3K0JA

Crystal structure of the e. coli thim riboswitch in complex with thiamine pyrophosphate and the u1a crystallization module
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
92
Chain Sequence
b'TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords U1 small nuclear ribonucleoprotein A
publication title Thermodynamic analysis of ligand binding and ligand binding-induced tertiary structure formation by the thiamine pyrophosphate riboswitch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna/rna binding protein
total genus 20
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3k0jA00
5HL7Q 2YH0A 4LJMA 2MZTA 4Z2XA 3MURP 2JWNA 5DDQC 2QEXS 3JB9k 1WTBA 2KRRA 3B4MA 3BO3A 1B7FA 1NO8A 5CA5A 2CQDA 4TU9A 2NZ4A 4YOEA 4F02A 4CQ1A 2HGMA 2JRSA 1WELA 2FY1A 1U1NA 2KHCA 2DO4A 2Q79A 2DO0A 1H2TZ 2CPYA 1VBXA 1YWXA 1WHVA 3CCJS 1UAWA 1U1PA 3U1LA 1AUDA 4IOAQ 1N54B 3U1MA 4WIIA 1VQ7S 2LKZA 3TP2A 2RVJA 2DGTA 1NJIT 2CPHA 2CQPA 1UFWA 2X1BA 2J76E 1WI6A 1X5TA 2CQ4A 3V4MA 4EGLA 4WF9Q 3K0JA 2CPFA 3EX7B 3UCZP 5LSOA 3NS5A 2CPXA 3BO2A 2U1AA 5LJ3Y 3S8SA 2NLWA 1VQNS 2VOOA 3HHNB 1N88A 4C0OC 3BS9A 1YIJS 2MMYA 1X4HA 1M5PC 1X4EA 5LXYA 4IO9Q 2RUGA 1X5SA 2CQGA 2KT5A 3THTA 5DDRC 2KM8B 1VQ5S 3CD6S 2RS2A 1Q86T 1G2EA 1X4FA 3SDEA 1VC0A 3I56S 2MZQA 1U1MA 1Q81T 5H1SV 4M5DB 2M7SA 3D2WA 2FHOB 2LA6A 4V19X 2VODA 3MD3A 2CQIA 2FC8A 2MGZA 1U1KA 2QA4S 2B0GA 2DNLA 3SMZA 3MUMP 1U1QA 1U1RA 2E5HA 1WWHA 2CPDA 2MSSA 4QPTA 2ZJQQ 1P1TA 1X5PA 3VAKA 1WEYA 2N82B 4P6QA 3TO8A 3NNAA 2XSFA 2CPIA 2MKIA 1KQSR 1WHXA 2AYBA 2RS8A 3G71S 2HGLA 2CQHA 2G0CA 3MD1A 1U6FA 2CQ1A 1K9MT 1Q7YT 4WFBQ 5DM7Q 3VF0B 2DGVA 2RQ4A 3TYTA 2L08A 5BJRA 3MUVP 3VAJA 5IFMA 1VQ9S 4WFNQ 4U67Q 2DGWA 2DGUA 5GVQA 3FEYB 2D9OA 2AYEA 1SXLA 3CCUS 2DNNA 1WG5A 2FPHX 2KXHA 4J5OA 2DH7A 2M0GB 1A7GE 3IRWP 4IUFA 4CH1A 2KU7A 1URNA 2KI2A 3UCUP 1VBYA 2DHGA 1X4AA 2DH9A 4WCEQ 2MPUA 3G6ES 1JJ2R 1H2VZ 3MOJB 1H6KX 5GAGU 3G4SS 3VAMA 2E5IA 1K73T 1HL6A 2CQ0A 2XNQA 4PR6A 1WEXA 4F26A 2KM8C 2M52A 4OZ1A 2KN4A 2X1GA 3US5A 2MSTA 1VC5A 5DM6Q 2JX2A 4YB1P 2ADCA 2JVOA 1DHMA 3DXBA 5IM0A 2VOPA 2M4MA 3H2UB 2OIHA 1FJCA 2MB0B 2L9WA 1WHWA 4RU2A 1M90T 2AD9A 2M8HA 2M70A 1VQPS 2CQ3A 2DHSA 5FJ4A 5DDOC 2DNYA 1Q82T 2CJKA 1QM9A 1OWXA 2E5JA 3G96A 2F3JA 3BO4A 5DDPC 1WHYA 3Q2TC 2AYGA 2X1FA 1S72S 1FO1A 1L3KA 5LXRA 2MQLA 1M5VC 2DNPA 3CUNA 3RW6A 2MKKA 1XN9A 1ZH5A 2DITA 1SJQA 5GAEU 2OTJS 1FT8A 1NU4A 3CTRA 1HD1A 3BEGB 1H2UX 1HD0A 1WF2A 2LCWA 2KXNB 1A9NB 1R8HA 1SJFA 1FHTA 4CH0S 3I55S 2ZJRQ 2CQCA 3CCLS 1WG1A 1SJ3P 2D3OR 1DRZA 2MKJA 2OJ3A 4QU7A 2MJNA 3S6EA 2CQBA 2YTCA 4PKDB 1SJ4P 2XS7A 3P49B 4ERDA 1WF1A 2KG1A 4LIRA 2DISA 4Y00A 2MYFA 3UD3P 2LEBA 1DBDA 2PEHA 2V94A 1M5OC 2MXYA 4ZKAA 2CPZA 2DGOA 1VQKS 2MQQA 1UW4A 2F9JA 1RKJA 1DZ5A 3EGZA 2DNZA 2G1DA 3P3DA 2KVIA 1O0PA 1R8PA 2CPJA 2DH8A 2MQPA 2XNRA 1X4DA 2K3KA 3EGNA 3IWNC 4UY8T 1P27B 2PE8A 1YJNS 5GADU 2LYVA 1WF0A 2MQNA 2DGSA 2DNQA 5IM0B 2LA4A 2LECA 2N3OA 2YWKA 2MQMA 4BS2A 3UCGA 3LQVA 4TU7A 2HVZA 3CCRS 2MJUA 2DNHA 2MZRA 1YITS 2OTLS 2CPEA 3MUTP 2YH1A 1CVJA 4OZ0A 2BZ2A 3NMRA 1VQ8S 3VAFA 2DHAA 1BY9A 3CCVS 1VQLS 4C7QA 2HYIB 3Q2SC 1IQTA 2M88A 2A3JA 2EK6A 2XS5A 1SJRA 1QVFR 2DHXA 3H2VE 3R1HA 2KFYA 4F25A 3SDEB 2K8GA 1KOHA 1KOOA 2YKAA 3DLLQ 3VAHA 1FXLA 2MY8A 2MY7A 2N7CA 3S01A 2MGZB 3CCQS 2X1AA 3G8TA 2DGXA 2LXUA 3R27A 3UD4P 3P5TL 3CC4S 2LXIA 2MZJA 1OO0B 2UP1A 2M9KA 3UWTA 1RK8A 3CCES 2CQ2A 4ED5A 4CIOA 2VONA 2EVZA 1WG4A 3VAGA 1U6BA 3MXHP 4FXVA 2RT3A 2GHPA 4PRFA 5CYJA 4TU8A 1X4CA 2DIVA 3UE2A 2MQOA 1JJ4A 2J0SD 3N9UC 2D9PA 3ZZYA 2DK2A 1M5KC 3THPA 1WEZA 1U1LA 2RRBA 2DNRA 5EN1A 3NS6A 2DNKA 5D77A 1VQOS 1N8RT 5JVGQ 2M8DB 3CF5Q 4YUDA 3R1LA 3L3CA 1N52B 4QQBA 3FEXB 3SXLA 5D78A 2DB1A 5DETA 4WKRA 2RU3A 3CULA 4A8XA 1U2FA 5GMKa 1VQMS 2MZ1A 3CXCR 1PO6A 1ZZFA 1FJEB 2ZJPQ 2BOPA 1QVGR 2FC9A 4C4WA 2MZSA 2ADBA 4FXWA 2L41A 2RRAA 2GO9A 1S79A 4UQTA 2LEAA 2XB2D 5IQQA 3OW2R 1YTYA 1U1OA 2MKSA 3B4DA 3CPWR 5JVHQ 1ZZNA 2DIUA 3CCMS 2F9DA 3ZZZA 2O3DA 2SXLA 3P6YC 3VALA 2M2BA 3MI7X 5HO4A 1YI2S 5GAHU 3G8SA 2DNMA 2E44A 3CC7S 1D9AA 2E5GA 1JMTA 5MLCV 1UP1A 2EK1A 2LQ5A 3PIOQ 4TLQA 2MKHA 1FNXH 3G9CA 1HA1A 4IOCQ 5LJ5Y 3J7YU 2QFJA 2XS2A 2DGQA 4W92B 2J0QD 4Y0FA 3LPYA 2LMIA 3J7ZT 1F9FA 1OPIA 3RW7A 5CXTA 2HGNA 1X4BA 3CC2S 1X4GA 2J8AA 2ERRA 5LSLA 1JJHA 4W90B 3NNCA 2N3LA 1WI8A 2KXFA 2I2YA 5ITHA 2RNEA 2MKCA 1VQ4S 3S7RA 2I38A 1YJWS 1VQ6S 2G4BA 3MDFA 1M1KT 3ULHA 4WFAQ 2MHNA 4LMZA 1YJ9S 1VBZA 2KG0A 2DNGA 3HI9A 3PIPQ 2HZCA 1X0FA 2OSRA 3VAIA 1OIAA 2RQCA 2KYXA 2JVRA 1W2BR 1VC6A 2AYMA 1K8AT 2DNOA 3CMAS 1FJ7A 1PGZA 3CMES 3NNHA 2WBRA 4QU6A 1KD1T 2U2FA 1D8ZA 3CCSS 1X5OA 1KC8T 2OSQA 2KH9A 2KRBA 1YHQS
chains in the Genus database with same CATH superfamily
4G6VB 3WC2A 1NUEA 3D9BA 3BO3A 2VG6B 2NZ4A 2RF2A 3PY8A 2UXDF 3ZNUA 2WB1D 3C3LA 1RT4B 2ZNYA 1YBTA 4AXJA 2YKOA 2ALYB 3SFUA 3OTEA 2GQQA 3PCOB 3NOCA 1LWCA 3VGUA 2LVWA 4WF9Q 2ZH8A 2HMIB 5LSOA 2E9TA 3HHLB 1LXNA 1LW0A 4RW8B 3S8SA 1RTIB 1HHTP 4OI0A 2MMYA 3QFWA 1X4HA 4Y2CA 1Y7PA 1HBNB 5KT6A 3KG0A 4UZCA 3T5KA 4NEZA 5H1SV 3D2WA 2BJDA 3TVKA 2VODA 2DHHA 3C16A 5HK4A 1WC5A 2CPDA 4O4GA 4QR0A 4EK2A 4UQGA 1U8WA 5C42B 1BLUA 1S6QB 3E3XA 3K5LA 3CE8A 1ZM4A 3CEDA 3TYTA 3AFGA 3BGRB 3OUYA 2XYHB 4LREA 3HKWA 1VQ9S 5IT0A 3N28A 4PAAA 2EW9A 3D6HB 4DS4A 2M0GB 2WVCA 4CH1A 2VDHA 2IBKA 3TWZA 3DOKA 4ZS6A 4WCEQ 4A47A 4KYZA 2DYAA 1H2VZ 1KLMA 1VRTA 5HLFA 4DR2J 1CBKA 3D28A 4JI5J 3M05A 2VG5A 3Q22A 2NXCA 3US5A 2HZAA 3L7OA 3MEDA 2JVOA 4ZVHA 3IS9A 2V2VA 1FJCA 3JSMB 4WXWA 2MB0B 1S1TA 2L9WA 1WHWA 3D1OA 3FCVA 5FJ4A 4F4YA 1S4FA 3OBIA 3G96A 3GIMA 1QD1A 5DDPC 1CQNA 1S9GA 3R5JB 3QO9B 4PCQA 2DEIA 1ZH5A 2ILZA 2H54B 5F3TA 2CZVC 4PWWA 4QZVB 5B0EA 3EUNA 4JV2A 4ITSA 3LH2S 3OVBA 2C3MA 3JSBA 1NSQA 4ZJLA 4JI0J 4LIRA 2MYFA 3G2XA 3BH7B 1VIXA 3P3DA 2LDIA 1PG5B 2XMVA 3FNNA 1DAXA 2WOMA 5IM0B 3H2LA 5ETNA 4LQ3A 2HVZA 4CLSA 3FSXA 2QRRA 2UXCJ 1E6YB 2UU9J 1L3VA 3QJLA 3UQSA 3TW0A 1VQLS 3CCVS 4A8MP 1SQFA 4KHPJ 2CKWA 3UW1A 4NCGA 2XGQA 2BRLA 2RQMA 3TRGA 5A2QY 4KHRA 4PWDB 3CCQS 2BJ7A 1AFJA 4U8YA 4YFUA 3UD4P 5DZ7A 4ANCA 5BYQA 4DR5F 1SL2A 4RNFA 3QRRA 1TL3A 1VI7A 3P4UB 2IHR1 4ZVPB 1VJQA 4DPYA 2JFDA 1LWFB 1I1GA 1CJVB 3MEKA 3W9HA 3M2VA 3D5MA 2DR5A 2UVUA 1YRUA 3DOMA 4Q8FA 3R1LA 2BQ3A 1N52B 2DB1A 4RWWA 2PI5A 3CDEA 5GMKa 3PX6A 2FC9A 1HMVA 2A1BA 4TVAB 2BM0A 2LEAA 2CJBA 2F1FA 1TAUA 3BB5A 2M2BA 1R3NA 5FDLB 2BKOA 1TL1B 2QFIA 4PQUB 3CJKA 4R5PA 2HVDA 1TU0B 2OPQA 2H5IB 5E3AA 4EI2A 1JLQB 2MEWA 2LMIA 1S9EB 2J8AA 3ETMA 3RR8A 4JI8F 3EJMA 2CG8A 4QWDA 1RZMA 4AL6A 3MDFA 1M1KT 4WFAQ 3DLHA 4ALZA 3OR2A 2QSWA 2YWHA 3SQGB 5B0FA 2RQCA 5HSPA 3I4HX 2HLTA 3Q0AA 2WVFA 3L95X 1PGZA 3D6MB 2KRBA 1SBRA 2Z2LA 3FBCA 1HI8A 1RLCL 3R9LA 3D3BJ 2BJ8A 1KONA 3MTKA 4CQ1A 2GGPB 1F5AA 4WTOB 3PHEA 5L9NA 2C2OB 3W7BA 3J81Y 2OEJA 2VB6A 5J2QA 5CHCB 2QC3A 3TP2A 1XMQJ 1U09A 1KQFB 4J9OA 3I0RA 3LPEA 2I5JA 2ZH5A 3BO2A 4IFYA 1AROP 1RE1B 1R7IA 1VQNS 3GFHA 2VDIA 1HBMB 4X66J 2YBVA 2ASYA 3EGVA 2R7UA 2BQUA 2ZZMA 4DR6J 3GV5B 4DG1B 3DDNA 2AKWB 3M8ZA 4CTAA 1VC0A 1KRPA 3O5TB 2FHOB 2R9LA 1OJ4A 1DQ8A 4LFCF 1NLKL 2V34A 1I3OB 2ZJQQ 3F0NA 4N76A 4FKXA 1X5PA 3KK3A 2EWHA 3WDOA 4JI1F 3RGIA 2BVZA 3UDEA 1K0TA 4NZ0A 3DGPA 5M2UA 2I8EA 2HAIA 3HJFA 2HRYA 4K4ZA 1FFSB 3FFIB 4ZCMA 2AYEA 3D54A 2Z2ZA 1SL1A 4YDDB 3T5LA 3NCPA 3D4JA 2R7SA 2EG1A 2VPWB 1IJFB 1R0BG 1IR2A 1NK5A 4C6AA 3ZTPA 1K73T 3FJ2A 3QRQA 3KG1A 4NX9A 3BGFA 4R0JA 1RACB 5HVHA 3GU0A 1HQUA 4A48A 4Q8EA 2HHQA 1XR7A 4RU2A 2VD3A 1IKVA 3R6LB 1FK9B 4QIFA 4KGVB 1RHKB 5KFJA 2GX8A 5G0RA 1NK4A 3MAQA 4U96A 5J1EB 1ZBTA 1HWLA 1RDRA 2PN6A 3AD9C 3I5CA 4M95A 3LOUA 4A8FA 1T9VA 3ILOA 4QU7A 2MJNA 3Q23A 1QE1B 4FVMA 4OFZA 2N4DA 3PXGa 4RBTA 1NJYA 3DDKA 4KV8B 2J9DA 3M9MB 1RQ0A 1ZM2A 2FYXA 2N4CA 3BBCA 3U02A 1UVLA 1HNWF 3H7HB 4KAIA 3FK4A 3OLAA 3M6XA 1EKSA 4ZLNA 2YPZA 3W63A 4K2JA 2RAQA 2Q6CA 3H5SA 3RYLA 1NJWA 3GTYX 4ZPWR 1AYEA 4IO1A 4CO3A 4JYAJ 2EK6A 1SJRA 3DDIA 3FGVA 1LFWA 1TUGB 1AZSA 3M8QA 5H9EJ 4RKUC 3T19A 3T9NA 4O0IA 2VJUA 3GIKA 5E33A 2M9KA 1X9WA 3HVRA 2J7UA 2GJ2A 2IRXA 2Y1IA 4B3RJ 4LF5F 4NLRA 5CZVA 5DG7A 3U27A 3B6BA 5K8NA 2FGCA 1F1BB 2OMLA 4WP8A 3TUIC 1NKCA 1T94A 4IG3A 2IY5B 2B5JB 1IKWB 5D78A 3CDUA 1SV5A 1ITPA 2K1RB 2ZKUA 4PG7A 1QVGR 1GT8A 3KMQA 1KR4A 2FVQA 3NBPB 1RJJA 2GA7A 3EXCX 4BWJA 3AY0A 4RNMA 3CPWR 4OI3A 5KFQA 4M5LA 3Q8RB 3VALA 3MI7X 8RUCA 1XTZA 1YI2S 1P1LA 5KFYA 1Y11A 2BE2A 1VS3A 2OPSA 1EX8A 3F56A 1JXVA 3RUBL 3U7JA 3PJ9A 4LRFA 2IAJA 4MH8A 3MPUB 1RABB 4DV4F 1F60B 1XBWA 4FS1A 2I2YA 4EBCA 4B3SJ 3MFIA 2BA9A 3S7RA 3DXSX 2ZKTA 2EFGA 1X0FA 2CIMA 2KYXA 2JC1A 1MU2B 3KLFB 4L3KA 1O8BA 4QU6A 1D8ZA 3HP6A 3IR7B 2KH9A 3SSRA 1RAJA 3IWLA 4F67A 1C0TA 1RA6A 3RBZA 4A8QA 3BGLA 2E5LF 3PYDA 4FVCA 2HURA 5GAEI 1VBXA 1UA0A 1WHVA 4DQPA 2V4JB 3IG1A 1NJIT 4QYRA 2ZH1A 4USWA 3V4MA 4HHUA 1DJ0A 5HATA 3M1VA 4IFVA 2E9RX 2VOOA 4NOHA 2XQCA 1RHRB 4QOTA 1YIJS 1K0VA 2MLZA 1LOUA 2KT5A 3MAAA 4C97A 2B9YA 3W9IA 1ZETA 4ED8A 1U1MA 1I6JA 1FNOA 2BACA 4H4MB 3PFEA 1FRMA 2D3O1 4X4TA 1FFGB 3AOAA 4OYWA 1N56A 4NYZA 4OIXA 3E2EA 4CP5A 1IBKF 1P6TA 5A6WA 1Y5LB 2G0CA 3MD1A 1S97A 4CYUB 3VF0B 5SUHA 1FKPB 4X4UA 1G3OA 3GIIA 1URRA 2B7CB 3KK1A 3ITHB 3GWCA 4WFNQ 2DGUA 3ZTQA 2RRNA 5GVQA 3KLHB 3H0PA 5A2QU 3TZZA 3UVJB 3MECA 3R2DJ 2FPHX 3CGIA 4W4MA 4URQU 3AOBA 3HDSA 4OZ3A 5F8MA 1S1VB 3G6YA 3V6HA 4P9SA 1Y3KA 2JLEA 2QZ8A 4OMFG 5GAGU 2K06A 3R5GA 3FMWA 4NCBA 3K7RA 3RU0A 3CDBA 3T6BA 2R2TA 3W2WA 3IFEA 3MOZA 3KJNB 2XLJA 2M70A 1VQPS 2DHSA 2IDLA 3VZIA 1V3RA 2XI2A 4OZLA 3I5AA 2WW8A 3DRRA 5L8RC 2Z2YB 2NXNA 4DUZJ 2DITA 4P71A 1S99A 5L46A 4N56A 3OVSA 1RWUA 4KKOA 2KXNB 1FRKA 1SJFA 1CJKB 2R42A 2KTQA 1WG1A 3JSYA 5CCMA 2NZCA 4FYYB 4B3TJ 5L1KA 3GONA 2PEHA 4YB7A 3Q83A 1LWEB 2MQQA 3EZOA 3CCTA 5G4DA 2BJEA 4FXDA 5ETKA 4J9MA 4DQRA 1H7XA 1FERA 4ZVTB 4C0HA 3B54A 1BGXT 2DXEA 4KY3A 2DNHA 3HPOA 3QRPA 1C0UB 3PW4A 4OZ0A 1IWAA 1TUWA 2AEFA 2XULA 4C98A 2F63A 3Q8VA 1U2CA 3SDEB 1KOHA 1H74A 1FXLA 2EC0A 3R8YA 3ENVA 3J81U 1M0SA 3BQ0A 2J5AA 3C8YA 2AX1A 2CQ2A 3LWMA 3QT8A 2IC3A 4CLYA 1N32J 4NRTA 2HS3A 3RRKA 4JI6F 2HK2A 4CO1A 2LQJA 4WBFA 5B0AA 2KHDA 5EWFA 3HHLD 2B8PA 4QWBA 2Z0GA 3O1LA 2G1HA 2OEMA 5DETA 3RRGA 5DJBA 4YR2A 1VQMS 3OXLA 1LK7A 1S4EA 2P9EA 3ZZUA 1L5UA 4QIEA 4K8RA 1EP4B 2DIUA 1VOMA 2VG6A 2C3YA 2O3DA 1HHQA 4PG8A 2GMJA 3K8WA 1MSWD 2E5GA 1S49A 4EBEA 2ZDOA 3RRHA 1TK5A 2QFJA 4YHHJ 2GVZB 1PKUA 4NWBA 1D1UA 3NMAA 1F9FA 1YX2A 5F0UA 2XC9A 2W2NP 2HMIA 1JLCB 4RW8A 1RTIA 2C3OA 2P9CA 1J2VA 2I38A 3TR5A 3OV7A 5LMNF 4URGA 3AXMA 2VBZA 1SH0A 4RW6A 3G87A 2FHJD 2NXUA 5EX0A 5F3ZA 2BJ9A 1Y4ZB 4I68A 5HL7Q 1HNZJ 2XSJB 2YNFA 3MURP 1EQMA 1WTBA 1GTHA 5C42A 1S6QA 2AMCB 4NPOA 1RBAA 4ZLJA 3EVMA 4IOAQ 3H42A 1TAQA 2AJ2A 4ED4A 1UFWA 2HG4A 4PG6A 5KFGA 3DLKA 1YDLA 5JUMA 4DL0C 1RTHA 3PTWA 5LJ3Y 1WC1A 1NDLA 3OQ2A 5LXYA 1LV5A 1RT7A 5DQIA 1QLNA 2FHJA 1FJGF 4QWAA 4J9QA 5DQHA 2OKQA 2ZOMA 3VVTA 5IWAF 3MUMP 1KKHA 1YG0A 3GG1A 3WX4A 4LFCJ 2QA2A 4FPRA 1HNXF 3TO8A 4B3OA 1JLAB 3H20A 1FWKA 2MKIA 2DVIA 4ES1A 3PW0A 2VQEJ 2HGLA 4DQSA 3DOLB 3GJRB 4EFAC 1RT1B 3Q89A 4Z37A 2QV6A 4MYUA 3GYGA 4R0EA 5C25B 4U67Q 3HT3A 1SJ1A 1NCLA 1BD6A 4U6PA 3PEJA 4BWMA 5F8GA 4LVOP 3HKZD 2J7KA 4Y65A 5CABA 1OY8A 3G6ES 2R8IA 4P2SA 3TUZC 2FUG9 3OFFA 4DMZA 3EZ5A 4KGXB 1WC4A 2XMWA 3K57A 1WEXA 4F26A 4LRBA 2M52A 2D74B 2MSTA 1K44A 1D9FA 1N36J 2V2KA 3EZUA 3M2RB 1T03A 2JX2A 4WK1A 2ADCA 1RWKB 5IM0A 3KK2A 2Z4PA 2IVYA 3THVA 3PVXA 1S6PB 3M32B 5DZ6A 1E6YA 3H4DA 1IKYB 3NCQA 1Q82T 1WHYA 2QLJB 2AYGA 2MQLA 2ZEJA 1VLOA 1T8EA 2FQQB 8ATCB 3D6TB 2FJBB 1GMVA 4PWDA 4X65J 3I55S 1JLGB 4UW2A 1FXDA 2YWWA 4FNIA 5IT4A 3MMCB 3FMBA 4MT1A 2C3PA 2DGOA 4WWSA 4GO5X 1LWFA 2DH8A 1APSA 1Q7LB 2PGCA 2PE8A 3FQLA 2P5VA 4DFJA 3AD8C 2HHHF 3BBBA 1XEZA 3SBMA 1SL0A 1VK3A 4KTQA 3M8WA 4ZPTR 3LQVA 2V8DA 3FCHA 1LWXA 1VGYA 3IO1A 3MUTP 2HQDA 2V5HG 5T41A 1HNWJ 1U45A 4TLRA 1V6HA 4Q43A 1VQ8S 2AV5A 3QWUA 2QTWA 2QJ3A 5CYQB 3FBBA 3HVTB 3M8PB 2IFXA 3LAMA 2K3IA 2MY7A 4TYAA 3IBCB 2WHOA 2LXIA 4BC9A 2HBYB 3K5PA 4J9SA 4OHXA 4K4WA 3AOCA 1N0UA 4B3MJ 3MMAB 2CXEA 1JLQA 1HHSA 2BOAA 1T11A 1G1XA 1X4CA 4RW7B 4LF5J 1VBKA 3ZZYA 5AE2A 1HR0F 2CA9A 1GMWD 2DNRA 1S10A 4RNNA 2B4UA 4RZRA 2XLKA 4NA2A 2MZ1A 2H5EA 2Z56B 2NYIA 4LFAF 5DQGA 1TVRB 2MZSA 3OL9A 4X64F 2V50A 4RW4B 4ER8A 5LSRA 2B4PA 4YS2A 1L3TA 4AD6A 3AJ1A 1IUJA 2EFNA 2F9DA 3I6PA 1JQGA 1SH2A 9RUBA 4H4OB 3QYYA 1K47A 4F0KA 2XHCA 5IC6B 4IOCQ 4LF1A 2Y1RI 2BMBA 2ZH3A 1GMWA 1RBLA 2C28A 4B17A 3GYXB 4PUOA 2CWXA 2WZ1A 3SSQA 2RNEA 4DV4J 1HBMA 4CLKA 3DGVA 3V5RA 1YBAA 3KKFA 2KG0A 2FVCA 1HWKA 4DG1A 1RT6B 3NAIA 3PIPQ 4UZBA 4J9PA 2OSRA 2HHSA 3LP2B 5A76A 3ET6B 3GB0A 5IZHA 4K59A 2JL9A 1D8YA 1CVJA 2YKMA 3W5YA 4ECRA 4WFXA 1T95A 3CJ3A 5CA5A 5HP1B 3TQ1A 1S6UA 3LA0A 2Y1JA 4LSNA 3OSPA 1SC6A 2CVIA 2D3UA 5K14B 1WC6A 1JX4A 3HSGA 4ZN1A 3DFEA 3MCOA 1YJRA 2WTFA 2W8LA 3MF5A 2DGTA 3FFIA 4MIAA 2RJZA 2J76E 1T0TV 2H9ZA 2WRMA 1DARA 5K20B 2GQCA 1RAIB 3DLGB 2H3EB 4F36A 4J9KA 2ZVIA 4CT8A 4CO0A 5C2CA 5D3GA 4WK3A 5KFMA 2KJWA 2W24A 2YNIB 2RS2A 3AXKA 3ELHA 4PYAA 4X4QA 3M8YA 3PX4A 2XWXA 4DWIA 4IG0B 3B78A 2XZTB 3GFYA 5HI7A 5F8IA 3VAKA 2E1PA 4DR3F 4K4XA 1KLNA 1RT5B 1WHXA 3KOAA 2DRDA 2GVDA 1U6FA 4DUTA 3MWBA 4HT7A 3AD7C 2HHPA 3HX9A 3PNIA 4KJIA 3GILA 4OI4A 2XLIA 5KFPA 4DUYF 4ZP9A 3TJ8A 3IRWP 3LP1A 2IM1A 3AH6A 1JJ2R 4LT6A 2Z58B 3KLIA 2PA8D 2ZNZA 5AXMA 4X4PA 1PAEX 4UOFA 1U26A 3IRXB 1VC5A 1DQ9A 1N5SA 5HMYA 3BREA 4KV8A 3ADAC 4Q0BA 3D1HA 3DXBA 1V5VA 4RWXA 1NK0A 2W7OA 4BLGA 2AD9A 1UPPA 2PMWA 2M8HA 3H90A 4JV1A 1NJXA 3TARA 1FKOA 1M1GA 2VFRA 1BC6A 1FWPA 5E5NA 2WBMA 1L3KA 2YKNB 4LR9A 1EHWA 5DGBA 3GJTB 3GJSB 3F73A 3WQPA 1HD0A 2HQ3A 3KHLA 4ZK7M 1V5IB 2MTLA 2OEKA 2AHOB 1GEHA 1R8BA 4PZVA 2ZJRQ 2GJIA 3CCLS 4MJKA 2MLXA 4X4SA 4UOHA 2XS7A 2YTCA 4ZVRB 4ELTA 4KQZA 4OI1A 5ETTA 1RAOA 1DBDA 1FDNA 3IAS9 3CIZA 4F3OA 5KFDA 1X4DA 2OLWA 2VV5A 1TMMA 3IWNC 2IRUA 3DRPA 4LFBF 1VQSA 2HFUA 1Z2LA 2LYVA 1PYOB 4AL5A 4K5RA 2OMOA 4F0HA 2B5JA 1IKWA 2YQ0A 3CJ5A 2IA0A 2JEIA 2GAHC 3M9NB 4X4OA 2K1RA 5I3PA 1NDPA 3TJ9A 3QZ7A 3POTA 3NBPA 2HYIB 2PEBA 2F4FA 1X8DA 2M88A 3HHLC 2A3JA 2C2MB 1R0CB 2RE1A 3I5BA 1R8AA 2Q1LA 3HZEA 1XERA 1VQYA 3PRVA 4Q2LA 2MGZB 1S57A 4D3HA 1LW2B 1WKKA 1U0SA 4M5NA 2HEKA 2WK4A 3MM9A 4PABA 2VONA 4DV2J 4K4YA 4NLOA 1R31A 2KT2A 1NAQA 4FPIA 3R5DA 3UE2A 4I56A 3TZYA 4OV1A 4DV6F 4FF2A 3KG4A 1WKLA 3DHWC 3P5BP 2OFHX 3PW5A 4DEZA 1U2FA 1QTMA 4TN2A 3KLFA 5L9XA 1FJEB 1ZA1B 2QLFB 4R8UA 3OR1A 2KFNA 2HFSA 2GO9A 4WYLA 4UQTA 4LR7A 1F5BA 2HKEA 1FKAF 2JEGA 1ZZNA 4F8RA 4DJBA 4LVNP 2E44A 1Q8LA 1QDUB 4ZCLA 1WORA 2RIJA 4XTTA 4K5SA 2J0QD 2V4JA 4M8LA 5L1LA 2W4CA 3HSDA 3MTJA 1ZTTA 3MZIA 5C24B 4I4BA 3CJTA 2IRYA 3QSIA 3NNCA 1U2RA 3OTDA 2HNDB 3A8IA 1YJWS 2H48B 2MHNA 4LMZA 2RSQA 4JP8A 3HI9A 4QJVA 4QWCA 2WAQD 5LMNJ 1FJ7A 4H4MA 1RYRA 4F4WA 3NXZA 2NQPA 1X5OA 4C8LA 1TKTB 4G3IA 1BUXA 1KNZA 2GZOA 4I6WA 3HVAA 5ETRA 4PQAA 3IP0A 2R8GA 2FY1A 2YQ3A 1UZHA 4CYUA 5CH7B 1BQNB 1TELA 4PXDA 1FKPA 3IM9A 4C8KA 6FD1A 4ANDA 4USUA 2QLWA 1S59A 3ITHA 1D9DA 3TEHB 3V6DA 2UVWA 2RDIA 2IM2A 2JZ5A 2BANB 2LU2A 3GFZA 5T7LB 5KFWA 1XWLA 2DEJA 2OD4A 3ZTOA 2HLUA 1XIQA 3FEZA 3QJJA 1S1VA 3THTA 4ICLA 3PR5B 2PD1A 1IR0A 1RBOB 3TVZA 4ILLA 3I56S 3FDSA 1DLOB 1NPKA 2QA4S 2L9NA 3HD1A 2HNYB 3SMZA 4J91A 3CD5A 1U1QA 1KTQA 1Q8KA 5IWAJ 4Y2MA 3AJ2A 2HHVA 2W7AA 4M5HA 5HVFA 5KFLA 4CLWA 1RWVB 4YQWA 3LTOA 1XK8A 3GV8B 1K9MT 3DRXA 1JKHB 3K5OA 3IA0A 1AUSL 1GXLA 5DM7Q 2HRTA 5DGAA 2ALZA 1WC3A 3SEOA 3G6XA 2OGUA 4I7FB 2HFVA 2EFQA 4LF2A 2UXCF 2UU9F 3PW2A 5KG0A 2H4WB 2HFOA 2Z2MA 1CJKA 1RA7A 2DH7A 4N41A 4KHPF 1PYTA 1J5OB 3IN5A 1HWJA 3EM1A 2PMHA 2GAGC 5HROB 3WZ0A 3W8PA 1LWEA 2E5IA 2OP5A 3CDAA 3P96A 3Q8QB 1CULB 5KG3A 5DM6Q 3HSZA 3M2UA 4QPXA 2WVDA 3ZC4A 1DTQA 4RW9B 2C3UA 4NLPA 3J80Y 4WIQA 1QM9A 1C0UA 1OWXA 3AJDA 5F41A 2C2EA 1AA1B 3GSDA 1I51B 3ETOA 1GXTA 4ID5B 5IS2A 4MFBA 1HPZA 3PEHA 3LUYA 5KG4A 1JXLA 4YR3A 1UVIA 5GAEU 2ROGA 1EKRA 2BJ3A 3CJ0A 1RT2A 1MROB 2YX4A 1PILA 1SVDA 3N6NA 2W9CA 4WZQA 4ZN3A 5EUHA 2MKJA 3RBEA 4G1PA 4Y00A 4EUVA 1A0OB 5E3CA 2AGOA 1VQKS 1UWBB 4CLUA 1N6QB 1KN6A 2DNZA 2DCUB 2NYHA 3BGUA 2EKYA 1TP7A 4DV7J 2XCAA 4TYBA 4FYXB 3CT9A 3DLEB 2DPJA 3UCGA 1CJTA 4QYZK 2OTLS 2Y8WA 3GQCA 4UOCA 4A46A 2RILA 2DRBA 3LANA 1Y5NB 3DRSA 5KG2A 3S1TA 1YKWA 1FEEA 1VHIA 2XMAA 3FZ2A 4A8OA 4CLZA 2E66A 2JC0A 3S01A 4IDKA 2DGXA 4ECWA 2B9XA 1H98A 1NEEA 4ZJOA 2VH7A 4MKAA 4NRUA 2ZE2B 2GVZA 3DU5A 3GR1A 3M6VA 1JLCA 1HR0J 2RH3A 4ES2A 5DLGA 2G13A 4WKRA 5B09A 3SYZA 3DLJA 2BEFA 2CZ4A 2HVIA 1TFWA 2B6AB 1PAUB 1RISA 4X66F 1NSPA 4LFAJ 1WOOA 4G1QB 4DZDA 4DL4A 4OHYA 4LF4J 2XSJA 1YTYA 1FFWB 3J81j 2MKSA 1MWYA 2V8VA 2E1RA 4DR4J 5HANA 4MMOA 4J9NA 2EFOA 1RTJA 2LQ5A 2MKHA 3J7YU 5A8WB 4W92B 4Y0FA 5BYRA 2FZCB 1O6XA 2HQFA 1H7WA 1GFWB 1HYSB 3KLVA 1JWWA 3KLGB 2D7SA 2G2OA 1W2BR 1EIYB 4AFFA 3PV8A 2POKA 1KD1T 4HTIA 2RHQB 1OSDA 4ZIVA 4YB5A 1ZM9A 2EXUA 5AT1B 1M1HA 3QGIA 4M5GA 1JLAA 1NK8A 1S48A 1ROFA 3DOLA 1F3FA 3A8EA 4C11B 1YWXA 2AZ1A 1RT1A 3CCJS 3MR3A 4HL9A 4L72B 3NOGA 5C25A 4XPCA 4JI7F 3WIVA 2VICA 4Y2AA 3O2IA 3H59A 3UCZP 3NS5A 1WOSA 2NS1B 1W25A 5DDRC 1Y9OA 1RWNB 3UDVA 2M7SA 1AB8A 4ZITA 2W4PA 2CQIA 2R3VA 2YKQA 1U1KA 1HQEA 3IR6B 3M2RA 1LEOA 1T3OA 4DQQA 3BPSP 3C6TB 2CPIA 5KFIA 1C4AA 4DR3J 4O3SA 1S0NA 3M32A 3FQKA 1CS4B 3TX8A 5K5MA 1TKZA 3AB2B 5C7PA 2BE9B 5D4NA 1IKYA 3MUVP 1ELOA 1KTVA 1QTNB 1RKIA 5IFMA 3N5BA 1CEZA 2P6SA 3M30B 2ZHBA 2D9OA 2V2QA 4DN0A 1KVKA 2O66A 3QLHB 4F50A 4I1TA 4V1Ak 4DUYJ 1TK0A 4JYAF 4USVA 1X4AA 4ETXA 4NYPA 1T7PA 4O3OA 4NYOA 4DV0F 3FZBA 3NWGA 3QJPA 3SFGA 1HL6A 3UPFA 3SCIE 4FN5A 5CZXA 2XG8A 4QWEA 4RU9A 4DV5J 2XWYA 1NZ8A 4Q5VA 3R3TA 4B3RF 3T5HA 1VRQC 2RQKA 3LGMA 2CQ3A 4HLBA 1MN9A 3W60A 1ZOTA 4JI3F 4E8UA 2B7BB 2VFTA 1TKXB 4DN9A 2NCKL 2PA3A 3K5NA 2QT7A 5LXRA 2DNPA 4URSA 1X0PA 2MKKA 1R8CA 4OLOA 1ZPVA 3LGNA 3KJVB 2LP4A 4M5KA 1TL7A 1VRUB 1AW0A 4G1IA 3H5YA 1ZYQA 4DFMA 4CNYA 1QUPA 1RTDA 1RWPB 4HT5A 2V94A 3MGJA 4O3PA 4DL2A 4O3QA 3NGTA 2YPYA 4YDXA 1YJNS 1B64A 1WF0A 4LFBJ 4WU2A 2B4OA 2XMMA 1WSRA 1LWCB 1QAJA 2RD5C 3CJRA 2CFXA 5IQ6A 2O01C 1KBRA 2BZ2A 4PPDA 2XO6A 1TVRA 4RW4A 4C7QA 3HFVA 5L1IA 4F25A 4M5DA 2QMUB 1Q8BA 2LXUA 3I31A 3MM7A 3TA0A 4CIOA 4O4GB 1RU1A 2KFZA 2R4FA 2F7VA 3R6GB 4NASA 1T05A 2XMTA 2B51A 1T3NA 1NH7A 4O44A 1M5SA 3T1YJ 3UI3A 4DV6J 2VL1A 1N8RT 3CF5Q 4YUDA 5THWA 5D0RA 1O51A 4OHWA 2KDOA 3MEGB 3LP2A 4DSKA 2ZUAA 3IC1A 1B0TA 3DOKB 4JOUA 3R2CJ 2UZAA 1KLMB 1FXRA 5HLFB 3OVAA 4Y3CA 3MM6A 4BBYA 5HP1A 4ZPDA 4EEYA 1UETA 2DNMA 1QUVA 1JMTA 3ISND 5EX3A 2Y0BB 3GP9A 3IS9B 1HA1A 4E0DA 2A6OA 1U02A 1OPIA 4G65A 2HGNA 1X4GA 3MM8A 2D41A 3DLGA 4W90B 4ILMA 2N3LA 3PKMA 5K8OA 3QT5A 5IC4B 3M4XA 3IGVA 3GZ7A 2EFPA 3EICA 2DY1A 1K8AT 4J90A 2PDAA 3G6VA 1HNIB 4O3NA 2IBOA 5DDQC 2CZ9A 5U47A 3J80U 1RT5A 4IRDA 1RGVA 1VJWA 2XGPA 1H2TZ 4YP3A 2CADA 2ZHOA 2GHVC 3QPIA 2L9DA 5J1NA 3OFGA 2X1BA 2FJXA 5ETMA 5ETOA 4BDPA 1N34F 2ZBCA 1JLBB 1JIHA 3OXFA 3KHRA 2OI2A 3BKFA 4DUZF 1RAFB 2QGFB 1NRKA 4NCGB 3AT1B 2MZQA 2A2DA 3IRXA 2R7OA 4B3TF 4Z7CA 2UVVA 1F0XA 3NNAA 4ZVQB 1ZS6A 2K2PA 1GAOA 5AJ3F 4EMDA 2BRKA 3OL7A 4LRCA 2JEJA 4WFBQ 3M2VB 1SKSA 3NS7B 4DHVA 4DX6A 2PIIA 3DOMB 1PYSB 4QW9A 3CW2C 1SH3A 4RBUA 1Q1KA 5CQGA 1U4BA 1WG5A 1EQ0A 3W66A 4ZCIA 5BR8F 4J5OA 2BJ1A 4IUFA 4WTYA 1HMVB 2UV8A 1WD6A 4I67A 3PJXA 2IIHA 4MIBA 4L73A 2X3DA 2FHMA 4X4VA 1JLEA 4YR0A 3I9ZA 1BQXA 3BSNA 3SCLE 1CLFA 2XNQA 3TVYA 2KM8C 2G0IA 1N4LA 3IMQJ 5E3QA 2VF3A 4R5PB 2ZZTA 4RUBA 3UN3A 1DHMA 1N32F 4P10A 2HQGA 4KH0B 2B9EA 2ZWOA 2VC0A 1VISA 4FYWB 5DDOC 2DNYA 4IRKA 4NEYA 3FBFA 2AT1B 2E5JA 5F0WA 4P7VA 5GAHI 2ILYA 3KWMA 3OR2B 1KEKA 4ED3A 4DR1J 3ZTRA 5LM7E 4IH7A 3K5MA 4CH0S 1K1SA 1X31C 2OJ3A 4CLLA 2J6SA 1Q0NA 4HACA 2BW2A 4RO0A 5AE1A 3EGWB 4B9LA 2B56A 2KVIA 1R8PA 2MQPA 3M8SA 1XMOJ 4J9LA 3EGNA 3JTOA 3KHHA 1C1BB 4YHHF 2LECA 4GKJJ 5J2QB 1U49A 4BS2A 1LKZA 5ETSA 3I0RB 2MJUA 3NG8A 2MZRA 2Q3PA 2AGQA 3ZXWA 2ZM6F 4IFYB 4ED6A 3HHKA 3IWXA 3H25A 1S6OA 4DPOA 2BKPA 3CO9A 4L76A 4LSLA 2AGPA 1QVFR 3H2VE 4XDCA 4CTAB 4ELUA 2EI5A 2YKAA 2KO1A 2N7CA 4V19J 2I6WA 2QA4G 1HNZF 3A3PB 3MPVA 2FD2A 2R2SA 4UY85 2XMJA 3KK3B 1EETB 1HBOB 4QR2A 3QFHA 3SQOP 3SV3A 3DGPB 4UTGA 2DNKA 4YB6A 5F8LA 3T1HJ 2BM1A 2HNDA 4RPFA 2H5JB 4YEAA 2UVRA 5B0CA 3PO4A 4IR1A 3NL0A 4RLEA 1NHKL 4WU3A 1ZZFA 1FDBA 1FRIA 5JXSA 1ZAWA 3A4TA 4BHQA 2FJEB 3W61A 1NPPA 4DSFA 3AA8A 2ZVSA 4DX8H 4Q45A 1R0AB 3DYAA 2UXBJ 1FVSA 4IH5A 4B9SA 3HZGA 5KFCA 2G0JA 5E0OA 1UMJA 3TZXA 2JJ4D 1UP1A 5LL6d 1U7LA 2IVMA 5B0DA 5LJ5Y 2VQEF 1MMNA 3R5BA 4NMLA 1IKVB 1JLFB 4PXEA 4ZVFA 3LWLA 4DSEA 2BANA 4EYHB 1X4BA 4RUHA 2CWKA 5T7LA 4MKVA 3W62A 4CT9A 3RB0A 3C2PA 4IOBA 2F8EX 2KXFA 3SIPB 2J8SA 3JQMA 3C14B 4LIWA 1YJ9S 2QLBB 2VFUA 5G0RB 4M5JA 4QIWD 1TR0A 2OO4A 5KT2A 2D1CA 3BQ2A 1DLOA 1N5VA 5FD1A 4B9UA 2OSQA 2HNYA 1YHQS 2MZTA 2JWNA 9ATCB 4GVLA 4NA1A 3X3UA 2NSBA 4TU9A 3K17A 5KFHA 2HGMA 3I0SA 1N36F 3VZHA 2YWEA 3OXGA 1JKHA 2DO0A 1CQMA 3J7Z5 4OX6A 5KT7A 3JYTA 5CD4A 4OX9F 4DCPB 4I7FA 4WIIA 1VQ7S 4CLPA 1KWMA 2OHDA 4JI7J 4GVBA 5AXKA 4NLVA 2AEMA 4L75A 2NLWA 3D6FB 2LXFA 2J0WA 1N88A 4C0OC 1X9MA 1J5OA 4OZ2A 4ECXA 1X4EA 1SB6A 1WDTA 1VQ5S 1EARA 1LQ9A 3A8JA 4CM2A 4NLSA 1RYSA 4X65F 5M2RA 1TK8A 2AJ4A 4XDDA 4V19X 4ECSA 1CULA 5AXLA 3ZNJ1 1WWHA 3QIDA 2KB2A 3SSSA 1N33F 3ILJA 3GCXP 2DPIA 1GQEA 4PPZA 2X51A 3G71S 2V4RA 5LMUJ 1Q7YT 2ATLA 5J2NA 3VAJA 4IG3B 2EEYA 3NLCA 1D09B 4ID5A 4LQ9A 5KT3A 3N4WA 1EAYC 1SV5B 2EKNA 1RLDA 1BQMA 1MROA 1KS2A 3KNAA 4I2PA 1URNA 2HQCA 4RUAA 2M3DA 4DI6A 1XR5A 3OTCA 1WACA 4B9NA 1HWUA 4GRSA 4OL8A 2WSEC 4HI2A 5KT4A 4DV0J 3PYEA 5CCLA 2XI3A 4OYBA 2BE2B 4E98A 4RNHA 2OPPA 2OPSB 3P8BB 4B3MF 3DLEA 5ETPA 3TAMB 4ZPBA 4CO4A 2DT9A 2H4YB 2IMOA 4KB7A 4DSJA 2IAJB 2FDNA 1XNRF 3WBZA 2AU0A 1I94J 4EO8A 2UUWA 4JI3J 4Y34A 4OZNA 5HJYA 5H9EK 2A0FB 2WONB 3CTRA 3BEGB 1WF2A 4M94A 1HLWA 2I9SA 1RWWB 4F4ZA 1W26A 4PKDB 2GMHA 2V8PA 1UW4A 2L3MA 1UEKA 2CPJA 1IM4A 2BW7A 5EWEA 1FDDA 5KG6A 3ZFVA 3GV7B 3VGTA 2DNQA 1MMLA 1PC4A 3CVKA 2A2CA 4CO2A 1WOPA 2R7QA 3I96A 1F2HA 3L7UA 1U8SA 4FKYA 2YNGA 3T9ZA 1RHQB 2GQ2A 1VMBA 2AJ0A 3MAAB 2UV8G 1OPZA 2IM0A 2RB7A 3FBEA 4U95A 5KFEA 2JDJA 4YY3J 3TX0A 3N5FA 3T6JA 2AJFE 1I5OB 2DR6A 4FZVA 1ULRA 3OL8A 2DTJA 2KZMA 2LEPA 2MZJA 3UWTA 4GC6A 2C2ZB 3KJQB 5A8WA 3RZAA 5E7OB 1KQGB 1TKDA 4KGZB 2YX1A 2W9BB 2E29A 3ISNC 5J2PA 3V81B 3KK1B 4WE1A 4WYWA 1UA1A 4LF7J 5KG5A 4ZLPA 2BDPA 3MECB 3KLGA 3KUGA 3O6QA 3KLEB 1PO6A 2APOA 3CD7A 1U48A 2VU5A 3OTOJ 4IR9A 1RWMB 3Q8UA 3BKTA 2KZZA 3B4DA 3NGDA 5JVHQ 1G4CA 3PACA 3E01A 4X62F 4P2FA 1UVJA 2B4VA 4C11A 2ACYA 3ZZTA 1Y5IB 3UR3C 4OJ3A 4OYZA 5EGYA 4U8VA 2A6MA 2DGQA 3NCRA 1HI1A 4U9RA 3BM7A 2L48A 2FTRA 1P8GA 3Q8YA 2UUBF 1WI8A 2IYIA 2VG7B 4WP3A 1HFEL 5F8NA 3NGRA 2G4BA 5AE3A 5EHHA 1BE4A 3VGSA 4OJ1A 3TAQA 4KKOB 3MEEB 3QWPA 1VC6A 4A8KA 1KC8T 5KFVA 3O44A 3H8YA 3ZZ0A 3LAKA 2RDJA 4YOEA 5KG7A 2B8QA 4F02A 1WKJA 3N6MA 1CS4A 4EU0A 1KQKA 3LP0B 3EPGA 1MLAA 7FD1A 2QX0A 3R7NB 4DCOB 4FYDA 2UUAF 3M30A 4KIAA 3VGVA 2ZDPA 1LNQA 4P74A 4DFPA 2HWTA 3DMJB 3MFHA 4JI4J 2U1AA 3UN5A 1N34J 3A13A 4USTA 1WSVA 3CJ2A 2FVSA 3J7YI 1GH8A 3T41A 1QAXA 1U1RA 2RKIB 5KG1A 3DRYA 2YNHA 1DURA 2IC3B 2XSFA 4ZPCA 5K8PA 1S0OA 2LU1A 5J2MB 3L09A 5AJ3J 5I42A 1M5HA 3KTQA 3ENQA 2BUNA 1TKXA 3QT7A 4NLGA 1R6YA 3FRYA 1QSLA 3KJVA 2OPRB 2YQ1A 1RHJB 3G82B 5BR8J 2NR0A 4KO0A 1RT3A 3M7VA 2NREA 1H6KX 4UF4A 4LF8F 4EBDA 4MYTA 1U47A 3CO0P 1FVQA 4DV2F 1BXNA 1W7WA 4XIUA 2VPYB 4ZVSB 5I3UA 4H4KA 3JXOA 4ELVA 4PYDA 2UUTA 2R7RA 2CJKA 5ETVA 4KRWA 2HW3A 1IN0A 4OI6A 2XM3A 3CUNA 2QL7B 3N01A 2NPFA 3JSRA 5A0YA 1T9YA 2LCWA 4RW6B 4U7UD 2BQRA 1SJ3P 1S76D 1FA0A 1TV6B 3EDQB 2XYGB 3P49B 1NM2A 5A8RB 2YNFB 5L39A 2LEBA 4C3MA 3PFOA 4WP9A 4N5SA 3OFEA 1O0PA 4M1KA 4C8MA 1RT4A 1RCOB 1XNQJ 4TKTA 5D0EA 4LUBA 2FJAB 4DLGA 2XHWA 1R43A 2GFFA 5E41A 3HO1A 1SI9A 4J37A 2H51B 1YITS 4KH1B 3DLKB 3MEGA 4MK7A 1RTHB 2NXEA 3HHLA 1C1CB 4AUKA 2ZM6J 4I0WA 1L3SA 1HBNA 1RT7B 2HS0A 2Z57B 3L7PA 1SKRA 1LXJA 2KFYA 4ZDNA 4NLDA 3UD5A 2XMUA 3QNWB 3P5TL 4CZCA 3MCNA 3CCES 3OD2A 4GKKJ 4USKA 4B3OB 3MXHP 2DR9A 3T3FA 2GHPA 1OYEA 3ICLA 4TU8A 4DL5A 3UDLA 4MTPA 4GO7X 3N9UC 2NXJA 5E3RA 1WEZA 3TAPA 1U1LA 1F6TA 2Y3YA 3NS6A 5D77A 1S1XB 5KOXA 3BGRA 4DCJB 3L3CA 2UUCF 5D15A 4RUCA 2OUGA 2VBYA 2W1BA 1FNMA 2BBEA 2YWFA 1J5EJ 5IXUA 2E1AA 1MG7A 1HNIA 2CYYA 3CJ8A 1NSAA 1U1OA 3G8QA 1WUUA 3QAEA 3QGHA 1D9AA 1T03B 3SZ2A 4B02A 1SKWA 1S12A 2GW8A 3AQOA 3N6LA 3KK2B 1V3ZA 2E1CA 3JSMA 5D4LA 2HIQA 3T5JA 5CXTA 1MN7A 1CC8A 1JLBA 4S0MA 1B0VA 3O8WA 4ED0A 5ITHA 3FSYA 3E8OA 2YXLA 1VQ6S 3QO9A 2PMZD 3I32A 1R6VA 4ZOSA 3VAIA 5B08A 2DNOA 1YLXA 1N5TA 2R7TA 4WZMA 3D1QA 1U24A 3JB9k 4AXIA 1DTTB 2JRSA 3W65A 4BCAA 2KHCA 4OYIA 5SZTA 4P2MA 2GO8A 1AUDA 1UVNA 3J7A1 2PFDA 5KFOA 4OX9J 4OX7A 2M5YA 2CQ4A 3AA9A 2DRAA 3B8HA 2CNOB 2FLLA 2WB4A 1DY3A 1ZA2B 2HIYA 4F3QA 5FLXY 3MCMA 4ID8A 2F5GA 3W3SA 1H0HB 3SI8A 5GADI 5T14A 1X7VA 3AQPA 4JUZA 4XO0A 2FC8A 3IR5B 3TZWA 3K2YA 5E3PA 1MWZA 2R7VA 2WVEA 1N33J 2AYBA 4DV7F 4TY8B 1CJVA 2CQ1A 1QJHA 4DBQA 4OYPA 2W2QP 4LRAA 4ED7A 1FTRA 1ZAXA 2MDAA 4JBCA 2BV3A 1Q16B 1F2GA 3MMBB 3H98A 3KFWX 5D0GA 4NI2B 4I6YA 3HULA 4JI2J 1N5QA 3R97A 3NWRA 4GMKA 2RU9A 3MPWA 3VAMA 3HSJA 5FDLA 3PX0A 3BR9A 1S7IA 1TL1A 4USIA 2K7KA 4QIGA 5FIIA 2YY3A 2F8MA 4YB1P 4PQUA 4F04B 5BYSA 3NGKA 3C46A 3LF0A 1C1BA 3QGPA 5DO2A 1G7CB 1P9YA 1RADB 3PDNA 3HLUA 3SCJE 1RWOB 1Z4UA 1S9EA 1MW7A 2CJAA 1HI0P 4DSIA 4HH0A 2KL8A 1XNRJ 4ED1A 1V9OA 4PUOB 4ETZA 1S72S 1IBMJ 3HJVA 2XMKA 4K4UA 4NL5A 1T9WA 3SQGA 1PIEA 4U7UK 2ZZNA 1ZPWX 1VYAA 1NJZA 4ZMMA 3C66A 4LF4F 2YKMB 3TA1A 3TI0A 3UD3P 4TXSA 1M5OC 2MXYA 5HVGA 1EETA 1HBOA 2CPZA 4DR4F 5I3QA 5EWGA 3EGZA 2GGPA 3ONQA 2G1DA 2J7WA 2WW4A 1S1WB 4LSNB 5L38A 8AT1B 4N47A 2J6TA 5AXNA 3MR2A 2N3OA 2NUHA 1SQGA 1N5YB 3QATA 4A8WA 2VQFJ 3OHBA 2PFFB 3JQJA 1FDAA 5KOWA 4DX7A 2DHAA 2WVBA 4NCAA 2BYCA 3MPYA 4L74A 5D3GB 4DR7J 1VR6A 1RHMB 3VWSA 1R0AA 3C19A 4J9UE 4ECQA 3E51A 2X1AA 1REVB 3UO0A 1OO0B 4TNOA 1SPBP 3HM9A 5KTQA 1B7YB 1H38A 1WG4A 3MHYA 1U6BA 5CYJA 2GVDB 2F40A 1JLFA 3W64A 4CDIA 2QYGA 2DK2A 3TOQA 2J9DE 3VCDA 3PZPA 4WFYA 1IBCB 3C14A 4XK8C 3A1YG 3HF5A 4ZVEA 2BOPA 1YJTA 2ZH9A 3O3LA 2Y8YA 3NGSA 3LP1B 4RJVA 4DU8A 2Z8QA 3MAHA 1YQHA 5IV3A 3A3OB 2CJXB 3KLIB 1IJEB 4OJGA 2W8KA 5D4PA 3BZQA 4CCHA 5GAHU 2IDEA 4AT1B 4X62J 3QZ8A 4MKYA 4Q0BB 4USHA 5EDWA 2W2PP 1FEHA 4OX8A 4CWBA 1FK9A 2B9WA 3R7SB 1UTAA 3ZO7A 1BMQB 1FKOB 2V8GA 2AJQA 3H40A 4C9DA 1HW8A 2ZC3A 2UUBJ 1VQ4S 4DL3A 2HQIA 1SQEA 3CJSA 5J1EA 4FBUA 1OIAA 4HVZA 1RXOB 2FHKA 2JVRA 1OY9A 3D67A 3EVOA 3Q8SB 3L4BC 3CMES 4K7QA 4DQIA 4C2MA 2O5DA 1AXQA 1FD2A 2YH0A 1QE1A 4NZ6A 2J0XA 3B4MA 4DL7A 2CQDA 1HWIA 1ACMB 3V4IB 2ZBQA 2ASDA 4DV5F 3DRPB 4FS2A 2XZDB 2Q79A 5IV4A 2X7IA 1UFKA 3U1LA 4M63A 1GXUA 1K1QA 4OHVA 4ECVA 2OFGX 4PG4A 4H4KC 4LF6J 1CPZA 4USJC 3K0JA 2UUAJ 4OZ5A 4LBPA 4KPCA 2CPXA 3VQTA 5ETQA 3TUJC 3BYRA 3POTB 3GIJA 3NY0A 2RUGA 1G2EA 3PRDA 4DPWA 3GYNA 3MD3A 4ZHRB 1B4SA 4DL6A 1Q8IA 3QMQA 3MM9B 2V68A 2OAUA 3TAMA 2G2ZA 3BV8A 4IKAA 1V3SA 2E7WA 5JMNA 4F2SA 3BF4A 1FX2A 1S1UB 4DS5A 1NB2A 2EG2A 1B70B 3BSCA 2YKPA 4Y2KA 1BHNA 4OQJA 4JV5J 1UCNA 2VA2A 3JS9A 1ZAVA 4ZVGA 4DX5A 1SXLA 2WONA 2QSFA 3OJSA 3NKYA 4DV1F 2RUSA 2XTJP 1NBEB 3GE9A 4R8UB 2W9AA 2CUYA 3OR1B 1YK9A 4IRCA 2J9EA 2DH9A 3CIMA 2VKZG 2AX0A 1QAIA 6AT1B 4PR6A 4LF8J 4OZ1A 4N7TA 2KN4A 2UXDJ 1FWLA 5GMDA 5L1JA 3BH6B 2AQ4A 4B9TA 2VPXB 5HQLA 2M4MA 2GNKA 5BXIA 1RTZA 4LR8A 3DKDA 2QYCA 5KFUA 1PCAA 4K4TA 3T1YF 3FC9A 5F9NA 3GPAA 3Q2TC 4UT4A 1RAAB 1UEVA 4NXMF 1SJQA 2OTJS 1HD1A 1H2UX 2WSFC 1MU2A 2XYPB 1X60A 2FY8A 2BXJA 3S6EA 5M2PA 1QSSA 2KG1A 3QT6A 1ZM3A 5H9FJ 3V6KA 1LFPA 3J7AN 4UY8T 1L3UA 2I1RA 4DOZA 2W9BA 4Y2IA 2ATCB 2LA4A 3V81A 2C1EB 1NNDA 2MQMA 4DV3F 3V6DB 2V63A 3QSYB 4Y6IA 1U25A 5CD4H 3CCWA 3KLEA 2YH1A 1YZ6A 3VAFA 2JLGA 4OYAA 3CNQP 5ETLA 1J27A 5H9FK 1S0VA 4WXOA 2A10A 1IXKA 4ICLB 2XS5A 5F9LA 1F5CA 3JAMY 3R1HA 2K8GA 2F4VF 1T9UA 3D0GE 3VAHA 1JXEA 2F8HA 2UP1A 5MAOA 2DY9A 2R8KA 2H65B 2JLFA 3M9OB 2MLYA 3VTIA 4OZJA 5C2GA 5E2QA 4NLQA 1YGYA 4A8YA 3DC2A 1JJ4A 2P9GA 5KFAA 2D9PA 5FLXU 2VG7A 3B82A 3TUPA 4ZLLA 1RI7A 3KLHA 2GC8A 4F3MA 3UVJA 2UUCJ 1GX6A 2CJQA 3V2UC 3MEEA 3CXCR 2FLNA 3GLJA 1VK8A 4I64A 1C4CA 1SIWB 2L41A 3EPIA 2AP6A 2ZH6A 1RSCA 3P6YC 4CRJA 3BN7A 1F9HA 4X4RA 1S9FA 1YZ7A 4W98A 3M2UB 5CYMB 1FE4A 3LP0A 1SUQB 1QSYA 1DTQB 2BX6A 1HBUB 3G9CA 3LPYA 3J7ZT 1UZDA 2FVRA 1CJUB 3PJWA 2YX7A 4KR0B 1YSJA 2FJDB 3DMJA 3JQKA 1JJHA 1FCAA 3FRZA 5D8HB 4MFBB 1HPZB 3A8KA 3U1NA 3ZZRA 3QIPB 1U6ZA 4N77A 3ISZA 2GIFA 5HMZA 5DG8A 3TJAA 3CMQA 1QAYA 1RT2B 2WBRA 2W9CB 1W2IA 1DFDA 1WTFA 2HNZB 2IPOB 3HD2A 4DR5J 2RKIA 4B9VA 1NO8A 4WKYA 2ZC4A 3K89A 5J2MA 4JV0A 2ZOFA 2VIHA 2HWHA 2GS8A 4Q2MA 3CB4A 1N54B 3TNVA 3QGGA 2QG9B 1CJTB 1U0HB 1UW9A 2DBBA 2W4DA 4EGLA 2CPFA 2OPRA 4ZP6A 3G82A 4NLXA 1KP6A 3IXQA 3I4PA 1M5PC 1S5ZA 4IO9Q 3DRSB 1X5SA 3PW7A 1E6VB 4KFBB 2KM8B 4DR1F 4PEOA 3SDEA 5DRKA 2OELA 4ED2A 4IDKB 2B0GA 4XAKA 1S77D 2E9ZA 2QN6B 4KSEB 4QPTA 1WEYA 2DKOB 3GR0A 3UN2A 3UR0A 1XMOF 4ECUA 3V6JA 1Q5YA 1F3VA 2H1YA 2DGVA 4GKJF 2RQ4A 4P75A 5KFXA 5BJRA 4JI8J 3D3CJ 4B08A 5D4OA 5A8KB 2DGWA 1PBAA 3AB4B 2ROEA 2K7JA 4C8NA 2DNNA 4DF4A 3GCWP 2IMWP 4IQXA 1VDHA 5KFKA 3LALA 1TV6A 5F8JA 1ICEB 2MPUA 1GNKA 1HNVB 5A8RA 2W7PA 2OD6A 1EP4A 3G4SS 4HHJA 2GJFA 2ZBRA 5HN0A 3KHGA 3KUHA 1RTJB 1P9QC 3K8VA 3EE3A 2OIHA 5KFBA 4AQYF 3EDRB 3VHQA 4K4VA 4YMEA 2EC2A 2IJNA 1RU2A 4P73A 1Q95G 3T1HF 4NLUA 1C1CA 1HKAA 2HHWA 2XCPA 1IKXB 1M5VC 2AW0A 1XN9A 1CSJA 3WC0A 1GMUA 1HIYA 2QL9B 3BGOP 2Q43A 1Q4RA 1PJ7A 2ZOGA 3FUYA 4HDGA 2ZH2A 3A3NB 4MK8A 4I2QB 4ERDA 2UXBF 2EPIA 4ZKAA 1KDNA 3CSKA 2V4QA 1DZ5A 3R7BB 1Y00A 2AWZA 3RG6A 4C8YA 4ZCKA 1GX5A 4JI1J 2AEJA 3TANA 3DNCA 1S1XA 2CNLB 4LRDA 1YJ7A 4AE5A 4YN3B 2YVSA 5HMWA 4QW8A 3CCRS 3PYGA 3G86A 4HH1A 2CPEA 3DU6A 2ZD1B 4L3NA 3CJ4A 4ECTA 1NPRA 2QIFA 1BY9A 1T9XA 3Q2SC 3EWGA 4QBUA 2DR8A 2GMLA 1KOOA 4F4AA 5HQMA 2JSXA 3IGNA 3W5ZA 4OHZA 3CC4S 1HQEB 4ED5A 1FRJA 1BWVA 3VAGA 2WSCC 2RT3A 2FLOA 1TKZB 1M5KC 2NUUG 1FRLA 5KAKA 5JVGQ 3TQEA 3FEXB 3CULA 4A8XA 4ILRA 3BR8A 2CG4A 3MM5B 4FXWA 2R2RA 1S79A 1Y3JA 3OW2R 1X9SA 3IAM9 4F0MA 2G9OA 1JK9B 3AHPA 5F8HA 2Y0SD 5B0BA 1DTTA 1IM6A 2LDYA 4NZ7A 3HFZB 3G8SA 2HVHA 3X1LB 2QMWA 1KVJA 4C8ZA 2DXFA 2EK1A 2FJWA 2MQ8A 4TLQA 4LBIA 4C48A 1XMBA 5LMUF 3RW7A 2CVEA 1S6PA 2V9KA 4C0BA 2HBQB 5LSLA 4LF9F 4FYVB 2BABA 3ULHA 4PXCA 2CDRB 3NEKA 4HYKA 1YJVA 2HZCA 1OYDA 4LBHA 4OLPA 1TL7B 5IT9Y 1JLGA 2EBGA 3BPDA 3MMCA 3C15B 1GTEA 2PSZA 3VVUA 1RTDB 4P72A 4Z2XA 4EYIB 1R27B 3C6UB 2J6UA 1B7FA 4OYMA 1OSCA 5KFNA 3KXDA 4OJHA 2N7YA 4TY8A 3DI6B 2YWGA 4K0KF 1U1NA 2DO4A 2CPYA 2GIRA 3HHEA 4NA3A 4ZPVR 1TL5A 1GK8A 3U1MA 4FNHA 3VV2B 2RVJA 2JH3A 4HEA9 4PWUA 3MMBA 1I94F 4CO5A 3D0HE 1C2PA 2LFVA 4N8OA 4NI2A 3HFKA 2CJ9A 5HBMB 5CYQA 2QLXA 4CH7A 1IBLF 1WNEA 3HVTA 3WIUA 1X4FA 3W2VB 3M8PA 1Q81T 4M5DB 2B43A 5LOQA 2E1MC 5A6PA 4WJBA 2NSCA 1CC7A 4OI2A 3DM2B 2XY5A 4X4NA 1QY7A 3MM7B 2MSSA 1P1TA 1XJWB 2N82B 4HR2A 3MMAA 4MAKA 2RF2B 2MKYA 4RW7A 1T05B 5KFTA 4NLWA 3RTVA 2VASA 3DLBA 3RR7A 4O44B 3HHDA 3N79A 1UKUA 3TEGA 1NMEB 5I4MA 3JAMU 4FF4A 1UEUA 2PI4A 4OYOA 3CCUS 1KHWA 4RR5A 2W2OP 3RB3A 2ZITA 3IBFB 1LW0B 2HBRB 3UFCX 4DV1J 3RAQA 2VKRA 2HBZB 2NPIA 3UCUP 1JNZB 4ENOA 1RAGB 4YY3F 1NHVA 1TL4A 3MM6B 4RNOA 3H4BA 2GCFA 3C16B 5HJXA 2X1GA 1S1WA 2E5LJ 4KGKA 3RB4A 1AT1B 1UVKA 2C2KB 4H4OA 2VOPA 3W1YC 1OS5A 1N5YA 4NE9C 3RB6A 4X2BA 3RBDA 3OL6A 3MM8B 2VFSA 2F3JA 3CJQA 4LF7F 3BO4A 3OUYB 2EBEA 1FO1A 4UOGA 3RW6A 1SC1B 5B0GA 1SC3B 1RT6A 4NXMJ 1NU4A 3D66A 1A9NB 4DDFA 1FHTA 4DU7A 4UUXA 3OTOF 3ET6A 2HPUA 2KKHA 1REVA 2O1PA 2CQBA 4ZVUB 1VCTA 1N0VC 3KMSA 3Q24A 4CLFA 4FBTA 1VRTB 1N48A 2F9JA 1OY6A 2VG5B 3OT9A 2ZFHA 2K3KA 1IBKJ 3HT0A 5GADU 3MEDB 1XR6A 5K14A 2HSEB 4N8NA 3TA2A 2ZH4A 3OJUA 4ZP8A 1S1TB 3KDOA 3MMJA 1RCXB 4DV3J 3MR6A 3H5UA 5IOLA 3L9ZA 5C5JA 1S9GB 1IQTA 2HHXA 1KFSA 4OYXA 1RHUB 2YNIA 4WFZA 4CI0B 3DLLQ 3GIRA 2IM3A 2MY8A 3OHAA 3FSIA 2F4VJ 3R27A 3PG9A 4IG0A 2FZKB 1NKBA 4TQSA 4MK9A 1NH8A 3SCKE 1H73A 1VIOA 4P52A 2MQOA 1IQZA 3THPA 1O5JA 2IJFA 5EN1A 2WOMB 4DLEA 5KT5A 2FJVA 3SXLA 2GIQA 4JI4F 3VR1A 3AAWB 1T9TA 2QMXA 1EJ7L 2DXDA 3ILLA 4HHHA 2XB2D 4ANEA 1JLEB 5KFRA 1OQ3A 4C3LA 4O23A 2CJYB 2SXLA 3BN4A 3V4IA 5HO4A 4DPXA 3PM9A 1VLYA 3IM8A 4NXNF 1TL3B 3RAXA 3DHXA 3EYZA 3FVYA 1SC4B 4FF1A 4ZP7A 2FZGB 1PJ5A 2CAJA 4P7TA 2ERRA 2FB0A 3NRBA 2YKNA 2ZUGA 2HFZA 3KNGA 4XPEA 2AIRB 3CWJA 2OH2A 2V0NA 3PHTA 3MR7A 3PYFA 3NNHA 2XBPA 1UFLA 3BSAA 3RAMA 4ZHRA 4DXLA 3CCSS 3PKYA 2RDDA 3WX8A 3OPKA 3QBCA 4HACB 2IJRA 2QEXS 2KRRA 4HDHA 3D0IE 2Y1LB 1RB0A 5HMXA 4JI6J 3W8GA 3CJKB 4USMA 1S1UA 2OPQB 1U1PA 4TY9A 2IYGA 2V69A 1IR1A 2CQPA 1X5TA 1NB7A 4KBIA 3EX7B 1TQLA 2G2YA 2VPZB 3GMGA 3BDPA 1NK6A 4HI1A 3HHNB 1FX4A 1NDKA 3BS9A 2DR7A 5B7WA 2QO3A 3CD6S 4LSLB 3OSNA 4A4JA 2V6AA 3CD0A 3IBWA 2MGZA 2ABYA 2DNLA 1LW2A 2DJWA 2XY7A 1YBUA 4Q7AA 3HMJG 4P6QA 4KPYA 1KQSR 2RS8A 4Z7YA 4ZIWA 2CQHA 1XNQF 1KSPA 2LQBA 2AF6A 1WC0A 3RJMB 1CG2A 2W01A 4ZPAA 2E7XA 1NZAA 3FEYB 2Y9HA 2I5JB 1A7GE 2J9CA 2C22A 2FVPA 1DQAA 2FIUA 7AT1B 2KU7A 4K50A 2KI2A 2DHGA 4CM0A 4DR2F 1UJ6A 2ZHAA 3DYAB 3MOJB 4ATNA 4QCLA 4JI5F 2CQ0A 2HHTA 2KJVA 1PBUA 3W9JA 4Q44A 4F4XA 4GKKF 4PXBA 2VHGA 4TQRA 2HRUA 4DPTA 4MKBA 1FD8A 3H2UB 1S7HA 2V8HA 1M90T 3I87A 4AQYJ 2KVQE 3JTPA 3ENAA 5C24A 2P8IA 3DN9A 3NAHA 3ENWA 2C2RA 3OFHA 1UJ4A 2X1FA 2ACMA 3KJFB 1HW9A 1R89A 1NSKL 1REGX 2KYZA 2HWIA 1PC5A 3Q8PB 3BBFA 4RBVA 7FDRA 3A12A 3M6WA 1H72C 1J5EF 3D68A 2LQ9A 2AZ3A 2CQCA 5RUBA 4J7CA 1FJGJ 1YJUA 3PR4A 2D3OR 1TKTA 4JI0F 2RMLA 2DISA 1LK5A 1JNRB 2R8HA 1F9EB 1HNXJ 3KDNA 1RKJA 2XY6A 1ZTWA 3I0SB 4FF3A 2DD8S 1P27B 2R7WA 1BQNA 1HARA 1Z1ZA 2MQNA 2QE5A 3JYTB 2DGSA 1HQUB 2YWKA 3F44A 3RBXA 2IA6A 4CNZA 5IT9U 3EXYA 4GVBB 2O67A 3M6UA 1XC9A 2F65A 2COLA 2VC1A 4J9VA 2PC6A 4C8OA 4KT0C 5DG9A 2Z30B 2DHXA 4A8SA 3R5AA 3LW5C 4KC5A 2C2NA 1UVMA 4DSLA 2JHEA 5CYMA 1OMSA 1RK8A 2B3TB 1SUQA 4KGMA 2VBXA 2EVZA 5J1PA 2LQ8A 1HBUA 5CAAA 2HFNA 2DIVA 1PJ6A 2RHSB 4HTJA 3NP5A 1BWEA 3UDCA 2J0SD 1CJUA 3HVWA 3K58A 4IH6A 2W25A 2RRBA 2PT0A 5J2NB 1Q53A 1VQOS 4DFKA 2M8DB 1B3TA 2ZH7A 3QIPA 2P2CB 1BQMB 2LLZA 4WPAA 5KFZA 4C4WA 2IVFB 2ZBPA 4I2PB 3HXMA 3QAUA 4QYZJ 2RRAA 2A18A 2AJ1A 4DZ6A 2CNKB 2HNZA 5DLFA 5HROA 1WDDA 4L6V3 1AZSB 3M8QB 2HVEA 5D6GA 1SKUB 2XZWA 3W5XA 3PO5A 5K9FA 1FI4A 1S0MA 1JJCB 3GSIA 5MLCV 2OPPB 3UNGC 3PIOQ 4RW9A 2HHHJ 4PG5A 5GMEA 1U0HA 3BYPA 3LGHA 3SV4A 1KFDA 2R2UA 1Q78A 5GAGI 5KFSA 4LF9J 2MKCA 4M5MA 1Z2ZA 4MIWA 2ZBIA 4HKQA 1E6VA 4KFBA 1EB0A 1JB0C 2ZWPA 4P2XA 3CMAS 3T1AA 4JI2F 2JOQA 3ZTSA 5DS7A 4JB8B 1FE0A 2VUGA 1A6LA 4LJMA 5D0HA 4NMXA 1Q79A 5KFFA 4AL7A 3EMTA 4EO6A 1UWBA 1N6QA 1WELA 3F41A 1MNEA 2Q66A 4K0KJ 1UAWA 3UNYA 2X3GA 1XMQF 1TZ0A 4E2FB 2XEXA 2LKZA 5A8KA 2I0XA 2CPHA 1WI6A 1HQ2A 2E7VA 4UUWA 2YNGB 1EZZB 1KHVA 4M5IA 1IBMF 1FRXA 3ZZPA 3R5CA 1NK7A 4DR6F 4X64J 1D0EA 2CQGA 1HNVA 1Q86T 2W2MP 1IBLJ 4BC7A 2LA6A 3MPDA 4O0NA 4Y28C 2E5HA 1C0TB 2JNJA 2BKNA 1UL3A 3BDEA 4O3RA 4EZ9A 2ZE2A 4F2RA 2D69A 1VFJA 5JJBA 1T02A 5K8MA 2L08A 5J2PB 4WE1B 3KYLA 2VA3A 2VQFF 1TTHB 1IKXA 2VZ9A 4FP9A 1IVZA 3IG1B 2C42A 4IYQA 1TUVA 2R7XA 2HK3A 2KXHA 2FLPA 1XQIA 1OQ6A 3M1VB 4IFVB 4I6AA 2B6AA 3N0VA 3I82A 4DR7F 1NK9A 2PO4A 3KUEA 1VBYA 4G1QA 4I2QA 1G6BA 2VBWA 4QR1A 4U7CA 3ZZOA 4RX6A 3BJYA 2JFKA 4R25A 1AFIA 1YRXA 1YVFA 2V2ZA 1RP5A 2D3ZA 3E01B 4I69A 4B9MA 4RL1A 4D3GA 1D3WA 3AODA 3Q86A 2HAFA 1RAHB 3WHIA 1B99A 3I9V9 1TMJA 3BQ1A 1FRHA 4EWTA 3LO3A 2GV1A 3FCWA 1KVIA 2MHEA 4ECYA 2ZD1A 4K4SA 1HYSA 3H5XA 3HK2A 2JEFA 1FTCA 4QIVA 4KHMA 1FT8A 1R8HA 5ADZA 3P45B 3JTNA 2CDQA 3M8RA 1Q5VA 4AYBD 1DRZA 1RWXB 1SJ4P 3D7SB 1WF1A 1RUSA 2XNRA 3MR5A 2FGOA 4F4KA 3W2WB 3BKUA 2CNNB 2VJVA 3GG0A 4TU7A 4LSZB 3EVWA 3PRBA 1IWGA 1B0PA 1NHUA 4DF8A 3MM5A 3NMRA 1RAEB 3DRRB 2HHUA 5LT5A 1SCJB 4CLTA 2Q6BA 1Y10A 1H3DA 3G8TA 2EFVA 1VHFA 4DPUA 3C6TA 2QA1A 2YNHB 3GJQB 4FXVA 1FF2A 2C2DA 4PRFA 4X84A 5I42B 4O4RA 2ASJA 3BSOA 1PSDA 4IQMA 1TFYA 4LF6F 4QQBA 4NLTA 2ASLA 2V67A 1UJ5A 2R8JA 2RU3A 1NXIA 3QLHA 4ZVOB 2ZJPQ 4EZ6A 2KT3A 3MCSA 2ADBA 4GC7A 4KE5A 2BE7D 3VQSA 4KO0B 4ZJQA 1RT3B 4H54A 3C15A 5IQQA 1MMDA 1NDCA 2VFVA 3QQCD 3C6UA 3CCMS 3ZZZA 3DCAA 3OTBA 2ROPA 3DI6A 3CC7S 2GHWA 1SIZA 5I3UB 1UWAA 4NXNJ 3ILIA 1FNXH 1MWQA 2XS2A 2DCLA 2HZVA 4C3KA 3CC2S 4ZA1A 3CCZA 3HCXA 3NGUA 4K2XA 4B3SF 1WJ9A 4JV5F 1Y0HA 3GFXA 5HQ8A 1YRTA 4OV6A 2QL5B 2CRLA 2XO7A 4F7VA 1FESA 3K59A 4FDFA 5HBMA 2HS4A 1VBZA 1NKEA 3OLBA 3FKBA 4NLYA 5A0YB 2DNGA 2V9WA 2WCXA 2P6TA 3W2VA 1VRUA 2AYMA 2BR0A 4ES3A 4J9RA 6FDRA 1UPMB 5HAOA 4ECZA 2U2FA 3CDWA 3DM2A
chains in the Genus database with same CATH topology
1WTFA 4G6VB 2HNZB 1T95A 4WFXA 2MZTA 2JWNA 3WC2A 2RKIA 3CJ3A 4B9VA 3BO3A 4NA1A 3X3UA 1NO8A 5CA5A 2NSBA 4TU9A 5HP1B 2VG6B 2NZ4A 4WKYA 3TQ1A 2RF2A 2ZC4A 5KFHA 3PY8A 2HGMA 1S6UA 3I0SA 5J2MA 1N36F 2UXDF 3VZHA 2Y1JA 4JV0A 2YWEA 3OXGA 4LSNA 1JKHA 2WB1D 2DO0A 1CQMA 3J7Z5 1RT4B 3C3LA 2ZOFA 2ZNYA 3OSPA 2HWHA 1SC6A 4OX6A 2CVIA 2D3UA 5K14B 4AXJA 5KT7A 2YKOA 4Q2MA 3JYTA 3CB4A 1JX4A 3SFUA 3OTEA 1N54B 4OX9F 2GQQA 4I7FA 3DFEA 4WIIA 1VQ7S 1YJRA 3TNVA 2WTFA 2W8LA 3MF5A 3QGGA 2DGTA 3FFIA 4MIAA 2RJZA 2J76E 2DBBA 1LWCA 2W4DA 4EGLA 2LVWA 4WF9Q 2H9ZA 2CPFA 2OPRA 2WRMA 5AXKA 1DARA 2ZH8A 2GQCA 3DLGB 4NLVA 5LSOA 2HMIB 4ZP6A 2E9TA 4J9KA 3HHLB 1LXNA 1LW0A 4RW8B 4CT8A 3S8SA 1RTIB 2NLWA 4CO0A 1HHTP 2LXFA 4NLXA 2J0WA 1N88A 4OI0A 4C0OC 1X9MA 2MMYA 3IXQA 1J5OA 1X4HA 4ECXA 4Y2CA 3I4PA 5D3GA 1M5PC 1X4EA 1Y7PA 4IO9Q 3DRSB 1X5SA 3PW7A 1E6VB 1SB6A 4KFBB 1HBNB 4WK3A 5KT6A 2KM8B 1VQ5S 5KFMA 4DR1F 2KJWA 1LQ9A 2W24A 2YNIB 2RS2A 4NLSA 3KG0A 1RYSA 4X65F 3SDEA 5M2RA 5DRKA 3T5KA 2AJ4A 1TK8A 5H1SV 4ED2A 4X4QA 3D2WA 2BJDA 4XDDA 3TVKA 4V19X 2VODA 4IDKB 3PX4A 2XWXA 4DWIA 4ECSA 4IG0B 2B0GA 5AXLA 3B78A 4XAKA 3GFYA 1S77D 2E9ZA 4KSEB 1WWHA 2CPDA 3QIDA 2KB2A 4QPTA 4O4GA 5HI7A 3SSSA 5F8IA 1N33F 3VAKA 1WEYA 4QR0A 4UQGA 4DR3F 5C42B 4K4XA 1BLUA 2DPIA 1GQEA 4PPZA 1KLNA 1RT5B 1S6QB 3E3XA 2X51A 3GR0A 3K5LA 1WHXA 3UR0A 1XMOF 3KOAA 3G71S 3CE8A 4ECUA 1ZM4A 2V4RA 3V6JA 1U6FA 3CEDA 1Q7YT 3MWBA 2DGVA 2ATLA 2RQ4A 4GKJF 5J2NA 5KFXA 4HT7A 3BGRB 3TYTA 5BJRA 3OUYA 3VAJA 4IG3B 3NLCA 4ID5A 4B08A 3HKWA 5D4OA 1VQ9S 4LQ9A 5A8KB 2HHPA 5KT3A 5IT0A 2DGWA 3AB4B 3N28A 3N4WA 2ROEA 2K7JA 3HX9A 3PNIA 1SV5B 4C8NA 2DNNA 4DF4A 4KJIA 1BQMA 2EW9A 4OI4A 2XLIA 3GILA 4DS4A 5KFPA 1MROA 2M0GB 4DUYF 4ZP9A 2IMWP 3IRWP 1KS2A 4CH1A 4IQXA 3KNAA 5KFKA 3LALA 4I2PA 1URNA 2IBKA 3LP1A 4RUAA 3DOKA 1TV6A 5F8JA 4ZS6A 2M3DA 2IM1A 3AH6A 1XR5A 2MPUA 1WACA 3OTCA 4A47A 1GNKA 1HNVB 5A8RA 4LT6A 4WCEQ 1JJ2R 1H2VZ 1KLMA 1VRTA 1HWUA 5HLFA 4B9NA 2W7PA 3KLIA 2OD6A 2PA8D 1EP4A 2ZNZA 3G4SS 4HHJA 4OL8A 2WSEC 3D28A 4HI2A 5AXMA 4X4PA 5KT4A 3M05A 2VG5A 5CCLA 3Q22A 2XI3A 1U26A 3IRXB 1VC5A 3US5A 5HN0A 3L7OA 3KHGA 2BE2B 1DQ9A 3MEDA 4E98A 1N5SA 5HMYA 4RNHA 2JVOA 2OPPA 3BREA 4KV8A 1RTJB 2OPSB 4ZVHA 1P9QC 3K8VA 4B3MF 4Q0BA 3D1HA 3DLEA 3DXBA 3IS9A 2OIHA 4RWXA 5KFBA 1FJCA 3JSMB 4WXWA 3TAMB 4ZPBA 4AQYF 1NK0A 1S1TA 2MB0B 2L9WA 1WHWA 2W7OA 4CO4A 4K4VA 3D1OA 2DT9A 2AD9A 2IMOA 4KB7A 2M8HA 4DSJA 4YMEA 2IJNA 5FJ4A 2IAJB 4F4YA 2FDNA 1XNRF 3WBZA 4JV1A 1NJXA 1S4FA 3OBIA 3T1HF 3TARA 1FKOA 2AU0A 3G96A 4NLUA 2VFRA 1C1CA 3GIMA 1BC6A 4EO8A 5DDPC 2UUWA 1CQNA 2HHWA 5E5NA 2XCPA 2WBMA 4Y34A 4OZNA 1L3KA 1IKXB 2YKNB 1S9GA 1M5VC 2AW0A 3QO9B 1XN9A 4PCQA 5DGBA 1CSJA 1ZH5A 2WONB 3WC0A 2ILZA 3CTRA 3F73A 3BEGB 1HD0A 1WF2A 2Q43A 5F3TA 2HQ3A 3KHLA 2CZVC 4ZK7M 4QZVB 4M94A 5B0EA 1Q4RA 2ZOGA 1R8BA 3EUNA 2ZJRQ 4JV2A 4ITSA 2GJIA 3CCLS 4HDGA 2ZH2A 3LH2S 4MJKA 3OVBA 2I9SA 4MK8A 4F4ZA 2C3MA 4X4SA 4I2QB 2XS7A 2YTCA 3JSBA 4PKDB 4ERDA 4ELTA 2UXBF 4KQZA 2GMHA 2EPIA 4OI1A 4LIRA 2MYFA 1DBDA 1FDNA 4ZKAA 3IAS9 3CSKA 3CIZA 1UW4A 2L3MA 2V4QA 1DZ5A 4F3OA 1Y00A 1VIXA 3P3DA 5KFDA 2AWZA 2CPJA 2LDIA 4C8YA 1IM4A 1X4DA 5EWEA 1FDDA 2OLWA 2VV5A 3IWNC 2IRUA 3DRPA 4LFBF 1VQSA 4ZCKA 5KG6A 1Z2LA 1GX5A 2XMVA 2LYVA 3FNNA 3ZFVA 1DAXA 3GV7B 3TANA 4AL5A 2WOMA 3DNCA 2DNQA 1MMLA 1S1XA 1PC4A 5IM0B 3CVKA 4K5RA 2OMOA 2A2CA 4CO2A 2B5JA 1IKWA 3CJ5A 4AE5A 3H2LA 2YVSA 2IA0A 4LQ3A 5HMWA 2HVZA 4QW8A 3CCRS 3FSXA 2QRRA 2JEIA 3M9NB 2R7QA 4X4OA 3G86A 2K1RA 3I96A 4HH1A 1E6YB 1U8SA 2CPEA 2YNGA 3DU6A 2ZD1B 5I3PA 1L3VA 3T9ZA 4L3NA 3QZ7A 2GQ2A 3QJLA 3CJ4A 3UQSA 3POTA 4ECTA 3TW0A 2QIFA 1BY9A 3CCVS 1VMBA 1VQLS 4A8MP 2AJ0A 3NBPA 2HYIB 3Q2SC 1X8DA 2M88A 2UV8G 3HHLC 1OPZA 2CKWA 3UW1A 2A3JA 2IM0A 4QBUA 2RB7A 2DR8A 4NCGA 2XGQA 2BRLA 2RE1A 3I5BA 2GMLA 2RQMA 3TRGA 5KFEA 2JDJA 1R8AA 2Q1LA 3HZEA 1XERA 1KOOA 1VQYA 2JSXA 3N5FA 3T6JA 5A2QY 2AJFE 4KHRA 4PWDB 3IGNA 4FZVA 4Q2LA 4OHZA 2MGZB 3CCQS 1ULRA 3OL8A 1AFJA 2DTJA 2KZMA 2LEPA 4YFUA 3UD4P 4D3HA 1LW2B 3CC4S 1HQEB 2MZJA 5BYQA 4DR5F 3UWTA 4GC6A 2WK4A 3MM9A 4ED5A 1FRJA 1SL2A 2VONA 4RNFA 4K4YA 1TL3A 1VI7A 4NLOA 3VAGA 1R31A 2IHR1 2KT2A 1NAQA 2WSCC 3R5DA 2RT3A 2FLOA 5A8WA 2JFDA 1LWFB 3UE2A 1I1GA 4I56A 3MEKA 3RZAA 5E7OB 1KQGB 1TKDA 1TKZB 1M5KC 4OV1A 4DV6F 4FF2A 3KG4A 2YX1A 3M2VA 1YHQS 2W9BB 2E29A 3D5MA 2DR5A 3ISNC 2UVUA 2NUUG 5J2PA 1FRLA 3V81B 1YRUA 5KAKA 3KK1B 4WE1A 5JVGQ 3DOMA 4WYWA 1UA1A 4Q8FA 3DHWC 3R1LA 2BQ3A 1N52B 3FEXB 5KG5A 2OFHX 2DB1A 4RWWA 3PW5A 4ZLPA 2PI5A 4DEZA 3CDEA 2BDPA 4A8XA 3MECB 3KLGA 3CULA 1U2FA 4ILRA 3BR8A 1QTMA 5GMKa 3PX6A 3O6QA 3KLEB 2CG4A 1PO6A 4TN2A 3KLFA 5L9XA 3OLBA 2APOA 1FJEB 3MM5B 3CD7A 2FC9A 1HMVA 1U48A 4R8UA 2A1BA 3OR1A 4FXWA 4IR9A 2KFNA 2R2RA 2GO9A 1S79A 1Y3JA 4WYLA 2BM0A 4UQTA 2LEAA