4E8UA

Crystal structure of arabidopsis idn2 xs domain along with a small segment of adjacent coiled-coil region
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
166
Chain Sequence
DEKLVYPWKGIVVNIPTTKAQDGRSAGESGSKLRDEYILRGFNPTRVRPLWNYLGHSGTAIVEFNKDWNGLHNGLLFDKAYTVDGHGKKDWLKKDGPKLGLYGWIARADDYNGNNIIGENLRKTGDLKTIAELTEEEARKQELLVQNLRQLVEEKKKDMKEIEELC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein T8P19.180
publication title INVOLVED IN DE NOVO 2-containing complex involved in RNA-directed DNA methylation in Arabidopsis.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Rna binding protein
total genus 49
structure length 166
sequence length 166
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03468 XS XS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4e8uA00
4E8UA
chains in the Genus database with same CATH superfamily
2VPXB 2FZGB 2F8MA 1CJTB 1X4CA 2PMHA 4HDGA 2KL8A 2ROGA 3EDRB 1VHFA 1B70B 3ZFVA 3M2RA 4QW9A 1ACMB 4X66F 4UQGA 4J9KA 1S4FA 3CDEA 1X9MA 4O3QA 5HP1B 3LW5C 3BSCA 4XPCA 5H9EJ 3DFEA 2HAIA 4FVCA 2RS8A 4DR1F 1H72C 3TAMB 2F8EX 3AOAA 3VHQA 4YY3F 3AA8A 4N56A 2B7CB 3KLFA 5HROB 4C0BA 3NCQA 3J81j 1K0TA 4IRDA 5LJ3Y 3CJ5A 1U0SA 4LF7J 3NP5A 4JI1F 1BQMA 3IAM9 1OYEA 3POTA 1QSLA 1P9YA 2XGQA 5F41A 1RWUA 3FBCA 4X4RA 3P3DA 4FYXB 1FNXH 1X9WA 4N76A 2OIHA 2C2EA 4NLPA 4WYLA 3LWLA 2ZH5A 3RU0A 1RWWB 1GX6A 2XC9A 3J80Y 4F0HA 5KT5A 4USWA 2JFKA 1BHNA 4RW7B 3BPSP 3NGDA 1PKUA 3MCMA 4Q8FA 4KHMA 2XMWA 3OTCA 1NKEA 3UFCX 1JQGA 1DZ5A 2AV5A 4H4KA 2VJVA 1FTRA 4Y2IA 4ENOA 5A8WB 3CCES 4OJ1A 2RB7A 5F8IA 1N36F 1YJVA 2QL9B 3GJTB 1G3OA 5FLXY 2LA4A 4O4GA 3IAS9 2WONB 2EFVA 2DVIA 1M5SA 4X84A 4O0NA 5KT3A 2OTLS 3DRPB 3W9HA 1FRMA 2XI3A 2NZ4A 3TA2A 4ILMA 1XMQF 2HFUA 5DO2A 3HKZD 3NL0A 5ETLA 4ID8A 3RAQA 2VH7A 1IQZA 3MMCA 1P8GA 3UR0A 4H4MA 2E66A 1I6JA 2AWZA 2JNJA 1IKXA 1T3NA 4ECRA 1H73A 2VG7A 2WTFA 3KLHB 3N6MA 2H3EB 1RCOB 2DGWA 3R7NB 2YWGA 4EYHB 1IKYA 2B6AB 3ENWA 2G4BA 3CCMS 5K14A 3E8OA 3P49B 4UOHA 1W26A 4P2XA 3SSRA 1BD6A 3M1VB 5CZVA 4KGXB 1HYSB 4RBTA 2XZDB 3M05A 2RUSA 3V4MA 2UUCF 4C3MA 1WF2A 2D9PA 5B08A 4KTQA 2VASA 3QLHA 2GW8A 4LRBA 4DR1J 1NPRA 4EK2A 1DTTA 3PHTA 1ICEB 4HTJA 4YY3J 1WSRA 1S12A 3JAMY 3PW5A 1CQNA 1KSPA 4PG8A 4OYPA 2YKMB 3PEHA 4B9LA 4EFAC 1RXOB 2RMLA 1T11A 3ZTRA 2XCAA 3H25A 3H59A 2APOA 2DHXA 3T9NA 2DPIA 1KRPA 4FYYB 4DLGA 4K4UA 3M30A 2IDEA 5KT7A 4FKYA 1F60B 1T9XA 3HHLB 5EWEA 3L95X 1FX4A 2IFXA 3M2VA 3CJ2A 3GYGA 5GMKa 4AL6A 2NXEA 1Y00A 1JNZB 1U2RA 1PC5A 1SC4B 3D9BA 3UE2A 2A10A 3VAIA 5IWAJ 3G82A 4NXMF 4WU3A 2BE2A 4ZDNA 1HI8A 3A1YG 2HWHA 5L1LA 2NXJA 1N36J 3ULHA 4PXDA 2GHPA 2V9KA 4B3MF 4GMKA 4FPRA 1NSPA 3NG8A 2N4CA 2KO1A 1LWEA 4U7CA 5J1EA 2MQQA 4AL7A 1DLOA 5E33A 4B3TF 3J7YI 2NQPA 1PYTA 3MAHA 3ISZA 5LMUF 2R7TA 1W2IA 4V19X 2IDLA 5U47A 1RKJA 3T6BA 2MLXA 3RB6A 1SIWB 1JIHA 1Q86T 4DV5J 3L7UA 1HMVB 4RKUC 1M5KC 3CDBA 2L9WA 2MB0B 1ZM3A 3PW2A 1JJCB 1X4AA 1GK8A 4NRUA 4DPOA 3BO4A 2C2DA 2JC0A 2QEXS 3PDNA 1Q5YA 3FBBA 4YHHF 4R0EA 4S0MA 1NNDA 1BWEA 4LR9A 5HJYA 3C46A 2K2PA 2KU7A 2YNFA 4O3SA 4UY85 5AJ3J 1B99A 1KLMB 3G8TA 1AZSA 2DGSA 3PKMA 2YNHA 1RHJB 1HPZB 3KMSA 4ES2A 2ZITA 1RT4A 4IUFA 1RYRA 3Q0AA 5HVGA 3DM2B 3HHNB 4O3NA 4RUCA 2ZNZA 4TXSA 5F3TA 2UUCJ 2LKZA 1MSWD 1Q8LA 2Y1IA 2G1HA 1MWQA 1ITPA 2MDAA 4FF1A 3K58A 3EMTA 2EPIA 1WTBA 4HACB 3MAQA 3GLJA 3VALA 2DNLA 1SXLA 2W9CB 1NK4A 2RILA 4JI5J 1VI7A 2M0GB 2Q79A 2V5HG 3CCQS 3IRXA 1WHWA 2BJ1A 1Y0HA 2NXUA 2ZD1B 2HZVA 4J37A 2N7YA 1Z1ZA 4DU8A 3MM6B 3M32A 3H8YA 3VR1A 3DDIA 2R7QA 2WRMA 4QIGA 1RTZA 2F9JA 3K57A 3I56S 1U09A 1S1VB 4X4UA 4P71A 4CIOA 1SC1B 4FBUA 1K47A 5SZTA 3P4UB 2P2CB 3GYNA 4C8LA 2R3VA 3BDPA 1YQHA 2OPSB 3HLUA 1TMJA 4J9NA 3M9OB 4LBHA 3T5JA 1CJTA 1K1QA 1CS4B 4M8LA 2YH1A 1S59A 4DZ6A 1F9EB 2ZM6F 5DZ6A 2UXDF 2AYMA 3GR1A 3GJSB 3EPGA 1N5VA 2UZAA 3AOCA 4I6YA 2VF3A 3MFIA 1RE1B 4B3MJ 1DTQA 4Y0FA 1IM6A 4OX8A 1IBMJ 5M2RA 1VHIA 3UVJA 1LV5A 3D2WA 1TKTA 2BDPA 3KG0A 2RQMA 4ZLNA 5KG0A 4G1QA 2HZCA 2MGZB 1D8ZA 2MKJA 2R9LA 3MPYA 5LOQA 2B4VA 3NGUA 2GAHC 5LMUJ 3D0IE 2AP6A 4DFKA 4YS2A 4UZBA 3IXQA 3R7BB 5B0EA 1WDTA 3ENQA 3HK2A 5L1IA 4ED5A 3H4DA 1R0AA 4A8KA 4K4VA 2EWHA 4DSFA 2VA3A 4A4JA 2V67A 1DARA 3LPYA 3P5TL 3CJKA 4LQ3A 5GAEI 1IXKA 2VA2A 2ZH8A 3F44A 1HBOA 5KFPA 2HBQB 4U8VA 1RCXB 2GQQA 3QT5A 3W2WB 4C98A 3MTJA 1HWJA 2ZBRA 4HEA9 4OHXA 2Q1LA 3QO9B 2MJUA 5KFYA 4PXCA 4DCJB 2IVFB 3RR7A 4FF2A 4OZLA 2MKCA 3VQSA 4M5GA 3W61A 1SV5B 1OYDA 2Z2LA 5DM6Q 5F8HA 4F67A 1BGXT 2XMJA 5A8WA 1KR4A 3CO9A 4PWDA 9RUBA 1LK7A 3KK2B 3CD6S 4QYZK 4NPOA 3KG1A 4GC6A 3IS9A 2LEBA 4I7FA 2DR7A 2OTJS 3CCUS 1UJ4A 3KJVA 4ELTA 5I3QA 4MKVA 1UJ6A 3DRPA 2Y8YA 3OFHA 3BBCA 2HHHF 1MNEA 4NRTA 1FJ7A 3PX4A 1NK6A 2CJBA 4O3PA 1WTFA 2ZH6A 2NZCA 2GMLA 2CJKA 3BN7A 5KFOA 2MLYA 2HWTA 1HQ2A 3C6UB 1RTDA 3K2YA 1RA7A 4U9RA 1S6OA 2NLWA 2KT3A 2V94A 3KLHA 4W92B 2PN6A 2A6OA 1EX8A 3LP1B 2XSJB 4UOGA 1UZHA 3JB9k 1B0VA 1KHVA 3I5BA 3H20A 2ATLA 3MM8B 1JJHA 4RUHA 4Q43A 2ZM6J 1X9SA 3IA0A 4RR5A 1N8RT 3FC9A 3BO3A 4Z2XA 2EBGA 1WACA 3HSDA 4UOFA 2V63A 2XMKA 3BS9A 2GQCA 3DYAA 1R3NA 2IVMA 3DOMB 1AT1B 2HSEB 4KGVB 2JLEA 2KT2A 4FDFA 4J9RA 2BZ2A 4OQJA 5DQGA 1K8AT 4CQ1A 1CSJA 3B54A 1ZBTA 3PY8A 1TKZB 2ZVSA 2VZ9A 1NDLA 1XEZA 4YB6A 3RBEA 4ALZA 3PR4A 2LA6A 3BQ1A 2HKEA 2ZOFA 4LT6A 2CA9A 1QAYA 3QGGA 4OZ1A 2HK3A 2DY9A 4RJVA 3OXGA 3LF0A 2IRYA 4F04B 1QTNB 1NU4A 3EGWB 4P75A 1N5YA 2AHOB 2FDNA 1RAGB 4B9VA 4B08A 3OT9A 3AA9A 1JLQA 2FQQB 2OPRA 2WB4A 2BM0A 2ZE2A 3RGIA 4LJMA 2W01A 4OZ5A 1HBUB 2QLBB 4F02A 1RBAA 1XC9A 4K4ZA 1C0UB 2M9KA 2FHKA 1CJKB 4CT9A 2FVCA 3I31A 4OX9F 1S1TB 1RHKB 4KFBB 4DUYF 3DCAA 2BYCA 1FCAA 1XJWB 1NPKA 3G2XA 3OTOJ 4ZHRA 1EAYC 1RAIB 2A1BA 1U1LA 4ZJOA 1MMLA 2LP4A 3GIJA 4K4SA 3I5CA 4CO2A 4OYWA 3CMES 1HHTP 1TL1A 4TKTA 3RAMA 1YDLA 5MAOA 3PFEA 5HQLA 1UTAA 4HI1A 4NCGA 4PAAA 3DLKA 4ZCKA 3J7Z5 1HWLA 4UY8T 4UTGA 3GG0A 2I38A 1YI2S 1R27B 4CRJA 4EU0A 1KQGB 4YOEA 4N47A 1SJFA 3T5HA 1UVJA 2X1FA 3BBBA 3GV8B 4X64F 3MUMP 3DRYA 4U6PA 1OY8A 1UPMB 5HVFA 2OH2A 4DV0F 1I94F 4ICLB 2NPFA 5E3PA 5K8PA 2HBZB 3QJLA 5KFSA 2LDYA 3FEZA 2WW4A 4TQRA 1C1BB 4QW8A 5A8KA 5KFMA 1M1HA 2C2MB 2OAUA 4KO0A 4I1TA 3O6QA 5BYRA 2CPIA 2CJ9A 5FD1A 5KFJA 4N77A 1HPZA 3CSKA 2PMWA 1X5PA 3GILA 3DHWC 1S49A 3MR2A 1TAQA 3Q8YA 4C8YA 2OFGX 2XMVA 4E2FB 1O0PA 2K8GA 1LNQA 1TU0B 1N6QB 2G0CA 4DL0C 4DSKA 2B51A 2H1YA 4CYUB 1NJWA 2AMCB 4IOCQ 4OYZA 5E3CA 1P6TA 4HI2A 4WFAQ 2WSFC 2ZVIA 2Z4PA 2W7AA 2F9DA 4O44A 4AT1B 3LGMA 4MT1A 2YQ0A 1DBDA 4F4YA 4NLGA 4H54A 2H5EA 3WX4A 3LAKA 4OYXA 2AQ4A 1YJ7A 2B9EA 2M5YA 3DC2A 5KG2A 1SJ4P 4Y65A 4N8NA 3KHLA 4KRWA 3GSIA 1JLGA 1S1VA 1S1UA 2AX1A 2RU9A 1MLAA 3L09A 1GT8A 2E9RX 3VAJA 4QOTA 3HHLD 4TU9A 3KLVA 4DPXA 1I5OB 3ENAA 4WXWA 2AKWB 3HSGA 3K5NA 3L9ZA 2JVRA 1W25A 4DUYJ 2HWIA 3W64A 1UA1A 4MYTA 4ED7A 3FRZA 2J9DA 4KC5A 4IG0B 1S76D 2CQ3A 2QGFB 1VCTA 1RSCA 2AZ1A 1E6YB 1ZAXA 4WZQA 1IJEB 1WOSA 5GADU 1XR5A 4WU2A 4HVZA 3LGHA 4ZPWR 5I42B 1ZZNA 1D0EA 1T03B 3BGRA 2FUG9 3FK4A 4GVBB 2P6SA 3E3XA 1SKWA 1CEZA 1TV6A 4RW9A 5F8NA 5J2NA 2Z2YB 2V8PA 2HGMA 2CJXB 2OEKA 3D6MB 1SKRA 2JX2A 3W5ZA 4X64J 2DNKA 2JRSA 3MECB 3I82A 3CCLS 3N79A 2NYHA 3NEKA 1I94J 2LU1A 2IPOB 2WSEC 4EZ6A 2DXDA 4LF2A 4EBDA 4QCLA 2G2YA 2HEKA 4OX7A 2MZQA 3MMBB 2HAFA 3IBCB 1U1NA 1A7GE 3D6HB 4P74A 4ZVHA 1KWMA 2ASJA 3OFGA 1J27A 2DR6A 3M6XA 3QO9A 3D28A 1Y10A 1TQLA 1OMSA 4DR6F 2XHWA 5D4OA 2CZ9A 4IRCA 3A8EA 2ERRA 3BGLA 3TZZA 4ZVTB 2F7VA 1WELA 3OL9A 1IWGA 3W3SA 3UW1A 1T9TA 2V4QA 1WHVA 1ZTTA 5E3QA 4L6V3 3PIOQ 2CQPA 2MYFA 4BBYA 1CC8A 3KK3A 5K5MA 2V50A 4OFZA 3RUBL 4DV3F 3IM8A 1TR0A 2R7UA 3BR8A 3IN5A 1T3OA 1U24A 3MPUB 4DJBA 1NLKL 3IR5B 4UQTA 2NUHA 4DR5F 3TUIC 1WOOA 2CG4A 1TAUA 3QWPA 1KDNA 2E29A 5A0YA 3HF5A 2W9AA 4KGKA 2ZBCA 3H2VE 5KFBA 4XO0A 1JWWA 5D0GA 3M4XA 1OSCA 3C2PA 2YNIB 4WYWA 3PRVA 2ZDPA 2HFNA 2AX0A 1YVFA 3PACA 4FXDA 4E98A 2LCWA 2QZ8A 4ED4A 4PWWA 1YRUA 2EVZA 3GFZA 1A0OB 4KH1B 5HMXA 4NWBA 2DGVA 1D3WA 1HNZJ 1REVA 2POKA 5GAHU 1QAJA 1LWFB 4ZVOB 4H4KC 2HQIA 4ECYA 5DDPC 1QSYA 2HFOA 2F3JA 2V2QA 2FIUA 2WAQD 3DOMA 3O44A 1ZETA 1NAQA 4ANCA 1PCAA 5D0HA 3R8YA 2ASYA 3V6KA 2YPZA 1WI6A 1HHQA 1PGZA 4IRKA 3HD1A 1V3SA 5E2QA 4Y28C 1FJGF 3ET6B 3RR8A 3IBFB 2VDHA 3VF0B 2R42A 1FRXA 5D4LA 3AAWB 3W65A 2BR0A 3UPFA 3IR7B 5G0RA 1TKXA 3B82A 1XNQF 2J7UA 2OSQA 2BANA 4KHPF 2C2RA 1EKSA 1TK8A 4USMA 1CLFA 1PYSB 5EWFA 3ISND 3VV2B 1BUXA 4DV2F 3BF4A 5IQQA 5KG3A 3SV3A 1N34F 2K06A 1LOUA 3DLLQ 2YNGA 4USTA 4FS2A 3U1MA 2XLKA 2RE1A 3IWXA 1HBUA 4ECXA 2JSXA 3MPDA 4DR6J 3VZIA 2J0QD 2QTWA 1VQPS 4QR2A 1EJ7L 3AD7C 4DX5A 1NM2A 3SQOP 2BRLA 2EFOA 3R3TA 3J7ZT 2PEBA 3LGNA 1KVIA 4ER8A 3OXLA 5A76A 2QSFA 1X4FA 2X51A 1UJ5A 4DV3J 3BGUA 2YWFA 3SSQA 5B7WA 3SDEB 3AH6A 2NSCA 3M8QB 3J7A1 1JLFB 4USVA 2GO9A 4JV1A 1F5BA 4NYOA 1XBWA 1NHUA 1J5EJ 2VBXA 3MR6A 3QBCA 4P52A 1U7LA 3CIMA 3CULA 2KG1A 2X7IA 2M70A 3N4WA 2UUWA 4X62F 5C2CA 3W63A 1G4CA 5L9XA 3AODA 3KHGA 4WTYA 2UXBF 4WP8A 3M8PA 2JEFA 1KQSR 1RU2A 2KH9A 2AYEA 4KV8A 1M5OC 1WD6A 3P6YC 4XPEA 4WE1B 2CVEA 2YX1A 3ZZTA 2CZVC 4ILLA 5KOWA 1RDRA 4DPYA 2C1EB 1EQMA 2AJ4A 1LFPA 4DV1F 3NAIA 1ZOTA 4NI2B 1KEKA 2XO6A 2GNKA 3GSDA 1U8WA 2O01C 2Z57B 3DDNA 5CHCB 3WX8A 4CLFA 3SYZA 1RBLA 5CYMA 3TUPA 3HULA 2QLXA 5LXYA 4ED8A 2BOAA 4DL5A 4K4YA 2CNKB 3B4MA 4KHPJ 1YJUA 3DDKA 4OJHA 1ZYQA 1OQ3A 2CQ0A 4Y34A 3CJ0A 3C6TB 4RW4B 5HQ8A 1VYAA 5ETRA 4B3SF 4WK1A 3PR5B 2AYGA 1TVRA 3DHXA 4K5RA 4MFBB 1S0MA 4DV2J 2E1CA 2JFDA 1HQEB 1EETB 2YBVA 1J5OB 5CABA 4ZVQB 2OKQA 1NSAA 4P7VA 3S6EA 4DV7F 1LK5A 3NGTA 4X65F 4PUOB 4NZ6A 3D7SB 2H48B 2DNRA 2UUAF 5ETOA 2BQUA 3ILOA 4IG0A 3U02A 3CJ3A 2P9CA 1R8HA 3US5A 3RB4A 3MGJA 4KGZB 1KD1T 4O3OA 5D0RA 3V5RA 4CZCA 5J1PA 1VRUA 3SCKE 3LP2B 2UXCF 5I42A 3LP0B 4DV6F 3KLEA 1T03A 4QWAA 4B9MA 4TNOA 3OV7A 4K4XA 4CNYA 4QJVA 2AJ2A 3TARA 4IG3B 2VUGA 1S1XB 2V4JB 2EG2A 1B0TA 2C3OA 2I5JA 2ZBQA 3OHBA 1CULB 2JZ5A 1FE0A 2RF2A 4X62J 3PFOA 3JS9A 2PSZA 3AOBA 5HK4A 2GAGC 1HBNB 2MHNA 3QFWA 4LBPA 5I3UA 2WK4A 1FVSA 2EKYA 3DOLA 1UWBB 4RWWA 4M95A 4DG1B 2COLA 2H54B 4Z7YA 4ED2A 1U1KA 5D4NA 4JI7F 3V81B 1UFKA 1NO8A 2M8HA 2ZZNA 1VQYA 2H5JB 3N0VA 3QIPA 5HQMA 1OWXA 1EARA 3FSYA 4DV1J 1WEYA 1CJVB 2KB2A 4EMDA 1HD1A 2GA7A 2XGPA 2KI2A 3MTKA 3GIMA 3I87A 2BW2A 2PI5A 3D3BJ 4CWBA 3Q86A 1MW7A 2Q66A 1BLUA 1T9VA 3GV7B 4B9TA 4OZNA 3PKYA 3D6FB 2CAJA 2QV6A 3E2EA 1CG2A 3AB2B 2HNYA 2HHUA 3NGRA 4NYPA 1FDDA 3JTOA 2HG4A 7FD1A 1D9FA 4L3NA 3CD0A 2A3JA 3MCNA 4ZJLA 2MQPA 3BQ0A 5M2PA 2OPQA 3W7BA 4K4TA 1FXDA 4G1IA 3BKFA 4ECSA 3H2UB 4NASA 5J2PB 4HHHA 3ZZZA 4URGA 2NUUG 4K50A 4DBQA 3H5UA 3MAAB 3CDWA 1JLCA 2D3ZA 3A8IA 3UCGA 1JJ4A 2BM1A 4ZKAA 4LF1A 3H42A 4Y6IA 3UN5A 1TL3B 4FBTA 2HIQA 4DV7J 2F65A 3BGFA 3T19A 2Y8WA 2HQDA 3EXYA 3I5AA 4NLYA 3OVAA 1F3FA 4X65J 5DM7Q 2WVFA 1JLAB 3PX6A 5DQHA 3MM7B 5LJ5Y 1OIAA 4DU7A 3FCVA 2UXCJ 4KAIA 4DV6J 1TK5A 1WOPA 3OR1B 4DR4F 2P9GA 4ZPAA 2IJFA 2G13A 2W25A 3TZWA 2WSCC 1URNA 1IR0A 1HNVB 3O2IA 5ETPA 3M8ZA 2F63A 3PW4A 3ADAC 4RL1A 2FB0A 5CD4A 2W1BA 4FPIA 3PJWA 2HFZA 2NREA 2ASDA 3HVWA 5HLFA 1UVIA 4QIVA 2MJNA 4NCBA 5EX0A 2LLZA 1OSDA 3IBWA 4N7TA 4YB1P 1NSQA 2VONA 1IQTA 3M7VA 2XLJA 2BMBA 3MM5B 2M3DA 1T9YA 4GO7X 3KDNA 3VWSA 2GVDB 3CVKA 2HVIA 5SUHA 1RADB 3G4SS 3KNGA 2NCKL 2W2QP 4KKOB 2J7KA 4DQSA 1ZH5A 4Q2MA 1HNIB 4NLWA 4PXEA 2W7OA 1Q8KA 1SH3A 2E5HA 4A8OA 3NNCA 1YJWS 4LSLA 2ACYA 3MR5A 2OO4A 3TVZA 4AXIA 1FO1A 4FXWA 3Q2SC 1RT5A 2F1FA 3FMWA 4ZLPA 2X1GA 1KFDA 3MEKA 2E5JA 2NYIA 1Q7LB 4B3RF 4RNOA 5DGBA 2MSSA 4ID5A 3GYXB 3MPWA 4F0KA 4RLEA 2GVZA 1X4GA 5BJRA 1Q7YT 1YSJA 2YKAA 2KVQE 3DMJB 2ZNYA 2ZZTA 4IOBA 5DQIA 3MEGA 5L1JA 3M8QA 4DPUA 1YBAA 1JLFA 2H5IB 2BVZA 1CJUA 5KG1A 4A8QA 4RO0A 4MH8A 2B3TB 2V69A 3D5MA 1L3SA 4MTPA 1NDPA 2FY1A 4CLTA 2HQ3A 4EO6A 2BJ9A 2EK1A 4C8NA 3RB3A 1BE4A 1TK0A 3VGVA 4TU7A 1H74A 2EXUA 4CP5A 1T9UA 3SFGA 4RW6A 5IXUA 1BQNA 4LF8F 5DRKA 1FJCA 2M7SA 1OPIA 1RABB 2ZJPQ 3KLFB 3GTYX 2QLJB 1K44A 4IFVA 2CIMA 5L1KA 3TVKA 1KTQA 4DFPA 5DETA 5EX3A 3W5XA 2X1AA 1BQMB 2DR5A 3POTB 3GIKA 2BABA 5KFNA 4CLWA 4IYQA 1VRQC 4DR4J 4F3OA 1F1BB 1KP6A 4ECZA 3H4BA 3EUNA 3J7AN 2DHSA 3KYLA 4DR7J 3W8GA 1QJHA 4AD6A 1ZAWA 5A6WA 2UUBF 1FFWB 1ROFA 3NMAA 2ROEA 4EZ9A 4JP8A 2N4DA 3GPAA 3DNCA 3THTA 1WC0A 1EZZB 1LXJA 4BS2A 4DZDA 3I96A 4OHYA 2GHWA 1P27B 2AYBA 5GMEA 4O4GB 4DS5A 2FYXA 1RACB 2VB6A 2VQFF 3VAGA 3HVAA 3I4PA 4YFUA 3NBPB 5BR8F 4WK3A 2PIIA 3K0JA 1RKIA 3IC1A 4DWIA 2W4PA 3UQSA 3OLAA 5ETTA 3CDUA 3CD7A 3MCSA 3O5TB 4ZLLA 3UO0A 1HW9A 2HMIA 4F4XA 3SSSA 1QUPA 3MMCB 4B3RJ 1NB2A 2CQGA 4ECUA 5HMYA 4CNZA 1VC0A 4Y3CA 4CM0A 1IKXB 3J81Y 1PO6A 4JI2F 3KUEA 4KYZA 2VG7B 2BV3A 3TYTA 3QAUA 1IKYB 1WNEA 1NRKA 2D74B 2W4CA 1HWIA 1U6FA 2WVDA 3HJVA 2KYXA 2FZKB 3JQJA 1S6UA 4QIFA 4G65A 3TZYA 4K0KJ 5GVQA 1U45A 6AT1B 5JVHQ 5HATA 2K7JA 5HAOA 2FHJA 2XTJP 1CULA 2MKIA 2L41A 3C15A 2YWHA 3QLHB 5IT9U 3R6LB 2RJZA 3W60A 4LF8J 4E8UA 2G9OA 3FDSA 4X4NA 1YBTA 2P9EA 3QGPA 1RWOB 2GMHA 4K59A 2GIFA 1UWBA 2DNGA 1WG4A 2VFSA 2QT7A 4DQRA 4R0JA 5EDWA 1HBMB 1WSVA 4TLRA 5IM0A 2Y0SD 1R8BA 1TUVA 3BZQA 2AJ0A 3GQCA 2CRLA 3CWJA 1H98A 3M30B 2CPYA 4FP9A 4NYZA 4OI4A 1MU2A 2G2ZA 1SQEA 2E1RA 2KFNA 2IIHA 4F7VA 1UETA 3BN4A 2H4WB 4DX6A 4AFFA 2DRBA 2DR9A 3CF5Q 5CYJA 3M2UA 3BSOA 3WQPA 3EZOA 2BKNA 1U1RA 2FLLA 2AU0A 2DNHA 3HD2A 3FSIA 5HJXA 5FJ4A 4X4VA 3IFEA 1VBYA 2Z30B 2B8PA 2KDOA 3G82B 4IQMA 4PQAA 3CCZA 2BE2B 1SJ1A 4PWUA 1VJWA 2LXFA 2W2NP 3H5SA 1A6LA 3OSPA 4NLRA 4FYDA 3J7YU 1HWUA 2OPPA 2FVRA 2YQ3A 4PR6A 1S7IA 1LWEB 5C42A 2VQFJ 2Z58B 5J1EB 1DLOB 1CC7A 1YBUA 1RYSA 2KFYA 1Q5VA 4DFJA 3FSXA 2UUTA 3L7PA 4G6VB 1DHMA 1RZMA 5HL7Q 1P1TA 2CDRB 4KPCA 4X2BA 1RQ0A 3FEXB 3Q89A 2H65B 3JSMA 4QWBA 4DOZA 3KHRA 1X4DA 4WKYA 4OYAA 1JLAA 3PYEA 4KGMA 3W1YC 2DD8S 2MY7A 3MFHA 4XK8C 4LR8A 4JI2J 1UW9A 4OZ0A 4IKAA 2DT9A 2P5VA 2XY7A 1LEOA 3GIIA 1N5SA 4LRDA 1KHWA 2AGPA 1FA0A 2YNFB 3GMGA 3CCTA 1PC4A 1AZSB 3QRQA 2YNHB 3BM7A 1RT4B 1FRIA 3MEDA 1T7PA 4Y2MA 3FQKA 3RJMB 3O1LA 1WF1A 2MTLA 3HT0A 3R5DA 1OY6A 3CCJS 2RRNA 1S1WA 1RU1A 2KJWA 2Z2MA 5GAGU 2R7SA 1NKCA 2DGUA 2B56A 4QIWD 3IM9A 3FCHA 3G96A 3C66A 3EJMA 5IQ6A 3IRXB 2RUGA 2HGLA 4HHUA 3HT3A 3TUJC 2V34A 5K9FA 3WHIA 3J81U 3W8PA 4M5IA 4N5SA 4PQUA 3KFWX 4J9VA 1UKUA 4IH7A 3PJXA 3MM9A 1UWAA 2MZJA 1G6BA 2G0IA 4DN9A 2HZAA 1Q53A 2RQCA 1V6HA 4P9SA 1U2CA 4WJBA 1WDDA 1QM9A 4OYMA 4QR0A 2E1MC 3GG1A 4UW2A 2JEGA 5LT5A 1GFWB 5KFTA 3FEYB 3EWGA 2WZ1A 2WB1D 3HKWA 2NR0A 4NMLA 2XY6A 1RAHB 2CQ2A 3F73A 4ZS6A 1SH0A 2LU2A 3GJRB 7FDRA 1WWHA 3BKUA 2XWXA 1DTQB 1FD2A 2HW3A 4WFBQ 1Q95G 4OHVA 3UVJB 2XS2A 1TKTB 2IHR1 2ZC4A 3UDCA 3A12A 2N3OA 4G1QB 1PG5B 3HVRA 1VGYA 3NOGA 3D0GE 1F6TA 2YX4A 2O1PA 1C2PA 4HT7A 3OJUA 2XMMA 3N6LA 3FQLA 5A2QY 4F4ZA 2XYPB 4LFAF 5GAEU 1R0AB 3OUYA 1FWKA 5E5NA 2GJ2A 5MLCV 3S7RA 3KNAA 3L3CA 4CLUA 1TKDA 1NEEA 3CJKB 4Q2LA 3B4DA 2ATCB 1ZM4A 1NK9A 1MWZA 1M5HA 2XULA 1HBOB 1NJIT 3PG9A 5L46A 1D09B 3LALA 2BE7D 4KHRA 4QPTA 3WC0A 4ETZA 3FZ2A 3G6VA 4DF8A 3TRGA 2VIHA 5M2UA 4HTIA 4WIIA 2KRBA 2DNQA 2YWEA 4A8WA 4I2QB 4I6WA 3G6ES 2CPJA 5IWAF 2R2RA 1VS3A 2H51B 2PD1A 2LFVA 4ZOSA 1U1PA 2C28A 4J9SA 3SMZA 4CI0B 4PWDB 1VRTA 1Q4RA 3HDSA 4OLOA 3TJ9A 5H9EK 3O8WA 2CNNB 3IS9B 4I7FB 4C97A 1S6PA 3NBPA 4LF6F 2C3MA 3KJVB 2JWNA 1NUEA 2ALZA 2XMAA 2W24A 2D3O1 1JNRB 2QMXA 2WW8A 2LVWA 3KLGA 1FE4A 3KK1A 2MHEA 2NXNA 2CJAA 1NJXA 2MKYA 2RDIA 2JEJA 2PFDA 5KT2A 3R6GB 3HSZA 3PTWA 3V4IA 4LMZA 1WC6A 4IFYA 4DV5F 4OI3A 2W2OP 3RG6A 3QATA 1RTDB 2Y1JA 4U7UD 2YXLA 1SB6A 1DRZA 2JLGA 1IVZA 2AJFE 4C8ZA 4YMEA 4ELUA 2D9OA 2UV8G 2QIFA 1B3TA 2XMTA 1RAFB 2IJNA 4QWCA 3E51A 4NCAA 1WC1A 3LAMA 5AJ3F 3TQEA 4JBCA 4P2SA 2ZEJA 3DU6A 2G2OA 4A48A 3DYAB 4ZITA 1U0HA 5JJBA 1FT8A 2VU5A 4U95A 1Q1KA 1RWMB 5EN1A 4NLQA 2GJIA 1IR1A 4USKA 3DOKA 2FVQA 4B3OA 1YIJS 1S4EA 3KJQB 3DGVA 4CT8A 3UCUP 1TL7A 2BBEA 3R5JB 4JI5F 3D6TB 1CQMA 3ELHA 2DIVA 4DHVA 4LFAJ 4LRCA 1E6VB 2WVCA 1VISA 1HBMA 4F3MA 4TY8A 1W7WA 3EGZA 2QX0A 3N5FA 3TWZA 2LECA 2JLFA 1IM4A 4J91A 1BXNA 1R6YA 1LW2A 4P73A 4CO1A 1JMTA 1N5YB 2XY5A 3KLIB 5KFCA 4NEZA 1JLQB 2OPRB 3ZC4A 2HVEA 2ZE2B 1GNKA 2I9SA 5K8NA 1KLNA 3TR5A 2DO0A 2BUNA 4ITSA 4IO1A 1HA1A 4AYBD 5GAHI 1KOOA 4ATNA 2IM3A 2J9EA 1U6BA 4A47A 3MMAB 2CJQA 3D54A 4ZHRB 5HI7A 5F8MA 1JLBA 1XTZA 1QAIA 3GFYA 1IBMF 1FKPA 4DQQA 1IKWA 4ED1A 1M0SA 4ZPDA 1MMDA 4LF6J 1TL1B 1APSA 1N5TA 5ETNA 4NCGB 3DLKB 5CYQA 4DUTA 2ZZMA 1KTVA 3IO1A 3NNHA 2QA1A 1M90T 3PW7A 4DMZA 1FWLA 4ZPCA 2ZC3A 5E7OB 2GIRA 1VIXA 2XHCA 3PIPQ 2L08A 1H38A 5A8RA 3J80U 2Z8QA 3NS7B 3K5MA 4D3HA 2HHSA 2VPYB 2Q6CA 4F4AA 1B7YB 2FC9A 3Q8VA 5A8KB 3CMQA 2Y9HA 4KO0B 4GRSA 4OI0A 4CLPA 4ECTA 2VKZG 1URRA 4QR1A 5FLXU 1KVKA 5KFEA 4I4BA 1M5VC 4C0HA 3M6VA 1WHXA 3QT7A 1U1MA 5ETMA 5ADZA 5DDRC 4DL2A 1H2UX 2GJFA 1R0CB 2IM0A 2FJVA 1V3RA 2UVVA 4I6AA 3OLBA 2M2BA 1FK9A 4K2XA 3I4HX 4U7UK 2GZOA 4QZVB 2FPHX 5HVHA 3R7SB 3Q2TC 1LW0B 4OHZA 1S72S 1FX2A 4TN2A 1Y11A 1RGVA 4PKDB 2OSRA 1F5CA 3DI6A 1XWLA 4O44B 3HHLC 1YRXA 1V5IB 4YR3A 3K7RA 3R5AA 4ZP6A 2V9WA 2ROPA 1FKOA 4OI2A 4QYRA 3CCVS 2R8GA 2W2MP 1U49A 3UNYA 3LTOA 4DSIA 3UDLA 2AEMA 1JLGB 2V68A 1S1UB 5KFXA 2MSTA 5A6PA 5B0BA 3OR2A 2RT3A 2JJ4D 2R7RA 5IOLA 2G0JA 3I9ZA 3PYGA 3QFHA 3VVUA 1MWYA 2PDAA 3R5BA 2FTRA 2OUGA 3DLHA 2U2FA 4IDKA 2LEAA 3JAMU 1C4CA 4L75A 2FC8A 2HNDB 3H7HB 2ILYA 1FXLA 1Y5IB 1GMVA 4OYIA 3PZPA 2IMOA 1TP7A 1OO0B 3BGRB 3ETOA 3FMBA 3PO4A 3TJAA 3G8QA 4M5JA 4URQU 2FVSA 3PO5A 4FNIA 2J7WA 3H5YA 4CH1A 4NEYA 1TV6B 4RW9B 3UD5A 2YQ1A 2ZFHA 1YRTA 4L74A 3D1OA 5J2NB 2BE9B 3GR0A 4J9OA 4B02A 2K7KA 4M5KA 4DFMA 1MN9A 2H9ZA 1FDBA 3RB0A 2Y0BB 2FJXA 1F2GA 2JEIA 1F5AA 3AJDA 5D6GA 3NKYA 4M5DA 3K8WA 3SCJE 2QFJA 1DURA 3OTDA 1S77D 1NZAA 1T95A 1IKVA 1NJYA 2WCXA 4C9DA 4MIBA 3LOUA 3L7OA 1S0VA 1K73T 4TYAA 4NA2A 4CCHA 2YKNA 1HNXF 2DNYA 4EI2A 4I2QA 3FRYA 1J2VA 1H6KX 2CVIA 5IT4A 1RTHA 3JTNA 4X4QA 2FZCB 2C3UA 3EGNA 4PYDA 3OTOF 1N32F 2X3GA 2KXFA 3JYTA 3H40A 2DO4A 1FFSB 3KK3B 2BQRA 4F36A 5BXIA 1JXVA 2FLNA 1UVNA 1YKWA 1U2FA 2W9BA 4QPXA 1YJRA 5KFUA 1NH8A 1PAEX 4ED6A 3TANA 5A0YB 2CQCA 2E9TA 3BSNA 1T9WA 2EC0A 1IR2A 4JV2A 4F4KA 2Y1LB 1GTEA 4X4OA 1U02A 2MZ1A 3Q24A 2MKHA 2KYZA 2MQOA 4R25A 2ZHOA 4EGLA 1VC6A 1VJQA 3W5YA 1RWXB 3IR6B 1Y3KA 3QPIA 1GMWA 1IWAA 2IMWP 4DI6A 4J90A 4ZVEA 1REVB 4DUZF 2B9YA 1V9OA 2GS8A 2K1RA 2ILZA 3CPWR 2CQBA 5IV4A 2RHQB 2ZH7A 1RISA 2E5GA 4DQIA 4D3GA 1YG0A 2RQKA 1ZPWX 1R6VA 1UVLA 3RTVA 1RWKB 4C8OA 1HQUA 4USIA 4C8KA 3ISNC 1RWPB 3I0RB 1VC5A 3QQCD 1X0PA 2ZH1A 1QDUB 1RAJA 3BB5A 1F3VA 1QAXA 2MMYA 2ZUAA 3PRBA 2KRRA 3BH6B 2VFRA 1E6VA 4O3RA 3V6DB 2HYIB 1F9FA 5G0RB 1TKXB 3ITHA 4EO8A 2BANB 3BSAA 2C3YA 2QO3A 3HHEA 2DEIA 1S48A 2IJRA 1YHQS 1PBUA 1OQ6A 1WHYA 3QRRA 1RT3B 5C7PA 2YY3A 3GIRA 4BDPA 2OFHX 2Y3YA 3KLIA 2DGOA 4HLBA 2MQNA 1FXRA 2YNGB 3FNNA 3NLCA 2QN6B 4XIUA 3EVOA 3AQOA 1N33F 3T1HF 4R8UA 1TL4A 1HNXJ 4C11A 4OI6A 3ZZUA 1NZ8A 4F0MA 3MMAA 3H0PA 3HHKA 1C0TA 1N32J 3HSJA 2A18A 4Q45A 4JV0A 1UVKA 2Q43A 2B5JA 2MQLA 1RHQB 4DL4A 1RK8A 1RT1A 3NWRA 1N52B 1FRLA 4DL6A 1AFJA 1YWXA 4FZVA 4RUAA 3EPIA 4TLQA 1QSSA 3CC4S 4LF9J 1Y9OA 3R1HA 2B43A 4KSEB 4ECQA 1FNOA 4I69A 2VOPA 4DEZA 4DX8H 4JOUA 2EC2A 4HT5A 2XMUA 3M8RA 3MWBA 4NLSA 1JLEA 3HZGA 1RBOB 1FDNA 3M8PB 1LXNA 1VQKS 4J9LA 2U1AA 4KV8B 5KFRA 2BEFA 2B0GA 1FFGB 4DUZJ 3CT9A 3ZZRA 2I0XA 2EW9A 4K7QA 3C16A 4OX6A 3B8HA 2BJDA 3FVYA 3M8SA 4CH7A 3TJ8A 5E3RA 1VQ7S 3C14A 1X7VA 4R5PA 3AT1B 4DCPB 3P5BP 1UA0A 3NOCA 5FDLA 2BJ7A 3G6YA 1ZPVA 1VLOA 3CC7S 2RH3A 3FGVA 2JHEA 1XMOF 5CYMB 1LW0A 5C25A 1S7HA 2HK2A 2N7CA 1I3OB 2N3LA 4F3QA 2XZWA 4WP9A 2VICA 5L38A 3K5PA 4L72B 1ULRA 1VLYA 4ZIWA 4PPDA 1P9QC 3GCXP 2DRDA 2VPZB 3EZ5A 2NPIA 2E9ZA 1SPBP 2LDIA 3MCOA 3P96A 3R1LA 3W9IA 1IBCB 1Q8IA 1UVMA 1TVRB 2AJQA 1S6QA 1REGX 2FGOA 5CCMA 2YWWA 5HBMA 5AXNA 1DFDA 2LQJA 4N41A 2PGCA 4Q7AA 4MYUA 4WKRA 3LH2S 1KFSA 2B4PA 2OMLA 1N33J 3T1HJ 1QVFR 4DXLA 2LQ5A 3DRRA 4USUA 2DGXA 1HI1A 3RRHA 2KM8C 1HNZF 2OMOA 3FBFA 2I8EA 3VVTA 4M94A 4EWTA 1Y3JA 2E5IA 2F4VF 3CEDA 1VQOS 2HNDA 4ZA1A 1VRUB 5D15A 3R5GA 2C42A 5LSRA 2BX6A 3OL6A 1WJ9A 3KLEB 1U4BA 3M9MB 1O5JA 4LF5F 2ZHBA 4GVLA 4PXBA 1PILA 1MROA 2J0XA 3CJRA 3FCWA 4RU2A 2EFNA 2QRRA 1YZ7A 5CCLA 4CLYA 2GHVC 5LL6d 2I5JB 5E41A 3ZZ0A 4PZVA 1CBKA 4NMXA 5JUMA 5ETKA 4QU7A 3NGSA 1WG5A 1XR7A 1VIOA 1KONA 2VG6A 2WVEA 1G7CB 1Y7PA 2RF2B 4CM2A 1FNMA 2AIRB 2ALYB 2VBZA 1L3TA 5I3UB 4O0IA 1JX4A 4URSA 2R7VA 2XYGB 2VHGA 3NAHA 1QE1A 3N28A 3D68A 3DOLB 5D77A 4PEOA 2D1CA 1AYEA 1FHTA 1T02A 2CPFA 1NDCA 3HVTA 2UVWA 2VFUA 3QIPB 1FVQA 2IC3A 2EEYA 5DLFA 4RW8A 4P2MA 3QWUA 7AT1B 4B9UA 2DK2A 4DPTA 4EBCA 1VR6A 2H4YB 3CTRA 4Q0BA 3S8SA 2E5LF 2WBMA 4X66J 3EZUA 3SQGA 1XMOJ 1SC3B 2GV1A 2DCLA 1HFEL 3KKFA 5KFFA 4JI3F 1YITS 1NDKA 1KC8T 2HNYB 3OJSA 4F2RA 4YDXA 3TX8A 3EM1A 1J5EF 1RT7A 2GQ2A 3VGTA 1I51B 1X4HA 1RAEB 2OPQB 2GC8A 3UN3A 4ZVGA 4C3KA 4CLSA 1FI4A 4WF9Q 2LQBA 3CJ4A 2IM2A 4DPWA 2BKOA 1JLCB 4JI1J 4TY9A 3WIVA 2CQIA 5KFHA 4KB7A 2OHDA 4V19J 4MIWA 2B8QA 2PA8D 1MMNA 2HBYB 1JXEA 1RTJB 4BHQA 5KT6A 2RU3A 5AE3A 3H2LA 2RRAA 1VQNS 1YX2A 2IYGA 1SKUB 5LSLA 4H4OA 1M1GA 4CTAA 2V6AA 1S10A 2VD3A 2F4VJ 3HFZB 5IFMA 2V0NA 1F0XA 3AB4B 4P72A 2J9CA 4F50A 3PEJA 3ILLA 4L3KA 2DH9A 3CB4A 4JUZA 4RBUA 3X1LB 3HJFA 1DJ0A 2DXFA 1RHRB 2DKOB 3F0NA 1AB8A 3BJYA 1NJZA 1FRHA 1VFJA 3DLEA 2HRUA 2KHDA 4LF5J 3PX0A 4HL9A 5KG7A 2FD2A 4MIAA 1SUQA 2W7PA 2QYGA 4ZCMA 3I0RA 5LSOA 3NMRA 1S9GB 2E7XA 4XDDA 3MZIA 1QVGR 2QMUB 1VQ9S 1ZA2B 5D8HB 3HFVA 1DQ9A 1V3ZA 4ECWA 3GU0A 3OVBA 4M5NA 5HLFB 1H2TZ 4DL3A 2VFVA 1EB0A 1QUVA 3V6DA 3IG1A 3VGUA 4OJGA 1Q16B 3FFIB 4DSJA 4LBIA 1UMJA 1LWCA 3SCLE 1RHMB 1XMQJ 1BY9A 6FD1A 4OYOA 2J0SD 1G1XA 1RT3A 4I0WA 2Z0GA 4ERDA 3T41A 3SFUA 1I1GA 4YN3B 2HLTA 2QA4G 1UP1A 4QWDA 3VAHA 3W66A 3QSIA 4LSLB 1L3KA 1S97A 2CQ1A 4PPZA 3MUVP 4LREA 2V2KA 2GGPA 1RT5B 3PVXA 4WCEQ 2R4FA 2YPYA 2DNZA 3M6UA 3LQVA 2GIQA 2DRAA 3MXHP 2RNEA 4DX7A 2WOMB 2QMWA 4ID5B 2GMJA 2JDJA 2E5LJ 4WFXA 5B09A 2GVZB 3G71S 3NXZA 3PCOB 1UZDA 1KQKA 5KFAA 4NZ0A 1AUSL 4LRAA 5KFKA 4JI3J 2YTCA 2V2VA 2CKWA 3MEGB 2GFFA 2QA2A 2XO7A 1XERA 2CQDA 1CJUB 1WUUA 4Q5VA 1MN7A 4A8MP 4DQPA 2CPDA 5KFWA 5GAGI 2BJEA 3IWLA 4RU9A 2YKQA 4DR2F 2FLOA 2FGCA 3DLGA 1Q81T 5J2MA 3T5KA 1L3UA 4RW6B 3Q83A 1BQNB 2ZH2A 1EHWA 1QLNA 4HDHA 5CD4H 4ZIVA 3BYRA 3SV4A 1ZAVA 4IFVB 5IZHA 2DIUA 5KTQA 5AT1B 1C4AA 3HHDA 4B9SA 2QLFB 4OI1A 3A4TA 3ONQA 5D3GA 3IWNC 1TUGB 5F9LA 1R31A 2DNOA 1PJ5A 1D8YA 2HURA 5ITHA 2WBRA 1IBLF 2O5DA 3D3CJ 2CNOB 4NXMJ 1R8CA 5CXTA 3EX7B 3QMQA 2P8IA 2AGOA 2ZKUA 3VAFA 1PIEA 4FVMA 3QGHA 4KH0B 1FRKA 3I9V9 5HP1A 4I56A 2PE8A 4QYZJ 1LKZA 2EI5A 4C4WA 2L9NA 4OLPA 3OSNA 3EE3A 3HI9A 4LF4F 3U1LA 3KUHA 2HIYA 2E44A 5B0FA 3TAMA 3W9JA 4J9QA 3Q23A 4B3TJ 1N5QA 4UUWA 2ZUGA 1YTYA 2MXYA 5HROA 3ZNJ1 4YR2A 3SI8A 5LXRA 1F2HA 4Y2KA 2QJ3A 3GFXA 1RT6B 1CVJA 2XS5A 4DN0A 4DS4A 3RRKA 3DRSB 2CPZA 4IR1A 1O8BA 2SXLA 2NS1B 1ZS6A 4EBEA 1VQ5S 3DXSX 1VQLS 4CLKA 4YHHJ 2HMIB 3RYLA 5IV3A 3FBEA 4W4MA 2BXJA 2VDIA 3HM9A 2CNLB 3DXBA 3AJ2A 4EEYA 2OP5A 4ILRA 2F8HA 1GQEA 4RW7A 2IRXA 3P8BB 2V8HA 2XLIA 1Z2LA 3ZZPA 4CO4A 3CCWA 3CO0P 3AXMA 1WKKA 3IMQJ 3RW6A 2LQ9A 4HKQA 4MAKA 3BR9A 8ATCB 5F8JA 2MEWA 4YB5A 2IVYA 1X4EA 2WONA 4DR2J 5HANA 1QTMA 2BACA 3C15B 4C8MA 4Y2AA 3T1AA 3OFEA 1N54B 4NLOA 2HS4A 1Q78A 1SVDA 1RTIB 1FDAA 3M6WA 1SBRA 4RZRA 1LQ9A 4JB8B 4PRFA 3HX9A 2OD4A 2X3DA 1KN6A 4KBIA 5JXSA 1Z4UA 5IM0B 1OJ4A 1FWPA 2ABYA 2DISA 2HHWA 2DBBA 4OMFG 2CPEA 2VG5B 4JV5F 1IBLJ 2KXHA 4FYVB 3HXMA 2B9XA 3I32A 3RBDA 4MK8A 1MU2B 3RAXA 1BC6A 3KXDA 2B6AA 1GXLA 3HFKA 4Z37A 2J6TA 2UXDJ 3NS5A 3M2UB 1SJRA 2DHGA 4M5HA 3M1VA 5KT4A 1NKBA 5GMDA 3TP2A 2L9DA 2A2DA 1HYSA 4IH6A 5K8MA 2CPXA 3E01B 2BOPA 2ZJRQ 2FVPA 3W2VB 4CLLA 2W8KA 1YJTA 5KFQA 2L3MA 2FHMA 2XQCA 3LWMA 4LF4J 3SCIE 3ZZOA 4BLGA 4ZK7M 1VBKA 4UZCA 4I2PB 4LSNB 2KFZA 2FJAB 4X4PA 4WZMA 2OPPB 4YB7A 5F8LA 2YKMA 5C42B 1R0BG 4WXOA 4NOHA 2VFTA 3QGIA 4V1Ak 3ICLA 3NGKA 1AW0A 3KWMA 1X31C 1DAXA 3EDQB 2RDJA 2QA4S 5JVGQ 4YUDA 3JSMB 1RTJA 3C8YA 3HHLA 3K17A 1VDHA 2J9DE 3THVA 1R8PA 4ZP7A 2A0FB 3TX0A 4OJ3A 5KG6A 2HHQA 5E3AA 3A3PB 4W98A 1ZZFA 1NXIA 1SQFA 4ZP8A 4C7QA 5C24B 3ZTOA 2DB1A 3EICA 4OHWA 2UP1A 2LXUA 1S9GA 3TA0A 3UI3A 3MEDB 2M88A 4K2JA 4DR7F 4YP3A 1WI8A 1VMBA 4U96A 2IA6A 4NXNF 2YVSA 3MDFA 1FERA 4WBFA 1TELA 1S1WB 2KM8B 3SBMA 3ZO7A 4NZ7A 1T94A 3OTBA 1D1UA 4OYBA 3TQ1A 2UVUA 3FFIA 5AXLA 3CD5A 3R2CJ 2HHHJ 5C2GA 3T9ZA 2M8DB 2YKPA 2MLZA 4AQYF 4OV1A 2RS2A 1NH7A 2HLUA 4M5MA 1D9AA 2E1PA 4ED3A 2QG9B 2BRKA 2ZH4A 1HMVA 3LA0A 4PG7A 5D0EA 4WIQA 4K8RA 3ETMA 3TUZC 2C2NA 1GX5A 4PQUB 2GO8A 1U26A 1PJ7A 2HHVA 4P10A 4JV5J 3MM9B 4OZJA 4LVOP 3QIDA 1U6ZA 1VQSA 3ILIA 1AXQA 2UU9F 9ATCB 2HVHA 2PO4A 2WOMA 2AZ3A 1KLMA 3MPVA 5B0GA 2R2TA 4K5SA 2B9WA 3D66A 2KT5A 2ZJQQ 2XB2D 4ETXA 3M8WA 2RQ4A 3DM2A 5B0AA 3DGPB 3IP0A 2HBRB 4KPYA 4UUXA 2J8SA 2RKIB 3FJ2A 1SI9A 2J0WA 2MZRA 1NBEB 4HACA 4M5LA 2KXNB 3MR7A 4K0KF 2W9CA 2VQEF 3LPEA 4LFCF 3R5CA 2BW7A 2IRUA 4DL7A 2EKNA 2LEPA 3ZNUA 3BPDA 2R2SA 4O23A 2EFGA 5EHHA 2ZD1A 1NK0A 1JJ2R 1OS5A 1R89A 3KDOA 1P1LA 3MM6A 2JH3A 3KJFB 2MZTA 1JXLA 2FJBB 2ZWPA 2KZMA 2ZWOA 2CDQA 1PYOB 3IRWP 2Q6BA 4FS1A 2R8HA 4BC9A 3U1NA 1S9EB 2CUYA 3OUYB 1KS2A 1U1OA 1DY3A 4I67A 2XWYA 1Q79A 3D0HE 3W62A 2I2YA 3CW2C 2OEJA 2HPUA 1RLCL 2OPSA 2IY5B 1WORA 3NY0A 4Y2CA 3CDAA 4OX9J 1WC4A 2YX7A 3KG4A 1CS4A 5D78A 2HHTA 4DLEA 3OW2R 4M1KA 2CXEA 1NSKL 3RZAA 4RUBA 4NXNJ 3OHAA 3AD8C 5J2QB 3WDOA 2PT0A 1TL5A 1RAAB 1QY7A 3GFHA 2MGZA 1BMQB 1HARA 3K59A 4WWSA 3QSYB 5KAKA 1VRTB 2RHSB 4AQYJ 3PHEA 1RWNB 1YK9A 3P45B 1K0VA 1RT6A 5KG5A 1S6PB 2QYCA 4KQZA 5DZ7A 3TOQA 3U27A 4HR2A 3G6XA 3DRSA 4ANEA 4IOAQ 3TEHB 1VQ8S 4DV0J 2HHPA 5HSPA 4NE9C 3KLGB 2Z56B 3KK1B 1QD1A 1RWVB 2QSWA 3TAQA 4C2MA 5HO4A 3G87A 4KE5A 2EK6A 4XAKA 2UU9J 3GONA 3V4IB 1KVJA 4C6AA 3DN9A 5F0WA 4UT4A 4IFYB 4W90B 4JYAF 2ASLA 5T41A 3W2WA 4TU8A 3OD2A 4Z7CA 1K9MT 1GH8A 4ELVA 3VCDA 4BWMA 3AFGA 2FLPA 4OZ3A 3UN2A 4HH1A 4J9MA 2OI2A 4WTOB 1H3DA 2V4RA 1SV5A 2MPUA 2ADBA 1RHUB 2VQEJ 5H9FK 2VPWB 4LFCJ 3KK2A 3MOJB 1U0HB 1TZ0A 4RX6A 2XI2A 3CJTA 5B0CA 4NA3A 1H7XA 4C48A 1YJNS 2XSFA 3G86A 3MURP 4ZVSB 3DOKB 1RTIA 4B3OB 4G1PA 4PABA 2EBEA 5KOXA 2F5GA 2MKSA 1VOMA 1TL7B 1LFWA 3TNVA 3OTEA 1H0HB 2CADA 1Q82T 4ES3A 4GKJF 2R7XA 2HNZB 4FKXA 1X0FA 2DPJA 1ZA1B 2DGQA 3IGNA 2VV5A 2MY8A 4IR9A 1DQ8A 4TY8B 3OXFA 1B0PA 3QJJA 3C6UA 1FTCA 1FKAF 2DY1A 3LUYA 2D7SA 2VG5A 3UDEA 4YR0A 3JXOA 3SZ2A 3DU5A 1H7WA 4KIAA 1LW2B 3LP1A 2XSJA 1K1SA 3H90A 3CCRS 3WIUA 1B7FA 3MM8A 5CAAA 3RRGA 2I1RA 4MKYA 3R97A 2CQHA 3E01A 2C2OB 3TAPA 1DQAA 2XEXA 2C2ZB 5DG7A 3CIZA 3W2VA 5KFLA 3IGVA 3M9NB 2HFSA 1XIQA 2R2UA 1KKHA 4I2PA 4LSNA 2ZH9A 1JLBB 1EQ0A 3TO8A 4CDIA 3K8VA 3EYZA 1FKPB 1IKWB 4M63A 1X8DA 2VJUA 1TKZA 1HIYA 4IQXA 3MEEB 2PI4A 4GC7A 4JI8F 2OEMA 5CH7B 5CYQB 5T14A 2Q3PA 2BJ3A 2PA3A 2RAQA 2J8AA 5DGAA 1Q0NA 1NPPA 4LR7A 2XZTB 4CLZA 2HS0A 1U25A 4F8RA 5K20B 4JYAJ 4F25A 3CE8A 1HNWF 3LANA 5A8RB 3CNQP 4DCOB 3CGIA 2UV8A 1SQGA 4ECVA 4XDCA 4A8SA 3EXCX 2K3KA 5ETSA 2EFPA 5KG4A 4YDDB 3GP9A 1R43A 5C24A 1C0UA 5DS7A 3BEGB 1CJKA 2DXEA 3V2UC 1S1TA 4DDFA 4KFBA 3T6JA 3CC2S 1SJ3P 1O51A 2PFFB 2OD6A 1TMMA 3MD1A 2BJ8A 3AHPA 1WC3A 2EG1A 4AE5A 3HZEA 1S0NA 1WEZA 3UCZP 5IC6B 1OY9A 5I3PA 1HWKA 4DR5J 1UW4A 1FK9B 4IO9Q 2G1DA 1FJEB 4LVNP 3M8YA 2GCFA 4ZCLA 2MZSA 3K5LA 3HMJG 2FHJD 2V2ZA 4GKJJ 4TQSA 3QAEA 1UFLA 4PG4A 3DI6B 3TW0A 2YKOA 3KHHA 3D67A 5F3ZA 4ICLA 1FKOB 2J6SA 4F26A 3LO3A 3GZ7A 3BREA 2X1BA 8AT1B 1C1BA 3HPOA 2QC3A 1O6XA 1Y5NB 4XTTA 3JSBA 3BYPA 2KKHA 1L5UA 2FY8A 4CO5A 1UEUA 2OGUA 3OR2B 3DGPA 3GWCA 2RD5C 4LQ9A 2RKIA 1SC6A 1VBXA 4CO0A 2WHOA 3GV5B 3PM9A 4YEAA 1N6QA 4ZVFA 4IDKB 4CYUA 3QJPA 1XNRF 2KG0A 1FJGJ 1SKSA 1JKHB 2KHCA 4C0OC 4OIXA 3KTQA 2UVRA 5JMNA 4JI8J 2IAJB 1XNQJ 4MK7A 3AQPA 1GXUA 1TUWA 2BA9A 4RNFA 3Q8QB 4DV4F 1NMEB 1KNZA 4HHJA 2ADCA 5THWA 2HS3A 2KJVA 5AE2A 4A8XA 3T3FA 4J7CA 2DEJA 4A46A 1S9EA 1N34J 1HNWJ 2IBKA 3TEGA 2O3DA 1U8SA 1GMUA 1FESA 3A8KA 2OELA 3VAMA 4B17A 1RLDA 5CQGA 3N6NA 4M5DB 2DHAA 1IKVB 2D3UA 4LRFA 2VC0A 2HVDA 1XR6A 2I6WA 3WC2A 4AXJA 3UWTA 1E6YA 2DITA 3O3LA 2KVIA 5DJBA 2YKNB 2V8DA 1N48A 2FJEB 2CPHA 5J2QA 2E7VA 3VZHA 3AXKA 5KFIA 2NXCA 1RTHB 2XNQA 4GVBA 5ETVA 5KFZA 3BKTA 2JC1A 5GADI 3MR3A 3JYTB 1AUDA 5B0DA 3C3LA 4FF3A 4Q8EA 2XS7A 3SEOA 2W9BB 2RIJA 4ZVRB 4FNHA 2HQGA 3MECA 1U47A 3F41A 2AT1B 2MQ8A 1SCJB 2UXBJ 2AF6A 2C2KB 4OL8A 4J9PA 3DKDA 3ZTSA 1N4LA 3MMBA 3HP6A 3L4BC 1SJQA 2VBYA 1VQ4S 4JI6F 4GKKF 5C5JA 4ZPTR 1EP4B 1N0VC 4QBUA 4KR0B 4DSLA 4U8YA 1KOHA 3A8JA 2DH8A 2AEFA 2VBWA 4BCAA 1NHKL 1EKRA 3VTIA 2OLWA 1C1CB 3AJ1A 3U7JA 2KZZA 1HR0F 2E1AA 2K1RB 2DNNA 3PYDA 3OL8A 4WFNQ 2JOQA 3FZBA 2R8IA 1XNRJ 3F56A 1FRJA 2BQ3A 1UL3A 1S57A 1KQFB 1RB0A 2V8GA 2V8VA 3SXLA 3UNGC 2JVOA 3Q8SB 3A3NB 1HQUB 1S99A 1AFIA 5CA5A 1TFWA 4DV4J 5HMWA 3CJQA 1T0TV 1ZTWA 1XK8A 3OQ2A 4B3SJ 8RUCA 2YNIA 2HNZA 1BQXA 3B78A 2RSQA 1HKAA 2CQ4A 4JI0F 4EUVA 1VQMS 4ZPBA 4ZVPB 2DR8A 1ZM9A 3ITHB 2ZBIA 3JQKA 5G4DA 4QQBA 1M5PC 1FEEA 2DHHA 3JTPA 3CXCR 3G9CA 2QL5B 3MUTP 3AY0A 3PW0A 2N82B 4TYBA 4MKAA 5F8GA 4UOCA 1JK9B 2E7WA 4FYWB 1G2EA 1BWVA 2UUAJ 1IJFB 1N0UA 1VK3A 1LWFA 1MG7A 2LQ8A 3KMQA 2PMZD 1SL2A 2R8JA 5BYQA 1HHSA 5T7LB 1WKJA 2VKRA 4P7TA 2MQMA 4Y00A 4R8UB 2MKKA 3ILJA 4C11B 3G8SA 3BH7B 3Q8PB 1T05B 1RT2B 3PXGa 4RNNA 3GE9A 1C0TB 1HW8A 1FF2A 3D1QA 3MF5A 4MMOA 3H5XA 1PAUB 4RNMA 4KJIA 4ZJQA 3RW7A 5A2QU 2HHXA 2B5JB 3QRPA 3ET6A 3RBXA 1RT1B 5DLGA 4N8OA 2F40A 3I6PA 3MEEA 4ANDA 1V5VA 2ZH3A 2J76E 2ZKTA 3VGSA 2J6UA 4LIRA 1L3VA 2D41A 3MMJA 2AD9A 5AXKA 2IM1A 1PBAA 3TA1A 3MHYA 4JI6J 1X5SA 4PYAA 1WKLA 1SH2A 4GKKJ 2R7OA 4JI7J 3NCPA 3JQMA 2AGQA 4BWJA 4O4RA 5IT9Y 3I0SB 2VOOA 3MD3A 1JLEB 3TI0A 3UDVA 2KTQA 1RAOA 1UAWA 5D4PA 2QE5A 2EFQA 1XQIA 4HYKA 4U67Q 4JI4F 1AROP 2DNMA 1HR0J 1CPZA 4ES1A 4F4WA 3C16B 4OV6A 1M1KT 4I68A 3WZ0A 4WP3A 4LIWA 1HD0A 3AD9C 3C14B 3ENVA 4NL5A 2AEJA 4PG6A 3SDEA 5RUBA 4WFZA 4R5PB 4X4SA 4DSEA 4NLDA 5FDLB 3CCSS 5DDOC 5ETQA 1X60A 3M2RB 1YLXA 3EGVA 2FJDB 3OBIA 1U1QA 3VQTA 3GB0A 1N88A 2QFIA 1XN9A 1HL6A 5C25B 2HRYA 3FKBA 4JI0J 1R7IA 3CUNA 2WVBA 3D4JA 3NWGA 3MI7X 5HMZA 4CO3A 1ZM2A 4Q44A 2AW0A 1YGYA 4NA1A 6FDRA 3S01A 5CZXA 1S6QB 4P6QA 2RVJA 1NK8A 1UPPA 4ZN3A 4WE1A 4QIEA 5HBMB 3NNAA 1S5ZA 1GXTA 3BQ2A 2CWKA 4MJKA 2RDDA 4ED0A 5EGYA 2QLWA 4L76A 4NLTA 4UF4A 4TVAB 3DRRB 1VK8A 5K8OA 4NI2A 3ZZYA 2R7WA 3DRXA 3NRBA 1TTHB 2DNPA 1Y4ZB 5IT0A 2J5AA 1W2BR 1T8EA 4MKBA 4BC7A 2CZ4A 3R27A 1GTHA 3S1TA 3JSYA 3A3OB 2CJYB 5FIIA 1N56A 5I4MA 3Q8RB 2DTJA 2FJWA 2O66A 1JKHA 1S79A 5H9FJ 3PNIA 1Q8BA 3THPA 5F0UA 2IAJA 3CMAS 5BYSA 4A8FA 4ZN1A 1MROB 4F2SA 4ZPVR 3PYFA 4HH0A 1KBRA 3C6TA 4RW4A 2W8LA 3CJ8A 4C3LA 5DDQC 2DH7A 2HQFA 4MFBA 1RA6A 1NHVA 1FD8A 1HQEA 2VG6B 5F9NA 1NCLA 1EETA 3Q8UA 1H2VZ 1J5OA 2XM3A 5EWGA 3I55S 4EYIB 3UR3C 4NX9A 3OFFA 4GO5X 3B6BA 1QE1B 3QNWB 2IA0A 2DJWA 2M4MA 2PEHA 2F4FA 5J1NA 2IYIA 3A13A 5KFGA 5L9NA 2KN4A 4PUOA 4JI4J 2HFVA 1EIYB 1GAOA 3BGOP 5LMNF 1IBKF 2LYVA 3HVTB 4LFBF 4H4MB 1ELOA 2IC3B 3K5OA 3UD3P 4NLUA 5EUHA 4RW8B 2XG8A 3LP2A 5IS2A 3LP0A 1SIZA 4P2FA 1S9FA 5K14B 3EVMA 2GX8A 4ZVUB 4LSZB 1B64A 3BV8A 4IG3A 4Q0BB 1RJJA 4ZLJA 1U48A 1RP5A 1S1XA 2C3PA 4MK9A 3TZXA 3SQGB 4OZ2A 2V4JA 5IC4B 1X4BA 3V6HA 4RNHA 2PC6A 3K89A 3SIPB 2W4DA 3ZTPA 3DLJA 4DR3F 4KY3A 3QT6A 1DTTB 4CH0S 4USJC 1X5TA 3PJ9A 1HBNA 2LMIA 2HQCA 1F9HA 3BO2A 1RT7B 1UEVA 3ZTQA 2CWXA 4LF9F 2ZHAA 4L73A 3HCXA 3BBFA 1D9DA 2ZOGA 4DG1A 1IUJA 2RRBA 2VL1A 2DCUB 4QU6A 3X3UA 1OPZA 4K4WA 3DLBA 4QWEA 3V81A 3BDEA 3T5LA 1FEHA 4AL5A 1EP4A 2ACMA 2HGNA 4ZCIA 1VQ6S 5HN0A 3T1YF 4YQWA 2B7BB 2YWKA 2B4OA 1CJVA 1C1CA 5L39A 4NLVA 1Y5LB 1RUSA 1YJ9S 3M2VB 1S0OA 5AXMA 4PCQA 1A9NB 2XBPA 4H4OB 4CTAB 3WBZA 2XCPA 1GEHA 5E0OA 3QYYA 3GJQB 2HRTA 2CYYA 1RI7A 2UUBJ 4DF4A 3DLEB 3TVYA 2D69A 1B4SA 4NLXA 2D3OR 1SUQB 2HVZA 4J5OA 3KJNB 4KT0C 1NK5A 3QT8A 3UD4P 4FF4A 4WPAA 2NSBA 1SL1A 3VAKA 4WFYA 3IG1B 1PSDA 2FHOB 5BR8J 5H1SV 3ZXWA 5J2PA 1WG1A 1SL0A 1TFYA 3MAAA 3V6JA 1X5OA 1LWCB 3PV8A 3H98A 3GCWP 1WF0A 3N9UC 2YH0A 3OPKA 4B9NA 1TL3A 1HLWA 4E0DA 4ZMMA 2M52A 3FUYA 3C19A 2XYHB 3CJSA 1IN0A 2C22A 2R8KA 3D1HA 1PJ6A 5LMNJ 2Z2ZA 1IBKJ 3JSRA 5L8RC 4ZP9A 4LFBJ 2DGTA 1UEKA 5KFDA 4LF7F 4A8YA 5T7LA 3OL7A 2GGPB 4FN5A 3MM7A 3N5BA 1WC5A 4IH5A 2W2PP 3OR1A 4FXVA 1T05A 5LM7E 3MOZA 2CFXA 4J9UE 4RPFA 4RWXA 1HNVA 1RT2A 2O67A 2VC1A 1YZ6A 5AE1A 2AJ1A 2CG8A 3PRDA 2XNRA 1JB0C 2ZDOA 2IBOA 2K3IA 4RBVA 1AA1B 5KFVA 3KOAA 3R9LA 4DR3J 3HO1A 1UCNA 1R8AA 3N01A 2VODA 2Y1RI 3MM5A 4X4TA 2P6TA 1UFWA 2A6MA 2GVDA 3RBZA 3QZ7A 3OVSA 2JL9A 2LXIA 4KKOA 3R2DJ 1LWXA 3Q22A 2ZBPA 3DLGB 1HNIA 3QZ8A 3NCRA 5J2MB 2B4UA 2DYAA 3EVWA 4USHA 1WEXA 3I0SA 3T1YJ 1NK7A 5DG8A 3NS6A 2ZOMA 4AUKA 2OJ3A 3M32B 2QL7B 2L48A 4I64A 1Z2ZA 4G3IA 1VBZA 5D3GB 2A2CA 4LUBA 1NB7A 1HI0P 1XMBA 4PG5A 1GMWD 5DG9A 2BKPA 3DMJA 3KUGA
chains in the Genus database with same CATH topology
4LFCF 2VPXB 3R5CA 4ZP6A 2YX1A 2F8MA 2V9WA 2ROPA 1X4CA 2PMHA 1FKOA 4OI2A 4HDGA 3ZZTA 2CZVC 2ROGA 4ILLA 5KOWA 2IRUA 4DL7A 1VHFA 2LEPA 1RDRA 3ZFVA 2R2SA 4QYRA 2AJ4A 3M2RA 1LFPA 4O23A 4DV1F 2EFGA 3NAIA 3CCVS 4QW9A 2R8GA 5EHHA 2ZD1A 1ZOTA 1U49A 4X66F 1NK0A 4UQGA 4J9KA 1JJ2R 1OS5A 1KEKA 1S4FA 3CDEA 1X9MA 4DSIA 3UDLA 1R89A 4O3QA 2GNKA 1P1LA 3GSDA 5HP1B 2O01C 1JLGB 2JH3A 3LW5C 1S1UB 3BSCA 3MM6A 2MZTA 5KFXA 4XPCA 1JXLA 2FJBB 2MSTA 5H9EJ 3DFEA 3DDNA 5CHCB 5A6PA 2KZMA 2CDQA 3IRWP 2Q6BA 3OR2A 5B0BA 2HAIA 4FS1A 4FVCA 2R8HA 2RT3A 2JJ4D 4BC9A 3SYZA 2RS8A 4DR1F 3U1NA 3TAMB 1S9EB 5CYMA 3OUYB 1KS2A 2R7RA 2F8EX 3I9ZA 4YY3F 2QLXA 1U1OA 3AA8A 4N56A 1MWYA 2B7CB 2PDAA 3R5BA 5LXYA 3KLFA 4ED8A 4I67A 2FTRA 4DL5A 2XWYA 5HROB 3DLHA 1Q79A 2U2FA 4K4YA 4IDKA 3B4MA 3D0HE 2I2YA 4C0BA 2LEAA 2HPUA 3NCQA 1C4CA 1K0TA 2FC8A 4IRDA 1YJUA 2OPSA 5LJ3Y 2HNDB 3DDKA 2ILYA 4OJHA 3CJ5A 1FXLA 1Y5IB 4Y2CA 3PZPA 1ZYQA 2IMOA 3CDAA 1OQ3A 1TP7A 2CQ0A 2YX7A 4Y34A 3CJ0A 3NP5A 3C6TB 4RW4B 3KG4A 5HQ8A 1OO0B 5D78A 4JI1F 4B3SF 2HHTA 3BGRB 1BQMA 3ETOA 3FMBA 4WK1A 3PO4A 3IAM9 3PR5B 2AYGA 1TVRA 4DLEA 3G8QA 3DHXA 3POTA 1QSLA 4URQU 4K5RA 2XGQA 2FVSA 4MFBB 3OW2R 3PO5A 4FNIA 2J7WA 5F41A 1S0MA 3H5YA 2E1CA 2JFDA 1RWUA 1HQEB 4CH1A 4X4RA 3P3DA 1EETB 4M1KA 3RZAA 1J5OB 3OHAA 1TV6B 4RW9B 1FNXH 2ZFHA 1X9WA 1YRTA 2OKQA 4N76A 2OIHA 3D1OA 5J2NB 5J2QB 2C2EA 4NLPA 4WYLA 3WDOA 3LWLA 2PT0A 2ZH5A 3RU0A 1TL5A 4P7VA 1GX6A 1QY7A 3GR0A 3S6EA 3GFHA 2XC9A 4B02A 4J9OA 4DV7F 2MGZA 1HARA 3J80Y 5KT5A 3K59A 2JFKA 1LK5A 2K7KA 4RW7B 5KAKA 4X65F 3NGDA 4DFMA 4PUOB 1VRTB 2H9ZA 1FDBA 4NZ6A 2DNRA 2UUAF 4Q8FA 3RB0A 2BQUA 4KHMA 2XMWA 3OTCA 1NKEA 3PHEA 3UFCX 4IG0A 3U02A 3CJ3A 2P9CA 1R8HA 1K0VA 1RT6A 2AV5A 4H4KA 3MGJA 1S6PB 3US5A 5KG5A 3RB4A 1DZ5A 2QYCA 4KQZA 1KD1T 3TOQA 4O3OA 1FTRA 3U27A 4Y2IA 2JEIA 5A8WB 3CCES 1F2GA 1F5AA 3V5RA 4CZCA 5J1PA 1VRUA 4OJ1A 5D6GA 2RB7A 3NKYA 3G6XA 3DRSA 5F8IA 4IOAQ 4M5DA 3K8WA 3SCJE 3SCKE 2QFJA 1N36F 1DURA 1VQ8S 1YJVA 3LP2B 2UXCF 3OTDA 5I42A 2HHPA 1G3OA 3LP0B 4DV6F 1S77D 3KLEA 5FLXY 1NZAA 1T95A 4QWAA 1IKVA 1T03A 4B9MA 1NJYA 2WCXA 4TNOA 4C9DA 2LA4A 4O4GA 4MIBA 3KLGB 3KK1B 3LOUA 3OV7A 2QSWA 3TAQA 3IAS9 2WONB 4C2MA 3L7OA 4K4XA 5HO4A 4CNYA 1S0VA 4QJVA 1K73T 2EFVA 2DVIA 4KE5A 4TYAA 3TARA 1M5SA 2EK6A 4IG3B 4NA2A 4X84A 2VUGA 4XAKA 3V4IB 4CCHA 1S1XB 1KVJA 2YKNA 3DN9A 5KT3A 1HNXF 2DNYA 2OTLS 2V4JB 3DRPB 5F0WA 4IFYB 4W90B 1FRMA 2XI3A 4I2QA 2NZ4A 2EG2A 1B0TA 4JYAF 2ASLA 3FRYA 1J2VA 1H6KX 2C3OA 3TA2A 1XMQF 4ILMA 5T41A 2CVIA 3W2WA 2I5JA 5DO2A 5IT4A 3HKZD 4TU8A 1RTHA 1K9MT 3NL0A 3JTNA 3OHBA 4X4QA 1GH8A 4ELVA 2JZ5A 1FE0A 3VCDA 4ID8A 3RAQA 4BWMA 2C3UA 3EGNA 3OTOF 2RF2A 2FLPA 1N32F 2VH7A 2KXFA 2X3GA 3PFOA 1IQZA 3JYTA 3H40A 3MMCA 4HH1A 2PSZA 4J9MA 2DO4A 3KK3B 1P8GA 1HBNB 2BQRA 1H3DA 2MHNA 3UR0A 2V4RA 1SV5A 4H4MA 2E66A 2FLNA 5I3UA 2WK4A 1UVNA 1FVSA 2EKYA 2AWZA 1I6JA 1U2FA 1IKXA 1T3NA 4ECRA 2W9BA 2MPUA 2ADBA 3DOLA 1UWBB 4RWWA 4QPXA 1YJRA 5KFUA 4M95A 4DG1B 2COLA 1NH8A 2VG7A 2WTFA 3KLHB 4ED6A 3N6MA 4ED2A 2DGWA 3TANA 2VPWB 1U1KA 3KK2A 5D4NA 2YWGA 4EYHB 1IKYA 4JI7F 5A0YB 2B6AB 3V81B 3MOJB 3ENWA 1NO8A 1TZ0A 2G4BA 4RX6A 2M8HA 2ZZNA 1VQYA 2XI2A 3CCMS 5B0CA 3N0VA 5K14A 3QIPA 4NA3A 3E8OA 1OWXA 1H7XA 3P49B 1YJNS 2CQCA 2E9TA 3FSYA 3BSNA 2XSFA 3SSRA 1BD6A 3M1VB 2EC0A 5CZVA 3G86A 3MURP 3DOKB 1WEYA 1RTIA 4B3OB 4G1PA 1HYSB 4JV2A 2EBEA 2KB2A 4RBTA 5KOXA 1HD1A 2GA7A 2MKSA 1VOMA 3M05A 4F4KA 2XGPA 2KI2A 3MTKA 3GIMA 1GTEA 1LFWA 3I87A 3TNVA 3OTEA 3V4MA 4X4OA 1H0HB 2BW2A 2PI5A 1Q82T 2UUCF 4C3MA 1WF2A 4ES3A 4GKJF 2R7XA 2D9PA 5B08A 2HNZB 1X0FA 2DPJA 4KTQA 2VASA 2MZ1A 3Q24A 2MKHA 2DGQA 2GW8A 3QLHA 3IGNA 2KYZA 1MW7A 2MY8A 2VV5A 2MQOA 1DTTA 4IR9A 4R25A 2Q66A 1BLUA 3GV7B 4B9TA 2ZHOA 1DQ8A 4TY8B 4EGLA 3OXFA 1B0PA 1VC6A 4OZNA 3QJJA 4HTJA 3C6UA 1Y3KA 1FTCA 3IR6B 3QPIA 3PKYA 2IMWP 2QV6A 4ZVEA 1REVB 1FKAF 3JAMY 3PW5A 3E2EA 4DUZF 1CG2A 1CQNA 1V9OA 2B9YA 1KSPA 3LUYA 2K1RA 3AB2B 2HNYA 4PG8A 2D7SA 2ILZA 2VG5A 3CPWR 2YKMB 4YR0A 2CQBA 3PEHA 3SZ2A 2HHUA 3DU5A 4B9LA 4EFAC 4NYPA 1FDDA 1H7WA 2RMLA 3JTOA 4KIAA 1LW2B 2ZH7A 1RISA 2HG4A 3LP1A 2XSJA 1K1SA 2E5GA 7FD1A 4DQIA 1D9FA 4L3NA 4D3GA 2XCAA 3CD0A 3H25A 1YG0A 2RQKA 3H59A 2A3JA 3CCRS 1ZPWX 2APOA 1B7FA 3MM8A 1UVLA 2DHXA 3T9NA 2MQPA 3RTVA 3RRGA 2DPIA 2I1RA 3BQ0A 5M2PA 1KRPA 4C8OA 4DLGA 4MKYA 2OPQA 4K4UA 3W7BA 1HQUA 1FXDA 3M30A 4G1IA 4USIA 4K4TA 4C8KA 4ECSA 3ISNC 5KT7A 3H2UB 2CQHA 3E01A 3I0RB 1VC5A 5J2PB 1F60B 3ZZZA 1X0PA 4URGA 2NUUG 3TAPA 4K50A 2ZH1A 4DBQA 3H5UA 1DQAA 3CDWA 2XEXA 3HHLB 1RAJA 3BB5A 5DG7A 3CIZA 5EWEA 3W2VA 3L95X 3IGVA 5KFLA 3M9NB 1JLCA 2D3ZA 2IFXA 3M2VA 1QAXA 3CJ2A 2MMYA 3PRBA 3UCGA 1JJ4A 2BM1A 4ZKAA 2KRRA 4Y6IA 5GMKa 2VFRA 1TL3B 4FBTA 2HIQA 4AL6A 1Y00A 3BGFA 1E6VA 3T19A 2R2UA 4O3RA 3V6DB 3EXYA 3I5AA 2HYIB 1JNZB 4NLYA 1U2RA 3OVAA 1F9FA 1PC5A 4I2PA 4LSNA 5G0RB 1TKXB 3ITHA 4EO8A 2ZH9A 2BANB 5DM7Q 3BSAA 2C3YA 1JLBB 2QO3A 3HHEA 3TO8A 3UE2A 1JLAB 3K8VA 1S48A 3PX6A 2A10A 3VAIA 3EYZA 1FKPB 1IKWB 1YHQS 4M63A 1X8DA 1OQ6A 4NXMF 1TKZA 4WU3A 2BE2A 1WHYA 4ZDNA 1RT3B 1HI8A 5DQHA 4IQXA 3MEEB 3A1YG 2HWHA 3MM7B 5LJ5Y 2PI4A 4GC7A 1OIAA 2YY3A 5L1LA 4BDPA 2OFHX 3KLIA 4JI8F 2DGOA 4KAIA 3ULHA 4HLBA 4PXDA 2GHPA 5CH7B 1TK5A 2V9KA 4B3MF 4GMKA 5CYQB 3OR1B 4FPRA 4DR4F 2P9GA 2MQNA 5T14A 2Q3PA 1FXRA 3NG8A 2YNGB 2N4CA 2IJFA 3FNNA 3NLCA 4ZPAA 2PA3A 2G13A 2KO1A 2W25A 2WSCC 1LWEA 4U7CA 1URNA 1IR0A 1HNVB 5J1EA 3O2IA 2J8AA 5DGAA 2MQQA 4XIUA 4AL7A 1DLOA 3AQOA 5E33A 3PW4A 1N33F 3T1HF 2FB0A 4R8UA 1TL4A 2HS0A 3PJWA 1U25A 4F8RA 2HFZA 4F25A 3CE8A 1HNWF 3LANA 4B3TF 3J7YI 2NQPA 4C11A 2NREA 4OI6A 5A8RB 2ASDA 3HVWA 3CGIA 3ZZUA 5HLFA 3MAHA 3ISZA 5LMUF 1UVIA 2R7TA 4QIVA 2MJNA 4NCBA 2UV8A 5EX0A 1W2IA 4ECVA 3MMAA 2LLZA 4XDCA 4A8SA 3EXCX 1OSDA 4V19X 3IBWA 5U47A 3HHKA 1RKJA 1C0TA 2K3KA 4YB1P 3T6BA 2EFPA 5KG4A 2A18A 3RB6A 4Q45A 4YDDB 2VONA 1SIWB 1JIHA 1Q86T 1R43A 4JV0A 1IQTA 5C24A 2XLJA 1C0UA 5DS7A 1HMVB 3BEGB 1UVKA 3MM5B 4RKUC 2M3DA 1M5KC 4GO7X 2Q43A 2B5JA 3VWSA 3CDBA 2MQLA 3V2UC 3CVKA 2HVIA 2L9WA 5SUHA 2MB0B 1S1TA 1ZM3A 4DDFA 4KFBA 3T6JA 3CC2S 3G4SS 3PW2A 1SJ3P 4DL4A 1RK8A 1RT1A 1O51A 1X4AA 4DPOA 4NRUA 3BO4A 2C2DA 3KNGA 2PFFB 2OD6A 2JC0A 3MD1A 2QEXS 3AHPA 4KKOB 2J7KA 4DQSA 3PDNA 1N52B 1FRLA 2EG1A 4YHHF 1ZH5A 4R0EA 4Q2MA 1NNDA 1BWEA 4DL6A 1HNIB 4NLWA 4AE5A 4PXEA 1AFJA 2W7OA 3C46A 2K2PA 2KU7A 3HZEA 1YWXA 1SH3A 4FZVA 1S0NA 2E5HA 4A8OA 1WEZA 2YNFA 3UCZP 1YJWS 4O3SA 4RUAA 4UY85 3NNCA 3EPIA 4TLQA 1QSSA 4LSLA 3CC4S 2ACYA 5I3PA 3MR5A 2OO4A 3TVZA 4AXIA 1FO1A 1KLMB 4FXWA 1Y9OA 1HWKA 3G8TA 3Q2SC 2DGSA 1RT5A 3PKMA 2YNHA 2F1FA 1UW4A 1FK9B 1HPZB 4IO9Q 3KMSA 2G1DA 4ES2A 3R1HA 1FJEB 3FMWA 2B43A 2ZITA 1RT4A 4KSEB 4ZLPA 1RYRA 4LVNP 3Q0AA 2X1GA 4IUFA 2GCFA 4ECQA 1FNOA 4I69A 4ZCLA 2MZSA 3DM2B 3K5LA 4DEZA 3HHNB 4O3NA 2VOPA 1KFDA 4DX8H 3HMJG 4JOUA 2FHJD 4RUCA 3MEKA 2ZNZA 2E5JA 4TXSA 2NYIA 1Q7LB 4HT5A 4B3RF 5F3TA 4RNOA 2LKZA 1MSWD 1Q8LA 2XMUA 3MWBA 5DGBA 3M8RA 2Y1IA 4TQSA 4NLSA 3QAEA 2MSSA 4ID5A 1UFLA 3GYXB 3MPWA 1JLEA 3HZGA 2MDAA 4RLEA 3K58A 4FF1A 2EPIA 1WTBA 4PG4A 1X4GA 1FDNA 3DI6B 3M8PB 5BJRA 3MAQA 3TW0A 1Q7YT 3VALA 2DNLA 1YSJA 2YKAA 2YKOA 3KHHA 1LXNA 1SXLA 1VQKS 3DMJB 4J9LA 2U1AA 4KV8B 2W9CB 5KFRA 1NK4A 2RILA 2ZNYA 1VI7A 2B0GA 2M0GB 2Q79A 3CT9A 3ZZRA 5F3ZA 4IOBA 4ICLA 3MEGA 1FKOB 5DQIA 5L1JA 2J6SA 3M8QA 2V5HG 2I0XA 3CCQS 2EW9A 1YBAA 4OX6A 3IRXA 1JLFA 1WHWA 4F26A 3LO3A 2BVZA 3B8HA 2BJDA 3FVYA 5KG1A 3M8SA 4A8QA 4CH7A 4MH8A 2B3TB 3D5MA 3GZ7A 3BREA 5E3RA 1VQ7S 2X1BA 1Y0HA 1C1BA 3HPOA 2NXUA 4MTPA 2ZD1B 1L3SA 2FY1A 2HQ3A 1Y5NB 4EO6A 4J37A 1X7VA 2N7YA 1Z1ZA 4R5PA 2EK1A 4C8NA 3JSBA 3RB3A 2KKHA 3MM6B 1UA0A 1L5UA 5FDLA 1TK0A 3G6YA 4CO5A 1UEUA 1ZPVA 3CC7S 3M32A 3OR2B 3H8YA 4TU7A 2RH3A 3DGPA 3GWCA 3FGVA 3VR1A 2RD5C 2R7QA 3SFGA 4RW6A 2JHEA 5IXUA 2WRMA 4QIGA 2F9JA 1BQNA 1XMOF 5CYMB 4LF8F 1LW0A 4LQ9A 5DRKA 3K57A 2RKIA 1SC6A 5C25A 1FJCA 2M7SA 1OPIA 1VBXA 4CO0A 2WHOA 3GV5B 3PM9A 3KLFB 3I56S 2ZJPQ 1S7HA 4YEAA 1N6QA 1N48A 2N7CA 1U09A 1S1VB 4X4UA 2N3LA 4F3QA 2XZWA 4CIOA 4ZVFA 4IDKB 4FBUA 4IFVA 5SZTA 3QJPA 5L38A 3K5PA 4L72B 2CIMA 1ULRA 3GYNA 5L1KA 1VLYA 4C8LA 3BDPA 1YQHA 4PPDA 3TVKA 2OPSB 1P9QC 3HLUA 2KG0A 1XNRF 4J9NA 1SKSA 3M9OB 1KTQA 2VPZB 1JKHB 2KHCA 3T5JA 3EZ5A 2NPIA 4DFPA 5DETA 2E9ZA 5EX3A 2LDIA 4C0OC 1K1QA 4M8LA 3P96A 2YH1A 3R1LA 2X1AA 2ZM6F 1BQMB 4OIXA 3KTQA 2UXDF 1Q8IA 2DR5A 1UVMA 2AYMA 3GR1A 1TVRB 2AJQA 1S6QA 3POTB 3GIKA 2UVRA 2BABA 2IAJB 5KFNA 4MK7A 4IYQA 3EPGA 1N5VA 2UZAA 3AQPA 4I6YA 2FGOA 1GXUA 5CCMA 3MFIA 2BA9A 4RNFA 1DTQA 5HBMA 3Q8QB 5AXNA 4DV4F 4HHJA 4Y0FA 1KNZA 1DFDA 2LQJA 4N41A 2PGCA 4F3OA 4OX8A 4Q7AA 5M2RA 2ADCA 5THWA 2HS3A 4MYUA 4ECZA 2KJVA 5AE2A 4WKRA 3LH2S 1LV5A 4A8XA 3D2WA 1KFSA 1TKTA 3T3FA 2B4PA 2OMLA 2BDPA 3H4BA