3K0JA

Crystal structure of the e. coli thim riboswitch in complex with thiamine pyrophosphate and the u1a crystallization module
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
92
Chain Sequence
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna/rna binding protein
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Thermodynamic analysis of ligand binding and ligand binding-induced tertiary structure formation by the thiamine pyrophosphate riboswitch.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 92
sequence length 92
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3k0jA00
2HGLA 2DNGA 1RK8A 5IFMA 3MURP 3R27A 3BO3A 2DNMA 4F26A 3S01A 2XS7A 2M9KA 2M88A 2FY1A 2JVRA 2MGZB 4F02A 2DISA 2CPYA 3G9CA 1OIAA 4IOAQ 3IRWP 5D77A 1L3KA 2XNQA 1UAWA 3G4SS 1WELA 1S79A 5GMKa 1N8RT 3MI7X 2AYGA 2MQPA 3VAFA 2EK6A 3TYTA 1DHMA 2VOOA 2X1AA 4PR6A 3P3DA 5GADU 2ADBA 4TU8A 2M4MA 2LEBA 1X0FA 1M5KC 1SJQA 4TLQA 2CQ4A 1YI2S 3SDEA 2RU3A 1S72S 1X4DA 1BY9A 2KN4A 5HL7Q 1YITS 4CH0S 2HGNA 3UD4P 2MJNA 3EGZA 1HD0A 3D2WA 4W92B 4J5OA 4YB1P 2QFJA 2M70A 2NLWA 2CPJA 4QQBA 2RVJA 2X1GA 1VQKS 4ED5A 2E44A 1VQ7S 2E5GA 2DHGA 1X5PA 2U2FA 1R8PA 3CMES 1WG5A 2XB2D 2RNEA 2XNRA 2OSQA 1U1QA 3MDFA 2CPIA 3SXLA 2RQCA 2AYMA 2F3JA 3H2VE 2ERRA 1JJHA 3UE2A 2MZTA 2J76E 4LIRA 1QVGR 4YOEA 2N7CA 2FHOB 1WHWA 3HI9A 2CPDA 4UY8T 2YTCA 1XN9A 2MQOA 5BJRA 3NNHA 3L3CA 4FXWA 2MZ1A 1SJ4P 1HA1A 2MB0B 2NZ4A 1K8AT 2XSFA 3MUTP 1AUDA 4PKDB 2KH9A 1R8HA 2I2YA 2GHPA 2ADCA 1WI8A 1M5VC 1RKJA 5GAEU 3R1HA 2BOPA 2KHCA 1WWHA 2DB1A 5IM0A 1U1LA 3BS9A 2DIUA 1WF2A 2RUGA 1Q86T 1D8ZA 2DNHA 2E5HA 3EX7B 1M5PC 2CQGA 2JVOA 3VALA 2LKZA 1WG1A 4C4WA 5LJ5Y 3N9UC 2MY8A 3UCZP 2DNRA 3OW2R 3S8SA 1FJ7A 1ZZNA 1YJNS 3RW6A 2A3JA 1YWXA 2ZJPQ 1VQMS 4PRFA 2CPXA 1A7GE 2YH1A 2E5JA 2DGXA 1WHXA 4EGLA 2PEHA 3UCUP 2K8GA 3CPWR 2DNOA 2QA4S 2I38A 3P6YC 2D3OR 2LYVA 3CC4S 3EGNA 2MQMA 5LSLA 2FPHX 2MSTA 2G0CA 1OO0B 2YH0A 4Z2XA 4TU7A 3THPA 2MQNA 2XS2A 4WKRA 5GAHU 2DGVA 2DGTA 3VAMA 5CA5A 3CUNA 2OJ3A 2XS5A 1HL6A 3DLLQ 1X4AA 2CQIA 1VBXA 3MUVP 3PIPQ 4C7QA 4IO9Q 1FJCA 1U6FA 3ZZZA 2CQCA 2DNKA 3V4MA 3UD3P 2JWNA 2ZJRQ 2M8HA 3BEGB 1X4CA 4QU6A 2DH9A 2DNYA 3NS5A 2VODA 5DDOC 2B0GA 2DGOA 2DIVA 4V19X 1PGZA 3MD1A 1N54B 2X1FA 2KYXA 2QEXS 3VAHA 1K9MT 3MXHP 3ULHA 1YJWS 5H1SV 2M2BA 5GVQA 1WEXA 1H2VZ 2J8AA 2AYBA 1B7FA 4WCEQ 3VAKA 2SXLA 1X4FA 3K0JA 2LXIA 1QVFR 2KXFA 3G96A 1X5TA 3Q2SC 1P1TA 1DZ5A 2KM8C 2CPHA 2CQHA 3NNCA 2RQ4A 1FT8A 1JMTA 2X1BA 2KFYA 1U1OA 1VQ5S 1P27B 3P5TL 1URNA 2DK2A 1U1MA 3MUMP 3FEXB 3HHNB 1WF1A 4UQTA 1VQ6S 1OWXA 5FJ4A 1U1KA 4YUDA 2RT3A 3CMAS 1HD1A 1ZZFA 4C0OC 3CC2S 3MD3A 3US5A 2RS8A 3G6ES 3CCQS 2DNNA 2MQLA 2D9PA 3G8TA 5DETA 2U1AA 1U1PA 2M8DB 2DNPA 5CYJA 4P6QA 1SXLA 1FNXH 3CTRA 1JJ4A 3B4DA 5HO4A 3SDEB 3CCJS 3DXBA 5DM7Q 3U1LA 3R1LA 2DH8A 2PE8A 2OTLS 1NO8A 4Y0FA 1SJ3P 2DGSA 2MGZA 2CPFA 4WF9Q 2KU7A 2L08A 2MPUA 1D9AA 1N88A 1VQOS 3CF5Q 3LQVA 2LXUA 1Q82T 4LJMA 2MKKA 1ZH5A 1WI6A 2OTJS 1WHVA 3FEYB 2L41A 5EN1A 1VC0A 1UFWA 2D9OA 2GO9A 5D78A 5LXYA 1M1KT 3CCLS 5MLCV 4FXVA 2G4BA 3J7YU 2EVZA 2Q79A 1Q7YT 2MHNA 1FHTA 4ZKAA 1NU4A 1WG4A 2O3DA 4CH1A 2LECA 2VOPA 4WFAQ 4WFNQ 1DRZA 2LA4A 1H2TZ 3NNAA 5LXRA 2WBRA 1F9FA 3ZZYA 3TO8A 3PIOQ 2FC9A 3CCSS 1K73T 2FC8A 3JB9k 3CULA 1N52B 2MSSA 2KRRA 1U6BA 1WEYA 1IQTA 5JVGQ 3I55S 4OZ1A 1VQ9S 3RW7A 2OIHA 2DHXA 1VQNS 1U1NA 2G1DA 2CQDA 5IM0B 4OZ0A 2E5IA 2DITA 3CXCR 5JVHQ 2HZCA 2MZQA 3IWNC 2N82B 1UP1A 2M0GB 2LEAA 2DNLA 1SJFA 1X4BA 1X4EA 2K3KA 3MOJB 1WEZA 1UW4A 2DHSA 5LSOA 1JJ2R 2MQQA 1OPIA 1WTBA 1QM9A 1VQ4S 4A8XA 2YWKA 1VC5A 1X4GA 1KOOA 1NJIT 2CQBA 2HVZA 1KD1T 5DDRC 2VONA 2RS2A 5IQQA 3CCRS 2CPZA 1FO1A 2KI2A 1WF0A 2DHAA 3Q2TC 4ERDA 1VBZA 4W90B 2F9DA 2V94A 3CCUS 3CD6S 2DGWA 2JX2A 4WFBQ 1FXLA 3VAIA 1PO6A 4LMZA 2CQ0A 1O0PA 3LPYA 4CQ1A 1X5OA 1CVJA 5DM6Q 3CC7S 2LA6A 1X4HA 1W2BR 3J7ZT 4CIOA 3BO2A 2RRBA 2DGQA 2DO0A 2MJUA 1YTYA 4IUFA 4IOCQ 2MKJA 2RRAA 1G2EA 2KVIA 2HGMA 2DNZA 2KM8B 3UWTA 3CCVS 1X5SA 2CQ2A 4WIIA 5LJ3Y 2MMYA 3G8SA 2KXNB 3VF0B 3G71S 2MXYA 4QPTA 1M5OC 2YKAA 1Q81T 1U1RA 2KRBA 1YIJS 1VBYA 1SJRA 3VAGA 2AYEA 5DDQC 2MZRA 2CJKA 1VQ8S 1WHYA 2LQ5A 4Y00A 2BZ2A 2UP1A 3H2UB 2M7SA 2MKSA 2CPEA 2KT5A 3S7RA 5DDPC 3CCMS 2KG1A 2J0SD 2ZJQQ 2M52A 2HYIB 2DH7A 1H6KX 2LCWA 1A9NB 1VC6A 2OSRA 3S6EA 1KOHA 1VQPS 3TP2A 2MKHA 4M5DB 3CCES 2CQPA 4U67Q 4QU7A 2EK1A 3THTA 3UCGA 1VQLS 4BS2A 5ITHA 2DGUA 4RU2A 1H2UX 2F9JA 1YJ9S 2MZJA 4TU9A 2J0QD 3BO4A 3B4MA 2N3OA 5CXTA 1FJEB 3NMRA 2MKIA 2CQ3A 2CQ1A 2N3LA 5GAGU 3NS6A 3P49B 1M90T 2L9WA 2AD9A 2MY7A 1U2FA 1KC8T 2DO4A 2LMIA 3SMZA 1YHQS 2MZSA 1DBDA 2MYFA 2JRSA 4F25A 3VAJA 2KXHA 3I56S 2MKCA 2DNQA 1KQSR 2KG0A 3U1MA
chains in the Genus database with same CATH superfamily
2RJZA 2HGLA 4KGVB 3AAWB 3OVBA 1FTRA 4F02A 4UOHA 3B6BA 3KJQB 5KT6A 2FLLA 2AYGA 2MQPA 3VAFA 3QT5A 3HD1A 2Z2MA 4H4KC 1SBRA 2IM3A 4TLQA 2CQ4A 4DV1F 4ID8A 5D0GA 4O23A 1EETB 5A8RA 2GZOA 1KLNA 2MKYA 4O3OA 2PT0A 1X7VA 4ED5A 1QTNB 4G6VB 4OJ3A 2VF3A 2PFDA 3O2IA 3AD9C 4NLYA 2N7YA 4AXIA 1NKEA 1CULA 2J6TA 2VFTA 3M8YA 5M2RA 1FWPA 2OEKA 1AZSB 5J2PA 4KY3A 3MUTP 2FHMA 4GVLA 1HWLA 3KJNB 3CVKA 1RKJA 5E5NA 2BOPA 4WYLA 4ZMMA 3QIPB 2RUGA 3EX7B 4TLRA 1WSVA 4USHA 3BSNA 4Y28C 2H3EB 5C42A 3N9UC 2DNRA 1FERA 3LWMA 2ZBQA 3VTIA 3OTDA 2ILYA 3GSDA 4ZPVR 1FRLA 4OZLA 2V8HA 3KLHA 4H4MB 4KV8B 1XERA 5L8RC 5HLFA 1KONA 3HVWA 5GAHU 2YVSA 4NE9C 1XEZA 3LP1B 4F3MA 2J9CA 4E2FB 2FVQA 4EBDA 4ECRA 5EX3A 3PIPQ 2E7WA 1FJCA 1U6FA 3PRVA 3LGNA 3I9ZA 2FZGB 4GKJJ 3B8HA 2X1FA 5FLXU 3VAHA 2BJ9A 1K9MT 5KFSA 3JSMA 2AEJA 3POTA 3QRRA 2AGQA 2SXLA 1EHWA 2V5HG 1S9GB 4FKYA 3D1HA 4F2RA 3ITHB 3CJKB 3C6TA 1EQMA 3Q23A 4AL5A 2V50A 2AF6A 2GIRA 3AH6A 4RLEA 4LF9F 2DNNA 1SH0A 3QGHA 1S97A 5A2QU 4CCHA 4OX8A 1FVSA 1FE0A 1YJRA 3OR1A 4KPYA 2FZKB 5A6WA 5HVGA 1LK7A 2OPSA 3SI8A 1TVRA 3JTNA 1IKVB 3OFFA 2QIFA 2HK3A 2HIQA 4OIXA 2PMZD 1RTIA 3IG1A 2KU7A 1S5ZA 1VQOS 3LQVA 4HLBA 4JV1A 2R8GA 3H40A 4GRSA 1X9MA 1Q82T 1HKAA 1EP4A 3TZZA 4ZVGA 4KRWA 3PNIA 1M1KT 3KLGB 3DLJA 4X66J 2DYAA 3TWZA 4C8KA 2VOPA 4WFAQ 1N4LA 5KOXA 1N52B 2RQMA 3EM1A 2KRRA 2UVRA 4YMEA 4IH7A 5DS7A 4X65J 2DPIA 1HWUA 5JVGQ 4KHRA 4EEYA 2GAHC 1JLCA 2NPIA 2HZCA 3CO9A 2PC6A 3CJSA 4B08A 3KNAA 1ZYQA 3MOJB 2R7XA 1WEZA 3W60A 3LOUA 1X4GA 2CQBA 2CKWA 1NSPA 4MYTA 2GQCA 3UFCX 3K89A 3D6MB 3ZTQA 1GH8A 4U8YA 3ILOA 5BXIA 3LH2S 1LNQA 2B8QA 1DTTA 2H9ZA 2D74B 2DO0A 1FWLA 1NK0A 2LXFA 2UXCJ 4JI0F 3PRBA 2ZC3A 3KUEA 3TAMB 1RHRB 4NYZA 5J2QA 4OHYA 4C8YA 4K2XA 5ADZA 1VDHA 4M5KA 4ZVUB 4DV2F 4F0HA 1NPKA 3CCMS 2P5VA 2ALYB 2F7VA 2UXDF 2DCUB 2ATLA 3TAPA 4EZ9A 4ETZA 3UDLA 4LBHA 3V4IA 4XO0A 4LVNP 5ITHA 4TYAA 1HQEA 4RU2A 5K14B 2HFZA 2ZOMA 3K5OA 1OSCA 3IP0A 3NBPA 1YZ6A 4L75A 3FZ2A 4PQAA 1NCLA 1T9YA 2ZDOA 4EBEA 4X62J 2AZ1A 3H8YA 4OZ2A 3TZYA 4GC7A 3HMJG 4RW4A 4RW9A 1IN0A 1JNZB 4Q43A 5A2QY 1C0TB 1MN7A 1HHTP 4URSA 4ED2A 1U49A 2N4CA 1C4CA 2OH2A 1X4DA 3W5XA 1S6PB 1U8SA 3RB3A 4LSLB 4WFYA 4F4KA 1B7YB 1NPPA 1CJUB 2WB4A 2UUAF 4DR5J 1HQUA 3MM6B 4QYZK 1NUEA 2EFVA 4EO6A 3DOLB 2QA4G 1AROP 2KB2A 5ETKA 4BDPA 2OEMA 4Q8FA 1FKAF 4Y2KA 2BX6A 4DX6A 1K8AT 4RW7B 1N5YA 3UW1A 3CIMA 3EXCX 2FY8A 4QWDA 2OPPA 2YQ1A 1FFWB 4ZCIA 5C5JA 1FA0A 1D8ZA 2ZH4A 4KIAA 2MY8A 2QMWA 1FX4A 1MMDA 5CZVA 1W2IA 2YH1A 4K4XA 3DN9A 2GQ2A 3LP0B 1SUQB 4NZ6A 2QGFB 2AMCB 1T3OA 1RAFB 4QPXA 2IFXA 2MQNA 2QO3A 4WKRA 1FJGJ 3OTOJ 3DLKA 4CLTA 2JWNA 3FDSA 4QU6A 3M6XA 4ILRA 2HVEA 3F41A 2CNNB 2WVEA 3GFYA 3MXHP 7AT1B 3MMCB 4DR7J 2KXFA 2G0IA 3MCMA 4DF4A 4O3SA 1XMQF 2CQHA 3NNCA 3PTWA 1FT8A 3BH7B 8ATCB 1T9WA 5RUBA 1WKKA 5KFTA 1PSDA 1C1CA 3L9ZA 5DZ6A 3QMQA 4ILMA 5DGBA 3RYLA 2X3DA 1NLKL 2FVSA 3MAQA 1F60B 5HBMA 1I94F 3PR4A 3RR8A 4DUYJ 4DWIA 3SCKE 3LAKA 5CCLA 3M6WA 5K8OA 1EJ7L 2F4FA 2UUBF 4JI6J 5KFBA 2KDOA 1CG2A 2YNFA 4LF7F 4NMLA 3ZTPA 4JI5J 4WF9Q 2FLOA 1N88A 2G2ZA 3MR3A 4FF2A 2GGPB 4DSKA 4ZPAA 4EYIB 5JJBA 5LXYA 1T7PA 4DF8A 1EETA 3SCJE 3KOAA 3P4UB 4DSJA 1LK5A 2Z2ZA 2R8KA 3PW4A 1K1QA 5L1IA 1MMLA 4DPOA 2UU9J 4YY3F 2W1BA 1IQTA 2B51A 2DR9A 4AQYJ 4USKA 2CQDA 4ZJLA 4K5RA 1BQMB 4NRUA 2C2MB 4DV0J 1AZSA 2G13A 4CLWA 5KAKA 1AT1B 3UDEA 2L9NA 4NLQA 4NXMJ 4DMZA 1F9HA 3QIPA 4WU2A 3AY0A 3LPYA 1UVJA 4XPEA 2VA3A 4NLUA 4K7QA 2DGQA 3W66A 4RW6B 4ECQA 4K2JA 3NGRA 3KLVA 1U47A 3RAQA 2Q3PA 1HI8A 3HCXA 3KK2B 4I69A 3IO1A 3FKBA 4KV8A 3VR1A 2IBOA 3EUNA 5IT9Y 2YNGB 2HNZB 1NEEA 3LP1A 2VIHA 3ZZPA 3Q83A 4NCAA 3MFHA 3BKFA 5KFXA 5ETOA 1IUJA 3Q8UA 1YRXA 1ULRA 4P7TA 3BSOA 2J0QD 1S1XB 2BKOA 4JV2A 4R0JA 1MMNA 1S9GA 2L9WA 3C15B 3ITHA 3CJKA 5K9FA 1VLYA 3DXSX 4F25A 3VAJA 1L3TA 2VICA 4EMDA 2AU0A 1VRQC 2BA9A 1EARA 1XMOJ 3BBBA 4F26A 1RAAB 2QMUB 3JS9A 3HHKA 1F6TA 1UAWA 5GMKa 2PI4A 4TVAB 4TU8A 1X0FA 1UA0A 2QSFA 2W7AA 2ZDPA 2AP6A 5D3GB 3OL8A 1IKVA 2F8MA 1IXKA 5DO2A 1B4SA 3HSDA 3CGIA 4ZN1A 5DQGA 1X5PA 1HNZJ 4FYXB 1U09A 4PUOB 4ZLNA 3DU6A 1EQ0A 2NUHA 4F8RA 5B09A 1S6UA 4DN0A 1FRHA 1RWNB 1VYAA 5D6GA 2LQ9A 1NJWA 3GE9A 3P5BP 3RU0A 1VBKA 4DV4J 3AHPA 3FSYA 1WI8A 2ADCA 5GMEA 1IM6A 1XMBA 2L9DA 4MK8A 5GMDA 4DL5A 3NGDA 3MPDA 2CQGA 4DR2F 9RUBA 3MOZA 3UCZP 2DR8A 3BR9A 4NYPA 4ZPTR 4A8WA 1YJNS 3P96A 1IBKF 4ZVEA 3TAQA 2B9EA 3RAMA 2K8GA 4CLLA 2I38A 3UR3C 4X64J 5LSLA 2WVFA 4O3PA 4JBCA 1EKRA 5THWA 4DPYA 4DL2A 2A0FB 4FYVB 4DQQA 3MWBA 2JC1A 4HHUA 4TNOA 2ZJRQ 1NJXA 2XMVA 1YJTA 1N54B 3TAMA 3D6FB 3SIPB 1KHVA 1N5VA 5EDWA 4YQWA 2M2BA 1JJCB 2HSEB 2J8AA 4X84A 1X4FA 3K0JA 3DRSB 3TI0A 1QVFR 4DV5F 3FC9A 2HBQB 4DQIA 2NS1B 3KLEB 1HI0P 1H3DA 2Z0GA 5J1EB 5C24B 1HNXF 5K14A 2UUCF 1SPBP 2I6WA 1K0TA 2RSQA 3PY8A 4ZLLA 3PX4A 2HWIA 2HFNA 1U1PA 2ZBPA 2UXBF 4FYYB 4Q2LA 4QW8A 2HVHA 5E7OB 3R1LA 2ZWPA 4OX9F 1BC6A 3FNNA 4LF6J 1PAUB 2H5JB 4N8OA 4TQRA 4IQMA 2GO9A 2J9DE 2IVFB 2GC8A 2XLJA 3QLHB 2Q79A 1S6PA 2JFKA 4WXWA 4NCBA 4L76A 4LSLA 5IC4B 4I2QB 1VK8A 5A8WB 5KG4A 1NM2A 3ET6A 1CJUA 3W8PA 4Q2MA 4Q7AA 3FRYA 1K73T 2EFGA 1ZM2A 3BSCA 2XZWA 1VQNS 4LSNB 2ZFHA 5D4PA 1IKWB 3DU5A 4Z7YA 3IWNC 1UP1A 2M0GB 1X4EA 1FWKA 9ATCB 4F4WA 2IAJB 1IR1A 1NH7A 3V2UC 4X2BA 5F8MA 2VG7B 4I6WA 2Y8WA 1P8GA 3GV8B 3BGOP 5FD1A 1RT7B 2CPZA 4JI7F 2GX8A 3UI3A 4MIAA 3Q2TC 4J90A 3RGIA 2V94A 3BBCA 1PYOB 5F9LA 3J7YI 3EJMA 2V9KA 3TVZA 1FNOA 1UTAA 5KFMA 5GAGI 1Y5IB 2NSCA 1RA7A 1QDUB 3LP0A 3OHBA 2Q43A 2MMYA 4QJVA 3G71S 4ZA1A 3OTEA 4B3RJ 2QRRA 1QLNA 5KFKA 3KJVA 1IBMF 2CXEA 2C1EB 5B0DA 2X51A 4B3SF 3HJVA 1VRUB 4KGXB 4R5PB 4JI2F 4B9SA 3HPOA 4LF5J 2QLXA 1Q79A 1WSRA 1XR7A 1CQMA 1RBLA 3MMCA 4M63A 5K5MA 1KC8T 1SL1A 3HHLB 1DQ8A 3QT7A 3CDWA 4A8FA 5AE3A 2VQEJ 3LGHA 2HG4A 3K5NA 2GVDB 2JVRA 5D77A 3V81B 1R31A 2EK6A 2VOOA 1SJQA 1RT1B 1YRUA 1NAQA 5DG9A 5CHCB 4ZPDA 1UL3A 3V5RA 4WTYA 4FPIA 5LMNF 2UVUA 3CEDA 2KT3A 2W2PP 4EU0A 1M1HA 3ZZTA 2M70A 2X1GA 2R7QA 2E44A 1VQ7S 2GGPA 3HHEA 3BQ2A 1N34F 3EMTA 3D7SB 3U1NA 2LEPA 4FDFA 4JI3F 4ZVTB 4FXWA 2BKPA 2MB0B 4C2MA 3IN5A 1KS2A 3KK3B 2VPXB 4L3KA 1HMVB 1ACMB 3AB4B 4AE5A 4KQZA 4LFBJ 2QC3A 4UY85 2DB1A 1Q16B 3EGWB 5I3QA 3T19A 3FFIB 4KHPF 4LBPA 1BQMA 4WYWA 5JUMA 2ZBIA 2CPXA 2Z57B 3OD2A 1A7GE 2FVCA 4EGLA 3QYYA 3QSIA 2CG4A 4DUZF 4RR5A 1OO0B 3TRGA 2CG8A 4ECVA 2H65B 1HL6A 4UOGA 4KC5A 2OPQB 4RW6A 3U27A 4ID5B 4JB8B 3FJ2A 1X4CA 5DDOC 3KK2A 4NWBA 1BE4A 3AOCA 4OL8A 1IWGA 3G6XA 2HNZA 3ENVA 4DSIA 4DV1J 3VZIA 1N0VC 4NL5A 2AX0A 1IJFB 3JAMU 2HQIA 2WCXA 1DAXA 4NZ0A 2A10A 5HAOA 2DRAA 2HS3A 1TUWA 5B0BA 2VASA 4ZP9A 3J81Y 2Y0BB 2U1AA 3C15A 5CYJA 3GFXA 3BF4A 4OYAA 2QA1A 4O44B 4LF4J 1QE1B 2BRKA 1SJ3P 2Y1RI 1D9AA 2RF2B 2VQFF 2A2CA 2XY7A 3A12A 4M5IA 4R8UA 4LJMA 4IRCA 3IAS9 3OT9A 2OTJS 3M2VB 3HDSA 3ENQA 5D78A 1P9YA 3NWGA 3CCLS 1UWBA 2WTFA 3F56A 3EVMA 4IFVB 2CJXB 1RACB 2LA4A 5T41A 5ETVA 2IC3B 4ZS6A 1O51A 3PJ9A 2E5LF 2OI2A 4PUOA 3HKWA 3IWLA 3F44A 2VFUA 2D3ZA 2C2RA 4YR0A 1LKZA 1NHKL 3K8VA 2MZQA 1GTEA 1TL3B 3W5ZA 2B6AB 2MQQA 2OFGX 5M2UA 2A18A 3OTCA 3PACA 3BV8A 5HN0A 1NK9A 1U2RA 2CZ4A 1NK5A 2RS2A 1OY8A 2GCFA 1AB8A 4N8NA 1VOMA 2F9DA 3R5JB 1FXLA 1Y00A 1SC4B 4Q5VA 1R43A 2F4VF 4FXDA 2RRBA 4PWUA 2MJUA 3FSIA 1AFIA 3SQGA 4B9LA 2WHOA 1Y0HA 5ETMA 4DR1J 4LF9J 4ES3A 3R2CJ 3W61A 2VPYB 4P2SA 2BRLA 1AUSL 2IYGA 3D6TB 5F41A 2XMJA 4HHJA 3WC0A 2KG1A 2OELA 2DHHA 1KOHA 1VQPS 4BWMA 4FS2A 3M8WA 1UMJA 1W25A 3H4DA 1KLMA 4HDHA 1RAHB 2V4JA 5CXTA 3OXFA 2CQ1A 3DRSA 2V34A 4CH7A 5GAGU 1CJKB 2MY7A 2B56A 3M8PB 4L74A 2IYIA 3KK1A 5D0EA 3R27A 5J1EA 4A8OA 2XS7A 5C24A 2QL9B 1VIXA 2MGZB 3MI7X 2CUYA 2HQCA 4AFFA 3P3DA 1JB0C 1KN6A 5DLFA 4AD6A 1U4BA 2PD1A 4CLPA 2W2QP 4KT0C 5HMZA 3N6NA 4NLDA 3SSSA 4CH0S 3ZTOA 1UPPA 4X4PA 4DL3A 2J7WA 2X3GA 4DV6F 2CAJA 1R8PA 3JSRA 5EX0A 2RNEA 1RCOB 2RQCA 4TY8B 3M6UA 4P72A 3ILLA 3I87A 3KYLA 2CPDA 3QLHA 1XN9A 2FGOA 3RG6A 4JI0J 4I2QA 5A8WA 5EGYA 2AEMA 3MHYA 2ZHBA 2W8LA 4DFKA 1H73A 2R8IA 4LQ3A 4OI4A 1JNRB 1M1GA 5GADI 5C2CA 3RB0A 1RT2B 4QIEA 4DV2J 3CCTA 1LW0B 1NK4A 1Q86T 1IKWA 1JK9B 4ER8A 3CDBA 1VI7A 2PMWA 3GV5B 2P2CB 2LKZA 1VHFA 4C4WA 2UXDJ 3R3TA 4IOBA 4NXNF 1X8DA 1PJ6A 2VG7A 3T5JA 3N79A 3R7SB 1IQZA 1PYSB 5E41A 2PEHA 1RT7A 3DDKA 2Z8QA 5D0RA 1NB2A 2R3VA 1HNIB 2VG5B 3HVTB 1GTHA 1T0TV 1S99A 4FF1A 2AIRB 4WTOB 2OJ3A 4KTQA 5KFAA 2OUGA 2CQIA 3OVSA 1VBXA 1WC3A 3FCVA 2DNYA 3NS5A 3BQ0A 2B0GA 4K4UA 2ZH1A 4MTPA 5KFLA 1JLGB 4ED0A 2ZZNA 5H1SV 2HQFA 2HWHA 4HACB 1PC5A 2HQGA 2LXIA 3DOMB 3G96A 1T8EA 4CO2A 3CDEA 3RBZA 2YWFA 5B0AA 2HK2A 2EC2A 4ZK7M 3C6UA 4LR7A 2R8JA 2UUAJ 2EC0A 2YBVA 4OMFG 1QY7A 3TANA 3MPVA 1VQ6S 1OWXA 4ANEA 3AQPA 3EVOA 3CCQS 1SKUB 4KH0B 1JLEA 1B0VA 4JP8A 3M32A 4RX6A 5BR8F 2FHKA 1PJ5A 3JQKA 4FNHA 2XWYA 3OR2A 4KKOA 2YKMB 4QWEA 5A8KB 2GW8A 2C2OB 1BHNA 4USUA 1RTDB 3O44A 1V5VA 2OTLS 3R6GB 2GVDA 2EWHA 2NR0A 4PG8A 4C3MA 1B99A 4J7CA 3M9OB 1XWLA 4ES2A 1RT1A 2V2KA 2EG1A 1VQSA 1F9EB 5MLCV 1H98A 1GMVA 1LW2B 3KHLA 3PEJA 4Y2IA 5KFIA 2XBPA 2RB7A 4PZVA 2DBBA 1U02A 4BHQA 1HBUB 3IM9A 2Q6CA 3FRZA 2RD5C 2G1DA 1GMUA 3BB5A 3T6JA 3MMBB 1UWAA 2L3MA 1JXVA 4EK2A 3KK3A 3T5HA 1WUUA 5DDRC 4IG3B 1HMVA 3HZEA 5L1KA 3SSQA 2C28A 4MK7A 3W3SA 3KJFB 5DM6Q 3H5XA 2VZ9A 3ILJA 4DUTA 1G2EA 3BZQA 5E3PA 3CCVS 2YKAA 1Q81T 4N76A 1TAUA 3Q24A 3I6PA 4DPUA 1FEHA 1Q0NA 4FYDA 4Y00A 2UUBJ 1EZZB 2PEBA 4GO5X 2OPQA 5HROB 1WACA 3WBZA 3EE3A 4I0WA 1WKLA 5B0CA 2FJWA 1TMMA 1FXDA 3CCES 1PG5B 3W1YC 3J7AN 3K2YA 4ZPBA 3P49B 1KSPA 3DGPA 1RWMB 1CC8A 3D3BJ 4JV0A 4CT8A 2MKCA 2BEFA 1IKYA 4YY3J 4QR1A 2HZAA 2DNGA 2ZZTA 2OMLA 5IFMA 5L9XA 2DNMA 2B43A 3CD7A 4ES1A 3S1TA 4K0KF 1YBTA 4B9NA 3TYTA 2E1PA 2XHCA 2ADBA 1IBCB 5FIIA 1T02A 1Q7LB 4DQPA 4O44A 2RU9A 1QE1A 3QQCD 5KG7A 2KO1A 1YBUA 4F04B 3UD4P 2XO6A 4ZPCA 1SJ1A 2RF2A 4BCAA 4YB1P 3DHXA 1ZS6A 2W25A 1BXNA 4QQBA 3JXOA 6AT1B 2ZD1B 5F8HA 1N32F 2YNHB 2DHGA 3SXLA 2F3JA 3C14A 3KLIA 3MAHA 1D9FA 3CIZA 2P9EA 3I96A 3MM8B 3QRPA 5BJRA 4F36A 4IFVA 3M4XA 2JEIA 2FLNA 2R42A 1KFSA 2IC3A 3DGVA 1TV6B 5KFZA 1R8HA 5AJ3F 2FJVA 3K17A 5KFFA 3O1LA 2R7WA 3IAM9 3BS9A 3L7OA 1TL3A 2B6AA 1UVLA 2XLKA 2BE2B 3TA0A 1QSLA 1SQGA 3R5AA 1REVA 1UZHA 2D3OR 2FYXA 2FPHX 2KFNA 2XZDB 2G0CA 2YH0A 2AWZA 3T5LA 2NXEA 2CJAA 3THPA 2W4PA 5AE2A 1TL1B 2GS8A 2CDRB 2DGVA 1WC4A 4W98A 3UN3A 3ZZRA 1T11A 2CQCA 4IH5A 3J7A1 2IA6A 2XO7A 5LOQA 1OYDA 2HFVA 1FK9B 2B4UA 2YKQA 5KFPA 2DJWA 1P9QC 2BACA 4RUBA 1W26A 2QYCA 2CPHA 3QAEA 2CVEA 4F0KA 1VQ5S 2FDNA 2DK2A 1QUVA 2V8GA 3UDCA 4UW2A 2HVIA 1IR2A 3CO0P 3CC2S 2IM2A 4G3IA 2VBYA 3W9IA 1CJKA 3G8TA 3M8PA 4U7CA 2QYGA 4K59A 2Z4PA 4M94A 2QA2A 1F5AA 4IG0B 3SDEB 2RUSA 5T7LB 2UVVA 3D1OA 4DLGA 4ELUA 5IXUA 2GNKA 1S4FA 2MGZA 3UPFA 2XMAA 4UZCA 2PA3A 2K1RB 2W2MP 3KG0A 4RNOA 4R25A 1K1SA 3KXDA 2KT2A 4FXVA 1IBKJ 1SH2A 1Q7YT 3LGMA 3BR8A 4ZKAA 2O3DA 4I56A 5SZTA 4AUKA 1Q78A 1SKSA 2BANB 3NKYA 2P8IA 2B9XA 2NYIA 3CCSS 1RA6A 3WIVA 1JLBB 2CWXA 1T05A 4DV7F 4XDCA 1AA1B 2OIHA 3NEKA 2H1YA 4M5NA 3A8EA 1LQ9A 2ZH2A 3AODA 1TUVA 3WX4A 2JL9A 3DMJB 4F4AA 1WTBA 2XGPA 4P2MA 3QGIA 2XMWA 1VMBA 1F3VA 3DHWC 3HLUA 3D3CJ 1RT2A 1LW0A 1REGX 2FHJA 1FTCA 3GLJA 2ZHOA 1T9UA 2RHQB 4L72B 1DARA 1VFJA 3VGTA 2HGMA 5K8PA 1HNXJ 2UUCJ 2H5IB 1LV5A 2Y1IA 5K8MA 2EPIA 2YKPA 2ASLA 1CS4B 1U1RA 2W9AA 2VG5A 1AW0A 3HVTA 3VAGA 2RRNA 3SFUA 3KG4A 2B8PA 2MKSA 1PBUA 4H4OB 2M52A 4WP8A 2DH7A 4ILLA 3LP2B 4OX9J 4HTJA 4N7TA 1VRTB 3MCNA 3WZ0A 2UVWA 2CQPA 4U67Q 1XIQA 4QU7A 1JLGA 4PAAA 1NH8A 2YWEA 1Q5YA 3GJSB 1YJ9S 5IC6B 4HACA 1KVIA 2VKRA 1PYTA 3DOMA 1KQGB 2HBRB 2ZWOA 5G0RB 1ZTWA 4FNIA 2RDDA 3ISZA 1WOOA 1YRTA 2M9KA 4I7FB 4MKYA 1EX8A 2VD3A 2XEXA 1HNWF 2IJRA 2RE1A 1DHMA 2VV5A 5ETQA 2VPWB 3FEZA 2YKMA 5A8KA 2E9ZA 4JI4F 1O6XA 3TEHB 1YI2S 2F8HA 1RTDA 5HL7Q 1YITS 3H5YA 2G9OA 2IDLA 4NASA 1B70B 4ECXA 4JI7J 1A0OB 4MIBA 3ENWA 1VQKS 2XB2D 1E6VA 3CDAA 1S49A 2QL5B 1Q8LA 2E29A 2D3O1 2ERRA 1SL0A 3TOQA 2N7CA 4UY8T 2VU5A 4DX7A 3KHHA 2R8HA 3L3CA 1QSSA 2LFVA 3R5BA 4DS4A 2NZ4A 2Q66A 3ZC4A 4PCQA 2JEFA 3UN5A 2Y0SD 2PIIA 1HBUA 1RT4B 1U1LA 5KFWA 2BM0A 2ZE2B 2R7UA 5F8GA 5AXMA 3TVYA 2HNYB 2G2OA 1IBMJ 1H0HB 2B9YA 4ICLA 4B3SJ 2HRTA 4NLSA 5L38A 2XHWA 1FJ7A 3MR7A 1HNVB 1LWCA 2EFOA 1HBNB 3HM9A 3DLEB 4A48A 2GVZB 4IG3A 2FHJD 3TQ1A 3RTVA 4J9QA 3OJUA 3KHRA 3EGNA 2W2NP 3ONQA 3DYAB 1FD2A 1UW9A 1S1UA 4DSLA 4L73A 4YHHF 4IO9Q 2DNKA 2OO4A 1QAXA 1J5OB 2V2QA 4P52A 1D1UA 4K4SA 2QEXS 3KMQA 3JTPA 2X7IA 1Y5LB 2HHWA 3VAKA 2RAQA 1FI4A 4P2FA 5HROA 2XSJB 2AW0A 5LMNJ 4B9VA 2O01C 5MAOA 3HT3A 4QR0A 3E3XA 3CWJA 4YDDB 1N34J 3OL9A 2VFVA 4FKXA 4QIGA 1VR6A 4J9NA 2B7BB 4JI3J 4QWAA 1GX6A 4U9RA 1UVKA 1FNXH 1FRJA 1S77D 1KP6A 3QFHA 1KRPA 2RMLA 4U7UD 1KHWA 2CPFA 1Q5VA 2OFHX 4KHPJ 2RKIB 4CT9A 3G2XA 3M30A 4LIWA 3Q8YA 2G2YA 1R6VA 5D4OA 2EVZA 3UO0A 2IVMA 1V5IB 3MGJA 1DRZA 3M2UB 1F9FA 1RBOB 1QD1A 4CTAB 2O66A 1X9SA 4DUZJ 2EFNA 2WSCC 1ICEB 2ZD1A 3PW2A 1MG7A 3V6DA 5KG6A 4ECYA 4XPCA 3NGSA 2HURA 2E5IA 1RBAA 1TFYA 2N82B 3QSYB 5HVFA 2OD4A 1BUXA 3SEOA 1ZA1B 3RR7A 1TV6A 4Y2CA 1YJ7A 3L95X 4LVOP 2XY5A 1HR0F 1NSAA 2KI2A 3H90A 4FF4A 4W90B 4NEYA 3H98A 3I0RB 1GT8A 4WFBQ 1N6QB 3NXZA 4LMZA 4CQ1A 4CLUA 4O3RA 2BE2A 3TJ9A 4PPZA 4EBCA 4LFAF 4OYBA 2VBXA 4IOCQ 4F2SA 4O4GB 4QR2A 1T3NA 2WB1D 1RWXB 2P6SA 3ZZUA 2ZH9A 1YIJS 1Q4RA 4NOHA 2LQ5A 4E0DA 3MM5B 2W9BA 1JXEA 3DLGB 2ASDA 5E3AA 2OD6A 3DC2A 4QIWD 2QFIA 5F8NA 3FBCA 2OKQA 2VQFJ 1FK9A 2DXEA 4EWTA 1I51B 5CD4A 1VQLS 1HPZB 2DGUA 3ZNUA 3F73A 4DSFA 3B4MA 4Y2AA 2N3OA 1GX5A 1Q8BA 4ITSA 2POKA 3DM2A 1VGYA 4X62F 1YHQS 5CCMA 4H4KA 4HKQA 1G3OA 2EG2A 3MCSA 5J2MB 3GIRA 3M6VA 1WOSA 4ENOA 1TL4A 3G9CA 3H0PA 3B78A 4YB5A 1S48A 4A8KA 2J7UA 5IWAF 3PKYA 2QX0A 4DR3J 5IOLA 5LL6d 3A8JA 4WFZA 3N6LA 4P75A 5KT3A 3SDEA 4O0IA 2CZ9A 3PKMA 4DS5A 3RZAA 1U0HB 4IKAA 2HGNA 2MJNA 3IRXB 2CYYA 5C25B 4WP3A 3BQ1A 4ZVHA 2K1RA 1M5HA 4CLSA 4ZN3A 1GMWA 2OSQA 2CPIA 3U7JA 2MLYA 2F4VJ 2EEYA 4V1Ak 1ITPA 1CJVB 4URGA 3QRQA 5HANA 4UOCA 2LDYA 4I64A 1HHSA 1OPZA 1U26A 1PKUA 1WTFA 2D69A 1URRA 1Y3JA 3BPDA 4AYBD 4B3MF 3I0SB 2BANA 1RQ0A 3OVAA 1MROA 2QL7B 3T41A 5KOWA 1RTJA 3T1HJ 3JSYA 2V8DA 1WG1A 3OFGA 4J37A 3RW6A 3FGVA 5D4LA 1HIYA 2A3JA 2ZJPQ 3A8KA 3K57A 3VVTA 2VG6A 1FRXA 3MR5A 2LYVA 1JLQB 2ZH3A 2BABA 3HVRA 5I3UB 4KFBB 1YVFA 4L6V3 4CYUB 3D1QA 2JHEA 4LF1A 2QTWA 3DOKB 2J8SA 3KNGA 3AOAA 3ZZZA 3V4MA 1XJWB 2COLA 3ISND 4OV6A 3I82A 3QZ8A 2IRYA 3FSXA 4KO0A 1BLUA 3R7NB 5FDLB 3D0GE 1CS4A 1KR4A 4RKUC 1TKXB 1XK8A 4RL1A 3CD5A 2BJ1A 4O4RA 3KDNA 2GIFA 3VHQA 4CDIA 4PQUA 2YNIB 3D9BA 3P45B 3IBWA 3R5CA 4X4TA 4H4OA 2C2ZB 5HJXA 4L3NA 1FDBA 1WC5A 2IVYA 3LP2A 1OSDA 1RHKB 4FYWB 1J5EF 3ADAC 1VRTA 1NJZA 2HAIA 3MUMP 1U1MA 3TARA 4DI6A 4KH1B 3WHIA 5HQLA 1IR0A 4WE1A 4DV6J 1U1KA 5CYQB 4YUDA 4IFYB 4DR6F 2A6MA 1MU2B 3DLBA 2QV6A 1J2VA 1TAQA 3T3FA 5G0RA 3QIDA 4B02A 1KKHA 3H20A 2W01A 5HO4A 2P6TA 3I5BA 2PMHA 3AOBA 2DGSA 5L46A 4NLTA 2HIYA 4I7FA 3PYGA 3T5KA 2HS0A 3GIMA 5L39A 3LO3A 2NREA 2OLWA 2Q1LA 5KT2A 1Y9OA 3TJAA 1S9FA 4OYOA 4NXNJ 3KG1A 1RU2A 3PHTA 3V6JA 4Q8EA 1GMWD 2NZCA 2QLJB 3ZZYA 3LTOA 2JOQA 3M8QB 4FS1A 4U95A 3CULA 2V8VA 4MKBA 4A8YA 2NPFA 5BYRA 4F3OA 1Q1KA 2VC1A 4M5HA 3CJTA 1LOUA 4LFCF 2OEJA 5AE1A 2DHSA 2VJUA 4ZOSA 3SCIE 2XTJP 3DFEA 2R2UA 3HD2A 1RT4A 4ZJQA 1WF0A 3EPIA 3BGLA 2C2NA 2ZE2A 4ETXA 1FE4A 3MM7B 5CAAA 2V9WA 2APOA 2HFOA 4CIOA 4X4RA 1XTZA 1HNVA 1HBNA 3DLEA 1UKUA 2C3YA 2KVIA 2DXFA 3NG8A 3G8SA 2NUUG 4ZP7A 3ICLA 4C6AA 3DYAA 5BR8J 4DPXA 1U48A 3W65A 3A3OB 1YSJA 1TUGB 2MZRA 4K4VA 4IYQA 3R2DJ 3D28A 2AT1B 2EFQA 2M7SA 4P74A 4DU8A 1FRKA 1YZ7A 3VQTA 4USWA 1TKTB 3Q8VA 2CIMA 1RWWB 1IKXA 2CWKA 4TU9A 1KVKA 1TKZB 5CYMB 2N3LA 5DRKA 3GB0A 5J2PB 3NY0A 1VK3A 2XSJA 4N47A 2FJXA 3FMWA 2MYFA 4Z37A 5EWGA 1LXJA 1CLFA 3UN2A 1EIYB 2H48B 2GHVC 4MT1A 2ZKTA 4ED8A 4PWDB 3MURP 4USIA 2H4YB 4F67A 1OIAA 4IOAQ 5IT9U 2ACYA 4OHWA 1U0SA 5C42B 4FBUA 4OYWA 3RJMB 2OPRA 3QT8A 4C8ZA 3EDRB 2M4MA 4DFJA 2RILA 4CO3A 3CCZA 3O6QA 1KBRA 3SYZA 3HFKA 1FVQA 3M2RB 1S72S 2ASYA 1IM4A 3D68A 2KN4A 1M0SA 2VDIA 5HLFB 1HNZF 4MYUA 4YDXA 3KTQA 1RWOB 1R0AA 3A13A 1MNEA 2CJQA 3KDOA 1TL7B 1NHVA 2BDPA 3N5BA 4U8VA 2RVJA 2AJ0A 3PJWA 2XNRA 3MCOA 1B3TA 8RUCA 4XAKA 4A46A 1JJHA 2XI2A 3UE2A 1LWFB 4MIWA 3GR1A 4OHXA 3I32A 3HFVA 4P9SA 4OJGA 1HA1A 1SH3A 4CTAA 3KLFB 3QJJA 3DDNA 2GHPA 1C2PA 2BQUA 1M5VC 1UVNA 1RLDA 1EKSA 1FRMA 3BDPA 4X4OA 3GIKA 1K47A 4A8QA 2JVOA 1RB0A 3A1YG 5LJ5Y 4Q0BB 2ATCB 1LWEB 4X64F 3GJQB 1AXQA 2YWWA 2ZM6F 1UFLA 3PR5B 3H25A 3PFEA 1RE1B 4ZP8A 4O3QA 4KHMA 3P6YC 1NB7A 2YX1A 2M5YA 1TKDA 1N6QA 2OPSB 5EUHA 1RTZA 3OUYB 1WDDA 3VAMA 1B0TA 3NMAA 2GJFA 1SKWA 3MUVP 4O4GA 1V3RA 1EP4B 4K0KJ 3C46A 2DH9A 3PZPA 4PABA 1PGZA 3E51A 2R7TA 3PM9A 4IDKB 2CA9A 1FXRA 3MM5A 3OLBA 1Z2ZA 4X4NA 2NXNA 3DLGA 2KM8C 1E6YB 4OJ1A 1CPZA 1G6BA 5KG3A 4CLZA 5KFVA 3W2WB 3FEXB 4Q45A 4UQTA 2HHSA 3DRYA 2G0JA 2V4QA 5FJ4A 1N32J 2JNJA 2Y9HA 5GAHI 1N5QA 2XY6A 5DETA 2VUGA 2DNPA 4P6QA 1SXLA 4DQSA 4QYRA 1FEEA 1JJ4A 4H4MA 4ZCLA 5J2MA 3HF5A 3IC1A 5AJ3J 2R7VA 1DTTB 3QGPA 2VBWA 4N41A 3CF5Q 2FJAB 1N36F 1WC1A 2IPOB 1KDNA 1WHVA 3W7BA 3GTYX 1NKBA 2HHHF 3H59A 3QFWA 2BR0A 5J1PA 1ROFA 5J2QB 1WG4A 3BJYA 3IRXA 1VQYA 5ETPA 5C25A 4ZHRB 4LUBA 4NLWA 2FC9A 2GMJA 2BW2A 1GK8A 1U6BA 5SUHA 3ZTSA 5HSPA 1S6OA 4NA1A 3V4IB 3WDOA 1HQEB 2I5JB 2HNDB 1QM9A 3I0SA 1KOOA 3MAAB 2H54B 3WIUA 4C8NA 3NGKA 2QE5A 1FO1A 1YBAA 4ECWA 3CCUS 2WONB 3RBDA 2DGWA 2CJBA 1Y4ZB 4DL4A 4LQ9A 1X5OA 1FDNA 2C2DA 4QCLA 1DFDA 3CE8A 1X4HA 1T03B 2EXUA 1I3OB 4K4YA 4NYOA 1TK0A 3IFEA 1JXLA 4ED6A 2IMWP 3UWTA 3M8SA 2IHR1 5F8JA 3KLGA 5HK4A 2KXNB 1R7IA 1SC1B 1JLQA 2EFPA 1R0CB 5I3UA 2AV5A 1IJEB 4KFBA 5KFUA 2CVIA 2HS4A 1VQ8S 3DKDA 4CYUA 3PCOB 2CPEA 3DOKA 1CSJA 4LF5F 5HJYA 1B0PA 1RT6B 5JXSA 5KFCA 1TKXA 1QUPA 5U47A 2AJ4A 2IM0A 3SBMA 3NMRA 4RWXA 4CLYA 3JQMA 2B3TB 4KYZA 3N0VA 5IT0A 2DNQA 1BWVA 4MH8A 3S01A 5HATA 5CYQA 5I4MA 1RT5B 4IFYA 2DISA 2CPYA 4DV7J 1FNMA 4YN3B 2BV3A 1MU2A 4JI1F 4F0MA 1IBLF 2C3OA 1ZAXA 4M5MA 4GMKA 2Y1JA 4J9OA 2LLZA 3BBFA 3J80Y 3EZOA 2J6SA 2RU3A 4CZCA 2B5JB 1LEOA 4Z7CA 4DSEA 3C2PA 4N5SA 1RGVA 3OHAA 4H54A 2D41A 3TQEA 1TELA 5KFRA 2QFJA 2FJDB 1KNZA 3LAMA 3TA1A 1FF2A 3AA8A 1QAYA 1U1QA 3R9LA 2BOAA 2QG9B 1APSA 3W2VB 4JI8F 2F65A 1QVGR 4BWJA 4ZCMA 3MECB 2WW4A 1UFKA 1YLXA 1SJ4P 4LFBF 3MTJA 3M8QA 4HL9A 2AJ1A 3NAIA 2VJVA 1H7XA 2KHCA 1W7WA 4WK3A 2PA8D 3CW2C 1ELOA 4LRDA 2F5GA 1C0TA 3VWSA 2AGPA 1FKOB 3GWCA 1DJ0A 4UUWA 4PRFA 3A8IA 3DRXA 1TTHB 3CPWR 2DNOA 4G1IA 2ZUGA 3THVA 4ZVFA 4ECTA 5B0FA 4UQGA 5K20B 2YNFB 2BJEA 3M05A 4ZIVA 4N56A 3MM6A 3DLLQ 5ETLA 1H72C 1TZ0A 2BJ3A 2J5AA 5L1JA 3QNWB 5KFNA 4WPAA 3KHGA 1SKRA 4FVCA 2YQ0A 3DOLA 3DRRB 2D1CA 3BN4A 3PO4A 3RB6A 4DL0C 3HSZA 1HNWJ 1WOPA 1CEZA 4NX9A 3OSNA 1HHQA 2E1MC 4MK9A 5C2GA 2XLIA 4RW7A 3C66A 4WCEQ 5AXKA 4JI4J 1HQ2A 1D8YA 2K2PA 4YS2A 4CO0A 4OHZA 4OX7A 2HLUA 2XGQA 3TUPA 4FPRA 1JKHB 3P5TL 1URNA 3PW0A 1TKTA 2VL1A 3HHNB 1NK8A 1SQEA 4QIVA 1NMEB 4U7UK 4P73A 4OX6A 1TKZA 2RS8A 5CYMA 3BSAA 5D15A 4LF4F 1ZTTA 3BGFA 1PILA 3UR0A 3R8YA 1SUQA 1R3NA 3T9NA 1D09B 4PWDA 1NO8A 3K7RA 3N28A 4QIFA 5JMNA 4G65A 3FBBA 1S7HA 1WI6A 2AKWB 3TUJC 3SSRA 2LP4A 3M2RA 1BQNB 3PVXA 2JLGA 3HULA 3KMSA 2MHNA 5T14A 4OZ3A 3GJTB 2FQQB 4ECSA 1B64A 1TL7A 3J81U 4GKKF 7FDRA 2DHXA 4DJBA 1RI7A 1LWFA 4S0MA 3CXCR 1OY6A 3IS9B 4YHHJ 1CQNA 3DRPB 4OI0A 4PXDA 2QLBB 2KTQA 1OY9A 4QOTA 3KLFA 2VBZA 3KKFA 2A2DA 1NJIT 3G82B 4RNFA 4J9VA 3GYNA 5IQQA 2B4OA 3GFHA 4GVBB 4MKVA 3HK2A 3C8YA 2BQ3A 3TX0A 3IMQJ 1RAOA 1O0PA 3IR6B 3CC7S 4Q0BA 4DR1F 2J7KA 4QZVB 2R2TA 2EKNA 1LWEA 3H42A 2JJ4D 4PYAA 3M9NB 2C2EA 5F3ZA 2O67A 2LU2A 1NZ8A 2VH7A 4WIIA 3QWUA 3T1YF 4QPTA 1FFGB 3GYXB 2DEIA 1P1LA 2CJKA 3OUYA 1V6HA 3M8ZA 2EI5A 1IWAA 4NCGB 3VGSA 1SV5B 4I1TA 2ZOGA 3GIIA 2V0NA 1F2GA 3UDVA 2HHXA 4DQRA 2OSRA 1UJ5A 2ZVIA 1DQ9A 1N48A 4M5DB 3SV4A 3FCHA 4LBIA 4IDKA 4UZBA 1Q95G 4M5JA 2HHTA 1MW7A 1C0UB 2AD9A 3KUGA 3TW0A 1E6YA 2IA0A 1LXNA 3E01B 2MZSA 2XCAA 2DRDA 3W2WA 2BE9B 2KHDA 2FB0A 1VJWA 4CRJA 2FY1A 3D67A 2IDEA 3IWXA 3N5FA 2R7OA 5HI7A 1S79A 1R0BG 2FJEB 1PBAA 3U02A 1RWUA 4UF4A 4I6AA 3W64A 2YNGA 1NRKA 3D2WA 1HR0J 4J5OA 3ZZOA 1HWJA 1WD6A 2CPJA 5E33A 3CJ4A 3AD8C 1HW9A 5F3TA 4NI2B 1N5SA 4EO8A 4LFAJ 5L9NA 1S1TB 2AHOB 1S1XA 1Q53A 2MQ8A 1MWQA 2LVWA 3NCQA 4IO1A 3EZ5A 4ZHRA 4K5SA 3H5SA 4KR0B 2XM3A 3OSPA 2KL8A 1LWXA 4J9SA 2R7RA 3PYEA 4USVA 5FLXY 2DNHA 2WVDA 4DL6A 3VALA 5H9FJ 3TA2A 2I5JA 4HT5A 1NPRA 1ZZNA 2HNDA 3MAAA 4IRKA 2DGXA 2W2OP 4B3OB 1WHXA 1MSWD 3UCUP 5D3GA 1F5CA 3A4TA 2WONA 2F1FA 4DXLA 4CM0A 4Z2XA 1SCJB 1HWKA 2XS2A 3GR0A 1SIWB 4WFXA 4FBTA 1T03A 2FUG9 3CUNA 1X4AA 2IJFA 2QMXA 1OJ4A 3PDNA 2ABYA 4YFUA 3FUYA 1K0VA 5IWAJ 5LMUF 3HFZB 3AA9A 2HWTA 3CJQA 4OI2A 4DX5A 1WEXA 1B7FA 4WXOA 4X4QA 4M1KA 3B82A 2PO4A 3ET6B 3NOCA 4K4ZA 4MKAA 3EWGA 1DY3A 3JSBA 2KFYA 1WORA 4NLRA 1RT6A 3HSGA 3N01A 3OPKA 5AXLA 2MEWA 2ZOFA 4OZNA 1ZZFA 1OQ6A 1DQAA 2E7VA 2NQPA 4F3QA 1RSCA 3IBCB 1VJQA 1N56A 1X9WA 2M8DB 3CTRA 5F0UA 4ZJOA 4B3MJ 3FBEA 5E0OA 4DDFA 4ED7A 3O8WA 2DH8A 3JQJA 1RT5A 3J81j 2C2KB 1X0PA 3PV8A 2EBGA 4U6PA 4G1QB 2VA2A 2H5EA 2V4RA 5KFOA 4TYBA 1C1BB 2BJDA 1TP7A 1GNKA 2B5JA 1F5BA 2G4BA 3J7YU 2MLXA 2V8PA 4CH1A 3ZNJ1 4ZCKA 5AT1B 4LREA 5LXRA 3ZFVA 1R27B 5ETSA 2HEKA 2RDJA 3I4PA 5B0EA 3KJVB 3KLEA 1GXTA 5KT4A 3W2VA 2P9CA 4I2PB 2W9CB 5IM0B 1NSQA 3MECA 4RUCA 2HRUA 4ZDNA 1JJ2R 3IR7B 2DR7A 3RRKA 2YY3A 4DHVA 4QBUA 4OYMA 3H7HB 2H51B 1RZMA 3Q8SB 3VVUA 2F8EX 3CD6S 3HKZD 2JX2A 2XYPB 1CVJA 4DL7A 2BW7A 2QJ3A 1W2BR 1N5TA 1FKOA 3MFIA 3AB2B 5KG0A 4USTA 4X4VA 2J0XA 1J5EJ 3AJDA 5A0YB 4JUZA 3PEHA 4DOZA 2BQRA 2WK4A 4WZQA 1RDRA 3NOGA 4DR6J 2VKZG 3SV3A 2WW8A 2MXYA 1RAGB 1ZAWA 1GXLA 3RAXA 3VQSA 3LUYA 3TZXA 4M8LA 4ZLPA 5IT4A 5KG1A 1T9VA 3S7RA 3PW7A 4ZVSB 3GILA 2J6UA 5F8LA 2FGCA 3GSIA 2BM1A 1G7CB 2CFXA 3DRRA 1H6KX 1VIOA 1FRIA 1Y7PA 4LSNA 1A9NB 1S10A 4TXSA 3UCGA 1RISA 3R97A 2MTLA 1H2UX 2IAJA 4WBFA 4UTGA 2CQ3A 3NS6A 2XWXA 1M90T 3NLCA 2WBMA 1CC7A 2KZMA 1I1GA 3UNYA 1JKHA 3KWMA 2KG0A 3Q22A 1D9DA 1RYSA 2M88A 4KBIA 4URQU 4HDGA 3G6YA 5G4DA 1L3KA 1YKWA 4LFCJ 3OQ2A 1GAOA 4W4MA 2VC0A 3FCWA 3AXMA 1NZAA 1BY9A 4M5LA 1LFPA 2GQQA 4B9UA 2E66A 1OMSA 3M8RA 3HO1A 5AXNA 1H38A 1PC4A 1KEKA 2C42A 4WZMA 2NLWA 4LRBA 4WKYA 1L5UA 2U2FA 4AL7A 1VRUA 3MDFA 1WKJA 1HW8A 4R5PA 1HBMB 1I5OB 3H2VE 4PG5A 1BQNA 1WHWA 2YXLA 5KT5A 4DZDA 2ZH6A 1ZETA 2HZVA 2UZAA 1KQKA 3NGUA 2YQ3A 3BKTA 3BDEA 4PKDB 1VISA 2KH9A 3HZGA 3HHLA 3GP9A 2HBYB 3R1HA 2DY1A 3G6VA 5E3QA 5DG8A 4YR2A 4OYXA 1R8AA 4ZVRB 3IS9A 3MMJA 2LQBA 4CWBA 4I4BA 3DRPA 3BREA 3V81A 3M1VB 4UUXA 3HJFA 4E8UA 5LM7E 3GIJA 3G82A 1UJ6A 2NYHA 2XQCA 4LF8F 4BC9A 2AJQA 2A6OA 4Q44A 2HLTA 4GVBA 3SZ2A 2MQMA 2JEGA 4NLVA 1DURA 4LRCA 4QWBA 4P7VA 4KAIA 5L1LA 2DGTA 3QO9B 2XS5A 5KFDA 3G8QA 1L3UA 3QGGA 4R8UB 1XNQF 3MM9B 3CDUA 1NDKA 4V19X 3MD1A 1OYEA 4AT1B 1UWBB 2ZEJA 3MPWA 4CNZA 1H2VZ 2HHUA 2OHDA 2C3MA 1BMQB 1J27A 5DJBA 2UV8G 1ZM9A 4NCGA 5IQ6A 1SV5A 4AL6A 1CJTB 4DR4F 5KFGA 4XDDA 1DZ5A 2R9LA 4CO4A 3QATA 4XIUA 3UVJB 1P27B 2CDQA 3FFIA 4M5DA 1XMQJ 1SL2A 4B3TF 3CMAS 2CNLB 1K44A 2YX7A 4M95A 3G6ES 5ETTA 4CO5A 3MEDB 5CH7B 1Y3KA 1C0UA 4ED4A 3OTBA 3E01A 3BYRA 3ETMA 1KFDA 4O3NA 1SQFA 1I94J 2GMLA 2ZNZA 2WOMB 3NL0A 1R8CA 1QAIA 2NXUA 4IQXA 1YDLA 4LF7J 4ID5A 3SQGB 3FEYB 2MHEA 3NAHA 2YKNB 3WQPA 1KQFB 1L3VA 2ZM6J 2B4PA 4C8OA 2HRYA 4WFNQ 1H2TZ 3NNAA 1F0XA 2CJYB 4RNNA 3AJ2A 2EBEA 2QLWA 4OYPA 1R8BA 4NI2A 2Y1LB 4C0HA 3EDQB 2FD2A 1S1TA 5LT5A 3TUIC 2BMBA 4V19J 3HHLD 4CM2A 5LSOA 1S12A 2HQ3A 1OPIA 3GONA 1KLMB 1RJJA 1NDCA 1H7WA 2V4JB 1VQ4S 4A8XA 4N77A 1N33F 4OLOA 3TVKA 1RYRA 3H2LA 2G1HA 4JV5F 1D3WA 2KJWA 2DHAA 2GJIA 3V6KA 3O3LA 2N4DA 1JLAB 3KK1B 2HAFA 4OZJA 2LA6A 3ZO7A 1PJ7A 4ZIWA 1S0VA 1XBWA 1KVJA 1NXIA 2W8KA 3HP6A 4B3OA 3M2VA 2DT9A 2RHSB 3PX0A 2LU1A 3MZIA 4GO7X 4B9TA 1VS3A 2ZKUA 3L09A 2A1BA 1AYEA 3LPEA 4Y2MA 2JLFA 2KT5A 2J0SD 4F4XA 2JLEA 2O1PA 4OJHA 2HMIB 4RBVA 1N36J 4DFMA 4F50A 4BS2A 2V2ZA 4D3GA 3PX6A 4DFPA 5F8IA 2FIUA 2VFSA 2HHHJ 4ECUA 2PFFB 2W24A 1U2FA 3GYGA 4PXBA 2LMIA 5ETNA 4WK1A 2V63A 1RLCL 4I67A 3W63A 2DTJA 2FJBB 1S76D 2XNQA 3CJ5A 3ILIA 1QSYA 2DXDA 2X1AA 4KE5A 4TQSA 5GADU 4ECZA 1MN9A 2LEBA 3K8WA 3TX8A 4RJVA 3I5AA 4G1PA 4A47A 5CD4H 3HVAA 1HD0A 3R7BB 5CZXA 3C19A 3OV7A 3JYTB 4MFBB 4G1QA 5B7WA 1C1BA 2E5GA 3CMES 1WG5A 3D0HE 2AYMA 1RKIA 3K5MA 2FVRA 1GXUA 2YPZA 2J76E 4YOEA 3BH6B 2YTCA 1RU1A 2JSXA 2F63A 1JLFB 3EGVA 4DG1B 3RRHA 4NMXA 1Q8KA 1G1XA 4JYAF 2K7KA 2I2YA 1Z1ZA 4ZITA 4NLOA 2ZUAA 1RHQB 5HP1B 3HHDA 3LANA 4I2PA 2W9CA 3C6UB 4JOUA 5IM0A 3MF5A 1DLOB 2CRLA 2PN6A 3RBXA 3CMQA 4B17A 5D0HA 4KGZB 2C3UA 2RDIA 3OW2R 3S8SA 2QT7A 1GQEA 4C98A 2ZNYA 1VQMS 1JLEB 4NRTA 4DR2J 3M32B 2J9DA 1Y10A 5F0WA 4NA3A 5K8NA 3OR2B 4KKOB 2ZBRA 2QA4S 2MSTA 2FTRA 1RAEB 4DV3F 4FF3A 1S7IA 2P9GA 3TEGA 4J9KA 4OYZA 2V6AA 3K5PA 3GV7B 3GQCA 5A0YA 1T9XA 4TY8A 3NGTA 1SI9A 3CSKA 2E9RX 2VODA 3DLHA 1GEHA 4JI1J 1IBLJ 1S59A 4OV1A 4DBQA 5EWFA 1ZM3A 1XQIA 2DCLA 2AYBA 1C4AA 3LF0A 5B08A 2JH3A 4TY9A 1BWEA 4UT4A 3SQOP 2X1BA 3VZHA 3FK4A 4I6YA 1U1OA 1U8WA 2WZ1A 4NA2A 4IRDA 4HH1A 1MWYA 4DV5J 2OP5A 3IXQA 3CJRA 1WF1A 1U2CA 4JI8J 5H9EJ 2OAUA 4MJKA 2UUWA 1UCNA 4DZ6A 5KT7A 1XNRF 2JZ5A 1HNIA 5H9FK 3AJ1A 4NPOA 3SFGA 2UXBJ 4Y0FA 4YR3A 3NCPA 4ANDA 1BGXT 1NSKL 1HFEL 3ELHA 3Q89A 4DLEA 2VPZB 4FP9A 3GCWP 4CP5A 2BXJA 4PEOA 1UVIA 3TUZC 3TO8A 2VFRA 2L48A 1SIZA 1HBMA 4FZVA 5E3CA 1VQ9S 3RW7A 3KUHA 3Q8RB 2DITA 2IMOA 1HBOB 1X4BA 1UJ4A 2FZCB 4MAKA 1WNEA 2YWKA 1VC5A 4J9PA 4NLGA 3DGPB 5HQ8A 3C3LA 1BQXA 4K50A 1IKYB 3VAIA 2CQ0A 1TU0B 4P10A 2ZC4A 3M1VA 4F4YA 4K4WA 1RUSA 2JC0A 4C11B 3T9ZA 1YTYA 1RT3B 3PFOA 2IY5B 3M9MB 3MR6A 3DNCA 4X4SA 1ZPVA 4HH0A 2K3IA 3PJXA 3TNVA 3FZBA 1GFWB 2XG8A 1S1WB 4NLXA 1LW2A 2BYCA 1A6LA 2HBZB 3J7Z5 1SJRA 3VV2B 2I0XA 3H2UB 2PI5A 3QO9A 3D0IE 3E2EA 5A6PA 3ZXWA 2HHPA 3MM9A 3I9V9 1SC6A 3PXGa 1Z4UA 3MPUB 3C14B 3KLIB 3THTA 2DRBA 3MMBA 2R2SA 2MZJA 2NCKL 2CJ9A 2B9WA 2XMMA 4JI2J 3W8GA 3HX9A 1CJTA 4ELVA 3SMZA 2F40A 3UVJA 2KXHA 2PDAA 4ATNA 1F1BB 4O0NA 1RK8A 2BJ8A 4GKKJ 1FDDA 4DR3F 1XR6A 2BKNA 2JDJA 2K06A 4KGKA 3OL6A 2AQ4A 2ZBCA 4GKJF 3G87A 4OI3A 3G4SS 1EB0A 1WELA 3MEDA 3QBCA 1KWMA 1N8RT 3W62A 1O8BA 4PR6A 2LQJA 5GAEI 4YP3A 3MEGB 2WVCA 1REVB 5DLGA 1YJUA 5BYSA 1WDTA 4Y3CA 1S1VB 2DVIA 4UOFA 5EHHA 5F9NA 2WOMA 2PGCA 1SB6A 1L3SA 1HARA 3C16B 1YK9A 2YKNA 5DG7A 2JEJA 4HVZA 2MQOA 4B9MA 1U25A 5DQHA 3T1YJ 4ZP6A 1AUDA 3T1HF 3BGRB 5J1NA 3Q8QB 1FFSB 5HMYA 4FN5A 2KVQE 1RP5A 1HYSB 3W9JA 1WWHA 2DR5A 3AXKA 4C8LA 2DIUA 1WF2A 1M5PC 5DZ7A 2YWHA 2Z56B 1UETA 1Z2LA 3OXGA 4KGMA 4X66F 3JAMY 2ZZMA 3R5GA 3PO5A 3CC4S 3TR5A 1JLAA 4J9UE 4X65F 3HXMA 4RUHA 3CJ8A 5CA5A 3CD0A 2YNHA 5KFHA 2UUTA 2YKOA 2CNKB 4NEZA 4K8RA 2VHGA 2DY9A 4IH6A 3BEGB 2BJ7A 3TJ8A 1X60A 2W4DA 2DIVA 2V67A 2MLZA 3MM8A 1VCTA 3BM7A 3FBFA 3GZ7A 6FDRA 1ZPWX 3ULHA 3WX8A 4ZVQB 3EYZA 3MEEB 2CADA 1X5TA 2HW3A 2BBEA 3Q2SC 2ZH8A 1P1TA 4J91A 2HMIA 5D4NA 4WU3A 1SVDA 4OFZA 1T05B 4EFAC 3T1AA 2UXCF 2RT3A 3ZZ0A 2C3PA 2QN6B 3US5A 3GFZA 2MQLA 2YWGA 1PAEX 4C97A 4DEZA 4C8MA 3NCRA 4C0BA 3DCAA 1UEVA 1F3FA 4KB7A 3SCLE 1TL5A 4NZ7A 3CCJS 1FCAA 3U1LA 1TL1A 3E8OA 2AGOA 2YX4A 3KFWX 3MR2A 5DGAA 4A4JA 2LXUA 3HHLC 2MKKA 3D6HB 1ZH5A 3ENAA 3MTKA 3EVWA 2L41A 2XYHB 1UFWA 2D9OA 5HMWA 3GU0A 1NHUA 4LF2A 1NU4A 1PIEA 3GPAA 4PPDA 2WBRA 4ANCA 4HT7A 4NLPA 3JYTA 3AT1B 3PIOQ 4MFBA 1NK6A 2FC8A 2V2VA 2ROPA 3JB9k 1UEUA 1RXOB 5KG5A 3I55S 4DU7A 2VB6A 3X3UA 5JVHQ 2E5LJ 1JLFA 1SJFA 4RW8B 1UW4A 4ELTA 3GJRB 1Y5NB 4RNMA 4DG1A 5I42B 4Y34A 5LMUJ 1KD1T 2VONA 3CCRS 3FQKA 4IG0A 5HP1A 1IVZA 5T7LA 4ERDA 3CJ2A 2ILZA 4RU9A 4DR5F 2DEJA 2KJVA 1DLOA 2NXCA 3ETOA 3HT0A 4HEA9 2VDHA 2AEFA 3D5MA 5BYQA 5E3RA 3MMAB 2RRAA 3TZWA 2BVZA 2KM8B 1T9TA 1YQHA 5HQMA 5LJ3Y 3A3NB 2HFSA 4EUVA 3AD7C 2AYEA 5DDQC 1WHYA 2IIHA 2HKEA 4WWSA 1XC9A 4DX8H 1JLBA 4P71A 3WC2A 1YG0A 2ROEA 1E6VB 4Y65A 1YGYA 2LCWA 3FMBA 1VC6A 2R4FA 1HLWA 4RUAA 4ZPWR 2UV8A 1NBEB 3QWPA 2R2RA 8AT1B 4LRFA 2F9JA 3DMJA 4C3LA 1JQGA 2E7XA 2LQ8A 4TN2A 4HR2A 2GIQA 2DO4A 4YB6A 1KTVA 5J2NB 2Z58B 4CI0B 1FJGF 3I56S 1OS5A 4M5GA 3BYPA 3OTOF 4CNYA 1TFWA 4OLPA 2IBKA 1RAIB 3BO3A 3IGNA 3DI6B 1QTMA 3IRWP 2YPYA 4ICLB 4WJBA 4DCJB 1LWCB 2MDAA 2XMKA 2AJ2A 2AJFE 4EZ6A 2ZH5A 4DR7F 4KPCA 3CJ3A 1RADB 3EGZA 4P2XA 2J0WA 2K7JA 4W92B 2V68A 1S1UB 3N4WA 3PRDA 3QAUA 1MWZA 4FVMA 4LIRA 3D4JA 3HI9A 5ETRA 4DUYF 3CNQP 3NNHA 1TK8A 3GG1A 1UA1A 4JI6F 3V6HA 1SC3B 3RRGA 3DDIA 4OHVA 4JI5F 5GAEU 3K5LA 4DPWA 3GG0A 3MEKA 4K4TA 3OFEA 2ZVSA 3OXLA 1YJVA 1NKCA 1HBOA 1UZDA 1DTQB 1NDLA 2E5JA 4C48A 3L7UA 3P8BB 1JWWA 1G4CA 3OBIA 2UU9F 3UQSA 2ACMA 2EKYA 2WSFC 2CNOB 6FD1A 2HFUA 3MPYA 5I3PA 4HI2A 2KFZA 4AQYF 4C11A 3EPGA 4KJIA 1WJ9A 1RT3A 4C7QA 1N0UA 1S6QB 3IA0A 4DV0F 4USMA 3M30B 1S1WA 4LR8A 5HVHA 1FKPB 2BE7D 2RIJA 2ZH7A 3CCWA 2HVDA 2AZ3A 3I4HX 1YJWS 5GVQA 4NXMF 4OYIA 1RTHB 2XCPA 5KG2A 2Z2YB 1S9EB 1CBKA 3FQLA 1Y11A 3V6DB 2HNYA 4ZVPB 3CB4A 5EWEA 2IJNA 1U24A 4C0OC 3MD3A 2ZHAA 4RZRA 2GVZA 3OFHA 3QT6A 4ED1A 2B4VA 3I5CA 5CQGA 4OI6A 2XI3A 2W4CA 1FD8A 3H4BA 3DXBA 5DM7Q 3K59A 2PE8A 5A8RB 3VCDA 3OJSA 4QW9A 2MPUA 1VLOA 3D54A 4USJC 2J9EA 1RCXB 4J9MA 3IR5B 5KTQA 1J5OA 3EXYA 3MEGA 4RBUA 4ZLJA 4RNHA 1OQ3A 4PG4A 1CULB 1JX4A 1S1VA 1FHTA 4LF8J 2B7CB 4YB7A 2WRMA 4DCOB 3Q8PB 3IM8A 4EI2A 1WC0A 3H5UA 1XMOF 2W9BB 3PYFA 3C16A 1WEYA 4CLKA 4HI1A 2DD8S 1ZM4A 2V69A 1F2HA 1RWVB 2DNLA 2K3KA 3K58A 2ZITA 1X31C 1XNQJ 4J9LA 3UNGC 4Y6IA 1ZA2B 3BGRA 1S57A 2GO8A 3VGUA 2HVZA 2OGUA 4OI1A 3DM2B 2Q6BA 1HYSA 1VBZA 3KLHB 5A76A 1NJYA 3L4BC 3LW5C 4DR4J 1PO6A 4OQJA 4LSZB 2GA7A 5H9EK 2ASJA 1V3ZA 1AFJA 4PXCA 2XMUA 3OL7A 4IUFA 2M3DA 1M5SA 2RKIA 4YEAA 2MKJA 5DQIA 4B3TJ 5KFYA 1T94A 1O5JA 4QYZJ 2PSZA 1X5SA 4A8MP 1T95A 5M2PA 3VF0B 1RWPB 2HQDA 2KYZA 4DV4F 1VBYA 3JSMB 3M2UA 3POTB 4PXEA 2UP1A 1FX2A 4LT6A 3Q0AA 5DDPC 2GV1A 4U96A 2RQKA 2HYIB 2NSBA 4F7VA 3C6TB 3O5TB 2Z2LA 3S6EA 3TP2A 2MKHA 1QAJA 4RWWA 3F0NA 4LRAA 3PHEA 4WIQA 3PW5A 1RWKB 3BO4A 1FJEB 2MKIA 3MEEA 4RO0A 1MROB 4D3HA 1DBDA 2JRSA 2QLFB 3OR1B 3I0RA 3D66A 3VGVA 1KQSR 5C7PA 3U1MA 1RTJB 1TVRB 1TR0A 5IZHA 1RTIB 3IG1B 1U45A 1HWIA 2EW9A 1U7LA 4PG6A 2GJ2A 1ZBTA 3G86A 1V3SA 1M5KC 2W7OA 4TKTA 4BLGA 2VG6B 2LDIA 1I6JA 3BN7A 1N33J 4JV5J 4J9RA 1EAYC 5KFEA 2DPJA 4HHHA 1TQLA 1VHIA 2XYGB 2H4WB 2RH3A 2KZZA 2MZTA 4KO0B 1BD6A 1JLCB 1NDPA 2FHOB 1HPZA 1H74A 2WAQD 4DPTA 2BUNA 2MZ1A 3I31A 2IRXA 4PQUB 4XTTA 2XSFA 5IV4A 2HPUA 2W7PA 2I8EA 3QZ7A 3LWLA 4LF6F 3J80U 4X4UA 3UD5A 4ED3A 4OZ5A 2E5HA 1RHJB 4RW8A 4WE1B 3LA0A 2DKOB 1NK7A 2WSEC 3R5DA 5I42A 1YWXA 4C3KA 4ALZA 3L7PA 3BKUA 5HMXA 3NWRA 1U0HA 1ZAVA 4TU7A 2R7SA 1RHMB 2D3UA 3MMAA 3NRBA 2OMOA 3QJLA 2E9TA 3UD3P 2XC9A 1CJVA 2M8HA 3AFGA 2XULA 2DGOA 2IRUA 2IM1A 2KYXA 3NBPB 3ZTRA 3GMGA 2RQ4A 1JMTA 1S4EA 3RBEA 2E1RA 3IGVA 3EZUA 5KFQA 3Q86A 3W9HA 1QJHA 1HD1A 1Q8IA 4RW4B 4RW9B 2O5DA 2D7SA 4HTIA 2Z30B 2D9PA 3PG9A 1UVMA 2Y3YA 5CABA 4B3RF 3HSJA 5J2NA 4DCPB 2I9SA 1HI1A 3B4DA 4F4ZA 2QSWA 4ZVOB 4I68A 2GMHA 1R6YA 4JYAJ 5E2QA 2NXJA 2HHQA 3DI6A 2L08A 4KSEB 1D0EA 1JIHA 2XMTA 1HQUB 1RABB 3RB4A 3CT9A 1S0NA 2KKHA 5IS2A 5FDLA 5EN1A 3FVYA 1VC0A 4BC7A 2E1AA 4PG7A 2XZTB 4XK8C 4QWCA 7FD1A 3PYDA 2LECA 3BPSP 2YNIA 3RUBL 4RBTA 5LSRA 1N5YB 4E98A 3R6LB 3CJ0A 2VQEF 2GFFA 4PWWA 2MSSA 4DV3J 3BGUA 2GHWA 2OPPB 4OZ1A 3NP5A 1U1NA 4OZ0A 1UPMB 3X1LB 2LEAA 3W5YA 4HYKA 3GCXP 1IKXB 4EYHB 5D8HB 1V9OA 4DN9A 1XR5A 1RAJA 1FESA 2FVPA 4WP9A 2JFDA 3IBFB 4IR9A 4BBYA 1R89A 1TK5A 1FDAA 1S0MA 3B54A 4LR9A 2ALZA 2Y8YA 3J7ZT 1DTQA 1UEKA 3BO2A 1U6ZA 4CLFA 2E1CA 3DLKB 3LALA 2ROGA 4AXJA 2FLPA 2DNZA 1MLAA 2QZ8A 4MMOA 2CQ2A 2OPRB 3QJPA 1M5OC 4IR1A 4C9DA 1S0OA 2GAGC 2KRBA 3M7VA 1LFWA 3EICA 3N6MA 2BZ2A 3JTOA 2AX1A 1KTQA 1YX2A 1XNRJ 1WC6A 1R0AB 2ZJQQ 1RHUB 4GC6A 2I1RA 1P6TA 5KFJA 1S6QA 3OLAA 1TMJA 1ZOTA 4R0EA 1FKPA 4CO1A 2EK1A 5IV3A 2CZVC 1C1CB 3ISNC 2HHVA 3QPIA 5B0GA 3NS7B 3T6BA 1PCAA 4RPFA 4PYDA 1RTHA 4A8SA 1NNDA 3AQOA 5HBMB 2DR6A 3A3PB 1S9EA 2C22A 3MM7A 2WVBA
chains in the Genus database with same CATH topology
2RJZA 2HGLA 3KK1A 4ED8A 4PWDB 3MURP 5J1EA 3R27A 4A8OA 2XS7A 5C24A 2DTJA 2FJBB 3AAWB 3OVBA 1FTRA 1VIXA 4USIA 2MGZB 4F02A 4F67A 1S76D 1OIAA 4IOAQ 5KT6A 2ACYA 4OHWA 4FBUA 5C42B 2XNQA 3CJ5A 2FLLA 3MI7X 2AYGA 2MQPA 3VAFA 1QSYA 4AFFA 2X1AA 4KE5A 4TQSA 2Z2MA 4H4KC 1SBRA 3P3DA 1JB0C 5GADU 1KN6A 2OPRA 4ECZA 4C8ZA 2M4MA 2LEBA 5DLFA 3K8WA 4DFJA 2IM3A 2RILA 4CO3A 4TLQA 1U4BA 2CQ4A 2PD1A 3CCZA 3O6QA 3TX8A 3SYZA 3HFKA 1FVQA 3M2RB 4DV1F 1S72S 4ID8A 2ASYA 1IM4A 4KT0C 5HMZA 3N6NA 4O23A 1EETB 2KN4A 4NLDA 3SSSA 5A8RA 1M0SA 3I5AA 4G1PA 4A47A 4CH0S 5HLFB 5CD4H 3HVAA 1HNZF 4MYUA 4YDXA 1HD0A 3KTQA 5CZXA 1KLNA 4X4PA 1R0AA 3OV7A 1MNEA 3JYTB 4DL3A 2CJQA 4MFBB 2BDPA 1NHVA 4G1QA 3N5BA 4O3OA 2RVJA 2J7WA 2X3GA 4DV6F 2PT0A 1X7VA 5B7WA 4ED5A 1C1BA 2E5GA 2AJ0A 4G6VB 1R8PA 3JSRA 1WG5A 3PJWA 2RNEA 4OJ3A 5EX0A 3CMES 2XNRA 3D0HE 2RQCA 2AYMA 4TY8B 1RKIA 3O2IA 3K5MA 3M6UA 4NLYA 2FVRA 4XAKA 4A46A 1JJHA 1GXUA 2XI2A 3UE2A 1LWFB 2J76E 2N7YA 3I87A 3KYLA 4YOEA 4MIWA 2CPDA 4AXIA 3GR1A 2YTCA 3QLHA 1NKEA 2JSXA 1XN9A 4OHXA 1JLFB 2FGOA 2J6TA 2VFTA 3I32A 5M2RA 4I2QA 5A8WA 4OJGA 1HA1A 5EGYA 1SH3A 4CTAA 3KLFB 4DG1B 5J2PA 3QJJA 3RRHA 3MHYA 2ZHBA 3MUTP 2W8LA 4DFKA 2FHMA 1G1XA 2R8IA 4LQ3A 3DDNA 1HWLA 4OI4A 4JYAF 2K7KA 2I2YA 1JNRB 2GHPA 1C2PA 3CVKA 1Z1ZA 2BQUA 1M5VC 1UVNA 1RKJA 4NLOA 5E5NA 5GADI 1FRMA 3RB0A 5HP1B 3HHDA 1RT2B 3LANA 2BOPA 4QIEA 4I2PA 4WYLA 2W9CA 3CCTA 1LW0B 3C6UB 4JOUA 1NK4A 4ZMMA 5IM0A 3BDPA 4X4OA 3QIPB 2RUGA 1Q86T 1IKWA 1JK9B 3MF5A 1DLOB 2CRLA 3CDBA 4TLRA 4USHA 1VI7A 2PN6A 2JVOA 3BSNA 4A8QA 4Y28C 3A1YG 4B17A 3GV5B 2LKZA 1VHFA 4C4WA 2C3UA 5C42A 5LJ5Y 3N9UC 4Q0BB 2DNRA 2RDIA 3R3TA 3OW2R 3S8SA 2QT7A 4IOBA 1GQEA 4NXNF 1LWEB 1X8DA 4C98A 1FERA 4X64F 3LWMA 2ZNYA 3VTIA 3OTDA 1VQMS 1AXQA 1JLEB 4NRTA 2VG7A 3M32B 2J9DA 2ZM6F 1UFLA 3T5JA 3N79A 2ILYA 1IQZA 3GSDA 4ZPVR 5E41A 3PR5B 5F0WA 2PEHA 3H25A 3PFEA 1RT7A 4NA3A 4ZP8A 5K8NA 3OR2B 4KKOB 3DDKA 2Z8QA 4O3QA 1FRLA 4KHMA 4OZLA 2QA4S 3P6YC 2V8HA 1NB7A 2YX1A 2M5YA 3KLHA 1TKDA 4H4MB 4KV8B 2MSTA 1XERA 2FTRA 5L8RC 1N6QA 2OPSB 1HNIB 2VG5B 5HLFA 4DV3F 3HVTB 4FF3A 1GTHA 1KONA 3HVWA 1S99A 2P9GA 5EUHA 4J9KA 4FF1A 3OUYB 5GAHU 2YVSA 3VAMA 3K5PA 1XEZA 3GV7B 2OJ3A 3LP1B 1B0TA 4KTQA 5KFAA 4F3MA 2J9CA 3NMAA 2FVQA 2CQIA 4EBDA 4ECRA 3GQCA 1SKWA 5EX3A 5A0YA 3OVSA 3MUVP 3PIPQ 1VBXA 2E7WA 1FJCA 1U6FA 4O4GA 1V3RA 4TY8A 1EP4B 1SI9A 3C46A 3CSKA 2DH9A 2DNYA 3LGNA 3I9ZA 3NS5A 3PZPA 3BQ0A 2E9RX 3DLHA 2VODA 2B0GA 1PGZA 4K4UA 3E51A 2ZH1A 4MTPA 3B8HA 2X1FA 5KFLA 1JLGB 4OV1A 4DBQA 5EWFA 3VAHA 2R7TA 4ED0A 1K9MT 5KFSA 1ZM3A 3JSMA 3POTA 3PM9A 2ZZNA 4IDKB 5H1SV 2DCLA 2AYBA 2HWHA 2AGQA 1FXRA 3MM5A 1C4AA 2SXLA 3LF0A 3OLBA 1PC5A 2V5HG 5B08A 1Z2ZA 2JH3A 2LXIA 4X4NA 3G96A 1T8EA 4TY9A 1BWEA 1S9GB 3DLGA 4CO2A 3CDEA 3D1HA 4F2RA 2KM8C 1E6YB 2YWFA 4OJ1A 5B0AA 1CPZA 3ITHB 3CJKB 1G6BA 5KG3A 2X1BA 4ZK7M 3VZHA 3C6TA 3C6UA 4I6YA 1U1OA 4NA2A 3Q23A 5KFVA 4IRDA 3W2WB 4HH1A 2R8JA 1MWYA 3FEXB 2EC0A 2OP5A 3IXQA 4Q45A 4OMFG 4AL5A 1QY7A 1WF1A 3TANA 2AF6A 2GIRA 4UQTA 3DRYA 2HHSA 3MPVA 2V4QA 1VQ6S 1OWXA 5FJ4A 3AH6A 3AQPA 4RLEA 3CCQS 4LF9F 5GAHI 2DNNA 5H9EJ 1JLEA 1B0VA 1SH0A 2OAUA 3M32A 3QGHA 1S97A 4RX6A 5BR8F 2FHKA 1N5QA 4FNHA 4CCHA 2XY6A 5DETA 2XWYA 4OX8A 2VUGA 2DNPA 3OR2A 2UUWA 2YKMB 4KKOA 4MJKA 4P6QA 4QWEA 1FVSA 1SXLA 5A8KB 2GW8A 4DQSA 4QYRA 1FEEA 1FE0A 1YJRA 3OR1A 4KPYA 1JJ4A 5A6WA 4H4MA 5KT7A 1XNRF 2JZ5A 4ZCLA 1LK7A 2OPSA 1HNIA 3SI8A 1RTDB 1TVRA 3O44A 5J2MA 3HF5A 3JTNA 3AJ1A 4NPOA 1IKVB 3OFFA 2QIFA 3SFGA 3IC1A 2OTLS 4Y0FA 2R7VA 4YR3A 2HIQA 1DTTB 3QGPA 4OIXA 2PMZD 1RTIA 3IG1A 2KU7A 2EWHA 2VBWA 4N41A 3NCPA 1BGXT 1VQOS 3CF5Q 2FJAB 3LQVA 1N36F 2NR0A 4PG8A 4HLBA 4C3MA 4JV1A 2R8GA 3H40A 1X9MA 1Q82T 1EP4A 3M9OB 1HFEL 1XWLA 4DLEA 4ZVGA 1WHVA 4ES2A 3W7BA 1RT1A 2V2KA 1NKBA 2EG1A 2HHHF 3H59A 4KRWA 1VQSA 3PNIA 2VPZB 4FP9A 1M1KT 2BR0A 3KLGB 5MLCV 1H98A 3DLJA 5J1PA 1LW2B 4C8KA 1ROFA 5J2QB 1WG4A 2VOPA 3KHLA 4WFAQ 3BJYA 3IRXA 3PEJA 4Y2IA 5KFIA 2BXJA 2XBPA 1VQYA 1UVIA 5C25A 3TUZC 2RB7A 3TO8A 4ZHRB 2VFRA 4LUBA 4NLWA 2FC9A 2GMJA 1N4LA 5KOXA 1N52B 2DBBA 2L48A 1SIZA 2BW2A 2RQMA 4BHQA 2UVRA 2KRRA 4YMEA 1U6BA 4IH7A 1HBUB 5SUHA 5DS7A 2DPIA 1HBMA 4FZVA 1HWUA 5E3CA 2Q6CA 5JVGQ 1VQ9S 4KHRA 3FRZA 3RW7A 2RD5C 4EEYA 2G1DA 1JLCA 3Q8RB 2NPIA 2DITA 2HZCA 2IMOA 3BB5A 3CO9A 2PC6A 3T6JA 1HBOB 1S6OA 4NA1A 4B08A 1X4BA 1ZYQA 3V4IB 3MOJB 3WDOA 1WEZA 3MMBB 2R7XA 1HQEB 1UJ4A 2L3MA 2I5JB 2HNDB 1QM9A 3I0SA 4MAKA 1WNEA 2YWKA 3LOUA 1X4GA 3KK3A 3T5HA 1VC5A 1KOOA 2CQBA 2CKWA 4J9PA 4NLGA 5DDRC 4IG3B 4C8NA 3NGKA 1HMVA 4MYTA 2GQCA 3HZEA 3UFCX 5L1KA 2QE5A 5HQ8A 3C3LA 3SSQA 1FO1A 1GH8A 2C28A 4MK7A 1BQXA 1YBAA 4ECWA 3CCUS 2WONB 3RBDA 4K50A 3LH2S 2DGWA 2CJBA 1IKYB 3W3SA 1DTTA 3VAIA 1Y4ZB 4DL4A 2CQ0A 4LQ9A 1X5OA 1FDNA 2C2DA 4QCLA 1DFDA 5DM6Q