2Y1LB

Caspase-8 in complex with darpin-8.4
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
YIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CASPASE-8
publication title Caspase-8 in Complex with Darpin-8.4
rcsb
source organism Homo sapiens
molecule tags Hydrolase/inhibitor
total genus 20
structure length 87
sequence length 87
chains with identical sequence D
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2010-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2y1lB00
1SC4B 3EDRB 2Y0BB 3RJMB 2CNKB 2Y1LB 2XZDB 4ZVRB 3IBFB 1RHKB 2H5IB 2H54B 2CJYB 3NS7B 1RHMB 3R5JB 2QL5B 2H5JB 5IC4B 3EDQB 1RWNB 1RWXB 1RHJB 2HBQB 1GFWB 2C2KB 2CNLB 3P45B 2H4YB 3D6HB 2HBRB 2QL9B 2C2MB 2DKOB 4ZVPB 4JB8B 4ZVSB 1I51B 1RWPB 2QLFB 3KJNB 1F9EB 2XZTB 2CJXB 1RHUB 4ZVQB 4DCOB 3R7NB 3GJRB 1RWWB 1RWMB 1IBCB 3KJQB 2FQQB 2P2CB 4DCPB 1I3OB 1BMQB 3D6FB 1SC1B 2XYHB 1RE1B 2H65B 2QLBB 1RWKB 2CDRB 3KJFB 3R7BB 3R6LB 4ZVOB 1QTNB 2CNNB 2HBYB 5IC6B 1SC3B 3SIPB 1PYOB 1RHQB 3GJTB 2H4WB 2XYGB 3P4UB 3GJQB 2C2OB 4ZVTB 4ZVUB 2HBZB 4LSZB 1PAUB 1RHRB 5K20B 3D6MB 4DCJB 2CNOB 3IBCB 3R7SB 2C1EB 1NMEB 1QDUB 2C2ZB 2QLJB 1RWOB 2H51B 3QNWB 3R6GB 1RWVB 2H48B 2QL7B 1ICEB 2XYPB 3GJSB
chains in the Genus database with same CATH superfamily
5J2MB 4A8QA 1YJ7A 5LSRA 1D3WA 2M0GB 3DGPA 4GMKA 3T5JA 4O4GB 4DL0C 3W8GA 3AXMA 2YNGB 5BR8J 2ZZTA 4PQAA 3J80U 1V9OA 4DR7F 2CNLB 2AJ0A 5KOXA 1V5VA 1H7WA 3UE2A 2YVSA 4NA2A 4IQMA 4TQSA 1XERA 4JI3J 1JMTA 5F9NA 1WSRA 1VMBA 3BYRA 4AL6A 1KC8T 4KAIA 3MI7X 4ECSA 2D7SA 5H9FK 1IR0A 2UUCF 4KIAA 1SC1B 3E01A 1AYEA 4KYZA 4TY8B 1LW2B 1VJQA 2ZH4A 1SIZA 4USUA 1U8SA 1YGYA 5AJ3F 3I4HX 2N4CA 4KGMA 4KO0A 2WSEC 1LQ9A 1Y11A 3GG0A 1S7IA 2D3ZA 2HRYA 1VC6A 2DY1A 3ENAA 3CCZA 2MQ8A 1NKEA 2JJ4D 3QJPA 2KL8A 3UD5A 1HNVB 1HBOB 2WCXA 2CVIA 4WXOA 4X65F 5JUMA 3TA1A 3UN5A 3G6XA 3SEOA 4XPEA 4DFJA 2HFOA 2R9LA 2MKJA 4A48A 4CO0A 1JLQB 4DR5F 4WYWA 2HSEB 2VV5A 1UVMA 2V5HG 1ACMB 2QSWA 2KXFA 2B4OA 3IR5B 3PDNA 2LEPA 4RUAA 2OPQA 4FBTA 1TKTB 4LVOP 4CWBA 3BQ2A 1TQLA 2FZCB 2IRXA 4OV1A 2FHMA 3RRGA 4DSJA 4PUOA 1IKYA 5L1LA 2GVZB 5E33A 2KXNB 1RAAB 4RBTA 4DQRA 1L5UA 3NBPA 3AXKA 2KHCA 2YKMA 4RR5A 4LF6F 4QYRA 3TX0A 1TL4A 4TNOA 2CZ4A 5L9NA 1QSLA 2VFTA 4RNMA 5J2PA 1FWLA 1QM9A 2RIJA 2V4RA 2Q66A 3ELHA 4U6PA 3MAHA 1L3UA 1KS2A 2BE9B 1YKWA 2K8GA 2L9DA 2XGPA 2IVFB 1Y9OA 2Z2YB 3P8BB 1H3DA 2PI5A 4JV5J 3KUHA 1TL5A 2BE7D 3FEXB 3EVOA 4ALZA 3HI9A 2IDEA 2ZEJA 3M30B 3NAHA 1MW7A 4NCBA 5LM7E 4A46A 2IHR1 4BBYA 1XNRJ 4MT1A 4W90B 3D0HE 4YOEA 3K5MA 3LQVA 5EWGA 1UJ5A 2CPHA 2DR5A 2W9BA 1X5OA 4DI6A 2UV8A 1HBUA 1Y10A 5F8GA 2QO3A 3BGUA 3MECB 4ICLA 3LA0A 3FUYA 1QVFR 4NZ6A 1S9GB 3D1QA 4ZN3A 5LSOA 3THVA 4R8UA 2GO9A 4URSA 4GO5X 2JFKA 3TA0A 1VS3A 3OFGA 1HNXF 3PV8A 1SJ3P 4LSZB 3VAIA 5AE1A 3D6MB 4P6QA 3KHGA 3BGLA 6AT1B 2YQ3A 3C66A 3DGPB 4LMZA 3MUTP 4X2BA 4A8WA 5M2UA 1JLAA 3VVUA 3DOLA 1R6VA 3D6HB 4LBPA 5E3PA 2IBKA 4GVLA 4DZDA 2BE2A 2OAUA 2EG2A 3E01B 3D9BA 1IKWA 1O5JA 2LU1A 2ERRA 3F44A 4DSFA 1JIHA 4P7VA 2KZZA 3V4MA 4KO0B 5IC6B 1NDLA 3GSDA 1JLCA 1NXIA 4XO0A 1NPRA 1JJ2R 2DJWA 2LVWA 3SSSA 5K8MA 1GX5A 1NPPA 5FJ4A 1U47A 3NRBA 1SCJB 4DX6A 2DRAA 1Q5VA 4DV2J 3MMJA 3JAMU 2XM3A 4RW4A 3V4IA 5AXKA 1CJUA 1WG5A 5KFWA 3LWMA 3D1HA 1S1VA 4WZMA 3O2IA 3FBEA 2VPZB 1FKAF 1WSVA 2JHEA 1V3ZA 1R8CA 2OPQB 4FS1A 2CQ1A 2X1AA 2MZJA 1BLUA 1RGVA 4HH1A 4ECZA 4KPCA 4USIA 1ZM2A 3N6NA 3KLIA 4QIWD 3R2CJ 4PUOB 1IKYB 2WOMA 3ZZOA 5A8RA 3NBPB 2YKMB 2WVEA 4O4RA 3NNHA 3HK2A 4ED2A 4ZVOB 5HN0A 4N56A 3V2UC 3MAQA 5J2PB 2L3MA 2W7PA 5H1SV 1XMOJ 4OYZA 4NWBA 4EYIB 2QSFA 3FSYA 4L76A 3T5LA 4IFYA 1FWKA 4MIBA 3LWLA 3ITHA 4C97A 2BOPA 7FDRA 1LXNA 1WD6A 1WELA 2FZKB 2ZDOA 3D3BJ 3L7UA 3ZZZA 1C1CA 2PMZD 5K8PA 3CVKA 4IFVA 1M1GA 3TANA 3V6DA 4URQU 3DFEA 2JX2A 1T3NA 4ZITA 1ROFA 3PRVA 4DSEA 2W9BB 4OHZA 1HBUB 4J9QA 4C0HA 4ED0A 2Y9HA 4U7CA 2R8JA 3PKYA 4ICLB 4K4ZA 3DRRA 2VG6A 5BYRA 3M32A 4OJGA 4I2PA 3MCMA 1I6JA 1P1TA 4USJC 2C3MA 4C3LA 2ASLA 1VQ5S 1F9HA 2XCPA 3W60A 1FRLA 3IXQA 4PKDB 4YB1P 2VF3A 4KHPF 3O3LA 1Y3JA 4WU3A 1FKOA 3UCGA 3BR8A 3RW6A 4OX7A 4EZ9A 1B99A 1NMEB 3LUYA 2J9DA 4N77A 1FD2A 4YHHJ 4USTA 3KYLA 4NXNF 1U6BA 3A8EA 1OWXA 5KG5A 1JLAB 2EC0A 3EDRB 1M5KC 3QATA 2BACA 5KFCA 3DOLB 4DV4J 1PCAA 3K59A 2VBXA 5J1PA 5DGAA 1PC4A 1DAXA 1NJIT 1BHNA 4CNYA 2BE2B 4NX9A 5DO2A 2MLYA 4OI4A 4IKAA 1HIYA 1R27B 4NLPA 3OPKA 1YWXA 4M63A 1IKWB 2XSJA 3V81A 2HFZA 3G9CA 2NZCA 1AB8A 1HQUA 5AJ3J 3NGSA 1R8BA 1WHWA 4FXWA 3D2WA 2OEKA 2Z0GA 1WDDA 2F4VJ 1JLCB 1NK4A 4FYWB 2F3JA 4LF9J 2FJBB 1TELA 4IG3A 4LFAJ 1QE1A 3ETOA 2P9GA 3GV8B 1UVJA 4Q7AA 3OSPA 2BW7A 1Y5LB 3HHEA 2PEBA 1VQPS 2JEGA 3KHRA 3EJMA 1F2HA 3GZ7A 4RW4B 2C2ZB 3B4MA 2HPUA 1EZZB 3V4IB 1S59A 3R6GB 3A12A 3MD1A 1CJUB 2ALYB 1ZAVA 2VBZA 1G6BA 1S1VB 2R7UA 3D5MA 2PEHA 3G2XA 4DQPA 4E98A 2YQ0A 1NHVA 5IV4A 1H38A 3AB4B 4DG1A 5HLFA 2CVEA 4LF7J 3GFZA 2P6TA 2JLFA 1RA7A 2MXYA 4ENOA 3KLIB 1FFGB 4P74A 4O23A 3KLEA 5B0AA 1F60B 2WOMB 1H2VZ 1RWPB 5A8RB 3BH7B 3VGUA 2O1PA 2ZJPQ 4MK8A 3TAMA 5CA5A 1ZM4A 5GMKa 4DV0J 3TARA 5DDOC 2R7XA 1TK0A 1RAGB 5CD4A 2B0GA 2X1BA 4DUZF 1HHQA 3CIMA 4IFYB 4ZCKA 3ITHB 5A76A 2WW4A 4NLGA 2R8GA 2HGMA 2YX7A 8ATCB 1Q4RA 5L8RC 1REVA 3Q8YA 3H0PA 1C1CB 3A1YG 1S5ZA 4IFVB 2RAQA 3K17A 3V6DB 1VRQC 2LKZA 2ZWOA 1UEKA 3T1AA 4N5SA 2IDLA 4L3KA 2G2OA 4AD6A 2YTCA 2D3O1 5D6GA 4A47A 4LT6A 3ENVA 3GIKA 2IRYA 3MM5A 1T9TA 5DETA 1S6UA 3DRRB 2VG6B 2LA6A 3CPWR 3M32B 3Q2TC 5EN1A 2RJZA 5EX0A 5HANA 4I2PB 1K1SA 4OI1A 2QIFA 1O0PA 2OPRA 4NASA 2F4FA 3ZZUA 2NLWA 1FRHA 4HI2A 1HNIA 2ZBIA 3SSRA 2CXEA 4EU0A 1YX2A 2HGLA 5B0EA 4AFFA 4IQXA 1KONA 2FC8A 1Z1ZA 2DK2A 1FKOB 2MQOA 4DUYF 3PX6A 3EX7B 4QWBA 5AE2A 4C6AA 5I3PA 5BYSA 1P8GA 2W2NP 3R9LA 2C42A 5L1IA 4XK8C 4DR3F 4PWUA 2FHOB 3A3PB 1K1QA 5CH7B 3M8ZA 4OYMA 5B09A 1QAXA 1FWPA 4GRSA 1QLNA 3N6MA 4PXDA 2GNKA 2QRRA 5ETLA 3UD3P 2XSJB 3V81B 2JWNA 2VIHA 2E5GA 4ZLNA 1HQUB 1DLOA 3CW2C 3JS9A 1NZ8A 2DGVA 2MHNA 4DL6A 1DQ8A 3FQKA 2ZJQQ 4ED1A 2QLXA 2B7CB 4J5OA 4IG3B 1QE1B 4Q5VA 2J76E 3NOCA 4I1TA 1AFIA 2M5YA 1NK5A 2DT9A 4EMDA 3FNNA 4YUDA 5KFDA 1KFDA 4D3GA 3D0IE 4ZVHA 2OFGX 3Q83A 4DPWA 2APOA 1Q8BA 3M1VA 4ZVUB 4KV8A 1C2PA 1BWEA 2UVWA 4PYDA 1T9VA 3W9HA 3F0NA 2CNOB 2FIUA 1S48A 4C98A 1WACA 2IBOA 2QLJB 3J81U 3BO4A 5K5MA 2MTLA 2FD2A 1R8HA 4NYOA 1Q1KA 1UWBA 3C3LA 4DG1B 5HLFB 2KYXA 3QFWA 3BGOP 2UXBJ 5T7LA 4M5DA 4M5LA 3KLEB 2VG7A 4PG6A 5KFPA 4DS5A 1VI7A 2Y0SD 4ZN1A 3HO1A 4USHA 3K5OA 3QGGA 1T05A 3DLGA 1TL3A 2KB2A 3B6BA 2MQPA 3VR1A 1N32J 5LMNJ 3FC9A 5KFSA 3ISNC 5F0UA 3TAMB 3BPSP 2BJ7A 1HWUA 2FJEB 3SI8A 2MSTA 3W7BA 2LQ8A 5B0DA 2V2KA 3MR6A 2UUTA 1NK6A 4YDXA 1VQOS 2XO7A 1REVB 3VGTA 1D1UA 2LQ5A 2XMKA 2NQPA 4FF2A 2DCLA 2FJDB 1RTHA 2HG4A 2AKWB 4DFPA 4M5NA 4KQZA 1IBLF 1I94F 4DZ6A 3PYEA 1S0VA 3PKMA 2BKOA 1U1OA 1RAOA 1DFDA 3MM5B 2A6MA 2AJFE 4RNNA 4M5GA 3OQ2A 3Q8RB 3ZNUA 2BEFA 4KH0B 1NK0A 3R5JB 1U49A 3A13A 4AE5A 1EJ7L 2C2KB 2OPRB 1HR0F 3AOBA 1KSPA 1TL7A 3W61A 4ZA1A 5IZHA 2UU9F 5F8JA 3UDVA 4H4KA 3GP9A 2HNZA 1HNIB 3EICA 1NJZA 3CCQS 1KR4A 4PR6A 1KTQA 2YWKA 3GIRA 4USKA 3Q8QB 1YIJS 4DBQA 3RZAA 2V9WA 2W4DA 4R25A 2ZNZA 3IAS9 3TUPA 2C2DA 5IT9Y 1DQAA 2BZ2A 2R42A 2JC1A 3R6LB 2K7JA 2XQCA 2H4WB 5D4LA 4J9KA 4DR4F 1VC5A 2FDNA 3J7AN 3SCLE 3M9OB 4JI5J 4A8YA 4HH0A 1RWOB 2E5JA 5KFVA 1CC7A 2E66A 2JC0A 4M95A 4CT9A 1FF2A 2CPDA 2QG9B 2Z8QA 3QLHA 4OLPA 5IV3A 3CJ0A 2D69A 5C2CA 1DLOB 2MJNA 2A10A 1NH8A 4QPTA 3B54A 1G1XA 4OQJA 1TL1A 2KFZA 4ZK7M 5HBMA 2NPFA 3OBIA 2DVIA 1SKWA 1IR2A 4J9OA 2VOOA 4TU9A 1F9EB 2VFVA 3RTVA 2ZKUA 4DV3J 4LFBF 1HI8A 1WC6A 1RT2A 4ECXA 3CEDA 1NKBA 3M1VB 1M5PC 3KFWX 2AJQA 3IR7B 2AYMA 4KV8B 4JI6F 1BGXT 1SBRA 4MKYA 2E5LJ 1HNZF 1FXLA 4UF4A 5LSLA 1LFPA 5I3QA 3JSBA 1UWBB 1C4AA 5EWEA 3HFKA 1EP4A 2RQMA 5T7LB 5C5JA 4M5DB 3BPDA 2VG7B 3MMCA 1E6YA 5T14A 1AROP 2DIVA 3AJ2A 4V19J 3AA9A 4I7FA 1T05B 3S01A 3DLGB 5DDQC 5HMYA 1TL3B 3NNCA 5EUHA 3BSAA 4HDGA 3DLHA 1ZPWX 2OH2A 3W65A 1R8AA 2YNIA 5EX3A 5KAKA 1WC1A 2CG8A 2FGOA 3SCJE 2CZVC 2FHKA 2HS3A 4C7QA 2O01C 4JI7F 3QSYB 2CDQA 3J7ZT 1EKSA 3CD7A 1VFJA 2JLGA 4C9DA 1S4FA 2YKNA 3LF0A 5D15A 3CDEA 3M8RA 3HD2A 5IWAJ 1S99A 3VQTA 2NREA 1JQGA 2CJKA 1KTVA 5HAOA 2FY8A 3QRPA 1R31A 1RTHB 4ECTA 1UVNA 4LFCJ 1DQ9A 1EETA 3ZZYA 3D66A 2N7YA 3CD5A 4LRFA 2LFVA 1WUUA 1KVIA 5L46A 1S4EA 4DV1F 4F4YA 3HM9A 1NHKL 1ICEB 1C4CA 1RLDA 3HVTA 4KGKA 2R4FA 2FGCA 4RUCA 4RX6A 4ZIWA 2D3UA 1TL7B 1PILA 4AL7A 3SXLA 2HNZB 3FQLA 3QYYA 4QIEA 5SZTA 1FX2A 1KLNA 3DDNA 4OHXA 4CH0S 2HQIA 1B0PA 4OJHA 1NSAA 4KSEB 4FXDA 4I69A 3VAMA 4IOAQ 1U6FA 3AOAA 1GXUA 2GS8A 2KRRA 1OQ3A 4Y00A 3Q8PB 4FKYA 2E1MC 3H90A 4FYYB 5DQGA 2HHVA 2WVBA 1RK8A 3IR6B 1Q7LB 5KFAA 3VQSA 5H9FJ 1VIOA 3AD8C 3MM6A 1BUXA 2ROPA 4KKOA 4CLZA 4K2XA 3DRSA 3QLHB 1TKXA 1RUSA 2ATCB 4WCEQ 3W64A 4C4WA 3VAGA 2CQIA 2PMHA 1FNMA 1MWZA 1TAUA 4ELUA 1TL1B 5HBMB 3QJLA 5HQ8A 4WFNQ 4ZPTR 1TZ0A 3KUGA 2YKPA 1N0VC 2WAQD 1KD1T 5DM6Q 2KI2A 1UPPA 2AX1A 3FSIA 1N5QA 1RT2B 2CYYA 4F0KA 3T9NA 3N0VA 5HMXA 4OYOA 2D3OR 1XC9A 1FK9A 2V68A 2VD3A 4PABA 1JXVA 1MMNA 2UXCF 2OEMA 2CWXA 3BKFA 3GCXP 4RBUA 3EVMA 1KRPA 4I68A 3QJJA 2NSCA 1NBEB 2HS0A 1URNA 5DG8A 2L41A 3T1YF 3PX4A 1SKUB 1S1XA 2HIYA 5HVHA 1EP4B 3H5XA 1S1UA 4MK7A 3MMCB 1E6YB 3QQCD 5KFIA 3FSXA 3ILIA 3HDSA 4I7FB 2BR0A 3NWGA 1SH2A 2CPJA 3BEGB 2N3OA 3FMWA 1DHMA 2B3TB 2YNIB 3MOJB 3IC1A 2DR9A 1M5HA 4UUWA 3ULHA 4FP9A 2CPEA 3DLKA 2FB0A 1IVZA 4C8LA 4OLOA 2YKNB 3TWZA 4K0KF 2DGUA 2NPIA 3CO0P 2XMVA 2HVDA 2HHTA 4X4RA 1RE1B 2L48A 1S0NA 1T94A 1EETB 3VHQA 2XLKA 2HBYB 1IWAA 2OD6A 3FBCA 3AH6A 4G1QA 2LYVA 1UMJA 2PD1A 3H40A 3HVTB 4ZLJA 4HKQA 1HW8A 5A8WA 1RSCA 2L9NA 2P9EA 1RT1A 1KVKA 2A3JA 1SC4B 4DR6J 4QIVA 4TVAB 3TZXA 5EWFA 1YDLA 2XY6A 1X8DA 3W66A 2WHOA 4JYAJ 3PHTA 2RUGA 1CQMA 3AHPA 4JP8A 2MMYA 2R7WA 1RABB 3HPOA 2ZH7A 2IA0A 2V9KA 5EGYA 4DV6F 3W9JA 4JI8J 1R89A 2R3VA 2MY8A 1GAOA 1SXLA 4ZS6A 5ETKA 2DCUB 1J27A 3MM6B 2J7WA 3GCWP 4KKOB 2EI5A 4Q43A 3DRSB 1FTCA 4CP5A 2V2QA 2I5JA 1TKXB 3HHDA 1IBKF 4NLSA 2WTFA 4DDFA 2O66A 1QDUB 4FKXA 5ETNA 2CQ2A 4C8MA 2VDIA 4KGVB 3B82A 3OHAA 1YI2S 2AWZA 2C22A 1RHKB 2RDIA 4GKJJ 1P27B 4PG8A 3HHLA 2XEXA 5MAOA 3DNCA 2MKCA 4X84A 2JZ5A 1WWHA 4F4XA 2YNFA 3HHLD 5D8HB 2DRBA 3QWUA 4DSKA 5DLFA 3KHHA 1FK9B 1RKJA 2EFPA 3MEGA 4ZVFA 4HTIA 5DZ7A 1HWLA 1X4HA 2ZH2A 1U1NA 2BRKA 1QAJA 3MEKA 1WEXA 2Y1IA 3MZIA 1XTZA 4MJKA 4HEA9 2VFSA 3I0RA 1S1XB 4MK9A 2X3GA 4WK3A 3H20A 5D0RA 2KJVA 4L3NA 4P71A 1S1UB 5DJBA 4IRDA 1GQEA 5ETSA 3AODA 1XMBA 2RU3A 2HQFA 1HQ2A 1RAIB 2ACYA 3KHLA 1LNQA 4ZJOA 4QWCA 1Q5YA 3T1HJ 1P9YA 3DU5A 3HSZA 1VBYA 5CD4H 1FRJA 3QNWB 2R7TA 3G86A 3M6VA 1IR1A 4L6V3 3WIVA 2HNYA 1ZAXA 2ZHAA 1OY8A 4F2RA 3CCVS 3MDFA 2VOPA 5DGBA 3DLKB 3GILA 3N01A 4MMOA 2IVYA 3EGNA 1RZMA 1TAQA 2C2MB 2FC9A 2MKHA 1FEHA 2KVIA 3ISND 4LQ3A 2UUAF 2OMOA 5A8KA 1APSA 1VC0A 4BC9A 1EQ0A 1KHVA 1WC0A 2EWHA 3CGIA 4NPOA 4M5JA 4BDPA 2V4QA 1RJJA 3F73A 1EAYC 3MM9A 3HSGA 5GMEA 3PY8A 3OL7A 4G1QB 3IO1A 4DQIA 3UVJA 4HTJA 4U67Q 4MIAA 2ADBA 1WOOA 1FERA 2V8PA 1SJ4P 5JJBA 5BJRA 5A8WB 1PKUA 1RT1B 4KGZB 2ACMA 1Q95G 3QT8A 3B8HA 2AMCB 1YK9A 4DR1F 2FPHX 4WBFA 5A6WA 3UR0A 1DARA 2CJ9A 3BJYA 3BBBA 5T41A 4NMXA 5GAGU 2DNQA 2GCFA 5LMUF 1VBXA 2RSQA 5GAEI 1RAFB 2UZAA 2GZOA 5KG0A 4ER8A 1JX4A 2H4YB 3I55S 4NLUA 1NCLA 4ZCMA 4JI4J 4CLFA 1WI8A 4DV5F 2ZH6A 3GB0A 1RT6A 2OJ3A 5CABA 5J2QA 4Z7YA 4F4AA 1QTMA 1GNKA 2F65A 1YSJA 1H73A 3PEJA 3GWCA 9ATCB 1N34J 4G1PA 2I5JB 1DZ5A 4ECQA 3L3CA 2MQQA 4P2SA 2F7VA 2XS2A 3MWBA 3HT0A 1X31C 3RRKA 3PIPQ 3CCUS 1N36J 2PC6A 4OYWA 4YFUA 3PZPA 3PACA 4O3NA 3W8PA 4RW9A 3H98A 5HO4A 1TKZA 1NK9A 4J9UE 4B3MJ 3HHLB 3RJMB 2YNFB 2ASJA 5ETRA 1UW4A 1WG4A 4N8NA 3DLJA 2ZE2A 4CO1A 2ASYA 5A2QY 2ZZNA 1T9WA 3CJKA 2XI2A 1U0HA 3HSJA 1D09B 5C25A 4K4YA 3MEGB 2G2ZA 3KLHA 3AD9C 1FJ7A 3Q2SC 4OHWA 1NUEA 2VB6A 2GJFA 1T9YA 3EMTA 1G2EA 3I0RB 1ZS6A 1VBZA 4KE5A 2V0NA 1K0VA 1LWFA 2DNZA 1YRUA 2ADCA 1U1LA 3TO8A 1IWGA 2IRUA 4PWWA 1VIXA 2W7OA 4U8VA 2MHEA 3OTOJ 2LQ9A 4K2JA 4HDHA 3WHIA 3HVRA 3C14A 4CH1A 5HJXA 3BSNA 4LSLB 5CCMA 1ZAWA 3JQJA 3DOMA 1Q16B 2HNYB 2EFGA 3BO3A 3N79A 4E8UA 2Z57B 4OI6A 1VQKS 3OVAA 2QV6A 2QJ3A 4ZPVR 4JI2J 4LF2A 1HWJA 3A8KA 4KTQA 3T41A 5A8KB 1SKSA 2OSRA 2I6WA 4WZQA 3CD6S 4I67A 2ROEA 2A2DA 3ZZPA 4HHUA 4I6YA 3OFEA 2IYIA 5K9FA 1O51A 2J6TA 1U1MA 1N33J 2QYCA 1O6XA 2KU7A 4V1Ak 3MM9B 4X4UA 2QLWA 2HVHA 4WE1A 3UVJB 2Y1JA 2HWIA 2H1YA 4RNOA 4C8NA 2W2PP 3UI3A 4I2QA 3DYAA 3Q8SB 3N28A 2R7OA 2EBGA 3GR1A 1NH7A 4C8YA 2K2PA 2AYEA 2DNYA 2C3OA 4CQ1A 1L3VA 1VLOA 2AGOA 2ZOFA 1SJFA 2OD4A 2Q3PA 1WG1A 2CADA 1UFLA 2EK1A 1GX6A 1EQMA 4IO1A 1TMMA 3I87A 2B9YA 2LXIA 4O0IA 3DKDA 4JI1J 3RBDA 1RT6B 3THPA 5J2QB 2BKPA 2YY3A 2YWGA 4HACA 2DBBA 2DGXA 3H2LA 2EKNA 2B8PA 4W92B 4B3TJ 4RU9A 2XO6A 2DRDA 3KG1A 1WHXA 1JWWA 3LPEA 4X62J 3ENWA 4R0EA 3AT1B 2B43A 3H59A 4ZIVA 1RWMB 1PJ5A 2DIUA 4KGXB 3LANA 3O44A 2K06A 1S97A 2DITA 4WTOB 4K50A 2KZMA 3RG6A 1FO1A 3GU0A 3L4BC 1HYSA 4OX9J 4CLPA 4LR9A 2KXHA 2Z58B 2RHQB 3HVAA 4RW9B 1TKZB 1RBLA 5IT0A 3MF5A 1KP6A 4BLGA 4X64J 2ZE2B 4OJ3A 4LF4J 3P3DA 3CJKB 1KEKA 1FDNA 1U0HB 1YZ7A 4J9PA 3JSRA 5C25B 2HHWA 5AXNA 4H54A 1WI6A 5C2GA 2ZM6J 3W5YA 2HVZA 2CUYA 4OMFG 2YWEA 1FDBA 1SUQA 4W98A 3T3FA 1HA1A 1LWFB 1WKKA 4DUTA 4WFXA 1GMUA 1M5SA 4M5IA 5KT4A 2CZ9A 1KNZA 4LF5J 1XK8A 3G8TA 1U2RA 4ZJLA 1HFEL 4QW9A 2FQQB 5GAHU 3C14B 2VONA 2CJBA 2RDJA 4EGLA 4ANDA 3BYPA 1FJGJ 5HMWA 3DOMB 2WSFC 5E3RA 3BDEA 1NRKA 1YLXA 4O3RA 4WFYA 3LW5C 3PJXA 4AQYF 1F0XA 3US5A 2GQQA 1FNOA 1U09A 3NWRA 2RUSA 4DJBA 1RT4A 2IM2A 3V5RA 3KK1A 3JXOA 1EHWA 3EVWA 4RWWA 3M2VA 9RUBA 4DN9A 3PRDA 2H5IB 1SQEA 3KWMA 2AW0A 3MUMP 3NP5A 4LF8F 4ZLLA 2KHDA 2NUUG 1HD0A 1RTIA 3R5BA 4Y2IA 2E5IA 4WE1B 3QGIA 1YZ6A 3BQ1A 4OZ2A 3R5AA 2NXUA 2DY9A 3L7OA 1JJ4A 2MKSA 2JSXA 1X7VA 1Q82T 4I2QB 3DYAB 4L72B 3D6FB 3OL6A 3NGDA 5KT3A 2BRLA 3I4PA 2RQCA 1ULRA 2M8HA 3JSMA 4F3OA 2O67A 1NDCA 1ITPA 2LLZA 3I56S 4ZVGA 2DYAA 1BQNA 3BO2A 1Y3KA 2A0FB 3MHYA 3GFXA 4OI3A 3IN5A 4BS2A 4KJIA 1FRXA 5KFMA 4DN0A 2C3PA 3FCWA 5ETPA 2Y1LB 3Q0AA 3LO3A 4IOBA 4HACB 3MAAA 3KJVA 2RRNA 2XG8A 3D1OA 2XBPA 4HHHA 3U1NA 1CJKA 2QL9B 5HATA 5IOLA 3J7YI 4FZVA 1S9FA 3DM2A 3FMBA 3K89A 3QIDA 3AQPA 4G65A 1WTFA 4KRWA 4BWMA 2BJ1A 2A1BA 3PJ9A 4FNIA 1HYSB 2OTLS 1HKAA 5IM0B 3RBEA 4OI2A 2ZHBA 3QO9A 2MB0B 3IFEA 3FEYB 3BM7A 1Y4ZB 1FDAA 1LOUA 2PE8A 1A6LA 2HBZB 3BGFA 4IH5A 3I96A 4TXSA 3IBCB 1JXEA 1W7WA 3LGMA 3H5YA 2OTJS 1MNEA 1RWVB 2HHHJ 2IYGA 1DJ0A 1SUQB 1VJWA 3N4WA 2UUBF 1D9FA 3AOCA 3VTIA 5I3UA 2DR7A 5FDLA 2QC3A 3EDQB 2MKYA 2XLJA 4JI0J 3HX9A 2DKOB 4ID8A 5B0FA 2IMWP 3UW1A 4Y3CA 4WPAA 3W5ZA 1OPZA 2FJWA 3PJWA 3NNAA 2BANA 2RRBA 2IMOA 3K8WA 1CULA 4LR7A 4KPYA 4NLDA 3IM9A 2BJ8A 1ZM9A 5F3TA 2OSQA 1YBUA 1RI7A 2VQEF 4MKAA 2E9TA 4Y2KA 3H2VE 1RT4B 1FCAA 2E1CA 3KK1B 1SH3A 4ZPDA 2F40A 4NRUA 2OP5A 5RUBA 1U26A 3TP2A 3QRQA 2M4MA 3M2VB 1KWMA 2M3DA 2NR0A 2EFVA 5B0CA 2ZNYA 5C42A 2HVIA 1U1PA 3M9MB 4C0OC 2XMAA 1PBAA 4RKUC 2UV8G 2KO1A 3LPYA 1RTIB 4Y6IA 4WKRA 4Y2AA 4U7UK 4C8KA 5A0YA 1IBMJ 2HFNA 2HFVA 4GVBA 1XMQF 5HVGA 5M2PA 1TR0A 3HKZD 4ED7A 1YJNS 2NUHA 1Y5NB 2AGQA 2HQCA 3D3CJ 4YY3J 3JB9k 2X51A 4PG7A 3H5UA 2COLA 5HVFA 3JSMB 1HI0P 2W2MP 4I4BA 4Y65A 1BQNB 4B9NA 4NEZA 5LXYA 1CEZA 4DX5A 5E3CA 2HQ3A 2B5JA 4CO5A 2ZBCA 4B9MA 2AJ2A 3QGHA 3C16A 1VQ6S 3PVXA 1KQFB 1UTAA 2R2UA 1X4CA 2R2RA 5DLGA 1CBKA 1TK5A 3MAAB 3KJVB 3S1TA 3I82A 1O8BA 1NK7A 2J0WA 3PHEA 2N7CA 2ZC3A 2VC1A 1CJKB 1U8WA 4L74A 3HKWA 1FJCA 2PGCA 5CZXA 1DBDA 3H25A 3BKTA 3EZ5A 3SV4A 1RWXB 5D0GA 1UFKA 1KDNA 3DM2B 2IA6A 1H2TZ 2W8KA 3OTDA 3MPVA 1V6HA 3PFOA 4KT0C 4DSIA 1TK8A 3AD7C 2EVZA 2FLOA 1L3SA 4F36A 3MURP 2KKHA 2DGSA 3BN7A 4PCQA 3U27A 1J5EF 3QO9B 3CDUA 4MH8A 5E41A 2QA4S 2I0XA 1RT7A 1FKPA 4ELVA 3KDNA 4ECRA 1N5YA 2XI3A 1WJ9A 4GKKF 2WVDA 1HNWJ 2LEAA 4F67A 3H8YA 1YITS 4C3KA 2KT2A 1IUJA 1U02A 5KFJA 4UW2A 2AU0A 5HI7A 4IDKA 1YTYA 2KT5A 1P1LA 1OQ6A 4YP3A 4PYAA 1U1RA 5I3UB 5FDLB 3WIUA 2MZRA 3JTNA 1VCTA 3S6EA 2LU2A 1VBKA 2V67A 1N48A 3CULA 3A3NB 4CZCA 2F8HA 3TVZA 4DV7J 2BANB 1REGX 4DX7A 3W3SA 1CULB 3SMZA 4YMEA 4QIFA 1R0CB 3CCTA 2HAIA 5CYQA 3BS9A 2AJ4A 2PDAA 2XYHB 4X4NA 4ZPWR 4EBCA 2FTRA 3DLBA 1UKUA 3Q89A 4K59A 2VDHA 4F3MA 2XYGB 1XNQF 1HHTP 3V6KA 2HW3A 2OEJA 5C42B 3GQCA 8RUCA 4X66F 3HSDA 4NXMF 2BV3A 2BM1A 3H5SA 4DHVA 2DHGA 5DS7A 1U7LA 1CJVA 5FIIA 4ECUA 3RAQA 5A0YB 4M8LA 2IIHA 1SL1A 4OZ3A 4AXJA 5KFQA 2X1FA 1CJTA 2BM0A 2VQFF 2DH9A 5DG9A 4GVBB 2HHSA 1H7XA 3FGVA 2V6AA 1TVRA 3FRYA 4PPDA 3CCLS 1RHMB 2H5EA 1QY7A 5G4DA 2PFDA 4LSNA 3WC0A 4KB7A 3RRHA 3BDPA 5IT4A 1AW0A 3H42A 1AZSA 2DNGA 4RLEA 2LXUA 1Z2LA 4YN3B 1AUDA 1KVJA 2CJXB 2DHSA 4B3SJ 1X4EA 5C24A 3LP0A 2FVSA 2GQCA 3U7JA 4Q0BA 1RADB 2G0CA 2LMIA 3R2DJ 1XIQA 2QFIA 2B5JB 1R43A 4CH7A 1M90T 2KVQE 4F26A 4KBIA 3C16B 1FXRA 2DNHA 2ALZA 2F9JA 5BR8F 1U4BA 2HLUA 1IKVA 3CCMS 4EZ6A 4YEAA 4UOGA 2RDDA 3HF5A 2GX8A 1NB7A 2E7XA 2KDOA 1Y0HA 3I5CA 4UY85 2BW2A 3KXDA 3CMQA 4A8SA 4DS4A 1QAYA 2ZJRQ 2VPXB 3UDEA 5LOQA 2CKWA 2C28A 2CQGA 1SKRA 4R8UB 3RR7A 4Q8EA 4HLBA 4NEYA 3HVWA 4LBIA 1F5BA 1KBRA 3WBZA 1S0MA 4EO8A 4F8RA 2F9DA 2DXDA 1RHUB 2BXJA 2EKYA 1RT7B 1FKPB 3GJRB 1N5YB 2HEKA 2MDAA 1X0PA 3ZTQA 2P5VA 2IY5B 2GFFA 5H9EK 1G4CA 5IS2A 1H2UX 4DR7J 4UQGA 1LWEA 1GT8A 3PW0A 2QGFB 3PTWA 1IQTA 1UL3A 4IDKB 4NLXA 4EI2A 2QX0A 2XHWA 3RUBL 2FJXA 2LECA 3MTKA 1A7GE 2AV5A 2UUCJ 4USWA 1N5TA 2E5HA 4PXBA 5KFFA 5ETMA 5IFMA 3TI0A 1VQYA 2M7SA 5J1EA 3BR9A 1VHIA 4B02A 4LIWA 3IA0A 3ISZA 4CNZA 1U2FA 2QA4G 2GAHC 1ZA2B 2RS2A 2CQPA 2I38A 1CSJA 1HMVA 4PXCA 5CQGA 1NU4A 5CYQB 4ZVSB 3HZGA 3GPAA 3OXLA 4OHVA 1VQ8S 1YJUA 2DH8A 3RB4A 3EGVA 3HHNB 2EK6A 3LGHA 2U2FA 4X65J 2WW8A 1RTZA 2VG5A 1CPZA 1G7CB 2BKNA 1RWKB 1LEOA 4U8YA 3R7BB 2CRLA 2HNDA 1FESA 3EE3A 3S8SA 4EK2A 4DR5J 5KG6A 1CG2A 3QMQA 2D74B 2JVRA 5JVHQ 4JV5F 1NHUA 3SCIE 1CJVB 2ATLA 2LDIA 3T19A 1RKIA 3W62A 5GAEU 1U48A 1XNRF 1CJTB 2HZCA 1N52B 1TVRB 2QEXS 5KFHA 1F3FA 2AEMA 1M1KT 4LSNB 1UZHA 2CAJA 5ETTA 4ZJQA 1AZSB 3CWJA 2XSFA 4LF6J 2DR8A 4EWTA 4DXLA 4ZP6A 5FLXY 2YBVA 3I5BA 1BE4A 5G0RA 2UVVA 4WFAQ 1U0SA 5C24B 3LP0B 3KLGA 4Q0BB 4HVZA 3UN3A 2VH7A 3R7NB 4NE9C 1ELOA 3OVSA 1AT1B 3IAM9 3U1LA 4L73A 2Y8WA 3N6LA 1QUVA 1SH0A 1HARA 2YNGA 2J8SA 4TYBA 1UETA 1ZOTA 1IKVB 4ANEA 1NJXA 3SIPB 1JLGA 1S77D 1T9UA 3CCES 3TW0A 5ADZA 4LREA 3AB2B 4NLVA 4RPFA 4IH6A 4X4TA 5K20B 2FJVA 1NM2A 2XWXA 2I9SA 2NXJA 5L39A 4DL2A 2MJUA 4LRCA 2HKEA 4ETXA 3GONA 3ZO7A 5ETVA 1MN9A 4J9SA 3E8OA 4ID5A 2VZ9A 5DQHA 3TRGA 3M05A 3KKFA 3CDAA 3J81j 1HNXJ 4YR2A 4PG5A 2JOQA 3JSYA 2C3YA 3CDWA 2M70A 3AY0A 3SFUA 3I6PA 1N4LA 2IVMA 2ZVSA 4NLRA 3QT7A 3PCOB 4UZBA 2EEYA 3DRPA 2MLXA 4OYXA 1LWEB 2DGTA 3MPWA 1X60A 1ZYQA 3DHXA 3U1MA 4DV2F 2DR6A 4CDIA 3Q22A 3F56A 3TX8A 3GIIA 2NYIA 1E6VA 4U7UD 3QT6A 3IGVA 5JVGQ 2B6AA 5L38A 1SPBP 4ZVTB 2F1FA 4MKVA 1S10A 2X3DA 3CJ8A 4I6AA 3GYNA 3HMJG 3TZYA 2A6OA 5J1EB 2F5GA 4CTAA 4RUHA 3PM9A 4A8MP 2YX4A 3R27A 1MMLA 3T5HA 2G2YA 5DG7A 2Z2MA 4HT5A 2HFSA 3VZHA 5B08A 1UVKA 1PAEX 1HMVB 3DI6A 1ZH5A 4PWDA 3ADAC 4NLOA 4HI1A 3ENQA 3VAKA 4EFAC 2VUGA 1PYSB 4ECYA 2ZUGA 3T9ZA 2NYHA 1FFSB 1XMOF 1LK5A 3NGUA 2BJ3A 2NSBA 3SBMA 3CMAS 2L08A 2VG5B 3NMRA 2IAJA 5HQMA 2AD9A 4F04B 3I9V9 3D54A 1LFWA 4FS2A 2HNDB 4M5MA 2P2CB 4NI2A 4X66J 2QN6B 5KG7A 2K3KA 4A4JA 3JAMY 3PR4A 3P4UB 3FRZA 2YKAA 1W26A 1T3OA 2Q1LA 2P9CA 1S72S 3CD0A 2K3IA 2QE5A 3GV5B 2RILA 2C1EB 5DDPC 2HGNA 4BWJA 4YB6A 2J7UA 4QW8A 3O5TB 2XYPB 2HQDA 4ECVA 1GXTA 1WORA 1GTEA 2M52A 5F0WA 3CCSS 2V34A 2GAGC 3H7HB 2ILZA 2GW8A 4B3RF 3RGIA 1P6TA 2RU9A 5G0RB 4RW7A 2XMJA 3KLGB 5E2QA 1GFWB 2Q79A 4FF3A 3EPIA 1MU2A 1W2IA 2RF2A 4XDCA 4FVCA 2GA7A 3PNIA 2XMMA 4V19X 1N88A 4YHHF 1RWWB 5F8NA 3DRYA 1JLGB 2O5DA 5E5NA 3RBXA 2MYFA 1RBAA 1JLBA 1NSPA 3SYZA 3RB6A 3RW7A 3R5CA 4DV4F 2W2OP 3CMES 1OJ4A 3DRXA 2KRBA 1UZDA 3WX8A 2BA9A 4FXVA 2C2RA 1FFWB 1FRKA 1K73T 4QIGA 4ID5B 2M2BA 2WBRA 2K7KA 3THTA 4WK1A 3WDOA 3EGZA 4WP8A 3AJ1A 3MM7A 5I4MA 2G0JA 3R5GA 4C0BA 2F4VF 1U45A 4KHPJ 1X9WA 2DGOA 4LF9F 2QFJA 3D67A 4LFAF 2UUWA 4U95A 4DLEA 1TU0B 3A3OB 2JVOA 3DRPB 1HBNA 4O3OA 4JV1A 4NXNJ 1TKDA 5BYQA 2EFNA 2KT3A 1E6VB 4LRAA 3VAJA 1VR6A 2XWYA 2B6AB 2BABA 2FLLA 3W63A 1YHQS 5DM7Q 3KNGA 1NK8A 4P73A 2VU5A 3NOGA 4ZCIA 1MWQA 3TJAA 3PYGA 2QMXA 3MR3A 1K8AT 4LF7F 3JQKA 4CTAB 4FPRA 1L3TA 4CLYA 5FLXU 2AYGA 4ZPBA 1YG0A 4OZNA 1VYAA 2HS4A 3EPGA 4L75A 3OFHA 1T02A 2JL9A 3UCZP 4LUBA 3DDKA 3DI6B 4PWDB 1BQMA 4I6WA 3NAIA 4DV0F 4HHJA 1F3VA 5KFNA 4WKYA 5J2NA 5DRKA 3L9ZA 1OO0B 3PYFA 2DGQA 4XAKA 3AJDA 2IAJB 3VZIA 1EKRA 3T5KA 1MMDA 3DMJA 5L1JA 3MPUB 2B4UA 2N4DA 3V6JA 4NI2B 3KDOA 4IUFA 5D4PA 2BBEA 1NSQA 2LQJA 1VK8A 3MFIA 1GH8A 2WZ1A 1NSKL 2H65B 4PPZA 4F7VA 4CRJA 3C8YA 4H4KC 3VGVA 2ASDA 4YB7A 3QAUA 1UEUA 1S6PA 3L95X 4QZVB 1QSYA 2BVZA 2V69A 5E3QA 3PRBA 3U02A 1RBOB 3ZTRA 4ES2A 3KG4A 2G9OA 2WSCC 1OIAA 2J5AA 4XTTA 2ZBRA 3CIZA 2R8KA 2YWFA 2Y0BB 2DHXA 4RW7B 4Q2LA 2YPYA 5A6PA 4DUZJ 3J7YU 3G82A 1NEEA 4N47A 1MU2B 3CXCR 2RF2B 2VPYB 2IJFA 2HYIB 3G4SS 2VA3A 4EYHB 3ZTSA 1T95A 3TR5A 2E1AA 3RB0A 4QYZJ 4JUZA 2DH7A 4P52A 2ZHOA 1JLBB 2QZ8A 3TZWA 3LGNA 2LP4A 2MQLA 3HULA 3O1LA 4YR0A 1BMQB 1RLCL 3VALA 2DB1A 3BN4A 2R8HA 2CJAA 4Y34A 5ITHA 3BZQA 1RT3A 4OYBA 2ZH8A 3SZ2A 2I8EA 6FDRA 4C8OA 3FDSA 4C3MA 3Q23A 2MZSA 3R7SB 2FLNA 1DTTA 3MM7B 3RR8A 2PN6A 1XR6A 3BSOA 2JRSA 3CJQA 4YS2A 1RYRA 2YPZA 3N9UC 3VV2B 5KFOA 2BDPA 3EUNA 4ILMA 2V2ZA 3KK2A 4DUYJ 3MCNA 3OW2R 4DWIA 1HBNB 3GFYA 4USMA 2MSSA 3QSIA 4DR3J 2M9KA 2D41A 5HMZA 3K5NA 4DL5A 1FE4A 4J9NA 4USVA 2HVEA 4F50A 1M0SA 4B9TA 4J37A 3A4TA 1MWYA 2DGWA 1FD8A 1X0FA 3P5TL 3WC2A 1OSDA 4NA3A 2XLIA 2UXBF 4ZP8A 2F8EX 1FTRA 1IN0A 4LBHA 2M8DB 4WYLA 1TFYA 1HI1A 3QIPA 4CM2A 1XR7A 2ROGA 4U96A 4OZ0A 1N32F 5LMNF 4GC6A 4DQSA 1Q8KA 1BQMB 2F8MA 1M1HA 5J2NB 2IJNA 4TU8A 2V2VA 1RXOB 4NL5A 2RD5C 2IFXA 2W4PA 2DO0A 2GIQA 5CCLA 4K4VA 2HRUA 3JYTA 1NZAA 2IC3A 4MYTA 3DMJB 4ERDA 4H4MA 5KG3A 2WONA 1N56A 2HZAA 2DD8S 2W1BA 4J9RA 2LCWA 1N6QA 4OI0A 4WIQA 4DSLA 3J81Y 2ABYA 1S6PB 3OTBA 2QYGA 5ETOA 2AJ1A 2VFUA 3KK3A 1ZBTA 5LJ3Y 3QWPA 4B3RJ 4KR0B 1PG5B 4DU8A 4WWSA 2QTWA 1PC5A 1PSDA 4NLQA 1LW0A 2QA1A 4DL4A 4YR3A 4ATNA 3G82B 5IT9U 2JEJA 4P9SA 5AE3A 1MN7A 2Z2ZA 2EG1A 4WP9A 4WP3A 1F2GA 4PAAA 4JV2A 1PYTA 5HP1A 3ZTOA 2V50A 5CHCB 1RHJB 3SQOP 5KFGA 4AL5A 1AXQA 2F63A 3W1YC 4FDFA 4B9UA 4EO6A 2FJAB 1IBLJ 1I94J 2SXLA 1PIEA 4JI5F 2H9ZA 1RT3B 3Q86A 2Z56B 2B4VA 1VQ4S 2QLBB 3CJRA 5GAGI 4K4UA 1SC3B 4TLRA 2D1CA 5KFKA 1HR0J 1DTTB 2UU9J 1H0HB 2D9PA 1Q8LA 1RT5A 3IBWA 3J7A1 4X4OA 2BQ3A 1DY3A 5GVQA 1NDKA 3BF4A 2GIFA 1M5VC 4LR8A 2AEFA 3UCUP 2LQBA 3R1HA 3CF5Q 3KK2B 3CJTA 4DV3F 2JH3A 1URRA 2A2CA 1LK7A 1B70B 1M5OC 4EUVA 3Q24A 1HW9A 3V6HA 5KFBA 3E51A 1L3KA 4UQTA 4DR4J 2CPZA 2DHHA 4ED3A 2E5LF 4TLQA 3UPFA 2XNQA 2R2SA 5HL7Q 1IJEB 1SI9A 3UDCA 1R0AA 2Z30B 3FEZA 4EBEA 2ZC4A 2AQ4A 5KFZA 5CYJA 3P49B 1K47A 5BXIA 2Q6CA 5THWA 2JFDA 1YRTA 4O3SA 3TAPA 2XHCA 3FCHA 4LJMA 5KFYA 3M6UA 3VVTA 1NB2A 1YJRA 3DHWC 3FBBA 2R8IA 4P2FA 2AYBA 3QIPB 3R97A 3IS9A 2PMWA 4PZVA 4DX8H 3UQSA 3NY0A 2VC0A 4DL7A 3QT5A 4CLLA 3M7VA 1RU2A 1S6OA 4H4OA 3LP2A 2WB1D 1R6YA 2Q43A 4ES3A 4RU2A 3NGTA 3MR5A 4IO9Q 3W5XA 4Z37A 1S7HA 2LEBA 2RT3A 4LFBJ 2BUNA 2J9CA 2MY7A 4RUBA 4B9SA 1R8PA 1DRZA 4CCHA 1CLFA 4NOHA 3M8SA 3JYTB 3TEGA 1D8ZA 2KH9A 1ZZFA 2IC3B 2DTJA 4H4MB 2WONB 3PW7A 4JI6J 2FZGB 3AA8A 2VODA 1JB0C 4ZCLA 3P6YC 5IWAF 4G3IA 2CG4A 5F8MA 1HNZJ 3PO4A 3LAMA 1QUPA 1T11A 3C6UA 4IH7A 1RACB 1N6QB 4LFCF 2W24A 5DQIA 4RNHA 1T7PA 4WTYA 2PO4A 2BQUA 4RZRA 4ZLPA 4BHQA 4RL1A 7AT1B 1PO6A 1XR5A 2CQ0A 2PIIA 3QZ7A 2CPFA 3K57A 2DNRA 2OHDA 2Z2LA 3KK3B 2DNLA 1X4DA 2KTQA 1FVQA 4QQBA 1V3SA 1LW0B 4ZMMA 2R2TA 5L1KA 4JI7J 4F0MA 1N8RT 4TQRA 3OXFA 2OIHA 3GYGA 3MOZA 2YQ1A 2XTJP 2MLZA 4ED5A 3M8PA 2XZWA 3FCVA 1VRUA 3MUVP 5HP1B 3TUIC 1YBAA 2GMHA 2K1RA 5JXSA 3POTA 3B4DA 5M2RA 5GADI 4FVMA 3ZZ0A 2LXFA 3VCDA 2B9WA 2GVDA 3CJ2A 1X4BA 1K44A 3J7Z5 1VOMA 1NO8A 4DV1J 4MYUA 1HWKA 2QLFB 2W2QP 3ILOA 3MFHA 3QRRA 4WJBA 2G1DA 1RTJA 3HHLC 2UXDF 3HP6A 5IQQA 4DMZA 1UJ6A 3PX0A 4D3HA 4RBVA 1RT5B 2DHAA 3L09A 1SJRA 4ZVEA 4HT7A 3EM1A 5HQLA 3UR3C 2GC8A 1UVIA 3GJQB 1NPKA 1X5TA 1PAUB 1U1QA 3O8WA 1QJHA 5H9EJ 3GTYX 1C0TA 2XS5A 1FNXH 4F4KA 1GMWA 2J0SD 2NCKL 4LRBA 3M2RA 1S57A 1GMWD 2VICA 1R3NA 3RYLA 4Y2MA 4P72A 4QU7A 4ZP9A 1WNEA 1PJ7A 2MQMA 3NKYA 4TU7A 2E1PA 1RAHB 1PGZA 4IR9A 2YKQA 2UVUA 2W7AA 2AZ1A 2OMLA 4OL8A 1VQ9S 1R0AB 2VA2A 2HBRB 3RAXA 1D9DA 3PYDA 1WC3A 1N5SA 1Q7YT 4UOCA 3KUEA 5D4NA 2XMWA 3ZC4A 2XZTB 3OLAA 1HD1A 2W25A 3DXBA 2HHUA 2JDJA 3IS9B 3TUJC 1BQXA 2WVCA 3NCRA 4LRDA 4H4OB 3LP2B 1QTNB 5HJYA 4K4XA 2RS8A 2AZ3A 3VWSA 4K5SA 1QAIA 3QAEA 4DF8A 3DGVA 4WFZA 5LJ5Y 1VHFA 4QJVA 1VRTA 2I2YA 3TNVA 4FNHA 2CQHA 4ZOSA 2DNOA 2WBMA 3EZOA 1GTHA 4K5RA 2IM1A 3TJ8A 1SQGA 4KHMA 2UXCJ 3QBCA 1JNZB 3ZNJ1 1FHTA 2ZUAA 3CB4A 1UCNA 2RHSB 3C6UB 5GAHI 3OL8A 1WKLA 4E2FB 2YWWA 3T1YJ 4ECWA 3HJVA 5F8LA 4WFBQ 1FDDA 1WEYA 4B9VA 2HBQB 2C2NA 4QOTA 1IM6A 2E7VA 2VHGA 4ZPCA 2YNHA 1FE0A 1MG7A 4JB8B 1H72C 5B0BA 3DN9A 2P8IA 4NA1A 1N54B 3PFEA 8AT1B 3FFIA 1ZPVA 2FHJA 1IBCB 2ZOGA 1VQLS 4OYPA 2FHJD 5E3AA 3AQOA 4DR6F 3KJFB 1SC6A 3OT9A 3NXZA 4JYAF 5I42A 3HXMA 1HQEA 4GC7A 3OXGA 1QSSA 2ZKTA 1GEHA 2C2OB 2GO8A 2X1GA 5KT6A 5GMDA 3CT9A 2XMUA 4K0KJ 3M8PB 1U24A 1VRUB 1R7IA 5KOWA 4K7QA 1UPMB 3MD3A 1RAJA 2K1RB 1FRIA 4ETZA 3M8WA 1UA0A 3POTB 2PSZA 4JI8F 3IWNC 2E29A 2J7KA 1U25A 1RWUA 3VGSA 1S9EA 2GVDB 4CI0B 1JNRB 1WC4A 3UN2A 1IJFB 3S7RA 4I64A 4Z7CA 3JQMA 1RAEB 2B7BB 3LAKA 3C15A 2EC2A 1VLYA 2CQ3A 1RTJB 1A9NB 4A8XA 2FVRA 2U1AA 1I51B 5KTQA 4JV0A 3TZZA 4O0NA 1WKJA 2YKOA 3MR7A 1CQNA 5L9XA 5LL6d 5D77A 3X1LB 4RW6A 2GHPA 4M1KA 2AGPA 3MEEA 3EXCX 4OV6A 3OSNA 2POKA 2KJWA 5SUHA 4GKJF 4IG0A 1C0TB 2XMTA 2HK3A 5KT5A 1B7FA 2KM8C 4ED8A 3ZTPA 2AP6A 3M2RB 2ZBQA 3QPIA 1T03A 2QMWA 4DV6J 4TY9A 1K0TA 4AXIA 4B08A 3HD1A 4YDDB 2EFOA 1YBTA 3M8YA 1EIYB 5HSPA 3NS5A 1OS5A 2EPIA 4NZ0A 3X3UA 3TJ9A 1OY9A 4PQUA 5D3GA 4MKBA 4X4SA 1X5SA 3A8IA 2H5JB 5IC4B 1RP5A 1IBKJ 3SDEA 3NLCA 1F5AA 2NZ4A 3DCAA 4DQQA 3KOAA 1OYDA 4DEZA 3T1HF 2XY7A 3OL9A 4O3QA 3UD4P 3IGNA 2VASA 4KFBA 4FPIA 5U47A 1AUSL 3ONQA 3DU6A 5E7OB 1HPZA 1V5IB 5EDWA 1T0TV 1VRTB 3TAQA 2N3LA 2NXCA 1IKXA 4RJVA 3GJTB 4TYAA 4RNFA 1B7YB 3K5LA 6FD1A 4F0HA 3GLJA 1S49A 1ZA1B 4M5KA 4UZCA 1SJ1A 3KLHB 2J0XA 4P7TA 3GFHA 3K2YA 3TYTA 2DXEA 1Z4UA 4G1IA 4J91A 3OR2A 4QWDA 1Q8IA 2B4PA 4ANCA 3CC2S 3C2PA 5K8OA 2PT0A 3TOQA 3EGWB 3E2EA 3I9ZA 2XY5A 3TEHB 1XWLA 2CJYB 5DZ6A 2YNHB 2DPIA 4QR2A 4YB5A 3OVBA 4ITSA 1S1TA 3MCSA 4IRCA 4ZVPB 2GJIA 3FFIB 1UWAA 2EXUA 4QCLA 3ET6A 2HWHA 3MPDA 3IWLA 2YWHA 4NLYA 1WF2A 2B8QA 3K0JA 4DFMA 4AUKA 1N0UA 5E0OA 1YJWS 2VBYA 1WDTA 2FVCA 5I42B 1HQEB 5F8HA 3W9IA 3R1LA 2KN4A 3UNYA 4N76A 4C2MA 3QFHA 3MMBA 1FEEA 5F41A 2UUAJ 3T6BA 1KKHA 4MTPA 3LALA 3OUYA 2W8LA 1LWCA 4JI4F 3HZEA 3G6YA 3NCQA 2DISA 1S9EB 1KLMA 3OLBA 4DR2F 4NYPA 4RW8A 2CJQA 5CYMA 2J0QD 4WIIA 1H98A 1D8YA 3Q8VA 1N34F 3C15B 1X4GA 3OJUA 5K14A 3RBZA 2UXDJ 1YRXA 2FLPA 5KG1A 4Z2XA 3LOUA 4UOFA 1G3OA 5CXTA 4AT1B 3P45B 4LF1A 4W4MA 2ZD1A 1RQ0A 2PI4A 2V8GA 3BB5A 3IRXA 1N36F 4HR2A 4DR1J 2EFQA 3KMSA 1RA6A 3KJNB 3R5DA 2OKQA 4OZ5A 4IOCQ 1WF0A 4RW6B 3BBCA 3MEEB 4BC7A 5A2QU 4PXEA 3PIOQ 4AYBD 4B3MF 4DCPB 2HURA 4IG0B 5LMUJ 3M2UA 4C8ZA 5KFTA 2CNNB 3RU0A 1CS4A 3QZ8A 4DL3A 1T03B 4QWEA 5LT5A 4ED6A 1WF1A 2AIRB 1NLKL 4DV5J 3CSKA 4A8OA 3UFCX 4LVNP 3K58A 1NAQA 3D68A 4QYZK 4Q2MA 3D4JA 3DLLQ 1GMVA 4PQUB 4NCAA 5D3GB 1TFWA 2QL7B 1NJWA 1HHSA 2MEWA 3EWGA 3MR2A 1RISA 3SDEB 2DNNA 4O44A 2ZFHA 1FX4A 2G0IA 5KG2A 3OTOF 3T6JA 1B0VA 2UVRA 1D9AA 4KFBB 3OJSA 5DDRC 3HFZB 1HPZB 2XGQA 2MZQA 3MEDA 2MGZA 1IKXB 4OX6A 1TTHB 1UW9A 1H6KX 1QD1A 4ED4A 2CPIA 1JLEA 3IMQJ 1ZTTA 3CJSA 1EX8A 3P5BP 2OPPA 3CJ3A 2GGPA 4JI2F 3DOKA 2KG1A 4P10A 3MCOA 3EYZA 2GHWA 2RB7A 4OZ1A 2L9WA 1YJVA 4NRTA 3UWTA 4I56A 3I32A 4CIOA 3WX4A 5KFUA 4EEYA 3BREA 2ILYA 3OR2B 2Y8YA 3NS6A 2MQNA 3JTPA 2C2EA 1N33F 1VGYA 3K8VA 2RE1A 4O3PA 1UAWA 2H48B 4R5PA 1I5OB 5AXMA 4QR1A 4Q8FA 1KQKA 1S1TB 1SV5A 2Y1RI 3DXSX 3UO0A 3PW4A 1N5VA 4P75A 3NS7B 1SL0A 1V3RA 3ET6B 2HHQA 3C46A 4ILLA 2HAFA 2G13A 2V8VA 3E3XA 3CJ4A 2GJ2A 5KFEA 2GQ2A 1LKZA 4MFBA 3M4XA 3TVKA 1UJ4A 4DCOB 5KFLA 1EB0A 1CVJA 2G1HA 3G96A 3NMAA 1FXDA 1IQZA 2B9EA 3MMBB 1DTQA 4LIRA 1VQSA 2RRAA 2V4JA 4CLUA 3FJ2A 3OUYB 1LWCB 3BV8A 1IM4A 2QA2A 2R7QA 1RHQB 1I1GA 1XJWB 4JI1F 3N5BA 3UNGC 4CO2A 1RHRB 3F41A 3OR1A 1KLMB 4URGA 3HJFA 4CO3A 3N5FA 3GE9A 4B3TF 2BQRA 3W2WA 1JXLA 4RW8B 1WC5A 4CM0A 5CYMB 2FVQA 4X62F 2VBWA 3LP1A 2J8AA 1WEZA 2BOAA 2V94A 4Q44A 3KLFA 5K14B 3IM8A 3PXGa 3GR0A 3CC4S 4N41A 2ZD1B 3EZUA 3IRXB 1OMSA 2HRTA 3O6QA 3CJ5A 3NGRA 4FF4A 4OX9F 3TQEA 4I0WA 4WXWA 2W9AA 3ETMA 1UVLA 1Y5IB 4KHRA 5B7WA 3PW5A 1D0EA 3M2UB 2HFUA 1T9XA 4X64F 1HBMA 5CAAA 1CS4B 3SV3A 2NXNA 2XNRA 2J6UA 4LF4F 1VISA 5HK4A 2ZH3A 4HL9A 4B9LA 2G4BA 3CTRA 2VJVA 3FVYA 2CFXA 5KFRA 3SFGA 2PA8D 2J9EA 3DLEA 2ZM6F 2O3DA 4N8OA 3VF0B 1J5OA 3D28A 3I0SA 1S6QA 2W4CA 1C0UA 4PEOA 4JBCA 1U2CA 4A8FA 1XQIA 1UA1A 4P2MA 4B3OA 2HQGA 4O44B 4LF5F 3C6TA 4FYDA 3ZZRA 4F4ZA 4MIWA 2HIQA 1RU1A 1VQNS 4U9RA 1TMJA 5B0GA 2V8HA 1FJGF 1JKHA 4LSLA 2GMLA 4OJ1A 4DOZA 1Q53A 4P2XA 1IXKA 3MEDB 1XN9A 3FK4A 3RB3A 1MLAA 2MGZB 2BJEA 4OZJA 2OPSA 2ZH5A 3G71S 1FI4A 1AA1B 1JLEB 1SL2A 3SQGA 2VFRA 2OPPB 1FT8A 2LA4A 2GGPB 4QWAA 3HFVA 2R7RA 2JEFA 3DOKB 3OHBA 1I3OB 2ZITA 4FN5A 1FJEB 2ZBPA 4FYXB 3P96A 1BWVA 4XPCA 1SJQA 2XC9A 4F3QA 1UFWA 1PYOB 1Z2ZA 4J9MA 4NCGA 1OSCA 3HLUA 2VKZG 2IPOB 4NMLA 4UT4A 4F4WA 1P9QC 3WQPA 4R5PB 1B3TA 1Y00A 1B64A 1Q81T 2AEJA 1BC6A 2RH3A 1SV5B 2ZH1A 2KFNA 1JLFA 2HHXA 1KQSR 1RYSA 4TN2A 4K8RA 3OFFA 5JMNA 1RDRA 3PR5B 4X4PA 3MTJA 1HLWA 2FVPA 4CYUA 4AQYJ 2BMBA 2CA9A 4MFBB 5D4OA 4ZDNA 2BJDA 1OYEA 1ZETA 2M88A 4K4WA 3MXHP 4QBUA 4DPUA 5HROA 1DTQB 4EBDA 2UP1A 4XDDA 2V4JB 2HZVA 2VL1A 1U6ZA 3OD2A 4FBUA 2HLTA 1PBUA 2YXLA 2OI2A 4LF8J 4R0JA 3OV7A 4F2SA 4DLGA 2RMLA 4Q45A 1R0BG 1UEVA 2OUGA 3OR1B 1LV5A 1X5PA 3IG1A 3KMQA 3D0GE 3W2WB 4DR2J 1JJCB 2MZTA 3SCKE 2BJ9A 3LP1B 1PJ6A 3KLFB 5KT7A 2ZWPA 3CE8A 2VPWB 3W2VA 4BCAA 4KC5A 3ICLA 4N7TA 2DNMA 1GK8A 2XZDB 3ZZTA 2AX0A 2V63A 3I5AA 3R3TA 2CPYA 3D6TB 3H2UB 2HWTA 3M8QA 2QL5B 2WK4A 2GMJA 1Y7PA 2A18A 2H3EB 2RKIA 2FYXA 4X4QA 1W2BR 4UOHA 3BGRA 2W9CA 3M9NB 3KTQA 4Y2CA 1HBMB 2DXFA 3BH6B 2E9ZA 1Q78A 3K5PA 1TUGB 1YJTA 2GHVC 1TUWA 4HYKA 1MSWD 3GYXB 3DLEB 4ES1A 1Q0NA 4ZKAA 2QT7A 2MKIA 3BQ0A 4IYQA 4CLWA 1J5OB 2OFHX 1GXLA 1NJYA 4J9LA 3I0SB 1X4AA 2HHHF 3ZFVA 1RCXB 1S6QB 3I31A 4OYIA 3OTEA 2ZDPA 4C11A 4JI3F 1C0UB 2DPJA 5LXRA 4OHYA 2B51A 1MROA 4IR1A 1FVSA 1EARA 2QMUB 4JI0F 1VQ7S 1S76D 4A8KA 4B3OB 3MGJA 1SB6A 5FD1A 2JNJA 4CO4A 3C6TB 1H74A 3MMAA 1ZM3A 4C48A 2OGUA 1C1BA 2HMIA 2Y3YA 2BYCA 2E9RX 1CC8A 4RO0A 3G6ES 2B9XA 3IBFB 3RAMA 3DDIA 1FRMA 1JKHB 1WOSA 4PG4A 4NYZA 2P6SA 4S0MA 2OPSB 1TV6A 1X4FA 3SQGB 3G6VA 3DC2A 3BSCA 3GSIA 1YQHA 3LH2S 3NGKA 2AF6A 1HL6A 3PO5A 2PFFB 4DF4A 3MM8A 2RNEA 2UUBJ 1BD6A 3NG8A 4NCGB 1SQFA 2XULA 1X9MA 2DEJA 3J80Y 2CPXA 4ILRA 4NLTA 5ETQA 5KFXA 1KOHA 1IBMF 1VDHA 1JLFB 3PEHA 3CC7S 3CCRS 2RQ4A 3KG0A 5GADU 2R7VA 1FA0A 1UP1A 1VK3A 1KQGB 1AFJA 3NEKA 3GJSB 5CZVA 4CLTA 1S79A 4YY3F 5D0EA 3KNAA 1QVGR 2E7WA 2VQEJ 4CYUB 2KYZA 5KT2A 4FYVB 3MPYA 4WU2A 4J9VA 5K8NA 1HWIA 4DFKA 1OPIA 4LQ9A 3IP0A 5HROB 2D9OA 2WB4A 5J1NA 4ZHRA 1BXNA 1VQMS 3BKUA 5C7PA 2ZVIA 3AFGA 5EHHA 2I1RA 5AT1B 4FF1A 4Y28C 3FZBA 2YH1A 2MPUA 5F3ZA 3FZ2A 1TP7A 3K7RA 3KJQB 3IG1B 1TUVA 4XIUA 2FY1A 3G8SA 1S0OA 2CDRB 4G6VB 2N82B 1F1BB 4ELTA 3R8YA 2YH0A 1YJ9S 1RTDA 5KG4A 1Q86T 1YVFA 2ZH9A 3D7SB 2KG0A 1F9FA 1XMQJ 4QU6A 3FBFA 3W2VB 4K4TA 1KOOA 4TKTA 1S12A 3PW2A 2CQCA 4QR0A 1SVDA 1K9MT 4DPOA 1RCOB 3GMGA 4Y0FA 2BX6A 2NS1B 4CT8A 2DNKA 1NKCA 2W01A 1F6TA 1S1WA 2OO4A 5IM0A 1XEZA 3M8QB 3TVYA 2CQ4A 3QGPA 2RKIB 2J9DE 4WF9Q 5J2MA 3BGRB 2W9CB 1KHWA 4DPTA 1WHVA 1RWNB 3G87A 3SSQA 4YQWA 2VKRA 2KFYA 4O4GA 1SIWB 3UDLA 4MAKA 3H4BA 1HNWF 1JK9B 4OX8A 3EXYA 5IQ6A 3IRWP 2JEIA 2E44A 3NL0A 1WOPA 3BBFA 4ZVQB 2R7SA 1JJHA 2DEIA 2CWKA 2OLWA 2XB2D 4DPXA 2KM8B 4C11B 2HK2A 3GIJA 1F5CA 4E0DA 4PRFA 1MROB 1NNDA 2Q6BA 3Q8UA 1BY9A 3CCJS 2Z4PA 3LTOA 2E1RA 3MMAB 3M6XA 1C1BB 4TY8A 1LW2A 2HMIB 2NXEA 5D78A 3H4DA 1RB0A 1XBWA 3TA2A 3VAFA 4J7CA 4ZP7A 2CQBA 4DV7F 4B17A 3CNQP 3ILJA 3KLVA 3TQ1A 1J5EJ 2HHPA 2RVJA 3M6WA 1A0OB 2EBEA 3AAWB 3WZ0A 4ZVRB 2CQDA 4OZLA 3IWXA 2MZ1A 2JLEA 3GG1A 1TV6B 2B56A 4F02A 2V8DA 2X7IA 4J90A 1HNVA 1HBOA 4GKKJ 5IXUA 2PA3A 1KFSA 1LWXA 4CLKA 2ZZMA 4DU7A 2FUG9 4IRKA 2EW9A 3MM8B 1OY6A 4UUXA 1W25A 1JLQA 4ZPAA 5D0HA 3C19A 3CUNA 3ILLA 2WVFA 1DURA 4F25A 2IM3A 4UTGA 2DO4A 3HCXA 1ZZNA 2LDYA 5F9LA 1TKTA 3B78A 1B4SA 3NCPA 3G8QA 3CDBA 4GO7X 4QPXA 2GVZA 5F8IA 3HT3A 5AXLA 2ZOMA 2XCAA 4DCJB 2GV1A 4NLWA 4OIXA 3HHKA 4KH1B 2AHOB 3TUZC 3CO9A 2CIMA 1LXJA 4B3SF 2CNKB 2IM0A 1J2VA 2H54B 2GIRA 3A8JA 2C3UA 4UY8T 4K4SA 1XNQJ 3PG9A 2OELA 4ZHRB 1ZTWA 4NZ7A 4DPYA 3GV7B 1WHYA 3GIMA 4JOUA 4NXMJ 1U1KA 3FKBA 4X4VA 2J6SA 3L7PA 2XS7A 2WRMA 2VJUA 1X9SA 3M30A 2MKKA 1WTBA 5MLCV 1NDPA 1RTDB 3ZXWA 2VQFJ 3CCWA 1B0TA 2YX1A 7FD1A 4M94A 4OFZA 3VAHA 4M5HA 4RWXA 1KN6A 1T8EA 2IJRA 3MECA 4CLSA 2RQKA 2AT1B 1S9GA 3OTCA 1S1WB 2DNPA 4KY3A 1Q79A 3JTOA 2H51B 4OYAA
chains in the Genus database with same CATH topology
1SC4B 3EDRB 2Y0BB 3RJMB 2CNKB 2Y1LB 2XZDB 4ZVRB 3IBFB 1RHKB 2H5IB 2H54B 2CJYB 3NS7B 1RHMB 3R5JB 2QL5B 2H5JB 5IC4B 3EDQB 1RWNB 1RWXB 1RHJB 2HBQB 1GFWB 2C2KB 2CNLB 3P45B 2H4YB 3D6HB 2HBRB 2QL9B 2C2MB 2DKOB 4ZVPB 4JB8B 4ZVSB 1I51B 1RWPB 2QLFB 3KJNB 1F9EB 2XZTB 2CJXB 1RHUB 4ZVQB 4DCOB 3R7NB 3GJRB 1RWWB 1RWMB 1IBCB 3KJQB 2FQQB 2P2CB 4DCPB 1I3OB 1BMQB 3D6FB 1SC1B 2XYHB 1RE1B 2H65B 2QLBB 1RWKB 2CDRB 3KJFB 3R7BB 3R6LB 4ZVOB 1QTNB 2CNNB 2HBYB 5IC6B 1SC3B 3SIPB 1PYOB 1RHQB 3GJTB 2H4WB 2XYGB 3P4UB 3GJQB 2C2OB 4ZVTB 4ZVUB 2HBZB 4LSZB 1PAUB 1RHRB 5K20B 3D6MB 4DCJB 2CNOB 3IBCB 3R7SB 2C1EB 1NMEB 1QDUB 2C2ZB 2QLJB 1RWOB 2H51B 3QNWB 3R6GB 1RWVB 2H48B 2QL7B 1ICEB 2XYPB 3GJSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SC4 B;  3EDR B;  2Y0B B;  3RJM B;  2CNK B;  2Y1L B;  2XZD B;  4ZVR B;  3IBF B;  1RHK B;  2H5I B;  2H54 B;  2CJY B;  3NS7 B;  1RHM B;  3R5J B;  2QL5 B;  2H5J B;  5IC4 B;  3EDQ B;  1RWN B;  1RWX B;  1RHJ B;  2HBQ B;  1GFW B;  2C2K B;  2CNL B;  3P45 B;  2H4Y B;  3D6H B;  2HBR B;  2QL9 B;  2C2M B;  2DKO B;  4ZVP B;  4JB8 B;  4ZVS B;  1I51 B;  1RWP B;  2QLF B;  3KJN B;  1F9E B;  2XZT B;  2CJX B;  1RHU B;  4ZVQ B;  4DCO B;  3R7N B;  3GJR B;  1RWW B;  1RWM B;  1IBC B;  3KJQ B;  2FQQ B;  2P2C B;  4DCP B;  1I3O B;  1BMQ B;  3D6F B;  1SC1 B;  2XYH B;  1RE1 B;  2H65 B;  2QLB B;  1RWK B;  2CDR B;  3KJF B;  3R7B B;  3R6L B;  4ZVO B;  1QTN B;  2CNN B;  2HBY B;  5IC6 B;  1SC3 B;  3SIP B;  1PYO B;  1RHQ B;  3GJT B;  2H4W B;  2XYG B;  3P4U B;  3GJQ B;  2C2O B;  4ZVT B;  4ZVU B;  2HBZ B;  4LSZ B;  1PAU B;  1RHR B;  5K20 B;  3D6M B;  4DCJ B;  2CNO B;  3IBC B;  3R7S B;  2C1E B;  1NME B;  1QDU B;  2C2Z B;  2QLJ B;  1RWO B;  2H51 B;  3QNW B;  3R6G B;  1RWV B;  2H48 B;  2QL7 B;  1ICE B;  2XYP B;  3GJS B; 
#chains in the Genus database with same CATH topology
 5J2M B;  4A8Q A;  1YJ7 A;  5LSR A;  1D3W A;  2M0G B;  3DGP A;  4GMK A;  3T5J A;  4O4G B;  4DL0 C;  3W8G A;  3AXM A;  2YNG B;  5BR8 J;  2ZZT A;  4PQA A;  3J80 U;  1V9O A;  4DR7 F;  2CNL B;  2AJ0 A;  5KOX A;  1V5V A;  1H7W A;  3UE2 A;  2YVS A;  4NA2 A;  4IQM A;  4TQS A;  1XER A;  4JI3 J;  1JMT A;  5F9N A;  1WSR A;  1VMB A;  3BYR A;  4AL6 A;  1KC8 T;  4KAI A;  3MI7 X;  4ECS A;  2D7S A;  5H9F K;  1IR0 A;  2UUC F;  4KIA A;  1SC1 B;  3E01 A;  1AYE A;  4KYZ A;  4TY8 B;  1LW2 B;  1VJQ A;  2ZH4 A;  1SIZ A;  4USU A;  1U8S A;  1YGY A;  5AJ3 F;  3I4H X;  2N4C A;  4KGM A;  4KO0 A;  2WSE C;  1LQ9 A;  1Y11 A;  3GG0 A;  1S7I A;  2D3Z A;  2HRY A;  1VC6 A;  2DY1 A;  3ENA A;  3CCZ A;  2MQ8 A;  1NKE A;  2JJ4 D;  3QJP A;  2KL8 A;  3UD5 A;  1HNV B;  1HBO B;  2WCX A;  2CVI A;  4WXO A;  4X65 F;  5JUM A;  3TA1 A;  3UN5 A;  3G6X A;  3SEO A;  4XPE A;  4DFJ A;  2HFO A;  2R9L A;  2MKJ A;  4A48 A;  4CO0 A;  1JLQ B;  4DR5 F;  4WYW A;  2HSE B;  2VV5 A;  1UVM A;  2V5H G;  1ACM B;  2QSW A;  2KXF A;  2B4O A;  3IR5 B;  3PDN A;  2LEP A;  4RUA A;  2OPQ A;  4FBT A;  1TKT B;  4LVO P;  4CWB A;  3BQ2 A;  1TQL A;  2FZC B;  2IRX A;  4OV1 A;  2FHM A;  3RRG A;  4DSJ A;  4PUO A;  1IKY A;  5L1L A;  2GVZ B;  5E33 A;  2KXN B;  1RAA B;  4RBT A;  4DQR A;  1L5U A;  3NBP A;  3AXK A;  2KHC A;  2YKM A;  4RR5 A;  4LF6 F;  4QYR A;  3TX0 A;  1TL4 A;  4TNO A;  2CZ4 A;  5L9N A;  1QSL A;  2VFT A;  4RNM A;  5J2P A;  1FWL A;  1QM9 A;  2RIJ A;  2V4R A;  2Q66 A;  3ELH A;  4U6P A;  3MAH A;  1L3U A;  1KS2 A;  2BE9 B;  1YKW A;  2K8G A;  2L9D A;  2XGP A;  2IVF B;  1Y9O A;  2Z2Y B;  3P8B B;  1H3D A;  2PI5 A;  4JV5 J;  3KUH A;  1TL5 A;  2BE7 D;  3FEX B;  3EVO A;  4ALZ A;  3HI9 A;  2IDE A;  2ZEJ A;  3M30 B;  3NAH A;  1MW7 A;  4NCB A;  5LM7 E;  4A46 A;  2IHR 1;  4BBY A;  1XNR J;  4MT1 A;  4W90 B;  3D0H E;  4YOE A;  3K5M A;  3LQV A;  5EWG A;  1UJ5 A;  2CPH A;  2DR5 A;  2W9B A;  1X5O A;  4DI6 A;  2UV8 A;  1HBU A;  1Y10 A;  5F8G A;  2QO3 A;  3BGU A;  3MEC B;  4ICL A;  3LA0 A;  3FUY A;  1QVF R;  4NZ6 A;  1S9G B;  3D1Q A;  4ZN3 A;  5LSO A;  3THV A;  4R8U A;  2GO9 A;  4URS A;  4GO5 X;  2JFK A;  3TA0 A;  1VS3 A;  3OFG A;  1HNX F;  3PV8 A;  1SJ3 P;  4LSZ B;  3VAI A;  5AE1 A;  3D6M B;  4P6Q A;  3KHG A;  3BGL A;  6AT1 B;  2YQ3 A;  3C66 A;  3DGP B;  4LMZ A;  3MUT P;  4X2B A;  4A8W A;  5M2U A;  1JLA A;  3VVU A;  3DOL A;  1R6V A;  3D6H B;  4LBP A;  5E3P A;  2IBK A;  4GVL A;  4DZD A;  2BE2 A;  2OAU A;  2EG2 A;  3E01 B;  3D9B A;  1IKW A;  1O5J A;  2LU1 A;  2ERR A;  3F44 A;  4DSF A;  1JIH A;  4P7V A;  2KZZ A;  3V4M A;  4KO0 B;  5IC6 B;  1NDL A;  3GSD A;  1JLC A;  1NXI A;  4XO0 A;  1NPR A;  1JJ2 R;  2DJW A;  2LVW A;  3SSS A;  5K8M A;  1GX5 A;  1NPP A;  5FJ4 A;  1U47 A;  3NRB A;  1SCJ B;  4DX6 A;  2DRA A;  1Q5V A;  4DV2 J;  3MMJ A;  3JAM U;  2XM3 A;  4RW4 A;  3V4I A;  5AXK A;  1CJU A;  1WG5 A;  5KFW A;  3LWM A;  3D1H A;  1S1V A;  4WZM A;  3O2I A;  3FBE A;  2VPZ B;  1FKA F;  1WSV A;  2JHE A;  1V3Z A;  1R8C A;  2OPQ B;  4FS1 A;  2CQ1 A;  2X1A A;  2MZJ A;  1BLU A;  1RGV A;  4HH1 A;  4ECZ A;  4KPC A;  4USI A;  1ZM2 A;  3N6N A;  3KLI A;  4QIW D;  3R2C J;  4PUO B;  1IKY B;  2WOM A;  3ZZO A;  5A8R A;  3NBP B;  2YKM B;  2WVE A;  4O4R A;  3NNH A;  3HK2 A;  4ED2 A;  4ZVO B;  5HN0 A;  4N56 A;  3V2U C;  3MAQ A;  5J2P B;  2L3M A;  2W7P A;  5H1S V;  1XMO J;  4OYZ A;  4NWB A;  4EYI B;  2QSF A;  3FSY A;  4L76 A;  3T5L A;  4IFY A;  1FWK A;  4MIB A;  3LWL A;  3ITH A;  4C97 A;  2BOP A;  7FDR A;  1LXN A;  1WD6 A;  1WEL A;  2FZK B;  2ZDO A;  3D3B J;  3L7U A;  3ZZZ A;  1C1C A;  2PMZ D;  5K8P A;  3CVK A;  4IFV A;  1M1G A;  3TAN A;  3V6D A;  4URQ U;  3DFE A;  2JX2 A;  1T3N A;  4ZIT A;  1ROF A;  3PRV A;  4DSE A;  2W9B B;  4OHZ A;  1HBU B;  4J9Q A;  4C0H A;  4ED0 A;  2Y9H A;  4U7C A;  2R8J A;  3PKY A;  4ICL B;  4K4Z A;  3DRR A;  2VG6 A;  5BYR A;  3M32 A;  4OJG A;  4I2P A;  3MCM A;  1I6J A;  1P1T A;  4USJ C;  2C3M A;  4C3L A;  2ASL A;  1VQ5 S;  1F9H A;  2XCP A;  3W60 A;  1FRL A;  3IXQ A;  4PKD B;  4YB1 P;  2VF3 A;  4KHP F;  3O3L A;  1Y3J A;  4WU3 A;  1FKO A;  3UCG A;  3BR8 A;  3RW6 A;  4OX7 A;  4EZ9 A;  1B99 A;  1NME B;  3LUY A;  2J9D A;  4N77 A;  1FD2 A;  4YHH J;  4UST A;  3KYL A;  4NXN F;  1U6B A;  3A8E A;  1OWX A;  5KG5 A;  1JLA B;  2EC0 A;  3EDR B;  1M5K C;  3QAT A;  2BAC A;  5KFC A;  3DOL B;  4DV4 J;  1PCA A;  3K59 A;  2VBX A;  5J1P A;  5DGA A;  1PC4 A;  1DAX A;  1NJI T;  1BHN A;  4CNY A;  2BE2 B;  4NX9 A;  5DO2 A;  2MLY A;  4OI4 A;  4IKA A;  1HIY A;  1R27 B;  4NLP A;  3OPK A;  1YWX A;  4M63 A;  1IKW B;  2XSJ A;  3V81 A;  2HFZ A;  3G9C A;  2NZC A;  1AB8 A;  1HQU A;  5AJ3 J;  3NGS A;  1R8B A;  1WHW A;  4FXW A;  3D2W A;  2OEK A;  2Z0G A;  1WDD A;  2F4V J;  1JLC B;  1NK4 A;  4FYW B;  2F3J A;  4LF9 J;  2FJB B;  1TEL A;  4IG3 A;  4LFA J;  1QE1 A;  3ETO A;  2P9G A;  3GV8 B;  1UVJ A;  4Q7A A;  3OSP A;  2BW7 A;  1Y5L B;  3HHE A;  2PEB A;  1VQP S;  2JEG A;  3KHR A;  3EJM A;  1F2H A;  3GZ7 A;  4RW4 B;  2C2Z B;  3B4M A;  2HPU A;  1EZZ B;  3V4I B;  1S59 A;  3R6G B;  3A12 A;  3MD1 A;  1CJU B;  2ALY B;  1ZAV A;  2VBZ A;  1G6B A;  1S1V B;  2R7U A;  3D5M A;  2PEH A;  3G2X A;  4DQP A;  4E98 A;  2YQ0 A;  1NHV A;  5IV4 A;  1H38 A;  3AB4 B;  4DG1 A;  5HLF A;  2CVE A;  4LF7 J;  3GFZ A;  2P6T A;  2JLF A;  1RA7 A;  2MXY A;  4ENO A;  3KLI B;  1FFG B;  4P74 A;  4O23 A;  3KLE A;  5B0A A;  1F60 B;  2WOM B;  1H2V Z;  1RWP B;  5A8R B;  3BH7 B;  3VGU A;  2O1P A;  2ZJP Q;  4MK8 A;  3TAM A;  5CA5 A;  1ZM4 A;  5GMK a;  4DV0 J;  3TAR A;  5DDO C;  2R7X A;  1TK0 A;  1RAG B;  5CD4 A;  2B0G A;  2X1B A;  4DUZ F;  1HHQ A;  3CIM A;  4IFY B;  4ZCK A;  3ITH B;  5A76 A;  2WW4 A;  4NLG A;  2R8G A;  2HGM A;  2YX7 A;  8ATC B;  1Q4R A;  5L8R C;  1REV A;  3Q8Y A;  3H0P A;  1C1C B;  3A1Y G;  1S5Z A;  4IFV B;  2RAQ A;  3K17 A;  3V6D B;  1VRQ C;  2LKZ A;  2ZWO A;  1UEK A;  3T1A A;  4N5S A;  2IDL A;  4L3K A;  2G2O A;  4AD6 A;  2YTC A;  2D3O 1;  5D6G A;  4A47 A;  4LT6 A;  3ENV A;  3GIK A;  2IRY A;  3MM5 A;  1T9T A;  5DET A;  1S6U A;  3DRR B;  2VG6 B;  2LA6 A;  3CPW R;  3M32 B;  3Q2T C;  5EN1 A;  2RJZ A;  5EX0 A;  5HAN A;  4I2P B;  1K1S A;  4OI1 A;  2QIF A;  1O0P A;  2OPR A;  4NAS A;  2F4F A;  3ZZU A;  2NLW A;  1FRH A;  4HI2 A;  1HNI A;  2ZBI A;  3SSR A;  2CXE A;  4EU0 A;  1YX2 A;  2HGL A;  5B0E A;  4AFF A;  4IQX A;  1KON A;  2FC8 A;  1Z1Z A;  2DK2 A;  1FKO B;  2MQO A;  4DUY F;  3PX6 A;  3EX7 B;  4QWB A;  5AE2 A;  4C6A A;  5I3P A;  5BYS A;  1P8G A;  2W2N P;  3R9L A;  2C42 A;  5L1I A;  4XK8 C;  4DR3 F;  4PWU A;  2FHO B;  3A3P B;  1K1Q A;  5CH7 B;  3M8Z A;  4OYM A;  5B09 A;  1QAX A;  1FWP A;  4GRS A;  1QLN A;  3N6M A;  4PXD A;  2GNK A;  2QRR A;  5ETL A;  3UD3 P;  2XSJ B;  3V81 B;  2JWN A;  2VIH A;  2E5G A;  4ZLN A;  1HQU B;  1DLO A;  3CW2 C;  3JS9 A;  1NZ8 A;  2DGV A;  2MHN A;  4DL6 A;  1DQ8 A;  3FQK A;  2ZJQ Q;  4ED1 A;  2QLX A;  2B7C B;  4J5O A;  4IG3 B;  1QE1 B;  4Q5V A;  2J76 E;  3NOC A;  4I1T A;  1AFI A;  2M5Y A;  1NK5 A;  2DT9 A;  4EMD A;  3FNN A;  4YUD A;  5KFD A;  1KFD A;  4D3G A;  3D0I E;  4ZVH A;  2OFG X;  3Q83 A;  4DPW A;  2APO A;  1Q8B A;  3M1V A;  4ZVU B;  4KV8 A;  1C2P A;  1BWE A;  2UVW A;  4PYD A;  1T9V A;  3W9H A;  3F0N A;  2CNO B;  2FIU A;  1S48 A;  4C98 A;  1WAC A;  2IBO A;  2QLJ B;  3J81 U;  3BO4 A;  5K5M A;  2MTL A;  2FD2 A;  1R8H A;  4NYO A;  1Q1K A;  1UWB A;  3C3L A;  4DG1 B;  5HLF B;  2KYX A;  3QFW A;  3BGO P;  2UXB J;  5T7L A;  4M5D A;  4M5L A;  3KLE B;  2VG7 A;  4PG6 A;  5KFP A;  4DS5 A;  1VI7 A;  2Y0S D;  4ZN1 A;  3HO1 A;  4USH A;  3K5O A;  3QGG A;  1T05 A;  3DLG A;  1TL3 A;  2KB2 A;  3B6B A;  2MQP A;  3VR1 A;  1N32 J;  5LMN J;  3FC9 A;  5KFS A;  3ISN C;  5F0U A;  3TAM B;  3BPS P;  2BJ7 A;  1HWU A;  2FJE B;  3SI8 A;  2MST A;  3W7B A;  2LQ8 A;  5B0D A;  2V2K A;  3MR6 A;  2UUT A;  1NK6 A;  4YDX A;  1VQO S;  2XO7 A;  1REV B;  3VGT A;  1D1U A;  2LQ5 A;  2XMK A;  2NQP A;  4FF2 A;  2DCL A;  2FJD B;  1RTH A;  2HG4 A;  2AKW B;  4DFP A;  4M5N A;  4KQZ A;  1IBL F;  1I94 F;  4DZ6 A;  3PYE A;  1S0V A;  3PKM A;  2BKO A;  1U1O A;  1RAO A;  1DFD A;  3MM5 B;  2A6M A;  2AJF E;  4RNN A;  4M5G A;  3OQ2 A;  3Q8R B;  3ZNU A;  2BEF A;  4KH0 B;  1NK0 A;  3R5J B;  1U49 A;  3A13 A;  4AE5 A;  1EJ7 L;  2C2K B;  2OPR B;  1HR0 F;  3AOB A;  1KSP A;  1TL7 A;  3W61 A;  4ZA1 A;  5IZH A;  2UU9 F;  5F8J A;  3UDV A;  4H4K A;  3GP9 A;  2HNZ A;  1HNI B;  3EIC A;  1NJZ A;  3CCQ S;  1KR4 A;  4PR6 A;  1KTQ A;  2YWK A;  3GIR A;  4USK A;  3Q8Q B;  1YIJ S;  4DBQ A;  3RZA A;  2V9W A;  2W4D A;  4R25 A;  2ZNZ A;  3IAS 9;  3TUP A;  2C2D A;  5IT9 Y;  1DQA A;  2BZ2 A;  2R42 A;  2JC1 A;  3R6L B;  2K7J A;  2XQC A;  2H4W B;  5D4L A;  4J9K A;  4DR4 F;  1VC5 A;  2FDN A;  3J7A N;  3SCL E;  3M9O B;  4JI5 J;  4A8Y A;  4HH0 A;  1RWO B;  2E5J A;  5KFV A;  1CC7 A;  2E66 A;  2JC0 A;  4M95 A;  4CT9 A;  1FF2 A;  2CPD A;  2QG9 B;  2Z8Q A;  3QLH A;  4OLP A;  5IV3 A;  3CJ0 A;  2D69 A;  5C2C A;  1DLO B;  2MJN A;  2A10 A;  1NH8 A;  4QPT A;  3B54 A;  1G1X A;  4OQJ A;  1TL1 A;  2KFZ A;  4ZK7 M;  5HBM A;  2NPF A;  3OBI A;  2DVI A;  1SKW A;  1IR2 A;  4J9O A;  2VOO A;  4TU9 A;  1F9E B;  2VFV A;  3RTV A;  2ZKU A;  4DV3 J;  4LFB F;  1HI8 A;  1WC6 A;  1RT2 A;  4ECX A;  3CED A;  1NKB A;  3M1V B;  1M5P C;  3KFW X;  2AJQ A;  3IR7 B;  2AYM A;  4KV8 B;  4JI6 F;  1BGX T;  1SBR A;  4MKY A;  2E5L J;  1HNZ F;  1FXL A;  4UF4 A;  5LSL A;  1LFP A;  5I3Q A;  3JSB A;  1UWB B;  1C4A A;  5EWE A;  3HFK A;  1EP4 A;  2RQM A;  5T7L B;  5C5J A;  4M5D B;  3BPD A;  2VG7 B;  3MMC A;  1E6Y A;  5T14 A;  1ARO P;  2DIV A;  3AJ2 A;  4V19 J;  3AA9 A;  4I7F A;  1T05 B;  3S01 A;  3DLG B;  5DDQ C;  5HMY A;  1TL3 B;  3NNC A;  5EUH A;  3BSA A;  4HDG A;  3DLH A;  1ZPW X;  2OH2 A;  3W65 A;  1R8A A;  2YNI A;  5EX3 A;  5KAK A;  1WC1 A;  2CG8 A;  2FGO A;  3SCJ E;  2CZV C;  2FHK A;  2HS3 A;  4C7Q A;  2O01 C;  4JI7 F;  3QSY B;  2CDQ A;  3J7Z T;  1EKS A;  3CD7 A;  1VFJ A;  2JLG A;  4C9D A;  1S4F A;  2YKN A;  3LF0 A;  5D15 A;  3CDE A;  3M8R A;  3HD2 A;  5IWA J;  1S99 A;  3VQT A;  2NRE A;  1JQG A;  2CJK A;  1KTV A;  5HAO A;  2FY8 A;  3QRP A;  1R31 A;  1RTH B;  4ECT A;  1UVN A;  4LFC J;  1DQ9 A;  1EET A;  3ZZY A;  3D66 A;  2N7Y A;  3CD5 A;  4LRF A;  2LFV A;  1WUU A;  1KVI A;  5L46 A;  1S4E A;  4DV1 F;  4F4Y A;  3HM9 A;  1NHK L;  1ICE B;  1C4C A;  1RLD A;  3HVT A;  4KGK A;  2R4F A;  2FGC A;  4RUC A;  4RX6 A;  4ZIW A;  2D3U A;  1TL7 B;  1PIL A;  4AL7 A;  3SXL A;  2HNZ B;  3FQL A;  3QYY A;  4QIE A;  5SZT A;  1FX2 A;  1KLN A;  3DDN A;  4OHX A;  4CH0 S;  2HQI A;  1B0P A;  4OJH A;  1NSA A;  4KSE B;  4FXD A;  4I69 A;  3VAM A;  4IOA Q;  1U6F A;  3AOA A;  1GXU A;  2GS8 A;  2KRR A;  1OQ3 A;  4Y00 A;  3Q8P B;  4FKY A;  2E1M C;  3H90 A;  4FYY B;  5DQG A;  2HHV A;  2WVB A;  1RK8 A;  3IR6 B;  1Q7L B;  5KFA A;  3VQS A;  5H9F J;  1VIO A;  3AD8 C;  3MM6 A;  1BUX A;  2ROP A;  4KKO A;  4CLZ A;  4K2X A;  3DRS A;  3QLH B;  1TKX A;  1RUS A;  2ATC B;  4WCE Q;  3W64 A;  4C4W A;  3VAG A;  2CQI A;  2PMH A;  1FNM A;  1MWZ A;  1TAU A;  4ELU A;  1TL1 B;  5HBM B;  3QJL A;  5HQ8 A;  4WFN Q;  4ZPT R;  1TZ0 A;  3KUG A;  2YKP A;  1N0V C;  2WAQ D;  1KD1 T;  5DM6 Q;  2KI2 A;  1UPP A;  2AX1 A;  3FSI A;  1N5Q A;  1RT2 B;  2CYY A;  4F0K A;  3T9N A;  3N0V A;  5HMX A;  4OYO A;  2D3O R;  1XC9 A;  1FK9 A;  2V68 A;  2VD3 A;  4PAB A;  1JXV A;  1MMN A;  2UXC F;  2OEM A;  2CWX A;  3BKF A;  3GCX P;  4RBU A;  3EVM A;  1KRP A;  4I68 A;  3QJJ A;  2NSC A;  1NBE B;  2HS0 A;  1URN A;  5DG8 A;  2L41 A;  3T1Y F;  3PX4 A;  1SKU B;  1S1X A;  2HIY A;  5HVH A;  1EP4 B;  3H5X A;  1S1U A;  4MK7 A;  3MMC B;  1E6Y B;  3QQC D;  5KFI A;  3FSX A;  3ILI A;  3HDS A;  4I7F B;  2BR0 A;  3NWG A;  1SH2 A;  2CPJ A;  3BEG B;  2N3O A;  3FMW A;  1DHM A;  2B3T B;  2YNI B;  3MOJ B;  3IC1 A;  2DR9 A;  1M5H A;  4UUW A;  3ULH A;  4FP9 A;  2CPE A;  3DLK A;  2FB0 A;  1IVZ A;  4C8L A;  4OLO A;  2YKN B;  3TWZ A;  4K0K F;  2DGU A;  2NPI A;  3CO0 P;  2XMV A;  2HVD A;  2HHT A;  4X4R A;  1RE1 B;  2L48 A;  1S0N A;  1T94 A;  1EET B;  3VHQ A;  2XLK A;  2HBY B;  1IWA A;  2OD6 A;  3FBC A;  3AH6 A;  4G1Q A;  2LYV A;  1UMJ A;  2PD1 A;  3H40 A;  3HVT B;  4ZLJ A;  4HKQ A;  1HW8 A;  5A8W A;  1RSC A;  2L9N A;  2P9E A;  1RT1 A;  1KVK A;  2A3J A;  1SC4 B;  4DR6 J;  4QIV A;  4TVA B;  3TZX A;  5EWF A;  1YDL A;  2XY6 A;  1X8D A;  3W66 A;  2WHO A;  4JYA J;  3PHT A;  2RUG A;  1CQM A;  3AHP A;  4JP8 A;  2MMY A;  2R7W A;  1RAB B;  3HPO A;  2ZH7 A;  2IA0 A;  2V9K A;  5EGY A;  4DV6 F;  3W9J A;  4JI8 J;  1R89 A;  2R3V A;  2MY8 A;  1GAO A;  1SXL A;  4ZS6 A;  5ETK A;  2DCU B;  1J27 A;  3MM6 B;  2J7W A;  3GCW P;  4KKO B;  2EI5 A;  4Q43 A;  3DRS B;  1FTC A;  4CP5 A;  2V2Q A;  2I5J A;  1TKX B;  3HHD A;  1IBK F;  4NLS A;  2WTF A;  4DDF A;  2O66 A;  1QDU B;  4FKX A;  5ETN A;  2CQ2 A;  4C8M A;  2VDI A;  4KGV B;  3B82 A;  3OHA A;  1YI2 S;  2AWZ A;  2C22 A;  1RHK B;  2RDI A;  4GKJ J;  1P27 B;  4PG8 A;  3HHL A;  2XEX A;  5MAO A;  3DNC A;  2MKC A;  4X84 A;  2JZ5 A;  1WWH A;  4F4X A;  2YNF A;  3HHL D;  5D8H B;  2DRB A;  3QWU A;  4DSK A;  5DLF A;  3KHH A;  1FK9 B;  1RKJ A;  2EFP A;  3MEG A;  4ZVF A;  4HTI A;  5DZ7 A;  1HWL A;  1X4H A;  2ZH2 A;  1U1N A;  2BRK A;  1QAJ A;  3MEK A;  1WEX A;  2Y1I A;  3MZI A;  1XTZ A;  4MJK A;  4HEA 9;  2VFS A;  3I0R A;  1S1X B;  4MK9 A;  2X3G A;  4WK3 A;  3H20 A;  5D0R A;  2KJV A;  4L3N A;  4P71 A;  1S1U B;  5DJB A;  4IRD A;  1GQE A;  5ETS A;  3AOD A;  1XMB A;  2RU3 A;  2HQF A;  1HQ2 A;  1RAI B;  2ACY A;  3KHL A;  1LNQ A;  4ZJO A;  4QWC A;  1Q5Y A;  3T1H J;  1P9Y A;  3DU5 A;  3HSZ A;  1VBY A;  5CD4 H;  1FRJ A;  3QNW B;  2R7T A;  3G86 A;  3M6V A;  1IR1 A;  4L6V 3;  3WIV A;  2HNY A;  1ZAX A;  2ZHA A;  1OY8 A;  4F2R A;  3CCV S;  3MDF A;  2VOP A;  5DGB A;  3DLK B;  3GIL A;  3N01 A;  4MMO A;  2IVY A;  3EGN A;  1RZM A;  1TAQ A;  2C2M B;  2FC9 A;  2MKH A;  1FEH A;  2KVI A;  3ISN D;  4LQ3 A;  2UUA F;  2OMO A;  5A8K A;  1APS A;  1VC0 A;  4BC9 A;  1EQ0 A;  1KHV A;  1WC0 A;  2EWH A;  3CGI A;  4NPO A;  4M5J A;  4BDP A;  2V4Q A;  1RJJ A;  3F73 A;  1EAY C;  3MM9 A;  3HSG A;  5GME A;  3PY8 A;  3OL7 A;  4G1Q B;  3IO1 A;  4DQI A;  3UVJ A;  4HTJ A;  4U67 Q;  4MIA A;  2ADB A;  1WOO A;  1FER A;  2V8P A;  1SJ4 P;  5JJB A;  5BJR A;  5A8W B;  1PKU A;  1RT1 B;  4KGZ B;  2ACM A;  1Q95 G;  3QT8 A;  3B8H A;  2AMC B;  1YK9 A;  4DR1 F;  2FPH X;  4WBF A;  5A6W A;  3UR0 A;  1DAR A;  2CJ9 A;  3BJY A;  3BBB A;  5T41 A;  4NMX A;  5GAG U;  2DNQ A;  2GCF A;  5LMU F;  1VBX A;  2RSQ A;  5GAE I;  1RAF B;  2UZA A;  2GZO A;  5KG0 A;  4ER8 A;  1JX4 A;  2H4Y B;  3I55 S;  4NLU A;  1NCL A;  4ZCM A;  4JI4 J;  4CLF A;  1WI8 A;  4DV5 F;  2ZH6 A;  3GB0 A;  1RT6 A;  2OJ3 A;  5CAB A;  5J2Q A;  4Z7Y A;  4F4A A;  1QTM A;  1GNK A;  2F65 A;  1YSJ A;  1H73 A;  3PEJ A;  3GWC A;  9ATC B;  1N34 J;  4G1P A;  2I5J B;  1DZ5 A;  4ECQ A;  3L3C A;  2MQQ A;  4P2S A;  2F7V A;  2XS2 A;  3MWB A;  3HT0 A;  1X31 C;  3RRK A;  3PIP Q;  3CCU S;  1N36 J;  2PC6 A;  4OYW A;  4YFU A;  3PZP A;  3PAC A;  4O3N A;  3W8P A;  4RW9 A;  3H98 A;  5HO4 A;  1TKZ A;  1NK9 A;  4J9U E;  4B3M J;  3HHL B;  3RJM B;  2YNF B;  2ASJ A;  5ETR A;  1UW4 A;  1WG4 A;  4N8N A;  3DLJ A;  2ZE2 A;  4CO1 A;  2ASY A;  5A2Q Y;  2ZZN A;  1T9W A;  3CJK A;  2XI2 A;  1U0H A;  3HSJ A;  1D09 B;  5C25 A;  4K4Y A;  3MEG B;  2G2Z A;  3KLH A;  3AD9 C;  1FJ7 A;  3Q2S C;  4OHW A;  1NUE A;  2VB6 A;  2GJF A;  1T9Y A;  3EMT A;  1G2E A;  3I0R B;  1ZS6 A;  1VBZ A;  4KE5 A;  2V0N A;  1K0V A;  1LWF A;  2DNZ A;  1YRU A;  2ADC A;  1U1L A;  3TO8 A;  1IWG A;  2IRU A;  4PWW A;  1VIX A;  2W7O A;  4U8V A;  2MHE A;  3OTO J;  2LQ9 A;  4K2J A;  4HDH A;  3WHI A;  3HVR A;  3C14 A;  4CH1 A;  5HJX A;  3BSN A;  4LSL B;  5CCM A;  1ZAW A;  3JQJ A;  3DOM A;  1Q16 B;  2HNY B;  2EFG A;  3BO3 A;  3N79 A;  4E8U A;  2Z57 B;  4OI6 A;  1VQK S;  3OVA A;  2QV6 A;  2QJ3 A;  4ZPV R;  4JI2 J;  4LF2 A;  1HWJ A;  3A8K A;  4KTQ A;  3T41 A;  5A8K B;  1SKS A;  2OSR A;  2I6W A;  4WZQ A;  3CD6 S;  4I67 A;  2ROE A;  2A2D A;  3ZZP A;  4HHU A;  4I6Y A;  3OFE A;  2IYI A;  5K9F A;  1O51 A;  2J6T A;  1U1M A;  1N33 J;  2QYC A;  1O6X A;  2KU7 A;  4V1A k;  3MM9 B;  4X4U A;  2QLW A;  2HVH A;  4WE1 A;  3UVJ B;  2Y1J A;  2HWI A;  2H1Y A;  4RNO A;  4C8N A;  2W2P P;  3UI3 A;  4I2Q A;  3DYA A;  3Q8S B;  3N28 A;  2R7O A;  2EBG A;  3GR1 A;  1NH7 A;  4C8Y A;  2K2P A;  2AYE A;  2DNY A;  2C3O A;  4CQ1 A;  1L3V A;  1VLO A;  2AGO A;  2ZOF A;  1SJF A;  2OD4 A;  2Q3P A;  1WG1 A;  2CAD A;  1UFL A;  2EK1 A;  1GX6 A;  1EQM A;  4IO1 A;  1TMM A;  3I87 A;  2B9Y A;  2LXI A;  4O0I A;  3DKD A;  4JI1 J;  3RBD A;  1RT6 B;  3THP A;  5J2Q B;  2BKP A;  2YY3 A;  2YWG A;  4HAC A;  2DBB A;  2DGX A;  3H2L A;  2EKN A;  2B8P A;  4W92 B;  4B3T J;  4RU9 A;  2XO6 A;  2DRD A;  3KG1 A;  1WHX A;  1JWW A;  3LPE A;  4X62 J;  3ENW A;  4R0E A;  3AT1 B;  2B43 A;  3H59 A;  4ZIV A;  1RWM B;  1PJ5 A;  2DIU A;  4KGX B;  3LAN A;  3O44 A;  2K06 A;  1S97 A;  2DIT A;  4WTO B;  4K50 A;  2KZM A;  3RG6 A;  1FO1 A;  3GU0 A;  3L4B C;  1HYS A;  4OX9 J;  4CLP A;  4LR9 A;  2KXH A;  2Z58 B;  2RHQ B;  3HVA A;  4RW9 B;  1TKZ B;  1RBL A;  5IT0 A;  3MF5 A;  1KP6 A;  4BLG A;  4X64 J;  2ZE2 B;  4OJ3 A;  4LF4 J;  3P3D A;  3CJK B;  1KEK A;  1FDN A;  1U0H B;  1YZ7 A;  4J9P A;  3JSR A;  5C25 B;  2HHW A;  5AXN A;  4H54 A;  1WI6 A;  5C2G A;  2ZM6 J;  3W5Y A;  2HVZ A;  2CUY A;  4OMF G;  2YWE A;  1FDB A;  1SUQ A;  4W98 A;  3T3F A;  1HA1 A;  1LWF B;  1WKK A;  4DUT A;  4WFX A;  1GMU A;  1M5S A;  4M5I A;  5KT4 A;  2CZ9 A;  1KNZ A;  4LF5 J;  1XK8 A;  3G8T A;  1U2R A;  4ZJL A;  1HFE L;  4QW9 A;  2FQQ B;  5GAH U;  3C14 B;  2VON A;  2CJB A;  2RDJ A;  4EGL A;  4AND A;  3BYP A;  1FJG J;  5HMW A;  3DOM B;  2WSF C;  5E3R A;  3BDE A;  1NRK A;  1YLX A;  4O3R A;  4WFY A;  3LW5 C;  3PJX A;  4AQY F;  1F0X A;  3US5 A;  2GQQ A;  1FNO A;  1U09 A;  3NWR A;  2RUS A;  4DJB A;  1RT4 A;  2IM2 A;  3V5R A;  3KK1 A;  3JXO A;  1EHW A;  3EVW A;  4RWW A;  3M2V A;  9RUB A;  4DN9 A;  3PRD A;  2H5I B;  1SQE A;  3KWM A;  2AW0 A;  3MUM P;  3NP5 A;  4LF8 F;  4ZLL A;  2KHD A;  2NUU G;  1HD0 A;  1RTI A;  3R5B A;  4Y2I A;  2E5I A;  4WE1 B;  3QGI A;  1YZ6 A;  3BQ1 A;  4OZ2 A;  3R5A A;  2NXU A;  2DY9 A;  3L7O A;  1JJ4 A;  2MKS A;  2JSX A;  1X7V A;  1Q82 T;  4I2Q B;  3DYA B;  4L72 B;  3D6F B;  3OL6 A;  3NGD A;  5KT3 A;  2BRL A;  3I4P A;  2RQC A;  1ULR A;  2M8H A;  3JSM A;  4F3O A;  2O67 A;  1NDC A;  1ITP A;  2LLZ A;  3I56 S;  4ZVG A;  2DYA A;  1BQN A;  3BO2 A;  1Y3K A;  2A0F B;  3MHY A;  3GFX A;  4OI3 A;  3IN5 A;  4BS2 A;  4KJI A;  1FRX A;  5KFM A;  4DN0 A;  2C3P A;  3FCW A;  5ETP A;  2Y1L B;  3Q0A A;  3LO3 A;  4IOB A;  4HAC B;  3MAA A;  3KJV A;  2RRN A;  2XG8 A;  3D1O A;  2XBP A;  4HHH A;  3U1N A;  1CJK A;  2QL9 B;  5HAT A;  5IOL A;  3J7Y I;  4FZV A;  1S9F A;  3DM2 A;  3FMB A;  3K89 A;  3QID A;  3AQP A;  4G65 A;  1WTF A;  4KRW A;  4BWM A;  2BJ1 A;  2A1B A;  3PJ9 A;  4FNI A;  1HYS B;  2OTL S;  1HKA A;  5IM0 B;  3RBE A;  4OI2 A;  2ZHB A;  3QO9 A;  2MB0 B;  3IFE A;  3FEY B;  3BM7 A;  1Y4Z B;  1FDA A;  1LOU A;  2PE8 A;  1A6L A;  2HBZ B;  3BGF A;  4IH5 A;  3I96 A;  4TXS A;  3IBC B;  1JXE A;  1W7W A;  3LGM A;  3H5Y A;  2OTJ S;  1MNE A;  1RWV B;  2HHH J;  2IYG A;  1DJ0 A;  1SUQ B;  1VJW A;  3N4W A;  2UUB F;  1D9F A;  3AOC A;  3VTI A;  5I3U A;  2DR7 A;  5FDL A;  2QC3 A;  3EDQ B;  2MKY A;  2XLJ A;  4JI0 J;  3HX9 A;  2DKO B;  4ID8 A;  5B0F A;  2IMW P;  3UW1 A;  4Y3C A;  4WPA A;  3W5Z A;  1OPZ A;  2FJW A;  3PJW A;  3NNA A;  2BAN A;  2RRB A;  2IMO A;  3K8W A;  1CUL A;  4LR7 A;  4KPY A;  4NLD A;  3IM9 A;  2BJ8 A;  1ZM9 A;  5F3T A;  2OSQ A;  1YBU A;  1RI7 A;  2VQE F;  4MKA A;  2E9T A;  4Y2K A;  3H2V E;  1RT4 B;  1FCA A;  2E1C A;  3KK1 B;  1SH3 A;  4ZPD A;  2F40 A;  4NRU A;  2OP5 A;  5RUB A;  1U26 A;  3TP2 A;  3QRQ A;  2M4M A;  3M2V B;  1KWM A;  2M3D A;  2NR0 A;  2EFV A;  5B0C A;  2ZNY A;  5C42 A;  2HVI A;  1U1P A;  3M9M B;  4C0O C;  2XMA A;  1PBA A;  4RKU C;  2UV8 G;  2KO1 A;  3LPY A;  1RTI B;  4Y6I A;  4WKR A;  4Y2A A;  4U7U K;  4C8K A;  5A0Y A;  1IBM J;  2HFN A;  2HFV A;  4GVB A;  1XMQ F;  5HVG A;  5M2P A;  1TR0 A;  3HKZ D;  4ED7 A;  1YJN S;  2NUH A;  1Y5N B;  2AGQ A;  2HQC A;  3D3C J;  4YY3 J;  3JB9 k;  2X51 A;  4PG7 A;  3H5U A;  2COL A;  5HVF A;  3JSM B;  1HI0 P;  2W2M P;  4I4B A;  4Y65 A;  1BQN B;  4B9N A;  4NEZ A;  5LXY A;  1CEZ A;  4DX5 A;  5E3C A;  2HQ3 A;  2B5J A;  4CO5 A;  2ZBC A;  4B9M A;  2AJ2 A;  3QGH A;  3C16 A;  1VQ6 S;  3PVX A;  1KQF B;  1UTA A;  2R2U A;  1X4C A;  2R2R A;  5DLG A;  1CBK A;  1TK5 A;  3MAA B;  3KJV B;  3S1T A;  3I82 A;  1O8B A;  1NK7 A;  2J0W A;  3PHE A;  2N7C A;  2ZC3 A;  2VC1 A;  1CJK B;  1U8W A;  4L74 A;  3HKW A;  1FJC A;  2PGC A;  5CZX A;  1DBD A;  3H25 A;  3BKT A;  3EZ5 A;  3SV4 A;  1RWX B;  5D0G A;  1UFK A;  1KDN A;  3DM2 B;  2IA6 A;  1H2T Z;  2W8K A;  3OTD A;  3MPV A;  1V6H A;  3PFO A;  4KT0 C;  4DSI A;  1TK8 A;  3AD7 C;  2EVZ A;  2FLO A;  1L3S A;  4F36 A;  3MUR P;  2KKH A;  2DGS A;  3BN7 A;  4PCQ A;  3U27 A;  1J5E F;  3QO9 B;  3CDU A;  4MH8 A;  5E41 A;  2QA4 S;  2I0X A;  1RT7 A;  1FKP A;  4ELV A;  3KDN A;  4ECR A;  1N5Y A;  2XI3 A;  1WJ9 A;  4GKK F;  2WVD A;  1HNW J;  2LEA A;  4F67 A;  3H8Y A;  1YIT S;  4C3K A;  2KT2 A;  1IUJ A;  1U02 A;  5KFJ A;  4UW2 A;  2AU0 A;  5HI7 A;  4IDK A;  1YTY A;  2KT5 A;  1P1L A;  1OQ6 A;  4YP3 A;  4PYA A;  1U1R A;  5I3U B;  5FDL B;  3WIU A;  2MZR A;  3JTN A;  1VCT A;  3S6E A;  2LU2 A;  1VBK A;  2V67 A;  1N48 A;  3CUL A;  3A3N B;  4CZC A;  2F8H A;  3TVZ A;  4DV7 J;  2BAN B;  1REG X;  4DX7 A;  3W3S A;  1CUL B;  3SMZ A;  4YME A;  4QIF A;  1R0C B;  3CCT A;  2HAI A;  5CYQ A;  3BS9 A;  2AJ4 A;  2PDA A;  2XYH B;  4X4N A;  4ZPW R;  4EBC A;  2FTR A;  3DLB A;  1UKU A;  3Q89 A;  4K59 A;  2VDH A;  4F3M A;  2XYG B;  1XNQ F;  1HHT P;  3V6K A;  2HW3 A;  2OEJ A;  5C42 B;  3GQC A;  8RUC A;  4X66 F;  3HSD A;  4NXM F;  2BV3 A;  2BM1 A;  3H5S A;  4DHV A;  2DHG A;  5DS7 A;  1U7L A;  1CJV A;  5FII A;  4ECU A;  3RAQ A;  5A0Y B;  4M8L A;  2IIH A;  1SL1 A;  4OZ3 A;  4AXJ A;  5KFQ A;  2X1F A;  1CJT A;  2BM0 A;  2VQF F;  2DH9 A;  5DG9 A;  4GVB B;  2HHS A;  1H7X A;  3FGV A;  2V6A A;  1TVR A;  3FRY A;  4PPD A;  3CCL S;  1RHM B;  2H5E A;  1QY7 A;  5G4D A;  2PFD A;  4LSN A;  3WC0 A;  4KB7 A;  3RRH A;  3BDP A;  5IT4 A;  1AW0 A;  3H42 A;  1AZS A;  2DNG A;  4RLE A;  2LXU A;  1Z2L A;  4YN3 B;  1AUD A;  1KVJ A;  2CJX B;  2DHS A;  4B3S J;  1X4E A;  5C24 A;  3LP0 A;  2FVS A;  2GQC A;  3U7J A;  4Q0B A;  1RAD B;  2G0C A;  2LMI A;  3R2D J;  1XIQ A;  2QFI A;  2B5J B;  1R43 A;  4CH7 A;  1M90 T;  2KVQ E;  4F26 A;  4KBI A;  3C16 B;  1FXR A;  2DNH A;  2ALZ A;  2F9J A;  5BR8 F;  1U4B A;  2HLU A;  1IKV A;  3CCM S;  4EZ6 A;  4YEA A;  4UOG A;  2RDD A;  3HF5 A;  2GX8 A;  1NB7 A;  2E7X A;  2KDO A;  1Y0H A;  3I5C A;  4UY8 5;  2BW2 A;  3KXD A;  3CMQ A;  4A8S A;  4DS4 A;  1QAY A;  2ZJR Q;  2VPX B;  3UDE A;  5LOQ A;  2CKW A;  2C28 A;  2CQG A;  1SKR A;  4R8U B;  3RR7 A;  4Q8E A;  4HLB A;  4NEY A;  3HVW A;  4LBI A;  1F5B A;  1KBR A;  3WBZ A;  1S0M A;  4EO8 A;  4F8R A;  2F9D A;  2DXD A;  1RHU B;  2BXJ A;  2EKY A;  1RT7 B;  1FKP B;  3GJR B;  1N5Y B;  2HEK A;  2MDA A;  1X0P A;  3ZTQ A;  2P5V A;  2IY5 B;  2GFF A;  5H9E K;  1G4C A;  5IS2 A;  1H2U X;  4DR7 J;  4UQG A;  1LWE A;  1GT8 A;  3PW0 A;  2QGF B;  3PTW A;  1IQT A;  1UL3 A;  4IDK B;  4NLX A;  4EI2 A;  2QX0 A;  2XHW A;  3RUB L;  2FJX A;  2LEC A;  3MTK A;  1A7G E;  2AV5 A;  2UUC J;  4USW A;  1N5T A;  2E5H A;  4PXB A;  5KFF A;  5ETM A;  5IFM A;  3TI0 A;  1VQY A;  2M7S A;  5J1E A;  3BR9 A;  1VHI A;  4B02 A;  4LIW A;  3IA0 A;  3ISZ A;  4CNZ A;  1U2F A;  2QA4 G;  2GAH C;  1ZA2 B;  2RS2 A;  2CQP A;  2I38 A;  1CSJ A;  1HMV A;  4PXC A;  5CQG A;  1NU4 A;  5CYQ B;  4ZVS B;  3HZG A;  3GPA A;  3OXL A;  4OHV A;  1VQ8 S;  1YJU A;  2DH8 A;  3RB4 A;  3EGV A;  3HHN B;  2EK6 A;  3LGH A;  2U2F A;  4X65 J;  2WW8 A;  1RTZ A;  2VG5 A;  1CPZ A;  1G7C B;  2BKN A;  1RWK B;  1LEO A;  4U8Y A;  3R7B B;  2CRL A;  2HND A;  1FES A;  3EE3 A;  3S8S A;  4EK2 A;  4DR5 J;  5KG6 A;  1CG2 A;  3QMQ A;  2D74 B;  2JVR A;  5JVH Q;  4JV5 F;  1NHU A;  3SCI E;  1CJV B;  2ATL A;  2LDI A;  3T19 A;  1RKI A;  3W62 A;  5GAE U;  1U48 A;  1XNR F;  1CJT B;  2HZC A;  1N52 B;  1TVR B;  2QEX S;  5KFH A;  1F3F A;  2AEM A;  1M1K T;  4LSN B;  1UZH A;  2CAJ A;  5ETT A;  4ZJQ A;  1AZS B;  3CWJ A;  2XSF A;  4LF6 J;  2DR8 A;  4EWT A;  4DXL A;  4ZP6 A;  5FLX Y;  2YBV A;  3I5B A;  1BE4 A;  5G0R A;  2UVV A;  4WFA Q;  1U0S A;  5C24 B;  3LP0 B;  3KLG A;  4Q0B B;  4HVZ A;  3UN3 A;  2VH7 A;  3R7N B;  4NE9 C;  1ELO A;  3OVS A;  1AT1 B;  3IAM 9;  3U1L A;  4L73 A;  2Y8W A;  3N6L A;  1QUV A;  1SH0 A;  1HAR A;  2YNG A;  2J8S A;  4TYB A;  1UET A;  1ZOT A;  1IKV B;  4ANE A;  1NJX A;  3SIP B;  1JLG A;  1S77 D;  1T9U A;  3CCE S;  3TW0 A;  5ADZ A;  4LRE A;  3AB2 B;  4NLV A;  4RPF A;  4IH6 A;  4X4T A;  5K20 B;  2FJV A;  1NM2 A;  2XWX A;  2I9S A;  2NXJ A;  5L39 A;  4DL2 A;  2MJU A;  4LRC A;  2HKE A;  4ETX A;  3GON A;  3ZO7 A;  5ETV A;  1MN9 A;  4J9S A;  3E8O A;  4ID5 A;  2VZ9 A;  5DQH A;  3TRG A;  3M05 A;  3KKF A;  3CDA A;  3J81 j;  1HNX J;  4YR2 A;  4PG5 A;  2JOQ A;  3JSY A;  2C3Y A;  3CDW A;  2M70 A;  3AY0 A;  3SFU A;  3I6P A;  1N4L A;  2IVM A;  2ZVS A;  4NLR A;  3QT7 A;  3PCO B;  4UZB A;  2EEY A;  3DRP A;  2MLX A;  4OYX A;  1LWE B;  2DGT A;  3MPW A;  1X60 A;  1ZYQ A;  3DHX A;  3U1M A;  4DV2 F;  2DR6 A;  4CDI A;  3Q22 A;  3F56 A;  3TX8 A;  3GII A;  2NYI A;  1E6V A;  4U7U D;  3QT6 A;  3IGV A;  5JVG Q;  2B6A A;  5L38 A;  1SPB P;  4ZVT B;  2F1F A;  4MKV A;  1S10 A;  2X3D A;  3CJ8 A;  4I6A A;  3GYN A;  3HMJ G;  3TZY A;  2A6O A;  5J1E B;  2F5G A;  4CTA A;  4RUH A;  3PM9 A;  4A8M P;  2YX4 A;  3R27 A;  1MML A;  3T5H A;  2G2Y A;  5DG7 A;  2Z2M A;  4HT5 A;  2HFS A;  3VZH A;  5B08 A;  1UVK A;  1PAE X;  1HMV B;  3DI6 A;  1ZH5 A;  4PWD A;  3ADA C;  4NLO A;  4HI1 A;  3ENQ A;  3VAK A;  4EFA C;  2VUG A;  1PYS B;  4ECY A;  2ZUG A;  3T9Z A;  2NYH A;  1FFS B;  1XMO F;  1LK5 A;  3NGU A;  2BJ3 A;  2NSB A;  3SBM A;  3CMA S;  2L08 A;  2VG5 B;  3NMR A;  2IAJ A;  5HQM A;  2AD9 A;  4F04 B;  3I9V 9;  3D54 A;  1LFW A;  4FS2 A;  2HND B;  4M5M A;  2P2C B;  4NI2 A;  4X66 J;  2QN6 B;  5KG7 A;  2K3K A;  4A4J A;  3JAM Y;  3PR4 A;  3P4U B;  3FRZ A;  2YKA A;  1W26 A;  1T3O A;  2Q1L A;  2P9C A;  1S72 S;  3CD0 A;  2K3I A;  2QE5 A;  3GV5 B;  2RIL A;  2C1E B;  5DDP C;  2HGN A;  4BWJ A;  4YB6 A;  2J7U A;  4QW8 A;  3O5T B;  2XYP B;  2HQD A;  4ECV A;  1GXT A;  1WOR A;  1GTE A;  2M52 A;  5F0W A;  3CCS S;  2V34 A;  2GAG C;  3H7H B;  2ILZ A;  2GW8 A;  4B3R F;  3RGI A;  1P6T A;  2RU9 A;  5G0R B;  4RW7 A;  2XMJ A;  3KLG B;  5E2Q A;  1GFW B;  2Q79 A;  4FF3 A;  3EPI A;  1MU2 A;  1W2I A;  2RF2 A;  4XDC A;  4FVC A;  2GA7 A;  3PNI A;  2XMM A;  4V19 X;  1N88 A;  4YHH F;  1RWW B;  5F8N A;  3DRY A;  1JLG B;  2O5D A;  5E5N A;  3RBX A;  2MYF A;  1RBA A;  1JLB A;  1NSP A;  3SYZ A;  3RB6 A;  3RW7 A;  3R5C A;  4DV4 F;  2W2O P;  3CME S;  1OJ4 A;  3DRX A;  2KRB A;  1UZD A;  3WX8 A;  2BA9 A;  4FXV A;  2C2R A;  1FFW B;  1FRK A;  1K73 T;  4QIG A;  4ID5 B;  2M2B A;  2WBR A;  2K7K A;  3THT A;  4WK1 A;  3WDO A;  3EGZ A;  4WP8 A;  3AJ1 A;  3MM7 A;  5I4M A;  2G0J A;  3R5G A;  4C0B A;  2F4V F;  1U45 A;  4KHP J;  1X9W A;  2DGO A;  4LF9 F;  2QFJ A;  3D67 A;  4LFA F;  2UUW A;  4U95 A;  4DLE A;  1TU0 B;  3A3O B;  2JVO A;  3DRP B;  1HBN A;  4O3O A;  4JV1 A;  4NXN J;  1TKD A;  5BYQ A;  2EFN A;  2KT3 A;  1E6V B;  4LRA A;  3VAJ A;  1VR6 A;  2XWY A;  2B6A B;  2BAB A;  2FLL A;  3W63 A;  1YHQ S;  5DM7 Q;  3KNG A;  1NK8 A;  4P73 A;  2VU5 A;  3NOG A;  4ZCI A;  1MWQ A;  3TJA A;  3PYG A;  2QMX A;  3MR3 A;  1K8A T;  4LF7 F;  3JQK A;  4CTA B;  4FPR A;  1L3T A;  4CLY A;  5FLX U;  2AYG A;  4ZPB A;  1YG0 A;  4OZN A;  1VYA A;  2HS4 A;  3EPG A;  4L75 A;  3OFH A;  1T02 A;  2JL9 A;  3UCZ P;  4LUB A;  3DDK A;  3DI6 B;  4PWD B;  1BQM A;  4I6W A;  3NAI A;  4DV0 F;  4HHJ A;  1F3V A;  5KFN A;  4WKY A;  5J2N A;  5DRK A;  3L9Z A;  1OO0 B;  3PYF A;  2DGQ A;  4XAK A;  3AJD A;  2IAJ B;  3VZI A;  1EKR A;  3T5K A;  1MMD A;  3DMJ A;  5L1J A;  3MPU B;  2B4U A;  2N4D A;  3V6J A;  4NI2 B;  3KDO A;  4IUF A;  5D4P A;  2BBE A;  1NSQ A;  2LQJ A;  1VK8 A;  3MFI A;  1GH8 A;  2WZ1 A;  1NSK L;  2H65 B;  4PPZ A;  4F7V A;  4CRJ A;  3C8Y A;  4H4K C;  3VGV A;  2ASD A;  4YB7 A;  3QAU A;  1UEU A;  1S6P A;  3L95 X;  4QZV B;  1QSY A;  2BVZ A;  2V69 A;  5E3Q A;  3PRB A;  3U02 A;  1RBO B;  3ZTR A;  4ES2 A;  3KG4 A;  2G9O A;  2WSC C;  1OIA A;  2J5A A;  4XTT A;  2ZBR A;  3CIZ A;  2R8K A;  2YWF A;  2Y0B B;  2DHX A;  4RW7 B;  4Q2L A;  2YPY A;  5A6P A;  4DUZ J;  3J7Y U;  3G82 A;  1NEE A;  4N47 A;  1MU2 B;  3CXC R;  2RF2 B;  2VPY B;  2IJF A;  2HYI B;  3G4S S;  2VA3 A;  4EYH B;  3ZTS A;  1T95 A;  3TR5 A;  2E1A A;  3RB0 A;  4QYZ J;  4JUZ A;  2DH7 A;  4P52 A;  2ZHO A;  1JLB B;  2QZ8 A;  3TZW A;  3LGN A;  2LP4 A;  2MQL A;  3HUL A;  3O1L A;  4YR0 A;  1BMQ B;  1RLC L;  3VAL A;  2DB1 A;  3BN4 A;  2R8H A;  2CJA A;  4Y34 A;  5ITH A;  3BZQ A;  1RT3 A;  4OYB A;  2ZH8 A;  3SZ2 A;  2I8E A;  6FDR A;  4C8O A;  3FDS A;  4C3M A;  3Q23 A;  2MZS A;  3R7S B;  2FLN A;  1DTT A;  3MM7 B;  3RR8 A;  2PN6 A;  1XR6 A;  3BSO A;  2JRS A;  3CJQ A;  4YS2 A;  1RYR A;  2YPZ A;  3N9U C;  3VV2 B;  5KFO A;  2BDP A;  3EUN A;  4ILM A;  2V2Z A;  3KK2 A;  4DUY J;  3MCN A;  3OW2 R;  4DWI A;  1HBN B;  3GFY A;  4USM A;  2MSS A;  3QSI A;  4DR3 J;  2M9K A;  2D41 A;  5HMZ A;  3K5N A;  4DL5 A;  1FE4 A;  4J9N A;  4USV A;  2HVE A;  4F50 A;  1M0S A;  4B9T A;  4J37 A;  3A4T A;  1MWY A;  2DGW A;  1FD8 A;  1X0F A;  3P5T L;  3WC2 A;  1OSD A;  4NA3 A;  2XLI A;  2UXB F;  4ZP8 A;  2F8E X;  1FTR A;  1IN0 A;  4LBH A;  2M8D B;  4WYL A;  1TFY A;  1HI1 A;  3QIP A;  4CM2 A;  1XR7 A;  2ROG A;  4U96 A;  4OZ0 A;  1N32 F;  5LMN F;  4GC6 A;  4DQS A;  1Q8K A;  1BQM B;  2F8M A;  1M1H A;  5J2N B;  2IJN A;  4TU8 A;  2V2V A;  1RXO B;  4NL5 A;  2RD5 C;  2IFX A;  2W4P A;  2DO0 A;  2GIQ A;  5CCL A;  4K4V A;  2HRU A;  3JYT A;  1NZA A;  2IC3 A;  4MYT A;  3DMJ B;  4ERD A;  4H4M A;  5KG3 A;  2WON A;  1N56 A;  2HZA A;  2DD8 S;  2W1B A;  4J9R A;  2LCW A;  1N6Q A;  4OI0 A;  4WIQ A;  4DSL A;  3J81 Y;  2ABY A;  1S6P B;  3OTB A;  2QYG A;  5ETO A;  2AJ1 A;  2VFU A;  3KK3 A;  1ZBT A;  5LJ3 Y;  3QWP A;  4B3R J;  4KR0 B;  1PG5 B;  4DU8 A;  4WWS A;  2QTW A;  1PC5 A;  1PSD A;  4NLQ A;  1LW0 A;  2QA1 A;  4DL4 A;  4YR3 A;  4ATN A;  3G82 B;  5IT9 U;  2JEJ A;  4P9S A;  5AE3 A;  1MN7 A;  2Z2Z A;  2EG1 A;  4WP9 A;  4WP3 A;  1F2G A;  4PAA A;  4JV2 A;  1PYT A;  5HP1 A;  3ZTO A;  2V50 A;  5CHC B;  1RHJ B;  3SQO P;  5KFG A;  4AL5 A;  1AXQ A;  2F63 A;  3W1Y C;  4FDF A;  4B9U A;  4EO6 A;  2FJA B;  1IBL J;  1I94 J;  2SXL A;  1PIE A;  4JI5 F;  2H9Z A;  1RT3 B;  3Q86 A;  2Z56 B;  2B4V A;  1VQ4 S;  2QLB B;  3CJR A;  5GAG I;  4K4U A;  1SC3 B;  4TLR A;  2D1C A;  5KFK A;  1HR0 J;  1DTT B;  2UU9 J;  1H0H B;  2D9P A;  1Q8L A;  1RT5 A;  3IBW A;  3J7A 1;  4X4O A;  2BQ3 A;  1DY3 A;  5GVQ A;  1NDK A;  3BF4 A;  2GIF A;  1M5V C;  4LR8 A;  2AEF A;  3UCU P;  2LQB A;  3R1H A;  3CF5 Q;  3KK2 B;  3CJT A;  4DV3 F;  2JH3 A;  1URR A;  2A2C A;  1LK7 A;  1B70 B;  1M5O C;  4EUV A;  3Q24 A;  1HW9 A;  3V6H A;  5KFB A;  3E51 A;  1L3K A;  4UQT A;  4DR4 J;  2CPZ A;  2DHH A;  4ED3 A;  2E5L F;  4TLQ A;  3UPF A;  2XNQ A;  2R2S A;  5HL7 Q;  1IJE B;  1SI9 A;  3UDC A;  1R0A A;  2Z30 B;  3FEZ A;  4EBE A;  2ZC4 A;  2AQ4 A;  5KFZ A;  5CYJ A;  3P49 B;  1K47 A;  5BXI A;  2Q6C A;  5THW A;  2JFD A;  1YRT A;  4O3S A;  3TAP A;  2XHC A;  3FCH A;  4LJM A;  5KFY A;  3M6U A;  3VVT A;  1NB2 A;  1YJR A;  3DHW C;  3FBB A;  2R8I A;  4P2F A;  2AYB A;  3QIP B;  3R97 A;  3IS9 A;  2PMW A;  4PZV A;  4DX8 H;  3UQS A;  3NY0 A;  2VC0 A;  4DL7 A;  3QT5 A;  4CLL A;  3M7V A;  1RU2 A;  1S6O A;  4H4O A;  3LP2 A;  2WB1 D;  1R6Y A;  2Q43 A;  4ES3 A;  4RU2 A;  3NGT A;  3MR5 A;  4IO9 Q;  3W5X A;  4Z37 A;  1S7H A;  2LEB A;  2RT3 A;  4LFB J;  2BUN A;  2J9C A;  2MY7 A;  4RUB A;  4B9S A;  1R8P A;  1DRZ A;  4CCH A;  1CLF A;  4NOH A;  3M8S A;  3JYT B;  3TEG A;  1D8Z A;  2KH9 A;  1ZZF A;  2IC3 B;  2DTJ A;  4H4M B;  2WON B;  3PW7 A;  4JI6 J;  2FZG B;  3AA8 A;  2VOD A;  1JB0 C;  4ZCL A;  3P6Y C;  5IWA F;  4G3I A;  2CG4 A;  5F8M A;  1HNZ J;  3PO4 A;  3LAM A;  1QUP A;  1T11 A;  3C6U A;  4IH7 A;  1RAC B;  1N6Q B;  4LFC F;  2W24 A;  5DQI A;  4RNH A;  1T7P A;  4WTY A;  2PO4 A;  2BQU A;  4RZR A;  4ZLP A;  4BHQ A;  4RL1 A;  7AT1 B;  1PO6 A;  1XR5 A;  2CQ0 A;  2PII A;  3QZ7 A;  2CPF A;  3K57 A;  2DNR A;  2OHD A;  2Z2L A;  3KK3 B;  2DNL A;  1X4D A;  2KTQ A;  1FVQ A;  4QQB A;  1V3S A;  1LW0 B;  4ZMM A;  2R2T A;  5L1K A;  4JI7 J;  4F0M A;  1N8R T;  4TQR A;  3OXF A;  2OIH A;  3GYG A;  3MOZ A;  2YQ1 A;  2XTJ P;  2MLZ A;  4ED5 A;  3M8P A;  2XZW A;  3FCV A;  1VRU A;  3MUV P;  5HP1 B;  3TUI C;  1YBA A;  2GMH A;  2K1R A;  5JXS A;  3POT A;  3B4D A;  5M2R A;  5GAD I;  4FVM A;  3ZZ0 A;  2LXF A;  3VCD A;  2B9W A;  2GVD A;  3CJ2 A;  1X4B A;  1K44 A;  3J7Z 5;  1VOM A;  1NO8 A;  4DV1 J;  4MYU A;  1HWK A;  2QLF B;  2W2Q P;  3ILO A;  3MFH A;  3QRR A;  4WJB A;  2G1D A;  1RTJ A;  3HHL C;  2UXD F;  3HP6 A;  5IQQ A;  4DMZ A;  1UJ6 A;  3PX0 A;  4D3H A;  4RBV A;  1RT5 B;  2DHA A;  3L09 A;  1SJR A;  4ZVE A;  4HT7 A;  3EM1 A;  5HQL A;  3UR3 C;  2GC8 A;  1UVI A;  3GJQ B;  1NPK A;  1X5T A;  1PAU B;  1U1Q A;  3O8W A;  1QJH A;  5H9E J;  3GTY X;  1C0T A;  2XS5 A;  1FNX H;  4F4K A;  1GMW A;  2J0S D;  2NCK L;  4LRB A;  3M2R A;  1S57 A;  1GMW D;  2VIC A;  1R3N A;  3RYL A;  4Y2M A;  4P72 A;  4QU7 A;  4ZP9 A;  1WNE A;  1PJ7 A;  2MQM A;  3NKY A;  4TU7 A;  2E1P A;  1RAH B;  1PGZ A;  4IR9 A;  2YKQ A;  2UVU A;  2W7A A;  2AZ1 A;  2OML A;  4OL8 A;  1VQ9 S;  1R0A B;  2VA2 A;  2HBR B;  3RAX A;  1D9D A;  3PYD A;  1WC3 A;  1N5S A;  1Q7Y T;  4UOC A;  3KUE A;  5D4N A;  2XMW A;  3ZC4 A;  2XZT B;  3OLA A;  1HD1 A;  2W25 A;  3DXB A;  2HHU A;  2JDJ A;  3IS9 B;  3TUJ C;  1BQX A;  2WVC A;  3NCR A;  4LRD A;  4H4O B;  3LP2 B;  1QTN B;  5HJY A;  4K4X A;  2RS8 A;  2AZ3 A;  3VWS A;  4K5S A;  1QAI A;  3QAE A;  4DF8 A;  3DGV A;  4WFZ A;  5LJ5 Y;  1VHF A;  4QJV A;  1VRT A;  2I2Y A;  3TNV A;  4FNH A;  2CQH A;  4ZOS A;  2DNO A;  2WBM A;  3EZO A;  1GTH A;  4K5R A;  2IM1 A;  3TJ8 A;  1SQG A;  4KHM A;  2UXC J;  3QBC A;  1JNZ B;  3ZNJ 1;  1FHT A;  2ZUA A;  3CB4 A;  1UCN A;  2RHS B;  3C6U B;  5GAH I;  3OL8 A;  1WKL A;  4E2F B;  2YWW A;  3T1Y J;  4ECW A;  3HJV A;  5F8L A;  4WFB Q;  1FDD A;  1WEY A;  4B9V A;  2HBQ B;  2C2N A;  4QOT A;  1IM6 A;  2E7V A;  2VHG A;  4ZPC A;  2YNH A;  1FE0 A;  1MG7 A;  4JB8 B;  1H72 C;  5B0B A;  3DN9 A;  2P8I A;  4NA1 A;  1N54 B;  3PFE A;  8AT1 B;  3FFI A;  1ZPV A;  2FHJ A;  1IBC B;  2ZOG A;  1VQL S;  4OYP A;  2FHJ D;  5E3A A;  3AQO A;  4DR6 F;  3KJF B;  1SC6 A;  3OT9 A;  3NXZ A;  4JYA F;  5I42 A;  3HXM A;  1HQE A;  4GC7 A;  3OXG A;  1QSS A;  2ZKT A;  1GEH A;  2C2O B;  2GO8 A;  2X1G A;  5KT6 A;  5GMD A;  3CT9 A;  2XMU A;  4K0K J;  3M8P B;  1U24 A;  1VRU B;  1R7I A;  5KOW A;  4K7Q A;  1UPM B;  3MD3 A;  1RAJ A;  2K1R B;  1FRI A;  4ETZ A;  3M8W A;  1UA0 A;  3POT B;  2PSZ A;  4JI8 F;  3IWN C;  2E29 A;  2J7K A;  1U25 A;  1RWU A;  3VGS A;  1S9E A;  2GVD B;  4CI0 B;  1JNR B;  1WC4 A;  3UN2 A;  1IJF B;  3S7R A;  4I64 A;  4Z7C A;  3JQM A;  1RAE B;  2B7B B;  3LAK A;  3C15 A;  2EC2 A;  1VLY A;  2CQ3 A;  1RTJ B;  1A9N B;  4A8X A;  2FVR A;  2U1A A;  1I51 B;  5KTQ A;  4JV0 A;  3TZZ A;  4O0N A;  1WKJ A;  2YKO A;  3MR7 A;  1CQN A;  5L9X A;  5LL6 d;  5D77 A;  3X1L B;  4RW6 A;  2GHP A;  4M1K A;  2AGP A;  3MEE A;  3EXC X;  4OV6 A;  3OSN A;  2POK A;  2KJW A;  5SUH A;  4GKJ F;  4IG0 A;  1C0T B;  2XMT A;  2HK3 A;  5KT5 A;  1B7F A;  2KM8 C;  4ED8 A;  3ZTP A;  2AP6 A;  3M2R B;  2ZBQ A;  3QPI A;  1T03 A;  2QMW A;  4DV6 J;  4TY9 A;  1K0T A;  4AXI A;  4B08 A;  3HD1 A;  4YDD B;  2EFO A;  1YBT A;  3M8Y A;  1EIY B;  5HSP A;  3NS5 A;  1OS5 A;  2EPI A;  4NZ0 A;  3X3U A;  3TJ9 A;  1OY9 A;  4PQU A;  5D3G A;  4MKB A;  4X4S A;  1X5S A;  3A8I A;  2H5J B;  5IC4 B;  1RP5 A;  1IBK J;  3SDE A;  3NLC A;  1F5A A;  2NZ4 A;  3DCA A;  4DQQ A;  3KOA A;  1OYD A;  4DEZ A;  3T1H F;  2XY7 A;  3OL9 A;  4O3Q A;  3UD4 P;  3IGN A;  2VAS A;  4KFB A;  4FPI A;  5U47 A;  1AUS L;  3ONQ A;  3DU6 A;  5E7O B;  1HPZ A;  1V5I B;  5EDW A;  1T0T V;  1VRT B;  3TAQ A;  2N3L A;  2NXC A;  1IKX A;  4RJV A;  3GJT B;  4TYA A;  4RNF A;  1B7Y B;  3K5L A;  6FD1 A;  4F0H A;  3GLJ A;  1S49 A;  1ZA1 B;  4M5K A;  4UZC A;  1SJ1 A;  3KLH B;  2J0X A;  4P7T A;  3GFH A;  3K2Y A;  3TYT A;  2DXE A;  1Z4U A;  4G1I A;  4J91 A;  3OR2 A;  4QWD A;  1Q8I A;  2B4P A;  4ANC A;  3CC2 S;  3C2P A;  5K8O A;  2PT0 A;  3TOQ A;  3EGW B;  3E2E A;  3I9Z A;  2XY5 A;  3TEH B;  1XWL A;  2CJY B;  5DZ6 A;  2YNH B;  2DPI A;  4QR2 A;  4YB5 A;  3OVB A;  4ITS A;  1S1T A;  3MCS A;  4IRC A;  4ZVP B;  2GJI A;  3FFI B;  1UWA A;  2EXU A;  4QCL A;  3ET6 A;  2HWH A;  3MPD A;  3IWL A;  2YWH A;  4NLY A;  1WF2 A;  2B8Q A;  3K0J A;  4DFM A;  4AUK A;  1N0U A;  5E0O A;  1YJW S;  2VBY A;  1WDT A;  2FVC A;  5I42 B;  1HQE B;  5F8H A;  3W9I A;  3R1L A;  2KN4 A;  3UNY A;  4N76 A;  4C2M A;  3QFH A;  3MMB A;  1FEE A;  5F41 A;  2UUA J;  3T6B A;  1KKH A;  4MTP A;  3LAL A;  3OUY A;  2W8L A;  1LWC A;  4JI4 F;  3HZE A;  3G6Y A;  3NCQ A;  2DIS A;  1S9E B;  1KLM A;  3OLB A;  4DR2 F;  4NYP A;  4RW8 A;  2CJQ A;  5CYM A;  2J0Q D;  4WII A;  1H98 A;  1D8Y A;  3Q8V A;  1N34 F;  3C15 B;  1X4G A;  3OJU A;  5K14 A;  3RBZ A;  2UXD J;  1YRX A;  2FLP A;  5KG1 A;  4Z2X A;  3LOU A;  4UOF A;  1G3O A;  5CXT A;  4AT1 B;  3P45 B;  4LF1 A;  4W4M A;  2ZD1 A;  1RQ0 A;  2PI4 A;  2V8G A;  3BB5 A;  3IRX A;  1N36 F;  4HR2 A;  4DR1 J;  2EFQ A;  3KMS A;  1RA6 A;  3KJN B;  3R5D A;  2OKQ A;  4OZ5 A;  4IOC Q;  1WF0 A;  4RW6 B;  3BBC A;  3MEE B;  4BC7 A;  5A2Q U;  4PXE A;  3PIO Q;  4AYB D;  4B3M F;  4DCP B;  2HUR A;  4IG0 B;  5LMU J;  3M2U A;  4C8Z A;  5KFT A;  2CNN B;  3RU0 A;  1CS4 A;  3QZ8 A;  4DL3 A;  1T03 B;  4QWE A;  5LT5 A;  4ED6 A;  1WF1 A;  2AIR B;  1NLK L;  4DV5 J;  3CSK A;  4A8O A;  3UFC X;  4LVN P;  3K58 A;  1NAQ A;  3D68 A;  4QYZ K;  4Q2M A;  3D4J A;  3DLL Q;  1GMV A;  4PQU B;  4NCA A;  5D3G B;  1TFW A;  2QL7 B;  1NJW A;  1HHS A;  2MEW A;  3EWG A;  3MR2 A;  1RIS A;  3SDE B;  2DNN A;  4O44 A;  2ZFH A;  1FX4 A;  2G0I A;  5KG2 A;  3OTO F;  3T6J A;  1B0V A;  2UVR A;  1D9A A;  4KFB B;  3OJS A;  5DDR C;  3HFZ B;  1HPZ B;  2XGQ A;  2MZQ A;  3MED A;  2MGZ A;  1IKX B;  4OX6 A;  1TTH B;  1UW9 A;  1H6K X;  1QD1 A;  4ED4 A;  2CPI A;  1JLE A;  3IMQ J;  1ZTT A;  3CJS A;  1EX8 A;  3P5B P;  2OPP A;  3CJ3 A;  2GGP A;  4JI2 F;  3DOK A;  2KG1 A;  4P10 A;  3MCO A;  3EYZ A;  2GHW A;  2RB7 A;  4OZ1 A;  2L9W A;  1YJV A;  4NRT A;  3UWT A;  4I56 A;  3I32 A;  4CIO A;  3WX4 A;  5KFU A;  4EEY A;  3BRE A;  2ILY A;  3OR2 B;  2Y8Y A;  3NS6 A;  2MQN A;  3JTP A;  2C2E A;  1N33 F;  1VGY A;  3K8V A;  2RE1 A;  4O3P A;  1UAW A;  2H48 B;  4R5P A;  1I5O B;  5AXM A;  4QR1 A;  4Q8F A;  1KQK A;  1S1T B;  1SV5 A;  2Y1R I;  3DXS X;  3UO0 A;  3PW4 A;  1N5V A;  4P75 A;  3NS7 B;  1SL0 A;  1V3R A;  3ET6 B;  2HHQ A;  3C46 A;  4ILL A;  2HAF A;  2G13 A;  2V8V A;  3E3X A;  3CJ4 A;  2GJ2 A;  5KFE A;  2GQ2 A;  1LKZ A;  4MFB A;  3M4X A;  3TVK A;  1UJ4 A;  4DCO B;  5KFL A;  1EB0 A;  1CVJ A;  2G1H A;  3G96 A;  3NMA A;  1FXD A;  1IQZ A;  2B9E A;  3MMB B;  1DTQ A;  4LIR A;  1VQS A;  2RRA A;  2V4J A;  4CLU A;  3FJ2 A;  3OUY B;  1LWC B;  3BV8 A;  1IM4 A;  2QA2 A;  2R7Q A;  1RHQ B;  1I1G A;  1XJW B;  4JI1 F;  3N5B A;  3UNG C;  4CO2 A;  1RHR B;  3F41 A;  3OR1 A;  1KLM B;  4URG A;  3HJF A;  4CO3 A;  3N5F A;  3GE9 A;  4B3T F;  2BQR A;  3W2W A;  1JXL A;  4RW8 B;  1WC5 A;  4CM0 A;  5CYM B;  2FVQ A;  4X62 F;  2VBW A;  3LP1 A;  2J8A A;  1WEZ A;  2BOA A;  2V94 A;  4Q44 A;  3KLF A;  5K14 B;  3IM8 A;  3PXG a;  3GR0 A;  3CC4 S;  4N41 A;  2ZD1 B;  3EZU A;  3IRX B;  1OMS A;  2HRT A;  3O6Q A;  3CJ5 A;  3NGR A;  4FF4 A;  4OX9 F;  3TQE A;  4I0W A;  4WXW A;  2W9A A;  3ETM A;  1UVL A;  1Y5I B;  4KHR A;  5B7W A;  3PW5 A;  1D0E A;  3M2U B;  2HFU A;  1T9X A;  4X64 F;  1HBM A;  5CAA A;  1CS4 B;  3SV3 A;  2NXN A;  2XNR A;  2J6U A;  4LF4 F;  1VIS A;  5HK4 A;  2ZH3 A;  4HL9 A;  4B9L A;  2G4B A;  3CTR A;  2VJV A;  3FVY A;  2CFX A;  5KFR A;  3SFG A;  2PA8 D;  2J9E A;  3DLE A;  2ZM6 F;  2O3D A;  4N8O A;  3VF0 B;  1J5O A;  3D28 A;  3I0S A;  1S6Q A;  2W4C A;  1C0U A;  4PEO A;  4JBC A;  1U2C A;  4A8F A;  1XQI A;  1UA1 A;  4P2M A;  4B3O A;  2HQG A;  4O44 B;  4LF5 F;  3C6T A;  4FYD A;  3ZZR A;  4F4Z A;  4MIW A;  2HIQ A;  1RU1 A;  1VQN S;  4U9R A;  1TMJ A;  5B0G A;  2V8H A;  1FJG F;  1JKH A;  4LSL A;  2GML A;  4OJ1 A;  4DOZ A;  1Q53 A;  4P2X A;  1IXK A;  3MED B;  1XN9 A;  3FK4 A;  3RB3 A;  1MLA A;  2MGZ B;  2BJE A;  4OZJ A;  2OPS A;  2ZH5 A;  3G71 S;  1FI4 A;  1AA1 B;  1JLE B;  1SL2 A;  3SQG A;  2VFR A;  2OPP B;  1FT8 A;  2LA4 A;  2GGP B;  4QWA A;  3HFV A;  2R7R A;  2JEF A;  3DOK B;  3OHB A;  1I3O B;  2ZIT A;  4FN5 A;  1FJE B;  2ZBP A;  4FYX B;  3P96 A;  1BWV A;  4XPC A;  1SJQ A;  2XC9 A;  4F3Q A;  1UFW A;  1PYO B;  1Z2Z A;  4J9M A;  4NCG A;  1OSC A;  3HLU A;  2VKZ G;  2IPO B;  4NML A;  4UT4 A;  4F4W A;  1P9Q C;  3WQP A;  4R5P B;  1B3T A;  1Y00 A;  1B64 A;  1Q81 T;  2AEJ A;  1BC6 A;  2RH3 A;  1SV5 B;  2ZH1 A;  2KFN A;  1JLF A;  2HHX A;  1KQS R;  1RYS A;  4TN2 A;  4K8R A;  3OFF A;  5JMN A;  1RDR A;  3PR5 B;  4X4P A;  3MTJ A;  1HLW A;  2FVP A;  4CYU A;  4AQY J;  2BMB A;  2CA9 A;  4MFB B;  5D4O A;  4ZDN A;  2BJD A;  1OYE A;  1ZET A;  2M88 A;  4K4W A;  3MXH P;  4QBU A;  4DPU A;  5HRO A;  1DTQ B;  4EBD A;  2UP1 A;  4XDD A;  2V4J B;  2HZV A;  2VL1 A;  1U6Z A;  3OD2 A;  4FBU A;  2HLT A;  1PBU A;  2YXL A;  2OI2 A;  4LF8 J;  4R0J A;  3OV7 A;  4F2S A;  4DLG A;  2RML A;  4Q45 A;  1R0B G;  1UEV A;  2OUG A;  3OR1 B;  1LV5 A;  1X5P A;  3IG1 A;  3KMQ A;  3D0G E;  3W2W B;  4DR2 J;  1JJC B;  2MZT A;  3SCK E;  2BJ9 A;  3LP1 B;  1PJ6 A;  3KLF B;  5KT7 A;  2ZWP A;  3CE8 A;  2VPW B;  3W2V A;  4BCA A;  4KC5 A;  3ICL A;  4N7T A;  2DNM A;  1GK8 A;  2XZD B;  3ZZT A;  2AX0 A;  2V63 A;  3I5A A;  3R3T A;  2CPY A;  3D6T B;  3H2U B;  2HWT A;  3M8Q A;  2QL5 B;  2WK4 A;  2GMJ A;  1Y7P A;  2A18 A;  2H3E B;  2RKI A;  2FYX A;  4X4Q A;  1W2B R;  4UOH A;  3BGR A;  2W9C A;  3M9N B;  3KTQ A;  4Y2C A;  1HBM B;  2DXF A;  3BH6 B;  2E9Z A;  1Q78 A;  3K5P A;  1TUG B;  1YJT A;  2GHV C;  1TUW A;  4HYK A;  1MSW D;  3GYX B;  3DLE B;  4ES1 A;  1Q0N A;  4ZKA A;  2QT7 A;  2MKI A;  3BQ0 A;  4IYQ A;  4CLW A;  1J5O B;  2OFH X;  1GXL A;  1NJY A;  4J9L A;  3I0S B;  1X4A A;  2HHH F;  3ZFV A;  1RCX B;  1S6Q B;  3I31 A;  4OYI A;  3OTE A;  2ZDP A;  4C11 A;  4JI3 F;  1C0U B;  2DPJ A;  5LXR A;  4OHY A;  2B51 A;  1MRO A;  4IR1 A;  1FVS A;  1EAR A;  2QMU B;  4JI0 F;  1VQ7 S;  1S76 D;  4A8K A;  4B3O B;  3MGJ A;  1SB6 A;  5FD1 A;  2JNJ A;  4CO4 A;  3C6T B;  1H74 A;  3MMA A;  1ZM3 A;  4C48 A;  2OGU A;  1C1B A;  2HMI A;  2Y3Y A;  2BYC A;  2E9R X;  1CC8 A;  4RO0 A;  3G6E S;  2B9X A;  3IBF B;  3RAM A;  3DDI A;  1FRM A;  1JKH B;  1WOS A;  4PG4 A;  4NYZ A;  2P6S A;  4S0M A;  2OPS B;  1TV6 A;  1X4F A;  3SQG B;  3G6V A;  3DC2 A;  3BSC A;  3GSI A;  1YQH A;  3LH2 S;  3NGK A;  2AF6 A;  1HL6 A;  3PO5 A;  2PFF B;  4DF4 A;  3MM8 A;  2RNE A;  2UUB J;  1BD6 A;  3NG8 A;  4NCG B;  1SQF A;  2XUL A;  1X9M A;  2DEJ A;  3J80 Y;  2CPX A;  4ILR A;  4NLT A;  5ETQ A;  5KFX A;  1KOH A;  1IBM F;  1VDH A;  1JLF B;  3PEH A;  3CC7 S;  3CCR S;  2RQ4 A;  3KG0 A;  5GAD U;  2R7V A;  1FA0 A;  1UP1 A;  1VK3 A;  1KQG B;  1AFJ A;  3NEK A;  3GJS B;  5CZV A;  4CLT A;  1S79 A;  4YY3 F;  5D0E A;  3KNA A;  1QVG R;  2E7W A;  2VQE J;  4CYU B;  2KYZ A;  5KT2 A;  4FYV B;  3MPY A;  4WU2 A;  4J9V A;  5K8N A;  1HWI A;  4DFK A;  1OPI A;  4LQ9 A;  3IP0 A;  5HRO B;  2D9O A;  2WB4 A;  5J1N A;  4ZHR A;  1BXN A;  1VQM S;  3BKU A;  5C7P A;  2ZVI A;  3AFG A;  5EHH A;  2I1R A;  5AT1 B;  4FF1 A;  4Y28 C;  3FZB A;  2YH1 A;  2MPU A;  5F3Z A;  3FZ2 A;  1TP7 A;  3K7R A;  3KJQ B;  3IG1 B;  1TUV A;  4XIU A;  2FY1 A;  3G8S A;  1S0O A;  2CDR B;  4G6V B;  2N82 B;  1F1B B;  4ELT A;  3R8Y A;  2YH0 A;  1YJ9 S;  1RTD A;  5KG4 A;  1Q86 T;  1YVF A;  2ZH9 A;  3D7S B;  2KG0 A;  1F9F A;  1XMQ J;  4QU6 A;  3FBF A;  3W2V B;  4K4T A;  1KOO A;  4TKT A;  1S12 A;  3PW2 A;  2CQC A;  4QR0 A;  1SVD A;  1K9M T;  4DPO A;  1RCO B;  3GMG A;  4Y0F A;  2BX6 A;  2NS1 B;  4CT8 A;  2DNK A;  1NKC A;  2W01 A;  1F6T A;  1S1W A;  2OO4 A;  5IM0 A;  1XEZ A;  3M8Q B;  3TVY A;  2CQ4 A;  3QGP A;  2RKI B;  2J9D E;  4WF9 Q;  5J2M A;  3BGR B;  2W9C B;  1KHW A;  4DPT A;  1WHV A;  1RWN B;  3G87 A;  3SSQ A;  4YQW A;  2VKR A;  2KFY A;  4O4G A;  1SIW B;  3UDL A;  4MAK A;  3H4B A;  1HNW F;  1JK9 B;  4OX8 A;  3EXY A;  5IQ6 A;  3IRW P;  2JEI A;  2E44 A;  3NL0 A;  1WOP A;  3BBF A;  4ZVQ B;  2R7S A;  1JJH A;  2DEI A;  2CWK A;  2OLW A;  2XB2 D;  4DPX A;  2KM8 B;  4C11 B;  2HK2 A;  3GIJ A;  1F5C A;  4E0D A;  4PRF A;  1MRO B;  1NND A;  2Q6B A;  3Q8U A;  1BY9 A;  3CCJ S;  2Z4P A;  3LTO A;  2E1R A;  3MMA B;  3M6X A;  1C1B B;  4TY8 A;  1LW2 A;  2HMI B;  2NXE A;  5D78 A;  3H4D A;  1RB0 A;  1XBW A;  3TA2 A;  3VAF A;  4J7C A;  4ZP7 A;  2CQB A;  4DV7 F;  4B17 A;  3CNQ P;  3ILJ A;  3KLV A;  3TQ1 A;  1J5E J;  2HHP A;  2RVJ A;  3M6W A;  1A0O B;  2EBE A;  3AAW B;  3WZ0 A;  4ZVR B;  2CQD A;  4OZL A;  3IWX A;  2MZ1 A;  2JLE A;  3GG1 A;  1TV6 B;  2B56 A;  4F02 A;  2V8D A;  2X7I A;  4J90 A;  1HNV A;  1HBO A;  4GKK J;  5IXU A;  2PA3 A;  1KFS A;  1LWX A;  4CLK A;  2ZZM A;  4DU7 A;  2FUG 9;  4IRK A;  2EW9 A;  3MM8 B;  1OY6 A;  4UUX A;  1W25 A;  1JLQ A;  4ZPA A;  5D0H A;  3C19 A;  3CUN A;  3ILL A;  2WVF A;  1DUR A;  4F25 A;  2IM3 A;  4UTG A;  2DO4 A;  3HCX A;  1ZZN A;  2LDY A;  5F9L A;  1TKT A;  3B78 A;  1B4S A;  3NCP A;  3G8Q A;  3CDB A;  4GO7 X;  4QPX A;  2GVZ A;  5F8I A;  3HT3 A;  5AXL A;  2ZOM A;  2XCA A;  4DCJ B;  2GV1 A;  4NLW A;  4OIX A;  3HHK A;  4KH1 B;  2AHO B;  3TUZ C;  3CO9 A;  2CIM A;  1LXJ A;  4B3S F;  2CNK B;  2IM0 A;  1J2V A;  2H54 B;  2GIR A;  3A8J A;  2C3U A;  4UY8 T;  4K4S A;  1XNQ J;  3PG9 A;  2OEL A;  4ZHR B;  1ZTW A;  4NZ7 A;  4DPY A;  3GV7 B;  1WHY A;  3GIM A;  4JOU A;  4NXM J;  1U1K A;  3FKB A;  4X4V A;  2J6S A;  3L7P A;  2XS7 A;  2WRM A;  2VJU A;  1X9S A;  3M30 A;  2MKK A;  1WTB A;  5MLC V;  1NDP A;  1RTD B;  3ZXW A;  2VQF J;  3CCW A;  1B0T A;  2YX1 A;  7FD1 A;  4M94 A;  4OFZ A;  3VAH A;  4M5H A;  4RWX A;  1KN6 A;  1T8E A;  2IJR A;  3MEC A;  4CLS A;  2RQK A;  2AT1 B;  1S9G A;  3OTC A;  1S1W B;  2DNP A;  4KY3 A;  1Q79 A;  3JTO A;  2H51 B;  4OYA A; 
#chains in the Genus database with same CATH homology
 1SC4 B;  3EDR B;  2Y0B B;  3RJM B;  2CNK B;  2Y1L B;  2XZD B;  4ZVR B;  3IBF B;  1RHK B;  2H5I B;  2H54 B;  2CJY B;  3NS7 B;  1RHM B;  3R5J B;  2QL5 B;  2H5J B;  5IC4 B;  3EDQ B;  1RWN B;  1RWX B;  1RHJ B;  2HBQ B;  1GFW B;  2C2K B;  2CNL B;  3P45 B;  2H4Y B;  3D6H B;  2HBR B;  2QL9 B;  2C2M B;  2DKO B;  4ZVP B;  4JB8 B;  4ZVS B;  1I51 B;  1RWP B;  2QLF B;  3KJN B;  1F9E B;  2XZT B;  2CJX B;  1RHU B;  4ZVQ B;  4DCO B;  3R7N B;  3GJR B;  1RWW B;  1RWM B;  1IBC B;  3KJQ B;  2FQQ B;  2P2C B;  4DCP B;  1I3O B;  1BMQ B;  3D6F B;  1SC1 B;  2XYH B;  1RE1 B;  2H65 B;  2QLB B;  1RWK B;  2CDR B;  3KJF B;  3R7B B;  3R6L B;  4ZVO B;  1QTN B;  2CNN B;  2HBY B;  5IC6 B;  1SC3 B;  3SIP B;  1PYO B;  1RHQ B;  3GJT B;  2H4W B;  2XYG B;  3P4U B;  3GJQ B;  2C2O B;  4ZVT B;  4ZVU B;  2HBZ B;  4LSZ B;  1PAU B;  1RHR B;  5K20 B;  3D6M B;  4DCJ B;  2CNO B;  3IBC B;  3R7S B;  2C1E B;  1NME B;  1QDU B;  2C2Z B;  2QLJ B;  1RWO B;  2H51 B;  3QNW B;  3R6G B;  1RWV B;  2H48 B;  2QL7 B;  1ICE B;  2XYP B;  3GJS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...