2Y1LB

Caspase-8 in complex with darpin-8.4
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
YIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/inhibitor
molecule keywords CASPASE-8
publication title Caspase-8 in Complex with Darpin-8.4
rcsb
source organism Homo sapiens
total genus 20
structure length 87
sequence length 87
chains with identical sequence D
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2010-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2y1lB00
2CNLB 4ZVQB 2HBZB 2QL9B 1F9EB 1RWVB 3P4UB 5IC4B 3R7SB 3EDQB 2H51B 2H4YB 2CJYB 2H5JB 3GJQB 3IBCB 3R5JB 3KJFB 1I51B 2H54B 1PAUB 1RHRB 4ZVTB 2HBQB 2QLJB 4ZVRB 1RWPB 3R6LB 1RWXB 3P45B 1RWNB 2P2CB 2H65B 4ZVPB 1RE1B 2C2MB 4ZVOB 1ICEB 2XYGB 2XYPB 4DCOB 1BMQB 2CNKB 2H4WB 3KJNB 2H5IB 2HBRB 1QDUB 1SC1B 1RWKB 2Y1LB 3GJRB 3QNWB 3IBFB 4LSZB 1NMEB 5K20B 3R7NB 3GJSB 3RJMB 1SC4B 1GFWB 1IBCB 2CNNB 2H48B 2Y0BB 3GJTB 2C2OB 1I3OB 1RHJB 3NS7B 1PYOB 1SC3B 2CNOB 3EDRB 1RWWB 4JB8B 1RHUB 3R7BB 1QTNB 1RWMB 3KJQB 2CJXB 2QL7B 2QLBB 3D6MB 3D6FB 1RHQB 4ZVUB 1RHKB 3SIPB 4DCPB 2XZDB 3R6GB 2C2ZB 3D6HB 2CDRB 4DCJB 2QL5B 5IC6B 2FQQB 2QLFB 2DKOB 2C2KB 2XYHB 2HBYB 2XZTB 2C1EB 1RHMB 1RWOB 4ZVSB
chains in the Genus database with same CATH superfamily
3GR1A 2UU9J 1UTAA 3BO2A 3J80U 2VBYA 1MU2B 4L75A 3RBZA 2GVZB 2GCFA 3R6LB 4EBEA 1TKDA 4PYDA 2XO6A 4IKAA 1S10A 1V9OA 3M6UA 4X2BA 1VIOA 2ALYB 3EPGA 3MEGA 2V50A 1Y10A 3KJNB 2HVZA 3JAMY 4F0MA 4A8QA 4NLTA 1VK3A 1SKWA 4DFMA 3LUYA 4DR4J 4LIWA 2MY7A 2VG6B 4PR6A 1VBXA 3FFIB 1VRUA 2VFRA 4DUZF 1MNEA 3MPWA 3EPIA 2YNFA 3NWRA 3FRYA 3M8ZA 2UUWA 1JLFB 4LBPA 3CCLS 3ICLA 3PXGa 5CCMA 4LBIA 2XMWA 2LA4A 3H25A 3AFGA 3R6GB 3HHNB 4M5HA 2MHNA 3D3CJ 1N5VA 3FNNA 1UW9A 2VPWB 1FE0A 4F36A 2N7YA 5KT2A 5DDQC 2YKAA 4KT0C 1UA0A 2QJ3A 5C5JA 1FERA 2M0GB 5J1PA 1ZAXA 3JSBA 4CH0S 3VR1A 4FYYB 2V4JA 1U2RA 5I4MA 3GIMA 1NCLA 1C0TA 3PW4A 1FE4A 2VG7B 1UVIA 4FNIA 2KVQE 3PIOQ 8ATCB 2CPEA 1R7IA 4EFAC 1ICEB 3NGUA 3EVMA 4I4BA 1U8WA 2Q66A 5KG3A 3RRGA 4OHYA 2LDIA 1GMWD 2AEJA 3GG0A 5GAHU 3IS9B 4UQGA 4QU6A 3CMAS 2E7WA 4U8VA 3ISNC 1RXOB 3MD1A 3OR2B 4LMZA 2ZH7A 2CWXA 3MR6A 5HO4A 3LA0A 1SQGA 3L95X 2H9ZA 1WUUA 4B3SF 3TZZA 2GMJA 1G1XA 3UN5A 2C3YA 4JV1A 3N01A 5HBMA 2I2YA 2DNPA 9ATCB 2QL9B 2HEKA 3JYTA 1ZOTA 5AJ3J 3FCVA 4ZS6A 4GC7A 1S9FA 1NXIA 2E5HA 5B0CA 4I7FB 3MPDA 3N9UC 4CP5A 2DH9A 2F1FA 4YR3A 2G0JA 1FRJA 1F3FA 1LFWA 5L9NA 2E5IA 4DQQA 2B9YA 5GADI 3IA0A 1W7WA 3AA8A 4KO0A 3I31A 2MQOA 1CJVB 3M6XA 3LGHA 2ZC3A 4CDIA 5C2CA 3MCSA 4WU3A 1SJFA 2PMHA 2XHCA 2BA9A 4P74A 2DR7A 2EK6A 1MW7A 3BO4A 1HBOB 2FLOA 5U47A 1ZZNA 3CDEA 4YN3B 4M5LA 1J5EJ 4MYUA 3O5TB 1UKUA 2ATLA 1NKBA 4BHQA 1HW8A 2YKNB 3VWSA 5EGYA 3P4UB 4X62J 1LOUA 3HKWA 1RT3A 4HDHA 3BEGB 4QIGA 4DX5A 4WFAQ 4MT1A 1WDDA 1S6OA 5CAAA 1LXNA 2GIQA 4DV1F 3OXFA 4JI4J 2R7QA 4YHHF 3K17A 4WCEQ 3AODA 2FHMA 1S9GB 5DRKA 4RW4B 2GGPA 5HMYA 2IDLA 1JJ4A 2ZKUA 2K7KA 3NAIA 1NMEB 1YTYA 2UXBF 4QWEA 3MOZA 1FK9A 4B02A 2LYVA 4FXVA 3M8RA 3L4BC 2P9GA 2OPRB 1DLOA 4QR0A 1FO1A 1OY8A 2BDPA 5DGBA 1ZH5A 3T5HA 4EI2A 4QZVB 3OFEA 2X7IA 4RNMA 5IV4A 2F7VA 1GAOA 1PYSB 4UF4A 3RAMA 4RPFA 2YNIA 2IM0A 3D1QA 3P96A 3UR3C 3L7OA 3T1YF 3LP0B 3IWNC 2GS8A 3OJUA 4PUOB 2QG9B 5EX3A 4ECRA 1L3TA 1QAIA 2RHQB 1HNIB 2DEIA 3X3UA 1KQGB 2IJFA 1HNXJ 2M5YA 2DT9A 5LJ5Y 2DR5A 5IQ6A 4K2JA 1IKVB 4K5RA 3QPIA 4B9TA 4TYBA 3HZEA 2ZBRA 4OL8A 2HHUA 2W2OP 4DQPA 2AWZA 2BRLA 3DOMA 1D09B 1VOMA 2V8GA 3PYGA 2DR8A 5GAHI 2Q43A 3EGNA 5F9LA 4P73A 3F56A 2M9KA 2DNLA 4RW7A 4Q5VA 1N88A 2QEXS 4B9MA 1FXRA 1BQMB 3MECB 1MWQA 2KT2A 3U02A 4Y6IA 2F8MA 5IC6B 4CLFA 2QYGA 4MTPA 3NGSA 3RG6A 2HQDA 2DNMA 5J2MB 3UO0A 4M8LA 3M2UA 1M90T 3B82A 4C3KA 1M5HA 5F3ZA 2KRRA 1BQNB 2F3JA 3ILLA 2HWTA 2CA9A 1KVKA 4NXMJ 4URGA 4JI7J 5G0RA 3ZTQA 3I9V9 4JI0F 2X1FA 3CB4A 1S1TB 1XR6A 1KBRA 4MK7A 2X1BA 3SFGA 2E7XA 2QSFA 2LCWA 3NNCA 4Q2MA 4LF1A 5HVFA 2CNOB 4C3MA 1Q5YA 4DPTA 2MB0B 1R8BA 1D8ZA 3OTBA 4LF5J 4ILMA 1JLBA 4C98A 3C15B 2ZH2A 4XDCA 4KBIA 1Q7YT 4ZCMA 2N3LA 4IQMA 4JI5F 4M5GA 2YKPA 2B4PA 3IGVA 3E2EA 2RUGA 2POKA 1LKZA 1MLAA 3CUNA 1U47A 2W2PP 1UJ5A 3KNAA 4F04B 4USUA 1KWMA 5B08A 5ETLA 1FWKA 3OXLA 5THWA 4O4RA 3ZZ0A 4DPWA 4WTOB 4YY3F 4JI2J 4CH1A 1FKPB 1HNZF 2DXDA 2BKOA 4WXOA 3F0NA 4JI8F 4CO0A 2CYYA 3K89A 4X66F 4Y00A 4LRCA 4DLGA 4DSIA 2RDDA 3QIDA 3B54A 5IWAJ 2KT5A 3AA9A 4KJIA 2W9BA 2DYAA 4WXWA 1BY9A 4DV0J 1FRMA 3AXMA 1SIZA 3LGMA 4C0HA 4JB8B 1JQGA 1FT8A 1Q78A 3KJQB 1NB7A 4RWWA 1AYEA 5GAEI 2GAHC 2WTFA 3OJSA 1Y0HA 1KHWA 1Q0NA 3W62A 2E5GA 4DCPB 4CT9A 1YJTA 5GAGU 3TARA 5JVHQ 2YBVA 2J0XA 2OAUA 2VB6A 1SJQA 2RF2A 1NEEA 3BKUA 1TK8A 2LFVA 4O3QA 2YXLA 5EN1A 1JLAA 3M8QA 2CRLA 2W9CB 4OYMA 1X5TA 4L3KA 2KM8C 3QLHB 2NSCA 2DY9A 5A6WA 1H2TZ 1Q7LB 5KFPA 1W2BR 1N56A 3G6VA 4DLEA 2MEWA 2YWFA 4IDKB 1QTMA 1TAUA 2WONB 1FHTA 4E8UA 3CO0P 1FRIA 5M2PA 2ASDA 1WTFA 4RW9A 2YKMB 4RKUC 2XO7A 4Y2KA 3I56S 3B8HA 3HK2A 1AUSL 4RW8B 1RHJB 4GVLA 2DPJA 1PYOB 3MMCB 4LRAA 3EDRB 3POTA 1I94J 2IM1A 1U1MA 4NA3A 4V1Ak 1S79A 3MMJA 4LSNA 3K8VA 3AHPA 3KLHA 4DL0C 4A47A 4IH5A 2YNHB 3OVBA 2IJRA 1JLEA 4I2QA 5BYRA 4ILLA 3E01A 3ZFVA 3HO1A 5ETRA 2B43A 2P9EA 4CO5A 2DRBA 1ZS6A 3BSOA 2KVIA 1TELA 2HHHJ 1IUJA 5A6PA 4ZP8A 2OGUA 2OTLS 3OR1B 4LSLB 1S0VA 1U48A 3ZTRA 3P6YC 3R5AA 2NXUA 2J6TA 3SSQA 4F0HA 4HYKA 4DOZA 1UJ6A 5KFLA 2R9LA 5HLFA 2ZHBA 1LW0A 2IMWP 3FBCA 4WP8A 3GCXP 1KD1T 2XMAA 2XLJA 1UWBB 2RIJA 1VJWA 1CLFA 3M8PB 4QU7A 1ZAWA 3BGRB 2AP6A 3NRBA 3I4PA 1M1KT 1MN9A 4LF2A 5HMWA 4GKKJ 4ITSA 1Q81T 1HR0J 2E5LJ 1HWLA 1PAEX 3VAMA 2EFGA 1SV5A 2FHJA 4HR2A 4X4VA 3C14A 2QLFB 2ZUAA 3D0HE 4IFYA 3KG4A 2GVDB 4Y0FA 4KE5A 4N41A 4DR7F 3LH2S 4I2PB 3QFWA 1KTVA 1VMBA 4NCGA 4UZBA 4AL5A 3TA1A 2CQCA 1WSVA 2UUAJ 3W8GA 3IRXB 3LP1A 1VQYA 2R7TA 3PKYA 2XQCA 4WFXA 1AROP 3K57A 2UXCF 4JBCA 1P1LA 1NK8A 2DTJA 1ITPA 4Y2AA 2N82B 1FJEB 1VYAA 1BC6A 1APSA 1J5OA 2CXEA 1FTCA 1VC0A 2FZCB 3I0RA 3MMAB 2VJVA 4QYRA 2CQ3A 1FDDA 2VQFJ 2EEYA 2HNDB 3BREA 2DK2A 1I5OB 1QE1A 4F3MA 4B17A 1K1QA 5HVHA 1EQ0A 2FLPA 1JLQA 4KSEB 2V4RA 3EXYA 3HHLB 3H2VE 4JOUA 4NLGA 4B9SA 2V2QA 4DUYF 3H5XA 4NPOA 4JI1J 3OUYA 3CCJS 2YY3A 3CWJA 2B7CB 3I96A 3N0VA 1OY9A 4FF3A 1HPZA 1WHVA 1RT4B 3AJ2A 1TR0A 4ZVPB 4HHJA 3CDUA 1Y3JA 2BW2A 2CVIA 1SH0A 2RQKA 2B3TB 3IAS9 2FJDB 1NNDA 5B0GA 1SPBP 4EO6A 2UUCF 1RQ0A 4B08A 3CIZA 3RYLA 3W9HA 3OSNA 2GAGC 3CCRS 6FD1A 2AIRB 2BRKA 5CA5A 1SUQB 1I3OB 3D4JA 3GYXB 1P9YA 2OHDA 2E66A 7AT1B 2AMCB 2Z8QA 2OPSA 4FYXB 4RUCA 2XULA 1BE4A 1H7WA 2ROPA 1U7LA 1HIYA 1F5BA 1Y7PA 4M5IA 1IBMJ 1U2CA 2O5DA 2VBZA 2HVDA 3O44A 1U49A 3GFXA 3DI6A 4I6WA 4LF8J 1SVDA 4FVMA 2XLIA 5AE2A 4DR5J 2C2RA 1RWVB 5A8KA 5D6GA 3BB5A 4AQYF 1D8YA 1RCXB 3HSZA 3Q83A 4LR7A 2GVZA 3VAKA 2F8HA 3E51A 1U45A 2YKQA 1P27B 3PFEA 3KG1A 1TL3B 5AJ3F 1XEZA 1PBAA 3QT6A 5KT6A 3MFHA 3QT7A 5CYQB 2EFPA 1WI6A 1IR2A 3ILJA 2HKEA 1T05A 7FD1A 2E1AA 4GMKA 5KG2A 3H5YA 1MMNA 1HI8A 3VAJA 1T9UA 3OTCA 2LEAA 1Y5IB 2A1BA 2XLKA 3FFIA 2EVZA 2SXLA 2KRBA 2W2MP 2M52A 4NLYA 1ZETA 3M9OB 3PW0A 1HYSB 3DYAA 3MM5B 5D0HA 2F5GA 2XMMA 4R0JA 1FI4A 1WC1A 1AZSA 4NXNJ 1QAXA 1ZZFA 1UPPA 2AX1A 4EGLA 3J7YU 1U02A 3BQ2A 2LECA 1IKWB 4RNNA 2DNNA 4ECWA 1IKYA 5HROB 4OI4A 5LMUJ 1HI0P 4KKOB 5KFNA 4C8ZA 4P2XA 3FEXB 2ALZA 1CS4B 2Y1RI 4BC7A 2OEKA 4J9SA 3DLLQ 1NO8A 4WBFA 3HHLD 3T6JA 3BGUA 4QQBA 1XMBA 2M4MA 3TJAA 4Y28C 1UFLA 4TY8A 3DDNA 4UUWA 4DX7A 5LL6d 1WI8A 3OL8A 4IOBA 4LREA 4J9VA 4IG0A 1S4FA 2JLEA 2LQJA 2OO4A 4MIBA 3PW7A 3F73A 3QIPA 2ROEA 2MQPA 2BKNA 1PCAA 2DIVA 2UXDF 5ETVA 1DTTA 1N5QA 2EG2A 4O44A 4ED0A 2VG5A 5DQIA 3KMSA 2YPZA 4AL7A 3BR8A 5E0OA 1OQ6A 2ZKTA 3C19A 2YWGA 1SKRA 4NOHA 2HHQA 4CNZA 2E29A 3NS6A 1VBYA 5A0YA 1NDKA 2FYXA 4D3HA 4A48A 4H4MA 4OYBA 2IVFB 3QT5A 4FF2A 1TKXA 3GMGA 4ZITA 2EC2A 1Q79A 4GO7X 5M2UA 5ITHA 1VK8A 1AXQA 3G6XA 2B56A 1NKCA 2D7SA 2VDHA 3IG1A 3QRQA 5L1KA 2XYGB 2J9EA 4IG3B 3M9MB 3OVAA 2FB0A 2ZWPA 1B4SA 1X4HA 3BPSP 3GIRA 4NZ6A 4P52A 5KFBA 3EYZA 4ATNA 3GJSB 1VHFA 1FJGJ 3KLIB 1EETB 3PO5A 4FKXA 2GV1A 2DO0A 1S97A 4CLLA 2P8IA 2V67A 1S1VA 1IBLJ 2LKZA 1XQIA 4DR1F 4QPTA 4ED2A 1YX2A 2DH8A 3TYTA 5KG0A 5C25B 4M5JA 1X4DA 5JVGQ 1T0TV 3NKYA 2FLLA 4ZVSB 2G2ZA 2MY8A 4TKTA 1KN6A 1N5YB 3AQPA 4MFBB 1YWXA 4IOAQ 2E1CA 2MPUA 3IXQA 5F3TA 4BC9A 1Y3KA 4OIXA 3MPYA 2ZZMA 3EZ5A 5J2NB 4USHA 1EQMA 2B9XA 3CJKA 3EMTA 2N3OA 4NXMF 2UVWA 2Z58B 4NMLA 2PMZD 1VQOS 1UETA 1YIJS 2OPRA 3HHKA 2HS4A 2KXHA 1DQ8A 2MYFA 4ICLB 1N32F 1FCAA 4DFJA 3DLEA 5K14B 2ZE2B 2B6AB 1KFSA 4ZN3A 1SQFA 2EXUA 5K5MA 4RNFA 4AXIA 3UN3A 4P6QA 4RLEA 4X4RA 3OL7A 3JSMB 4EBCA 1TUVA 1JMTA 5EX0A 1FDAA 2UVUA 1RT7B 4MKVA 1RWXB 1D9FA 3HD2A 2C2MB 4QW8A 2RDIA 2PIIA 1OPZA 2KYZA 4UY85 4JI2F 3G8SA 1CJKA 5BYSA 1WEYA 3N6LA 3TANA 4KGZB 1IKVA 4W4MA 1PO6A 3HFZB 5A8RB 2BUNA 3MXHP 5KG7A 3G8TA 4EZ6A 3VVUA 4DU7A 2MQ8A 3SCJE 3VQSA 1HNWF 3D9BA 1N6QB 3DHWC 4KGKA 4WTYA 2MGZB 3BYPA 2W8LA 1N48A 1BHNA 3H2LA 2BANB 2OFHX 2K1RB 4QIEA 2XY5A 1NJXA 1S0MA 2ZJQQ 3RZAA 3SXLA 3MUVP 5CYMA 1E6VB 1UEKA 3FRZA 3LPEA 2C3UA 3O6QA 2NPIA 3FEYB 2KFZA 3M32B 1DZ5A 4UY8T 2E7VA 3LAKA 1AFJA 3KHHA 5DG7A 1HMVA 2K2PA 3IWXA 2XCAA 4E2FB 4LR9A 3RTVA 4HKQA 3ISZA 5ETNA 1BQNA 5AT1B 3OHAA 5J2PB 3OTDA 2NXJA 1R8CA 5T7LB 3UD5A 1M1GA 4TQSA 4WJBA 4ZVFA 5JJBA 4ER8A 2MZJA 1GNKA 5I3PA 4TLQA 1W25A 4FS2A 1QSYA 3UVJB 4NZ0A 4OJ1A 4DV6J 4ZP6A 4DX8H 4WZMA 2OMLA 5JMNA 1XMQJ 2VA2A 4ES2A 1JB0C 1S9EA 1KKHA 5F8IA 5HN0A 4U96A 2CQPA 1HNVA 1FXLA 1OYDA 2P5VA 3ET6A 4FPIA 1GQEA 1I94F 1BUXA 3C6TA 1GTEA 4PWWA 2AGPA 1IR0A 3RAXA 1LWEB 3CDBA 4NRTA 2HFNA 2IAJA 2RQCA 5LOQA 1BQXA 2VKZG 5F8NA 2FD2A 3ZC4A 2VPYB 2OI2A 1ZTWA 2FIUA 4USWA 5L38A 1RT2B 1WG5A 2CWKA 4HACB 1RISA 1DHMA 2V68A 4N76A 2VF3A 2KT3A 3C6UB 5F8GA 2HHHF 5E3AA 1LWXA 5A8WA 1IBKF 2LQ5A 1DY3A 5CHCB 1RT5B 2CNNB 5SZTA 4O3NA 2XB2D 2EWHA 2B9WA 1IN0A 2AKWB 4KAIA 2PDAA 5C2GA 2D74B 1H7XA 3BDEA 1X4CA 4IYQA 3W66A 5C7PA 3B4DA 2DGUA 3NL0A 4ECQA 3DRPA 1IKXB 2BX6A 2HAIA 3ZZZA 3DHXA 3GU0A 1G4CA 1SQEA 2MTLA 3TUPA 2HVHA 2XI3A 2YWHA 3PHTA 1HR0F 1T8EA 2E5LF 1DURA 4GO5X 3FBEA 1RKIA 3EDQB 4M1KA 2QV6A 4O4GB 1PAUB 3I0SB 4KGXB 1R43A 3R2CJ 4NWBA 3QLHA 4H54A 4NX9A 1U6BA 4KH1B 2ACMA 3K58A 5HQLA 3OQ2A 2Z57B 3DLGA 3EXCX 4NA1A 5IT4A 4ED6A 3CCUS 1S0NA 1BD6A 5HANA 2G0IA 2YKMA 4CM0A 3DXBA 2HURA 1RB0A 2GFFA 3MMCA 4YDDB 1FF2A 1HLWA 1SC6A 1WELA 4Q8FA 4IH6A 3HULA 1XWLA 2V5HG 2EFNA 1MG7A 4ZVUB 3W9JA 2OMOA 2WOMB 2VQFF 1WHYA 4MIWA 1N34F 3F41A 4KFBB 2CDRB 2CQ1A 3HD1A 5E33A 4DCJB 1FEEA 2QL5B 2I5JB 5KT5A 2BE2B 3SFUA 2PI4A 3HLUA 3DOKB 1M5OC 1IQTA 2XS7A 5EWFA 3MTKA 2GC8A 2AJ0A 4X4OA 2HHVA 4OX6A 3BDPA 4ERDA 1U1OA 4MKBA 2OFGX 5DM6Q 4DPUA 2A6OA 2YQ1A 1RBOB 5LMNF 4NLUA 3S7RA 4JI1F 1FKOB 1T95A 3LP2B 3DGPB 1S1WB 2QX0A 3LANA 2C3MA 2LXIA 2Z2LA 3TJ9A 4K4SA 3TWZA 5I3UB 1U6FA 2ZNYA 2APOA 5KFYA 1R8AA 2NUHA 3FC9A 4DV4F 3DMJB 1DFDA 4PG6A 3QJLA 2VFSA 3PVXA 3AH6A 2YNGB 1R0AB 2OKQA 4X64F 2DHAA 1P6TA 5C24B 3AXKA 4Q0BB 3MEEA 3CCES 2G13A 1GH8A 4AXJA 2CQ0A 3V6DA 4OZLA 3T9ZA 4O3SA 4J9UE 5KT3A 5J2QB 4K4UA 3RW7A 2AD9A 2DNKA 3SQGB 4I2PA 1IBMF 2J9DE 1JKHA 5EHHA 3U1LA 4DQRA 5KFWA 4MK8A 5AXNA 2MLXA 3BQ0A 2F4VF 3GWCA 4O0NA 2C3OA 3GFYA 3W2VB 1M5SA 3CC7S 1TMJA 3BH7B 3R97A 3HVTA 3NY0A 2COLA 8RUCA 1R0BG 1TL1A 2Y1IA 2KI2A 3M8SA 2JEFA 1GFWB 1S12A 4CLKA 4RW6B 3PG9A 3MM8B 1EP4B 1U0SA 2EK1A 3LO3A 2E1PA 1T02A 4PWDA 3D6MB 4OYZA 1QLNA 1DAXA 2DR9A 1ZA1B 4B9LA 2XWXA 1O6XA 3H4DA 2UVRA 4URSA 2X1AA 3THPA 1X4FA 4WFZA 2J8AA 2HBYB 2AZ1A 1FNMA 1RP5A 1N5TA 1RT6A 4NXNF 1LWFA 2CJYB 4F4ZA 2UXBJ 2KG1A 3UNGC 1NU4A 1YITS 2FC8A 4OYWA 1FTRA 5KFRA 5C42B 4J9RA 1YI2S 3UDVA 3BSNA 4L73A 4HT7A 2XSJA 1GXUA 3NNHA 4TU8A 1WF1A 3HHLC 5LSOA 4ILRA 4DR6F 1SL1A 1S6UA 4JI3F 1YZ7A 3Q8PB 2H5EA 2YKOA 4ANCA 2JHEA 1IBCB 3CPWR 4DHVA 1SC3B 1JXLA 1NBEB 4K50A 3I82A 4ZA1A 4QWCA 3T1YJ 3IAM9 4FYWB 3NG8A 3OHBA 3KK3A 1EIYB 3JB9k 2C3PA 2ZH4A 3PYDA 4B3OB 3HPOA 4LFAJ 2FVRA 1OIAA 2M3DA 5KAKA 1JJCB 4BLGA 2R7OA 3HSGA 2ZVIA 3R7SB 1UL3A 4CCHA 4PWUA 5HVGA 2A2CA 4BWMA 4FN5A 2WAQD 2P9CA 1TUGB 5KG1A 4J90A 2BJ9A 2C28A 3UWTA 4H4KA 3J81U 5CYQA 2PFFB 5KG6A 4CLTA 3KNGA 2V69A 3MEDA 2BACA 2J6SA 4ZLNA 2MZQA 3Q0AA 4JV2A 4EMDA 4K8RA 4CH7A 5HMXA 1UPMB 2W01A 4UUXA 2Z2MA 3KG0A 2M70A 1VQLS 2QLXA 4O3PA 3KLFB 4N7TA 4DL2A 1KLMA 3UDEA 3AJDA 4DL5A 3K2YA 5ETKA 3BSAA 4WU2A 5KFIA 3KWMA 5FJ4A 4JV5J 3QMQA 4C8OA 1B3TA 4D3GA 4JI0J 1BGXT 2VBWA 2ZOGA 3K0JA 1IBLF 5LJ3Y 1KR4A 1RU2A 2MKKA 1Y5NB 2VQEJ 2PT0A 1A7GE 4L74A 4DQIA 1NSQA 3QGGA 4R25A 3M2RA 5IQQA 4N56A 1K0TA 4CO4A 4QPXA 1S1XB 2AQ4A 1F9HA 2GMLA 2FJXA 4P10A 1VLOA 3WDOA 3OPKA 3OVSA 3OTEA 1ZM9A 2V2VA 1NK0A 2NLWA 2IHR1 3M9NB 3HSJA 4JI5J 3VCDA 5KFTA 4WIIA 3HDSA 2E5JA 2LMIA 4I6YA 3CT9A 4F4YA 3MM7B 4OI6A 5IV3A 1J2VA 3C16B 1VLYA 2GJ2A 2CJAA 2XGPA 1VC6A 1TFWA 2NXNA 4AD6A 3HT0A 1KQFB 5F8JA 4OI2A 5T41A 2KHDA 3N4WA 4YY3J 1RWMB 1JLGB 1TL5A 5I42A 4TQRA 5JUMA 3KJVB 2AW0A 3M1VB 4F7VA 3FSXA 2KTQA 4JI8J 3QFHA 2B5JB 1S6PA 3L09A 4X66J 1CULB 1C0UB 3MAAB 3MPVA 3CSKA 2IDEA 2V2KA 4WIQA 5B09A 2L9DA 5J1EA 2ZC4A 1SH2A 2JC1A 3DU6A 2MKSA 3GJQB 1GX6A 1F5AA 2MQLA 4KR0B 3QO9B 4ZVRB 4C2MA 2Y8YA 3RRHA 2OPQA 2XYPB 1BMQB 2EKNA 1RTJA 3T6BA 1IVZA 2IRXA 3S8SA 3X1LB 1TVRB 4Y3CA 2XSFA 4DV3J 4ZHRA 5D77A 1DJ0A 3KLIA 3TX0A 1CPZA 3BO3A 4PQUB 1EETA 1T9YA 4HHHA 3GYNA 4M5NA 3CW2C 3MOJB 1QM9A 4ETXA 2OTJS 1HI1A 1VQ6S 1UVJA 1L3SA 2RSQA 3BS9A 4QYZJ 1N52B 3SIPB 1RBAA 3KYLA 1X9MA 1OO0B 2VFTA 4RZRA 2PGCA 3DOLB 4U9RA 4FNHA 5H9FK 3UCGA 4WP3A 3V4IB 1HKAA 4EEYA 4KGVB 3T5JA 1OMSA 2B4OA 4K4TA 4YOEA 1DBDA 3VHQA 2QE5A 4WYWA 5KFOA 2CJ9A 3MR7A 1WOSA 3VALA 2HQCA 1TKTA 3T5LA 1ROFA 4OMFG 4PYAA 2V4QA 2HPUA 3HJFA 3DXSX 5ETTA 3EGVA 4DZ6A 5CQGA 2NCKL 1C1CA 4B9VA 1UEUA 4M95A 1TV6B 2Z2YB 4I56A 4C97A 4CLYA 5IFMA 3I5BA 1KTQA 4Q45A 3GJTB 1VR6A 2NZCA 3NS7B 1H6KX 2DXFA 2HGLA 2VZ9A 1WC5A 5K8NA 3R9LA 1PC4A 4MMOA 4BS2A 4FP9A 3TAPA 2DD8S 2CPIA 3MAHA 2IBKA 4NYOA 4FS1A 4G1QB 3N79A 2G1HA 3VGVA 4J5OA 3ZNUA 5MLCV 2Q6BA 3FCWA 2DITA 3TVZA 5KG4A 2JEJA 3O3LA 2RDJA 2IRUA 2GO9A 1Q53A 2YWWA 3OD2A 3SDEA 3D0IE 2HVIA 6AT1B 1R6VA 1YJUA 5EUHA 3PYFA 2RKIB 2DGTA 2OH2A 3D28A 1VQ5S 3VTIA 3R5JB 4OX8A 3KJFB 1YJWS 3M7VA 4K2XA 1L3UA 5J1NA 1B0PA 1L5UA 2WSFC 4KGMA 4DWIA 2MKIA 3ITHA 5B0AA 2MJNA 2QLWA 2X51A 3CE8A 2G2OA 3TQEA 3W61A 2CPHA 1VRTB 4LRFA 4ID5A 1YRTA 1HL6A 1FD2A 2Y1LB 4OJ3A 1X7VA 4ZPAA 3LGNA 3KDNA 5F0UA 2FVQA 4DSLA 3MEGB 2CQGA 4DR7J 1XR7A 1GT8A 2ZH9A 4KIAA 4YB5A 3PM9A 5BR8J 1FX4A 4OHVA 2V9WA 3CIMA 1HWKA 1EZZB 2BANA 4WPAA 3I4HX 2K1RA 1KC8T 3CJTA 2GHVC 1WC6A 1GXLA 1VRUB 2KYXA 1RTHA 4ECXA 5HMZA 2YNFB 4UOCA 4MH8A 2UXCJ 4FF4A 3NEKA 1V3RA 4RBTA 2D3ZA 2BW7A 5FIIA 3Q8YA 3W1YC 4EUVA 1SXLA 1H0HB 2QFJA 1RHRB 1FRHA 2RT3A 2HW3A 5J2PA 2BZ2A 2CG8A 3G87A 4CM2A 4QIFA 3FCHA 3DN9A 5DZ7A 2GQCA 4IRKA 2WBRA 4ES3A 1Q4RA 1Y00A 3N5FA 2V4JB 1T03A 3EWGA 3UCZP 2XG8A 4J9NA 4J37A 4OFZA 4IRDA 4YMEA 3BZQA 5L8RC 4ZVEA 3THTA 1YBUA 4NLDA 4LQ3A 5E5NA 1DTQA 4XTTA 4DUYJ 2PFDA 2FPHX 3J80Y 2RS8A 2ZEJA 2XNRA 3D6FB 1NM2A 3D0GE 1RHKB 2RQ4A 1N4LA 3BGOP 1LXJA 4F02A 2ZDOA 3JTNA 2UUCJ 1LWEA 2HHXA 1Z2ZA 3OL9A 2BJDA 4R8UA 2LDYA 1FDBA 3DLBA 1JLCA 4WFNQ 1RT2A 2QLJB 2AGOA 4OHXA 5HBMB 3RU0A 1B0TA 3A8IA 1SI9A 2R2UA 3JYTB 2NSBA 3RR8A 4ZLJA 2JRSA 4J9KA 2A2DA 2NUUG 3K5PA 1F2GA 2C2NA 2F65A 4M5DA 2ABYA 3D67A 4RWXA 1K1SA 3IGNA 5DG8A 4AQYJ 2M88A 1R8HA 3PHEA 3M6VA 1LWCA 4M94A 1M5VC 4JYAJ 1VFJA 2CJXB 1WNEA 4KO0B 3TZYA 2ZD1B 4IRCA 5KFGA 1IKXA 2FY8A 3ZTPA 3DLKA 3AD9C 4YUDA 1Z1ZA 2HQIA 4UOHA 4RUHA 2E44A 2WVFA 1XR5A 4DMZA 4KY3A 2I9SA 2VIHA 3IBWA 3GCWP 3C66A 2PEBA 1O5JA 5FLXU 1UEVA 2HIQA 1ZM3A 3IC1A 5HJXA 2PN6A 3D1HA 1U0HA 5T14A 3UD4P 2CG4A 2WHOA 2MDAA 2R2RA 2E1MC 1X9SA 2XEXA 3CCMS 1RAAB 2MZ1A 4DX6A 3NGKA 4DV7F 3TI0A 1YJ7A 1RT1A 1OSDA 4DL3A 1RT3B 4ZPVR 3JQMA 4LUBA 4L6V3 2FUG9 4LFBF 1TQLA 3SMZA 4J9LA 4A8OA 3SI8A 2Z4PA 5K20B 2YX1A 4OYAA 1U1RA 3QRRA 3VQTA 1AW0A 2CAJA 2GGPB 3QBCA 7FDRA 5D3GA 4B3RJ 2HFVA 2FGCA 2WK4A 2ZOMA 1FFGB 1OPIA 4ED8A 2WOMA 1FK9B 3T3FA 4IR9A 1T3OA 3I6PA 2D41A 2HFSA 2ZNZA 1DLOB 2BE2A 4CI0B 4HI2A 2WW4A 4QR2A 3DOKA 3W5XA 5HK4A 3K5MA 1HBNA 3TO8A 4P7TA 2F40A 4F25A 1TZ0A 5KFXA 2QA2A 1VQ9S 4EWTA 3JTPA 2W1BA 1UZDA 4ED5A 5HJYA 2UXDJ 5B7WA 3ULHA 3DRYA 4K4XA 4NLPA 3M8YA 4QOTA 1EKRA 2ZH5A 2YNIB 2GJFA 4CLZA 1S1WA 2L9WA 3QGIA 3HP6A 1HWUA 3QYYA 2PEHA 2UUBJ 1NRKA 2HWHA 4OV1A 3H42A 2BQRA 2DHHA 1IR1A 1C2PA 3CCWA 1FNOA 2BJ8A 2A10A 4B3MF 3A12A 1YBAA 3DMJA 2HWIA 5A2QU 4MKAA 4R5PA 1HBMA 2I1RA 4URQU 2R7VA 2XZDB 2XNQA 3CGIA 3CJRA 4DUTA 2KXNB 1OSCA 1TL7A 2XYHB 4PPDA 5F9NA 5KFCA 3MR2A 3Q2SC 2WSEC 3R5BA 1CJUA 4RW7B 4LFAF 4QR1A 4Q44A 1RAOA 1Q5VA 5E41A 5ETPA 4LR8A 3D1OA 1PILA 5KTQA 2J7UA 1HQUA 4ECTA 2DB1A 1NK4A 2NQPA 3G82A 5B0BA 3TUZC 3BR9A 2PE8A 1PC5A 3DRSA 4U7CA 2XS5A 1RUSA 2CQ4A 3Q8VA 3M2UB 4ED3A 3MD3A 2QRRA 5EWEA 4DR1J 3I9ZA 1CJTA 1WHWA 4BDPA 5CZXA 4HL9A 3BQ1A 2VL1A 1KNZA 2AF6A 3W65A 1HFEL 3MMBA 2MKYA 3HI9A 2J9DA 1QVGR 1H72C 5G0RB 5HAOA 1FWPA 1LW2A 4JUZA 4L72B 3MAQA 4NLSA 2PMWA 2K7JA 1VS3A 4HHUA 3L3CA 4P2FA 3VAFA 5D0EA 3S6EA 3PX0A 4HDGA 2D1CA 1R6YA 1VRQC 3QSYB 2VD3A 2XZTB 3SSSA 5F0WA 1JLBB 1SL2A 2JFKA 4JV5F 1WHXA 2DEJA 2E9ZA 4Y2MA 2LXUA 5HL7Q 2EI5A 2O3DA 1G6BA 3GPAA 4KV8A 2VQEF 3P45B 2ILYA 2ERRA 2FZGB 4QYZK 1FA0A 1RE1B 4USKA 4U7UD 3K5OA 3DC2A 1N32J 3DCAA 2IVYA 2B4VA 3DRXA 4DG1A 1NK7A 4ZMMA 2WSCC 5DZ6A 3QNWB 2Q79A 4K59A 4DR2F 4USTA 4OLPA 3KK2A 4A8WA 3I5CA 2IY5B 1LFPA 4DPXA 4A8XA 3MDFA 5IT9Y 4NLXA 3P3DA 2ZDPA 4XK8C 1FRKA 2W9BB 1MROA 2HNZA 1S4EA 2HHPA 1YJVA 2CZ4A 4R0EA 2BE7D 3QQCD 4DDFA 3UDCA 2XC9A 2RH3A 3GIJA 4M5MA 2DR6A 1S72S 3V6JA 2FVCA 3CXCR 2ZVSA 2H51B 2KKHA 3PACA 4ZCKA 2EFOA 2ZBQA 2AX0A 1HNWJ 2W4DA 2Z0GA 5IM0A 5E7OB 2HHWA 5AE3A 1S6QA 2J7KA 3KFWX 3DM2A 1CBKA 2RF2B 2G4BA 2KZMA 2ZZTA 1JLAB 2RRAA 2XHWA 3M8QB 3K5NA 4X4TA 4Y2CA 3SV4A 3NGRA 4K4VA 2OD4A 1QVFR 3FEZA 5AXLA 1CVJA 3RB3A 1WJ9A 4W92B 5KFKA 1T3NA 3EUNA 4FVCA 4DV3F 3A13A 2QGFB 1HQEB 3EZUA 2JL9A 5F41A 3RBXA 2M8HA 4RW9B 5D15A 3IP0A 2OPPA 3O1LA 3BGFA 3NWGA 1NH7A 2G2YA 4NCBA 2LU1A 3H90A 4CO3A 1WSRA 3EVOA 1IM6A 3M30B 3LQVA 4OHZA 2QN6B 3KLHB 1N36F 3IBCB 2ZZNA 1PYTA 1QSLA 4G6VB 1F5CA 4FKYA 4ZP7A 1JLEB 1U1NA 4K4ZA 1SKSA 4I2QB 1G7CB 2IC3B 2R2TA 4XAKA 4GVBB 2GO8A 3UDLA 1S57A 2DHSA 3GONA 2JNJA 3CDAA 4K0KJ 1X5SA 3PV8A 4NYZA 3KDOA 2HGNA 4OX9F 3CJ2A 2GQ2A 2DJWA 3AOBA 2DHGA 4JI6J 4ZIWA 2O66A 1HWJA 3CCSS 4IQXA 3KLGA 1ACMB 2Y8WA 1WF0A 2HQGA 3JQJA 4OQJA 2QA4G 4NZ7A 1NUEA 2A3JA 5HLFB 3PJ9A 3GSIA 4MJKA 1U2FA 1WEZA 5GVQA 4CYUA 2V8DA 2MQMA 1M5PC 3QGHA 1MMLA 3V81A 1NJWA 4ZCIA 3OL6A 5DDRC 1NDLA 1WF2A 4P7VA 3AOAA 2FY1A 1RWOB 1IBKJ 3CULA 2MSTA 1REVB 2ADCA 3B6BA 4EK2A 4QIWD 1JIHA 4DPYA 4WK3A 3JTOA 1SV5B 2UV8A 1XNRJ 3GFHA 3C14B 4FBUA 4FXWA 1YG0A 4IFYB 1PJ6A 1N33F 5KFAA 1NDCA 3MCOA 5CH7B 2J7WA 1GX5A 1ZAVA 3FKBA 3AQOA 2HBRB 3PX4A 2BJ1A 4NCGB 2AJQA 1FNXH 2C2EA 3H2UB 2R8IA 2HLUA 3MGJA 2EFQA 2BQUA 4K4WA 2IBOA 4PQUA 1TL4A 1U25A 4WE1A 2QFIA 3HCXA 3OXGA 1XIQA 1U09A 2LVWA 3W2WA 4LF6J 4G1PA 4DSEA 4ECUA 1WKLA 1VIXA 1JXVA 2G9OA 2RVJA 1TK0A 4RBVA 5KFEA 1HQ2A 5BR8F 4RR5A 3LPYA 3DOLA 3TVYA 1Y11A 3MFIA 2HVEA 3QRPA 5DDOC 2K3IA 1YRUA 2J5AA 3TP2A 1JX4A 1T11A 1JLQB 5D4PA 4CNYA 2K8GA 3M4XA 4ZLPA 1RWPB 1RWNB 3VZIA 3O8WA 2DO4A 1AT1B 5E3QA 2RQMA 2PA8D 1GK8A 4IR1A 1N34J 1N5SA 3IR5B 3QWUA 3TA0A 1HPZB 3AT1B 1EHWA 2AJ2A 1SC4B 4ECZA 3CF5Q 4O0IA 1UFWA 3TAMA 2Z2ZA 2RE1A 2CJBA 1XMOJ 2KHCA 5GAGI 2YH1A 1U1LA 5GADU 1BWEA 1C4CA 1JNRB 1EJ7L 1N0UA 2VDIA 1F6TA 3KLEB 3CNQP 4C8NA 3MM9A 1WG1A 1F3VA 3QWPA 3JAMU 3QAUA 4NE9C 3UR0A 2XGQA 2JLGA 4OI0A 3DKDA 5LMNJ 1Q8IA 4AT1B 1Q95G 4BCAA 3W60A 1DARA 1GMWA 3GLJA 2CQ2A 4OHWA 2UUTA 5F8MA 4PG5A 2RKIA 3D68A 5FD1A 2H4YB 3CEDA 1V5IB 2JC0A 4N8NA 2ATCB 2DGWA 2QSWA 3GG1A 4DV4J 4EYHB 4RBUA 2CPFA 4KH0B 1SKUB 3DI6B 4USMA 1RU1A 1C4AA 3UI3A 3Q24A 4X64J 2JX2A 4Z7YA 5A8KB 3R5CA 1KDNA 1UW4A 5FDLA 2H5IB 3DFEA 1IWAA 2JSXA 1VRTA 2HFZA 4UQTA 3TAQA 2VKRA 2HNYA 2X1GA 2HFOA 1YVFA 4ZPTR 5DQGA 3PEJA 2FHJD 3C3LA 3ZTSA 1CQNA 2ACYA 2H48B 4CT8A 2QO3A 4P2SA 1E6YA 1KHVA 4NRUA 2YX4A 1C1BA 3D5MA 1TU0B 3ETMA 1O8BA 3NCRA 1T05B 2BJEA 4TNOA 1OQ3A 2F4VJ 4TYAA 2QLBB 4LFCF 4J9MA 4DV2J 3SYZA 4M5KA 1U8SA 2B7BB 2XMTA 1J27A 3HF5A 4JYAF 1MU2A 1Z2LA 4YB6A 3J81j 3BJYA 3DYAB 2NS1B 3N28A 1A9NB 2EPIA 1AZSB 2GJIA 2MLZA 2XI2A 2UZAA 2CQIA 1GMUA 5KFZA 1SJ3P 3G9CA 1PIEA 1WEXA 2VG6A 2XMVA 2OEMA 1IKYB 4DFPA 3OV7A 4F8RA 2ZBIA 2X3DA 4DCOB 2AYEA 1WKJA 2V63A 5MAOA 2HG4A 2IM2A 1JLFA 1WC3A 2JLFA 2YWEA 5D0RA 4LJMA 3D3BJ 4U6PA 1QJHA 4DZDA 3C8YA 4TY8B 1F2HA 2I38A 3CD6S 3NLCA 4IG0B 3A8JA 3B78A 2B4UA 4TN2A 2CJKA 3H40A 3MUTP 5CYJA 3QIPB 4B3RF 4CZCA 3NCPA 1OWXA 3V6KA 3SZ2A 3G71S 3ADAC 1VDHA 2WVCA 2VG7A 1DTTB 1LEOA 4DR6J 2W8KA 5EWGA 1VHIA 4IOCQ 5BJRA 4O44B 3KUEA 4JI3J 1F9EB 1B7YB 2VG5B 5DGAA 2EW9A 3TEHB 1I51B 1F1BB 2NPFA 4ZIVA 3OTOF 1HHSA 5A0YB 1S5ZA 3IS9A 1B64A 4ZPBA 2DGSA 2FZKB 4H4MB 1TKXB 3EICA 4DSKA 3OR2A 1R8PA 3ZXWA 9RUBA 5L39A 3IG1B 2DCUB 2Y0BB 3FMBA 1GEHA 2UUBF 1P8GA 1F9FA 3HKZD 3RB4A 1K44A 2W24A 3AY0A 1GMVA 4BWJA 2ZD1A 3ZZRA 2FJVA 1VISA 3JQKA 4I7FA 3P5BP 3A8EA 3CCTA 3GV5B 2DNOA 8AT1B 1NHUA 2VH7A 2XMUA 3LALA 2O1PA 2DRDA 5IOLA 3HJVA 1VQ7S 4MK9A 3BYRA 1S1VB 2WZ1A 4Z37A 2IYIA 3A8KA 2CJQA 4ZK7M 3BBBA 1CJVA 2JEIA 1SL0A 2B0GA 1Y5LB 3P5TL 2XMKA 3S01A 5HI7A 3V4MA 1RWUA 3KXDA 1VBKA 3C2PA 5H9EJ 3B4MA 3W8PA 4ZP9A 4Z7CA 3CDWA 1IJFB 3DNCA 1HBOA 2V34A 4RU2A 4NLWA 1YRXA 3K8WA 3IR7B 3OW2R 4DN9A 5KT4A 1YJRA 3HFKA 3U7JA 3PZPA 3CJKB 3NGDA 1TK5A 1KVIA 4RU9A 3BF4A 3SCKE 3MHYA 4A8YA 4LT6A 2YKNA 2DNGA 2R4FA 1S48A 1X4BA 5KFVA 3W7BA 4TU9A 1Q8KA 3NP5A 1FD8A 3D6HB 2OJ3A 2WVDA 4LF4J 2F4FA 2GMHA 3BKTA 1YQHA 5GAEU 3FDSA 2HLTA 2HK3A 1KFDA 2VHGA 1S9GA 2ZH6A 4RW4A 2JDJA 4ZPWR 3DLEB 3PRVA 1WOOA 1S7HA 4NL5A 4DL6A 3T19A 4CIOA 4C11B 1CQMA 2F8EX 2RS2A 3TZXA 4OI1A 1U4BA 4F0KA 2D9OA 1TAQA 2H4WB 3G6YA 2HRUA 3RB6A 4DEZA 1KSPA 1V3SA 1VCTA 1FVSA 3NMRA 4GKJJ 2FTRA 1RZMA 2W25A 4K4YA 4XPCA 3T5KA 1CJKB 1ZYQA 1K8AT 3J7YI 3UD3P 2QMWA 1VGYA 1RA6A 2FJAB 2FHKA 2EC0A 2PD1A 4ES1A 3LP0A 1VQNS 2LU2A 3RUBL 4PUOA 5M2RA 1XNQF 1HNIA 3M2VB 2KJWA 3VAIA 5AXKA 1SJ1A 5HP1B 1NAQA 3E3XA 2FJWA 1X4EA 4C9DA 2R42A 3NXZA 1HBUB 5B0EA 5CYMB 4ZVTB 3PRBA 1XN9A 2EBEA 3ZO7A 3PTWA 4ANEA 4Y34A 3SQOP 1UAWA 1HMVB 5IT9U 3AB2B 4P72A 2BXJA 4TXSA 1K73T 4LF7F 2MZTA 1U1QA 1UZHA 2CKWA 2XBPA 3EGZA 4J9OA 1D3WA 1IWGA 2DXEA 1NPKA 1BQMA 3MECA 4PKDB 3FGVA 3G96A 3BH6B 4NLQA 1N54B 3AJ1A 1HHTP 4XIUA 4I67A 3P49B 3FSYA 3G86A 1IJEB 1QTNB 2FJBB 2Z56B 1RDRA 5J2MA 4UTGA 4PXCA 3WIUA 3OFFA 2AHOB 3DDIA 2C2ZB 2XM3A 1S9EB 1ZA2B 3L7PA 2LP4A 4ZN1A 5KT7A 3UW1A 1HNVB 2CUYA 3IN5A 3ET6B 2H5JB 2AU0A 3C6TB 5GMEA 3E8OA 3KMQA 3U1MA 1S1TA 3PY8A 3BKFA 1XJWB 3FUYA 3H7HB 2IAJB 4WKRA 2Q6CA 1RAFB 4OZ3A 2KDOA 5LXYA 4LQ9A 4DR3J 4HTIA 2XTJP 3GV8B 2E9RX 1OY6A 1JWWA 3PR4A 4CRJA 3DGVA 5HQMA 5AXMA 3H4BA 5DETA 4FDFA 4PZVA 3SCLE 3C15A 4K0KF 3PR5B 2CQHA 2JVOA 1QUVA 4DBQA 4IFVB 3LF0A 4KYZA 2ZM6F 3CTRA 5H1SV 5AE1A 5A8WB 4HH0A 4LRBA 3OFHA 3GIKA 4JI6F 2EG1A 3GYGA 3IM8A 3MM6B 3W3SA 1R31A 2A0FB 2ZH8A 2RUSA 1FKPA 1H73A 1WC0A 3QJJA 2HHSA 2DKOB 5EDWA 1UWAA 2CFXA 3TW0A 1U1PA 3CJQA 1AFIA 3DRPB 3G8QA 3CCZA 2KN4A 1RJJA 1ZTTA 6FDRA 1PGZA 2NYHA 1UFKA 2B9EA 5H9FJ 4X4UA 2GHWA 4OJGA 2DNRA 2D3O1 1RTDB 2CIMA 3EX7B 2L41A 2PO4A 3LOUA 4MAKA 1XNRF 4MKYA 1RTIB 3RB0A 2VPXB 2DNZA 1HARA 4NYPA 3IBFB 2YWKA 2L08A 1FJ7A 3RJMB 1YSJA 2BJ7A 2ZH3A 2RU3A 4YDXA 4ANDA 3DLHA 4F3QA 4PAAA 3DLGB 4I68A 1D0EA 1NLKL 1HQEA 4ED1A 4TVAB 1PJ5A 4AE5A 2W9CA 3D2WA 2YVSA 4ZJOA 1Z4UA 1R89A 5IXUA 4LF6F 1CSJA 3WHIA 3VV2B 4KPYA 4F50A 3R5DA 3QATA 1XBWA 2JH3A 1S77D 3RR7A 1SJ4P 2NXCA 2AGQA 3M30A 1QAJA 4IDKA 1RGVA 4QWAA 2WBMA 2WONA 2H54B 4WFYA 3HHDA 2IC3A 3D6TB 1KP6A 4GVBA 2H65B 2Q1LA 4ED4A 2HMIB 4CTAB 4RW8A 4NCAA 4MYTA 4X65J 1SH3A 2J0WA 1S1UB 1D1UA 2MQNA 2CZVC 4X84A 5LSLA 3V5RA 5KFSA 4CO2A 2WW8A 3R5GA 3DRRB 3BBFA 2RILA 3ENWA 2VUGA 2YNHA 1OS5A 2MXYA 5D0GA 2MKJA 3IR6B 2X3GA 1WWHA 2DGXA 1NJIT 2JVRA 3PW5A 1RAIB 1MSWD 5DLFA 1XMOF 4PPZA 1KOHA 2V94A 2IPOB 3HSDA 3NMAA 5DO2A 4X4QA 4NASA 1V5VA 3J7A1 2KU7A 2RNEA 1RADB 2HS3A 3OR1A 5LM7E 4LSLA 1REVA 1D9AA 2PI5A 2E9TA 2BBEA 3KUHA 3MEEB 1H2UX 4YR0A 4ENOA 1LK7A 2B51A 1KLNA 3FVYA 4DF4A 2O01C 3V6DB 1FKAF 4M63A 2D9PA 3S1TA 2QA4S 1RAEB 1RSCA 2QA1A 3WBZA 2XMJA 3PO4A 3KHRA 4DXLA 2CVEA 1QAYA 1Q86T 4WF9Q 3RW6A 1JKHB 1UWBA 3M8PA 3BGRA 4DS5A 4NI2B 5B0FA 1VQ4S 2UU9F 2Y9HA 2PA3A 5G4DA 4A4JA 3ENAA 1HD0A 3HVTB 3EE3A 3HVWA 5E2QA 2GVDA 2EKYA 3JS9A 1TL1B 4PG8A 1RHQB 2IA6A 4G65A 4HEA9 4DV7J 1YGYA 4RNOA 1YJNS 4HH1A 4ZVGA 4DR4F 4DV2F 4LFBJ 3IRXA 3ZZOA 4PWDB 2CNLB 5SUHA 3PW2A 5DJBA 3KUGA 2OUGA 2M2BA 3LW5C 3CC4S 1UA1A 2HGMA 1DQAA 3PRDA 3HHEA 1TKZB 2JFDA 3MMAA 4B3TJ 2HIYA 1RT6B 2VASA 1Y4ZB 2R8GA 2RU9A 4J91A 1LWFB 2YTCA 3ONQA 3FBFA 1N0VC 2HNDA 3H5UA 3LWMA 2NR0A 3Q2TC 3SV3A 3W63A 1EAYC 2XSJB 1Q16B 1KVJA 1MMDA 5KG5A 1VI7A 3GP9A 3CJ0A 2BM1A 3KLEA 2KXFA 3RBEA 3HHLA 1FESA 2CPDA 3TX8A 5DDPC 3LWLA 2NREA 4Q43A 4OYOA 4DJBA 5ADZA 3CCQS 4EO8A 5H9EK 2VC0A 2UVVA 3VZHA 2R7SA 4P2MA 4YQWA 1REGX 3MWBA 1RT4A 4J9QA 1RHMB 2MQQA 4PRFA 4OV6A 3KK3B 4U8YA 2DBBA 5L1IA 2V9KA 1LV5A 4CQ1A 4ED7A 2W2QP 4B3MJ 4YB1P 1S49A 1NH8A 2V6AA 1F60B 1SUQA 2WVEA 2MKHA 3K59A 2L9NA 2IFXA 2CPZA 4LVOP 2VC1A 3T1HJ 1MWZA 1U1KA 3NBPB 1UVMA 3TUJC 1NJZA 4CO1A 3W64A 1KQSR 2ASJA 5K9FA 1NPRA 2G1DA 2HK2A 1NZAA 2H3EB 3MEDB 3HZGA 2GX8A 2DCLA 1PJ7A 2KZZA 1CC8A 3R1LA 2BJ3A 4PXEA 4DF8A 1TL3A 2KG0A 1NJYA 2IYGA 1KLMB 2HBZB 3BBCA 3LTOA 3CD5A 1O0PA 4BBYA 2DGQA 4L76A 1RAGB 2BV3A 1J5EF 4ZCLA 4LRDA 3EM1A 1V6HA 2M8DB 4ETZA 3NS5A 3M2RB 1PG5B 1HYSA 2IA0A 4DQSA 1BLUA 2BM0A 3MM5A 1X31C 5LXRA 3MUMP 2ZITA 5D78A 4X62F 4PG4A 4FZVA 4OZ5A 2V8VA 2BEFA 3KHGA 2GNKA 4ZPCA 1RYSA 2AT1B 3SBMA 2WB1D 4X4SA 5LT5A 4RUBA 1IKWA 4DL7A 2H1YA 4JI4F 2XY7A 1SBRA 2QL7B 4DI6A 1NK9A 4WWSA 5HROA 3A3NB 2Y1JA 4C8MA 4KKOA 3R2DJ 1RYRA 2CPXA 2GW8A 3J81Y 1QUPA 1CS4A 4UOFA 3US5A 5KFJA 3NGTA 3CJSA 4S0MA 3RRKA 5I42B 3OLBA 1YKWA 2FGOA 2W2NP 4HVZA 4DR2J 3Q89A 4LF4F 1S6PB 4AL6A 1I1GA 3UFCX 3TA2A 3ZTOA 1RI7A 1X0FA 5J1EB 2YX7A 1NHKL 3W5ZA 4PXDA 2GHPA 4ZKAA 3ENQA 3J7Z5 3H8YA 4KRWA 4C48A 2G0CA 1K0VA 3CD0A 1OJ4A 4EYIB 4Y65A 3ILOA 1ZM4A 2MSSA 2OPQB 4USJC 5CD4A 4O3RA 4I64A 1RTJB 1WKKA 4GKJF 4KHMA 4CLSA 1RHUB 3AB4B 1HNXF 3RAQA 4ZHRB 5IS2A 2VOOA 3OT9A 1CEZA 3IWLA 3SCIE 4KTQA 2WB4A 3C46A 2OSQA 3KLVA 4C8LA 5D4LA 4YR2A 3WIVA 5IC4B 4IG3A 5ETOA 4OYIA 4FF1A 3QSIA 3J7ZT 4LF9J 3Q23A 3NAHA 1IM4A 3FBBA 3EZOA 2KO1A 4DV5J 4OX7A 3IFEA 3Q8RB 5DM7Q 3BPDA 2BMBA 2BYCA 4CWBA 2VODA 1VQMS 2QMUB 4OZ2A 2DH7A 3Q86A 2Q3PA 3FQKA 4I69A 2C2DA 2F9DA 3EVWA 3PIPQ 1TKTB 2DHXA 3PNIA 2IVMA 3UE2A 5C25A 1N36J 4I0WA 3KTQA 4K5SA 3FJ2A 2CADA 1C1CB 1JNZB 3OSPA 5F8HA 2ILZA 4JI7F 4KQZA 1N5YA 2GIRA 1S7IA 1P9QC 4MFBA 4AUKA 2WVBA 2LXFA 2FQQB 1EARA 3EGWB 2C2KB 2BOAA 2J0QD 3HFVA 3W5YA 5L46A 3NCQA 4OX9J 1RK8A 2IIHA 5J2NA 4WFBQ 2R3VA 4F3OA 2J6UA 4LF5F 1AA1B 3Q8UA 3MURP 1B0VA 4C11A 2XY6A 2FVPA 1N8RT 3SDEB 2N4DA 3U27A 3OLAA 3KK1B 4FBTA 4H4OB 2R7RA 1HWIA 1CG2A 2RRBA 4DR3F 2L48A 4KB7A 4ICLA 3G2XA 1FFWB 1RA7A 1FXDA 4RUAA 3GTYX 5K14A 3ITHB 2ZE2A 2B6AA 3J7AN 3QZ8A 1TFYA 2KFYA 1DQ9A 2W7PA 3BGLA 2RB7A 4ID5B 3H98A 3NOGA 2R7XA 1DRZA 4ELUA 4DL4A 1N33J 3JSMA 1RABB 5BYQA 2VONA 5IWAF 2RD5C 4WP9A 1WG4A 2VFVA 1RT7A 1RLCL 1FWLA 1X5OA 5KOWA 2ZHOA 5DQHA 3M2VA 5E3RA 3M6WA 4FYVB 3PYEA 4OZNA 1H98A 1KEKA 5HP1A 1ZBTA 2ZH1A 5KFFA 4DV0F 1VQ8S 5F8LA 2HYIB 2NXEA 3WZ0A 2XS2A 1HBUA 1RTHB 1NZ8A 3GFZA 4KHPJ 5A8RA 4QWBA 4RJVA 2LEBA 3R27A 4AYBD 2L3MA 3RGIA 3IM9A 4F4KA 2J0SD 3GV7B 2ZUGA 4Q2LA 1N6QA 3JSRA 2DGOA 2MGZA 3FK4A 2ZOFA 4YB7A 4KPCA 1ZM2A 3QZ7A 4F67A 3THVA 2R8KA 1R0CB 3QAEA 2N7CA 2BKPA 5A76A 3HX9A 2GIFA 2LEPA 2OP5A 4PXBA 4EZ9A 1E6VA 3BSCA 1H3DA 3MR5A 3PDNA 2DNHA 2BQ3A 2M7SA 1AB8A 3TUIC 3CJ3A 1T03B 3M32A 5E3CA 1LQ9A 5K8PA 3TRGA 3IO1A 1X0PA 4IO9Q 2EBGA 3MPUB 4A8FA 1T94A 1DTQB 2AYBA 1JJHA 3H0PA 4KC5A 1X5PA 1WACA 2W4CA 3TZWA 5T7LA 2HFUA 3MEKA 1FRXA 2V0NA 3I55S 1Q82T 2B8QA 1L3VA 1ZPWX 1NSKL 2RHSB 3UVJA 3IMQJ 1C0TB 3TOQA 4F2RA 3HXMA 4C4WA 1VC5A 4OLOA 3K7RA 2KJVA 4R8UB 4UOGA 1JLCB 3PX6A 2LQ9A 4E0DA 4GRSA 4K7QA 4X65F 3VVTA 1YBTA 4RO0A 3ZNJ1 4IFVA 3BM7A 2C22A 3GZ7A 1O51A 4O23A 1Q8LA 1Q8BA 4QW9A 2AEFA 2FDNA 4M5DB 1S0OA 1YDLA 4OZJA 2NYIA 2MZSA 4CLWA 2DNQA 1T9VA 3MM6A 3G4SS 1X8DA 1H74A 2Z30B 3OFGA 3K5LA 4JV0A 2CPYA 1LWCB 1JK9B 4Q8EA 3MCNA 2CQBA 4HACA 4V19X 1U6ZA 5K8MA 1R3NA 1RAHB 2MZRA 3FZBA 2YPYA 2KFNA 1H38A 3C6UA 1SCJB 1WC4A 3DLKB 1W2IA 4OZ1A 3ZZPA 2MLYA 4QWDA 1RAJA 1K9MT 4GKKF 2DISA 2VA3A 1RTDA 1RT5A 1H2VZ 1RTZA 1U26A 1T9TA 4LFCJ 1GXTA 4IH7A 4ZOSA 2ADBA 2YQ3A 2CNKB 1RTIA 2HZVA 1EKSA 4FYDA 3MI7X 1U0HB 1QDUB 4DUZJ 5D8HB 3NOCA 2VJUA 2XWYA 3R7NB 1RT1B 3GQCA 4I6AA 4P9SA 3GB0A 3IRWP 2UV8G 5RUBA 2UUAF 4J9PA 1A6LA 3MTJA 1MWYA 3Q22A 4LIRA 2BOPA 2HQFA 2AV5A 3UQSA 2ZBCA 4O3OA 3M05A 4TU7A 4O4GA 3PCOB 2CPJA 3I0SA 2HSEB 2FC9A 4AFFA 4GC6A 5D3GB 2ZJRQ 2HS0A 1IQZA 1FEHA 3L7UA 2ASYA 3Q8QB 4A8KA 1PBUA 1QSSA 2PSZA 4ZDNA 2R7UA 4NEYA 1HBNB 4DPOA 2IM3A 2HMIA 4C7QA 4CTAA 4HI1A 2ZJPQ 2AJFE 1S1UA 2K3KA 2JEGA 4ID8A 3T41A 4QBUA 4ELVA 4B3TF 2QIFA 2N4CA 3DRRA 1FVQA 3HMJG 1XTZA 4B9UA 1W26A 2ZHAA 3A1YG 3ISND 3OBIA 1SJRA 4YFUA 5LSRA 4KFBA 4B3SJ 4J7CA 4X4NA 4HLBA 3HM9A 2WRMA 2DRAA 5FLXY 2I5JA 1YK9A 1WDTA 2RJZA 4JP8A 1M0SA 2QMXA 3ILIA 3QGPA 3OTOJ 2J8SA 4YP3A 1CC7A 3TEGA 3WX4A 4X4PA 1Q1KA 3FSIA 2FHOB 4R5PB 1HBMB 1RACB 1UVKA 2VICA 3MR3A 4L3NA 1FX2A 4Q7AA 1FDNA 1NB2A 1YZ6A 4QIVA 1FKOA 1NSAA 3FZ2A 4F4AA 3LP2A 3DGPA 2QTWA 3D7SB 4OJHA 5I3UA 2HBQB 1TL7B 3GILA 3VAGA 2VBXA 4C8KA 1G2EA 1NKEA 5D4OA 3VGUA 4ZVOB 1CJUB 2DNYA 1KOOA 3I87A 2ASLA 2R7WA 1EX8A 1BXNA 1VJQA 4OI3A 3DDKA 4LF8F 4DR5F 2D3UA 2V2ZA 4NI2A 4XPEA 1UVLA 1ZPVA 4F26A 3L9ZA 2FLNA 1HQUB 2YNGA 1R0AA 4LSZB 4ZVHA 1SIWB 5C24A 5L1LA 3G82B 2IRYA 4Q0BA 1LNQA 3DRSB 4G1IA 4OZ0A 4U95A 1PSDA 3DOMB 4EU0A 2LQ8A 2QYCA 3T1HF 3QT8A 4XDDA 1S59A 3Q8SB 4ECYA 5J2QA 1M5KC 1CJTB 3TQ1A 2JJ4D 3KKFA 3SQGA 4ZJLA 2HRYA 4QJVA 3MMBB 2FJEB 3SSRA 1NPPA 1VQKS 3HT3A 1V3ZA 1LW2B 3VGSA 3ZZUA 5IZHA 5JXSA 2XCPA 1B70B 3W2VA 2UP1A 1R27B 2DIUA 4YEAA 4DV1J 1F0XA 4WK1A 4YHHJ 4C3LA 2C42A 3D66A 1WORA 3CJ5A 5KFDA 5HSPA 1TKZA 2P2CB 5A2QY 1YHQS 4UZCA 4RW6A 3DLJA 4KHRA 5BXIA 2W7OA 3BN7A 3MM8A 1NHVA 1MN7A 2B8PA 4Y2IA 3D54A 1EP4A 1HA1A 5CXTA 3PJXA 4ZPDA 2RAQA 4G3IA 3GJRB 1L3KA 4KV8B 1HW9A 3MCMA 4I1TA 5LMUF 5ETMA 1AUDA 2XZWA 4NEZA 1B99A 2C2OB 3O2IA 4WKYA 5KFQA 1TMMA 2F63A 2RRNA 2ZBPA 4DG1B 2OLWA 1WD6A 2HZAA 3WC0A 1VQSA 5D4NA 2HZCA 1KQKA 3KK2B 3ENVA 3AD7C 2VPZB 5CCLA 2AJ4A 5C42A 2CQDA 5DG9A 4DSFA 2DY1A 4IO1A 1UJ4A 4RNHA 1MROB 2HNZB 1ELOA 3T1AA 2GZOA 5E3PA 2W7AA 2U1AA 1RBLA 1QY7A 3TNVA 1NK5A 3R8YA 3N5BA 1T7PA 1TP7A 5ETQA 1SB6A 4V19J 3P8BB 3EJMA 5IM0B 1SC1B 1S6QB 1XNQJ 2V8HA 2ZFHA 3DM2B 3QJPA 3NBPA 4MIAA 1A0OB 3ZZYA 4B3OA 2GQQA 1LK5A 3CO9A 4A46A 4WZQA 2KM8B 1KS2A 4UW2A 4A8MP 3TVKA 1RKJA 2OIHA 3MZIA 2I8EA 3KHLA 4F4WA 5KFHA 4ALZA 1TUWA 4B9NA 2OD6A 4H4KC 1D9DA 1FJGF 1U24A 4FPRA 2VFUA 5ETSA 3U1NA 4ZVQB 1RCOB 4LF7J 4C6AA 3JXOA 1RLDA 2I6WA 3MF5A 2OPPB 2A6MA 5KFMA 2GA7A 2FVSA 4USIA 3HVAA 4LF9F 2AJ1A 1QD1A 2JOQA 2E1RA 3RBDA 4ZLLA 3KLFA 2K06A 3BV8A 1UMJA 4YS2A 1RWKB 1M1HA 2BABA 4DV5F 2BE9B 5L1JA 4DN0A 4P71A 3AD8C 2AEMA 3POTB 3GR0A 4ECSA 3NNAA 2Y3YA 2R8JA 1XERA 4LSNB 4NLVA 1JJ2R 2EFVA 3PKMA 2PC6A 4HTJA 3FQLA 4N77A 1HD1A 2AYGA 2JZ5A 2IJNA 3R3TA 3ETOA 1Y9OA 1S1XA 3KLGB 4OYPA 1FJCA 3G6ES 5KFUA 3LAMA 2O67A 3E01B 2C1EB 1HNZJ 2D69A 5CABA 1UCNA 1PKUA 4UT4A 1OYEA 4CYUB 2BVZA 3WQPA 1JXEA 1UVNA 4IUFA 5IT0A 1UP1A 3JSYA 1S76D 2MMYA 3V81B 2ZM6J 1IXKA 3A3PB 2OELA 3MM7A 3C16A 2HRTA 3GIIA 1I6JA 1BWVA 1YLXA 2Y0SD 2LQBA 4PG7A 3H20A 3A4TA 3CCVS 4N5SA 2ZWOA 5DS7A 2DPIA 1JLGA 3I32A 3KJVA 3M1VA 3DU5A 1EB0A 1NDPA 1LW0B 2B5JA 1FRLA 3FMWA 4ELTA 1G3OA 1CULA 1C0UA 4DS4A 4DFKA 3TR5A 3MAAA 5GMKa 3CJ8A 2MJUA 4CLUA 5HATA 2HAFA 5I3QA 4ECVA 3CD7A 4ZJQA 2VV5A 3PEHA 2WCXA 4A8SA 2I0XA 2IMOA 1K47A 4WE1B 5HQ8A 4F2SA 1URRA 3UPFA 5K8OA 1ULRA 3QO9A 3W2WB 2D3OR 4RX6A 3ZZTA 4RL1A 3HVRA 3WX8A 4PEOA 2CDQA 3VGTA 1P1TA 2KB2A 3GSDA 2BR0A 3UNYA 2RMLA 3GE9A 5B0DA 1TVRA 3UCUP 4EBDA 2NZ4A 4LBHA 3T9NA 1VQPS 3CMES 3LP1B 1GTHA 2F9JA 4KHPF 2P6SA 4QCLA 5DLGA 2OSRA 3VF0B 2YQ0A 4HT5A 2P6TA 1X4AA 2DGVA 1J5OB 3I0RB 4NMXA 4WYLA 4F4XA 5CD4H 4Z2XA 2J76E 4NLOA 3H5SA 2VU5A 3V4IA 3AOCA 2MKCA 2YH0A 1S99A 1QE1B 1B7FA 4U7UK 1FFSB 3PFOA 1T9WA 3BN4A 5L9XA 3TAMB 1NK6A 4P75A 2HQ3A 3CMQA 4C0BA 2JWNA 4DV6F 3M8WA 2CZ9A 4W90B 1VBZA 5GMDA 3W9IA 1XMQF 3MM9B 3CJ4A 4N8OA 1WOPA 1NSPA 1HHQA 1URNA 3V6HA 2MHEA 4CLPA 3CVKA 3OUYB 3UN2A 4E98A 3F44A 1T9XA 1TV6A 4C0OC 2OEJA 4C8YA 1X4GA 3KOAA 2AZ3A 4OYXA 3R1HA 4U67Q 1KRPA 3KK1A 4TY9A 2VOPA 2A18A 4N47A 4H4OA 4XO0A 4PABA 5KOXA 3A3OB 2KL8A 2QC3A 2QZ8A 3CC2S 1KONA 2LA6A 1X9WA 1XK8A 3V2UC 4NLRA 3WC2A 2U2FA 1YJ9S 4G1QA 1TTHB 3TJ8A 2ROGA 1XC9A 2W9AA 2R8HA 2W4PA 4PCQA 5FDLB 2J9CA 4DSJA 2HHTA 4PQAA 1RWWB 3I5AA 5CZVA 4NA2A 2HNYB 3R7BB 4W98A 2DVIA 4USVA 2LLZA 2OPSB 1WTBA 4DU8A 3AAWB 2QT7A 3SEOA 3N6NA 3N6MA 2V8PA 4LVNP 2AYMA 1E6YB 1C1BB 3ELHA 3PJWA 1X60A 4TLRA 4FXDA 3VAHA 2KH9A 2R2SA 3H59A
chains in the Genus database with same CATH topology
2CNLB 4ZVQB 2HBZB 2QL9B 1F9EB 1RWVB 3P4UB 5IC4B 3R7SB 3EDQB 2H51B 2H4YB 2CJYB 2H5JB 3GJQB 3IBCB 3R5JB 3KJFB 1I51B 2H54B 1PAUB 1RHRB 4ZVTB 2HBQB 2QLJB 4ZVRB 1RWPB 3R6LB 1RWXB 3P45B 1RWNB 2P2CB 2H65B 4ZVPB 1RE1B 2C2MB 4ZVOB 1ICEB 2XYGB 2XYPB 4DCOB 1BMQB 2CNKB 2H4WB 3KJNB 2H5IB 2HBRB 1QDUB 1SC1B 1RWKB 2Y1LB 3GJRB 3QNWB 3IBFB 4LSZB 1NMEB 5K20B 3R7NB 3GJSB 3RJMB 1SC4B 1GFWB 1IBCB 2CNNB 2H48B 2Y0BB 3GJTB 2C2OB 1I3OB 1RHJB 3NS7B 1PYOB 1SC3B 2CNOB 3EDRB 1RWWB 4JB8B 1RHUB 3R7BB 1QTNB 1RWMB 3KJQB 2CJXB 2QL7B 2QLBB 3D6MB 3D6FB 1RHQB 4ZVUB 1RHKB 3SIPB 4DCPB 2XZDB 3R6GB 2C2ZB 3D6HB 2CDRB 4DCJB 2QL5B 5IC6B 2FQQB 2QLFB 2DKOB 2C2KB 2XYHB 2HBYB 2XZTB 2C1EB 1RHMB 1RWOB 4ZVSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CNL B;  4ZVQ B;  2HBZ B;  2QL9 B;  1F9E B;  1RWV B;  3P4U B;  5IC4 B;  3R7S B;  3EDQ B;  2H51 B;  2H4Y B;  2CJY B;  2H5J B;  3GJQ B;  3IBC B;  3R5J B;  3KJF B;  1I51 B;  2H54 B;  1PAU B;  1RHR B;  4ZVT B;  2HBQ B;  2QLJ B;  4ZVR B;  1RWP B;  3R6L B;  1RWX B;  3P45 B;  1RWN B;  2P2C B;  2H65 B;  4ZVP B;  1RE1 B;  2C2M B;  4ZVO B;  1ICE B;  2XYG B;  2XYP B;  4DCO B;  1BMQ B;  2CNK B;  2H4W B;  3KJN B;  2H5I B;  2HBR B;  1QDU B;  1SC1 B;  1RWK B;  2Y1L B;  3GJR B;  3QNW B;  3IBF B;  4LSZ B;  1NME B;  5K20 B;  3R7N B;  3GJS B;  3RJM B;  1SC4 B;  1GFW B;  1IBC B;  2CNN B;  2H48 B;  2Y0B B;  3GJT B;  2C2O B;  1I3O B;  1RHJ B;  3NS7 B;  1PYO B;  1SC3 B;  2CNO B;  3EDR B;  1RWW B;  4JB8 B;  1RHU B;  3R7B B;  1QTN B;  1RWM B;  3KJQ B;  2CJX B;  2QL7 B;  2QLB B;  3D6M B;  3D6F B;  1RHQ B;  4ZVU B;  1RHK B;  3SIP B;  4DCP B;  2XZD B;  3R6G B;  2C2Z B;  3D6H B;  2CDR B;  4DCJ B;  2QL5 B;  5IC6 B;  2FQQ B;  2QLF B;  2DKO B;  2C2K B;  2XYH B;  2HBY B;  2XZT B;  2C1E B;  1RHM B;  1RWO B;  4ZVS B; 
#chains in the Genus database with same CATH topology
 3GR1 A;  2UU9 J;  1UTA A;  3BO2 A;  3J80 U;  2VBY A;  1MU2 B;  4L75 A;  3RBZ A;  2GVZ B;  2GCF A;  3R6L B;  4EBE A;  1TKD A;  4PYD A;  2XO6 A;  4IKA A;  1S10 A;  1V9O A;  3M6U A;  4X2B A;  1VIO A;  2ALY B;  3EPG A;  3MEG A;  2V50 A;  1Y10 A;  3KJN B;  2HVZ A;  3JAM Y;  4F0M A;  4A8Q A;  4NLT A;  1VK3 A;  1SKW A;  4DFM A;  3LUY A;  4DR4 J;  4LIW A;  2MY7 A;  2VG6 B;  4PR6 A;  1VBX A;  3FFI B;  1VRU A;  2VFR A;  4DUZ F;  1MNE A;  3MPW A;  3EPI A;  2YNF A;  3NWR A;  3FRY A;  3M8Z A;  2UUW A;  1JLF B;  4LBP A;  3CCL S;  3ICL A;  3PXG a;  5CCM A;  4LBI A;  2XMW A;  2LA4 A;  3H25 A;  3AFG A;  3R6G B;  3HHN B;  4M5H A;  2MHN A;  3D3C J;  1N5V A;  3FNN A;  1UW9 A;  2VPW B;  1FE0 A;  4F36 A;  2N7Y A;  5KT2 A;  5DDQ C;  2YKA A;  4KT0 C;  1UA0 A;  2QJ3 A;  5C5J A;  1FER A;  2M0G B;  5J1P A;  1ZAX A;  3JSB A;  4CH0 S;  3VR1 A;  4FYY B;  2V4J A;  1U2R A;  5I4M A;  3GIM A;  1NCL A;  1C0T A;  3PW4 A;  1FE4 A;  2VG7 B;  1UVI A;  4FNI A;  2KVQ E;  3PIO Q;  8ATC B;  2CPE A;  1R7I A;  4EFA C;  1ICE B;  3NGU A;  3EVM A;  4I4B A;  1U8W A;  2Q66 A;  5KG3 A;  3RRG A;  4OHY A;  2LDI A;  1GMW D;  2AEJ A;  3GG0 A;  5GAH U;  3IS9 B;  4UQG A;  4QU6 A;  3CMA S;  2E7W A;  4U8V A;  3ISN C;  1RXO B;  3MD1 A;  3OR2 B;  4LMZ A;  2ZH7 A;  2CWX A;  3MR6 A;  5HO4 A;  3LA0 A;  1SQG A;  3L95 X;  2H9Z A;  1WUU A;  4B3S F;  3TZZ A;  2GMJ A;  1G1X A;  3UN5 A;  2C3Y A;  4JV1 A;  3N01 A;  5HBM A;  2I2Y A;  2DNP A;  9ATC B;  2QL9 B;  2HEK A;  3JYT A;  1ZOT A;  5AJ3 J;  3FCV A;  4ZS6 A;  4GC7 A;  1S9F A;  1NXI A;  2E5H A;  5B0C A;  4I7F B;  3MPD A;  3N9U C;  4CP5 A;  2DH9 A;  2F1F A;  4YR3 A;  2G0J A;  1FRJ A;  1F3F A;  1LFW A;  5L9N A;  2E5I A;  4DQQ A;  2B9Y A;  5GAD I;  3IA0 A;  1W7W A;  3AA8 A;  4KO0 A;  3I31 A;  2MQO A;  1CJV B;  3M6X A;  3LGH A;  2ZC3 A;  4CDI A;  5C2C A;  3MCS A;  4WU3 A;  1SJF A;  2PMH A;  2XHC A;  2BA9 A;  4P74 A;  2DR7 A;  2EK6 A;  1MW7 A;  3BO4 A;  1HBO B;  2FLO A;  5U47 A;  1ZZN A;  3CDE A;  4YN3 B;  4M5L A;  1J5E J;  4MYU A;  3O5T B;  1UKU A;  2ATL A;  1NKB A;  4BHQ A;  1HW8 A;  2YKN B;  3VWS A;  5EGY A;  3P4U B;  4X62 J;  1LOU A;  3HKW A;  1RT3 A;  4HDH A;  3BEG B;  4QIG A;  4DX5 A;  4WFA Q;  4MT1 A;  1WDD A;  1S6O A;  5CAA A;  1LXN A;  2GIQ A;  4DV1 F;  3OXF A;  4JI4 J;  2R7Q A;  4YHH F;  3K17 A;  4WCE Q;  3AOD A;  2FHM A;  1S9G B;  5DRK A;  4RW4 B;  2GGP A;  5HMY A;  2IDL A;  1JJ4 A;  2ZKU A;  2K7K A;  3NAI A;  1NME B;  1YTY A;  2UXB F;  4QWE A;  3MOZ A;  1FK9 A;  4B02 A;  2LYV A;  4FXV A;  3M8R A;  3L4B C;  2P9G A;  2OPR B;  1DLO A;  4QR0 A;  1FO1 A;  1OY8 A;  2BDP A;  5DGB A;  1ZH5 A;  3T5H A;  4EI2 A;  4QZV B;  3OFE A;  2X7I A;  4RNM A;  5IV4 A;  2F7V A;  1GAO A;  1PYS B;  4UF4 A;  3RAM A;  4RPF A;  2YNI A;  2IM0 A;  3D1Q A;  3P96 A;  3UR3 C;  3L7O A;  3T1Y F;  3LP0 B;  3IWN C;  2GS8 A;  3OJU A;  4PUO B;  2QG9 B;  5EX3 A;  4ECR A;  1L3T A;  1QAI A;  2RHQ B;  1HNI B;  2DEI A;  3X3U A;  1KQG B;  2IJF A;  1HNX J;  2M5Y A;  2DT9 A;  5LJ5 Y;  2DR5 A;  5IQ6 A;  4K2J A;  1IKV B;  4K5R A;  3QPI A;  4B9T A;  4TYB A;  3HZE A;  2ZBR A;  4OL8 A;  2HHU A;  2W2O P;  4DQP A;  2AWZ A;  2BRL A;  3DOM A;  1D09 B;  1VOM A;  2V8G A;  3PYG A;  2DR8 A;  5GAH I;  2Q43 A;  3EGN A;  5F9L A;  4P73 A;  3F56 A;  2M9K A;  2DNL A;  4RW7 A;  4Q5V A;  1N88 A;  2QEX S;  4B9M A;  1FXR A;  1BQM B;  3MEC B;  1MWQ A;  2KT2 A;  3U02 A;  4Y6I A;  2F8M A;  5IC6 B;  4CLF A;  2QYG A;  4MTP A;  3NGS A;  3RG6 A;  2HQD A;  2DNM A;  5J2M B;  3UO0 A;  4M8L A;  3M2U A;  1M90 T;  3B82 A;  4C3K A;  1M5H A;  5F3Z A;  2KRR A;  1BQN B;  2F3J A;  3ILL A;  2HWT A;  2CA9 A;  1KVK A;  4NXM J;  4URG A;  4JI7 J;  5G0R A;  3ZTQ A;  3I9V 9;  4JI0 F;  2X1F A;  3CB4 A;  1S1T B;  1XR6 A;  1KBR A;  4MK7 A;  2X1B A;  3SFG A;  2E7X A;  2QSF A;  2LCW A;  3NNC A;  4Q2M A;  4LF1 A;  5HVF A;  2CNO B;  4C3M A;  1Q5Y A;  4DPT A;  2MB0 B;  1R8B A;  1D8Z A;  3OTB A;  4LF5 J;  4ILM A;  1JLB A;  4C98 A;  3C15 B;  2ZH2 A;  4XDC A;  4KBI A;  1Q7Y T;  4ZCM A;  2N3L A;  4IQM A;  4JI5 F;  4M5G A;  2YKP A;  2B4P A;  3IGV A;  3E2E A;  2RUG A;  2POK A;  1LKZ A;  1MLA A;  3CUN A;  1U47 A;  2W2P P;  1UJ5 A;  3KNA A;  4F04 B;  4USU A;  1KWM A;  5B08 A;  5ETL A;  1FWK A;  3OXL A;  5THW A;  4O4R A;  3ZZ0 A;  4DPW A;  4WTO B;  4YY3 F;  4JI2 J;  4CH1 A;  1FKP B;  1HNZ F;  2DXD A;  2BKO A;  4WXO A;  3F0N A;  4JI8 F;  4CO0 A;  2CYY A;  3K89 A;  4X66 F;  4Y00 A;  4LRC A;  4DLG A;  4DSI A;  2RDD A;  3QID A;  3B54 A;  5IWA J;  2KT5 A;  3AA9 A;  4KJI A;  2W9B A;  2DYA A;  4WXW A;  1BY9 A;  4DV0 J;  1FRM A;  3AXM A;  1SIZ A;  3LGM A;  4C0H A;  4JB8 B;  1JQG A;  1FT8 A;  1Q78 A;  3KJQ B;  1NB7 A;  4RWW A;  1AYE A;  5GAE I;  2GAH C;  2WTF A;  3OJS A;  1Y0H A;  1KHW A;  1Q0N A;  3W62 A;  2E5G A;  4DCP B;  4CT9 A;  1YJT A;  5GAG U;  3TAR A;  5JVH Q;  2YBV A;  2J0X A;  2OAU A;  2VB6 A;  1SJQ A;  2RF2 A;  1NEE A;  3BKU A;  1TK8 A;  2LFV A;  4O3Q A;  2YXL A;  5EN1 A;  1JLA A;  3M8Q A;  2CRL A;  2W9C B;  4OYM A;  1X5T A;  4L3K A;  2KM8 C;  3QLH B;  2NSC A;  2DY9 A;  5A6W A;  1H2T Z;  1Q7L B;  5KFP A;  1W2B R;  1N56 A;  3G6V A;  4DLE A;  2MEW A;  2YWF A;  4IDK B;  1QTM A;  1TAU A;  2WON B;  1FHT A;  4E8U A;  3CO0 P;  1FRI A;  5M2P A;  2ASD A;  1WTF A;  4RW9 A;  2YKM B;  4RKU C;  2XO7 A;  4Y2K A;  3I56 S;  3B8H A;  3HK2 A;  1AUS L;  4RW8 B;  1RHJ B;  4GVL A;  2DPJ A;  1PYO B;  3MMC B;  4LRA A;  3EDR B;  3POT A;  1I94 J;  2IM1 A;  1U1M A;  4NA3 A;  4V1A k;  1S79 A;  3MMJ A;  4LSN A;  3K8V A;  3AHP A;  3KLH A;  4DL0 C;  4A47 A;  4IH5 A;  2YNH B;  3OVB A;  2IJR A;  1JLE A;  4I2Q A;  5BYR A;  4ILL A;  3E01 A;  3ZFV A;  3HO1 A;  5ETR A;  2B43 A;  2P9E A;  4CO5 A;  2DRB A;  1ZS6 A;  3BSO A;  2KVI A;  1TEL A;  2HHH J;  1IUJ A;  5A6P A;  4ZP8 A;  2OGU A;  2OTL S;  3OR1 B;  4LSL B;  1S0V A;  1U48 A;  3ZTR A;  3P6Y C;  3R5A A;  2NXU A;  2J6T A;  3SSQ A;  4F0H A;  4HYK A;  4DOZ A;  1UJ6 A;  5KFL A;  2R9L A;  5HLF A;  2ZHB A;  1LW0 A;  2IMW P;  3FBC A;  4WP8 A;  3GCX P;  1KD1 T;  2XMA A;  2XLJ A;  1UWB B;  2RIJ A;  1VJW A;  1CLF A;  3M8P B;  4QU7 A;  1ZAW A;  3BGR B;  2AP6 A;  3NRB A;  3I4P A;  1M1K T;  1MN9 A;  4LF2 A;  5HMW A;  4GKK J;  4ITS A;  1Q81 T;  1HR0 J;  2E5L J;  1HWL A;  1PAE X;  3VAM A;  2EFG A;  1SV5 A;  2FHJ A;  4HR2 A;  4X4V A;  3C14 A;  2QLF B;  2ZUA A;  3D0H E;  4IFY A;  3KG4 A;  2GVD B;  4Y0F A;  4KE5 A;  4N41 A;  4DR7 F;  3LH2 S;  4I2P B;  3QFW A;  1KTV A;  1VMB A;  4NCG A;  4UZB A;  4AL5 A;  3TA1 A;  2CQC A;  1WSV A;  2UUA J;  3W8G A;  3IRX B;  3LP1 A;  1VQY A;  2R7T A;  3PKY A;  2XQC A;  4WFX A;  1ARO P;  3K57 A;  2UXC F;  4JBC A;  1P1L A;  1NK8 A;  2DTJ A;  1ITP A;  4Y2A A;  2N82 B;  1FJE B;  1VYA A;  1BC6 A;  1APS A;  1J5O A;  2CXE A;  1FTC A;  1VC0 A;  2FZC B;  3I0R A;  3MMA B;  2VJV A;  4QYR A;  2CQ3 A;  1FDD A;  2VQF J;  2EEY A;  2HND B;  3BRE A;  2DK2 A;  1I5O B;  1QE1 A;  4F3M A;  4B17 A;  1K1Q A;  5HVH A;  1EQ0 A;  2FLP A;  1JLQ A;  4KSE B;  2V4R A;  3EXY A;  3HHL B;  3H2V E;  4JOU A;  4NLG A;  4B9S A;  2V2Q A;  4DUY F;  3H5X A;  4NPO A;  4JI1 J;  3OUY A;  3CCJ S;  2YY3 A;  3CWJ A;  2B7C B;  3I96 A;  3N0V A;  1OY9 A;  4FF3 A;  1HPZ A;  1WHV A;  1RT4 B;  3AJ2 A;  1TR0 A;  4ZVP B;  4HHJ A;  3CDU A;  1Y3J A;  2BW2 A;  2CVI A;  1SH0 A;  2RQK A;  2B3T B;  3IAS 9;  2FJD B;  1NND A;  5B0G A;  1SPB P;  4EO6 A;  2UUC F;  1RQ0 A;  4B08 A;  3CIZ A;  3RYL A;  3W9H A;  3OSN A;  2GAG C;  3CCR S;  6FD1 A;  2AIR B;  2BRK A;  5CA5 A;  1SUQ B;  1I3O B;  3D4J A;  3GYX B;  1P9Y A;  2OHD A;  2E66 A;  7AT1 B;  2AMC B;  2Z8Q A;  2OPS A;  4FYX B;  4RUC A;  2XUL A;  1BE4 A;  1H7W A;  2ROP A;  1U7L A;  1HIY A;  1F5B A;  1Y7P A;  4M5I A;  1IBM J;  1U2C A;  2O5D A;  2VBZ A;  2HVD A;  3O44 A;  1U49 A;  3GFX A;  3DI6 A;  4I6W A;  4LF8 J;  1SVD A;  4FVM A;  2XLI A;  5AE2 A;  4DR5 J;  2C2R A;  1RWV B;  5A8K A;  5D6G A;  3BB5 A;  4AQY F;  1D8Y A;  1RCX B;  3HSZ A;  3Q83 A;  4LR7 A;  2GVZ A;  3VAK A;  2F8H A;  3E51 A;  1U45 A;  2YKQ A;  1P27 B;  3PFE A;  3KG1 A;  1TL3 B;  5AJ3 F;  1XEZ A;  1PBA A;  3QT6 A;  5KT6 A;  3MFH A;  3QT7 A;  5CYQ B;  2EFP A;  1WI6 A;  1IR2 A;  3ILJ A;  2HKE A;  1T05 A;  7FD1 A;  2E1A A;  4GMK A;  5KG2 A;  3H5Y A;  1MMN A;  1HI8 A;  3VAJ A;  1T9U A;  3OTC A;  2LEA A;  1Y5I B;  2A1B A;  2XLK A;  3FFI A;  2EVZ A;  2SXL A;  2KRB A;  2W2M P;  2M52 A;  4NLY A;  1ZET A;  3M9O B;  3PW0 A;  1HYS B;  3DYA A;  3MM5 B;  5D0H A;  2F5G A;  2XMM A;  4R0J A;  1FI4 A;  1WC1 A;  1AZS A;  4NXN J;  1QAX A;  1ZZF A;  1UPP A;  2AX1 A;  4EGL A;  3J7Y U;  1U02 A;  3BQ2 A;  2LEC A;  1IKW B;  4RNN A;  2DNN A;  4ECW A;  1IKY A;  5HRO B;  4OI4 A;  5LMU J;  1HI0 P;  4KKO B;  5KFN A;  4C8Z A;  4P2X A;  3FEX B;  2ALZ A;  1CS4 B;  2Y1R I;  4BC7 A;  2OEK A;  4J9S A;  3DLL Q;  1NO8 A;  4WBF A;  3HHL D;  3T6J A;  3BGU A;  4QQB A;  1XMB A;  2M4M A;  3TJA A;  4Y28 C;  1UFL A;  4TY8 A;  3DDN A;  4UUW A;  4DX7 A;  5LL6 d;  1WI8 A;  3OL8 A;  4IOB A;  4LRE A;  4J9V A;  4IG0 A;  1S4F A;  2JLE A;  2LQJ A;  2OO4 A;  4MIB A;  3PW7 A;  3F73 A;  3QIP A;  2ROE A;  2MQP A;  2BKN A;  1PCA A;  2DIV A;  2UXD F;  5ETV A;  1DTT A;  1N5Q A;  2EG2 A;  4O44 A;  4ED0 A;  2VG5 A;  5DQI A;  3KMS A;  2YPZ A;  4AL7 A;  3BR8 A;  5E0O A;  1OQ6 A;  2ZKT A;  3C19 A;  2YWG A;  1SKR A;  4NOH A;  2HHQ A;  4CNZ A;  2E29 A;  3NS6 A;  1VBY A;  5A0Y A;  1NDK A;  2FYX A;  4D3H A;  4A48 A;  4H4M A;  4OYB A;  2IVF B;  3QT5 A;  4FF2 A;  1TKX A;  3GMG A;  4ZIT A;  2EC2 A;  1Q79 A;  4GO7 X;  5M2U A;  5ITH A;  1VK8 A;  1AXQ A;  3G6X A;  2B56 A;  1NKC A;  2D7S A;  2VDH A;  3IG1 A;  3QRQ A;  5L1K A;  2XYG B;  2J9E A;  4IG3 B;  3M9M B;  3OVA A;  2FB0 A;  2ZWP A;  1B4S A;  1X4H A;  3BPS P;  3GIR A;  4NZ6 A;  4P52 A;  5KFB A;  3EYZ A;  4ATN A;  3GJS B;  1VHF A;  1FJG J;  3KLI B;  1EET B;  3PO5 A;  4FKX A;  2GV1 A;  2DO0 A;  1S97 A;  4CLL A;  2P8I A;  2V67 A;  1S1V A;  1IBL J;  2LKZ A;  1XQI A;  4DR1 F;  4QPT A;  4ED2 A;  1YX2 A;  2DH8 A;  3TYT A;  5KG0 A;  5C25 B;  4M5J A;  1X4D A;  5JVG Q;  1T0T V;  3NKY A;  2FLL A;  4ZVS B;  2G2Z A;  2MY8 A;  4TKT A;  1KN6 A;  1N5Y B;  3AQP A;  4MFB B;  1YWX A;  4IOA Q;  2E1C A;  2MPU A;  3IXQ A;  5F3T A;  4BC9 A;  1Y3K A;  4OIX A;  3MPY A;  2ZZM A;  3EZ5 A;  5J2N B;  4USH A;  1EQM A;  2B9X A;  3CJK A;  3EMT A;  2N3O A;  4NXM F;  2UVW A;  2Z58 B;  4NML A;  2PMZ D;  1VQO S;  1UET A;  1YIJ S;  2OPR A;  3HHK A;  2HS4 A;  2KXH A;  1DQ8 A;  2MYF A;  4ICL B;  1N32 F;  1FCA A;  4DFJ A;  3DLE A;  5K14 B;  2ZE2 B;  2B6A B;  1KFS A;  4ZN3 A;  1SQF A;  2EXU A;  5K5M A;  4RNF A;  4AXI A;  3UN3 A;  4P6Q A;  4RLE A;  4X4R A;  3OL7 A;  3JSM B;  4EBC A;  1TUV A;  1JMT A;  5EX0 A;  1FDA A;  2UVU A;  1RT7 B;  4MKV A;  1RWX B;  1D9F A;  3HD2 A;  2C2M B;  4QW8 A;  2RDI A;  2PII A;  1OPZ A;  2KYZ A;  4UY8 5;  4JI2 F;  3G8S A;  1CJK A;  5BYS A;  1WEY A;  3N6L A;  3TAN A;  4KGZ B;  1IKV A;  4W4M A;  1PO6 A;  3HFZ B;  5A8R B;  2BUN A;  3MXH P;  5KG7 A;  3G8T A;  4EZ6 A;  3VVU A;  4DU7 A;  2MQ8 A;  3SCJ E;  3VQS A;  1HNW F;  3D9B A;  1N6Q B;  3DHW C;  4KGK A;  4WTY A;  2MGZ B;  3BYP A;  2W8L A;  1N48 A;  1BHN A;  3H2L A;  2BAN B;  2OFH X;  2K1R B;  4QIE A;  2XY5 A;  1NJX A;  1S0M A;  2ZJQ Q;  3RZA A;  3SXL A;  3MUV P;  5CYM A;  1E6V B;  1UEK A;  3FRZ A;  3LPE A;  2C3U A;  3O6Q A;  2NPI A;  3FEY B;  2KFZ A;  3M32 B;  1DZ5 A;  4UY8 T;  2E7V A;  3LAK A;  1AFJ A;  3KHH A;  5DG7 A;  1HMV A;  2K2P A;  3IWX A;  2XCA A;  4E2F B;  4LR9 A;  3RTV A;  4HKQ A;  3ISZ A;  5ETN A;  1BQN A;  5AT1 B;  3OHA A;  5J2P B;  3OTD A;  2NXJ A;  1R8C A;  5T7L B;  3UD5 A;  1M1G A;  4TQS A;  4WJB A;  4ZVF A;  5JJB A;  4ER8 A;  2MZJ A;  1GNK A;  5I3P A;  4TLQ A;  1W25 A;  4FS2 A;  1QSY A;  3UVJ B;  4NZ0 A;  4OJ1 A;  4DV6 J;  4ZP6 A;  4DX8 H;  4WZM A;  2OML A;  5JMN A;  1XMQ J;  2VA2 A;  4ES2 A;  1JB0 C;  1S9E A;  1KKH A;  5F8I A;  5HN0 A;  4U96 A;  2CQP A;  1HNV A;  1FXL A;  1OYD A;  2P5V A;  3ET6 A;  4FPI A;  1GQE A;  1I94 F;  1BUX A;  3C6T A;  1GTE A;  4PWW A;  2AGP A;  1IR0 A;  3RAX A;  1LWE B;  3CDB A;  4NRT A;  2HFN A;  2IAJ A;  2RQC A;  5LOQ A;  1BQX A;  2VKZ G;  5F8N A;  2FD2 A;  3ZC4 A;  2VPY B;  2OI2 A;  1ZTW A;  2FIU A;  4USW A;  5L38 A;  1RT2 B;  1WG5 A;  2CWK A;  4HAC B;  1RIS A;  1DHM A;  2V68 A;  4N76 A;  2VF3 A;  2KT3 A;  3C6U B;  5F8G A;  2HHH F;  5E3A A;  1LWX A;  5A8W A;  1IBK F;  2LQ5 A;  1DY3 A;  5CHC B;  1RT5 B;  2CNN B;  5SZT A;  4O3N A;  2XB2 D;  2EWH A;  2B9W A;  1IN0 A;  2AKW B;  4KAI A;  2PDA A;  5C2G A;  2D74 B;  1H7X A;  3BDE A;  1X4C A;  4IYQ A;  3W66 A;  5C7P A;  3B4D A;  2DGU A;  3NL0 A;  4ECQ A;  3DRP A;  1IKX B;  2BX6 A;  2HAI A;  3ZZZ A;  3DHX A;  3GU0 A;  1G4C A;  1SQE A;  2MTL A;  3TUP A;  2HVH A;  2XI3 A;  2YWH A;  3PHT A;  1HR0 F;  1T8E A;  2E5L F;  1DUR A;  4GO5 X;  3FBE A;  1RKI A;  3EDQ B;  4M1K A;  2QV6 A;  4O4G B;  1PAU B;  3I0S B;  4KGX B;  1R43 A;  3R2C J;  4NWB A;  3QLH A;  4H54 A;  4NX9 A;  1U6B A;  4KH1 B;  2ACM A;  3K58 A;  5HQL A;  3OQ2 A;  2Z57 B;  3DLG A;  3EXC X;  4NA1 A;  5IT4 A;  4ED6 A;  3CCU S;  1S0N A;  1BD6 A;  5HAN A;  2G0I A;  2YKM A;  4CM0 A;  3DXB A;  2HUR A;  1RB0 A;  2GFF A;  3MMC A;  4YDD B;  1FF2 A;  1HLW A;  1SC6 A;  1WEL A;  4Q8F A;  4IH6 A;  3HUL A;  1XWL A;  2V5H G;  2EFN A;  1MG7 A;  4ZVU B;  3W9J A;  2OMO A;  2WOM B;  2VQF F;  1WHY A;  4MIW A;  1N34 F;  3F41 A;  4KFB B;  2CDR B;  2CQ1 A;  3HD1 A;  5E33 A;  4DCJ B;  1FEE A;  2QL5 B;  2I5J B;  5KT5 A;  2BE2 B;  3SFU A;  2PI4 A;  3HLU A;  3DOK B;  1M5O C;  1IQT A;  2XS7 A;  5EWF A;  3MTK A;  2GC8 A;  2AJ0 A;  4X4O A;  2HHV A;  4OX6 A;  3BDP A;  4ERD A;  1U1O A;  4MKB A;  2OFG X;  5DM6 Q;  4DPU A;  2A6O A;  2YQ1 A;  1RBO B;  5LMN F;  4NLU A;  3S7R A;  4JI1 F;  1FKO B;  1T95 A;  3LP2 B;  3DGP B;  1S1W B;  2QX0 A;  3LAN A;  2C3M A;  2LXI A;  2Z2L A;  3TJ9 A;  4K4S A;  3TWZ A;  5I3U B;  1U6F A;  2ZNY A;  2APO A;  5KFY A;  1R8A A;  2NUH A;  3FC9 A;  4DV4 F;  3DMJ B;  1DFD A;  4PG6 A;  3QJL A;  2VFS A;  3PVX A;  3AH6 A;  2YNG B;  1R0A B;  2OKQ A;  4X64 F;  2DHA A;  1P6T A;  5C24 B;  3AXK A;  4Q0B B;  3MEE A;  3CCE S;  2G13 A;  1GH8 A;  4AXJ A;  2CQ0 A;  3V6D A;  4OZL A;  3T9Z A;  4O3S A;  4J9U E;  5KT3 A;  5J2Q B;  4K4U A;  3RW7 A;  2AD9 A;  2DNK A;  3SQG B;  4I2P A;  1IBM F;  2J9D E;  1JKH A;  5EHH A;  3U1L A;  4DQR A;  5KFW A;  4MK8 A;  5AXN A;  2MLX A;  3BQ0 A;  2F4V F;  3GWC A;  4O0N A;  2C3O A;  3GFY A;  3W2V B;  1M5S A;  3CC7 S;  1TMJ A;  3BH7 B;  3R97 A;  3HVT A;  3NY0 A;  2COL A;  8RUC A;  1R0B G;  1TL1 A;  2Y1I A;  2KI2 A;  3M8S A;  2JEF A;  1GFW B;  1S12 A;  4CLK A;  4RW6 B;  3PG9 A;  3MM8 B;  1EP4 B;  1U0S A;  2EK1 A;  3LO3 A;  2E1P A;  1T02 A;  4PWD A;  3D6M B;  4OYZ A;  1QLN A;  1DAX A;  2DR9 A;  1ZA1 B;  4B9L A;  2XWX A;  1O6X A;  3H4D A;  2UVR A;  4URS A;  2X1A A;  3THP A;  1X4F A;  4WFZ A;  2J8A A;  2HBY B;  2AZ1 A;  1FNM A;  1RP5 A;  1N5T A;  1RT6 A;  4NXN F;  1LWF A;  2CJY B;  4F4Z A;  2UXB J;  2KG1 A;  3UNG C;  1NU4 A;  1YIT S;  2FC8 A;  4OYW A;  1FTR A;  5KFR A;  5C42 B;  4J9R A;  1YI2 S;  3UDV A;  3BSN A;  4L73 A;  4HT7 A;  2XSJ A;  1GXU A;  3NNH A;  4TU8 A;  1WF1 A;  3HHL C;  5LSO A;  4ILR A;  4DR6 F;  1SL1 A;  1S6U A;  4JI3 F;  1YZ7 A;  3Q8P B;  2H5E A;  2YKO A;  4ANC A;  2JHE A;  1IBC B;  3CPW R;  4DHV A;  1SC3 B;  1JXL A;  1NBE B;  4K50 A;  3I82 A;  4ZA1 A;  4QWC A;  3T1Y J;  3IAM 9;  4FYW B;  3NG8 A;  3OHB A;  3KK3 A;  1EIY B;  3JB9 k;  2C3P A;  2ZH4 A;  3PYD A;  4B3O B;  3HPO A;  4LFA J;  2FVR A;  1OIA A;  2M3D A;  5KAK A;  1JJC B;  4BLG A;  2R7O A;  3HSG A;  2ZVI A;  3R7S B;  1UL3 A;  4CCH A;  4PWU A;  5HVG A;  2A2C A;  4BWM A;  4FN5 A;  2WAQ D;  2P9C A;  1TUG B;  5KG1 A;  4J90 A;  2BJ9 A;  2C28 A;  3UWT A;  4H4K A;  3J81 U;  5CYQ A;  2PFF B;  5KG6 A;  4CLT A;  3KNG A;  2V69 A;  3MED A;  2BAC A;  2J6S A;  4ZLN A;  2MZQ A;  3Q0A A;  4JV2 A;  4EMD A;  4K8R A;  4CH7 A;  5HMX A;  1UPM B;  2W01 A;  4UUX A;  2Z2M A;  3KG0 A;  2M70 A;  1VQL S;  2QLX A;  4O3P A;  3KLF B;  4N7T A;  4DL2 A;  1KLM A;  3UDE A;  3AJD A;  4DL5 A;  3K2Y A;  5ETK A;  3BSA A;  4WU2 A;  5KFI A;  3KWM A;  5FJ4 A;  4JV5 J;  3QMQ A;  4C8O A;  1B3T A;  4D3G A;  4JI0 J;  1BGX T;  2VBW A;  2ZOG A;  3K0J A;  1IBL F;  5LJ3 Y;  1KR4 A;  1RU2 A;  2MKK A;  1Y5N B;  2VQE J;  2PT0 A;  1A7G E;  4L74 A;  4DQI A;  1NSQ A;  3QGG A;  4R25 A;  3M2R A;  5IQQ A;  4N56 A;  1K0T A;  4CO4 A;  4QPX A;  1S1X B;  2AQ4 A;  1F9H A;  2GML A;  2FJX A;  4P10 A;  1VLO A;  3WDO A;  3OPK A;  3OVS A;  3OTE A;  1ZM9 A;  2V2V A;  1NK0 A;  2NLW A;  2IHR 1;  3M9N B;  3HSJ A;  4JI5 J;  3VCD A;  5KFT A;  4WII A;  3HDS A;  2E5J A;  2LMI A;  4I6Y A;  3CT9 A;  4F4Y A;  3MM7 B;  4OI6 A;  5IV3 A;  1J2V A;  3C16 B;  1VLY A;  2GJ2 A;  2CJA A;  2XGP A;  1VC6 A;  1TFW A;  2NXN A;  4AD6 A;  3HT0 A;  1KQF B;  5F8J A;  4OI2 A;  5T41 A;  2KHD A;  3N4W A;  4YY3 J;  1RWM B;  1JLG B;  1TL5 A;  5I42 A;  4TQR A;  5JUM A;  3KJV B;  2AW0 A;  3M1V B;  4F7V A;  3FSX A;  2KTQ A;  4JI8 J;  3QFH A;  2B5J B;  1S6P A;  3L09 A;  4X66 J;  1CUL B;  1C0U B;  3MAA B;  3MPV A;  3CSK A;  2IDE A;  2V2K A;  4WIQ A;  5B09 A;  2L9D A;  5J1E A;  2ZC4 A;  1SH2 A;  2JC1 A;  3DU6 A;  2MKS A;  3GJQ B;  1GX6 A;  1F5A A;  2MQL A;  4KR0 B;  3QO9 B;  4ZVR B;  4C2M A;  2Y8Y A;  3RRH A;  2OPQ A;  2XYP B;  1BMQ B;  2EKN A;  1RTJ A;  3T6B A;  1IVZ A;  2IRX A;  3S8S A;  3X1L B;  1TVR B;  4Y3C A;  2XSF A;  4DV3 J;  4ZHR A;  5D77 A;  1DJ0 A;  3KLI A;  3TX0 A;  1CPZ A;  3BO3 A;  4PQU B;  1EET A;  1T9Y A;  4HHH A;  3GYN A;  4M5N A;  3CW2 C;  3MOJ B;  1QM9 A;  4ETX A;  2OTJ S;  1HI1 A;  1VQ6 S;  1UVJ A;  1L3S A;  2RSQ A;  3BS9 A;  4QYZ J;  1N52 B;  3SIP B;  1RBA A;  3KYL A;  1X9M A;  1OO0 B;  2VFT A;  4RZR A;  2PGC A;  3DOL B;  4U9R A;  4FNH A;  5H9F K;  3UCG A;  4WP3 A;  3V4I B;  1HKA A;  4EEY A;  4KGV B;  3T5J A;  1OMS A;  2B4O A;  4K4T A;  4YOE A;  1DBD A;  3VHQ A;  2QE5 A;  4WYW A;  5KFO A;  2CJ9 A;  3MR7 A;  1WOS A;  3VAL A;  2HQC A;  1TKT A;  3T5L A;  1ROF A;  4OMF G;  4PYA A;  2V4Q A;  2HPU A;  3HJF A;  3DXS X;  5ETT A;  3EGV A;  4DZ6 A;  5CQG A;  2NCK L;  1C1C A;  4B9V A;  1UEU A;  4M95 A;  1TV6 B;  2Z2Y B;  4I56 A;  4C97 A;  4CLY A;  5IFM A;  3I5B A;  1KTQ A;  4Q45 A;  3GJT B;  1VR6 A;  2NZC A;  3NS7 B;  1H6K X;  2DXF A;  2HGL A;  2VZ9 A;  1WC5 A;  5K8N A;  3R9L A;  1PC4 A;  4MMO A;  4BS2 A;  4FP9 A;  3TAP A;  2DD8 S;  2CPI A;  3MAH A;  2IBK A;  4NYO A;  4FS1 A;  4G1Q B;  3N79 A;  2G1H A;  3VGV A;  4J5O A;  3ZNU A;  5MLC V;  2Q6B A;  3FCW A;  2DIT A;  3TVZ A;  5KG4 A;  2JEJ A;  3O3L A;  2RDJ A;  2IRU A;  2GO9 A;  1Q53 A;  2YWW A;  3OD2 A;  3SDE A;  3D0I E;  2HVI A;  6AT1 B;  1R6V A;  1YJU A;  5EUH A;  3PYF A;  2RKI B;  2DGT A;  2OH2 A;  3D28 A;  1VQ5 S;  3VTI A;  3R5J B;  4OX8 A;  3KJF B;  1YJW S;  3M7V A;  4K2X A;  1L3U A;  5J1N A;  1B0P A;  1L5U A;  2WSF C;  4KGM A;  4DWI A;  2MKI A;  3ITH A;  5B0A A;  2MJN A;  2QLW A;  2X51 A;  3CE8 A;  2G2O A;  3TQE A;  3W61 A;  2CPH A;  1VRT B;  4LRF A;  4ID5 A;  1YRT A;  1HL6 A;  1FD2 A;  2Y1L B;  4OJ3 A;  1X7V A;  4ZPA A;  3LGN A;  3KDN A;  5F0U A;  2FVQ A;  4DSL A;  3MEG B;  2CQG A;  4DR7 J;  1XR7 A;  1GT8 A;  2ZH9 A;  4KIA A;  4YB5 A;  3PM9 A;  5BR8 J;  1FX4 A;  4OHV A;  2V9W A;  3CIM A;  1HWK A;  1EZZ B;  2BAN A;  4WPA A;  3I4H X;  2K1R A;  1KC8 T;  3CJT A;  2GHV C;  1WC6 A;  1GXL A;  1VRU B;  2KYX A;  1RTH A;  4ECX A;  5HMZ A;  2YNF B;  4UOC A;  4MH8 A;  2UXC J;  4FF4 A;  3NEK A;  1V3R A;  4RBT A;  2D3Z A;  2BW7 A;  5FII A;  3Q8Y A;  3W1Y C;  4EUV A;  1SXL A;  1H0H B;  2QFJ A;  1RHR B;  1FRH A;  2RT3 A;  2HW3 A;  5J2P A;  2BZ2 A;  2CG8 A;  3G87 A;  4CM2 A;  4QIF A;  3FCH A;  3DN9 A;  5DZ7 A;  2GQC A;  4IRK A;  2WBR A;  4ES3 A;  1Q4R A;  1Y00 A;  3N5F A;  2V4J B;  1T03 A;  3EWG A;  3UCZ P;  2XG8 A;  4J9N A;  4J37 A;  4OFZ A;  4IRD A;  4YME A;  3BZQ A;  5L8R C;  4ZVE A;  3THT A;  1YBU A;  4NLD A;  4LQ3 A;  5E5N A;  1DTQ A;  4XTT A;  4DUY J;  2PFD A;  2FPH X;  3J80 Y;  2RS8 A;  2ZEJ A;  2XNR A;  3D6F B;  1NM2 A;  3D0G E;  1RHK B;  2RQ4 A;  1N4L A;  3BGO P;  1LXJ A;  4F02 A;  2ZDO A;  3JTN A;  2UUC J;  1LWE A;  2HHX A;  1Z2Z A;  3OL9 A;  2BJD A;  4R8U A;  2LDY A;  1FDB A;  3DLB A;  1JLC A;  4WFN Q;  1RT2 A;  2QLJ B;  2AGO A;  4OHX A;  5HBM B;  3RU0 A;  1B0T A;  3A8I A;  1SI9 A;  2R2U A;  3JYT B;  2NSB A;  3RR8 A;  4ZLJ A;  2JRS A;  4J9K A;  2A2D A;  2NUU G;  3K5P A;  1F2G A;  2C2N A;  2F65 A;  4M5D A;  2ABY A;  3D67 A;  4RWX A;  1K1S A;  3IGN A;  5DG8 A;  4AQY J;  2M88 A;  1R8H A;  3PHE A;  3M6V A;  1LWC A;  4M94 A;  1M5V C;  4JYA J;  1VFJ A;  2CJX B;  1WNE A;  4KO0 B;  3TZY A;  2ZD1 B;  4IRC A;  5KFG A;  1IKX A;  2FY8 A;  3ZTP A;  3DLK A;  3AD9 C;  4YUD A;  1Z1Z A;  2HQI A;  4UOH A;  4RUH A;  2E44 A;  2WVF A;  1XR5 A;  4DMZ A;  4KY3 A;  2I9S A;  2VIH A;  3IBW A;  3GCW P;  3C66 A;  2PEB A;  1O5J A;  5FLX U;  1UEV A;  2HIQ A;  1ZM3 A;  3IC1 A;  5HJX A;  2PN6 A;  3D1H A;  1U0H A;  5T14 A;  3UD4 P;  2CG4 A;  2WHO A;  2MDA A;  2R2R A;  2E1M C;  1X9S A;  2XEX A;  3CCM S;  1RAA B;  2MZ1 A;  4DX6 A;  3NGK A;  4DV7 F;  3TI0 A;  1YJ7 A;  1RT1 A;  1OSD A;  4DL3 A;  1RT3 B;  4ZPV R;  3JQM A;  4LUB A;  4L6V 3;  2FUG 9;  4LFB F;  1TQL A;  3SMZ A;  4J9L A;  4A8O A;  3SI8 A;  2Z4P A;  5K20 B;  2YX1 A;  4OYA A;  1U1R A;  3QRR A;  3VQT A;  1AW0 A;  2CAJ A;  2GGP B;  3QBC A;  7FDR A;  5D3G A;  4B3R J;  2HFV A;  2FGC A;  2WK4 A;  2ZOM A;  1FFG B;  1OPI A;  4ED8 A;  2WOM A;  1FK9 B;  3T3F A;  4IR9 A;  1T3O A;  3I6P A;  2D41 A;  2HFS A;  2ZNZ A;  1DLO B;  2BE2 A;  4CI0 B;  4HI2 A;  2WW4 A;  4QR2 A;  3DOK A;  3W5X A;  5HK4 A;  3K5M A;  1HBN A;  3TO8 A;  4P7T A;  2F40 A;  4F25 A;  1TZ0 A;  5KFX A;  2QA2 A;  1VQ9 S;  4EWT A;  3JTP A;  2W1B A;  1UZD A;  4ED5 A;  5HJY A;  2UXD J;  5B7W A;  3ULH A;  3DRY A;  4K4X A;  4NLP A;  3M8Y A;  4QOT A;  1EKR A;  2ZH5 A;  2YNI B;  2GJF A;  4CLZ A;  1S1W A;  2L9W A;  3QGI A;  3HP6 A;  1HWU A;  3QYY A;  2PEH A;  2UUB J;  1NRK A;  2HWH A;  4OV1 A;  3H42 A;  2BQR A;  2DHH A;  1IR1 A;  1C2P A;  3CCW A;  1FNO A;  2BJ8 A;  2A10 A;  4B3M F;  3A12 A;  1YBA A;  3DMJ A;  2HWI A;  5A2Q U;  4MKA A;  4R5P A;  1HBM A;  2I1R A;  4URQ U;  2R7V A;  2XZD B;  2XNQ A;  3CGI A;  3CJR A;  4DUT A;  2KXN B;  1OSC A;  1TL7 A;  2XYH B;  4PPD A;  5F9N A;  5KFC A;  3MR2 A;  3Q2S C;  2WSE C;  3R5B A;  1CJU A;  4RW7 B;  4LFA F;  4QR1 A;  4Q44 A;  1RAO A;  1Q5V A;  5E41 A;  5ETP A;  4LR8 A;  3D1O A;  1PIL A;  5KTQ A;  2J7U A;  1HQU A;  4ECT A;  2DB1 A;  1NK4 A;  2NQP A;  3G82 A;  5B0B A;  3TUZ C;  3BR9 A;  2PE8 A;  1PC5 A;  3DRS A;  4U7C A;  2XS5 A;  1RUS A;  2CQ4 A;  3Q8V A;  3M2U B;  4ED3 A;  3MD3 A;  2QRR A;  5EWE A;  4DR1 J;  3I9Z A;  1CJT A;  1WHW A;  4BDP A;  5CZX A;  4HL9 A;  3BQ1 A;  2VL1 A;  1KNZ A;  2AF6 A;  3W65 A;  1HFE L;  3MMB A;  2MKY A;  3HI9 A;  2J9D A;  1QVG R;  1H72 C;  5G0R B;  5HAO A;  1FWP A;  1LW2 A;  4JUZ A;  4L72 B;  3MAQ A;  4NLS A;  2PMW A;  2K7J A;  1VS3 A;  4HHU A;  3L3C A;  4P2F A;  3VAF A;  5D0E A;  3S6E A;  3PX0 A;  4HDG A;  2D1C A;  1R6Y A;  1VRQ C;  3QSY B;  2VD3 A;  2XZT B;  3SSS A;  5F0W A;  1JLB B;  1SL2 A;  2JFK A;  4JV5 F;  1WHX A;  2DEJ A;  2E9Z A;  4Y2M A;  2LXU A;  5HL7 Q;  2EI5 A;  2O3D A;  1G6B A;  3GPA A;  4KV8 A;  2VQE F;  3P45 B;  2ILY A;  2ERR A;  2FZG B;  4QYZ K;  1FA0 A;  1RE1 B;  4USK A;  4U7U D;  3K5O A;  3DC2 A;  1N32 J;  3DCA A;  2IVY A;  2B4V A;  3DRX A;  4DG1 A;  1NK7 A;  4ZMM A;  2WSC C;  5DZ6 A;  3QNW B;  2Q79 A;  4K59 A;  4DR2 F;  4UST A;  4OLP A;  3KK2 A;  4A8W A;  3I5C A;  2IY5 B;  1LFP A;  4DPX A;  4A8X A;  3MDF A;  5IT9 Y;  4NLX A;  3P3D A;  2ZDP A;  4XK8 C;  1FRK A;  2W9B B;  1MRO A;  2HNZ A;  1S4E A;  2HHP A;  1YJV A;  2CZ4 A;  4R0E A;  2BE7 D;  3QQC D;  4DDF A;  3UDC A;  2XC9 A;  2RH3 A;  3GIJ A;  4M5M A;  2DR6 A;  1S72 S;  3V6J A;  2FVC A;  3CXC R;  2ZVS A;  2H51 B;  2KKH A;  3PAC A;  4ZCK A;  2EFO A;  2ZBQ A;  2AX0 A;  1HNW J;  2W4D A;  2Z0G A;  5IM0 A;  5E7O B;  2HHW A;  5AE3 A;  1S6Q A;  2J7K A;  3KFW X;  3DM2 A;  1CBK A;  2RF2 B;  2G4B A;  2KZM A;  2ZZT A;  1JLA B;  2RRA A;  2XHW A;  3M8Q B;  3K5N A;  4X4T A;  4Y2C A;  3SV4 A;  3NGR A;  4K4V A;  2OD4 A;  1QVF R;  3FEZ A;  5AXL A;  1CVJ A;  3RB3 A;  1WJ9 A;  4W92 B;  5KFK A;  1T3N A;  3EUN A;  4FVC A;  4DV3 F;  3A13 A;  2QGF B;  1HQE B;  3EZU A;  2JL9 A;  5F41 A;  3RBX A;  2M8H A;  4RW9 B;  5D15 A;  3IP0 A;  2OPP A;  3O1L A;  3BGF A;  3NWG A;  1NH7 A;  2G2Y A;  4NCB A;  2LU1 A;  3H90 A;  4CO3 A;  1WSR A;  3EVO A;  1IM6 A;  3M30 B;  3LQV A;  4OHZ A;  2QN6 B;  3KLH B;  1N36 F;  3IBC B;  2ZZN A;  1PYT A;  1QSL A;  4G6V B;  1F5C A;  4FKY A;  4ZP7 A;  1JLE B;  1U1N A;  4K4Z A;  1SKS A;  4I2Q B;  1G7C B;  2IC3 B;  2R2T A;  4XAK A;  4GVB B;  2GO8 A;  3UDL A;  1S57 A;  2DHS A;  3GON A;  2JNJ A;  3CDA A;  4K0K J;  1X5S A;  3PV8 A;  4NYZ A;  3KDO A;  2HGN A;  4OX9 F;  3CJ2 A;  2GQ2 A;  2DJW A;  3AOB A;  2DHG A;  4JI6 J;  4ZIW A;  2O66 A;  1HWJ A;  3CCS S;  4IQX A;  3KLG A;  1ACM B;  2Y8W A;  1WF0 A;  2HQG A;  3JQJ A;  4OQJ A;  2QA4 G;  4NZ7 A;  1NUE A;  2A3J A;  5HLF B;  3PJ9 A;  3GSI A;  4MJK A;  1U2F A;  1WEZ A;  5GVQ A;  4CYU A;  2V8D A;  2MQM A;  1M5P C;  3QGH A;  1MML A;  3V81 A;  1NJW A;  4ZCI A;  3OL6 A;  5DDR C;  1NDL A;  1WF2 A;  4P7V A;  3AOA A;  2FY1 A;  1RWO B;  1IBK J;  3CUL A;  2MST A;  1REV B;  2ADC A;  3B6B A;  4EK2 A;  4QIW D;  1JIH A;  4DPY A;  4WK3 A;  3JTO A;  1SV5 B;  2UV8 A;  1XNR J;  3GFH A;  3C14 B;  4FBU A;  4FXW A;  1YG0 A;  4IFY B;  1PJ6 A;  1N33 F;  5KFA A;  1NDC A;  3MCO A;  5CH7 B;  2J7W A;  1GX5 A;  1ZAV A;  3FKB A;  3AQO A;  2HBR B;  3PX4 A;  2BJ1 A;  4NCG B;  2AJQ A;  1FNX H;  2C2E A;  3H2U B;  2R8I A;  2HLU A;  3MGJ A;  2EFQ A;  2BQU A;  4K4W A;  2IBO A;  4PQU A;  1TL4 A;  1U25 A;  4WE1 A;  2QFI A;  3HCX A;  3OXG A;  1XIQ A;  1U09 A;  2LVW A;  3W2W A;  4LF6 J;  4G1P A;  4DSE A;  4ECU A;  1WKL A;  1VIX A;  1JXV A;  2G9O A;  2RVJ A;  1TK0 A;  4RBV A;  5KFE A;  1HQ2 A;  5BR8 F;  4RR5 A;  3LPY A;  3DOL A;  3TVY A;  1Y11 A;  3MFI A;  2HVE A;  3QRP A;  5DDO C;  2K3I A;  1YRU A;  2J5A A;  3TP2 A;  1JX4 A;  1T11 A;  1JLQ B;  5D4P A;  4CNY A;  2K8G A;  3M4X A;  4ZLP A;  1RWP B;  1RWN B;  3VZI A;  3O8W A;  2DO4 A;  1AT1 B;  5E3Q A;  2RQM A;  2PA8 D;  1GK8 A;  4IR1 A;  1N34 J;  1N5S A;  3IR5 B;  3QWU A;  3TA0 A;  1HPZ B;  3AT1 B;  1EHW A;  2AJ2 A;  1SC4 B;  4ECZ A;  3CF5 Q;  4O0I A;  1UFW A;  3TAM A;  2Z2Z A;  2RE1 A;  2CJB A;  1XMO J;  2KHC A;  5GAG I;  2YH1 A;  1U1L A;  5GAD U;  1BWE A;  1C4C A;  1JNR B;  1EJ7 L;  1N0U A;  2VDI A;  1F6T A;  3KLE B;  3CNQ P;  4C8N A;  3MM9 A;  1WG1 A;  1F3V A;  3QWP A;  3JAM U;  3QAU A;  4NE9 C;  3UR0 A;  2XGQ A;  2JLG A;  4OI0 A;  3DKD A;  5LMN J;  1Q8I A;  4AT1 B;  1Q95 G;  4BCA A;  3W60 A;  1DAR A;  1GMW A;  3GLJ A;  2CQ2 A;  4OHW A;  2UUT A;  5F8M A;  4PG5 A;  2RKI A;  3D68 A;  5FD1 A;  2H4Y B;  3CED A;  1V5I B;  2JC0 A;  4N8N A;  2ATC B;  2DGW A;  2QSW A;  3GG1 A;  4DV4 J;  4EYH B;  4RBU A;  2CPF A;  4KH0 B;  1SKU B;  3DI6 B;  4USM A;  1RU1 A;  1C4A A;  3UI3 A;  3Q24 A;  4X64 J;  2JX2 A;  4Z7Y A;  5A8K B;  3R5C A;  1KDN A;  1UW4 A;  5FDL A;  2H5I B;  3DFE A;  1IWA A;  2JSX A;  1VRT A;  2HFZ A;  4UQT A;  3TAQ A;  2VKR A;  2HNY A;  2X1G A;  2HFO A;  1YVF A;  4ZPT R;  5DQG A;  3PEJ A;  2FHJ D;  3C3L A;  3ZTS A;  1CQN A;  2ACY A;  2H48 B;  4CT8 A;  2QO3 A;  4P2S A;  1E6Y A;  1KHV A;  4NRU A;  2YX4 A;  1C1B A;  3D5M A;  1TU0 B;  3ETM A;  1O8B A;  3NCR A;  1T05 B;  2BJE A;  4TNO A;  1OQ3 A;  2F4V J;  4TYA A;  2QLB B;  4LFC F;  4J9M A;  4DV2 J;  3SYZ A;  4M5K A;  1U8S A;  2B7B B;  2XMT A;  1J27 A;  3HF5 A;  4JYA F;  1MU2 A;  1Z2L A;  4YB6 A;  3J81 j;  3BJY A;  3DYA B;  2NS1 B;  3N28 A;  1A9N B;  2EPI A;  1AZS B;  2GJI A;  2MLZ A;  2XI2 A;  2UZA A;  2CQI A;  1GMU A;  5KFZ A;  1SJ3 P;  3G9C A;  1PIE A;  1WEX A;  2VG6 A;  2XMV A;  2OEM A;  1IKY B;  4DFP A;  3OV7 A;  4F8R A;  2ZBI A;  2X3D A;  4DCO B;  2AYE A;  1WKJ A;  2V63 A;  5MAO A;  2HG4 A;  2IM2 A;  1JLF A;  1WC3 A;  2JLF A;  2YWE A;  5D0R A;  4LJM A;  3D3B J;  4U6P A;  1QJH A;  4DZD A;  3C8Y A;  4TY8 B;  1F2H A;  2I38 A;  3CD6 S;  3NLC A;  4IG0 B;  3A8J A;  3B78 A;  2B4U A;  4TN2 A;  2CJK A;  3H40 A;  3MUT P;  5CYJ A;  3QIP B;  4B3R F;  4CZC A;  3NCP A;  1OWX A;  3V6K A;  3SZ2 A;  3G71 S;  3ADA C;  1VDH A;  2WVC A;  2VG7 A;  1DTT B;  1LEO A;  4DR6 J;  2W8K A;  5EWG A;  1VHI A;  4IOC Q;  5BJR A;  4O44 B;  3KUE A;  4JI3 J;  1F9E B;  1B7Y B;  2VG5 B;  5DGA A;  2EW9 A;  3TEH B;  1I51 B;  1F1B B;  2NPF A;  4ZIV A;  3OTO F;  1HHS A;  5A0Y B;  1S5Z A;  3IS9 A;  1B64 A;  4ZPB A;  2DGS A;  2FZK B;  4H4M B;  1TKX B;  3EIC A;  4DSK A;  3OR2 A;  1R8P A;  3ZXW A;  9RUB A;  5L39 A;  3IG1 B;  2DCU B;  2Y0B B;  3FMB A;  1GEH A;  2UUB F;  1P8G A;  1F9F A;  3HKZ D;  3RB4 A;  1K44 A;  2W24 A;  3AY0 A;  1GMV A;  4BWJ A;  2ZD1 A;  3ZZR A;  2FJV A;  1VIS A;  3JQK A;  4I7F A;  3P5B P;  3A8E A;  3CCT A;  3GV5 B;  2DNO A;  8AT1 B;  1NHU A;  2VH7 A;  2XMU A;  3LAL A;  2O1P A;  2DRD A;  5IOL A;  3HJV A;  1VQ7 S;  4MK9 A;  3BYR A;  1S1V B;  2WZ1 A;  4Z37 A;  2IYI A;  3A8K A;  2CJQ A;  4ZK7 M;  3BBB A;  1CJV A;  2JEI A;  1SL0 A;  2B0G A;  1Y5L B;  3P5T L;  2XMK A;  3S01 A;  5HI7 A;  3V4M A;  1RWU A;  3KXD A;  1VBK A;  3C2P A;  5H9E J;  3B4M A;  3W8P A;  4ZP9 A;  4Z7C A;  3CDW A;  1IJF B;  3DNC A;  1HBO A;  2V34 A;  4RU2 A;  4NLW A;  1YRX A;  3K8W A;  3IR7 B;  3OW2 R;  4DN9 A;  5KT4 A;  1YJR A;  3HFK A;  3U7J A;  3PZP A;  3CJK B;  3NGD A;  1TK5 A;  1KVI A;  4RU9 A;  3BF4 A;  3SCK E;  3MHY A;  4A8Y A;  4LT6 A;  2YKN A;  2DNG A;  2R4F A;  1S48 A;  1X4B A;  5KFV A;  3W7B A;  4TU9 A;  1Q8K A;  3NP5 A;  1FD8 A;  3D6H B;  2OJ3 A;  2WVD A;  4LF4 J;  2F4F A;  2GMH A;  3BKT A;  1YQH A;  5GAE U;  3FDS A;  2HLT A;  2HK3 A;  1KFD A;  2VHG A;  1S9G A;  2ZH6 A;  4RW4 A;  2JDJ A;  4ZPW R;  3DLE B;  3PRV A;  1WOO A;  1S7H A;  4NL5 A;  4DL6 A;  3T19 A;  4CIO A;  4C11 B;  1CQM A;  2F8E X;  2RS2 A;  3TZX A;  4OI1 A;  1U4B A;  4F0K A;  2D9O A;  1TAQ A;  2H4W B;  3G6Y A;  2HRU A;  3RB6 A;  4DEZ A;  1KSP A;  1V3S A;  1VCT A;  1FVS A;  3NMR A;  4GKJ J;  2FTR A;  1RZM A;  2W25 A;  4K4Y A;  4XPC A;  3T5K A;  1CJK B;  1ZYQ A;  1K8A T;  3J7Y I;  3UD3 P;  2QMW A;  1VGY A;  1RA6 A;  2FJA B;  2FHK A;  2EC0 A;  2PD1 A;  4ES1 A;  3LP0 A;  1VQN S;  2LU2 A;  3RUB L;  4PUO A;  5M2R A;  1XNQ F;  1HNI A;  3M2V B;  2KJW A;  3VAI A;  5AXK A;  1SJ1 A;  5HP1 B;  1NAQ A;  3E3X A;  2FJW A;  1X4E A;  4C9D A;  2R42 A;  3NXZ A;  1HBU B;  5B0E A;  5CYM B;  4ZVT B;  3PRB A;  1XN9 A;  2EBE A;  3ZO7 A;  3PTW A;  4ANE A;  4Y34 A;  3SQO P;  1UAW A;  1HMV B;  5IT9 U;  3AB2 B;  4P72 A;  2BXJ A;  4TXS A;  1K73 T;  4LF7 F;  2MZT A;  1U1Q A;  1UZH A;  2CKW A;  2XBP A;  3EGZ A;  4J9O A;  1D3W A;  1IWG A;  2DXE A;  1NPK A;  1BQM A;  3MEC A;  4PKD B;  3FGV A;  3G96 A;  3BH6 B;  4NLQ A;  1N54 B;  3AJ1 A;  1HHT P;  4XIU A;  4I67 A;  3P49 B;  3FSY A;  3G86 A;  1IJE B;  1QTN B;  2FJB B;  2Z56 B;  1RDR A;  5J2M A;  4UTG A;  4PXC A;  3WIU A;  3OFF A;  2AHO B;  3DDI A;  2C2Z B;  2XM3 A;  1S9E B;  1ZA2 B;  3L7P A;  2LP4 A;  4ZN1 A;  5KT7 A;  3UW1 A;  1HNV B;  2CUY A;  3IN5 A;  3ET6 B;  2H5J B;  2AU0 A;  3C6T B;  5GME A;  3E8O A;  3KMQ A;  3U1M A;  1S1T A;  3PY8 A;  3BKF A;  1XJW B;  3FUY A;  3H7H B;  2IAJ B;  4WKR A;  2Q6C A;  1RAF B;  4OZ3 A;  2KDO A;  5LXY A;  4LQ9 A;  4DR3 J;  4HTI A;  2XTJ P;  3GV8 B;  2E9R X;  1OY6 A;  1JWW A;  3PR4 A;  4CRJ A;  3DGV A;  5HQM A;  5AXM A;  3H4B A;  5DET A;  4FDF A;  4PZV A;  3SCL E;  3C15 A;  4K0K F;  3PR5 B;  2CQH A;  2JVO A;  1QUV A;  4DBQ A;  4IFV B;  3LF0 A;  4KYZ A;  2ZM6 F;  3CTR A;  5H1S V;  5AE1 A;  5A8W B;  4HH0 A;  4LRB A;  3OFH A;  3GIK A;  4JI6 F;  2EG1 A;  3GYG A;  3IM8 A;  3MM6 B;  3W3S A;  1R31 A;  2A0F B;  2ZH8 A;  2RUS A;  1FKP A;  1H73 A;  1WC0 A;  3QJJ A;  2HHS A;  2DKO B;  5EDW A;  1UWA A;  2CFX A;  3TW0 A;  1U1P A;  3CJQ A;  1AFI A;  3DRP B;  3G8Q A;  3CCZ A;  2KN4 A;  1RJJ A;  1ZTT A;  6FDR A;  1PGZ A;  2NYH A;  1UFK A;  2B9E A;  5H9F J;  4X4U A;  2GHW A;  4OJG A;  2DNR A;  2D3O 1;  1RTD B;  2CIM A;  3EX7 B;  2L41 A;  2PO4 A;  3LOU A;  4MAK A;  1XNR F;  4MKY A;  1RTI B;  3RB0 A;  2VPX B;  2DNZ A;  1HAR A;  4NYP A;  3IBF B;  2YWK A;  2L08 A;  1FJ7 A;  3RJM B;  1YSJ A;  2BJ7 A;  2ZH3 A;  2RU3 A;  4YDX A;  4AND A;  3DLH A;  4F3Q A;  4PAA A;  3DLG B;  4I68 A;  1D0E A;  1NLK L;  1HQE A;  4ED1 A;  4TVA B;  1PJ5 A;  4AE5 A;  2W9C A;  3D2W A;  2YVS A;  4ZJO A;  1Z4U A;  1R89 A;  5IXU A;  4LF6 F;  1CSJ A;  3WHI A;  3VV2 B;  4KPY A;  4F50 A;  3R5D A;  3QAT A;  1XBW A;  2JH3 A;  1S77 D;  3RR7 A;  1SJ4 P;  2NXC A;  2AGQ A;  3M30 A;  1QAJ A;  4IDK A;  1RGV A;  4QWA A;  2WBM A;  2WON A;  2H54 B;  4WFY A;  3HHD A;  2IC3 A;  3D6T B;  1KP6 A;  4GVB A;  2H65 B;  2Q1L A;  4ED4 A;  2HMI B;  4CTA B;  4RW8 A;  4NCA A;  4MYT A;  4X65 J;  1SH3 A;  2J0W A;  1S1U B;  1D1U A;  2MQN A;  2CZV C;  4X84 A;  5LSL A;  3V5R A;  5KFS A;  4CO2 A;  2WW8 A;  3R5G A;  3DRR B;  3BBF A;  2RIL A;  3ENW A;  2VUG A;  2YNH A;  1OS5 A;  2MXY A;  5D0G A;  2MKJ A;  3IR6 B;  2X3G A;  1WWH A;  2DGX A;  1NJI T;  2JVR A;  3PW5 A;  1RAI B;  1MSW D;  5DLF A;  1XMO F;  4PPZ A;  1KOH A;  2V94 A;  2IPO B;  3HSD A;  3NMA A;  5DO2 A;  4X4Q A;  4NAS A;  1V5V A;  3J7A 1;  2KU7 A;  2RNE A;  1RAD B;  2HS3 A;  3OR1 A;  5LM7 E;  4LSL A;  1REV A;  1D9A A;  2PI5 A;  2E9T A;  2BBE A;  3KUH A;  3MEE B;  1H2U X;  4YR0 A;  4ENO A;  1LK7 A;  2B51 A;  1KLN A;  3FVY A;  4DF4 A;  2O01 C;  3V6D B;  1FKA F;  4M63 A;  2D9P A;  3S1T A;  2QA4 S;  1RAE B;  1RSC A;  2QA1 A;  3WBZ A;  2XMJ A;  3PO4 A;  3KHR A;  4DXL A;  2CVE A;  1QAY A;  1Q86 T;  4WF9 Q;  3RW6 A;  1JKH B;  1UWB A;  3M8P A;  3BGR A;  4DS5 A;  4NI2 B;  5B0F A;  1VQ4 S;  2UU9 F;  2Y9H A;  2PA3 A;  5G4D A;  4A4J A;  3ENA A;  1HD0 A;  3HVT B;  3EE3 A;  3HVW A;  5E2Q A;  2GVD A;  2EKY A;  3JS9 A;  1TL1 B;  4PG8 A;  1RHQ B;  2IA6 A;  4G65 A;  4HEA 9;  4DV7 J;  1YGY A;  4RNO A;  1YJN S;  4HH1 A;  4ZVG A;  4DR4 F;  4DV2 F;  4LFB J;  3IRX A;  3ZZO A;  4PWD B;  2CNL B;  5SUH A;  3PW2 A;  5DJB A;  3KUG A;  2OUG A;  2M2B A;  3LW5 C;  3CC4 S;  1UA1 A;  2HGM A;  1DQA A;  3PRD A;  3HHE A;  1TKZ B;  2JFD A;  3MMA A;  4B3T J;  2HIY A;  1RT6 B;  2VAS A;  1Y4Z B;  2R8G A;  2RU9 A;  4J91 A;  1LWF B;  2YTC A;  3ONQ A;  3FBF A;  1N0V C;  2HND A;  3H5U A;  3LWM A;  2NR0 A;  3Q2T C;  3SV3 A;  3W63 A;  1EAY C;  2XSJ B;  1Q16 B;  1KVJ A;  1MMD A;  5KG5 A;  1VI7 A;  3GP9 A;  3CJ0 A;  2BM1 A;  3KLE A;  2KXF A;  3RBE A;  3HHL A;  1FES A;  2CPD A;  3TX8 A;  5DDP C;  3LWL A;  2NRE A;  4Q43 A;  4OYO A;  4DJB A;  5ADZ A;  3CCQ S;  4EO8 A;  5H9E K;  2VC0 A;  2UVV A;  3VZH A;  2R7S A;  4P2M A;  4YQW A;  1REG X;  3MWB A;  1RT4 A;  4J9Q A;  1RHM B;  2MQQ A;  4PRF A;  4OV6 A;  3KK3 B;  4U8Y A;  2DBB A;  5L1I A;  2V9K A;  1LV5 A;  4CQ1 A;  4ED7 A;  2W2Q P;  4B3M J;  4YB1 P;  1S49 A;  1NH8 A;  2V6A A;  1F60 B;  1SUQ A;  2WVE A;  2MKH A;  3K59 A;  2L9N A;  2IFX A;  2CPZ A;  4LVO P;  2VC1 A;  3T1H J;  1MWZ A;  1U1K A;  3NBP B;  1UVM A;  3TUJ C;  1NJZ A;  4CO1 A;  3W64 A;  1KQS R;  2ASJ A;  5K9F A;  1NPR A;  2G1D A;  2HK2 A;  1NZA A;  2H3E B;  3MED B;  3HZG A;  2GX8 A;  2DCL A;  1PJ7 A;  2KZZ A;  1CC8 A;  3R1L A;  2BJ3 A;  4PXE A;  4DF8 A;  1TL3 A;  2KG0 A;  1NJY A;  2IYG A;  1KLM B;  2HBZ B;  3BBC A;  3LTO A;  3CD5 A;  1O0P A;  4BBY A;  2DGQ A;  4L76 A;  1RAG B;  2BV3 A;  1J5E F;  4ZCL A;  4LRD A;  3EM1 A;  1V6H A;  2M8D B;  4ETZ A;  3NS5 A;  3M2R B;  1PG5 B;  1HYS A;  2IA0 A;  4DQS A;  1BLU A;  2BM0 A;  3MM5 A;  1X31 C;  5LXR A;  3MUM P;  2ZIT A;  5D78 A;  4X62 F;  4PG4 A;  4FZV A;  4OZ5 A;  2V8V A;  2BEF A;  3KHG A;  2GNK A;  4ZPC A;  1RYS A;  2AT1 B;  3SBM A;  2WB1 D;  4X4S A;  5LT5 A;  4RUB A;  1IKW A;  4DL7 A;  2H1Y A;  4JI4 F;  2XY7 A;  1SBR A;  2QL7 B;  4DI6 A;  1NK9 A;  4WWS A;  5HRO A;  3A3N B;  2Y1J A;  4C8M A;  4KKO A;  3R2D J;  1RYR A;  2CPX A;  2GW8 A;  3J81 Y;  1QUP A;  1CS4 A;  4UOF A;  3US5 A;  5KFJ A;  3NGT A;  3CJS A;  4S0M A;  3RRK A;  5I42 B;  3OLB A;  1YKW A;  2FGO A;  2W2N P;  4HVZ A;  4DR2 J;  3Q89 A;  4LF4 F;  1S6P B;  4AL6 A;  1I1G A;  3UFC X;  3TA2 A;  3ZTO A;  1RI7 A;  1X0F A;  5J1E B;  2YX7 A;  1NHK L;  3W5Z A;  4PXD A;  2GHP A;  4ZKA A;  3ENQ A;  3J7Z 5;  3H8Y A;  4KRW A;  4C48 A;  2G0C A;  1K0V A;  3CD0 A;  1OJ4 A;  4EYI B;  4Y65 A;  3ILO A;  1ZM4 A;  2MSS A;  2OPQ B;  4USJ C;  5CD4 A;  4O3R A;  4I64 A;  1RTJ B;  1WKK A;  4GKJ F;  4KHM A;  4CLS A;  1RHU B;  3AB4 B;  1HNX F;  3RAQ A;  4ZHR B;  5IS2 A;  2VOO A;  3OT9 A;  1CEZ A;  3IWL A;  3SCI E;  4KTQ A;  2WB4 A;  3C46 A;  2OSQ A;  3KLV A;  4C8L A;  5D4L A;  4YR2 A;  3WIV A;  5IC4 B;  4IG3 A;  5ETO A;  4OYI A;  4FF1 A;  3QSI A;  3J7Z T;  4LF9 J;  3Q23 A;  3NAH A;  1IM4 A;  3FBB A;  3EZO A;  2KO1 A;  4DV5 J;  4OX7 A;  3IFE A;  3Q8R B;  5DM7 Q;  3BPD A;  2BMB A;  2BYC A;  4CWB A;  2VOD A;  1VQM S;  2QMU B;  4OZ2 A;  2DH7 A;  3Q86 A;  2Q3P A;  3FQK A;  4I69 A;  2C2D A;  2F9D A;  3EVW A;  3PIP Q;  1TKT B;  2DHX A;  3PNI A;  2IVM A;  3UE2 A;  5C25 A;  1N36 J;  4I0W A;  3KTQ A;  4K5S A;  3FJ2 A;  2CAD A;  1C1C B;  1JNZ B;  3OSP A;  5F8H A;  2ILZ A;  4JI7 F;  4KQZ A;  1N5Y A;  2GIR A;  1S7I A;  1P9Q C;  4MFB A;  4AUK A;  2WVB A;  2LXF A;  2FQQ B;  1EAR A;  3EGW B;  2C2K B;  2BOA A;  2J0Q D;  3HFV A;  3W5Y A;  5L46 A;  3NCQ A;  4OX9 J;  1RK8 A;  2IIH A;  5J2N A;  4WFB Q;  2R3V A;  4F3O A;  2J6U A;  4LF5 F;  1AA1 B;  3Q8U A;  3MUR P;  1B0V A;  4C11 A;  2XY6 A;  2FVP A;  1N8R T;  3SDE B;  2N4D A;  3U27 A;  3OLA A;  3KK1 B;  4FBT A;  4H4O B;  2R7R A;  1HWI A;  1CG2 A;  2RRB A;  4DR3 F;  2L48 A;  4KB7 A;  4ICL A;  3G2X A;  1FFW B;  1RA7 A;  1FXD A;  4RUA A;  3GTY X;  5K14 A;  3ITH B;  2ZE2 A;  2B6A A;  3J7A N;  3QZ8 A;  1TFY A;  2KFY A;  1DQ9 A;  2W7P A;  3BGL A;  2RB7 A;  4ID5 B;  3H98 A;  3NOG A;  2R7X A;  1DRZ A;  4ELU A;  4DL4 A;  1N33 J;  3JSM A;  1RAB B;  5BYQ A;  2VON A;  5IWA F;  2RD5 C;  4WP9 A;  1WG4 A;  2VFV A;  1RT7 A;  1RLC L;  1FWL A;  1X5O A;  5KOW A;  2ZHO A;  5DQH A;  3M2V A;  5E3R A;  3M6W A;  4FYV B;  3PYE A;  4OZN A;  1H98 A;  1KEK A;  5HP1 A;  1ZBT A;  2ZH1 A;  5KFF A;  4DV0 F;  1VQ8 S;  5F8L A;  2HYI B;  2NXE A;  3WZ0 A;  2XS2 A;  1HBU A;  1RTH B;  1NZ8 A;  3GFZ A;  4KHP J;  5A8R A;  4QWB A;  4RJV A;  2LEB A;  3R27 A;  4AYB D;  2L3M A;  3RGI A;  3IM9 A;  4F4K A;  2J0S D;  3GV7 B;  2ZUG A;  4Q2L A;  1N6Q A;  3JSR A;  2DGO A;  2MGZ A;  3FK4 A;  2ZOF A;  4YB7 A;  4KPC A;  1ZM2 A;  3QZ7 A;  4F67 A;  3THV A;  2R8K A;  1R0C B;  3QAE A;  2N7C A;  2BKP A;  5A76 A;  3HX9 A;  2GIF A;  2LEP A;  2OP5 A;  4PXB A;  4EZ9 A;  1E6V A;  3BSC A;  1H3D A;  3MR5 A;  3PDN A;  2DNH A;  2BQ3 A;  2M7S A;  1AB8 A;  3TUI C;  3CJ3 A;  1T03 B;  3M32 A;  5E3C A;  1LQ9 A;  5K8P A;  3TRG A;  3IO1 A;  1X0P A;  4IO9 Q;  2EBG A;  3MPU B;  4A8F A;  1T94 A;  1DTQ B;  2AYB A;  1JJH A;  3H0P A;  4KC5 A;  1X5P A;  1WAC A;  2W4C A;  3TZW A;  5T7L A;  2HFU A;  3MEK A;  1FRX A;  2V0N A;  3I55 S;  1Q82 T;  2B8Q A;  1L3V A;  1ZPW X;  1NSK L;  2RHS B;  3UVJ A;  3IMQ J;  1C0T B;  3TOQ A;  4F2R A;  3HXM A;  4C4W A;  1VC5 A;  4OLO A;  3K7R A;  2KJV A;  4R8U B;  4UOG A;  1JLC B;  3PX6 A;  2LQ9 A;  4E0D A;  4GRS A;  4K7Q A;  4X65 F;  3VVT A;  1YBT A;  4RO0 A;  3ZNJ 1;  4IFV A;  3BM7 A;  2C22 A;  3GZ7 A;  1O51 A;  4O23 A;  1Q8L A;  1Q8B A;  4QW9 A;  2AEF A;  2FDN A;  4M5D B;  1S0O A;  1YDL A;  4OZJ A;  2NYI A;  2MZS A;  4CLW A;  2DNQ A;  1T9V A;  3MM6 A;  3G4S S;  1X8D A;  1H74 A;  2Z30 B;  3OFG A;  3K5L A;  4JV0 A;  2CPY A;  1LWC B;  1JK9 B;  4Q8E A;  3MCN A;  2CQB A;  4HAC A;  4V19 X;  1U6Z A;  5K8M A;  1R3N A;  1RAH B;  2MZR A;  3FZB A;  2YPY A;  2KFN A;  1H38 A;  3C6U A;  1SCJ B;  1WC4 A;  3DLK B;  1W2I A;  4OZ1 A;  3ZZP A;  2MLY A;  4QWD A;  1RAJ A;  1K9M T;  4GKK F;  2DIS A;  2VA3 A;  1RTD A;  1RT5 A;  1H2V Z;  1RTZ A;  1U26 A;  1T9T A;  4LFC J;  1GXT A;  4IH7 A;  4ZOS A;  2ADB A;  2YQ3 A;  2CNK B;  1RTI A;  2HZV A;  1EKS A;  4FYD A;  3MI7 X;  1U0H B;  1QDU B;  4DUZ J;  5D8H B;  3NOC A;  2VJU A;  2XWY A;  3R7N B;  1RT1 B;  3GQC A;  4I6A A;  4P9S A;  3GB0 A;  3IRW P;  2UV8 G;  5RUB A;  2UUA F;  4J9P A;  1A6L A;  3MTJ A;  1MWY A;  3Q22 A;  4LIR A;  2BOP A;  2HQF A;  2AV5 A;  3UQS A;  2ZBC A;  4O3O A;  3M05 A;  4TU7 A;  4O4G A;  3PCO B;  2CPJ A;  3I0S A;  2HSE B;  2FC9 A;  4AFF A;  4GC6 A;  5D3G B;  2ZJR Q;  2HS0 A;  1IQZ A;  1FEH A;  3L7U A;  2ASY A;  3Q8Q B;  4A8K A;  1PBU A;  1QSS A;  2PSZ A;  4ZDN A;  2R7U A;  4NEY A;  1HBN B;  4DPO A;  2IM3 A;  2HMI A;  4C7Q A;  4CTA A;  4HI1 A;  2ZJP Q;  2AJF E;  1S1U A;  2K3K A;  2JEG A;  4ID8 A;  3T41 A;  4QBU A;  4ELV A;  4B3T F;  2QIF A;  2N4C A;  3DRR A;  1FVQ A;  3HMJ G;  1XTZ A;  4B9U A;  1W26 A;  2ZHA A;  3A1Y G;  3ISN D;  3OBI A;  1SJR A;  4YFU A;  5LSR A;  4KFB A;  4B3S J;  4J7C A;  4X4N A;  4HLB A;  3HM9 A;  2WRM A;  2DRA A;  5FLX Y;  2I5J A;  1YK9 A;  1WDT A;  2RJZ A;  4JP8 A;  1M0S A;  2QMX A;  3ILI A;  3QGP A;  3OTO J;  2J8S A;  4YP3 A;  1CC7 A;  3TEG A;  3WX4 A;  4X4P A;  1Q1K A;  3FSI A;  2FHO B;  4R5P B;  1HBM B;  1RAC B;  1UVK A;  2VIC A;  3MR3 A;  4L3N A;  1FX2 A;  4Q7A A;  1FDN A;  1NB2 A;  1YZ6 A;  4QIV A;  1FKO A;  1NSA A;  3FZ2 A;  4F4A A;  3LP2 A;  3DGP A;  2QTW A;  3D7S B;  4OJH A;  5I3U A;  2HBQ B;  1TL7 B;  3GIL A;  3VAG A;  2VBX A;  4C8K A;  1G2E A;  1NKE A;  5D4O A;  3VGU A;  4ZVO B;  1CJU B;  2DNY A;  1KOO A;  3I87 A;  2ASL A;  2R7W A;  1EX8 A;  1BXN A;  1VJQ A;  4OI3 A;  3DDK A;  4LF8 F;  4DR5 F;  2D3U A;  2V2Z A;  4NI2 A;  4XPE A;  1UVL A;  1ZPV A;  4F26 A;  3L9Z A;  2FLN A;  1HQU B;  2YNG A;  1R0A A;  4LSZ B;  4ZVH A;  1SIW B;  5C24 A;  5L1L A;  3G82 B;  2IRY A;  4Q0B A;  1LNQ A;  3DRS B;  4G1I A;  4OZ0 A;  4U95 A;  1PSD A;  3DOM B;  4EU0 A;  2LQ8 A;  2QYC A;  3T1H F;  3QT8 A;  4XDD A;  1S59 A;  3Q8S B;  4ECY A;  5J2Q A;  1M5K C;  1CJT B;  3TQ1 A;  2JJ4 D;  3KKF A;  3SQG A;  4ZJL A;  2HRY A;  4QJV A;  3MMB B;  2FJE B;  3SSR A;  1NPP A;  1VQK S;  3HT3 A;  1V3Z A;  1LW2 B;  3VGS A;  3ZZU A;  5IZH A;  5JXS A;  2XCP A;  1B70 B;  3W2V A;  2UP1 A;  1R27 B;  2DIU A;  4YEA A;  4DV1 J;  1F0X A;  4WK1 A;  4YHH J;  4C3L A;  2C42 A;  3D66 A;  1WOR A;  3CJ5 A;  5KFD A;  5HSP A;  1TKZ A;  2P2C B;  5A2Q Y;  1YHQ S;  4UZC A;  4RW6 A;  3DLJ A;  4KHR A;  5BXI A;  2W7O A;  3BN7 A;  3MM8 A;  1NHV A;  1MN7 A;  2B8P A;  4Y2I A;  3D54 A;  1EP4 A;  1HA1 A;  5CXT A;  3PJX A;  4ZPD A;  2RAQ A;  4G3I A;  3GJR B;  1L3K A;  4KV8 B;  1HW9 A;  3MCM A;  4I1T A;  5LMU F;  5ETM A;  1AUD A;  2XZW A;  4NEZ A;  1B99 A;  2C2O B;  3O2I A;  4WKY A;  5KFQ A;  1TMM A;  2F63 A;  2RRN A;  2ZBP A;  4DG1 B;  2OLW A;  1WD6 A;  2HZA A;  3WC0 A;  1VQS A;  5D4N A;  2HZC A;  1KQK A;  3KK2 B;  3ENV A;  3AD7 C;  2VPZ B;  5CCL A;  2AJ4 A;  5C42 A;  2CQD A;  5DG9 A;  4DSF A;  2DY1 A;  4IO1 A;  1UJ4 A;  4RNH A;  1MRO B;  2HNZ B;  1ELO A;  3T1A A;  2GZO A;  5E3P A;  2W7A A;  2U1A A;  1RBL A;  1QY7 A;  3TNV A;  1NK5 A;  3R8Y A;  3N5B A;  1T7P A;  1TP7 A;  5ETQ A;  1SB6 A;  4V19 J;  3P8B B;  3EJM A;  5IM0 B;  1SC1 B;  1S6Q B;  1XNQ J;  2V8H A;  2ZFH A;  3DM2 B;  3QJP A;  3NBP A;  4MIA A;  1A0O B;  3ZZY A;  4B3O A;  2GQQ A;  1LK5 A;  3CO9 A;  4A46 A;  4WZQ A;  2KM8 B;  1KS2 A;  4UW2 A;  4A8M P;  3TVK A;  1RKJ A;  2OIH A;  3MZI A;  2I8E A;  3KHL A;  4F4W A;  5KFH A;  4ALZ A;  1TUW A;  4B9N A;  2OD6 A;  4H4K C;  1D9D A;  1FJG F;  1U24 A;  4FPR A;  2VFU A;  5ETS A;  3U1N A;  4ZVQ B;  1RCO B;  4LF7 J;  4C6A A;  3JXO A;  1RLD A;  2I6W A;  3MF5 A;  2OPP B;  2A6M A;  5KFM A;  2GA7 A;  2FVS A;  4USI A;  3HVA A;  4LF9 F;  2AJ1 A;  1QD1 A;  2JOQ A;  2E1R A;  3RBD A;  4ZLL A;  3KLF A;  2K06 A;  3BV8 A;  1UMJ A;  4YS2 A;  1RWK B;  1M1H A;  2BAB A;  4DV5 F;  2BE9 B;  5L1J A;  4DN0 A;  4P71 A;  3AD8 C;  2AEM A;  3POT B;  3GR0 A;  4ECS A;  3NNA A;  2Y3Y A;  2R8J A;  1XER A;  4LSN B;  4NLV A;  1JJ2 R;  2EFV A;  3PKM A;  2PC6 A;  4HTJ A;  3FQL A;  4N77 A;  1HD1 A;  2AYG A;  2JZ5 A;  2IJN A;  3R3T A;  3ETO A;  1Y9O A;  1S1X A;  3KLG B;  4OYP A;  1FJC A;  3G6E S;  5KFU A;  3LAM A;  2O67 A;  3E01 B;  2C1E B;  1HNZ J;  2D69 A;  5CAB A;  1UCN A;  1PKU A;  4UT4 A;  1OYE A;  4CYU B;  2BVZ A;  3WQP A;  1JXE A;  1UVN A;  4IUF A;  5IT0 A;  1UP1 A;  3JSY A;  1S76 D;  2MMY A;  3V81 B;  2ZM6 J;  1IXK A;  3A3P B;  2OEL A;  3MM7 A;  3C16 A;  2HRT A;  3GII A;  1I6J A;  1BWV A;  1YLX A;  2Y0S D;  2LQB A;  4PG7 A;  3H20 A;  3A4T A;  3CCV S;  4N5S A;  2ZWO A;  5DS7 A;  2DPI A;  1JLG A;  3I32 A;  3KJV A;  3M1V A;  3DU5 A;  1EB0 A;  1NDP A;  1LW0 B;  2B5J A;  1FRL A;  3FMW A;  4ELT A;  1G3O A;  1CUL A;  1C0U A;  4DS4 A;  4DFK A;  3TR5 A;  3MAA A;  5GMK a;  3CJ8 A;  2MJU A;  4CLU A;  5HAT A;  2HAF A;  5I3Q A;  4ECV A;  3CD7 A;  4ZJQ A;  2VV5 A;  3PEH A;  2WCX A;  4A8S A;  2I0X A;  2IMO A;  1K47 A;  4WE1 B;  5HQ8 A;  4F2S A;  1URR A;  3UPF A;  5K8O A;  1ULR A;  3QO9 A;  3W2W B;  2D3O R;  4RX6 A;  3ZZT A;  4RL1 A;  3HVR A;  3WX8 A;  4PEO A;  2CDQ A;  3VGT A;  1P1T A;  2KB2 A;  3GSD A;  2BR0 A;  3UNY A;  2RML A;  3GE9 A;  5B0D A;  1TVR A;  3UCU P;  4EBD A;  2NZ4 A;  4LBH A;  3T9N A;  1VQP S;  3CME S;  3LP1 B;  1GTH A;  2F9J A;  4KHP F;  2P6S A;  4QCL A;  5DLG A;  2OSR A;  3VF0 B;  2YQ0 A;  4HT5 A;  2P6T A;  1X4A A;  2DGV A;  1J5O B;  3I0R B;  4NMX A;  4WYL A;  4F4X A;  5CD4 H;  4Z2X A;  2J76 E;  4NLO A;  3H5S A;  2VU5 A;  3V4I A;  3AOC A;  2MKC A;  2YH0 A;  1S99 A;  1QE1 B;  1B7F A;  4U7U K;  1FFS B;  3PFO A;  1T9W A;  3BN4 A;  5L9X A;  3TAM B;  1NK6 A;  4P75 A;  2HQ3 A;  3CMQ A;  4C0B A;  2JWN A;  4DV6 F;  3M8W A;  2CZ9 A;  4W90 B;  1VBZ A;  5GMD A;  3W9I A;  1XMQ F;  3MM9 B;  3CJ4 A;  4N8O A;  1WOP A;  1NSP A;  1HHQ A;  1URN A;  3V6H A;  2MHE A;  4CLP A;  3CVK A;  3OUY B;  3UN2 A;  4E98 A;  3F44 A;  1T9X A;  1TV6 A;  4C0O C;  2OEJ A;  4C8Y A;  1X4G A;  3KOA A;  2AZ3 A;  4OYX A;  3R1H A;  4U67 Q;  1KRP A;  3KK1 A;  4TY9 A;  2VOP A;  2A18 A;  4N47 A;  4H4O A;  4XO0 A;  4PAB A;  5KOX A;  3A3O B;  2KL8 A;  2QC3 A;  2QZ8 A;  3CC2 S;  1KON A;  2LA6 A;  1X9W A;  1XK8 A;  3V2U C;  4NLR A;  3WC2 A;  2U2F A;  1YJ9 S;  4G1Q A;  1TTH B;  3TJ8 A;  2ROG A;  1XC9 A;  2W9A A;  2R8H A;  2W4P A;  4PCQ A;  5FDL B;  2J9C A;  4DSJ A;  2HHT A;  4PQA A;  1RWW B;  3I5A A;  5CZV A;  4NA2 A;  2HNY B;  3R7B B;  4W98 A;  2DVI A;  4USV A;  2LLZ A;  2OPS B;  1WTB A;  4DU8 A;  3AAW B;  2QT7 A;  3SEO A;  3N6N A;  3N6M A;  2V8P A;  4LVN P;  2AYM A;  1E6Y B;  1C1B B;  3ELH A;  3PJW A;  1X60 A;  4TLR A;  4FXD A;  3VAH A;  2KH9 A;  2R2S A;  3H59 A; 
#chains in the Genus database with same CATH homology
 2CNL B;  4ZVQ B;  2HBZ B;  2QL9 B;  1F9E B;  1RWV B;  3P4U B;  5IC4 B;  3R7S B;  3EDQ B;  2H51 B;  2H4Y B;  2CJY B;  2H5J B;  3GJQ B;  3IBC B;  3R5J B;  3KJF B;  1I51 B;  2H54 B;  1PAU B;  1RHR B;  4ZVT B;  2HBQ B;  2QLJ B;  4ZVR B;  1RWP B;  3R6L B;  1RWX B;  3P45 B;  1RWN B;  2P2C B;  2H65 B;  4ZVP B;  1RE1 B;  2C2M B;  4ZVO B;  1ICE B;  2XYG B;  2XYP B;  4DCO B;  1BMQ B;  2CNK B;  2H4W B;  3KJN B;  2H5I B;  2HBR B;  1QDU B;  1SC1 B;  1RWK B;  2Y1L B;  3GJR B;  3QNW B;  3IBF B;  4LSZ B;  1NME B;  5K20 B;  3R7N B;  3GJS B;  3RJM B;  1SC4 B;  1GFW B;  1IBC B;  2CNN B;  2H48 B;  2Y0B B;  3GJT B;  2C2O B;  1I3O B;  1RHJ B;  3NS7 B;  1PYO B;  1SC3 B;  2CNO B;  3EDR B;  1RWW B;  4JB8 B;  1RHU B;  3R7B B;  1QTN B;  1RWM B;  3KJQ B;  2CJX B;  2QL7 B;  2QLB B;  3D6M B;  3D6F B;  1RHQ B;  4ZVU B;  1RHK B;  3SIP B;  4DCP B;  2XZD B;  3R6G B;  2C2Z B;  3D6H B;  2CDR B;  4DCJ B;  2QL5 B;  5IC6 B;  2FQQ B;  2QLF B;  2DKO B;  2C2K B;  2XYH B;  2HBY B;  2XZT B;  2C1E B;  1RHM B;  1RWO B;  4ZVS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...