1KOHA 4ZCLA 2JC1A 4L6V3 1A9NB 4XO0A 2EVZA 3OQ2A 3G71S 1C0UA 1Y4ZB 4N8OA 1VIOA 1E6VB 1KTVA 1Y3JA 1HNVB 2YKQA 2XGQA 1FKPB 3VALA 4A8OA 2ZVSA 1HI8A 4OZNA 1HWLA 2ZDPA 3TA2A 4UQGA 1WACA 1TKTA 2OPSA 2LMIA 4MH8A 2Q6CA 2DO4A 1C1CB 2HLTA 3CCJS 3RBDA 2ZFHA 3WC2A 3IR5B 4I4BA 5KFAA 2APOA 2KKHA 1OPZA 3HMJG 4LF7F 3IA0A 4LVOP 2AU0A 4LF6F 4YB7A 1RK8A 5FJ4A 2VASA 1TZ0A 2ZHBA 2VD3A 1DLOA 3MMCB 1VRUA 1S1VB 4IH7A 2X1BA 2V0NA <