4E8UA

Crystal structure of arabidopsis idn2 xs domain along with a small segment of adjacent coiled-coil region
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
166
Chain Sequence
DEKLVYPWKGIVVNIPTTKAQDGRSAGESGSKLRDEYILRGFNPTRVRPLWNYLGHSGTAIVEFNKDWNGLHNGLLFDKAYTVDGHGKKDWLKKDGPKLGLYGWIARADDYNGNNIIGENLRKTGDLKTIAELTEEEARKQELLVQNLRQLVEEKKKDMKEIEELC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title INVOLVED IN DE NOVO 2-containing complex involved in RNA-directed DNA methylation in Arabidopsis.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Rna binding protein
molecule keywords Putative uncharacterized protein T8P19.180
total genus 49
structure length 166
sequence length 166
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03468 XS XS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4e8uA00
4E8UA
chains in the Genus database with same CATH superfamily
5D0HA 4KE5A 5AJ3F 2MKKA 2FY1A 4W4MA 2KH9A 4IUFA 2IC3B 2RAQA 4RPFA 3JSMB 2H5EA 1Y00A 5A6WA 2M0GB 2H48B 2WOMB 1LOUA 5DDRC 4I67A 4LF9J 1VRQC 3TVYA 4OI4A 2KRBA 2L48A 3M30A 4QW9A 2BMBA 5LJ5Y 4DX5A 2E5LF 3SDEA 3EZOA 4BDPA 3I0SB 3CCTA 4DV6F 3CDBA 4ED4A 5L1KA 3ENVA 4ZIWA 5L46A 1VRTB 5H9FK 3PRVA 1VLYA 2IHR1 5ETSA 1I94J 2Z2YB 1DY3A 2V4JB 2EBEA 3C46A 4JI3F 2R7TA 1FKPA 4QOTA 1WKKA 2AEFA 1REGX 4U7UK 3IWNC 2B6AB 1DFDA 4CYUB 2RD5C 4WBFA 2WCXA 5KFIA 4ELUA 3DM2A 2WW4A 3TA0A 1NB7A 1XR5A 2PD1A 1U1QA 3IMQJ 3T9NA 2F9DA 2APOA 4LBPA 1UAWA 1N5VA 2E5HA 1NK8A 4NRTA 1Q0NA 4EYHB 1UJ6A 1XR7A 2VQFF 5KFNA 3PKYA 1B99A 3T5JA 4NWBA 1LXNA 3DRSA 3NCPA 4PWUA 3KK3A 4FF1A 1RAJA 1PJ5A 1OMSA 1Z1ZA 1FRLA 2E9RX 2FVPA 3NP5A 2DNRA 3G96A 8RUCA 4P75A 1HI1A 3DNCA 4XDCA 2QC3A 4E0DA 3UNYA 2GHVC 2HZVA 4ILMA 3G8QA 3R97A 1U2CA 3ITHA 3M32B 4C4WA 4TU9A 1R3NA 2GNKA 4YR3A 1GXLA 1WC3A 3JQMA 5DM7Q 3HSDA 1UZDA 3UCGA 1H98A 2XWYA 1ZS6A 2FJBB 2W25A 4YY3F 2AYBA 2HVEA 4C7QA 5C2CA 3EMTA 1NJZA 3GQCA 1HI8A 3DU6A 1GX6A 1LK7A 2R8IA 4DUTA 1PBAA 2IA6A 3C14A 3AODA 1IBCB 1IBMF 3Q8RB 4ES1A 3VGUA 4JI6F 1EP4A 1VGYA 2CJ9A 2V68A 4UOHA 4BBYA 4CLYA 1A9NB 3PR5B 1RAEB 3KLHB 1RWNB 1VQYA 4QIWD 3V6JA 4ZVOB 1U6BA 3ZZRA 2YNGA 2WSCC 2Z2MA 3DCAA 2I9SA 1Y5IB 4USJC 2MSSA 2I1RA 3CD7A 3O5TB 4K8RA 4LF2A 2BA9A 3KLGA 1T7PA 2Z58B 2FLPA 1EARA 4WP9A 4NZ7A 1KOOA 3CDWA 2DR5A 4OLPA 1HI0P 1R6VA 5D0GA 3MM6A 3RZAA 2UVUA 2RQCA 1ELOA 1JNZB 3LGHA 3R1HA 3I31A 1AW0A 2FHJD 5LOQA 2BQ3A 1VQSA 1G3OA 3OTBA 1RE1B 1P1TA 1RAFB 2J9EA 1IKVA 1Q8BA 2W8KA 3CPWR 2HLUA 4RLEA 4YHHJ 2AYGA 2J6SA 2ALYB 2HNZB 4C3KA 3FMBA 4PXCA 3CJKB 3A4TA 1HBMA 3HT3A 3K5OA 5LMUJ 1WOPA 4LFCJ 3LH2S 1GQEA 5SUHA 4UZBA 3KTQA 2W1BA 3MPWA 4I2PA 1QSSA 1DLOB 3AT1B 4NCGA 2BRKA 4OV6A 5M2PA 1U6FA 4MH8A 3MR2A 2JC1A 2MZTA 3THVA 3MEDA 2UUBJ 4HKQA 1URRA 4DG1A 1HNVB 1YRUA 2XHWA 5IT4A 1WG1A 2GIRA 3UDCA 3CO0P 3MM5A 1SI9A 2QMWA 3D6MB 2VDHA 3NRBA 1ZOTA 2BUNA 4ZLNA 1RU2A 4JI2J 2V0NA 2VV5A 5CYJA 1TUGB 1JLQB 1JKHA 1TKTB 1MU2B 2NXEA 3CCWA 5F8IA 3I5AA 3H5YA 1W26A 1FFWB 2HHPA 4I64A 3Q23A 4FYDA 2CQGA 3HHLD 3TVZA 2AZ1A 5HQMA 1RTDA 1SCJB 5KFDA 1K73T 3HHDA 3K5MA 1UL3A 3DRRA 4OX9J 1M1GA 4KKOA 1HA1A 2P6SA 2QA2A 1S72S 1QAYA 3M6XA 3M05A 4YN3B 4IR1A 2X1BA 2PSZA 2XEXA 3J81j 1FJGJ 5B0FA 1KP6A 3DFEA 1NSPA 1ACMB 1SQFA 1UW4A 1REVA 2HKEA 3H5UA 2Z57B 4FVMA 4PZVA 5HI7A 4JV2A 2VOOA 4CM0A 1SJ1A 2DEIA 3LF0A 4OZ5A 4UW2A 1HR0J 1NK4A 1VRTA 1T02A 3B54A 4ER8A 4PYDA 4CT9A 2VQEF 5I42A 1FDBA 2ZBCA 4KH0B 3J81Y 3HVTB 5CHCB 1LXJA 1SH2A 4CTAA 4DMZA 3V6DB 2CPYA 1IXKA 2B6AA 4RBTA 4UTGA 2DNYA 1A6LA 5C42B 3RB3A 4Q5VA 3F44A 1N5QA 2RQKA 2OSRA 4HTIA 3QRRA 4K4VA 2MQPA 3JSRA 1ROFA 4JV5J 3AOCA 3J7A1 4DR6J 2CPHA 2RMLA 1UVJA 1VYAA 2FUG9 2I0XA 2ZEJA 2KT5A 2HLTA 2JRSA 2YKAA 3EDQB 4LR7A 4RWXA 5KFRA 2KO1A 4CP5A 4O0IA 1KD1T 1Q1KA 3SI8A 4MKVA 3ZNJ1 1JK9B 3JTOA 6FDRA 4X64J 2Q3PA 4XK8C 1X8DA 3RAQA 3A8IA 1S9FA 1J5EF 5JUMA 4XO0A 2DGOA 5L39A 1VQLS 1GMVA 4HTJA 1FXLA 1WWHA 2IJNA 1U25A 4ED7A 4DOZA 3OV7A 2ZOGA 2XS2A 4L75A 3IBCB 2K1RA 2ZH1A 4ICLB 3B8HA 1IJFB 4OZLA 3M8ZA 2VF3A 2LDYA 4X62J 1I6JA 1EZZB 5D3GB 4DPXA 1JLBB 3M2RB 1O8BA 4YDXA 3OTOJ 1GNKA 2UU9F 4YR0A 2DITA 2DGSA 4FYVB 1B0TA 2MLZA 4K0KF 2AD9A 3K57A 1KVKA 4M8LA 4RZRA 3QSIA 2GS8A 3LP1B 3GIIA 2YKQA 4ZVTB 3OLAA 2OSQA 1RT6B 2AJFE 1LWXA 3VQSA 3FBBA 1ULRA 3M4XA 4J5OA 3QT5A 1KQKA 5A2QU 2XO7A 3W2VA 3PG9A 1S6QB 4ZIVA 1KQFB 4X65F 4CQ1A 2NR0A 1Y4ZB 1N52B 2HBQB 2GMLA 2D3O1 2GMJA 4OI3A 4WK1A 5DETA 2YNGB 4UY85 2QX0A 4ECWA 4UOCA 4C48A 1T3NA 4CLZA 1QAIA 3L3CA 1SXLA 2FJXA 1IM4A 1N5YA 2OHDA 1L3VA 3P5BP 2BJ1A 1L3SA 3GCWP 3NOGA 4M63A 3ZZPA 3G82A 4QR0A 5DDOC 2QYCA 1DARA 2KKHA 4AUKA 2K3KA 3JXOA 4NEYA 4C98A 5C25A 3HVAA 5DGAA 1R8BA 1RT4B 5SZTA 1P9YA 2CPEA 3DOMA 4ZJLA 3C6TA 2JSXA 1HBNA 2K2PA 5HP1A 2KJWA 1KWMA 3D28A 3FEZA 4OYBA 3WZ0A 4IKAA 4A46A 2CPDA 4ZHRA 3V6KA 4ZPCA 2CIMA 4ZPTR 5HL7Q 2KT3A 2J8SA 3DXBA 4TKTA 4XDDA 3DLKB 4H4MA 2HQDA 4TNOA 3G6ES 3AAWB 3MUTP 2VJUA 4B08A 2NS1B 2OGUA 4PABA 4FS1A 3BQ2A 4KIAA 3T1YJ 1KVIA 2JLGA 3CJQA 4L76A 3QIPA 4FZVA 1K47A 5G4DA 4WU2A 3W1YC 3RRGA 4KY3A 2HNYB 3VVUA 1K8AT 4BCAA 2VG5A 2KB2A 2VASA 3L4BC 1Q7YT 3MOZA 2IM2A 4LF4F 3T1HF 2KHCA 2QLJB 3LUYA 3FK4A 1CC8A 3P8BB 5L8RC 1PILA 1L3KA 5J1PA 2XY5A 3HP6A 3SCIE 2GQQA 1LKZA 1SPBP 4DV0J 2R2RA 3PHTA 2CQ4A 3LGMA 4WFYA 1XBWA 2YNIB 2XYPB 5HLFB 4PAAA 2DNNA 1PSDA 2HWIA 4Y34A 3ISND 3ISNC 4TYBA 2G1DA 3D67A 5IWAJ 3MAAB 4DL7A 4LF6F 1VC0A 1X0PA 1VISA 3U27A 3W2WA 2XLIA 3ISZA 4KKOB 3CJ4A 1TAUA 1GTHA 3QT6A 2ERRA 2CQ0A 3TWZA 3CJ5A 1QDUB 5D4LA 2YH0A 1AUSL 1TFWA 1REVB 3U1NA 2CG4A 2DHHA 5KT3A 5CAAA 3MCMA 2ADCA 2XSFA 3CCSS 3QYYA 3H2VE 4JI7J 2MKYA 3GFXA 1U8SA 1S9GB 1HPZA 1TKZB 1BY9A 4FKXA 5I42B 3CE8A 3C19A 1H2VZ 1HQUA 2DHAA 3K7RA 1UETA 4ZA1A 4DCOB 4ATNA 2ABYA 3H40A 4C2MA 2W9BA 4A8QA 2P6TA 3LW5C 5AXNA 1HHQA 2X1AA 3FNNA 4GKKF 4ETZA 3W62A 4ECYA 1S59A 2E1PA 3ET6A 3SXLA 2QMXA 1WF1A 2UZAA 4DPYA 3DHWC 4RW7A 3NL0A 1RI7A 1N32F 1KKHA 1DQ8A 4K4UA 4ED5A 1H74A 4DSKA 3A3OB 2HZAA 3D1HA 3M6VA 3AJDA 4JUZA 3RUBL 2XM3A 2BRLA 1JLCB 3PYDA 1JQGA 3AA8A 4DXLA 4MK9A 2ATLA 1I94F 4I56A 3MUVP 5ETTA 5KAKA 2MLYA 1W7WA 2MHNA 2BQUA 2R7VA 3TP2A 3V6HA 3CMAS 2W2OP 3AQPA 2DGVA 5E3CA 3UWTA 5IFMA 1D0EA 4WXOA 4ECZA 2YH1A 4PG8A 2Q6BA 3O8WA 3VF0B 1LW2A 2DIVA 6FD1A 2QL5B 2BOPA 3IRXB 2MJNA 4GVBB 4Z2XA 3GTYX 2HFSA 1PJ7A 1YJVA 1I3OB 1T9WA 2A6MA 2WSFC 5E3QA 3O6QA 5KFCA 4ED1A 4LMZA 2DVIA 5HMWA 3LP1A 2PIIA 5KG5A 1AXQA 4JI8J 3T9ZA 1RT6A 3EDRB 2OPRA 1S7HA 3IG1B 4D3HA 3LWMA 4A8YA 1JMTA 5IXUA 5F8MA 2BR0A 5D8HB 5LSRA 3SCJE 4F4XA 2WVEA 2UUBF 3VR1A 5EN1A 2N3LA 3U1LA 4KPYA 2GAHC 2IRXA 4P2XA 2J7UA 2H9ZA 3M2VA 1FK9B 4TY9A 2HGLA 3T5LA 3T1YF 4IRKA 1APSA 4LQ9A 2OEMA 3W5XA 3IM8A 3MF5A 4J91A 1N34J 4Q45A 1N5YB 3QPIA 2M52A 4I7FB 1DTTB 1FA0A 1AT1B 2B5JB 2NSBA 4RO0A 3S7RA 2FLOA 3CNQP 5KG3A 3BO2A 4ZS6A 2CQ1A 5RUBA 2MKJA 3KLEA 1O51A 2HNDA 3FSXA 2AGPA 1RACB 4DF4A 1IJEB 2ZZNA 2GVDA 4U9RA 1JLFA 2YWEA 5LSLA 2CWKA 2F65A 5JVHQ 2PI5A 1HMVB 3FCWA 4B3OB 3HCXA 5H9EK 2OJ3A 4KAIA 1OYDA 1FRHA 2GIFA 3GP9A 3FVYA 3THPA 4MIBA 4PG4A 5DLGA 4OHZA 3QWPA 4B9LA 1M90T 2AT1B 2OH2A 4JI4F 2AX1A 3D66A 5F9LA 3DLKA 1YRXA 2GQCA 4DSJA 1GX5A 4WFBQ 4FPIA 3OR1A 4HH1A 3T3FA 4ECVA 1ZA1B 1UFLA 2JFKA 4PEOA 5F41A 1S9EA 2BE7D 1XR6A 5T7LB 1FTCA 5A8WB 1U49A 3WBZA 4R25A 3FUYA 1U1PA 4KV8A 1NPKA 5DJBA 1R8AA 2MDAA 5HVFA 1XQIA 3DYAA 3RBXA 4C8OA 3PTWA 5KTQA 3JTPA 2PA3A 3FZ2A 4AXIA 2CKWA 3KK2B 4QIEA 3UVJB 3GIJA 2R9LA 4DV5J 4V19X 4ILLA 2YKMA 3I0RA 2BJ3A 4DV7J 2K7KA 4YY3J 2UP1A 4NLDA 3UN2A 2B43A 3UPFA 2KL8A 3JQJA 3EZ5A 1CJKB 3EGNA 4NLTA 1OWXA 1RT7B 3BGRA 4K5RA 5EWEA 3HSJA 4FS2A 2YVSA 3CJRA 3PJ9A 4DUYJ 1QTNB 2BANA 4R0JA 2WB1D 2FVRA 2Y0SD 4DR7F 2DGXA 1T95A 2RKIB 5KFJA 4DV0F 5EX0A 4OJ1A 5KFYA 1VI7A 3L7UA 3CO9A 1FEHA 2Z2LA 1X4HA 2KHDA 1XC9A 1VQ8S 2VOPA 4HI1A 2IMOA 5H9FJ 3Q8PB 4Q8FA 5IT0A 1HWIA 1GH8A 2M8HA 5K5MA 4FYXB 2CPFA 2UU9J 3IFEA 4B9NA 2CG8A 4DR4J 4OL8A 1A0OB 1LV5A 2E7XA 2LU2A 5F3ZA 2HHHJ 3GWCA 2ZDOA 4OX6A 1MMDA 1MG7A 1NPPA 1YLXA 3TAMA 2YWWA 3RU0A 3I56S 2QSFA 2W9BB 3GE9A 4DV6J 1SQEA 1UWBB 1SV5B 4O23A 1QAXA 3AOBA 1VQ6S 4LSNA 2F1FA 3QO9A 4DSIA 3D68A 1Q81T 4QYZK 3BKUA 4DR3F 1X9WA 3D1OA 1DTQB 2JL9A 4RW7B 2ZHAA 1QD1A 3KMQA 1UVNA 2UXBJ 2OO4A 1P8GA 1VMBA 1EKSA 4ZPAA 2MQMA 2GFFA 4A8SA 2ZNYA 4DL6A 5KFVA 3Q8SB 1H72C 2E5GA 3HF5A 3M8WA 3MPDA 5AT1B 3E3XA 4CNYA 4DDFA 4F4ZA 2XBPA 3M9NB 3HDSA 4M94A 3P49B 1Y9OA 4K59A 5CYQA 4FYYB 2C2MB 5E2QA 5BR8F 3PW5A 3V5RA 1PCAA 2MZJA 1SC1B 1Q86T 4RNHA 4USTA 3VVTA 1HNWF 1Z2ZA 2C2KB 1XNRF 2W2QP 1H7WA 2F4FA 4KH1B 4G1PA 1T11A 2IPOB 3H90A 3CJ0A 5BYSA 4EGLA 3AOAA 1UW9A 3QRPA 4LRCA 5E7OB 2NYHA 3IP0A 1J2VA 2PMHA 3PEHA 3PVXA 2XULA 4I2PB 5ETPA 5GVQA 3WX8A 2H3EB 4YFUA 3PW4A 1WORA 4HT5A 1C1CA 2ZD1B 4EO6A 1Q8IA 1FJ7A 1LFPA 2F63A 4OFZA 1FWKA 4EI2A 2KZMA 3GR0A 2G13A 3KFWX 3QFWA 3KWMA 1RHMB 5KFBA 3MAHA 2VPZB 5KFWA 1FDDA 2BJDA 2FYXA 4NA1A 4ELVA 2QE5A 1SH3A 2H65B 5IM0A 2ZKTA 1MU2A 5KFOA 2V63A 3MEGA 3QMQA 3BQ0A 3QT7A 4I4BA 2C3YA 1FKAF 4NEZA 4LQ3A 5KFFA 2XNQA 1HWUA 3KXDA 4PXDA 1P27B 3R7SB 1HNZF 1J27A 3MM7A 2RS2A 2VPYB 1KRPA 4U7UD 1RYRA 2ACMA 4B3RJ 1JLFB 3AXKA 3B6BA 3PJXA 1XMQJ 2UXCF 4I69A 4X4NA 1F5AA 1KOHA 2RUSA 3LAMA 1RWUA 4B3SJ 5FJ4A 1MWZA 2MKHA 2LQ8A 3NGTA 5CZVA 2KXNB 4DV2J 5KT7A 4DR6F 4KGMA 2JC0A 2RF2A 4O4GB 3DMJB 3DOLA 1BMQB 2Y3YA 5J1EB 3VGSA 5D6GA 3J7ZT 2AJQA 4IQMA 2XZWA 4YEAA 2KYZA 4G1QA 1ZPVA 2Z30B 4CTAB 8ATCB 1JX4A 2BE9B 5T7LA 3CEDA 3TZYA 4LF7F 4F02A 4BLGA 1OPIA 4BS2A 1R8CA 2KYXA 4GO5X 2KI2A 1KHVA 2LYVA 5ETQA 3S01A 3IO1A 3DYAB 5A8RB 2KVIA 2I2YA 2Q66A 3KK2A 1PYSB 1NAQA 3I32A 5DZ6A 1Y7PA 3P4UB 2AJ0A 3MUMP 4B3SF 3ENAA 1IUJA 5HAOA 2IRUA 4USVA 2DTJA 4CH7A 1UKUA 2H5JB 5IWAF 1D8ZA 5IT9U 5AXKA 4WIIA 2L9DA 3BGRB 2HAIA 2C42A 1NRKA 2BANB 2K1RB 2ZH3A 2C22A 1EIYB 3Q0AA 4IH7A 1WI6A 4N5SA 3PW0A 4LF7J 2HHSA 2F8MA 2OPPB 1S0NA 4B17A 3BEGB 4KYZA 3M2RA 4OI1A 3HJFA 2OTJS 3BR8A 3UDLA 1EKRA 5DG7A 3C6UB 1RT1A 3OFHA 4PR6A 5M2RA 3M9MB 5BYRA 2B4UA 3M1VA 2HVIA 3BF4A 5J2PB 1YTYA 5CD4A 2QTWA 3W9JA 4U95A 1TV6A 1U0HB 4ZCMA 3NWGA 2LP4A 1TKXB 3GIRA 4LSNB 5KOXA 2RUGA 2D3UA 3BDEA 3PM9A 3DLGB 2YNHA 4IDKA 3TUZC 5KFAA 3MAQA 1DRZA 3DU5A 4C0BA 1J5OA 4CDIA 5CH7B 4KB7A 1Y3KA 1N5SA 5ADZA 4ZP7A 1FNMA 1K1QA 4Q8EA 1WHYA 2XYGB 1CQNA 3T19A 3AJ1A 1S6OA 4DV2F 1C4AA 3FRZA 3UNGC 2JJ4D 4Z7CA 2XGQA 2E7VA 4P2FA 2DO0A 1UP1A 3L09A 3EPIA 3CJ3A 1KHWA 2BM1A 2CZVC 3R7NB 2QLBB 2XNRA 4F8RA 3NMRA 3SBMA 2GIQA 1R43A 3CCRS 4RW6B 1UFWA 4TY8A 1VDHA 4DPOA 1U1NA 4NLWA 4QCLA 2LFVA 3FFIA 3QAEA 4NYOA 3BSNA 1NKBA 3BM7A 2DGWA 1R7IA 2MQNA 4I6AA 4O3NA 4WWSA 1ZM4A 2H1YA 4R5PA 1VQMS 2WSEC 1HQEA 3QATA 3POTB 4KPCA 5L9NA 2ZM6J 5CXTA 2ZH9A 5A0YB 3Q2TC 2QIFA 3TYTA 1C1CB 2CFXA 2DH7A 4OHXA 4MT1A 1LQ9A 2VG5B 3CWJA 2O3DA 2CQ2A 3HKZD 1LW0B 2NSCA 2OI2A 3ZC4A 4B9MA 3KJQB 2LEAA 2NZCA 4ZVQB 2W24A 4JI1F 4IOAQ 1OIAA 3CC7S 3LTOA 1OJ4A 1U1OA 2XMWA 4KFBB 1TUWA 4HDGA 3EVWA 3ILJA 4MFBA 2DNPA 4ZMMA 2N7CA 1CSJA 1H0HB 2L9WA 2PA8D 1OQ6A 2WAQD 3N6NA 4QIFA 1ZM2A 4ZLLA 7FDRA 3FQLA 2C2EA 2DNGA 1SKSA 2ZOMA 1U0SA 3FEXB 4I2QB 4LF1A 4YB7A 5DDPC 5I3PA 4B9SA 4JI0J 1FJCA 3U7JA 3OHBA 1D09B 4LREA 1RCOB 3EGVA 2ZWPA 2H54B 4PQUB 3DGPB 4PWWA 1Q7LB 3OL9A 1F60B 4QR1A 1X0FA 2M70A 3RTVA 2GHWA 2A1BA 4QPXA 5M2UA 3WC2A 3SDEB 4CNZA 1PJ6A 1VS3A 2C28A 5AE1A 1TAQA 2CJAA 2VZ9A 4A48A 2PFFB 2E9TA 5K9FA 3FCHA 3DOLB 1KFSA 1WC4A 1YVFA 1E6VA 1TVRA 2EWHA 3H42A 2F8EX 2FQQB 3QGGA 5B08A 1HPZB 1TKZA 5A2QY 4MAKA 4MK7A 3FRYA 1FERA 3PFOA 1HQUB 5KOWA 3OJSA 1WUUA 4G1QB 3PRDA 2B7BB 2H5IB 2VG6A 3KNGA 2O66A 3D3CJ 1Q16B 3THTA 3VGTA 1VQOS 1L3TA 4RU2A 5E3RA 4NXMF 1C0TA 3NOCA 1G4CA 3IR6B 5A8RA 1TFYA 2B9EA 5JXSA 4YB1P 2AYEA 1FJGF 4DV7F 1L5UA 4MMOA 2R8GA 1FJEB 4IO1A 5C24A 3TR5A 2AYMA 2HBYB 2R3VA 4A8WA 3K8WA 4DI6A 1N48A 4N77A 1VJQA 2LU1A 2QA4G 3DLEA 3OVAA 2HWTA 2QYGA 4PG7A 4AXJA 3H5XA 4BC9A 1SC3B 3TUIC 5DQHA 2OAUA 3CC2S 3V81A 3BH7B 1TR0A 2ZITA 3MCSA 4ANEA 5GAGU 4DUYF 1RHUB 2OPPA 3OBIA 3R8YA 5DQIA 1X5SA 3HVRA 3QLHB 4DV1J 4DCJB 5F8JA 5JVGQ 1XMBA 1HLWA 1YWXA 3CCZA 2UV8A 3QBCA 3K59A 1HWJA 3GMGA 3C6UA 4FF3A 1X5TA 4WZQA 1TK5A 5FD1A 3BGFA 3J81U 1YITS 1H2UX 1Q4RA 3EWGA 3CGIA 3HZEA 3DDIA 4J9QA 1MW7A 3RR7A 1RTIA 2EFOA 1U0HA 1UMJA 1CJVB 3BQ1A 4I1TA 2KM8C 3B4DA 4J9RA 2XMMA 3BPDA 2AWZA 4M5MA 4X4PA 3S6EA 2Y1LB 1UFKA 4FKYA 2HK2A 5AXLA 4DR3J 4IO9Q 3KUHA 3PHEA 4I7FA 5HQLA 2KZZA 5HK4A 2QGFB 2RDIA 4L72B 2DNKA 3TQEA 4C0OC 3TA2A 5KT4A 2B56A 1YJRA 3IAM9 5B0GA 1TK8A 3TRGA 1YZ7A 1S77D 1M0SA 3R27A 2HYIB 2XB2D 2J76E 4O44B 4YB6A 4MYTA 4F4YA 1HBUA 3KG1A 1RTHB 4DV4J 1NJWA 1FESA 1RU1A 2Z56B 2UVWA 2PN6A 3G86A 3EE3A 4YB5A 1H38A 1NK6A 3R7BB 2B8QA 2V2QA 4WYWA 1FF2A 3EGWB 3T5HA 4DSFA 3DC2A 3CJKA 1V3RA 3HPOA 2B0GA 3DRPB 3MM9B 1VQ4S 4B3TJ 7FD1A 3KLFA 1QVFR 4R5PB 4J9LA 3UN3A 3BZQA 1HHSA 3POTA 4NCGB 1VIOA 1R27B 1N88A 1S9EB 1WHVA 3UDEA 3QJJA 2F8HA 5A8WA 2QA4S 4UF4A 5KFEA 3BR9A 3H5SA 3MEDB 3X3UA 2CPIA 1LW0A 2NXNA 3R2CJ 3AH6A 2DYAA 2LXFA 6AT1B 1RT2A 1JJCB 2DNOA 2AIRB 2FGOA 4ENOA 4DUZJ 1UVIA 3PFEA 5LMUF 3HJVA 3HHLA 4MTPA 2PMZD 1QSLA 5HROB 3Q83A 3OD2A 1AROP 2CZ9A 5CZXA 3N6MA 2M4MA 3LP0A 1IWGA 4X4QA 1RTDB 4C6AA 2IYIA 5CD4H 3F73A 1R89A 3NAIA 1UEKA 1VCTA 1C4CA 3DGPA 2LMIA 4DFPA 2RDJA 4DQRA 2V2ZA 3HHEA 3ONQA 3BS9A 4LSLA 3TAQA 4X2BA 4UUXA 1R6YA 1S5ZA 3N79A 3PJWA 1S1UA 4E98A 4DR2F 2XC9A 1YI2S 5GMDA 2JEGA 2OPQA 3NXZA 3AB4B 5KT2A 2OD6A 1XN9A 1H7XA 3EX7B 1RHRB 2GAGC 3UQSA 3AQOA 3IRWP 1BUXA 1XTZA 5GMKa 1Q8LA 1B0PA 3W60A 1Q8KA 2BX6A 4EFAC 3OFFA 2DH8A 4FP9A 3NEKA 5HATA 4Y6IA 4ZPDA 2LEBA 2FZKB 1QTMA 3EPGA 3ILOA 4EBCA 3J80Y 3W64A 2XMJA 4URSA 2AMCB 4AL5A 5K8OA 4CI0B 4WJBA 1GTEA 1ZA2B 1DTQA 1S79A 2WZ1A 4F7VA 5KFUA 2J7KA 5H1SV 5GAGI 2ASLA 1FCAA 1TL5A 2DY9A 4QYZJ 5KFHA 1WDTA 2Q1LA 1YJTA 5C24B 1SH0A 4Z7YA 2WONA 3RAMA 4DPTA 3TEGA 1T03B 3P45B 4DCPB 4UQGA 3SQGA 4Q43A 4ID5B 1CPZA 2RQ4A 4OV1A 3D1QA 1YBUA 4OI0A 1WC1A 3PW2A 2IFXA 3TX8A 2WRMA 3V81B 1WHXA 1RLDA 3HFKA 4ICLA 5DG8A 1N34F 2YKNA 1RAAB 2QFIA 4WFAQ 4TU8A 5D3GA 1VRUB 3FBEA 5KG0A 3BGLA 2KXFA 3TI0A 3ZZZA 2MQOA 1M5OC 3RB4A 1CVJA 1F9EB 2K3IA 1YKWA 2ZBPA 2ZBQA 1UVLA 1HYSA 1SIZA 2W2NP 3MM8A 3OXGA 3T6BA 1WF2A 5K8MA 3NGDA 1AUDA 3MECA 3FBFA 2P9GA 4PPZA 4A8FA 4QU7A 1EETA 3ZO7A 3R3TA 4USMA 5KFKA 1SUQA 2QG9B 1CJVA 1Y0HA 2KFYA 1NSAA 1RP5A 5FIIA 3MGJA 4JI2F 4ES2A 4CZCA 3FSIA 4YS2A 4K4WA 1NKCA 2IA0A 3OSPA 1DJ0A 2V6AA 1IM6A 4J9OA 4FPRA 4AE5A 4F50A 5GMEA 1FVSA 2W4PA 3MEGB 4JP8A 2E5LJ 3IGNA 4QR2A 3VAIA 4NZ6A 1S57A 1BQMB 2DHXA 2O67A 4L73A 4QZVB 5U47A 4RNNA 3M8SA 3GV5B 4ZPVR 1OY6A 4KSEB 3K0JA 2ZUGA 2CA9A 1HNIA 4HI2A 4QW8A 4ZN3A 1HBNB 3KHGA 4EEYA 5HP1B 1JJ4A 2R8JA 1X60A 2E44A 2ZC4A 2W9AA 3RRHA 4YHHF 1N36F 2WW8A 4ZP9A 2QEXS 3JSBA 1IR1A 3RW6A 5KG7A 2QO3A 2JDJA 4LR9A 1CS4A 1RWWB 3I0SA 2EFGA 4HT7A 4ZJOA 5KFSA 3IN5A 4KHPJ 1XEZA 4C8ZA 4K4TA 1Q79A 3LGNA 3AD7C 1S1WB 3F0NA 3Q86A 4J37A 3C15A 4CO0A 2M7SA 1VBKA 2JLFA 3SCLE 1X9MA 1FKPB 1AFIA 1LFWA 1VBZA 4Q2MA 4RJVA 1H6KX 3E01A 5CA5A 2V9KA 2OIHA 2KN4A 1V3ZA 4MIWA 1X4AA 2HS3A 4P2MA 4CLLA 4ZJQA 4J9NA 4EK2A 1LWFA 2OMLA 3TX0A 2GJ2A 4NXMJ 3MHYA 2B9YA 3SV4A 1JWWA 2BE2B 3AXMA 3Q8QB 1ZPWX 3D0HE 2W4CA 1VBXA 4LRDA 4RW9A 4ZVRB 1G7CB 2GVZA 1V5IB 2YNIA 3R5AA 2IYGA 2RH3A 3ADAC 3MD1A 4TLQA 3ZTQA 3QZ8A 3MMJA 2XY6A 2A18A 1U26A 3MURP 3MAAA 3UI3A 1S4EA 2Z8QA 2V8HA 3EUNA 1VQ9S 4Q2LA 3OL8A 2HHWA 3PKMA 3I9ZA 3BYPA 4OX7A 1RT3B 2XYHB 2I6WA 1F6TA 4B9UA 4CLFA 4WF9Q 3AFGA 3D7SB 2BDPA 1K0TA 4F2RA 3DI6B 4NA2A 4LIRA 1XMOJ 2ADBA 1OS5A 2BV3A 2DGTA 3FC9A 1RHJB 1CJTB 1GFWB 5FDLA 3OXFA 3KMSA 1DZ5A 1N0UA 3LQVA 1NH7A 3N5BA 4OMFG 2ASJA 2Y8WA 4Y65A 2ZH2A 1N32J 1JLGB 1KDNA 2YWHA 4O3RA 4DN0A 1EP4B 1QUPA 3ZTPA 3G4SS 4DL2A 1IBLJ 3DLGA 4N47A 3TNVA 1DQAA 1MN9A 1MWYA 4ZVGA 2F40A 2IIHA 4NLYA 4LRAA 4DN9A 2V8PA 2HZCA 3LPYA 3NBPA 1SC4B 1I51B 2IVYA 5EX3A 2J6UA 1N36J 1X7VA 1KS2A 1IKWB 2HVDA 1TL7A 4ZVEA 3SCKE 1B7FA 3T41A 2FJEB 2OKQA 2EKNA 4IFYB 1LWEB 2HFZA 2ZDPA 3J7YI 4RU9A 4KGXB 3CCQS 1V9OA 3CW2C 4E8UA 2XLKA 1C0UA 5A6PA 4RR5A 1R0CB 2EVZA 2RB7A 4UY8T 3GYGA 2LQ9A 1WEYA 2J9CA 3U1MA 3R1LA 4YMEA 1HKAA 1IKVB 2G0IA 1UPMB 2ILZA 3KJVB 2LXIA 4RW6A 4A8OA 5DS7A 1LW2B 3CDEA 2K8GA 2HNZA 3IRXA 2BOAA 3FFIB 3GB0A 1HBMB 3GZ7A 3GV7B 3QT8A 1ZM9A 2XZTB 3GR1A 2E5IA 4PG6A 3US5A 5B7WA 4B3TF 4IQXA 4CLPA 2QZ8A 3S1TA 1S1TA 2ZOFA 3H7HB 2IVMA 2VH7A 1XMQF 2ZVIA 3IWXA 3VZHA 3W8GA 5EGYA 1U45A 2HBZB 3P5TL 4P2SA 2MZQA 2RIJA 4ZOSA 4DG1B 3L7OA 1EETB 4RBUA 2HBRB 3P3DA 2LQJA 1SIWB 2XI2A 5DRKA 2FVSA 2HFOA 3NCQA 2IVFB 2B8PA 3HM9A 2EI5A 2J0XA 3M2VB 4PPDA 4QQBA 1U24A 3BSAA 5IQQA 3HHLC 4USUA 5DZ7A 2FHKA 4M5JA 4AQYF 1JKHB 1TKTA 1MSWD 1U8WA 5IS2A 1TL3B 1TQLA 1T9XA 4I2QA 1WACA 1UZHA 3NG8A 4RWWA 5DLFA 3OTDA 1RA7A 4X4OA 3KLEB 2GMHA 3K5PA 2PMWA 2FHMA 2VBYA 1M5KC 1FHTA 1VR6A 4LSZB 1K44A 2DJWA 2VG7A 1HMVA 3AA9A 3GPAA 4KRWA 4P73A 5GAEI 3CDUA 2VJVA 1BD6A 2CWXA 2VPXB 3Q8UA 2COLA 2VQFJ 4PKDB 1WSRA 1IBKF 1HQ2A 3CDAA 4KGZB 3VHQA 3GIKA 3BB5A 2EW9A 3DRXA 4IR9A 1FTRA 4NE9C 1V5VA 2AW0A 2DKOB 3D2WA 3OPKA 2IAJA 3JAMY 3BH6B 1TVRB 2RRBA 1RWOB 4FBTA 1X5PA 3J7AN 5HJYA 1VK3A 1CULA 4ZCKA 3VQTA 2LKZA 3PW7A 2XZDB 2IBKA 4U96A 2CJBA 5HJXA 2LQ5A 3UDVA 2YX4A 4DQIA 1TMMA 4KV8B 5CYMA 3CCJS 4KHPF 1C0TB 4J9MA 4LFCF 4WE1B 5B0AA 3LANA 1D9AA 3MEEA 3J7Z5 3A3PB 4LF5F 4X4SA 1OYEA 1IKYB 5IOLA 1U1KA 1YBAA 3UVJA 1M5SA 2KJVA 4K2XA 3MR7A 3OTOF 1TTHB 2V8GA 2GVZB 1VBYA 2MPUA 1UPPA 3KYLA 1FDNA 2FLLA 3V4IA 3AY0A 1NJIT 2HIQA 3FSYA 3UR3C 4ZP8A 4HHHA 2HFUA 2HFVA 3B4MA 1XERA 3C16B 5L1LA 1RT3A 1HWKA 3BBBA 3OT9A 5IC4B 2JWNA 4IRCA 2C3OA 3FKBA 1PAUB 1VC5A 4OZ3A 4TVAB 2KTQA 1JLBA 4WFNQ 1FRIA 1SJQA 2MZRA 3DI6A 4JI0F 3JAMU 2RQMA 4NCAA 2B3TB 2DCLA 3UE2A 4WP3A 4CLKA 4G6VB 2HS4A 5HBMA 2CQBA 4MK8A 2UVRA 3JB9k 1M1KT 4Q0BA 1BHNA 2EFQA 2I38A 2QLFB 2YBVA 3IGVA 3CB4A 2A2CA 4IH5A 5BR8J 3PIOQ 2MTLA 2X51A 2XHCA 4CO2A 2DRAA 1RTIB 2W2PP 3W2VB 4ERDA 1JLGA 1WG5A 3DOKA 1S7IA 4OYXA 5E3PA 3CCLS 1M5VC 5J1NA 2W7PA 2XMUA 3HSZA 2XS7A 4EBDA 2VICA 2HHTA 1R8HA 3KHLA 3JYTA 1T9TA 2QMUB 3BSCA 3LP2A 4KO0A 3SFUA 4DF8A 3UCUP 4C3LA 3LWLA 2NYIA 4XPCA 1HHTP 1JLAA 5G0RA 2MHEA 2Y0BB 3A13A 2HGMA 5KFXA 2N4CA 3CC4S 2FDNA 2DK2A 4G65A 1C0UB 3IBWA 3GFHA 1EAYC 3NGUA 4OZJA 1CJUA 1RWKB 2D7SA 4AL6A 1NHUA 4UZCA 4ZVPB 1RTHA 2AU0A 2RNEA 1RBAA 3BN4A 3NGKA 2VA3A 2DXEA 3GJRB 2L08A 4PRFA 1NPRA 5HO4A 2R8HA 2KG0A 2DXDA 4MIAA 2RDDA 4H4MB 2KG1A 3VALA 3OUYA 1U1MA 3RW7A 1UVKA 1CG2A 4DPWA 1KTVA 4JI7F 3NNAA 1ZZFA 3KLFB 2MLXA 2NCKL 3GJQB 4H4KA 1ZTTA 2DEJA 2ZNZA 4Y2AA 2GO8A 4QWDA 4JI5F 1YK9A 2EFVA 1B4SA 2D41A 1H73A 2HQ3A 4OQJA 5D0EA 2BJ9A 1YHQS 1N6QA 4PG5A 4OHWA 1YRTA 2B9WA 3OVSA 3T1AA 2W8LA 1K1SA 1BWEA 2WK4A 4FXWA 4PQAA 2GQ2A 3WX4A 2C2OB 4CO4A 1RKIA 1WC5A 2V67A 1T05B 4DBQA 3IS9A 5A8KB 2BM0A 4NLRA 5IM0B 4DR2J 1NZ8A 4XAKA 2L41A 1NKEA 2J0QD 4OYAA 5HLFA 2HHHF 2EFPA 4GC7A 4FVCA 3DLLQ 2KXHA 2DISA 2I5JB 4AFFA 4DV3F 2L3MA 1HBOA 1MWQA 3QAUA 3W2WB 5B0BA 2ZM6F 1U4BA 3RGIA 4AYBD 1S6PB 1RHQB 1WG4A 2C3UA 2M88A 3K2YA 4RX6A 4JI5J 2CJYB 4DFMA 1S1UB 1T9YA 4NCBA 1NJYA 2N3OA 1TKDA 4Y3CA 3QNWB 4P71A 2VD3A 2M2BA 2DB1A 3M9OB 4KHRA 1IR0A 4LFAF 1F3VA 2IAJB 2BACA 1F0XA 2F4VJ 1IQTA 2J9DA 4H4OB 2CADA 3BGUA 3HKWA 1IN0A 4ZVFA 2ZH5A 2CXEA 3VAGA 1IBLF 2UXCJ 3MFHA 5GADI 5J2NA 4LBIA 4FNIA 4CYUA 3DN9A 2G2YA 3I5CA 1O6XA 3IM9A 2H4YB 3ET6B 2YTCA 4NLOA 1XJWB 3ZXWA 2XLJA 3Q89A 3F41A 5DG9A 1NO8A 3MEEB 4CT8A 2W7OA 3E8OA 1MMLA 2X3GA 3MWBA 4J9SA 2HRTA 3H2LA 2G4BA 4ECUA 2ZWOA 4FXDA 3L7PA 2YQ0A 4DS5A 2CJXB 3OL7A 3MMAA 4MKAA 3EZUA 3TJ9A 1R31A 2BBEA 2V8DA 1BE4A 3W5ZA 3DRSB 2B51A 2KU7A 5B09A 4USIA 1HWLA 2R2TA 2XS5A 1QE1A 2PEHA 1JLEB 2Z2ZA 2JLEA 4ID5A 4K5SA 4R0EA 4BWJA 1S99A 4M5NA 5FLXY 2Y1IA 1X9SA 2U1AA 3Q2SC 4OYOA 2OFGX 1WKLA 2DD8S 2CNOB 2CQDA 2ZC3A 4JI8F 4G1IA 1BGXT 3ITHB 4ZDNA 3A8KA 2FHOB 4EBEA 1ZH5A 3UD4P 2MQ8A 4WXWA 2VHGA 2Z4PA 4IG0B 4RW4A 1OY8A 4NLUA 3PO4A 3P6YC 4ELTA 3O1LA 2QL9B 3MMBA 2GJIA 2OMOA 2GGPB 4OYWA 5GAHU 1T9VA 3UCZP 3MM8B 1Y10A 2IRYA 4IG3B 5J2PA 3MECB 1D1UA 4AQYJ 3DDKA 3WIVA 3HFZB 2G0JA 4DSEA 1QAJA 3H4DA 4GC6A 4DSLA 5LMNJ 4KJIA 5KFPA 3KLHA 5L1JA 2HVZA 1ZAWA 3PY8A 3HHNB 3JYTB 2E1MC 3UR0A 3M6UA 1J5OB 5D4PA 4JBCA 3MZIA 2AV5A 4N8OA 2IMWP 2HRYA 2P9CA 5ETMA 3KOAA 4L74A 5C7PA 5KT5A 2E5JA 4A47A 2XQCA 1KQGB 2FB0A 3SIPB 4OHVA 3W3SA 2JNJA 4YOEA 4A8KA 1RABB 3ELHA 5I3QA 3IA0A 2B7CB 1MMNA 1Q82T 4OJGA 3R9LA 2GA7A 4HL9A 1NMEB 2CJQA 5KFGA 4PUOB 1MN7A 4B3OA 5K14A 3OFGA 1F9FA 4OJ3A 1JXEA 1YJ7A 3NGRA 2XMVA 1S0MA 1FRJA 4NXNF 1FFGB 2R7QA 4G3IA 3NMAA 3CMES 3VAJA 4QWAA 4TY8B 1GXUA 1G6BA 4YP3A 1RT5A 4K4XA 4EZ9A 1B3TA 1UVMA 1Y5NB 1H2TZ 3HHKA 2IJRA 4C8MA 3OUYB 1S1WA 2HHQA 3OR1B 1LWCA 2H51B 3C15B 4ITSA 2AJ2A 1SJRA 3CCMS 4K2JA 1KFDA 2J0WA 1HQEB 1BXNA 3CD0A 5EHHA 2R2SA 2OD4A 1C1BA 3IBFB 5A0YA 2MKIA 4HYKA 3BKFA 2UUAJ 2KT2A 3M2UA 1QLNA 3E01B 1J5EJ 1OO0B 4TN2A 1HNVA 4NLQA 2QSWA 1V3SA 3OXLA 2J8AA 1FI4A 2RJZA 1XK8A 4R8UA 2X1GA 3KUGA 1GK8A 2LEPA 2MEWA 4PXEA 3GONA 4JV1A 4ZK7M 5LSOA 3O44A 1HNWJ 2BE2A 4GKJF 3BO4A 4C8YA 1P1LA 4MFBB 2FJVA 2ZUAA 2M9KA 3B78A 1UCNA 1Q5VA 4RW9B 3H8YA 3BGOP 2AEJA 1TL1B 3H20A 3R5CA 3OR2A 2XO6A 1S49A 2LQBA 3AD8C 4E2FB 1K0VA 1PBUA 2HS0A 1GT8A 4UQTA 2JVOA 5LL6d 1X31C 3ZZTA 2ASDA 2E1RA 1WEXA 4QWEA 1AA1B 2QN6B 3PCOB 4DL5A 4V19J 2F5GA 4M5LA 2W4DA 2A10A 1KSPA 1U2FA 2IDLA 2PGCA 1U7LA 2CPXA 1S10A 4F4KA 1IKXB 4NX9A 4P10A 4S0MA 1FXRA 1FO1A 4IOBA 5C2GA 3N9UC 4B3MJ 3NNHA 3W63A 2DR7A 3MPYA 4RBVA 3UN5A 1WI8A 1Y11A 2E29A 2FIUA 4ECTA 3GJTB 3FCVA 2VG6B 1HNZJ 2OTLS 1SV5A 3RB0A 2I8EA 1NSQA 5D4NA 2EFNA 2XY7A 2ZJPQ 4NZ0A 2ZFHA 3R5JB 4I6WA 3P96A 5ETVA 1CBKA 2DHGA 4JV0A 2IDEA 4EO8A 1M5HA 4K4YA 4X66J 2CZ4A 4DR7J 3NBPB 4C8NA 2ZHOA 2MGZA 1TL7B 1MROB 3I9V9 2H4WB 2P8IA 3DRYA 1Q95G 1S1XB 2CPZA 4IFYA 5J2MB 3CCES 1ZZNA 4JYAF 1WTFA 4NA3A 1RUSA 1JLEA 1D9DA 3KJFB 1KQSR 1S76D 1NK7A 2OELA 5CYQB 2BKNA 3BREA 3C66A 3D3BJ 4K4SA 2N4DA 1RHKB 3KJVA 1VIXA 2CUYA 4X64F 4ED0A 1PYTA 3U02A 1NB2A 2YX1A 2DNZA 4IG0A 1QJHA 4RW4B 4ANCA 5F8LA 1N54B 5KG2A 1P9QC 1NK0A 3N0VA 2EC0A 4C9DA 1GMWD 2Z0GA 3GJSB 3KG0A 3ZZUA 2YWFA 4DUZF 1X5OA 3MMBB 1T8EA 1ICEB 3KUEA 2BJ7A 2NXJA 2C3PA 2LCWA 3G87A 3HT0A 4WFXA 3TARA 2DR9A 4U8YA 3W5YA 2UUWA 2ZD1A 3JTNA 1HD1A 4L3NA 3TANA 4DFKA 1S6QA 1YIJS 1F5BA 1E6YA 2G1HA 1DURA 2CVEA 4OIXA 1FWLA 4DX8H 2AX0A 1FT8A 3LPEA 4JI4J 4B3RF 1F9HA 2FZCB 4ZN1A 2CNKB 5KFMA 3CT9A 1YQHA 4PXBA 3KK1A 4DV4F 3H25A 4EZ6A 4Q44A 1G2EA 1RYSA 4W90B 4NMXA 4ZPBA 3G8TA 1TL3A 1TK0A 2FY8A 1SC6A 1N5TA 3GFYA 3I5BA 3DLBA 2V4QA 2YWKA 4PYAA 2D9OA 5C25B 3MM7B 3M8RA 2G2OA 2CJKA 3NAHA 4PUOA 3R6LB 4ETXA 1LK5A 3N01A 3C6TB 4QPTA 2VG7B 5HMXA 1RKJA 1PO6A 5K14B 4B3MF 1WOSA 1PKUA 4LBHA 5EWGA 2W9CA 3KLIA 3M30B 1NHKL 1UA1A 1B64A 2C2NA 4A8XA 4IRDA 5GAEU 4USWA 3GYXB 1M5PC 2C2RA 4UOFA 1FWPA 1U1LA 1F2GA 4M1KA 2NUUG 1FXDA 3GSDA 4Q7AA 4GKJJ 1LWCB 4KHMA 2DR6A 2XG8A 3G2XA 2HIYA 2M3DA 1CULB 1CQMA 1XIQA 4WKYA 2ZHBA 4DJBA 1XNRJ 3TOQA 2VUGA 3A12A 3M2UB 3NLCA 1FVQA 4O0NA 3GCXP 3G71S 3QQCD 4R8UB 1XNQF 2CYYA 1T9UA 1RSCA 2DBBA 4O3QA 3PEJA 2PO4A 2QJ3A 1YG0A 1RAGB 1PIEA 2W7AA 3CJSA 2V2VA 1IKYA 4OI6A 3GV8B 2ZJRQ 1GMWA 1RA6A 3NGSA 3GLJA 3B82A 5T14A 4C8LA 4OZNA 3RBEA 4NLXA 3KK3B 1RBLA 1YX2A 3LP0B 1V6HA 1PG5B 3QWUA 3SSRA 2PDAA 2ZH4A 1TL1A 4LF4J 3V4IB 1NLKL 1RTZA 5F8GA 5LMNF 1MNEA 4C3MA 1Y3JA 2FHJA 2IM3A 4RNOA 3GU0A 3NS6A 4LSLB 2MXYA 1MLAA 1IBMJ 4DL3A 5KG4A 2VC0A 1F1BB 2FTRA 3JQKA 4LFAJ 2R7SA 3TZXA 4DQSA 3CD5A 4HHJA 1EHWA 1XNQJ 1FRKA 2F3JA 2CDQA 1Q78A 4X4VA 2GHPA 2RE1A 4NPOA 2VFRA 3LA0A 3SZ2A 2ROEA 3M8QB 3RYLA 1W2BR 5HBMB 1JXVA 1RWXB 1DHMA 1SBRA 2V8VA 4WKRA 4RL1A 3DDNA 4WU3A 3M1VB 4B9VA 3VTIA 4DQPA 1RK8A 1NNDA 2DPJA 3GG0A 1OSDA 4FF2A 4N76A 4QYRA 2KDOA 3J80U 1UJ5A 3TEHB 1TKXA 5LT5A 3K5NA 3BBCA 1CLFA 2P9EA 4J9PA 4IDKB 4YDDB 4OYIA 3IXQA 4MYUA 2FJDB 3MFIA 1RBOB 4TYAA 1EQMA 2ZH8A 1HNXF 1NU4A 1JLAB 1AB8A 4IYQA 1TP7A 4WYLA 2MGZB 2R7RA 1EX8A 1Z2LA 2QT7A 1NUEA 2B4OA 1YJUA 2RHQB 2UV8G 3TAPA 4IOCQ 1JLCA 3HI9A 3MTJA 1VJWA 1BC6A 5AE2A 2WB4A 3MM6B 1SJ3P 2IY5B 4DR5J 1UA0A 5DDQC 2DPIA 1CJUB 2EPIA 1UJ4A 1FKOA 2DGUA 2MKCA 3RBZA 2W01A 3N28A 4ALZA 4EYIB 2DR8A 4W92B 2YKNB 5JJBA 3ILLA 1U1RA 3SMZA 4ED2A 3D9BA 3KKFA 5HN0A 4GRSA 2FVCA 3PACA 4QJVA 1DAXA 2Y1JA 1KVJA 3LALA 1HW8A 2HQIA 2ZZTA 4M5HA 4DWIA 3NCRA 5J2QB 3HMJG 3FQKA 1S97A 4LF9F 1VQPS 4ED8A 4ES3A 1U2RA 4KR0B 1IR2A 4Y28C 4DFJA 1VFJA 4I68A 3F56A 4DV3J 3WDOA 3KNAA 2PE8A 3FEYB 3QJPA 4LFBF 3DGVA 3IAS9 2CVIA 3D6TB 1NH8A 2BYCA 3C3LA 2Y9HA 3PX6A 4X4RA 1PAEX 2E66A 3I82A 3KK1B 3IC1A 1T05A 3UFCX 3IS9B 1KC8T 1RISA 5E0OA 1JLQA 4CO3A 4DU8A 3RJMB 4JI6J 3OL6A 1R8PA 1DTTA 2B5JA 2JOQA 1BQMA 2EBGA 2NXCA 1T0TV 3JS9A 1YJ9S 2FPHX 5D78A 3HK2A 3MCOA 2HNDB 4XIUA 3LO3A 4TQSA 2R7WA 2XI3A 2GVDB 2HHUA 4F2SA 3OFEA 2VQEJ 3AB2B 4ID8A 4A8MP 3RG6A 2W9CB 2VPWB 3PO5A 3TUJC 3UD5A 4C0HA 4X65J 1K9MT 1PYOB 4X66F 2JEFA 3FGVA 4BHQA 2MZ1A 2E1AA 4H54A 1PC5A 4BC7A 3HD1A 1RB0A 1UEUA 1TMJA 1NK9A 4LFBJ 4EU0A 2N7YA 2OPSA 4NRUA 1NM2A 3H98A 1HL6A 2K7JA 3W66A 2AQ4A 2YNFA 2FVQA 1ZAXA 3AHPA 2IM0A 2LA4A 2BJ8A 2EXUA 2WBRA 2ZBIA 2FD2A 3HVTA 4OZ1A 1GEHA 2GZOA 4PCQA 3V6DA 3W65A 5E33A 1SL2A 4GMKA 4RKUC 5C42A 2U2FA 1QY7A 4U7CA 2AF6A 1VQ5S 2FJWA 2M8DB 2WBMA 4ZLPA 3CUNA 5GADU 4O3OA 3DLHA 3QGHA 1NDKA 2QL7B 1TL4A 3DXSX 4X84A 4CLUA 4RUAA 1X4FA 5HANA 4XPEA 3KJNB 2IM1A 3OSNA 3HSGA 3PDNA 4C97A 2XMAA 2UUTA 1IWAA 2WVCA 4YR2A 2K06A 3ETOA 1EQ0A 4ZKAA 2YKOA 1WEZA 3MMAB 4DV1F 1YJWS 1A7GE 2LVWA 4M5DB 2YKMB 3I0RB 5K8PA 5F0WA 4CLTA 2VODA 4ECSA 2AGOA 2Y8YA 1U48A 3EVMA 2C2DA 1WNEA 3DLEB 1ZYQA 4ZVUB 3G9CA 3NKYA 1RADB 1CJKA 1RWVB 5IV3A 1QSYA 2CDRB 3H4BA 4V1Ak 4QBUA 2ZBRA 2MMYA 3PNIA 4YQWA 3QSYB 3HLUA 5I3UB 2XGPA 5HVGA 1C2PA 4CO5A 1S12A 2M5YA 3V2UC 4CLSA 5AXMA 3VAHA 2O1PA 2RRAA 3WIUA 2UVVA 4PWDA 2VBZA 3EYZA 1SQGA 5F8HA 3VCDA 3KHRA 1AZSB 2RILA 3M8QA 3PZPA 2XCPA 3CJTA 2JEJA 2AJ1A 1B7YB 1SKRA 2BXJA 1NDCA 3OW2R 2R7XA 3TJAA 1TZ0A 2KVQE 2VC1A 3BKTA 3ENWA 3TAMB 3EVOA 1U02A 4DEZA 4ZITA 5IQ6A 2QFJA 2KRRA 4D3GA 4WP8A 4TXSA 2CQIA 4USKA 3IR7B 4K0KJ 4P9SA 2C1EB 2PC6A 4WK3A 5DO2A 5T41A 3CIZA 4KT0C 4N7TA 4WFZA 4F04B 3SYZA 2J6TA 2DNLA 1FDAA 2EKYA 4NLSA 3NNCA 3MMCA 4Y2KA 2RRNA 4JOUA 4Y00A 5CCMA 4NXNJ 2B9XA 5IC6B 5A76A 1O0PA 4M95A 4EMDA 1ZAVA 3IR5B 1RTJB 2J7WA 2ZH7A 5BYQA 4DZDA 1LWEA 2JX2A 3HO1A 1HD0A 1R0AB 8AT1B 4RNMA 5L1IA 3DOMB 4ZCLA 2HQGA 3WHIA 2MSTA 2HMIB 3W9HA 4C11B 1FKOB 3CMQA 1FRXA 2CQHA 2DHSA 2EG1A 4W98A 4CCHA 2UXBF 3I6PA 4ZHRB 1X4BA 2O5DA 4FDFA 5EDWA 4QWBA 3N5FA 2QRRA 2HHVA 2AKWB 4JB8B 2R8KA 1YDLA 1S0VA 2YY3A 2JHEA 2NLWA 4WTYA 1RAOA 4I0WA 4F0KA 2F7VA 3QIPB 1S1TB 1JNRB 2DNQA 4GO7X 2D3OR 5J2QA 1JJHA 1LNQA 4UOGA 2ATCB 1NZAA 2HNYA 3HFVA 4CH0S 1P6TA 3H2UB 3D54A 3K8VA 4BWMA 1Q5YA 2J9DE 5F3TA 2HPUA 5I4MA 2KM8B 3G6VA 4LF8J 3I96A 1RT2B 1IQZA 2D9PA 1N56A 3TVKA 1TELA 2N82B 5HROA 2G9OA 3OTCA 1SL0A 4LT6A 2VB6A 2P2CB 1S0OA 2BKOA 4DHVA 3RBDA 2L9NA 2XSJA 3PIPQ 3PYFA 3VAKA 4F4WA 3VWSA 2FGCA 1FX2A 1WD6A 3OR2B 2UUCJ 2CNNB 1W2IA 2A3JA 2GW8A 3D6FB 4J7CA 3CTRA 2Q43A 4NASA 2AP6A 1S6UA 2ILYA 2OEJA 2WOMA 4USHA 3CIMA 4URGA 5KT6A 4FF4A 4PQUA 2KFZA 1RXOB 1YJNS 1SKWA 9ATCB 3ZZ0A 5GAHI 3EXYA 2OPQB 4NLGA 2Y1RI 3GILA 4ECQA 1VK8A 4KTQA 1B70B 2RF2B 4O4GA 4TQRA 2HG4A 2OPSB 5MAOA 2Q6CA 5J1EA 1YZ6A 2YNFB 2V34A 4HACB 2DNMA 4O3PA 2V4JA 2HK3A 3HZGA 3G6YA 1FE0A 2E7WA 2DIUA 1NDLA 3A3NB 5F8NA 2VBWA 1LEOA 4X62F 2BKPA 5ETRA 2KFNA 2FC9A 1RWMB 5ETKA 3WQPA 3FBCA 4LRBA 3ETMA 4DX7A 5EWFA 2LLZA 4DV5F 2BABA 3TZZA 4WE1A 1FE4A 4FYWB 1SVDA 1FD2A 4F3MA 4WIQA 3DHXA 2NREA 2MZSA 3W8PA 4F25A 5D15A 2JZ5A 3A1YG 3LOUA 3R6GB 5KFQA 4M5DA 1S1XA 1WJ9A 2GJFA 2VU5A 4LIWA 5L9XA 3SQGB 5KG1A 4N41A 2WTFA 1JXLA 3CJ2A 1KN6A 3V4MA 3C8YA 4YUDA 4H4KC 3E2EA 3MXHP 4M5KA 3D4JA 1D8YA 1BLUA 4LJMA 4P74A 2CQPA 5I3UA 2ROPA 3K58A 1VC6A 4OLOA 1QM9A 3RAXA 3ZTSA 4PWDB 2GCFA 5THWA 3PX4A 4CLWA 2PFDA 2MY8A 2HQCA 3PX0A 4GVBA 2CRLA 2RS8A 2R4FA 3Q8VA 4HHUA 2YPYA 4RUHA 1AZSA 1W25A 4C8KA 2E1CA 3RB6A 4EUVA 3K17A 3W7BA 5K8NA 3A8JA 2XCAA 1YSJA 4OX8A 1XMOF 4KBIA 1NJXA 3R2DJ 4Q0BB 5KFLA 1KBRA 3PYGA 2MB0B 2EG2A 4DR1F 5AE3A 1UTAA 2Q79A 2RVJA 3DOKB 3I87A 3CJ8A 3ULHA 2QA1A 2VKRA 3AD9C 1FX4A 2VFVA 2OUGA 4F36A 4CWBA 2YNHB 4OJHA 4F26A 3MEKA 1I1GA 1HNXJ 1PC4A 1WHWA 1NHVA 3BO3A 2UXDJ 2R7OA 2C3MA 1WKJA 3ZNUA 5G0RB 2UUAF 1RTJA 5AJ3J 2EK6A 1RCXB 4F4AA 3BDPA 4DR5F 4LVNP 3T1HJ 1R0AA 4K4ZA 2DRBA 1HNIB 3EM1A 4DZ6A 4CIOA 2RHSB 3A8EA 4GVLA 4C11A 3T6JA 3CCVS 4LVOP 4DQQA 3KLIB 1X4CA 4Y0FA 3N4WA 3TJ8A 3PXGa 2AGQA 1FNXH 1TU0B 1U09A 4LUBA 5HQ8A 3HX9A 2D1CA 3GSIA 2MQLA 2ZE2B 3R5BA 5HMZA 2ZZMA 4AD6A 1CS4B 4Y2MA 4KC5A 4RW8B 3HVWA 3KDOA 3CULA 5E5NA 1KLMA 1FFSB 4TLRA 4ZCIA 2V94A 5F0UA 2ACYA 2HW3A 5HVHA 1NSKL 1N0VC 2CQCA 2VBXA 3BBFA 1EB0A 4KGVB 2D74B 4OZ0A 2DNHA 1RAHB 4WTOB 4DLEA 1N6QB 3OVBA 4HEA9 2P5VA 4OYMA 2RSQA 1HR0F 2XTJP 3OHAA 2WVDA 3EJMA 5ITHA 1JB0C 1LWFB 1FNOA 5IV4A 2AHOB 5K20B 5MLCV 2F4VF 2V5HG 1SJ4P 2MYFA 2E9ZA 4K50A 5KG6A 2ROGA 3K5LA 1GXTA 3TO8A 4NYZA 2HFNA 3H59A 5A8KA 4FBUA 4WZMA 1M1HA 1VLOA 1KR4A 4OI2A 3M6WA 2HHXA 1RDRA 2V2KA 2XSJB 3MCNA 3MI7X 4J9KA 2GX8A 2I5JA 4M5IA 1RT7A 3D0IE 2JEIA 2WVBA 4RUCA 3DRRB 1HBOB 2A6OA 3MR5A 3PRBA 3EICA 5C5JA 4WCEQ 1S6PA 1S1VA 4DL0C 2DRDA 2RKIA 1WTBA 2V50A 2X3DA 4ECRA 2FLNA 1RJJA 4F0MA 1WDDA 3RRKA 5KFTA 4F3QA 4JYAJ 4HR2A 2YQ3A 3HD2A 3O2IA 1CJTA 2FJAB 2HSEB 5ETOA 5FDLB 2GO9A 1VHIA 1E6VB 4K7QA 4ZP6A 5J2MA 2X1FA 5LXRA 2AEMA 4HACA 2HVHA 4H4OA 2OP5A 2CNLB 5F9NA 3VAFA 4ED6A 1N4LA 3CD6S 3GG1A 4P7TA 3M8PA 5J2NB 2HGNA 3N6LA 4DPUA 1HARA 1UWBA 4ZLJA 2VIHA 4JI3J 3Q24A 3C2PA 3D5MA 4IFVB 2BVZA 3QFHA 3SEOA 1ITPA 2C2ZB 3QO9B 2D3ZA 3JSYA 3FJ2A 4U6PA 2R7UA 4DLGA 1NEEA 3NWRA 2DO4A 5JMNA 2O01C 3QIDA 2RU3A 3PV8A 2ZJQQ 2XMKA 3RR8A 1BWVA 3R5GA 4FXVA 3UW1A 1UEVA 1IKWA 2D69A 4M5GA 4Y2IA 5D0RA 1L3UA 1CEZA 1WC6A 1VQ7S 4B02A 1X4EA 2VFUA 1QE1B 2CPJA 1WF0A 2XMTA 3I4PA 3QJLA 4JV5F 2CQ3A 4NLVA 3TW0A 1NK5A 2VL1A 2MY7A 5BXIA 2IJFA 3FMWA 2OEKA 1F3FA 1ZTWA 4KGKA 1WELA 3T5KA 1H3DA 1O5JA 2DCUB 4J9VA 4P7VA 2V4RA 3QLHA 5D77A 3MR6A 5L38A 1BQNB 2OLWA 4LR8A 3TZWA 1AYEA 4LF5J 4O3SA 1S4FA 4MKBA 2DGQA 1OSCA 4A4JA 1CC7A 1DBDA 1OPZA 2V69A 1SJFA 3HXMA 1T94A 4RUBA 2GGPA 5IT9Y 3SFGA 2SXLA 1FEEA 1NXIA 4NI2A 4IG3A 2NZ4A 2CAJA 3KDNA 3DKDA 3FDSA 3H0PA 3ZFVA 3SSSA 3E51A 4FNHA 4EWTA 4F0HA 2VKZG 5CCLA 1WOOA 1KONA 4JI1J 1FD8A 2R2UA 1RWPB 3BV8A 3O3LA 4NL5A 3SSQA 2F9JA 5LXYA 2LECA 1XWLA 4Y2CA 1ZM3A 4OX9F 2HQFA 4FN5A 4U8VA 2IBOA 4X4TA 2BW2A 3Q8YA 2RU9A 3L95X 2B4VA 3TA1A 2LXUA 1HFEL 4CRJA 5DQGA 3L9ZA 2VA2A 1JIHA 4P6QA 1RZMA 5CABA 5LJ3Y 4DS4A 3R5DA 1SL1A 2XWXA 3NS5A 4DR1J 1QVGR 3KG4A 4ZPWR 4X4UA 2VFSA 3G82B 2ALZA 1PGZA 2DH9A 2POKA 3I55S 1RT4A 1GMUA 2J5AA 4QWCA 2IC3A 3I4HX 3M7VA 1DQ9A 4O44A 7AT1B 3G8SA 1EJ7L 2YX7A 3JSMA 2HAFA 3ZZYA 1HBUB 2GV1A 3PR4A 1R0BG 2UXDF 1T3OA 2EC2A 2DXFA 3MDFA 3VZIA 1URNA 2FC8A 3OQ2A 4ZVHA 2HEKA 3UD3P 2ASYA 4OHYA 2ZE2A 2BEFA 5HSPA 4CH1A 4RW8A 2LA6A 1RT5B 3GYNA 2YPZA 3OTEA 1KLMB 3DMJA 3MPVA 4OYZA 4UT4A 3DRPA 3MM9A 4HH0A 4CM2A 2WVFA 4ED3A 1Y5LB 4F3OA 2OFHX 1AFJA 1GAOA 1C1BB 4NLPA 5H9EJ 1IVZA 2VFTA 2BZ2A 2JVRA 4UUWA 1ZBTA 3DM2B 5CYMB 2BJEA 3QGIA 5FLXU 4CO1A 3CF5Q 2EK1A 1SB6A 4RNFA 1D9FA 1OQ3A 9RUBA 4N56A 1N8RT 5DGBA 1VQNS 3J7YU 3BJYA 1Z4UA 2FZGB 2MKSA 1X4GA 3HHLB 3MD3A 4ILRA 4L6V3 1RGVA 1KLNA 4DR4F 5E3AA 2DT9A 4OYPA 5B0EA 4AL7A 2PI4A 2X7IA 3ENQA 3EXCX 4WPAA 1NBEB 1IBKJ 1I5OB 3G6XA 3TUPA 3IWLA 3BYRA 2BQRA 2YXLA 4DX6A 3NY0A 3VGVA 3S8SA 3C16A 1HW9A 1RAIB 2PEBA 1RQ0A 4U67Q 5BJRA 3OJUA 1S1VB 2A2DA 3M32A 1ZETA 1NDPA 3MTKA 5E41A 5HMYA 4NMLA 3W9IA 1VQKS 5DM6Q 2VONA 2HWHA 2HURA 4J90A 3SV3A 5EUHA 4AT1B 2NUHA 1VOMA 3QRQA 1U47A 1IKXA 4L3KA 4MKYA 3ZTRA 1UWAA 1B0VA 2QV6A 1RT1B 3PYEA 4XTTA 3OLBA 4LF6J 1S9GA 2R42A 1QUVA 2BW7A 3C14B 4QIVA 1F2HA 2RT3A 1VHFA 1WSVA 1TV6B 3CXCR 3M8PB 3FZBA 3DLJA 3VAMA 2G0CA 2JH3A 3UO0A 2YKPA 1YGYA 3X1LB 2HRUA 2NPIA 4IFVA 1N33J 2B4PA 2VDIA 3K89A 4IH6A 5KFZA 2AJ4A 4HVZA 3LP2B 3AJ2A 4KO0B 5IZHA 1JJ2R 3MMCB 2G2ZA 2ZKUA 3MOJB 3KLGB 3GIMA 2NPFA 3VV2B 1NCLA 3BPSP 3ZTOA 4B9TA 3EGZA 2YQ1A 5B0DA 1HIYA 1U6ZA 1X4DA 1S48A 2J0SD 1MROA 1D3WA 2MJUA 2EEYA 2WONB 1T03A 1Q53A 3ILIA 1F5CA 2PT0A 4URQU 1KNZA 4GKKJ 2A0FB 5D4OA 3HULA 2AZ3A 3SQOP 5B0CA 2HMIA 4O4RA 2QLXA 1G1XA 3LAKA 4TU7A 3BSOA 4Z37A 1TUVA 3CCUS 1SKUB 2JFDA 2WHOA 3GFZA 4NYPA 3CVKA 4P52A 4DL4A 1VRUA 3BN7A 4LF8F 3ICLA 1BQNA 1N33F 2YWGA 4KQZA 3CSKA 1BQXA 5ETNA 4QU6A 4N8NA 4NOHA 2V9WA 1HYSB 5LM7E 3QGPA 1DLOA 4HLBA 4J9UE 4F67A 3W61A 4HDHA 4NI2B 2NQPA 4QIGA 3NS7B 2OPRB 1RLCL 3IG1A 3D0GE 4LRFA 1E6YB 1SUQB 2UUCF 1FRMA 3MM5B 3KLVA 5CQGA 4I6YA 1FK9A 2DY1A 1YBTA 2QLWA 3M8YA 4KFBA 2LDIA 4DU7A 3MR3A 3MPUB 1OY9A 4MJKA 4ZVSB 2MQQA 2ZVSA 5ETLA 3KHHA 3D6HB 3Q22A 3TQ1A 3WC0A 2GC8A 2ZH6A 1KEKA 3ZZOA 2W2MP 4OZ2A 3QZ7A 2NXUA 4ANDA 4ECXA 1KTQA 4P72A 1WC0A
chains in the Genus database with same CATH topology
4IUFA 4KE5A 5AJ3F 2MKKA 2FY1A 2KH9A 2IC3B 4PQUA 3JSMB 2H5EA 1Y00A 5A6WA 2M0GB 2WOMB 4I67A 1LOUA 5DDRC 3TVYA 4QW9A 4OI4A 2KRBA 2L48A 3M30A 5LJ5Y 2E5LF 3SDEA 4BDPA 3I0SB 3CCTA 4DV6F 3CDBA 5L1KA 3ENVA 1VRTB 1VLYA 2IHR1 2V4JB 2EBEA 2R7TA 4JI3F 1FKPA 4QOTA 4U7UK 3IWNC 2B6AB 1DFDA 2RD5C 2WCXA 5KFIA 4ELUA 3DM2A 3TA0A 1NB7A 1XR5A 2PD1A 1U1QA 3T9NA 2F9DA 2APOA 1UAWA 1N5VA 2E5HA 1NK8A 4NRTA 4EYHB 1UJ6A 1XR7A 2VQFF 5KFNA 3PKYA 3T5JA 4NWBA 1LXNA 3DRSA 3NCPA 4PWUA 3KK3A 4FF1A 1RAJA 1Z1ZA 1FRLA 2E9RX 2FVPA 3NP5A 2DNRA 3G96A 4XDCA 1HI1A 3DNCA 4E0DA 2GHVC 4ILMA 3G8QA 3ITHA 3M32B 4C4WA 4TU9A 1R3NA 2GNKA 1GXLA 5DM7Q 3UCGA 1H98A 2XWYA 2FJBB 2W25A 4YY3F 2AYBA 4C7QA 1NJZA 1HI8A 3DU6A 1GX6A 1LK7A 2IA6A 1IBMF 3Q8RB 4ES1A 4JI6F 1EP4A 1VGYA 2CJ9A 4BBYA 1A9NB 3PR5B 3KLHB 1VQYA 4QIWD 3V6JA 1U6BA 3ZZRA 2YNGA 2WSCC 2Z2MA 3DCAA 2I9SA 1Y5IB 4USJC 2MSSA 2I1RA 3CD7A 3O5TB 3KLGA 2BA9A 1T7PA 2FLPA 4NZ7A 1KOOA 3CDWA 2DR5A 4OLPA 1HI0P 3MM6A 3RZAA 2UVUA 2RQCA 1ELOA 1JNZB 3R1HA 3I31A 1AW0A 2FHJD 2BQ3A 1VQSA 1G3OA 3OTBA 1P1TA 2J9EA 1IKVA 1Q8BA 2W8KA 3CPWR 2HLUA 4RLEA 2AYGA 2J6SA 2HNZB 3FMBA 4PXCA 3CJKB 1HBMA 3HT3A 3K5OA 3LH2S 1GQEA 5SUHA 3KTQA 3MPWA 1QSSA 4I2PA 1DLOB 5M2PA 4NCGA 2BRKA 1U6FA 4MH8A 3MR2A 2JC1A 2MZTA 3THVA 3MEDA 4HKQA 1URRA 4DG1A 1HNVB 1YRUA 2XHWA 5IT4A 1WG1A 2GIRA 3UDCA 3MM5A 1SI9A 2QMWA 3NRBA 1ZOTA 2BUNA 2V0NA 2VV5A 5CYJA 5F8IA 1JLQB 1JKHA 1TKTB 1MU2B 3CCWA 3H5YA 3I5AA 3Q23A 2HHPA 4FYDA 4I64A 2CQGA 3HHLD 3TVZA 1RTDA 5KFDA 1K73T 3HHDA 3K5MA 1UL3A 3DRRA 4KKOA 1HA1A 2P6SA 2QA2A 1QAYA 3M6XA 3M05A 4IR1A 2X1BA 2PSZA 2XEXA 5B0FA 3DFEA 1UW4A 1REVA 3H5UA 4FVMA 5HI7A 4JV2A 2VOOA 1SJ1A 3LF0A 4OZ5A 4UW2A 1NK4A 1VRTA 1T02A 4CT9A 2VQEF 5I42A 1FDBA 2ZBCA 3J81Y 3HVTB 5CHCB 1LXJA 1SH2A 4CTAA 4DMZA 3V6DB 2CPYA 1IXKA 2B6AA 4RBTA 5C42B 2DNYA 1A6LA 3RB3A 4Q5VA 3F44A 1N5QA 2RQKA 2OSRA 4HTIA 4K4VA 2MQPA 3JSRA 1ROFA 3J7A1 2CPHA 2RMLA 1UVJA 2FUG9 2I0XA 2DR7A 2KT5A 2HLTA 2JRSA 2YKAA 4J9SA 4O0IA 4RWXA 5KFRA 2KO1A 1KD1T 3C46A 1Q1KA 3SI8A 1JK9B 3JTOA 6FDRA 2Q3PA 4XK8C 1X8DA 3RAQA 1S9FA 1J5EF 5JUMA 4XO0A 2DGOA 5L39A 1VQLS 1FXLA 4HTJA 1WWHA 2IJNA 1U25A 4ED7A 4DOZA 3OV7A 2ZOGA 2XS2A 2K1RA 2ZH1A 4ICLB 3B8HA 1IJFB 4OZLA 1I6JA 2LDYA 5D3GB 1JLBB 3M2RB 1O8BA 4YDXA 1GNKA 2UU9F 4YR0A 2DITA 2DGSA 1B0TA 4K0KF 2AD9A 3K57A 4M8LA 4RZRA 3LP1B 3GIIA 2YKQA 3OLAA 2OSQA 1RT6B 2AJFE 3VQSA 3M4XA 1ULRA 4J5OA 2XO7A 4DV4F 1KQKA 5DGAA 3W2VA 1S6QB 4X65F 1KQFB 2NR0A 4CQ1A 1Y4ZB 1N52B 2GMLA 2GMJA 4OI3A 4WK1A 5DETA 2YNGB 4UY85 4ECWA 4UOCA 1T3NA 1QAIA 3L3CA 1SXLA 2FJXA 1IM4A 1N5YA 1L3VA 1L3SA 5DDOC 4M63A 3ZZPA 4QR0A 2QYCA 1DARA 2KKHA 4AUKA 2K3KA 4C98A 5C25A 3HVAA 1R8BA 1RT4B 5SZTA 2CPEA 3DOMA 3C6TA 2JSXA 1HBNA 2K2PA 5HP1A 2KJWA 3D28A 3FEZA 3WZ0A 4IKAA 4A46A 2CPDA 4ZHRA 3V6KA 4ZPCA 2CIMA 4ZPTR 5HL7Q 2KT3A 3DXBA 4TKTA 4XDDA 3DLKB 4H4MA 4TNOA 3G6ES 3AAWB 3MUTP 4B08A 2NS1B 1KVIA 4FS1A 3BQ2A 4KIAA 2JLGA 3QIPA 4FZVA 5G4DA 4WU2A 3RRGA 2HNYB 1K8AT 4BCAA 2VG5A 2KB2A 2VASA 1Q7YT 3MOZA 2IM2A 4LF4F 3T1HF 2KHCA 3LUYA 1CC8A 5L8RC 1PILA 1L3KA 5J1PA 2XY5A 3HP6A 3SCIE 2GQQA 1LKZA 2R2RA 2CQ4A 3LGMA 4WFYA 1XBWA 2YNIB 5HLFB 4Y34A 2DNNA 1PSDA 2HWIA 3ISND 3ISNC 4TYBA 2G1DA 4LF6F 1VC0A 1X0PA 3U27A 3W2WA 2XLIA 3ISZA 4KKOB 3CJ4A 1TAUA 1GTHA 2ERRA 2CQ0A 3CJ5A 5D4LA 2YH0A 1TFWA 1REVB 3U1NA 2CG4A 5KT3A 2ADCA 2XSFA 3CCSS 3QYYA 3H2VE 3GFXA 1U8SA 1S9GB 1HPZA 1TKZB 1BY9A 5I42B 3CE8A 4ZA1A 1H2VZ 1HQUA 2DHAA 3K7RA 1UETA 4ATNA 2ABYA 3H40A 4C2MA 2W9BA 4A8QA 2P6TA 3LW5C 5AXNA 2X1AA 3FNNA 4GKKF 4ETZA 4ECYA 3SXLA 2QMXA 1WF1A 2UZAA 3DHWC 4RW7A 3NL0A 1RI7A 1DQ8A 4K4UA 4ED5A 4DSKA 3D1HA 3M6VA 4JUZA 2BRLA 1JLCB 3AA8A 4MK9A 2ATLA 1I94F 4I56A 3MUVP 5KAKA 2MHNA 2R7VA 2BQUA 3TP2A 3V6HA 3CMAS 3UWTA 3AQPA 2DGVA 5E3CA 5IFMA 1D0EA 4WXOA 4ECZA 2YH1A 4PG8A 2Q6BA 3O8WA 3VF0B 1LW2A 2DIVA 6FD1A 2BOPA 3IRXB 2MJNA 4Z2XA 2WSFC 5KFCA 1YJVA 5E3QA 3O6QA 4ED1A 4LMZA 2DVIA 5HMWA 3LP1A 2PIIA 5KG5A 1AXQA 3T9ZA 1RT6A 2OPRA 1S7HA 3IG1B 4D3HA 3LWMA 4A8YA 1JMTA 5IXUA 5F8MA 2BR0A 5D8HB 5LSRA 3SCJE 4F4XA 2UUBF 3VR1A 5EN1A 2N3LA 3U1LA 4KPYA 2IRXA 2H9ZA 2J7UA 3M2VA 1FK9B 4TY9A 2HGLA 3T5LA 3T1YF 4IRKA 1APSA 4LQ9A 3MF5A 4Q45A 1N5YB 3QPIA 2M52A 4I7FB 1DTTB 1FA0A 2B5JB 2NSBA 3S7RA 5KG3A 4EO8A 2FLOA 3BO2A 4ZS6A 2CQ1A 3KLEA 2MKJA 1O51A 2HNDA 3FSXA 2AGPA 4DF4A 1IJEB 2ZZNA 4U9RA 1JLFA 2YWEA 5LSLA 5JVHQ 2PI5A 4B3OB 1HMVB 2OJ3A 4KAIA 1FRHA 3FVYA 3THPA 4MIBA 4PG4A 5DLGA 4OHZA 3QWPA 4B9LA 1M90T 2OH2A 4JI4F 2AX1A 5F9LA 3DLKA 1YRXA 2GQCA 4DSJA 1GX5A 4WFBQ 3OR1A 4HH1A 3T3FA 4ECVA 1UFLA 2JFKA 5F41A 1S9EA 1XR6A 5T7LB 1FTCA 5A8WB 1U49A 3WBZA 4R25A 1U1PA 4KV8A 5DJBA 1R8AA 2MDAA 3DYAA 4C8OA 5KTQA 3JTPA 2PA3A 3FZ2A 4AXIA 2CKWA 3KK2B 4QIEA 3GIJA 2R9LA 4ILLA 4V19X 2YKMA 3I0RA 2K7KA 2UP1A 4NLDA 2B43A 3UPFA 3EZ5A 5EWEA 3EGNA 4NLTA 1OWXA 1RT7B 3BGRA 4K5RA 4FS2A 2YVSA 2BANA 4R0JA 2FVRA 2WB1D 2Y0SD 4DR7F 2DGXA 1T95A 2RKIB 5KFJA 4DV0F 5EX0A 4OJ1A 5KFYA 1VI7A 3CO9A 1FEHA 2Z2LA 1X4HA 2KHDA 1XC9A 1VQ8S 2VOPA 4HI1A 2IMOA 5H9FJ 3Q8PB 4Q8FA 5IT0A 1HWIA 1GH8A 2M8HA 5K5MA 2CPFA 3IFEA 4B9NA 1LV5A 2E7XA 2LU2A 5F3ZA 3GWCA 2ZDOA 4OX6A 1MMDA 3TAMA 3I56S 3RU0A 2QSFA 2W9BB 3GE9A 1SQEA 1UWBB 1SV5B 4O23A 1QAXA 1VQ6S 4LSNA 2F1FA 3QO9A 4DSIA 4DR3F 1X9WA 3D1OA 1DTQB 2JL9A 4RW7B 2ZHAA 3KMQA 1UVNA 2OO4A 1P8GA 1VMBA 4ZPAA 2MQMA 2GFFA 4A8SA 2ZNYA 4DL6A 5KFVA 3Q8SB 2E5GA 3HF5A 4DDFA 4F4ZA 3E3XA 4CNYA 2XBPA 3M9NB 3HDSA 4M94A 3P49B 1Y9OA 4K59A 5CYQA 5E2QA 5BR8F 3PW5A 3V5RA 2MZJA 1HNWF 1Q86T 4RNHA 1XNRF 1Z2ZA 1H7WA 4G1PA 3CJ0A 5BYSA 4EGLA 5E7OB 1J2VA 2PMHA 3PEHA 3PVXA 2XULA 4I2PB 5GVQA 4YFUA 3PW4A 4HT5A 1C1CA 2ZD1B 4EO6A 1Q8IA 1FJ7A 1LFPA 4OFZA 2KZMA 3GR0A 2G13A 3KFWX 3KWMA 5KFBA 3MAHA 2VPZB 5KFWA 1FDDA 2BJDA 4NA1A 4ELVA 2QE5A 1SH3A 5IM0A 2ZKTA 1MU2A 5KFOA 3MEGA 3QMQA 3BQ0A 1FKAF 4I4BA 2C3YA 4LQ3A 5KFFA 2XNQA 1HWUA 4PXDA 1HNZF 1P27B 3MM7A 2RS2A 2VPYB 1KRPA 1RYRA 1JLFB 3PJXA 2UXCF 4I69A 4X4NA 1F5AA 1KOHA 3LAMA 1RWUA 5FJ4A 1MWZA 2MKHA 5CZVA 2KXNB 5KT7A 4DR6F 4KGMA 2JC0A 2RF2A 4O4GB 3DMJB 3DOLA 5D6GA 5J1EB 3J7ZT 2AJQA 4IQMA 2XZWA 4YEAA 2KYZA 4G1QA 1ZPVA 4CTAB 1JX4A 5T7LA 3CEDA 4LF7F 4F02A 1OPIA 4BS2A 1R8CA 2KYXA 4GO5X 2KI2A 1KHVA 2LYVA 3S01A 3IO1A 3DYAB 5A8RB 2KVIA 2I2YA 2Q66A 3KK2A 1NAQA 3I32A 1Y7PA 2AJ0A 3MUMP 4B3SF 1IUJA 4CH7A 2IRUA 2DTJA 1UKUA 5IWAF 1D8ZA 5AXKA 4WIIA 2L9DA 3BGRB 2HAIA 2C42A 1NRKA 2BANB 2K1RB 2ZH3A 2C22A 3Q0AA 4IH7A 1WI6A 4N5SA 3PW0A 2HHSA 2F8MA 2OPPB 1S0NA 4B17A 3BEGB 3M2RA 4OI1A 3HJFA 2OTJS 3BR8A 3UDLA 5DG7A 3C6UB 1RT1A 3OFHA 4PR6A 5M2RA 3M9MB 5BYRA 2B4UA 3M1VA 2HVIA 3BF4A 5J2PB 1YTYA 1TV6A 4ZCMA 3NWGA 1TKXB 4LSNB 5KOXA 2RUGA 2D3UA 3BDEA 3PM9A 3DLGB 2YNHA 4IDKA 3TUZC 5KFAA 3MAQA 1DRZA 3DU5A 4C0BA 1J5OA 5CH7B 4KB7A 1Y3KA 1N5SA 5ADZA 4ZP7A 1FNMA 1K1QA 4Q8EA 1WHYA 1CQNA 3T19A 3AJ1A 1S6OA 4DV2F 1C4AA 3FRZA 3UNGC 2JJ4D 2XGQA 2DO0A 1UP1A 3L09A 3EPIA 3CJ3A 1KHWA 2BM1A 2CZVC 2XNRA 3NMRA 4F8RA 2GIQA 1R43A 3CCRS 4RW6B 1UFWA 4TY8A 4DPOA 1U1NA 4NLWA 4QCLA 3FFIA 3QAEA 4NYOA 3BSNA 1NKBA 3BM7A 2DGWA 1R7IA 2MQNA 4I6AA 4O3NA 4R5PA 1ZM4A 1VQMS 2WSEC 1HQEA 5L9NA 3POTB 5CXTA 2ZH9A 5A0YB 3Q2TC 2QIFA 3TYTA 1C1CB 2CFXA 2DH7A 4OHXA 4C3KA 1LQ9A 3CWJA 2VG5B 2O3DA 2CQ2A 3HKZD 2NSCA 1LW0B 3ZC4A 4B9MA 4MKYA 2LEAA 2W24A 4JI1F 4IOAQ 1OIAA 3CC7S 1U1OA 2XMWA 4KFBB 4HDGA 4ZMMA 4MFBA 2DNPA 2N7CA 1CSJA 1H0HB 2L9WA 2PA8D 2WAQD 1OQ6A 3N6NA 4QIFA 1ZM2A 7FDRA 2C2EA 3FQLA 2DNGA 1SKSA 2ZOMA 3FEXB 4I2QB 4YB7A 5DDPC 4B9SA 5I3PA 1FJCA 3U7JA 3OHBA 4PQUB 1Q7LB 3OL9A 1F60B 4QR1A 1X0FA 2M70A 3RTVA 2GHWA 2A1BA 4QPXA 5M2UA 3WC2A 3SDEB 4CNZA 1VS3A 2C28A 5AE1A 1TAQA 2CJAA 2VZ9A 4A48A 2PFFB 2E9TA 5K9FA 3FCHA 3DOLB 1KFSA 1YVFA 1E6VA 1TVRA 2EWHA 3QGGA 2F8EX 5A2QY 5B08A 1HPZB 1TKZA 4MAKA 4MK7A 3FRYA 1FERA 3PFOA 1HQUB 5KOWA 3OJSA 4G1QB 3PRDA 2B7BB 2VG6A 3KNGA 2O66A 1Q16B 3THTA 1VQOS 1L3TA 4RU2A 5E3RA 4NXMF 1C0TA 3IR6B 5A8RA 1TFYA 5JXSA 4YB1P 2AYEA 1FJGF 4DV7F 1L5UA 4MMOA 2R8GA 1FJEB 4IO1A 5C24A 3TR5A 2AYMA 4A8WA 3K8WA 1N48A 4N77A 2LU1A 2QA4G 3DLEA 3OVAA 2HWTA 4PG7A 4AXJA 3H5XA 4BC9A 3TUIC 5DQHA 3V81A 2OAUA 3CC2S 1TR0A 2ZITA 3MCSA 4DUYF 5GAGU 2OPPA 3OBIA 3HVRA 5DQIA 1X5SA 3QLHB 5F8JA 5JVGQ 1XMBA 1YWXA 3CCZA 2UV8A 3K59A 1HWJA 3GMGA 3C6UA 4FF3A 1X5TA 4WZQA 1TK5A 5FD1A 3BGFA 1YITS 1H2UX 1Q4RA 3HZEA 3CGIA 4J9QA 1MW7A 3RR7A 1RTIA 2EFOA 1UMJA 3BQ1A 4I1TA 2KM8C 3B4DA 4J9RA 2XMMA 2AWZA 4X4PA 3S6EA 5AXLA 4IO9Q 3PHEA 4I7FA 2KZZA 2RDIA 4L72B 2DNKA 4C0OC 3TA2A 5KT4A 2B56A 1YJRA 3IAM9 5B0GA 1TK8A 3TRGA 1S77D 2XB2D 1M0SA 3R27A 2HYIB 2J76E 4O44B 4YB6A 4MYTA 4F4YA 1HBUA 3KG1A 1RTHB 1NJWA 1FESA 2UVWA 2PN6A 3G86A 4YB5A 1H38A 1NK6A 4WYWA 1FF2A 3EGWB 3T5HA 4DSFA 3DC2A 3CJKA 1V3RA 3HPOA 2B0GA 3DRPB 3MM9B 1VQ4S 7FD1A 3KLFA 4R5PB 4J9LA 3BZQA 1HHSA