1S57A

Crystal structure of nucleoside diphosphate kinase 2 from arabidopsis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
SMEDVEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYITSGPVVCMAWEGVGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSPENGKREIGLWFKEGELCKWDSALATWLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase II
publication title Structural analysis of Arabidopsis thaliana nucleoside diphosphate kinase-2 for phytochrome-mediated light signaling
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 41
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1s57A00
3ETMA 1HLWA 1S57A 3VGVA 3EE3A 2B8PA 3ZTQA 3BBFA 4HR2A 3EM1A 2B8QA 2BX6A 3JS9A 1JXVA 1NLKL 1MN7A 2ZUAA 3DDIA 3Q86A 2DXEA 3BBCA 5CAAA 3NGTA 1UCNA 3EVMA 3VVTA 1B99A 3FBBA 1HHQA 3FCVA 1F6TA 4EK2A 4F36A 4ANEA 1VYAA 1NDKA 3NGRA 3NGSA 3EICA 1NSPA 3FBCA 3Q8YA 3B54A 4CP5A 3PRVA 1KDNA 2BEFA 1K44A 3EJMA 3Q83A 1HIYA 4KPCA 1W7WA 2DYAA 3Q8VA 3FBEA 1LWXA 1NSQA 4ENOA 3G2XA 4UOFA 4W98A 1F3FA 3VVUA 2NCKL 4ANCA 4DI6A 4FKXA 2DY9A 4FKYA 2DXDA 3ZTOA 1NCLA 1NDLA 4DZ6A 3FC9A 3FBFA 3EVOA 5C7PA 2AZ1A 2HVEA 1WKLA 1ZS6A 1EHWA 1BUXA 1PAEX 1MN9A 1NHKL 1WKJA 1WKKA 1NPKA 3B6BA 3ENAA 2CWKA 1NDCA 1NDPA 4UOGA 5CABA 3EMTA 1NSKL 3R9LA 3BH7B 1BE4A 1XIQA 1NUEA 3GP9A 5IOLA 1S5ZA 4F4AA 3NGUA 4O0NA 3VGTA 1NB2A 1PKUA 4UOHA 3Q8UA 3VGUA 1B4SA 3ELHA 4C6AA 5BXIA 3BBBA 3FCWA 4S0MA 3ZTPA 3GPAA 4DUTA 3WX8A 3ZTSA 3VGSA 2DXFA 1BHNA 4ANDA 3BH6B 3PJ9A 1U8WA 2HVDA 1LEOA 3ZTRA 2HURA 2AZ3A 3FKBA 4WBFA 3L7UA 1XQIA 3DKDA 3Q89A 1S59A 3MPDA 3EVWA 2VU5A
chains in the Genus database with same CATH superfamily
2NUHA 4ZIWA 2BX6A 4ILRA 3J80U 3LQVA 3GWCA 3E2EA 1HHQA 1S1WA 2YQ0A 3GU0A 1JLEA 1Q79A 1KTQA 2F40A 3TUPA 3OLBA 1NSQA 3KLFA 2CJXB 4O0IA 2CDQA 4L6V3 3BQ1A 1ZZNA 3H5UA 1SIWB 5D0HA 3W9JA 1OPIA 3FBFA 2HQGA 2CG4A 4FP9A 1NK0A 4K0KF 2FY1A 2AHOB 2YPYA 5E3AA 1DRZA 3BH7B 4WTYA 2NPIA 1D9DA 2AYGA 2J0QD 3KLEB 3I6PA 4WP3A 4PKDB 4NLXA 2RKIB 2OPQB 3DI6A 3ZTRA 2A6MA 5EX0A 2DH7A 2RT3A 3C16B 5DM6Q 2V4JB 2F8MA 1GAOA 3JS9A 5F8JA 2MQOA 4Y2CA 1KEKA 4LT6A 2E5GA 2HS0A 3IR7B 4TVAB 1B99A 2WSCC 2GAGC 2AGQA 1DZ5A 2MEWA 4P72A 4B3TF 1IKXB 1YJUA 2HNYB 5D8HB 1K44A 1F3VA 1VQ8S 3FZ2A 3M1VB 3CJRA 3QJLA 2R7QA 4ZKAA 2QLJB 1MWZA 3IRXB 1V6HA 2FDNA 2HFUA 4XTTA 2OUGA 3PDNA 4JI7J 1TV6A 2HHUA 4MMOA 1NH7A 5ETNA 5C2GA 1WHWA 2DT9A 3M8QB 1RTHB 3EZOA 3MPVA 2HKEA 3T5HA 5A6WA 4C8MA 3C15A 5C25B 3VAJA 4JI3F 1HBOB 2R9LA 3M6WA 1H2TZ 2XB2D 4KKOB 2ILZA 2YWWA 3NG8A 2C3OA 1UWBB 5DG7A 5CQGA 1ROFA 1CULA 4NRUA 1RK8A 1M0SA 3KJNB 2WW4A 3W9HA 2YQ3A 5K8PA 4IKAA 1OO0B 5AE1A 3LWMA 2ALYB 3A8KA 3TAMA 2J7UA 3CJQA 2ALZA 4CP5A 1SV5A 1X5PA 1YZ6A 3DMJA 4QR1A 4N7TA 3MEEA 4A4JA 3EPGA 4TKTA 1TL3A 4CO5A 3CDBA 2C1EB 1MN9A 1R89A 1JKHA 3PW4A 1XNRF 5KFPA 3R9LA 3L95X 3UNGC 3T1HJ 1RTJB 2RILA 2FY8A 1FTCA 3B4MA 3GP9A 2V8GA 1TZ0A 2GX8A 4OYIA 1VRTA 2ROGA 1WC0A 4B08A 4CDIA 3LGMA 3PX6A 2EFQA 4NASA 1FRKA 5LJ3Y 1F5BA 2YNHA 4B3RJ 2CKWA 5DDQC 3HT0A 2XYGB 1J5EF 2OI2A 5CZVA 3QRQA 2ZH2A 3Q8RB 3MM8A 3THPA 2B8QA 4Y65A 1JXVA 4JI8F 2Q6CA 5I3UA 1WOOA 3I5CA 2HNDA 1UEUA 4DS4A 3UD3P 4TN2A 1N5YA 1H6KX 2ZFHA 4I2QB 3JAMY 3HM9A 3A12A 2DGWA 1Y7PA 5J2MB 2FC8A 4V19J 1HI8A 2EK1A 1GTEA 3GZ7A 2XS7A 1ZPVA 4MYTA 4MIAA 1FRIA 1GH8A 4K0KJ 4ED2A 2Q66A 4M5LA 5EDWA 2VG6B 2WOMA 4DQIA 1WKKA 1URNA 4KO0B 3MMAB 3PIOQ 4YR3A 3PHTA 1Q81T 2ASLA 5C5JA 3HHLA 2KFNA 4NCGA 1TP7A 3HMJG 3PYDA 1OIAA 4N56A 3TYTA 4JI2F 3WDOA 3CE8A 2B51A 3V5RA 2GJFA 1PYOB 5F8MA 4ZPCA 4DR1F 2ZH3A 4FF1A 4DEZA 1KD1T 3PEHA 5EWEA 4Q45A 2C22A 5E3PA 3UCGA 1M5PC 4RW7B 1KOHA 4KR0B 2V2VA 4F4ZA 3H42A 4F36A 1TFWA 3NGRA 3CCVS 2DRDA 4LBHA 2BJEA 2GHVC 5GMKa 1C0UA 3E8OA 3IFEA 3NEKA 4MFBB 1Y10A 3NOGA 4LRFA 3DC2A 4DPWA 2MKJA 1UVIA 3CCRS 2V8PA 2AW0A 2XWYA 1WORA 2WONB 3I4PA 2UP1A 4JI3J 3TAPA 1L3SA 1WOSA 1EZZB 3GTYX 3NBPB 4WIIA 1NZAA 5IM0B 3UWTA 4PG6A 4X64F 3QGPA 3D9BA 3QO9B 1VRUB 1HD1A 2IAJA 2KO1A 4ZIVA 2HRTA 3HHNB 1GXTA 4GVBA 4KIAA 2OD4A 1IR0A 4DQPA 1VQKS 2VODA 4DR7F 2F5GA 4URGA 3I82A 5SZTA 2EK6A 4DPYA 4QR2A 1JXEA 2OJ3A 2BUNA 1RA6A 4PAAA 2P6TA 4X4NA 2J76E 2EFVA 1NKCA 5F8GA 2AGOA 3QNWB 1RP5A 4P2XA 1XEZA 2H9ZA 2W01A 4QPXA 3LP1B 3W5ZA 3JQJA 5FJ4A 4U95A 5SUHA 2IRUA 4JV5F 3BYPA 4QYRA 2I9SA 1X5SA 4HHUA 4ZVHA 1R3NA 1XNRJ 2XMJA 1NHKL 2KXFA 1F1BB 3PTWA 4IFVB 1FVSA 4I6YA 5HO4A 4JI5F 1WDTA 5L46A 1S9GB 2PT0A 4ZHRA 2KI2A 4IFYA 7FDRA 2V50A 2ZITA 4RZRA 3SCKE 2QE5A 3UN2A 3G6YA 3OUYA 3SV4A 1FWKA 2DO4A 1N34F 1IKYA 2H51B 2X51A 4GKJF 4A8FA 1LK5A 1HARA 3GJRB 3AB2B 1PC5A 2BM1A 1U4BA 3V6DB 1D0EA 4RW9A 4FF2A 1RAIB 1R0BG 4ETZA 3QFHA 4OFZA 1FE0A 2DXEA 5ETSA 3LAKA 3KLGA 3H20A 3CJ4A 4OYZA 3N01A 1TKZA 2PMZD 4X65J 5IV3A 4OQJA 2UXDJ 1SCJB 2XS5A 1I51B 5IT0A 1EARA 2UUCF 3BREA 3H40A 1TVRB 2XGPA 1F2GA 1X5TA 2BKOA 5E7OB 4TYBA 4RNOA 3JTOA 1ZM4A 1QJHA 2YKPA 3IM9A 2UXBF 2N7CA 4YY3J 3RR7A 1F5AA 3BSAA 4CNZA 2ZH7A 3KUHA 3DDNA 3I0SA 1XMOF 4DSJA 2GC8A 4EZ6A 2A2CA 3N6MA 3MCSA 5CD4H 3X1LB 1Q53A 1UJ6A 1VLOA 3KDNA 4DR1J 1FEEA 2VIHA 2VB6A 1Q95G 1VI7A 3C46A 3CSKA 2V2ZA 1FTRA 1HHTP 1HHSA 4J90A 3E3XA 3I56S 2U2FA 2QSWA 2F65A 3ETOA 2GS8A 1HWJA 1TR0A 4KTQA 1NNDA 4DG1B 1GFWB 4O3OA 3K59A 1ZA2B 3HHEA 4I7FB 2ZM6F 2E7VA 4RNFA 4DHVA 3M30B 1KVKA 2CQGA 3DGPB 3TZZA 2VBYA 3BDEA 1RWMB 1M5HA 4LRBA 3B54A 5KFBA 4CH7A 4LIWA 2KN4A 2AJ0A 2D74B 3DFEA 1SKRA 3UE2A 3FEZA 1BD6A 3KJVB 3BGOP 4M5DA 2K06A 2LEAA 3TWZA 3VAGA 1DLOB 2LYVA 1WSRA 4RUHA 3HHLC 2KTQA 1SJRA 1REVA 2HFOA 1TUVA 1VLYA 2CQBA 4U7UD 4TY8B 2ATCB 2GFFA 4X64J 4C9DA 1NHVA 1VQ7S 2YBVA 1WJ9A 3QT8A 4PWDA 1VHFA 1XN9A 4DR4F 4UUWA 3PEJA 5ETQA 3R6GB 3NRBA 3M2VB 4LFCF 1OQ6A 1YSJA 3B8HA 1GX5A 5J2QB 4M94A 1SJ3P 3M2RB 5GAEU 1NPPA 1T02A 2FJBB 3HFVA 2ZBQA 5HVFA 2B0GA 3IAM9 1RT7B 2FZGB 1V5IB 3D5MA 2FLNA 1EAYC 4NA1A 5LM7E 4USIA 4USTA 2HW3A 3BPDA 5D15A 3OSPA 4OMFG 3Q8YA 3UQSA 4IR9A 5C42B 4JV5J 2FVCA 3AT1B 5DM7Q 4DPOA 2ZH8A 1C1BA 1T05A 1YITS 1L3UA 1WC3A 4DXLA 6AT1B 1T03B 3B82A 2OPPA 2XYPB 2YH1A 3H2UB 1K1QA 1IKWB 1RWKB 3FK4A 4AL6A 4OZ0A 5B0FA 2KJWA 4DSKA 2X1GA 4F4XA 2JJ4D 4ID8A 3FFIA 2UZAA 3CCWA 4RUBA 2KRRA 2VFRA 1KWMA 3CUNA 4YB5A 2CVIA 4I0WA 2WVBA 4X4RA 1N34J 3UFCX 4ZPDA 4M8LA 1Z2ZA 1YI2S 1VQYA 1N0VC 1JIHA 1FNMA 1ZAVA 2ZC4A 1N6QB 4TU8A 3G82A 3CULA 5ETKA 4Y3CA 4LF5F 3LW5C 2J6TA 4J9LA 2OPSA 4DU7A 1R8PA 2G4BA 4QOTA 5AXLA 3DLKA 2J6SA 4NMLA 1S1XB 2LCWA 3OVAA 1M5OC 5HLFB 3W2VB 1BXNA 1LK7A 5J2PA 5E3QA 5F3ZA 1K0TA 4DFPA 4AQYF 1RCXB 3EGWB 1U47A 3OFFA 2DITA 1U8SA 3PCOB 1U7LA 4FS1A 2ZC3A 3QLHB 1KVJA 1HBUB 2LECA 2WAQD 1LFPA 1XR6A 2BANB 2CWKA 5HP1B 1YTYA 2AU0A 4FS2A 2AD9A 1WOPA 4P74A 2XZTB 1QSYA 5KFXA 5KT4A 4HACB 2XLIA 1ICEB 1RGVA 1HQEB 5L9NA 2GAHC 3PYGA 4PPZA 3LAMA 2QLBB 2M0GB 3N28A 4TLQA 3KLHA 2XLKA 5M2PA 2O67A 2VPZB 4CYUB 2MSSA 1RWUA 2C2MB 1EP4B 4PG4A 2IDEA 1WDDA 3OR1A 3WZ0A 3M8RA 3R7SB 3QT6A 5KFGA 2CRLA 3BZQA 4FF3A 2P5VA 3MEGA 3ILJA 4R5PB 3SSQA 5H9EK 2YKMA 4O4RA 4WPAA 4NLDA 4WXOA 2W4DA 2JX2A 1EHWA 5G0RB 2HK3A 3ULHA 3IO1A 4PCQA 4KQZA 2GVZA 3PW5A 3DOKA 2MQ8A 4DR4J 2F1FA 4H4KA 1VDHA 3FSXA 4LFCJ 1WUUA 2GIFA 3FNNA 4MKBA 2K2PA 3GJTB 2KB2A 4F4YA 4L3KA 1NAQA 1LW0A 1U26A 3N9UC 2QL9B 3T41A 1H7WA 4P7VA 4UOCA 3Q2SC 2ZBIA 4F67A 2AJ1A 2BJ9A 1RBAA 2W2MP 3ZFVA 5KOWA 4CO2A 1ZA1B 4CZCA 1GEHA 1CSJA 2FUG9 2G13A 4L73A 3C6UB 5B0BA 1FNXH 5H9EJ 2BQRA 4ANCA 2P8IA 5A8RB 4FKXA 4DX6A 5LMNF 4WU2A 1FO1A 2HHXA 5IV4A 3RAXA 1TL5A 3O44A 3CJ8A 4HHHA 2N3LA 4UOGA 5HMZA 4DR2J 2YVSA 2OIHA 5CCMA 3L3CA 2UUBJ 2JWNA 1FNOA 2HGNA 2KL8A 2O3DA 2B4PA 4ZCIA 2Y1LB 2DXFA 3QAEA 3KLEA 3PFEA 1ZTTA 1JJHA 2GNKA 4OJHA 2R8KA 1LOUA 3CMES 1CC8A 3KYLA 2RKIA 4C7QA 2OPQA 4LF5J 1RWNB 2ZBCA 4DR5F 3WIUA 4NLPA 1N8RT 3C16A 4LQ3A 2V4JA 3L9ZA 4QPTA 2BA9A 4DSIA 5B0AA 4NYOA 4F04B 3PW0A 2YKQA 4EBCA 3VQTA 5HROB 4AQYJ 1P9YA 3KTQA 5KTQA 4AT1B 3E51A 3ENVA 1KDNA 1O8BA 1IKXA 1I3OB 2HNYA 4Y34A 2JSXA 3G8QA 3M1VA 2F9JA 3PX4A 1F9HA 5KOXA 4Y28C 4J9VA 3NP5A 3IRXA 1M90T 3B6BA 1BQNB 2J8SA 2CJQA 2R42A 2MMYA 5LSOA 1YX2A 2UUWA 3SEOA 3BO2A 4NI2B 1RISA 1WG1A 3M8QA 4MJKA 3SFGA 1RTHA 5U47A 4CI0B 5C25A 1HBOA 3ELHA 4HT5A 2R2SA 4KKOA 2V8DA 3AOAA 1UWBA 4WE1B 4KGZB 1SQEA 4WTOB 4PYDA 3K8WA 4ZVRB 3A3NB 4XK8C 3S7RA 1YRTA 1JLBB 1ZBTA 3WC0A 3RBDA 3MAAB 4B3OB 1FDBA 3IWXA 4NPOA 2RDJA 5ITHA 2AIRB 1Q8BA 4QU6A 4PRFA 3M8PB 4W98A 4ATNA 1TKTB 1U1QA 1RJJA 3VQSA 3K17A 4X4PA 4USVA 2JOQA 2POKA 1WF1A 1N88A 2GJ2A 4B3SJ 1VQLS 4ZP7A 1NK7A 2W2OP 5ETPA 1W2IA 1RXOB 2CPEA 2DGXA 4Q7AA 3CIZA 4B9VA 1RTJA 4M5GA 1MROB 3BF4A 4G3IA 4C8ZA 2OFHX 2WK4A 3W66A 2RRAA 3IWLA 2MGZB 3PJ9A 1B0PA 3VR1A 2K3IA 1QE1B 2WTFA 4HTJA 5KFIA 4ZVGA 1W2BR 2VG7B 1OS5A 1X8DA 2W2NP 3OXLA 3QT7A 4NX9A 3T6JA 3AHPA 2V8HA 3CNQP 4Q5VA 2PFDA 3OLAA 1K73T 2RD5C 2KKHA 4P2FA 2XSJB 1GNKA 4C0OC 1TELA 4I2QA 4FYDA 4ED8A 1HNXF 5J2MA 4CIOA 1YVFA 3BKUA 5LMNJ 3NS7B 1IUJA 4UZBA 3BQ2A 1PG5B 3QGGA 4RO0A 3MF5A 3TP2A 4GRSA 4ZP6A 1FFWB 1X9SA 2RVJA 4MKAA 2XS2A 4IUFA 2EW9A 2VG6A 4EYHB 1PC4A 2MZRA 1QAJA 4Y00A 4H4KC 4KO0A 3MMAA 4TQRA 4DBQA 1R43A 2BJDA 2BVZA 5CXTA 4CLWA 1O51A 2AX0A 1N56A 1TKDA 1NO8A 2MB0B 4J9QA 2KM8C 1HNIB 2LU2A 2HLTA 3D7SB 2XSFA 2V4RA 3M8SA 1SI9A 1LWFB 2HAIA 5KFZA 5LXRA 1WWHA 4OZLA 3A8IA 2GO8A 4RW7A 2CJKA 3MM6B 1N32F 4FNIA 3IR6B 3HI9A 1X0PA 4HDGA 3MD1A 3W8GA 2VC0A 1P8GA 1SL2A 4P2MA 4MFBA 5AT1B 1KVIA 1T9XA 3EGNA 2BW2A 3I31A 4DV7F 2UVWA 3G86A 1U1PA 5D4PA 4I6AA 2WONA 5HBMB 5KT5A 4YHHF 3RAMA 3D2WA 2ZBRA 4HEA9 1WACA 1BQMB 4D3GA 2ZH5A 4QIFA 4WFBQ 3NBPA 2NXCA 4CH1A 5KG7A 5IM0A 4RBVA 2CNLB 2Y0SD 3QO9A 1VRUA 1SIZA 1Z4UA 4ITSA 4U9RA 4P7TA 3DRRB 2HBZB 1KLMB 3LTOA 5D77A 1RBOB 1S1VB 1H73A 3ADAC 2L9DA 3HXMA 2EFPA 1SXLA 1YIJS 3RB0A 3BJYA 3AODA 2WZ1A 2A3JA 4HI2A 3NCPA 3OR2B 4ZJOA 4ZCMA 4IQXA 1RAAB 5FIIA 2VPXB 5A8WB 2BKPA 3LP1A 4B3MF 2PI5A 4FKYA 4OHZA 4ZPBA 1WKLA 4KV8B 3PKMA 5A0YB 3T1YF 3U02A 3RB6A 3RR8A 1RAEB 4IYQA 5D78A 2CZVC 3TRGA 4LSLB 2PA3A 4IFVA 2E44A 4A47A 4FF4A 1S9GA 1Q0NA 3J7A1 1G4CA 3VCDA 1RHQB 2KZZA 2VG5B 4MYUA 5KFCA 2OPRB 1C4AA 1T0TV 3BH6B 2FZKB 1JX4A 3FZBA 1HKAA 3MPDA 4DL6A 1UAWA 3G4SS 4XDCA 3V6DA 1V5VA 4W4MA 1SH3A 4AFFA 1AFIA 4DR6J 3VALA 1S12A 5LMUJ 3FBBA 3ZZPA 1S0NA 2GO9A 1HNXJ 4ZJQA 1VMBA 4DQSA 2E1RA 1SJ4P 2CJAA 2V0NA 2RIJA 1HIYA 2Y0BB 1N5TA 3IM8A 4L76A 1TVRA 2I38A 4UOFA 1NK4A 1NM2A 1X4DA 1OPZA 4P73A 3FC9A 2ZZTA 3MM7B 2WB4A 1SL0A 3BO3A 2MKIA 4RW8B 1NPKA 3PG9A 4FVCA 5E3CA 2AEJA 2VONA 2MKKA 4E8UA 2ADCA 1RT4B 2PMWA 3VGUA 1VRQC 1RWVB 3W1YC 4DV0J 3CDUA 4IOBA 4WFAQ 2LDYA 3CC4S 3CIMA 4CT9A 1SVDA 4WZQA 2E7XA 2LQBA 3MM5B 1KP6A 2W8KA 3OFEA 3R3TA 4O3NA 4DG1A 4W92B 4NLYA 5KG3A 4I7FA 4FN5A 4DU8A 2EC2A 2UVUA 4XIUA 5HL7Q 3J7Z5 3DYAB 3M30A 2EXUA 2KYZA 3K5NA 1RZMA 1NK8A 3DGPA 2XMKA 4DQRA 3W5XA 4ZLNA 3FBEA 1VGYA 3ICLA 1VCTA 1G7CB 2VOOA 3IGNA 4LQ9A 4EYIB 3TUJC 3KJVA 2CQ3A 4YHHJ 3AA8A 2YNIB 1DLOA 2GVDB 5KFDA 2E9ZA 2UV8G 5GMEA 1R6VA 4YMEA 2NSBA 3BS9A 1ZETA 1RHMB 1PJ6A 4TY8A 3RAQA 5GMDA 2K7KA 3ZZUA 2BJ8A 1UFWA 4IH5A 3IWNC 3UCUP 4ZITA 3M2VA 1EIYB 2UVVA 1UZDA 2FC9A 5HMXA 2BQ3A 2DR9A 3W64A 1HLWA 1GTHA 3JB9k 2JRSA 2RF2B 3SXLA 4PG7A 3M2RA 3KK2B 3U1NA 3NGKA 4EUVA 4LR9A 3TA1A 2JEGA 1RT7A 4OX7A 2NYHA 4ANEA 2PO4A 1PJ5A 3PR5B 1MU2B 2J8AA 5AJ3F 2FGOA 2HGLA 2QLWA 3H25A 1RA7A 4FDFA 3RJMB 5C42A 4LIRA 3TVYA 1M1GA 3T1YJ 2MQNA 2V2KA 3J7AN 3US5A 2UUAJ 1T03A 3E01B 1AUDA 4JYAJ 3TUIC 1UPPA 1IKWA 1D09B 1JLCB 1NSKL 1ZM3A 3CT9A 4KFBB 1RKJA 5KT2A 5K8OA 5KG1A 2G0IA 4A8MP 3HO1A 6FDRA 5LT5A 3PO4A 4M63A 3KHHA 1DARA 4PQUB 1OSCA 3QSYB 4LRDA 1WC6A 2XZDB 4JOUA 5KT7A 5CA5A 1TL7B 1S4EA 4YDDB 2UU9F 2CQDA 4USUA 1N6QA 1HD0A 4WKRA 2Y3YA 8RUCA 1UETA 3FQLA 2PIIA 4PXCA 1RT3B 2DB1A 2CWXA 2O01C 3I32A 4OI3A 3BGRB 1GK8A 3D0GE 3CCJS 1S1XA 4KPCA 2HRYA 2J5AA 5HLFA 3W2VA 3K57A 3G8SA 2VV5A 1VC0A 2XHCA 2ACYA 4JI1F 1VFJA 1RTDB 1HNVB 4MT1A 2DKOB 2R7OA 3CJ2A 1OWXA 1RAJA 1PCAA 3BR9A 1QUPA 3QLHA 1HBUA 4P71A 1H0HB 2CPZA 3CJ5A 2QO3A 1XR5A 2BANA 5HP1A 2RQKA 1MMLA 3LPEA 1ITPA 4KHMA 2AJQA 5EWFA 1HR0F 1EETB 1YJ7A 1OYDA 4CM2A 4MKVA 2V2QA 4ZS6A 4HACA 4ED5A 4C0HA 2C3YA 1YQHA 1HQEA 3ZXWA 2WSEC 2XMWA 3RRGA 1X4CA 3MMBB 2K8GA 3LP0B 2QTWA 4Q2LA 4RX6A 3DDIA 1TK0A 1JXLA 4RW4B 1HI0P 1S1UB 2FJVA 3R5BA 4CYUA 4WU3A 5CH7B 1G1XA 1EP4A 2XTJP 2MYFA 3PR4A 4NXMF 5BR8J 3OBIA 5AXKA 1AFJA 4OLPA 2H5IB 2W2QP 3HK2A 4R5PA 3H0PA 2DXDA 1HWLA 4DZ6A 3AD7C 1HYSB 4ES2A 2IYGA 2A10A 5F3TA 2EI5A 2R7UA 4XPEA 3MAQA 5G0RA 2AX1A 3IP0A 2VBXA 4NZ0A 5DS7A 2HZVA 3VAKA 5BYSA 3HCXA 2J7WA 2ZBPA 2IM3A 1NK5A 1HWUA 3R1LA 4V19X 1U02A 1LQ9A 1NJZA 2IYIA 4DV6F 2B43A 5LSLA 1Q8IA 2C3PA 2ZD1B 3T1AA 3OT9A 4ECZA 1FDAA 2WB1D 3OPKA 4H54A 4TLRA 4TU9A 3TJ9A 2V4QA 2Q6BA 2ZH6A 2HIYA 2E5IA 2XWXA 1UCNA 4LF6F 3G9CA 2XBPA 4NLUA 4XO0A 2DHGA 4TY9A 4IR1A 4JV1A 4OI0A 4ZOSA 3OTOF 4GMKA 2P9GA 5A8RA 3H4BA 2CFXA 3W61A 3KWMA 1BUXA 3CC7S 2P9CA 3Q23A 1FJEB 3A8EA 1SH2A 5CABA 5I42B 2RB7A 4DR3F 2L41A 3HHLD 1HPZB 3DLBA 1VISA 1NB2A 1T9YA 2V94A 4F3QA 4C0BA 2M8DB 3GSIA 4Y2KA 2I1RA 4X66J 3DGVA 1MMNA 1RSCA 4BHQA 2CVEA 2UU9J 3VAMA 2AZ3A 1SKWA 3GB0A 1Z1ZA 1CQMA 3CD0A 3SCLE 2APOA 3QATA 2J0WA 5KG2A 4A8QA 3S8SA 3GIMA 5JJBA 4Q0BB 2Z2MA 2ZUAA 4FBUA 5C24B 5CAAA 4UQTA 2Y1IA 3CVKA 3A13A 1K9MT 1AXQA 5T14A 2P6SA 2IIHA 2J7KA 5EHHA 1HNZF 1EJ7L 2DNHA 3TARA 1URRA 1UVKA 4CTAB 5HROA 3ZZRA 4Q2MA 2DD8S 4JI1J 2ASYA 4FPRA 4CLUA 5CZXA 4B9NA 3K0JA 4IG0B 5MAOA 5L1IA 2LEBA 1CG2A 1TAUA 3CD7A 2IC3B 2LXIA 1DAXA 1BQNA 3RBXA 2YKAA 4DX8H 4W90B 1FCAA 3F41A 3QRPA 1HR0J 5BYQA 1U1NA 4FVMA 3G71S 4NI2A 3L4BC 3W60A 2B7CB 1YJ9S 4ECVA 1S99A 1CJTB 2HS4A 4LF7F 2Z57B 1LXNA 2YWHA 4WE1A 1S0OA 4M95A 4ZVOB 4RNMA 4QWBA 1U49A 3BKTA 2XULA 3TOQA 5J1EB 4TQSA 3MM9B 3DHWC 2MJNA 2ZHOA 4NXMJ 1JLBA 3FBCA 1TK8A 3OTDA 5JUMA 3MAAA 3J81Y 4B3OA 3R1HA 1WELA 3G2XA 1HW8A 4ID5B 1Y5LB 2DY9A 3G8TA 3M8PA 2D7SA 3UR3C 5DLFA 3EVOA 3UI3A 4NXNF 2GQQA 3CCLS 3WC2A 2V8VA 1RLCL 4I2PB 3D68A 1VQ4S 4DZDA 2A0FB 2NXNA 4DLEA 1TU0B 3W9IA 4F4KA 4BDPA 2MKSA 2ILYA 2HPUA 2GA7A 2LQ5A 1AT1B 4C6AA 3CCSS 4DV6J 4P9SA 1MROA 3HF5A 5D0RA 1N54B 2HVDA 2MGZA 3A3OB 2VFVA 1QE1A 2N82B 3KUGA 3NWRA 3MFIA 3RW7A 4QWCA 5EWGA 1VC6A 1KNZA 3QFWA 2Y9HA 4DL7A 2VG7A 4ZLJA 2BJ1A 1C4CA 2Z2ZA 1IJEB 1S48A 2DNLA 3L7OA 3H5XA 2IA0A 4JV0A 3OTOJ 2GHPA 4IDKB 2HNZB 2XSJA 1VHIA 3V2UC 5CYJA 5HMWA 2H4YB 4JI0F 5B0EA 2AF6A 4DSEA 1VQMS 3GILA 5DO2A 1RTIB 2ZDOA 2DR5A 1IBLJ 2Y1JA 1PO6A 4BC9A 4DR3J 1OY6A 1PIEA 2XM3A 1DTTB 2A18A 1X4HA 4C8KA 1AB8A 3OTCA 4O44B 1WSVA 2R8JA 3OL8A 3P49B 4GC7A 3SQGB 2R7RA 3HT3A 2IPOB 4NWBA 4EO6A 1X4EA 4OYMA 5IOLA 5CYQB 5I3PA 1HNIA 2AKWB 1FJ7A 4M5JA 1JLFB 4DV4J 5IWAJ 3O2IA 4U7UK 5HI7A 4OX8A 1U2CA 1LWFA 3QZ8A 1HNZJ 3VVTA 1R8CA 4CM0A 1S7HA 1Y9OA 2E29A 3EXYA 1FJGF 3GONA 1OY8A 2QYCA 3KOAA 4K4TA 4F0KA 4NLOA 4CNYA 3MM6A 3MZIA 2HYIB 3GLJA 3OFGA 4NLVA 3UN3A 3BKFA 2DGUA 3ILIA 1VIOA 2M2BA 1R0CB 6FD1A 1EX8A 1NJIT 3RGIA 3HHKA 1OMSA 2PDAA 1X9MA 3BGFA 3BSCA 3SV3A 1FRHA 2B9XA 1AZSB 4X2BA 2LDIA 4RBTA 2ROEA 5HBMA 1ACMB 3PYEA 2VOPA 2ZZMA 4D3HA 2XMUA 5THWA 1BQMA 4M5NA 3ISNC 3PKYA 2CJYB 3ISZA 4LUBA 3KUEA 2YY3A 1CLFA 3J7YI 1S9FA 2XY7A 1Y3KA 1NZ8A 3UD4P 3KNAA 3DRRA 1KLMA 1IR2A 2IM1A 3MWBA 4LFAJ 4AE5A 1WD6A 1RU1A 1S1VA 3GYGA 3HPOA 3IMQJ 4KY3A 4DL2A 1FRLA 1QUVA 3I5AA 5D6GA 2KG0A 3M9OB 4ED1A 1DURA 1VS3A 3OR2A 2E1MC 1KHVA 2FD2A 3QSIA 3BN4A 4DI6A 4RU9A 4NXNJ 5A8WA 3TX0A 4DX7A 3VZHA 1NDLA 4NEZA 3TA2A 2DPJA 1N36F 2F3JA 4KV8A 5A0YA 2DY1A 2E5LJ 2EG1A 2AYMA 2JH3A 3IBCB 4LSLA 1Y3JA 1XNQJ 1GMWA 2OHDA 4U96A 2K7JA 3NKYA 2LA4A 1FRMA 5GADI 4CCHA 4QW8A 5F41A 2O66A 2VG5A 3GIKA 2OPRA 1IBMF 2PA8D 4J37A 3UDLA 4R0EA 2N7YA 1XQIA 3A1YG 1B7YB 2WVDA 3BR8A 1YBTA 2DPIA 3M9MB 3THVA 3MOJB 2NXUA 1FE4A 2HEKA 2HHPA 5DZ7A 4LVOP 1FEHA 3NGSA 2I2YA 1T8EA 4A46A 1YK9A 4YB1P 1W25A 2XCPA 2BZ2A 3BDPA 4UZCA 4JI0J 1APSA 2CZ9A 4PYAA 5EN1A 4RUCA 2KHDA 2RQMA 4DV5J 1ZOTA 2IBKA 2OSRA 4PWWA 4PR6A 1U48A 2B4UA 3PZPA 3MM7A 3H59A 4RW8A 2HAFA 2QZ8A 2VPWB 1Y4ZB 1XC9A 2GW8A 2HZAA 3VGTA 3M6UA 1RT4A 3FRZA 4UOHA 3RRHA 3RW6A 4HT7A 4P52A 1GX6A 3TZYA 3VWSA 3GJSB 3FEXB 3WX8A 1P1TA 3AOCA 2MZSA 1SUQB 3FKBA 2BOPA 2N4DA 1BWVA 3M32B 3PO5A 1YRXA 3NL0A 2HIQA 1XMQF 2R7WA 1OJ4A 1OSDA 3GE9A 3DOMB 4CLSA 3MM5A 2FVSA 3PACA 4J9MA 1KRPA 2MSTA 4YQWA 1Y11A 4HHJA 5A76A 4G1PA 4EZ9A 1IBCB 3DXBA 4ZVEA 1F6TA 2MZJA 3EXCX 1SBRA 5IZHA 2HHVA 1UFKA 1IQZA 4XPCA 2EEYA 3DYAA 2B6AB 1DTQB 3O8WA 2MLXA 4IOCQ 3FMWA 3QGIA 1FFGB 2QSFA 2RUSA 1RLDA 2XYHB 3DM2B 5A2QU 3RBZA 3D67A 3T19A 3GR0A 3HJFA 2EFOA 3HVTB 2BDPA 4IH7A 1U25A 3UD5A 1RYSA 1F9FA 2HQFA 2YNIA 4DFMA 1A7GE 1BE4A 4NE9C 2UUTA 2GVDA 3RG6A 3HFZB 3KK3B 1G3OA 2JEIA 1FA0A 3G87A 2ZUGA 3DOLB 4ZP9A 1O0PA 5DQGA 1ZM9A 2G0CA 3EDRB 3TVZA 4K2XA 2BW7A 5MLCV 4WBFA 4PEOA 2G9OA 3DRSB 1WG5A 3ETMA 1RACB 2CADA 3CXCR 1HBNB 4NZ7A 2RF2A 1FKPB 3CB4A 3KK2A 2W9AA 3JYTB 4Q43A 1E6VB 4IO9Q 2QT7A 2KVIA 2GMJA 1SPBP 4DJBA 2DNYA 2Z2YB 2AEMA 4Z2XA 4DN9A 1MU2A 4IH6A 3L7PA 5DG9A 2W2PP 2IY5B 2FTRA 4N8OA 2VPYB 2ZOFA 2W8LA 3ZTOA 5D4NA 1U6FA 2K1RB 1NJYA 1N48A 2YXLA 2CPHA 4FXVA 5HQMA 3EGVA 4JP8A 4EGLA 1NDPA 3E01A 2IBOA 4IG3B 5HQ8A 4ILMA 1RTZA 2ASJA 3TANA 2BE9B 3DRPB 1JLCA 2NS1B 4KFBA 2I8EA 1V3RA 3MPWA 2VD3A 4B3TJ 3DRYA 3DLGB 1LWEB 1HNWF 4PQUA 2CPJA 4RNHA 4JUZA 1XK8A 4PG5A 1S57A 5KFFA 4Z37A 3R5JB 1WI8A 1TL7A 2D9OA 2L9NA 2B9WA 4U6PA 2DGOA 3C66A 4USHA 3LP2B 1RT3A 3D6TB 3TW0A 2ERRA 4DV2F 2Y8YA 1ZTWA 1I5OB 3BGRA 3G6VA 1FT8A 1RT1B 2D3ZA 1SB6A 3PNIA 2MXYA 2DNZA 1MSWD 3X3UA 1U1RA 3NMAA 3DU5A 2DGQA 3CCUS 2CZ4A 2CUYA 4WCEQ 1FWPA 4I4BA 1RTDA 1HNVA 3CW2C 3TZXA 5KG6A 3SBMA 3DCAA 2XMVA 2Z2LA 5GAHI 3GV7B 1EKRA 2EPIA 4ER8A 4ECYA 3IN5A 5ETMA 1EETA 4ANDA 3KHGA 4DFJA 2E5HA 1XMQJ 2KXNB 4IQMA 3B4DA 4ZK7M 3NAHA 3J7YU 2RS2A 2OSQA 4J9UE 3MMBA 3LP0A 1D9FA 1UTAA 3Q8SB 3FQKA 4EBDA 4DL3A 4RW4A 1KONA 1S1UA 4DF8A 4TYAA 2C2EA 1UWAA 5JVGQ 3LANA 4C3MA 3CDEA 4QIEA 2Z30B 4OV1A 2ZZNA 2J0SD 4P10A 3SYZA 3TJAA 5F8LA 3CO9A 3R7BB 2F63A 3LO3A 2MZ1A 1AW0A 4JI6F 1KQGB 2RU9A 3GFHA 3KMQA 2PD1A 3MD3A 3MCMA 1CJKB 2MY8A 1HYSA 4PXEA 1J5EJ 4HYKA 4K4ZA 2YNFB 1N33F 1IVZA 3GG1A 4JI8J 1CC7A 4E98A 2DNKA 4MIBA 2L3MA 3H7HB 3HFKA 1IWGA 4OYXA 4DSLA 3NS6A 5GADU 4YN3B 3CMAS 1TMJA 1NXIA 4RLEA 2SXLA 2LKZA 2V9WA 2QN6B 3MDFA 3OJUA 4I6WA 2MQQA 3D3BJ 4DUZF 1Q78A 2G2YA 2ZD1A 5K8MA 2M3DA 3U1LA 2V67A 1PILA 4ZLLA 3CC2S 4UY85 4B9UA 5F0UA 4RWWA 2XLJA 3OXGA 4R8UB 1U24A 2CA9A 1CBKA 2PN6A 2RS8A 1AROP 3J7ZT 3PFOA 4AL7A 4ZVUB 4C4WA 2YNGB 5KFMA 2R8GA 3GIRA 3UVJB 4RW6B 2RAQA 4O3QA 4JI2J 3WBZA 2FQQB 2YX1A 5DDRC 1GMUA 2DEIA 3CJSA 2DH8A 2JVRA 2RNEA 5HVGA 4ZDNA 5EGYA 5E2QA 4JB8B 3TUZC 3OJSA 4HI1A 3RUBL 3AY0A 4WXWA 1VQSA 2IFXA 1HQ2A 4OV6A 5I42A 2R7VA 4ZJLA 2QYGA 5DQIA 4ECQA 4F0HA 4F4AA 4X4UA 1PKUA 2JNJA 1HPZA 1HNWJ 3GIJA 3U27A 2EBGA 2PFFB 3MAHA 1Q5YA 2ZKUA 2KZMA 5HN0A 3BGLA 4DUYF 5LOQA 1BY9A 2DCUB 2CJ9A 4PUOB 5H9FK 4Q0BA 1UEKA 1FRXA 4DV2J 1VK8A 3MR5A 5C24A 1ULRA 2MKYA 1SC4B 1RBLA 3HVAA 4CLPA 1WEXA 4LF2A 3KK1B 2HVIA 2XO7A 4CTAA 3M8YA 3BO4A 5B0CA 1VR6A 2HQIA 1FHTA 4OYBA 1FXDA 1N5VA 3QAUA 2C2OB 4DV1F 4IG0A 3HSJA 5JXSA 3QMQA 3MR6A 1MG7A 3HKWA 4HL9A 2FJAB 3J81U 4DR7J 2HBRB 2IC3A 4PZVA 3IC1A 2YWKA 3HP6A 3POTB 5K14B 2RRBA 4K4UA 3ILLA 5DDPC 2DNQA 3QBCA 4N77A 4Y2IA 1HWKA 2DR6A 5KG5A 3D6MB 1S6QB 2DRAA 2BOAA 4ZVQB 4QWDA 2F7VA 2RSQA 4J91A 5AE2A 4M5MA 1DBDA 3OL6A 3TNVA 2C28A 1CJTA 3UN5A 4RL1A 2V6AA 1VQ9S 2FHOB 5J1NA 4UTGA 3SCJE 3TVKA 4RUAA 2EG2A 4MAKA 3NGTA 4GO5X 4ZCLA 1K0VA 5J1EA 1WC4A 2W25A 4FBTA 1Q7LB 3MM9A 2QIFA 4WK3A 4ES1A 4JI5J 3BB5A 3SIPB 1W7WA 3T5KA 2ZWOA 2BACA 4RJVA 5L39A 4JI6J 4F3OA 4I69A 2MPUA 2PGCA 3KHRA 1FX2A 2HHTA 5KFSA 4ID5A 1D8YA 3OL9A 1RAFB 4OX6A 2XC9A 2JFDA 1ZS6A 3THTA 4GKJJ 4DV3F 4B9SA 2C2NA 4F50A 4I2PA 4ELUA 2LMIA 3DU6A 3VAHA 2JC0A 1NK6A 3JTNA 1U1MA 3N5FA 4O0NA 5D4LA 3LOUA 2QRRA 3R2DJ 5BXIA 5BJRA 1DQ8A 3ITHB 1QSLA 3DLEB 3MUTP 4DUZJ 4JI7F 5F9NA 2HFNA 2U1AA 2F8EX 2HQCA 2UUCJ 3ET6B 4I67A 3ILOA 4GKKF 1ZYQA 2HVHA 4USWA 1KFDA 4LF9F 3AH6A 1LWCB 2AEFA 4ZLPA 4YEAA 2DR8A 1VYAA 1TL1B 2UXBJ 2V34A 1F5CA 3H8YA 1XMOJ 1RHJB 2WVCA 4IDKA 2HNZA 3KG4A 2FLOA 2HSEB 4BWMA 1FVQA 1HL6A 1S4FA 2QMWA 3IRWP 2KDOA 2C2RA 2MZQA 2UV8A 4CO0A 2RHQB 2CPIA 2OLWA 4K50A 1YBUA 1RTIA 3P5TL 1XWLA 1XERA 2VF3A 1KLNA 1C2PA 2XCAA 2LXUA 2GIQA 1CVJA 4BCAA 1DTTA 5D4OA 3PM9A 2DGTA 4KBIA 5GAHU 2ZM6J 2CPXA 2GVZB 1Y5IB 2GQCA 4O44A 3R6LB 2HURA 2FJEB 4OI2A 4DUYJ 2BQUA 3UNYA 1RE1B 4YB6A 5AE3A 2R4FA 5CYQA 2JC1A 3JSRA 1BQXA 1JLFA 1FRJA 2A2DA 2C42A 3K2YA 2Z58B 4F25A 3FEYB 4KRWA 2NLWA 2E7WA 2MQLA 2V9KA 2Z4PA 2KFZA 5L1LA 1F3FA 3MMCB 4DV1J 3EPIA 3KXDA 4G1IA 3CD6S 2D3OR 3O6QA 3AD8C 1U0HB 2MDAA 3PX0A 3SSSA 5IT9Y 2Y8WA 1AZSA 3OD2A 3CDWA 1ZPWX 2ZHAA 4J9SA 5KG0A 1X5OA 3KLVA 3NCQA 1LW2B 3M7VA 1UVNA 2C3MA 4ECTA 3R5CA 3MPUB 3PV8A 2VQFF 1M5KC 3HKZD 4G6VB 5A6PA 3W2WB 1SKSA 1LXJA 2GZOA 4X4OA 2CNOB 1NSAA 1KOOA 2GIRA 4AL5A 1BLUA 3V4IB 3G6ES 2W1BA 4ZPAA 2VC1A 3NOCA 4H4OB 5L9XA 1DFDA 5E41A 2FVQA 1N4LA 3OSNA 3A8JA 1JJCB 1IM4A 2FJXA 1XTZA 4WWSA 2W7PA 2H65B 2YWEA 4LJMA 2N4CA 4DV3J 1XR7A 2B4VA 4C8LA 3NS5A 2VDIA 4C8YA 2D3UA 4DPTA 4M5IA 4PG8A 3MUVP 3TQ1A 5KFNA 2HQDA 1VC5A 3NGUA 4IO1A 4X4QA 3BN7A 1HBMB 2M9KA 4GKKJ 1IN0A 1FJCA 3MMJA 4OZNA 4OL8A 4LF9J 5F8IA 2M5YA 4QIVA 2QA4S 3EDQB 1F0XA 2XGQA 2OFGX 3Q86A 2RQCA 1QY7A 1JJ2R 1JWWA 1H7XA 3FCHA 4F7VA 2CIMA 3AA9A 3N5BA 2X7IA 4UUXA 3C3LA 2R3VA 2O5DA 3BPSP 2BJ3A 3U7JA 3D28A 2CPYA 4AYBD 4PXDA 4C8NA 1Y5NB 1SC1B 4WJBA 3EZ5A 3FUYA 4LFBF 1NDCA 4HTIA 1HWIA 2NYIA 4C2MA 2H54B 3WHIA 1LFWA 2KRBA 4WF9Q 4NLTA 3MI7X 2VH7A 2LA6A 4FYYB 2G1HA 1SJFA 1QTMA 2J9EA 2QLXA 3W65A 2YPZA 1R0AB 4DF4A 2X3DA 1SUQA 2M7SA 3AAWB 4OJ3A 3NNAA 3M32A 2ZJPQ 1VQ5S 3PHEA 4EFAC 1R31A 1ELOA 3DOMA 4OI4A 4OHYA 1RWWB 3B78A 5ETRA 2ZOMA 2DCLA 5GAEI 1D1UA 1L3KA 3SZ2A 5DLGA 2MHNA 3W7BA 2GV1A 2ZDPA 3VTIA 4K5SA 2QFJA 5IC6B 2DHXA 3HULA 4URSA 2B6AA 1DTQA 4DSFA 3H5SA 4ECRA 2Q79A 1ZAXA 3S1TA 2DHAA 3OTEA 3DM2A 3QIDA 3C2PA 2KT5A 3FJ2A 1RAOA 1CPZA 2MJUA 3HVTA 2EVZA 3CCTA 1DQAA 4X65F 2UXDF 1B0TA 2WBRA 2GMHA 5D3GB 4LSNB 3EMTA 3IXQA 3O3LA 3NNCA 2C3UA 2RQ4A 2P2CB 2OKQA 2HWIA 2AQ4A 3IG1B 1X7VA 3KK3A 1RT6B 1IKVB 1R7IA 2VQFJ 3DOLA 1IXKA 2LEPA 4YY3F 4U7CA 3SDEB 4GC6A 3CO0P 1R27B 1T7PA 2B8PA 3PVXA 3DRSA 3EM1A 1WF0A 4KHPF 1CS4B 2NQPA 5K20B 5LJ5Y 1LV5A 1M5SA 4ZPWR 4B02A 1HBNA 1FKPA 4KT0C 2YTCA 1HW9A 1FXLA 1YGYA 3JYTA 2G2OA 1E6VA 4A8WA 2RHSB 1YJRA 2QGFB 1S72S 2DTJA 3DLJA 2Y1RI 1NH8A 1AYEA 3HLUA 2FPHX 3P45B 4G65A 3LA0A 2FLPA 2QEXS 2VICA 1R8BA 3UW1A 4O3SA 2K1RA 4F3MA 2MQMA 1S0VA 1T9TA 1R8AA 2ACMA 3H2VE 2OP5A 3SCIE 2OTJS 3Q24A 1DJ0A 4DR5J 1V3ZA 3P5BP 4IG3A 8ATCB 5CYMB 5I4MA 3DRPA 1Y0HA 5KT6A 5E5NA 1H3DA 2BXJA 1AUSL 3RU0A 3M05A 3KHLA 3RRKA 2IM0A 2WVEA 3ISND 5IT4A 3UR0A 3EYZA 3DLGA 5FD1A 3EVWA 1LWEA 2VU5A 2E1AA 3VGVA 3K5PA 1WHYA 1WF2A 3G96A 1OQ3A 2V63A 2H4WB 3IBFB 1XBWA 2J0XA 1GMVA 3GG0A 4CLLA 5IQ6A 2VL1A 4OJ1A 5CD4A 3QPIA 4L75A 3LP2A 1QD1A 2DNRA 2YH0A 1RT1A 4C3KA 3V6HA 1RCOB 1J27A 3QYYA 4LFBJ 3FDSA 4OZ5A 4YB7A 2YX7A 4NRTA 4KGXB 1HQUB 3K5MA 3JQKA 4Q44A 5HJXA 2JLGA 3MPYA 4DOZA 2YWGA 5KFHA 1WG4A 1DQ9A 3NXZA 1N5SA 2OTLS 4NL5A 3MCNA 4C3LA 1QM9A 4CO4A 4DPXA 4J9OA 4RU2A 3EGZA 3D6HB 2VUGA 3CCES 4BS2A 4J5OA 1Q4RA 1EB0A 5HQLA 4RR5A 3R5GA 2RE1A 7FD1A 5GAGI 2F9DA 1NSPA 4OHXA 2LFVA 4L72B 2M4MA 2QL7B 3M2UB 2FB0A 1S49A 2ZH4A 5CHCB 4DQQA 3T5JA 5DRKA 4DLGA 3BV8A 5KFYA 1E6YB 3ZZOA 1TKXB 4PPDA 4CH0S 4HDHA 2VQEF 1NK9A 1PAEX 1TUWA 3JSMB 2HFZA 2DJWA 2I5JB 1CJKA 3OVSA 4FYWB 2BABA 5FLXY 2D3O1 2AJFE 2GCFA 4YR2A 4NYZA 2XNQA 2W24A 5DETA 1PBUA 2YNFA 1KS2A 4A8KA 2GGPB 3T3FA 3GQCA 3BEGB 3Q8UA 4NYPA 1NJXA 5HANA 3AXKA 3L7UA 4EU0A 4KHPJ 2XMMA 2VDHA 2IJRA 2XEXA 4F8RA 5KFQA 2KT2A 2L9WA 1HMVB 2IRXA 4WFYA 5KFUA 3VAIA 2Z56B 3M8ZA 4J9KA 2IDLA 4R8UA 2FHJA 3BSNA 2FHKA 4DL0C 3L09A 4CLTA 2JZ5A 4WYWA 4OYOA 2C2ZB 2YNGA 3UVJA 4RW6A 3W3SA 1KHWA 2B5JB 1S79A 3N0VA 4N41A 1YHQS 1JQGA 3HZGA 2MTLA 4DMZA 2NR0A 4NMXA 2HLUA 2OAUA 2KYXA 4HLBA 2XY5A 3H98A 2C2KB 4ICLB 5H1SV 4CO3A 3PY8A 4M5KA 3VF0B 2CNNB 3BM7A 4NZ6A 1S5ZA 1QAYA 3GFXA 2L08A 2QG9B 1RT2B 3ZTPA 4YP3A 4NCAA 1N32J 3CF5Q 1RB0A 3DKDA 4C11B 4NEYA 4MK8A 3HVWA 2LQ9A 5L8RC 3MCOA 2QL5B 4CLKA 4PUOA 4LRCA 4ZN3A 4DV7J 1KSPA 2E1CA 3I9ZA 3PRBA 2KFYA 2YKNB 2RDIA 4ILLA 2DVIA 3KK1A 2FJWA 1NMEB 2NCKL 4ECWA 3BQ0A 3CJKB 3QRRA 1N5QA 1S1TB 4RWXA 4QU7A 2NPFA 1YRUA 4J7CA 3AXMA 2EWHA 1Y00A 3FGVA 4O3RA 4PWUA 3ZNUA 5DQHA 3O1LA 2BJ7A 5J2QA 3HSDA 2PEHA 3R27A 3GFZA 3LH2S 2W9BB 1I6JA 1B64A 3POTA 5K14A 2HGMA 4BLGA 3PW2A 4QW9A 3OV7A 2VKZG 2OO4A 5A2QY 4KPYA 1S6QA 5DG8A 1JLGB 1PGZA 1H74A 5IC4B 1ZAWA 4NLRA 4ECSA 4DR2F 1N52B 4ZVTB 2FVRA 1JLAB 1T3OA 4B3MJ 2UUBF 4A8YA 2KH9A 2NZCA 2AYEA 1SQGA 2HHWA 4F2RA 4GO7X 2OMOA 5HATA 4TNOA 2X1FA 4EK2A 2VZ9A 5I3QA 1UFLA 1NDKA 4EBEA 4MK9A 3W62A 3GV8B 3TQEA 2HVZA 2PE8A 3N6LA 1L5UA 3KJQB 1VBYA 2IVMA 4KH1B 3PW7A 4E0DA 4I1TA 3OTBA 2VQEJ 1JMTA 1KTVA 3AJ2A 2LXFA 4QR0A 3D0IE 2R7TA 1WHXA 4KSEB 1RYRA 4QZVB 4QIGA 4N5SA 4YUDA 1P1LA 4P75A 1GMWD 5CCLA 1Q82T 3KLIB 4ELTA 3AD9C 2GMLA 3CD5A 3ITHA 3DLEA 4QWAA 3CTRA 5ADZA 2OH2A 1JLQB 1FK9B 3P96A 3ET6A 5LXYA 2W7AA 1S6PB 3K58A 4G1QB 5RUBA 2Q1LA 2DISA 1YKWA 2IJFA 5A8KB 3MHYA 2E9RX 2Q3PA 5KAKA 1LWCA 2JEJA 1TFYA 2ZE2B 2VA2A 3MEKA 2IHR1 1UW9A 1TL1A 3I55S 4KAIA 2DNNA 1RABB 2RMLA 1FKAF 3Q8VA 3LUYA 2B3TB 4UT4A 3OW2R 1H72C 4Y0FA 4YR0A 3MEDB 3WQPA 2P9EA 2VFSA 5J1PA 2CQ4A 2OEMA 2BE2B 4YFUA 4P6QA 4J9NA 4JI4F 4Z7YA 3TAQA 5KFVA 1XIQA 2NREA 1GT8A 1CJVB 5KFRA 4U67Q 3CDAA 2FZCB 3V81B 1FESA 2YQ1A 4B3SF 2DHSA 1RDRA 3A3PB 3TEHB 5IT9U 1RUSA 3MR3A 4GVLA 3PJXA 1RT5B 1KKHA 3HJVA 5T7LB 4K4YA 4O4GB 4UY8T 4KGKA 3M9NB 3MXHP 3NCRA 1UL3A 4NA2A 1NU4A 2MY7A 3SI8A 4A48A 1P27B 4WYLA 8AT1B 4CWBA 5GAGU 3UDVA 2MKHA 2BEFA 2HQ3A 2M70A 2KXHA 1C1CB 2R8HA 3UO0A 3MMCA 3I5BA 3N79A 2FVPA 3Q22A 3IAS9 2KHCA 4WFZA 2WHOA 2E66A 3HSZA 3PRDA 2DGSA 2ASDA 2CPDA 3OFHA 4FZVA 2KG1A 2D69A 2H1YA 1U0HA 4U8YA 4EWTA 1T3NA 1M5VC 2LQJA 4CT8A 3FSIA 2NSCA 1U6ZA 3H5YA 1LW2A 3R8YA 5AJ3J 4LBPA 5K8NA 1Q8LA 4H4MB 2XHWA 2Z0GA 1VBXA 1TMMA 4CLFA 4ED6A 5KFAA 4ED4A 4ECXA 2B9YA 5EUHA 3GYXB 3W2WA 2CXEA 4WP9A 4KJIA 1NKBA 2VFTA 2OEJA 1FF2A 4KGMA 3JXOA 2VASA 3IA0A 2BKNA 3C6UA 1YWXA 4Y6IA 1TAQA 3V4IA 2CQPA 2F4VF 1UJ4A 2LVWA 2PSZA 3GFYA 3C14B 3AJ1A 4H4OA 3M6VA 1VOMA 4KGVB 1UVLA 3I9V9 3A4TA 2LU1A 3H90A 1QLNA 5DZ6A 2J9DA 3ZZ0A 2DNGA 2YWFA 3OQ2A 5C2CA 5KFTA 2RJZA 1S10A 2FIUA 4OIXA 1SJQA 3MTKA 3I87A 3QT5A 3MECB 3EUNA 1S9EB 1PAUB 2BBEA 1U2RA 2YKOA 3GR1A 2MHEA 3HZEA 2RDDA 5E0OA 2AJ4A 2HHHF 5BYRA 1RHUB 4FNHA 2EKNA 2PC6A 2ZWPA 2R8IA 4LR8A 4AXJA 1A6LA 4ZVSB 2W9CB 1KBRA 1U8WA 3Q0AA 3CPWR 1HBMA 2J6UA 1WNEA 3NWGA 4QCLA 2VKRA 4A8SA 2DEJA 1CJUB 2EBEA 3HVRA 1PBAA 2VJUA 3OXFA 2GQ2A 2DIVA 5B0GA 1FERA 3Q2TC 4IRDA 4ZVFA 2OD6A 4WFNQ 3QZ7A 1BGXT 3TA0A 3EJMA 5GVQA 1X9WA 3CCMS 1Q16B 4O3PA 3VV2B 1NCLA 3PIPQ 2JHEA 4K4SA 1CEZA 2RU3A 4JI4J 3GV5B 1NB7A 5ETVA 2DK2A 1WKJA 5IS2A 4ZVPB 4PQAA 2JLFA 1KQSR 1RHKB 4KE5A 3TEGA 1YBAA 4A8OA 3JAMU 1RQ0A 3I0RB 2EKYA 4R25A 1XJWB 1FKOB 4OHVA 4RKUC 1ZM2A 1LEOA 3DDKA 2JL9A 1RKIA 1R0AA 1J5OB 3S01A 2M88A 3ONQA 1EQMA 2QX0A 1NKEA 3FMBA 4PXBA 4YS2A 3MTJA 1DHMA 1TKTA 3D3CJ 2B7BB 3EICA 1FXRA 1T94A 2VHGA 2W4PA 4CO1A 3KFWX 2ZJQQ 2QA2A 2I0XA 1SC3B 3IBWA 3QIPB 1CQNA 1VQNS 1VQOS 3RBEA 4DR6F 1LKZA 5LMUF 2B9EA 2HS3A 1T9VA 1YJWS 3J81j 3ZZZA 2G0JA 2D1CA 3V4MA 4KH0B 1Q86T 2IMOA 3OHBA 5D3GA 4LSNA 2D41A 5B09A 1MW7A 4WP8A 3T9NA 1FD2A 3IS9B 5KT3A 4WK1A 2HFVA 3CCQS 3ENWA 4LRAA 2DHHA 4LF6J 3IG1A 4OYAA 2HWTA 1RT6A 3I96A 1IKVA 3N4WA 1U2FA 2BV3A 3G6XA 1P6TA 1H2VZ 4J9PA 1UKUA 4QYZK 3SDEA 3RB4A 1B0VA 1P9QC 2CAJA 1M1KT 1YLXA 9RUBA 1CS4A 1IJFB 2F4VJ 1TUGB 1IBKF 4DV0F 3P4UB 2B56A 4OZJA 4RPFA 5J2NB 2AYBA 4CLZA 4N47A 4AUKA 4HH1A 4V1Ak 5LL6d 3MR2A 4K8RA 3PRVA 1C0TB 2GHWA 1HFEL 4NLQA 2FLLA 1QAXA 3C6TB 3Q8QB 5DJBA 4NCBA 2HBQB 3K5LA 1T9WA 2DO0A 4TU7A 5FDLB 1MWYA 2YX4A 2PEBA 4QIWD 1B70B 1VBZA 5ETLA 3V6KA 2DRBA 1GXUA 2HHHJ 2L48A 4C48A 4DWIA 2HMIB 1HI1A 2E9TA 5CYMA 1UP1A 4MKYA 5IFMA 4LF4F 1UA1A 4M1KA 3EX7B 3W63A 2IMWP 2CJBA 1S59A 1XMBA 4QYZJ 4QQBA 2E1PA 3CWJA 1NLKL 3S6EA 2LLZA 5E3RA 4WKYA 2IA6A 1K8AT 3DXSX 3V6JA 4ECUA 2XMAA 1IQTA 2GJIA 1S1WB 3FCVA 2AMCB 1JLEB 3AOBA 2IRYA 1KC8T 3CJ0A 4LF8F 3K7RA 1VJWA 1Q1KA 2KU7A 3DRXA 3KLFB 2ZNYA 2XQCA 3M4XA 3DLHA 2V68A 1X31C 4X62F 4DS5A 5HVHA 4X4VA 3CJTA 1NHUA 1PYTA 4L74A 4LF1A 3HX9A 3VHQA 4LF7J 3DN9A 1KFSA 3QGHA 2KVQE 4ES3A 4EO8A 1HQUA 1H98A 2HRUA 2QFIA 3EWGA 3J80Y 1L3TA 1SJ1A 4S0MA 3D0HE 3DI6B 2V69A 4HH0A 2UUAF 2NUUG 1FX4A 2G2ZA 4JYAF 4WZMA 5FLXU 4BWJA 3SFUA 4C98A 4UW2A 1YJNS 3GJQB 2HK2A 1SQFA 4F0MA 2MKCA 3WX4A 2RUGA 4OYPA 3AFGA 2DYAA 1U1OA 2EFGA 3T6BA 3GMGA 3MFHA 3M2UA 4ZPVR 1TV6B 2IVYA 3O5TB 4AD6A 1E6YA 1TKXA 3ENAA 4F2SA 3IGVA 3JSMA 3WIVA 1EQ0A 1RHRB 4MH8A 4UF4A 3C15B 2I5JA 3KNGA 2CQCA 1U0SA 1WEZA 3Q8PB 5HJYA 1OYEA 3HD1A 4LBIA 3QJJA 1NBEB 2GGPA 2R2UA 3ZTSA 2ZVSA 2H3EB 3K5OA 1FFSB 2JFKA 2BMBA 4MIWA 4OI1A 1F60B 1CULB 4N8NA 4I68A 2HG4A 4DCOB 5HMYA 3ZTQA 2ROPA 1YJVA 3HSGA 1IBKJ 1O6XA 3BBCA 2LQ8A 4N76A 4JV2A 4Q8FA 1HMVA 3R5DA 2XI2A 4HVZA 3TAMB 1RI7A 1SV5B 3PXGa 3LGHA 3DMJB 1S0MA 4EMDA 3LWLA 1UA0A 4DCPB 5KFKA 4LVNP 3MEEB 5F9LA 2DH9A 2ZNZA 1Q8KA 3KMSA 3M8WA 3CEDA 1TL3B 1VIXA 2M8HA 2Z8QA 4IRCA 2F8HA 2AZ1A 4CRJA 2B5JA 3NGDA 1WEYA 2DR7A 1JKHB 1X4GA 2JLEA 1M1HA 4QJVA 2I6WA 2OMLA 4BBYA 4WIQA 1NUEA 4DX5A 5BR8F 3QJPA 1VRTB 5JVHQ 4ICLA 4LF4J 4WFXA 1PSDA 1X60A 1W26A 2YNHB 4R0JA 1FJGJ 1RT2A 4K59A 4Y2MA 3GSDA 2EC0A 1A0OB 2CNKB 3JTPA 5KFLA 3MM8B 3K89A 3D1OA 5I3UB 3R7NB 4C11A 5B0DA 1MMDA 2HNDB 2UXCF 2ABYA 1AA1B 1N5YB 2DNOA 2X1BA 2HHSA 4LF8J 1TK5A 1RWPB 4UQGA 2CQ0A 4E2FB 1TL4A 3P8BB 2IJNA 2WCXA 1X0FA 3CCZA 4EEYA 4K4VA 1O5JA 2O1PA 4MTPA 4FXDA 3JSYA 2VBWA 2YKNA 4X62J 2MLYA 1QVFR 4OX9F 3ZNJ1 5IQQA 2MLZA 4LR7A 2RRNA 2WOMB 3BSOA 3CJKA 2XZWA 5M2RA 5JMNA 1S1TA 1VQ6S 2ZHBA 1Q7YT 3HHLB 4NCGB 1QAIA 2H5EA 4B9TA 4HKQA 3F44A 1JK9B 5T41A 4ELVA 4YOEA 5K5MA 4B17A 2H5JB 1Q5VA 2M52A 3FCWA 2CQ2A 2W9BA 2HFSA 3QWPA 4F4WA 2DNMA 1BHNA 1S7IA 3IR5B 5KFOA 2A1BA 1QTNB 4FPIA 5L38A 1JLGA 4ED0A 3Q89A 3D1QA 1EKSA 1I94F 1UJ5A 4I56A 2UVRA 3VZIA 2QJ3A 1JLAA 3LALA 2DNPA 2AT1B 5K9FA 5F8HA 1RU2A 1DY3A 1N36J 4X66F 1PJ7A 4J9RA 3R2CJ 2MZTA 1U45A 2AV5A 1NPRA 1MWQA 1A9NB 1VBKA 2H48B 1S77D 1C0UB 1VJQA 4USJC 4K2JA 1IM6A 2QV6A 2BM0A 3NLCA 3MGJA 3T5LA 3OL7A 3GYNA 2ZJRQ 4NLWA 3JQMA 1GXLA 3D1HA 1IBMJ 4I64A 5IXUA 3EZUA 3RYLA 3TZWA 4DL5A 3MR7A 4KYZA 4L3NA 2F4FA 3GCWP 1FDNA 2B4OA 2PMHA 2R7XA 2IAJB 1TQLA 4OZ1A 3DLLQ 2DBBA 3KLIA 2DIUA 4GVBB 5B08A 3TI0A 3FRYA 1RAGB 3EE3A 1SH0A 1LNQA 1YJTA 3BBFA 2ZEJA 1JLQA 2OEKA 1FK9A 1S6UA 5DGBA 3R5AA 1S6PA 4G1QA 3C19A 1F2HA 1T9UA 5A8KA 3FSYA 2X3GA 1V9OA 4BC7A 1BWEA 2ZE2A 3KDOA 4USMA 4ERDA 4ZP8A 1H38A 1U1LA 1UVMA 4ZMMA 3SMZA 4EI2A 4DN0A 4ENOA 3ZO7A 2BR0A 4B9MA 3MEDA 3H2LA 3N6NA 1GQEA 4LMZA 1X4AA 1UPMB 4X84A 2BE2A 3UCZP 4ZHRB 1R6YA 4IFYB 2OGUA 2AGPA 2X1AA 3W5YA 4O23A 1X4FA 5KG4A 2QLFB 2HBYB 3OUYB 3D6FB 1CJVA 3BBBA 1G2EA 1I1GA 1IKYB 3F0NA 3V81A 3CGIA 3K8VA 4ZCKA 4RW9B 2UXCJ 2EFNA 3LF0A 3ENQA 3LPYA 2ATLA 1ZH5A 4HR2A 4OZ2A 1RT5A 1TTHB 4OYWA 3KLGB 1X4BA 4IRKA 3OVBA 2BYCA 5T7LA 1SC6A 4OZ3A 1Z2LA 1TKZB 4O4GA 4OJGA 2W7OA 2N3OA 2XNRA 2FGCA 3AQOA 3M6XA 2WW8A 1F9EB 2KJVA 4X4SA 1RADB 1JB0C 4C97A 4OX9J 3DHXA 1YZ7A 2WBMA 3AQPA 1WHVA 4CLYA 1D9AA 1LWXA 1IR1A 3TR5A 1C1CA 1FDDA 3MURP 3BYRA 2W4CA 1KQFB 4OLOA 3U1MA 2MQPA 1YDLA 3ZZYA 2CPFA 3I0SB 1B7FA 2ZH1A 3NAIA 4DPUA 1SKUB 5DDOC 4IOAQ 3CMQA 1WTFA 2K3KA 2IM2A 2VJVA 3HDSA 2ZH9A 3KJFB 4USKA 3ZC4A 4ED7A 1JNZB 1D8ZA 3D66A 1IBLF 1JJ4A 1I94J 1T95A 2XI3A 3KG0A 1KN6A 4H4MA 4NA3A 5ETOA 2WSFC 4MK7A 3TO8A 4KHRA 3MUMP 4CQ1A 2FHMA 1L3VA 4Q8EA 4K7QA 1UMJA 2HZCA 1WC5A 3C14A 1K1SA 1FD8A 1VK3A 2ZKTA 5HSPA 2ZOGA 3JSBA 4DV4F 1PYSB 5IWAF 4M5HA 4M5DB 3P6YC 5C7PA 2HVEA 1BC6A 3QWUA 3MECA 1REVB 5F8NA 1WTBA 1S9EA 5KFEA 5D0GA 2ADBA 3GCXP 4A8XA 4XDDA 3D4JA 4PWDB 2COLA 4F02A 4PABA 4K4XA 1KR4A 9ATCB 1UW4A 1S97A 3GPAA 1BMQB 7AT1B 5LSRA 2CDRB 1UVJA 2W9CA 3P3DA 4YDXA 3MOZA 1SL1A 2QC3A 1CJUA 1RWOB 5D0EA 3I4HX 5AXNA 5DGAA 1MNEA 3W8PA 2WVFA 3EVMA 2D9PA 4C8OA 4FYXB 1NJWA 2R7SA 5L1JA 1HA1A 1H2UX 3RTVA 2HWHA 4B9LA 4NLSA 2E5JA 3KKFA 1C1BB 1T05B 1VQPS 3VVUA 2OELA 3F73A 4AXIA 2OPPB 3RZAA 1MLAA 4LFAF 1JNRB 3CJ3A 3FVYA 2QMXA 3H4DA 1FWLA 1U09A 1REGX 4P2SA 3RB3A 1V3SA 2XG8A 2QA1A 2DGVA 2LP4A 5EX3A 4NLGA 2QA4G 3HD2A 2JEFA 3FFIB 4ZPTR 1RAHB 2WRMA 2VA3A 2IVFB 4F26A 3NMRA 5HAOA 3NY0A 4KB7A 3PJWA 4RNNA 1WI6A 5H9FJ 2RH3A 3VAFA 4QBUA 3AJDA 3QQCD 3I0RA 1FKOA 4ETXA 3G82B 3AB4B 2E5LF 2AJ2A 2QMUB 4FYVB 1XNQF 2V5HG 2G1DA 1J5OA 2OPSB 1NEEA 2R2RA 3DLKB 3D54A 3UDCA 2FYXA 5J2PB 2JVOA 1S6OA 4Z7CA 4Y2AA 3T9ZA 2BE7D 5F0WA 1N33J 4URQU 1OY9A 4OI6A 2KT3A 3QIPA 1QVGR 1QSSA 2C2DA 3TJ8A 4ED3A 4NOHA 4FXWA 2VFUA 1U6BA 2CQHA 2J9DE 5G4DA 3SQOP 4TXSA 4DDFA 3BGUA 1YG0A 1D3WA 3NNHA 3PYFA 5ETTA 1ZZFA 4DL4A 4U8VA 3KG1A 2VBZA 4DFKA 5B7WA 3IS9A 4DV5F 3R97A 4K4WA 5HK4A 3UPFA 1QDUB 4XAKA 3HHDA 3KLHB 2NZ4A 3F56A 2Q43A 3GIIA 3LGNA 1MN7A 1UZHA 4JBCA 5M2UA 1N0UA 4K5RA 2FJDB 5KFJA 3OR1B 2R2TA 2CYYA 2AP6A 4KC5A 2XY6A 2CG8A 5J2NA 5L1KA 3MEGB 1T11A 2FHJD 3C8YA 3Q83A 1K47A 1C0TA 2YKMB 2NXEA 4DCJB 2NXJA 1S76D 3C6TA 1IWAA 5AXMA 3OHAA 3TX8A 5FDLA 4ZN1A 2J9CA 1WC1A 5E33A 5KFWA 3DOKB 4ZA1A 2CQ1A 3DNCA 4ALZA 1FI4A 2CQIA 3ZZTA 1NRKA 4LSZB 4OHWA 4QWEA 3SQGA 1U1KA 2JDJA 3UDEA 1G6BA 2BRKA 2HMIA 1J2VA 1B3TA 3T1HF 2A6OA 4LREA 2PI4A 1B4SA 2BRLA 2XMTA 1LW0B 1KQKA 4DUTA 4RBUA 3VGSA 4X4TA 3SSRA 2HHQA 2XO6A 1UEVA 1RWXB 1R8HA 2ZVIA 2AWZA 4B3RF 2KM8B
chains in the Genus database with same CATH topology
3ETMA 1HLWA 1S57A 3VGVA 3EE3A 2B8PA 3ZTQA 3BBFA 4HR2A 3EM1A 2B8QA 2BX6A 3JS9A 1JXVA 1NLKL 1MN7A 2ZUAA 3DDIA 3Q86A 2DXEA 3BBCA 5CAAA 3NGTA 1UCNA 3EVMA 3VVTA 1B99A 3FBBA 1HHQA 3FCVA 1F6TA 4EK2A 4F36A 4ANEA 1VYAA 1NDKA 3NGRA 3NGSA 3EICA 1NSPA 3FBCA 3Q8YA 3B54A 4CP5A 3PRVA 1KDNA 2BEFA 1K44A 3EJMA 3Q83A 1HIYA 4KPCA 1W7WA 2DYAA 3Q8VA 3FBEA 1LWXA 1NSQA 4ENOA 3G2XA 4UOFA 4W98A 1F3FA 3VVUA 2NCKL 4ANCA 4DI6A 4FKXA 2DY9A 4FKYA 2DXDA 3ZTOA 1NCLA 1NDLA 4DZ6A 3FC9A 3FBFA 3EVOA 5C7PA 2AZ1A 2HVEA 1WKLA 1ZS6A 1EHWA 1BUXA 1PAEX 1MN9A 1NHKL 1WKJA 1WKKA 1NPKA 3B6BA 3ENAA 2CWKA 1NDCA 1NDPA 4UOGA 5CABA 3EMTA 1NSKL 3R9LA 3BH7B 1BE4A 1XIQA 1NUEA 3GP9A 5IOLA 1S5ZA 4F4AA 3NGUA 4O0NA 3VGTA 1NB2A 1PKUA 4UOHA 3Q8UA 3VGUA 1B4SA 3ELHA 4C6AA 5BXIA 3BBBA 3FCWA 4S0MA 3ZTPA 3GPAA 4DUTA 3WX8A 3ZTSA 3VGSA 2DXFA 1BHNA 4ANDA 3BH6B 3PJ9A 1U8WA 2HVDA 1LEOA 3ZTRA 2HURA 2AZ3A 3FKBA 4WBFA 3L7UA 1XQIA 3DKDA 3Q89A 1S59A 3MPDA 3EVWA 2VU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ETM A;  1HLW A;  1S57 A;  3VGV A;  3EE3 A;  2B8P A;  3ZTQ A;  3BBF A;  4HR2 A;  3EM1 A;  2B8Q A;  2BX6 A;  3JS9 A;  1JXV A;  1NLK L;  1MN7 A;  2ZUA A;  3DDI A;  3Q86 A;  2DXE A;  3BBC A;  5CAA A;  3NGT A;  1UCN A;  3EVM A;  3VVT A;  1B99 A;  3FBB A;  1HHQ A;  3FCV A;  1F6T A;  4EK2 A;  4F36 A;  4ANE A;  1VYA A;  1NDK A;  3NGR A;  3NGS A;  3EIC A;  1NSP A;  3FBC A;  3Q8Y A;  3B54 A;  4CP5 A;  3PRV A;  1KDN A;  2BEF A;  1K44 A;  3EJM A;  3Q83 A;  1HIY A;  4KPC A;  1W7W A;  2DYA A;  3Q8V A;  3FBE A;  1LWX A;  1NSQ A;  4ENO A;  3G2X A;  4UOF A;  4W98 A;  1F3F A;  3VVU A;  2NCK L;  4ANC A;  4DI6 A;  4FKX A;  2DY9 A;  4FKY A;  2DXD A;  3ZTO A;  1NCL A;  1NDL A;  4DZ6 A;  3FC9 A;  3FBF A;  3EVO A;  5C7P A;  2AZ1 A;  2HVE A;  1WKL A;  1ZS6 A;  1EHW A;  1BUX A;  1PAE X;  1MN9 A;  1NHK L;  1WKJ A;  1WKK A;  1NPK A;  3B6B A;  3ENA A;  2CWK A;  1NDC A;  1NDP A;  4UOG A;  5CAB A;  3EMT A;  1NSK L;  3R9L A;  3BH7 B;  1BE4 A;  1XIQ A;  1NUE A;  3GP9 A;  5IOL A;  1S5Z A;  4F4A A;  3NGU A;  4O0N A;  3VGT A;  1NB2 A;  1PKU A;  4UOH A;  3Q8U A;  3VGU A;  1B4S A;  3ELH A;  4C6A A;  5BXI A;  3BBB A;  3FCW A;  4S0M A;  3ZTP A;  3GPA A;  4DUT A;  3WX8 A;  3ZTS A;  3VGS A;  2DXF A;  1BHN A;  4AND A;  3BH6 B;  3PJ9 A;  1U8W A;  2HVD A;  1LEO A;  3ZTR A;  2HUR A;  2AZ3 A;  3FKB A;  4WBF A;  3L7U A;  1XQI A;  3DKD A;  3Q89 A;  1S59 A;  3MPD A;  3EVW A;  2VU5 A; 
#chains in the Genus database with same CATH topology
 2NUH A;  4ZIW A;  2BX6 A;  4ILR A;  3J80 U;  3LQV A;  3GWC A;  3E2E A;  1HHQ A;  1S1W A;  2YQ0 A;  3GU0 A;  1JLE A;  1Q79 A;  1KTQ A;  2F40 A;  3TUP A;  3OLB A;  1NSQ A;  3KLF A;  2CJX B;  4O0I A;  2CDQ A;  4L6V 3;  3BQ1 A;  1ZZN A;  3H5U A;  1SIW B;  5D0H A;  3W9J A;  1OPI A;  3FBF A;  2HQG A;  2CG4 A;  4FP9 A;  1NK0 A;  4K0K F;  2FY1 A;  2AHO B;  2YPY A;  5E3A A;  1DRZ A;  3BH7 B;  4WTY A;  2NPI A;  1D9D A;  2AYG A;  2J0Q D;  3KLE B;  3I6P A;  4WP3 A;  4PKD B;  4NLX A;  2RKI B;  2OPQ B;  3DI6 A;  3ZTR A;  2A6M A;  5EX0 A;  2DH7 A;  2RT3 A;  3C16 B;  5DM6 Q;  2V4J B;  2F8M A;  1GAO A;  3JS9 A;  5F8J A;  2MQO A;  4Y2C A;  1KEK A;  4LT6 A;  2E5G A;  2HS0 A;  3IR7 B;  4TVA B;  1B99 A;  2WSC C;  2GAG C;  2AGQ A;  1DZ5 A;  2MEW A;  4P72 A;  4B3T F;  1IKX B;  1YJU A;  2HNY B;  5D8H B;  1K44 A;  1F3V A;  1VQ8 S;  3FZ2 A;  3M1V B;  3CJR A;  3QJL A;  2R7Q A;  4ZKA A;  2QLJ B;  1MWZ A;  3IRX B;  1V6H A;  2FDN A;  2HFU A;  4XTT A;  2OUG A;  3PDN A;  4JI7 J;  1TV6 A;  2HHU A;  4MMO A;  1NH7 A;  5ETN A;  5C2G A;  1WHW A;  2DT9 A;  3M8Q B;  1RTH B;  3EZO A;  3MPV A;  2HKE A;  3T5H A;  5A6W A;  4C8M A;  3C15 A;  5C25 B;  3VAJ A;  4JI3 F;  1HBO B;  2R9L A;  3M6W A;  1H2T Z;  2XB2 D;  4KKO B;  2ILZ A;  2YWW A;  3NG8 A;  2C3O A;  1UWB B;  5DG7 A;  5CQG A;  1ROF A;  1CUL A;  4NRU A;  1RK8 A;  1M0S A;  3KJN B;  2WW4 A;  3W9H A;  2YQ3 A;  5K8P A;  4IKA A;  1OO0 B;  5AE1 A;  3LWM A;  2ALY B;  3A8K A;  3TAM A;  2J7U A;  3CJQ A;  2ALZ A;  4CP5 A;  1SV5 A;  1X5P A;  1YZ6 A;  3DMJ A;  4QR1 A;  4N7T A;  3MEE A;  4A4J A;  3EPG A;  4TKT A;  1TL3 A;  4CO5 A;  3CDB A;  2C1E B;  1MN9 A;  1R89 A;  1JKH A;  3PW4 A;  1XNR F;  5KFP A;  3R9L A;  3L95 X;  3UNG C;  3T1H J;  1RTJ B;  2RIL A;  2FY8 A;  1FTC A;  3B4M A;  3GP9 A;  2V8G A;  1TZ0 A;  2GX8 A;  4OYI A;  1VRT A;  2ROG A;  1WC0 A;  4B08 A;  4CDI A;  3LGM A;  3PX6 A;  2EFQ A;  4NAS A;  1FRK A;  5LJ3 Y;  1F5B A;  2YNH A;  4B3R J;  2CKW A;  5DDQ C;  3HT0 A;  2XYG B;  1J5E F;  2OI2 A;  5CZV A;  3QRQ A;  2ZH2 A;  3Q8R B;  3MM8 A;  3THP A;  2B8Q A;  4Y65 A;  1JXV A;  4JI8 F;  2Q6C A;  5I3U A;  1WOO A;  3I5C A;  2HND A;  1UEU A;  4DS4 A;  3UD3 P;  4TN2 A;  1N5Y A;  1H6K X;  2ZFH A;  4I2Q B;  3JAM Y;  3HM9 A;  3A12 A;  2DGW A;  1Y7P A;  5J2M B;  2FC8 A;  4V19 J;  1HI8 A;  2EK1 A;  1GTE A;  3GZ7 A;  2XS7 A;  1ZPV A;  4MYT A;  4MIA A;  1FRI A;  1GH8 A;  4K0K J;  4ED2 A;  2Q66 A;  4M5L A;  5EDW A;  2VG6 B;  2WOM A;  4DQI A;  1WKK A;  1URN A;  4KO0 B;  3MMA B;  3PIO Q;  4YR3 A;  3PHT A;  1Q81 T;  2ASL A;  5C5J A;  3HHL A;  2KFN A;  4NCG A;  1TP7 A;  3HMJ G;  3PYD A;  1OIA A;  4N56 A;  3TYT A;  4JI2 F;  3WDO A;  3CE8 A;  2B51 A;  3V5R A;  2GJF A;  1PYO B;  5F8M A;  4ZPC A;  4DR1 F;  2ZH3 A;  4FF1 A;  4DEZ A;  1KD1 T;  3PEH A;  5EWE A;  4Q45 A;  2C22 A;  5E3P A;  3UCG A;  1M5P C;  4RW7 B;  1KOH A;  4KR0 B;  2V2V A;  4F4Z A;  3H42 A;  4F36 A;  1TFW A;  3NGR A;  3CCV S;  2DRD A;  4LBH A;  2BJE A;  2GHV C;  5GMK a;  1C0U A;  3E8O A;  3IFE A;  3NEK A;  4MFB B;  1Y10 A;  3NOG A;  4LRF A;  3DC2 A;  4DPW A;  2MKJ A;  1UVI A;  3CCR S;  2V8P A;  2AW0 A;  2XWY A;  1WOR A;  2WON B;  3I4P A;  2UP1 A;  4JI3 J;  3TAP A;  1L3S A;  1WOS A;  1EZZ B;  3GTY X;  3NBP B;  4WII A;  1NZA A;  5IM0 B;  3UWT A;  4PG6 A;  4X64 F;  3QGP A;  3D9B A;  3QO9 B;  1VRU B;  1HD1 A;  2IAJ A;  2KO1 A;  4ZIV A;  2HRT A;  3HHN B;  1GXT A;  4GVB A;  4KIA A;  2OD4 A;  1IR0 A;  4DQP A;  1VQK S;  2VOD A;  4DR7 F;  2F5G A;  4URG A;  3I82 A;  5SZT A;  2EK6 A;  4DPY A;  4QR2 A;  1JXE A;  2OJ3 A;  2BUN A;  1RA6 A;  4PAA A;  2P6T A;  4X4N A;  2J76 E;  2EFV A;  1NKC A;  5F8G A;  2AGO A;  3QNW B;  1RP5 A;  4P2X A;  1XEZ A;  2H9Z A;  2W01 A;  4QPX A;  3LP1 B;  3W5Z A;  3JQJ A;  5FJ4 A;  4U95 A;  5SUH A;  2IRU A;  4JV5 F;  3BYP A;  4QYR A;  2I9S A;  1X5S A;  4HHU A;  4ZVH A;  1R3N A;  1XNR J;  2XMJ A;  1NHK L;  2KXF A;  1F1B B;  3PTW A;  4IFV B;  1FVS A;  4I6Y A;  5HO4 A;  4JI5 F;  1WDT A;  5L46 A;  1S9G B;  2PT0 A;  4ZHR A;  2KI2 A;  4IFY A;  7FDR A;  2V50 A;  2ZIT A;  4RZR A;  3SCK E;  2QE5 A;  3UN2 A;  3G6Y A;  3OUY A;  3SV4 A;  1FWK A;  2DO4 A;  1N34 F;  1IKY A;  2H51 B;  2X51 A;  4GKJ F;  4A8F A;  1LK5 A;  1HAR A;  3GJR B;  3AB2 B;  1PC5 A;  2BM1 A;  1U4B A;  3V6D B;  1D0E A;  4RW9 A;  4FF2 A;  1RAI B;  1R0B G;  4ETZ A;  3QFH A;  4OFZ A;  1FE0 A;  2DXE A;  5ETS A;  3LAK A;  3KLG A;  3H20 A;  3CJ4 A;  4OYZ A;  3N01 A;  1TKZ A;  2PMZ D;  4X65 J;  5IV3 A;  4OQJ A;  2UXD J;  1SCJ B;  2XS5 A;  1I51 B;  5IT0 A;  1EAR A;  2UUC F;  3BRE A;  3H40 A;  1TVR B;  2XGP A;  1F2G A;  1X5T A;  2BKO A;  5E7O B;  4TYB A;  4RNO A;  3JTO A;  1ZM4 A;  1QJH A;  2YKP A;  3IM9 A;  2UXB F;  2N7C A;  4YY3 J;  3RR7 A;  1F5A A;  3BSA A;  4CNZ A;  2ZH7 A;  3KUH A;  3DDN A;  3I0S A;  1XMO F;  4DSJ A;  2GC8 A;  4EZ6 A;  2A2C A;  3N6M A;  3MCS A;  5CD4 H;  3X1L B;  1Q53 A;  1UJ6 A;  1VLO A;  3KDN A;  4DR1 J;  1FEE A;  2VIH A;  2VB6 A;  1Q95 G;  1VI7 A;  3C46 A;  3CSK A;  2V2Z A;  1FTR A;  1HHT P;  1HHS A;  4J90 A;  3E3X A;  3I56 S;  2U2F A;  2QSW A;  2F65 A;  3ETO A;  2GS8 A;  1HWJ A;  1TR0 A;  4KTQ A;  1NND A;  4DG1 B;  1GFW B;  4O3O A;  3K59 A;  1ZA2 B;  3HHE A;  4I7F B;  2ZM6 F;  2E7V A;  4RNF A;  4DHV A;  3M30 B;  1KVK A;  2CQG A;  3DGP B;  3TZZ A;  2VBY A;  3BDE A;  1RWM B;  1M5H A;  4LRB A;  3B54 A;  5KFB A;  4CH7 A;  4LIW A;  2KN4 A;  2AJ0 A;  2D74 B;  3DFE A;  1SKR A;  3UE2 A;  3FEZ A;  1BD6 A;  3KJV B;  3BGO P;  4M5D A;  2K06 A;  2LEA A;  3TWZ A;  3VAG A;  1DLO B;  2LYV A;  1WSR A;  4RUH A;  3HHL C;  2KTQ A;  1SJR A;  1REV A;  2HFO A;  1TUV A;  1VLY A;  2CQB A;  4U7U D;  4TY8 B;  2ATC B;  2GFF A;  4X64 J;  4C9D A;  1NHV A;  1VQ7 S;  2YBV A;  1WJ9 A;  3QT8 A;  4PWD A;  1VHF A;  1XN9 A;  4DR4 F;  4UUW A;  3PEJ A;  5ETQ A;  3R6G B;  3NRB A;  3M2V B;  4LFC F;  1OQ6 A;  1YSJ A;  3B8H A;  1GX5 A;  5J2Q B;  4M94 A;  1SJ3 P;  3M2R B;  5GAE U;  1NPP A;  1T02 A;  2FJB B;  3HFV A;  2ZBQ A;  5HVF A;  2B0G A;  3IAM 9;  1RT7 B;  2FZG B;  1V5I B;  3D5M A;  2FLN A;  1EAY C;  4NA1 A;  5LM7 E;  4USI A;  4UST A;  2HW3 A;  3BPD A;  5D15 A;  3OSP A;  4OMF G;  3Q8Y A;  3UQS A;  4IR9 A;  5C42 B;  4JV5 J;  2FVC A;  3AT1 B;  5DM7 Q;  4DPO A;  2ZH8 A;  1C1B A;  1T05 A;  1YIT S;  1L3U A;  1WC3 A;  4DXL A;  6AT1 B;  1T03 B;  3B82 A;  2OPP A;  2XYP B;  2YH1 A;  3H2U B;  1K1Q A;  1IKW B;  1RWK B;  3FK4 A;  4AL6 A;  4OZ0 A;  5B0F A;  2KJW A;  4DSK A;  2X1G A;  4F4X A;  2JJ4 D;  4ID8 A;  3FFI A;  2UZA A;  3CCW A;  4RUB A;  2KRR A;  2VFR A;  1KWM A;  3CUN A;  4YB5 A;  2CVI A;  4I0W A;  2WVB A;  4X4R A;  1N34 J;  3UFC X;  4ZPD A;  4M8L A;  1Z2Z A;  1YI2 S;  1VQY A;  1N0V C;  1JIH A;  1FNM A;  1ZAV A;  2ZC4 A;  1N6Q B;  4TU8 A;  3G82 A;  3CUL A;  5ETK A;  4Y3C A;  4LF5 F;  3LW5 C;  2J6T A;  4J9L A;  2OPS A;  4DU7 A;  1R8P A;  2G4B A;  4QOT A;  5AXL A;  3DLK A;  2J6S A;  4NML A;  1S1X B;  2LCW A;  3OVA A;  1M5O C;  5HLF B;  3W2V B;  1BXN A;  1LK7 A;  5J2P A;  5E3Q A;  5F3Z A;  1K0T A;  4DFP A;  4AQY F;  1RCX B;  3EGW B;  1U47 A;  3OFF A;  2DIT A;  1U8S A;  3PCO B;  1U7L A;  4FS1 A;  2ZC3 A;  3QLH B;  1KVJ A;  1HBU B;  2LEC A;  2WAQ D;  1LFP A;  1XR6 A;  2BAN B;  2CWK A;  5HP1 B;  1YTY A;  2AU0 A;  4FS2 A;  2AD9 A;  1WOP A;  4P74 A;  2XZT B;  1QSY A;  5KFX A;  5KT4 A;  4HAC B;  2XLI A;  1ICE B;  1RGV A;  1HQE B;  5L9N A;  2GAH C;  3PYG A;  4PPZ A;  3LAM A;  2QLB B;  2M0G B;  3N28 A;  4TLQ A;  3KLH A;  2XLK A;  5M2P A;  2O67 A;  2VPZ B;  4CYU B;  2MSS A;  1RWU A;  2C2M B;  1EP4 B;  4PG4 A;  2IDE A;  1WDD A;  3OR1 A;  3WZ0 A;  3M8R A;  3R7S B;  3QT6 A;  5KFG A;  2CRL A;  3BZQ A;  4FF3 A;  2P5V A;  3MEG A;  3ILJ A;  4R5P B;  3SSQ A;  5H9E K;  2YKM A;  4O4R A;  4WPA A;  4NLD A;  4WXO A;  2W4D A;  2JX2 A;  1EHW A;  5G0R B;  2HK3 A;  3ULH A;  3IO1 A;  4PCQ A;  4KQZ A;  2GVZ A;  3PW5 A;  3DOK A;  2MQ8 A;  4DR4 J;  2F1F A;  4H4K A;  1VDH A;  3FSX A;  4LFC J;  1WUU A;  2GIF A;  3FNN A;  4MKB A;  2K2P A;  3GJT B;  2KB2 A;  4F4Y A;  4L3K A;  1NAQ A;  1LW0 A;  1U26 A;  3N9U C;  2QL9 B;  3T41 A;  1H7W A;  4P7V A;  4UOC A;  3Q2S C;  2ZBI A;  4F67 A;  2AJ1 A;  2BJ9 A;  1RBA A;  2W2M P;  3ZFV A;  5KOW A;  4CO2 A;  1ZA1 B;  4CZC A;  1GEH A;  1CSJ A;  2FUG 9;  2G13 A;  4L73 A;  3C6U B;  5B0B A;  1FNX H;  5H9E J;  2BQR A;  4ANC A;  2P8I A;  5A8R B;  4FKX A;  4DX6 A;  5LMN F;  4WU2 A;  1FO1 A;  2HHX A;  5IV4 A;  3RAX A;  1TL5 A;  3O44 A;  3CJ8 A;  4HHH A;  2N3L A;  4UOG A;  5HMZ A;  4DR2 J;  2YVS A;  2OIH A;  5CCM A;  3L3C A;  2UUB J;  2JWN A;  1FNO A;  2HGN A;  2KL8 A;  2O3D A;  2B4P A;  4ZCI A;  2Y1L B;  2DXF A;  3QAE A;  3KLE A;  3PFE A;  1ZTT A;  1JJH A;  2GNK A;  4OJH A;  2R8K A;  1LOU A;  3CME S;  1CC8 A;  3KYL A;  2RKI A;  4C7Q A;  2OPQ A;  4LF5 J;  1RWN B;  2ZBC A;  4DR5 F;  3WIU A;  4NLP A;  1N8R T;  3C16 A;  4LQ3 A;  2V4J A;  3L9Z A;  4QPT A;  2BA9 A;  4DSI A;  5B0A A;  4NYO A;  4F04 B;  3PW0 A;  2YKQ A;  4EBC A;  3VQT A;  5HRO B;  4AQY J;  1P9Y A;  3KTQ A;  5KTQ A;  4AT1 B;  3E51 A;  3ENV A;  1KDN A;  1O8B A;  1IKX A;  1I3O B;  2HNY A;  4Y34 A;  2JSX A;  3G8Q A;  3M1V A;  2F9J A;  3PX4 A;  1F9H A;  5KOX A;  4Y28 C;  4J9V A;  3NP5 A;  3IRX A;  1M90 T;  3B6B A;  1BQN B;  2J8S A;  2CJQ A;  2R42 A;  2MMY A;  5LSO A;  1YX2 A;  2UUW A;  3SEO A;  3BO2 A;  4NI2 B;  1RIS A;  1WG1 A;  3M8Q A;  4MJK A;  3SFG A;  1RTH A;  5U47 A;  4CI0 B;  5C25 A;  1HBO A;  3ELH A;  4HT5 A;  2R2S A;  4KKO A;  2V8D A;  3AOA A;  1UWB A;  4WE1 B;  4KGZ B;  1SQE A;  4WTO B;  4PYD A;  3K8W A;  4ZVR B;  3A3N B;  4XK8 C;  3S7R A;  1YRT A;  1JLB B;  1ZBT A;  3WC0 A;  3RBD A;  3MAA B;  4B3O B;  1FDB A;  3IWX A;  4NPO A;  2RDJ A;  5ITH A;  2AIR B;  1Q8B A;  4QU6 A;  4PRF A;  3M8P B;  4W98 A;  4ATN A;  1TKT B;  1U1Q A;  1RJJ A;  3VQS A;  3K17 A;  4X4P A;  4USV A;  2JOQ A;  2POK A;  1WF1 A;  1N88 A;  2GJ2 A;  4B3S J;  1VQL S;  4ZP7 A;  1NK7 A;  2W2O P;  5ETP A;  1W2I A;  1RXO B;  2CPE A;  2DGX A;  4Q7A A;  3CIZ A;  4B9V A;  1RTJ A;  4M5G A;  1MRO B;  3BF4 A;  4G3I A;  4C8Z A;  2OFH X;  2WK4 A;  3W66 A;  2RRA A;  3IWL A;  2MGZ B;  3PJ9 A;  1B0P A;  3VR1 A;  2K3I A;  1QE1 B;  2WTF A;  4HTJ A;  5KFI A;  4ZVG A;  1W2B R;  2VG7 B;  1OS5 A;  1X8D A;  2W2N P;  3OXL A;  3QT7 A;  4NX9 A;  3T6J A;  3AHP A;  2V8H A;  3CNQ P;  4Q5V A;  2PFD A;  3OLA A;  1K73 T;  2RD5 C;  2KKH A;  4P2F A;  2XSJ B;  1GNK A;  4C0O C;  1TEL A;  4I2Q A;  4FYD A;  4ED8 A;  1HNX F;  5J2M A;  4CIO A;  1YVF A;  3BKU A;  5LMN J;  3NS7 B;  1IUJ A;  4UZB A;  3BQ2 A;  1PG5 B;  3QGG A;  4RO0 A;  3MF5 A;  3TP2 A;  4GRS A;  4ZP6 A;  1FFW B;  1X9S A;  2RVJ A;  4MKA A;  2XS2 A;  4IUF A;  2EW9 A;  2VG6 A;  4EYH B;  1PC4 A;  2MZR A;  1QAJ A;  4Y00 A;  4H4K C;  4KO0 A;  3MMA A;  4TQR A;  4DBQ A;  1R43 A;  2BJD A;  2BVZ A;  5CXT A;  4CLW A;  1O51 A;  2AX0 A;  1N56 A;  1TKD A;  1NO8 A;  2MB0 B;  4J9Q A;  2KM8 C;  1HNI B;  2LU2 A;  2HLT A;  3D7S B;  2XSF A;  2V4R A;  3M8S A;  1SI9 A;  1LWF B;  2HAI A;  5KFZ A;  5LXR A;  1WWH A;  4OZL A;  3A8I A;  2GO8 A;  4RW7 A;  2CJK A;  3MM6 B;  1N32 F;  4FNI A;  3IR6 B;  3HI9 A;  1X0P A;  4HDG A;  3MD1 A;  3W8G A;  2VC0 A;  1P8G A;  1SL2 A;  4P2M A;  4MFB A;  5AT1 B;  1KVI A;  1T9X A;  3EGN A;  2BW2 A;  3I31 A;  4DV7 F;  2UVW A;  3G86 A;  1U1P A;  5D4P A;  4I6A A;  2WON A;  5HBM B;  5KT5 A;  4YHH F;  3RAM A;  3D2W A;  2ZBR A;  4HEA 9;  1WAC A;  1BQM B;  4D3G A;  2ZH5 A;  4QIF A;  4WFB Q;  3NBP A;  2NXC A;  4CH1 A;  5KG7 A;  5IM0 A;  4RBV A;  2CNL B;  2Y0S D;  3QO9 A;  1VRU A;  1SIZ A;  1Z4U A;  4ITS A;  4U9R A;  4P7T A;  3DRR B;  2HBZ B;  1KLM B;  3LTO A;  5D77 A;  1RBO B;  1S1V B;  1H73 A;  3ADA C;  2L9D A;  3HXM A;  2EFP A;  1SXL A;  1YIJ S;  3RB0 A;  3BJY A;  3AOD A;  2WZ1 A;  2A3J A;  4HI2 A;  3NCP A;  3OR2 B;  4ZJO A;  4ZCM A;  4IQX A;  1RAA B;  5FII A;  2VPX B;  5A8W B;  2BKP A;  3LP1 A;  4B3M F;  2PI5 A;  4FKY A;  4OHZ A;  4ZPB A;  1WKL A;  4KV8 B;  3PKM A;  5A0Y B;  3T1Y F;  3U02 A;  3RB6 A;  3RR8 A;  1RAE B;  4IYQ A;  5D78 A;  2CZV C;  3TRG A;  4LSL B;  2PA3 A;  4IFV A;  2E44 A;  4A47 A;  4FF4 A;  1S9G A;  1Q0N A;  3J7A 1;  1G4C A;  3VCD A;  1RHQ B;  2KZZ A;  2VG5 B;  4MYU A;  5KFC A;  2OPR B;  1C4A A;  1T0T V;  3BH6 B;  2FZK B;  1JX4 A;  3FZB A;  1HKA A;  3MPD A;  4DL6 A;  1UAW A;  3G4S S;  4XDC A;  3V6D A;  1V5V A;  4W4M A;  1SH3 A;  4AFF A;  1AFI A;  4DR6 J;  3VAL A;  1S12 A;  5LMU J;  3FBB A;  3ZZP A;  1S0N A;  2GO9 A;  1HNX J;  4ZJQ A;  1VMB A;  4DQS A;  2E1R A;  1SJ4 P;  2CJA A;  2V0N A;  2RIJ A;  1HIY A;  2Y0B B;  1N5T A;  3IM8 A;  4L76 A;  1TVR A;  2I38 A;  4UOF A;  1NK4 A;  1NM2 A;  1X4D A;  1OPZ A;  4P73 A;  3FC9 A;  2ZZT A;  3MM7 B;  2WB4 A;  1SL0 A;  3BO3 A;  2MKI A;  4RW8 B;  1NPK A;  3PG9 A;  4FVC A;  5E3C A;  2AEJ A;  2VON A;  2MKK A;  4E8U A;  2ADC A;  1RT4 B;  2PMW A;  3VGU A;  1VRQ C;  1RWV B;  3W1Y C;  4DV0 J;  3CDU A;  4IOB A;  4WFA Q;  2LDY A;  3CC4 S;  3CIM A;  4CT9 A;  1SVD A;  4WZQ A;  2E7X A;  2LQB A;  3MM5 B;  1KP6 A;  2W8K A;  3OFE A;  3R3T A;  4O3N A;  4DG1 A;  4W92 B;  4NLY A;  5KG3 A;  4I7F A;  4FN5 A;  4DU8 A;  2EC2 A;  2UVU A;  4XIU A;  5HL7 Q;  3J7Z 5;  3DYA B;  3M30 A;  2EXU A;  2KYZ A;  3K5N A;  1RZM A;  1NK8 A;  3DGP A;  2XMK A;  4DQR A;  3W5X A;  4ZLN A;  3FBE A;  1VGY A;  3ICL A;  1VCT A;  1G7C B;  2VOO A;  3IGN A;  4LQ9 A;  4EYI B;  3TUJ C;  3KJV A;  2CQ3 A;  4YHH J;  3AA8 A;  2YNI B;  1DLO A;  2GVD B;  5KFD A;  2E9Z A;  2UV8 G;  5GME A;  1R6V A;  4YME A;  2NSB A;  3BS9 A;  1ZET A;  1RHM B;  1PJ6 A;  4TY8 A;  3RAQ A;  5GMD A;  2K7K A;  3ZZU A;  2BJ8 A;  1UFW A;  4IH5 A;  3IWN C;  3UCU P;  4ZIT A;  3M2V A;  1EIY B;  2UVV A;  1UZD A;  2FC9 A;  5HMX A;  2BQ3 A;  2DR9 A;  3W64 A;  1HLW A;  1GTH A;  3JB9 k;  2JRS A;  2RF2 B;  3SXL A;  4PG7 A;  3M2R A;  3KK2 B;  3U1N A;  3NGK A;  4EUV A;  4LR9 A;  3TA1 A;  2JEG A;  1RT7 A;  4OX7 A;  2NYH A;  4ANE A;  2PO4 A;  1PJ5 A;  3PR5 B;  1MU2 B;  2J8A A;  5AJ3 F;  2FGO A;  2HGL A;  2QLW A;  3H25 A;  1RA7 A;  4FDF A;  3RJM B;  5C42 A;  4LIR A;  3TVY A;  1M1G A;  3T1Y J;  2MQN A;  2V2K A;  3J7A N;  3US5 A;  2UUA J;  1T03 A;  3E01 B;  1AUD A;  4JYA J;  3TUI C;  1UPP A;  1IKW A;  1D09 B;  1JLC B;  1NSK L;  1ZM3 A;  3CT9 A;  4KFB B;  1RKJ A;  5KT2 A;  5K8O A;  5KG1 A;  2G0I A;  4A8M P;  3HO1 A;  6FDR A;  5LT5 A;  3PO4 A;  4M63 A;  3KHH A;  1DAR A;  4PQU B;  1OSC A;  3QSY B;  4LRD A;  1WC6 A;  2XZD B;  4JOU A;  5KT7 A;  5CA5 A;  1TL7 B;  1S4E A;  4YDD B;  2UU9 F;  2CQD A;  4USU A;  1N6Q A;  1HD0 A;  4WKR A;  2Y3Y A;  8RUC A;  1UET A;  3FQL A;  2PII A;  4PXC A;  1RT3 B;  2DB1 A;  2CWX A;  2O01 C;  3I32 A;  4OI3 A;  3BGR B;  1GK8 A;  3D0G E;  3CCJ S;  1S1X A;  4KPC A;  2HRY A;  2J5A A;  5HLF A;  3W2V A;  3K57 A;  3G8S A;  2VV5 A;  1VC0 A;  2XHC A;  2ACY A;  4JI1 F;  1VFJ A;  1RTD B;  1HNV B;  4MT1 A;  2DKO B;  2R7O A;  3CJ2 A;  1OWX A;  1RAJ A;  1PCA A;  3BR9 A;  1QUP A;  3QLH A;  1HBU A;  4P71 A;  1H0H B;  2CPZ A;  3CJ5 A;  2QO3 A;  1XR5 A;  2BAN A;  5HP1 A;  2RQK A;  1MML A;  3LPE A;  1ITP A;  4KHM A;  2AJQ A;  5EWF A;  1HR0 F;  1EET B;  1YJ7 A;  1OYD A;  4CM2 A;  4MKV A;  2V2Q A;  4ZS6 A;  4HAC A;  4ED5 A;  4C0H A;  2C3Y A;  1YQH A;  1HQE A;  3ZXW A;  2WSE C;  2XMW A;  3RRG A;  1X4C A;  3MMB B;  2K8G A;  3LP0 B;  2QTW A;  4Q2L A;  4RX6 A;  3DDI A;  1TK0 A;  1JXL A;  4RW4 B;  1HI0 P;  1S1U B;  2FJV A;  3R5B A;  4CYU A;  4WU3 A;  5CH7 B;  1G1X A;  1EP4 A;  2XTJ P;  2MYF A;  3PR4 A;  4NXM F;  5BR8 J;  3OBI A;  5AXK A;  1AFJ A;  4OLP A;  2H5I B;  2W2Q P;  3HK2 A;  4R5P A;  3H0P A;  2DXD A;  1HWL A;  4DZ6 A;  3AD7 C;  1HYS B;  4ES2 A;  2IYG A;  2A10 A;  5F3T A;  2EI5 A;  2R7U A;  4XPE A;  3MAQ A;  5G0R A;  2AX1 A;  3IP0 A;  2VBX A;  4NZ0 A;  5DS7 A;  2HZV A;  3VAK A;  5BYS A;  3HCX A;  2J7W A;  2ZBP A;  2IM3 A;  1NK5 A;  1HWU A;  3R1L A;  4V19 X;  1U02 A;  1LQ9 A;  1NJZ A;  2IYI A;  4DV6 F;  2B43 A;  5LSL A;  1Q8I A;  2C3P A;  2ZD1 B;  3T1A A;  3OT9 A;  4ECZ A;  1FDA A;  2WB1 D;  3OPK A;  4H54 A;  4TLR A;  4TU9 A;  3TJ9 A;  2V4Q A;  2Q6B A;  2ZH6 A;  2HIY A;  2E5I A;  2XWX A;  1UCN A;  4LF6 F;  3G9C A;  2XBP A;  4NLU A;  4XO0 A;  2DHG A;  4TY9 A;  4IR1 A;  4JV1 A;  4OI0 A;  4ZOS A;  3OTO F;  4GMK A;  2P9G A;  5A8R A;  3H4B A;  2CFX A;  3W61 A;  3KWM A;  1BUX A;  3CC7 S;  2P9C A;  3Q23 A;  1FJE B;  3A8E A;  1SH2 A;  5CAB A;  5I42 B;  2RB7 A;  4DR3 F;  2L41 A;  3HHL D;  1HPZ B;  3DLB A;  1VIS A;  1NB2 A;  1T9Y A;  2V94 A;  4F3Q A;  4C0B A;  2M8D B;  3GSI A;  4Y2K A;  2I1R A;  4X66 J;  3DGV A;  1MMN A;  1RSC A;  4BHQ A;  2CVE A;  2UU9 J;  3VAM A;  2AZ3 A;  1SKW A;  3GB0 A;  1Z1Z A;  1CQM A;  3CD0 A;  3SCL E;  2APO A;  3QAT A;  2J0W A;  5KG2 A;  4A8Q A;  3S8S A;  3GIM A;  5JJB A;  4Q0B B;  2Z2M A;  2ZUA A;  4FBU A;  5C24 B;  5CAA A;  4UQT A;  2Y1I A;  3CVK A;  3A13 A;  1K9M T;  1AXQ A;  5T14 A;  2P6S A;  2IIH A;  2J7K A;  5EHH A;  1HNZ F;  1EJ7 L;  2DNH A;  3TAR A;  1URR A;  1UVK A;  4CTA B;  5HRO A;  3ZZR A;  4Q2M A;  2DD8 S;  4JI1 J;  2ASY A;  4FPR A;  4CLU A;  5CZX A;  4B9N A;  3K0J A;  4IG0 B;  5MAO A;  5L1I A;  2LEB A;  1CG2 A;  1TAU A;  3CD7 A;  2IC3 B;  2LXI A;  1DAX A;  1BQN A;  3RBX A;  2YKA A;  4DX8 H;  4W90 B;  1FCA A;  3F41 A;  3QRP A;  1HR0 J;  5BYQ A;  1U1N A;  4FVM A;  3G71 S;  4NI2 A;  3L4B C;  3W60 A;  2B7C B;  1YJ9 S;  4ECV A;  1S99 A;  1CJT B;  2HS4 A;  4LF7 F;  2Z57 B;  1LXN A;  2YWH A;  4WE1 A;  1S0O A;  4M95 A;  4ZVO B;  4RNM A;  4QWB A;  1U49 A;  3BKT A;  2XUL A;  3TOQ A;  5J1E B;  4TQS A;  3MM9 B;  3DHW C;  2MJN A;  2ZHO A;  4NXM J;  1JLB A;  3FBC A;  1TK8 A;  3OTD A;  5JUM A;  3MAA A;  3J81 Y;  4B3O A;  3R1H A;  1WEL A;  3G2X A;  1HW8 A;  4ID5 B;  1Y5L B;  2DY9 A;  3G8T A;  3M8P A;  2D7S A;  3UR3 C;  5DLF A;  3EVO A;  3UI3 A;  4NXN F;  2GQQ A;  3CCL S;  3WC2 A;  2V8V A;  1RLC L;  4I2P B;  3D68 A;  1VQ4 S;  4DZD A;  2A0F B;  2NXN A;  4DLE A;  1TU0 B;  3W9I A;  4F4K A;  4BDP A;  2MKS A;  2ILY A;  2HPU A;  2GA7 A;  2LQ5 A;  1AT1 B;  4C6A A;  3CCS S;  4DV6 J;  4P9S A;  1MRO A;  3HF5 A;  5D0R A;  1N54 B;  2HVD A;  2MGZ A;  3A3O B;  2VFV A;  1QE1 A;  2N82 B;  3KUG A;  3NWR A;  3MFI A;  3RW7 A;  4QWC A;  5EWG A;  1VC6 A;  1KNZ A;  3QFW A;  2Y9H A;  4DL7 A;  2VG7 A;  4ZLJ A;  2BJ1 A;  1C4C A;  2Z2Z A;  1IJE B;  1S48 A;  2DNL A;  3L7O A;  3H5X A;  2IA0 A;  4JV0 A;  3OTO J;  2GHP A;  4IDK B;  2HNZ B;  2XSJ A;  1VHI A;  3V2U C;  5CYJ A;  5HMW A;  2H4Y B;  4JI0 F;  5B0E A;  2AF6 A;  4DSE A;  1VQM S;  3GIL A;  5DO2 A;  1RTI B;  2ZDO A;  2DR5 A;  1IBL J;  2Y1J A;  1PO6 A;  4BC9 A;  4DR3 J;  1OY6 A;  1PIE A;  2XM3 A;  1DTT B;  2A18 A;  1X4H A;  4C8K A;  1AB8 A;  3OTC A;  4O44 B;  1WSV A;  2R8J A;  3OL8 A;  3P49 B;  4GC7 A;  3SQG B;  2R7R A;  3HT3 A;  2IPO B;  4NWB A;  4EO6 A;  1X4E A;  4OYM A;  5IOL A;  5CYQ B;  5I3P A;  1HNI A;  2AKW B;  1FJ7 A;  4M5J A;  1JLF B;  4DV4 J;  5IWA J;  3O2I A;  4U7U K;  5HI7 A;  4OX8 A;  1U2C A;  1LWF A;  3QZ8 A;  1HNZ J;  3VVT A;  1R8C A;  4CM0 A;  1S7H A;  1Y9O A;  2E29 A;  3EXY A;  1FJG F;  3GON A;  1OY8 A;  2QYC A;  3KOA A;  4K4T A;  4F0K A;  4NLO A;  4CNY A;  3MM6 A;  3MZI A;  2HYI B;  3GLJ A;  3OFG A;  4NLV A;  3UN3 A;  3BKF A;  2DGU A;  3ILI A;  1VIO A;  2M2B A;  1R0C B;  6FD1 A;  1EX8 A;  1NJI T;  3RGI A;  3HHK A;  1OMS A;  2PDA A;  1X9M A;  3BGF A;  3BSC A;  3SV3 A;  1FRH A;  2B9X A;  1AZS B;  4X2B A;  2LDI A;  4RBT A;  2ROE A;  5HBM A;  1ACM B;  3PYE A;  2VOP A;  2ZZM A;  4D3H A;  2XMU A;  5THW A;  1BQM A;  4M5N A;  3ISN C;  3PKY A;  2CJY B;  3ISZ A;  4LUB A;  3KUE A;  2YY3 A;  1CLF A;  3J7Y I;  1S9F A;  2XY7 A;  1Y3K A;  1NZ8 A;  3UD4 P;  3KNA A;  3DRR A;  1KLM A;  1IR2 A;  2IM1 A;  3MWB A;  4LFA J;  4AE5 A;  1WD6 A;  1RU1 A;  1S1V A;  3GYG A;  3HPO A;  3IMQ J;  4KY3 A;  4DL2 A;  1FRL A;  1QUV A;  3I5A A;  5D6G A;  2KG0 A;  3M9O B;  4ED1 A;  1DUR A;  1VS3 A;  3OR2 A;  2E1M C;  1KHV A;  2FD2 A;  3QSI A;  3BN4 A;  4DI6 A;  4RU9 A;  4NXN J;  5A8W A;  3TX0 A;  4DX7 A;  3VZH A;  1NDL A;  4NEZ A;  3TA2 A;  2DPJ A;  1N36 F;  2F3J A;  4KV8 A;  5A0Y A;  2DY1 A;  2E5L J;  2EG1 A;  2AYM A;  2JH3 A;  3IBC B;  4LSL A;  1Y3J A;  1XNQ J;  1GMW A;  2OHD A;  4U96 A;  2K7J A;  3NKY A;  2LA4 A;  1FRM A;  5GAD I;  4CCH A;  4QW8 A;  5F41 A;  2O66 A;  2VG5 A;  3GIK A;  2OPR A;  1IBM F;  2PA8 D;  4J37 A;  3UDL A;  4R0E A;  2N7Y A;  1XQI A;  3A1Y G;  1B7Y B;  2WVD A;  3BR8 A;  1YBT A;  2DPI A;  3M9M B;  3THV A;  3MOJ B;  2NXU A;  1FE4 A;  2HEK A;  2HHP A;  5DZ7 A;  4LVO P;  1FEH A;  3NGS A;  2I2Y A;  1T8E A;  4A46 A;  1YK9 A;  4YB1 P;  1W25 A;  2XCP A;  2BZ2 A;  3BDP A;  4UZC A;  4JI0 J;  1APS A;  2CZ9 A;  4PYA A;  5EN1 A;  4RUC A;  2KHD A;  2RQM A;  4DV5 J;  1ZOT A;  2IBK A;  2OSR A;  4PWW A;  4PR6 A;  1U48 A;  2B4U A;  3PZP A;  3MM7 A;  3H59 A;  4RW8 A;  2HAF A;  2QZ8 A;  2VPW B;  1Y4Z B;  1XC9 A;  2GW8 A;  2HZA A;  3VGT A;  3M6U A;  1RT4 A;  3FRZ A;  4UOH A;  3RRH A;  3RW6 A;  4HT7 A;  4P52 A;  1GX6 A;  3TZY A;  3VWS A;  3GJS B;  3FEX B;  3WX8 A;  1P1T A;  3AOC A;  2MZS A;  1SUQ B;  3FKB A;  2BOP A;  2N4D A;  1BWV A;  3M32 B;  3PO5 A;  1YRX A;  3NL0 A;  2HIQ A;  1XMQ F;  2R7W A;  1OJ4 A;  1OSD A;  3GE9 A;  3DOM B;  4CLS A;  3MM5 A;  2FVS A;  3PAC A;  4J9M A;  1KRP A;  2MST A;  4YQW A;  1Y11 A;  4HHJ A;  5A76 A;  4G1P A;  4EZ9 A;  1IBC B;  3DXB A;  4ZVE A;  1F6T A;  2MZJ A;  3EXC X;  1SBR A;  5IZH A;  2HHV A;  1UFK A;  1IQZ A;  4XPC A;  2EEY A;  3DYA A;  2B6A B;  1DTQ B;  3O8W A;  2MLX A;  4IOC Q;  3FMW A;  3QGI A;  1FFG B;  2QSF A;  2RUS A;  1RLD A;  2XYH B;  3DM2 B;  5A2Q U;  3RBZ A;  3D67 A;  3T19 A;  3GR0 A;  3HJF A;  2EFO A;  3HVT B;  2BDP A;  4IH7 A;  1U25 A;  3UD5 A;  1RYS A;  1F9F A;  2HQF A;  2YNI A;  4DFM A;  1A7G E;  1BE4 A;  4NE9 C;  2UUT A;  2GVD A;  3RG6 A;  3HFZ B;  3KK3 B;  1G3O A;  2JEI A;  1FA0 A;  3G87 A;  2ZUG A;  3DOL B;  4ZP9 A;  1O0P A;  5DQG A;  1ZM9 A;  2G0C A;  3EDR B;  3TVZ A;  4K2X A;  2BW7 A;  5MLC V;  4WBF A;  4PEO A;  2G9O A;  3DRS B;  1WG5 A;  3ETM A;  1RAC B;  2CAD A;  3CXC R;  1HBN B;  4NZ7 A;  2RF2 A;  1FKP B;  3CB4 A;  3KK2 A;  2W9A A;  3JYT B;  4Q43 A;  1E6V B;  4IO9 Q;  2QT7 A;  2KVI A;  2GMJ A;  1SPB P;  4DJB A;  2DNY A;  2Z2Y B;  2AEM A;  4Z2X A;  4DN9 A;  1MU2 A;  4IH6 A;  3L7P A;  5DG9 A;  2W2P P;  2IY5 B;  2FTR A;  4N8O A;  2VPY B;  2ZOF A;  2W8L A;  3ZTO A;  5D4N A;  1U6F A;  2K1R B;  1NJY A;  1N48 A;  2YXL A;  2CPH A;  4FXV A;  5HQM A;  3EGV A;  4JP8 A;  4EGL A;  1NDP A;  3E01 A;  2IBO A;  4IG3 B;  5HQ8 A;  4ILM A;  1RTZ A;  2ASJ A;  3TAN A;  2BE9 B;  3DRP B;  1JLC A;  2NS1 B;  4KFB A;  2I8E A;  1V3R A;  3MPW A;  2VD3 A;  4B3T J;  3DRY A;  3DLG B;  1LWE B;  1HNW F;  4PQU A;  2CPJ A;  4RNH A;  4JUZ A;  1XK8 A;  4PG5 A;  1S57 A;  5KFF A;  4Z37 A;  3R5J B;  1WI8 A;  1TL7 A;  2D9O A;  2L9N A;  2B9W A;  4U6P A;  2DGO A;  3C66 A;  4USH A;  3LP2 B;  1RT3 A;  3D6T B;  3TW0 A;  2ERR A;  4DV2 F;  2Y8Y A;  1ZTW A;  1I5O B;  3BGR A;  3G6V A;  1FT8 A;  1RT1 B;  2D3Z A;  1SB6 A;  3PNI A;  2MXY A;  2DNZ A;  1MSW D;  3X3U A;  1U1R A;  3NMA A;  3DU5 A;  2DGQ A;  3CCU S;  2CZ4 A;  2CUY A;  4WCE Q;  1FWP A;  4I4B A;  1RTD A;  1HNV A;  3CW2 C;  3TZX A;  5KG6 A;  3SBM A;  3DCA A;  2XMV A;  2Z2L A;  5GAH I;  3GV7 B;  1EKR A;  2EPI A;  4ER8 A;  4ECY A;  3IN5 A;  5ETM A;  1EET A;  4AND A;  3KHG A;  4DFJ A;  2E5H A;  1XMQ J;  2KXN B;  4IQM A;  3B4D A;  4ZK7 M;  3NAH A;  3J7Y U;  2RS2 A;  2OSQ A;  4J9U E;  3MMB A;  3LP0 A;  1D9F A;  1UTA A;  3Q8S B;  3FQK A;  4EBD A;  4DL3 A;  4RW4 A;  1KON A;  1S1U A;  4DF8 A;  4TYA A;  2C2E A;  1UWA A;  5JVG Q;  3LAN A;  4C3M A;  3CDE A;  4QIE A;  2Z30 B;  4OV1 A;  2ZZN A;  2J0S D;  4P10 A;  3SYZ A;  3TJA A;  5F8L A;  3CO9 A;  3R7B B;  2F63 A;  3LO3 A;  2MZ1 A;  1AW0 A;  4JI6 F;  1KQG B;  2RU9 A;  3GFH A;  3KMQ A;  2PD1 A;  3MD3 A;  3MCM A;  1CJK B;  2MY8 A;  1HYS A;  4PXE A;  1J5E J;  4HYK A;  4K4Z A;  2YNF B;  1N33 F;  1IVZ A;  3GG1 A;  4JI8 J;  1CC7 A;  4E98 A;  2DNK A;  4MIB A;  2L3M A;  3H7H B;  3HFK A;  1IWG A;  4OYX A;  4DSL A;  3NS6 A;  5GAD U;  4YN3 B;  3CMA S;  1TMJ A;  1NXI A;  4RLE A;  2SXL A;  2LKZ A;  2V9W A;  2QN6 B;  3MDF A;  3OJU A;  4I6W A;  2MQQ A;  3D3B J;  4DUZ F;  1Q78 A;  2G2Y A;  2ZD1 A;  5K8M A;  2M3D A;  3U1L A;  2V67 A;  1PIL A;  4ZLL A;  3CC2 S;  4UY8 5;  4B9U A;  5F0U A;  4RWW A;  2XLJ A;  3OXG A;  4R8U B;  1U24 A;  2CA9 A;  1CBK A;  2PN6 A;  2RS8 A;  1ARO P;  3J7Z T;  3PFO A;  4AL7 A;  4ZVU B;  4C4W A;  2YNG B;  5KFM A;  2R8G A;  3GIR A;  3UVJ B;  4RW6 B;  2RAQ A;  4O3Q A;  4JI2 J;  3WBZ A;  2FQQ B;  2YX1 A;  5DDR C;  1GMU A;  2DEI A;  3CJS A;  2DH8 A;  2JVR A;  2RNE A;  5HVG A;  4ZDN A;  5EGY A;  5E2Q A;  4JB8 B;  3TUZ C;  3OJS A;  4HI1 A;  3RUB L;  3AY0 A;  4WXW A;  1VQS A;  2IFX A;  1HQ2 A;  4OV6 A;  5I42 A;  2R7V A;  4ZJL A;  2QYG A;  5DQI A;  4ECQ A;  4F0H A;  4F4A A;  4X4U A;  1PKU A;  2JNJ A;  1HPZ A;  1HNW J;  3GIJ A;  3U27 A;  2EBG A;  2PFF B;  3MAH A;  1Q5Y A;  2ZKU A;  2KZM A;  5HN0 A;  3BGL A;  4DUY F;  5LOQ A;  1BY9 A;  2DCU B;  2CJ9 A;  4PUO B;  5H9F K;  4Q0B A;  1UEK A;  1FRX A;  4DV2 J;  1VK8 A;  3MR5 A;  5C24 A;  1ULR A;  2MKY A;  1SC4 B;  1RBL A;  3HVA A;  4CLP A;  1WEX A;  4LF2 A;  3KK1 B;  2HVI A;  2XO7 A;  4CTA A;  3M8Y A;  3BO4 A;  5B0C A;  1VR6 A;  2HQI A;  1FHT A;  4OYB A;  1FXD A;  1N5V A;  3QAU A;  2C2O B;  4DV1 F;  4IG0 A;  3HSJ A;  5JXS A;  3QMQ A;  3MR6 A;  1MG7 A;  3HKW A;  4HL9 A;  2FJA B;  3J81 U;  4DR7 J;  2HBR B;  2IC3 A;  4PZV A;  3IC1 A;  2YWK A;  3HP6 A;  3POT B;  5K14 B;  2RRB A;  4K4U A;  3ILL A;  5DDP C;  2DNQ A;  3QBC A;  4N77 A;  4Y2I A;  1HWK A;  2DR6 A;  5KG5 A;  3D6M B;  1S6Q B;  2DRA A;  2BOA A;  4ZVQ B;  4QWD A;  2F7V A;  2RSQ A;  4J91 A;  5AE2 A;  4M5M A;  1DBD A;  3OL6 A;  3TNV A;  2C28 A;  1CJT A;  3UN5 A;  4RL1 A;  2V6A A;  1VQ9 S;  2FHO B;  5J1N A;  4UTG A;  3SCJ E;  3TVK A;  4RUA A;  2EG2 A;  4MAK A;  3NGT A;  4GO5 X;  4ZCL A;  1K0V A;  5J1E A;  1WC4 A;  2W25 A;  4FBT A;  1Q7L B;  3MM9 A;  2QIF A;  4WK3 A;  4ES1 A;  4JI5 J;  3BB5 A;  3SIP B;  1W7W A;  3T5K A;  2ZWO A;  2BAC A;  4RJV A;  5L39 A;  4JI6 J;  4F3O A;  4I69 A;  2MPU A;  2PGC A;  3KHR A;  1FX2 A;  2HHT A;  5KFS A;  4ID5 A;  1D8Y A;  3OL9 A;  1RAF B;  4OX6 A;  2XC9 A;  2JFD A;  1ZS6 A;  3THT A;  4GKJ J;  4DV3 F;  4B9S A;  2C2N A;  4F50 A;  4I2P A;  4ELU A;  2LMI A;  3DU6 A;  3VAH A;  2JC0 A;  1NK6 A;  3JTN A;  1U1M A;  3N5F A;  4O0N A;  5D4L A;  3LOU A;  2QRR A;  3R2D J;  5BXI A;  5BJR A;  1DQ8 A;  3ITH B;  1QSL A;  3DLE B;  3MUT P;  4DUZ J;  4JI7 F;  5F9N A;  2HFN A;  2U1A A;  2F8E X;  2HQC A;  2UUC J;  3ET6 B;  4I67 A;  3ILO A;  4GKK F;  1ZYQ A;  2HVH A;  4USW A;  1KFD A;  4LF9 F;  3AH6 A;  1LWC B;  2AEF A;  4ZLP A;  4YEA A;  2DR8 A;  1VYA A;  1TL1 B;  2UXB J;  2V34 A;  1F5C A;  3H8Y A;  1XMO J;  1RHJ B;  2WVC A;  4IDK A;  2HNZ A;  3KG4 A;  2FLO A;  2HSE B;  4BWM A;  1FVQ A;  1HL6 A;  1S4F A;  2QMW A;  3IRW P;  2KDO A;  2C2R A;  2MZQ A;  2UV8 A;  4CO0 A;  2RHQ B;  2CPI A;  2OLW A;  4K50 A;  1YBU A;  1RTI A;  3P5T L;  1XWL A;  1XER A;  2VF3 A;  1KLN A;  1C2P A;  2XCA A;  2LXU A;  2GIQ A;  1CVJ A;  4BCA A;  1DTT A;  5D4O A;  3PM9 A;  2DGT A;  4KBI A;  5GAH U;  2ZM6 J;  2CPX A;  2GVZ B;  1Y5I B;  2GQC A;  4O44 A;  3R6L B;  2HUR A;  2FJE B;  4OI2 A;  4DUY J;  2BQU A;  3UNY A;  1RE1 B;  4YB6 A;  5AE3 A;  2R4F A;  5CYQ A;  2JC1 A;  3JSR A;  1BQX A;  1JLF A;  1FRJ A;  2A2D A;  2C42 A;  3K2Y A;  2Z58 B;  4F25 A;  3FEY B;  4KRW A;  2NLW A;  2E7W A;  2MQL A;  2V9K A;  2Z4P A;  2KFZ A;  5L1L A;  1F3F A;  3MMC B;  4DV1 J;  3EPI A;  3KXD A;  4G1I A;  3CD6 S;  2D3O R;  3O6Q A;  3AD8 C;  1U0H B;  2MDA A;  3PX0 A;  3SSS A;  5IT9 Y;  2Y8W A;  1AZS A;  3OD2 A;  3CDW A;  1ZPW X;  2ZHA A;  4J9S A;  5KG0 A;  1X5O A;  3KLV A;  3NCQ A;  1LW2 B;  3M7V A;  1UVN A;  2C3M A;  4ECT A;  3R5C A;  3MPU B;  3PV8 A;  2VQF F;  1M5K C;  3HKZ D;  4G6V B;  5A6P A;  3W2W B;  1SKS A;  1LXJ A;  2GZO A;  4X4O A;  2CNO B;  1NSA A;  1KOO A;  2GIR A;  4AL5 A;  1BLU A;  3V4I B;  3G6E S;  2W1B A;  4ZPA A;  2VC1 A;  3NOC A;  4H4O B;  5L9X A;  1DFD A;  5E41 A;  2FVQ A;  1N4L A;  3OSN A;  3A8J A;  1JJC B;  1IM4 A;  2FJX A;  1XTZ A;  4WWS A;  2W7P A;  2H65 B;  2YWE A;  4LJM A;  2N4C A;  4DV3 J;  1XR7 A;  2B4V A;  4C8L A;  3NS5 A;  2VDI A;  4C8Y A;  2D3U A;  4DPT A;  4M5I A;  4PG8 A;  3MUV P;  3TQ1 A;  5KFN A;  2HQD A;  1VC5 A;  3NGU A;  4IO1 A;  4X4Q A;  3BN7 A;  1HBM B;  2M9K A;  4GKK J;  1IN0 A;  1FJC A;  3MMJ A;  4OZN A;  4OL8 A;  4LF9 J;  5F8I A;  2M5Y A;  4QIV A;  2QA4 S;  3EDQ B;  1F0X A;  2XGQ A;  2OFG X;  3Q86 A;  2RQC A;  1QY7 A;  1JJ2 R;  1JWW A;  1H7X A;  3FCH A;  4F7V A;  2CIM A;  3AA9 A;  3N5B A;  2X7I A;  4UUX A;  3C3L A;  2R3V A;  2O5D A;  3BPS P;  2BJ3 A;  3U7J A;  3D28 A;  2CPY A;  4AYB D;  4PXD A;  4C8N A;  1Y5N B;  1SC1 B;  4WJB A;  3EZ5 A;  3FUY A;  4LFB F;  1NDC A;  4HTI A;  1HWI A;  2NYI A;  4C2M A;  2H54 B;  3WHI A;  1LFW A;  2KRB A;  4WF9 Q;  4NLT A;  3MI7 X;  2VH7 A;  2LA6 A;  4FYY B;  2G1H A;  1SJF A;  1QTM A;  2J9E A;  2QLX A;  3W65 A;  2YPZ A;  1R0A B;  4DF4 A;  2X3D A;  1SUQ A;  2M7S A;  3AAW B;  4OJ3 A;  3NNA A;  3M32 A;  2ZJP Q;  1VQ5 S;  3PHE A;  4EFA C;  1R31 A;  1ELO A;  3DOM A;  4OI4 A;  4OHY A;  1RWW B;  3B78 A;  5ETR A;  2ZOM A;  2DCL A;  5GAE I;  1D1U A;  1L3K A;  3SZ2 A;  5DLG A;  2MHN A;  3W7B A;  2GV1 A;  2ZDP A;  3VTI A;  4K5S A;  2QFJ A;  5IC6 B;  2DHX A;  3HUL A;  4URS A;  2B6A A;  1DTQ A;  4DSF A;  3H5S A;  4ECR A;  2Q79 A;  1ZAX A;  3S1T A;  2DHA A;  3OTE A;  3DM2 A;  3QID A;  3C2P A;  2KT5 A;  3FJ2 A;  1RAO A;  1CPZ A;  2MJU A;  3HVT A;  2EVZ A;  3CCT A;  1DQA A;  4X65 F;  2UXD F;  1B0T A;  2WBR A;  2GMH A;  5D3G B;  4LSN B;  3EMT A;  3IXQ A;  3O3L A;  3NNC A;  2C3U A;  2RQ4 A;  2P2C B;  2OKQ A;  2HWI A;  2AQ4 A;  3IG1 B;  1X7V A;  3KK3 A;  1RT6 B;  1IKV B;  1R7I A;  2VQF J;  3DOL A;  1IXK A;  2LEP A;  4YY3 F;  4U7C A;  3SDE B;  4GC6 A;  3CO0 P;  1R27 B;  1T7P A;  2B8P A;  3PVX A;  3DRS A;  3EM1 A;  1WF0 A;  4KHP F;  1CS4 B;  2NQP A;  5K20 B;  5LJ5 Y;  1LV5 A;  1M5S A;  4ZPW R;  4B02 A;  1HBN A;  1FKP A;  4KT0 C;  2YTC A;  1HW9 A;  1FXL A;  1YGY A;  3JYT A;  2G2O A;  1E6V A;  4A8W A;  2RHS B;  1YJR A;  2QGF B;  1S72 S;  2DTJ A;  3DLJ A;  2Y1R I;  1NH8 A;  1AYE A;  3HLU A;  2FPH X;  3P45 B;  4G65 A;  3LA0 A;  2FLP A;  2QEX S;  2VIC A;  1R8B A;  3UW1 A;  4O3S A;  2K1R A;  4F3M A;  2MQM A;  1S0V A;  1T9T A;  1R8A A;  2ACM A;  3H2V E;  2OP5 A;  3SCI E;  2OTJ S;  3Q24 A;  1DJ0 A;  4DR5 J;  1V3Z A;  3P5B P;  4IG3 A;  8ATC B;  5CYM B;  5I4M A;  3DRP A;  1Y0H A;  5KT6 A;  5E5N A;  1H3D A;  2BXJ A;  1AUS L;  3RU0 A;  3M05 A;  3KHL A;  3RRK A;  2IM0 A;  2WVE A;  3ISN D;  5IT4 A;  3UR0 A;  3EYZ A;  3DLG A;  5FD1 A;  3EVW A;  1LWE A;  2VU5 A;  2E1A A;  3VGV A;  3K5P A;  1WHY A;  1WF2 A;  3G96 A;  1OQ3 A;  2V63 A;  2H4W B;  3IBF B;  1XBW A;  2J0X A;  1GMV A;  3GG0 A;  4CLL A;  5IQ6 A;  2VL1 A;  4OJ1 A;  5CD4 A;  3QPI A;  4L75 A;  3LP2 A;  1QD1 A;  2DNR A;  2YH0 A;  1RT1 A;  4C3K A;  3V6H A;  1RCO B;  1J27 A;  3QYY A;  4LFB J;  3FDS A;  4OZ5 A;  4YB7 A;  2YX7 A;  4NRT A;  4KGX B;  1HQU B;  3K5M A;  3JQK A;  4Q44 A;  5HJX A;  2JLG A;  3MPY A;  4DOZ A;  2YWG A;  5KFH A;  1WG4 A;  1DQ9 A;  3NXZ A;  1N5S A;  2OTL S;  4NL5 A;  3MCN A;  4C3L A;  1QM9 A;  4CO4 A;  4DPX A;  4J9O A;  4RU2 A;  3EGZ A;  3D6H B;  2VUG A;  3CCE S;  4BS2 A;  4J5O A;  1Q4R A;  1EB0 A;  5HQL A;  4RR5 A;  3R5G A;  2RE1 A;  7FD1 A;  5GAG I;  2F9D A;  1NSP A;  4OHX A;  2LFV A;  4L72 B;  2M4M A;  2QL7 B;  3M2U B;  2FB0 A;  1S49 A;  2ZH4 A;  5CHC B;  4DQQ A;  3T5J A;  5DRK A;  4DLG A;  3BV8 A;  5KFY A;  1E6Y B;  3ZZO A;  1TKX B;  4PPD A;  4CH0 S;  4HDH A;  2VQE F;  1NK9 A;  1PAE X;  1TUW A;  3JSM B;  2HFZ A;  2DJW A;  2I5J B;  1CJK A;  3OVS A;  4FYW B;  2BAB A;  5FLX Y;  2D3O 1;  2AJF E;  2GCF A;  4YR2 A;  4NYZ A;  2XNQ A;  2W24 A;  5DET A;  1PBU A;  2YNF A;  1KS2 A;  4A8K A;  2GGP B;  3T3F A;  3GQC A;  3BEG B;  3Q8U A;  4NYP A;  1NJX A;  5HAN A;  3AXK A;  3L7U A;  4EU0 A;  4KHP J;  2XMM A;  2VDH A;  2IJR A;  2XEX A;  4F8R A;  5KFQ A;  2KT2 A;  2L9W A;  1HMV B;  2IRX A;  4WFY A;  5KFU A;  3VAI A;  2Z56 B;  3M8Z A;  4J9K A;  2IDL A;  4R8U A;  2FHJ A;  3BSN A;  2FHK A;  4DL0 C;  3L09 A;  4CLT A;  2JZ5 A;  4WYW A;  4OYO A;  2C2Z B;  2YNG A;  3UVJ A;  4RW6 A;  3W3S A;  1KHW A;  2B5J B;  1S79 A;  3N0V A;  4N41 A;  1YHQ S;  1JQG A;  3HZG A;  2MTL A;  4DMZ A;  2NR0 A;  4NMX A;  2HLU A;  2OAU A;  2KYX A;  4HLB A;  2XY5 A;  3H98 A;  2C2K B;  4ICL B;  5H1S V;  4CO3 A;  3PY8 A;  4M5K A;  3VF0 B;  2CNN B;  3BM7 A;  4NZ6 A;  1S5Z A;  1QAY A;  3GFX A;  2L08 A;  2QG9 B;  1RT2 B;  3ZTP A;  4YP3 A;  4NCA A;  1N32 J;  3CF5 Q;  1RB0 A;  3DKD A;  4C11 B;  4NEY A;  4MK8 A;  3HVW A;  2LQ9 A;  5L8R C;  3MCO A;  2QL5 B;  4CLK A;  4PUO A;  4LRC A;  4ZN3 A;  4DV7 J;  1KSP A;  2E1C A;  3I9Z A;  3PRB A;  2KFY A;  2YKN B;  2RDI A;  4ILL A;  2DVI A;  3KK1 A;  2FJW A;  1NME B;  2NCK L;  4ECW A;  3BQ0 A;  3CJK B;  3QRR A;  1N5Q A;  1S1T B;  4RWX A;  4QU7 A;  2NPF A;  1YRU A;  4J7C A;  3AXM A;  2EWH A;  1Y00 A;  3FGV A;  4O3R A;  4PWU A;  3ZNU A;  5DQH A;  3O1L A;  2BJ7 A;  5J2Q A;  3HSD A;  2PEH A;  3R27 A;  3GFZ A;  3LH2 S;  2W9B B;  1I6J A;  1B64 A;  3POT A;  5K14 A;  2HGM A;  4BLG A;  3PW2 A;  4QW9 A;  3OV7 A;  2VKZ G;  2OO4 A;  5A2Q Y;  4KPY A;  1S6Q A;  5DG8 A;  1JLG B;  1PGZ A;  1H74 A;  5IC4 B;  1ZAW A;  4NLR A;  4ECS A;  4DR2 F;  1N52 B;  4ZVT B;  2FVR A;  1JLA B;  1T3O A;  4B3M J;  2UUB F;  4A8Y A;  2KH9 A;  2NZC A;  2AYE A;  1SQG A;  2HHW A;  4F2R A;  4GO7 X;  2OMO A;  5HAT A;  4TNO A;  2X1F A;  4EK2 A;  2VZ9 A;  5I3Q A;  1UFL A;  1NDK A;  4EBE A;  4MK9 A;  3W62 A;  3GV8 B;  3TQE A;  2HVZ A;  2PE8 A;  3N6L A;  1L5U A;  3KJQ B;  1VBY A;  2IVM A;  4KH1 B;  3PW7 A;  4E0D A;  4I1T A;  3OTB A;  2VQE J;  1JMT A;  1KTV A;  3AJ2 A;  2LXF A;  4QR0 A;  3D0I E;  2R7T A;  1WHX A;  4KSE B;  1RYR A;  4QZV B;  4QIG A;  4N5S A;  4YUD A;  1P1L A;  4P75 A;  1GMW D;  5CCL A;  1Q82 T;  3KLI B;  4ELT A;  3AD9 C;  2GML A;  3CD5 A;  3ITH A;  3DLE A;  4QWA A;  3CTR A;  5ADZ A;  2OH2 A;  1JLQ B;  1FK9 B;  3P96 A;  3ET6 A;  5LXY A;  2W7A A;  1S6P B;  3K58 A;  4G1Q B;  5RUB A;  2Q1L A;  2DIS A;  1YKW A;  2IJF A;  5A8K B;  3MHY A;  2E9R X;  2Q3P A;  5KAK A;  1LWC A;  2JEJ A;  1TFY A;  2ZE2 B;  2VA2 A;  3MEK A;  2IHR 1;  1UW9 A;  1TL1 A;  3I55 S;  4KAI A;  2DNN A;  1RAB B;  2RML A;  1FKA F;  3Q8V A;  3LUY A;  2B3T B;  4UT4 A;  3OW2 R;  1H72 C;  4Y0F A;  4YR0 A;  3MED B;  3WQP A;  2P9E A;  2VFS A;  5J1P A;  2CQ4 A;  2OEM A;  2BE2 B;  4YFU A;  4P6Q A;  4J9N A;  4JI4 F;  4Z7Y A;  3TAQ A;  5KFV A;  1XIQ A;  2NRE A;  1GT8 A;  1CJV B;  5KFR A;  4U67 Q;  3CDA A;  2FZC B;  3V81 B;  1FES A;  2YQ1 A;  4B3S F;  2DHS A;  1RDR A;  3A3P B;  3TEH B;  5IT9 U;  1RUS A;  3MR3 A;  4GVL A;  3PJX A;  1RT5 B;  1KKH A;  3HJV A;  5T7L B;  4K4Y A;  4O4G B;  4UY8 T;  4KGK A;  3M9N B;  3MXH P;  3NCR A;  1UL3 A;  4NA2 A;  1NU4 A;  2MY7 A;  3SI8 A;  4A48 A;  1P27 B;  4WYL A;  8AT1 B;  4CWB A;  5GAG U;  3UDV A;  2MKH A;  2BEF A;  2HQ3 A;  2M70 A;  2KXH A;  1C1C B;  2R8H A;  3UO0 A;  3MMC A;  3I5B A;  3N79 A;  2FVP A;  3Q22 A;  3IAS 9;  2KHC A;  4WFZ A;  2WHO A;  2E66 A;  3HSZ A;  3PRD A;  2DGS A;  2ASD A;  2CPD A;  3OFH A;  4FZV A;  2KG1 A;  2D69 A;  2H1Y A;  1U0H A;  4U8Y A;  4EWT A;  1T3N A;  1M5V C;  2LQJ A;  4CT8 A;  3FSI A;  2NSC A;  1U6Z A;  3H5Y A;  1LW2 A;  3R8Y A;  5AJ3 J;  4LBP A;  5K8N A;  1Q8L A;  4H4M B;  2XHW A;  2Z0G A;  1VBX A;  1TMM A;  4CLF A;  4ED6 A;  5KFA A;  4ED4 A;  4ECX A;  2B9Y A;  5EUH A;  3GYX B;  3W2W A;  2CXE A;  4WP9 A;  4KJI A;  1NKB A;  2VFT A;  2OEJ A;  1FF2 A;  4KGM A;  3JXO A;  2VAS A;  3IA0 A;  2BKN A;  3C6U A;  1YWX A;  4Y6I A;  1TAQ A;  3V4I A;  2CQP A;  2F4V F;  1UJ4 A;  2LVW A;  2PSZ A;  3GFY A;  3C14 B;  3AJ1 A;  4H4O A;  3M6V A;  1VOM A;  4KGV B;  1UVL A;  3I9V 9;  3A4T A;  2LU1 A;  3H90 A;  1QLN A;  5DZ6 A;  2J9D A;  3ZZ0 A;  2DNG A;  2YWF A;  3OQ2 A;  5C2C A;  5KFT A;  2RJZ A;  1S10 A;  2FIU A;  4OIX A;  1SJQ A;  3MTK A;  3I87 A;  3QT5 A;  3MEC B;  3EUN A;  1S9E B;  1PAU B;  2BBE A;  1U2R A;  2YKO A;  3GR1 A;  2MHE A;  3HZE A;  2RDD A;  5E0O A;  2AJ4 A;  2HHH F;  5BYR A;  1RHU B;  4FNH A;  2EKN A;  2PC6 A;  2ZWP A;  2R8I A;  4LR8 A;  4AXJ A;  1A6L A;  4ZVS B;  2W9C B;  1KBR A;  1U8W A;  3Q0A A;  3CPW R;  1HBM A;  2J6U A;  1WNE A;  3NWG A;  4QCL A;  2VKR A;  4A8S A;  2DEJ A;  1CJU B;  2EBE A;  3HVR A;  1PBA A;  2VJU A;  3OXF A;  2GQ2 A;  2DIV A;  5B0G A;  1FER A;  3Q2T C;  4IRD A;  4ZVF A;  2OD6 A;  4WFN Q;  3QZ7 A;  1BGX T;  3TA0 A;  3EJM A;  5GVQ A;  1X9W A;  3CCM S;  1Q16 B;  4O3P A;  3VV2 B;  1NCL A;  3PIP Q;  2JHE A;  4K4S A;  1CEZ A;  2RU3 A;  4JI4 J;  3GV5 B;  1NB7 A;  5ETV A;  2DK2 A;  1WKJ A;  5IS2 A;  4ZVP B;  4PQA A;  2JLF A;  1KQS R;  1RHK B;  4KE5 A;  3TEG A;  1YBA A;  4A8O A;  3JAM U;  1RQ0 A;  3I0R B;  2EKY A;  4R25 A;  1XJW B;  1FKO B;  4OHV A;  4RKU C;  1ZM2 A;  1LEO A;  3DDK A;  2JL9 A;  1RKI A;  1R0A A;  1J5O B;  3S01 A;  2M88 A;  3ONQ A;  1EQM A;  2QX0 A;  1NKE A;  3FMB A;  4PXB A;  4YS2 A;  3MTJ A;  1DHM A;  1TKT A;  3D3C J;  2B7B B;  3EIC A;  1FXR A;  1T94 A;  2VHG A;  2W4P A;  4CO1 A;  3KFW X;  2ZJQ Q;  2QA2 A;  2I0X A;  1SC3 B;  3IBW A;  3QIP B;  1CQN A;  1VQN S;  1VQO S;  3RBE A;  4DR6 F;  1LKZ A;  5LMU F;  2B9E A;  2HS3 A;  1T9V A;  1YJW S;  3J81 j;  3ZZZ A;  2G0J A;  2D1C A;  3V4M A;  4KH0 B;  1Q86 T;  2IMO A;  3OHB A;  5D3G A;  4LSN A;  2D41 A;  5B09 A;  1MW7 A;  4WP8 A;  3T9N A;  1FD2 A;  3IS9 B;  5KT3 A;  4WK1 A;  2HFV A;  3CCQ S;  3ENW A;  4LRA A;  2DHH A;  4LF6 J;  3IG1 A;  4OYA A;  2HWT A;  1RT6 A;  3I96 A;  1IKV A;  3N4W A;  1U2F A;  2BV3 A;  3G6X A;  1P6T A;  1H2V Z;  4J9P A;  1UKU A;  4QYZ K;  3SDE A;  3RB4 A;  1B0V A;  1P9Q C;  2CAJ A;  1M1K T;  1YLX A;  9RUB A;  1CS4 A;  1IJF B;  2F4V J;  1TUG B;  1IBK F;  4DV0 F;  3P4U B;  2B56 A;  4OZJ A;  4RPF A;  5J2N B;  2AYB A;  4CLZ A;  4N47 A;  4AUK A;  4HH1 A;  4V1A k;  5LL6 d;  3MR2 A;  4K8R A;  3PRV A;  1C0T B;  2GHW A;  1HFE L;  4NLQ A;  2FLL A;  1QAX A;  3C6T B;  3Q8Q B;  5DJB A;  4NCB A;  2HBQ B;  3K5L A;  1T9W A;  2DO0 A;  4TU7 A;  5FDL B;  1MWY A;  2YX4 A;  2PEB A;  4QIW D;  1B70 B;  1VBZ A;  5ETL A;  3V6K A;  2DRB A;  1GXU A;  2HHH J;  2L48 A;  4C48 A;  4DWI A;  2HMI B;  1HI1 A;  2E9T A;  5CYM A;  1UP1 A;  4MKY A;  5IFM A;  4LF4 F;  1UA1 A;  4M1K A;  3EX7 B;  3W63 A;  2IMW P;  2CJB A;  1S59 A;  1XMB A;  4QYZ J;  4QQB A;  2E1P A;  3CWJ A;  1NLK L;  3S6E A;  2LLZ A;  5E3R A;  4WKY A;  2IA6 A;  1K8A T;  3DXS X;  3V6J A;  4ECU A;  2XMA A;  1IQT A;  2GJI A;  1S1W B;  3FCV A;  2AMC B;  1JLE B;  3AOB A;  2IRY A;  1KC8 T;  3CJ0 A;  4LF8 F;  3K7R A;  1VJW A;  1Q1K A;  2KU7 A;  3DRX A;  3KLF B;  2ZNY A;  2XQC A;  3M4X A;  3DLH A;  2V68 A;  1X31 C;  4X62 F;  4DS5 A;  5HVH A;  4X4V A;  3CJT A;  1NHU A;  1PYT A;  4L74 A;  4LF1 A;  3HX9 A;  3VHQ A;  4LF7 J;  3DN9 A;  1KFS A;  3QGH A;  2KVQ E;  4ES3 A;  4EO8 A;  1HQU A;  1H98 A;  2HRU A;  2QFI A;  3EWG A;  3J80 Y;  1L3T A;  1SJ1 A;  4S0M A;  3D0H E;  3DI6 B;  2V69 A;  4HH0 A;  2UUA F;  2NUU G;  1FX4 A;  2G2Z A;  4JYA F;  4WZM A;  5FLX U;  4BWJ A;  3SFU A;  4C98 A;  4UW2 A;  1YJN S;  3GJQ B;  2HK2 A;  1SQF A;  4F0M A;  2MKC A;  3WX4 A;  2RUG A;  4OYP A;  3AFG A;  2DYA A;  1U1O A;  2EFG A;  3T6B A;  3GMG A;  3MFH A;  3M2U A;  4ZPV R;  1TV6 B;  2IVY A;  3O5T B;  4AD6 A;  1E6Y A;  1TKX A;  3ENA A;  4F2S A;  3IGV A;  3JSM A;  3WIV A;  1EQ0 A;  1RHR B;  4MH8 A;  4UF4 A;  3C15 B;  2I5J A;  3KNG A;  2CQC A;  1U0S A;  1WEZ A;  3Q8P B;  5HJY A;  1OYE A;  3HD1 A;  4LBI A;  3QJJ A;  1NBE B;  2GGP A;  2R2U A;  3ZTS A;  2ZVS A;  2H3E B;  3K5O A;  1FFS B;  2JFK A;  2BMB A;  4MIW A;  4OI1 A;  1F60 B;  1CUL B;  4N8N A;  4I68 A;  2HG4 A;  4DCO B;  5HMY A;  3ZTQ A;  2ROP A;  1YJV A;  3HSG A;  1IBK J;  1O6X A;  3BBC A;  2LQ8 A;  4N76 A;  4JV2 A;  4Q8F A;  1HMV A;  3R5D A;  2XI2 A;  4HVZ A;  3TAM B;  1RI7 A;  1SV5 B;  3PXG a;  3LGH A;  3DMJ B;  1S0M A;  4EMD A;  3LWL A;  1UA0 A;  4DCP B;  5KFK A;  4LVN P;  3MEE B;  5F9L A;  2DH9 A;  2ZNZ A;  1Q8K A;  3KMS A;  3M8W A;  3CED A;  1TL3 B;  1VIX A;  2M8H A;  2Z8Q A;  4IRC A;  2F8H A;  2AZ1 A;  4CRJ A;  2B5J A;  3NGD A;  1WEY A;  2DR7 A;  1JKH B;  1X4G A;  2JLE A;  1M1H A;  4QJV A;  2I6W A;  2OML A;  4BBY A;  4WIQ A;  1NUE A;  4DX5 A;  5BR8 F;  3QJP A;  1VRT B;  5JVH Q;  4ICL A;  4LF4 J;  4WFX A;  1PSD A;  1X60 A;  1W26 A;  2YNH B;  4R0J A;  1FJG J;  1RT2 A;  4K59 A;  4Y2M A;  3GSD A;  2EC0 A;  1A0O B;  2CNK B;  3JTP A;  5KFL A;  3MM8 B;  3K89 A;  3D1O A;  5I3U B;  3R7N B;  4C11 A;  5B0D A;  1MMD A;  2HND B;  2UXC F;  2ABY A;  1AA1 B;  1N5Y B;  2DNO A;  2X1B A;  2HHS A;  4LF8 J;  1TK5 A;  1RWP B;  4UQG A;  2CQ0 A;  4E2F B;  1TL4 A;  3P8B B;  2IJN A;  2WCX A;  1X0F A;  3CCZ A;  4EEY A;  4K4V A;  1O5J A;  2O1P A;  4MTP A;  4FXD A;  3JSY A;  2VBW A;  2YKN A;  4X62 J;  2MLY A;  1QVF R;  4OX9 F;  3ZNJ 1;  5IQQ A;  2MLZ A;  4LR7 A;  2RRN A;  2WOM B;  3BSO A;  3CJK A;  2XZW A;  5M2R A;  5JMN A;  1S1T A;  1VQ6 S;  2ZHB A;  1Q7Y T;  3HHL B;  4NCG B;  1QAI A;  2H5E A;  4B9T A;  4HKQ A;  3F44 A;  1JK9 B;  5T41 A;  4ELV A;  4YOE A;  5K5M A;  4B17 A;  2H5J B;  1Q5V A;  2M52 A;  3FCW A;  2CQ2 A;  2W9B A;  2HFS A;  3QWP A;  4F4W A;  2DNM A;  1BHN A;  1S7I A;  3IR5 B;  5KFO A;  2A1B A;  1QTN B;  4FPI A;  5L38 A;  1JLG A;  4ED0 A;  3Q89 A;  3D1Q A;  1EKS A;  1I94 F;  1UJ5 A;  4I56 A;  2UVR A;  3VZI A;  2QJ3 A;  1JLA A;  3LAL A;  2DNP A;  2AT1 B;  5K9F A;  5F8H A;  1RU2 A;  1DY3 A;  1N36 J;  4X66 F;  1PJ7 A;  4J9R A;  3R2C J;  2MZT A;  1U45 A;  2AV5 A;  1NPR A;  1MWQ A;  1A9N B;  1VBK A;  2H48 B;  1S77 D;  1C0U B;  1VJQ A;  4USJ C;  4K2J A;  1IM6 A;  2QV6 A;  2BM0 A;  3NLC A;  3MGJ A;  3T5L A;  3OL7 A;  3GYN A;  2ZJR Q;  4NLW A;  3JQM A;  1GXL A;  3D1H A;  1IBM J;  4I64 A;  5IXU A;  3EZU A;  3RYL A;  3TZW A;  4DL5 A;  3MR7 A;  4KYZ A;  4L3N A;  2F4F A;  3GCW P;  1FDN A;  2B4O A;  2PMH A;  2R7X A;  2IAJ B;  1TQL A;  4OZ1 A;  3DLL Q;  2DBB A;  3KLI A;  2DIU A;  4GVB B;  5B08 A;  3TI0 A;  3FRY A;  1RAG B;  3EE3 A;  1SH0 A;  1LNQ A;  1YJT A;  3BBF A;  2ZEJ A;  1JLQ A;  2OEK A;  1FK9 A;  1S6U A;  5DGB A;  3R5A A;  1S6P A;  4G1Q A;  3C19 A;  1F2H A;  1T9U A;  5A8K A;  3FSY A;  2X3G A;  1V9O A;  4BC7 A;  1BWE A;  2ZE2 A;  3KDO A;  4USM A;  4ERD A;  4ZP8 A;  1H38 A;  1U1L A;  1UVM A;  4ZMM A;  3SMZ A;  4EI2 A;  4DN0 A;  4ENO A;  3ZO7 A;  2BR0 A;  4B9M A;  3MED A;  3H2L A;  3N6N A;  1GQE A;  4LMZ A;  1X4A A;  1UPM B;  4X84 A;  2BE2 A;  3UCZ P;  4ZHR B;  1R6Y A;  4IFY B;  2OGU A;  2AGP A;  2X1A A;  3W5Y A;  4O23 A;  1X4F A;  5KG4 A;  2QLF B;  2HBY B;  3OUY B;  3D6F B;  1CJV A;  3BBB A;  1G2E A;  1I1G A;  1IKY B;  3F0N A;  3V81 A;  3CGI A;  3K8V A;  4ZCK A;  4RW9 B;  2UXC J;  2EFN A;  3LF0 A;  3ENQ A;  3LPY A;  2ATL A;  1ZH5 A;  4HR2 A;  4OZ2 A;  1RT5 A;  1TTH B;  4OYW A;  3KLG B;  1X4B A;  4IRK A;  3OVB A;  2BYC A;  5T7L A;  1SC6 A;  4OZ3 A;  1Z2L A;  1TKZ B;  4O4G A;  4OJG A;  2W7O A;  2N3O A;  2XNR A;  2FGC A;  3AQO A;  3M6X A;  2WW8 A;  1F9E B;  2KJV A;  4X4S A;  1RAD B;  1JB0 C;  4C97 A;  4OX9 J;  3DHX A;  1YZ7 A;  2WBM A;  3AQP A;  1WHV A;  4CLY A;  1D9A A;  1LWX A;  1IR1 A;  3TR5 A;  1C1C A;  1FDD A;  3MUR P;  3BYR A;  2W4C A;  1KQF B;  4OLO A;  3U1M A;  2MQP A;  1YDL A;  3ZZY A;  2CPF A;  3I0S B;  1B7F A;  2ZH1 A;  3NAI A;  4DPU A;  1SKU B;  5DDO C;  4IOA Q;  3CMQ A;  1WTF A;  2K3K A;  2IM2 A;  2VJV A;  3HDS A;  2ZH9 A;  3KJF B;  4USK A;  3ZC4 A;  4ED7 A;  1JNZ B;  1D8Z A;  3D66 A;  1IBL F;  1JJ4 A;  1I94 J;  1T95 A;  2XI3 A;  3KG0 A;  1KN6 A;  4H4M A;  4NA3 A;  5ETO A;  2WSF C;  4MK7 A;  3TO8 A;  4KHR A;  3MUM P;  4CQ1 A;  2FHM A;  1L3V A;  4Q8E A;  4K7Q A;  1UMJ A;  2HZC A;  1WC5 A;  3C14 A;  1K1S A;  1FD8 A;  1VK3 A;  2ZKT A;  5HSP A;  2ZOG A;  3JSB A;  4DV4 F;  1PYS B;  5IWA F;  4M5H A;  4M5D B;  3P6Y C;  5C7P A;  2HVE A;  1BC6 A;  3QWU A;  3MEC A;  1REV B;  5F8N A;  1WTB A;  1S9E A;  5KFE A;  5D0G A;  2ADB A;  3GCX P;  4A8X A;  4XDD A;  3D4J A;  4PWD B;  2COL A;  4F02 A;  4PAB A;  4K4X A;  1KR4 A;  9ATC B;  1UW4 A;  1S97 A;  3GPA A;  1BMQ B;  7AT1 B;  5LSR A;  2CDR B;  1UVJ A;  2W9C A;  3P3D A;  4YDX A;  3MOZ A;  1SL1 A;  2QC3 A;  1CJU A;  1RWO B;  5D0E A;  3I4H X;  5AXN A;  5DGA A;  1MNE A;  3W8P A;  2WVF A;  3EVM A;  2D9P A;  4C8O A;  4FYX B;  1NJW A;  2R7S A;  5L1J A;  1HA1 A;  1H2U X;  3RTV A;  2HWH A;  4B9L A;  4NLS A;  2E5J A;  3KKF A;  1C1B B;  1T05 B;  1VQP S;  3VVU A;  2OEL A;  3F73 A;  4AXI A;  2OPP B;  3RZA A;  1MLA A;  4LFA F;  1JNR B;  3CJ3 A;  3FVY A;  2QMX A;  3H4D A;  1FWL A;  1U09 A;  1REG X;  4P2S A;  3RB3 A;  1V3S A;  2XG8 A;  2QA1 A;  2DGV A;  2LP4 A;  5EX3 A;  4NLG A;  2QA4 G;  3HD2 A;  2JEF A;  3FFI B;  4ZPT R;  1RAH B;  2WRM A;  2VA3 A;  2IVF B;  4F26 A;  3NMR A;  5HAO A;  3NY0 A;  4KB7 A;  3PJW A;  4RNN A;  1WI6 A;  5H9F J;  2RH3 A;  3VAF A;  4QBU A;  3AJD A;  3QQC D;  3I0R A;  1FKO A;  4ETX A;  3G82 B;  3AB4 B;  2E5L F;  2AJ2 A;  2QMU B;  4FYV B;  1XNQ F;  2V5H G;  2G1D A;  1J5O A;  2OPS B;  1NEE A;  2R2R A;  3DLK B;  3D54 A;  3UDC A;  2FYX A;  5J2P B;  2JVO A;  1S6O A;  4Z7C A;  4Y2A A;  3T9Z A;  2BE7 D;  5F0W A;  1N33 J;  4URQ U;  1OY9 A;  4OI6 A;  2KT3 A;  3QIP A;  1QVG R;  1QSS A;  2C2D A;  3TJ8 A;  4ED3 A;  4NOH A;  4FXW A;  2VFU A;  1U6B A;  2CQH A;  2J9D E;  5G4D A;  3SQO P;  4TXS A;  4DDF A;  3BGU A;  1YG0 A;  1D3W A;  3NNH A;  3PYF A;  5ETT A;  1ZZF A;  4DL4 A;  4U8V A;  3KG1 A;  2VBZ A;  4DFK A;  5B7W A;  3IS9 A;  4DV5 F;  3R97 A;  4K4W A;  5HK4 A;  3UPF A;  1QDU B;  4XAK A;  3HHD A;  3KLH B;  2NZ4 A;  3F56 A;  2Q43 A;  3GII A;  3LGN A;  1MN7 A;  1UZH A;  4JBC A;  5M2U A;  1N0U A;  4K5R A;  2FJD B;  5KFJ A;  3OR1 B;  2R2T A;  2CYY A;  2AP6 A;  4KC5 A;  2XY6 A;  2CG8 A;  5J2N A;  5L1K A;  3MEG B;  1T11 A;  2FHJ D;  3C8Y A;  3Q83 A;  1K47 A;  1C0T A;  2YKM B;  2NXE A;  4DCJ B;  2NXJ A;  1S76 D;  3C6T A;  1IWA A;  5AXM A;  3OHA A;  3TX8 A;  5FDL A;  4ZN1 A;  2J9C A;  1WC1 A;  5E33 A;  5KFW A;  3DOK B;  4ZA1 A;  2CQ1 A;  3DNC A;  4ALZ A;  1FI4 A;  2CQI A;  3ZZT A;  1NRK A;  4LSZ B;  4OHW A;  4QWE A;  3SQG A;  1U1K A;  2JDJ A;  3UDE A;  1G6B A;  2BRK A;  2HMI A;  1J2V A;  1B3T A;  3T1H F;  2A6O A;  4LRE A;  2PI4 A;  1B4S A;  2BRL A;  2XMT A;  1LW0 B;  1KQK A;  4DUT A;  4RBU A;  3VGS A;  4X4T A;  3SSR A;  2HHQ A;  2XO6 A;  1UEV A;  1RWX B;  1R8H A;  2ZVI A;  2AWZ A;  4B3R F;  2KM8 B; 
#chains in the Genus database with same CATH homology
 3ETM A;  1HLW A;  1S57 A;  3VGV A;  3EE3 A;  2B8P A;  3ZTQ A;  3BBF A;  4HR2 A;  3EM1 A;  2B8Q A;  2BX6 A;  3JS9 A;  1JXV A;  1NLK L;  1MN7 A;  2ZUA A;  3DDI A;  3Q86 A;  2DXE A;  3BBC A;  5CAA A;  3NGT A;  1UCN A;  3EVM A;  3VVT A;  1B99 A;  3FBB A;  1HHQ A;  3FCV A;  1F6T A;  4EK2 A;  4F36 A;  4ANE A;  1VYA A;  1NDK A;  3NGR A;  3NGS A;  3EIC A;  1NSP A;  3FBC A;  3Q8Y A;  3B54 A;  4CP5 A;  3PRV A;  1KDN A;  2BEF A;  1K44 A;  3EJM A;  3Q83 A;  1HIY A;  4KPC A;  1W7W A;  2DYA A;  3Q8V A;  3FBE A;  1LWX A;  1NSQ A;  4ENO A;  3G2X A;  4UOF A;  4W98 A;  1F3F A;  3VVU A;  2NCK L;  4ANC A;  4DI6 A;  4FKX A;  2DY9 A;  4FKY A;  2DXD A;  3ZTO A;  1NCL A;  1NDL A;  4DZ6 A;  3FC9 A;  3FBF A;  3EVO A;  5C7P A;  2AZ1 A;  2HVE A;  1WKL A;  1ZS6 A;  1EHW A;  1BUX A;  1PAE X;  1MN9 A;  1NHK L;  1WKJ A;  1WKK A;  1NPK A;  3B6B A;  3ENA A;  2CWK A;  1NDC A;  1NDP A;  4UOG A;  5CAB A;  3EMT A;  1NSK L;  3R9L A;  3BH7 B;  1BE4 A;  1XIQ A;  1NUE A;  3GP9 A;  5IOL A;  1S5Z A;  4F4A A;  3NGU A;  4O0N A;  3VGT A;  1NB2 A;  1PKU A;  4UOH A;  3Q8U A;  3VGU A;  1B4S A;  3ELH A;  4C6A A;  5BXI A;  3BBB A;  3FCW A;  4S0M A;  3ZTP A;  3GPA A;  4DUT A;  3WX8 A;  3ZTS A;  3VGS A;  2DXF A;  1BHN A;  4AND A;  3BH6 B;  3PJ9 A;  1U8W A;  2HVD A;  1LEO A;  3ZTR A;  2HUR A;  2AZ3 A;  3FKB A;  4WBF A;  3L7U A;  1XQI A;  3DKD A;  3Q89 A;  1S59 A;  3MPD A;  3EVW A;  2VU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...