1BWEA

Artificial fe8s8 ferredoxin: the d13c variant of bacillus schlegelii fe7s8 ferredoxin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
77
structure length
77
Chain Sequence
b'AYVITEPCIGTKCASCVEVCPVDCIHEGEDQYYIDPDVCIDCGACEAVCPVSAIYHEDFVPEEWKSYIQKNRDFFKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN)
publication title Solution structure of an artificial Fe8S8 ferredoxin: the D13C variant of Bacillus schlegelii Fe7S8 ferredoxin.
pubmed doi rcsb
source organism Bacillus schlegelii
molecule tags Electron transport
total genus 19
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1bweA00
4XDCA 1IQZA 1FRJA 4ID8A 4KT0C 1JNRB 1DFDA 2FJBB 3MM7A 1FDDA 1FEHA 2XSJA 5BYRA 2PA8D 2C3UA 2PDAA 1KQGB 2VPXB 1Y4ZB 2FDNA 2WSCC 1GTEA 4RKUC 2GMJA 3EXYA 2FGOA 2Y0SD 1Y5IB 2GMHA 6FDRA 1FCAA 1KQFB 3MM8A 2VPYB 2VKRA 2C3OA 1Y5NB 4YDDB 3IR7B 1G3OA 3LW5C 3OR1B 4L6V3 1GT8A 5CH7B 1AXQA 3MM9B 1FDAA 3MMBB 7FD1A 3IR5B 2FJDB 4DHVA 1XERA 2UZAA 3MM5B 1FRXA 1H0HB 4CI0B 1F5CA 2C3MA 5E7OB 3MMCB 4AYBD 1SIWB 2V4JA 2V2KA 3GYXB 1K0TA 2VPZB 7FDRA 1FF2A 2VPWB 1B0TA 1WTFA 1FXRA 1HFEL 1BLUA 3OR2B 1C4CA 2ZVSA 3MM9A 2FJAB 2O01C 1DAXA 1FRIA 1R27B 2C3PA 3MMBA 4OV1A 1JB0C 1H7XA 3HKZD 1SJ1A 1FRKA 3MM7B 3IR6B 4XK8C 1FTCA 1KEKA 1G6BA 4XDDA 2WSEC 1GTHA 4OMFG 2XSJB 1F2GA 3MMAB 1PC4A 5BYQA 4Y28C 1CLFA 2C3YA 1FERA 1H7WA 5FD1A 1GAOA 1PC5A 1FRLA 3MM6B 2Z8QA 2WB1D 2FJEB 1ROFA 2PMZD 3OR1A 3PNIA 6FD1A 2WSFC 1IR0A 2C42A 1JNZB 3MM8B 1B0PA 1A6LA 1FRMA 1SIZA 1BC6A 1Y5LB 2FD2A 1D3WA 3MMAA 3MM5A 1DURA 5L8RC 3C8YA 5BYSA 3MMCA 2WAQD 3EGWB 1Q16B 1BD6A 2IVFB 1FXDA 3MM6A 5CHCB 1FDNA 1H98A 1FD2A 1VJWA 1F5BA 1BQXA 1B0VA 3EUNA 1RGVA 3OR2A 1FRHA 1C4AA 1FDBA 2V4JB 1BWEA
chains in the Genus database with same CATH superfamily
3GSDA 2FLNA 2F9JA 5A0YA 1AUSL 2D69A 1KOOA 4WYWA 2KG1A 4DV2J 1RHQB 3OTOF 4TYAA 3PY8A 3L09A 1IKWA 2EK1A 2D3OR 1SH3A 2BQRA 1NBEB 5A8WB 1FXLA 4DHVA 2Q3PA 3T19A 2RDIA 1S97A 2YWFA 2MZSA 3UR3C 4JP8A 4LF9F 3RBEA 3PJWA 1N5YA 4FKXA 3ENVA 1BHNA 1KHWA 1OPZA 6AT1B 4NYPA 1MWQA 2HK2A 4OV1A 4M5DB 4K4YA 3R6GB 4JYAF 3W5YA 4TLRA 4I68A 3EICA 4IDKB 3QSIA 1IBMJ 4O3OA 2GA7A 2CPEA 1XNRF 3QWPA 3KLVA 2UXDJ 5GMEA 4DL0C 2B7CB 1TZ0A 1NKEA 2BZ2A 1ZM4A 2GGPB 3NKYA 2YY3A 2HQDA 4TY8A 2HQCA 3MEEB 3UVJB 1DHMA 2WSCC 1TFWA 3BEGB 1QVGR 4KHMA 4KHRA 1QSSA 3H5XA 3D0HE 1E6YB 1NUEA 3MECA 4NCAA 3R6LB 1GMUA 1N52B 2DK2A 3SFGA 4EUVA 3HPOA 4JI1F 3AODA 2BJEA 3UDEA 2OFHX 1TMJA 1RKIA 2KJWA 3S01A 4IH7A 7FDRA 3TYTA 4EU0A 1OJ4A 1UW9A 1QLNA 1U2RA 5D77A 3M6VA 3Q89A 5DM6Q 1HQEA 3RB0A 4JI5J 1JWWA 3UE2A 2YNHA 4M8LA 1IKYB 1T3NA 3NGKA 2OIHA 1I94J 1RA6A 2WBMA 4YY3J 2ZD1A 1VQOS 2FLPA 3BGOP 5KFQA 2WVEA 4CLFA 1RT2A 3T5JA 1WJ9A 5GADU 1RAHB 1OSCA 2BQ3A 3UWTA 3PW4A 1RT4B 5IT0A 4LF5F 1MWYA 1TFYA 5FIIA 1CBKA 4FYWB 1S57A 1SKWA 4ANDA 2J76E 4I6WA 5BR8J 4B9LA 3MPVA 2E7VA 4CZCA 3CD7A 1C0UB 2FB0A 5HANA 1VQKS 2YNFA 4JV5J 3HX9A 4ZOSA 4MYUA 5DG9A 2PMWA 4QWDA 1FRXA 1H0HB 1F5CA 1V9OA 4ID5A 5E7OB 5D3GB 4F26A 4IQXA 1DTQA 1GQEA 4A8OA 3HFVA 4J7CA 4ZPWR 4ZJQA 1Z2LA 5AXKA 4C4WA 1KEKA 3VAKA 4ZHRB 4ZVRB 4DV7F 2FVSA 4K4UA 1VQ4S 3C14B 4NCGB 3C6UA 3EZUA 4X2BA 5HP1B 1SJFA 3SCJE 1OMSA 1FXDA 2QEXS 3H2VE 1RGVA 3JSRA 1C4AA 4ZA1A 2OPRA 4ED8A 4IRDA 4IR1A 4LFCF 5IZHA 1FDDA 4P9SA 4ZP8A 2ZH8A 4PWUA 3CMAS 3T3FA 2Q79A 2XY6A 4YR2A 1FESA 3PW5A 3FEXB 2Q66A 2BRLA 2ZWOA 2M88A 1Y3JA 3VQSA 2V63A 4YFUA 2HGNA 4RO0A 3H5SA 1JLFA 4IFVA 1DTTA 2ZHBA 3BB5A 4DFKA 1U49A 1BE4A 3J7Z5 3IMQJ 4ZJOA 5EWFA 1Q79A 4BDPA 5B0GA 1MROB 2DPIA 5SZTA 2XMUA 2E5HA 4OYWA 3ET6B 3THTA 3GSIA 4EBCA 2Y1JA 3MPWA 4KGXB 1Y00A 3MM6B 3HHKA 2IM3A 1JLCB 2IRUA 1SV5B 4IH6A 3SFUA 4RW7A 1OY6A 3UQSA 4FKYA 1BQXA 4HR2A 1IM6A 2QA4G 4RUCA 4P2MA 2FHKA 2Y8WA 3N9UC 5K8NA 5GAGU 4X64J 2HQ3A 1S6OA 2OPQA 3DRSA 2ZKTA 1C1CA 3UCGA 3G8TA 4Y65A 4DX7A 3NEKA 3HVAA 5B0AA 3M8ZA 4Q5VA 4FXDA 1UJ4A 4BS2A 4EO6A 5IV3A 4X4VA 3CVKA 1R3NA 4ZK7M 3CXCR 3C19A 3M8YA 2UVVA 2C3MA 1SKRA 1NHUA 1VI7A 4LF8J 4NEYA 5L1LA 1U48A 3C2PA 1ZS6A 4KJIA 4LSLA 2BACA 3IWLA 2GIQA 4E98A 4ECYA 2CJBA 3DCAA 4B3MF 4X4OA 1NSAA 2MKHA 4ICLB 3CCES 2IMOA 2A2CA 2FYXA 4JI2J 3THVA 4OYAA 3AOAA 3P4UB 1AW0A 3MDFA 2HHPA 3JQJA 3B8HA 2EXUA 4L74A 4CLTA 1EB0A 3M1VB 1U0HA 5AE3A 2BV3A 2ZE2A 1FHTA 3EE3A 4OZJA 1T9VA 3CSKA 2YX4A 1LWCB 4LVOP 1B7FA 3N4WA 2C2KB 3T5HA 1RYRA 4JI4J 3L9ZA 3VF0B 1TR0A 2YVSA 3BKFA 1WF1A 1EETB 1Q82T 1RHUB 1TL1B 1SBRA 1QE1A 4C3KA 4CTAB 1JQGA 5C7PA 1WC1A 1T9XA 4LBIA 4ZVGA 3J81Y 1BGXT 4RU2A 3PO4A 3DDKA 1FXRA 2FQQB 2K7JA 3KLFB 1PAEX 1CJTA 2RH3A 4PYAA 1TV6B 2RRBA 4XDDA 2VG6B 3CNQP 4N47A 4KR0B 4OJHA 1IXKA 4DOZA 3MR5A 2XCAA 3A3PB 2N7YA 3MUVP 1GNKA 2NQPA 5HMWA 2IM0A 5KFSA 4NXNJ 1PKUA 4USJC 4RW6B 2YQ3A 3BV8A 3KTQA 3MM5A 1TL7B 3U1MA 2HHHF 4PWWA 1UEKA 1FDNA 1CEZA 4F4AA 2AW0A 2CNKB 2XSJA 1GK8A 4FVMA 1T3OA 2G2OA 3I0RB 3QRRA 3GONA 4EEYA 2CUYA 3HSGA 2IA0A 3M6XA 5B0EA 4HKQA 2LQ8A 4A8QA 3MM9B 2B7BB 1KTQA 1SJ3P 5B0CA 2QJ3A 2P8IA 2E5LJ 3GFHA 3NOCA 3OFGA 3OHAA 3MMJA 2ZVSA 1RYSA 4OQJA 5CYJA 3MM7B 5KFUA 2L41A 5F9NA 3IXQA 4Y00A 2BE2A 3GYGA 5B09A 2QSFA 1QTNB 4P74A 2CQGA 1SQEA 3CW2C 1FRLA 1CQMA 4LF1A 1S10A 1WEYA 3QWUA 2PMZD 3PNIA 1LNQA 3HLUA 1JKHB 1Y9OA 4K4WA 2VICA 1PO6A 2E9RX 2L48A 7AT1B 1YJRA 2A6MA 2E1MC 4LQ3A 5B0FA 3GE9A 1FRJA 4ANEA 1ICEB 3CT9A 3IBWA 3Q8UA 3PIPQ 3U02A 2GMJA 4DG1A 3DRRA 1TKZB 3O3LA 1RHJB 3SDEB 3M8QB 3UN3A 3IR5B 4WK3A 5ETSA 4FYVB 1OWXA 2ZH9A 2ZBPA 4QR2A 1X4GA 2KKHA 2L3MA 3DDIA 2HYIB 4DV1F 2X3DA 4ZCMA 4JI7F 3SSSA 4FYXB 3GLJA 3L3CA 1N36F 2VIHA 1SB6A 1KHVA 3DN9A 2AGOA 2FGCA 1U47A 4DR4J 1U0SA 1KWMA 4AUKA 2R7OA 4DV3J 3M8SA 1FWKA 3OW2R 1S7IA 3WBZA 3G8QA 4DSIA 1KOHA 3GG1A 3JYTA 1D8YA 2QN6B 3GPAA 2J6SA 3J7AN 1N34J 2RS8A 3CCJS 4L76A 2ACYA 4DCJB 4MT1A 3HFKA 3DOKB 2A1BA 4H4OA 1ZM2A 2GQQA 2ZC4A 3Q8SB 1JJ4A 1MWZA 3V6HA 3E2EA 5K9FA 2DT9A 4PKDB 1X4DA 4I6AA 2YKQA 2AYMA 2G1HA 3BBFA 3M9MB 3IG1A 4ED2A 2VH7A 1UA1A 4KHPF 1Q8BA 1ZAXA 1R8CA 3FSYA 1LWEB 4LREA 1OQ6A 3W3SA 3DMJA 5LMNJ 1S7HA 4ATNA 4DSEA 3P5TL 2HS4A 1APSA 3BYPA 5HMXA 3TOQA 3LO3A 1B0PA 3BF4A 3BS9A 1MLAA 5A8WA 3B4DA 4QW8A 1Q16B 1T7PA 1CSJA 2MLYA 3C46A 4HT7A 2YWGA 2V67A 4N41A 4AL5A 1F0XA 1JLQB 1FNMA 2CPIA 2DXDA 1C0TA 3DGPB 1HBMB 4B02A 5J1NA 2RDJA 4AQYF 1RT5A 2P9EA 4IDKA 1M90T 1HYSB 2KG0A 4WPAA 1WSVA 1OYEA 2H54B 4NLYA 1HI0P 1WNEA 2W2MP 2O1PA 3A3NB 3VGSA 3BSNA 4JI0J 2GGPA 2MZ1A 3KJQB 2HZAA 4DFPA 2CJAA 2MMYA 5GMKa 1WC5A 1U25A 3MEEA 5DO2A 4Y2CA 2VOOA 1RT3B 4C0OC 2EFVA 2BM1A 2ZH2A 2VZ9A 3D6MB 1NU4A 1GAOA 9RUBA 4WFAQ 1Q0NA 1E6YA 2WOMB 4NYOA 2MHEA 4F67A 3J81j 2PC6A 5E2QA 2WSFC 5KFXA 2FUG9 2DRBA 1B7YB 2HWTA 2DTJA 1VK3A 1BD6A 2GNKA 2CJXB 4LSZB 1V5VA 1IBLJ 4NMLA 2UV8G 1X8DA 3M9NB 1VK8A 1FVSA 3GMGA 4BC9A 3IWNC 2VD3A 1IKYA 1N0UA 1MMDA 1RU2A 3DI6B 5K8PA 5DDRC 3NS5A 1AFJA 5L46A 3IR7B 3S8SA 4XTTA 4K2XA 2YX1A 3BGLA 1M5VC 1TAUA 3VGUA 3CJ8A 2BDPA 5IQQA 1RT4A 1OO0B 2EC2A 3EPIA 3F73A 1L3TA 2E5GA 4U96A 4Q2MA 1RB0A 2VJVA 4ZP6A 2HFZA 2PT0A 3PFOA 1DQ8A 4DSFA 2QMXA 4O44B 2BE9B 3TWZA 1CQNA 5E33A 5C25B 5F8JA 2PSZA 4NLOA 2ZNYA 4QPTA 4ZPTR 4X4TA 3KUGA 5KG6A 2EFNA 1C1BB 4DV0J 3CMQA 2FIUA 4ZS6A 2XG8A 1SQFA 1ZTWA 3CGIA 4F0KA 2HAFA 1VBZA 3CC4S 1LW2B 4OL8A 3R5AA 4UOHA 3I5AA 4ED5A 3PZPA 1TKXB 3BGRA 3UD4P 1PJ5A 3I5BA 4FF2A 2H3EB 4ZHRA 4IUFA 2CJ9A 3IS9B 2W8KA 3R9LA 3MXHP 4J9OA 3KMSA 4NCGA 2BBEA 2EBGA 1CULB 3M9OB 4HEA9 3GIJA 2HIYA 5HP1A 5AE2A 2HVZA 3NOGA 1JLGB 2IBOA 2XS2A 2QLWA 3TEHB 2GQ2A 3EZ5A 1UWBB 2AX1A 3ZZPA 1RBLA 4RR5A 3ISNC 1QUPA 1RXOB 2QMWA 1ZPVA 1PAUB 1QUVA 2F65A 4ENOA 5MAOA 2R7SA 1IWGA 2VOPA 2GQCA 2GJ2A 1WC6A 1UJ5A 4G6VB 2VF3A 5A2QY 2HRUA 1S5ZA 4G3IA 4HI2A 3NXZA 2AQ4A 3H90A 4KH0B 4OFZA 1AZSB 2QIFA 2QC3A 3KLGB 1VQ5S 2XEXA 3ZZYA 1MROA 2KHDA 4B3SF 1AROP 3ET6A 1N56A 4ZLPA 1H2UX 1HL6A 5D6GA 3BDPA 3BR8A 4B3TJ 6FDRA 4DX8H 3D6TB 4NRTA 1CC8A 3K5OA 1SV5A 1WOSA 3S7RA 1X9WA 1KVIA 1UFWA 2LEPA 4JOUA 5B7WA 3RZAA 4MFBB 3SQGB 2BR0A 1EP4B 2XZWA 2QT7A 1M1GA 5M2UA 1U2FA 3KHRA 1VIOA 1RWXB 3QJJA 5KT5A 2Z0GA 1IBKF 3NGRA 1N6QB 3PO5A 4WTOB 4ED1A 3J7A1 2CXEA 5GADI 3LP2B 3O5TB 2ASDA 3GFXA 2VBXA 2XLKA 2Z8QA 5KT6A 2ZZMA 4WZMA 1XQIA 4FPRA 2E9TA 5DDQC 3OTCA 4LF4F 2DBBA 3IBFB 2VV5A 3TR5A 1K44A 2E5JA 2HPUA 1YBUA 4YR0A 3QFHA 4TKTA 4NLVA 3HFZB 1FDBA 5DGBA 5U47A 3MZIA 2RS2A 5CYQB 3I55S 3MOZA 2F9DA 3CJ3A 3KNGA 5HN0A 4ICLA 3SMZA 1VRUA 3W2WB 3MFIA 1A0OB 4FVCA 2RNEA 1HD0A 4J9QA 3M2RB 3VAIA 5K8OA 2EI5A 1HWUA 3M1VA 2KI2A 2FPHX 1V6HA 3MEDB 5E5NA 4DR5J 3WIVA 3V4IB 3PEJA 4ELUA 4B3RF 2P5VA 1BWVA 1LWCA 1YWXA 2CPZA 2G1DA 4FZVA 3W60A 1IR1A 5KFTA 4JI3F 3C3LA 4QCLA 1WTBA 3SI8A 3TNVA 2FHOB 4DQIA 4CTAA 2BW7A 2Q1LA 2HWHA 4OI6A 2FD2A 1WG4A 4G65A 4O4GB 1R0AB 1ZYQA 4PZVA 3EGWB 2R8IA 2W9BA 4MH8A 4IFYB 1FFWB 5L9XA 2CWKA 5KFYA 2L08A 2B9WA 4RNFA 2JVRA 2I8EA 2KZMA 3QLHB 4URQU 3GCXP 2A3JA 1JLEA 4PQUA 3T1YJ 2VG6A 3O44A 2EKNA 5EHHA 1SL0A 1N48A 2K7KA 4HH0A 2ZM6F 1HNIA 1OPIA 1D8ZA 4LFBJ 2C3OA 2LQJA 4RW6A 4CO0A 4CRJA 3OUYB 2XB2D 4OZ2A 1RACB 1SH2A 4KPCA 4LF7F 2A0FB 1NDKA 2AZ1A 4HTIA 2FVQA 2UU9J 3K59A 4P10A 3E8OA 2RQKA 2ZBIA 2IYGA 2H4YB 3J80Y 4NPOA 1YBTA 4OX9F 1T05B 5KFWA 1P9YA 4E0DA 2DY9A 1JMTA 3I0RA 3DLBA 1RDRA 3K8WA 1Q8LA 3OL6A 4DR2F 2DR9A 2OPPB 4FBTA 4ZVPB 3PVXA 4ZVHA 1BQMB 1M5SA 3B54A 3RB3A 3CCWA 3UN2A 4K8RA 4N8NA 5L8RC 5GAGI 4TU9A 4AD6A 3D68A 5F8MA 2V4JB 2Z58B 5C2GA 2NREA 1CC7A 2R7UA 3MM7A 4O3SA 5KFGA 3QRQA 4HLBA 2X51A 4OX8A 3G4SS 1JKHA 1LOUA 4KBIA 2G9OA 2XHCA 2LU2A 3AQOA 1SC3B 2M5YA 4M63A 5CH7B 4ZLJA 2ZHOA 1NDLA 1NDPA 1JJCB 1GMVA 3RBZA 4IOBA 2F5GA 2QMUB 1K0TA 3MHYA 3CDEA 3R27A 2ASLA 1DQAA 1VBXA 2NYHA 2H9ZA 2HLUA 2YPZA 1TTHB 5BYQA 4I2QB 4W90B 2LQ5A 2K3IA 1TKZA 4OLPA 3G96A 2PI5A 2DGVA 2V8DA 4TN2A 4UQTA 2A18A 2AEFA 4F4ZA 5KFJA 3UFCX 5A8RB 2PGCA 1R6YA 2WW4A 3DRXA 4F3MA 4CLSA 1VJWA 8AT1B 5LT5A 1QSLA 1X5TA 1O0PA 1T9YA 5C24B 2YWWA 3Q8YA 2A6OA 3CIZA 2J6UA 3ULHA 2AU0A 2B43A 3ZTRA 2XMVA 3R2CJ 3QSYB 4QZVB 5L38A 2FC8A 2DGUA 1Y4ZB 3L95X 3TUPA 2LKZA 2M2BA 2VPYB 4B9UA 3L7OA 3MAQA 2DEJA 1NK8A 1U1MA 1T9UA 2J8SA 4U8YA 4ZVTB 1O6XA 3IM9A 2BMBA 1F9EB 4CI0B 2MQMA 3GYXB 5F8GA 1MU2B 1ELOA 3HVWA 3H98A 2YNIB 3DOKA 1VQ7S 1YX2A 1U8WA 1IKVA 4X4SA 1Y0HA 4DSKA 4HHJA 1SQGA 2D7SA 4DR7J 2ROPA 5J2NB 3CIMA 1J5OA 3H40A 1YRTA 4D3HA 3IN5A 1SIZA 4DCOB 4P75A 3MMAA 2XMWA 2B56A 4NZ0A 2V8PA 1A9NB 1RI7A 5HQMA 4M5MA 1Q81T 1OYDA 4X65J 2HVHA 2RRAA 2MKYA 5E3PA 5CHCB 1XMOF 1LWEA 4DWIA 2JC1A 4J9KA 3NL0A 1BWEA 1T8EA 1MN9A 1FJGF 5HLFA 3FMBA 3OVBA 1N32J 4OX7A 5KFDA 2XLJA 4MK8A 4WFBQ 2F3JA 2XGPA 2RD5C 3AHPA 2NXEA 3M7VA 1ZAWA 4YDDB 1X4BA 2FVCA 4AT1B 2AIRB 3AAWB 2C28A 5KOWA 1U1OA 1QVFR 2J0XA 4MK7A 4DV4J 3QBCA 5AJ3F 2KDOA 3WIUA 3DGPA 1HBMA 3MMBA 2Z57B 1JB0C 4RU9A 1KD1T 4PCQA 1F6TA 3TZWA 1WC3A 2KYXA 3TVYA 1Q8IA 2D74B 1RKJA 3QYYA 4WKYA 1HBNB 4GO5X 3C6TB 2V68A 3QIPB 2DY1A 3IM8A 3BBBA 4ZLNA 1N5VA 1JJHA 2WONA 1V3RA 2B51A 1YJ9S 4KO0A 2UVRA 1FE4A 3F0NA 2JOQA 3FKBA 4U7UK 1RT3A 3BKUA 3UCUP 2KT5A 2RU3A 2OPSB 2CQ1A 1N33F 4NZ7A 4W98A 3UDLA 4DSLA 2WOMA 3HD1A 3EXYA 3N79A 1GXUA 2QL9B 3VGVA 3CJ2A 4LR7A 2GAHC 2BVZA 3BH6B 1MW7A 1TQLA 1J27A 3DLGB 4F50A 3SCIE 2RT3A 3W9HA 3DYAB 4UW2A 5KFKA 3W5XA 1BLUA 3G9CA 4RW4A 2CQCA 4J91A 4JI1J 2FJAB 1WC4A 2QYCA 2XWXA 2CYYA 1RWMB 3FDSA 3DI6A 1N5SA 1KONA 1KP6A 3QMQA 1ZH5A 3B78A 2DGQA 4FNHA 1TL4A 4HT5A 3M2UA 2J9DA 3JTPA 2OEKA 5HQ8A 2F40A 1LXNA 1H98A 1F5BA 2C2OB 5L9NA 3R5GA 3JS9A 3T6JA 1ZOTA 4CLYA 5JXSA 5C25A 4N56A 2IBKA 3KJVA 4LBHA 4Z7CA 1X4EA 1HR0F 2N3OA 2CPJA 4B3OB 2AWZA 2FDNA 1HNWJ 2JHEA 2G2YA 1TU0B 4PEOA 2Z2MA 1IKXB 4QU7A 3GIMA 2VKRA 1PYSB 1LW2A 2CNLB 1FKPB 2H65B 2VPZB 4DV6J 1TKXA 2ZOFA 5SUHA 3H25A 1F3FA 2JL9A 1Q53A 1MN7A 3CDUA 5LM7E 1QAIA 2HFNA 4B9NA 3IS9A 2F4FA 1N5TA 2PN6A 2V5HG 2W2QP 3VCDA 3O8WA 1B3TA 1FFSB 1CLFA 3I6PA 2ADBA 1CULA 2F8EX 2VFUA 2E66A 4TNOA 4V19X 1LV5A 2XMJA 4DUTA 3FQLA 1JLGA 4DV7J 1UWBA 4PG5A 2HGMA 2IVFB 3OHBA 5CQGA 4RWWA 1FA0A 3N6NA 1WKLA 3VAHA 1EAYC 2CQIA 2MQPA 3LPEA 4HL9A 2HZCA 3N0VA 2LEAA 2VC0A 3KLHB 1HNVB 3BPDA 4I67A 1XR6A 5D4PA 2JX2A 4LFCJ 1Y5NB 4DV2F 5HK4A 1HQUB 1ZTTA 1RABB 5EX0A 4C8LA 2MKJA 4AYBD 3ZZ0A 3A8KA 3KLGA 1OSDA 5G0RA 2W7AA 3DXSX 1W2BR 1U7LA 2VU5A 2AGPA 2O3DA 3NG8A 2XMMA 4XK8C 3S6EA 1NJZA 3Q2SC 2F1FA 2DO4A 2WZ1A 3G71S 4IG3A 4M5GA 4ERDA 3DM2B 1NXIA 3QO9B 1Q78A 2FZCB 4MFBA 2IRYA 1IBMF 3UD5A 1EP4A 2NXNA 1WSRA 1R0BG 3MFHA 3ZZUA 3QAUA 3P45B 4RBTA 4KV8B 1R8HA 2UXDF 1S9FA 3J80U 2FJBB 1SI9A 4FDFA 2L9DA 3LP2A 2DGXA 2IIHA 2M52A 4N5SA 1U09A 4YR3A 5AXMA 1FX2A 3I9V9 4CYUB 1H3DA 2UXCJ 3HCXA 4K4XA 1F3VA 3IRWP 2LFVA 4P71A 3KFWX 2VFTA 1YJUA 4QWBA 2GHWA 2L9NA 3SCLE 1X31C 2POKA 5CYQA 4M5LA 3OPKA 2XQCA 4F4XA 5THWA 2OMLA 1TKTB 2GV1A 2HFSA 2DGOA 3KG0A 2W2OP 2CJKA 2EFPA 3AH6A 5DLGA 1I94F 4YY3F 3M2RA 4X4QA 3MCOA 5DDPC 3MEDA 2Z2YB 3V4IA 1X5SA 3I96A 3T6BA 3CDBA 5B08A 1NSKL 3R2DJ 2N3LA 4KKOB 3CCVS 1KQKA 5BR8F 1LK5A 5E3QA 3KG4A 5CZVA 2C1EB 3QZ8A 3EGZA 3KLIA 2VQEF 1FCAA 2YQ1A 4WZQA 1JLAB 1DBDA 1E6VA 4IQMA 4EO8A 4O4GA 2ADCA 3RG6A 2KU7A 4RNHA 4DF8A 1YRUA 4J37A 1FKOB 2V0NA 2JEGA 4IFYA 4JV5F 2UZAA 1SJQA 2YKPA 5D4NA 2VC1A 4ILLA 2G13A 3QLHA 4CO1A 4B9VA 4K5RA 1B0TA 4DL2A 3OR2B 3RW7A 4K2JA 3BO4A 3HVTB 5D0GA 2PFDA 3W64A 1PC4A 2LXUA 3BREA 1URNA 2V2QA 1ACMB 4DFMA 3T9ZA 3FSXA 2D41A 3N01A 1NCLA 3KNAA 3RW6A 2WAQD 4KGZB 2DHXA 2D1CA 3RUBL 2HMIB 3FCVA 1T05A 4PUOA 2BYCA 3BPSP 4USMA 4L3KA 1Q5YA 3OL8A 1JLBB 1HBOB 4F3OA 3RB4A 1Y7PA 4NWBA 2MY7A 3KLEA 4C6AA 2COLA 1BQMA 3L7PA 3EJMA 1FT8A 4CLWA 1GT8A 1HWIA 4RUHA 4U7UD 3Q8QB 3L4BC 3RRGA 4DS4A 4I2PA 2V4JA 2ZOMA 4OIXA 2IYIA 2QO3A 4KTQA 1XK8A 2W9AA 4E2FB 1H7XA 4ZPDA 4F2SA 3CDWA 2JEJA 4ZPCA 3TUZC 4UUWA 1YJ7A 2MQLA 3JSYA 1G7CB 2B0GA 2HNYA 4ZVFA 1BMQB 1W2IA 3V4MA 2J6TA 3TAMB 2ZZNA 4LBPA 3D67A 4RX6A 3T41A 3V6JA 1JXEA 2KN4A 3UW1A 2O66A 1GH8A 3TX0A 4UF4A 1YZ6A 3D0IE 3M8WA 1HMVB 4ZCIA 4JI6J 2W25A 2C22A 4D3GA 1PG5B 1VGYA 2BANB 2DISA 4K4ZA 3DC2A 4B17A 2K8GA 4X64F 1WHYA 5I4MA 1SCJB 5T41A 1TL3B 3GV7B 3OSNA 4J90A 1URRA 2RUGA 4LUBA 2DNQA 4K4VA 1VC6A 3KG1A 3BSCA 1YITS 7FD1A 4CP5A 3I5CA 3VV2B 1NK7A 5B0DA 3PHTA 4GC6A 4O4RA 2C2DA 3FBFA 5ETPA 4QYZK 3H4BA 2ZUGA 4ES3A 3ILIA 4DV1J 3VZIA 4HACB 1D0EA 2VHGA 3BDEA 5KG3A 1NZAA 4QYRA 2W4CA 3QGGA 4FXVA 2WB1D 1N36J 5HROB 1BUXA 1FEEA 1A6LA 2MYFA 4QPXA 4JI2F 5IC4B 2K06A 5K14A 2VA3A 1HWLA 4C98A 2VA2A 1L5UA 2DH7A 2CJYB 3GJSB 5DRKA 1MU2A 2DVIA 5E3RA 1S6PB 2YNIA 4NYZA 4K7QA 1NSQA 1EX8A 4OI2A 1KFDA 2ZBQA 4ZDNA 3ZO7A 4AXIA 2OD4A 3HHLB 2ZH7A 1N8RT 4DLGA 1K47A 9ATCB 2QV6A 5GAHU 3GQCA 3CDAA 1VCTA 3D5MA 2AEJA 2J9DE 5CD4A 2RQ4A 1VDHA 3C15A 3BH7B 1RT7B 1UP1A 2MZTA 4DUZF 1KQSR 1U1PA 4U8VA 5FDLB 3X3UA 1UA0A 1VYAA 2D9OA 2GVDB 3OTBA 1VQLS 3UR0A 4DL5A 2OH2A 2DO0A 2DNYA 2CQ4A 4CT9A 1Y11A 3IR6B 1X0PA 3LP1A 1VHFA 2KM8C 4OHVA 3POTB 4BBYA 2J5AA 1HI8A 2IJFA 1YBAA 4ZVUB 4F04B 2ZDPA 1AT1B 2U1AA 1IR0A 5ADZA 2NZCA 4DUYF 5KG0A 2FY8A 3A8JA 4DL7A 2W9CB 3TJ8A 3PW2A 2VUGA 3FJ2A 3CEDA 4NZ6A 2HWIA 2M8HA 2OHDA 3ICLA 4WE1A 4CQ1A 2GAGC 2ILYA 4N8OA 4C0HA 3BGUA 3TQEA 4IRCA 2V4QA 4N76A 3IRXA 3L7UA 3C6TA 2GX8A 4DX6A 1GXTA 4AQYJ 3C16A 1FJEB 3HHNB 2YX7A 2BKNA 3IGNA 2BA9A 3PRVA 3R5DA 3HHLD 3Q8VA 4K59A 1XNQJ 1S9GB 2ASJA 2O01C 2E5LF 1MG7A 1YHQS 3P5BP 3NRBA 2OPSA 3FEZA 4CIOA 4PXEA 3GIRA 2H48B 3OLBA 1LFPA 5I42A 3NS6A 5IFMA 5HBMB 3KDNA 5CYMB 3OLAA 2V9KA 4DCPB 2MKIA 2QLXA 3DLGA 4NOHA 2GO9A 2NLWA 2L9WA 4ECUA 3PM9A 2NR0A 2GMLA 4EFAC 3E01B 1B70B 4ZPVR 1KBRA 2APOA 2P9GA 3W62A 1T0TV 4NA1A 3WC2A 1VJQA 1LW0B 2OSRA 1RISA 3BGFA 1NJYA 3PDNA 3P96A 2HNDB 4RW9B 3AJDA 4DBQA 1EJ7L 2VPXB 3PRBA 1RAIB 3AA8A 1FK9B 1BQNB 1V3ZA 2HNZB 4QIVA 4F4KA 4P72A 2DNGA 4MAKA 4ECVA 4QQBA 1AXQA 4UUXA 1N88A 2KFNA 2VB6A 4HVZA 3EVMA 1ZZFA 1SC6A 1N0VC 4FF1A 2RU9A 1WUUA 3CCZA 3QGHA 2V8HA 3CCRS 1Z2ZA 1W25A 3BO2A 3QGIA 1EZZB 4B3OA 1GTHA 1REGX 1WHWA 4QU6A 3G86A 2MPUA 1IKXA 4HYKA 4OI4A 1Q1KA 2YXLA 3BR9A 4LRCA 2IM2A 4H4KC 2RKIB 3K57A 3NWGA 1FKPA 1ZM9A 4DV3F 5D0HA 5KFZA 1UVKA 3CF5Q 1FD2A 1ZPWX 3MUMP 1PYOB 1YIJS 2VG7B 1UPPA 2HBYB 1V5IB 4WKRA 2YKMA 2Y8YA 3W7BA 2IFXA 3LOUA 3MF5A 2EFGA 4WWSA 5DZ7A 4Y2MA 1VR6A 4Z37A 1G1XA 2M7SA 1WI8A 1NH8A 2QA2A 3PG9A 4ES2A 2HEKA 2VG5B 4WFNQ 4ECTA 2IC3B 4IO9Q 2IY5B 1U8SA 1SIWB 4R5PA 1M5PC 3EZOA 1F1BB 1WELA 4OZ5A 2C3PA 1HNZJ 2BX6A 4PG6A 1R8BA 2OO4A 2KZZA 1HNVA 1AB8A 1RTJA 1YDLA 3OFFA 1YJNS 2BKOA 1FE0A 3PJXA 2XY7A 1HQUA 2GCFA 2XBPA 3BQ1A 3FNNA 5M2PA 1BC6A 1Y5LB 5LMUJ 5F0WA 5BYSA 2JVOA 3QT5A 2R8GA 3H4DA 2MXYA 4AE5A 3MEGB 5LXYA 3DLEA 3FRYA 1VQ6S 2LECA 5DZ6A 4ES1A 5KFVA 2DKOB 5CAAA 4OYZA 1YRXA 1RWUA 3OL9A 3DM2A 1EQ0A 3EGVA 1KQFB 4B3SJ 2BJ7A 3QO9A 4OYPA 1RUSA 1X4HA 3PYFA 3HZGA 5KAKA 2MTLA 4LMZA 4XO0A 4TLQA 2MKSA 4KV8A 1HW8A 5EWGA 2ATLA 2ASYA 2DRDA 1C4CA 2IM1A 2XMAA 3OXGA 3MTKA 3K0JA 2FJXA 1S76D 1LWFB 2UUWA 4ZVSB 4YP3A 3D1HA 1WACA 1KTVA 2JJ4D 4CYUA 3NP5A 4LR9A 3G6XA 3A13A 4TY8B 2UV8A 1WHXA 2HHUA 2ILZA 4I1TA 3MPDA 2YWHA 4UZBA 2BXJA 5A6WA 4EYHB 4A4JA 1D9FA 5LOQA 4LRDA 5T7LB 2KM8B 3IP0A 2I5JB 5CZXA 1NJWA 3PIOQ 3PX4A 1KN6A 4L75A 4USIA 4KQZA 1TKTA 4OZLA 4DU7A 5FJ4A 3TVKA 3PYGA 1PILA 1D9AA 4QIWD 2RJZA 2AV5A 3H42A 1RLCL 3CD0A 1SUQA 2LP4A 2WRMA 2J8AA 2EFOA 2AJ4A 3QJPA 3D3CJ 1V3SA 3R5CA 4JV1A 3UCZP 4I56A 3IBCB 4DZ6A 1FVQA 4OJ1A 4AL7A 3CCSS 2I0XA 2LEBA 4FPIA 1R27B 4NX9A 4KKOA 3M8PB 3PRDA 4JB8B 2VQFJ 3PX6A 4G1QB 1S49A 1H74A 1R43A 1YKWA 2AJQA 1JLAA 3DOLB 1VC5A 2HW3A 1FKOA 3LH2S 2CVEA 3QPIA 2HHSA 1WKJA 2XZDB 1RBAA 4DV0F 2I9SA 1Q4RA 1Y3KA 3MAAB 3OR2A 4X4PA 4MKVA 2XC9A 2V34A 3W2VB 2VL1A 4DQPA 2QX0A 3HVTA 3AB4B 1GEHA 1SC4B 1WDDA 3D4JA 2BE7D 2YNFB 2PA8D 3GV5B 3UN5A 2Z2ZA 2R7XA 4A8MP 3FQKA 2DB1A 3ENAA 1UAWA 1FNOA 4ETXA 4YB5A 1FNXH 4URGA 5I3UB 3PHEA 2AJFE 2KT3A 4PXCA 3PR4A 2W8LA 2ZH5A 4IYQA 2HMIA 5E0OA 3FFIA 3NNAA 3SBMA 5JJBA 3HT3A 1HNXJ 1X4AA 4LF7J 4X66J 1JLBA 1HBOA 2JEFA 3NCPA 3CCLS 4PPDA 2YKOA 4DR6J 3AOCA 3VAMA 5KT4A 4QOTA 4OYOA 1JX4A 2EK6A 2Q6BA 2FC9A 3I56S 2HLTA 4PG7A 4ECQA 2UP1A 4DR1F 1RE1B 4NCBA 2CPDA 4GRSA 2XZTB 2RDDA 1PJ7A 3LP0A 3UNGC 2GHPA 3HJVA 4ZPBA 2PDAA 4YS2A 2LDYA 3ILJA 4KGMA 3W63A 4IFVB 3GP9A 1DTTB 1PJ6A 1UL3A 1TVRA 2G2ZA 3JSBA 4B3TF 2W4PA 1HPZB 2RILA 3EYZA 2C2RA 3T1HJ 2FVRA 2BJ9A 1U1LA 2R7VA 3R1HA 2NS1B 1XERA 4JI8J 5A76A 4Q45A 1HMVA 4ECZA 2VPWB 3ELHA 1SJRA 4ED0A 2BANA 2JNJA 2DRAA 3HSDA 1ZAVA 3IA0A 4YDXA 4RJVA 4OI3A 2FJWA 2ZDOA 4RW7B 3TEGA 1KR4A 1RP5A 1FO1A 3W1YC 2JFDA 4DV5F 3TW0A 3BSOA 2LLZA 4S0MA 2OPQB 1C1CB 3CE8A 3IAM9 3H5UA 2XS5A 2AX0A 3EUNA 4QR1A 2IJNA 3G6ES 4IO1A 4BWMA 4UOFA 3H2UB 4HACA 3HF5A 4DPUA 4UT4A 5CABA 4I7FB 3EMTA 1YJVA 2CJQA 3VGTA 2J7WA 1XMQJ 4PXBA 5HROA 5HVFA 4HHHA 3NBPB 3NLCA 2WB4A 2FZGB 3T5LA 3VVUA 2DPJA 1NK0A 4CNZA 2DCUB 2GVZB 2R9LA 1RK8A 2JWNA 1S1XB 3ZTOA 3CJ4A 2BRKA 2RQMA 4RBUA 4DR5F 2AGQA 2UXBF 4DEZA 4A8FA 5LSRA 1TL5A 1M0SA 2HIQA 4CO4A 1ZM3A 4Q8FA 3PXGa 1KC8T 3H7HB 4NLUA 1H2VZ 1K0VA 2ZE2B 3NCRA 1U6BA 1RT7A 4ZN1A 5HI7A 2MZJA 2I2YA 5F8HA 3KK1B 5FDLA 4XPCA 4WXWA 4DX5A 2PI4A 3G2XA 2MKKA 3ZZRA 2ZEJA 1PSDA 2DXEA 1VHIA 2XLIA 1RTHB 2AHOB 3POTA 2VFVA 5ETVA 3KK2B 4UY8T 1YLXA 2KH9A 4DSJA 5IM0B 4P73A 3OT9A 1RAAB 5ITHA 4L6V3 4J9MA 1CJTB 4P6QA 2W9CA 4KFBB 3W9IA 2R2TA 3K5NA 4HTJA 2LXFA 5C2CA 1HW9A 4ZCKA 2UU9F 4CLUA 3WC0A 3HKZD 2N4CA 4GKJF 3WHIA 3I82A 5AJ3J 2B5JB 3PKYA 3LUYA 2DHGA 3V81B 1S79A 5KFHA 2CNOB 1QDUB 1UZHA 2MLXA 3TANA 4IG0B 3LGMA 3WX4A 2J9CA 3VHQA 4DPXA 1EIYB 4Z2XA 2ZH6A 1S9GA 3US5A 1FJ7A 5B0BA 2AP6A 3UDVA 2WVDA 1RLDA 3HT0A 3T9NA 2M3DA 2YKNB 3AXMA 2C2ZB 5CYMA 3JB9k 3DU5A 2BEFA 4DL3A 2FLOA 1VQMS 2B4VA 2F4VJ 3TJ9A 3E01A 1NSPA 4P7VA 3QATA 1GX6A 2KRBA 2AMCB 2BE2B 3OD2A 1RAGB 5DETA 3EDRB 1LW0A 3O6QA 4E8UA 1DAXA 2JSXA 2CADA 4FF3A 2HBZB 1S0NA 4EWTA 1PC5A 4BHQA 2IDEA 5AE1A 4USKA 2AYEA 2MJUA 4M5DA 1NK9A 2J0WA 4W92B 3CMES 4C48A 1H73A 5IXUA 4LFAF 2FHJD 2WK4A 2E9ZA 1XJWB 1DURA 1HD1A 3SYZA 1ZETA 2NZ4A 5D0EA 2W01A 3Q22A 1S1TB 2HK3A 2I1RA 2E5IA 1QAYA 3DRRB 3CC7S 3EM1A 4MKBA 3PCOB 3JXOA 5GAHI 2Q6CA 4F36A 1RHKB 4M1KA 2IVYA 2E7XA 2QA4S 3I87A 4I4BA 3PYEA 4GVLA 1HR0J 2QZ8A 3PX0A 5ETTA 3UVJA 1FDAA 1TELA 2FJDB 2UUAF 5J2QB 3CJKB 4F3QA 5ETLA 2HHVA 3DDNA 5AXNA 5K8MA 4YQWA 1UETA 4NLPA 3TUJC 4QBUA 2HFVA 5KFFA 1DZ5A 4F2RA 1J5EF 2R42A 5A8KB 1FTCA 4LIRA 2HG4A 4ZIWA 1Q95G 4OMFG 3RR8A 5D4LA 3JYTB 1T9TA 5J2MB 4DQSA 2QE5A 4A8XA 1X0FA 1KFSA 2VG5A 2WTFA 2BKPA 4DPYA 1XBWA 2JEIA 2MDAA 2OEMA 5J1PA 1S0MA 2VASA 2OGUA 4X65F 2V2VA 1EKRA 2Y3YA 2HHXA 1LEOA 2AEMA 1NO8A 5ETOA 4FS2A 1ZZNA 4YB1P 4GO7X 1N32F 2P6TA 3RJMB 4OV6A 1YSJA 3MAHA 3DMJB 1C0UA 3DFEA 4XAKA 2ZH4A 3OV7A 4UQGA 3MCNA 1UTAA 3MEGA 3A4TA 1BXNA 4J9NA 3N6MA 4O23A 3CCTA 4DV4F 2LU1A 3DGVA 2QL7B 4PRFA 5D3GA 2QLBB 4YHHJ 4WFYA 2HZVA 1TUVA 3CD6S 3K17A 4MYTA 1NPRA 4QIGA 2BJDA 2R2RA 1H2TZ 3NGTA 4X4UA 1C0TB 2CKWA 4C8OA 3I31A 1X4FA 1U6ZA 3C14A 4B9SA 4C9DA 1RT5B 3D2WA 5KG5A 2ZJQQ 4L72B 1NKBA 4NXMJ 4R0EA 3EWGA 4OHWA 1LWFA 2XM3A 3M4XA 3R1LA 3G82B 5J1EB 1P1LA 1RJJA 1KQGB 2HS3A 1K8AT 1GTEA 3OSPA 3RU0A 2FHMA 2BUNA 2QFIA 4F25A 1YK9A 2OMOA 3UNYA 4TQSA 4ZVOB 2NXJA 1XIQA 4GKKJ 2XGQA 3TVZA 2X1GA 3UDCA 2JH3A 5GVQA 5T7LA 4ILRA 4IKAA 2I5JA 1NB7A 4DDFA 1YJTA 1UVLA 2J7UA 4ECSA 1P6TA 1TK0A 5DGAA 2ZC3A 2UUBJ 2D3ZA 1S9EB 2DNMA 2MKCA 4OZNA 2CG4A 3W61A 4J9LA 5D78A 5EN1A 2QLJB 4KGVB 2GJIA 2PE8A 4XPEA 2UUCF 2LMIA 4NLXA 2HQGA 1TKDA 3MM6A 4J9UE 2GZOA 1WWHA 1JLCA 5IC6B 5L39A 1SL1A 2BQUA 3HKWA 3M8PA 2ZJPQ 3P3DA 1X60A 4G1QA 2V9WA 2EG2A 2YNGB 4N7TA 1CPZA 2AT1B 2NUUG 3DOLA 2HVEA 2E7WA 4OI1A 4ZLLA 5KFNA 1S59A 2B6AB 1ZBTA 3NCQA 1HNWF 1DLOB 3DHXA 4B9TA 3HO1A 3K5MA 1HHSA 2DCLA 1NHKL 2RAQA 2VQEJ 4ITSA 5JUMA 3MAAA 2XYHB 1RT1B 1FF2A 5IWAF 3W2VA 1CG2A 1XTZA 4TYBA 5CA5A 3PW0A 3EGNA 3HK2A 3BJYA 3FRZA 4DV6F 2X1BA 4NLSA 4ECWA 3KHLA 2EBEA 1UKUA 4ANCA 1NPPA 4X4RA 4KPYA 1HBUB 2A2DA 2C42A 3Q2TC 2XO7A 1CJUB 5I3UA 2V4RA 3UPFA 2KJVA 3BGRB 4IH5A 3X1LB 3KKFA 3MPYA 5EWEA 1S0VA 3N5FA 2VFSA 1VLOA 4OYBA 4KAIA 3ISZA 2Z4PA 3LGNA 5AXLA 2N7CA 5H9FJ 3K58A 2YPYA 2B9YA 2JZ5A 8ATCB 3HXMA 4K4TA 1U24A 4USWA 3UO0A 2Q43A 1OS5A 4X4NA 3ZNUA 3ZZTA 4CLPA 1ITPA 4NI2B 2G4BA 3QT7A 3H8YA 1XR7A 1U6FA 3RB6A 1EETA 2RHQB 1TL1A 1R89A 4UY85 3D6FB 2ROGA 1HWKA 5ETQA 1SL2A 2K3KA 1T03B 1XMBA 2HBQB 2ROEA 4YMEA 2C3YA 4H4KA 2CZ4A 3KLFA 4DR3F 5H9EK 1HPZA 5D4OA 1TV6A 1LFWA 3LANA 1QAJA 3KHGA 4X62J 3QT6A 3TX8A 4UOCA 4F02A 1UVIA 2DR5A 3PKMA 4NA3A 1S1WB 5JVGQ 3QZ7A 1TL7A 2MQQA 4C3LA 1F9FA 3FBBA 1I1GA 4C8MA 5CXTA 2ZBRA 2BOAA 1NJIT 2ACMA 1HIYA 3ZTPA 4DI6A 2HHTA 1RCOB 2OTLS 3UI3A 2F8HA 4C8ZA 2BJ8A 1G2EA 3BN4A 1UWAA 1I51B 4CO2A 4FF4A 3DNCA 4JV2A 2FVPA 2UXCF 3P8BB 1R0CB 3DU6A 2R2SA 1NK5A 2G0JA 2VFRA 3MM9A 1R6VA 4IRKA 5EX3A 4ZPAA 1PBUA 1RWPB 4I7FA 4WU3A 2RIJA 3O1LA 3OTEA 3OXFA 4HH1A 3RYLA 3NBPA 1VLYA 3GJRB 3MWBA 1PGZA 1RTDB 4R8UB 3MM8B 4WBFA 2GVZA 3CUNA 3CO0P 3FUYA 4YB7A 4FNIA 1S1XA 1S6QB 2DNNA 1VRUB 1FD8A 4XDCA 1EQMA 3NY0A 3TO8A 1GFWB 2NYIA 3R7NB 4TU7A 1UFKA 3O2IA 4WTYA 4WFZA 5IT9Y 2KVIA 5HSPA 3IGVA 3A8EA 3MCSA 4J9RA 4LT6A 2DH8A 1VOMA 3NS7B 2Y1IA 4DPWA 3KK1A 4KB7A 4DU8A 4NE9C 5KG2A 1P1TA 2O67A 1RTHA 2OTJS 1PIEA 3SDEA 1DRZA 3M8QA 3JQMA 2ZH3A 5GAEU 3VZHA 4DUZJ 1AYEA 3KK2A 2XYGB 4ZN3A 3VR1A 1SKUB 2B3TB 5IM0A 3KOAA 4EYIB 4Q7AA 1H7WA 2W9BB 1LK7A 3FCHA 2KXNB 3ZFVA 4TVAB 2GIFA 2Z30B 2DNKA 4KFBA 1CS4B 2PEHA 1JLEB 3ETMA 3ILLA 4PQUB 1UMJA 3I0SB 1S0OA 1RA7A 2XULA 5T14A 2H5JB 5D0RA 4ZMMA 4DUYJ 1WDTA 3GFYA 2FHJA 2FLLA 1HNIB 4LF6J 1RT6B 4CM2A 4Q44A 4AL6A 3OBIA 2B5JA 2CG8A 3I32A 1J2VA 3ZZOA 4ZVEA 3V81A 5DLFA 4LJMA 3MURP 4IG0A 3OTDA 1H72C 4Q0BB 2NXCA 4GMKA 2MQNA 1TUWA 1X7VA 3DRPB 1L3SA 4FYDA 1FFGB 4MKAA 1R31A 2CWXA 4DQQA 2MSTA 3N6LA 3NMRA 2DITA 1REVB 1VBKA 4ED4A 3OQ2A 3CO9A 2YKNA 1KNZA 4BC7A 2CDQA 2ERRA 1IWAA 3G87A 1Q86T 4L3NA 2B8PA 4RUBA 1U1NA 4EGLA 1YG0A 3B4MA 2HQFA 1D9DA 4QR0A 2XHWA 4C8YA 3CULA 4KT0C 2DR6A 1RADB 3DKDA 3H5YA 3TQ1A 4JI6F 2KFYA 4KE5A 2JLEA 4RUAA 5LXRA 3OTOJ 4YN3B 4QYZJ 2RE1A 1JLQA 4RW8B 2NPFA 3ILOA 3GIKA 2XTJP 2AYBA 3K5LA 3GYNA 4FYYB 4LF9J 1UVNA 2ABYA 1X5OA 1I5OB 1S1TA 3KXDA 4ZJLA 3HP6A 2BW2A 1HYSA 3F44A 1JXLA 5K5MA 3OXLA 1R8AA 2AD9A 2ALZA 4Y6IA 3KDOA 4C2MA 4YUDA 3PV8A 3MD1A 1TAQA 4JYAJ 3KUHA 2LQBA 4DL6A 2RSQA 5F8NA 2DD8S 1QTMA 2KVQE 1XNRJ 4ELVA 3CCQS 2KT2A 1VRTB 1K73T 3TP2A 4O3NA 2WHOA 5J2QA 5HJXA 3CJKA 1SVDA 4QIFA 2EW9A 3D66A 2R8KA 2CFXA 1UVMA 4P2FA 2WVCA 1JNRB 1T95A 5A8KA 2VONA 3FZBA 1L3KA 2UUTA 1R7IA 2X3GA 1DJ0A 1RBOB 3K2YA 3GG0A 1K9MT 1P27B 3LWMA 5J2MA 1MMNA 4JV0A 1UVJA 1Y5IB 2PA3A 5HMYA 1WHVA 5KFOA 1YI2S 1NPKA 2XSFA 2XCPA 3A3OB 3ETOA 1RZMA 5LSLA 1IKVB 2W1BA 2H1YA 2ZNZA 4ECXA 1J5OB 1RHMB 3MR6A 2KYZA 4K0KF 3MMAB 4DMZA 1RWNB 3QGPA 4CCHA 3Q8PB 3M6WA 5ETMA 1ROFA 4O44A 1RTIB 3TA2A 2WVBA 1W26A 2ZVIA 2HVIA 4LF5J 5HLFB 2PO4A 5ETRA 2KB2A 1QSYA 5KG4A 2VODA 2MGZB 5HVGA 1C1BA 4C11B 2DNLA 1WD6A 2E1RA 2X1FA 1MMLA 3DOMB 3WQPA 2W24A 5C42B 3AFGA 2J9EA 1HKAA 1XEZA 2XMKA 1VQSA 2J0SD 2DNPA 3RAMA 3GILA 2R7WA 4MIAA 3E3XA 3EX7B 5FLXY 3MMBB 2E29A 3LGHA 2OJ3A 2OELA 3RBXA 3ZTQA 2E1PA 2R8JA 3G82A 5J1EA 3ZXWA 1XNQF 4W4MA 3LF0A 4I0WA 1AA1B 3KMQA 3PACA 2RHSB 2ZWPA 2WONB 1LQ9A 4Y2AA 4KO0B 1VQNS 1SC1B 3S1TA 3G6VA 3FMWA 3Q23A 3SZ2A 2RVJA 1FKAF 2ZH1A 2HAIA 1XC9A 5I3QA 3GIIA 1YVFA 2DNZA 3JSMB 2V94A 1WEZA 4RLEA 4LSNB 2C2MB 1OIAA 2U2FA 2YH0A 5LJ3Y 3AXKA 4J9VA 2W4DA 3QIDA 1AZSA 1AUDA 1HLWA 2VBYA 3D28A 3JTNA 3M32B 1S9EA 3RAXA 1YJWS 5E41A 4TY9A 2ZJRQ 3GR0A 1TK8A 2D3UA 4ZVQB 4RW4B 3CJRA 1T9WA 3TARA 1VIXA 4M5HA 3SV4A 3HHLC 5F9LA 1FRIA 2CA9A 2I38A 2YNGA 2NXUA 5EUHA 3SQGA 3M2UB 3WZ0A 1F2GA 2IMWP 1CJVB 5CCMA 4Q2LA 2DYAA 2B6AA 1DLOA 2IPOB 2G0IA 2P6SA 1N6QA 1FRMA 1D3WA 4MKYA 3KJVB 1RT1A 2RF2B 4QJVA 5KFCA 3SEOA 3SV3A 3LALA 2QRRA 1NMEB 2R7TA 2MLZA 3P6YC 1NK4A 4NASA 1VC0A 1WOPA 3DLJA 1ZA1B 4RBVA 4KY3A 1QY7A 1FX4A 2UVWA 1UCNA 1VQ8S 1HBUA 1CJUA 3P49B 4OX6A 2V8VA 2DNOA 4O3QA 2DR7A 3W2WA 4PABA 1WF2A 4KRWA 2C2NA 4JI5F 4M94A 1HHTP 1AFIA 3TAPA 4PR6A 5EGYA 3NGDA 4FP9A 2SXLA 5J2PB 4RNMA 3OFHA 1DQ9A 1TK5A 4ZCLA 2VBZA 4B3MJ 4ELTA 4O0NA 2ZUAA 1HNZF 2DXFA 3VAJA 5IT9U 2DNHA 1WEXA 4WCEQ 3TRGA 5EDWA 4TXSA 4NI2A 1NB2A 3BQ2A 3KYLA 2LCWA 4ZP7A 2LA6A 4NLDA 4WFXA 3ENWA 3R3TA 3TUIC 5LMUF 1RQ0A 2FZKB 3LA0A 3MPUB 4A48A 2F8MA 1IQZA 5LL6d 1NZ8A 1R0AA 1T03A 1PCAA 4ZKAA 4DR1J 3PEHA 3TA0A 3E51A 1NDCA 4QWAA 1F5AA 4WK1A 3RTVA 1TP7A 2GS8A 5K20B 2MQ8A 2GMHA 5C5JA 1U02A 3J81U 2GHVC 4HI1A 3IO1A 5G0RB 4GVBB 4OZ0A 4MIBA 5L1JA 3CD5A 2A10A 4UTGA 1NNDA 5IS2A 5D8HB 5I3PA 3G6YA 1S1WA 3OUYA 2B4PA 1GXLA 3PW7A 2P9CA 1TUGB 4IG3B 3AA9A 2QTWA 2ZHAA 1WF0A 4XIUA 2HVDA 3QFWA 4F4WA 2WCXA 4OHYA 4JBCA 3AD8C 4DFJA 2PEBA 3B82A 2HHHJ 3RR7A 2JC0A 1NRKA 3FBEA 4YB6A 3TA1A 3EPGA 3K89A 4BLGA 2CPYA 2BJ1A 2ZKUA 1O5JA 4P2XA 2OPPA 3SSQA 1MNEA 4V1Ak 3U1LA 2CIMA 1W7WA 4K50A 1Q5VA 3HZEA 1DY3A 4DV5J 2JFKA 1QD1A 3QJLA 2AJ0A 1BY9A 1NM2A 3RRKA 2AF6A 5L1IA 3GV8B 1OQ3A 1A7GE 4ILMA 1H6KX 1RTDA 1FJCA 4R8UA 3LQVA 3MOJB 2B9EA 3MM8A 1JJ2R 2VBWA 3FC9A 3M30B 2KL8A 4RNOA 3LW5C 3OR1B 4ALZA 4L73A 2JLGA 1S4EA 2OKQA 4LF2A 1S6QA 1UEUA 4CDIA 2HRTA 1WI6A 1RAOA 3MUTP 3JAMY 2ATCB 1L3UA 2MSSA 1X9MA 1F60B 1LXJA 3HSJA 4H54A 2DGTA 1SJ1A 3QAEA 1XN9A 3ZC4A 2EWHA 5E3CA 4DN9A 2QYGA 3VWSA 3V6DB 1B4SA 2JDJA 4EBDA 2VQFF 5KG7A 2GW8A 2UXBJ 3OJSA 1RWOB 4WJBA 2BOPA 2HS0A 1CJKB 1FWPA 2B4UA 5KTQA 4PWDB 1PYTA 1MSWD 4I2QA 4A8WA 3G8SA 4HHUA 2CDRB 1NHVA 2WVFA 3MGJA 4USUA 2H5IB 3H59A 3KLIB 5A8RA 1B99A 2M9KA 1E6VB 3NGUA 3HULA 4Z7YA 2CPHA 1RWWB 3QRPA 1PBAA 2ZBCA 5F8LA 2DGSA 1IJEB 5C24A 3AT1B 2VDIA 2FGOA 2Y0SD 2OFGX 3R97A 2LXIA 4LF8F 1IBCB 2J7KA 1FI4A 3LPYA 4PG4A 1CS4A 1OY9A 2QGFB 3I0SA 4JI7J 4R25A 1IVZA 5M2RA 2MEWA 3DRYA 1S12A 2K2PA 4CH1A 5KFBA 3IFEA 1RT6A 4WIQA 4CH7A 3D54A 4F0MA 1HNXF 1KLMB 4X66F 1S1UB 2RUSA 2IJRA 5HO4A 4DR6F 3KK3B 4YOEA 4Q0BA 2N82B 5DDOC 6FD1A 4GKJJ 4NEZA 4PPZA 5KFIA 2R7RA 4MTPA 4PUOB 4Y2IA 3DRPA 2DR8A 3M2VB 3MEKA 2DIVA 3B6BA 3IC1A 5F8IA 5J2NA 3KLEB 1RAFB 1REVA 2GJFA 4I69A 4JI4F 2OSQA 2W2NP 4KSEB 4K4SA 2Y1RI 4KYZA 3LWLA 4P7TA 1XR5A 3J7YU 4M5KA 2HHWA 2CQ2A 4RKUC 4OLOA 2AJ1A 4I2PB 2XI2A 3DXBA 5DQHA 4KHPJ 3R7BB 1M1HA 1M5OC 2DEIA 2KXHA 5ETKA 5E3AA 3MR7A 2CRLA 3T1HF 4RNNA 3GWCA 4JI8F 5KFEA 2E44A 3T5KA 3GFZA 2HNYB 4J9PA 1TMMA 1VFJA 4NXNF 1SH0A 1S6UA 4OZ3A 4DJBA 1CVJA 2E1CA 4Y28C 1N4LA 5FD1A 2AZ3A 1O51A 4G1PA 1KS2A 1VQYA 4RW8A 2Y1LB 5F3TA 2QA1A 1VQ9S 3GB0A 3CCMS 4EK2A 1M5HA 3AQPA 5FLXU 4C8KA 1I3OB 2EG1A 4C0BA 3VVTA 5F3ZA 4LVNP 1P8GA 2DNRA 4MMOA 1HBNA 5JVHQ 4DL4A 2CQHA 5BXIA 4TQRA 4EI2A 4LFAJ 2FJVA 3QIPA 3NAIA 1WC0A 2XWYA 3KJFB 4X84A 1KKHA 1FEHA 1KDNA 3VALA 3ONQA 5KT2A 2D9PA 1VRTA 4NLQA 1XMQF 4EZ6A 2V2ZA 2EKYA 4WP9A 3LTOA 5GAEI 1RWVB 3MMCB 4AXJA 2YWEA 5JMNA 3U1NA 2HURA 3V2UC 1UEVA 2UUAJ 4WU2A 3VQTA 5K14B 4C97A 2IAJB 3NWRA 3DYAA 4A46A 3ZNJ1 3T1AA 1J5EJ 4A8YA 2MB0B 1JNZB 2V50A 2ZFHA 2HBRB 2XYPB 3MR3A 4WP8A 2J0QD 2K1RB 2KFZA 2PFFB 3DLKB 3QQCD 1DFDA 1NLKL 4OYIA 4QWCA 4YEAA 5HMZA 3AD9C 4FXWA 5CD4H 3BQ0A 3C15B 3CJTA 3TZXA 1RTIA 1JXVA 4CLZA 3Q8RB 4ZP9A 2G0CA 4LIWA 5HJYA 2JLFA 4KIAA 3R7SB 3W65A 2MGZA 1HHQA 4RL1A 4UZCA 1D1UA 3LP1B 5F0UA 3GZ7A 4C11A 2IVMA 4H4MB 3ISND 2QLFB 1KLNA 1IJFB 2RQCA 2HFOA 4DR4F 3DOMA 4PQAA 5C42A 2H4WB 1FWLA 1S1VB 4B08A 2OLWA 2Z2LA 4USVA 4NLGA 3TAQA 1N34F 4RZRA 4EBEA 2GFFA 1QJHA 2CQDA 1HI1A 2M4MA 1B64A 5HVHA 4WE1B 3A8IA 1SPBP 4RWXA 3OVSA 4B9MA 1KVKA 3KUEA 1IM4A 3R5BA 3IRXB 4ID8A 4DXLA 1Q8KA 4ER8A 2UVUA 2MJNA 2B4OA 5BYRA 3C16B 5CCLA 3CJQA 4CLLA 2EFQA 3FBCA 3ITHB 1RU1A 2VKZG 2HGLA 3KLHA 4OHZA 5LMNF 5BJRA 3AOBA 4CO5A 2F4VF 3JSMA 2DIUA 1IN0A 4NRUA 1RWKB 3JTOA 4M5JA 2CZVC 1GMWD 4LSNA 1HFEL 2GC8A 1RTZA 5I42B 5A2QU 1U45A 1T94A 4RPFA 4A8KA 3M32A 2DHHA 3FZ2A 5A0YB 1VMBA 3HI9A 1YQHA 3VTIA 3GJTB 3GCWP 1KSPA 3EDQB 4IOAQ 2HQIA 3PJ9A 2VDHA 5KFAA 4CM0A 3JQKA 1IKWB 2EEYA 2BM0A 2R7QA 1G4CA 1RHRB 2NSCA 3HDSA 3BKTA 4R0JA 1WG5A 3HHEA 1N5YB 1UW4A 3ZTSA 2UUCJ 4TU8A 1VQPS 1CJVA 2N4DA 4OZ1A 4P52A 3LAMA 5HAOA 2NSBA 2C2EA 4MK9A 3H2LA 1K1SA 4DLEA 4JI0F 3AY0A 2RB7A 4IR9A 2RF2A 4Y34A 2YTCA 2WBRA 4A8SA 1GX5A 2M70A 2ZITA 5DQGA 1IBKJ 3BZQA 4P2SA 2BJ3A 2W2PP 4U67Q 4LRBA 2YH1A 1IR2A 5KOXA 5IWAJ 3OL7A 1Z1ZA 3FEYB 4Y2KA 3IWXA 3Q0AA 4LF4J 3SCKE 1IBLF 3MECB 2HKEA 3MTJA 1S4FA 2OUGA 3SQOP 2YKMB 5LSOA 3AJ2A 4M5IA 2CNNB 2DJWA 1FRHA 4PAAA 5J2PA 2KRRA 3HHDA 3JAMU 1L3VA 5IOLA 4MJKA 1U1RA 2AJ2A 5KFMA 1HQEB 4CLKA 1NEEA 4U6PA 2I6WA 2YNHB 4FS1A 4IOCQ 1SKSA 5D15A 2LQ9A 5KT7A 2R2UA 4R5PB 2RRNA 2ZD1B 1Q7LB 3RBDA 1RT2B 4HDGA 3V5RA 1D09B 2ZOGA 1EARA 4B3RJ 4MIWA 1RTJB 2V2KA 3CJ5A 4JI3J 2EC0A 3H20A 1NK6A 1Z4UA 2OD6A 1HWJA 4ED7A 5KFLA 5H9FK 4LR8A 4BCAA 4DF4A 1LWXA 3OFEA 4Q8EA 3W66A 2O5DA 4DPTA 2W7PA 4YHHF 4GVBA 4ED6A 2XMTA 3CJSA 3DLEB 3HD2A 3U7JA 4AFFA 3SSRA 4WF9Q 4DR3J 3I9ZA 5H1SV 5AT1B 4ID5B 4DN0A 4USTA 1C2PA 2OAUA 2OEJA 4LRFA 1ZA2B 1DTQB 2Z56B 2QSWA 2VJUA 1T02A 3D3BJ 3R5JB 3A1YG 4NXMF 1XWLA 3MI7X 3HVRA 3ADAC 2ZM6J 2NCKL 4ETZA 5DJBA 4O3PA 5ETNA 4C7QA 2GIRA 5MLCV 3WDOA 3C6UB 3SXLA 3FSIA 1S77D 2NPIA 2XNRA 2LA4A 1NH7A 3GJQB 4OX9J 4GKKF 4WP3A 3GR1A 3NGSA 2XO6A 2OPRB 3RGIA 3DLHA 1SXLA 4NLTA 2YQ0A 4DR2J 2E1AA 1G6BA 2WSEC 1NAQA 4FN5A 2BABA 3THPA 1WKKA 1ULRA 3NAHA 4JUZA 3M30A 2UUBF 3ZZZA 3OR1A 1M1KT 3NNCA 4ZITA 4WXOA 1EHWA 1S72S 4N77A 4NLWA 2LYVA 4V19J 3IAS9 1KVJA 2V69A 4OJGA 1JLFB 2F7VA 3TAMA 3AD7C 1RCXB 4USHA 1IQTA 2PMHA 2C3UA 1SUQB 3D0GE 3V6DA 5F41A 5IT4A 3BBCA 4LQ9A 3CJ0A 3ENQA 2R3VA 2R8HA 1CJKA 5HQLA 2YWKA 4PWDA 4Y3CA 4J5OA 3W8PA 3A12A 1TL3A 2FTRA 5DG8A 1JK9B 8RUCA 1N54B 1U26A 2AYGA 3PTWA 1FRKA 1QM9A 3DRSB 3GU0A 5KG1A 4BWJA 1UPMB 1U1QA 1M5KC 2Y9HA 2X1AA 2QG9B 3FK4A 2CPFA 3I4PA 3BN7A 3C8YA 1VRQC 3QT8A 3KHHA 3VAFA 2XY5A 3FCWA 1JIHA 1KRPA 3N5BA 3F41A 1KLMA 1S1UA 2PIIA 3OJUA 4O3RA 3R8YA 4QW9A 2EPIA 3TZYA 4LSLB 4LRAA 2WW8A 4KC5A 3KK3A 2MY8A 1S6PA 4Y0FA 4U9RA 2OP5A 5HATA 5DS7A 4CT8A 3MCMA 1HQ2A 3M8RA 3FFIB 4OJ3A 3M2VA 2DHAA 2CQBA 1U2CA 1OY8A 2HHQA 2M0GB 3HHLA 3VAGA 5H9EJ 4NMXA 2CVIA 4ED3A 4FBUA 1WTFA 1U0HB 2H5EA 4F8RA 2NUHA 3AB2B 4KGKA 2DH9A 1UFLA 1F9HA 3K5PA 2ZZTA 1DARA 2OI2A 1QAXA 4ECRA 3PFEA 4WYLA 1YTYA 2FY1A 2X7IA 2P2CB 1S99A 3BO3A 2GVDA 2AKWB 2LDIA 1YGYA 2RMLA 1U1KA 3TI0A 5DG7A 2XS7A 4U95A 1QE1B 1XMOJ 3KWMA 3MR2A 3I4HX 3LP0B 3PYDA 3T1YF 3EVWA 5KT3A 3F56A 1B0VA 1FJGJ 1K1QA 3MD3A 4X62F 4OYMA 1X9SA 2QFJA 3H0PA 1UJ6A 3NNHA 1TVRB 4LFBF 3D7SB 3D9BA 3J7ZT 4F7VA 5RUBA 1HARA 2YKAA 3FGVA 3EVOA 3Q24A 2HFUA 3Q83A 4F4YA 3MM5B 4DQRA 3W9JA 1RAJA 3D1QA 2D3O1 2MZRA 4C8NA 4A47A 2CPXA 3FVYA 5GMDA 4M95A 2M8DB 1Q7YT 3CB4A 1VBYA 2XSJB 1FERA 4OYXA 2CQ3A 2FJEB 3V6KA 1YZ7A 1EKSA 2CQ0A 3KJNB 2B9XA 3W8GA 2B8QA 1H38A 3CPWR 1VISA 3SIPB 2LVWA 3MMCA 5LJ5Y 2XI3A 1HA1A 3Q86A 1WOOA 5HBMA 4C3MA 3HJFA 4PYDA 4Q43A 3N28A 2IDLA 3HMJG 3OVAA 1IUJA 1U4BA 4CO3A 1N33J 1NKCA 2IAJA 4O0IA 2DHSA 2MQOA 5IQ6A 5DQIA 2KO1A 3K8VA 2HSEB 2EVZA 2IHR1 3RAQA 3WX8A 3M05A 3M6UA 2HNDA 4RW9A 3AJ1A 4EMDA 5L1KA 4URSA 2V6AA 1FK9A 1BQNA 2K1RA 5HL7Q 3DLKA 2HNZA 3TJAA 2W7OA 3W5ZA 4DZDA 2H51B 3HM9A 4UOGA 2KHCA 2IA6A 1UZDA 2CAJA 4OI0A 2DGWA 2KTQA 2HRYA 4J9SA 2KXFA 1I6JA 3CTRA 4NA2A 4G1IA 4QWEA 3UD3P 4DS5A 1GMWA 2PD1A 2R4FA 3K7RA 4DG1B 2JRSA 3PR5B 1R8PA 4K0KJ 1FTRA 3DHWC 3TZZA 4PG8A 4H4MA 4CWBA 2Y0BB 3BYRA 1Y10A 1N5QA 3LAKA 2RKIA 3J7YI 4OHXA 1X5PA 1WORA 3HSZA 4U7CA 1S1VA 4K5SA 4ZIVA 4LF6F 1RAEB 3RRHA 4I6YA 3GTYX 5A6PA 2VG7A 2CZ9A 3CC2S 3CCUS 1G3OA 1X4CA 4GC7A 3BM7A 4WIIA 4F0HA 2XNQA 2V8GA 1VS3A 3EXCX 3QNWB 3U27A 5KFPA 1SJ4P 3D6HB 2MZQA 3BSAA 2CQPA 4NL5A 4EZ9A 3CWJA 4NLRA 2MHNA 2YBVA 1P9QC 2IRXA 2IC3A 4DR7F 1F2HA 2ALYB 1WG1A 2F63A 1RSCA 4CNYA 1NJXA 4H4OB 5DM7Q 3NMAA 3DLLQ 1O8BA 3ITHA 3C66A 4HDHA 4M5NA 4I64A 4PXDA 1S48A 4CH0S 1T11A 4DPOA 4QIEA 1LKZA 3IG1B 5G4DA 5KFRA 5IV4A 3D1OA 2QL5B 2GO8A 4KH1B
chains in the Genus database with same CATH topology
2R7TA 3CIZA 2J6UA 3ULHA 3GSDA 2FLNA 3P6YC 2AU0A 2F9JA 1NK4A 2B43A 2XMVA 1VC0A 5A0YA 3LP0A 3UNGC 2GHPA 4QZVB 5L38A 4ZPBA 2PDAA 1KOOA 4WYWA 2KG1A 2FC8A 2DGUA 1Y4ZB 2LDYA 3L95X 3DLJA 4KGMA 4RBVA 2LKZA 1QY7A 4IFVB 2M2BA 2UVWA 1VQ8S 1DTTB 1HBUA 3OTOF 1UL3A 2VPYB 4B9UA 3L7OA 3MAQA 1NK8A 4TYAA 3P49B 1TVRA 4OX6A 1U1MA 3JSBA 4B3TF 3PY8A 3L09A 2W4PA 1HPZB 1IKWA 2RILA 3EYZA 2V8VA 2EK1A 2D3OR 1SH3A 2C2RA 2DNOA 2BQRA 4O3QA 2FVRA 5A8WB 2DR7A 1U1LA 1FXLA 4DHVA 2R7VA 3R1HA 2NS1B 3W2WA 1XERA 2Q3PA 3T19A 4Q45A 1HMVA 1WF2A 2RDIA 4CI0B 4KRWA 1S97A 2YWFA 2MZSA 4ECZA 4JI5F 3UR3C 2MQMA 3GYXB 1HHTP 4M94A 4LF9F 3RBEA 1AFIA 5F8GA 3TAPA 2VPWB 1MU2B 3PJWA 4PR6A 5EGYA 1N5YA 3ENVA 1ELOA 1KHWA 1OPZA 4FP9A 3HVWA 3NGDA 1SJRA 2SXLA 3H98A 5J2PB 2BANA 4ED0A 4RNMA 3OFHA 2YNIB 3DOKA 4NYPA 1DQ9A 2DRAA 1TK5A 4ZCLA 4OV1A 2VBZA 4M5DB 1ZAVA 4ELTA 3IA0A 1VQ7S 4YDXA 4K4YA 1HNZF 1IKVA 4X4SA 3VAJA 4OI3A 1Y0HA 2FJWA 2ZDOA 4HHJA 2DNHA 4DSKA 1WEXA 4WCEQ 3TRGA 4RW7B 4JYAF 2D7SA 4TLRA 4I68A 1KR4A 5EDWA 1RP5A 4TXSA 4IDKB 2ROPA 1FO1A 5J2NB 3CIMA 1J5OA 4O3OA 3H40A 1YRTA 2GA7A 4D3HA 2JFDA 3IN5A 2CPEA 3BQ2A 1SIZA 4DV5F 3TW0A 3KYLA 3BSOA 1XNRF 2LLZA 2LCWA 4ZP7A 3MMAA 2XMWA 2B56A 2LA6A 4NZ0A 4NLDA 1A9NB 2OPQB 1RI7A 4WFXA 3QWPA 1Q81T 2HVHA 3KLVA 3ENWA 1C1CB 2RRAA 3CE8A 3IAM9 3H5UA 3R3TA 5CHCB 5E3PA 3TUIC 1XMOF 2XS5A 2AX0A 4DL0C 1LWEA 5LMUF 4DWIA 1RQ0A 2B7CB 2JC1A 1TZ0A 4J9KA 3EUNA 4QR1A 1NKEA 2IJNA 2BZ2A 4A48A 3G6ES 3NL0A 1BWEA 4IO1A 1ZM4A 2F8MA 1IQZA 5LL6d 4BWMA 2GGPB 3NKYA 1T8EA 1R0AA 2YY3A 1FJGF 5HLFA 3H2UB 1T03A 4ZKAA 3FMBA 3PEHA 4TY8A 3OVBA 3HF5A 4I7FB 4OX7A 3TA0A 3MEEB 5KFDA 1YJVA 3E51A 2CJQA 1DHMA 2XLJA 4MK8A 4QWAA 1F5AA 4WFBQ 2WSCC 1TFWA 2J7WA 3BEGB 4WK1A 4PXBA 1QVGR 2F3JA 4KHMA 1TP7A 2XGPA 2RD5C 4KHRA 3RTVA 5HROA 2GMHA 3AHPA 1QSSA 3NBPB 3NLCA 5C5JA 1ZAWA 3H5XA 2GHVC 3D0HE 2WB4A 4HI1A 1E6YB 3IO1A 4YDDB 3MECA 5G0RB 1X4BA 4NCAA 3T5LA 2FVCA 4OZ0A 1N52B 4MIBA 2DK2A 3AAWB 3SFGA 4EUVA 3HPOA 5L1JA 2C28A 2DPJA 3CD5A 5KOWA 1U1OA 4JI1F 2A10A 1NNDA 2BJEA 1NK0A 2OFHX 5IS2A 5D8HB 1QVFR 4CNZA 1RKIA 2DCUB 2J0XA 2R9LA 4MK7A 1RK8A 2JWNA 5I3PA 3G6YA 2KJWA 1S1WA 3S01A 4IH7A 7FDRA 3TYTA 1S1XB 4EU0A 3OUYA 2B4PA 1GXLA 3PW7A 3CJ4A 2P9CA 5AJ3F 2KDOA 1QLNA 4IG3B 2BRKA 2RQMA 4RBUA 4DR5F 1U2RA 3AA9A 3DGPA 1HBMA 5D77A 2AGQA 3M6VA 3MMBA 1JB0C 5DM6Q 2UXBF 4DEZA 4RU9A 2ZHAA 1HQEA 3RB0A 4A8FA 5LSRA 1WF0A 1KD1T 1TL5A 1JWWA 3UE2A 2YNHA 4XIUA 4PCQA 1M0SA 2HIQA 4M8LA 4F4WA 1IKYB 4CO4A 1T3NA 1ZM3A 4Q8FA 2KYXA 2WCXA 3NGKA 3TVYA 3PXGa 2OIHA 1Q8IA 2D74B 1RA6A 4OHYA 4JBCA 2WBMA 1KC8T 2ZD1A 1VQOS 1RKJA 2FLPA 5KFQA 3QYYA 4DFJA 4WKYA 1HBNB 3B82A 4GO5X 3C6TB 1RT2A 4NLUA 1H2VZ 3RR7A 2JC0A 1K0VA 1NRKA 5GADU 3T5JA 4YB6A 3TA1A 2ZE2B 3NCRA 3QIPB 3EPGA 1U6BA 1OSCA 1RT7A 2CPYA 2BQ3A 2ZKUA 1O5JA 5HI7A 2MZJA 3UWTA 2I2YA 5F8HA 3KK1B 3PW4A 1RT4B 3SSQA 2OPPA 1N5VA 1MNEA 5FDLA 4XPCA 4WXWA 3U1LA 1JJHA 5IT0A 2PI4A 4LF5F 2WONA 2CIMA 1V3RA 2B51A 4K50A 1MWYA 3HZEA 1YJ9S 4KO0A 2UVRA 1TFYA 5FIIA 2MKKA 2JFKA 1FE4A 3ZZRA 1SKWA 3QJLA 2J76E 4I6WA 1PSDA 2AJ0A 4B9LA 2XLIA 1RTHB 2JOQA 1BY9A 4U7UK 1RT3A 3POTA 3MPVA 3UCUP 2KT5A 3RRKA 2AF6A 4CZCA 2OPSB 2CQ1A 2RU3A 5L1IA 3CD7A 1N33F 2VFVA 3GV8B 3KK2B 4UY8T 4NZ7A 1C0UB 2FB0A 3UDLA 4DSLA 1OQ3A 1A7GE 2WOMA 3EXYA 4ILMA 2KH9A 3N79A 1GXUA 4DSJA 1H6KX 1RTDA 5IM0B 1FJCA 4R8UA 3LQVA 3MOJB 3MM8A 1JJ2R 2VBWA 3M30B 1VQKS 2YNFA 5ITHA 3CJ2A 4RNOA 3HX9A 3LW5C 3OR1B 4L6V3 4J9MA 4ALZA 4ZOSA 2BVZA 4P6QA 4MYUA 1MW7A 5DG9A 2JLGA 2W9CA 4KFBB 1TQLA 2OKQA 4QWDA 1FRXA 2R2TA 3DLGB 1H0HB 3K5NA 1F5CA 1S6QA 1V9OA 2LXFA 4HTJA 4ID5A 5E7OB 5D3GB 4F50A 3SCIE 1UEUA 1HW9A 2RT3A 4ZCKA 3DYAB 4UW2A 4F26A 1WI6A 5KFKA 2UU9F 3MUTP 4IQXA 1DTQA 3JAMY 1BLUA 3WC0A 3G9CA 1L3UA 1GQEA 4RW4A 2CQCA 2MSSA 5IWAF 2FJAB 1X9MA 2QYCA 4A8OA 1F60B 4ZPWR 1LXJA 4H54A 2XWXA 2DGTA 3HKZD 1Z2LA 2CYYA 2N4CA 1SJ1A 4GKJF 5AXKA 3QAEA 4C4WA 1KEKA 1XN9A 3ZC4A 3VAKA 3I82A 4ZHRB 3FDSA 2EWHA 5E3CA 4DN9A 3DI6A 1N5SA 3VWSA 4DV7F 3V6DB 1KONA 2JDJA 4EBDA 2VQFF 2B5JB 3PKYA 2FVSA 4K4UA 3LUYA 1VQ4S 5KG7A 3QMQA 2GW8A 2DHGA 1ZH5A 3V81B 1S79A 3B78A 3OJSA 5KFHA 4NCGB 3TANA 4WJBA 2DGQA 2BOPA 3C6UA 4IG0B 2HS0A 3EZUA 3LGMA 3WX4A 4FNHA 1TL4A 4HT5A 4X2BA 2B4UA 2J9CA 2J9DA 3M2UA 5KTQA 4PWDB 3JTPA 1MSWD 4Z2XA 4I2QA 5HQ8A 2F40A 4A8WA 5HP1B 1SJFA 3SCJE 1FXDA 1LXNA 2ZH6A 3G8SA 1H98A 1F5BA 1NHVA 5L9NA 2QEXS 3H2VE 1RGVA 3JSRA 1S9GA 1C4AA 4ZA1A 3US5A 3MGJA 1FJ7A 2OPRA 3T6JA 1ZOTA 5B0BA 3H59A 5JXSA 5C25A 3KLIB 2AP6A 5A8RA 4N56A 4ED8A 2IBKA 2M9KA 1E6VB 3KJVA 4IR1A 4IRDA 4LFCF 5IZHA 2CPHA 1FDDA 1X4EA 4ZP8A 1HR0F 2ZH8A 4PWUA 2ZBCA 2N3OA 5F8LA 2DGSA 2CPJA 3CMAS 4B3OB 3T3FA 2Q79A 3T9NA 2M3DA 2XY6A 2YKNB 4YR2A 2AWZA 1FESA 1IJEB 2FDNA 5C24A 2JHEA 3PW5A 5CYMA 3FEXB 2FGOA 2Y0SD 2OFGX 3JB9k 2Z2MA 1IKXB 3DU5A 2Q66A 4QU7A 2BRLA 2LXIA 2VKRA 3GIMA 4LF8F 2J7KA 3LPYA 2M88A 1Y3JA 3VQSA 4PG4A 2FLOA 4DL3A 1VQMS 2B4VA 4YFUA 2HGNA 3I0SA 3H5SA 3E01A 4P7VA 1LW2A 1FKPB 1JLFA 1GX6A 4R25A 4IFVA 5M2RA 1DTTA 2ZHBA 3BB5A 2KRBA 2BE2B 2VPZB 1TKXA 2ZOFA 5SUHA 5DETA 3H25A 3DRYA 4DFKA 2K2PA 1U49A 4CH1A 3J7Z5 1LW0A 5KFBA 3IFEA 1RT6A 3O6QA 2JL9A 4E8UA 1DAXA 2JSXA 5EWFA 1Q53A 3CDUA 1QAIA 1Q79A 4FF3A 4CH7A 2HFNA 4BDPA 4B9NA 5B0GA 3IS9A 1MROB 3D54A 2DPIA 5SZTA 2XMUA 1HNXF 1N5TA 2E5HA 2PN6A 1KLMB 2V5HG 4X66F 1S0NA 1S1UB 3VCDA 3THTA 3O8WA 4EBCA 2Y1JA 3MPWA 3I6PA 1CLFA 2ADBA 4EWTA 5HO4A 1PC5A 1Y00A 4BHQA 2F8EX 2VFUA 2IM3A 3HHKA 3MM6B 2E66A 3KK3B 4DR6F 4YOEA 4Q0BA 1JLCB 4TNOA 5AE1A 2IRUA 2N82B 4V19X 5DDOC 1LV5A 2AYEA 6FD1A 2MJUA 4M5DA 2XMJA 1NK9A 2J0WA 4W92B 3CMES 3FQLA 4PPZA 1JLGA 5KFIA 5IXUA 2R7RA 4MTPA 4LFAF 2FHJD 2WK4A 4PUOB 2E9ZA 4Y2IA 1SV5B 1UWBA 3DRPA 1DURA 2DR8A 3M2VB 3MEKA 1HD1A 2DIVA 4IH6A 3SYZA 4PG5A 2HGMA 3SFUA 1ZETA 2IVFB 2NZ4A 3IC1A 4RW7A 3Q22A 1S1TB 3UQSA 5F8IA 1BQXA 3OHBA 5J2NA 3KLEB 5CQGA 2QA4G 4RWWA 1REVA 2I1RA 4I69A 4JI4F 2OSQA 1FA0A 2FHKA 4RUCA 2E5IA 3N9UC 1QAYA 3DRRB 4KSEB 3N6NA 5K8NA 3CC7S 4K4SA 3VAHA 5GAGU 2Y1RI 4MKBA 2CQIA 2HQ3A 1S6OA 3LWLA 2OPQA 3DRSA 4P7TA 2MQPA 2ZKTA 4HL9A 2HZCA 1C1CA 3N0VA 3UCGA 5GAHI 3G8TA 2Q6CA 4Y65A 2LEAA 2VC0A 1XR5A 3KLHB 1HNVB 3J7YU 4M1KA 2HHWA 2CQ2A 2IVYA 2E7XA 4RKUC 2QA4S 4I67A 1XR6A 5D4PA 3I87A 2JX2A 4OLOA 3HVAA 5B0AA 2AJ1A 4Q5VA 4I2PB 4I4BA 4FXDA 1UJ4A 1Y5NB 4DV2F 2QZ8A 2XI2A 3PX0A 4BS2A 4EO6A 3DXBA 4X4VA 1HQUB 5DQHA 3CVKA 1R3NA 1FDAA 1ZTTA 4ZK7M 3CXCR 5EX0A 2FJDB 2UUAF 1M5OC 5J2QB 2UVVA 3CJKB 4F3QA 2KXHA 4C8LA 2C3MA 2HHVA 5E3AA 1SKRA 2MKJA 4AYBD 2CRLA 3ZZ0A 1NHUA 3T1HF 4RNNA 1VI7A 3KLGA 1OSDA 3DDNA 5AXNA 5K8MA 4YQWA 5G0RA 2W7AA 1UETA 3DXSX 3GWCA 4JI8F 4NLPA 1W2BR 1U7LA 3TUJC 4QBUA 2AGPA 5L1LA 2O3DA 5KFFA 5KFEA 1DZ5A 4F2RA 3NG8A 2E44A 3T5KA 1U48A 3GFZA 2HNYB 4J9PA 2XMMA 1J5EF 3C2PA 1VFJA 4KJIA 4XK8C 3S6EA 5A8KB 4LSLA 4NXNF 1FTCA 1SH0A 4LIRA 2BACA 3IWLA 2GIQA 1NJZA 1S6UA 2HG4A 2F1FA 3Q2SC 4E98A 4ECYA 2CJBA 4OMFG 4DJBA 2E1CA 1CVJA 3RR8A 3DCAA 2DO4A 4ECTA 4B3MF 4Y28C 4X4OA 1N4LA 2MKHA 3G71S 4ICLB 5D4LA 3JYTB 3CCES 2IMOA 2A2CA 5FD1A 4IG3A 1O51A 4G1PA 1KS2A 1VQYA 4RW8A 3THVA 5J2MB 4DQSA 5F3TA 4ERDA 3DM2B 2QA1A 2QE5A 1VQ9S 3GB0A 3CCMS 1AW0A 4A8XA 3MDFA 1X0FA 2HHPA 1KFSA 2VG5A 1M5HA 3AQPA 3QO9B 2WTFA 3B8HA 1Q78A 4C8KA 1XBWA 4MFBA 2IRYA 1IBMF 2EG1A 2MDAA 2JEIA 1EP4A 4C0BA 3MFHA 5F3ZA 3ZZUA 4LVNP 1P8GA 5J1PA 2DNRA 3M1VB 4MMOA 1HBNA 5JVHQ 4DL4A 2CQHA 1S0MA 2VASA 3QAUA 4RBTA 4KV8B 1R8HA 4X65F 4TQRA 2FJVA 5AE3A 2BV3A 2UXDF 2HHXA 2ZE2A 3QIPA 3NAIA 1S9FA 1FHTA 1NO8A 4OZJA 3CSKA 2FJBB 1SI9A 4FS2A 2XWYA 2YX4A 1LWCB 4X84A 1ZZNA 2L9DA 4LVOP 3LP2A 1FEHA 4YB1P 1B7FA 2DGXA 3N4WA 3VALA 3ONQA 5KT2A 2M52A 4N5SA 1U09A 3T5HA 1RYRA 4GO7X 4YR3A 3VF0B 1TR0A 1N32F 5AXMA 2YVSA 2P6TA