2K3KA

Solution structure of drosophila melanogaster snf rbd1
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
104
structure length
104
Chain Sequence
MEMLPNQTIYINNLNEKIKKEELKKSLYAIFSQFGQILDIVALKTLKMRGQAFVIFKEIGSASNALRTMQGFPFYDKPMQIAYSKSDSDIVAKIKGTFKERPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U1 small nuclear ribonucleoprotein A
publication title Structural and Functional Studies of RNA Splicing Factor Sans-Fille by Multidimentional NMR Spectroscopy
rcsb
source organism Drosophila melanogaster
total genus 29
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2008-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2k3kA00
1YHQS 1H2UX 2HGMA 3B4MA 4J5OA 4FXWA 1WF2A 3PIPQ 5DDPC 2J0SD 2X1AA 2KRRA 2WBRA 2DGTA 3NNHA 3MI7X 5EN1A 1WG4A 2DGVA 1U1KA 2M8HA 2MZRA 2CPXA 2I38A 5IFMA 2CPYA 2DH7A 4LIRA 3PIOQ 2DGOA 1KD1T 4ERDA 2B0GA 4LMZA 2KFYA 2JRSA 1VQ4S 2QFJA 2CPDA 1IQTA 2MSSA 1X5TA 1JMTA 2MKHA 1XN9A 1H6KX 2DNNA 1VQ8S 1SJ3P 5GAHU 2KHCA 2MY7A 2MQMA 2MJUA 3U1LA 5GADU 2MKKA 2J0QD 4UY8T 2KM8C 3MD3A 2D3OR 2RRAA 1FJ7A 3MUVP 4Y0FA 2DNHA 5GVQA 2LEAA 3CC4S 1M5KC 2QA4S 2HGNA 2E5JA 1UAWA 1D9AA 2DO4A 3MXHP 1YTYA 1JJ2R 2G1DA 3CCMS 1YI2S 2D9PA 1O0PA 5DM7Q 4F02A 3NNCA 2EK1A 2DHGA 1YJWS 4QQBA 3CCES 1N8RT 2CPFA 5JVHQ 2UP1A 2MHNA 5JVGQ 3S01A 1KQSR 1VC0A 2VONA 1UW4A 2CQHA 1HD0A 3G71S 2MQLA 1PGZA 3H2VE 5LSOA 2LCWA 2DO0A 1URNA 1N88A 1QM9A 3CUNA 2VOOA 2MYFA 1B7FA 3VAFA 2KT5A 4PRFA 5D78A 2MQQA 2KG0A 2J8AA 2KN4A 3BS9A 1X5PA 2MKIA 2DIVA 3THPA 2RT3A 1K9MT 2CJKA 3MD1A 1WHVA 4F25A 3TP2A 3R27A 1YWXA 2CQ0A 3B4DA 5HL7Q 2RQ4A 5CA5A 3DXBA 2MQPA 2DNRA 3VAKA 2MSTA 2XS5A 1R8PA 2MZ1A 2K3KA 2F3JA 3N9UC 2L41A 1RKJA 2JVOA 2GHPA 2J76E 4PR6A 2FC9A 2G4BA 2RS2A 1A9NB 3TO8A 2DNMA 2L08A 3NNAA 1WEYA 5H1SV 3OW2R 3U1MA 2RVJA 3I56S 2LECA 1YIJS 2MKJA 4YUDA 2RS8A 1D8ZA 2L9WA 1H2TZ 2DNQA 3CMES 1WF1A 1YITS 2N7CA 2KRBA 1A7GE 1X4CA 4IUFA 5BJRA 2BZ2A 2DNYA 2N3OA 2MQOA 3IRWP 1M5VC 2AYMA 1DZ5A 2D9OA 3MUMP 3CCSS 2MPUA 1VQLS 1Q7YT 3CPWR 3UD4P 2CQDA 2MGZA 4P6QA 2YTCA 1U6BA 3EGNA 2CQ2A 2HVZA 4WFBQ 2XSFA 1X4BA 1QVGR 1G2EA 3NMRA 3G9CA 3L3CA 1ZZNA 2MZTA 1K73T 4CH0S 3MUTP 2DHSA 2YH0A 5GAGU 2ADCA 1VQ6S 2DNPA 3CD6S 3SDEA 1WG5A 2MGZB 1WHYA 5LJ3Y 3CCQS 2CPJA 1U1RA 2O3DA 3BEGB 3Q2SC 3JB9k 1WEXA 2LYVA 5DM6Q 4F26A 2DIUA 1X4AA 1FT8A 1X5OA 1X4FA 1VC5A 2N82B 3V4MA 2ERRA 1WG1A 2XNRA 3EGZA 1BY9A 2DITA 1VQMS 3SDEB 1Q86T 4IOAQ 2X1GA 2HZCA 1KC8T 2MMYA 3P6YC 2CQ3A 2F9JA 1UFWA 1FNXH 5DDQC 1U1MA 2MJNA 2ZJRQ 3CCUS 1DHMA 3TYTA 1X4HA 2KG1A 1YJNS 3CF5Q 2XB2D 3VAJA 1H2VZ 4WFNQ 2EVZA 2E5GA 3CCVS 4TU8A 3ULHA 1VQ5S 2CQ1A 2U1AA 5LJ5Y 1CVJA 2M9KA 2EK6A 3MURP 2E5HA 5IM0A 2CPHA 3CCLS 2KH9A 1L3KA 1NJIT 1K8AT 1OPIA 3J7YU 2LKZA 2BOPA 1X5SA 1U2FA 1W2BR 4C0OC 4Z2XA 2HYIB 3HHNB 3G8SA 1KOHA 2MXYA 2LMIA 1X4EA 2HGLA 1SXLA 1FJEB 1ZH5A 1U1LA 2DNLA 1Q81T 1WF0A 2RRBA 2DK2A 4Y00A 4CH1A 2MKSA 3NS6A 2ZJQQ 1Q82T 3ZZYA 1N54B 2CQGA 2SXLA 3VAGA 1OWXA 2M0GB 2DGSA 2CQ4A 3HI9A 2MB0B 2ADBA 2K8GA 2OSQA 2DNZA 2DNKA 1S79A 1M90T 1SJRA 4ZKAA 1U1QA 4YOEA 5MLCV 2F9DA 2LXUA 4OZ0A 4PKDB 2AD9A 2E44A 3LQVA 3S8SA 4QU7A 1AUDA 2I2YA 2DH9A 3G8TA 4YB1P 1SJFA 1VBXA 3I55S 5GMKa 5LXYA 4TU9A 2RU3A 4IOCQ 2M2BA 5HO4A 2CPZA 1FHTA 3P49B 2M88A 2Q79A 2KVIA 3CXCR 2FY1A 2MQNA 3K0JA 3S7RA 3D2WA 2MZQA 3UCUP 2OJ3A 3CMAS 1NU4A 2KU7A 1VBZA 5DDRC 2OTJS 2MZJA 2KM8B 4CQ1A 4WF9Q 2DGQA 1U1PA 1FXLA 4CIOA 1OO0B 2KXFA 4QPTA 1VQPS 2CQIA 2DGUA 3UWTA 2ZJPQ 2JX2A 3VALA 1WWHA 4IO9Q 2DNOA 1R8HA 4WKRA 3VAMA 3LPYA 3FEXB 2DB1A 5CXTA 3UD3P 3RW7A 1WEZA 3BO3A 3SMZA 2M8DB 2FHOB 5GAEU 1FJCA 1VQ9S 4EGLA 3CCRS 3DLLQ 2JVRA 2LA6A 2A3JA 1WHXA 3BO4A 1NO8A 1X4GA 2KYXA 2VODA 2YH1A 3US5A 2OIHA 2CQCA 2DHXA 2DGXA 4FXVA 3G96A 1M1KT 3H2UB 2KI2A 1WHWA 2RQCA 1SJQA 2KXHA 4C7QA 3P3DA 2AYEA 2XS2A 5DDOC 4ED5A 2RNEA 2XS7A 3Q2TC 3UCGA 1U6FA 1JJ4A 2NZ4A 3MDFA 1DBDA 1X0FA 1U1NA 3CULA 1JJHA 3J7ZT 3NS5A 1N52B 3UCZP 4U67Q 1HL6A 2GO9A 2LXIA 1VQOS 2CQBA 2FC8A 2DNGA 3SXLA 5D77A 2OSRA 2KXNB 5IQQA 3G4SS 3R1HA 3CC7S 3FEYB 2G0CA 1S72S 5DETA 1SJ4P 3IWNC 3BO2A 1WELA 2LEBA 1YJ9S 1WI8A 2NLWA 2AYGA 2PEHA 1VQKS 4W92B 2MKCA 2YKAA 2X1FA 1VBYA 1KOOA 1DRZA 5IM0B 2LQ5A 2N3LA 2M4MA 3R1LA 1VQNS 2X1BA 2MY8A 2OTLS 2PE8A 4M5DB 1U1OA 2DISA 3VAIA 2AYBA 3VF0B 1P1TA 3G6ES 4A8XA 2CPEA 1F9FA 1M5OC 1HD1A 3THTA 2FPHX 2RUGA 4UQTA 1M5PC 4C4WA 4WIIA 1RK8A 5CYJA 1OIAA 2VOPA 4TU7A 3S6EA 4QU6A 1P27B 1ZZFA 3UE2A 3MOJB 3P5TL 3EX7B 2V94A 5FJ4A 3CC2S 2XNQA 2M7SA 4LJMA 4WFAQ 2CQPA 1WTBA 2QEXS 5LXRA 2M52A 1HA1A 2MZSA 3RW6A 5ITHA 1UP1A 2M70A 2CPIA 2DGWA 4OZ1A 2DHAA 4V19X 4WCEQ 1PO6A 3ZZZA 1VC6A 2U2FA 1VQ7S 4TLQA 5LSLA 1WI6A 1QVFR 4W90B 1X4DA 2E5IA 3CCJS 4BS2A 2DH8A 4RU2A 1FO1A 3VAHA 2LA4A 3CTRA 2JWNA 2YWKA
chains in the Genus database with same CATH superfamily
4B02A 1LWXA 2KT2A 2I38A 5ETVA 1RT1B 4X4QA 1UVIA 1IQTA 1S9GA 4UOGA 1T9WA 2MHEA 3IS9A 1PJ6A 3MD3A 1HNWF 2DNHA 3OTOF 3CC4S 3Q89A 4A48A 1EAYC 4DUYJ 1OPZA 4Y2CA 4J90A 3M4XA 2BOAA 1YI2S 2JH3A 2EK1A 2DHGA 3M6VA 1RBLA 3CE8A 3QRPA 4WE1B 3DRYA 4AE5A 3HJVA 4YDDB 2D74B 3SSQA 1C4AA 5KT5A 4DR6F 1UJ5A 5KTQA 1FE4A 3PHTA 3RZAA 5BYSA 1KFDA 1WC5A 1RACB 2KN4A 1FJGJ 4LQ3A 2HAFA 1RAHB 4G1QA 1IKYA 3M8PA 3UN5A 1RKJA 4CNZA 1RYRA 4PR6A 4ZDNA 2RF2A 3DOKB 1N5YA 1SIWB 4KBIA 3GFXA 2AEMA 2XLIA 1WUUA 5I4MA 2HIQA 4WU2A 2H5IB 2C2NA 4JI7J 5J1EB 2MQOA 4HLBA 1B99A 1SH0A 4P71A 4OMFG 1FXDA 5HAOA 4IFYB 4KE5A 2WAQD 1MW7A 2I6WA 3E51A 5HLFB 1K0TA 2P9GA 5IWAF 1LWFA 2GHVC 2IJFA 1KHVA 2DHSA 4PG5A 2QIFA 1WHYA 2JSXA 2G13A 2JEGA 2CVEA 3U02A 4ZVOB 4ZVSB 4ED1A 5K5MA 3X3UA 2VPYB 1JLEB 5D15A 1H7WA 1X4FA 4ZITA 1WG1A 2HMIB 2ZJRQ 3M8WA 5I42B 2E5GA 3BH6B 3WX4A 5AJ3J 1UJ6A 1VRUA 3MCOA 3MURP 2E5HA 1N48A 3CCLS 3MZIA 1PJ7A 2BOPA 1TQLA 3TUZC 1Q81T 4P7VA 1NRKA 2XGPA 4FN5A 1HBNA 2PC6A 3H42A 3MMCA 2I8EA 3VZIA 4EEYA 3RAXA 2VZ9A 4MKYA 3PYGA 1RT6B 4DSIA 2YPZA 1ZTWA 1EP4A 2B5JA 1LWCA 1KTQA 3GYNA 1RXOB 2ZBCA 3LPEA 1H98A 4USMA 1M5SA 3OD2A 3PXGa 1SV5A 4P7TA 5FD1A 2MZJA 1C1CA 3QT5A 1H74A 2DGUA 5KAKA 4EK2A 3R5BA 2M8DB 2NYIA 5IT9Y 3AOAA 2KYXA 4RW8B 1XK8A 5KFQA 4C7QA 2QFIA 1RAJA 1MROA 3ZTRA 4LRFA 1TK5A 3Q86A 1JJ4A 3I96A 3W65A 2IAJA 3PVXA 3J7ZT 1PJ5A 4IDKA 2GO9A 1T05B 4H4MB 1DTTB 3PRDA 1ZETA 1GMUA 3HP6A 2VJVA 3JAMU 4B3TF 5KG3A 3AH6A 3LGNA 4ZPTR 3K7RA 4X64F 3B78A 4W92B 2L3MA 3SCLE 2PN6A 1MU2B 4USIA 2JC0A 4M5DB 3O44A 1XJWB 2FPHX 2BBEA 4NLUA 1FK9B 1EB0A 4X66F 3WZ0A 2XCPA 1K0VA 2X3DA 2OPPA 4IR1A 3P5TL 5A6WA 4UUXA 1S0NA 1T8EA 1XMBA 2JDJA 3KHHA 2U2FA 1KEKA 2R7RA 2XSJB 5KFCA 3MM6B 2HFNA 3R7NB 4TQRA 3D0GE 4C6AA 3TANA 4LF7F 3ZZ0A 5M2UA 4JI2F 3FEZA 2MQMA 3KTQA 2MJUA 3MEDA 3R97A 3T9NA 3MEGA 3PZPA 1E6YB 3J81Y 2E9RX 4R8UB 2QLWA 1FDAA 4KO0B 1F60B 5AE1A 2BMBA 1ZAXA 1XR7A 4LF4F 3WIVA 3H20A 2VUGA 4Q8EA 3E8OA 2K7KA 3TEGA 2NXCA 1TL1B 1ULRA 1V6HA 4G65A 4PRFA 1CG2A 2IBKA 1T03A 2J8AA 4ID5A 1X5PA 2W8KA 1WHVA 5KFXA 2BUNA 2CFXA 1UA1A 3DXBA 4A8QA 1EETA 5E3AA 1RE1B 3MPDA 2CJBA 4DJBA 4EO6A 2J76E 1RT3B 2G9OA 5H1SV 5JMNA 1YIJS 3CT9A 3NGTA 5BYQA 3I9ZA 2NPFA 2JZ5A 4HEA9 4OHZA 1DZ5A 1EKRA 3RBDA 1LWEB 1I6JA 1UMJA 2AT1B 2HVDA 4KGXB 2ZH9A 2G1HA 3A8IA 1HWKA 2HAIA 3NMRA 1ZZNA 3KJVB 1LK5A 3SDEA 5G0RA 3EDQB 1FTRA 5AE3A 3KLEA 4P9SA 4F26A 1LK7A 1UWAA 2MKYA 4KB7A 5ETMA 2N82B 2ERRA 4AXJA 2EWHA 1YJNS 3OL6A 3FZ2A 2RQMA 3ISNC 2EVZA 4HT5A 4CLZA 2WVFA 3Q8RB 1SUQA 5HMXA 3GZ7A 1IBMF 1NJZA 3OTCA 1UVKA 3OFFA 4F4ZA 2FLLA 3MEEB 1EIYB 4M94A 3ZXWA 2RRBA 4GKKJ 3IC1A 2AHOB 1RLCL 4LF5F 1WKLA 1B0TA 2E29A 2MB0B 2ADBA 3DLKB 1NK9A 2OSQA 1O8BA 1SJRA 1LW0B 3UVJB 3D28A 2EC2A 3OL8A 1HNVA 4WU3A 4NLPA 2E1AA 1J27A 3QT8A 3JSBA 5J2QA 1U47A 1KQFB 2JC1A 3TI0A 3A8KA 3I55S 5D4LA 3CIMA 3GU0A 3LA0A 2YKMA 2FY1A 3K89A 3W3SA 2KXFA 3E01B 3TAQA 3CIZA 1RT1A 4FF1A 1YRUA 2QGFB 2XI3A 3U7JA 3R5CA 4DDFA 2IYGA 3DLGB 2AU0A 3KG0A 5DG9A 3RB6A 1NH7A 4TY8A 3QGPA 3QPIA 1UKUA 1WHXA 2YH1A 2AJ0A 2E5LJ 2DGXA 1U26A 3TZYA 3D3BJ 3I4HX 1X9WA 4ED5A 4OJGA 2A1BA 5LT5A 1SPBP 3CULA 1UWBA 1N52B 4B9VA 2ACMA 1YSJA 1Y9OA 1JJCB 3KMQA 3CC7S 1HPZA 1TL4A 1CSJA 2VHGA 4B08A 3OJSA 1DY3A 3R1LA 2CDQA 2OPQB 3ILLA 1QUPA 2VQEF 4RUAA 1F5AA 2JLEA 4DZ6A 2V69A 2HVIA 3GG1A 3OR2A 1L3SA 2IC3A 2BKOA 4LF9J 5AXKA 4WTYA 4DPYA 4ZA1A 2V94A 1JKHA 4LSLB 2MZSA 5ITHA 4JOUA 5T14A 1WOOA 2NCKL 1X4DA 5CD4A 4BS2A 4IFYA 2EG2A 4U7CA 2QSWA 4ATNA 3H5YA 3DC2A 1HQEA 1WTFA 4I2PB 3M8RA 2GVZB 4NWBA 4NLQA 1KBRA 1P8GA 4H4KC 1S6QB 4RJVA 4RL1A 1TZ0A 5HVGA 1RT5A 2HK3A 2APOA 4FPIA 2CPDA 3V6DB 1JLEA 4XDCA 3MF5A 3TAMA 2Z8QA 2MY7A 2GGPB 5F0UA 2HMIA 3IAS9 3FGVA 1LKZA 4GVBB 1M5KC 4DV4J 3EVOA 2B56A 2ZM6J 3NBPA 2WVCA 1JQGA 4QQBA 2HEKA 3GWCA 1WORA 5HQMA 2CWXA 3S01A 3LP2B 2CYYA 3GONA 2MQLA 1HNZJ 4U8VA 2OPRA 1ZAWA 2X3GA 1FRMA 3R6LB 4QOTA 3MM7B 2UXDF 1U02A 3BZQA 5DO2A 5BYRA 5GMEA 3BS9A 2DIVA 3GB0A 4KPYA 1NZAA 3W9IA 3A1YG 5CA5A 3KXDA 2YKQA 4N5SA 2ZITA 2VC1A 2L08A 4ZVRB 4JV5F 3PX6A 1DQ9A 3M2RB 2RVJA 1CC8A 4DR4F 2ZKUA 3JSMA 5HVFA 3V4IA 4ZCMA 1YITS 4USTA 1SL2A 5BJRA 2DNYA 3N0VA 4MYUA 1GT8A 2ZKTA 5H9FJ 3ZNUA 4NLRA 1SI9A 5ETKA 5FDLB 4H4OB 2XMKA 1G2EA 3DOLB 4WP9A 1NZ8A 5GAGU 3CDEA 3EZ5A 2R7XA 4WBFA 3UDLA 2G2ZA 2C3UA 2BACA 1HMVA 1WEXA 1FT8A 2HG4A 1KQKA 3T1HF 4ANEA 2DR7A 2JEFA 1DTTA 1T94A 4IKAA 4IH5A 2KL8A 3TYTA 2XB2D 2YQ0A 3HX9A 1QDUB 3K58A 1IN0A 3HSDA 4B9SA 4WYLA 2HNZA 1SQFA 1OPIA 4DCPB 1MU2A 2E1MC 3CSKA 4M5DA 3TAPA 2LMIA 3D5MA 4CLLA 3HLUA 2L9DA 4UQGA 3HVRA 2Y8YA 2M0GB 4CM2A 3VR1A 3OTDA 2XY5A 1R6VA 1K1SA 4CLKA 1CS4B 1XR6A 4M1KA 4OX9J 3CD5A 4UUWA 4EBEA 3IRXB 4JI3J 1IWAA 1HHSA 3M32B 3Q8SB 4ZJOA 3GR0A 1KR4A 3OUYB 2HBYB 4USVA 4ED8A 4NXNF 4NZ0A 5H9FK 2Y3YA 2EKYA 2Z2ZA 1S4FA 2OPSB 3I4PA 2VV5A 2C2RA 5C25B 1HNXJ 2I5JA 4C98A 5KFWA 4ZLJA 2C2KB 2ROEA 3HKWA 5IC6B 3HVAA 1ELOA 3FFIB 1NDPA 5EX3A 3GYGA 3M7VA 1E6YA 4ECRA 3DDNA 4R8UA 2RNEA 1AW0A 5IT9U 2ZZNA 3C16A 4KO0A 3NG8A 4GKJJ 1T95A 5L1JA 2NSCA 2WVBA 3AY0A 3NS5A 2NUHA 4LSZB 4RWWA 4DMZA 1RTHA 2R7QA 2VA3A 3A3OB 1WSVA 2R7VA 5D0RA 2B7CB 6FDRA 1FFWB 5A2QY 3QBCA 1T9TA 3G6ES 4ECXA 3Q23A 1HD1A 4JV0A 1UFKA 4CYUA 1M5PC 1HR0J 1GMWA 2RD5C 1JLAB 1FWLA 2DBBA 2DRBA 2R8IA 4ELUA 3MCMA 3S6EA 2W4DA 1YJ7A 3ENAA 2LQBA 1NKBA 3R5GA 1NPRA 4C11A 2JL9A 5A8RA 3BSCA 1QY7A 5LSLA 1FA0A 1N6QA 2RIJA 3X1LB 2XMUA 1SB6A 4J5OA 2BX6A 2YWWA 2YKNB 2AZ1A 2KHDA 1U1KA 2AX0A 2CPYA 1C0TB 4TXSA 1NEEA 1BQMA 2VBZA 2VG6A 2P6TA 3Q24A 2PGCA 3D67A 4NA3A 4ID8A 3G6YA 4W4MA 4Y2IA 4O0NA 3C14B 3CGIA 4DV2F 2DO4A 4F3MA 2EI5A 4HL9A 4Y34A 3VVUA 3BR8A 3TWZA 3J81U 3NCPA 4CTAA 1OQ6A 1N8RT 3DXSX 3QNWB 3L7UA 1FF2A 1KQSR 1UVMA 3AJ2A 3H4BA 4ER8A 2BJ9A 4X65J 3K5OA 4FS2A 5K14A 3G86A 4X4TA 3HHLD 3L7PA 3MD1A 3R27A 4OYPA 3EVWA 3HCXA 3NRBA 2MSTA 4U96A 2K3KA 2BANA 3W63A 1T0TV 1NJXA 2VIHA 2LECA 2RS8A 5U47A 2L9WA 3BSNA 3ISZA 4RKUC 2HVEA 2XBPA 3K8WA 4I4BA 3E01A 2DPJA 2F8EX 4NYPA 3CCSS 4E0DA 1JLBA 4OX8A 2RH3A 2ZBQA 2YX7A 2VL1A 1T3OA 1JX4A 3W7BA 1X4BA 3SI8A 2XTJP 3DU6A 3WBZA 1EX8A 4I56A 4B3MF 1URRA 4X84A 1R7IA 2V8VA 2UUAF 4F50A 1CJTB 2HWIA 2RKIB 4YY3J 6FD1A 5SZTA 4DU7A 2XNRA 1VQMS 2LEPA 2OFGX 1KC8T 3GFYA 4DV7J 3RYLA 2Z56B 3D6TB 3I31A 2ROPA 4ED2A 1C0UB 3DYAB 3CJSA 1FESA 5IXUA 4HDHA 2M9KA 4UY85 3NGUA 2YNGA 1K8AT 2BV3A 2W9BA 2V34A 4NLYA 2OPQA 2UXCF 1U2FA 4OV1A 3W62A 2WSCC 2ZZMA 1KOHA 1SXLA 1FJEB 1ZH5A 5A8WA 1IKWB 3NAIA 2IRXA 1QAXA 5A8KB 1J5OB 4F2RA 1FKOB 4J37A 2CQ4A 1J5EJ 1KS2A 3H5XA 4EZ9A 2DNZA 2ZEJA 2K2PA 1NB2A 1U1QA 1LQ9A 4YDXA 4OZ0A 4LSNB 4PYDA 2EW9A 5HVHA 4DPWA 2B4OA 3CW2C 5GMKa 1T7PA 3DDIA 1TUVA 1FKAF 2V50A 2WONA 4ELTA 3RBXA 4ZJQA 1PIEA 4I2PA 3FRZA 3OSNA 2GVZA 4DUTA 2PD1A 4P2FA 2HNDB 2CUYA 4L74A 4GO7X 1C2PA 1S6QA 2D69A 3UI3A 4K50A 4JI1F 3W2WB 3QZ8A 3V6DA 4IG3B 2V68A 4FPRA 1U0SA 2FHOB 2GGPA 3NCQA 2DY1A 1SQEA 2E9ZA 4WXOA 4GVBA 2DRDA 2UUTA 5CYQB 2NR0A 2AYEA 2EG1A 1TL3B 3NGKA 3OV7A 1HNIB 3UCZP 1IBLF 4CDIA 4DCJB 5D77A 4WWSA 2KXNB 4CZCA 4O3QA 3BR9A 4CLSA 1YQHA 3R8YA 2PA3A 1PYSB 3MM7A 4PABA 1YJVA 4UTGA 1KSPA 2CPEA 2PEBA 4ANDA 4DUZJ 5KFKA 1NB7A 4ZHRB 4QWEA 3BJYA 2CG4A 2UU9F 1RA6A 2F65A 3C19A 1REVA 2LP4A 3M2RA 1HA1A 3VZHA 1CC7A 2CA9A 1NNDA 5HANA 2GIQA 2CPIA 2A2DA 4O3RA 2FYXA 4OZ1A 4PXCA 1VQYA 1GXUA 3DHXA 2BW7A 1UVLA 5DJBA 3KLHB 5FDLA 4HYKA 1S0OA 3DOLA 3GV7B 5EHHA 3HKZD 1HKAA 4OQJA 2V2QA 4K5RA 2VFTA 2XMTA 4IH6A 2X1AA 4NCBA 3DI6A 2DGVA 4QWAA 3K5LA 2W1BA 3H98A 2QLFB 4LMZA 2VQFF 2J6SA 1Y4ZB 3W9JA 1H6KX 3MPVA 1IQZA 4A8MP 2KM8C 3ADAC 2EFOA 1TP7A 1Z2LA 1SL0A 3TUPA 2CZ4A 3OVBA 2D9PA 4LFBJ 2W4CA 2AMCB 2CPFA 1SBRA 1B3TA 2ZZTA 1OSDA 4DV1F 4OZNA 4C0BA 1YRTA 2UUBJ 1PGZA 3W8GA 3FSXA 4NLSA 1FVSA 2RAQA 5E3RA 1P6TA 2GFFA 4DV3F 2GO8A 1CS4A 4ECYA 1NK5A 3EUNA 3DLBA 4L6V3 1T11A 2V4RA 2AJ4A 3IRXA 5L8RC 4DX7A 3OTBA 4QYRA 2MQPA 1N33J 2HBZB 2H4WB 5M2PA 2HNYB 4RBTA 3TVZA 1F5BA 1ZTTA 1TV6B 1WEYA 1D8YA 4DV5J 2MKJA 5C25A 2EBEA 2KRBA 3P45B 2DKOB 4DQSA 4FF4A 1VR6A 5CH7B 9RUBA 3IRWP 1M5VC 1FRJA 4P2XA 5ETLA 1NH8A 4Y28C 3UD4P 3FFIA 1X7VA 1GTHA 1U45A 4ANCA 3GV8B 2VBXA 1HWJA 3MM8B 4I1TA 4RW9B 3KOAA 3SEOA 4DR3J 2EC0A 2GNKA 2XULA 3C8YA 1X5OA 3PKMA 2VBWA 4LUBA 3C6UB 1S9FA 4LF8J 3N4WA 3CDUA 1F2GA 3FC9A 3SQGB 3CD7A 2MJNA 4X4VA 3UR3C 4I6AA 1NKEA 3NKYA 1RCXB 1PAEX 3QLHA 4DQRA 2CPHA 4DUYF 4ETXA 2ZUAA 2J6UA 1YKWA 3MFIA 1X4EA 1G1XA 2PI4A 1RHMB 2RRNA 1NDLA 1S97A 2UV8A 1HI0P 2VBYA 1RAAB 2SXLA 4NPOA 3TVYA 2Y1JA 3WIUA 4OI4A 1YJRA 2BM1A 2PFFB 1A0OB 1T02A 3WC0A 2BABA 3F56A 4N77A 2UXBJ 1FJGF 2AGOA 4EBDA 3OJUA 2VF3A 1SL1A 1G6BA 2XO6A 4B3OB 4HHUA 3RTVA 4TKTA 3RRGA 5DLGA 3MMJA 2YKNA 2DGQA 3W5YA 2C3MA 4DPOA 4NCGB 1OYEA 2CQIA 5EWGA 2ASYA 4OI0A 4JI7F 3PYEA 3BF4A 4RX6A 4QW8A 1VQ9S 5GAGI 1ACMB 4QPXA 2ZE2B 1UZHA 1WDDA 1MMDA 2CNOB 2CQCA 3QMQA 1HBUB 1RB0A 1WHWA 1MLAA 2GIRA 3C14A 4F8RA 4QR0A 3SCKE 3HFZB 1KNZA 1TKZB 2ZOFA 2XLJA 2BVZA 2UUCJ 1S1UA 3PW5A 4DL7A 1X31C 1DLOA 4Q7AA 4DLGA 1VQOS 4O44A 2DNGA 3EICA 3L4BC 2ZUGA 4ZN3A 1IKXB 3BO2A 3BGOP 4TN2A 3A8JA 3MPWA 5AJ3F 1I51B 2K7JA 3HSZA 2ZOGA 3CJKB 4MFBB 3AB2B 1KQGB 2PE8A 2QN6B 2WB4A 4QW9A 3THTA 2RUGA 1FEEA 5J2NB 1VRTB 3H40A 2Y0BB 2H48B 5A2QU 4YR0A 3J7A1 3JQJA 2GCFA 4DZDA 4AL6A 4L72B 1BXNA 1HBMA 4CWBA 4MT1A 2HFSA 2GQCA 2WCXA 3TRGA 3MR5A 3K59A 1GFWB 4OIXA 3SV4A 2LQJA 2FJXA 1S1WB 1AZSB 4W90B 3EGVA 1Y7PA 4HVZA 3TX8A 1R0AB 5EX0A 4F04B 2KZMA 4O3SA 2HGMA 1Y5IB 5AE2A 3CJTA 1WF2A 4MAKA 4C8MA 5G4DA 3MI7X 2ZC3A 4DN0A 3KUGA 3ZNJ1 2F8MA 4ZCKA 1KD1T 4CLYA 1SQGA 2GC8A 2R2UA 3BKUA 2RKIA 1HQUA 4OYMA 5HBMA 3U1LA 5FLXY 1C1BB 2J0QD 1RT7B 1NCLA 1GK8A 4KC5A 2LEAA 2FLNA 1C0UA 1I5OB 2O1PA 2EFNA 4C8LA 4DR6J 4HT7A 1YTYA 2XMJA 2RJZA 1O0PA 5LM7E 4F02A 2ZH8A 4OX6A 1YZ7A 1SH2A 2XCAA 1SC3B 4AYBD 3CWJA 1VC0A 1IKWA 3IM8A 3CJQA 3ILOA 1URNA 3V5RA 5B0DA 3I0SB 4NCAA 1V5IB 1Q0NA 2QL7B 5DZ6A 3QQCD 4LREA 3W66A 3N6MA 5D78A 1QAIA 2HPUA 3T5JA 2HQIA 5KFMA 2XHCA 2GIFA 5DS7A 3W61A 5HL7Q 2QA1A 3FCWA 5KFHA 4Z7YA 4OYZA 1A9NB 4R25A 4G1QB 3U1MA 3PY8A 1IKYB 1SC6A 4Y65A 4YUDA 3M8PB 3TW0A 3KJNB 1GMVA 3DRPB 2RF2B 1CPZA 2OAUA 4DPTA 2WBMA 1N5YB 3B54A 4NLXA 3W2WA 2AJ1A 1Q7YT 4C0HA 2CQDA 2CQ2A 2P8IA 2HHQA 2G0JA 1LW2A 1MMLA 2MZTA 5HMWA 4XDDA 2YH0A 1CJVA 1VQ6S 5CYQA 3T9ZA 3PYFA 2CIMA 5HMZA 2HHUA 2IMOA 1LWFB 3G87A 4EFAC 1X4AA 1P1LA 3AD8C 1R6YA 1D0EA 4GVLA 4HACB 1X4HA 5KFYA 2KG1A 1RHUB 1H2VZ 1ZM4A 3BDPA 1SIZA 1GXLA 4IFVB 1QSLA 4F0HA 1NJIT 1RWUA 3AFGA 3QJJA 1W2BR 3PRBA 3HHNB 1RU1A 4DG1A 1PILA 2BW2A 1VRUB 2DK2A 2WOMA 3VCDA 2D3UA 4Y00A 4ZHRA 2MKSA 1KLNA 3ZZYA 4HTJA 4X4RA 2J9EA 2G0IA 1TAQA 2OD4A 3QZ7A 3U1NA 8AT1B 4DF8A 5DZ7A 2B4UA 2HK2A 1S79A 2OEJA 1TL7A 5D8HB 4LBHA 1HBNB 5KFZA 1N5TA 3MMCB 4WFYA 1AYEA 3S8SA 3NMAA 4O3OA 2BJ8A 2VKRA 3WHIA 3KLHA 4RNHA 1EP4B 2B5JB 1RABB 1YJTA 1V5VA 3GR1A 4UZCA 1OO0B 3ZTSA 3OL9A 1HYSA 1MN7A 3UWTA 2JX2A 2C2ZB 2PO4A 4J9OA 1SV5B 3I6PA 3QRRA 2B8PA 3UW1A 3DLLQ 3HD2A 1H7XA 3KYLA 1ROFA 3NOCA 4Z37A 1MNEA 1WOSA 2XMVA 4BC7A 1F1BB 4K8RA 1RWWB 3A13A 4X64J 3PJXA 3C66A 1U1NA 3H0PA 3RG6A 5K8MA 1VIOA 3JQKA 4R0JA 3CO0P 2LXIA 1MROB 1RADB 2FDNA 1AT1B 2HWTA 3L95X 2VDHA 3MHYA 2IAJB 5K8OA 4X66J 3BQ2A 5KT4A 2XWYA 1KDNA 3AXMA 5DGAA 1VQNS 1W26A 2YBVA 4FP9A 3TVKA 2HNYA 4K4SA 3CEDA 4GKKF 4U7UK 3ETMA 1N32J 1TV6A 1N34J 2CQPA 1ZPVA 3UR0A 3K17A 4S0MA 1UP1A 2M70A 5K20B 1B0VA 3EJMA 2V63A 2Z0GA 3DU5A 2OPPB 1F5CA 4ZP7A 2VG5B 2F4VJ 4TLQA 3GCXP 3OBIA 2B43A 4LF7J 3HVTA 3QIDA 4GO5X 2YWKA 1YHQS 1H2UX 3B4MA 3LOUA 4LIWA 5EDWA 4OI2A 3NNHA 3QATA 3MECA 2O01C 4U95A 4BLGA 2NSBA 2P6SA 2YNFA 1TU0B 4P52A 4G3IA 4ZCIA 2J9DA 2BXJA 4A4JA 1UEKA 2OFHX 4YP3A 2GW8A 2QX0A 4KYZA 1IBKJ 3PW0A 3P96A 2GVDB 4JI8J 2E5LF 1RI7A 4U8YA 1JJ2R 3MEDB 1OMSA 2W2MP 2B9WA 3CJ4A 2R2SA 1SC1B 1YBTA 1TKTB 3LGHA 3SQOP 1UW4A 1Y0HA 3J7Z5 3MM9A 1N88A 1ZM2A 4RW4A 3SCJE 3H90A 4D3HA 1RZMA 5B09A 3AQOA 1WC6A 2YNIA 5C2CA 4B3SJ 2RT3A 2OUGA 4C3LA 1VYAA 3BGUA 1AFJA 4FYDA 1FNMA 2BJ7A 2MTLA 1T03B 1TFYA 2W9AA 4ID5B 4B3OA 2DNMA 3D6MB 2K1RB 1KKHA 2BM0A 5LMNJ 5L9XA 4LF9F 1EETB 5C7PA 1D8ZA 3OT9A 1L5UA 4URSA 5MAOA 3J81j 3EXYA 2AYMA 1KTVA 1CJUB 1ITPA 2XZDB 4Y6IA 3EGNA 1LFWA 5D0GA 4DHVA 4I67A 5F41A 2ZE2A 3HF5A 3T41A 1DFDA 1U1RA 5HP1B 2HS0A 3TJAA 2DIUA 2ZVIA 3MEKA 3W5XA 3V4MA 1IBMJ 4DXLA 3SDEB 4ILLA 5G0RB 2FZCB 1S1TA 5DDQC 3KK2A 1IKXA 1BE4A 2KKHA 3KLEB 1J2VA 2AV5A 2FTRA 4B9MA 2ACYA 4DV4F 4NLDA 8RUCA 2ZM6F 3PW4A 3CJKA 4MFBA 4P2MA 2XZWA 2DXFA 5F8IA 2B3TB 3O6QA 2P5VA 5KFOA 4ZS6A 4UT4A 1SUQB 2WW4A 4NMLA 5KFLA 5J2NA 4JI0J 5B0AA 5KFVA 2ZH4A 3VAGA 1RA7A 2V8PA 1TKXB 4L3NA 4Q8FA 1APSA 2BKPA 4IG0B 1NBEB 4FXDA 2DNKA 4WK3A 4K7QA 4QIWD 1FE0A 1NDCA 3QGIA 4Y2AA 2R8KA 1S1WA 4NX9A 4HHJA 5C24B 5ETOA 3LH2S 3NGDA 2CPZA 3IBFB 2W24A 4G1IA 2KVIA 3ISND 1HNVB 3M9MB 5F8LA 2KU7A 1HHTP 2LQ8A 5J2QB 4BWMA 1SJ1A 1RTJB 3ILIA 1EZZB 2GMJA 2YKMB 1VI7A 4K4VA 1FX4A 5IT4A 1N36F 4IO9Q 2FVRA 2V67A 1RBAA 4DV6F 4J91A 1JNRB 3PYDA 1C1BA 2A3JA 1RT7A 1NO8A 5B0EA 4I6YA 1UTAA 4IRCA 2KI2A 1FRHA 5GMDA 5DDOC 5E5NA 2P9CA 1V9OA 3UCGA 4TY8B 3CJ5A 3EPIA 2BQUA 1B7YB 4X4SA 4I68A 4A8YA 4F0MA 1HL6A 4KH1B 2X7IA 1E6VB 2EBGA 2I0XA 3R1HA 1UWBB 3I0SA 5HSPA 3PDNA 2QYGA 3QAUA 4KFBA 3KNGA 1NMEB 2NXNA 5KFSA 2RU9A 1MWYA 2ZHAA 3M30B 2X1BA 1LXNA 4OYIA 2F7VA 1HPZB 4XIUA 3DMJB 3KLFA 3S1TA 3IWXA 3G82A 3BREA 2FHMA 1VDHA 1T9YA 4ZIVA 1B70B 1XERA 3A4TA 2M7SA 2FJWA 2QEXS 2FZKB 1S0MA 2W2PP 3OR2B 3DRPA 2IC3B 3M8ZA 4DQPA 4OX9F 1KN6A 1JKHB 5F8NA 4CO3A 1ZS6A 1WC0A 5EWEA 3M8YA 4JI3F 2DH8A 2HIYA 2IYIA 1BWVA 3LUYA 2R7TA 5E41A 2JWNA 2BE2A 4NLOA 3KMSA 4FXWA 3LP1B 2DJWA 1FKPB 4F4YA 3QO9B 1LEOA 5CCLA 4ERDA 3Q8VA 1JLCA 1HQEB 4Q2MA 1HNXF 4M5GA 3T6BA 2MKHA 4MKAA 5KFTA 1U4BA 3DGVA 3FMWA 4HACA 3SBMA 1RT5B 3T5LA 4DSKA 3CD0A 3TAMB 2XYGB 4IFVA 5FLXU 3MXHP 2PDAA 2C1EB 3U27A 4USUA 4ECSA 4PQUB 3KLIA 4GKJF 5JVGQ 3N01A 1BQNA 3PJ9A 2DCUB 4DX8H 3NBPB 1XNRJ 1U2RA 2LCWA 4DI6A 1PYOB 3RBZA 2E1CA 1BC6A 1S59A 4JV5J 2ILYA 3MMAB 2MKIA 4KTQA 2OI2A 4DFPA 4WIQA 4F25A 4PWUA 4R5PB 2OPRB 5AXNA 5J2PA 3UDEA 2MLZA 2POKA 2COLA 5D4NA 2Y1RI 4MYTA 2PI5A 4FNIA 1HR0F 2GZOA 2W4PA 4O0IA 3IBCB 4NLVA 3Q8QB 2OO4A 4ENOA 3MTJA 1H2TZ 2VG7B 3DCAA 2XMAA 1GX6A 3TJ9A 2FLOA 5I3QA 2JFKA 3PCOB 3HD1A 4XPCA 4CCHA 4DU8A 4JI6J 7FDRA 3JSMB 3HHLC 3KUHA 3V4IB 2AGQA 4BHQA 1QVGR 1N5SA 1T9VA 3DFEA 5KFBA 3N28A 1VLYA 4DV0J 4DSEA 2FUG9 3BEGB 1S4EA 3OPKA 1UZDA 2PT0A 1UETA 3HHDA 2VD3A 3UN2A 4X62J 1UW9A 4XPEA 1VISA 5F9NA 1EHWA 3CB4A 3V81A 3BV8A 2GA7A 3VAJA 1HMVB 2VA2A 4K5SA 5KT7A 2EK6A 4OFZA 2NXUA 4EWTA 1X5SA 1UEUA 4ED4A 1LXJA 5B08A 1WF0A 2HNZB 1GMWD 2H9ZA 2WSEC 2NPIA 4YR3A 3N5BA 1U6ZA 4X65F 1WNEA 4ZKAA 1VFJA 4M5KA 5IV3A 2AD9A 3LQVA 1ZOTA 1GH8A 2VG5A 1SJFA 3VQTA 4KV8B 2M2BA 1Q95G 2W2NP 2HRTA 3CXCR 4J9UE 4Q44A 3CMAS 5DDRC 3QWPA 4CQ1A 1UEVA 4U9RA 1GXTA 5KFNA 3VGTA 2ZJPQ 3JSRA 4DLEA 1XWLA 3FBFA 4WKRA 2IIHA 3TUJC 3RW7A 3PKYA 3T19A 2DD8S 2PMWA 2I5JB 1KVIA 3CCRS 4PQAA 2OIHA 5GAEI 2DHXA 3MAAA 3H2UB 4ZP6A 3OFGA 3TQ1A 4FF3A 2GVDA 1EKSA 2FLPA 5KFIA 2CNKB 2ILZA 3Q2TC 3NXZA 2HHPA 2ZD1A 5D4OA 1S77D 3NL0A 5B0GA 1UL3A 4ECWA 1TKTA 4LF1A 2CKWA 4UOHA 2CQBA 4YY3F 2CNLB 2E7XA 1NM2A 2OSRA 5J1NA 3C16B 4M5NA 2RDDA 4KGMA 4DV7F 4DSLA 4ZLLA 2AYGA 2PEHA 1N4LA 1RAIB 3BSAA 5I3UA 2LQ5A 3NLCA 4JI5J 1VGYA 2B9EA 3PR5B 1U2CA 1RTHB 2MY8A 1FTCA 1VBKA 1C4CA 1U09A 4ZLPA 3ZO7A 2DVIA 4W98A 2YWHA 3MR7A 2K1RA 4QIVA 2UVUA 4Y3CA 4CYUB 5LXRA 1J5EF 5IT0A 2CADA 2DGWA 2DXDA 1V3SA 2D3ZA 1QVFR 1EARA 4HI2A 2BA9A 1CJUA 1ZM3A 2WW8A 5KFGA 5LL6d 1KLMA 4KQZA 4C11B 5A8RB 1N6QB 4EI2A 1JLQA 1WG4A 1FCAA 4EMDA 2CPXA 5HP1A 3PIOQ 3FCVA 3RRHA 2QFJA 3OQ2A 4MMOA 1K1QA 3J80Y 2LLZA 5GAHU 1SJ3P 4N47A 2Q6CA 4PG7A 5GADU 4OYAA 2RRAA 4Y0FA 3JAMY 2Z2MA 2HURA 4BWJA 3V6KA 3H8YA 4I7FB 1BQMB 1RAFB 2VG6B 3MWBA 5D3GA 1RBOB 1YJWS 1RISA 3HJFA 2LFVA 4LQ9A 2MHNA 1O6XA 4PAAA 2VONA 3D68A 3PW7A 3CJ8A 4DWIA 2R8JA 2QC3A 4CTAB 1S6PB 4FZVA 1TKXA 3BPDA 4IG0A 4BBYA 4GRSA 4ELVA 3F44A 3KFWX 5K14B 2HLTA 3R7BB 4D3GA 3VAKA 2QV6A 1R8PA 2MZ1A 5C24A 2L41A 4DUZF 4L73A 3CJ2A 1SC4B 1TK0A 4LF2A 4F4KA 1WJ9A 3I56S 4OI1A 1R89A 1RTJA 2N7CA 2BANB 4OJHA 5CQGA 4USWA 4U6PA 1S1XB 2AZ3A 4PPDA 2MPUA 3R2CJ 2HHVA 3CPWR 3TX0A 3PEJA 1O51A 3LTOA 2HHSA 2ZH5A 2XQCA 2GV1A 3AAWB 1JLBB 3L09A 5T7LB 1PYTA 2HQGA 2FVCA 4AL7A 1UCNA 4P10A 3GIIA 3M2VA 3VGUA 1Q5YA 2AEFA 4IOAQ 1SKWA 1E6VA 1DHMA 4DR1J 4P72A 3ULHA 1VQ5S 2W25A 4YB7A 2RHSB 2R2RA 3OL7A 3M30A 4WP3A 4C0OC 3DN9A 1R8BA 4RUHA 3VWSA 4LFBF 3AODA 1U1LA 4FYWB 3DMJA 2YNGB 1JLFB 4WZMA 2W9BB 2CQGA 2UUBF 2DGSA 1OS5A 1WDTA 3D0HE 3BGLA 4WFZA 2C2OB 4EUVA 1VS3A 4DL6A 4PG6A 2L48A 2V8HA 5A8WB 4JYAJ 2FVQA 2R7SA 4ZLNA 1D9FA 3RAMA 5J2MA 5HJYA 3ENWA 3CJ0A 1RWNB 1IXKA 5KG6A 1NHUA 2BDPA 4YB1P 1UVJA 1RTDB 4IOCQ 5HO4A 3J7AN 4CH7A 1Y5NB 2IRUA 2NXEA 2MQNA 2LXFA 2IFXA 2YQ1A 2WRMA 3LP1A 2QLJB 1I3OB 1FKPA 3O5TB 1F6TA 3QO9A 1U1PA 2NQPA 2WONB 4DPXA 1YK9A 1R8HA 1SCJB 4N7TA 3UD3P 4CT9A 1RTIB 1WEZA 1MN9A 5BR8J 1RWPB 3BGRB 4I2QA 4EO8A 4PUOA 4E2FB 4I6WA 3G96A 4WFXA 3P3DA 1RAEB 3PO5A 4Q2LA 4CLTA 3BQ1A 1S5ZA 2BRLA 4DR3F 4DS5A 4C9DA 4PQUA 3NY0A 3GFHA 4ZN1A 3C15B 5LSRA 2HHHJ 3A3PB 5IQQA 3G4SS 1QJHA 3FZBA 1FERA 4M5HA 3DLEA 1AUSL 4FYVB 2FY8A 2M4MA 4FVCA 3TZWA 1PSDA 4URGA 2D41A 2YWGA 3F0NA 4HDGA 3MMAA 4ECVA 1FDBA 1P1TA 4R5PA 1MG7A 1RT4B 1RHJB 1IJFB 4TVAB 3QSYB 5F8JA 3MM5B 2IJRA 3OFEA 4LVOP 2V4QA 2V9KA 5HATA 1NK6A 1HWIA 5THWA 2AJ2A 2YNHB 2VG7A 1S7IA 4OYXA 1Q7LB 2KVQE 3AJ1A 3D6FB 3GV5B 3ZZZA 2XI2A 1G4CA 4I0WA 4OHWA 1CQMA 1REVB 1WI6A 3HT3A 3D0IE 2BQ3A 2UXBF 4G1PA 1Q8BA 1FEHA 1VRQC 2DY9A 1LFPA 1NXIA 2GAHC 1D09B 1HI1A 3UFCX 4QR1A 2VASA 2M8HA 3MTKA 4FDFA 4RW7B 2MSSA 1YBUA 3PO4A 2DNNA 3DI6B 2DCLA 2ROGA 2PSZA 3C6TB 2VJUA 4DV1J 2AJFE 3EPGA 1RGVA 2YWFA 2V6AA 5KG5A 4YHHJ 2KTQA 2VFSA 3MR2A 3WC2A 2UP1A 1VHFA 2UUCF 1KONA 3BDEA 3HT0A 2CJ9A 5KFAA 2CQHA 3QYYA 4YN3B 2BRKA 2XEXA 2WTFA 3PV8A 1IBCB 1V3RA 3SZ2A 2MQQA 3QGHA 4J9MA 3RRKA 4DFKA 4FS1A 2CVIA 1FFGB 1K9MT 5IS2A 1FRIA 4A8KA 4H4KA 4NZ6A 2VPXB 2AGPA 3IXQA 3CDAA 2UVVA 2KB2A 4KV8A 3A8EA 4F0KA 5HQ8A 2B7BB 2J0WA 3ET6A 3L9ZA 5KOXA 3GIMA 2VICA 5CZVA 3NWGA 3CO9A 2K3IA 3RR8A 4KR0B 3M1VB 3CMES 1A7GE 3JTOA 2J0XA 2N3OA 3B6BA 3HSGA 1S48A 3BBFA 2RUSA 2MGZA 2H4YB 3IAM9 1FD8A 5D0EA 1X9SA 4IRKA 2BKNA 1IWGA 3MMBA 5LJ3Y 3K5PA 2CPJA 3I5AA 3JB9k 4OHVA 3DGPB 2EPIA 3VTIA 3K57A 2CXEA 4CLWA 2C28A 4JI4J 1UFWA 5LMUJ 3JTPA 3CCUS 4RU9A 1HQ2A 2HWHA 4NEZA 2G2OA 3EM1A 5LJ5Y 2BEFA 2FB0A 5HQLA 3UPFA 2KH9A 4ZOSA 2CRLA 4EYIB 4LRBA 4Z2XA 3G8SA 4B9LA 4L3KA 3M2UB 4K4WA 4GC7A 3QLHB 1TVRA 5HK4A 2ZJQQ 4DOZA 3OXFA 5LOQA 5HN0A 4NOHA 1NK8A 4LFCJ 3T5KA 3KJFB 1NSKL 3DOMA 4PKDB 4USJC 4DR2J 3DLJA 2QTWA 4QJVA 3O2IA 2RDJA 1WKKA 2XG8A 3B8HA 2RU3A 2W7OA 1Z1ZA 2Q79A 3EMTA 2HFUA 2B8QA 4KIAA 5L1LA 1TK8A 2QG9B 2KM8B 4DQIA 3JTNA 4KGKA 3VALA 1V3ZA 1WWHA 2CJXB 1PC5A 2W01A 2VH7A 3M8QA 3CJ3A 4NE9C 3KLGA 1S1VB 4FVMA 1UA0A 2VODA 1Y5LB 1IM4A 4FXVA 2YX4A 4I7FA 3OLAA 4N8NA 4I69A 2XS2A 1YRXA 2J8SA 2CJAA 3HHKA 3DM2A 1YGYA 1Y11A 3QJPA 1F3VA 1VLOA 5DQHA 2BQRA 1S1UB 2LEBA 1S6PA 2NLWA 1AFIA 1DLOB 2X1FA 4EBCA 4O44B 1DRZA 2RHQB 2A0FB 4CLPA 3FRYA 5ETQA 4B3RJ 3PG9A 1U1OA 4K0KJ 3F73A 1NDKA 1NPKA 3IGVA 3CDWA 4IQMA 3LWLA 4HH0A 4C4WA 2V0NA 4ED0A 5CD4H 7AT1B 4EYHB 2W2OP 4AQYF 1FWPA 1VOMA 1ZZFA 3NS7B 1HWUA 5L39A 4KGVB 4PG4A 4KJIA 2M52A 1SVDA 2OEMA 3G8QA 1S1XA 2KYZA 4Q0BB 1VC6A 3THVA 3RAQA 4BCAA 1HBMB 1JLGB 2XY6A 4DFMA 3R6GB 4UW2A 3PFOA 1FO1A 4ALZA 3RUBL 3VAHA 3K5MA 2GHWA 2YQ3A 2CWKA 2DR8A 5DDPC 2J0SD 5DG8A 1RTZA 3TA0A 1RDRA 3GJSB 5T7LA 4MKVA 2UUWA 2JFDA 2MZRA 4CO5A 4YR2A 2DGOA 2BE9B 2B0GA 2KFYA 5KT2A 1X5TA 4URQU 3TA1A 2N7YA 3P5BP 3SCIE 3J80U 1HQUB 2AW0A 3T1AA 1N0VC 5HBMB 3CCMS 3HZEA 2EFVA 4MK7A 3CCES 3LP0B 2BJ1A 3M6XA 4ECQA 2Z30B 3FBBA 1OYDA 2AX1A 3LANA 3G71S 1JLFA 3PTWA 1S6OA 1ZM9A 2YKPA 3CUNA 1RJJA 3RB3A 1Q1KA 2MYFA 3M9NB 4OYOA 1PKUA 3DNCA 4MIAA 5C42A 2VPWB 3TARA 3IR7B 5FIIA 4OZ3A 2IM1A 1LV5A 3TP2A 4DR5J 4RO0A 1RTDA 2F3JA 9ATCB 4CM0A 3TO8A 1JK9B 2JEJA 3AOBA 3L7OA 1CLFA 2OKQA 1UJ4A 1N32F 1N34F 1QTMA 1IVZA 2NXJA 3PJWA 4DL0C 2FGOA 1YX2A 3OR1A 5E3PA 1RTIA 3BGRA 4CO0A 1U6BA 2F4VF 4QYZJ 2C22A 2LDIA 1FWKA 3MUTP 1PBUA 2Y1IA 4RPFA 4F67A 4PWDA 3CCQS 2A6MA 5E3QA 1LW2B 5GAHI 5SUHA 4NYOA 3ZZPA 5GADI 1WACA 3MR6A 1EJ7L 1CJVB 2XC9A 1VJWA 3R5DA 1DQ8A 3IG1B 3GJTB 5EWFA 2CAJA 4JV2A 1BD6A 1JIHA 3C15A 2F9JA 2FHJD 4DL5A 1VK8A 1S10A 1JXEA 2QMXA 3CCVS 1LOUA 4Q5VA 3GJQB 4C48A 1IBKF 1CJKB 4JI8F 3M05A 5IV4A 2MXYA 4QBUA 1H38A 1RT4A 2ZBRA 4KHMA 4WYWA 4MTPA 4N56A 4CH1A 1RT2B 3A3NB 4LFAJ 3A12A 3MM5A 2KT3A 3BB5A 3UN3A 2HFOA 4DG1B 2R9LA 4FF2A 3HI9A 1S76D 4LBIA 1JNZB 3NAHA 2WOMB 1Z4UA 3JQMA 4IQXA 2YNHA 4NXMJ 2ATLA 2D1CA 2DEJA 2IMWP 2Q66A 2F9DA 3AB4B 2VKZG 2E44A 1R3NA 2I1RA 2HKEA 4RZRA 4B3SF 1TL7B 3IWLA 2HSEB 4B9NA 4JB8B 2ZBIA 1QAJA 2I9SA 2ZH7A 3LWMA 4UOCA 1XMOJ 2OJ3A 3UCUP 1VBZA 2HQDA 6AT1B 3AA8A 1LNQA 3UNGC 5LMNF 2IM3A 4QYZK 1R0CB 5E2QA 1BUXA 4NLWA 1HWLA 1GX5A 2XMMA 4L76A 2QMWA 4ED6A 2DHHA 4RW7A 3VAMA 2WVEA 2C2DA 2EFPA 5HMYA 3SMZA 1FJCA 4EGLA 2MLXA 1RWVB 1HYSB 3C6TA 3BO4A 1I94J 3TUIC 1R43A 2RQCA 4KHPJ 1S9EA 1GNKA 3GPAA 3T6JA 4OLOA 5F8GA 2XWXA 4OI3A 1FDNA 3ZZUA 3IMQJ 3SYZA 4U7UD 1KRPA 3HFVA 1IUJA 3NGRA 3FEYB 3LGMA 4ZPAA 2Q6BA 1VQKS 3I5CA 2YKAA 2R8GA 4ZVHA 1OSCA 2IJNA 2N3LA 2ZVSA 2LU1A 3FVYA 2AWZA 4ZMMA 1XC9A 4C8YA 2W9CB 3HO1A 4FYXB 4ECTA 3VF0B 2HFZA 2HQCA 3POTA 4TYAA 4A8XA 1TFWA 1M5OC 1F9FA 1CULA 2IHR1 5A0YA 2ALZA 4JV1A 4WIIA 1RK8A 2V4JA 4C2MA 2HW3A 4JI0F 3UE2A 3KK3A 3EX7B 1RHQB 1Y10A 2DRAA 1SH3A 3M1VA 2NREA 5E7OB 2DHAA 3QJLA 3K5NA 4DCOB 2NYHA 1TUWA 3AXKA 4ES3A 4YFUA 4Y2MA 3R5JB 4MJKA 1XMQJ 3SFGA 4USKA 4TLRA 2VFVA 2IPOB 2X51A 2KRRA 2WBRA 3R3TA 2QRRA 2W7AA 3Q8UA 3HVTB 2XYPB 5IFMA 3DGPA 2B9XA 2JRSA 2RDIA 3D3CJ 3DHWC 1YDLA 4OZ2A 2CZ9A 2L9NA 3JXOA 2OH2A 3MFHA 4DX5A 3MECB 1U25A 1T9XA 4Y2KA 2YNFB 3VHQA 4WE1A 1CQNA 2ZHBA 4E8UA 4X4OA 5KG2A 5F8MA 2HRYA 3IP0A 5DM7Q 1O5JA 4ZIWA 3D6HB 5JVHQ 4DFJA 3M2UA 5DQGA 4ILMA 3AJDA 3H2VE 5BXIA 4DR7J 4C3KA 2UVRA 4OZLA 2VOOA 2KDOA 4BC9A 1JXVA 4OYBA 1NJYA 1M5HA 2V8GA 2F5GA 3MM9B 4RW4B 3R2DJ 2ZWOA 2XO7A 1X0PA 1ZYQA 1N5QA 3DOKA 1HW8A 2CQ0A 2FVPA 4ES2A 4RNMA 5L1IA 4CI0B 2YNIB 1HBOB 1XQIA 3N9UC 4USHA 2GHPA 5J1EA 2G4BA 3GIJA 5EUHA 1QSSA 2RMLA 2HS3A 2OHDA 4A8OA 1RWMB 4N41A 4X4PA 3UNYA 1UFLA 5D6GA 1YJUA 1TMJA 3VV2B 5HLFA 4KSEB 1T3NA 2BZ2A 4TQSA 3HULA 4F4XA 3MPUB 1NLKL 4MKBA 4NLTA 2C3OA 1ICEB 4P6QA 2YTCA 3AOCA 1XNQJ 4RUBA 4N76A 2QO3A 1S1VA 2XSFA 4LF6J 1M1GA 3L3CA 1TAUA 3HHEA 5IQ6A 3GFZA 3LAKA 3BBCA 2CJQA 2H65B 3D4JA 2QJ3A 3M9OB 2LYVA 5I42A 5AXLA 2HLUA 3GTYX 2AKWB 2UVWA 2J9DE 2HZCA 2A2CA 4PXEA 5DLFA 4CT8A 4NRUA 3T1YJ 3O3LA 4CNYA 3I87A 2U1AA 2C3YA 3GLJA 1RQ0A 4A46A 4ZVQB 1L3KA 1S1TB 3KK2B 1NJWA 1Y3KA 1AA1B 3HVWA 2OELA 5JUMA 2HYIB 4C8NA 4DX6A 3HFKA 4ILRA 2DNLA 2E66A 4LBPA 1RT6A 1Q82T 3SFUA 2ZHOA 1N54B 1QE1B 3D54A 1XNRF 2P2CB 3FCHA 3BH7B 5L9NA 5MLCV 1KVKA 3I82A 2LXUA 4RNOA 1AUDA 2DR6A 4ICLB 4Q0BA 2IVMA 2PMHA 2A18A 5DQIA 1JXLA 2DR9A 1JLGA 1N36J 2GQQA 4DV6J 4F7VA 3KKFA 3GE9A 3H25A 2B51A 3GG0A 1DTQB 1FRLA 1U8SA 3ZZRA 1FXLA 1ZA1B 1VCTA 1RLDA 4WTOB 3PX0A 3ZFVA 4CLFA 1RSCA 4RW8A 3EGWB 5HI7A 1HNWJ 3FJ2A 3GMGA 4OLPA 1Q78A 2YX1A 2GJIA 2IDLA 3OTOJ 1K44A 4JI6F 1NK7A 1FD2A 2KO1A 4CO4A 2VB6A 1M1KT 3ONQA 1RCOB 4HTIA 2V8DA 1T05A 4H4MA 1QTNB 3SIPB 4RBUA 2FZGB 2IM2A 5DG7A 3H5UA 2XS7A 2B6AB 1FRXA 3GYXB 2ASJA 1DBDA 1F2HA 2QLBB 3NWRA 5KFJA 4DV0F 2B4VA 3LP0A 4F4WA 4QIFA 5KOWA 4X62F 3W60A 1L3UA 4KHRA 2IM0A 4P75A 4MK8A 1SJ4P 1XBWA 3R9LA 3G2XA 4RW6B 1BMQB 1B64A 5B0FA 2IA0A 2N4DA 4UZBA 1YG0A 1FK9A 5C2GA 4ED7A 3TZXA 2W7PA 2OTLS 3RR7A 4KFBB 4NMXA 3SSSA 4UQTA 3AD7C 5F8HA 4CO2A 5L1KA 3RU0A 1IKVB 4QU6A 3K2YA 3KG1A 1R27B 2ZNYA 4K4ZA 3KLFB 1NK0A 1WTBA 3IR6B 1ZAVA 1XTZA 4K4TA 1G7CB 3G82B 1B0PA 2XSJA 1NSAA 3MM6A 1BHNA 1ZBTA 2LU2A 2E5IA 4LRAA 2A10A 5IWAJ 4J9NA 2ASLA 3OHBA 1VQSA 3MGJA 3CNQP 3H7HB 2D3O1 1BLUA 5DRKA 2FQQB 5EN1A 4IOBA 2IVYA 2BE2B 3TZZA 1RWKB 3G6XA 4OI6A 2G2YA 2XY7A 2R4FA 1IR1A 1VQ8S 3IG1A 2KHCA 1BQXA 4ZVTB 4QIGA 4DPUA 2AIRB 2D3OR 1FJ7A 1SKSA 1JLCB 3MUVP 2O5DA 1BGXT 3GP9A 3HXMA 2J7KA 2V2KA 2E5JA 1UAWA 1D9AA 5CZXA 2LQ9A 4K4YA 1IR0A 4OHYA 2F63A 1CJKA 7FD1A 1MWQA 4X2BA 4K2JA 1TL1A 3MCNA 4KGZB 1HFEL 1AB8A 4NEYA 3LO3A 3OXGA 1RT2A 5LSOA 2HZVA 3ITHB 2XHWA 3KLIB 2CZVC 3SSRA 1BQNB 1S57A 4NYZA 1RT3A 4OZJA 2Z2YB 2ZH6A 4JI5F 4C3MA 1YWXA 1NK4A 2ZC4A 4Z7CA 4OV6A 4AT1B 3M6WA 2AEJA 2JVOA 2F8HA 1LWEA 5J2PB 1TELA 2DNQA 2Y1LB 2OLWA 1Q4RA 3KJVA 3R5AA 2F40A 1VQLS 4NA1A 4KH0B 4C8ZA 2PMZD 4M5MA 3RB4A 3P8BB 4WFBQ 2UZAA 3I32A 3F41A 4ZVFA 3DRXA 4F36A 4CH0S 4HHHA 1VHIA 2ADCA 1RKIA 1HI8A 2JLFA 4ES1A 5RUBA 3PFEA 1RWXB 4C8KA 2IY5B 4PXDA 2E7VA 3V6HA 2NUUG 2DITA 3ETOA 4B3TJ 2M3DA 4CLUA 2CQ3A 4RLEA 1R8CA 2Z2LA 3PHEA 3MEEA 5KG1A 4J9VA 2OMLA 3C3LA 4FNHA 4PPZA 2FHJA 3V81B 2QL9B 2OGUA 3FK4A 1RWOB 2MEWA 2W9CA 2NZCA 5F3TA 3DLKA 3MPYA 2R7OA 4YB6A 4CRJA 4ZPWR 4PYAA 1PBAA 1Q79A 1LW0A 3UVJA 5KFRA 2QSFA 2XLKA 4OYWA 4JBCA 2LDYA 1BWEA 4O23A 3QGGA 4DSJA 3GQCA 2GAGC 2KFNA 3GSDA 3T5HA 5DGBA 1X60A 1I1GA 1VBXA 2DTJA 3EZOA 4B9UA 3P49B 1GQEA 4P74A 3RJMB 1N5VA 2QYCA 3K0JA 3S7RA 2MZQA 4J9PA 3DLGA 3NEKA 3BYPA 3OFHA 1U0HB 3PEHA 2RILA 4JI2J 2C42A 1TR0A 4PXBA 4ITSA 2FJDB 3ILJA 5J1PA 2DB1A 5C5JA 2QL5B 3ZZOA 2GMHA 1WC4A 4ZVUB 2JVRA 3EWGA 3DDKA 3ZTQA 5E0OA 1QSYA 3C46A 1RP5A 3US5A 4B9TA 2KXHA 5A76A 2WB1D 2FGCA 2GMLA 3QWUA 2DT9A 2EFGA 3MDFA 4LF4J 1X0FA 2DEIA 4ZCLA 4K4UA 3MAAB 3OLBA 4L75A 1S72S 2ZD1B 5DETA 1WELA 4DN9A 5KFEA 1YJ9S 3DRSB 2MKCA 4DR1F 2E1PA 4WXWA 1X9MA 4A8FA 2ZH2A 4QWCA 3TNVA 3VAIA 3KUEA 3BKFA 5I3UB 3KHGA 4LSLA 3Q0AA 3IR5B 2QE5A 4YMEA 2C3PA 1U8WA 1HBOA 2GS8A 1OIAA 2IDEA 2KJWA 2ZBPA 4V19J 3KDNA 3HHLB 4KT0C 5L46A 3ZTOA 1JWWA 4JYAF 1WKJA 2HBRB 3CCJS 1IJEB 1T9UA 3AQPA 3DLHA 2Y9HA 1N0UA 3UD5A 1WOPA 2Z58B 2OEKA 2VPZB 4ZVEA 4HH1A 1RAOA 1HLWA 3QFHA 1FDDA 2DGTA 4R0EA 4WZQA 1KLMB 2JNJA 4LIRA 3AD9C 2ABYA 1VQ4S 4LR9A 3C2PA 5ETSA 1XN9A 3N79A 3HPOA 1JLQB 1S0VA 1TL5A 1D3WA 3V6JA 5BR8F 3P4UB 4FKXA 1N56A 2QZ8A 3LP2A 3KWMA 4LT6A 3FBEA 4RWXA 1DAXA 1VJQA 4QWDA 3EXCX 3D1QA 1FX2A 5D3GB 1F0XA 4AFFA 2R7UA 4DL3A 4NL5A 4LF5J 3D1OA 1M0SA 5K8NA 4J9SA 1RU2A 2VU5A 1GAOA 1QE1A 2HHHF 3EYZA 1B7FA 4ZPBA 2PFDA 3G6VA 3QAEA 5I3PA 2QLXA 1HNZF 4ICLA 2XMWA 2ZWPA 4HR2A 2DNRA 2XS5A 3B82A 4F3QA 3QIPB 5KT3A 3NNAA 5K9FA 2MQ8A 4P2SA 5KG4A 1OY9A 1DTQA 1R31A 1NSQA 3BSOA 2HHWA 4H4OA 3EVMA 4QWBA 2CNNB 2OD6A 2HS4A 5CABA 1GTEA 5KFFA 4PEOA 1G3OA 5CYMB 4AUKA 2HVZA 4M5IA 3UDCA 4J9LA 1K73T 3CMQA 3CCTA 1Q5VA 2H3EB 3IBWA 3KNAA 4O4GB 1YZ6A 2O3DA 4RUCA 2B6AA 3GILA 1KFSA 5DM6Q 2M5YA 5F0WA 4M5LA 1HARA 2J6TA 1BY9A 3ENQA 2MMYA 2YVSA 4KPCA 4LR8A 4NI2B 3H2LA 1KWMA 3CDBA 3M2VB 2LVWA 4RW6A 2CQ1A 2OMOA 1W7WA 2VQEJ 4NZ7A 2Z57B 4MIBA 3J7YU 4CP5A 4YHHF 3FBCA 4AD6A 4OZ5A 3MCSA 2ZDOA 5CHCB 4N8OA 3KK1B 1VK3A 1U49A 2WK4A 3W9HA 3WQPA 3NS6A 3AT1B 1RUSA 1IKVA 3M32A 4IO1A 1X8DA 2GX8A 2K8GA 4RR5A 1YLXA 1SKRA 3OUYA 3PRVA 1QLNA 1R8AA 2I2YA 5KFPA 2DH9A 3KJQB 2KZZA 1FRKA 2OPSA 4Q43A 3IA0A 1YVFA 1FHTA 3H59A 2M88A 3K8VA 5J2MB 1L3VA 2XZTB 1Y3JA 3D2WA 3M6UA 4JUZA 3H5SA 2JLGA 4ECUA 5JXSA 1DJ0A 3O1LA 3HZGA 1OQ3A 4IRDA 3ICLA 2DNOA 2K06A 4ETZA 3LPYA 3FEXB 5CXTA 3GIKA 1WC3A 4QZVB 2HQ3A 1X4GA 2E1RA 2ALYB 2VC0A 3FUYA 3UQSA 1K47A 4MH8A 2FJAB 4PCQA 3AA9A 1SJQA 2ZH3A 1HW9A 1Q8KA 1FVQA 4A8SA 3ENVA 4I2QB 4PUOB 3PX4A 1JJHA 4M5JA 4FKYA 3JYTB 1Q53A 2FC8A 4J9QA 3BN4A 3IFEA 2Q3PA 1XIQA 3ITHA 2UXDJ 1IM6A 4JI4F 5LMUF 2GJ2A 1H72C 1HIYA 3QT7A 5IM0B 1JLAA 1PC4A 2BE7D 4XAKA 3DLEB 4ZK7M 2CJYB 3H4DA 4ECZA 2H51B 4K4XA 3EZUA 2C2EA 3MAHA 2E9TA 4DR4J 1Q8IA 3CJRA 3LALA 2FIUA 4LJMA 4WFAQ 4QIEA 4YB5A 4ZP9A 3D66A 1AROP 2IVFB 3RW6A 4KY3A 3N6NA 4X4NA 4LFCF 5IOLA 4V19X 4WCEQ 2W2QP 4Q45A 2AQ4A 2D7SA 3W2VB 2JOQA 4DR2F 4TNOA 1TUGB 4RU2A 1UVNA 2YXLA 1OJ4A 3JS9A 2LA4A 2H1YA 3CTRA 1C0TA 4J9RA 4J9KA 1NPPA 5K8PA 3TEHB 1H0HB 1M1HA 4OJ3A 5D0HA 2DH7A 4PG8A 3UO0A 2R7WA 2EEYA 3T1HJ 4OX7A 3KDOA 4F3OA 1TTHB 3EE3A 2KJVA 2J7UA 5HROB 3DKDA 2MKKA 4UY8T 5GVQA 2C2MB 2QA4S 2FVSA 5JJBA 2FJVA 2HGNA 4C8OA 5ETPA 3CVKA 3DRRB 4ED3A 4KKOB 4IH7A 5F9LA 2ZFHA 5A6PA 1WSRA 2J9CA 1S7HA 4E98A 1QM9A 5T41A 4XO0A 3LF0A 3W5ZA 3VAFA 3IN5A 2HZAA 3MAQA 5KFUA 2CJKA 2H54B 1OY6A 4AXIA 2VFRA 1DQAA 3LAMA 3ZTPA 4B3RF 4K0KF 4NXNJ 1ZPWX 5D4PA 1AXQA 3IO1A 1HHQA 3PACA 3ZZTA 3WX8A 2RS2A 2DXEA 3QFWA 4MK9A 1PCAA 2KFZA 5AT1B 3SV3A 3OXLA 3QRQA 1CBKA 3QT6A 3W64A 3BM7A 1H3DA 4RNFA 1WF1A 1L3TA 1U0HA 2O67A 2J7WA 3ET6B 8ATCB 2GJFA 3MUMP 3PW2A 4DF4A 2PIIA 3I0RB 2GQ2A 2BR0A 3FQKA 2H5EA 1CJTA 1VIXA 3G9CA 3NGSA 4ZVPB 3CD6S 2AJQA 1WG5A 3FNNA 2MGZB 4O3PA 4I64A 2JHEA 3DYAA 1S9GB 1R0BG 3TOQA 3RGIA 1Q86T 3IS9B 3MMBB 2Y8WA 4KAIA 2JJ4D 1PAUB 4K2XA 1NKCA 4WK1A 3TA2A 4WFNQ 4TU8A 2CG8A 4DBQA 3DRSA 1RYSA 5A8KA 1J5OA 1FKOA 2HFVA 2ATCB 1W25A 2ZOMA 4EZ6A 1SKUB 2QA2A 2ZDPA 4MIWA 2HGLA 3GSIA 4TY9A 4A47A 2RB7A 3BYRA 3FKBA 1MSWD 3MOZA 4OHXA 1VMBA 2ASDA 4NA2A 4LSNA 1NSPA 3V2UC 3HMJG 3HHLA 2EXUA 1M90T 2XYHB 1YBAA 1TVRB 4IYQA 4YOEA 2FD2A 1EQ0A 3OTEA 3JSYA 3G8TA 2V9WA 2CDRB 2HNDA 4DR5F 2WZ1A 3DOMB 2H5JB 2HRUA 3TJ8A 2B4PA 1GEHA 4J7CA 1D1UA 2Y0SD 4IG3A 3N6LA 5ETTA 3I9V9 2OTJS 2AP6A 4WF9Q 4CIOA 1NAQA 3D9BA 2JEIA 3PR4A 5GAEU 2MLYA 2O66A 1P9YA 3NCRA 2R42A 1TL3A 5IC4B 2LA6A 1Q8LA 2YKOA 4DV2J 2HBQB 1HNIA 2QT7A 3W8PA 2OP5A 2HVHA 1OY8A 2R3VA 3RBEA 4O4RA 3M8QB 2PA8D 3E3XA 1F9EB 4DL2A 1U6FA 3KLGB 2WVDA 3BQ0A 1FXRA 5AXMA 1Y00A 2IBOA 4U67Q 3Q8PB 3MR3A 3VQSA 3Q83A 4HKQA 1PG5B 3KHLA 3DM2B 3IWNC 4RBVA 1WI8A 3RB0A 1U7LA 3Q22A 1KOOA 5KG7A 4AQYJ 4ZJLA 1RHRB 1EQMA 1NHVA 1MMNA 3HK2A 1FFSB 3TR5A 3BBBA 2HHTA 1FI4A 1Z2ZA 3QIPA 4YQWA 2HHXA 2W8LA 5E33A 1IR2A 4LFAF 3MOJB 4ZPDA 3FMBA 3CC2S 2XNQA 4AL5A 5CAAA 3PNIA 3BPSP 1LWCB 1NHKL 5KT6A 4NXMF 1VQ7S 4JP8A 4LRCA 5CYMA 4B3MJ 4YS2A 2MDAA 2F4FA 4ZVGA 3O8WA 3BGFA 3PIPQ 2E7WA 4K59A 2UUAJ 5KG0A 4O4GA 4ZPVR 1XMOF 3VGVA 2UV8G 1C1CB 5L38A 1KHWA 3ZC4A 1JMTA 2NS1B 2YY3A 4KRWA 4LVNP 1WC1A 5ETRA 3QSIA 3UDVA 5ADZA 4NI2A 3W1YC 3HM9A 5F3ZA 4DL4A 1H73A 3I5BA 4PWWA 2RSQA 1I94F 3IM9A 3AHPA 2UXCJ 4F2SA 2G1DA 5H9EJ 4KHPF 3NNCA 2RE1A 4IDKB 4P73A 3FQLA 5B7WA 3KK1A 2FJEB 1RHKB 1HD0A 2BJ3A 2DO0A 4WP8A 4DEZA 3D1HA 4WPAA 2KT5A 3HSJA 1XR5A 1NUEA 2KG0A 3IGNA 3KHRA 1DARA 4WKYA 3GCWP 3THPA 4A8WA 2ZNZA 2EFQA 2YWEA 4CO1A 2RQKA 2Q43A 3B4DA 1MWZA 2RQ4A 4IR9A 4FBUA 1S99A 3OVSA 5C42B 2FHKA 2XGQA 2BJDA 1RAGB 5B0CA 1F9HA 2FC9A 4BDPA 1B4SA 3OW2R 4YEAA 4JI1J 2FJBB 4M63A 4NRTA 3PM9A 1X4CA 4IUFA 2BJEA 5B0BA 1N33F 2D9OA 3MM8A 1CEZA 4RW9A 2DR5A 4DQQA 3BKTA 4DV5F 1WD6A 4WJBA 2DYAA 2Q1LA 4C97A 4EU0A 2P9EA 1XMQF 4LRDA 3VGSA 2DNPA 3C6UA 3OR1B 3ELHA 4UF4A 3SQGA 3Q2SC 2Z4PA 1IBLJ 2VDIA 1VC5A 4OL8A 3EGZA 3JYTA 4PWDB 2V5HG 2QMUB 2X1GA 4XK8C 5H9EK 4OJ1A 4B17A 3P6YC 3MEGB 1FNXH 1U1MA 3CF5Q 1FNOA 3CCWA 4GMKA 2BYCA 1F3FA 1CVJA 1A6LA 1Q16B 1TMMA 1U24A 1ZA2B 5IM0A 2LKZA 3NP5A 4H54A 4LF8F 4PZVA 1REGX 3NOGA 2UU9J 3N5FA 4UOFA 3LW5C 4O3NA 1DURA 4DSFA 1KP6A 1OWXA 4NLGA 3Q8YA 4V1Ak 4ZPCA 4DR7F 2IRYA 2EKNA 3KG4A 2WHOA 2IA6A 1XEZA 3M8SA 5KFDA 1P9QC 4DS4A 4QU7A 3W2VA 4HI1A 1QAYA 1S49A 3OHAA 1KVJA 4QCLA 5LXYA 3HDSA 4TU9A 2R8HA 3E2EA 5ETNA 4NCGA 3VVTA 1QUVA 4FBTA 3KLVA 2DPIA 1NU4A 4XTTA 3TQEA 2A6OA 4GC6A 3FSIA 5CCMA 3GJRB 2VQFJ 4QPTA 2B9YA 1VQPS 3EDRB 1HBUA 4NASA 3R7SB 3BO3A 1TKZA 4QR2A 5HROA 4F4AA 2J5AA 1S12A 3T3FA 1XNQF 3OSPA 2F1FA 4LF6F 1TKDA 3BN7A 3DRRA 2WSFC 4KKOA 2NZ4A 1QD1A 5EGYA 4M95A 3CCZA 1UPMB 1S9EB 2ZH1A 3SXLA 1W2IA 2G0CA 4M8LA 2YPYA 4DV3J 4RNNA 2QA4G 3J7YI 2N4CA 4FYYB 4LR7A 1VBYA 3T1YF 3FSYA 1VRTA 3GIRA 1U48A 3FDSA 2DISA 4TYBA 4G6VB 2AYBA 2R2TA 1JB0C 1UPPA 5CYJA 2HQFA 2VOPA 4TU7A 3POTB 1P27B 5FJ4A 1AZSA 1CULB 5A0YB 5IZHA 5HJXA 3WDOA 4X4UA 1R0AA 2XM3A 2V4JB 2VFUA 1D9DA 1PO6A 1S6UA 5M2RA 3KK3B 2V2VA 2V2ZA 2AF6A 5E3CA 3D7SB 3I0RA 4ZP8A 3OVAA
chains in the Genus database with same CATH topology
4C11B 4HYKA 1S0OA 3DOLA 3MGJA 5A8RB 3GV7B 5EHHA 3HKZD 4OQJA 4B02A 1BLUA 5DRKA 4K5RA 2VFTA 2XMTA 4IH6A 2X1AA 1N6QB 4NCBA 3DI6A 1JLQA 5EN1A 1WG4A 4IOBA 2DGVA 4QWAA 1FCAA 3K5LA 2KT2A 2CPXA 2I38A 2IVYA 5HP1A 3PIOQ 2BE2B 3H98A 1RT1B 4LMZA 4X4QA 1UVIA 3RRHA 2QFJA 1IQTA 3OQ2A 4MMOA 1K1QA 3J80Y 3G6XA 2VQFF 1Y4ZB 2J6SA 4OI6A 1S9GA 2XY7A 2R4FA 1H6KX 3MPVA 1VQ8S 3IG1A 2LLZA 5GAHU 2KHCA 1BQXA 1SJ3P 2MHEA 1IQZA 3IS9A 2Q6CA 4N47A 4PG7A 5GADU 4A8MP 4QIGA 2KM8C 3MD3A 1HNWF 2D3OR 2RRAA 1FJ7A 1SKSA 1JLCB 3MUVP 2EFOA 4Y0FA 2DNHA 3JAMY 2O5DA 1BGXT 2Z2MA 3OTOF 4BWJA 3V6KA 3CC4S 3H8YA 1TP7A 4I7FB 1Z2LA 4A48A 1SL0A 3HXMA 1BQMB 1OPZA 2J7KA 2V2KA 2VG6B 3MWBA 4Y2CA 2E5JA 1UAWA 1D9AA 5CZXA 2CZ4A 2LQ9A 5D3GA 4K4YA 1IR0A 4OHYA 3OVBA 3M4XA 1YI2S 2D9PA 2JH3A 7FD1A 2EK1A 2DHGA 1YJWS 2W4CA 1RISA 2CPFA 3HJFA 3M6VA 3CE8A 1SBRA 4X2BA 4WE1B 3DRYA 1OSDA 4LQ9A 2MHNA 1TL1A 4AE5A 4YDDB 4DV1F 2VONA 2D74B 3SSQA 4OZNA 4C0BA 1HFEL 1C4AA 1YRTA 3PW7A 3LO3A 1PGZA 5KT5A 3OXGA 1RT2A 5LSOA 4DWIA 2R8JA 4CTAB 4DR6F 3FSXA 1UJ5A 5KTQA 3ITHB 2XHWA 3KLIB 1S6PB 2CZVC 4NLSA 3SSRA 1FE4A 3RZAA 1FVSA 4FZVA 5E3RA 1P6TA 2GFFA 1TKXA 5BYSA 4DV3F 1BQNB 2GO8A 4IG0A 4NYZA 4BBYA 1KFDA 4ELVA 2KN4A 4ECYA 1NK5A 3EUNA 3F44A 1RT3A 4OZJA 3DLBA 3KFWX 2ZH6A 4L6V3 4LQ3A 4JI5F 4C3MA 5K14B 2V4RA 2HLTA 2AJ4A 3IRXA 5L8RC 4G1QA 1YWXA 3OTBA 1IKYA 4QYRA 4D3GA 2MQPA 3VAKA 1NK4A 2QV6A 2ZC4A 1R8PA 3M8PA 2MZ1A 5C24A 3M6WA 5M2PA 2L41A 1RKJA 4CNZA 1RYRA 4DUZF 2HNYB 2JVOA 4RBTA 3CJ2A 4PR6A 3TVZA 2F8HA 1F5BA 1ZTTA 4ZDNA 1TK0A 2RF2A 3DOKB 1N5YA 1TV6B 1WEYA 1D8YA 1SIWB 4KBIA 1LWEA 4F4KA 5J2PB 3I56S 3GFXA 2MKJA 4OI1A 2XLIA 5I4MA 5C25A 1R89A 2DNQA 1RTJA 2HIQA 2EBEA 2N7CA 2KRBA 4WU2A 2BANB 4DQSA 4FF4A 5J1EB 4OJHA 5CH7B 5CQGA 4U6PA 2MQOA 4HLBA 3IRWP 1S1XB 2OLWA 1M5VC 1Q4RA 1SH0A 1FRJA 4PPDA 3KJVA 4OMFG 1FXDA 2MPUA 3R5AA 2F40A 1VQLS 4NA1A 4IFYB 4KE5A 2WAQD 2HHVA 1NH8A 4Y28C 3CPWR 1MW7A 3FFIA 3UD4P 1X7VA 4C8ZA 2PMZD 3E51A 3RB4A 3PEJA 1GTHA 1O51A 4WFBQ 2UZAA 5HLFB 1U45A 1K0TA 3I32A 2HHSA 2P9GA 3F41A 5IWAF 1LWFA 4ZVFA 2GHVC 3GV8B 2ZH5A 2VBXA 1HWJA 2GV1A 3DRXA 4CH0S 2IJFA 3AAWB 3MM8B 4I1TA 1KHVA 2DHSA 1JLBB 4PG5A 2ADCA 4RW9B 3L09A 1RKIA 1HI8A 3KOAA 5T7LB 3SEOA 2JLFA 2QIFA 1WHYA 4ES1A 2EC0A 2JSXA 3PFEA 2G13A 2JEGA 2CVEA 2GNKA 3U02A 2FVCA 4AL7A 4C8KA 4ED1A 5K5MA 4PXDA 3X3UA 2VPYB 3GIIA 2XULA 1JLEB 3C8YA 1X5OA 1H7WA 1X4FA 3M2VA 3PKMA 3V6HA 1WG1A 2NUUG 2DITA 2VBWA 3C6UB 4LUBA 1S9FA 3ETOA 3N4WA 3CDUA 4IOAQ 1F2GA 1SKWA 2M3DA 3SQGB 2HMIB 2CQ3A 1E6VA 4RLEA 3CD7A 2MJNA 2ZJRQ 1R8CA 1DHMA 2Z2LA 4X4VA 3UR3C 3PHEA 4I6AA 2E5GA 5I42B 1NKEA 3MEEA 3WX4A 3ULHA 3NKYA 5KG1A 1VQ5S 2W25A 2OMLA 1UJ6A 1VRUA 3C3LA 4FNHA 4YB7A 3QLHA 4PPZA 3MURP 2E5HA 2FHJA 1N48A 3CCLS 2CPHA 4DQRA 2R2RA 3MZIA 4DUYF 3OL7A 3V81B 3M30A 4ETXA 2BOPA 2J6UA 4C0OC 1TQLA 2W9CA 3DN9A 3MFIA 1R8BA 5F3TA 3TUZC 1X4EA 4RUHA 3VWSA 4LFBF 1G1XA 3DLKA 3MPYA 1U1LA 2R7OA 4YB6A 1Q81T 3DMJA 2PI4A 2RRNA 4ZPWR 4P7VA 1NRKA 2YNGB 2XGPA 1JLFB 1S97A 1Q79A 2UV8A 1LW0A 4FN5A 4WZMA 2W9BB 1HBNA 2PC6A 3MMCA 1HI0P 2CQGA 2VBYA 2I8EA 2QSFA 2SXLA 4NPOA 5KFRA 3TVYA 2XLKA 2Y1JA 2UUBF 2DGSA 1OS5A 3VZIA 4JBCA 2LDYA 3D0HE 1BWEA 4EEYA 3BGLA 4O23A 4OI4A 4WFZA 3RAXA 3QGGA 4EUVA 1VS3A 2VZ9A 4DL6A 4PG6A 2L48A 2V8HA 1YJRA 5A8WB 2FVQA 2BM1A 4MKYA 2PFFB 2R7SA 4DSJA 3GQCA 1RT6B 4DSIA 1T02A 1D9FA 3RAMA 5J2MA 2KFNA 3GSDA 1ZTWA 3WC0A 1EP4A 2B5JA 2BABA 3F56A 3ENWA 5DGBA 3T5HA 3CJ0A 1LWCA 1IXKA 5KG6A 4N77A 1FJGF 1NHUA 1KTQA 2BDPA 4YB1P 1UVJA 1I1GA 2AGOA 1VBXA 3GYNA 1RTDB 2DTJA 4EBDA 2ZBCA 3OJUA 1H98A 4IOCQ 5HO4A 4B9UA 3P49B 1GQEA 1SL1A 1G6BA 4CH7A 1N5VA 1Y5NB 2IRUA 4B3OB 2MQNA 2QYCA 3K0JA 2LXFA 3S7RA 2IFXA 1M5SA 2MZQA 3RTVA 4TKTA 3PXGa 1SV5A 2WRMA 4J9PA 3RRGA 3LP1A 4P7TA 5FD1A 3MMJA 5DLGA 2MZJA 2YKNA 3DLGA 1FKPA 3O5TB 2DGQA 3QO9A 1U1PA 2NQPA 1C1CA 2C3MA 3OFHA 4DPOA 4NCGB 2CQIA 2RILA 2DGUA 2WONB 2C42A 3PEHA 1TR0A 4PXBA 5EWGA 2ASYA 4ITSA 1R8HA 4JI7F 2FJDB 4OI0A 5KAKA 5J1PA 2DB1A 3R5BA 5C5JA 4CT9A 3UD3P 1RTIB 1WEZA 3ZZOA 2GMHA 3BF4A 2M8DB 4RX6A 3BGRB 4QW8A 1VQ9S 5GAGI 2JVRA 4I2QA 3DDKA 2NYIA 4EO8A 4PUOA 4QPXA 5E0OA 5IT9Y 2ZE2B 1QSYA 2KYXA 3C46A 1MMDA 1RP5A 3US5A 2CQCA 3QMQA 4I6WA 1HBUB 3G96A 4RW8B 4B9TA 1WHWA 1XK8A 4WFXA 5KFQA 2GIRA 2KXHA 4C7QA 4F8RA 4QR0A 3SCKE 3P3DA 2WB1D 3PO5A 1KNZA 2FGCA 2GMLA 1TKZB 1RAJA 1MROA 3QWUA 2ZOFA 2XLJA 2DT9A 2BVZA 4Q2LA 2EFGA 1TK5A 1JJ4A 3I96A 3BQ1A 3MDFA 1X0FA 2IAJA 2BRLA 4DR3F 4DS5A 4ZCLA 1S1UA 3PVXA 4C9DA 4K4UA 4PQUA 3PW5A 3J7ZT 3OLBA 4DL7A 4IDKA 1DLOA 2GO9A 1T05B 4H4MB 3GFHA 4Q7AA 4DLGA 1VQOS 4O44A 2DNGA 1DTTB 3PRDA 5LSRA 1ZETA 5IQQA 3G4SS 1QJHA 2ZUGA 1IKXB 3HP6A 1S72S 2ZD1B 5DETA 3FZBA 3BO2A 5KG3A 3AH6A 3LGNA 1WELA 4ZPTR 4DN9A 5KFEA 4B3TF 1YJ9S 1FERA 3K7RA