3K0JA

Crystal structure of the e. coli thim riboswitch in complex with thiamine pyrophosphate and the u1a crystallization module
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
92
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords U1 small nuclear ribonucleoprotein A
publication title Thermodynamic analysis of ligand binding and ligand binding-induced tertiary structure formation by the thiamine pyrophosphate riboswitch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna/rna binding protein
total genus 20
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3k0jA00
2X1AA 1OIAA 4WCEQ 3BS9A 3MD1A 1YWXA 5DDPC 4LMZA 3MI7X 3G8TA 3VAFA 2LEBA 5H1SV 2J8AA 2VOPA 2MY8A 3MD3A 1HD1A 2HGNA 1FNXH 2LA6A 1SJ4P 3UCGA 2N3OA 3PIOQ 3MURP 4EGLA 3PIPQ 2G0CA 2DNKA 1K9MT 2M2BA 2MJUA 2DNYA 2JVRA 2ZJQQ 3VAGA 3CCUS 2CQ2A 1VQKS 5LJ5Y 3CCMS 1YTYA 2MHNA 5GVQA 2LKZA 2EK6A 5GMKa 1N52B 1VBXA 2CQDA 5GAHU 2RRAA 3VAHA 1PO6A 3FEYB 1R8HA 1X5TA 2PEHA 3NNCA 3I55S 1U6BA 5LXYA 1M5VC 2DO4A 3D2WA 2DNHA 2DISA 3BEGB 3L3CA 3THTA 1WI6A 2KFYA 4F26A 2MXYA 3NNAA 2G4BA 1HD0A 2DNOA 2MJNA 1KOOA 3DXBA 3VF0B 3I56S 3NNHA 2KG0A 2FHOB 2MKIA 5MLCV 1DZ5A 1WEYA 3B4MA 2LXUA 1YI2S 2CPJA 2M88A 1FO1A 2XSFA 2CPZA 2CQ4A 2E5GA 1WHYA 3HI9A 2LXIA 1UW4A 5HL7Q 2M8DB 4IOCQ 1WG4A 2MZTA 5DDQC 1M5OC 2DIUA 1OPIA 2SXLA 2HVZA 4TU7A 1WF0A 2KI2A 3CPWR 1VQPS 3DLLQ 5D77A 2JWNA 3CCSS 3VAJA 3G8SA 4PR6A 3TO8A 1M1KT 1X4AA 2DIVA 2K3KA 3CCVS 1U1OA 1SXLA 1FJCA 1P27B 5DM6Q 3P6YC 2F3JA 1X5OA 2RS8A 1D9AA 2KRBA 3ZZZA 1X4FA 1X4GA 5CA5A 3CCES 3G96A 1N8RT 4RU2A 3RW7A 1WI8A 1JJ4A 1SJQA 2I38A 4QQBA 2MQPA 2MB0B 4ZKAA 2CPDA 2FPHX 2KHCA 5GAGU 5JVHQ 1M5PC 2M0GB 2KVIA 1U2FA 4OZ1A 5BJRA 3CCRS 3FEXB 1ZZFA 1W2BR 2CPIA 2MZQA 4PRFA 2OSQA 1NO8A 3R27A 2YKAA 2XB2D 2J76E 2YH1A 1YIJS 3VAMA 1VQ4S 3EX7B 1FHTA 3EGZA 3RW6A 4YB1P 3TP2A 1U6FA 1U1KA 1FJ7A 3CC4S 2QFJA 1VBYA 3MUVP 2F9DA 2L08A 1SJFA 2CQGA 4QU6A 1H6KX 2CPFA 2DB1A 1VC5A 2AD9A 2M9KA 1DHMA 3IRWP 2DHXA 3Q2SC 1VQLS 2XS7A 2MQNA 2E44A 1M90T 1WG5A 2AYGA 1QM9A 2MKHA 1DBDA 2NLWA 5CXTA 2KT5A 1R8PA 4TLQA 3CC7S 4ERDA 1VC6A 2MZJA 3NMRA 2U2FA 1N88A 2MKCA 2CJKA 2EVZA 3CUNA 3NS6A 2M4MA 4YOEA 2AYBA 1Q81T 3U1MA 3VALA 1AUDA 1X4HA 3BO2A 3J7ZT 1VQ6S 2DGUA 2MPUA 3SXLA 2N3LA 4TU9A 2ADBA 4LJMA 2ZJPQ 2CQHA 2CQ3A 2LCWA 1X5SA 1D8ZA 1B7FA 2DNZA 3JB9k 2KXFA 2MMYA 1RKJA 3LQVA 3P3DA 3R1HA 1Q82T 2LEAA 1S79A 2D3OR 2MGZB 3CXCR 1YJNS 1U1PA 1KQSR 2CQIA 4IUFA 1VQ5S 4F25A 2DK2A 2DGSA 2WBRA 5LSLA 3G9CA 1FT8A 1WELA 3S01A 1XN9A 1VBZA 4J5OA 1VQ8S 1IQTA 2N7CA 3UD3P 2A3JA 1P1TA 1PGZA 3CC2S 2G1DA 2CQCA 3BO3A 3UD4P 1JJHA 5GADU 3CMES 2MZRA 2MKJA 2KYXA 5JVGQ 1QVFR 2OSRA 2E5JA 2HGMA 1URNA 2VOOA 4PKDB 2KN4A 4WFNQ 5IQQA 3B4DA 1WHWA 1N54B 4W90B 3UE2A 2XNRA 1KOHA 2DHSA 3UWTA 1WEXA 3VAKA 2EK1A 3UCZP 4WKRA 2CPYA 1X5PA 1X0FA 2KRRA 2N82B 4F02A 2MGZA 4QPTA 2MQMA 2PE8A 3V4MA 1U1RA 2CPXA 2M52A 4YUDA 1H2UX 2LYVA 2BOPA 3R1LA 1FXLA 5CYJA 4FXWA 2KG1A 3ZZYA 2RVJA 1Q7YT 1WWHA 2E5IA 1L3KA 3S7RA 4C0OC 3S6EA 2DNRA 3CTRA 1U1NA 2UP1A 5GAEU 3S8SA 2ADCA 3J7YU 2AYMA 2DH7A 2DITA 2DNLA 1K73T 2RT3A 4CIOA 4P6QA 1X4DA 4IOAQ 4WF9Q 2M8HA 2DO0A 2MQLA 2MQQA 4Y00A 1X4EA 2KU7A 3MDFA 4UQTA 3CCJS 1QVGR 3P5TL 4ED5A 2YWKA 1U1MA 2FC9A 2NZ4A 3MXHP 5LJ3Y 3CF5Q 4TU8A 2DGOA 2RQCA 2HYIB 4FXVA 2MKKA 3NS5A 2Q79A 1YJWS 4W92B 2FY1A 1WF1A 2MSTA 5D78A 3U1LA 1S72S 5IM0B 2X1FA 4U67Q 1Q86T 4BS2A 1DRZA 5ITHA 2LMIA 2CQBA 2DH9A 2MQOA 1UAWA 3UCUP 1O0PA 1NU4A 2DGTA 4Y0FA 3H2VE 2FC8A 2ZJRQ 2OIHA 1M5KC 3CCLS 3CCQS 2OTLS 4V19X 5DM7Q 3CD6S 2O3DA 4A8XA 2MYFA 2CPHA 2J0SD 2LQ5A 2HZCA 2DGWA 4M5DB 4WFAQ 3MUTP 3Q2TC 2QEXS 2X1BA 2CPEA 2JRSA 1A9NB 2DGQA 2DHAA 1WG1A 3OW2R 3IWNC 3LPYA 3CULA 2OJ3A 1U1LA 1ZH5A 2CQ1A 2RU3A 3US5A 4UY8T 2RRBA 3CMAS 1WEZA 4OZ0A 1X4BA 2RNEA 2DNMA 1VQ9S 2D9PA 2DGVA 3K0JA 2K8GA 3MUMP 1UFWA 1WHVA 2LECA 3MOJB 1A7GE 5IM0A 1JJ2R 2MZ1A 5FJ4A 2B0GA 3G71S 4C4WA 2KH9A 3HHNB 1CVJA 2DH8A 2XS5A 1YHQS 2YTCA 1BY9A 2MKSA 2CQ0A 2VONA 2D9OA 2KM8C 2E5HA 5LSOA 1VQOS 1KD1T 4C7QA 1SJRA 1VC0A 1NJIT 2DNPA 2HGLA 1G2EA 1HA1A 3SDEB 2MSSA 2MY7A 1WTBA 5DETA 2CQPA 2QA4S 2DNGA 3SMZA 1YJ9S 1U1QA 1RK8A 4CH1A 2RQ4A 3G6ES 2GO9A 2DHGA 5EN1A 3P49B 5IFMA 2F9JA 4CQ1A 2YH0A 3BO4A 2BZ2A 2RUGA 3VAIA 1K8AT 1KC8T 2DNQA 1HL6A 2MZSA 2V94A 5DDOC 3H2UB 1FJEB 1UP1A 4WFBQ 2M7SA 3G4SS 2KM8B 2J0QD 1OWXA 4CH0S 1JMTA 2KXNB 2LA4A 5HO4A 2VODA 2I2YA 2JX2A 2XS2A 1X4CA 1VQNS 2ERRA 2JVOA 4LIRA 3EGNA 3ULHA 2GHPA 1VQMS 2OTJS 1WHXA 1H2TZ 3SDEA 1VQ7S 4QU7A 3N9UC 2XNQA 1WF2A 1ZZNA 2AYEA 2U1AA 4IO9Q 5LXRA 1F9FA 2DGXA 4Z2XA 5DDRC 1OO0B 2DNNA 4WIIA 3TYTA 3THPA 1SJ3P 2KXHA 2RS2A 2X1GA 1YITS 1H2VZ 2M70A 2L41A 2L9WA
chains in the Genus database with same CATH superfamily
2X1AA 2JFKA 3MI7X 2LEBA 3MEGB 1RAHB 1T9UA 2JNJA 1PBAA 3HULA 2FVSA 3IRXB 5CABA 5IT4A 4JI0J 2EBEA 4GKKJ 1LKZA 3ILIA 3PIPQ 2ZC3A 3OUYA 4F67A 3CDWA 3P96A 4J9VA 1TR0A 1YBTA 3OFGA 2Q6CA 2D1CA 4OV6A 2D3UA 4EUVA 5HANA 1HNIB 2P9EA 3AY0A 4LF6J 4ZLLA 3BR8A 4P52A 4M5NA 3BBCA 2KG0A 1BGXT 1RABB 3D1OA 1W2IA 4IH7A 4FS1A 4CLFA 1S59A 3B54A 1LK7A 3JSMA 1H74A 4J9OA 1Y0HA 3G8SA 3W64A 1J5OA 1E6VB 1KS2A 3LGMA 4DR5F 1Y7PA 1D9AA 2KRBA 1X4FA 4P71A 3W5YA 1V3RA 1SJQA 4ICLB 1ZM3A 5BJRA 4YQWA 4ECYA 4AYBD 5BYRA 2DCLA 2DEJA 1NRKA 3BGUA 4ID5A 3VAMA 5HQLA 2MQ8A 1VBYA 4OI0A 4K4XA 1SJFA 5L38A 4XK8C 4NZ7A 3D66A 1VGYA 4ZVRB 1P6TA 2VFSA 1JKHA 1VHFA 2APOA 3SCIE 4IYQA 2Z2ZA 3FCWA 2NXUA 2AYBA 3E2EA 1RTIA 2GJ2A 4MIWA 5HVFA 3RYLA 4DU7A 3M2UA 3BGRB 5DO2A 3LPEA 3W9JA 2D3OR 1RT3B 2BW7A 2AEFA 6FD1A 4IOBA 1EZZB 1OY8A 2XGQA 3KK2B 2XZTB 3ELHA 4DR6J 4J37A 1ZPWX 5JXSA 2NQPA 1VBZA 1GH8A 1H0HB 3Q24A 1SQFA 5F0UA 2C3MA 3BO3A 3K58A 2KYXA 5IT9U 3KWMA 1QVFR 2CXEA 1D8YA 4RW4B 4L6V3 1S12A 1R6YA 1GMVA 4Z7CA 4BC7A 5K14A 2EK1A 1JLEB 3QT7A 1T8EA 8ATCB 1WKLA 2H5EA 2XQCA 4C8LA 1NK5A 4DR7F 3F73A 1Q7YT 3JAMY 3IM9A 3DU6A 1CQMA 2M3DA 2W9CB 3CD5A 2KFNA 2E1RA 3PJWA 4O3SA 3QLHB 3HF5A 5CYQA 4CIOA 3A3PB 4PXEA 2C22A 1KWMA 4B9TA 2KU7A 4DOZA 3K5LA 5LL6d 1RTDB 2ZHOA 2R42A 4A47A 3M30A 4W92B 1N5SA 4NLDA 4B9LA 1HI0P 3AHPA 1SKRA 1S72S 1RLCL 2GVDB 4JI7J 4JI1J 2LMIA 4I2PA 1IR0A 3KNGA 1NU4A 2OIHA 4QIWD 2ZOFA 3MUTP 1UTAA 1UW9A 1TK8A 2X3DA 3TANA 3CULA 3MEDB 1CC7A 1PSDA 2GW8A 4ZVOB 4J9RA 2DKOB 3ISZA 2B6AB 1D0EA 4LF5F 4KHRA 1DQ9A 1HBOB 2IJFA 3BQ2A 3HVTB 1RHJB 3TZZA 4JB8B 2V4QA 3RZAA 2V50A 5LSOA 3M6XA 4YN3B 2HGLA 2CWKA 2MY7A 2B5JB 4PCQA 2W9AA 3W66A 2KL8A 1GT8A 3N6MA 4EO8A 3H5YA 2XHWA 1T05A 2BKPA 2V94A 3V81B 2IM1A 4QWEA 4WU2A 1JLAA 1N34J 1BLUA 2J0QD 3G6VA 4L3NA 2LA4A 3R5CA 2GHVC 1VRUA 4A8QA 1VQMS 3V6HA 1IR2A 2ZKUA 2UVUA 1KQGB 2AYEA 2B4OA 3BR9A 2Y1LB 2FB0A 3I6PA 3ZO7A 5DQHA 2ZZNA 3GU0A 2YVSA 4H4MB 5DDRC 1U0SA 3N4WA 1U0HA 4H54A 1RAIB 3BS9A 4LMZA 5J1EA 4F7VA 3DU5A 3MCMA 2ZVSA 1I94J 2J9DE 4I6YA 1MMNA 4A8SA 2ZE2B 1Y3JA 1VBXA 4ZIVA 1M1GA 4J9PA 4RW7B 2YWGA 1VI7A 2AEJA 3UR3C 1X5TA 4EK2A 1JK9B 1NSKL 3ZZUA 2DNHA 3UVJA 5KFQA 3PO5A 4GO7X 2DT9A 2J9DA 1FI4A 1YJUA 2H1YA 5HQ8A 3R7NB 3VGVA 2R8IA 2V9WA 1WG4A 1MSWD 3IP0A 2E5LJ 1ZETA 3PRVA 2IBKA 3DRSA 3TO8A 3TJ9A 3HDSA 4O3OA 3H5SA 3A8KA 3CJQA 2ZH1A 4U9RA 2HHHJ 1LV5A 3DOKA 2I6WA 4O44B 1OY6A 5J2QA 3CO0P 3QJJA 2VFVA 2DJWA 2I5JB 1XNRJ 3A12A 4ZHRB 1O8BA 3W3SA 1WORA 1FHTA 3EGZA 3TP2A 1WOOA 1T0TV 2GMLA 1CJVB 1L3TA 4O0NA 2DXDA 1SIWB 3PKMA 5A8KA 1KSPA 3KK3B 2BXJA 2XS7A 4KV8B 4E8UA 3LANA 3RRHA 1NXIA 2QJ3A 4ERDA 4DX7A 4OYXA 2IM3A 2M4MA 1UWAA 4NLQA 2YY3A 1IKYB 3QYYA 4ZP9A 2R8JA 5HVGA 2CQHA 2PA3A 4YR3A 3DRPB 3JB9k 2IPOB 4MKAA 2AT1B 5JUMA 3OVBA 3EPGA 3HHDA 4WYLA 1FT8A 1NAQA 4DV3F 2VF3A 4DPTA 1HYSA 3WHIA 2HLUA 3E01A 4P10A 2O67A 5HATA 5GADU 3CMES 2UVVA 2EWHA 1RDRA 2R7WA 3POTB 3SFGA 4U7UD 1R0AA 2Z8QA 4FF2A 3KK1B 5K9FA 1HNVB 1LWEA 2BOPA 1TUVA 3MR6A 2ZOGA 2WVEA 1MU2A 1S57A 4NYZA 3ZZYA 3F41A 3GQCA 3EJMA 2IFXA 1LW2B 3KOAA 1NJZA 2QC3A 4N76A 2M8HA 3JSRA 1RT1B 1UEUA 4EYIB 3NWRA 3EWGA 3MWBA 2BJ1A 5F8LA 2J6TA 2NZ4A 5HVHA 3UDVA 4RW9B 2ZUAA 3IBWA 4EYHB 4MFBA 3PHEA 5ETKA 3OVSA 1KKHA 3JSBA 2DH9A 4F8RA 3GLJA 3K17A 1FK9A 1BQMA 3QZ7A 1PBUA 1H73A 2O3DA 2HVEA 4HI1A 1VISA 2BA9A 5EHHA 2RDJA 3ITHA 2B9WA 2IVYA 2F8MA 2GV1A 4N77A 2JRSA 2CJQA 2EPIA 1BUXA 3QATA 4NL5A 4LVOP 4C3KA 5IV4A 3WC2A 2EKNA 2RH3A 3AXKA 2H4YB 2DGVA 3K5MA 2K8GA 4FBUA 1WHVA 2UVWA 2QRRA 2LECA 5KFLA 2AHOB 1FRKA 3BBFA 2C2KB 2GAGC 3W62A 2BJ8A 2PIIA 1N33F 1HNWJ 2A18A 1N6QB 2GC8A 2F4VJ 3QGIA 1RBOB 3HKWA 2BACA 1HWKA 1S6QB 1RK8A 4LF1A 2CNKB 2GO9A 3K59A 1S6UA 4FN5A 3P49B 4RWWA 4RZRA 2PA8D 4I67A 1FRXA 2DNQA 4KBIA 1QE1A 4KB7A 2IM2A 3ZTSA 5K8PA 2I0XA 2XWYA 2XC9A 4HDGA 3AXMA 2UU9J 2EXUA 4PWDA 4RUHA 4TXSA 4B9UA 3KUHA 3P8BB 5LXRA 3I4HX 4M5IA 4Z2XA 4HT7A 1NDPA 4RUBA 2PGCA 4QIVA 2IMOA 2X1GA 1H2VZ 2HHQA 3QFWA 4EMDA 3DLGA 2HS3A 1FFWB 2YNIB 3Q8RB 5H1SV 4DV6F 3MTKA 3MGJA 2ZVIA 3MMJA 3JTPA 1N32J 2EK6A 2I8EA 4JI6J 3FUYA 5BYSA 5LXYA 1TKXB 2HHTA 2QGFB 4DV2F 4FZVA 1Q8LA 3KG1A 4L75A 1J27A 1HD0A 3MEGA 4YMEA 3KLGB 2GIRA 3IRXA 1LNQA 3B4MA 5LMNF 3NGUA 2C3UA 1S4EA 1VOMA 2LXIA 1TUGB 1WC0A 4NXNJ 1OPIA 1WACA 2HFNA 3BKTA 5GAGI 5DGBA 4NLUA 3VAJA 3GZ7A 1QJHA 3HSGA 4F3OA 2BMBA 1HR0F 2FJWA 3D6HB 1HNIA 1X4GA 2HK2A 3PACA 5C25B 3D68A 3AD7C 1FNMA 2NXJA 2FPHX 1SQEA 5IT0A 5KG6A 2DTJA 2QLFB 4HTIA 2KVIA 1T9YA 5H9FJ 1B0VA 2W2OP 1UZDA 4YS2A 4I2QB 2NYHA 1ZYQA 4XTTA 4F4YA 1E6VA 2WVCA 1H6KX 1T9VA 1WC6A 3ENWA 1S0NA 1HBNB 1OJ4A 2KVQE 4OJ1A 2YQ3A 2PFFB 2EFNA 4ICLA 5CXTA 3PVXA 2KT5A 2VKRA 2NXEA 5AXNA 1FXRA 3KDNA 1FD2A 2EVZA 3JTOA 4CTAB 4DUYJ 4JP8A 2LP4A 4DLEA 5HSPA 4MMOA 4WWSA 2ADBA 3TQ1A 2W24A 4DV1J 1KTVA 2MGZB 3CXCR 1A0OB 4IG3A 4ZJLA 4Q0BB 2F40A 3WBZA 2WBRA 1LEOA 4LF8J 2DY1A 1XN9A 1VQ8S 1ELOA 1KFSA 2CQCA 3UD4P 1NNDA 4G3IA 5ETPA 2XLKA 5KG4A 1URNA 4W90B 1BMQB 3QGHA 2HAFA 4WKRA 2Y1IA 3BGRA 1FVSA 3R7SB 2UXCJ 2JJ4D 3HHLD 3N79A 2FJDB 4B17A 3CB4A 3ZFVA 4KYZA 3KK2A 1X31C 4OX6A 2JLEA 1EP4B 3HHLC 4MKYA 1SPBP 1EAYC 4CT9A 1J5EJ 4OYZA 3CTRA 2UP1A 3NP5A 4M63A 5M2RA 3J7YU 4RW4A 3CJ0A 2QMUB 2WSCC 5KT6A 2AF6A 2MQQA 1JLEA 5KG1A 1YX2A 3K5OA 2WB1D 1S77D 5CH7B 4JYAJ 3KJFB 4MKVA 2ZJRQ 2DRAA 1PYSB 4LBIA 2Z2MA 2CG8A 2W9CA 2IMWP 1M5SA 3QLHA 4DCOB 5K20B 2OJ3A 1RTDA 1ZH5A 2EI5A 3FZBA 2WW4A 3CMAS 3QWUA 4OZ0A 1RWKB 3ILLA 4ZPBA 1X4BA 5DG7A 2RNEA 1REGX 1H3DA 1QSSA 1XNQF 4O23A 1K47A 3V6DB 5DZ7A 4ES1A 5LT5A 1SIZA 2GVDA 2J0XA 2V8HA 2LU2A 2FJXA 3CSKA 3M9OB 1SKUB 1RSCA 2IRUA 1RT6B 4C9DA 3R7BB 2BKOA 3LW5C 2NXNA 5DETA 3MM5A 4NLTA 4NZ6A 3MEDA 4CH1A 3R3TA 3W9HA 2B6AA 1NK9A 3C6TB 3P4UB 3I4PA 1HWJA 3I31A 2BV3A 1HBOA 2O1PA 4ZP8A 1SH0A 2IAJB 1FTRA 3C15B 4UOGA 4ECRA 1X4CA 3EGWB 4KFBB 2M5YA 2OTJS 4J9QA 1RACB 3NCRA 1WOSA 2U1AA 3MPWA 2R4FA 5J1PA 2B5JA 5B0EA 5I3PA 4ER8A 2RS2A 2Y8YA 1RAFB 4G1IA 2D74B 4IKAA 4A8OA 5GAHI 4Y6IA 2BBEA 3V81A 4P73A 3R5JB 2M2BA 1Q53A 2JC0A 5E3AA 4L76A 1SUQB 3EDRB 1TV6B 2MDAA 3RAXA 4N7TA 1HBUB 2FJAB 3T1HF 2VDIA 4H4MA 2VFUA 4C8NA 3TVYA 2RHQB 4QYRA 2DISA 1AFIA 1DY3A 2E9ZA 1XMQF 4YB5A 2HHSA 3HK2A 4OX7A 4IO1A 4LUBA 2QL7B 3KG0A 1MLAA 4QW8A 5KT5A 2W2PP 5E0OA 3TZYA 2CPZA 4N47A 2HIQA 1W25A 4N56A 3U1NA 1F0XA 2ZE2A 5D3GB 3MM7B 2IA6A 2O66A 3AJDA 4RW7A 1V5IB 1GX5A 1X4AA 3ETOA 2R8KA 3D4JA 1P27B 5DM6Q 2EFPA 4ZN3A 1UEKA 2CJAA 3ZZZA 1SC3B 4AL5A 2W4DA 4RU2A 2GJIA 2MB0B 4XDDA 4X66J 2CPDA 2AZ1A 1GAOA 4C8KA 3L7PA 3GJTB 4RW6B 1S9GB 2VZ9A 4ZVPB 3DLKB 3ZZTA 3GIJA 4C98A 2QMWA 3H98A 4GKKF 4DSJA 2CNOB 4O44A 2YX4A 2L48A 4ATNA 1Y11A 1WG5A 1S6PB 2I5JA 2MKHA 4QWCA 1HI1A 1RT7B 4TLQA 3SFUA 3FEZA 4PWWA 2BANB 5A0YA 3NMRA 3ZTQA 4ZHRA 3DN9A 4RBVA 4FPIA 1Y4ZB 4USUA 4LRBA 3DHWC 5KFRA 2B8PA 2R2UA 2N3LA 2Y0SD 5KFFA 1CJVA 4Q2LA 1B0PA 3KK3A 4CLZA 2RJZA 4KV8A 4K4SA 3NGSA 3PRBA 4ED1A 2PT0A 4CI0B 2CIMA 3S01A 1NHUA 5IWAJ 1IQTA 4MK8A 4F04B 1IBLF 4OQJA 3BDEA 4FXDA 3RAMA 1RWMB 1EX8A 3R9LA 1RAOA 3CJ8A 2HVIA 4KGVB 4RUCA 2H9ZA 5KTQA 1NH7A 3N6NA 2KN4A 1IKYA 2ZH2A 3RR8A 1ZBTA 4PG8A 4CLYA 3CEDA 3DRPA 3UR0A 5H9FK 2JLFA 3E8OA 1ROFA 2QL9B 2Y3YA 1FRJA 3NGKA 4DV7F 3R1LA 3GCWP 2LQBA 2VPZB 5CYJA 4ECQA 4B9SA 4FS2A 4RLEA 2CKWA 4LF4J 2R8HA 4DF4A 3NGDA 4URSA 3MCSA 2BM1A 3EZOA 2E7VA 2BJDA 4QR2A 4DQRA 3POTA 2DNLA 2RT3A 3W5ZA 1X4EA 1GX6A 4NA2A 4UZCA 3BQ0A 2C2OB 3IA0A 1S1XB 1ULRA 3KK1A 2QG9B 3AFGA 1HNVA 2XI3A 4HHJA 3ET6B 1RB0A 1HNZJ 1S99A 1EARA 4NLWA 5KFZA 1HQUB 1E6YB 2ZUGA 2CQBA 4ED8A 1S1UB 1M5KC 1LW2A 1VK8A 1I51B 3EXCX 5F8GA 1Y5NB 2ZHAA 2WBMA 2RB7A 2X1BA 1RT1A 2E1AA 3M6VA 2ZH7A 4DR6F 5KG0A 2CDQA 1WSVA 4RW9A 3KG4A 1UFWA 4NA1A 3DRRB 2V5HG 3OL7A 5D0RA 2K2PA 2V69A 2FJEB 2XS5A 2HFVA 3LP0B 4M95A 3IR5B 4H4OB 1K0VA 2IJRA 1S0MA 2CVEA 2XGPA 3Q8YA 2Z0GA 3IS9B 1LWFB 2XO6A 3G6ES 3SCJE 3BGFA 3D0IE 4NCAA 1R0BG 1TL1B 3TX8A 2F9JA 2ZBPA 3UN2A 3BO4A 5LSRA 1XWLA 1F5CA 4OL8A 2PEBA 2UXBJ 3WDOA 1Y5IB 1TKDA 2OMLA 2IRYA 5ETVA 5HBMB 3KLIB 4LF2A 3I9ZA 1T94A 3CVKA 1N6QA 4EI2A 1YBAA 4OI3A 1U02A 1CS4B 4X65J 1S6QA 1OY9A 3CDBA 3MTJA 3THPA 3TAQA 2VB6A 3HFVA 3UDLA 4JI1F 2XSJB 2NS1B 1MMDA 2FQQB 3THVA 2J7UA 1BQNB 1YWXA 1MN9A 3MEKA 3T5HA 1DFDA 3OR2B 3D6TB 3JYTB 2DRDA 4DL0C 1UVKA 1FDBA 1F3FA 3M8SA 1JLCA 1N0VC 3MURP 2GIFA 4OYPA 2AZ3A 2N7YA 4DXLA 1SL2A 2VV5A 3K5NA 5IV3A 2HHWA 1JXEA 1F9HA 2FY8A 4OJ3A 2E1PA 4P7TA 3N5BA 1U45A 1PC5A 4F0KA 3KJNB 3CIMA 1X9SA 2EFOA 5KFIA 3PX4A 4ZN1A 1U6BA 4PEOA 3THTA 1UFKA 4OI6A 1UVLA 1URRA 2YNIA 2RRNA 2DNOA 3OSPA 2A6MA 3NNHA 3QQCD 4WPAA 5ADZA 2CJXB 1SQGA 3P5BP 2POKA 3I32A 3HI9A 2ZC4A 3LO3A 1UW4A 2M8DB 4ZIWA 1NJXA 2HVZA 3RBEA 4A46A 4KPCA 4F3MA 4LF5J 5D77A 4QR1A 2QMXA 1N34F 2BR0A 2DIVA 3CJ2A 1TKXA 4YDDB 3CCVS 1U1OA 4F0HA 2GNKA 1IUJA 2HQFA 3KLGA 3ENVA 3ILOA 3RW7A 3PR4A 2QLXA 2QL5B 2VPYB 2OAUA 2UUCF 3CCRS 2GA7A 2O5DA 1GEHA 4Q8FA 4PXCA 3MMCB 4EO6A 2ASLA 4YB1P 1FJ7A 4MK9A 5E2QA 4F36A 2WVFA 4ILMA 4HACB 1DHMA 1MNEA 4DPWA 5C25A 3DRYA 5HJYA 1QM9A 4EZ6A 1VC6A 2J9EA 2H5JB 4UUWA 4I2QA 4DL6A 2JDJA 1MROB 2C42A 3IO1A 3TWZA 3ZC4A 2HHVA 3MR5A 1SL1A 2DNZA 2KXFA 2DR6A 5AE3A 4PXBA 4UUXA 1ZAVA 3IR6B 1HBNA 4WYWA 3MFHA 4ZPCA 3UN5A 3C16B 1ZAWA 3F56A 2DY9A 1P1TA 3SSSA 2E5LF 4J9NA 4CTAA 4EBEA 2VOOA 3WX4A 3B4DA 2OPRB 2WZ1A 1FERA 4DQPA 2XEXA 2XG8A 3PFEA 1X5PA 4H4KC 5GAEI 1UPPA 2B4PA 4PG6A 1TL5A 2MGZA 5KT2A 1U6ZA 4B3MJ 4Q0BA 1RHMB 1FXLA 5KFUA 5FIIA 2H3EB 1NK0A 3R5GA 4MT1A 2BJ9A 2HWHA 3PG9A 1PAUB 5E7OB 2HQCA 5ETTA 2ADCA 2P6SA 2DH7A 2DITA 4NRUA 5F41A 4WF9Q 3Q83A 4WE1B 4Y00A 3CCWA 5CCLA 1ZS6A 3EZ5A 3OHAA 1TVRB 4UOHA 2B4UA 1TZ0A 5FD1A 4DR1J 1IKVB 3FMBA 5KG3A 2IVFB 4C0BA 1Q86T 3W65A 1EP4A 1TL3B 2B3TB 4TY8B 2HVDA 3M8ZA 2QEXS 2CPEA 2HQIA 2KZZA 1WG1A 5FLXU 3LPYA 3C66A 4ECXA 1OSCA 1MWZA 1P1LA 2WK4A 1WEZA 4ZLPA 4NYOA 2P2CB 1UFLA 2GQCA 2DXFA 2VHGA 3QO9B 1JJCB 3F0NA 3CJ4A 5KG7A 2EKYA 3RAQA 2NUHA 2VICA 3OSNA 3HXMA 4BWJA 2XY7A 1PC4A 2I9SA 4GO5X 1G2EA 3H20A 3SDEB 1R8BA 3TAPA 1XQIA 2RQ4A 4XPEA 3IR7B 2KZMA 3D3BJ 5IFMA 1JLBA 4TYAA 3QJPA 2HRYA 3M2RB 2FLOA 3AT1B 3V6DA 2UUBJ 3KMSA 3NLCA 3HD1A 1OWXA 4F4WA 1JMTA 1H72C 2QSWA 4LIRA 1RT6A 1H2TZ 5D4OA 1AW0A 3GIRA 1F9FA 2NZCA 4ELTA 1FX4A 3CD0A 1SJ3P 3LWLA 2FLLA 2CVIA 4TYBA 3LGHA 3C6TA 3VHQA 3MD1A 4NLVA 1RQ0A 3VAFA 3D0HE 2KT3A 1RT5B 4RNNA 2IAJA 3C15A 2FZCB 4ALZA 2BQUA 4KFBA 2JEIA 3CCMS 2GMJA 3NY0A 1N52B 1KDNA 4PABA 8AT1B 2JOQA 1CG2A 2C2DA 1ICEB 2GAHC 3FC9A 1QY7A 3M8RA 5KFCA 4ED0A 2DR5A 1GMUA 3L7OA 3TA0A 2HMIB 3VGSA 5CZVA 4LFAJ 1F5AA 2HBRB 2LXFA 4DR2J 4CLKA 2JSXA 3C3LA 3BH6B 1VIXA 4IOCQ 3IN5A 1SUQA 3FBFA 1TV6A 1Y10A 3BH7B 2B56A 2OD4A 1HBUA 4B3RJ 4K50A 4GVLA 3Q86A 4FF4A 1OPZA 5T41A 2AW0A 5K8NA 2ACYA 2LQ9A 4K5SA 1RHUB 5F9NA 2DR8A 2UU9F 4Q44A 4X4RA 4P2MA 2M0GB 2OHDA 4M94A 2K7JA 2G9OA 2YNGB 4DL5A 3MM7A 1R0CB 4MAKA 2GVZB 2LFVA 3EMTA 2AJ4A 1T03B 4CO2A 5SUHA 3OL9A 3FDSA 3WC0A 1T3NA 2WHOA 1N32F 5F0WA 5KFWA 3GR1A 3QWPA 2KDOA 2CWXA 4JI6F 4RW6A 4QW9A 4B08A 3HKZD 1S9GA 3DLKA 3NMAA 3HCXA 4DV6J 1XBWA 2JL9A 1F3VA 3PYGA 2BJ3A 1BD6A 1IKXB 3TQEA 4A8MP 4QWBA 3P3DA 5J2NB 4U7CA 5DQGA 1S10A 3OL8A 3O8WA 4NXNF 1S6PA 4LF7J 4U95A 2B51A 2BANA 2A3JA 3HM9A 2MZRA 1Q95G 4ZS6A 4DV2J 2XTJP 4LSNA 1MW7A 2LQJA 3DLHA 2HHUA 4OYOA 2XNRA 4WZMA 1PCAA 8RUCA 3RGIA 3EICA 2ZBRA 4NI2B 1HIYA 2MQMA 2M52A 1KVKA 3DOMB 3DCAA 2RE1A 2E5IA 2VQFJ 3S6EA 3R6LB 4J7CA 2W2NP 3R97A 3FVYA 2YX1A 4UF4A 2A6OA 2VBZA 1N5TA 2UUAJ 3MDFA 2Z30B 2HURA 4C3LA 4JV5J 4KGZB 3GYGA 5EUHA 4ED5A 2YWKA 2LDYA 2HYIB 4WK3A 5G0RB 5HP1B 3NS5A 2Q79A 1B64A 3AJ1A 1U48A 4DUYF 3LP1B 2ZWOA 4IRDA 3OPKA 3SCLE 3CD7A 4J9SA 3IMQJ 4Y0FA 2FD2A 3HSDA 2GQ2A 4A8XA 2DGWA 4DV1F 1Q0NA 3OFEA 2DGQA 1F2GA 3R8YA 5B08A 2VPWB 4U96A 4HH0A 3US5A 4UY8T 4ID8A 3W63A 4DV0F 5C5JA 3JAMU 1UPMB 3W5XA 3ET6A 1HQUA 5FJ4A 1E6YA 4J91A 1S1UA 2CQ0A 5HMWA 2VH7A 3HMJG 2KM8C 4LREA 4AXJA 1B99A 4IQMA 4ITSA 2W8LA 1S97A 2XMWA 3TAMB 1S49A 1G1XA 4B3TJ 3KHGA 1YQHA 5K5MA 2DPIA 2OPPB 5LM7E 2E9RX 1PG5B 5IOLA 5B0DA 3MPVA 2FVPA 3DRRA 1UVIA 1B0TA 1FJEB 2ALZA 2KM8B 3LP0A 3DNCA 2XS2A 4A8FA 2EBGA 3HX9A 4H4OA 1KFDA 3CMQA 4JI5J 1F9EB 3IS9A 1GXLA 4X64J 2YWHA 3JTNA 4FF1A 2K06A 4JYAF 1TL1A 4WZQA 2DEIA 1G6BA 3VWSA 1KQKA 5KFJA 1NJWA 1FNXH 2R8GA 3KLIA 4CM0A 3W9IA 3CJ3A 4BBYA 1PJ5A 4RWXA 4R0JA 2MHNA 3T1AA 3K57A 5GMKa 1CS4A 4Y2IA 2WTFA 1VRQC 3CDAA 2V4RA 1R8HA 4YR2A 3NNCA 2V2VA 2XSJA 4A8WA 1WUUA 4N8NA 3GJQB 3H59A 4AQYJ 5AXLA 2MXYA 3OR2A 4OX8A 3SV3A 1BWEA 5AXMA 1FD8A 4Y2CA 1FO1A 2XSFA 1JNRB 2J6UA 5DRKA 5DDQC 1SVDA 1PILA 2OH2A 4QBUA 3VGUA 2YKNB 3QZ8A 3H8YA 2F5GA 1GTHA 2K3KA 3LAMA 4LRCA 1U7LA 5KOWA 3DGVA 4DV5F 2DBBA 2DCUB 3D7SB 3M8WA 3SIPB 3G96A 3V2UC 1GNKA 4PG7A 4V1Ak 5FLXY 4M5KA 3V4IB 1SCJB 4R8UB 7FDRA 1NCLA 3MEEB 3DYAB 3A4TA 1OQ6A 1K1QA 2IY5B 1AROP 5F8MA 3NL0A 2YH1A 1VQ4S 3ZTPA 3FJ2A 4OIXA 4QU6A 5ETOA 4PZVA 4NEZA 4Y65A 4P2XA 3CJKB 2QA1A 2DPJA 4WFYA 2B4VA 4ZA1A 3O1LA 2AYGA 2UVRA 2EW9A 4OX9J 3VQSA 1WDDA 1HW9A 1XR7A 2CADA 2JEGA 3HT0A 4DDFA 3MMCA 3EZUA 1QUPA 3LA0A 1YJRA 2HQ3A 4F0MA 3HHEA 2DGUA 3NGTA 4C11B 4DFJA 4UOFA 4EWTA 1X5SA 3L09A 1Q7LB 2MLYA 4KPYA 1JQGA 4HACA 1RKJA 3LQVA 4E0DA 4Q5VA 2LEAA 4XDCA 2W1BA 4YDXA 3W7BA 1FFSB 3LP2B 4CNYA 2PN6A 1NDKA 2XZDB 3T1HJ 3O3LA 4JV1A 3G8QA 3IXQA 3E3XA 4DL7A 3EM1A 4OZJA 2HWTA 3ENAA 4J9KA 1DTQB 4JI2J 2IIHA 5LMUJ 3BB5A 3UE2A 3TUPA 1MROA 3UWTA 1FDDA 2XMKA 3A8JA 1X0FA 1AA1B 1KRPA 3SBMA 3HD2A 3EDQB 2GIQA 3PW4A 4R5PB 1TK5A 1NKEA 2Q43A 2WRMA 4UZBA 2IDLA 1NZ8A 2J7WA 3HSJA 5D0HA 4GMKA 2YWEA 4RR5A 2RUSA 2OPRA 1TAQA 2QFIA 2YKMB 5LJ3Y 1DURA 3KLHB 2KHDA 1S1WB 4HVZA 1RAGB 3RG6A 1R27B 4CDIA 1HW8A 1FDAA 1AUSL 2W9BB 2FHJD 3CJTA 1VK3A 2Z57B 2DGTA 1UWBB 3IAM9 4UTGA 3CD6S 1TQLA 2MYFA 5KG5A 1NJYA 3N6LA 2XBPA 4IRKA 1V6HA 2KO1A 4WE1A 2E7WA 1RWOB 5KAKA 4ANEA 1C4AA 2RRBA 1ZTTA 3PDNA 1ZPVA 5IWAF 3RBZA 3AOAA 1FWPA 5C24B 5D0GA 2ZEJA 3K0JA 2ZD1B 1IKVA 3MOJB 1A7GE 4MK7A 1JJ2R 2B0GA 4C4WA 1YSJA 2ILYA 2DVIA 1TL3A 1RU1A 1HWIA 2WW8A 4TY8A 3GPAA 1VQYA 3K8VA 1KD1T 4DPXA 1VC0A 1HHQA 2CJBA 3GILA 3G87A 4HEA9 4ECZA 5KFBA 1IBLJ 5EN1A 2Q66A 4LF4F 4KAIA 4ZCKA 3NWGA 3VAIA 1YLXA 2AKWB 3QO9A 3NGRA 1FRLA 2RILA 3RTVA 4L73A 5HO4A 5HMXA 2ERRA 1X0PA 4CLLA 2AGPA 3KKFA 3GCXP 3SDEA 4DV7J 3F44A 2HEKA 4OYWA 1R31A 1RHQB 1HNZF 3GG0A 2HRUA 1U8SA 1JB0C 4OHZA 4WIIA 1KQFB 4N8OA 4BCAA 2G2OA 3M2RA 3X1LB 5G4DA 1NPPA 3VVTA 1KLNA 3TI0A 4DBQA 1KHWA 3D3CJ 2N3OA 3M32B 3MF5A 3EPIA 2EFGA 1I3OB 2MJUA 2BE2B 1IM4A 2JVRA 1RUSA 1RAAB 5GVQA 4NLSA 1RWPB 1FFGB 4RNHA 4ZVQB 4P9SA 3BM7A 3O44A 2R7VA 2IHR1 2G4BA 1QDUB 1ZM2A 3EUNA 1JNZB 1RT5A 2RQMA 1NEEA 1WHYA 4KTQA 4X4PA 1FDNA 3SQGB 4DL4A 3TJAA 1WSRA 1VMBA 4GVBB 5A2QU 2UXBF 2W7AA 3M4XA 3BSCA 2C3YA 2HMIA 3LGNA 1UJ4A 4QQBA 5JVHQ 1V9OA 4X65F 4DX6A 1YZ6A 2OSQA 1B3TA 1YJVA 4ED3A 4FP9A 3KHRA 3FKBA 1P9QC 3EX7B 3ONQA 3D54A 1U6FA 1F6TA 1VLYA 3TRGA 2RDIA 1YBUA 3PR5B 1MN7A 3T5LA 1IBCB 1G7CB 1QTMA 2MQNA 2CFXA 1WOPA 1R8PA 2BM0A 2KT2A 2U2FA 4NOHA 3MR2A 2PI5A 4KO0B 4PPZA 1U2CA 1AUDA 1M1HA 3J7ZT 5CCMA 2GVZA 4FYVB 5GADI 2HPUA 1T03A 4RO0A 1V3ZA 2HZAA 1N5QA 2RQKA 3MM8B 3VGTA 5LSLA 2ZH3A 3O5TB 3RB3A 1WKJA 3ISND 3UPFA 3UCZP 4YEAA 4KR0B 1IKXA 3SCKE 1S1VB 3ISNC 5J2NA 3JSYA 1CJTB 3R5AA 1BC6A 5IC4B 5AE1A 2KG1A 3GV7B 2J7KA 1WWHA 4WFXA 3S7RA 3MPYA 1S48A 3DFEA 4ZLNA 4X2BA 4F50A 2YNHB 3SV4A 2VC0A 2AYMA 1EETB 4OI2A 1H7WA 3T1YJ 3TARA 4AUKA 4FPRA 2N4DA 4QIEA 2R7RA 2UUCJ 2MKKA 4NI2A 4B3SJ 3HFZB 2XWXA 5T14A 4KGXB 1LXJA 3DOMA 3U1LA 4B9VA 2VFTA 5ITHA 1SC1B 4DMZA 2D3O1 3B6BA 2B7BB 4QYZK 2J0SD 4DX8H 4WFAQ 5K8MA 4DSIA 1FWLA 3PY8A 1TL7B 4FVMA 3K2YA 1Y9OA 1EB0A 1R6VA 5KFHA 5G0RA 3NRBA 5HP1A 1HKAA 1MG7A 4PXDA 3MUMP 2UXDJ 1S6OA 1YRUA 3LP1A 1RTHB 3NBPB 1AZSA 3OXGA 3K5PA 4DZDA 1NHKL 2MKSA 2Z2LA 1VJQA 1IN0A 4I69A 4CO3A 2GHWA 4LR7A 2DNPA 4B3MF 2V8PA 4KC5A 3TNVA 2H5IB 4WXWA 1U1QA 1HARA 2RAQA 2H51B 4OHVA 4OZ5A 4CQ1A 2Z58B 4HR2A 1UP1A 5GMEA 4ZVGA 3T5JA 2CNNB 1FKAF 4M8LA 2VODA 4M5HA 3SI8A 3ULHA 3TAMA 4U8YA 1GQEA 2OO4A 2GO8A 4DR1F 3BSOA 2R7XA 2OPPA 2VQEF 2YXLA 1YITS 5RUBA 2L41A 1I1GA 2LQ8A 2HWIA 2J8AA 3MD3A 2GJFA 1JLGB 2ZH4A 5L1LA 1AB8A 4Y2KA 1YTYA 4C8ZA 4LR9A 2EEYA 4O3QA 4IRCA 2CQDA 1GTEA 2MTLA 1NB7A 3GYNA 2GGPB 4A48A 1RT2B 4IG0B 2DO4A 5JMNA 1T7PA 4F26A 1GXUA 1JLAB 3AOCA 3D9BA 3SEOA 3DXBA 5IQ6A 1JLFB 3A13A 1JLQB 5D4LA 1YI2S 2DR9A 5IC6B 5KFTA 5HL7Q 2SXLA 1N5VA 3FBCA 3MAAB 3TUIC 1QD1A 2DR7A 2UUBF 2HLTA 3U02A 3W2VB 1WC1A 1UA0A 4O0IA 1HPZB 1O5JA 4JI4J 2HFOA 1HHTP 2A10A 1JJ4A 1NDCA 4DUZF 1HQ2A 3PRDA 1LWCB 2MQPA 5K8OA 1RCXB 5ETMA 2CPIA 4PRFA 3OXLA 3WX8A 3H7HB 2NREA 3FSXA 1YIJS 4NXMJ 2YKNA 3CT9A 3Q22A 5IZHA 3C8YA 2KB2A 4PUOB 4IQXA 1EKSA 2PFDA 3UVJB 3D67A 1TMJA 2M9KA 4KKOB 1VLOA 3NAIA 1MWQA 1OSDA 4E2FB 1J2VA 3QGGA 3V4IA 1T3OA 4R8UA 1B70B 2HRTA 3AAWB 2GQQA 3DYAA 5CYMB 4ZCLA 5KFOA 3RBXA 3CUNA 3H5XA 3ENQA 2QSFA 4ANDA 4ZPVR 2FHKA 3JQKA 4LFAF 5I42A 1SKWA 1Q82T 4RNMA 1S79A 3M8YA 2C2ZB 4DR2F 5AT1B 3PW0A 3CJKA 1U1PA 1RZMA 4EU0A 3MMAB 1QSLA 1LW0B 2LLZA 5GMDA 4B3RF 2ZH8A 1VFJA 2C3OA 3IBCB 4X62F 4NLGA 2HGMA 2YQ1A 3MM9A 5KT7A 4NYPA 1XMBA 4ILRA 4NE9C 3GFHA 4C11A 1YRXA 1FRMA 4L74A 2N82B 3J7YI 1KEKA 2JZ5A 2YKQA 3QIDA 3LP2A 2LYVA 1XJWB 3FZ2A 3QRPA 3H2LA 3N0VA 4USIA 3Q23A 3N01A 3W60A 5L39A 4UW2A 1X60A 4IH6A 1RHRB 1WTFA 2OP5A 2ILZA 4ZPDA 3BZQA 3GP9A 3MM6B 2FC9A 3MXHP 4TU8A 4R5PA 4J9LA 2WSFC 3ZXWA 3IFEA 2MSTA 5IM0B 3DMJB 3OHBA 5A2QY 2YWFA 2VU5A 3PV8A 4G1QB 3QIPB 2ZM6J 2DYAA 1XEZA 2FZKB 4HH1A 5KT4A 2YKMA 4FYYB 4HT5A 3KLHA 4LF7F 1S1WA 2D7SA 2HIYA 2YNFA 2F63A 1MU2B 4CT8A 2V67A 2GZOA 2IM0A 3HLUA 2W9BA 2KH9A 3UNYA 2DH8A 1BE4A 1UWBA 2D9OA 1A6LA 1FKPB 5HQMA 1TKTB 4ECWA 4C0HA 2P9GA 4DV4F 2CJ9A 5HMYA 5A8WB 3PHTA 4C8MA 1TKZB 1ZOTA 5C24A 3SSRA 4IFYB 2VQFF 2XMVA 2YH0A 1GMWA 2BZ2A 3WZ0A 2RUGA 5H9EJ 2ZD1A 2MZSA 1WC4A 2F8HA 4IR1A 1XK8A 3QSYB 3G4SS 3IGNA 1Z4UA 1FK9B 2UUAF 1WNEA 3NS7B 1XERA 4PPDA 4KHPJ 4JV5F 2JX2A 3KHLA 3QJLA 2F65A 2J0WA 4RW8B 3J81j 4ZLJA 2XNQA 3Q0AA 3OBIA 3MECB 4TN2A 2ALYB 2KTQA 1IR1A 3CCZA 2AJFE 4ILLA 4RNOA 2ZBQA 4DR4J 7FD1A 5HI7A 2C1EB 3GE9A 4YY3J 2VFRA 3BBBA 1S0OA 4G6VB 2LA6A 2D69A 2P6TA 4LF9J 4CZCA 2COLA 1QAIA 1UVMA 5EWGA 1VQKS 4LBPA 1XIQA 2RRAA 2R7SA 2GX8A 2HS0A 3FEYB 4LVNP 3HZEA 2OPQB 2PEHA 3U7JA 4OV1A 3I55S 4HHHA 2HBZB 3L3CA 2H48B 4PWUA 2KFYA 1RBAA 5DLGA 3GIMA 1HFEL 3KDOA 2MKIA 2OUGA 3D0GE 3QMQA 3GV8B 4F3QA 1DZ5A 3HHKA 3M32A 4B3TF 3PJ9A 4YP3A 3D6FB 4Q2MA 4DV0J 5J1NA 1QTNB 2NPIA 2BE2A 3NOCA 3AB4B 1WF0A 2AP6A 2KI2A 5BR8F 4S0MA 3OTDA 2VG5B 3CCSS 1C0TB 4PR6A 4ETXA 1X5OA 3T6JA 3MPUB 2VJUA 1MWYA 1RT3A 1BQXA 2J6SA 4JI5F 4EBDA 2EG1A 2PMWA 4PQUB 2RDDA 1KONA 4X64F 2MZQA 3SQGA 4NWBA 1YDLA 2OKQA 4USHA 2XB2D 2RHSB 3IBFB 1QAJA 2FDNA 1V3SA 1SV5B 1ZA2B 4GVBA 2BE9B 4DFKA 4GRSA 1T11A 4JI3F 1NPRA 2OFHX 5IS2A 1T9TA 2VG7B 2AD9A 3DLEB 4KT0C 4KHMA 5EX3A 3HHLB 2BX6A 3UD5A 3OR1B 2HNYB 1XTZA 2PO4A 2MKCA 3NS6A 5CD4A 1SC4B 3GFYA 1QAYA 4FNHA 4AQYF 1X4HA 3KFWX 2XCAA 3GFZA 4Q45A 5ETQA 4LJMA 3GJRB 2CYYA 5AXKA 4CLUA 1P8GA 3TZWA 1NM2A 1AFJA 1RA7A 1RADB 1LXNA 2OI2A 3PX0A 3HFKA 2R7UA 3Q89A 4KO0A 4JBCA 2MHEA 2R7OA 3NCQA 4NMXA 2CDRB 2QX0A 1D3WA 2NYIA 1KOHA 2DHSA 1AYEA 3MR7A 3DXSX 2CPYA 1NK4A 2HFSA 4ED4A 3UDCA 4QPTA 1UMJA 3MM8A 1M0SA 1V5VA 4YB7A 4DPOA 5BXIA 5C42B 3OV7A 4RBUA 1IBMJ 1C1BB 4LT6A 1FCAA 3HVTA 1SC6A 4KGMA 4QIFA 2ROPA 3OD2A 4DV5J 4NZ0A 1ZM4A 4LQ9A 4M5JA 3J7AN 2E1CA 3TVZA 1B7YB 4ZITA 1VRTB 2R2RA 1S1VA 4CO5A 2RQCA 2BRKA 4IG3B 3EVWA 4OX9F 3TX0A 3CNQP 3B78A 1RWUA 3NOGA 1CJTA 4U67Q 4B9MA 2AGOA 1NK8A 3DLJA 2JH3A 5CQGA 1UAWA 3UCUP 1O0PA 3H2VE 3KLFB 3BKUA 2YNHA 3J80Y 2HZCA 5AJ3J 4DPUA 2XLJA 1EETA 3R6GB 2ASJA 3OW2R 1KBRA 5D8HB 3I0RB 4DU8A 4AT1B 3R5BA 3TA2A 4TY9A 4M1KA 4RBTA 4NPOA 5B0CA 4JI2F 5LMUF 4F4KA 4ZJQA 2FHMA 3I5AA 4I0WA 3LAKA 3DRXA 3KJVB 1HA1A 2EG2A 3AA9A 2ZWPA 1TL7A 4P2FA 1U25A 4JV2A 1RHKB 4LRFA 2A1BA 1HL6A 1CSJA 1RTHA 3NBPA 3B8HA 1ZM9A 4C2MA 2ZH9A 1U09A 2I2YA 3QT5A 3DHXA 2AX1A 3FBEA 5KFMA 2R2TA 1X7VA 1ZZNA 1C1CB 4QR0A 2Z4PA 4X4NA 2V9KA 3TYTA 4BDPA 1X9MA 1T02A 4I6WA 5CD4H 1S7HA 4EZ9A 2GFFA 1S9FA 1HD1A 1KR4A 3UCGA 3LWMA 2AGQA 4X4UA 5DJBA 1HMVB 3NAHA 2HQGA 3AOBA 2XMMA 5EDWA 3MM5B 2LKZA 2F4FA 4P74A 3QNWB 3NCPA 4LRAA 3KXDA 4R25A 5HN0A 4L3KA 3PO4A 1H38A 3KLEB 1NK6A 2MJNA 3BSAA 5D0EA 3I56S 1HHSA 1JLGA 2MLXA 2XYGB 4HL9A 2CZ4A 2LXUA 2FYXA 3QAUA 2B9YA 5H9EK 1M5OC 4WXOA 4TU7A 2YKOA 2V6AA 2K1RB 4DCJB 2JWNA 1SL0A 1IBKJ 2QLWA 4WBFA 3D28A 2GGPA 2XYPB 1RT2A 1M1KT 4IG0A 1U49A 3GONA 1VJWA 2OPSB 4P75A 4IH5A 1F2HA 1JLFA 3GJSB 1JLQA 1VS3A 4OHXA 2ZITA 3DI6B 2G13A 2UV8G 1M5PC 3T6BA 2C2RA 2VC1A 2XCPA 1NO8A 3R27A 2UZAA 2PDAA 4DPYA 3PKYA 1BHNA 2WSEC 3MAAA 3W2VA 2MEWA 3A1YG 4DR3F 1HPZA 2WB4A 2R7QA 2DB1A 1W26A 2F8EX 3UN3A 4FKXA 1LWCA 1KP6A 1Q79A 3IM8A 3P45B 3PYFA 2QT7A 3WQPA 4KSEB 3E51A 5KG2A 4YOEA 1VCTA 4OJGA 3U1MA 2BDPA 4PUOA 1BXNA 4JI8J 1LQ9A 3CIZA 4KQZA 2XY5A 2OGUA 1PIEA 3I82A 1NMEB 5I3QA 5D6GA 2ZNZA 4KKOA 2DK2A 3AB2B 2D41A 2YQ0A 1WELA 5A6WA 5CYMA 4NCBA 2B8QA 2OELA 3D5MA 3ZTRA 3TA1A 5L9XA 1Q5VA 1RWVB 2IYIA 2E66A 3QSIA 4WU3A 4PKDB 1N54B 2Y1RI 1TP7A 5SZTA 2Q1LA 1U4BA 4TNOA 5BYQA 1D1UA 3SSQA 3PW7A 2KKHA 2CUYA 4CLSA 2BUNA 2XZWA 3C14B 3V4MA 1U1RA 4YUDA 5F8HA 3MMAA 3OQ2A 4OZNA 4FKYA 1LW0A 5A0YB 4WTYA 3AD8C 3I9V9 1CEZA 3DM2B 4BWMA 3S8SA 2R2SA 5KFEA 3W2WB 3V5RA 3QRRA 1LFWA 3P5TL 4DJBA 1U1MA 3PXGa 3KNAA 4LBHA 4ZOSA 3ZZPA 3G82B 3CGIA 1WF1A 2G2ZA 1RYRA 1DAXA 2NUUG 1LFPA 1RTZA 2FLNA 4DQIA 2FC8A 4Y3CA 5L1KA 4ED7A 4V19X 1KVIA 5L1IA 4O3RA 3I0SB 3MZIA 2LQ5A 4M5DB 4IDKB 4MTPA 5A8RB 4I4BA 3Q2TC 1EJ7L 2G1HA 3IWNC 3JQJA 3G6XA 3MM6A 1RWXB 4YHHF 3ICLA 4LRDA 2ZNYA 5KFGA 4PYAA 4R0EA 5IM0A 5M2PA 3DMJA 1TAUA 1PJ7A 1NKBA 1RI7A 3TVKA 2W4CA 4ELVA 4G1QA 3QIPA 4Q8EA 4ZCIA 1UEVA 2CQPA 3CJ5A 2DHGA 4FYDA 1SB6A 1FTCA 4OYIA 1WD6A 4LFBJ 2VBXA 1Z2ZA 3WIUA 1Q8KA 3X3UA 3T1YF 2VD3A 4UQGA 1FKPA 1TKTA 2JVOA 5KFYA 2GHPA 4B3SF 1VQ7S 3PYDA 2QLJB 2CNLB 1IWGA 4IO9Q 1NUEA 5A8WA 3EGVA 4QIGA 2KXHA 1GK8A 1Z1ZA 1X8DA 1TKZA 2M70A 4IFYA 3GTYX 1ZAXA 5DDPC 1Q8BA 2HBQB 3VZHA 2P9CA 1SH2A 2ZH6A 1Y5LB 1XMOJ 5EWFA 1K9MT 1OQ3A 4E98A 4WP3A 2DNYA 2CZVC 2OFGX 2EFVA 3BN4A 1LWXA 4RW8A 3FQLA 5KFDA 3MECA 3VAHA 2YPZA 4RU9A 3KYLA 1YVFA 1PO6A 3JS9A 3DLBA 2UXDF 5ETRA 4I68A 2J9CA 1ZTWA 1M5VC 1RA6A 3AJ2A 3BEGB 1DARA 3MFIA 2FVRA 1KOOA 3WIVA 4OLPA 1K0TA 1EHWA 3ZZ0A 3OJSA 2E5GA 4C6AA 1R8AA 3OTBA 3AD9C 2CG4A 2QN6B 3ETMA 4D3GA 2BQRA 2H54B 3L9ZA 2OPQA 3GWCA 1FJCA 1SXLA 4PG4A 4USKA 4JOUA 4W98A 2OEKA 3D1HA 3KLVA 3AQPA 3BV8A 3N28A 3J7A1 1JLCB 4ZKAA 1S5ZA 3HP6A 2BEFA 2GCFA 1HI8A 4LQ3A 1U2FA 4DFPA 4DZ6A 3M6UA 1N48A 2AJ2A 2J76E 4J90A 1VIOA 4NA3A 2VG5A 1C0TA 4X4SA 4I56A 4GKJF 2ZBCA 2FZGB 2QFJA 5IT9Y 3EE3A 2CPFA 2RSQA 3G2XA 4ECVA 3MAQA 1VQLS 5DQIA 5L8RC 2NPFA 2L9DA 5KOXA 2KJWA 2NLWA 1D09B 2V68A 1C0UB 4PQUA 3L7UA 1N88A 1RLDA 3BPSP 2VQEJ 4RPFA 5B7WA 5L9NA 3PYEA 1SV5A 3IGVA 2L9NA 3BO2A 4K4WA 1IKWB 3M1VB 2IA0A 1N5YB 3CJRA 3VQTA 3BREA 3PTWA 2VG7A 3DLEA 4IR9A 2ACMA 3SYZA 1VQ5S 1FJGJ 3G9CA 2UUTA 1I5OB 1RGVA 1U8WA 3HHLA 3L95X 4GC6A 3OR1A 1CULB 2L3MA 4QOTA 5THWA 2HNYA 3UD3P 2UUWA 4EEYA 5JVGQ 2OSRA 4WP9A 3BYPA 5IQQA 1WHWA 4BHQA 1Z2LA 4JI4F 3R2CJ 1U26A 1OYDA 4WTOB 4DL3A 4OZLA 4F02A 4ZK7M 2PE8A 5HLFB 3HJFA 4CRJA 1HQEB 4ETZA 3GIIA 4NXMF 3C6UB 2FGOA 2QA4G 1L3KA 5HMZA 4LR8A 2KJVA 1QUVA 3RRGA 2ZZMA 3I5BA 1UJ6A 2VG6B 3KMQA 3H40A 4DUZJ 5KFKA 2QYCA 1GXTA 3CCJS 1R43A 3OTOJ 2R3VA 3FGVA 2F7VA 1T9XA 2BJEA 2JEJA 2AIRB 4FXVA 1RT4B 4MYUA 1YJWS 4KIAA 3MMBB 3HT3A 1U24A 5D4PA 5C42A 4BS2A 2WVBA 3QRQA 1C1BA 3M2VB 4QCLA 4OZ2A 1S4FA 3H0PA 2CPHA 1R89A 1REVB 4MIBA 1A9NB 1VRTA 2FTRA 2ASDA 3LALA 4URGA 2ZFHA 3VCDA 3A8IA 4DQSA 5KFVA 4ES2A 3FFIB 1FE4A 2G0JA 3G71S 5J2MB 2ABYA 2VA2A 1BY9A 3KLFA 4A8YA 2VONA 3BJYA 3MCNA 3FSIA 2XYHB 4NMLA 4C7QA 1NJIT 4QWAA 4DN9A 3FCVA 1IWAA 2QA4S 1UJ5A 3I0RA 4DWIA 3UDEA 1D9DA 2IJNA 1CJUB 5AE2A 4X62J 2XMAA 5F9LA 1S9EB 4OI1A 2M7SA 3QT6A 1FNOA 3BPDA 3JQMA 4NEYA 1Q78A 2WVDA 3KJVA 3EGNA 2H65B 2IRXA 1WF2A 5D3GA 3C2PA 4NLXA 3Q8PB 4K7QA 4RX6A 4RNFA 3T3FA 3LH2S 1UA1A 4ZJOA 1ACMB 2B7CB 4Y2AA 1OIAA 3OFHA 2ZH5A 4LFCF 2ZM6F 4CLTA 2OMOA 3BGLA 2VUGA 1DQAA 2FVQA 3AQOA 2CQ2A 2NXCA 2JEFA 2CJYB 1C1CA 4DFMA 1L3VA 1S1TB 4USWA 4JV0A 1JLBB 2FJBB 3R5DA 4LIWA 1WC3A 1DLOB 3GFXA 3D2WA 4V19J 3FCHA 4K0KJ 3GB0A 3UFCX 1WDTA 3V6JA 5MLCV 2GMHA 1HMVA 1RT7A 2YWWA 1N36J 5FDLB 4UT4A 3MOZA 1B4SA 1I6JA 1VQPS 4OI4A 2QTWA 3OTEA 2UV8A 4M5LA 4KE5A 1FVQA 3VV2B 2NSCA 2F3JA 5KFSA 3GYXB 4WKYA 4KHPF 1K44A 3KLEA 4AD6A 4EBCA 4DV4J 3HVWA 2I38A 1SH3A 1RISA 5GAGU 2X7IA 2PMHA 2WCXA 2QE5A 2ATLA 2Y9HA 1RWNB 5JJBA 2K1RA 4DR4F 3CC4S 2XM3A 4YY3F 3UI3A 3FK4A 1RKIA 2L08A 2CQGA 1AT1B 4LF9F 1U2RA 1Q8IA 2OPSA 3W61A 1FESA 2RMLA 4TQSA 1VC5A 3MAHA 2BYCA 2I1RA 3FRZA 2VIHA 3FQKA 3EVMA 2E44A 1DBDA 2WOMB 5CZXA 3DI6A 1YRTA 1Q4RA 2E7XA 2RKIB 2MZJA 1C2PA 4CP5A 2CJKA 3DGPB 5T7LB 4I7FB 3HO1A 2OEMA 4DF8A 1VQ6S 5B0GA 1IVZA 5U47A 2LCWA 4ECSA 2MMYA 2G0IA 1SKSA 3W8GA 2XMUA 1S1XA 2CQIA 2D3ZA 2RF2B 4DG1B 2MKYA 3MCOA 1VBKA 3H5UA 4J5OA 2N7CA 3Q8QB 4KH1B 3CC2S 5E3CA 2CRLA 2QZ8A 3T5KA 3QFHA 1TU0B 2AMCB 4QJVA 2BABA 2KRRA 4RKUC 4IFVB 4HTJA 3RR7A 2DD8S 2JHEA 4U7UK 1NSAA 2J8SA 9RUBA 4NASA 5BR8J 1FRIA 1RYSA 3W1YC 3KJQB 2BVZA 3DC2A 3BQ1A 3GG1A 3KHHA 2DNRA 1S0VA 3OLBA 3IWXA 2FVCA 1P9YA 1NHVA 3K7RA 2DO0A 2MQLA 4UQTA 4JI0F 3DDKA 1LWFA 2DGOA 3C14A 2XULA 3M8QB 3H90A 2HK3A 4FDFA 4CNZA 1HNXJ 2HZVA 1RP5A 4Q43A 4KGKA 4P7VA 5D78A 2B43A 1S76D 1DRZA 4JI3J 2MQOA 3RB4A 4WJBA 2HHPA 1Q5YA 3CCLS 1IM6A 5HBMA 3DM2A 4LSNB 4LF6F 5KFPA 3W2WA 1PYTA 4DSEA 4YB6A 2HNZB 3M6WA 2RU3A 1KLMB 1FEEA 2DNMA 4KRWA 1RXOB 2D9PA 3G82A 4OLOA 1JX4A 2DRBA 3N5FA 1KNZA 4F2RA 1BQNA 3M8PB 3JYTA 1GFWB 4CM2A 2YTCA 2RU9A 4UY85 1JIHA 1L5UA 3A3NB 5B09A 3I0SA 2KFZA 1VQOS 4M5DA 4IDKA 5A8RA 3KUEA 2Y0BB 5I3UB 2DXEA 4GC7A 3AH6A 3SMZA 1IJEB 1IBMF 1YZ7A 5DS7A 1TTHB 4WFBQ 3ADAC 4DR5J 2C28A 4O3NA 4U8VA 3PJXA 4ZP6A 3T41A 1WC5A 3L4BC 3N9UC 4ZMMA 3VVUA 2XMTA 3QGPA 4CCHA 2DGXA 2W8KA 3DOLB 1NDLA 1FA0A 4HHUA 2V0NA 2A2CA 1NZAA 2BQ3A 3OLAA 3G8TA 3KUGA 1R3NA 2HAIA 1RU2A 2IC3B 1QAXA 4X4OA 5AJ3F 1JXLA 1CJKB 2IYGA 4DSKA 3BN7A 2G0CA 4CYUB 2DNKA 2LEPA 4FBTA 4L72B 2ZJQQ 3VAGA 3CCUS 5LJ5Y 5B0AA 1EQMA 2IBOA 1XR5A 5GAHU 2PD1A 3LUYA 4Y2MA 2W7OA 3EVOA 4K59A 5EWEA 3BGOP 2AX0A 5HROB 2V34A 2E29A 2LDIA 4M5MA 1RBLA 4QYZJ 4B3OB 4NLPA 1HBMB 5DGAA 1APSA 2CPJA 2M88A 1TUWA 1FRHA 5J2PB 2DIUA 3M05A 2R9LA 5B0BA 2V2KA 2ZDOA 1LK5A 5IXUA 1EQ0A 1VHIA 5HK4A 1NKCA 4TVAB 3PCOB 4ECTA 5KFXA 4D3HA 3K89A 4OYAA 5F3ZA 5E3QA 3PEHA 3DDNA 3HSZA 3CCES 5F8JA 1N8RT 2Q6BA 4A8KA 2HFUA 4ENOA 1R8CA 4WIQA 1L3SA 3C16A 1CLFA 4XO0A 1ZZFA 1W2BR 4ELUA 4DR7J 4YR0A 4USJC 3RB0A 4UOCA 3RW6A 2V8DA 2ZDPA 4JI7F 3A3OB 6AT1B 2XI2A 1TFYA 2W2MP 1SBRA 1WKKA 2V4JB 4MKBA 1U47A 2HS4A 4TQRA 1CC8A 3UO0A 3CC7S 3A8EA 4PAAA 2XHCA 5L1JA 1N4LA 3OVAA 3IG1B 4NCGB 4LSLB 4MYTA 4WFZA 1EIYB 1FKOB 4H4KA 4TU9A 4Z37A 4HKQA 1RE1B 3TUJC 4ED2A 1TVRA 2W2QP 4PG5A 1YJNS 2HNDB 4IUFA 3NG8A 3HVAA 4F25A 2BE7D 4XAKA 1UCNA 1C0UA 1VQSA 1IBKF 1SI9A 1UZHA 2FUG9 1CQNA 3QBCA 1ZA1B 3D1QA 5DG9A 1RTJB 4WFNQ 1PAEX 2JC1A 1IKWA 3VAKA 2OEJA 5A6PA 1IJFB 2IVMA 3M1VA 1N5YA 3ZNUA 2HVHA 3CO9A 4F4ZA 3Q8VA 1TMMA 1H2UX 4O3PA 1YJ7A 3R2DJ 4FXWA 1AXQA 1CULA 1YGYA 3ZTOA 3BDPA 4ZVHA 4OMFG 1U1NA 4B02A 3GR0A 2FIUA 3Q8UA 1RCOB 1QVGR 3VTIA 4O4GB 1I94F 2RIJA 2FY1A 4M5GA 5HLFA 1DTTB 1HQEA 2WONB 1RAJA 2X1FA 4MJKA 3GIKA 3C6UA 4HI2A 3AODA 1VDHA 4ZVTB 4DR3J 2OTLS 5DM7Q 4JI8F 3TUZC 4K4YA 4NLRA 1KTQA 2RD5C 2VG6A 1T95A 9ATCB 3ZNJ1 4C3MA 1OS5A 3AA8A 3QPIA 1RT4A 3W8PA 3MMBA 3I5CA 2XLIA 3FBBA 3NKYA 1UKUA 2ROGA 3DDIA 2BRLA 1IQZA 3HHNB 3M2VA 2LU1A 2A2DA 4X4VA 4OZ3A 2K3IA 2X51A 1FXDA 4WP8A 4AXIA 2YX7A 2HHHF 1REVA 3D6MB 2PSZA 3PW5A 5F8IA 2DNGA 3VZIA 5LOQA 1XNRF 4A4JA 4K4ZA 3FFIA 1K8AT 1KC8T 3H2UB 2ZHBA 5J2MA 2CA9A 4CO0A 4DSLA 4CH0S 1OMSA 2WAQD 4EFAC 4FNIA 3J81U 4AFFA 3OUYB 3ZZOA 1PYOB 1Q16B 1WHXA 3U27A 1H7XA 1Y3KA 4ANCA 1KHVA 2ZOMA 3O6QA 2AWZA 3DKDA 3M9NB 2YBVA 4DN0A 1CJUA 4N41A 4DUTA 4PYDA 1S9EA 4QZVB 1UVJA 1HLWA 2VOPA 2MY8A 3MPDA 2P8IA 2HGNA 3PIOQ 1NSQA 4BC9A 1JWWA 2PC6A 3TOQA 3RB6A 4G65A 4MH8A 3JSMB 3ILJA 2YNGA 4CLWA 5DG8A 3OFFA 3FNNA 2HBYB 4K2JA 1J5OB 4ZVUB 2ATCB 5HAOA 2FJVA 4DQQA 1Y00A 1WI6A 4HLBA 4P2SA 3NNAA 5M2UA 4ZVEA 3BSNA 1RAEB 2AV5A 1WEYA 3S1TA 1RWWB 1NSPA 2CQ4A 3PZPA 4YHHJ 4DV3J 4ID5B 2AU0A 4ZPTR 3CDEA 1S1TA 4LFBF 4Y34A 1DLOA 3PW2A 5DLFA 2Y1JA 2RS8A 5CA5A 1WI8A 1TL4A 5F8NA 1XR6A 3T19A 2Z2YB 4W4MA 2VA3A 1JKHB 4OZ1A 3FEXB 5FDLA 5E5NA 3HPOA 1C4CA 2YKAA 4F2SA 1F5BA 1RTIB 1FF2A 2ASYA 4OYBA 1T9WA 3PFOA 4ZDNA 3MUVP 2AEMA 3M2UB 4MIAA 2F9DA 4DX5A 1EKRA 2LVWA 5C7PA 2XY6A 4AL6A 2EC2A 1XMOF 2A0FB 3EYZA 2DHXA 3Q2SC 3IAS9 3Q8SB 2GS8A 2YPYA 5I4MA 5CHCB 3RRKA 2BJ7A 2R7TA 2W4PA 4DS5A 2W01A 2VKZG 5A76A 3PEJA 1QSYA 1Q81T 1YKWA 5K14B 4RJVA 3SXLA 1TFWA 1Q1KA 2CQ3A 1D8ZA 3GSDA 1B7FA 3M7VA 4Q7AA 1HNWF 3CDUA 3VR1A 2F4VF 4O4RA 5KT3A 4XPCA 1KQSR 2Y8WA 1K1SA 4P72A 3NEKA 3J7Z5 2WOMA 2X3GA 5HJXA 2RKIA 2OLWA 4QWDA 1YG0A 2H4WB 3DGPA 2VDHA 2MKJA 4B9NA 5T7LA 3H25A 4I7FA 2C2MB 2O01C 1HWLA 4HYKA 5CYQB 1M5HA 4CO4A 3SZ2A 1WEXA 4JUZA 1N33J 3I96A 3M9MB 3M30B 1UL3A 2CPXA 6FDRA 2RF2A 4DG1A 1PKUA 2V8VA 1L3UA 5KFNA 4X4QA 3GSIA 2RVJA 2OD6A 4I2PB 3PNIA 1F60B 5CAAA 1CBKA 5GAEU 2VBWA 4OJHA 5MAOA 2HQDA 1X4DA 4P6QA 4IOAQ 2N4CA 2ROEA 2B9XA 3RBDA 4BLGA 4G1PA 3CJSA 4IFVA 2BW2A 4K8RA 4X4TA 3KTQA 4I64A 4GKJJ 4CO1A 3QAEA 3CCQS 3OTCA 3CCTA 3PX6A 1X9WA 4FVCA 2DHHA 2AQ4A 1VYAA 2IDEA 3UNGC 4ZP7A 1U1LA 2CQ1A 1FJGF 1G3OA 1NBEB 4DL2A 4DI6A 3M8QA 4FYWB 5C2GA 4CLPA 1T05B 4RUAA 2MZ1A 2VJVA 2C2NA 3FMWA 4FYXB 4K5RA 3C19A 3RUBL 1VRUB 1WTBA 3TJ8A 2AJ0A 5LMNJ 2HNZA 2B9EA 1KLMA 1NH8A 3BKFA 1U0HB 4F4AA 1FE0A 2V2ZA 2W7PA 3RJMB 4NRTA 5DDOC 5ETNA 5J1EB 3G6YA 3M8PA 3J80U 2EC0A 1QLNA 3MR3A 1YJTA 2KXNB 1HR0J 1D9FA 1DQ8A 3PM9A 3TZXA 3OTOF 4OHWA 4DHVA 1VQNS 1NPKA 4AL7A 2G2YA 4NLYA 4QU7A 5KFAA 5I3UA 2ZKTA 2HFZA 3HVRA 4K4UA 2QV6A 1OO0B 1WJ9A 2L9WA 4WCEQ 4KJIA 1SJ1A 1H98A 4ZPAA 1AZSB 1R7IA 3LF0A 3TEHB 3EXYA 1SJ4P 1JXVA 2VASA 4EGLA 4CH7A 3I87A 3MEEA 1O51A 4U6PA 4USMA 3O2IA 4YFUA 1FX2A 4DEZA 3SQOP 4LF8F 4LSZB 3UQSA 4K2XA 3DOLA 2JFDA 5ETLA 3DRSB 2JLGA 3B82A 4Z7YA 3OT9A 4DSFA 5F3TA 2PMZD 5E3RA 3UW1A 3DOKB 2HW3A 2IC3A 3VF0B 1NK7A 4FF3A 1CJKA 2FHOB 5J2QB 3FSYA 1TK0A 5C2CA 3TEGA 2F1FA 4CYUA 1PJ6A 4K4VA 4AE5A 2VPXB 1FEHA 2V8GA 3V6KA 2UXCF 2MZTA 3ZZRA 4Y28C 3C46A 1VR6A 3CPWR 3DLLQ 1NLKL 1F1BB 2HHXA 2HSEB 2J5AA 1J5EF 4C8YA 2V63A 5B0FA 4C97A 4DLGA 3P6YC 5HROA 3CW2C 4ZVFA 5A8KB 2QLBB 4B3OA 2K7KA 1RJJA 1HBMA 2KHCA 2ZBIA 4OHYA 3CWJA 5J2PA 4QPXA 2NSBA 4C8OA 2BKNA 2MLZA 1U1KA 4RL1A 1DTQA 1BWVA 2CZ9A 2NCKL 4TLRA 2ZZTA 1W7WA 3GV5B 1OYEA 1FWKA 3IRWP 4ZCMA 4TKTA 1TELA 5L46A 1M90T 2E1MC 2QIFA 1KVJA 3NXZA 4DS4A 1HYSB 3OJUA 3LOUA 3E01B 4XIUA 2E9TA 2EFQA 3VALA 3JXOA 1YK9A 4LFCJ 1R0AB 4K0KF 2MPUA 2ZJPQ 3J81Y 3T9ZA 4HDHA 3R1HA 2V4JA 4N5SA 4C48A 4K4TA 1LWEB 2XO7A 1N36F 3RU0A 2P5VA 2DGSA 2BOAA 5EGYA 2NR0A 1KN6A 5D4NA 1PGZA 4ZVSB 2G1DA 1XNQJ 1JJHA 5D15A 3HZGA 3IG1A 4NCGA 4ZPWR 2YKPA 2E5JA 2QYGA 4LSLA 3OL6A 1FKOA 2W25A 3H4BA 5EX0A 2HKEA 7AT1B 1HWUA 2HNDA 4MFBB 5E3PA 2C2EA 3IWLA 3H42A 3MHYA 4PQAA 4F4XA 4C0OC 1UETA 4OFZA 3OXFA 1BQMB 2FHJA 1RTJA 1K73T 4NX9A 3ITHB 2Q3PA 4ES3A 5I42B 2CAJA 3CF5Q 2FGCA 4USVA 2VBYA 2HG4A 3IC1A 1G4CA 4I6AA 1MMLA 3HJVA 1O6XA 1IXKA 5E33A 4I1TA 1CPZA 3GMGA 5DZ6A 3BF4A 3MM9B 2AJ1A 4KH0B 2C3PA 3H4DA 2DHAA 2AJQA 2KYZA 4O4GA 1XC9A 4WK1A 1VQ9S 4URQU 1DTTA 2WONA 4J9MA 1N56A 1QE1B 3TR5A 3TW0A 2QA2A 2Z56B 3T9NA 1NB2A 1CVJA 1ITPA 1YHQS 1LOUA 4CWBA 4OYMA 1XMQJ 2E5HA 3CE8A 1SJRA 3K8WA 4PWDB 2MSSA 3FRYA 4KY3A 4X66F 1YJ9S 4DCPB 3G86A 3DLGB 4X84A 1UVNA 1N0UA 4NLOA 5ETSA 2QO3A 3QT8A 3BYRA 2FLPA 4ED6A 5E41A 1DJ0A 2PI4A 2XMJA 4ECUA 3LTOA 2V2QA 1S7IA 1HNXF 2VL1A 1GMWD 4USTA 2DNNA 2YNFB 4J9UE
chains in the Genus database with same CATH topology
2HWIA 1MMDA 1OIAA 2X1AA 3THVA 2J7UA 1BQNB 1YWXA 3OFHA 3MEKA 2JFKA 3MI7X 3T5HA 1DFDA 3OR2B 3JYTB 2ZH5A 2LEBA 3MEGB 4LFCF 2J8AA 1UVKA 4DL0C 2ZM6F 3MD3A 1FDBA 2FVSA 1JLGB 3IRXB 5IT4A 3M8SA 1JLCA 1N0VC 2EBEA 2ZH4A 1LKZA 2OMOA 3MURP 3BGLA 3PIPQ 5L1LA 2ZC3A 3OUYA 2VUGA 4F67A 2N7YA 1DQAA 3CDWA 3P96A 4Y2KA 1SL2A 2VV5A 3K5NA 2FVQA 3AQOA 2CQ2A 1YTYA 4C8ZA 2HHWA 1JXEA 2JEFA 1TR0A 3OFGA 4OJ3A 4O3QA 4IRCA 2CQDA 2Q6CA 1C1CA 1GTEA 2D1CA 4P7TA 4DFMA 1NB7A 3GYNA 3N5BA 1U45A 1PC5A 2GGPB 1S1TB 4A48A 1L3VA 3CIMA 4JV0A 1JLBB 2FJBB 3R5DA 2EFOA 4LIWA 1X9SA 1RT2B 5KFIA 3PX4A 1DLOB 4IG0B 2D3UA 1U6BA 3GFXA 2DO4A 3D2WA 3THTA 4EUVA 4OI6A 4V19J 1UVLA 1HNIB 1T7PA 1URRA 2P9EA 2YNIA 3AY0A 1GXUA 3FCHA 4F26A 2RRNA 1JLAB 2DNOA 3BR8A 3GB0A 3SEOA 3DXBA 3UFCX 5IQ6A 3V6JA 3OSPA 1JLFB 3NNHA 2KG0A 1JLQB 1BGXT 5MLCV 3D1OA 5ADZA 5D4LA 1W2IA 1YI2S 2POKA 2DR9A 4IH7A 2GMHA 3I32A 4FS1A 3HI9A 1HMVA 2ZC4A 3LO3A 1RT7A 1UW4A 5KFTA 5HL7Q 2M8DB 5FDLB 2SXLA 1NJXA 1LK7A 2HVZA 3MOZA 3RBEA 1I6JA 4A46A 1N5VA 1VQPS 4F3MA 3JSMA 4OI4A 5D77A 3OTEA 3TUIC 2UV8A 2DR7A 2UUBF 4J9OA 1Y0HA 2HLTA 3U02A 3G8SA 3W2VB 1J5OA 4QR1A 1E6VB 4KE5A 2QMXA 1N34F 1UA0A 2BR0A 2DIVA 1KS2A 3CJ2A 1TKXA 4YDDB 4O0IA 1FVQA 3CCVS 1U1OA 2NSCA 2HHSA 3LGMA 4DR5F 2F3JA 1Y7PA 5KFSA 1HPZB 1O5JA 3GYXB 4WKYA 4KHPF 1D9AA 2GNKA 2KRBA 3KLEA 1IUJA 1X4FA 3KLGA 4EBCA 3ENVA 2HFOA 3HVWA 3RW7A 3PR4A 2A10A 2QLXA 1JJ4A 1V3RA 1HHTP 4DUZF 3PRDA 1LWCB 1SJQA 1SH3A 2I38A 5K8OA 2MQPA 1RISA 2VPYB 2OAUA 4ICLB 5GAGU 2PMHA 1ZM3A 2UUCF 2WCXA 5BJRA 2GA7A 3CCRS 4YQWA 4ECYA 2O5DA 2CPIA 2QE5A 4AYBD 5BYRA 4PRFA 4Q8FA 2ATLA 3OXLA 2DCLA 4PXCA 2NREA 3MMCB 5JJBA 1NRKA 4EO6A 2ASLA 3FSXA 2K1RA 3BGUA 4ID5A 1YIJS 3VAMA 4DR4F 2YKNA 4YB1P 3CT9A 3Q22A 5IZHA 3C8YA 1FJ7A 2KB2A 4MK9A 3CC4S 4YY3F 4PUOB 3UI3A 1VBYA 4IQXA 4OI0A 5E2QA 4K4XA 1RKIA 2L08A 1SJFA 2CQGA 5L38A 4XK8C 4ILMA 4LF9F 1U2RA 1Q8IA 2OPSA 4NZ7A 1FESA 2RMLA 4TQSA 1VC5A 3MAHA 2BYCA 1DHMA 1MNEA 2M9KA 4KKOB 3NAIA 2I1RA 3FRZA 5C25A 1OSDA 1VGYA 3DRYA 3FQKA 2E44A 1P6TA 2VFSA 1J2VA 3QGGA 3V4IA 1T3OA 1QM9A 4R8UA 4EZ6A 1DBDA 2WOMB 5CZXA 3AAWB 1YRTA 3DI6A 1Q4RA 2GQQA 2E7XA 2RKIB 3DYAA 5CYMB 2MZJA 1VC6A 1JKHA 2J9EA 4ZCLA 1C2PA 5KFOA 1VHFA 2APOA 2CJKA 3CUNA 3H5XA 5T7LB 3SCIE 4I7FB 4IYQA 2NXUA 2AYBA 4UUWA 3ENQA 3E2EA 3HO1A 1RTIA 4I2QA 4DF8A 4DL6A 2GJ2A 2JDJA 4MIWA 1VQ6S 2QSFA 1MROB 2C42A 3IO1A 5B0GA 3RYLA 4ZPVR 3M2UA 5U47A 2FHKA 3ZC4A 2LCWA 3BGRB 4ECSA 5DO2A 2HHVA 3MR5A 1SL1A 2DNZA 4LFAF 2KXFA 5I42A 2MMYA 1SKWA 1Q82T 4RNMA 2D3OR 1S79A 1SKSA 5AE3A 4PXBA 4UUXA 4DR2F 1ZAVA 2XMUA 3PW0A 1S1XA 1RT3B 3CJKA 1U1PA 3IR6B 1HBNA 4WYWA 6FD1A 4EU0A 2CQIA 4IOBA 3MFHA 2D3ZA 2RF2B 4DG1B 3MMAB 2XGQA 4ZPCA 3KK2B 1QSLA 3H5UA 4J37A 1LW0B 1ZPWX 5JXSA 2NQPA 1ZAWA 3F56A 2LLZA 1VBZA 4B3RF 4J5OA 1GH8A 2N7CA 1H0HB 2ZH8A 1P1TA 3Q8QB 3Q24A 3CC2S 3SSSA 5E3CA 5F0UA 2E5LF 4J9NA 2C3MA 3BO3A 1VFJA 2CRLA 2C3OA 3K58A 2KYXA 4CTAA 3KWMA 1QVFR 4X62F 2QZ8A 4EBEA 4RW4B 2HGMA 1D8YA 3T5KA 4NLGA 2VOOA 3WX4A 3MM9A 4L6V3 3B4DA 2OPRB 5KT7A 1R6YA 1FERA 4DQPA 4NYPA 1XMBA 2XEXA 4ILRA 2XG8A 4BC7A 5K14A 2EK1A 4QJVA 1JLEB 3GFHA 3PFEA 4C11A 1X5PA 1YRXA 4H4KC 1FRMA 1T8EA 2BABA 5GAEI 2KRRA 2N82B 2B4PA 4PG6A 4IFVB 4RKUC 3J7YI 1TL5A 1KEKA 2JZ5A 2YKQA 4HTJA 3RR7A 2MGZA 5KT2A 1U6ZA 2DD8S 3QIDA 2H5EA 2JHEA 4U7UK 4Q0BA 3LP2A 2LYVA 4C8LA 1FXLA 5KFUA 1FRIA 1RYSA 3FZ2A 1NK5A 4DR7F 5FIIA 3H2LA 1NK0A 3N0VA 3F73A 4USIA 1Q7YT 3JAMY 2BVZA 3DU6A 3DC2A 3BQ1A 3Q23A 3N01A 2HWHA 3GG1A 5L39A 3KHHA 2DNRA 1S0VA 1CQMA 3OLBA 2M3DA 3IWXA 2W9CB 5E7OB 3CD5A 4UW2A 2ADCA 2KFNA 2E1RA 3PJWA 4O3SA 2P6SA 3QLHB 2DH7A 2DITA 3HF5A 4IH6A 2FVCA 5CYQA 4CIOA 4NRUA 5F41A 1NHVA 3K7RA 4PXEA 2DO0A 2MQLA 2C22A 4WF9Q 1WTFA 4WE1B 4Y00A 4B9TA 2KU7A 4DOZA 3CCWA 4UQTA 5CCLA 3K5LA 2OP5A 3EZ5A 4JI0F 2ILZA 4ZPDA 5LL6d 1RTDB 3BZQA 2ZHOA 3MM6B 2FC9A 3OHAA 1TVRB 3DDKA 1LWFA 3MXHP 4DSEA 4TU8A 2DGOA 2B4UA 2XULA 4A47A 3M30A 3M8QB 4R5PA 4J9LA 4CNZA 1RP5A 4W92B 1N5SA 4NLDA 2WSFC 1TZ0A 3IFEA 5FD1A 1HI0P 4B9LA 4Q43A 2MSTA 4KGKA 4P7VA 5D78A 3AHPA 1IKVB 1SKRA 3FMBA 5KG3A 2IVFB 4C0BA 5IM0B 1S72S 1Q86T 3DMJB 2B43A 3OHBA 1S76D 1EP4A 1DRZA 5A2QY 2LMIA 4I2PA 1IR0A 2MQOA 3RB4A 3KNGA 4WJBA 2HHPA 1NU4A 2YWFA 2OIHA 3CCLS 5HBMA 1TL3B 2B3TB 3DM2A 4QIWD 3PV8A 4LSNB 4TY8B 4G1QB 3QIPB 2ZOFA 4LF6F 3MUTP 1TK8A 2QEXS 5KFPA 2CPEA 2HQIA 3W2WA 2KZZA 1WG1A 1XEZA 3TANA 3LPYA 3C66A 4HH1A 2HNZB 1OSCA 3M6WA 4YB6A 5KT4A 1MWZA 4ECXA 3CULA 2YKMA 3MEDB 1CC7A 1P1LA 1PSDA 2GW8A 1KLMB 2RU3A 4J9RA 2WK4A 4HT5A 3KLHA 1FEEA 1WEZA 4LF7F 4ZLPA 1S1WA 2D7SA 3ISZA 4NYOA 2B6AB 2DNMA 4KRWA 2YNFA 2D9PA 4OLOA 1JX4A 2DRBA 1UFLA 3N5FA 1MU2B 2GQCA 4CT8A 1KNZA 1D0EA 4F2RA 3QO9B 4LF5F 1BQNA 2IM0A 3HLUA 3M8PB 2W9BA 3CJ4A 2KH9A 3JYTA 4KHRA 1DQ9A 1HBOB 2IJFA 5KG7A 2DH8A 3BQ2A 2EKYA 3RAQA