1BWEA

Artificial fe8s8 ferredoxin: the d13c variant of bacillus schlegelii fe7s8 ferredoxin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
AYVITEPCIGTKCASCVEVCPVDCIHEGEDQYYIDPDVCIDCGACEAVCPVSAIYHEDFVPEEWKSYIQKNRDFFKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of an artificial Fe8S8 ferredoxin: the D13C variant of Bacillus schlegelii Fe7S8 ferredoxin.
pubmed doi rcsb
source organism Bacillus schlegelii
molecule tags Electron transport
molecule keywords PROTEIN (FERREDOXIN)
total genus 19
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bweA00
5BYQA 1F5CA 4XDDA 5L8RC 4YDDB 1VJWA 2V2KA 1FTCA 1BQXA 1KEKA 1PC5A 5BYRA 1H98A 1CLFA 1B0VA 1BD6A 2WSEC 1Q16B 3MM7A 1Y5NB 2FJEB 2GMJA 1Y5IB 5CHCB 6FD1A 3MM9B 3MMBB 1H7XA 3EXYA 3HKZD 3C8YA 2VPYB 1FDAA 4ID8A 2FJBB 1FRHA 1B0TA 1JNZB 2PDAA 4OV1A 1JNRB 3MM6B 3PNIA 2O01C 1R27B 1FRXA 2FJDB 1SJ1A 3OR1B 1JB0C 1RGVA 3MMBA 1GTHA 2PA8D 3MM5A 2C3OA 4KT0C 1C4AA 2XSJB 7FDRA 2FDNA 1F2GA 5E7OB 3MM8B 3MM8A 1FRJA 4XDCA 1FXDA 1Y4ZB 1GT8A 1F5BA 2V4JB 1K0TA 1AXQA 2PMZD 2VPWB 1SIZA 1FXRA 2FJAB 3MMAA 2WB1D 3LW5C 4RKUC 2C3MA 2Y0SD 1Y5LB 1IR0A 3OR2A 1FDNA 4Y28C 1KQGB 1GAOA 2C3UA 2Z8QA 2WAQD 1FRIA 3IR6B 2C3YA 4DHVA 1FRKA 2FGOA 1H0HB 1IQZA 1D3WA 3MM7B 3MM6A 2C3PA 1XERA 2FD2A 1B0PA 1FCAA 1FRMA 2IVFB 1SIWB 6FDRA 2VPXB 3MMAB 1DAXA 1PC4A 5FD1A 1BWEA 1DFDA 1G6BA 4OMFG 4XK8C 1DURA 1FRLA 3EUNA 3IR7B 3MM9A 1HFEL 2GMHA 1GTEA 1C4CA 3MM5B 1BC6A 1ROFA 3MMCB 2VPZB 2VKRA 1H7WA 5BYSA 2XSJA 3GYXB 1FDDA 5CH7B 4AYBD 2ZVSA 4CI0B 1WTFA 1A6LA 3EGWB 3OR1A 1G3OA 2WSFC 1FF2A 2V4JA 2UZAA 3OR2B 3MMCA 7FD1A 2C42A 2WSCC 1FEHA 1KQFB 1BLUA 1FDBA 3IR5B 1FERA 4L6V3 1FD2A
chains in the Genus database with same CATH superfamily
1YWXA 1R43A 4H4MB 2GIFA 4ECXA 4A46A 3OLBA 5K9FA 2B9EA 2V2KA 5J2NB 4IOAQ 4IQMA 2MKKA 1IKXB 1BQXA 2Q79A 2MZSA 2W9CA 1HNXF 3NL0A 2AEFA 3DLGB 1TAQA 4GKJF 3BS9A 3WQPA 4R5PB 4QYZJ 1MWYA 1OQ3A 2XO6A 3U02A 1FJ7A 1SUQA 2JVRA 4GC6A 3RBDA 1X0FA 1RTDB 3IXQA 3LGNA 4DEZA 5AE2A 1RTDA 4WFYA 3M2VA 4HEA9 1CJKB 2H9ZA 2HFSA 3PW2A 2J7KA 2XMVA 4IFVB 1OYEA 1NZ8A 1Q4RA 3DCAA 3DGPA 3G96A 1WHVA 4DL7A 4HH1A 1ZPVA 2YQ0A 5A76A 1UP1A 2G9OA 4J5OA 5F0UA 4CLKA 4ZKAA 5EUHA 3VAFA 4KRWA 3JTOA 4TVAB 3QT5A 4X64F 3V6JA 1WACA 3BSAA 2HLTA 1JLBB 1B70B 4DX6A 1VS3A 3DRXA 3W62A 2IRUA 3OL8A 4FNHA 3R27A 1X4DA 2ZBQA 1R27B 1FRXA 3LAMA 1QAYA 1SQGA 4JI8F 5LM7E 3VZIA 1FKPB 1T3NA 2F9JA 1JMTA 2NXNA 2MZRA 4IYQA 1FJGJ 1JIHA 1B7YB 4K0KJ 1RADB 1TKTA 4CDIA 4U7UK 1HNZJ 3CJ0A 1RT1A 4DV2J 1RTJA 4MH8A 4B9SA 3B4MA 2RDIA 3A4TA 4ECZA 3OFFA 2BKOA 1VRUB 4ZLLA 1K0TA 5FIIA 1H6KX 1N5QA 3D28A 4O3QA 1CJUB 3JB9k 4KH1B 2HMIB 1RT4A 3M6UA 5H9FJ 2GC8A 3OD2A 1Q5YA 1KVKA 1SBRA 1YG0A 3VHQA 2BJ7A 5LXYA 2VG5B 4NLXA 3ZTRA 3EX7B 3KLGA 4ERDA 1WHWA 3QQCD 4QIEA 3CDUA 2GQ2A 3W2WA 3K89A 4YEAA 2VG6A 3AODA 1QAIA 2CPIA 1QD1A 3L9ZA 1HW9A 2YKPA 1CBKA 3CT9A 3KJVA 1IKWA 4BHQA 3MOJB 2V6AA 3DRSA 3LP1B 4CLTA 2IIHA 4TKTA 1JXLA 3CCMS 1S1TA 4CO0A 1HNXJ 3Q89A 4KPYA 1LWCB 3DHWC 3PIOQ 3LGMA 4B3MF 3OJUA 2DXEA 5AJ3J 3D67A 1SIWB 5E3PA 2BA9A 3FMBA 1PC4A 2LDYA 4PWUA 3CNQP 1Z2LA 2LEPA 1VRQC 4BLGA 2JLGA 4NCBA 2RAQA 2XMMA 1DURA 5KFWA 3TJAA 3OUYB 3M9OB 3M05A 1TK8A 2DRAA 2GMHA 4NZ6A 2DNQA 3D3CJ 4QOTA 5AXKA 4CH0S 4K2JA 3OLAA 4LFBJ 4DPXA 2HQ3A 5EX3A 2XB2D 2ZUAA 3BR9A 1KNZA 1J5OB 4TU8A 3R97A 3UD5A 5C5JA 3CCVS 5DDPC 3QGPA 4LSLB 2YPZA 3R8YA 1NH7A 5J2QB 4B3RJ 4F25A 5D4NA 3TWZA 3SBMA 4U67Q 1B7FA 1YBTA 5IC4B 2ADBA 3RW7A 1YJNS 3HJVA 1PYTA 5A2QU 1HWJA 5M2RA 2J9DE 2QO3A 1YRXA 4L74A 5HQMA 2BR0A 4C97A 1N32F 2XS7A 4NX9A 3MMCA 3HLUA 1KFDA 1QDUB 2W7PA 1BLUA 1J2VA 5KFMA 4DG1A 3V2UC 1P9YA 1MU2A 2CZVC 2OAUA 2WVFA 1KQSR 3MDFA 4M94A 4I0WA 4Q44A 5K14B 4JYAF 2VG7B 3QIDA 3CDBA 2NLWA 1WEXA 4KPCA 4MTPA 1NU4A 2D3O1 2GIRA 1F60B 5KT5A 4MJKA 2MTLA 1RYSA 1WSRA 3DLLQ 2WHOA 1WWHA 3H8YA 3DMJA 5J2PB 4JV5J 3MFHA 1U2CA 5KFRA 2MGZB 3DDIA 4UOCA 4J9KA 3IBFB 1RB0A 3RJMB 4LQ3A 1E6VB 4YDXA 2VV5A 3GWCA 1ZAVA 1VBZA 3TEHB 1UAWA 5KFAA 4F67A 2LEAA 1S1XA 3PFOA 1XMOF 2F65A 1UFWA 2PD1A 1FDAA 4IRDA 2YBVA 1R6YA 4WYLA 3GILA 5GMDA 4DPTA 1NK9A 1K9MT 3QGHA 4ZHRA 2RRBA 3NCPA 1NUEA 3DRPA 3E01B 1UVLA 1ZH5A 2DNLA 4F26A 1N5TA 2AJFE 1IJFB 1RHUB 1YJTA 3FFIB 4ZPWR 1U09A 4DV2F 1OMSA 2IRYA 3ZTOA 1FKAF 3B78A 4HHJA 3GJQB 1RWKB 2JJ4D 2M88A 2UUAJ 2UXBF 1X4GA 1U6ZA 5K14A 1CSJA 1X0PA 3S01A 3SFUA 2FDNA 3IAS9 5E7OB 3KDOA 1AFJA 2LA4A 3CCTA 1Y3KA 1FWKA 4A8XA 2VHGA 1JLCA 1XBWA 4WFZA 3ZO7A 4ED6A 1TL3B 2QG9B 2FZGB 3M8RA 3TAQA 2IFXA 3FCVA 1RAGB 3M8YA 4Z2XA 5L1JA 1JJHA 4ZJOA 4IDKA 1SL2A 3TX8A 2A3JA 3CVKA 5DGAA 2ZZMA 1DTQB 4DL5A 3W1YC 5L39A 2JC1A 2X3DA 3EVMA 5IWAJ 5THWA 3NS5A 3UN2A 3H4BA 1QE1A 2WVEA 1J5OA 4ES2A 3VGSA 4ZJQA 4DF4A 2XLJA 2XY6A 2KJWA 3OR2A 2FIUA 2DHHA 4Q2LA 2HVEA 4F3OA 4CO2A 2IJNA 1SKUB 3S7RA 3JYTB 3PG9A 2JDJA 2CWKA 4EO8A 3R5GA 4KR0B 3SSRA 2P6SA 2MZ1A 2CIMA 3DDKA 1GNKA 3AAWB 1NPKA 1ZTWA 4DL4A 1KLMA 3ZZRA 4DPUA 2HAFA 5RUBA 3DNCA 1R3NA 3I5CA 1IKYA 1RU1A 2HK3A 4Q2MA 1J5EJ 2FVQA 1UZHA 2MSTA 2HZVA 4PUOA 1CULA 5IT0A 1ZAXA 1YX2A 2QA1A 3H59A 3A8IA 4FYXB 5IC6B 3IO1A 3D1QA 3DDNA 5J2MB 3LP1A 5IT9Y 2JSXA 2ROGA 1SJRA 2A0FB 2FVPA 3QFWA 1N48A 5D0RA 3MR3A 1SPBP 5D77A 2LFVA 1GTEA 4NLGA 4C8LA 1WD6A 4DOZA 5L46A 4QWEA 1JX4A 1FA0A 2XMUA 5HSPA 1TAUA 2YNHA 4LVOP 1NRKA 2RHSB 3D0GE 3R6LB 1XMQF 3SV3A 3W5ZA 4KAIA 3WIVA 3FK4A 2AT1B 3NEKA 5T7LA 4CNZA 4L3NA 2HZCA 1N34J 3AA8A 2NUHA 4LSNA 5F8IA 2AX0A 2YNGA 1XR6A 1ZA1B 2GHVC 3EGWB 3OR1A 1S4FA 4WTYA 3R5CA 5KG6A 2ERRA 3Q2TC 2BKNA 2ABYA 4QR1A 4CT9A 5LJ5Y 4M5MA 2DNKA 4XPCA 1S49A 1VRUA 1ZS6A 1I94F 1RACB 2ZE2B 3NY0A 4EO6A 4NLWA 4UF4A 1FE0A 4C0BA 3P3DA 2FHOB 3M9MB 4NCAA 1V3RA 2X1GA 3BGRB 2OMLA 3KG1A 2F8EX 2EEYA 3SCKE 5KG4A 3WBZA 2MY8A 2XS2A 2ZOFA 3T5KA 1HPZB 4OX9J 1FTCA 2NCKL 1FWPA 4NE9C 2AJ2A 1X31C 4NLDA 1VQPS 2C28A 2UUCJ 1D9AA 3LF0A 2VA2A 4DSLA 4KE5A 2XMWA 4IQXA 2HWIA 2UXCJ 2GA7A 3MI7X 2J5AA 1RAAB 5L38A 1LWEB 1O6XA 2CQ4A 3O1LA 1HR0F 2OELA 3GR0A 4NL5A 4TLRA 2NYIA 3UD3P 3ILOA 2QSWA 3K7RA 3NWRA 4PCQA 1XJWB 2HS4A 5DZ7A 1U24A 2EFPA 2ZDOA 2BE9B 1TKDA 3ETOA 3SI8A 1JLFB 1BY9A 1UW4A 3DM2B 2E5HA 3L7UA 2H5JB 1WG1A 3TO8A 2VICA 5F8JA 5JUMA 1LK5A 4RZRA 4J9PA 1YITS 4V1Ak 2CPYA 2VQEF 2ZKTA 4DN9A 2BJEA 3I5AA 4CRJA 1D0EA 2B7BB 2AV5A 2JHEA 4HI1A 4YQWA 2MDAA 3PNIA 3LP0A 4WFXA 1S9FA 1KS2A 3V4MA 4B3SF 3SYZA 1WELA 1WF1A 3VZHA 3BO4A 3CB4A 3AHPA 2OFHX 4FDFA 1M5KC 1HLWA 3N28A 4FYVB 3KLVA 4N7TA 2HFOA 2HPUA 2ZNZA 4O3PA 4DSFA 4P10A 1OSCA 2Q1LA 1X4CA 3JQJA 4A8OA 5M2UA 4A8SA 5HVFA 2DRBA 4FVCA 4KGVB 2D9PA 4MKBA 2HNZA 2VIHA 1RT7A 2XZTB 2B9XA 1F9EB 3OL7A 4FXDA 2EFNA 4ICLA 2ZOGA 3W2WB 5KFDA 2K7KA 4JI4J 1N33F 3BR8A 1X8DA 2V4JB 4CT8A 3JTNA 1Y7PA 3SMZA 1IUJA 4QPXA 1PBUA 2PMZD 4PABA 1SIZA 2C2EA 2MPUA 1S9GA 3M8QB 2FLNA 5ETRA 5H9FK 4LFCJ 1EETA 2HK2A 2CJKA 1UCNA 3SQGB 1NJIT 2CPXA 2P2CB 3I9V9 1VQMS 2FHMA 2ZZNA 1RU2A 3L09A 1T9YA 2GS8A 2HVZA 4C2MA 3VV2B 3FJ2A 1R6VA 3HDSA 3HHDA 4NLSA 2W01A 4B17A 4ZN3A 1M5HA 3RAMA 2AYGA 3BSOA 5L9NA 2F4VF 1S6OA 1YZ6A 4LRBA 3WC0A 3SQGA 4CYUA 2YNFB 2Q3PA 2W2QP 3KFWX 1VCTA 4P74A 2OTJS 3TUPA 1D8ZA 3CTRA 1QVGR 3FQKA 1YI2S 4M5IA 4DZDA 2Y8YA 4NXNF 2DBBA 3O2IA 3NG8A 3ZZOA 2R7QA 2HBRB 4P73A 1M5SA 4JV1A 3DLHA 1DFDA 1X60A 3UQSA 2R7WA 1YIJS 4R25A 3QZ8A 3RBZA 3G6VA 4HDGA 1IR2A 3K58A 2UXDF 3RAXA 3IAM9 1K47A 2CADA 2V2VA 4KO0B 1VI7A 1VGYA 2VPZB 4NPOA 2Y1IA 1NZAA 2KT2A 4MMOA 2BDPA 4RWWA 3FBEA 4WJBA 3Q24A 3CF5Q 1UFKA 3H2LA 4K4UA 1H7WA 1WOOA 2IM2A 2D3UA 2GQCA 1TTHB 3NBPA 3H90A 4CI0B 3VGVA 1TL5A 1UPMB 1IKXA 2W9CB 1NKBA 2NZCA 1RXOB 1VRTB 4Y34A 4I2PA 3GV5B 2IMWP 3QJPA 2BEFA 3DLEB 2C42A 4CP5A 2XTJP 1NPRA 3POTB 3CEDA 3GFXA 4FF4A 3C66A 4X62J 2HHHF 5BR8J 2DEIA 4Q5VA 4HVZA 3VAHA 1U1NA 3X3UA 3HT0A 1FD2A 1NH8A 1RBOB 2WRMA 2CVEA 1MNEA 2LQ8A 1UMJA 4I4BA 2PA3A 2V8DA 3W61A 1LWEA 2KFZA 5SZTA 1EP4A 3BPSP 1YK9A 3OL6A 1U0HA 1VR6A 1VYAA 4HT7A 4O0NA 1HMVA 2HIYA 2RUGA 4WFNQ 2Z2LA 4M1KA 3LGHA 2LYVA 4IH7A 4DQRA 2WK4A 3PFEA 4HTJA 4RW7B 3SSQA 4DX5A 5K8OA 4P75A 4DQSA 5BXIA 4Y2CA 2BRLA 4ZP6A 3Q86A 2OTLS 2UVVA 1S10A 2VKZG 3KLHA 1F3FA 2AW0A 1WEZA 3TQEA 1HARA 3PTWA 4USUA 2K1RA 1LKZA 2QLWA 3U1NA 2CRLA 4OYZA 4OYWA 1FD8A 3R7BB 3TRGA 2P5VA 4C3MA 3P49B 2FJBB 3B4DA 3CCES 3DRRA 3N5FA 3Q8YA 1JJ4A 1WTBA 5L1LA 2PDAA 3AT1B 1NSQA 1T95A 2DXFA 3LA0A 4GVBA 4OV1A 1HI8A 4K0KF 3THTA 2BJ3A 5I4MA 3OTEA 4N41A 4I6WA 2LCWA 2C22A 2XM3A 5CYMB 4F4XA 1SJ1A 1D09B 1RLCL 2NPIA 2RH3A 4CTAB 3Q8RB 3I31A 1BQMA 4KT0C 4OI6A 3V81A 1ZETA 7FDRA 3QRQA 1RZMA 1F2GA 4CLUA 1VDHA 4WBFA 4ZVPB 3CMAS 4DV5F 3BREA 2PMHA 2I5JB 3TA2A 2ILZA 4JBCA 4XDCA 1FFWB 3GJSB 2OD4A 4NWBA 1FXDA 3ZNJ1 2WBRA 1K0VA 3IBWA 2LDIA 4RW4A 3TAMA 3EGZA 1NK7A 2V2QA 1UWBB 4J9OA 2QLFB 2VPWB 2QA2A 4J7CA 1FXRA 3GU0A 2YX1A 3M7VA 4R8UB 2W7AA 2ZH9A 1S7IA 2ROEA 1R8PA 4CO4A 2CQ3A 4OI2A 2QFJA 3AXKA 5E5NA 4IOCQ 1GFWB 4DL3A 2CDQA 2FHKA 5E3RA 5E41A 2ZH8A 3VCDA 3J81U 1CVJA 5HMYA 2RJZA 3R7SB 5KG0A 3DLEA 3V6DB 3U1MA 2C2OB 4DV1J 2BW7A 3O3LA 1KTQA 3T6JA 3KG0A 4RW9A 4K8RA 3MPVA 3LWLA 2ZH2A 3RRKA 4B9LA 4FF1A 3N01A 2MJUA 1TFYA 3AJ1A 3HT3A 1SQFA 2LU2A 1Z4UA 3SDEB 4C3LA 3AJDA 1E6VA 3OVBA 2NYHA 1PGZA 2X1FA 2OPSA 3W66A 2J0QD 1H0HB 1U1RA 3EPIA 4ZPTR 1TUWA 1U8WA 2F9DA 1OIAA 1UJ4A 2V8HA 3UCGA 1YRUA 1S72S 2YKOA 2ZHOA 1HBNA 3CJ5A 2QRRA 1HBMA 2GV1A 5AE3A 4YMEA 1S6UA 3PJXA 5JMNA 4DV6F 3W63A 4ECUA 1S6PB 3BH7B 3GIRA 4RW8A 3MM9A 4IG0B 2UUBJ 4K59A 4WZMA 4UQTA 1CG2A 5IM0A 5IM0B 3IA0A 1DRZA 1KN6A 2WB4A 2FUG9 2BJDA 4ECRA 1MMDA 2Z0GA 2CPHA 4DFJA 4MK9A 2DGOA 2W24A 3CUNA 1WDDA 3HULA 4DR7J 4FYDA 3V5RA 4H4KC 4DG1B 2XSJA 4AL5A 1C0TA 2YY3A 2BOPA 1FDDA 2O3DA 5CH7B 3UCZP 3MD1A 1SXLA 1FESA 1NK5A 5B0BA 1O0PA 3DI6B 4J9MA 1A9NB 3OTOJ 4P72A 2ZJRQ 3DLBA 4NI2B 4KY3A 2I8EA 2WSCC 3JXOA 1WDTA 4LSLA 1KQFB 5J2QA 2MGZA 4FF3A 3RB4A 3RG6A 1S6PA 4RW8B 3K5OA 4OI4A 4TQSA 1EETB 3IWLA 2Z4PA 1U1PA 4KKOA 4LVNP 4ZCMA 4KHRA 1FWLA 4N76A 3ADAC 2W9BB 3SV4A 1NK0A 2V9KA 3PJ9A 2B5JA 4OZ0A 2ZH4A 2UUTA 3IRXA 3KG4A 5T41A 4PWWA 4AL6A 3G86A 2XYGB 1WNEA 1PKUA 1T0TV 4R8UA 1B99A 2BKPA 4X64J 4CO1A 1GH8A 3EE3A 4TN2A 4DX7A 4UY8T 2O67A 5DRKA 2A10A 5E0OA 1SCJB 1SC1B 2HGNA 4I6YA 2D41A 1SL0A 4BS2A 1HNVA 2L3MA 3CD7A 4K2XA 4KTQA 5T14A 1W7WA 4P2FA 4DV1F 2Z2MA 2DR8A 5KFTA 1VC0A 1FRHA 3TP2A 1WOSA 2VBYA 4ZVSB 4CTAA 3GMGA 2ALZA 3MR5A 4C8OA 1T9UA 1OO0B 1SB6A 3N5BA 4JI2F 1N5YB 2VG6B 3B8HA 3D0HE 3MM6B 2YKNB 3G71S 1WEYA 4LFCF 3H2UB 2E1CA 1MSWD 2V4QA 4M63A 1JB0C 2VDIA 2UV8A 4ZPAA 1RWVB 4B3TF 2RF2A 2P8IA 3A8JA 3HHEA 2XCAA 2KL8A 1HNWJ 3G6YA 2CPFA 3M8PB 3BBFA 3GPAA 3T41A 4ILLA 5DG7A 2KVQE 4PG8A 2VOPA 2MZJA 5G0RB 4ZJLA 2H54B 5IQ6A 3NGTA 4MIAA 1KFSA 4WZQA 2EVZA 5KFQA 1HQEA 4O3OA 4U8YA 1PO6A 4RW6A 5H1SV 5DQGA 2WOMA 2XCPA 1T9XA 4LUBA 5ETKA 4DL0C 3HP6A 1R8HA 2VH7A 3CJKA 4K4SA 3LOUA 2Y0BB 2P6TA 4DZ6A 4GVBB 1T02A 3HHLA 1VLYA 3BGOP 3K5PA 1H2UX 2P9EA 3HHLC 3MMAA 2GVZA 1UEVA 2HAIA 2I0XA 4WIQA 3TVYA 3RB3A 1RYRA 1JKHB 2OPQB 1QTMA 3C6UA 1S99A 4DBQA 4OZ1A 4CNYA 4DV3J 2YWKA 3QO9A 1FDNA 4Y28C 3R5BA 5HATA 3UO0A 1K73T 1M90T 4J91A 1D9FA 4OZNA 1FVQA 2VG5A 1RT3B 2VFVA 2ZM6F 4Q45A 4DR6J 1V3SA 4O4GA 3AA9A 3IR6B 1Q95G 3MAAB 1BXNA 3QWPA 4ALZA 4EFAC 2OHDA 2WW8A 2YNHB 5CYJA 2GZOA 1D3WA 1PBAA 4IFYA 1AFIA 1FE4A 1FNOA 2RD5C 1TUVA 2IVFB 1RTJB 4NLTA 1RT1B 3RU0A 3UDVA 5FD1A 3MWBA 5GMEA 3MEKA 3W5YA 3I82A 1G6BA 4CLLA 5E33A 1RTIA 2WONA 5KFYA 1G7CB 4KBIA 4JV0A 4R5PA 2BQ3A 2CJXB 2M8DB 3HF5A 3R7NB 2CXEA 3H7HB 4I2QA 3VWSA 1HFEL 2PT0A 5D15A 1Q1KA 3I96A 3MPUB 4ED0A 3RR8A 1RAJA 2G1DA 4PG5A 1U6BA 2J6TA 1JQGA 2D9OA 1WJ9A 4DL6A 1DZ5A 4L72B 2J0XA 3NBPB 3OFGA 3H5YA 3BN7A 2OSRA 4CWBA 2J0WA 3O5TB 3OTDA 1EKSA 4IR9A 4LFAF 1FT8A 4YP3A 3PEJA 4IRCA 4HACB 2E5LF 4O3RA 1FF2A 2YKQA 3M1VA 5DDRC 2X51A 2UZAA 3NGSA 1A0OB 1VHIA 3IG1B 3OR2B 2VFUA 1HWKA 4RNMA 5KOXA 2LKZA 1FFSB 2AGOA 1SKRA 4ZLNA 1MW7A 4HL9A 4L6V3 1VBYA 2EFOA 1HIYA 2IVMA 2YKMA 4PXEA 3W7BA 4CLWA 4Y3CA 3I4PA 1LOUA 1PYOB 2ZVIA 3DOLA 4HH0A 4NCGA 4Q0BB 3DI6A 3HK2A 2ATLA 1O8BA 1V6HA 4C6AA 1FO1A 1Q8IA 3UNGC 3PR5B 2UVWA 3NNHA 3MECA 4ZMMA 1L3VA 3H25A 1XNRF 1JLCB 2E1PA 4JP8A 5ETSA 3MEGB 2DTJA 3FSXA 1PAUB 4TU7A 2IDEA 1H73A 5A6PA 3QBCA 3MM7A 4J9UE 4TYBA 1F5AA 2NS1B 4IG3B 2UUBF 2V8VA 2JZ5A 1WC5A 1N54B 1ZBTA 2CKWA 2MQQA 5EWEA 1S0VA 5HK4A 4USJC 1M1HA 3I5BA 9ATCB 1JK9B 1KR4A 3N79A 2N3LA 4P2SA 4OYXA 3MUMP 4MKYA 4ZCKA 3K17A 5HBMB 2CJQA 2FPHX 1H3DA 3NWGA 4U95A 3PX4A 2IPOB 1N56A 2FGCA 3FBFA 2ZH6A 1HWIA 1S1XB 3IWXA 4WP3A 4ANDA 3M4XA 2X1BA 2ZM6J 2YTCA 1B3TA 2HVIA 3C14B 2LVWA 2OI2A 4RUCA 1WHYA 2HNDA 5LMUJ 2JEJA 1BQNA 2NXUA 2VFRA 3HVAA 2HHSA 1CJTB 2GVDB 3NAHA 4C8MA 3US5A 1S59A 2XY7A 1Q7YT 4IOBA 2GHWA 3SCLE 1L5UA 1TMMA 1I5OB 5JXSA 3VAJA 2K3IA 1S0MA 4Y2IA 3HHKA 3GCWP 3UI3A 1EX8A 4QQBA 3G82A 2DHAA 4EYHB 1I3OB 1X9WA 2NSCA 2PEHA 2OEJA 4N77A 4DSIA 4MYUA 4Z37A 2DT9A 4P52A 4N47A 3OJSA 1U1MA 1TKZA 2C2KB 2J9CA 4TU9A 1S0OA 4F4ZA 3PYEA 1C2PA 4O44B 4DI6A 2Y0SD 3M8WA 4JI4F 3J7AN 2J6SA 3BDPA 1N33J 1IVZA 2EFQA 3MAAA 2PI5A 1BUXA 1JLFA 3DM2A 2IM1A 1CJVA 2LA6A 4LRCA 4ZVGA 4DL2A 3NOGA 1OQ6A 1RCOB 2F8HA 3EICA 4M5DB 2W4PA 3LP2B 2XYHB 4NA1A 5KFZA 3D7SB 3EDRB 2ZE2A 5LSLA 2XLIA 3PX6A 3PZPA 1KONA 4ED4A 5LMNJ 2IM0A 4DHVA 2G1HA 3T1HJ 2M8HA 3FDSA 3CIZA 3G82B 4CZCA 2PE8A 2R7SA 2E1MC 2NUUG 1B0PA 3MMJA 3I0RA 3D1HA 1HKAA 1VQYA 2VDHA 1HPZA 3HHLB 3MMAB 4FXWA 3BKUA 1Q53A 3CD6S 3ICLA 3FRZA 2R4FA 5A8RA 3B82A 2GO8A 4N8OA 2R3VA 1TZ0A 3IN5A 1RHKB 4DQIA 2V8GA 2PSZA 4ED5A 1EKRA 4Y65A 2DGXA 1SJ3P 2RE1A 1V5IB 5KT6A 4JI1F 2ROPA 1VQLS 2LECA 3R2CJ 5HVHA 2X7IA 3HVWA 1B4SA 4KJIA 3FMWA 1GMUA 3M8PA 3OVAA 1WOPA 1Q8BA 5KG5A 3E3XA 3ITHA 4ZLPA 2EK1A 4GVLA 4DR3J 1MN7A 3PHTA 3EVWA 1S9EB 4NLVA 1KLMB 2PEBA 3LPEA 2OP5A 4FNIA 4RR5A 4WIIA 3V4IB 2IAJA 2NSBA 1DQ9A 1GMWA 4RWXA 3MXHP 4DX8H 5FJ4A 5IT4A 4MIWA 4K4WA 4LF5J 1FJGF 3KHGA 1NSKL 4ZPCA 2OPPA 4MYTA 2HHUA 1H72C 4I56A 3EMTA 1DJ0A 1NJZA 5C42A 5C25B 3HHLD 4ZLJA 4ZS6A 2W9AA 2GMLA 2GW8A 3HKWA 3TAPA 5LOQA 4LMZA 4I2PB 1APSA 3QGIA 1PAEX 5HMXA 1HNVB 3RAQA 1RWMB 4Y00A 3UN3A 2ACMA 2LQ5A 3VAKA 1RTHA 1H98A 3K8VA 4B9UA 2I2YA 5LSRA 2DRDA 5G4DA 4A48A 1DTQA 5EX0A 4KFBA 4XTTA 3I55S 5FLXU 4QIWD 2JH3A 4CLPA 4CLZA 3PW7A 3AFGA 4B9NA 1ZPWX 1RWWB 2AJ1A 4QYRA 2B5JB 4WXOA 4JI2J 2XC9A 1RISA 2QJ3A 1UPPA 2FJEB 2MHNA 4HHHA 4ETZA 2DNOA 1ULRA 1MLAA 2IA6A 1JJCB 6FD1A 2RQMA 4NASA 3WZ0A 4UUWA 1K44A 2DH7A 3MD3A 5F8MA 3GE9A 3PM9A 3TI0A 2FVSA 3C8YA 2CJYB 3QRPA 4MIBA 4A8WA 1N5SA 5DG8A 1DARA 3KKFA 4B9VA 2Z30B 4OLOA 3GLJA 5KAKA 2JLEA 3U27A 3Q2SC 2RQKA 3M30B 2QZ8A 3MAHA 3C46A 1RGVA 2JOQA 2U1AA 3VVUA 1GTHA 2GFFA 2CJ9A 4BCAA 5L9XA 2Z56B 1VHFA 1X5SA 3R5JB 5F41A 1C4AA 2B51A 2EW9A 1PG5B 2NXCA 2XSJB 1HHSA 3FZBA 5CA5A 5C25A 3MM8B 4C7QA 4Y2AA 2AP6A 2JNJA 3AD9C 4K50A 1WHXA 3GV7B 3VAMA 1YDLA 4X4TA 4RBVA 3I9ZA 1H2TZ 1KC8T 2J6UA 2EC0A 2VFTA 2VB6A 2F40A 4OYPA 3ILJA 2IAJB 4F3MA 1UW9A 3J81j 4LF2A 2MQ8A 2QLJB 3CDEA 5IQQA 1R0AA 1S9GB 2UVRA 1NLKL 4ZOSA 4WCEQ 5B09A 1HBNB 3D9BA 4DV0J 2FVCA 2R8GA 2H48B 4H4MA 4Q7AA 2C2MB 3M32B 5AXLA 4DPOA 2W4DA 3I87A 2RSQA 4YUDA 3KJFB 2AJ0A 4CIOA 1VQSA 3QPIA 2ASYA 2KDOA 2Z2YB 3FQLA 4RUAA 4ZVQB 1S1UB 1EQMA 4J9LA 2IA0A 2AGQA 1ZM3A 5EDWA 2EXUA 3K8WA 4P7VA 3KLIA 4ZIVA 5J2PA 2C2RA 3HD1A 1X4EA 2AZ3A 2E9ZA 4JI3J 1IQTA 2IC3B 2ZBPA 4DFMA 3DOMB 2J7UA 4O3NA 2PGCA 1L3UA 1DHMA 1CC8A 4X66F 4NXMF 1KOHA 2L48A 1S77D 2J8SA 2B3TB 4DR5J 1T9VA 2A2CA 2DO4A 2Y1RI 4WU2A 3K5MA 2GHPA 4DR2J 1Y10A 4JYAJ 3S6EA 2YH0A 3TAMB 4ZN1A 4RW4B 3VQSA 1EZZB 5JVHQ 4KV8B 1NHUA 4IUFA 2E44A 5EWFA 2DGTA 1NDKA 1T9WA 1FX4A 3MMCB 2RQCA 2KJVA 5GMKa 4RX6A 1RWUA 1EJ7L 3BBCA 2ZWPA 1TL1B 2KH9A 4F2SA 2XS5A 1RHRB 3ISND 1S79A 1N32J 2DR5A 2ZVSA 4OL8A 3DOMA 3GFYA 1TMJA 2HBZB 4PRFA 4P7TA 4OZJA 5CD4A 3MUVP 4JI5F 2CJBA 2JX2A 5KT2A 2BQRA 2DO0A 1WKJA 2DPIA 3FRYA 4PZVA 3EPGA 3TARA 1YBAA 3CCUS 2AQ4A 4WFAQ 5H9EJ 3UNYA 2QMXA 4PYAA 1DBDA 4O23A 1X4FA 4XDDA 2DGVA 3OSNA 3KHHA 2V68A 2IYGA 3E2EA 3BGLA 3TZWA 1Q86T 3GIJA 2QSFA 1REVA 4B3OA 4KHPF 4K4VA 1QAXA 1JLEB 3FKBA 3W65A 3R1HA 2ZKUA 4DU7A 4OHZA 5HBMA 5A8KB 3G8SA 2B8PA 5GAHI 2W7OA 4A8KA 4BWMA 2RRAA 4DSKA 1E6YB 1HBUA 3GSDA 3SFGA 1Q8LA 5F8NA 2O66A 3KUEA 3LQVA 4RUBA 5IS2A 1VQ5S 4RNFA 1V5VA 1HYSB 4CO3A 1ZYQA 3KK3A 2LU1A 5A2QY 3FEZA 2NPFA 5GAEI 3QATA 3UR0A 4LREA 2ZEJA 1PILA 1YBUA 2DXDA 4IG3A 2L41A 3MEDA 2XWXA 5J1EB 5DGBA 5HP1B 1S97A 4M5JA 2LQJA 3CCSS 3BYRA 3AXMA 4ZVHA 1WC4A 3N9UC 3MEGA 2CVIA 2V8PA 1SC3B 1UFLA 1FI4A 4E2FB 1G2EA 5KG3A 1N52B 1JNRB 4IO1A 3VAIA 3PVXA 1XNRJ 2OPRB 2FJDB 4FKXA 2ZNYA 4IO9Q 2QC3A 3A1YG 3F0NA 3DYAB 4BWJA 2MKSA 3AD7C 4EYIB 1T9TA 3EVOA 1JLBA 3PHEA 2VOOA 2DNNA 3LUYA 4PKDB 4AE5A 5K8MA 1MMNA 2DPJA 3DHXA 4A8YA 1UVMA 3MM8A 4ZITA 3VVTA 3DN9A 4KSEB 1BGXT 3AH6A 3MCOA 1P1LA 2FZKB 3GZ7A 4FYYB 5CCLA 1OJ4A 3L3CA 2A6OA 3OHAA 3GP9A 4M95A 1ZZFA 3M1VB 3O6QA 1CJKA 2EPIA 2XMTA 3M2VB 4FPRA 2UUAF 2UXBJ 4OJHA 3SCIE 1MG7A 1XNQF 3TJ9A 5ADZA 1SUQB 3DOKA 1FNMA 2EC2A 2GGPA 3QT6A 4ZPBA 4NMXA 4LT6A 4M5KA 1IKVB 5HQLA 1KHWA 2J9DA 3EZUA 4LF6F 2ZH1A 3TJ8A 4E0DA 3H20A 3H5XA 3CJ3A 5CQGA 1Y5LB 3M6VA 4YY3J 4F4KA 4WP9A 4WKRA 2KRRA 4B3MJ 1RAOA 2KRBA 3G8QA 1XC9A 3LTOA 3DGPB 1KQGB 2XZWA 1XN9A 3CIMA 2HWHA 3WHIA 1UZDA 1SJFA 1CC7A 1U2FA 2IMOA 2HG4A 1RTIB 2WONB 3EZOA 3LAKA 2DGWA 3QT7A 5IV4A 2WAQD 1GXUA 2AJ4A 2BM1A 2RILA 4EBEA 3AJ2A 2WW4A 3PCOB 3KLEA 4PG6A 2CZ9A 2GAGC 3PYGA 4QPTA 4UOGA 3GQCA 4AL7A 3QFHA 4DCJB 4DQPA 2D1CA 2DYAA 3MPWA 3LPYA 4FPIA 4P71A 2DGSA 2FD2A 4G6VB 1VK3A 2ZC4A 4FBTA 5B0FA 1M0SA 2QTWA 2VPXB 4ZHRB 3D2WA 5J2NA 2NR0A 1BWEA 2V63A 1T8EA 2IBKA 4TY8B 3TVZA 4ZP9A 3OW2R 2KN4A 2OPPB 2XZDB 2JLFA 3OFHA 3PO4A 3KK1A 3IFEA 4JI0F 2KYZA 4UT4A 5CCMA 3N6NA 4LR9A 1S1VA 1JKHA 2DGQA 2OPQA 4LRFA 4DWIA 1RK8A 2YWWA 4KYZA 3L95X 3WC2A 3MHYA 3BYPA 5ETLA 4R0JA 1Q78A 3J7YI 5IXUA 4USKA 1UVNA 4DPWA 2E5JA 2B4VA 4OLPA 4G1IA 4C0HA 4AT1B 2OH2A 4DSEA 4B08A 1HNIA 4HDHA 1YGYA 4ZVRB 2K7JA 7FD1A 3THVA 1NK6A 2XWYA 1FDBA 3AOCA 1RTZA 4HT5A 1C1CA 1Q5VA 4KGMA 4B02A 3BQ1A 1SKSA 5DS7A 1IR1A 4ZIWA 3GJTB 5L8RC 3FVYA 3BSNA 1X4HA 3NP5A 3C15A 3RBXA 4NLRA 3PW5A 3M2UB 2RF2B 1MMLA 4KV8A 5ETMA 1N0UA 4HHUA 4WYWA 3Q8QB 2XO7A 2V0NA 1N34F 1VQ6S 4B3RF 5F9NA 2ZUGA 2KZZA 3GSIA 1V3ZA 5MLCV 1KSPA 1N88A 2YXLA 3MTJA 3AOBA 4R0EA 2R2UA 2B7CB 3CC4S 5IZHA 2E7XA 5A8KA 2A1BA 3VF0B 2E9RX 5KG1A 2POKA 2AJQA 2IC3A 2EKNA 3JSRA 5D78A 1HBOB 3HKZD 4P2XA 4N56A 1QAJA 4JI0J 5EGYA 1R8AA 3ZZ0A 4MFBB 1PCAA 4DCOB 8AT1B 2R7TA 4EZ6A 5LMUF 3TZXA 1T05A 2DY1A 1HNWF 1NHVA 1TKZB 5GAGI 2CG8A 2CPEA 3G6XA 4BC7A 3FZ2A 3MGJA 5CXTA 5C24A 1LW2B 3OTBA 3BZQA 3ZNUA 4YS2A 4YOEA 2DIUA 3OR1B 2LXFA 4KO0A 1N0VC 4X66J 3MMBA 1ZM2A 1R31A 2DJWA 4RNHA 1WUUA 4KKOB 3DRSB 5GAEU 1R0AB 3KLFA 2HQCA 4F50A 2C2DA 2UUCF 1ICEB 1NB2A 1NPPA 2G0IA 4A8MP 1S1VB 3Q8PB 4EZ9A 1NDLA 1CS4A 1FRJA 2AYMA 2MQLA 1WF2A 4DCPB 5KFFA 2VONA 3G6ES 3IM8A 5HMZA 4PQUB 4O0IA 4X4RA 4FBUA 3ENAA 2HBYB 3C14A 3H4DA 5C7PA 1GT8A 1M1GA 1U0SA 4ZDNA 3W60A 1HQ2A 2DR7A 1BE4A 3KDNA 3TANA 1SV5A 5AT1B 3MECB 1N5VA 3PXGa 2HHVA 2HHQA 4USHA 4YN3B 4YR3A 3HM9A 3I4HX 2HEKA 2ZBCA 1IXKA 3JAMU 4QW9A 1YKWA 3RR7A 2MHEA 2FLOA 3GV8B 5J1PA 5KFOA 4DV4J 4DSJA 1XMQJ 3MEEB 3HI9A 3A8KA 2Z58B 3TA1A 3TVKA 2MXYA 3V6HA 1N6QA 2HVHA 1RJJA 4DXLA 1S57A 2DNGA 3D6FB 3NGKA 3NOCA 1IN0A 2Z8QA 3IG1A 2PFFB 1HBMB 4RBTA 3I6PA 1NM2A 4LF7J 2C3YA 2N7CA 2ATCB 3GJRB 2M3DA 3HO1A 2VBWA 4WFBQ 1RAEB 1TKXA 4A47A 2YH1A 4ZA1A 3RW6A 2OKQA 3ETMA 3CC2S 2MLYA 4ANCA 4NCGB 1XQIA 5F8GA 5E3AA 1RSCA 5KFGA 3EGVA 4X4UA 4J9NA 1QJHA 1ACMB 1S12A 4NEZA 2YX4A 3MF5A 2FJVA 2H51B 3R6GB 2HLUA 4RW9B 5HL7Q 1U45A 2WBMA 4I64A 2KFNA 3CE8A 3GG0A 3G8TA 5DG9A 4ZPDA 1F1BB 2HQDA 2DNHA 4KGXB 4K7QA 4NLOA 4KQZA 3KLEB 3C3LA 4D3HA 2B0GA 3IM9A 1KWMA 3ZZZA 1ZTTA 1Y11A 1RWOB 2KZMA 2N4CA 5I42B 2APOA 2V94A 4F3QA 2VL1A 4ED3A 3ZTSA 3G87A 1S9EA 4LF1A 3OL9A 4O4GB 4K4TA 2H5IB 3ITHB 1FEHA 5I3UA 1VC5A 4DUYJ 3QLHA 3QRRA 2D3ZA 5KFJA 3IR5B 2DCUB 4PPZA 2XMJA 4YDDB 3KK2A 1AROP 2RS8A 4FS2A 4BDPA 4MKVA 5KFKA 5JJBA 3VGUA 1RKJA 1T3OA 3NAIA 1NNDA 2K06A 3OT9A 2QLBB 2W25A 2EFVA 3JAMY 2XGQA 3EYZA 3CO9A 1R89A 1X5PA 4OZLA 3CJKB 9RUBA 4RNOA 4L76A 4BC9A 4C11B 2XY5A 3I0RB 5AE1A 1Q16B 3IBCB 1X9MA 3RRGA 4ZP7A 1DLOB 2QV6A 6AT1B 1JLEA 3HFKA 2OFGX 4U9RA 5HN0A 4TYAA 2BANB 2MLXA 3P96A 5HLFA 4DV5J 5CAAA 1IBLJ 3IWNC 4PXDA 2L9DA 4DPYA 2MEWA 1FEEA 2DITA 1VISA 1FK9B 1YQHA 3HZGA 4OI0A 1WI6A 4ZVTB 5T7LB 4AQYJ 1HI0P 4UTGA 1NDCA 2OLWA 4OYIA 3CXCR 1HW8A 2CDRB 3IP0A 2O01C 2IJFA 1XR7A 2E1AA 1Q79A 3N0VA 5HP1A 5KFSA 2WVBA 2PA8D 1YJVA 1GQEA 3MM5A 4RW6B 2AEJA 2D69A 1WC6A 2HGMA 2DR6A 1VQKS 1F3VA 3MTKA 2I6WA 1K1SA 4PPDA 1HYSA 3T5JA 2B4PA 2AYEA 3A12A 1Y00A 3R9LA 3VAGA 3BO2A 1U6FA 1AZSA 1WKKA 4PUOB 2K3KA 1P1TA 3HFVA 1IBKF 4G65A 1IKYB 3BN4A 4PYDA 2Z2ZA 4GKKF 1Y4ZB 1R0BG 4YY3F 4DLEA 4PXCA 3UPFA 3KOAA 1U26A 4X2BA 1DTTA 1CQMA 3CDWA 3JYTA 1I51B 4OHYA 1J27A 2PMWA 5E2QA 4LF7F 1ZAWA 1LEOA 4QIGA 4DR7F 1NJXA 1JLQA 3CO0P 2AU0A 4J37A 1L3TA 4M5NA 1HQUA 3W8PA 1D1UA 5HJXA 3BKFA 3HJFA 2UXDJ 4ENOA 2G13A 4RU2A 2QL5B 2MKIA 1IKWB 1SVDA 2BW2A 4F4AA 3VALA 4PG4A 1N36J 3OTOF 2YVSA 4ECTA 1H38A 1VK8A 4Y2KA 5GADI 1S7HA 4IDKB 4LFAJ 1IQZA 3MM7B 4XO0A 1XERA 1FRMA 2IVYA 3GCXP 4NEYA 3IGNA 5KFBA 3PJWA 2KXHA 3QSYB 3W5XA 1I1GA 3IRWP 3CCJS 3TUZC 1WC0A 1X4AA 2B43A 1FJEB 2BJ1A 4K4XA 5HLFB 1P6TA 4C4WA 1BC6A 2QT7A 3W2VA 3J81Y 1HWUA 2KHDA 1ROFA 3QAUA 4B9MA 2VKRA 1DLOA 2MJNA 4ZK7M 3QWUA 3C16B 4OIXA 2FY1A 3TNVA 2Q43A 4NLYA 2Y1LB 3DRPB 3E01A 4CH1A 1UA0A 4URQU 2GJ2A 3M8QA 2E7VA 2VBXA 3HSZA 3PKMA 1FXLA 5DQIA 4X84A 2WSFC 5D0HA 1UJ5A 3CC7S 3G9CA 3W64A 2RKIA 3HFZB 2HQGA 4M5LA 4AD6A 1VQ9S 2X1AA 2Y9HA 2G0JA 5B0EA 3ZXWA 4MK7A 3TYTA 2XHCA 3RZAA 1CS4B 1REGX 4URGA 3Q22A 1AW0A 1IM6A 4PR6A 1TL4A 2MQOA 2BE2B 2KYXA 4LIRA 1FTRA 1LNQA 1N36F 2WVDA 2CQPA 4ECQA 1KVIA 1FFGB 1NSPA 2MZTA 4EU0A 2V67A 3KWMA 3G4SS 1NCLA 1PJ7A 1QUPA 3T3FA 1KEKA 4DMZA 1NK8A 4M5GA 4H4KA 5FDLB 4LF5F 2CQBA 2FB0A 1DQ8A 3SSSA 1AUDA 3KTQA 1RBLA 3D6MB 2G4BA 1MN9A 3BO3A 4QWAA 4JI8J 2OGUA 3DLJA 2JFKA 3D1OA 3T9NA 1YLXA 4X4SA 4DS4A 3DLGA 4TY9A 2E7WA 2N4DA 2I5JA 2NQPA 3ILIA 3EXCX 2L9NA 2SXLA 2YNIB 1TR0A 3U1LA 4JI1J 3M30A 2I38A 1RT3A 4FVMA 4OQJA 2F8MA 3BF4A 4ID8A 2G2ZA 3UW1A 1RHMB 3ISNC 1JNZB 4I7FB 1KDNA 2D74B 2C2NA 3E8OA 1NHKL 5DO2A 2COLA 4YFUA 1ZZNA 1LV5A 1TKXB 1KTVA 2KB2A 2CZ4A 3E51A 2HHXA 1UVIA 1VJQA 2AIRB 5K8NA 2AZ1A 4AXJA 4M5HA 2C3OA 3D6HB 2VQEJ 2MKJA 4KGZB 2F4FA 3OUYA 2CPDA 2B9YA 1C1BA 5A0YA 3WX4A 1WF0A 4LBPA 4URSA 3H42A 3MEEA 5ETVA 5HI7A 5C2GA 1AT1B 5HANA 3PDNA 3ZZTA 3K2YA 3DXBA 3PRBA 5D0GA 4OJ3A 4NZ0A 2H3EB 2M9KA 2CQ2A 3THPA 1KLNA 4DV3F 1S5ZA 2BJ9A 4QWBA 2FJAB 2RUSA 2XHWA 4LSNB 5CYQB 4RW7A 2AX1A 2WB1D 4PQAA 4F0HA 3UVJA 1SJQA 2MLZA 3HX9A 4G1QB 4JUZA 3KLHB 2M52A 1NMEB 2DHSA 1WKLA 3UWTA 4JI3F 3O8WA 4J9VA 4UZCA 4C98A 1QSLA 4A8FA 2VZ9A 4DR4F 2WCXA 1DQAA 1AB8A 4I7FA 4YHHF 4LF4F 1F9FA 2FYXA 5BR8F 3PKYA 1GAOA 2FHJD 3DFEA 2EI5A 3T5HA 3V4IA 2XSFA 2UVUA 4M5DA 3UVJB 4LSZB 2EFGA 2MY7A 4GRSA 4TY8A 1VFJA 3IS9B 2C3UA 7AT1B 4YR0A 1OWXA 1RWNB 3J7Z5 4KIAA 2ADCA 1I94J 4ELUA 2B4UA 1VRTA 2CJAA 4YB6A 5KFCA 1CJUA 2VQFF 1UTAA 2EG1A 2CNOB 4DUYF 2KFYA 4QJVA 2V4RA 4EEYA 1LXJA 2C3PA 1G4CA 1XMBA 3DC2A 3D5MA 3K5LA 4DFPA 2FVRA 4U8VA 4OZ3A 5D4OA 3MR7A 3J7YU 2O1PA 1U0HB 1VOMA 4MKAA 4GKKJ 3O44A 4FZVA 3ZZPA 4OMFG 5CD4H 2BOAA 2W2MP 2MQPA 5A8RB 5C2CA 4UZBA 4ZCLA 3CMQA 4DV7J 4DR4J 4H4OB 8ATCB 2W9BA 3PYFA 3DLKB 3MOZA 4UUXA 3MR6A 1TVRB 1RWXB 2LLZA 3W3SA 3WIUA 3K5NA 1C0UA 1L3SA 1S1WB 1S76D 4JOUA 3T5LA 2HWTA 2JWNA 3D68A 1N8RT 2HS0A 3UN5A 3GYNA 1YJWS 1SJ4P 2ZOMA 5BYSA 1BQNB 4EGLA 4GKJJ 2RHQB 2QMUB 1RA6A 2YWEA 5LL6d 4KC5A 2V2ZA 4ZVUB 2RKIB 4OHVA 4ATNA 4E98A 5HAOA 2M5YA 3RUBL 2JEFA 1U25A 2P9GA 3M2UA 2Q66A 4DR6F 2QN6B 1FHTA 4J9RA 3LALA 1IBCB 2B9WA 3P45B 3TUJC 4DR2F 4EBDA 1TL3A 2R7XA 1C0TB 3TA0A 4F4WA 2BACA 3NGRA 1GMVA 4CYUB 2R8IA 1R8CA 4ED7A 1FERA 4WWSA 1W2BR 1R7IA 1HNZF 1F5CA 2A6MA 2V34A 3W2VB 1HNIB 1VJWA 2CG4A 1UEKA 3KUGA 2Z57B 4L3KA 1T7PA 2XNRA 3W8GA 3ZZUA 1Y0HA 3FBBA 5FDLA 3NMAA 4FF2A 3JSBA 2OPRA 2BQUA 2K2PA 4OYOA 4USWA 3HVTA 2VODA 1IM4A 2R7RA 2BBEA 4IKAA 5KFUA 1X7VA 3RB6A 2GX8A 3P6YC 4OX6A 2JC0A 4C8YA 1Z1ZA 1RT5A 3QT8A 3UDCA 1NK4A 2W8LA 1M5PC 2M0GB 1GXLA 4QU7A 3DKDA 1OY9A 1HL6A 4HYKA 4W92B 4DV0F 2YKMB 4P9SA 1K1QA 1UJ6A 1IBKJ 4F04B 2E29A 2Q6BA 1KOOA 3RBEA 2ALYB 2OJ3A 1RP5A 1H2VZ 3CJ2A 1B0TA 1YRTA 1RT2B 5KFEA 1LW0B 2RS2A 1LW0A 3V6DA 4ZVFA 2QIFA 5HROB 5IFMA 3GIKA 2OSQA 3Q23A 3LP0B 4K5RA 3IC1A 1MWZA 1KQKA 4V19X 5KFLA 4HACA 1RT6A 5F3ZA 4P6QA 5L1IA 2MZQA 3PV8A 1YJ9S 3CCWA 2W2NP 1OYDA 4F02A 1SH2A 2J8AA 1QUVA 2VASA 2YQ1A 2ZWOA 4HR2A 1OY6A 1UWBA 1RHQB 2HNZB 3H5SA 3W9IA 3PO5A 1MU2B 2PC6A 2KXNB 3QAEA 4J9SA 1PIEA 1LWFB 1OSDA 5AJ3F 2XLKA 2NZ4A 1D8YA 3HVTB 2J0SD 1AZSB 4DR5F 4QZVB 4ECYA 2C1EB 2KTQA 3ZTPA 2OO4A 4DS5A 4OHWA 1NBEB 2GGPB 1PYSB 3GB0A 3OPKA 4RU9A 3VQTA 1FKOB 2H4YB 5IT9U 1L3KA 4EI2A 4JI7F 4EK2A 4Z7CA 4ILRA 4IH6A 5CYMA 5JVGQ 1U1OA 3UDEA 4F7VA 3VGTA 4DV7F 3OVSA 3NMRA 1AYEA 2GJIA 5B0DA 4JI6F 2CNKB 4X4NA 3NLCA 4X62F 2HHHJ 3KXDA 3QJLA 2CNNB 2PN6A 5D0EA 5B0AA 2ZC3A 3TUIC 2YX7A 3PEHA 2DIVA 4LQ9A 1VQNS 2QEXS 2QYGA 4U7UD 1VMBA 2CYYA 3AD8C 1X5OA 2VD3A 3DYAA 3VR1A 2R8HA 5DM7Q 5KFNA 1M5OC 2YKAA 5DZ6A 1FRKA 1RUSA 2H65B 2JRSA 2RMLA 4X4OA 1RLDA 2ZFHA 1WC1A 3MPDA 2CPZA 2LXIA 4XPEA 2RU3A 1N5YA 3L4BC 2GVZB 1LWCA 1URRA 3CCZA 3CD0A 4DU8A 3L7OA 4LIWA 2F3JA 1NDPA 1HA1A 4NA2A 2ASJA 4H4OA 1GXTA 4XK8C 3KLIB 2IDLA 4QR0A 5U47A 2B56A 3JS9A 4HTIA 3MM5B 3KK3B 1U47A 4A8QA 2KHCA 1I6JA 1LQ9A 2R7VA 2MMYA 4RL1A 4EWTA 1R0CB 4AXIA 2GAHC 5J2MA 1WSVA 1XEZA 1CULB 2ZD1B 5GAGU 5FLXY 5EHHA 5KOWA 3POTA 3K59A 4LJMA 4WK1A 2R2RA 3Q0AA 5KFPA 2PI4A 4AYBD 4XIUA 1RCXB 4C3KA 1S0NA 2PO4A 3M2RA 5DLGA 2MKCA 3JSYA 1S6QB 2DVIA 3FBCA 2CNLB 4FS1A 2GCFA 1AUSL 4USMA 3HZEA 5KFIA 2KVIA 2BANA 4ECSA 2CA9A 1QTNB 2E1RA 3BBBA 3R5AA 4OI1A 3ZTQA 2V9WA 5ETPA 2DNMA 1VBXA 5BYQA 4USTA 4CLYA 3HMJG 2XI3A 1GX6A 3OHBA 1U2RA 1FX2A 4O4RA 1UEUA 5LMNF 3HXMA 3W9HA 3SEOA 1TUGB 2A2DA 2WOMB 1H74A 1FKOA 1VIOA 2RDDA 3KHLA 2JEGA 3TQ1A 4I1TA 2HFVA 3KK2B 1BD6A 1XR5A 2IY5B 1BMQB 2B4OA 2KT3A 2M4MA 2HQIA 4OYAA 5G0RA 3T6BA 1ITPA 3R1LA 2XQCA 1Y5NB 3QSIA 4W4MA 4X65F 4TLQA 1TL7B 2R7UA 1Y5IB 1W2IA 5CHCB 3FUYA 4KHMA 3Q83A 2NXJA 4UW2A 1VQ8S 2VA3A 1NXIA 2N7YA 3FEXB 4FYWB 1S48A 5IOLA 1ZOTA 3T1AA 4JI5J 1SI9A 5DETA 3MUTP 2B8QA 3T1YJ 1QE1B 2P9CA 4ED2A 4C8KA 2GNKA 2J9EA 2ZZTA 3BH6B 3SIPB 4LF8F 2DH8A 1RBAA 2XYPB 1CPZA 1NO8A 1UWAA 2KI2A 3GG1A 2L08A 3HSDA 1ZM9A 2XULA 4GO7X 1ELOA 4OHXA 4OV6A 2R9LA 3B54A 2YNIA 2UU9J 1HD1A 3UR3C 2HNYB 5CABA 4K4YA 4L75A 4USIA 2HQFA 1KHVA 3NCRA 2E5LJ 2JL9A 2W4CA 3CCQS 1S1UA 3AOAA 4J9QA 4AUKA 1SH3A 4PQUA 2CQ0A 2LEBA 3LANA 1B64A 4JV5F 1UL3A 1K8AT 1OPZA 2NREA 3IRXB 1MWQA 1RT6B 2DD8S 3DMJB 2BRKA 3GIIA 2AHOB 2E66A 1Q8KA 2JVOA 3FFIA 3QIPA 2G2YA 3FSYA 3QIPB 2UXCF 5KFHA 4ZP8A 2KKHA 1Y3JA 1VBKA 2BE2A 2XEXA 3LW5C 4RKUC 2I1RA 1PJ6A 4W98A 1GK8A 5F8HA 3T1YF 3FEYB 4PWDB 4DJBA 1RWPB 2QGFB 4IR1A 1TQLA 3FCHA 2F4VJ 4CO5A 4NI2A 1UVKA 3F56A 3CWJA 2RT3A 2X3GA 3G2XA 3P4UB 4QIVA 3CJ4A 4U96A 3T9ZA 2IM3A 3IGVA 1T03B 3CSKA 3NNCA 2BABA 1GEHA 2ZHAA 5B0CA 1RT5B 4UOFA 1HI1A 1FRIA 2EK6A 4RBUA 1TV6B 1HD0A 5D3GB 1KD1T 2DGUA 1EHWA 3M6XA 1FNXH 4QBUA 2KO1A 1NAQA 5HQ8A 4LF8J 4HLBA 4JI6J 4QCLA 4W90B 2BJ8A 5HMWA 1SC4B 1DAXA 2VG7A 1U8SA 1RDRA 2DNRA 3NS7B 1IWGA 3OBIA 1BWVA 1TELA 2RB7A 4F8RA 2VU5A 2FJXA 4CLFA 3BPDA 2BX6A 4X65J 3BM7A 4A4JA 1SH0A 4TQRA 2XMKA 3I56S 5EN1A 1C4CA 4G1PA 2ZBRA 2ZDPA 1IWAA 2HFZA 1U48A 2RIJA 3PACA 3JSMA 3MCSA 4ES1A 5D4LA 1NEEA 3A13A 2OPSB 4ER8A 4NZ7A 2F63A 4PG7A 1EQ0A 4RJVA 5D4PA 5D6GA 2HURA 3BGUA 3JQKA 5MAOA 4DUTA 4LBIA 1P8GA 3OV7A 1G3OA 1XTZA 4YB5A 5A6WA 4CM0A 2QYCA 3AB2B 1HR0J 2YNGB 1QSYA 2FLLA 2MYFA 1S1WA 4C8NA 4DV6J 4MAKA 1JLQB 3SQOP 2G2OA 4PEOA 3GIMA 3C2PA 1TP7A 4I6AA 3VTIA 1JLGA 3EWGA 2GVDA 2V5HG 4ZCIA 4RNNA 4WKYA 4CH7A 3MAQA 3MFIA 1LWXA 2HNDB 2QA4G 3GYGA 1U7LA 2EKYA 4K4ZA 3LWMA 2K1RB 4NLPA 1PSDA 3M2RB 4B3TJ 3C6TA 2CFXA 2CQ1A 3D0IE 1CLFA 1N4LA 3B6BA 1JLAA 3OFEA 2WSEC 4NLQA 2R7OA 4LRDA 4WPAA 1D9DA 1KRPA 3NGDA 1WI8A 4ZVOB 3PW4A 4WXWA 4Y0FA 2Y3YA 2BM0A 1BQMB 3V81B 1URNA 3L7PA 3A3PB 1RABB 1HWLA 1XNQJ 4LRAA 2HRUA 1HHQA 4QU6A 2CQIA 3DU5A 1YJ7A 2AEMA 5J1NA 4E8UA 1FJCA 1JLGB 3ILLA 3PRVA 3V6KA 1UETA 3F41A 4G1QA 2DNPA 4ZPVR 1PJ5A 4FN5A 2MKYA 2HGLA 5KTQA 4U7CA 3BJYA 2H1YA 4BBYA 3X1LB 3DRRB 5B7WA 1LK7A 2CAJA 2DNZA 2FQQB 1WORA 1W26A 2IBOA 2F5GA 2M7SA 4NRTA 4WP8A 3D3BJ 2HMIA 2C2ZB 4TNOA 2FY8A 4PAAA 3KK1B 1J5EF 3QMQA 3H98A 3DOLB 4OZ2A 3DOKB 1IBMJ 2K8GA 2EBEA 2HKEA 1CJVB 3CGIA 1TKTB 3NS6A 2J7WA 3GR1A 3HPOA 4F0MA 4MK8A 2CQHA 4I68A 5F8LA 1VQ4S 5I3PA 4O44A 1F5BA 2R8KA 2HZAA 1EARA 4GO5X 1VC6A 1WG4A 2XBPA 1AXQA 2GO9A 5KT7A 5KT3A 1VQ7S 3M9NB 3J80U 4IRKA 4RLEA 5F0WA 2H5EA 2N82B 4ECVA 1RE1B 1YJRA 4C0OC 4D3GA 3EDQB 2N3OA 2EG2A 3QJJA 2DISA 5B08A 4TXSA 2C3MA 3ZFVA 3PIPQ 4AQYF 4F2RA 5I3UB 1QM9A 2PFDA 1TV6A 2HIQA 2WTFA 5LSOA 2ASLA 2BV3A 5ETQA 5D3GA 5M2PA 1A7GE 3ELHA 2KU7A 1XWLA 4I2QB 4C9DA 2VUGA 3RB0A 4NA3A 5KG2A 3MEDB 2DY9A 5J1EA 1RI7A 1IKVA 3I32A 4LR8A 5E3QA 3OXFA 2MB0B 5DM6Q 5EWGA 1QLNA 4HI2A 2MQMA 1CEZA 1F0XA 4YHHJ 5HROA 4OJ1A 2UUWA 4LF4J 3MPYA 3BB5A 3W9JA 5F9LA 4GC7A 1X9SA 2VF3A 2HSEB 3SXLA 4F4YA 1Q82T 2B6AB 1O51A 1M5VC 2GQQA 2OEMA 1FRLA 3AB4B 3NRBA 3CD5A 2M2BA 3BGFA 3IR7B 1REVB 3JTPA 4B3OB 2HHWA 8RUCA 4QIFA 1U4BA 2CWXA 2CQCA 2ACYA 5F3TA 4ELVA 3CCRS 1EIYB 1RT7B 4B9TA 2FJWA 1XMOJ 1W25A 2QX0A 4CCHA 4LF6J 2MKHA 4X4QA 2Y8WA 2HFUA 4Y2MA 2W2PP 4EUVA 2VJVA 2BZ2A 2FZCB 2HNYA 3I0SA 4USVA 3ZC4A 3UD4P 4NOHA 3KUHA 2ZH3A 1A6LA 4CM2A 2IJRA 2HS3A 3RRHA 3K57A 3C16A 3H40A 4Q0BA 4F0KA 1LXNA 3Q8UA 4NYOA 3N6LA 3Q8VA 5GVQA 2W2OP 1XK8A 4MT1A 2F7VA 4WU3A 3PR4A 1JLAB 1YJUA 1SV5B 5IV3A 5I3QA 3J80Y 1Y9OA 1TK0A 3CULA 1YZ7A 3C6TB 4QW8A 3TZZA 5DQHA 1IBMF 2R42A 5BYRA 2U2FA 3D6TB 1OY8A 4UY85 2HVDA 2MQNA 3IMQJ 2BUNA 2UP1A 3PRDA 2YKNA 4ICLB 4N5SA 1B0VA 3JQMA 3NNAA 3SZ2A 4Z7YA 3R5DA 2ZJPQ 4C8ZA 3FNNA 2Y1JA 2DCLA 3GTYX 3KLFB 1SL1A 3K0JA 4RO0A 3T19A 4YB1P 2YWHA 3KMQA 1S1TB 3DLKA 3LO3A 4OYBA 4ETXA 3MMBB 1SC6A 4ID5A 4X4PA 4NYZA 4LFBF 2HFNA 2VPYB 3BGRA 3H5UA 1HHTP 2RU9A 3KMSA 1LW2A 4DDFA 1JJ2R 2AGPA 4DV4F 2FLPA 1TL1A 3U7JA 4DR3F 1RAHB 4IFYB 3KJQB 2QL7B 2AD9A 4NLUA 1X4BA 2QL9B 4MFBA 4QYZK 4NXNJ 1S6QA 4LBHA 2PIIA 3ET6B 4H54A 4RPFA 1NKEA 4ELTA 2L9WA 2E5GA 4NYPA 5HO4A 2KG0A 4F36A 5LJ3Y 4LF9F 1RT4B 3H2VE 3WDOA 2ZD1A 1JXVA 3D4JA 3N6MA 1QVFR 3CCLS 3QO9B 1Q7LB 2HRTA 1O5JA 4Q8EA 2VC0A 2ILYA 3CW2C 4B3SJ 2IYIA 3C6UB 1U49A 3J7A1 2ASDA 1F9HA 1XIQA 3A8EA 2VC1A 4KGKA 2HHTA 1RAFB 4J90A 5K5MA 1UKUA 3UE2A 5CYQA 3AQOA 2YQ3A 3BQ2A 4OJGA 1MROB 3FCWA 3QYYA 2IHR1 1FKPA 2DHXA 1T03A 4IH5A 1TFWA 4PXBA 5AXNA 2ZH5A 2G0CA 3RYLA 1HQEB 3QNWB 3TZYA 5DDOC 3TX0A 1X5TA 1IR0A 4WE1B 1KBRA 3GFHA 5DLFA 1IBLF 4I67A 1YSJA 3M8ZA 1C1BB 5A0YB 2XGPA 1NJYA 1VIXA 4JV2A 3M32A 5KG7A 1U1QA 2UU9F 4G3IA 4ED1A 1YTYA 3RGIA 4C11A 2KM8B 3EGNA 4IFVA 2DKOB 2D3OR 1QY7A 4EBCA 3KYLA 1RKIA 1GMWD 3MM6A 2DNYA 2VBZA 2YPYA 3NKYA 4GMKA 4ANEA 5K8PA 2KM8C 1FCAA 1YHQS 2XMAA 2AWZA 6FDRA 5GAHU 3UCUP 1VQOS 4I69A 2BMBA 4DQQA 2HBQB 2FHJA 3HD2A 1QSSA 1FVSA 1RTHB 3ISZA 3DXSX 1Q0NA 3TOQA 3BV8A 4ES3A 4RUHA 3M8SA 3EZ5A 5L1KA 3TEGA 3QLHB 3ENWA 1LWFA 3ULHA 3KNGA 3F73A 2RNEA 2DK2A 5GADU 1V9OA 3CJQA 3ENQA 1EB0A 3NGUA 5KFXA 2VFSA 3PX0A 5LT5A 5DDQC 2DB1A 2HYIB 2QA4S 5I42A 3GYXB 4S0MA 2QMWA 4DR1F 1RQ0A 4L73A 5D8HB 2OD6A 1LFPA 3S1TA 2DEJA 1UVJA 3CJRA 3BEGB 4U6PA 2A18A 4Q43A 5DJBA 2H4WB 4QWDA 1TL7A 3SCJE 3KNAA 3R3TA 4DFKA 5H9EK 3T1HF 3H0PA 3RTVA 1RT2A 3OSPA 3DU6A 2W1BA 4FP9A 4ILMA 3N4WA 1N6QB 3PY8A 3CDAA 4NMLA 3MR2A 2CQDA 2QE5A 4DN0A 4KFBB 1OS5A 2CQGA 4HKQA 2DHGA 3CJTA 1P9QC 3FSIA 4LF9J 4EMDA 2DH9A 5ETTA 3QGGA 2MSSA 3ENVA 1PC5A 3HHNB 3CJ8A 3FC9A 1T94A 4ITSA 1NB7A 2JFDA 1BHNA 3P5BP 1MROA 5ETOA 1U1LA 1Q81T 2O5DA 5LXRA 4QWCA 3ONQA 4CQ1A 1F6TA 2LQBA 5ITHA 4Q8FA 5C42B 3WX8A 2YWFA 5K20B 2OEKA 2CUYA 2Q6CA 2RRNA 2GJFA 4Y6IA 4OX9F 4M8LA 2AKWB 2GMJA 4KH0B 2JEIA 2HW3A 2CPJA 4JB8B 3EJMA 3MM9B 4IG0A 1H7XA 3EXYA 4WE1A 2R8JA 4V19J 1KP6A 3NCQA 1WC3A 3LP2A 1CQNA 1IJEB 2ZBIA 2V69A 2DR9A 2AF6A 5HVGA 1UA1A 1RHJB 4ED8A 2YWGA 4FXVA 2ZJQQ 3R2DJ 2OMOA 5A8WA 5HJYA 5C24B 2EBGA 4N8NA 3BQ0A 2GIQA 2QFIA 3HSJA 1JXEA 1HMVB 3SDEA 4OX8A 2RDJA 2E5IA 3A3OB 1EP4B 2D7SA 3OTCA 5E3CA 5ETNA 4C48A 2W8KA 3OXGA 1G1XA 1ZM4A 2E9TA 4ID5B 3QZ7A 4UOHA 1HQUB 2HHPA 1E6YA 1HBUB 3CPWR 3UDLA 1NSAA 4WTOB 1C0UB 4XAKA 3DRYA 1M1KT 2LQ9A 4DLGA 1TVRA 3P5TL 2EWHA 4P2MA 1JWWA 1SKWA 2HRYA 3ET6A 2VJUA 1WG5A 1ZA2B 2V50A 1CJTA 1DTTB 4AFFA 3CJSA 1OPIA 4OYMA 3Q8SB 2KT5A 1VLOA 4YB7A 2KG1A 1R8BA 4DF8A 2OIHA 4ZVEA 1DY3A 2FTRA 5A8WB 4FKYA 2WVCA 1T05B 3PYDA 2OUGA 4OFZA 4OX7A 3JSMB 2NXEA 2UV8G 4LR7A 3MZIA 3GONA 1KKHA 3FGVA 3OQ2A 3D66A 2AYBA 3F44A 1RAIB 1S4EA 1HBOA 1U02A 3DGVA 1RA7A 3IS9A 4NRUA 4YR2A 4NXMJ 1C1CB 5B0GA 3GFZA 4K5SA 3LH2S 3ZZYA 1GX5A 2IRXA 3CMES 1P27B 2LMIA 2FGOA 3HCXA 4DUZF 2AMCB 4DR1J 2RQ4A 3D54A 3BKTA 5IWAF 2I9SA 3I0SB 3HVRA 1F2HA 2KXFA 2ZH7A 1Z2ZA 2XG8A 4ECWA 5BJRA 5AXMA 3C15B 3TR5A 1FK9A 1EAYC 3HSGA 2R2TA 5CZVA 4KHPJ 2YNFA 3A3NB 3MCNA 2VQFJ 3EUNA 3UFCX 1YVFA 1NKCA 4CLSA 3BDEA 2FC9A 3MURP 5SUHA 3PW0A 5KT4A 4UQGA 2QLXA 2BYCA 3KHRA 4OZ5A 3MCMA 4KB7A 1AA1B 2B6AA 2WZ1A 5CZXA 4X4VA 2LXUA 2F1FA 4O3SA 4PWDA 1TU0B 3TW0A 2RVJA 2ZHBA 1LFWA 1TK5A 1KVJA 4DUZJ 2XNQA 3BSCA 4OI3A 2LP4A 2ZITA 3M6WA 2R2SA 2BE7D 3C19A 4JI7J 1WTFA 2J76E 1U1KA 3P8BB 4WF9Q 3S8SA 2XI2A 3KJVB 3NXZA 3AY0A 4QR2A 2V4JA 3J7ZT 3KJNB 3AQPA 3EM1A 1T11A 4WK3A 2BVZA 2BXJA 1NJWA 1SQEA 3OXLA 3KLGB 2FC8A 2M70A 5KFVA
chains in the Genus database with same CATH topology
1YWXA 1R43A 4H4MB 4ECXA 4A46A 3OLBA 5K9FA 2V2KA 5J2NB 4IOAQ 4IQMA 2MKKA 1IKXB 1BQXA 2Q79A 2MZSA 2W9CA 1HNXF 3NL0A 3DLGB 1TAQA 4GKJF 3BS9A 4QYZJ 4R5PB 1MWYA 1OQ3A 3U02A 1FJ7A 1SUQA 2JVRA 4GC6A 3RBDA 1X0FA 1RTDB 3IXQA 3LGNA 4DEZA 5AE2A 1RTDA 4WFYA 3M2VA 4HEA9 2H9ZA 3PW2A 2J7KA 2XMVA 4IFVB 3DCAA 1Q4RA 3G96A 3DGPA 4DL7A 1WHVA 4HH1A 1ZPVA 1UP1A 2G9OA 4J5OA 5F0UA 4ZKAA 5EUHA 3VAFA 4KRWA 3JTOA 3V6JA 4X64F 1WACA 3BSAA 2HLTA 1JLBB 1VS3A 3DRXA 2IRUA 3OL8A 4FNHA 3R27A 1X4DA 1R27B 1FRXA 3LAMA 1QAYA 4JI8F 3VZIA 1FKPB 1T3NA 2F9JA 1JMTA 2MZRA 4IYQA 1JIHA 1TKTA 4U7UK 3CJ0A 1RT1A 1RTJA 4MH8A 4B9SA 3B4MA 2RDIA 4ECZA 3OFFA 1VRUB 1K0TA 5FIIA 1H6KX 1N5QA 3D28A 4O3QA 3JB9k 2HMIB 1RT4A 3M6UA 5H9FJ 2GC8A 1SBRA 1YG0A 5LXYA 2VG5B 4NLXA 3EX7B 3KLGA 4ERDA 1WHWA 4QIEA 3CDUA 2GQ2A 3W2WA 4YEAA 2VG6A 1QAIA 2CPIA 1HW9A 2YKPA 3CT9A 3KJVA 1IKWA 4BHQA 3MOJB 3DRSA 3LP1B 4TKTA 1JXLA 3CCMS 1S1TA 4CO0A 4KPYA 1LWCB 3DHWC 3PIOQ 3LGMA 4B3MF 3OJUA 1SIWB 5E3PA 2BA9A 3FMBA 1PC4A 2LDYA 4PWUA 2JLGA 1Z2LA 2LEPA 4NCBA 2XMMA 1DURA 5KFWA 3OUYB 3M9OB 3M05A 1TK8A 2DRAA 2GMHA 4NZ6A 2DNQA 5AXKA 4QOTA 4CH0S 3OLAA 2HQ3A 5EX3A 2XB2D 1KNZA 3BR9A 1J5OB 4TU8A 3C46A 5C5JA 3CCVS 5DDPC 3QGPA 4LSLB 5J2QB 1NH7A 4F25A 5D4NA 4U67Q 1B7FA 1YJNS 2ADBA 3RW7A 1HWJA 5M2RA 2J9DE 2QO3A 1YRXA 2BR0A 4C97A 2XS7A 4NX9A 3MMCA 3HLUA 1KFDA 2W7PA 1BLUA 1J2VA 5KFMA 4DG1A 3V2UC 1MU2A 2CZVC 2OAUA 1KQSR 3MDFA 4M94A 4I0WA 4Q44A 5K14B 4JYAF 2VG7B 3QIDA 3CDBA 2NLWA 1WEXA 4MTPA 1NU4A 2GIRA 1F60B 5KT5A 4MJKA 1RYSA 3DLLQ 2WHOA 1WWHA 3H8YA 3DMJA 5J2PB 3MFHA 5KFRA 2MGZB 4UOCA 4J9KA 4LQ3A 1E6VB 4YDXA 2VV5A 3GWCA 1ZAVA 1VBZA 1UAWA 5KFAA 4F67A 2LEAA 1S1XA 3PFOA 1XMOF 1UFWA 2PD1A 1FDAA 4IRDA 1R6YA 4WYLA 3GILA 1NK9A 1K9MT 3QGHA 4ZHRA 2RRBA 3NCPA 1UVLA 3DRPA 3E01B 1ZH5A 2DNLA 4F26A 1N5TA 2AJFE 1IJFB 3FFIB 1YJTA 4ZPWR 1U09A 4DV2F 2IRYA 1FKAF 3B78A 4HHJA 2JJ4D 2M88A 2UXBF 1X4GA 1U6ZA 5K14A 1CSJA 1X0PA 3S01A 3SFUA 2FDNA 3IAS9 5E7OB 1AFJA 2LA4A 3CCTA 1Y3KA 4A8XA 1JLCA 1XBWA 4WFZA 4ED6A 3TAQA 1TL3B 3M8RA 2IFXA 5L1JA 4Z2XA 1JJHA 1SL2A 4IDKA 3TX8A 2A3JA 3CVKA 5DGAA 2ZZMA 1DTQB 4DL5A 5L39A 2JC1A 5THWA 3NS5A 3H4BA 1QE1A 1J5OA 4ES2A 2XLJA 2XY6A 2KJWA 3OR2A 2FIUA 4Q2LA 4F3OA 4CO2A 2IJNA 3S7RA 3JYTB 2JDJA 4EO8A 4KR0B 3SSRA 2P6SA 2MZ1A 2CIMA 3DDKA 1GNKA 3AAWB 1ZTWA 4DL4A 1KLMA 3ZZRA 3DNCA 1R3NA 3I5CA 1IKYA 4Q2MA 2FVQA 2MSTA 4PUOA 5IT0A 1ZAXA 3H59A 2QA1A 3IO1A 3D1QA 3DDNA 5J2MB 3LP1A 5IT9Y 2JSXA 2ROGA 1SJRA 2FVPA 1N48A 3MR3A 5D77A 1GTEA 4NLGA 4C8LA 1WD6A 4DOZA 4QWEA 1JX4A 1FA0A 2XMUA 1TAUA 2YNHA 4LVOP 1NRKA 3D0GE 1XMQF 3SV3A 4KAIA 4CNZA 5T7LA 4L3NA 2HZCA 3AA8A 2NUHA 4LSNA 5F8IA 2AX0A 2YNGA 1XR6A 2GHVC 3EGWB 3OR1A 1S4FA 4WTYA 3R5CA 5KG6A 2ERRA 3Q2TC 4QR1A 2ABYA 4CT9A 5LJ5Y 4XPCA 2V4RA 2DNKA 1I94F 1S49A 1VRUA 2ZE2B 4EO6A 4NLWA 4C0BA 1FE0A 3P3DA 2FHOB 3M9MB 4NCAA 3BGRB 1V3RA 2X1GA 2OMLA 3KG1A 2F8EX 4DF4A 3SCKE 5KG4A 3WBZA 2MY8A 2XS2A 2ZOFA 3T5KA 1HPZB 1FTCA 4NLDA 1VQPS 2C28A 4DSLA 2VA2A 1D9AA 3LF0A 4IQXA 4KE5A 2XMWA 2HWIA 2GA7A 3MI7X 2J5AA 5L38A 1LWEB 3O1LA 2CQ4A 1HR0F 4NL5A 3GR0A 4TLRA 2NYIA 3UD3P 3K7RA 2QSWA 4PCQA 2HS4A 1U24A 2EFPA 2ZDOA 1TKDA 3ETOA 3SI8A 1JLFB 1BY9A 1UW4A 3DM2B 2E5HA 3TO8A 1WG1A 5F8JA 5JUMA 1LK5A 4RZRA 4J9PA 1YITS 2CPYA 2VQEF 2ZKTA 4DN9A 2BJEA 3I5AA 1D0EA 2B7BB 2AV5A 2JHEA 4HI1A 4YQWA 2MDAA 3PNIA 3LP0A 4WFXA 1S9FA 1KS2A 3V4MA 4B3SF 3SYZA 1WELA 1WF1A 3VZHA 3BO4A 3CB4A 3AHPA 2OFHX 1M5KC 3N28A 3KLVA 4DSFA 2HFOA 2ZNZA 2HPUA 4O3PA 1OSCA 2Q1LA 1X4CA 1AW0A 4A8OA 5M2UA 4A8SA 2DRBA 4FVCA 4MKBA 2D9PA 2HNZA 1RT7A 3OL7A 2B9XA 4FXDA 2EFNA 4ICLA 2ZOGA 3W2WB 5KFDA 2K7KA 1N33F 3BR8A 1X8DA 2V4JB 4CT8A 3JTNA 1Y7PA 3SMZA 1IUJA 4QPXA 2PMZD 1SIZA 2C2EA 2MPUA 1S9GA 3M8QB 2FLNA 1EETA 2CJKA 1NJIT 3SQGB 2ZZNA 2CPXA 1VQMS 3I9V9 2FHMA 3L09A 2HVZA 4C2MA 3FJ2A 3HDSA 3HHDA 4NLSA 4B17A 1M5HA 3RAMA 2AYGA 3BSOA 5L9NA 1S6OA 3WC0A 3SQGA 2YNFB 2Q3PA 3KFWX 2OTJS 1D8ZA 3CTRA 1QVGR 3FQKA 1YI2S 4NXNF 2DBBA 3O2IA 3NG8A 3ZZOA 2R7QA 1M5SA 4JV1A 3DLHA 1DFDA 3UQSA 2R7WA 1YIJS 4R25A 3QZ8A 3G6VA 4HDGA 3K58A 2UXDF 3RAXA 3IAM9 4KO0B 2Y1IA 1VI7A 2VPZB 1VGYA 4NPOA 2BDPA 1NZAA 2KT2A 4MMOA 4RWWA 4WJBA 3Q24A 3CF5Q 3H2LA 1H7WA 2IM2A 2D3UA 2GQCA 4CI0B 3NBPA 1TL5A 1IKXA 2W9CB 1NKBA 1VRTB 3GV5B 4Y34A 4I2PA 3QJPA 2IMWP 3DLEB 2C42A 4FF4A 3POTB 3CEDA 3GFXA 3C66A 2HHHF 4Q5VA 1U1NA 4HVZA 3VAHA 3X3UA 1FD2A 1NH8A 2WRMA 4I4BA 2CVEA 1MNEA 5A8KB 1UMJA 2PA3A 2V8DA 1LWEA 2KFZA 5SZTA 1EP4A 3OL6A 4HT7A 1HMVA 2RUGA 4WFNQ 2Z2LA 4M1KA 2LYVA 4IH7A 4DQRA 2WK4A 3PFEA 4HTJA 4RW7B 3SSQA 4DQSA 5K8OA 4Y2CA 2BRLA 4ZP6A 2OTLS 2UVVA 1S10A 2VKZG 2AW0A 1WEZA 1HARA 2K1RA 1LKZA 2QLWA 3U1NA 2CRLA 1FD8A 3TRGA 2P5VA 4C3MA 3P49B 2FJBB 3B4DA 3CCES 3DRRA 3N5FA 1JJ4A 1WTBA 5L1LA 2PDAA 1T95A 4K0KF 1N32F 4OV1A 1HI8A 3THTA 5I4MA 3OTEA 4N41A 4I6WA 2LCWA 2C22A 5CYMB 4F4XA 1SJ1A 2NPIA 2RH3A 4CTAB 3Q8RB 3I31A 1BQMA 4KT0C 4OI6A 3V81A 1ZETA 7FDRA 1F2GA 3CMAS 4DV5F 3BREA 2PMHA 2I5JB 3TA2A 2ILZA 4JBCA 4XDCA 2OD4A 4NWBA 1FXDA 2WBRA 1K0VA 3IBWA 2LDIA 4RW4A 3TAMA 3EGZA 1NK7A 1UWBB 4J9OA 2VPWB 2QA2A 4R8UB 1FXRA 2YX1A 2W7AA 2ZH9A 2ROEA 1R8PA 4CO4A 2CQ3A 4OI2A 2QFJA 5E5NA 4IOCQ 4DL3A 2CDQA 2FHKA 5E3RA 5E41A 2ZH8A 3VCDA 1CVJA 5HMYA 2RJZA 5KG0A 3DLEA 3V6DB 3U1MA 3O3LA 1KTQA 3T6JA 3KG0A 4RW9A 2ZH2A 3MPVA 3LWLA 4FF1A 3RRKA 4B9LA 3N01A 2MJUA 1TFYA 3AJ1A 3HT3A 2LU2A 1Z4UA 3SDEB 4C3LA 3OVBA 1E6VA 1PGZA 2X1FA 2OPSA 2J0QD 1H0HB 1U1RA 3EPIA 4ZPTR 1UJ4A 2V8HA 1OIAA 2F9DA 3UCGA 1YRUA 1S72S 2ZHOA 2YKOA 1HBNA 3CJ5A 2QRRA 1HBMA 2GV1A 5AE3A 4YMEA 1S6UA 3PJXA 4DV6F 4ECUA 1S6PB 4RW8A 3MM9A 4IG0B 4WZMA 4K59A 1KN6A 4UQTA 1CG2A 5IM0A 5IM0B 3IA0A 1DRZA 2WB4A 2FUG9 2BJDA 4ECRA 1MMDA 2Z0GA 2CPHA 4DFJA 4MK9A 2DGOA 2W24A 3CUNA 4FYDA 3V5RA 4H4KC 4DG1B 2XSJA 4AL5A 1C0TA 2YY3A 2BOPA 1FDDA 2O3DA 5CH7B 3UCZP 3MD1A 1SXLA 1FESA 1NK5A 5B0BA 1O0PA 3DI6B 4J9MA 1A9NB 2ZJRQ 3DLBA 2I8EA 2WSCC 4LSLA 1KQFB 5J2QA 2MGZA 4FF3A 3RB4A 1S6PA 4RW8B 3K5OA 4OI4A 4TQSA 1EETB 3IWLA 2Z4PA 1U1PA 4KKOA 4LVNP 4ZCMA 4KHRA 4N76A 3SV4A 2W9BB 1NK0A 2V9KA 4OZ0A 2B5JA 2ZH4A 2UUTA 3IRXA 3KG4A 5T41A 4AL6A 3G86A 1WNEA 4R8UA 4CO1A 1GH8A 4TN2A 4UY8T 2O67A 5DRKA 2A10A 5E0OA 2HGNA 4I6YA 4BS2A 2D41A 1SL0A 1HNVA 2L3MA 3CD7A 4K2XA 5T14A 4DV1F 2Z2MA 2DR8A 5KFTA 1VC0A 1FRHA 3TP2A 2VBYA 4CTAA 3GMGA 2ALZA 3MR5A 4C8OA 4JI2F 1OO0B 1SB6A 3N5BA 2VG6B 3B8HA 3D0HE 3MM6B 2YKNB 3G71S 1WEYA 4LFCF 3H2UB 2E1CA 1MSWD 2V4QA 4M63A 1JB0C 2UV8A 4ZPAA 2RF2A 2XCAA 3HHEA 3G6YA 2CPFA 3M8PB 4ILLA 5DG7A 4PG8A 2VOPA 2MZJA 5G0RB 5IQ6A 1KFSA 4MIAA 4WZQA 2EVZA 5KFQA 1HQEA 4O3OA 1PO6A 4RW6A 5H1SV 5DQGA 2WOMA 2XCPA 4LUBA 3HP6A 4DL0C 1R8HA 2VH7A 3CJKA 4K4SA 3LOUA 2P6TA 1T02A 3HHLA 1VLYA 3K5PA 3MMAA 1H2UX 2P9EA 3HHLC 3TVYA 5A6PA 1UEVA 2HAIA 2I0XA 3RB3A 1RYRA 1JKHB 2OPQB 1QTMA 3C6UA 1S99A 4DBQA 4OZ1A 4CNYA 2YWKA 3QO9A 1FDNA 4Y28C 3R5BA 1K73T 1M90T 1D9FA 4OZNA 1FVQA 2VG5A 1RT3B 2VFVA 2ZM6F 4Q45A 1V3SA 4O4GA 3AA9A 3IR6B 3QWPA 4ALZA 2E5LF 2J0SD 4EFAC 2YNHB 2WW8A 5CYJA 1D3WA 4IFYA 1AFIA 1FE4A 1FNOA 2RD5C 1TUVA 2IVFB 1RTJB 4NLTA 1RT1B 3RU0A 5FD1A 3MWBA 3MEKA 3I82A 1G6BA 5E33A 1RTIA 2WONA 5KFYA 1G7CB 4KBIA 4JV0A 4R5PA 2BQ3A 1VQ4S 2M8DB 3HF5A 4I2QA 3VWSA 1HFEL 2PT0A 1Q1KA 3I96A 4ED0A 3RR8A 1RAJA 2G1DA 4PG5A 1U6BA 2J6TA 2D9OA 4DL6A 1DZ5A 4L72B 2J0XA 3NBPB 3OFGA 3H5YA 3BN7A 2OSRA 4IR9A 2J0WA 3O5TB 3OTDA 4LFAF 1FT8A 4YP3A 3PEJA 4IRCA 4O3RA 1FF2A 2YKQA 3M1VA 5DDRC 2X51A 2UZAA 3OR2B 4RNMA 3IG1B 4CH1A 4K4UA 2VFUA 1HWKA 5KOXA 2LKZA 1SKRA 2AGOA 1MW7A 4HL9A 4L6V3 1VBYA 2EFOA 2IVMA 2YKMA 4PXEA 3W7BA 4Y3CA 3I4PA 1LOUA 3DOLA 4HH0A 4Q0BB 4NCGA 3DI6A 3HK2A 2ATLA 1O8BA 1V6HA 1FO1A 1Q8IA 3UNGC 3PR5B 2UVWA 3NNHA 3MECA 4ZMMA 3H25A 1XNRF