1BWEA

Artificial fe8s8 ferredoxin: the d13c variant of bacillus schlegelii fe7s8 ferredoxin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
AYVITEPCIGTKCASCVEVCPVDCIHEGEDQYYIDPDVCIDCGACEAVCPVSAIYHEDFVPEEWKSYIQKNRDFFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PROTEIN (FERREDOXIN)
publication title Solution structure of an artificial Fe8S8 ferredoxin: the D13C variant of Bacillus schlegelii Fe7S8 ferredoxin.
pubmed doi rcsb
source organism Bacillus schlegelii
total genus 19
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bweA00
1PC4A 2VPXB 1XERA 4ID8A 2WAQD 1FDNA 1BLUA 3OR1A 3MM9B 1FXRA 1H0HB 2FGOA 4RKUC 2PA8D 4L6V3 2WSEC 1F5BA 2C3MA 2VPZB 2C3OA 1GT8A 1WTFA 2WB1D 1SIZA 3MM8A 3C8YA 2PDAA 1B0PA 2Z8QA 2C42A 3LW5C 4KT0C 1FDDA 2VPWB 1DFDA 3MM6B 2C3YA 2XSJA 2C3UA 1BQXA 3MM7B 1KQGB 2WSCC 2FJEB 5BYQA 2V2KA 2WSFC 1IQZA 3OR2A 1A6LA 2ZVSA 1FD2A 1FEHA 1G6BA 1GAOA 1KQFB 4DHVA 1G3OA 1H98A 2FJBB 1BC6A 3MMAA 1FDAA 3MMBB 1VJWA 1HFEL 4AYBD 5CHCB 1FTCA 1B0TA 1BWEA 1C4CA 1FRXA 1FRMA 1FXDA 3PNIA 1AXQA 2Y0SD 3MM5B 1RGVA 2V4JA 1JB0C 5E7OB 2VKRA 1FCAA 4OMFG 4CI0B 3MMCB 1F2GA 1FRKA 7FDRA 4OV1A 3MM9A 1CLFA 1ROFA 3HKZD 6FDRA 3IR7B 1C4AA 2FJDB 4XDCA 2UZAA 3EXYA 2C3PA 3OR1B 2GMJA 1R27B 1Y5NB 1Q16B 6FD1A 1B0VA 1FRHA 2FDNA 3MM8B 5BYRA 2VPYB 3EUNA 1JNZB 3MM6A 1K0TA 3MM7A 1Y4ZB 2O01C 1H7WA 1FRLA 1D3WA 1BD6A 1FF2A 2XSJB 1Y5IB 2FD2A 1FDBA 2GMHA 3EGWB 1SJ1A 5CH7B 3OR2B 4Y28C 3IR6B 1FERA 4XK8C 1GTHA 1GTEA 1KEKA 4YDDB 1DURA 1FRIA 1H7XA 3GYXB 3MMBA 5BYSA 1SIWB 2IVFB 3MMAB 5FD1A 3MM5A 1JNRB 1F5CA 1IR0A 3IR5B 4XDDA 1DAXA 2PMZD 1PC5A 3MMCA 5L8RC 7FD1A 2V4JB 1FRJA 1Y5LB 2FJAB
chains in the Genus database with same CATH superfamily
3T5LA 2XLJA 5HK4A 2P2CB 5J2NB 1NJYA 1SUQA 4LF4J 2C2KB 5FDLB 3PRDA 5I3QA 4MH8A 1XNRJ 1VQ8S 1UA1A 4I6AA 3BH7B 3SQOP 2YX7A 3Q8QB 2FC9A 3GIMA 4BDPA 2AYBA 4Q5VA 1PSDA 1MMLA 2WRMA 2MGZB 4M5KA 3Q8VA 2LEBA 1HMVA 4CNZA 3MEKA 2QT7A 2WK4A 1IBKJ 5J1EB 2HHHF 5HLFA 4DUYF 1QE1B 2HZVA 1Y7PA 1FE0A 1PJ6A 2H9ZA 4F0HA 4ED7A 3C46A 2FHJD 6AT1B 5T7LB 3Q83A 2XMUA 4ZDNA 4PG4A 5A76A 2PT0A 4ZK7M 4N8OA 3TRGA 4IDKB 2G2OA 2XS2A 2DXDA 1D3WA 1CSJA 2XSJB 4AXIA 2HIQA 3EGWB 4Y3CA 4OYOA 1T3NA 4CTAA 1WOOA 4RUCA 2D3OR 3WIUA 3EVWA 1OY9A 3G96A 1X4CA 4J9MA 1AUSL 1S9EB 5KFMA 2W9BB 1GNKA 1OPIA 3M8PB 4C0BA 1FVSA 2B4VA 2QEXS 3UVJA 1FKPA 2HHHJ 5LJ5Y 4DUYJ 1YJVA 3DRRA 1TL7B 1RHMB 3W9JA 3FMWA 4QOTA 2KT2A 3PW4A 2XS5A 3OTEA 5F8JA 2KU7A 1TFYA 1RT1A 1RT3A 3P96A 3MMCB 1RJJA 3RAQA 4MKBA 4B9LA 3I32A 1RTHB 4WFNQ 2OHDA 1NSAA 1SC1B 1QD1A 2FYXA 1JQGA 1S6OA 2XYPB 1HL6A 2PIIA 1BE4A 2QFJA 1W2BR 1IR1A 3DNCA 3B54A 3MMBA 5ETRA 4NCBA 4C11B 4DR3F 3UDVA 2ZUGA 3QLHB 1P1TA 1S6QB 2BV3A 4K4ZA 2I38A 1N6QB 2BE2A 4DL6A 2DNMA 1AW0A 2VBXA 5GAHI 3U1NA 2ZZTA 4WTOB 4ED4A 4F4YA 2DGVA 3FZ2A 4DFJA 3KHGA 2XM3A 2IYIA 3MM7B 5E3PA 4B02A 4LSNB 1HBOB 2RDIA 3HVWA 4AQYF 2ACMA 2F3JA 4PUOA 2UP1A 3DRYA 1F9FA 4E98A 2R2SA 1T9UA 2NXCA 2A6MA 4JBCA 3CJKB 2QE5A 1YHQS 2GV1A 4O3RA 4PG7A 3VAJA 4MYUA 2RSQA 4TY9A 4YB6A 2HNDA 2HQFA 3J81Y 2PD1A 2QL7B 2V68A 1ZAVA 4IH7A 4ZVTB 1WSRA 1NK4A 2V34A 2H5IB 3FVYA 1RHUB 3B78A 1PGZA 5M2RA 3DDIA 3VAGA 2B9YA 4CNYA 1GXUA 3IN5A 2D7SA 2ZH5A 4CO4A 1DHMA 1NDCA 2AWZA 4B9SA 2E1PA 1NZAA 3V5RA 2CQ3A 3NWRA 2FJEB 4KSEB 4H4KC 3QFHA 3KDOA 1VK3A 4EBDA 5B0EA 3B82A 3B4MA 2HFOA 4CLSA 5EN1A 1Y0HA 3CMAS 2MQQA 3MAHA 2W9AA 3NGTA 3RAXA 3KNGA 3OV7A 4RX6A 1S7HA 5IC4B 5J2PA 4QWCA 1JK9B 3M2VA 3T41A 3N28A 2GMHA 1U1RA 3AAWB 1F6TA 2CRLA 1YJ9S 3CCLS 2IVFB 1S9FA 3MMAB 2I0XA 3A3NB 1VQKS 1S1XB 1RAJA 4NLTA 1HBUB 4RKUC 1U1QA 2VJVA 1NHUA 4ZPBA 4B9TA 3V6JA 2P9EA 1QJHA 3C16A 4MMOA 4O3NA 4CYUB 4LF5F 4TU7A 2OO4A 2VFVA 2RIJA 4UUWA 2B8QA 1IBLF 4JI6J 2G2YA 1AFIA 3LP1A 2DRAA 1JKHA 3TAPA 1Q8BA 1PKUA 3BN7A 1HNVB 3GONA 2GJ2A 3M8YA 4LRCA 3LF0A 3IO1A 4TLRA 3HSJA 2A10A 4YHHF 5F8LA 2DNQA 3C6TB 3TWZA 3OUYB 1W25A 2HFSA 1H2TZ 1MG7A 1CJUA 3J81j 5K14A 5KFNA 1O6XA 3O44A 4PXDA 4WFBQ 1SC4B 4O3SA 1UJ6A 1KQSR 4M94A 4M5JA 1XWLA 5CYQA 4HEA9 2LQ8A 1RT4A 1U1KA 4PKDB 3RB4A 3RB6A 4I68A 4XDDA 3SDEB 3CDAA 2E9TA 3MEEB 4P75A 3TAQA 1QAIA 4LF5J 1HIYA 2JEJA 1NMEB 2IDEA 2BM0A 3FSXA 1IKXB 3DFEA 2JC0A 2WW4A 2Z30B 4PG5A 5M2UA 3RW6A 2E7VA 2HFZA 2OPSA 5HJYA 3TQEA 1M0SA 2XSFA 4YHHJ 2OEKA 5EX3A 4ZP7A 4A8KA 2IRYA 1N5VA 2HBYB 3E8OA 1BWEA 2APOA 1X9SA 2W01A 5LXYA 2XMTA 3HCXA 4IO9Q 5J2NA 5JVGQ 2G0CA 1WG5A 3K8VA 2VBYA 5FDLA 2XC9A 4PYDA 3CC2S 1KOOA 4C97A 5ETNA 3H7HB 2DRBA 3A12A 3UDLA 1FRLA 2MGZA 1BD6A 2HHVA 1M90T 3QRQA 2KG0A 2ZOMA 1VBZA 3TZYA 3CT9A 2HFNA 4RL1A 1B7FA 1RWWB 3MXHP 4QIVA 1JJHA 1X5TA 4LSLA 3MECB 1DRZA 5J1EA 4DV0F 1QE1A 3GV7B 1YK9A 2W8LA 2ZH1A 3FEYB 1RT2B 4P2SA 5T7LA 3U02A 3GE9A 3TVYA 3KK2B 4IDKA 1LQ9A 4QIGA 3BH6B 4DI6A 2XG8A 3NMAA 1QAYA 2XSJA 1DLOB 3VGVA 1K1QA 3PR5B 3OVBA 2BOPA 1W2IA 2NSCA 2CPYA 1IM4A 1G3OA 4J9PA 1E6VB 4OZ2A 4NL5A 4L3NA 3GFYA 2YWFA 3PNIA 3S01A 1WF2A 2QLWA 1S9EA 1HNZF 1CJTB 3SZ2A 1FRKA 3CCUS 1Q8LA 2W9BA 2LDIA 1R8BA 1X4FA 1F0XA 3M8PA 3QGPA 4JI3J 2AW0A 3GZ7A 3T5HA 1PILA 4DV0J 2FDNA 4BC7A 3D0IE 2DVIA 1TL7A 1YJWS 4O23A 9ATCB 4F50A 3UQSA 1FTRA 2R7RA 2HLUA 2RU9A 3EICA 1BHNA 1WI6A 4J9NA 3EMTA 1KVJA 3BKUA 3UE2A 2EKNA 3R97A 3T19A 5KT2A 2J0XA 3MMCA 2KH9A 3MOJB 1FXLA 3W60A 2VPXB 4IO1A 1RTHA 1YBAA 4WU2A 3DMJB 1XK8A 2BE7D 1H0HB 2HGNA 3KLVA 2OP5A 3CD6S 4F4XA 4ELVA 2CJXB 2CQ2A 3IBCB 3OHBA 1FNMA 4J7CA 1CEZA 1U1LA 1HNZJ 2WSCC 5KAKA 1Q79A 4FVCA 4HYKA 3IAM9 5A2QU 1N5QA 2AEJA 2XMAA 1KTQA 4C11A 2H5EA 3PHEA 2RD5C 4K4UA 4WKRA 2DGSA 3PHTA 4L76A 3CVKA 3D66A 3QLHA 2ZH7A 1S6QA 3RZAA 1N6QA 3MCMA 4N47A 4KH0B 2K3IA 2VG6B 3EZUA 4WK1A 1WTBA 5K8NA 3HKZD 1AT1B 2BJDA 2UZAA 4OI6A 1Q82T 3LWLA 3D6FB 1SJFA 4C7QA 3MM7A 3CCVS 4LSNA 3EXCX 4LVOP 1HBOA 3W5XA 3R5JB 1GTHA 2V2ZA 2KM8B 1APSA 2F9DA 3E2EA 5L8RC 5L39A 3CJKA 5L1IA 1UVLA 2QZ8A 3A3PB 3GJSB 2IM1A 2DNRA 1HBMB 1FNOA 4EGLA 4KRWA 1GXTA 3E51A 2DNZA 2BW7A 2V0NA 1U1OA 1M1KT 2JLFA 4H4MB 3WIVA 1RAEB 4C8MA 2J0SD 4HDHA 1YJRA 5KOXA 2D1CA 4A8FA 5HBMB 4C6AA 2DISA 5DZ6A 3X1LB 4QU7A 3KJVB 4YQWA 1RQ0A 2BJ8A 1HLWA 5D6GA 3HPOA 4K2JA 5DETA 2QV6A 1KP6A 3JAMU 4TQSA 3WC2A 3CCQS 1UWBB 3QSYB 1R8AA 5K8OA 3MM8B 2VPYB 4U6PA 3P3DA 5F3ZA 3TJAA 1K0TA 2ZVIA 1FA0A 2DH9A 4M95A 3J7ZT 1X60A 2XI2A 4WFZA 3R5DA 2FVQA 1SIWB 3HT0A 3AQPA 1U09A 1CPZA 3US5A 1IKYB 5IT9Y 3NS5A 2C42A 1Q8IA 1GEHA 2Y9HA 4C8ZA 3ENQA 2VPZB 1IJEB 4USJC 2RMLA 1G4CA 1J5EF 3AA9A 3FUYA 4JI1F 1B99A 4X4NA 1XQIA 4UY85 3QATA 1FEHA 1O51A 3NEKA 2VODA 2EPIA 3FC9A 2VDIA 3PCOB 3MMAA 1N34F 2P6SA 2E9RX 2QG9B 3NKYA 2H54B 1S1XA 4KGMA 2KYXA 3ZTQA 3DOKB 1HBUA 4KPCA 3P49B 2DO4A 4PWUA 3E3XA 2MZTA 5HI7A 2CNKB 4QQBA 4W92B 5T41A 2X1BA 1NM2A 3QRRA 4CYUA 3KJNB 2IPOB 3DLJA 3H5UA 4KFBA 2PO4A 1J5EJ 3QRPA 2R7WA 2KO1A 4JI1J 2HKEA 1RYSA 1HNVA 4LF6F 3M8QB 2EK1A 3G82B 4ELUA 3TOQA 1X9MA 3C6TA 3OUYA 2DRDA 5IM0B 4J90A 1N34J 4JV0A 3HFZB 2EBGA 2FUG9 3ZC4A 1RI7A 1OIAA 5KFVA 3R3TA 4DV2J 2VD3A 5KTQA 1TAUA 2ALZA 2B56A 1H98A 2W4PA 1K44A 4FBTA 3I0SB 1N5TA 3W62A 1NBEB 3SDEA 3MEEA 2ASJA 3TJ8A 4FS2A 1RBLA 3IBFB 5H9EJ 3GR1A 2Y1RI 1CC8A 4A8QA 3PX0A 2VQFF 3NGSA 1IKXA 2IFXA 2HAFA 5J2MA 1QSLA 1DY3A 4EBEA 4UOFA 1QDUB 2DITA 4ZJLA 3I55S 4LF6J 2M7SA 2CDQA 3OR2B 3QFWA 3OBIA 4G1PA 1EQMA 1NH7A 2V8GA 2HYIB 1QVFR 4MK8A 1KD1T 4G65A 1PC5A 3H20A 4HTIA 2G4BA 2FHKA 3KLEB 3HD1A 4UW2A 2X1FA 1RAIB 4C4WA 3DGVA 3NOGA 4L6V3 5E0OA 3BV8A 4LJMA 1VC5A 4IRCA 3P4UB 1FX2A 2JJ4D 4WJBA 5CCLA 1SJRA 3MGJA 1UZHA 1UEKA 4FYXB 3CCRS 3V4IB 3UD5A 1TL5A 2HAIA 1NO8A 3MECA 4AYBD 2RVJA 2HVZA 1UPPA 5B08A 3CDUA 5GVQA 2MQMA 1RT2A 2VKRA 3ICLA 1TV6B 3VTIA 4IUFA 3NCPA 5HP1B 1XMQJ 3O6QA 3M8SA 3TA0A 3HZEA 1SJ4P 4R0JA 3KK2A 1Q86T 1REVB 3NLCA 4FS1A 2MSSA 2HEKA 2CAJA 3BGFA 3BSOA 1JJ4A 1U45A 4IG0B 3Q24A 3C15B 2QN6B 2CZVC 1XR5A 1E6VA 3ADAC 4N76A 3WX8A 1U6FA 5KFHA 2H65B 2LDYA 5KT3A 1VGYA 1U25A 3H8YA 4USVA 1CJTA 4B3RF 1UVKA 2V4JB 2HQDA 3VAHA 1UCNA 3SCKE 1WDTA 2W7AA 2HBZB 4CRJA 1P9YA 3MEGA 1FK9B 1WHWA 3NCRA 3CJ3A 4ECZA 1JLFB 3JYTB 4KC5A 2CQDA 1KQGB 1W7WA 3H90A 1WC1A 2YNHB 2DH7A 2YKQA 1RT5B 1YI2S 1M1GA 3PRBA 1T94A 3MCSA 3MUVP 2J9DE 5SUHA 2DIUA 1NRKA 4A8MP 1TK0A 4BS2A 2EEYA 2IY5B 3DHXA 4ZLLA 3JTOA 4Q0BB 3DMJA 3HF5A 2V8HA 3R6GB 3M30B 3UDCA 1JLCB 3GSIA 4GVLA 4J9UE 1UFWA 5AT1B 2VV5A 2J0WA 2ZM6F 4B9VA 5L1JA 2CIMA 4B3RJ 1WDDA 1PBAA 1R7IA 4X4RA 2KB2A 3W2WB 3N4WA 5CCMA 3R1HA 1ZPVA 2VG6A 7FD1A 5IZHA 1UEVA 1SQGA 3UR3C 4YB7A 3QJPA 1C1BB 1VOMA 2CG4A 3HVTB 5KFLA 2CVIA 2AMCB 3KLIB 2BZ2A 4ZVFA 4HR2A 2VPWB 5M2PA 3CJSA 4XPEA 1FO1A 5KFDA 3PDNA 1X31C 2RS8A 3G4SS 2G13A 4OJ3A 1XN9A 3H2VE 3LGNA 4IKAA 2MJNA 5LXRA 4RO0A 2CQ0A 3TNVA 1EX8A 1D9DA 1TL1B 5ITHA 5GMKa 3BKFA 4FPIA 4TVAB 4UQTA 2OD6A 1HBMA 2AGQA 3UNYA 1LK7A 1OSCA 2JC1A 1FWKA 5BJRA 5J2QB 2UUAF 1KOHA 2IJFA 2AYMA 2ZBPA 4YS2A 4H4MA 2LP4A 1HI1A 1YJ7A 4NYOA 2F4FA 4Y65A 5EHHA 4LFCF 2O67A 5HBMA 3NAIA 4MYTA 2YQ3A 3KJVA 2QLBB 5AE3A 5SZTA 1SPBP 1S5ZA 3HFVA 2JHEA 4L75A 4IYQA 1JLEB 1U2CA 4DSLA 3IG1B 1FXRA 4XTTA 4A46A 1RTJA 3DCAA 2B4PA 2XB2D 1UWBA 2I6WA 3MM8A 1M5OC 5KFWA 2D69A 2OPRB 1VQ5S 2DCUB 3MM6B 4C8NA 1NK9A 4OHXA 4IQMA 3W64A 1V3ZA 5DZ7A 3GLJA 3OFGA 1XR7A 2RRBA 2VFUA 1VJWA 4PAAA 1VQSA 3Q89A 2X51A 4EYIB 2UUAJ 3D1OA 1IKYA 1QAJA 1N48A 3CIZA 3N79A 3HHDA 2RQ4A 1SH3A 4YP3A 2XEXA 2CYYA 1C0TB 4NYZA 1U48A 1RHJB 1JNZB 5HMYA 3PKMA 3NG8A 4DBQA 5DQGA 3MPYA 3MCOA 4HLBA 4FF1A 1IR2A 2DNKA 1NKBA 3NGDA 1LFWA 4DV6F 3PR4A 4LREA 2OSRA 2VZ9A 3RBZA 3I5CA 2F4VF 1QM9A 3VQSA 1VRTB 3DOKA 3AOAA 1VISA 4M5LA 4LFAJ 3MTKA 5GADU 3IWLA 3BO4A 3CJRA 5L1KA 3OSPA 1OSDA 3GCXP 2HGLA 3R8YA 2CKWA 2OJ3A 3GQCA 1DZ5A 3DLHA 1H2VZ 4CWBA 1RGVA 3M8QA 3G82A 5ETSA 5KFIA 3KG1A 3ZZYA 1HARA 1Q4RA 1U2FA 2FJDB 4IQXA 2QGFB 2HLTA 3UCZP 5IM0A 3AQOA 4HVZA 4DV6J 1RTIB 4WK3A 4F02A 4QYZJ 2MKIA 2JLGA 3FMBA 3HO1A 2M9KA 4RR5A 2BQ3A 1Q5VA 3I0SA 5LL6d 3GJQB 3FRYA 4ZCLA 2CQPA 4C3LA 4ZP9A 2V63A 4K0KF 1TL4A 5DG8A 2HK2A 2C2EA 5A6PA 2HHPA 1WG4A 1UAWA 3A8IA 1H74A 1AROP 2VL1A 2P9CA 1RWOB 1D0EA 1DFDA 2N4CA 3OR2A 4DV1F 1XTZA 3D1HA 1K9MT 2ZBRA 3MZIA 4K5SA 1Q0NA 4ZP8A 3HMJG 2K1RA 1HW8A 4K7QA 3MPWA 2MQ8A 2FZCB 3GCWP 3OXLA 3Q22A 1RKIA 3U1MA 4ES1A 2GCFA 3KLEA 4DR6F 5B0FA 1AB8A 1Z2ZA 2LEAA 3J7A1 3OSNA 4KKOB 4UF4A 2QMXA 1UZDA 2R9LA 1SJ1A 3KYLA 4DMZA 3V4IA 2PI5A 4KQZA 1RHKB 3VGSA 4OFZA 1QUPA 2EWHA 3ZZ0A 5IQ6A 3CJ5A 3J81U 4TKTA 4YR0A 2F8EX 2G0IA 4NLRA 3FCWA 1KLNA 2R2RA 1TV6A 5HP1A 2KDOA 4DV1J 3V6KA 3HSGA 2W7PA 1H6KX 3HI9A 4C3MA 1REVA 1WOPA 5D15A 3LP2B 2ASDA 4IG0A 3C15A 3I0RB 1R8CA 1R0AB 3CD7A 4ECWA 3D7SB 2IVYA 4KYZA 3BR9A 1IBMF 4IFVB 2XGPA 3CXCR 3JTPA 2PC6A 4NLGA 2V4JA 1WEYA 4I6WA 2KFYA 5IXUA 1FWLA 3BGRB 3D9BA 4PXCA 1QUVA 1JLBB 2R4FA 1FK9A 3DOMB 3S6EA 4B3TF 2IVMA 3OR1B 2CQCA 1BXNA 1JLFA 3JYTA 2B4OA 3I4PA 3R2DJ 2YBVA 2ZEJA 2ZBQA 2CDRB 2YNHA 5BR8F 4KPYA 1RT5A 2AYGA 2RT3A 2ZE2B 1HYSB 2CQBA 4ZPDA 3NY0A 2NUUG 4OHWA 2HQCA 5D0EA 2R7UA 4QR1A 4PG8A 4B3MF 1HNXF 1RAAB 4Q0BA 2MZ1A 2HHUA 5DG9A 3FEZA 3M30A 3SFGA 1JLCA 4KBIA 2WSEC 4DSKA 3H2LA 3JXOA 1N54B 3OTBA 3K58A 1IBMJ 3C8YA 1YG0A 2V4QA 1YLXA 1Y3JA 2W4DA 3I31A 1HW9A 2C3YA 3K5NA 2HS4A 1U26A 3AH6A 3FBCA 1ZZFA 3W2WA 1S77D 2IMOA 3HJVA 1CS4B 2B9WA 5CHCB 3MF5A 3CIMA 3GB0A 2Y8YA 1C1BA 2AJ1A 2PEHA 1RAHB 3ZFVA 5BR8J 3EGZA 3ITHB 3HVTA 5A8RB 5C42B 1U7LA 2Z2MA 2HQ3A 3KLIA 1MLAA 1VBXA 4B3MJ 1S1TB 2LLZA 3HULA 4QIWD 4WYLA 3LO3A 1GX6A 1VQYA 5D77A 2LA4A 9RUBA 4CH1A 5J1PA 1Q1KA 1QAXA 2YKAA 3EZOA 3BS9A 5IT4A 3R9LA 1TL1A 4KB7A 1FJCA 1HQEB 4DL0C 2PMZD 3MPUB 5EWGA 2UVUA 1U47A 5FJ4A 1PC4A 1X4AA 3PACA 3JQMA 2DY9A 2A2CA 2LXFA 2RHSB 5J2QA 1SH0A 1UVIA 2C22A 4IH5A 1P9QC 2YKMB 3F44A 1Q7YT 1SV5B 5HJXA 4NEZA 5H9FK 2CPIA 3NGKA 2MQOA 2ACYA 1KQFB 3AXKA 2LYVA 2W2MP 4K59A 4PYAA 1PYOB 2GS8A 2FB0A 1T7PA 1JLQB 4ZN3A 1VIXA 1JLEA 3HLUA 3IG1A 5C2GA 2VICA 2QFIA 4YY3F 2YX1A 2I5JB 1V5IB 2OPRA 1FRHA 4KHPF 2OMLA 4R0EA 3SCLE 3MM6A 5FLXY 1VR6A 2GW8A 3BZQA 5F3TA 1LFPA 1NK5A 4HT7A 3TP2A 1ZA2B 1IVZA 4EWTA 3T9ZA 1RU1A 1S1WB 1LW2B 2R8GA 3IR5B 2B8PA 4X65F 2VFSA 1ULRA 4PZVA 4U7UK 3MUTP 4DCJB 1C0TA 2ZC4A 4ZVGA 4PWWA 4DR1F 4OZ1A 2MZRA 1KONA 3PVXA 1WC4A 1SL0A 4CO2A 2HRUA 4X64F 4USMA 4YY3J 1TUWA 2R7TA 2KXFA 4KHPJ 1D1UA 3W5ZA 1RE1B 1VRTA 2C2OB 1GMUA 2VC1A 5KOWA 4WFAQ 5CD4A 2RKIA 2W2QP 4ILLA 2CPHA 3ZTOA 3AA8A 2E5HA 2XY7A 3QIPB 2UUWA 2ALYB 3VGUA 4RZRA 3N0VA 2L3MA 4YDDB 2Q66A 4DSFA 4DR1J 1F5CA 3J80U 4WP9A 1VRUB 1VQNS 2ZZNA 4LF7J 3N6MA 3GG1A 1NB7A 5KT5A 2BMBA 4X64J 1VBYA 4P72A 4G3IA 3D4JA 3JAMY 1T9VA 2IBKA 1RTIA 4NLPA 1NJWA 4NXMF 1Q53A 3DLKB 3MR7A 2OMOA 2Z8QA 3ENAA 3CDEA 3FDSA 3QWUA 4OZJA 3ZTPA 2BX6A 3NXZA 1JJCB 3L3CA 2ZFHA 3L7PA 4RU9A 3BQ1A 2ZNYA 4ED5A 2QA2A 3WC0A 4UZBA 1KBRA 4B3SF 1FCAA 5LSLA 1F2GA 5CAAA 4UT4A 2AX1A 1NCLA 4JYAF 3PJ9A 3QMQA 2V2QA 3J7Z5 4P2FA 2WW8A 2NXNA 2E1CA 1NEEA 4U67Q 3PRVA 4G6VB 2CJBA 1HWKA 3R2CJ 5LT5A 4NXMJ 3CJ8A 2OLWA 3IC1A 2V9KA 4ETZA 4Q45A 3SMZA 2F8HA 4DDFA 4MFBB 3K57A 2F5GA 5GAEU 3AJDA 1CQMA 4CM2A 4RU2A 3ISND 3MPDA 1NB2A 4KKOA 3SCJE 4FKXA 4B3SJ 2IHR1 2FVRA 3W2VB 1ZA1B 3Q23A 2MB0B 3RRKA 2AJ2A 2YKPA 4CQ1A 3CO0P 4NLDA 4MTPA 4JYAJ 3OVSA 2R7XA 3WX4A 3AODA 2N3LA 3DRPB 5HSPA 5EUHA 4FBUA 4MIWA 4NRUA 1FXDA 2HFVA 1R3NA 2DGWA 3FCVA 2MSTA 3ZZRA 2CQ1A 3FKBA 1WSVA 2NZ4A 1SL2A 2I2YA 1TAQA 3Q8UA 3LP2A 4DG1B 2B7BB 4CIOA 2B3TB 3I0RA 3W66A 3M6VA 1R0AA 4DPXA 3QIDA 4X4QA 1ZM3A 2OTLS 3CCJS 3IFEA 2PN6A 3ZXWA 4IFVA 1XEZA 2G1HA 4I56A 3TZWA 2WVDA 4NXNF 2XLIA 2V8VA 3BGRA 1LXJA 2XO7A 1LWCB 2MPUA 1FDNA 3DOMA 1BLUA 4JUZA 3OR1A 1SC6A 2BJEA 3UFCX 2GQQA 3ZZOA 3H40A 4M1KA 1K1SA 1T05B 4IR1A 1LNQA 3FEXB 3HHLC 2ZWOA 5IT9U 3ILJA 4KGXB 3GIRA 4Y2CA 2PE8A 2ZE2A 1HYSA 2B51A 1RHQB 1TK8A 4PR6A 2FY1A 1L5UA 5C24B 4OHVA 3BR8A 4DX5A 2MXYA 5D4PA 4OX7A 2LECA 2BBEA 2Y1LB 1SJ3P 2DR8A 3EX7B 3G2XA 1EIYB 3RBEA 3NNCA 2RAQA 4X4PA 2KFNA 4FXDA 3MR6A 2C3PA 3LP0B 2HVDA 4OL8A 2IA0A 2E29A 1RTZA 4PUOB 4NXNJ 1PYSB 3PYDA 3K59A 2L9NA 2I8EA 5A6WA 4RWXA 1FDBA 1PIEA 2Y1JA 4RW9B 1X0FA 4H4KA 1T03B 1X8DA 1CS4A 4B17A 1T9TA 2CNOB 2VQEF 1KRPA 4KHMA 1FFSB 1TZ0A 2W24A 4J9RA 2Z2LA 4URSA 2WTFA 3ITHA 1M5SA 5A8RA 4ECXA 2A3JA 4URQU 1IWAA 2QMUB 5C42A 4ZLNA 4WPAA 1ZETA 1I6JA 2PFDA 4ZLJA 3OL9A 1S1TA 1AZSB 4Z2XA 5DLGA 1NPKA 3KJFB 2FLNA 3NS6A 4P9SA 1GAOA 1Z2LA 2LXIA 1VQ7S 4DPUA 4YOEA 5DLFA 2J7WA 1YRXA 4KO0B 1HWJA 3ILIA 2GQ2A 3F73A 2E7XA 4JV1A 1N5YB 1NDLA 4I67A 3CCZA 1S49A 1N0UA 1KSPA 5KFCA 3CJ0A 3Q8YA 2WOMB 3CO9A 4OYAA 1WNEA 1FNXH 2YKMA 2IDLA 1SV5A 3TX0A 2W4CA 4JI7F 1S0VA 3PEHA 1ZM2A 4CP5A 1RA7A 2V2VA 2Y3YA 3NGUA 4F36A 4NCAA 3GR0A 1S12A 3OFFA 4OX8A 2NXEA 3R7SB 1JLQA 1MROB 5LMUF 3NS7B 4C8LA 4TLQA 3J7YI 1KLMB 1PBUA 2NZCA 4NMLA 2DNYA 2I5JA 4NX9A 2UVVA 2I1RA 3JSYA 2LMIA 3PO4A 5AXKA 3H42A 4DSEA 4RBUA 3KG4A 1DQ9A 4MKVA 4F3QA 2H4YB 2FZGB 4RNFA 1B70B 4TYBA 2W9CB 1S1WA 4DSJA 3A8JA 2DNOA 1BWVA 1LW2A 1B0TA 2VA3A 2AJFE 3PW7A 4DV3J 1H2UX 5ETOA 4JI7J 4EO8A 4IRDA 2Q6CA 3CULA 2RQMA 3WDOA 2XWYA 5ETPA 2MLXA 4DS5A 1GK8A 1X4BA 2B6AB 4FZVA 5LMUJ 2YVSA 3AD8C 4X2BA 2BQUA 3KMQA 1EKSA 1TMMA 1YZ6A 3FBBA 2NXUA 2PI4A 2D9OA 1G7CB 3HK2A 3TUZC 3CDWA 2XMMA 1EHWA 1RABB 2DGQA 1D8YA 2FJAB 1RWNB 2QL9B 5LSRA 3K5OA 1NUEA 2BDPA 4J9LA 4ZVUB 1XNRF 4WKYA 4QJVA 3QIPA 4ANEA 1KS2A 4EU0A 3G71S 3G8QA 3LUYA 5IC6B 5AXNA 1FT8A 3FBFA 2YNFB 2OTJS 4Q7AA 3CC7S 3OJUA 4LIWA 3OJSA 1C4CA 1VRUA 2XHCA 2Y0BB 4WXOA 1FJGF 3QGIA 2JVRA 4L74A 1MWZA 1NK0A 2R8JA 4M63A 2ABYA 2HHQA 2CXEA 3OTCA 2AJ0A 3RB0A 2NUHA 2Y8WA 2GHPA 3DLKA 2BJ7A 4AL6A 4KV8B 5RUBA 1FD8A 2DR5A 2OEMA 4UUXA 4N5SA 3PEJA 4X66F 5JUMA 1OO0B 2VC0A 3T1AA 3K0JA 4D3GA 4LRBA 2VJUA 4CLWA 4DX7A 4LMZA 1SQFA 5KFOA 1YJUA 2O3DA 4O44A 4J9QA 4DJBA 4NMXA 2CG8A 3MR2A 2XCAA 4LSLB 1X9WA 3M4XA 2FVPA 1FFWB 2YWKA 1FJGJ 2DEJA 1URNA 1BQXA 2IJNA 1M5PC 2RB7A 4DX8H 4F25A 2CA9A 2ZBCA 3EZ5A 2YWEA 4MJKA 1RAFB 3VCDA 1IQTA 1HA1A 3MM5B 1HPZB 4MFBA 4MK7A 2KRRA 5A0YB 3NCQA 5DS7A 1CVJA 2HHXA 3CEDA 4X66J 1YBUA 1JLAB 2W1BA 2ZHOA 3W2VA 3I5BA 4U7CA 2YX4A 1V3SA 2J6UA 4AL5A 3DDNA 4DCOB 2YWWA 3DRPA 2RNEA 1K73T 2A1BA 2EI5A 2VOPA 2JSXA 4ES3A 4QIEA 3IRWP 5CZXA 2ZH2A 2O1PA 4P52A 2X3DA 5H1SV 2DH8A 1SB6A 2R2UA 1VYAA 4ZMMA 3N01A 1UVNA 5K9FA 3NOCA 4DG1A 3TVKA 1EB0A 5KT7A 4WIQA 2V2KA 3Q2TC 4ZP6A 4DL5A 3QZ7A 1ACMB 1T9YA 5GMDA 2FLOA 1QTNB 1HFEL 1MSWD 3P8BB 2HNZB 2IRUA 3HFKA 4FVMA 1LWCA 1GFWB 2HRTA 2F7VA 4V19X 4ECQA 5DQHA 2MHEA 2OI2A 4O4RA 3W63A 1VHFA 3QAEA 5J1NA 4YR3A 1T05A 3KOAA 2KFZA 3SXLA 3FQLA 4M5DB 2XNQA 3K5PA 4K4TA 5C24A 4RLEA 2HURA 2YTCA 1PJ5A 4Q44A 3L7UA 2C1EB 4WFYA 1L3KA 2V50A 3OVAA 2AEFA 4A4JA 1UW9A 2WAQD 2CNNB 3LP0A 1RUSA 1TU0B 2GIQA 3LGMA 1X4HA 1QVGR 8ATCB 4DZ6A 5HMXA 2DGOA 1XJWB 3IAS9 3RR7A 4LBIA 1BQMB 4RW9A 4YB1P 1T03A 5C5JA 2K7JA 1VC0A 5I4MA 4GMKA 4N56A 4MKAA 4DPTA 4HACB 4RUBA 1CULA 1NSQA 5KFRA 1VQPS 1T0TV 1N0VC 2VFRA 3OTOF 4C8KA 2GFFA 1WOSA 4C98A 2YXLA 1AZSA 3PZPA 1RLDA 4P10A 3CTRA 4UZCA 1YITS 1TKZB 4DN0A 1WKKA 2CUYA 4O0NA 2HZAA 2M0GB 4KO0A 1KFDA 3M1VB 1WF1A 5E3AA 5IT0A 3GG0A 2WVBA 3DYAB 4NLQA 1ELOA 1N5YA 3GJTB 2IRXA 3CCES 3G6VA 2KM8C 3QYYA 3M6WA 5I42A 2JVOA 2H51B 3RR8A 2PSZA 3D6HB 2MQNA 2XYGB 3PW2A 2WOMA 2B9XA 4JV2A 4MKYA 3H2UB 2ZHAA 1ZAXA 4YB5A 2J8AA 2ZVSA 2VASA 4M5HA 3M8WA 3OTOJ 2ZITA 3HHKA 5E5NA 4YFUA 1PJ7A 4JI6F 2ZH4A 5D78A 1MROA 5K5MA 1JJ2R 1KLMA 3PIOQ 4ZVHA 8RUCA 2BKNA 5B0BA 1RWVB 4CLPA 4V19J 2J6TA 3PY8A 3AB4B 5E33A 5KFJA 2DHAA 1YQHA 3GILA 2W9CA 2DY1A 4LR7A 5IFMA 1HI8A 1MMNA 2RS2A 1N8RT 1DARA 4M5GA 1Y11A 3D2WA 1YDLA 4ZVPB 3EM1A 2DEIA 3NP5A 2GHVC 4Y2KA 5DDRC 1NAQA 2KXNB 2R8IA 3IWXA 2GAGC 2E5GA 3T5KA 2RHQB 5HN0A 4KFBB 3CF5Q 2ZDOA 3GIJA 4CH7A 2B6AA 4Y2AA 1RISA 4DFPA 2R7QA 1F9EB 3VALA 2WSFC 4ZOSA 1KR4A 5KFUA 3C14A 1L3VA 3VZIA 1S97A 4J9KA 1OY8A 2XZDB 3KK3A 3BF4A 1OJ4A 3PFOA 2HGMA 4DU7A 2N3OA 3ZNJ1 4ALZA 3IR7B 5AE1A 2KJWA 4JI4F 3CWJA 3IM8A 1Y9OA 5CYMB 4ITSA 1LOUA 1UKUA 3LQVA 5LOQA 1PO6A 4DLEA 2YNFA 1S4FA 2YWHA 3MDFA 2X1AA 1GTEA 3RYLA 2AHOB 5J2MB 2A2DA 1KC8T 3KDNA 3HKWA 3R5GA 3VZHA 3DXSX 3TYTA 3ZZTA 3TQ1A 2MQPA 4OYPA 3MFIA 2OD4A 2ZWPA 3VF0B 2N7CA 1UVJA 2Z57B 3CCMS 3W8GA 1LW0B 2MY7A 1R8HA 2CPDA 4KV8A 2A0FB 3I9V9 2HFUA 1U8SA 5CXTA 2YKOA 2HZCA 4JI4J 4PPZA 3HM9A 1RT6B 4DXLA 1Z4UA 3GIKA 3TVZA 3VAKA 4BLGA 4E8UA 2GX8A 4JI3F 2FQQB 2EK6A 3H5SA 2IAJB 2DTJA 5FIIA 4Q2MA 3DGPB 1KVIA 2YNIA 5GMEA 4LBPA 1FI4A 3BSNA 2QJ3A 4PRFA 1EKRA 5FD1A 3MM5A 1REGX 1HPZA 3DKDA 5A0YA 2QA4G 3IXQA 3TUJC 4YEAA 5D8HB 2MKKA 2PEBA 3SFUA 1JLAA 2PA8D 2VBWA 4JV5J 3VVUA 4H4OB 4ED6A 1T9XA 2EFVA 3K5MA 4ZS6A 1JX4A 1PCAA 2LCWA 4J5OA 1VQ9S 4DWIA 3MEGB 4ZPTR 2KRBA 2XY5A 2BRKA 3J80Y 4QWDA 4DR4J 3D6TB 3V4MA 4EEYA 3KK1B 3UN2A 2GO9A 1AYEA 1RBOB 4ZHRB 1Y5NB 1NHKL 5KFFA 3OL7A 3DOLB 2QLJB 4Y34A 4RW7B 3BDEA 3VAFA 4DL3A 1D9AA 3L09A 4RW4B 3PV8A 2R42A 3L95X 5E41A 4RBTA 4IOAQ 2HNZA 3QJJA 5AXLA 3GFZA 2MKSA 1SKSA 4ED3A 2AJQA 5FLXU 3PTWA 4LFBF 4GVBB 1ZM9A 2UXCF 3GSDA 1DQ8A 2CJYB 2E1RA 4LIRA 3UWTA 3SV4A 3D0HE 2QX0A 4FP9A 1I94F 1S6UA 3IGVA 1UETA 2UXBF 4HH0A 1TKDA 3BREA 3W5YA 2Q43A 4M5DA 5KFAA 2Z2YB 3MR3A 3K17A 1NDKA 3MTJA 5KG2A 4DUZF 5A8KB 4ILMA 4F0MA 2CJKA 2CZ4A 1FRXA 5F0WA 2V9WA 2LEPA 5ADZA 1GX5A 1HQ2A 4ED8A 2ERRA 5F9LA 3B8HA 3GU0A 4ENOA 4WWSA 2HRYA 1N32F 3EVMA 4NA1A 4XPCA 3M8ZA 4LFBJ 3ZTRA 3EWGA 2UXCJ 2UVRA 1VS3A 1BQMA 1GXLA 1RACB 1NKEA 3FJ2A 1IUJA 1I94J 4X84A 2VKZG 5BYSA 4E0DA 3BBFA 2UXBJ 2EFQA 3EPGA 4W98A 4HACA 1NLKL 4WE1B 1LK5A 4CO0A 4KGZB 2O66A 2CPZA 2BJ1A 2LXUA 4WFXA 5G0RB 4DUZJ 3QGHA 4M5MA 4N7TA 3BJYA 4BCAA 1YZ7A 3OXFA 1W26A 2P8IA 3IA0A 5EWEA 3CJ4A 3SIPB 3LA0A 1TKZA 4L3KA 4PG6A 1RTJB 1CQNA 3M1VA 5F8NA 1N32J 2ATCB 1HKAA 4FNIA 1F60B 3DYAA 5KFSA 1S1UB 4DU8A 5BXIA 5DRKA 2VOOA 1Q5YA 1IM6A 4L73A 3UDEA 3CJQA 1X4EA 4ZCKA 3M6UA 2JFDA 3BGUA 4NCGB 1U1MA 4ED2A 4DPWA 4KR0B 4QWAA 2ROEA 4WCEQ 3CGIA 3HHLD 5HQ8A 4A8SA 1HR0F 2FJVA 5L9XA 2YQ0A 2BW2A 3IRXB 1RK8A 4C3KA 3LPEA 1F1BB 3ENVA 2GJIA 4CLTA 3UPFA 3CCSS 2IMWP 2BANB 2DD8S 3V2UC 3POTB 3KHHA 1P8GA 2AEMA 3DLGB 4ANCA 3O2IA 2DPJA 3EPIA 2BXJA 4Z7YA 3G6YA 4DV2F 3V81B 1KKHA 4OHZA 1NJXA 3PKYA 1HD0A 5KFBA 3PYGA 5DJBA 2FJBB 2WZ1A 2FHMA 1BC6A 3GPAA 5B0CA 4OX6A 1T8EA 1V3RA 4ZLPA 2QL5B 1WEXA 2X1GA 3TUIC 2HNYB 1CLFA 4P7VA 3MD1A 2JDJA 4HTJA 4J9SA 3QO9B 2KXHA 1SKWA 1O8BA 2MKHA 1B3TA 3TUPA 2ZH9A 1BGXT 2DHXA 3QJLA 1HR0J 2RDJA 4CM0A 1UPMB 4K4WA 2DCLA 3RRHA 3HHNB 2AX0A 4ZVEA 3G9CA 3GYNA 2J0QD 1U49A 2W2PP 2FVCA 3V6DB 2WONB 1RDRA 3QBCA 4HHJA 2NCKL 3PFEA 4ECRA 1RWXB 4K4VA 5HO4A 5CYMA 2P9GA 2ZJRQ 3S7RA 2V94A 1S0NA 1KHWA 3SSRA 2DXFA 3KLGB 3KJQB 1X0PA 4NWBA 2IIHA 5LM7E 2HBQB 3IMQJ 1WEZA 4OYZA 2BABA 4LVNP 4IOCQ 4U9RA 2XBPA 1RTDB 4FYWB 1S76D 2WHOA 1T11A 1S0OA 2Y0SD 3PXGa 5HVGA 1RT7B 4NI2B 2QSFA 7FDRA 1X5PA 3LPYA 1XMQF 1WORA 4LUBA 1LW0A 3PM9A 2K1RB 1WF0A 3CMQA 2L08A 4RNHA 2FPHX 2XYHB 4ICLB 3K5LA 3M9NB 1FHTA 3HP6A 3FQKA 4OHYA 4DR5F 2AYEA 1S57A 3KUEA 3D54A 4F4AA 4A47A 1QTMA 3M32B 1KEKA 2ADBA 2BKPA 1RT6A 4W90B 1D9FA 3TX8A 2ZZMA 2ZH6A 4BWMA 4F3MA 4I2QB 5D4LA 2QC3A 3MM9B 2DR9A 3DU6A 3ILOA 3UI3A 3LWMA 1TL3B 4KTQA 1NNDA 2IAJA 2OIHA 2VF3A 2GMLA 3P6YC 3DGPA 3D28A 2C3UA 1CC7A 1RWKB 1UTAA 3HHLB 2B9EA 4IH6A 1VRQC 4RJVA 3KMSA 2KZZA 1NSKL 2W25A 4QCLA 2QYCA 1A0OB 2RUSA 4DR5J 2BE9B 1LKZA 4URGA 1Q16B 4WXWA 4H4OA 1SCJB 2MY8A 5AJ3F 3GV5B 3Q8RB 1YGYA 1B4SA 2G9OA 3TJ9A 3M05A 4B9MA 1GMWA 2VBZA 2ZNZA 4ECVA 3KK1A 4EZ6A 3DRSB 4FYDA 3WHIA 4ZHRA 5KFPA 3DRXA 3N6NA 1SIZA 3ZZZA 3DOLA 1K0VA 2VHGA 4HI1A 2XHWA 4RW7A 4DF8A 1LWEB 4FF3A 2QSWA 3SSQA 3CE8A 2UUBF 4RW4A 1H3DA 3R5AA 2M2BA 5KFEA 3GMGA 2WVCA 5I3PA 2EBEA 1FRMA 1UMJA 2OPPB 4GVBA 5AJ3J 1MN7A 1SXLA 3NRBA 4QR0A 2RH3A 2DHHA 3Q8SB 3BEGB 4I69A 2OSQA 6FD1A 1J5OB 2KVQE 3AD9C 4DL2A 4QBUA 3P5BP 1JXLA 2K7KA 5MLCV 1IJFB 3M8RA 3A1YG 5A8KA 4F2RA 3VAIA 3H25A 5I3UB 4DR3J 4LR8A 1S99A 3DXBA 3OL6A 4FF2A 1IR0A 2UUBJ 3G8TA 5HROB 3MI7X 4ID8A 3KKFA 3BN4A 4UQGA 4XIUA 2DNPA 1YBTA 1WTFA 3BSCA 3H59A 4EBCA 3TR5A 2L9WA 4DX6A 4CLFA 2HVIA 4AQYJ 2KL8A 2XCPA 4CT9A 1U4BA 1DTTB 2JX2A 1SKRA 4WE1A 4ANDA 4DF4A 4C8YA 1F9HA 4ED1A 2KHCA 2OH2A 3HJFA 4OYIA 5KG7A 1QSYA 5G0RA 2FIUA 3WZ0A 2D41A 3HVAA 3WQPA 2JH3A 1Q8KA 4DQSA 4DFKA 1S72S 1Y5IB 3AY0A 3QWPA 2YPYA 4GC7A 3BO2A 1UP1A 3UD3P 1UJ5A 2P5VA 1BQNB 1QLNA 4GO7X 3HX9A 4Q8EA 1S1UA 1BUXA 3GFXA 4OZLA 3DHWC 2JEIA 1MU2B 3ET6B 3MD3A 3CC4S 1D8ZA 1Q95G 4LFAF 4NCGA 5LSOA 1RCOB 5GAGU 1SKUB 3GTYX 2NR0A 1WKJA 4CO5A 2BJ9A 3K89A 2HPUA 4OV6A 5KFKA 3I96A 1U0HB 3IRXA 1VMBA 4RUHA 1RKJA 2E1AA 3O3LA 1NK6A 4RW8B 2BANA 1U6ZA 3POTA 2XNRA 4K4XA 2IM2A 3G87A 3SI8A 2M88A 1N33F 3THPA 2NYIA 3M2UB 3DLGA 1JXVA 4PPDA 3MUMP 1YSJA 2O01C 1H7WA 3V81A 4NLYA 3W9IA 2IBOA 3GYGA 1P27B 5CH7B 2RKIB 3MHYA 1H7XA 5MAOA 2YH0A 2EW9A 1HHTP 1N5SA 2HWHA 3GJRB 1XIQA 3H5XA 2HNYA 3BSAA 3EJMA 1U02A 1OQ3A 4R8UB 2GGPB 3QO9A 3OL8A 2GZOA 2KVIA 1T95A 1HQUB 4EZ9A 1B0PA 3D3CJ 4A8YA 4O3QA 3BYPA 1N36F 2V67A 4QWEA 3W61A 2I9SA 1N33J 1J27A 3ONQA 3CJTA 1FTCA 3NGRA 1IBLJ 4P73A 5E3RA 3V6DA 2WONA 2UUCF 2QMWA 1FKOB 4RNNA 1HWIA 3R27A 3HZGA 1Q81T 1KVKA 3R5CA 2NQPA 4X4UA 2VG5B 2YKNB 1F3FA 3KLGA 5BYRA 2ILZA 3MPVA 2J5AA 4O0IA 1PAEX 2M5YA 4KGVB 3K7RA 2MMYA 2KJVA 2GVZB 1RTDA 5B7WA 3L9ZA 1EARA 4XO0A 4LT6A 4NLWA 1RT7A 2V69A 2RQCA 4NI2A 2AJ4A 4KH1B 3NAHA 4Y0FA 1N36J 5B0DA 2COLA 2UUTA 4YMEA 3OT9A 1YVFA 4LQ9A 5HATA 2HG4A 2PDAA 4ICLA 4KT0C 2UUCJ 4QZVB 3I56S 1EETB 3M32A 4DHVA 1FX4A 1KDNA 2DBBA 2XQCA 1JXEA 3IBWA 1YJTA 5KG3A 3DLBA 2UXDF 2BACA 4OYMA 3RUBL 4I2QA 4B08A 2M8HA 3C3LA 4TU8A 2JNJA 1SJQA 3MM9A 1JLGB 4CO3A 1TL3A 1R27B 1AUDA 1RAOA 3HHEA 4Y00A 4NA2A 2N4DA 1Y4ZB 3HHLA 4K4YA 5KT6A 1YJNS 3DC2A 1UEUA 3EE3A 4GC6A 1LV5A 1OY6A 2B43A 3GWCA 2ZKUA 1K8AT 3OHAA 1U24A 3JQKA 2YPZA 5JXSA 1D09B 2MKCA 3R7NB 4OZ5A 4AUKA 3QZ8A 4CLYA 2GA7A 2AGOA 1SL1A 4LBHA 3R7BB 4B3OB 2GIRA 1XNQF 2UXDJ 2LFVA 2E9ZA 1FFGB 1IXKA 5HQMA 4NYPA 2MHNA 4DOZA 1SQEA 3M9MB 3N6LA 4PWDB 2ZJPQ 3Q8PB 2GIFA 3MFHA 2Z56B 4HDGA 3W8PA 2BA9A 3QQCD 4KJIA 1TUGB 5ETLA 4ZPAA 3DRSA 3HSZA 3BBCA 1DTQB 4P7TA 4DV7F 4U7UD 1LWEA 1SH2A 4HHHA 2FGCA 2AV5A 4AFFA 3TA1A 2O5DA 5F8GA 3X3UA 2JZ5A 5EDWA 1S0MA 3IGNA 1U1NA 5KG5A 4WYWA 3SCIE 2KKHA 2DGXA 2OPPA 3ZZUA 1XNQJ 5L1LA 3UN5A 1NJIT 5GAGI 4QW8A 4AT1B 2KZMA 5D4NA 1JWWA 4TYAA 3GFHA 5AE2A 5HANA 2QA4S 5K8MA 4TNOA 5HVFA 4IRKA 1J5OA 4G1IA 2OEJA 3I87A 3N5FA 4DQRA 2XTJP 2MLYA 3IM9A 1VQ4S 4EFAC 1UW4A 1N52B 5JJBA 2Z4PA 3Q0AA 5I3UA 4ZPVR 3K8WA 2RRNA 4ES2A 4DV7J 1TR0A 4LF1A 3SQGB 3W1YC 5HROA 3JTNA 1MW7A 2N7YA 2HWTA 1NZ8A 3FCHA 4LF9F 1ZH5A 2CPJA 1B64A 2RQKA 2V8PA 4RPFA 3I82A 3MOZA 2BJ3A 2VG7B 1UWAA 2FHJA 4DEZA 5GADI 4DQIA 2NXJA 2W7OA 4Z37A 4OYXA 3EVOA 1PG5B 2IYGA 3AD7C 3T9NA 2JOQA 1DJ0A 2CQIA 1JIHA 3NBPB 1DTTA 1I3OB 3CCWA 2BR0A 4HHUA 2R8HA 3U1LA 1KN6A 4FDFA 2V6AA 2UVWA 4JI0F 1PYTA 4USTA 5CD4H 2M8DB 1PAUB 2Q3PA 3O8WA 4NZ7A 2F9JA 2K2PA 1TVRB 4CLZA 3THTA 2C3MA 4DV4F 3LTOA 2C2DA 2CFXA 3TI0A 3OPKA 2DK2A 1FDDA 3A8KA 5KFZA 2ADCA 4X4OA 4W4MA 1WC6A 2KT5A 4KAIA 2XLKA 4LF9J 3OTDA 1BQNA 3D0GE 1VFJA 2DR6A 4KGKA 2HVEA 2XMVA 2QO3A 4XAKA 1URRA 5HMZA 5F8MA 1MU2A 3ET6A 1L3TA 2F1FA 1VJQA 1WC3A 2AKWB 3LALA 4I1TA 4NLVA 4WU3A 2DGTA 3ISNC 2VA2A 3B6BA 4JI0J 5KFTA 3MR5A 4F8RA 3CMES 3N5BA 1WUUA 2ASYA 3MWBA 3QGGA 1XMBA 3D68A 2JEGA 4DV4J 4V1Ak 2RU3A 1U0HA 5DGBA 1VLOA 3I4HX 2KTQA 3BQ0A 4RW8A 4LF7F 2YH1A 4FXVA 4DLGA 1Q7LB 4LR9A 3CSKA 5IV3A 2F40A 2QRRA 2DNLA 3M2UA 2E5LF 2WB1D 5DGAA 1WHYA 1S1VB 3G8SA 4OZNA 1YRUA 5A8WB 2C2RA 3T3FA 3DLLQ 4KHRA 1S79A 3M7VA 4F4WA 1G6BA 3M9OB 4LRAA 4IOBA 5K8PA 1G1XA 4X4TA 2L41A 4K4SA 3M6XA 3TO8A 5KFYA 2RUGA 4DN9A 2J8SA 2ZDPA 3HDSA 1MWQA 1E6YB 2H5JB 1ROFA 4R8UA 2GGPA 4A8OA 4Z7CA 2WBMA 2EFPA 1HQUA 3A8EA 1I5OB 1TP7A 4OJ1A 1S6PB 2BOAA 4KE5A 1LXNA 1A9NB 1IN0A 2RDDA 2E5LJ 5IWAF 3I5AA 1JNRB 3OD2A 4F2SA 3AXMA 4ZPWR 1FKOA 1H73A 2ASLA 3GIIA 3KLHB 1HHQA 4J91A 2VG5A 2C3OA 1VCTA 2YKNA 2OPQB 3KWMA 5IV4A 2C2MB 3PX6A 4O44B 1RA6A 4U95A 5HMWA 4MT1A 4ZN1A 2GVZA 2EXUA 3OW2R 5F8IA 2FLLA 4G1QB 4ZVRB 4RNOA 2NPIA 2L48A 3EXYA 2VQFJ 1BY9A 2W2OP 5IWAJ 3EGNA 2EFOA 4YN3B 5KFGA 4ZJQA 4ZA1A 1I1GA 2PMWA 5AXMA 5LMNF 1EETA 5C7PA 2FD2A 4USKA 1S59A 4UTGA 5KG4A 3VV2B 3IWNC 4TY8B 5D3GB 2XMKA 2E66A 1S4EA 3F0NA 4CLKA 1UFKA 1DLOA 1JLGA 3DI6B 1M5VC 4EI2A 4A8WA 2FJXA 2R2TA 2EFGA 5HAOA 3NMRA 1HWUA 4C48A 3PYFA 2NYHA 1BMQB 2GVDB 2BVZA 1A6LA 3EDQB 4OZ0A 5DM7Q 2OKQA 3PIPQ 2EG2A 5D0RA 4PCQA 4QW9A 1NK8A 3TAMB 5LMNJ 2A6OA 2ZKTA 6FDRA 1YWXA 2EC0A 4LF8F 5CQGA 1VQLS 2DXEA 3RJMB 2EG1A 4LQ3A 2X7IA 4B3OA 2YNGB 2F65A 2GO8A 1DQAA 2FLPA 4K5RA 2HBRB 4OYBA 2ROPA 4LRDA 1RP5A 2KT3A 3D3BJ 3MEDB 3DN9A 4XK8C 2HS0A 4PWDA 4CDIA 2DB1A 1UFLA 4PXBA 3PJWA 4F4KA 3C2PA 1VIOA 5IQQA 4ZCIA 1RBAA 4ILRA 4DQPA 3C6UB 3DDKA 1Y3KA 4A48A 2FVSA 1HD1A 4QR2A 1DTQA 1NH8A 1IKVB 4FXWA 4FNHA 2J7UA 2UU9F 1FJEB 1RHRB 1X4GA 2YQ1A 4I6YA 2HWIA 2AD9A 2JEFA 2OFHX 2W2NP 2MZSA 4HT5A 3KXDA 3TANA 2ROGA 2XY6A 5IOLA 3Q2SC 3UD4P 3THVA 4AD6A 3MAAB 4LF8J 4J37A 1U0SA 2AT1B 4CLLA 2CQHA 1RB0A 1UVMA 2B4UA 1T3OA 4I2PB 4O4GB 3HVRA 4CI0B 2E5JA 4QIFA 4WP8A 4TN2A 4OIXA 5DO2A 3SSSA 2K06A 2MJUA 2ZM6J 3LAMA 2LQJA 1HI0P 2QYGA 2VU5A 4C8OA 5K20B 2BQRA 1FF2A 1CULB 4RBVA 3KLFB 1NSPA 1KHVA 2UU9J 2A18A 1P1LA 3BB5A 2G1DA 3K2YA 3SQGA 3MCNA 5EWFA 3QNWB 1DAXA 2IM3A 4HH1A 4I7FB 2V5HG 3H4DA 2FZKB 1ZAWA 1C2PA 3CJ2A 1KFSA 3D5MA 4F4ZA 2VG7A 5JVHQ 4NZ6A 1QY7A 3NL0A 1C0UB 1RLCL 2CNLB 2POKA 2M70A 1OPZA 2NREA 3HD2A 5CZVA 3MMJA 5I42B 2D3UA 1YKWA 3NBPA 5G4DA 1HBNB 2JWNA 2CJAA 4DS4A 3D6MB 3H4BA 1VQMS 4DV3F 1JB0C 2BYCA 1TMJA 2Y1IA 5L9NA 1TVRA 3QAUA 5DDQC 2HW3A 3QPIA 3ENWA 1NHVA 4BC9A 3DU5A 3KUGA 2BUNA 3H98A 2VIHA 4U8YA 3ZZPA 4TQRA 1S10A 3PW0A 2VONA 1IKWB 4C0OC 2DNGA 2HS3A 3DM2B 4LFCJ 4RUAA 2J76E 4USUA 4NLSA 2BM1A 1KTVA 1Z1ZA 3SBMA 4EO6A 3H5YA 2OAUA 3LGHA 1U1PA 2MZQA 4AE5A 3E01B 1CG2A 4X4VA 1FESA 3ETMA 3FFIB 3CPWR 2DHGA 3SV3A 2HMIB 3QT8A 2B5JB 2DYAA 3CCTA 4ECSA 2D3ZA 5D4OA 2BKOA 3JSMB 1M5HA 2R7VA 2RJZA 3A4TA 4JI5F 4E2FB 3IS9B 1HNIB 5C25B 2DKOB 4FN5A 4LF2A 4J9VA 1LWFB 5GAEI 2J6SA 2H3EB 1N4LA 2GMJA 5HQLA 4K8RA 1EAYC 2M52A 3AB2B 3C14B 1TTHB 1S1VA 2DR7A 3KK3B 2E5IA 5A8WA 1ZYQA 1H72C 1NJZA 3BGLA 3N9UC 4FYYB 2HHTA 4NLXA 4K50A 3SEOA 2OUGA 2ILYA 2U2FA 4NZ0A 2F4VJ 4C2MA 2U1AA 4OI0A 1E6YA 3ISZA 2H1YA 4EYHB 5DDPC 3FNNA 3JS9A 4OI1A 1TKTB 2VUGA 1KNZA 3C66A 2D74B 4JI5J 4QWBA 3DLEB 2Q79A 2AZ3A 4M8LA 3OLBA 1S6PA 1P6TA 2NSBA 4WP3A 4R5PB 1FJ7A 1S7IA 4UOHA 4ATNA 1RU2A 1I51B 3RBDA 3A3OB 4YUDA 2OELA 1RADB 3R6LB 4OJHA 3RBXA 4IG3B 2YY3A 5HL7Q 3BDPA 1EQ0A 3KLHA 2UV8A 1LEOA 3OFHA 3L7OA 4ZPCA 4CH0S 3UCUP 2OPQA 4YR2A 3JQJA 1EP4B 1KQKA 4NE9C 2NS1B 2CJQA 3M2RB 3JSRA 1WD6A 3EGVA 4AL7A 3AJ1A 3NNAA 3FBEA 2IC3B 3P45B 1FE4A 4ZIVA 2MYFA 4G1QA 2YNIB 4BHQA 2LA6A 4O3OA 4UOCA 4ECUA 4N8NA 5LJ3Y 4K0KJ 3FRZA 3EDRB 2ZOGA 3RAMA 1IWGA 1RWUA 4P6QA 2CZ9A 3WBZA 1L3UA 3AFGA 4ETXA 5EX0A 4GKJF 2AU0A 1DBDA 1ITPA 1VHIA 1R0BG 1GH8A 2AP6A 4TY8A 1S9GB 5D3GA 4M5NA 4GKKF 3R5BA 3KHRA 4CZCA 2AGPA 2N82B 3F56A 1RZMA 1VQ6S 2J7KA 1Q78A 3RW7A 4S0MA 2CPXA 2HK3A 3D67A 1G2EA 3DI6A 4DR6J 3HXMA 2WBRA 1WC5A 4MK9A 3RRGA 3UN3A 1R31A 3F41A 4X62F 3UNGC 2R8KA 1NU4A 2GVDA 2FHOB 4CO1A 4NASA 1Y10A 4C9DA 1XMOF 2IM0A 4WF9Q 4MAKA 4P74A 5T14A 3KTQA 4RW6B 1ZPWX 3TAMA 4USIA 4GKJJ 2WCXA 2QIFA 2Q6BA 2LQ5A 1EJ7L 2AZ1A 4DUTA 2E1MC 2K3KA 5E2QA 3U27A 1F5BA 4DR2F 1WELA 2V8DA 2YNGA 4GKKJ 4C0HA 3GP9A 1Y00A 4WZMA 1R0CB 3MEDA 2DNNA 2VDHA 1O0PA 1OWXA 3RTVA 2ZUAA 4HL9A 3TZXA 4X62J 1FDAA 1AXQA 2XMWA 2IJRA 3C6UA 3QT7A 2DGUA 1XMOJ 4EK2A 1IKVA 3MURP 4B3TJ 3UO0A 4IFYB 2CQ4A 2AF6A 2WVEA 4F04B 3G86A 3LH2S 1TKXB 3MAAA 3KUHA 5DM6Q 3JB9k 4ED0A 1QSSA 4DR2J 1DURA 2WB4A 4I2PA 3TARA 2XMJA 2ZHBA 4O4GA 3J7AN 4MIBA 4OJGA 3O5TB 2KYZA 3AOBA 1HNXJ 2RF2B 3BM7A 5ETMA 3T6JA 2HQGA 1FWPA 5CYJA 4Q8FA 3KLFA 2P6TA 4I4BA 2ZJQQ 4YDXA 1R89A 2XI3A 3ZO7A 4BBYA 2MLZA 5KG1A 3CDBA 5HVHA 2LQBA 3FZBA 4N41A 2JLEA 4DSIA 4DR7F 3VR1A 2DT9A 4F0KA 4I7FA 2ZD1B 4JI2F 4Q43A 3BO3A 4TXSA 4A8XA 1GMVA 2RRAA 4PQUB 1S48A 1C0UA 4OQJA 1VQOS 3LANA 2FJWA 3RGIA 4DCPB 3CD0A 1VI7A 1FVQA 1C1CB 1SC3B 4AXJA 4D3HA 3I6PA 1HBNA 4LSZB 4K2XA 2KI2A 3AT1B 1RYRA 1FRJA 4OI2A 4PABA 3ZTSA 2VB6A 5A2QY 3BQ2A 3G6ES 1WJ9A 3JSBA 3ZNUA 3PX4A 1R8PA 4CLUA 4DR7J 1F3VA 2X3GA 4DFMA 3NNHA 1IKWA 4NEYA 4JI2J 2CADA 4NOHA 1FD2A 3DM2A 2Q1LA 2ATLA 4F26A 3PG9A 1HNWF 4ID5B 2C2NA 2L9DA 1RCXB 2PA3A 1H38A 1ZTTA 1MN9A 3QT6A 2E44A 4PQAA 3W7BA 3E01A 4ZVSB 2B7CB 1WHXA 2GNKA 2LKZA 3PO5A 2C28A 4ZITA 4JB8B 3FFIA 4PXEA 2XGQA 1GMWD 2HMIA 3FSIA 2D9PA 4ECYA 3G6XA 2B5JA 1OMSA 3U7JA 3TW0A 4ZVOB 3JSMA 4Y28C 2QTWA 4MIAA 4DQQA 1XR6A 2R7SA 1WACA 4DV5F 1VLYA 2GC8A 3OLAA 2AIRB 3IS9A 1HNIA 2DPIA 5C25A 5D0HA 1CJKB 1CJVB 1Y5LB 4X65J 1FEEA 2CWKA 1WC0A 4O3PA 1XERA 1LWFA 5ETQA 2K8GA 2FGOA 3FSYA 3SYZA 2FC8A 1SVDA 1OQ6A 1HNWJ 4ELTA 3S1TA 4ERDA 2H48B 1HWLA 1U8WA 2J9EA 1ZOTA 4WBFA 4FKYA 1XBWA 1EZZB 1U6BA 1YTYA 2KN4A 2NPFA 1OYEA 5KFXA 5H9EK 3AJ2A 3J7YU 2CJ9A 1V9OA 2RE1A 4P2MA 2Z2ZA 2ZC3A 5B09A 3OXGA 3UW1A 3BBBA 1TKTA 3ELHA 2GJFA 1SUQB 2Z0GA 1XC9A 4DV5J 4JP8A 5ETVA 3DLEA 1X4DA 4EMDA 4ER8A 2RILA 1V6HA 4R5PA 5DG7A 4B9UA 1JMTA 4HKQA 2BRLA 3ILLA 1HMVB 4OZ3A 1V5VA 1X5SA 4IG3A 4M5IA 4Q2LA 4X4SA 2LU1A 4I64A 5HLFB 1ZM4A 3ETOA 3B4DA 4USWA 5KFQA 5C2CA 2PMHA 1K47A 3AOCA 5B0AA 1GT8A 4ZVQB 4JV5F 2CPEA 2QLFB 4NPOA 4FYVB 1L3SA 2R3VA 1EP4A 4NRTA 4ECTA 4UOGA 4OI4A 1ICEB 2EVZA 2MKYA 3M2RA 5L38A 1VK8A 1NXIA 1FKAF 2HVHA 1HHSA 2R7OA 2IC3A 3S8SA 3LOUA 4CTAB 4R25A 4QU6A 5DQIA 2QA1A 4DR4F 1UL3A 2W8KA 1VBKA 4EUVA 3GV8B 5D0GA 4I0WA 2GHWA 3UR0A 1ZTWA 2OFGX 4XDCA 2CWXA 2J9DA 3FGVA 5KG6A 2MTLA 2AQ4A 3UVJB 5E3CA 2DO0A 1FKPB 3EUNA 3UCGA 1A7GE 4DPYA 3DRRB 3NWGA 4WIIA 3BPDA 5E3QA 1TK5A 1S9GA 2EKYA 1J2VA 3TA2A 4OLOA 3GYXB 4H54A 2M3DA 3RG6A 2FTRA 1CBKA 2VFTA 4ZCMA 4OI3A 1TELA 2JFKA 1IBCB 1RT1B 3CW2C 2F8MA 1RT3B 2DHSA 1KWMA 1O5JA 4DL7A 3L4BC 2HSEB 5F41A 3O1LA 3R1LA 4USHA 3LW5C 2ZBIA 3Q86A 5BYQA 1JLBA 4F3OA 4OLPA 1RWMB 4RW6A 2C2ZB 2LVWA 3PYEA 3MMBB 3TZZA 4UY8T 3V6HA 4GO5X 1VC6A 4F7VA 2XWXA 5L46A 5E7OB 4OMFG 2BE2B 1UA0A 2ZH8A 5ETTA 4WTYA 2HQIA 2B0GA 4KIAA 1B0VA 2XZTB 3C19A 2PGCA 5F0UA 4JI8F 4WZQA 1ZS6A 4FF4A 2XS7A 2MQLA 2CPFA 1NKCA 4QPTA 3EYZA 2G2ZA 3KFWX 1YRTA 1MMDA 4OYWA 3TEGA 4U8VA 3P5TL 4IFYA 1RWPB 2MZJA 3T5JA 5EGYA 2HNDB 4F67A 2ZOFA 1TKXA 4OX9F 1IQZA 1N88A 1R6YA 1TUVA 2BEFA 2GQCA 3MAQA 2WVFA 4JOUA 1AFJA 3VHQA 1U2RA 3QT5A 4Y2MA 2F63A 1WI8A 2RF2A 4OV1A 1OYDA 4JI8J 4IR9A 1WHVA 2D3O1 1MNEA 3KHLA 2J9CA 1HQEA 1X7VA 3LAKA 3RU0A 3HSDA 1F5AA 2V4RA 4Y2IA 4GRSA 4TU9A 1R6VA 1VDHA 1FERA 2XO6A 1FRIA 2OGUA 5IS2A 5JMNA 2KG1A 5ETKA 2LU2A 5F9NA 2VQEJ 1T9WA 3I9ZA 2VH7A 3CD5A 2ZD1A 4ZJOA 4ZIWA 4OX9J 4RWWA 1GQEA 1LWXA 2CVEA 3PW5A 2DNHA 3QSIA 5H9FJ 4PQUA 4ZKAA 3W65A 5J2PB 3IP0A 2XZWA 2FY8A 2CQGA 1OS5A 1AA1B 1WG1A 3RB3A 2HHSA 1R43A 3M2VB 3T1YF 1C1CA 5GAHU 1ZZNA 7AT1B 4NLUA 2HHWA 4PEOA 5U47A 1RSCA 3KG0A 5B0GA 2JL9A 1T02A 3OQ2A 2EC2A 3ULHA 3BPSP 4P2XA 2ZH3A 2DIVA 2GAHC 1C4AA 3BKTA 4FPRA 3VQTA 4CCHA 5F8HA 3VGTA 4BWJA 3CNQP 3W9HA 1NPRA 1N56A 3A13A 3C16B 1NPPA 1UJ4A 1X5OA 3HT3A 1SI9A 3VWSA 4ID5A 2MKJA 5THWA 4DL4A 3VAMA 2Z58B 1WWHA 3OFEA 1YIJS 5KG0A 3LP1B 5KT4A 3VVTA 1JKHB 2M4MA 2E7WA 3H0PA 4J9OA 4DPOA 5CABA 8AT1B 3T1YJ 2HIYA 4Y6IA 3T1HF 2SXLA 2H4WB 2IA6A 2MEWA 2DJWA 3CUNA 1YX2A 5CA5A 4NLOA 4U96A 1CJUB 5K14B 1MWYA 5CYQB 4N77A 4NA3A 1TFWA 1F2HA 4DZDA 4LF4F 2YWGA 2PFFB 3T6BA 2JRSA 4LRFA 1RT4B 3CB4A 1SBRA 3D1QA 3TEHB 1CJKA 1NDPA 1CJVA 4QPXA 1TQLA 2XULA 1M1HA 3AHPA 4CT8A 2NLWA 4RNMA 1RXOB 1RAGB 3BYRA 4P71A 4QYZK 4HI2A 3PJXA 1IBKF 3BGOP 1NK7A 2EFNA 3W3SA 4QYRA 2OPSB 3T1HJ 1B7YB 2QLXA 2LQ9A 3IR6B 4L72B 3KNAA 1ZBTA 2G0JA 3FK4A 4B9NA 1M5KC 5DDOC 2MDAA 1WKLA 2UV8G 4KY3A 2KHDA
chains in the Genus database with same CATH topology
3ZZTA 3T5LA 2XLJA 3TQ1A 2MQPA 2ASLA 5J2NB 4K0KF 3MFIA 3GIIA 1TL4A 2OD4A 5DG8A 1NJYA 3VF0B 1SUQA 3KLHB 2N7CA 1UVJA 3CCMS 5A6PA 2C2EA 2HHPA 1WG4A 2C3OA 2VG5A 2YKNA 5FDLB 3PRDA 5I3QA 4MH8A 1LW0B 1UAWA 1VQ8S 1UA1A 4I6AA 2MY7A 1R8HA 1AROP 2CPDA 2YX7A 4KV8A 3Q8QB 2FC9A 2VL1A 2P9CA 3GIMA 2OPQB 4BDPA 2AYBA 3KWMA 3I9V9 1D0EA 1DFDA 4Q5VA 1PSDA 2N4CA 1U8SA 1MMLA 3PX6A 2WRMA 4O44B 2MGZB 5CXTA 1RA6A 3OR2A 4DV1F 1XTZA 3D1HA 2YKOA 1K9MT 5HMWA 2LEBA 3MZIA 1HMVA 4K5SA 4CNZA 2HZCA 4ZP8A 3MEKA 3HMJG 2K1RA 2QT7A 4PPZA 1HW8A 2WK4A 3MPWA 3OW2R 3HM9A 1RT6B 5J1EB 3OXLA 1Z4UA 3Q22A 2HHHF 5HLFA 1RKIA 3U1MA 4ES1A 1QE1B 2GCFA 3TVZA 5F8IA 3GIKA 1Y7PA 4DUYF 3KLEA 3VAKA 2FLLA 1FE0A 4G1QB 4DR6F 2H9ZA 5B0FA 4ED7A 3C46A 4RNOA 2FHJD 2NPIA 2L48A 3EXYA 4E8UA 1BY9A 2GX8A 5T7LB 4JI3F 1Z2ZA 2LEAA 3J7A1 2XMUA 4ZDNA 3OSNA 2EK6A 3H5SA 3EGNA 4PG4A 2EFOA 2PT0A 4KKOB 4N8OA 4ZK7M 2IAJB 3TRGA 5KFGA 4IDKB 2XS2A 2DTJA 4ZA1A 5FIIA 4Q2MA 1I1GA 1D3WA 1KVIA 2YNIA 5AXMA 5LMNF 1CSJA 1EETA 2XSJB 2FD2A 2QMXA 4AXIA 2R9LA 2HIQA 3EGWB 1SJ1A 3BSNA 3KYLA 4DMZA 3V4IA 2PI5A 4PRFA 4KQZA 4Y3CA 5KG4A 1T3NA 3IWNC 4OFZA 1QUPA 2EWHA 3ZZ0A 4CTAA 5IQ6A 3CJ5A 4TY8B 5D3GB 5FD1A 4RUCA 4TKTA 2D3OR 3MM5A 2XMKA 4YR0A 2E66A 1HPZA 2F8EX 4NLRA 3G96A 5A0YA 1KLNA 1X4CA 4J9MA 2QA4G 1DLOA 3IXQA 3TUJC 1TV6A 1S9EB 2R2RA 5HP1A 1JLGA 4YEAA 3DI6B 2KDOA 5D8HB 3V6KA 2MKKA 1M5VC 3SFUA 5KFMA 2W9BB 4A8WA 1GNKA 1JLAA 2PA8D 2W7PA 2VBWA 1H6KX 1OPIA 3HI9A 3M8PB 4C3MA 1REVA 2FJXA 2R2TA 4C0BA 1FVSA 2B4VA 2QEXS 2EFGA 3NMRA 4H4OB 1HWUA 1FKPA 4ED6A 2EFVA 5LJ5Y 3LP2B 3K5MA 2ASDA 1YJVA 3DRRA 4ZS6A 4IG0A 1JX4A 3I0RB 1R8CA 2LCWA 1R0AB 2BVZA 4J5OA 3CD7A 1A6LA 1VQ9S 4DWIA 3FMWA 4OZ0A 5DM7Q 4ECWA 3MEGB 2IVYA 2OKQA 4QOTA 4ZPTR 3PIPQ 2EG2A 2KT2A 3PW4A 2XS5A 4PCQA 3OTEA 5F8JA 3BR9A 1IBMF 4IFVB 2KRBA 2XGPA 2XY5A 2BRKA 4QW9A 3CXCR 3JTPA 3J80Y 2KU7A 1NK8A 1TFYA 4QWDA 3TAMB 2PC6A 4NLGA 2V4JA 1RT1A 1WEYA 4I6WA 1RT3A 3P96A 2KFYA 5IXUA 3MMCB 1RJJA 3BGRB 3RAQA 4MKBA 3V4MA 4B9LA 2ZKTA 3I32A 4PXCA 4EEYA 6FDRA 3KK1B 1QUVA 1RTHB 1JLBB 1YWXA 2GO9A 2R4FA 4LF8F 2EC0A 1FK9A 3S6EA 4B3TF 2IVMA 3OR1B 5CQGA 4WFNQ 1VQLS 2CQCA 4ZHRB 1Y5NB 2EG1A 1JLFA 1S6OA 2B4OA 3JYTA 5KFFA 4LQ3A 2YNGB 4B3OA 3I4PA 1HL6A 3OL7A 3DOLB 2GO8A 2PIIA 4Y34A 4RW7B 3BDEA 3VAFA 2QFJA 1W2BR 1DQAA 4DL3A 2FLPA 4K5RA 1D9AA 2YNHA 3L09A 5BR8F 4KPYA 2ROPA 4RW4B 3PV8A 1RT5A 3DNCA 2AYGA 1RP5A 2KT3A 2RT3A 2ZE2B 3MEDB 1HYSB 2CQBA 3L95X 4ZPDA 3DN9A 4XK8C 2HS0A 4PWDA 5E41A 2NUUG 4OHWA 3MMBA 4NCBA 4C11B 2DB1A 2R7UA 4QR1A 4RBTA 4DR3F 4IOAQ 1UFLA 4PXBA 4PG8A 3PJWA 2HNZA 3QJJA 5AXLA 2ZUGA 3GFZA 4F4KA 2MKSA 1SKSA 4ED3A 2AJQA 3QLHB 1P1TA 1S6QB 1VIOA 2BV3A 5IQQA 3C2PA 4K4ZA 4ZCIA 2I38A 1N6QB 4B3MF 4LFBF 2BE2A 4ILRA 1HNXF 1ZM9A 4DL6A 4DQPA 3C6UB 2UXCF 3GSDA 4Q0BA 1DQ8A 2DNMA 3DDKA 2E1RA 2MZ1A 2HHUA 1Y3KA 4LIRA 1AW0A 3UWTA 5DG9A 3FEZA 4A48A 3SV4A 3M30A 2FVSA 3D0HE 3SFGA 1HD1A 4QR2A 1DTQA 1JLCA 1NH8A 2VBXA 4FP9A 5GAHI 4KBIA 1IKVB 2WSEC 4FXWA 4FNHA 3U1NA 1I94F 3H2LA 4DSKA 2J7UA 1S6UA 3IGVA 2UU9F 1FJEB 1N54B 1UETA 3OTBA 1X4GA 4F4YA 2UXBF 3K58A 2DGVA 4HH0A 3FZ2A 3C8YA 1TKDA 3BREA 4I6YA 1YG0A 2HWIA 2V4QA 4DFJA 2AD9A 2OFHX 2JEFA 1Y3JA 2W4DA 2MZSA 3KHGA 4HT5A 2Q43A 3I31A 4M5DA 3TANA 1HW9A 2C3YA 2IYIA 2ROGA 3MM7B 5E3PA 5KFAA 4B02A 3MR3A 3K5NA 2XY6A 2HS4A 1U26A 3Q2SC 3AH6A 4LSNB 3UD4P 3THVA 1HBOB 2RDIA 4J37A 1ZZFA 3HVWA 3W2WA 1S77D 4AQYF 2IMOA 3MTJA 5KG2A 2CQHA 4DUZF 5A8KB 1UVMA 2F3JA 4ILMA 2B9WA 2B4UA 5CHCB 2CJKA 2CZ4A 1T3OA 4PUOA 4I2PB 1FRXA 3MF5A 5F0WA 2UP1A 2V9WA 4O4GB 3CIMA 2LEPA 3DRYA 1F9FA 3HVRA 5ADZA 4E98A 3GB0A 1GX5A 4CI0B 2E5JA 2R2SA 1C1BA 2AJ1A 4ED8A 2PEHA 2ERRA 4QIFA 3ZFVA 3EGZA 4JBCA 3CJKB 5F9LA 2QE5A 1YHQS 2GV1A 4O3RA 3ITHB 4TN2A 3B8HA 3HVTA 4PG7A 5A8RB 4OIXA 3VAJA 4MYUA 5DO2A 3SSSA 2HRYA 2RSQA 4TY9A 4YB6A 2MJUA 1U7LA 2Z2MA 5C42B 2HQ3A 3KLIA 1N32F 1VBXA 2HNDA 3J81Y 3LAMA 2PD1A 4NA1A 2LQJA 4XPCA 1HI0P 4C8OA 1S1TB 1ZAVA 2LLZA 4IH7A 4QIWD 4WYLA 2BQRA 2UVRA 1VS3A 3LO3A 1FF2A 1GX6A 1VQYA 5D77A 1BQMA 2LA4A 1GXLA 4RBVA 1NK4A 1NKEA 3KLFB 3FJ2A 3FVYA 4CH1A 1IUJA 1KHVA 3B78A 5J1PA 1Q1KA 4X84A 2VKZG 1QAXA 2YKAA 5BYSA 3BS9A 5M2RA 1PGZA 4E0DA 2A18A 5IT4A 1P1LA 3BB5A 2G1DA 2EFQA 3VAGA 1TL1A 4KB7A 3EPGA 1FJCA 3K2YA 3SQGA 5EWFA 1HQEB 4DL0C 2B9YA 1DAXA 2PMZD 2IM3A 4CNYA 4WE1B 5EWGA 2UVUA 1GXUA 1U47A 1LK5A 4HH1A 3IN5A 5FJ4A 1PC4A 4I7FB 2V5HG 3H4DA 1ZAWA 1X4AA 4CO0A 2D7SA 3PACA 2O66A 2ZH5A 1C2PA 3CJ2A 4CO4A 2CPZA 2A2CA 1KFSA 2LXFA 1DHMA 2LXUA 4WFXA 2AWZA 3D5MA 5G0RB 5J2QA 3QGHA 4F4ZA 1SH0A 2VG7A 5JVHQ 4B9SA 1UVIA 1NZAA 4NZ6A 1QY7A 3NL0A 3BJYA 4BCAA 1C0UB 3V5RA 2POKA 2CQ3A 3OXFA 4IH5A 2C22A 1P9QC 2YKMB 5EWEA 3IA0A 2M70A 3F44A 1Q7YT 1SV5B 3CJ4A 1OPZA 2FJEB 2CPIA 4KSEB 3NGKA 4H4KC 2NREA 1TKZA 5CZVA 2KG1A 1VK3A 2MQOA 2ACYA 3MMJA 5I42B 4PG6A 1KQFB 4EBDA 5B0EA 2D3UA 3NBPA 1RTJB 1CQNA 5G4DA 3B82A 1HBNB 2HFOA 3B4MA 3M1VA 5EN1A 5F8NA 1Y0HA 2JWNA 2LYVA 2CJAA 4DS4A 4FNIA 4K59A 1F60B 3H4BA 3DYAA 3CMAS 1VQMS 2MQQA 4DV3F 3MAHA 5KFSA 1JB0C 2FB0A 1T7PA 1JLQB 1S1UB 1VIXA 1JLEA 2W9AA 2BYCA 2Y1IA 5L9NA 3HLUA 3IG1A 5DRKA 2VOOA 1TVRA 3QAUA 5DDQC 2HW3A 3RAXA 3KNGA 4YY3F 3QPIA 3ENWA 1NHVA 3OV7A 1X4EA 2YX1A 4BC9A 4ZCKA 4RX6A 1S7HA 2I5JB 5J2PA 3M6UA 2OPRA 3DU5A 4QWCA 1FRHA 4KHPF 2JFDA 3BGUA 2BUNA 3H98A 4NCGB 1U1MA 1JK9B 2OMLA 4R0EA 3SCLE 3MM6A 3ZZPA 5FLXY 4ED2A 3M2VA 4TQRA 1S10A 2GW8A 4KR0B 3PW0A 4QWAA 2VONA 1IKWB 3BZQA 5F3TA 2ROEA 1LFPA 3N28A 4C0OC 2GMHA 4WCEQ 1U1RA 1NK5A 4HT7A 3CGIA 2DNGA 2HS3A 3TP2A 3DM2B 3AAWB 4EWTA 3HHLD 4RUAA 2J76E 2CRLA 1YJ9S 3CCLS 4NLSA 2IVFB 2BM1A 3T9ZA 1S9FA 1S1WB 3MMAB 5HQ8A 1LW2B 1KTVA 2I0XA 4A8SA 1HR0F 2FJVA 2R8GA 5L9XA 3IRXB 2BW2A 1Z1ZA 1RK8A 3IR5B 4EO6A 4C3KA 1VQKS 3H5YA 3ENVA 4X65F 2GJIA 1S1XB 2VFSA 1ULRA 2OAUA 1RAJA 3UPFA 3CCSS 1U1PA 2IMWP 2BANB 2DD8S 4U7UK 3V2UC 2MZQA 4NLTA 3POTB 3MUTP 1HBUB 4AE5A 3E01B 4RKUC 3KHHA 1CG2A 4X4VA 1FESA 1U1QA 1C0TA 2ZC4A 4ZVGA 1NHUA 1P8GA 4ZPBA 4B9TA 4DR1F 3V6JA 3FFIB 3DLGB 3CPWR 4OZ1A 2MZRA 2P9EA 2DHGA 3SV3A 1QJHA 1KONA 3O2IA 2HMIB 4MMOA 2DPJA 3EPIA 2BXJA 4O3NA 3PVXA 3G6YA 4DV2F 2B5JB 3CCTA 3V81B 1SL0A 4LF5F 4CO2A 4OHZA 2HRUA 4ECSA 2D3ZA 5D4OA 1NJXA 4TU7A 3PKYA 4X64F 3JSMB 1M5HA 2OO4A 1HD0A 2VFVA 5KFBA 2RIJA 2R7VA 4UUWA 5DJBA 2FJBB 2FHMA 1BC6A 2R7TA 5B0CA 1IBLF 2RJZA 4JI5F 2KXFA 1AFIA 4OX6A 1D1UA 3LP1A 2DRAA 1JKHA 1T8EA 1VRTA 3IS9B 3TAPA 1V3RA 1HNIB 5C25B 4ZLPA 1Q8BA 2VC1A 3BN7A 5KOWA 1WEXA 1HNVB 4FN5A 2X1GA 2GJ2A 3TUIC 4WFAQ 2HNYB 1CLFA 3LF0A 3IO1A 4TLRA 1LWFB 4P7VA 5GAEI 3MD1A 2J6SA 2A10A 2RKIA 4YHHF 5F8LA 1N4LA 2GMJA 2DNQA 4ILLA 2JDJA 3C6TB 4HTJA 4J9SA 3OUYB 1W25A 3QO9B 2KXHA 1SKWA 1O8BA 2MKHA 2CPHA 2M52A 1H2TZ 3AB2B 2ZH9A 1BGXT 2DHXA 1S1VA 3QJLA 5K14A 2DR7A 3AA8A 2E5HA 5KFNA 2XY7A 3KK3B 3QIPB 2E5IA 5A8WA 1ZYQA 3O44A 2RDJA 2UUWA 4PXDA 4WFBQ 4O3SA 1UJ6A 1KQSR 4M94A 4K4WA 1XWLA 5CYQA 2DCLA 4HEA9 3RRHA 4RZRA 3N0VA 1NJZA 3HHNB 3BGLA 2AX0A 3N9UC 2L3MA 4YDDB 4ZVEA 3G9CA 2Q66A 3GYNA 1RT4A 2HHTA 4NLXA 4K50A 2J0QD 1U49A 4DSFA 1U1KA 4PKDB 3RB4A 3SEOA 2FVCA 1F5CA 3RB6A 4I68A 1VRUB 2ILYA 4XDDA 3CDAA 2U2FA 3SDEB 3MEEB 4NZ0A 2E9TA 3V6DB 1VQNS 4C2MA 2U1AA 2WONB 2ZZNA 4OI0A 1RDRA 1E6YA 3GG1A 3N6MA 3ISZA 4HHJA 3TAQA 1QAIA 4EYHB 3PFEA 4ECRA 1NB7A 5KT5A 4K4VA 2JEJA 5DDPC 3FNNA 5HO4A 1VBYA 4OI1A 4G3IA 2BM0A 5CYMA 3FSXA 1IKXB 1TKTB 2VUGA 2P9GA 3JAMY 2ZJRQ 1KNZA 2IBKA 1RTIA 3S7RA 3C66A 2JC0A 3DFEA 2V94A 4NLPA 1NJWA 4NXMF 4PG5A 1Q53A 2D74B 1S0NA 1KHWA 5M2UA 4QWBA 3DLKB 3SSRA 3DLEB 2Q79A 4M8LA 3OLBA 3RW6A 3KLGB 2OMOA 2Z8QA 2HFZA 1S6PA 1P6TA 1X0PA 2NSBA 4NWBA 3CDEA 3FDSA 3QWUA 2OPSA 4R5PB 1FJ7A 4ATNA 4OZJA 3RBDA 1M0SA 1WEZA 2BABA 2XSFA 4LVNP 4YUDA 3L3CA 2ZFHA 3L7PA 4RU9A