1LW2B

Crystal structure of t215y mutant hiv-1 reverse transcriptase in complex with 1051u91
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
422
structure length
406
Chain Sequence
TVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLYTKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE
publication title Crystal structures of Zidovudine- or Lamivudine-resistant human immunodeficiency virus type 1 reverse transcriptases containing mutations at codons 41, 184, and 215.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 114
structure length 406
sequence length 422
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2002-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1lw2B01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2B04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2B02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lw2B03
1BQMB 1JLFB 2ASJA 3D5MA 2XGQA 4K4ZA 2OH2A 1RTDB 2RF2B 3G6VA 2UVRA 1BQNA 4LSNB 1RT5A 4H4OA 3NAHA 3MR2A 3KHGA 4DG1A 1T3NA 3I5BA 1JLGA 1EETB 2IM3A 3FRZA 1LW0A 4KHMA 1RT7B 1C0TA 4URQU 5KFTA 4J9SA 4QWDA 2C22A 1MU2B 4QPXA 5F8LA 1RT1B 4F4YA 2YNGA 5F8MA 2W9AA 4ED6A 3QO9A 1TVRA 4U7CA 5KT2A 1VRTB 3DI6B 4MK9A 3V6HA 4TN2A 2VG5B 1IM4A 3QGHA 3C6TA 4NLTA 3RB6A 3KK3B 4IFYA 2HNZB 2WOMA 5KT6A 3GIMA 1OS5A 4Y3CA 3BQ0A 4U6PA 4MIBA 3M8PB 3DOKB 3GV7B 4Q0BB 2FVRA 2GIRA 1T05B 2QE5A 4MFBA 3MFHA 4IKAA 3DRSA 3KOAA 5D3GA 5DG7A 1S9EA 1RT4A 5KFCA 3T1AA 3Q8RB 2IAJB 2AX1A 5KFSA 1N48A 4G3IA 1HARA 3BGRB 2UUWA 4WE1A 5KG5A 3DM2B 2QV6A 1S6PA 1S48A 2E9RX 5EUHA 1BQNB 2ALZA 4DG1B 3KK1B 3T5LA 3PR4A 3NGDA 1JLGB 2W9CA 5JXSA 1TKZB 4QW8A 4H4MA 5KFPA 2HMIB 3FSIA 1LW0B 3M9MB 1C0TB 4J9PA 4RW9A 4Q45A 2WRMA 3NAIA 1HMVA 3QO9B 5HLFA 1TL3A 1TVRB 3JSMB 5F8HA 3DRPA 4YR2A 3ICLA 3DYAB 4WZMA 5KFDA 4O44A 4KE5A 3LP1A 5JUMA 1JLEA 4XPEA 4NLVA 1S1TA 3C6TB 2YKNB 4HKQA 3TVKA 4FBUA 4IFYB 2WOMB 3CJ4A 4NLSA 1TQLA 1S1UA 4RUCA 4NCGA 2CJQA 3BQ1A 2ZD1A 1GX5A 4WXOA 1D1UA 4MFBB 1N5YA 3DOLA 1IKWA 2FLNA 3DRSB 5T14A 1S9EB 4ZPCA 2BRKA 2B6AB 4ZPDA 3C6UA 3VQSA 1S4FA 2YNHA 3PZPA 4LQ3A 5KFOA 3IG1A 3H5YA 3LANA 2GC8A 3V6JA 3GIJA 4J9OA 1S6PB 2O5DA 3NKYA 2J6SA 3PR5B 1QUVA 1Z4UA 1S1WB 4H54A 4NLDA 5I3UA 1RT6A 4H4MB 2IC3A 1N56A 4J9QA 2JLEA 2W8KA 3UQSA 3Q8SB 4G1QA 3H59A 3NBPA 2C28A 5HLFB 1TL3B 3DRPB 3T5JA 4O44B 2JEGA 3LP1B 4JUZA 1JLEB 1BQMA 3PW2A 1LWCB 1S1TB 2W8LA 3QIPB 2R2RA 5KFLA 4ECRA 1W25A 2R8KA 4O4RA 4K50A 1S1UB 3CIZA 4NCGB 3H4BA 1RYRA 4O4GA 3PW7A 4ED8A 4JV0A 1EETA 2ZD1B 4ZP8A 3SFUA 2R2SA 5KG4A 4PQUA 1FKPA 3DOLB 1IKWB 3CJ0A 3KLGB 2UVUA 4NYZA 4WYLA 4ZPBA 3N6NA 3C6UB 4ZVFA 4EEYA 2YNHB 3PJXA 4ICLA 2VG7A 4ECQA 2JEJA 2IA6A 5FDLA 4Q43A 1HPZA 2HNZA 1SH3A 4ED7A 1HNIB 4GC6A 1RT6B 1ZTTA 3UPFA 3RB0A 2IC3B 4YP3A 1XR7A 1LWFA 3ITHB 5KT7A 2XWYA 1KHVA 3CDEA 3D28A 4Q0BA 3RB4A 4G1QB 1T05A 5EWFA 3MR6A 3RBDA 1S1XA 2BE2A 1S9GA 4MK7A 1RA7A 1XR6A 3OHAA 2W9BA 4ED1A 1HQUA 2ASLA 1TV6A 4Y34A 3N6LA 4FBTA 3DM2A 2B43A 2VA2A 5DLGA 1ZETA 3HVTB 1WNEA 4ZP6A 3KJVA 5C24B 5KFHA 4O4GB 3KK1A 1YVFA 4Y2CA 3CDWA 3KHHA 1TKZA 4ECWA 4O3PA 2HMIA 3CJ5A 3HKWA 4I7FA 1VRUA 4PQUB 1K1QA 1FKPB 2V9WA 3V81A 3BR9A 2YNIA 4ECXA 4F4XA 3JSMA 3OL6A 3PJWA 4RNNA 3DYAA 4K4YA 4ICLB 2VG7B 4TLRA 5KFYA 2FLLA 5FDLB 4K4WA 2YKNA 3PHEA 1TP7A 3TQ1A 1HPZB 4IH6A 3KLVA 4RW6B 5F8IA 1S0OA 2DPJA 2D3ZA 4ED3A 4QWBA 1LWFB 1JLCB 4RW7A 3E51A 2AGPA 4FS1A 3OSPA 4I2QB 5KFRA 4EYHB 1S1XB 2BE2B 4WFXA 4IH5A 4RUAA 4Q8FA 1S9GB 4NLWA 5C5JA 2B6AA 2W9BB 1HQUB 1TV6B 4TQRA 2E9TA 4ECVA 1RDRA 4RNFA 4J9MA 3QGIA 3KJVB 4KB7A 1RYSA 3IGNA 4ZVHA 3MEGA 1N6QB 2YKMA 1S1WA 3H98A 4KO0A 3MF5A 4LQ9A 4TXSA 5F8GA 5EWGA 4PWDA 2XI3A 4K4XA 4I7FB 1R0AA 1VRUB 2EC0A 3NL0A 5F9LA 2FVCA 4J9LA 3V81B 1S0NA 3GV8B 2YNIB 3GYNA 1IKVB 3IGVA 2RDJA 4FS2A 4IG3A 2JEFA 1HYSA 3CO9A 3KLFA 4IRCA 4NLUA 2UVVA 1TL1B 5KFEA 3DLKA 4O3SA 3ISNC 1LWCA 3OL9A 3QIPA 4MH8A 4NRUA 4K4VA 5C25A 2AX0A 5DGAA 4F50A 2C2RA 4RW8B 5KFKA 4PUOB 2R8IA 4NLPA 4ZHRA 3JYTB 2UUTA 4RW7B 4R8UB 4KAIA 4TY9A 1DLOA 5KFMA 4IFVA 3FDSA 2WONA 3KLGA 1ZTWA 1CSJA 2HNDB 5HBMA 4ZP7A 1T94A 3DMJA 1NHUA 5F9NA 1SH0A 2ATLA 4NLQA 2I1RA 1C2PA 4ECUA 4IH7A 4ZVEA 5DQIA 3MEGB 1SV5A 4MIAA 2YKMB 3FFIA 4ID5A 1HNIA 4KO0B 3EPIA 4ED2A 5KFWA 4PWDB 4B3OA 2AWZA 3ITHA 1R0AB 3OL8A 3CJ2A 3I0RA 1C0UA 1GX6A 4TYBA 3IRXA 3MEDA 1S6QA 4IG3B 4KSEB 1HYSB 3IS9A 4M94A 3KLFB 4MKAA 3DLKB 3T19A 4Q44A 3TAMA 3HVTA 4O3NA 1REVA 4MKBA 4URGA 5C25B 2B5JA 5J2QA 5KG0A 5C24A 3H40A 1RTJB 2BANA 3GIKA 3DLEA 4ZHRB 3MECA 1JIHA 2CKWA 1RTHA 4RW4A 4NLYA 3KMSA 1QAIA 1DLOB 3MR5A 2JC1A 4IFVB 2XCPA 2WONB 3RAQA 5I42B 2R8GA 2OPSA 1S9FA 2WCXA 2IM0A 5HBMB 4DL3A 3I5AA 1C1BA 3DMJB 4IG0A 4EO8A 2FJWA 3QGGA 2UVWA 5J2PB 4J9RA 1RAJA 3SI8A 3PW0A 3KNAA 2FJXA 4YR0A 1SV5B 5L9XA 5EWEA 3NMAA 3FFIB 4ID5B 4RW6A 1UWBB 2BQRA 3G6YA 5J1EA 1JLBA 4URSA 4KHRA 3FQKA 4KKOA 4B3OB 2GIQA 4RNMA 2BR0A 4ZP9A 3KLIA 3I0RB 1C0UB 1C1CA 1JLCA 3DLGA 3DRRA 5KFQA 1S97A 3M8QA 1DTTA 4I2QA 3IRXB 4IOBA 3MEDB 1S6QB 4O3OA 5KFZA 5F8NA 5HROA 4RNHA 4J9NA 4EBCA 3IS9B 2C2DA 4EYIB 2ZKUA 3PVXA 5J2MA 3KHRA 1KLMA 3TAMB 5DG8A 2OPQA 3I5CA 3V4IB 1REVB 4JV2A 2B5JB 5J2QB 4RNOA 1N6QA 4ECSA 2BANB 2BQUA 5CYQA 3RBEA 3DLEB 2WK4A 3MECB 1RTHB 4RW4B 4ZVGA 5KFFA 3KLHA 1IKXA 2HNYA 1JKHA 1T03A 3N6MA 4IRDA 2BRLA 4K4UA 3I0SA 3MR3A 2OPSB 1IKVA 2RKIA 5L1KA 1C1BB 4IG0B 3OSNA 2ILZA 3BSCA 4EBEA 4ECZA 1TL1A 2ILYA 3IN5A 2D3UA 2AQ4A 5KT3A 4EBDA 4IRKA 4Y2AA 1IKYA 5CYMA 5J1EB 1JLBB 4RW8A 4R5PA 1LW2A 4KKOB 1JLQB 4KV8A 4PUOA 3KLIB 4R8UA 3CDUA 1C1CB 3JYTA 3M9OB 3DLGB 3DRRB 3MEEA 4KFBA 5KFIA 3M8QB 1DTTB 2J6UA 4R0EA 1HQEB 1J5OA 3LP0A 3BREA 3M9NB 5HROB 3HVAA 4DL5A 2IBKA 1QAJA 2HNDA 1RT3B 4WFYA 5J2MB 1I6JA 2R2UA 1JLAA 3MFIA 1KLMB 2OPQB 2C2EA 3MTKA 2ZE2A 5J2NA 4KBIA 1K1SA 5C42A 5KFUA 3CWJA 3LALA 1RA6A 4XPCA 2AU0A 1RTIA 5CYQB 2JEIA 5KG7A 5KT5A 1EP4A 3KLHB 1IKXB 2HNYB 1JKHB 1T03B 1DTQA 3H5SA 3KK2A 5KFAA 5KG2A 5KFBA 3LAMA 3I0SB 5HP1A 4IR1A 1QE1A 3V6KA 2JC0A 5KT4A 2RKIB 5KFXA 4J9KA 4Q8EA 3HHKA 4TQSA 1S10A 4WYWA 3BJYA 2IM1A 2HAIA 4LSLA 1JXLA 3UR0A 2FVQA 2IJNA 3H2LA 4NLGA 1IKYB 4NLOA 5CYMB 2D7SA 1TKXA 1RTJA 4R5PB 1LW2B 1RT5B 4H4OB 3V6DA 2OPPA 4KV8B 4OL8A 3QZ8A 3OLBA 4IQXA 2D41A 4ED0A 3H5XA 4KFBB 3MEEB 4I2PA 1J5OB 3LP0B 3KMQA 5I42A 1RT2A 3RB3A 2F8EX 4RZRA 4QWAA 2XGPA 4NZ0A 5L1JA 2YNGB 5DLFA 1S1VA 2HWIA 1JLAB 1S0MA 4DL7A 2VG6A 4DL2A 4QWEA 2ZE2B 4F4WA 5J2NB 5J2PA 3QZ7A 3T5HA 4DL4A 5C42B 2ASDA 4K4SA 4M95A 4K4TA 1UWBA 1RTIB 2OPRA 2IJFA 5EDWA 1EP4B 5F8JA 1NNDA 4X2BA 2AGOA 4MK8A 4DEZA 1JX4A 1DTQB 2FJVA 3KK2B 4QWCA 4TYAA 1U09A 5HP1B 1TKTA 3H4DA 1QE1B 3ISND 2HWHA 3PW4A 1FKOA 2J6TA 3LAKA 5K14A 3QIDA 5KFJA 4GC7A 4ECYA 2R8HA 2BQ3A 2V0NA 5D3GB 5DG9A 3E01A 1FK9A 1LWEA 4TY8A 1RT4B 4YQWA 5L1LA 2WTFA 4IDKA 3OLAA 4LSLB 2XCAA 4NLRA 4WE1B 1HNVA 3V4IA 2FVSA 5KFVA 3GIIA 3RAXA 2XC9A 3Q8QB 3OHBA 5KG1A 1TKXB 3GILA 3V6DB 3GV5B 2VA3A 2OPPB 2W7OA 2R2TA 5L1IA 2DPIA 2E9ZA 3KLEA 2W9CB 2AGQA 4XO0A 4I2PB 4RU9A 3CVKA 2IMWP 2YNFA 1RT2B 4RW9B 4YR3A 1N4LA 4ECTA 1HMVB 1S1VB 1SUQA 3BSNA 2VG6B 3UDLA 2V4QA 3KHLA 3QLHA 3EZUA 3OL7A 3GQCA 2I5JA 3QYYA 4HYKA 3LP2A 2XI2A 1JLFA 3SFGA 1RTDA 1MMLA 2RF2A 2R8JA 2OPRB 4LSNA 3BQ2A 1JLQA 1NHVA 4YMEA 5DQGA 1S49A 4WZQA 5DGBA 1TKTB 3PW5A 1HQEA 1RT7A 3G86A 1FKOB 3G6XA 3CJ3A 5K14B 1MU2A 1N5YB 1KHWA 1RT1A 5DQHA 1RT3A 3E01B 1FK9B 1LWEB 3BSAA 4TY8B 3T5KA 2W7PA 4O3RA 4IDKB 3BSOA 1VRTA 3DI6A 2FVPA 4F4ZA 1HNVB 3IG1B 4ZPAA 2VG5A 4WFZA 5KG3A 3KK3A 5KFNA 2IM2A 3DDKA 4NLXA 2WB4A 3EPGA 3Q8PB 2FLPA 5I3UB 3KLEB 2WHOA 1SH2A 3FQLA 4WXWA 2RDIA 3M8PA 2YNFB 3DOKA 3HVWA 1XR5A 4QW9A 4JV1A 5KG6A 5KFGA 3NBPB 4O3QA 1SUQB 4IR9A 4EO6A 4ZMMA 4DL6A 4NRTA 1D0EA 3H5UA 2V4RA 2IAJA 3QLHB 2I5JB 3BGRA 3LP2B
chains in the Genus database with same CATH superfamily
3SQGB 5HVGA 2PMZD 1RBLA 1SQGA 3NAHA 2BJEA 1UVIA 1RT1B 3M2UB 5LL6d 4ED6A 3D6TB 4HHJA 2DNRA 3V6HA 2E44A 1CJTB 1B3TA 4NLTA 1X4GA 3OTBA 3CCUS 3SQOP 3M8PB 1RHKB 2XM3A 2BKNA 1GMWA 1HARA 3C15B 1IXKA 3Q8UA 3MR7A 1Q0NA 2VKRA 1HNWJ 4CCHA 1NSAA 3TEGA 3RBXA 4TLQA 4KGVB 2WOMB 2CWXA 1Y5IB 1IJEB 3Q22A 4OX9J 3BQ1A 2Q6BA 4LFBF 3IWNC 2IFXA 5A0YB 1S4FA 1TK8A 5D4OA 3KFWX 3M6XA 1CJKB 3D6HB 4GRSA 4J9QA 4KH1B 3QSIA 1OYDA 3H59A 4C6AA 2JEGA 1XMOJ 2PI4A 2LEPA 2GVZA 4WYLA 3O6QA 1PAUB 4P7VA 4L74A 1I51B 2KZMA 1V3RA 3R5CA 2HNZA 4ED7A 4F0KA 3RB0A 1GH8A 2X3DA 5AXMA 4Q0BA 3TO8A 2VZ9A 4G6VB 1E6YA 3N6LA 1ZETA 1SBRA 2VBWA 4B9TA 2J7WA 1EAYC 2WW8A 2EG1A 1XK8A 4K4WA 4QR0A 3TW0A 2D3ZA 3CD0A 4HT7A 2V50A 1YK9A 2LEBA 4FPIA 4G1IA 1B70B 2EFQA 4ZVHA 1KR4A 1VQ9S 4KO0A 1NPRA 4A48A 1HR0J 2COLA 3A8JA 3MOJB 2HZAA 3GV8B 2GMLA 3M2VA 3QSYB 3KLFA 4NLUA 3UCUP 2RJZA 1LWCA 1BE4A 1EB0A 1QD1A 2EFGA 5F9NA 1RAHB 2K1RA 4ED2A 1FWLA 4S0MA 1C0UA 1U1RA 1GX6A 3MURP 1PKUA 2DEIA 4MKAA 2B8QA 1TL7B 1V5IB 1P9QC 1H73A 4ENOA 6FDRA 3PX4A 2GJFA 4B17A 4DSKA 3UN3A 1WC5A 3IRXB 3HF5A 1KVJA 2WVEA 1NUEA 2U1AA 4ITSA 9ATCB 5J2QB 4DLEA 3EVMA 3RBEA 2NPFA 4NYPA 1FTRA 5L1KA 3CD7A 3MMCA 1TL5A 2ILYA 4WCEQ 4OHVA 1O5JA 1KWMA 3I56S 4KKOB 1B64A 3M8QB 1H2VZ 1RT3B 2N4DA 3EZ5A 2EBGA 2GAGC 2C2EA 2X7IA 2PD1A 1S72S 1DY3A 1OQ3A 5KG7A 5KFBA 1KTQA 5ETVA 1YJ9S 2YWGA 3GFHA 2HSEB 4ED5A 2RQ4A 3KYLA 4TVAB 2G0CA 1TL4A 3SDEA 5CYMB 3GG1A 4R5PB 2EPIA 3JQMA 4MMOA 2DNQA 2XY7A 2DGXA 3VAKA 2VQFF 1J5EJ 4C98A 3T1YJ 1JJ4A 3VAJA 3QZ7A 4DL4A 2QLXA 2LP4A 3TX0A 2QRRA 1JX4A 1DTQB 4QWCA 2VPZB 2E66A 4RBVA 3BYRA 5BR8J 5L1LA 2RQKA 3LW5C 1HNVA 4DV2F 5T7LB 2HVHA 3QT6A 2DY9A 4UOGA 2B9EA 4QBUA 1F6TA 1PGZA 1P8GA 3BSNA 3UDLA 3ILJA 3GQCA 1A0OB 1JNRB 4UUXA 2XI2A 4QZVB 3T9NA 2OFGX 4B3MJ 1MMLA 4E8UA 2I8EA 3BQ2A 1JLQA 1OY8A 4DV3J 5DQGA 2Q1LA 2DCUB 2A2DA 4LF6J 3QT7A 2HZCA 2I9SA 1DRZA 2RT3A 3C46A 2E29A 3D3CJ 2LXIA 4QPTA 2YNFB 4YHHF 3RU0A 1SUQB 4ZMMA 1H72C 4AL6A 3BGRA 2Z2YB 2AV5A 2UUCJ 5IT9U 1MROB 2H54B 2KI2A 4LF1A 3THPA 2MY8A 4C0HA 3HPOA 4URQU 3W63A 2GX8A 2P6SA 2EXUA 2BKOA 3D3BJ 4CRJA 1RHMB 3P6YC 2HNZB 4EI2A 1L3VA 1HWKA 3K5LA 4USVA 4Q0BB 3J7YU 5T41A 3E2EA 3E8OA 3MM8A 1VBYA 3N9UC 3J81j 1HHTP 1C0TB 1HI0P 2N3OA 2WRMA 1HNXJ 4L3KA 5HLFA 1CS4A 2DNPA 4PWWA 3W5XA 3UE2A 4KH0B 1SPBP 3L9ZA 4DR2J 5DM7Q 2CJQA 1NSKL 2AYMA 4KPYA 1GX5A 4MFBB 2EC2A 2FLNA 2BMBA 3PZPA 3H5YA 1T11A 4DXLA 1C4AA 4NLDA 3RUBL 3UNGC 3M6WA 2IC3A 1SKUB 4L75A 3AJ2A 4Y6IA 4BLGA 4G1PA 4IO9Q 2DCLA 1LWCB 3I9ZA 3ETOA 4LF4F 2LA4A 3HT3A 4ZP8A 1OSDA 2UUAF 3QFHA 3N6NA 4YDXA 1KQGB 2BACA 1G2EA 2E1PA 1MSWD 2POKA 4GC6A 1S9GA 2VJUA 4P2FA 2ASLA 1T8EA 2OEMA 1TKZA 1Y5NB 2AJ1A 3SMZA 5IV4A 2VC1A 4ECXA 1U24A 4HDGA 2HLUA 2UUBF 3HSGA 2QL7B 5B0BA 4DSEA 4ED4A 1MN9A 4CH0S 1E6VA 1UETA 3NWGA 4OX8A 4I7FB 1SQEA 5HQLA 2DGQA 2YNIB 4MYTA 1NB2A 1S0VA 1RADB 1I3OB 4ZHRA 4IFVA 2R7OA 2DHHA 4HL9A 4RPFA 3TEHB 2JOQA 4N77A 4PWDB 2LECA 3M32B 3GZ7A 2KKHA 4FNIA 4MJKA 1OWXA 1I1GA 2GA7A 4NA2A 3A1YG 3GG0A 1FFGB 2CPIA 2ZWPA 2BJDA 2V68A 2CKWA 4OZLA 3WHIA 4JI8F 4NXMJ 1WC0A 4J9RA 4LF9J 1NXIA 4RW6A 2DNHA 5D4NA 2LCWA 4KHPF 4IOBA 5KFZA 5F8NA 2NXJA 3MD1A 1SC4B 2WW4A 4NI2A 3P96A 2B5JB 3NY0A 3R2CJ 3G82B 4BWJA 5KFFA 2ZH6A 1IKVA 2CZVC 3CJSA 2R4FA 4X4QA 3CUNA 1RWPB 3VVTA 1JLQB 3CDUA 3JYTA 2J6UA 3BREA 3CJRA 2WB1D 2B7CB 3ZNJ1 4B9SA 4Q5VA 1JLAA 3MFIA 3GJQB 4YOEA 3MTKA 2F9DA 5J2NA 3M8YA 2JFDA 1EP4A 4K8RA 1IKXB 1JKHB 1Y0HA 1NRKA 5KT4A 2RKIB 4OX9F 3NGTA 3B6BA 4LBPA 4X4TA 3M7VA 2D7SA 3OLBA 2OSQA 2ZNZA 4I2PA 2QSWA 1R8PA 1S1VA 1GXLA 2EW9A 2HWIA 4DL2A 5J2PA 5B7WA 2XMVA 5JMNA 3HLUA 3DFEA 3IR7B 1DQ8A 5EDWA 1TKTA 1EKRA 4HTIA 3VHQA 3K58A 2ZM6F 3WIVA 4IDKA 4LSLB 3QNWB 4C11A 3DU5A 4OZ0A 4KGXB 3AD8C 2DPIA 2XS7A 1MW7A 2R7XA 3S7RA 2RHQB 1CS4B 4OJ3A 3OL7A 1JLFA 2OPRB 1K8AT 2CQ2A 1KKHA 1VMBA 3BSAA 2G2YA 4F4ZA 2FVPA 3G8TA 4M5DB 2MJNA 3EPGA 2HVZA 1SJRA 1LXNA 2V8DA 4C3MA 1N5SA 3DXBA 4NRTA 3QLHB 2I5JB 1LV5A 3KDNA 2DHXA 4AQYJ 4LSNB 4DSJA 4H4OA 2KRBA 4OZ3A 5CXTA 1MU2B 4QPXA 3D1OA 4OHXA 5F8MA 4X4SA 1GMUA 1RABB 4U9RA 2ZH2A 2O3DA 4NMLA 3S6EA 2MMYA 1VI7A 5D3GA 1SL1A 1RAEB 2G2OA 1CC7A 3NCRA 3Q0AA 5IT9Y 4J9VA 3OTOJ 1TKZB 3US5A 1UEVA 4F3MA 4JI2J 4AT1B 1TVRB 5F8HA 4DU7A 3C2PA 5LMNJ 1N8RT 3TVKA 3J7AN 4X4NA 4L3NA 1NHKL 3UD5A 2L3MA 2QLJB 3NWRA 2DEJA 3H0PA 5EN1A 5IZHA 2M8HA 3LANA 3M6UA 4UTGA 3RYLA 1BUXA 2NS1B 1E6VB 1CC8A 1N56A 2Y1JA 2MSSA 3DGPB 3X3UA 2J0WA 1S1TB 4F3OA 5KFLA 4BC7A 3CIZA 1RAFB 1AUSL 4ZVFA 3MWBA 2FGOA 4OQJA 2OSRA 1SC3B 1V3ZA 5KT7A 2AJQA 1KHVA 1FRLA 1S1XA 4MK7A 2J9DE 5A8KA 2XMAA 3WQPA 1H98A 5L46A 3TA2A 3P5TL 2OLWA 4PCQA 3HKWA 2FGCA 3AQPA 3V81A 2KXFA 2ZZTA 2LQBA 4RW6B 2HGMA 2DPJA 1P1TA 4RW7A 1WG4A 2KVQE 3OSPA 4EYHB 4WFXA 4GKKJ 1X0FA 2LXFA 3K5OA 3MMAA 1NK7A 3T1YF 2EC0A 1IKVB 2L9DA 1NDPA 1S99A 3DLKA 4ANCA 3D6MB 4K5RA 2DNNA 5BR8F 4BDPA 4LF8J 3JYTB 1DLOA 1PC5A 2D9OA 1YJWS 3A3NB 1NHUA 1Q81T 4LR7A 4A8YA 4MIAA 1JWWA 4JI7J 1AW0A 1X4HA 2QYGA 2KHDA 4IG3B 4DV3F 4C2MA 4LF6F 4I56A 4TKTA 1YIJS 3UDCA 1D09B 2KT5A 1HBUA 2ZH7A 4C4WA 1BGXT 5J2PB 3HCXA 1YTYA 3PFOA 3DDNA 5HROA 2UUCF 2XO7A 1RWKB 1UJ5A 3TJ8A 2DNMA 3KJNB 4NYOA 3MUMP 1KLMA 1B4SA 4Y28C 3GFXA 4ZVTB 3D0IE 2NXUA 4QYZK 2OEJA 3J81Y 4WKYA 3EGZA 2CPFA 2BX6A 1TL1A 2DVIA 3KNGA 5D0RA 2KZZA 2J0SD 4GVBA 1DTTB 1X9SA 5B0CA 4K0KF 5ITHA 2OPQB 2A3JA 4YB7A 3DHXA 3BGOP 4OMFG 2JEIA 2Z2LA 2V9KA 2GS8A 2DGUA 4M8LA 4DR2F 3SEOA 1Q79A 3VAFA 1WG1A 3BKUA 4H4OB 4IQXA 3H5XA 1AYEA 4PXDA 5ETKA 5HI7A 5I42A 1F1BB 2XGPA 4NPOA 1RWVB 2VG6A 1N34F 2AEMA 3ZTQA 3EDRB 4NASA 1DHMA 1VIXA 2OFHX 5GAHU 1QE1B 2KYXA 3QIDA 5D3GB 4ZCIA 1YQHA 3POTB 1YJNS 2AJ4A 5KFVA 2B8PA 3Q8QB 3GILA 3GTYX 5BYRA 3CVKA 1U0SA 3VALA 1S7IA 4Z7YA 1G6BA 3D67A 2MZRA 1L3SA 4PG8A 3DI6A 3C3LA 3MUVP 3TUPA 4I64A 2R7UA 2UZAA 5F0WA 2ZVSA 3KG1A 4EO6A 4O0IA 2V4RA 3G9CA 4CP5A 3G6VA 5KFTA 1CBKA 3ZO7A 3EXCX 3NGKA 4USJC 2ZJRQ 2RRAA 4DQSA 3M8WA 4Y3CA 4L6V3 3ZTPA 1Z2ZA 2C3YA 4K5SA 2VFVA 1S9EA 2FYXA 5E7OB 1XTZA 1RHQB 2ALZA 4XIUA 1HBOB 1LW0B 1EARA 2QZ8A 5KFDA 2ROGA 4QU7A 4NLVA 5KTQA 1H6KX 2Y9HA 1Q4RA 1TQLA 4OZ1A 1B7YB 1UJ4A 2GJ2A 3GCXP 2ZH8A 2EK6A 4NOHA 1QDUB 4ZPCA 2BRKA 2GGPA 2ZNYA 3MMAB 3NKYA 4KYZA 5ETOA 2G2ZA 2JVOA 1VQ7S 1JJHA 2ZOGA 1JNZB 4H4KC 1V9OA 5DDQC 2V4JB 1R0BG 4RWWA 1RYRA 2DNLA 2ZD1B 3SFUA 2R2SA 3JSYA 3SCLE 3UR3C 3UN2A 1RU1A 2Z4PA 2DT9A 1VHIA 1SC1B 2BE9B 2R9LA 4Q43A 2CWKA 1LWFA 1VGYA 2GJIA 4ZIVA 4G1QB 1T05A 1NLKL 1TV6A 3BO2A 4EZ9A 3GFZA 3HSZA 3KK1A 1HBNB 2M88A 1KFSA 4ECWA 3PCOB 2XSJB 3EE3A 2NZ4A 4RNNA 5HVFA 4LF5J 3JXOA 1HW9A 1F9EB 2BUNA 3E51A 3OFEA 3FBEA 4NLWA 1RKJA 3LTOA 1EQMA 1RDRA 4C9DA 1J27A 4TXSA 1FX2A 1R0AA 4X84A 2RUGA 3JAMU 1YSJA 1TL1B 2HHSA 4NRUA 4YUDA 1YHQS 2PEHA 4P9SA 5L8RC 5EX3A 4YFUA 3CD5A 3RR8A 3KLGA 2KL8A 5HBMA 4TU7A 2DR7A 1KS2A 1C2PA 5K8MA 2Z30B 3QJJA 4X66J 1VLOA 3WZ0A 1SV5A 4JV5J 4X4RA 4YDDB 4DUZJ 3S01A 2GVDB 1Q8LA 2OELA 1R8CA 3DLEA 2XCPA 5I42B 3NLCA 1S9FA 2HQGA 4DL3A 4ZK7M 3M30A 1U1QA 3SI8A 4Z7CA 2OTJS 3MM5B 4DV7J 3FFIB 1QJHA 1K9MT 2F8MA 4BCAA 2V67A 1SKSA 4B3OB 1R6VA 3I0RB 1UWAA 2YPYA 3GPAA 3IS9B 2W2QP 1RK8A 3B4MA 4AE5A 4E98A 1NK9A 1NKEA 4BWMA 1KTVA 4IRDA 3N6MA 1K0VA 1FDDA 4DCPB 3FZBA 4EBEA 2O1PA 4IRKA 7AT1B 4DUYJ 4LFCJ 3HHLA 5HVHA 1PC4A 4C8MA 5BYQA 2R2UA 3OTOF 1UVKA 1CJUB 2KJVA 1RA6A 4JI2F 2AU0A 2PA3A 2HQIA 2HGLA 1WKLA 1UVLA 1FE0A 3PKMA 2O01C 7FD1A 5D0GA 4DX5A 2CJKA 1RLCL 1JB0C 4KV8B 3G4SS 2MQ8A 4ZLPA 4CTAB 3KMQA 1T95A 3DCAA 4ZCMA 1S5ZA 4DCOB 2ZH1A 5HMYA 2JX2A 1RXOB 1WWHA 3KK2B 3NOGA 3VAMA 5DG9A 4DPYA 3LUYA 2MEWA 1ZM2A 1U25A 4ILLA 1Q8IA 1TMMA 2IVMA 2NLWA 2ZOMA 1H0HB 4ZVOB 5I3QA 1B0VA 5G0RA 2DO0A 2FJEB 2N7YA 2KRRA 1Q86T 4OI1A 1JQGA 5B09A 4J9UE 1RT7A 3G6XA 4CYUA 4DJBA 4TY8B 3O8WA 1VRTA 5CA5A 4DQPA 2VG5A 3VQTA 4USKA 3MAQA 1Q7LB 3JS9A 1WTBA 2NZCA 4ID8A 1RACB 1NJWA 2ZKTA 1S6UA 5KFGA 2A6MA 2CAJA 4DV4F 2K2PA 3RW6A 1BQNA 1NDKA 3I55S 4B08A 4J9SA 3QO9A 3HHNB 2KFYA 2AMCB 4IFYA 1WEYA 3GR0A 3BPDA 4DBQA 1ZAXA 3GV7B 5EGYA 1T05B 4OHYA 4LF8F 5KFSA 2KG1A 5E5NA 3KK1B 1JLGB 4FYXB 2VIHA 2AJ2A 4JI7F 3RR7A 3ICLA 2AHOB 4PAAA 3C6TB 1DARA 2ZBIA 2R3VA 2HFUA 2XBPA 2YQ0A 3MPDA 3VQSA 2YNHA 5KFOA 2M70A 1WD6A 3RZAA 2O5DA 2HVIA 4CWBA 1WC6A 1WKKA 3D1QA 3D4JA 4G65A 2KHCA 4F8RA 1X4EA 1NCLA 1D8YA 2MZTA 1Y00A 1XEZA 2BW7A 2F5GA 2HK2A 2QX0A 1IKWB 4RU2A 3KLGB 2MLYA 3SV4A 4NWBA 1AT1B 2Z0GA 4P74A 3QT8A 3FSXA 2C2NA 3RB4A 5EWFA 2RRBA 3HHLC 1FD8A 1LWXA 1WNEA 4ZP6A 5F0UA 2LDYA 3BR8A 4PQUB 3BR9A 3OL6A 2XSFA 2VC0A 3MM7B 4V19X 4I6AA 1TP7A 4IH6A 1R31A 1RUSA 3BO4A 2DR8A 3VAIA 3GONA 1BXNA 2KYZA 1FWPA 4Q8FA 1S57A 3SYZA 4I0WA 4FNHA 3MF5A 2HHPA 2K8GA 3R5AA 1VRUB 1VDHA 1RI7A 4FS2A 1NJXA 3C8YA 2L08A 1RWWB 3EX7B 4IRCA 1QSLA 1WEZA 3SSRA 1VJWA 4F50A 2JFKA 4HH0A 2EVZA 3PX6A 1B0TA 2RUSA 3JB9k 5LJ3Y 4XDCA 1GNKA 4P75A 4NZ7A 1X4AA 3NNCA 1K0TA 3GFYA 2QJ3A 2VBXA 3W3SA 4GMKA 5M2UA 2ZWOA 4RUBA 2A1BA 3JAMY 2LQ8A 4QYRA 4URGA 3OUYB 1ZM4A 4UF4A 4MAKA 3GIKA 1MWYA 4FYWB 3K17A 3R6GB 2RAQA 3D54A 4IG0A 1QSSA 1Q78A 3H8YA 1U4BA 4ID5B 4KHRA 5ETNA 2GIQA 5B0GA 3DRRA 3K0JA 3ZTOA 4WU3A 1MMNA 1ITPA 1KRPA 2MKHA 5E3PA 2DH7A 5E3CA 2BANB 4WTYA 2FHKA 2OPSB 3ZZRA 2W1BA 1C1BB 3VZHA 1GTHA 3OVAA 1IBMF 2NR0A 2GQQA 3QRPA 2VJVA 2ERRA 4Y2AA 4ES3A 1ZZNA 3KLIB 1XC9A 1WI6A 2ZFHA 2CUYA 4WFYA 3CCQS 1ZM9A 4C3KA 2H48B 2ZE2A 5M2RA 5KFUA 3CWJA 2Z56B 2B0GA 2F65A 2FY1A 3UO0A 2HNYB 1T03B 5KFAA 5HP1A 2CPYA 4E2FB 1JK9B 1SJ1A 2OD4A 4WYWA 4NLOA 1TUWA 2OPPA 2Y3YA 2GCFA 2YWHA 3GIRA 3LP0B 4I67A 2QFJA 3RB3A 4RZRA 1R8BA 2Y0SD 4DL7A 3O44A 1UA1A 5IC4B 5C42B 5F8JA 5ETQA 4TYAA 1LNQA 3HD2A 3PW4A 1LWEA 4YQWA 3MCMA 2FVSA 4XO0A 4RU9A 1OJ4A 5KOWA 4DR6J 1X4DA 1U26A 3UD4P 2Z2MA 4ECTA 3OVBA 2MZQA 3EZUA 4HYKA 4HACB 4RBUA 2R8JA 5DDRC 1WC4A 1F5CA 3CJQA 4F0HA 4WFZA 2C2ZB 2JL9A 1CJVB 3DDKA 4BC9A 2WHOA 1U2RA 4PG7A 4WK3A 1R43A 3LP2B 2ASJA 3PYFA 2RF2B 1U48A 1Q16B 2ALYB 3FEYB 3IC1A 3PNIA 2YX1A 2IDEA 4USHA 3MI7X 5F8LA 4DPUA 2Z57B 1VQNS 1L3KA 3L7UA 5HMZA 2QA2A 1AZSA 2XMKA 1ZBTA 3I4PA 5B0FA 4ES1A 2QE5A 4I68A 3MMBA 1XMBA 4WE1A 1S6PA 3CDBA 4DG1B 2CQBA 3C16B 1NJZA 3FSIA 2IDLA 4X66F 2FHOB 3PO4A 4JV5F 2WVFA 4O44A 4DUZF 3KG4A 1FXRA 2VPXB 1SJFA 4NCGA 1U1OA 1N5QA 4DDFA 2AYGA 2PI5A 1X8DA 2PO4A 4WFNQ 1IR1A 2W8KA 3M2RB 1TL3B 3LP1B 1HNZJ 1XQIA 3HD1A 4O4GA 2ZC4A 3MM6A 1RWXB 1ZA1B 1VK8A 2NUHA 1N0UA 4NYZA 1L3UA 3T41A 4UQTA 1NDLA 2IA6A 2MQOA 3K8VA 3P3DA 3TNVA 2E5JA 4OHWA 4HT5A 3RBDA 4B3RJ 3TVZA 4LFCF 3OHAA 4ED1A 1HQUA 4FXDA 2VA2A 4KGMA 4HI1A 4PABA 3KHHA 1Y5LB 3D66A 4HEA9 4DL0C 4P71A 4X65J 2MQLA 5DJBA 4PRFA 2QG9B 2FLLA 3AD7C 1MN7A 4WWSA 1X5OA 3OQ2A 3HFKA 2V94A 1U2CA 1VQ6S 3J80Y 3TZZA 1XBWA 1PJ7A 1KOOA 4AUKA 1OSCA 5F9LA 2KXNB 1RQ0A 5E3RA 2IRUA 1HHSA 4UOFA 2HFSA 2H51B 3SCKE 4LF7J 3BGFA 2ZUAA 2AX0A 3CCMS 2AZ1A 2C2KB 4DZDA 3CCZA 3DMJA 1OO0B 2XEXA 3MEGB 3I31A 4FXWA 3PEJA 2AWZA 4WP3A 4FYDA 1X9WA 1HYSB 2GAHC 4X4VA 4JI1F 3HVTA 1H74A 1HD0A 4QIGA 3KMSA 3MR5A 1VQKS 2JC1A 5FIIA 4Y0FA 3D1HA 3I5AA 3QGGA 1MNEA 1R3NA 4YR0A 3RW7A 3LA0A 1M90T 1C1CA 1TK5A 4JI3J 3BBFA 2RVJA 1ICEB 3MAAA 1UJ6A 2DHSA 4C8KA 3MECB 3NRBA 1UVJA 1YRXA 2I0XA 2EKNA 4OZNA 2DNGA 1M5VC 4NXNJ 3W8GA 5J1EB 1XNQF 1LW2A 2MLZA 2ROPA 4KFBA 3MEEA 4JI0F 1QAJA 4UOHA 2A6OA 4OJHA 4UOCA 2UU9F 1LXJA 4ZN3A 3BBCA 1UZDA 2HHHJ 2DNZA 5CYQB 3MMJA 3MCNA 2JC0A 1N54B 1XMQJ 4TQSA 4LVNP 1N52B 2HAIA 1NH8A 1TUGB 2FVQA 2BOPA 4OL8A 3BPSP 1HWLA 1FHTA 1IBKJ 1RT2A 5L1JA 5C7PA 2HBRB 2BJ3A 2ZHAA 1N33J 4M95A 1IBLJ 1UWBA 3NGRA 3GJSB 1FCAA 2FJBB 3TRGA 4CI0B 2E5HA 1N5TA 3Q8YA 2V0NA 4OYXA 3AJ1A 4WE1B 3V4IA 4I6YA 3PYEA 3CMAS 3CT9A 5ETTA 4M5IA 3F0NA 2HRUA 5L1IA 3KLEA 1R7IA 1ULRA 2CZ4A 4ZPWR 2XNQA 1Y4ZB 2OGUA 4FN5A 4QCLA 3SQGA 2XMTA 2VFTA 3TZWA 2GQCA 1RT1A 3M2UA 2PIIA 1NKBA 4ZPAA 1CJTA 2E1CA 5KG3A 4NLXA 1U8WA 3M8PA 3Q2SC 2BEFA 3AD9C 3AOBA 1F2HA 2YH0A 4OLPA 1WDTA 4FVCA 2V2QA 3KUEA 3C15A 4DU8A 3KUHA 1FNOA 1T02A 4QWDA 2U2FA 5HJYA 2QLWA 3U1LA 2GZOA 5KT2A 2D1CA 3QGHA 2WOMA 1OS5A 2CQGA 5CD4H 1RT4A 3Q8RB 2IAJB 2XHWA 4WU2A 3IBWA 2MXYA 3PR4A 3NGDA 1Q5YA 3EICA 2NUUG 4RW9A 5LSRA 4Q45A 3OBIA 1SJQA 2XB2D 4U8VA 3IA0A 4GKJF 4WIIA 2FZGB 2EEYA 5AJ3J 4LRDA 3DRSB 2NSBA 4JB8B 4V19J 2CQHA 2LU2A 2NXNA 1ZA2B 4N7TA 2DXEA 4H4MB 4ZPVR 1M0SA 2Y1IA 3AODA 3BM7A 3DRPB 3DKDA 1BLUA 2CQ0A 1BHNA 3IWXA 2G1DA 5KAKA 3ZZUA 4ED8A 4B3TJ 3O1LA 1W2IA 4KRWA 3AB4B 2B51A 2QFIA 2J76E 3ELHA 3OR1A 1ZTTA 3R5BA 2XWYA 2BM0A 5GAGI 3LQVA 3HVTB 2R7WA 4B02A 5KFHA 4X4PA 2HMIA 3SZ2A 3JQKA 2BJ7A 1R8HA 4F4XA 4TLRA 2V5HG 2KXHA 3AFGA 4EGLA 3FCWA 2OP5A 2D9PA 3RBZA 2OI2A 4A46A 3X1LB 4AD6A 3TZYA 4TQRA 1FRXA 4LFAF 4DS5A 3W61A 2ZC3A 3H98A 1S1WA 5ETLA 2DKOB 3I96A 2RNEA 3I82A 8AT1B 3UDVA 2RDJA 4NCBA 4ES2A 1M5PC 3SBMA 5KFEA 2MHEA 3UFCX 2C2MB 1ZH5A 2Q43A 3JTOA 1NK6A 3HI9A 3T1HJ 4DR6F 1UW9A 4C48A 5IS2A 2ZJQQ 1FJ7A 2OD6A 4TYBA 3IRXA 2FB0A 4KQZA 4N8NA 3I32A 1H3DA 4U8YA 3TVYA 3GJTB 2UV8G 5C25B 5J2QA 2JLFA 4WK1A 5C24A 4RKUC 1Y3KA 1QUPA 2C42A 5I3PA 2H9ZA 2F9JA 2IM0A 2AW0A 3G8QA 2JLGA 3N79A 1RAJA 2C3PA 1UZHA 1MWQA 2DO4A 2W01A 2BQRA 1UWBB 1YKWA 1U2FA 3CC2S 4KKOA 4FXVA 1BMQB 4F04B 5KFQA 3M8QA 2D69A 1TKDA 3M05A 4HLBA 3BS9A 3C14A 5LXYA 3I5CA 3V4IB 2VU5A 4RNOA 2NYHA 1REGX 2XLJA 2FJDB 1RTHB 4K4UA 4QU6A 4ZVQB 2ILZA 3CCLS 2B9YA 5CYMA 2LEAA 4R5PA 2DR6A 2VPWB 2ACMA 3M9NB 1HHQA 1FO1A 2IBKA 3DRYA 1V6HA 3RRGA 3P49B 1U02A 1DAXA 2OHDA 3IAS9 3H5SA 1DTQA 2RE1A 4DUTA 1YBUA 3TJAA 3FBBA 1SB6A 4CH7A 1L3TA 3UR0A 1FA0A 2IJNA 3H2LA 4NLGA 5T7LA 2DYAA 5DETA 1RTJA 3QZ8A 5GMEA 5IQQA 4QWAA 2VB6A 1NKCA 4QWEA 1YITS 2DD8S 1FNXH 3A8EA 1WF1A 2AGOA 1HNZF 3HFZB 1TELA 3ISND 3J7YI 4DV0J 4A8KA 1HBMB 1HLWA 1RT4B 2LQJA 3OLAA 2VV5A 4NLRA 1YJUA 3RAXA 1LK7A 4OI2A 2PA8D 2AD9A 2RHSB 2YNFA 4RW9B 2E1RA 1SUQA 3WBZA 3DHWC 3B4DA 1SC6A 2KM8B 2CQCA 4B3RF 2NYIA 4QIWD 1MROA 2F7VA 2FC9A 4YMEA 3FKBA 4WZQA 3MDFA 3B78A 2GQ2A 4UY85 3M1VB 2IM2A 3PRDA 5HO4A 2MHNA 3TP2A 4WJBA 1Y10A 2KT3A 1VQLS 2DR9A 4DL6A 5LT5A 3UQSA 2RSQA 3KHGA 1RT5A 4CLSA 4DFKA 1T3NA 3FRZA 1C0TA 2LDIA 1A6LA 2PGCA 2OMOA 2ZITA 3OR1B 5AXNA 2E5LF 4LF7F 3Q24A 3I9V9 1UMJA 2ZH4A 3MUTP 4MFBA 3DRXA 4CLFA 1YG0A 2CZ9A 2PT0A 1VBXA 2XHCA 3RTVA 3B8HA 3VF0B 3T5LA 1Y7PA 5KFPA 2HMIB 1D8ZA 1X7VA 1WHWA 2I6WA 4YR2A 2LVWA 1W7WA 4WP8A 4DZ6A 3AXMA 1WORA 4ZKAA 1N5YA 2C1EB 3MD3A 3GIJA 4YEAA 3PR5B 2WVCA 1S1WB 5I3UA 2NREA 2CQ3A 4F4AA 3QRQA 5G4DA 4JUZA 1JLEB 3V5RA 2OTLS 4K50A 2CVEA 3PW7A 2UV8A 3G6ES 2KN4A 4DOZA 1AFIA 4DV5J 4AFFA 2FUG9 1VIOA 2GIFA 4QQBA 1FI4A 5A8RA 3N5FA 1SH3A 3Q8VA 5A8WA 1RT6B 4NXNF 2RIJA 1EIYB 3PJ9A 1KVKA 5DDOC 2W24A 4TU9A 4QR2A 2HG4A 5C24B 3HK2A 4Y2CA 3CDWA 2XMMA 3ZFVA 3CD6S 2MYFA 4I7FA 3IM9A 2DNOA 2YNIA 4Y2MA 3PJWA 2B4OA 3KJQB 5LJ5Y 1XMQF 4CLKA 4QWBA 3NOCA 1SCJB 5KFRA 1ZAWA 5HMXA 3CO0P 1RKIA 4M5NA 4ZVPB 3C14B 1IBKF 2QMWA 4DR3F 1RYSA 3OT9A 1WOOA 2G13A 2BABA 5F8GA 4PWDA 2AEFA 3M32A 1N33F 4QIEA 1S0NA 1IBLF 4F67A 1PYOB 2FQQB 4WF9Q 1RSCA 3FBFA 3NXZA 4YN3B 5D0HA 1UVMA 2CQIA 4PKDB 1CULA 5K5MA 4J5OA 3GCWP 3W62A 2RQCA 3VGSA 2XZTB 4DR1J 1V3SA 1ZTWA 2IIHA 3KKFA 4EUVA 3LH2S 5F41A 4IH7A 2MZJA 2YKMB 3ITHA 2H4WB 3D0HE 3NNAA 1JMTA 4KPCA 4M94A 4MKBA 3R1LA 2B5JA 1RAAB 1WEXA 2OKQA 1RTJB 3G82A 2WONB 1OYEA 5L38A 1FERA 3K5MA 4DSLA 4EO8A 2Q79A 2HPUA 2HLTA 1RBOB 4RNMA 2UXDJ 1S6QB 4EBCA 1IR2A 4N41A 1REVB 4JV2A 2FHJA 2DBBA 3TUJC 4X4UA 4MYUA 4RW4B 1IKXA 1JKHA 4DR7J 3FK4A 2RKIA 3KUGA 1YLXA 1OPIA 3H20A 4CT8A 2XYHB 4R8UA 3AJDA 3W9HA 1D9AA 2FTRA 2RILA 2E5IA 3GSDA 3T3FA 4F02A 4WIQA 1RAGB 5FLXU 3HFVA 3EM1A 2IYIA 5IFMA 1FFSB 2I38A 4LSLA 3CCWA 5AJ3F 1RT5B 4ED0A 2MB0B 3UD3P 4NZ0A 3FC9A 3HO1A 5ETSA 2OPRA 1NNDA 1U6BA 4X2BA 4DEZA 1TFWA 2A10A 2DRDA 2WTFA 4M5DA 3RGIA 3OHBA 1TKXB 1N4LA 4RBTA 3VAHA 1SIWB 3QLHA 2I5JA 2EFOA 4LSNA 3IM8A 2AT1B 2B9WA 5K14B 1MU2A 1N5YB 5D15A 3PRVA 3HM9A 5CHCB 3TAPA 4PXBA 5RUBA 4OZJA 4JYAJ 3PTWA 5I3UB 4KIAA 1H2TZ 4P2MA 1WC3A 5E2QA 5FD1A 3J7Z5 4DMZA 2VDIA 3D6FB 1PJ5A 1R0CB 2V63A 8RUCA 3W9IA 3CXCR 3CGIA 3BGLA 3I5BA 4U7UD 5J1PA 1R27B 5HN0A 1UP1A 1TVRA 4MK9A 5A8RB 5A8WB 1FKAF 3BQ0A 4U6PA 3PX0A 3DOKB 2FVRA 2IRYA 1GMWD 4KC5A 2PE8A 2BDPA 1NZAA 2MKYA 4KR0B 1S48A 2E9RX 5EUHA 4ZLLA 1N32F 3P45B 3QJPA 3T1HF 4JI6J 4JP8A 1UAWA 3DGPA 1UPPA 1SI9A 1LFPA 1WELA 4DWIA 1S1TA 1WI8A 3R5JB 2CYYA 4D3GA 3AH6A 1ZPWX 2AYEA 4LQ3A 3IG1A 2KU7A 2QA1A 4PXEA 3VVUA 2M7SA 2HBQB 4JOUA 1NJIT 2V8VA 1URNA 3TARA 2DGSA 4V1Ak 2R2RA 3Q83A 1CULB 1S1UB 1Q7YT 1EETA 4B9MA 3J81U 1YI2S 1B99A 1GAOA 4Y00A 3C6UB 1QY7A 2DNYA 3ITHB 2CJBA 1UKUA 3U27A 3CMQA 3KXDA 3DM2A 4PPDA 4ATNA 1EJ7L 3MM9B 5BYSA 4DFPA 1GXTA 1FKPB 1FT8A 3PFEA 2VG7B 3HKZD 2M0GB 3CULA 2DIVA 1HPZB 2HVEA 3QBCA 3LWMA 4K2XA 4LR9A 3UI3A 2BV3A 2BE2B 2CIMA 3TOQA 2G0IA 2W9BB 2JWNA 1FESA 4OZ2A 1HNWF 3CTRA 1T9XA 4K4XA 4N76A 4IG3A 3T6JA 3CO9A 5HK4A 5D8HB 2EFVA 1RHUB 4DV0F 5KFKA 1U1KA 4R8UB 2BBEA 3OD2A 3J7A1 4LF2A 1VYAA 4ZP7A 3EUNA 5MAOA 3PIPQ 2WVDA 2VQFJ 5DQIA 1DZ5A 1X31C 4W90B 1WOPA 2CJ9A 3OR2B 5IWAJ 1XMOF 4KSEB 2IBOA 4ETXA 1S76D 1CQMA 5ETPA 5THWA 4O3NA 2XZDB 1VFJA 3M8ZA 1VCTA 1JIHA 4CO2A 4DV2J 3PY8A 5A76A 2HKEA 4OV6A 4DI6A 3N0VA 2V2VA 3KNAA 1FEEA 5GMKa 1VQ4S 4ZP9A 2HYIB 1S97A 1DTTA 4HR2A 5CCLA 4F7VA 3PVXA 3K5NA 4OZ5A 2OPQA 2J0QD 2AJFE 2GHVC 2YPZA 3CJ8A 1QLNA 4XAKA 4QIFA 3VGUA 1WDDA 2QA4S 5E33A 1JLBB 2XWXA 1X5TA 2MSTA 5F3TA 4M5HA 3CCJS 1HR0F 2RU3A 3BN4A 3H2UB 1SXLA 3NMRA 2X1BA 3W2VB 1NK5A 3ETMA 3KLHB 2H5EA 1KOHA 3I0SB 1QAYA 1QE1A 3MOZA 2CJXB 2YKOA 4J9KA 4B9VA 3CC4S 4KT0C 1GT8A 3POTA 5CYJA 2G9OA 1U0HB 1IKYB 3RG6A 1N88A 1J5OB 4DLGA 1VBZA 4FYYB 2OUGA 4K4TA 3CJKA 5D6GA 1RTIB 1RWMB 5FLXY 3V4MA 2HS3A 4FPRA 2CPZA 2F40A 5GADU 3V6DB 4ZCLA 2PFFB 4C8NA 1TU0B 1H38A 2NCKL 2B56A 3GJRB 3MEKA 2CQ4A 3OJUA 3BO3A 1DQAA 3E01B 3T5KA 3A12A 4N5SA 3IG1B 2ADBA 4ZOSA 3Q8PB 2J8AA 2QLFB 1WSVA 4QW9A 1L5UA 2QSFA 3U1NA 3R2DJ 1EETB 3BF4A 2H3EB 4X64J 1HBOA 1LW0A 3PYDA 1KNZA 2ATCB 4LBHA 2W9AA 1F60B 2DHGA 3NCPA 4MT1A 4TN2A 1BY9A 3GU0A 3JTPA 1OPZA 3DLJA 4A8QA 3UCZP 3B54A 2K3IA 2QN6B 3DM2B 3QAUA 1J5EF 3BDEA 1VQYA 5CQGA 4P10A 3AHPA 5F3ZA 1ZM3A 3HHDA 3R7NB 2PSZA 2IRXA 1QTNB 3AA9A 4KE5A 5LOQA 2V4JA 3JQJA 2F1FA 1F3VA 3IAM9 4UZCA 2ZD1A 4ZCKA 4WXOA 4USMA 5J1NA 5H9FJ 3CC7S 2L48A 1VQPS 2Q66A 1Z4UA 2XO6A 3EVOA 1WHXA 4B3MF 2JLEA 3Q8SB 4G1QA 1I94J 4CLYA 1WUUA 2D3OR 2UXDF 3QPIA 1NSQA 3VV2B 4F36A 3W2WA 2W8LA 2H65B 2FLOA 2RU9A 4M5MA 1HBNA 5C2CA 2FHMA 3DOLB 2XSJA 3ILLA 3NGSA 4CM2A 2RH3A 4RX6A 3PJXA 4ECQA 4JI8J 4DR7F 1QM9A 3CPWR 1RGVA 1XR7A 2H1YA 2LLZA 3QJLA 3NGUA 1PYTA 4L76A 1GFWB 3SCJE 4KHPJ 1TTHB 2YWKA 1U8SA 3MPWA 3HZEA 4M5LA 2ZHBA 2DIUA 1K1QA 2MZSA 1ELOA 4ICLB 4ZVUB 2ZBRA 1P27B 5FDLB 3TANA 1VC5A 1XIQA 2FIUA 3WDOA 4UZBA 4FS1A 2K3KA 4HDHA 3RJMB 2L9WA 2XMUA 3KJVB 2ZDPA 3IGNA 1U6ZA 1HNXF 5EWGA 2X3GA 9RUBA 3PM9A 2JEFA 4KGKA 4ZJLA 5A6WA 3BYPA 2GVDA 2UVVA 2YKAA 3AY0A 3SCIE 5U47A 2VD3A 1HWIA 3TR5A 2H5JB 4KAIA 4DCJB 1TR0A 3WX8A 2B4VA 5CCMA 1WTFA 2GMJA 3BKFA 4N8OA 3TA0A 2HQ3A 3MM5A 3FFIA 4B3OA 4U67Q 3I0RA 2YWFA 4DQRA 3IS9A 2QLBB 1WHYA 2W2MP 5DZ6A 3U7JA 4IO1A 1FX4A 2VFSA 3LO3A 6AT1B 1PJ6A 2BXJA 1VQMS 4HTJA 4PR6A 2ZM6J 3JSBA 3DLHA 5LSOA 1QAIA 2DJWA 4JYAF 3M8SA 5CZXA 2VOOA 3ENQA 2LQ5A 4LMZA 2DRAA 1UCNA 3CJKB 1VHFA 4A8XA 3W7BA 1KQSR 1T9WA 3MEDB 3ZZPA 4EYIB 2ZKUA 2CADA 3TAMB 1A7GE 4B9NA 5FJ4A 1CJUA 2MKCA 2AF6A 4C7QA 2WK4A 3PKYA 3MR3A 2HQFA 2VASA 1OMSA 4M63A 1KC8T 3C19A 1WF0A 2GNKA 2X1GA 4MKVA 4KV8A 2HHWA 3DLGB 3L4BC 2L9NA 4CTAA 2MZ1A 5J2MB 4ELUA 1YZ6A 2P9EA 2YVSA 4JI6F 1K1SA 3TA1A 2NXCA 2ZBCA 4F4YA 4JBCA 3KK2A 5KOXA 4U96A 1R8AA 3K8WA 2RD5C 2XMJA 2O66A 3B82A 4OI3A 4F4WA 3T5HA 2YX7A 2IY5B 2B7BB 4X62J 2MKKA 1WACA 4X4OA 1N5VA 2FJVA 2BZ2A 2MGZB 5GAGU 2BQ3A 4GC7A 1EQ0A 4TY8A 4ZJQA 2VH7A 4NXMF 4RLEA 3EXYA 1JJ2R 3UVJB 1M5OC 2IHR1 2E7VA 4LF9F 2EWHA 1YRTA 2I2YA 2HHQA 4HI2A 2DXFA 3CCRS 3G86A 1FKOB 1VBKA 1M1HA 1SJ3P 1FK9B 3U02A 2W7PA 1RAIB 1F5AA 1YWXA 3FQLA 4WXWA 1CPZA 3EMTA 4LRFA 4NA1A 4GVLA 3R1HA 3W2WB 1D9FA 3I6PA 1RTDB 2H5IB 4FF2A 2Y0BB 1JLGA 3SSQA 2C22A 3ET6B 4WTOB 3C6TA 3KK3B 2F4VJ 3HHEA 3GIMA 2LU1A 3IWLA 4MIBA 2CJYB 2HVDA 1JJCB 4P7TA 1O0PA 3OFFA 2PFDA 3SV3A 2YXLA 3ENVA 1NO8A 2VL1A 1NH7A 1T0TV 2M8DB 5IWAF 2M4MA 2YWEA 4NLSA 1F9HA 1IKWA 3DOMA 2XY5A 3EYZA 1BWVA 2GW8A 4C8OA 2IYGA 5SUHA 2HIQA 1AROP 2ZBPA 2ZZMA 4GO5X 4OYPA 4FKXA 4WKRA 4ECRA 1W25A 2R8KA 4ZVRB 2Q6CA 5KG4A 4PQUA 2V2ZA 4EEYA 2M2BA 3PHTA 2QA4G 3MM7A 3N01A 1KFDA 1M1KT 4USTA 1NMEB 4BS2A 1EZZB 8ATCB 3IRWP 4EZ6A 4AQYF 1IBCB 4LR8A 3BH6B 2A18A 4Z37A 2ZEJA 1Q95G 4P2XA 2GVZB 5CZVA 1VRUA 2V9WA 3MCOA 4O0NA 3P8BB 5KFYA 3TJ9A 3KLVA 1U47A 1S0OA 1T9UA 3N28A 2HURA 1CLFA 2QL5B 1E6YB 4P52A 4ECVA 1KP6A 2BOAA 3IP0A 4LQ9A 4K0KJ 5LMNF 2FVCA 4OHZA 4O3SA 4DV6J 3OUYA 3LGNA 4JI5J 4DHVA 3OXGA 2XNRA 1HWUA 4OJ1A 5KFMA 2EFNA 1CSJA 1X4FA 1IR0A 2VOPA 4ID5A 1HNIA 4KO0B 2D74B 5KFWA 1LQ9A 1N34J 4DS4A 1NK8A 5LM7E 2YY3A 3M2VB 3KLFB 1ZZFA 3R3TA 1X0PA 1QVFR 2CG8A 2QO3A 5KG0A 4KTQA 2BANA 5L9NA 2M52A 4ANDA 5DDPC 2OPSA 1PAEX 3IR6B 2M3DA 4RO0A 1G1XA 1C1BA 4OFZA 3PW0A 2FJXA 1NBEB 3C66A 3NMAA 2K1RB 3OFGA 5HQ8A 2YWWA 2WBMA 3RAMA 4C3LA 1RE1B 4WBFA 3KLIA 1C0UB 3A13A 2M9KA 4RR5A 1CQNA 2GHWA 4YY3J 2P5VA 4X64F 3DN9A 1D3WA 1TK0A 5D4LA 2V8PA 2HNYA 1T03A 2XYGB 3BN7A 1K47A 1LKZA 2R7QA 3EDQB 3IN5A 1H7WA 2EK1A 1UFLA 4GKKF 3DNCA 4Q2LA 4UW2A 3LP0A 2JSXA 4DL5A 3TZXA 2HNDA 1I6JA 3D0GE 4IOAQ 4A8MP 4TU8A 4KBIA 5C42A 4BBYA 4ZLNA 1BC6A 3V6KA 1SIZA 3MMCB 1S10A 2IM1A 2QMXA 3FSYA 4FDFA 2W2PP 1Q82T 2VICA 3IBFB 1YBTA 2MQPA 1T3OA 2D41A 1FDAA 4HVZA 2F8EX 2ASDA 2MJUA 3VGVA 4HACA 1I94F 2IJFA 5A6PA 1QSYA 2DISA 1NM2A 4DV1J 1TUVA 3T6BA 3FMBA 2KG0A 1YRUA 4OX6A 3SDEB 3D2WA 1CJVA 2E9ZA 1FRIA 3PRBA 1FJGJ 4OI4A 2CNKB 3TQEA 4OJGA 2Q3PA 4F2RA 2J7KA 1UL3A 3LP2A 4CNZA 2RF2A 3I4HX 4PWUA 4ELTA 1RJJA 2HS0A 1HQEA 3DOMB 5DQHA 1HNVB 2VBZA 2CQPA 3FEZA 3BZQA 3FCVA 3J80U 1DQ9A 2CNLB 4A47A 1X4CA 4F26A 1HW8A 4LSZB 4W4MA 3P5BP 4DG1A 2QMUB 3C16A 4PYDA 2RS2A 1DFDA 1YBAA 1UW4A 2OO4A 1FFWB 4PZVA 3SXLA 5H9EJ 3RB6A 3FNNA 4D3HA 1EX8A 4IKAA 3KOAA 1N48A 3T1AA 5IT0A 5D78A 2AX1A 5JVGQ 1KVIA 3BGRB 2UUWA 4CLUA 4I6WA 1U1NA 2UXBJ 2WBRA 3AXKA 4CO0A 3NAIA 3M2RA 1TL3A 3LP1A 4XPEA 4HKQA 3O3LA 2ADCA 1HI8A 1XN9A 4HHHA 2ZDOA 3MM8B 2KTQA 1DJ0A 3V6JA 3D7SB 2J6SA 4Y2KA 2HW3A 1QUVA 4K59A 1VJQA 4ILMA 5HLFB 4Q2MA 3PW2A 2KFZA 4O4RA 3H4BA 5IM0A 5AXLA 3G8SA 2XS5A 4JV0A 2CA9A 2V6AA 4KY3A 2APOA 4DR4J 2W7AA 3CMES 7FDRA 1PBUA 5HAOA 4CLZA 1HNIB 3UPFA 2IC3B 3DGVA 3D68A 2N3LA 3GSIA 3D28A 3F41A 3GP9A 1S59A 4WFAQ 4R0JA 5JJBA 1RA7A 1BD6A 4FBTA 1VR6A 1RU2A 2YX4A 1C4CA 3BV8A 1R6YA 3JSMA 3DYAA 3TQ1A 2YKNA 4J91A 3W9JA 3W60A 4ED3A 3TUZC 3NNHA 2ZH3A 4OV1A 1S9GB 1NZ8A 3NG8A 3QGIA 1OY9A 3MEGA 4C0BA 2JNJA 5AXKA 3QWPA 1HI1A 3NL0A 3OPKA 1EHWA 4J9LA 4XDDA 4X62F 3N4WA 4QJVA 1HYSA 4CLLA 2VFUA 3OL9A 2DY1A 3MGJA 3Q86A 3FCHA 5HMWA 2C2RA 3K7RA 4ZDNA 3Q2TC 4TY9A 2QC3A 3OV7A 4MTPA 2ZUGA 3EJMA 3TAQA 1H7XA 1CVJA 2HNDB 2H4YB 1T94A 3OTEA 4ECUA 2EG2A 3EPIA 3T19A 1M5KC 3R7BB 4ZHRB 3MECA 2UXCJ 3UCGA 4IFVB 1FRJA 3T9ZA 3NEKA 2PN6A 1NK4A 3A3OB 3GYGA 4CLWA 5AE3A 3DXSX 2F8HA 2PMWA 5L9XA 3L3CA 3G6YA 5J1EA 2FZCB 2ACYA 2A0FB 4I2QA 2IVFB 1WG5A 1X9MA 5IXUA 4NEZA 5CYQA 4LF5F 3HX9A 4ZVSB 2F4VF 3OSNA 4N47A 2KT2A 3G2XA 4RW8A 2R8HA 3HHLD 4F2SA 4DV4J 1HQEB 2CQDA 5HL7Q 2HFNA 1G3OA 4LRCA 3L09A 4NI2B 1DBDA 3BB5A 3DLBA 4FF3A 3OW2R 3H90A 5KT5A 2YQ3A 2ZVIA 3Q23A 3L7PA 1LK5A 3BJYA 2B9XA 3HXMA 1VC0A 2IA0A 4LJMA 2EBEA 5E3QA 4Y2IA 1JLAB 5J2NB 2GFFA 1WHVA 3O5TB 3IBCB 2DGTA 4MIWA 1EP4B 1CEZA 1U09A 1PYSB 1M1GA 2DGVA 5GAEI 3GIIA 4AXJA 4I2PB 2G1HA 4YR3A 4DV7F 1S1VB 1UVNA 1S12A 3SFGA 3DDIA 1T7PA 5B0EA 4CO1A 4H4KA 3UDEA 1S49A 1TKTB 5HSPA 2VONA 4IDKB 3MCSA 1DURA 4I4BA 4C11B 5E0OA 4FZVA 1HQ2A 2MKSA 4O3QA 4PXCA 4DUYF 2CRLA 2IAJA 3N5BA 4CM0A 1JLFB 3D5MA 2XGQA 1CG2A 2OH2A 1ROFA 4EWTA 1XNRJ 3AB2B 2JVRA 3MR2A 5IM0B 2IM3A 2XULA 4KHMA 2YQ1A 4B9UA 1SJ4P 4U7CA 4FYVB 4WP9A 5KT6A 4NE9C 2N7CA 3VZIA 4DV6F 2HRYA 2MQNA 1TAQA 2L41A 3DRSA 4JI5F 4TNOA 2XLIA 2QV6A 1T9VA 3TI0A 4ZITA 4H4MA 3NS6A 2HRTA 1HMVA 3JSMB 3DRPA 3DYAB 3MZIA 3L95X 4ER8A 2YKNB 3CJ4A 4RUHA 4JI4J 1TZ0A 3PIOQ 5DZ7A 1O8BA 4J9OA 4LBIA 4UUWA 1FTCA 2NXEA 1HIYA 2C28A 2K7KA 3T5JA 5B0DA 1BQMA 2G4BA 4XK8C 4YY3F 2HQCA 4DQIA 3IFEA 2KJWA 4EK2A 1OY6A 4Y65A 1PSDA 3OVSA 4OLOA 1HFEL 4AL7A 1U49A 4K2JA 4O3PA 4OI0A 3CJ5A 4DFJA 5B08A 2CDQA 1RAOA 2HFVA 3ILOA 3RRKA 2CPXA 3LWLA 3UW1A 1IBMJ 4I2QB 1S1XB 3KWMA 2EI5A 4J90A 2G0JA 5A8KB 3AOAA 2B3TB 2DITA 3HULA 4KB7A 2Y8WA 4UY8T 3V81B 2ASYA 3HSJA 3FGVA 1F9FA 2AZ3A 5HATA 4MH8A 3NS5A 1VQ8S 4DV1F 5C25A 4RW8B 3PDNA 2R8IA 2FDNA 4RW7B 2VF3A 1OQ6A 1K73T 1VISA 3AT1B 2C3MA 3GYXB 2XYPB 4NL5A 1FJGF 2F3JA 3KJFB 3CJ2A 2IJRA 2HBZB 3BH7B 1G4CA 3DLKB 2KFNA 3TYTA 4LRBA 2Y8YA 4C97A 1H2UX 1NSPA 3CDAA 1RTHA 5BJRA 1DLOB 1GEHA 4AYBD 2O67A 1ZS6A 3FJ2A 5CAAA 2FY8A 1JLCA 2E1MC 3BBBA 4J9NA 2OIHA 2ZH5A 1UA0A 5AT1B 4PYAA 2VPYB 4ECSA 3SSSA 1U45A 3JTNA 1HD1A 4OYAA 1HBUB 3HSDA 4ETZA 2D3UA 2AQ4A 4DSFA 2XTJP 4PUOA 1JXEA 5KFIA 2UXBF 5HROB 2HBYB 1KLMB 4M1KA 2DH9A 5K9FA 3G96A 2DH8A 4XPCA 4A8SA 3NP5A 4P72A 5KG2A 1F0XA 2IMOA 3R5GA 1HBMA 2A2CA 3K89A 5K20B 3CEDA 1VS3A 1Y3JA 4GVBB 2AKWB 4KGZB 1S0MA 3IR5B 4UT4A 2CNNB 3PO5A 5I4MA 2RDDA 2J9CA 4LIRA 2CPDA 4A4JA 2W4PA 3WX4A 1NU4A 3R8YA 2M5YA 5B0AA 3M1VA 2MPUA 5KG1A 2HHUA 3GV5B 4DR4F 3PEHA 2YBVA 4L73A 1HMVB 4ZJOA 2VG6B 3ISZA 2V4QA 3AOCA 3QYYA 3R5DA 1PCAA 2WSEC 5DGBA 4NA3A 3CJ3A 2JH3A 1NPPA 3R6LB 3ZC4A 2MDAA 5KFNA 3OJSA 1SH2A 3HVWA 4FF1A 1FWKA 1B0PA 1D0EA 5A2QU 3HZGA 1BQMB 3QAEA 5K8OA 3GB0A 1FRMA 4QOTA 1ZOTA 5DRKA 2YNGA 4LUBA 3DI6B 3G87A 1IM4A 1NDCA 3CCSS 3VTIA 1XERA 2W2OP 1X60A 1FE4A 3MFHA 1SKWA 2VHGA 5DG7A 2RMLA 4G3IA 4DPXA 5K8NA 3KTQA 5KG5A 3VR1A 2HEKA 4DPOA 1TAUA 5GMDA 4QW8A 1FXDA 1F2GA 3OTDA 1PBAA 1KBRA 3SIPB 2HFZA 3LGMA 2XS2A 2ZHOA 1JLEA 4K7QA 4ZS6A 2E7XA 4RUCA 5HQMA 1SQFA 1I5OB 1AB8A 1W26A 1FRKA 1D1UA 2EFPA 3KG0A 5ADZA 2KH9A 2OAUA 1S9EB 2UXCF 4DQQA 2UP1A 4ZN1A 2CVIA 1UEKA 1AA1B 3ULHA 4ZA1A 1FXLA 5DO2A 1RT6A 2DTJA 4MKYA 3CNQP 4OYMA 4JI1J 1Z1ZA 4B3SJ 2XZWA 1AFJA 1HKAA 1X5SA 2E1AA 2UVUA 2GGPB 2YTCA 2JEJA 1X5PA 2B4PA 4EFAC 2CNOB 1GQEA 1XR6A 2MQMA 2R7VA 3THVA 3MXHP 2B43A 2FPHX 3H2VE 1Q1KA 3QT5A 2V34A 4F3QA 2F63A 3HJFA 3PHEA 1PO6A 2QYCA 2MKJA 1LWFB 1JLCB 2AGPA 2HAFA 4ELVA 2HIYA 4ZPTR 1XNQJ 5C5JA 2B6AA 4ILRA 1TV6B 3PV8A 3IXQA 4JI0J 1S4EA 4WPAA 4ERDA 2HGNA 4OIXA 2YKMA 5E41A 2KM8C 1FF2A 2UU9J 2KB2A 4EMDA 3CCVS 4FF4A 2AYBA 2LYVA 2AJ0A 2WSCC 3MPUB 1RWOB 3QIPA 3J7ZT 4PUOB 5AE2A 2UUTA 4AXIA 2GHPA 2WONA 2BE7D 3A8KA 4NLQA 3HVRA 2ATLA 5LMUJ 1R89A 5CH7B 1EKSA 3FEXB 1Y9OA 3BKTA 1R0AB 3EGNA 4IYQA 1S6QA 4Z2XA 2BW2A 1IQTA 4PG4A 3LPEA 4Q44A 1HA1A 1REVA 4RW4A 3GWCA 2BVZA 3RAQA 4EU0A 5HBMB 3M8RA 2QL9B 1SV5B 3VCDA 2F4FA 2JZ5A 1SL0A 2B4UA 4URSA 1UPMB 3ZZTA 2BR0A 1FDNA 1RHRB 5E3AA 2P9CA 1XNRF 1O6XA 2VODA 4NX9A 2X1FA 4X65F 2BQUA 3DLEB 3EGWB 3HMJG 2VQEJ 2BRLA 3EWGA 3D9BA 3FBCA 3QQCD 3M30B 2CQ1A 1VQ5S 3DU6A 1K44A 4FVMA 1HL6A 3F73A 1RBAA 3HT0A 3HVAA 3THTA 3EZOA 3PYGA 3LALA 1MG7A 2ZBQA 3H7HB 4P73A 1V5VA 1TMJA 1Q8KA 4JI4F 1VRQC 4LIWA 1FJEB 2GO8A 4DPWA 4KJIA 1TKXA 4DX6A 3UN5A 1KDNA 3HHLB 1RB0A 5D77A 3GLJA 4QYZJ 1RCOB 2YNGB 1KONA 3QGPA 3QMQA 4RL1A 2DGWA 2JDJA 1YJVA 1M5HA 4A8WA 2OMLA 3ZNUA 4MK8A 2QEXS 2J8SA 4M5JA 5JVHQ 5K14A 4GKJJ 5M2PA 1HWJA 4CLTA 4WFBQ 2XCAA 3JSRA 2XC9A 1M5SA 2VA3A 4ALZA 4DR5J 4HH1A 2AIRB 2HHXA 2MQQA 1KQKA 4C8YA 1G7CB 2MY7A 4JI3F 2HZVA 3AAWB 1RCXB 2XLKA 1VLYA 3PW5A 3VWSA 1URRA 3H42A 2BYCA 3NS7B 1NB7A 1N36J 2K7JA 3UWTA 3TX8A 2WB4A 1NEEA 2FD2A 3DOKA 4JV1A 1FDBA 4LVOP 4IR9A 2MTLA 1YJ7A 1KEKA 3H5UA 3K57A 5G0RB 2XY6A 4K4ZA 3FRYA 2AP6A 3WIUA 3DLLQ 2BJ8A 1RWUA 5H9FK 1RT7B 4CYUB 1U1MA 2HHHF 1VRTB 2CPEA 4C8ZA 1GMVA 2BJ1A 4M5GA 2VG5B 4CT9A 4YS2A 3VAGA 2GIRA 1X4BA 2HS4A 3QWUA 5KFCA 4I1TA 2KDOA 4DPTA 2E7WA 1YZ7A 2P8IA 5A2QY 1BQNB 3R97A 4LFAJ 1IWGA 2X1AA 4J9PA 3LPYA 1UEUA 2Y1LB 3QO9B 2WSFC 4WZMA 4RJVA 1AUDA 1T9YA 4FBUA 4IFYB 3OTCA 1BQXA 2KO1A 1S1UA 1YX2A 3R27A 4IQMA 1IN0A 2WVBA 4ANEA 2B6AB 3C6UA 3FMWA 4PG5A 1VOMA 2GC8A 2HHTA 1S77D 1KQFB 4CNYA 1BWEA 2P9GA 1APSA 2AEJA 4CH1A 2Y1RI 1IQZA 2R7TA 3QIPB 3GR1A 3MM9A 4F25A 1FKPA 1ZYQA 4CO5A 2C3UA 2W2NP 2V2KA 3ZTSA 4ZPBA 4C0OC 2YNHB 2VG7A 1HPZA 1IM6A 3RRHA 2W4CA 5SZTA 3HP6A 1QTMA 3MR6A 1GXUA 3CCTA 2BE2A 3LGHA 2W9BA 4IUFA 1Q8BA 2VBYA 3M6VA 3WC2A 2EKYA 3A8IA 2PMHA 3K2YA 4YB6A 4IOCQ 2DK2A 2V8GA 1P9YA 1OIAA 5F8IA 4OYBA 4IH5A 4RUAA 3OXLA 2E9TA 3ILIA 4RNFA 4J9MA 2DHAA 3OR2A 1FD2A 2LA6A 3GYNA 3FZ2A 3F56A 2Z58B 1QVGR 1U7LA 1F3FA 2ZZNA 4K4VA 2QIFA 4YB1P 2NSCA 2OJ3A 3OXFA 5H1SV 4NLPA 1Y11A 2XMWA 3HJVA 2E5GA 5IOLA 2J0XA 1S7HA 4DN9A 1SKRA 3GMGA 5IQ6A 2ZH9A 3HDSA 3F44A 4B3TF 4LFBJ 2ABYA 2PDAA 2R8GA 2DGOA 1P6TA 2FJWA 1JLBA 3FQKA 5LXRA 4R25A 1B7FA 2BJ9A 2CFXA 4RNHA 2C2DA 4W98A 5K8PA 5L39A 4I69A 5DG8A 1WJ9A 5GADI 1N6QA 5HANA 3W2VA 3KLHA 4OYZA 1LEOA 3I0SA 3IMQJ 1RP5A 4IG0B 4OYIA 3BSCA 2JRSA 2MKIA 4ECZA 1ACMB 4QR1A 1U0HA 5KT3A 1IKYA 3CCES 1QAXA 3S1TA 2NQPA 3DRRB 1S79A 4R0EA 1J5OA 4OX7A 3ZZOA 2HWTA 3CF5Q 3ZZ0A 1P1LA 3ENAA 4U7UK 5HJXA 2ZJPQ 1RTIA 2R7RA 2P6TA 3LAMA 5KFXA 2CJAA 1FNMA 2E5LJ 1JXLA 4LREA 3QATA 1YJTA 1WKJA 3V6DA 2YH1A 4F0MA 2RQMA 4USWA 3CW2C 3I87A 2KVIA 5DLFA 3QRRA 1IVZA 3ZZYA 2ZE2B 4DSIA 4K4SA 2DRBA 3K59A 4P6QA 1FVSA 1YJRA 5GVQA 3H4DA 5HP1B 3TUIC 2J6TA 4CQ1A 3E01A 1KLNA 4B3SF 4UQGA 2DNKA 3LOUA 4YB5A 2OPPB 2W7OA 1A9NB 2R2TA 1NAQA 4NZ6A 2AGQA 1J2VA 2FJAB 2J9DA 3NCQA 2Z2ZA 1F5BA 3MPYA 2CG4A 1KHWA 4O3RA 1LWEB 3BSOA 2W25A 2FLPA 2RDIA 2CXEA 5KG6A 1UTAA 4DX8H 4PQAA 3ONQA 3E3XA 3IO1A 2UVRA 3BDPA 1MMDA 1Q53A 3FVYA 1YGYA 3ENWA 2JHEA 1MWZA 2SXLA 4OYOA 4A8OA 4P2SA 2R7SA 2CPJA 1W2BR 3W5ZA 3LF0A 1JXVA 4B9LA 2XQCA 1KN6A 2ROEA 3AA8A 4NCAA 2HHVA 1RTZA 5IC6B 2V69A 1TFYA 1AXQA 2DB1A 1KD1T 1NPKA 3R7SB 3W64A 2JJ4D 2W9CA 5JXSA 5LMUF 1FEHA 1YDLA 3M9MB 5LSLA 2CDRB 4DR3J 3VGTA 1U1PA 2BM1A 4ZLJA 4O23A 3BGUA 2LMIA 3KDOA 4N56A 5JUMA 4PPZA 1AZSB 2J7UA 1RWNB 1WSRA 3H25A 3EGVA 3DOLA 3MMBB 5T14A 4ZPDA 4DN0A 4CZCA 1S6PB 3R9LA 3AQOA 1D9DA 3WC0A 4H54A 3TWZA 1O51A 5D4PA 3NBPA 1T9TA 4O44B 3ZZZA 5DM6Q 4PG6A 4BHQA 1LOUA 4NCGB 4CIOA 3CB4A 3CJ0A 5EHHA 4ICLA 2VQEF 3A4TA 5FDLA 5ETRA 5BXIA 2QGFB 2R42A 4YP3A 1NJYA 3PG9A 5EX0A 3CDEA 2D3O1 4J37A 5GAHI 5IV3A 2XG8A 1PILA 4Y34A 5DLGA 3CIMA 3KJVA 2HK3A 2W4DA 2FC8A 4O4GB 1YVFA 4W92B 3MM6B 1Q5VA 1IUJA 1FRHA 1U6FA 1WC1A 5D0EA 3ZXWA 4K4YA 2IVYA 3O2IA 4YHHJ 3CSKA 3BEGB 2V8HA 1UFWA 4NEYA 5A0YA 1GTEA 1HQUB 5GAEU 3W1YC 1N6QB 1CJKA 2XI3A 1WF2A 2PC6A 2P2CB 5C2GA 2HFOA 4FKYA 3IGVA 4HHUA 2OEKA 5CABA 2J5AA 3ADAC 3DC2A 3ISNC 1PG5B 3S8SA 1UFKA 5DGAA 2GV1A 1RHJB 4OYWA 1FVQA 2DXDA 4L72B 5AE1A 3CE8A 3FDSA 2X51A 4U95A 2K06A 3M4XA 4PEOA 1MLAA 4NMXA 1SH0A 4DR5F 2I1RA 2WAQD 1Z2LA 4ZVEA 3W8PA 4OI6A 4CO4A 3OL8A 3MEDA 4USUA 4QIVA 3W66A 2MLXA 3TAMA 3H40A 4DV5F 1N36F 4NLYA 2QTWA 4GO7X 3Q89A 3L7OA 2WCXA 2GMHA 4DF4A 6FD1A 3DMJB 2UVWA 1NK0A 5EWEA 4CDIA 3P4UB 3CJTA 1ZPVA 3DLGA 4C8LA 4O3OA 4J7CA 4LF4J 2N82B 5J2MA 3KHRA 2VFRA 2FHJD 2UUAJ 1VQSA 4CLPA 1VK3A 4ZVGA 3EVWA 5CD4A 2N4CA 3W65A 2VUGA 5IT4A 3UNYA 4LRAA 3U1MA 4EBDA 1RISA 2Z8QA 1C1CB 3M9OB 1SL2A 1XWLA 1VQOS 2LXUA 2BKPA 1FJCA 2VDHA 2HQDA 2DR5A 3MAAB 2IPOB 1RZMA 1IWAA 4DFMA 2GO9A 4E0DA 2NPIA 1VC6A 4IR1A 2C2OB 2MGZA 4Q8EA 2UUBJ 3HHKA 3MAHA 1TL7A 2RB7A 3OFHA 2LFVA 4F4KA 1N0VC 2WZ1A 3MHYA 4DR1F 1WOSA 2LKZA 1LW2B 3UVJA 4DF8A 4KFBB 3MEEB 1RLDA 1N32J 4Q7AA 2BA9A 2CPHA 4RWXA 3MTJA 3A3PB 3G71S 1PIEA 2YKPA 2RS8A 4M5KA 3W5YA 2HWHA 1FKOA 3LAKA 5KFJA 4ECYA 2FZKB 3PXGa 5MLCV 4A8FA 2RRNA 1FK9A 3QFWA 5DS7A 1U1LA 4DX7A 3GE9A 3K5PA 2W9CB 2PEBA 2IMWP 1IJFB 1RT2B 3MPVA 3V2UC 2C3OA 5H9EK 3PACA 3KHLA 4USIA 2YKQA 1RTDA 1NHVA 1RT3A 4FP9A 4ZIWA 1ZAVA 3ET6A 2J9EA 4AL5A 2VKZG 3KK3A 1SVDA 4XTTA 1XJWB 2LQ9A 3KLEB 4CO3A 2ZOFA 1S6OA 1XR5A 3ZTRA 1LFWA 3NBPB 4LT6A 2QT7A 1GK8A 1KSPA 3FUYA 5ETMA
chains in the Genus database with same CATH topology
1JLFB 2K2PA 3D5MA 3SQGB 2XGQA 1CG2A 2OH2A 1ROFA 2PMZD 4EWTA 3CXCR 3RW6A 3AB2B 1BQNA 2JVRA 3CGIA 3NAHA 3MR2A 5IM0B 3BGLA 3I5BA 2IM3A 3I55S 2XULA 2BJEA 4B08A 4J9SA 4KHMA 1UVIA 5J1PA 4B9UA 1R27B 1RT1B 3M2UB 5LL6d 5HN0A 1UP1A 4ED6A 1SJ4P 3QO9A 3HHNB 1TVRA 4HHJA 4U7CA 2DNRA 4MK9A 2KFYA 3V6HA 2E44A 4NLTA 5A8RB 4IFYA 1X4GA 5KT6A 1WEYA 3OTBA 5A8WB 2N7CA 3CCUS 3GR0A 3BQ0A 1FKAF 4U6PA 4DBQA 3PX0A 1ZAXA 3M8PB 3DOKB 3VZIA 5EGYA 3GV7B 4DV6F 2HRYA 2MQNA 2FVRA 1TAQA 1T05B 2IRYA 2L41A 3DRSA 4OHYA 4KC5A 4LF8F 2PE8A 4JI5F 4TNOA 2BDPA 5KFSA 1HARA 2XLIA 1NZAA 2QV6A 2KG1A 4KR0B 1S48A 2E9RX 5EUHA 1N32F 5E5NA 1IXKA 3TI0A 3KK1B 1JLGB 3QJPA 4H4MA 3T1HF 3NS6A 2VKRA 1UAWA 4CCHA 3DGPA 1HMVA 4JI7F 3JSMB 3RR7A 3DRPA 3ICLA 3DYAB 1SI9A 1LFPA 3MZIA 3L95X 4TLQA 1WELA 4DWIA 1S1TA 3C6TB 2YKNB 2WOMB 1WI8A 3CJ4A 4RUHA 1Y5IB 1IJEB 3Q22A 2CYYA 1TZ0A 1DARA 2ZBIA 3BQ1A 2Q6BA 2XBPA 3PIOQ 4D3GA 4LFBF 3AH6A 3IWNC 2IFXA 1O8BA 1ZPWX 5A0YB 3VQSA 1S4FA 2YNHA 2AYEA 5KFOA 3IG1A 4LQ3A 2M70A 1WD6A 1TK8A 4J9OA 3RZAA 2KU7A 5D4OA 3KFWX 2O5DA 3M6XA 2QA1A 2HVIA 4UUWA 1FTCA 4PXEA 4J9QA 2M7SA 4JOUA 3H59A 1NJIT 2C28A 2V8VA 1URNA 3TARA 2DGSA 3D1QA 2K7KA 3T5JA 5B0DA 2JEGA 2KHCA 1BQMA 2R2RA 4F8RA 2G4BA 1X4EA 4XK8C 4YY3F 1S1UB 2PI4A 2LEPA 1Q7YT 1D8YA 1EETA 2MZTA 1Y00A 1XEZA 4B9MA 4DQIA 3IFEA 1YI2S 1IKWB 4RU2A 3KLGB 1GAOA 2KJWA 4Y00A 4WYLA 3O6QA 3C6UB 3SV4A 4NWBA 4P7VA 2KZMA 1QY7A 1V3RA 3R5CA 4Y65A 1PSDA 2HNZA 4ED7A 2DNYA 2Z0GA 3OVSA 3FSXA 3RB0A 1GH8A 3ITHB 5AXMA 2CJBA 4Q0BA 3RB4A 5EWFA 1UKUA 3U27A 3TO8A 2VZ9A 2RRBA 4OLOA 3HHLC 4G6VB 1FD8A 1E6YA 3N6LA 3DM2A 1HFEL 1ZETA 1WNEA 4AL7A 4ZP6A 4PPDA 5F0UA 2LDYA 4ATNA 1U49A 3BR8A 3MM9B 5BYSA 1SBRA 4DFPA 4O3PA 4OI0A 1GXTA 3CJ5A 4DFJA 5B08A 4PQUB 1FKPB 1FT8A 2VBWA 4B9TA 2J7WA 3BR9A 2CDQA 3PFEA 2WW8A 3OL6A 2EG1A 2VG7B 2XSFA 1XK8A 3HKZD 2VC0A 3MM7B 2M0GB 4V19X 3CULA 2DIVA