1S57A

Crystal structure of nucleoside diphosphate kinase 2 from arabidopsis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
SMEDVEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYITSGPVVCMAWEGVGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSPENGKREIGLWFKEGELCKWDSALATWLRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of Arabidopsis thaliana nucleoside diphosphate kinase-2 for phytochrome-mediated light signaling
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
molecule keywords Nucleoside diphosphate kinase II
total genus 41
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1s57A00
1NHKL 1S5ZA 4DI6A 3FC9A 1PKUA 5BXIA 3Q83A 1HIYA 1NCLA 3ELHA 3Q8UA 4WBFA 1NPKA 1WKKA 3NGSA 2VU5A 2AZ1A 3BH6B 1NDKA 3ETMA 3EMTA 1S59A 1NSPA 1B4SA 3EVMA 3VGTA 1NDLA 3PRVA 3ZTOA 4DUTA 1EHWA 3ZTPA 3GPAA 1XQIA 3EVWA 2AZ3A 5IOLA 2NCKL 4UOFA 3FBFA 4HR2A 3B6BA 3FBBA 3BBBA 3ENAA 1UCNA 1HHQA 3FBCA 1LWXA 4F4AA 4O0NA 1PAEX 2BEFA 1BE4A 2ZUAA 1JXVA 3EVOA 1S57A 3G2XA 1W7WA 3DDIA 3DKDA 1U8WA 2HVEA 2DXFA 1F6TA 3NGTA 3B54A 4F36A 4FKYA 3L7UA 2HVDA 2CWKA 4DZ6A 5CAAA 1NUEA 4S0MA 2DY9A 2DXEA 2DXDA 3Q86A 1NSQA 3BBCA 4ANDA 3EM1A 4UOHA 4C6AA 3MPDA 3BBFA 1VYAA 1LEOA 1KDNA 1MN7A 3PJ9A 1NLKL 4ANEA 5C7PA 4ENOA 1NDCA 1NDPA 2DYAA 2B8PA 3VGUA 4FKXA 2B8QA 1XIQA 4UOGA 3ZTSA 4KPCA 3ZTRA 3Q89A 3VVUA 3NGUA 3EJMA 3VVTA 1BHNA 1WKJA 1WKLA 3JS9A 3VGVA 3FCWA 3NGRA 4CP5A 1B99A 1HLWA 1K44A 2HURA 4EK2A 3Q8VA 1MN9A 3EICA 4W98A 3VGSA 3Q8YA 3EE3A 1NSKL 3BH7B 3R9LA 5CABA 1ZS6A 1F3FA 1NB2A 3FKBA 3GP9A 3WX8A 1BUXA 4ANCA 3ZTQA 3FCVA 2BX6A 3FBEA
chains in the Genus database with same CATH superfamily
2B9XA 3VWSA 4ZVHA 2LFVA 3S6EA 4DF4A 3CCES 2OJ3A 1RYRA 4PG6A 5A8KB 2M8HA 3Q83A 5FDLB 5L9NA 1HIYA 5ETKA 3K5OA 3MM8B 4ZPWR 4JV5F 2P2CB 4DSIA 3TYTA 2GA7A 4EBEA 3RB6A 3CJ8A 1N36F 1ZAVA 5D0GA 3UVJB 1HBUB 3KLEA 3RB3A 3U1LA 2YX1A 3F41A 3CCRS 1VBKA 3VGTA 1NDLA 1FKOB 2MEWA 3ZFVA 3ADAC 1QAIA 1H38A 4QWBA 4JP8A 4LQ9A 3QYYA 4TXSA 1Y7PA 3BSOA 5HLFB 2AMCB 2VFSA 3CJ5A 3I5BA 3JXOA 1S0OA 2ZE2B 1WACA 2LXUA 1Q8LA 1SCJB 1LK7A 1TKTB 1W2IA 3LH2S 3LW5C 3TJ9A 4C7QA 1V3SA 5LSOA 3HPOA 4ED2A 3LP2A 1LWXA 1U02A 1EB0A 1Y5LB 3I6PA 4L6V3 4RW4A 1NHVA 2PE8A 3BQ1A 4JI8J 4F4XA 1OWXA 1SJFA 3OL9A 2GJIA 1REGX 2RE1A 4IRKA 3DU5A 1PJ7A 5KFNA 1S57A 2GAHC 2YWHA 3SMZA 4ICLB 5K8MA 4K4UA 2DO4A 4IKAA 5E3AA 2GHWA 4LUBA 2GO8A 3K89A 2IMOA 1YITS 2VICA 3AODA 1U6ZA 1C1CA 3OFHA 4C3MA 2H4YB 2XMUA 3OVAA 1ZAXA 2G4BA 1URRA 2D3UA 4I6YA 5D15A 5HAOA 2IA0A 4BC9A 3W63A 1S76D 4G6VB 1RI7A 1JJCB 1O8BA 2EFOA 2XMKA 4LFAJ 4F0KA 3PKMA 3HFZB 3EM1A 4JI3F 1ZTWA 2IVYA 3QAEA 4O3SA 5AXNA 1IBLJ 1C0UA 4OYAA 1ZPVA 5CCMA 3KMSA 1VQ9S 5EN1A 4U7UD 1KP6A 5KFFA 2HHVA 3WX4A 4X4RA 1KTQA 2XMAA 1PAUB 1HPZA 3E01B 3MCMA 3KHHA 2FVQA 2FHJD 1CLFA 3P45B 4OZJA 4FVMA 2OIHA 1WNEA 4ILLA 2ZH4A 4P6QA 3TVKA 1PO6A 1U1MA 1EETB 3LGNA 1LWCA 4ZHRB 1T03B 2AJQA 3VV2B 1FDNA 1JNZB 2ACMA 3O8WA 5KT7A 1S1WA 5CD4A 4K0KJ 1RTDA 1V5IB 2D41A 3PG9A 1GTEA 1R27B 1VRUA 2NUHA 3HM9A 3BN7A 4J9NA 3BB5A 4WU2A 1WOSA 3IR6B 2AYGA 1XNRJ 4K8RA 3OLAA 4ZVPB 5GAHU 5L1IA 5M2PA 2V50A 2F9DA 4WF9Q 4LR7A 2MQPA 3NKYA 1WSRA 2BDPA 1BHNA 3U27A 1NPRA 3ET6A 2R8KA 5JVHQ 4NXNF 1QE1B 4O23A 1P9YA 2CZVC 2OI2A 4RW6B 3SEOA 5KFRA 4X66J 1FKPA 2ACYA 3IBCB 4MK8A 4UTGA 5A6PA 5IWAF 1N8RT 1F9HA 3RBZA 1TUGB 5HQ8A 3MEEA 1T8EA 3RAQA 2UUCF 3POTB 1UVLA 2CPIA 3POTA 1RHMB 1UFKA 2J6SA 4DU8A 4QIGA 3VGSA 3UCZP 3G4SS 2YQ0A 3D28A 4ATNA 3KJFB 1YG0A 3ZZ0A 2D7SA 3J81j 3OHAA 2FZGB 4J9RA 1KHWA 2MLYA 2PFFB 1RGVA 2AQ4A 1C0TA 4V19X 2HLUA 1FD2A 2G13A 4E98A 4WKYA 2GGPA 3D6MB 2CG8A 4J9LA 3F44A 4I68A 4URSA 4DV3J 2BX6A 3BKFA 2FB0A 2DKOB 2JFKA 2BE9B 3OR1B 2E5JA 2IJNA 4Q2MA 4RJVA 1KHVA 2DBBA 2XZDB 2F4VJ 2ZZTA 2OPPB 2XM3A 3G8SA 4DL2A 5KFGA 2LYVA 3HSZA 1NCLA 2M88A 1HQ2A 3M4XA 1QVFR 3CJKA 4DR4J 3NAIA 1WKKA 4HVZA 4CLWA 3M2UA 2XMVA 4EO8A 1U49A 1RWPB 3JSMA 2BANA 2V8HA 2QJ3A 4DR6F 1UA0A 4ZP9A 2IC3A 4CO4A 3OW2R 4CO1A 3L9ZA 3NP5A 1OY9A 1BQMB 3NY0A 1RHRB 4GRSA 2MHEA 1DRZA 1VK3A 4NL5A 3IG1A 1FK9B 4FPRA 1UP1A 2ZJPQ 2GMHA 5IFMA 2F65A 4OYXA 4R0EA 3D7SB 4F02A 1IKXB 1JLBA 2OLWA 1BQNB 3GONA 4FYWB 3THTA 2MKHA 4F4ZA 1U1PA 3PJWA 5DDOC 1IBKF 5I3UB 4CI0B 2JDJA 2PIIA 2VFRA 3CCTA 4YR3A 3UN2A 3BBBA 3B4MA 4OV6A 1VISA 2J9EA 4CTAB 2N4DA 4OMFG 4Q0BB 1D9FA 4RW9B 1RBLA 4TU9A 2RS2A 4N76A 4YOEA 1RWWB 3IWLA 3RB4A 3JB9k 2ZUAA 4MFBB 4AXJA 1D0EA 1FNMA 1T9TA 1VQ6S 1FVSA 4M5IA 4AT1B 1RA7A 1HKAA 4PWDB 5K8PA 3OVSA 5L38A 1YK9A 4M5DA 4TY8A 3TUIC 3KK1A 2HRUA 2RT3A 1F9EB 3N6LA 3NGTA 4WIQA 2MQNA 4YY3F 1CS4B 4ZJOA 1FRMA 2IDLA 5ETMA 1SKRA 2BOPA 3LP1A 1Y00A 1RHJB 3W5YA 4L3KA 1K1SA 2NXUA 5LXRA 1I94F 2LQ9A 2I1RA 5ETQA 3MURP 4DV1J 1IKYB 1D9DA 4M5HA 3GTYX 3RR7A 2WOMA 1HBOA 3MOZA 4PXCA 3DGPB 1DTTB 4NYZA 5HO4A 3VAKA 2IRXA 2I5JB 1C4CA 3HX9A 1DLOB 1RCOB 1MU2A 4WJBA 4RW7A 5LMUJ 4YHHJ 2W9BA 1PIEA 5JXSA 3U1MA 4B3MF 2DRAA 1TKXB 2MDAA 2OPSB 2JX2A 2ZHBA 1IBMJ 5FIIA 4LJMA 4DSFA 4F26A 3U7JA 1ZZFA 2QLJB 3BQ2A 4CZCA 3KNAA 3H0PA 5HANA 4DR1J 2HPUA 2MZQA 2O01C 3CCUS 1S6QB 2W9AA 5J2QA 5B0BA 4NXNJ 2G2ZA 2VODA 4DCPB 4EYHB 2I2YA 1MWQA 2XG8A 4TYBA 4H4KC 8AT1B 2G2YA 4IFYA 1QVGR 4USWA 1IVZA 4F3MA 2CPEA 2AHOB 4HTIA 2RNEA 1ZM4A 3NG8A 3PEHA 4B9SA 4LRAA 4B3TJ 4FF4A 1XNQJ 3M2VB 1R8PA 2HFUA 1OYDA 3I9ZA 3MFIA 1HARA 2C2ZB 4DSLA 3JSRA 1B99A 2C3YA 3OJSA 2F9JA 1TKZB 1T9XA 1HMVB 1WF0A 1F9FA 4ES3A 4FYYB 3QQCD 1NEEA 3EDQB 4KHPJ 3IS9B 4PG8A 3DMJB 1J5OA 2QMXA 3E3XA 3RGIA 4F4KA 2VPYB 1S7IA 3TI0A 4NI2B 2YWGA 2HZCA 2CDQA 4ZVFA 3JTOA 3PO5A 2GVZB 3R27A 4Z7CA 1B0TA 2OAUA 1YWXA 1AROP 7FDRA 2QSFA 4CNYA 3CCMS 1VQ8S 1CJKA 4DPOA 5IM0A 4F3QA 3M2RA 4ZA1A 5I3UA 2FZCB 4YEAA 1HNIA 2WW8A 3OTEA 5DZ6A 2HHUA 4CLSA 5AE3A 4WZMA 1RISA 2VZ9A 1Y10A 1U8SA 3K2YA 4DI6A 3W3SA 3GU0A 3IRXB 4ZIWA 4LF6J 3ZZYA 3Q2SC 5IT0A 1FXRA 3M9OB 1UTAA 5CA5A 3PX4A 2ZEJA 2HSEB 2OSRA 4G1IA 4DL5A 2GFFA 1GH8A 4P71A 3NS5A 2FHJA 2GNKA 2VC1A 1KQKA 1IR2A 2FZKB 1Y4ZB 3BPSP 4XIUA 3J81Y 1RK8A 2J6TA 2MQQA 2DTJA 5RUBA 5L39A 1SJQA 2CPZA 2EPIA 1O51A 4B3OA 4NZ7A 1AZSB 1RAHB 2QYGA 4CLYA 5KFQA 1GTHA 4WXOA 4ECXA 4HL9A 1NJYA 3PNIA 1TMMA 1NJXA 2DH7A 4AD6A 2ZH3A 2XBPA 2HHPA 2Z2ZA 3M6WA 4Q5VA 1KN6A 4B3MJ 1WOOA 1X5SA 1FX4A 3NNCA 3AXMA 1H6KX 3QT8A 2QLWA 4P7TA 3C2PA 1X4CA 2ZBIA 4Q43A 1UCNA 2VG6B 4Z37A 2ATCB 4ECUA 2YH1A 5AJ3J 4LR8A 2B9EA 1N5QA 2V2VA 2GVDB 3E51A 4ED0A 2OD4A 2GVDA 4O0NA 4BWMA 1D9AA 5IWAJ 5HBMA 2R7QA 3OXGA 5E3CA 1JX4A 2QYCA 3KLIB 3NLCA 1IBCB 5E3PA 2AWZA 1RABB 2DH8A 3H4DA 4UY8T 2I38A 2G1HA 1HW8A 1W7WA 3CDEA 4P73A 5CYMB 1J5EJ 4OJGA 1HI8A 3RRHA 2BE2B 1R8AA 4RNNA 3OHBA 2HFOA 3HP6A 1MMNA 1UEUA 4J9OA 1KLNA 1XNQF 2BZ2A 3C15A 4DV0F 1LFPA 2A1BA 1UAWA 2HBRB 4RUBA 3HFKA 4CQ1A 2DXEA 5AXKA 1RT2A 1YJ7A 4EFAC 4JV2A 2G2OA 2M7SA 4DV4F 5HROA 4DV2F 2MQLA 1RT7A 2G9OA 2HQDA 2MKYA 2ZH7A 3VALA 2AX1A 5SZTA 2DVIA 1VRTB 4NLTA 4ANEA 2HLTA 1RKJA 4U67Q 2RRBA 3I0SB 2FJEB 1VHFA 1RSCA 3J7AN 3MEGA 3SCKE 4LVNP 2R7OA 2Y1IA 2W2MP 3SSSA 2B4OA 2E5LJ 4LIWA 2VPWB 5EWFA 5G0RA 2ABYA 1WC3A 3VGUA 1JK9B 4DL7A 4ZPTR 1B7FA 3PVXA 5BR8F 1RAEB 3TJAA 3J7Z5 1FWKA 3CDWA 3G6VA 4ZLJA 1EKRA 4DV7F 2HHXA 2Q3PA 3MPUB 4XPCA 3IN5A 5KFDA 3HT0A 4NYOA 4NRTA 2FHKA 2DNQA 3BDEA 4EGLA 5J2MA 1P1TA 3SFGA 2A3JA 2M4MA 4KKOB 3BSCA 4LSNB 3RRKA 1AUSL 2QX0A 3TARA 4JBCA 1WKLA 2UZAA 5KAKA 1ZTTA 3F56A 1NB7A 1PJ5A 3GFYA 4JI8F 3R2CJ 3RW6A 2DHGA 4CP5A 1NSAA 3HK2A 3TW0A 5ETRA 4JOUA 1RAGB 2WVEA 2LU1A 4GVBA 3T6BA 1S1VA 3H90A 5GMDA 3H7HB 1ACMB 4C11B 3C46A 2CJAA 1RWNB 3Q8YA 3GIRA 4CLTA 1MW7A 3H5YA 3BSNA 2DO0A 1HD1A 5LMNF 5J2PA 3QWPA 2DB1A 2RDDA 4DMZA 3C6TA 1BQMA 3GP9A 4C0OC 3CD5A 3KYLA 6FDRA 3R7BB 1AYEA 1NH8A 1U0HA 2EVZA 5HQLA 4DQIA 2Z2YB 1NHKL 2RDJA 1S6PB 1GMWA 1P9QC 5D0HA 2FVPA 2ZWPA 3FFIA 3JYTA 2ZD1A 2POKA 5CQGA 3GV5B 1ZETA 3D3BJ 4YHHF 1N5YB 5HK4A 2K2PA 3QRPA 5GMKa 4RLEA 4I6WA 2FVCA 1RTIB 3PTWA 5EGYA 4WFAQ 5DM7Q 3UN5A 1M5KC 5CYMA 3NWRA 4ZVRB 3R97A 2IYIA 1YDLA 4NX9A 1ULRA 3M8QA 2CNOB 4K0KF 1JWWA 1HNVB 1U2RA 1WTBA 2KJVA 3MECB 3CD0A 2A18A 3KLGA 2M8DB 4LFCJ 2DR5A 1VFJA 4IO1A 4USHA 1S9FA 4ZVQB 4J9VA 5EX0A 4QBUA 2XWXA 5DG9A 2ZC4A 3ET6B 1FTRA 1ZBTA 4ZJLA 2XMTA 4AQYF 3TRGA 4HR2A 3DRSB 2YNFB 2XS5A 1NRKA 1GNKA 4USVA 3UDLA 5LT5A 5CHCB 3LUYA 3CPWR 4X4UA 2GAGC 3AT1B 2KXHA 3VAFA 1TL1A 3RG6A 4OX8A 1LW2B 2VC0A 4O3PA 2CPDA 4RUCA 3GB0A 1QUVA 4QZVB 4K5RA 1JXVA 1ROFA 3BN4A 5LOQA 2QN6B 1YJWS 2XTJP 3N0VA 3B78A 3DC2A 4ZN3A 3O5TB 4ZP7A 5ADZA 2N7CA 5AXLA 3CMAS 4ECTA 1V9OA 4C4WA 4OI3A 3CJ2A 2ZOFA 3IO1A 1L3SA 2FLPA 3N9UC 2ZM6J 3T5HA 4ZPVR 5HATA 3TP2A 1X4DA 3G87A 1HQUB 4DZ6A 4K4ZA 5C24B 1NUEA 2A2DA 5C24A 1RT4B 2DXDA 3GYGA 1TL3B 3ETOA 2FD2A 2B4UA 3BGFA 3BBFA 5DDQC 3R6LB 1HWUA 1WC0A 3MHYA 4KGKA 2EC2A 4CT9A 1CULB 2BQRA 3K7RA 4OYMA 1X4AA 2HBQB 2QC3A 3UI3A 2CJXB 2QL5B 2W25A 1VLOA 3NGKA 4DDFA 1Q82T 4NA1A 1VMBA 2AJ2A 1N5SA 2XS2A 1S1WB 2HZAA 2VQEJ 4B3RF 4GKJF 1GXLA 2KXFA 1SJ3P 2E7XA 3ISZA 2RVJA 3AA8A 2EXUA 4MIWA 2CVEA 2ADCA 2LMIA 2RDIA 5H1SV 4NPOA 1UZHA 1B7YB 3VVUA 2Q6BA 2BKPA 3CD6S 3MMCA 3P5TL 5CZVA 4EU0A 3CJ0A 5A8WB 5IT4A 1KFSA 3BO2A 3T1HF 4XAKA 1T05B 3VVTA 4F50A 1S6PA 1SXLA 4QIWD 1Z2ZA 2ZJQQ 1BQNA 1Q16B 1WKJA 1RT3A 3CJTA 5IQ6A 3FSIA 1RU1A 4DSJA 4LF4J 1T95A 2CRLA 4OL8A 1RKIA 1UFLA 3NS6A 4KHMA 4OZ2A 3NGRA 4RR5A 3TANA 2UU9J 1VK8A 2OPQB 6AT1B 5K14B 4U96A 4CRJA 4X4SA 1OIAA 2Y1RI 1RE1B 4XK8C 1Q53A 3A4TA 4PXDA 1O0PA 3LP1B 3PW7A 1BXNA 2ZBQA 3UVJA 2WHOA 3TA1A 2H5IB 2GIRA 3OV7A 4MIBA 2N82B 3BR8A 1QJHA 1N6QA 2ROEA 3HJFA 4CLPA 2BJEA 3IBFB 1IKYA 1OY8A 4CT8A 3PO4A 4U95A 2APOA 4FPIA 5KFEA 5A2QY 3D68A 3PYGA 1VGYA 2HFVA 2Q79A 4DSEA 1CEZA 3C14A 2VQEF 1M5OC 2E1MC 4GKJJ 4B3RJ 3NBPA 2V67A 3KXDA 1BWEA 3ZTQA 1PC4A 4EMDA 4I67A 2KVQE 4ZMMA 2R2RA 3AQOA 4UZCA 2EBGA 2JNJA 3SV4A 1H3DA 1TP7A 4OYZA 4PXBA 3HHLB 5MLCV 5GAHI 3OT9A 1IJEB 3ILJA 1S9GB 2FHOB 2NXEA 4A48A 5K8OA 2QLFB 2RUSA 4KIAA 4GKKJ 5KFLA 4CLKA 4ERDA 4R0JA 2DGWA 1VDHA 1HYSB 1XMOF 1M0SA 2BQUA 4RUAA 1NDKA 4OYBA 3PR4A 5I42A 4M5GA 1X8DA 3KG0A 4WFYA 5BR8J 4LFAF 2L9NA 1EJ7L 4NA3A 1U47A 2DEIA 2CPFA 3NGDA 3E8OA 4PYDA 1WC6A 3RYLA 3H4BA 4B9NA 2O66A 3Q8PB 1Y0HA 2FUG9 1FXLA 1RJJA 1VQ5S 1WDTA 4UUWA 3W65A 2F8MA 3LF0A 4ID5B 3MR7A 3HXMA 3C15B 2CPHA 2YNIB 1N54B 2YNIA 2QMUB 3PYDA 3E2EA 3X1LB 1TELA 4I2QA 5LJ3Y 1BD6A 2Z57B 3QGPA 2V4JA 3P96A 4WFZA 1Q8KA 5HROB 4X4PA 2ZHAA 2KT5A 3NMRA 3KFWX 3MM7B 2BEFA 2Y1LB 1BE4A 2DHXA 3FMBA 4DEZA 5HJYA 3K5MA 4QOTA 2KI2A 4QCLA 2YPZA 4ZPCA 3D6TB 4ZK7M 2AKWB 2ILYA 2OPRA 4ZHRA 3DCAA 1CJUA 4DWIA 1U8WA 3KDOA 2HGMA 4Y34A 3BO4A 1R3NA 3Q22A 2AEFA 1F3VA 2WW4A 5LXYA 3EGZA 1JLGB 4JYAJ 2K3IA 1PYSB 2Q1LA 3CJQA 3M2RB 2J8SA 1E6VB 3M1VA 3PFOA 3UE2A 3PHTA 1TVRB 1X60A 1RTHB 4OHWA 5CAAA 1L3UA 2FVRA 2ZZMA 2C3UA 4QPXA 3UD3P 3G9CA 2ZH6A 4MTPA 3DLEA 2CPJA 1S0VA 2CQ2A 2IRYA 5F8GA 2Y8YA 4DZDA 2COLA 4B9LA 2IDEA 3PACA 1Q79A 5G4DA 3SCJE 4JI3J 3QBCA 4WIIA 2YNGA 1KEKA 4WYLA 2UUBF 3IMQJ 2FJDB 1Y9OA 1WC5A 1K9MT 4DS5A 1DZ5A 1NXIA 1RWXB 3KK2B 5A0YA 2P9GA 3R2DJ 2B8PA 4ECYA 3EZ5A 1AZSA 2GHPA 1NJIT 4TNOA 1HBMA 1CJTB 1XMQF 3JQMA 2R7WA 3DGVA 1RZMA 3GYNA 3ZTSA 3KJVA 1XK8A 3A1YG 4A4JA 5KOXA 1BMQB 2YH0A 3O44A 3UCGA 3M9NB 3CEDA 4YB1P 3SDEB 3N6MA 2YBVA 5CZXA 3U02A 4FS1A 2XULA 5F8LA 1PILA 2DK2A 2Y3YA 1NZAA 3L3CA 3R7NB 2DGVA 1XNRF 1GMUA 1UWBA 3OUYB 1LXJA 1UWBB 4OHVA 3OUYA 4N8OA 2ZOGA 4DLGA 1G4CA 2XY5A 3MUVP 2DGUA 4J9KA 1X7VA 1WOPA 2YKPA 5KFBA 1QSYA 4HT7A 1FESA 3MI7X 2DGQA 2OMOA 1DBDA 3HSGA 1KNZA 3M6VA 1YLXA 4HEA9 1K8AT 3U1NA 4AUKA 4KB7A 5IV4A 2WVFA 2E29A 5E33A 2QTWA 3C6UB 5FDLA 3T9NA 3ZNJ1 1P8GA 2AIRB 4F25A 2R7UA 1LWCB 3D9BA 1SC4B 3KLIA 4IG0B 2A2CA 2C2MB 3C66A 2KT3A 2FJBB 3DLKB 2NZ4A 3BH7B 1OQ3A 2D69A 1ZS6A 1S0MA 4B9VA 1K0TA 3T41A 2V63A 2IM2A 3RU0A 3OFGA 2LDYA 3MPVA 1SC1B 4ILMA 4HHJA 3KLGB 2XLJA 2MQMA 1Q8BA 3BGUA 3RBXA 2UVRA 3K17A 3AHPA 3R1HA 5IT9U 4OHZA 2OSQA 2W4CA 3UD5A 1KVKA 3AH6A 4X62J 2D9PA 4LF9F 3W9IA 3J7YI 5A8RB 2G0JA 1WTFA 2MQ8A 3IR7B 2GV1A 1HMVA 2ZE2A 2C2OB 5IC6B 1KSPA 2MYFA 2YVSA 3SQGB 4B02A 2RSQA 3J7YU 4DFKA 1Q86T 2E9TA 2MZTA 2YWKA 4WBFA 1NPKA 1JXLA 2CNLB 3CJRA 3LP2B 2VU5A 1UKUA 1L3KA 2AZ1A 3BH6B 4E0DA 1VQNS 4IOAQ 3HKZD 4M5DB 3UNGC 1WC1A 5IQQA 4QW8A 2CJ9A 1QUPA 4Y2MA 5HMYA 3T5LA 1K73T 1RWVB 5MAOA 2ZWOA 2QSWA 1X31C 3BQ0A 2DISA 2OHDA 1DFDA 3VAIA 3FJ2A 1RTHA 2U1AA 1M5PC 2W4PA 3AJDA 5U47A 4DCOB 1SH2A 4OI6A 4RU2A 1AT1B 1NK7A 5C25A 3FGVA 2UV8G 5IOLA 3K5PA 2L3MA 2E9ZA 1MG7A 2FVSA 3MMBA 4WE1B 1RT4A 3ENAA 3MM5A 4C3KA 3UPFA 1TU0B 3CB4A 5HP1A 1JB0C 5AXMA 3KKFA 2E66A 1TKXA 1YBTA 2NPIA 2OPSA 3PYFA 1EQ0A 2Z0GA 1X0FA 3BDPA 2R7XA 4JV0A 4NXMJ 2CKWA 4NLUA 4EWTA 3UR0A 1ICEB 2VV5A 2JC0A 1ZYQA 2V68A 2Z4PA 3EZUA 3AOAA 1HBMB 2GW8A 2CAJA 2Y0SD 2HFSA 4L73A 2XWYA 4C8KA 4OZ0A 2GMJA 4HI2A 4ECVA 2FJXA 1BLUA 2B51A 2H4WB 3EXCX 3BPDA 3AA9A 1URNA 3AQPA 3DLBA 4ZCMA 1S1UB 2MJUA 1JKHB 1Y5NB 3TEHB 3N5BA 3TA0A 1VI7A 3NRBA 5ETOA 3TAQA 1REVB 1B70B 3T1YF 1N33F 1KVJA 4QR1A 5F3TA 2FDNA 1FFGB 1OSDA 1TR0A 2ZBPA 1HI1A 5A8WA 1TK0A 2AGQA 1FXDA 1SPBP 1YI2S 4CLLA 1X9WA 1NJWA 3EGNA 1NDPA 3Q8QB 5L1JA 1S77D 5DO2A 2U2FA 1OS5A 2N3LA 1VBZA 4KC5A 1IKVB 3AJ2A 4O44A 1VBYA 3MAAB 2ASDA 2K7JA 3B82A 1C1BA 1N5VA 2AF6A 2J9DE 1C1BB 2ZDOA 1HFEL 3D1OA 2EFVA 4IG3A 4DUYJ 1UVKA 1VQSA 2CZ4A 4KPCA 2O5DA 3LOUA 3KJNB 4DG1B 2FGOA 2KB2A 3DOLB 2I6WA 3GFZA 4ZCIA 3OL8A 1VQOS 4OZLA 2ZH1A 3B8HA 2UU9F 2KJWA 4AFFA 2XY7A 3WDOA 3H20A 3WQPA 1EP4A 1ZA1B 4CLFA 1FJGJ 4AL5A 4LFBJ 1TL1B 3NNHA 5KG0A 1S6OA 4CH1A 4OZ1A 4J9SA 1FJGF 1WHVA 2WOMB 3W5XA 4X64J 2YQ3A 1TV6B 4RKUC 5GAEI 2HIQA 3QSYB 2P9EA 3DN9A 2P5VA 2R3VA 4LREA 4WP3A 4DV7J 2GQ2A 3JS9A 4PXEA 4L3NA 2UUBJ 4DR5J 2R2TA 1AB8A 4NLRA 2QA4S 2AYMA 4MKAA 2Z56B 3DRRB 2IM1A 4DR5F 2K3KA 2V4QA 2PEBA 2HNZB 3CGIA 3MZIA 3PJXA 2HNZA 3VZHA 6FD1A 1V3ZA 4QQBA 5C5JA 4B3SJ 3PRBA 2HFNA 3QWUA 4X65F 1M5VC 2PC6A 4LF5F 3BGRB 5B7WA 1E6YA 2WSFC 3C6TB 4EI2A 1CBKA 2V8GA 4Q44A 1C0UB 2XNQA 3BJYA 3IP0A 4MKVA 4P72A 3MD3A 1CULA 3QIPA 2YPYA 2X3GA 3MM5B 1G2EA 1IKXA 1JLBB 3MMAB 2PFDA 4YQWA 4ZKAA 3HD1A 2ZHOA 1S1VB 2ASYA 3A8KA 1EETA 3K58A 4NCAA 1MSWD 3HSDA 5DDPC 4GVLA 4F4WA 2HHHF 4HT5A 4TQRA 4RW9A 2XSJB 3UR3C 2YXLA 1HPZB 3E01A 5JVGQ 2BANB 2J7WA 3NOGA 4QU7A 2KVIA 1RTJA 2IC3B 2M5YA 3H5SA 4G1QA 4NOHA 3AOBA 2KHCA 1VCTA 2VFVA 1JXEA 3S01A 3CVKA 4A8OA 3VAHA 4CDIA 1A9NB 2OFHX 4IH6A 1SB6A 4K4WA 2RJZA 1RT3B 4K7QA 2FC9A 4WWSA 1H72C 1HWKA 1E6VA 2YKQA 4J37A 5DRKA 4CNZA 3MM6B 4Y2CA 3ISND 5I3QA 3JAMU 3B6BA 4FBTA 2ZUGA 2A6OA 5JJBA 2DGOA 4OV1A 3T5KA 3PV8A 3TO8A 2W9CA 2BA9A 3N6NA 1EX8A 5H9FK 5DZ7A 1HD0A 2VKRA 2XYPB 1DQ9A 4AE5A 1FVQA 1VQYA 2XHCA 3EVOA 3R5JB 4FBUA 1NH7A 1XR6A 2W1BA 1SQGA 4WPAA 2HVEA 4ZCLA 3CCVS 3KG1A 2X1GA 4PEOA 2BRKA 2MKJA 1ZOTA 4NE9C 4Y2IA 3IXQA 3D2WA 3QJPA 2VKZG 2V8VA 3M8PA 1YSJA 3G8QA 4ZPAA 1WELA 3Q86A 4M5NA 2K8GA 5SUHA 4OZNA 1S99A 3M9MB 1IM4A 3C19A 2V0NA 4J7CA 1G7CB 2VONA 1VOMA 5DETA 2PI5A 2MGZA 2PMHA 4DJBA 4DU7A 1U1QA 3IWXA 1GQEA 2R9LA 3HVWA 3W2WB 5F9NA 3SSQA 3VF0B 2NUUG 1JMTA 1HA1A 1GMVA 3GZ7A 2FJWA 1N32F 2R8HA 1RBOB 1S1TA 2QRRA 3D0IE 1XN9A 1D3WA 3D67A 4L76A 4DFJA 1A0OB 2UUTA 4A47A 4ECQA 1VBXA 1VQKS 3DLLQ 1ELOA 3PXGa 2CQDA 1FF2A 4J9QA 2MZSA 3H8YA 5LSRA 4TQSA 2YNHB 4ZJQA 2C28A 4EO6A 2KXNB 1JQGA 2H1YA 4I2QB 4NLPA 4X4NA 5C42B 2WONB 4K59A 4A8WA 3R6GB 5EUHA 3MOJB 1DHMA 2F8EX 3DRPB 1X4EA 4A8FA 2XCAA 2ZBCA 3VGVA 5J1PA 2GQQA 2DHAA 3FMWA 4YDXA 4KGZB 4OYWA 3EGVA 2JL9A 1WWHA 1U7LA 2VFUA 3SQOP 1NBEB 2JLEA 2X1AA 1TUWA 2BRLA 2CYYA 1TL7B 1RWMB 2ROPA 4DX8H 1KOOA 3PY8A 1NSKL 1OJ4A 1Q7YT 3WBZA 3TZXA 4LMZA 4IFVB 4M94A 1H0HB 3WIVA 3TAMA 1OY6A 1JLGA 1S7HA 5E41A 4DV1F 4WP8A 2KO1A 2KRBA 3IBWA 4I56A 1Q8IA 3PKYA 1DTQB 1XEZA 1DTQA 1EARA 2CPYA 1S48A 2LQBA 3VTIA 2HBZB 3HHEA 1Z4UA 3GSDA 5B0CA 1KBRA 1YJVA 2VBWA 3DDNA 1S9GA 2JZ5A 3HVRA 4PG4A 1IN0A 3AB2B 2DIUA 3SYZA 1N6QB 4JI4J 3KJVB 2DRBA 2R4FA 1S79A 1PSDA 5D4NA 3TZYA 4MKYA 5HQMA 4DPTA 4XTTA 2MXYA 4GO5X 4V19J 2CJBA 4HTJA 4TN2A 2WVBA 3GJTB 3HHLC 3QT5A 2ZC3A 3D0HE 3FCHA 2LKZA 1OO0B 1ZA2B 5A6WA 4JI6F 4DLEA 4YN3B 1S4EA 3BS9A 1QY7A 3EVWA 2GIQA 1G3OA 2Y1JA 5AT1B 1F5AA 2NCKL 3HHLA 4UOFA 2Q6CA 3VAMA 1PGZA 3EGWB 3EWGA 2B7BB 3I9V9 3FBBA 4OZ5A 4DN0A 2XB2D 1HHQA 1L3VA 4DXLA 1CJVA 4HH0A 3HHNB 2OEMA 1R6VA 3FSYA 1OQ6A 1VQ7S 2HWHA 4HLBA 1S0NA 5B0EA 3MM8A 2C42A 1RHUB 4PABA 4QWAA 3FDSA 4DUZJ 2OH2A 1X4BA 1JLEB 1SKUB 2AEMA 4BC7A 5HMZA 2EW9A 3I55S 3DDIA 7AT1B 1QAJA 3MXHP 2KFNA 2AJ0A 1F6TA 2EBEA 3TUJC 4NLQA 2C1EB 4K50A 5G0RB 3CC2S 1DAXA 3GR0A 1CJKB 2BM0A 2VHGA 1TVRA 4R8UB 2HAIA 2LEBA 2PO4A 1NO8A 1RADB 3PW5A 2IMWP 2XYHB 3H5XA 3HZGA 1UPMB 1HL6A 4NI2A 2V4JB 4P2XA 1I6JA 4ANDA 3LP0A 1Q0NA 2KT2A 4UOHA 4C6AA 2V34A 4LVOP 1QM9A 3CE8A 1OSCA 3EUNA 4ID8A 5E7OB 2PEHA 1BWVA 4C8NA 4P10A 1DURA 1RDRA 3S7RA 4CM0A 1WG4A 3R8YA 4D3GA 4WFBQ 5D4OA 5L8RC 4N56A 2B43A 1LOUA 4IOBA 5KG5A 3H2LA 2LEAA 2NREA 4V1Ak 2YKNB 3KJQB 3W7BA 3R3TA 1RQ0A 4QYZJ 4F2RA 7FD1A 4KBIA 1SI9A 3FSXA 5CYQB 5HVFA 3ZZZA 1HHTP 3PRDA 3TNVA 1TL5A 1HQEA 3VR1A 1Q78A 3IFEA 3M05A 3QZ7A 2E1RA 5IZHA 2CFXA 2QV6A 3Q89A 1SC6A 1VQPS 3KOAA 3ISNC 1MWYA 4RWWA 1DTTA 1T11A 3L7OA 5ETPA 4ED8A 2VG6A 3CD7A 1DLOA 1N52B 5J2PB 1H2TZ 2RMLA 4AL6A 4DL3A 1Q5VA 4RU9A 4KKOA 4LSNA 2C3PA 1HWLA 4B9TA 2CPXA 1X0PA 2RQMA 2IJFA 3UFCX 1H73A 3HVTB 4HKQA 1NK8A 3US5A 5F3ZA 4RX6A 2DPJA 5GAEU 4XPEA 2YQ1A 4I7FB 2FTRA 4B08A 3GIKA 5H9EK 3KLHB 4CYUA 2DITA 3CIMA 1VLYA 3D0GE 2C2EA 1RT2B 1RTIA 3R9LA 1RBAA 4DHVA 1R8HA 1P6TA 1U24A 1UJ5A 3AB4B 3HI9A 1S9EA 1SKSA 1VHIA 4DV0J 3O1LA 1PBAA 3SI8A 2NYHA 3C8YA 2Z2LA 4HACA 2R7RA 2RKIA 1R8BA 1PYTA 4WK3A 1IXKA 3W61A 1D09B 2KYZA 4X4OA 4KH0B 4URQU 4DV5J 3JSYA 2G0IA 3FQKA 5DQHA 5L1KA 2M2BA 3R5AA 4HDGA 5BXIA 5DG7A 3HSJA 4HHUA 2YY3A 2RQ4A 2ZD1B 4WTYA 5KFSA 2MPUA 3GJQB 4LF2A 3Q8UA 3DYAA 2L9WA 2PDAA 2LEPA 4FNHA 4DV6J 5LL6d 2DCLA 3LWMA 2DR7A 4JI2J 3EMTA 1S59A 3HZEA 3ITHB 4YY3J 3OTOF 2VJVA 1S6UA 2HNYB 2PD1A 1UW4A 2DHSA 2HNYA 3TUZC 4C8OA 3PRVA 1UFWA 4UUXA 3TJ8A 4ETXA 2FY1A 3OXLA 1WUUA 4CO3A 2UV8A 2W8KA 2IBOA 2C2RA 1T3NA 1SV5B 2NXJA 3P49B 1EHWA 4N8NA 1FDDA 3BKTA 2B56A 5A8RA 5D4LA 2CUYA 5D78A 2CQ3A 1I1GA 4I2PB 2GGPB 2NSBA 1TKTA 4U8VA 4WE1A 1SJ1A 2RD5C 2V2KA 4JI0F 2AJFE 4QJVA 4TU7A 2R7SA 2HYIB 2BW2A 2GO9A 4NZ6A 1MMDA 4OJ1A 4P7VA 1JLFB 2MZ1A 2W7PA 3H40A 4LRFA 1V3RA 2VQFF 4RW4B 3S1TA 2EFQA 5GAGU 1DY3A 2E1PA 3CMES 4UT4A 3MAQA 1NKBA 2XHWA 3G2XA 4JV5J 2OKQA 2DNLA 2ZNYA 5M2UA 2XNRA 3BGRA 3QPIA 3DOMB 4JI5J 1FWLA 3K59A 2Z8QA 1WSVA 3W60A 5ETVA 4F36A 4KGXB 1O5JA 4USTA 1W25A 3V2UC 1QD1A 2VPZB 1RLDA 1GX5A 1M5HA 2LCWA 4U6PA 3IG1B 2DR6A 3FZ2A 1IKWB 4S0MA 2IVFB 1C2PA 4KSEB 3CCLS 1NSQA 2HHSA 5F8JA 4RNMA 2YWEA 3BBCA 2RUGA 3I87A 4CH0S 1FNXH 4KAIA 1RAOA 3BGOP 3HVAA 2V9KA 3DM2A 3M8WA 1KC8T 3QATA 2EG1A 3SFUA 5KG3A 4CO5A 5F8MA 2NR0A 3OXFA 3CF5Q 4TKTA 4EUVA 5HMWA 3MD1A 3QIDA 3KLFA 4ENOA 4IQXA 2EEYA 2H3EB 5KFWA 4Z7YA 2P6TA 4G1QB 1G6BA 2ZDPA 4KRWA 4U7CA 4F2SA 3AFGA 3ENWA 3MECA 3K5NA 2BM1A 1VRQC 2C22A 4I7FA 3HKWA 4FKXA 2D3ZA 5CXTA 4KPYA 4IG0A 4TY8B 3KK1B 4OJ3A 4O3OA 5HI7A 4PZVA 5KFVA 1JJ4A 2EFNA 1LWFA 3BGLA 4NCBA 4ED6A 1RWKB 1WC4A 1VIOA 3MM9A 4NXMF 4C8MA 3DFEA 2R2UA 2D3OR 4Q8FA 4YB5A 4MYTA 3G6ES 1MNEA 5HL7Q 4R5PA 2C2NA 4TLRA 2VH7A 2QIFA 1RACB 1FT8A 4IRCA 5F8HA 4FXDA 1MROB 3NCPA 4E2FB 5C2GA 4PPZA 1UA1A 1N36J 3QRQA 3HD2A 4OX7A 4M5MA 4FXVA 1FCAA 2BKNA 2P6SA 1FKPB 1X9MA 1QSSA 1SIZA 3SQGA 3CXCR 3EPGA 1FRLA 2W9BB 5KG7A 1SUQA 1YIJS 3PR5B 4C97A 5DLFA 4KGVB 3AJ1A 4TLQA 5KFMA 4MYUA 2DT9A 1WORA 3ITHA 4EBCA 5DGAA 2V69A 3KLEB 4QYZK 4NWBA 1B3TA 2VBXA 3EICA 2W7OA 3CCJS 3QT6A 1SC3B 3QGHA 4JI0J 2PI4A 1RT5A 4URGA 4WTOB 3QNWB 5DJBA 3HHKA 4A8YA 5B0FA 4CO2A 4DPWA 2UXCJ 4IFYB 2HHTA 4G1PA 1ZZNA 1RYSA 2OP5A 5L1LA 4DV4J 3GFXA 3SZ2A 4ECSA 2RHSB 3OR1A 3BM7A 4Z2XA 4NZ0A 4ED1A 1TL3A 2JC1A 2ZKUA 2AEJA 3DRRA 1SQEA 2L48A 1HWJA 1TL4A 4A8QA 1GXUA 1UJ6A 1KLMB 5LSLA 3HMJG 1KQSR 2B9WA 2HQFA 3MCNA 3ZZUA 1AUDA 3ZO7A 4ZLNA 1TTHB 2MKSA 3UW1A 3LTOA 4DX5A 2OEKA 3ETMA 4NLVA 3OTBA 4X64F 2YWFA 2GZOA 2IAJA 3CJ4A 1RT1A 5I42B 4DQPA 2V8DA 3PM9A 4DR2F 3EVMA 3O2IA 1Y11A 2ALYB 2J7UA 4FXWA 3N79A 5C42A 2W8LA 2XZWA 1J27A 5CD4H 3GV8B 3AD8C 4ECRA 3DNCA 1PC5A 1SH3A 5EDWA 3TQEA 4FVCA 1U0SA 1N0UA 4MKBA 4YDDB 5T14A 2PN6A 2J76E 1SIWB 3RW7A 5CYJA 2WONA 3QMQA 1IM6A 3QO9A 2KZZA 4BHQA 4F4AA 3D54A 1YJNS 1FWPA 2FGCA 4LBHA 3ZNUA 2CJKA 2F4VF 3DRPA 3GIJA 1VQ4S 1RAAB 4N7TA 2JVRA 1KWMA 2WBMA 3H98A 4NRUA 1WHWA 1T03A 3DKDA 3I0RB 2R42A 5B0GA 1M1KT 3LO3A 3OD2A 5AJ3F 3TAMB 3L7UA 3QFWA 1IBLF 1R0CB 3MR2A 5DS7A 3JSBA 1WEZA 1JLAB 2QMWA 3B4DA 3BEGB 3SSRA 2Y9HA 3QRRA 1APSA 2R8GA 1R0BG 5J1NA 4DN9A 4KHRA 2Z30B 2HBYB 4MK7A 2C2DA 1M1HA 1YBAA 4LSZB 4X4TA 2W9CB 1IQTA 5J2NA 2M9KA 3DGPA 2JVOA 1HBOB 1LEOA 4PYAA 1CC7A 1HR0F 5IV3A 4G3IA 2R7VA 1HYSA 3P5BP 3LALA 3DRXA 2J0WA 3HLUA 3W2WA 1FRXA 3C16B 3HCXA 1NDCA 2FIUA 2VG7B 3CCQS 2EI5A 1UEKA 1QDUB 3FNNA 1NZ8A 3KUEA 3S8SA 3KK2A 4O3RA 2IY5B 3HVTA 3PX6A 2IHR1 1TQLA 2DGXA 3DDKA 2N3OA 2W2QP 4ZPBA 3K57A 4JB8B 3EPIA 1X4GA 1XIQA 2VJUA 4J91A 3PYEA 1U1RA 4PQAA 1EKSA 2IIHA 2DNRA 5D3GA 2ZJRQ 4EEYA 4YMEA 4X4QA 1E6YB 2E5LF 1K0VA 1H2UX 2WZ1A 2EK1A 4Q7AA 4ZP8A 3M8YA 2ZVIA 4O0IA 2HS3A 3KWMA 3OR2B 2G1DA 3KG4A 1S10A 2YKMB 5B08A 4J9PA 5K5MA 3QGGA 1U2CA 1XMBA 1KQGB 1NPPA 2E5GA 1XERA 3MF5A 2DRDA 2RKIB 3WC2A 1U2FA 4PUOA 2FJVA 4DL6A 4PUOB 4PRFA 3BYRA 2F5GA 3TEGA 4RZRA 2XMMA 4H4MA 1HR0J 3CT9A 1LKZA 2PSZA 4A8SA 1U1KA 4IR9A 3RBDA 3MM7A 2BV3A 3C6UA 4ES2A 1IBMF 1RTJB 3DMJA 1NK4A 4JI5F 4W98A 1T3OA 2EKNA 3Q2TC 1JIHA 4HHHA 3MMCB 1UL3A 1CJUB 1U6FA 4IFVA 2HG4A 5E3QA 3VAGA 1SJ4P 2HHQA 1NB2A 4GKKF 2QA4G 2XYGB 1GAOA 3NS7B 3DXSX 4ETZA 4ILRA 3FBEA 2HRYA 4OI4A 1TV6A 3DLEB 3RZAA 3DRYA 5K14A 3PX0A 2UXDF 2XZTB 2QO3A 4L75A 2UVVA 4FYDA 2IFXA 1FD8A 4M1KA 2OEJA 4PWDA 2DD8S 5DLGA 1MWZA 2B0GA 4RW8B 4Y2KA 5FLXU 4BS2A 2UUAF 2XEXA 2CJYB 1K47A 2MSTA 3IA0A 1HQEB 2XY6A 1IBKJ 3M8ZA 4TVAB 2PMZD 4MMOA 3V5RA 2ZH8A 1SL2A 4QPTA 1FI4A 5DQGA 5GVQA 1NSPA 5A0YB 4DOZA 4B9MA 2V94A 4GC6A 1F2HA 2W2PP 2WVDA 3MAHA 3OQ2A 2XCPA 3Q0AA 2KG0A 2OMLA 2VPXB 2YKAA 3I4HX 3NBPB 3FUYA 2AU0A 5HJXA 1HNWJ 4KJIA 5IS2A 1YTYA 2XS7A 1KR4A 2HS4A 4EYIB 4B3SF 2OTJS 3OLBA 1X9SA 1TZ0A 3ZZRA 2JEGA 1U0HB 3T19A 3CDUA 2I5JA 4LF9J 4ZIVA 3MMAA 5H9EJ 1REVA 5K9FA 2B5JA 2EKYA 1QTMA 2B5JB 4F4YA 4J5OA 5F8NA 4P74A 3QJLA 2QEXS 4USKA 4QWCA 5KTQA 5DDRC 2RH3A 4ZVTB 2E1CA 3UCUP 3CO9A 3LAKA 1R89A 3P8BB 1YJUA 5GMEA 3M8SA 2V2ZA 2K1RA 4O4GA 4I4BA 4H4KA 2AGPA 1GEHA 2FJAB 2HVDA 1CPZA 3RR8A 4QIEA 2DCUB 4NLWA 5ETSA 3K0JA 4IOCQ 3ONQA 2AJ1A 4IG3B 2ALZA 1FJEB 4NASA 2J8AA 3T1HJ 2AD9A 2IBKA 1JJHA 2NS1B 1JLQB 1KTVA 2Q43A 2NYIA 4K4YA 1JJ2R 2AYEA 3H59A 3IR5B 1HNZJ 2IRUA 3M7VA 1SVDA 2JLFA 3T3FA 1HW9A 1RT6B 2K06A 1VQMS 1RT6A 2NQPA 3MGJA 4Q45A 5J2QB 4ZCKA 5ETLA 2H65B 4H4MB 2DYAA 5K8NA 4KO0B 3GJRB 1UVMA 4NLSA 3HHDA 2EK6A 2W24A 4IH5A 4RW6A 2RAQA 2VL1A 2BYCA 4U9RA 2ZH2A 3VQSA 2QL9B 1NAQA 2V5HG 4C2MA 2EFGA 2ZNZA 2NPFA 2J6UA 4OYIA 4GMKA 4RNOA 4WU3A 1HHSA 1WF2A 1B0VA 2CJQA 1ZM2A 2XSFA 3CW2C 3LP0B 4WYWA 4X66F 4WCEQ 1SQFA 2A10A 1UW9A 2HQGA 4OZ3A 4PWWA 4TY9A 5C2CA 1S49A 2WAQD 1FKOA 4RL1A 5ETTA 3WZ0A 4BDPA 2BR0A 1GMWD 1LWEA 2GC8A 3CJ3A 3UD4P 3QLHB 2JEFA 4JI4F 3SV3A 1RAJA 2BVZA 2F4FA 2IYGA 3SBMA 2VFTA 4ZN1A 5E5NA 3PHEA 1CG2A 2ERRA 1ITPA 2RIJA 4KFBB 4KE5A 4C9DA 3CTRA 2YTCA 4DF8A 5EWGA 1XR5A 2ZBRA 3OJUA 1SKWA 3NL0A 4RUHA 4EK2A 3Q8VA 4LFCF 4PG7A 1S1TB 4I1TA 4R25A 1WG5A 2F40A 4CYUB 4F04B 1XTZA 5JUMA 1WEXA 2WCXA 4L74A 1H7XA 2ATLA 3QSIA 2W2OP 3H42A 4J90A 4LF6F 3NCQA 1F3FA 3GJSB 3ULHA 3IAM9 3T6JA 4CH7A 2CVIA 3WX8A 5H9FJ 2E7VA 4ED5A 3W1YC 4ANCA 2FHMA 2WSEC 3GQCA 1T9UA 3MDFA 4HDHA 4ZS6A 4DR3F 2KM8B 3VHQA 4UQGA 1S5ZA 1JKHA 2G0CA 5KFAA 4DR2J 3SCIE 2KKHA 4QU6A 2QFIA 2OD6A 3THPA 2CG4A 4X4VA 2LQ5A 3ILIA 2LLZA 2YWWA 4LT6A 2M70A 3NGSA 1MMLA 4USIA 3DLKA 3QO9B 3LANA 5KFIA 2DNYA 3W2VB 4ZVGA 2X3DA 2OUGA 1ZM3A 3TR5A 4QIFA 3M8QB 3R5CA 3ZZOA 4WFNQ 4K4TA 5KFKA 1EP4B 1IKVA 1RWUA 4O44B 3ZTOA 2MJNA 2HNDB 1H74A 4R8UA 2X1FA 1VC0A 2V2QA 2B9YA 1TAQA 3FQLA 4YFUA 1RHKB 3BO3A 3V6DB 2AT1B 3CSKA 2DH9A 3AXKA 2AZ3A 1LW0B 1S1XA 2PT0A 1WDDA 3EYZA 1S1XB 2WBRA 3MM6A 3DRSA 4UZBA 2L9DA 1IWAA 4EBDA 2VA3A 4EZ6A 1LW2A 3J80U 3MEGB 3V6JA 2WB4A 5CCLA 5LM7E 4O3NA 2W7AA 1FO1A 3HFVA 1M90T 4P2SA 2JOQA 4I64A 1LQ9A 4K2JA 4TU8A 2PMWA 3W9JA 1VQLS 1WHXA 1GFWB 3F0NA 1NK6A 1XC9A 1Y3KA 2HKEA 1C0TB 1V5VA 3UWTA 1DQAA 1NKCA 3FRZA 2HEKA 4LF8F 2UXBJ 1RA6A 1IKWA 3J7ZT 2DY9A 4P52A 1FNOA 3DI6A 3W9HA 3IGNA 4KGMA 4NMLA 1VC5A 4JI6J 4LBPA 3RJMB 5HP1B 4NMXA 3TUPA 4OQJA 3MPDA 2CQ1A 3MPWA 2DIVA 4KH1B 2V4RA 1KDNA 3HULA 1MN7A 1KLMA 3KLVA 4DUYF 2VOPA 5D8HB 2JRSA 1S12A 5C7PA 3J7A1 3V81B 2Y0BB 4EZ9A 2CWXA 1U09A 3DOKB 4M5LA 4CLUA 2QA2A 1Q1KA 1Q4RA 2V6AA 4M5KA 4QR0A 4WXWA 1TKDA 2UUAJ 2RQCA 1R6YA 5IT9Y 1LFWA 4C11A 5E2QA 2DJWA 5BJRA 3KLHA 4W90B 3ZZPA 1SH0A 2CQ0A 1J5EF 4UOGA 4N41A 1KS2A 1WHYA 1BGXT 1X4HA 3ILLA 5B0DA 5DM6Q 3RBEA 1N4LA 1Q95G 4KYZA 3M1VB 2FPHX 4IQMA 1FFWB 2VF3A 3KHLA 2CQCA 1UEVA 2ZVSA 4LF7J 4J9UE 4PCQA 3CMQA 1AXQA 1N0VC 2DNHA 3CCZA 2BUNA 3EJMA 1MROA 1R7IA 3MFHA 4IR1A 4F67A 4GO7X 1BQXA 1QTNB 2WSCC 3BR9A 1UMJA 4W4MA 1KRPA 3IWNC 4K4SA 5HVHA 4ITSA 2KYXA 2UVUA 3K8VA 3DYAB 2V8PA 4LQ3A 2OGUA 2HURA 1LWFB 4DR6J 2A0FB 4H4OB 1U25A 4C8YA 2GJ2A 4XO0A 1HBUA 3A8JA 4NYPA 3A3PB 1MN9A 2BBEA 3PIOQ 2XI2A 2AJ4A 2FQQB 3BYPA 3IGVA 2ASLA 3A3OB 2HNDA 1X5OA 4WFXA 2B6AB 4ZOSA 4M95A 1T02A 2M3DA 3JTNA 3M30B 4LRBA 2XQCA 2HVHA 1I51B 1H7WA 5KG6A 3GV7B 1MU2B 2W4DA 2VUGA 2VG5A 4N47A 4NLYA 1KFDA 1GK8A 1M5SA 3NXZA 2QT7A 1PKUA 1VIXA 2BW7A 3GFHA 3FVYA 3BF4A 1T94A 4NLXA 1U1NA 4JI2F 1F60B 2HK3A 2KHDA 1YJTA 3O6QA 1WI8A 4OLPA 3UDVA 2PGCA 2JH3A 2L41A 1FHTA 2RRNA 1RU2A 3MUTP 1C4AA 3CNQP 2ZOMA 2RU3A 4USMA 1M1GA 4DX6A 5KFCA 3Q23A 4DV6F 2HK2A 1XWLA 3CUNA 4DQSA 2NSCA 4DPUA 1BC6A 2XI3A 4ER8A 3MEDB 2RS8A 2BMBA 4QYRA 3KHRA 4DUTA 3QIPB 4M8LA 3T5JA 5LJ5Y 4PAAA 1RP5A 2JFDA 3TX0A 2XC9A 2BOAA 4NCGB 1TAUA 3LPEA 4LSLB 4MJKA 1IQZA 4P2MA 4LF1A 3DLGB 1X5TA 4ZVSB 1D8YA 2RF2A 1NJZA 1EZZB 1U1LA 2CQPA 5J1EB 3OR2A 2HVIA 2ZM6F 1CJVB 2HVZA 1PAEX 4MFBA 4NEZA 1H98A 3D5MA 3L09A 1KKHA 4FYVB 3MEKA 4LR9A 2VQFJ 3PW4A 3QJJA 4IDKB 1F5CA 4IH7A 3GMGA 2B4PA 4PPDA 4UOCA 2RB7A 3AD9C 4HH1A 3W8PA 5ETNA 1RWOB 4PWUA 2XMJA 5ITHA 3MM9B 1I3OB 2GMLA 4DX7A 4LRCA 5KFJA 3H2VE 5KT4A 4JI7J 2C3OA 1UZDA 4MK9A 4Y3CA 3OBIA 5HVGA 1XBWA 5KOWA 2V9WA 4HI1A 3RRGA 4ZVOB 3DXBA 3UN3A 1N5TA 5KT6A 2XGQA 4PKDB 1TMJA 2DY1A 3PJ9A 1NLKL 3OL6A 1NHUA 1CC8A 3C16A 3LPYA 4ED3A 5E0OA 4GC7A 2OPQA 3GCWP 4PQUB 5L46A 3IRXA 3RTVA 3PW0A 3IM9A 3EXYA 2RQKA 1RAFB 4DUZF 2WB1D 4G65A 3I96A 1N56A 1KVIA 3DOMA 1S6QA 1CJTA 2I9SA 1WJ9A 3QFHA 2BJ8A 4GVBB 4F0HA 1IUJA 2FY8A 1HNZF 2J0QD 3K5LA 3NWGA 2B6AA 1WD6A 4Y2AA 1AFJA 4MAKA 1ZM9A 3FZBA 4X2BA 2QFJA 2O67A 3L4BC 1LK5A 2E5HA 1X4FA 5M2RA 2VB6A 5D77A 4DQQA 1FKAF 1UVJA 2VG5B 1KQFB 1FEEA 2DHHA 1YZ7A 3HT3A 3Q8RB 3KTQA 2WVCA 2D9OA 3EZOA 3HHLD 3RAXA 2R2SA 4U8YA 1JNRB 2MY8A 3BZQA 2HRTA 2Y8WA 4ELUA 2HFZA 3HDSA 3FCWA 2H51B 3I56S 3D6HB 4DSKA 2ZH9A 2WK4A 2HMIB 3JYTB 3W64A 4B3TF 1D8ZA 3J81U 1QLNA 4M63A 1RT1B 2EFPA 2F3JA 3JTPA 3P6YC 1B0PA 2AYBA 4B17A 4KV8A 3GSIA 5BYQA 4AXIA 3JAMY 3EE3A 2O1PA 5KFZA 3QGIA 4BWJA 4YR2A 3I82A 3A3NB 1S97A 2AX0A 4DG1A 4ZITA 3EDRB 4RBUA 2LQJA 4Y0FA 4KTQA 1YRTA 3G8TA 2KU7A 4UQTA 2J9CA 3CULA 2MLXA 3N01A 3DLGA 3JQJA 4Y28C 5F8IA 4JV1A 5EWEA 1IWGA 3D4JA 3V4IA 3MR6A 2RU9A 2QG9B 2YKOA 2PA3A 3R7SB 3V4IB 1RHQB 4RWXA 2D1CA 2H48B 3VCDA 2ZH5A 2ZFHA 3GLJA 1T9WA 2IPOB 1VR6A 4IYQA 3CCSS 3ZXWA 5KFHA 2QLXA 3FEXB 5FLXY 3ELHA 4CIOA 1N48A 3Q8SB 1KONA 2JEJA 1JLFA 1S4FA 2QL7B 1FA0A 2GIFA 3I0RA 3AD7C 2MB0B 1U48A 1I5OB 1B4SA 2H5EA 2UUCJ 4FYXB 2X1BA 4ICLA 1JLCB 1W2BR 1YVFA 5J2MB 1OMSA 4OI0A 3RB0A 1R0AA 4WKRA 1CQNA 3ENVA 4RBTA 3MMJA 1SV5A 4DL4A 4RNFA 3A8EA 3GPAA 3ILOA 1C1CB 3CDBA 3FRYA 4DV2J 1QAXA 3T1YJ 1N33J 2ZZNA 1HQUA 2LXIA 1PG5B 1YJRA 4FZVA 2B4VA 5IC4B 5AE2A 1U1OA 1L3TA 4ZVEA 4YB6A 2GX8A 2BJ1A 1HBNA 2LQ8A 2QGFB 3VZIA 4DCJB 5DG8A 4X62F 2F7VA 2W01A 1TK5A 1PJ6A 1WI6A 2MSSA 5HBMB 4QWDA 1SBRA 4PQUA 1GXTA 3W62A 8RUCA 1OPZA 5FJ4A 1RXOB 5KT5A 2ADBA 4I0WA 2FLNA 2LU2A 4DR4F 1TFYA 2HZVA 2R8JA 2BXJA 2DXFA 1FE4A 1R43A 3A13A 1N34J 4LFBF 2AP6A 3B54A 2XLKA 2IA6A 1FJCA 1U26A 1P1LA 4FKYA 2VBYA 2CWKA 1O6XA 3A12A 3MUMP 1ZAWA 4QWEA 5KFXA 3PW2A 5BYRA 1S1UA 5I4MA 2CA9A 3I5CA 4DFPA 4JUZA 1LNQA 2WTFA 4A8XA 1RTDB 2J5AA 1FRJA 2YKMA 1VRUB 5KFPA 2XO6A 1NNDA 1RB0A 9ATCB 4A8MP 1HNXF 2DNZA 3DM2B 2VASA 3P3DA 4HACB 3X3UA 2DNPA 3R5GA 3KK3A 1JLEA 2H5JB 3KK3B 1U45A 2GS8A 2Z2MA 3G82B 1UJ4A 2I0XA 1F5BA 3QT7A 3LGMA 1G1XA 2R7TA 5KFUA 3NAHA 3KHGA 2P8IA 2P9CA 1OYEA 4N77A 3PFEA 3IS9A 4XDDA 4X65J 4LF5J 4ALZA 2AW0A 3CIZA 3DHWC 3MAAA 2HWTA 1CSJA 4H4OA 2ZITA 1FFSB 1GX6A 1JLQA 2E7WA 2Z58B 5AE1A 2XGPA 2X7IA 2N7YA 4LBIA 4JI7F 1RT5B 2CQ4A 2DNOA 2MHNA 3I0SA 1LWEB 3GG0A 5GAGI 3VQTA 2CADA 5J2NB 4HYKA 1NK0A 5L9XA 2YX7A 2MGZB 3ENQA 4FP9A 2YKNA 3GE9A 2HQIA 2M52A 4KFBA 5D0RA 2NXNA 5KFOA 4M5JA 5BYSA 1FDAA 2PA8D 2VG7A 4QR2A 4OX9F 1YX2A 1SUQB 3UDEA 5A76A 4KHPF 4OI2A 3T1AA 2J9DA 2DR9A 1XR7A 1HNWF 5KG1A 4C0BA 3QZ8A 1VJQA 2DPIA 2E44A 3L95X 4X84A 1V6HA 3M2UB 4RO0A 3TX8A 4W92B 3W5ZA 3JSMB 3UQSA 4YP3A 2JSXA 2IJRA 4DFMA 3FEZA 2CNKB 3WIUA 1Q81T 5HSPA 4D3HA 4F7VA 3F73A 4OYPA 3QLHA 2DR8A 2JEIA 4AQYJ 1T9VA 3M6XA 4J9MA 1TUVA 5KFTA 3BSAA 3MMBB 3FCVA 3VAJA 1MLAA 4NA2A 1HBNB 1SL0A 1PCAA 3OL7A 1S72S 1HWIA 1UETA 2EG2A 3M2VA 2CQBA 2FLOA 2KRRA 2VIHA 4F0MA 2J0SD 5JMNA 2VBZA 5EX3A 4DQRA 3MTKA 4ES1A 4OYOA 1NK5A 4MT1A 4WK1A 2OFGX 3A8IA 3KNGA 4NLDA 4C8LA 1FE0A 3W2VA 2VDIA 3KDNA 3OFFA 3SIPB 4N5SA 3KLFB 4IO9Q 3OPKA 3G71S 4OHXA 4AL7A 2IAJB 1NKEA 1IR0A 1F0XA 2UUWA 2MZRA 5F41A 4OIXA 2C3MA 2JJ4D 3BV8A 3CCWA 4R5PB 2JLGA 2B3TB 1VJWA 3R5DA 4OLOA 2HHWA 1FK9A 1ZH5A 1YJ9S 1CS4A 1N88A 3ZTPA 2NXCA 3H2UB 5F9LA 2UXCF 4BCAA 1DJ0A 1QE1A 3RUBL 5GADI 3FFIB 3M32A 2MTLA 5A8KA 2YNFA 3M32B 1Y5IB 4Y65A 3MCOA 4JI1J 2QLBB 5HN0A 3EX7B 4ZLPA 4DV3F 3TQ1A 2IM0A 4A8KA 2D74B 2VOOA 4DPXA 1Z1ZA 3FBCA 4I6AA 4UW2A 9RUBA 4YR0A 3J80Y 3OSNA 3AY0A 3G82A 1TFWA 5DQIA 4F3OA 3D1QA 2HGLA 2KL8A 4KO0A 2BJ3A 3CJSA 1DQ8A 1EQMA 2CQIA 1FRKA 1HNVA 4CWBA 4C48A 2GHVC 2DEJA 1U4BA 4DS4A 4AYBD 3IRWP 1KD1T 3T9ZA 5B0AA 3V6DA 5HLFA 2ZKTA 2K7KA 1Q5YA 2MLZA 3D3CJ 3DOLA 4E8UA 4I2PA 2CDRB 2HS0A 2EC0A 1JLAA 2FC8A 4ZLLA 3I4PA 3M8PB 4NLOA 3LWLA 3GIMA 5KFYA 4UY85 2CNNB 4O4RA 1Z2LA 4OFZA 4Y00A 1D1UA 4MIAA 4DV5F 2GQCA 4K5SA 2MMYA 1X5PA 2E1AA 3C14B 4USUA 3CJKB 4ZPDA 1T7PA 3R1LA 2A6MA 3WHIA 4FNIA 3V81A 2ASJA 4NEYA 3W8GA 2QZ8A 3OTCA 3AAWB 4F8RA 4WZQA 1FEHA 4DL0C 3OFEA 1EAYC 2WRMA 4RNHA 3TVYA 3G96A 3DHXA 3SXLA 4ECZA 1A6LA 1KOHA 1Q7LB 3D66A 2RILA 2VDHA 1W26A 2B8QA 4ZP6A 2B7CB 2QE5A 3KUGA 5FD1A 3CO0P 4ED7A 1TKZA 1UVNA 3GYXB 4NCGA 1AW0A 4ID5A 4A46A 2E9RX 1B64A 4KQZA 2YNHA 4Q2LA 2MZJA 4CO0A 1YRUA 4B9UA 2IM3A 4DR3J 2D3O1 3MEDA 3CDAA 3FEYB 3N4WA 3PCOB 4CTAA 5IXUA 5D6GA 2QA1A 4OI1A 1Y3JA 4Q0BA 5HMXA 3OSPA 1L5UA 8ATCB 3THVA 1HNXJ 2DNMA 2DGSA 3H5UA 5F0UA 3PEJA 4LSLA 3V6KA 4FF3A 3WC0A 1N5YA 4ELTA 2MKKA 3BKUA 3HJVA 5LMUF 4ECWA 5J1EA 1XMOJ 3LQVA 1P27B 5KG4A 1SJRA 4FDFA 2JHEA 2FYXA 1NM2A 2AV5A 1TL7A 1RTZA 5EHHA 2KH9A 3G6YA 4K4VA 1T9YA 2LXFA 1N34F 1J5OB 4LF4F 4NLGA 3MR3A 2OPRB 3SCLE 2J0XA 2LDIA 3CWJA 3PZPA 1R31A 1H2VZ 2RHQB 4BLGA 1QAYA 2F8HA 1F2GA 3C3LA 1NK9A 2GVZA 2HAFA 3IAS9 4BBYA 4DBQA 3FKBA 1HI0P 4OX6A 4QIVA 3CC7S 1J2VA 1JLCA 1BY9A 2R8IA 2OTLS 2C2KB 3IM8A 1R0AB 1YGYA 1HNIB 1PYOB 5CABA 3R5BA 2MQOA 3Q24A 4Q8EA 3MPYA 2J7KA 1SL1A 4OJHA 3TAPA 1RCXB 3FC9A 2FLLA 4FF1A 2BABA 3MCSA 3MEEB 5KT2A 4IUFA 5I3PA 2LECA 2IVMA 1T0TV 3GG1A 3NNAA 3TZZA 2H54B 3MTJA 4C8ZA 1GT8A 2I8EA 1YKWA 2YNGB 2LVWA 4C0HA 4OX9J 2CQHA 3QAUA 5D4PA 2CZ9A 1AA1B 3I5AA 4DR1F 2M0GB 3DU6A 3M30A 3P4UB 4U7UK 2GJFA 2W2NP 2KM8C 5KT3A 4LF8J 4DR7F 3GIIA 1RLCL 2HQCA 2NLWA 5E3RA 3UNYA 2K1RB 3DI6B 4O4GB 5A2QU 1PBUA 1EIYB 3K8WA 3OVBA 1XQIA 2BKOA 5F0WA 2BJ7A 3OTOJ 2OPPA 2RF2B 3FBFA 1TK8A 5B09A 3AOCA 1UWAA 3ICLA 3NOCA 3H25A 2HMIA 2EWHA 1RT7B 4OHYA 5T41A 2DGTA 1FDBA 1I94J 3NCRA 2MKCA 1VRTA 1XJWB 2VD3A 4QW9A 1OPIA 4P75A 2XO7A 4C98A 4KT0C 3I31A 1DARA 2CXEA 4C3LA 3DLJA 2KTQA 2BE2A 1FX2A 3TOQA 3KMQA 3DLHA 3OTDA 2KG1A 2KFYA 3PDNA 3FK4A 3GWCA 1IR1A 2UVWA 4ELVA 4DR7J 2LP4A 2E5IA 2OO4A 3GCXP 4MH8A 3CC4S 2BE7D 4UF4A 2BJ9A 2DNKA 1K1QA 3G86A 4RBVA 1U6BA 1T05A 1LW0A 3MWBA 4ZVUB 3JQKA 2SXLA 1RAIB 1VYAA 1WG1A 2VA2A 3BREA 4K2XA 4ED4A 1N32J 2HGNA 3KUHA 4RW8A 3N28A 3TVZA 5IM0B 2MKIA 4FF2A 2DNGA 4IDKA 1LV5A 1CVJA 5D0EA 2H9ZA 2L08A 2HIYA 1VC6A 1YQHA 2CIMA 4H54A 4P2FA 3V4MA 1FJ7A 1WEYA 1FERA 4YUDA 5GADU 3ZZTA 4CLZA 2HHHJ 1YBUA 2DNNA 4KY3A 3MR5A 4B3OB 2LA4A 1F1BB 4KR0B 4CM2A 4P9SA 3NMAA 4USJC 5CYQA 1LXNA 5LMNJ 1YHQS 3LA0A 1R8CA 4DPYA 4Y6IA 3ZTRA 5C25B 3D6FB 1QSLA 3UO0A 3SDEA 3PIPQ 3M8RA 2BQ3A 5THWA 1UPPA 3LGHA 3NGUA 2CQGA 4IRDA 5CH7B 5KG2A 4K4XA 4RW7B 1NU4A 3HF5A 3V6HA 4ZDNA 3I32A 4LF7F 3HO1A 2HW3A 4JYAF 4JI1F 2KDOA 2RRAA 2XLIA 2ILZA 2AGOA 2UP1A 2UXBF 4PG5A 1IJFB 3N5FA 4YB7A 2N4CA 1AFIA 4WP9A 3GR1A 3LAMA 1VS3A 2LA6A 4O3QA 2KN4A 4PR6A 3TZWA 1UVIA 1CQMA 2KZMA 3DOKA 2OELA 2NZCA 1HLWA 2F1FA 1K44A 3UDCA 1FRHA 4YS2A 4FS2A 5D3GB 2JWNA 4TYAA 4LRDA 3GILA 4L72B 1YZ6A 3ZC4A 1FRIA 2HQ3A 2MY7A 2F63A 2YX4A 4KV8B 3TA2A 1NMEB 2O3DA 1ZPWX 1WF1A 3IC1A 4XDCA 2XSJA 3L7PA 2BJDA 2X51A 3W66A 2HWIA 4RPFA 2Q66A 3NEKA 4LIRA 2UXDJ 2GCFA 5K20B 1S9EB 5DGBA 4CCHA 1A7GE 3M6UA 3TWZA 3G6XA 1FTCA 1RUSA 4FN5A 2ROGA 2XMWA 1BUXA 3O3LA 4I69A 3RAMA 1XMQJ 2BACA 3D1HA 2KFZA 5T7LB 1YRXA 5T7LA
chains in the Genus database with same CATH topology
1NHKL 1S5ZA 4DI6A 3FC9A 1PKUA 5BXIA 3Q83A 1HIYA 1NCLA 3ELHA 3Q8UA 4WBFA 1NPKA 1WKKA 3NGSA 2VU5A 2AZ1A 3BH6B 1NDKA 3ETMA 3EMTA 1S59A 1NSPA 1B4SA 3EVMA 3VGTA 1NDLA 3PRVA 3ZTOA 4DUTA 1EHWA 3ZTPA 3GPAA 1XQIA 3EVWA 2AZ3A 5IOLA 2NCKL 4UOFA 3FBFA 4HR2A 3B6BA 3FBBA 3BBBA 3ENAA 1UCNA 1HHQA 3FBCA 1LWXA 4F4AA 4O0NA 1PAEX 2BEFA 1BE4A 2ZUAA 1JXVA 3EVOA 1S57A 3G2XA 1W7WA 3DDIA 3DKDA 1U8WA 2HVEA 2DXFA 1F6TA 3NGTA 3B54A 4F36A 4FKYA 3L7UA 2HVDA 2CWKA 4DZ6A 5CAAA 1NUEA 4S0MA 2DY9A 2DXEA 2DXDA 3Q86A 1NSQA 3BBCA 4ANDA 3EM1A 4UOHA 4C6AA 3MPDA 3BBFA 1VYAA 1LEOA 1KDNA 1MN7A 3PJ9A 1NLKL 4ANEA 5C7PA 4ENOA 1NDCA 1NDPA 2DYAA 2B8PA 3VGUA 4FKXA 2B8QA 1XIQA 4UOGA 3ZTSA 4KPCA 3ZTRA 3Q89A 3VVUA 3NGUA 3EJMA 3VVTA 1BHNA 1WKJA 1WKLA 3JS9A 3VGVA 3FCWA 3NGRA 4CP5A 1B99A 1HLWA 1K44A 2HURA 4EK2A 3Q8VA 1MN9A 3EICA 4W98A 3VGSA 3Q8YA 3EE3A 1NSKL 3BH7B 3R9LA 5CABA 1ZS6A 1F3FA 1NB2A 3FKBA 3GP9A 3WX8A 1BUXA 4ANCA 3ZTQA 3FCVA 2BX6A 3FBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHK L;  1S5Z A;  4DI6 A;  3FC9 A;  1PKU A;  5BXI A;  3Q83 A;  1HIY A;  1NCL A;  3ELH A;  3Q8U A;  4WBF A;  1NPK A;  1WKK A;  3NGS A;  2VU5 A;  2AZ1 A;  3BH6 B;  1NDK A;  3ETM A;  3EMT A;  1S59 A;  1NSP A;  1B4S A;  3EVM A;  3VGT A;  1NDL A;  3PRV A;  3ZTO A;  4DUT A;  1EHW A;  3ZTP A;  3GPA A;  1XQI A;  3EVW A;  2AZ3 A;  5IOL A;  2NCK L;  4UOF A;  3FBF A;  4HR2 A;  3B6B A;  3FBB A;  3BBB A;  3ENA A;  1UCN A;  1HHQ A;  3FBC A;  1LWX A;  4F4A A;  4O0N A;  1PAE X;  2BEF A;  1BE4 A;  2ZUA A;  1JXV A;  3EVO A;  1S57 A;  3G2X A;  1W7W A;  3DDI A;  3DKD A;  1U8W A;  2HVE A;  2DXF A;  1F6T A;  3NGT A;  3B54 A;  4F36 A;  4FKY A;  3L7U A;  2HVD A;  2CWK A;  4DZ6 A;  5CAA A;  1NUE A;  4S0M A;  2DY9 A;  2DXE A;  2DXD A;  3Q86 A;  1NSQ A;  3BBC A;  4AND A;  3EM1 A;  4UOH A;  4C6A A;  3MPD A;  3BBF A;  1VYA A;  1LEO A;  1KDN A;  1MN7 A;  3PJ9 A;  1NLK L;  4ANE A;  5C7P A;  4ENO A;  1NDC A;  1NDP A;  2DYA A;  2B8P A;  3VGU A;  4FKX A;  2B8Q A;  1XIQ A;  4UOG A;  3ZTS A;  4KPC A;  3ZTR A;  3Q89 A;  3VVU A;  3NGU A;  3EJM A;  3VVT A;  1BHN A;  1WKJ A;  1WKL A;  3JS9 A;  3VGV A;  3FCW A;  3NGR A;  4CP5 A;  1B99 A;  1HLW A;  1K44 A;  2HUR A;  4EK2 A;  3Q8V A;  1MN9 A;  3EIC A;  4W98 A;  3VGS A;  3Q8Y A;  3EE3 A;  1NSK L;  3BH7 B;  3R9L A;  5CAB A;  1ZS6 A;  1F3F A;  1NB2 A;  3FKB A;  3GP9 A;  3WX8 A;  1BUX A;  4ANC A;  3ZTQ A;  3FCV A;  2BX6 A;  3FBE A; 
#chains in the Genus database with same CATH topology
 2B9X A;  3VWS A;  4ZVH A;  2LFV A;  3S6E A;  4DF4 A;  3CCE S;  2OJ3 A;  1RYR A;  4PG6 A;  5A8K B;  2M8H A;  3Q83 A;  5FDL B;  5L9N A;  1HIY A;  5ETK A;  3K5O A;  3MM8 B;  4ZPW R;  4JV5 F;  2P2C B;  4DSI A;  3TYT A;  2GA7 A;  4EBE A;  3RB6 A;  3CJ8 A;  1N36 F;  1ZAV A;  5D0G A;  3UVJ B;  1HBU B;  3KLE A;  3RB3 A;  3U1L A;  2YX1 A;  3F41 A;  3CCR S;  1VBK A;  3VGT A;  1NDL A;  1FKO B;  2MEW A;  3ZFV A;  3ADA C;  1QAI A;  1H38 A;  4QWB A;  4JP8 A;  4LQ9 A;  3QYY A;  4TXS A;  1Y7P A;  3BSO A;  5HLF B;  2AMC B;  2VFS A;  3CJ5 A;  3I5B A;  3JXO A;  1S0O A;  2ZE2 B;  1WAC A;  2LXU A;  1Q8L A;  1SCJ B;  1LK7 A;  1TKT B;  1W2I A;  3LH2 S;  3LW5 C;  3TJ9 A;  4C7Q A;  1V3S A;  5LSO A;  3HPO A;  4ED2 A;  3LP2 A;  1LWX A;  1U02 A;  1EB0 A;  1Y5L B;  3I6P A;  4L6V 3;  4RW4 A;  1NHV A;  2PE8 A;  3BQ1 A;  4JI8 J;  4F4X A;  1OWX A;  1SJF A;  3OL9 A;  2GJI A;  1REG X;  2RE1 A;  4IRK A;  3DU5 A;  1PJ7 A;  5KFN A;  1S57 A;  2GAH C;  2YWH A;  3SMZ A;  4ICL B;  5K8M A;  4K4U A;  2DO4 A;  4IKA A;  5E3A A;  2GHW A;  4LUB A;  2GO8 A;  3K89 A;  2IMO A;  1YIT S;  2VIC A;  3AOD A;  1U6Z A;  1C1C A;  3OFH A;  4C3M A;  2H4Y B;  2XMU A;  3OVA A;  1ZAX A;  2G4B A;  1URR A;  2D3U A;  4I6Y A;  5D15 A;  5HAO A;  2IA0 A;  4BC9 A;  3W63 A;  1S76 D;  4G6V B;  1RI7 A;  1JJC B;  1O8B A;  2EFO A;  2XMK A;  4LFA J;  4F0K A;  3PKM A;  3HFZ B;  3EM1 A;  4JI3 F;  1ZTW A;  2IVY A;  3QAE A;  4O3S A;  5AXN A;  1IBL J;  1C0U A;  4OYA A;  1ZPV A;  5CCM A;  3KMS A;  1VQ9 S;  5EN1 A;  4U7U D;  1KP6 A;  5KFF A;  2HHV A;  3WX4 A;  4X4R A;  1KTQ A;  2XMA A;  1PAU B;  1HPZ A;  3E01 B;  3MCM A;  3KHH A;  2FVQ A;  2FHJ D;  1CLF A;  3P45 B;  4OZJ A;  4FVM A;  2OIH A;  1WNE A;  4ILL A;  2ZH4 A;  4P6Q A;  3TVK A;  1PO6 A;  1U1M A;  1EET B;  3LGN A;  1LWC A;  4ZHR B;  1T03 B;  2AJQ A;  3VV2 B;  1FDN A;  1JNZ B;  2ACM A;  3O8W A;  5KT7 A;  1S1W A;  5CD4 A;  4K0K J;  1RTD A;  1V5I B;  2D41 A;  3PG9 A;  1GTE A;  1R27 B;  1VRU A;  2NUH A;  3HM9 A;  3BN7 A;  4J9N A;  3BB5 A;  4WU2 A;  1WOS A;  3IR6 B;  2AYG A;  1XNR J;  4K8R A;  3OLA A;  4ZVP B;  5GAH U;  5L1I A;  5M2P A;  2V50 A;  2F9D A;  4WF9 Q;  4LR7 A;  2MQP A;  3NKY A;  1WSR A;  2BDP A;  1BHN A;  3U27 A;  1NPR A;  3ET6 A;  2R8K A;  5JVH Q;  4NXN F;  1QE1 B;  4O23 A;  1P9Y A;  2CZV C;  2OI2 A;  4RW6 B;  3SEO A;  5KFR A;  4X66 J;  1FKP A;  2ACY A;  3IBC B;  4MK8 A;  4UTG A;  5A6P A;  5IWA F;  1N8R T;  1F9H A;  3RBZ A;  1TUG B;  5HQ8 A;  3MEE A;  1T8E A;  3RAQ A;  2UUC F;  3POT B;  1UVL A;  2CPI A;  3POT A;  1RHM B;  1UFK A;  2J6S A;  4DU8 A;  4QIG A;  3VGS A;  3UCZ P;  3G4S S;  2YQ0 A;  3D28 A;  4ATN A;  3KJF B;  1YG0 A;  3ZZ0 A;  2D7S A;  3J81 j;  3OHA A;  2FZG B;  4J9R A;  1KHW A;  2MLY A;  2PFF B;  1RGV A;  2AQ4 A;  1C0T A;  4V19 X;  2HLU A;  1FD2 A;  2G13 A;  4E98 A;  4WKY A;  2GGP A;  3D6M B;  2CG8 A;  4J9L A;  3F44 A;  4I68 A;  4URS A;  4DV3 J;  2BX6 A;  3BKF A;  2FB0 A;  2DKO B;  2JFK A;  2BE9 B;  3OR1 B;  2E5J A;  2IJN A;  4Q2M A;  4RJV A;  1KHV A;  2DBB A;  2XZD B;  2F4V J;  2ZZT A;  2OPP B;  2XM3 A;  3G8S A;  4DL2 A;  5KFG A;  2LYV A;  3HSZ A;  1NCL A;  2M88 A;  1HQ2 A;  3M4X A;  1QVF R;  3CJK A;  4DR4 J;  3NAI A;  1WKK A;  4HVZ A;  4CLW A;  3M2U A;  2XMV A;  4EO8 A;  1U49 A;  1RWP B;  3JSM A;  2BAN A;  2V8H A;  2QJ3 A;  4DR6 F;  1UA0 A;  4ZP9 A;  2IC3 A;  4CO4 A;  3OW2 R;  4CO1 A;  3L9Z A;  3NP5 A;  1OY9 A;  1BQM B;  3NY0 A;  1RHR B;  4GRS A;  2MHE A;  1DRZ A;  1VK3 A;  4NL5 A;  3IG1 A;  1FK9 B;  4FPR A;  1UP1 A;  2ZJP Q;  2GMH A;  5IFM A;  2F65 A;  4OYX A;  4R0E A;  3D7S B;  4F02 A;  1IKX B;  1JLB A;  2OLW A;  1BQN B;  3GON A;  4FYW B;  3THT A;  2MKH A;  4F4Z A;  1U1P A;  3PJW A;  5DDO C;  1IBK F;  5I3U B;  4CI0 B;  2JDJ A;  2PII A;  2VFR A;  3CCT A;  4YR3 A;  3UN2 A;  3BBB A;  3B4M A;  4OV6 A;  1VIS A;  2J9E A;  4CTA B;  2N4D A;  4OMF G;  4Q0B B;  1D9F A;  4RW9 B;  1RBL A;  4TU9 A;  2RS2 A;  4N76 A;  4YOE A;  1RWW B;  3IWL A;  3RB4 A;  3JB9 k;  2ZUA A;  4MFB B;  4AXJ A;  1D0E A;  1FNM A;  1T9T A;  1VQ6 S;  1FVS A;  4M5I A;  4AT1 B;  1RA7 A;  1HKA A;  4PWD B;  5K8P A;  3OVS A;  5L38 A;  1YK9 A;  4M5D A;  4TY8 A;  3TUI C;  3KK1 A;  2HRU A;  2RT3 A;  1F9E B;  3N6L A;  3NGT A;  4WIQ A;  2MQN A;  4YY3 F;  1CS4 B;  4ZJO A;  1FRM A;  2IDL A;  5ETM A;  1SKR A;  2BOP A;  3LP1 A;  1Y00 A;  1RHJ B;  3W5Y A;  4L3K A;  1K1S A;  2NXU A;  5LXR A;  1I94 F;  2LQ9 A;  2I1R A;  5ETQ A;  3MUR P;  4DV1 J;  1IKY B;  1D9D A;  4M5H A;  3GTY X;  3RR7 A;  2WOM A;  1HBO A;  3MOZ A;  4PXC A;  3DGP B;  1DTT B;  4NYZ A;  5HO4 A;  3VAK A;  2IRX A;  2I5J B;  1C4C A;  3HX9 A;  1DLO B;  1RCO B;  1MU2 A;  4WJB A;  4RW7 A;  5LMU J;  4YHH J;  2W9B A;  1PIE A;  5JXS A;  3U1M A;  4B3M F;  2DRA A;  1TKX B;  2MDA A;  2OPS B;  2JX2 A;  2ZHB A;  1IBM J;  5FII A;  4LJM A;  4DSF A;  4F26 A;  3U7J A;  1ZZF A;  2QLJ B;  3BQ2 A;  4CZC A;  3KNA A;  3H0P A;  5HAN A;  4DR1 J;  2HPU A;  2MZQ A;  2O01 C;  3CCU S;  1S6Q B;  2W9A A;  5J2Q A;  5B0B A;  4NXN J;  2G2Z A;  2VOD A;  4DCP B;  4EYH B;  2I2Y A;  1MWQ A;  2XG8 A;  4TYB A;  4H4K C;  8AT1 B;  2G2Y A;  4IFY A;  1QVG R;  4USW A;  1IVZ A;  4F3M A;  2CPE A;  2AHO B;  4HTI A;  2RNE A;  1ZM4 A;  3NG8 A;  3PEH A;  4B9S A;  4LRA A;  4B3T J;  4FF4 A;  1XNQ J;  3M2V B;  1R8P A;  2HFU A;  1OYD A;  3I9Z A;  3MFI A;  1HAR A;  2C2Z B;  4DSL A;  3JSR A;  1B99 A;  2C3Y A;  3OJS A;  2F9J A;  1TKZ B;  1T9X A;  1HMV B;  1WF0 A;  1F9F A;  4ES3 A;  4FYY B;  3QQC D;  1NEE A;  3EDQ B;  4KHP J;  3IS9 B;  4PG8 A;  3DMJ B;  1J5O A;  2QMX A;  3E3X A;  3RGI A;  4F4K A;  2VPY B;  1S7I A;  3TI0 A;  4NI2 B;  2YWG A;  2HZC A;  2CDQ A;  4ZVF A;  3JTO A;  3PO5 A;  2GVZ B;  3R27 A;  4Z7C A;  1B0T A;  2OAU A;  1YWX A;  1ARO P;  7FDR A;  2QSF A;  4CNY A;  3CCM S;  1VQ8 S;  1CJK A;  4DPO A;  5IM0 A;  4F3Q A;  3M2R A;  4ZA1 A;  5I3U A;  2FZC B;  4YEA A;  1HNI A;  2WW8 A;  3OTE A;  5DZ6 A;  2HHU A;  4CLS A;  5AE3 A;  4WZM A;  1RIS A;  2VZ9 A;  1Y10 A;  1U8S A;  3K2Y A;  4DI6 A;  3W3S A;  3GU0 A;  3IRX B;  4ZIW A;  4LF6 J;  3ZZY A;  3Q2S C;  5IT0 A;  1FXR A;  3M9O B;  1UTA A;  5CA5 A;  3PX4 A;  2ZEJ A;  2HSE B;  2OSR A;  4G1I A;  4DL5 A;  2GFF A;  1GH8 A;  4P71 A;  3NS5 A;  2FHJ A;  2GNK A;  2VC1 A;  1KQK A;  1IR2 A;  2FZK B;  1Y4Z B;  3BPS P;  4XIU A;  3J81 Y;  1RK8 A;  2J6T A;  2MQQ A;  2DTJ A;  5RUB A;  5L39 A;  1SJQ A;  2CPZ A;  2EPI A;  1O51 A;  4B3O A;  4NZ7 A;  1AZS B;  1RAH B;  2QYG A;  4CLY A;  5KFQ A;  1GTH A;  4WXO A;  4ECX A;  4HL9 A;  1NJY A;  3PNI A;  1TMM A;  1NJX A;  2DH7 A;  4AD6 A;  2ZH3 A;  2XBP A;  2HHP A;  2Z2Z A;  3M6W A;  4Q5V A;  1KN6 A;  4B3M J;  1WOO A;  1X5S A;  1FX4 A;  3NNC A;  3AXM A;  1H6K X;  3QT8 A;  2QLW A;  4P7T A;  3C2P A;  1X4C A;  2ZBI A;  4Q43 A;  1UCN A;  2VG6 B;  4Z37 A;  2ATC B;  4ECU A;  2YH1 A;  5AJ3 J;  4LR8 A;  2B9E A;  1N5Q A;  2V2V A;  2GVD B;  3E51 A;  4ED0 A;  2OD4 A;  2GVD A;  4O0N A;  4BWM A;  1D9A A;  5IWA J;  5HBM A;  2R7Q A;  3OXG A;  5E3C A;  1JX4 A;  2QYC A;  3KLI B;  3NLC A;  1IBC B;  5E3P A;  2AWZ A;  1RAB B;  2DH8 A;  3H4D A;  4UY8 T;  2I38 A;  2G1H A;  1HW8 A;  1W7W A;  3CDE A;  4P73 A;  5CYM B;  1J5E J;  4OJG A;  1HI8 A;  3RRH A;  2BE2 B;  1R8A A;  4RNN A;  3OHB A;  2HFO A;  3HP6 A;  1MMN A;  1UEU A;  4J9O A;  1KLN A;  1XNQ F;  2BZ2 A;  3C15 A;  4DV0 F;  1LFP A;  2A1B A;  1UAW A;  2HBR B;  4RUB A;  3HFK A;  4CQ1 A;  2DXE A;  5AXK A;  1RT2 A;  1YJ7 A;  4EFA C;  4JV2 A;  2G2O A;  2M7S A;  4DV4 F;  5HRO A;  4DV2 F;  2MQL A;  1RT7 A;  2G9O A;  2HQD A;  2MKY A;  2ZH7 A;  3VAL A;  2AX1 A;  5SZT A;  2DVI A;  1VRT B;  4NLT A;  4ANE A;  2HLT A;  1RKJ A;  4U67 Q;  2RRB A;  3I0S B;  2FJE B;  1VHF A;  1RSC A;  3J7A N;  3MEG A;  3SCK E;  4LVN P;  2R7O A;  2Y1I A;  2W2M P;  3SSS A;  2B4O A;  2E5L J;  4LIW A;  2VPW B;  5EWF A;  5G0R A;  2ABY A;  1WC3 A;  3VGU A;  1JK9 B;  4DL7 A;  4ZPT R;  1B7F A;  3PVX A;  5BR8 F;  1RAE B;  3TJA A;  3J7Z 5;  1FWK A;  3CDW A;  3G6V A;  4ZLJ A;  1EKR A;  4DV7 F;  2HHX A;  2Q3P A;  3MPU B;  4XPC A;  3IN5 A;  5KFD A;  3HT0 A;  4NYO A;  4NRT A;  2FHK A;  2DNQ A;  3BDE A;  4EGL A;  5J2M A;  1P1T A;  3SFG A;  2A3J A;  2M4M A;  4KKO B;  3BSC A;  4LSN B;  3RRK A;  1AUS L;  2QX0 A;  3TAR A;  4JBC A;  1WKL A;  2UZA A;  5KAK A;  1ZTT A;  3F56 A;  1NB7 A;  1PJ5 A;  3GFY A;  4JI8 F;  3R2C J;  3RW6 A;  2DHG A;  4CP5 A;  1NSA A;  3HK2 A;  3TW0 A;  5ETR A;  4JOU A;  1RAG B;  2WVE A;  2LU1 A;  4GVB A;  3T6B A;  1S1V A;  3H90 A;  5GMD A;  3H7H B;  1ACM B;  4C11 B;  3C46 A;  2CJA A;  1RWN B;  3Q8Y A;  3GIR A;  4CLT A;  1MW7 A;  3H5Y A;  3BSN A;  2DO0 A;  1HD1 A;  5LMN F;  5J2P A;  3QWP A;  2DB1 A;  2RDD A;  4DMZ A;  3C6T A;  1BQM A;  3GP9 A;  4C0O C;  3CD5 A;  3KYL A;  6FDR A;  3R7B B;  1AYE A;  1NH8 A;  1U0H A;  2EVZ A;  5HQL A;  4DQI A;  2Z2Y B;  1NHK L;  2RDJ A;  1S6P B;  1GMW A;  1P9Q C;  5D0H A;  2FVP A;  2ZWP A;  3FFI A;  3JYT A;  2ZD1 A;  2POK A;  5CQG A;  3GV5 B;  1ZET A;  3D3B J;  4YHH F;  1N5Y B;  5HK4 A;  2K2P A;  3QRP A;  5GMK a;  4RLE A;  4I6W A;  2FVC A;  1RTI B;  3PTW A;  5EGY A;  4WFA Q;  5DM7 Q;  3UN5 A;  1M5K C;  5CYM A;  3NWR A;  4ZVR B;  3R97 A;  2IYI A;  1YDL A;  4NX9 A;  1ULR A;  3M8Q A;  2CNO B;  4K0K F;  1JWW A;  1HNV B;  1U2R A;  1WTB A;  2KJV A;  3MEC B;  3CD0 A;  2A18 A;  3KLG A;  2M8D B;  4LFC J;  2DR5 A;  1VFJ A;  4IO1 A;  4USH A;  1S9F A;  4ZVQ B;  4J9V A;  5EX0 A;  4QBU A;  2XWX A;  5DG9 A;  2ZC4 A;  3ET6 B;  1FTR A;  1ZBT A;  4ZJL A;  2XMT A;  4AQY F;  3TRG A;  4HR2 A;  3DRS B;  2YNF B;  2XS5 A;  1NRK A;  1GNK A;  4USV A;  3UDL A;  5LT5 A;  5CHC B;  3LUY A;  3CPW R;  4X4U A;  2GAG C;  3AT1 B;  2KXH A;  3VAF A;  1TL1 A;  3RG6 A;  4OX8 A;  1LW2 B;  2VC0 A;  4O3P A;  2CPD A;  4RUC A;  3GB0 A;  1QUV A;  4QZV B;  4K5R A;  1JXV A;  1ROF A;  3BN4 A;  5LOQ A;  2QN6 B;  1YJW S;  2XTJ P;  3N0V A;  3B78 A;  3DC2 A;  4ZN3 A;  3O5T B;  4ZP7 A;  5ADZ A;  2N7C A;  5AXL A;  3CMA S;  4ECT A;  1V9O A;  4C4W A;  4OI3 A;  3CJ2 A;  2ZOF A;  3IO1 A;  1L3S A;  2FLP A;  3N9U C;  2ZM6 J;  3T5H A;  4ZPV R;  5HAT A;  3TP2 A;  1X4D A;  3G87 A;  1HQU B;  4DZ6 A;  4K4Z A;  5C24 B;  1NUE A;  2A2D A;  5C24 A;  1RT4 B;  2DXD A;  3GYG A;  1TL3 B;  3ETO A;  2FD2 A;  2B4U A;  3BGF A;  3BBF A;  5DDQ C;  3R6L B;  1HWU A;  1WC0 A;  3MHY A;  4KGK A;  2EC2 A;  4CT9 A;  1CUL B;  2BQR A;  3K7R A;  4OYM A;  1X4A A;  2HBQ B;  2QC3 A;  3UI3 A;  2CJX B;  2QL5 B;  2W25 A;  1VLO A;  3NGK A;  4DDF A;  1Q82 T;  4NA1 A;  1VMB A;  2AJ2 A;  1N5S A;  2XS2 A;  1S1W B;  2HZA A;  2VQE J;  4B3R F;  4GKJ F;  1GXL A;  2KXF A;  1SJ3 P;  2E7X A;  3ISZ A;  2RVJ A;  3AA8 A;  2EXU A;  4MIW A;  2CVE A;  2ADC A;  2LMI A;  2RDI A;  5H1S V;  4NPO A;  1UZH A;  1B7Y B;  3VVU A;  2Q6B A;  2BKP A;  3CD6 S;  3MMC A;  3P5T L;  5CZV A;  4EU0 A;  3CJ0 A;  5A8W B;  5IT4 A;  1KFS A;  3BO2 A;  3T1H F;  4XAK A;  1T05 B;  3VVT A;  4F50 A;  1S6P A;  1SXL A;  4QIW D;  1Z2Z A;  2ZJQ Q;  1BQN A;  1Q16 B;  1WKJ A;  1RT3 A;  3CJT A;  5IQ6 A;  3FSI A;  1RU1 A;  4DSJ A;  4LF4 J;  1T95 A;  2CRL A;  4OL8 A;  1RKI A;  1UFL A;  3NS6 A;  4KHM A;  4OZ2 A;  3NGR A;  4RR5 A;  3TAN A;  2UU9 J;  1VK8 A;  2OPQ B;  6AT1 B;  5K14 B;  4U96 A;  4CRJ A;  4X4S A;  1OIA A;  2Y1R I;  1RE1 B;  4XK8 C;  1Q53 A;  3A4T A;  4PXD A;  1O0P A;  3LP1 B;  3PW7 A;  1BXN A;  2ZBQ A;  3UVJ A;  2WHO A;  3TA1 A;  2H5I B;  2GIR A;  3OV7 A;  4MIB A;  2N82 B;  3BR8 A;  1QJH A;  1N6Q A;  2ROE A;  3HJF A;  4CLP A;  2BJE A;  3IBF B;  1IKY A;  1OY8 A;  4CT8 A;  3PO4 A;  4U95 A;  2APO A;  4FPI A;  5KFE A;  5A2Q Y;  3D68 A;  3PYG A;  1VGY A;  2HFV A;  2Q79 A;  4DSE A;  1CEZ A;  3C14 A;  2VQE F;  1M5O C;  2E1M C;  4GKJ J;  4B3R J;  3NBP A;  2V67 A;  3KXD A;  1BWE A;  3ZTQ A;  1PC4 A;  4EMD A;  4I67 A;  2KVQ E;  4ZMM A;  2R2R A;  3AQO A;  4UZC A;  2EBG A;  2JNJ A;  3SV4 A;  1H3D A;  1TP7 A;  4OYZ A;  4PXB A;  3HHL B;  5MLC V;  5GAH I;  3OT9 A;  1IJE B;  3ILJ A;  1S9G B;  2FHO B;  2NXE A;  4A48 A;  5K8O A;  2QLF B;  2RUS A;  4KIA A;  4GKK J;  5KFL A;  4CLK A;  4ERD A;  4R0J A;  2DGW A;  1VDH A;  1HYS B;  1XMO F;  1M0S A;  2BQU A;  4RUA A;  1NDK A;  4OYB A;  3PR4 A;  5I42 A;  4M5G A;  1X8D A;  3KG0 A;  4WFY A;  5BR8 J;  4LFA F;  2L9N A;  1EJ7 L;  4NA3 A;  1U47 A;  2DEI A;  2CPF A;  3NGD A;  3E8O A;  4PYD A;  1WC6 A;  3RYL A;  3H4B A;  4B9N A;  2O66 A;  3Q8P B;  1Y0H A;  2FUG 9;  1FXL A;  1RJJ A;  1VQ5 S;  1WDT A;  4UUW A;  3W65 A;  2F8M A;  3LF0 A;  4ID5 B;  3MR7 A;  3HXM A;  3C15 B;  2CPH A;  2YNI B;  1N54 B;  2YNI A;  2QMU B;  3PYD A;  3E2E A;  3X1L B;  1TEL A;  4I2Q A;  5LJ3 Y;  1BD6 A;  2Z57 B;  3QGP A;  2V4J A;  3P96 A;  4WFZ A;  1Q8K A;  5HRO B;  4X4P A;  2ZHA A;  2KT5 A;  3NMR A;  3KFW X;  3MM7 B;  2BEF A;  2Y1L B;  1BE4 A;  2DHX A;  3FMB A;  4DEZ A;  5HJY A;  3K5M A;  4QOT A;  2KI2 A;  4QCL A;  2YPZ A;  4ZPC A;  3D6T B;  4ZK7 M;  2AKW B;  2ILY A;  2OPR A;  4ZHR A;  3DCA A;  1CJU A;  4DWI A;  1U8W A;  3KDO A;  2HGM A;  4Y34 A;  3BO4 A;  1R3N A;  3Q22 A;  2AEF A;  1F3V A;  2WW4 A;  5LXY A;  3EGZ A;  1JLG B;  4JYA J;  2K3I A;  1PYS B;  2Q1L A;  3CJQ A;  3M2R B;  2J8S A;  1E6V B;  3M1V A;  3PFO A;  3UE2 A;  3PHT A;  1TVR B;  1X60 A;  1RTH B;  4OHW A;  5CAA A;  1L3U A;  2FVR A;  2ZZM A;  2C3U A;  4QPX A;  3UD3 P;  3G9C A;  2ZH6 A;  4MTP A;  3DLE A;  2CPJ A;  1S0V A;  2CQ2 A;  2IRY A;  5F8G A;  2Y8Y A;  4DZD A;  2COL A;  4B9L A;  2IDE A;  3PAC A;  1Q79 A;  5G4D A;  3SCJ E;  4JI3 J;  3QBC A;  4WII A;  2YNG A;  1KEK A;  4WYL A;  2UUB F;  3IMQ J;  2FJD B;  1Y9O A;  1WC5 A;  1K9M T;  4DS5 A;  1DZ5 A;  1NXI A;  1RWX B;  3KK2 B;  5A0Y A;  2P9G A;  3R2D J;  2B8P A;  4ECY A;  3EZ5 A;  1AZS A;  2GHP A;  1NJI T;  4TNO A;  1HBM A;  1CJT B;  1XMQ F;  3JQM A;  2R7W A;  3DGV A;  1RZM A;  3GYN A;  3ZTS A;  3KJV A;  1XK8 A;  3A1Y G;  4A4J A;  5KOX A;  1BMQ B;  2YH0 A;  3O44 A;  3UCG A;  3M9N B;  3CED A;  4YB1 P;  3SDE B;  3N6M A;  2YBV A;  5CZX A;  3U02 A;  4FS1 A;  2XUL A;  5F8L A;  1PIL A;  2DK2 A;  2Y3Y A;  1NZA A;  3L3C A;  3R7N B;  2DGV A;  1XNR F;  1GMU A;  1UWB A;  3OUY B;  1LXJ A;  1UWB B;  4OHV A;  3OUY A;  4N8O A;  2ZOG A;  4DLG A;  1G4C A;  2XY5 A;  3MUV P;  2DGU A;  4J9K A;  1X7V A;  1WOP A;  2YKP A;  5KFB A;  1QSY A;  4HT7 A;  1FES A;  3MI7 X;  2DGQ A;  2OMO A;  1DBD A;  3HSG A;  1KNZ A;  3M6V A;  1YLX A;  4HEA 9;  1K8A T;  3U1N A;  4AUK A;  4KB7 A;  5IV4 A;  2WVF A;  2E29 A;  5E33 A;  2QTW A;  3C6U B;  5FDL A;  3T9N A;  3ZNJ 1;  1P8G A;  2AIR B;  4F25 A;  2R7U A;  1LWC B;  3D9B A;  1SC4 B;  3KLI A;  4IG0 B;  2A2C A;  2C2M B;  3C66 A;  2KT3 A;  2FJB B;  3DLK B;  2NZ4 A;  3BH7 B;  1OQ3 A;  2D69 A;  1ZS6 A;  1S0M A;  4B9V A;  1K0T A;  3T41 A;  2V63 A;  2IM2 A;  3RU0 A;  3OFG A;  2LDY A;  3MPV A;  1SC1 B;  4ILM A;  4HHJ A;  3KLG B;  2XLJ A;  2MQM A;  1Q8B A;  3BGU A;  3RBX A;  2UVR A;  3K17 A;  3AHP A;  3R1H A;  5IT9 U;  4OHZ A;  2OSQ A;  2W4C A;  3UD5 A;  1KVK A;  3AH6 A;  4X62 J;  2D9P A;  4LF9 F;  3W9I A;  3J7Y I;  5A8R B;  2G0J A;  1WTF A;  2MQ8 A;  3IR7 B;  2GV1 A;  1HMV A;  2ZE2 A;  2C2O B;  5IC6 B;  1KSP A;  2MYF A;  2YVS A;  3SQG B;  4B02 A;  2RSQ A;  3J7Y U;  4DFK A;  1Q86 T;  2E9T A;  2MZT A;  2YWK A;  4WBF A;  1NPK A;  1JXL A;  2CNL B;  3CJR A;  3LP2 B;  2VU5 A;  1UKU A;  1L3K A;  2AZ1 A;  3BH6 B;  4E0D A;  1VQN S;  4IOA Q;  3HKZ D;  4M5D B;  3UNG C;  1WC1 A;  5IQQ A;  4QW8 A;  2CJ9 A;  1QUP A;  4Y2M A;  5HMY A;  3T5L A;  1K73 T;  1RWV B;  5MAO A;  2ZWO A;  2QSW A;  1X31 C;  3BQ0 A;  2DIS A;  2OHD A;  1DFD A;  3VAI A;  3FJ2 A;  1RTH A;  2U1A A;  1M5P C;  2W4P A;  3AJD A;  5U47 A;  4DCO B;  1SH2 A;  4OI6 A;  4RU2 A;  1AT1 B;  1NK7 A;  5C25 A;  3FGV A;  2UV8 G;  5IOL A;  3K5P A;  2L3M A;  2E9Z A;  1MG7 A;  2FVS A;  3MMB A;  4WE1 B;  1RT4 A;  3ENA A;  3MM5 A;  4C3K A;  3UPF A;  1TU0 B;  3CB4 A;  5HP1 A;  1JB0 C;  5AXM A;  3KKF A;  2E66 A;  1TKX A;  1YBT A;  2NPI A;  2OPS A;  3PYF A;  1EQ0 A;  2Z0G A;  1X0F A;  3BDP A;  2R7X A;  4JV0 A;  4NXM J;  2CKW A;  4NLU A;  4EWT A;  3UR0 A;  1ICE B;  2VV5 A;  2JC0 A;  1ZYQ A;  2V68 A;  2Z4P A;  3EZU A;  3AOA A;  1HBM B;  2GW8 A;  2CAJ A;  2Y0S D;  2HFS A;  4L73 A;  2XWY A;  4C8K A;  4OZ0 A;  2GMJ A;  4HI2 A;  4ECV A;  2FJX A;  1BLU A;  2B51 A;  2H4W B;  3EXC X;  3BPD A;  3AA9 A;  1URN A;  3AQP A;  3DLB A;  4ZCM A;  1S1U B;  2MJU A;  1JKH B;  1Y5N B;  3TEH B;  3N5B A;  3TA0 A;  1VI7 A;  3NRB A;  5ETO A;  3TAQ A;  1REV B;  1B70 B;  3T1Y F;  1N33 F;  1KVJ A;  4QR1 A;  5F3T A;  2FDN A;  1FFG B;  1OSD A;  1TR0 A;  2ZBP A;  1HI1 A;  5A8W A;  1TK0 A;  2AGQ A;  1FXD A;  1SPB P;  1YI2 S;  4CLL A;  1X9W A;  1NJW A;  3EGN A;  1NDP A;  3Q8Q B;  5L1J A;  1S77 D;  5DO2 A;  2U2F A;  1OS5 A;  2N3L A;  1VBZ A;  4KC5 A;  1IKV B;  3AJ2 A;  4O44 A;  1VBY A;  3MAA B;  2ASD A;  2K7J A;  3B82 A;  1C1B A;  1N5V A;  2AF6 A;  2J9D E;  1C1B B;  2ZDO A;  1HFE L;  3D1O A;  2EFV A;  4IG3 A;  4DUY J;  1UVK A;  1VQS A;  2CZ4 A;  4KPC A;  2O5D A;  3LOU A;  3KJN B;  4DG1 B;  2FGO A;  2KB2 A;  3DOL B;  2I6W A;  3GFZ A;  4ZCI A;  3OL8 A;  1VQO S;  4OZL A;  2ZH1 A;  3B8H A;  2UU9 F;  2KJW A;  4AFF A;  2XY7 A;  3WDO A;  3H20 A;  3WQP A;  1EP4 A;  1ZA1 B;  4CLF A;  1FJG J;  4AL5 A;  4LFB J;  1TL1 B;  3NNH A;  5KG0 A;  1S6O A;  4CH1 A;  4OZ1 A;  4J9S A;  1FJG F;  1WHV A;  2WOM B;  3W5X A;  4X64 J;  2YQ3 A;  1TV6 B;  4RKU C;  5GAE I;  2HIQ A;  3QSY B;  2P9E A;  3DN9 A;  2P5V A;  2R3V A;  4LRE A;  4WP3 A;  4DV7 J;  2GQ2 A;  3JS9 A;  4PXE A;  4L3N A;  2UUB J;  4DR5 J;  2R2T A;  1AB8 A;  4NLR A;  2QA4 S;  2AYM A;  4MKA A;  2Z56 B;  3DRR B;  2IM1 A;  4DR5 F;  2K3K A;  2V4Q A;  2PEB A;  2HNZ B;  3CGI A;  3MZI A;  3PJX A;  2HNZ A;  3VZH A;  6FD1 A;  1V3Z A;  4QQB A;  5C5J A;  4B3S J;  3PRB A;  2HFN A;  3QWU A;  4X65 F;  1M5V C;  2PC6 A;  4LF5 F;  3BGR B;  5B7W A;  1E6Y A;  2WSF C;  3C6T B;  4EI2 A;  1CBK A;  2V8G A;  4Q44 A;  1C0U B;  2XNQ A;  3BJY A;  3IP0 A;  4MKV A;  4P72 A;  3MD3 A;  1CUL A;  3QIP A;  2YPY A;  2X3G A;  3MM5 B;  1G2E A;  1IKX A;  1JLB B;  3MMA B;  2PFD A;  4YQW A;  4ZKA A;  3HD1 A;  2ZHO A;  1S1V B;  2ASY A;  3A8K A;  1EET A;  3K58 A;  4NCA A;  1MSW D;  3HSD A;  5DDP C;  4GVL A;  4F4W A;  2HHH F;  4HT5 A;  4TQR A;  4RW9 A;  2XSJ B;  3UR3 C;  2YXL A;  1HPZ B;  3E01 A;  5JVG Q;  2BAN B;  2J7W A;  3NOG A;  4QU7 A;  2KVI A;  1RTJ A;  2IC3 B;  2M5Y A;  3H5S A;  4G1Q A;  4NOH A;  3AOB A;  2KHC A;  1VCT A;  2VFV A;  1JXE A;  3S01 A;  3CVK A;  4A8O A;  3VAH A;  4CDI A;  1A9N B;  2OFH X;  4IH6 A;  1SB6 A;  4K4W A;  2RJZ A;  1RT3 B;  4K7Q A;  2FC9 A;  4WWS A;  1H72 C;  1HWK A;  1E6V A;  2YKQ A;  4J37 A;  5DRK A;  4CNZ A;  3MM6 B;  4Y2C A;  3ISN D;  5I3Q A;  3JAM U;  3B6B A;  4FBT A;  2ZUG A;  2A6O A;  5JJB A;  2DGO A;  4OV1 A;  3T5K A;  3PV8 A;  3TO8 A;  2W9C A;  2BA9 A;  3N6N A;  1EX8 A;  5H9F K;  5DZ7 A;  1HD0 A;  2VKR A;  2XYP B;  1DQ9 A;  4AE5 A;  1FVQ A;  1VQY A;  2XHC A;  3EVO A;  3R5J B;  4FBU A;  1NH7 A;  1XR6 A;  2W1B A;  1SQG A;  4WPA A;  2HVE A;  4ZCL A;  3CCV S;  3KG1 A;  2X1G A;  4PEO A;  2BRK A;  2MKJ A;  1ZOT A;  4NE9 C;  4Y2I A;  3IXQ A;  3D2W A;  3QJP A;  2VKZ G;  2V8V A;  3M8P A;  1YSJ A;  3G8Q A;  4ZPA A;  1WEL A;  3Q86 A;  4M5N A;  2K8G A;  5SUH A;  4OZN A;  1S99 A;  3M9M B;  1IM4 A;  3C19 A;  2V0N A;  4J7C A;  1G7C B;  2VON A;  1VOM A;  5DET A;  2PI5 A;  2MGZ A;  2PMH A;  4DJB A;  4DU7 A;  1U1Q A;  3IWX A;  1GQE A;  2R9L A;  3HVW A;  3W2W B;  5F9N A;  3SSQ A;  3VF0 B;  2NUU G;  1JMT A;  1HA1 A;  1GMV A;  3GZ7 A;  2FJW A;  1N32 F;  2R8H A;  1RBO B;  1S1T A;  2QRR A;  3D0I E;  1XN9 A;  1D3W A;  3D67 A;  4L76 A;  4DFJ A;  1A0O B;  2UUT A;  4A47 A;  4ECQ A;  1VBX A;  1VQK S;  3DLL Q;  1ELO A;  3PXG a;  2CQD A;  1FF2 A;  4J9Q A;  2MZS A;  3H8Y A;  5LSR A;  4TQS A;  2YNH B;  4ZJQ A;  2C28 A;  4EO6 A;  2KXN B;  1JQG A;  2H1Y A;  4I2Q B;  4NLP A;  4X4N A;  5C42 B;  2WON B;  4K59 A;  4A8W A;  3R6G B;  5EUH A;  3MOJ B;  1DHM A;  2F8E X;  3DRP B;  1X4E A;  4A8F A;  2XCA A;  2ZBC A;  3VGV A;  5J1P A;  2GQQ A;  2DHA A;  3FMW A;  4YDX A;  4KGZ B;  4OYW A;  3EGV A;  2JL9 A;  1WWH A;  1U7L A;  2VFU A;  3SQO P;  1NBE B;  2JLE A;  2X1A A;  1TUW A;  2BRL A;  2CYY A;  1TL7 B;  1RWM B;  2ROP A;  4DX8 H;  1KOO A;  3PY8 A;  1NSK L;  1OJ4 A;  1Q7Y T;  3WBZ A;  3TZX A;  4LMZ A;  4IFV B;  4M94 A;  1H0H B;  3WIV A;  3TAM A;  1OY6 A;  1JLG A;  1S7H A;  5E41 A;  4DV1 F;  4WP8 A;  2KO1 A;  2KRB A;  3IBW A;  4I56 A;  1Q8I A;  3PKY A;  1DTQ B;  1XEZ A;  1DTQ A;  1EAR A;  2CPY A;  1S48 A;  2LQB A;  3VTI A;  2HBZ B;  3HHE A;  1Z4U A;  3GSD A;  5B0C A;  1KBR A;  1YJV A;  2VBW A;  3DDN A;  1S9G A;  2JZ5 A;  3HVR A;  4PG4 A;  1IN0 A;  3AB2 B;  2DIU A;  3SYZ A;  1N6Q B;  4JI4 J;  3KJV B;  2DRB A;  2R4F A;  1S79 A;  1PSD A;  5D4N A;  3TZY A;  4MKY A;  5HQM A;  4DPT A;  4XTT A;  2MXY A;  4GO5 X;  4V19 J;  2CJB A;  4HTJ A;  4TN2 A;  2WVB A;  3GJT B;  3HHL C;  3QT5 A;  2ZC3 A;  3D0H E;  3FCH A;  2LKZ A;  1OO0 B;  1ZA2 B;  5A6W A;  4JI6 F;  4DLE A;  4YN3 B;  1S4E A;  3BS9 A;  1QY7 A;  3EVW A;  2GIQ A;  1G3O A;  2Y1J A;  5AT1 B;  1F5A A;  2NCK L;  3HHL A;  4UOF A;  2Q6C A;  3VAM A;  1PGZ A;  3EGW B;  3EWG A;  2B7B B;  3I9V 9;  3FBB A;  4OZ5 A;  4DN0 A;  2XB2 D;  1HHQ A;  1L3V A;  4DXL A;  1CJV A;  4HH0 A;  3HHN B;  2OEM A;  1R6V A;  3FSY A;  1OQ6 A;  1VQ7 S;  2HWH A;  4HLB A;  1S0N A;  5B0E A;  3MM8 A;  2C42 A;  1RHU B;  4PAB A;  4QWA A;  3FDS A;  4DUZ J;  2OH2 A;  1X4B A;  1JLE B;  1SKU B;  2AEM A;  4BC7 A;  5HMZ A;  2EW9 A;  3I55 S;  3DDI A;  7AT1 B;  1QAJ A;  3MXH P;  2KFN A;  2AJ0 A;  1F6T A;  2EBE A;  3TUJ C;  4NLQ A;  2C1E B;  4K50 A;  5G0R B;  3CC2 S;  1DAX A;  3GR0 A;  1CJK B;  2BM0 A;  2VHG A;  1TVR A;  4R8U B;  2HAI A;  2LEB A;  2PO4 A;  1NO8 A;  1RAD B;  3PW5 A;  2IMW P;  2XYH B;  3H5X A;  3HZG A;  1UPM B;  1HL6 A;  4NI2 A;  2V4J B;  4P2X A;  1I6J A;  4AND A;  3LP0 A;  1Q0N A;  2KT2 A;  4UOH A;  4C6A A;  2V34 A;  4LVO P;  1QM9 A;  3CE8 A;  1OSC A;  3EUN A;  4ID8 A;  5E7O B;  2PEH A;  1BWV A;  4C8N A;  4P10 A;  1DUR A;  1RDR A;  3S7R A;  4CM0 A;  1WG4 A;  3R8Y A;  4D3G A;  4WFB Q;  5D4O A;  5L8R C;  4N56 A;  2B43 A;  1LOU A;  4IOB A;  5KG5 A;  3H2L A;  2LEA A;  2NRE A;  4V1A k;  2YKN B;  3KJQ B;  3W7B A;  3R3T A;  1RQ0 A;  4QYZ J;  4F2R A;  7FD1 A;  4KBI A;  1SI9 A;  3FSX A;  5CYQ B;  5HVF A;  3ZZZ A;  1HHT P;  3PRD A;  3TNV A;  1TL5 A;  1HQE A;  3VR1 A;  1Q78 A;  3IFE A;  3M05 A;  3QZ7 A;  2E1R A;  5IZH A;  2CFX A;  2QV6 A;  3Q89 A;  1SC6 A;  1VQP S;  3KOA A;  3ISN C;  1MWY A;  4RWW A;  1DTT A;  1T11 A;  3L7O A;  5ETP A;  4ED8 A;  2VG6 A;  3CD7 A;  1DLO A;  1N52 B;  5J2P B;  1H2T Z;  2RML A;  4AL6 A;  4DL3 A;  1Q5V A;  4RU9 A;  4KKO A;  4LSN A;  2C3P A;  1HWL A;  4B9T A;  2CPX A;  1X0P A;  2RQM A;  2IJF A;  3UFC X;  1H73 A;  3HVT B;  4HKQ A;  1NK8 A;  3US5 A;  5F3Z A;  4RX6 A;  2DPJ A;  5GAE U;  4XPE A;  2YQ1 A;  4I7F B;  2FTR A;  4B08 A;  3GIK A;  5H9E K;  3KLH B;  4CYU A;  2DIT A;  3CIM A;  1VLY A;  3D0G E;  2C2E A;  1RT2 B;  1RTI A;  3R9L A;  1RBA A;  4DHV A;  1R8H A;  1P6T A;  1U24 A;  1UJ5 A;  3AB4 B;  3HI9 A;  1S9E A;  1SKS A;  1VHI A;  4DV0 J;  3O1L A;  1PBA A;  3SI8 A;  2NYH A;  3C8Y A;  2Z2L A;  4HAC A;  2R7R A;  2RKI A;  1R8B A;  1PYT A;  4WK3 A;  1IXK A;  3W61 A;  1D09 B;  2KYZ A;  4X4O A;  4KH0 B;  4URQ U;  4DV5 J;  3JSY A;  2G0I A;  3FQK A;  5DQH A;  5L1K A;  2M2B A;  3R5A A;  4HDG A;  5BXI A;  5DG7 A;  3HSJ A;  4HHU A;  2YY3 A;  2RQ4 A;  2ZD1 B;  4WTY A;  5KFS A;  2MPU A;  3GJQ B;  4LF2 A;  3Q8U A;  3DYA A;  2L9W A;  2PDA A;  2LEP A;  4FNH A;  4DV6 J;  5LL6 d;  2DCL A;  3LWM A;  2DR7 A;  4JI2 J;  3EMT A;  1S59 A;  3HZE A;  3ITH B;  4YY3 J;  3OTO F;  2VJV A;  1S6U A;  2HNY B;  2PD1 A;  1UW4 A;  2DHS A;  2HNY A;  3TUZ C;  4C8O A;  3PRV A;  1UFW A;  4UUX A;  3TJ8 A;  4ETX A;  2FY1 A;  3OXL A;  1WUU A;  4CO3 A;  2UV8 A;  2W8K A;  2IBO A;  2C2R A;  1T3N A;  1SV5 B;  2NXJ A;  3P49 B;  1EHW A;  4N8N A;  1FDD A;  3BKT A;  2B56 A;  5A8R A;  5D4L A;  2CUY A;  5D78 A;  2CQ3 A;  1I1G A;  4I2P B;  2GGP B;  2NSB A;  1TKT A;  4U8V A;  4WE1 A;  1SJ1 A;  2RD5 C;  2V2K A;  4JI0 F;  2AJF E;  4QJV A;  4TU7 A;  2R7S A;  2HYI B;  2BW2 A;  2GO9 A;  4NZ6 A;  1MMD A;  4OJ1 A;  4P7V A;  1JLF B;  2MZ1 A;  2W7P A;  3H40 A;  4LRF A;  1V3R A;  2VQF F;  4RW4 B;  3S1T A;  2EFQ A;  5GAG U;  1DY3 A;  2E1P A;  3CME S;  4UT4 A;  3MAQ A;  1NKB A;  2XHW A;  3G2X A;  4JV5 J;  2OKQ A;  2DNL A;  2ZNY A;  5M2U A;  2XNR A;  3BGR A;  3QPI A;  3DOM B;  4JI5 J;  1FWL A;  3K59 A;  2Z8Q A;  1WSV A;  3W60 A;  5ETV A;  4F36 A;  4KGX B;  1O5J A;  4UST A;  1W25 A;  3V2U C;  1QD1 A;  2VPZ B;  1RLD A;  1GX5 A;  1M5H A;  2LCW A;  4U6P A;  3IG1 B;  2DR6 A;  3FZ2 A;  1IKW B;  4S0M A;  2IVF B;  1C2P A;  4KSE B;  3CCL S;  1NSQ A;  2HHS A;  5F8J A;  4RNM A;  2YWE A;  3BBC A;  2RUG A;  3I87 A;  4CH0 S;  1FNX H;  4KAI A;  1RAO A;  3BGO P;  3HVA A;  2V9K A;  3DM2 A;  3M8W A;  1KC8 T;  3QAT A;  2EG1 A;  3SFU A;  5KG3 A;  4CO5 A;  5F8M A;  2NR0 A;  3OXF A;  3CF5 Q;  4TKT A;  4EUV A;  5HMW A;  3MD1 A;  3QID A;  3KLF A;  4ENO A;  4IQX A;  2EEY A;  2H3E B;  5KFW A;  4Z7Y A;  2P6T A;  4G1Q B;  1G6B A;  2ZDP A;  4KRW A;  4U7C A;  4F2S A;  3AFG A;  3ENW A;  3MEC A;  3K5N A;  2BM1 A;  1VRQ C;  2C22 A;  4I7F A;  3HKW A;  4FKX A;  2D3Z A;  5CXT A;  4KPY A;  4IG0 A;  4TY8 B;  3KK1 B;  4OJ3 A;  4O3O A;  5HI7 A;  4PZV A;  5KFV A;  1JJ4 A;  2EFN A;  1LWF A;  3BGL A;  4NCB A;  4ED6 A;  1RWK B;  1WC4 A;  1VIO A;  3MM9 A;  4NXM F;  4C8M A;  3DFE A;  2R2U A;  2D3O R;  4Q8F A;  4YB5 A;  4MYT A;  3G6E S;  1MNE A;  5HL7 Q;  4R5P A;  2C2N A;  4TLR A;  2VH7 A;  2QIF A;  1RAC B;  1FT8 A;  4IRC A;  5F8H A;  4FXD A;  1MRO B;  3NCP A;  4E2F B;  5C2G A;  4PPZ A;  1UA1 A;  1N36 J;  3QRQ A;  3HD2 A;  4OX7 A;  4M5M A;  4FXV A;  1FCA A;  2BKN A;  2P6S A;  1FKP B;  1X9M A;  1QSS A;  1SIZ A;  3SQG A;  3CXC R;  3EPG A;  1FRL A;  2W9B B;  5KG7 A;  1SUQ A;  1YIJ S;  3PR5 B;  4C97 A;  5DLF A;  4KGV B;  3AJ1 A;  4TLQ A;  5KFM A;  4MYU A;  2DT9 A;  1WOR A;  3ITH A;  4EBC A;  5DGA A;  2V69 A;  3KLE B;  4QYZ K;  4NWB A;  1B3T A;  2VBX A;  3EIC A;  2W7O A;  3CCJ S;  3QT6 A;  1SC3 B;  3QGH A;  4JI0 J;  2PI4 A;  1RT5 A;  4URG A;  4WTO B;  3QNW B;  5DJB A;  3HHK A;  4A8Y A;  5B0F A;  4CO2 A;  4DPW A;  2UXC J;  4IFY B;  2HHT A;  4G1P A;  1ZZN A;  1RYS A;  2OP5 A;  5L1L A;  4DV4 J;  3GFX A;  3SZ2 A;  4ECS A;  2RHS B;  3OR1 A;  3BM7 A;  4Z2X A;  4NZ0 A;  4ED1 A;  1TL3 A;  2JC1 A;  2ZKU A;  2AEJ A;  3DRR A;  1SQE A;  2L48 A;  1HWJ A;  1TL4 A;  4A8Q A;  1GXU A;  1UJ6 A;  1KLM B;  5LSL A;  3HMJ G;  1KQS R;  2B9W A;  2HQF A;  3MCN A;  3ZZU A;  1AUD A;  3ZO7 A;  4ZLN A;  1TTH B;  2MKS A;  3UW1 A;  3LTO A;  4DX5 A;  2OEK A;  3ETM A;  4NLV A;  3OTB A;  4X64 F;  2YWF A;  2GZO A;  2IAJ A;  3CJ4 A;  1RT1 A;  5I42 B;  4DQP A;  2V8D A;  3PM9 A;  4DR2 F;  3EVM A;  3O2I A;  1Y11 A;  2ALY B;  2J7U A;  4FXW A;  3N79 A;  5C42 A;  2W8L A;  2XZW A;  1J27 A;  5CD4 H;  3GV8 B;  3AD8 C;  4ECR A;  3DNC A;  1PC5 A;  1SH3 A;  5EDW A;  3TQE A;  4FVC A;  1U0S A;  1N0U A;  4MKB A;  4YDD B;  5T14 A;  2PN6 A;  2J76 E;  1SIW B;  3RW7 A;  5CYJ A;  2WON A;  3QMQ A;  1IM6 A;  3QO9 A;  2KZZ A;  4BHQ A;  4F4A A;  3D54 A;  1YJN S;  1FWP A;  2FGC A;  4LBH A;  3ZNU A;  2CJK A;  2F4V F;  3DRP A;  3GIJ A;  1VQ4 S;  1RAA B;  4N7T A;  2JVR A;  1KWM A;  2WBM A;  3H98 A;  4NRU A;  1WHW A;  1T03 A;  3DKD A;  3I0R B;  2R42 A;  5B0G A;  1M1K T;  3LO3 A;  3OD2 A;  5AJ3 F;  3TAM B;  3L7U A;  3QFW A;  1IBL F;  1R0C B;  3MR2 A;  5DS7 A;  3JSB A;  1WEZ A;  1JLA B;  2QMW A;  3B4D A;  3BEG B;  3SSR A;  2Y9H A;  3QRR A;  1APS A;  2R8G A;  1R0B G;  5J1N A;  4DN9 A;  4KHR A;  2Z30 B;  2HBY B;  4MK7 A;  2C2D A;  1M1H A;  1YBA A;  4LSZ B;  4X4T A;  2W9C B;  1IQT A;  5J2N A;  2M9K A;  3DGP A;  2JVO A;  1HBO B;  1LEO A;  4PYA A;  1CC7 A;  1HR0 F;  5IV3 A;  4G3I A;  2R7V A;  1HYS A;  3P5B P;  3LAL A;  3DRX A;  2J0W A;  3HLU A;  3W2W A;  1FRX A;  3C16 B;  3HCX A;  1NDC A;  2FIU A;  2VG7 B;  3CCQ S;  2EI5 A;  1UEK A;  1QDU B;  3FNN A;  1NZ8 A;  3KUE A;  3S8S A;  3KK2 A;  4O3R A;  2IY5 B;  3HVT A;  3PX6 A;  2IHR 1;  1TQL A;  2DGX A;  3DDK A;  2N3O A;  2W2Q P;  4ZPB A;  3K57 A;  4JB8 B;  3EPI A;  1X4G A;  1XIQ A;  2VJU A;  4J91 A;  3PYE A;  1U1R A;  4PQA A;  1EKS A;  2IIH A;  2DNR A;  5D3G A;  2ZJR Q;  4EEY A;  4YME A;  4X4Q A;  1E6Y B;  2E5L F;  1K0V A;  1H2U X;  2WZ1 A;  2EK1 A;  4Q7A A;  4ZP8 A;  3M8Y A;  2ZVI A;  4O0I A;  2HS3 A;  3KWM A;  3OR2 B;  2G1D A;  3KG4 A;  1S10 A;  2YKM B;  5B08 A;  4J9P A;  5K5M A;  3QGG A;  1U2C A;  1XMB A;  1KQG B;  1NPP A;  2E5G A;  1XER A;  3MF5 A;  2DRD A;  2RKI B;  3WC2 A;  1U2F A;  4PUO A;  2FJV A;  4DL6 A;  4PUO B;  4PRF A;  3BYR A;  2F5G A;  3TEG A;  4RZR A;  2XMM A;  4H4M A;  1HR0 J;  3CT9 A;  1LKZ A;  2PSZ A;  4A8S A;  1U1K A;  4IR9 A;  3RBD A;  3MM7 A;  2BV3 A;  3C6U A;  4ES2 A;  1IBM F;  1RTJ B;  3DMJ A;  1NK4 A;  4JI5 F;  4W98 A;  1T3O A;  2EKN A;  3Q2T C;  1JIH A;  4HHH A;  3MMC B;  1UL3 A;  1CJU B;  1U6F A;  4IFV A;  2HG4 A;  5E3Q A;  3VAG A;  1SJ4 P;  2HHQ A;  1NB2 A;  4GKK F;  2QA4 G;  2XYG B;  1GAO A;  3NS7 B;  3DXS X;  4ETZ A;  4ILR A;  3FBE A;  2HRY A;  4OI4 A;  1TV6 A;  3DLE B;  3RZA A;  3DRY A;  5K14 A;  3PX0 A;  2UXD F;  2XZT B;  2QO3 A;  4L75 A;  2UVV A;  4FYD A;  2IFX A;  1FD8 A;  4M1K A;  2OEJ A;  4PWD A;  2DD8 S;  5DLG A;  1MWZ A;  2B0G A;  4RW8 B;  4Y2K A;  5FLX U;  4BS2 A;  2UUA F;  2XEX A;  2CJY B;  1K47 A;  2MST A;  3IA0 A;  1HQE B;  2XY6 A;  1IBK J;  3M8Z A;  4TVA B;  2PMZ D;  4MMO A;  3V5R A;  2ZH8 A;  1SL2 A;  4QPT A;  1FI4 A;  5DQG A;  5GVQ A;  1NSP A;  5A0Y B;  4DOZ A;  4B9M A;  2V94 A;  4GC6 A;  1F2H A;  2W2P P;  2WVD A;  3MAH A;  3OQ2 A;  2XCP A;  3Q0A A;  2KG0 A;  2OML A;  2VPX B;  2YKA A;  3I4H X;  3NBP B;  3FUY A;  2AU0 A;  5HJX A;  1HNW J;  4KJI A;  5IS2 A;  1YTY A;  2XS7 A;  1KR4 A;  2HS4 A;  4EYI B;  4B3S F;  2OTJ S;  3OLB A;  1X9S A;  1TZ0 A;  3ZZR A;  2JEG A;  1U0H B;  3T19 A;  3CDU A;  2I5J A;  4LF9 J;  4ZIV A;  3MMA A;  5H9E J;  1REV A;  5K9F A;  2B5J A;  2EKY A;  1QTM A;  2B5J B;  4F4Y A;  4J5O A;  5F8N A;  4P74 A;  3QJL A;  2QEX S;  4USK A;  4QWC A;  5KTQ A;  5DDR C;  2RH3 A;  4ZVT B;  2E1C A;  3UCU P;  3CO9 A;  3LAK A;  1R89 A;  3P8B B;  1YJU A;  5GME A;  3M8S A;  2V2Z A;  2K1R A;  4O4G A;  4I4B A;  4H4K A;  2AGP A;  1GEH A;  2FJA B;  2HVD A;  1CPZ A;  3RR8 A;  4QIE A;  2DCU B;  4NLW A;  5ETS A;  3K0J A;  4IOC Q;  3ONQ A;  2AJ1 A;  4IG3 B;  2ALZ A;  1FJE B;  4NAS A;  2J8A A;  3T1H J;  2AD9 A;  2IBK A;  1JJH A;  2NS1 B;  1JLQ B;  1KTV A;  2Q43 A;  2NYI A;  4K4Y A;  1JJ2 R;  2AYE A;  3H59 A;  3IR5 B;  1HNZ J;  2IRU A;  3M7V A;  1SVD A;  2JLF A;  3T3F A;  1HW9 A;  1RT6 B;  2K06 A;  1VQM S;  1RT6 A;  2NQP A;  3MGJ A;  4Q45 A;  5J2Q B;  4ZCK A;  5ETL A;  2H65 B;  4H4M B;  2DYA A;  5K8N A;  4KO0 B;  3GJR B;  1UVM A;  4NLS A;  3HHD A;  2EK6 A;  2W24 A;  4IH5 A;  4RW6 A;  2RAQ A;  2VL1 A;  2BYC A;  4U9R A;  2ZH2 A;  3VQS A;  2QL9 B;  1NAQ A;  2V5H G;  4C2M A;  2EFG A;  2ZNZ A;  2NPF A;  2J6U A;  4OYI A;  4GMK A;  4RNO A;  4WU3 A;  1HHS A;  1WF2 A;  1B0V A;  2CJQ A;  1ZM2 A;  2XSF A;  3CW2 C;  3LP0 B;  4WYW A;  4X66 F;  4WCE Q;  1SQF A;  2A10 A;  1UW9 A;  2HQG A;  4OZ3 A;  4PWW A;  4TY9 A;  5C2C A;  1S49 A;  2WAQ D;  1FKO A;  4RL1 A;  5ETT A;  3WZ0 A;  4BDP A;  2BR0 A;  1GMW D;  1LWE A;  2GC8 A;  3CJ3 A;  3UD4 P;  3QLH B;  2JEF A;  4JI4 F;  3SV3 A;  1RAJ A;  2BVZ A;  2F4F A;  2IYG A;  3SBM A;  2VFT A;  4ZN1 A;  5E5N A;  3PHE A;  1CG2 A;  2ERR A;  1ITP A;  2RIJ A;  4KFB B;  4KE5 A;  4C9D A;  3CTR A;  2YTC A;  4DF8 A;  5EWG A;  1XR5 A;  2ZBR A;  3OJU A;  1SKW A;  3NL0 A;  4RUH A;  4EK2 A;  3Q8V A;  4LFC F;  4PG7 A;  1S1T B;  4I1T A;  4R25 A;  1WG5 A;  2F40 A;  4CYU B;  4F04 B;  1XTZ A;  5JUM A;  1WEX A;  2WCX A;  4L74 A;  1H7X A;  2ATL A;  3QSI A;  2W2O P;  3H42 A;  4J90 A;  4LF6 F;  3NCQ A;  1F3F A;  3GJS B;  3ULH A;  3IAM 9;  3T6J A;  4CH7 A;  2CVI A;  3WX8 A;  5H9F J;  2E7V A;  4ED5 A;  3W1Y C;  4ANC A;  2FHM A;  2WSE C;  3GQC A;  1T9U A;  3MDF A;  4HDH A;  4ZS6 A;  4DR3 F;  2KM8 B;  3VHQ A;  4UQG A;  1S5Z A;  1JKH A;  2G0C A;  5KFA A;  4DR2 J;  3SCI E;  2KKH A;  4QU6 A;  2QFI A;  2OD6 A;  3THP A;  2CG4 A;  4X4V A;  2LQ5 A;  3ILI A;  2LLZ A;  2YWW A;  4LT6 A;  2M70 A;  3NGS A;  1MML A;  4USI A;  3DLK A;  3QO9 B;  3LAN A;  5KFI A;  2DNY A;  3W2V B;  4ZVG A;  2X3D A;  2OUG A;  1ZM3 A;  3TR5 A;  4QIF A;  3M8Q B;  3R5C A;  3ZZO A;  4WFN Q;  4K4T A;  5KFK A;  1EP4 B;  1IKV A;  1RWU A;  4O44 B;  3ZTO A;  2MJN A;  2HND B;  1H74 A;  4R8U A;  2X1F A;  1VC0 A;  2V2Q A;  2B9Y A;  1TAQ A;  3FQL A;  4YFU A;  1RHK B;  3BO3 A;  3V6D B;  2AT1 B;  3CSK A;  2DH9 A;  3AXK A;  2AZ3 A;  1LW0 B;  1S1X A;  2PT0 A;  1WDD A;  3EYZ A;  1S1X B;  2WBR A;  3MM6 A;  3DRS A;  4UZB A;  2L9D A;  1IWA A;  4EBD A;  2VA3 A;  4EZ6 A;  1LW2 A;  3J80 U;  3MEG B;  3V6J A;  2WB4 A;  5CCL A;  5LM7 E;  4O3N A;  2W7A A;  1FO1 A;  3HFV A;  1M90 T;  4P2S A;  2JOQ A;  4I64 A;  1LQ9 A;  4K2J A;  4TU8 A;  2PMW A;  3W9J A;  1VQL S;  1WHX A;  1GFW B;  3F0N A;  1NK6 A;  1XC9 A;  1Y3K A;  2HKE A;  1C0T B;  1V5V A;  3UWT A;  1DQA A;  1NKC A;  3FRZ A;  2HEK A;  4LF8 F;  2UXB J;  1RA6 A;  1IKW A;  3J7Z T;  2DY9 A;  4P52 A;  1FNO A;  3DI6 A;  3W9H A;  3IGN A;  4KGM A;  4NML A;  1VC5 A;  4JI6 J;  4LBP A;  3RJM B;  5HP1 B;  4NMX A;  3TUP A;  4OQJ A;  3MPD A;  2CQ1 A;  3MPW A;  2DIV A;  4KH1 B;  2V4R A;  1KDN A;  3HUL A;  1MN7 A;  1KLM A;  3KLV A;  4DUY F;  2VOP A;  5D8H B;  2JRS A;  1S12 A;  5C7P A;  3J7A 1;  3V81 B;  2Y0B B;  4EZ9 A;  2CWX A;  1U09 A;  3DOK B;  4M5L A;  4CLU A;  2QA2 A;  1Q1K A;  1Q4R A;  2V6A A;  4M5K A;  4QR0 A;  4WXW A;  1TKD A;  2UUA J;  2RQC A;  1R6Y A;  5IT9 Y;  1LFW A;  4C11 A;  5E2Q A;  2DJW A;  5BJR A;  3KLH A;  4W90 B;  3ZZP A;  1SH0 A;  2CQ0 A;  1J5E F;  4UOG A;  4N41 A;  1KS2 A;  1WHY A;  1BGX T;  1X4H A;  3ILL A;  5B0D A;  5DM6 Q;  3RBE A;  1N4L A;  1Q95 G;  4KYZ A;  3M1V B;  2FPH X;  4IQM A;  1FFW B;  2VF3 A;  3KHL A;  2CQC A;  1UEV A;  2ZVS A;  4LF7 J;  4J9U E;  4PCQ A;  3CMQ A;  1AXQ A;  1N0V C;  2DNH A;  3CCZ A;  2BUN A;  3EJM A;  1MRO A;  1R7I A;  3MFH A;  4IR1 A;  4F67 A;  4GO7 X;  1BQX A;  1QTN B;  2WSC C;  3BR9 A;  1UMJ A;  4W4M A;  1KRP A;  3IWN C;  4K4S A;  5HVH A;  4ITS A;  2KYX A;  2UVU A;  3K8V A;  3DYA B;  2V8P A;  4LQ3 A;  2OGU A;  2HUR A;  1LWF B;  4DR6 J;  2A0F B;  4H4O B;  1U25 A;  4C8Y A;  2GJ2 A;  4XO0 A;  1HBU A;  3A8J A;  4NYP A;  3A3P B;  1MN9 A;  2BBE A;  3PIO Q;  2XI2 A;  2AJ4 A;  2FQQ B;  3BYP A;  3IGV A;  2ASL A;  3A3O B;  2HND A;  1X5O A;  4WFX A;  2B6A B;  4ZOS A;  4M95 A;  1T02 A;  2M3D A;  3JTN A;  3M30 B;  4LRB A;  2XQC A;  2HVH A;  1I51 B;  1H7W A;  5KG6 A;  3GV7 B;  1MU2 B;  2W4D A;  2VUG A;  2VG5 A;  4N47 A;  4NLY A;  1KFD A;  1GK8 A;  1M5S A;  3NXZ A;  2QT7 A;  1PKU A;  1VIX A;  2BW7 A;  3GFH A;  3FVY A;  3BF4 A;  1T94 A;  4NLX A;  1U1N A;  4JI2 F;  1F60 B;  2HK3 A;  2KHD A;  1YJT A;  3O6Q A;  1WI8 A;  4OLP A;  3UDV A;  2PGC A;  2JH3 A;  2L41 A;  1FHT A;  2RRN A;  1RU2 A;  3MUT P;  1C4A A;  3CNQ P;  2ZOM A;  2RU3 A;  4USM A;  1M1G A;  4DX6 A;  5KFC A;  3Q23 A;  4DV6 F;  2HK2 A;  1XWL A;  3CUN A;  4DQS A;  2NSC A;  4DPU A;  1BC6 A;  2XI3 A;  4ER8 A;  3MED B;  2RS8 A;  2BMB A;  4QYR A;  3KHR A;  4DUT A;  3QIP B;  4M8L A;  3T5J A;  5LJ5 Y;  4PAA A;  1RP5 A;  2JFD A;  3TX0 A;  2XC9 A;  2BOA A;  4NCG B;  1TAU A;  3LPE A;  4LSL B;  4MJK A;  1IQZ A;  4P2M A;  4LF1 A;  3DLG B;  1X5T A;  4ZVS B;  1D8Y A;  2RF2 A;  1NJZ A;  1EZZ B;  1U1L A;  2CQP A;  5J1E B;  3OR2 A;  2HVI A;  2ZM6 F;  1CJV B;  2HVZ A;  1PAE X;  4MFB A;  4NEZ A;  1H98 A;  3D5M A;  3L09 A;  1KKH A;  4FYV B;  3MEK A;  4LR9 A;  2VQF J;  3PW4 A;  3QJJ A;  4IDK B;  1F5C A;  4IH7 A;  3GMG A;  2B4P A;  4PPD A;  4UOC A;  2RB7 A;  3AD9 C;  4HH1 A;  3W8P A;  5ETN A;  1RWO B;  4PWU A;  2XMJ A;  5ITH A;  3MM9 B;  1I3O B;  2GML A;  4DX7 A;  4LRC A;  5KFJ A;  3H2V E;  5KT4 A;  4JI7 J;  2C3O A;  1UZD A;  4MK9 A;  4Y3C A;  3OBI A;  5HVG A;  1XBW A;  5KOW A;  2V9W A;  4HI1 A;  3RRG A;  4ZVO B;  3DXB A;  3UN3 A;  1N5T A;  5KT6 A;  2XGQ A;  4PKD B;  1TMJ A;  2DY1 A;  3PJ9 A;  1NLK L;  3OL6 A;  1NHU A;  1CC8 A;  3C16 A;  3LPY A;  4ED3 A;  5E0O A;  4GC7 A;  2OPQ A;  3GCW P;  4PQU B;  5L46 A;  3IRX A;  3RTV A;  3PW0 A;  3IM9 A;  3EXY A;  2RQK A;  1RAF B;  4DUZ F;  2WB1 D;  4G65 A;  3I96 A;  1N56 A;  1KVI A;  3DOM A;  1S6Q A;  1CJT A;  2I9S A;  1WJ9 A;  3QFH A;  2BJ8 A;  4GVB B;  4F0H A;  1IUJ A;  2FY8 A;  1HNZ F;  2J0Q D;  3K5L A;  3NWG A;  2B6A A;  1WD6 A;  4Y2A A;  1AFJ A;  4MAK A;  1ZM9 A;  3FZB A;  4X2B A;  2QFJ A;  2O67 A;  3L4B C;  1LK5 A;  2E5H A;  1X4F A;  5M2R A;  2VB6 A;  5D77 A;  4DQQ A;  1FKA F;  1UVJ A;  2VG5 B;  1KQF B;  1FEE A;  2DHH A;  1YZ7 A;  3HT3 A;  3Q8R B;  3KTQ A;  2WVC A;  2D9O A;  3EZO A;  3HHL D;  3RAX A;  2R2S A;  4U8Y A;  1JNR B;  2MY8 A;  3BZQ A;  2HRT A;  2Y8W A;  4ELU A;  2HFZ A;  3HDS A;  3FCW A;  2H51 B;  3I56 S;  3D6H B;  4DSK A;  2ZH9 A;  2WK4 A;  2HMI B;  3JYT B;  3W64 A;  4B3T F;  1D8Z A;  3J81 U;  1QLN A;  4M63 A;  1RT1 B;  2EFP A;  2F3J A;  3JTP A;  3P6Y C;  1B0P A;  2AYB A;  4B17 A;  4KV8 A;  3GSI A;  5BYQ A;  4AXI A;  3JAM Y;  3EE3 A;  2O1P A;  5KFZ A;  3QGI A;  4BWJ A;  4YR2 A;  3I82 A;  3A3N B;  1S97 A;  2AX0 A;  4DG1 A;  4ZIT A;  3EDR B;  4RBU A;  2LQJ A;  4Y0F A;  4KTQ A;  1YRT A;  3G8T A;  2KU7 A;  4UQT A;  2J9C A;  3CUL A;  2MLX A;  3N01 A;  3DLG A;  3JQJ A;  4Y28 C;  5F8I A;  4JV1 A;  5EWE A;  1IWG A;  3D4J A;  3V4I A;  3MR6 A;  2RU9 A;  2QG9 B;  2YKO A;  2PA3 A;  3R7S B;  3V4I B;  1RHQ B;  4RWX A;  2D1C A;  2H48 B;  3VCD A;  2ZH5 A;  2ZFH A;  3GLJ A;  1T9W A;  2IPO B;  1VR6 A;  4IYQ A;  3CCS S;  3ZXW A;  5KFH A;  2QLX A;  3FEX B;  5FLX Y;  3ELH A;  4CIO A;  1N48 A;  3Q8S B;  1KON A;  2JEJ A;  1JLF A;  1S4F A;  2QL7 B;  1FA0 A;  2GIF A;  3I0R A;  3AD7 C;  2MB0 B;  1U48 A;  1I5O B;  1B4S A;  2H5E A;  2UUC J;  4FYX B;  2X1B A;  4ICL A;  1JLC B;  1W2B R;  1YVF A;  5J2M B;  1OMS A;  4OI0 A;  3RB0 A;  1R0A A;  4WKR A;  1CQN A;  3ENV A;  4RBT A;  3MMJ A;  1SV5 A;  4DL4 A;  4RNF A;  3A8E A;  3GPA A;  3ILO A;  1C1C B;  3CDB A;  3FRY A;  4DV2 J;  1QAX A;  3T1Y J;  1N33 J;  2ZZN A;  1HQU A;  2LXI A;  1PG5 B;  1YJR A;  4FZV A;  2B4V A;  5IC4 B;  5AE2 A;  1U1O A;  1L3T A;  4ZVE A;  4YB6 A;  2GX8 A;  2BJ1 A;  1HBN A;  2LQ8 A;  2QGF B;  3VZI A;  4DCJ B;  5DG8 A;  4X62 F;  2F7V A;  2W01 A;  1TK5 A;  1PJ6 A;  1WI6 A;  2MSS A;  5HBM B;  4QWD A;  1SBR A;  4PQU A;  1GXT A;  3W62 A;  8RUC A;  1OPZ A;  5FJ4 A;  1RXO B;  5KT5 A;  2ADB A;  4I0W A;  2FLN A;  2LU2 A;  4DR4 F;  1TFY A;  2HZV A;  2R8J A;  2BXJ A;  2DXF A;  1FE4 A;  1R43 A;  3A13 A;  1N34 J;  4LFB F;  2AP6 A;  3B54 A;  2XLK A;  2IA6 A;  1FJC A;  1U26 A;  1P1L A;  4FKY A;  2VBY A;  2CWK A;  1O6X A;  3A12 A;  3MUM P;  1ZAW A;  4QWE A;  5KFX A;  3PW2 A;  5BYR A;  1S1U A;  5I4M A;  2CA9 A;  3I5C A;  4DFP A;  4JUZ A;  1LNQ A;  2WTF A;  4A8X A;  1RTD B;  2J5A A;  1FRJ A;  2YKM A;  1VRU B;  5KFP A;  2XO6 A;  1NND A;  1RB0 A;  9ATC B;  4A8M P;  1HNX F;  2DNZ A;  3DM2 B;  2VAS A;  3P3D A;  4HAC B;  3X3U A;  2DNP A;  3R5G A;  3KK3 A;  1JLE A;  2H5J B;  3KK3 B;  1U45 A;  2GS8 A;  2Z2M A;  3G82 B;  1UJ4 A;  2I0X A;  1F5B A;  3QT7 A;  3LGM A;  1G1X A;  2R7T A;  5KFU A;  3NAH A;  3KHG A;  2P8I A;  2P9C A;  1OYE A;  4N77 A;  3PFE A;  3IS9 A;  4XDD A;  4X65 J;  4LF5 J;  4ALZ A;  2AW0 A;  3CIZ A;  3DHW C;  3MAA A;  2HWT A;  1CSJ A;  4H4O A;  2ZIT A;  1FFS B;  1GX6 A;  1JLQ A;  2E7W A;  2Z58 B;  5AE1 A;  2XGP A;  2X7I A;  2N7Y A;  4LBI A;  4JI7 F;  1RT5 B;  2CQ4 A;  2DNO A;  2MHN A;  3I0S A;  1LWE B;  3GG0 A;  5GAG I;  3VQT A;  2CAD A;  5J2N B;  4HYK A;  1NK0 A;  5L9X A;  2YX7 A;  2MGZ B;  3ENQ A;  4FP9 A;  2YKN A;  3GE9 A;  2HQI A;  2M52 A;  4KFB A;  5D0R A;  2NXN A;  5KFO A;  4M5J A;  5BYS A;  1FDA A;  2PA8 D;  2VG7 A;  4QR2 A;  4OX9 F;  1YX2 A;  1SUQ B;  3UDE A;  5A76 A;  4KHP F;  4OI2 A;  3T1A A;  2J9D A;  2DR9 A;  1XR7 A;  1HNW F;  5KG1 A;  4C0B A;  3QZ8 A;  1VJQ A;  2DPI A;  2E44 A;  3L95 X;  4X84 A;  1V6H A;  3M2U B;  4RO0 A;  3TX8 A;  4W92 B;  3W5Z A;  3JSM B;  3UQS A;  4YP3 A;  2JSX A;  2IJR A;  4DFM A;  3FEZ A;  2CNK B;  3WIU A;  1Q81 T;  5HSP A;  4D3H A;  4F7V A;  3F73 A;  4OYP A;  3QLH A;  2DR8 A;  2JEI A;  4AQY J;  1T9V A;  3M6X A;  4J9M A;  1TUV A;  5KFT A;  3BSA A;  3MMB B;  3FCV A;  3VAJ A;  1MLA A;  4NA2 A;  1HBN B;  1SL0 A;  1PCA A;  3OL7 A;  1S72 S;  1HWI A;  1UET A;  2EG2 A;  3M2V A;  2CQB A;  2FLO A;  2KRR A;  2VIH A;  4F0M A;  2J0S D;  5JMN A;  2VBZ A;  5EX3 A;  4DQR A;  3MTK A;  4ES1 A;  4OYO A;  1NK5 A;  4MT1 A;  4WK1 A;  2OFG X;  3A8I A;  3KNG A;  4NLD A;  4C8L A;  1FE0 A;  3W2V A;  2VDI A;  3KDN A;  3OFF A;  3SIP B;  4N5S A;  3KLF B;  4IO9 Q;  3OPK A;  3G71 S;  4OHX A;  4AL7 A;  2IAJ B;  1NKE A;  1IR0 A;  1F0X A;  2UUW A;  2MZR A;  5F41 A;  4OIX A;  2C3M A;  2JJ4 D;  3BV8 A;  3CCW A;  4R5P B;  2JLG A;  2B3T B;  1VJW A;  3R5D A;  4OLO A;  2HHW A;  1FK9 A;  1ZH5 A;  1YJ9 S;  1CS4 A;  1N88 A;  3ZTP A;  2NXC A;  3H2U B;  5F9L A;  2UXC F;  4BCA A;  1DJ0 A;  1QE1 A;  3RUB L;  5GAD I;  3FFI B;  3M32 A;  2MTL A;  5A8K A;  2YNF A;  3M32 B;  1Y5I B;  4Y65 A;  3MCO A;  4JI1 J;  2QLB B;  5HN0 A;  3EX7 B;  4ZLP A;  4DV3 F;  3TQ1 A;  2IM0 A;  4A8K A;  2D74 B;  2VOO A;  4DPX A;  1Z1Z A;  3FBC A;  4I6A A;  4UW2 A;  9RUB A;  4YR0 A;  3J80 Y;  3OSN A;  3AY0 A;  3G82 A;  1TFW A;  5DQI A;  4F3O A;  3D1Q A;  2HGL A;  2KL8 A;  4KO0 A;  2BJ3 A;  3CJS A;  1DQ8 A;  1EQM A;  2CQI A;  1FRK A;  1HNV A;  4CWB A;  4C48 A;  2GHV C;  2DEJ A;  1U4B A;  4DS4 A;  4AYB D;  3IRW P;  1KD1 T;  3T9Z A;  5B0A A;  3V6D A;  5HLF A;  2ZKT A;  2K7K A;  1Q5Y A;  2MLZ A;  3D3C J;  3DOL A;  4E8U A;  4I2P A;  2CDR B;  2HS0 A;  2EC0 A;  1JLA A;  2FC8 A;  4ZLL A;  3I4P A;  3M8P B;  4NLO A;  3LWL A;  3GIM A;  5KFY A;  4UY8 5;  2CNN B;  4O4R A;  1Z2L A;  4OFZ A;  4Y00 A;  1D1U A;  4MIA A;  4DV5 F;  2GQC A;  4K5S A;  2MMY A;  1X5P A;  2E1A A;  3C14 B;  4USU A;  3CJK B;  4ZPD A;  1T7P A;  3R1L A;  2A6M A;  3WHI A;  4FNI A;  3V81 A;  2ASJ A;  4NEY A;  3W8G A;  2QZ8 A;  3OTC A;  3AAW B;  4F8R A;  4WZQ A;  1FEH A;  4DL0 C;  3OFE A;  1EAY C;  2WRM A;  4RNH A;  3TVY A;  3G96 A;  3DHX A;  3SXL A;  4ECZ A;  1A6L A;  1KOH A;  1Q7L B;  3D66 A;  2RIL A;  2VDH A;  1W26 A;  2B8Q A;  4ZP6 A;  2B7C B;  2QE5 A;  3KUG A;  5FD1 A;  3CO0 P;  4ED7 A;  1TKZ A;  1UVN A;  3GYX B;  4NCG A;  1AW0 A;  4ID5 A;  4A46 A;  2E9R X;  1B64 A;  4KQZ A;  2YNH A;  4Q2L A;  2MZJ A;  4CO0 A;  1YRU A;  4B9U A;  2IM3 A;  4DR3 J;  2D3O 1;  3MED A;  3CDA A;  3FEY B;  3N4W A;  3PCO B;  4CTA A;  5IXU A;  5D6G A;  2QA1 A;  4OI1 A;  1Y3J A;  4Q0B A;  5HMX A;  3OSP A;  1L5U A;  8ATC B;  3THV A;  1HNX J;  2DNM A;  2DGS A;  3H5U A;  5F0U A;  3PEJ A;  4LSL A;  3V6K A;  4FF3 A;  3WC0 A;  1N5Y A;  4ELT A;  2MKK A;  3BKU A;  3HJV A;  5LMU F;  4ECW A;  5J1E A;  1XMO J;  3LQV A;  1P27 B;  5KG4 A;  1SJR A;  4FDF A;  2JHE A;  2FYX A;  1NM2 A;  2AV5 A;  1TL7 A;  1RTZ A;  5EHH A;  2KH9 A;  3G6Y A;  4K4V A;  1T9Y A;  2LXF A;  1N34 F;  1J5O B;  4LF4 F;  4NLG A;  3MR3 A;  2OPR B;  3SCL E;  2J0X A;  2LDI A;  3CWJ A;  3PZP A;  1R31 A;  1H2V Z;  2RHQ B;  4BLG A;  1QAY A;  2F8H A;  1F2G A;  3C3L A;  1NK9 A;  2GVZ A;  2HAF A;  3IAS 9;  4BBY A;  4DBQ A;  3FKB A;  1HI0 P;  4OX6 A;  4QIV A;  3CC7 S;  1J2V A;  1JLC A;  1BY9 A;  2R8I A;  2OTL S;  2C2K B;  3IM8 A;  1R0A B;  1YGY A;  1HNI B;  1PYO B;  5CAB A;  3R5B A;  2MQO A;  3Q24 A;  4Q8E A;  3MPY A;  2J7K A;  1SL1 A;  4OJH A;  3TAP A;  1RCX B;  3FC9 A;  2FLL A;  4FF1 A;  2BAB A;  3MCS A;  3MEE B;  5KT2 A;  4IUF A;  5I3P A;  2LEC A;  2IVM A;  1T0T V;  3GG1 A;  3NNA A;  3TZZ A;  2H54 B;  3MTJ A;  4C8Z A;  1GT8 A;  2I8E A;  1YKW A;  2YNG B;  2LVW A;  4C0H A;  4OX9 J;  2CQH A;  3QAU A;  5D4P A;  2CZ9 A;  1AA1 B;  3I5A A;  4DR1 F;  2M0G B;  3DU6 A;  3M30 A;  3P4U B;  4U7U K;  2GJF A;  2W2N P;  2KM8 C;  5KT3 A;  4LF8 J;  4DR7 F;  3GII A;  1RLC L;  2HQC A;  2NLW A;  5E3R A;  3UNY A;  2K1R B;  3DI6 B;  4O4G B;  5A2Q U;  1PBU A;  1EIY B;  3K8W A;  3OVB A;  1XQI A;  2BKO A;  5F0W A;  2BJ7 A;  3OTO J;  2OPP A;  2RF2 B;  3FBF A;  1TK8 A;  5B09 A;  3AOC A;  1UWA A;  3ICL A;  3NOC A;  3H25 A;  2HMI A;  2EWH A;  1RT7 B;  4OHY A;  5T41 A;  2DGT A;  1FDB A;  1I94 J;  3NCR A;  2MKC A;  1VRT A;  1XJW B;  2VD3 A;  4QW9 A;  1OPI A;  4P75 A;  2XO7 A;  4C98 A;  4KT0 C;  3I31 A;  1DAR A;  2CXE A;  4C3L A;  3DLJ A;  2KTQ A;  2BE2 A;  1FX2 A;  3TOQ A;  3KMQ A;  3DLH A;  3OTD A;  2KG1 A;  2KFY A;  3PDN A;  3FK4 A;  3GWC A;  1IR1 A;  2UVW A;  4ELV A;  4DR7 J;  2LP4 A;  2E5I A;  2OO4 A;  3GCX P;  4MH8 A;  3CC4 S;  2BE7 D;  4UF4 A;  2BJ9 A;  2DNK A;  1K1Q A;  3G86 A;  4RBV A;  1U6B A;  1T05 A;  1LW0 A;  3MWB A;  4ZVU B;  3JQK A;  2SXL A;  1RAI B;  1VYA A;  1WG1 A;  2VA2 A;  3BRE A;  4K2X A;  4ED4 A;  1N32 J;  2HGN A;  3KUH A;  4RW8 A;  3N28 A;  3TVZ A;  5IM0 B;  2MKI A;  4FF2 A;  2DNG A;  4IDK A;  1LV5 A;  1CVJ A;  5D0E A;  2H9Z A;  2L08 A;  2HIY A;  1VC6 A;  1YQH A;  2CIM A;  4H54 A;  4P2F A;  3V4M A;  1FJ7 A;  1WEY A;  1FER A;  4YUD A;  5GAD U;  3ZZT A;  4CLZ A;  2HHH J;  1YBU A;  2DNN A;  4KY3 A;  3MR5 A;  4B3O B;  2LA4 A;  1F1B B;  4KR0 B;  4CM2 A;  4P9S A;  3NMA A;  4USJ C;  5CYQ A;  1LXN A;  5LMN J;  1YHQ S;  3LA0 A;  1R8C A;  4DPY A;  4Y6I A;  3ZTR A;  5C25 B;  3D6F B;  1QSL A;  3UO0 A;  3SDE A;  3PIP Q;  3M8R A;  2BQ3 A;  5THW A;  1UPP A;  3LGH A;  3NGU A;  2CQG A;  4IRD A;  5CH7 B;  5KG2 A;  4K4X A;  4RW7 B;  1NU4 A;  3HF5 A;  3V6H A;  4ZDN A;  3I32 A;  4LF7 F;  3HO1 A;  2HW3 A;  4JYA F;  4JI1 F;  2KDO A;  2RRA A;  2XLI A;  2ILZ A;  2AGO A;  2UP1 A;  2UXB F;  4PG5 A;  1IJF B;  3N5F A;  4YB7 A;  2N4C A;  1AFI A;  4WP9 A;  3GR1 A;  3LAM A;  1VS3 A;  2LA6 A;  4O3Q A;  2KN4 A;  4PR6 A;  3TZW A;  1UVI A;  1CQM A;  2KZM A;  3DOK A;  2OEL A;  2NZC A;  1HLW A;  2F1F A;  1K44 A;  3UDC A;  1FRH A;  4YS2 A;  4FS2 A;  5D3G B;  2JWN A;  4TYA A;  4LRD A;  3GIL A;  4L72 B;  1YZ6 A;  3ZC4 A;  1FRI A;  2HQ3 A;  2MY7 A;  2F63 A;  2YX4 A;  4KV8 B;  3TA2 A;  1NME B;  2O3D A;  1ZPW X;  1WF1 A;  3IC1 A;  4XDC A;  2XSJ A;  3L7P A;  2BJD A;  2X51 A;  3W66 A;  2HWI A;  4RPF A;  2Q66 A;  3NEK A;  4LIR A;  2UXD J;  2GCF A;  5K20 B;  1S9E B;  5DGB A;  4CCH A;  1A7G E;  3M6U A;  3TWZ A;  3G6X A;  1FTC A;  1RUS A;  4FN5 A;  2ROG A;  2XMW A;  1BUX A;  3O3L A;  4I69 A;  3RAM A;  1XMQ J;  2BAC A;  3D1H A;  2KFZ A;  5T7L B;  1YRX A;  5T7L A; 
#chains in the Genus database with same CATH homology
 1NHK L;  1S5Z A;  4DI6 A;  3FC9 A;  1PKU A;  5BXI A;  3Q83 A;  1HIY A;  1NCL A;  3ELH A;  3Q8U A;  4WBF A;  1NPK A;  1WKK A;  3NGS A;  2VU5 A;  2AZ1 A;  3BH6 B;  1NDK A;  3ETM A;  3EMT A;  1S59 A;  1NSP A;  1B4S A;  3EVM A;  3VGT A;  1NDL A;  3PRV A;  3ZTO A;  4DUT A;  1EHW A;  3ZTP A;  3GPA A;  1XQI A;  3EVW A;  2AZ3 A;  5IOL A;  2NCK L;  4UOF A;  3FBF A;  4HR2 A;  3B6B A;  3FBB A;  3BBB A;  3ENA A;  1UCN A;  1HHQ A;  3FBC A;  1LWX A;  4F4A A;  4O0N A;  1PAE X;  2BEF A;  1BE4 A;  2ZUA A;  1JXV A;  3EVO A;  1S57 A;  3G2X A;  1W7W A;  3DDI A;  3DKD A;  1U8W A;  2HVE A;  2DXF A;  1F6T A;  3NGT A;  3B54 A;  4F36 A;  4FKY A;  3L7U A;  2HVD A;  2CWK A;  4DZ6 A;  5CAA A;  1NUE A;  4S0M A;  2DY9 A;  2DXE A;  2DXD A;  3Q86 A;  1NSQ A;  3BBC A;  4AND A;  3EM1 A;  4UOH A;  4C6A A;  3MPD A;  3BBF A;  1VYA A;  1LEO A;  1KDN A;  1MN7 A;  3PJ9 A;  1NLK L;  4ANE A;  5C7P A;  4ENO A;  1NDC A;  1NDP A;  2DYA A;  2B8P A;  3VGU A;  4FKX A;  2B8Q A;  1XIQ A;  4UOG A;  3ZTS A;  4KPC A;  3ZTR A;  3Q89 A;  3VVU A;  3NGU A;  3EJM A;  3VVT A;  1BHN A;  1WKJ A;  1WKL A;  3JS9 A;  3VGV A;  3FCW A;  3NGR A;  4CP5 A;  1B99 A;  1HLW A;  1K44 A;  2HUR A;  4EK2 A;  3Q8V A;  1MN9 A;  3EIC A;  4W98 A;  3VGS A;  3Q8Y A;  3EE3 A;  1NSK L;  3BH7 B;  3R9L A;  5CAB A;  1ZS6 A;  1F3F A;  1NB2 A;  3FKB A;  3GP9 A;  3WX8 A;  1BUX A;  4ANC A;  3ZTQ A;  3FCV A;  2BX6 A;  3FBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...