1BWEA

Artificial fe8s8 ferredoxin: the d13c variant of bacillus schlegelii fe7s8 ferredoxin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
AYVITEPCIGTKCASCVEVCPVDCIHEGEDQYYIDPDVCIDCGACEAVCPVSAIYHEDFVPEEWKSYIQKNRDFFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN)
publication title Solution structure of an artificial Fe8S8 ferredoxin: the D13C variant of Bacillus schlegelii Fe7S8 ferredoxin.
pubmed doi rcsb
source organism Bacillus schlegelii
molecule tags Electron transport
total genus 19
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bweA00
1Y5NB 1F5BA 1BQXA 1GAOA 2WAQD 1D3WA 2FJBB 2WSCC 1RGVA 1FERA 3EXYA 4XDCA 4Y28C 2Y0SD 1SJ1A 1FTCA 2C3PA 1CLFA 1DFDA 3MM7B 1WTFA 3GYXB 5BYQA 3MM7A 1FXDA 3HKZD 3MMCB 3PNIA 1FDAA 2C42A 2PMZD 2FJAB 7FD1A 2FJEB 1IR0A 4ID8A 2Z8QA 1GTHA 2IVFB 4XK8C 2V4JB 3MM9A 1FEHA 2VPYB 3MMBB 5E7OB 5CH7B 1HFEL 1F2GA 2V4JA 2VPWB 1FRJA 2GMHA 3MMBA 1FRKA 1FDNA 1IQZA 1G6BA 1Y5IB 2FGOA 1FRIA 2C3OA 2FDNA 2VPXB 1B0PA 1KEKA 4YDDB 1SIWB 1FCAA 6FDRA 3LW5C 1FRLA 4KT0C 1G3OA 5CHCB 4OMFG 1FD2A 2FD2A 1BLUA 1FXRA 2PDAA 1Y5LB 3MM9B 1BD6A 1BWEA 2O01C 1K0TA 2C3MA 3OR1B 1B0TA 1DAXA 1FRHA 1C4AA 3IR7B 3IR5B 4CI0B 3OR1A 5L8RC 1FRMA 3MM8B 1Y4ZB 4XDDA 1BC6A 3MM8A 1GT8A 1H98A 4OV1A 1DURA 1ROFA 1FF2A 3EGWB 2UZAA 1C4CA 3C8YA 4L6V3 7FDRA 1JNRB 1PC4A 4DHVA 1FDBA 2WSEC 1R27B 2WB1D 5BYSA 3MM6B 5BYRA 1AXQA 4AYBD 1H7WA 2GMJA 1A6LA 1H7XA 1PC5A 3IR6B 3MM6A 1XERA 1JB0C 4RKUC 1B0VA 1SIZA 2XSJB 3OR2B 1FRXA 2VPZB 1KQGB 2VKRA 2WSFC 3EUNA 1GTEA 1Q16B 2C3UA 1H0HB 3MM5B 2XSJA 3OR2A 2ZVSA 1VJWA 5FD1A 3MM5A 1FDDA 2FJDB 1F5CA 2V2KA 3MMCA 2C3YA 3MMAB 6FD1A 1KQFB 3MMAA 2PA8D 1JNZB
chains in the Genus database with same CATH superfamily
2MSSA 3HCXA 3DGPA 2WW8A 2VDIA 4FNHA 4F4YA 3MUMP 1UJ5A 1FXDA 3CD7A 4NLPA 4I7FB 4EI2A 1AROP 1TV6A 4I7FA 2DR6A 1FE4A 1Y00A 3DRYA 3MD3A 4C0HA 3LPYA 1RT7B 2M88A 3TQEA 4EZ6A 2UUTA 3Q23A 5IT0A 1RT7A 1IBMF 1LQ9A 2BZ2A 1S5ZA 4M5GA 2ADBA 3HK2A 4AQYF 4QWBA 2ZNYA 4JV5F 1KRPA 2MXYA 1IXKA 2ZD1B 1B3TA 1H98A 4KGVB 2B4OA 1UVJA 2QE5A 5ETKA 5T14A 2F1FA 4AT1B 4ZCIA 1U48A 3D3CJ 4DQPA 1T02A 4FYXB 2FJDB 2J0QD 2G2ZA 4QW9A 3UPFA 4F36A 1NHVA 4DDFA 2YNHB 1P1TA 4RPFA 2YNHA 2HVZA 4LF1A 1D0EA 4FPIA 4F7VA 3C66A 4Q45A 1WC3A 3VVUA 4FKXA 4M5HA 4DV4J 4DSEA 2AGPA 2BR0A 3JSYA 2LQJA 1NJZA 1XTZA 1Q5YA 1RA6A 3MR2A 1YRTA 5CXTA 2UUWA 3SCKE 3IS9B 3SYZA 4LIRA 1F9EB 3IS9A 4ZPDA 1TU0B 4BHQA 3G6ES 2V50A 3R5GA 3DLBA 4DPWA 1FF2A 1CBKA 1UZHA 3DYAB 2Y1RI 5B0EA 4HL9A 3BBFA 3D54A 3DYAA 1Z2ZA 3R97A 1X7VA 3PYFA 5GAGI 2KG0A 3ELHA 4Y0FA 2NSBA 1BY9A 2MY8A 5F9LA 4JI4F 4O4GB 4BWMA 1HQ2A 3DOKB 4O4GA 5KFWA 1D8ZA 1VQKS 3DOKA 4PXCA 2BA9A 2GNKA 2QLBB 2QEXS 3H5UA 3LAKA 2ZUGA 2YQ1A 4DR2J 2XNRA 2VOPA 2XO7A 3QPIA 4DQQA 5RUBA 2DHXA 4FYWB 1RLDA 5A76A 1YZ7A 3EPIA 3LH2S 2OKQA 2LDIA 3AB2B 3DDNA 2N7CA 3QFWA 6FDRA 2LQBA 2MLYA 4K5SA 2P6TA 1QAYA 2K1RB 4WZQA 1VQSA 3CCQS 2K1RA 4NMLA 2RVJA 1NO8A 4DV6F 4DSLA 2ZM6F 3PO5A 4ED7A 3H8YA 1TZ0A 1AB8A 5F0WA 1ACMB 5B7WA 3PDNA 3PM9A 2LVWA 3CWJA 1WHXA 3TUZC 2YWWA 5L38A 1DZ5A 2OI2A 5BR8J 2NPIA 4N8NA 3RRGA 4FF4A 3B4MA 5B0BA 5IV3A 4LF5J 4X4TA 2JOQA 5DZ7A 1TUGB 4M95A 3A8IA 5L39A 4G1QB 2P5VA 3PFEA 3BM7A 2YKOA 4G1QA 3GONA 2JX2A 2HBRB 2I2YA 1LKZA 3M9OB 3KHGA 3B4DA 1Y5IB 2M9KA 1W7WA 4RWWA 4K59A 3KKFA 4USIA 4R25A 2BE9B 4KT0C 3VTIA 3DRRA 4L3KA 2DIUA 3C14B 3BSAA 3BZQA 4HHJA 5C7PA 4DL7A 2VA2A 2DB1A 4M5LA 4B9MA 1IR1A 4IO1A 3JS9A 4RW4B 1IBKF 4ZMMA 4J91A 2R8JA 2V6AA 4PG4A 2IDLA 4RW4A 1OS5A 4ES1A 1U6BA 4I6AA 1ZAVA 3S7RA 4KHRA 5K8MA 3KK3B 3LO3A 1T94A 2M2BA 3KK3A 4O3NA 4K4SA 6FD1A 1ZTTA 2E1AA 5E2QA 1RK8A 2F4VJ 3JTPA 2HQFA 1B64A 1MSWD 1S49A 3Q8PB 3KYLA 2DD8S 4BCAA 3HHLB 5K8PA 3G4SS 2Y3YA 4DV0F 3HHLA 4CH7A 4ED5A 5LM7E 1FRKA 3ILOA 2IRXA 5DETA 1SI9A 4K4XA 3NEKA 2MHNA 4TKTA 3HJVA 1HNWF 4ZCKA 3VR1A 3LWLA 4OMFG 2NCKL 4GRSA 5HQMA 4KTQA 1U49A 4Q5VA 2ABYA 4ECUA 3HZEA 1C1CB 5LT5A 3K5PA 4ED8A 1C1CA 1TK5A 1T05B 3K58A 3Q86A 7FDRA 1T05A 1UEUA 4LRAA 4K7QA 2MHEA 1VQ6S 4RO0A 4P74A 1N8RT 2B9XA 4ZIVA 3ILLA 3HXMA 1Q79A 2P9GA 3ONQA 1VK8A 3RW6A 5F8JA 3AJDA 1OY8A 1KN6A 4X66F 4I6YA 5HVHA 4FN5A 2KHCA 2V5HG 2QL9B 2BMBA 1HWLA 4ID5A 4A46A 3EYZA 2R8KA 4KHPJ 3ZZZA 4WFAQ 2LEPA 2IA0A 2KTQA 5KFBA 2Y8YA 3AB4B 2HZAA 3C19A 4OJHA 4ZP9A 3M2VB 4LFCJ 3WC0A 2B7CB 3M2VA 4X4RA 3QRQA 1G3OA 2HGLA 2XWXA 3AXMA 2K3KA 4ZITA 2XQCA 3J7AN 5HI7A 1YK9A 3LALA 8ATCB 1SJRA 3EXCX 3FDSA 2RRNA 2ROGA 5C25A 1S1TB 1U1LA 2EFGA 2X1FA 2DHSA 1S1TA 2XYGB 3NWRA 2RHQB 4JI1J 2CQIA 1YSJA 2XGPA 2BE7D 2HFSA 2ZVSA 2ILYA 1UVMA 1KVJA 2CDRB 3MWBA 2N4CA 1FA0A 3UD4P 1XEZA 2LXUA 2L48A 1B70B 2PMHA 2QLWA 3B78A 1WACA 3N9UC 1BUXA 3NOGA 5D15A 4YUDA 1GFWB 1HI1A 2BM1A 4EEYA 1R6VA 1UTAA 1X31C 5B08A 2QRRA 2L08A 4IR1A 3K5MA 4YOEA 2DGWA 4F26A 1DRZA 2VA3A 3W9JA 5AXNA 3KXDA 4WFZA 3QJLA 2OPQB 3TA1A 2OPQA 1JKHB 4DSKA 3W61A 1X9WA 2XGQA 1JKHA 1XBWA 1RAGB 2XS5A 4CM2A 5LSOA 4G3IA 1IKYB 2XY6A 2WSEC 4DV5F 1TQLA 4KYZA 4ZVSB 1IKYA 3ZXWA 2J7UA 4RZRA 2VASA 1FESA 3NGDA 3PR4A 4DWIA 2XMUA 4OZ0A 5IC6B 3HHKA 3GZ7A 4K2XA 5K9FA 2GGPB 3CDBA 2HQ3A 4K8RA 2GGPA 3UDCA 3AQOA 3A8EA 3B6BA 1JLAB 3GMGA 1VGYA 1JLAA 4X4QA 4F4AA 4Y3CA 2ASYA 4JV1A 2QA4S 1NMEB 4KH0B 3TVZA 3GV5B 2QJ3A 3Q24A 3KLVA 1U6ZA 2AKWB 4CM0A 2QGFB 2M3DA 1VC5A 4JI8J 1NAQA 3M1VB 3DLLQ 3M1VA 4FS1A 1X60A 4CIOA 3K5OA 4WFNQ 3JSRA 2XNQA 4PPZA 1A6LA 2MPUA 2ASLA 2KJWA 2KDOA 5C24B 3I55S 4U95A 1WF1A 5D4NA 5C24A 2F65A 2GV1A 3NXZA 4W90B 2WHOA 1GXUA 3MMCA 2YTCA 3RB3A 5CYMA 4ZVFA 4LRFA 2F7VA 3DHXA 1RTDA 2HHQA 4RBUA 4S0MA 4RW7B 2MQOA 1U6FA 2CADA 3OD2A 3OLBA 3PIOQ 4RW7A 3TEGA 1CJUB 2E1CA 3G8SA 1CJUA 1K0VA 4GKJJ 3D1HA 4G1PA 4NLRA 2IVFB 5K8NA 4J9KA 2QT7A 3M9MB 1X4FA 5E3QA 1V9OA 2UUCJ 2CA9A 2HHHF 3KDNA 4KY3A 2K06A 5LXYA 1PAUB 2KXNB 3T1YF 1HW9A 2HK2A 1FKAF 2JLEA 1S9EB 2HAFA 1TVRB 3FEYB 1S9EA 3I9V9 1TVRA 4J9SA 1W2IA 4Q8EA 3CCZA 4USKA 2LLZA 4KGZB 1V3RA 1JLEB 2QSFA 1NJWA 1JLEA 4Y2AA 2WONB 4TY9A 1U7LA 2WONA 2ZFHA 2W4PA 4PPDA 4C2MA 4WFBQ 3IO1A 4X64J 4JB8B 3KLGB 1XMQF 1X5PA 1C0TB 1T3NA 3KLGA 3S1TA 1C0TA 4QQBA 2IMWP 3QIPA 2D7SA 3OSNA 2PSZA 2RQCA 2UVVA 1WDDA 3IBCB 2LU1A 4IOCQ 2Z30B 1ZBTA 4HR2A 5KT2A 2DNZA 1D1UA 2FY8A 1FO1A 5DLFA 1U1NA 1A7GE 1C2PA 2R7XA 3EGVA 2HYIB 1KOHA 2YPZA 3VAGA 2DY1A 4TVAB 4P7VA 3TX0A 4QCLA 3UR3C 1IBCB 4LQ3A 1CEZA 2UXDF 4EO6A 1TKXB 4U8YA 4I68A 1KC8T 1TKXA 5FLXY 3H7HB 9RUBA 1R0BG 2BJEA 4OV1A 1JNRB 1YVFA 3KLEB 5BXIA 3KLEA 4I67A 1L3SA 1OYDA 2ZITA 1XQIA 3FBCA 5B0DA 2ACMA 1R6YA 1U2FA 5KFIA 4DFJA 3IGNA 3UO0A 3CMQA 1O5JA 5HROB 3TUPA 5HROA 4YB5A 1N48A 3GV8B 4DR5F 1NSPA 1GXLA 3PW7A 4ETZA 2F8HA 2FC9A 2HQDA 2WOMA 3M8RA 4A8YA 4RR5A 7FD1A 5LMNJ 1Q8LA 1VBYA 4LSZB 2HHUA 1YJUA 4IFVB 4DR1F 5KG0A 3HFZB 2F63A 4IFVA 3PIPQ 1XK8A 1QAIA 4NCAA 3QGHA 2XULA 3HVTB 2KM8C 3MPDA 3HVTA 4LJMA 1JJ4A 1RP5A 4DCPB 3IP0A 2H51B 1URRA 2ZC4A 2BW7A 4K0KJ 3J7A1 2KXHA 3L7PA 2F9DA 4DEZA 5BYRA 2FJWA 2ZJQQ 2XHCA 1APSA 4PG8A 1VHFA 1DHMA 3ZZOA 1Q1KA 1GH8A 5GAHI 4P10A 1FDDA 3N28A 2XM3A 2HHWA 3VAIA 2BUNA 3TO8A 2RS8A 4NLXA 2JEGA 1YDLA 3G6YA 2NXUA 4B3MJ 3HPOA 1NKCA 1YLXA 3SV3A 1FT8A 3P5BP 3MPWA 3Q2SC 4ZVQB 4A8XA 1J5EJ 2V34A 2ROPA 3PY8A 5CH7B 4C6AA 2CQCA 5HSPA 3HX9A 1CS4B 5F9NA 3WIUA 4KH1B 3RAMA 2E5IA 1LWCB 1CS4A 1AUSL 1LWCA 1XMOJ 1RHJB 2R2TA 1N88A 1OPZA 4P73A 2DVIA 3F41A 3IBWA 3MM9B 1YJRA 5KFYA 5DQIA 3I82A 3QZ7A 3MEGB 3MEEB 1JLBB 3UDLA 3TJ8A 3MEGA 3MEEA 1JLBA 2HFOA 4YP3A 3TVYA 2RU3A 1S76D 2G2OA 2V8VA 2VBXA 2BABA 3CJ0A 3MCNA 1J27A 2WSFC 1IWAA 5LOQA 4DFKA 2ZKTA 1ITPA 1HKAA 1Q86T 2A6MA 3TEHB 1ZOTA 5JVGQ 1PCAA 3JYTB 4RNMA 2DGTA 1X0PA 5J1EB 3JYTA 4LF7J 5J1EA 2EPIA 3NS7B 1IN0A 1UFKA 3MZIA 2CQBA 1S4EA 2C42A 1EKRA 2KRBA 5KTQA 2MQLA 2UVUA 2W24A 2V68A 2CXEA 4ZPCA 5CA5A 2YH0A 2NS1B 1FFSB 2FGOA 1Q8KA 4DFPA 3W66A 3JAMU 2VQFJ 1X5SA 2DGSA 2F8MA 3GU0A 2QLFB 3TZWA 2LFVA 3G96A 4UT4A 3EJMA 1WF0A 2IPOB 4Y65A 2XZDB 4N41A 4MFBB 2QL5B 5THWA 3THPA 2UXCF 3IFEA 5JVHQ 4LFAF 3GJRB 3UCUP 2DPIA 1UL3A 1KQGB 3E01B 4CO2A 1TL7B 2EG1A 1TL7A 3N6MA 4EO8A 2R7TA 4LSNB 3VQSA 2Z2ZA 4LSNA 2J6UA 4J9NA 3QO9B 3MPVA 3J81U 2UV8G 3SV4A 1YJ7A 1S97A 1W26A 1IUJA 3QO9A 3LP1A 3I32A 4OHXA 4K2JA 3NKYA 3CB4A 5GAEU 4DR7J 4UY85 2FJEB 4PABA 3BF4A 5KG7A 2DNNA 3MCOA 4J7CA 3CC7S 2HBZB 2V0NA 2ZDOA 2HNZA 4C8KA 1ZAWA 4JYAJ 2MZQA 2JJ4D 1B7YB 1RU2A 2M70A 1KBRA 4CLSA 1IQTA 3MAHA 1VIOA 4Q2LA 2FQQB 5KFRA 4ECWA 3DOLB 1YG0A 2E29A 1JXEA 1N36J 3X1LB 4F02A 1NJIT 4X84A 3QIDA 1KNZA 2B5JB 4M5NA 2YKMB 3ZZYA 3F73A 3SEOA 2B5JA 2YKMA 3A3PB 1Y7PA 2PA3A 4Y34A 3RBDA 1CQMA 4P6QA 3PX0A 3ZZPA 3GE9A 1JNZB 2BQUA 3OBIA 3R5CA 3KG1A 2W01A 3AD8C 2IFXA 1QJHA 3AHPA 2PMZD 1YHQS 1YI2S 2CPEA 2YWGA 2B4VA 5E7OB 3EZ5A 2ZEJA 4C8ZA 3VGSA 1XNQF 1MMNA 2FB0A 1VRUB 3K8WA 3AA8A 3C3LA 3AH6A 3NMRA 2OMOA 3PTWA 3UE2A 4DPTA 5CYJA 3OFFA 4I0WA 1V6HA 4ZDNA 3KLHB 1PJ6A 3D0IE 3KLHA 4YMEA 5A6PA 3H5XA 2AX0A 2FUG9 4U9RA 5E3PA 2HS0A 3E51A 1JB0C 3I5CA 1H73A 1IBMJ 2XBPA 4RLEA 1F5CA 1UVNA 3TARA 4JV5J 3DU5A 2FZGB 2QG9B 4LVNP 3MDFA 4Y28C 1HLWA 3NWGA 1NEEA 2LA6A 4O0NA 4WU2A 4F67A 2CQHA 2L41A 4ZS6A 4WXOA 3GCWP 1YBUA 2LQ5A 4NMXA 1RUSA 5HJXA 5L1IA 2E7VA 3FBBA 1M90T 2V2QA 4F50A 4YDXA 3GLJA 3WC2A 4LF9F 4ECTA 2O3DA 1YJNS 1NU4A 2QYGA 3W60A 1AFJA 1M5OC 4I6WA 5IZHA 2V67A 1N32F 4J37A 4IRCA 2EW9A 7AT1B 2DNLA 2W9CB 2FVCA 4I1TA 4CLFA 2W9CA 1GXTA 2VC1A 2ERRA 1X4AA 1RB0A 2MKCA 2ZH5A 4BC7A 4DR3F 4V19X 4RKUC 5AXLA 5CZVA 1AFIA 4DU8A 2C3UA 4PG7A 1NH7A 4C0OC 2RQ4A 4FYVB 1MU2B 2HRYA 1D9FA 2HWTA 1MU2A 3K57A 2MKKA 1OQ6A 3RTVA 3GIRA 4WCEQ 3PV8A 4NRUA 5LSLA 2KM8B 1WKKA 1Q82T 1SJ3P 3R7NB 1NKEA 1O0PA 4X62F 1LXJA 2R2UA 4JI4J 4GO5X 1FCAA 2FC8A 4TU8A 4DUYF 2VFRA 4V1Ak 4JP8A 4YB7A 2NUHA 2VB6A 3DNCA 5A8RB 5D77A 2NYHA 4HT5A 1MROB 4KC5A 1N56A 2AJQA 5KT7A 1MROA 3MOZA 2BACA 1GMUA 2LP4A 2GAGC 4NA3A 4CT8A 3J80U 3W5ZA 2WCXA 4NA2A 3CCMS 2HLUA 4F25A 4XAKA 4B3OB 2IA6A 4B3OA 3PJXA 2UU9J 1SH3A 1YRUA 3HVWA 1UCNA 5FLXU 1S6QB 4DV6J 4DV3F 2ZM6J 1S6QA 4AUKA 3N6LA 1V3ZA 1VFJA 5KFNA 4ES3A 2OLWA 2EI5A 5J2PA 1HW8A 2VODA 4K4WA 5KFEA 5D3GB 2ALZA 1RAIB 4F8RA 3IAM9 2CPYA 2W4CA 5D3GA 3NLCA 3UCZP 1H6KX 2JLFA 3PRDA 4B9VA 1I1GA 4TLRA 4F3OA 3IG1B 1LWFB 2CJ9A 3JSMB 3T41A 3IG1A 1LWFA 3JSMA 4QU7A 1RHKB 1P6TA 2F4FA 1EETB 4B9SA 5FDLB 1EETA 5A0YB 1TKDA 3PZPA 2HIYA 2GIQA 5FDLA 5A0YA 4ITSA 4DPOA 2G2YA 3AOBA 3HDSA 3C8YA 1T9UA 5I3PA 4MYTA 4ELVA 3I5AA 5GMDA 2WBMA 2YNFB 2JC0A 3MR7A 3W8GA 1LWXA 2VD3A 2YNFA 4IRDA 2D3OR 1I5OB 1RI7A 4M63A 1VC0A 2ZH4A 3U1LA 1S1XB 1RGVA 2DRAA 1EIYB 2C1EB 2R7RA 2U1AA 3G8TA 1S1XA 1IBKJ 5EX0A 1ZA1B 2R42A 2BE2B 2BE2A 5J2MB 3NAIA 4X4PA 5J2MA 1VQYA 3K7RA 5E5NA 1NSKL 3Q2TC 1Q53A 2E7XA 2JL9A 3D6TB 2FD2A 4ZK7M 1BD6A 3C6TA 2N82B 4JI0F 3GQCA 2D9PA 4FVCA 5AXKA 5DG7A 2M52A 4DV0J 4X2BA 1SJ4P 2KHDA 1FDBA 1G1XA 2EFQA 1E6VB 1CC8A 2V94A 4FF3A 1H7WA 1E6VA 2LECA 2XG8A 2PI4A 3FBEA 2C2NA 1RA7A 4HDGA 4D3GA 3M8YA 3WX4A 2JH3A 4B9LA 2YBVA 3IGVA 4DUTA 2VQEJ 2XLKA 1QTMA 1QD1A 3R27A 3NNHA 2PGCA 3GFYA 5ETVA 4OX9F 1HFEL 1RWUA 2BKNA 3W8PA 3N01A 3G6VA 5KFXA 3TOQA 4E2FB 4UOHA 2KFZA 4X66J 4O3RA 3BB5A 3IA0A 3NGUA 2AGQA 5IT9U 1FX2A 2DY9A 4P52A 4LF8F 2ROEA 2C2RA 2ZZMA 2HW3A 3RRHA 3O3LA 4LIWA 5D6GA 4JI6J 1ZM4A 5EWEA 1S10A 2GFFA 3T5HA 4ZP7A 1PC5A 5LL6d 5DG9A 2H3EB 2YXLA 2F8EX 1RHMB 2IM1A 3Q83A 2V8GA 4DR4F 1MWYA 1S9FA 3CVKA 5HO4A 3MTKA 1UETA 4B3SJ 3OXFA 2ZHAA 3KFWX 2JSXA 2ZWPA 3V5RA 4NASA 2C3PA 3MM7B 3IWXA 5DRKA 4A8QA 2DNMA 3MM7A 1DQ8A 3VZHA 2MQNA 2DHHA 1UJ6A 2Z8QA 1JLFA 5IFMA 1UWAA 2G1DA 2XI3A 4X65F 1XC9A 1FDNA 4L74A 1NZAA 3VAKA 5IS2A 1F1BB 5EN1A 4RBVA 1Y5LB 2C2KB 4Q8FA 3L9ZA 1TL3A 1DAXA 3O2IA 2GHVC 4QWEA 2W4DA 2MB0B 1T9YA 1REGX 4OYPA 3HZGA 2AZ3A 1FWPA 1L3KA 4EWTA 3VGUA 1FNXH 1AXQA 3RR7A 4X4VA 3D67A 3V6KA 1K44A 5CABA 4JI3J 4USTA 1X8DA 4BLGA 3TQ1A 3SSRA 1S7HA 5ETRA 2BEFA 1TMJA 5DG8A 3R7BB 3BH6B 3UD5A 4DV5J 4PR6A 1FJGF 1FKPB 1HWKA 2QTWA 2UXBJ 4KGKA 2VG6B 3BGLA 2HWIA 1FKPA 3BEGB 4OI3A 2VG6A 1T9XA 3CCJS 2WK4A 4QR1A 2KO1A 1PKUA 2AEJA 1F2HA 3TVKA 3D1OA 2G0JA 1GMVA 5EUHA 4B9UA 4QOTA 1HD0A 4L75A 4A8OA 5D0EA 1I94J 4ELTA 1FNOA 1R8AA 4Y2MA 3ZTPA 3Q0AA 4KSEB 1GX6A 1WEXA 1PO6A 1R8HA 2QLJB 2H65B 3DMJB 4K4TA 2P2CB 3FEXB 2IBKA 3UN3A 4DOZA 3DMJA 4FBUA 4C8NA 1FTRA 1WSVA 4YB1P 3SXLA 3R9LA 4WXWA 1SH0A 1ZH5A 4USJC 1Y5NB 4DL3A 3CIZA 3NCQA 1SV5B 2HEKA 1C1BB 1SV5A 1C1BA 4DPXA 4OZ3A 1Q8IA 2YKAA 1CJKA 2FJAB 4K4ZA 4RWXA 3MAAB 4ED1A 1VRQC 2VPYB 4C8YA 2E5HA 4OLPA 3MAAA 5GMKa 2YPYA 3BV8A 2AJFE 3NY0A 1IBLF 1FRLA 5ETNA 4X4NA 1R0CB 4F4XA 2OH2A 3BR9A 2QFJA 3SCIE 3T6JA 4UQTA 2BXJA 3FNNA 2IC3B 3I31A 3T9NA 4MAKA 4ES2A 1RTZA 3OV7A 3DLEB 3DLEA 4DSFA 3ILIA 2RAQA 3JQJA 5KT6A 1VBKA 2L3MA 4OI4A 4PCQA 2MJUA 3FFIB 1EAYC 1B0VA 1HA1A 3FFIA 1HWIA 2FHJD 3T1YJ 2VJUA 2Z2LA 2HSEB 2BQRA 3RZAA 2A18A 3KJQB 3NNCA 5KFVA 3R7SB 2VBWA 2DR7A 1OYEA 5A8WB 4C11B 2A3JA 2LXIA 4PXEA 5A8WA 3HM9A 3AAWB 3B82A 1HNVB 1W2BR 4E0DA 1XMQJ 2HRTA 1HNVA 2FTRA 2AYEA 2QIFA 1G6BA 3PW5A 4NLGA 3HT0A 2E5LF 3DRPA 4LMZA 3L95X 1F5AA 2CVEA 2H5EA 2H9ZA 3I96A 5ETOA 2R7SA 4M5IA 4A48A 4P2XA 2YQ0A 3EPGA 1FRHA 2HAIA 2CJAA 3M8WA 3MHYA 3KNGA 4DLGA 1FRMA 3H2LA 2BOAA 1YJ9S 3SIPB 1GT8A 1H2UX 1S12A 1NBEB 1M1HA 1M5VC 1TFWA 4F4KA 5L1JA 3CJSA 4KR0B 2UXDJ 3KMQA 5LMUF 4YEAA 3OVAA 2WW4A 4IOAQ 2FHMA 1WC5A 1RHQB 4Y2KA 1NHUA 2HBQB 1S0OA 4DV4F 3EDRB 3BSCA 3J7ZT 2FVPA 2QLXA 4FPRA 4M5MA 4MKVA 1Z2LA 3K2YA 2IYGA 4TQRA 4A4JA 4PXDA 3QT6A 4CRJA 2RRBA 3WBZA 1WHWA 1HBNB 2MDAA 5EX3A 1HBNA 1UFWA 2AU0A 3VWSA 4Q7AA 5HJYA 4DR5J 3D7SB 3NRBA 3GB0A 5E3RA 4NLQA 2CZ9A 2FLNA 5GVQA 4FXWA 1QE1B 1ZS6A 4N56A 1DQAA 3DFEA 1VBXA 3FQKA 1RT1B 1Y4ZB 1I3OB 1ROFA 5L1LA 4RX6A 1HMVB 3OTDA 1QSYA 1HMVA 3P6YC 4JOUA 2VG7B 3TA0A 2DNPA 3GR0A 2VG7A 5IV4A 2EXUA 3TZXA 1V5IB 5IWAF 5KFLA 1ZPVA 3OTEA 3TJAA 1U0HB 1MN9A 2CQGA 2DNYA 1U0HA 1WSRA 1M1GA 1AT1B 1T9TA 2AW0A 3D5MA 3EWGA 5KFKA 2VHGA 4OJGA 4DR2F 5KFJA 2OTLS 4HI2A 2V8DA 2XSFA 4LRBA 2DKOB 3A3OB 4EYIB 2EK1A 4IO9Q 4TQSA 3HHLC 4XK8C 2A0FB 3GILA 1U45A 4EGLA 4U7UD 5KT4A 2FGCA 2NQPA 1R8BA 1RAHB 4OYXA 3PYGA 1OWXA 3K5NA 1ELOA 1U02A 2J9DE 3Q8SB 2JLGA 2XMKA 4DCOB 4J9OA 2X51A 3EICA 1RT5B 2DGVA 2DXDA 1RT5A 3PYDA 1HNIA 2V4QA 2CQPA 3HVAA 5HVFA 2ZBQA 3GIJA 1L3UA 3E2EA 2KYZA 5B0AA 5F8MA 2OAUA 5BR8F 2RILA 4YB6A 2V63A 4KGXB 3HT3A 2HGNA 3ILJA 3K0JA 1ZM2A 1H0HB 2QA2A 1N6QB 1FWKA 4CH1A 1RBAA 4UOFA 1N6QA 3G9CA 4H4KA 1RCXB 3TRGA 1U1OA 1ZTWA 2EC0A 4NLDA 3CCWA 1NDKA 3FKBA 4RUAA 2LQ8A 5CAAA 4NLUA 5KFFA 1P9YA 3HKWA 4HT7A 4YN3B 3PNIA 1QSLA 2VBZA 3FK4A 1VQOS 1RT3B 1JLQB 1IM6A 5LSRA 2GO8A 3H0PA 3M8PB 1RT3A 5ETQA 4UF4A 1JLQA 1FK9A 3M8PA 3GIIA 1IKXB 3AXKA 3OVSA 3H40A 4YR2A 2QC3A 1KFSA 1K1QA 5K20B 2DH7A 3JTNA 5C42B 1QVGR 1RTHA 4AXIA 3OTOJ 2ZBIA 5C42A 5HP1B 4B3TJ 3IM9A 1OSCA 5HP1A 5LXRA 1JLCB 1ZAXA 4EYHB 3OJUA 1JLCA 1DJ0A 1NDPA 3IWLA 3MFHA 4DHVA 4BS2A 2ZHBA 4QPTA 2DGUA 2VV5A 3L3CA 3NAHA 1NB7A 5KT3A 5ETMA 5KG4A 3W65A 4P2MA 2PO4A 2YKQA 3Q8QB 1WELA 2Z4PA 1PILA 2WRMA 2FYXA 3B54A 2OEKA 2X1BA 4RU2A 4ZKAA 2ZH8A 5CQGA 2HZCA 2UXCJ 3FZBA 1NK0A 2VG5B 4DPYA 3GR1A 4CLUA 3IBFB 2VG5A 1U1KA 1O51A 2JZ5A 2YNIB 3E8OA 4LFAJ 3OJSA 4FYDA 1S0VA 2G0CA 2YNIA 4CWBA 1WG5A 1RWMB 2J76E 4ZVGA 3JQMA 1F2GA 5HK4A 3PRVA 2VONA 3CSKA 3VQTA 1Y3JA 2LKZA 4DV1F 2ZD1A 3FC9A 2G13A 4UUWA 1H74A 2QX0A 2BRLA 4DPUA 3IRXB 3DLJA 4DUZF 1AA1B 1BMQB 3IRXA 2BBEA 4OI1A 2EK6A 4ER8A 1VYAA 4F2SA 1NRKA 2ASDA 4RL1A 3BREA 3UD3P 5DJBA 4PQAA 2CQ1A 2B8QA 4I2QB 4OZLA 3RBEA 4AYBD 2X7IA 4I2QA 2R3VA 2XS7A 3ENQA 5F8IA 2NLWA 2FZCB 3O6QA 4IYQA 4ED3A 2HFUA 2F40A 2B51A 4OI0A 1RSCA 1UA0A 4OQJA 4LUBA 2WZ1A 2FJBB 1UP1A 1G7CB 3IWNC 2ZH2A 3R5JB 2HZVA 1A0OB 4RUCA 4FF2A 5MLCV 4PEOA 1NSAA 3G87A 4NLYA 4OV6A 4YY3F 4ZPTR 2IJRA 2R8GA 2OSQA 5H9FK 1QTNB 2KH9A 3H42A 2XLIA 4KPCA 3GJSB 3GWCA 1IM4A 2XC9A 2W8KA 2DH9A 1NB2A 3DOMB 2YKNB 4I2PB 1X4CA 3US5A 3DOMA 2L9NA 3CJ5A 4UQGA 3CTRA 4QIVA 2MY7A 2YKNA 4I2PA 1BWEA 1LNQA 4A8MP 3O8WA 1JK9B 1T11A 1BC6A 2DXFA 2LEBA 3E3XA 4IRKA 4KFBB 4PYAA 5KFSA 2OD4A 4RNOA 3MR5A 1JX4A 3GV7B 3CCES 1XNQJ 4C4WA 1SC4B 1SC6A 2AZ1A 3HFVA 4MJKA 3VAFA 2F3JA 5EDWA 4A8WA 2APOA 3OPKA 5ETSA 2JWNA 3FCWA 5CD4H 2DBBA 4J90A 2I6WA 3ZTOA 4AE5A 1RYRA 3ZTSA 3NCPA 3I87A 1U25A 1KFDA 2KG1A 2R7UA 1AUDA 1FFGB 1TUWA 3S6EA 1HR0F 3EM1A 5D0RA 1EZZB 4QIWD 3ULHA 5DDRC 1HARA 3SQOP 2CJXB 2FHKA 2J9CA 3LAMA 3BJYA 5AJ3J 3V4MA 1WD6A 3DDKA 1U8SA 1ZA2B 4NOHA 4C3MA 2ZH6A 3D28A 1WHYA 5DGBA 4TN2A 1U8WA 2Q43A 4WWSA 5IM0B 3UN5A 4NZ7A 5AT1B 5IM0A 4L73A 2LYVA 4CLKA 4LF9J 2IY5B 1NK6A 5KFUA 5H1SV 2UVWA 1N33F 3PYEA 1NZ8A 1N32J 3QATA 4QPXA 2HQCA 3CULA 4NLOA 1D8YA 4N77A 3QZ8A 3PEHA 1TL4A 4DQSA 5E33A 1WJ9A 3OL8A 4PWDB 2PC6A 4PWDA 2IVMA 3TX8A 3QJJA 1LXNA 1WC4A 4DR3J 2COLA 5GAHU 2DTJA 3C14A 1YJTA 4TYAA 1Q8BA 3KK1B 2LXFA 4CLLA 2KZZA 4J9PA 4DG1B 3KK1A 2J8AA 4DX8H 4DG1A 4ZLJA 2HG4A 2R7VA 1HPZB 3OFHA 4WFYA 4ZJOA 4HKQA 1HPZA 2HS4A 3H90A 3BGFA 2ZJPQ 5HQ8A 5IOLA 3RG6A 2K2PA 2CDQA 1XN9A 1EQ0A 4WP8A 4X62J 3BQ2A 4NXMF 2M5YA 5DLGA 2ZBPA 2CQ4A 2MEWA 4DUYJ 5D0HA 3GCXP 1U24A 2Z2MA 2C3YA 3QLHB 1KQFB 3CJTA 4ZPAA 2K7JA 4GKJF 1BQXA 2IDEA 4WTYA 1RABB 2R7QA 2AJ2A 2GX8A 2GZOA 1P8GA 4HTIA 3N6NA 2EFPA 2W9BB 1HD1A 1OPIA 3LGHA 2W9BA 1SH2A 1Q81T 3CJQA 1SC3B 2E9RX 1R31A 3MOJB 3SMZA 1RWOB 1QY7A 2CVIA 4E98A 4IDKB 3ZTRA 3ZNUA 2GCFA 4DV3J 2MKJA 4IDKA 2HVHA 2Q6CA 1VI7A 1NUEA 3GFZA 3CJKB 3CJKA 4MKBA 4MK9A 3CMES 4A8KA 2OD6A 2K8GA 5L46A 4XPEA 2QL7B 3RYLA 2XZWA 4DX6A 2R8IA 3JAMY 2GO9A 3MPYA 3KTQA 2LMIA 5KFHA 1NHKL 4NEZA 1U2CA 3MMJA 2GS8A 1YJWS 3QJPA 2XZTB 1T95A 4K4VA 1RU1A 2IJNA 4RUBA 3CT9A 1S1VB 3ICLA 5EWGA 3H4BA 2F5GA 3LWMA 2VICA 1S1VA 1K9MT 5J2NB 2HVIA 1S6UA 3HI9A 5J2NA 2KYXA 4LREA 2OEMA 5AXMA 2AYGA 1R89A 2BW2A 3J81Y 1UPMB 4CO4A 4L72B 4ICLB 3P45B 2PDAA 3TNVA 4ICLA 2O01C 1SJQA 3GTYX 1K0TA 3RJMB 1JJHA 3MM8B 3T6BA 3C16B 3MGJA 3MM8A 2D3O1 3C16A 2F9JA 2DRDA 1JWWA 5J2QB 4DV2F 3D3BJ 1HNZF 1Q4RA 5J2QA 2VPZB 3S8SA 1S99A 2LEAA 4FDFA 2N7YA 4Z7CA 3AD9C 4OYZA 4DN9A 3T5LA 3JB9k 1F5BA 4UUXA 4KPYA 4UZCA 2WB4A 3ETOA 2E44A 5KFGA 2J0SD 1YITS 1XR7A 4TYBA 2NUUG 3QGIA 2CZVC 1LK5A 1RAEB 1KP6A 4OX7A 1DLOB 1DLOA 1YRXA 3LW5C 4URSA 3D0GE 2GIFA 5ITHA 2HHXA 1LWEB 1TTHB 1LWEA 3KUGA 3IR7B 4U67Q 2EG2A 4XDDA 2A1BA 1RBLA 1RT4B 3HSZA 4ZPBA 4C3KA 2OFGX 2LQ9A 1RT4A 1HI0P 4XIUA 2POKA 1DQ9A 1JLGB 4NI2B 4WU3A 4OHWA 2CPFA 1TFYA 3AOAA 4NI2A 2OO4A 3X3UA 1WG4A 1XR6A 4LF8J 4EZ9A 2Q6BA 2RT3A 1N4LA 4OLOA 4O4RA 4GVLA 1QAJA 2WVCA 4OX8A 3LUYA 3MECB 4JV0A 2AT1B 3MECA 2W2PP 1YGYA 3NCRA 4ED0A 2IRUA 3D4JA 2KT2A 3OHBA 2GAHC 4QIGA 1FRIA 2C3OA 2ZWOA 2DGQA 3R1HA 1SIWB 2IMOA 4LT6A 4K4YA 2B7BB 1RXOB 4WZMA 2DRBA 3OR1B 2ZH7A 4NZ0A 5JJBA 3QRPA 3IR5B 3OR1A 2IJFA 4PQUB 1WTBA 1Q7YT 2DYAA 2VFTA 4PQUA 1HHTP 1NPRA 4NLTA 4ERDA 1CC7A 4X65J 1S9GB 4M8LA 5GMEA 1S9GA 4GKKJ 1Y10A 1S4FA 2DO4A 1DTQB 4PG5A 1VOMA 1HI8A 4WJBA 1QM9A 1DTQA 2VBYA 1VS3A 1YX2A 5EWFA 3NNAA 1LK7A 4O23A 1NXIA 5HMWA 4ZIWA 3QWPA 1XNRJ 3O1LA 5HAOA 4RNNA 4EK2A 2IAJB 3S01A 2RU9A 3C2PA 1N52B 1RKIA 2IAJA 3NGRA 2DJWA 4R0JA 1VQ5S 4O3SA 3PHTA 4NZ6A 3CW2C 4ENOA 1TP7A 1T8EA 1TUVA 3UNGC 3TUIC 1RAFB 3KG4A 3PKMA 2CWKA 2W2NP 1MWZA 1WEYA 2CKWA 4ZOSA 3AJ1A 5KG2A 2E9ZA 4B3RF 1FJGJ 4RNHA 1NK9A 4BC9A 2HMIB 3NL0A 2HMIA 2HHTA 4V19J 4FF1A 4MT1A 1J5OB 2AJ1A 5DDPC 2R7WA 1VCTA 1J5OA 5JXSA 2AF6A 5HANA 2UVRA 4NYZA 3MPUB 5KG1A 4W92B 3K59A 5FJ4A 4DSJA 3EGZA 4C98A 3CDEA 2MZ1A 3J80Y 3P4UB 2RUGA 1DFDA 1X4GA 2VIHA 5I3UB 3M2UB 5H9FJ 1RQ0A 2RSQA 5I3UA 3FGVA 3M2UA 1VQMS 2RNEA 1SPBP 2A2CA 2DR9A 2OIHA 4TY8B 4LSLB 4TY8A 4LSLA 4B02A 1TK8A 2YX4A 1IKVB 4RJVA 3VAJA 3FCVA 3BDPA 2DGOA 2V8PA 1UW4A 2NXJA 1IKVA 3GPAA 2XTJP 1WWHA 1UEVA 3N5BA 3AA9A 4FVMA 2XMTA 4A8FA 2RH3A 2U2FA 1RLCL 4WIIA 3I4HX 4JI7J 4J9QA 3GP9A 3SQGB 1IBLJ 1S72S 4WE1B 2NXEA 4PKDB 2B8PA 2XI2A 3SQGA 4ZLPA 2ADCA 4WE1A 4F0KA 1RZMA 3ZFVA 3MMAB 2RMLA 3MMAA 1U47A 4DX7A 3UDEA 4N8OA 3PW2A 1NK7A 3CUNA 3THVA 4PXBA 1QAXA 2ZH1A 3HKZD 2G4BA 5E3AA 4GO7X 2PFDA 2CNNB 4YFUA 3K17A 2KVQE 3NS5A 2CG8A 2PIIA 4EMDA 3OL6A 1KONA 2DHAA 4JI5F 5C2CA 3G82B 4LVOP 1WOSA 1UJ4A 4N76A 3G82A 4KKOB 5F8HA 2UUBF 4HDHA 1TV6B 1ULRA 2OPRB 2Y0BB 4KKOA 4N5SA 2OPRA 5G4DA 2RIJA 2YY3A 4ZVOB 2OMLA 5F0UA 1FHTA 4ZVPB 3QGPA 4NXNF 1QSSA 2VOOA 2DGXA 4Y2CA 2EKNA 3K89A 2E5LJ 3BGOP 1NH8A 4ETXA 2BYCA 1N5QA 3KMSA 1Q16B 4B9NA 4JBCA 5KFAA 4C3LA 2MTLA 4R0EA 5ADZA 1C0UB 2N4DA 2R2RA 3Q89A 3KUEA 1C0UA 4OYIA 2GC8A 2KN4A 1F3VA 4B08A 1LFWA 2VFUA 1BHNA 2HFNA 1S57A 4Z2XA 4F3QA 2ZC3A 1VQNS 2H4YB 3QGGA 2R2SA 1RTIB 2KXFA 2HGMA 3VZIA 1UA1A 1FDAA 4ILRA 1RTIA 1L3VA 4QJVA 1RISA 1MMDA 3K8VA 2IVYA 3MM9A 4KB7A 3BR8A 2ZDPA 2B43A 2J6SA 3J7YI 5LMUJ 1WC1A 1EHWA 1PGZA 1Q78A 2XMJA 4NEYA 2RB7A 1P1LA 2BVZA 1HYSB 1NNDA 1HYSA 2DPJA 4WKYA 1X4BA 4FP9A 2X3DA 2NREA 4RUHA 1NCLA 3TANA 2Z58B 4J9VA 3EGWB 2W2MP 3CJ8A 1JJCB 3KLFB 3IM8A 2WVBA 2JEIA 3TZZA 2I8EA 3KLFA 1FRXA 1GNKA 4DR6F 2LU2A 3GYNA 3W3SA 5IT9Y 2PD1A 1PSDA 2CPZA 2OGUA 4OYAA 2FZKB 2ZOFA 3WX8A 1GMWA 2Z57B 2BV3A 4K5RA 4HH0A 2A2DA 2RDIA 4DN0A 2VFSA 2JEFA 1PBUA 1MNEA 1ZPWX 4NLWA 5IWAJ 3BQ0A 4AL6A 5D78A 4L76A 2FY1A 4OFZA 4PG6A 1UVIA 4MFBA 4F0MA 3PFOA 1KEKA 3FMBA 2HVDA 3PX6A 3M2RB 4K4UA 4W4MA 3M2RA 2J5AA 4ZLNA 4KGMA 2GQCA 2MMYA 1T9VA 2J8SA 3WIVA 1Y3KA 3E01A 3NGSA 4LF6F 4CO1A 2J9DA 3O44A 1RYSA 2UU9F 1WORA 3KHLA 5K8OA 3KHRA 5D4PA 3OXLA 4C8OA 4P2FA 1M0SA 1B4SA 3ENVA 4OIXA 2IRYA 3BKUA 3QFHA 2KU7A 3VHQA 2W7PA 1SQGA 2HRUA 2R8HA 2A10A 3MR6A 1HBOB 3GYGA 3BN4A 1FERA 1ICEB 1HBOA 2Y0SD 4GC7A 3MCMA 1X4HA 1S0MA 1WI6A 4CDIA 1I6JA 3FBFA 1AYEA 1H38A 1TKZB 2CWXA 1EJ7L 2QMWA 1TKZA 2CJKA 3CO0P 4IG0B 3BQ1A 4IG0A 5IXUA 2Q79A 2Q66A 4MK8A 5KFCA 1FEEA 5E3CA 2VPXB 5DM6Q 2V9WA 4O3OA 2HHVA 2DNGA 1M5HA 3DKDA 4CTAB 3BGRB 3A12A 3DOLA 4QU6A 4CTAA 3CJ3A 4PUOB 3BGRA 3JTOA 5DQGA 2VH7A 4PUOA 5CZXA 1SC1B 5EHHA 3ZZTA 4HHHA 3DLGB 3GFXA 3LA0A 3DLGA 4QIFA 2XYPB 3DRRB 4O44B 2UZAA 3UQSA 4O44A 4DQIA 4DQRA 2IIHA 2J7WA 2X3GA 2EVZA 3FRZA 3N5FA 4M5JA 2C2ZB 2V69A 3HD1A 1P27B 4IH6A 1WHVA 4PAAA 1N0VC 1N34J 3R5BA 2OJ3A 1YJVA 2QMUB 3F56A 3D2WA 4MIBA 1RACB 4M5DB 4M5DA 1VRUA 4RW6B 3M05A 4RW6A 1CULB 2MZTA 5SUHA 1SB6A 2CQ0A 2C28A 1CULA 2OPSB 5KG5A 4ECVA 3EMTA 2OPSA 3EGNA 1WNEA 2QO3A 1JXLA 3U1MA 4OHVA 3ISND 2QA4G 4EFAC 3TZYA 1X4DA 1KVIA 4AQYJ 3GSDA 4KQZA 2B9EA 4FYYB 3W62A 2JDJA 4MK7A 4DS5A 3A8KA 1H7XA 3D6FB 2ZH3A 4DV1J 3QT5A 4JI2F 3MM5B 1U2RA 3MM5A 3R5AA 1NDCA 3NBPB 2VQEF 5ETLA 2GQQA 3UDVA 2ZOMA 3NBPA 1HWUA 2B4PA 4DUZJ 4DS4A 2BOPA 4MH8A 1DARA 1S0NA 3HHNB 2KRRA 4CLTA 1U09A 3PJ9A 1KDNA 3D6MB 3EVMA 3DRXA 2AWZA 1VQPS 4IFYB 2FLLA 2MZJA 4IFYA 1U1MA 1OIAA 4QR0A 4ZJLA 2BJDA 4ZVTB 4KO0B 1EX8A 4WBFA 3M6UA 4KO0A 3VALA 2CRLA 1NM2A 1BQNB 4ID5B 1IQZA 2V9KA 1BQNA 1HBMB 3PR5B 3CJRA 3LQVA 2YWFA 1HBMA 2HNDB 2Y1LB 4MKAA 4NX9A 1BWVA 2HNDA 4Z7YA 2YX7A 1FD2A 3OT9A 2PT0A 2OPPB 5I42B 4JI6F 2OPPA 5I42A 4QR2A 4CNZA 3H20A 3T5KA 2RS2A 1V5VA 2CYYA 1B99A 3BYRA 1VISA 4YY3J 5AE1A 5D0GA 4ECYA 1RADB 3V6HA 4Z37A 2CZ4A 4P72A 3VF0B 2G0IA 1XR5A 3R6GB 3I4PA 5C25B 2XSJB 2B9WA 2XSJA 1P9QC 4B3SF 5IQ6A 1F0XA 1MW7A 3RRKA 1R3NA 3M6VA 2ZJRQ 4DV7F 3M6WA 4ZCMA 2SXLA 3EZUA 1YZ6A 4EBDA 5GADI 1H2TZ 3L09A 2WTFA 3RGIA 2LA4A 3HVRA 3HHDA 1ZYQA 2XMVA 3TYTA 4IQMA 1CG2A 5L9NA 4F04B 3CD0A 5A8RA 4NCBA 2W8LA 4G65A 4PWUA 4YR3A 1H72C 2PE8A 2HURA 1F6TA 3UN2A 4ECZA 3T1HF 1R8PA 3KHHA 4GC6A 3N0VA 4Y6IA 1BLUA 4CLYA 1LW2B 1B0TA 2RQMA 1LW2A 5L8RC 3OL7A 3ITHB 1HR0J 2BX6A 2BKPA 3D1QA 3ITHA 5HMXA 4JI3F 4N7TA 4IKAA 4JUZA 1HIYA 1TAQA 2AEFA 2EWHA 5KG3A 2FJXA 3VVTA 3PRBA 1VMBA 4TU9A 1HL6A 4WPAA 2DCUB 1PYTA 5KOXA 2UXBF 1U4BA 3HSJA 1X0FA 4DF8A 1CQNA 2ACYA 1RAAB 1TKTB 1IWGA 3O5TB 3UI3A 1GQEA 1TKTA 4MYUA 1SQFA 1SXLA 4ANDA 1JQGA 4CQ1A 1UW9A 3ENWA 1N5SA 2C2OB 3H25A 1J2VA 4U7CA 2GMHA 5J1PA 3CDWA 3KLIB 1N33J 3SZ2A 2ZOGA 3KLIA 3CCSS 1I94F 3OFGA 4C8MA 2IM3A 2KFYA 4R8UB 2JNJA 4R8UA 4ZHRB 4ZHRA 2FHJA 5B09A 2CAJA 3G2XA 1K1SA 4QW8A 3TWZA 1XIQA 2GIRA 4ATNA 3FJ2A 1AZSB 3T9ZA 4OZ1A 1AZSA 3I0SB 5AE2A 1N54B 4Q0BB 1QVFR 3I0SA 2GA7A 2RHSB 4Q0BA 2BJ3A 4FZVA 4NE9C 3DLKB 2IBOA 5FD1A 3PG9A 3DLKA 3M4XA 2DO0A 4TU7A 3UNYA 1SBRA 3CE8A 4ZPVR 5DQHA 1UVLA 2BANB 1D3WA 4E8UA 2BANA 3QT7A 4LF4F 4X4OA 3FUYA 2GVZB 4DL6A 4MTPA 5D8HB 2GVZA 3MMCB 3RW7A 1PBAA 4CO0A 4QYZK 5CYMB 1SL1A 1XWLA 3T1AA 2Y1JA 4NXMJ 1KVKA 1RTDB 4MMOA 1T0TV 1EB0A 3R2CJ 1T9WA 2EFNA 3DXSX 4L3NA 4M5KA 4YDDB 3RR8A 2ATLA 2DNQA 4C48A 1KS2A 3ADAC 4ZJQA 5DDQC 4F4WA 2EFOA 3HF5A 2DIVA 3HO1A 2GVDB 3V6DB 1HNWJ 1RWKB 2GVDA 3V6DA 4YQWA 1V3SA 4L6V3 2MSTA 2XLJA 1PC4A 2NXCA 3DI6B 4J5OA 4NWBA 3EDQB 5C2GA 3DI6A 2XWYA 3CMAS 2EKYA 2HLTA 4IQXA 3QSIA 4CH0S 2YVSA 4IG3B 3AY0A 3RBZA 1FWLA 1WEZA 4IG3A 1FVSA 4X4UA 3DN9A 3EVWA 3PO4A 4DF4A 2V8HA 3QIPB 1VQ4S 4OZ2A 2DITA 2WVFA 3I6PA 3T19A 1NJXA 2ZKUA 3NOCA 3GSIA 2HHSA 4YHHF 4N47A 1R0AB 3OL9A 1HNXF 3VV2B 3CJ2A 4BWJA 1R0AA 2XEXA 2CPHA 5CCMA 2DR8A 2MZSA 2YWEA 1F9FA 3GIKA 2O66A 4DBQA 2QA1A 1QLNA 4DMZA 4ECXA 3HHLD 2B4UA 3SFGA 4YS2A 4OI2A 3W1YC 2DR5A 5DM7Q 2YQ3A 2MGZB 1UEKA 4LF2A 2Z2YB 3L7OA 2MGZA 4HHUA 4OYBA 3U7JA 4JV2A 3I56S 3TA2A 4Y00A 4CZCA 4H4KC 4DL0C 1EP4B 3KNAA 4G6VB 3QBCA 1EP4A 1RCOB 2BJ7A 2V2KA 2HK3A 1X5TA 3GJQB 1JIHA 8AT1B 2J6TA 2ZVIA 3OLAA 1XMBA 2MYFA 1NKBA 3P96A 1K73T 4DV2J 1HNZJ 1IR0A 2MKHA 2FIUA 2UUAF 1RT6B 3M6XA 1TAUA 2V4JB 1RWVB 3ZC4A 1RT6A 2WOMB 2V4JA 1IVZA 3A8JA 2M8HA 1Q95G 4TNOA 2W25A 4H54A 2W7AA 4J9LA 3Q8UA 3QMQA 5CHCB 5B0FA 3CXCR 2AP6A 3C15B 3V2UC 1UWBB 3C15A 1UWBA 5EGYA 1OY9A 4BBYA 3MUVP 1RHUB 2K7KA 1B7FA 2M7SA 3HD2A 3V6JA 2D69A 2Q3PA 1DTTB 2C2DA 1DTTA 1KR4A 2CUYA 2QZ8A 4LFBF 3CCVS 1VLOA 5GAGU 1FJ7A 2V4RA 1FX4A 3CJ4A 4IH5A 3H4DA 3HJFA 4UOCA 3W63A 3KK2B 4HTJA 2EBGA 2R4FA 2QN6B 3GYXB 2YKPA 3KK2A 5T7LB 1NSQA 5T7LA 1RE1B 4IH7A 1KHVA 3Q8VA 2WVDA 2RUSA 3PW4A 3A4TA 3BBCA 2VPWB 2H5IB 1QDUB 1IJEB 4PYDA 2H48B 4RNFA 2WBRA 2D41A 1IJFB 4DL2A 2JRSA 4DX5A 1FXRA 4F3MA 1NPKA 2CPJA 1LEOA 3KUHA 5L9XA 3JQKA 3BKFA 4P2SA 3RU0A 2VJVA 2DNKA 2PI5A 4FS2A 2VU5A 3L4BC 3W7BA 3DU6A 4CYUB 4O0IA 1K47A 3QYYA 4CYUA 3PVXA 1WOPA 5M2PA 3AQPA 4CLWA 3F0NA 1JXVA 4YR0A 1Q5VA 3K5LA 2HNYB 2GHWA 2ZHOA 3SSQA 3W2WB 2DT9A 3OUYB 1C4AA 2HNYA 1S7IA 3BKTA 5KFZA 3W2WA 3OUYA 2FLPA 5HN0A 3M8SA 3LGMA 4BDPA 5BJRA 3FEZA 5KG6A 4OZJA 1S1UB 2VUGA 4DCJB 1OJ4A 1S1UA 2DNHA 3NS6A 2DXEA 3EZOA 3Q8RB 2IC3A 3OTOF 4M1KA 4B3TF 2RD5C 4PRFA 1LV5A 2P9CA 4QBUA 5CCLA 1RWPB 2H54B 4QIEA 2B6AB 3CC4S 1KLMB 1RAJA 2HHHJ 2B6AA 1VRTB 4J9MA 1KLMA 2A6OA 2HIQA 1VRTA 1SCJB 3VAMA 4ILMA 1OMSA 2ZBRA 4H4OB 3R8YA 4HH1A 3H59A 1HHQA 1RBOB 3MM6B 4H4OA 2O5DA 3MM6A 2OTJS 3UFCX 1OSDA 2KB2A 2VKRA 3EUNA 1S79A 3MEDB 4C11A 4DI6A 3MEDA 3DM2B 4ZVUB 3DM2A 2WSCC 4B3RJ 3D66A 3EXYA 8RUCA 4EUVA 4RW9B 3I0RB 2I38A 4RW9A 3I0RA 4X4SA 4AL7A 3HHEA 1EARA 5F3ZA 1RAOA 1OY6A 1OO0B 1SL0A 2YH1A 2X1AA 3LP1B 4XPCA 2AJ4A 1N5VA 1FNMA 3QT8A 2CJQA 1YBTA 1VHIA 4UY8T 3NGTA 1NJYA 3JSBA 2HNZB 3NGKA 4C0BA 3FQLA 2Y8WA 4C97A 1S59A 2BDPA 3CPWR 1WKLA 2P8IA 2BM0A 2HKEA 2AHOB 1S77D 1DY3A 2HBYB 3HMJG 4XO0A 2XMMA 3HFKA 2BJ1A 1XERA 2XMAA 2VF3A 3J7Z5 2AEMA 2W7OA 2P9EA 4H4MB 3DLHA 3THTA 3UVJB 4H4MA 2CG4A 3UVJA 3CNQP 4HVZA 1LFPA 4KBIA 2AV5A 3R6LB 4D3HA 4W98A 1X5OA 2OSRA 4Y2IA 4MIWA 1WI8A 2JC1A 1FD8A 4WP9A 5HATA 3PX4A 2CPIA 2RDDA 2CIMA 5J1NA 4ZVRB 3OVBA 1PYSB 3M9NB 3UW1A 2O1PA 2VDHA 3PJWA 1KQSR 1OQ3A 5KFMA 1QE1A 2CQDA 1RT1A 4A8SA 4ZP6A 1O8BA 2B0GA 1E6YB 2LCWA 3T5JA 1SKWA 3MR3A 1D09B 1E6YA 3H98A 3U02A 2MQPA 4DR1J 1SUQB 1T3OA 1SUQA 5HQLA 1T7PA 4HI1A 4FBTA 2DHGA 4DL4A 5G0RB 2YWHA 5A2QY 4ZA1A 1MN7A 2V2VA 1CJTB 2N3LA 3LP0B 5G0RA 4QWAA 1CJTA 3LP0A 1BQMB 1LOUA 1BQMA 1RWXB 2G9OA 3OFEA 3T3FA 4WK3A 4JI5J 2FPHX 9ATCB 2UUBJ 2RKIB 2YNGB 1RHRB 1H3DA 5HMYA 4I56A 3CGIA 2RKIA 2YNGA 1SL2A 2I0XA 4FNIA 4AD6A 2WAQD 4QWDA 4WKRA 1NLKL 4ZP8A 3WQPA 3BDEA 2E66A 2DEIA 4NXNJ 3VAHA 3G71S 4LRCA 1YTYA 4ID8A 2QYCA 5HL7Q 3QSYB 2FVSA 4Q44A 1U1QA 2GJFA 4C9DA 4AFFA 2CNLB 2E1RA 1VQLS 5AJ3F 4M94A 3P49B 3OSPA 2BQ3A 3H2VE 1KSPA 2P6SA 1ZZFA 2KT3A 1D9AA 2K3IA 4ANCA 3M8QB 2PFFB 3M8QA 4LF5F 1G2EA 4GVBB 2RDJA 4DU7A 3BO3A 2I1RA 4GVBA 1QUVA 2IM0A 3LOUA 1LW0B 5BYSA 1FJEB 4ZPWR 1LW0A 2D3ZA 1F3FA 1UMJA 4LR8A 1Z4UA 4F4ZA 2QV6A 2GMLA 3PW0A 3DRSB 2EFVA 3D68A 3DRSA 3TAPA 1MMLA 3RAQA 4U6PA 2JEJA 3KJNB 2GHPA 2MJNA 4G1IA 3C46A 1IKXA 5HLFB 4QYZJ 2ATCB 5HLFA 1L5UA 1RWWB 2E1MC 1PIEA 3A13A 3BSOA 4DR6J 1S1WB 3C6UB 2GQ2A 4GMKA 1I51B 1S1WA 2DCLA 3C6UA 3CCUS 3A3NB 3CDAA 2EEYA 2PN6A 3TR5A 2AMCB 3IAS9 3QNWB 4NPOA 2FJVA 2IHR1 4ZN1A 2FLOA 1CVJA 1EKSA 3BN7A 3M8ZA 2AX1A 3R1LA 3QAEA 2F4VF 2HFZA 5H9EK 1VJQA 2J0WA 5DGAA 2DH8A 1U1RA 3BSNA 3IR6B 2R9LA 1VQ9S 1SIZA 3OR2B 4IR9A 3KJVB 1HQEB 2FHOB 3IN5A 3OR2A 1GX5A 5IT4A 1KHWA 3RB0A 3KJVA 1HQEA 2QSWA 3SSSA 3MXHP 3FVYA 5IC4B 3CF5Q 3SFUA 5F8NA 1N5YB 2KJVA 3CIMA 1N5YA 3WZ0A 3AODA 3DHWC 1SJ1A 4LF6J 3DC2A 2I5JB 3BS9A 4QWCA 2I5JA 3PKYA 3POTB 3WDOA 3MUTP 2BJ8A 2ZNZA 3POTA 1FEHA 2VC0A 3DGVA 3M30B 3EX7B 3R3TA 3M30A 4NYOA 5J2PB 1M1KT 1B0PA 2V2ZA 3EE3A 4LBHA 1X9SA 1UAWA 5B0CA 1PJ7A 2B3TB 4ECSA 4KRWA 4UW2A 1BXNA 1WF2A 1IKWB 1IKWA 4FXVA 2KVIA 5KAKA 1GMWD 2BRKA 2G1HA 3P5TL 3HLUA 5L1KA 1L3TA 1AW0A 4KHPF 2J0XA 3HP6A 2H4WB 3W2VB 4ALZA 4CO5A 1URNA 4P71A 3QRRA 1U26A 3W2VA 4QZVB 3CC2S 3W5XA 2XYHB 3J81j 2ZZNA 3N4WA 4WTOB 1G4CA 1GTEA 2EBEA 4LFCF 3UWTA 2B56A 1VBZA 4B17A 1YWXA 4U8VA 3KDOA 3VGVA 3KJFB 4R5PB 3TW0A 3LP2B 4XDCA 4TLQA 2Z56B 3HULA 3G8QA 4R5PA 3LP2A 2EC2A 3BPDA 1FVQA 2HPUA 2MKYA 1SVDA 2DISA 4CO3A 3MMBB 2AGOA 3MMBA 3IC1A 4CLPA 4JI1F 3ISZA 2R7OA 2JFKA 2FDNA 2WVEA 4ZCLA 4KFBA 2XY7A 3H2UB 4ED2A 4NRTA 1S6PB 1CPZA 2CNKB 2AD9A 2KZMA 1NPPA 2ASJA 2L9DA 4ECQA 1S6PA 1NK4A 1RJJA 3RUBL 4FXDA 3CCTA 4KJIA 4CP5A 4UOGA 2B9YA 5DO2A 4MKYA 2WB1D 1FJCA 1FE0A 3C6TB 4USUA 2CPXA 1KQKA 2X1GA 4LBIA 3VGTA 4U96A 3PEJA 4I69A 2E5GA 3SBMA 2OP5A 1SKRA 3OXGA 3OTBA 1FFWB 2JFDA 3MCSA 2HQIA 2ILZA 1RKJA 2UP1A 4WK1A 2RE1A 5LJ3Y 1GK8A 4JI2J 1FRJA 1KTVA 4CNYA 2RJZA 4P9SA 4Q43A 5KFQA 5ETTA 2D74B 1TR0A 2H1YA 4DXLA 2M4MA 2E5JA 2DK2A 1U0SA 1HBUB 2M0GB 1KOOA 1VC6A 1HBUA 3SDEB 1KKHA 2DEJA 1VQ8S 1FXLA 4KE5A 1UFLA 5I4MA 3SDEA 1R27B 4B9TA 1W25A 4EBEA 2LDYA 2PMWA 1PG5B 3MEKA 4OYOA 1HHSA 2FVRA 1RT2B 5B0GA 1Y11A 3FSYA 1RT2A 4ELUA 1VIXA 3B8HA 3NMAA 1WDTA 4IOBA 3OQ2A 3F44A 1XJWB 3GJTB 4P7TA 1WC0A 3CD6S 2N3OA 4JI8F 3ZNJ1 4WIQA 3BO4A 1Q0NA 2PEBA 4A47A 2ZE2B 3U27A 4ECRA 1KTQA 4EU0A 2ZE2A 3AOCA 4LRDA 1YKWA 1Y9OA 3ISNC 3D9BA 4DL5A 4USWA 3DCAA 3CCRS 4DV7J 2E7WA 4U7UK 1JLFB 3P3DA 5SZTA 1F60B 4ED6A 1H2VZ 1M5KC 1R7IA 3DXBA 2GW8A 4RU9A 1SQEA 2W2OP 4GKKF 1DURA 2VL1A 3CDUA 2XCPA 5T41A 3J7YU 1M5SA 1X9MA 2OUGA 2C2EA 2Q1LA 1TL3B 1UPPA 3QLHA 4LR7A 3LPEA 3TI0A 4I64A 5E41A 3QWUA 5GAEI 2RQKA 2D9OA 2XO6A 1NDLA 1MLAA 5MAOA 3FSIA 3T1HJ 1T03B 1XNRF 5JUMA 1T03A 5HMZA 4UZBA 2UUCF 3FSXA 3M32B 2AYMA 2MKIA 1CJVB 2BKOA 3M32A 5DZ6A 1CJVA 4OYWA 5DDOC 2NSCA 2NZCA 4USHA 4C8LA 4OI6A 3KWMA 3WHIA 2GJ2A 4LR9A 1A9NB 3PCOB 4FKYA 4ZVHA 4X64F 2NPFA 2OEJA 4LQ9A 3W5YA 1JMTA 5K5MA 3OTCA 4P75A 5F3TA 2C2MB 4OJ3A 2MKSA 2Z0GA 3H5YA 5E0OA 1TMMA 2OFHX 3MURP 2KT5A 2XS2A 4ED4A 2ZZTA 5IQQA 4AL5A 5F8LA 1YQHA 1EQMA 1SKSA 4TXSA 1C4CA 4Q2MA 4OHYA 1SKUB 2UV8A 4F2RA 3M7VA 3RBXA 2E1PA 4OX6A 1WUUA 2GMJA 3MTJA 4OYMA 3R5DA 4I4BA 4NLVA 4O3QA 1SJFA 3G6XA 1YIJS 1N0UA 3PACA 2RRAA 3TP2A 2BJ9A 2HHPA 4OHZA 5A2QU 1UVKA 4DZDA 2VZ9A 2W1BA 2AQ4A 4EBCA 2DNOA 3BBBA 2MQMA 3NP5A 2HWHA 1GTHA 4WP3A 4ANEA 4NCGB 1VDHA 2W9AA 1VLYA 4NCGA 3SCLE 2ALYB 3RAXA 1CJKB 1M5PC 2QFIA 2IM2A 2KL8A 3JXOA 5M2RA 2C3MA 4LF4J 5LJ5Y 4MIAA 4CI0B 2VFVA 1PYOB 1JJ2R 1CSJA 4JI7F 3ZZ0A 2JVOA 2W2QP 3TAMB 1DBDA 4HEA9 5A6WA 2XCAA 3TAMA 1HWJA 4NA1A 4JI0J 3BO2A 4OL8A 5LMNF 4J9RA 5AE3A 4HYKA 3P8BB 4OZ5A 2DNRA 5I3QA 1MG7A 4PZVA 3W9HA 3FCHA 3AJ2A 3D6HB 4K50A 3IRWP 2XY5A 1CLFA 3FZ2A 3ETMA 3LANA 5HVGA 4HACB 3AT1B 3IXQA 3BGUA 4HACA 3V4IB 4K0KF 3SI8A 3V4IA 4KV8B 4KV8A 3BPSP 3OHAA 4OX9J 1NK8A 4WYLA 3ZZUA 3MFIA 2MLXA 2XB2D 2E9TA 3R2DJ 2IYIA 4URQU 3DRPB 1RWNB 1JLGA 4B3MF 4ZN3A 5C5JA 3QAUA 4AXJA 4YHHJ 3MI7X 2NYIA 2C22A 1HNXJ 3V81B 3V81A 1D9DA 1J5EF 4OJ1A 2D1CA 2XMWA 2ZH9A 1VR6A 3TUJC 3IMQJ 1PAEX 1VJWA 2L9WA 3DDIA 4ZLLA 1XMOF 3CCLS 1R43A 1KWMA 2CPDA 4DZ6A 2OHDA 3KG0A 4DR4J 1NK5A 1RTJB 1ZM9A 1RTJA 2KI2A 4XTTA 1FKOB 3RB6A 2CQ3A 4CT9A 1FKOA 2CJYB 1GEHA 4HLBA 3SCJE 3QQCD 4NYPA 3LF0A 5FIIA 3H5SA 5KFTA 1QUPA 4J9UE 4QYRA 1IR2A 2AYBA 1WKJA 2O67A 2HFVA 2FVQA 1UZDA 3HSGA 3Q22A 2M8DB 2VKZG 4URGA 3I9ZA 2ZUAA 3BH7B 3AFGA 4CLZA 6AT1B 5H9EJ 4LF7F 5F41A 2UUAJ 4O3PA 3W9IA 2MQ8A 1TELA 4DJBA 4WFXA 5CYQB 4CCHA 3MF5A 3N79A 5CYQA 3A1YG 2CQ2A 1Q7LB 1ZETA 3MAQA 1ZM3A 4WYWA 4KHMA 1KD1T 2JHEA 1TK0A 3PXGa 4NLSA 2JVRA 5HBMB 5F8GA 4DSIA 2HVEA 5HBMA 2XHWA 4WF9Q 2VQFF 1RDRA 1N5TA 3L7UA 2Y1IA 3PHEA 5DS7A 3ZO7A 1UKUA 1KLNA 1Z1ZA 3CO9A 1WTFA 3BYPA 5BYQA 2KFNA 2OELA 4DLEA 5CD4A 3FRYA 4USVA 5U47A 4ZVEA 3EVOA 2CNOB 1S48A 1BGXT 3KOAA 4IUFA 2PEHA 3GG0A 2MZRA 5KFOA 4ILLA 4LFBJ 2ZBCA 1TL5A 3I5BA 2H5JB 1ZZNA 1YBAA 3HSDA 4NL5A 5JMNA 1S6OA 3GFHA 3RB4A 4KIAA 5GADU 3LGNA 3D0HE 1BE4A 1FI4A 3U1NA 2MQQA 2J9EA 1HQUB 4PWWA 1WC6A 1HQUA 2NXNA 2I9SA 4RBTA 3ZZRA 3CEDA 4DR7F 1HNIB 2NR0A 1X4EA 3OW2R 3NG8A 5ETPA 4LBPA 1WG1A 3ET6B 1VQ7S 2J7KA 3ET6A 2HQGA 2GJIA 4KAIA 1GAOA 4JYAF 1TL1B 2MLZA 2YWKA 1FTCA 3ENAA 1TL1A 5KFDA 3ZTQA 1O6XA 2QMXA 1U1PA 1WOOA 5K14B 2KKHA 5K14A 1R8CA 3TAQA 2AIRB 3FMWA 1MWQA 1PJ5A 3CD5A 1N36F 1K8AT 3VCDA 2HS3A 4OZNA 3Q8YA 4USMA 2CJBA 1FK9B 4F0HA 4DFMA 3MD1A 5KT5A 4C7QA 2AJ0A 1F9HA 1VK3A 1Y0HA 5KFPA 1RTHB 5A8KB 3AD7C 5D4LA 3UCGA 5A8KA 2RF2B 4UTGA 5KOWA 2RF2A 3LTOA 3TJ9A 1N34F 4RW8B 3UR0A 4RW8A 2CFXA 2D3UA 3G86A 3GG1A 1REVB 2YX1A 5D4OA 1REVA 3W64A 2Y9HA 2NZ4A 3GIMA 3DGPB 2PA8D 5M2UA
chains in the Genus database with same CATH topology
2MSSA 3CJ4A 2HRYA 4IH5A 1D9FA 2HWTA 3DGPA 2WW8A 1MU2A 3K57A 3H4DA 3HJFA 2MKKA 1OQ6A 3H5YA 3RTVA 4FNHA 4UOCA 3KK2B 4F4YA 1T95A 4HTJA 4K4VA 2EBGA 2R4FA 3MUMP 1UJ5A 3GYXB 2YKPA 3KK2A 5T7LB 1FXDA 2IJNA 4WCEQ 3PV8A 4NRUA 5T7LA 3CD7A 4NLPA 4I7FB 4IH7A 5LSLA 3CT9A 1AROP 1KHVA 1S1VB 3ICLA 5EWGA 2KM8B 3H4BA 1TV6A 3LWMA 4I7FA 1FE4A 1Y00A 3PW4A 1S1VA 1K9MT 5J2NB 3DRYA 2VPWB 3MD3A 4C0HA 1IJEB 3LPYA 1S6UA 2HVIA 1Q82T 3HI9A 1SJ3P 5J2NA 4RNFA 1NKEA 1O0PA 1RT7B 2KYXA 2M88A 2WBRA 4X62F 1LXJA 2R2UA 2D41A 1IJFB 5AXMA 2UUTA 4EZ6A 3Q23A 4GO5X 5IT0A 1RT7A 1FCAA 2FC8A 4DL2A 1IBMF 2AYGA 1R89A 2BW2A 4TU8A 2JRSA 3J81Y 1LQ9A 2BZ2A 4CO4A 4L72B 2VFRA 4ICLB 4DUYF 1FXRA 2PDAA 4F3MA 2ADBA 3TNVA 2CPJA 4ICLA 3HK2A 4AQYF 2O01C 4YB7A 1SJQA 1K0TA 4QWBA 5L9XA 2NUHA 2ZNYA 2VB6A 4JV5F 3DNCA 1JJHA 1KRPA 2MXYA 5A8RB 3MM8B 3T6BA 5D77A 4HT5A 3MGJA 1MROB 1IXKA 2ZD1B 4P2SA 3MM8A 1H98A 4KC5A 1N56A 2AJQA 5KT7A 1MROA 3RU0A 3MOZA 2F9JA 2B4OA 2DNKA 2PI5A 1UVJA 2BACA 2QE5A 4FS2A 5T14A 4NA3A 4CT8A 1JWWA 2WCXA 4NA2A 5J2QB 4DV2F 3W7BA 3CCMS 1HNZF 3DU6A 2HLUA 4F25A 1Q4RA 4XAKA 2F1FA 4O0IA 5J2QA 4B3OB 3QYYA 4ZCIA 2IA6A 1U48A 4B3OA 2VPZB 3PVXA 3S8SA 4DQPA 1S99A 3PJXA 1T02A 5M2PA 3AQPA 2LEAA 2FJDB 2J0QD 1SH3A 1YRUA 3HVWA 2N7YA 4DN9A 4YR0A 1S6QB 4QW9A 3T5LA 3UPFA 3K5LA 4DV3F 2HNYB 1S6QA 2GHWA 2ZHOA 3SSQA 4AUKA 1NHVA 3W2WB 2DT9A 4DDFA 3OUYB 1C4AA 2YNHB 3JB9k 3N6LA 1P1TA 1F5BA 1V3ZA 1VFJA 2HNYA 5KFNA 4UUXA 4KPYA 5KFZA 3W2WA 3OUYA 2YNHA 2WB4A 2HVZA 3ETOA 2E44A 4ES3A 5HN0A 3M8SA 2FLPA 2OLWA 5KFGA 1D0EA 2EI5A 3LGMA 4BDPA 3C66A 3FEZA 5BJRA 4Q45A 5J2PA 1HW8A 2J0SD 5KG6A 1YITS 2VODA 1XR7A 4OZJA 1S1UB 2VUGA 4TYBA 4DSEA 2AGPA 2BR0A 4K4WA 1S1UA 2NUUG 3QGIA 4Y2IA 2DNHA 2CZVC 5KFEA 3NS6A 3JSYA 2LQJA 1LK5A 5D3GB 2ALZA 3Q8RB 2IC3A 1NJZA 3OTOF 3IAM9 4OX7A 4F8RA 4M1KA 2CPYA 2W4CA 5D3GA 1DLOB 3NLCA 4B3TF 1XTZA 2RD5C 3UCZP 1H6KX 2JLFA 3PRDA 4PRFA 1DLOA 1YRXA 1I1GA 1LV5A 2P9CA 3LW5C 4B9VA 4URSA 1RA6A 4TLRA 4QBUA 5CCLA 3IG1B 1LWFB 2CJ9A 3D0GE 3MR2A 3JSMB 5ITHA 4F3OA 1YRTA 3IG1A 1LWFA 5CXTA 2UUWA 3SCKE 3JSMA 4QU7A 2HHXA 3IS9B 1LWEB 4QIEA 2B6AB 3SYZA 4LIRA 3IS9A 3CC4S 4ZPDA 1KLMB 1LWEA 1P6TA 4BHQA 3IR7B 1RAJA 4U67Q 2B6AA 1VRTB 1EETB 4J9MA 1KLMA 3G6ES 4B9SA 2HIQA 5FDLB 1VRTA 1EETA 2EG2A 4XDDA 5A0YB 2A1BA 1TKDA 3DLBA 3VAMA 3PZPA 4ILMA 1FF2A 1RT4B 2GIQA 4ZPBA 5FDLA 4C3KA 5A0YA 4ITSA 2OFGX 4DPOA 2LQ9A 3HDSA 3C8YA 1RT4A 3DYAB 2Y1RI 5B0EA 5I3PA 4HL9A 3D54A 4MYTA 4H4OB 4HH1A 3H59A 3DYAA 4ELVA 1HI0P 3MM6B 3I5AA 2O5DA 4H4OA 1Z2ZA 2WBMA 4XIUA 2POKA 2JC0A 2YNFB 1DQ9A 3MM6A 2OTJS 1JLGB 1X7VA 2VD3A 2YNFA 3UFCX 2KB2A 2VKRA 1OSDA 3EUNA 5GAGI 2KG0A 1S79A 4WU3A 4IRDA 4OHWA 2CPFA 1TFYA 2D3OR 3MEDB 4C11A 4Y0FA 2NSBA 1RI7A 1BY9A 2OO4A 3MEDA 2MY8A 5F9LA 4JI4F 4O4GB 4BWMA 3X3UA 1WG4A 1XR6A 4M63A 3DOKB 3DM2B 4O4GA 1VC0A 4EZ9A 2Q6BA 2RT3A 5KFWA 2ZH4A 1N4LA 3U1LA 1D8ZA 1VQKS 3DOKA 3DM2A 4O4RA 4OLOA 4PXCA 2BA9A 2WSCC 1QAJA 1S1XB 2GNKA 1RGVA 2DRAA 3EXYA 2QEXS 4OX8A 2R7RA 2U1AA 3G8TA 1S1XA 3LUYA 3MECB 3H5UA 4JV0A 4RW9B 4EUVA 5EX0A 3I0RB 3LAKA 2ZUGA 3MECA 2I38A 2BE2B 4RW9A 3I0RA 2XNRA 2VOPA 4X4SA 2BE2A 2XO7A 1YGYA 3NCRA 3QPIA 3HHEA 4AL7A 4DQQA 4ED0A 2IRUA 2KT2A 5F3ZA 2DHXA 5J2MB 3OHBA 1OO0B 3NAIA 2YH1A 1SL0A 4X4PA 5J2MA 1VQYA 2X1AA 3LP1B 3K7RA 4XPCA 4QIGA 3EPIA 3LH2S 2OKQA 2AJ4A 2LDIA 1N5VA 5E5NA 1FRIA 3AB2B 1FNMA 2C3OA 2DGQA 3DDNA 3R1HA 3Q2TC 2N7CA 1Q53A 1SIWB 2E7XA 2JL9A 2CJQA 6FDRA 2LQBA 4K5SA 2IMOA 4LT6A 4K4YA 2P6TA 1QAYA 2K1RB 2B7BB 4WZQA 1VQSA 2FD2A 4UY8T 3CCQS 1NJYA 2K1RA 4ZK7M 1BD6A 4WZMA 4NMLA 2RVJA 2DRBA 1NO8A 3JSBA 3OR1B 3C6TA 4DV6F 2ZH7A 4DSLA 4NZ0A 5JJBA 2ZM6F 2N82B 3IR5B 3PO5A 3OR1A 2IJFA 4ED7A 4JI0F 1WTBA 1Q7YT 4PQUB 3H8YA 2VFTA 3GQCA 1TZ0A 2HNZB 3NGKA 4C0BA 5F0WA 4PQUA 2D9PA 4FVCA 3FQLA 5AXKA 1HHTP 5B7WA 3PDNA 5DG7A 4C97A 2BDPA 2M52A 3PM9A 3CPWR 4X2BA 4NLTA 1SJ4P 2KHDA 4ERDA 1CC7A 2BM0A 1FDBA 1G1XA 2LVWA 3CWJA 1S9GB 2EFQA 1E6VB 1CC8A 1S77D 3HMJG 2V94A 4FF3A 1H7WA 1WHXA 2XMMA 3HFKA 4M8LA 3TUZC 1S9GA 4XO0A 1E6VA 2LECA 2XG8A 1XERA 1S4FA 5L38A 1DZ5A 3J7Z5 1S76D 2PI4A 2NPIA 2DO4A 1DTQB 4N8NA 2W7OA 4PG5A 1VOMA 1HI8A 2P9EA 4H4MB 4WJBA 3RRGA 1RA7A 3B4MA 5B0BA 1QM9A 3DLHA 4FF4A 1DTQA 4HDGA 3THTA 2VBYA 1VS3A 4H4MA 4D3GA 3NNAA 5EWFA 2CG4A 1LK7A 4O23A 4X4TA 4HVZA 1LFPA 2JOQA 3WX4A 5HMWA 2JH3A 3QWPA 4KBIA 4B9LA 4M95A 3IGVA 2AV5A 5L39A 3O1LA 2XLKA 1QTMA 4D3HA 4G1QB 4RNNA 2IAJB 3S01A 1X5OA 2OSRA 2P5VA 1WI8A 2RU9A 2JC1A 1FD8A 3PFEA 3BM7A 2YKOA 3R27A 4G1QA 4MIWA 1N52B 1RKIA 2IAJA 3PX4A 3NNHA 2CPIA 5J1NA 2CIMA 2PGCA 2DJWA 4R0JA 3OVBA 3M9NB 3UW1A 2O1PA 3GFYA 1VQ5S 4O3SA 4NZ6A 4OX9F 2JX2A 3PJWA 1HFEL 2I2YA 1LKZA 1KQSR 1OQ3A 5KFMA 1RWUA 3N01A 3M9OB 1QE1A 1TP7A 3KHGA 2CQDA 1TUVA 1T8EA 3UNGC 3B4DA 1Y5IB 2M9KA 3G6VA 4RWWA 5KFXA 3TOQA 3TUIC 4K59A 3KKFA 4USIA 1RT1A 4A8SA 4R25A 4ZP6A 2KFZA 1O8BA 2B0GA 4O3RA 3KG4A 4KT0C 3PKMA 3VTIA 3DRRA 3BB5A 1E6YB 2LCWA 3IA0A 3T5JA 1SKWA 2DIUA 3MR3A 1E6YA 3H98A 3U02A 2AGQA 2MQPA 3BSAA 1MWZA 1SUQB 1T3OA 1WEYA 3BZQA 2CKWA 4LF8F 4ZOSA 1SUQA 2ROEA 2C2RA 3AJ1A 1T7PA 4HI1A 2ZZMA 5KG2A 2HW3A 2E9ZA 4HHJA 4DL7A 4FBTA 4B3RF 3RRHA 4RNHA 2VA2A 2DB1A 3O3LA 4B9MA 2DHGA 4IO1A 4LIWA 5D6GA 1NK9A 4DL4A 1ZM4A 5G0RB 4RW4B 5EWEA 2YWHA 1IBKF 4ZMMA 5A2QY 4ZA1A 2R8JA 4BC9A 2N3LA 3LP0B 4PG4A 2HMIB 5G0RA 4QWAA 4RW4A 1S10A 1OS5A 4ES1A 1U6BA 2GFFA 3T5HA 3NL0A 3LP0A 2HMIA 2HHTA 4I6AA 1BQMB 1ZAVA 3S7RA 4ZP7A 1PC5A 5LL6d 1LOUA 1BQMA 4KHRA 2G9OA 3OFEA 5K8MA 3T3FA 4V19J 4WK3A 3KK3B 3LO3A 4FF1A 1T94A 5DG9A 2M2BA 1J5OB 2FPHX 2F8EX 3KK3A 2AJ1A 5DDPC 4O3NA 2IM1A 2R7WA 1J5OA 2RKIB 2YNGB 1H3DA 5HMYA 4I56A 2V8GA 5JXSA 4K4SA 2AF6A 3CGIA 4DR4F 2RKIA 2YNGA 1SL2A 1MWYA 6FD1A 1S9FA 2UVRA 1ZTTA 2I0XA 4NYZA 2E1AA 3CVKA 4FNIA 5HO4A 3MTKA 1UETA 5KG1A 5E2QA 1RK8A 4W92B 3K59A 2WAQD 4QWDA 5FJ4A 4DSJA 3JTPA 3EGZA 4WKRA 4C98A 3OXFA 3CDEA 2MZ1A 3KFWX 2ZHAA 2JSXA 1B64A 1MSWD 4ZP8A 3J80Y 3V5RA 2RUGA 3BDEA 2C3PA 2E66A 1DFDA 3MM7B 3IWXA 5DRKA 1X4GA 5I3UA 4A8QA 2DNMA 3MM7A 1DQ8A 5I3UB 3VZHA 3G71S 3VAHA 1S49A 2MQNA 3M2UB 5H9FJ 3Q8PB 3KYLA 2DD8S 1YTYA 1UJ6A 4ID8A 1RQ0A 2RSQA 2QYCA 2Z8QA 3HHLB 4BCAA 5K8PA 3G4SS 1JLFA 5IFMA 3FGVA 3M2UA 5HL7Q 1VQMS 4DV0F 2RNEA 2FVSA 3HHLA 2G1DA 4Q44A 4CH7A 2XI3A 4ED5A 4X65F 2A2CA 1U1QA 1XC9A 1FRKA 1FDNA 2DR9A 4C9DA 2OIHA 4AFFA 2E1RA 2IRXA 4TY8B 1VQLS 1NZAA 5DETA 1SI9A 5AJ3F 4LSLB 3OSPA 4M94A 4TY8A 3P49B 4K4XA 2BQ3A 2MHNA 3H2VE 4TKTA 1HNWF 3VAKA 4ZCKA 5IS2A 4LSLA 3VR1A 4B02A 3LWLA 5EN1A 1KSPA 4OMFG 4RBVA 2P6SA 1ZZFA 2KT3A 1Y5LB 4Q8FA 1D9AA 1TK8A 2K3IA 2YX4A 4KTQA 1IKVB 3M8QB 1TL3A 3VAJA 3BDPA 1DAXA 2DGOA 2PFFB 1U49A 4Q5VA 1UW4A 2ABYA 1IKVA 3M8QA 4ECUA 4LF5F 3HZEA 1G2EA 2RDJA 1C1CB 5LT5A 3O2IA 3BO3A 3K5PA 2I1RA 4ED8A 1WWHA 2GHVC 4QWEA 1C1CA 2W4DA 1TK5A 1QUVA 1UEVA 1T05B 2MB0B 2IM0A 3HZGA 3K58A 3N5BA 3LOUA 1T05A 7FDRA 1UEUA 1L3KA 3AA9A 1LW0B 4FVMA 2XMTA 2MHEA 5BYSA 2RH3A 4A8FA 1VQ6S 1FJEB 4ZPWR 4EWTA 1N8RT 1FNXH 1LW0A 1AXQA 2U2FA 2B9XA 2D3ZA 4WIIA 3I4HX 4J9QA 1UMJA 3RR7A 3SQGB 4X4VA 3HXMA 1S72S 1Z4UA 4WE1B 4F4ZA 2QV6A 4PKDB 2XI2A 3SQGA 4ZLPA 2ADCA 4WE1A 1Q79A 2GMLA 2P9GA 3V6KA 3ONQA 1VK8A 3RW6A 5F8JA 3ZFVA 3PW0A 3DRSB 3MMAB 4X66F 1KN6A 4I6YA 2EFVA 2RMLA 1X8DA 3DRSA 3MMAA 3TQ1A 1U47A 4FN5A 2KHCA 2V5HG 3TAPA 3SSRA 1MMLA 3RAQA 1S7HA 4N8OA 3PW2A 1NK7A 1HWLA 4U6PA 4ID5A 4A46A 3CUNA 3THVA 5DG8A 2GHPA 2MJNA 4G1IA 3EYZA 2JEJA 2R8KA 3C46A 1IKXA 3ZZZA 4WFAQ 5HLFB 4PXBA 1QAXA 4QYZJ 2ZH1A 2LEPA 3HKZD 2IA0A 5HLFA 4PR6A 1FJGF 1FKPB 1HWKA 5KFBA 2KTQA 3AB4B 1L5UA 2G4BA 5E3AA 4KGKA 2VG6B 3BGLA 4GO7X 2E1MC 2HWIA 1FKPA 4YFUA 4OJHA 3BSOA 3BEGB 4OI3A 2VG6A 4ZP9A 3NS5A 1S1WB 3C6UB 2PIIA 2GQ2A 3M2VB 4GMKA 3WC0A 2B7CB 1S1WA 2DCLA 3C6UA