2Y1LB

Caspase-8 in complex with darpin-8.4
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
87
structure length
87
Chain Sequence
YIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Caspase-8 in Complex with Darpin-8.4
rcsb
source organism Homo sapiens
molecule tags Hydrolase/inhibitor
molecule keywords CASPASE-8
total genus 20
structure length 87
sequence length 87
chains with identical sequence D
ec nomenclature ec 3.4.22.61: Caspase-8.
pdb deposition date 2010-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2y1lB00
1RWXB 2HBZB 4DCPB 4DCOB 3GJRB 1RE1B 2CNNB 3EDRB 2XZTB 2QLJB 3R7BB 1IBCB 1SC3B 1RHKB 3P4UB 2C2OB 2C2MB 2H51B 2CNKB 3NS7B 2QL9B 1ICEB 3KJQB 2QL5B 2CJXB 3GJQB 4ZVUB 2C1EB 2Y0BB 1BMQB 4DCJB 4ZVOB 2XYGB 1RWKB 3D6MB 5IC4B 2H5IB 1NMEB 4LSZB 2C2KB 1RHRB 1RHJB 3QNWB 3R5JB 3SIPB 4ZVRB 1RHMB 2C2ZB 3KJFB 3KJNB 3IBFB 3R7NB 2QLBB 2CDRB 1RWNB 4ZVQB 1SC1B 2H4YB 1RHQB 2DKOB 4ZVTB 1RWWB 2CNLB 1GFWB 5IC6B 1PYOB 2H48B 4JB8B 2XYHB 1QTNB 2H5JB 1SC4B 3R6LB 1RWOB 2H4WB 2HBQB 3IBCB 2XZDB 2XYPB 1I3OB 1QDUB 3R7SB 1RWPB 2CNOB 4ZVPB 1I51B 2Y1LB 2QLFB 3GJSB 3RJMB 1F9EB 2QL7B 2HBYB 4ZVSB 1PAUB 2HBRB 3GJTB 2CJYB 2P2CB 1RHUB 3EDQB 2H65B 3D6HB 3R6GB 1RWMB 5K20B 3D6FB 2FQQB 3P45B 2H54B 1RWVB
chains in the Genus database with same CATH superfamily
5A2QU 3TRGA 1V5VA 2XQCA 3LQVA 2F4VF 4WU3A 2E66A 3JAMY 3DLGA 4CLTA 2GA7A 2DR9A 4BHQA 1BQXA 1SIZA 2NXCA 2RVJA 3LF0A 3IN5A 2R8IA 4K4WA 3PW4A 2HNZB 2RUSA 3EGNA 3IM9A 4MMOA 4ZCKA 2XY6A 3M4XA 3OXGA 2ZZMA 2EFOA 2R7SA 2ADBA 2ZBPA 3BGFA 2CPIA 2GVZB 3OTBA 4WJBA 3S6EA 3TWZA 3EZ5A 2JEGA 2G2OA 2RDIA 4BC9A 3CDEA 3QMQA 3W62A 2COLA 1FX4A 3K5OA 4MIWA 5HAOA 2JWNA 5KFTA 5KFDA 5B0EA 2RS2A 1NAQA 2E1RA 1KD1T 4YQWA 5F8HA 2YKQA 3J80U 1NDKA 3VAMA 1T9XA 2F4FA 2LVWA 4NLXA 4FS1A 1S77D 4I67A 4LFCJ 3NGUA 4KHRA 2GVDA 5J2NB 1UEKA 1YSJA 2W2MP 4RU2A 3CJKB 1JKHA 1RADB 3GLJA 4KR0B 2KM8C 3OR1B 4RW9B 2FVPA 3C15B 3BGOP 1UVLA 2HHPA 2PO4A 3MFIA 1UPPA 2V63A 4K4TA 4P2XA 1FWKA 3HSJA 3TP2A 1WNEA 1EKRA 2CDQA 3HFVA 5K9FA 4EBCA 2UXDJ 5IT9Y 3ZFVA 2DGTA 2AIRB 2VG5B 4HHHA 2HK3A 3S7RA 4GO5X 1U8WA 3UDEA 3VZHA 2BKNA 4DN9A 3Q8SB 2DGWA 2KT2A 2MQPA 4IKAA 2RQ4A 4WCEQ 3OBIA 1FJGF 4RW8A 1RAHB 1GMUA 3D3BJ 1S76D 4QIVA 2Y8YA 3W7BA 3LP2A 5DZ6A 3RRKA 4FS2A 1WACA 1ZA2B 3KDNA 4A8XA 5CXTA 4NLQA 4BCAA 3A4TA 4PG7A 2VQEJ 4ECTA 2AGOA 2UXBF 4HLBA 4C98A 1V5IB 4IDKA 4DN0A 4WK1A 4EK2A 3ZZZA 4QPXA 3CDBA 3BO4A 3PZPA 1HYSB 2HFUA 2G4BA 2W9BA 3PIPQ 1P1LA 3V6KA 2GNKA 4KC5A 1WG4A 4I0WA 4ZVTB 3ZZUA 5CABA 2BVZA 1AZSB 2HHUA 1BY9A 2VBXA 2EFPA 3CC2S 4DU7A 4DFMA 1IBLF 3MXHP 1T8EA 2OIHA 1HNXJ 2KRBA 2GQ2A 4OHYA 3GPAA 3PHTA 4FYDA 3MM8B 2C3MA 2H48B 2PIIA 3H4DA 1HNVA 2MJNA 3DRPA 4UQTA 3EVWA 3G6XA 3DOMB 2YNFA 1U49A 3PDNA 3NS5A 2WHOA 5B0FA 5C42B 4ER8A 5F9LA 1R89A 2BE2A 3C8YA 2IJRA 3L7UA 4RZRA 2GMJA 1N52B 1JLAB 1PCAA 2ZHAA 3GFHA 2V4JB 4CH1A 1C1BB 4MK7A 1TK0A 1OSDA 2AYEA 2JLFA 3D67A 2XTJP 4CLFA 2CQ0A 3LAKA 2NSCA 5L1IA 1U47A 3UCZP 1KOHA 1NK5A 1RKJA 5K8MA 3RBXA 3AA8A 3EMTA 5JMNA 4LQ9A 2OKQA 3HZEA 5IT4A 2XMTA 2RKIA 2HIQA 4F4KA 2V5HG 4DV1J 3FKBA 4IG3A 3NCPA 4MT1A 3UWTA 1REVA 2G0JA 2OPSB 4B02A 1JX4A 2CIMA 1U2RA 3D6HB 1IM6A 3GIJA 1H73A 2UXDF 2A6OA 2BQUA 3M8PB 2P6SA 4Z7CA 1HW9A 2HS3A 4C4WA 3SQGA 4CI0B 1CULB 2FQQB 2H5EA 2M52A 4K2XA 2LU2A 2DGXA 2PI5A 2KZMA 3BGRA 3JQKA 1T05B 2IRUA 2MSSA 3GYGA 5IV3A 4J9LA 3PYDA 4X84A 2JX2A 2ILYA 4QIWD 1R8HA 3BDEA 3LP0B 1FVSA 1W26A 2LLZA 2VG6B 3CIZA 3N28A 2YKAA 1T9WA 2DT9A 3HHNB 2HFVA 1QJHA 1HBUB 4EU0A 2J8SA 4DDFA 3WIVA 1F2GA 1KQFB 2G13A 2J6SA 4G1QA 2ZJPQ 1X7VA 1RSCA 3VAJA 1LKZA 5CYQA 5DGBA 2BABA 1JLFA 3QYYA 2L08A 4OQJA 5LL6d 5AE3A 5E41A 1D1UA 4DQQA 2JVOA 2YKNA 4DR3F 3MR3A 2CZ9A 1WF2A 1N6QA 4OMFG 4DU8A 4LF7J 1U1QA 4PYAA 2Y0BB 1GTEA 3CMAS 3DXSX 3QRQA 2M0GB 3P96A 3PFOA 1KOOA 1X4CA 5LJ3Y 3F44A 2F63A 2HGMA 1RTIA 1YGYA 1GNKA 1X4BA 2O1PA 3CB4A 3CTRA 2A2CA 3DLJA 3UDCA 2UXCJ 4ELUA 3NLCA 2V68A 1RTHA 2OPQB 2DIVA 4ZPVR 2B56A 1FRXA 4WFXA 1OY8A 3TJ9A 4QU6A 1RZMA 1RHJB 2IVYA 2EFNA 4DLEA 4OYMA 1UP1A 4CQ1A 4WP9A 4YR0A 3L4BC 1DY3A 1TFYA 2XZWA 3MAAB 2C2ZB 1H7XA 4RWXA 1VLOA 4N77A 1DTQA 3DI6A 5K8PA 5F0UA 3R9LA 5SZTA 3SI8A 1K0TA 5H9EK 5D4OA 1U2FA 2M9KA 3I96A 1T9VA 3N9UC 4FYYB 3GIMA 5LMUF 4B9NA 2CADA 5D78A 1X4GA 5IV4A 2VONA 1R0AB 4HACA 3SCLE 4I1TA 3UPFA 3K5NA 1PILA 3PYFA 3KK1A 1CEZA 1X9MA 1UFWA 2Y1JA 4M8LA 1RJJA 1MN9A 2KG1A 2IDEA 4IOCQ 3C14A 1U1LA 3HX9A 2Y9HA 4PXEA 3T9ZA 4C8LA 2YNHB 1WEZA 2FJDB 3A3NB 1IKVB 3FZBA 4XPCA 2VOOA 4NCGA 1JLQB 1FE0A 1HW8A 2OO4A 4HEA9 1UWBB 5LOQA 2QA4G 1B99A 1UVIA 4LVNP 2I6WA 5C5JA 2KHDA 5E3CA 3RYLA 1WOPA 4DV7J 5HI7A 4U7CA 1FKOB 1SQEA 4DG1A 3TAMA 3M8SA 4PZVA 2M4MA 3K2YA 3KXDA 4FXVA 3SMZA 3V81B 3POTB 5KFEA 2ZJRQ 2PFFB 1QUVA 2XZDB 2V69A 2XYPB 3G86A 5GAHI 1LXNA 4CLUA 4QW9A 2RHSB 3HFZB 3GB0A 3CJ4A 3NWGA 2WVDA 2IMWP 2N3OA 2Z2LA 2DTJA 1U25A 4O4GB 1NM2A 3FJ2A 1RYRA 1D0EA 3AB2B 3ENQA 1LW0A 2HAIA 1JKHB 2W4CA 3TEGA 2X3GA 1WI8A 3GIIA 5FDLB 1IKWA 4CTAB 1TL7A 3DOKB 5F8JA 2VG7B 4BWMA 5CYJA 4UT4A 3GILA 2V50A 2VA2A 1P1TA 3DLBA 4J9NA 3F0NA 1BLUA 2W9CA 1GX6A 2BJ3A 4DFJA 2YKNB 2W9AA 3I9ZA 2MJUA 3MMAB 2VJUA 2HGNA 2PGCA 1X5OA 4AXIA 4IRCA 2J9EA 2E1AA 4O0NA 1Q1KA 4GKKJ 1LWEA 4USHA 1VGYA 4TLRA 4RUHA 1MMNA 3ENAA 2D41A 4P7VA 1VRTB 1UWAA 1BUXA 2LYVA 2ZZTA 4X65J 3NGTA 3RAMA 5D3GA 4KKOB 5LMNF 3MPUB 2C2MB 4ES1A 3QLHA 1FRKA 4M5MA 3NS7B 3Q8RB 3K57A 2XEXA 4E8UA 4YHHJ 3LAMA 3MEDA 1FCAA 5KFPA 1N6QB 2JVRA 2NZ4A 1ZM9A 1QAYA 4CWBA 2K8GA 4QCLA 3BREA 3T41A 5KAKA 1N34F 1KS2A 2C1EB 1X0FA 2MKYA 2L3MA 3W61A 5DJBA 2EWHA 2OEMA 5J2NA 4O44A 2DRDA 2PC6A 4JI3F 1HIYA 3NEKA 1QUPA 1HARA 4TU9A 4B9LA 4LF4F 3NNHA 1FFGB 3DFEA 1T02A 1NLKL 2EC2A 3D6TB 4K0KJ 1WC1A 1SB6A 2ZHBA 5HBMB 1WC4A 1TK8A 3ZTQA 2FLNA 2HSEB 2CQ2A 5CD4A 2ZD1A 4DR1F 1NZ8A 2BJ7A 3LANA 2DEIA 4Y2CA 1IBMF 4Q8FA 1KLMB 3GQCA 1J5OB 4IFYB 1CJTA 2RQCA 2QMWA 2ZH2A 1B0VA 2O66A 2IPOB 3BM7A 3OFGA 1NPKA 3TJAA 3UW1A 5D8HB 1IWAA 4X64J 4PWDA 1QM9A 4L72B 4R25A 3M2UB 3H5UA 2CJAA 2OUGA 2K7JA 3C66A 2WB4A 3JTNA 1FFWB 3DLKA 3MMCA 2IBKA 5KT7A 4OYXA 3W2WA 3DLGB 1NPRA 4O3QA 3IRXA 4NYPA 3MM6A 4OV1A 4OL8A 3MGJA 4K5RA 3QRPA 1N5TA 1HWJA 3GV7B 3KLFA 1BC6A 1S9EA 2HURA 3MR6A 1N32F 3OHBA 4GKKF 2YVSA 4H4KA 3HVTB 2B5JB 4DPWA 3PVXA 3JSRA 4WTOB 2H3EB 3T1AA 2DKOB 2K2PA 1S0OA 4L3KA 1JQGA 2MTLA 2XBPA 1FDDA 1HKAA 3CJ5A 3FSXA 5CZXA 2R2TA 3QFWA 4KYZA 1UMJA 5DO2A 3HM9A 4EZ6A 4ED4A 4X62F 1WTBA 3B54A 3ZTPA 4B3OB 2L9WA 3D28A 3DKDA 2WCXA 4DPUA 3OLBA 3OJSA 4OZ3A 3H2VE 1ZA1B 1X4FA 2FJAB 1BWEA 1FJCA 1KN6A 5J1EA 5D4LA 1JJCB 2NYHA 2HQFA 2MZQA 2UZAA 3R7SB 3NNAA 2O67A 4LMZA 2WVFA 1I3OB 1QDUB 4M5HA 3R97A 2V4QA 3PYEA 2ACMA 3RAXA 5DQGA 4JI6J 2YWFA 4OZ0A 4LIWA 3E01A 5RUBA 4ECSA 2LQJA 1SH0A 2QLFB 2KT5A 3KLFB 4KPCA 4LBIA 3A3OB 4I2PB 1RAIB 4FNHA 4LF2A 4KKOA 2E44A 4TNOA 2DRAA 1FRHA 2Y8WA 4OHWA 2HYIB 4Y65A 2VDIA 5KFBA 1JJ4A 2H65B 4C0HA 3M2UA 4MKAA 1X31C 1YJRA 1S4FA 3ISND 1SJ4P 3IXQA 3SQOP 2F8EX 2HPUA 1M5PC 8AT1B 2H54B 4QQBA 2Q6BA 5KFVA 1YRUA 1Q7YT 1JXLA 2UU9F 1HD0A 2XZTB 2CQGA 3PR5B 1G1XA 4I7FA 4LVOP 4IFVA 1C0UA 1OYEA 2NCKL 2OELA 3DOKA 4ZP8A 3J7AN 2C2OB 3GV8B 1GMWD 1C1CA 3CUNA 1YHQS 1S79A 1H72C 3I5CA 1WF1A 3SSQA 1M5VC 3D2WA 3KJQB 3OSNA 2CZ4A 2AGQA 4X64F 2BRKA 2HS4A 1C0TA 1WC6A 1X5TA 3IO1A 4LFAJ 2R3VA 1D9AA 3CC4S 2CQHA 3KG0A 3FFIA 2F9DA 2V4JA 3D9BA 4MYTA 3CXCR 4ECRA 2QLWA 4EZ9A 4KPYA 1YWXA 3L9ZA 3Q8YA 5H9FK 2MKSA 3NGRA 2CFXA 2RD5C 2A6MA 4YEAA 4C11B 2KI2A 1S1VA 1FKOA 5L39A 4F2RA 1KNZA 1WELA 3I0RA 1PG5B 2YKMA 2YQ0A 4JP8A 2DGQA 2PSZA 5HLFA 1T05A 3KOAA 2MYFA 5J2MB 3HULA 3AQOA 4RX6A 4X4QA 1Y5LB 2BYCA 3ETMA 3M8WA 3PKYA 1ZAWA 2W2PP 3KMQA 1NMEB 2IAJB 1VBYA 1K1SA 4X4UA 4LRCA 3IGNA 2DCUB 5HJXA 2ZH7A 4DV2J 2W9BB 1FRJA 3BF4A 2GQCA 3C6UB 4W98A 4WYLA 3PM9A 3THTA 4EMDA 2N7CA 3M8ZA 2RQKA 5J1PA 3QSYB 1Q8LA 4WK3A 3EGVA 4J9SA 3PR4A 1GMVA 1FI4A 1LXJA 1U0HB 3RW7A 3TX8A 3AD7C 5J2PA 2BE7D 4NE9C 1URRA 3CCWA 4XTTA 3JSMA 1S9GB 2HZCA 1NJIT 2OI2A 4USTA 2MB0B 2WBMA 1DARA 2BM0A 2IM2A 1DQAA 2ZC4A 5BJRA 3BBBA 5JJBA 4FDFA 1NK4A 1K0VA 3UI3A 3A3PB 4B3RF 4M5NA 4FF4A 3N0VA 3L09A 3SBMA 4DL6A 4ZVQB 4JI7J 1I6JA 4I2QA 2D9PA 2ATLA 4LRBA 1R27B 4U6PA 1NH7A 4B08A 3SV4A 4F25A 2LFVA 3CJSA 1HWKA 3DN9A 4IH6A 1EP4B 1HQEB 4TLQA 4YY3J 2BDPA 4DZDA 2Z8QA 4IQXA 5DG7A 3TNVA 3G6ES 3RUBL 1BQMB 4WZQA 5HO4A 3NAIA 5FLXU 4M5JA 2GHWA 1F60B 1XK8A 3QBCA 4PG6A 1R8BA 3CD5A 1S49A 2A1BA 1FXDA 5C24B 1DAXA 5CCMA 3VZIA 2R2UA 4WP3A 1Z4UA 2FHJD 3IWXA 2K1RB 4C8MA 4C3LA 4DSEA 3K17A 1FESA 1XR7A 2AMCB 3MPYA 4V1Ak 3NRBA 2OEKA 1RWOB 5ETNA 1IBKJ 1NJWA 2CVEA 1N8RT 1NHKL 2MKJA 3C46A 4DL4A 1CJKA 1NRKA 5F8IA 2R7RA 1Q81T 1S57A 1YZ7A 2B7CB 3P8BB 1YJWS 3VAIA 1UETA 2ABYA 1S1TB 3P5TL 5U47A 1M1HA 2DNMA 3C16B 1H2VZ 2LQ5A 3GZ7A 3OTOF 4ED8A 4OX9F 2GIRA 3T1HF 2IBOA 1RUSA 4RNHA 3MAAA 4DR6J 3DMJA 1CJVB 2MLXA 2KM8B 1RWMB 5IQQA 4ILLA 1UWBA 2GO9A 3D6FB 3BGRB 1K8AT 1JJHA 4DV6J 3PJWA 5C7PA 5F8LA 2PDAA 1S0NA 1TKDA 4E0DA 4C8OA 2J8AA 1B4SA 4AQYF 4DSLA 2BZ2A 1IQZA 3JTPA 2NPIA 1RE1B 2XMJA 3MDFA 4P74A 3SQGB 1CULA 3ZZOA 5B0DA 5ITHA 2PI4A 1XNRJ 4ZVHA 3O3LA 3IRXB 1C4CA 2OPRA 4NLPA 3OVSA 1DHMA 1QAXA 3H98A 5AXKA 5T7LA 3H5YA 4JI1F 3JS9A 1WHVA 4ICLB 4B3RJ 3H25A 1VRTA 1FNMA 2RDDA 3BBFA 1AB8A 2CJBA 4FPRA 4XK8C 1FDNA 1RQ0A 2LA4A 1HBOA 3HVRA 2DHGA 1KTVA 2QA4S 1UW4A 2RT3A 2KYXA 3OV7A 3FBCA 3PTWA 1CC7A 4A4JA 2RAQA 1NSQA 2UVRA 2J0SD 1PYTA 3AQPA 3GJQB 3RR8A 3OL7A 1NNDA 2QGFB 3PRBA 1SI9A 2ZEJA 3V6DA 3HSZA 5HN0A 2EPIA 2QG9B 5EUHA 4DOZA 4BWJA 3I4PA 4X4PA 2XULA 3DOMA 3M8QB 1VS3A 3Q89A 4Y2IA 3C2PA 4P52A 3FEZA 2GZOA 2OPQA 4ZJOA 5ADZA 5E3AA 1VK8A 4ZVOB 2KRRA 1YITS 1L5UA 3QRRA 3PW2A 3D0IE 1LW0B 3IG1A 1L3KA 2W8KA 4Z37A 2ZOFA 4ZK7M 2UUTA 3IAS9 1N88A 1S12A 2BA9A 2XI3A 3OFFA 4YY3F 2WRMA 3DDNA 3AXKA 5A6PA 2H5IB 3CJQA 2RRBA 3NCRA 3GMGA 4WFBQ 3E01B 4YB7A 4TU8A 3VAFA 1U45A 2B9YA 5D0RA 2K3KA 4CO5A 1NJYA 1DBDA 1SV5A 4J5OA 3IFEA 1XTZA 3GU0A 4GKJJ 3AOCA 4J9MA 3RRGA 3DGVA 1NCLA 4M5GA 3ZO7A 4A48A 4KO0B 1YTYA 4U9RA 3T1HJ 2V67A 2DY9A 5E3QA 3LP2B 4TY9A 1S6OA 4X62J 3CJ3A 2YWKA 3W2VB 2ZWOA 1XNQF 1RAGB 4FBTA 4USKA 2QZ8A 2QLXA 3AY0A 2R7XA 3K8VA 5KFAA 5BYSA 1SJ1A 4DV6F 2DHXA 4EFAC 3MHYA 4ENOA 5HATA 3ILJA 4PG8A 3IWNC 3V2UC 4OX8A 2NPFA 1JXEA 3QO9B 3KHHA 3GFXA 2CQIA 4ZJLA 2NREA 2XWYA 3BS9A 3NMRA 5CCLA 3H7HB 4PWUA 2CPFA 2JJ4D 3THPA 1RT5A 2D69A 2MSTA 3KMSA 2KG0A 2R9LA 3G9CA 2HEKA 2PFDA 4HDHA 3HVTA 2DD8S 2ZH6A 5F8NA 3BO3A 3I82A 3I87A 3RU0A 4CZCA 3DDKA 5IM0A 5ETTA 1FKPA 5AJ3F 5C24A 1RCOB 2A3JA 2EK1A 2CQDA 1J27A 1HNVB 2L48A 1CQNA 3FEXB 2OAUA 1Q78A 2HGLA 3H20A 3KLVA 3HP6A 3PO4A 4H4MA 1RAAB 2R7QA 2R7WA 3HVAA 1W2IA 1VK3A 2OPPA 4LJMA 4R5PA 3I55S 3US5A 5L1JA 3BJYA 3V5RA 1SKRA 3OT9A 2KVQE 2FYXA 2X3DA 5KFRA 3W1YC 5HK4A 3Q86A 3FRZA 2E5LJ 4X4VA 2CNOB 2ZNYA 3CW2C 2ZH5A 2XM3A 3DNCA 3HXMA 2HFOA 3QFHA 3TQ1A 1XIQA 2FZKB 5DLFA 1J5OA 3GJSB 4O0IA 4UY8T 2UUWA 1B7YB 3MCMA 2HZAA 2C3PA 2HBYB 1JLCA 3A13A 4G3IA 3ET6A 3KLGB 1T9UA 4NLGA 4JYAF 1Q7LB 2KVIA 1TL5A 3QJLA 4OLOA 3EZOA 5ETOA 2HNZA 1HMVA 2LXUA 2XG8A 1OS5A 1B3TA 3DDIA 4DQPA 2HHSA 2W2OP 3DM2A 5EX3A 1U24A 4P75A 1V3SA 3PG9A 2DGUA 2VFRA 1VBXA 5ETVA 5D4PA 2KXFA 3L3CA 1RTDA 4B3MJ 3CE8A 1OJ4A 3WC0A 3PX4A 2NR0A 3Q0AA 3KDOA 4GO7X 2C28A 4DEZA 4EEYA 3AOBA 3HMJG 3Q2TC 2QMUB 2MKCA 1HBNB 4BLGA 5LSLA 1FDAA 5HL7Q 1Y3JA 1ZPVA 2VUGA 3TZYA 5MLCV 3W8PA 3C6TB 1LW2B 2XO6A 1NSPA 5ETMA 3K89A 4WWSA 4DX7A 1SL2A 2B3TB 1S7IA 2VA3A 3G82A 1MMDA 4JUZA 1JJ2R 3ELHA 1ICEB 4Z2XA 2UUCF 4RNNA 2Z0GA 1F3VA 1HPZB 2MY8A 2I9SA 4K4VA 3IWLA 2NYIA 2CJXB 2YNIB 3EX7B 4ID5B 2ZBQA 1DJ0A 3AH6A 2DH9A 3Q2SC 1FO1A 4AL5A 2VC0A 3DRRB 3GONA 2HMIA 2GHVC 1XQIA 2DITA 2EI5A 1X4DA 2XHCA 3IG1B 2C2NA 1HQ2A 3N4WA 2WSCC 4LRFA 4AYBD 3WIUA 1CLFA 2KT3A 4NXNF 4DCJB 2R7TA 4U7UD 4K59A 1KP6A 4USUA 1N5VA 1JLEB 2GAHC 2QV6A 3OTEA 2NXUA 3P3DA 3BV8A 3TVKA 4KGVB 3WBZA 1C2PA 4PABA 1RTJA 3OD2A 3HPOA 2VC1A 3I0RB 1R6VA 1S1XA 4LF8J 4M5KA 1CJTB 1Y3KA 4C2MA 3VAKA 3FUYA 4NMLA 3SSSA 1N4LA 4KGMA 3QZ8A 2VODA 3IA0A 4LSZB 3CCSS 1GTHA 1Y0HA 2FGOA 5I3PA 1RAJA 1UJ5A 4PQUB 3J7ZT 5KFQA 2FC8A 4KBIA 2BQRA 4Q44A 3AJ1A 2L9NA 1FEEA 3MCNA 3I32A 3TUIC 4USVA 1Y5NB 2YNGB 3HK2A 4DUYF 1HQUA 1EQMA 1QE1A 1H74A 3OUYA 3M9OB 1KQGB 5KFIA 3JSMB 1Q86T 4YR3A 4HVZA 4L6V3 2D3O1 4I4BA 3J81U 2X1AA 1AW0A 5HVGA 4O3NA 3VQSA 2QA1A 3D3CJ 1HD1A 5DQHA 2RB7A 3MAHA 1URNA 3HD2A 1WC5A 1SV5B 4DUZJ 2QYCA 4AD6A 4U8YA 1T11A 4AL7A 2N4DA 3D68A 2RH3A 2XY7A 1YI2S 1X9WA 2J0QD 1U1NA 1WI6A 1RXOB 2BRLA 4RUBA 5F9NA 4QIEA 5BR8J 2B9WA 2HFNA 3NWRA 2R8HA 5KG3A 4Q43A 1ZH5A 1FJ7A 3AA9A 2ZUAA 3N6NA 2HVDA 3SEOA 3SV3A 3HHLC 4DQRA 4ED5A 4A8WA 1O8BA 3Q8UA 4JI4J 4XAKA 3MCOA 1VIXA 4TYBA 1NJXA 3D0HE 3HKWA 1XNQJ 3OR2A 5EWFA 5KG1A 2HRYA 2KB2A 3J7Z5 3D1OA 2FVRA 1YJTA 1L3TA 2UP1A 3FQKA 4ECYA 2JL9A 2FHOB 1IJFB 2OD6A 2FY8A 2Z30B 4IH7A 5KFLA 2XC9A 1DURA 2DNYA 2EFGA 5FDLA 2F8HA 3HHEA 4PG5A 5D0EA 4CTAA 4ITSA 4RNOA 3T5JA 3RR7A 3PY8A 2GFFA 4IR9A 1NZAA 3D66A 1RKIA 2YH0A 1VBZA 2XLKA 3BKUA 4DL2A 5KFCA 2CJYB 1RHUB 1HL6A 1P9YA 2V8PA 4ED6A 3T5KA 2DPIA 4L75A 4CRJA 5C2GA 1RT6B 2V34A 2VBYA 1UTAA 3W65A 4NLOA 3CCLS 1S0MA 2VASA 3I0SB 1RYSA 3NMAA 1Q79A 3P45B 1M0SA 4J9RA 2KTQA 4NXNJ 4ZPCA 4QWBA 1C1BA 3VALA 4A8SA 4WE1B 4ZOSA 2XO7A 4P6QA 1RT2A 3BN7A 2UUAJ 5B0AA 3X1LB 3W2VA 1J2VA 1TL4A 2AP6A 4F26A 3ILOA 4LF8F 5ETLA 2MGZB 3GFZA 2HFSA 3T9NA 1K1QA 1EJ7L 2MQLA 2RE1A 2MXYA 4DV4F 4QYZK 5IT0A 1GXUA 2CNKB 3I56S 4NLRA 3B4MA 2DGSA 3V6JA 2FLOA 1YRTA 2ZVIA 5AXNA 2QL9B 4FXWA 2DNNA 4KAIA 4M94A 1NDPA 5KFOA 3BSAA 2ZFHA 3H0PA 2IYGA 2QJ3A 2FHJA 2IAJA 3OXFA 1FXRA 1S4EA 3NGDA 2BR0A 5F41A 2FJWA 2UXBJ 1AA1B 3PRDA 2JDJA 1GEHA 3BQ2A 1VC5A 2YPYA 2KO1A 1F2HA 5KT2A 3EPGA 4C9DA 4PRFA 4UZBA 5GADI 3DC2A 1B0TA 1SKUB 3DLEB 1FT8A 3OSPA 2HNDA 4KB7A 3ZZYA 1FWLA 5HROA 3EYZA 1NK0A 1TV6B 2HLTA 5HMXA 4YHHF 4DR2F 1MMLA 2VDHA 1S6PA 1HI1A 1S1TA 3OXLA 3EVMA 1FXLA 1LWEB 1WORA 1K9MT 1UAWA 1RLCL 3D6MB 2OTJS 1AXQA 3SCJE 1VQMS 4LF6F 1JLFB 4I69A 3T1YF 1TKXA 3UQSA 1YBUA 4O23A 4ED7A 1CSJA 4LT6A 5AE2A 3SIPB 1GQEA 1IM4A 3CCTA 5JUMA 3KK2B 1LV5A 3MEKA 3M32A 1JLBA 2L9DA 1HMVB 2M8HA 3BGUA 4UTGA 4WZMA 2KDOA 2QEXS 4NEYA 3TW0A 2Y1RI 2CJKA 1OO0B 2J9CA 1ZPWX 2L41A 5HP1B 5LM7E 4ELTA 4OI3A 5DDOC 4DR1J 3PEHA 1U0HA 1R31A 1NHUA 2VFSA 2E29A 2HS0A 2ZNZA 2J6UA 3HFKA 1HYSA 3ITHA 2XGQA 2KFNA 1U6ZA 2RKIB 4WFYA 1KLNA 4F4WA 2ADCA 2FTRA 4RWWA 5KFNA 3TAPA 3LPYA 2WZ1A 4QJVA 1VQPS 2MKKA 1RWWB 4QYRA 1CS4B 1HI0P 4NRUA 4NASA 1FDBA 3PKMA 4CLLA 3TUJC 4QWCA 1U0SA 2KU7A 4J91A 4LF7F 3U02A 3CEDA 1S6QB 1ZTTA 2NXNA 2J9DA 2HG4A 2WBRA 1S9FA 2MQNA 2CJ9A 1SC4B 2GW8A 2N4CA 4IG0B 1UEVA 5A8RA 3OJUA 2AJ2A 2XGPA 3BSNA 3DLLQ 2V2VA 2GAGC 1VBKA 3CO0P 1N33F 3V4IB 3I0SA 5SUHA 1NK9A 2X1FA 3QGIA 5J2QB 3ICLA 2HMIB 2BE9B 4PR6A 4Q8EA 1RWPB 4QR2A 2K1RA 4WFAQ 4ZVPB 4DPOA 2HHWA 2DY1A 4JI2J 4DV4J 3R1HA 4DR3J 3KJVA 1MN7A 3CJTA 4E2FB 2WOMB 2QL7B 1GXLA 2JLEA 3N79A 3CJ8A 1HNWF 1ROFA 3DMJB 2E7XA 3LPEA 1XN9A 2HBRB 5LSRA 1TVRB 2P2CB 2YQ1A 2ZKTA 4PG4A 4H4OB 1JLBB 1Q8IA 3TANA 1YZ6A 4LSLA 4OYAA 2PMZD 2FC9A 1KFDA 1T9TA 5KFJA 2CQPA 2ZOGA 4Z7YA 3T6JA 4X2BA 2UUCJ 3JYTA 3DU5A 3QQCD 4HHUA 1RWVB 4RNMA 3VWSA 4J37A 1VFJA 2IDLA 4N7TA 4QZVB 4DCPB 5I3QA 4YFUA 2HRUA 3NL0A 1AFIA 2KZZA 2G9OA 2ZH8A 2ASLA 5I42A 4B17A 3MPWA 1M90T 4I6WA 3J81j 4RBTA 2MZ1A 1CJUA 3VF0B 1SC3B 5CHCB 5KOXA 1VJWA 2M2BA 3ZZ0A 3AB4B 2WTFA 1FRLA 2VOPA 1W25A 1TL7B 2LA6A 2BX6A 3HLUA 2B51A 2WVEA 2IVFB 1RTZA 4V19J 3GTYX 1D09B 2YNIA 2F9JA 3FC9A 2IYIA 3LH2S 3T6BA 5B0BA 5K8OA 4ELVA 3NOCA 2UXCF 1KLMA 3QSIA 1T95A 1UL3A 3LWLA 1FJGJ 1NHVA 4TQSA 4RW6B 2HHTA 4YDXA 2MMYA 3EZUA 4P71A 3M1VB 3KUGA 3O2IA 5F8MA 5DGAA 2BBEA 1SJRA 1WJ9A 4HTIA 1JIHA 5B0GA 2DCLA 3G71S 1RISA 2B6AA 1QSLA 4UUXA 5KG2A 1U1OA 1Q8KA 3UNYA 5F8GA 1ZAXA 3G6YA 1TK5A 3HHLB 1PC4A 3LO3A 2J0WA 5GMKa 5ETPA 1NSAA 3KLEB 3KK3A 2ZHOA 1MROA 2BV3A 2EXUA 1UZHA 5GAEI 5HQLA 1FFSB 2AJ1A 3RGIA 4N41A 3AD8C 4PWWA 4XO0A 4WU2A 5KG4A 3DCAA 3U7JA 1UKUA 1JLQA 3VGVA 2LDIA 4RR5A 4DL5A 3MD3A 1SH2A 3GSIA 2BXJA 2VL1A 2C2KB 4QYZJ 4Y6IA 1WSRA 3QIPB 5E3RA 3HO1A 3CDUA 3PX0A 5A8KB 4CM0A 1KQSR 2DJWA 2VHGA 3BO2A 2VD3A 2GIQA 3DLHA 2PE8A 2RUGA 2YKPA 4OZJA 4WP8A 3SDEA 4QBUA 4USJC 3N6LA 5KFSA 4CNYA 5LT5A 2RNEA 3OUYB 3R2DJ 1N33J 4FF3A 3W63A 1RBOB 4KE5A 3G8SA 4ZP7A 4DS5A 3K5LA 2AX0A 1ZZFA 1C4AA 2DXFA 4EI2A 2C22A 1UA1A 3M2RB 3E8OA 3UFCX 2RDJA 4ZLJA 1EETA 1X4HA 3BDPA 3KHLA 1IWGA 1OIAA 1SC1B 1WC3A 4HKQA 1DFDA 1PBAA 3G82B 1HNWJ 4ILRA 3FMBA 2LEPA 3M2VB 2RU9A 1C0TB 2QFJA 1P9QC 2YKOA 4H4MB 3T19A 3DRPB 3CCZA 2YPZA 3FEYB 2VH7A 2Z4PA 3Q24A 2M8DB 2JEJA 2R7UA 5IOLA 2I5JB 3SFUA 2IY5B 1CC8A 1FKPB 1Y11A 2KJWA 2M88A 3HD1A 1WOOA 2LP4A 3W2WB 2CRLA 1OPZA 4OI6A 5A8WB 4N8NA 3GIKA 2ZBCA 4HT5A 1YVFA 1BQNB 1KHWA 4KV8B 1IKXA 4KT0C 2FZGB 2MQMA 4AUKA 5KTQA 1I1GA 1U7LA 3FZ2A 1RA7A 2F1FA 3FCVA 1WHXA 4MKBA 3TOQA 3GG1A 2YY3A 3UVJB 3ZZRA 2R7VA 3G2XA 3U1NA 1HWLA 3UN5A 3MUTP 2E7VA 2R4FA 3KG4A 3M8RA 2DBBA 3UD3P 4M95A 2XMUA 1SJQA 4Q5VA 3OL6A 5HROB 1JXVA 1R7IA 1S6QA 1HWIA 2YWGA 4D3GA 4DHVA 4M5DA 4FKXA 4KH0B 2DEJA 1LW2A 4ZS6A 4MTPA 3GR0A 5J2PB 5GAEU 3IP0A 1AUSL 4OFZA 5KT6A 2YNHA 5T14A 1EQ0A 4CO2A 1S97A 2Q1LA 2X1GA 4NLYA 1Y5IB 5EWGA 1R8AA 2GMLA 4OHXA 2E5IA 3TVZA 3GV5B 3BQ0A 2DH7A 2IA6A 1TFWA 2VV5A 2Z56B 5C25A 4IO1A 1IXKA 2XS5A 3QT6A 4HACB 1X5SA 5A8WA 2DR5A 2FDNA 4WPAA 2FLLA 3QATA 2AWZA 1ZOTA 4ZMMA 2ZWPA 2V4RA 1W7WA 1LWCA 1T0TV 3BSCA 2MY7A 4FZVA 4C6AA 2FHMA 3ZNUA 3TAQA 4MK8A 4NPOA 4EYHB 4C0BA 1S59A 2ZH3A 5K8NA 2B7BB 3BB5A 1VYAA 2GHPA 3Q23A 3RAQA 3VGUA 3WX4A 3TX0A 4F3QA 2I8EA 2POKA 4ECQA 4W4MA 4URSA 4ES3A 2HWHA 1XNRF 1NH8A 1VQSA 1IKXB 4JI6F 2E9RX 1WTFA 1OWXA 2BJ1A 3D0GE 2FPHX 2GJ2A 3UDLA 4R5PB 2Z2YB 4OYWA 1NB2A 3IAM9 3LP1A 3QGGA 1DQ8A 1IJEB 4ANDA 1QE1B 2GVDB 2A18A 2VQFF 1LOUA 2W7AA 2LKZA 3HF5A 4CT8A 5IM0B 2GX8A 3NXZA 4ZLLA 4QWDA 3CSKA 4AQYJ 4ED3A 2QX0A 2K7KA 4OYIA 4RW7B 4S0MA 2GJFA 1EP4A 1NDLA 3AHPA 2LU1A 3B8HA 2B8PA 4UOCA 5EGYA 3OL8A 1U1RA 1HR0F 2JOQA 3QLHB 3MD1A 5D0HA 2UU9J 4HL9A 1CPZA 2JC0A 1MNEA 4IO9Q 4JI5J 3UNGC 1TL3B 3W9HA 1MWQA 3AD9C 3TUZC 2IJNA 4XPEA 2R8GA 2VU5A 3S1TA 5HQMA 1RT3B 1Z1ZA 1FRIA 3CD7A 3LGMA 1HNZF 3RTVA 5A0YA 1BGXT 4B9TA 4KGKA 1IR2A 5LXYA 5BYRA 2W25A 3W66A 2AD9A 3AAWB 3HI9A 4PEOA 3SCKE 4OYBA 2ATCB 1JNRB 2WONA 4KSEB 4O44B 1SUQA 4YB5A 2AQ4A 2HWTA 3UVJA 3TARA 4J9KA 3L7OA 5IT9U 3HJVA 1PJ5A 2FVQA 3KKFA 2WAQD 7FDRA 4QOTA 4LR7A 4GVBB 3MMBB 2KH9A 1HI8A 5KFYA 4HYKA 1FD8A 3PW0A 4LREA 6AT1B 2N82B 4DL7A 5F3TA 2JFDA 1WG5A 1Q4RA 4ZJQA 3UDVA 1T3OA 4DR7F 2AJ0A 3FDSA 1HLWA 2EG2A 1VRUB 1IUJA 2R8KA 4C3KA 4E98A 3M32B 1VC0A 3PYGA 2AEMA 2W2QP 4F0KA 1FF2A 3PJ9A 4ZLPA 3K0JA 1FRMA 4URQU 4OHZA 2H4WB 4F36A 1XMQF 2DRBA 4I2QB 3L7PA 2NUHA 1P8GA 2LDYA 4CO1A 2F40A 5HANA 5BYQA 5DZ7A 2JEFA 1YJ9S 5IFMA 5FJ4A 3M6XA 3DXBA 1WWHA 1VQYA 4GRSA 1MLAA 2NQPA 3KTQA 2HRTA 3CJRA 4ZN1A 4DV2F 4FXDA 3MI7X 2YX1A 2XMVA 3OFHA 4IG3B 2CG4A 4K8RA 1DZ5A 4CCHA 3DM2B 4JV5F 1R6YA 2BJ8A 4EYIB 1CS4A 2BKOA 5C2CA 3VAHA 2EBGA 3IM8A 4GVBA 5B0CA 3DRRA 4IOAQ 6FDRA 1PKUA 5HVHA 2P9EA 5A2QY 1N48A 3QIPA 2EBEA 2DHSA 2XLIA 3CULA 2HBZB 2D7SA 4NYZA 4LR9A 5A8RB 1UZDA 3JYTB 2W4DA 5J2MA 2Y1IA 1IKYB 3FQLA 4QR0A 3MEEA 3RRHA 1VCTA 3KUEA 1N5YA 1DTQB 2QIFA 3DI6B 1R8PA 1REGX 5K14B 1U09A 1UPMB 3VR1A 3FCWA 1VC6A 1HNZJ 5KFMA 1OYDA 1O0PA 2GQQA 3C19A 2PEHA 2ZUGA 4OZ2A 4CLPA 2CVIA 1LQ9A 2H51B 3LP0A 3QIDA 3ULHA 1TV6A 1F3FA 2LEAA 2EKYA 2QYGA 4WKYA 2DNKA 1Q0NA 2XLJA 2HHVA 4G6VB 1YJNS 1ZS6A 1DQ9A 4R0JA 2XMAA 2MPUA 3H2LA 4RW6A 3EICA 2DVIA 2HQ3A 2M70A 1SKSA 2W7PA 4HI1A 2HVIA 1R3NA 4C8ZA 2DISA 2ASYA 1G3OA 2CUYA 1OY6A 4RO0A 5KG6A 2QN6B 2CZVC 1YLXA 3RZAA 4RL1A 3WZ0A 2Y3YA 5D15A 3VCDA 4I6YA 1F0XA 2MZTA 4LF5J 3ZNJ1 1U48A 1MW7A 1JLCB 2AF6A 3LTOA 3G4SS 4F50A 3H90A 4IH5A 2WW8A 4BDPA 1WDTA 2OD4A 2W2NP 2G1DA 3KFWX 4MH8A 2FB0A 2CWXA 4ATNA 4B3TF 4DL3A 1H98A 2JSXA 4J9UE 4RNFA 3QGHA 3M30B 3TA1A 4DBQA 1MG7A 5FIIA 3UN2A 1X60A 2F8MA 2JLGA 3O1LA 4DLGA 4JV5J 1RHMB 5CAAA 1S5ZA 3JTOA 5A0YB 1XR6A 2ZVSA 2MQQA 2E5GA 4M63A 1APSA 3MR7A 3A8IA 3MM8A 3MEEB 4D3HA 1SJ3P 1YBTA 2E1CA 2ZBIA 4HR2A 3VQTA 4C3MA 1VR6A 2A0FB 5FLXY 4XDCA 2KYZA 1BWVA 1RACB 3DGPB 3KLIA 4RUAA 4JI3J 2OP5A 2CXEA 3G96A 2MKHA 3TZXA 3F73A 2AYBA 4FF1A 1KTQA 1O51A 2NXJA 2WVCA 2ZE2B 3CJ0A 3HKZD 3R5DA 2IRYA 2XMKA 4TY8B 2H9ZA 3NY0A 4DR5J 1FNOA 1K73T 3V6HA 3V6DB 4CLKA 1EZZB 3GYXB 1F5BA 1S1UA 5ETSA 3KLGA 4ED1A 1PO6A 5E7OB 1AT1B 3D1QA 4NA2A 5IC6B 1LFWA 2IC3B 3I5AA 3ONQA 1TVRA 2J5AA 4CM2A 4CLZA 4OI0A 3GSDA 4PXCA 3R6LB 4F4XA 1QVFR 2EFVA 2FJVA 1F9HA 4B9MA 4WF9Q 2J7KA 5I4MA 4JBCA 4DUZF 3IBCB 2B5JA 1R0CB 1LWXA 1UFLA 4USIA 2BJEA 4DMZA 5LSOA 2DNRA 3FSIA 5EN1A 1XERA 1IN0A 1H2TZ 1R0AA 1IVZA 1XEZA 3HZGA 4CDIA 4WFNQ 5J2QA 1F9EB 3W9JA 1TKTB 3M6VA 1OSCA 3OR1A 2F3JA 1V3ZA 1VRQC 4NRTA 4DPXA 5IS2A 4GC7A 2A10A 1FERA 4TU7A 1V3RA 1X4EA 2E5JA 1TU0B 3SDEB 1KR4A 3PNIA 3IMQJ 1F5AA 1NBEB 1NUEA 4ZVFA 1B70B 2PD1A 4DV0F 4B3TJ 4K4SA 5M2RA 1TAUA 2RMLA 1EKSA 2GV1A 2ASJA 4Y34A 3H2UB 3IC1A 4UQGA 5A76A 5DM7Q 1N5SA 1AUDA 5T41A 4ZVEA 4MK9A 5KT3A 4DCOB 2VJVA 3A1YG 3NCQA 7FD1A 3TJ8A 2DYAA 5HBMA 4OLPA 1S6PB 3MUMP 4NLDA 3POTA 4ZKAA 1TQLA 2XCPA 4K4ZA 1M5SA 1WC0A 1XMBA 2YKMB 3ENWA 2RSQA 1RHKB 2PMHA 3P5BP 3DYAB 2JH3A 1S72S 4TXSA 2C2DA 4OZ5A 1CJKB 1WD6A 1X5PA 2E1MC 2F65A 2BEFA 4ZPTR 1RTJB 3LGHA 2D3ZA 5KFXA 1S99A 3R3TA 4ZIWA 3GP9A 3ZTOA 2ALZA 1KSPA 3FBEA 3FFIB 3M6WA 2VBWA 3KHRA 3OVBA 4QW8A 2J6TA 2AW0A 4KQZA 4OX6A 1ZM4A 4LFBF 2DO4A 4N8OA 4ES2A 1TKZA 2HK2A 3UD4P 1VQ6S 1U02A 4RBVA 4KIAA 4C8NA 4H4KC 4NLTA 2ZITA 1RT1B 4RJVA 1CJVA 2KN4A 1JWWA 1FEHA 4JOUA 5GMEA 1WUUA 2KXHA 4IDKB 4WXWA 3VGSA 2IA0A 3W60A 1GK8A 2CQBA 4IG0A 4O3OA 2GGPA 1ZAVA 3SXLA 1EHWA 2DH8A 2W7OA 4PPZA 2FLPA 4KGXB 4B3SF 2HWIA 1U1KA 4P7TA 1SQGA 1RT2B 2Q3PA 2XCAA 1N36F 4IFYA 1D3WA 1KKHA 4WYWA 1HPZA 4GC6A 1KRPA 2ROPA 3ADAC 1FX2A 1RP5A 3ZZPA 2V2ZA 1RABB 4KTQA 3LOUA 2BANB 3R5JB 4ZPDA 5CYMB 2AX1A 4DPYA 2W24A 2YNFB 1TL3A 2OPSA 1S1WB 2PA8D 3H5SA 1UVKA 4YB6A 4FNIA 3FK4A 3RBDA 1SL0A 4U95A 2ASDA 3PIOQ 1HHSA 4ZHRB 2HLUA 2ACYA 2DHHA 3KJFB 3KJNB 4NEZA 5L38A 3QJPA 5HP1A 1PSDA 2QLBB 4Y2MA 5AXMA 4NXMJ 2DNHA 2MQOA 3CVKA 3M8QA 1P27B 2E5HA 2DR7A 3LALA 3ET6B 2HVEA 4Q7AA 3QZ7A 3UE2A 2J7WA 4ZPWR 2G1HA 4DV5F 1TZ0A 3BYRA 1XMQJ 2C2EA 2EW9A 3KHGA 4EBDA 1H38A 3TI0A 4CIOA 1WKJA 1EETB 3NG8A 3HHKA 4IQMA 1RAFB 4H4OA 2XNQA 3DOLB 4CLYA 1QSSA 1R43A 2IC3A 2V8VA 2V9KA 1RBAA 3CT9A 2ZJQQ 5B08A 5F3ZA 4PUOB 2KFYA 2E1PA 1ZTWA 4MIAA 2CQCA 1BQNA 2AYMA 2FIUA 2NS1B 2XI2A 2Z2MA 2WK4A 1PYOB 5FD1A 4JB8B 4FVCA 5JXSA 2HZVA 3OTDA 4B3OA 1S48A 2AZ3A 2X51A 5E5NA 1TL1A 4MFBB 4IUFA 2KKHA 1WSVA 2P9CA 2QMXA 1VQOS 3P49B 2HVHA 4UF4A 1H2UX 5DDPC 1FHTA 4NLUA 1HFEL 3IRWP 2W9CB 1MU2A 1RT4A 2CPEA 3NBPA 2JNJA 2ZM6J 1U2CA 1XMOF 2UVWA 4FKYA 4I56A 2FHKA 5CZVA 4DZ6A 3EXYA 3H4BA 4JI1J 3I6PA 2VIHA 1N32J 1DRZA 3SZ2A 1XR5A 4Y28C 5CYQB 2M5YA 2DNZA 3FSYA 4G1QB 4WIIA 1SL1A 2XB2D 3QO9A 4PWDB 4LIRA 2ROGA 2YBVA 4UOFA 2C3OA 4OHVA 4W90B 1N36J 4O4GA 4ETXA 1NK8A 4WIQA 4FN5A 3MM7B 5DM6Q 4CH7A 3BPSP 4JI8J 5C25B 1EARA 1HBMB 5KFZA 1J5EJ 2OMOA 5EDWA 1RK8A 3M30A 2IIHA 4I64A 1AYEA 2B9XA 3NGSA 2BMBA 3D1HA 3O44A 3T3FA 2JFKA 1DTTB 2DR6A 1RWXB 4UOGA 1E6YB 1QSYA 2GJIA 4F7VA 1HNXF 1A0OB 5DQIA 2HHHF 2J7UA 2D9OA 1JK9B 4B3SJ 2VKRA 2YWEA 2V94A 3B78A 2HNDB 2GC8A 1YJUA 4ED0A 3P4UB 2OMLA 2XWXA 1IKWB 4CO4A 2MZSA 5CQGA 4A8MP 1VQKS 2HIYA 2MHEA 3C14B 3D7SB 3KNGA 4TYAA 1W2BR 1B64A 2XSFA 4AE5A 2YWWA 1GT8A 3MEGA 4X4NA 4P72A 3TQEA 4JI2F 1G4CA 2VPXB 4XDDA 4ZITA 1NO8A 1TL1B 4PPDA 3N5BA 3O6QA 4XIUA 4P2SA 2VZ9A 2BOPA 1WHWA 2P9GA 3JXOA 2I5JA 4P10A 1QY7A 3OLAA 1NEEA 4URGA 4UY85 2JZ5A 1I5OB 5H9FJ 4FP9A 2VICA 4DV1F 3M2RA 1SPBP 1T94A 2QA2A 2LMIA 1WG1A 3B6BA 3DYAA 1IQTA 2E7WA 2YWHA 4I2PA 1XWLA 2F5GA 5KG0A 4YS2A 5BR8F 1M1KT 1Y00A 5HJYA 2N3LA 1HBNA 1IKVA 1LEOA 2CQ3A 2HQDA 2RQMA 4AXJA 4CNZA 5B7WA 5GAGI 4DSIA 4NCAA 1G6BA 3JSYA 5AJ3J 5JVHQ 3CD6S 2DHAA 4CYUA 2RU3A 1I94J 3KLHB 2CA9A 1GMWA 2IRXA 3VVUA 5MAOA 2VPZB 3GWCA 3OL9A 2VPWB 4RW7A 4ZA1A 4Y00A 4ZHRA 4DWIA 1Q5VA 2ZZNA 2EFQA 2LEBA 2HHQA 3BR9A 5IZHA 3K59A 3LA0A 3UN3A 1RAOA 3IR5B 3FBFA 2OTLS 4LBPA 5I42B 1LK5A 4I7FB 1MSWD 2RRAA 4MKYA 1D9DA 2YX7A 2V2QA 4NOHA 4OI4A 5AXLA 2XY5A 5THWA 2BW7A 4Y0FA 4IRDA 1DLOA 3RBEA 4UUWA 1NSKL 4EWTA 4FVMA 2B6AB 3HDSA 5H9EJ 4PCQA 1HQEA 1SCJB 1NK7A 3MWBA 1TKXB 3NGKA 1S9EB 2HNYA 1MROB 5DDQC 2FJBB 1PJ6A 2R2SA 1IBMJ 1RTHB 4NLSA 2VKZG 5M2UA 2Q6CA 1NPPA 1H3DA 2Z58B 3MEDB 4B3MF 4RBUA 1LK7A 3PEJA 2DNOA 3J81Y 3NKYA 3W9IA 1YRXA 2BKPA 1VOMA 3EVOA 5KFHA 2QSFA 2R7OA 3N5FA 4CT9A 2ZDOA 7AT1B 5L9XA 1N0UA 2X7IA 2OFGX 1OMSA 2H1YA 3CNQP 3LW5C 4P2MA 1RT5B 3MFHA 1JB0C 4U7UK 3MR5A 2E9TA 5KFGA 5G0RB 1Y9OA 2ALYB 2KJVA 1X9SA 4NI2B 4R8UB 3RB3A 4YDDB 4LF6J 1I51B 3KG1A 3DGPA 4F4YA 1FK9A 1PYSB 2XHWA 2U1AA 1HBOB 4C48A 2AYGA 1NXIA 5AT1B 4J90A 2FVSA 4NLWA 1M5OC 3KNAA 2CPJA 2XMMA 4L3NA 1YKWA 2P6TA 2Q43A 4RPFA 3GJTB 5M2PA 1KVJA 4N5SA 3DU6A 2C42A 1D9FA 2A2DA 2DXDA 2YX4A 2HNYB 3PW5A 4F2SA 1QTMA 2OHDA 5KG7A 2IM1A 3A12A 4X66J 4TQRA 4DR2J 1Y4ZB 1PJ7A 2Z2ZA 4J9PA 3MM5B 4CO0A 1AROP 1YX2A 3HHDA 1DLOB 3BPDA 5ETKA 3WQPA 3PV8A 4FYVB 4RW9A 3T1YJ 4USWA 5DG9A 1E6VB 4FF2A 4USMA 3LWMA 1IBCB 4KHMA 2VPYB 2XMWA 5D77A 5LMUJ 3HHLA 4OYOA 3KK3B 3V81A 1RTIB 4K5SA 4GVLA 3G8TA 3HT3A 5HVFA 1H6KX 1RT7B 2VB6A 2VBZA 5HLFB 4IFVB 2N7YA 3CWJA 1S1UB 2Q66A 4KFBA 1HA1A 3UCGA 1HNIB 4Q0BA 1U1MA 4AFFA 4PKDB 1A9NB 3MM9A 1VI7A 3G87A 5KOWA 3S8SA 2DPJA 1DTTA 5E33A 3TZZA 3MAQA 2ZDPA 2HW3A 4NYOA 4DUYJ 4DV3F 5HMWA 1RT6A 4Y3CA 3R5CA 5GMDA 4IYQA 3IR7B 1TELA 4RW4B 1AFJA 2I38A 2Z57B 2OPPB 2GS8A 4NZ0A 4QIGA 1CJUB 3MOZA 4C7QA 4ECVA 2VG6A 2AGPA 4HI2A 3AJ2A 1NJZA 4K50A 4N47A 3HSGA 3E51A 1TKTA 3CMES 3JB9k 4DX5A 1F1BB 1A6LA 4CYUB 4NLVA 4F0HA 4ECZA 3KK1B 1S7HA 2MQ8A 4DX8H 2MGZA 1SKWA 2VQEF 3IBWA 1RAEB 5CYMA 2R2RA 3R8YA 1SIWB 3QNWB 3M9MB 4JI0F 1PGZA 4TN2A 4YMEA 2M7SA 2AU0A 3CO9A 2CPXA 3PHEA 1HNIA 2FZCB 3SSRA 4Q0BB 4FPIA 2MLYA 4ANEA 1TUGB 5CH7B 4NA3A 4B9VA 1HBMA 5DDRC 3EWGA 1GX5A 3GIRA 2UV8G 3CJ2A 4UW2A 1ZM2A 2XSJB 5ETQA 3NS6A 3KLEA 4ICLA 4ECWA 4NCBA 4ERDA 5AE1A 1P6TA 1N54B 1SBRA 1ZM3A 1YK9A 2ZOMA 3DLEA 2FJEB 3PXGa 3CCRS 1KFSA 3CDAA 2CQ1A 3RW6A 2BW2A 2ROEA 3B82A 4CO3A 2H4YB 4PYDA 5K5MA 3Q8QB 1N56A 1HR0J 4PQUA 1Q53A 2GVZA 3NNCA 2QRRA 3EJMA 1EX8A 1XMOJ 3CCJS 4X65F 2OSRA 3BZQA 1JLGA 2O5DA 1CG2A 3GE9A 3QWUA 3WX8A 1VQ4S 4RLEA 2W01A 4QIFA 3ISNC 1VQLS 1VRUA 2DNLA 4F4ZA 3HVWA 3IS9A 4X66F 3M7VA 1S6UA 4MFBA 4B9UA 4DR4F 4N76A 2XYHB 4NMXA 4FYXB 5L1LA 1VHIA 3M8YA 2AHOB 4LUBA 3H40A 2DXEA 3P6YC 3PRVA 2QT7A 1EB0A 2NSBA 1VIOA 3CF5Q 2D3UA 1N34J 4ILMA 1J5EF 5K14A 1FVQA 2CAJA 2HBQB 3QT5A 2CPZA 4YP3A 1FK9B 2CG8A 4OI2A 3Q8PB 1FTCA 3L95X 2EG1A 4ZP6A 4LQ3A 3J7A1 1LWFB 1D8YA 4CLWA 2U2FA 3M9NB 4N56A 2XSJA 1O6XA 3LUYA 4M5LA 3ETOA 4OJHA 4TKTA 4Y2KA 2DNGA 4C0OC 2MDAA 4ZCLA 4F04B 3WC2A 3VTIA 3TVYA 1ITPA 4J9OA 4H54A 1MWYA 3WHIA 5DETA 4Q45A 1WF0A 5EWEA 2CPYA 2VFVA 2YTCA 1LWCB 2PA3A 4ECUA 2G2ZA 3MTKA 1KBRA 4GMKA 4TVAB 1YBAA 1NKCA 2V9WA 2V8HA 1VQ5S 1RU2A 5HSPA 4O3SA 3PFEA 2APOA 3C6UA 4JI0J 4DV3J 1TP7A 5KT4A 4J9QA 3A8KA 3JAMU 2LECA 4K4UA 2V6AA 2LXFA 3BH7B 4WXOA 2YXLA 2IM0A 3U27A 2IJFA 1VQ7S 2YQ3A 3QAEA 2JC1A 1RB0A 2GMHA 4RU9A 5DG8A 2M3DA 2YNGA 4X4TA 3V4IA 2AJFE 2FVCA 3R7BB 2RJZA 2CQ4A 2DGOA 4G1IA 3LP1B 3PCOB 4P73A 2NXEA 3DOLA 1WHYA 2D1CA 1UVMA 3QJJA 2RIJA 3R2CJ 3TA2A 3MPVA 4G1PA 3J7YU 1KONA 2DB1A 2XNRA 1H0HB 5E0OA 3EPIA 2HFZA 4P2FA 2WOMA 1UA0A 1UEUA 1JNZB 4Y2AA 5F0WA 4DPTA 4EUVA 1X8DA 2CPDA 2CPHA 4FYWB 3ILLA 2FY1A 1QD1A 4X4OA 2C2RA 1Y7PA 2PT0A 4ID5A 1I94F 3VVTA 1RTDB 2K3IA 1OY9A 2ZBRA 1KWMA 1JLEA 4DR4J 2Y0SD 2HHXA 2EKNA 3B4DA 3DLKB 3SCIE 2CJQA 3D5MA 5T7LB 3BEGB 3IR6B 1T03B 2DR8A 3M05A 3ILIA 3OVAA 5L1KA 3N6MA 1RT3A 3MPDA 1ZBTA 2VFUA 2W8LA 4EBEA 4A47A 3CCMS 1IR1A 3HJFA 3W8GA 1X0PA 3ZC4A 2P8IA 4LRAA 5IC4B 3MM9B 3KK2A 2BQ3A 1YJ7A 1RHRB 1SC6A 3AT1B 1R8CA 1CBKA 2AEJA 4OYPA 3T5LA 1KQKA 1HWUA 4ZVRB 1SQFA 2J0XA 4ANCA 3QT7A 3MF5A 3MEGB 4OV6A 2B4PA 3CIMA 8RUCA 4C8KA 4QR1A 1HHQA 3R5BA 1TAQA 4YR2A 4ECXA 2MZRA 3I4HX 4WTYA 3TZWA 3CPWR 3J80Y 4DF8A 4OYZA 3R7NB 1U6FA 1U26A 1BHNA 3M1VA 3QT8A 2WW4A 4DV7F 4QU7A 1Q16B 4ALZA 2WSFC 3MMAA 3GFYA 3MTJA 3QAUA 1VQNS 3F56A 3THVA 4R0EA 2UVVA 4U8VA 3JQMA 2ZE2A 3SFGA 1S10A 4KJIA 1WKLA 3U1LA 3C3LA 2GIFA 2PEBA 3DRSA 3OTCA 2AT1B 1KC8T 5G4DA 1G2EA 1KVIA 3BGLA 1YJVA 1EAYC 5D3GB 1FTRA 1RGVA 3DRXA 1RI7A 1U8SA 2GO8A 5GADU 5ETRA 3QPIA 4LF5F 3F41A 4GKJF 4NWBA 1B0PA 3TO8A 4DI6A 1KHVA 3AODA 4C97A 2HQGA 2KXNB 4PUOA 1FE4A 1VQ9S 2H5JB 1SH3A 4DJBA 3J7YI 1SXLA 5KFKA 2AJQA 1M5HA 1LWFA 4Q2LA 2ZH1A 5GAGU 1RT1A 4F02A 5D0GA 3N01A 1V6HA 2D74B 4NX9A 3R1LA 3MZIA 2W1BA 2EEYA 3FRYA 1RU1A 2DO0A 4WBFA 2JHEA 1Q95G 4ZIVA 1FJEB 2LCWA 4M1KA 3AJDA 2Y1LB 3A8EA 2EVZA 2CWKA 2OLWA 4DFPA 1Z2ZA 3FVYA 2WB1D 3CJKA 1L3SA 1NB7A 4ED2A 3I31A 1U6BA 4ZVSB 1VMBA 2OH2A 4LFAF 1YDLA 5D6GA 1C1CB 3D54A 2UVUA 3I9V9 5GVQA 3VHQA 4ETZA 1VISA 4DFKA 5CD4H 1FKAF 5LMNJ 3CCVS 2R8JA 2G2YA 4JI5F 5DLGA 3EE3A 2YH1A 4K0KF 5J1NA 2BANA 4NL5A 4QPTA 4ZCIA 5K20B 3AOAA 4DL0C 2PN6A 1NU4A 1NDCA 1XBWA 3AXMA 3SYZA 1TMJA 3OFEA 4KO0A 4WE1A 3KLIB 3UO0A 4HTJA 4MKVA 4MAKA 1O5JA 4OJGA 3MM5A 1VJQA 1WEYA 3FCHA 4PXBA 3DHXA 2MZJA 2ZD1B 3K58A 1GH8A 2HVZA 4KY3A 4F8RA 1L3VA 2B43A 1OPIA 4YB1P 2E9ZA 1TUVA 4DV0J 2RHQB 2B9EA 1T03A 3EUNA 4L76A 4LR8A 2PMWA 2RF2B 4LF4J 2ERRA 5EHHA 2DIUA 4M5IA 3EM1A 1YIJS 4A8QA 1OQ6A 3V4MA 3MMCB 2CKWA 1TKZB 5KT5A 1UFKA 1AZSA 1X4AA 2FD2A 2OSQA 4P9SA 4F4AA 2IHR1 2X1BA 4HT7A 1JLGB 1LNQA 4O4RA 4ID8A 4A8OA 2MHNA 4O3RA 2ILZA 2F4VJ 4KHPJ 2BUNA 3X3UA 2AZ1A 3GCXP 3VAGA 3T5HA 1QLNA 3OTOJ 4YN3B 2ZKUA 4A8YA 1C0UB 1TUWA 2BJ9A 2I0XA 3BBCA 4DF4A 1GAOA 2EK6A 3C6TA 1RWUA 3MMJA 4O3PA 1IR0A 3MCSA 1HQUB 3NOGA 1HBUA 3PO5A 1WOSA 4CLSA 3OW2R 1H7WA 3QWPA 3ENVA 3R27A 4ZLNA 4LRDA 1M5KC 5D4NA 1IBKF 1QAJA 8ATCB 1UVNA 2F7VA 2UUBJ 1U4BA 1QAIA 4NZ6A 1KVKA 2OPRB 3CD0A 2JRSA 3HHLD 2ZH9A 3CCUS 3UR0A 3ZTSA 1ZYQA 3DRSB 4OZNA 4RUCA 3W3SA 4IOBA 1BXNA 4WKRA 1B7FA 3O8WA 3ISZA 1UCNA 5C42A 4EO6A 3UR3C 1NKEA 1XC9A 2XS2A 4DR6F 2EC0A 3M8PA 3W64A 4OIXA 1UW9A 2G0IA 4CH0S 3Q22A 1E6VA 2ZC3A 3IBFB 3QGPA 4NA1A 4OJ1A 3G6VA 2CDRB 5E3PA 4F3OA 2V8GA 5E2QA 4JV0A 2QE5A 3M6UA 4OJ3A 4LFBJ 3KJVB 4RW4A 2HAFA 3MUVP 5LJ5Y 2KHCA 1RDRA 2V0NA 2LQ8A 2W4PA 1FNXH 1V9OA 3BR8A 4AL6A 1T3NA 3BSOA 3CDWA 2I1RA 3K5PA 4PAAA 4FBUA 1REVB 5EX0A 3EGZA 3MM7A 3PX6A 2RS8A 1FD2A 1L3UA 2FJXA 1TMMA 1QVGR 3RB6A 4LF9J 4DG1B 5KFUA 1TR0A 3H8YA 4M5DB 4F3MA 3G8QA 1NKBA 2RRNA 1SVDA 4K7QA 5DRKA 2NLWA 1KDNA 2IMOA 4EGLA 2LQ9A 3E3XA 2I2YA 2BOAA 1RLDA 2MKIA 1XJWB 2HQCA 5G0RA 3FMWA 2D3OR 1FWPA 2BACA 2DGVA 3MECA 1TTHB 4DV5J 2VFTA 4K2JA 2IVMA 1N5QA 1YG0A 2BE2B 1F9FA 1T7PA 4L74A 4G65A 3KYLA 4BBYA 1G7CB 4C8YA 4QWEA 2IFXA 4HH1A 3ITHB 2AKWB 3RJMB 3FNNA 2B4UA 2B4VA 5H1SV 4IR1A 5I3UA 2DNQA 3HCXA 1SUQB 4MYUA 2P5VA 6FD1A 2K06A 5IXUA 2WONB 3GYNA 4CP5A 5IWAF 1BQMA 2RF2A 4IRKA 1R0BG 2KL8A 1EIYB 1Q8BA 1S1WA 2UUBF 3I5BA 2VF3A 3GG0A 3MMBA 3FBBA 3BN4A 3GCWP 4ZPBA 4KHPF 1PAEX 2OGUA 4C11A 3OHAA 2HKEA 2ZM6F 2G0CA 4HH0A 4JV2A 4ZCMA 3OR2B 4V19X 4OZLA 5A6WA 4JI4F 3KWMA 4DXLA 3RB4A 2WSEC 4QWAA 3GJRB 2CNNB 2BJDA 1S1XB 3EDRB 1RA6A 2NZCA 3VV2B 3ZTRA 4LSNA 3W5XA 1Y10A 1S9GA 2QLJB 1RT7A 2FGCA 3BH6B 3CC7S 3MECB 1ZZNA 2GGPB 1T9YA 2WVBA 2VQFJ 1KEKA 3LGNA 3DHWC 2J9DE 4DR5F 1Q5YA 3R5GA 5JVGQ 2VG7A 3BKTA 3PACA 1F6TA 2E5LF 3IS9B 1ZETA 4I68A 3U1MA 2IM3A 3VGTA 4A46A 5A8KA 3KLHA 4ZP9A 4W92B 3W5ZA 1S0VA 3MOJB 1ELOA 2QL5B 2V8DA 1ACMB 1VHFA 3M2VA 4ZDNA 4KRWA 4JI7F 2QFIA 4LF9F 1JLAA 4ZVUB 3RG6A 1MU2B 1RT4B 2FUG9 3NBPB 2OFHX 4LSLB 4U96A 3TYTA 1NK6A 2HHHJ 4HDGA 1UJ6A 4JYAJ 3D4JA 1BE4A 3JQJA 1BMQB 1WKKA 4KH1B 4ZVGA 1U1PA 1CQMA 3H59A 2DNPA 4I6AA 4ZN3A 3RBZA 2AV5A 2OEJA 3S01A 4LF1A 3TAMB 2LQBA 2Q79A 2XYGB 2QTWA 2B0GA 4OZ1A 4JI8F 2UUAF 4B9SA 1GXTA 2MEWA 4DX6A 1WDDA 9RUBA 4L73A 4F0MA 2J76E 3OQ2A 5I3UB 3UCUP 1N5YB 1IKYA 3UD5A 1RWKB 4A8KA 3K5MA 3EGWB 4NI2A 4R8UA 4Q2MA 4EO8A 3AFGA 4NCGB 2QC3A 1UJ4A 4RKUC 4DQSA 5GAHU 2KFZA 2LXIA 1N0VC 3PW7A 3CGIA 3HT0A 1BD6A 3C15A 3IGVA 1ULRA 3KUHA 3NP5A 2BM1A 3Q8VA 4OX7A 5B09A 4MIBA 5IWAJ 4DR7J 3MURP 5L46A 4DSJA 5HMZA 4YOEA 2AEFA 2RILA 2GCFA 2HQIA 2MLZA 4WFZA 3TUPA 3GR1A 1MWZA 4OI1A 4X4RA 3R5AA 4X4SA 3W5YA 3A8JA 5KFWA 1FA0A 4UZCA 5L9NA 4A8FA 4LSNB 4DQIA 4KGZB 4RW8B 2SXLA 4BS2A 4DS4A 2DK2A 1PC5A 1RWNB 3K8WA 4F67A 3E2EA 1S1VB 3BYPA 4PXDA 4LFCF 3TEHB 1A7GE 1LFPA 3PJXA 1M1GA 2C3YA 4MJKA 3ZXWA 4YUDA 5CA5A 4DSFA 2QSWA 1RHQB 5LXRA 3FGVA 3ZZTA 2UV8A 2B8QA 4PQAA 1RCXB 5L8RC 2ZH4A 2CNLB 2R42A 3RB0A 2OJ3A 4HHJA 1GFWB 3BQ1A 1K47A 5J1EB 3BKFA 3MM6B 5KFFA 1OQ3A 4NZ7A 1PIEA 4K4XA 3H5XA 1QTNB 1CVJA 4DSKA 2JEIA 4OX9J 3CCQS 1F5CA 2AJ4A 4JV1A 2C3UA 2QO3A 4AT1B 2O3DA 4J9VA 2NUUG 1VDHA 4KV8A 4UOHA 9ATCB 1E6YA 3WDOA 1SJFA 2CYYA 4K4YA 1VQ8S 5BXIA 1K44A 3Q83A 4LBHA 4DUTA 4U67Q 1YQHA 3H42A 5IQ6A 4ZPAA 5KG5A 1D8ZA 3JSBA 4KFBB 3DRYA 3NAHA 3MR2A 2B4OA 1PAUB 4J7CA 5DS7A 3HSDA 2XS7A 3EDQB 1VLYA 3TA0A 1RBLA 3C16A 4TY8A 1HHTP 3CCES 1IBLJ 3OPKA 3R6GB 2O01C 3TR5A 1Q82T 2VG5A 3K7RA 5HQ8A 2V2KA 3EXCX 5HMYA 4NXMF 3O5TB 1PBUA 4BC7A 1WEXA 1Z2LA 1UVJA 3CMQA 1JMTA
chains in the Genus database with same CATH topology
1RWXB 2HBZB 4DCPB 4DCOB 3GJRB 1RE1B 2CNNB 3EDRB 2XZTB 2QLJB 3R7BB 1IBCB 1SC3B 1RHKB 3P4UB 2C2OB 2C2MB 2H51B 2CNKB 3NS7B 2QL9B 1ICEB 3KJQB 2QL5B 2CJXB 3GJQB 4ZVUB 2C1EB 2Y0BB 1BMQB 4DCJB 4ZVOB 2XYGB 1RWKB 3D6MB 5IC4B 2H5IB 1NMEB 4LSZB 2C2KB 1RHRB 1RHJB 3QNWB 3R5JB 3SIPB 4ZVRB 1RHMB 2C2ZB 3KJFB 3KJNB 3IBFB 3R7NB 2QLBB 2CDRB 1RWNB 4ZVQB 1SC1B 2H4YB 1RHQB 2DKOB 4ZVTB 1RWWB 2CNLB 1GFWB 5IC6B 1PYOB 2H48B 4JB8B 2XYHB 1QTNB 2H5JB 1SC4B 3R6LB 1RWOB 2H4WB 2HBQB 3IBCB 2XZDB 2XYPB 1I3OB 1QDUB 3R7SB 1RWPB 2CNOB 4ZVPB 1I51B 2Y1LB 2QLFB 3GJSB 3RJMB 1F9EB 2QL7B 2HBYB 4ZVSB 1PAUB 2HBRB 3GJTB 2CJYB 2P2CB 1RHUB 3EDQB 2H65B 3D6HB 3R6GB 1RWMB 5K20B 3D6FB 2FQQB 3P45B 2H54B 1RWVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWX B;  2HBZ B;  4DCP B;  4DCO B;  3GJR B;  1RE1 B;  2CNN B;  3EDR B;  2XZT B;  2QLJ B;  3R7B B;  1IBC B;  1SC3 B;  1RHK B;  3P4U B;  2C2O B;  2C2M B;  2H51 B;  2CNK B;  3NS7 B;  2QL9 B;  1ICE B;  3KJQ B;  2QL5 B;  2CJX B;  3GJQ B;  4ZVU B;  2C1E B;  2Y0B B;  1BMQ B;  4DCJ B;  4ZVO B;  2XYG B;  1RWK B;  3D6M B;  5IC4 B;  2H5I B;  1NME B;  4LSZ B;  2C2K B;  1RHR B;  1RHJ B;  3QNW B;  3R5J B;  3SIP B;  4ZVR B;  1RHM B;  2C2Z B;  3KJF B;  3KJN B;  3IBF B;  3R7N B;  2QLB B;  2CDR B;  1RWN B;  4ZVQ B;  1SC1 B;  2H4Y B;  1RHQ B;  2DKO B;  4ZVT B;  1RWW B;  2CNL B;  1GFW B;  5IC6 B;  1PYO B;  2H48 B;  4JB8 B;  2XYH B;  1QTN B;  2H5J B;  1SC4 B;  3R6L B;  1RWO B;  2H4W B;  2HBQ B;  3IBC B;  2XZD B;  2XYP B;  1I3O B;  1QDU B;  3R7S B;  1RWP B;  2CNO B;  4ZVP B;  1I51 B;  2Y1L B;  2QLF B;  3GJS B;  3RJM B;  1F9E B;  2QL7 B;  2HBY B;  4ZVS B;  1PAU B;  2HBR B;  3GJT B;  2CJY B;  2P2C B;  1RHU B;  3EDQ B;  2H65 B;  3D6H B;  3R6G B;  1RWM B;  5K20 B;  3D6F B;  2FQQ B;  3P45 B;  2H54 B;  1RWV B; 
#chains in the Genus database with same CATH topology
 5A2Q U;  3TRG A;  1V5V A;  2XQC A;  3LQV A;  2F4V F;  4WU3 A;  2E66 A;  3JAM Y;  3DLG A;  4CLT A;  2GA7 A;  2DR9 A;  4BHQ A;  1BQX A;  1SIZ A;  2NXC A;  2RVJ A;  3LF0 A;  3IN5 A;  2R8I A;  4K4W A;  3PW4 A;  2HNZ B;  2RUS A;  3EGN A;  3IM9 A;  4MMO A;  4ZCK A;  2XY6 A;  3M4X A;  3OXG A;  2ZZM A;  2EFO A;  2R7S A;  2ADB A;  2ZBP A;  3BGF A;  2CPI A;  2GVZ B;  3OTB A;  4WJB A;  3S6E A;  3TWZ A;  3EZ5 A;  2JEG A;  2G2O A;  2RDI A;  4BC9 A;  3CDE A;  3QMQ A;  3W62 A;  2COL A;  1FX4 A;  3K5O A;  4MIW A;  5HAO A;  2JWN A;  5KFT A;  5KFD A;  5B0E A;  2RS2 A;  1NAQ A;  2E1R A;  1KD1 T;  4YQW A;  5F8H A;  2YKQ A;  3J80 U;  1NDK A;  3VAM A;  1T9X A;  2F4F A;  2LVW A;  4NLX A;  4FS1 A;  1S77 D;  4I67 A;  4LFC J;  3NGU A;  4KHR A;  2GVD A;  5J2N B;  1UEK A;  1YSJ A;  2W2M P;  4RU2 A;  3CJK B;  1JKH A;  1RAD B;  3GLJ A;  4KR0 B;  2KM8 C;  3OR1 B;  4RW9 B;  2FVP A;  3C15 B;  3BGO P;  1UVL A;  2HHP A;  2PO4 A;  3MFI A;  1UPP A;  2V63 A;  4K4T A;  4P2X A;  1FWK A;  3HSJ A;  3TP2 A;  1WNE A;  1EKR A;  2CDQ A;  3HFV A;  5K9F A;  4EBC A;  2UXD J;  5IT9 Y;  3ZFV A;  2DGT A;  2AIR B;  2VG5 B;  4HHH A;  2HK3 A;  3S7R A;  4GO5 X;  1U8W A;  3UDE A;  3VZH A;  2BKN A;  4DN9 A;  3Q8S B;  2DGW A;  2KT2 A;  2MQP A;  4IKA A;  2RQ4 A;  4WCE Q;  3OBI A;  1FJG F;  4RW8 A;  1RAH B;  1GMU A;  3D3B J;  1S76 D;  4QIV A;  2Y8Y A;  3W7B A;  3LP2 A;  5DZ6 A;  3RRK A;  4FS2 A;  1WAC A;  1ZA2 B;  3KDN A;  4A8X A;  5CXT A;  4NLQ A;  4BCA A;  3A4T A;  4PG7 A;  2VQE J;  4ECT A;  2AGO A;  2UXB F;  4HLB A;  4C98 A;  1V5I B;  4IDK A;  4DN0 A;  4WK1 A;  4EK2 A;  3ZZZ A;  4QPX A;  3CDB A;  3BO4 A;  3PZP A;  1HYS B;  2HFU A;  2G4B A;  2W9B A;  3PIP Q;  1P1L A;  3V6K A;  2GNK A;  4KC5 A;  1WG4 A;  4I0W A;  4ZVT B;  3ZZU A;  5CAB A;  2BVZ A;  1AZS B;  2HHU A;  1BY9 A;  2VBX A;  2EFP A;  3CC2 S;  4DU7 A;  4DFM A;  1IBL F;  3MXH P;  1T8E A;  2OIH A;  1HNX J;  2KRB A;  2GQ2 A;  4OHY A;  3GPA A;  3PHT A;  4FYD A;  3MM8 B;  2C3M A;  2H48 B;  2PII A;  3H4D A;  1HNV A;  2MJN A;  3DRP A;  4UQT A;  3EVW A;  3G6X A;  3DOM B;  2YNF A;  1U49 A;  3PDN A;  3NS5 A;  2WHO A;  5B0F A;  5C42 B;  4ER8 A;  5F9L A;  1R89 A;  2BE2 A;  3C8Y A;  2IJR A;  3L7U A;  4RZR A;  2GMJ A;  1N52 B;  1JLA B;  1PCA A;  2ZHA A;  3GFH A;  2V4J B;  4CH1 A;  1C1B B;  4MK7 A;  1TK0 A;  1OSD A;  2AYE A;  2JLF A;  3D67 A;  2XTJ P;  4CLF A;  2CQ0 A;  3LAK A;  2NSC A;  5L1I A;  1U47 A;  3UCZ P;  1KOH A;  1NK5 A;  1RKJ A;  5K8M A;  3RBX A;  3AA8 A;  3EMT A;  5JMN A;  4LQ9 A;  2OKQ A;  3HZE A;  5IT4 A;  2XMT A;  2RKI A;  2HIQ A;  4F4K A;  2V5H G;  4DV1 J;  3FKB A;  4IG3 A;  3NCP A;  4MT1 A;  3UWT A;  1REV A;  2G0J A;  2OPS B;  4B02 A;  1JX4 A;  2CIM A;  1U2R A;  3D6H B;  1IM6 A;  3GIJ A;  1H73 A;  2UXD F;  2A6O A;  2BQU A;  3M8P B;  2P6S A;  4Z7C A;  1HW9 A;  2HS3 A;  4C4W A;  3SQG A;  4CI0 B;  1CUL B;  2FQQ B;  2H5E A;  2M52 A;  4K2X A;  2LU2 A;  2DGX A;  2PI5 A;  2KZM A;  3BGR A;  3JQK A;  1T05 B;  2IRU A;  2MSS A;  3GYG A;  5IV3 A;  4J9L A;  3PYD A;  4X84 A;  2JX2 A;  2ILY A;  4QIW D;  1R8H A;  3BDE A;  3LP0 B;  1FVS A;  1W26 A;  2LLZ A;  2VG6 B;  3CIZ A;  3N28 A;  2YKA A;  1T9W A;  2DT9 A;  3HHN B;  2HFV A;  1QJH A;  1HBU B;  4EU0 A;  2J8S A;  4DDF A;  3WIV A;  1F2G A;  1KQF B;  2G13 A;  2J6S A;  4G1Q A;  2ZJP Q;  1X7V A;  1RSC A;  3VAJ A;  1LKZ A;  5CYQ A;  5DGB A;  2BAB A;  1JLF A;  3QYY A;  2L08 A;  4OQJ A;  5LL6 d;  5AE3 A;  5E41 A;  1D1U A;  4DQQ A;  2JVO A;  2YKN A;  4DR3 F;  3MR3 A;  2CZ9 A;  1WF2 A;  1N6Q A;  4OMF G;  4DU8 A;  4LF7 J;  1U1Q A;  4PYA A;  2Y0B B;  1GTE A;  3CMA S;  3DXS X;  3QRQ A;  2M0G B;  3P96 A;  3PFO A;  1KOO A;  1X4C A;  5LJ3 Y;  3F44 A;  2F63 A;  2HGM A;  1RTI A;  1YGY A;  1GNK A;  1X4B A;  2O1P A;  3CB4 A;  3CTR A;  2A2C A;  3DLJ A;  3UDC A;  2UXC J;  4ELU A;  3NLC A;  2V68 A;  1RTH A;  2OPQ B;  2DIV A;  4ZPV R;  2B56 A;  1FRX A;  4WFX A;  1OY8 A;  3TJ9 A;  4QU6 A;  1RZM A;  1RHJ B;  2IVY A;  2EFN A;  4DLE A;  4OYM A;  1UP1 A;  4CQ1 A;  4WP9 A;  4YR0 A;  3L4B C;  1DY3 A;  1TFY A;  2XZW A;  3MAA B;  2C2Z B;  1H7X A;  4RWX A;  1VLO A;  4N77 A;  1DTQ A;  3DI6 A;  5K8P A;  5F0U A;  3R9L A;  5SZT A;  3SI8 A;  1K0T A;  5H9E K;  5D4O A;  1U2F A;  2M9K A;  3I96 A;  1T9V A;  3N9U C;  4FYY B;  3GIM A;  5LMU F;  4B9N A;  2CAD A;  5D78 A;  1X4G A;  5IV4 A;  2VON A;  1R0A B;  4HAC A;  3SCL E;  4I1T A;  3UPF A;  3K5N A;  1PIL A;  3PYF A;  3KK1 A;  1CEZ A;  1X9M A;  1UFW A;  2Y1J A;  4M8L A;  1RJJ A;  1MN9 A;  2KG1 A;  2IDE A;  4IOC Q;  3C14 A;  1U1L A;  3HX9 A;  2Y9H A;  4PXE A;  3T9Z A;  4C8L A;  2YNH B;  1WEZ A;  2FJD B;  3A3N B;  1IKV B;  3FZB A;  4XPC A;  2VOO A;  4NCG A;  1JLQ B;  1FE0 A;  1HW8 A;  2OO4 A;  4HEA 9;  1UWB B;  5LOQ A;  2QA4 G;  1B99 A;  1UVI A;  4LVN P;  2I6W A;  5C5J A;  2KHD A;  5E3C A;  3RYL A;  1WOP A;  4DV7 J;  5HI7 A;  4U7C A;  1FKO B;  1SQE A;  4DG1 A;  3TAM A;  3M8S A;  4PZV A;  2M4M A;  3K2Y A;  3KXD A;  4FXV A;  3SMZ A;  3V81 B;  3POT B;  5KFE A;  2ZJR Q;  2PFF B;  1QUV A;  2XZD B;  2V69 A;  2XYP B;  3G86 A;  5GAH I;  1LXN A;  4CLU A;  4QW9 A;  2RHS B;  3HFZ B;  3GB0 A;  3CJ4 A;  3NWG A;  2WVD A;  2IMW P;  2N3O A;  2Z2L A;  2DTJ A;  1U25 A;  4O4G B;  1NM2 A;  3FJ2 A;  1RYR A;  1D0E A;  3AB2 B;  3ENQ A;  1LW0 A;  2HAI A;  1JKH B;  2W4C A;  3TEG A;  2X3G A;  1WI8 A;  3GII A;  5FDL B;  1IKW A;  4CTA B;  1TL7 A;  3DOK B;  5F8J A;  2VG7 B;  4BWM A;  5CYJ A;  4UT4 A;  3GIL A;  2V50 A;  2VA2 A;  1P1T A;  3DLB A;  4J9N A;  3F0N A;  1BLU A;  2W9C A;  1GX6 A;  2BJ3 A;  4DFJ A;  2YKN B;  2W9A A;  3I9Z A;  2MJU A;  3MMA B;  2VJU A;  2HGN A;  2PGC A;  1X5O A;  4AXI A;  4IRC A;  2J9E A;  2E1A A;  4O0N A;  1Q1K A;  4GKK J;  1LWE A;  4USH A;  1VGY A;  4TLR A;  4RUH A;  1MMN A;  3ENA A;  2D41 A;  4P7V A;  1VRT B;  1UWA A;  1BUX A;  2LYV A;  2ZZT A;  4X65 J;  3NGT A;  3RAM A;  5D3G A;  4KKO B;  5LMN F;  3MPU B;  2C2M B;  4ES1 A;  3QLH A;  1FRK A;  4M5M A;  3NS7 B;  3Q8R B;  3K57 A;  2XEX A;  4E8U A;  4YHH J;  3LAM A;  3MED A;  1FCA A;  5KFP A;  1N6Q B;  2JVR A;  2NZ4 A;  1ZM9 A;  1QAY A;  4CWB A;  2K8G A;  4QCL A;  3BRE A;  3T41 A;  5KAK A;  1N34 F;  1KS2 A;  2C1E B;  1X0F A;  2MKY A;  2L3M A;  3W61 A;  5DJB A;  2EWH A;  2OEM A;  5J2N A;  4O44 A;  2DRD A;  2PC6 A;  4JI3 F;  1HIY A;  3NEK A;  1QUP A;  1HAR A;  4TU9 A;  4B9L A;  4LF4 F;  3NNH A;  1FFG B;  3DFE A;  1T02 A;  1NLK L;  2EC2 A;  3D6T B;  4K0K J;  1WC1 A;  1SB6 A;  2ZHB A;  5HBM B;  1WC4 A;  1TK8 A;  3ZTQ A;  2FLN A;  2HSE B;  2CQ2 A;  5CD4 A;  2ZD1 A;  4DR1 F;  1NZ8 A;  2BJ7 A;  3LAN A;  2DEI A;  4Y2C A;  1IBM F;  4Q8F A;  1KLM B;  3GQC A;  1J5O B;  4IFY B;  1CJT A;  2RQC A;  2QMW A;  2ZH2 A;  1B0V A;  2O66 A;  2IPO B;  3BM7 A;  3OFG A;  1NPK A;  3TJA A;  3UW1 A;  5D8H B;  1IWA A;  4X64 J;  4PWD A;  1QM9 A;  4L72 B;  4R25 A;  3M2U B;  3H5U A;  2CJA A;  2OUG A;  2K7J A;  3C66 A;  2WB4 A;  3JTN A;  1FFW B;  3DLK A;  3MMC A;  2IBK A;  5KT7 A;  4OYX A;  3W2W A;  3DLG B;  1NPR A;  4O3Q A;  3IRX A;  4NYP A;  3MM6 A;  4OV1 A;  4OL8 A;  3MGJ A;  4K5R A;  3QRP A;  1N5T A;  1HWJ A;  3GV7 B;  3KLF A;  1BC6 A;  1S9E A;  2HUR A;  3MR6 A;  1N32 F;  3OHB A;  4GKK F;  2YVS A;  4H4K A;  3HVT B;  2B5J B;  4DPW A;  3PVX A;  3JSR A;  4WTO B;  2H3E B;  3T1A A;  2DKO B;  2K2P A;  1S0O A;  4L3K A;  1JQG A;  2MTL A;  2XBP A;  1FDD A;  1HKA A;  3CJ5 A;  3FSX A;  5CZX A;  2R2T A;  3QFW A;  4KYZ A;  1UMJ A;  5DO2 A;  3HM9 A;  4EZ6 A;  4ED4 A;  4X62 F;  1WTB A;  3B54 A;  3ZTP A;  4B3O B;  2L9W A;  3D28 A;  3DKD A;  2WCX A;  4DPU A;  3OLB A;  3OJS A;  4OZ3 A;  3H2V E;  1ZA1 B;  1X4F A;  2FJA B;  1BWE A;  1FJC A;  1KN6 A;  5J1E A;  5D4L A;  1JJC B;  2NYH A;  2HQF A;  2MZQ A;  2UZA A;  3R7S B;  3NNA A;  2O67 A;  4LMZ A;  2WVF A;  1I3O B;  1QDU B;  4M5H A;  3R97 A;  2V4Q A;  3PYE A;  2ACM A;  3RAX A;  5DQG A;  4JI6 J;  2YWF A;  4OZ0 A;  4LIW A;  3E01 A;  5RUB A;  4ECS A;  2LQJ A;  1SH0 A;  2QLF B;  2KT5 A;  3KLF B;  4KPC A;  4LBI A;  3A3O B;  4I2P B;  1RAI B;  4FNH A;  4LF2 A;  4KKO A;  2E44 A;  4TNO A;  2DRA A;  1FRH A;  2Y8W A;  4OHW A;  2HYI B;  4Y65 A;  2VDI A;  5KFB A;  1JJ4 A;  2H65 B;  4C0H A;  3M2U A;  4MKA A;  1X31 C;  1YJR A;  1S4F A;  3ISN D;  1SJ4 P;  3IXQ A;  3SQO P;  2F8E X;  2HPU A;  1M5P C;  8AT1 B;  2H54 B;  4QQB A;  2Q6B A;  5KFV A;  1YRU A;  1Q7Y T;  1JXL A;  2UU9 F;  1HD0 A;  2XZT B;  2CQG A;  3PR5 B;  1G1X A;  4I7F A;  4LVO P;  4IFV A;  1C0U A;  1OYE A;  2NCK L;  2OEL A;  3DOK A;  4ZP8 A;  3J7A N;  2C2O B;  3GV8 B;  1GMW D;  1C1C A;  3CUN A;  1YHQ S;  1S79 A;  1H72 C;  3I5C A;  1WF1 A;  3SSQ A;  1M5V C;  3D2W A;  3KJQ B;  3OSN A;  2CZ4 A;  2AGQ A;  4X64 F;  2BRK A;  2HS4 A;  1C0T A;  1WC6 A;  1X5T A;  3IO1 A;  4LFA J;  2R3V A;  1D9A A;  3CC4 S;  2CQH A;  3KG0 A;  3FFI A;  2F9D A;  2V4J A;  3D9B A;  4MYT A;  3CXC R;  4ECR A;  2QLW A;  4EZ9 A;  4KPY A;  1YWX A;  3L9Z A;  3Q8Y A;  5H9F K;  2MKS A;  3NGR A;  2CFX A;  2RD5 C;  2A6M A;  4YEA A;  4C11 B;  2KI2 A;  1S1V A;  1FKO A;  5L39 A;  4F2R A;  1KNZ A;  1WEL A;  3I0R A;  1PG5 B;  2YKM A;  2YQ0 A;  4JP8 A;  2DGQ A;  2PSZ A;  5HLF A;  1T05 A;  3KOA A;  2MYF A;  5J2M B;  3HUL A;  3AQO A;  4RX6 A;  4X4Q A;  1Y5L B;  2BYC A;  3ETM A;  3M8W A;  3PKY A;  1ZAW A;  2W2P P;  3KMQ A;  1NME B;  2IAJ B;  1VBY A;  1K1S A;  4X4U A;  4LRC A;  3IGN A;  2DCU B;  5HJX A;  2ZH7 A;  4DV2 J;  2W9B B;  1FRJ A;  3BF4 A;  2GQC A;  3C6U B;  4W98 A;  4WYL A;  3PM9 A;  3THT A;  4EMD A;  2N7C A;  3M8Z A;  2RQK A;  5J1P A;  3QSY B;  1Q8L A;  4WK3 A;  3EGV A;  4J9S A;  3PR4 A;  1GMV A;  1FI4 A;  1LXJ A;  1U0H B;  3RW7 A;  3TX8 A;  3AD7 C;  5J2P A;  2BE7 D;  4NE9 C;  1URR A;  3CCW A;  4XTT A;  3JSM A;  1S9G B;  2HZC A;  1NJI T;  2OI2 A;  4UST A;  2MB0 B;  2WBM A;  1DAR A;  2BM0 A;  2IM2 A;  1DQA A;  2ZC4 A;  5BJR A;  3BBB A;  5JJB A;  4FDF A;  1NK4 A;  1K0V A;  3UI3 A;  3A3P B;  4B3R F;  4M5N A;  4FF4 A;  3N0V A;  3L09 A;  3SBM A;  4DL6 A;  4ZVQ B;  4JI7 J;  1I6J A;  4I2Q A;  2D9P A;  2ATL A;  4LRB A;  1R27 B;  4U6P A;  1NH7 A;  4B08 A;  3SV4 A;  4F25 A;  2LFV A;  3CJS A;  1HWK A;  3DN9 A;  4IH6 A;  1EP4 B;  1HQE B;  4TLQ A;  4YY3 J;  2BDP A;  4DZD A;  2Z8Q A;  4IQX A;  5DG7 A;  3TNV A;  3G6E S;  3RUB L;  1BQM B;  4WZQ A;  5HO4 A;  3NAI A;  5FLX U;  4M5J A;  2GHW A;  1F60 B;  1XK8 A;  3QBC A;  4PG6 A;  1R8B A;  3CD5 A;  1S49 A;  2A1B A;  1FXD A;  5C24 B;  1DAX A;  5CCM A;  3VZI A;  2R2U A;  4WP3 A;  1Z4U A;  2FHJ D;  3IWX A;  2K1R B;  4C8M A;  4C3L A;  4DSE A;  3K17 A;  1FES A;  1XR7 A;  2AMC B;  3MPY A;  4V1A k;  3NRB A;  2OEK A;  1RWO B;  5ETN A;  1IBK J;  1NJW A;  2CVE A;  1N8R T;  1NHK L;  2MKJ A;  3C46 A;  4DL4 A;  1CJK A;  1NRK A;  5F8I A;  2R7R A;  1Q81 T;  1S57 A;  1YZ7 A;  2B7C B;  3P8B B;  1YJW S;  3VAI A;  1UET A;  2ABY A;  1S1T B;  3P5T L;  5U47 A;  1M1H A;  2DNM A;  3C16 B;  1H2V Z;  2LQ5 A;  3GZ7 A;  3OTO F;  4ED8 A;  4OX9 F;  2GIR A;  3T1H F;  2IBO A;  1RUS A;  4RNH A;  3MAA A;  4DR6 J;  3DMJ A;  1CJV B;  2MLX A;  2KM8 B;  1RWM B;  5IQQ A;  4ILL A;  1UWB A;  2GO9 A;  3D6F B;  3BGR B;  1K8A T;  1JJH A;  4DV6 J;  3PJW A;  5C7P A;  5F8L A;  2PDA A;  1S0N A;  1TKD A;  4E0D A;  4C8O A;  2J8A A;  1B4S A;  4AQY F;  4DSL A;  2BZ2 A;  1IQZ A;  3JTP A;  2NPI A;  1RE1 B;  2XMJ A;  3MDF A;  4P74 A;  3SQG B;  1CUL A;  3ZZO A;  5B0D A;  5ITH A;  2PI4 A;  1XNR J;  4ZVH A;  3O3L A;  3IRX B;  1C4C A;  2OPR A;  4NLP A;  3OVS A;  1DHM A;  1QAX A;  3H98 A;  5AXK A;  5T7L A;  3H5Y A;  4JI1 F;  3JS9 A;  1WHV A;  4ICL B;  4B3R J;  3H25 A;  1VRT A;  1FNM A;  2RDD A;  3BBF A;  1AB8 A;  2CJB A;  4FPR A;  4XK8 C;  1FDN A;  1RQ0 A;  2LA4 A;  1HBO A;  3HVR A;  2DHG A;  1KTV A;  2QA4 S;  1UW4 A;  2RT3 A;  2KYX A;  3OV7 A;  3FBC A;  3PTW A;  1CC7 A;  4A4J A;  2RAQ A;  1NSQ A;  2UVR A;  2J0S D;  1PYT A;  3AQP A;  3GJQ B;  3RR8 A;  3OL7 A;  1NND A;  2QGF B;  3PRB A;  1SI9 A;  2ZEJ A;  3V6D A;  3HSZ A;  5HN0 A;  2EPI A;  2QG9 B;  5EUH A;  4DOZ A;  4BWJ A;  3I4P A;  4X4P A;  2XUL A;  3DOM A;  3M8Q B;  1VS3 A;  3Q89 A;  4Y2I A;  3C2P A;  4P52 A;  3FEZ A;  2GZO A;  2OPQ A;  4ZJO A;  5ADZ A;  5E3A A;  1VK8 A;  4ZVO B;  2KRR A;  1YIT S;  1L5U A;  3QRR A;  3PW2 A;  3D0I E;  1LW0 B;  3IG1 A;  1L3K A;  2W8K A;  4Z37 A;  2ZOF A;  4ZK7 M;  2UUT A;  3IAS 9;  1N88 A;  1S12 A;  2BA9 A;  2XI3 A;  3OFF A;  4YY3 F;  2WRM A;  3DDN A;  3AXK A;  5A6P A;  2H5I B;  3CJQ A;  2RRB A;  3NCR A;  3GMG A;  4WFB Q;  3E01 B;  4YB7 A;  4TU8 A;  3VAF A;  1U45 A;  2B9Y A;  5D0R A;  2K3K A;  4CO5 A;  1NJY A;  1DBD A;  1SV5 A;  4J5O A;  3IFE A;  1XTZ A;  3GU0 A;  4GKJ J;  3AOC A;  4J9M A;  3RRG A;  3DGV A;  1NCL A;  4M5G A;  3ZO7 A;  4A48 A;  4KO0 B;  1YTY A;  4U9R A;  3T1H J;  2V67 A;  2DY9 A;  5E3Q A;  3LP2 B;  4TY9 A;  1S6O A;  4X62 J;  3CJ3 A;  2YWK A;  3W2V B;  2ZWO A;  1XNQ F;  1RAG B;  4FBT A;  4USK A;  2QZ8 A;  2QLX A;  3AY0 A;  2R7X A;  3K8V A;  5KFA A;  5BYS A;  1SJ1 A;  4DV6 F;  2DHX A;  4EFA C;  3MHY A;  4ENO A;  5HAT A;  3ILJ A;  4PG8 A;  3IWN C;  3V2U C;  4OX8 A;  2NPF A;  1JXE A;  3QO9 B;  3KHH A;  3GFX A;  2CQI A;  4ZJL A;  2NRE A;  2XWY A;  3BS9 A;  3NMR A;  5CCL A;  3H7H B;  4PWU A;  2CPF A;  2JJ4 D;  3THP A;  1RT5 A;  2D69 A;  2MST A;  3KMS A;  2KG0 A;  2R9L A;  3G9C A;  2HEK A;  2PFD A;  4HDH A;  3HVT A;  2DD8 S;  2ZH6 A;  5F8N A;  3BO3 A;  3I82 A;  3I87 A;  3RU0 A;  4CZC A;  3DDK A;  5IM0 A;  5ETT A;  1FKP A;  5AJ3 F;  5C24 A;  1RCO B;  2A3J A;  2EK1 A;  2CQD A;  1J27 A;  1HNV B;  2L48 A;  1CQN A;  3FEX B;  2OAU A;  1Q78 A;  2HGL A;  3H20 A;  3KLV A;  3HP6 A;  3PO4 A;  4H4M A;  1RAA B;  2R7Q A;  2R7W A;  3HVA A;  1W2I A;  1VK3 A;  2OPP A;  4LJM A;  4R5P A;  3I55 S;  3US5 A;  5L1J A;  3BJY A;  3V5R A;  1SKR A;  3OT9 A;  2KVQ E;  2FYX A;  2X3D A;  5KFR A;  3W1Y C;  5HK4 A;  3Q86 A;  3FRZ A;  2E5L J;  4X4V A;  2CNO B;  2ZNY A;  3CW2 C;  2ZH5 A;  2XM3 A;  3DNC A;  3HXM A;  2HFO A;  3QFH A;  3TQ1 A;  1XIQ A;  2FZK B;  5DLF A;  1J5O A;  3GJS B;  4O0I A;  4UY8 T;  2UUW A;  1B7Y B;  3MCM A;  2HZA A;  2C3P A;  2HBY B;  1JLC A;  3A13 A;  4G3I A;  3ET6 A;  3KLG B;  1T9U A;  4NLG A;  4JYA F;  1Q7L B;  2KVI A;  1TL5 A;  3QJL A;  4OLO A;  3EZO A;  5ETO A;  2HNZ A;  1HMV A;  2LXU A;  2XG8 A;  1OS5 A;  1B3T A;  3DDI A;  4DQP A;  2HHS A;  2W2O P;  3DM2 A;  5EX3 A;  1U24 A;  4P75 A;  1V3S A;  3PG9 A;  2DGU A;  2VFR A;  1VBX A;  5ETV A;  5D4P A;  2KXF A;  3L3C A;  1RTD A;  4B3M J;  3CE8 A;  1OJ4 A;  3WC0 A;  3PX4 A;  2NR0 A;  3Q0A A;  3KDO A;  4GO7 X;  2C28 A;  4DEZ A;  4EEY A;  3AOB A;  3HMJ G;  3Q2T C;  2QMU B;  2MKC A;  1HBN B;  4BLG A;  5LSL A;  1FDA A;  5HL7 Q;  1Y3J A;  1ZPV A;  2VUG A;  3TZY A;  5MLC V;  3W8P A;  3C6T B;  1LW2 B;  2XO6 A;  1NSP A;  5ETM A;  3K89 A;  4WWS A;  4DX7 A;  1SL2 A;  2B3T B;  1S7I A;  2VA3 A;  3G82 A;  1MMD A;  4JUZ A;  1JJ2 R;  3ELH A;  1ICE B;  4Z2X A;  2UUC F;  4RNN A;  2Z0G A;  1F3V A;  1HPZ B;  2MY8 A;  2I9S A;  4K4V A;  3IWL A;  2NYI A;  2CJX B;  2YNI B;  3EX7 B;  4ID5 B;  2ZBQ A;  1DJ0 A;  3AH6 A;  2DH9 A;  3Q2S C;  1FO1 A;  4AL5 A;  2VC0 A;  3DRR B;  3GON A;  2HMI A;  2GHV C;  1XQI A;  2DIT A;  2EI5 A;  1X4D A;  2XHC A;  3IG1 B;  2C2N A;  1HQ2 A;  3N4W A;  2WSC C;  4LRF A;  4AYB D;  3WIU A;  1CLF A;  2KT3 A;  4NXN F;  4DCJ B;  2R7T A;  4U7U D;  4K59 A;  1KP6 A;  4USU A;  1N5V A;  1JLE B;  2GAH C;  2QV6 A;  3OTE A;  2NXU A;  3P3D A;  3BV8 A;  3TVK A;  4KGV B;  3WBZ A;  1C2P A;  4PAB A;  1RTJ A;  3OD2 A;  3HPO A;  2VC1 A;  3I0R B;  1R6V A;  1S1X A;  4LF8 J;  4M5K A;  1CJT B;  1Y3K A;  4C2M A;  3VAK A;  3FUY A;  4NML A;  3SSS A;  1N4L A;  4KGM A;  3QZ8 A;  2VOD A;  3IA0 A;  4LSZ B;  3CCS S;  1GTH A;  1Y0H A;  2FGO A;  5I3P A;  1RAJ A;  1UJ5 A;  4PQU B;  3J7Z T;  5KFQ A;  2FC8 A;  4KBI A;  2BQR A;  4Q44 A;  3AJ1 A;  2L9N A;  1FEE A;  3MCN A;  3I32 A;  3TUI C;  4USV A;  1Y5N B;  2YNG B;  3HK2 A;  4DUY F;  1HQU A;  1EQM A;  1QE1 A;  1H74 A;  3OUY A;  3M9O B;  1KQG B;  5KFI A;  3JSM B;  1Q86 T;  4YR3 A;  4HVZ A;  4L6V 3;  2D3O 1;  4I4B A;  3J81 U;  2X1A A;  1AW0 A;  5HVG A;  4O3N A;  3VQS A;  2QA1 A;  3D3C J;  1HD1 A;  5DQH A;  2RB7 A;  3MAH A;  1URN A;  3HD2 A;  1WC5 A;  1SV5 B;  4DUZ J;  2QYC A;  4AD6 A;  4U8Y A;  1T11 A;  4AL7 A;  2N4D A;  3D68 A;  2RH3 A;  2XY7 A;  1YI2 S;  1X9W A;  2J0Q D;  1U1N A;  1WI6 A;  1RXO B;  2BRL A;  4RUB A;  5F9N A;  4QIE A;  5BR8 J;  2B9W A;  2HFN A;  3NWR A;  2R8H A;  5KG3 A;  4Q43 A;  1ZH5 A;  1FJ7 A;  3AA9 A;  2ZUA A;  3N6N A;  2HVD A;  3SEO A;  3SV3 A;  3HHL C;  4DQR A;  4ED5 A;  4A8W A;  1O8B A;  3Q8U A;  4JI4 J;  4XAK A;  3MCO A;  1VIX A;  4TYB A;  1NJX A;  3D0H E;  3HKW A;  1XNQ J;  3OR2 A;  5EWF A;  5KG1 A;  2HRY A;  2KB2 A;  3J7Z 5;  3D1O A;  2FVR A;  1YJT A;  1L3T A;  2UP1 A;  3FQK A;  4ECY A;  2JL9 A;  2FHO B;  1IJF B;  2OD6 A;  2FY8 A;  2Z30 B;  4IH7 A;  5KFL A;  2XC9 A;  1DUR A;  2DNY A;  2EFG A;  5FDL A;  2F8H A;  3HHE A;  4PG5 A;  5D0E A;  4CTA A;  4ITS A;  4RNO A;  3T5J A;  3RR7 A;  3PY8 A;  2GFF A;  4IR9 A;  1NZA A;  3D66 A;  1RKI A;  2YH0 A;  1VBZ A;  2XLK A;  3BKU A;  4DL2 A;  5KFC A;  2CJY B;  1RHU B;  1HL6 A;  1P9Y A;  2V8P A;  4ED6 A;  3T5K A;  2DPI A;  4L75 A;  4CRJ A;  5C2G A;  1RT6 B;  2V34 A;  2VBY A;  1UTA A;  3W65 A;  4NLO A;  3CCL S;  1S0M A;  2VAS A;  3I0S B;  1RYS A;  3NMA A;  1Q79 A;  3P45 B;  1M0S A;  4J9R A;  2KTQ A;  4NXN J;  4ZPC A;  4QWB A;  1C1B A;  3VAL A;  4A8S A;  4WE1 B;  4ZOS A;  2XO7 A;  4P6Q A;  1RT2 A;  3BN7 A;  2UUA J;  5B0A A;  3X1L B;  3W2V A;  1J2V A;  1TL4 A;  2AP6 A;  4F26 A;  3ILO A;  4LF8 F;  5ETL A;  2MGZ B;  3GFZ A;  2HFS A;  3T9N A;  1K1Q A;  1EJ7 L;  2MQL A;  2RE1 A;  2MXY A;  4DV4 F;  4QYZ K;  5IT0 A;  1GXU A;  2CNK B;  3I56 S;  4NLR A;  3B4M A;  2DGS A;  3V6J A;  2FLO A;  1YRT A;  2ZVI A;  5AXN A;  2QL9 B;  4FXW A;  2DNN A;  4KAI A;  4M94 A;  1NDP A;  5KFO A;  3BSA A;  2ZFH A;  3H0P A;  2IYG A;  2QJ3 A;  2FHJ A;  2IAJ A;  3OXF A;  1FXR A;  1S4E A;  3NGD A;  2BR0 A;  5F41 A;  2FJW A;  2UXB J;  1AA1 B;  3PRD A;  2JDJ A;  1GEH A;  3BQ2 A;  1VC5 A;  2YPY A;  2KO1 A;  1F2H A;  5KT2 A;  3EPG A;  4C9D A;  4PRF A;  4UZB A;  5GAD I;  3DC2 A;  1B0T A;  1SKU B;  3DLE B;  1FT8 A;  3OSP A;  2HND A;  4KB7 A;  3ZZY A;  1FWL A;  5HRO A;  3EYZ A;  1NK0 A;  1TV6 B;  2HLT A;  5HMX A;  4YHH F;  4DR2 F;  1MML A;  2VDH A;  1S6P A;  1HI1 A;  1S1T A;  3OXL A;  3EVM A;  1FXL A;  1LWE B;  1WOR A;  1K9M T;  1UAW A;  1RLC L;  3D6M B;  2OTJ S;  1AXQ A;  3SCJ E;  1VQM S;  4LF6 F;  1JLF B;  4I69 A;  3T1Y F;  1TKX A;  3UQS A;  1YBU A;  4O23 A;  4ED7 A;  1CSJ A;  4LT6 A;  5AE2 A;  3SIP B;  1GQE A;  1IM4 A;  3CCT A;  5JUM A;  3KK2 B;  1LV5 A;  3MEK A;  3M32 A;  1JLB A;  2L9D A;  1HMV B;  2M8H A;  3BGU A;  4UTG A;  4WZM A;  2KDO A;  2QEX S;  4NEY A;  3TW0 A;  2Y1R I;  2CJK A;  1OO0 B;  2J9C A;  1ZPW X;  2L41 A;  5HP1 B;  5LM7 E;  4ELT A;  4OI3 A;  5DDO C;  4DR1 J;  3PEH A;  1U0H A;  1R31 A;  1NHU A;  2VFS A;  2E29 A;  2HS0 A;  2ZNZ A;  2J6U A;  3HFK A;  1HYS A;  3ITH A;  2XGQ A;  2KFN A;  1U6Z A;  2RKI B;  4WFY A;  1KLN A;  4F4W A;  2ADC A;  2FTR A;  4RWW A;  5KFN A;  3TAP A;  3LPY A;  2WZ1 A;  4QJV A;  1VQP S;  2MKK A;  1RWW B;  4QYR A;  1CS4 B;  1HI0 P;  4NRU A;  4NAS A;  1FDB A;  3PKM A;  4CLL A;  3TUJ C;  4QWC A;  1U0S A;  2KU7 A;  4J91 A;  4LF7 F;  3U02 A;  3CED A;  1S6Q B;  1ZTT A;  2NXN A;  2J9D A;  2HG4 A;  2WBR A;  1S9F A;  2MQN A;  2CJ9 A;  1SC4 B;  2GW8 A;  2N4C A;  4IG0 B;  1UEV A;  5A8R A;  3OJU A;  2AJ2 A;  2XGP A;  3BSN A;  3DLL Q;  2V2V A;  2GAG C;  1VBK A;  3CO0 P;  1N33 F;  3V4I B;  3I0S A;  5SUH A;  1NK9 A;  2X1F A;  3QGI A;  5J2Q B;  3ICL A;  2HMI B;  2BE9 B;  4PR6 A;  4Q8E A;  1RWP B;  4QR2 A;  2K1R A;  4WFA Q;  4ZVP B;  4DPO A;  2HHW A;  2DY1 A;  4JI2 J;  4DV4 J;  3R1H A;  4DR3 J;  3KJV A;  1MN7 A;  3CJT A;  4E2F B;  2WOM B;  2QL7 B;  1GXL A;  2JLE A;  3N79 A;  3CJ8 A;  1HNW F;  1ROF A;  3DMJ B;  2E7X A;  3LPE A;  1XN9 A;  2HBR B;  5LSR A;  1TVR B;  2P2C B;  2YQ1 A;  2ZKT A;  4PG4 A;  4H4O B;  1JLB B;  1Q8I A;  3TAN A;  1YZ6 A;  4LSL A;  4OYA A;  2PMZ D;  2FC9 A;  1KFD A;  1T9T A;  5KFJ A;  2CQP A;  2ZOG A;  4Z7Y A;  3T6J A;  4X2B A;  2UUC J;  3JYT A;  3DU5 A;  3QQC D;  4HHU A;  1RWV B;  4RNM A;  3VWS A;  4J37 A;  1VFJ A;  2IDL A;  4N7T A;  4QZV B;  4DCP B;  5I3Q A;  4YFU A;  2HRU A;  3NL0 A;  1AFI A;  2KZZ A;  2G9O A;  2ZH8 A;  2ASL A;  5I42 A;  4B17 A;  3MPW A;  1M90 T;  4I6W A;  3J81 j;  4RBT A;  2MZ1 A;  1CJU A;  3VF0 B;  1SC3 B;  5CHC B;  5KOX A;  1VJW A;  2M2B A;  3ZZ0 A;  3AB4 B;  2WTF A;  1FRL A;  2VOP A;  1W25 A;  1TL7 B;  2LA6 A;  2BX6 A;  3HLU A;  2B51 A;  2WVE A;  2IVF B;  1RTZ A;  4V19 J;  3GTY X;  1D09 B;  2YNI A;  2F9J A;  3FC9 A;  2IYI A;  3LH2 S;  3T6B A;  5B0B A;  5K8O A;  4ELV A;  3NOC A;  2UXC F;  1KLM A;  3QSI A;  1T95 A;  1UL3 A;  3LWL A;  1FJG J;  1NHV A;  4TQS A;  4RW6 B;  2HHT A;  4YDX A;  2MMY A;  3EZU A;  4P71 A;  3M1V B;  3KUG A;  3O2I A;  5F8M A;  5DGA A;  2BBE A;  1SJR A;  1WJ9 A;  4HTI A;  1JIH A;  5B0G A;  2DCL A;  3G71 S;  1RIS A;  2B6A A;  1QSL A;  4UUX A;  5KG2 A;  1U1O A;  1Q8K A;  3UNY A;  5F8G A;  1ZAX A;  3G6Y A;  1TK5 A;  3HHL B;  1PC4 A;  3LO3 A;  2J0W A;  5GMK a;  5ETP A;  1NSA A;  3KLE B;  3KK3 A;  2ZHO A;  1MRO A;  2BV3 A;  2EXU A;  1UZH A;  5GAE I;  5HQL A;  1FFS B;  2AJ1 A;  3RGI A;  4N41 A;  3AD8 C;  4PWW A;  4XO0 A;  4WU2 A;  5KG4 A;  3DCA A;  3U7J A;  1UKU A;  1JLQ A;  3VGV A;  2LDI A;  4RR5 A;  4DL5 A;  3MD3 A;  1SH2 A;  3GSI A;  2BXJ A;  2VL1 A;  2C2K B;  4QYZ J;  4Y6I A;  1WSR A;  3QIP B;  5E3R A;  3HO1 A;  3CDU A;  3PX0 A;  5A8K B;  4CM0 A;  1KQS R;  2DJW A;  2VHG A;  3BO2 A;  2VD3 A;  2GIQ A;  3DLH A;  2PE8 A;  2RUG A;  2YKP A;  4OZJ A;  4WP8 A;  3SDE A;  4QBU A;  4USJ C;  3N6L A;  5KFS A;  4CNY A;  5LT5 A;  2RNE A;  3OUY B;  3R2D J;  1N33 J;  4FF3 A;  3W63 A;  1RBO B;  4KE5 A;  3G8S A;  4ZP7 A;  4DS5 A;  3K5L A;  2AX0 A;  1ZZF A;  1C4A A;  2DXF A;  4EI2 A;  2C22 A;  1UA1 A;  3M2R B;  3E8O A;  3UFC X;  2RDJ A;  4ZLJ A;  1EET A;  1X4H A;  3BDP A;  3KHL A;  1IWG A;  1OIA A;  1SC1 B;  1WC3 A;  4HKQ A;  1DFD A;  1PBA A;  3G82 B;  1HNW J;  4ILR A;  3FMB A;  2LEP A;  3M2V B;  2RU9 A;  1C0T B;  2QFJ A;  1P9Q C;  2YKO A;  4H4M B;  3T19 A;  3DRP B;  3CCZ A;  2YPZ A;  3FEY B;  2VH7 A;  2Z4P A;  3Q24 A;  2M8D B;  2JEJ A;  2R7U A;  5IOL A;  2I5J B;  3SFU A;  2IY5 B;  1CC8 A;  1FKP B;  1Y11 A;  2KJW A;  2M88 A;  3HD1 A;  1WOO A;  2LP4 A;  3W2W B;  2CRL A;  1OPZ A;  4OI6 A;  5A8W B;  4N8N A;  3GIK A;  2ZBC A;  4HT5 A;  1YVF A;  1BQN B;  1KHW A;  4KV8 B;  1IKX A;  4KT0 C;  2FZG B;  2MQM A;  4AUK A;  5KTQ A;  1I1G A;  1U7L A;  3FZ2 A;  1RA7 A;  2F1F A;  3FCV A;  1WHX A;  4MKB A;  3TOQ A;  3GG1 A;  2YY3 A;  3UVJ B;  3ZZR A;  2R7V A;  3G2X A;  3U1N A;  1HWL A;  3UN5 A;  3MUT P;  2E7V A;  2R4F A;  3KG4 A;  3M8R A;  2DBB A;  3UD3 P;  4M95 A;  2XMU A;  1SJQ A;  4Q5V A;  3OL6 A;  5HRO B;  1JXV A;  1R7I A;  1S6Q A;  1HWI A;  2YWG A;  4D3G A;  4DHV A;  4M5D A;  4FKX A;  4KH0 B;  2DEJ A;  1LW2 A;  4ZS6 A;  4MTP A;  3GR0 A;  5J2P B;  5GAE U;  3IP0 A;  1AUS L;  4OFZ A;  5KT6 A;  2YNH A;  5T14 A;  1EQ0 A;  4CO2 A;  1S97 A;  2Q1L A;  2X1G A;  4NLY A;  1Y5I B;  5EWG A;  1R8A A;  2GML A;  4OHX A;  2E5I A;  3TVZ A;  3GV5 B;  3BQ0 A;  2DH7 A;  2IA6 A;  1TFW A;  2VV5 A;  2Z56 B;  5C25 A;  4IO1 A;  1IXK A;  2XS5 A;  3QT6 A;  4HAC B;  1X5S A;  5A8W A;  2DR5 A;  2FDN A;  4WPA A;  2FLL A;  3QAT A;  2AWZ A;  1ZOT A;  4ZMM A;  2ZWP A;  2V4R A;  1W7W A;  1LWC A;  1T0T V;  3BSC A;  2MY7 A;  4FZV A;  4C6A A;  2FHM A;  3ZNU A;  3TAQ A;  4MK8 A;  4NPO A;  4EYH B;  4C0B A;  1S59 A;  2ZH3 A;  5K8N A;  2B7B B;  3BB5 A;  1VYA A;  2GHP A;  3Q23 A;  3RAQ A;  3VGU A;  3WX4 A;  3TX0 A;  4F3Q A;  2I8E A;  2POK A;  4ECQ A;  4W4M A;  4URS A;  4ES3 A;  2HWH A;  1XNR F;  1NH8 A;  1VQS A;  1IKX B;  4JI6 F;  2E9R X;  1WTF A;  1OWX A;  2BJ1 A;  3D0G E;  2FPH X;  2GJ2 A;  3UDL A;  4R5P B;  2Z2Y B;  4OYW A;  1NB2 A;  3IAM 9;  3LP1 A;  3QGG A;  1DQ8 A;  1IJE B;  4AND A;  1QE1 B;  2GVD B;  2A18 A;  2VQF F;  1LOU A;  2W7A A;  2LKZ A;  3HF5 A;  4CT8 A;  5IM0 B;  2GX8 A;  3NXZ A;  4ZLL A;  4QWD A;  3CSK A;  4AQY J;  4ED3 A;  2QX0 A;  2K7K A;  4OYI A;  4RW7 B;  4S0M A;  2GJF A;  1EP4 A;  1NDL A;  3AHP A;  2LU1 A;  3B8H A;  2B8P A;  4UOC A;  5EGY A;  3OL8 A;  1U1R A;  1HR0 F;  2JOQ A;  3QLH B;  3MD1 A;  5D0H A;  2UU9 J;  4HL9 A;  1CPZ A;  2JC0 A;  1MNE A;  4IO9 Q;  4JI5 J;  3UNG C;  1TL3 B;  3W9H A;  1MWQ A;  3AD9 C;  3TUZ C;  2IJN A;  4XPE A;  2R8G A;  2VU5 A;  3S1T A;  5HQM A;  1RT3 B;  1Z1Z A;  1FRI A;  3CD7 A;  3LGM A;  1HNZ F;  3RTV A;  5A0Y A;  1BGX T;  4B9T A;  4KGK A;  1IR2 A;  5LXY A;  5BYR A;  2W25 A;  3W66 A;  2AD9 A;  3AAW B;  3HI9 A;  4PEO A;  3SCK E;  4OYB A;  2ATC B;  1JNR B;  2WON A;  4KSE B;  4O44 B;  1SUQ A;  4YB5 A;  2AQ4 A;  2HWT A;  3UVJ A;  3TAR A;  4J9K A;  3L7O A;  5IT9 U;  3HJV A;  1PJ5 A;  2FVQ A;  3KKF A;  2WAQ D;  7FDR A;  4QOT A;  4LR7 A;  4GVB B;  3MMB B;  2KH9 A;  1HI8 A;  5KFY A;  4HYK A;  1FD8 A;  3PW0 A;  4LRE A;  6AT1 B;  2N82 B;  4DL7 A;  5F3T A;  2JFD A;  1WG5 A;  1Q4R A;  4ZJQ A;  3UDV A;  1T3O A;  4DR7 F;  2AJ0 A;  3FDS A;  1HLW A;  2EG2 A;  1VRU B;  1IUJ A;  2R8K A;  4C3K A;  4E98 A;  3M32 B;  1VC0 A;  3PYG A;  2AEM A;  2W2Q P;  4F0K A;  1FF2 A;  3PJ9 A;  4ZLP A;  3K0J A;  1FRM A;  4URQ U;  4OHZ A;  2H4W B;  4F36 A;  1XMQ F;  2DRB A;  4I2Q B;  3L7P A;  2NUH A;  1P8G A;  2LDY A;  4CO1 A;  2F40 A;  5HAN A;  5BYQ A;  5DZ7 A;  2JEF A;  1YJ9 S;  5IFM A;  5FJ4 A;  3M6X A;  3DXB A;  1WWH A;  1VQY A;  4GRS A;  1MLA A;  2NQP A;  3KTQ A;  2HRT A;  3CJR A;  4ZN1 A;  4DV2 F;  4FXD A;  3MI7 X;  2YX1 A;  2XMV A;  3OFH A;  4IG3 B;  2CG4 A;  4K8R A;  1DZ5 A;  4CCH A;  3DM2 B;  4JV5 F;  1R6Y A;  2BJ8 A;  4EYI B;  1CS4 A;  2BKO A;  5C2C A;  3VAH A;  2EBG A;  3IM8 A;  4GVB A;  5B0C A;  3DRR A;  4IOA Q;  6FDR A;  1PKU A;  5HVH A;  2P9E A;  5A2Q Y;  1N48 A;  3QIP A;  2EBE A;  2DHS A;  2XLI A;  3CUL A;  2HBZ B;  2D7S A;  4NYZ A;  4LR9 A;  5A8R B;  1UZD A;  3JYT B;  2W4D A;  5J2M A;  2Y1I A;  1IKY B;  3FQL A;  4QR0 A;  3MEE A;  3RRH A;  1VCT A;  3KUE A;  1N5Y A;  1DTQ B;  2QIF A;  3DI6 B;  1R8P A;  1REG X;  5K14 B;  1U09 A;  1UPM B;  3VR1 A;  3FCW A;  1VC6 A;  1HNZ J;  5KFM A;  1OYD A;  1O0P A;  2GQQ A;  3C19 A;  2PEH A;  2ZUG A;  4OZ2 A;  4CLP A;  2CVI A;  1LQ9 A;  2H51 B;  3LP0 A;  3QID A;  3ULH A;  1TV6 A;  1F3F A;  2LEA A;  2EKY A;  2QYG A;  4WKY A;  2DNK A;  1Q0N A;  2XLJ A;  2HHV A;  4G6V B;  1YJN S;  1ZS6 A;  1DQ9 A;  4R0J A;  2XMA A;  2MPU A;  3H2L A;  4RW6 A;  3EIC A;  2DVI A;  2HQ3 A;  2M70 A;  1SKS A;  2W7P A;  4HI1 A;  2HVI A;  1R3N A;  4C8Z A;  2DIS A;  2ASY A;  1G3O A;  2CUY A;  1OY6 A;  4RO0 A;  5KG6 A;  2QN6 B;  2CZV C;  1YLX A;  3RZA A;  4RL1 A;  3WZ0 A;  2Y3Y A;  5D15 A;  3VCD A;  4I6Y A;  1F0X A;  2MZT A;  4LF5 J;  3ZNJ 1;  1U48 A;  1MW7 A;  1JLC B;  2AF6 A;  3LTO A;  3G4S S;  4F50 A;  3H90 A;  4IH5 A;  2WW8 A;  4BDP A;  1WDT A;  2OD4 A;  2W2N P;  2G1D A;  3KFW X;  4MH8 A;  2FB0 A;  2CWX A;  4ATN A;  4B3T F;  4DL3 A;  1H98 A;  2JSX A;  4J9U E;  4RNF A;  3QGH A;  3M30 B;  3TA1 A;  4DBQ A;  1MG7 A;  5FII A;  3UN2 A;  1X60 A;  2F8M A;  2JLG A;  3O1L A;  4DLG A;  4JV5 J;  1RHM B;  5CAA A;  1S5Z A;  3JTO A;  5A0Y B;  1XR6 A;  2ZVS A;  2MQQ A;  2E5G A;  4M63 A;  1APS A;  3MR7 A;  3A8I A;  3MM8 A;  3MEE B;  4D3H A;  1SJ3 P;  1YBT A;  2E1C A;  2ZBI A;  4HR2 A;  3VQT A;  4C3M A;  1VR6 A;  2A0F B;  5FLX Y;  4XDC A;  2KYZ A;  1BWV A;  1RAC B;  3DGP B;  3KLI A;  4RUA A;  4JI3 J;  2OP5 A;  2CXE A;  3G96 A;  2MKH A;  3TZX A;  3F73 A;  2AYB A;  4FF1 A;  1KTQ A;  1O51 A;  2NXJ A;  2WVC A;  2ZE2 B;  3CJ0 A;  3HKZ D;  3R5D A;  2IRY A;  2XMK A;  4TY8 B;  2H9Z A;  3NY0 A;  4DR5 J;  1FNO A;  1K73 T;  3V6H A;  3V6D B;  4CLK A;  1EZZ B;  3GYX B;  1F5B A;  1S1U A;  5ETS A;  3KLG A;  4ED1 A;  1PO6 A;  5E7O B;  1AT1 B;  3D1Q A;  4NA2 A;  5IC6 B;  1LFW A;  2IC3 B;  3I5A A;  3ONQ A;  1TVR A;  2J5A A;  4CM2 A;  4CLZ A;  4OI0 A;  3GSD A;  4PXC A;  3R6L B;  4F4X A;  1QVF R;  2EFV A;  2FJV A;  1F9H A;  4B9M A;  4WF9 Q;  2J7K A;  5I4M A;  4JBC A;  4DUZ F;  3IBC B;  2B5J A;  1R0C B;  1LWX A;  1UFL A;  4USI A;  2BJE A;  4DMZ A;  5LSO A;  2DNR A;  3FSI A;  5EN1 A;  1XER A;  1IN0 A;  1H2T Z;  1R0A A;  1IVZ A;  1XEZ A;  3HZG A;  4CDI A;  4WFN Q;  5J2Q A;  1F9E B;  3W9J A;  1TKT B;  3M6V A;  1OSC A;  3OR1 A;  2F3J A;  1V3Z A;  1VRQ C;  4NRT A;  4DPX A;  5IS2 A;  4GC7 A;  2A10 A;  1FER A;  4TU7 A;  1V3R A;  1X4E A;  2E5J A;  1TU0 B;  3SDE B;  1KR4 A;  3PNI A;  3IMQ J;  1F5A A;  1NBE B;  1NUE A;  4ZVF A;  1B70 B;  2PD1 A;  4DV0 F;  4B3T J;  4K4S A;  5M2R A;  1TAU A;  2RML A;  1EKS A;  2GV1 A;  2ASJ A;  4Y34 A;  3H2U B;  3IC1 A;  4UQG A;  5A76 A;  5DM7 Q;  1N5S A;  1AUD A;  5T41 A;  4ZVE A;  4MK9 A;  5KT3 A;  4DCO B;  2VJV A;  3A1Y G;  3NCQ A;  7FD1 A;  3TJ8 A;  2DYA A;  5HBM A;  4OLP A;  1S6P B;  3MUM P;  4NLD A;  3POT A;  4ZKA A;  1TQL A;  2XCP A;  4K4Z A;  1M5S A;  1WC0 A;  1XMB A;  2YKM B;  3ENW A;  2RSQ A;  1RHK B;  2PMH A;  3P5B P;  3DYA B;  2JH3 A;  1S72 S;  4TXS A;  2C2D A;  4OZ5 A;  1CJK B;  1WD6 A;  1X5P A;  2E1M C;  2F65 A;  2BEF A;  4ZPT R;  1RTJ B;  3LGH A;  2D3Z A;  5KFX A;  1S99 A;  3R3T A;  4ZIW A;  3GP9 A;  3ZTO A;  2ALZ A;  1KSP A;  3FBE A;  3FFI B;  3M6W A;  2VBW A;  3KHR A;  3OVB A;  4QW8 A;  2J6T A;  2AW0 A;  4KQZ A;  4OX6 A;  1ZM4 A;  4LFB F;  2DO4 A;  4N8O A;  4ES2 A;  1TKZ A;  2HK2 A;  3UD4 P;  1VQ6 S;  1U02 A;  4RBV A;  4KIA A;  4C8N A;  4H4K C;  4NLT A;  2ZIT A;  1RT1 B;  4RJV A;  1CJV A;  2KN4 A;  1JWW A;  1FEH A;  4JOU A;  5GME A;  1WUU A;  2KXH A;  4IDK B;  4WXW A;  3VGS A;  2IA0 A;  3W60 A;  1GK8 A;  2CQB A;  4IG0 A;  4O3O A;  2GGP A;  1ZAV A;  3SXL A;  1EHW A;  2DH8 A;  2W7O A;  4PPZ A;  2FLP A;  4KGX B;  4B3S F;  2HWI A;  1U1K A;  4P7T A;  1SQG A;  1RT2 B;  2Q3P A;  2XCA A;  1N36 F;  4IFY A;  1D3W A;  1KKH A;  4WYW A;  1HPZ A;  4GC6 A;  1KRP A;  2ROP A;  3ADA C;  1FX2 A;  1RP5 A;  3ZZP A;  2V2Z A;  1RAB B;  4KTQ A;  3LOU A;  2BAN B;  3R5J B;  4ZPD A;  5CYM B;  2AX1 A;  4DPY A;  2W24 A;  2YNF B;  1TL3 A;  2OPS A;  1S1W B;  2PA8 D;  3H5S A;  1UVK A;  4YB6 A;  4FNI A;  3FK4 A;  3RBD A;  1SL0 A;  4U95 A;  2ASD A;  3PIO Q;  1HHS A;  4ZHR B;  2HLU A;  2ACY A;  2DHH A;  3KJF B;  3KJN B;  4NEZ A;  5L38 A;  3QJP A;  5HP1 A;  1PSD A;  2QLB B;  4Y2M A;  5AXM A;  4NXM J;  2DNH A;  2MQO A;  3CVK A;  3M8Q A;  1P27 B;  2E5H A;  2DR7 A;  3LAL A;  3ET6 B;  2HVE A;  4Q7A A;  3QZ7 A;  3UE2 A;  2J7W A;  4ZPW R;  2G1H A;  4DV5 F;  1TZ0 A;  3BYR A;  1XMQ J;  2C2E A;  2EW9 A;  3KHG A;  4EBD A;  1H38 A;  3TI0 A;  4CIO A;  1WKJ A;  1EET B;  3NG8 A;  3HHK A;  4IQM A;  1RAF B;  4H4O A;  2XNQ A;  3DOL B;  4CLY A;  1QSS A;  1R43 A;  2IC3 A;  2V8V A;  2V9K A;  1RBA A;  3CT9 A;  2ZJQ Q;  5B08 A;  5F3Z A;  4PUO B;  2KFY A;  2E1P A;  1ZTW A;  4MIA A;  2CQC A;  1BQN A;  2AYM A;  2FIU A;  2NS1 B;  2XI2 A;  2Z2M A;  2WK4 A;  1PYO B;  5FD1 A;  4JB8 B;  4FVC A;  5JXS A;  2HZV A;  3OTD A;  4B3O A;  1S48 A;  2AZ3 A;  2X51 A;  5E5N A;  1TL1 A;  4MFB B;  4IUF A;  2KKH A;  1WSV A;  2P9C A;  2QMX A;  1VQO S;  3P49 B;  2HVH A;  4UF4 A;  1H2U X;  5DDP C;  1FHT A;  4NLU A;  1HFE L;  3IRW P;  2W9C B;  1MU2 A;  1RT4 A;  2CPE A;  3NBP A;  2JNJ A;  2ZM6 J;  1U2C A;  1XMO F;  2UVW A;  4FKY A;  4I56 A;  2FHK A;  5CZV A;  4DZ6 A;  3EXY A;  3H4B A;  4JI1 J;  3I6P A;  2VIH A;  1N32 J;  1DRZ A;  3SZ2 A;  1XR5 A;  4Y28 C;  5CYQ B;  2M5Y A;  2DNZ A;  3FSY A;  4G1Q B;  4WII A;  1SL1 A;  2XB2 D;  3QO9 A;  4PWD B;  4LIR A;  2ROG A;  2YBV A;  4UOF A;  2C3O A;  4OHV A;  4W90 B;  1N36 J;  4O4G A;  4ETX A;  1NK8 A;  4WIQ A;  4FN5 A;  3MM7 B;  5DM6 Q;  4CH7 A;  3BPS P;  4JI8 J;  5C25 B;  1EAR A;  1HBM B;  5KFZ A;  1J5E J;  2OMO A;  5EDW A;  1RK8 A;  3M30 A;  2IIH A;  4I64 A;  1AYE A;  2B9X A;  3NGS A;  2BMB A;  3D1H A;  3O44 A;  3T3F A;  2JFK A;  1DTT B;  2DR6 A;  1RWX B;  4UOG A;  1E6Y B;  1QSY A;  2GJI A;  4F7V A;  1HNX F;  1A0O B;  5DQI A;  2HHH F;  2J7U A;  2D9O A;  1JK9 B;  4B3S J;  2VKR A;  2YWE A;  2V94 A;  3B78 A;  2HND B;  2GC8 A;  1YJU A;  4ED0 A;  3P4U B;  2OML A;  2XWX A;  1IKW B;  4CO4 A;  2MZS A;  5CQG A;  4A8M P;  1VQK S;  2HIY A;  2MHE A;  3C14 B;  3D7S B;  3KNG A;  4TYA A;  1W2B R;  1B64 A;  2XSF A;  4AE5 A;  2YWW A;  1GT8 A;  3MEG A;  4X4N A;  4P72 A;  3TQE A;  4JI2 F;  1G4C A;  2VPX B;  4XDD A;  4ZIT A;  1NO8 A;  1TL1 B;  4PPD A;  3N5B A;  3O6Q A;  4XIU A;  4P2S A;  2VZ9 A;  2BOP A;  1WHW A;  2P9G A;  3JXO A;  2I5J A;  4P10 A;  1QY7 A;  3OLA A;  1NEE A;  4URG A;  4UY8 5;  2JZ5 A;  1I5O B;  5H9F J;  4FP9 A;  2VIC A;  4DV1 F;  3M2R A;  1SPB P;  1T94 A;  2QA2 A;  2LMI A;  1WG1 A;  3B6B A;  3DYA A;  1IQT A;  2E7W A;  2YWH A;  4I2P A;  1XWL A;  2F5G A;  5KG0 A;  4YS2 A;  5BR8 F;  1M1K T;  1Y00 A;  5HJY A;  2N3L A;  1HBN A;  1IKV A;  1LEO A;  2CQ3 A;  2HQD A;  2RQM A;  4AXJ A;  4CNZ A;  5B7W A;  5GAG I;  4DSI A;  4NCA A;  1G6B A;  3JSY A;  5AJ3 J;  5JVH Q;  3CD6 S;  2DHA A;  4CYU A;  2RU3 A;  1I94 J;  3KLH B;  2CA9 A;  1GMW A;  2IRX A;  3VVU A;  5MAO A;  2VPZ B;  3GWC A;  3OL9 A;  2VPW B;  4RW7 A;  4ZA1 A;  4Y00 A;  4ZHR A;  4DWI A;  1Q5V A;  2ZZN A;  2EFQ A;  2LEB A;  2HHQ A;  3BR9 A;  5IZH A;  3K59 A;  3LA0 A;  3UN3 A;  1RAO A;  3IR5 B;  3FBF A;  2OTL S;  4LBP A;  5I42 B;  1LK5 A;  4I7F B;  1MSW D;  2RRA A;  4MKY A;  1D9D A;  2YX7 A;  2V2Q A;  4NOH A;  4OI4 A;  5AXL A;  2XY5 A;  5THW A;  2BW7 A;  4Y0F A;  4IRD A;  1DLO A;  3RBE A;  4UUW A;  1NSK L;  4EWT A;  4FVM A;  2B6A B;  3HDS A;  5H9E J;  4PCQ A;  1HQE A;  1SCJ B;  1NK7 A;  3MWB A;  1TKX B;  3NGK A;  1S9E B;  2HNY A;  1MRO B;  5DDQ C;  2FJB B;  1PJ6 A;  2R2S A;  1IBM J;  1RTH B;  4NLS A;  2VKZ G;  5M2U A;  2Q6C A;  1NPP A;  1H3D A;  2Z58 B;  3MED B;  4B3M F;  4RBU A;  1LK7 A;  3PEJ A;  2DNO A;  3J81 Y;  3NKY A;  3W9I A;  1YRX A;  2BKP A;  1VOM A;  3EVO A;  5KFH A;  2QSF A;  2R7O A;  3N5F A;  4CT9 A;  2ZDO A;  7AT1 B;  5L9X A;  1N0U A;  2X7I A;  2OFG X;  1OMS A;  2H1Y A;  3CNQ P;  3LW5 C;  4P2M A;  1RT5 B;  3MFH A;  1JB0 C;  4U7U K;  3MR5 A;  2E9T A;  5KFG A;  5G0R B;  1Y9O A;  2ALY B;  2KJV A;  1X9S A;  4NI2 B;  4R8U B;  3RB3 A;  4YDD B;  4LF6 J;  1I51 B;  3KG1 A;  3DGP A;  4F4Y A;  1FK9 A;  1PYS B;  2XHW A;  2U1A A;  1HBO B;  4C48 A;  2AYG A;  1NXI A;  5AT1 B;  4J90 A;  2FVS A;  4NLW A;  1M5O C;  3KNA A;  2CPJ A;  2XMM A;  4L3N A;  1YKW A;  2P6T A;  2Q43 A;  4RPF A;  3GJT B;  5M2P A;  1KVJ A;  4N5S A;  3DU6 A;  2C42 A;  1D9F A;  2A2D A;  2DXD A;  2YX4 A;  2HNY B;  3PW5 A;  4F2S A;  1QTM A;  2OHD A;  5KG7 A;  2IM1 A;  3A12 A;  4X66 J;  4TQR A;  4DR2 J;  1Y4Z B;  1PJ7 A;  2Z2Z A;  4J9P A;  3MM5 B;  4CO0 A;  1ARO P;  1YX2 A;  3HHD A;  1DLO B;  3BPD A;  5ETK A;  3WQP A;  3PV8 A;  4FYV B;  4RW9 A;  3T1Y J;  4USW A;  5DG9 A;  1E6V B;  4FF2 A;  4USM A;  3LWM A;  1IBC B;  4KHM A;  2VPY B;  2XMW A;  5D77 A;  5LMU J;  3HHL A;  4OYO A;  3KK3 B;  3V81 A;  1RTI B;  4K5S A;  4GVL A;  3G8T A;  3HT3 A;  5HVF A;  1H6K X;  1RT7 B;  2VB6 A;  2VBZ A;  5HLF B;  4IFV B;  2N7Y A;  3CWJ A;  1S1U B;  2Q66 A;  4KFB A;  1HA1 A;  3UCG A;  1HNI B;  4Q0B A;  1U1M A;  4AFF A;  4PKD B;  1A9N B;  3MM9 A;  1VI7 A;  3G87 A;  5KOW A;  3S8S A;  2DPJ A;  1DTT A;  5E33 A;  3TZZ A;  3MAQ A;  2ZDP A;  2HW3 A;  4NYO A;  4DUY J;  4DV3 F;  5HMW A;  1RT6 A;  4Y3C A;  3R5C A;  5GMD A;  4IYQ A;  3IR7 B;  1TEL A;  4RW4 B;  1AFJ A;  2I38 A;  2Z57 B;  2OPP B;  2GS8 A;  4NZ0 A;  4QIG A;  1CJU B;  3MOZ A;  4C7Q A;  4ECV A;  2VG6 A;  2AGP A;  4HI2 A;  3AJ2 A;  1NJZ A;  4K50 A;  4N47 A;  3HSG A;  3E51 A;  1TKT A;  3CME S;  3JB9 k;  4DX5 A;  1F1B B;  1A6L A;  4CYU B;  4NLV A;  4F0H A;  4ECZ A;  3KK1 B;  1S7H A;  2MQ8 A;  4DX8 H;  2MGZ A;  1SKW A;  2VQE F;  3IBW A;  1RAE B;  5CYM A;  2R2R A;  3R8Y A;  1SIW B;  3QNW B;  3M9M B;  4JI0 F;  1PGZ A;  4TN2 A;  4YME A;  2M7S A;  2AU0 A;  3CO9 A;  2CPX A;  3PHE A;  1HNI A;  2FZC B;  3SSR A;  4Q0B B;  4FPI A;  2MLY A;  4ANE A;  1TUG B;  5CH7 B;  4NA3 A;  4B9V A;  1HBM A;  5DDR C;  3EWG A;  1GX5 A;  3GIR A;  2UV8 G;  3CJ2 A;  4UW2 A;  1ZM2 A;  2XSJ B;  5ETQ A;  3NS6 A;  3KLE A;  4ICL A;  4ECW A;  4NCB A;  4ERD A;  5AE1 A;  1P6T A;  1N54 B;  1SBR A;  1ZM3 A;  1YK9 A;  2ZOM A;  3DLE A;  2FJE B;  3PXG a;  3CCR S;  1KFS A;  3CDA A;  2CQ1 A;  3RW6 A;  2BW2 A;  2ROE A;  3B82 A;  4CO3 A;  2H4Y B;  4PYD A;  5K5M A;  3Q8Q B;  1N56 A;  1HR0 J;  4PQU A;  1Q53 A;  2GVZ A;  3NNC A;  2QRR A;  3EJM A;  1EX8 A;  1XMO J;  3CCJ S;  4X65 F;  2OSR A;  3BZQ A;  1JLG A;  2O5D A;  1CG2 A;  3GE9 A;  3QWU A;  3WX8 A;  1VQ4 S;  4RLE A;  2W01 A;  4QIF A;  3ISN C;  1VQL S;  1VRU A;  2DNL A;  4F4Z A;  3HVW A;  3IS9 A;  4X66 F;  3M7V A;  1S6U A;  4MFB A;  4B9U A;  4DR4 F;  4N76 A;  2XYH B;  4NMX A;  4FYX B;  5L1L A;  1VHI A;  3M8Y A;  2AHO B;  4LUB A;  3H40 A;  2DXE A;  3P6Y C;  3PRV A;  2QT7 A;  1EB0 A;  2NSB A;  1VIO A;  3CF5 Q;  2D3U A;  1N34 J;  4ILM A;  1J5E F;  5K14 A;  1FVQ A;  2CAJ A;  2HBQ B;  3QT5 A;  2CPZ A;  4YP3 A;  1FK9 B;  2CG8 A;  4OI2 A;  3Q8P B;  1FTC A;  3L95 X;  2EG1 A;  4ZP6 A;  4LQ3 A;  3J7A 1;  1LWF B;  1D8Y A;  4CLW A;  2U2F A;  3M9N B;  4N56 A;  2XSJ A;  1O6X A;  3LUY A;  4M5L A;  3ETO A;  4OJH A;  4TKT A;  4Y2K A;  2DNG A;  4C0O C;  2MDA A;  4ZCL A;  4F04 B;  3WC2 A;  3VTI A;  3TVY A;  1ITP A;  4J9O A;  4H54 A;  1MWY A;  3WHI A;  5DET A;  4Q45 A;  1WF0 A;  5EWE A;  2CPY A;  2VFV A;  2YTC A;  1LWC B;  2PA3 A;  4ECU A;  2G2Z A;  3MTK A;  1KBR A;  4GMK A;  4TVA B;  1YBA A;  1NKC A;  2V9W A;  2V8H A;  1VQ5 S;  1RU2 A;  5HSP A;  4O3S A;  3PFE A;  2APO A;  3C6U A;  4JI0 J;  4DV3 J;  1TP7 A;  5KT4 A;  4J9Q A;  3A8K A;  3JAM U;  2LEC A;  4K4U A;  2V6A A;  2LXF A;  3BH7 B;  4WXO A;  2YXL A;  2IM0 A;  3U27 A;  2IJF A;  1VQ7 S;  2YQ3 A;  3QAE A;  2JC1 A;  1RB0 A;  2GMH A;  4RU9 A;  5DG8 A;  2M3D A;  2YNG A;  4X4T A;  3V4I A;  2AJF E;  2FVC A;  3R7B B;  2RJZ A;  2CQ4 A;  2DGO A;  4G1I A;  3LP1 B;  3PCO B;  4P73 A;  2NXE A;  3DOL A;  1WHY A;  2D1C A;  1UVM A;  3QJJ A;  2RIJ A;  3R2C J;  3TA2 A;  3MPV A;  4G1P A;  3J7Y U;  1KON A;  2DB1 A;  2XNR A;  1H0H B;  5E0O A;  3EPI A;  2HFZ A;  4P2F A;  2WOM A;  1UA0 A;  1UEU A;  1JNZ B;  4Y2A A;  5F0W A;  4DPT A;  4EUV A;  1X8D A;  2CPD A;  2CPH A;  4FYW B;  3ILL A;  2FY1 A;  1QD1 A;  4X4O A;  2C2R A;  1Y7P A;  2PT0 A;  4ID5 A;  1I94 F;  3VVT A;  1RTD B;  2K3I A;  1OY9 A;  2ZBR A;  1KWM A;  1JLE A;  4DR4 J;  2Y0S D;  2HHX A;  2EKN A;  3B4D A;  3DLK B;  3SCI E;  2CJQ A;  3D5M A;  5T7L B;  3BEG B;  3IR6 B;  1T03 B;  2DR8 A;  3M05 A;  3ILI A;  3OVA A;  5L1K A;  3N6M A;  1RT3 A;  3MPD A;  1ZBT A;  2VFU A;  2W8L A;  4EBE A;  4A47 A;  3CCM S;  1IR1 A;  3HJF A;  3W8G A;  1X0P A;  3ZC4 A;  2P8I A;  4LRA A;  5IC4 B;  3MM9 B;  3KK2 A;  2BQ3 A;  1YJ7 A;  1RHR B;  1SC6 A;  3AT1 B;  1R8C A;  1CBK A;  2AEJ A;  4OYP A;  3T5L A;  1KQK A;  1HWU A;  4ZVR B;  1SQF A;  2J0X A;  4ANC A;  3QT7 A;  3MF5 A;  3MEG B;  4OV6 A;  2B4P A;  3CIM A;  8RUC A;  4C8K A;  4QR1 A;  1HHQ A;  3R5B A;  1TAQ A;  4YR2 A;  4ECX A;  2MZR A;  3I4H X;  4WTY A;  3TZW A;  3CPW R;  3J80 Y;  4DF8 A;  4OYZ A;  3R7N B;  1U6F A;  1U26 A;  1BHN A;  3M1V A;  3QT8 A;  2WW4 A;  4DV7 F;  4QU7 A;  1Q16 B;  4ALZ A;  2WSF C;  3MMA A;  3GFY A;  3MTJ A;  3QAU A;  1VQN S;  3F56 A;  3THV A;  4R0E A;  2UVV A;  4U8V A;  3JQM A;  2ZE2 A;  3SFG A;  1S10 A;  4KJI A;  1WKL A;  3U1L A;  3C3L A;  2GIF A;  2PEB A;  3DRS A;  3OTC A;  2AT1 B;  1KC8 T;  5G4D A;  1G2E A;  1KVI A;  3BGL A;  1YJV A;  1EAY C;  5D3G B;  1FTR A;  1RGV A;  3DRX A;  1RI7 A;  1U8S A;  2GO8 A;  5GAD U;  5ETR A;  3QPI A;  4LF5 F;  3F41 A;  4GKJ F;  4NWB A;  1B0P A;  3TO8 A;  4DI6 A;  1KHV A;  3AOD A;  4C97 A;  2HQG A;  2KXN B;  4PUO A;  1FE4 A;  1VQ9 S;  2H5J B;  1SH3 A;  4DJB A;  3J7Y I;  1SXL A;  5KFK A;  2AJQ A;  1M5H A;  1LWF A;  4Q2L A;  2ZH1 A;  5GAG U;  1RT1 A;  4F02 A;  5D0G A;  3N01 A;  1V6H A;  2D74 B;  4NX9 A;  3R1L A;  3MZI A;  2W1B A;  2EEY A;  3FRY A;  1RU1 A;  2DO0 A;  4WBF A;  2JHE A;  1Q95 G;  4ZIV A;  1FJE B;  2LCW A;  4M1K A;  3AJD A;  2Y1L B;  3A8E A;  2EVZ A;  2CWK A;  2OLW A;  4DFP A;  1Z2Z A;  3FVY A;  2WB1 D;  3CJK A;  1L3S A;  1NB7 A;  4ED2 A;  3I31 A;  1U6B A;  4ZVS B;  1VMB A;  2OH2 A;  4LFA F;  1YDL A;  5D6G A;  1C1C B;  3D54 A;  2UVU A;  3I9V 9;  5GVQ A;  3VHQ A;  4ETZ A;  1VIS A;  4DFK A;  5CD4 H;  1FKA F;  5LMN J;  3CCV S;  2R8J A;  2G2Y A;  4JI5 F;  5DLG A;  3EE3 A;  2YH1 A;  4K0K F;  5J1N A;  2BAN A;  4NL5 A;  4QPT A;  4ZCI A;  5K20 B;  3AOA A;  4DL0 C;  2PN6 A;  1NU4 A;  1NDC A;  1XBW A;  3AXM A;  3SYZ A;  1TMJ A;  3OFE A;  4KO0 A;  4WE1 A;  3KLI B;  3UO0 A;  4HTJ A;  4MKV A;  4MAK A;  1O5J A;  4OJG A;  3MM5 A;  1VJQ A;  1WEY A;  3FCH A;  4PXB A;  3DHX A;  2MZJ A;  2ZD1 B;  3K58 A;  1GH8 A;  2HVZ A;  4KY3 A;  4F8R A;  1L3V A;  2B43 A;  1OPI A;  4YB1 P;  2E9Z A;  1TUV A;  4DV0 J;  2RHQ B;  2B9E A;  1T03 A;  3EUN A;  4L76 A;  4LR8 A;  2PMW A;  2RF2 B;  4LF4 J;  2ERR A;  5EHH A;  2DIU A;  4M5I A;  3EM1 A;  1YIJ S;  4A8Q A;  1OQ6 A;  3V4M A;  3MMC B;  2CKW A;  1TKZ B;  5KT5 A;  1UFK A;  1AZS A;  1X4A A;  2FD2 A;  2OSQ A;  4P9S A;  4F4A A;  2IHR 1;  2X1B A;  4HT7 A;  1JLG B;  1LNQ A;  4O4R A;  4ID8 A;  4A8O A;  2MHN A;  4O3R A;  2ILZ A;  2F4V J;  4KHP J;  2BUN A;  3X3U A;  2AZ1 A;  3GCX P;  3VAG A;  3T5H A;  1QLN A;  3OTO J;  4YN3 B;  2ZKU A;  4A8Y A;  1C0U B;  1TUW A;  2BJ9 A;  2I0X A;  3BBC A;  4DF4 A;  1GAO A;  2EK6 A;  3C6T A;  1RWU A;  3MMJ A;  4O3P A;  1IR0 A;  3MCS A;  1HQU B;  3NOG A;  1HBU A;  3PO5 A;  1WOS A;  4CLS A;  3OW2 R;  1H7W A;  3QWP A;  3ENV A;  3R27 A;  4ZLN A;  4LRD A;  1M5K C;  5D4N A;  1IBK F;  1QAJ A;  8ATC B;  1UVN A;  2F7V A;  2UUB J;  1U4B A;  1QAI A;  4NZ6 A;  1KVK A;  2OPR B;  3CD0 A;  2JRS A;  3HHL D;  2ZH9 A;  3CCU S;  3UR0 A;  3ZTS A;  1ZYQ A;  3DRS B;  4OZN A;  4RUC A;  3W3S A;  4IOB A;  1BXN A;  4WKR A;  1B7F A;  3O8W A;  3ISZ A;  1UCN A;  5C42 A;  4EO6 A;  3UR3 C;  1NKE A;  1XC9 A;  2XS2 A;  4DR6 F;  2EC0 A;  3M8P A;  3W64 A;  4OIX A;  1UW9 A;  2G0I A;  4CH0 S;  3Q22 A;  1E6V A;  2ZC3 A;  3IBF B;  3QGP A;  4NA1 A;  4OJ1 A;  3G6V A;  2CDR B;  5E3P A;  4F3O A;  2V8G A;  5E2Q A;  4JV0 A;  2QE5 A;  3M6U A;  4OJ3 A;  4LFB J;  3KJV B;  4RW4 A;  2HAF A;  3MUV P;  5LJ5 Y;  2KHC A;  1RDR A;  2V0N A;  2LQ8 A;  2W4P A;  1FNX H;  1V9O A;  3BR8 A;  4AL6 A;  1T3N A;  3BSO A;  3CDW A;  2I1R A;  3K5P A;  4PAA A;  4FBU A;  1REV B;  5EX0 A;  3EGZ A;  3MM7 A;  3PX6 A;  2RS8 A;  1FD2 A;  1L3U A;  2FJX A;  1TMM A;  1QVG R;  3RB6 A;  4LF9 J;  4DG1 B;  5KFU A;  1TR0 A;  3H8Y A;  4M5D B;  4F3M A;  3G8Q A;  1NKB A;  2RRN A;  1SVD A;  4K7Q A;  5DRK A;  2NLW A;  1KDN A;  2IMO A;  4EGL A;  2LQ9 A;  3E3X A;  2I2Y A;  2BOA A;  1RLD A;  2MKI A;  1XJW B;  2HQC A;  5G0R A;  3FMW A;  2D3O R;  1FWP A;  2BAC A;  2DGV A;  3MEC A;  1TTH B;  4DV5 J;  2VFT A;  4K2J A;  2IVM A;  1N5Q A;  1YG0 A;  2BE2 B;  1F9F A;  1T7P A;  4L74 A;  4G65 A;  3KYL A;  4BBY A;  1G7C B;  4C8Y A;  4QWE A;  2IFX A;  4HH1 A;  3ITH B;  2AKW B;  3RJM B;  3FNN A;  2B4U A;  2B4V A;  5H1S V;  4IR1 A;  5I3U A;  2DNQ A;  3HCX A;  1SUQ B;  4MYU A;  2P5V A;  6FD1 A;  2K06 A;  5IXU A;  2WON B;  3GYN A;  4CP5 A;  5IWA F;  1BQM A;  2RF2 A;  4IRK A;  1R0B G;  2KL8 A;  1EIY B;  1Q8B A;  1S1W A;  2UUB F;  3I5B A;  2VF3 A;  3GG0 A;  3MMB A;  3FBB A;  3BN4 A;  3GCW P;  4ZPB A;  4KHP F;  1PAE X;  2OGU A;  4C11 A;  3OHA A;  2HKE A;  2ZM6 F;  2G0C A;  4HH0 A;  4JV2 A;  4ZCM A;  3OR2 B;  4V19 X;  4OZL A;  5A6W A;  4JI4 F;  3KWM A;  4DXL A;  3RB4 A;  2WSE C;  4QWA A;  3GJR B;  2CNN B;  2BJD A;  1S1X B;  3EDR B;  1RA6 A;  2NZC A;  3VV2 B;  3ZTR A;  4LSN A;  3W5X A;  1Y10 A;  1S9G A;  2QLJ B;  1RT7 A;  2FGC A;  3BH6 B;  3CC7 S;  3MEC B;  1ZZN A;  2GGP B;  1T9Y A;  2WVB A;  2VQF J;  1KEK A;  3LGN A;  3DHW C;  2J9D E;  4DR5 F;  1Q5Y A;  3R5G A;  5JVG Q;  2VG7 A;  3BKT A;  3PAC A;  1F6T A;  2E5L F;  3IS9 B;  1ZET A;  4I68 A;  3U1M A;  2IM3 A;  3VGT A;  4A46 A;  5A8K A;  3KLH A;  4ZP9 A;  4W92 B;  3W5Z A;  1S0V A;  3MOJ B;  1ELO A;  2QL5 B;  2V8D A;  1ACM B;  1VHF A;  3M2V A;  4ZDN A;  4KRW A;  4JI7 F;  2QFI A;  4LF9 F;  1JLA A;  4ZVU B;  3RG6 A;  1MU2 B;  1RT4 B;  2FUG 9;  3NBP B;  2OFH X;  4LSL B;  4U96 A;  3TYT A;  1NK6 A;  2HHH J;  4HDG A;  1UJ6 A;  4JYA J;  3D4J A;  1BE4 A;  3JQJ A;  1BMQ B;  1WKK A;  4KH1 B;  4ZVG A;  1U1P A;  1CQM A;  3H59 A;  2DNP A;  4I6A A;  4ZN3 A;  3RBZ A;  2AV5 A;  2OEJ A;  3S01 A;  4LF1 A;  3TAM B;  2LQB A;  2Q79 A;  2XYG B;  2QTW A;  2B0G A;  4OZ1 A;  4JI8 F;  2UUA F;  4B9S A;  1GXT A;  2MEW A;  4DX6 A;  1WDD A;  9RUB A;  4L73 A;  4F0M A;  2J76 E;  3OQ2 A;  5I3U B;  3UCU P;  1N5Y B;  1IKY A;  3UD5 A;  1RWK B;  4A8K A;  3K5M A;  3EGW B;  4NI2 A;  4R8U A;  4Q2M A;  4EO8 A;  3AFG A;  4NCG B;  2QC3 A;  1UJ4 A;  4RKU C;  4DQS A;  5GAH U;  2KFZ A;  2LXI A;  1N0V C;  3PW7 A;  3CGI A;  3HT0 A;  1BD6 A;  3C15 A;  3IGV A;  1ULR A;  3KUH A;  3NP5 A;  2BM1 A;  3Q8V A;  4OX7 A;  5B09 A;  4MIB A;  5IWA J;  4DR7 J;  3MUR P;  5L46 A;  4DSJ A;  5HMZ A;  4YOE A;  2AEF A;  2RIL A;  2GCF A;  2HQI A;  2MLZ A;  4WFZ A;  3TUP A;  3GR1 A;  1MWZ A;  4OI1 A;  4X4R A;  3R5A A;  4X4S A;  3W5Y A;  3A8J A;  5KFW A;  1FA0 A;  4UZC A;  5L9N A;  4A8F A;  4LSN B;  4DQI A;  4KGZ B;  4RW8 B;  2SXL A;  4BS2 A;  4DS4 A;  2DK2 A;  1PC5 A;  1RWN B;  3K8W A;  4F67 A;  3E2E A;  1S1V B;  3BYP A;  4PXD A;  4LFC F;  3TEH B;  1A7G E;  1LFP A;  3PJX A;  1M1G A;  2C3Y A;  4MJK A;  3ZXW A;  4YUD A;  5CA5 A;  4DSF A;  2QSW A;  1RHQ B;  5LXR A;  3FGV A;  3ZZT A;  2UV8 A;  2B8Q A;  4PQA A;  1RCX B;  5L8R C;  2ZH4 A;  2CNL B;  2R42 A;  3RB0 A;  2OJ3 A;  4HHJ A;  1GFW B;  3BQ1 A;  1K47 A;  5J1E B;  3BKF A;  3MM6 B;  5KFF A;  1OQ3 A;  4NZ7 A;  1PIE A;  4K4X A;  3H5X A;  1QTN B;  1CVJ A;  4DSK A;  2JEI A;  4OX9 J;  3CCQ S;  1F5C A;  2AJ4 A;  4JV1 A;  2C3U A;  2QO3 A;  4AT1 B;  2O3D A;  4J9V A;  2NUU G;  1VDH A;  4KV8 A;  4UOH A;  9ATC B;  1E6Y A;  3WDO A;  1SJF A;  2CYY A;  4K4Y A;  1VQ8 S;  5BXI A;  1K44 A;  3Q83 A;  4LBH A;  4DUT A;  4U67 Q;  1YQH A;  3H42 A;  5IQ6 A;  4ZPA A;  5KG5 A;  1D8Z A;  3JSB A;  4KFB B;  3DRY A;  3NAH A;  3MR2 A;  2B4O A;  1PAU B;  4J7C A;  5DS7 A;  3HSD A;  2XS7 A;  3EDQ B;  1VLY A;  3TA0 A;  1RBL A;  3C16 A;  4TY8 A;  1HHT P;  3CCE S;  1IBL J;  3OPK A;  3R6G B;  2O01 C;  3TR5 A;  1Q82 T;  2VG5 A;  3K7R A;  5HQ8 A;  2V2K A;  3EXC X;  5HMY A;  4NXM F;  3O5T B;  1PBU A;  4BC7 A;  1WEX A;  1Z2L A;  1UVJ A;  3CMQ A;  1JMT A; 
#chains in the Genus database with same CATH homology
 1RWX B;  2HBZ B;  4DCP B;  4DCO B;  3GJR B;  1RE1 B;  2CNN B;  3EDR B;  2XZT B;  2QLJ B;  3R7B B;  1IBC B;  1SC3 B;  1RHK B;  3P4U B;  2C2O B;  2C2M B;  2H51 B;  2CNK B;  3NS7 B;  2QL9 B;  1ICE B;  3KJQ B;  2QL5 B;  2CJX B;  3GJQ B;  4ZVU B;  2C1E B;  2Y0B B;  1BMQ B;  4DCJ B;  4ZVO B;  2XYG B;  1RWK B;  3D6M B;  5IC4 B;  2H5I B;  1NME B;  4LSZ B;  2C2K B;  1RHR B;  1RHJ B;  3QNW B;  3R5J B;  3SIP B;  4ZVR B;  1RHM B;  2C2Z B;  3KJF B;  3KJN B;  3IBF B;  3R7N B;  2QLB B;  2CDR B;  1RWN B;  4ZVQ B;  1SC1 B;  2H4Y B;  1RHQ B;  2DKO B;  4ZVT B;  1RWW B;  2CNL B;  1GFW B;  5IC6 B;  1PYO B;  2H48 B;  4JB8 B;  2XYH B;  1QTN B;  2H5J B;  1SC4 B;  3R6L B;  1RWO B;  2H4W B;  2HBQ B;  3IBC B;  2XZD B;  2XYP B;  1I3O B;  1QDU B;  3R7S B;  1RWP B;  2CNO B;  4ZVP B;  1I51 B;  2Y1L B;  2QLF B;  3GJS B;  3RJM B;  1F9E B;  2QL7 B;  2HBY B;  4ZVS B;  1PAU B;  2HBR B;  3GJT B;  2CJY B;  2P2C B;  1RHU B;  3EDQ B;  2H65 B;  3D6H B;  3R6G B;  1RWM B;  5K20 B;  3D6F B;  2FQQ B;  3P45 B;  2H54 B;  1RWV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...