1LW2B

Crystal structure of t215y mutant hiv-1 reverse transcriptase in complex with 1051u91
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
422
structure length
406
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
total genus 114
structure length 406
sequence length 422
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lw2B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2B03
4R5PA 2IM2A 1JLEB 5CYQB 3N6MA 5KFVA 3RAQA 3CDWA 4IDKA 4MK8A 1NHVA 2FVCA 1RT2B 3PW4A 2IA6A 3T5LA 4NLYA 5KFCA 3KLEA 3MR6A 2W9BA 1KHVA 1CSJA 3KHGA 3E51A 3V6HA 4IQXA 4PWDB 3T1AA 3GIMA 1S1TA 3OHAA 3G6XA 4J9LA 2RDJA 4DG1A 3RAXA 4EBEA 4KO0A 5F8JA 2W8LA 3KLIA 3I0SB 4I2PA 4NLVA 2BQ3A 2VG6A 1QUVA 3H5UA 3DOLB 2IAJB 5J2NA 3JSMA 2QE5A 2OPPA 4ZVFA 4O3QA 1UWBB 1JLQA 4XPEA 4RW7A 2WONA 1QAIA 3OL8A 1RT3B 3BSOA 5L1JA 5I42B 1TL3A 3HVTA 2AU0A 1TV6A 4IG3B 3QIPB 2ILZA 5C42B 4QWBA 2HWIA 1DTQA 5KG7A 5J1EB 4J9RA 4H4OB 4ECZA 3LP2A 3KHRA 3BGRB 4B3OB 2DPIA 4QWEA 4Q8EA 3KLGA 3GV8B 1RYRA 4DL7A 4MK9A 4RW9B 4EYIB 4RW4A 5EUHA 1DTTA 1REVB 3KK1A 3CIZA 1N5YA 3RB0A 4NCGA 2WHOA 3GV5B 1DLOB 3H98A 4NLWA 2YNIA 1RYSA 3KK2A 4ID5B 3V81A 3DRSB 5EWGA 2HNDB 4ZPBA 4TY8A 1S6PA 1T05B 4MIAA 4NLQA 4NLGA 1JKHA 1LWCB 4I7FA 4O3NA 1JLAB 1LW0B 5KT6A 3IRXB 3TAMB 4WZMA 3CWJA 1HQUB 4ZVHA 5JUMA 1HQEB 3RBEA 4DL3A 4MFBA 5KFYA 3BJYA 1ZETA 5HLFA 1J5OB 1IKVA 2R2TA 1NNDA 3D5MA 1Z4UA 3M9MB 2OPQA 5C25A 3JYTB 4IRCA 3ITHA 2YNFB 4J9NA 4WFYA 4I7FB 3MFHA 2AX0A 1T05A 2BQUA 2E9RX 3DLEA 5KFRA 1K1QA 1RT5A 4RW6B 3KLFB 2CJQA 2HAIA 4J9KA 1OS5A 3IS9A 4KKOB 4KSEB 3KK2B 1IM4A 1K1SA 3CJ2A 1DLOA 5L1LA 2J6SA 2ILYA 2UVRA 1N48A 4NCGB 4XO0A 1T94A 3GYNA 3C6UB 3H5XA 1FKPA 4IFVB 2XI2A 1HMVA 1HMVB 3KLHB 3KLHA 5KFUA 2D3ZA 1FKPB 4IFVA 5KT4A 4O3RA 4WFZA 4ZVEA 4RU9A 4ECTA 4R8UB 5DGAA 2F8EX 2D3UA 1TVRB 2BANB 4ECWA 3KLFA 1RDRA 1RTIA 2OH2A 4IR1A 5DQGA 2ZD1A 4O44B 2JEGA 2IM1A 1TV6B 4IG3A 5KFIA 4EBDA 4F4WA 1JLFA 4LSNB 1TQLA 2FLLA 4TQRA 3NL0A 1QAJA 4WXWA 4QW9A 1C1BB 2YNGB 5HLFB 1J5OA 2FVPA 1SUQA 3FRZA 1S4FA 2AGPA 3T5KA 4Y34A 3V6DA 2HMIB 3NAHA 3I5AA 4R0EA 3QZ7A 3LP1B 5KFNA 2R8JA 1C2PA 4YR3A 1RT1B 1TL1A 1HQUA 3UDLA 3MEEA 2ZE2B 3IRXA 3TAMA 5C24A 5T14A 4YQWA 3OL7A 4J9PA 5HP1B 4PWDA 1HPZA 1QE1B 2VG5A 3E01B 5D3GA 3QIDA 4TLRA 3RB3A 4K50A 3MEDB 1BQNB 3DOKB 4MH8A 2JLEA 4ECVA 4ID5A 3MEDA 4Q44A 3PR4A 4IH7A 1C0TB 1RA7A 3HVAA 3PW2A 4O4GA 4K4SA 4HKQA 2XGPA 3N6NA 1RT2A 3FFIA 1T3NA 1S1WA 3G6VA 4RW4B 4G1QB 1S0OA 5KFDA 5DG8A 1KLMA 3MEEB 4IKAA 4O4RA 3HKWA 4F50A 4EBCA 1RT1A 1S1XA 4DL5A 4ZMMA 2AGOA 2XCAA 2R2RA 3LP2B 2BRKA 5F8IA 1SUQB 4TQSA 1WNEA 1DTQB 2GIRA 2B5JA 4NLRA 1IKYB 2HNYA 3GILA 3Q8SB 5L9XA 2EC0A 4RNOA 2WONB 2FJVA 1SH2A 2WB4A 5KFZA 5KG3A 4RNMA 1JLQB 5KFLA 2OPPB 1JLBA 1JLBB 1HNVB 1HNVA 4PQUB 4Y2AA 2WTFA 4ED8A 5F9LA 4NLSA 5EDWA 2YKNB 5KFGA 3BQ0A 1JXLA 1RTDB 1XR5A 1VRTB 1HYSA 2V0NA 3MTKA 5KFXA 3BREA 3KLIB 4ED2A 5KFEA 4EEYA 3PW0A 1S1WB 1TKZA 3FSIA 2AWZA 2HNYB 4X2BA 5J2QB 1IKYA 1N4LA 5CYMB 4Q0BA 5KFAA 4ZHRB 5J2MB 3MR2A 2W9BB 1D1UA 1RT6A 1LW2B 1KLMB 1RT7A 4ED7A 1T03B 2BQRA 1W25A 4WYWA 4IDKB 1RT7B 3ITHB 3NAIA 3UPFA 5KFFA 2OPQB 3GIJA 1C0TA 3DYAA 3LP1A 4QWCA 3V6DB 1MMLA 4K4XA 3DM2A 4M95A 3OL6A 1HNIA 4IRKA 1HARA 3MECB 1IKXA 2OPSB 1S10A 1NHUA 3ICLA 3IGNA 1YVFA 3H5YA 4QWDA 5C24B 4TYBA 1RTDA 4ZPAA 4TY8B 2WRMA 3M8QA 3T19A 2AQ4A 3V81B 2BANA 2BE2B 2FVSA 4PUOB 4LQ9A 5KFMA 4R8UA 3I0RB 3KOAA 1RAJA 1DTTB 3QLHB 2D41A 2JC0A 4ZP6A 5KG4A 4URGA 5EWFA 3M8PB 5FDLA 3H4BA 5DG7A 4WE1A 3MFIA 4O44A 4Y3CA 3PJXA 4RNNA 2B5JB 5KFBA 2W8KA 3QYYA 4NLOA 2I1RA 1LWEA 5J1EA 3FQLA 3IG1A 1JLGA 1R0AA 5KT3A 4RUAA 2J6TA 5I3UA 3KMQA 4G1QA 3QLHA 3FFIB 1RT3A 3KHHA 3TVKA 2YKMA 4O4GB 4RW7B 3DDKA 3PJWA 1UWBA 5F8NA 2RF2B 4DEZA 2RDIA 4MIBA 1FK9B 4K4WA 4MFBB 1HQEA 4WZQA 4NLXA 4EO6A 1QE1A 1HPZB 2VG5B 2VG6B 3M9OB 3T5HA 1JLCA 2XGQA 4RUCA 1JKHB 1LWCA 2GC8A 5KFSA 5KFQA 4JV2A 3RB4A 3MECA 1S6PB 1HNIB 3DM2B 4IR9A 3H2LA 3FQKA 2E9TA 3LAMA 3FDSA 2YNIB 2RF2A 5KFTA 2FVRA 1SH3A 4IH5A 3M9NB 1RTJB 1N5YB 1D0EA 3PW7A 3H5SA 4IFYB 1REVA 2C2RA 5DG9A 5DGBA 2BRLA 4IG0A 2C2DA 5F8HA 5I3UB 1FKOA 4KFBB 3BR9A 4FBUA 3CJ3A 4NLUA 5F8LA 4MKBA 4ZVGA 2FJXA 3CDEA 4ECRA 4YR0A 4J9QA 1TVRA 3SI8A 4Q0BB 2V4RA 1JX4A 2JC1A 3MF5A 4WE1B 3PVXA 4RW8A 3M8PA 5FDLB 5I42A 2AX1A 3BQ2A 5F8GA 1RTHB 1VRTA 1HYSB 3LP0A 2YKNA 4Q8FA 3KLGB 2BE2A 3BGRA 4B3OA 3DOLA 4ZPCA 3M8QB 2RKIA 5L1KA 5KFOA 4KHMA 3Q8RB 1XR7A 2JEFA 3CJ0A 4WXOA 3VQSA 2UUTA 3KMSA 1S1UB 3MR3A 4FS1A 2V9WA 4G3IA 4OL8A 1S0MA 1N56A 5KFHA 1S1TB 3IN5A 1IKXB 2OPSA 3QO9A 4YP3A 3BQ1A 2IJNA 1IKVB 3V4IA 3RB6A 5KG0A 2JEIA 1S6QA 4NRTA 3HHKA 3DRPA 2ASLA 2WCXA 4ED6A 1EETB 3I0SA 2VG7A 3DLKA 4WFXA 3MEGA 3ISND 3PZPA 1LW2A 3QGIA 1RT6B 4YMEA 4NLPA 3RBDA 1TKTA 4NLTA 2FJWA 1RA6A 4ZHRA 5J2MA 1TP7A 1S0NA 2DPJA 1BQNA 3DOKA 2I5JA 4H4MA 3KHLA 4RZRA 3PW5A 3E01A 5D3GB 1S9GB 5HP1A 5F9NA 2WOMA 3LALA 1TKZB 3DI6B 3NKYA 2W9CA 3TQ1A 4TY9A 4ECQA 2R8KA 2ZE2A 1EETA 1TL1B 1VRUB 4KV8B 3V6JA 2JEJA 4K4UA 3BSAA 2HMIA 4PQUA 5DLFA 1S9EB 3DLGB 1EP4A 3DYAB 3V4IB 2FVQA 4GC6A 1ZTTA 5KG2A 4U6PA 4Q43A 3CO9A 3QO9B 1LWFB 1TL3B 3HVTB 3OSNA 3H40A 1JLFB 4LSNA 1N6QB 1N6QA 4ZP7A 3H4DA 4J9MA 1I6JA 1LWFA 1MU2B 2BR0A 4ECUA 4I2QB 1U09A 2W7OA 3C6TB 1RTIB 3PHEA 2RKIB 5J2NB 2IAJA 4DL2A 4F4YA 5DQIA 4HYKA 2HWHA 2C28A 2J6UA 3OLAA 3GIKA 1S1XB 1VRUA 4KV8A 4TN2A 2W7PA 1GX6A 3NBPA 4DL4A 4Y2CA 4MKAA 3CJ5A 3CVKA 3DI6A 5KFWA 2IBKA 3C6UA 2W9AA 3EPIA 4DL6A 1SV5A 4ED3A 3OSPA 2R2UA 2I5JB 4H4MB 2B6AB 3MR5A 5L1IA 4U7CA 4ECXA 4FBTA 1IKWA 2E9ZA 4JUZA 2IMWP 3DLEB 5EWEA 1KHWA 3DMJA 3DLKB 2VG7B 4NRUA 2OPRB 4IFYA 2GIQA 4FS2A 3NMAA 3IGVA 5C25B 1RTJA 3GV7B 4KBIA 4YR2A 1JLEA 4QWAA 1SH0A 3CJ4A 4EO8A 1S6QB 2V4QA 4IOBA 3UQSA 5HBMA 3OL9A 1C1BA 2YNGA 3LANA 3G86A 5HROB 3KK3A 3OHBA 5KG6A 1S9FA 1ZTWA 1JLAA 1LW0A 4K4ZA 4QPXA 5KFPA 1S1UA 3DRRA 5K14A 3T5JA 3DMJB 1BQMB 2ZD1B 4M94A 2R8GA 4LSLB 2HNZB 3KJVB 4O3OA 4O3PA 1FK9A 5KT5A 2XC9A 1C1CB 2UVWA 3GIIA 3CDUA 4ZP9A 3LP0B 3QGGA 4URSA 1SV5B 1C0UB 2YNHA 1S49A 1TKXB 4EYHB 3SFUA 5F8MA 2ATLA 4ZPDA 3I5BA 5J2PA 1TKXA 4RW9A 5KFKA 5KT7A 2ALZA 2FLNA 4O3SA 4TXSA 2C2EA 2ZKUA 4J9OA 4NZ0A 4KKOA 3IS9B 2C22A 1RT5B 4RW6A 4KE5A 2XWYA 4LSLA 5C42A 4IH6A 1BQMA 2ASJA 3QIPA 1FKOB 2IC3A 1S1VB 4KFBA 3QGHA 4RNHA 4IG0B 2UVUA 4URQU 3H59A 4GC7A 4F4ZA 2YNFA 2YNHB 1C0UA 4RNFA 3JYTA 3EZUA 4KB7A 3I0RA 3BSNA 5HBMB 4KHRA 3JSMB 4PUOA 4ED1A 3DLGA 4QW8A 2UUWA 2XI3A 3LAKA 4JV1A 2R2SA 3KLVA 3DRRB 5K14B 2R8IA 2OPRA 4KO0B 3HVWA 5KFJA 3PR5B 4IRDA 4KAIA 4DG1B 1JLCB 3EPGA 2WOMB 2W9CB 2FLPA 3KK3B 1S9GA 5HROA 4K4TA 1S97A 2IM3A 2CKWA 2HNDA 3QZ8A 3NGDA 3DRSA 2AGQA 4F4XA 2VA3A 4XPCA 1TKTB 3KLEB 2D7SA 3Q8QB 4WYLA 3I5CA 2QV6A 2YKMB 1S48A 3MEGB 2B43A 3KK1B 1XR6A 1T03A 4ECYA 3NBPB 1S1VA 2IC3B 3GQCA 5CYQA 1JLGB 3IG1B 1R0AB 3N6LA 3DRPB 4R5PB 4ECSA 1LWEB 2WK4A 1IKWB 4H54A 5C5JA 2VA2A 4H4OA 3ISNC 2B6AA 2O5DA 3C6TA 4ZP8A 5CYMA 3OLBA 5J2QA 2XCPA 4I2QA 4TYAA 3UR0A 5J2PB 4ICLB 3SFGA 3G6YA 3D28A 4LQ3A 4ED0A 5KT2A 1GX5A 3KNAA 1RT4B 1JIHA 2IJFA 1C1CA 5KG1A 1EP4B 5DQHA 2HNZA 3KJVA 4J9SA 1RT4A 3Q8PB 2ASDA 1RTHA 4NYZA 4I2PB 3BSCA 1MU2A 4K4VA 5JXSA 4JV0A 2IM0A 4ICLA 4MK7A 4NLDA 4RW8B 5DLGA 2UVVA 5KG5A 4Q45A 2R8HA 4K4YA 3V6KA 1S9EA
chains in the Genus database with same CATH superfamily
2G1HA 1TL5A 2IM2A 4F3QA 1YI2S 3G8TA 3TVZA 2V6AA 2RU9A 3Q8UA 1WELA 3CDWA 2ZNZA 1YJRA 2BV3A 3Q2TC 3QMQA 1XWLA 9RUBA 4ZPWR 4RKUC 3TNVA 3T5LA 1VK3A 3KLEA 1WG1A 2RD5C 3R27A 3ZNUA 3U7JA 5KTQA 1GNKA 2GQ2A 1XMOJ 2DNQA 1CSJA 2XSJA 3V6HA 1DRZA 2GAHC 5A2QY 2GHPA 1S7IA 1RSCA 1R43A 2Z2LA 3W8PA 4J9LA 5J1NA 2AJ2A 1RABB 2HBQB 2L08A 2VPXB 4DCPB 4ZIWA 1NPKA 2BXJA 3KUHA 4PXEA 3SDEB 4OYZA 1YZ6A 4X4QA 5B08A 4LF5J 2CA9A 3PG9A 2P8IA 2Q43A 2QE5A 4UF4A 3T1HF 1UWBB 1REGX 2XEXA 4C6AA 1B0VA 2ZH4A 4N5SA 1HNZF 3D67A 3DKDA 3BSOA 4LFAF 1U4BA 3PDNA 2M70A 2UP1A 3HVTA 3Q23A 1V6HA 2GGPA 4IG3B 3OJSA 1CLFA 2VBZA 1OWXA 2MLYA 1URRA 2LU2A 3DLJA 4OLOA 5C42B 5KG7A 3ELHA 1EZZB 4DCOB 4Y2KA 3BGRB 4B3OB 1U2RA 5LL6d 4C11B 5L9NA 3GV8B 4MKVA 4DR7F 4DR5F 1RYRA 4DL7A 2E1AA 4FYYB 2W2OP 2CQIA 4GKKF 4BDPA 3J81U 4P73A 2E5LJ 1U6BA 3EM1A 2ZHOA 3NXZA 1VHFA 4NI2A 1DLOB 2CPZA 3X3UA 2YNIA 1HBMA 3NS7B 3CCES 4ID5B 3V81A 2B9WA 3MUMP 4J37A 2HHHJ 1D8ZA 2XMKA 2HNDB 1FXDA 3ILIA 3OTEA 2HRYA 4TY8A 4QIGA 2UUAJ 3K5OA 4NLQA 1V9OA 1JKHA 2KYZA 4G6VB 3W9JA 1JLAB 1LW0B 3R6GB 5IT4A 1YIJS 2MKHA 3CWJA 4ZVHA 3QT8A 4DPYA 2KN4A 1HNXJ 4Z37A 3ZC4A 1YJNS 4QCLA 1RAHB 1YJ9S 2W4PA 1P9QC 3C16B 4FN5A 1TUVA 2J9EA 3TYTA 5A2QU 4F4KA 3M9MB 4HVZA 3UO0A 4B08A 2ZJPQ 2IRYA 3AAWB 1UVKA 3EDRB 3JYTB 1UJ6A 2CRLA 2ZEJA 1TTHB 4KYZA 2YNFB 1S6OA 3UR3C 3W65A 5GADU 3TAQA 3JAMU 4I7FB 2AJ4A 2XMMA 3FGVA 3T9ZA 4CO5A 4DOZA 4LT6A 4N77A 5A8KB 3W3SA 3JSYA 3DLEA 1E6YA 2CVIA 2LLZA 2ROPA 4ED5A 1LNQA 2XMVA 2DVIA 2CJQA 3CJ2A 1K1SA 5AE2A 1FVQA 3C3LA 2UVRA 1DLOA 2BKNA 5L1LA 5DETA 2BABA 2J9CA 4XO0A 1T94A 1Y00A 3CT9A 1XMQF 1XQIA 3DHXA 1S57A 2DKOB 1HMVB 4IFVA 3TRGA 3IBCB 3DXSX 3HF5A 2ZOMA 2OTLS 3IM9A 4R8UB 3DGPB 4A4JA 2KFZA 2BANB 4X4VA 4C9DA 2J7WA 2CDRB 2OH2A 2IDEA 3FBFA 3RRHA 2CAJA 4IG3A 3HPOA 5H9FK 5F3ZA 3EZ5A 2DR8A 3GG1A 2QMXA 2L48A 5I3PA 4DQRA 2JDJA 2AIRB 1SL1A 4TQRA 3TEGA 1OPIA 2OEJA 1Q81T 2ZOGA 3BN7A 3JB9k 4CQ1A 4DV4J 1N36F 5HLFB 2Y8YA 1SUQA 2FZCB 4JI4F 1RI7A 4GMKA 4R0EA 3NAHA 3I5AA 4OI3A 2FJEB 4QYZK 1C2PA 4GRSA 4BWMA 4YR3A 2HQIA 3ET6B 3MEEA 5HJYA 4ZS6A 2HZVA 3D1QA 4LJMA 3FVYA 5U47A 2EXUA 2HEKA 3FCHA 3ZZTA 1H72C 4PXCA 4WKRA 1T0TV 2IRUA 3RB3A 1VJQA 3DOKB 4GVLA 4Q44A 4DFMA 4QYRA 1C0TB 1VFJA 1XJWB 4HLBA 2MQLA 3CCZA 3N6NA 4RW4B 1HL6A 2C3OA 2C2OB 5L46A 2WVCA 3BKTA 1KLMA 5KFDA 5HK4A 1RT1A 4GKJJ 1U6ZA 2QLWA 1SIWB 5DDOC 2C3PA 3LP2B 2BRKA 2G9OA 2ZDPA 3ZTPA 2QFJA 1HI0P 4DQIA 2VONA 4DX5A 4NLRA 2MGZA 4LF8F 4MKYA 3CGIA 2HNYA 1VRQC 4ALZA 4DV1F 2ZH7A 3AH6A 3G96A 2WB1D 3CNQP 3Q8SB 3G4SS 2VBYA 3ZTOA 4RNOA 2A10A 2WONB 2WB4A 2ZOFA 5KFZA 1VQPS 1S12A 4DSKA 1JLQB 1RJJA 3FEYB 2OGUA 4OHXA 2V2VA 3MUTP 3D2WA 1JLBA 1JLBB 1HNVB 1HNVA 2CJKA 2FC8A 4B3SJ 2GJIA 1PCAA 5GAHI 1UWAA 2CYYA 1HYSA 2DGQA 4WIQA 5H9EJ 1R6VA 3KLIB 1GTHA 4JI2J 5AXNA 5KFEA 1S1WB 1TKZA 3MM8B 2QSWA 4N56A 1PJ6A 4Q0BA 2KVIA 4HACA 3CJRA 4K2XA 1J2VA 3GMGA 3UDEA 4CLSA 3PW4A 1S72S 2GVZB 4KC5A 3BGLA 3BPSP 1UVNA 4GVBB 1LFPA 3N79A 4P2MA 1WF0A 3BS9A 3H2UB 4NA1A 4C2MA 4Q5VA 4DV3F 4OX8A 3LO3A 1NK0A 3S01A 1Y5NB 3NEKA 1U48A 4QIFA 1MMLA 3IAM9 4LIWA 1HNIA 4UUWA 4CLUA 3OL6A 2GAGC 3I87A 4DV6J 3MECB 4DZ6A 1S10A 3G8QA 2X1BA 4M8LA 2WW4A 1NHUA 1U1RA 3JXOA 3OFEA 1N34F 5C24B 2DJWA 5B0FA 3NLCA 3LF0A 2MLXA 1RTDA 1FJEB 4C8LA 4F0HA 5C7PA 4WCEQ 2WRMA 1DAXA 2HGLA 2L9WA 5HI7A 2BANA 4S0MA 2FVSA 3NS5A 4L74A 5DDRC 2QYCA 1TL4A 1BUXA 2Y0SD 4R8UA 3TVYA 3G9CA 3RUBL 3KJQB 2MKYA 3OBIA 3OR2B 2NUUG 2KRBA 4OYPA 4V1Ak 3U27A 5IQ6A 3MCSA 4RU2A 5EWFA 2QX0A 1F0XA 2RQ4A 5KG4A 4OX9J 2DRDA 3ULHA 4BBYA 3OFGA 4WKYA 1SJ1A 1S6UA 4RNNA 1SQGA 3N5FA 2LP4A 3PJXA 2B5JB 1SPBP 4A8OA 2FZGB 3BO4A 2NYHA 1UCNA 2ROEA 5J1EA 4V19J 5KT3A 4RUAA 4JI4J 3M1VB 1K44A 1F5AA 4BC7A 2HBRB 1AB8A 2DISA 1SKSA 2BE7D 3WX4A 3J7ZT 3KMQA 3QLHA 4OJ3A 3FFIB 1RT3A 3KHHA 4WBFA 3TVKA 1X8DA 4DR6J 4C98A 1SKRA 1FD2A 5F8NA 1IR1A 2RMLA 1WC6A 4A8YA 4FXVA 2GCFA 3C16A 2VQFJ 4OX7A 4RL1A 1HQEA 4WZQA 1QE1A 1D09B 2MHEA 1U2CA 4L72B 3ZZUA 2MZSA 4M5GA 5A8KA 2XGQA 2LQBA 3UD3P 2GC8A 2GV1A 2GO8A 3EVOA 1FFGB 3KKFA 2ACYA 4USWA 5AJ3J 1U1NA 1M90T 4IR9A 3LAMA 4KQZA 2YNIB 2CWKA 4IH5A 1SH3A 2DO4A 3BR8A 4NI2B 1V3SA 1RTJB 2GMHA 5B0BA 2C2MB 4ZLNA 3MPDA 4YY3J 4IFYB 3BGOP 4A8MP 4F02A 1FERA 3OJUA 3GU0A 3IBWA 4NZ6A 2YTCA 3GR0A 3O8WA 4IG0A 4DV0J 2MZQA 3BR9A 4NASA 1SC6A 2X3DA 3RAMA 4Z7CA 1Y9OA 3MZIA 5ITHA 5F8LA 2EVZA 5HQLA 3JTNA 3N01A 4ECRA 1TVRA 2H5EA 4M5LA 2O66A 1FJ7A 2CQ2A 2ZDOA 2Z2YB 5LSLA 4WE1B 1VK8A 4LFBF 2OO4A 1QUPA 4PG8A 5I42A 3DCAA 2JVRA 3JQJA 3BQ2A 1RWXB 2PA8D 1V3RA 2DHSA 4U8YA 3UD4P 4L73A 1NDLA 1RCOB 4LREA 1HFEL 4ZPCA 2QN6B 1VIXA 1ZAWA 3AQPA 2HHHF 3Q8RB 4KHMA 1R27B 1Q16B 2JEFA 1H6KX 3G6ES 2YKAA 5D0RA 3UVJA 1U1QA 2B4VA 1NK6A 3BYPA 3AQOA 1W2BR 1Q53A 4G3IA 4OL8A 1S0MA 2UXDF 1U2FA 2AYEA 4RUBA 1S1TB 2D3OR 1FRKA 4YP3A 3QO9A 2B7CB 2IY5B 1IKVB 1JQGA 2W01A 4L76A 3CDAA 1S6QA 3HHKA 4OFZA 1WEXA 1T3OA 4DR7J 2WCXA 5BYSA 2VQEJ 4ED6A 2VV5A 4P9SA 4DWIA 1X9WA 3AXKA 2VFTA 3A8IA 1T9TA 1GAOA 4FYVB 4DUYF 1ULRA 5HMXA 3AFGA 4C4WA 2MKSA 3PZPA 2HAFA 2K7JA 5IT0A 1HBOA 4NOHA 1KONA 1YBTA 3O5TB 2H51B 3U1MA 1RKJA 5L38A 2FJWA 2FYXA 4ZHRA 1FX2A 1HBNA 1TP7A 2IDLA 1ZOTA 1BQNA 4M5HA 3PEHA 4CLZA 3PKYA 4RZRA 3PW5A 3E01A 2ZBCA 3BH6B 2Z2ZA 4P6QA 4RBUA 5HP1A 2IPOB 3A8EA 1N8RT 2ZBRA 4OZJA 1TFWA 2PT0A 3Q24A 2ZE2A 1EETA 3OW2R 4QYZJ 3M6XA 1FO1A 1VRUB 1G3OA 1Z1ZA 1RHMB 5EX0A 4ZJQA 3V6JA 3SCLE 3MM5B 2G1DA 2FVQA 1ZTTA 3VGSA 2CPEA 2GO9A 1EARA 5G0RA 4TNOA 4DV1J 1TL3B 3OSNA 4DPUA 4LSNA 3MDFA 3H4DA 4CNYA 4J9MA 3R97A 2E1RA 2AEMA 1MU2B 1HI8A 4OZLA 2F5GA 3HT0A 2MGZB 2Z56B 3NWRA 2GFFA 3AJ2A 2E44A 4WP8A 2RKIB 4LVNP 2IAJA 4OYWA 5HQ8A 1BMQB 2M88A 2VFSA 3HHDA 3PXGa 4F4YA 1VQOS 3BPDA 2Q3PA 5IV4A 2AYGA 2J6UA 3NS6A 1VRUA 1G7CB 4NYOA 1P27B 1F6TA 2DBBA 3G82B 3LUYA 4PCQA 1GX6A 5BYQA 3T6JA 3KDNA 5GAHU 4Y2CA 2BUNA 2PC6A 4NX9A 3CJ5A 3M6WA 2WW8A 5IOLA 2N3LA 2W9AA 3EPIA 3QPIA 4DL6A 1FJCA 3VGUA 1VC5A 5B7WA 2I5JB 4H4MB 4X4TA 3MR5A 2WSCC 3HFVA 5LMNJ 3W64A 4DR1F 1JJHA 4JUZA 4ECXA 2QT7A 2ZZMA 1WD6A 4HI2A 4A47A 3D6HB 3WBZA 1KHWA 2IVYA 5HN0A 3DMJA 4A8XA 5EWEA 4DV5F 2HS3A 3C46A 3HK2A 3CEDA 4FNIA 1RZMA 3CIMA 5BR8F 3R1LA 1OY9A 2XZWA 1S99A 3AOAA 4FS2A 1NM2A 3P5BP 1T8EA 3IGVA 2Q1LA 3MHYA 2AT1B 2F4VF 4C8YA 3A13A 3KTQA 4EO8A 5F3TA 3WX8A 1S6QB 2J5AA 4ZDNA 2MZJA 1VLYA 1D9AA 3R7NB 4B3RJ 1WHYA 3LANA 3W2WB 2YXLA 3M8YA 3TA0A 3VWSA 1JJ4A 3MMAA 1HWJA 2Y8WA 4QPXA 2DIVA 3DRRA 3AB2B 3DMJB 2DIUA 2ZD1B 1X4EA 4L6V3 2C2NA 1FDBA 3GIIA 2GVDB 3QWUA 2GJFA 4ZP9A 3LP0B 2FTRA 5ETOA 3JTPA 4QOTA 3UFCX 1VOMA 2OELA 3JQKA 1QD1A 2ATLA 4ZPDA 2DHAA 3MOZA 1LFWA 5KFKA 2FLNA 3HSZA 4O3SA 1NUEA 1FJGF 2C2EA 2DD8S 4M63A 4J9OA 1U1LA 3K8WA 3IS9B 3POTB 5FLXY 2FQQB 2X51A 2CJAA 4CRJA 4LSLA 4JOUA 3K0JA 1F5CA 5KAKA 4XDDA 4C3MA 2P9EA 2YNFA 2YNHB 1C0UA 4PYDA 3KG1A 2PI4A 4U67Q 2MSTA 2V8DA 3LW5C 2AJFE 3W5YA 3BSNA 5HBMB 4KHRA 2ZWOA 1U8SA 1VBXA 2EG1A 3EICA 2L9NA 3PRVA 4JBCA 3K8VA 2DT9A 1X5PA 2Q6CA 2FC9A 3IC1A 1Q1KA 2FB0A 3G87A 4KO0B 3HVWA 2MDAA 4KAIA 4DG1B 1IR2A 1FESA 2GW8A 2WOMB 3H0PA 3PYEA 4ZLLA 1M5VC 3WC0A 4ELTA 1E6VB 4CO0A 2M2BA 3UNYA 2YKPA 2JFKA 4OI2A 4KH0B 4Y65A 5DGBA 1Q7LB 2VA3A 3A3OB 4QQBA 1TKTB 4DSFA 3NP5A 4BS2A 2QV6A 2YKMB 1WDTA 4KGMA 3SIPB 5E0OA 5IS2A 5D8HB 2W2NP 4P2FA 2V2ZA 1T03A 3A8JA 5D0HA 4D3GA 5D4OA 2LCWA 1YBAA 2FHJD 1HBUB 3MM6B 3N6LA 4LF6J 4LF9J 1Q5VA 3D9BA 4C11A 4UZBA 2HHSA 5THWA 2B6AA 4RWWA 3C6TA 4ZP8A 5CYMA 1MLAA 3J81j 1ZM4A 2DNNA 2MTLA 4I2QA 3HKZD 2XCPA 4DUZF 2VD3A 4DFPA 4ICLB 1HHSA 3EGVA 3G6YA 4YB5A 4K7QA 2IVFB 3B6BA 2NS1B 3NNCA 5SZTA 2CQGA 5K9FA 3VAJA 2IJFA 1MMNA 3R1HA 3KJVA 1MWYA 1RT4A 2CQ4A 1MWQA 3MPVA 3ZZYA 4DS5A 3FCWA 4NYZA 2VIHA 3CE8A 4I6AA 4AL7A 4CH7A 4I69A 2LEPA 1FJGJ 4JV0A 2IM0A 2B7BB 4NLDA 2HVHA 3PYGA 3CXCR 2KT3A 1R8BA 2UU9F 2UVVA 4OI0A 2XSJB 5KG5A 4K4YA 2CPJA 4F2RA 4FF2A 3DYAA 2D9PA 2C3UA 1RHUB 4R5PA 2KL8A 2D9OA 4P2XA 3UWTA 1FE0A 3MM6A 1HBUA 2A3JA 4C3KA 3EE3A 4LFCJ 1TFYA 3QJJA 3RAQA 3GJSB 2HG4A 2P6SA 4IDKA 4L75A 4OYXA 2BW2A 3GYXB 1NHVA 3F44A 4RLEA 1ZA2B 2B0GA 2DGWA 2EEYA 1NZAA 2XG8A 1YX2A 1OQ3A 2HGNA 2PA3A 3MM7B 4ZVQB 4NLYA 5L8RC 2M7SA 3CD0A 1L3KA 2ZH3A 1N32J 1VQ6S 2W9BA 1MWZA 2QGFB 2BBEA 3H8YA 1KD1T 1RWOB 2XO6A 4AL5A 2GX8A 5H9FJ 3N0VA 3T1AA 1SQFA 3O2IA 5BXIA 3M8RA 3PX4A 3M32B 3HXMA 2RDJA 1GXLA 2PMZD 5F8JA 3KLIA 2LA4A 4I2PA 4U9RA 3RBXA 1VBYA 1GEHA 1EX8A 2HQDA 2QYGA 3H5UA 4YDDB 4DS4A 2BM1A 2IAJB 3IWXA 1RADB 4O0NA 4QU7A 3QFWA 2OPPA 2IYGA 5E3QA 4ZVFA 5JJBA 1JLQA 2VKRA 1NKEA 2CNOB 2WONA 1T95A 1KR4A 1RT3B 2KJWA 4ZOSA 2HGMA 5LSOA 1OSDA 3V2UC 1OYEA 5AXMA 1F9EB 3AJ1A 3QNWB 4DL0C 4ED4A 2KZMA 5LMUF 3A8KA 3UN3A 2MQ8A 1DTQA 4H4OB 2F65A 3LP2A 1DQAA 2B9XA 2MKIA 2DR9A 3HFZB 3TA2A 3KLGA 4ZCLA 4LBPA 4UQTA 4MK9A 1WEYA 4JI5J 1T11A 3TW0A 4I4BA 5K8NA 2I0XA 4RW4A 2V2KA 3GJQB 2IIHA 1REVB 4N47A 3K59A 4EYIB 1VQLS 4EUVA 4I56A 1N5YA 1KLNA 4NCGA 2DTJA 2NQPA 2W7AA 4LRDA 8AT1B 3H98A 3I55S 1TK5A 3IP0A 2EFVA 2K3IA 3DRSB 2RRNA 1UEVA 4AUKA 1D9DA 4OZNA 1A0OB 2QL5B 1FNOA 2CJXB 2XWXA 3BO2A 2MKCA 3MWBA 1QSSA 2K2PA 3C19A 3C15B 4JP8A 1IWAA 4DFJA 2B56A 2XYHB 2D3O1 2L3MA 2ZH2A 1DQ8A 1NSPA 3K17A 2EFOA 4HT7A 4DL3A 3RBEA 1TK0A 3TJAA 1QVFR 5HLFA 5IZHA 1IKVA 4X65F 1URNA 1PAUB 1OY6A 2DNYA 2OPQA 1WKJA 2PEBA 3A12A 4NCAA 5ETRA 3QRPA 3ITHA 4J91A 3AY0A 4J9NA 1I94J 3D1HA 4LRBA 4C48A 3N5BA 4JYAF 2OTJS 3W5ZA 3D0HE 1BC6A 2AYBA 1PKUA 5BYRA 2DGOA 3RRGA 1K1QA 4B9LA 4RW6B 2HIYA 4ECZA 4E98A 4KKOB 3KK2B 2CQ0A 1Y3JA 4B3MJ 2QC3A 2VODA 1BHNA 4Y6IA 3FMBA 3BB5A 3L7UA 4NCGB 3GYNA 1FCAA 4NA3A 1U1MA 1UA1A 1NJWA 4M5DB 2AEJA 1ZZFA 2XI2A 1HMVA 3KLHB 3GFZA 3HJFA 3RTVA 5KT4A 2COLA 4QIVA 3PO5A 3EYZA 3FKBA 4RU9A 1TUGB 3RJMB 4PYAA 3HM9A 4K0KF 1T02A 1XMBA 1UP1A 2F8EX 1AA1B 2RVJA 4WPAA 1RDRA 2I6WA 3ZO7A 1B70B 2JHEA 3W2VB 2EFQA 2R7OA 4PG7A 3HDSA 3CJKA 4IR1A 4DPXA 1NB7A 2IM1A 5KFIA 1VBKA 2UU9J 1O5JA 2J0QD 4LSNB 3M8SA 3N9UC 1WOSA 4J9VA 2PGCA 3NL0A 4WXWA 3LH2S 1ZM2A 5CXTA 1S4FA 5B0CA 1FRIA 4Y34A 4KGVB 5B0EA 3X1LB 4LMZA 1UZHA 1KWMA 2KU7A 1RT1B 1TL1A 1XC9A 1HQUA 2YPZA 2Q79A 3C2PA 2ZE2B 1NSKL 2CQPA 2MZTA 2PE8A 4K5RA 5T14A 2CPXA 2KJVA 3SMZA 3WQPA 3V5RA 1UTAA 3D7SB 4ANDA 3OL7A 1PG5B 1YRUA 3CF5Q 4J9PA 2V4JB 3QSIA 4PWDA 1HPZA 1QE1B 3E01B 2V69A 4MH8A 1IBKJ 3ENWA 2JLEA 2C3MA 2Z57B 2FDNA 1ZYQA 3Q86A 5D4LA 4U7UD 5GADI 2ZUAA 1RA7A 1S5ZA 1NZ8A 2LFVA 2XZTB 2XMAA 3MM7A 1HD1A 3DU6A 3FFIA 4AQYF 3VGTA 3R3TA 4F36A 4YUDA 2XLIA 4O4RA 1UW4A 1GMWA 2U1AA 1S1XA 1BY9A 2XMUA 4ZMMA 2XCAA 4DR2J 4TQSA 1WNEA 2B5JA 1YITS 2F7VA 2F4VJ 4C97A 1RWUA 3FBCA 1IKYB 1Q95G 3B54A 4ZLPA 1U0SA 4I1TA 2BDPA 2OEMA 2I8EA 5LXYA 2GZOA 4Z2XA 2JZ5A 2DCUB 5ADZA 1SH2A 2AW0A 2K3KA 3OR2A 4OQJA 3KJFB 4AT1B 5EGYA 3E2EA 2Y1LB 5C2GA 2G2OA 3DHWC 2LQ9A 5E3AA 4Y2AA 2KHCA 2NYIA 4PQUB 3MAAB 2YQ3A 3D68A 5F0WA 5F9LA 2WTFA 5KFGA 1FE4A 3PO4A 2UXCJ 1XR5A 2NXCA 1F2GA 2HFUA 3MTKA 3MM9A 3OTDA 1KC8T 4USVA 3T3FA 4ED2A 3PW0A 3JSRA 3BO3A 4X2BA 4QZVB 1IKYA 1DHMA 2P9GA 1K0TA 1Y3KA 3EDQB 1OIAA 3NCRA 2I2YA 5J2MB 1XNQJ 1CQMA 2V9KA 1Q8LA 1LW2B 2HBZB 3NY0A 1CJUA 3P96A 1R8AA 4TLQA 1T03B 4C0BA 2IBOA 4A8FA 2KO1A 2BVZA 3GJTB 4WYWA 4CLTA 4F25A 3NAIA 2V8GA 2BE9B 5IWAJ 4PWUA 1HQ2A 2J0WA 4QWCA 1BWVA 3V6DB 1IN0A 2ZH1A 1IWGA 3FNNA 1FRMA 4DR4F 3S6EA 3CW2C 4Y00A 4RJVA 2XTJP 4XK8C 2YVSA 1CEZA 1YVFA 3NCQA 2F3JA 5GAEI 1YSJA 4ZPAA 3W5XA 4TY8B 5M2RA 1ROFA 4W98A 1WC0A 8RUCA 3M8QA 3HHLB 2BE2B 3US5A 2ZVIA 2VH7A 3NWGA 3I0RB 4GO5X 1JNRB 1RAJA 2ZBPA 3CDBA 3OFFA 4OYOA 2AV5A 3DDNA 5ETPA 4ES1A 3NGRA 5FJ4A 2D41A 2JC0A 3FCVA 4ZP6A 2B8QA 4URGA 4GKJF 4P7VA 4DQQA 4J7CA 4O44A 2VPZB 4Y3CA 2HFNA 2MZ1A 1FXRA 4LSZB 5KFBA 2H4YB 3QYYA 1PBUA 2I1RA 4NLOA 2M9KA 2W8KA 1VQ8S 1QM9A 3J80Y 3AOCA 2KG0A 2XS2A 1R8CA 1K0VA 1LQ9A 3RBZA 1M1KT 5I3UA 3QSYB 2DRBA 1AFJA 3EGNA 4G1QA 4CM0A 1YDLA 1RUSA 2DGSA 3HZGA 3PFEA 4OJGA 1DQ9A 1UWBA 3PJWA 4DX6A 2RF2B 1OY8A 2F9JA 4UOCA 2RDIA 4MIBA 1CC8A 4R25A 1R89A 3KJNB 1F1BB 3QT5A 1RGVA 3PNIA 2ZHBA 1Z2ZA 2VG5B 3GSIA 4EO6A 2IA6A 2R7SA 1ZAXA 3OR1A 2HVIA 1JLCA 1HWUA 1X4GA 2DNKA 3F0NA 1H7XA 1L3SA 2H9ZA 1LWCA 2SXLA 2AJ0A 5KFSA 4JV2A 5LM7E 3AD8C 3MECA 1S0VA 2PFFB 3PKMA 1I5OB 1O6XA 3R5AA 4MTPA 3J7Z5 3VCDA 3H2LA 3UE2A 1ICEB 4QIWD 4FKXA 2CWXA 2OI2A 2VKZG 3M9NB 2FPHX 1D0EA 4DDFA 4JI8F 4U96A 4YY3F 1KDNA 1V5VA 2MEWA 1VHIA 3BYRA 2AMCB 2E66A 2ZVSA 3MPYA 3R6LB 4GVBA 2GJ2A 3TUJC 4EK2A 1AYEA 5I3UB 1FKOA 4KFBB 5F8HA 2C2DA 4FBUA 4ZVPB 3M2UB 3CB4A 1IJEB 3PFOA 2FJXA 3CDEA 4YR0A 1UEUA 2A18A 4J9QA 3CJSA 3HSDA 4WTYA 5E41A 4P10A 2KXNB 2V4RA 3TI0A 2E5LF 1UVIA 3TARA 4DV7J 3W61A 3MI7X 3SZ2A 5IFMA 2ZM6F 2H1YA 4DQSA 4WP3A 2DY9A 1HNWJ 4USHA 3P3DA 2DNHA 4DFKA 4DXLA 2VF3A 1RTHB 4Y0FA 2UUBF 4C8NA 3B78A 3OXLA 4A48A 3KLGB 2QA2A 4KY3A 3HHLA 5ETLA 2RKIA 5KFOA 1H2TZ 2AZ3A 3I4HX 1XR7A 2F8MA 4LRFA 2W1BA 2UUTA 3KMSA 2E5HA 3IA0A 2JFDA 4LFAJ 2V9WA 5A8WA 2Y3YA 3SCIE 4IO9Q 3M32A 3NGUA 5KFHA 3TX0A 1N56A 3PX6A 4YB7A 2RQCA 1JK9B 1WI6A 2IJNA 1SIZA 3Q8VA 4DU7A 3W1YC 3RB6A 2G2ZA 3M6UA 4NRTA 1HHTP 4LF7J 1SJFA 2ASLA 2KTQA 1EETB 1NH8A 4Q2LA 4ZVUB 1KQSR 4DCJB 2VG7A 3PJ9A 4WFXA 5K8MA 3ISND 4OV1A 2EKYA 2YWEA 4I68A 4B3MF 1FRHA 3QGIA 4YMEA 4QU6A 4NLPA 3RBDA 3W7BA 1RA6A 1X0PA 2MLZA 4OZ2A 1U25A 3TP2A 2CNKB 4AXIA 1ZAVA 2QA4S 3DOKA 1QJHA 2B8PA 3QT7A 2BMBA 2DPJA 2HFVA 5D3GB 3GFHA 4LF4J 1S9GB 1QDUB 2P9CA 3AT1B 1TZ0A 5CD4A 2IHR1 2VFUA 3DI6B 4NMXA 4UQGA 4W4MA 1YTYA 2QSFA 4ECQA 1DFDA 2H4WB 2IVMA 4OMFG 5T7LB 2JEJA 4ELUA 2HMIA 4PQUA 2DCLA 2HFZA 3DYAB 1EP4A 4UUXA 1HIYA 3V4IB 2VB6A 3ZXWA 3T1HJ 4U6PA 3QO9B 3GE9A 4OV6A 1TAUA 2NXJA 5JVGQ 1LWFB 3HVTB 1HLWA 3G6VA 1LWXA 4ZP7A 2KM8B 2CXEA 4KR0B 2YH1A 2QRRA 2EFPA 2BR0A 4WFNQ 4FF1A 1LK7A 4I2QB 4OHWA 4B9VA 2OFHX 2J0XA 3IR7B 2FJDB 3PHEA 2W7OA 2XY7A 1WG5A 5J2NB 4JI8J 3W8GA 4ILLA 1V3ZA 2KT5A 2QFIA 4OZ0A 1ZA1B 3MMCB 3OLAA 1S1XB 1RAAB 2ZC4A 4TN2A 3GIKA 1N0VC 3EWGA 2WZ1A 4DUYJ 4DL4A 2JLFA 3CVKA 4ZA1A 1F3VA 1YKWA 2CG8A 4ENOA 1FWLA 4MMOA 5KFWA 1SV5A 3TANA 2YWWA 1FFWB 2R7WA 2JSXA 3GYGA 4ZJOA 4F2SA 4YN3B 1RISA 2B6AB 1SC3B 4P74A 5L1IA 1ZH5A 3DRXA 1M5HA 2L41A 1DJ0A 3JSBA 2POKA 4Z7YA 1E6YB 3DLEB 3HD1A 2J9DE 2UXDJ 1SCJB 1D9FA 4RX6A 4DPOA 1IBLF 1IBLJ 2VG7B 2HHUA 1S79A 1VISA 3ZZPA 4LR8A 5D77A 4IFYA 2LXUA 4P7TA 4YDXA 4CO1A 1WF1A 5C25B 1RAEB 2CNNB 4FYWB 3K5MA 2E7WA 4YR2A 2VPYB 4IYQA 1SH0A 3HP6A 2V4QA 2VBXA 2BX6A 2J7KA 4IOBA 5HBMA 2L9DA 1B4SA 3KK3A 4P75A 5KG6A 2P2CB 3GONA 5IT9Y 2XHWA 2LXFA 3PEJA 1WORA 4LRAA 2MQPA 1G1XA 2R7VA 2ZH8A 2B4PA 4M94A 1GQEA 2CQDA 3M05A 4LSLB 3W2VA 1QVGR 4DV6F 4O3OA 4O3PA 1FK9A 5FIIA 2XC9A 1C1CB 2CJYB 2DNGA 1HBMB 1RWWB 2VASA 5HO4A 3R2CJ 2KB2A 2A6OA 3QGGA 1NMEB 1SV5B 2JRSA 1C0UB 2YNHA 1S49A 3TUPA 2MXYA 3Q2SC 1WHVA 5E33A 1NK9A 4RW9A 5KT7A 2BKPA 2ALZA 4TXSA 2RIJA 1PGZA 2R7UA 3VAKA 4RW6A 1RACB 3M6VA 4KE5A 1UW9A 2XWYA 4IH6A 3OTOJ 2ZJRQ 2Y9HA 5IXUA 1FKOB 4KFBA 3QGHA 3O44A 2H5IB 1KS2A 5DDPC 2PMWA 2ZZNA 1ZZNA 2UVWA 4F8RA 4UOGA 4HH0A 3HX9A 4KHPF 2YBVA 3U1LA 2PEHA 1CJVB 3EZUA 1HW9A 4KB7A 3MR7A 1RE1B 3HSJA 2H3EB 3JSMB 4PUOA 4ED1A 3DLGA 2F4FA 4QW8A 2VFRA 1U1PA 4USIA 4B3SF 1RU2A 1N32F 2KI2A 2R2SA 2NZ4A 1R8PA 1HR0J 2OPRA 5KFJA 3BH7B 1Q78A 4C7QA 2DH8A 2W9CB 3W2WA 4X64J 1M0SA 1NH7A 5DG9A 1S97A 2CUYA 2IM3A 2J76E 1PO6A 3DGVA 5AJ3F 3NGDA 3BDPA 3DRSA 3W9HA 3RYLA 4F4XA 5HVHA 7FDRA 2ACMA 2D7SA 3KLEB 1KTVA 1VQKS 4WYLA 2FHKA 3PRBA 3HSGA 2CJBA 5CYJA 1VS3A 4X4PA 4JI7J 2B43A 4ZN3A 4C0HA 4F0MA 4PKDB 1D8YA 4DR4J 3G82A 2ZBIA 3IWNC 2GVZA 3MCNA 2QLXA 1N33J 3IG1B 1R0AB 2PFDA 3DRPB 2QJ3A 1FX4A 4ECSA 4H54A 2NREA 1B7FA 3ISNC 3J7AN 2HZCA 2RU3A 4F0KA 5LJ3Y 3UR0A 3VAIA 2ROGA 1FRJA 1KFDA 2E7XA 2EK6A 1KNZA 4DR2F 1PJ7A 2XMTA 3KNAA 5F0UA 3LOUA 2E7VA 4XDCA 5D78A 1JIHA 2E5GA 5CD4H 4DLEA 3W63A 3QRRA 3OTCA 2HNZA 4NE9C 1NDPA 4E2FB 1GXUA 4I0WA 1RTHA 3VF0B 2XQCA 1VMBA 3JS9A 3CCVS 1MU2A 4HEA9 3K57A 4BWJA 4K4VA 2KH9A 3HFKA 4MK7A 2J9DA 2N4DA 1A9NB 4PG4A 2CQHA 2OHDA 3Q0AA 1QAYA 4WTOB 4CCHA 3ZNJ1 3B82A 4CLLA 2HZAA 5E3PA 1U7LA 3NOCA 3SCJE 1JLEB 1R8HA 4OHVA 4X62F 2OFGX 1MROA 4CO2A 1ZPWX 1I3OB 1WC4A 4OI1A 4MK8A 4CDIA 2FVCA 1RT2B 1RAIB 2CPFA 2EBEA 1AZSB 4YHHF 2RHSB 4G65A 5KFCA 3RR8A 2OKQA 3MR6A 1U45A 2HHQA 2HVZA 3UI3A 1KHVA 1NKBA 4B9MA 3A3NB 3AJDA 3E51A 3CD5A 1S1TA 2HPUA 3IBFB 3OHAA 1U6FA 2WBRA 3G6XA 4ANEA 4U95A 4EBEA 1UAWA 1WEZA 2LEAA 3IFEA 3OR1B 1IBMJ 2BQ3A 4W90B 2CNLB 2VG6A 2FY8A 1OPZA 3UVJB 4X4SA 1HWIA 2K1RB 1CJKB 5J2NA 3JSMA 1P8GA 4O3QA 3ADAC 1QSLA 1P6TA 2ZC3A 4XPEA 4RW7A 3BBBA 2XHCA 2HHWA 4FNHA 1LK5A 4YB6A 1S77D 5I42B 2KYXA 1FEEA 1VQMS 4CT9A 4AD6A 2QA1A 2AU0A 4JYAJ 3M2VB 2MMYA 3QIPB 3MTJA 3TR5A 2ILZA 3A1YG 4J9RA 2HWIA 2WSEC 4FF3A 3LGHA 3MMJA 5CZVA 1RAFB 3KHRA 4JI1F 4Q8EA 1FRXA 1WSRA 3G71S 4N7TA 1MN9A 2RB7A 2RSQA 1NK4A 1X9SA 4RW9B 4UZCA 2HS0A 2HLUA 2LU1A 4LF2A 4NYPA 1RBLA 5EUHA 4E0DA 3KK1A 3VAFA 1KN6A 2RS8A 1T9UA 3J7YU 1XBWA 2YY3A 4NLWA 4QR0A 3W66A 1RYSA 3QT6A 2OEKA 1H98A 2BJ8A 5EWGA 3HO1A 2RQKA 4ZPBA 1IBMF 1E6VA 1T05B 4DN0A 4JV5J 2V63A 1ACMB 3VAMA 4I7FA 4KRWA 4LR7A 3GB0A 4B9TA 1M1GA 2HFOA 2J8SA 1HQUB 1XNQF 4G1IA 5M2UA 3J7YI 1HQEB 1IQZA 2B51A 3PM9A 3Q89A 3OPKA 5KFYA 4DV5J 1ZETA 1PC5A 2W2QP 1UVMA 3BM7A 3TQEA 1F9HA 1NNDA 5HJXA 1APSA 3IM8A 3H90A 5C25A 4NEZA 2KHDA 1C4CA 4C0OC 4JI3J 4WFYA 2ZNYA 5HATA 5IWAF 2YWHA 4ZPTR 1WTFA 4FP9A 4AYBD 5HSPA 1PYSB 3MFHA 3R9LA 3UN2A 3QAEA 2BJ7A 1T05A 1RKIA 1N54B 2GQCA 2U2FA 1CS4A 2YQ0A 4RBTA 3CJKB 1FRLA 2BQUA 2E9RX 3R5CA 1RT5A 2R42A 3KLFB 1OS5A 3IS9A 1IM4A 2PMHA 3FZ2A 4KPYA 2J6SA 4PR6A 5ETKA 2Y0BB 3EUNA 1N48A 4ATNA 4LR9A 4WWSA 1FKPA 4UY85 5ETSA 3KLHA 1S76D 1NLKL 1O0PA 4ZJLA 4EGLA 2D3ZA 3P5TL 5DZ7A 4IRCA 3MM9B 4ZPVR 4WFZA 1NBEB 4O3RA 2CQ3A 4K2JA 3ZTQA 4UOFA 5DGAA 3RU0A 2D3UA 2LQ8A 1CULA 3AXMA 2GQQA 4X84A 1RTIA 1WOPA 3OT9A 5AXKA 4F3MA 5DQGA 4TU8A 3SYZA 2ZD1A 1TMMA 2ADBA 1HNXF 4JI1J 2R7XA 3D0IE 1W7WA 2XO7A 4EBDA 3RZAA 3GJRB 2WAQD 5A8RB 4FYXB 4OYBA 3M8WA 4F4WA 1GMVA 1NEEA 2GA7A 3OVSA 1OQ6A 1TQLA 2AHOB 3CCWA 4X66J 1UZDA 1KFSA 1VQSA 2PDAA 2RUSA 4R0JA 4OZ1A 3TWZA 1C1BB 1J5OA 2PIIA 2FVPA 1FTRA 2DH7A 2R8JA 2HMIB 2FJBB 5DS7A 4G1PA 4N8NA 1XTZA 3THPA 4OHZA 5HMWA 3IRXA 3TAMA 5C24A 4YQWA 3I4PA 1U1KA 2F63A 2JX2A 4OZ3A 3MD1A 4K50A 2VG5A 1ZS6A 5D3GA 1RQ0A 2LA6A 4TLRA 2JVOA 4F4AA 3MEDB 5CAAA 3TAPA 4HH1A 3EZOA 3CJQA 2P6TA 1H3DA 1UFLA 3I6PA 1AUSL 1Y5IB 3TA1A 3PR4A 4ECVA 4IH7A 5JVHQ 1AZSA 3HVAA 3PW2A 4O4GA 2GS8A 2XGPA 3HHLD 4AQYJ 1RT2A 1T3NA 2OIHA 1S1WA 1EJ7L 4G1QB 2F40A 1S0OA 1HNZJ 5DG8A 4CI0B 4EBCA 4IKAA 3HKWA 3HLUA 2M52A 3I96A 1B99A 1VQYA 2AGOA 2DO0A 4K0KJ 4DR3J 2DNZA 2D74B 3HVRA 5KOWA 1Q82T 3HJVA 3OUYB 3L3CA 1DTQB 4ER8A 1WHXA 1U0HB 2DHHA 3GILA 4Q2MA 3F73A 3ILOA 3GCXP 2HVEA 3DU5A 2YX4A 5IV3A 1VIOA 2BJDA 2HQCA 2ZUGA 4CWBA 2B9YA 1CJTA 1RU1A 4RNMA 1ELOA 2OPPB 2DGXA 1M5OC 2C1EB 3T1YJ 4ED8A 1W2IA 1JXLA 1PILA 4NLSA 5IT9U 1O8BA 4AL6A 1MMDA 2DXDA 3NGTA 2VOOA 4N41A 1JMTA 4CP5A 2HNYB 2YWKA 5T41A 2MB0B 4PPZA 2ADCA 1AUDA 2ALYB 1JB0C 4LF7F 1BQXA 5KFAA 4ZHRB 1HBNB 3TZZA 4J90A 2W9BB 3SV3A 1EKSA 1D1UA 3PCOB 1RT6A 3AODA 1HBOB 1KLMB 1RT7A 1N33F 4USTA 1W25A 2W2MP 2MJNA 4J5OA 4IDKB 1CJUB 3ITHB 1H74A 1UFKA 2V68A 3TZWA 1VBZA 2OMOA 5KFFA 2OPQB 1I94F 5HAOA 2PI5A 1C0TA 4CYUB 2DRAA 4I64A 3M8ZA 2YWFA 1K9MT 1LXJA 4NA2A 2VQFF 4M95A 1DURA 5DM6Q 2HWTA 1IKXA 2OPSB 1FTCA 1TMJA 1XK8A 1EHWA 3GZ7A 1H2UX 4WK3A 3ICLA 3H5YA 1ZPVA 2M8HA 4HL9A 1Q79A 5GMKa 2H5JB 4QWDA 3JAMY 3CC7S 3S1TA 2BEFA 1SBRA 3WHIA 4A8SA 1EQ0A 1F5BA 4DV2F 3T19A 4DV7F 2AQ4A 3P8BB 1CULB 3AHPA 4PUOB 3MAQA 3DGPA 3LQVA 5D0EA 4FKYA 1NK5A 1YHQS 1NK8A 2RH3A 1TKDA 1GK8A 4FZVA 1Y10A 1DTTB 4ZKAA 5A8RA 2QA4G 4U7UK 1T9YA 3M8PB 5FDLA 1KQGB 4WIIA 4BHQA 3H4BA 2ZH6A 4WE1A 3CC4S 1RB0A 1SJRA 1PYTA 2VJVA 1VGYA 3Q8YA 1YG0A 1VC6A 1WJ9A 1LWEA 4CT8A 3DNCA 3FQLA 1JLGA 2VU5A 2X7IA 4B02A 1VYAA 4ZCMA 4KJIA 2X3GA 3GIRA 1XMOF 4DSIA 3K2YA 3VZIA 3KUGA 3QJLA 3P45B 4USKA 4DMZA 1FI4A 2YKMA 2CPIA 3L7PA 3DDKA 1X31C 1H7WA 4DEZA 1FK9B 4IO1A 3T6BA 1H0HB 1MG7A 1RAOA 2KT2A 2HIQA 2RAQA 3PYFA 3TUIC 7AT1B 3P49B 4NLXA 1HPZB 4DR1J 3UN5A 3T5HA 2V50A 3TJ9A 2C2KB 5DM7Q 2BA9A 4RUCA 1Y7PA 1JKHB 3VAHA 3S8SA 3VGVA 4N76A 1NCLA 3BBFA 4ZCKA 3KDOA 5HQMA 2M4MA 2A1BA 3DM2B 3MUVP 1N88A 3FQKA 3Q83A 1Y4ZB 2FVRA 4TU7A 3CTRA 3PW7A 3EVWA 2X1FA 2EC2A 3GLJA 3K5NA 3QAUA 3PRDA 1J5EF 1IJFB 2BRLA 1LV5A 1PJ5A 4PABA 1KVKA 2F8HA 3M1VA 3CJ3A 4NLUA 5E5NA 1L3VA 1X4AA 2QMUB 4MKBA 3L4BC 2AP6A 3NGKA 4LIRA 1QY7A 4ZVGA 1FF2A 3SI8A 3IR6B 2Y1IA 1S4EA 2XZDB 1BE4A 2JC1A 2KVQE 1FT8A 4M5NA 2HRUA 1VQNS 1G2EA 4PWWA 1VQ9S 3OXFA 3M8PA 5FDLB 1QAXA 1N5SA 2FHJA 1YJUA 4M5DA 4USMA 4NEYA 3L9ZA 1SL2A 1RLCL 1VRTA 1UFWA 3LP0A 4YB1P 6FD1A 1HWKA 2YKNA 1GXTA 3G2XA 2GVDA 4JV5F 3BGRA 4B3OA 2DB1A 2K1RA 4FVCA 5CHCB 1T7PA 4NXMF 2C3YA 3FK4A 2W24A 1WC5A 1VLOA 3CJ0A 3VQSA 4HT5A 2XM3A 2E1CA 1S1UB 2R7TA 4HDGA 2J0SD 2VBWA 3R7SB 1WTBA 3IN5A 1IKXB 2OPSA 1PYOB 4OJ1A 3MEKA 1OJ4A 1VR6A 3BQ1A 1MN7A 3V4IA 2IYIA 4B9SA 1CPZA 1HKAA 2JEIA 4DR6F 5GMDA 3LA0A 4MJKA 3B4DA 2NPIA 4P72A 3SDEA 4JI0J 4B17A 4C3LA 4DZDA 3MGJA 1X4FA 3M30A 4IQMA 3VVTA 2DXEA 3DLKA 4DQPA 1JNZB 4IOAQ 1RT6B 1F3FA 1WG4A 2KXFA 1TKTA 2UXBJ 2C42A 4NLTA 3GWCA 1XN9A 2W7PA 2RNEA 2DNPA 2KXHA 2YWGA 1S0NA 1FVSA 2I5JA 4H4MA 3KHLA 2CZ4A 4LF4F 2RS2A 3NOGA 4P71A 2WOMA 3NKYA 1TKZB 1JJCB 5D6GA 1YWXA 2FGOA 1WKKA 5DJBA 4CLFA 3LWLA 1PIEA 1PAEX 1R7IA 1T9WA 2MY7A 1TL1B 5ETMA 4KV8B 3U1NA 1RP5A 3CMES 4NZ7A 2KG1A 4K4UA 2E1MC 1EIYB 3AA8A 5DLFA 2HHPA 2AJQA 2D1CA 1JJ2R 1WWHA 1SKUB 2A6MA 4GC6A 4HHJA 5KG2A 2NXUA 4X66F 1YJWS 1OO0B 4U8VA 2Q66A 2HHVA 1U26A 1Q7YT 2BJ9A 2CPYA 1ITPA 2LXIA 1KTQA 1TUWA 1X5TA 4PG5A 1JLFB 4WU2A 3H40A 1XNRF 4OHYA 1I6JA 1NB2A 4ECUA 1IBCB 1P1TA 4X65J 1SVDA 2MJUA 2XS7A 2JNJA 2XLJA 1UEKA 3IR5B 1VQ5S 1U09A 2QZ8A 4DL2A 1CVJA 2ABYA 1HA1A 3D6TB 3M7VA 1M1HA 5DQIA 2JLGA 2HWHA 1WC3A 4HYKA 1RXOB 2G0IA 2C28A 4KV8A 2EPIA 2VJUA 1RWPB 2MQMA 4CZCA 5I4MA 4NXNJ 3FBEA 2Z4PA 4KT0C 2KZZA 2ZKTA 2UUBJ 3GSDA 3GFXA 4MKAA 1JXEA 4A46A 3OFHA 3BV8A 3J7A1 3C6UA 1QTMA 4NXMJ 8ATCB 3RW7A 2RQMA 4ED3A 3OSPA 4FF4A 2R2UA 3K7RA 1NO8A 3SCKE 3PIPQ 1U47A 5MAOA 4FBTA 2E9ZA 4F04B 3NRBA 1M5PC 2OUGA 2IMWP 1X4CA 3M2UA 5GAGU 4BC9A 2GHWA 4RBVA 3GP9A 2QL7B 3TZYA 5BR8J 3DLKB 2H65B 1A7GE 2LDIA 3OV7A 2AKWB 4N8OA 4LVOP 2OPRB 3TZXA 2R7RA 3VVUA 1CG2A 4EU0A 2GMJA 3L95X 1KVIA 1RTZA 2MQQA 1TAQA 5K5MA 1NU4A 4QWAA 3PY8A 3CJ4A 1HWLA 1B7YB 3BDEA 3ETMA 3MAHA 4LBIA 1BGXT 4B3RF 5CQGA 5GVQA 1C1BA 1BLUA 4WP9A 2VICA 2HHXA 2RUGA 2FGCA 1AW0A 5GAGI 5HROB 2B9EA 3OHBA 3C15A 1R0CB 3DRYA 1UETA 3BZQA 2C2ZB 5KFPA 2UUCJ 1S1UA 1LKZA 3T5JA 4DPWA 1Q8IA 3D6MB 5CABA 2QEXS 6FDRA 3KJVB 1SI9A 3AB4B 4PQAA 2HBYB 3UCGA 3ZZOA 3FRYA 5KT5A 1XEZA 2BJEA 1RHRB 4ES2A 3CDUA 1W26A 1FDAA 3D4JA 1CJVA 2QTWA 2R7QA 4YOEA 1TKXB 1RK8A 4EWTA 3I5BA 1FKAF 2RE1A 5J2PA 1FEHA 2LEBA 2W4DA 2G0CA 2ZKUA 2Z30B 4HTIA 5M2PA 2C22A 1RT5B 2EBGA 3W60A 4FYDA 2ZBQA 4KPCA 1BQMA 4QR1A 2IC3A 1S1VB 4V19X 3EMTA 4IG0B 2CDQA 4Y28C 5CH7B 4URQU 4GC7A 4JI3F 3GCWP 1WKLA 3J81Y 4F4ZA 2LQ5A 3T9NA 3LWMA 3SBMA 3JYTA 3FJ2A 2APOA 1RAGB 2XBPA 3I0RA 1UPMB 4M1KA 2HHTA 2Z2MA 1NDCA 1SC4B 2KM8C 3R7BB 2RILA 2UUWA 2RT3A 2YX1A 4DR5J 3UCUP 2UV8G 3LAKA 3B8HA 4PAAA 1DBDA 1X7VA 3DN9A 5K14B 2MPUA 2R8IA 3CCRS 1I1GA 1R3NA 2CPHA 3VQTA 4IRDA 2W2PP 1MW7A 2FLPA 3MXHP 3NMAA 3KK3B 4K4TA 1NXIA 3FBBA 4FXDA 2CKWA 2HNDA 3QATA 4CTAA 2DEJA 4OYMA 2AGQA 4B9UA 1FD8A 1IR0A 3KK1B 2LMIA 3PYDA 5DZ6A 3NBPB 1OYDA 2M8DB 5HMYA 1S1VA 2IC3B 2EW9A 4JI6F 4ELVA 5IC6B 5CYQA 1JLGB 3ZTRA 4R5PB 4LBHA 1LWEB 2V8HA 1IKWB 2WK4A 5A76A 2DNRA 2R3VA 3UD5A 1YJVA 5C5JA 1PSDA 4I67A 1GFWB 4H4KC 5J2QA 3DC2A 1Q86T 3CD7A 2HLTA 5HVGA 4TYAA 4LFBJ 5J2PB 4X62J 1RWKB 3SFGA 3GPAA 3GFYA 3SXLA 1X9MA 3D28A 2BJ3A 2WVDA 4LQ3A 2QO3A 1GX5A 3ZTSA 3DOMB 2V67A 2ZFHA 1I51B 1RT4B 3MAAA 1N52B 1N5VA 1EP4B 3RGIA 5DQHA 1KSPA 2FJAB 4J9SA 3DLLQ 3Q8PB 3IRWP 1NSQA 3CC2S 4USJC 1D3WA 2QIFA 3BSCA 1UMJA 4RWXA 4QBUA 5JXSA 4ICLA 2KKHA 3RRKA 4GO7X 5DLGA 4ZN1A 1QSYA 2HVDA 4Q45A 1X5SA 3V6KA 4MAKA 1S9EA 4CIOA 2HKEA 1U1OA 2MHNA 1X60A 5CYQB 1UKUA 2X1GA 3N6MA 5KFVA 1FHTA 3KXDA 7FD1A 2AD9A 4KH1B 4K59A 1YQHA 2RDDA 3HHNB 4ERDA 1KEKA 2FHOB 2VHGA 3NG8A 5HVFA 3OVBA 1YGYA 1T9VA 1Y11A 3DDIA 2A0FB 3MPUB 3H20A 4HR2A 2WVEA 1JWWA 3KHGA 3D0GE 4DX8H 3CUNA 3QFHA 5BJRA 4IQXA 4PWDB 2DR7A 4EMDA 3GIMA 1X4DA 3KNGA 4DPTA 4DG1A 3RAXA 3H2VE 4KO0A 2B4OA 2W8LA 3I0SB 3QGPA 1OSCA 4NLVA 1QUVA 5A0YB 1FDNA 3MMBA 2NLWA 5KOXA 3MURP 3SSRA 3DOLB 1R0BG 2DH9A 2HK3A 1XMQJ 4J9UE 5SUHA 3VV2B 3H7HB 4JB8B 2XSFA 4YFUA 1CJTB 4MYTA 2OJ3A 3OL8A 1QAIA 1XNRJ 2PD1A 5L1JA 1RHQB 4OIXA 1TL3A 2VOPA 1TV6A 3BKFA 3FC9A 2ATCB 3IAS9 3WDOA 5J1PA 1U0HA 2YPYA 5LT5A 4QWBA 2OD4A 2ZZTA 5J1EB 2BACA 2V34A 2XULA 2DPIA 4QWEA 4ZITA 4ZVSB 3PV8A 1LXNA 1N34J 5E3CA 4JI5F 1FNMA 1HW8A 3E3XA 2ZH9A 1DTTA 4XAKA 3ENVA 2MQNA 4I6WA 3CIZA 3RB0A 2WHOA 3GV5B 2MYFA 2EWHA 2E1PA 5GAEU 2VZ9A 3CMQA 3KK2A 4KGXB 1WACA 2NUHA 4X64F 2Z0GA 5FLXU 3TO8A 1S6PA 3KFWX 4FPRA 4HI1A 1H73A 2AJ1A 2Q6BA 4MIAA 1F2HA 3JQMA 4OX9F 5CCLA 4FPIA 1LWCB 1WOOA 1KOHA 1B3TA 4NLGA 4O3NA 5KT6A 4IOCQ 3IRXB 3TAMB 1S59A 2WSFC 3N4WA 1WUUA 4WZMA 5JUMA 3IXQA 4ITSA 1RWNB 2ZH5A 4MFBA 4LRCA 5AE1A 3BJYA 1BXNA 3LTOA 4CO3A 3HT3A 4JI6J 1J5OB 2B4UA 3CJTA 2R2TA 3D5MA 4CYUA 1Z4UA 1C4AA 2K7KA 1GTEA 3KG0A 2XNQA 1ZM9A 2KFNA 5IQQA 3GTYX 4LFCF 3TUZC 2AX0A 1LOUA 2FIUA 2DITA 3ILJA 5KFRA 2XYPB 4EI2A 3OXGA 2HAIA 2Y1RI 1AXQA 4J9KA 1YJ7A 4KSEB 2AEFA 2ILYA 4PEOA 2CQ1A 5G4DA 1RCXB 2VDIA 3SV4A 4LF5F 5E2QA 3C6UB 3N28A 4D3HA 4IFVB 4UY8T 1T9XA 3H5XA 3EJMA 5DO2A 5KFUA 1FKPB 2CIMA 2O1PA 4MIWA 3BN4A 4OYIA 3T41A 1TK8A 3R2DJ 1Q4RA 1SC1B 4ZVEA 4ECTA 1F9FA 2G4BA 1EKRA 1TVRB 4ECWA 3KLFA 1YZ7A 3OTOF 3CD6S 4QJVA 4O44B 3CCSS 2GHVC 2Y1JA 4CLYA 1J5EJ 1TV6B 4LUBA 2JEGA 3UNGC 3HCXA 5LMUJ 1LEOA 2EG2A 1JLFA 2PSZA 4CH0S 1K47A 3Q22A 2FLLA 3GG0A 3CCLS 4UW2A 1QAJA 2LQJA 3O6QA 4QW9A 2YNGB 3OUYA 2RRBA 3FRZA 4LF1A 5B0DA 5LXRA 2ZHAA 3T5KA 3V6DA 1U8WA 3QZ7A 2AGPA 4LF6F 1K73T 3LP1B 1B0TA 3SSSA 5A0YA 3W62A 5KFNA 1UVJA 3C66A 1Q0NA 1DARA 2NCKL 1KOOA 4USUA 3UDLA 4C8MA 4CLKA 4KGZB 4UT4A 5K8PA 1VDHA 1FDDA 3W9IA 3CCQS 3CO0P 2OSRA 2VC0A 3ZFVA 4DV3J 3HD2A 3SQGB 3KG4A 5L39A 1N0UA 1IUJA 3R5GA 2EKNA 5HP1B 2UXCF 1OMSA 4PRFA 2OD6A 3QIDA 2AF6A 1BQNB 1FFSB 3ETOA 1H2VZ 5ETNA 4ID5A 1CBKA 3MEDA 5HANA 4KIAA 3VTIA 2V8PA 3THTA 4K4SA 4HKQA 2DYAA 2FY1A 2AZ1A 3M30B 4F50A 3DFEA 3MEEB 3ET6A 4E8UA 1G4CA 2A2DA 1NJIT 4DL5A 3SQOP 3WC2A 1FWKA 2BKOA 3R5DA 2O3DA 2FUG9 2R2RA 1A6LA 1CQNA 1EB0A 1SUQB 1KP6A 5F8IA 3QRQA 1UL3A 2ASYA 2GIRA 1QTNB 2QLBB 2RHQB 4OJHA 5RUBA 2N3OA 2LKZA 1SJ3P 2M3DA 2G2YA 1FA0A 4L3KA 5ETTA 4DV4F 2XB2D 3V4MA 5IC4B 1TU0B 2BZ2A 1TELA 5L9XA 2EC0A 3CCJS 2FJVA 2DNOA 2NXEA 1ZM3A 4OX6A 2B3TB 2NPFA 5KG3A 5KFLA 4ILRA 5MLCV 4DV2J 9ATCB 4F7VA 1CJKA 1WSVA 4OI4A 5EDWA 3BQ0A 2YKNB 2D69A 1RTDB 4C8KA 1VRTB 1Q5YA 2V0NA 5KFXA 3QQCD 3BREA 2LECA 4NXNF 3VR1A 4CO4A 1HNWF 1Q8BA 3OTBA 2W4CA 2YKOA 2HQGA 3HHLC 4EEYA 3FSIA 3VALA 4KTQA 2AWZA 4HDHA 2K06A 5J2QB 4DJBA 1N4LA 5CYMB 2CADA 1RWMB 2G0JA 2DEIA 3MR2A 2IMOA 4TVAB 1DY3A 4FDFA 4B9NA 2WVFA 3H42A 4K8RA 3UDVA 1RLDA 2V4JA 3DLBA 3FSXA 2N4CA 3LGMA 4LF9F 3FMWA 3L09A 4M5IA 3SQGA 3KWMA 4ED7A 4AXJA 5EHHA 2BQRA 3I82A 1RT7B 3CJ8A 2NSBA 1NDKA 3HHEA 3WIUA 4AFFA 1SQEA 2DGVA 2V94A 5B09A 3UPFA 3LP1A 3GIJA 2AYMA 1GMWD 3JTOA 1GH8A 2Z58B 2DHXA 3DM2A 1J27A 4K4XA 2RRAA 2YQ1A 4WU3A 3H25A 2JH3A 1HARA 3E8OA 2J8AA 4CM2A 4IRKA 4NMLA 2NR0A 2XS5A 5D4PA 3IGNA 5A8WB 4TYBA 4RO0A 2MKKA 2HS4A 2OAUA 2W25A 1JXVA 1ZBTA 2I9SA 3OVAA 2XLKA 1KBRA 3IWLA 3V81B 1B64A 5AE3A 4LQ9A 5KFMA 1P9YA 2DNLA 5F41A 3KOAA 3PHTA 1KKHA 1YRXA 4H4KA 4DU8A 1L3TA 1KQKA 1V5IB 3QLHB 1N36J 3M4XA 4XTTA 1NKCA 2MY8A 2ZJQQ 5DG7A 3C14A 1BWEA 4TU9A 3MFIA 2QL9B 2OMLA 2XYGB 2LVWA 1WHWA 2RJZA 3ISZA 4O0IA 1WF2A 3WIVA 2VUGA 2MKJA 2QLFB 1SL0A 2WBMA 2N7YA 3VAGA 3IG1A 1R0AA 5IM0B 2J6TA 4ZVOB 4YS2A 3T1YF 2NZCA 3DLHA 2G13A 4NCBA 4DN9A 2IFXA 2VL1A 2ERRA 4GKKJ 2JWNA 2M0GB 5A6PA 1VQ7S 1WI8A 2HFSA 1GT8A 4O4GB 2DK2A 4RW7B 2V8VA 4QPTA 1EAYC 1VQ4S 4QIEA 1O51A 2ZM6J 5CCMA 1U02A 4UOHA 3O1LA 4MFBB 4RR5A 4ID8A 4K4WA 4CNZA 2HSEB 1L3UA 2VG6B 1IM6A 3M9OB 4M5KA 2BM0A 4X4UA 3EVMA 5AT1B 4RUHA 2H54B 5FD1A 5LOQA 1SB6A 5KFQA 3RB4A 1U24A 2O01C 1S6PB 1YLXA 1HNIB 3P4UB 3SEOA 2MQOA 3LGNA 2HQFA 1VCTA 2UUAF 3HI9A 3LPYA 2E9TA 2CJ9A 2J7UA 2RF2A 3FDSA 5KFTA 3CCUS 3VZHA 1KQFB 3TJ8A 1N5YB 1NJYA 3H5SA 4C8OA 1REVA 2C2RA 2KRRA 4WFAQ 1N5TA 4OZ5A 3CPWR 4ANCA 1YBUA 2VQEF 4PXBA 4PXDA 1YJTA 2E29A 4C8ZA 4F26A 1PC4A 2DR6A 4A8KA 5ETVA 1XERA 5D15A 3K58A 1VC0A 1N5QA 3HULA 2XNRA 2GIFA 4Q0BB 4HACB 5ETQA 4ES3A 4CH1A 1FXLA 3VHQA 1JX4A 4HTJA 2EFNA 3MF5A 4X4NA 4RPFA 2UUCF 3PVXA 2UXBF 5LMNF 4ZLJA 4RW8A 3NNAA 1Q8KA 2PO4A 2AX1A 3ZZ0A 5F8GA 2JOQA 1HYSB 2FD2A 2GNKA 5A6WA 1X0FA 1NHKL 4Q8FA 2NXNA 1DZ5A 2BE2A 2MZRA 3EX7B 3DOLA 2YKQA 3M8QB 5L1KA 1IVZA 1EQMA 3MMBB 5D4NA 5K8OA 4DF4A 1NRKA 5B0GA 4WXOA 1TL7A 4EFAC 6AT1B 1NJZA 4IUFA 3MR3A 1U49A 4FS1A 2V5HG 4ZVRB 3FUYA 5G0RB 2CG4A 3MOJB 2BYCA 1RBAA 3R5BA 3KYLA 3BBCA 4FXWA 5KG0A 4BCAA 3DRPA 2Z8QA 2EI5A 2EK1A 4EZ6A 3B4MA 2CZ9A 5HL7Q 3I0SA 2GMLA 3TEHB 3FEZA 3I9V9 4M5MA 3MEGA 2F9DA 1LW2A 2CFXA 2N7CA 3QBCA 4DLGA 2BJ1A 4NPOA 1NSAA 3FZBA 5J2MA 3ENAA 3S7RA 4B3TF 2CQCA 5EX3A 4ZCIA 5F9NA 3LALA 1M5SA 4OLPA 4DBQA 2W9CA 4L3NA 4FVMA 2KDOA 4TY9A 2FLOA 2R9LA 1X4HA 5JMNA 3TQ1A 3SSQA 2R8KA 1Y0HA 2LYVA 2CVEA 2HK2A 4DI6A 3M2RA 3BSAA 4OYAA 3NNHA 4B3TJ 1S9EB 3DLGB 3IMQJ 4ZK7M 3DXBA 2DR5A 1UPPA 4EZ9A 1M5KC 4CLPA 3UCZP 3BEGB 4Q43A 4DSEA 2YH0A 3CO9A 3CSKA 3PX0A 3M2VA 4WF9Q 5AXLA 3ILLA 1N6QB 1N6QA 2V2QA 5K20B 1LWFA 3OD2A 4BLGA 1UJ4A 2HYIB 4AE5A 2PN6A 2CZVC 3AD7C 3UDCA 3BGFA 3C6TB 1RTIB 3WZ0A 3P6YC 4X4OA 3BKUA 5E3RA 5CA5A 5T7LA 3PIOQ 3DOMA 1GMUA 4DV0F 4A8QA 3J80U 5DDQC 1Z2LA 4NWBA 1FWPA 2WVBA 3A4TA 3BGUA 3NBPA 4PG6A 4XIUA 1AFIA 2IBKA 3DI6A 2K8GA 3EGWB 4O23A 1RWVB 1S7HA 2XY6A 2IRXA 2XY5A 2VC1A 3K5PA 3FSYA 1IBKF 3RR7A 3HZEA 4U7CA 1IKWA 2X1AA 1X4BA 1R6YA 4I6YA 4CTAB 1NK7A 1CS4B 4YEAA 2H48B 1NAQA 4ETZA 4F3OA 2OSQA 4NRUA 5LJ5Y 3EXYA 3LPEA 3PACA 4CLWA 1K8AT 2GIQA 1WC1A 2YX7A 2CPDA 2FHMA 2I38A 1RTJA 3D1OA 1MROB 3KUEA 5D0GA 4DUZJ 3GV7B 3AA9A 4KBIA 1JLEA 3D66A 2ZITA 4P52A 4ILMA 4Y2IA 3I31A 1B0PA 3D3BJ 4ZVTB 3UQSA 3ZZZA 2YNGA 3BF4A 3K5LA 3OL9A 2DHGA 2HURA 2OP5A 2UV8A 3G86A 2M5YA 4TKTA 3MD3A 1S9FA 1ZTWA 1BD6A 1HR0F 1JLAA 1LW0A 1RBOB 3D6FB 3L7OA 4YHHJ 1SKWA 4K4ZA 5K14A 1PBAA 1R31A 1F60B 2DGUA 1TL7B 2JJ4D 3I9ZA 4HHUA 1BQMB 2KFYA 1L5UA 4W92B 2R8GA 2HNZB 3CMAS 2DY1A 3MCOA 3FEXB 4URSA 4ETXA 4KGKA 2LDYA 2QMWA 4NL5A 2P5VA 1NPRA 5E7OB 4JI2F 3SFUA 5F8MA 4EYHB 4OI6A 1TKXA 2XMJA 1NPPA 4Y2MA 5B0AA 2E5JA 5EN1A 3U02A 1HI1A 3MMCA 4JI7F 1NJXA 1AT1B 4NZ0A 4KKOA 3POTA 2R4FA 2VFVA 4F67A 1YRTA 2QG9B 5C42A 3R5JB 2ASJA 3K89A 3QIPA 1VI7A 1H38A 1QLNA 2UVUA 3EGZA 2GGPB 4RNHA 3RG6A 4DF8A 1SJQA 3H59A 3MPWA 3MMAB 2FZKB 3THVA 2HQ3A 4RNFA 4LF8J 1MSWD 4DSJA 3QJPA 1IQTA 1P1LA 1TR0A 2HW3A 2ZWPA 4JI0F 1IXKA 5DRKA 5GMEA 2MSSA 2XI3A 3M2RB 4PZVA 4QR2A 5H1SV 2CQBA 4JV1A 2DNMA 2E5IA 3KLVA 3DRRB 3D54A 3AOBA 3GR1A 3UW1A 3ENQA 2BW7A 3PR5B 1UVLA 4K5SA 5LSRA 1JLCB 3EPGA 4PPDA 5HROA 1S9GA 3I56S 3G8SA 1AROP 2UZAA 3ONQA 5HMZA 3QZ8A 1HHQA 3MCMA 3PTWA 4XPCA 4DR3F 3Q8QB 3I5CA 3A3PB 2BOAA 4X4RA 1S48A 3MEGB 2O67A 4M5JA 5CZXA 1RHJB 1XR6A 3R8YA 4ECYA 3NCPA 1FNXH 1X5OA 3AD9C 3GQCA 2HRTA 1G6BA 3QWPA 5H9EK 5IM0A 3IO1A 2VA2A 4DHVA 3F41A 3HMJG 4WFBQ 4H4OA 2O5DA 1CC7A 3C8YA 2VDHA 3OQ2A 5I3QA 3CCMS 3OLBA 1WDDA 4A8WA 2DGTA 1SXLA 3MM8A 1HD0A 1UJ5A 3C14B 3O3LA 3D3CJ 4P2SA 4DSLA 4MT1A 4KHPJ 4WJBA 3ZZRA 4ED0A 5KT2A 2BOPA 1Y5LB 2VPWB 5C2CA 3EXCX 3F56A 3TOQA 2F1FA 1C1CA 5KG1A 4MYUA 2N82B 4HHHA 1MNEA 2ASDA 2DXFA 3I32A 4ZIVA 1UA0A 1SJ4P 1XIQA 4DX7A 1KRPA 3NGSA 4I2PB 4Q7AA 1KVJA 3RW6A 4UTGA 1YK9A 2XMWA 4RW8B 1RHKB 2EFGA 4DUTA 2NSCA 2JL9A 3CULA 3CCTA 3TX8A 3NMRA 2IJRA 2QLJB 4WK1A 2R8HA 2OLWA 1VJWA 2IA0A 3MM5A 2A2CA
chains in the Genus database with same CATH topology
1TL5A 2IM2A 4F3QA 1YI2S 3G8TA 3TVZA 2RU9A 1WELA 3CDWA 2ZNZA 1YJRA 2BV3A 3Q2TC 3QMQA 1XWLA 4ZPWR 4RKUC 3TNVA 3T5LA 1VK3A 3KLEA 1WG1A 2RD5C 3R27A 5KTQA 3U7JA 1GNKA 2GQ2A 2DNQA 1CSJA 2XSJA 3V6HA 1DRZA 5A2QY 2GHPA 1R43A 2Z2LA 4J9LA 5J1NA 2L08A 2VPXB 2BXJA 4PXEA 3SDEB 4X4QA 5B08A 3T1HF 2Q43A 2QE5A 1UWBB 2XEXA 1B0VA 2ZH4A 4N5SA 1HNZF 3BSOA 4LFAF 1U4BA 3PDNA 2M70A 2UP1A 3HVTA 3Q23A 1V6HA 2GGPA 4IG3B 3OJSA 1CLFA 2VBZA 1OWXA 3DLJA 1URRA 2LU2A 4OLOA 5C42B 5KG7A 4Y2KA 3BGRB 4B3OB 1U2RA 5LL6d 4C11B 5L9NA 3GV8B 4DR7F 4DR5F 1RYRA 4DL7A 2E1AA 2CQIA 4GKKF 4BDPA 1U6BA 2ZHOA 1VHFA 1DLOB 2CPZA 3X3UA 2YNIA 1HBMA 3CCES 4ID5B 3V81A 2B9WA 3MUMP 4J37A 1D8ZA 2XMKA 2HNDB 1FXDA 3OTEA 2HRYA 4TY8A 4QIGA 3K5OA 4NLQA 1V9OA 1JKHA 2KYZA 4G6VB 1JLAB 1LW0B 5IT4A 1YIJS 2MKHA 3CWJA 4ZVHA 4QCLA 2KN4A 4Z37A 3ZC4A 1YJNS 1YJ9S 2W4PA 1P9QC 4FN5A 4F4KA 1TUVA 2J9EA 3TYTA 3M9MB 4HVZA 4B08A 2ZJPQ 2IRYA 3AAWB 1UVKA 3JYTB 1UJ6A 2CRLA 5GADU 3UR3C 3TAQA 2YNFB 1S6OA 4IRCA 4I7FB 2AJ4A 2XMMA 3FGVA 3T9ZA 4CO5A 4DOZA 4LT6A 4N77A 5A8KB 3W3SA 3JSYA 3DLEA 1E6YA 2CVIA 2LLZA 2ROPA 4ED5A 2XMVA 2DVIA 2CJQA 3CJ2A 1K1SA 5AE2A 1FVQA 3C3LA 2UVRA 1DLOA 5L1LA 5DETA 2BABA 2J9CA 4XO0A 1T94A 1Y00A 3CT9A 1XMQF 3DHXA 1HMVB 4IFVA 3TRGA 3DXSX 3HF5A 2ZOMA 2OTLS 4R8UB 4A4JA 2KFZA 2BANB 4X4VA 4C9DA 2J7WA 2OH2A 3RRHA 4IG3A 3HPOA 5F3ZA 3EZ5A 2DR8A 3GG1A 2QMXA 2L48A 5I3PA 4DQRA 2JDJA 4TQRA 1OPIA 1Q81T 2ZOGA 3BN7A 3JB9k 4CQ1A 1N36F 5HLFB 1SUQA 4JI4F 1RI7A 4GMKA 4R0EA 3NAHA 3I5AA 4OI3A 2FJEB 1C2PA 4BWMA 4YR3A 2HQIA 3MEEA 4ZS6A 3D1QA 4LJMA 3FVYA 5U47A 3FCHA 3ZZTA 4PXCA 4WKRA 2IRUA 3RB3A 3DOKB 4Q44A 4DFMA 4QYRA 1C0TB 1VFJA 4HLBA 2MQLA 3CCZA 3N6NA 4RW4B 1HL6A 2C3OA 5KFDA 1KLMA 1RT1A 1U6ZA 2QLWA 1SIWB 5DDOC 2C3PA 3LP2B 2BRKA 2G9OA 2ZDPA 2QFJA 1HI0P 4DQIA 2VONA 4LF8F 4NLRA 2MGZA 4MKYA 3CGIA 2HNYA 4ALZA 4DV1F 2ZH7A 3AH6A 3G96A 2WB1D