1BWEA

Artificial fe8s8 ferredoxin: the d13c variant of bacillus schlegelii fe7s8 ferredoxin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
AYVITEPCIGTKCASCVEVCPVDCIHEGEDQYYIDPDVCIDCGACEAVCPVSAIYHEDFVPEEWKSYIQKNRDFFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN)
publication title Solution structure of an artificial Fe8S8 ferredoxin: the D13C variant of Bacillus schlegelii Fe7S8 ferredoxin.
pubmed doi rcsb
source organism Bacillus schlegelii
molecule tags Electron transport
total genus 19
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bweA00
2FJEB 1GTHA 2C3YA 3EXYA 6FDRA 1ROFA 5CH7B 2FJBB 2VPWB 2WB1D 1DAXA 2FJAB 1FDNA 2FDNA 1G6BA 3OR2A 3GYXB 4XK8C 2ZVSA 1IR0A 2VPXB 4YDDB 2PDAA 3LW5C 4CI0B 1FF2A 5CHCB 1JNRB 2XSJB 1FERA 4L6V3 2C3OA 5L8RC 4OV1A 1Y4ZB 2Y0SD 1RGVA 3PNIA 1FRJA 4AYBD 1GT8A 1H7XA 2PMZD 2VPZB 1FRXA 1IQZA 3EGWB 2VPYB 1DFDA 1BLUA 1F5BA 5BYRA 1D3WA 2WSEC 3MM9A 1Y5IB 2Z8QA 3MM5B 1KQFB 1SJ1A 3C8YA 5E7OB 1F2GA 3MM6A 1A6LA 2C3MA 2C3UA 1HFEL 1H98A 3OR2B 3MM8A 1FTCA 4Y28C 1BC6A 2FJDB 5BYQA 2O01C 3IR7B 1FDDA 1XERA 3MMCA 1PC4A 1F5CA 1FDAA 1H7WA 3MMAA 2WSCC 4XDCA 1C4AA 1FCAA 1R27B 1AXQA 1BD6A 4KT0C 4ID8A 1G3OA 3MMBA 2IVFB 1SIWB 1H0HB 2C42A 3MM9B 3MM7A 1FRIA 2GMHA 1K0TA 1PC5A 5FD1A 3OR1A 1FXRA 2V4JA 7FD1A 1C4CA 1FRLA 3MM6B 1VJWA 4XDDA 2WAQD 2FGOA 5BYSA 4DHVA 7FDRA 1FRHA 3IR5B 4OMFG 1GAOA 2VKRA 1B0TA 3MMCB 3EUNA 2C3PA 1FRMA 1DURA 1SIZA 3HKZD 1CLFA 1Q16B 1FD2A 2PA8D 2XSJA 1FEHA 3MMAB 1B0VA 2GMJA 1JNZB 1KEKA 2UZAA 1BQXA 1KQGB 6FD1A 4RKUC 1Y5NB 1FRKA 2V2KA 1Y5LB 3MMBB 1JB0C 1FXDA 3MM7B 1BWEA 2FD2A 1FDBA 1B0PA 3MM8B 1GTEA 1WTFA 3OR1B 2V4JB 3IR6B 2WSFC 3MM5A
chains in the Genus database with same CATH superfamily
2GVZA 4NZ7A 4MIBA 4PXDA 3KLHB 5HMXA 2X1GA 1EQMA 3WC2A 3FCVA 4KQZA 5U47A 2CRLA 5D77A 1QE1A 2ZBRA 1P9QC 3O2IA 3PEJA 3EGWB 2RE1A 1SH3A 1S48A 4LSNA 4WJBA 3DFEA 3G9CA 2QE5A 1WI8A 2E66A 2MEWA 1N54B 2PD1A 3CCQS 3QAEA 1OO0B 2Y1RI 1DJ0A 1TUVA 3DOKB 5KFVA 4RNMA 2B9YA 2EVZA 4FYWB 3UPFA 4XO0A 2HHHJ 4ANCA 2PN6A 4DPYA 2YXLA 3DLEA 1MWYA 5IWAF 4OZLA 4DR2F 3WX4A 2ZM6F 2PFFB 2E9TA 4JV1A 4YY3J 1U8WA 5C7PA 1N8RT 4N8OA 3JSRA 3MUTP 3H2VE 2ZC3A 1S6QB 4K4TA 4JI6F 4QU7A 4OV6A 4DPUA 4URQU 1AYEA 1U7LA 2YKNB 2P9CA 2BE2A 5CYMA 4PAAA 4N76A 2HHQA 4OZ2A 1N5SA 1SH2A 2F7VA 4CLUA 5HP1A 1VQLS 4I2QB 4LBIA 3BSOA 3R5BA 4PXBA 4KE5A 4CTAA 2QA4S 2QA2A 4FF4A 3DOMA 1ZM3A 3ZTPA 3W2VA 4DQRA 2HQIA 1T3NA 1R7IA 2J6SA 3KLIA 3KK1B 1RXOB 1C4CA 1E6VA 2AW0A 4JI3J 3WIUA 2LQ8A 3KMQA 3GWCA 2IM3A 3I0RA 2D3ZA 2X3DA 3AFGA 3VTIA 4MJKA 2W9CB 2CZ9A 1M5KC 2XSJA 1NPRA 3EM1A 3W8GA 2JOQA 5A0YA 5ETSA 1TKXA 2XZWA 1WI6A 4DV2J 4DV3F 3CDBA 1RZMA 4CP5A 1CC7A 4DV6F 3CMES 3M2VB 2Y1JA 2IPOB 2C2ZB 2FJBB 4K2JA 1R3NA 3PVXA 3DCAA 3I82A 4ECQA 1EHWA 2VG7B 1IKXB 5HL7Q 3G71S 5DDQC 1TMJA 1RLCL 2ZOMA 3BN4A 2ZKTA 4GVBB 2QG9B 4RPFA 4H4MB 2EFVA 4FXDA 2IYGA 1DQ8A 3EPGA 1RWMB 1NSQA 3Q24A 3VWSA 2KTQA 4UUXA 3CCES 4JYAF 4ZJOA 2R7VA 4F4ZA 1RAGB 3NGSA 2CJYB 1RT4B 2MYFA 2P9EA 2HQGA 4EI2A 3JSMB 4RU2A 3JQMA 1M90T 5JVHQ 4OZJA 2AD9A 1UW4A 2BQ3A 3P5TL 2NSBA 2Z58B 2MLZA 3BO4A 3UN3A 4HT5A 3HHLB 2R8IA 4F3MA 3QMQA 2KH9A 2CKWA 1KEKA 2HNZA 3HVTA 2YNIA 1JWWA 1F60B 2JEJA 5AXNA 3C14B 3CD5A 5J2PA 4DR5J 2F8MA 1WJ9A 3Q2SC 1TKZA 1U2RA 2Y3YA 1JLEB 2GQ2A 4TKTA 1R8HA 4UZCA 2IMWP 4LF6J 4LSZB 4CQ1A 2O67A 3Q23A 4JOUA 4QQBA 1U6BA 2MSSA 3C15A 1QAYA 3OQ2A 1RKIA 1NK0A 4NCGA 5F9NA 5ETKA 5E7OB 1XR7A 3PCOB 4P7TA 3M1VA 4NLTA 1X9SA 3EICA 4DFMA 2D3O1 5J2NB 3BSCA 4LBPA 2ZUAA 4A8WA 3QWPA 2HWHA 2E29A 5AXKA 2KKHA 4UY8T 4EBDA 1L3TA 3D6TB 3VGUA 2E5JA 1D9FA 3NGDA 4R5PB 4B9LA 5MAOA 4DG1B 3OSNA 1FEEA 4B3MJ 5K9FA 1CULB 2ZBCA 2JNJA 3DI6A 1LXJA 3PRDA 1VRTA 1IM4A 1RWKB 4JV5J 2FY8A 1XMQF 2R7RA 3D7SB 1YSJA 2A3JA 2E5HA 3N9UC 1TK8A 3HZGA 4FN5A 4IFVA 2E7XA 2XEXA 4ED2A 3MXHP 4NLOA 2CPEA 3TUPA 4C2MA 4KKOA 1PJ7A 4YS2A 3POTB 1CJVB 1KHWA 1MMLA 5EX0A 3VGVA 1DARA 1N36F 5F8NA 2FHJA 5KAKA 1RP5A 1YWXA 3BBFA 4XDCA 4AD6A 2A2DA 2F5GA 3QIDA 2I5JA 2ZC4A 2FB0A 4X4PA 1FWPA 4R25A 3KTQA 1TAUA 1T9VA 2OJ3A 1NRKA 4F2RA 2K7JA 4WE1B 4DDFA 5T41A 2AX1A 2HRYA 5L1LA 4OX6A 2NZCA 3M32A 2NLWA 3N5BA 1BXNA 3CCRS 1IKVB 1E6YA 4I64A 3MR5A 3SXLA 4M5IA 1T0TV 5LMUF 4CI0B 1XNRF 3GFZA 3R9LA 5C5JA 2RT3A 2XO7A 2M9KA 3LAMA 2BACA 1S1VB 2B7CB 2GGPA 1V3SA 4WCEQ 2BW2A 3QT7A 4O44A 1BLUA 2MQNA 4WP3A 4ZVRB 3CD6S 2W4DA 2VBXA 2M88A 4X4OA 3K5NA 3SQGB 3CEDA 3LWMA 3HLUA 2OUGA 2HFOA 1UJ4A 3K5PA 2R2RA 1VK3A 4EK2A 2AEFA 3D6MB 5KFPA 1LWXA 3IC1A 3RU0A 2VZ9A 1Y3KA 2MQ8A 1X9MA 3A3NB 3LUYA 4B9SA 3OL6A 1VQKS 2DVIA 4IO9Q 5C24A 4V19X 1Z1ZA 3QLHB 5AE2A 5KFAA 3M2RB 4PG4A 1PYSB 2V2KA 3C66A 4DR7F 5M2RA 2AYGA 3MEGA 5F8GA 3ILJA 2MQMA 1GTEA 1VMBA 3DM2B 2GIRA 3JB9k 2DTJA 3PXGa 4L3KA 2M7SA 4K4WA 3BGOP 1VQMS 4ZCIA 2Y8YA 3OTEA 3BV8A 1ZPVA 2N4CA 4IG0A 4DPWA 3HXMA 4MK7A 3W9JA 3U27A 5A8KA 4TQSA 1IWGA 2M8HA 4CZCA 2FJWA 2WVBA 2B9XA 1JLBB 4NRTA 2D41A 3HP6A 1RTJA 4OI6A 1QTNB 4Y3CA 2ZOGA 2F9JA 1VBKA 2DGQA 1G2EA 3NY0A 2J0QD 2UUBF 3J7A1 3UD5A 2HIYA 2I9SA 4FKXA 4M5JA 3FEZA 4R8UA 4K5RA 2VV5A 4BWJA 1X8DA 4YB7A 3MPVA 4WKYA 3M8PA 3MMAB 4MIWA 2ACYA 4E98A 2JX2A 2V69A 3CDWA 5I42B 2OPQA 3BKUA 2QN6B 2R7SA 3GP9A 1WOPA 2ZH1A 4OJ3A 1ZZFA 4GKKJ 1NBEB 4HHUA 1PILA 3THPA 3E3XA 4JI8J 3I9ZA 4YB1P 4DPTA 1KVKA 3M2UA 2HGLA 1YVFA 2Z8QA 4ZVOB 4YN3B 2BQRA 1WNEA 4WZQA 4DX7A 5IQ6A 3VZHA 2RUGA 3V81B 3EVMA 3MMCA 1H7WA 4IH7A 2V8HA 4DSJA 3OD2A 2QYGA 1BD6A 2J9DE 4X62J 2NXNA 5D4OA 1OYEA 4PR6A 1HI8A 3BGRA 4A8YA 4J7CA 4I6AA 3SDEA 1B7FA 3E01A 5KG2A 3CDEA 1VBYA 1YJVA 1WF0A 1MNEA 1S12A 5T14A 3PX6A 2AZ3A 2QL7B 1N56A 2JH3A 1T7PA 5LSRA 1Q7YT 1DRZA 3VAFA 4LF1A 4TY8A 1RWWB 1QM9A 2RDJA 1KKHA 4NLUA 2JHEA 2HS0A 1QSLA 2KO1A 2J5AA 4ED8A 1OQ3A 3D0IE 3BB5A 5F8LA 4YUDA 4ELVA 2CJAA 1I5OB 4KPCA 3B4MA 1TV6B 2YPZA 4P52A 4EWTA 4E0DA 2DEIA 3TVYA 1BQMB 1F2GA 3CB4A 2IAJB 2XS2A 5ETOA 2VQEJ 3DKDA 1I3OB 3CJTA 1K73T 2AV5A 4XPEA 1I6JA 1TAQA 3SYZA 3G6ES 4ZVGA 4DX8H 4USJC 4B3SJ 2K7KA 2DITA 3KLGB 2GHVC 3OJSA 4J9MA 4WIQA 1U0HB 4ECWA 2C22A 2B51A 3GCXP 4GO7X 3QJJA 2ZWPA 3SV4A 4DXLA 3K5MA 3SV3A 4ZVPB 2EBEA 4TLQA 2VB6A 4UZBA 5HJYA 1VBXA 3JQKA 1Z2LA 2RRNA 1T9UA 3DRRA 4IRKA 4ICLA 2DHSA 4OHYA 3OFGA 1HYSA 3HHDA 4M94A 5C42A 1FT8A 1C1CA 4KJIA 5IC4B 4PQAA 1KQKA 3ZZYA 4QIFA 2HVHA 1Y4ZB 3W64A 4X64F 3QFHA 1ZBTA 3LANA 1DFDA 4DQIA 5HJXA 1S0NA 2EC0A 1SUQB 2YX1A 5CYQA 1ZM2A 3NMAA 4A8SA 4DL4A 4FPRA 1LV5A 2GHPA 2AEJA 4A8QA 1T9XA 1OMSA 3HHNB 4CYUA 2HNDA 4X4TA 2BOAA 2ZBPA 4I2PB 4LFAF 5GMEA 2GO9A 3FK4A 4P72A 2ZJRQ 4CT9A 2JFKA 4ED6A 2VG5A 4FYYB 1TZ0A 4K0KF 3T5JA 4YB6A 4U8VA 3CNQP 5BXIA 3P5BP 2ZH6A 3VZIA 3F73A 4RX6A 2IM0A 1FKPA 1S77D 3T9NA 4Q2MA 2ACMA 1BWEA 4ZMMA 2R2SA 5IV4A 3DRSB 1JXEA 4KGKA 3NKYA 1U2CA 1NZAA 3TA2A 5HAOA 3MECA 1HQEA 3P3DA 3TAPA 2YKMB 3N5FA 2CPDA 3T1YF 3UQSA 2W4CA 2XMMA 1GEHA 4A47A 2ZJPQ 4JB8B 1SJ3P 2CJQA 2FY1A 4DU7A 2OI2A 2DEJA 2HEKA 3MM6A 1HBNA 5H9FK 5KTQA 5DGBA 1N6QB 4C3KA 2CXEA 3B54A 2JZ5A 2X1AA 3PO4A 1X0PA 3A8EA 3TP2A 1NK8A 1HQUA 2AHOB 4QWAA 2D3UA 3OPKA 3BGFA 2RAQA 4Q2LA 2HVZA 4FZVA 1TVRB 4Y34A 5BYSA 2CPHA 1I94F 1TTHB 3UNYA 2OKQA 4X4NA 3C6UB 3CWJA 2I1RA 4DV1J 2KJWA 4OLOA 2QLBB 2DGXA 4GKJF 1EKRA 3KUEA 3CO9A 1Y5NB 1NKCA 5DQGA 5IFMA 2MKIA 4CDIA 4XK8C 2ZVSA 1UJ5A 4I7FB 1T02A 3RB0A 4MTPA 2P5VA 3W9HA 1X0FA 1D9DA 3NNCA 2WONB 4K4VA 2H9ZA 1SKSA 5B0EA 5KFLA 3GV7B 1ZETA 1C1BA 3I5AA 1RLDA 3MM5B 5ETLA 1SJ1A 2GO8A 1VC5A 3VGSA 1A6LA 2GHWA 2HFZA 2HPUA 5DO2A 2V4RA 1R0AA 3PIOQ 1IUJA 2WHOA 4NYOA 5IV3A 5G0RB 4C7QA 4KFBA 2E1RA 2LDIA 3TNVA 4USWA 3Q89A 1DHMA 1UFKA 4OX7A 1FRLA 1QAXA 2OP5A 2CQ4A 2HHHF 4A8XA 4ZP7A 1TK5A 2MKHA 2PEBA 1S5ZA 2G0JA 1JLGB 1YRUA 3C16A 1HWLA 3T3FA 1TELA 2JLEA 3MF5A 4YY3F 2R2UA 2HMIA 5HP1B 2XLJA 3KJVB 3DYAB 3SFGA 1HBMB 2BABA 5HBMB 1LW0A 3A3OB 4RLEA 2ZWOA 5JXSA 1N52B 2PDAA 3I56S 4PWWA 3ISZA 4OHVA 5EDWA 2C2MB 3JYTA 4OFZA 3FSXA 4RZRA 3AJDA 1IKYA 3ZTOA 4WFAQ 1E6VB 1L5UA 2A0FB 1GMWA 5KFJA 2KB2A 2XMWA 1R8BA 1K47A 3PX0A 3CTRA 5J1PA 2QLXA 1NAQA 1TMMA 3S6EA 2RU3A 3CCWA 2XNRA 4K59A 4CCHA 1SKRA 2QLJB 2E5LJ 4DX5A 5IT0A 3IRWP 4XIUA 2CPIA 4NYZA 3H4BA 3V6DA 1RTIB 1YTYA 2QA1A 2R42A 4PQUB 3TAMA 1MMNA 1Y10A 4ZN3A 2OSRA 3OV7A 4F0HA 2J9EA 4DPOA 2XMVA 3GPAA 2KT3A 2EK1A 3PY8A 1RWVB 1VQNS 1S1TA 4RW8B 1JLCB 2CDRB 5E3RA 4RO0A 4DV2F 3T1HJ 1PCAA 3JAMY 3EXYA 1MWZA 3VAGA 1NDCA 2P6TA 2NPFA 4MKAA 4QPXA 4ECYA 1N4LA 2EI5A 3DXBA 3LWLA 1AW0A 3J81Y 4KTQA 2W4PA 2V0NA 1U1PA 3UVJA 2IDEA 3HCXA 3N28A 1Q79A 2VBYA 2NS1B 1WSRA 2DGVA 4OHWA 4RWWA 2KT2A 1YZ6A 4PWDB 3KLFA 2HWTA 3PM9A 2V6AA 4RWXA 2D7SA 1NK5A 3MD1A 5B08A 4V1Ak 3DHXA 2JVOA 4KGMA 1TL7A 3HD2A 1RJJA 2ZNZA 1RYSA 4LVOP 1AZSA 1UFWA 4ANEA 1QJHA 1VJWA 3H2UB 4ZCLA 2EW9A 3J7AN 4U7UK 4IG3A 1NSPA 2RDDA 3TRGA 2CPYA 1REVA 4P74A 1KVJA 3ZTSA 4FXWA 1DTQA 2BM0A 2ATLA 2HGMA 1UWAA 1RHMB 2MQLA 2EEYA 2QTWA 1JXVA 3MUMP 3MCSA 4ELTA 2CQCA 2M2BA 4UOFA 3OHBA 3IXQA 2AF6A 4LF6F 4LRDA 5IT4A 4JI5J 1WC6A 1F5BA 3PYGA 2O66A 1PGZA 1ZOTA 2PO4A 4IR9A 3F0NA 1S57A 4HL9A 3NRBA 2IFXA 2HHWA 3QGHA 4AXJA 2FLLA 2MLXA 4K50A 3N4WA 3DI6B 3C6TA 2Z56B 1VCTA 2XNQA 5LSLA 3UR3C 5ETVA 1TKTA 4QR0A 2HFSA 1X5PA 2DO0A 4UOHA 3HVWA 2OPSA 2CDQA 1JJHA 1X31C 2W1BA 3EWGA 3F41A 1Q16B 2B4VA 2W2MP 3IGNA 3IG1A 2I8EA 5KFIA 1KQGB 2GAGC 4I69A 4QR1A 2LQBA 3MPDA 2DIUA 3MMBB 2GIQA 4R0JA 2BKNA 4TU7A 1DLOA 5I3UA 2FHMA 4USKA 1N32J 4F3QA 4J9VA 5RUBA 3DRPB 2MJUA 4ZP6A 3A1YG 2L41A 4X2BA 4FVCA 2X1FA 4RUAA 2I5JB 3KDNA 2J76E 4NMLA 3GJSB 2IMOA 2AJ2A 2A6MA 4PUOB 2ZEJA 4O0IA 4P10A 1EETA 3C8YA 1QSSA 2UUWA 3EYZA 4EO8A 4HEA9 3MWBA 1XERA 2ZE2B 2MQOA 1Q4RA 4B3OB 1OPZA 3MR6A 5A6WA 4IFYB 2KVQE 1H74A 5L9XA 1FX2A 1KRPA 3CPWR 1C0TA 2IBKA 3ENVA 1UPMB 2XULA 2L3MA 1MLAA 4ZLPA 2F3JA 2LXUA 5CZXA 3WQPA 4ZLLA 4TVAB 1T03B 4F4AA 4A46A 4J9KA 3BPDA 3M8QA 1J5OB 2VJUA 3OHAA 3ZZTA 2ZZTA 1T95A 2RJZA 1XNQJ 1UVJA 1Q78A 4WP8A 3KK3A 1WACA 3CJ0A 2D3OR 5AXMA 1JLAB 3CXCR 3HK2A 4F4KA 4CO4A 1M1HA 4RBTA 4YDXA 5LMNJ 5CCLA 3M9MB 3HJVA 4FP9A 2NPIA 2R9LA 2AJFE 1RA7A 3RBEA 3QRPA 4ECUA 2XI2A 3B8HA 2LMIA 5C24B 4ALZA 1VFJA 1ZAVA 1LFWA 5IT9Y 4AE5A 1SJQA 1BC6A 1NXIA 2ASJA 3DN9A 4IRDA 3VAKA 3A13A 1FNOA 3LP2B 4DL7A 2RHSB 2XCAA 4RW6A 3VHQA 3OVBA 3W60A 4EZ9A 2J8SA 2HAIA 5DQIA 4EYHB 4W98A 3J7Z5 5F9LA 3J7YI 1UKUA 4KBIA 2BX6A 2GVDB 1UZHA 2DGOA 2L9NA 1ZTTA 2M4MA 3RRHA 2NREA 1HMVB 1F1BB 3W7BA 1QAJA 1WTFA 4CLLA 4RUHA 2OSQA 2Q3PA 3DLLQ 1C0UA 2MKYA 3TUZC 1GX5A 2R8GA 1NHUA 1LXNA 3FBEA 4J5OA 2ZD1B 1XTZA 5KFKA 2QA4G 3GONA 2HHVA 3KHHA 2QGFB 2J0SD 4C3LA 1A0OB 2CQ3A 2PI4A 3HT0A 1UVIA 3CCVS 3V2UC 4OX9J 2YTCA 5HQMA 4MK8A 4Y2CA 1HBOA 3V6JA 2AWZA 2K3IA 3M8PB 4ZK7M 4NCBA 1XC9A 3R6LB 1B4SA 1YJTA 1YJUA 3TJ9A 2AYBA 3M05A 2FGCA 3PFOA 2Z30B 1U4BA 3EZOA 3MPWA 4W92B 2XGQA 3VALA 3C3LA 1I1GA 3DLBA 1AT1B 3KJQB 3PX4A 3CF5Q 1XQIA 5D3GA 3TOQA 1SQEA 2A10A 5D0HA 1RK8A 4RW7A 3R7BB 4TNOA 5LSOA 3P6YC 2OGUA 1NJXA 1IQTA 5AE1A 1WOOA 1DAXA 1HA1A 4WFBQ 1RKJA 4ES2A 1YX2A 1S49A 4LSLA 2QSWA 4GKKF 1OQ6A 4V19J 3QPIA 1JLQA 4I68A 1UZDA 5CA5A 3KK2A 1JKHB 2WVCA 2YPYA 2J7UA 1NB7A 4HLBA 2Q66A 4I67A 2CWXA 2FZGB 2XSFA 3GQCA 3OR2B 3I0SB 2B8PA 1S10A 2Q43A 1RAAB 3ZZ0A 1WDDA 4RL1A 1CJKA 3BDEA 4A8MP 3PR4A 5BJRA 1LKZA 1ULRA 2GCFA 4C9DA 3ZO7A 2VIHA 1RT6B 4CNYA 4X62F 1RAHB 4IRCA 4DSIA 4B3TJ 3GG1A 3UE2A 3D4JA 4OHXA 2RQMA 2K3KA 1SL2A 1SVDA 3CO0P 3UO0A 5C2GA 2RF2B 3K57A 4Q8FA 4ZPWR 4EU0A 1HBUB 2W7AA 2OPPA 1O0PA 3J7YU 3QWUA 1X60A 1U24A 3OT9A 3FEYB 4HYKA 4ETZA 4OV1A 4M5DA 3G2XA 1RTHB 3AAWB 4QIEA 3U1LA 4NWBA 1RADB 2JEGA 1T9YA 1VLYA 2VA2A 3KWMA 3Q2TC 1YLXA 4DFPA 3IS9B 1VOMA 1VC0A 2VQEF 1B7YB 5KG5A 1HYSB 5HLFA 1F9FA 3DMJB 3HSDA 5CXTA 4HHJA 2B6AB 2PFDA 3FCHA 1Q8BA 2BYCA 1RT2A 2XMTA 4DR1J 2Z2MA 1MN7A 3OTDA 3MAAA 2A6OA 2BJ8A 1NDKA 3BR8A 4Q0BA 2DNHA 1PAEX 4LF7J 1W2BR 3BJYA 2QV6A 2C3YA 1DTTB 2EFQA 2G9OA 2XLKA 4XTTA 2BJ7A 3O5TB 2XYPB 4TQRA 1X4AA 2GQQA 3H40A 5KFNA 1MWQA 2OTLS 1FKOA 2GV1A 4N56A 4DV4J 2DXFA 1TR0A 2B4OA 2VG6B 1F9HA 5F41A 1U6FA 1FVSA 4ENOA 2CG8A 1F0XA 3V6KA 3PYDA 3T5LA 1VI7A 1EAYC 3AB2B 3SEOA 2ZH8A 3CIMA 3FFIA 2AKWB 3ZTQA 2V34A 4CLTA 1RAEB 3GG0A 3UDCA 2DHHA 5SUHA 1D1UA 5DLGA 2IDLA 3OXLA 2CFXA 5DJBA 4IO1A 5F8HA 3T1AA 1J5EJ 4NA2A 2PC6A 5HMWA 2FLPA 2V50A 3BO2A 1Q82T 3K59A 4U96A 3RB3A 3M6XA 1G4CA 5K8NA 3KUHA 2OAUA 4F02A 2GMLA 3MMJA 5T7LB 5ETTA 3HHEA 2VPYB 2IM2A 2AIRB 2KYZA 2R4FA 2BA9A 4IDKB 3S7RA 1T9WA 2CQBA 3KG4A 1YG0A 2VC1A 2LQ5A 2W9AA 3H90A 4H4OA 2W8KA 2POKA 2PSZA 5D0EA 4WWSA 3QIPB 3VAIA 5KFMA 1S1WA 2VFVA 2MMYA 3ETMA 1UWBB 1HPZB 1LWEB 3PZPA 3EXCX 1FRIA 1ZH5A 4N41A 1S1UA 3NL0A 1F2HA 3D0HE 2R7QA 2VKRA 4L3NA 1JQGA 3K2YA 5KG6A 1TK0A 1LFPA 1CG2A 2G2OA 1NLKL 3FBBA 1Z4UA 2V4JB 1WF1A 1SV5B 3QGGA 4OYMA 4M63A 2FDNA 5JMNA 2O3DA 2FIUA 1RQ0A 2DR6A 4L74A 2RQCA 4ITSA 2DPIA 1ZA1B 3AHPA 3M8WA 4KFBB 3Q8YA 2BV3A 1FRJA 4I6YA 1FRXA 3TUJC 4OJ1A 4RBUA 3R8YA 1VQ4S 4JV0A 5EWFA 2BZ2A 3RB6A 1HWKA 2H5EA 3CC7S 3CJ3A 2YNGA 4NI2A 2AZ1A 2KFYA 1VR6A 2W8LA 4HTIA 1D8ZA 2F4VJ 5FDLB 2ZH3A 2DNNA 4AL5A 4W4MA 5IZHA 2EKYA 3AB4B 2IVFB 4TXSA 2EXUA 3CJ2A 2R7UA 3QGPA 2DH9A 3ELHA 2BJ1A 1HNIB 3ZXWA 3UCGA 3NBPA 2AT1B 3M8SA 2IC3A 4U95A 3LALA 2WBMA 2L9DA 4ZVTB 4IKAA 3NNHA 1X5OA 1MROA 4O23A 4EGLA 2CQDA 2XMKA 2NUHA 1SB6A 5KFGA 5KT2A 3PEHA 1ZM9A 1IKWB 2LKZA 4MFBA 4CLZA 1JXLA 4OIXA 4QWCA 4Y2KA 3N6MA 3V6DB 3UD3P 1KD1T 5THWA 3CIZA 4DCPB 3QFWA 3H5XA 2CNKB 3RAXA 1N5QA 3M30B 3FMWA 1LK7A 4K4SA 2CQ1A 4Y2MA 4PEOA 4HACA 4BCAA 4QIGA 4YB5A 1FA0A 2QO3A 5AE3A 4WKRA 3LAKA 2HG4A 4KHPJ 5DS7A 2E5LF 3DNCA 3ZTRA 4QW9A 2XMUA 2WBRA 5I3QA 5LM7E 1KOOA 2JDJA 4USUA 4WTYA 2KRBA 5KT5A 2KU7A 4O0NA 1MW7A 3OVAA 4B02A 3FNNA 4LJMA 3LO3A 5IM0B 3GLJA 4K4ZA 1GK8A 4O4RA 3U1NA 4ZLJA 3SI8A 4MKYA 2OMLA 4CIOA 3MTJA 1HARA 4WYWA 3PW5A 5BR8J 3T1HF 1WELA 1RTDA 5SZTA 1RTZA 3DOLA 5H1SV 1D9AA 5CHCB 2N7YA 4DF8A 5B0AA 2MKKA 4ECZA 3WX8A 2BANA 1GX6A 1O5JA 4DN0A 4D3HA 1WG4A 2W9BA 3IWNC 3JXOA 4NLGA 1U8SA 2KG0A 2QYCA 5L1JA 2EPIA 4NLRA 4UUWA 1REVB 3ISND 3MOJB 2XO6A 4O3RA 2DY1A 2HWIA 3ZFVA 1Q95G 4ID8A 4YOEA 2CJXB 3PJXA 3L4BC 4NCAA 4JI7J 4WP9A 1CPZA 3QO9B 3KLEA 2RRBA 4C11A 4DFKA 4J91A 1F6TA 1UJ6A 3IRXA 2VFRA 1TL3B 3DRXA 5DM7Q 1NJZA 4ZPCA 2CZ4A 1JK9B 2JRSA 4AXIA 4DBQA 3NNAA 2DK2A 2KYXA 2CYYA 3T9ZA 1AFJA 1VYAA 4PG7A 4ZJQA 2V67A 2QFJA 3H98A 2XZDB 3ADAC 2XMAA 3S01A 2UVUA 2V2VA 4P71A 4ED7A 5KT4A 2BR0A 1OY8A 3MR2A 4DUYF 1WG1A 3G6VA 4CM0A 4JI5F 4KH1B 1UTAA 4DR6J 2DXDA 1W7WA 3TJ8A 2OPRA 4RJVA 2IRXA 1NH7A 4KV8A 3MEDB 1TL1A 4PXCA 1C4AA 1MU2A 3W65A 3MTKA 3RJMB 1H6KX 2B43A 3OR1A 4BHQA 4URSA 2HRUA 4X66J 5H9EK 4C8YA 3FZBA 1REGX 3NS7B 1FEHA 4WFNQ 3AA9A 3CCUS 1M0SA 4FYXB 3OBIA 1HNXJ 3GYNA 1J2VA 1BQNB 1Q1KA 4UTGA 6FDRA 2UXCJ 1WEYA 2H54B 1N32F 4QYZK 1U1QA 2Z57B 1VRUB 2QLFB 4JI4J 1RT3A 3RBZA 2FJVA 2NSCA 2XTJP 1N5YB 2B5JA 4DV7J 3QJPA 1X7VA 4RW4A 2WW8A 4AQYJ 1VHFA 2F8HA 1T8EA 3CC2S 1Y5IB 3DGPB 4DZDA 1M1KT 2LU1A 4GC6A 1S9GA 1H98A 3SSRA 5LOQA 2Q79A 1VS3A 3PHEA 5HVFA 1DY3A 1IM6A 4OI2A 1UP1A 2M8DB 5A8RB 5E5NA 2Y1IA 3ET6B 3BN7A 3R5GA 4DCJB 1Q7LB 2Z0GA 3H59A 3KLHA 4QJVA 3O1LA 3CVKA 2XYGB 1K0VA 1CQNA 4OZ3A 3Q22A 2J6TA 2V8DA 3BYRA 4QOTA 4DJBA 4NLVA 1XNQF 4DLEA 3KOAA 2K06A 3CJSA 1H2UX 4ZHRB 2APOA 1YKWA 2U2FA 2FJXA 3E51A 4IQXA 2C3OA 1VQ8S 2Z2YB 2F4FA 2YWEA 4MT1A 2PMZD 3DOKA 2VPZB 1VHIA 2LYVA 3A8IA 3H4DA 4U9RA 4DLGA 1U25A 2V5HG 4DPXA 4QYRA 4ZP9A 1UCNA 4LRAA 3SBMA 1RAJA 3NWRA 4IUFA 2CG4A 4ZN1A 3UDVA 1NU4A 1B64A 2DCLA 3LP1B 4KO0B 2DRBA 4ED0A 1CS4B 1OPIA 2W2QP 1C0UB 4NLQA 1S6PB 3ENAA 2DNLA 3HVRA 3ONQA 5CABA 1FK9B 2QMXA 2V94A 5B09A 2HNYB 1YGYA 2X1BA 1NK6A 3HULA 4LBHA 1T05B 1S6QA 3FBCA 2XWXA 1CJTB 2KI2A 2ROEA 3QZ8A 3U7JA 2P6SA 3PYEA 4K7QA 2RHQB 4BC9A 4N47A 3D66A 2YKNA 4OHZA 3HZEA 3DXSX 4NZ0A 2LP4A 2YWKA 1RHUB 3M6WA 3AQPA 5KFBA 3V5RA 2Q6BA 1IJFB 4OI4A 4HVZA 3GYXB 2VL1A 2DISA 3VF0B 5ETRA 4I2QA 2PIIA 1JNRB 4P6QA 4NOHA 4DV3J 1RGVA 2DNYA 2YNFB 2N4DA 1V3ZA 3LQVA 4OX9F 2G2YA 1QD1A 3KK1A 3RRGA 2RB7A 4RW7B 2NCKL 3IFEA 2JSXA 3MCNA 4M5HA 2W9CA 3V4MA 4ECSA 2IVMA 2W25A 3ENWA 1LWCA 5CZVA 4BC7A 4P2FA 2LEPA 1NEEA 3H5UA 2CQGA 1S6UA 4FKYA 2ASYA 3KG1A 3DLGB 3VV2B 2EFPA 2CUYA 3M2VA 5LJ5Y 4DN9A 3QRRA 2QMUB 1YQHA 1IKXA 1F9EB 3O8WA 1KDNA 3MGJA 4CNZA 4GVBA 4H4MA 2VDIA 2VPWB 2YNHB 1BWVA 1LQ9A 5GAEU 2CQ0A 3ZZPA 3EJMA 3QQCD 3BR9A 1U26A 1RT4A 3RUBL 1QUVA 2EG2A 3JSMA 5K14A 1AROP 4FF1A 3RW6A 2KXNB 2MDAA 2AMCB 1D0EA 1IXKA 4NLSA 3NOGA 3HHLA 4EBCA 3OTCA 2IA6A 2YKAA 5HANA 2OPPB 3SCJE 2P2CB 3GU0A 3MM9B 1YRXA 3C14A 3KHGA 1CC8A 3BH7B 2AX0A 4NLYA 2ASDA 2VODA 4UOGA 4B3TF 1JLEA 5KFUA 3M8RA 2E7WA 1VLOA 1YI2S 3ILIA 1EJ7L 4OI0A 3MDFA 1X4DA 2GZOA 3MM7B 2XY7A 3GIKA 3TAQA 4TU9A 3MR3A 3LGHA 2RKIB 3MFIA 5CH7B 4KB7A 2Z2ZA 1IR0A 2VPXB 1LK5A 4GRSA 3MCOA 4LF9J 5KT7A 2RIJA 4F4YA 4ETXA 5K5MA 3WIVA 1S4FA 2G13A 2OMOA 4ZP8A 2CNNB 4L76A 1X4FA 2C1EB 3W8PA 1Y0HA 2J7WA 4WXWA 4R5PA 1Q8KA 4QWEA 1UA0A 1Q86T 4E8UA 1WC4A 2R3VA 5D4PA 1FCAA 1FXLA 3TVKA 1LW2A 2FHJD 2C2OB 1CULA 4WFZA 1N36J 4OI1A 4EMDA 4NA3A 2YY3A 5HMZA 5HROB 1QLNA 4DR1F 2CJ9A 2PEHA 3R97A 2D9PA 2HHPA 4LF7F 2BE7D 3LTOA 4YQWA 4WK3A 3OL7A 3POTA 2ILZA 1CJVA 2BMBA 4LIWA 5AT1B 1ZA2B 2D74B 1DQAA 2LXIA 1HI0P 1HD0A 3CCJS 1JJCB 2RQKA 2ZH4A 4NMXA 2OELA 4DV4F 1XNRJ 3Q8UA 2XZTB 2HZAA 3MM8A 3QRQA 3GR1A 4WE1A 1L3SA 4OQJA 1WHXA 5CYJA 2WB4A 3WC0A 2VDHA 3J7ZT 4OZ1A 1V3RA 1RAFB 4DSFA 1VK8A 5B0CA 1H38A 1IKVA 1WKJA 4C0BA 7FD1A 2KRRA 4M5KA 2Z2LA 5KG0A 2RNEA 2AEMA 5KFEA 4OMFG 3CJKB 3MEEB 3NAHA 3PKYA 1NJIT 4DX6A 2R7WA 2ATCB 1S1VA 4K5SA 1FRKA 3Q0AA 4C8LA 1EP4B 4DQQA 1J5EF 1RWUA 2K2PA 3F44A 4X4SA 5DRKA 3H5YA 3J80U 3I31A 4MK9A 1NO8A 4DL2A 3ILOA 2VU5A 3SQGA 2GAHC 2H65B 3BDPA 3EE3A 1Z2ZA 4PYAA 4B9VA 4AYBD 4F25A 1UMJA 2XGPA 4G3IA 2LFVA 2ADCA 2QT7A 3H2LA 2VUGA 1XMBA 2MZRA 3HFZB 3QLHA 1X5TA 2VBZA 1AUDA 2OD4A 3M2RA 1AFIA 5IC6B 5A8WB 2DR7A 2M52A 3BBBA 3DM2A 2NYIA 3MEKA 4MKVA 2FYXA 2HFVA 2B0GA 3TX0A 4QIWD 2J7KA 1PBAA 2H51B 3M8YA 1YRTA 1PIEA 2PA8D 1UVNA 4DS5A 4G1QB 2LXFA 2ROPA 3R5JB 2FLNA 2V9KA 5A6PA 2H48B 3SCLE 1JLBA 2W2OP 1ZTWA 4JI2J 3KYLA 3CJ5A 4CLSA 2DB1A 4EEYA 3FQLA 1M5OC 4O3PA 3R2CJ 2DGUA 3OUYB 3IP0A 5HI7A 3CMQA 4D3GA 1HL6A 2IC3B 2UVRA 3QSYB 4B3RF 3G8SA 2YH1A 1V5VA 4X4UA 2ZNYA 1WKLA 3QAUA 4FPIA 3MMAA 2F4VF 1U1KA 4IOAQ 2V68A 4ECVA 5I42A 4QWDA 4NE9C 2WOMB 3AOCA 1XWLA 1TL5A 1CJUB 2E5GA 3GFXA 5J1EB 1FFWB 2YWFA 1RT5B 3RZAA 5JJBA 2LU2A 4ZOSA 5HK4A 3G82B 2FVCA 5B0FA 4NEYA 3I55S 2EBGA 2H1YA 2R7TA 2V2ZA 2V2QA 3IM8A 5KOWA 5HQ8A 3Q8VA 3PIPQ 1KR4A 3DDNA 2ABYA 1SBRA 4C98A 2CJBA 4ECXA 2XHCA 2DRAA 3V81A 4FNHA 1SXLA 4HHHA 3B6BA 3W2WA 2DRDA 4ZPVR 3SIPB 5J2QB 1KS2A 2BKPA 1VQYA 5KG7A 3JSYA 3DGVA 3TUIC 1NDLA 5H9FJ 1DZ5A 1P1LA 1H2VZ 4FBTA 4DV5F 4C8MA 5B0BA 2IYIA 2MGZB 2WSCC 4A48A 3JTOA 4KHPF 3FSYA 2OFHX 3H5SA 2V8GA 3K8WA 1IR1A 4O4GB 4A8OA 1APSA 3IWLA 4DS4A 3L95X 1EKSA 2RILA 2FGOA 2M3DA 5EHHA 1WSVA 3E8OA 1SPBP 1RBOB 2YKPA 4RUCA 2ERRA 2GW8A 1O51A 2W2PP 4WU2A 1TV6A 4NXMJ 2MHEA 1TP7A 5FJ4A 2XB2D 2DR5A 2RRAA 2FPHX 1KLNA 2CVEA 1JMTA 1VQPS 1BQMA 3A3PB 1VGYA 2IAJA 1K1QA 1WHVA 2AP6A 1L3UA 3L7UA 3DLKB 2VC0A 1PSDA 5D4LA 4CO1A 3RB4A 3L3CA 3OXGA 1UETA 4C11B 3W3SA 3OW2R 4Q44A 4OZ0A 3KLGA 2MXYA 1U0HA 2JLFA 3RW7A 4WZMA 3TA0A 3EGZA 5HN0A 3NGKA 3HD1A 3OJUA 2XMJA 2CVIA 4RBVA 1ZAWA 6AT1B 1JLFA 1Q8LA 3KNGA 5M2PA 2BJDA 1S9EB 2I2YA 3OXFA 2VFSA 2E5IA 4JI7F 4ED3A 4S0MA 5EN1A 1B0TA 3LP0B 4IH5A 2C3PA 3QT8A 4MMOA 3HM9A 9RUBA 2ZDPA 2FZKB 5E0OA 3AODA 3ULHA 4IQMA 2HVIA 2IJRA 1SUQA 1XR5A 2EKNA 4YP3A 4Y2AA 5E33A 3OLBA 4O3OA 2UUAJ 1S97A 3D1OA 3NS5A 4CH7A 1GNKA 3ZNUA 1RT1B 4I2PA 2YX4A 4URGA 3W1YC 3ZZRA 4KGZB 2K1RB 1UEVA 4DR6F 4H54A 1VQ5S 3GIRA 3TZYA 2DR9A 1T3OA 3SSQA 1WD6A 3VAJA 1N33J 1KHVA 4UOCA 5KFQA 2PT0A 3ZC4A 2UUCJ 1HNZF 3JQJA 1YJNS 1V6HA 3DRSA 2W2NP 4WFYA 2OH2A 2CQPA 1ZZNA 1KQSR 2WRMA 4ZLNA 3GR0A 3P96A 5B7WA 3THTA 4X66F 4OJHA 3K17A 2DNPA 4DR3F 2DIVA 3PO5A 3TZXA 2QMWA 4X4RA 3KHLA 1EB0A 3CCLS 4DCOB 2WB1D 1FFSB 1IBMF 1S1XB 4B08A 2FZCB 2UXCF 3AJ2A 4FBUA 1N6QA 4XPCA 4Z7YA 4JI4F 3HJFA 4PG6A 4TYBA 1S72S 1PJ6A 4DV7F 4DSEA 4HDGA 1DQ9A 2GVZB 2CNOB 2DH7A 4AQYF 1TVRA 3ILLA 4AUKA 2AJQA 3C6UA 2WVFA 3FRZA 2BM1A 1L3KA 1QE1B 3Q8PB 3RTVA 2IA0A 4ED5A 1N0UA 1PJ5A 3UN2A 4F3OA 1WORA 4JBCA 1BUXA 4LSNB 3AA8A 2QLWA 3WHIA 3DHWC 1D8YA 1WC0A 3MR7A 3IR5B 1UVKA 3EUNA 4I7FA 1FRMA 3CJQA 1PKUA 3AD7C 4ED1A 2WONA 3HPOA 3EMTA 3AOAA 4HI1A 1NNDA 1B0PA 1MG7A 1TU0B 3BYPA 1RI7A 3MM5A 2E9RX 3DLEB 3NLCA 2FC8A 1Q5YA 3WBZA 3HSJA 3DC2A 3TQEA 4JI1J 3J81j 5LL6d 5G0RA 2ALZA 1H2TZ 2KM8C 4DUTA 1ZAXA 4KYZA 4F8RA 2J8AA 4FNIA 3FZ2A 3UFCX 1U49A 4ECRA 5E3QA 1GMWD 3BBCA 1URNA 3FVYA 1JLGA 1GFWB 2BE2B 5CYMB 1UA1A 1SIWB 3E2EA 1PAUB 3KJVA 3DYAA 1HBMA 5HBMA 2A1BA 1UEUA 5DDRC 5A2QU 2VKZG 4B9NA 2V8VA 3PJWA 4PWUA 4CTAB 1QUPA 4ZVHA 3DOMB 3W2VB 2XI3A 3PTWA 2D1CA 2HZVA 3NMRA 3OL9A 4WK1A 2Y1LB 1JB0C 3KLIB 2FD2A 1VIOA 3I0RB 1F3FA 2GNKA 1VDHA 1LWCB 2G0IA 4DL6A 2XSJB 5A0YB 1NCLA 1TKXB 1NHVA 5F8MA 2DGSA 1RTIA 2DNMA 1I51B 5CAAA 5KT3A 4QWBA 4PQUA 3FBFA 3MD3A 2RDIA 2C3MA 2PMHA 4RW9A 2DGTA 2CAJA 3CDUA 3NWGA 4C8ZA 3PKMA 2QL9B 2KJVA 4JI3F 4HH1A 3HO1A 4KT0C 4UQTA 2NR0A 4WPAA 3GCWP 2HFUA 4RW8A 1KOHA 2GMHA 1JLCA 4X84A 4CO2A 2GS8A 5DGAA 5HSPA 3JS9A 4L75A 2DT9A 2EFNA 4IR1A 7FDRA 2KG1A 2MKJA 1MSWD 1ZPWX 5K14B 3CJ8A 5HVHA 2VH7A 4Q5VA 5LXRA 1FXDA 3S1TA 5ADZA 1EX8A 1U1LA 3CC4S 2QL5B 2FJEB 4YHHJ 4PWDA 4IYQA 2HW3A 3Q8RB 2WZ1A 3MZIA 2VA3A 3R6GB 4CLYA 5C25A 2HNZB 2IRUA 4R0EA 3HVTB 1H7XA 2YNIB 3T5HA 5J2PB 2OD6A 3IM9A 1TKZB 1HI1A 2BDPA 4C0HA 1P27B 4NZ6A 3QGIA 3IN5A 2HGNA 4Y65A 1VQ9S 3MOZA 3G8TA 3C15B 1S6OA 5KFOA 5IOLA 4NCGB 3THVA 2DGWA 3GJTB 4DUZJ 1VQOS 2ZUGA 3MCMA 3M1VB 3IA0A 4DR5F 1HNVA 1HWUA 1WUUA 4OLPA 2FUG9 4ILRA 2IRYA 3BGLA 3CJRA 2B56A 5EWGA 2XYHB 3K58A 4OYOA 3QT5A 3BM7A 4HDHA 3CDAA 2DYAA 3UR0A 2RSQA 1RT7A 3ITHA 3CD0A 5KFWA 4LF5J 4LF9F 1LW2B 5KT6A 3UCZP 1KFSA 4JI0J 4ER8A 1VRTB 2XY6A 2DCUB 4NL5A 3D3BJ 2QSFA 2DKOB 3JTPA 3TWZA 4WF9Q 2CADA 1KC8T 2HIQA 5A76A 1KWMA 2O1PA 3UD4P 4ZIVA 4IFVB 3I96A 1ICEB 3TR5A 2LCWA 3MMBA 1U47A 4Q8EA 4KKOB 3C46A 1FXRA 1NKEA 2OEJA 1YBTA 1S4EA 3DRPA 4B3MF 1OSDA 1S9FA 2YQ1A 1W2IA 1Q53A 1A7GE 1RU1A 2YWWA 1TUWA 2GA7A 2M70A 4CLKA 2JL9A 2N7CA 4JV5F 1R6YA 4C8OA 5EWEA 4GC7A 1SKWA 3NP5A 1OIAA 3BPSP 1Q5VA 3GSIA 3MM8B 4K4XA 1UPPA 4PUOA 4LRBA 2ZZNA 1YJRA 1SL1A 2M5YA 2DJWA 2ZE2A 4NX9A 2FLOA 4B3OA 3HVAA 4IFYA 3UNGC 4HR2A 1N88A 3M32B 2V9WA 1H73A 2BQUA 3UN5A 1E6YB 2HLTA 3CW2C 3ZNJ1 1SH0A 2XQCA 1YBUA 4CLWA 3IR7B 1XIQA 2QRRA 1NJWA 4QIVA 4Y0FA 4YR3A 1T03A 2BJ9A 1BY9A 1WG5A 2ZH2A 3CD7A 4P9SA 3TA1A 3W66A 3OL8A 1J5OA 2GGPB 4DL3A 4O44B 1OYDA 1W25A 4Q45A 2RUSA 2GIFA 5D6GA 3IBWA 3QZ7A 1B70B 1NPPA 1DBDA 3I6PA 4USHA 1XBWA 2ASLA 3AH6A 3CMAS 1JLAA 3HKZD 3W62A 3U1MA 3MUVP 1S0VA 5DDPC 1GXTA 1KLMA 4EZ6A 1URRA 3BREA 2R7OA 1Q8IA 3D3CJ 3SCKE 3ZZOA 4TN2A 2HQCA 4NXNJ 2JLGA 2GX8A 3QYYA 3LW5C 4DI6A 4YFUA 1IBKJ 2PA3A 2HQ3A 1VISA 3LP2A 3CCTA 3MEGB 3RBDA 3TQ1A 1SI9A 2DO4A 4F4XA 5F0WA 2ZJQQ 2LDYA 3ZZUA 1H3DA 4IG0B 2GVDA 1FDAA 1FTRA 4MYTA 5A8KB 2HS4A 3BSAA 3QATA 1M5SA 3PDNA 2J0WA 3K5LA 1HMVA 1BE4A 3QNWB 1XMOJ 2AGPA 2HRTA 1HHQA 4XDDA 4G1PA 3AY0A 1AB8A 3R27A 3I5BA 1RTJB 4USIA 2ZD1A 1WOSA 4ID5A 2IVYA 4U6PA 3GILA 2B8QA 3HMJG 4C4WA 3GE9A 4KAIA 3AD8C 2F40A 2ZVIA 2NQPA 1R43A 4P73A 4H4KC 1ZYQA 3R5AA 4R8UB 1XEZA 3D9BA 2X7IA 4JI2F 4LQ9A 4YEAA 4LUBA 1RB0A 2UXDJ 2IHR1 3PHTA 1HW8A 1H72C 1KFDA 2JVRA 4G1IA 4DL5A 2OPQB 4LR8A 3OFHA 2J6UA 2L9WA 1K1SA 1RCXB 1A9NB 2DD8S 2UVWA 1RISA 2R8JA 5DZ7A 2H4YB 3NEKA 2JC1A 2ZH7A 3TZWA 2J9DA 1YIJS 1XJWB 3PFEA 1CBKA 2RD5C 4HTJA 2XY5A 2OHDA 3M2UB 3B78A 3IBCB 3L9ZA 2Y9HA 1UAWA 2G1HA 2IM1A 1TFYA 3ENQA 3BSNA 1SJ4P 4B9UA 5D8HB 3W2WB 3MMCB 2C2KB 1RBLA 2UZAA 1BQXA 2I38A 4RKUC 4LQ3A 5MLCV 1JKHA 3V4IA 4ILLA 2HFNA 3BGRB 1P6TA 3OTBA 3SDEB 4JI8F 3E01B 4DFJA 4F2SA 1U45A 1NSAA 3OR2A 3I0SA 3D68A 3K5OA 3IWXA 4KPYA 1OS5A 1QY7A 4TY8B 3NOCA 4ES1A 1SKUB 2CJKA 5K8MA 1UVLA 1RT6A 2NXUA 4O3SA 4QU6A 3P8BB 4L73A 4TU8A 2VASA 4CM2A 1RHKB 2OEKA 1WHYA 3LF0A 4J37A 2KVIA 2MZSA 2XWYA 3OFFA 1HQ2A 3VQSA 3AQOA 2RF2A 5L39A 4OYBA 4MIAA 4ZVSB 2HSEB 2CIMA 3KFWX 5KFYA 1HBUA 3CCZA 4LFCJ 3R1HA 2DPJA 4USTA 1M5PC 4CWBA 3L09A 4M5NA 4USVA 2GMJA 3AT1B 1RTHA 5ITHA 3W63A 2HS3A 3RAQA 3C2PA 5DM6Q 4NXMF 5GMDA 3G96A 3LPEA 1JIHA 4KHRA 1G6BA 5K8PA 2XHWA 3FMBA 1JLFB 4DF4A 3IS9A 4PZVA 2BEFA 4J9LA 4L6V3 2F9DA 3DRRB 4ICLB 2LEBA 3DMJA 2AQ4A 5BYRA 3NGUA 3FKBA 2B6AA 1YBAA 4UF4A 5C42B 4B3SF 1C1CB 1K9MT 1P1TA 1FNMA 4OX8A 2B4UA 4DMZA 1JJ2R 1RCOB 3F56A 1WC3A 1AXQA 1V5IB 2DXEA 4G65A 2BVZA 2MY7A 3I4PA 5CYQB 5KFSA 2L48A 5AJ3J 2D69A 3JSBA 3NGRA 5JVGQ 4DHVA 1DTTA 4W90B 1NPKA 4GMKA 2E9ZA 2JC0A 3VCDA 2VFTA 4KIAA 3AOBA 4CYUB 2HNDB 3WZ0A 5L9NA 1Y9OA 2Y8WA 4JV2A 2VG6A 3HF5A 3PACA 3LH2S 4TLRA 2VG5B 2FJAB 4F36A 2FHOB 4OYWA 2UUAF 3NCQA 1FKPB 3QBCA 3G4SS 5ETNA 4ZIWA 2UXBJ 1K8AT 1FJGJ 2VBWA 3FEXB 1KONA 4DU8A 3MECB 4C0OC 2YQ0A 1HQEB 2FJDB 1N5VA 4GVLA 2HVEA 1NUEA 2VJVA 2LA6A 3OTOJ 4Y00A 1N33F 3MAHA 3IMQJ 1FJ7A 3S8SA 2UUCF 3TI0A 3MM6B 1HBNB 2WW4A 1IBLJ 3BKFA 2C2NA 3BQ2A 5DG8A 4ZITA 3W61A 1NSKL 1RSCA 4I4BA 5T7LA 2N82B 2NXEA 2LECA 1HQUB 2CPJA 2HK2A 3GTYX 2YVSA 4IDKA 4M5GA 1SL0A 2UV8A 2DNZA 5E3AA 3R7NB 2UVVA 4OYPA 1PYTA 3EDQB 2N3LA 3HFKA 2AJ1A 3IO1A 3QIPA 2OFGX 4NLWA 2EK6A 3NCPA 2QJ3A 3MFHA 1UWBA 1HPZA 1LWEA 5HVGA 4YR2A 1HNWJ 4DQSA 5E3CA 3VAMA 1FTCA 3O3LA 3I4HX 4CH1A 3OLAA 1SQGA 5DG7A 4LF8J 1NHKL 5GMKa 1X5SA 1RWNB 4M1KA 1MMDA 1H0HB 1S79A 4DV1F 2MJNA 1C1BB 3W9IA 3D6HB 2MTLA 1U48A 2V4JA 3H8YA 3K8VA 1SV5A 5LJ3Y 1N34J 2X3GA 3TYTA 2AU0A 2WVDA 3N79A 4EO6A 4DWIA 4KY3A 2OEMA 4QR2A 1R0AB 4LF4J 3EGNA 5J2MA 2VHGA 1B0VA 2LEAA 4DV0J 2L08A 2GJ2A 3FJ2A 3HHKA 5CD4H 2DNOA 3HHLC 2NYHA 5HQLA 2H4WB 3I9V9 4KGVB 5E3PA 5I4MA 1RU2A 2MKCA 4C8NA 3K0JA 2KT5A 3L7OA 5FDLA 4KC5A 1GT8A 3C16B 4JI1F 4A8KA 3TJAA 2HMIB 1U1NA 2BBEA 1D3WA 1WEXA 1LW0B 2MQQA 4FXVA 1O6XA 2D9OA 2W7PA 5EX3A 4X65J 2XBPA 4DEZA 1X4BA 3FUYA 1HNIA 4ANDA 5DZ6A 5C2CA 2AYEA 4I0WA 2KZZA 4TY9A 3JYTB 4NPOA 1IKYB 3KKFA 2KFNA 5K8OA 5IXUA 1GXUA 1CVJA 1U6ZA 3GIIA 1FD8A 1RAOA 5H9EJ 4Q7AA 2WVEA 1IKWA 2HHUA 2KZMA 1FKAF 2JEFA 1HIYA 4G6VB 3U02A 3QT6A 1QAIA 4K2XA 4P7VA 3OSPA 3M30A 1RHQB 4DR4J 4CLFA 2V8PA 4RW9B 2B7BB 3FC9A 4RNFA 2YH0A 1IJEB 3R5DA 3TAMB 1IWAA 4QYZJ 2B3TB 2ALYB 2E1CA 4QBUA 4CT8A 4WYLA 2W24A 4OYIA 4RUBA 1UFLA 3I32A 1S1TB 2OIHA 4J9SA 1HHSA 1BGXT 1HWJA 5CQGA 1ZS6A 1FESA 5I3PA 4N5SA 1B3TA 2Z4PA 2A2CA 1Q0NA 2MQPA 2RQ4A 3H20A 2B4PA 2HHSA 3TX8A 5IM0A 3UVJB 2RS2A 2DNQA 1FI4A 4WFXA 4HKQA 3CULA 1PC5A 2BRLA 4IOCQ 3CCSS 3KLFB 4U7CA 1NZ8A 3KHRA 4ECTA 5IS2A 4C48A 2MY8A 5C25B 3TARA 1EQ0A 8RUCA 1DURA 3HKWA 1J27A 1PYOB 1RWPB 1GXLA 2G1DA 3ZZZA 4OI3A 1S7HA 1YDLA 5GAHI 2F1FA 1HR0J 1TL7B 4P2MA 1AZSB 2H3EB 3H0PA 4ED4A 4CO0A 1N5TA 2CPFA 2DNGA 3EX7B 1NM2A 3X3UA 4IG3B 4YHHF 1M5HA 2E1AA 1WWHA 1PBUA 3N6NA 3HI9A 4X4QA 1BHNA 2DNRA 4M95A 2DBBA 4H4KA 1KTQA 2ZOFA 2ILYA 2C2DA 3QJLA 1DTQB 4B9MA 2GC8A 3QO9A 2XLIA 3GZ7A 1HNVB 4BWMA 2HYIB 1VQ6S 2FC9A 4DUYJ 2KXHA 5LT5A 1TL3A 1OY9A 4CO3A 3PJ9A 2CQHA 1RAIB 1JJ4A 2BW7A 4IOBA 1XR6A 1EARA 2XS7A 1RT7B 4DUZF 2FVSA 3ITHB 4LFBJ 2B9EA 1S76D 5GVQA 5FLXY 4N7TA 3M9OB 2QZ8A 2GJFA 4PCQA 4A4JA 2ZZMA 4BLGA 1P8GA 2VD3A 5E2QA 3MAQA 1QVGR 8ATCB 1CLFA 3CUNA 5AXLA 1RABB 2K8GA 3C6TB 3R5CA 1D09B 2LLZA 5D78A 4F04B 1GQEA 3GIJA 1TKTB 2CPZA 4FF2A 4U8YA 3AXMA 3NAIA 2OPSB 4Z37A 2BXJA 4ZVFA 3D0GE 3BQ0A 1OSCA 4WIIA 2MZQA 3N6LA 1LOUA 3MEDA 3IG1B 4L72B 3BH6B 5GADI 1FJCA 2R8KA 4LF5F 2F8EX 1DLOB 5I3UB 2A18A 4JI0F 4EFAC 3PRVA 1K44A 2CQ2A 1LWFA 3V6HA 2UU9J 3GFYA 1OY6A 3M6UA 5DDOC 1EZZB 2HHTA 1WDTA 4F0KA 1EETB 1L3VA 2VICA 1BQNA 1YJ7A 2SXLA 5DETA 2VQFJ 3M8ZA 1VRUA 1GAOA 1RE1B 1U1MA 2CQIA 3RG6A 4UY85 3PRBA 2XS5A 1N5YA 2YBVA 1RWXB 1C0TB 4ZPBA 2VOOA 4F4WA 4ZS6A 3J80Y 3DGPA 4LMZA 3RAMA 2YWHA 4KH0B 3M8QB 2VOPA 2MZJA 3T6JA 2U1AA 2EC2A 1R8AA 3R2DJ 5GAHU 1B99A 5A8RA 4MYUA 2XM3A 1UL3A 4CO5A 3KK3B 3A8KA 3ET6A 1Y11A 4ZKAA 1VC6A 3BEGB 3DLHA 1KLMB 4KR0B 3VVTA 3FDSA 1S59A 3BF4A 3PW0A 2QFIA 4J90A 3D5MA 2DHGA 1G3OA 1UEKA 4UQGA 3US5A 2DR8A 2MZTA 3GFHA 3ETOA 5IWAJ 5KG4A 4DR2J 4J9QA 3D54A 2ZM6J 4ZHRA 2N3OA 2HVDA 1FD2A 1RYRA 4ZPAA 3GSDA 1JNZB 4ZCKA 4EYIB 2DHXA 4RW6B 4XAKA 2HBYB 4F7VA 3NG8A 4ZPDA 3IR6B 5LMNF 4NEZA 2KHDA 1X9WA 1FDNA 2R7XA 3VQTA 4JI6J 4YDDB 4NXNF 3UWTA 2IY5B 1HD1A 3PYFA 3M6VA 3TO8A 2EFOA 3SZ2A 1IBKF 3LP1A 4UW2A 1PG5B 2FVRA 4KO0A 3UCUP 1AA1B 4IH6A 3SCIE 1O8BA 5KFDA 1CS4A 3PG9A 3NXZA 3IGVA 1S6PA 1LNQA 2P8IA 1FK9A 3CT9A 2HNYA 3B4DA 3UI3A 1Q81T 4ID5B 1T05A 3DU6A 4F67A 2H5IB 3LGNA 4K8RA 1CJTA 3GJQB 3RGIA 5GADU 2WCXA 1TKDA 1NDPA 3FCWA 1KP6A 4ZA1A 4FYDA 2C42A 2KHCA 1GH8A 2GJIA 5KG1A 1HBOB 1C2PA 1S0OA 1N48A 1XMOF 3PW4A 2QC3A 3H42A 1R6VA 2DH8A 4ZJLA 2ZHOA 1SC6A 4O3NA 1OWXA 2MLYA 1WC1A 3PW2A 1PO6A 2YNFA 2XCPA 1TL4A 1T9TA 4DV6J 5KG3A 4M8LA 3GB0A 1HWIA 2I6WA 3RR7A 3I87A 1U1OA 5D3GB 1FWKA 3ISNC 3H25A 1KSPA 1ACMB 1S99A 2MZ1A 2GQCA 2UXDF 3R7SB 5EGYA 2IBOA 4FF3A 2KFZA 2PE8A 1SCJB 3PW7A 1U02A 3DLGA 2ZHBA 1WKKA 3TVZA 2W7OA 2LVWA 4JYAJ 1FDDA 4LR9A 4CLPA 1AUSL 4LSLB 1S7IA 1JLQB 3UDEA 3V4IB 2VG7A 4WBFA 3KK2B 4AL6A 3UDLA 4PYDA 2YKQA 3HHLD 2J9CA 2KN4A 4LRFA 4PABA 1YITS 2YNHA 2KXFA 2KDOA 4F0MA 1CJKB 4HH0A 2RMLA 1X4GA 4HT7A 1VJQA 2MPUA 8AT1B 6FD1A 2NZ4A 3SQOP 1SC1B 1FDBA 1Y3JA 2ZBQA 3JAMU 2ROGA 2KM8B 4WTOB 4Y6IA 3CE8A 3AD9C 1FERA 2RU9A 3KMSA 4NYPA 3HX9A 5L8RC 1SJFA 3J81U 2G4BA 4F50A 3R3TA 1HHTP 2HK3A 2FHKA 4AL7A 3MM9A 3M7VA 5B0DA 1QVFR 2ZFHA 3M9NB 5KFTA 4OL8A 3TANA 3EVOA 5KFFA 4M5DB 4DSKA 1NB2A 4ZCMA 1QTMA 4PPZA 4NA1A 1Y00A 3KLVA 2ZKUA 3SFUA 3T5KA 2QX0A 5ETMA 3W5YA 2C2RA 3MM7A 4ZVEA 3FSIA 7AT1B 1FNXH 1LEOA 3BZQA 2E7VA 2RKIA 2HLUA 4AT1B 4LRCA 2WTFA 3TW0A 3K89A 4LR7A 4LFCF 3RYLA 3D28A 3DU5A 2RVJA 4RNHA 5J2NA 3GJRB 5HLFB 2ZBIA 4DQPA 2R2TA 2I0XA 1G7CB 3NCRA 4OZNA 5HMYA 4MAKA 2ZH5A 2EFGA 2E1PA 2WSFC 1XMQJ 2HQDA 1RACB 1ROFA 1FHTA 1YZ7A 1RT2B 2HURA 4DZ6A 3Q8SB 4OYAA 1RWOB 4DSLA 4N77A 1NK4A 3CGIA 1GMUA 1U09A 2HZCA 3LA0A 3MAAB 1RDRA 5KFHA 5M2UA 2CWKA 9ATCB 4PXEA 4WU3A 4Q0BB 2PI5A 1CSJA 2PGCA 3FGVA 4FVMA 2WSEC 4Z2XA 4DG1A 4GO5X 5F0UA 4K4YA 5F8IA 1TFWA 1U1RA 3MURP 2VONA 3G8QA 3NS6A 5FLXU 3TZZA 5HROA 3FRYA 1FKOB 2Q1LA 3LOUA 2GFFA 2F63A 3A4TA 1FWLA 3I5CA 1K0TA 4J9RA 2AGQA 5F3ZA 1WF2A 5AJ3F 2MHNA 4O3QA 1F5AA 4J9NA 3VVUA 4I1TA 2MKSA 4Y2IA 3FFIB 3MHYA 5KFRA 3T6BA 3P45B 4NASA 2PMWA 2G2ZA 2WK4A 4U67Q 4ERDA 4C3MA 3HSGA 5LMUJ 1X4HA 3ICLA 3Q83A 4ELUA 4OYXA 2H5JB 4ATNA 3LPYA 2HHXA 4A8FA 2JWNA 2M0GB 2BRKA 2HBQB 3O6QA 1IN0A 5J1NA 3EZUA 2UXBF 1RHJB 3SMZA 2AJ0A 5GAGI 3WDOA 5L1IA 1FJGF 4QZVB 4J9UE 2F65A 1NJYA 1F3VA 3CJKA 1QDUB 3GV8B 5B0GA 5D4NA 2Y0BB 3MEEA 2RH3A 2B9WA 1PC4A 1ITPA 3HFVA 3KXDA 4LF2A 5ETQA 3OTOF 1EP4A 3CSKA 2DY9A 1SC4B 3N0VA 4LIRA 5L46A 1U2FA 1FE4A 1KTVA 1R89A 3KG0A 4H4OB 3LGMA 1IBLF 1XN9A 2CZVC 3D2WA 3C19A 1VQSA 4JP8A 1SIZA 2ZDOA 2ZHAA 1WEZA 1S1WB 2UV8G 5D0RA 4DR7J 2HQFA 1QSYA 4WXOA 3VGTA 2ZITA 1VRQC 4NRUA 1S1UB 1R31A 2AGOA 2LQJA 1SC3B 1IVZA 2MB0B 4ES3A 2Y0SD 4YMEA 4Q43A 1NK9A 1N0VC 3D6FB 5A8WA 4ZPTR 1UVMA 1P9YA 3VR1A 1FE0A 1SQFA 4FYVB 1KQFB 2RS8A 5J2MB 1HNWF 4Y28C 1CQMA 5IT9U 5BYQA 2BJ3A 4MH8A 1U0SA 1KN6A 2CPXA 2MSTA 5K20B 4LF8F 4P75A 4PPDA 4G1QA 1NK7A 4AFFA 2UUBJ 5IQQA 2LA4A 4B3RJ 3BQ1A 2E44A 2X51A 3RR8A 2CNLB 4OYZA 4NLPA 2JJ4D 5CCMA 5A2QY 1N34F 1RUSA 2YNGB 4NI2B 3SSSA 2IIHA 2COLA 3T19A 3KUGA 4LVNP 2CA9A 4LF4F 1X4EA 2JFDA 1OJ4A 4C8KA 4DOZA 2HBZB 3G87A 3D1QA 3DDIA 5E41A 3JTNA 2AJ4A 3NGTA 4DV0F 4M5LA 4CRJA 3OUYA 3GYGA 2V4QA 2C28A 3M4XA 3A8JA 3EZ5A 1XK8A 3G86A 4M5MA 3BGUA 3NBPB 5D0GA 1S0MA 1V9OA 4KSEB 4RNNA 4RNOA 4TYAA 1IQZA 2FTRA 2OTJS 2C2EA 1MROB 1RBAA 2UP1A 4RU9A 2WOMA 1UW9A 4JUZA 2AYMA 3DLJA 1HW9A 2LQ9A 2IJFA 5CD4A 1M5VC 1YK9A 1CJUA 4MFBB 5J1EA 1CEZA 4X65F 1X4CA 4PG8A 1RT5A 3W5XA 2G0CA 3GMGA 2OLWA 4B9TA 3G82A 1ZM4A 3EPIA 3PV8A 1YHQS 1RA6A 4UT4A 4DV5J 4HACB 5FD1A 4ZVUB 2FVPA 5GAGU 4OJGA 2E1MC 2BUNA 5L38A 1R8CA 2BKOA 3HT3A 1FVQA 4NLDA 3KJFB 1T94A 1VIXA 5J2QA 2V63A 5EUHA 3D67A 2JEIA 3OFEA 4PG5A 2QIFA 4QW8A 4KRWA 4DR4F 2QEXS 5F3TA 3P49B 2OO4A 4P2SA 3HDSA 3VAHA 3HSZA 3G6YA 2MGZA 4ZDNA 3IAS9 1TUGB 2UUTA 3PR5B 2ZH9A 2Q6CA 3UW1A 5DLFA 5D15A 3RBXA 4O4GA 5F8JA 3GIMA 1RTDB 2YWGA 4BDPA 2O01C 3DOLB 2IJNA 1ELOA 3BS9A 3KNAA 3B82A 1RHRB 1R27B 3G6XA 2BANB 3CCMS 1KBRA 4DL0C 2W9BB 2P9GA 4Z7CA 2BE9B 2WAQD 5KFXA 4ILMA 1WTBA 3IAM9 4OZ5A 3O44A 3EGVA 3CJ4A 3DLKA 1KNZA 4CH0S 5BR8F 4QPTA 2BJEA 4F26A 3MPYA 1NMEB 4I6WA 3AJ1A 3TEGA 2DNKA 5HO4A 5G4DA 4N8NA 1NH8A 3KLEB 1HR0F 4MKBA 2FVQA 3IRXB 1WHWA 2NUUG 3FQKA 3EDRB 5FIIA 1FF2A 4HI2A 4X64J 3MPUB 1T11A 1VBZA 1Y7PA 1HLWA 4EBEA 3Q86A 1NKBA 1FX4A 5L1KA 1S9EA 2O5DA 3RRKA 2YX7A 5KOXA 5HATA 2BOPA 3L7PA 1HFEL 2HBRB 1EIYB 1R0CB 3P4UB 1YJ9S 3LP0A 2XC9A 2NXJA 4C97A 1KVIA 4LFAJ 4E2FB 3MI7X 3GV5B 3X1LB 2YKOA 1SJRA 1GMVA 1HKAA 4J9PA 4K4UA 4K0KJ 3KJNB 2OPRB 4LFBF 4LREA 2HKEA 4RR5A 4KV8B 5JUMA 2W01A 1TL1B 4BBYA 1G1XA 1R0BG 1HNZJ 4J9OA 5LXYA 4YR0A 1FJEB 1MU2B 4PKDB 3H7HB 3A12A 3W5ZA 1JX4A 3QSIA 5DQHA 1Y5LB 1RT1A 3Q8QB 1LWFB 4P2XA 1VQ7S 4FS1A 3OR1B 1GTHA 2VF3A 3N01A 2K1RA 2FQQB 3OVSA 4DR3J 2NXCA 3IBFB 1MN9A 3T1YJ 4KGXB 2EG1A 4KHMA 1TQLA 2DHAA 3PNIA 4X4VA 1IBMJ 1YJWS 1FFGB 4B17A 3BO3A 2C3UA 4PRFA 1W26A 3DRYA 1RT3B 3DDKA 5KFCA 3AXKA 4NLXA 3KDOA 4U7UD 4QCLA 2UU9F 4I56A 1F5CA 1IR2A 2B5JB 3K7RA 1IBCB 3T41A 2YKMA 5DG9A 2J0XA 4BS2A 4RW4B 4FDFA 1R8PA 1WC5A 2VFUA 4FS2A 4C6AA 2KL8A 4LT6A 1S9GB 1I94J 2R8HA 1HNXF 2EWHA 2YQ3A 4EUVA 1S1XA 3EVWA 1FRHA 4ZVQB 2VQFF 1M1GA 4GKJJ 5ETPA 1FO1A 2ADBA 2HAFA 1BMQB 3TEHB 2XG8A 4USMA 3BKTA 5KFZA 3R1LA 5GAEI 3D1HA
chains in the Genus database with same CATH topology
3KK3A 4NZ7A 1WACA 3CJ0A 3I31A 2D3OR 2UVVA 4MIBA 4MK9A 4PXDA 3KLHB 5AXMA 1JLAB 1NO8A 4DL2A 5HMXA 3CXCR 3SQGA 3HK2A 2X1GA 2N3LA 3HFKA 3WC2A 4F4KA 2AJ1A 3BDPA 3IO1A 3QIPA 1Z2ZA 4KQZA 2OFGX 4NLWA 4CO4A 2EK6A 5U47A 4RBTA 4YDXA 2CRLA 5D77A 4B9VA 1QE1A 4AYBD 4F25A 5CCLA 3M9MB 3NCPA 4FP9A 3MFHA 1P9QC 2NPIA 1UMJA 3O2IA 3PEJA 3EGWB 2R9LA 1UWBA 2AJFE 1RA7A 1HPZA 1LWEA 2RE1A 1SH3A 2XGPA 3RBEA 4YR2A 4G3IA 1S48A 4ECUA 4LSNA 2XI2A 3B8HA 4WJBA 3DFEA 4DQSA 2LMIA 3G9CA 2QE5A 4ALZA 5C24B 1WI8A 1VFJA 1ZAVA 5E3CA 1LFWA 2ADCA 2QT7A 3VAMA 3H2LA 1FTCA 5IT9Y 4AE5A 3O3LA 2E66A 1SJQA 2VUGA 3I4HX 4CH1A 1BC6A 1XMBA 3OLAA 2ASJA 2MZRA 3DN9A 1N54B 2PD1A 5DG7A 3CCQS 4IRDA 3QLHA 3QAEA 1X5TA 3VAKA 1OO0B 2VBZA 2Y1RI 1DJ0A 1AUDA 5GMKa 2OD4A 1X5SA 1FNOA 1TUVA 3LP2B 3M2RA 4DL7A 1AFIA 4M1KA 3DOKB 5KFVA 4RNMA 2B9YA 1MMDA 5A8WB 2XCAA 2EVZA 4RW6A 3OVBA 2DR7A 2M52A 1H0HB 1S79A 4DV1F 4EZ9A 2MJNA 2HAIA 1C1BB 3UPFA 5DQIA 3DM2A 1U48A 4XO0A 4EYHB 2NYIA 2V4JA 3H8YA 3K8VA 1SV5A 3MEKA 5LJ3Y 2X3GA 3J7Z5 3TYTA 2B0GA 5F9LA 2AU0A 4QIWD 2PN6A 3J7YI 2J7KA 3DLEA 3N79A 1MWYA 4EO6A 4DWIA 5IWAF 4QR2A 1R0AB 1UKUA 4OZLA 4DR2F 3EGNA 1YRTA 4KBIA 3WX4A 5J2MA 2ZM6F 2PA8D 1B0VA 2PFFB 1UVNA 4DS5A 2E9TA 2LEAA 4JV1A 2DGOA 2L9NA 4G1QB 2LXFA 1ZTTA 2L08A 2ROPA 2M4MA 2FLNA 1N8RT 3RRHA 2NREA 2V9KA 4N8OA 1HMVB 5A6PA 3SCLE 3W7BA 1QAJA 2GJ2A 3JSRA 3MUTP 1WTFA 3FJ2A 4RUHA 2OSQA 2Q3PA 3H2VE 1JLBA 3DLLQ 3HHKA 1C0UA 5CD4H 2DNOA 3HHLC 3TUZC 1GX5A 1ZTWA 2R8GA 2ZC3A 3KYLA 1NHUA 1S6QB 1LXNA 4J5OA 2ZD1B 3CJ5A 1XTZA 3I9V9 5KFKA 5E3PA 4K4TA 5I4MA 4JI6F 2QA4G 4QU7A 2DB1A 4EEYA 2MKCA 4C8NA 2HHVA 3K0JA 2KT5A 3L7OA 3FQLA 4URQU 3KHHA 5FDLA 2J0SD 1M5OC 1U7LA 4C3LA 4KC5A 4O3PA 2YKNB 1GT8A 2CQ3A 2PI4A 2P9CA 4JI1F 1UVIA 4A8KA 3CCVS 2BE2A 3V2UC 5CYMA 2HMIB 1U1NA 2BBEA 1D3WA 2YTCA 2DGUA 4N76A 2HHQA 1WEXA 4MK8A 4Y2CA 3OUYB 1N5SA 1SH2A 1HBOA 2F7VA 5HI7A 1LW0B 2MQQA 3V6JA 4FXVA 4D3GA 5HP1A 2D9OA 2W7PA 5EX3A 1VQLS 2AWZA 2XBPA 1HL6A 4DEZA 2IC3B 2K3IA 3M8PB 2UVRA 4I2QB 4ZK7M 1X4BA 4NCBA 3G8SA 4B3RF 3BSOA 2YH1A 1XC9A 3R5BA 4PXBA 1HNIA 1YJTA 4KE5A 4CTAA 2ZNYA 2QA2A 2QA4S 1YJUA 4X4UA 4FF4A 3DOMA 2AYEA 3QAUA 1ZM3A 2AYBA 4I0WA 2KZZA 3MMAA 3W2VA 4DQRA 2F4VF 4TY9A 2HQIA 3M05A 2FGCA 3PFOA 3JYTB 1U1KA 4NPOA 4IOAQ 1U4BA 1T3NA 1IKYB 1R7IA 3KKFA 4ECVA 5I42A 2KFNA 5K8OA 3MPWA 4W92B 4QWDA 2J6SA 3KLIA 2WOMB 5IXUA 2XGQA 3VALA 1GXUA 1CVJA 3C3LA 1I1GA 1XWLA 3KK1B 1U6ZA 3DLBA 1C4CA 3GIIA 1E6VA 2AW0A 3PX4A 1TL5A 3KMQA 3CF5Q 1FD8A 3GWCA 2IM3A 3I0RA 5H9EJ 2D3ZA 2E5GA 3GFXA 4Q7AA 5J1EB 3VTIA 1IKWA 5D3GA 2YWFA 1RT5B 4MJKA 3RZAA 2W9CB 5JJBA 2HHUA 3TOQA 1SQEA 2A10A 1M5KC 1FKAF 2KZMA 2LU2A 4ZOSA 2XSJA 2JEFA 1RK8A 4RW7A 4G6VB 4TNOA 3U02A 2JOQA 2FVCA 5A0YA 1QAIA 5B0FA 1TKXA 4K2XA 4P7VA 2XZWA 5LSOA 3OSPA 1WI6A 3P6YC 3M30A 3I55S 2EBGA 4DV3F 4RW9B 2B7BB 3CDBA 1NJXA 2R7TA 1IQTA 5AE1A 4RNFA 2YH0A 1CC7A 4DV6F 1IJEB 3CMES 3M2VB 3R5DA 3TAMB 5KOWA 2Y1JA 4QYZJ 2FJBB 5HQ8A 3PIPQ 1DAXA 2B3TB 1HA1A 4WFBQ 1RKJA 1KR4A 3DDNA 4ES2A 1R3NA 2ABYA 3PVXA 1SBRA 3DCAA 3I82A 4C98A 2E1CA 2CJBA 4ECXA 1S49A 4ECQA 4QBUA 2VG7B 4CT8A 3V81A 2DRAA 1IKXB 4LSLA 2QSWA 4FNHA 4GKKF 1SXLA 5HL7Q 1OQ6A 4WYLA 3G71S 5DDQC 2W24A 4V19J 3W2WA 4ZPVR 1UFLA 3QPIA 1JLQA 3I32A 5J2QB 1S1TB 2OIHA 4I68A 1KS2A 5CA5A 3KK2A 1JKHB 4J9SA 1HHSA 1VQYA 1BGXT 2ZOMA 2J7UA 1NB7A 1HWJA 3BN4A 2ZKTA 5CQGA 4H4MB 4HLBA 2Q66A 1FESA 5KG7A 3JSYA 5I3PA 4N5SA 4I67A 2EFVA 4FXDA 2IYGA 1DQ8A 3EPGA 2XSFA 2Z4PA 2A2CA 3GQCA 3TUIC 5H9FJ 3Q24A 3VWSA 1DZ5A 1P1LA 4UUXA 2MQPA 3OR2B 1H2VZ 2KTQA 4FBTA 3I0SB 1S10A 4DV5F 2RQ4A 2Q43A 3H20A 2B4PA 3CCES 2HHSA 4C8MA 3ZZ0A 5B0BA 3TX8A 2IYIA 4JYAF 2MGZB 3BDEA 4A8MP 5IM0A 2R7VA 4F4ZA 3PR4A 2WSCC 4A48A 5BJRA 3JTOA 1RT4B 1LKZA 2RS2A 2MYFA 1ULRA 2GCFA 4C9DA 4KHPF 2P9EA 4RU2A 3JSMB 2DNQA 3FSYA 1M90T 5JVHQ 1RT6B 2OFHX 4WFXA 3H5SA 2V8GA 4OZJA 4CNYA 2AD9A 4HKQA 4X62F 1UW4A 3K8WA 2BQ3A 4IRCA 4DSIA 3CULA 1PC5A 2BRLA 4O4GB 4A8OA 3P5TL 2NSBA 4IOCQ 1APSA 3IWLA 3CCSS 3GG1A 3KLFB 4DS4A 3L95X 4U7CA 2RILA 2FGOA 2M3DA 3UE2A 3KHRA 5EHHA 3BO4A 4ECTA 3E8OA 5IS2A 4HT5A 2MY8A 5C25B 3TARA 3HHLB 4OHXA 2RQMA 2R8IA 4F3MA 2YKPA 3QMQA 1DURA 3HKWA 2K3KA 4RUCA 2KH9A 1SL2A 2CKWA 2ERRA 1GXLA 1KEKA 2G1DA 3ZZZA 2GW8A 2HNZA 4OI3A 1O51A 3HVTA 1S7HA 2RF2B 4WU2A 2YNIA 1TV6A 2MHEA 5GAHI 1F60B 2JEJA 1TP7A 3K57A 1JWWA 2F1FA 4Q8FA 5FJ4A 5AXNA 4ZPWR 3CD5A 5J2PA 2XB2D 4EU0A 2DR5A 2RRAA 2FPHX 1HBUB 2W7AA 1KLNA 2CVEA 1JMTA 2F8MA 2OPPA 4CO0A 1N5TA 1VQPS 2CPFA 2DNGA 3Q2SC 1BQMA 3EX7B 1TKZA 1U2RA 1O0PA 3J7YU 3X3UA 1JLEB 2GQ2A 4IG3B 1VGYA 4YHHF 2IAJA 3QWUA 1K1QA 4TKTA 1WHVA 1M5HA 2AP6A 2E1AA 1L3UA 1U24A 1WWHA 3DLKB 3N6NA 2VC0A 3HI9A 1R8HA 3FEYB 2IMWP 1PSDA 5D4LA 4CO1A 4CQ1A 4ETZA 4X4QA 4HYKA 4OV1A 4M5DA 2O67A 3Q23A 2DNRA 3RB4A 4M95A 1RTHB 4JOUA 3AAWB 2DBBA 4QQBA 1U6BA 3L3CA 4H4KA 3OXGA 1KTQA 2MSSA 2ZOFA 1UETA 1QAYA 4QIEA 3U1LA 3OQ2A 1RKIA 2ILYA 4NWBA 4C11B 4NCGA 1NK0A 3W3SA 3OW2R 4Q44A 2C2DA 3QJLA 1DTQB 4OZ0A 4B9MA 5F9NA 3KLGA 2GC8A 2JEGA 5E7OB 3QO9A 1XR7A 4P7TA 3M1VA 2MXYA 3GZ7A 2JLFA 4NLTA 3RW7A 2XLIA 1VLYA 1X9SA 1HNVB 4BWMA 2HYIB 2VA2A 1VQ6S 4WZMA 3KWMA 3Q2TC 4DFMA 4DFPA 2FC9A 2KXHA 5LT5A 5J2NB 3TA0A 3EGZA 3IS9B 3BSCA 5HN0A 1TL3A 1VOMA 1VC0A 3NGKA 3OJUA 2XMJA 2CVIA 2VQEF 5KG5A 4RBVA 4CO3A 1ZAWA 1JLFA 1Q8LA 2CQHA 1HYSB 5HLFA 4A8WA 1F9FA 3KNGA 3QWPA 5M2PA 3DMJB 1JJ4A 5CXTA 2BJDA 1S9EB 1XR6A 4IOBA 2HWHA 2E29A 2I2YA 4HHJA 3OXFA 2B6AB 5AXKA 2XS7A 1RT7B 2KKHA 2VFSA 4DUZF 2E5IA 3FCHA 4EBDA 1L3TA 2FVSA 2E5JA 3ITHB 4UY8T 4JI7F 1Q8BA 1S76D 5GVQA 2BYCA 5FLXY 4ED3A 3M9OB 5EN1A 1RT2A 1D9FA 2QZ8A 3NGDA 4PCQA 4A4JA 4R5PB 2ZZMA 1B0TA 1P8GA 3LP0B 4IH5A 4B9LA 5MAOA 2C3PA 2VD3A 5E2QA 3MAQA 4MMOA 1QVGR 1CLFA 2XMTA 2Z2MA 3CUNA 5AXLA 3OTDA 3HM9A 2ZDPA 2K8GA 3C6TB 3R5CA 4DG1B 3BR8A 3OSNA 2LLZA 4Q0BA 1FEEA 5E0OA 2DNHA 5D78A 3ULHA 1GQEA 4IQMA 5K9FA 2ZBCA 3GIJA 1TKTB 2CPZA 1W2BR 4FF2A 2HVIA 3DI6A 1LXJA 3BJYA 2QV6A 1SUQA 3PRDA 1VRTA 1IM4A 2C3YA 1XR5A 1DTTB 3NAIA 1XMQF 2OPSB 4YP3A 4Z37A 2BXJA 2R7RA 2EFQA 4Y2AA 4ZVFA 5E33A 3D0GE 3BQ0A 1OSCA 2G9OA 3OLBA 2XLKA 1YSJA 4WIIA 2A3JA 4O3OA 2MZQA 2E5HA 3N9UC 3N6LA 3O5TB 1TK8A 1LOUA 3MEDA 3IG1B 3D1OA 4L72B 4TQRA 1X4AA 3NS5A 1GNKA 4CH7A 5GADI 3HZGA 1S97A 1FJCA 2GQQA 4FN5A 3H40A 4IFVA 5KFNA 2E7XA 2OTLS 1FKOA 2XEXA 2GV1A 4N56A 2R8KA 1RT1B 4ED2A 4LF5F 1TR0A 2B4OA 4I2PA 3MXHP 2VG6B 2F8EX 1DLOB 5I3UB 2YX4A 4NLOA 4URGA 2CPEA 2A18A 3ZZRA 5F41A 1U6FA 4JI0F 4EFAC 4C2MA 4KKOA 1FVSA 2CQ2A 2K1RB 1LWFA 3V6HA 1UEVA 1F0XA 3POTB 1KHWA 1MMLA 5EX0A 1DARA 3V6KA 1N36F 5F8NA 4DR6F 4H54A 2FHJA 3T5LA 5KAKA 1VQ5S 1VI7A 3GFYA 2DR9A 1RP5A 1T3OA 3SSQA 1YWXA 3M6UA 3AB2B 1WD6A 5DDOC 3VAJA 4XDCA 3SEOA 2ZH8A 1KHVA 2HHTA 3CIMA 4UOCA 5KFQA 3FFIA 2A2DA 2PT0A 3ZC4A 3QIDA 2I5JA 2ZC4A 1HNZF 2FB0A 4X4PA 1YJNS 1V6HA 3GG0A 1EETB 3DRSA 3UDCA 1L3VA 5SUHA 1BQNA 4R25A 2CQPA 2SXLA 4WFYA 1ZZNA 1KQSR 2WRMA 2OH2A 3KTQA 2OJ3A 1TAUA 1NRKA 5DETA 3GR0A 3P96A 1D1UA 5B7WA 4F2RA 5DLGA 1VRUA 3OXLA 2K7JA 1GAOA 2CFXA 3THTA 5DJBA 4X66F 4OJHA 4WE1B 1U1MA 2CQIA 4IO1A 4DDFA 4UY85 3PRBA 2DNPA 5T41A 4DR3F 5F8HA 2AX1A 2XS5A 3T1AA 1N5YA 2HRYA 5L1LA 2DIVA 3PO5A 2QMWA 4OX6A 3M32A 2NLWA 1C0TB 4ZPBA 2VOOA 4X4RA 4F4WA 3N5BA 4NA2A 2PC6A 4ZS6A 5HMWA 1IKVB 3CCRS 3BO2A 2FLPA 1E6YA 3KHLA 1Q82T 3J80Y 3K59A 3DGPA 4LMZA 4I64A 3CCLS 2WB1D 3MR5A 3RB3A 3SXLA 3M6XA 3RAMA 1IBMF 1S1XB 4B08A 2UXCF 3AJ2A 5LMUF 4FBUA 1N6QA 4XPCA 4CI0B 1XNRF 5K8NA 3GFZA 4JI4F 2OAUA 2YWHA 3HJFA 3M8QB 4F02A 2VOPA 2GMLA 3MMJA 2MZJA 2RT3A 4PG6A 2U1AA 3T6JA 5T7LB 5C5JA 2XO7A 2M9KA 3LAMA 1R8AA 2BACA 4TYBA 1S1VB 2B7CB 1S72S 2GGPA 1V3SA 4WCEQ 2BW2A 3HHEA 4O44A 2VPYB 5GAHU 2IM2A 2R4FA 1BLUA 2KYZA 2MQNA 2BA9A 5A8RA 4DV7F