2K3KA

Solution structure of drosophila melanogaster snf rbd1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
b'MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Structural and Functional Studies of RNA Splicing Factor Sans-Fille by Multidimentional NMR Spectroscopy
rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein
total genus 29
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2k3kA00
5H1SV 1U1QA 1ZZFA 3BO2A 2DNYA 2DNRA 2KG1A 4CIOA 1NO8A 3US5A 1QM9A 1P27B 1KQSR 4ED5A 4Z2XA 1U1MA 2L08A 5DETA 4WKRA 2CPHA 2FY1A 5DDRC 1VBYA 3BEGB 3G71S 3CULA 1NJIT 2LXIA 2DNGA 2MSTA 3R1LA 3I56S 3MXHP 1H2UX 1X5SA 2CQ2A 1VQ7S 4ZKAA 4IOCQ 3S01A 3D2WA 1K9MT 1D8ZA 4YUDA 2LYVA 2DNHA 3BO3A 1WI6A 3G8SA 5FJ4A 3VALA 1FJEB 2MHNA 1X4FA 3FEYB 1VQLS 1N54B 1FNXH 2VOPA 3UWTA 1R8PA 1VQ5S 3UCGA 1JJ2R 2XS2A 1S79A 3L3CA 1X4BA 1Q7YT 2DGOA 1WEZA 1L3KA 1VQNS 2MSSA 1DBDA 2CPEA 2RT3A 2DIVA 2JX2A 3DXBA 3CCMS 2LEBA 2L41A 1FHTA 2KM8C 1VQOS 3H2UB 3MDFA 1PO6A 4QQBA 1H2VZ 3JB9k 4FXVA 3N9UC 2E44A 2DGTA 2N3OA 1WF0A 2MKSA 1F9FA 3U1MA 4WFAQ 3Q2TC 2MZ1A 3CCJS 1SJFA 2KXNB 4YB1P 2M52A 1VQKS 2MKCA 2DGWA 5IFMA 3P3DA 2UP1A 1U1KA 2N3LA 5EN1A 2E5IA 3P49B 2E5GA 2DNNA 2M8HA 3NMRA 3HI9A 3CC7S 1VC0A 4WFBQ 2RRAA 5HO4A 2RQ4A 5IM0A 3MUVP 4F02A 2PEHA 4Y0FA 2MQLA 3UCUP 1X5OA 2ZJPQ 2MZTA 2KXHA 3PIPQ 2KRBA 1KC8T 2J76E 1QVFR 3SMZA 1K8AT 5GAHU 2DGQA 2DISA 2KFYA 3NNCA 2M88A 2MJNA 3UE2A 1VBZA 2ERRA 1YWXA 1DZ5A 2AYMA 1HD1A 1X4CA 1X4DA 2MQPA 1SJ3P 1X4HA 1FXLA 2N7CA 1X0FA 2CPDA 1U1NA 2G4BA 2MXYA 4OZ0A 2EK6A 2KN4A 2MGZB 1VC5A 2KYXA 5LSOA 2DNLA 1VQ6S 2MQOA 5DDOC 3J7ZT 1FT8A 1N52B 2MJUA 2SXLA 2GO9A 1IQTA 2FHOB 4TLQA 3G6ES 1H2TZ 3VAFA 2XS5A 2DITA 2Q79A 1BY9A 1KOOA 2DNMA 1AUDA 2LQ5A 5CXTA 1NU4A 3P6YC 3MUTP 2XS7A 2DO0A 2QA4S 1HD0A 2DH7A 3BS9A 3MURP 1Q81T 4A8XA 3UD4P 3ULHA 5D78A 2XNRA 1WWHA 4CQ1A 3NNAA 2ADBA 5LXRA 1OO0B 1RK8A 1UFWA 2CQDA 3UD3P 2DO4A 2BZ2A 3TP2A 1DRZA 2CQGA 2D9PA 2U1AA 2JWNA 1YHQS 2M9KA 3CC2S 1FJCA 4IOAQ 3THTA 1HL6A 1OIAA 2CPFA 5ITHA 1M5PC 2AYEA 5CA5A 2A3JA 2EK1A 2DHSA 2EVZA 1M5OC 2DNPA 3MOJB 1ZH5A 4F25A 2YH1A 3V4MA 2LA6A 1WHYA 1Q86T 2MPUA 3CTRA 1M5VC 2RUGA 3VAKA 1YJNS 2RU3A 2RQCA 1SJRA 1WEXA 1A9NB 3G9CA 3R27A 3CXCR 4QU7A 1XN9A 1VQ9S 1U1RA 4TU8A 2YKAA 2CPZA 2BOPA 2F9DA 4LIRA 5LJ3Y 1SJ4P 1WELA 4C4WA 5GAEU 4ERDA 2KH9A 4TU9A 2CPJA 2CQBA 4LJMA 5DM7Q 3MI7X 4U67Q 2CQCA 4UQTA 1M1KT 1A7GE 3G96A 1H6KX 3CPWR 1JMTA 4J5OA 3LPYA 3ZZZA 3TYTA 4CH1A 2HGNA 2ZJRQ 2CQ1A 2MYFA 2YTCA 5DDPC 2HYIB 2KG0A 2MB0B 2KU7A 1UAWA 2N82B 3VAJA 2AYBA 3SDEB 1U6BA 4TU7A 2LXUA 1YITS 1SJQA 3CF5Q 1VC6A 4C0OC 2RNEA 2MMYA 2OSQA 4M5DB 2CPXA 1KD1T 2K3KA 2NLWA 4PR6A 5LXYA 1VBXA 3S8SA 1B7FA 2DNOA 3IWNC 1SXLA 3TO8A 1R8HA 2QFJA 2LA4A 5GADU 2MKIA 2CPIA 2CJKA 3CCRS 4FXWA 2M4MA 1U1LA 4W92B 2MGZA 4C7QA 3DLLQ 2HZCA 2B0GA 2CQPA 2FC8A 3CCSS 1G2EA 4P6QA 1WHXA 1WG5A 1K73T 3IRWP 1QVGR 5GMKa 2DH9A 1WF1A 2HGLA 1N8RT 4RU2A 4IO9Q 2DNQA 4QU6A 2K8GA 4YOEA 2G1DA 3G8TA 4Y00A 5JVGQ 3FEXB 3LQVA 2KRRA 2DNKA 3S7RA 1U2FA 3S6EA 2U2FA 3MD3A 2D9OA 2DHAA 2ZJQQ 1YIJS 1M5KC 2HGMA 3CCQS 3RW6A 2DHGA 3VAHA 1YJWS 5DDQC 1FO1A 2JRSA 1JJHA 2MKHA 3MUMP 5IQQA 2OTLS 2OTJS 4WFNQ 3VAGA 2E5JA 3VAIA 2CQIA 3I55S 3CCLS 2MKJA 3RW7A 3OW2R 2LMIA 2DGVA 3CCES 4PRFA 4QPTA 3VF0B 4BS2A 2DGSA 2OJ3A 3UCZP 3SXLA 2M8DB 2L9WA 3PIOQ 3EX7B 1WTBA 2X1FA 1KOHA 1U6FA 2CQHA 2RVJA 2KM8B 1DHMA 2F9JA 3MD1A 2DGXA 2DH8A 3CUNA 2YH0A 2DHXA 2LCWA 2MZQA 2M0GB 5JVHQ 1VQMS 2AD9A 2NZ4A 2RRBA 2HVZA 2I38A 2LEAA 1D9AA 2XNQA 1X5TA 5D77A 1ZZNA 3CMES 2DB1A 1JJ4A 2LECA 3THPA 2MZJA 2OIHA 3J7YU 2ADCA 2I2YA 2DIUA 3P5TL 2JVRA 5HL7Q 2MQMA 3ZZYA 4WF9Q 4UY8T 4EGLA 2KI2A 3BO4A 1U1PA 2RS8A 2MQNA 2FC9A 1WG4A 2MY7A 1N88A 2KXFA 2LKZA 1WEYA 3EGZA 2V94A 5LSLA 2F3JA 2MKKA 2KT5A 2E5HA 1M90T 1HA1A 3CC4S 1WHWA 3H2VE 2G0CA 1UW4A 3NS6A 2AYGA 3SDEA 3K0JA 2M70A 1X4GA 2MZRA 2MY8A 1FJ7A 1YI2S 4WCEQ 2CQ0A 3B4MA 3VAMA 3U1LA 1RKJA 1Q82T 1O0PA 2D3OR 2YWKA 2XB2D 2M2BA 4IUFA 5LJ5Y 1CVJA 1WI8A 2X1GA 1YTYA 2DK2A 2FPHX 2QEXS 2XSFA 3R1HA 1UP1A 2WBRA 2CPYA 5DM6Q 3NS5A 1URNA 4V19X 2GHPA 3B4DA 1VQPS 2VODA 2J8AA 2VONA 1WG1A 5GAGU 1P1TA 2RS2A 4LMZA 2X1AA 2M7SA 5IM0B 4W90B 4PKDB 1U1OA 3CCVS 1OWXA 1VQ4S 2PE8A 1WF2A 2MZSA 1OPIA 3EGNA 3CD6S 2CQ3A 3CMAS 1W2BR 2O3DA 3NNHA 2DGUA 2OSRA 1X5PA 4WIIA 2J0SD 3Q2SC 1X4EA 3G4SS 1S72S 1YJ9S 5MLCV 1VQ8S 2JVOA 5CYJA 2KVIA 3CCUS 5BJRA 1X4AA 2VOOA 4F26A 2J0QD 1WHVA 2KHCA 2X1BA 5GVQA 4OZ1A 4CH0S 2MQQA 3HHNB 1PGZA 2CQ4A 2DNZA
chains in the Genus database with same CATH superfamily
1FA0A 3OFGA 4LF9J 4LF2A 3AY0A 2LQJA 5CYMB 4WP3A 1H73A 3PTWA 4OI1A 5D0RA 4WKRA 4TY9A 1JJCB 1QSYA 2C28A 2ZNYA 3GFHA 4F67A 3MEDB 3DC2A 2LXIA 4PPDA 1NK8A 3FNNA 1D8ZA 4AL7A 2RILA 4OMFG 4O0NA 5E7OB 1RT6A 4LFCF 3MMAA 3UCGA 3BM7A 3VGTA 2NZCA 4CCHA 4Z7YA 3MM5B 1CBKA 2J6UA 4ES2A 4UW2A 3GCWP 8AT1B 2MKSA 4DZ6A 2XMAA 3MMBA 3UVJA 2PT0A 2ZBCA 2V8VA 5HQLA 4RPFA 2OPQB 4NLGA 2N3LA 2DNNA 5LSRA 1UFKA 1RE1B 3PNIA 5A0YA 3QSYB 4WFBQ 2RRAA 2ZZMA 3HHLC 4FZVA 1VYAA 1HBMB 1RLCL 4DCJB 4FNIA 3PIPQ 3NGDA 3TRGA 1SQGA 2AZ1A 2DGQA 3BSAA 2VPZB 2MJNA 2J6TA 3EUNA 2W2OP 5IC6B 2GCFA 1H3DA 2YVSA 2MQOA 2Z56B 5ETMA 2ZC3A 5HROA 2UUCJ 4R0JA 2GX8A 5THWA 2FHOB 4G1QA 4WK1A 1DARA 2O66A 1SL1A 1VHFA 1HD0A 2ADBA 1WNEA 1HQEA 3TZXA 1RK8A 1UFWA 1HBNB 4DV7F 2CQDA 4B17A 4F3MA 4OI3A 3AD9C 1UL3A 3NS7B 4OYPA 4MIAA 2DHSA 1T95A 2CNKB 4WJBA 1S5ZA 2FUG9 3GIIA 3BF4A 5KG0A 4GO7X 2GZOA 2CWKA 3DOLA 2ZITA 1LV5A 1Y10A 5HLFB 5LJ3Y 1D9FA 3I5CA 3ILOA 2DR5A 4LJMA 1KWMA 4RNHA 2G9OA 5IOLA 3FBEA 1TKDA 2WTFA 4CH1A 3FCVA 3TARA 2KU7A 3R2DJ 1U4BA 5M2PA 4LRFA 2D74B 5I42B 2GMLA 1SJQA 4C0OC 4RW9B 1Q16B 1X0PA 2FYXA 1UJ5A 5KFJA 2NLWA 4ELUA 2Z2ZA 4OQJA 3S8SA 3W5ZA 3AOAA 3R9LA 2AJ2A 2JH3A 1UA0A 4ZP7A 5K9FA 1IKWB 2YWGA 1AZSB 1TTHB 2B9EA 3GIKA 4J9SA 1IKVB 2HFUA 1V9OA 1FEEA 2O01C 2VJUA 2BJ3A 1UVJA 1PC5A 4DV4J 2OP5A 2DHAA 3D6FB 1Q8LA 3A3OB 3I5BA 5IQQA 4J9QA 3I55S 2EFOA 1VQYA 1CULB 1WKKA 3SI8A 3CCES 2H4YB 3NMAA 4RW6B 4PRFA 4BS2A 4CH7A 2GVZA 1T9YA 1Q8IA 3EDQB 2HQCA 4CP5A 3CUNA 2EG2A 3UN5A 3VGVA 2LEAA 3KNGA 1FNOA 3O8WA 4B9MA 5D77A 1B64A 1U8WA 1QE1A 2I2YA 1XMQJ 1WOSA 2MQMA 3QWPA 4WF9Q 4EGLA 3BR9A 4ZIVA 1WG4A 3OQ2A 4WYWA 2WSEC 2IM1A 1EZZB 3K5MA 4FVMA 1S1UB 1BQNA 4WCEQ 2C2MB 3B54A 3W62A 1CJUA 2D3OR 2WB1D 4WPAA 4K4ZA 4USJC 3N5FA 4OI2A 3M9NB 1GX5A 5C2CA 2XSFA 3JTNA 4DF4A 2JC0A 2CPYA 4ECYA 1R31A 3TA2A 3DDNA 5ETRA 1ZAWA 1HHSA 2Y3YA 3AJ1A 3AJDA 4ID8A 1MU2B 4F4AA 1NSKL 2BM1A 2K1RA 3D0GE 3NCPA 4AQYF 3CCVS 5AE3A 1UPMB 4KGXB 2WZ1A 4DR6F 1Y3JA 1YZ7A 1IM6A 4ECQA 4OL8A 2IPOB 1N4LA 2VG7B 4YS2A 3PKMA 4X65F 2JVOA 2VF3A 2E1CA 4F3QA 5C7PA 3K5OA 2VOOA 4DPYA 2KHCA 2YXLA 4QYZK 3FQKA 2R8HA 3US5A 2B7BB 3MZIA 3CDEA 4WFXA 2JJ4D 1N33J 1YBAA 2YWHA 4URQU 2J6SA 2WVBA 3I31A 2RU9A 1SIZA 4KBIA 3G82B 4EO6A 3EJMA 5CZVA 2YWFA 4EI2A 1REGX 4MT1A 2YNHA 3SV4A 3H90A 3KNAA 3H7HB 2HHSA 3JSMB 2KO1A 4P9SA 1ROFA 1DQ8A 1N54B 1TK5A 1Q95G 4DV6F 3KK2B 3TUPA 3OV7A 4MH8A 2QZ8A 2GAGC 1R0BG 5KFEA 2ZEJA 5T7LA 4LT6A 2WK4A 1KP6A 1R3NA 2GVDA 3GFYA 4HI1A 2LEPA 4I2PB 4C3MA 1NZAA 4URSA 1RAAB 5KT5A 5IFMA 3WIUA 3MR3A 3KJVB 5A8KA 2RQ4A 3MFHA 3NNCA 2CVIA 1X4DA 3J80U 3ONQA 2I9SA 5AXMA 1WC0A 2EI5A 4Q2LA 3NAHA 3V4IB 2ZE2A 4WFZA 1KHVA 2GJ2A 3TW0A 4GC7A 1NNDA 3QATA 2VG5A 3ZZ0A 3Q8QB 4GVBA 2HMIA 1REVA 4PXEA 4DV3J 1F3VA 2M9KA 3F41A 2EK1A 2CFXA 1T9TA 2KHDA 1N32F 2XSJB 2K7KA 1RHJB 1RT1B 1FF2A 2YWWA 3FZ2A 3GIRA 1VRUB 3TUIC 4I1TA 5KT4A 2RUGA 3T1YJ 2L9DA 1S1VB 1Y5LB 2AIRB 1JLAA 3GPAA 1RA7A 4Y3CA 1SKSA 1JQGA 1EKRA 4TU8A 1W25A 4C97A 3MM6A 3NGSA 1QAIA 4LF7J 4V19J 1YRXA 4LIRA 5U47A 2W2PP 5J2QA 3ZZUA 2RH3A 1IJEB 3HHLB 1N5SA 5HK4A 3CCWA 4UQTA 1A7GE 2IAJA 4A8WA 4DR3J 1H6KX 3GJQB 3H25A 1HNZF 4TQRA 4K5RA 3UQSA 2KG0A 2N82B 3UO0A 2CIMA 4F7VA 2ZVSA 1GAOA 4G6VB 4DQIA 3RR8A 1HLWA 2DTJA 2MMYA 1CS4B 1FKAF 2KFZA 2HFSA 4M5NA 2YNFB 3UNGC 3TO8A 2V34A 1NK4A 2MGZA 1L3SA 3DLLQ 1NKEA 4MJKA 2GQCA 4QW9A 3CD7A 2VQEJ 1LKZA 1VRTA 1DLOA 4HL9A 2BABA 2YX7A 4M5HA 1Y5NB 3G8TA 3J81j 1FWLA 4IG0A 1OS5A 2HBYB 4FYYB 3PYGA 1R0AB 1YJWS 1MNEA 3IBCB 4MFBB 2E5JA 3VAIA 2NYHA 5A76A 3ISNC 4QPTA 4UF4A 1S6UA 2ZKTA 1Q1KA 4F04B 3KFWX 2ILYA 4ILLA 2M0GB 3Q0AA 1KR4A 2RRBA 2I38A 3A3NB 2JEIA 5KFCA 1Q8BA 2OIHA 1LFWA 1BXNA 3QNWB 1HR0F 5KFXA 2KI2A 2RS8A 1RT6B 4HVZA 2Z8QA 3HULA 1Q7LB 3MMAB 1FX4A 4DR1F 5EWEA 2IYIA 2AYGA 1RKIA 1NK5A 5L8RC 2QA4G 1FFWB 1O0PA 4RX6A 4NXNJ 4TKTA 5D4PA 3MMBB 3QAUA 3UVJB 2QEXS 3D7SB 1O5JA 3BR8A 5KFKA 2KYZA 1RAFB 2QL9B 3KOAA 3OT9A 2C2DA 1IBMF 5A0YB 3M8QA 4LMZA 1HQUA 4DSIA 2Y8YA 2HSEB 4B9LA 2H5EA 1UJ4A 1PG5B 3PR4A 2AJQA 3I4HX 1X5PA 4LSZB 2ZFHA 3G4SS 4KV8A 3GYXB 2MLYA 2YKPA 4P2MA 2ZM6J 3TQ1A 3D4JA 4CO0A 2EW9A 2ZZTA 1HI8A 1V3RA 2RQKA 3TOQA 4G1QB 5KOXA 3HM9A 4C0HA 3M2RA 4Q7AA 3FJ2A 4HT7A 4RUHA 1LWXA 4DV1F 4QR2A 4DX6A 1KLNA 1HQEB 3IFEA 1IN0A 2I8EA 1OQ3A 3I56S 2GV1A 2HZVA 2V2QA 5A6PA 3W7BA 5DZ6A 1UEVA 4NLOA 4P52A 3BH6B 4ZOSA 1R8PA 4I69A 4USVA 3FCWA 2W2NP 3DOLB 3CWJA 3CDWA 3U7JA 2DGTA 1WDTA 4YN3B 3HVRA 3V2UC 2KXNB 3T41A 2MKCA 3HVAA 2RQMA 3G6XA 3HSZA 3FK4A 4CWBA 2D3UA 2EBEA 3LWMA 1S9EA 3ILJA 1X5OA 1H98A 1QTMA 3EVMA 1RHMB 2KRBA 4PG7A 2KFYA 1RT3A 1VISA 2YKQA 2E1MC 2KT2A 3CVKA 3T9ZA 3KJFB 2EK6A 1C1CA 5LSOA 3K5NA 3QGHA 2OPRA 4YEAA 1JLEA 5DLGA 4OJ1A 4KQZA 4C3KA 1BUXA 3OSNA 2UXDJ 2W4CA 3OJUA 3CJ0A 2HBZB 4UUXA 3A12A 4GMKA 1TUGB 3M2UA 4P71A 2I5JA 2DO4A 3TP2A 2FLLA 1HNWF 1YHQS 1Y11A 2D7SA 5CA5A 2GVZB 1MLAA 2VDHA 3GG1A 2IY5B 2G1HA 1TUVA 1FDAA 4O3OA 2HQ3A 3V4MA 4Q8FA 3M6XA 1DURA 2HS0A 3R27A 1QD1A 4IKAA 4QU7A 5C2GA 1S6OA 3U1NA 3PW0A 1QE1B 1BGXT 3FBCA 2VH7A 3J80Y 3JXOA 2BQUA 1RU1A 4DOZA 2GMHA 4CT8A 1PJ7A 4ID5A 8RUCA 1F0XA 2J9DA 4CLKA 4KH0B 2W7PA 1CSJA 5A2QU 1BQNB 4N47A 1T03B 3CJTA 1SV5A 1CJUB 4I68A 4U8YA 3CJ2A 2AHOB 5LXYA 1QAJA 1B7FA 2DNOA 5K14A 4NCGA 4BC7A 2QFJA 4WZQA 5KFNA 2V6AA 2CJKA 3CCRS 1M1HA 2RHQB 3EICA 4QWDA 2ZD1A 2B0GA 4AL5A 2CQPA 4X4SA 1K73T 2K1RB 2V4RA 2NSCA 3KLVA 1LQ9A 4TN2A 5A8RA 1S1TA 3KJQB 1CQNA 3H0PA 4URGA 2BV3A 4ZHRA 1SBRA 2YWEA 4ZPVR 1TUWA 4AXIA 1UMJA 3OW2R 2LMIA 2DGVA 3QAEA 2Q1LA 2DGSA 1SQEA 1WKLA 2QO3A 7FD1A 3T1AA 3ZXWA 4OYAA 3W9HA 1NHUA 3IA0A 4PZVA 3KHGA 2YH0A 2MZQA 4D3HA 1ZZNA 2QYCA 4WTYA 2YNHB 1N5VA 3W8GA 4PG8A 2ZWOA 2DRDA 2MQNA 4YHHF 5G4DA 1WEYA 2E5HA 2XMWA 3E8OA 4LQ9A 3BPSP 2RD5C 2Y1LB 4DBQA 3HSJA 1TL5A 5T7LB 1RTZA 5FLXU 3ELHA 2GVDB 2BKOA 2V8PA 1KFSA 2LU2A 3WX4A 4A48A 1CC7A 3NS5A 4M94A 3AA8A 2HFOA 5A8KB 2BXJA 1V3ZA 5T14A 1NKCA 3IG1A 3DLBA 4I67A 4I4BA 4X4PA 1P6TA 5KG6A 3MR2A 4DL5A 1TELA 5I4MA 2BJDA 1LWEA 5B0DA 2HWHA 2D3O1 2MQ8A 4ZCLA 2PIIA 3A3PB 3HF5A 2GJIA 2IA6A 4O3SA 4DR2F 3HHNB 1T9VA 2DNZA 3AFGA 3FMWA 3P4UB 2ZE2B 2PMHA 2DRBA 2R7WA 1UW9A 4Y2MA 2AV5A 2VG5B 4GVBB 2HMIB 2YX1A 1REVB 3K8WA 2MSTA 4JYAJ 3I96A 5KFRA 1GK8A 4ED2A 4FXDA 1K47A 3D67A 3N5BA 2ZUAA 4JI6J 3HJVA 3GFZA 5M2UA 1TL4A 2XS2A 3L3CA 4J9PA 5L9XA 3CJSA 1FXDA 2AZ3A 3R7BB 2JX2A 2W2MP 1S1XA 3MM6B 4M5GA 1G1XA 4RNMA 1FHTA 3MEKA 1PO6A 4G65A 7AT1B 1H2VZ 4FXVA 4HHHA 3OR1A 6AT1B 5J2QB 4U7CA 3CDAA 1HNXF 3SFGA 1SC3B 4NXMJ 3U1MA 2IAJB 3Q2TC 1IWGA 2C3PA 3NP5A 4JBCA 2F8HA 4JI1F 1N5QA 3DN9A 3UCUP 1TU0B 4QIFA 3SMZA 2RE1A 2DEIA 3C8YA 1HD1A 4WIQA 1VS3A 1F2GA 1R8BA 1B3TA 3V5RA 1JWWA 1NSPA 3GE9A 2MXYA 2MGZB 2ZBIA 1UFLA 2DNLA 4QWBA 4K7QA 4MK9A 3TAMB 3LF0A 3TA0A 2FJWA 2GO9A 3P45B 2B4VA 3I9V9 1VRTB 3ETMA 1DLOB 4OZLA 3LP2A 3SZ2A 4IG0B 1KSPA 2NXUA 2AP6A 2BKPA 5KFMA 1Z2ZA 2JFKA 2BANA 5F8IA 1WUUA 2F65A 2R4FA 1HL6A 5D4LA 2A3JA 2B9WA 1XNRF 2J9CA 3LTOA 2NUUG 4B3RF 4X62J 3LH2S 1PAUB 1EP4A 3CIZA 3AAWB 2EXUA 3IN5A 2HFNA 4OI6A 1JNZB 4C8KA 2CPZA 3PHTA 1RAJA 2F9DA 3AODA 2Z4PA 4MIBA 3D3CJ 2CPJA 2CQBA 2E1AA 4HHJA 4LRAA 1CLFA 1OQ6A 3LPYA 3ZZZA 2C2EA 1ZPVA 2CQ1A 3GV8B 2YTCA 2HYIB 1UAWA 1U6BA 4TU7A 2EFQA 3L09A 3VVTA 2QG9B 3R5BA 4ZDNA 3NOGA 2V2KA 4L76A 2V2VA 1TKTA 4CO5A 4EO8A 1S7HA 1S9GA 3M8QB 3NKYA 2GA7A 1HQUB 4RU2A 3VVUA 2V9WA 3H4DA 1S97A 4XPEA 4ZVRB 3MTKA 4KV8B 3MD3A 2KT3A 4K5SA 1NK0A 4JUZA 2ZWPA 4GKKJ 1FX2A 4C3LA 3AOCA 3MUMP 4ZCMA 2GIQA 3Q83A 2B7CB 1Q4RA 3JTOA 3ZC4A 2OJ3A 3UCZP 4J91A 2M8DB 4L3NA 1GNKA 2VL1A 3M2RB 5A2QY 4LVOP 3GZ7A 2ZVIA 3CJ5A 4DPTA 4JI2J 5DG8A 3MWBA 4QIWD 1PJ6A 1JB0C 1YLXA 2DB1A 4FYWB 4BHQA 4X4RA 5KG3A 1T05A 4NLWA 4PXBA 2JVRA 5C5JA 2XYPB 3DNCA 1U1PA 3KHHA 1QUPA 1HMVA 2F3JA 3DLGA 1I94J 3OUYA 2VKRA 4XO0A 3K0JA 3MHYA 3HVTA 1TFWA 1FE0A 3IR5B 2HURA 4DFJA 4KKOA 2M2BA 4CZCA 3H59A 4KHPF 5L46A 2CRLA 2DR7A 1CC8A 5ETVA 4HTJA 2UUBF 2GGPA 1WG1A 4QR0A 2PSZA 1P1TA 1RQ0A 2M7SA 3DGVA 1S9EB 3P96A 4W98A 1UETA 3M8YA 1U48A 1PJ5A 3EGNA 4XIUA 2CQ3A 1W2BR 2FJDB 3GR0A 3RB4A 1RT3B 3C15A 3LW5C 4HH1A 4ETZA 1VHIA 2QL5B 1S72S 1X4EA 3MF5A 5LM7E 3EVOA 4OX9J 2J0QD 2VPXB 3I0SA 1C1CB 1MG7A 2OPRB 1JLEB 2VD3A 2L08A 2FIUA 3AB2B 2M5YA 1KTQA 3J7A1 5FLXY 5EX0A 3CULA 1XBWA 3M2UB 2QRRA 4JI4J 2I5JB 1Y4ZB 1PYOB 4ZKAA 2HVDA 4KGMA 4U95A 2CADA 2BW7A 4O23A 4RWXA 1WJ9A 3C46A 1NM2A 2MHNA 3ZTRA 3H4BA 1RWUA 3DM2A 1E6VA 4CLWA 1NHKL 4ED0A 4FF3A 5KFQA 4LSLA 1MMNA 3L7PA 3RJMB 4F3OA 1TR0A 4JI0F 3BGFA 3A8KA 3OVAA 4WFAQ 1S76D 5F8MA 1FRMA 4F0MA 3CCJS 2Z2YB 4ID5B 3J7YI 2DGWA 1HWIA 2AJ4A 4TQSA 1HBOA 2XY5A 4RLEA 4GO5X 4YR2A 2ZJPQ 1SV5B 4FYDA 5RUBA 5K14B 4DL7A 4ED1A 4NCGB 1RWNB 3OHAA 2WB4A 2LU1A 1FXLA 1RT5A 2QIFA 4FVCA 2ZD1B 1TL7A 1VQ6S 5ETNA 3J7ZT 4F2RA 4WWSA 4OHWA 1UVIA 3VAFA 5ETKA 4CI0B 3UD5A 3IAM9 2HK3A 3MUTP 2DH7A 3ISND 5A8RB 3ZFVA 3HO1A 4R8UA 1URRA 3K59A 5I3QA 3M30A 1NPRA 4ZHRB 4Q45A 4PG5A 1QAYA 2NREA 5CCLA 1F5AA 4HLBA 3ADAC 1VK3A 3QJJA 1M5PC 4HR2A 5B0GA 4WXWA 2WAQD 3WC0A 2C42A 4OI4A 4M5JA 2P5VA 2FHMA 3CTRA 4J9OA 2RU3A 1R0CB 5IC4B 2ZH3A 1OYEA 3GIMA 4EFAC 4LR9A 2J5AA 5IZHA 4IH5A 1WELA 4H4KA 2R2TA 1LK7A 4NZ0A 3Q8VA 1S10A 3PM9A 4MKBA 2CQCA 1LW2A 3V6KA 3DDIA 1YJ7A 4DI6A 2JNJA 3LAMA 3GU0A 3UW1A 4X4QA 1ZBTA 3PYFA 2C2RA 4ETXA 1TL1A 3A4TA 4DQPA 2BBEA 4HI2A 1VBXA 2QL7B 4DV5F 2UUAF 1SXLA 1OSDA 3ZTSA 2ZHBA 2PFFB 2VJVA 1IVZA 2B3TB 1WOOA 2HVHA 2MTLA 2LDIA 4BC9A 5EWFA 2FC8A 3IG1B 3IRWP 1FE4A 4PAAA 1ZA2B 4RW4A 4B3MF 3BKUA 1GTHA 4OYWA 2R9LA 1D3WA 2UUTA 3MEEA 3LQVA 1LWEB 3S7RA 2W4PA 3S6EA 2ALYB 3O6QA 4EBEA 1WC6A 4IQXA 4R25A 2DHGA 3HZGA 4IOBA 4X64F 2QSWA 3GYNA 3VAGA 3VV2B 2JEFA 1NLKL 4CLUA 1ZYQA 3CDUA 3KMQA 3O3LA 3RB0A 1RJJA 2WSCC 1ZTTA 2G0IA 2JDJA 4YB6A 2VBXA 2HQGA 3OL8A 3W2VA 2HRYA 3CMES 1N32J 2W9CA 2Q66A 3GONA 2V67A 4FKYA 2R7QA 3QMQA 1FKOA 4EMDA 1S48A 4OZ3A 5HQ8A 2MKKA 2KT5A 2ATCB 3CGIA 1F9EB 4R5PA 2M70A 4PG6A 3W8PA 5H9EJ 1S1XB 1WSRA 2MZRA 1S7IA 3OR1B 1NB2A 2XB2D 3RRGA 4YY3F 1JIHA 4IUFA 1VBKA 2K2PA 4ZCIA 3HMJG 1WI8A 1HNIA 1CJTA 3ZZPA 2WBRA 2CKWA 3MR6A 1XK8A 2GHPA 3LALA 1FVSA 4H4KC 5EUHA 3FQLA 2DPIA 3KDNA 2X1AA 4B3SF 1FDBA 3ZNUA 3OHBA 2O3DA 3CCZA 2OFHX 1PILA 3HKZD 3KWMA 1XMOF 2J0SD 2Q6CA 4UZCA 1GQEA 2GS8A 4IFVA 4OJHA 1FESA 4J7CA 1JXEA 2MQQA 1PGZA 3BQ0A 5D0EA 2BX6A 3IS9A 1WACA 5CCMA 3PR5B 4NLUA 3L95X 3LP2B 2AX0A 4BCAA 1AROP 1H7WA 4DPOA 3CIMA 2XWYA 3TWZA 1MROA 2VPYB 2BANB 4DG1A 3T1HJ 2BM0A 3KUEA 2LYVA 1WI6A 3GJSB 3M2VA 4AFFA 4L75A 4CO3A 2DJWA 4EUVA 1EIYB 3CD0A 4LF8J 1EP4B 3FBBA 4QWAA 3FSIA 3EE3A 1SKRA 1VJQA 3MR7A 2VIHA 2FB0A 2DIVA 2L41A 1AA1B 3H40A 2KM8C 2JLFA 5ETTA 2UXCF 2UU9F 2HNYA 1PYTA 2QLJB 2FY8A 1SJFA 4YB1P 1KVIA 3UNYA 3L4BC 4RU9A 1FERA 4TYAA 1S4FA 5HO4A 3MUVP 4C8MA 4J9LA 4F4XA 1RT7A 3D68A 1J27A 4KYZA 3TX0A 2Y1JA 2HHTA 2DR9A 1N56A 1V3SA 3B8HA 3UE2A 1TKTB 2CVEA 3R5AA 2WVFA 2X3DA 1RGVA 2H65B 2HNDA 2HKEA 4DL3A 1S9GB 3VZHA 5E3RA 2FHJA 2HHUA 1TP7A 2MLZA 1IQTA 1AUDA 1EQ0A 5CXTA 5KFSA 3P6YC 3MPWA 4LBHA 3BS9A 1AW0A 5F8LA 1WWHA 4JI7J 3AJ2A 5C25A 3UD3P 2CJBA 2BZ2A 2WCXA 5CYQA 1SL0A 2MHEA 1VRQC 2ZH1A 4ECRA 2YPZA 5ITHA 2CJYB 3HK2A 1DFDA 1KHWA 1WTFA 1NPPA 2BDPA 1IXKA 1U47A 1TMJA 2MDAA 1ZM4A 4IR1A 1U02A 1F2HA 1RAIB 1AB8A 2GJFA 1U1RA 4NCBA 5HMXA 1LW0A 4YMEA 4Q2MA 2C22A 1T05B 1SJ4P 2YNGA 2XYHB 4LR7A 3NWGA 4TU9A 4DU8A 4KHRA 1XQIA 1R6VA 2WBMA 5DM7Q 1WOPA 1AXQA 3PRDA 2EEYA 1HMVB 4JV5J 3OBIA 4J9RA 4F50A 2VFUA 2FLNA 2LLZA 3F56A 2FGCA 3DLGB 4CDIA 3OUYB 3FC9A 4ATNA 3HVTB 1J5OA 2F4VF 4XDDA 2DVIA 1VC6A 1KVJA 3FRZA 1XJWB 4KKOB 4Q8EA 2XY6A 3NRBA 2E9RX 4HACA 2XMUA 5T41A 4ZVQB 1KQGB 4GC6A 4OV6A 3NGKA 2GGPB 4W92B 2M4MA 1RACB 2CWXA 4ZCKA 2PO4A 4OYMA 2ZHAA 2XCPA 1FJGF 2Y1IA 5F8NA 4DSFA 4ZJLA 2MKYA 3C15B 3FEXB 1U2FA 1U26A 3I0SB 1CQMA 5DDQC 1JJHA 1VCTA 4M5KA 1OYDA 3HFZB 2XLJA 4WFNQ 2Y1RI 5LOQA 2G13A 4WU3A 4ZVSB 3MGJA 1J5EF 3VWSA 3D1OA 3JQJA 3M6VA 3EX7B 1WTBA 4DV2F 3O2IA 1Q53A 4R0EA 4MKVA 2E1RA 5KFPA 2DHXA 1XR7A 1HYSA 4GKJF 2J9DE 2H3EB 4QW8A 4ITSA 2F8EX 1X5TA 4YB5A 2HS3A 3UDCA 3T5JA 3THPA 2DXEA 2E5LJ 2W25A 5D15A 2VA2A 1L3VA 4UY85 2IMWP 1S4EA 3DM2B 1E6VB 4ANDA 3C3LA 4B9TA 4LF5J 4LSLB 2B43A 3FSXA 2ALZA 4ZVFA 5E0OA 3HJFA 1XIQA 5DQIA 3BJYA 4CTAA 1CVJA 1YTYA 2DK2A 2FPHX 4ZLPA 3WZ0A 3KLEA 2DR6A 2J7WA 2NXEA 2LFVA 3DI6A 3ETOA 1FFSB 1VR6A 2OEJA 1C0UA 1HBOB 2YQ1A 4NYOA 4U8VA 5GAGU 3G6YA 4AUKA 3OTOF 5J2MA 2IMOA 1NH7A 3PRVA 3M6WA 3KG0A 1AT1B 4U9RA 2PE8A 2WOMA 3HDSA 4Y28C 2VQFJ 3EZUA 2ZH8A 4NE9C 4LF9F 1JX4A 4CLPA 4IDKB 5BJRA 1RT5B 4IYQA 1TL7B 1CJVA 4NLPA 4CH0S 3OJSA 4DN9A 1YRTA 1F5CA 2XG8A 2ZH9A 9ATCB 1JLBA 4WBFA 4M1KA 1VIOA 1SH0A 1NDPA 4IH7A 4OYIA 1Q5YA 1RHRB 3L9ZA 4R8UB 3M30B 4K4WA 1APSA 2UXBJ 4DR5J 3SBMA 2EKYA 2VPWB 2FJXA 3VALA 3CMQA 4HTIA 2E7XA 4PUOB 1FD2A 2HS4A 4I64A 2W9BA 1U45A 3HHKA 1S12A 3X1LB 4B9SA 2B6AA 4KB7A 3W9IA 2QJ3A 2JEJA 4J9UE 3OR2A 4FP9A 1GXUA 1B0TA 4NI2B 2WRMA 3QFHA 4QIVA 1TK8A 1LW2B 3ICLA 3OXFA 3QIDA 2HZAA 5FDLA 1HI0P 4FBTA 3GCXP 2W9AA 5KG1A 2GHWA 2C2OB 2QA1A 3O1LA 4X2BA 4G1IA 1FNMA 1TL1B 3FCHA 1NK9A 4DCPB 1KC8T 5GAHU 2A18A 2ACMA 2UUCF 4CLLA 4P74A 2XTJP 3PYEA 4LRDA 1X4HA 4OV1A 4L6V3 2KN4A 4YR3A 2DY1A 1QDUB 2OGUA 2QA2A 2YKMA 2UV8G 5J1PA 1XNQJ 2XI3A 4RW4B 4DR7J 2AGOA 2F1FA 3MEEB 3I32A 5D0GA 2G2YA 2HVIA 3AOBA 4ZVGA 2XNRA 3V6DA 4LBPA 3BYPA 3OVBA 1TKXA 1RAHB 4B02A 3D0HE 3WHIA 5J2PA 2ZNZA 1RYSA 5KT2A 4IRKA 4Y2AA 4OI0A 1WEXA 1S0OA 4C9DA 3W2VB 4O4GA 2R8JA 3EGWB 2W9CB 5B0FA 2XHWA 2R7VA 1H38A 2A6MA 1M1KT 3PW4A 1V5IB 5ETOA 3BSOA 1JMTA 2CDQA 1KQKA 1FKOB 2HGNA 4EU0A 4A8OA 1N34J 4AL6A 1RWKB 3VZIA 4RZRA 3BSCA 2QMWA 3PY8A 2ROGA 1HI1A 2V4JA 2P9CA 2OSQA 3N6MA 4OHXA 2FJVA 2K3KA 3KUHA 5DZ7A 3QRQA 5CD4H 4B9VA 2R8GA 1HNIB 1NHVA 1CJTB 4WKYA 1JNRB 4DQRA 3GR1A 1MMDA 1QLNA 4DV4F 5DO2A 3GTYX 3CCSS 1RZMA 3MPUB 4K4SA 1VQSA 4QYRA 1M5SA 1VJWA 4J9VA 4LIWA 3BBFA 1PKUA 3FBFA 4U96A 2FVRA 4UOGA 1YIJS 2HGMA 4IFVB 3VAHA 2AEFA 2BKNA 4RUAA 2KB2A 1SH2A 3K17A 3CCLS 3IS9B 2J7UA 2IBOA 3VF0B 3NGRA 2R7TA 1MWQA 3N0VA 4J37A 2X1FA 1JLQA 5EGYA 1RUSA 1DHMA 2F9JA 1XMQF 2E7WA 2BJ8A 4A47A 3BKTA 2NZ4A 1MROB 2OPPA 4DG1B 5L1JA 1NJXA 1P9YA 3Q86A 4USIA 4RWWA 3T5HA 3SQOP 3PCOB 3M2VB 1N88A 2W8LA 4RUBA 2VB6A 5KAKA 2C2KB 3M32A 1C1BA 3TAQA 3HHDA 1K44A 5EX3A 2XY7A 2HLTA 4LVNP 1Q82T 2BEFA 4M5DA 2F63A 2HNYB 5HQMA 3MAAB 1XERA 1LXJA 5F8JA 1ZPWX 5LL6d 4WXOA 4TVAB 4V19X 1LWFA 2PEBA 3KJNB 2Z0GA 3EZ5A 2R7SA 1RT7B 3KTQA 3ENQA 2UZAA 1OWXA 3CNQP 3RG6A 2MZSA 4J9MA 3CD6S 4BWJA 2AJ0A 1KS2A 1N33F 3LGMA 3AH6A 2B8PA 4RNNA 2HNDB 4O3RA 5HVFA 4N77A 4EYIB 3EXCX 5H9EK 1LFPA 3N6NA 4V1Ak 2X1BA 5GVQA 5DS7A 1ZZFA 2V8DA 4LF4J 4KPYA 4CO4A 3HFVA 2R2SA 3PG9A 2ZH6A 1I5OB 4A8FA 4F0KA 3R3TA 2H9ZA 1KBRA 2PC6A 2Z2MA 5C25B 1H2UX 2YQ3A 5CYQB 1VQ7S 3S01A 3MCSA 3G8SA 1FJEB 1TMMA 3NWRA 3KLFA 4I6AA 3FKBA 1L3TA 3PFEA 2B51A 1YDLA 2W2QP 1L3KA 2CPEA 3DXBA 1LW0B 3Q8SB 1VQOS 4Y2IA 3JB9k 1X9WA 2YNGB 2W7AA 3IO1A 4J9KA 3SSRA 1LNQA 3Q22A 3QJLA 2MZ1A 4ZVUB 2HRUA 4FYXB 4YR0A 2DHHA 3WDOA 1VQKS 4DSKA 3HT0A 2E5GA 3AA9A 1J5OB 1ELOA 2JC1A 2P9GA 2EFVA 2PEHA 5KTQA 1OY6A 2ZBRA 2J76E 1QVFR 2BMBA 4CNZA 4HACB 1YWXA 2AEMA 4A8KA 3GJTB 3P5BP 4IRCA 3Q23A 4FYVB 1FT8A 3NBPA 4DV3F 5C42A 2B4UA 3KLHA 4FPRA 5I3UA 3V6JA 3ENWA 3GMGA 2ASJA 3T1YF 2D9PA 3G6VA 5HN0A 4IOAQ 5SUHA 2AT1B 4NPOA 5BYSA 4LF7F 3EXYA 2IDEA 1YK9A 1NH8A 1HYSB 4DR3F 1SCJB 1U24A 1NJZA 2QT7A 4DUYJ 3MFIA 4CYUA 1T7PA 1RWXB 3G96A 4WTOB 4PPZA 1HW9A 2MYFA 2MB0B 1SC1B 2LXUA 2DBBA 4M5MA 4Z7CA 3T19A 2R3VA 1Q0NA 2VASA 4CTAB 2CPXA 1IKXA 3KLEB 2VQEF 2VA3A 3OTEA 3DI6B 1C0UB 1M0SA 3G8QA 3WIVA 3MPDA 4DSEA 5J1EA 2HZCA 5J2MB 1WHXA 5KG2A 2D3ZA 5KT6A 4O4RA 3CCTA 5HSPA 1H74A 1PC4A 2W1BA 1UVMA 3DLJA 2WOMB 2GHVC 4LFAJ 1GMWD 4Y00A 5JVGQ 4I6WA 3PV8A 5D0HA 4A46A 1M5KC 1RTIA 4DUZJ 1G3OA 4TY8A 1CJVB 4LBIA 1VLYA 2IJFA 4NZ6A 4JI8J 2P6TA 2VU5A 3V81A 2COLA 1JLBB 3OFEA 5CABA 5KFDA 5LMUJ 3SXLA 1KOHA 1EX8A 2B5JA 2LCWA 3TAPA 2FJBB 1ZS6A 3J81Y 3MAHA 2ZH7A 3PJWA 3BV8A 5KFZA 3WQPA 1U09A 3QRRA 3OTDA 2MZJA 2DCUB 4ZPAA 5AJ3J 2Z57B 3RBDA 2E1PA 3W9JA 2W9BB 2RJZA 1X60A 4USUA 2KXFA 4NXNF 2V94A 3G2XA 2B6AB 3SCLE 3DLKA 2XGPA 1Q78A 1TV6A 3CC4S 4HDGA 2AGPA 4ECSA 3SDEA 2C2ZB 4O3PA 3NXZA 2AKWB 1RAGB 3Q8YA 5BR8J 2XO6A 4DL6A 3I6PA 1RWVB 3BPDA 5LJ5Y 4NEYA 1WSVA 3CJ8A 4LSNA 3BGLA 4NLXA 5FDLB 2JSXA 4K0KJ 3ZTQA 3D3BJ 2A1BA 4A4JA 2AGQA 2PFDA 1U25A 1IBLJ 2ZM6F 4K2XA 1G7CB 5KFAA 3C6TA 2WSFC 3CMAS 4OFZA 5JUMA 5F9LA 3ET6A 3CCUS 1PIEA 2O67A 4C6AA 1JKHA 3D28A 2YKMB 5H1SV 1M5HA 2DNYA 2ZOMA 3MCOA 4F8RA 1KQSR 3UFCX 1YJVA 3TNVA 1K0TA 4KGVB 3D0IE 2FJEB 3V6DB 3KKFA 3A13A 3JTPA 1TKXB 1NJIT 2D69A 3MXHP 3LUYA 3TVYA 3M7VA 2ZOFA 3E51A 4EZ9A 3DGPA 3MCMA 2OO4A 5J2PB 4NYZA 3EYZA 1X4FA 5FD1A 3KLGA 4ZVHA 4EYHB 3HX9A 3GV5B 3PZPA 1NB7A 4O4GB 1KKHA 2E9TA 3W3SA 2UV8A 5K20B 3KMSA 5JXSA 4QYZJ 3N9UC 2N3OA 3CW2C 1WF0A 1RWWB 3T6BA 4Z37A 4ELVA 5IWAJ 3UI3A 2CZ9A 1RDRA 2M52A 4FKXA 4NL5A 5SZTA 3A8JA 3C6UA 5EN1A 3NMRA 3QWUA 2F5GA 2VFSA 1FFGB 3CO9A 3KLIA 4DF8A 1SPBP 3HZEA 2V4JB 4FNHA 2PMZD 5KFOA 2D1CA 2EFGA 3RR7A 2VFRA 3KK1B 2UXDF 1RCXB 5M2RA 2KYXA 3VQSA 4ED8A 1ZA1B 4TLQA 1H2TZ 3X3UA 2Q79A 3GP9A 3NAIA 4P2XA 2ASLA 2EBGA 1FTRA 1CJKA 5LXRA 2XO7A 2LXFA 4KIAA 2A6OA 3OD2A 2U1AA 2JWNA 3QGGA 4Y6IA 2AMCB 5KFFA 3EWGA 1FI4A 1L3UA 3DFEA 1UCNA 1JLQB 2YY3A 4F25A 1SL2A 1GMUA 4UOHA 2MPUA 3SSSA 1U0HA 1SUQA 3I0RA 3TZYA 2OPPB 1MWYA 3R7NB 1S77D 3R6GB 1VK8A 2OHDA 1VLOA 4H54A 4U67Q 3QZ8A 3A8EA 4NLDA 3M32B 5E2QA 1C1BB 4I56A 5E3QA 1MU2A 1ITPA 1SC6A 2POKA 4M5DB 3FGVA 1LOUA 4C8ZA 1S49A 4G3IA 5HBMA 4TLRA 3O5TB 4OZNA 5A6WA 1XR5A 4OYZA 2MKIA 4ZP8A 4LFBJ 4RBVA 1LWFB 4ZPWR 4OX6A 2HHHJ 1WC1A 3OSPA 3BN7A 1QVGR 2N4DA 2DH9A 1D9DA 2J0XA 2CAJA 3H5XA 2FTRA 4P2FA 2F7VA 2CZ4A 2E7VA 4MAKA 2BOAA 1EARA 2UUWA 1FDNA 2OTLS 5HROB 3LO3A 3RW7A 4OZJA 1FVQA 3HKWA 1NDCA 1S9FA 4LF6J 2CUYA 3W66A 2RKIA 4USTA 4RL1A 3PACA 4NMXA 1OJ4A 1BE4A 1DQ9A 2LVWA 1T0TV 2XNQA 1TFYA 3CJKA 5L9NA 3UDVA 3J7YU 3VTIA 5HL7Q 1RI7A 7FDRA 2CJ9A 3DYAA 5ETQA 4ZK7M 3GFXA 4P72A 1T8EA 3CJQA 2ABYA 3H2VE 2G0CA 1BQXA 2R8IA 1LEOA 4B3TJ 3FEZA 1N0VC 1SIWB 1IKYA 1P9QC 2PGCA 3UN2A 1RT4A 4K59A 2RDJA 2X1GA 3RU0A 4X66J 3EM1A 1UP1A 3RGIA 2HIYA 4L3KA 2AJ1A 5H9FJ 3FDSA 2IVYA 2J8AA 2VONA 3AD7C 2APOA 4E0DA 3E01A 3Q8UA 4B9UA 1WF2A 3PO5A 2DGUA 5DRKA 1F9HA 4WIIA 3SFUA 4KE5A 3W5YA 1U7LA 3DRPA 2KVIA 4F26A 4DFPA 4OZ1A 3GILA 1O6XA 2BE7D 5GADI 4JYAF 4PCQA 1NO8A 3LPEA 5C42B 2VFVA 4ED5A 1ZM2A 2Z58B 4PQAA 5B0EA 2L3MA 4DL4A 3KLHB 3D1QA 2VUGA 3OL7A 1IR0A 1QAXA 1N36J 1VRUA 3TR5A 2W4DA 4JI6F 5I3UB 3DMJA 2NS1B 1NAQA 3W64A 2HWIA 4A8SA 3C16A 3ILIA 3VHQA 4JP8A 2LQ8A 2GQ2A 1B70B 1VQLS 3EZOA 3HFKA 3OL6A 2Q43A 4NXMF 1GTEA 1OY9A 1WEZA 5LMNJ 3OTCA 1DBDA 1T02A 4K8RA 1RSCA 3H2UB 3MDFA 5K8MA 2ROEA 4CYUB 3M8ZA 2R7UA 1GH8A 1J2VA 4P7VA 1S0VA 1F9FA 2I6WA 3BDPA 1GXLA 4DQQA 3RAQA 2PN6A 2VICA 4XK8C 1KTVA 2GO8A 3IMQJ 2P8IA 2BE9B 2BACA 2HAFA 2QMXA 1IKXB 1K8AT 2ERRA 4BBYA 4C8NA 3IAS9 4UT4A 1YKWA 3DOKA 2KJVA 2G4BA 3NCQA 4WZMA 2CA9A 4OZ0A 5J1EB 3H20A 4A8MP 4DV0J 2Y0BB 2P2CB 4HT5A 2FD2A 4RBTA 2DNMA 4JI5J 4NEZA 4PWDA 2DO0A 1Q81T 2JL9A 1RTIB 2CYYA 3DLEA 5L39A 4TY8B 4DX8H 4J90A 4X62F 4I2QA 1A0OB 3CC2S 5D3GA 1EB0A 4OHYA 2RMLA 1OIAA 1M5OC 3V81B 1NRKA 3MM7A 3G87A 3QT7A 3R6LB 2YH1A 2B5JB 4KO0A 2IHR1 2E9ZA 3IM9A 3IC1A 4NA3A 4CM0A 4DL0C 1NXIA 2IRYA 4KGKA 2R7XA 1Q5VA 2DXDA 1TL3A 2R7OA 1YG0A 2P9EA 4KY3A 3KDOA 5GAEU 1R89A 4LRBA 1YGYA 4E98A 5AXNA 4DR4J 3D1HA 3CPWR 3TYTA 2UVUA 3DRRA 4JV1A 3DLKB 1TV6B 2Q6BA 5D4OA 3SDEB 2B56A 2HW3A 1S1WA 2IVMA 5GMEA 3TVZA 1C2PA 3H5YA 3H8YA 2XMVA 3FUYA 3HHLD 4LUBA 2QYGA 1F1BB 3GIJA 2H5IB 4LSNB 1XC9A 1EQMA 1FD8A 3MMCA 2LA4A 1UPPA 3IXQA 3H2LA 2BE2A 4USMA 2J9EA 4ZJOA 1ZTWA 4DMZA 4N5SA 4YDDB 1C4AA 3HD2A 1N8RT 2LQBA 4GKKF 1RP5A 3C6TB 4M5IA 4NYPA 4GRSA 2K8GA 1FRIA 1TAQA 1F60B 4A8YA 2ASYA 3ET6B 4LF1A 1NEEA 2CNNB 3RW6A 2Y0SD 3NGTA 1JKHB 2V50A 2XMKA 2JZ5A 4JI2F 1GFWB 3K7RA 4NLVA 5IT4A 2RUSA 1ZM9A 1VIXA 1B0PA 4DSLA 4B3OA 5JVHQ 2AD9A 5F0UA 2ILZA 3QT6A 1TZ0A 4IH6A 1I94F 2V9KA 2VHGA 3E3XA 3IR6B 1IWAA 3B6BA 3DGPB 3R5GA 5D4NA 2X3GA 3BGUA 3ZZYA 1PSDA 3BO4A 2FC9A 3KLGB 5LSLA 4B08A 1JLAB 1KDNA 2IDLA 2ZH2A 2VZ9A 4JI3J 3D6HB 3VR1A 3MM8A 2MY8A 4ENOA 3VAMA 4ED6A 1RKJA 2DXFA 1U2CA 1T94A 3NGUA 2F40A 1QTNB 2RIJA 3OPKA 1FRJA 1S0NA 1QSLA 5B0AA 3C19A 2VC0A 1D1UA 1URNA 4WP8A 3C6UB 3BH7B 4UUWA 5KFWA 2DKOB 3TJ9A 2ZUGA 4RNOA 3RB3A 3KLIB 3DRXA 4OX9F 1T9WA 5G0RA 3VQTA 2B4OA 3FVYA 3UDEA 2PD1A 5KFUA 3Q2SC 5MLCV 1VQ8S 4ES3A 5KOWA 4DCOB 5ADZA 1CPZA 3JAMU 2V4QA 3RB6A 1IBKJ 4ZS6A 4JI4F 3BO2A 4EEYA 2IRUA 4ZMMA 1QM9A 4Z2XA 4ECUA 1S57A 5IV3A 2JFDA 4QZVB 1CJKB 3BBBA 2AU0A 2HHQA 2W24A 1RXOB 2V68A 4PABA 1GMVA 4KSEB 3M8SA 4FDFA 4DPUA 3D6TB 2HPUA 4OHZA 1C0TA 1UVLA 3PX4A 1MW7A 2WVCA 2WONA 3FEYB 1AFJA 4XAKA 2B9YA 1U0HB 2O1PA 1SUQB 3I0RB 1NKBA 1Q7YT 3TEHB 2HAIA 3PJ9A 2RT3A 4YP3A 4F4YA 5JJBA 4LFCJ 4YQWA 3JYTA 1T03A 2E29A 3ITHA 2G2OA 4YFUA 3N28A 1KVKA 4DX7A 2IYGA 3I82A 3P3DA 1U1KA 2EWHA 2OKQA 1QJHA 2C3YA 3M8PA 2FZKB 2AX1A 1VC0A 4KAIA 3H42A 4O44A 3CDBA 1VBZA 5HBMB 3PJXA 5KG7A 2IC3A 1X4CA 2MQPA 1U1NA 4ZA1A 1Z4UA 4EBCA 2RDDA 3KG4A 4DXLA 3AXMA 1KEKA 1FRLA 3PHEA 2PDAA 2F8MA 1Z2LA 4DDFA 2HBRB 3QIPA 2CQGA 5K5MA 1B99A 4TYBA 2A10A 3LP1A 1IUJA 4P73A 2RKIB 4KC5A 4DV7J 3GQCA 3BB5A 3VAKA 2L9NA 2RQCA 1DJ0A 1JLGA 5IQ6A 4C11A 2IBKA 3CJKB 5F8GA 4PXDA 2M3DA 2Q3PA 3HXMA 2KL8A 3MI7X 3DYAB 1RHKB 3M6UA 3CD5A 6FD1A 3TI0A 4RO0A 2CNOB 1Y3KA 4Y2KA 3JSRA 3TEGA 3IM8A 2R7RA 4K4TA 1K1QA 1YITS 2NQPA 1HWJA 3SYZA 1LWCA 1IKYB 1NBEB 3TJAA 1RT4B 1YJTA 3A8IA 3F73A 2Y9HA 1VMBA 3I4PA 3IWNC 1HARA 4ZLNA 2CPIA 4H4MA 2QLFB 1G2EA 3E01B 4ECXA 1U49A 4OYOA 1F6TA 5B0CA 4K50A 2XC9A 1LK5A 1ZAVA 5GAGI 1NCLA 2ZH5A 1PBAA 3DRPB 2RF2A 2J8SA 2D9OA 5KG5A 2HG4A 1T9XA 1N6QA 4N8NA 5CAAA 5F3TA 4DSJA 3DRSA 4ZITA 3PIOQ 1HWKA 2RVJA 2ACYA 2NCKL 2NUHA 2UVWA 3DMJB 3HPOA 4OIXA 2FZCB 5MAOA 3IBWA 3MEGA 1JJ4A 2VV5A 5KG4A 3WC2A 1SVDA 2BA9A 3SEOA 3C16B 2QMUB 1HHTP 1YJRA 2PA8D 1MN7A 1UW4A 1BD6A 1JXVA 2HQDA 2Z2LA 1P8GA 4HDHA 4ZVPB 1YI2S 3EPIA 1OY8A 2BYCA 4DPXA 1HKAA 4I6YA 2V0NA 4OLPA 2H48B 3OFFA 1YQHA 4KPCA 3N4WA 4X4UA 4KH1B 3TANA 1Y00A 1N5TA 1VDHA 3JQKA 1VQPS 4KGZB 3RRKA 4H4OA 3FFIA 2HWTA 1VQ4S 3TAMA 2IM3A 4NASA 4I0WA 3EGVA 4U7UK 4CRJA 2DEJA 3DOKB 1GX6A 1KFDA 4AQYJ 1NK7A 5GAHI 2N7YA 2V8HA 4DR6J 3O44A 4S0MA 4OYBA 2DNRA 3T1HF 1FRXA 4X65J 4PWDB 1KRPA 1H0HB 1S1TB 4MTPA 3U27A 4FF1A 5H9FK 3CT9A 5D8HB 3DLEB 3HT3A 3R1LA 3BQ2A 4LF8F 3TUJC 4I2QB 5D3GB 1FRKA 3D54A 5FJ4A 5E5NA 3LWLA 1WC4A 2PI5A 3MM7B 1WC5A 2IRXA 3MMJA 1D8YA 1FNXH 4KO0B 3UWTA 2HRTA 1KONA 1R6YA 2MSSA 3C14A 5E3PA 2ATLA 1XEZA 3BBCA 1TL3B 4QQBA 1CEZA 1FRHA 4RW8A 4RW7A 4DV6J 4P75A 4L73A 1L5UA 4C8YA 3MPYA 3JAMY 2LQ9A 4I7FA 4A8QA 1RADB 3TA1A 3DRRB 4MYUA 3FSYA 1SC4B 1S1WB 4O3NA 3PVXA 2JHEA 1A6LA 1AYEA 3QPIA 5IXUA 2CXEA 2XULA 2KXHA 1D09B 3T6JA 5KFIA 3UDLA 3PXGa 2BJEA 1SJ3P 3MMCB 1RWMB 1UJ6A 3CSKA 4ECWA 4C0BA 2BE2B 3R7SB 5KFBA 4JI7F 2FZGB 2IM2A 1KOOA 2QV6A 3M1VA 2QA4S 4IFYA 3NNAA 3CB4A 4DU7A 2F4FA 1JK9B 3BYRA 4RNFA 2CG4A 3T5KA 3HD1A 1UZDA 5IS2A 4DFMA 2DNPA 3MOJB 2XCAA 4C8OA 2HHVA 5IT9U 2LA6A 1FK9A 4NLYA 4B3OB 1A9NB 3L7OA 1RTDA 4JV5F 2FQQB 4LR8A 5ETPA 2IA0A 3S1TA 2NSBA 4QBUA 1R8CA 4XDCA 2QGFB 2BQ3A 3QSIA 1HQ2A 3M05A 4WK3A 3MM8B 2GNKA 3BN4A 3ENVA 3QGIA 2XYGB 2RNEA 3EVWA 3K8VA 2OD4A 1HNZJ 5HAOA 2CJXB 3M8WA 1U0SA 3KK3A 4X4OA 4CLTA 2OD6A 1G4CA 1KLMA 4EBDA 4Y65A 2XZWA 3PKYA 3VGSA 3NLCA 4MMOA 5KFYA 5KFHA 3RZAA 1RU2A 2AF6A 3UR3C 5G0RB 3THVA 4CLZA 4QCLA 4ZVEA 1RCOB 3LA0A 2YX4A 2HHPA 2U2FA 1YBUA 2OTJS 3QT8A 2OH2A 3E2EA 2LP4A 3NL0A 4PWWA 2L9WA 3MR5A 4ILRA 2K3IA 2E5LF 4PYDA 2DH8A 1HWLA 4ZJQA 1Z1ZA 1B0VA 5A8WA 1D9AA 4UTGA 2WHOA 1EETA 4LF5F 2DRAA 3D5MA 2ADCA 4M95A 4HYKA 4M8LA 1C0TB 3F44A 2KZMA 4EZ6A 4UY8T 2EFNA 1YRUA 2HHXA 2W01A 2WONB 3BGRA 5GMDA 3PFOA 1S6PA 2GAHC 3ISZA 2K7JA 2JLEA 1HR0J 1SB6A 3B4MA 3C2PA 3JYTB 3W1YC 3ITHB 4DR1J 3FZBA 2HK2A 1OPZA 2HHWA 3Q89A 3AHPA 2C3OA 9RUBA 2XGQA 2HFVA 3R1HA 2GIFA 2VQFF 2CG8A 1SI9A 3M8PB 2KKHA 3C66A 2HVEA 3SCKE 4W90B 4QWCA 5HANA 3Q8RB 2GFFA 2C3UA 4O44B 2XBPA 1FEHA 1RISA 4DZDA 1PYSB 2IC3B 1IBMJ 1T11A 2WW4A 1WC3A 3CEDA 3ZTOA 4LQ3A 1QUVA 5K8NA 3OXLA 5KFVA 4X4TA 2OEKA 1RTHA 3PEJA 2UXBF 4NMLA 4CIOA 4DR5F 1I3OB 3PEHA 4L72B 1U6ZA 3B82A 3I87A 4ED4A 5AXLA 2VG6A 1TVRA 4CLFA 5DQHA 4DWIA 4NLQA 5L1IA 4FPIA 4HH0A 3QIPB 4IOCQ 4Y2CA 4F0HA 4YUDA 2V5HG 3BKFA 3LP1B 1ULRA 2R2RA 1V5VA 4DV1J 3PX6A 2HQFA 1Y9OA 2IFXA 1X4BA 1BWVA 4XPCA 1NDKA 1JLGB 4C11B 4KT0C 2ZC4A 2A0FB 2LEBA 4DPWA 4NWBA 2ZHOA 4Q5VA 1G6BA 5CHCB 4ZPCA 4CM2A 2P6SA 2XZTB 1QSSA 3AQOA 3CJ4A 2EG1A 3TZZA 5K8PA 3AB4B 2XLIA 3QQCD 1UA1A 2IM0A 4Y0FA 1LWCB 4FF4A 3KHRA 4JB8B 1XNQF 3BDEA 1X31C 4DR7F 4YDXA 2OPSA 1SH3A 4H4MB 5CD4A 5B08A 4MYTA 3QRPA 2RSQA 1ZETA 2XMTA 3WX8A 1NU4A 4OJ3A 2XS7A 3MURP 3AXKA 1BQMA 2RF2B 2O5DA 2H4WB 1N6QB 3VGUA 3K5LA 4AT1B 2EVZA 3DRSB 1YBTA 2AWZA 3ZZRA 2QX0A 5HP1A 1WHYA 1Q86T 2PMWA 2XQCA 5J1NA 1EAYC 1HNWJ 1RAEB 3LGHA 3IRXA 4W4MA 3G9CA 1Q8KA 4WFYA 3W2WA 5BYQA 1NUEA 1UVKA 2EKNA 3MEGB 3B78A 4IG3A 1N34F 4PYAA 3UR0A 1SJ1A 3A1YG 4J9NA 2HBQB 4Y34A 3IGNA 3GSIA 3MM9A 4ZPTR 2KFNA 4WE1A 3G86A 3N79A 2OELA 3D9BA 3CF5Q 3NCRA 1JXLA 2HFZA 5B09A 2EPIA 3EDRB 3WBZA 2XHCA 5L1LA 1JLCA 1H72C 1XR6A 2CJAA 4P2SA 2Z30B 5ETSA 2DCLA 1VFJA 4C7QA 2OUGA 2YQ0A 1IBCB 1WG5A 4H4OB 5IT9Y 3FFIB 3QFWA 2DY9A 1WF1A 2JLGA 4U7UD 1UWBA 3QZ7A 3RAMA 1NJYA 2DNKA 1PAEX 1N48A 3K57A 4Q0BA 1DTQA 1GEHA 1FKPA 2MKHA 2QFIA 2IIHA 4C8LA 2CQIA 1N5YA 1YZ6A 4O3QA 3CJ3A 1W26A 3FRYA 2CQHA 5HJYA 2YNIA 1V6HA 3MECA 3AQPA 3BSNA 3GJRB 1VQMS 1MSWD 2HQIA 4RJVA 1RAOA 3MAQA 3P5TL 4BWMA 1KQFB 3Q8PB 1I6JA 2NR0A 4KJIA 3JS9A 1OMSA 2QN6B 2LKZA 1YX2A 4RBUA 3DLHA 4UZBA 4E2FB 3NS6A 3C14B 4ZPDA 1FJ7A 2H1YA 5DGAA 3PRBA 1RA6A 2H5JB 4RW8B 1E6YA 4RW7B 4YHHJ 2YPYA 3W63A 5E3CA 3W61A 4I7FB 1FTCA 1HPZA 3JQMA 3OFHA 1NSQA 1QY7A 4JV2A 3R5JB 4TXSA 5F0WA 1VOMA 3SQGA 1K0VA 1H7XA 2I0XA 5CZXA 3NG8A 1B7YB 4MK7A 4C98A 4LF4F 3EMTA 1RT2A 3HSGA 3W60A 1S59A 2A2CA 2C2NA 4ICLA 2K06A 2BR0A 4EWTA 5HMYA 2B9XA 3GWCA 4P10A 1U1QA 2RAQA 5F9NA 2GW8A 3K2YA 4USWA 5HATA 2UVVA 5DETA 3M1VB 3GB0A 2WVDA 3G71S 4IFYB 4DR2J 2FLPA 1RBLA 1VGYA 2QLWA 1U8SA 4DLGA 2DYAA 1X5SA 2L48A 1K9MT 3D66A 5F41A 2CZVC 3HSDA 4NRUA 3DOMA 4N8OA 4N76A 1FK9B 3TJ8A 1VQ5S 1S79A 4ILMA 4PEOA 1RTDB 3BQ1A 1KN6A 1IR2A 2FJAB 4AXJA 4HHUA 1HWUA 1KNZA 5K8OA 4R5PB 3HI9A 3CC7S 3LP0A 1HNXJ 2X51A 5IM0A 4F02A 5DG7A 1Y5IB 2FGOA 3ENAA 4MKYA 4DFKA 4JI1J 2M88A 3KK3B 2W8KA 1DZ5A 5JMNA 2C3MA 1BMQB 1KLMB 1X0FA 2CPDA 3TVKA 1VC5A 5DDOC 1N52B 2SXLA 3G6ES 1UZHA 2DITA 2LQ5A 4N41A 4DEZA 4OX8A 2HNZA 3UD4P 5D78A 4CQ1A 2BJ1A 1UKUA 3LGNA 5KFGA 1DRZA 3SV3A 3GV7B 4OZ5A 3THTA 4X4NA 2CPFA 4ZN1A 4DUYF 4PWUA 1ZH5A 3HVWA 3DRYA 5IT0A 5E33A 5B0BA 5EDWA 3ILLA 2WW8A 1OSCA 1WKJA 4OZ2A 5A8WB 2CNLB 1XNRJ 1EETB 1UEKA 4JOUA 1XMBA 2W7OA 2XMMA 2OI2A 4PQUA 4ERDA 4B3RJ 1WD6A 4BDPA 1IR1A 3BGRB 2GMJA 4J5OA 2QTWA 4IRDA 1S6PB 1R8AA 4K4XA 3N01A 5HVGA 5DDPC 4K2JA 3VAJA 1FDDA 1S6QA 4AD6A 4NA1A 4PXCA 2H54B 5FIIA 4LFAF 4F2SA 5GADU 4IDKA 4FXWA 1RTJA 2PA3A 1M1GA 3LANA 2CJQA 5CH7B 1LXNA 1ACMB 4P6QA 2FDNA 4DUZF 1MWZA 3RYLA 3NOCA 1HNVA 5GMKa 4D3GA 3PW2A 3QGPA 1GT8A 2GC8A 1RBOB 2VBWA 2G1DA 4JI8F 1UTAA 4XTTA 2IVFB 4GVLA 2VFTA 5LMUF 3DHWC 2XWXA 3UN3A 3W65A 3CCQS 2YKNA 3T9NA 2XEXA 1RTHB 2JOQA 1U6FA 4PUOA 4NOHA 3OTBA 2ZOGA 2VG6B 3MD1A 1TVRB 5AJ3F 4X84A 5C24A 4FN5A 4U6PA 1SKWA 1R43A 2XLKA 4NX9A 3OL9A 2FLOA 3QO9A 1FXRA 1YSJA 2IJRA 2FHKA 2DIUA 4NI2A 3CO0P 3CJRA 1NPKA 5BR8F 4CNYA 2YKOA 1TQLA 3EGZA 4DX5A 1WHWA 4F4ZA 2KDOA 1DTTA 4K0KF 3L7UA 2YWKA 1GMWA 1IBLF 5ETLA 2NPIA 4N56A 1RBAA 4MIWA 3HCXA 5L38A 5J2NA 3HHEA 2RB7A 2RS2A 1AUSL 4KHPJ 4PKDB 1U1OA 2BJ7A 1UWAA 2VC1A 3H5SA 2UUBJ 1BHNA 2OSRA 3TQEA 3QJPA 2OPSB 3QLHA 1X4AA 1WHVA 1FWKA 4DS4A 3SCJE 1EKSA 4WP9A 4ZLJA 4USHA 4F4WA 1P27B 2OMOA 2RHSB 2D41A 1UEUA 2CPHA 2FY1A 3CE8A 1NSAA 4FBUA 3BEGB 1BQMB 4USKA 4ECTA 2AW0A 1EHWA 2FVPA 2ZZNA 4QWEA 3SIPB 3LOUA 2EFPA 5HMZA 4NLTA 3D2WA 4ELTA 1B4SA 3KHLA 2DNHA 1TKZA 2KTQA 1CG2A 2OAUA 2FVSA 3DXSX 2XI2A 3POTA 5HP1B 3H98A 1YVFA 1JJ2R 3IRXB 3IR7B 5IWAF 3OLAA 1UVNA 3QYYA 1WORA 3F0NA 5L1KA 1O8BA 3W2WB 4IG3B 1T3NA 4CO1A 2QLBB 3PW7A 4F36A 4ZP9A 1ZAXA 2ZBQA 4JV0A 3I5AA 5HMWA 3MM9B 3KUGA 2UP1A 2VKZG 5GAEI 1NK6A 2M8HA 2MEWA 4JI0J 4WE1B 2V2ZA 3R8YA 3I9ZA 5F3ZA 2FVCA 2QLXA 1SKUB 4DLEA 3KYLA 4NZ7A 2DISA 1JLCB 4WYLA 2VBYA 1MMLA 2HIQA 5DQGA 1JLFA 2DD8S 4KFBA 2VDIA 4PG4A 1HBUA 2BJ9A 2V8GA 3J7Z5 5E41A 2MJUA 3ZO7A 2NXJA 3R2CJ 1X7VA 2XS5A 5CYMA 3JSYA 4DS5A 1UWBB 3J7AN 3ULHA 4Q0BB 4MK8A 1OO0B 1DTQB 3MEDA 1NMEB 4OYXA 1FKPB 2EC2A 1FJCA 1N5YB 1RWPB 1RABB 2R8KA 2AYEA 2WVEA 1HW8A 1XTZA 2J7KA 2I1RA 3U02A 2YNIB 3MECB 4CO2A 1M5VC 3Q24A 1YJNS 5AT1B 1SJRA 4K4YA 3P8BB 3GLJA 1XN9A 1VQ9S 3HLUA 3MM5A 2YKAA 3M8RA 4ECVA 1P1LA 4WU2A 2KZZA 1PCAA 4QPXA 3R5DA 3H5UA 3MAAA 2OLWA 2KJWA 1W7WA 2B4PA 2ZJRQ 2OPQA 3OR2B 4CLSA 2NYIA 5KFLA 2QE5A 1HBMA 1ZM3A 2QC3A 4LFBF 2G2ZA 4YB7A 1E6YB 4RUCA 1XWLA 4PR6A 2HHHF 1F3FA 1BWEA 2EC0A 3DCAA 1R8HA 2IJNA 1HPZB 4HEA9 3SSQA 1U1LA 3SQGB 1DQAA 2V69A 3MCNA 1DY3A 2H51B 3LAKA 3IWXA 4DV5J 2UUAJ 2HGLA 2A2DA 2DNQA 1HHQA 2RDIA 5DLFA 5EWGA 4L74A 1PBUA 1RT2B 4LF6F 5IV4A 4N7TA 4ZLLA 1FO1A 1HBNA 4ICLB 2JRSA 4B3MJ 3NEKA 3PYDA 4NLRA 1ICEB 3MOZA 1U2RA 4ECZA 1AFIA 2BRLA 4OX7A 4QIGA 3ZZOA 4BLGA 4UOCA 3QBCA 4X64J 4X4VA 2UVRA 4RKUC 2OEMA 2CDRB 1R7IA 4QOTA 4UQGA 3VCDA 5HLFA 4B3TF 3PDNA 4F4KA 4ZPBA 3DOMB 2MY7A 4UOFA 5AE1A 2BUNA 5F8HA 4X66F 2R42A 1HFEL 4QJVA 5I42A 4M5LA 2ZH4A 2NPFA 3M4XA 5I3PA 3U1LA 4RW9A 2ZBPA 4K4VA 2ZDPA 1S99A 3PX0A 5KT3A 4M63A 4NCAA 4DL2A 3K89A 1IKWA 1VI7A 3B4DA 2VODA 1AZSA 2XZDB 3LP0B 4YY3J 2Y8WA 5IM0B 3TUZC 3AD8C 4FF2A 4EK2A 3V6HA 1Q79A 1IKVA 4AE5A 2HEKA 4CLYA 2VBZA 5EHHA 1S0MA 2YBVA 5CYJA 4B3SJ 3DU5A 2G0JA 1N36F 5KFTA 1I1GA 1CULA 1XMOJ 2KG1A 4RW6A 4ZP6A 3HP6A 1F5BA 2FVQA 1U1MA 3BREA 1TK0A 2V63A 3R5CA 3R97A 5DDRC 1VBYA 2HNZB 3OVSA 3ZNJ1 1IM4A 2DNGA 4ED3A 2FHJD 2CQ2A 5LMNF 1RYRA 4ZVOB 3DHXA 2E66A 3BO3A 3GG0A 3RBEA 4DJBA 2VOPA 2ZDOA 4AYBD 1WDDA 2BQRA 2OMLA 2DGOA 1BC6A 1VQNS 3T3FA 3CCMS 1NDLA 4ZIWA 2N4CA 1S1UA 4OHVA 1W2IA 4PQUB 2E44A 4FS2A 3UPFA 4CT9A 2BRKA 2KVQE 5CQGA 4NA2A 2E5IA 3P49B 2BW2A 4IO1A 2UXCJ 3M9MB 3DDKA 2UU9J 4DN0A 1X9SA 1EJ7L 2MQLA 2AJFE 2MZTA 3K58A 4ER8A 3W5XA 3FMBA 1X8DA 4DV0F 2JEGA 4IR9A 1S6QB 4ED7A 2AYMA 2ZKUA 3BGOP 2VG7A 2N7CA 4Q43A 4G1PA 4JI5F 1RTJB 1T3OA 3IP0A 1FWPA 3OXGA 2B8QA 1HNVB 4ES1A 3AT1B 3QT5A 2DR8A 5DG9A 1BY9A 4KHMA 4NLSA 1HIYA 1N0UA 4A8XA 3T5LA 3G82A 5HVHA 4ZN3A 1FCAA 2YKNB 4C2MA 3MTJA 2AQ4A 1O51A 3DU6A 3JSMA 1K1SA 4QIEA 3KK2A 5C24B 3TX8A 4DR4F 1NZ8A 3RTVA 4FS1A 2LDYA 5E3AA 3CXCR 4LRCA 3RUBL 2GIRA 3QO9B 1Y7PA 1DAXA 1SQFA 2BOPA 4C48A 4C4WA 2KH9A 3KG1A 5LT5A 4I2PA 2NXNA 3KLFB 2R2UA 8ATCB 4DQSA 3KJVA 2AYBA 5DGBA 1DTTB 5HI7A 1RLDA 2BVZA 1RHQB 1KD1T 4LREA 1YJUA 3D6MB 4KR0B 1IQZA 3SCIE 3IBFB 2PI4A 3DKDA 5D6GA 2F4VJ 3MPVA 3GSDA 1RHUB 3NY0A 6FDRA 4ANEA 5J2NB 1D0EA 1X9MA 3PO4A 3V4IA 4RR5A 4IO9Q 4QU6A 4YOEA 4ANCA 3RAXA 4HKQA 2ASDA 2ROPA 2KRRA 2ZJQQ 4IQMA 2XMJA 1R27B 3QLHB 2XM3A 3GYGA 1IJFB 3NBPB 1FJGJ 4NRTA 3EPGA 2MKJA 1GXTA 2XSJA 3K5PA 3TZWA 1RT1A 2KM8B 4KRWA 4DUTA 4TNOA 2DGXA 1S1VA 4MKAA 2QSFA 3RBXA 5HJXA 2HVZA 2NXCA 4DHVA 1J5EJ 4K4UA 2LECA 2OFGX 3JSBA 4DV2J 4JI3F 2HLUA 1TKZB 2RRNA 3HHLA 2J0WA 4GKJJ 3POTB 2GQQA 2X7IA 1NJWA 1Y0HA 1TAUA 1M90T 4B9NA 1HA1A 3OLBA 4O0IA 4KTQA 3ZTPA 1X4GA 4ALZA 2CQ0A 1RB0A 3PW5A 5BYRA 1CS4A 3IWLA 4ZVTB 3RRHA 3J81U 1T9UA 3BZQA 5BXIA 2YNFA 2DPJA 3ZZTA 5DM6Q 5AE2A 3RBZA 1I51B 1BLUA 5B7WA 3KK1A 5KT7A 2AEJA 4P7TA 2MLXA 5AXKA 4QR1A 1OPIA 4OJGA 1IBKF 3NNHA 4E8UA 2C1EB 3N6LA 4Q44A 3OTOJ 1MN9A 1YJ9S 1JLFB 1R0AA 3IGVA 3KXDA 1ZOTA 1RWOB 4KFBB 4OLOA 2DT9A 2CQ4A 5DJBA 3M9OB 4MFBA 1C4CA 1HBUB
chains in the Genus database with same CATH topology
5H1SV 1FA0A 1JLEB 3OXLA 5KFVA 3OFGA 4X4TA 1M5HA 1RTHA 2DNYA 3PEJA 2UXBF 2ZOMA 4NMLA 4CIOA 3AY0A 4DR5F 2LQJA 3PEHA 5CYMB 4F8RA 1KQSR 3UFCX 4L72B 1U6ZA 2VD3A 2L08A 3B82A 3I87A 2FIUA 4TY9A 1YJVA 3AB2B 4OI1A 1QSYA 5AXLA 4WKRA 3TNVA 2M5YA 2VG6A 2C28A 1KTQA 1TVRA 1K0TA 3J7A1 5FLXY 5DQHA 2ZNYA 5EX0A 4DWIA 3D0IE 4NLQA 2FJEB 3V6DB 1XBWA 3M2UB 2QRRA 3GFHA 3KKFA 5L1IA 3CULA 4F67A 3JTPA 3MEDB 1TKXB 3DC2A 1NJIT 2LXIA 2I5JB 3MXHP 1Y4ZB 3LUYA 4HH0A 4PPDA 3QIPB 3TVYA 4ZKAA 4KGMA 4IOCQ 3FNNA 4Y2CA 1NK8A 4O23A 1D8ZA 2ZOFA 3E51A 4YUDA 4AL7A 4EZ9A 2V5HG 2RILA 3DGPA 4RWXA 4OMFG 2OO4A 3LP1B 5E7OB 3C46A 5J2PB 2MHNA 4NYZA 1ULRA 3H4BA 2R2RA 1RT6A 3EYZA 1X4FA 5FD1A 3KLGA 4ZVHA 4LFCF 1RWUA 4EYHB 3MMAA 3DM2A 3HX9A 3PX6A 1E6VA 3UCGA 1Y9OA 3BM7A 2IFXA 3GV5B 4ED0A 4FF3A 5KFQA 1X4BA 4XPCA 4CCHA 3PZPA 4LSLA 1NB7A 1JLGB 4C11B 1MMNA 4KT0C 2ZC4A 4O4GB 2LEBA 3MM5B 4NWBA 2E9TA 2ZHOA 3W3SA 2UV8A 3L7PA 4Q5VA 3KMSA 1G6BA 5JXSA 2J6UA 4F3OA 4QYZJ 1TR0A 5CHCB 4ES2A 4JI0F 4UW2A 3N9UC 4ZPCA 2N3OA 3BGFA 1WF0A 2P6SA 2MKSA 3T6BA 4Z37A 1QSSA 3OVAA 3AQOA 3MMBA 4ELVA 4WFAQ 1S76D 2PT0A 3CJ4A 1FRMA 2EG1A 3UI3A 5F8MA 5K8PA 3CCJS 2ZBCA 1RDRA 4ID5B 3J7YI 2V8VA 2M52A 3AB4B 2DGWA 2OPQB 4NL5A 1HWIA 2XLIA 5SZTA 2AJ4A 4TQSA 1UA1A 3C6UA 2N3LA 4NLGA 5EN1A 1HBOA 2DNNA 5LSRA 3NMRA 3QWUA 3PNIA 2VFSA 5A0YA 2ZZMA 4WFBQ 2RRAA 2IM0A 3HHLC 4FZVA 2XY5A 3CO9A 4RLEA 4GO5X 4YR2A 1HBMB 4Y0FA 1LWCB 2ZJPQ 1SV5B 3KLIA 4DF8A 4FF4A 4FYDA 3HZEA 2V4JB 4FNHA 4FNIA 2PMZD 3PIPQ 5KFOA 3NGDA 3TRGA 3KHRA 2DGQA 3BSAA 2D1CA 2VPZB 2MJNA 5K14B 4DL7A 3EUNA 4ED1A 2J6TA 1XNQF 4NCGB 3BDEA 4DR7F 2EFGA 4YDXA 2GCFA 2WB4A 3OHAA 2OPSA 2LU1A 3RR7A 1H3DA 1SH3A 1FXLA 2YVSA 4H4MB 2VFRA 3KK1B 2UXDF 1RT5A 2QIFA 4FVCA 5B08A 2ZD1B 4MYTA 5M2RA 2KYXA 1VQ6S 2MQOA 3J7ZT 4F2RA 3VQSA 2ZC3A 4ED8A 4OHWA 5HROA 2RSQA 1ZETA 4R0JA 2GX8A 2XMTA 5THWA 2FHOB 4TLQA 4G1QA 1H2TZ 4WK1A 1DARA 3X3UA 3VAFA 1UVIA 2Q79A 2O66A 4CI0B 3NAIA 2ASLA 1NU4A 4OJ3A 2EBGA 3IAM9 1SL1A 1VHFA 1FTRA 3MUTP 2XS7A 1HD0A 2DH7A 3ISND 5A8RB 3MURP 3ZFVA 3HO1A 1BQMA 2RF2B 4R8UA 2ADBA 5LXRA 1URRA 3K59A 1WNEA 5I3QA 2XO7A 1HQEA 3M30A 2LXFA 4ZHRB 1RK8A 4KIAA 4Q45A 1UFWA 1HBNB 4DV7F 2CQDA 4PG5A 1QAYA 2O5DA 2NREA 4B17A 5CCLA 4F3MA 4OI3A 1F5AA 4HLBA 1N6QB 2U1AA 2JWNA 3QGGA 1UL3A 3K5LA 4Y6IA 1VK3A 4MIAA 1M5PC 3QJJA 5KFFA 2DHSA 2EVZA 1T95A 5B0GA 4WXWA 2WAQD 4WJBA 3DRSB 1L3UA 2AWZA 2FUG9 3DFEA 3WC0A 1JLQB 3ZZRA 2C42A 4OI4A 2YY3A 4F25A 3GIIA 1SL2A 5HP1A 1WHYA 3BF4A 5KG0A 2P5VA 2MPUA 4GO7X 1Q86T 2FHMA 3CTRA 5J1NA 3SSSA 1SUQA 3I0RA 4J9OA 2RU3A 3IRXA 3G9CA 3DOLA 4WFYA 2ZH3A 3GIMA 2ZITA 3W2WA 2OPPB 5BYQA 4EFAC 2J5AA 1UVKA 1LV5A 3MEGB 3B78A 4IG3A 1N34F 5IZHA 1MWYA 5HLFB 4IH5A 3UR0A 5LJ3Y 1WELA 3I5CA 1D9FA 1S77D 4H4KA 2R2TA 1SJ1A 1LK7A 4NZ0A 3A1YG 4J9NA 2DR5A 1S10A 3PM9A 4LJMA 1VK8A 2CQCA 4H54A 4MKBA 4U67Q 3QZ8A 1LW2A 4RNHA 2G9OA 3V6KA 3A8EA 4NLDA 1TKDA 4Y34A 3IGNA 3MM9A 2WTFA 4CH1A 4ZPTR 3TARA 2KU7A 3LAMA 3M32B 5E2QA 1U4BA 2KFNA 1C1BB 5M2PA 4WE1A 3G86A 4I56A 3UW1A 3N79A 2D74B 5I42B 2GMLA 5E3QA 4X4QA 1MU2A 1SJQA 1ZBTA 3CF5Q 3NCRA 1SC6A 4C0OC 4RW9B 2POKA 2C2RA 4ETXA 1Q16B 1X0PA 1JXLA 2HFZA 1UJ5A 1TL1A 5KFJA 5B09A 4M5DB 3FGVA 2EPIA 3WBZA 2NLWA 5L1LA 2BBEA 4HI2A 4DQPA 1LOUA 1VBXA 4ELUA 4C8ZA 4OQJA 3S8SA 1S49A 1JLCA 4DV5F 2UUAF 1SXLA 4G3IA 5HBMA 1OSDA 4TLRA 1XR6A 2ZHBA 2PFFB 2CJAA 3O5TB 4P2SA 2JH3A 4OZNA 5A6WA 1XR5A 2MKIA 4ZP8A 4ZP7A 5K9FA 1IKWB 1UA0A 2DCLA 2B3TB 2YWGA 1VFJA 4RBVA 2HVHA 1LWFB 4C7QA 4ZPWR 2LDIA 4BC9A 5EWFA 2FC8A 1WG5A 4OX6A 4H4OB 3OSPA 3IG1B 3IRWP 5IT9Y 3BN7A 3FFIB 1QVGR 2N4DA 2DH9A 3GIKA 1D9DA 1FE4A 4J9SA 1WF1A 2JLGA 1IKVB 4RW4A 4B3MF 1V9OA 1GTHA 1FEEA 1D3WA 2O01C 2J0XA 2UUTA 2R9LA 3MEEA 1UVJA 3H5XA 1UWBA 1LWEB 3LQVA 3QZ7A 3RAMA 1PC5A 2FTRA 1NJYA 2DNKA 2F7VA 2CZ4A 3S7RA 2W4PA 3S6EA 4W92B 2OP5A 2DHAA 4MAKA 3O6QA 1N48A 4EBEA 3K57A 4Q0BA 1Q8LA 4IQXA 4R25A 2DHGA 3HZGA 1DTQA 4IOBA 4X64F 2UUWA 2QSWA 1FDNA 1FKPA 2MKHA 3I5BA 5IQQA 2OTLS 3GYNA 5HROB 3VAGA 4J9QA 2CQIA 3LO3A 3I55S 2JEFA 2EFOA 1N5YA 3RW7A 4OZJA 4C8LA 1VQYA 3SI8A 1ZYQA 1FVQA 4O3QA 3HKWA 3CCES 3CJ3A 4RW6B 3NMAA 4PRFA 3CDUA 1S9FA 4BS2A 3KMQA 3FRYA 4CH7A 3O3LA 1Q8IA 3RB0A 2WSCC 1RJJA 2CQHA 2RKIA 3PACA 2YNIA 1V6HA 3MECA 3CUNA 3AQPA 1ZTTA 2JDJA 4YB6A 3BSNA 1DQ9A 2EG2A 2LVWA 1VQMS 2VBXA 1MSWD 3OL8A 3W2VA 2HQIA 2LEAA 3KNGA 1FNOA 2XNQA 2HRYA 3O8WA 4B9MA 1TFYA 5D77A 3CJKA 3CMES 1B64A 2W9CA 2Q66A 5L9NA 3MAQA 3J7YU 1QE1A 2I2YA 3P5TL 4BWMA 1KQFB 3VTIA 5HL7Q 2MQMA 3QWPA 3Q8PB 1I6JA 2NR0A 2R7QA 4KJIA 4WF9Q 1RI7A 4EGLA 7FDRA 2CJ9A 3DYAA 3BR9A 3QMQA 4ZK7M 3GFXA 1WG4A 1T8EA 2LKZA 3OQ2A 4RBUA 1FKOA 1S48A 2ABYA 3DLHA 5HQ8A 2MKKA 2KT5A 3H2VE 2G0CA 3CGIA 1BQXA 3NS6A 4WYWA 2R8IA 2WSEC 4R5PA 2IM1A 2M70A 3FEZA 4PG6A