2K3KA

Solution structure of drosophila melanogaster snf rbd1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
b'MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 small nuclear ribonucleoprotein A
molecule tags Rna binding protein
source organism Drosophila melanogaster
publication title Structural and Functional Studies of RNA Splicing Factor Sans-Fille by Multidimentional NMR Spectroscopy
rcsb
total genus 29
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2k3kA00
2RQ4A 2MKIA 2RVJA 2DGOA 1U1NA 2PE8A 3OW2R 1U1MA 1M5VC 2MZRA 1WEZA 1HD1A 2CPHA 1KD1T 5GAEU 3S7RA 2K3KA 3LQVA 4TLQA 2RRAA 4C0OC 4LMZA 3RW7A 1O0PA 3NNAA 3CC4S 1X4GA 2CQ3A 2G1DA 3L3CA 1KC8T 2EVZA 3VAGA 2MQMA 1KQSR 3K0JA 4LJMA 1WEYA 2KFYA 3DLLQ 1NU4A 3CC2S 5LJ3Y 2MGZB 3CMAS 2AD9A 1BY9A 1U6BA 3S6EA 2XNQA 2DGXA 3CCQS 1QVGR 3UD3P 2E5IA 1R8HA 1L3KA 2DNMA 3FEXB 1SJFA 2XNRA 5HL7Q 2A3JA 2F9JA 1DBDA 2KM8B 1U1LA 1X4HA 4PKDB 3CF5Q 2MY7A 1WG1A 3THTA 2KT5A 3HI9A 2JWNA 2YH1A 3NNHA 2DIUA 3CCSS 1N88A 2MKKA 2E5HA 2J0SD 2FPHX 1KOOA 3MI7X 5IM0A 2MZ1A 3JB9k 1HA1A 2CPFA 1VC0A 3VAJA 2D3OR 5BJRA 1WG4A 1YI2S 1SXLA 3NS6A 3U1LA 3N9UC 3G9CA 2N7CA 3MD1A 3SXLA 3I55S 3G96A 2L41A 1WG5A 2M0GB 3D2WA 3UCGA 2DGVA 5DDQC 2J0QD 3B4DA 1VQLS 1KOHA 1Q82T 3ZZZA 4C4WA 2HVZA 2KG0A 3CTRA 1F9FA 2LA4A 1FO1A 1X4EA 1YTYA 4CH0S 3G4SS 2MSTA 1WTBA 1FXLA 2DNRA 1WHYA 1QM9A 3BS9A 3V4MA 1VQ9S 3ZZYA 2X1GA 3S01A 1VC5A 1M90T 2AYGA 2KRBA 2X1BA 5DDPC 2CPXA 1N8RT 1SJ3P 1H2VZ 3UE2A 1OPIA 2LA6A 2KN4A 2NLWA 5IFMA 2WBRA 2DO0A 1JJ2R 5GMKa 3G8SA 4WFAQ 3EGZA 3TO8A 4FXVA 2RS2A 3HHNB 2XB2D 2ERRA 2MXYA 2N3LA 3UD4P 2FY1A 1FJ7A 2VOPA 2CQDA 1B7FA 3US5A 2AYBA 3J7ZT 2MKCA 4F02A 2CQ4A 2AYMA 3IWNC 2EK6A 2LEAA 2DK2A 1YJ9S 3P49B 2MQQA 2DNKA 3CMES 3SDEA 3MD3A 2KXNB 2JRSA 1A9NB 2HGMA 1M5KC 2KU7A 5ITHA 2E5GA 2MMYA 2I2YA 2LMIA 1AUDA 1N54B 1U6FA 2XS7A 2MY8A 2OIHA 3MUMP 3CCUS 1PGZA 3Q2TC 4BS2A 1WF2A 1WHWA 2RT3A 2DGQA 2M70A 3G8TA 2J76E 1CVJA 4J5OA 3VAMA 4W92B 2MZQA 1W2BR 2DH8A 2DGTA 2LXIA 1WI8A 3P3DA 5IQQA 1X4CA 2ZJPQ 3CCES 3VAHA 3VAIA 1U1KA 2MPUA 2CQ1A 2CQHA 1YITS 4F26A 1FT8A 4A8XA 1H2UX 2QFJA 3CD6S 3DXBA 2OTJS 4W90B 5CXTA 2RUGA 2JVOA 2DNZA 2CQ0A 2D9PA 2ZJRQ 3VAFA 1VQ5S 3NNCA 2FC8A 5GVQA 5GAGU 2ZJQQ 2OTLS 1JJ4A 4WFNQ 2FHOB 5MLCV 2CPZA 5D77A 4Y0FA 2QA4S 1FNXH 5DDOC 3UCZP 2M8HA 2LQ5A 3EX7B 2K8GA 2MKHA 1YJWS 3MUTP 2M52A 4UQTA 3I56S 1H2TZ 2VOOA 3R1HA 1SJQA 2NZ4A 3R27A 2RU3A 1OWXA 2LCWA 2L08A 3SDEB 2HGNA 2DB1A 4IOCQ 2XS2A 2EK1A 2LXUA 3CCMS 1VBZA 2DGWA 5DDRC 1URNA 2I38A 2HYIB 2RS8A 2DIVA 3MXHP 2YWKA 2M7SA 2KRRA 5D78A 4IOAQ 2M9KA 4OZ0A 1VQ6S 4WKRA 2KHCA 5CA5A 5DM7Q 1YHQS 3CULA 2DNQA 3CCJS 4V19X 2M88A 3G71S 1RK8A 2MZTA 2MQLA 2DH9A 2BOPA 4F25A 3UWTA 3CXCR 1NJIT 4QPTA 2DHAA 1DHMA 1XN9A 1YWXA 2MJUA 3P5TL 2G4BA 1U1PA 2DHGA 1P1TA 2GO9A 3P6YC 3CUNA 2DH7A 1RKJA 1ZZFA 2PEHA 2DNOA 2L9WA 3BO2A 2GHPA 3CCRS 1HL6A 2OSQA 2J8AA 2CPDA 2O3DA 1G2EA 4CIOA 3MDFA 3VAKA 5GADU 2CQPA 1DRZA 1OO0B 2DGSA 1DZ5A 5LXRA 3NS5A 1PO6A 4ED5A 1FJEB 2D9OA 3FEYB 2KG1A 4IUFA 5DM6Q 2CQ2A 5CYJA 1VQ7S 2KH9A 2M4MA 2DNLA 2BZ2A 1OIAA 2MKSA 5EN1A 4FXWA 5HO4A 2YH0A 3SMZA 4IO9Q 4RU2A 2N3OA 2KYXA 2DNPA 2LECA 2B0GA 1WF0A 1U2FA 4TU9A 1X4BA 1JMTA 2CPEA 1Q81T 2VONA 4EGLA 1WI6A 1WELA 2MKJA 2LKZA 5H1SV 5LJ5Y 5JVGQ 2V94A 2MZSA 3H2VE 1Q86T 2CPIA 2F9DA 1R8PA 3CC7S 3B4MA 4YOEA 3J7YU 1WWHA 2KXHA 1JJHA 3MURP 1H6KX 3CCLS 1ZZNA 5GAHU 1P27B 3ULHA 4TU7A 4OZ1A 4PRFA 1ZH5A 2AYEA 3BO3A 2N82B 1U1OA 3THPA 1K73T 2CQBA 3VF0B 2ADBA 1WHVA 1SJ4P 2KVIA 2OSRA 1M5OC 2UP1A 2DISA 2DITA 2CPJA 2SXLA 3BO4A 1NO8A 2CQGA 3IRWP 2XSFA 3CPWR 5JVHQ 1VC6A 1VQKS 3NMRA 3UCUP 2YKAA 5DETA 1S72S 2DNHA 2F3JA 3R1LA 4QQBA 4YB1P 5LSOA 2CJKA 1WF1A 3PIOQ 2KM8C 2LEBA 2DGUA 4QU7A 1VQNS 1M1KT 3G6ES 5FJ4A 2XS5A 2MSSA 2CPYA 4LIRA 2X1FA 3Q2SC 2MQNA 3MUVP 2RQCA 2M8DB 3RW6A 3PIPQ 1HD0A 1VQOS 2DHSA 1UAWA 1X4DA 1X5SA 3BEGB 5LXYA 2U1AA 2DO4A 2JX2A 1WEXA 4PR6A 1UFWA 4CQ1A 2FC9A 2KI2A 1YJNS 2MQOA 3S8SA 2DNYA 3TYTA 2MQPA 3LPYA 3CCVS 3TP2A 2MZJA 1Q7YT 2MHNA 1X5OA 1SJRA 4YUDA 1X4FA 3H2UB 3MOJB 2KXFA 4M5DB 2VODA 2X1AA 4UY8T 4U67Q 1UW4A 4ZKAA 4ERDA 2CQIA 1U1RA 1X5PA 1D8ZA 1S79A 2HGLA 2U2FA 1M5PC 4CH1A 4C7QA 1A7GE 1N52B 1IQTA 2MGZA 4TU8A 2QEXS 4WF9Q 1FHTA 2LYVA 2DNNA 4WIIA 2CQCA 2RRBA 5LSLA 1VQ4S 2HZCA 1X5TA 2MJNA 4WCEQ 4WFBQ 1QVFR 1VBXA 1K9MT 1VQ8S 4Y00A 3VALA 2Q79A 2G0CA 2E5JA 1VQMS 4P6QA 1VQPS 1YIJS 2DHXA 2M2BA 2YTCA 4QU6A 1D9AA 2E44A 5IM0B 4Z2XA 1K8AT 1WHXA 3U1MA 1VBYA 1U1QA 1X4AA 2OJ3A 1FJCA 2JVRA 2RNEA 2MB0B 2MYFA 3EGNA 2DNGA 1UP1A 1X0FA 2ADCA
chains in the Genus database with same CATH superfamily
1RCOB 5K9FA 2MKIA 3BV8A 1TKZB 1D09B 2DGOA 2JZ5A 3QPIA 5F0WA 1GX6A 1C4AA 1UCNA 2B51A 2HLTA 2C2NA 2CG4A 4USIA 3C15B 4ES1A 3OW2R 4ECZA 1U02A 1FDBA 4DN0A 2W9CB 1AA1B 1FCAA 2CPHA 2NSBA 3SFGA 1TQLA 4WP8A 3JSMA 4M5JA 3MEDA 5GAEU 3J81Y 4JBCA 3KYLA 2K3KA 3LQVA 3RB0A 4IRKA 4LMZA 3KJFB 2C1EB 2JEGA 2CJQA 2EEYA 3CD0A 4FKYA 3CT9A 1LV5A 3GCWP 2JLEA 3NNAA 2AJFE 1EJ7L 3A3PB 2G1DA 1V3ZA 2VD3A 2R3VA 3DLGA 3M30A 3OFEA 3BJYA 1D9DA 3NMAA 1PBAA 5LMUJ 2UUAJ 4WZMA 1GAOA 2RB7A 3V5RA 2P5VA 1KQSR 3JXOA 3B54A 2B9EA 1TAQA 2QIFA 2HHXA 4PWDB 3SCIE 1F60B 1S1XA 1IKVA 3K59A 3CC2S 4DCJB 2AGOA 3EXYA 3CCUS 2E1AA 1BY9A 1PBUA 1FDNA 3EVWA 3I5CA 3IO1A 1NRKA 2N4CA 4HL9A 3S6EA 4LF5F 3O5TB 4G6VB 2BVZA 1ZPVA 3FSXA 3CCQS 1QVGR 3L7UA 2V69A 2ZBIA 1FJGF 1AW0A 4WXWA 2CDRB 4CM2A 1SJFA 4KQZA 3J81j 3PNIA 5KFZA 2C22A 2XNRA 4ILMA 2BKNA 1S9FA 3U02A 3GFHA 2M3DA 2D74B 4PKDB 1B0PA 5G0RA 1ZTTA 3PJWA 4J9KA 4AL6A 4M94A 2NPFA 4XTTA 4NXNF 2O66A 2KT5A 2OKQA 1GMUA 3D6HB 2XO6A 4OI2A 3MWBA 4MAKA 1HBOB 2H5EA 4W98A 2YH1A 2DIUA 5K14A 4C6AA 1EIYB 3CJKB 1JK9B 2YQ1A 2WVCA 5E33A 3GV7B 1VQYA 4M5NA 1VHIA 2FPHX 3H8YA 2FVSA 5I3PA 2XI2A 4UOCA 2BE9B 5IM0A 2MZ1A 4ED3A 1HA1A 2OH2A 4A47A 1HQUB 4KPYA 3KTQA 3KJNB 4F04B 5E3QA 2OPRB 1SXLA 4PXDA 3D3CJ 1ZOTA 2H5IB 5A8RA 3G6YA 4DFJA 1S0NA 3KUHA 3MCNA 4ICLB 3SFUA 2B4OA 2AZ3A 2BM0A 2M0GB 4J7CA 3UCGA 5DDQC 1XMQJ 4OYOA 2ZWPA 1VQLS 1Q82T 4ID8A 3BB5A 1IM4A 4HYKA 2KG0A 2XQCA 1BD6A 2WB4A 2B6AA 3LW5C 1TFWA 2XMAA 1F9FA 2LA4A 4X64J 1NJZA 4AL5A 1S7IA 1F0XA 2J7UA 2L48A 3MPUB 3K5OA 4U7CA 2XLIA 4CYUB 3KLFA 3TA0A 3G4SS 2MSTA 3P4UB 1JLFA 4U8YA 3MR7A 5F8JA 2ZHOA 2VG6A 1KVJA 3GG0A 4AFFA 2GMHA 1QM9A 2XLKA 3V2UC 4YB5A 2HHQA 4R0JA 2QJ3A 4TQRA 3S01A 2DY9A 4DS5A 4C3MA 2ZH6A 2CRLA 4X64F 1FNOA 2CDQA 4X84A 2VKZG 3RR8A 1S57A 5I3UB 2DCUB 1KVIA 2FYXA 3KJVB 1KWMA 5D0HA 3ENQA 4PYDA 2FZGB 3GSDA 4DV2F 2V9KA 4YQWA 2G2ZA 4CTAA 3I5BA 2OMLA 3VQSA 5KFHA 5LMNJ 1L3VA 2WBRA 2L9NA 4UUWA 3KLHA 2PMHA 5GMKa 1KRPA 3DLKA 4K5RA 1PYTA 3TO8A 5DQGA 2NR0A 3EGZA 4IDKB 3HHNB 3OR2B 4O3OA 5HMWA 1RT3A 3UD4P 4YY3J 4NLQA 4USUA 4ZVQB 4CO2A 1RYRA 3ELHA 2CQDA 3SSSA 1NKEA 2C2KB 4B3TF 3KOAA 3GE9A 4DR4J 2CQ4A 4I1TA 4IRDA 3L95X 3IG1A 3MM5B 1TFYA 2BANB 3IWNC 3M7VA 3D1OA 1NB7A 1RT6A 2EK6A 1FESA 2LEAA 1YJ9S 4K2XA 4KSEB 3CMES 1T03A 3AD8C 1FDDA 4YS2A 1FXRA 4M5GA 1S6QA 2CNNB 2FLOA 2K3IA 3MM9A 4DV3F 1SH2A 1F5CA 2JRSA 3D67A 2QGFB 3M32A 2DXDA 1B3TA 1M5KC 3W2WA 3HD2A 2KU7A 2HFSA 3HT0A 2QLBB 1MMNA 1T9VA 2VFTA 4NLOA 5HVGA 4DL2A 2XMVA 5L1IA 4KFBA 4FYDA 4TLRA 2ASLA 1RT7A 2DRAA 5KOWA 2AKWB 2BW7A 1VI7A 1LWCB 4RUBA 5J2PA 2MY8A 1WC0A 1MWYA 2F8HA 3P5BP 5K20B 4OZ2A 2UVVA 3LP1B 4LRFA 4RUCA 1TKTA 3MR2A 4ELVA 3MMJA 2HRTA 5KFWA 4LF9F 2OHDA 5AE2A 1HWLA 3PM9A 1E6VB 1WF2A 4BS2A 4EU0A 4O3PA 5L1KA 2DGQA 2VA3A 2VIHA 1BGXT 3G8TA 3L4BC 4PAAA 4DPXA 5A8WA 3DLBA 1CVJA 4J5OA 2CJBA 1F9HA 1RT4A 2QRRA 4JI7J 2VJVA 2HVHA 2EC2A 1QY7A 2Z2MA 3MGJA 4FZVA 2DH8A 2P9CA 3BGFA 3GMGA 1OY6A 3IMQJ 1WKJA 2VG7A 1K1SA 1DTTA 5ETMA 3P3DA 7FD1A 2ZJPQ 1K0TA 1UVNA 2XZTB 4S0MA 2IBKA 4RU9A 4EBDA 2MPUA 2ZH9A 4DX8H 4FPIA 2HHTA 3KG1A 4J90A 2VQEJ 4BDPA 3HZEA 1RT1B 1S1TA 2RUGA 2B43A 2JVOA 2DNZA 2XSJA 4MFBA 3O6QA 1VQ5S 4ED2A 3NNCA 1HBNA 1YZ7A 5A2QY 2QG9B 3M8QB 2JEIA 2WCXA 3MMBA 3KK2A 1FERA 4NXMF 4AXIA 3M1VB 1Q8BA 1W25A 2QMWA 4NA1A 2BR0A 2YNFA 3IWLA 4NLUA 3M8RA 4Y0FA 3JYTB 1FNXH 2W7PA 3UCZP 3LANA 2OAUA 3D1QA 3EX7B 4DV2J 3IG1B 3MM5A 4OX6A 4UQTA 1ZM9A 3DGVA 5F0UA 3HP6A 1IKYB 2YXLA 1H7WA 2GMJA 3OTEA 1SJQA 3HKZD 3VQTA 2NZ4A 3T5KA 1TL7A 4C8LA 3AOCA 4R8UA 2XY7A 1TKDA 3GYNA 1I1GA 2AT1B 3HDSA 3MEGA 3MTJA 2IC3B 3P8BB 4D3GA 3K5PA 1GXUA 4HACA 2DYAA 5A76A 4O3RA 2LXUA 3A4TA 3CJ0A 2EWHA 5F8HA 2A1BA 4I6AA 3HHLA 2DGWA 5F8IA 4LIWA 1IXKA 5DDRC 1X9WA 4K7QA 2R7XA 3HT3A 3QO9B 2NPIA 2RS8A 4F8RA 6AT1B 4RW7B 4ECQA 3ISND 1DAXA 2R7QA 4ECUA 4C11B 3BPDA 3QWUA 5D78A 1P8GA 1VLYA 1Q53A 5D0GA 4ZVRB 5KG6A 4PPDA 1FNMA 3OD2A 1N5TA 1NZ8A 3PYEA 4A8YA 3SCJE 3CCZA 3M8ZA 1CLFA 4AQYF 1IWAA 2IHR1 2ASDA 1I3OB 1YHQS 3AT1B 1QSLA 1FD8A 1RTIA 4DG1B 2NXUA 2BRKA 1NNDA 1RT4B 4V19X 3QGGA 5HQMA 2M88A 3V6KA 4DF4A 1HNWF 4RW6A 4J9SA 1NBEB 4ED8A 1RK8A 1NHKL 2DH9A 1UEKA 2EPIA 2ZWOA 4C8MA 4QYZJ 5GMDA 5KFOA 5GAGI 3UWTA 1KP6A 3M8PB 1XIQA 1RWKB 4QPTA 1N36F 4B08A 1MU2A 1TKZA 4EFAC 2WW8A 3ILJA 1V5VA 1Q79A 3LP2A 3PG9A 1YX2A 2WOMA 3O2IA 3UPFA 4X4NA 3SQGA 1C4CA 2G1HA 2DHGA 2XHWA 1S6PA 4JI3J 3J80Y 2WTFA 2LQBA 1NH8A 3MEDB 3SCKE 4BC7A 5IXUA 1KHWA 2XZDB 5ETTA 2Y1LB 5LM7E 2G0JA 4TY8B 3TUJC 1M0SA 2OMOA 2L9WA 4DWIA 1UWAA 4U9RA 3CCRS 3BSNA 4AT1B 2GJIA 1KNZA 2KTQA 1XC9A 2O3DA 3DFEA 4X66F 3J7YI 3AJ2A 4RZRA 2R2TA 1UVJA 2DEJA 4W4MA 5B0BA 1VOMA 4IFVA 3H5SA 4OYZA 4WU3A 1XNQJ 1RLCL 1Y5IB 2PSZA 3TZYA 3BGUA 1CEZA 7FDRA 3HVRA 2DGSA 3CWJA 2C2ZB 3NGKA 3NS5A 5LXRA 2GHWA 1ICEB 2AIRB 2H51B 3GIRA 2HK2A 5H9EJ 4ED5A 1VRUA 2R2UA 3TVKA 4ALZA 1UW9A 1XNRF 2KG1A 1B7YB 4KGMA 2IAJB 3GSIA 3MEEA 4OIXA 4IUFA 5KFYA 2MLYA 2D69A 1IWGA 1LXJA 4MIAA 5HSPA 4TQSA 1VQ7S 1RT2B 2D7SA 2DNLA 2N7YA 4WTYA 2JHEA 2XLJA 2RQKA 5ETSA 2MEWA 4TYAA 4ED6A 1E6YB 3TAPA 4FXWA 4JI2F 1RCXB 1WJ9A 1RKIA 3H7HB 2ZM6J 3LP0B 5DO2A 2Z56B 2RH3A 3HHLC 3JTPA 1PJ7A 2YY3A 1XMOJ 3H98A 1W26A 2DNPA 2R9LA 4X62F 3T5JA 1XJWB 3MOJB 4HDHA 2C3YA 1URRA 1WF0A 4ZCIA 3J7Z5 4JI4F 5F8NA 1X4BA 2ZITA 2GS8A 3GU0A 4NA2A 2J5AA 2N4DA 4DR6F 3N0VA 4DN9A 3PRBA 4WWSA 3KLIA 1DQ9A 1LEOA 2IYIA 4DOZA 3ZTQA 2ZEJA 3T5HA 3VV2B 2ZC3A 4IH6A 4MIWA 5ETKA 3VGUA 2LKZA 4JI0J 3PKMA 3MM8B 5JVGQ 3PJXA 1P9QC 2V8HA 2CPIA 3G82B 4QZVB 2XY6A 1Q86T 2HAIA 3JSRA 3VTIA 1NK8A 4YOEA 4LR8A 2K06A 5D0RA 2KXHA 5L1JA 1S1VB 2D3ZA 2AZ1A 2GJ2A 4OI1A 3RRKA 1PCAA 3KK1A 5LT5A 4HLBA 5U47A 1AXQA 4IH7A 1P27B 2AQ4A 2VUGA 1JLQB 1FVQA 4P2FA 4BLGA 4B9VA 4TU7A 1U8SA 1PAEX 3C6TA 2A2CA 2W2OP 1TL1B 2K1RA 2WVDA 4P2XA 4QIWD 3BO3A 5D3GB 2JFKA 4AXJA 1R6YA 2CQBA 3VF0B 5KFEA 2BA9A 2NUUG 4ZDNA 2ADBA 4JI5F 1HPZA 5F3ZA 5H9EK 1SJ4P 2KVIA 1SL2A 1KR4A 2RF2B 2W9AA 4NLPA 1QLNA 1RQ0A 1UVIA 3HK2A 2DISA 3UO0A 2SXLA 3DHWC 4TYBA 3BO4A 1YDLA 3DCAA 5I3UA 2ZZTA 2XSFA 3MPWA 3OR1B 5JVHQ 2AMCB 4F3OA 4LVNP 3FNNA 1JLEA 3N5FA 3PYGA 4K4YA 4A8WA 2UUCJ 2NXNA 2BEFA 2W24A 3KLHB 4N76A 3R8YA 1TUWA 2W25A 2PO4A 3TAMB 4USVA 5E41A 2IM1A 3PACA 4I2PA 4ANEA 3SEOA 4OZ5A 8ATCB 2QA4G 2JEJA 2UVWA 3PY8A 4FVCA 1E6YA 4MJKA 1TELA 3HJVA 3L09A 2LEBA 2QLFB 3BF4A 4NYZA 1VQNS 4QJVA 2I6WA 1M1KT 4CT9A 2V4JA 1KSPA 4O0NA 4K4VA 1FKAF 3A8EA 3MEKA 2X1FA 1FKPB 4JV2A 2HHWA 2MQNA 5HBMB 2J9CA 4LQ3A 4M95A 1N33F 2APOA 3RW6A 4C8OA 4PWDA 1HD0A 2CNOB 1VQOS 4N7TA 2DHSA 1Y3JA 1TMMA 3ILLA 1IKWB 3CJ5A 4KHPJ 2HNDA 3MMAA 1OYDA 2HS3A 2H54B 2G2OA 4I68A 3NGRA 4MT1A 3Q23A 4FYXB 5HANA 2JX2A 3HSZA 1WEXA 2PGCA 2FIUA 3CIZA 4NYOA 4PR6A 1T8EA 3X1LB 2KI2A 3DDIA 5F8MA 4NXNJ 3MFIA 4V1Ak 1ZETA 2MQPA 2DNYA 1TK0A 1B0VA 3RJMB 3W62A 2AWZA 1E6VA 1IBCB 1EZZB 3C16B 2LFVA 3FDSA 3MOZA 4I7FA 4OI6A 4X65J 1HW9A 1F3FA 1S9GA 1XR5A 1FA0A 2B9WA 2Z30B 1BQXA 1VJQA 2QYCA 3FZBA 3IA0A 3OXGA 4CT8A 2PN6A 4J9NA 3DN9A 2K2PA 4L72B 3K2YA 1GMWA 4ECYA 3IR5B 1HWJA 1TU0B 2G0IA 2IDLA 4CO0A 3HHLD 4USMA 1UW4A 3BPSP 4ZKAA 4Q8FA 5KFXA 5M2UA 4I0WA 4NLGA 4ERDA 1EHWA 2IYGA 5K14B 4DSFA 4B3OA 4ELUA 4K4ZA 1U1RA 4M5LA 1RE1B 3G8QA 4FYYB 3NGDA 3K89A 4KGZB 1D8ZA 2ZVIA 1N0VC 1LW0A 3DNCA 4ZP6A 5A8KB 4QPXA 3A8IA 4YR2A 4CH1A 1M5PC 3FC9A 1EQ0A 2H4YB 1NM2A 1RHKB 2BACA 4ZMMA 5B0GA 2DHHA 1JB0C 2VQFF 1FHTA 2H65B 1F2GA 2OPPA 1NSPA 2ZFHA 4C0BA 2C2MB 1X60A 2GIFA 1WACA 3QIDA 1SI9A 4O4GB 4Q5VA 1X5TA 1VQ4S 2MJNA 5J1NA 4DX7A 3ENWA 4B3TJ 3H4BA 4Y2AA 2Y9HA 3GPAA 3MECB 4NEYA 4UW2A 4PG8A 1R8AA 1YJVA 4CM0A 2V63A 4KAIA 2YWGA 4K2JA 4LRDA 2W9BA 1FWLA 1W7WA 3JYTA 2ZH7A 4UY8T 2QLXA 4RUAA 1P1LA 1KN6A 1NEEA 3TX0A 3UI3A 3K8WA 1IKYA 3ZTRA 5HVFA 3JAMY 1ZYQA 2HNYB 3Q8VA 2VG6B 3LPEA 3T6BA 2M2BA 1GMWD 2QMXA 4L3KA 2UXCF 4IR1A 3MCSA 1SJ1A 2WVEA 4KIAA 4R8UB 2VB6A 1PKUA 2WK4A 1O8BA 4CLSA 1K8AT 1WHXA 4A8FA 3C3LA 3LH2S 4JI8F 5CD4A 3W65A 3PW0A 1RAIB 4B3OB 2JVRA 1B64A 4ENOA 1HBUB 1F1BB 2MYFA 4I6WA 1TZ0A 1UP1A 4NL5A 3FEZA 4RW8A 4YEAA 4DPUA 3HFKA 1XK8A 2RQMA 4LBPA 3W8PA 3RB3A 2RUSA 1RTDB 1TV6A 1N56A 1NDKA 1UMJA 2BJ1A 2LQJA 3H20A 4ZVUB 3UFCX 1CC7A 1WEZA 4IDKA 4LF6F 4XK8C 2IMWP 1HNWJ 3HD1A 1JWWA 4GKJF 1NZAA 3S7RA 3G6VA 4TLQA 3M6XA 3CJQA 3K5MA 4OYWA 3RGIA 3NWGA 2FTRA 1FRKA 2H5JB 3MAAB 4XPCA 2B8QA 5I42A 4DQIA 2WB1D 2XZWA 1FEEA 3FRZA 3OSNA 3L3CA 1GQEA 5E3CA 2Z58B 4A8MP 1KC8T 4ELTA 4KHRA 3VAGA 1CQMA 1IM6A 1Q78A 1U8WA 1K1QA 2AGPA 5CYMA 1NSAA 1RTHA 2KFYA 2O67A 3OXFA 5CYQA 4B9TA 3DLLQ 5KT4A 3EZ5A 1NU4A 3Q22A 1Y3KA 3CMAS 3A13A 1DURA 3LP2B 4MKAA 4JI5J 1SC3B 3AJ1A 4HVZA 4QWBA 4YHHF 2XNQA 2WW4A 2ACYA 3TW0A 2DGXA 1RU2A 4A8OA 4DQPA 4PG5A 4RW4A 3KK3B 5CAAA 4DV5F 2F9JA 1FRMA 1LQ9A 1YRUA 1DBDA 2HBQB 2IRYA 2Q6CA 1N5YB 5HLFB 1CSJA 1X4HA 3CF5Q 1UWBA 1LOUA 2QMUB 2PEBA 1UETA 2ZBCA 3DRRA 4ZVPB 4UT4A 4EO6A 3GCXP 3W8GA 5KFAA 2JWNA 2RKIB 4QIEA 4QWCA 3IC1A 2D1CA 3FJ2A 3OLBA 3CCSS 1N88A 4NLRA 5KFNA 2AJQA 3H25A 4DV5J 1KOOA 3MI7X 3T5LA 1QSSA 3GR0A 3JB9k 5IT9U 2CPFA 3FZ2A 4DV4F 4Q45A 5FDLB 2D3OR 4LFBF 4ILRA 4OJ3A 3ZNUA 4CLWA 3NS6A 2XEXA 4KT0C 1DTQB 2P2CB 2WSCC 4PWWA 3N9UC 4CO4A 3GIKA 1J5OA 4PQUB 2N7CA 2WONA 5DLGA 1SKRA 3SXLA 5AE3A 1FFSB 3GIJA 3V6DA 4UTGA 1WG5A 4QIGA 2L41A 4LSLA 2DGVA 3JQKA 4JV0A 3VZIA 1ELOA 3MMBB 3ZC4A 1R43A 1A0OB 1QAYA 2CNLB 2YX4A 3DC2A 1OY8A 1N33J 1KS2A 3MPDA 4H4KA 4MKVA 4OZJA 1XEZA 2J6SA 1FO1A 2FB0A 1C1BA 3R5DA 3I9V9 1SC4B 4F4AA 2FZCB 5DQIA 3H2LA 4Y2MA 3T1YJ 2UXBJ 2E5LF 1WTBA 1TMJA 1FXLA 4CLLA 2OP5A 3HF5A 4ZS6A 2FJWA 4J9MA 5F41A 3VCDA 3WZ0A 5CD4H 4Z7CA 1FXDA 3V4MA 3ZZYA 4XPEA 1YJUA 2VBWA 4FPRA 1X9MA 2NXEA 2AYGA 2UUBJ 3MEGB 3HVTB 1JLGA 1R8BA 4BBYA 2QFIA 3G82A 2X1BA 1N8RT 3D6FB 1LWFA 5A0YB 1OPZA 2FJDB 1SUQB 3T1AA 1SQGA 1FFWB 4E0DA 1LXNA 2KN4A 2HZAA 5L8RC 2XHCA 5IS2A 2DO0A 2V8DA 3G8SA 4DL7A 2I9SA 4OV6A 1ULRA 2V8PA 4FF2A 3BGRB 3Q24A 3GQCA 3H4DA 2KT2A 2GQ2A 2N3LA 3QLHB 4LRCA 1RT5B 4UOGA 1HI0P 1FJ7A 5DS7A 1HW8A 4RBTA 4F02A 2RSQA 3FQKA 2HHVA 1T02A 3MPYA 2ALZA 2MKYA 4RX6A 4O4RA 2GHVC 1BQNA 2J9EA 2XWYA 4ZIVA 2FJVA 2ZOGA 3C2PA 2PA8D 4NA3A 3BQ1A 1HQUA 4R5PA 4JI6J 4DL5A 3O3LA 5T14A 2HS0A 4DR7J 1K0VA 1KHVA 5A8RB 3H5YA 3TUIC 4QOTA 1TK8A 2HGMA 2WRMA 3M2VA 2G9OA 2HNZB 2HMIB 3KG4A 4PQUA 3AAWB 1HR0J 2LMIA 3JSBA 1XNQF 3ENVA 1N54B 2J0XA 2F4VJ 1SH0A 3SZ2A 1VCTA 1WDTA 4NYPA 4OZNA 2OIHA 4QIFA 2VC0A 3TQ1A 2VQEF 1ZAWA 1I94F 1WHWA 2C2RA 4CLPA 1CJTA 2H3EB 2M70A 3PXGa 1HWUA 1Q0NA 4ZIWA 5EGYA 3OL8A 2Z57B 3MR6A 1C2PA 2VFSA 3Q0AA 1C0UB 2RILA 1P6TA 4W92B 3R9LA 4GKJJ 4MKYA 2XO7A 2DGTA 1IBLF 3HXMA 4KH1B 3QZ8A 4CNYA 4CDIA 3RBEA 1T3NA 3VGTA 5F8GA 2V34A 4HT5A 3HSDA 1HQEA 3ET6A 3VAIA 4B9LA 3HJFA 2VOPA 2FGOA 3EM1A 2CQ1A 5HQ8A 3KLVA 1C1CA 3EVMA 3BN7A 1FT8A 3QBCA 2ZBQA 4M5MA 5M2RA 4A48A 4A8XA 4CH7A 1PC5A 1VHFA 3E01A 4RPFA 1NKCA 4YDDB 2QO3A 4ID5B 3VAFA 3QZ7A 5AXMA 1VIOA 2BQUA 4WXOA 2OFHX 2HVDA 2KDOA 3C16A 4KO0A 3NOGA 5GVQA 3QATA 3W5YA 1R0AA 2CVIA 3M4XA 4NLTA 4NCAA 3AB2B 3FSIA 4RNNA 1JLBA 3TJ8A 1A6LA 4HHUA 3TZZA 5MLCV 2CPZA 4NE9C 4WYLA 5D77A 5SZTA 3KG0A 3L7OA 5E3PA 1IBMF 3H0PA 2ZE2B 1LW2B 1HI1A 3EDQB 3UDVA 4LFBJ 3WQPA 2V4QA 3MUTP 1YJWS 4DR3J 1TKXB 4YFUA 5IZHA 4CCHA 3RZAA 1U26A 4OYIA 4P2SA 6FDRA 1TL3A 2YWFA 1RAFB 3FCWA 3BBBA 3I56S 3R1HA 2VASA 3FFIB 1T9UA 4B02A 4NCBA 4EBEA 1V5IB 3R27A 2EKYA 3IR7B 1UJ6A 2OGUA 2LCWA 3D66A 1WOSA 1FJGJ 1L5UA 2AEMA 1W2IA 2NQPA 3DLJA 4DU7A 1LKZA 3O8WA 4KC5A 5J1EA 3T19A 5JJBA 2HMIA 3VGSA 4AYBD 4F4WA 1U48A 3QSIA 2OEKA 1URNA 1VIXA 4TNOA 4PUOB 1H38A 1WC3A 1OYEA 1YBUA 2EG1A 2NSCA 4WYWA 1R6VA 1O51A 4NPOA 4PEOA 2DIVA 1D3WA 1HWIA 2YWKA 3CCLS 4DL4A 1B99A 2KRRA 2DR5A 1EETA 1RABB 2MLXA 4DR5J 2VA2A 4GC6A 1VK3A 4KRWA 3IS9A 4OZ0A 3ZZOA 5ADZA 4LR7A 5EX3A 4DV1J 5ETNA 5KFKA 1TL1A 1OQ3A 2K1RB 3LGNA 4RJVA 2NZCA 3RU0A 1N36J 4WPAA 4O44A 1G4CA 4J9LA 1S4EA 1HHTP 4C97A 2QX0A 3TJAA 4RKUC 5IWAJ 2JFDA 2IM2A 2BOPA 2OPSA 3CCWA 1F3VA 1NJIT 3CXCR 3N6NA 2QSFA 2EC0A 3OR1A 3W63A 4F2SA 2XG8A 1XN9A 1YWXA 1RT1A 2ZDOA 4DV6J 1WC1A 1AUSL 2W01A 3D54A 4OYBA 4DL3A 5E7OB 1NLKL 3IGNA 3F41A 4FF1A 3EYZA 2FHJD 3MHYA 3MTKA 4I2PB 5KFUA 3P6YC 4DV0J 1REVB 3M1VA 4ECVA 2DH7A 3T1YF 3OUYA 2OD6A 4M8LA 1RKJA 3TA1A 2JOQA 2XWXA 2CJXB 1S1UB 1LWXA 2PEHA 2VZ9A 1EP4A 5K8OA 4F2RA 2DNOA 3MAHA 2R8IA 4ZITA 3BO2A 2GHPA 3TUZC 2YQ0A 4O3SA 3HSJA 2OSQA 1ZS6A 2ZHBA 1HMVA 1TVRB 2XMKA 1RLDA 4DV7J 3KNAA 2BJ8A 1SV5A 3ONQA 4M1KA 5BR8J 2P6TA 4JI2J 2EKNA 1HARA 1BQMB 3PEHA 4PXCA 5HQLA 4YY3F 4ECRA 3L7PA 1CPZA 3R6GB 2HFZA 3W2VB 1FRHA 1DRZA 1J2VA 3GFXA 2ZKTA 4QW8A 3RYLA 1MSWD 2IC3A 3UDCA 1PO6A 1RB0A 3VHQA 2IVMA 3C66A 1H3DA 5KG5A 3CO9A 2EFVA 4A8KA 4LF7J 5D8HB 3QFWA 4UZBA 2LP4A 2D9OA 3FEYB 3KWMA 2BJDA 1ZA1B 2DXFA 4YB6A 4LFCJ 4ZPWR 4MK9A 5C25A 3POTA 2C42A 3R7SB 2CQ2A 3TZWA 5DM6Q 2KH9A 2M4MA 2OPQB 4DDFA 2BZ2A 4B9SA 2IBOA 3M2RA 5EWFA 2O1PA 5HO4A 4Z37A 5DQHA 3Q8UA 2YNIA 3DLHA 2F63A 2V68A 3D0HE 4LF7F 2N3OA 1HNVB 2RKIA 2ZC4A 4CO3A 2ZDPA 2MLZA 1ZM4A 2LECA 1UA0A 2R7TA 4C9DA 3AJDA 3QRRA 3OTCA 1U2FA 1SKUB 4O44B 5CQGA 3BKFA 4NRUA 4N41A 1JNZB 1JMTA 2HS4A 5CCLA 1DJ0A 2VONA 1NDCA 4EGLA 2GZOA 5EWEA 2HBRB 2YWHA 1WSRA 1HNXF 3NS7B 1GNKA 2WOMB 4ED0A 1VR6A 4HI1A 3AD9C 1UZHA 2MZSA 5AT1B 3H2VE 3OFHA 4DX6A 2R2RA 1CULA 1VFJA 2BKPA 1R8PA 2F9DA 1FKOB 4X66J 4DPTA 4QCLA 3M6UA 4DR1F 1JLAB 1J27A 3JSMB 5FIIA 1FX2A 3QYYA 2WSEC 3MM6A 2HFOA 3IWXA 1B70B 1R7IA 2V2KA 3C15A 4YN3B 3LWMA 3AHPA 3EZUA 1SL0A 5C2GA 1HBMA 3ULHA 2VPZB 2RRNA 3PR4A 4JYAJ 4OX8A 4LFAF 2ATLA 3R5BA 2E7XA 2OUGA 1B0TA 4RWWA 5AXKA 5IT9Y 2XTJP 3UVJB 5E3AA 4U7UK 3MR3A 1RHRB 1OSCA 4KR0B 1BQMA 1NHVA 2JLFA 1Y4ZB 2MTLA 3M30B 5J2NB 3V81A 1M5OC 2XM3A 2UP1A 2AP6A 4ZPTR 4DV1F 2HLUA 3A3OB 2GC8A 4NOHA 2UV8A 5D4OA 1D0EA 1JXEA 3MPVA 2FY8A 3LO3A 3MMCA 3IRWP 1FK9B 3DGPB 4M5HA 3U1NA 3UCUP 4RW8B 3MAQA 2BE7D 4O3NA 2E5LJ 1LK7A 2RDIA 2DNHA 4ECSA 4QQBA 3DU5A 4GKKJ 3VWSA 3TARA 1TV6B 1VLOA 3PFOA 3PVXA 3LP0A 4GMKA 2Y8YA 1OS5A 3QLHA 3HVAA 1S7HA 4X4TA 3M2RB 3D28A 2YNGB 4LT6A 2C28A 4OHYA 1NKBA 1N32J 2CZ9A 3CIMA 4IKAA 2UV8G 4QR0A 3ZFVA 1T11A 2NXCA 4EUVA 1U45A 4QU7A 1T9YA 5FJ4A 2FJBB 1YKWA 4RNFA 1Z1ZA 2X7IA 3OPKA 3OV7A 2R7UA 1GMVA 3B8HA 2LQ9A 3Q2SC 3QGHA 3CJTA 1GH8A 2HQ3A 4KBIA 4QYZK 2VFUA 3ZNJ1 1WUUA 2FHKA 3KUGA 3GLJA 3QFHA 4GRSA 1T05B 2GNKA 5CYMB 3PIPQ 1IKXA 1Q5VA 3CJKA 4EEYA 3RRHA 1NK5A 1F9EB 1LNQA 3CJRA 4N47A 2IFXA 3PW7A 3R5JB 5GAHI 1X4DA 1X5SA 3NAIA 3ZTSA 4WU2A 3KJQB 4ZLLA 5LXYA 3HPOA 2U1AA 2Q66A 2BBEA 5IC6B 2LLZA 2DO4A 2KL8A 4X4RA 1LWEB 1UFWA 3LGHA 3HSGA 2YKPA 2FC9A 3I9ZA 2EFNA 3DMJB 3KK3A 2MQOA 4DV7F 3KK1B 2UXCJ 4C8NA 2IRUA 4ETZA 2FVPA 1RWPB 4C8ZA 3AY0A 2AX1A 3NP5A 1U0HA 1M5HA 3T9ZA 3R5CA 5KFVA 1MWQA 9RUBA 2HQCA 5L38A 3H2UB 3JSYA 1H0HB 5JMNA 2D3O1 1C0UA 2VODA 1VGYA 1FWKA 1QTMA 3BDEA 2YX7A 1X7VA 5DLFA 4J9PA 4P72A 4K4UA 5L9NA 1NCLA 5GAEI 1NPRA 4CLUA 2RE1A 3KLGB 3GV5B 5F3TA 1CQNA 1N52B 1ZM2A 4DX5A 4EYIB 3D68A 2MGZA 2IVFB 3CVKA 2KFNA 3BYPA 2LDYA 4IFYB 2XI3A 5DZ7A 1FI4A 3C14A 2KO1A 2LYVA 1RAOA 3M8WA 4E8UA 3TI0A 4WF9Q 3UR0A 3QAUA 2CQCA 4FYWB 4F7VA 2HRYA 4KO0B 4CO1A 5FLXU 3I0SA 3I0RA 5BYRA 5EWGA 3SV3A 1HHQA 3N6MA 4LBIA 2NS1B 5HI7A 4F36A 2W9CA 1S1WA 2W7AA 4U7UD 2R7VA 3IBFB 1CJKB 3FRYA 2GQCA 2ZE2A 2GJFA 3PCOB 4ZK7M 4NZ7A 2Q79A 4WP9A 3H40A 2V67A 2VBXA 2BANA 2G0CA 3SSRA 2VQFJ 1RT6B 3CW2C 1NJXA 1TL3B 4A8QA 1Y0HA 1RADB 3QNWB 5CHCB 4URGA 3TJ9A 1AFIA 1EKRA 5BYSA 5KFFA 1VQPS 1YIJS 2DHXA 4OHWA 2YTCA 1NMEB 4DZ6A 1S6QB 5CCMA 4BC9A 1XNRJ 3D9BA 3NGSA 3QGPA 4EMDA 4XDCA 2VBYA 1PYOB 1NHUA 2JLGA 4A4JA 1IJEB 2GVZA 1TAUA 4JI4J 1C0TB 1OSDA 2MB0B 3NLCA 4Y2KA 1YLXA 3DM2B 3IP0A 4IQMA 1N0UA 3FQLA 3W2WB 2CYYA 1VMBA 5HK4A 5J2PB 2H1YA 1AT1B 2DPJA 1S4FA 3FBFA 3IRXA 2AJ0A 4W90B 4ED1A 4FS1A 1S9GB 2MQ8A 1FRJA 4EO8A 1KD1T 4X4UA 1U0HB 2GMLA 3PV8A 1VDHA 2VFVA 5HP1B 4P9SA 2RRAA 4C0OC 3H90A 1VRQC 4WFXA 2WVBA 1O0PA 4B3RJ 1DLOA 2EXUA 5D6GA 1GX5A 1OMSA 1BWVA 1X4GA 1HWKA 2CQ3A 2IJNA 2NUHA 1RP5A 3HULA 3K7RA 3LF0A 2EVZA 4KGXB 5RUBA 2MQMA 1YK9A 4YHHJ 2AF6A 3GJSB 2XGQA 1NH7A 2I1RA 1WEYA 2B3TB 4OJGA 4U96A 4ZP7A 2QL9B 5KG3A 4N5SA 1BC6A 5EDWA 2HBZB 4USKA 4LF8J 5LJ3Y 2MGZB 2H4WB 3D6TB 1HLWA 2JL9A 1U6BA 1FRIA 4IG3B 4XAKA 3DRSA 4Y3CA 2DBBA 4EI2A 3MR5A 5B0EA 1F5AA 1REVA 5LSRA 4DR6J 4QR1A 2V8VA 2MHEA 3DLEB 4JP8A 2DNMA 5E2QA 1HYSA 1T94A 1KONA 1R89A 2HVEA 2WZ1A 2W9BB 3A8JA 5ETQA 4R0EA 1U1LA 1N48A 1DQAA 1KDNA 3LALA 4ANDA 2UUCF 2MY7A 4LRAA 5D4LA 3U27A 3ISNC 3BBFA 4WTOB 2PMZD 1CJTB 3PRVA 2GIRA 3KLFB 3THVA 1MN9A 2ZH2A 1XMQF 3PO5A 2C3PA 3HLUA 4M63A 3W2VA 3IBWA 1UVLA 2Q6BA 3EE3A 4WJBA 3NNHA 4CZCA 3CNQP 2MKKA 3R6LB 5MAOA 1S0OA 3OL9A 3PRDA 2E5HA 4XDDA 2J0SD 2I0XA 1F5BA 2B9XA 1LFWA 5KT2A 3TA2A 4LF9J 3LGMA 2DR9A 2EBEA 4O0IA 1S1XB 3FBBA 3N4WA 3DRPB 5ETPA 4C3KA 1GFWB 1WG4A 2RAQA 4DBQA 4E98A 5C25B 2ROEA 4F67A 4QWDA 2DEIA 2IJRA 5IV4A 1PSDA 1JXLA 1I5OB 3I82A 1XWLA 3QO9A 4CTAB 3I55S 3KHRA 4ID5A 5CZVA 1T9XA 3D2WA 1N6QB 2CAJA 4NCGB 3W61A 1L3TA 2ZH5A 4P52A 2DR8A 4DSLA 1R27B 3CEDA 3ZZZA 4CP5A 3A3NB 3NG8A 4DV3J 4C4WA 4WZQA 1U6ZA 2KYZA 4QW9A 2HKEA 4JUZA 3GB0A 2BOAA 2F1FA 2VV5A 4DV4J 3C46A 1M1HA 5D0EA 3IAM9 4LREA 4NMXA 4DV6F 5J2QA 2OEMA 2IY5B 5B08A 3OJUA 1BXNA 4DQRA 1S10A 2EFOA 3R5AA 2GGPB 4IH5A 1DLOB 1DQ8A 2HWTA 3IR6B 3JQMA 4KH0B 4RW6B 5LOQA 3KLEB 2ZH3A 2DPIA 1WNEA 4J9UE 4JI3F 5CYQB 2DNRA 1WHYA 2E7VA 3I5AA 5FLXY 4B9MA 1VJWA 1HNIA 2JJ4D 4P74A 5AXLA 1U47A 1HNZJ 5HROA 2X1GA 1IBMJ 4FS2A 2UVUA 4XO0A 1VC5A 2Y0BB 3Q86A 4ZA1A 4X4PA 4UY85 4RO0A 1JJCB 1CS4B 4HH1A 5K8PA 4IG3A 4WBFA 1CJVA 1H2VZ 2CKWA 3HMJG 2KZMA 3B78A 1YSJA 2LA6A 3OTOF 1SIZA 3OXLA 1QD1A 2NLWA 5IFMA 9ATCB 2UU9J 4B9UA 5CABA 4KV8B 1JJ2R 4EZ9A 1IBKJ 1HFEL 1FTRA 4QYRA 4MTPA 3SQGB 3Q8RB 2RS2A 4CLTA 2VU5A 2BQRA 3H42A 4IG0A 5IV3A 3G6XA 2ERRA 4DFKA 1HNZF 4IOBA 3CC4S 4ZVOB 2W1BA 3SI8A 1B7FA 3DOLB 3J7ZT 4DF8A 2AYBA 4DUTA 1ZAVA 4CYUA 5A8WB 4H4OA 2DK2A 2JSXA 3M2UB 4RW9B 3WX8A 2AGQA 3P49B 4FKXA 2Z2LA 3EWGA 1WSVA 2HIQA 2DNKA 2QLJB 4NLWA 1NK7A 2C2DA 1U2CA 1ZM3A 3SDEA 1FVSA 4IFVB 4JI1F 2KXNB 2B9YA 3EZOA 1Z2LA 2BJ3A 2C3MA 1RGVA 4WIQA 3HO1A 1N32F 5F8LA 4Q44A 1UJ5A 2IAJA 3MEEB 1U7LA 5ITHA 5EUHA 3WDOA 2MMYA 3VR1A 3M6VA 5K8MA 3SV4A 2I2YA 1BWEA 3SIPB 2NYHA 4QWAA 1S1TB 1UTAA 4UOHA 1WKLA 3M8YA 4XIUA 1U6FA 3JAMU 3BGLA 5C42A 2YNGA 2XS7A 3C8YA 4DZDA 2CWXA 1QE1B 3R5GA 1SPBP 3M8QA 3MUMP 2BABA 4KKOA 3OR2A 4URQU 1RT2A 4WK3A 3GJTB 3VVUA 3ZZ0A 2BKOA 2W2MP 1PGZA 5KFDA 1S1UA 5G4DA 4ZVSB 1RUSA 2CUYA 4F0HA 2HWHA 2RT3A 3D1HA 4U8VA 2QE5A 1G3OA 2W4CA 4ZPAA 3PHTA 1QTNB 1TVRA 3VZHA 3VAMA 1RACB 3QIPB 4PXBA 1MN7A 2CZ4A 1T05A 3J7AN 2W8LA 1T9WA 4DLGA 5KFGA 3W9HA 1RISA 4OYPA 2LXIA 3EJMA 1WI8A 5IQQA 3VAHA 3GFYA 4OYMA 5C24A 3EDRB 4OLOA 3M32B 3IM8A 1U1KA 4AQYJ 2CA9A 2YPYA 4X65F 2CQHA 3MF5A 1TR0A 2AX0A 1RWWB 4O3QA 2B7CB 4ZHRA 1H2UX 4IO1A 1KVKA 3DRXA 2FDNA 3WIVA 4ZLPA 2I5JB 5DZ6A 1ROFA 3IFEA 4KFBB 2BX6A 3WX4A 3CO0P 1S6OA 2D9PA 4ZN1A 2FC8A 3CDEA 4L3NA 1X31C 1JQGA 3DOMB 5GAGU 2OTLS 1T3OA 5AJ3F 4C11A 4TKTA 5EHHA 5E3RA 5D4PA 4WFNQ 3C6TB 3HHKA 1UWBB 3I4HX 4LF4F 2QN6B 2QA4S 1YJRA 2VJUA 1L3UA 4LFCF 4DQSA 1HBOA 4PG7A 4EYHB 1OQ6A 3IM9A 3W5ZA 2MKHA 3W66A 1XR7A 1Y5NB 5HJXA 2HQGA 4H4OB 1IR2A 1HPZB 1YGYA 3GWCA 2CFXA 2W8KA 4F50A 4HR2A 1Y9OA 1YZ6A 2CJAA 2VOOA 4H4KC 4JV5J 2EW9A 2YKQA 4DLEA 2LXFA 5DRKA 2RU3A 1Q5YA 2AHOB 2A18A 2L08A 5D15A 4ZVTB 3SDEB 3IAS9 3QQCD 2ZZNA 2HGNA 2RF2A 3M8PA 4LF2A 2DB1A 1O6XA 1UPPA 1YRTA 3X3UA 2DRBA 2XS2A 3O1LA 4USHA 2CZVC 2EK1A 1DTQA 2E1RA 2XMUA 4Y28C 5B0CA 4DUYJ 5KFMA 4GC7A 2LEPA 2RHQB 2KJWA 3H5UA 4LSNA 4F0KA 4HEA9 1UVMA 4MYUA 1N5QA 3CD7A 2I38A 1WOPA 3JTNA 2HYIB 4ITSA 4LSLB 4OX9F 1CJKA 1AZSA 4JB8B 4YR0A 1L3SA 4FF4A 1QE1A 4K4SA 1IBLJ 1NK9A 3MM6B 1RTJB 3MXHP 2HHHJ 2EFQA 2M7SA 3T1HF 2V4JB 4MMOA 4NMLA 4DR7F 3AQPA 5HMYA 4IOAQ 1SQFA 2JDJA 2XMMA 3K8VA 4I4BA 1NSQA 4DL0C 2B6AB 2UUTA 4LF8F 4WKRA 1T9TA 2VKRA 3D0IE 5CA5A 2VFRA 3CD5A 2BDPA 1ZAXA 4A8SA 4FF3A 3CCJS 3FMBA 1RA7A 3QJLA 3CJ2A 3G71S 4DPWA 1JLFB 5HAOA 3ZZTA 2HRUA 3OTOJ 3ET6B 3ZO7A 3M8SA 2OEJA 2HFUA 4KGVB 1MW7A 2HWIA 3E3XA 5HVHA 4F25A 1IKWA 5KFBA 1ITPA 2GVZB 5KFPA 1RJJA 4F4ZA 4I2QA 2DHAA 1DHMA 3MMCB 2JNJA 4F0MA 3KHGA 3SYZA 1U1NA 2KFZA 1S12A 2MJUA 4ZHRB 3P5TL 4URSA 5DG8A 4FYVB 1PAUB 2CJ9A 3MMAB 3NBPB 1OY9A 2PMWA 4AE5A 4DEZA 2ZH1A 1P1TA 4IR9A 3AOBA 3HZGA 5CH7B 5H9FK 3DDKA 2X3DA 3FMWA 3DOKA 2KJVA 4WKYA 2QTWA 3JQJA 1QDUB 2O01C 3DOMA 3FUYA 3PKYA 1ZZFA 2WHOA 3CDAA 1RYSA 2HQFA 1EKSA 1WTFA 4ATNA 4NLXA 4C2MA 2J8AA 2V5HG 4J9RA 2CPDA 3QT8A 1SL1A 4KTQA 1T03B 3QAEA 1Z2ZA 1MG7A 2RD5C 1BHNA 3D7SB 3NXZA 1BUXA 1XQIA 3MM9B 3VAKA 5KFTA 4G3IA 4ZCLA 1IVZA 1BE4A 1OO0B 2D3UA 3BYRA 1DZ5A 4I6YA 1FJEB 2ILZA 2B7BB 3MM7A 1AFJA 3L9ZA 5T7LB 2EBGA 1DY3A 1FEHA 5L9XA 4U6PA 3MM8A 4QIVA 1FTCA 3PW5A 1XR6A 1Q95G 4JV1A 2QL7B 3HFVA 2GO8A 2OFGX 2E66A 4EWTA 3M9MB 2QV6A 3H5XA 2JEFA 1RT7B 2VPWB 2KKHA 5EN1A 4L76A 3IS9B 4JI8J 1KFDA 2XBPA 4MIBA 4ZPVR 4BHQA 3CB4A 4RU2A 4LVOP 1TKTB 4RNOA 2DR6A 2IA6A 1QUPA 2BV3A 2V4RA 1V3RA 2KYXA 2J7WA 1VC0A 3HKWA 2G13A 3LA0A 4K59A 4OJ1A 3W9IA 5D3GA 2DJWA 2VDHA 4NASA 1NXIA 5HN0A 4C8YA 4WFYA 2GIQA 3GYGA 1SC1B 3DKDA 1V3SA 4ZLJA 1SQEA 5IQ6A 4NI2A 2CPEA 4OZLA 1Q81T 4NLVA 4UUXA 4DCPB 4DR4F 1HBUA 1Y5LB 3T3FA 1HQEB 1YJTA 1RBAA 4N8NA 3TVZA 3HCXA 2ZVSA 2C3UA 3OT9A 2VG5A 5H1SV 1RAAB 4I69A 4Y6IA 3WC2A 3DXSX 1N6QA 1I94J 2DR7A 1RHJB 3CDWA 5HATA 4CI0B 3I0RB 2FJXA 3GG1A 1JJHA 3MURP 3IGVA 3GONA 3I6PA 2A6MA 3DOKB 3QT6A 3TZXA 3V4IB 3UQSA 1JXVA 3RAXA 2GW8A 1Q1KA 2L3MA 2VPXB 3TRGA 3HM9A 2J0WA 2J6UA 4OFZA 2E9ZA 2YNFB 1LW2A 3ISZA 3JTOA 1ZH5A 4PRFA 3V6JA 4B9NA 4GVLA 2K7JA 2LU2A 3GILA 4QBUA 2VH7A 2XYHB 4K50A 4ZVGA 3RAMA 2QT7A 1FKPA 4KB7A 3THPA 1WHVA 1HNIB 3M9OB 4ZPBA 5HROB 2BE2A 1F2HA 3OTDA 2OSRA 2RHSB 5B0AA 2ZNZA 3BH6B 2KB2A 2LQ8A 1R3NA 3EGWB 3NGUA 3AA9A 4KYZA 4ZOSA 1RU1A 4I64A 3FSYA 5DG9A 3MM7B 1VC6A 4QWEA 3NMRA 3HHLB 3T1HJ 2E9RX 3DM2A 1Y00A 4HTIA 4ZP9A 4RLEA 2YQ3A 4ZPCA 3UNGC 5DETA 2COLA 3K5NA 4TXSA 2B5JB 2F3JA 5LSOA 3FGVA 3IRXB 3OVBA 3BKUA 2VPYB 2YKMA 4J9OA 3N01A 4TN2A 4CLYA 2KM8C 2ALYB 3BSOA 3FVYA 5G0RB 1IR1A 2BJ7A 1M1GA 3W3SA 3Q89A 2Z4PA 2B4UA 3SCLE 1Q8LA 2VC1A 1RBLA 3Q8SB 3WBZA 2QA2A 2ZOFA 3DRRB 1F6TA 4NWBA 3KDOA 4LRBA 2ZH4A 3CJ8A 2RQCA 2YKNA 4DCOB 3OFFA 4ED4A 3CDBA 2M8DB 3QGIA 2BM1A 4NLYA 1AROP 1LW0B 3FCVA 4J91A 4DFPA 1NK4A 3OL6A 3OTBA 1YQHA 1RWNB 3W9JA 5C7PA 1UEUA 2OPRA 2W4PA 4LF4J 4AUKA 2F4FA 1QAIA 4QU6A 3BEGB 2BJEA 5FDLA 1VS3A 1AYEA 1DFDA 3KKFA 4WE1A 2E1CA 1MU2B 5C42B 2XY5A 3K5LA 1PILA 3R97A 3PHEA 5HJYA 2OLWA 3DLEA 3I31A 2E9TA 2OO4A 3WIUA 3J7A1 2FLNA 2DT9A 3TYTA 3S8SA 1X0PA 3LPYA 1NK0A 4P2MA 2FGCA 1Q7YT 1RSCA 1LK5A 5KT7A 3TAQA 1N34F 2HG4A 3PW4A 1SJRA 2NYIA 4F3QA 2YWWA 2FJEB 1N4LA 4DL6A 1G6BA 3T9NA 4ZN3A 1U25A 4ZVHA 5KT3A 1R0CB 3KDNA 3R3TA 1NJWA 3QIPA 4HI2A 1U24A 4M5DB 3D3BJ 1HMVB 4DFMA 2VBZA 4U67Q 3RBXA 2HURA 4DHVA 1KFSA 4CLKA 5C5JA 4DR1J 3GIIA 4F3MA 1BLUA 2WSFC 5AXNA 4K4WA 2HSEB 3TVYA 1X5PA 2BE2B 4DUZF 1S79A 2HGLA 3TOQA 1A7GE 3HHEA 3TNVA 2B4VA 3NCPA 3DRPA 1FRLA 2EI5A 5B09A 2X3GA 5KFQA 4X4VA 1IN0A 3BSAA 5A0YA 4TU8A 1IQTA 3KJVA 1IKVB 3ILIA 2NREA 1JLGB 2RRBA 4K4XA 4ZPDA 3CJ3A 1SKWA 1EAYC 2B5JA 3ZTOA 2HZCA 3OVSA 1S0MA 4DR2J 2R8KA 4WFBQ 1SUQA 5KFLA 2A6OA 1S0VA 4G65A 2YKMB 1Q8KA 5GADI 1RT3B 2ZNYA 3ZZPA 1K9MT 3AOAA 5H9FJ 2Y8WA 4NRTA 5ETVA 4Y00A 2OD4A 3VALA 4L6V3 5GMEA 4OHZA 2Z2ZA 1GT8A 1ACMB 1KQGB 3QSYB 2R8JA 2E5JA 4MYTA 3PR5B 1VQMS 3W5XA 1HHSA 2QA1A 1FD2A 2AJ1A 4DSEA 4YB7A 3KHLA 1NPKA 1TTHB 1D9AA 2BW2A 2E44A 2GX8A 3DI6B 3NCQA 3EPIA 4Z2XA 1S76D 4FXDA 1RTHB 3GR1A 1CG2A 2Z2YB 3U1MA 3KNGA 5A8KA 5F9LA 1VBYA 1U1QA 2VDIA 2OJ3A 2JC1A 4KPCA 2ZUGA 3ZZRA 4LSNB 4Y2CA 3J81U 5KTQA 3BQ2A 3N79A 1X0FA 2QFJA 3IBCB 1P9YA 1IJFB 1CJVB 2RQ4A 3DMJA 2B56A 3BBCA 3KLEA 1U49A 2DVIA 2RVJA 1AZSB 2PA3A 3P45B 4GVBA 4KE5A 3WC0A 5DGBA 4EK2A 3QRQA 2J9DE 2PE8A 1U1MA 3OQ2A 4ICLA 1M5VC 1I51B 2MZRA 3DYAA 1HD1A 2V8GA 4P75A 1QAJA 4F4YA 3QMQA 4DPOA 4DS4A 1J5EF 2F65A 1YVFA 2E29A 2ASJA 1RXOB 1VK8A 2H9ZA 3E51A 1UVKA 3RW7A 3LTOA 2W7OA 1RAEB 4M5DA 2VL1A 2ZBPA 5DG7A 4AL7A 3ENAA 2HNYA 3W60A 2DCLA 3K0JA 1KLMA 1RHMB 1QUVA 2VG7B 1DTTB 1GTEA 2QZ8A 4LJMA 5J2NA 3PJ9A 2F40A 4FBTA 4IFYA 3UNYA 5E0OA 3GYXB 3W64A 2Z0GA 1WORA 2C3OA 3GV8B 2QLWA 1D8YA 2FLLA 4C8KA 5B7WA 1UJ4A 4N56A 3BZQA 2AD9A 3BGOP 1JX4A 1J5OB 4DR5F 4H4MA 2FZKB 2HPUA 5K5MA 2HEKA 3FBEA 2B8PA 2LVWA 5IOLA 2XSJB 4MFBB 3HHDA 2E5IA 7AT1B 3UD3P 1QSYA 4K0KJ 1R8HA 1L3KA 3GP9A 3FEXB 4G1IA 3TAMA 5KFJA 1PC4A 5HL7Q 2A3JA 4ZLNA 3R2DJ 3RG6A 2KM8B 1MROA 3D0GE 4KKOB 1HNXJ 3MCOA 5DGAA 2GAHC 2WAQD 8RUCA 2FQQB 4OI0A 4BCAA 1WG1A 2RU9A 1R31A 3THTA 1SBRA 2DY1A 5I42B 5BXIA 3QJJA 3HI9A 1CJUB 3AH6A 2DKOB 1AB8A 2NCKL 3BKTA 5AJ3J 3GIMA 1RI7A 3N6LA 2J6TA 1V9OA 1X9SA 4CNZA 3DI6A 3JS9A 1TL7B 2YKOA 5HBMA 3EGVA 2IRXA 4P73A 3EVOA 3FBCA 4OI3A 2LDIA 1GK8A 1H72C 2HNDB 4Y2IA 4Y65A 4KGKA 3VAJA 1U0SA 2FVCA 1KEKA 5BJRA 4B3MJ 1YI2S 3RRGA 5THWA 4A46A 1NB2A 1RTZA 2E7WA 2GFFA 2IMOA 3U1LA 5ETOA 1S99A 3G9CA 1X8DA 3BN4A 3MD1A 4Q2LA 5J1EB 1PIEA 4LF6J 4Q0BB 3G96A 1LWEA 4GVBB 2V2QA 3B82A 3VGVA 4WK1A 2J0QD 3B4DA 4I7FB 1KOHA 1EX8A 4RW7A 1KQKA 3BGRA 3RUBL 4NLSA 1N5SA 5BR8F 5HP1A 3AA8A 3PFEA 1D9FA 2HVZA 4RNHA 4DJBA 3MZIA 3CTRA 4MKBA 1UKUA 2GVDB 3TR5A 1GXLA 1Q4RA 1X4EA 2K7KA 5IT0A 4ES2A 1SKSA 4D3HA 2W2PP 4USJC 1YTYA 4CH0S 4IQXA 1RBOB 5LMNF 4FNHA 1FE4A 2ZZMA 3J80U 1WD6A 1SC6A 4USWA 4ZJQA 2OPSB 4CWBA 2Y1IA 3BS9A 3Q83A 4NLDA 3Q8PB 1H7XA 1VQ9S 1PJ5A 3KUEA 2F8MA 3O44A 2W2NP 2ROPA 2PC6A 2ZD1A 1M90T 3RR7A 4NXMJ 2KZZA 2HAFA 4DMZA 2KRBA 1YITS 3C14B 3B6BA 1JKHA 2CPXA 5DDPC 1SJ3P 3EUNA 1H73A 5C2CA 1WC5A 2HHHF 2WONB 3F44A 1OPIA 3IXQA 3UE2A 3IN5A 3V6DB 1NPPA 3I0SB 1QAXA 1KTVA 3PYDA 3W7BA 4WFAQ 4FXVA 2UUBF 2XB2D 3BM7A 3FCHA 2MXYA 2FY1A 2HQIA 3PZPA 3MECA 1HR0F 1UZDA 2BJ9A 2NXJA 1S9EB 2YNHB 3AXKA 3GJRB 2BUNA 2Y0SD 1KKHA 3NWRA 4LR9A 4YDXA 2MKCA 3US5A 4ETXA 2V9WA 3H59A 2AYMA 1ZBTA 2C2EA 4PWUA 4CLFA 1HI8A 4J9QA 2YWEA 2G2YA 4PPZA 4TVAB 4DPYA 2MQQA 1UPMB 5IT4A 1SV5B 3UN3A 4RR5A 1Q7LB 4ZVFA 1IBKF 1HIYA 3E2EA 3R2CJ 4ES3A 3MD3A 3N28A 2KHDA 4OYAA 3ILOA 4OV1A 2XMJA 4P7TA 4C98A 3EPGA 1S97A 4I2QB 1A9NB 3R7BB 2W2QP 4OZ3A 3POTB 4B3RF 1SB6A 2E5GA 1LWFB 3F56A 1XERA 4PCQA 1S5ZA 1AUDA 2XYGB 3NBPA 1MLAA 4Q0BA 1REGX 4HTJA 2F7VA 3U7JA 5D4NA 2ATCB 2YNIB 1RWXB 2JC0A 2AJ4A 2PI4A 1N5VA 2OPQA 3N5BA 2R7SA 3OFGA 4OQJA 3Q2TC 3ZTPA 3MCMA 3C6UB 4JI1J 3Q8QB 3PX0A 1TP7A 2E1MC 2HBYB 1MWZA 2RDJA 4DQQA 2DTJA 1VRTB 4HT7A 4PXEA 2CXEA 2J76E 4FN5A 3CUNA 4OL8A 2AJ2A 3I4PA 2YKNB 4DXLA 4DI6A 1J5EJ 4OJHA 1RTIB 2MZQA 2VF3A 1TUGB 2Y3YA 2ZKUA 4P7VA 2I8EA 5SUHA 3RB6A 1W2BR 4LF5J 4LSZB 2PD1A 3I87A 2QL5B 3OHBA 2XCAA 3ETMA 1X4CA 3CCES 1T0TV 1JLCA 2DD8S 1QJHA 2J8SA 2ZOMA 5T7LA 3TANA 2KVQE 4WE1B 4F4KA 1CULB 5IC4B 4X4SA 1EB0A 3E8OA 4F26A 2BMBA 5A6PA 3DRSB 3EICA 4NZ6A 4ZP8A 1WC4A 3BDPA 3CD6S 3DXBA 2OTJS 3BH7B 5CXTA 2ZJRQ 2CQ0A 4H54A 4OI4A 2ABYA 1I6JA 3BREA 4PUOA 2PDAA 5KFSA 1YBTA 2UXBF 4C0HA 1YRXA 1YJ7A 2V2ZA 4AD6A 4KY3A 2ZJQQ 2CWKA 1S6PB 4JI6F 1JLAA 2FJAB 1JJ4A 1XMBA 4WFZA 1EETB 1T95A 3AXMA 4FP9A 2FHOB 1JLQA 2A10A 4IYQA 4J9VA 1S9EA 1UFKA 2YNHA 5KG4A 3ITHB 5DDOC 1TL4A 2M8HA 2LQ5A 3GZ7A 3QWPA 4RW9A 2K8GA 2Q3PA 1TK5A 1VQSA 4OLPA 1DARA 4P10A 5KT5A 4B3MF 5A2QU 2ASYA 2M52A 2V50A 3GJQB 3OSPA 4V19J 1H2TZ 1TL5A 3F0NA 3M05A 5KG7A 1NUEA 4O23A 1S48A 3CDUA 2AEJA 4NI2B 3K58A 4DR2F 4BWMA 1OWXA 2RJZA 2F8EX 2MDAA 4I67A 2Y1RI 2BRLA 5I4MA 1PG5B 4J37A 1IUJA 3V81B 2FVRA 3CJ4A 1RWVB 2X51A 4IOCQ 4BWJA 2VG5B 2HHPA 1CBKA 4E2FB 3CCMS 1VBZA 4EBCA 1GTHA 1RHQB 5HMZA 1Y11A 4DU8A 5F9NA 1H74A 1KTQA 1V6HA 4U95A 3RTVA 1YBAA 1UFLA 3AODA 3D4JA 1RHUB 4JOUA 4ECWA 4GO7X 1VBKA 5J1PA 2DRDA 1NJYA 4OX7A 3PX6A 4ZCKA 4LUBA 4CRJA 3V4IA 2EFGA 5A6WA 2UVRA 4YP3A 1OJ4A 1EQMA 2M9KA 3K17A 5KFRA 1VQ6S 2KHCA 2QYGA 4IRCA 1NDPA 4L75A 5DM7Q 5KG0A 1H98A 3UDEA 3CULA 2DNQA 2GGPA 2RIJA 4HHHA 1C1BB 2CIMA 4PYAA 3UN2A 3DLGB 2CJYB 3NEKA 1JNRB 4LBHA 2MZTA 2MQLA 2YBVA 2HFVA 3QT5A 1ZTWA 3CMQA 3ICLA 2P9GA 2ZUAA 1JLCB 3OBIA 5ETRA 1VYAA 3EXCX 4USTA 2PI5A 2A0FB 2O5DA 1UEVA 3NOCA 3KLIB 2I5JA 2WVFA 4HKQA 3KXDA 3P96A 3CSKA 3ZXWA 5JUMA 5KG2A 4M5KA 4KJIA 4L74A 2G4BA 8AT1B 1U1PA 3S1TA 3UR3C 3SSQA 2QC3A 2GO9A 2KT3A 4HH0A 5EX0A 2XC9A 2J9DA 4B3SJ 1MMLA 2IA0A 1FDAA 3LP1A 2UZAA 4Q43A 2M5YA 1FFGB 2CVEA 2R2SA 2AW0A 1RT5A 4G1PA 1HL6A 3NAHA 2YVSA 3NY0A 3G86A 1D1UA 1GEHA 3PDNA 1G2EA 4NZ0A 3M2UA 1KLMB 4MK7A 2VHGA 2UXDF 4CIOA 2HFNA 1BQNB 3PW2A 3PX4A 3MDFA 3RBZA 3SBMA 5JXSA 1LFPA 5GADU 3RAQA 2CQPA 2GAGC 2H48B 2GQQA 3R7NB 3M2VB 1G7CB 2GCFA 4B3SF 1XTZA 4R5PB 4MK8A 1RAHB 4ANCA 1NSKL 4DV0F 1CC8A 2HIYA 5DJBA 3DDNA 3I32A 3PTWA 4PQAA 4RUHA 5L46A 3F73A 3QRPA 2HQDA 4X2BA 1TUVA 3VVTA 2HHUA 2HNZA 3HVWA 3OHAA 4ER8A 2HK3A 5CYJA 4O4GA 5FD1A 1FRXA 4ZCMA 2FVQA 4RBUA 1OIAA 1RTJA 2B4PA 3BSCA 5KAKA 3AB4B 4K5SA 2MKSA 1T7PA 3AFGA 3C19A 5KFCA 4FDFA 3KK2B 5KFIA 3OUYB 2AV5A 5IWAF 2FD2A 5E5NA 3D5MA 2EFPA 3DHXA 2YH0A 3LAMA 1EP4B 1HBMB 3SMZA 4IO9Q 3RB4A 2PFFB 3TUPA 1CJUA 3BR9A 1KLNA 5I3QA 2YX1A 4C3LA 2R42A 2RMLA 3UVJA 4KHPF 2B0GA 3NCRA 4LQ9A 3PYFA 4TU9A 3K57A 3ETOA 1Y10A 3ZZUA 2JH3A 3NGTA 2W4DA 2Q1LA 1SH3A 3A1YG 3A8KA 3D6MB 3CGIA 1IQZA 1C0TA 4FNIA 1WI6A 1WELA 4OHVA 5LL6d 2OI2A 2CG8A 3WHIA 5C24B 2FLPA 1FK9A 3DGPA 3E01B 2MKJA 1UA1A 5LJ5Y 2V94A 3UDLA 2ILYA 1C1CB 1RA6A 4N77A 3CC7S 1RTDA 3B4MA 3I96A 3G2XA 2P9EA 3J7YU 1WWHA 1JLBB 2J7KA 3QJPA 2BXJA 1H6KX 4UOFA 1ZZNA 2PT0A 3DLKB 2GV1A 4JI0F 4YR3A 4UQGA 2ZH8A 4UF4A 1R8CA 5GAHU 5L1LA 1R0AB 4RNMA 2IIHA 1TKXA 4PG4A 2CADA 2XCPA 4NEZA 3CJSA 4WP3A 1FF2A 2DXEA 3NRBA 4HDGA 4OZ1A 4DSJA 2AYEA 2L9DA 5KT6A 4CLZA 3FFIA 2XYPB 2N82B 1U1OA 1PYSB 1U2RA 1K73T 1WOOA 2ZM6F 4L73A 4OX9J 4MH8A 3AQOA 2ZHAA 2DITA 4ECXA 4GKKF 2CPJA 4TY9A 1RAJA 2P8IA 1NO8A 1XMOF 4EZ6A 2CQGA 3UD5A 1FX4A 1GXTA 2Z8QA 3CPWR 2AU0A 1VQKS 2POKA 3OJSA 2WBMA 2XGPA 2XMTA 5LMUF 2UUAF 2YKAA 5J2MB 1S72S 2FHMA 3R1LA 2E1PA 4YB1P 1FKOA 4JYAF 4RW4B 4DSKA 2OPPB 2CJKA 4Q7AA 1WF1A 2BYCA 3BR8A 1K47A 3DYAB 5KOXA 4P71A 4G1QA 3PIOQ 1LWCA 5HLFA 1VISA 5B0DA 1HYSB 2DGUA 3A12A 4TY8A 3CCTA 4OHXA 2XULA 4Q8EA 2F5GA 4CO5A 4K8RA 3G6ES 1PJ6A 2ZBRA 4I56A 2FHJA 3OL7A 2F4VF 2XS5A 1SVDA 3KMSA 3HX9A 2MSSA 2CPYA 1EARA 4LIRA 1JIHA 2R7RA 1ZPWX 4GO5X 1KQFB 1XBWA 2ACMA 2IJFA 3M6WA 3MUVP 3BQ0A 4DUYF 4PABA 1WC6A 2IM3A 1RDRA 2P6SA 4FVMA 4M5IA 3MFHA 3TWZA 1RWUA 5ETLA 3KLGA 4DSIA 1FWPA 1HKAA 1UL3A 1RAGB 2IPOB 1VRUB 4NX9A 2Y1JA 1UAWA 3GTYX 4HHJA 1NK6A 2UUWA 3T41A 4H4MB 4JV5F 1MNEA 3GFZA 1B4SA 1RZMA 1Q16B 4NCGA 4R25A 4Y34A 4B17A 2IM0A 4CQ1A 2HZVA 2PFDA 3CE8A 3HFZB 1YJNS 2IDEA 3PEJA 1BMQB 1S1WB 3C6UA 1MROB 1S6UA 3CCVS 3KHHA 3G87A 3TP2A 2MZJA 1HBNB 5J2QB 3DRYA 1YG0A 1VRTA 5CZXA 2MHNA 1X5OA 3KFWX 4YUDA 4ILLA 1X4FA 2PIIA 3Q8YA 3FK4A 3UN5A 4DUZJ 4FBUA 1APSA 2KXFA 1WDDA 3DU6A 4RBVA 4RWXA 2X1AA 1MMDA 1S49A 1HQ2A 3AD7C 3RBDA 3TX8A 2R4FA 3MAAA 1SIWB 2V2VA 2CQIA 4Z7YA 2Q43A 3QT7A 3ADAC 4ZJLA 4PZVA 1FE0A 5M2PA 2U2FA 1IKXB 2C2OB 5B0FA 4C7QA 4X62J 1O5JA 2D41A 2AEFA 1N34J 1CS4A 3HVTA 4KHMA 3TEGA 4N8OA 1ZA2B 2R7WA 4F4XA 2YPZA 4PG6A 4UZCA 2QEXS 3OLAA 4Q2MA 4DR3F 2UXDJ 2DNNA 1RWMB 3FKBA 4LF1A 3V6HA 1NDLA 4WIIA 3TQEA 4X4OA 1Q8IA 4HACB 1R0BG 4KV8A 5LSLA 3T6JA 4K4TA 1K44A 5J2MA 4JI7F 4YMEA 5L39A 4OMFG 4X4QA 3NL0A 1M5SA 5AE1A 3TEHB 4WCEQ 1IR0A 2BQ3A 2HVIA 1S1VA 3SQOP 5K8NA 1QVFR 2VICA 5T41A 4ZJOA 4G1QB 3OVAA 1Z4UA 4ZVEA 1VBXA 1S77D 1VQ8S 3ITHA 2CNKB 4ED7A 3EMTA 2GVDA 2QSWA 4QR2A 4IG0B 4ECTA 4C48A 1N5YA 2A2DA 5KG1A 2GA7A 1KBRA 2FUG9 1HNVA 4OYXA 3DOLA 3UW1A 3LWLA 2HHSA 4P6QA 3NKYA 1Y7PA 2IVYA 3W1YC 3M9NB 5BYQA 4DG1A 5HMXA 6FD1A 1WKKA 4RL1A 2UU9F 5IM0B 2LU1A 2RDDA 3LOUA 3LUYA 4K0KF 1U09A 2HW3A 3PO4A 3LAKA 2EG2A 3KMQA 1S59A 1G1XA 1SCJB 1X4AA 2ZD1B 2ROGA 1NAQA 2R8GA 1FJCA 2R8HA 4LFAJ 1RWOB 2RNEA 2V0NA 2R7OA 2XMWA 3EGNA 1U4BA 2DNGA 2OELA 1JKHB 1JLEB 2V6AA 2ADCA
chains in the Genus database with same CATH topology
5K9FA 2MKIA 1TKZB 5F0WA 2DGOA 2JZ5A 3QPIA 1U1NA 1GX6A 1C4AA 2B51A 2HLTA 4ES1A 2UVWA 2CG4A 4USIA 3OW2R 4ECZA 1FDBA 4DN0A 2W9CB 1FCAA 2CPHA 2NSBA 3SFGA 1TQLA 3JSMA 3RB0A 5GAEU 3MEDA 3J81Y 3KYLA 4JBCA 4IRKA 2K3KA 3LQVA 4LMZA 2JEGA 2CJQA 3CD0A 3CT9A 1LV5A 2JLEA 3NNAA 2AJFE 2G1DA 1V3ZA 2VD3A 3DLGA 3M30A 3OFEA 3BJYA 1D9DA 3NMAA 4WZMA 1GAOA 2RB7A 3V5RA 2P5VA 1KQSR 2HHXA 1TAQA 2QIFA 4PWDB 3SCIE 1F60B 1S1XA 1IKVA 3K59A 3CC2S 2AGOA 3EXYA 2E1AA 1BY9A 1FDNA 3I5CA 3IO1A 3S6EA 1NRKA 2N4CA 4HL9A 4LF5F 3O5TB 4G6VB 2BVZA 1ZPVA 3FSXA 3CCQS 1QVGR 1AW0A 2ZBIA 1FJGF 4WXWA 1SJFA 4KQZA 2C22A 3PNIA 5KFZA 2XNRA 4ILMA 1S9FA 3U02A 3GFHA 2M3DA 2D74B 4PKDB 1B0PA 5G0RA 1ZTTA 3PJWA 4J9KA 4AL6A 4M94A 2NPFA 4NXNF 2O66A 2KT5A 2OKQA 4OI2A 3MWBA 4MAKA 1HBOB 2H5EA 2YH1A 2DIUA 5K14A 4B3OB 3CJKB 1JK9B 3GV7B 5E33A 2J6TA 1VQYA 2FVSA 2FPHX 3H8YA 2OH2A 5I3PA 2XI2A 4UOCA 5IM0A 2MZ1A 4ED3A 1HA1A 4A47A 1HQUB 4KPYA 3KTQA 5E3QA 2OPRB 1SXLA 4PXDA 1ZOTA 3G6YA 5A8RA 4DFJA 1S0NA 4ICLB 3SFUA 2B4OA 2BM0A 2M0GB 3UCGA 5DDQC 1VQLS 1Q82T 4ID8A 3BB5A 1IM4A 4HYKA 2KG0A 1BD6A 2WB4A 2B6AA 3LW5C 1TFWA 1F9FA 2LA4A 1NJZA 4AL5A 1F0XA 2J7UA 2L48A 3K5OA 4U7CA 2XLIA 3KLFA 3TA0A 3G4SS 2MSTA 1JLFA 5F8JA 2ZHOA 2VG6A 1KVJA 3GG0A 4AFFA 2GMHA 1QM9A 2XLKA 3V2UC 4YB5A 2HHQA 4R0JA 4TQRA 3S01A 4DS5A 4C3MA 2ZH6A 2CRLA 4X64F 1FNOA 2CDQA 4X84A 2VKZG 3RR8A 5I3UB 2DCUB 1KVIA 3KJVB 3ENQA 3GSDA 4DV2F 2V9KA 4YQWA 4CTAA 3I5BA 2OMLA 3VQSA 5KFHA 1L3VA 2WBRA 2L9NA 4UUWA 3KLHA 2PMHA 5GMKa 3DLKA 4K5RA 3TO8A 3EGZA 5DQGA 3HHNB 2HW3A 4IDKB 3OR2B 4O3OA 5HMWA 1RT3A 3UD4P 4NLQA 4CO2A 1RYRA 3SSSA 2CQDA 1NKEA 3KOAA 3GE9A 2CQ4A 4I1TA 4IRDA 3L95X 3IG1A 3MM5B 1TFYA 2BANB 3IWNC 3D1OA 1NB7A 1RT6A 2EK6A 1FESA 2LEAA 1YJ9S 4K2XA 4KSEB 3CMES 1T03A 1FDDA 1FXRA 1S6QA 2FLOA 2K3IA 3MM9A 4DV3F 1SH2A 1F5CA 2JRSA 3M32A 1M5KC 3W2WA 2KU7A 1MMNA 4NLOA 2VFTA 4DL2A 2XMVA 5L1IA 4KFBA 4FYDA 4TLRA 2ASLA 1RT7A 2DRAA 5KOWA 1VI7A 1LWCB 5J2PA 2MY8A 1MWYA 2F8HA 2UVVA 3LP1B 4RUCA 3MR2A 1TKTA 4ELVA 3MMJA 5KFWA 4LF9F 5AE2A 1HWLA 3PM9A 1E6VB 1WF2A 4BS2A 4EU0A 4O3PA 5L1KA 2DGQA 2VA3A 1BGXT 3G8TA 5A8WA 3DLBA 1CVJA 4J5OA 2CJBA 2QRRA 1RT4A 2HVHA 1QY7A 2Z2MA 3MGJA 4FZVA 2DH8A 2P9CA 3BGFA 3GMGA 2VG7A 1K1SA 1DTTA 3P3DA 7FD1A 2ZJPQ 1K0TA 1UVNA 4RU9A 4EBDA 2MPUA 2ZH9A 4DX8H 2HHTA 3KG1A 3HZEA 1RT1B 1S1TA 2RUGA 2B43A 2JVOA 2DNZA 2XSJA 4MFBA 3O6QA 1VQ5S 4ED2A 3NNCA 1HBNA 5A2QY 2JEIA 3M8QB 2WCXA 3MMBA 3KK2A 1FERA 4NXMF 4AXIA 3M1VB 2QMWA 1Q8BA 1W25A 4NA1A 2BR0A 2YNFA 3IWLA 4NLUA 3M8RA 4Y0FA 3JYTB 1FNXH 2W7PA 3UCZP 3LANA 2OAUA 3D1QA 3EX7B 3IG1B 3MM5A 4OX6A 4UQTA 1ZM9A 5F0UA 3HP6A 1IKYB 1H7WA 2GMJA 3OTEA 1SJQA 3HKZD 3VQTA 2NZ4A 3T5KA 4C8LA 4R8UA 2XY7A 1TKDA 3GYNA 1I1GA 3MEGA 3HDSA 3MTJA 2IC3B 4D3GA 4O3RA 3K5PA 1GXUA 2LXUA 3CJ0A 2EWHA 5F8HA 2A1BA 4I6AA 3HHLA 2DGWA 5F8IA 4LIWA 1IXKA 5DDRC 1X9WA 2R7XA 3HT3A 3QO9B 2NPIA 2RS8A 4F8RA 4RW7B 4ECQA 3ISND 1DAXA 2R7QA 4ECUA 4C11B 3QWUA 5D78A 1P8GA 1VLYA 1Q53A 5KG6A 4PPDA 1FNMA 4A8YA 1N5TA 3SCJE 3CCZA 1CLFA 4AQYF 2IHR1 2ASDA 1QSLA 1YHQS 2IBKA 1FD8A 1RTIA 4DG1B 2NXUA 2BRKA 1NNDA 1RT4B 4V19X 3QGGA 3V6KA 2M88A 1HNWF 4DF4A 4RW6A 4J9SA 4ED8A 1RK8A 2DH9A 4C8MA 2EPIA 4QYZJ 5KFOA 5GAGI 3UWTA 3M8PB 4QPTA 1N36F 4B08A 1MU2A 1TKZA 4EFAC 2WW8A 1Q79A 3LP2A 4X4NA 3UPFA 2WOMA 3O2IA 3SQGA 1C4CA 2DHGA 2XHWA 1S6PA 3J80Y 2WTFA 2LQBA 1NH8A 3MEDB 3SCKE 4BC7A 5IXUA 1KHWA 4TY8B 3TUJC 1M0SA 2OMOA 2L9WA 4DWIA 4U9RA 3CCRS 3BSNA 2GJIA 1KNZA 2KTQA 1XC9A 2O3DA 3DFEA 4X66F 3J7YI 3AJ2A 4RZRA 2R2TA 1UVJA 5B0BA 1VOMA 4IFVA 3H5SA 4WU3A 1Y5IB 1CEZA 2PSZA 3BGUA 7FDRA 3HVRA 2DGSA 3CWJA 3NGKA 5LXRA 3NS5A 5H9EJ 2GHWA 4B3TF 4ED5A 1VRUA 2R2UA 3TVKA 4ALZA 1XNRF 2KG1A 4KGMA 4OIXA 2IAJB 4IUFA 3MEEA 5KFYA 4TQSA 4MIAA 1VQ7S 1LXJA 1RT2B 2D7SA 2DNLA 2N7YA 4WTYA 2JHEA 2RQKA 4TYAA 4ED6A 3TAPA 1E6YB 4FXWA 4JI2F 1RKIA 3LP0B 5DO2A 2RH3A 3HHLC 3JTPA 2YY3A 3H98A 2DNPA 2R9LA 4X62F 3T5JA 5F8NA 4HDHA 2C3YA 1URRA 1WF0A 4ZCIA 3J7Z5 4JI4F 1X4BA 2ZITA 4NA2A 2J5AA 2N4DA 4DR6F 3N0VA 4DN9A 3PRBA 3KLIA 1DQ9A 4DOZA 2IYIA 3T5HA 2ZC3A 4IH6A 4MIWA 3PKMA 2LKZA 3MM8B 5JVGQ 3PJXA 1P9QC 2V8HA 2CPIA 4QZVB 2XY6A 1Q86T 2HAIA 3JSRA 3VTIA 1NK8A 4YOEA 2KXHA 5L1JA 1S1VB 2D3ZA 2GJ2A 4OI1A 3RRKA 3KK1A 5LT5A 4HLBA 5U47A 1AXQA 4IH7A 1P27B 2AQ4A 2VUGA 1JLQB 1FVQA 4B9VA 4TU7A 1U8SA 3C6TA 2A2CA 4QIWD 1TL1B 2K1RA 3BO3A 5D3GB 2JFKA 4AXJA 1R6YA 2CQBA 3VF0B 5KFEA 2BA9A 2NUUG 4ZDNA 2ADBA 4JI5F 1HPZA 5F3ZA 1SJ4P 1SL2A 2KVIA 1QLNA 1KR4A 2RF2B 2W9AA 4NLPA 1RQ0A 1UVIA 3HK2A 2DISA 3DHWC 2SXLA 4TYBA 3BO4A 3DCAA 5I3UA 2XSFA 3MPWA 3OR1B 5JVHQ 4F3OA 4LVNP 3FNNA 1JLEA 3N5FA 4K4YA 4A8WA 4N76A 2W24A 3KLHB 2PO4A 2W25A 3TAMB 5E41A 2IM1A 3PACA 4I2PA 3SEOA 4OZ5A 2QA4G 3PY8A 4FVCA 1E6YA 4MJKA 3L09A 2LEBA