2K3KA

Solution structure of drosophila melanogaster snf rbd1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Structural and Functional Studies of RNA Splicing Factor Sans-Fille by Multidimentional NMR Spectroscopy
rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein
total genus 29
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2k3kA00
1RK8A 1RKJA 3H2UB 2RQ4A 2M8HA 1KOHA 3ZZYA 2DITA 1M1KT 1QVGR 1VQMS 3P3DA 5JVGQ 1WF1A 4ZKAA 3UCZP 1XN9A 1SJQA 2DNHA 2MZTA 2DNZA 3BEGB 2YWKA 4F02A 2CPYA 3FEXB 2F9DA 2MYFA 3ZZZA 2LEAA 2MY8A 2MKKA 3L3CA 1DBDA 3CCJS 2K3KA 4IUFA 1U2FA 2CQ1A 1KD1T 2J76E 1X4CA 2KYXA 3H2VE 1H2VZ 3S7RA 2LECA 3UCUP 5CXTA 2DHXA 3VAIA 1URNA 2VOOA 1HD1A 2EK6A 2G1DA 2XS7A 3CD6S 1BY9A 2MGZB 3MUVP 1U6BA 5LSLA 2G0CA 1D8ZA 2MMYA 2CPEA 2WBRA 2DGSA 1JJ2R 2Q79A 2LXIA 1N88A 3CCVS 2ZJPQ 1X5TA 2VODA 4Y0FA 1X4FA 2OSRA 2MZQA 2J8AA 2X1BA 4F25A 2J0SD 3VF0B 3NNCA 2RS8A 1YI2S 1N52B 2LQ5A 3G6ES 1P27B 2XS2A 5LJ3Y 2DNLA 2KM8C 3VAMA 1L3KA 3UE2A 3G8SA 5CYJA 4IOCQ 2D9PA 2KHCA 2KVIA 1DRZA 1S72S 3G8TA 2SXLA 4P6QA 2HGNA 1JJ4A 2DGQA 1VBYA 2FPHX 1M5PC 1U1QA 1NJIT 2DNOA 2E5HA 2DO0A 3R1HA 3UD3P 3IWNC 2XSFA 2N7CA 2BZ2A 5DDOC 5GAGU 5HL7Q 3MUMP 1SJ3P 2ZJRQ 4WF9Q 1X4DA 2OTLS 4QU6A 1VQ9S 2MQQA 2RU3A 1VQ7S 1WI8A 1H2TZ 5FJ4A 2OIHA 4WKRA 1X5SA 3EX7B 3CPWR 2M88A 2ZJQQ 2E5IA 2D9OA 2DNRA 3P49B 1M5VC 4TLQA 2RRBA 1WWHA 2CQDA 2KI2A 3R27A 2MZRA 2M4MA 4Y00A 1JMTA 2VOPA 3UCGA 2DNGA 2JX2A 1Q82T 1N54B 2DH9A 1VBZA 4LMZA 2CQIA 4TU8A 3BO2A 4J5OA 1YJWS 4EGLA 1WF0A 2CQ4A 2XNQA 3D2WA 2MQNA 1K73T 1F9FA 2U2FA 5MLCV 1OIAA 3TYTA 3CMES 2X1GA 2FC8A 2J0QD 4PRFA 3US5A 2RVJA 1X5OA 1KOOA 2MXYA 1X4EA 2MJNA 2RUGA 2XB2D 3U1LA 2AD9A 4C4WA 1WEYA 2CPFA 2F3JA 3CTRA 1SJFA 2AYBA 2FHOB 3VALA 1VQ4S 2M2BA 2CQ3A 3CULA 5DM7Q 3HI9A 3MD3A 1M5KC 1FJCA 1VQKS 3U1MA 2LMIA 2DHAA 2HGLA 1QVFR 2MSTA 1YITS 2MKCA 5IM0A 3N9UC 2VONA 1FNXH 3G71S 1R8HA 1O0PA 1OPIA 2MZ1A 1VC6A 1PO6A 1X4GA 3RW7A 3FEYB 2AYEA 2LA6A 2XS5A 2DH8A 1WHVA 3PIPQ 1WEZA 2DHGA 4WIIA 5H1SV 2KRRA 2DIVA 4C0OC 2ADBA 2N3OA 3SMZA 2CQ0A 2JRSA 1S79A 5GAHU 3NMRA 4FXWA 2M52A 2M0GB 1VQ5S 1UW4A 2L41A 1YJNS 2DNMA 3P5TL 3CCQS 2UP1A 2CQHA 2KN4A 3V4MA 2V94A 3VAGA 2YH1A 2DGTA 3SDEA 2GHPA 3JB9k 2E5JA 1VBXA 1SXLA 2YH0A 3I56S 4ED5A 1HD0A 4CH0S 4V19X 1OO0B 4LJMA 3DLLQ 3NNHA 2L9WA 2RNEA 3I55S 4WCEQ 5ITHA 2RT3A 1UFWA 2I2YA 2KG0A 3BO4A 2OSQA 1VQLS 3UWTA 1WELA 2MKSA 3OW2R 2F9JA 1K8AT 3UD4P 4IO9Q 1WEXA 2DGXA 1A7GE 3J7ZT 3BO3A 2RS2A 2JWNA 3CCLS 3TP2A 2E44A 3CC2S 3DXBA 1UAWA 5GMKa 3MI7X 2G4BA 2M7SA 2BOPA 1Q7YT 2LCWA 5LXRA 2GO9A 3P6YC 2M70A 3RW6A 3K0JA 2KM8B 3S6EA 2LYVA 2A3JA 3LPYA 3NS6A 5EN1A 3CC7S 2RQCA 3R1LA 1ZH5A 1WG1A 1X0FA 3EGZA 2CPZA 2B0GA 2O3DA 4A8XA 1VC5A 5HO4A 5LXYA 2CQPA 2MQLA 3VAHA 1YTYA 1WHYA 3MD1A 3THPA 1YWXA 2MHNA 5CA5A 2MGZA 1WHXA 2CPXA 1VQPS 2M9KA 3CMAS 1KQSR 2KG1A 1U1OA 2EK1A 2ADCA 3THTA 2DH7A 3PIOQ 3NNAA 2KXNB 2MZJA 1SJRA 4M5DB 3LQVA 3CF5Q 2CPHA 4Z2XA 1M90T 5JVHQ 1HA1A 2DGVA 3ULHA 2LA4A 2MQOA 2KXHA 2I38A 2DNKA 1QM9A 1U1NA 1DZ5A 1U1MA 1HL6A 5BJRA 2DHSA 3G96A 2DNYA 1VQ6S 2XNRA 2YKAA 3VAKA 1NO8A 4C7QA 3CCES 1YIJS 1WF2A 2DO4A 2QEXS 2DGOA 4WFNQ 2X1AA 2QFJA 3MXHP 5DDRC 2KH9A 5DDPC 1FHTA 2MKIA 2OJ3A 3HHNB 2X1FA 1PGZA 2MY7A 4IOAQ 4ERDA 2L08A 2DNQA 1FJ7A 1AUDA 4W90B 5D78A 4YOEA 1SJ4P 1KC8T 1VC0A 3VAFA 2KT5A 4PKDB 1X4HA 3MURP 4U67Q 2CQBA 3CC4S 5DM6Q 2MKJA 4OZ0A 1U1LA 3CCRS 4YUDA 1VQOS 4QPTA 2MKHA 2KRBA 5DDQC 1X5PA 5IM0B 2DK2A 3MUTP 1WG5A 5GAEU 1FO1A 3B4DA 2HZCA 1U1RA 1JJHA 3CCMS 3CXCR 1U1KA 1A9NB 1Q81T 1WG4A 1P1TA 1UP1A 4WFBQ 4PR6A 1D9AA 2K8GA 3CCUS 3CCSS 2OTJS 4UQTA 3MDFA 1FJEB 2D3OR 3MOJB 4WFAQ 2CPIA 4FXVA 2HVZA 2CQGA 5LJ5Y 2MB0B 4BS2A 2FY1A 2KFYA 2LXUA 3SDEB 2CJKA 3Q2SC 1U6FA 1VQNS 4TU9A 1FT8A 2FC9A 4W92B 2U1AA 2CQ2A 2MQMA 3EGNA 4LIRA 2DNPA 2RRAA 2MQPA 4CIOA 3Q2TC 2CPJA 3BS9A 1U1PA 5LSOA 2HGMA 1FXLA 2DGUA 3S01A 4QU7A 1WHWA 1WI6A 4QQBA 1YHQS 1YJ9S 1NU4A 2NLWA 2CQCA 3J7YU 2JVOA 2NZ4A 1H2UX 1K9MT 1Q86T 4F26A 2MJUA 5GADU 2EVZA 1X4BA 2KU7A 2LKZA 2MSSA 2AYGA 2DGWA 2KXFA 3IRWP 3VAJA 2MZSA 3CUNA 1N8RT 2HYIB 1ZZNA 2DISA 4CH1A 4CQ1A 2DIUA 3NS5A 2MPUA 2ERRA 2CPDA 2JVRA 2PE8A 2LEBA 5IFMA 3SXLA 1CVJA 1X4AA 1W2BR 3G9CA 2PEHA 5DETA 5GVQA 1G2EA 5D77A 2YTCA 4OZ1A 3S8SA 1R8PA 1DHMA 2AYMA 1WTBA 4YB1P 4UY8T 1VQ8S 2M8DB 2DB1A 2E5GA 3TO8A 1M5OC 2QA4S 5IQQA 1OWXA 4TU7A 3G4SS 1B7FA 1ZZFA 4RU2A 1IQTA 3B4MA 1H6KX 2DNNA 2N82B 2N3LA
chains in the Genus database with same CATH superfamily
1CS4B 3ZZYA 2W25A 5JMNA 5ETLA 4WP8A 3LOUA 5K8OA 1UCNA 2G2YA 3BEGB 3BKTA 2RQKA 2PC6A 4P9SA 3TNVA 3FRYA 2GHVC 4RBVA 4IRKA 3L7OA 2IHR1 1YJUA 2CPEA 3RB6A 4I7FB 4PQUB 1BWEA 1IKWA 5L38A 2H65B 2FTRA 1NK5A 4NLGA 4NPOA 1ACMB 3VAMA 4K4TA 4ZPDA 3AD7C 4R5PB 2KHCA 1XNRF 3L9ZA 2FPHX 3M8ZA 3AAWB 5KFLA 2N7CA 2HSEB 3QAEA 1EIYB 3M2UB 4RL1A 3DLHA 3JTOA 2KTQA 1WI8A 5E3QA 3HLUA 3QFWA 4RLEA 3CCZA 4UOCA 5GADI 3KLEB 1WWHA 2Y1JA 3QJJA 1RLDA 4QWEA 3GWCA 4KQZA 5JXSA 2B6AB 1GMUA 4FKXA 3F56A 2LDIA 1JLGA 4WU3A 4WJBA 1JXVA 2F3JA 1SJFA 5K8PA 4LF6J 1KHWA 3JQKA 1GMWD 4PPDA 1NMEB 1YITS 3N9UC 5DGBA 3PV8A 1OPIA 1I5OB 1KWMA 1HBMA 3QLHA 4PUOA 3CIMA 3TEGA 5IWAJ 4NXNJ 2KN4A 4OV6A 2WCXA 2HQDA 4DLGA 3M1VB 4DR6F 1N33F 1HD0A 4YS2A 3JYTB 2AT1B 4F4WA 1UETA 1RLCL 2ZC3A 2QX0A 3AT1B 1BUXA 2DGXA 3CCLS 3TP2A 4DV7J 2YKQA 3DXBA 4ED2A 3C2PA 1HR0J 5AE2A 2HHPA 1W7WA 1K0TA 4KPYA 4LFBJ 4F7VA 1RT3B 4KR0B 1SC6A 3V6DB 1Z1ZA 2QLFB 3MMAA 5LT5A 1K0VA 4ATNA 1SBRA 1WHYA 2AJ4A 4XPCA 4B9LA 1PSDA 2WVDA 3THTA 4F4KA 2FVQA 4V19J 4DR1F 4M5DB 1VJQA 3CF5Q 2JC0A 3TVYA 3UD5A 4LSNA 1YZ7A 2GAGC 4Q0BB 2ZITA 1DZ5A 1X0PA 3G96A 3W5ZA 4NLVA 1YGYA 1YJ7A 1EX8A 4GVLA 2W9CA 1UL3A 4USWA 4NA1A 4C2MA 1T95A 2R7SA 4DV2F 4ERDA 5HQLA 4L6V3 4DR5F 2BKPA 1N56A 1RP5A 2ZUAA 1CJUA 3OBIA 4O3SA 3H5SA 4C8ZA 4L72B 4FNHA 2GGPA 2O1PA 2V8PA 1OY9A 4DSEA 4DXLA 5DS7A 1TL3B 4N8OA 2F63A 3NRBA 2JLGA 5IM0B 3H7HB 3QATA 3CXCR 2B51A 2CZVC 4LUBA 2ROEA 4EO8A 2H48B 5HROB 1VISA 1S6OA 3Q8YA 4N5SA 2MB0B 3K5MA 5AT1B 2KFYA 3I4HX 4O3RA 2VFVA 3LPEA 3E8OA 2QLJB 2BE7D 2AGPA 5LMUF 4WXWA 4DV5F 3S01A 1WHWA 1WI6A 1WC5A 4DZDA 2QTWA 4P74A 4AXIA 3OHAA 1IWAA 2D74B 1HPZB 4Y2MA 3DM2A 4KIAA 4RBUA 4XAKA 4WFZA 2EVZA 1X4BA 3FMBA 2AYGA 3D1HA 2OEKA 3ITHA 3M8PA 4M94A 3QGGA 3ENAA 2MPUA 2RDIA 3D68A 4LRCA 4TQSA 1SL2A 4QR1A 3I5CA 3EXYA 5D4NA 1JJCB 4DV0F 3MR5A 1SKRA 3BSAA 3ILOA 1ULRA 3QT8A 3NGDA 2M8HA 3DI6A 1NUEA 3MPVA 1BWVA 3CD0A 2DXFA 2V4JA 3JXOA 4OX7A 1BD6A 3ZC4A 5L8RC 1TQLA 3HX9A 3SEOA 3KK3B 3RRGA 5HI7A 3PNIA 4CRJA 3L3CA 4J9NA 1Y0HA 3IGVA 2OD4A 1WOOA 5CXTA 2HNDB 2KYZA 4J9PA 3TA0A 5FD1A 4LF7J 4EUVA 3UNGC 3CDBA 4DL6A 1RWUA 1U4BA 1MN9A 3ET6B 4M5IA 3DGPB 4O0IA 2J0SD 1JB0C 4DWIA 3G8SA 2G9OA 4TXSA 3CJ5A 3JAMU 5CD4A 4D3GA 4B08A 3W2WB 5KFWA 4A8QA 3M6UA 3TEHB 1RAIB 5F8JA 4JI6F 2LVWA 4ES3A 3MAQA 2B4OA 5FLXY 2G13A 3QIPA 4ZP8A 2CJXB 3EX7B 2VPWB 3PYDA 5IT9U 3ETMA 1DARA 5HP1A 2DNGA 5HLFA 4LIWA 1R43A 1BQMB 3KOAA 1VGYA 1WF0A 4Q8EA 3FGVA 3G6YA 1LWFB 1LFPA 3K89A 4NOHA 2VBXA 2IM2A 1LW2B 2EKNA 1UFLA 1X5OA 1IBKJ 1V9OA 3HZEA 3PR5B 3BPDA 5J1PA 1P6TA 3KJVA 3C3LA 4WKYA 1AFJA 3DU5A 5CQGA 2V5HG 1KP6A 3DRPA 1GT8A 1XR5A 1WKKA 4MJKA 2DH8A 3MM8A 3R5DA 2ADBA 5KFBA 3AY0A 1AZSB 3FZBA 3SV4A 4ANCA 4E8UA 3D6FB 4ELVA 3GR1A 3EYZA 1Y3KA 3TZXA 2EBGA 2C3YA 5ITHA 4DV1J 2C2KB 4QIWD 2OSQA 4CO0A 3JTPA 5A8KA 2C22A 4ID5A 2GMHA 3CD7A 5DQGA 1MROA 4F0MA 1JLAB 4L3NA 4DG1B 2QC3A 1Q7YT 1S6PA 1MWZA 3R1LA 1QSSA 2R2RA 4CDIA 1TELA 2FLOA 4A8XA 3EZOA 1YTYA 2APOA 4X2BA 1CULA 4KE5A 2CPXA 3RRKA 2WB1D 1U1OA 2WW8A 4ZHRA 3MMBA 1ZOTA 1SJRA 3MF5A 1UWBB 2HVDA 5B0FA 3QRRA 4L76A 3IRXA 5CAAA 3AXKA 3CMQA 4LF6F 2GIQA 1Y3JA 1RAAB 3D54A 3NY0A 2FJEB 1AW0A 3EZ5A 2YVSA 1FVQA 1T9XA 1M0SA 4RJVA 1RT1B 2W01A 2CUYA 2QA4G 2I9SA 4UF4A 4YR2A 4M5LA 1FJ7A 1AUDA 2ALYB 2W9BA 2XM3A 5IWAF 2H54B 3VAFA 1LEOA 4NASA 2ZNYA 4RNOA 1DFDA 3TX8A 2P9CA 4OJHA 4F0KA 2VD3A 3BGRA 1ZAVA 5C24A 3TWZA 2D69A 4FF3A 3BQ1A 1JWWA 2GMLA 4NI2B 1JJHA 4JYAF 3KWMA 3KXDA 1HNVB 3NEKA 3CCTA 1NHUA 5F9LA 2NXNA 4EBEA 2R2TA 3CCUS 1RT6A 2JDJA 3BREA 2DPJA 5K8NA 2CPIA 5C2GA 1HR0F 4LR9A 4RUCA 4JI2F 3OHBA 3TAQA 2JC1A 1C4AA 2MQMA 3EGNA 2UVVA 2C2NA 2MLZA 4HHHA 5IQ6A 4K5RA 1H7XA 1U2RA 3DCAA 2W7AA 4ECRA 4UOGA 3KTQA 1FFWB 4PWDB 1VHFA 1K9MT 2ZDPA 5KFFA 3UDCA 2F4VJ 1CLFA 3K2YA 1O51A 2Q6CA 2HZVA 1HKAA 2K7JA 3EM1A 4EEYA 2LEBA 1S10A 4DPWA 1TZ0A 2B9EA 1S97A 1HIYA 4EU0A 2PEHA 3AHPA 3D9BA 2UV8G 2VC1A 2Z4PA 1SH0A 4ECZA 3M8SA 4UZBA 2ZH8A 3I5AA 3MMCA 3WDOA 2QMWA 5FIIA 1FJGJ 2WSFC 3VGUA 2J6UA 5KT2A 4DZ6A 3M6WA 1JXLA 2OEJA 1JLEA 4UUXA 1FDBA 3HSZA 2MY8A 1V5VA 4IUFA 1RXOB 2KO1A 1TUVA 3VAIA 4G3IA 3BV8A 3J7AN 3OFFA 2VPYB 2LXIA 2D3ZA 4RU9A 5F41A 3CCVS 2ZKUA 3N6MA 2ZHBA 4OX6A 3FK4A 2XSJA 1VBKA 1ZBTA 3VF0B 4DPXA 2FJVA 1RACB 4DX6A 4DV6J 2XHCA 3IBCB 1FE0A 4B9MA 4O4GA 2DNOA 2DO0A 4GVBB 1TL5A 4YB6A 2XYHB 1ROFA 5BR8J 2YNGA 5IOLA 4Q2LA 1NSAA 2RU3A 4FXDA 4J90A 5HBMA 3UN2A 3DN9A 2D9OA 1N5YB 4CCHA 5JUMA 1N54B 1HNIA 1CJKB 1Y5IB 1XQIA 1F3VA 3PRDA 5MLCV 5J2QA 5G0RA 4LF8J 3LAKA 2PN6A 3SSQA 3BSOA 1N32J 2YX1A 4CP5A 1NKCA 1VQ4S 1R3NA 3CULA 3G2XA 4ZOSA 2NQPA 1RTDB 4MKVA 1VDHA 2QN6B 2VUGA 2G2ZA 4J9OA 1RJJA 4QOTA 5CCLA 5L9NA 4LF7F 3FEYB 3KHRA 1SQEA 2YQ0A 3D5MA 1TMJA 3WQPA 2N3OA 3GYNA 5A8RA 2ZH1A 2CQ0A 2GW8A 1SCJB 4PABA 5CCMA 2OUGA 4HH1A 1KVKA 2Y8YA 2ZBPA 3IM9A 1JLCB 4K4YA 2GO8A 2XBPA 2RT3A 2I2YA 1L5UA 2VC0A 1M5SA 1M1HA 3GG0A 3J7ZT 4IFVB 2BQRA 2OGUA 1NKEA 3OR2B 2G4BA 1UEVA 4C8LA 4QZVB 4LRBA 5AXKA 2VG6A 1URRA 2FQQB 4CT8A 2N4CA 4LRDA 1WC1A 2ROGA 1T03B 3MD1A 3ILLA 3P5BP 5L1JA 2YKNB 1XMOJ 2XG8A 2QL7B 4OX8A 2CWKA 1IBKF 3DOLA 4JOUA 1NXIA 3PR4A 3KLGB 2DNYA 4HI2A 3PEJA 4CLWA 1H98A 3PW4A 1L3VA 2OJ3A 4MIBA 2VFTA 5EX0A 2H1YA 1SJ4P 1NK7A 5CYMA 2EFQA 2A2DA 4RNHA 2V8DA 1C0UA 3FBFA 5D8HB 4PYDA 1YLXA 1NDCA 4I67A 2XMJA 5C7PA 4DV1F 1U1RA 3C16A 1U1KA 5GMDA 2RJZA 1BXNA 1IM6A 4AYBD 3NGKA 2K1RA 3H5XA 3GE9A 4NMXA 1HQEB 1QE1A 3LGHA 4ZCLA 2W2NP 3HHEA 4TU9A 4WZQA 3I6PA 2V9WA 3PG9A 2OLWA 3DHXA 2Z57B 2XMMA 3PXGa 2KFZA 2VBWA 1SC1B 2QGFB 1YJ9S 5I42B 4CTAB 2ZUGA 3KLHA 2OFHX 1TL7A 3NLCA 3PY8A 3IRWP 1YK9A 2PEBA 4DFMA 1ZZNA 2ZH7A 2FB0A 3HVTA 1SC3B 3CJRA 5KFDA 1KLMB 3HHDA 1R31A 3MOZA 2KZMA 3MAAB 2UVWA 1JNZB 1ZPVA 1FRJA 1TK8A 4R0JA 1R0CB 3O6QA 2E5GA 4OI3A 4FF1A 3HFZB 3ZNUA 1J5OA 1ZM4A 3WX4A 4K7QA 2MGZA 3H2UB 2WONA 2BANA 2HHWA 3U02A 4C3MA 4LSZB 2BE9B 3T6BA 2J7KA 1RWOB 3PHTA 2C2MB 3Q0AA 4DL5A 1X8DA 4CM2A 1X4CA 1B99A 3P45B 4URGA 2VG5B 2G0CA 1DY3A 1OSCA 1VRTA 4ED3A 2GVDA 4ECQA 1IJFB 1Y11A 4HVZA 2RF2A 2JSXA 3W5XA 2D3UA 2WVEA 4X62F 2HS3A 2H3EB 2YKPA 5F8MA 1MU2B 2ZH9A 1V3ZA 4ZN1A 1B0VA 4DPTA 2C3UA 4IO1A 4OJ3A 4RUHA 4ZP7A 1F60B 3GFZA 1N5SA 4HT7A 6FD1A 1JJ4A 1RTJB 2H5JB 4OL8A 3R1HA 2XSFA 2JNJA 1AYEA 1N4LA 4TY8A 2EG1A 4WF9Q 4X4NA 1X4DA 1VQ9S 2OPSB 4ZDNA 2K2PA 4ICLB 2D1CA 5B0GA 1R8AA 3UN3A 1IBMF 3DXSX 2WW4A 3UDVA 1LOUA 3P8BB 4X65J 1Q5YA 4IR1A 1UEUA 4M5NA 2ASJA 3CMES 1D9DA 4QWAA 3TVZA 4ZLLA 1LWEA 1KOOA 1JLFB 4N8NA 2Z2YB 4Y2CA 3N6LA 3L7PA 1R7IA 2CQ3A 3RU0A 3GIKA 2ZZTA 2N4DA 4GO7X 1FJCA 1VQKS 4PG7A 2DHAA 2MSTA 4EBDA 1SPBP 2MKCA 1RBLA 5EHHA 2V8HA 1X4GA 1MMNA 4IG0A 1S1TB 3PIPQ 3F0NA 4C0OC 1NK6A 9ATCB 3I9V9 1UMJA 2ILYA 5CYQB 4FVMA 1SXLA 1MNEA 3UPFA 5HMZA 3FJ2A 4I4BA 2L9WA 3VQTA 5E33A 4NXMJ 1T9WA 2L3MA 3V4IB 1G7CB 1NJXA 1UEKA 2M7SA 2BOPA 4C0BA 2AP6A 2HIQA 5IT0A 4KSEB 2A3JA 1H0HB 2HRTA 2CPZA 2B0GA 2MEWA 1Y7PA 1FX2A 1JLBB 5KG1A 2XY5A 4QYRA 5CA5A 1ZM2A 2HNYB 4DX7A 1F9EB 1J27A 4LQ9A 4HR2A 2KG1A 3I0SB 3NNAA 4OHWA 2E1MC 4XPEA 4G6VB 2IJNA 4C3KA 1QTNB 4RX6A 3RB0A 2WZ1A 2LU1A 2C2EA 1L3UA 2J9EA 2BBEA 3OVSA 1I3OB 2JOQA 3DOMB 4C6AA 5ETSA 2MKIA 2X1FA 2GJIA 3ETOA 2UXCJ 2XI3A 4Q7AA 1IKXA 5IZHA 4K50A 3QGIA 3V6KA 1AB8A 3DLEA 3HCXA 3MURP 3M8QB 2V63A 4U7UK 1XWLA 3W63A 5DZ6A 1X5PA 1NH8A 3T41A 3R9LA 3AFGA 1UKUA 5HVGA 1CPZA 3NAHA 4OZJA 2DXEA 1LK5A 1MMLA 3E51A 4FXVA 3DYAA 3ZZOA 1C1CA 4BS2A 3QO9B 4GRSA 4G1PA 4ANEA 3WX8A 3BBBA 5CHCB 4QQBA 3DC2A 1YX2A 5KFAA 1XMOF 3IS9A 1Q86T 1U45A 1UVNA 2MSSA 3N01A 2R7OA 3VAJA 1WTFA 4CH1A 1DTTB 2CIMA 2CPDA 3MM7B 3BDPA 2CKWA 1VK3A 3QMQA 3NS7B 3SXLA 4K2JA 2GVZB 3G9CA 1GQEA 3PW7A 3NGUA 4NLSA 3E2EA 2FJXA 4YB1P 4UY8T 3SQGA 2DB1A 1D3WA 4B3SJ 5CABA 2QA1A 1YG0A 4U95A 3KYLA 4Q2MA 3N6NA 4PXCA 4NZ7A 1LWCA 1QAJA 5IV4A 4B3RF 3MFIA 3R5BA 1S77D 4ZPCA 5T7LA 3HVWA 1REGX 3KG0A 1TKTB 3RAQA 4G65A 2EG2A 3CCJS 2AEFA 3GFXA 3ILJA 4A46A 5FLXU 2KJVA 3W65A 5B09A 2HK3A 4ER8A 2BQUA 1R6YA 2QG9B 3W1YC 4QYZK 1R0AA 4IKAA 1JJ2R 1S4EA 1UVKA 4A8OA 4LFAJ 1FKOA 2BJ7A 5ETOA 2X1BA 4WYLA 1REVB 3PKYA 5LOQA 2AU0A 4R0EA 4M1KA 4G1QB 2X7IA 3R6GB 1FK9A 2ZC4A 1TV6B 2E66A 2OKQA 1NJIT 3PX6A 1UJ4A 3AODA 4O44A 1BMQB 3FBCA 3MUMP 2BKOA 1WC6A 3PFEA 5E41A 3B54A 1H2TZ 3LW5C 2L48A 2GV1A 3QPIA 3CPWR 4PYAA 2M88A 2VFSA 2L9DA 2HNZB 2RRBA 2HFZA 5AE1A 4RW6B 4EGLA 2LQ9A 2MQNA 1K73T 1F9FA 4U7UD 5J1EA 2HHTA 2UUCJ 1HI8A 2IY5B 3M2RA 4U7CA 1V3RA 2Z58B 2XB2D 1BHNA 1OPZA 2AD9A 3ENWA 2V2QA 4IDKB 1WKJA 3M2VA 3MD3A 6AT1B 1M5KC 4KV8B 4W98A 2LMIA 3OTEA 2HGLA 1IKYB 2XQCA 4JV0A 3CJKA 2W4PA 4GC7A 4A8KA 2AJFE 2DHGA 3KUGA 2HWHA 5GAHU 2WSCC 1X7VA 2LLZA 2JZ5A 2ZWOA 3PX0A 1UW4A 4J9SA 2BEFA 4LF4J 1Q79A 1V6HA 1YKWA 2YH1A 1KR4A 4K4WA 1S6UA 4CO3A 4ED5A 2CADA 3PYGA 1N36J 3NNHA 5C42A 1QUPA 3OW2R 3LANA 2HG4A 2BACA 4JI0J 1IKWB 3DMJA 4OYBA 4CLSA 3HZGA 2FVPA 3RW6A 2BYCA 5EWEA 2KM8B 1FEHA 1U2CA 1WD6A 3CC7S 4OI6A 1WG1A 3QT5A 3CWJA 1RTIB 2ZBCA 4ZP6A 4X4UA 4I68A 4PWWA 5KFIA 5M2UA 2BQ3A 3EWGA 1HBUB 1U0HA 3AA9A 3DGVA 2HVIA 4KO0A 3PACA 1HWJA 3QYYA 5AE3A 3D3CJ 2J6TA 2BMBA 1KS2A 2YNHA 5BJRA 3GSDA 2YNIA 1NB7A 1Q8IA 2HHSA 2YWWA 4J7CA 5F3TA 4WFNQ 5DDRC 4NCBA 3H8YA 1RUSA 1HARA 2QFIA 4NYOA 3MEDA 1PGZA 4IOAQ 1JLGB 2FUG9 1FWKA 3RBXA 3PW5A 4C8NA 4C0HA 3I0RA 3SSRA 2CNKB 2OPPA 2HHHJ 3CC4S 4P7TA 3BDEA 1DTQA 2XZWA 2R42A 2DK2A 5GAEU 3QWPA 3DLKA 1ELOA 2YKMA 2QO3A 3DLGB 1HBMB 3QLHB 1ICEB 4TVAB 4XIUA 4ZCIA 1HFEL 2QYGA 4OMFG 5HSPA 2A10A 4MFBA 1Y10A 3KLIA 4ECVA 1NPPA 4ZCMA 5KAKA 4RUBA 1IXKA 3SIPB 1NB2A 2J9DA 4ZVFA 2MQPA 1CQNA 5B0EA 1PC4A 3BBCA 3BBFA 1FXLA 1RWPB 4FYWB 4JI5F 1YHQS 4IH7A 4F3OA 3CUNA 5SUHA 4ZCKA 2BE2A 2W4CA 3EPGA 1IR2A 5J2PA 3MMAB 5GVQA 3T5HA 2OELA 2E29A 5KG7A 4JV1A 1RHKB 2UXCF 3HKWA 3MPYA 4CYUB 4LSNB 4OZLA 4DU8A 3OVAA 4I7FA 4ELTA 5KFHA 1ITPA 2VIHA 1LV5A 1PYTA 4DOZA 2LEAA 4WTOB 2W9CB 1HMVA 3FBBA 2GNKA 1U2FA 2BRLA 3OSPA 3B78A 2F8HA 3AD8C 7AT1B 4YY3J 1IJEB 3FKBA 3LP2A 3W7BA 1CJUB 4U96A 1TKZB 4N41A 2XHWA 2Q79A 4JI1J 2F40A 3D7SB 2GGPB 3DU6A 3GMGA 4Y0FA 2OSRA 2Z56B 4B02A 3M2UA 3T5KA 2X51A 4BWMA 3RBZA 2IDLA 1L3KA 3AJ2A 4IOCQ 4KJIA 4ZIWA 5AJ3J 3X1LB 1FRKA 4NLYA 1Q8LA 2J0WA 3PJWA 5E3RA 3MMJA 1RB0A 5DDOC 4IG3B 5D0EA 4F3QA 4IR9A 2B6AA 5KFMA 1OY8A 1T3OA 5DG8A 5FDLA 2XGQA 3OTBA 1M5VC 4RKUC 1Q82T 5EUHA 1FFGB 4OIXA 2F65A 2VBZA 3DM2B 2U2FA 4DN0A 1SL0A 1OQ6A 3FEZA 5HMXA 3TZZA 4ED0A 2CJYB 1NK4A 4LF9J 2FVRA 1RI7A 3ITHB 3M8PB 5DJBA 1S9FA 4LSLA 3T9NA 4EBCA 4C8KA 3QFHA 5DQHA 3IC1A 3PRBA 1RCOB 1LWXA 4PZVA 3M1VA 2FHJD 1FNXH 1O0PA 2YX7A 5ETRA 2FHKA 5H9EJ 1WEZA 2O01C 1KVJA 2H51B 2HHQA 1S79A 1YRUA 3DI6B 1D9FA 3V81B 5GAHI 2V4JB 4H4KA 4YR0A 4CM0A 4B3MF 3AB2B 4AQYF 3VHQA 1VBXA 2YH0A 4NWBA 1OO0B 3L09A 4OYWA 5KFNA 1EQMA 4PG8A 4TN2A 1RT3A 3E01B 3UWTA 2Q1LA 1NHVA 5DO2A 4ZVPB 3MR3A 3W2VA 2NXEA 4I6AA 3AOAA 4USJC 3HHLA 1F9HA 5T41A 1NDPA 3RZAA 2GQQA 5I3QA 2FJDB 3K0JA 3BPSP 2PI4A 2QYCA 4RW7A 4Z7CA 1YBUA 3EGZA 4BDPA 3VAHA 3GONA 2B8PA 2LQBA 3THPA 2BR0A 2J6SA 3OFGA 4DSLA 1AFIA 3IAM9 4J9QA 2CPHA 2IYGA 3ULHA 3D28A 4KB7A 3M05A 2MQOA 3BGOP 5HP1B 1U1NA 1VQ6S 2RIJA 5HLFB 5D4PA 3QRPA 1RU1A 4GO5X 4UW2A 4C7QA 5BYSA 3CCES 3CSKA 2X1AA 4HHJA 5EWFA 2KH9A 1FHTA 3GZ7A 3SCKE 5ETNA 2QIFA 3TANA 4DR4J 3H4DA 4EYIB 3DRSB 3TAMB 1FESA 2BW2A 1NH7A 2JEJA 1TL4A 4DSFA 3EDQB 4LF4F 1X4HA 1DLOB 3GJTB 2CQBA 4RWWA 5HROA 1SKUB 1NRKA 3GYXB 3TJ9A 4ES1A 4C8YA 5ETTA 2Y3YA 2YX4A 3W3SA 1N36F 3DRPB 2DVIA 4WP9A 4B3TJ 1ZYQA 4FVCA 4ZLPA 2GZOA 2HFNA 3F41A 4B9NA 2ATCB 2E7XA 1A9NB 2JEFA 1JXEA 1WG4A 2HS0A 1UP1A 4I2QA 2XCPA 3MDFA 1RBAA 2D3OR 1E6VA 1RE1B 4FPRA 4HHUA 1VQNS 4QW9A 4W92B 1GMWA 2CPJA 1UJ5A 4L74A 2ZOFA 3NL0A 5A8KB 3UI3A 3OFEA 1HI0P 1MROB 4NEYA 4K4UA 2NZ4A 1OJ4A 3KJQB 5GADU 2QJ3A 2B7CB 4P2MA 2MZSA 2DIUA 1S6PB 4DCPB 4HDGA 4NLRA 3VZHA 2UUAJ 3K17A 3BKFA 1PILA 2YTCA 4OZ1A 5LMNJ 1RT4A 1DURA 4F4AA 2KL8A 2B9XA 1BE4A 3G4SS 4ZHRB 3MMBB 4LF1A 2HNDA 4H4MB 1H6KX 4DJBA 3IRXB 1M1KT 1WKLA 1LKZA 2HHHF 3P3DA 4ENOA 1XN9A 4GMKA 5BYRA 2FVCA 2C3PA 4IFYA 4UT4A 2Q66A 1WUUA 1NLKL 2JFDA 2G1DA 4K5SA 4P7VA 2OPRA 2W9BB 2UU9J 2MTLA 4ZMMA 2DGSA 2ZH5A 4FKYA 2RSQA 4RW4B 2K06A 3T1HF 5HANA 2MZQA 1NCLA 1XIQA 2A18A 3BGRB 3MM5A 2C28A 5C24B 2R7XA 5DRKA 4P52A 1CBKA 3H42A 2DGQA 3OJSA 4ECUA 1M5PC 3DHWC 3IWNC 3BQ2A 4OJGA 2NPFA 4YHHJ 1S4FA 3R3TA 1LWFA 1FD2A 4DS5A 1FERA 2FLLA 1N0VC 1S0VA 3K58A 2YKOA 3ZXWA 2VL1A 3R27A 4UTGA 2KHDA 4I2PA 3GV8B 4Y00A 2JX2A 3FCHA 1IR1A 3BO2A 5J2MB 3D2WA 4RPFA 3TYTA 2RUSA 4ZVTB 4U8YA 3U1NA 2J0QD 1U02A 4Y34A 1X4EA 2AMCB 2MJNA 4ECWA 5B08A 4M5JA 1EKRA 2AYBA 1AZSA 4ILMA 4NRUA 3F73A 4B9SA 4GKKJ 2BJDA 1QVFR 2I6WA 3H98A 4PAAA 3OD2A 1VC6A 2NR0A 3CJQA 2YWEA 2XYGB 4ECXA 2AKWB 4JI1F 3NGSA 1VQ5S 2DCLA 2PA8D 2L41A 3MCMA 4S0MA 3P5TL 2UXBJ 4P2XA 1JLEB 4WFXA 1HBNA 4KKOA 4JBCA 3C14B 3LP1A 3PRVA 2XEXA 3BO4A 2W24A 5K14A 3IG1A 2F9JA 3RBEA 4ZS6A 5RUBA 5CZVA 4OYOA 4A4JA 1FKAF 4HYKA 2VQEJ 5GMKa 4HKQA 1MWQA 3OL8A 1FRMA 2IAJA 1NPRA 2E5LJ 3ILIA 3NCPA 8ATCB 3M6XA 4JV5J 2VG7B 4OYAA 4FYXB 3R8YA 3ZTPA 5I4MA 3IN5A 2OH2A 1TU0B 1YBTA 2YNGB 1WHXA 5HVHA 1QSLA 3C19A 1RT1A 1CJTA 3IR6B 5HBMB 1S7IA 3M4XA 4UY85 3VGSA 2QL5B 5D15A 4ZVRB 2PMWA 1HNIB 3THVA 2XTJP 1WF2A 3CGIA 5H9FJ 1Q8BA 1S9GA 3Q22A 1PIEA 4ZJOA 4QWDA 1XNQF 1R8CA 1Z2ZA 1J2VA 1U09A 2IBKA 1NK0A 3TA1A 3RB4A 4P72A 1BC6A 4YUDA 3ZZTA 1FNOA 3SFGA 1W2IA 2VH7A 2HZCA 4DFKA 4AXJA 3AOBA 3K57A 1P1TA 4M5MA 3TZYA 5A8RB 3KMSA 1KRPA 3KDOA 3B8HA 1D9AA 5B7WA 3F44A 3HSJA 2Y1RI 4FF4A 2BUNA 1FNMA 4PWDA 2FY1A 3DLBA 2NXUA 1U6FA 2IBOA 4B3OA 2GCFA 4A47A 1AUSL 1XEZA 3OT9A 3CJ0A 1IBLJ 2UVUA 4CLKA 1SQGA 1Q95G 3WIVA 2FD2A 1B0PA 3GIJA 1RWMB 4I0WA 4LF5F 2QMXA 2HURA 5KFSA 1W2BR 1I6JA 1EKSA 5D77A 5KG4A 3HMJG 3I9ZA 3R7SB 4R25A 2ZVSA 1HBOA 3V2UC 2ZH6A 4DR4F 2BJ3A 4QWBA 2KFNA 2XO6A 3JQMA 1Q5VA 3UW1A 2BOAA 3WZ0A 1ZTTA 3DOLB 4CO4A 2RQ4A 4F8RA 1SV5A 1IKVA 3C6UA 1U47A 2YWKA 4NCGA 3OR1B 2BJ9A 4FP9A 1GX6A 3MZIA 2W2MP 3PW0A 4RNNA 1KD1T 4B3TF 3ADAC 4WIQA 2JEIA 3MTJA 4F2RA 1MWYA 5DZ7A 2EK6A 1BY9A 4C97A 1F0XA 1FWLA 2Z2MA 1N88A 4GVBA 3TR5A 2E7WA 2VODA 3FSIA 1FEEA 4DUZJ 3ZNJ1 4JI4J 4ED7A 3FBEA 1C4CA 2IA0A 2HHUA 1P27B 3VTIA 3NCRA 1U7LA 5I3UA 2ACYA 5J1NA 1SKSA 1PCAA 1S72S 1N5YA 2R7WA 3O2IA 3O1LA 1T7PA 2G0IA 4QIFA 3B6BA 3MEEA 3UD3P 4KRWA 5HAOA 1PAEX 1FFSB 4C9DA 1T9YA 1RQ0A 2K1RB 2GS8A 1SC4B 4EYHB 3PX4A 3H4BA 1QE1B 5D3GA 1X5SA 1XC9A 3TJ8A 1B64A 2KDOA 4ECSA 3HDSA 1YQHA 2ZM6J 3WIUA 1H38A 5LMNF 1YVFA 3HM9A 3KLHB 3RG6A 1K1SA 1Q1KA 1RA6A 1TL1A 4ED4A 4ZVGA 4ZK7M 1RAGB 4UOFA 4B9UA 5HJYA 1H74A 4X84A 4O4RA 3L4BC 3J81U 4ZITA 3GV5B 3QAUA 1H72C 2VZ9A 5J2NB 4F4XA 3ONQA 4EZ6A 4DF4A 1JLCA 2ZE2B 2XS5A 5CZXA 1WHVA 1J5OB 2UU9F 3LAMA 5L1IA 3RBDA 4E98A 3D67A 2WONB 2M52A 2BANB 4FS2A 3CJSA 2PI5A 3VAGA 2DGTA 4D3HA 2GHPA 2E5JA 2YWHA 4V19X 1IN0A 3CDUA 4ZPVR 1NSPA 3U7JA 2DR9A 1KQFB 3WHIA 1VRTB 4WYWA 2CXEA 3BR9A 5C25B 1KFDA 4WPAA 4IH6A 5D6GA 3KLVA 4YHHF 4JI8J 5KFUA 1UAWA 1L3SA 2EXUA 4DLEA 5C2CA 3OTOJ 2RQCA 4IRCA 1X0FA 3EDRB 4DR3F 1KQGB 4DQSA 1JIHA 3CO0P 2HBZB 4FDFA 2ASYA 4BWJA 4KFBA 2ZD1B 3DRRA 1YWXA 2MHNA 2QE5A 3LGNA 3D1OA 3CMAS 3KJFB 4KGKA 4NLUA 2H5EA 2KT2A 3KNAA 2MZJA 2V8VA 3A3NB 5JVHQ 1HA1A 3T1YJ 4GC6A 3GCXP 1TAUA 3SCIE 4GKKF 1A6LA 4FZVA 4DL3A 3MWBA 4RO0A 3K8VA 5KFZA 4YB7A 2EWHA 2EEYA 4ETZA 2HBRB 3M7VA 4HTIA 1RT7A 1XERA 1UA1A 1VC0A 4DQIA 4EZ9A 2BM1A 3PEHA 2Q6BA 4TKTA 3WC0A 4NL5A 1FXDA 3TZWA 2V2VA 2VFRA 2EFNA 1VQOS 3OV7A 1S1WB 3HP6A 3DDKA 1RBOB 2VKRA 5A6WA 3GIMA 2HLTA 4IG0B 3KK2A 3GSIA 4X4OA 4PR6A 2GQ2A 3NG8A 2YY3A 3CCSS 2OFGX 3VVTA 5I42A 2VQEF 2IIHA 2CQGA 2V6AA 2W8LA 5HMYA 2CJKA 2XZTB 4OX9J 2FC9A 4WE1B 2C2ZB 4JI3J 4TNOA 4LFCJ 2DGUA 3H2LA 4URSA 3MAAA 2GAHC 2C2RA 4QR0A 1YBAA 2FHMA 1HHQA 3LO3A 2KU7A 4QPXA 2LKZA 4PXEA 2DGWA 1FRXA 2RKIB 4FN5A 1UVMA 4HI1A 5D4OA 4EK2A 2DR5A 4YQWA 4ZVHA 5L39A 4Q5VA 5LM7E 2HWTA 3TAPA 3IMQJ 1ZZFA 1DAXA 4MYTA 3PW2A 1TKDA 1RK8A 1PAUB 2VG5A 3PO5A 2AJ2A 2DNZA 1JKHB 1FF2A 2IC3B 4CH7A 4FPIA 2RB7A 1WJ9A 1URNA 3W66A 5KFKA 2EFPA 1U8SA 1IKXB 3AA8A 4TLRA 8RUCA 1RTJA 1RWVB 4N76A 5F8IA 3DLEB 3R2CJ 3GCWP 2MLXA 4F25A 3G6ES 1S7HA 2DNLA 3UE2A 4ICLA 2UXDJ 4Y2AA 1AROP 3RTVA 4NZ6A 4Y2IA 1U1QA 3EMTA 4U8VA 2VJUA 4ZPWR 1EETA 3DYAB 1C1CB 3PHEA 1S0NA 3IBFB 5IC6B 4Q45A 2HEKA 2ZJQQ 5D0RA 2G1HA 1JLFA 2DNRA 3P49B 4MKAA 4RW8B 5C5JA 1RT2A 2XMVA 3OL7A 1JMTA 3CJTA 1SI9A 1C0TA 3IR7B 3KK1B 1SJ1A 3I87A 4W4MA 2X1GA 3IS9B 2FC8A 1VRUB 3A1YG 2I0XA 1B0TA 2MXYA 1S1TA 2W7OA 3HSDA 5DG9A 3QRQA 3HI9A 1XJWB 2KKHA 5F0WA 4CLPA 3GP9A 3FCWA 3G86A 3SQGB 4K0KJ 3E3XA 3BYRA 4LVOP 2LA6A 3GJRB 8AT1B 2QT7A 2KRRA 1IUJA 2AEMA 4CNYA 1Q7LB 4NXNF 1FDDA 5JJBA 3SI8A 5KG0A 5T7LB 2YQ3A 1Q0NA 1W25A 3CCQS 2H4WB 4MK8A 2HK2A 2V94A 3NBPA 1S1UA 1UPPA 4ILRA 3I56S 1PG5B 2JLEA 2E1RA 4BCAA 4ZVQB 1NSQA 1VQLS 1WELA 2GJFA 1YZ6A 4DV7F 2AX0A 2E1PA 3W9JA 2OO4A 3KHLA 2E44A 3W8PA 5L1KA 2ZH4A 4LFBF 2HFSA 2ROPA 1MW7A 4R8UA 4DN9A 3P6YC 1PKUA 4DV3J 3FFIB 4OLOA 1GAOA 2L9NA 3LWMA 3HJFA 1NJYA 2XMKA 4I1TA 2CAJA 4M63A 4P2SA 2O3DA 4NLQA 2NUUG 5LXYA 2CQPA 2MQLA 4O44B 2E9RX 5EWGA 3EICA 4Q44A 2B5JA 4MIAA 3PYEA 2BKNA 4KY3A 4KGVB 3HXMA 1N48A 1QSYA 2LA4A 4DR1J 1FDNA 2RDDA 1TAQA 2I38A 2DNKA 1HYSA 3G82A 1JX4A 3HFVA 1NSKL 3M8QA 3H25A 3Q8VA 1N0UA 4LQ3A 5J1EB 1S57A 3M2RB 4PPZA 1P8GA 1KTQA 3KLFB 1KC8T 1TKXB 4DV2J 1GNKA 4WFYA 4YDXA 4U67Q 2D7SA 3M2VB 2A6OA 1U1LA 1UWAA 2Z2ZA 2EI5A 3R5CA 1O6XA 1S99A 2LXFA 4RBTA 1RWKB 1D0EA 2AQ4A 4LBIA 2OTJS 2CWXA 2LXUA 3Q2SC 3NOGA 1TFYA 2A2CA 3OTOF 1DTTA 4Z37A 1RZMA 3KJNB 4NEZA 2E1AA 1U1PA 2EBEA 2GHWA 5LMUJ 1P9QC 2P9EA 4DV5J 3DRYA 3J7YU 3DMJB 2MJUA 1T8EA 5KFJA 2VICA 2C3MA 5HMWA 4OLPA 4CO2A 3NS5A 2JVRA 1WDDA 1D1UA 1Q78A 1TMMA 4I6WA 3FMWA 5HQMA 2R8KA 4Y28C 5DG7A 5IXUA 2C3OA 2EC0A 5IQQA 1U0HB 2HZAA 3MPWA 3KUHA 3BH6B 1WNEA 2D41A 3DRXA 4ZKAA 2YNHB 2R3VA 3TW0A 4A8WA 1HI1A 1Q16B 2YNIB 1RCXB 3MEGA 2R7UA 3FZ2A 2DR6A 4DHVA 2C2OB 4M8LA 1IR0A 2KYXA 3I4PA 3C66A 2XS7A 4RZRA 4C98A 5LSLA 1T0TV 1TV6A 2IVYA 1FI4A 3I0RB 2WRMA 2OPPB 4MTPA 2RS8A 4LR8A 3UVJB 1FCAA 2PFDA 1UPMB 2FLPA 1J5EJ 4PXBA 2KVIA 1DRZA 4NA2A 2SXLA 2YKMB 2GIFA 4LFCF 3NP5A 4QWCA 2E5HA 2CFXA 4AL7A 4OZ5A 4MFBB 3KLIB 3TX0A 4RW6A 2ZDOA 3T3FA 3SBMA 2X3DA 2WVCA 1SJ3P 3A12A 4JI6J 4ALZA 1FVSA 3R6LB 7FDRA 5F8LA 3POTA 5KT4A 2OIHA 4X4RA 1VQSA 1XMBA 5AXNA 2H9ZA 4Y65A 5IT4A 3TI0A 1JNRB 3R5JB 1WC0A 4AL5A 2DRAA 4UOHA 4LT6A 2V50A 3QZ7A 2BE2B 1YJVA 4C4WA 3M9OB 1RYRA 5KG3A 5J2PB 4PG4A 2XWYA 4N77A 1KKHA 2IJFA 1Z4UA 2VU5A 2ACMA 3Q23A 3A8KA 1MN7A 4X64J 2MZ1A 3RYLA 4HACA 2DRDA 1H3DA 2JRSA 2RAQA 1CC7A 3BZQA 1AXQA 2M5YA 2J7WA 7FD1A 2F8EX 1OSDA 1BGXT 2QMUB 2EKYA 1HMVB 2UXDF 3HD1A 3MECA 4OI4A 4WCEQ 4J9VA 1CQMA 2KG0A 3ZO7A 3LP2B 3UD4P 1RTIA 2GX8A 3M32B 3IR5B 3KUEA 1A7GE 1S6QA 3FQLA 4IQXA 2FVSA 4J9UE 4ED1A 2O5DA 1HBUA 3LPYA 5EN1A 2ZWPA 3OUYA 1G6BA 2JHEA 1RT5A 1VC5A 4ILLA 2V4QA 3HJVA 5ETPA 1S1VB 4XK8C 2B56A 1QJHA 3W62A 2KXNB 5CD4H 1ZETA 5FDLB 3WBZA 2VFUA 3RB3A 3BGFA 2KXHA 3LGMA 2O67A 5T14A 4DPYA 4H4OA 1DJ0A 1JK9B 4DL0C 4K0KF 2DEJA 3CE8A 4HDHA 5B0AA 3A4TA 3H59A 4W90B 1KVIA 5ETMA 1FKPA 4LSLB 2VA2A 2GFFA 3DLGA 2B7BB 2MHEA 4ECYA 2P6SA 1VQYA 2P9GA 4OQJA 2ABYA 3TA2A 2MKJA 4OZ0A 4WK1A 4X4TA 1R6VA 3C8YA 4KTQA 1WC3A 3BF4A 1RAFB 1FO1A 3PO4A 3WC2A 2HFVA 1T05A 2CA9A 4WBFA 5ETKA 3H0PA 3TQEA 4JYAJ 4DL4A 2XLKA 4JI7J 1FJEB 1BQNB 4ZLNA 4WFAQ 1YDLA 3H20A 4L75A 5LJ5Y 1E6YB 3C6TA 4DV3F 4BC9A 3T1AA 1FRIA 4JI2J 2W9AA 3A3OB 4FYYB 4DMZA 5LSOA 2HGMA 4QU7A 2AF6A 1NZ8A 3I5BA 3W2VB 2CQCA 2F4VF 3D4JA 2JVOA 3HHLB 4RR5A 1FRLA 4N47A 3J7YI 2XMWA 3GV7B 1ZAXA 4OYXA 4P75A 3OXFA 4RW7B 4CYUA 4BBYA 5IFMA 3HHKA 1RAJA 5A76A 3N5FA 1T3NA 2AGQA 1DQ8A 5U47A 2HMIB 2Z30B 3SQOP 3KMQA 3PM9A 1FJGF 2ZEJA 2N3LA 2QLBB 1RKJA 3QSIA 2I1RA 1TKZA 1VQMS 5KFQA 1RAHB 1T02A 4WU2A 4DL7A 2ZBQA 1DBDA 4CLYA 2J76E 1NJZA 1KSPA 5F3ZA 3H2VE 2VOOA 5D4LA 1HD1A 3JSMA 1U6BA 2V0NA 4JB8B 5M2PA 2FGCA 3CJ4A 3KHGA 1KQKA 4A8MP 1SQFA 3HK2A 3JQJA 2QSFA 2J8AA 4IG3A 4JV2A 2I5JB 1S76D 3UQSA 4DV6F 2HKEA 4MAKA 2IVMA 2YQ1A 2KM8C 3DDNA 2CZ4A 3CW2C 2WTFA 3CCWA 5KT6A 2D9PA 3HULA 2E9ZA 3NGRA 3K5OA 3GB0A 4FNIA 4BHQA 4F67A 5BR8F 4I2QB 3HVRA 1S0OA 4G1IA 3M8RA 3GLJA 3BQ0A 3K7RA 3A3PB 1E6VB 2HVHA 4QU6A 1OMSA 1Y00A 1XBWA 2IM1A 3D0HE 5THWA 2LQJA 2MZRA 2VOPA 3EGWB 4RW9A 4JUZA 1VBZA 1R0BG 4TU8A 3ZFVA 1HNZJ 2DPIA 2Y0BB 2CQ4A 2XNQA 3G8QA 3IA0A 4LF8F 4XDCA 2YXLA 4I6YA 4DDFA 3OLAA 1N32F 2ALZA 2HVEA 1SKWA 1FDAA 4KC5A 3MM9A 3T19A 2M2BA 3Q24A 3V81A 5DM7Q 3SFUA 5KG2A 2J7UA 3M8YA 3U1MA 3MR2A 3W64A 5B0CA 1RT4B 1RADB 1SH3A 5F8HA 1RTHA 1HWLA 3GG1A 3I96A 3E01A 2GC8A 2CNOB 1YJNS 2IRYA 2UP1A 2NYHA 1TR0A 1IQZA 1GH8A 4IFYB 3FSYA 1J5EF 4KH0B 5K8MA 3ICLA 3KNGA 4J37A 2RNEA 3NCQA 1UFWA 1Q4RA 2OPRB 2M3DA 2YNFA 2ZH2A 1TVRA 3M30A 3BO3A 4O0NA 1RWXB 2VJVA 1PYSB 3MM5B 1RA7A 2GO9A 2M70A 2ATLA 1ZA1B 3D6HB 1ZH5A 1AA1B 1I1GA 5ADZA 3PVXA 1EP4B 4ZPTR 4WWSA 3ZTOA 4USUA 1CJVA 3LP0A 3MM6A 2CG8A 2ZKTA 3OL9A 3Q8SB 3C15A 4MIWA 1WORA 4USVA 4Z2XA 3DRSA 2DGVA 4PWUA 3A13A 3TAMA 2QRRA 3BYPA 1QM9A 1JLQA 4I2PB 2ASDA 2H4YB 2DHSA 3IBWA 1DLOA 2YKAA 2RH3A 3KKFA 3RRHA 2J9DE 1YIJS 2DO4A 2QZ8A 1K44A 2DGOA 3RR8A 4X64F 4CZCA 4AFFA 2MY7A 3VCDA 4J91A 3KDNA 5ETQA 4LRFA 3G6VA 2V8GA 1X60A 2XC9A 3R5GA 3I31A 4F4ZA 4DPOA 1MLAA 4AL6A 3CDAA 3HT0A 4DUYJ 2AWZA 3GIIA 4QPTA 3X3UA 4F0HA 2BDPA 3CEDA 1KONA 3BN7A 3K8WA 2AV5A 3MCOA 2CYYA 2NREA 2QV6A 2OPQB 1S1XA 4U9RA 3PFOA 1HQUB 4KYZA 4F4YA 2R7QA 3V6HA 1K1QA 1KHVA 1HBNB 4KKOB 4B9TA 4KPCA 1FT8A 3BGLA 1LW0A 1NJWA 2ZNZA 3LP1B 1GEHA 3Q2TC 1VHIA 3B82A 2FHJA 5K14B 3IG1B 1U49A 2GIRA 3DOKB 2JH3A 3H40A 1N6QB 3BB5A 2RD5C 2F4FA 2ZZMA 2XMAA 4YDDB 4FBTA 4A8FA 2IAJB 2DISA 3AXMA 4DQPA 4H4MA 1JQGA 2PE8A 5LSRA 4V1Ak 3I82A 2AZ3A 3I32A 4C11B 4OYZA 4QIGA 2P6TA 4WTYA 4OI2A 2XLJA 4RU2A 1IQTA 1CJTB 4DL2A 3NAIA 2HPUA 2RRAA 3W60A 1VCTA 4RW4A 1U24A 4IOBA 4DX5A 2F9DA 2MYFA 4NYPA 2MKKA 2K3KA 1S9GB 2DY1A 3EGVA 2IM3A 2LECA 3S7RA 3D6MB 3KHHA 1UA0A 2F1FA 4QBUA 1RHRB 2HQCA 3JSBA 1D8ZA 4JI7F 3QZ8A 1KTVA 3A8IA 4YR3A 4X62J 1IWGA 3M9NB 5KOXA 2XZDB 4DQQA 1FTCA 2J0XA 4NA3A 3PKMA 2E9TA 1KNZA 2HLUA 4XDDA 5GAGU 5A8WA 4ANDA 5J2MA 5B0BA 2ILZA 2OTLS 1VQ7S 4EWTA 3KG4A 4WK3A 1RAEB 4KGXB 2WOMA 4X65F 4B3OB 4TLQA 1IBMJ 4LMZA 1SUQA 4EMDA 5KFGA 1HLWA 2V2ZA 1NK8A 3GPAA 4QYZJ 1W26A 2V68A 4FBUA 1T94A 4B17A 2NYIA 4DFJA 4CLUA 1U25A 2CPFA 3VALA 1LFWA 1G1XA 2ZBIA 1C1BA 1N5QA 1MG7A 4YEAA 3TUPA 1HBOB 1WACA 2WAQD 3C14A 3ZZPA 5AXMA 4LBPA 2XLIA 3QWUA 2DIVA 3QQCD 2COLA 2ZVIA 3EVMA 5E3CA 2LFVA 1VJWA 1SV5B 1IKVB 4FXWA 2DHHA 3S1TA 3C6UB 3TUZC 3R7BB 4ITSA 4NCGB 2CQHA 3SDEA 3T9ZA 3GJSB 1TUWA 3R5AA 4NXMF 1GMVA 2FZCB 2B3TB 4PUOB 1FRHA 2VG7A 2W1BA 2DRBA 2EFVA 3J80Y 1PJ7A 2WK4A 2RS2A 1S9EA 2FJBB 2AJ1A 2IDEA 3GU0A 5CH7B 1NAQA 2F5GA 3H5YA 2KZZA 2UUTA 3QIDA 1PYOB 3RUBL 1G4CA 2LYVA 5I3UB 1VR6A 2EPIA 5A0YA 1HNZF 6FDRA 1QY7A 2CDQA 3MEEB 1UZHA 4ECTA 4PG6A 4DF8A 1RABB 3MCSA 1KQSR 3EXCX 5D3GB 4IQMA 1CS4A 1P1LA 4P73A 4KT0C 2R2UA 2RDJA 2PT0A 1QAXA 1T9UA 3D0IE 1NO8A 1UVIA 2NXJA 1ZS6A 2YPZA 4KH1B 1ZM3A 4DR2J 4FS1A 1TL1B 3ZZRA 4X4VA 2L08A 4OHXA 1M1GA 2OEMA 4IYQA 2ASLA 4PQUA 2KT5A 3FC9A 3J7A1 3MEKA 5KFRA 2AHOB 2NSBA 3ISZA 2FIUA 2IA6A 3CCRS 3H90A 3PZPA 4K4ZA 4F3MA 5IV3A 9RUBA 3B4DA 4R5PA 1YSJA 1CEZA 3AQOA 2XI2A 4YN3B 3FRZA 3ENVA 4WFBQ 1PBUA 2K8GA 2V34A 4UQTA 3UDEA 3HD2A 4TYAA 3NMAA 4N7TA 4WP3A 4DEZA 2XMUA 5L9XA 3FUYA 3R7NB 1I94J 2HQGA 3DFEA 1KN6A 4HL9A 3KLEA 2Z2LA 2CVEA 1NNDA 3TQ1A 2GJ2A 1N5VA 2YWGA 5KG5A 2VBYA 4DSKA 1NDKA 4NLXA 3BM7A 4PQAA 3TVKA 3CD5A 5EX3A 4KGMA 2DYAA 3ZTRA 3FQKA 3UR0A 3TJAA 4F36A 1WSVA 3ZTQA 4NLWA 1G3OA 2W2PP 1G2EA 3MCNA 1EB0A 4KFBB 3OR1A 3J81j 3DRRB 4B3SF 1R8PA 4N56A 5I3PA 3OLBA 2F7VA 2RQMA 5A2QY 4QR2A 2EFOA 2WVFA 2NS1B 3NWRA 3B4MA 4DCOB 2AJ0A 3BKUA 4RNMA 4RNFA 1R89A 4AUKA 4B3RJ 3TRGA 2VDHA 4DUYF 3UR3C 2WBMA 2HS4A 2LU2A 3ZZZA 4ZP9A 3O8WA 2BXJA 3JTNA 2C2DA 1F3FA 3LA0A 5BXIA 2DHXA 2O66A 1RTZA 3TOQA 3JYTA 3CD6S 2A6MA 1GXTA 1YRTA 4ID8A 4E0DA 3H5UA 3D3BJ 4LFAF 1RT7B 1N34J 4NYZA 5A6PA 4IRDA 2VB6A 5KG6A 3R2DJ 2ZJPQ 1X5TA 2IFXA 1FXRA 1O5JA 2HAFA 2ZFHA 1T9VA 2BW7A 5LJ3Y 2BM0A 3V6DA 3IGNA 4P6QA 3UN5A 3KK2B 4DBQA 3UDLA 1VOMA 1YJTA 3M6VA 3O3LA 1U26A 3ENQA 5GAGI 1P9YA 4NLTA 5FJ4A 2A1BA 4M5DA 2BJEA 5K9FA 4CLZA 4Q0BA 2Y9HA 4USTA 4E2FB 2AEJA 4GKJJ 1HNXJ 1YJWS 1GXUA 1UW9A 2W8KA 1OYDA 2UUCF 3BN4A 2CG4A 1S5ZA 4QCLA 5J2NA 3QIPB 3W8GA 5F9NA 2NXCA 2Y1LB 4A8YA 2ZE2A 3A8JA 1IBCB 2B43A 1QDUB 4OJ1A 2FHOB 3CDWA 1NHKL 3JSYA 3NWGA 2OD6A 4DQRA 1TL3A 3IFEA 2UZAA 2Y8WA 2FGOA 3VZIA 5IM0A 3T5JA 4Y3CA 2AYEA 4MMOA 2VA3A 5G4DA 3KJVB 3O44A 5C25A 2XY6A 2RHQB 2P2CB 2UV8A 4DSIA 4LBHA 3MM8B 2V9KA 3PJ9A 3PTWA 1CSJA 4JI0F 1S12A 2MKSA 4J9KA 1K8AT 4IO9Q 4K8RA 2ZD1A 1HPZA 2IJRA 4UZCA 5HVFA 1HQ2A 1EZZB 2LCWA 2IMWP 4USHA 1F2HA 4HT5A 3S6EA 4I56A 4LREA 3G87A 3NS6A 4OFZA 5D0GA 5HN0A 3QT6A 4AD6A 1A0OB 4X66J 3Q8RB 4ID5B 2R4FA 2A0FB 1Q53A 1EETB 5DLGA 4EO6A 4M5KA 2PDAA 3W9IA 2DR7A 1B3TA 1FA0A 4K4XA 4ZPBA 3DLJA 1RT2B 4IH5A 3AOCA 1LK7A 4ED8A 2P5VA 1C0TB 3KK3A 1CULB 2BA9A 1NZAA 1R8BA 2QFJA 3DKDA 1S59A 3OPKA 1AT1B 2VF3A 4Y2KA 2LEPA 4ETXA 2ZOGA 1S1WA 4WXOA 3EVWA 4MKBA 3FCVA 3HFKA 1Y4ZB 2DJWA 2AW0A 5KFOA 3ET6A 2MLYA 3DGPA 3NOCA 2HWIA 1WG5A 2GA7A 2MKYA 4WE1A 4NLPA 1B7YB 3W2WA 3HF5A 3W5YA 1V5IB 1U8WA 3OJUA 2ZOMA 3V6JA 2IM0A 2HVZA 3NBPB 1S1UB 5F8GA 4CLFA 4OZNA 1VIOA 1I51B 1VMBA 1NEEA 1RWNB 4ZJQA 4O3PA 2DBBA 1EAYC 2RKIA 2BJ8A 1M5HA 1RT6B 1X9MA 1BQMA 1NU4A 4TYBA 2NLWA 2DKOB 4M5GA 4JI5J 2JEGA 4F26A 1TFWA 4R8UB 1UVJA 3BH7B 1LW2A 2NUHA 3UO0A 1OQ3A 4QJVA 3FNNA 3AQPA 4M95A 5E2QA 2MDAA 3OQ2A 3S8SA 4Q43A 1DHMA 1JKHA 4DR2F 3CIZA 2B5JB 2HFUA 4I64A 2IC3A 2QA4S 1OWXA 4TU7A 1B7FA 3BSCA 4DV4J 3SYZA 4BC7A 3Q86A 3IP0A 2UUBJ 2DITA 4OHVA 3N79A 1HYSB 1WF1A 4OHYA 3G82B 1SJQA 4F02A 2R7RA 1QLNA 3ELHA 1XR7A 5EDWA 2AX1A 3UFCX 4YY3F 1RHUB 1LNQA 3MMCB 4NLOA 2RHSB 2EFGA 2VPXB 5DLFA 2B4PA 1JLAA 3RR7A 4DG1A 1I94F 3NNCA 5KFPA 3K5NA 5AJ3F 1TTHB 4CNZA 1EHWA 2POKA 2OAUA 2LQ8A 1NBEB 3G8TA 3LF0A 4RW8A 1VBYA 4O3OA 1F5BA 1HHTP 5ETVA 1YRXA 2CDRB 3GR0A 1XK8A 3KK1A 2B4UA 4DSJA 3Q83A 5HL7Q 2XSJB 3N4WA 2ZJRQ 2MQQA 4CI0B 1VRUA 3OXLA 2V69A 1UWBA 1SIZA 2PA3A 3HSGA 2VQFJ 2KI2A 2IYIA 4O4GB 1CC8A 4X4SA 2CQIA 2CJQA 3W9HA 4J5OA 1TP7A 2Z8QA 2BX6A 1RKIA 4LF9F 1NKBA 1UTAA 1O8BA 2VHGA 4OYIA 4NZ0A 5LL6d 2B8QA 4KHPJ 2CJBA 1WEYA 3GILA 1Z2LA 2NCKL 3LH2S 2B9YA 2W2QP 2PGCA 4MK7A 2IRXA 5J2QB 5K5MA 3GFHA 1F2GA 4O23A 2VONA 1R8HA 2XYPB 5G0RB 1PO6A 4LRAA 4NI2A 2ZZNA 4WIIA 1HNVA 1N34F 4X4PA 4URQU 3GJQB 3V4MA 5IS2A 4PEOA 3MEGB 3R97A 4LJMA 3DLLQ 4B3MJ 3FFIA 1CG2A 4AQYJ 2Q3PA 3G6XA 1KDNA 3O5TB 4XO0A 2RU9A 2DXDA 1X31C 2GMJA 5E3PA 5AXLA 2NZCA 3CC2S 4MT1A 2EW9A 5LXRA 5L1LA 3P4UB 2Q43A 2KT3A 1WOSA 3KG1A 4LR7A 4H54A 4GKJF 1HNXF 2KVQE 4O3NA 2M9KA 2DH7A 3PIOQ 1RWWB 1SH2A 3POTB 5D0HA 3LQVA 2VG6B 3SSSA 1RISA 5KFYA 3KLFA 1TKXA 1HL6A 1VLOA 4CLLA 3VGVA 3VAKA 2Z0GA 3A8EA 3M8WA 2HRUA 5KFVA 2QA2A 4NE9C 2DNQA 3LALA 5E0OA 2DD8S 2PMZD 4XTTA 3UNYA 2DEIA 3D6TB 2PD1A 3QNWB 4QIEA 1F5CA 2KB2A 3GTYX 1B4SA 3T6JA 3IO1A 4J9LA 1B70B 2KRBA 2MKHA 5DDQC 1QUVA 1S0MA 4ED6A 2AJQA 1HW9A 4HACB 3CCMS 2EC2A 4FF2A 1FX4A 2AZ1A 5CYMB 3J81Y 5KFCA 4HH0A 3EJMA 2RE1A 3U27A 4L73A 1GX5A 1Y5LB 4KBIA 3CDEA 3MHYA 1C0UB 1U48A 3JS9A 2OHDA 5KOWA 3C16B 4LIRA 3MECB 4X66F 2AGOA 3EUNA 1Y9OA 5E7OB 2HQ3A 2XGPA 1MMDA 3OVBA 2R2SA 2HFOA 1CJKA 1UZDA 3MGJA 1S6QB 1RYSA 2B4VA 2KXFA 4HLBA 2UUAF 3NGTA 2P8IA 1HNWJ 3OUYB 5KFTA 1RT5B 4YB5A 3VVUA 3BR8A 4ZVEA 1RTDA 3NXZA 4K2XA 2HAIA 4UQGA 1WTBA 1TL7B 1LXNA 2M8DB 4JP8A 3TO8A 2CJ9A 1ZM9A 4CO5A 4LVNP 3D1QA 1QTMA 3HVTB 5L46A 4DPUA 4ZVSB 1HW8A 4NLDA 1VLYA 2IMOA 1FWPA 3IXQA 1FE4A 4RWXA 2VPZB 3UCZP 2DNHA 4H4OB 2CPYA 4DUTA 4ZLJA 2VKZG 2DR8A 2CQ1A 3UVJA 4X4QA 1H2VZ 3VGTA 2MGZB 2D3O1 2VV5A 2ZHAA 1FKPB 2CNNB 2WBRA 3MTKA 2QLXA 1OS5A 4IFVA 4PXDA 1VFJA 1S48A 3L95X 1VI7A 1VRQC 3OR2A 4CO1A 3T1HJ 2IVFB 2RRNA 4WZMA 1C2PA 2G0JA 3Q89A 2HGNA 1T05B 2JL9A 2GVDB 1PBAA 1T03A 2RF2B 2OI2A 5H9EK 2YKNA 4DU7A 4PG5A 1BQXA 3C6TB 2CRLA 4I69A 3QSYB 5KFEA 3TARA 4ZA1A 3D0GE 1LQ9A 3KLGA 3HPOA 2CQDA 4C3LA 2DH9A 1X9WA 2HBYB 4TY8B 3K5LA 3JAMY 1OIAA 4UUWA 4ZN3A 4DV4F 4MKYA 3US5A 4J9RA 3QGPA 2RVJA 2UUBF 2RUGA 3N28A 3U1LA 5KT5A 4HEA9 3CTRA 2RMLA 3VWSA 1XR6A 2JFKA 3IWLA 3PCOB 1YJRA 2JLFA 5IT9Y 3K5PA 4U6PA 1GTHA 3GQCA 4C8OA 3J80U 3G71S 1RHJB 1RGVA 2K7KA 4ZVOB 1LWEB 4NX9A 4CT9A 5H1SV 3SMZA 2W7PA 4C48A 1ZTWA 4NMLA 2UXBF 2XWXA 4Q8FA 2M0GB 3BGUA 4F2SA 3OTCA 3M32A 3MR7A 1XMQJ 2LDYA 4K59A 3QJLA 1D09B 4QW8A 1HQEA 4DR7J 3JB9k 4EI2A 1PC5A 3J7Z5 2QSWA 3JSMB 4LF2A 1T11A 2FJAB 4ELUA 2OMLA 1APSA 3FVYA 1WEXA 3EZUA 4CTAA 1QD1A 4PCQA 2JWNA 3TUJC 1S1VA 4P10A 1SB6A 2V67A 2ZH3A 2E5LF 1TK0A 1MSWD 4JV5F 2VQFF 1SL1A 1GXLA 1RSCA 1WOPA 1NM2A 1ZPWX 2NPIA 1HWKA 2PIIA 1KLMA 2B9WA 4ZIVA 5HO4A 2XCAA 3DDIA 4F04B 4YMEA 4FYDA 4DFPA 4OZ3A 2QL9B 2BRKA 1VQPS 4P71A 3ISNC 2ADCA 4AT1B 5HK4A 1RHQB 4KHPF 2PO4A 1M90T 4A48A 1U6ZA 2LP4A 2FYXA 3GYGA 4KAIA 3BSNA 4RW9B 3AB4B 2XNRA 4USKA 1PJ5A 1XTZA 1TUGB 2QEXS 1ZAWA 3MXHP 1ZA2B 2FZGB 2J9CA 3HHNB 1HWIA 2WB4A 3QJPA 1HWUA 2GQCA 3L7UA 5D78A 4YOEA 1WC4A 1XNQJ 3MM9B 3FSXA 4PKDB 4K4VA 3QBCA 5DM6Q 2W4DA 1BQNA 1MU2A 5IC4B 1EQ0A 2BJ1A 3AJ1A 1E6YA 2E7VA 3W61A 3MUTP 3Q8UA 2JJ4D 3DNCA 1RTHB 1RAOA 3ZZUA 4OZ2A 1FD8A 1BLUA 4DX8H 1SIWB 2FDNA 3MOJB 4K4SA 3RAXA 4M5HA 2OPSA 3RJMB 1IVZA 3LUYA 1K47A 4CIOA 3BS9A 3ZTSA 5A2QU 1XNRJ 2WSEC 2YNFB 1IBLF 1TVRB 3OL6A 4KHMA 4ZVUB 3M30B 1H2UX 2HMIA 4NCAA 1PJ6A 3QGHA 1F6TA 3OTDA 1N8RT 5F0UA 4CQ1A 2ERRA 3LWLA 2CVIA 1D8YA 1CVJA 1X4AA 3MPUB 3OSNA 3HKZD 4LF5J 4BLGA 1T9TA 1DQ9A 3AD9C 3EE3A 2AYMA 1CJVB 3LP0B 3MM6B 2FZKB 1WSRA 1M5OC 3ZZ0A 4MH8A 3HVAA 1HHSA 3C15B 3AH6A 4USIA 1KLNA 4RUAA 1KOHA 3CO9A 4P2FA 1QVGR 5JVGQ 1JLQB 2HIYA 2MZTA 3FEXB 2FJWA 2Y0SD 1OY6A 5CYQA 2H5IB 4OYPA 4TY9A 2I5JA 1FTRA 2I8EA 3UCUP 3MUVP 2J8SA 1LWCB 3V4IA 3SCLE 5GAEI 3RGIA 4Y6IA 2MMYA 1KBRA 3ISND 3CJ2A 4DUZF 2YBVA 2V2KA 4JI4F 1X4FA 3AJDA 5KT3A 4OV1A 2G2OA 1YI2S 1N52B 2LQ5A 4DR6J 1N33J 2XS2A 5CYJA 1VS3A 4B9VA 1QAIA 1L3TA 2FLNA 2BVZA 2X3GA 5KT7A 1R0AB 1S1XB 2IRUA 3PJXA 5SZTA 2N7YA 1H7WA 1GFWB 1JLBA 2BZ2A 1FKOB 2HNYA 2XULA 2DY9A 2HW3A 3I0SA 4KHRA 3MAHA 2BABA 4WKRA 1FK9B 1HNWF 1LW0B 2E5IA 2R8IA 2ZM6F 4DS4A 2M4MA 3RAMA 2VDIA 2XMTA 3UCGA 3N5BA 3PYFA 3C46A 3DOMA 3SV3A 5HATA 4PRFA 3M9MB 3PDNA 3CB4A 4OHZA 2CZ9A 1LXJA 4MYUA 2HQFA 5EGYA 4L3KA 5K20B 2HRYA 3IWXA 3Q8PB 1VYAA 1S49A 5B0DA 4C8MA 2YPYA 3RW7A 1UJ6A 2HHXA 1NDLA 2R8HA 1SVDA 2UVRA 2CJAA 4DR5J 4MK9A 3NMRA 4CWBA 5BYQA 4H4KC 2DNMA 5MAOA 3D66A 2UUWA 3QO9A 3CJKB 2WHOA 4ZJLA 5KFXA 4CH0S 2MQ8A 3GIRA 4ZPAA 3I55S 2E1CA 3MFHA 2RILA 4JI8F 1NK9A 1EP4A 5H9FK 1WDTA 2HHVA 2R8GA 3SCJE 3HHLC 3KFWX 3T5LA 2OP5A 2R9LA 2FY8A 3VV2B 1GK8A 3MI7X 1GTEA 1QAYA 2DTJA 4YFUA 1R27B 4O3QA 3MM7A 5C42B 2YWFA 2NSCA 1U0SA 2GVZA 2WVBA 3MPDA 3BJYA 3N0VA 1H73A 4DI6A 1Q8KA 3IAS9 2IPOB 4DR3J 3CJ3A 3P96A 5A8WB 3SZ2A 2KJWA 1UVLA 2EK1A 4OI0A 2PMHA 5E5NA 3T1YF 5HQ8A 3CNQP 1F1BB 4AE5A 2WOMB 1F5AA 1X9SA 3CVKA 1RHMB 3TUIC 1U1MA 3CT9A 1TK5A 1TKTA 1SUQB 2PFFB 4KGZB 2XY7A 4A8SA 2QLWA 5DDPC 3VQSA 3MR6A 4J9MA 1NPKA 4KO0B 5M2RA 4DV0J 2OPQA 4Z7YA 2ZHOA 5KTQA 1UFKA 5E3AA 1XMQF 1HQUA 3EVOA 3JSRA 3VR1A 4DR7F 1DQAA 5DGAA 1REVA 2HQIA 2CNLB 1C1BB 3LTOA 4G1QA 2V4RA 4OI1A 4EFAC 3MEDB 3K59A 3CJ8A 1Q81T 3OFHA 3IM8A 1RDRA 3DOKA 1N6QA 1DTQB 4OX9F 4NRTA 1EJ7L 2K3IA 1V3SA 3SDEB 4JI3F 2Y1IA 1KFSA 2AIRB 1OYEA 2U1AA 1VK8A 2CQ2A 4HTJA 3DLKB 2HNZA 2DNPA 5HJXA 3EPIA 2C1EB 2R7TA 1VIXA 2DCUB 5DQIA 4OYMA 4F50A 2W2OP 1RU2A 3V5RA 3QT7A 2F8MA 1S9EB 3HT3A 4ES2A 4C11A 3Q8QB 4QIVA 2R7VA 2HYIB 2C42A 1IM4A 4FYVB 2HBQB 2ZBRA 4CLTA 4IDKA 2VASA 1Y5NB 2XO7A 5A0YB 3FDSA 2R8JA 5DETA 1EARA 3GFYA 4DCJB 2PSZA 4KV8A 5F8NA 4USMA 4TQRA 3NKYA 2BV3A 3HO1A 1IKYA 3OXGA 1VQ8S 5GMEA 1N5TA 1KEKA 2J5AA 4YP3A 2DT9A 2OMOA 2DNNA 2N82B 3HHLD
chains in the Genus database with same CATH topology
1LWCA 1RK8A 2VG5A 3PO5A 1QAJA 3ZZYA 2W25A 2AJ0A 4B3RF 3MFIA 3R5BA 1S77D 4ZPCA 5T7LA 3LOUA 4RNMA 4RNFA 5K8OA 1R89A 2DNZA 3BEGB 3HVWA 4AUKA 3KG0A 1TKTB 3TRGA 4DUYF 3UR3C 2WBMA 2HS4A 2RQKA 1JKHB 2LU2A 3RAQA 2PC6A 3ZZZA 4ZP9A 2EG2A 3O8WA 2BXJA 3JTNA 3CCJS 3TNVA 3GFXA 1FF2A 4A46A 2C2DA 2IC3B 4CH7A 2RB7A 2DHXA 2O66A 3TOQA 1URNA 3JYTA 3CD6S 2KJVA 3FRYA 5KFKA 2GHVC 1GXTA 2EFPA 4RBVA 1YRTA 1U8SA 5B09A 1IKXB 4ID8A 2BQUA 4IRKA 3AA8A 3H5UA 4E0DA 3L7OA 1R6YA 2IHR1 1YJUA 4TLRA 2CPEA 1RTJA 4LFAF 1RT7B 3RB6A 4I7FB 4IKAA 1R0AA 1JJ2R 4PQUB 4NYZA 5A6PA 4IRDA 2VB6A 1UVKA 5KG6A 4N76A 5F8IA 3DLEB 4A8OA 1X5TA 1IKWA 2ZJPQ 1BWEA 2IFXA 5L38A 1FXRA 1FKOA 2FTRA 2X1BA 1NK5A 4NLGA 4F25A 4WYLA 1REVB 1O5JA 3PKYA 2ZFHA 4NPOA 2AU0A 4R0EA 4M1KA 3G6ES 4G1QB 5LJ3Y 1S7HA 2DNLA 3VAMA 4K4TA 4ZPDA 3UE2A 4ICLA 2BM0A 4R5PB 1FK9A 4Y2AA 2ZC4A 2KHCA 1AROP 1TV6B 3V6DA 3IGNA 2E66A 2OKQA 4P6QA 3RTVA 4NZ6A 4Y2IA 3KK2B 1XNRF 4DBQA 2FPHX 3UDLA 1U1QA 1NJIT 3PX6A 1UJ4A 3AAWB 5KFLA 4O44A 1VOMA 1YJTA 3M6VA 2N7CA 3QAEA 3O3LA 4ZPWR 4AL7A 1EETA 3M2UB 1U26A 3MUMP 3DYAB 3DLHA 1C1CB 3JTOA 3ENQA 3PFEA 5GAGI 3PHEA 5E41A 2KTQA 4NLTA 1WI8A 1S0NA 5E3QA 1H2TZ 3LW5C 2L48A 3HLUA 5FJ4A 2A1BA 4M5DA 4RLEA 2GV1A 3CCZA 3QPIA 3CPWR 4UOCA 4Q45A 2BJEA 2M88A 2ZJQQ 5GADI 2VFSA 1JLFA 2L9DA 2HNZB 2DNRA 3P49B 4MKAA 3KLEB 4RW8B 5K9FA 5C5JA 2RRBA 1RT2A 1WWHA 2XMVA 3OL7A 4Q0BA 1JMTA 2Y1JA 1SI9A 1C0TA 3QJJA 3IR7B 2HFZA 3KK1B 1YJWS 1GXUA 5AE1A 2W8KA 4QWEA 4RW6B 4EGLA 3GWCA 2UUCF 1SJ1A 3I87A 4KQZA 5JXSA 3BN4A 2LQ9A 2CG4A 2MQNA 1K73T 1F9FA 2B6AB 2X1GA 3IS9B 4QCLA 2FC8A 5J1EA 1VRUB 5J2NA 3QIPB 3A1YG 2HHTA 1HI8A 5F9NA 3F56A 3M2RA 2I0XA 1B0TA 4U7CA 1V3RA 4A8YA 2LDIA 1JLGA 2ZE2A 2MXYA 1S1TA 4WU3A 2W7OA 2XB2D 4WJBA 2B43A 1OPZA 2AD9A 3ENWA 4OJ1A 5DG9A 2F3JA 1SJFA 2FHOB 4IDKB 3CDWA 3HI9A 5K8PA 3JSYA 3M2VA 3MD3A 2KKHA 3NWGA 5F0WA 1M5KC 1KHWA 2OD6A 4KV8B 4DQRA 1TL3A 3IFEA 2LMIA 2UZAA 3OTEA 2HGLA 4PPDA 1IKYB 2FGOA 3VZIA 3G86A 3SQGB 1YITS 5IM0A 3N9UC 4JV0A 3CJKA 2W4PA 5DGBA 3PV8A 3E3XA 1OPIA 4GC7A 4A8KA 2AJFE 4LVOP 3T5JA 4Y3CA 2AYEA 2LA6A 2DHGA 2QT7A 2KRRA 1HBMA 4MMOA 3QLHA 2VA3A 1IUJA 2HWHA 4PUOA 5G4DA 5GAHU 3CIMA 2WSCC 4CNYA 1Q7LB 1X7VA 4NXNF 1FDDA 5JJBA 2LLZA 3KJVB 2JZ5A 3O44A 5T7LB 5KG0A 3SI8A 2YQ3A 5C25A 3PX0A 1UW4A 1W25A 4J9SA 3CCQS 2XY6A 2KN4A 4MK8A 2WCXA 2V94A 1Q79A 1V6HA 3NBPA 4DLGA 3M1VB 2UV8A 1S1UA 2YH1A 4DR6F 1N33F 1KR4A 4ILRA 4K4WA 1S6UA 4CO3A 3I56S 4DSIA 4ED5A 1HD0A 2JLEA 2E1RA 3MM8B 2V9KA 4BCAA 3NNHA 3JYTB 4F4WA 1UETA 1CSJA 2ZC3A 5C42A 1VQLS 1QUPA 4JI0F 1WELA 2MKSA 4J9KA 3OW2R 1K8AT 3LANA 2HG4A 4IO9Q 4DV7F 2BACA 2DGXA 2AX0A 2ZD1A 1HPZA 1IKWB 2OO4A 3CCLS 3TP2A 3KHLA 2E44A 3DMJA 2YKQA 3DXBA 5L1KA 2ZH4A 4ED2A 3C2PA 4LFBF 5AE2A 2ROPA 2HHPA 1MW7A 2LCWA 4R8UA 3HZGA 2FVPA 2IMWP 1K0TA 4DN9A 4USHA 3P6YC 3RW6A 2BYCA 5EWEA 4HT5A 2KM8B 3S6EA 1FEHA 3FFIB 4OLOA 1GAOA 4KPYA 2L9NA 4I56A 3LWMA 3NS6A 1WD6A 4OFZA 3HJFA 1RT3B 3CC7S 1NJYA 5HN0A 4OI6A 2XMKA 4KR0B 1SC6A 3V6DB 1WG1A 3CWJA 1Z1ZA 4I1TA 1RTIB 4M63A 2ZBCA 4P2SA 3MMAA 2O3DA 4NLQA 4ZP6A 2NUUG 5LT5A 3Q8RB 5LXYA 2CQPA 2MQLA 2R4FA 4ID5B 4X4UA 4ATNA 1K0VA 1SBRA 4O44B 1Q53A 4I68A 2E9RX 1WHYA 5EWGA 2AJ4A 5KFIA 1EETB 4XPCA 4B9LA 1PSDA 4Q44A 5DLGA 2B5JA 4MIAA 5M2UA 3THTA 4F4KA 2BQ3A 2FVQA 1HBUB 3AA9A 4V19J 4EO6A 4DR1F 4M5DB 2PDAA 3HXMA 3CF5Q 1N48A 2HVIA 2JC0A 3TVYA 1QSYA 4LSNA 2DR7A 4KO0A 3PACA 1FA0A 1HWJA 2LA4A 4K4XA 4ZPBA 1FDNA 3DLJA 3QYYA 5AE3A 2J6TA 1RT2B 1KS2A 1TAQA 2I38A 2DNKA 4IH5A 4Q0BB 2ZITA 1HYSA 2YNHA 1X0PA 5BJRA 1DZ5A 1LK7A 3G96A 2P5VA 4ED8A 1JX4A 3GSDA 1C0TB 3KK3A 4NLVA 2YNIA 1YGYA 1NB7A 1Q8IA 2HHSA 5F3TA 2BA9A 2W9CA 3M8QA 1NZAA 1R8BA 3H25A 4WFNQ 1N0UA 1UL3A 2QFJA 5DDRC 4NA1A 4C2MA 4LQ3A 3H8YA 4NCBA 3OPKA 1HARA 5J1EB 4Y2KA 2LEPA 4NYOA 4ETXA 1T95A 2ZOGA 3M2RB 3MEDA 1S1WA 4PPZA 1PGZA 2R7SA 4DV2F 4WXOA 4IOAQ 4ERDA 4L6V3 4DR5F 1P8GA 1JLGB 1RP5A 2FUG9 4MKBA 1N56A 3PW5A 1KTQA 3HFKA 3KLFB 1KC8T 1TKXB 3OBIA 1Y4ZB 1GNKA 4C8NA 2DJWA 4O3SA 4C0HA 3H5SA 2AW0A 3I0RA 3SSRA 5KFOA 4L72B 4WFYA 4FNHA 2GGPA 4C8ZA 4YDXA 2O1PA 4U67Q 2OPPA 3CC4S 2D7SA 3M2VB 4P7TA 4DSEA 3DGPA 1U1LA 5DS7A 3BDEA 1DTQA 2XZWA 1TL3B 4N8OA 2JLGA 3NRBA 2EI5A 5IM0B 2DK2A 3R5CA 2HWIA 1WG5A 5GAEU 2GA7A 1S99A 2LXFA 4WE1A 4NLPA 3CXCR 3QWPA 3W2WA 3DLKA 3HF5A 1ELOA 2B51A 2YKMA 2CZVC 4LUBA 4RBTA 2QO3A 3DLGB 1HBMB 3QLHB 1D0EA 4XIUA 4ZCIA 1HFEL 2ROEA 2AQ4A 4EO8A 4OMFG 3OJUA 2OTJS 2A10A 2ZOMA 4MFBA 5HROB 3V6JA 3KLIA 2IM0A 1S6OA 4ECVA 2HVZA 4N5SA 4ZCMA 2MB0B 5KAKA 3K5MA 3NBPB 2KFYA 3I4HX 2LXUA 1S1UB 4O3RA 5F8GA 2VFVA 3Q2SC 4OZNA 1IXKA 3E8OA 1TFYA 2A2CA 1VIOA 3OTOF 2J9DA 4ZVFA 1VMBA 1NEEA 1DTTA 4Z37A 2MQPA 2AGPA 4O3PA 2DBBA 5LMUF 4WXWA 4DV5F 1CQNA 5B0EA 2E1AA 1PC4A 2RKIA 1U1PA 2HHXA 1FXLA