1S57A

Crystal structure of nucleoside diphosphate kinase 2 from arabidopsis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
153
structure length
153
Chain Sequence
b'SMEDVEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYITSGPVVCMAWEGVGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSPENGKREIGLWFKEGELCKWDSALATWLRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside diphosphate kinase II
publication title Structural analysis of Arabidopsis thaliana nucleoside diphosphate kinase-2 for phytochrome-mediated light signaling
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 41
structure length 153
sequence length 153
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2004-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1s57A00
2BEFA 4HR2A 3ZTOA 3FC9A 1WKJA 5CABA 1HLWA 3FKBA 2VU5A 1K44A 4ANDA 2CWKA 4O0NA 1S5ZA 1F6TA 1NDLA 3FBFA 3L7UA 1PAEX 3FBEA 1NDPA 4F36A 4UOHA 3BBCA 3EE3A 3MPDA 3BBBA 1NSPA 3EICA 3PJ9A 4W98A 3ZTPA 3DKDA 2DYAA 1NSKL 1LEOA 1XIQA 1LWXA 3PRVA 3ELHA 3VGSA 3ZTQA 3VGUA 4EK2A 4FKXA 3Q89A 1UCNA 4KPCA 1W7WA 1S59A 1NB2A 3GP9A 1MN9A 1NDKA 1ZS6A 2DY9A 4UOGA 1B99A 4FKYA 4DZ6A 3NGSA 3FCVA 4C6AA 4CP5A 1B4SA 3ETMA 2HVEA 3G2XA 3VGTA 4ENOA 1JXVA 1NUEA 3FBCA 3WX8A 3ZTSA 3NGTA 3BH6B 1F3FA 2AZ1A 3EVMA 1NLKL 2B8PA 3NGUA 5CAAA 2DXEA 1PKUA 3Q8YA 3DDIA 1NDCA 1BE4A 3R9LA 4F4AA 1EHWA 3VVUA 1WKKA 1NCLA 1U8WA 3EVWA 4ANCA 1WKLA 1KDNA 3EMTA 1VYAA 5C7PA 3ENAA 2DXDA 3EJMA 3EVOA 3FCWA 5IOLA 2AZ3A 3BBFA 1BUXA 1S57A 1HIYA 3JS9A 2DXFA 3B6BA 2BX6A 3Q83A 1XQIA 3B54A 3Q8UA 4S0MA 4DUTA 4WBFA 3Q86A 5BXIA 1NPKA 1NSQA 3EM1A 2HURA 1HHQA 3FBBA 1NHKL 1MN7A 2ZUAA 2B8QA 4UOFA 3VGVA 4ANEA 3NGRA 3ZTRA 3BH7B 3Q8VA 3GPAA 2HVDA 3VVTA 4DI6A 1BHNA 2NCKL
chains in the Genus database with same CATH superfamily
1URNA 2AJ1A 1HBOB 1VQNS 1ULRA 5A8WB 1CLFA 1B7FA 2ZJQQ 1U1OA 4CYUB 2O5DA 2OAUA 1TK8A 4CM2A 4KJIA 4I7FB 3BSAA 2OGUA 4KHMA 4LBIA 2C2RA 3RB6A 1LW2B 4ZCKA 3CJ5A 1WHWA 3HVWA 3N01A 4JI0J 3CC4S 2FHOB 4UOGA 1S6OA 4JI8J 5KFYA 2IRYA 1Q81T 2KKHA 2HNZB 4WFNQ 2UXCF 2DNHA 3FVYA 3N79A 2K2PA 4DV2F 2HQIA 4WE1B 3NGDA 1SC3B 2XWXA 5DRKA 2AD9A 1B3TA 3D1QA 2DEJA 2VPYB 2AU0A 2QLBB 3VVUA 7AT1B 3D1HA 2CAJA 2MGZA 1T02A 3OVSA 2IVMA 1BXNA 3T6BA 2EC2A 1RU1A 3T9NA 1X4DA 4DV1J 2FVSA 4NCGB 3GV7B 3PW5A 1Y7PA 4FXDA 2BQ3A 4XO0A 4K50A 4OHXA 3K8VA 4PXEA 1RT4A 4EFAC 2FPHX 5KT6A 1W25A 2PEHA 9RUBA 4QYRA 2J6TA 3BGOP 1K9MT 5MAOA 2YKAA 4DV6J 3BPDA 1M1HA 4IRCA 3I55S 2P5VA 1XK8A 1U24A 1S0OA 3AHPA 1M90T 4ZPAA 2Z0GA 1EQMA 2M88A 4CI0B 2P9CA 4X66J 4O3SA 5KT2A 4LRCA 4BC9A 2QIFA 4FDFA 4J9MA 1REVA 2ZNZA 2GJ2A 1BE4A 1OPZA 1CJUA 3MAQA 2DXDA 4YDDB 3RB3A 3NBPA 2O1PA 5C42B 1RT5B 4MYUA 6FD1A 1HNZF 2X1AA 3SQGB 4USHA 3RRGA 4UUWA 1FKOB 3KLFA 5GADU 3W2VA 2YWEA 4WXWA 2C2OB 4U7UK 4UT4A 3CE8A 2E29A 2R7VA 2OD6A 3LUYA 2FB0A 1WC5A 4DG1B 3GG1A 3NLCA 1JLEB 2FJVA 2VPXB 1FTCA 4ECRA 2ZOGA 1RA7A 2RU9A 5J1EB 2G1DA 1KN6A 4J37A 4ECSA 1DFDA 3V5RA 4DUZJ 3D3BJ 3CDBA 3BKUA 1C0TA 4TY8B 1D8YA 5H9FK 3GYXB 3MEDA 1CJVA 3DLLQ 2FGOA 5HJXA 4RNHA 3DLEB 3HPOA 2DNGA 3LWMA 1ZA2B 3QLHB 1KD1T 2FZKB 1X4CA 4O0IA 1VR6A 1UKUA 1JLBB 5BYRA 2OTLS 3DRRA 4ZIWA 4RKUC 1N8RT 3DDNA 3VALA 1IKYA 4NLSA 2YKNA 1VRTA 2N3OA 2QTWA 2MQPA 1EETB 2YNGB 4RNFA 2N82B 4U8YA 7FD1A 3FC9A 5ETOA 4LRBA 3DFEA 3GR1A 3AD7C 3FBFA 1CJTA 2CFXA 1N48A 3KK2B 4KHPF 1SJ1A 3H2UB 5HQLA 4JI1F 1K8AT 2AP6A 2WB4A 4KIAA 4QR2A 2AEJA 1XR7A 3IRWP 2A2DA 2FVQA 4P2XA 1L3TA 1B99A 4DU8A 4RL1A 4YDXA 2ZH4A 2OPQA 2ZZNA 1WEXA 3PYFA 3FQKA 2P9GA 1MWQA 2V9KA 2B43A 4U7UD 1HA1A 2R2SA 2KTQA 1NU4A 3I96A 1NJZA 2LU2A 3I6PA 3DDIA 3KLVA 1U1QA 3ILOA 1WSRA 4ECYA 2DPIA 3FFIB 3QFWA 1WKLA 2GVDB 1VDHA 2MKIA 3KMQA 2CXEA 3NEKA 1O8BA 2AZ3A 4M5JA 4TKTA 4ZIVA 3KG4A 4PYDA 2QE5A 1U49A 1S48A 2FTRA 4DUYJ 1U6FA 3VAHA 1G7CB 4WK3A 3HCXA 3BH7B 1WDTA 2VD3A 1MSWD 3ISZA 3GIMA 1VBXA 4OLPA 1PCAA 5F8HA 5HP1A 3JTPA 1NDLA 2OHDA 2XSJA 1I5OB 3IMQJ 1FKPB 2HGMA 2OPPB 1Y5LB 5IM0B 2ABYA 3BJYA 2J0XA 3DXBA 1KRPA 2BKOA 2LA4A 2I38A 1WHYA 5LMUJ 5AXNA 1A9NB 1GAOA 1RYSA 2CIMA 2Y8WA 1JLCA 1NH8A 1U47A 3TJ9A 3PYDA 2Y9HA 4EO6A 4KC5A 4C8MA 4ZKAA 4A8FA 3AA9A 3D1OA 3JSMA 3CD7A 3MF5A 3VCDA 3SI8A 2OEKA 4LF9F 1WKKA 4WPAA 2HMIB 1S1VB 2NUUG 5G0RA 2AWZA 3NP5A 2YWKA 3CGIA 1CEZA 3SIPB 3MPUB 5A8RB 3DLBA 3MEGA 3TX8A 3UNYA 3K5LA 2ZH6A 1T05A 5C25B 3K2YA 4WIIA 4DEZA 2WSFC 4F7VA 4LSNB 1FRIA 3JAMY 1L3VA 4F36A 2VG7A 1ZA1B 4NLRA 3JQJA 3AOAA 2WRMA 3MM8B 4DXLA 2CQIA 1IR1A 1Y5NB 3SYZA 3IR6B 1U6ZA 3NS7B 1GMUA 1FERA 4TU8A 5I3PA 1UWBA 4C0HA 2FJXA 1FNXH 3C3LA 2R7QA 3A8EA 4I6YA 3BYRA 2MHNA 2NZ4A 4JV1A 2YNFA 4NEZA 3AY0A 2ALYB 3NCRA 3ONQA 2QL5B 3SCIE 4N76A 1TR0A 5LT5A 3FRZA 1MMLA 3EGWB 4DV6F 3N6NA 4UF4A 2CJAA 4ED3A 1NK8A 1VYAA 3DGVA 4NMLA 1ZAXA 3VZIA 3GSDA 2BX6A 1VHFA 4J91A 5DDQC 1HNXJ 2YKMA 4M5DB 1U0SA 4DPOA 3VGVA 4USTA 2M52A 1CULB 3VVTA 2CZVC 4F3OA 3DI6A 1HPZB 1JJHA 2CG4A 5A8KB 5D4OA 5CZVA 1YLXA 1MU2B 1KOOA 2GNKA 2A0FB 2WVFA 4ED8A 1WELA 2YNHA 3KYLA 3K5MA 1V5IB 2C3PA 3AB4B 4F2RA 2LXFA 2D74B 4AUKA 1OY6A 3M4XA 1LWFA 1S1UA 2HS3A 1HBOA 1CPZA 1FFWB 3OBIA 1EQ0A 1RACB 1PILA 5A8WA 3H42A 2L9DA 3ZZZA 4CYUA 1N36J 4LF7J 1U1MA 3DRPB 4I7FA 5J1NA 2XS7A 3D3CJ 3T19A 1Q0NA 1U2FA 2DO0A 2W9AA 3OLBA 3CTRA 1S72S 1LW2A 4NXMJ 4CLPA 3J7Z5 2CQ1A 1KHWA 4X64F 2HNZA 1NHVA 2XULA 2RQCA 3WHIA 4MJKA 3G96A 4WE1A 3CCVS 3W64A 3PJXA 3KLIB 3MURP 1W2BR 4EYIB 4M94A 2UXBJ 2HS0A 1VIOA 2EXUA 1TUGB 4IOBA 3JAMU 3MGJA 3KXDA 4DL0C 2YXLA 4UOCA 2C2NA 3EE3A 1KQKA 1F60B 1KEKA 1X5TA 1VQ9S 4QPTA 4CT8A 3D68A 3RU0A 2OIHA 2FY1A 4NCGA 1RHQB 4NA2A 4CDIA 2CPDA 1SL1A 2GCFA 3QWPA 3OFFA 1EARA 1YZ7A 4FS2A 1NK4A 4TYAA 2VFUA 2C28A 4RNNA 3ULHA 2E5IA 1XMBA 2AIRB 1QVFR 4FBUA 4USWA 4D3HA 4U95A 3ISND 2Y1RI 1LV5A 3U7JA 1E6YB 4H4KA 2OH2A 1S9EB 4URQU 3MTJA 3QGPA 1YTYA 4IR9A 1HQUB 1FKAF 1XJWB 2NXJA 4QW8A 2VC0A 1SJRA 3PW0A 1L3KA 4RX6A 4ITSA 2MQQA 5D3GB 1RHUB 3M8YA 4UQGA 2GO9A 3J80Y 3A3PB 1LNQA 3R8YA 5KFCA 3IM9A 3HO1A 2B51A 2HHVA 3BBBA 4X4NA 4FF4A 1UEUA 4W98A 5C42A 1RT5A 1V6HA 2ZJPQ 1LKZA 3SQGA 4UY85 1FKOA 4DUYF 3I4HX 1JLGB 1S97A 5EDWA 3MFIA 4O4RA 4Y6IA 2Y1JA 2DRDA 2K1RB 2DIVA 1U1LA 4PG8A 4RR5A 3N5BA 3CVKA 3FDSA 4PQAA 1R0CB 4DG1A 5H9EK 1IWGA 1VQSA 3IN5A 4PQUB 2BJ9A 2Y1IA 1JLEA 4LQ9A 2GIRA 4H4MB 4V1Ak 3RR7A 4KPYA 1CBKA 5J1EA 4DMZA 3FZBA 5LMUF 2XGPA 2RE1A 3RAMA 2ZH5A 1FD8A 1FXDA 4HT5A 1SC1B 4ID5B 2HURA 2QA4S 5J2QB 4TY8A 5LL6d 3PKYA 3O6QA 4OYAA 3PTWA 3UW1A 3DGPB 4FNHA 4WU3A 2MKKA 1FFGB 4LJMA 2QEXS 3AODA 3KG0A 1B0TA 4K4TA 3DLEA 3Q2TC 4IQMA 2IM1A 3PDNA 4XDCA 2F4VF 3QLHA 1LW0B 3MWBA 2VQEJ 5CYQB 1WHVA 3SV4A 1JLBA 3MAHA 4F26A 3LAMA 5JVHQ 1VRUB 2KM8B 4OZ3A 1EETA 2YNGA 3VAMA 4AXJA 2QFJA 4OHYA 3HHLD 4FXWA 4A8XA 2HVIA 3DRXA 3KK2A 5KG5A 2HNYB 5DG7A 3HHDA 1N4LA 3IBWA 4X65F 5C7PA 4NLYA 1QTNB 2F3JA 3BQ2A 3OFHA 4D3GA 4JI5F 1OYEA 2LEAA 3QNWB 4DPUA 2YWHA 4LIRA 1O6XA 5F0WA 5RUBA 2XBPA 2ZBRA 1F9FA 2GZOA 3GPAA 4K4YA 2CQBA 5H1SV 4F0MA 4OYWA 3PYGA 3I5CA 1VFJA 1W26A 4F3QA 2HG4A 3RG6A 3FFIA 3W5YA 3CCTA 2JLFA 2JEGA 4F8RA 4NX9A 3N6LA 1T9XA 3QRQA 2W9BB 4QWBA 3OT9A 4KGMA 2MQMA 5EGYA 4OMFG 1X4AA 3PX4A 2JLGA 3FCVA 5DQHA 3PR5B 5ETVA 1FKPA 2OPPA 2BVZA 5IM0A 5DDRC 3UCZP 2XNQA 5D0GA 4JOUA 5LXYA 2J0WA 1TQLA 1TMJA 4EGLA 2B56A 3GIRA 1IR0A 1TFWA 1WNEA 2ZFHA 3UDEA 4R8UB 4DR1F 1VBZA 2XQCA 2AV5A 1MN7A 2ZUAA 3NWGA 4JV0A 2B4PA 2RT3A 1T3NA 3DXSX 1N36F 4LF7F 4V19J 4M5MA 2XLIA 1YJRA 2R7WA 3MOJB 1S49A 2HMIA 1NO8A 1S1VA 5CQGA 2W4CA 3A3OB 2HHHF 3DNCA 2GV1A 4EYHB 2RUSA 4DQIA 3G6ES 5A8RA 1NMEB 3CJQA 2DTJA 2XSFA 1Y3KA 6AT1B 4B9LA 3KWMA 5C25A 1FWLA 3W5ZA 5GMKa 2M2BA 4LSNA 4URSA 1F3FA 1ZTWA 1YITS 5L9XA 2AYBA 3POTB 1P1TA 2D3O1 3MM8A 2WB1D 3H2VE 3WZ0A 3GYGA 1MW7A 4OJ3A 1LXNA 3OTBA 2M3DA 4ECWA 2Z2MA 1VK3A 3I82A 2FDNA 4JI4F 1FE0A 1F5CA 3DRYA 1X4HA 3KOAA 3OL6A 2LEPA 4ZLPA 1RTJB 4OHWA 1SI9A 4DX6A 3JSYA 4HDHA 5MLCV 2DNRA 2H51B 3JTOA 1RHRB 4HTIA 2QZ8A 2XI2A 4X4OA 4I67A 4YB7A 2GHPA 2HKEA 4M5DA 4OZ0A 1UCNA 1SH0A 3LF0A 1R31A 1CULA 3FMBA 4DCPB 2GJFA 5DZ6A 4R5PB 1OMSA 1SQEA 1HPZA 5A8KA 4DR5F 3WX8A 3ZXWA 3CC7S 1MU2A 2XWYA 4DV0J 3EVMA 2YQ3A 3NWRA 4WFZA 3CW2C 3PJWA 1KVJA 4HI2A 2DD8S 3GWCA 4LRAA 1HI8A 1NCLA 5L38A 4GVLA 1VQYA 3VF0B 5F3ZA 3Q22A 2AF6A 2JH3A 4USJC 3D6TB 4M5GA 5AT1B 3CWJA 4KAIA 4EZ9A 3DRPA 3NS5A 2KG1A 4ED5A 1NKCA 2LVWA 4KKOB 4YFUA 5GMDA 2CJKA 5IT9U 2ZOMA 4A4JA 4DPTA 5B0CA 4Y28C 3SBMA 4P7VA 2FYXA 1HKAA 2W24A 2W2OP 3HI9A 1Q95G 3KLIA 5G4DA 1RA6A 2I5JB 3VAJA 3KJVB 2KJWA 2O66A 3R5CA 3M32B 1U4BA 3TA2A 2PA8D 5L39A 3NGTA 3I56S 4LSLB 3Q23A 3HZEA 3TVKA 3OW2R 3R3TA 4JI6J 4C98A 3GTYX 3UE2A 5B0DA 2ZZTA 3FSIA 3GLJA 3S6EA 4X62F 3HHEA 3DOLB 2PN6A 3QT8A 1WC1A 3ILIA 4KGZB 1NZAA 2Q1LA 5BXIA 5KFGA 2NXEA 4CO4A 1TK5A 1KFDA 1IQTA 2G2ZA 4U9RA 3JB9k 3J7AN 3HFKA 4C0OC 1PJ6A 1S9EA 3EUNA 5EWEA 1SJ3P 1MMNA 3TRGA 1HQUA 2XCPA 1WC0A 1BGXT 4IOCQ 2OEMA 4CLZA 1CQMA 3LW5C 2DKOB 1VBKA 2HBZB 2YNIB 2WVDA 4Y3CA 1ZS6A 5D3GA 5JXSA 5DO2A 2BKNA 1UL3A 3PY8A 2EG1A 2DNOA 1B4SA 3P6YC 5HL7Q 1MROB 3VGTA 2HRTA 1SB6A 1X4BA 3Q8RB 2MKCA 2JLEA 2RQ4A 4LMZA 4DR3F 2HBYB 3UPFA 4H4OA 1ZM2A 4P73A 2EFVA 5LJ5Y 2HEKA 4RW4B 2B9YA 3PX6A 2MYFA 4YS2A 2XM3A 2PD1A 1WORA 3CC2S 1SH3A 4YR0A 1M5PC 1TKZB 2WVEA 4QYZJ 3JS9A 4CH7A 1JLGA 2DNPA 2DNLA 1T0TV 4C8OA 1OO0B 4WP8A 4A48A 1VLOA 2K1RA 2HFVA 5DG9A 1NK6A 3ETOA 1FXLA 4OX9J 2GFFA 4PQUA 3KDNA 2HZAA 5KFAA 4RNMA 3VWSA 1BMQB 4F0HA 2LFVA 3EGNA 3N5FA 1JNRB 2CUYA 3UWTA 5J2NB 3CMQA 5LMNJ 3KLHB 1XIQA 1LEOA 4ID5A 2OO4A 5J2QA 2AYGA 2UU9J 3NMRA 3DGPA 3K7RA 4QIEA 4HI1A 2HHPA 4RW6B 4X2BA 3QJLA 2ASJA 3TVYA 4LR9A 2Z56B 1FFSB 3FCHA 2RIJA 1Y9OA 1LW0A 4DV3J 1YJWS 2MDAA 4USVA 4OYOA 5CYQA 3TA1A 1U1PA 1H7XA 3UD4P 3IWLA 4RZRA 3AXMA 1WC4A 1W2IA 4JV5J 3DCAA 2WVBA 3QFHA 4ECXA 2BJ3A 1VRUA 4JI2F 3DOMB 3CULA 4B9MA 2CZ4A 2ZVIA 3AJDA 3FSXA 3QO9B 2YX7A 2ZD1A 1TL5A 2EKNA 3BKTA 1ZPVA 2ZC4A 2HNYA 3C8YA 2W2PP 1U25A 1ZAWA 3ILJA 2KVQE 4DR4J 2BJ7A 1C0UB 5KFMA 4PG6A 1HNIB 3MMJA 1TAQA 1NNDA 4Y65A 1N5VA 3LGNA 2GJIA 1IN0A 2XG8A 4ZCLA 4R0EA 5IWAF 3KK3B 4ZPTR 1VI7A 4FP9A 2AJ4A 5B0AA 4ECTA 3RB0A 3DYAB 1Q1KA 2V50A 1IJFB 4NL5A 4DFPA 1Z2LA 4J9RA 2MEWA 4LUBA 3GU0A 3ZC4A 1HWUA 1RTHB 4P75A 4A46A 3CSKA 3GMGA 4RBVA 2W9BA 1BUXA 2EG2A 2HAIA 3KFWX 5B0BA 4TN2A 1SPBP 1RLDA 1UJ4A 1F1BB 4WFBQ 4X4RA 2PO4A 2ALZA 4UOFA 1SL2A 4AXIA 1MMDA 4P6QA 3M9OB 4DFMA 4P74A 3ZTOA 4F4KA 2UUBF 1OQ6A 1N6QB 4KFBB 1Q7YT 5IT0A 1PAEX 2R2UA 3VZHA 4DLEA 4C11B 2DGXA 4HKQA 4LF6J 5IV4A 2E5JA 4R8UA 4NZ7A 4LRFA 3LALA 2D1CA 5KG0A 2UXDJ 1PYOB 4PWUA 3D0GE 1FD2A 3KKFA 1DQ9A 4FYYB 4O3QA 5E7OB 1YRXA 1TK0A 4DQRA 4NZ6A 3NRBA 1WOSA 3AJ2A 4BLGA 4I4BA 4MYTA 2QSWA 2EW9A 1XR6A 4XK8C 1Q53A 3DOKB 4MT1A 1WDDA 1X5PA 3MPYA 2VPZB 2R42A 1F3VA 3KJQB 5BYSA 1GXTA 1RAFB 2HW3A 3G9CA 1HWJA 4HEA9 4HHHA 4ZJLA 4CO0A 2AW0A 4GMKA 1X4EA 1LQ9A 2JC1A 2GMJA 3H5UA 3POTA 4JI3J 1PBUA 4JI6F 2R8HA 4PXBA 4ANDA 2PEBA 4ECZA 3EGVA 4C3LA 3M8RA 2CVEA 2MMYA 2R7RA 1NK9A 4OYIA 1HD0A 4N8NA 2JEJA 2WAQD 4YR3A 1SUQB 3BQ0A 4CNZA 3T1YJ 2HVHA 4BS2A 5HK4A 2XNRA 3SFGA 2EWHA 4GKJF 1RTJA 3SCJE 1GMWA 1N5SA 3S7RA 3ENQA 4DSFA 4RUAA 4OYPA 2NUHA 2HAFA 1A7GE 4USMA 1K0VA 1PKUA 4WK1A 3BN4A 4BWJA 5KFUA 1JLAB 1FX2A 1PSDA 5KT3A 4K4XA 5IS2A 4M5NA 4CRJA 3ENAA 1C4CA 1E6VB 1X9WA 1P6TA 4DS4A 4R5PA 2VJUA 1S9FA 2Y0BB 1XMQJ 2YKOA 1J5OB 2C3MA 1GX6A 3UN5A 3TQEA 4C97A 1K1QA 3TARA 1AA1B 3W8PA 2E5LJ 2DB1A 5ETNA 2V9WA 2HRYA 2G0IA 2KXNB 4C7QA 4DF8A 4CLLA 1PG5B 4G6VB 1UVJA 3IM8A 3EYZA 4DN0A 1YIJS 2EFGA 4LFBF 1Q8BA 1SJFA 2BRLA 4B3MJ 3K5NA 4QU6A 2B7BB 1RADB 1P9YA 4WZMA 1FJCA 1GQEA 4N5SA 2WW8A 4OX9F 4IH5A 1M5VC 2ZBPA 2QC3A 5JVGQ 2FUG9 2JRSA 4KKOA 5KFIA 5GAEI 4PPZA 5DS7A 2GC8A 3DLJA 2E7WA 1M5KC 2K3KA 2EVZA 5LMNF 2GA7A 2VKZG 4P9SA 2XZDB 2QG9B 4C48A 2UU9F 2O3DA 4QWEA 1MLAA 2DR5A 3AQOA 3KJVA 1QE1B 1WD6A 1IJEB 3OXGA 4CQ1A 4G1IA 3M32A 3Q8PB 1M5OC 4LSLA 3L4BC 3W63A 1D3WA 2X51A 2RHQB 3RYLA 3DOLA 1SJQA 3T3FA 4JV5F 5F8NA 3CJKB 5T7LB 3EICA 1Y4ZB 1P1LA 2I2YA 3OTOJ 1UWAA 2XS2A 2HPUA 4NLWA 2W25A 4IUFA 2E66A 3JYTB 2WTFA 1S1WB 1RJJA 3QGGA 5EWGA 2DNMA 5KTQA 3W5XA 1F0XA 4BC7A 4P2SA 2PI4A 4EBDA 1VQ5S 1RDRA 5EX3A 3JTNA 1HD1A 4F3MA 2CPIA 4PG7A 5KFNA 3VR1A 2HFOA 4BHQA 1UPPA 3EJMA 2YNIA 3QGHA 3LAKA 1J2VA 3DHXA 3W2WB 2VA3A 2BDPA 3P49B 3G4SS 3KUGA 3NL0A 4NLDA 4A8QA 4IRKA 1MROA 1YJUA 3K59A 2XMKA 3BDPA 2IHR1 5KFBA 3NGKA 2AYEA 3D67A 1HFEL 5K20B 4C8LA 4RW4A 5KT4A 4WCEQ 3BGRB 4ES3A 1S77D 4ZDNA 1TKZA 2CPHA 1P27B 4FVMA 4YMEA 4Z7YA 2DR6A 4F50A 3R7SB 4KBIA 1KOHA 2IA0A 2G0CA 3R5AA 4OZLA 1IM6A 2QMXA 2QO3A 4ETZA 5D0EA 4Z2XA 3THTA 3R1LA 3HSJA 4MKAA 1VJQA 2C3YA 2ZKUA 2B6AB 2FHJA 2DHXA 3FEZA 1H7WA 4J5OA 5CAAA 2ZE2B 2RJZA 4AL6A 2V8VA 4YQWA 5DLGA 2C3UA 2NXNA 3QSIA 5J2NA 5KFWA 4LF6F 1HHTP 4ER8A 2UUTA 4DL4A 1V3ZA 2GX8A 4XTTA 3UR3C 4PUOB 1RXOB 1U2RA 3RZAA 1RTIB 2UXDF 2E1RA 4RW6A 4MAKA 2M8HA 4NPOA 2HZVA 3KLGB 1IBKJ 1O0PA 3W61A 3RAXA 3WIUA 3LP2B 1TFYA 3RW7A 2ZH8A 2AT1B 3AT1B 1N54B 2NPFA 3B8HA 2ASDA 1UVKA 4NWBA 3DLGB 5F3TA 4WF9Q 2GMHA 4YB6A 4RW9B 4AT1B 4ZN3A 3O5TB 3S1TA 3DOMA 3R27A 2COLA 1R27B 1MWZA 2VV5A 3QO9A 1JX4A 4WXOA 2JL9A 2RUGA 1WEYA 3F0NA 4IKAA 2KG0A 4LFCJ 1TL7B 2GQ2A 4DCJB 5AXMA 1SKRA 4JI3F 3D0HE 2NR0A 2CPFA 1VQKS 4I2QB 4OZNA 1QAJA 2UZAA 4CNYA 2KZZA 1VCTA 1C0UA 3OFEA 4DQQA 5E41A 1HNIA 3AD8C 2Q6BA 2RDJA 4YOEA 3MR5A 5ETPA 4C3KA 5CH7B 3KK3A 3RW6A 3IS9B 1HW9A 4Q2LA 2BBEA 3MXHP 2BA9A 3H59A 3DYAA 2U2FA 2DR8A 4LQ3A 3NXZA 2VG5B 4PZVA 2GQCA 4ZCMA 1RTHA 2YKQA 2FJBB 1N33J 3LPYA 1LFWA 2BJ8A 3H20A 1YBAA 3LANA 3HSGA 4ZK7M 1FJEB 1XMQF 2VHGA 1NPPA 5E2QA 5KFSA 2MQNA 3QWUA 2OPSB 1N6QA 3PZPA 1NUEA 1D09B 4KFBA 1F9HA 1PIEA 2KZMA 1RT3B 2C3OA 4TLRA 4C11A 3V6JA 3TR5A 4AL5A 4IO9Q 3CJ8A 1NJXA 3MM5B 1F5BA 2IBOA 1WG4A 4QU7A 2CWXA 3NNCA 5ETKA 4LF8J 3TZZA 4C2MA 1CS4B 3FGVA 4R25A 3M6VA 1WI6A 2MLXA 2B4OA 2H9ZA 3LPEA 4IH6A 1RTZA 2M0GB 4WZQA 1NEEA 3Q8QB 1K44A 1OIAA 4NXNF 4Q0BB 2FD2A 1JLQB 3DOKA 2DITA 1PC4A 1FRKA 2HGLA 2QYCA 1GH8A 3BEGB 2WSCC 4RW8B 1F9EB 2MY8A 3LH2S 1S99A 3HVRA 4NCBA 5D6GA 5HQMA 2BW7A 3DU6A 4ZCIA 2IJRA 2VBWA 4NI2B 1Q8LA 1IKWB 3H7HB 2H65B 4HHUA 4J9SA 1X7VA 3K5PA 2MXYA 2CKWA 2X1FA 2CPYA 2D3UA 4ILMA 1V3SA 4U8VA 2H4WB 1VC6A 1ZBTA 1RT2B 4CT9A 1RAGB 3GFHA 1X9SA 3D6MB 5F8GA 4P72A 3OTOF 5ETLA 3HF5A 2UVWA 3M9MB 1BC6A 2YKPA 2KXFA 3MMCB 2UUCJ 1SUQA 2EBEA 7FDRA 3LQVA 3TOQA 1R3NA 4RUBA 1RP5A 5DGBA 3GILA 5D15A 1BHNA 5IZHA 2HLUA 2MQLA 2JVRA 3FKBA 3W8GA 2ZBIA 1S6QB 1JLAA 4OJHA 4ZN1A 1GMVA 3CCMS 4K4ZA 5KFJA 1VQ6S 2N4DA 4K2JA 1G1XA 4KSEB 1NSPA 1E6VA 2VQFJ 2QLJB 1AXQA 2YWGA 2D3OR 3AFGA 4DPYA 3ELHA 1J5OA 2FVCA 2BABA 5KFHA 4EUVA 4QR1A 3GCXP 1JIHA 1U8SA 1HHSA 1Q86T 1GK8A 4DR7J 2HHUA 3CDAA 2RMLA 3IG1B 3F41A 3VV2B 3T5JA 5AJ3J 1NLKL 5HAOA 4ZP7A 1N56A 2KDOA 2XYHB 3PXGa 5T14A 5KG6A 2EC0A 1AFJA 3Q8YA 2E7VA 5IC4B 1U1KA 2IPOB 3RBXA 1S57A 2V63A 1OY8A 4NEYA 2A1BA 2BE2B 2EBGA 4W90B 4FBTA 3CJRA 5HANA 4DBQA 5C2CA 3M2VB 1ZH5A 2KYZA 1VJWA 1F6TA 1RQ0A 1OJ4A 4C8YA 4F02A 3OVBA 5CCLA 1ELOA 1XNQJ 2C1EB 2J9DA 3T9ZA 3KJFB 1Y0HA 1U2CA 3EZ5A 1SH2A 4UUXA 3QRRA 1QE1A 1YG0A 4Q7AA 2DNQA 1IBKF 5T41A 2CNLB 5F8LA 5AE2A 5THWA 2RB7A 3VAFA 3C46A 2F9JA 3T1HJ 1XR5A 4ZS6A 4XPEA 5EUHA 4WYLA 2YNHB 3K58A 5ITHA 3PIPQ 3CJKA 5T7LA 4RWXA 1T9TA 1CG2A 3JYTA 2FJDB 3EVOA 8AT1B 1S1WA 4B9UA 2DXFA 1X5SA 2BV3A 2W7AA 4X4UA 1RISA 3NNAA 4ZOSA 2I1RA 2UP1A 2XMTA 3AOBA 4LFCF 4JUZA 1IBMJ 1WOOA 2IM3A 4RO0A 4ZVSB 2RF2B 4ZHRB 3UNGC 4G1QB 3H4BA 2UUAJ 1Q78A 1TTHB 1F2HA 2ZUGA 4OI4A 2C2MB 2CQDA 1PBAA 2GQQA 3US5A 1TAUA 4HYKA 3W2WA 2B9WA 2MZ1A 1GT8A 1VQMS 1VGYA 2B4UA 4U96A 3PG9A 2H5IB 3SFUA 4DR2F 2IA6A 2LP4A 1FJGJ 4CLSA 3BO2A 3HZGA 2OFHX 4OZ5A 2R7TA 1BQMB 4TNOA 3BGRA 3WC0A 2WOMB 3IP0A 3QGIA 3GV5B 3DDKA 1TL4A 2FC8A 3DU5A 2Z2LA 2XMJA 2J5AA 5JJBA 2Z30B 3HHLB 1FI4A 5CCMA 2DBBA 2HS4A 2QYGA 4DR6J 3EM1A 4FYDA 4YEAA 2LKZA 1SXLA 4DV7F 4OZJA 1R7IA 2B6AA 5KG2A 5KFLA 1KP6A 3Q86A 2ZE2A 2M70A 1R8CA 1V3RA 2CQPA 4IG3B 1NDPA 2ROPA 1HR0F 2V67A 4PUOA 1RTIA 2CQ2A 2D41A 1NK5A 3IWXA 5ETQA 4LF8F 3I0RB 3KLGA 4GO7X 1FWPA 1I6JA 3LP2A 2WZ1A 3A8IA 1HL6A 2GMLA 1YBUA 4CCHA 4CO2A 3M2UB 2XO6A 3MMAB 1UFWA 3DLGA 2XTJP 1AUSL 2Z58B 4WP9A 3NOCA 1DQAA 1FDAA 1X4GA 4KHRA 1L3UA 2VPWB 4RW9A 2AGQA 1FWKA 1X8DA 1S1XB 3KHHA 1VK8A 2R8IA 1EHWA 4FF2A 3K57A 3GYNA 4C8NA 2C2KB 4IYQA 2EI5A 1WG1A 3C16B 3KUEA 5ADZA 3R2CJ 1TL7A 1HYSB 4DX8H 4OLOA 5LSRA 2K7JA 3M8WA 2D69A 4I2QA 1N32F 5JUMA 2XHCA 2V4QA 5FLXY 3M8ZA 3OXFA 3F44A 3FBEA 1HWKA 1Q16B 4AFFA 3EX7B 3H0PA 2ZHAA 2IM2A 5F8MA 2CJ9A 2E9TA 2DYAA 3IS9A 4QW9A 4JI7J 2RHSB 2HHTA 3G6XA 2R2RA 2KI2A 1ZZNA 1QD1A 1U26A 5KT5A 1RWVB 2VH7A 3M7VA 1B0VA 3OL8A 2UV8A 3G86A 3N6MA 2VG5A 3D6FB 3TQ1A 1R43A 5B0EA 3BREA 1N34J 1GX5A 2EFOA 2GS8A 4TVAB 4NLXA 2VQFF 3QATA 4WIQA 2V2QA 2J0QD 1V9OA 2R9LA 2CZ9A 1TVRB 3VTIA 5HMXA 1VLYA 5D0HA 2OPSA 3FBBA 2IYIA 2DNYA 1Q82T 1WF1A 4DR7F 3L7OA 4JB8B 3PW4A 1R0AB 1RT3A 2P9EA 3C2PA 4LFAJ 3CMES 3CDUA 4RBUA 1IWAA 2XI3A 4O4GB 1KS2A 1XNRJ 4L3NA 1J5EJ 3MM5A 5F9LA 2H4YB 2MSSA 2ATCB 4LF5J 4FYWB 5CZXA 1NAQA 3DKDA 1CS4A 2O01C 2XMUA 2YX4A 1RLCL 3VGUA 2IJFA 2W2QP 4JP8A 1VQ8S 1HARA 2ZZMA 3R7NB 1Y11A 3MFHA 3SSRA 1AFIA 4Q0BA 1JLQA 1YRUA 4IRDA 3TW0A 4ELUA 1FK9B 1T7PA 4RW8A 1TUWA 3EMTA 4PR6A 4NI2A 4ZPDA 1O5JA 1IKWA 4NLQA 2IC3B 4DL7A 1RT2A 4HR2A 5FLXU 2DH8A 4J7CA 4B08A 5K14B 4J9NA 1KQFB 5KFPA 3HDSA 1RHMB 1X31C 5IQQA 3MMCA 3O2IA 3ZNJ1 4OX6A 5GAEU 1YWXA 4ZP8A 2XC9A 3QPIA 3C19A 2SXLA 1I1GA 4HH1A 3ZNUA 3BO4A 1IBMF 1NJYA 2YWWA 1I3OB 3WBZA 2UUAF 4UZBA 3M05A 3T5LA 2OMLA 1SL0A 1S6QA 1DZ5A 1ZTTA 4JI0F 3GCWP 4JI8F 3OPKA 3O1LA 1T9VA 2HSEB 1TUVA 2FJAB 4DQPA 3E3XA 4MIBA 4QPXA 4LSZB 2IAJB 2NSBA 1RSCA 1NHKL 2ILYA 3MM7B 3IG1A 3W66A 1M5HA 5KFVA 3KHRA 5M2PA 2R7UA 3E2EA 2CDRB 1DURA 4DV1F 3KNGA 1UFKA 1NSAA 1XC9A 1TMMA 2CADA 4UOHA 1D9DA 1LWCB 3AB2B 3FEYB 1LOUA 3BGUA 3QZ8A 4OIXA 3TJ8A 2WSEC 1S1TB 2BE2A 2POKA 4DR6F 2PIIA 1R6YA 3UVJB 3HVTB 5HLFB 4KT0C 2MB0B 5H9FJ 4ED0A 1RBAA 3M2VA 2U1AA 3EXYA 3EDRB 1ROFA 4NA3A 4K5SA 2MPUA 3MUTP 4MIWA 2RU3A 4A47A 3TAMB 3HKWA 4N7TA 2KYXA 1U02A 2FJEB 1IVZA 1TZ0A 3ZZUA 2PMWA 4X66F 2IDLA 2N3LA 4DV5J 2WVCA 4L74A 4AE5A 2MZJA 4F04B 4ZVUB 1BLUA 4M8LA 2IRUA 4S0MA 3GFXA 2GIQA 4LRDA 4AL7A 2HWIA 4CH1A 1Z1ZA 2B5JB 4CLWA 4N8OA 3G87A 3SEOA 3K89A 3FK4A 1EKSA 2P2CB 2AMCB 2QV6A 2RDIA 1C1CB 3D7SB 3D9BA 1H74A 4A8SA 1R8PA 5KFEA 4DV2J 3LTOA 4H54A 2RF2A 4ZHRA 4WP3A 2DGOA 4G1QA 1AW0A 3UCGA 4BCAA 5KFTA 3MZIA 4PKDB 2PDAA 1SC6A 2GVZB 3A12A 1HQ2A 2RILA 4DU7A 2CQHA 4K4VA 4DUZF 2DHSA 2H5JB 3X1LB 1DAXA 2VL1A 2LXUA 3M1VB 4CIOA 1YJNS 4JI7F 3E01A 4PCQA 3TEGA 3BQ1A 4ICLB 2B9EA 2H5EA 5ETTA 2E5HA 3A1YG 1RB0A 2BANB 2BJ1A 1BQMA 3PCOB 1YJ7A 2WOMA 3SCKE 1VQOS 3R5GA 3FSYA 3RTVA 2VU5A 3A4TA 4W4MA 2BRKA 2NREA 1CJKB 2F4FA 3HHLA 5HVGA 1FT8A 2FC9A 1ZOTA 1KNZA 2MZQA 1CVJA 2ZVSA 5KT7A 2YTCA 4FXVA 3D0IE 5B0FA 5E3AA 1NDKA 3SMZA 4V19X 2HIQA 4X4VA 1JWWA 2J0SD 4CP5A 2CQCA 3DMJB 1IUJA 2YPYA 2JSXA 1XNRF 5B09A 4IG3A 4K7QA 1UW4A 1H98A 5C2GA 3V81B 1YRTA 3R97A 1HNZJ 2W7PA 3K5OA 3I0RA 3M8PB 2M9KA 2ZH7A 2UVRA 1U09A 1S0NA 1DRZA 2H1YA 1G6BA 1BQXA 5I42B 3TVZA 1PJ5A 1Y00A 3M2UA 4H4OB 4ANEA 3MMAA 3C6TB 3S8SA 4PG4A 3KJNB 2BEFA 1UFLA 2MZRA 4ED7A 1SQGA 5DQIA 1S1XA 4OYXA 2DH9A 3SV3A 2R7OA 2I9SA 4OFZA 3CJTA 3C16A 2BE7D 4CO1A 2M4MA 2K7KA 1Q79A 2YWFA 4XAKA 1HYSA 4QQBA 4ZMMA 2WW4A 4I6WA 3MCMA 2W8KA 1FA0A 2LLZA 3QT6A 4HT7A 2MLYA 4DZ6A 4WKRA 1RGVA 2GO8A 4CLUA 2C2DA 3GJTB 4F2SA 3BF4A 3WDOA 3H4DA 3DHWC 3HLUA 4IFYB 3OFGA 4RPFA 1YX2A 4OJ1A 4TQRA 3CJSA 2A10A 2OLWA 3TP2A 4YP3A 4HACB 3KLEB 4NRTA 2L9NA 2KXHA 4J9QA 5KG1A 2VICA 2KT5A 2PT0A 3GZ7A 4B17A 2HGNA 2V6AA 2W2MP 2KHDA 1XERA 2F8HA 4WTYA 1YZ6A 4JI1J 4OYMA 2VIHA 1JJCB 1JXEA 1ZM4A 5CYMB 2W9CB 4ZPBA 4CLKA 1FCAA 1TELA 4NLVA 5KFZA 1TKDA 1LK7A 1N5TA 1YVFA 3OTDA 3CCJS 1TVRA 1T8EA 2ZD1B 4MFBB 3A8JA 2PE8A 2BOAA 4N47A 3GP9A 4TXSA 1R0AA 3OL7A 3P4UB 2P8IA 1DTQB 5D4PA 3TUJC 2GGPB 3VHQA 2W4PA 2HVEA 4DN9A 4O4GA 4LVOP 4MK8A 3RUBL 3ITHB 3PR4A 4G1PA 1ZM9A 3CCRS 2DGTA 3KNAA 3HULA 3M9NB 4ANCA 3EPGA 2DVIA 2J7KA 2Q6CA 3E8OA 1N0VC 3JQKA 3J80U 5IOLA 3TX0A 3Q83A 3FMWA 2BJEA 2Y1LB 1RYRA 3V2UC 2CQ4A 3GFYA 4U7CA 5J2MB 3HT0A 3I9V9 2WHOA 2HVDA 2IIHA 2HIYA 2ASYA 3ZO7A 4Y0FA 1HNXF 1FK9A 1OS5A 1QSYA 3O3LA 4DSEA 4AYBD 5HVHA 5KFFA 2KVIA 4H4KC 2AJ2A 3RAQA 3PV8A 3GONA 1WSVA 5AXKA 1WEZA 2DIUA 2DY1A 1UEKA 3M8SA 2IC3A 3JXOA 2VDHA 4DX5A 2OD4A 2JFDA 3BDEA 2QMUB 4ERDA 4YN3B 4QBUA 2L48A 5K14A 4LF9J 3H25A 4OI2A 2HYIB 1EZZB 2MKSA 4KV8B 2BXJA 4P71A 4QWDA 4I56A 2FHMA 2DT9A 2BE9B 2QLWA 3BZQA 2AEMA 1TKTB 6FDRA 3G8SA 2R8KA 4JV2A 4QWAA 2XYGB 2RS8A 4GO5X 1T9YA 2OFGX 3BR9A 1M0SA 4NXMF 3ZTRA 3Q8SB 4WWSA 1UAWA 2GW8A 1GXUA 3THVA 4EWTA 5GAHI 3CT9A 1FVSA 2VG6B 2Z57B 1HI1A 1IKXB 3BSCA 1K73T 5A0YB 4CZCA 1TL1B 5J2PB 1D8ZA 2UXBF 2IAJA 1UMJA 1VOMA 3N0VA 1NSKL 4ED6A 3MM7A 2ROGA 4PAAA 2AJFE 3NGSA 5H9EJ 1B0PA 1RU2A 3PFEA 4OX8A 2ACMA 3FEXB 2B8PA 3OJUA 4RU2A 2EEYA 1LWCA 2FY8A 4TU9A 3ZZTA 4DL3A 4M5IA 2J9DE 4OZ2A 2XHWA 1S1TA 1PYTA 1QAYA 3CJ4A 3UVJA 3UN2A 1VC5A 3HVTA 4J9OA 4GKKJ 5HLFA 5KG4A 2RNEA 3BB5A 1OPIA 1IXKA 3JSBA 3PW7A 4DWIA 2IRXA 2XB2D 2C2ZB 3TAMA 3QMQA 5U47A 2AX1A 1KONA 3WIVA 4KH0B 3ZZOA 2HK2A 1IBCB 2WONB 5L1IA 2D9PA 1K0TA 5C24B 4EMDA 1UW9A 3VQTA 1FRHA 5DLFA 3V4IB 3A13A 2CDQA 2B5JA 3NCQA 3B4MA 1QY7A 1WF0A 3VAKA 2YQ0A 2IFXA 2QX0A 1KQGB 3GFZA 3W9JA 3HHKA 1YJTA 4OL8A 1C1CA 3MECB 4LIWA 4X64J 1U45A 2L08A 2IVFB 1YSJA 1C1BB 2CG8A 3G8QA 2UV8G 2CA9A 3TANA 4MMOA 3UFCX 1NPKA 3C66A 2JX2A 3TEHB 1HBNB 1F5AA 4NLTA 2GVZA 1S6UA 3SCLE 5FD1A 1KSPA 5KOXA 2J8AA 3ZZ0A 1XN9A 4EU0A 3K17A 4MKYA 2ADCA 4LF4J 4DFKA 3PHTA 3HD1A 1Y10A 3M1VA 1FTRA 5DM6Q 3R1HA 3BBCA 2ZWPA 3J7YI 4DQSA 4HDGA 2PI5A 3H98A 4ICLA 3ZTPA 3D66A 3H5YA 3QYYA 2HWTA 1NRKA 2JOQA 4EK2A 2BANA 2VQEF 2PA3A 3MM6B 5KG7A 1RAEB 1MN9A 4WFXA 1RWMB 4W92B 2Q3PA 4DOZA 2KH9A 5DZ7A 2OMOA 3EDQB 4IG0B 1CJKA 2W2NP 4KGKA 2FLLA 5ETRA 2YBVA 2VUGA 3BN7A 4NCAA 2HLTA 3MCOA 2XO7A 3PM9A 1QVGR 4BDPA 4B3TJ 1Q8IA 2BZ2A 3TJAA 3LO3A 5M2UA 4EBEA 3C15A 4X4PA 1R0BG 1H2VZ 2B8QA 3DMJA 3MD3A 3CO0P 2HBQB 3NKYA 3Q8VA 4JYAJ 4DX7A 4GRSA 4NRUA 2ZDPA 3RR8A 4ZJOA 3V81A 3LP1B 1D0EA 2RRBA 3PIOQ 1BD6A 4OX7A 3M8PA 1T3OA 8ATCB 3OR1B 1S12A 4AQYJ 3HHNB 4ZA1A 2QSFA 4HLBA 3CIMA 5K8OA 2XGQA 5I42A 2W7OA 2HQ3A 3C6TA 4MTPA 4IQXA 1FXRA 4FYXB 4ZPWR 5E3QA 2VBZA 2ZHOA 2F40A 3BS9A 4RJVA 4LBPA 3QAUA 2UUWA 1K1SA 2GHVC 4CLYA 2HFSA 2G1HA 4NE9C 3OTEA 2XMAA 2QLXA 3IFEA 3NY0A 1YQHA 1S7IA 3G6VA 2NYHA 1LWEB 1GTHA 4Y34A 2UVVA 1MG7A 1RCXB 2APOA 2IYGA 1RAAB 5A6PA 1HMVB 3B54A 3ICLA 2RDDA 4ATNA 4F0KA 4Q45A 4C8ZA 2YH1A 2CVIA 2WBRA 4O3PA 2ERRA 1I94J 2F4VJ 4IFYA 2NCKL 5KFQA 2DNNA 2KN4A 3DN9A 2VASA 1R8HA 4HACA 4NYOA 2RKIB 3KLEA 3I32A 3HK2A 3UI3A 1R6VA 2OP5A 3F56A 5LXRA 1ACMB 1SCJB 4LVNP 3L95X 2HHQA 4F25A 2KT3A 2OKQA 2B3TB 2IJNA 4Z7CA 5HROB 2HK3A 2MY7A 4C8KA 5DDOC 1WUUA 3HT3A 1G2EA 1AUDA 5AXLA 3L9ZA 4DS5A 4FN5A 2ZBQA 5E3RA 3MHYA 1FDDA 2EFNA 4PEOA 4X65J 5CYMA 2W9CA 2RS2A 2NZCA 4JI5J 3CXCR 4U6PA 3HJVA 4BWMA 5AE3A 4MFBA 3TA0A 2VF3A 3CUNA 3Q8UA 4DUTA 2IMOA 1DTQA 3THPA 2QA1A 1NK0A 2GGPA 2KRBA 2R3VA 3OTCA 3TZXA 2H3EB 4L72B 4KGVB 1AB8A 1VQLS 3ITHA 3M6WA 2A6MA 2E7XA 2DRAA 4URGA 3W3SA 2N7YA 2KRRA 4E0DA 3ZFVA 5BR8J 4GKKF 2VFSA 4K59A 2F7VA 4Y2MA 4M1KA 5IC6B 3HP6A 5DETA 4O3OA 2E9RX 2OSQA 2ASLA 5J2MA 3K0JA 2DHHA 2DY9A 1DBDA 1FRMA 5KG3A 1FRLA 3AAWB 4I0WA 3CJ2A 4L6V3 3QQCD 3QIPB 5DGAA 3I31A 4FF1A 2DXEA 2RRNA 3TAPA 1RAIB 3CJ3A 2E44A 2HHSA 4DR1J 1UETA 4J90A 3MD1A 2XLKA 4DV0F 1UVLA 2RH3A 4N77A 1UVNA 2DHAA 1T95A 5CD4A 2CYYA 2JJ4D 3CF5Q 4DL6A 2V8DA 3BM7A 4L76A 3AOCA 1S7HA 1BWVA 1QSSA 1NB2A 3IA0A 2ZM6J 4KV8A 1T11A 1RWWB 3R5DA 3CDEA 3NOGA 1S4FA 2HHHJ 1UZHA 3G82B 2P6TA 3TUZC 1EAYC 5EWFA 1TKTA 2GAGC 3D6HB 4DJBA 3NMAA 1RT7B 3CDWA 2FZCB 4MK9A 2HQFA 3D28A 2VA2A 3CNQP 2DO4A 3MMBB 1SKSA 1Q7LB 3HJFA 1H38A 1OYDA 4LF4F 1T9UA 2VG6A 2I0XA 1OQ3A 1QJHA 2WK4A 4WFAQ 1R8AA 4FPIA 1IKXA 3S01A 5A0YA 1TL1A 5J2PA 4XIUA 4KE5A 2CJBA 2H48B 4JI4J 2JWNA 5K8MA 2B9XA 2KFNA 4LT6A 4RWWA 4PRFA 1RHKB 1SIWB 3T5KA 4DSLA 3RB4A 4IH7A 1SKWA 3PRBA 3LWLA 2ADBA 3L3CA 2RRAA 1VBYA 4HH0A 2MJNA 3QT7A 4LR8A 4B3TF 5ETMA 3T5HA 2X3DA 1SVDA 2DRBA 4PG5A 1H6KX 4CO5A 4DR5J 3CCZA 2B7CB 2G2OA 2KM8C 3UDVA 4E8UA 1K47A 4JYAF 1X0PA 5J1PA 2OPRB 4FPRA 3TWZA 5FDLB 2WONA 3EWGA 2ZH2A 4OI3A 2V94A 3NCPA 4HHJA 5C24A 4AQYF 2F9DA 3HD2A 3HFZB 1ZZFA 1YBTA 3V4IA 4O44B 2AYMA 2ZHBA 3A3NB 4CLFA 2VC1A 2CJXB 1NSQA 1N52B 4GC6A 1WF2A 1HNWJ 3R6LB 3FQLA 3I9ZA 3MECA 2HQDA 2BYCA 4NLOA 4RNOA 2R8GA 1B70B 3AH6A 1C1BA 2Z2ZA 1XBWA 4J9PA 4Z37A 5KFOA 3MPWA 2CNNB 3MR3A 4PXCA 2NXUA 2HFZA 1HBNA 3W7BA 3IO1A 2E9ZA 3R5JB 1IBLJ 1AROP 3ILLA 2BM0A 4DF4A 1R8BA 4G3IA 3AA8A 3I0SB 1I94F 1WC3A 1UZDA 4IR1A 3OJSA 3PRDA 1DARA 4X62J 5KOWA 3N4WA 2RD5C 1UP1A 2AHOB 3HX9A 5DG8A 2QFIA 3KUHA 1NPRA 4EO8A 2IMWP 3U27A 1JLFB 4PPDA 2DGQA 4MH8A 3MM9B 4PWDB 3I5AA 2K06A 1WTBA 1VQ7S 1KWMA 3W1YC 2JNJA 3GQCA 3QJPA 4DV3F 3IBCB 3MM6A 1HIYA 4TYBA 3CCQS 3JSRA 2ZITA 1A0OB 5GVQA 2R7SA 5E3PA 3MOZA 4I64A 2FLPA 4IG0A 2V4RA 3H5XA 4EZ6A 2C2EA 2JEFA 3IXQA 2E1AA 4P10A 2A2CA 2QL7B 3DM2B 2F8MA 8RUCA 4ZVHA 3CD6S 3P45B 1KTQA 4F4XA 2LQ5A 3MR2A 3J7A1 4Y2IA 2OEJA 4F4YA 2ZKTA 3QAEA 4QIWD 3HXMA 4NASA 1JJ2R 2V8PA 1EIYB 4DR4F 3LGMA 3GV8B 4DR3J 1JXLA 2GVDA 3FZ2A 1X5OA 3P3DA 4C6AA 1UVMA 3ETMA 4R0JA 3LP1A 3CD0A 1IKVB 2CPZA 2AZ1A 2KFYA 2K8GA 5IV3A 3OR1A 1FEEA 3DRSB 3UCUP 1T03B 3SSQA 2BACA 3KDOA 5BR8F 4F4AA 4YY3J 5HO4A 2JHEA 2VDIA 2VBXA 1SKUB 3D2WA 3D5MA 3NG8A 2CNOB 2XZTB 5I3QA 3MPVA 2BR0A 5EX0A 2JZ5A 1ZM3A 2IVYA 1BY9A 1N5QA 3M2RB 4DSIA 4Y00A 1LWEA 3TI0A 1KVKA 2EFQA 3OR2B 1HMVA 4KH1B 4ILLA 4KQZA 2IM0A 2Z8QA 1AZSB 2BW2A 4RU9A 4YB1P 1W7WA 2D9OA 5F41A 4OI1A 1QLNA 2ZM6F 5IT9Y 1RAJA 1TV6B 4N41A 1JXVA 3M30B 3IWNC 2V2ZA 3BYPA 3BH6B 4Q8EA 1OWXA 3OUYB 2RKIA 2GHWA 4KRWA 1P9QC 1SIZA 1S4EA 3HVAA 4OI0A 2ZWOA 4JI2J 2FGCA 4IDKB 3FNNA 2JDJA 3OV7A 3GE9A 2ZOFA 1VS3A 3P5TL 5HROA 3QBCA 3N9UC 3RGIA 2C42A 1XWLA 2VB6A 1RABB 3OXLA 2MKHA 4QJVA 3CCUS 4QYZK 1DJ0A 4UQTA 5KFKA 1H2UX 2PFFB 4K8RA 3IBFB 4DPXA 1YJVA 1RT1B 2DNZA 3L7UA 5E5NA 1CQNA 3OHAA 1XTZA 4K0KJ 5IWAJ 3MCSA 3TYTA 2RVJA 2X1BA 2GAHC 1PJ7A 4EBCA 3BSNA 3IGVA 5LM7E 4HVZA 2PSZA 3W9IA 3GJRB 1EP4B 1SBRA 2I8EA 4ED2A 2QA2A 1X0FA 4ALZA 1VHIA 2ZDOA 3T1YF 4OYZA 3CIZA 3PKMA 1U8WA 4ID8A 5GAHU 1RTDB 4CWBA 3HMJG 5L9NA 3A8KA 3U02A 3RBDA 1QUVA 1R89A 2FIUA 2UUBJ 2BQUA 1NJWA 3HM9A 3SXLA 1LXJA 4DSKA 5SUHA 1IQZA 1YKWA 3BKFA 3QIPA 4ZP9A 4MKBA 4LBHA 3I4PA 3CEDA 4RW7B 1UA0A 4P52A 5D0RA 2W8LA 1GTEA 1VISA 1RBOB 2NLWA 5GAGI 3PEJA 3NAHA 5IFMA 3T41A 3P5BP 2E5LF 4IOAQ 1H73A 1LWXA 1KFSA 3LGHA 2VFTA 3LP0B 5HJYA 4A8KA 1QSLA 4KPCA 2ZNYA 2QGFB 4L3KA 1HNWF 2VKRA 1S6PB 5DM7Q 2VONA 3MR6A 1HWLA 4IFVB 2QN6B 4FZVA 4MIAA 5IT4A 4GVBB 4NMXA 4B3MF 3AD9C 3G82A 1KR4A 4Q44A 2ZH9A 3D4JA 2JFKA 4DSJA 4X4QA 1REGX 4QIFA 2ATLA 2V8HA 2B0GA 3U1NA 3V4MA 4F4ZA 3B4DA 1RT7A 5HBMB 2HFUA 2DK2A 1HW8A 1QTMA 1IBLF 2P6SA 3D54A 2BMBA 1JKHB 3MMBA 1X4FA 1JQGA 2XMVA 1GNKA 2Y8YA 2CJYB 4B3SJ 4ECVA 5HATA 1DTTB 1NB7A 2CPJA 2MQOA 1ICEB 4OYBA 1JJ4A 1X60A 4DDFA 3RBEA 1UPMB 2EKYA 1S9GB 4C4WA 5KFXA 4FKXA 3Q89A 1E6YA 4GKJJ 2KO1A 1P8GA 2A6OA 5A2QY 1WWHA 4FKYA 1VQPS 3LOUA 3M6XA 2ZC3A 2ILZA 4YHHJ 1FVQA 3W65A 3G6YA 2EK6A 2CNKB 3O44A 1HI0P 4DHVA 2PFDA 5JMNA 4K2XA 4ELVA 2LA6A 3R9LA 2DCUB 2LQJA 2HQCA 2KL8A 1FE4A 5K8PA 2J7UA 1IR2A 2V68A 1DLOB 3I87A 2YQ1A 1G3OA 3J7YU 2Q43A 3DLKB 1HHQA 1VC0A 2OPRA 3V6HA 3HKZD 4B3RJ 5FDLA 1N5YB 2DH7A 2E1CA 4I6AA 3WC2A 3P96A 4I2PB 2CWKA 2V69A 3QZ7A 4K4SA 2LCWA 2LDYA 4LFBJ 3TZYA 2MTLA 1UJ6A 2D3ZA 4YY3F 4O44A 1M1KT 4QIGA 3PFOA 2Z4PA 4O3NA 3ET6B 1WG5A 1C2PA 1WACA 4NYZA 4DPWA 2OSRA 2IBKA 1JK9B 1LK5A 2R4FA 2L9WA 4ILRA 4H4MA 1U1NA 3PEHA 2F63A 5B7WA 3GSIA 4EI2A 4M5KA 1HNVB 2G2YA 3G2XA 5BJRA 1QUPA 3DC2A 1U0HB 3CCWA 3KK1B 1UJ5A 2L41A 3RBZA 1OY9A 5D77A 1S10A 1MNEA 1HBUB 1FO1A 2VOPA 2HFNA 5CYJA 4K4UA 3UR0A 3CD5A 3OSNA 3C14B 3B6BA 3BV8A 1XQIA 3I0SA 3UQSA 4GC7A 4F4WA 2MSTA 3TO8A 3RJMB 4ES2A 2DGUA 1JMTA 2J9CA 2G0JA 3HSZA 4KY3A 1YHQS 3SQOP 4EEYA 4XPCA 4O23A 1JLFA 3MM9A 3UDLA 3U1MA 1FJ7A 4PWDA 3R6GB 2NSCA 2R7XA 2YX1A 3OL9A 4WYWA 3TAQA 2KHCA 2V4JB 3MUMP 2HHWA 3UD3P 4TQSA 3PX0A 3W9HA 3PHEA 1WOPA 3G71S 3OD2A 4U67Q 1RAOA 3MDFA 2Y0SD 5A2QU 4CLTA 1RCOB 1NZ8A 4A8YA 2M8DB 2QL9B 3DM2A 4KO0B 4K5RA 5F0UA 4PWWA 1JNZB 4DL2A 3R2DJ 2HQGA 5FIIA 1ZPWX 1PO6A 1NK7A 4ECUA 4K0KF 4TU7A 2LYVA 3MI7X 2DGVA 2RSQA 1CSJA 3FCWA 4B02A 4FS1A 1S79A 3PW2A 3R7BB 4ETXA 1Q5YA 3Q0AA 1IKVA 2OJ3A 5F8JA 1FDNA 4AD6A 1RBLA 1WC6A 4NLGA 2PC6A 2XZWA 5A6WA 4ZPVR 2AGOA 3DRSA 1T03A 1Y5IB 3E01B 4O0NA 1FNOA 3VAGA 1FHTA 2FQQB 1WI8A 5IXUA 3J81Y 2MHEA 2IY5B 1M1GA 1RUSA 1RWKB 5GADI 1N33F 2DNKA 3FRYA 2PMHA 1Q5VA 4X4TA 4X84A 4ZVGA 3H90A 4ECQA 1PAUB 4OHZA 3C6UB 3M2RA 5L8RC 4ENOA 2J6UA 3ZTSA 4ZPCA 3ADAC 4ZVRB 2CQGA 1D9FA 2CQ3A 2DPJA 3OR2A 3BR8A 5SZTA 1EJ7L 4UW2A 2F1FA 3SSSA 3AQPA 1NDCA 2O67A 3H5SA 1S0MA 4LREA 1AZSA 2MJUA 1KDNA 3CB4A 1RT6B 3KMSA 4WBFA 4DV4J 1SV5B 2E1MC 4F67A 1ZETA 1TV6A 4DL5A 3M30A 4KYZA 2XLJA 4NZ0A 2XMMA 2HBRB 3OUYA 1Z4UA 1U7LA 1NH7A 4J9UE 2QLFB 2VJVA 2C22A 1RI7A 1S5ZA 4NLPA 3OLAA 2FZGB 2N4CA 4IDKA 4NA1A 1TKXB 2BM1A 3VQSA 4KTQA 1SC4B 2G4BA 4ED1A 3PACA 4C3MA 1BQNB 2J9EA 2MZSA 4L73A 2LXIA 2J6SA 3LA0A 1YI2S 1S59A 4DFJA 2EFPA 2RQMA 1RK8A 4J9KA 3U1LA 4B3SF 4PXDA 2J76E 1L5UA 5F9NA 1EX8A 3ENWA 1RT1A 5DQGA 2OUGA 4UTGA 4J9VA 4CH0S 1L3SA 3NGUA 3T1AA 3PO4A 4B9SA 3ZZRA 2Z2YB 1UEVA 1KHVA 5D4NA 4NLUA 3V6DB 1B7YB 2G9OA 4Q43A 2HNDB 2OI2A 3TZWA 2FLNA 3MEKA 1RWUA 1HQEB 3OVAA 4YHHF 2M5YA 3O8WA 1EP4A 1XMOJ 2XMWA 5E33A 1FDBA 1RWOB 2UUCF 2VZ9A 4WU2A 1TL3B 2QRRA 1YK9A 1KLMB 2I6WA 2AQ4A 3MAAB 3QSYB 1T94A 3MEEB 1FF2A 2LDIA 3J81U 3B78A 1T9WA 5GMEA 1RTDA 4A8OA 5AE1A 3NAIA 3PJ9A 4E98A 1APSA 4B3OB 4UZCA 4OJGA 5LSOA 3M8QB 2HRUA 2A3JA 3PNIA 5I3UB 2V34A 5K9FA 4B3RF 1WHXA 5C5JA 1MWYA 4KB7A 1NM2A 5K5MA 1OSCA 3OHBA 4RW7A 4LF1A 2M7SA 2PGCA 4ZLLA 5D78A 4USIA 2IDEA 2F8EX 4OI6A 1FESA 4N56A 3EXCX 5AJ3F 3LP0A 4I68A 1NBEB 3BPSP 3ZZYA 5LSLA 2X3GA 2L3MA 4CM0A 5A76A 1NKEA 5CA5A 3TUIC 5HMZA 1S6PA 3VAIA 4NXNJ 1PGZA 4IFVA 2AX0A 4CTAB 2BQRA 4GVBA 1DY3A 2ZEJA 3GJSB 2QJ3A 1QAIA 2V2VA 4KGXB 2I5JA 1AT1B 2XY6A 2MKJA 2BKPA 2V8GA 3WX4A 5HBMA 4M5HA 3SDEB 4MK7A 1RKIA 3FJ2A 1DHMA 2XY5A 1JKHA 2XYPB 4WTOB 3IRXB 4FNIA 1NKBA 1XNQF 3SZ2A 3Q2SC 1DTTA 1HBMB 4Y2CA 4XDDA 4ZVEA 2LMIA 2QT7A 4M63A 4YR2A 1BWEA 4ED4A 4ZLJA 1TU0B 2KB2A 4OV1A 4OZ1A 4X4SA 2ACYA 2MQ8A 3T1HF 4HL9A 3EGZA 1S9GA 1SJ4P 1DQ8A 3HSDA 3H2LA 5D4LA 5BYQA 2MLZA 5EN1A 3TNVA 1U6BA 5FJ4A 1S76D 2OTJS 1GMWD 5B08A 2NS1B 3KHGA 3X3UA 5CXTA 4B9VA 1VMBA 1FRJA 3CJ0A 5HSPA 1ZYQA 1Q4RA 3EPIA 2N7CA 3NNHA 3J7ZT 4YUDA 2ZBCA 4QOTA 2MZTA 4Q5VA 2LU1A 1GXLA 1DLOA 3DLKA 3EZUA 5LOQA 1H0HB 2JVOA 1PC5A 2MGZB 2BUNA 2H54B 4P7TA 5HQ8A 4NOHA 4P2FA 2CRLA 5I4MA 4TLQA 1N5YA 2QMWA 4I1TA 2GIFA 4I2PA 2XY7A 3FBCA 4OQJA 1FJGF 1RZMA 1CC8A 2AGPA 1RE1B 1RT4B 2E1PA 2LQ8A 3T6JA 2ZH1A 4ZVTB 3FUYA 3H40A 3IR7B 5B0GA 3ET6A 2A18A 3UN3A 4USUA 1VRQC 2FLOA 5CD4H 3BO3A 4FVCA 3CCSS 5M2RA 2K3IA 1I51B 2W4DA 1HNVA 3I5BA 2ZJRQ 1U0HA 3KLHA 1C4AA 3KK1A 4KR0B 4ZVFA 2RQKA 4RBTA 1G4CA 4C9DA 4A8WA 2LECA 4QWCA 3QRPA 1TP7A 2D7SA 4ZVQB 1HBUA 4ZVOB 2NPIA 1URRA 2KFZA 2YPZA 2VOOA 4B9TA 2X7IA 3C14A 4Q8FA 1REVB 5KAKA 3PVXA 1EKRA 1FX4A 2AEFA 3PRVA 1EB0A 4DV4F 2VODA 4Q2MA 1CJUB 1WJ9A 4HTJA 2R2TA 3NBPB 1Z2ZA 1RWXB 2LQBA 4QR0A 3IR5B 1Q8KA 1UTAA 5CHCB 1HWIA 5ETSA 3KLFB 3W2VB 1KC8T 2HZCA 5E0OA 4UY8T 2VBYA 4IO1A 5IQ6A 4ES1A 1VIXA 3MCNA 2V4JA 4C0BA 2FJWA 1FRXA 3EVWA 4DZDA 1KKHA 2OELA 1LFPA 3V6KA 2VFVA 4ZITA 5F8IA 4KO0A 1A6LA 3AXKA 2F5GA 3BGLA 4J9LA 4RUHA 2UXCJ 5DDPC 1C0TB 5CABA 4CO3A 3E51A 3KHLA 2VFRA 3NS6A 4DR2J 4ELTA 2X1GA 1NXIA 2HWHA 3MEDB 1CJVB 4YB5A 5L1LA 3RRKA 2NYIA 1ITPA 1M5SA 3GIIA 1V5VA 2XS5A 3QIDA 4A8MP 1RHJB 4ZJQA 1XMOF 4RLEA 5E3CA 4OHVA 3K8WA 2J8SA 3DRRB 1KTVA 1D1UA 1GFWB 5L1KA 1IKYB 1PYSB 3TUPA 2YKNB 5L1JA 1VRTB 4WFYA 1YGYA 3L7PA 2V0NA 3GIJA 2Q79A 1KBRA 1KVIA 2XCAA 4PABA 1CJTB 4ZP6A 5DJBA 3BSOA 4DV7J 4WKYA 1N34F 2UVUA 2HVZA 2CJQA 4JBCA 1U48A 2ROEA 3CPWR 4FYVB 3L09A 2FVPA 3B82A 2DEIA 1SQFA 5K8NA 3C6UA 2FHJD 3JQMA 3OQ2A 1HR0J 4DI6A 3W62A 4Y2AA 1HLWA 1Y3JA 2OPQB 2DGSA 2LQ9A 4LF2A 4DLGA 3Q24A 2DCLA 3C15B 1F2GA 4QZVB 3H8YA 1OSDA 4LFAF 4B9NA 1RT6A 3RRHA 3CO9A 1SV5A 1J5EF 3ENVA 3CCLS 3CCES 1UA1A 4LF5F 1CC7A 4LR7A 1AYEA 3MR7A 3P8BB 1IM4A 3IC1A 4P2MA 4DCOB 2EPIA 4QIVA 5HVFA 4Y2KA 2B4VA 1YJ9S 1TKXA 2F65A 3MUVP 3GB0A 1RWPB 2W01A 5HP1B 2YH0A 9ATCB 2XSJB 1BQNA 2YY3A 3OSPA 2NQPA 3ISNC 1N32J 3R5BA 2G13A 2MKYA 4PYAA 1UVIA 3IGNA 3QJJA 5GAGU 2RAQA 2HHXA 3ZZPA 1H2TZ 2DISA 2W1BA 4FF3A 1JLCB 3HFVA 3PO5A 2E5GA 3EZOA 2DR9A 2JC0A 3GR0A 4RUCA 1ZAVA 3GG0A 4OV6A 2DJWA 4M5LA 3JSMB 3V6DA 2CPXA 3MPDA 3W60A 2DR7A 2HNDA 4L75A 4I69A 1WTFA 5HMWA 1HQEA 2WBMA 1KLNA 3VGSA 3ZTQA 2R8JA 2YVSA 2V2KA 3GJQB 1S0VA 5G0RB 1RKJA 2ZH3A 5EHHA 2BOPA 1TL3A 3MTKA 1KLMA 3MAAA 1FNMA 3MEEA 3MEGB 1T05B 2AJ0A 2Y3YA 2FVRA 1NHUA 4B3OA 2AJQA 1YDLA 1H72C 4E2FB 4ZLNA 2VG7B 3M8QA 1U1RA 4KHPJ 4WJBA 3KTQA 5I3UA 3BBFA 4G65A 2CPEA 1B64A 4USKA 3G8TA 3M6UA 3J81j 3PYEA 2NXCA 1JB0C 3NGRA 4MKVA 1UWBB 2AKWB 5KFRA 2QA4G 1H3DA 1QAXA 2JEIA 4QCLA 1WKJA 2V5HG 2YNFB 5KFDA 4BBYA 3UD5A 3DLHA 2XEXA 2DGWA 2LEBA 3UO0A 1QM9A 1VQ4S 3AJ1A 4ZVPB 1RWNB 2J7WA 3WQPA 1N0UA 1X9MA 2CQ0A 4M95A 3QT5A 4CTAA 4NYPA 4K4WA 5L46A 1D9AA 1KQSR 2KJVA 1N88A 3CMAS 3GIKA 2YKMB 3KG1A 4TY9A 2KU7A 1QDUB 2Q66A 1NJIT 3DI6B 4O3RA 3N28A 3SDEA 3UDCA 3IAM9 3HHLC 2DHGA 1FEHA 1O51A 1RAHB 3IRXA 5D8HB 3IAS9 3BGFA 5HN0A 2EK1A 2BJDA 1GEHA 2PMZD 2WCXA 5HMYA 5LJ3Y 2KT2A 5HI7A 4DV5F 1HBMA 3F73A 1J27A 1LWFB 1S1UB 2FHKA 1XEZA
chains in the Genus database with same CATH topology
2BEFA 4HR2A 3ZTOA 3FC9A 1WKJA 5CABA 1HLWA 3FKBA 2VU5A 1K44A 4ANDA 2CWKA 4O0NA 1S5ZA 1F6TA 1NDLA 3FBFA 3L7UA 1PAEX 3FBEA 1NDPA 4F36A 4UOHA 3BBCA 3EE3A 3MPDA 3BBBA 1NSPA 3EICA 3PJ9A 4W98A 3ZTPA 3DKDA 2DYAA 1NSKL 1LEOA 1XIQA 1LWXA 3PRVA 3ELHA 3VGSA 3ZTQA 3VGUA 4EK2A 4FKXA 3Q89A 1UCNA 4KPCA 1W7WA 1S59A 1NB2A 3GP9A 1MN9A 1NDKA 1ZS6A 2DY9A 4UOGA 1B99A 4FKYA 4DZ6A 3NGSA 3FCVA 4C6AA 4CP5A 1B4SA 3ETMA 2HVEA 3G2XA 3VGTA 4ENOA 1JXVA 1NUEA 3FBCA 3WX8A 3ZTSA 3NGTA 3BH6B 1F3FA 2AZ1A 3EVMA 1NLKL 2B8PA 3NGUA 5CAAA 2DXEA 1PKUA 3Q8YA 3DDIA 1NDCA 1BE4A 3R9LA 4F4AA 1EHWA 3VVUA 1WKKA 1NCLA 1U8WA 3EVWA 4ANCA 1WKLA 1KDNA 3EMTA 1VYAA 5C7PA 3ENAA 2DXDA 3EJMA 3EVOA 3FCWA 5IOLA 2AZ3A 3BBFA 1BUXA 1S57A 1HIYA 3JS9A 2DXFA 3B6BA 2BX6A 3Q83A 1XQIA 3B54A 3Q8UA 4S0MA 4DUTA 4WBFA 3Q86A 5BXIA 1NPKA 1NSQA 3EM1A 2HURA 1HHQA 3FBBA 1NHKL 1MN7A 2ZUAA 2B8QA 4UOFA 3VGVA 4ANEA 3NGRA 3ZTRA 3BH7B 3Q8VA 3GPAA 2HVDA 3VVTA 4DI6A 1BHNA 2NCKL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BEF A;  4HR2 A;  3ZTO A;  3FC9 A;  1WKJ A;  5CAB A;  1HLW A;  3FKB A;  2VU5 A;  1K44 A;  4AND A;  2CWK A;  4O0N A;  1S5Z A;  1F6T A;  1NDL A;  3FBF A;  3L7U A;  1PAE X;  3FBE A;  1NDP A;  4F36 A;  4UOH A;  3BBC A;  3EE3 A;  3MPD A;  3BBB A;  1NSP A;  3EIC A;  3PJ9 A;  4W98 A;  3ZTP A;  3DKD A;  2DYA A;  1NSK L;  1LEO A;  1XIQ A;  1LWX A;  3PRV A;  3ELH A;  3VGS A;  3ZTQ A;  3VGU A;  4EK2 A;  4FKX A;  3Q89 A;  1UCN A;  4KPC A;  1W7W A;  1S59 A;  1NB2 A;  3GP9 A;  1MN9 A;  1NDK A;  1ZS6 A;  2DY9 A;  4UOG A;  1B99 A;  4FKY A;  4DZ6 A;  3NGS A;  3FCV A;  4C6A A;  4CP5 A;  1B4S A;  3ETM A;  2HVE A;  3G2X A;  3VGT A;  4ENO A;  1JXV A;  1NUE A;  3FBC A;  3WX8 A;  3ZTS A;  3NGT A;  3BH6 B;  1F3F A;  2AZ1 A;  3EVM A;  1NLK L;  2B8P A;  3NGU A;  5CAA A;  2DXE A;  1PKU A;  3Q8Y A;  3DDI A;  1NDC A;  1BE4 A;  3R9L A;  4F4A A;  1EHW A;  3VVU A;  1WKK A;  1NCL A;  1U8W A;  3EVW A;  4ANC A;  1WKL A;  1KDN A;  3EMT A;  1VYA A;  5C7P A;  3ENA A;  2DXD A;  3EJM A;  3EVO A;  3FCW A;  5IOL A;  2AZ3 A;  3BBF A;  1BUX A;  1S57 A;  1HIY A;  3JS9 A;  2DXF A;  3B6B A;  2BX6 A;  3Q83 A;  1XQI A;  3B54 A;  3Q8U A;  4S0M A;  4DUT A;  4WBF A;  3Q86 A;  5BXI A;  1NPK A;  1NSQ A;  3EM1 A;  2HUR A;  1HHQ A;  3FBB A;  1NHK L;  1MN7 A;  2ZUA A;  2B8Q A;  4UOF A;  3VGV A;  4ANE A;  3NGR A;  3ZTR A;  3BH7 B;  3Q8V A;  3GPA A;  2HVD A;  3VVT A;  4DI6 A;  1BHN A;  2NCK L; 
#chains in the Genus database with same CATH topology
 1URN A;  2AJ1 A;  1HBO B;  1VQN S;  1ULR A;  5A8W B;  1CLF A;  1B7F A;  2ZJQ Q;  1U1O A;  4CYU B;  2O5D A;  2OAU A;  1TK8 A;  4CM2 A;  4KJI A;  4I7F B;  3BSA A;  2OGU A;  4KHM A;  4LBI A;  2C2R A;  3RB6 A;  1LW2 B;  4ZCK A;  3CJ5 A;  1WHW A;  3HVW A;  3N01 A;  4JI0 J;  3CC4 S;  2FHO B;  4UOG A;  1S6O A;  4JI8 J;  5KFY A;  2IRY A;  1Q81 T;  2KKH A;  2HNZ B;  4WFN Q;  2UXC F;  2DNH A;  3FVY A;  3N79 A;  2K2P A;  4DV2 F;  2HQI A;  4WE1 B;  3NGD A;  1SC3 B;  2XWX A;  5DRK A;  2AD9 A;  1B3T A;  3D1Q A;  2DEJ A;  2VPY B;  2AU0 A;  2QLB B;  3VVU A;  7AT1 B;  3D1H A;  2CAJ A;  2MGZ A;  1T02 A;  3OVS A;  2IVM A;  1BXN A;  3T6B A;  2EC2 A;  1RU1 A;  3T9N A;  1X4D A;  4DV1 J;  2FVS A;  4NCG B;  3GV7 B;  3PW5 A;  1Y7P A;  4FXD A;  2BQ3 A;  4XO0 A;  4K50 A;  4OHX A;  3K8V A;  4PXE A;  1RT4 A;  4EFA C;  2FPH X;  5KT6 A;  1W25 A;  2PEH A;  9RUB A;  4QYR A;  2J6T A;  3BGO P;  1K9M T;  5MAO A;  2YKA A;  4DV6 J;  3BPD A;  1M1H A;  4IRC A;  3I55 S;  2P5V A;  1XK8 A;  1U24 A;  1S0O A;  3AHP A;  1M90 T;  4ZPA A;  2Z0G A;  1EQM A;  2M88 A;  4CI0 B;  2P9C A;  4X66 J;  4O3S A;  5KT2 A;  4LRC A;  4BC9 A;  2QIF A;  4FDF A;  4J9M A;  1REV A;  2ZNZ A;  2GJ2 A;  1BE4 A;  1OPZ A;  1CJU A;  3MAQ A;  2DXD A;  4YDD B;  3RB3 A;  3NBP A;  2O1P A;  5C42 B;  1RT5 B;  4MYU A;  6FD1 A;  1HNZ F;  2X1A A;  3SQG B;  4USH A;  3RRG A;  4UUW A;  1FKO B;  3KLF A;  5GAD U;  3W2V A;  2YWE A;  4WXW A;  2C2O B;  4U7U K;  4UT4 A;  3CE8 A;  2E29 A;  2R7V A;  2OD6 A;  3LUY A;  2FB0 A;  1WC5 A;  4DG1 B;  3GG1 A;  3NLC A;  1JLE B;  2FJV A;  2VPX B;  1FTC A;  4ECR A;  2ZOG A;  1RA7 A;  2RU9 A;  5J1E B;  2G1D A;  1KN6 A;  4J37 A;  4ECS A;  1DFD A;  3V5R A;  4DUZ J;  3D3B J;  3CDB A;  3BKU A;  1C0T A;  4TY8 B;  1D8Y A;  5H9F K;  3GYX B;  3MED A;  1CJV A;  3DLL Q;  2FGO A;  5HJX A;  4RNH A;  3DLE B;  3HPO A;  2DNG A;  3LWM A;  1ZA2 B;  3QLH B;  1KD1 T;  2FZK B;  1X4C A;  4O0I A;  1VR6 A;  1UKU A;  1JLB B;  5BYR A;  2OTL S;  3DRR A;  4ZIW A;  4RKU C;  1N8R T;  3DDN A;  3VAL A;  1IKY A;  4NLS A;  2YKN A;  1VRT A;  2N3O A;  2QTW A;  2MQP A;  1EET B;  2YNG B;  4RNF A;  2N82 B;  4U8Y A;  7FD1 A;  3FC9 A;  5ETO A;  4LRB A;  3DFE A;  3GR1 A;  3AD7 C;  3FBF A;  1CJT A;  2CFX A;  1N48 A;  3KK2 B;  4KHP F;  1SJ1 A;  3H2U B;  5HQL A;  4JI1 F;  1K8A T;  2AP6 A;  2WB4 A;  4KIA A;  4QR2 A;  2AEJ A;  1XR7 A;  3IRW P;  2A2D A;  2FVQ A;  4P2X A;  1L3T A;  1B99 A;  4DU8 A;  4RL1 A;  4YDX A;  2ZH4 A;  2OPQ A;  2ZZN A;  1WEX A;  3PYF A;  3FQK A;  2P9G A;  1MWQ A;  2V9K A;  2B43 A;  4U7U D;  1HA1 A;  2R2S A;  2KTQ A;  1NU4 A;  3I96 A;  1NJZ A;  2LU2 A;  3I6P A;  3DDI A;  3KLV A;  1U1Q A;  3ILO A;  1WSR A;  4ECY A;  2DPI A;  3FFI B;  3QFW A;  1WKL A;  2GVD B;  1VDH A;  2MKI A;  3KMQ A;  2CXE A;  3NEK A;  1O8B A;  2AZ3 A;  4M5J A;  4TKT A;  4ZIV A;  3KG4 A;  4PYD A;  2QE5 A;  1U49 A;  1S48 A;  2FTR A;  4DUY J;  1U6F A;  3VAH A;  1G7C B;  4WK3 A;  3HCX A;  3BH7 B;  1WDT A;  2VD3 A;  1MSW D;  3ISZ A;  3GIM A;  1VBX A;  4OLP A;  1PCA A;  5F8H A;  5HP1 A;  3JTP A;  1NDL A;  2OHD A;  2XSJ A;  1I5O B;  3IMQ J;  1FKP B;  2HGM A;  2OPP B;  1Y5L B;  5IM0 B;  2ABY A;  3BJY A;  2J0X A;  3DXB A;  1KRP A;  2BKO A;  2LA4 A;  2I38 A;  1WHY A;  5LMU J;  5AXN A;  1A9N B;  1GAO A;  1RYS A;  2CIM A;  2Y8W A;  1JLC A;  1NH8 A;  1U47 A;  3TJ9 A;  3PYD A;  2Y9H A;  4EO6 A;  4KC5 A;  4C8M A;  4ZKA A;  4A8F A;  3AA9 A;  3D1O A;  3JSM A;  3CD7 A;  3MF5 A;  3VCD A;  3SI8 A;  2OEK A;  4LF9 F;  1WKK A;  4WPA A;  2HMI B;  1S1V B;  2NUU G;  5G0R A;  2AWZ A;  3NP5 A;  2YWK A;  3CGI A;  1CEZ A;  3SIP B;  3MPU B;  5A8R B;  3DLB A;  3MEG A;  3TX8 A;  3UNY A;  3K5L A;  2ZH6 A;  1T05 A;  5C25 B;  3K2Y A;  4WII A;  4DEZ A;  2WSF C;  4F7V A;  4LSN B;  1FRI A;  3JAM Y;  1L3V A;  4F36 A;  2VG7 A;  1ZA1 B;  4NLR A;  3JQJ A;  3AOA A;  2WRM A;  3MM8 B;  4DXL A;  2CQI A;  1IR1 A;  1Y5N B;  3SYZ A;  3IR6 B;  1U6Z A;  3NS7 B;  1GMU A;  1FER A;  4TU8 A;  5I3P A;  1UWB A;  4C0H A;  2FJX A;  1FNX H;  3C3L A;  2R7Q A;  3A8E A;  4I6Y A;  3BYR A;  2MHN A;  2NZ4 A;  4JV1 A;  2YNF A;  4NEZ A;  3AY0 A;  2ALY B;  3NCR A;  3ONQ A;  2QL5 B;  3SCI E;  4N76 A;  1TR0 A;  5LT5 A;  3FRZ A;  1MML A;  3EGW B;  4DV6 F;  3N6N A;  4UF4 A;  2CJA A;  4ED3 A;  1NK8 A;  1VYA A;  3DGV A;  4NML A;  1ZAX A;  3VZI A;  3GSD A;  2BX6 A;  1VHF A;  4J91 A;  5DDQ C;  1HNX J;  2YKM A;  4M5D B;  1U0S A;  4DPO A;  3VGV A;  4UST A;  2M52 A;  1CUL B;  3VVT A;  2CZV C;  4F3O A;  3DI6 A;  1HPZ B;  1JJH A;  2CG4 A;  5A8K B;  5D4O A;  5CZV A;  1YLX A;  1MU2 B;  1KOO A;  2GNK A;  2A0F B;  2WVF A;  4ED8 A;  1WEL A;  2YNH A;  3KYL A;  3K5M A;  1V5I B;  2C3P A;  3AB4 B;  4F2R A;  2LXF A;  2D74 B;  4AUK A;  1OY6 A;  3M4X A;  1LWF A;  1S1U A;  2HS3 A;  1HBO A;  1CPZ A;  1FFW B;  3OBI A;  1EQ0 A;  1RAC B;  1PIL A;  5A8W A;  3H42 A;  2L9D A;  3ZZZ A;  4CYU A;  1N36 J;  4LF7 J;  1U1M A;  3DRP B;  4I7F A;  5J1N A;  2XS7 A;  3D3C J;  3T19 A;  1Q0N A;  1U2F A;  2DO0 A;  2W9A A;  3OLB A;  3CTR A;  1S72 S;  1LW2 A;  4NXM J;  4CLP A;  3J7Z 5;  2CQ1 A;  1KHW A;  4X64 F;  2HNZ A;  1NHV A;  2XUL A;  2RQC A;  3WHI A;  4MJK A;  3G96 A;  4WE1 A;  3CCV S;  3W64 A;  3PJX A;  3KLI B;  3MUR P;  1W2B R;  4EYI B;  4M94 A;  2UXB J;  2HS0 A;  1VIO A;  2EXU A;  1TUG B;  4IOB A;  3JAM U;  3MGJ A;  3KXD A;  4DL0 C;  2YXL A;  4UOC A;  2C2N A;  3EE3 A;  1KQK A;  1F60 B;  1KEK A;  1X5T A;  1VQ9 S;  4QPT A;  4CT8 A;  3D68 A;  3RU0 A;  2OIH A;  2FY1 A;  4NCG A;  1RHQ B;  4NA2 A;  4CDI A;  2CPD A;  1SL1 A;  2GCF A;  3QWP A;  3OFF A;  1EAR A;  1YZ7 A;  4FS2 A;  1NK4 A;  4TYA A;  2VFU A;  2C28 A;  4RNN A;  3ULH A;  2E5I A;  1XMB A;  2AIR B;  1QVF R;  4FBU A;  4USW A;  4D3H A;  4U95 A;  3ISN D;  2Y1R I;  1LV5 A;  3U7J A;  1E6Y B;  4H4K A;  2OH2 A;  1S9E B;  4URQ U;  3MTJ A;  3QGP A;  1YTY A;  4IR9 A;  1HQU B;  1FKA F;  1XJW B;  2NXJ A;  4QW8 A;  2VC0 A;  1SJR A;  3PW0 A;  1L3K A;  4RX6 A;  4ITS A;  2MQQ A;  5D3G B;  1RHU B;  3M8Y A;  4UQG A;  2GO9 A;  3J80 Y;  3A3P B;  1LNQ A;  3R8Y A;  5KFC A;  3IM9 A;  3HO1 A;  2B51 A;  2HHV A;  3BBB A;  4X4N A;  4FF4 A;  1UEU A;  4W98 A;  5C42 A;  1RT5 A;  1V6H A;  2ZJP Q;  1LKZ A;  3SQG A;  4UY8 5;  1FKO A;  4DUY F;  3I4H X;  1JLG B;  1S97 A;  5EDW A;  3MFI A;  4O4R A;  4Y6I A;  2Y1J A;  2DRD A;  2K1R B;  2DIV A;  1U1L A;  4PG8 A;  4RR5 A;  3N5B A;  3CVK A;  3FDS A;  4PQA A;  1R0C B;  4DG1 A;  5H9E K;  1IWG A;  1VQS A;  3IN5 A;  4PQU B;  2BJ9 A;  2Y1I A;  1JLE A;  4LQ9 A;  2GIR A;  4H4M B;  4V1A k;  3RR7 A;  4KPY A;  1CBK A;  5J1E A;  4DMZ A;  3FZB A;  5LMU F;  2XGP A;  2RE1 A;  3RAM A;  2ZH5 A;  1FD8 A;  1FXD A;  4HT5 A;  1SC1 B;  4ID5 B;  2HUR A;  2QA4 S;  5J2Q B;  4TY8 A;  5LL6 d;  3PKY A;  3O6Q A;  4OYA A;  3PTW A;  3UW1 A;  3DGP B;  4FNH A;  4WU3 A;  2MKK A;  1FFG B;  4LJM A;  2QEX S;  3AOD A;  3KG0 A;  1B0T A;  4K4T A;  3DLE A;  3Q2T C;  4IQM A;  2IM1 A;  3PDN A;  4XDC A;  2F4V F;  3QLH A;  1LW0 B;  3MWB A;  2VQE J;  5CYQ B;  1WHV A;  3SV4 A;  1JLB A;  3MAH A;  4F26 A;  3LAM A;  5JVH Q;  1VRU B;  2KM8 B;  4OZ3 A;  1EET A;  2YNG A;  3VAM A;  4AXJ A;  2QFJ A;  4OHY A;  3HHL D;  4FXW A;  4A8X A;  2HVI A;  3DRX A;  3KK2 A;  5KG5 A;  2HNY B;  5DG7 A;  3HHD A;  1N4L A;  3IBW A;  4X65 F;  5C7P A;  4NLY A;  1QTN B;  2F3J A;  3BQ2 A;  3OFH A;  4D3G A;  4JI5 F;  1OYE A;  2LEA A;  3QNW B;  4DPU A;  2YWH A;  4LIR A;  1O6X A;  5F0W A;  5RUB A;  2XBP A;  2ZBR A;  1F9F A;  2GZO A;  3GPA A;  4K4Y A;  2CQB A;  5H1S V;  4F0M A;  4OYW A;  3PYG A;  3I5C A;  1VFJ A;  1W26 A;  4F3Q A;  2HG4 A;  3RG6 A;  3FFI A;  3W5Y A;  3CCT A;  2JLF A;  2JEG A;  4F8R A;  4NX9 A;  3N6L A;  1T9X A;  3QRQ A;  2W9B B;  4QWB A;  3OT9 A;  4KGM A;  2MQM A;  5EGY A;  4OMF G;  1X4A A;  3PX4 A;  2JLG A;  3FCV A;  5DQH A;  3PR5 B;  5ETV A;  1FKP A;  2OPP A;  2BVZ A;  5IM0 A;  5DDR C;  3UCZ P;  2XNQ A;  5D0G A;  4JOU A;  5LXY A;  2J0W A;  1TQL A;  1TMJ A;  4EGL A;  2B56 A;  3GIR A;  1IR0 A;  1TFW A;  1WNE A;  2ZFH A;  3UDE A;  4R8U B;  4DR1 F;  1VBZ A;  2XQC A;  2AV5 A;  1MN7 A;  2ZUA A;  3NWG A;  4JV0 A;  2B4P A;  2RT3 A;  1T3N A;  3DXS X;  1N36 F;  4LF7 F;  4V19 J;  4M5M A;  2XLI A;  1YJR A;  2R7W A;  3MOJ B;  1S49 A;  2HMI A;  1NO8 A;  1S1V A;  5CQG A;  2W4C A;  3A3O B;  2HHH F;  3DNC A;  2GV1 A;  4EYH B;  2RUS A;  4DQI A;  3G6E S;  5A8R A;  1NME B;  3CJQ A;  2DTJ A;  2XSF A;  1Y3K A;  6AT1 B;  4B9L A;  3KWM A;  5C25 A;  1FWL A;  3W5Z A;  5GMK a;  2M2B A;  4LSN A;  4URS A;  1F3F A;  1ZTW A;  1YIT S;  5L9X A;  2AYB A;  3POT B;  1P1T A;  2D3O 1;  3MM8 A;  2WB1 D;  3H2V E;  3WZ0 A;  3GYG A;  1MW7 A;  4OJ3 A;  1LXN A;  3OTB A;  2M3D A;  4ECW A;  2Z2M A;  1VK3 A;  3I82 A;  2FDN A;  4JI4 F;  1FE0 A;  1F5C A;  3DRY A;  1X4H A;  3KOA A;  3OL6 A;  2LEP A;  4ZLP A;  1RTJ B;  4OHW A;  1SI9 A;  4DX6 A;  3JSY A;  4HDH A;  5MLC V;  2DNR A;  2H51 B;  3JTO A;  1RHR B;  4HTI A;  2QZ8 A;  2XI2 A;  4X4O A;  4I67 A;  4YB7 A;  2GHP A;  2HKE A;  4M5D A;  4OZ0 A;  1UCN A;  1SH0 A;  3LF0 A;  1R31 A;  1CUL A;  3FMB A;  4DCP B;  2GJF A;  5DZ6 A;  4R5P B;  1OMS A;  1SQE A;  1HPZ A;  5A8K A;  4DR5 F;  3WX8 A;  3ZXW A;  3CC7 S;  1MU2 A;  2XWY A;  4DV0 J;  3EVM A;  2YQ3 A;  3NWR A;  4WFZ A;  3CW2 C;  3PJW A;  1KVJ A;  4HI2 A;  2DD8 S;  3GWC A;  4LRA A;  1HI8 A;  1NCL A;  5L38 A;  4GVL A;  1VQY A;  3VF0 B;  5F3Z A;  3Q22 A;  2AF6 A;  2JH3 A;  4USJ C;  3D6T B;  4M5G A;  5AT1 B;  3CWJ A;  4KAI A;  4EZ9 A;  3DRP A;  3NS5 A;  2KG1 A;  4ED5 A;  1NKC A;  2LVW A;  4KKO B;  4YFU A;  5GMD A;  2CJK A;  5IT9 U;  2ZOM A;  4A4J A;  4DPT A;  5B0C A;  4Y28 C;  3SBM A;  4P7V A;  2FYX A;  1HKA A;  2W24 A;  2W2O P;  3HI9 A;  1Q95 G;  3KLI A;  5G4D A;  1RA6 A;  2I5J B;  3VAJ A;  3KJV B;  2KJW A;  2O66 A;  3R5C A;  3M32 B;  1U4B A;  3TA2 A;  2PA8 D;  5L39 A;  3NGT A;  3I56 S;  4LSL B;  3Q23 A;  3HZE A;  3TVK A;  3OW2 R;  3R3T A;  4JI6 J;  4C98 A;  3GTY X;  3UE2 A;  5B0D A;  2ZZT A;  3FSI A;  3GLJ A;  3S6E A;  4X62 F;  3HHE A;  3DOL B;  2PN6 A;  3QT8 A;  1WC1 A;  3ILI A;  4KGZ B;  1NZA A;  2Q1L A;  5BXI A;  5KFG A;  2NXE A;  4CO4 A;  1TK5 A;  1KFD A;  1IQT A;  2G2Z A;  4U9R A;  3JB9 k;  3J7A N;  3HFK A;  4C0O C;  1PJ6 A;  1S9E A;  3EUN A;  5EWE A;  1SJ3 P;  1MMN A;  3TRG A;  1HQU A;  2XCP A;  1WC0 A;  1BGX T;  4IOC Q;  2OEM A;  4CLZ A;  1CQM A;  3LW5 C;  2DKO B;  1VBK A;  2HBZ B;  2YNI B;  2WVD A;  4Y3C A;  1ZS6 A;  5D3G A;  5JXS A;  5DO2 A;  2BKN A;  1UL3 A;  3PY8 A;  2EG1 A;  2DNO A;  1B4S A;  3P6Y C;  5HL7 Q;  1MRO B;  3VGT A;  2HRT A;  1SB6 A;  1X4B A;  3Q8R B;  2MKC A;  2JLE A;  2RQ4 A;  4LMZ A;  4DR3 F;  2HBY B;  3UPF A;  4H4O A;  1ZM2 A;  4P73 A;  2EFV A;  5LJ5 Y;  2HEK A;  4RW4 B;  2B9Y A;  3PX6 A;  2MYF A;  4YS2 A;  2XM3 A;  2PD1 A;  1WOR A;  3CC2 S;  1SH3 A;  4YR0 A;  1M5P C;  1TKZ B;  2WVE A;  4QYZ J;  3JS9 A;  4CH7 A;  1JLG A;  2DNP A;  2DNL A;  1T0T V;  4C8O A;  1OO0 B;  4WP8 A;  4A48 A;  1VLO A;  2K1R A;  2HFV A;  5DG9 A;  1NK6 A;  3ETO A;  1FXL A;  4OX9 J;  2GFF A;  4PQU A;  3KDN A;  2HZA A;  5KFA A;  4RNM A;  3VWS A;  1BMQ B;  4F0H A;  2LFV A;  3EGN A;  3N5F A;  1JNR B;  2CUY A;  3UWT A;  5J2N B;  3CMQ A;  5LMN J;  3KLH B;  1XIQ A;  1LEO A;  4ID5 A;  2OO4 A;  5J2Q A;  2AYG A;  2UU9 J;  3NMR A;  3DGP A;  3K7R A;  4QIE A;  4HI1 A;  2HHP A;  4RW6 B;  4X2B A;  3QJL A;  2ASJ A;  3TVY A;  4LR9 A;  2Z56 B;  1FFS B;  3FCH A;  2RIJ A;  1Y9O A;  1LW0 A;  4DV3 J;  1YJW S;  2MDA A;  4USV A;  4OYO A;  5CYQ A;  3TA1 A;  1U1P A;  1H7X A;  3UD4 P;  3IWL A;  4RZR A;  3AXM A;  1WC4 A;  1W2I A;  4JV5 J;  3DCA A;  2WVB A;  3QFH A;  4ECX A;  2BJ3 A;  1VRU A;  4JI2 F;  3DOM B;  3CUL A;  4B9M A;  2CZ4 A;  2ZVI A;  3AJD A;  3FSX A;  3QO9 B;  2YX7 A;  2ZD1 A;  1TL5 A;  2EKN A;  3BKT A;  1ZPV A;  2ZC4 A;  2HNY A;  3C8Y A;  2W2P P;  1U25 A;  1ZAW A;  3ILJ A;  2KVQ E;  4DR4 J;  2BJ7 A;  1C0U B;  5KFM A;  4PG6 A;  1HNI B;  3MMJ A;  1TAQ A;  1NND A;  4Y65 A;  1N5V A;  3LGN A;  2GJI A;  1IN0 A;  2XG8 A;  4ZCL A;  4R0E A;  5IWA F;  3KK3 B;  4ZPT R;  1VI7 A;  4FP9 A;  2AJ4 A;  5B0A A;  4ECT A;  3RB0 A;  3DYA B;  1Q1K A;  2V50 A;  1IJF B;  4NL5 A;  4DFP A;  1Z2L A;  4J9R A;  2MEW A;  4LUB A;  3GU0 A;  3ZC4 A;  1HWU A;  1RTH B;  4P75 A;  4A46 A;  3CSK A;  3GMG A;  4RBV A;  2W9B A;  1BUX A;  2EG2 A;  2HAI A;  3KFW X;  5B0B A;  4TN2 A;  1SPB P;  1RLD A;  1UJ4 A;  1F1B B;  4WFB Q;  4X4R A;  2PO4 A;  2ALZ A;  4UOF A;  1SL2 A;  4AXI A;  1MMD A;  4P6Q A;  3M9O B;  4DFM A;  4P74 A;  3ZTO A;  4F4K A;  2UUB F;  1OQ6 A;  1N6Q B;  4KFB B;  1Q7Y T;  5IT0 A;  1PAE X;  2R2U A;  3VZH A;  4DLE A;  4C11 B;  2DGX A;  4HKQ A;  4LF6 J;  5IV4 A;  2E5J A;  4R8U A;  4NZ7 A;  4LRF A;  3LAL A;  2D1C A;  5KG0 A;  2UXD J;  1PYO B;  4PWU A;  3D0G E;  1FD2 A;  3KKF A;  1DQ9 A;  4FYY B;  4O3Q A;  5E7O B;  1YRX A;  1TK0 A;  4DQR A;  4NZ6 A;  3NRB A;  1WOS A;  3AJ2 A;  4BLG A;  4I4B A;  4MYT A;  2QSW A;  2EW9 A;  1XR6 A;  4XK8 C;  1Q53 A;  3DOK B;  4MT1 A;  1WDD A;  1X5P A;  3MPY A;  2VPZ B;  2R42 A;  1F3V A;  3KJQ B;  5BYS A;  1GXT A;  1RAF B;  2HW3 A;  3G9C A;  1HWJ A;  4HEA 9;  4HHH A;  4ZJL A;  4CO0 A;  2AW0 A;  4GMK A;  1X4E A;  1LQ9 A;  2JC1 A;  2GMJ A;  3H5U A;  3POT A;  4JI3 J;  1PBU A;  4JI6 F;  2R8H A;  4PXB A;  4AND A;  2PEB A;  4ECZ A;  3EGV A;  4C3L A;  3M8R A;  2CVE A;  2MMY A;  2R7R A;  1NK9 A;  4OYI A;  1HD0 A;  4N8N A;  2JEJ A;  2WAQ D;  4YR3 A;  1SUQ B;  3BQ0 A;  4CNZ A;  3T1Y J;  2HVH A;  4BS2 A;  5HK4 A;  2XNR A;  3SFG A;  2EWH A;  4GKJ F;  1RTJ A;  3SCJ E;  1GMW A;  1N5S A;  3S7R A;  3ENQ A;  4DSF A;  4RUA A;  4OYP A;  2NUH A;  2HAF A;  1A7G E;  4USM A;  1K0V A;  1PKU A;  4WK1 A;  3BN4 A;  4BWJ A;  5KFU A;  1JLA B;  1FX2 A;  1PSD A;  5KT3 A;  4K4X A;  5IS2 A;  4M5N A;  4CRJ A;  3ENA A;  1C4C A;  1E6V B;  1X9W A;  1P6T A;  4DS4 A;  4R5P A;  2VJU A;  1S9F A;  2Y0B B;  1XMQ J;  2YKO A;  1J5O B;  2C3M A;  1GX6 A;  3UN5 A;  3TQE A;  4C97 A;  1K1Q A;  3TAR A;  1AA1 B;  3W8P A;  2E5L J;  2DB1 A;  5ETN A;  2V9W A;  2HRY A;  2G0I A;  2KXN B;  4C7Q A;  4DF8 A;  4CLL A;  1PG5 B;  4G6V B;  1UVJ A;  3IM8 A;  3EYZ A;  4DN0 A;  1YIJ S;  2EFG A;  4LFB F;  1Q8B A;  1SJF A;  2BRL A;  4B3M J;  3K5N A;  4QU6 A;  2B7B B;  1RAD B;  1P9Y A;  4WZM A;  1FJC A;  1GQE A;  4N5S A;  2WW8 A;  4OX9 F;  4IH5 A;  1M5V C;  2ZBP A;  2QC3 A;  5JVG Q;  2FUG 9;  2JRS A;  4KKO A;  5KFI A;  5GAE I;  4PPZ A;  5DS7 A;  2GC8 A;  3DLJ A;  2E7W A;  1M5K C;  2K3K A;  2EVZ A;  5LMN F;  2GA7 A;  2VKZ G;  4P9S A;  2XZD B;  2QG9 B;  4C48 A;  2UU9 F;  2O3D A;  4QWE A;  1MLA A;  2DR5 A;  3AQO A;  3KJV A;  1QE1 B;  1WD6 A;  1IJE B;  3OXG A;  4CQ1 A;  4G1I A;  3M32 A;  3Q8P B;  1M5O C;  4LSL A;  3L4B C;  3W63 A;  1D3W A;  2X51 A;  2RHQ B;  3RYL A;  3DOL A;  1SJQ A;  3T3F A;  4JV5 F;  5F8N A;  3CJK B;  5T7L B;  3EIC A;  1Y4Z B;  1P1L A;  2I2Y A;  3OTO J;  1UWA A;  2XS2 A;  2HPU A;  4NLW A;  2W25 A;  4IUF A;  2E66 A;  3JYT B;  2WTF A;  1S1W B;  1RJJ A;  3QGG A;  5EWG A;  2DNM A;  5KTQ A;  3W5X A;  1F0X A;  4BC7 A;  4P2S A;  2PI4 A;  4EBD A;  1VQ5 S;  1RDR A;  5EX3 A;  3JTN A;  1HD1 A;  4F3M A;  2CPI A;  4PG7 A;  5KFN A;  3VR1 A;  2HFO A;  4BHQ A;  1UPP A;  3EJM A;  2YNI A;  3QGH A;  3LAK A;  1J2V A;  3DHX A;  3W2W B;  2VA3 A;  2BDP A;  3P49 B;  3G4S S;  3KUG A;  3NL0 A;  4NLD A;  4A8Q A;  4IRK A;  1MRO A;  1YJU A;  3K59 A;  2XMK A;  3BDP A;  2IHR 1;  5KFB A;  3NGK A;  2AYE A;  3D67 A;  1HFE L;  5K20 B;  4C8L A;  4RW4 A;  5KT4 A;  4WCE Q;  3BGR B;  4ES3 A;  1S77 D;  4ZDN A;  1TKZ A;  2CPH A;  1P27 B;  4FVM A;  4YME A;  4Z7Y A;  2DR6 A;  4F50 A;  3R7S B;  4KBI A;  1KOH A;  2IA0 A;  2G0C A;  3R5A A;  4OZL A;  1IM6 A;  2QMX A;  2QO3 A;  4ETZ A;  5D0E A;  4Z2X A;  3THT A;  3R1L A;  3HSJ A;  4MKA A;  1VJQ A;  2C3Y A;  2ZKU A;  2B6A B;  2FHJ A;  2DHX A;  3FEZ A;  1H7W A;  4J5O A;  5CAA A;  2ZE2 B;  2RJZ A;  4AL6 A;  2V8V A;  4YQW A;  5DLG A;  2C3U A;  2NXN A;  3QSI A;  5J2N A;  5KFW A;  4LF6 F;  1HHT P;  4ER8 A;  2UUT A;  4DL4 A;  1V3Z A;  2GX8 A;  4XTT A;  3UR3 C;  4PUO B;  1RXO B;  1U2R A;  3RZA A;  1RTI B;  2UXD F;  2E1R A;  4RW6 A;  4MAK A;  2M8H A;  4NPO A;  2HZV A;  3KLG B;  1IBK J;  1O0P A;  3W61 A;  3RAX A;  3WIU A;  3LP2 B;  1TFY A;  3RW7 A;  2ZH8 A;  2AT1 B;  3AT1 B;  1N54 B;  2NPF A;  3B8H A;  2ASD A;  1UVK A;  4NWB A;  3DLG B;  5F3T A;  4WF9 Q;  2GMH A;  4YB6 A;  4RW9 B;  4AT1 B;  4ZN3 A;  3O5T B;  3S1T A;  3DOM A;  3R27 A;  2COL A;  1R27 B;  1MWZ A;  2VV5 A;  3QO9 A;  1JX4 A;  4WXO A;  2JL9 A;  2RUG A;  1WEY A;  3F0N A;  4IKA A;  2KG0 A;  4LFC J;  1TL7 B;  2GQ2 A;  4DCJ B;  5AXM A;  1SKR A;  4JI3 F;  3D0H E;  2NR0 A;  2CPF A;  1VQK S;  4I2Q B;  4OZN A;  1QAJ A;  2UZA A;  4CNY A;  2KZZ A;  1VCT A;  1C0U A;  3OFE A;  4DQQ A;  5E41 A;  1HNI A;  3AD8 C;  2Q6B A;  2RDJ A;  4YOE A;  3MR5 A;  5ETP A;  4C3K A;  5CH7 B;  3KK3 A;  3RW6 A;  3IS9 B;  1HW9 A;  4Q2L A;  2BBE A;  3MXH P;  2BA9 A;  3H59 A;  3DYA A;  2U2F A;  2DR8 A;  4LQ3 A;  3NXZ A;  2VG5 B;  4PZV A;  2GQC A;  4ZCM A;  1RTH A;  2YKQ A;  2FJB B;  1N33 J;  3LPY A;  1LFW A;  2BJ8 A;  3H20 A;  1YBA A;  3LAN A;  3HSG A;  4ZK7 M;  1FJE B;  1XMQ F;  2VHG A;  1NPP A;  5E2Q A;  5KFS A;  2MQN A;  3QWU A;  2OPS B;  1N6Q A;  3PZP A;  1NUE A;  1D09 B;  4KFB A;  1F9H A;  1PIE A;  2KZM A;  1RT3 B;  2C3O A;  4TLR A;  4C11 A;  3V6J A;  3TR5 A;  4AL5 A;  4IO9 Q;  3CJ8 A;  1NJX A;  3MM5 B;  1F5B A;  2IBO A;  1WG4 A;  4QU7 A;  2CWX A;  3NNC A;  5ETK A;  4LF8 J;  3TZZ A;  4C2M A;  1CS4 B;  3FGV A;  4R25 A;  3M6V A;  1WI6 A;  2MLX A;  2B4O A;  2H9Z A;  3LPE A;  4IH6 A;  1RTZ A;  2M0G B;  4WZQ A;  1NEE A;  3Q8Q B;  1K44 A;  1OIA A;  4NXN F;  4Q0B B;  2FD2 A;  1JLQ B;  3DOK A;  2DIT A;  1PC4 A;  1FRK A;  2HGL A;  2QYC A;  1GH8 A;  3BEG B;  2WSC C;  4RW8 B;  1F9E B;  2MY8 A;  3LH2 S;  1S99 A;  3HVR A;  4NCB A;  5D6G A;  5HQM A;  2BW7 A;  3DU6 A;  4ZCI A;  2IJR A;  2VBW A;  4NI2 B;  1Q8L A;  1IKW B;  3H7H B;  2H65 B;  4HHU A;  4J9S A;  1X7V A;  3K5P A;  2MXY A;  2CKW A;  2X1F A;  2CPY A;  2D3U A;  4ILM A;  1V3S A;  4U8V A;  2H4W B;  1VC6 A;  1ZBT A;  1RT2 B;  4CT9 A;  1RAG B;  3GFH A;  1X9S A;  3D6M B;  5F8G A;  4P72 A;  3OTO F;  5ETL A;  3HF5 A;  2UVW A;  3M9M B;  1BC6 A;  2YKP A;  2KXF A;  3MMC B;  2UUC J;  1SUQ A;  2EBE A;  7FDR A;  3LQV A;  3TOQ A;  1R3N A;  4RUB A;  1RP5 A;  5DGB A;  3GIL A;  5D15 A;  1BHN A;  5IZH A;  2HLU A;  2MQL A;  2JVR A;  3FKB A;  3W8G A;  2ZBI A;  1S6Q B;  1JLA A;  4OJH A;  4ZN1 A;  1GMV A;  3CCM S;  4K4Z A;  5KFJ A;  1VQ6 S;  2N4D A;  4K2J A;  1G1X A;  4KSE B;  1NSP A;  1E6V A;  2VQF J;  2QLJ B;  1AXQ A;  2YWG A;  2D3O R;  3AFG A;  4DPY A;  3ELH A;  1J5O A;  2FVC A;  2BAB A;  5KFH A;  4EUV A;  4QR1 A;  3GCX P;  1JIH A;  1U8S A;  1HHS A;  1Q86 T;  1GK8 A;  4DR7 J;  2HHU A;  3CDA A;  2RML A;  3IG1 B;  3F41 A;  3VV2 B;  3T5J A;  5AJ3 J;  1NLK L;  5HAO A;  4ZP7 A;  1N56 A;  2KDO A;  2XYH B;  3PXG a;  5T14 A;  5KG6 A;  2EC0 A;  1AFJ A;  3Q8Y A;  2E7V A;  5IC4 B;  1U1K A;  2IPO B;  3RBX A;  1S57 A;  2V63 A;  1OY8 A;  4NEY A;  2A1B A;  2BE2 B;  2EBG A;  4W90 B;  4FBT A;  3CJR A;  5HAN A;  4DBQ A;  5C2C A;  3M2V B;  1ZH5 A;  2KYZ A;  1VJW A;  1F6T A;  1RQ0 A;  1OJ4 A;  4C8Y A;  4F02 A;  3OVB A;  5CCL A;  1ELO A;  1XNQ J;  2C1E B;  2J9D A;  3T9Z A;  3KJF B;  1Y0H A;  1U2C A;  3EZ5 A;  1SH2 A;  4UUX A;  3QRR A;  1QE1 A;  1YG0 A;  4Q7A A;  2DNQ A;  1IBK F;  5T41 A;  2CNL B;  5F8L A;  5AE2 A;  5THW A;  2RB7 A;  3VAF A;  3C46 A;  2F9J A;  3T1H J;  1XR5 A;  4ZS6 A;  4XPE A;  5EUH A;  4WYL A;  2YNH B;  3K58 A;  5ITH A;  3PIP Q;  3CJK A;  5T7L A;  4RWX A;  1T9T A;  1CG2 A;  3JYT A;  2FJD B;  3EVO A;  8AT1 B;  1S1W A;  4B9U A;  2DXF A;  1X5S A;  2BV3 A;  2W7A A;  4X4U A;  1RIS A;  3NNA A;  4ZOS A;  2I1R A;  2UP1 A;  2XMT A;  3AOB A;  4LFC F;  4JUZ A;  1IBM J;  1WOO A;  2IM3 A;  4RO0 A;  4ZVS B;  2RF2 B;  4ZHR B;  3UNG C;  4G1Q B;  3H4B A;  2UUA J;  1Q78 A;  1TTH B;  1F2H A;  2ZUG A;  4OI4 A;  2C2M B;  2CQD A;  1PBA A;  2GQQ A;  3US5 A;  1TAU A;  4HYK A;  3W2W A;  2B9W A;  2MZ1 A;  1GT8 A;  1VQM S;  1VGY A;  2B4U A;  4U96 A;  3PG9 A;  2H5I B;  3SFU A;  4DR2 F;  2IA6 A;  2LP4 A;  1FJG J;  4CLS A;  3BO2 A;  3HZG A;  2OFH X;  4OZ5 A;  2R7T A;  1BQM B;  4TNO A;  3BGR A;  3WC0 A;  2WOM B;  3IP0 A;  3QGI A;  3GV5 B;  3DDK A;  1TL4 A;  2FC8 A;  3DU5 A;  2Z2L A;  2XMJ A;  2J5A A;  5JJB A;  2Z30 B;  3HHL B;  1FI4 A;  5CCM A;  2DBB A;  2HS4 A;  2QYG A;  4DR6 J;  3EM1 A;  4FYD A;  4YEA A;  2LKZ A;  1SXL A;  4DV7 F;  4OZJ A;  1R7I A;  2B6A A;  5KG2 A;  5KFL A;  1KP6 A;  3Q86 A;  2ZE2 A;  2M70 A;  1R8C A;  1V3R A;  2CQP A;  4IG3 B;  1NDP A;  2ROP A;  1HR0 F;  2V67 A;  4PUO A;  1RTI A;  2CQ2 A;  2D41 A;  1NK5 A;  3IWX A;  5ETQ A;  4LF8 F;  3I0R B;  3KLG A;  4GO7 X;  1FWP A;  1I6J A;  3LP2 A;  2WZ1 A;  3A8I A;  1HL6 A;  2GML A;  1YBU A;  4CCH A;  4CO2 A;  3M2U B;  2XO6 A;  3MMA B;  1UFW A;  3DLG A;  2XTJ P;  1AUS L;  2Z58 B;  4WP9 A;  3NOC A;  1DQA A;  1FDA A;  1X4G A;  4KHR A;  1L3U A;  2VPW B;  4RW9 A;  2AGQ A;  1FWK A;  1X8D A;  1S1X B;  3KHH A;  1VK8 A;  2R8I A;  1EHW A;  4FF2 A;  3K57 A;  3GYN A;  4C8N A;  2C2K B;  4IYQ A;  2EI5 A;  1WG1 A;  3C16 B;  3KUE A;  5ADZ A;  3R2C J;  1TL7 A;  1HYS B;  4DX8 H;  4OLO A;  5LSR A;  2K7J A;  3M8W A;  2D69 A;  4I2Q A;  1N32 F;  5JUM A;  2XHC A;  2V4Q A;  5FLX Y;  3M8Z A;  3OXF A;  3F44 A;  3FBE A;  1HWK A;  1Q16 B;  4AFF A;  3EX7 B;  3H0P A;  2ZHA A;  2IM2 A;  5F8M A;  2CJ9 A;  2E9T A;  2DYA A;  3IS9 A;  4QW9 A;  4JI7 J;  2RHS B;  2HHT A;  3G6X A;  2R2R A;  2KI2 A;  1ZZN A;  1QD1 A;  1U26 A;  5KT5 A;  1RWV B;  2VH7 A;  3M7V A;  1B0V A;  3OL8 A;  2UV8 A;  3G86 A;  3N6M A;  2VG5 A;  3D6F B;  3TQ1 A;  1R43 A;  5B0E A;  3BRE A;  1N34 J;  1GX5 A;  2EFO A;  2GS8 A;  4TVA B;  4NLX A;  2VQF F;  3QAT A;  4WIQ A;  2V2Q A;  2J0Q D;  1V9O A;  2R9L A;  2CZ9 A;  1TVR B;  3VTI A;  5HMX A;  1VLY A;  5D0H A;  2OPS A;  3FBB A;  2IYI A;  2DNY A;  1Q82 T;  1WF1 A;  4DR7 F;  3L7O A;  4JB8 B;  3PW4 A;  1R0A B;  1RT3 A;  2P9E A;  3C2P A;  4LFA J;  3CME S;  3CDU A;  4RBU A;  1IWA A;  2XI3 A;  4O4G B;  1KS2 A;  1XNR J;  4L3N A;  1J5E J;  3MM5 A;  5F9L A;  2H4Y B;  2MSS A;  2ATC B;  4LF5 J;  4FYW B;  5CZX A;  1NAQ A;  3DKD A;  1CS4 A;  2O01 C;  2XMU A;  2YX4 A;  1RLC L;  3VGU A;  2IJF A;  2W2Q P;  4JP8 A;  1VQ8 S;  1HAR A;  2ZZM A;  3R7N B;  1Y11 A;  3MFH A;  3SSR A;  1AFI A;  4Q0B A;  1JLQ A;  1YRU A;  4IRD A;  3TW0 A;  4ELU A;  1FK9 B;  1T7P A;  4RW8 A;  1TUW A;  3EMT A;  4PR6 A;  4NI2 A;  4ZPD A;  1O5J A;  1IKW A;  4NLQ A;  2IC3 B;  4DL7 A;  1RT2 A;  4HR2 A;  5FLX U;  2DH8 A;  4J7C A;  4B08 A;  5K14 B;  4J9N A;  1KQF B;  5KFP A;  3HDS A;  1RHM B;  1X31 C;  5IQQ A;  3MMC A;  3O2I A;  3ZNJ 1;  4OX6 A;  5GAE U;  1YWX A;  4ZP8 A;  2XC9 A;  3QPI A;  3C19 A;  2SXL A;  1I1G A;  4HH1 A;  3ZNU A;  3BO4 A;  1IBM F;  1NJY A;  2YWW A;  1I3O B;  3WBZ A;  2UUA F;  4UZB A;  3M05 A;  3T5L A;  2OML A;  1SL0 A;  1S6Q A;  1DZ5 A;  1ZTT A;  4JI0 F;  3GCW P;  4JI8 F;  3OPK A;  3O1L A;  1T9V A;  2HSE B;  1TUV A;  2FJA B;  4DQP A;  3E3X A;  4MIB A;  4QPX A;  4LSZ B;  2IAJ B;  2NSB A;  1RSC A;  1NHK L;  2ILY A;  3MM7 B;  3IG1 A;  3W66 A;  1M5H A;  5KFV A;  3KHR A;  5M2P A;  2R7U A;  3E2E A;  2CDR B;  1DUR A;  4DV1 F;  3KNG A;  1UFK A;  1NSA A;  1XC9 A;  1TMM A;  2CAD A;  4UOH A;  1D9D A;  1LWC B;  3AB2 B;  3FEY B;  1LOU A;  3BGU A;  3QZ8 A;  4OIX A;  3TJ8 A;  2WSE C;  1S1T B;  2BE2 A;  2POK A;  4DR6 F;  2PII A;  1R6Y A;  3UVJ B;  3HVT B;  5HLF B;  4KT0 C;  2MB0 B;  5H9F J;  4ED0 A;  1RBA A;  3M2V A;  2U1A A;  3EXY A;  3EDR B;  1ROF A;  4NA3 A;  4K5S A;  2MPU A;  3MUT P;  4MIW A;  2RU3 A;  4A47 A;  3TAM B;  3HKW A;  4N7T A;  2KYX A;  1U02 A;  2FJE B;  1IVZ A;  1TZ0 A;  3ZZU A;  2PMW A;  4X66 F;  2IDL A;  2N3L A;  4DV5 J;  2WVC A;  4L74 A;  4AE5 A;  2MZJ A;  4F04 B;  4ZVU B;  1BLU A;  4M8L A;  2IRU A;  4S0M A;  3GFX A;  2GIQ A;  4LRD A;  4AL7 A;  2HWI A;  4CH1 A;  1Z1Z A;  2B5J B;  4CLW A;  4N8O A;  3G87 A;  3SEO A;  3K89 A;  3FK4 A;  1EKS A;  2P2C B;  2AMC B;  2QV6 A;  2RDI A;  1C1C B;  3D7S B;  3D9B A;  1H74 A;  4A8S A;  1R8P A;  5KFE A;  4DV2 J;  3LTO A;  4H54 A;  2RF2 A;  4ZHR A;  4WP3 A;  2DGO A;  4G1Q A;  1AW0 A;  3UCG A;  4BCA A;  5KFT A;  3MZI A;  4PKD B;  2PDA A;  1SC6 A;  2GVZ B;  3A12 A;  1HQ2 A;  2RIL A;  4DU7 A;  2CQH A;  4K4V A;  4DUZ F;  2DHS A;  2H5J B;  3X1L B;  1DAX A;  2VL1 A;  2LXU A;  3M1V B;  4CIO A;  1YJN S;  4JI7 F;  3E01 A;  4PCQ A;  3TEG A;  3BQ1 A;  4ICL B;  2B9E A;  2H5E A;  5ETT A;  2E5H A;  3A1Y G;  1RB0 A;  2BAN B;  2BJ1 A;  1BQM A;  3PCO B;  1YJ7 A;  2WOM A;  3SCK E;  1VQO S;  3R5G A;  3FSY A;  3RTV A;  2VU5 A;  3A4T A;  4W4M A;  2BRK A;  2NRE A;  1CJK B;  2F4F A;  3HHL A;  5HVG A;  1FT8 A;  2FC9 A;  1ZOT A;  1KNZ A;  2MZQ A;  1CVJ A;  2ZVS A;  5KT7 A;  2YTC A;  4FXV A;  3D0I E;  5B0F A;  5E3A A;  1NDK A;  3SMZ A;  4V19 X;  2HIQ A;  4X4V A;  1JWW A;  2J0S D;  4CP5 A;  2CQC A;  3DMJ B;  1IUJ A;  2YPY A;  2JSX A;  1XNR F;  5B09 A;  4IG3 A;  4K7Q A;  1UW4 A;  1H98 A;  5C2G A;  3V81 B;  1YRT A;  3R97 A;  1HNZ J;  2W7P A;  3K5O A;  3I0R A;  3M8P B;  2M9K A;  2ZH7 A;  2UVR A;  1U09 A;  1S0N A;  1DRZ A;  2H1Y A;  1G6B A;  1BQX A;  5I42 B;  3TVZ A;  1PJ5 A;  1Y00 A;  3M2U A;  4H4O B;  4ANE A;  3MMA A;  3C6T B;  3S8S A;  4PG4 A;  3KJN B;  2BEF A;  1UFL A;  2MZR A;  4ED7 A;  1SQG A;  5DQI A;  1S1X A;  4OYX A;  2DH9 A;  3SV3 A;  2R7O A;  2I9S A;  4OFZ A;  3CJT A;  3C16 A;  2BE7 D;  4CO1 A;  2M4M A;  2K7K A;  1Q79 A;  2YWF A;  4XAK A;  1HYS A;  4QQB A;  4ZMM A;  2WW4 A;  4I6W A;  3MCM A;  2W8K A;  1FA0 A;  2LLZ A;  3QT6 A;  4HT7 A;  2MLY A;  4DZ6 A;  4WKR A;  1RGV A;  2GO8 A;  4CLU A;  2C2D A;  3GJT B;  4F2S A;  3BF4 A;  3WDO A;  3H4D A;  3DHW C;  3HLU A;  4IFY B;  3OFG A;  4RPF A;  1YX2 A;  4OJ1 A;  4TQR A;  3CJS A;  2A10 A;  2OLW A;  3TP2 A;  4YP3 A;  4HAC B;  3KLE B;  4NRT A;  2L9N A;  2KXH A;  4J9Q A;  5KG1 A;  2VIC A;  2KT5 A;  2PT0 A;  3GZ7 A;  4B17 A;  2HGN A;  2V6A A;  2W2M P;  2KHD A;  1XER A;  2F8H A;  4WTY A;  1YZ6 A;  4JI1 J;  4OYM A;  2VIH A;  1JJC B;  1JXE A;  1ZM4 A;  5CYM B;  2W9C B;  4ZPB A;  4CLK A;  1FCA A;  1TEL A;  4NLV A;  5KFZ A;  1TKD A;  1LK7 A;  1N5T A;  1YVF A;  3OTD A;  3CCJ S;  1TVR A;  1T8E A;  2ZD1 B;  4MFB B;  3A8J A;  2PE8 A;  2BOA A;  4N47 A;  3GP9 A;  4TXS A;  1R0A A;  3OL7 A;  3P4U B;  2P8I A;  1DTQ B;  5D4P A;  3TUJ C;  2GGP B;  3VHQ A;  2W4P A;  2HVE A;  4DN9 A;  4O4G A;  4LVO P;  4MK8 A;  3RUB L;  3ITH B;  3PR4 A;  4G1P A;  1ZM9 A;  3CCR S;  2DGT A;  3KNA A;  3HUL A;  3M9N B;  4ANC A;  3EPG A;  2DVI A;  2J7K A;  2Q6C A;  3E8O A;  1N0V C;  3JQK A;  3J80 U;  5IOL A;  3TX0 A;  3Q83 A;  3FMW A;  2BJE A;  2Y1L B;  1RYR A;  3V2U C;  2CQ4 A;  3GFY A;  4U7C A;  5J2M B;  3HT0 A;  3I9V 9;  2WHO A;  2HVD A;  2IIH A;  2HIY A;  2ASY A;  3ZO7 A;  4Y0F A;  1HNX F;  1FK9 A;  1OS5 A;  1QSY A;  3O3L A;  4DSE A;  4AYB D;  5HVH A;  5KFF A;  2KVI A;  4H4K C;  2AJ2 A;  3RAQ A;  3PV8 A;  3GON A;  1WSV A;  5AXK A;  1WEZ A;  2DIU A;  2DY1 A;  1UEK A;  3M8S A;  2IC3 A;  3JXO A;  2VDH A;  4DX5 A;  2OD4 A;  2JFD A;  3BDE A;  2QMU B;  4ERD A;  4YN3 B;  4QBU A;  2L48 A;  5K14 A;  4LF9 J;  3H25 A;  4OI2 A;  2HYI B;  1EZZ B;  2MKS A;  4KV8 B;  2BXJ A;  4P71 A;  4QWD A;  4I56 A;  2FHM A;  2DT9 A;  2BE9 B;  2QLW A;  3BZQ A;  2AEM A;  1TKT B;  6FDR A;  3G8S A;  2R8K A;  4JV2 A;  4QWA A;  2XYG B;  2RS8 A;  4GO5 X;  1T9Y A;  2OFG X;  3BR9 A;  1M0S A;  4NXM F;  3ZTR A;  3Q8S B;  4WWS A;  1UAW A;  2GW8 A;  1GXU A;  3THV A;  4EWT A;  5GAH I;  3CT9 A;  1FVS A;  2VG6 B;  2Z57 B;  1HI1 A;  1IKX B;  3BSC A;  1K73 T;  5A0Y B;  4CZC A;  1TL1 B;  5J2P B;  1D8Z A;  2UXB F;  2IAJ A;  1UMJ A;  1VOM A;  3N0V A;  1NSK L;  4ED6 A;  3MM7 A;  2ROG A;  4PAA A;  2AJF E;  3NGS A;  5H9E J;  1B0P A;  1RU2 A;  3PFE A;  4OX8 A;  2ACM A;  3FEX B;  2B8P A;  3OJU A;  4RU2 A;  2EEY A;  1LWC A;  2FY8 A;  4TU9 A;  3ZZT A;  4DL3 A;  4M5I A;  2J9D E;  4OZ2 A;  2XHW A;  1S1T A;  1PYT A;  1QAY A;  3CJ4 A;  3UVJ A;  3UN2 A;  1VC5 A;  3HVT A;  4J9O A;  4GKK J;  5HLF A;  5KG4 A;  2RNE A;  3BB5 A;  1OPI A;  1IXK A;  3JSB A;  3PW7 A;  4DWI A;  2IRX A;  2XB2 D;  2C2Z B;  3TAM A;  3QMQ A;  5U47 A;  2AX1 A;  1KON A;  3WIV A;  4KH0 B;  3ZZO A;  2HK2 A;  1IBC B;  2WON B;  5L1I A;  2D9P A;  1K0T A;  5C24 B;  4EMD A;  1UW9 A;  3VQT A;  1FRH A;  5DLF A;  3V4I B;  3A13 A;  2CDQ A;  2B5J A;  3NCQ A;  3B4M A;  1QY7 A;  1WF0 A;  3VAK A;  2YQ0 A;  2IFX A;  2QX0 A;  1KQG B;  3GFZ A;  3W9J A;  3HHK A;  1YJT A;  4OL8 A;  1C1C A;  3MEC B;  4LIW A;  4X64 J;  1U45 A;  2L08 A;  2IVF B;  1YSJ A;  1C1B B;  2CG8 A;  3G8Q A;  2UV8 G;  2CA9 A;  3TAN A;  4MMO A;  3UFC X;  1NPK A;  3C66 A;  2JX2 A;  3TEH B;  1HBN B;  1F5A A;  4NLT A;  2GVZ A;  1S6U A;  3SCL E;  5FD1 A;  1KSP A;  5KOX A;  2J8A A;  3ZZ0 A;  1XN9 A;  4EU0 A;  3K17 A;  4MKY A;  2ADC A;  4LF4 J;  4DFK A;  3PHT A;  3HD1 A;  1Y10 A;  3M1V A;  1FTR A;  5DM6 Q;  3R1H A;  3BBC A;  2ZWP A;  3J7Y I;  4DQS A;  4HDG A;  2PI5 A;  3H98 A;  4ICL A;  3ZTP A;  3D66 A;  3H5Y A;  3QYY A;  2HWT A;  1NRK A;  2JOQ A;  4EK2 A;  2BAN A;  2VQE F;  2PA3 A;  3MM6 B;  5KG7 A;  1RAE B;  1MN9 A;  4WFX A;  1RWM B;  4W92 B;  2Q3P A;  4DOZ A;  2KH9 A;  5DZ7 A;  2OMO A;  3EDQ B;  4IG0 B;  1CJK A;  2W2N P;  4KGK A;  2FLL A;  5ETR A;  2YBV A;  2VUG A;  3BN7 A;  4NCA A;  2HLT A;  3MCO A;  2XO7 A;  3PM9 A;  1QVG R;  4BDP A;  4B3T J;  1Q8I A;  2BZ2 A;  3TJA A;  3LO3 A;  5M2U A;  4EBE A;  3C15 A;  4X4P A;  1R0B G;  1H2V Z;  2B8Q A;  3DMJ A;  3MD3 A;  3CO0 P;  2HBQ B;  3NKY A;  3Q8V A;  4JYA J;  4DX7 A;  4GRS A;  4NRU A;  2ZDP A;  3RR8 A;  4ZJO A;  3V81 A;  3LP1 B;  1D0E A;  2RRB A;  3PIO Q;  1BD6 A;  4OX7 A;  3M8P A;  1T3O A;  8ATC B;  3OR1 B;  1S12 A;  4AQY J;  3HHN B;  4ZA1 A;  2QSF A;  4HLB A;  3CIM A;  5K8O A;  2XGQ A;  5I42 A;  2W7O A;  2HQ3 A;  3C6T A;  4MTP A;  4IQX A;  1FXR A;  4FYX B;  4ZPW R;  5E3Q A;  2VBZ A;  2ZHO A;  2F40 A;  3BS9 A;  4RJV A;  4LBP A;  3QAU A;  2UUW A;  1K1S A;  2GHV C;  4CLY A;  2HFS A;  2G1H A;  4NE9 C;  3OTE A;  2XMA A;  2QLX A;  3IFE A;  3NY0 A;  1YQH A;  1S7I A;  3G6V A;  2NYH A;  1LWE B;  1GTH A;  4Y34 A;  2UVV A;  1MG7 A;  1RCX B;  2APO A;  2IYG A;  1RAA B;  5A6P A;  1HMV B;  3B54 A;  3ICL A;  2RDD A;  4ATN A;  4F0K A;  4Q45 A;  4C8Z A;  2YH1 A;  2CVI A;  2WBR A;  4O3P A;  2ERR A;  1I94 J;  2F4V J;  4IFY A;  2NCK L;  5KFQ A;  2DNN A;  2KN4 A;  3DN9 A;  2VAS A;  1R8H A;  4HAC A;  4NYO A;  2RKI B;  3KLE A;  3I32 A;  3HK2 A;  3UI3 A;  1R6V A;  2OP5 A;  3F56 A;  5LXR A;  1ACM B;  1SCJ B;  4LVN P;  3L95 X;  2HHQ A;  4F25 A;  2KT3 A;  2OKQ A;  2B3T B;  2IJN A;  4Z7C A;  5HRO B;  2HK3 A;  2MY7 A;  4C8K A;  5DDO C;  1WUU A;  3HT3 A;  1G2E A;  1AUD A;  5AXL A;  3L9Z A;  4DS5 A;  4FN5 A;  2ZBQ A;  5E3R A;  3MHY A;  1FDD A;  2EFN A;  4PEO A;  4X65 J;  5CYM A;  2W9C A;  2RS2 A;  2NZC A;  4JI5 J;  3CXC R;  4U6P A;  3HJV A;  4BWM A;  5AE3 A;  4MFB A;  3TA0 A;  2VF3 A;  3CUN A;  3Q8U A;  4DUT A;  2IMO A;  1DTQ A;  3THP A;  2QA1 A;  1NK0 A;  2GGP A;  2KRB A;  2R3V A;  3OTC A;  3TZX A;  2H3E B;  4L72 B;  4KGV B;  1AB8 A;  1VQL S;  3ITH A;  3M6W A;  2A6M A;  2E7X A;  2DRA A;  4URG A;  3W3S A;  2N7Y A;  2KRR A;  4E0D A;  3ZFV A;  5BR8 J;  4GKK F;  2VFS A;  4K59 A;  2F7V A;  4Y2M A;  4M1K A;  5IC6 B;  3HP6 A;  5DET A;  4O3O A;  2E9R X;  2OSQ A;  2ASL A;  5J2M A;  3K0J A;  2DHH A;  2DY9 A;  1DBD A;  1FRM A;  5KG3 A;  1FRL A;  3AAW B;  4I0W A;  3CJ2 A;  4L6V 3;  3QQC D;  3QIP B;  5DGA A;  3I31 A;  4FF1 A;  2DXE A;  2RRN A;  3TAP A;  1RAI B;  3CJ3 A;  2E44 A;  2HHS A;  4DR1 J;  1UET A;  4J90 A;  3MD1 A;  2XLK A;  4DV0 F;  1UVL A;  2RH3 A;  4N77 A;  1UVN A;  2DHA A;  1T95 A;  5CD4 A;  2CYY A;  2JJ4 D;  3CF5 Q;  4DL6 A;  2V8D A;  3BM7 A;  4L76 A;  3AOC A;  1S7H A;  1BWV A;  1QSS A;  1NB2 A;  3IA0 A;  2ZM6 J;  4KV8 A;  1T11 A;  1RWW B;  3R5D A;  3CDE A;  3NOG A;  1S4F A;  2HHH J;  1UZH A;  3G82 B;  2P6T A;  3TUZ C;  1EAY C;  5EWF A;  1TKT A;  2GAG C;  3D6H B;  4DJB A;  3NMA A;  1RT7 B;  3CDW A;  2FZC B;  4MK9 A;  2HQF A;  3D28 A;  2VA2 A;  3CNQ P;  2DO4 A;  3MMB B;  1SKS A;  1Q7L B;  3HJF A;  1H38 A;  1OYD A;  4LF4 F;  1T9U A;  2VG6 A;  2I0X A;  1OQ3 A;  1QJH A;  2WK4 A;  4WFA Q;  1R8A A;  4FPI A;  1IKX A;  3S01 A;  5A0Y A;  1TL1 A;  5J2P A;  4XIU A;  4KE5 A;  2CJB A;  2H48 B;  4JI4 J;  2JWN A;  5K8M A;  2B9X A;  2KFN A;  4LT6 A;  4RWW A;  4PRF A;  1RHK B;  1SIW B;  3T5K A;  4DSL A;  3RB4 A;  4IH7 A;  1SKW A;  3PRB A;  3LWL A;  2ADB A;  3L3C A;  2RRA A;  1VBY A;  4HH0 A;  2MJN A;  3QT7 A;  4LR8 A;  4B3T F;  5ETM A;  3T5H A;  2X3D A;  1SVD A;  2DRB A;  4PG5 A;  1H6K X;  4CO5 A;  4DR5 J;  3CCZ A;  2B7C B;  2G2O A;  2KM8 C;  3UDV A;  4E8U A;  1K47 A;  4JYA F;  1X0P A;  5J1P A;  2OPR B;  4FPR A;  3TWZ A;  5FDL B;  2WON A;  3EWG A;  2ZH2 A;  4OI3 A;  2V94 A;  3NCP A;  4HHJ A;  5C24 A;  4AQY F;  2F9D A;  3HD2 A;  3HFZ B;  1ZZF A;  1YBT A;  3V4I A;  4O44 B;  2AYM A;  2ZHB A;  3A3N B;  4CLF A;  2VC1 A;  2CJX B;  1NSQ A;  1N52 B;  4GC6 A;  1WF2 A;  1HNW J;  3R6L B;  3FQL A;  3I9Z A;  3MEC A;  2HQD A;  2BYC A;  4NLO A;  4RNO A;  2R8G A;  1B70 B;  3AH6 A;  1C1B A;  2Z2Z A;  1XBW A;  4J9P A;  4Z37 A;  5KFO A;  3MPW A;  2CNN B;  3MR3 A;  4PXC A;  2NXU A;  2HFZ A;  1HBN A;  3W7B A;  3IO1 A;  2E9Z A;  3R5J B;  1IBL J;  1ARO P;  3ILL A;  2BM0 A;  4DF4 A;  1R8B A;  4G3I A;  3AA8 A;  3I0S B;  1I94 F;  1WC3 A;  1UZD A;  4IR1 A;  3OJS A;  3PRD A;  1DAR A;  4X62 J;  5KOW A;  3N4W A;  2RD5 C;  1UP1 A;  2AHO B;  3HX9 A;  5DG8 A;  2QFI A;  3KUH A;  1NPR A;  4EO8 A;  2IMW P;  3U27 A;  1JLF B;  4PPD A;  2DGQ A;  4MH8 A;  3MM9 B;  4PWD B;  3I5A A;  2K06 A;  1WTB A;  1VQ7 S;  1KWM A;  3W1Y C;  2JNJ A;  3GQC A;  3QJP A;  4DV3 F;  3IBC B;  3MM6 A;  1HIY A;  4TYB A;  3CCQ S;  3JSR A;  2ZIT A;  1A0O B;  5GVQ A;  2R7S A;  5E3P A;  3MOZ A;  4I64 A;  2FLP A;  4IG0 A;  2V4R A;  3H5X A;  4EZ6 A;  2C2E A;  2JEF A;  3IXQ A;  2E1A A;  4P10 A;  2A2C A;  2QL7 B;  3DM2 B;  2F8M A;  8RUC A;  4ZVH A;  3CD6 S;  3P45 B;  1KTQ A;  4F4X A;  2LQ5 A;  3MR2 A;  3J7A 1;  4Y2I A;  2OEJ A;  4F4Y A;  2ZKT A;  3QAE A;  4QIW D;  3HXM A;  4NAS A;  1JJ2 R;  2V8P A;  1EIY B;  4DR4 F;  3LGM A;  3GV8 B;  4DR3 J;  1JXL A;  2GVD A;  3FZ2 A;  1X5O A;  3P3D A;  4C6A A;  1UVM A;  3ETM A;  4R0J A;  3LP1 A;  3CD0 A;  1IKV B;  2CPZ A;  2AZ1 A;  2KFY A;  2K8G A;  5IV3 A;  3OR1 A;  1FEE A;  3DRS B;  3UCU P;  1T03 B;  3SSQ A;  2BAC A;  3KDO A;  5BR8 F;  4F4A A;  4YY3 J;  5HO4 A;  2JHE A;  2VDI A;  2VBX A;  1SKU B;  3D2W A;  3D5M A;  3NG8 A;  2CNO B;  2XZT B;  5I3Q A;  3MPV A;  2BR0 A;  5EX0 A;  2JZ5 A;  1ZM3 A;  2IVY A;  1BY9 A;  1N5Q A;  3M2R B;  4DSI A;  4Y00 A;  1LWE A;  3TI0 A;  1KVK A;  2EFQ A;  3OR2 B;  1HMV A;  4KH1 B;  4ILL A;  4KQZ A;  2IM0 A;  2Z8Q A;  1AZS B;  2BW2 A;  4RU9 A;  4YB1 P;  1W7W A;  2D9O A;  5F41 A;  4OI1 A;  1QLN A;  2ZM6 F;  5IT9 Y;  1RAJ A;  1TV6 B;  4N41 A;  1JXV A;  3M30 B;  3IWN C;  2V2Z A;  3BYP A;  3BH6 B;  4Q8E A;  1OWX A;  3OUY B;  2RKI A;  2GHW A;  4KRW A;  1P9Q C;  1SIZ A;  1S4E A;  3HVA A;  4OI0 A;  2ZWO A;  4JI2 J;  2FGC A;  4IDK B;  3FNN A;  2JDJ A;  3OV7 A;  3GE9 A;  2ZOF A;  1VS3 A;  3P5T L;  5HRO A;  3QBC A;  3N9U C;  3RGI A;  2C42 A;  1XWL A;  2VB6 A;  1RAB B;  3OXL A;  2MKH A;  4QJV A;  3CCU S;  4QYZ K;  1DJ0 A;  4UQT A;  5KFK A;  1H2U X;  2PFF B;  4K8R A;  3IBF B;  4DPX A;  1YJV A;  1RT1 B;  2DNZ A;  3L7U A;  5E5N A;  1CQN A;  3OHA A;  1XTZ A;  4K0K J;  5IWA J;  3MCS A;  3TYT A;  2RVJ A;  2X1B A;  2GAH C;  1PJ7 A;  4EBC A;  3BSN A;  3IGV A;  5LM7 E;  4HVZ A;  2PSZ A;  3W9I A;  3GJR B;  1EP4 B;  1SBR A;  2I8E A;  4ED2 A;  2QA2 A;  1X0F A;  4ALZ A;  1VHI A;  2ZDO A;  3T1Y F;  4OYZ A;  3CIZ A;  3PKM A;  1U8W A;  4ID8 A;  5GAH U;  1RTD B;  4CWB A;  3HMJ G;  5L9N A;  3A8K A;  3U02 A;  3RBD A;  1QUV A;  1R89 A;  2FIU A;  2UUB J;  2BQU A;  1NJW A;  3HM9 A;  3SXL A;  1LXJ A;  4DSK A;  5SUH A;  1IQZ A;  1YKW A;  3BKF A;  3QIP A;  4ZP9 A;  4MKB A;  4LBH A;  3I4P A;  3CED A;  4RW7 B;  1UA0 A;  4P52 A;  5D0R A;  2W8L A;  1GTE A;  1VIS A;  1RBO B;  2NLW A;  5GAG I;  3PEJ A;  3NAH A;  5IFM A;  3T41 A;  3P5B P;  2E5L F;  4IOA Q;  1H73 A;  1LWX A;  1KFS A;  3LGH A;  2VFT A;  3LP0 B;  5HJY A;  4A8K A;  1QSL A;  4KPC A;  2ZNY A;  2QGF B;  4L3K A;  1HNW F;  2VKR A;  1S6P B;  5DM7 Q;  2VON A;  3MR6 A;  1HWL A;  4IFV B;  2QN6 B;  4FZV A;  4MIA A;  5IT4 A;  4GVB B;  4NMX A;  4B3M F;  3AD9 C;  3G82 A;  1KR4 A;  4Q44 A;  2ZH9 A;  3D4J A;  2JFK A;  4DSJ A;  4X4Q A;  1REG X;  4QIF A;  2ATL A;  2V8H A;  2B0G A;  3U1N A;  3V4M A;  4F4Z A;  3B4D A;  1RT7 A;  5HBM B;  2HFU A;  2DK2 A;  1HW8 A;  1QTM A;  1IBL F;  2P6S A;  3D54 A;  2BMB A;  1JKH B;  3MMB A;  1X4F A;  1JQG A;  2XMV A;  1GNK A;  2Y8Y A;  2CJY B;  4B3S J;  4ECV A;  5HAT A;  1DTT B;  1NB7 A;  2CPJ A;  2MQO A;  1ICE B;  4OYB A;  1JJ4 A;  1X60 A;  4DDF A;  3RBE A;  1UPM B;  2EKY A;  1S9G B;  4C4W A;  5KFX A;  4FKX A;  3Q89 A;  1E6Y A;  4GKJ J;  2KO1 A;  1P8G A;  2A6O A;  5A2Q Y;  1WWH A;  4FKY A;  1VQP S;  3LOU A;  3M6X A;  2ZC3 A;  2ILZ A;  4YHH J;  1FVQ A;  3W65 A;  3G6Y A;  2EK6 A;  2CNK B;  3O44 A;  1HI0 P;  4DHV A;  2PFD A;  5JMN A;  4K2X A;  4ELV A;  2LA6 A;  3R9L A;  2DCU B;  2LQJ A;  2HQC A;  2KL8 A;  1FE4 A;  5K8P A;  2J7U A;  1IR2 A;  2V68 A;  1DLO B;  3I87 A;  2YQ1 A;  1G3O A;  3J7Y U;  2Q43 A;  3DLK B;  1HHQ A;  1VC0 A;  2OPR A;  3V6H A;  3HKZ D;  4B3R J;  5FDL A;  1N5Y B;  2DH7 A;  2E1C A;  4I6A A;  3WC2 A;  3P96 A;  4I2P B;  2CWK A;  2V69 A;  3QZ7 A;  4K4S A;  2LCW A;  2LDY A;  4LFB J;  3TZY A;  2MTL A;  1UJ6 A;  2D3Z A;  4YY3 F;  4O44 A;  1M1K T;  4QIG A;  3PFO A;  2Z4P A;  4O3N A;  3ET6 B;  1WG5 A;  1C2P A;  1WAC A;  4NYZ A;  4DPW A;  2OSR A;  2IBK A;  1JK9 B;  1LK5 A;  2R4F A;  2L9W A;  4ILR A;  4H4M A;  1U1N A;  3PEH A;  2F63 A;  5B7W A;  3GSI A;  4EI2 A;  4M5K A;  1HNV B;  2G2Y A;  3G2X A;  5BJR A;  1QUP A;  3DC2 A;  1U0H B;  3CCW A;  3KK1 B;  1UJ5 A;  2L41 A;  3RBZ A;  1OY9 A;  5D77 A;  1S10 A;  1MNE A;  1HBU B;  1FO1 A;  2VOP A;  2HFN A;  5CYJ A;  4K4U A;  3UR0 A;  3CD5 A;  3OSN A;  3C14 B;  3B6B A;  3BV8 A;  1XQI A;  3I0S A;  3UQS A;  4GC7 A;  4F4W A;  2MST A;  3TO8 A;  3RJM B;  4ES2 A;  2DGU A;  1JMT A;  2J9C A;  2G0J A;  3HSZ A;  4KY3 A;  1YHQ S;  3SQO P;  4EEY A;  4XPC A;  4O23 A;  1JLF A;  3MM9 A;  3UDL A;  3U1M A;  1FJ7 A;  4PWD A;  3R6G B;  2NSC A;  2R7X A;  2YX1 A;  3OL9 A;  4WYW A;  3TAQ A;  2KHC A;  2V4J B;  3MUM P;  2HHW A;  3UD3 P;  4TQS A;  3PX0 A;  3W9H A;  3PHE A;  1WOP A;  3G71 S;  3OD2 A;  4U67 Q;  1RAO A;  3MDF A;  2Y0S D;  5A2Q U;  4CLT A;  1RCO B;  1NZ8 A;  4A8Y A;  2M8D B;  2QL9 B;  3DM2 A;  4KO0 B;  4K5R A;  5F0U A;  4PWW A;  1JNZ B;  4DL2 A;  3R2D J;  2HQG A;  5FII A;  1ZPW X;  1PO6 A;  1NK7 A;  4ECU A;  4K0K F;  4TU7 A;  2LYV A;  3MI7 X;  2DGV A;  2RSQ A;  1CSJ A;  3FCW A;  4B02 A;  4FS1 A;  1S79 A;  3PW2 A;  3R7B B;  4ETX A;  1Q5Y A;  3Q0A A;  1IKV A;  2OJ3 A;  5F8J A;  1FDN A;  4AD6 A;  1RBL A;  1WC6 A;  4NLG A;  2PC6 A;  2XZW A;  5A6W A;  4ZPV R;  2AGO A;  3DRS A;  1T03 A;  1Y5I B;  3E01 B;  4O0N A;  1FNO A;  3VAG A;  1FHT A;  2FQQ B;  1WI8 A;  5IXU A;  3J81 Y;  2MHE A;  2IY5 B;  1M1G A;  1RUS A;  1RWK B;  5GAD I;  1N33 F;  2DNK A;  3FRY A;  2PMH A;  1Q5V A;  4X4T A;  4X84 A;  4ZVG A;  3H90 A;  4ECQ A;  1PAU B;  4OHZ A;  3C6U B;  3M2R A;  5L8R C;  4ENO A;  2J6U A;  3ZTS A;  4ZPC A;  3ADA C;  4ZVR B;  2CQG A;  1D9F A;  2CQ3 A;  2DPJ A;  3OR2 A;  3BR8 A;  5SZT A;  1EJ7 L;  4UW2 A;  2F1F A;  3SSS A;  3AQP A;  1NDC A;  2O67 A;  3H5S A;  1S0M A;  4LRE A;  1AZS A;  2MJU A;  1KDN A;  3CB4 A;  1RT6 B;  3KMS A;  4WBF A;  4DV4 J;  1SV5 B;  2E1M C;  4F67 A;  1ZET A;  1TV6 A;  4DL5 A;  3M30 A;  4KYZ A;  2XLJ A;  4NZ0 A;  2XMM A;  2HBR B;  3OUY A;  1Z4U A;  1U7L A;  1NH7 A;  4J9U E;  2QLF B;  2VJV A;  2C22 A;  1RI7 A;  1S5Z A;  4NLP A;  3OLA A;  2FZG B;  2N4C A;  4IDK A;  4NA1 A;  1TKX B;  2BM1 A;  3VQS A;  4KTQ A;  1SC4 B;  2G4B A;  4ED1 A;  3PAC A;  4C3M A;  1BQN B;  2J9E A;  2MZS A;  4L73 A;  2LXI A;  2J6S A;  3LA0 A;  1YI2 S;  1S59 A;  4DFJ A;  2EFP A;  2RQM A;  1RK8 A;  4J9K A;  3U1L A;  4B3S F;  4PXD A;  2J76 E;  1L5U A;  5F9N A;  1EX8 A;  3ENW A;  1RT1 A;  5DQG A;  2OUG A;  4UTG A;  4J9V A;  4CH0 S;  1L3S A;  3NGU A;  3T1A A;  3PO4 A;  4B9S A;  3ZZR A;  2Z2Y B;  1UEV A;  1KHV A;  5D4N A;  4NLU A;  3V6D B;  1B7Y B;  2G9O A;  4Q43 A;  2HND B;  2OI2 A;  3TZW A;  2FLN A;  3MEK A;  1RWU A;  1HQE B;  3OVA A;  4YHH F;  2M5Y A;  3O8W A;  1EP4 A;  1XMO J;  2XMW A;  5E33 A;  1FDB A;  1RWO B;  2UUC F;  2VZ9 A;  4WU2 A;  1TL3 B;  2QRR A;  1YK9 A;  1KLM B;  2I6W A;  2AQ4 A;  3MAA B;  3QSY B;  1T94 A;  3MEE B;  1FF2 A;  2LDI A;  3J81 U;  3B78 A;  1T9W A;  5GME A;  1RTD A;  4A8O A;  5AE1 A;  3NAI A;  3PJ9 A;  4E98 A;  1APS A;  4B3O B;  4UZC A;  4OJG A;  5LSO A;  3M8Q B;  2HRU A;  2A3J A;  3PNI A;  5I3U B;  2V34 A;  5K9F A;  4B3R F;  1WHX A;  5C5J A;  1MWY A;  4KB7 A;  1NM2 A;  5K5M A;  1OSC A;  3OHB A;  4RW7 A;  4LF1 A;  2M7S A;  2PGC A;  4ZLL A;  5D78 A;  4USI A;  2IDE A;  2F8E X;  4OI6 A;  1FES A;  4N56 A;  3EXC X;  5AJ3 F;  3LP0 A;  4I68 A;  1NBE B;  3BPS P;  3ZZY A;  5LSL A;  2X3G A;  2L3M A;  4CM0 A;  5A76 A;  1NKE A;  5CA5 A;  3TUI C;  5HMZ A;  1S6P A;  3VAI A;  4NXN J;  1PGZ A;  4IFV A;  2AX0 A;  4CTA B;  2BQR A;  4GVB A;  1DY3 A;  2ZEJ A;  3GJS B;  2QJ3 A;  1QAI A;  2V2V A;  4KGX B;  2I5J A;  1AT1 B;  2XY6 A;  2MKJ A;  2BKP A;  2V8G A;  3WX4 A;  5HBM A;  4M5H A;  3SDE B;  4MK7 A;  1RKI A;  3FJ2 A;  1DHM A;  2XY5 A;  1JKH A;  2XYP B;  4WTO B;  3IRX B;  4FNI A;  1NKB A;  1XNQ F;  3SZ2 A;  3Q2S C;  1DTT A;  1HBM B;  4Y2C A;  4XDD A;  4ZVE A;  2LMI A;  2QT7 A;  4M63 A;  4YR2 A;  1BWE A;  4ED4 A;  4ZLJ A;  1TU0 B;  2KB2 A;  4OV1 A;  4OZ1 A;  4X4S A;  2ACY A;  2MQ8 A;  3T1H F;  4HL9 A;  3EGZ A;  1S9G A;  1SJ4 P;  1DQ8 A;  3HSD A;  3H2L A;  5D4L A;  5BYQ A;  2MLZ A;  5EN1 A;  3TNV A;  1U6B A;  5FJ4 A;  1S76 D;  2OTJ S;  1GMW D;  5B08 A;  2NS1 B;  3KHG A;  3X3U A;  5CXT A;  4B9V A;  1VMB A;  1FRJ A;  3CJ0 A;  5HSP A;  1ZYQ A;  1Q4R A;  3EPI A;  2N7C A;  3NNH A;  3J7Z T;  4YUD A;  2ZBC A;  4QOT A;  2MZT A;  4Q5V A;  2LU1 A;  1GXL A;  1DLO A;  3DLK A;  3EZU A;  5LOQ A;  1H0H B;  2JVO A;  1PC5 A;  2MGZ B;  2BUN A;  2H54 B;  4P7T A;  5HQ8 A;  4NOH A;  4P2F A;  2CRL A;  5I4M A;  4TLQ A;  1N5Y A;  2QMW A;  4I1T A;  2GIF A;  4I2P A;  2XY7 A;  3FBC A;  4OQJ A;  1FJG F;  1RZM A;  1CC8 A;  2AGP A;  1RE1 B;  1RT4 B;  2E1P A;  2LQ8 A;  3T6J A;  2ZH1 A;  4ZVT B;  3FUY A;  3H40 A;  3IR7 B;  5B0G A;  3ET6 A;  2A18 A;  3UN3 A;  4USU A;  1VRQ C;  2FLO A;  5CD4 H;  3BO3 A;  4FVC A;  3CCS S;  5M2R A;  2K3I A;  1I51 B;  2W4D A;  1HNV A;  3I5B A;  2ZJR Q;  1U0H A;  3KLH A;  1C4A A;  3KK1 A;  4KR0 B;  4ZVF A;  2RQK A;  4RBT A;  1G4C A;  4C9D A;  4A8W A;  2LEC A;  4QWC A;  3QRP A;  1TP7 A;  2D7S A;  4ZVQ B;  1HBU A;  4ZVO B;  2NPI A;  1URR A;  2KFZ A;  2YPZ A;  2VOO A;  4B9T A;  2X7I A;  3C14 A;  4Q8F A;  1REV B;  5KAK A;  3PVX A;  1EKR A;  1FX4 A;  2AEF A;  3PRV A;  1EB0 A;  4DV4 F;  2VOD A;  4Q2M A;  1CJU B;  1WJ9 A;  4HTJ A;  2R2T A;  3NBP B;  1Z2Z A;  1RWX B;  2LQB A;  4QR0 A;  3IR5 B;  1Q8K A;  1UTA A;  5CHC B;  1HWI A;  5ETS A;  3KLF B;  3W2V B;  1KC8 T;  2HZC A;  5E0O A;  4UY8 T;  2VBY A;  4IO1 A;  5IQ6 A;  4ES1 A;  1VIX A;  3MCN A;  2V4J A;  4C0B A;  2FJW A;  1FRX A;  3EVW A;  4DZD A;  1KKH A;  2OEL A;  1LFP A;  3V6K A;  2VFV A;  4ZIT A;  5F8I A;  4KO0 A;  1A6L A;  3AXK A;  2F5G A;  3BGL A;  4J9L A;  4RUH A;  2UXC J;  5DDP C;  1C0T B;  5CAB A;  4CO3 A;  3E51 A;  3KHL A;  2VFR A;  3NS6 A;  4DR2 J;  4ELT A;  2X1G A;  1NXI A;  2HWH A;  3MED B;  1CJV B;  4YB5 A;  5L1L A;  3RRK A;  2NYI A;  1ITP A;  1M5S A;  3GII A;  1V5V A;  2XS5 A;  3QID A;  4A8M P;  1RHJ B;  4ZJQ A;  1XMO F;  4RLE A;  5E3C A;  4OHV A;  3K8W A;  2J8S A;  3DRR B;  1KTV A;  1D1U A;  1GFW B;  5L1K A;  1IKY B;  1PYS B;  3TUP A;  2YKN B;  5L1J A;  1VRT B;  4WFY A;  1YGY A;  3L7P A;  2V0N A;  3GIJ A;  2Q79 A;  1KBR A;  1KVI A;  2XCA A;  4PAB A;  1CJT B;  4ZP6 A;  5DJB A;  3BSO A;  4DV7 J;  4WKY A;  1N34 F;  2UVU A;  2HVZ A;  2CJQ A;  4JBC A;  1U48 A;  2ROE A;  3CPW R;  4FYV B;  3L09 A;  2FVP A;  3B82 A;  2DEI A;  1SQF A;  5K8N A;  3C6U A;  2FHJ D;  3JQM A;  3OQ2 A;  1HR0 J;  4DI6 A;  3W62 A;  4Y2A A;  1HLW A;  1Y3J A;  2OPQ B;  2DGS A;  2LQ9 A;  4LF2 A;  4DLG A;  3Q24 A;  2DCL A;  3C15 B;  1F2G A;  4QZV B;  3H8Y A;  1OSD A;  4LFA F;  4B9N A;  1RT6 A;  3RRH A;  3CO9 A;  1SV5 A;  1J5E F;  3ENV A;  3CCL S;  3CCE S;  1UA1 A;  4LF5 F;  1CC7 A;  4LR7 A;  1AYE A;  3MR7 A;  3P8B B;  1IM4 A;  3IC1 A;  4P2M A;  4DCO B;  2EPI A;  4QIV A;  5HVF A;  4Y2K A;  2B4V A;  1YJ9 S;  1TKX A;  2F65 A;  3MUV P;  3GB0 A;  1RWP B;  2W01 A;  5HP1 B;  2YH0 A;  9ATC B;  2XSJ B;  1BQN A;  2YY3 A;  3OSP A;  2NQP A;  3ISN C;  1N32 J;  3R5B A;  2G13 A;  2MKY A;  4PYA A;  1UVI A;  3IGN A;  3QJJ A;  5GAG U;  2RAQ A;  2HHX A;  3ZZP A;  1H2T Z;  2DIS A;  2W1B A;  4FF3 A;  1JLC B;  3HFV A;  3PO5 A;  2E5G A;  3EZO A;  2DR9 A;  2JC0 A;  3GR0 A;  4RUC A;  1ZAV A;  3GG0 A;  4OV6 A;  2DJW A;  4M5L A;  3JSM B;  3V6D A;  2CPX A;  3MPD A;  3W60 A;  2DR7 A;  2HND A;  4L75 A;  4I69 A;  1WTF A;  5HMW A;  1HQE A;  2WBM A;  1KLN A;  3VGS A;  3ZTQ A;  2R8J A;  2YVS A;  2V2K A;  3GJQ B;  1S0V A;  5G0R B;  1RKJ A;  2ZH3 A;  5EHH A;  2BOP A;  1TL3 A;  3MTK A;  1KLM A;  3MAA A;  1FNM A;  3MEE A;  3MEG B;  1T05 B;  2AJ0 A;  2Y3Y A;  2FVR A;  1NHU A;  4B3O A;  2AJQ A;  1YDL A;  1H72 C;  4E2F B;  4ZLN A;  2VG7 B;  3M8Q A;  1U1R A;  4KHP J;  4WJB A;  3KTQ A;  5I3U A;  3BBF A;  4G65 A;  2CPE A;  1B64 A;  4USK A;  3G8T A;  3M6U A;  3J81 j;  3PYE A;  2NXC A;  1JB0 C;  3NGR A;  4MKV A;  1UWB B;  2AKW B;  5KFR A;  2QA4 G;  1H3D A;  1QAX A;  2JEI A;  4QCL A;  1WKJ A;  2V5H G;  2YNF B;  5KFD A;  4BBY A;  3UD5 A;  3DLH A;  2XEX A;  2DGW A;  2LEB A;  3UO0 A;  1QM9 A;  1VQ4 S;  3AJ1 A;  4ZVP B;  1RWN B;  2J7W A;  3WQP A;  1N0U A;  1X9M A;  2CQ0 A;  4M95 A;  3QT5 A;  4CTA A;  4NYP A;  4K4W A;  5L46 A;  1D9A A;  1KQS R;  2KJV A;  1N88 A;  3CMA S;  3GIK A;  2YKM B;  3KG1 A;  4TY9 A;  2KU7 A;  1QDU B;  2Q66 A;  1NJI T;  3DI6 B;  4O3R A;  3N28 A;  3SDE A;  3UDC A;  3IAM 9;  3HHL C;  2DHG A;  1FEH A;  1O51 A;  1RAH B;  3IRX A;  5D8H B;  3IAS 9;  3BGF A;  5HN0 A;  2EK1 A;  2BJD A;  1GEH A;  2PMZ D;  2WCX A;  5HMY A;  5LJ3 Y;  2KT2 A;  5HI7 A;  4DV5 F;  1HBM A;  3F73 A;  1J27 A;  1LWF B;  1S1U B;  2FHK A;  1XEZ A; 
#chains in the Genus database with same CATH homology
 2BEF A;  4HR2 A;  3ZTO A;  3FC9 A;  1WKJ A;  5CAB A;  1HLW A;  3FKB A;  2VU5 A;  1K44 A;  4AND A;  2CWK A;  4O0N A;  1S5Z A;  1F6T A;  1NDL A;  3FBF A;  3L7U A;  1PAE X;  3FBE A;  1NDP A;  4F36 A;  4UOH A;  3BBC A;  3EE3 A;  3MPD A;  3BBB A;  1NSP A;  3EIC A;  3PJ9 A;  4W98 A;  3ZTP A;  3DKD A;  2DYA A;  1NSK L;  1LEO A;  1XIQ A;  1LWX A;  3PRV A;  3ELH A;  3VGS A;  3ZTQ A;  3VGU A;  4EK2 A;  4FKX A;  3Q89 A;  1UCN A;  4KPC A;  1W7W A;  1S59 A;  1NB2 A;  3GP9 A;  1MN9 A;  1NDK A;  1ZS6 A;  2DY9 A;  4UOG A;  1B99 A;  4FKY A;  4DZ6 A;  3NGS A;  3FCV A;  4C6A A;  4CP5 A;  1B4S A;  3ETM A;  2HVE A;  3G2X A;  3VGT A;  4ENO A;  1JXV A;  1NUE A;  3FBC A;  3WX8 A;  3ZTS A;  3NGT A;  3BH6 B;  1F3F A;  2AZ1 A;  3EVM A;  1NLK L;  2B8P A;  3NGU A;  5CAA A;  2DXE A;  1PKU A;  3Q8Y A;  3DDI A;  1NDC A;  1BE4 A;  3R9L A;  4F4A A;  1EHW A;  3VVU A;  1WKK A;  1NCL A;  1U8W A;  3EVW A;  4ANC A;  1WKL A;  1KDN A;  3EMT A;  1VYA A;  5C7P A;  3ENA A;  2DXD A;  3EJM A;  3EVO A;  3FCW A;  5IOL A;  2AZ3 A;  3BBF A;  1BUX A;  1S57 A;  1HIY A;  3JS9 A;  2DXF A;  3B6B A;  2BX6 A;  3Q83 A;  1XQI A;  3B54 A;  3Q8U A;  4S0M A;  4DUT A;  4WBF A;  3Q86 A;  5BXI A;  1NPK A;  1NSQ A;  3EM1 A;  2HUR A;  1HHQ A;  3FBB A;  1NHK L;  1MN7 A;  2ZUA A;  2B8Q A;  4UOF A;  3VGV A;  4ANE A;  3NGR A;  3ZTR A;  3BH7 B;  3Q8V A;  3GPA A;  2HVD A;  3VVT A;  4DI6 A;  1BHN A;  2NCK L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...