4E8UA

Crystal structure of arabidopsis idn2 xs domain along with a small segment of adjacent coiled-coil region
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
166
Chain Sequence
DEKLVYPWKGIVVNIPTTKAQDGRSAGESGSKLRDEYILRGFNPTRVRPLWNYLGHSGTAIVEFNKDWNGLHNGLLFDKAYTVDGHGKKDWLKKDGPKLGLYGWIARADDYNGNNIIGENLRKTGDLKTIAELTEEEARKQELLVQNLRQLVEEKKKDMKEIEELC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Putative uncharacterized protein T8P19.180
publication title INVOLVED IN DE NOVO 2-containing complex involved in RNA-directed DNA methylation in Arabidopsis.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 49
structure length 166
sequence length 166
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03468 XS XS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4e8uA00
4E8UA
chains in the Genus database with same CATH superfamily
2RB7A 1NNDA 2C3MA 3HKZD 2VKZG 4QU6A 1K0VA 3DM2A 1UVKA 5GVQA 2A0FB 4DWIA 4I64A 2XGPA 3BS9A 4L75A 5HROB 3GSIA 2V2KA 4QYRA 5K8PA 1HWUA 3BQ0A 1F3VA 2RDDA 3AXKA 2IAJB 1BD6A 1HYSA 3I82A 4HR2A 5HMZA 3FK4A 1S1WA 4CO1A 4CT9A 4Y2AA 4KB7A 4FS1A 4FP9A 2XLKA 4YOEA 1SBRA 5L1KA 3NCQA 2AYGA 3PIOQ 3GZ7A 2V69A 3T1HJ 5LM7E 3MAHA 3CCMS 2MQQA 5IWAF 4DR2F 1WNEA 2VDHA 4DQRA 4UF4A 3KJVA 4AXJA 3R5JB 2NXUA 4ZMMA 4YEAA 1YI2S 1V3RA 3MR6A 2DBBA 4YDDB 3MMCA 3W2WB 2JLGA 4C8MA 1WKKA 4HACB 3KHGA 1S1UB 4BLGA 1VRTA 3HSJA 5GAHI 4ECQA 1FRJA 2C2EA 4ELUA 2Z2YB 2DRAA 1D3WA 3BPSP 3MGJA 1M1GA 1RTJB 2W8KA 3TJ9A 1WORA 5J1EB 2ASLA 1XMOF 1QVFR 3ISNC 3VVUA 4U8YA 2YY3A 1F6TA 1P27B 4AUKA 1U1PA 4LFBJ 2IHR1 4DDFA 4X66J 3W9IA 1RWVB 3RB0A 1JLFA 2UV8A 2MHNA 2V2QA 4ECSA 1U2FA 4B02A 1G4CA 1JXEA 4KFBA 1DBDA 1I5OB 2NXEA 1EX8A 3NGSA 2OGUA 1VC6A 1REGX 3CIZA 1C0UA 4F0KA 2GCFA 3QRQA 3ZNJ1 1RA7A 3SV4A 2J7KA 1VQ7S 2X1BA 4RNOA 2IM2A 3H59A 3F41A 4UUXA 1U09A 1PGZA 2MZQA 3BV8A 5KT5A 2B4PA 3SZ2A 1EQ0A 1PILA 2BABA 2GIQA 3CW2C 4X4VA 1RISA 3L95X 3BN7A 3V6JA 1B4SA 1EKRA 1R8CA 1WDTA 4DL0C 1TL7B 2CPHA 2CFXA 4NLSA 2OD4A 3CJ4A 5KFWA 3HZEA 4IDKB 2CJYB 2XNQA 4DV7J 1VISA 1IKYA 1VQ6S 2YBVA 1HQUA 5BJRA 1JB0C 4EK2A 2HURA 4JI4F 2DH9A 1R8PA 1NB7A 1EHWA 5D15A 2HQIA 3KK3A 3GIKA 3PFEA 3J80U 1KQGB 4EU0A 1RAGB 2FVQA 2J6SA 3DLGA 3EJMA 5HJXA 2ZKTA 4PG4A 1NRKA 3N79A 3PV8A 5I3UB 3NKYA 3N4WA 1RTIA 3HMJG 2CKWA 3FQKA 2YKNB 1T3NA 2HFNA 2ZD1B 3LGMA 4U6PA 3TZYA 3RR8A 1A6LA 3DLHA 2FJAB 5LSRA 1KP6A 1EIYB 5JVGQ 4DS5A 2VBZA 2O67A 2RRBA 1S6QA 2E5LJ 2DEJA 2C3OA 1FRXA 3W65A 3ZC4A 2DT9A 3VGUA 1VQ9S 1O8BA 4OV6A 2H54B 4F4YA 1SL2A 1IKVA 4DX7A 4DN9A 2KVQE 3LQVA 3D67A 1REVB 3LP2B 4ZIWA 2AV5A 2YNIA 4N47A 4ER8A 3S7RA 2KXHA 3LP0A 2R9LA 4HT5A 2YKPA 1RWPB 3FMBA 4M5DB 1V9OA 2YX7A 1S10A 1J27A 3KK2B 3M8PB 3PRDA 3OR1B 2CQGA 2APOA 2YWWA 1TFYA 2B4UA 4IG3B 5HK4A 1FXRA 3G8TA 2OFHX 3AQOA 3CUNA 2L9DA 2OSQA 3RR7A 4F3QA 5DGAA 4ZN1A 2FLNA 2D3OR 3AT1B 3CULA 3W64A 4WP9A 4ZVRB 1QTMA 2XCPA 4QWDA 3T5LA 1FKOB 4LF5F 1YBAA 1R8AA 2DNLA 4OYPA 3JQKA 5A6WA 2KYXA 3MOZA 1W26A 3ULHA 2D3O1 2B6AB 1TK0A 1FNMA 2XMTA 2BXJA 5J1NA 3T5JA 3LOUA 3BJYA 4U9RA 2XMKA 4DR7J 1TKZB 3Q22A 4E8UA 4NX9A 1IR0A 1Q86T 2EWHA 1KHWA 1U6FA 1RT4B 2MLZA 3IG1B 4LIWA 3BGUA 4PCQA 2ZDOA 4ETXA 1P6TA 2F3JA 2Y1JA 4G3IA 1CS4A 1WKLA 3JB9k 2A6OA 3PIPQ 2NYHA 5GADU 3MR5A 2FC8A 2IVMA 3C8YA 1EETB 5CZXA 2FHOB 2R7OA 2Z2MA 4F02A 2BOAA 5CYQA 3PW5A 4YY3F 2A2DA 1VR6A 1LK5A 4H4OB 4O0NA 3BO3A 3QJLA 4ZPWR 5D3GB 3BH7B 1FDBA 4KGZB 1NK7A 4WE1B 2HGLA 1LWXA 1IM4A 2JVRA 4ZVPB 2KXNB 2XZWA 3KLHA 3OVAA 2C28A 3KDNA 4EYIB 3CEDA 1RT6A 5U47A 4F3MA 3MECB 1TU0B 3RBEA 4Y34A 4L6V3 4V1Ak 1TKDA 3K57A 4U7UK 1MN9A 3GG0A 3A8EA 1FEHA 2WAQD 4DR5F 2QMUB 2X1GA 3H5YA 1ZM2A 4WWSA 5A8WB 3POTB 2FC9A 5J2MA 3VTIA 1RAAB 3WBZA 2YX1A 3TA1A 3BQ2A 2VBXA 1HWLA 4ZS6A 1SL0A 4OYAA 3ENAA 1Z2LA 1PYTA 3DI6B 4O4RA 2W2OP 1RWNB 3NBPB 3IWNC 5LT5A 2DHAA 4A8QA 3GJSB 4CCHA 1Q16B 1M5OC 4FKYA 4KT0C 2P9GA 1LWEA 3ADAC 3AY0A 2ZUAA 3G87A 3MTKA 2N3OA 4K4WA 3NGKA 2DNOA 3MMBA 4WFAQ 3CJKB 1CPZA 2YKMB 3OVSA 1X5SA 3Q83A 3SI8A 5HATA 1KN6A 1B7YB 1HNIB 1FE4A 2IRUA 1W2BR 4KV8B 4RUBA 4JB8B 2ZH4A 5KG0A 1KR4A 4ATNA 3IAM9 2K7JA 2LQJA 2UXCJ 1EZZB 1PYOB 3QT7A 3RBXA 2WB4A 1N5TA 3CCVS 4OX7A 3ENWA 4G1PA 4MH8A 4KKOB 2GS8A 1FTCA 2QX0A 2PMWA 2XY5A 2RMLA 1QE1A 4LF5J 4KGXB 5K20B 1FJ7A 3PW0A 2WVEA 3QRRA 1MROB 1N36F 1ITPA 4ELTA 1SPBP 3MMAB 4QQBA 1H98A 2UUBJ 4O44A 2UVVA 2G4BA 2RKIB 1I94J 4DL2A 2JSXA 2OD6A 4EUVA 1RE1B 4ALZA 4NZ0A 3GP9A 4CH1A 3HHLC 2HGMA 1PC5A 2H4WB 4ED7A 2EC2A 5L39A 1JLBA 3CCZA 4URGA 4RL1A 2ZH3A 4UOCA 3L9ZA 1VQYA 2W4CA 5D4LA 2MHEA 5A76A 1NMEB 4J9SA 3TZZA 2Y3YA 1YITS 1HBOB 4NRTA 2FJBB 1F9EB 1JXVA 2YXLA 2JOQA 2IBOA 4NLTA 4MFBA 1LWFB 1S5ZA 1LNQA 4GKKJ 3MEDB 4EMDA 3JXOA 1HMVB 3M8SA 4ID5B 3SSRA 2F65A 4BWJA 1RP5A 5A2QU 3BB5A 3PNIA 1E6YA 2ZBPA 2JFDA 2XMAA 2MZSA 3GJTB 2BW2A 2HK2A 2ASJA 3LWLA 3HJFA 2KFNA 3SQGA 3O5TB 5LSOA 2R42A 4XTTA 4EZ9A 3VVTA 1PSDA 2FY8A 2W2MP 2WVCA 4PXBA 1TL4A 1F2HA 5C24B 4WYLA 2F4FA 3R5DA 4YFUA 1IWAA 2YKAA 3NWGA 1I3OB 1T9XA 4DR5J 4CO5A 3R27A 1IBMF 4F8RA 3DLKB 3DOKB 7AT1B 1M1HA 4DPTA 3BDPA 2QA1A 5L9NA 1K73T 3FZ2A 4LQ9A 3OSNA 3KNGA 3HT3A 3DHWC 2AZ1A 4I2PB 2A3JA 5KFRA 1CVJA 4M5NA 2O66A 4IOAQ 4UZCA 2E1PA 3HSDA 3DLEA 3MAAB 3ZZYA 2KDOA 4OI1A 5LXRA 1S1VA 1M5SA 4IOBA 4QWCA 1KVJA 2AP6A 2CJXB 3RAXA 1FWKA 4A8KA 2AQ4A 2FZCB 3L09A 1KS2A 3OUYB 3GFYA 4QJVA 2DR6A 3MI7X 1Y5IB 3MPVA 2WHOA 3G71S 1ZM9A 2ZH8A 5HBMB 2FB0A 3FBEA 2YQ3A 1FFGB 4I4BA 1KD1T 4QIFA 1ZM3A 2Q6CA 2W7AA 5L38A 4DL4A 2IC3A 3M9NB 5CCMA 2W9CB 3D5MA 4LBIA 3P4UB 2HHPA 4C8NA 4LBHA 3AA8A 4IO9Q 2FIUA 4CLFA 1EP4A 2JEIA 3QO9B 3B82A 3IS9A 3M6WA 3UPFA 4ED1A 2CPZA 2O01C 4DPXA 4X4TA 1T94A 3CB4A 4LRAA 3QNWB 3DRXA 2OFGX 3EDQB 5ETSA 3J7YI 4C97A 2DNGA 1WJ9A 3AOCA 1HBMB 2F9DA 3BSCA 3WHIA 1JKHA 2R7SA 3TX8A 5L1LA 3DLBA 6AT1B 5F9LA 2PFFB 2BM0A 2GJFA 4WK3A 1Q8LA 1FXDA 3ISND 1IVZA 3U1MA 3P45B 4IFYA 4OLPA 4MIAA 2B0GA 3SXLA 5K9FA 3VR1A 5DJBA 1YDLA 1K47A 4UY8T 1GK8A 1S6OA 2EW9A 3PZPA 3HVTB 2YWEA 1WEYA 5KFHA 3PJ9A 2RVJA 1TL1B 2QL5B 4F7VA 5F41A 4NLDA 2LXIA 1QSYA 2A6MA 4U8VA 3TAMA 2OPPB 3G4SS 1APSA 3M8WA 3EZ5A 5KFEA 4RBUA 2KHDA 5KT6A 2E9TA 5I3QA 4DEZA 2RE1A 3CCRS 5IC6B 3PACA 2J9DE 1T9VA 4U7CA 3ENVA 4K5SA 3DLJA 3QGIA 4DV5J 1FWLA 4X65F 1TV6B 4YHHF 1GNKA 1CC7A 1UFWA 1F5CA 1X0PA 2R2UA 3ET6A 2ZDPA 3MCMA 1DY3A 4ECXA 2DPIA 2GGPB 1AFIA 4FYWB 2BE2A 2P2CB 4TYBA 3MR2A 3T9NA 3GR1A 2IJRA 3KLIB 4ZVGA 1U49A 1S79A 2MTLA 3FFIB 2K7KA 3W8GA 1IBMJ 3JSYA 3ILIA 1LWCB 2KN4A 2E1AA 4DG1A 3GFHA 2ACYA 5T7LA 3JQJA 1ZZFA 5DDOC 4DX5A 3V4IB 4FXWA 2ZOGA 3PO5A 2VZ9A 2AIRB 2LKZA 3MEKA 2AKWB 4RW7A 4LFCF 3FEXB 2QLJB 2ILYA 1OY8A 4LRCA 2ZM6J 2OAUA 5KFYA 1BWEA 2C2MB 2AJ4A 1TKXA 1R27B 3CCES 1JXLA 4FNIA 2I8EA 3PYDA 1F5AA 3M8QB 1KKHA 4K5RA 3AH6A 1OO0B 1W2IA 5AJ3F 1MWQA 2QSFA 3C16A 3OL9A 3P5BP 4QR0A 2IM1A 2D3UA 4KTQA 4IOCQ 2LU2A 2HVZA 2BYCA 1ZZNA 3H40A 2BJ9A 3DRPB 2CPIA 5GAGI 4JV0A 2V94A 1ACMB 3HDSA 2K8GA 1N5YA 4DU8A 3UW1A 4USIA 4OZ5A 2F8MA 4O3PA 2CYYA 4C3LA 3PTWA 2M5YA 3TA0A 1SL1A 4MIWA 3HF5A 2KB2A 4DL5A 4ZDNA 3UN5A 1LW0A 5DQIA 1UZHA 4GRSA 3UN2A 2KT2A 3L7UA 4FKXA 1UCNA 2XHWA 1U1MA 3KWMA 1FVQA 1UEKA 4B3SJ 2EKYA 4LF4F 4QIEA 2QL9B 3UNGC 3NL0A 2IJFA 3GIRA 2M70A 3CD0A 3WIUA 1RTIB 5E5NA 4FPRA 2B56A 4WPAA 2CQ4A 1EAYC 3HHKA 4DCOB 3MZIA 2HSEB 4DQSA 2J6UA 1NJIT 4GVBB 4NXNF 2QL7B 3S1TA 1B3TA 4NCBA 3ZTRA 1RT5A 4BC7A 2KG1A 4LT6A 3U1NA 2GMLA 1WDDA 2EK1A 1UMJA 1GX6A 1TUWA 4Y2KA 5D78A 2C2OB 1HI8A 4PRFA 2XGQA 2ZNZA 3T19A 3UR3C 3F73A 2X51A 2DNQA 4OZ1A 1CBKA 3DGPB 2CIMA 3DOLB 3HKWA 1U1LA 1VBYA 3K5PA 1RTZA 2NQPA 3D66A 3I4HX 1Q53A 5F3ZA 2Y9HA 2KRBA 1XERA 1RHUB 2WONB 2RD5C 1FF2A 2BJ8A 1F0XA 3TUJC 4F0MA 1SJQA 1RT1B 3HX9A 4PZVA 3PR4A 1DRZA 5LMNJ 2K1RA 3OTEA 3OL8A 1VLYA 3E01B 1V5VA 4WTYA 5L9XA 4USWA 3HPOA 2M3DA 3JSRA 2MZTA 5J1PA 4XO0A 2HHWA 2YNGA 2DYAA 5H9EK 3LH2S 2DY9A 4WU2A 1B0VA 1FFWB 1FX4A 5CAAA 4ZK7M 3IFEA 5B0FA 4QWEA 4EYHB 4BDPA 1SKSA 1IBKF 1J2VA 1S0NA 3ZNUA 2EKNA 3ENQA 4DV3F 2QLXA 1R0AB 8ATCB 2BJ1A 4B3TJ 3MDFA 4C3MA 4LFCJ 2DGOA 1LOUA 3HSGA 1NJXA 4ECZA 3QGHA 4TN2A 3VAIA 1VCTA 3GONA 3CCLS 3N6LA 5F3TA 2ZHBA 5D4PA 4Q7AA 3DU6A 4DPUA 2DNHA 1X4DA 4S0MA 3VWSA 1S59A 4DR6F 3DGVA 4DUYJ 4M94A 4R5PA 1FKPA 2YWHA 3MD1A 4ZHRB 5KT2A 3QSIA 2GHWA 5KG1A 4NLWA 1KVIA 1NJWA 1Q79A 1CS4B 5JXSA 1TL3B 3UO0A 4F4WA 2NLWA 3D6MB 5B08A 2OO4A 1ICEB 1FRHA 1RU2A 2X7IA 2XHCA 3BEGB 1NK5A 3M1VA 3IRWP 5D4OA 1VQ5S 2C3YA 2EFNA 3U1LA 1C2PA 1YBUA 5HSPA 2KL8A 4JI7J 5IT9Y 4RNFA 2W2NP 1C1BB 1FO1A 4EBEA 3R5BA 2H48B 5CQGA 1RWWB 4QYZK 3CCJS 4DUZJ 3KLHB 2BJEA 3GIMA 2NPFA 4DFKA 5KFZA 1HBNA 4NLXA 4F4KA 1SQGA 4URQU 2R8IA 3G6VA 3BO4A 4I7FA 4N8NA 1H7WA 4LF9F 4BBYA 4O3OA 1FCAA 1S6PA 3C6TA 5KOWA 1JLEA 5KFIA 5ETKA 1FERA 1TQLA 4OI2A 4J37A 4OX9J 4DN0A 4KH1B 4NXNJ 2CVIA 4NEZA 3AJDA 4KHMA 1Q8KA 3MOJB 3FSIA 3N5FA 3RW6A 4YB6A 5A8KB 4EEYA 1HNVA 5J2NA 1FWPA 2ZNYA 1LWEB 4O4GA 3OTDA 3HHLD 5DG8A 5J2PB 1YJ7A 3DYAA 1U45A 1UJ4A 1VDHA 2E7VA 7FD1A 4OZNA 5M2UA 3KUGA 2YH1A 2IRXA 4X4NA 3MUTP 3JYTA 1N32J 4P2SA 5HQ8A 2AD9A 1YRXA 4RO0A 4X4SA 1AZSA 1TKTA 3DHXA 2XO7A 1CJVB 2MKHA 4K4ZA 3K5MA 2IMOA 1WC3A 2MZRA 1KDNA 1VYAA 4M5LA 3RB4A 2ASYA 3QMQA 1R0CB 1JNRB 3CC4S 3OBIA 1U7LA 5HMYA 1X8DA 1IUJA 1DJ0A 4GMKA 3W5XA 1PAEX 1JNZB 2EC0A 2MZJA 1L3KA 3GMGA 1FNXH 2NXCA 4KGMA 1IBKJ 3M8YA 4QPXA 2D3ZA 2G0IA 4YR0A 2HS3A 5HROA 2OELA 4JI3F 5DM6Q 3MAQA 2IAJA 3TWZA 1QTNB 3EGNA 1K8AT 4C6AA 3QGPA 4F4ZA 3MXHP 1BE4A 1QDUB 2HFOA 2FLOA 4P73A 4LF8F 2RRNA 4P10A 1R8BA 1T05B 1DZ5A 2ZC3A 2LYVA 2AW0A 5KT7A 4I56A 2DXDA 1Y5NB 2UUAF 1VIXA 3NRBA 4ETZA 4DR6J 1IR1A 4CYUB 3CJSA 4GC7A 4C98A 5F8HA 3G9CA 1UA1A 3M30B 3QZ8A 2B51A 3KLGB 3W2WA 4J9PA 2D9OA 5KFDA 4ZVHA 2BQ3A 4DPWA 4ZJQA 4UUWA 5CA5A 3CJTA 3NMRA 4HACA 2NR0A 2HRYA 2PA8D 3HK2A 3DNCA 1RABB 3M05A 1S1UA 3KLEB 3QJPA 4X4QA 4MYTA 3M2RB 2EVZA 3OLAA 3AAWB 2CUYA 1W25A 2ZFHA 5KFJA 3FGVA 1HFEL 1RTJA 3PJWA 2R8KA 2C2NA 2CQ0A 3GIJA 3CCUS 4B3OB 1PO6A 3IMQJ 3W9HA 2OUGA 2GJIA 1VC0A 3LTOA 1Q78A 3T9ZA 3J81Y 4RWXA 3D4JA 5B0BA 1UKUA 6FDRA 4LUBA 4ECYA 2XYPB 2VG7B 4CLPA 4A8YA 3J7ZT 4J9LA 5HQMA 3UR0A 4X62F 4PG6A 1IQTA 1FJCA 2H3EB 4DFPA 5L8RC 1LW2B 5KFBA 3UWTA 3BM7A 3PRVA 4YB5A 2OMOA 3FJ2A 1XMQJ 4TKTA 2KM8B 2B9WA 1GMUA 3TW0A 3UCGA 1DTTB 3VV2B 5J2QB 1YVFA 3EUNA 3O6QA 5D0GA 1O51A 3HD2A 1X4CA 1VI7A 4ITSA 3J7Z5 2W4PA 4XPCA 2XSJB 4KY3A 5JUMA 4JI0J 2V8PA 4ZN3A 1RLDA 3FMWA 2BUNA 4K4TA 1GX5A 1C1CB 2BX6A 4NZ6A 2V8DA 4PG7A 4RX6A 1TL7A 2GZOA 4CLSA 3I87A 1UZDA 3MPWA 2OI2A 3HXMA 2CDRB 3UDLA 4IDKA 4XIUA 3UVJB 3A4TA 2CQHA 3K58A 4ECTA 3J80Y 2RU9A 3KMSA 2YX4A 1FNOA 2WZ1A 2I5JB 3PXGa 3P3DA 1H2UX 2VBWA 1LFPA 3LUYA 4A48A 4QPTA 5AXLA 1OSDA 4A8MP 1O6XA 1H74A 2JLFA 2MGZB 1FXLA 3FCHA 4RU9A 2E5GA 2CNNB 1RZMA 2DHSA 1VIOA 1U2CA 5BR8F 1S7HA 5I3UA 1JJ4A 1RHJB 2UVUA 3MWBA 3R6LB 1URRA 4C8KA 1Q8BA 4I6WA 3QZ7A 2NPIA 5DO2A 4JI3J 1E6VB 1FD2A 2XB2D 2C22A 1ZA1B 4MMOA 4RW9B 4C2MA 2ZJRQ 2KHCA 2CPXA 4ZLNA 1M5PC 1RHKB 3LP2A 2KZZA 3PYEA 2QA4G 2AYMA 4M5JA 1X5PA 4TYAA 1S0VA 3HJVA 4F25A 2JLEA 4NLQA 2UUAJ 3MFHA 2KTQA 2V50A 3AOAA 2FTRA 4M5DA 3N9UC 2CZ4A 2JEFA 3BKTA 5KFNA 5HAOA 1RYRA 3HT0A 3OR1A 4A46A 2MLXA 5E3PA 4IG3A 2CADA 1Q5VA 1VMBA 2V5HG 3VHQA 1Q82T 2DB1A 4NMXA 4NYPA 1SJ3P 3FC9A 2ATLA 1IR2A 1U2RA 1HPZB 4FZVA 3MUMP 3C15B 4O3NA 4DF4A 3EDRB 1Y10A 1OSCA 2VQFF 2X3DA 1XR5A 2FJDB 4JI8F 1YJTA 2EBEA 4WTOB 4OZLA 2MY7A 2V2ZA 1WACA 3SDEB 1NU4A 3ET6B 1Y4ZB 3CDAA 1MWZA 4FYYB 2B6AA 1NPRA 4LQ3A 2GO8A 4B9UA 5LXYA 5ETNA 2PI5A 2RILA 1XN9A 4UTGA 3CDWA 5IQQA 1WSRA 4MJKA 4RUCA 1TKZA 4DR3F 2VC1A 4J91A 1RGVA 1F5BA 1RT4A 2DGUA 4W90B 3D1HA 4Y6IA 3GYXB 3FNNA 4WJBA 1S9EA 1ZAVA 2CJ9A 5C7PA 4M5MA 2QLWA 2OTJS 3PYFA 4XAKA 4C11B 2ZKUA 4ZCIA 2QO3A 2ZJQQ 3MMJA 1EETA 4DR4F 3R2DJ 2KRRA 1KFSA 1VLOA 3MUVP 2ZVIA 4H4OA 4B9LA 5I4MA 4ZIVA 4M5KA 4C8YA 4Q45A 5D3GA 2JFKA 3BF4A 3KG4A 2HAFA 2ZHOA 1HD1A 1W7WA 4NASA 1HHQA 3UCUP 4NLUA 4WE1A 4QBUA 2A18A 4ZPTR 1HWKA 4YB7A 3L7OA 2E1MC 1NZ8A 4ECWA 3AFGA 2U2FA 2V34A 3MECA 3IC1A 5GAEI 3OFGA 1NZAA 3R5CA 1PC4A 2BV3A 5EX0A 1N33J 4USVA 5BR8J 5FJ4A 2GV1A 4HI1A 2E7WA 2R7RA 3OTOF 4HVZA 4JYAF 4FXVA 1FRKA 5A8WA 4Z7CA 3POTA 5IS2A 4HTIA 1GT8A 3AD7C 2RH3A 3NS5A 2I6WA 2I1RA 1CJKB 1Y7PA 5BXIA 3DKDA 5F0WA 2YNFB 3DI6A 3ZZ0A 3M9OB 3PR5B 2HQFA 4HTJA 2FHJA 3NBPA 2LXUA 1GQEA 4DR1J 3I31A 5KFXA 1HI1A 2HQ3A 4LF6F 2QJ3A 2JEJA 4NA3A 3H0PA 3FSXA 2ZBRA 1UFLA 3VZIA 2JL9A 1U47A 3CJKA 1YZ7A 2HBQB 2YKMA 3GYGA 3GE9A 1HNIA 1HNZF 1CQNA 4WKYA 1P1LA 2OSRA 3CJ5A 4DV4F 4KV8A 5JVHQ 3DRYA 3UD4P 5KFOA 1CULB 3V6DB 3TJ8A 4V19X 4OI3A 1MU2B 4IFVA 2BE7D 2YPYA 1DQ9A 4OHZA 4ZITA 4FVCA 1L5UA 2X1FA 1H73A 2V0NA 3PJXA 2B5JB 3LPYA 2HZVA 3Q8RB 4CI0B 4AL6A 4JI8J 2K1RB 2OEJA 4KKOA 5JJBA 2IA0A 4KYZA 4NLVA 4TVAB 3KOAA 3IR5B 1YSJA 3BSNA 3WC0A 5HVGA 2MJUA 4BC9A 4KH0B 4ZVSB 1UJ5A 3MMAA 3RBZA 1KNZA 2ACMA 3DXSX 1L3TA 1L3VA 3UDEA 2RKIA 1RDRA 3W66A 1A0OB 2J7UA 2PMHA 4TY8B 2B7BB 3N6NA 1YBTA 5IV4A 4WZMA 1S9GB 2QMXA 4OYWA 1MNEA 4NL5A 1IN0A 4X2BA 3HHDA 2MLYA 2FVPA 2HVDA 2V4JB 2PO4A 2VA2A 5D0HA 4IUFA 2LP4A 4ZP8A 1RAFB 3WZ0A 4RWWA 2XO6A 3SSQA 4IYQA 3QPIA 2L41A 2XLIA 4GO7X 2XY6A 5EWFA 1LWFA 3CTRA 2HRUA 3CCSS 1GXUA 1OQ3A 2BJ7A 3KHHA 2GIRA 4Y65A 2HWTA 1HMVA 1GAOA 2XQCA 2MSTA 1JMTA 2HFUA 1S1XA 2XMJA 1N48A 5L1IA 4KBIA 4JI1J 2Y1LB 5E0OA 3B78A 1BQNB 2QG9B 3M1VB 4JP8A 1QLNA 3FCWA 2FLPA 3CIMA 5C24A 3NP5A 4OI4A 3PFOA 2DKOB 3MHYA 3QQCD 5KFQA 2BBEA 4RR5A 3EWGA 2BACA 3V4MA 5IT0A 5EWEA 3OTOJ 4JYAJ 4I69A 2QTWA 3DLKA 4DL6A 5I42A 2P6TA 4M5GA 3DOKA 2QA2A 3G6YA 1HWJA 5F8NA 1RT7B 2ZZTA 1WF1A 4I2PA 3VQTA 3D0GE 1UW9A 4B08A 1QD1A 2ZUGA 5E41A 4CO4A 2UXBF 2XM3A 2DNNA 4RKUC 2IPOB 4C8OA 4LSNB 2V4QA 1N56A 3OVBA 4CO0A 2K06A 3FRZA 2P9EA 3CC2S 2CQ3A 3N01A 2R7TA 5HBMA 4R0JA 4GKJF 3QATA 5D77A 2XI2A 4OHXA 3QLHB 2B3TB 5J2NB 2XZDB 2RQMA 2CG8A 2VIHA 3IWXA 3MPYA 2W9CA 2LLZA 1Z4UA 1FRMA 1WWHA 3QO9A 3MM9B 1VQOS 1U1QA 3PKYA 3X1LB 4ZJLA 1U1RA 1TR0A 2ROPA 2Y0BB 3W62A 3ZTSA 3CD7A 2AEMA 4KGKA 4P72A 5HMWA 3MM8B 2DR7A 5A0YA 1TFWA 2HBYB 3KHLA 1AZSB 2V68A 4LFAF 2DCUB 1HBMA 4ILRA 3MD3A 4WXWA 3MCNA 2XMWA 4DV6F 1S72S 4CNZA 4DPYA 4AT1B 1NHKL 1UA0A 4PEOA 4FBTA 3TRGA 4WKRA 1OPIA 4RNNA 3W9JA 2MKCA 3GV7B 2HMIB 1S0MA 1FE0A 2V8GA 4DSEA 4OYIA 2C2RA 1SQFA 1GH8A 1G2EA 3BN4A 3K59A 1RCXB 2ZJPQ 2LXFA 3HULA 3I0SB 2J76E 3HVTA 2HWIA 1AROP 1KONA 3AB4B 4RUHA 1TL1A 2ZE2B 4FBUA 3G8SA 2XSFA 2PE8A 4I6YA 2BMBA 2HHTA 2OPPA 2HNZB 3HFVA 5HL7Q 3M2UB 3G2XA 2DNPA 4CT8A 1YTYA 4Q0BB 3D54A 3OFEA 3SCJE 3NMAA 3QWPA 5E3QA 3CJQA 1FJGJ 1TTHB 4OYZA 3TOQA 4URSA 3J7AN 4LF1A 2EI5A 1K9MT 4CQ1A 1FD8A 1X7VA 9RUBA 1ZPWX 1TV6A 3DDKA 4TU7A 3MM6B 4HI2A 2UUCF 1KOHA 2P6SA 5DGBA 4QW9A 2WOMA 2MDAA 4AYBD 3NEKA 2GGPA 1HD0A 1IWGA 3OFFA 1N5QA 4HDHA 1PYSB 1CJUB 3OHBA 4JI6F 2G2YA 1JQGA 1UWBB 3KLIA 4ZVFA 3WX4A 2XYHB 2MQOA 4LSLB 3M6VA 1L3SA 3FFIA 4ELVA 3G86A 3NNCA 4LR9A 4XPEA 2MJNA 3UN3A 3Q23A 1LWCA 5KG4A 3QRPA 4RW8B 2MKSA 2DO0A 4M5IA 2JDJA 5LOQA 3V4IA 2CQCA 4X4PA 1OY9A 2AF6A 3HHLB 1PCAA 2CJAA 2PGCA 4B3RJ 1RTDA 4ECRA 1OQ6A 2ATCB 3CO0P 5ETLA 3ZTOA 4PPDA 2B43A 1YJRA 3GILA 3BDEA 3T3FA 5RUBA 2MQMA 1AUDA 4X84A 3T1YF 2VG5A 1UL3A 4B3MF 2HHUA 1IXKA 3BBFA 4CM0A 1IJEB 1HQ2A 2CQBA 1AT1B 4RW4B 3FCVA 3SBMA 1HQEB 3M8QA 3V6HA 2Y1RI 2F9JA 1TVRB 4WFBQ 4ZLPA 2EK6A 1NHUA 3GV8B 2GO9A 3W60A 3P6YC 1I6JA 2YQ0A 2R2RA 2XEXA 2D69A 2EFGA 1K44A 1URNA 1Q1KA 4DZ6A 3BKUA 2IMWP 4WXOA 5KFFA 4P6QA 3IGNA 1SB6A 3I5AA 2VOOA 2Y8WA 4QR2A 2B4VA 4OJ3A 3RB6A 3DRPA 4CLTA 3SCIE 5HLFB 1RQ0A 2B8PA 2UXDJ 2B9EA 4C8LA 2QV6A 1S7IA 2QLBB 1B64A 2GC8A 2IJNA 2OPQA 2VA3A 4MKYA 3FBFA 5DG7A 1S9FA 5AE3A 1FDDA 2AU0A 1KQFB 4Q2LA 2DGVA 4HHHA 4LFAJ 4RNHA 3OW2R 3N28A 5LMUJ 1JIHA 4MYUA 1YKWA 3U02A 2YTCA 1UFKA 3NAHA 2K3KA 3GJQB 1IBLF 3AHPA 2FZKB 4ZA1A 1R3NA 1WHVA 4C0BA 1YWXA 4GVBA 4DV1F 3MM7B 5IXUA 2ZBIA 2ADBA 1TK5A 4CH7A 4G6VB 1HA1A 1XTZA 1UEVA 4C0OC 3R1HA 3GR0A 2R8JA 9ATCB 3OR2B 1HKAA 3DGPA 1N5VA 5DDPC 3DOLA 4YR2A 2F4VF 4FXDA 2DHGA 5GADI 1U6BA 3WIVA 5CABA 5IWAJ 3LF0A 2WONA 3ZZZA 4DR2J 3D7SB 4HLBA 3KHRA 1BQXA 2H9ZA 3CMAS 4N77A 4BHQA 3IN5A 4WIQA 3JTOA 3G96A 4USUA 1RT1A 4DBQA 2XULA 3EGZA 1WG4A 2QRRA 2ROGA 3BR9A 5AE1A 4F4AA 1CQMA 2AX1A 2R2TA 3E01A 1K0TA 3I0RB 2BR0A 2AEFA 3H25A 1JLGB 3CWJA 3KG0A 3CT9A 5B7WA 2JH3A 4G1IA 2PIIA 5KTQA 4ED3A 2XZTB 3EGVA 1UEUA 2IYIA 2D7SA 3PEJA 5C25B 1N34F 4C7QA 1XMOJ 3CXCR 2FJWA 2IA6A 2Z4PA 3WQPA 4ANCA 1HNXF 1NKCA 3TR5A 1ROFA 2N4CA 1GEHA 3LGHA 2AHOB 2P5VA 1WOPA 1R0AA 2V8HA 4AE5A 4ED8A 1WEZA 4USHA 3UD5A 3CF5Q 3I55S 1XNRF 1HHSA 1LEOA 2VJUA 4W98A 1SCJB 3I5BA 4PG8A 2LDYA 3TARA 2R7VA 3T1YJ 3MM5A 1MG7A 4FNHA 3M32B 3BZQA 5MAOA 4XDDA 3NNHA 3M7VA 4G1QB 3I9V9 5DQHA 3W2VB 1S9EB 1V3SA 4ZHRA 7FDRA 2C3UA 4JV5F 5FLXY 4B9VA 4M8LA 4XDCA 1P9YA 1NDCA 4CRJA 3PVXA 3QT8A 2OMLA 3FDSA 3PX6A 3A12A 1U1KA 5H9FJ 1TL3A 3HCXA 2XS2A 4NYZA 1EB0A 3WX8A 5HP1B 2V4RA 3KNAA 1Z2ZA 2KO1A 2BJDA 4KHRA 3UFCX 2HZAA 2PEBA 3ZTQA 2KT3A 2FZGB 1NH8A 1H7XA 1G3OA 1Q4RA 3VAHA 1XR6A 1LK7A 1C1BA 4YUDA 3R1LA 1UW4A 1BQMB 1ZPVA 2RQ4A 4DFMA 5HN0A 4NA2A 3T6BA 2HPUA 4JI4J 4HH0A 2QIFA 4PQUA 5ETVA 1DTQB 5DDRC 3DFEA 2N7CA 1QSSA 4OZ0A 5ETTA 3P96A 4LMZA 2UU9F 3ZXWA 3NS7B 3ZTPA 2Q3PA 3M2VB 2XBPA 3KUHA 2DJWA 3RW7A 2BANB 2W1BA 3RBDA 4HH1A 1BWVA 5DZ6A 2RSQA 4DV1J 2WTFA 1D9FA 4UW2A 3D28A 1X5OA 1U6ZA 4K2XA 3F44A 1ZOTA 1BXNA 4Q8FA 1Y3KA 1N4LA 5KG6A 4A47A 5A8KA 2L9WA 2F4VJ 5DLFA 1XIQA 2DXEA 3LA0A 5J2PA 4NXMF 2ALZA 1NHVA 8RUCA 1RT3B 4ZVOB 3HZGA 2RNEA 2PC6A 1WHXA 2XY7A 3L3CA 1VOMA 1D8ZA 3CC7S 3H5SA 1SC4B 2ZH6A 2HHHF 2LEAA 3C66A 3PG9A 4IFVB 4TQRA 1VRUB 3W3SA 3T1AA 1CJVA 4DV0F 4H4KA 2KT5A 1RSCA 4P2XA 3SIPB 4DOZA 2HG4A 3LP1B 2J8AA 4PYDA 2XMMA 3IP0A 2WVBA 2KU7A 2PI4A 1HNWF 4PUOB 2LQ8A 5KFLA 4ECVA 1N34J 3BR8A 5CD4H 1M5VC 2G2ZA 3H7HB 1WTBA 1BC6A 4N56A 2VFUA 3ISZA 3ZZUA 3ITHB 2RT3A 3A8KA 2DGTA 3A8IA 5DS7A 4F3OA 5KFGA 1UJ6A 5G4DA 4CP5A 2ZOFA 1JLAB 2JJ4D 4DV2F 2J5AA 1T05A 1ULRA 3VQSA 4FN5A 2HQGA 1JJHA 2MQ8A 1D8YA 4NCAA 1B99A 4KHPF 3B54A 4C48A 4CYUA 2R7WA 1TUGB 2AJ1A 1P8GA 2VFRA 5KAKA 4DMZA 2LEPA 2WB1D 3T5HA 3M30A 5HVHA 1NSQA 3KLGA 4LIRA 3HSZA 4DF8A 1RXOB 2CQIA 4IRKA 1VRQC 2M2BA 3JQMA 2C2DA 3W5YA 1FK9B 3KLEA 2Z30B 4YY3J 1B70B 1JLQA 3M2RA 4P74A 5C42A 3D68A 2HEKA 5IV3A 2LU1A 3IXQA 1GMWD 3GU0A 2WK4A 3G6XA 3B6BA 4MKVA 4DU7A 2OP5A 2CAJA 2CZVC 1YRTA 3OL6A 1OYEA 4B3OA 4K2JA 2R7XA 4KO0B 3AXMA 2IDLA 1S1XB 1XMBA 1VQ4S 4DXLA 5GMEA 2FHKA 2HZCA 4W92B 1HWIA 1VGYA 4O3RA 2RF2B 4O23A 2VG7A 3D0HE 3DRRA 1CC8A 3MF5A 1KFDA 2DEIA 1IBCB 2RS8A 3GIIA 4ES1A 4I2QB 2R7UA 1LW2A 5G0RB 2GVZB 2KKHA 4ANEA 3BBBA 3N6MA 3K2YA 5I42B 4HKQA 3NGUA 1N6QB 1UVLA 4F67A 1YJ9S 1SC3B 1DTTA 2EXUA 3TX0A 3TO8A 4WZQA 5J2QA 2ZEJA 4P71A 2ZBQA 1R89A 6FD1A 3M8RA 1VJWA 5AXNA 2MYFA 2XSJA 4NPOA 3SV3A 5DM7Q 1TUVA 4R8UB 4KQZA 4YN3B 2VICA 1PAUB 1SXLA 2QLFB 5KG7A 1S77D 1C1CA 4NLPA 3RAQA 1U24A 1X0FA 2Q6BA 4QWBA 4UOFA 3UE2A 2HFVA 2DHHA 3FUYA 5B0DA 4X66F 1G7CB 1Z1ZA 3R7BB 5K8MA 2ZWPA 3UVJA 1GTEA 1SKUB 1C0TB 3V2UC 2GMJA 2F5GA 4NZ7A 2I5JA 4DV0J 1Y11A 4TU9A 3QT6A 5IC4B 2MGZA 2C1EB 3LAKA 4J7CA 3ZFVA 3BGRB 3OTCA 2RQCA 1RBOB 2J0QD 1R6YA 2Z0GA 2HLUA 4F50A 1S76D 3NOGA 2FYXA 3DLLQ 2YPZA 5A0YB 3I9ZA 2ROEA 3UNYA 2JRSA 3TP2A 4B9TA 4FYVB 4A8OA 2LEBA 3THTA 2DRBA 2LFVA 5IQ6A 1N36J 1E6VA 2HNDB 4PYAA 5E3AA 4UOHA 3S6EA 4K4UA 3PM9A 2I9SA 2DTJA 1XWLA 4RW9A 2NSBA 2MKJA 3TUZC 1RHQB 4L3NA 2J6TA 2QN6B 4DV2J 4DV7F 2FVRA 3GSDA 4KE5A 2N7YA 5D0RA 4CDIA 2MSSA 4MAKA 2Y8YA 4ED5A 4KHPJ 2LMIA 3HO1A 3KFWX 4CLUA 2DD8S 3AD8C 4OHVA 4I67A 1RT2B 2I0XA 1VQSA 5KT3A 3JTNA 3IR7B 3HVAA 5F8IA 2VBYA 1A9NB 3V5RA 1KEKA 1QAXA 2ASDA 1U26A 4LJMA 4RUAA 3EPGA 2GVDB 1HPZA 3C15A 3H2LA 1B7FA 3MPUB 4DLEA 3SSSA 3B4DA 5CZVA 3O1LA 2E5LF 3GPAA 4UY85 2E5HA 3CCQS 3FZBA 2E5JA 1VFJA 4LVOP 5DG9A 4B9MA 3OPKA 4NCGB 4QU7A 4ES2A 2M0GB 1DARA 1VK8A 3SDEA 2VHGA 2WOMB 1AXQA 5AE2A 4DFJA 4DQQA 2C2ZB 4IG0A 1DFDA 3KDOA 2JNJA 2ZVSA 4ED0A 1UPPA 1V5IB 3DOMB 4UT4A 2DH7A 4LF7F 3D0IE 1D1UA 3KJQB 1YZ6A 2BEFA 4OHYA 1NO8A 3QAEA 1RI7A 3EZOA 4Y2MA 4DCJB 1HIYA 4CZCA 3CPWR 3TVKA 1KTVA 1RTDB 2DXFA 5KG2A 2J7WA 2ABYA 1SH3A 4CTAB 2BRLA 1TMMA 4YP3A 3SFGA 2VG5B 1UAWA 3OL7A 5F0UA 4C11A 3FRYA 1IM6A 1YJNS 4ED4A 2LCWA 4LR8A 2BA9A 1QUPA 4IQMA 2EFPA 2UVRA 2OH2A 4HEA9 2QSWA 5DETA 3DRSB 5K8OA 2ZZNA 2H4YB 4FS2A 3E8OA 4BWMA 1QSLA 1WTFA 5KT4A 2Y0SD 3J81U 1PBUA 3R6GB 2PMZD 2JVOA 4USMA 3QSYB 4P9SA 4MK8A 2Z2ZA 4KPYA 4ED2A 4DR7F 5F8GA 3SEOA 4IH5A 1VS3A 2RHSB 2QMWA 5D0EA 5GMKa 2IRYA 4K4VA 2GW8A 3BSAA 3EZUA 1NLKL 3IBFB 2OPQB 4WBFA 3Q8QB 1PG5B 2ZITA 4AFFA 3ICLA 1IKWB 1NEEA 4C9DA 1KLMB 2OLWA 1RAHB 3OXFA 3QIPB 3IRXA 4OV1A 3GV5B 2OEMA 3IM9A 2J0XA 1YG0A 1CJKA 2CZ9A 2YNFA 3JAMY 3BPDA 1DQAA 1CJTB 2HBZB 2VONA 4NEYA 2OTLS 3G82B 4J9RA 3RRKA 4H4MB 5KFCA 2ZH9A 2E9ZA 3PY8A 4DCPB 3DU5A 4QR1A 4CLLA 1RTHB 4ANDA 5GAHU 2BJ3A 1N5SA 3S8SA 4N76A 2HNYB 5T41A 2MQPA 2VG6B 4WFZA 1YGYA 1CULA 1PBAA 3V6DA 3EGWB 4DQPA 1MU2A 4NYOA 4GO5X 1S1TB 1WOOA 4NA1A 1M90T 3KK1A 1WSVA 5FD1A 1HHTP 3IBCB 1HBUB 3VAGA 4ZVTB 2B5JA 2FVCA 2W9BB 4X65J 4KC5A 2H5IB 3DXBA 4YHHJ 2ZH1A 1SV5B 4CWBA 2Z58B 2E66A 3HFKA 3KXDA 2OHDA 5AXKA 3F56A 5ETRA 1PKUA 3IWLA 1N0VC 2UZAA 3HLUA 2XMVA 4Q2MA 2RDJA 4LRFA 4DL3A 2AYBA 3EXCX 2OPRB 4LF7J 3CJ2A 4TY8A 2ZWOA 4PWUA 1WI6A 2PD1A 4KRWA 1SC6A 1N52B 3TQEA 1S9GA 4JOUA 2RS2A 3Q8PB 2R7QA 5LJ3Y 4W4MA 4OX6A 1UETA 2BM1A 2RQKA 3NLCA 5L1JA 3J81j 1KRPA 2NZ4A 2J9EA 2V4JA 3LPEA 2UXCF 3C3LA 2HIYA 4QWAA 4J9OA 2OKQA 4PR6A 3KKFA 4N41A 4NE9C 2NUUG 3I32A 3MM5B 2H5EA 3VALA 3X3UA 3MFIA 5CYMB 1JWWA 3H5XA 4RW6B 2JC1A 4O3SA 4MKBA 4ZVQB 1WC6A 2VC0A 3R8YA 8AT1B 5AJ3J 4A4JA 2IYGA 3NGDA 3CD6S 1H6KX 2DITA 2E9RX 1Q8IA 4U95A 1GTHA 1C4AA 2ZH5A 2X1AA 1U1OA 4RBVA 4EGLA 4Q44A 4KIAA 5F8JA 2UUBF 2YWFA 1O0PA 2VV5A 1I94F 3TVZA 4DLGA 5F8LA 2DNKA 2FVSA 4HL9A 5GMDA 2BW7A 1XBWA 1SJRA 1FESA 1NSAA 1RB0A 3EPIA 3WDOA 1BQNA 1U0HA 4RBTA 1KHVA 2HAIA 2AJ0A 1MLAA 3ILJA 2EEYA 3OSPA 1VQKS 2QYCA 1SIZA 3GG1A 4PQUB 4MT1A 2Q66A 2MKKA 4J9KA 1FI4A 4ZVEA 2M8DB 2DH8A 4FF1A 2H1YA 1CSJA 3AA9A 4LF4J 2LA6A 2YKQA 1RT7A 3Q89A 2W2PP 1R6VA 2N82B 2Z57B 1TAQA 1NKEA 3UQSA 4GKKF 3BYPA 4WYWA 3L7PA 2LECA 2ZHAA 4OL8A 3CSKA 4CIOA 1X9SA 3D1OA 4LSNA 3TEGA 2HQDA 5HVFA 1GMVA 2DCLA 1X60A 3TNVA 4Y28C 3GTYX 1TL5A 1TMJA 3UD3P 1EKSA 3QLHA 4JBCA 2HRTA 2AMCB 1YIJS 3RGIA 3M8ZA 1T8EA 5A8RB 1XC9A 2EG1A 5FDLB 2UV8G 1AUSL 2DGSA 5E2QA 2JX2A 4K4YA 1Q0NA 3MM9A 2RUGA 3AJ1A 3Q0AA 4AD6A 2OPSB 5KFPA 3MM8A 4NWBA 1SUQB 2POKA 2JC0A 1WF0A 1Y3JA 1R7IA 5FIIA 1HARA 1NK4A 1S4FA 2EFQA 1OMSA 3K5NA 2Q43A 2KZMA 4F26A 5LL6d 1RLCL 2G2OA 2QA4S 2J8SA 5EDWA 2HHSA 1DLOB 1DHMA 5THWA 4E2FB 2KG0A 4ILMA 2HMIA 3S01A 2BKNA 1VQMS 3JSMB 2HK3A 2AGPA 4DV3J 3OXGA 2E7XA 2CWKA 3JTPA 1ZS6A 4RPFA 2HQCA 1X31C 1AW0A 2FQQB 3I0SA 5E33A 5B0CA 1NDKA 3AJ2A 1T7PA 2ZE2A 4ZPCA 2EFVA 3CJ8A 2DGWA 4YQWA 2R4FA 4PWDB 3T5KA 2HNZA 1X4GA 3C19A 3M2UA 3T41A 1IJFB 3CDBA 3G6ES 4Q0BA 1WC4A 3MEEB 1LXNA 3VGTA 3IA0A 2F7VA 2DY1A 4OYXA 3VAJA 3V81B 4MIBA 3PW2A 3MEGA 2VB6A 3TJAA 1NDLA 4Z2XA 2EPIA 3PHEA 4J9UE 3MM6A 4FVMA 4IR9A 4WF9Q 3EX7B 2HVEA 4JI2F 3GB0A 4CO2A 2IVYA 3R5GA 1Y0HA 2XC9A 4NRUA 1JLQB 1X4HA 4B9NA 5C42B 2FGOA 5IM0B 4CM2A 3GCXP 3KJNB 2R8GA 1CJUA 4NMLA 2CVEA 3CDUA 4TU8A 1VK3A 1UWBA 3D3CJ 4HDGA 4LSLA 1IKXB 2E1RA 1SIWB 3C14B 4DJBA 2HLTA 4CNYA 4OJHA 3D9BA 2XYGB 4RW8A 3TQ1A 1JJ2R 4BS2A 2E1CA 3DRRB 3HHLA 3OFHA 1RAIB 3DC2A 3R7SB 4LF9J 4JV1A 5KOXA 1M0SA 2R2SA 1SKWA 2FPHX 3H2UB 3KLFB 5C2CA 4DV5F 3P8BB 3D1QA 4ICLB 4RW4A 3NCRA 1HQEA 1YJWS 1TVRA 4OFZA 3KUEA 4OHWA 2BDPA 4ZCMA 2M8HA 1FHTA 1OS5A 5IFMA 2HS0A 2CQPA 2GQ2A 2F40A 3PKMA 2CWXA 2RU3A 2AJ2A 5IOLA 1D09B 3DDIA 5HLFA 3EVOA 3QT5A 4J9NA 5A6PA 4DSLA 3K7RA 2DNYA 4ZP7A 3H90A 2V9WA 1YJVA 2PEHA 2YKOA 1RADB 3RYLA 2KFZA 4ED6A 3C46A 1XNQF 2ZM6F 4M5HA 5B0AA 1MMDA 3Q24A 2IM3A 5K14B 3UI3A 1G1XA 3K5LA 4OMFG 3AODA 1MWYA 3C6UB 1T03B 2WSEC 1FVSA 2SXLA 3HHEA 4AL7A 4OZ3A 3H42A 5DDQC 3NXZA 1I51B 4LSZB 2VOPA 3MM7A 2B8QA 2G0JA 3Q8UA 3H98A 2CRLA 3FBCA 4IQXA 3RTVA 1FFSB 1J5OB 1S49A 1FT8A 4DX8H 3VGSA 2PSZA 4J9QA 2HYIB 2FY1A 1UVIA 2YWKA 2WSCC 2W7OA 4O0IA 2I38A 3OR2A 2MZ1A 4LF8J 4IH6A 3H2VE 1NJYA 1AFJA 4DHVA 4YMEA 2YNHB 2AJFE 2X3GA 4ZVUB 3SQOP 2QZ8A 2HVHA 3IBWA 3UCZP 4AL5A 4GC6A 2Z2LA 4PXEA 3ETMA 3KG1A 1TK8A 1FKAF 2OJ3A 1RKJA 4B3SF 2BVZA 4DZDA 3Q2SC 5ETPA 4NI2B 2FGCA 1MW7A 3QGGA 1SI9A 5KFKA 3F0NA 1U1NA 4IKAA 3K8VA 3A8JA 3D6TB 3I0RA 3OTBA 4JI2J 1V6HA 3DM2B 5C5JA 3RZAA 1ZTWA 2D1CA 1JLGA 2H5JB 4IH7A 2XS7A 2IY5B 2KVIA 2CPEA 4ENOA 1HI0P 5T14A 1HYSB 2MY8A 1H2TZ 4QIVA 1UP1A 5C25A 1S1WB 4CH0S 3JS9A 2DVIA 2ILZA 1X5TA 4YS2A 5HQLA 2O5DA 5KFMA 3M6UA 1QVGR 5BYQA 4WFXA 3CVKA 2UP1A 3Q8VA 4IG0B 3NCPA 4DPOA 1WG1A 2ZH7A 4X62J 4Y2IA 4OIXA 2VF3A 3IAS9 3KJVB 5F8MA 4EZ6A 2CPDA 3AD9C 4UQTA 5E3CA 2C42A 3TA2A 2WVFA 1TELA 4Y3CA 1WG5A 3M32A 3MMCB 4PQAA 2PDAA 5LMNF 1OIAA 4G1QA 2VH7A 3DCAA 5KFTA 3W2VA 1VC5A 2NREA 1VRTB 1X4FA 4UZBA 4ES3A 3CDEA 3N5BA 4NLGA 1ZM4A 4DSIA 2F8EX 1RWXB 1X4AA 3OJSA 4Y0FA 5HP1A 3MTJA 3P5TL 4P7VA 1NK9A 3J7YU 1H2VZ 2BKPA 4WP8A 2ZH2A 4B3TF 1KTQA 1JLFB 2VDIA 2VPXB 3ZZOA 1U0SA 1BQMA 2QGFB 2A2CA 4OYMA 5HMXA 4KFBB 1XNQJ 4RJVA 3NWRA 1RWUA 2FHMA 1AA1B 4HYKA 1DTQA 2NXNA 4M1KA 2YVSA 4PXDA 1C0UB 2F1FA 3BGFA 3P49B 2KJVA 4OQJA 2VFVA 3IGVA 4DUYF 1S12A 4ZPBA 2VPZB 3NGRA 3K8WA 5B0EA 3R7NB 3M2VA 1RK8A 3D6FB 1HW8A 2BANA 1NM2A 3IRXB 4X4UA 3TUPA 1RJJA 3GYNA 1VQPS 2M4MA 2WBRA 5HI7A 5M2PA 2FLLA 4EI2A 3H4BA 1T0TV 3FSYA 2L3MA 4DX6A 1NAQA 3A13A 4P52A 1P9QC 1NXIA 2BOPA 2MQNA 4K7QA 3OD2A 4FF2A 2GFFA 4JI7F 1IKYB 4ZCLA 1TAUA 1HQUB 1OPZA 2Q1LA 2BKOA 5M2RA 3RRGA 2L48A 4QIWD 2P9CA 1RACB 5F9NA 3NAIA 1RT3A 2W8LA 4DUZF 3EVMA 3KK3B 1F3FA 1ELOA 3DLGB 2C2KB 1U48A 2CXEA 2A10A 1WHYA 4F2SA 1S48A 2VKRA 1PJ6A 4N5SA 3H8YA 4IRCA 2O1PA 3MCSA 3A1YG 4YR3A 1ZAWA 1VRUA 4K4SA 1FJEB 2QYGA 1WC0A 3D2WA 3KK1B 2H65B 4OX9F 1O5JA 2HGNA 2CJKA 1BMQB 3BKFA 3W1YC 2HVIA 2VQFJ 2CPYA 3LP1A 3PHTA 5KFAA 1S6QB 2ZBCA 4WFNQ 5CD4A 1WKJA 1ZETA 4PUOA 4EO8A 2L08A 3FEYB 3ETOA 4ZLLA 1Q95G 4TY9A 3R9LA 1IKVB 2GQCA 4FDFA 3JSBA 2HFSA 2YNIB 3M4XA 1P1TA 2PT0A 1KWMA 3ITHA 4MKAA 2NUHA 3LP0B 1LKZA 4ID8A 2XCAA 2G13A 1Y9OA 4Z7YA 4UOGA 3LW5C 2F8HA 1RCOB 2R8HA 2KXFA 1JLAA 4DR3J 3CMES 1S4EA 2HWHA 2VUGA 1JLCA 3ILOA 3HP6A 2W24A 1N32F 1KQKA 3I6PA 4RU2A 4I1TA 3O44A 1WEXA 4TLRA 5GAGU 1RU1A 4USKA 5C2GA 1R0BG 5K8NA 4PWWA 5JMNA 2GHPA 1NCLA 1S57A 2QC3A 1BGXT 2XTJP 2HW3A 1F9HA 3PCOB 1PJ7A 1YJUA 4DR4J 1FK9A 1PIEA 3NS6A 4DUTA 3ELHA 3BGLA 4LF2A 2MQLA 3M9MB 1HR0F 4DSKA 3DMJA 5A2QY 1TP7A 2AYEA 3LAMA 3SCKE 3GWCA 1JK9B 3PRBA 3HI9A 1AB8A 4AXIA 4KO0A 3LALA 2CQDA 1MMNA 1T9TA 1VBKA 2K2PA 5KG5A 2M9KA 4DQIA 4L74A 4C3KA 3BSOA 2RF2A 1U8SA 1U0HB 2KFYA 5H9FK 2NCKL 3UDCA 2GIFA 2HKEA 4I2QA 2BE9B 4I68A 3SCLE 5G0RA 2GVZA 3MCOA 2W01A 3HHNB 1N6QA 3FVYA 1FTRA 1F1BB 5FLXU 3CJRA 3CMQA 2CNOB 1QM9A 3CCTA 2RAQA 4OYOA 1T9UA 3W63A 4TXSA 5CYQB 1NB2A 4OJGA 2ZC4A 4O3QA 3QFWA 1NKBA 1WC1A 2MMYA 4LF6J 2D9PA 4R8UA 2LQBA 1NPPA 1U4BA 2CQ1A 2XWXA 3OQ2A 4ZOSA 2DNZA 4B9SA 1SJ4P 2XLJA 4HHJA 4F36A 4QCLA 3EYZA 1RT6B 1RHMB 1YQHA 1RA6A 1UPMB 4QW8A 1B0PA 5ETOA 1HNZJ 5CHCB 3PX0A 4RLEA 1C0TA 1JJCB 4DV4J 2LQ5A 5B09A 3I96A 3PEHA 2VQEF 4F4XA 5HO4A 2N4DA 2WCXA 3PX4A 4X4RA 4HHUA 3LWMA 3LANA 3TAPA 4LREA 1XMQF 1R31A 5J2MB 5IT4A 3TI0A 3BGRA 1T11A 1NUEA 2G1DA 4FYDA 4IR1A 1BUXA 1CG2A 1S0OA 2KI2A 2AX0A 1K1SA 4F0HA 4K8RA 1U8WA 4K0KF 2AGQA 2LDIA 3FKBA 2HNDA 3R3TA 1JX4A 4JI0F 3D3BJ 1X9MA 4QIGA 1VQ8S 3Q8SB 2BZ2A 2J0SD 3TZWA 4U96A 3BREA 3MMBB 1WOSA 2AT1B 1ZYQA 2OIHA 3KLVA 4PPZA 3Q8YA 4WK1A 3QBCA 4IRDA 2B9YA 1LFWA 4B17A 4Q8EA 3GQCA 4WU3A 3Q2TC 3RJMB 1RT2A 2RJZA 1SJFA 2KJWA 2IVFB 3OV7A 3TYTA 3SYZA 1CLFA 2VU5A 5BYSA 3ILLA 4KR0B 3OLBA 1QAJA 2QEXS 2GVDA 1QE1B 2K3IA 1Q81T 1HR0J 1Y00A 3BYRA 1NPKA 3V6KA 3RG6A 1NSPA 4CLZA 3MEGB 4KGVB 1EARA 4PABA 1VBZA 3HD1A 3QYYA 2J0WA 3NY0A 4NCGA 1X9WA 2J9CA 2B7CB 3TZXA 1FDAA 4O44B 1KOOA 1QAYA 2PFDA 3LO3A 3VCDA 1FA0A 1NK0A 1HL6A 3N0VA 4K50A 3K89A 2GAGC 2HBRB 1NJZA 3E3XA 4OI0A 3EM1A 1S6UA 1X4EA 3ZZPA 2WW8A 3KYLA 2FDNA 1JLBB 3DOMA 4J9MA 2UUTA 2IBKA 3GLJA 4PAAA 2P8IA 4TQSA 3RRHA 2DPJA 3KMQA 2F63A 2QT7A 1T9WA 1F2GA 2MB0B 4Y00A 1I1GA 4A8XA 4MFBB 4FF4A 2N3LA 4WCEQ 1EQMA 4CTAA 1QAIA 4R0EA 2UXBJ 1SH2A 1U25A 3VF0B 4K4XA 2DHXA 4BCAA 1RAOA 3CCWA 5J1EA 5DRKA 1E6YB 4G65A 3CJ0A 1GFWB 4ZKAA 1HLWA 3DRSA 2AZ3A 2J9DA 2DR5A 5LJ5Y 4I0WA 2W2QP 3K5OA 4CLYA 1VJQA 3SQGB 4GKJJ 2QFIA 1Q7LB 4RZRA 4EO6A 2GNKA 2VQEJ 5DLGA 4MTPA 4P7TA 2ERRA 2KYZA 5ETQA 3QWUA 1T95A 2IFXA 3THVA 1MSWD 1ZH5A 2FJVA 4DL7A 5ETMA 3J7A1 3G8QA 4CLWA 4OZJA 1DAXA 4L3KA 1T9YA 2EFOA 3VAKA 2UUWA 3K0JA 5EN1A 1H38A 3A3OB 2AGOA 3DLEB 4ZCKA 1KC8T 1IKWA 1WD6A 1S1VB 2M88A 1KLMA 3QIPA 1C4CA 2W7PA 4K0KJ 1BLUA 4DV6J 3EE3A 4OJ1A 1ZTTA 5E7OB 1FDNA 1CJTA 4DI6A 4FYXB 3H20A 4U67Q 4KSEB 3MR3A 2GA7A 3FBBA 4PG5A 4KPCA 3G82A 3IR6B 4OYBA 4M63A 1YRUA 2G0CA 3CNQP 3PW7A 1PJ5A 1QUVA 5EGYA 4H4MA 5AXMA 4ZLJA 3ONQA 2GAHC 3DDNA 4C4WA 1N8RT 1CEZA 2IC3B 1BHNA 4EFAC 3SFUA 1RTHA 1NK6A 2DIVA 1EP4B 2HNYA 4ILLA 3IS9B 3UDVA 4A8FA 4NLYA 2VJVA 2VG6A 1N33F 1SH0A 3NNAA 2GMHA 4OZ2A 1L3UA 1NH7A 3IO1A 2YKNA 2YQ1A 2ZD1A 1S1TA 4E0DA 2FJXA 1XR7A 1WUUA 4CO3A 1R8HA 2DO4A 1D9AA 2IM0A 1M1KT 2HHXA 5CH7B 1FRIA 1HBUA 3CD5A 4USTA 2W9BA 1UVMA 1BY9A 1JKHB 4QZVB 2FJEB 2UUCJ 1SV5A 5EUHA 1OY6A 2JHEA 4X64F 1VQLS 2JEGA 4DR1F 3CO9A 1SQEA 1DURA 1RWOB 5EHHA 3FEZA 1REVA 1SJ1A 5D8HB 4IFYB 2BQRA 1OYDA 2ADCA 4P2MA 4JI6J 5KFSA 2C3PA 3MURP 1ZAXA 1IQZA 1XQIA 2OPRA 4EBCA 3QJJA 2NZCA 3KK2A 1HW9A 2VASA 4FPIA 2W9AA 3M8PA 5H9EJ 2VFTA 3TAMB 2RHQB 3FQLA 1AYEA 2L9NA 4AQYF 3WC2A 2RRAA 4LBPA 2FHJD 4ZJOA 2W25A 1J5EF 2GHVC 1YK9A 1F60B 1FEEA 3GCWP 4B3MJ 3E51A 3LGNA 4M95A 1S99A 4J5OA 4LVNP 3BO2A 5CXTA 5CYMA 2XS5A 2Q79A 3IM8A 4RW6A 1FKOA 4JUZA 2MKIA 4I6AA 2PN6A 2DGXA 1N54B 2DNRA 5CYJA 2BE2B 3NGTA 3A3PB 2D41A 5KFUA 2I2YA 1RAJA 4LRBA 3W5ZA 3B4MA 3O2IA 2Y1IA 3VZHA 1U02A 1X4BA 3EMTA 2ZOMA 3HVRA 1YHQS 4UQGA 3IG1A 4DG1B 5T7LB 1VQNS 4P75A 4RW7B 4Z37A 2LA4A 1VHFA 2V9KA 4PKDB 4TNOA 5LSLA 3QIDA 4CLKA 2W4DA 2AEJA 2LVWA 4DSJA 4GVLA 1TKXB 5IZHA 1DQ8A 3GFZA 1KSPA 2VODA 1GXTA 1M5HA 4OLOA 5KFVA 2CPFA 3TAQA 4KAIA 2MPUA 2M52A 1IBLJ 4QYZJ 3C16B 3U7JA 2CNKB 1Y5LB 3HVWA 4USJC 3NOCA 1MN7A 3CJ3A 3QAUA 3I56S 1VBXA 5B0GA 4RNMA 2EG2A 1UWAA 3EXYA 5K5MA 4XK8C 5EX3A 1KBRA 2NYIA 3O3LA 1XK8A 4ZPDA 4F04B 3PDNA 1Q7YT 4JI1F 3CE8A 3EICA 1NK8A 2ALYB 2MEWA 2BRKA 1N5YB 4NLOA 3ZZTA 2LQ9A 3H4DA 4JV2A 4Y2CA 5A8RA 2VFSA 2Z8QA 3BH6B 2CPJA 5FDLA 3THPA 3TEHB 4H4KC 2CQ2A 1LW0B 5DZ7A 3AB2B 1MMLA 1Q5YA 2DNMA 1S97A 2QE5A 2ZZMA 5KG3A 3R5AA 5DQGA 2A1BA 4C0HA 1H72C 3KJFB 2BQUA 2OPSA 2Z56B 4P2FA 2DISA 3GJRB 4D3HA 4ZPAA 4HT7A 1SUQA 3PYGA 3TUIC 2RUSA 1N0UA 5ITHA 1QJHA 4X64J 3M6XA 5AT1B 3JAMU 4ERDA 4L76A 4OI6A 1UVNA 2E29A 2VL1A 5BYRA 2VPYB 2XG8A 1F9FA 5HANA 1LQ9A 1RT5B 2E5IA 2CDQA 1SVDA 4FF3A 2XWYA 3ZO7A 2KH9A 1DLOA 4NLRA 4K59A 1WELA 4IO1A 1HNXJ 3HM9A 4EBDA 3JSMA 3B8HA 1SKRA 2CJQA 3D6HB 2COLA 1RWMB 2DRDA 2CJBA 5CCLA 4AQYJ 1RYSA 1XNRJ 4JI5F 2VD3A 1K1QA 5SZTA 3OHAA 4R25A 1ZA2B 2IIHA 4H54A 2UVWA 3PO4A 1J5EJ 2CNLB 4PWDA 5H1SV 3EVWA 2V8VA 1JLCB 1T3OA 1NDPA 1N88A 1YX2A 1H0HB 2B9XA 2JWNA 1ZBTA 3BBCA 3MEEA 3A3NB 4EWTA 1RKIA 3E2EA 1RUSA 4YDXA 4JV5J 1MROA 2YNGB 3V81A 5GAEU 4N8OA 3VAFA 3W8PA 2GQQA 1RAEB 1RWKB 2AJQA 2FD2A 4KJIA 2M7SA 2R3VA 2XI3A 4C8ZA 2FUG9 2RDIA 4WFYA 1SC1B 2DR8A 4YB1P 4LR7A 5IM0A 3DMJB 1V3ZA 4A8WA 1FRLA 2DIUA 3R2CJ 2XMUA 4L72B 1WI8A 3Q86A 2WBMA 1QY7A 2OEKA 1IKXA 3O8WA 2WVDA 2NSCA 3K17A 2G9OA 3C14A 1A7GE 2QFJA 4V19J 5SUHA 1KVKA 2GJ2A 2WRMA 2IDEA 2KM8C 3ZZRA 4ZP6A 3U27A 3T6JA 1RHRB 1TZ0A 4X4OA 1HBOA 3QFHA 1XJWB 3H5UA 3T1HF 1B0TA 1NSKL 3TANA 3L4BC 3DN9A 4QOTA 3RU0A 4R5PB 1FKPB 3BQ1A 1FJGF 3W7BA 2UU9J 2CG4A 4Q5VA 3MEDA 3RB3A 1WC5A 3W61A 3KLFA 1LV5A 4ID5A 3RAMA 4D3GA 2U1AA 4ICLA 2AWZA 3GFXA 1FX2A 2DK2A 5ADZA 2HHVA 4L73A 2O3DA 4WIIA 3CGIA 1H3DA 2B4OA 1UVJA 3OXLA 3KTQA 5EWGA 2VPWB 2DGQA 1KQSR 1T02A 4F2RA 1D0EA 2GX8A 3SMZA 5MLCV 2HS4A 3AQPA 2HHQA 4NXMJ 1R43A 2CA9A 4ZP9A 4OX8A 2NXJA 3PW4A 5IT9U 4TLQA 2YH0A 1VHIA 4ZPVR 4LFBF 4MK7A 3OJUA 4MK9A 3I5CA 1HBNB 1LXJA 2PA3A 2WSFC 4Q43A 3C2PA 1WHWA 4I7FB 1M5KC 5E3RA 4U7UD 4B3RF 2HHHJ 4DS4A 2NS1B 1S6PB 3MAAA 2MXYA 3C6TB 4LRDA 1RBAA 1JLEB 2G1HA 1GXLA 2H51B 3AOBA 2WW4A 1NBEB 2E44A 1OJ4A 5K14A 1D9DA 3VGVA 2D74B 4E98A 1WF2A 3OUYA 4WP3A 5D6GA 3C6UA 2XNRA 1T03A 1HNWJ 3HFZB 2HIQA 2V2VA 4DSFA 1HNVB 2V63A 4O4GB 1J5OA 4J9VA 5D4NA 4JI5J 1EJ7L 3DYAB 3R97A 2DR9A 3I4PA 2V67A 3NG8A 2MKYA 2V6AA 3VAMA 1YLXA 3BGOP 2UXDF 3MPDA 3RUBL 3US5A 1GMWA 3JYTB 2YNHA 1RBLA 2HFZA 4PXCA 4A8SA 2JZ5A 5I3PA 1UTAA 2YWGA 3MR7A 4ECUA 1XEZA 1TKTB 5L46A 4J90A 1KLNA 5LMUF 2EBGA 3TVYA 1G6BA 3OT9A 4NOHA 2RIJA 4NI2A 1OWXA 4N7TA 5HJYA
chains in the Genus database with same CATH topology
1LK7A 1C1BA 2RB7A 4YUDA 3R1LA 5E3CA 2C42A 1UW4A 3TA2A 1NNDA 1BQMB 2C3MA 4Y3CA 3HKZD 1ZPVA 2RQ4A 3N5FA 2VKZG 4YB6A 5A8KB 4DFMA 4EEYA 3RW6A 4QU6A 1K0VA 1HNVA 1WG5A 3M32A 4NA2A 5HN0A 3MMCB 5J2NA 3DM2A 4PQAA 2ZNYA 2HPUA 3T6BA 2PDAA 1UVKA 4HH0A 5GVQA 2QIFA 5LMNF 1LWEB 4O4GA 4DWIA 4PQUA 1OIAA 3OTDA 3HHLD 4I64A 5DG8A 4G1QA 2XGPA 5J2PB 2VH7A 3DCAA 5KFTA 3W2VA 1DTQB 3BS9A 5DDRC 3DFEA 5HROB 3DYAA 1U45A 2N7CA 1VC5A 2V2KA 4QYRA 5K8PA 1QSSA 1HWUA 3BQ0A 1UJ4A 2NREA 1VRTB 1X4FA 7FD1A 4ES3A 2IAJB 1BD6A 4OZ0A 4OZNA 5M2UA 1HYSA 2YH1A 2IRXA 4LMZA 3P96A 4X4NA 3I82A 3CDEA 3N5BA 3MUTP 4NLGA 3JYTA 2UU9F 5HMZA 1ZM4A 4DSIA 2F8EX 1S1WA 4CO1A 4C8ZA 1X4AA 3OJSA 4P2SA 2Q3PA 4CT9A 5HQ8A 3M2VB 4Y2AA 4Y0FA 4KB7A 5HP1A 3MTJA 2XBPA 4FS1A 1YRXA 2AD9A 3P5TL 4X4SA 4FP9A 2XLKA 4YOEA 2DJWA 1SBRA 4P7VA 3RW7A 2BANB 5L1KA 3NCQA 1TKTA 3J7YU 3RBDA 1NK9A 3PIOQ 2AYGA 3DHXA 4HH1A 1H2VZ 2XO7A 2RSQA 3GZ7A 2MKHA 4K4ZA 3K5MA 2WTFA 2IMOA 2MZRA 3MAHA 3RB4A 3CCMS 4UW2A 2MQQA 1D9FA 5IWAF 2ASYA 3QMQA 1JNRB 3D28A 2ZH2A 3CC4S 3OBIA 4B3TF 4DR2F 1WNEA 1U7LA 1X5OA 4DQRA 1KTQA 1U6ZA 5HMYA 1X8DA 3KJVA 4K2XA 3F44A 1JLFB 4AXJA 2VPXB 1IUJA 1DJ0A 1ZOTA 2NXUA 4ZMMA 4GMKA 4Q8FA 1Y3KA 3ZZOA 1JNZB 4YEAA 1YI2S 1N4LA 2EC0A 1V3RA 1BQMA 2MZJA 5KG6A 4A47A 3MR6A 2A2CA 5A8KA 5HMXA 2DBBA 4YDDB 4KFBB 2L9WA 1L3KA 3GMGA 1FNXH 3MMCA 3W2WB 4KGMA 2JLGA 5DLFA 4QPXA 1RWUA 4C8MA 2D3ZA 2FHMA 4HYKA 5J2PA 4NXMF 4YR0A 2ALZA 1DTQA 4M1KA 2HS3A 2YVSA 4PXDA 5HROA 1NHVA 1C0UB 4JI3F 2F1FA 3BGFA 5DM6Q 3KHGA 1S1UB 3P49B 2KJVA 4OQJA 1RT3B 2VFVA 1VRTA 2RNEA 3HZGA 3IGVA 5GAHI 2PC6A 4ECQA 3MAQA 4DUYF 1WHXA 2IAJA 2XY7A 4ZPBA 3L3CA 1VOMA 1FRJA 2C2EA 4ELUA 3EGNA 2DRAA 1K8AT 1D3WA 1D8ZA 3QGPA 4F4ZA 3MXHP 3CC7S 2VPZB 2HFOA 3H5SA 3K8WA 2FLOA 3MGJA 2ZH6A 4LF8F 5B0EA 1RTJB 3M2VA 2W8KA 1RK8A 2HHHF 2RRNA 5J1EB 1R8BA 1T05B 2LEAA 3C66A 2ASLA 1XMOF 1HW8A 4IFVB 2ZC3A 3ISNC 1DZ5A 1QVFR 4TQRA 1VRUB 2LYVA 2BANA 3W3SA 2AW0A 2YY3A 3IRXB 4I56A 3T1AA 5KT7A 4X4UA 1RJJA 3GYNA 4DV0F 1VQPS 4H4KA 2M4MA 2WBRA 2KT5A 5HI7A 1P27B 1Y5NB 4AUKA 5M2PA 2UUAF 2FLLA 1VIXA 3NRBA 4ETZA 3H4BA 1U1PA 4NCBA 2IHR1 4DDFA 3FSYA 2L3MA 4DOZA 2HG4A 3RB0A 3LP1B 2J8AA 1JLFA 1NAQA 2UV8A 2MHNA 2XMMA 4GC7A 4C98A 1P9QC 4ECSA 2BOPA 1U2FA 2KU7A 2PI4A 4B02A 5F8HA 1HNWF 3G9CA 4PUOB 1UA1A 3M30B 2MQNA 1JXEA 5KFLA 4ECVA 3QZ8A 2B51A 4KFBA 1DBDA 4FF2A 3KLGB 3W2WA 3BR8A 2GFFA 4J9PA 2D9OA 4JI7F 5CD4H 1IKYB 4ZCLA 1TAUA 5KFDA 4ZVHA 1M5VC 2BQ3A 4UUWA 1HQUB 1OPZA 2Q1LA 5CA5A 1WTBA 3CIZA 1VC6A 5M2RA 3RRGA 3NMRA 1BC6A 2NR0A 2HRYA 2PA8D 2L48A 3HK2A 1C0UA 3DNCA 4QIWD 4N56A 2GCFA 2P9CA 2VFUA 3ISZA 3M05A 1S1UA 3ZZUA 3KLEB 3QJPA 5F9NA 3NAIA 4X4QA 3ITHB 1RT3A 4MYTA 1RA7A 3M2RB 2W8LA 3SV4A 4DUZF 2EVZA 2RT3A 2J7KA 3OLAA 3KK3B 1VQ7S 3AAWB 2DGTA 2X1BA 5DS7A 4RNOA 1W25A 2IM2A 2ZFHA 3H59A 1ELOA 3F41A 5KFJA 3DLGB 4UUXA 1U48A 2A10A 1U09A 1PGZA 1WHYA 4F2SA 4F3OA 2MZQA 1S48A 2VKRA 5KFGA 1UJ6A 3FGVA 5G4DA 2ZOFA 1HFEL 1RTJA 3PJWA 2R8KA 4N5SA 1JLAB 3H8YA 2CQ0A 5KT5A 2JJ4D 4IRCA 2B4PA 2O1PA 3MCSA 2J5AA 3GIJA 3A1YG 4YR3A 4DV2F 1T05A 1ZAWA 3CCUS 3SZ2A 4B3OB 1PO6A 1PILA 1VRUA 2GJIA 4K4SA 1VC0A 2BABA 2GIQA 1FJEB 1ULRA 3D2WA 3VQSA 4FN5A 3KK1B 4X4VA 1JJHA 1Q78A 1RISA 3T9ZA 3L95X 1D8YA 3J81Y 3BN7A 4RWXA 3V6JA 4NCAA 5B0BA 1UKUA 4KHPF 4OX9F 1O5JA 2HGNA 2CJKA 1R8CA 6FDRA 2HVIA 4LUBA 4ECYA 2CPYA 3LP1A 5KFAA 4DL0C 1S6QB 2CPHA 2CFXA 2VG7B 2R7WA 4A8YA 2ZBCA 4NLSA 2OD4A 3CJ4A 4WFNQ 3J7ZT 4J9LA 5KFWA 2AJ1A 1P8GA 2VFRA 5KAKA 3UR0A 4X62F 4DMZA 1ZETA 2LEPA 2WB1D 3HZEA 4IDKB 4PG6A 3T5HA 4PUOA 3M30A 4EO8A 2L08A 1IQTA 1FJCA 4DFPA 3FEYB 3KLGA 2XNQA 3ETOA 5L8RC 4LIRA 4TY9A 1LW2B 5KFBA 3UWTA 1IKYA 3BM7A 1VQ6S 1IKVB 4DF8A 2CQIA 2GQCA 4IRKA 1HQUA 2OMOA 4YB5A 3FJ2A 2M2BA 5BJRA 2C2DA 1JB0C 3JSBA 4TKTA 2KM8B 1FK9B 2YNIB 2B9WA 3M4XA 2DH9A 3KLEA 4JI4F 1P1TA 2PT0A 3ITHA 1R8PA 1JLQA 3M2RA 3TW0A 1NB7A 4MKAA 5C42A 2HQIA 2NUHA 3UCGA 3KK3A 3LP0B 3GIKA 3PFEA 1DTTB 1KQGB 4EU0A 2FVQA 2J6SA 2LU1A 3DLGA 5J2QB 1YVFA 1LKZA 4ID8A 3IXQA 2XCAA 2G13A 3G6XA 1Y9OA 2WK4A 3EUNA 2ZKTA 3LW5C 3O6QA 2F8HA 4PG4A 1NRKA 3N79A 3PV8A 1O51A 2R8HA 2KXFA 2OP5A 1JLAA 5I3UB 3NKYA 2CZVC 1X4CA 1YRTA 3OL6A 3CMES 1VI7A 3N4WA 4B3OA 1RTIA 4ITSA 3HMJG 2CKWA 3FQKA 4KO0B 3J7Z5 2YKNB 1T3NA 2HFNA 2W4PA 2ZD1B 2HWHA 3LGMA 2VUGA 1JLCA 3HP6A 4U6PA 2W24A 4XPCA 1N32F 1S1XB 1KQKA 2XSJB 1XMBA 3RR8A 1VQ4S 1A6LA 5JUMA 3DLHA 2FJAB 5LSRA 2FHKA 3FMWA 2HZCA 2BUNA 3I6PA 4K4TA 1HWIA 4W92B 4RU2A 4I1TA 5JVGQ 4DS5A 1GX5A 1VGYA 2VBZA 1C1CB 3O44A 4NZ6A 2V8DA 1WEXA 2O67A 1S6QA 2RF2B 2RRBA 4PG7A 4RX6A 4O23A 4TLRA 2VG7A 3D0HE 3DRRA 1CC8A 3MF5A 1KFDA 2C3OA 1FRXA 5GAGU 2RS8A 3I87A 3ZC4A 3MPWA 3HXMA 3UDLA 4IDKA 2DT9A 5K8NA 3GIIA 4ES1A 4I2QB 4XIUA 1O8BA 1VQ9S 2R7UA 1LW2A 2GHPA 5G0RB 4F4YA 1SL2A 1IKVA 2CQHA 3K58A 2KKHA 1BGXT 2HW3A 4DN9A 3N6MA 3K2YA 4ECTA 5I42B 3LQVA 4HKQA 1N6QB 3J80Y 1REVB 1YJUA 2RU9A 3LP2B 3KMSA 1FK9A 2AV5A 2YNIA 2YX4A 3NS6A 4N47A 1UVLA 4F67A 1FNOA 3PXGa 2I5JB 3S7RA 3P3DA 1YJ9S 1H2UX 2KXHA 1LFPA 2VBWA 3LUYA 4A48A 4QPTA 3BGLA 5AXLA 1OSDA 4A8MP 3LP0A 2R9LA 2MQLA 3M9MB 1HR0F 4DSKA 3DMJA 1DTTA 2JLFA 3TO8A 4HT5A 5A2QY 2YKPA 2MGZB 1TP7A 2AYEA 5J2QA 1FXLA 4WZQA 3FCHA 3LAMA 3FMBA 4RU9A 2E5GA 3SCKE 3GWCA 4M5DB 1JK9B 2DHSA 1V9OA 3PRBA 3HI9A 1VIOA 2YX7A 5BR8F 1S7HA 1R89A 5I3UA 1S10A 3KK2B 1JJ4A 4AXIA 6FD1A 4KO0A 3M8RA 2UVUA 3LALA 3M8PB 1VJWA 3PRDA 3MWBA 2CQDA 1MMNA 1URRA 3OR1B 4C8KA 2CQGA 5AXNA 2K2PA 2APOA 2MYFA 2XSJA 4NPOA 1TFYA 3SV3A 2B4UA 4IG3B 5DM7Q 5KG5A 1TUVA 4R8UB 2M9KA 1FXRA 4KQZA 1Q8BA 3G8TA 2OFHX 3AQOA 3CUNA 4DQIA 1SXLA 4I6WA 3QZ7A 2L9DA 5KG7A 2NPIA 1S77D 4C3KA 1C1CA 4NLPA 5DO2A 3BSOA 3RAQA 2RF2A 2OSQA 1U8SA 3RR7A 1U24A 1E6VB 4F3QA 1X0FA 1FD2A 2Q6BA 2KFYA 2XB2D 5DGAA 4QWBA 2C22A 3UDCA 3UE2A 2FLNA 5B0DA 4X66F 4MMOA 1G7CB 4RW9B 4C2MA 1Z1ZA 5K8MA 2ZJRQ 2D3OR 4I2QA 4I68A 2KHCA 1GTEA 3CULA 3SCLE 2CPXA 1C0TB 5G0RA 3V2UC 2GMJA 4NZ7A 1QTMA 3HHNB 1N6QA 1M5PC 3LP2A 3FVYA 2XCPA 2KZZA 1FTRA 2QA4G 2AYMA 1X5PA 4TYAA 4QWDA 3T5LA 2I5JA 1FKOB 1S0VA 4LF5F 4F25A 4TU9A 1YBAA 1QM9A 1R8AA 2DNLA 2JLEA 3CCTA 4NLQA 3MFHA 5A6WA 2MGZA 3LAKA 2KYXA 2KTQA 2FTRA 3MOZA 4TXSA 5CYQB 3ZFVA 3ULHA 3BGRB 4M5DA 2B6AB 3N9UC 3OTCA 2RQCA 1TK0A 1FNMA 2XMTA 4OJGA 2J0QD 2ZC4A 2BXJA 2CZ4A 1R6YA 5J1NA 4O3QA 2Z0GA 2HLUA 4F50A 3T5JA 2JEFA 1S76D 1NKBA 5KFNA 3LOUA 1RYRA 3DLLQ 2MMYA 5A0YB 3I9ZA 2ROEA 3OR1A 2JRSA 3TP2A 4A46A 3BJYA 4U9RA 5E3PA 2XMKA 1TKZB 2D9PA 4IG3A 3Q22A 4B9TA 4E8UA 4R8UA 1VMBA 2LQBA 1U4BA 4NX9A 2CQ1A 4A8OA 1IR0A 2LEBA 3THTA 2V5HG 1Q86T 2EWHA 1KHWA 1Q82T 2DRBA 2DB1A 1U6FA 1RT4B 5IQ6A 4NYPA 3IG1B 1SJ3P 2XWXA 2ATLA 4LIWA 3OQ2A 3BGUA 1E6VA 2HNDB 2DNZA 1U2RA 4ZOSA 4B9SA 5E3AA 1SJ4P 1HPZB 2XLJA 4PCQA 4FZVA 3MUMP 4HHJA 3S6EA 4O3NA 4K4UA 4QCLA 3PM9A 2I9SA 4DF4A 2DTJA 3EYZA 1RT6B 2ZDOA 1XWLA 1YQHA 4RW9A 1RA6A 1OSCA 2VQFF 2NSBA 4ETXA 2MKJA 1P6TA 4QW8A 1B0PA 3TUZC 5CHCB 3PX0A 1XR5A 1C0TA 4RLEA 2F3JA 2LQ5A 2FJDB 2Y1JA 4JI8F 5B09A 1YJTA 3I96A 3PEHA 4L3NA 2VQEF 2J6TA 4G3IA 4F4XA 5HO4A 2EBEA 2N4DA 4DV7F 2WCXA 2FVRA 3GSDA 4OZLA 2MY7A 4KE5A 3JB9k 3PX4A 2N7YA 4X4RA 1WACA 3SDEB 1NU4A 3PIPQ 2MSSA 3LANA 4MAKA 3LWMA 3TAPA 5GADU 1Y4ZB 3CDAA 3MR5A 2FC8A 1MWZA 1R31A 2IVMA 3C8YA 3VAHA 1EETB 1XMQF 5CZXA 4ED5A 2FHOB 5J2MB 5IT4A 2R7OA 3TI0A 2Z2MA 4F02A 5CYQA 3PW5A 4YY3F 3BGRA 2LMIA 3HO1A 3KFWX 2A2DA 2B6AA 1LK5A 2DD8S 4LQ3A 4I67A 2GO8A 4OHVA 1RT2B 4B9UA 5LXYA 2G1DA 2I0XA 4FYDA 1VQSA 2RILA 5KT3A 2PI5A 4IR1A 3JTNA 1XN9A 3IR7B 4H4OB 3HVAA 3CDWA 3BO3A 5IQQA 3QJLA 4ZPWR 1CG2A 5F8IA 5D3GB 4MJKA 1S0OA 2VBYA 4RUCA 1TKZA 2KI2A 1A9NB 3V5RA 1KEKA 4DR3F 1FDBA 2AX0A 2VC1A 1NK7A 1RGVA 4WE1B 1K1SA 1QAXA 1F5BA 2HGLA 1RT4A 2ASDA 4K0KF 2AGQA 1U26A 2LDIA 2DGUA 4LJMA 4RUAA 1IM4A 4W90B 2HNDA 3D1HA 3R3TA 3EPGA 1JX4A 2JVRA 1HPZA 4JI0F 2KXNB 2XZWA 3H2LA 4Y6IA 3OVAA 3KLHA 2C28A 1B7FA 1X9MA 3GYXB 4EYIB 3FNNA 3CEDA 1RT6A 5U47A 4WJBA 4DLEA 3SSSA 4QIGA 4F3MA 3B4DA 5CZVA 1VQ8S 1S9EA 3Q8SB 1ZAVA 2BZ2A 3MECB 3O1LA 2J0SD 2E5LF 4UY85 2CJ9A 2E5HA 3CCQS 3BREA 3FZBA 2E5JA 3RBEA 1VFJA 3MMBB 4LVOP 2QLWA 5DG9A 4B9MA 3OPKA 4Y34A 4NCGB 4L6V3 1TKDA 4QU7A 3K57A 1ZYQA 2OIHA 4U7UK 3KLVA 4ES2A 4PPZA 2M0GB 2OTJS 3GG0A 1DARA 4XAKA 3A8EA 1FEHA 4WK1A 1VK8A 3SDEA 4C11B 2WAQD 4DR5F 2ZKUA 2WOMB 2X1GA 1ZM2A 3H5YA 5A8WB 1AXQA 4ZCIA 5AE2A 2QO3A 2ZJQQ 3POTB 2FC9A 1EETA 3MMJA 4DFJA 4IRDA 2B9YA 5J2MA 3VTIA 4DQQA 1LFWA 4DR4F 3WBZA 4B17A 4Q8EA 2YX1A 3TA1A 3GQCA 2KRRA 3BQ2A 2VBXA 4WU3A 1HWLA 3Q2TC 1KFSA 4IG0A 4ZS6A 3MUVP 1SL0A 1RT2A 1DFDA 2RJZA 2ZVSA 4ED0A 1SJFA 4H4OA 4B9LA 5I4MA 2KJWA 1Z2LA 2IVFB 3DI6B 4O4RA 4C8YA 4Q45A 5D3GA 2JFKA 3BF4A 2DH7A 3NBPB 4LF7F 3OV7A 3IWNC 3TYTA 5LT5A 2DHAA 3D0IE 3KG4A 3SYZA 1CLFA 2ZHOA 1D1UA 5BYSA 1HD1A 4KR0B 4A8QA 3UCUP 4NLUA 1NO8A 3QAEA 4WE1A 4QBUA