4E8UA

Crystal structure of arabidopsis idn2 xs domain along with a small segment of adjacent coiled-coil region
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
166
structure length
166
Chain Sequence
DEKLVYPWKGIVVNIPTTKAQDGRSAGESGSKLRDEYILRGFNPTRVRPLWNYLGHSGTAIVEFNKDWNGLHNGLLFDKAYTVDGHGKKDWLKKDGPKLGLYGWIARADDYNGNNIIGENLRKTGDLKTIAELTEEEARKQELLVQNLRQLVEEKKKDMKEIEELC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein T8P19.180
publication title INVOLVED IN DE NOVO 2-containing complex involved in RNA-directed DNA methylation in Arabidopsis.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Rna binding protein
total genus 49
structure length 166
sequence length 166
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03468 XS XS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2890 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4e8uA00
4E8UA
chains in the Genus database with same CATH superfamily
3HZGA 5IV4A 2N4CA 3KHHA 2XYHB 1SL2A 1S1UA 1SJRA 3TW0A 2A0FB 1RHQB 3L7PA 1FEHA 1T3OA 4J37A 3Q0AA 3DOKB 2HBRB 1DQ9A 2CZ9A 3JYTB 1J5OB 1GXLA 4JI4J 2BBEA 2V0NA 2JFKA 4OLOA 2R7SA 2B5JA 5K14B 4DPXA 4DV4J 4IR9A 3JXOA 2IIHA 3HVTA 1U1RA 4O44B 4FKXA 1T7PA 3OJUA 1CVJA 4C8LA 2NZ4A 4PCQA 3GTYX 5A8RA 3VWSA 2HKEA 2J0XA 1T03B 3FRZA 5F41A 2NUHA 4OJHA 4WFXA 1FX4A 2GHWA 2WVEA 2Z58B 2G1HA 1DQAA 4WTYA 1FJEB 1U2RA 1Z1ZA 2X7IA 4BWMA 3O6QA 2W7OA 1VMBA 1R8PA 1IBMJ 3P5TL 4DR6F 5ETTA 1ZZFA 4OLPA 4IO1A 1Y5LB 3P3DA 4EYIB 2RILA 1PO6A 4NXNJ 2JZ5A 5D3GB 2DRBA 1DTQB 4OHWA 2E5GA 3TJAA 5HP1A 2B9EA 3M2UA 1U6ZA 2KT3A 1FX2A 2BANB 2LEBA 2HQ3A 2YPZA 1C0TB 2NREA 1C4CA 4LFAF 2E5JA 2HFUA 4P73A 2KYZA 5CYMA 4DS5A 2ZUGA 1NK4A 2ACYA 2DNPA 3D1OA 2UXCJ 1URRA 2W2NP 3LAKA 1HHSA 2ATCB 2LU1A 4JI2F 1RUSA 4RZRA 1X8DA 1DZ5A 1KFSA 1JJHA 5T7LB 3GR0A 5F3ZA 1QSYA 4GVBB 4ZCKA 4BBYA 1P9QC 2R42A 4B3OB 1BHNA 3WQPA 1ZM4A 2VFRA 2I1RA 4DG1B 2J6TA 3NMRA 2G13A 1UCNA 3LO3A 4DR3J 1QUVA 4GKJF 2HZVA 2PI4A 3E8OA 5M2UA 3PO5A 3K58A 1X5OA 2DNZA 3G86A 4HH1A 3SEOA 3ZTRA 3GFHA 3BGFA 4G1PA 4IH7A 2CVEA 1SQFA 4TU7A 3A3NB 2QA2A 2DH8A 4H4MB 4OHVA 1V5IB 4ZCIA 1QAYA 2POKA 1S9EB 3AFGA 4LRDA 3OXLA 2V50A 2DXEA 2IC3B 3OBIA 4MIBA 2RKIA 2MGZB 3SYZA 4O3QA 3DLHA 4MKAA 2VPXB 5B0AA 3DLLQ 1N4LA 3QGGA 1RABB 1VJQA 2KFZA 4OI6A 2A3JA 3MD1A 1VBZA 2LDIA 5CH7B 4A8WA 3GLJA 1FFGB 2QFIA 3C6UB 2ALYB 4DR7F 1YQHA 3NWRA 1OQ3A 2R7RA 3C46A 3BGRA 1G1XA 4OJ3A 1B70B 1FKPA 1UZDA 4AD6A 4KHRA 5KFYA 5HVGA 4O23A 3LAMA 5B7WA 2PC6A 2FLNA 3DLKB 2NYHA 1FA0A 2XSFA 4TY8B 2F40A 2DB1A 3R1LA 4LVOP 1VDHA 5M2PA 3FUYA 2PO4A 3FSXA 1KQGB 1TAUA 4OZNA 5MLCV 5T41A 1ZM2A 4G3IA 2AGQA 2PT0A 2OSRA 3A12A 4KIAA 1Q16B 1YJTA 1D9AA 3ILJA 1URNA 5K8OA 5KG3A 1UPMB 1IXKA 2PE8A 3JAMU 3UD5A 1SQEA 3PR5B 2GQQA 2BE2A 1S6QB 4NZ7A 2DHGA 2ZBRA 3HFZB 1SJFA 1HBMA 7AT1B 2DNMA 2GJ2A 1GMWD 1V9OA 2CJ9A 2WW4A 2H48B 4UY8T 1HNIB 1MU2A 4DUZJ 2YWGA 1X5TA 2CPZA 3L9ZA 2CQDA 2LQBA 2NQPA 3ONQA 1FO1A 5A6PA 3C6TB 1VQ5S 3MPWA 4NXMF 2QGFB 2IM0A 2YWKA 4EGLA 4RBVA 5EX0A 2CQ3A 2WW8A 1KQSR 3D1QA 4HT5A 1FDDA 4OMFG 3EYZA 2HHVA 3BKFA 3EWGA 2OPPA 4LVNP 3ETMA 1X0FA 4WP9A 2DGOA 1HNWF 1VLYA 3D3CJ 4OYPA 3KNGA 2WSEC 5C24B 1IKXB 2HIQA 4X4UA 4ZITA 3GFYA 2WCXA 4ZK7M 5HANA 3ENQA 1EETA 3IO1A 1REGX 2Y1LB 4DSEA 3K57A 2XMVA 1WKKA 4CTAA 2VQFF 4FPIA 2BJDA 3MECA 1B7FA 2QEXS 5BR8J 3T5LA 2YY3A 1T9UA 5J1PA 4YS2A 4P10A 5LSLA 2JL9A 2JLEA 2GMHA 4IFYB 4LRBA 1WACA 1PC5A 4DN0A 2CAJA 2BR0A 2QLWA 4X4RA 2RRAA 2FJWA 3PZPA 2PFFB 2Y1JA 2Z2YB 1YG0A 4JI6J 4IYQA 1N54B 3PFOA 3ILIA 2O5DA 4B9LA 5DG7A 4B3SJ 2E5HA 5B0DA 4B9SA 4HHJA 2RF2A 3I9V9 3GIKA 4FYXB 1JX4A 3MPDA 1NRKA 2D9OA 4OZ1A 2H3EB 1YIJS 3AHPA 4N7TA 1LWEA 2H5JB 4KQZA 1ELOA 5K20B 4NLXA 1X9MA 2HYIB 3KG4A 5A2QY 2IM3A 2EXUA 3H25A 2LQ8A 1M5OC 4K2JA 1FJGJ 4M5DA 4BCAA 3R3TA 3OR1B 3EXYA 1WTBA 3Q2SC 2HK2A 3OR2A 1AUSL 1X4FA 3I0RA 1QM9A 4AQYJ 4QU7A 4K50A 3TA1A 5AXLA 3CJSA 3DYAB 5IFMA 1YTYA 1U6BA 5I42A 4M95A 3IS9B 5FD1A 3KHLA 1VCTA 4LFCF 5CXTA 4N8NA 4X62J 2IYIA 4X65J 3ZZZA 3QIPA 2JHEA 5LMNF 4IRDA 3CCSS 2WTFA 4LF4J 4QIFA 2R8KA 4PABA 1OQ6A 4RJVA 2VV5A 1U8WA 2QV6A 4TY9A 1E6YB 3HKWA 3LANA 1D8ZA 3T9NA 3RG6A 4OL8A 3PHTA 1QJHA 2FJDB 1NZ8A 4G1QB 4DV3F 1WF0A 5ETLA 4F4ZA 3UD4P 4X4NA 3CGIA 3K2YA 3DLJA 4XK8C 1VISA 2NXUA 2XS5A 2JH3A 4W4MA 2J0SD 2HVIA 4OI1A 4PXDA 1TL7B 4WFBQ 3KG0A 3HFVA 2RE1A 4WPAA 2HGLA 4ECYA 1NSAA 3HHLB 2O3DA 1HBNB 3MF5A 5KFAA 1HQUA 3AXMA 1UJ4A 2PA3A 2BZ2A 4J9NA 2XMJA 3AQPA 1YLXA 3P45B 2X1FA 3W66A 1SH3A 2AV5A 3MFIA 3DU6A 4I1TA 2CKWA 3AT1B 4FYDA 3EDRB 2A1BA 3PTWA 2P2CB 3ISND 2J6UA 3R7BB 3V4IA 2DH9A 4TU9A 5DGBA 3VAFA 5KG5A 1HNXJ 2JEIA 3CPWR 4DR5F 4QIEA 2DR7A 2LVWA 1SXLA 4URGA 1W2BR 3BSNA 2HWIA 4QR1A 5C25B 2AQ4A 3D0GE 2KU7A 2P9EA 5D4PA 2XWYA 1PJ5A 4Q45A 2R2SA 4JV5F 1KHVA 2OD4A 2XEXA 4H4OA 3HJVA 2XS7A 1WI8A 5D78A 2QTWA 1L3SA 1RI7A 2DNHA 2RUSA 4TU8A 2GO9A 1JLEB 1FXRA 2AIRB 4URQU 4DSIA 2CJKA 2QMWA 3DFEA 4ED8A 5BJRA 1UVLA 1TFYA 2L9DA 3KFWX 4ZN1A 3QWPA 1RAJA 1RT3A 1TMMA 3MEGB 3PRDA 2R7WA 3IGVA 5CCMA 2MZTA 4USVA 2FQQB 3W60A 4J91A 2GA7A 4ES2A 4DV1J 2G0CA 4F2RA 5DDRC 5ETRA 3SFUA 4DI6A 4X64J 3GMGA 3PX0A 3LPYA 1FK9A 3TAPA 1I94J 3NAHA 5C2GA 3EGWB 2MYFA 1JXLA 3Q8VA 3HXMA 2XQCA 1JLFB 2MQPA 3Q23A 1WHVA 3OXGA 4XDCA 2CZ4A 1RHUB 5G4DA 4BC7A 4RUHA 1H0HB 3FQKA 5AT1B 1RWKB 1QD1A 2BE7D 2UUAF 5EWGA 1X31C 3CUNA 1NB7A 3WDOA 1GEHA 4ZN3A 1JLBA 2CIMA 3HVRA 3GJQB 3UWTA 2OPQA 4ECXA 3OUYB 3VVTA 2BJ1A 3VGUA 5L1IA 5JJBA 2ZJPQ 1RT1A 1SVDA 1Q7YT 4I4BA 3LP2A 3T1YF 4QPTA 2ZVSA 2DNKA 1IR0A 2I2YA 5DDOC 4NLVA 4ECZA 1ZM3A 1FD2A 2IRYA 1NHKL 2JX2A 3EZOA 1CPZA 3V2UC 3QPIA 3KK3B 3MMBB 3PW0A 2EC2A 2PSZA 2YWHA 1RT2B 5C42B 3OFGA 3POTA 5CD4A 2M8DB 1HMVB 1WOSA 5FDLA 2G2OA 2MQ8A 3DOLA 2XI2A 1OMSA 1AW0A 1ZA1B 4Y00A 1UEKA 2HGNA 1CJKA 3M9OB 4WTOB 3TJ9A 4MIAA 3D54A 2F65A 3SCKE 4CLPA 1LWCA 3BKTA 4DL6A 1EKSA 2KZMA 5ITHA 3THPA 3I0SB 5I3UB 4JI8F 3B78A 3CJ0A 2HGMA 3DGPA 2XBPA 5SZTA 1QY7A 1Q5VA 1LOUA 3DOMB 1N34J 2UUBF 1UMJA 4WK3A 4ZP7A 2OEKA 3O8WA 2MZQA 1B3TA 2MKJA 5LXRA 3IRXB 4YDDB 3K5MA 2KL8A 4M5LA 4OX9J 3D68A 3TAMB 3BREA 2XMWA 5I3PA 4X4TA 5A8KB 1FNXH 3BGOP 1FDNA 1BWVA 4QIGA 4A8FA 4ZVFA 2X51A 1Y0HA 2DO4A 3WC0A 4UUXA 1CSJA 2XULA 1OY6A 2F63A 4DPTA 4YHHJ 4JBCA 5ETPA 4KJIA 3ZNJ1 1VRUB 2ADBA 4LSNB 4KHMA 3QZ8A 5KTQA 1GMWA 1QE1B 2Y8YA 3M6VA 2C3PA 1NSQA 4OV6A 2GMJA 2YX4A 3HD2A 3RRKA 2MKIA 3QYYA 3HZEA 4K4SA 3EUNA 4IG0B 2E7WA 4KSEB 2GZOA 4HYKA 3KUEA 4ZP8A 1RWNB 2EEYA 1H74A 3GV7B 2MDAA 4DQSA 4HACA 3T1HJ 2DGWA 1Z4UA 3NCPA 2ASDA 3FMBA 1SKSA 2ZFHA 5CD4H 2BOAA 2GGPA 2JFDA 1O5JA 1CS4A 3BBBA 1N6QA 5ETOA 2RU9A 1RKJA 3T1AA 4CLKA 5KAKA 2ZHOA 1S1UB 3KXDA 3PJ9A 4YY3J 2UP1A 1I6JA 3V6HA 4GC6A 2GFFA 1LW2A 1YK9A 4F25A 4ED6A 2ATLA 2VH7A 2WZ1A 4ZVOB 4LRAA 1CQMA 2G9OA 1FVQA 2B5JB 2XZWA 1NAQA 2LA4A 3E3XA 3HVTB 4D3HA 1HKAA 5A8RB 1VS3A 2KVQE 3CCMS 4NMLA 2MY8A 1T11A 1E6VA 3I5BA 4FBUA 4V19X 3ZZTA 4E98A 5KT6A 2F4FA 3GJRB 4KGVB 2ZJQQ 1X5SA 3GWCA 5DM6Q 2BJ7A 2VASA 2W7PA 2YQ3A 1R8BA 4L76A 4DPUA 4O3OA 2VHGA 2R7QA 2W2OP 5DG9A 1SV5A 5LMUJ 4LJMA 3HP6A 2I9SA 2I0XA 4U7CA 5HP1B 3K17A 1LQ9A 2BRKA 3M2UB 5IC6B 2VZ9A 4YR2A 2CNOB 2QYGA 1EIYB 2X1AA 4CH7A 4QQBA 3CCQS 3S01A 1UZHA 1S0NA 4CLFA 1IKVA 2F7VA 3EE3A 1N8RT 3D9BA 3KUHA 5CYMB 1T02A 1LWFA 4C0HA 4OX6A 2QLXA 3B4DA 4LF9J 2MKYA 1LV5A 3R5DA 4O3SA 3CE8A 5ETNA 3VTIA 3IBCB 1PBUA 1HI0P 1OWXA 1K8AT 2Z57B 3VAKA 3CIZA 3JQKA 3PRVA 4KFBA 3TNVA 5KFTA 1RBOB 4JYAJ 1Y3KA 1ZH5A 2VQEF 2MKHA 1L5UA 3A3OB 3THVA 1WEYA 1OS5A 2OTLS 4YEAA 2W9BA 3WHIA 1G2EA 1CLFA 4OI0A 3GCXP 3LF0A 3BO2A 1WORA 2YQ0A 4CI0B 2IDEA 5E7OB 2CJQA 2BOPA 2AJ4A 1NK6A 4JI3F 2E5IA 3OFEA 2L3MA 3HHKA 2UUWA 3JAMY 4NZ0A 2KFNA 1AB8A 4ZPDA 5DG8A 3PEJA 3CCLS 1NLKL 2AT1B 4IUFA 1MG7A 2RKIB 4U95A 2MEWA 5F8LA 5KFZA 2W4PA 1UETA 1YJ7A 4B3RJ 3CT9A 4LF5F 2HK3A 1NH7A 4PQUA 2E5LJ 3CMAS 2OH2A 2VA2A 4K5RA 3MGJA 2ZM6J 4KR0B 1PJ7A 4BDPA 2B8PA 2DYAA 1RISA 1RWUA 1LXNA 4RW4A 3RUBL 2M52A 4G1IA 2VBWA 1RXOB 3BGRB 1RT6A 3PR4A 4O4RA 2RRNA 3KJVA 1FF2A 5CYQA 1FKPB 4LT6A 2KT5A 3DDIA 3GYGA 2APOA 4ZPVR 3AA9A 4LBPA 2OI2A 1B0TA 2PDAA 4PAAA 1BXNA 1QSSA 3BSAA 4HI2A 2KHCA 2UVWA 3M9MB 2W25A 2FDNA 2KJWA 2AEMA 3VAGA 1NMEB 3SCJE 1TMJA 3H2LA 3QAEA 4ICLA 3SXLA 4QJVA 2XZTB 3PYFA 1P8GA 1FCAA 3HPOA 2KTQA 5J2PA 1T95A 4QWDA 2ZITA 2FGOA 1S12A 1JLCA 1KQKA 4NMXA 5H9EJ 3V81A 1HIYA 1O51A 2F8EX 2X1GA 2GS8A 1F5BA 4TYBA 2BE2B 4WZQA 3JQMA 4OZ3A 1BY9A 4LSZB 1IJFB 2HQGA 3IG1A 1HD1A 2HS0A 1HBMB 2MLZA 2G0JA 2GHPA 1MN9A 2GVZA 5E3AA 4RKUC 1P27B 1MU2B 2L08A 3CMES 1S6PA 2VFUA 2DRAA 4FPRA 1Q95G 3DN9A 1RZMA 4M5IA 2GAGC 2BQ3A 4PG7A 2YPYA 3NGUA 2LU2A 3ZXWA 4FYVB 2CQ1A 2CJAA 1C1CA 2CQHA 2IMWP 1XNRJ 2OPPB 3J80Y 3I4HX 4UW2A 3PACA 2ZBQA 3WC2A 2JWNA 5D4OA 4K4ZA 3CDEA 2FPHX 4PEOA 2UXBJ 4TNOA 1WJ9A 3DLGA 4JI0J 4KPCA 1EETB 3JSMA 2OHDA 2BX6A 3CC4S 2OMLA 5DRKA 2XCAA 4ED1A 4CTAB 2V4JA 1GXTA 1FRKA 3RAXA 3DGVA 3MECB 4ENOA 1HNVA 1TFWA 1XMBA 3IFEA 3T5HA 3X1LB 2CQCA 2ADCA 1N52B 3ZC4A 3OLBA 2F9DA 4NLPA 3T5JA 1YJUA 4DBQA 2M7SA 2ZBIA 3WZ0A 1Q4RA 4LRCA 1SJ1A 5LM7E 3EZUA 2CDRB 4PZVA 3CD6S 4KGZB 1CJVA 2VFVA 1R89A 1N36J 4F3QA 1OYEA 3BYPA 2FY1A 2V8DA 1KQFB 1RAEB 2XHWA 3H2VE 1F3VA 4ZVUB 1M5SA 1WSVA 1R3NA 2RF2B 2VIHA 5IXUA 1BUXA 3VQSA 5IWAJ 1GK8A 4CLZA 3RR8A 3CDAA 3EICA 1NKCA 4KKOA 2XO7A 3AY0A 4AXJA 1FTRA 4GVBA 1LWEB 2PMHA 1OY8A 2ZD1A 5HK4A 1XQIA 2OIHA 2YQ1A 2IYGA 4C3LA 4M5DB 4ILMA 1YJ9S 3IM8A 3NS5A 3MEEA 4ZLJA 3QT7A 4BC9A 3G96A 1XMQJ 3OR2B 3CJTA 5C5JA 3I0RB 2KI2A 2IVMA 3NBPA 2DR8A 4K8RA 4DUYJ 1CJTA 2GVDA 2P6SA 3DI6A 4ZP9A 2HBZB 2M88A 5I42B 3LALA 3R7NB 5HN0A 2K7JA 2BW2A 1GTHA 4CZCA 2NUUG 1IBKF 5E41A 3SZ2A 1TUGB 2B43A 2GO8A 3D2WA 2FVRA 2ZC4A 1B7YB 5IZHA 3MMAA 3QIPB 1NSKL 3FBEA 1WUUA 1NK8A 1VR6A 3ZTSA 4YR3A 3KLEA 4AL6A 3MHYA 2WB1D 4LBHA 3CIMA 2FJVA 5E0OA 2CXEA 1RHRB 3FK4A 4V1Ak 4RWWA 1JKHA 3R97A 4Y34A 4ZIVA 4ZLNA 4DOZA 4M94A 3Q8YA 2HNYB 2ZE2A 2B6AA 2YBVA 3OTEA 2V67A 3R5BA 1U1OA 2MZRA 3T3FA 3RTVA 3D28A 3KK2A 1N48A 1EP4A 2LECA 5E3PA 1OPZA 3FCHA 1RGVA 1Q82T 1VQ7S 3I6PA 3PW2A 3QAUA 2VPYB 1O0PA 5BYRA 2DIVA 1RA6A 1IM6A 3IA0A 5THWA 2VA3A 4DQIA 4ES1A 2DNRA 4AUKA 3RW6A 1HQUB 4DU7A 1MROA 1LK5A 4I56A 1BE4A 2XO6A 2V8PA 3U1LA 4XPCA 4X4OA 3M6WA 3DLEA 3ZTPA 2UXDF 2R7XA 2DGVA 2AEJA 3IN5A 3K5OA 3HJFA 3V4IB 2KVIA 1UA1A 4O4GA 2BXJA 2AWZA 5KT5A 4J9PA 2DBBA 3AD7C 5D0GA 3FC9A 3GB0A 2C2DA 3AA8A 3MXHP 1IJEB 2DITA 2KFYA 4H4OB 4ID5A 2LDYA 2XGPA 2B8QA 4QCLA 2KXFA 3G8QA 1ZS6A 2OTJS 2QA4S 1FNMA 5D77A 1RCXB 3OFFA 2DTJA 3M32A 1J5EF 1RWWB 3CJ5A 2KXNB 5G0RA 4CO5A 4Q5VA 2W4CA 1RT3B 1W25A 2YKPA 1DLOA 3M30A 4FN5A 4DUTA 2DIUA 3LWLA 4ZVPB 3G82A 5KFUA 4LIWA 1FI4A 1PIEA 2ZEJA 1LNQA 4ZPWR 3DHWC 2HBYB 3CO9A 1WI6A 4B02A 1FK9B 2BJ3A 1QTMA 1K0TA 3UCUP 2FHJD 1RTIA 1ACMB 4J90A 3HMJG 2ZH7A 3MMCA 5LL6d 1NK5A 3DRXA 2CNKB 2C2NA 4O3PA 3ZZ0A 5LSRA 4DR6J 3N79A 2QMUB 4DR3F 3GFXA 2DHSA 3AJ1A 4WE1A 4A8QA 3FJ2A 2QL9B 2C3OA 4DQPA 4UZBA 2K8GA 5J2QA 4DCJB 6AT1B 2HNZA 4MT1A 4OI2A 4GRSA 4LFAJ 1NEEA 4MK9A 2KJVA 4PG5A 3M7VA 3NS7B 2OPQB 1YWXA 3G6ES 4YUDA 2N4DA 4DZ6A 1VBYA 4ANDA 1RT1B 1K44A 1K47A 4JI2J 5H9FJ 3LP2B 4NCBA 2FC9A 2MZJA 1LKZA 1MMNA 1T9WA 3VVUA 4OZ0A 1DTTA 3CJ2A 1ZA2B 5EGYA 3POTB 2ROEA 4NA2A 3W2WA 5MAOA 1FRJA 2J9CA 4FYWB 4L6V3 5FDLB 3W63A 1TKXA 2R9LA 3DOLB 4Y6IA 2VONA 1RT4A 1CJKB 3EJMA 2ASJA 1K1SA 2DNOA 4OYIA 1SBRA 4RUAA 2NS1B 4MH8A 3J7A1 2NZCA 2EFPA 1LWCB 3HHNB 4ED0A 4I67A 4CLUA 2WVDA 1Z2LA 2CQ2A 4HI1A 4QIVA 1IWGA 3IWLA 2EKYA 4E0DA 3DGPB 3UQSA 1C2PA 2ZOFA 2FHOB 5K8PA 2XSJA 2W2QP 2OFGX 2IVYA 4Y2CA 4WF9Q 3TVKA 1RACB 3QWUA 2E9ZA 1VHFA 4C3KA 4QYRA 1LXJA 2PMWA 2XYPB 2QLBB 3EDQB 3M2VA 1N0UA 3BR9A 1RYRA 5GADU 2IPOB 1LW0A 1O6XA 5GADI 3UCZP 1TKTA 3HCXA 3FEXB 4CO3A 3UDLA 2HURA 1V3SA 3BS9A 3BF4A 4H4KC 4C8OA 3HI9A 2KM8C 2IA6A 3LGMA 1WHXA 3NNHA 1YVFA 4HLBA 4Y3CA 2EBGA 4NPOA 3KLHA 3LP0A 2J9EA 2VKRA 1NHUA 4F2SA 3DM2A 4B9NA 3V6DA 4YB5A 3OTOF 2JC1A 2BABA 4K59A 2CZVC 4K4TA 3OTDA 2B4PA 2XI3A 2FZCB 3AB4B 1H72C 4DX6A 5A2QU 1YRTA 1P1TA 2F9JA 3IRWP 4OZLA 4HACB 2KHDA 4K7QA 1NDPA 4WFZA 1EZZB 5KFLA 2NXEA 1KOHA 2YNIA 4N8OA 4LF1A 2GGPB 4J9MA 3GPAA 1PSDA 7FD1A 1CS4B 1N6QB 3PNIA 4DV6F 1S6UA 4F4XA 2YKNA 3K5PA 2IBKA 3NL0A 4OJ1A 5BR8F 2DR9A 1KLMA 5C25A 2LXIA 1LW2B 2ERRA 3NG8A 1RLDA 4URSA 4PUOA 3ELHA 5IQQA 4NXMJ 2CRLA 3HVWA 3FCWA 1U6FA 4ELTA 1G7CB 1NPKA 1R0BG 2XZDB 1ZETA 1I5OB 2FD2A 4UUWA 5GMKa 5HAOA 3THTA 5KG2A 2AHOB 2LP4A 5C7PA 1N32F 2E1CA 1E6VB 4LR9A 1HNWJ 4FZVA 1FRLA 2B7CB 4Y2MA 3B8HA 1BQNA 5KT3A 2C2EA 4USUA 1WC4A 1PC4A 4WKRA 2CUYA 4FXWA 5CQGA 4ZCMA 1LFPA 1VK8A 1HD0A 2VQFJ 1SV5B 4EZ9A 4J9QA 4L73A 3NXZA 3LWMA 2AGOA 3MPVA 3JS9A 1S48A 3CCJS 3RB0A 4AXIA 2FLPA 4KC5A 2JEFA 1YJWS 3M8SA 3I87A 5KG4A 5K8MA 1IKVB 1LEOA 3BSOA 1LWFB 1GNKA 4W92B 1IQZA 3QJPA 1F2HA 3L09A 4F7VA 1JMTA 3FZ2A 1S77D 2DHXA 5M2RA 2HLUA 1Y9OA 4WK1A 2DXFA 2D74B 1AFIA 1GH8A 1SIZA 1HHQA 1RADB 1H38A 5KG0A 5HQLA 3F0NA 2WONA 4KFBB 2VPZB 4OHZA 2C2MB 3TO8A 3OXFA 4WFYA 3CC2S 5JUMA 1N5VA 3BYRA 1HWJA 2YX7A 2H51B 4ECTA 3NNCA 3BBFA 3ZZRA 2W1BA 2W9BB 4WP8A 1N5YA 4RWXA 1R0CB 2BUNA 3MM5A 1OJ4A 3G6XA 5F8IA 3CDBA 4WYLA 1BQXA 3O5TB 1VQOS 1YZ7A 3R6LB 3AB2B 3FSYA 2F5GA 4YB7A 2CPYA 1YBTA 3ZNUA 3AODA 1VLOA 1HPZA 2OKQA 1PAUB 1KRPA 1ZM9A 1C1BA 2FB0A 3EVMA 2HQFA 1KFDA 4MKYA 3HX9A 2W9CA 3R9LA 3PW7A 3RYLA 1GQEA 3KOAA 4PQUB 2KB2A 4B17A 4KH0B 4K4XA 3GFZA 4LFCJ 3O44A 3BEGB 4Q8EA 4HH0A 2RS8A 3RBDA 3AJ2A 4UOFA 4DX5A 4IOBA 2RDJA 3EPGA 1YDLA 5LMNJ 4RW4B 4ECWA 2FVSA 5KFGA 4ED3A 2W4DA 4O3RA 2BDPA 5B08A 1RT6B 4NI2A 1HNZF 4LREA 3KJVB 5CYQB 3VAIA 5L9NA 1RU2A 1BD6A 2HAIA 4KBIA 2BMBA 2M3DA 4PYAA 3QATA 2FGCA 4DV3J 1BC6A 4W98A 1D3WA 2BM1A 1RBLA 1DAXA 2VU5A 4L74A 4CYUA 4V19J 4FXDA 3EVOA 4NL5A 4PWUA 4F0HA 2X1BA 5B0BA 3TVYA 3U02A 2WK4A 1TVRA 1EAYC 1K9MT 4FVCA 2IJRA 4DPWA 4CWBA 4O0IA 4ICLB 3W2VA 1XN9A 2K3IA 1U1MA 5J2PB 3CCUS 1M5VC 1YBAA 1JLCB 3ZZPA 3OL7A 2FZGB 4F3MA 3PKMA 3MR5A 3V81B 3S7RA 2EG1A 2IJNA 4Y2KA 1NZAA 3M8ZA 2RS2A 4J9RA 4MK8A 3ITHA 4JV2A 4XDDA 3K0JA 3IG1B 2HWHA 1KWMA 1IKWA 1T9YA 4GMKA 3CDWA 2ZH2A 1QSLA 1PILA 4NOHA 1VGYA 2R3VA 2GVZB 4ZJQA 4Y28C 4DR5J 2ZHAA 1WWHA 2DVIA 2HRUA 1S6PB 1GFWB 4KY3A 4F67A 1TL5A 3TX0A 4JI1F 4Z7CA 3QO9B 3E01A 3J81Y 4NASA 5CABA 4KE5A 2WAQD 2ZH9A 3J7AN 1HYSA 2H54B 3I9ZA 3HSDA 5A8WA 2FHJA 2XB2D 4QYZJ 1FRIA 3AH6A 1C1CB 2AJQA 5HATA 4XIUA 3KLGA 1UVNA 2YVSA 2RAQA 5H1SV 1ZTWA 3OJSA 1TP7A 4A8XA 3DLGB 4ZVTB 3TZYA 4RL1A 3UN3A 2BQRA 3H90A 1JLAA 1H2VZ 3JSMB 7FDRA 3UD3P 5LJ5Y 3CCZA 3PFEA 4CLWA 1X4BA 1OO0B 2V4JB 2RRBA 2CDQA 1KTVA 2J5AA 2C2OB 4RNFA 1P6TA 2N7CA 1HNVB 2QIFA 3WX8A 3RJMB 4WZMA 2GC8A 1FD8A 2GJIA 1VOMA 4RU2A 4QWBA 4K4VA 2YKMA 4FF4A 4K0KF 2A2CA 3D6TB 4HHHA 1CJVB 2JSXA 2W9AA 1D9DA 1TAQA 4XAKA 3US5A 3D67A 2UUAJ 4YFUA 3TA2A 1YRXA 2E44A 3GQCA 1EARA 2ZDPA 5T14A 3EGNA 4L72B 5HLFA 2VC0A 2HMIA 2FJAB 2V9KA 3O2IA 3MI7X 2PEBA 2AYMA 3CJ3A 2E9RX 4KKOB 3T1YJ 3U1MA 4HTIA 2W8LA 2GNKA 5B0CA 2ZD1B 5CAAA 3B6BA 1QAIA 3GIIA 1NJIT 3ADAC 4UTGA 5J1EA 4C97A 1RAGB 3HT3A 2HFVA 2CPHA 4HL9A 3MEEB 2DD8S 1XJWB 3TR5A 4DU8A 2AYGA 3W61A 1S4EA 2KN4A 3NBPB 1V5VA 1CJTB 2GVDB 2NCKL 3DI6B 1ZTTA 4DV2J 1X4CA 2ZH5A 4GKKF 3SFGA 3LGHA 4MIWA 3QT5A 1U1NA 1MN7A 2I5JA 4YHHF 4ZVSB 4OHXA 1TL1A 2HNDA 2M70A 3MMAB 4JI8J 4JUZA 1S1VA 3KLEB 1T94A 2HHHF 3GIMA 4NRTA 3VGTA 1CJUA 4B3TJ 2MY7A 4DF8A 5JVGQ 4NEYA 4BLGA 5IV3A 4MJKA 2OO4A 5KFCA 2FTRA 4NE9C 3D1HA 1Q8KA 1JKHB 2YWWA 2W01A 4G65A 1KVIA 1RWXB 2K3KA 2XCPA 3JSYA 3Q22A 3N28A 2XY7A 2ZE2B 2IRXA 2B6AB 4B9TA 3D4JA 3M8QA 2VBXA 4CT8A 4RLEA 1U8SA 3KK2B 1Y5IB 1EP4B 1PAEX 4R5PA 1XWLA 2YWFA 5GMEA 4K2XA 1NPRA 3IXQA 1VC5A 5IT9Y 3KK1A 2MMYA 2O67A 2GAHC 3H59A 2B9XA 4A47A 4DQRA 1RA7A 1MROB 4CNYA 1O8BA 4J9KA 3TZWA 1S0OA 2WHOA 2MJUA 1SKWA 3OT9A 3H5UA 3DLEB 3VHQA 4ED5A 2OEJA 1SC4B 2E9TA 3AXKA 2LEAA 2R7VA 3IR7B 4OYXA 4LQ9A 3TARA 4O4GB 3AJDA 3P4UB 3IP0A 4LBIA 4MKBA 4F4YA 1NJWA 3MUMP 2OJ3A 2QYCA 2OELA 3BN7A 4TLRA 2J9DA 3MEDA 4CH0S 3U1NA 5DJBA 3T19A 4FYYB 1XMOF 4ID5B 4C8MA 4EBEA 3EXCX 2YNHA 4WBFA 1GTEA 1PBAA 3MPYA 2ASLA 2VKZG 3HSJA 2OPRA 1V6HA 2DKOB 2MKSA 3M32B 4ZMMA 5G0RB 2CFXA 3NKYA 4PXEA 2MZ1A 1DLOB 3D66A 3M30B 1D8YA 2Z4PA 2CA9A 1M90T 3CB4A 2E1AA 1FKOA 3G82B 1HWIA 3FCVA 2D1CA 2E1MC 1XR5A 3BH7B 2PIIA 1EHWA 4GO7X 1QUPA 5AXNA 2EPIA 2AEFA 2OP5A 3KDOA 3KYLA 4Q0BA 3Q8PB 2GCFA 4KH1B 1HR0F 1RTIB 1VQ9S 4DV5F 2H5IB 4M5GA 3K5LA 3MMCB 4KHPF 1W7WA 2JVRA 4OZJA 2CPIA 3UN5A 1DY3A 1X5PA 4WE1B 3JTPA 4DFPA 3SQOP 2XNQA 4CLTA 2BQUA 3ZZUA 5J2QB 2DPIA 1RHKB 5KFPA 4NLGA 3CD5A 1BQMA 4IR1A 2GV1A 5D8HB 2HNZB 3DNCA 2YNFA 2V2ZA 2FVPA 3K8WA 1C0UA 1Q0NA 3CSKA 1TELA 5I3QA 1R0AA 2ZH1A 5L39A 1S79A 2C2ZB 2ZWOA 1K0VA 1KBRA 4X4QA 2QC3A 4ZDNA 4RNOA 2DGXA 4X4VA 4DV0F 2YH0A 1N56A 3TANA 5KFFA 1S57A 3PJWA 4X66F 4F50A 2RNEA 3HVAA 1XERA 1OSCA 1ZZNA 1NM2A 4RNNA 9RUBA 2VQEJ 2KYXA 4DR2F 1UPPA 3N5FA 1UWAA 4DSKA 2B9WA 2WVCA 1DTTB 2V63A 3J7ZT 3W2WB 3S6EA 1JXEA 1TKXB 1VC0A 2ABYA 2LMIA 4BS2A 4LQ3A 2ZJRQ 1RT4B 4LF6F 2MHEA 3NGTA 5DETA 1AFJA 4USIA 2LYVA 3J80U 2XC9A 3KNAA 3IBWA 2OLWA 1RAFB 4JI3J 4F02A 5IOLA 4M8LA 1AYEA 5BYSA 2NYIA 2LLZA 2XMAA 3DKDA 1DURA 4MYUA 4ZVRB 1VQKS 2JOQA 4LFBF 1Y7PA 3CNQP 1U2FA 2IRUA 1YJVA 3B4MA 4C8KA 3L4BC 1V3ZA 1P1LA 4FP9A 3OD2A 3PHEA 4ZPTR 4KV8A 2XWXA 3PIOQ 1OYDA 4OYAA 2XSJB 4B3MF 4FXVA 1MMDA 1D0EA 3M2VB 3HDSA 3I55S 1LW0B 5F8JA 3B54A 4CLSA 2ROPA 3HHDA 2BJEA 1TKTB 2CADA 4MK7A 2PA8D 1ZAVA 5KFDA 3TI0A 1TV6A 2DHHA 3KHRA 2RQMA 3DU5A 4ZPAA 2HNYA 2DGTA 3C16A 2FJEB 5IT4A 5ADZA 3QRRA 3D0IE 4OI3A 3DRSA 1G6BA 3RBXA 3PJXA 4WU3A 4LF8F 3KLHB 3LP0B 3TA0A 1KDNA 4L75A 3DM2B 2HS4A 3V6DB 3PIPQ 1Q8IA 1XBWA 3MOZA 1UVIA 2UVUA 3KJNB 3NMAA 5KG1A 3Q8QB 3CCVS 1UVMA 2YXLA 3C15A 3DC2A 3V5RA 1R8HA 2G2ZA 2R2UA 2HHSA 4IQXA 3PW4A 4R0JA 1D9FA 3F41A 3SV4A 3UVJA 1S9GA 1H7WA 4OYMA 1QVFR 3BQ0A 2DISA 1EQ0A 3AOAA 2YNIB 4OJGA 4B9VA 4P52A 3PKYA 3GIJA 4IQMA 2MXYA 1RQ0A 3W5YA 4I6AA 3Q8SB 4MFBA 2YKNB 4I0WA 1YX2A 2HHTA 3VQTA 5KOWA 4HVZA 4DL0C 2HVEA 4BHQA 1KLMB 5KFOA 3HO1A 3HKZD 1JNZB 4ZLLA 1HW9A 4ZVEA 3M6UA 3W5XA 3TOQA 1NK9A 4K4UA 4DR4J 2WVFA 1PYOB 1Q53A 1FFWB 1JNRB 1Y5NB 2VD3A 2ILYA 4PUOB 1WTFA 1I51B 5KFSA 2M2BA 2OPSA 1U2CA 4QIWD 2E1PA 5J2MA 4U7UK 4DX8H 3QIDA 3FVYA 4C11A 4HDGA 2HPUA 2DK2A 4HTJA 4OHYA 1UFLA 1Q1KA 3O1LA 6FDRA 2VF3A 2B51A 2R2RA 2V8HA 1FT8A 1NNDA 1BQNB 4DLGA 3BR8A 5IWAF 3ZO7A 2G4BA 2XTJP 2XMUA 4IH5A 3O3LA 2FVQA 5H9EK 3ETOA 4GO5X 2EWHA 4KB7A 1HBUA 4DPOA 4ED4A 3CC7S 1KD1T 1RCOB 4DL7A 3M8RA 5CZVA 2DY9A 1S76D 3TUPA 1VHIA 2RHSB 3T6JA 3GIRA 2ZUAA 5A0YA 3N0VA 1DARA 1HI1A 1KKHA 4DL2A 4QR0A 1B0PA 5EN1A 2G2YA 2AJ2A 4A8SA 3OQ2A 2BE9B 5DS7A 1R43A 4NLTA 1CEZA 4P7VA 2NPFA 3G6VA 4W90B 2EVZA 3L3CA 4M5JA 2MSTA 2WONB 3JTOA 1HBOA 3NGSA 1VQPS 3NWGA 1YBUA 2BJ9A 2H9ZA 2CQGA 4I7FA 1JIHA 3OTCA 1NO8A 4E2FB 2HBQB 2LKZA 1N5YB 5GAHU 2DGQA 4RR5A 3MM5B 5GAHI 1NXIA 4TLQA 2AKWB 4Z37A 4ZVHA 3JSBA 3G4SS 1S5ZA 2UUCF 5D0EA 2QSWA 5DZ6A 2ZBCA 3HM9A 1HPZB 5HROA 2Y1IA 3GE9A 3L95X 3PYDA 1C1BB 3JSRA 3IC1A 4J9SA 3MFHA 2DNLA 1IM4A 2MSSA 1CQNA 1U7LA 1F2GA 4AFFA 1RT7A 2W9CB 3UDCA 1VFJA 3UDVA 5DLGA 2CNNB 4X4PA 1EJ7L 1CG2A 1IR2A 1T05A 1IBKJ 1KR4A 3ICLA 2LCWA 1J2VA 1X9SA 2ZZTA 3LH2S 4CO0A 4JI5F 1XNQJ 4UZCA 3ISNC 3CJ4A 5J2NA 5FLXY 5HMYA 2K1RA 1S1XA 2QLFB 3GILA 4NI2B 4H4KA 3FBCA 4I68A 4QR2A 4ECUA 1UEUA 1HWLA 4UOCA 5B09A 1RK8A 2Y1RI 4USTA 4DSJA 2NLWA 2RUGA 4NYZA 1XR6A 1FDAA 4CYUB 4RW6A 3ENAA 3FDSA 4I64A 1JLQA 1M5PC 1TVRB 3RR7A 3H40A 1WG5A 2XMKA 3OPKA 4FDFA 3W2VB 3IM9A 3N6MA 2P8IA 1CBKA 3SV3A 2NSCA 2Z2LA 3MCOA 4DDFA 1OIAA 3DMJA 2K06A 1JJ2R 4PWDA 2ZH4A 3ITHB 2UXDJ 1TK0A 1S1WA 2AF6A 4QZVB 2FC8A 1IWAA 1IKWB 3KJFB 8RUCA 1SB6A 1NUEA 3FFIA 2P9CA 4ID8A 3W7BA 3JQJA 2V68A 2AYEA 2DR6A 3OSNA 1WHWA 2F3JA 2QE5A 4JV1A 4CM2A 3E01B 1HYSB 5A8WB 1NU4A 3FZBA 1YKWA 4C0BA 1JWWA 1IBCB 3P96A 2AW0A 3GG0A 3G2XA 2ILZA 3KJQB 3LUYA 3KLGB 4ELVA 1J5EJ 2HAFA 4RX6A 2CG4A 2DGSA 1RT5A 2KRRA 5LJ3Y 2RQCA 3NGDA 4DR1J 3LGNA 3C14A 1JLAB 5HMZA 2BKOA 4NYPA 1ROFA 3VGVA 1APSA 1KNZA 1H6KX 4X84A 2L48A 1A0OB 3GYNA 1WF1A 3H98A 4USMA 4A46A 2WRMA 1ZYQA 5E5NA 3R5CA 3G8SA 4ECRA 2E7VA 2ZC3A 3L7OA 4ES3A 3C8YA 1F1BB 1UVKA 3A1YG 3W3SA 4LIRA 3PX6A 1Y10A 1R7IA 1FXDA 1HQ2A 3MPUB 2YKMB 4HKQA 3MR2A 5K8NA 3X3UA 4NLUA 4OIXA 4XTTA 4Q7AA 3GONA 3BQ1A 1MWQA 2HQIA 2VL1A 1F6TA 2VB6A 4ILRA 4I2QA 2EK6A 5D4NA 1U49A 4P6QA 3MWBA 2ZWPA 1N88A 2CWKA 2Q66A 2MQLA 2HHXA 5HLFB 3CCES 4I6YA 3QQCD 2HMIB 4RW7A 2YNGA 2EC0A 4KO0A 1JK9B 2KZZA 3BPDA 4ZOSA 5IQ6A 2GW8A 3R27A 4ZP6A 4DX7A 4M5MA 1S99A 3BH6B 3PVXA 5GAGU 3MM8A 1U1PA 2MQMA 4KT0C 1FJ7A 4MMOA 5J1EB 3HHEA 5GAGI 4FS1A 3H20A 2FIUA 4DWIA 4J9VA 3KLIA 1L3UA 2ZHBA 2QRRA 3TUJC 2O1PA 2V5HG 2Y3YA 2RDDA 1KLNA 3TQ1A 5BXIA 1F9HA 4WIIA 4IO9Q 5L8RC 4Y2IA 3IGNA 2LXUA 4JI7F 3CCTA 2LXFA 4KGXB 4Q8FA 3H4BA 2I5JB 3N9UC 3BDPA 1TL1B 2HNDB 2Q3PA 5A76A 2H4YB 1S1VB 4JV0A 1FE4A 1CJUB 2QN6B 1WC0A 1RTDA 1Z2ZA 1F60B 3UR0A 5EUHA 2LFVA 3T9ZA 5ETQA 2CPEA 1W26A 1M1HA 2XS2A 1QDUB 2O66A 4TKTA 3U27A 3RAQA 4PQAA 2NR0A 5HO4A 2CQBA 3UO0A 1T0TV 3ET6A 2K2PA 3M1VA 1XR7A 5L46A 2W24A 3M8QB 4NA3A 2JJ4D 5H9FK 5D6GA 5HVFA 4IH6A 2C2RA 1KSPA 3TEHB 3JB9k 3VCDA 2B4OA 3PYEA 4N47A 2F4VJ 4R5PB 1WDTA 1FRMA 4C48A 2XYGB 2M4MA 3EVWA 4P9SA 5DDQC 3KK1B 1HLWA 1WD6A 4RPFA 4TQSA 4LF7F 1NK0A 3EGZA 3MCSA 4ZLPA 3TP2A 3KMQA 3PEHA 1RWVB 4M63A 4FS2A 4Z2XA 2VODA 4F0KA 3W9HA 2QJ3A 5IM0A 3KLVA 1S59A 3D6HB 1VQSA 2QA4G 1SL0A 4Z7YA 2ZDOA 2J7KA 2P9GA 4CDIA 3OTOJ 2HLTA 5I4MA 1CC7A 1FERA 3NCRA 3OLAA 2VC1A 1K1QA 1RBAA 4F26A 4NX9A 3ULHA 4QWEA 2Q79A 1N33J 1FE0A 4DV7F 3VF0B 2DPJA 4I69A 3R5AA 2MLYA 3D7SB 1VBKA 4N5SA 2C3UA 5F9NA 3CCWA 4UT4A 2CQIA 4DCOB 3PG9A 1SIWB 3MEDB 4DV6J 1MW7A 1YI2S 1FKAF 3P49B 1AZSA 2YTCA 2BA9A 2YNHB 2PEHA 3DRPA 2XHCA 2UU9F 1NDLA 3BGUA 3CO0P 4AL7A 4USHA 1EB0A 2OPRB 3QO9A 2L41A 3E51A 1MMLA 2XNRA 4UOHA 1GX6A 4C7QA 2XY5A 2JRSA 3PX4A 3HF5A 1UA0A 1FKOB 3H4DA 1UKUA 1VQNS 2AZ3A 3GR1A 1NB2A 3G87A 3HD1A 1S1TA 2DY1A 2IAJA 3CDUA 1N32J 2XMMA 4Q0BB 5DO2A 1R6YA 3FEZA 2B7BB 4CO1A 1IBLF 1PJ6A 2WBRA 4ZA1A 1SUQA 4J9OA 1M0SA 3D3BJ 1WEZA 4MKVA 5KFWA 5KFNA 1BQMB 1M1KT 4ZHRA 2V34A 3N5BA 4Y0FA 3W65A 2YNFB 3A4TA 3CMQA 1C0UB 4IOAQ 1VRTA 4B08A 2F1FA 3RBEA 1R0AB 2DO0A 4ZJLA 3I5CA 3SQGB 2V2QA 2W2MP 4LSLA 3AAWB 1JJCB 4WWSA 4GVLA 3QSIA 2Q43A 5KFRA 1SJQA 4J5OA 5IS2A 1REVA 1VQ6S 4ECQA 2B56A 3MM7A 5A6WA 1IUJA 1SH0A 2EKNA 3NP5A 1IR1A 4MTPA 3CF5Q 4QU6A 3UW1A 3I56S 3J81U 2WSFC 2PFDA 3SI8A 4C98A 3D6FB 3QT8A 3NCQA 2QFJA 3M05A 3BO3A 2CJXB 4DJBA 1N5SA 2B9YA 3W1YC 3PXGa 1EQMA 4PRFA 4ED2A 1B0VA 3Q89A 3FBBA 3QFHA 4I2PA 3UI3A 3B82A 3S1TA 3BZQA 3MM6A 4DS4A 3NEKA 3VR1A 2OUGA 3R5JB 2E1RA 1U48A 3QT6A 2D69A 3P5BP 3I32A 3UFCX 2HHQA 1TK5A 1X4DA 3DHXA 1WDDA 2F8MA 3LPEA 1F9EB 4DMZA 4KV8B 4MAKA 3G9CA 1RWMB 5HBMA 5F3TA 4EWTA 2Z0GA 2R8IA 1SC1B 4I6WA 3MD3A 1VJWA 4AL5A 1F3FA 2OEMA 2D3ZA 3PCOB 2KH9A 2J76E 1HWUA 5E33A 1HQEA 3HHLC 3MAQA 5AJ3F 1AXQA 1HNZJ 1TV6B 1H7XA 4C9DA 2VG7A 2V4QA 2XLIA 5DQHA 2JLFA 1H2UX 3H5SA 3NRBA 1XC9A 3OL8A 1PYSB 2YKAA 1RTHA 3C16B 3H0PA 2VDIA 1NDCA 5JXSA 2ALZA 3DRSB 2ZH8A 1FHTA 3MCNA 2GMLA 1RAOA 1NSPA 4PXCA 5KFBA 5HJYA 5D4LA 5D15A 3V6KA 2QLJB 2OD6A 1T9TA 2VG5A 1D09B 1Y00A 5KFKA 2IDLA 2FYXA 5CA5A 1YJRA 3BKUA 2QL7B 3C15B 3RAMA 4WP3A 1H73A 2W2PP 4EYHB 4JI4F 1U0SA 2I8EA 3RB3A 1RWPB 1KOOA 3UVJB 1S9GB 4DV4F 4CIOA 1PYTA 4N41A 2YX1A 4HT7A 2BW7A 5KT7A 1VC6A 4NLDA 1TK8A 1S10A 3NGKA 4FBTA 2BEFA 5E3QA 3MAAA 3QFWA 4YOEA 3OHAA 4MFBB 2FLLA 3BV8A 1M5HA 2VICA 2VFTA 4FNIA 2KXHA 3K5NA 2N7YA 3CD0A 5KG6A 3EGVA 1IBMF 4BWJA 3OL6A 2LEPA 1FESA 4JI1J 1UEVA 3BB5A 3AOBA 5CZXA 1U4BA 2QT7A 2MQNA 4NXNF 2A2DA 1WHYA 2OPSB 4PG4A 3S8SA 1KTQA 5J2MB 2D41A 2R7UA 4C11B 3TJ8A 4M1KA 4NCGA 5B0EA 3ILOA 1SI9A 4DHVA 3NLCA 2AD9A 2FY8A 3V6JA 4YMEA 2UXCF 3W64A 3QRPA 5E3CA 3HFKA 1U1LA 5IT9U 2BRLA 2BV3A 1UJ6A 1VQLS 4OZ2A 4P7TA 4P75A 8ATCB 3CTRA 1HBUB 4A4JA 3RW7A 6FD1A 1IVZA 2PMZD 3BBCA 2A6OA 2V9WA 2HRTA 5DZ7A 3SDEA 5A0YB 2VG6A 4RNMA 4K0KJ 2U2FA 2MZSA 2MKKA 3R2DJ 4RW9A 1P9YA 3RU0A 3M9NB 1U0HA 1MWYA 1S72S 4WJBA 3PY8A 4DV2F 4MYTA 5KOXA 2DNGA 1RTZA 3PW5A 4UOGA 4WKYA 1ZPVA 2R8HA 4WU2A 1GMVA 1ZOTA 5LT5A 3GJSB 1HBOB 2EFQA 2DNQA 2OMOA 3N01A 4NLYA 4I7FB 3RB6A 3W5ZA 1QVGR 3DXSX 3RRGA 2DRDA 4QYZK 3W9IA 4B3TF 4FF2A 4F3OA 4KGKA 1C4AA 3CJKA 5CYJA 1U1QA 1TKDA 1H98A 3E2EA 1RAAB 2IFXA 3GZ7A 3MMJA 2DEJA 2V69A 4A8MP 4OYZA 1SPBP 1WG1A 2G0IA 1X4GA 2WSCC 2QL5B 4LR7A 3DXBA 3GV5B 5HROB 1D1UA 2FVCA 2C22A 3N6LA 4OYWA 4U7UD 3G6YA 4GKJJ 2IMOA 5CHCB 2V4RA 4P2SA 3CEDA 1MLAA 1RSCA 3FKBA 3OHBA 2EK1A 2RVJA 4OI4A 1SJ3P 2HS3A 3G8TA 1UTAA 2JLGA 1RT7B 1JB0C 4Q44A 3QGPA 4EZ6A 1JLGA 4GKKJ 1K73T 1T05B 1S6OA 1MNEA 3WIUA 1Q81T 3QSYB 2AYBA 1TUVA 4HEA9 5L1JA 2DT9A 3UN2A 1JJ4A 2HHHJ 2CWXA 5J2NB 2Z30B 1VI7A 1GT8A 2K1RB 5E3RA 5KT2A 1S1XB 3OW2R 1RB0A 4WXWA 5HQMA 4RU9A 2ZH3A 4ER8A 2KM8B 2MLXA 2CPXA 3GYXB 2M0GB 4U96A 3UPFA 4JP8A 5KG7A 2D7SA 2D3OR 4TQRA 4YB6A 2YWEA 3ISZA 3J7YU 4DR7J 1Y11A 1X4EA 3GSIA 3RRHA 1U47A 3J7YI 5IT0A 3OFHA 3BJYA 4OV1A 3OTBA 4PPDA 4RW6B 4FVMA 1QTNB 2IVFB 3C2PA 2MB0B 1JLQB 5AXKA 2UVVA 4DUZF 4KTQA 1RE1B 2YH1A 1GAOA 1M5KC 1Q8LA 2RHQB 2PGCA 2PN6A 2Y0BB 4JB8B 2OSQA 4QW8A 3KTQA 2YKQA 2DXDA 2AZ1A 3DMJB 1B99A 3T5KA 2MQOA 4ERDA 4USWA 4P74A 4PWDB 2J8SA 2C42A 2AP6A 2NXCA 1S1WB 2P5VA 1H2TZ 3V4MA 3FFIB 3M4XA 3PDNA 1TUWA 3ZZOA 1EKRA 2JEGA 2JDJA 4GC7A 5IC4B 2M8HA 2XM3A 1TKZA 3MDFA 3DRRA 2RMLA 1NKBA 1X60A 4A8YA 1DQ8A 1SH2A 2R4FA 1RHJB 5AXMA 1XMOJ 4RW8A 1A7GE 5ETSA 2A10A 2CQPA 5EWFA 2J0WA 3WIVA 4Q2MA 2UV8A 5J1NA 2CYYA 1UJ5A 2WOMA 1AT1B 5GVQA 2GHVC 1ITPA 3R8YA 3LP1A 3TYTA 1Q5YA 1T8EA 2V2KA 2XGQA 1RT5B 5EDWA 1UFWA 2DR5A 3C14B 3IWXA 1UP1A 4DZDA 1BWEA 4J9UE 2VOPA 4JI6F 1SC3B 4OX7A 2CVIA 4ZKAA 2NPIA 2Y8WA 3QLHA 3I31A 2CPDA 4B3SF 2VBZA 3T6BA 3VZIA 4E8UA 4EI2A 3J7Z5 4IDKA 3T41A 1HR0J 3MM9A 4AYBD 3M2RA 3UCGA 4DV5J 3A3PB 4KHPJ 4EU0A 5KFVA 1FVSA 2HQCA 4U6PA 3I96A 4B9UA 3A8KA 3VAJA 1SC6A 2KRBA 4ZVGA 3CW2C 2VBYA 3EMTA 1R8CA 5HSPA 2PI5A 3Q8RB 5HVHA 3VV2B 5K9FA 2C3MA 2P6TA 2ROGA 3MEKA 3RBZA 1FJGF 1UWBA 4KYZA 4I2QB 3P6YC 3KUGA 2O01C 1L3TA 4DPYA 4AQYF 1NPPA 4RW7B 2EBEA 2W7AA 3HSZA 2YNGB 1U02A 5JVHQ 4KO0B 2VPWB 3A13A 1GMUA 1U24A 3HLUA 4NEZA 4DV0J 2XG8A 3R7SB 1Q79A 4OX8A 4U8VA 3TWZA 3KLFA 4X66J 1NKEA 2UZAA 3I5AA 3J81j 4X62F 4C6AA 1IKYA 4X65F 2UV8G 4M5NA 4ZCLA 4R8UA 2HFOA 4A48A 4LF4F 3CCRS 2AX0A 2HG4A 3MM8B 2X3DA 1T3NA 4DR2J 2ZBPA 1FRHA 3KLIB 3CULA 3W8PA 1SCJB 2D3UA 4O0NA 1DJ0A 2HHWA 2IY5B 2OFHX 4DEZA 3BO4A 1CULA 4IRKA 1Y3JA 3UNGC 4LF6J 3SSRA 5F8NA 2GQCA 1N5QA 4FF3A 1TTHB 2MQQA 2GQ2A 1WEXA 2GJFA 3H42A 4X2BA 5BYQA 2BJ8A 4G6VB 2ZOGA 4KRWA 2B4UA 3QZ7A 4LFBJ 5F8HA 2B4VA 3A8EA 1RLCL 2HFNA 9ATCB 2CJBA 4U67Q 1GXUA 3MAHA 1RTDB 4B9MA 3ZZYA 2NSBA 1VBXA 1RP5A 2CPFA 2JNJA 3CWJA 5L38A 1S4FA 2FLOA 4B3MJ 1ICEB 1TL4A 2H1YA 3CXCR 5F8MA 2DCLA 2L9WA 2MJNA 1T9XA 3ET6B 1RTJA 2FHMA 4CT9A 1Q78A 3M1VB 3OL9A 3BN4A 1RAIB 4DQQA 1VQ8S 1TL3A 4IFVA 1RKIA 1FFSB 2ZOMA 2Q6BA 5F0WA 1UAWA 1FWLA 1RDRA 1HNXF 3M8PA 2WB4A 4EUVA 1H3DA 4RUBA 5RUBA 2DNNA 3PV8A 3HHLD 1NDKA 4IG3A 1S0MA 3R6GB 4OYBA 4JOUA 3IWNC 1RU1A 3KDNA 4C8YA 4EMDA 2V6AA 1NK7A 4LF8J 5KFQA 1AROP 1XTZA 1ULRA 5IM0B 4DR4F 5DLFA 2ZZMA 4UF4A 1WF2A 5L1LA 3LW5C 4PG6A 4DL5A 2AMCB 3PYGA 4ITSA 4ZIWA 3DOKA 1F5CA 4FF1A 3JYTA 1J5OA 3G71S 3MCMA 1KVKA 4XPEA 5KT4A 2DHAA 2E66A 2C28A 2C2KB 5K14A 2LA6A 2M5YA 3KHGA 3C3LA 4O44A 1RAHB 2RJZA 4DV1F 2H5EA 3D5MA 2RH3A 2ACMA 4F8RA 3AD9C 4X64F 1T03A 3ENWA 1I1GA 4P72A 3MUTP 1I94F 3QBCA 4C2MA 5CCLA 1AZSB 2KG1A 3CJRA 3LTOA 4YQWA 1S0VA 2L9NA 3BQ2A 3DRPB 2CJYB 1HHTP 4N76A 2HW3A 1VIOA 5DQGA 1U09A 1HA1A 1U25A 1S97A 4QBUA 4WFNQ 2RT3A 3MR3A 3D0HE 4Q43A 4JV5J 4NA1A 5FLXU 1A6LA 1RJJA 2FJXA 4EEYA 1KEKA 5D3GA 1DTQA 4ZPCA 3DDNA 4QW9A 1NJZA 4F04B 2BANA 1WC5A 3BPSP 1C0TA 3GCWP 1S1TB 1HFEL 3KWMA 1UFKA 3RZAA 2HVHA 3EM1A 3QMQA 4ELUA 2IAJB 1SL1A 4DSLA 2MKCA 4P2MA 4LF2A 3AD8C 4DLEA 3M8YA 2BVZA 3TUIC 4DCPB 3OV7A 3F73A 4NLOA 2CNLB 4USKA 4ALZA 4CP5A 3SSQA 5JMNA 4YP3A 1SUQB 5T7LA 1SQGA 2J9DE 1XEZA 4J9LA 5AE2A 4B3OA 4R25A 3CVKA 1MWZA 4ZHRB 3QRQA 2EFOA 4DG1A 1HWKA 1HARA 3H5XA 1A9NB 4EBCA 1QAXA 2EFNA 2WVBA 1VRTB 4WIQA 3NAIA 4RBUA 4NLRA 2R8GA 3BM7A 5LOQA 2V2VA 1U1KA 4ZPBA 4LSLB 3TVZA 3MZIA 1FDBA 2EG2A 3I4PA 4FNHA 2ZNYA 3GV8B 1REVB 4H4MA 3MM7B 1TQLA 2GIRA 1S9EA 1S7IA 1OPIA 2IC3A 2MGZA 1U26A 3OVBA 4PWWA 1Y4ZB 1BMQB 1FTCA 2N82B 4FKYA 4NRUA 1XNQF 2NXJA 1WKLA 4ETZA 1CC8A 5EHHA 4U8YA 1Q8BA 4NLQA 4N56A 3VAHA 2BACA 1PG5B 1ZPWX 4NYOA 1N34F 5ETKA 2IJFA 3TRGA 4I2PB 2UUCJ 1F5AA 3C6UA 2RQ4A 4OX9F 2DCUB 3MM6B 5FIIA 1R8AA 3KKFA 3VALA 1S7HA 5HQ8A 2J0QD 2V94A 1B4SA 2PD1A 4LUBA 4WYWA 1RWOB 3GP9A 1VRQC 1YGYA 1DRZA 3MURP 3Q8UA 1F9FA 2FHKA 3GSDA 2I38A 4P2XA 2J8AA 1WSRA 3PM9A 3KG1A 2J6SA 1F0XA 5GMDA 3DLKA 4EO6A 4ANEA 2QO3A 4TY8A 2HFSA 5HBMB 5HL7Q 5HI7A 1BGXT 3TEGA 1FRXA 3UDEA 3DCAA 2QG9B 4K4YA 1KONA 3HSGA 4CCHA 4Y65A 4JI5J 1TU0B 3SCLE 4P71A 5D0RA 3UNYA 1Q86T 2BYCA 4U9RA 3QGHA 3U7JA 1HQEB 4AE5A 2E7XA 2EI5A 4KAIA 2C3YA 5SUHA 2IHR1 2UUBJ 2LQ9A 2VG7B 4DXLA 1X7VA 1QLNA 2AU0A 3T1HF 1SJ4P 3EPIA 2ZZNA 1RTHB 2ZKUA 2QA1A 1U45A 2QSFA 3QGIA 2KO1A 4IKAA 2DJWA 1S6QA 2LQJA 4Q2LA 1VQYA 2CQ4A 2D9PA 3C66A 2FUG9 2B3TB 3CD7A 3P8BB 3HT0A 4PYDA 4YY3F 2VG5B 2XY6A 1HNIA 2M9KA 5B0GA 3QJLA 1FWPA 2H4WB 5L1KA 3ZTQA 4YN3B 3EX7B 1LWXA 3C6TA 3QNWB 1LK7A 4R0EA 4DFKA 2SXLA 2BM0A 2CPJA 1KN6A 3H8YA 4A8OA 5HMWA 4DR1F 5EX3A 4HR2A 2HEKA 2Z2MA 4A8KA 3D6MB 2JC0A 3JTNA 4CH1A 2IBOA 3MAAB 3AOCA 1HI8A 5C24A 1IKXA 1IN0A 4F4WA 2DH7A 2D3O1 2GIQA 5LSOA 3SMZA 4ED7A 2ZNZA 3L7UA 1QAJA 2UUTA 2XMTA 4XO0A 1NJXA 4DN9A 5DM7Q 3IBFB 1TR0A 2N3OA 5LMUF 4L3KA 1J27A 2Y0SD 5C2CA 4IOCQ 1R6VA 5D0HA 3HULA 1AA1B 5HJXA 3IR6B 4NCGB 3TAQA 1T9VA 4KGMA 1JLBB 4IFYA 3Q2TC 4C4WA 1KVJA 4OYOA 2JVOA 1Q7LB 1SKRA 4TYAA 4WXOA 4LF9F 1PGZA 4X4SA 3DRYA 3TQEA 3MOJB 1DFDA 4DSFA 3OVAA 4YDXA 3MUVP 2A18A 4USJC 1R31A 4JYAF 1HW8A 1FXLA 3OSPA 3RGIA 3NGRA 1N0VC 2UVRA 5DQIA 2G1DA 3WBZA 2VFSA 1NHVA 4DL4A 1YZ6A 4NZ6A 4QPXA 2E29A 5B0FA 4C8NA 3SDEB 2EFGA 3K8VA 2VG6B 3RB4A 1WOPA 3DLBA 3MR6A 5AE3A 2HZAA 4RW9B 5KFMA 4CLLA 1U0HB 2AJFE 1OSDA 1UW4A 3Q24A 3OR1A 4Y2AA 1X4HA 3NOGA 4HHUA 3SQGA 4DFMA 4ECSA 3TUZC 2VDHA 4B3RF 3FRYA 3DYAA 5ETMA 1RHMB 4EO8A 3IS9A 2E5LF 3CJKB 3GJTB 3BDEA 3NOCA 1AUDA 1JQGA 2ZM6F 4IRCA 3K89A 2J7WA 4M5KA 3C19A 3Q86A 1V3RA 4CRJA 5AE1A 4PPZA 1HL6A 3MR7A 1WG4A 2ZVIA 2KG0A 4F4KA 2R2TA 2MPUA 3IMQJ 2ASYA 1SKUB 1E6YA 3N4WA 4LR8A 1L3VA 3CJ8A 4NWBA 1NJYA 2F4VF 4L3NA 5U47A 4UY85 1VQ4S 3DDKA 3M6XA 2GX8A 4G1QA 2RQKA 4JI7J 1FNOA 4S0MA 4WFAQ 5ETVA 4N77A 2I6WA 1JLGB 2U1AA 3FBFA 1WC3A 2BKNA 4QOTA 3W9JA 1KS2A 1VK3A 1TL7A 1XK8A 5KFXA 3TZZA 3PRBA 3IAS9 4RNHA 2HVZA 4ZS6A 2HQDA 4LF5J 3HHLA 2HVDA 2HIYA 1HBNA 1YJNS 2LQ5A 4RBTA 3FNNA 3MTKA 2H65B 3W8GA 1VQMS 5DGAA 2OAUA 1XIQA 3UR3C 2AJ0A 1N33F 3LA0A 2IM1A 3ILLA 4LMZA 3NY0A 2RSQA 3GG1A 1DBDA 3PO4A 2HHUA 3VZHA 2F8HA 1WC1A 2HFZA 3KMSA 2XLJA 2DNYA 3LOUA 2FJBB 2IM2A 1W2IA 2EFVA 1WC6A 3F44A 4CQ1A 2V8GA 5F8GA 4EBDA 4F4AA 2AGPA 2K7KA 4LF7J 2QZ8A 4CLYA 2J7UA 3H5YA 3FQLA 2W8KA 2QMXA 4F0MA 2HZCA 1ZAWA 2YKOA 2JEJA 1TZ0A 1N5TA 4M5HA 4C3MA 1JLEA 4ZVQB 2R8JA 1OY9A 3R1HA 4CO2A 2KKHA 1XNRF 1YSJA 2HSEB 4DF4A 4CO4A 4J7CA 4ETXA 4EK2A 1UL3A 3LQVA 4DV7J 2UXBF 4TVAB 1G3OA 4JI0F 3QJJA 3MEGA 3FMWA 1X4AA 2VUGA 1TKZB 4PKDB 5KFHA 4ZJOA 3H2UB 3DRRB 3SSSA 5E2QA 4K5SA 1PKUA 5F0UA 4KPYA 2XLKA 4LRFA 2GIFA 1PCAA 2RB7A 5F9LA 3UE2A 1X9WA 4RW8B 4QWCA 4H54A 4UQGA 3FEYB 3BSCA 1VIXA 3R2CJ 2AX1A 4K4WA 2R7OA 2UU9J 2Q1LA 2WOMB 1JLFA 2WBMA 5KFJA 1WELA 4QWAA 2A6MA 3ENVA 2Z2ZA 3LP1B 2RIJA 1YITS 5L9XA 2HRYA 2VJUA 2VJVA 1FJCA 1N36F 4CM0A 4EFAC 2BKPA 2NXNA 1FEEA 5FJ4A 4PR6A 2X3GA 4NLSA 1NCLA 5HMXA 4OZ5A 3QLHB 1ZBTA 3OUYA 1NBEB 3Q83A 3SIPB 4IDKB 2DEIA 1I3OB 2HWTA 3MM9B 3K7RA 3M2RB 3CJQA 3N6NA 1IBLJ 1VYAA 2ZKTA 3W62A 2N3LA 5EWEA 4RUCA 1G4CA 5GAEU 3NS6A 1R27B 5GAEI 2MTLA 3I82A 2MHNA 1WOOA 1IQTA 2CQ0A 3KK3A 3MMBA 3GU0A 2IA0A 2C1EB 4ATNA 1UWBB 1RT2A 5C42A 3IR5B 2Z8QA 3FSIA 1L3KA 1NH8A 1XMQF 1HMVA 3EZ5A 3NNAA 1S9FA 4DUYF 1JXVA 2AJ1A 1UW9A 1WKJA 4F36A 1LFWA 2V8VA 3SBMA 3KLFB 4C8ZA 1WNEA 2OGUA 2KT2A 4P2FA 1IKYB 2COLA 3VAMA 3I0SA 4R8UB 5I3UA 1YHQS 2KDOA 4O3NA 4NLWA 2R7TA 4C0OC 5K5MA 2QX0A 4OFZA 1YRUA 1KP6A 4CNZA 1KHWA 4OQJA 2RU3A 1DHMA 3ZTOA 2Q6CA 2RD5C 4ANCA 3DOMA 1CULB 3VGSA 3IAM9 1GX5A 1RYSA 3MTJA 3IRXA 2ZH6A 4AT1B 3TAMA 4DL3A 3A8JA 5A8KA 4RO0A 1MSWD 3M8WA 3OVSA 8AT1B 4YB1P 2Z56B 1FWKA 3K59A 1S49A 2B0GA 2Y9HA 4TXSA 5KFEA 3A8IA 1B64A 4ILLA 4NCAA 3TX8A 1UVJA 4YR0A 3ZFVA 3WX4A 1BLUA 1EX8A 1VRUA 3AQOA 4DFJA 3R5GA 4ECVA 4PG8A 4LSNA 1RTJB 3H7HB 2EW9A 5DDPC 1QE1A 1KC8T 2CG8A 4D3GA 2FZKB 4PXBA 3FGVA 3TZXA 1TL3B 1ZAXA 4IFVB 5KFIA 4IG0A 4WCEQ 3SCIE 2RDIA 4UQTA 5AJ3J 5LXYA 3HK2A 3F56A 2HHPA 3M8PB 2VOOA 4HDHA 4IG3B 3BGLA 1M1GA 2DGUA 4TN2A 1X0PA
chains in the Genus database with same CATH topology
5KFFA 3HZGA 1K73T 3PJWA 3CC4S 4X66F 4F50A 1S6OA 1T05B 2N4CA 2OMLA 5DRKA 2XCAA 4ED1A 4CTAB 2RNEA 3HVAA 1XERA 2V4JA 1GXTA 1MNEA 1OSCA 1ZZNA 1FRKA 3KHHA 1Q81T 3RAXA 1SL2A 2AYBA 4RNNA 1S1UA 1TUVA 4HEA9 3MECB 1SJRA 5L1JA 3TW0A 2DT9A 1HNVA 1TFWA 1XMBA 2KYXA 3IFEA 4DR2F 3T5HA 1JJ4A 3N5FA 3X1LB 3L7PA 4DSKA 1FEHA 2CQCA 2ADCA 2B9WA 1T3OA 4J37A 5J2NB 3Q0AA 1DTTB 1N52B 3DOKB 1VI7A 1GT8A 2K1RB 5E3RA 5KT2A 1S1XB 1DQ9A 3ZC4A 3OW2R 3OLBA 3JYTB 1J5OB 2F9DA 4NLPA 1GXLA 4WXWA 3T5JA 3J7ZT 1YJUA 2BBEA 3W2WB 4DBQA 2V0NA 3S6EA 2M7SA 2ZBIA 4RU9A 3WZ0A 1Q4RA 1JXEA 1TKXB 2ZH3A 1VC0A 1SJ1A 2ABYA 2KM8B 2LMIA 4BS2A 4LQ3A 2CPXA 2ZJRQ 1RT4B 2JFKA 3EZUA 4LF6F 4OLOA 2MHEA 2B5JA 5K14B 3GYXB 2R7SA 2M0GB 3UPFA 5DETA 3CD6S 4IR9A 1AFJA 4USIA 2LYVA 3KNAA 2XC9A 5KG7A 2D7SA 2VFVA 2D3OR 3IBWA 2OLWA 1R89A 4TQRA 3HVTA 4F3QA 4YB6A 2YWEA 4O44B 1U1RA 3ISZA 3J7YU 2FY1A 1X4EA 2V8DA 3RRHA 4F02A 1T7PA 1U47A 3OJUA 3J7YI 1KQFB 4M8LA 5BYSA 1CVJA 5IT0A 2NYIA 3OFHA 4C8LA 2NZ4A 2LLZA 3BJYA 4PCQA 5A8RA 4OV1A 3VWSA 2J0XA 3OTBA 4PPDA 1T03B 3FRZA 4RW6B 4FVMA 1DURA 4MYUA 1VQKS 2XHWA 2JOQA 5F41A 2IVFB 3C2PA 4LFBF 2NUHA 2MB0B 1JLQB 1Y7PA 3H2VE 4OJHA 4WFXA 2GHWA 1U2FA 2IRUA 5AXKA 1YJVA 3B4MA 1M5SA 4WTYA 1DQAA 2UVVA 4C8KA 4DUZF 4KTQA 1FJEB 1R3NA 1P1LA 1V3ZA 2RF2B 1U2RA 2YH1A 1GAOA 1M5KC 1Q8LA 1Z1ZA 2PGCA 4BWMA 5IXUA 4FP9A 3VQSA 3O6QA 2W7OA 1VMBA 3PHEA 4ZPTR 4KV8A 3RR8A 2PN6A 2XWXA 3CDAA 1R8PA 3PIOQ 1NKCA 4KKOA 3P5TL 2OSQA 2XSJB 2XO7A 3AY0A 4QW8A 4AXJA 3KTQA 4DR6F 1FTRA 2YKQA 1ZZFA 4B3MF 4OLPA 4FXVA 1LWEB 2PMHA 1MMDA 4IO1A 1Y5LB 3DMJB 1D0EA 3P3DA 4EYIB 2ZD1A 2RILA 3T5KA 2MQOA 4ERDA 2OIHA 3M2VB 1PO6A 2JZ5A 2IYGA 3HDSA 5D3GB 3I55S 2DRBA 1DTQB 4OHWA 2E5GA 4C3LA 5HP1A 1LW0B 5F8JA 4PWDB 3M2UA 1U6ZA 2ROPA 2KT3A 3HHDA 2BJEA 2C42A 1TKTB 4M5DB 4ILMA 1YJ9S 2BANB 3NS5A 2LEBA 3MEEA 2AP6A 2HQ3A 1S1WB 4MK7A 1C0TB 2P5VA 2PA8D 1ZAVA 4BC9A 1H2TZ 5KFDA 1C4CA 2NREA 4LFAF 3G96A 3OR2B 2E5JA 3TI0A 1TV6A 3KHRA 2RQMA 3V4MA 5C5JA 3DU5A 3I0RB 3FFIB 3M4XA 3PDNA 4ZPAA 2KYZA 5CYMA 2KI2A 2IVMA 3NBPA 2HNYA 4DS5A 2DR8A 2ZUGA 3ZZOA 1NK4A 2DGTA 2P6SA 2JEGA 3DI6A 2JDJA 4ZP9A 2ACYA 2DNPA 3D1OA 2M88A 2FJEB 1URRA 5IT4A 5I42B 4GC7A 2M8HA 5ADZA 3LAKA 1HHSA 1TKZA 3D0IE 3MDFA 3LALA 5HN0A 2K7JA 4OI3A 3DRSA 2BW2A 1G6BA 3DRRA 2LU1A 4JI2F 2RMLA 3PJXA 1GTHA 4CZCA 1NKBA 4RZRA 4WU3A 2NUUG 1X8DA 1IBKF 4LF8F 1DZ5A 4A8YA 5E41A 3KLHB 3LP0B 3TA0A 3SZ2A 1DQ8A 2B43A 1KFSA 1SH2A 1JJHA 2GO8A 5T7LB 2R4FA 3D2WA 2FVRA 3GR0A 5F3ZA 3DM2B 2ZC4A 1QSYA 4ZCKA 5IZHA 3MMAA 2HS4A 3QIPB 5AXMA 4BBYA 3V6DB 1P9QC 1NK8A 3PIPQ 4RW8A 4YR3A 3KLEA 1Q8IA 1A7GE 4AL6A 1XBWA 4B3OB 3MHYA 2A10A 2CQPA 3MOZA 2WB1D 5EWFA 3CIMA 2J0WA 1UVIA 2UVUA 2FJVA 1ZM4A 2VFRA 3NMAA 5E0OA 2I1RA 5KG1A 3Q8QB 3CCVS 1UVMA 4Q2MA 2UV8A 5J1NA 4DG1B 2J6TA 2CYYA 3NMRA 1UJ5A 2WOMA 3DC2A 5GVQA 3V5RA 2GHVC 1JKHA 1R8HA 2G13A 4RWWA 4Y34A 2R2UA 2HHSA 4IQXA 3PW4A 4R0JA 3LO3A 3LP1A 1D9FA 3F41A 3SV4A 1QUVA 4GKJF 3TYTA 1S9GA 1H7WA 1T8EA 4DOZA 2PI4A 4M94A 1QVFR 3E8OA 2V2KA 2XGQA 5M2UA 2HNYB 2ZE2A 3PO5A 1RT5B 2B6AA 3OTEA 5EDWA 3K58A 3BQ0A 1UFWA 2DISA 3R5BA 1X5OA 2DNZA 3G86A 4HH1A 2MZRA 3T3FA 1U1OA 3SEOA 2DR5A 3GFHA 3BGFA 4G1PA 3IWXA 4IH7A 1UP1A 1BWEA 2CVEA 3RTVA 4TU7A 2YNIB 4OJGA 3D28A 4B9VA 2VOPA 3KK2A 2QA2A 4JI6F 1N48A 1EP4A 3PKYA 3GIJA 2LECA 2DH8A 4H4MB 4OHVA 4OX7A 2CVIA 5E3PA 4ZCIA 1QAYA 1OPZA 2NPIA 2POKA 3FCHA 4IQMA 4ZKAA 1RGVA 2MXYA 1VQ7S 1Q82T 3QLHA 1RQ0A 3I6PA 4I6AA 1S9EB 3QAUA 3PW2A 2VPYB 1O0PA 3Q8SB 3I31A 4MFBA 2YKNB 2CPDA 3OXLA 5BYRA 4I0WA 4B3SF 2DIVA 2IC3B 3OBIA 2VBZA 2RKIA 4MIBA 2MGZB 3T6BA 3SYZA 2HHTA 3VZIA 1RA6A 4E8UA 3J7Z5 3VQTA 3IA0A 4IDKA 4O3QA 5KOWA 4HVZA 5THWA 2VA3A 4DQIA 4DL0C 4ES1A 3MM9A 4AYBD 4MKAA 3DLHA 2DNRA 3M2RA 1KLMB 2VPXB 4BHQA 3UCGA 5B0AA 4AUKA 3RW6A 5KFOA 3DLLQ 3HO1A 1HQUB 1N4LA 3QGGA 3HKZD 1JNZB 1HW9A 1MROA 1LK5A 4EU0A 5KFVA 1FVSA 4I56A 2KFZA 4U6PA 4ZVEA 4OI6A 3I96A 4B9UA 3M6UA 2A3JA 3TOQA 1NK9A 4K4UA 3U1LA 3MD1A 3VAJA 4XPCA 1Q53A 1SC6A 1Y5NB 1JNRB 2KRBA 4ZVGA 4X4OA 1VBZA 2VD3A 2ILYA 2VBYA 4PUOB 2LDIA 1WTFA 3M6WA 5CH7B 1R8CA 4A8WA 5KFSA 2M2BA 2OPSA 2PI5A 3DLEA 3Q8RB 3C6UB 4QIWD 2UXDF 2DGVA 2R7XA 5K9FA 2C3MA 2P6TA 2ROGA 3MEKA 4DR7F 1YQHA 1FJGF 5J2MA 4U7UK 1OQ3A 4DX8H 2R7RA 3QIDA 1UWBA 3FVYA 3C46A 4I2QB 3IN5A 4C11A 3BGRA 4HDGA 3K5OA 1G1XA 4OJ3A 3P6YC 2HPUA 2DK2A 4HTJA 2O01C 1L3TA 3HJFA 3V4IB 2KVIA 4OHYA 1UA1A 1FKPA 1UFLA 4AQYF 1Q1KA 4O4GA 3G6ES 3O1LA 6FDRA 2BXJA 2AWZA 2B51A 2EBEA 2W7AA 4KHRA 4RW7B 2V8HA 2YNGB 2R2RA 5KT5A 5JVHQ 1FT8A 4J9PA 1NNDA 5KFYA 4KO0B 1BQNB 2VPWB 2DBBA 3LAMA 4O23A 5B7WA 4DLGA 1U24A 3BR8A 2PC6A 2FLNA 3HLUA 3DLKB 2XG8A 5IWAF 2G4BA 1FA0A 2XSFA 2XMUA 4IH5A 4TY8B 1Q79A 4OX8A 2F40A 3O3LA 3KLFA 2DB1A 2FVQA 1NKEA 2UZAA 3GB0A 3I5AA 3R1LA 4X62F 4LVOP 5M2PA 1IKYA 3AA8A 4X65F 2C2DA 2PO4A 3MXHP 2UV8G 1IJEB 3ETOA 3FSXA 4GO5X 2EWHA 4ZCLA 4R8UA 2HFOA 2DITA 2KFYA 4H4OB 4ID5A 4KB7A 4A48A 1HBUA 2LDYA 4DPOA 1KQGB 2XGPA 4LF4F 3CC7S 1TAUA 3CCRS 2AX0A 2HG4A 4OZNA 3MM8B 4QCLA 1T3NA 1KD1T 4DL7A 2KXFA 3M8RA 3G8QA 5CZVA 1FRHA 5MLCV 1S76D 2OTJS 5T41A 1ZM2A 2QA4S 1FNMA 3KLIB 4G3IA 2AGQA 3CULA 5D77A 2PT0A 3T6JA 3OFFA 2OSRA 5A0YA 4KIAA 2DTJA 1Q16B 1YJTA 2D3UA 3M32A 1J5EF 3N0VA 1D9AA 1DJ0A 1DARA 1HI1A 2HHWA 3CJ5A 2OFHX 2KXNB 5G0RA 4CO5A 4QR0A 4DEZA 4Q5VA 3BO4A 4DL2A 4IRKA 1B0PA 2W4CA 1Y3JA 1URNA 5EN1A 1RT3B 1W25A 3UNGC 2YKPA 1DLOA 3SSRA 4A8SA 5F8NA 3M30A 3OQ2A 2GQCA 5K8OA 1N5QA 4FN5A 5KG3A 2PE8A 1IXKA 1SQEA 1R43A 4NLTA 5DS7A 3PR5B 2GQQA 2DIUA 3LWLA 4FF3A 1CEZA 2BE2A 4P7VA 5KFUA 2MQQA 2GQ2A 1WEXA 1S6QB 2NPFA 3G6VA 4W90B 4LIWA 2EVZA 3L3CA 4X2BA 2MSTA 2WONB 4NZ7A 5BYQA 4ZPWR 3DHWC 2DHGA 3JTOA 3CO9A 4G6VB 1HBOA 1WI6A 1SJFA 4B02A 1HBMA 2ZOGA 4KRWA 2B4UA 3QZ7A 2DNMA 1FK9B 5F8HA 1VQPS 2B4VA 3A8EA 3NWGA 2GJ2A 2H9ZA 1QTMA 2HFNA 1V9OA 2CJ9A 1K0TA 2CQGA 3UCUP 4I7FA 2CJBA 4U67Q 2FHJD 4UY8T 1HNIB 1MU2A 1GXUA 2YWGA 1X5TA 3MAHA 1RTDB 1RTIA 1JIHA 4B9MA 3OTCA 3ZZYA 2NSBA 2CPZA 1NO8A 1VBXA 1RP5A 2CPFA 3HMJG 2CQDA 3CWJA 2LQBA 3MMCA 2ZH7A 2NQPA 5LL6d 2LKZA 1NK5A 1N5YB 3DRXA 5GAHU 3ONQA 2DGQA 5LSRA 4O3PA 3ZZ0A 5L38A 1FO1A 1S4FA 3MM5B 3N79A 2FLOA 5A6PA 1TL4A 5GAHI 3C6TB 4DR3F 3GFXA 2DHSA 3AJ1A 4TLQA 4WE1A 3CXCR 1VQ5S 4Z37A 4ZVHA 3MPWA 5F8MA 2DCLA 3JSBA 4A8QA 2L9WA 3FJ2A 2MJNA 3G4SS 4NXMF 2C3OA 1RTJA 2FHMA 4CT9A 2IM0A 1Q78A 2YWKA 4DQPA 2K8GA 3M1VB 2UUCF 4EGLA 5J2QA 4RBVA 5EX0A 3BN4A 3OL9A 2CQ3A 2WW8A 4DQQA 1KQSR 3D1QA 1VQ8S 2QSWA 4HT5A 1FDDA 1TL3A 4OMFG 4IFVA 1RKIA 2HNZA 3EYZA 2ZBCA 2HHVA 4OI2A 3HM9A 2OPPA 1HPZB 2ZOMA 4LVNP 5HROA 2Q6BA 2Y1IA 3GE9A 5F0WA 1UAWA 1X0FA 1NEEA 4MK9A 1RDRA 3L95X 1HNXF 1C1BB 2KJVA 4PG5A 2DGOA 1HNWF 1VLYA 2OPQB 3JSRA 3M8PA 3IC1A 4J9SA 1YWXA 3KNGA 4YUDA 2WSEC 2N4DA 2WB4A 5C24B 1IKXB 4EUVA 3MFHA 1H3DA 2DNLA 2HIQA 2DNNA 1IM4A 3PV8A 4X4UA 1VBYA 2MSSA 3HHLD 3GFYA 2WCXA 1CQNA 4ZK7M 1U7LA 4IG3A 1F2GA 4AFFA 1RT7A 3ENQA 2W9CB 1S0MA 3UDCA 1EETA 4JOUA 3IO1A 1VFJA 3IWNC 1RT1B 5DLGA 4X4PA 4DSEA 5H9FJ 3K57A 3LP2B 4C8YA 1CG2A 1NK7A 2XMVA 1T05A 1KR4A 5KFQA 1AROP 1XTZA 3ICLA 4NCBA 1ULRA 2FC9A 4CTAA 2VQFF 2LCWA 5IM0B 2MZJA 4DR4F 1J2VA 1LKZA 1X9SA 5DLFA 2BJDA 3LH2S 2ZZMA 1MMNA 3MECA 1B7FA 1WF2A 4CO0A 4JI5F 2QEXS 5L1LA 3LW5C 4PG6A 4DL5A 3ISNC 3T5LA 2YY3A 3CJ4A 4ITSA 5J2NA 4OZ0A 1DTTA 3CJ2A 5FLXY 3DOKA 5HMYA 2K1RA 1F5CA 4FF1A 5J1PA 1S1XA 5EGYA 3POTB 3JYTA 1J5OA 5LSLA 3G71S 3GILA 4XPEA 5KT4A 2JL9A 2ROEA 4H4KA 2JLEA 4I68A 4NA2A 3W2WA 5MAOA 2DHAA 1FRJA 2J9CA 4L6V3 5FDLB 2E66A 2GMHA 4QR2A 4IFYB 4ECUA 1TKXA 2R9LA 3DOLB 1WACA 2C28A 1PC5A 4Y6IA 2VONA 1RT4A 1UEUA 1HWLA 4DN0A 5K14A 2ASJA 4UOCA 1K1SA 5B09A 2LA6A 2M5YA 2DNOA 2BR0A 2QLWA 4X4RA 3KHGA 2RRAA 2FJWA 3C3LA 4O44A 2RJZA 1RK8A 2Y1RI 1SBRA 4RUAA 4DSJA 2NLWA 4DV1F 3PZPA 2RUGA 2NS1B 4MH8A 4NYZA 1XR6A 2H5EA 3D5MA 3J7A1 2EFPA 2RH3A 2PFFB 1LWCB 1FDAA 2Y1JA 3HHNB 4F8RA 1YG0A 4ED0A 4X64F 1T03A 4IYQA 4RW6A 3ENWA 1I1GA 4I67A 3FDSA 1N54B 4I64A 3MUTP 3PFOA 1I94F 1JLQA 2O5DA 4B9LA 1Z2LA 4C2MA 2CQ2A 5DG7A 4HI1A 4QIVA 5CCLA 1M5PC 3IWLA 2E5HA 5B0DA 4B9SA 4HHJA 2EKYA 2KG1A 1S0VA 4YQWA 4E0DA 2RF2A 1TVRB 2L9NA 3I9V9 3GIKA 3RR7A 3BQ2A 3H40A 1JX4A 2XMKA 1WG5A 3DRPB 1NRKA 1HHTP 4N76A 2HW3A 3UQSA 3OPKA 1VIOA 5DQGA 1C2PA 1U09A 1HA1A 2D9OA 1U25A 2ZOFA 3W2VB 1S97A 4QBUA 2FHOB 4OZ1A 1YIJS 3AHPA 5K8PA 4WFNQ 3N6MA 2XSJA 3SV3A 2NSCA 2IVYA 2OFGX 2RT3A 2Z2LA 4Y2CA 4WF9Q 3MR3A 3D0HE 4Q43A 3TVKA 3QWUA 4NA1A 1LWEA 2E9ZA 1VHFA 4C3KA 4DDFA 1OIAA 3DMJA 1A6LA 4QYRA 1LXJA 4KQZA 1RJJA 1ELOA 3M2VA 4NLXA 1N0UA 2FJXA 3BR9A 4EEYA 1X9MA 1KEKA 5D3GA 1RYRA 2HYIB 3KG4A 1DTQA 4ZPCA 5GADU 1JJ2R 3DDNA 5A2QY 2IM3A 1LW0A 3H25A 4PWDA 2ZH4A 3ITHB 5GADI 3UCZP 1M5OC 4QW9A 1TKTA 4M5DA 1NJZA 2BANA 4BCAA 3R3TA 1TK0A 1S1WA 3OR1B 2AF6A 3FEXB 1C0TA 4QZVB 4CO3A 3UDLA 1S1TB 3EXYA