2H51B

Crystal structure of human caspase-1 (glu390->asp and arg286->lys) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
87
structure length
87
Chain Sequence
b'IKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTDRVTLTRCFYLFPGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-1
publication title An allosteric circuit in caspase-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 15
structure length 87
sequence length 87
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2h51B00
3R7NB 2HBYB 1RHRB 2QL7B 2C2KB 3EDQB 4ZVPB 2HBZB 3QNWB 5IC6B 2XYPB 2C2ZB 4ZVRB 1RHMB 2QL9B 2XZTB 2CNLB 2CNOB 2HBRB 3KJFB 1RWXB 1GFWB 1QTNB 2C2OB 1SC3B 1PYOB 1F9EB 4ZVUB 2CJXB 1RHKB 4ZVTB 3GJSB 3KJQB 2QLFB 1RWVB 4ZVQB 2Y0BB 2XYGB 3GJTB 3D6MB 2C1EB 4DCPB 4DCJB 2CDRB 3GJQB 2CNNB 3R7SB 5K20B 4ZVOB 3RJMB 3P4UB 3EDRB 1RE1B 4JB8B 1PAUB 1I3OB 1RWWB 2XZDB 3IBFB 3D6FB 2H4YB 3R6GB 3R7BB 4LSZB 3SIPB 2H4WB 2H54B 2H51B 4DCOB 3NS7B 3GJRB 2FQQB 2CJYB 3D6HB 2Y1LB 2C2MB 2CNKB 1I51B 1QDUB 1RWNB 2QL5B 1RWPB 1SC4B 5IC4B 3KJNB 2QLBB 3R5JB 1RHUB 1RWOB 2HBQB 2H48B 3IBCB 1NMEB 1RHQB 3P45B 1ICEB 2H5IB 1RWMB 3R6LB 1RHJB 2DKOB 2P2CB 2H5JB 2H65B 1SC1B 1IBCB 2QLJB 1RWKB 2XYHB 4ZVSB 1BMQB
chains in the Genus database with same CATH superfamily
4CDIA 2QYCA 5T7LA 1MW7A 1S1XA 1QAJA 2HZCA 4IQXA 2VG7A 1FRLA 4I6AA 5KFSA 3M8PA 3V6KA 2M2BA 4G1QB 2AGQA 4OI4A 4KFBA 2C28A 3QAEA 4DQQA 3HKZD 3BKTA 3R5CA 2ZWPA 3FMBA 2HNDA 2ROGA 2W4DA 1I6JA 1R0BG 2FHJA 4ZPTR 4O44B 4RLEA 2BQUA 2NSBA 4QR0A 3JQMA 1LWEA 2XC9A 3AAWB 2YH1A 2YBVA 2E9ZA 1SPBP 3AY0A 2DNLA 3QJLA 2F8MA 4P10A 2V2VA 4QYZJ 3CT9A 3OTDA 1BHNA 3SCKE 2EPIA 1Q5VA 1IKYA 3CDUA 2GVDB 2GQCA 1CQNA 1J27A 4Y00A 3DKDA 4ECXA 4TLQA 4AE5A 3UR0A 3QRPA 4OHVA 2EKNA 2WB1D 3VR1A 4LT6A 2MXYA 2KT3A 4DV6F 4J37A 1OQ6A 5EX3A 1RACB 5CYMB 4DUYF 2ILYA 3PW2A 3MMAB 3OQ2A 1GFWB 4J9RA 4LF4F 1S1TB 1PYOB 3K89A 1PG5B 2LEPA 8AT1B 6AT1B 4RX6A 2M0GB 2LXFA 1TK5A 4K4WA 3OVAA 3RRGA 2QG9B 1AZSB 3DDKA 1MN9A 4LIRA 3B6BA 1FFGB 2JFKA 3CCRS 3PM9A 3ZC4A 4JI1J 3UPFA 3TARA 3DM2A 3NGTA 1N34F 1SIZA 3L7PA 2DIUA 4WTOB 2OPPB 2QSWA 1N48A 3LO3A 3UNYA 1NHUA 3ZZTA 1MWQA 3V5RA 1AA1B 3LGMA 1T9VA 4OHXA 2ZITA 1N4LA 4P6QA 3ZZRA 4LSNB 2GIQA 4FNIA 3CCES 2IC3B 3GG0A 4R25A 2Z58B 3L7OA 1B4SA 1XIQA 3IM9A 5HN0A 2OPRB 1YBTA 3N0VA 4QWCA 2EG1A 5L1IA 2GA7A 2C2NA 4DX6A 1TL1A 3R9LA 4KKOB 3NNAA 2VBWA 3TQEA 1U1OA 2IBOA 1NJYA 4IUFA 2OEKA 3IR5B 2M3DA 4X4TA 3BH6B 1OSDA 1N33F 2MQOA 3GV8B 3DLHA 4ECSA 4OYIA 2MKCA 5HQLA 1VQSA 2B51A 2C42A 1UVMA 2FHOB 3IRWP 1WOPA 1C0TA 2RDDA 5FDLB 3VGVA 3I87A 4O0NA 1I94J 1BQMA 3KLHB 2XB2D 4U95A 3DMJA 4DV4F 3VAHA 4DR6J 4DUZJ 2ZFHA 3ZO7A 2HLTA 3KTQA 1X4BA 2JNJA 3W62A 1JJCB 3CGIA 4W98A 2V8GA 3QWUA 1IKVA 4RU2A 1QSYA 3I0RA 3OTOF 4NYZA 1UVIA 1TP7A 3SV3A 4DPTA 2UU9F 4LSLB 4PWWA 3W9IA 3TUJC 2PC6A 4Z2XA 4YR3A 2JX2A 2HPUA 4B02A 1X5PA 5L9NA 4LVOP 1N52B 3A1YG 2HQCA 1T05B 1RTJA 2P9CA 2CNOB 2V8DA 4RL1A 3ITHB 3W66A 1FDAA 3MPYA 3M8ZA 2U1AA 2MKIA 1FVQA 2IJRA 3G6YA 4YEAA 5ETLA 3SSSA 2RT3A 1A0OB 1RABB 1U0HA 4DCPB 4KHMA 2B8QA 1HNWF 1P9QC 2JRSA 3HFKA 1RWUA 2YWGA 2X3GA 4JB8B 3L3CA 3H5UA 4WE1A 4GVBB 4IFVB 2AW0A 1MWZA 3W5YA 2XLKA 5ETMA 1NH7A 1WC4A 3B54A 2EK1A 2NXJA 1VBKA 4KGZB 1Y5LB 2NYIA 1RA6A 3QQCD 4HHJA 3RB3A 3NEKA 4IH5A 1Z1ZA 4B9MA 2KDOA 1OO0B 3HP6A 5C24B 4F3OA 3RW6A 3FQLA 2M7SA 3MTJA 3NAIA 5C25A 2C3OA 1MG7A 2ATCB 4Q2MA 1UJ6A 3VZHA 3WIVA 3MXHP 1NO8A 3A8EA 2HNZA 3HF5A 3DU5A 2HVIA 2QYGA 3GCWP 2CDQA 4L74A 1Q4RA 3NLCA 2BR0A 1SKUB 1O8BA 1U09A 3EZOA 3G2XA 4IO9Q 5KG7A 2B6AB 4M5DB 1KVKA 3RYLA 3GB0A 3J81j 5A8RB 1ZTWA 1WNEA 5HLFA 1HBUB 2XLJA 2CQ0A 2BV3A 3T1YF 4YR0A 1TV6A 1X9MA 3NMAA 1RAOA 1XC9A 3KLVA 4HH1A 3KLFA 4LF5J 1DZ5A 4TLRA 4A47A 1EAYC 4YP3A 2ZHOA 1AFJA 1N56A 2P2CB 4RUCA 3JSMA 2YQ1A 1S0MA 2GVZA 3MM8B 2DIVA 4DL0C 2HHXA 2XBPA 1VISA 3PYDA 2VC1A 2VA2A 3DLGB 4PXDA 1X8DA 4TY8A 3I4HX 1KS2A 4LF2A 4RNOA 4HEA9 3D6MB 1DLOB 2E5LJ 4D3HA 4A48A 3D0GE 3DOKB 3CF5Q 5FJ4A 2X1AA 3M8QB 5I4MA 3TUPA 1VC5A 1JLAB 3HD1A 3VWSA 2XY6A 3OL7A 1F1BB 1NRKA 4CQ1A 3J7ZT 2H9ZA 1RT3A 4OI1A 2KH9A 2W4CA 3KHGA 2VG6B 3C3LA 3FCHA 3CJTA 2DK2A 5AXLA 5BR8J 3D67A 2ZDOA 3NOGA 2ADBA 3AA9A 4GO5X 5J2MA 1G4CA 1FT8A 1Z2LA 4TN2A 1F3VA 2O5DA 5F3TA 3QO9A 2ZH2A 3UNGC 4RR5A 2HSEB 2KHDA 3P5TL 2W7PA 3AHPA 3V81B 1T9UA 4FS2A 4B3MJ 3HFZB 4WBFA 4URGA 2KG0A 4K4ZA 1X5SA 1M5OC 2Q6BA 4PQUA 2CPHA 4X66F 1DTQA 4DV1F 1HD0A 3PW0A 1ZM4A 2DHXA 3SCJE 2VQFJ 3NWRA 2Q66A 3DXSX 1YSJA 2E9TA 2LQ5A 4HTIA 2MHNA 8RUCA 3H2UB 5HVGA 2GX8A 4V1Ak 5KFXA 2DGSA 3R6GB 5ETNA 3CSKA 4Q0BB 2KYXA 2MHEA 4PABA 5J1EB 3R2DJ 2DRAA 4PWDB 4CLWA 1PC4A 1B3TA 1HBOA 2AZ1A 4FVCA 5IWAF 2DHGA 2JH3A 4UZBA 3V4MA 3W7BA 4ED3A 3MEGA 1GNKA 1U8SA 1C0UB 2YNGB 2L08A 1LOUA 3IRXB 4O3RA 4F4ZA 4YMEA 2CPEA 3BKUA 1LK7A 2ASYA 1QUPA 5L8RC 3QT8A 4ITSA 3CJ0A 5KT4A 4IG0A 4PEOA 1GTHA 2DVIA 1OY6A 1PYTA 2QLJB 3U1NA 4OI2A 2OD6A 3R7NB 2R4FA 4ANEA 4EU0A 4P52A 4WKRA 1IQTA 4YOEA 3G8TA 1V9OA 2UXDJ 2CG4A 3HPOA 1WHXA 1F9HA 3BGUA 4YDXA 1Q7YT 3GJTB 1WKLA 2ZE2A 1VQ4S 2VU5A 3IR7B 2GQQA 2PEBA 4JI4F 2IIHA 3N4WA 4G1PA 3PFEA 2VH7A 2OEMA 1G3OA 4RNHA 5BJRA 1VC0A 5LMUJ 1R0AB 1FTRA 2HWIA 5AJ3F 4C3LA 2X51A 2HGMA 3FJ2A 5D77A 4A8QA 3C19A 4L76A 2UV8A 3G6ES 4OYXA 2AU0A 4WIIA 5KG2A 2CWXA 3MR3A 3M4XA 3N5BA 2ZBPA 5HVFA 3CC7S 1HBNA 4R8UA 3W2VA 4DQSA 1FO1A 3PW4A 2B9EA 4YR2A 3GMGA 3FRYA 1B7FA 5ETRA 2OKQA 1L5UA 4F0HA 1FJGF 2X1GA 3OTEA 4DL3A 1WSVA 1GMUA 4ZVRB 4A8OA 5AE2A 1TKTA 5D3GB 1PIEA 3EICA 1VQKS 1NSKL 2HQGA 5B09A 2W7OA 2OFGX 1N0VC 1WF1A 2NREA 2NSCA 4DDFA 4FN5A 1IXKA 5DQGA 2VIHA 3G96A 1RT2B 3QJPA 1ITPA 5A6WA 2XMWA 3LWLA 3KHHA 4N7TA 3BV8A 1HWLA 3D4JA 1SJFA 5T7LB 4NL5A 4AL6A 4LFAF 1KHVA 2JOQA 1LWXA 2MZJA 4OYWA 3ZZPA 2VG7B 2DH7A 2NUUG 4M63A 2Z2YB 2N7CA 3M8PB 2JLGA 1S4EA 4CO4A 3QZ7A 4K8RA 3M2VA 2G0IA 1RHJB 3I0SA 5K8OA 3IG1A 2HQFA 1Q8LA 2KB2A 2HNDB 3P96A 4LRAA 1HARA 2VICA 1N6QA 5L39A 3HHLC 2HWTA 1KQSR 3X1LB 2X1BA 2DGWA 3POTA 1U1PA 1X4DA 4OZJA 4LFCJ 4F2SA 4I6YA 4DLEA 2RMLA 3GJSB 4YB6A 4RNNA 3NCRA 4ZN3A 1TAQA 2G2ZA 1KC8T 1DQAA 4CTAA 1S49A 3C6TB 1LV5A 2BJEA 3JTNA 4ID8A 3KHLA 2LECA 2WSCC 2IAJA 2JEIA 2R3VA 2YKMA 3K5LA 1M1HA 4X62J 4PXCA 1FD2A 1RI7A 4OI3A 3L95X 1IBKF 4I4BA 2OTJS 1U1QA 1S6QA 4EZ9A 3EVOA 2VFRA 1S48A 2JEGA 1QE1A 3C16B 3KLGA 4Y28C 3RRKA 2AX0A 2V34A 2BRLA 2GJ2A 2H5JB 5ETPA 2ZH7A 3PO4A 1H72C 3VQSA 1NEEA 3GE9A 3DN9A 5LXYA 2GQ2A 3DRYA 2HHUA 2OFHX 2WAQD 2VA3A 1YGYA 3DM2B 2HBRB 3UD3P 4LVNP 1FESA 4DWIA 4QWDA 2PN6A 3SEOA 4WFXA 2WVDA 2A10A 3CTRA 4A8YA 5DETA 1B99A 5L1JA 2HHQA 3AD7C 4HTJA 4KTQA 4PAAA 3HX9A 2B9YA 4WXWA 3GYNA 1E6YA 1SIWB 2XMTA 1CJVA 1HBMA 3PHEA 5I3QA 3L4BC 5D4PA 3EVWA 1RTDB 2MZTA 4C4WA 2WONA 4ZLLA 1DY3A 1PJ5A 1TVRA 3ICLA 4XPCA 1H2UX 2ZH3A 1S1VA 3BSCA 3FGVA 2V68A 2AZ3A 2RKIA 3Q8YA 1TL1B 2J0SD 5L1KA 5A2QU 1KRPA 2C3UA 1U1KA 1D9FA 3UDEA 2RRAA 3MAAA 3IS9A 3GFXA 1XNRF 3JTPA 5KFKA 4WP9A 3HHLA 2D9OA 4YHHF 2ZD1A 2BJ9A 3MCNA 1H2TZ 3OT9A 3G6VA 4OYBA 1C0TB 4WFNQ 4KHPJ 2JVRA 3TJ9A 4I67A 1HQEA 1BQMB 4LR9A 3DCAA 1Z2ZA 3R5AA 4NCBA 3BO3A 1YBUA 5DLFA 3DMJB 4DPXA 1KBRA 1F9FA 1NK8A 1YWXA 3E8OA 2CQ4A 1HNVB 4AUKA 2CDRB 1IKVB 1SH0A 3I0RB 3P4UB 2XGQA 3BREA 1NJZA 4YY3F 2HZVA 4IRKA 3R7BB 3DLEA 1VYAA 3D3BJ 4K2XA 4F0MA 1YLXA 2DXDA 5GMKa 1T0TV 3TA0A 4JI6J 4MT1A 5HSPA 3F41A 1RTJB 2D3UA 5AXNA 4DSIA 2DCUB 3I5AA 5KFEA 1NMEB 3DYAA 3T5JA 1KWMA 1S72S 4FBTA 2ROPA 3B78A 4IFYB 1U0HB 3W60A 2RRBA 3G86A 3NG8A 4AYBD 4KHRA 4N47A 1WOSA 3I9ZA 2VFUA 1IQZA 2G1DA 3KK1A 1DFDA 2VV5A 3TX8A 2BRKA 3M32A 4DV3F 5IM0A 1M0SA 4NA2A 4FKXA 1ZAXA 4DX7A 3HJVA 5F0UA 4PYAA 4C9DA 1XK8A 5DZ6A 5CHCB 5BXIA 5DG9A 2W24A 3V4IA 3MMJA 2AF6A 4B9SA 3TAQA 1R8CA 3HDSA 3MUTP 3MECA 2V2ZA 2MKSA 2DB1A 3LTOA 4WXOA 3O6QA 2Z56B 2DNNA 5HATA 5F8LA 5GMEA 3TUZC 2DISA 4QPXA 3OD2A 2KZMA 4X4PA 3CVKA 2KI2A 4QOTA 3BR9A 4JI1F 2XEXA 1FJEB 2RILA 5HLFB 4WYLA 4DR3F 3QNWB 1LW0A 3TOQA 1MMNA 2BJ8A 1TV6B 2WVBA 4FP9A 4C8MA 2SXLA 1CULA 3IGVA 2HHVA 1W26A 3VALA 4B3OA 3JXOA 3F73A 1U1MA 5KFZA 2XS7A 1YRTA 3LP0A 3AODA 2E5IA 4PXEA 4OYPA 2KT5A 4ZIVA 2N82B 2RB7A 5KOWA 1T9XA 3JSMB 4XDDA 2M5YA 4OJ1A 3K5PA 3H2LA 2XHCA 1KTQA 2J9DA 2N3OA 2MQMA 3T1HJ 1KD1T 3MR7A 2KM8C 5C2CA 2CA9A 1MU2A 1S59A 1XMQJ 3R3TA 2E44A 4TY8B 1HR0F 2BKNA 2XTJP 4DPYA 1WTBA 2F7VA 2J9DE 1RT7A 1YJ9S 5HL7Q 5KT7A 2XM3A 4ZP6A 4CO0A 1NSAA 4BC9A 3HLUA 1R6VA 3M6VA 4ZLNA 4DR1J 4QJVA 1PO6A 3WC2A 1WACA 1I94F 2PGCA 2WBMA 3PKMA 2DGVA 4IDKA 1YG0A 4EBEA 4DR6F 1RT3B 4QW8A 1S6OA 5KFWA 5ETTA 1RHKB 4C7QA 2HAIA 1GQEA 2XS5A 1XR6A 4KBIA 1TR0A 4C0HA 4C11A 4MKVA 3EX7B 5J2MB 1CC8A 1RWWB 4F36A 1CJUA 5IS2A 3SDEA 3EGZA 3QO9B 2XMAA 1RTZA 2MZRA 3FEYB 1WG1A 2PFDA 4OZ5A 1RCXB 3MMCA 1O6XA 4GKKJ 3TJ8A 4ZJOA 3MOZA 4CO5A 4O3NA 1DTQB 4ILRA 3GIKA 3PIOQ 3CW2C 4DR7F 5LOQA 1FKOA 4TQRA 3X3UA 4MKYA 3T6JA 2WW8A 1J5EF 2M88A 3H5XA 4WTYA 2YPYA 2W7AA 4JI3F 4BDPA 3H98A 5SUHA 2IM2A 4K5RA 3NGRA 2CNLB 1TKZA 5KT5A 2AYBA 5HVHA 5JUMA 3OR1A 3CJKA 3LW5C 4RO0A 4MK9A 1HBOB 4ED7A 2YTCA 3PX4A 6FDRA 1Q16B 1DQ8A 4N8NA 1R8PA 4WFZA 4XPEA 1KNZA 3RR8A 2YNIA 3QZ8A 2ZNYA 3LP2A 1BGXT 1S79A 5KFQA 3HMJG 3IC1A 4IR9A 5J2NA 4IG0B 1QAXA 2FQQB 1V3ZA 3BSAA 4DR4J 5D0EA 2MMYA 3D66A 1FE0A 2D9PA 2ZOMA 2AJ2A 4C8LA 4CLYA 1D0EA 2BACA 1YQHA 4DV5J 4CO1A 4J7CA 1XNQJ 4X2BA 2JZ5A 3VV2B 4Y6IA 4IH7A 5ETQA 1L3KA 2V5HG 5BYRA 2LCWA 1IJEB 2ZE2B 2HFSA 4A8XA 4ZVSB 1NM2A 1K0VA 1X4AA 3R1LA 1QVFR 2PI5A 1QSSA 2LU2A 3BGOP 2XCPA 4P2XA 2ATLA 4HDGA 4O3PA 4LF5F 2A3JA 2R7XA 1FXRA 4DV6J 3A8KA 3QGIA 3ENAA 1ZM9A 5KT2A 2O66A 2VFTA 4JBCA 4DR2F 3LUYA 1WEYA 1VBXA 4DUYJ 3HZEA 2A6MA 1ROFA 3EGVA 3CWJA 1LNQA 3OHAA 3MM6A 5KFRA 1HBNB 4R8UB 2FGCA 3LGNA 1BXNA 1TZ0A 1WC0A 4LF4J 2O67A 4TU8A 4F04B 2YX1A 4QWEA 1UA1A 1RBAA 4LRCA 4V19X 1R7IA 4LRFA 1TTHB 3FBBA 2NCKL 3K57A 1UA0A 4FF3A 1RAAB 3P5BP 4WPAA 1CG2A 3NGUA 2OEJA 1OPZA 2ZUAA 5LJ3Y 2BKPA 1TKTB 3NMRA 4RBTA 3C14A 2VL1A 3M2RB 3QSYB 5KT6A 4O3OA 1N34J 4ZVFA 1BC6A 5HP1B 4ES1A 4DU7A 3VCDA 1I1GA 2OMLA 3OL9A 2MLXA 4ZVPB 5IOLA 4IRCA 2DEIA 3OXLA 2EFGA 4UT4A 3FSYA 1QVGR 3KLIB 5F8JA 1HPZA 4JYAF 4QIVA 1FJ7A 2Z57B 4QWAA 2LQBA 3D1QA 2EG2A 3DHWC 2E66A 3TVKA 3T6BA 5BR8F 5ETOA 1AXQA 1EETA 2MKJA 4CZCA 3HKWA 1FKPA 2HFUA 2V6AA 2NZ4A 3M2VB 1OYDA 1B0PA 2W2OP 1M5VC 1S76D 2AGOA 5E33A 4CM0A 2QX0A 2QTWA 1N33J 2GHPA 4NLYA 3DLBA 4M95A 1WD6A 3RAMA 4X4UA 2AJ1A 4C6AA 1NPPA 3CD7A 3UDVA 4NI2B 1KONA 2VQFF 1JMTA 4DS5A 2XSFA 2DNOA 4NRUA 2VD3A 3VAFA 4B3RF 1BY9A 3M1VA 1F3FA 4NLOA 3EGNA 4ER8A 3P49B 2DYAA 4DV4J 5JXSA 3G8QA 1ZOTA 2G9OA 2VKRA 2FC9A 2KJWA 2BZ2A 2UUWA 3CJSA 2HBZB 4NLVA 4ZVHA 3OTOJ 2QV6A 2YKMB 1KEKA 3KNGA 2K7JA 2UU9J 3IXQA 1JK9B 4BHQA 4C0BA 4ECTA 5DGAA 3W5ZA 1SJ1A 3W61A 1WI8A 3A3OB 4LQ3A 4LF9F 4MKAA 1QE1B 2BJ7A 3ILIA 4RU9A 2FLLA 4NYOA 3T9ZA 3KLGB 3VAGA 4F02A 1RQ0A 4ICLA 3ISND 4WYWA 2DNYA 1IM6A 1Q8IA 3F0NA 4Q7AA 2KKHA 1RTIA 2QA4G 1YJWS 4O44A 3DC2A 3OSPA 3S7RA 1YKWA 3MM7A 4H4KC 4AXJA 3OXGA 5ETKA 1K73T 4I68A 1FWLA 4F4KA 5DLGA 1RKIA 3EWGA 4P9SA 3MPDA 1V3SA 2HBQB 4DZ6A 3LGHA 4EYIB 4BC7A 3KXDA 5D78A 2B4VA 3MI7X 1RA7A 3PJ9A 4ZA1A 3G87A 1XR7A 5IT4A 1PCAA 4IR1A 1E6YB 4F4YA 1U4BA 3PCOB 4NXMF 1HBMB 2NLWA 3KNAA 1S12A 4DFMA 2XMKA 1VK8A 2IMWP 4ZN1A 2WONB 2V9WA 5IZHA 3Q83A 5AXMA 3OPKA 5CYQA 1JLFA 3TVYA 4DPOA 5IT9Y 4LIWA 2R7OA 2RKIB 3U1LA 1SKSA 4DS4A 2J6SA 2VODA 2Q79A 1VIXA 2BANB 2Z8QA 1PAUB 2YWFA 1JJ4A 4DSEA 2QSFA 2AP6A 4CLTA 3C46A 5LSLA 2CNKB 2LQ8A 3MAAB 3IS9B 2GCFA 3NCQA 3OTBA 3HHLB 2UUCF 3FK4A 1X5TA 4PXBA 2DR8A 3J7YU 2ZD1B 4F3QA 3DXBA 2OPPA 3T1YJ 2B7BB 3U02A 2AEFA 3KKFA 2XI2A 2DD8S 1FNMA 2AT1B 3M8WA 4J9KA 5IV3A 4KT0C 2HS3A 4HYKA 4LSNA 1LW2B 4A8SA 4JOUA 3OVBA 2IC3A 1NXIA 4QIEA 4Q43A 2ZC3A 3BYRA 3KG0A 3Q0AA 3A3NB 3DLEB 3TP2A 2MQPA 3L7UA 2DPIA 3TEGA 1P1TA 2DT9A 4Y2MA 3IM8A 4I2QB 4ELUA 5EHHA 3QMQA 2FYXA 4DL6A 3Q8PB 2B5JB 3DYAB 4J9VA 3EDRB 3MMBA 4KIAA 4CH0S 3MURP 3W3SA 2LXIA 2Y1LB 4H4KA 3UN5A 5HJYA 4B08A 2QGFB 4LFCF 1C2PA 4DZDA 1RZMA 3KK1B 4OFZA 4OYMA 3M32B 1ZH5A 2FUG9 5IM0B 3TA1A 2Q6CA 3UVJA 4MK7A 2NYHA 3FCWA 5D0HA 1OS5A 2DXEA 4DL4A 4WFYA 1IBCB 1V3RA 5KFLA 1VQ5S 4NLWA 1BQXA 2F1FA 1MWYA 2MY7A 4LSLA 2I1RA 2XHWA 1OSCA 5CD4A 3MR6A 5EGYA 5K5MA 1RWXB 5U47A 3M6UA 3V4IB 1T05A 5DZ7A 5HANA 1IR0A 4LBIA 1NDCA 3MECB 4OX7A 4OIXA 5H9FJ 2FLOA 3K58A 2V9KA 2YKQA 4LQ9A 2R7VA 4DL7A 2ZJRQ 5B7WA 4LRBA 3QT6A 5IT0A 4X66J 1AB8A 3OFGA 2R2SA 3SV4A 5HAOA 1BE4A 2VBXA 4B3TJ 3GV5B 1HIYA 4DFPA 3T3FA 4GVBA 1JX4A 4ES3A 1FJCA 2ZH8A 3A8IA 4Y0FA 2MZ1A 5F8NA 4DX5A 1J5OA 2CQGA 1KOHA 2RQMA 3Q8VA 3IWLA 4C3MA 2LFVA 3DGVA 5E3RA 2DNZA 2BMBA 1VR6A 4B3OB 5C24A 2NXEA 1N54B 5KFAA 4MH8A 4F8RA 1TFYA 3LP0B 4ZPWR 5GMDA 1WHVA 1ZTTA 1N5VA 3HD2A 2UUBJ 4ZVEA 1CJTA 1KFSA 1FDNA 2FJWA 4QIGA 1F5CA 4ECRA 4RW8A 3PRDA 4WF9Q 4RBUA 2CJXB 2DR6A 4TKTA 1B0VA 2N4CA 1S97A 3QJJA 4U7UD 1XMBA 2J6TA 1L3UA 4J9LA 2CPZA 4K4VA 3BN4A 1H7WA 1JJ2R 2YVSA 1MU2B 1RADB 1D8YA 2IVMA 8ATCB 4QPTA 3PW5A 3KJVA 2IMOA 1W25A 3R5BA 2BYCA 2BEFA 2KU7A 1S10A 2FD2A 2B6AA 1Q1KA 1OQ3A 1RT7B 2Y0SD 4M5DA 1K9MT 2D41A 5LL6d 1SH3A 3A8JA 3VAKA 4RW4B 3K0JA 4F7VA 3I6PA 2KL8A 3ZTQA 1VJQA 3CCQS 4O4RA 4NWBA 2KXNB 3TAMA 1ICEB 1TU0B 2XWXA 2KFYA 2C22A 4K4XA 4ECWA 3I9V9 2EFOA 1R31A 3R5GA 4G3IA 2Y9HA 4ZCMA 2Z30B 4C11B 2WSEC 4WKYA 1N88A 2QEXS 1EZZB 4CNZA 1CJUB 3O1LA 1IKWA 4K7QA 3TNVA 4JI6F 2CQHA 3PNIA 2R9LA 2M8DB 1QTNB 2LDIA 1NLKL 3WZ0A 1FJGJ 2E1RA 2AJQA 1GT8A 3MMCB 3DLGA 1XERA 3JTOA 1GAOA 4HDHA 1RU1A 4ZOSA 3W5XA 1RCOB 2JDJA 4DLGA 4CLLA 5DM7Q 2ZOGA 5DS7A 3ZZOA 2VBYA 1KOOA 4LFBJ 2LA6A 3MEEA 1DLOA 2BE2B 1FKOB 1SI9A 1KHWA 3KLEA 4K4YA 4L6V3 3M8QA 5LXRA 1EARA 3PG9A 1UZHA 3CCTA 3J80U 1WOOA 2V4RA 4DI6A 2CKWA 2XMVA 3ZTSA 1NSPA 3OW2R 3PYGA 4AFFA 5F0WA 1TKZB 2CPJA 1N5TA 3IBCB 5KTQA 1EP4A 1CSJA 3CJKB 2MSTA 4AT1B 2Y8YA 1M5HA 5IQ6A 3CIMA 4A8FA 3C15B 1K1QA 2VUGA 1F6TA 3NS6A 3CJ5A 2GAGC 3M7VA 2MQQA 2WW4A 1K0TA 3G9CA 2YNIB 1VQPS 2YKAA 3LP2B 4ZHRB 5E5NA 3CJRA 2K3KA 1D09B 5J2NB 1RISA 1UETA 2BQ3A 3WX8A 3V81A 2V4JA 2QT7A 3RBZA 2HK3A 3ULHA 3DRXA 4C8OA 3HCXA 3JSRA 1WC5A 1EQ0A 4EEYA 2BE7D 2WVCA 2P8IA 5HJXA 4AD6A 2XNRA 1SH2A 2LDYA 1YK9A 2RF2A 1VI7A 3D3CJ 1GK8A 2W01A 4I69A 4G6VB 1Y0HA 4Q0BA 2X7IA 1HI8A 3QGGA 2FZCB 2ROEA 2L9WA 2F4FA 4GC7A 1OMSA 3TYTA 1SXLA 3AT1B 2H48B 4F2RA 3KK2A 4ZMMA 4J9MA 2HEKA 3LH2S 3N9UC 3ILOA 4RBVA 4TYBA 3NL0A 5DDPC 3QRRA 1D1UA 4BWMA 2E1MC 2WOMB 2XY7A 3OR2A 2MZSA 1LWCA 3WIUA 3KJFB 2GGPA 4OLOA 3T1HF 2M70A 4DXLA 3MR2A 2YWEA 1H6KX 2ADCA 1IN0A 3TZYA 1HQ2A 2EFNA 3Q2SC 2MPUA 1YBAA 4WZQA 2NPIA 2DNGA 2YQ0A 3MAHA 2XZDB 2RS2A 4DR1F 2VG5A 5CD4H 3W63A 4Q8FA 4NEZA 2CPXA 2UZAA 2M8HA 1U25A 2IM1A 2XGPA 1HPZB 4DSJA 3EPIA 1Q81T 3NS5A 2R2TA 2HWHA 4WCEQ 1EETB 2A18A 2H65B 3C6UA 3QWPA 4CRJA 2JL9A 5M2RA 1CPZA 2RVJA 1FKPB 4XDCA 4Q44A 3DRPB 3PY8A 3K17A 5HBMA 1VIOA 2OHDA 4MYTA 4V19J 1HWUA 4OYAA 2D1CA 3VGTA 2IRXA 2DNPA 1ZYQA 4XTTA 3KDNA 1WC6A 1XNRJ 2YWKA 4P2FA 4EFAC 1Y3JA 1OY8A 2LEBA 3QT7A 2PI4A 1KN6A 2OPSA 1URRA 2I6WA 4USUA 2VDIA 3M1VB 4J90A 2ZM6F 4DQIA 4KE5A 2QJ3A 4B9UA 1I51B 5HMXA 1WTFA 1RT2A 1PKUA 2QL5B 3OHBA 3BS9A 3PHTA 2E1PA 2IM3A 3V6DB 4YY3J 1RWOB 4ZCLA 2PMHA 1UW4A 2V8VA 3CD5A 4H4MA 4PG5A 3P45B 1WF2A 1XQIA 2H5IB 3LALA 2DPJA 3R6LB 5A2QY 2HRUA 2E5GA 2Y3YA 4OX6A 2DRBA 9RUBA 1RT1A 3CJQA 1LXNA 4ICLB 4YB5A 1SL0A 1JLBB 4NASA 2KN4A 4DR4F 3BBBA 1XTZA 4TYAA 3GZ7A 1RTIB 2FIUA 1DJ0A 3MM7B 4DV5F 2ZDPA 1XR5A 1SC3B 3M30A 5KFHA 1XNQF 3K2YA 2JHEA 2B56A 3KUGA 1GX6A 3GYXB 2FJXA 3R2CJ 4J9SA 2ZH5A 3GSIA 1UVLA 3SCLE 4Y2KA 2R8JA 4OZLA 1QM9A 1SCJB 4LBPA 4DV3J 1WEXA 1ZZFA 2W9BA 4MTPA 3C6TA 4ILMA 2YXLA 2LXUA 1HKAA 4X4RA 3ISNC 1CBKA 1HHTP 4DV2J 3QSIA 1S5ZA 5H9EJ 5B0DA 1Q82T 2I38A 1UAWA 2R8GA 4OZ2A 3VAIA 3C16A 1YX2A 4UY8T 3MCSA 1JXLA 3GCXP 5CYQB 1JLFB 1UPMB 2JJ4D 4RUHA 2HG4A 2C2EA 3EDQB 5E3AA 2C2KB 3W2WA 5RUBA 1G6BA 3KUHA 3QFHA 2UVWA 1TQLA 2DO4A 1RHMB 3M8SA 2Z0GA 3FSIA 4C8NA 4ZKAA 1R89A 4ZVUB 1NJXA 1KLNA 1B64A 4OI6A 4DR3J 2IBKA 1VRUA 4DG1A 1CJKB 1HHSA 2XSJA 3KK3A 4EBDA 4QZVB 4WIQA 3T1AA 2OO4A 4HHHA 1IJFB 2AEJA 2KRRA 2R7WA 5DG8A 4QU6A 3Q86A 4XO0A 4JI7J 4OYOA 2RQCA 2BKOA 1PYSB 1RTDA 3J81Y 3RB4A 3AQPA 4IYQA 2GNKA 1L3VA 2BABA 1VC6A 4E8UA 4ID5A 3OUYB 1HNXJ 4ED0A 4K59A 2GC8A 1ZS6A 3PJWA 4Q45A 2R42A 1R6YA 4WP3A 2Z4PA 4AL5A 4EK2A 2APOA 2HBYB 4OJGA 2FB0A 1HR0J 4X65J 3MMBB 4H4OB 5DJBA 1T3NA 3UCZP 3HHKA 5BYQA 2PA8D 3AQOA 1GTEA 2RHSB 1UPPA 2RU3A 5A8KB 2DH8A 4XIUA 1PSDA 3PVXA 4OQJA 3QGHA 2KRBA 4KYZA 3SSQA 1EJ7L 3UVJB 1ZAWA 1HNVA 5ETVA 3THVA 1TL7A 2J7UA 3PX6A 2A6OA 3WC0A 4NXNJ 3MM5B 1VK3A 3FDSA 2L41A 2UVRA 2WBRA 4FF2A 1TMMA 1VRQC 4YUDA 5KG6A 3VAMA 2Q3PA 4WFBQ 4UZCA 3GR1A 3CIZA 3QIPA 2AHOB 1O0PA 4KGXB 2HQIA 1HNIA 2NQPA 4Y2IA 3D54A 2FVQA 4XK8C 2WHOA 2QMWA 2W8KA 5IT9U 4IFYA 1NU4A 5IFMA 1YVFA 3PZPA 4OX9F 5HO4A 3HZGA 4ZLJA 4DR7J 2CJAA 5LT5A 3NAHA 3H20A 4OYZA 2W9CA 5ITHA 1J5EJ 4PG8A 3BGLA 3M9NB 4JI3J 2XYGB 1YI2S 1X4HA 4LR8A 5DQIA 2JWNA 3W65A 1J5OB 2V67A 1KVJA 2CNNB 3FRZA 4BWJA 3H8YA 4Z7YA 1MROA 4OX8A 2OJ3A 4O0IA 1Q7LB 4Y2CA 4UUXA 1WJ9A 4NLRA 4TU9A 2K8GA 2FPHX 5HMZA 3KMSA 4G65A 4FDFA 1CJTB 4RPFA 3SFUA 4RW8B 3UO0A 4NLQA 2QLWA 7FD1A 2GV1A 3ETOA 2DNQA 1RUSA 4PQAA 2D3ZA 3K59A 4DUTA 4ZJLA 3KJVB 4UOFA 2GIFA 3O2IA 4B17A 2OP5A 4R0JA 3HXMA 2QN6B 3IAM9 2V8PA 4ED5A 2DNKA 1TKXA 4DL5A 3K5NA 2XWYA 2XNQA 1KKHA 2NXUA 3H59A 2XG8A 2BW7A 2ABYA 2MJUA 4JI5F 3E01A 3UE2A 4DSLA 3ILJA 5B0GA 5C7PA 4NPOA 3TAMB 1JLGA 2NXCA 1RE1B 1ZBTA 3M2UB 4DR2J 3H4BA 1DTTB 3BDPA 4USKA 4M5IA 2J76E 5CYJA 4AL7A 4ELVA 1UWAA 3FFIB 3QIDA 2AYMA 1IKWB 1AUDA 2AX1A 2FVSA 1IR1A 2I0XA 5EN1A 1FRHA 5KFMA 3PKYA 3A3PB 4QCLA 1RBLA 2WK4A 1NBEB 2XLIA 3N6NA 2EKYA 3D1HA 1N5YA 3MEEB 1NK6A 3KLEB 1APSA 5F8GA 2PFFB 4KSEB 1X4FA 4OJ3A 4WK3A 2CQIA 3H25A 4J9QA 3W64A 2EEYA 1EP4B 4BBYA 1YTYA 4JYAJ 4FS1A 2FJDB 4DJBA 3R5DA 1BLUA 2R2UA 5B08A 2DXFA 5B0CA 4MAKA 1U6FA 1X5OA 2FJAB 2GW8A 3MM9A 3KJNB 4OJHA 2FHKA 4OZ3A 2FVCA 1S0VA 2OSRA 3GQCA 2RUSA 2EXUA 1IVZA 2OELA 1CVJA 3O5TB 2V4JB 3MUMP 3BO2A 1XBWA 2IVFB 3JAMY 4ZPAA 1Q0NA 4NOHA 2ZJQQ 3D2WA 2IY5B 4PG4A 4B3TF 2BJDA 1FHTA 3G4SS 2VZ9A 2RF2B 3GIIA 4B3RJ 3J7YI 4DR5J 4NCAA 2C2OB 1LQ9A 3IA0A 4DU8A 1UWBA 4R5PA 3PR5B 2FTRA 1C4AA 4CYUA 3KK2B 4IKAA 2CQBA 3GJQB 5E3QA 3LOUA 3HVTA 3MEKA 4NEYA 3D6FB 2OD4A 1NK5A 5KFBA 2ZZTA 1QD1A 3D7SB 2CJQA 2VB6A 4LF9J 1D8ZA 2UUBF 2ZH6A 3GWCA 3ZTOA 3OR2B 2ZJPQ 2Y1JA 3Q8QB 1LWCB 3U27A 1L3TA 2XMMA 1SVDA 4FYVB 4TQSA 2GGPB 2HFZA 1HYSA 2GJIA 3JQJA 4LRDA 4MYUA 1NDLA 2UV8G 2IHR1 2LP4A 4FPIA 1IKXA 2C3MA 2VFVA 4HH0A 4DPWA 1RJJA 4LF6F 4M1KA 1WF0A 4W92B 4EYHB 1UMJA 3TZWA 2VG5B 2H5EA 3MPVA 2DR7A 3ZZ0A 2UXCF 1D3WA 1OPIA 3HSZA 1Y3KA 1SQEA 2PMWA 2V63A 4JI0J 3GILA 1FXDA 5L38A 1RAJA 4NXMJ 1YZ7A 2FJEB 1VQNS 2RD5C 3DI6A 3VGSA 2CUYA 2M4MA 1PC5A 2X3DA 2RDJA 3BF4A 2QFJA 3C6UB 1J2VA 2DGXA 2JEFA 2JC1A 1IR2A 1WUUA 2AQ4A 2KG1A 4Y34A 2GJFA 3MGJA 5HBMB 2ALZA 1HQUB 5KFJA 4DQRA 2DRDA 5KAKA 1QLNA 2HHSA 3ADAC 2HHWA 1N5SA 1UVJA 5M2UA 5GAGI 1CS4B 3D9BA 3M2RA 2UUCJ 1RYSA 5KG4A 4JI2J 4LFBF 2OPSB 3NWGA 5HP1A 3G6XA 1F5AA 4YDDB 2JFDA 3RR7A 2KXFA 3B8HA 2CXEA 4Y2AA 3EZUA 2KTQA 3KLIA 2MB0B 9ATCB 3SMZA 2MGZA 2K7KA 1HW9A 5F9LA 1JNRB 3CDAA 4O4GA 5DDOC 3V6JA 4H4MB 2VKZG 3FC9A 2IA0A 4C97A 2HK2A 4DMZA 3CXCR 1S7IA 1RT1B 4U8YA 4W4MA 3CMAS 5B0FA 3OV7A 1IWAA 4C98A 1FVSA 2PO4A 2CAJA 2DY9A 3I5BA 2O1PA 3GYGA 4CT8A 4HACA 2LMIA 1FX4A 2XO7A 4I56A 4A46A 3NRBA 3K8VA 5K8MA 1DURA 3Q24A 3M30B 1BWVA 3DLKA 1HA1A 2HNYB 4NI2A 4PWUA 3PXGa 2R7RA 2CG8A 3M9OB 2HLUA 3BGFA 3MFIA 5IV4A 2KO1A 4ED6A 3WQPA 3W9HA 4Y65A 2XULA 3PRVA 1WI6A 2IJFA 2D69A 2W9BB 2ACMA 1F60B 1S6PB 2DGUA 1WEZA 3KFWX 5KT3A 3IGNA 1ZPWX 3FUYA 3RBEA 2ASLA 2F63A 1PBAA 1G2EA 4ECZA 5DDQC 2C1EB 5KFOA 1FXLA 4JI8J 1R3NA 3VTIA 2LKZA 3T5LA 2HS0A 1MN7A 1U2FA 4RW7A 4RWXA 2ZWOA 2H4YB 4HHUA 1AROP 2H4WB 3TRGA 2BXJA 1N5QA 3D6HB 4CWBA 5C5JA 2JC0A 4USIA 2IRYA 1T3OA 4NRTA 3W2WB 1X31C 4C8YA 3I5CA 2B7CB 3GFZA 4RWWA 3CCLS 1RLDA 3OL6A 2K06A 1XMOF 2Z2MA 2HHTA 4PG6A 1YIJS 1V5IB 1ACMB 1DARA 2ZC4A 2CQ2A 1T11A 4HI1A 4I7FA 2DKOB 2J7WA 3T5KA 1O5JA 1VRUB 4BS2A 3RGIA 3AB4B 4LR7A 3T19A 2V50A 3M6XA 2NXNA 4DG1B 3BQ0A 2XSJB 2B0GA 3RW7A 3KK3B 2GHVC 3OJUA 2UVUA 3TI0A 3BEGB 2RS8A 4ELTA 2Q43A 2WCXA 5C42A 3K5OA 1RAFB 1JLEB 4M5HA 3VQTA 1U2CA 3FSXA 2W4PA 2F9DA 1N36F 1AUSL 4DEZA 1YJNS 1R0CB 1VGYA 2P9GA 4ID5B 2VPYB 3R7SB 4C3KA 2E5HA 3H4DA 1UFWA 4KV8B 2BANA 2E7WA 2EFPA 4ZDNA 5CXTA 3H0PA 4XAKA 1RT4B 2KXHA 1CQMA 1RP5A 2B4OA 3Q8UA 1TK8A 4EMDA 3PTWA 4ERDA 3EXYA 5LM7E 4IOBA 4ZCKA 1T95A 1U6ZA 3S1TA 2ZVSA 3F44A 2LLZA 3NNCA 5GAEU 2J8AA 1JLQA 3ZXWA 5L1LA 1FF2A 2COLA 1S0NA 4I2PA 1M1KT 2UUTA 4QYZK 4L3KA 3NOCA 1LW2A 1TL7B 3CC2S 5GAHI 2CZVC 4DSFA 4PYDA 3PACA 1VS3A 1V6HA 5G0RB 3BR8A 2DGQA 3N79A 3OLBA 3S8SA 2BE9B 3OVSA 4I2QA 5KG5A 3QIPB 5A0YA 5H9EK 1HNIB 3GLJA 5LMNF 4E0DA 4F50A 2H51B 2ZH1A 2B5JA 4MIAA 4QR1A 1A6LA 1JJHA 3PO5A 1T9YA 3MPUB 3EPGA 2R7SA 3W1YC 2J8SA 4AQYJ 1RWNB 1RAIB 1ELOA 5IC4B 4WK1A 5T14A 2QLBB 4DHVA 4Q8EA 4P7TA 1Q95G 4P75A 3JYTA 3CDEA 3KUEA 2W9CB 3DOMA 4YS2A 1RAHB 3IFEA 5THWA 2HQ3A 4ILLA 2GO9A 2Y8WA 3W9JA 1VFJA 2EVZA 3VF0B 5ADZA 4NA3A 4UOCA 1H3DA 1REGX 4K5SA 4CI0B 1MROB 1WG5A 2BUNA 4PZVA 1Q5YA 4O3QA 1KVIA 2Z2ZA 1NDKA 3TEHB 1LEOA 3OJSA 4DV2F 3UFCX 3HT0A 4LMZA 2JSXA 5BYSA 3HSGA 1TUGB 4FZVA 2CVEA 1D9AA 2CVIA 1EQMA 3TJAA 1FNXH 1YJVA 3J81U 4Z37A 5E0OA 4M5KA 4UTGA 2HAFA 4FVMA 1TUVA 4MFBA 3ENVA 3P8BB 3FVYA 3J80Y 4W90B 1UFLA 2H1YA 3LAKA 1FA0A 3GR0A 4CLSA 2GMHA 2WB4A 1TKXB 3PYFA 3EYZA 2IYGA 4DSKA 5GADU 1JNZB 2HVEA 2YQ3A 3TUIC 2FJBB 2YWWA 4HR2A 1WSRA 5L46A 2M52A 2YNHA 3D5MA 3CCJS 3IR6B 3MPWA 2DNRA 3E01B 2QRRA 2QL7B 1JLGB 3BYPA 1FFWB 4KJIA 3GV7B 1VDHA 2YX7A 4JI7F 2MKYA 3M8RA 1NJIT 2F9JA 1S4FA 4O3SA 3RAQA 4NCGA 5EWEA 2OPQA 1SUQB 2OGUA 3MHYA 3K8WA 2FLPA 1U26A 1HNXF 2RQ4A 1UW9A 1M5PC 2DHHA 1F5BA 3AOAA 3BJYA 3CMES 1VHIA 5AE1A 1ZA2B 2B9XA 4A8KA 4NZ6A 4X65F 3OFHA 2VHGA 4KB7A 4LBHA 1NK7A 4EWTA 1HNZF 3UCGA 1G7CB 1VBZA 1B70B 4FXWA 1N5YB 5KFCA 4QU7A 4RKUC 4ZCIA 2EFQA 2LEAA 2E7VA 3W8PA 4RW4A 3DGPA 3AFGA 2KVIA 3A13A 5E2QA 5E3PA 4OZ0A 4TXSA 4DF8A 3R97A 4IG3A 3H5SA 4NXNF 2O01C 1SB6A 3CEDA 2HQDA 2DBBA 1X4CA 4CT9A 2VONA 2RAQA 5FLXU 3CO9A 3MM9B 3PEHA 1AFIA 3BQ2A 5MAOA 3M9MB 2KVQE 3FKBA 1YJTA 1ZA1B 1ZM3A 4OLPA 3BN7A 3AJDA 1JKHA 1FI4A 4QW9A 2I5JA 3LF0A 3CJ8A 5HI7A 2F3JA 5KFIA 3GPAA 4GRSA 2BE2A 4CLUA 2UP1A 2BM0A 1X0FA 2D3O1 3OLAA 3GIJA 2WTFA 2A0FB 2YPZA 5E3CA 1RHQB 1HWIA 2ZM6J 4M8LA 2ALYB 2LQJA 3E3XA 1PBUA 2G0CA 4X64F 3W8GA 1UWBB 5B0BA 4R5PB 1UEUA 3VVUA 3EZ5A 4CYUB 3E51A 3C15A 3PFOA 3HVTB 1Q78A 1HLWA 1ZZNA 4NX9A 5J1NA 5I42B 3SSRA 4JV5F 2W8LA 2HGNA 2DHAA 3CJ2A 1VJWA 1NAQA 4ZHRA 1SKRA 2AIRB 2CZ4A 3B82A 2V0NA 3SXLA 5D4NA 5D6GA 1HYSB 3VAJA 4IOCQ 2B43A 2HVDA 4C0OC 1I3OB 1Q53A 3AJ1A 3RB6A 3EJMA 1R8AA 3SIPB 1T03A 4DOZA 1KSPA 1IKXB 2CPFA 3NBPB 4QWBA 4OHYA 3EM1A 2ZNZA 2DJWA 1F2HA 2AJFE 5EX0A 1FDBA 2I8EA 2F5GA 2MSSA 1FCAA 1P6TA 4FF4A 3S01A 2FJVA 1T94A 2HURA 3PYEA 4WU3A 2P9EA 1HMVA 3DI6B 2ZBCA 4KRWA 1U6BA 2CIMA 2GS8A 1XEZA 1LWFB 2HMIA 5CH7B 2WOMA 3WBZA 1S9GA 4DV7J 4F4XA 5DO2A 4KR0B 4ZVQB 3QLHA 4RW9A 3TR5A 5KFDA 2F4VF 3AXKA 2N7YA 2HIQA 1VBYA 2VPWB 3M8YA 1NHKL 2E29A 1S7HA 1H73A 2NR0A 1ZM2A 3JAMU 5HROB 3S6EA 3BZQA 1VQ8S 4YFUA 5IQQA 1NPKA 4IQMA 2XQCA 1MSWD 2HVZA 3THPA 2AMCB 3HO1A 3UDCA 1RWMB 3ENQA 1UFKA 4MJKA 5LSOA 2MGZB 4EUVA 4ED8A 4O4GB 5I3UA 2D3OR 2XMJA 4ZPDA 3DDIA 2DY1A 2W2MP 1Y00A 2XYPB 3C8YA 2UXBF 5D4OA 2XS2A 2QIFA 3JS9A 3DRPA 4CLFA 4LF8F 3QGPA 4A8MP 2VOOA 4B3SJ 3DLJA 1E6VA 2RSQA 2MQNA 1UJ4A 1UJ5A 1RB0A 4CCHA 2R8IA 4HACB 2JEJA 1SJ3P 4GMKA 4P73A 1U1LA 1T02A 3THTA 2L9DA 4DFJA 2FLNA 3PJXA 3DLKB 4JV1A 2XMUA 4NMLA 1WKJA 2CQDA 3TZXA 3GG1A 5EDWA 3BSOA 2CPDA 3TAPA 2YH0A 3NCPA 4DR5F 4P72A 1HL6A 2BVZA 2DNMA 2J0WA 1OIAA 4U8VA 3LWMA 1XJWB 3AD8C 1H38A 2MTLA 3D6TB 2L48A 3BPDA 3V6DA 2HZAA 1RTHB 4CP5A 4DV0J 1Z4UA 1RBOB 2DCLA 2VJVA 2HGLA 1EX8A 1UTAA 4UF4A 4N56A 2HW3A 5IC6B 4RW7B 3BO4A 3H42A 2C2ZB 1NSQA 4K0KF 1VQYA 1QUVA 5KFNA 4QIFA 3BGRA 1YITS 3I56S 1JLBA 1PGZA 2C3YA 2UUAF 3ILLA 2A2CA 2VQEF 2QLFB 5JMNA 2HHHF 3CCZA 5DQHA 3IN5A 4OX9J 4F25A 3DOLB 1GMWD 4WZMA 2KHCA 2QO3A 2VC0A 3D28A 3T5HA 2HFNA 4TVAB 3IWNC 1QAIA 3MWBA 4I7FB 2E1AA 3OSNA 1S9EB 2CJBA 4KQZA 4DCOB 1KLMA 4KGKA 1OJ4A 2LVWA 3EMTA 3EGWB 3GJRB 2HYIB 3CJ3A 3ZNJ1 3ETMA 2X1FA 1H7XA 4GKJF 2QZ8A 3CDWA 1N0UA 1SC4B 3BKFA 3H90A 2HS4A 4NLXA 4HT5A 4NLSA 1HI1A 1FTCA 4H54A 1FRXA 4QQBA 4JI0F 4UOGA 3GIRA 4NLTA 5C42B 3N6MA 1U1RA 1JLCB 4HL9A 2AWZA 3Q8RB 4JV2A 4P71A 3VVTA 3CNQP 1S1XB 4C8ZA 1TUWA 4JUZA 1X9SA 3HVRA 1ZETA 3DRSA 5E41A 4ED4A 2ASDA 1FRJA 5A6PA 1IUJA 3HVAA 4KFBB 3L9ZA 2VJUA 3AOCA 4BLGA 3TVZA 4JP8A 1Q86T 1RGVA 1DAXA 2BOPA 2A2DA 1K47A 4DBQA 1LWEB 4FYDA 5I3PA 3SFGA 1FKAF 1LXJA 7FDRA 3BPSP 4JI2F 1JWWA 3NKYA 4I1TA 1JLQB 3G8SA 1VQOS 1CJKA 1IKYB 4I2PB 4JI5J 1XWLA 1TAUA 2Y1RI 4FYXB 4LF1A 2W2NP 2PA3A 4U96A 1S77D 4K4TA 1YJRA 4B9VA 4ZLPA 3KG4A 4ED2A 2RIJA 4Y3CA 2IPOB 2EC0A 2BW2A 3OUYA 2M9KA 4HVZA 4B9LA 2WVEA 4ANDA 1RHRB 4GVLA 5A0YB 3KMQA 1R8HA 3I4PA 1IWGA 4QIWD 5K8NA 3ZTPA 2AYEA 1Y7PA 4ENOA 3UN3A 1IBLJ 4ZP7A 3KOAA 4OMFG 1P27B 3WHIA 1HFEL 3VGUA 2GZOA 4QR2A 3NGDA 3IAS9 4H4OA 3B4DA 4CO3A 1N32J 1T7PA 5A8WA 2FC8A 3RUBL 5A8KA 3JYTB 2P6TA 3FQKA 4PUOA 3DOMB 4RUBA 2P5VA 2FVPA 3CCUS 4FBUA 3VZIA 1AW0A 4RNFA 1U2RA 4E2FB 3EE3A 3TANA 1S99A 2ZKTA 4UUWA 5J2QA 4N5SA 3TWZA 3FZBA 3MM5A 3R5JB 3O8WA 1X4EA 2QFIA 4UY85 3CD0A 1S1WA 1RAGB 1UL3A 4M5NA 2CPYA 3GIMA 2IRUA 4JI8F 2JLEA 4AXIA 3C2PA 3BDEA 2ZUGA 2GHWA 2EFVA 1T9TA 2XYHB 2XI3A 1FEEA 2HIYA 3G71S 2R7QA 1U49A 4TNOA 1Y5NB 1EKRA 5KFPA 5F9NA 4G1IA 1NZAA 1A7GE 4ZVGA 2VASA 2VOPA 1X60A 3HVWA 4MFBB 1VLOA 1FX2A 2ZKUA 1RT5A 1PAEX 1EIYB 1RT6A 4KPCA 1O51A 3RB0A 2OMOA 3N01A 5HMYA 2DR9A 3MOJB 5K9FA 1SL2A 4CNYA 2YNHB 5KFYA 4USMA 1WELA 2WVFA 2A1BA 3SQGA 1UVKA 2YKNA 1NKCA 3U1MA 1U02A 2DGOA 4MK8A 5K14A 3NXZA 4HT7A 2F65A 4USVA 2PT0A 1BQNA 4F3MA 5JJBA 4NCGB 2OPQB 2ZH9A 2FZGB 3ZNUA 4FXDA 1EB0A 1QSLA 4M5JA 1BMQB 2LU1A 3LP1A 4ETXA 3MEDA 4KGVB 3LANA 1B0TA 2EK6A 2ZZMA 5D0RA 3TX0A 1NCLA 4WWSA 4UW2A 1NKEA 2VPZB 3KG1A 4ETZA 1REVA 2K2PA 4LF6J 1VRTA 1PJ6A 1G1XA 1SJQA 5AXKA 4WE1B 1FK9A 3HHEA 2UXCJ 4ANCA 3R27A 3DGPB 4DN9A 5ETSA 5KG3A 3MF5A 3MUVP 4DF4A 4IG3B 1M5SA 3E2EA 4FYWB 3M2UA 1DTTA 2LYVA 4PR6A 3C66A 1FE4A 3CCSS 3QYYA 3CE8A 4ALZA 5C25B 3FFIA 4OHZA 3NP5A 5CA5A 1SQGA 3SI8A 2G0JA 1OWXA 3ET6A 4K50A 3SZ2A 3ZZYA 2OAUA 2HNZB 1XN9A 5CZVA 5M2PA 1EKSA 1JKHB 3ENWA 3B4MA 2W2PP 4AQYF 2PE8A 2J9EA 2EW9A 4UQTA 3RG6A 2I5JB 2G13A 4QBUA 2AKWB 6FD1A 2AGPA 2CADA 1NK4A 4J9OA 2HHPA 3CUNA 3QAUA 2I2YA 1RLCL 2EWHA 4X4QA 1VQ7S 2R8KA 2B4PA 5A76A 1TK0A 1HWJA 1ZAVA 2IDLA 5KFFA 2MQLA 4HLBA 3KLFB 2OTLS 1S9FA 3UCUP 1URNA 1YHQS 2RH3A 4ZPBA 3ZZZA 3PW7A 2B3TB 4PKDB 2FHMA 2ZBIA 1NKBA 1X7VA 5JVGQ 2BM1A 2GVZB 4U7CA 3OL8A 5K8PA 3PRBA 2VFSA 4BCAA 1FD8A 3BQ1A 1R8BA 4K2JA 2CJKA 1YJUA 2ILZA 4PCQA 2OI2A 2BDPA 5CZXA 1T8EA 1FERA 1T03B 4ZITA 2K3IA 4A8WA 3LA0A 2B8PA 4F26A 3TZZA 1P8GA 3LAMA 4RW6A 5EWGA 3UQSA 5LSRA 3BBFA 3LQVA 5GAEI 1AT1B 3SQOP 4X4NA 3BB5A 1FWKA 4NLPA 3M05A 1YRXA 4EO6A 4DUZF 1IBMJ 3FBCA 4WFAQ 5KG1A 3US5A 3DHXA 3MZIA 4YQWA 1T9WA 2C2MB 1HMVB 3EVMA 5CAAA 2YY3A 3HJFA 4M5GA 2RNEA 4FNHA 4FYYB 3PIPQ 2LA4A 2O3DA 2HMIB 5L9XA 1NK9A 2LQ9A 2FDNA 4IRDA 1UEKA 2L9NA 3RBXA 1S9GB 5SZTA 5D8HB 2R8HA 4EBCA 4KO0A 2F40A 3QLHB 4RW9B 1RKJA 4MKBA 2ZBRA 1UZDA 2DH9A 1XMOJ 1H74A 4LF7J 4PQUB 1NZ8A 3J7Z5 5HQMA 3T9NA 2MKKA 4CLKA 1YJ7A 3FNNA 2P6SA 2AYGA 1UP1A 3MD3A 3FCVA 2RRNA 2ZZNA 1GXUA 4B9TA 2J0QD 3CO0P 3LPEA 1W7WA 5FD1A 2DO0A 2R7UA 5IXUA 3NNHA 3N6LA 2E9RX 5J2PA 2C3PA 5K20B 2ZH4A 4M94A 2PEHA 1MMDA 1GEHA 3JSYA 5DM6Q 4OZ1A 2CPIA 5KG0A 5I3UB 1N36J 3MEGB 2RU9A 3HULA 2Z2LA 3UW1A 1DQ9A 1MMLA 4FF1A 1RYRA 1JXEA 3TW0A 4KH1B 4HI2A 4URSA 3CCMS 2D7SA 1NK0A 1HQUA 1SJRA 4DFKA 1E6VB 1Y4ZB 1C1CA 2W1BA 2WSFC 1KQFB 5HMWA 4CLPA 1CS4A 2GIRA 2W2QP 5KFTA 2HFVA 3NGKA 1K1SA 1KTVA 3FEZA 3I32A 2FHJD 4OL8A 4L75A 4U9RA 4UQGA 1R43A 4L3NA 5GADI 4RNMA 3OXFA 1RXOB 2IJNA 3DNCA 2YNFA 1FRKA 2KJVA 4DCJB 3CPWR 3F56A 3UR3C 3VHQA 2DR5A 3NS7B 5KFVA 4TY9A 2IA6A 1W2IA 2GMJA 3H5YA 1U0SA 1QJHA 1SV5A 3G82A 3W2VB 3D1OA 5LMNJ 1VQ6S 4FPRA 4J9UE 3BGRB 3CCWA 2CQCA 4UOHA 3WX4A 5DG7A 1S1UA 2EBEA 2ZEJA 2L3MA 5KOXA 2G2OA 2QMXA 1RWKB 2HNYA 1FFSB 2QMUB 2DHSA 2GMLA 3EXCX 2V4QA 3O44A 1KLMB 2E5LF 1TL3A 3N5FA 4C48A 2EC2A 2E7XA 3GP9A 1S6PA 4USHA 2FVRA 4K4UA 2QA4S 2BOAA 4URQU 3L09A 3UWTA 4F0KA 3CCVS 3GFHA 4EZ6A 5AT1B 1VOMA 4N41A 1WDTA 3V2UC 1FEHA 1PILA 2J6UA 2CJYB 4WP8A 1U7LA 2HRYA 5F3ZA 4EO8A 3DRSB 2IYIA 2VPXB 4OI0A 3PEJA 3CB4A 3CMQA 4DV7F 2N4DA 2F8EX 3I0SB 1VHFA 1P1LA 3MCOA 3ZZUA 2PMZD 3IG1B 4B3MF 2G2YA 3IP0A 4LREA 4CO2A 1N6QB 4E98A 4JV0A 2MLZA 4USTA 1RU2A 1VQMS 2E5JA 4OV1A 3POTB 2D74B 4Q5VA 2DEJA 2V69A 2U2FA 3Q89A 4WJBA 3QT5A 1F2GA 4FXVA 1NJWA 1HHQA 3PDNA 2DITA 1C1BA 4DN0A 3PV8A 5KFUA 3FZ2A 1RSCA 1HW8A 2K1RA 4CTAB 3DRRA 1WHWA 3K5MA 1B7YB 2RE1A 1CLFA 3RRHA 1OYEA 2JVOA 5LJ5Y 2PIIA 4RZRA 1JLEA 1VMBA 2IAJB 5H1SV 1DRZA 1GXTA 2Y1IA 2NPFA 2MYFA 2QA1A 4YB1P 3A12A 3BH7B 1S6QB 3H40A 1K44A 4G1QA 4ECVA 3SCIE 2ZBQA 4F4WA 3BBCA 4KV8A 3TA2A 4B3SF 1U47A 4NMXA 4C2MA 2R7TA 1ULRA 1RT4A 4CIOA 3LPYA 2YX4A 1HNZJ 4NA1A 1HNWJ 5B0EA 5A8WB 3HT3A 2UXDF 3N28A 4MIWA 3RAXA 2J5AA 1VQLS 4PUOB 3D0HE 1KP6A 2BJ1A 2GVDA 1BWEA 1NH8A 1OY9A 3IBWA 4CM2A 4YB7A 5LMUF 2RQKA 3KJQB 5J2QB 1HWKA 4M5LA 1F0XA 5G0RA 1CJVB 1GXLA 4DV0F 4ZS6A 1S1WB 3RJMB 2XO6A 5CYMA 3IBFB 3OFFA 5HK4A 1TVRB 2HRTA 3MMAA 4NZ7A 1Y9OA 1BD6A 1S1TA 2IVYA 1S1VB 4LUBA 4DPUA 3MAQA 1GMWA 1MLAA 4J9NA 1W2BR 1QTMA 4NLUA 4N76A 2XCAA 1DBDA 1S57A 1AZSA 1RT5B 1P9YA 1LKZA 4YN3B 2WZ1A 1RT6B 4LJMA 5DDRC 2J9CA 4ZJQA 2J7KA 1HQEB 2MQ8A 3GFYA 5DRKA 2ZHBA 1FRIA 3OTCA 4X64J 1VLYA 3UD5A 2OH2A 3SQGB 1LFPA 2CJ9A 2VBZA 5FLXY 4NLDA 2YKNB 3ONQA 4F4AA 3CULA 1HI0P 2FY8A 4B9NA 1A9NB 5K14B 1LK5A 2I9SA 3AD9C 1WDDA 4JV5J 4RJVA 2XZWA 1KFDA 1BQNB 1FRMA 1WC1A 4ZVOB 2AJ4A 1FWPA 2NS1B 4DX8H 2OPRA 4ZIWA 2N3LA 3I55S 2QLXA 3FBEA 1JIHA 4OV6A 4P74A 3IMQJ 4KC5A 3KYLA 5AE3A 1JQGA 3LP1B 1S6UA 4KKOA 3RU0A 2QA2A 5JVHQ 3I31A 3P3DA 3MEDB 2QC3A 1KR4A 1RHUB 3QBCA 3QATA 4GO7X 3KHRA 5G4DA 4J9PA 1I5OB 1REVB 1VRTB 4Z7CA 1GX5A 1NB2A 1LFWA 1UCNA 5FDLA 1FK9B 3KLHA 1CEZA 1CC7A 3QFWA 3FEXB 1WWHA 3SYZA 4HKQA 1Y11A 3U7JA 1YZ6A 2XY5A 4KAIA 1BUXA 3GSDA 2OUGA 2V2QA 2CQPA 4X62F 1WORA 1SC6A 3GTYX 3BSNA 3UDLA 3HHDA 1SUQA 1WKKA 3Q8SB 3P6YC 3MCMA 4S0MA 3ET6B 4ZP8A 4KH0B 4ES2A 2Q1LA 3ITHA 1QDUB 1U48A 5GAGU 1X9WA 2QE5A 1NNDA 2F4VJ 1IBLF 5H9FK 1NUEA 4DV1J 2CWKA 4CLZA 1U8WA 4I6WA 5FIIA 1N32F 1UKUA 2KFZA 2WRMA 4J91A 3HHNB 3HK2A 3JB9k 1TELA 3Q23A 4WU2A 1WHYA 1N8RT 2DTJA 4IFVA 2V2KA 1LW0B 2MY8A 5MLCV 3DLLQ 3PR4A 3DU6A 2CQ3A 5EWFA 1UVNA 2HFOA 1CULB 1KQKA 1QAYA 4IH6A 2QL9B 2XZTB 3SBMA 5IWAJ 3RZAA 4A4JA 3FBFA 4X4OA 1F9EB 2ERRA 3V6HA 1JB0C 4X4SA 2B9WA 2BBEA 2Y0BB 2UXBJ 2CFXA 1MNEA 4ECYA 3MFHA 1TL4A 4LF8J 2RHQB 4ZK7M 2BA9A 3MR5A 5KFGA 2IFXA 3NY0A 1KDNA 1NHVA 1VCTA 3AOBA 4F67A 2YKOA 4NYPA 1RK8A 2C2RA 2OLWA 1FDDA 4I64A 2H3EB 2IM0A 3MTKA 4MMOA 5A8RA 3H7HB 4X4VA 1WG4A 1HBUA 4RW6B 1S0OA 1SKWA 3JSBA 4KHPF 4JI4J 4X84A 3OFEA 2HVHA 4Q2LA 1KQGB 1SC1B 2PD1A 5CCMA 2MEWA 5D15A 1H98A 4IDKB 5AJ3J 4IO1A 1NDPA 1YRUA 3BM7A 3QRQA 4DL2A 3AB2B 3AA8A 4DQPA 3WDOA 5I42A 4GC6A 1AYEA 3I82A 1TKDA 4ZVTB 5F8HA 2V8HA 5HQ8A 1RDRA 4K0KJ 1X0PA 3MM8A 2IDEA 3SDEB 3ZTRA 3QPIA 4RUAA 4N77A 1Y10A 1L3SA 2UUAJ 4KO0B 3ZFVA 3ELHA 2RUGA 2CYYA 4USJC 2VQEJ 1SL1A 2HHHJ 1M1GA 1Q8BA 1JXVA 1FNOA 2RJZA 2W25A 2JLFA 2BJ3A 1QY7A 3HSJA 2C2DA 3I96A 5CABA 3R8YA 2F8HA 3Q2TC 3NBPA 2FZKB 3MD1A 2AV5A 1Y5IB 4ZP9A 1X4GA 3DOKA 2RDIA 5B0AA 5E7OB 3AJ2A 1JLAA 4GKJJ 4OHWA 1VQ9S 4TU7A 2ACYA 2ZOFA 2G1HA 3CJ4A 3UD4P 1Q79A 5J2PB 2EI5A 2AEMA 2YKPA 3J7A1 3OR1B 2VG6A 2V94A 2BQRA 4P2MA 3CD6S 3M6WA 5EUHA 2G4BA 1U24A 2KYZA 5D4LA 4LFAJ 2FY1A 4D3GA 4O23A 2J0XA 1LWFA 3OBIA 4NZ0A 1SQFA 2E1CA 4USWA 4EGLA 2KT2A 3AXMA 1R27B 1C1CB 4LSZB 3UI3A 5CQGA 2H54B 1UEVA 1NPRA 5C2GA 4M5MA 4KGMA 2KM8B 3CC4S 2BX6A 5F8MA 3RTVA 4I0WA 2MZQA 4PPZA 3D0IE 1PJ7A 3Q22A 2FGOA 5HROA 2VDHA 1M90T 2DNHA 4MIBA 3TQ1A 4EI2A 1M5KC 3CDBA 2MLYA 3DFEA 5J1EA 4N8OA 4PWDA 5GAHU 2YNFB 4U7UK 2POKA 1SBRA 4IOAQ 2MJNA 3JQKA 3UN2A 2ASJA 4P7VA 4PG7A 4ATNA 1ZPVA 4KPYA 2NUHA 1C4CA 2B4UA 1C0UA 2YNGA 1IBKJ 3IRXA 1YDLA 3MM6B 4NE9C 1SV5B 3G82B 2W9AA 1RWVB 1V5VA 2KFNA 4PPDA 3ISZA 2KZZA 3HSDA 1RAEB 3AH6A 3HM9A 4L73A 1TFWA 7AT1B 3R1HA 4U67Q 4ZPVR 5GVQA 2CRLA 1S1UB 3D68A 3HFVA 1XMQF 2OIHA 4U6PA 1GMVA 2HKEA 3KWMA 3C14B 3PX0A 2AJ0A 3EUNA 2UVVA 1WC3A 3FMWA 4J5OA 1TL5A 4KY3A 1TL3B 1U45A 2PSZA 1R0AA 2ZVIA 4QYRA 3NGSA 1TMJA 2EBGA 1IM4A 2GFFA 2NZCA 1H2VZ 1IBMF 1EHWA 1HD1A 4OZNA 1RTHA 3GONA 3J7AN 1DHMA 1U1NA 3T41A 4R0EA 2PDAA 4ECUA 2MDAA 4CH1A 4ED1A 1K8AT 2ZHAA 5J1PA 1H0HB 5D0GA 3RBDA 3O3LA 1NB7A 3IO1A 4ECQA 1D9DA 3H2VE 4P2SA 4ZPCA 3TO8A 2R2RA 3A4TA 2CZ9A 2MKHA 1SJ4P 3IWXA 2AD9A 2CQ1A 4GKKF 3KDOA 5F8IA 2GAHC 2GO8A 3DOLA 2DGTA 4LF7F 5D3GA 5DGBA 5CCLA 4YHHJ 3GU0A 2YWHA 1RWPB 1S9EA 4FKYA 1GH8A 3DDNA 2VF3A 4C8KA 1Q8KA 1C1BB 3HHLD 2K1RB 3K7RA 4PRFA 3MDFA 3DRRB 2OSQA 5T41A 5F41A 4K4SA 4CH7A 1JLCA 4L72B 4NLGA 3HI9A
chains in the Genus database with same CATH topology
3R7NB 2HBYB 1RHRB 2QL7B 2C2KB 3EDQB 4ZVPB 2HBZB 3QNWB 5IC6B 2XYPB 2C2ZB 4ZVRB 1RHMB 2QL9B 2XZTB 2CNLB 2CNOB 2HBRB 3KJFB 1RWXB 1GFWB 1QTNB 2C2OB 1SC3B 1PYOB 1F9EB 4ZVUB 2CJXB 1RHKB 4ZVTB 3GJSB 3KJQB 2QLFB 1RWVB 4ZVQB 2Y0BB 2XYGB 3GJTB 3D6MB 2C1EB 4DCPB 4DCJB 2CDRB 3GJQB 2CNNB 3R7SB 5K20B 4ZVOB 3RJMB 3P4UB 3EDRB 1RE1B 4JB8B 1PAUB 1I3OB 1RWWB 2XZDB 3IBFB 3D6FB 2H4YB 3R6GB 3R7BB 4LSZB 3SIPB 2H4WB 2H54B 2H51B 4DCOB 3NS7B 3GJRB 2FQQB 2CJYB 3D6HB 2Y1LB 2C2MB 2CNKB 1I51B 1QDUB 1RWNB 2QL5B 1RWPB 1SC4B 5IC4B 3KJNB 2QLBB 3R5JB 1RHUB 1RWOB 2HBQB 2H48B 3IBCB 1NMEB 1RHQB 3P45B 1ICEB 2H5IB 1RWMB 3R6LB 1RHJB 2DKOB 2P2CB 2H5JB 2H65B 1SC1B 1IBCB 2QLJB 1RWKB 2XYHB 4ZVSB 1BMQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7N B;  2HBY B;  1RHR B;  2QL7 B;  2C2K B;  3EDQ B;  4ZVP B;  2HBZ B;  3QNW B;  5IC6 B;  2XYP B;  2C2Z B;  4ZVR B;  1RHM B;  2QL9 B;  2XZT B;  2CNL B;  2CNO B;  2HBR B;  3KJF B;  1RWX B;  1GFW B;  1QTN B;  2C2O B;  1SC3 B;  1PYO B;  1F9E B;  4ZVU B;  2CJX B;  1RHK B;  4ZVT B;  3GJS B;  3KJQ B;  2QLF B;  1RWV B;  4ZVQ B;  2Y0B B;  2XYG B;  3GJT B;  3D6M B;  2C1E B;  4DCP B;  4DCJ B;  2CDR B;  3GJQ B;  2CNN B;  3R7S B;  5K20 B;  4ZVO B;  3RJM B;  3P4U B;  3EDR B;  1RE1 B;  4JB8 B;  1PAU B;  1I3O B;  1RWW B;  2XZD B;  3IBF B;  3D6F B;  2H4Y B;  3R6G B;  3R7B B;  4LSZ B;  3SIP B;  2H4W B;  2H54 B;  2H51 B;  4DCO B;  3NS7 B;  3GJR B;  2FQQ B;  2CJY B;  3D6H B;  2Y1L B;  2C2M B;  2CNK B;  1I51 B;  1QDU B;  1RWN B;  2QL5 B;  1RWP B;  1SC4 B;  5IC4 B;  3KJN B;  2QLB B;  3R5J B;  1RHU B;  1RWO B;  2HBQ B;  2H48 B;  3IBC B;  1NME B;  1RHQ B;  3P45 B;  1ICE B;  2H5I B;  1RWM B;  3R6L B;  1RHJ B;  2DKO B;  2P2C B;  2H5J B;  2H65 B;  1SC1 B;  1IBC B;  2QLJ B;  1RWK B;  2XYH B;  4ZVS B;  1BMQ B; 
#chains in the Genus database with same CATH topology
 4CDI A;  2QYC A;  5T7L A;  1MW7 A;  1S1X A;  1QAJ A;  2HZC A;  4IQX A;  2VG7 A;  1FRL A;  4I6A A;  5KFS A;  3M8P A;  3V6K A;  2M2B A;  4G1Q B;  2AGQ A;  4OI4 A;  4KFB A;  2C28 A;  3QAE A;  4DQQ A;  3HKZ D;  3BKT A;  3R5C A;  2ZWP A;  3FMB A;  2HND A;  2ROG A;  2W4D A;  1I6J A;  1R0B G;  2FHJ A;  4ZPT R;  4O44 B;  4RLE A;  2BQU A;  2NSB A;  4QR0 A;  3JQM A;  1LWE A;  2XC9 A;  3AAW B;  2YH1 A;  2YBV A;  2E9Z A;  1SPB P;  3AY0 A;  2DNL A;  3QJL A;  2F8M A;  4P10 A;  2V2V A;  4QYZ J;  3CT9 A;  3OTD A;  1BHN A;  3SCK E;  2EPI A;  1Q5V A;  1IKY A;  3CDU A;  2GVD B;  2GQC A;  1CQN A;  1J27 A;  4Y00 A;  3DKD A;  4ECX A;  4TLQ A;  4AE5 A;  3UR0 A;  3QRP A;  4OHV A;  2EKN A;  2WB1 D;  3VR1 A;  4LT6 A;  2MXY A;  2KT3 A;  4DV6 F;  4J37 A;  1OQ6 A;  5EX3 A;  1RAC B;  5CYM B;  4DUY F;  2ILY A;  3PW2 A;  3MMA B;  3OQ2 A;  1GFW B;  4J9R A;  4LF4 F;  1S1T B;  1PYO B;  3K89 A;  1PG5 B;  2LEP A;  8AT1 B;  6AT1 B;  4RX6 A;  2M0G B;  2LXF A;  1TK5 A;  4K4W A;  3OVA A;  3RRG A;  2QG9 B;  1AZS B;  3DDK A;  1MN9 A;  4LIR A;  3B6B A;  1FFG B;  2JFK A;  3CCR S;  3PM9 A;  3ZC4 A;  4JI1 J;  3UPF A;  3TAR A;  3DM2 A;  3NGT A;  1N34 F;  1SIZ A;  3L7P A;  2DIU A;  4WTO B;  2OPP B;  2QSW A;  1N48 A;  3LO3 A;  3UNY A;  1NHU A;  3ZZT A;  1MWQ A;  3V5R A;  1AA1 B;  3LGM A;  1T9V A;  4OHX A;  2ZIT A;  1N4L A;  4P6Q A;  3ZZR A;  4LSN B;  2GIQ A;  4FNI A;  3CCE S;  2IC3 B;  3GG0 A;  4R25 A;  2Z58 B;  3L7O A;  1B4S A;  1XIQ A;  3IM9 A;  5HN0 A;  2OPR B;  1YBT A;  3N0V A;  4QWC A;  2EG1 A;  5L1I A;  2GA7 A;  2C2N A;  4DX6 A;  1TL1 A;  3R9L A;  4KKO B;  3NNA A;  2VBW A;  3TQE A;  1U1O A;  2IBO A;  1NJY A;  4IUF A;  2OEK A;  3IR5 B;  2M3D A;  4X4T A;  3BH6 B;  1OSD A;  1N33 F;  2MQO A;  3GV8 B;  3DLH A;  4ECS A;  4OYI A;  2MKC A;  5HQL A;  1VQS A;  2B51 A;  2C42 A;  1UVM A;  2FHO B;  3IRW P;  1WOP A;  1C0T A;  2RDD A;  5FDL B;  3VGV A;  3I87 A;  4O0N A;  1I94 J;  1BQM A;  3KLH B;  2XB2 D;  4U95 A;  3DMJ A;  4DV4 F;  3VAH A;  4DR6 J;  4DUZ J;  2ZFH A;  3ZO7 A;  2HLT A;  3KTQ A;  1X4B A;  2JNJ A;  3W62 A;  1JJC B;  3CGI A;  4W98 A;  2V8G A;  3QWU A;  1IKV A;  4RU2 A;  1QSY A;  3I0R A;  3OTO F;  4NYZ A;  1UVI A;  1TP7 A;  3SV3 A;  4DPT A;  2UU9 F;  4LSL B;  4PWW A;  3W9I A;  3TUJ C;  2PC6 A;  4Z2X A;  4YR3 A;  2JX2 A;  2HPU A;  4B02 A;  1X5P A;  5L9N A;  4LVO P;  1N52 B;  3A1Y G;  2HQC A;  1T05 B;  1RTJ A;  2P9C A;  2CNO B;  2V8D A;  4RL1 A;  3ITH B;  3W66 A;  1FDA A;  3MPY A;  3M8Z A;  2U1A A;  2MKI A;  1FVQ A;  2IJR A;  3G6Y A;  4YEA A;  5ETL A;  3SSS A;  2RT3 A;  1A0O B;  1RAB B;  1U0H A;  4DCP B;  4KHM A;  2B8Q A;  1HNW F;  1P9Q C;  2JRS A;  3HFK A;  1RWU A;  2YWG A;  2X3G A;  4JB8 B;  3L3C A;  3H5U A;  4WE1 A;  4GVB B;  4IFV B;  2AW0 A;  1MWZ A;  3W5Y A;  2XLK A;  5ETM A;  1NH7 A;  1WC4 A;  3B54 A;  2EK1 A;  2NXJ A;  1VBK A;  4KGZ B;  1Y5L B;  2NYI A;  1RA6 A;  3QQC D;  4HHJ A;  3RB3 A;  3NEK A;  4IH5 A;  1Z1Z A;  4B9M A;  2KDO A;  1OO0 B;  3HP6 A;  5C24 B;  4F3O A;  3RW6 A;  3FQL A;  2M7S A;  3MTJ A;  3NAI A;  5C25 A;  2C3O A;  1MG7 A;  2ATC B;  4Q2M A;  1UJ6 A;  3VZH A;  3WIV A;  3MXH P;  1NO8 A;  3A8E A;  2HNZ A;  3HF5 A;  3DU5 A;  2HVI A;  2QYG A;  3GCW P;  2CDQ A;  4L74 A;  1Q4R A;  3NLC A;  2BR0 A;  1SKU B;  1O8B A;  1U09 A;  3EZO A;  3G2X A;  4IO9 Q;  5KG7 A;  2B6A B;  4M5D B;  1KVK A;  3RYL A;  3GB0 A;  3J81 j;  5A8R B;  1ZTW A;  1WNE A;  5HLF A;  1HBU B;  2XLJ A;  2CQ0 A;  2BV3 A;  3T1Y F;  4YR0 A;  1TV6 A;  1X9M A;  3NMA A;  1RAO A;  1XC9 A;  3KLV A;  4HH1 A;  3KLF A;  4LF5 J;  1DZ5 A;  4TLR A;  4A47 A;  1EAY C;  4YP3 A;  2ZHO A;  1AFJ A;  1N56 A;  2P2C B;  4RUC A;  3JSM A;  2YQ1 A;  1S0M A;  2GVZ A;  3MM8 B;  2DIV A;  4DL0 C;  2HHX A;  2XBP A;  1VIS A;  3PYD A;  2VC1 A;  2VA2 A;  3DLG B;  4PXD A;  1X8D A;  4TY8 A;  3I4H X;  1KS2 A;  4LF2 A;  4RNO A;  4HEA 9;  3D6M B;  1DLO B;  2E5L J;  4D3H A;  4A48 A;  3D0G E;  3DOK B;  3CF5 Q;  5FJ4 A;  2X1A A;  3M8Q B;  5I4M A;  3TUP A;  1VC5 A;  1JLA B;  3HD1 A;  3VWS A;  2XY6 A;  3OL7 A;  1F1B B;  1NRK A;  4CQ1 A;  3J7Z T;  2H9Z A;  1RT3 A;  4OI1 A;  2KH9 A;  2W4C A;  3KHG A;  2VG6 B;  3C3L A;  3FCH A;  3CJT A;  2DK2 A;  5AXL A;  5BR8 J;  3D67 A;  2ZDO A;  3NOG A;  2ADB A;  3AA9 A;  4GO5 X;  5J2M A;  1G4C A;  1FT8 A;  1Z2L A;  4TN2 A;  1F3V A;  2O5D A;  5F3T A;  3QO9 A;  2ZH2 A;  3UNG C;  4RR5 A;  2HSE B;  2KHD A;  3P5T L;  2W7P A;  3AHP A;  3V81 B;  1T9U A;  4FS2 A;  4B3M J;  3HFZ B;  4WBF A;  4URG A;  2KG0 A;  4K4Z A;  1X5S A;  1M5O C;  2Q6B A;  4PQU A;  2CPH A;  4X66 F;  1DTQ A;  4DV1 F;  1HD0 A;  3PW0 A;  1ZM4 A;  2DHX A;  3SCJ E;  2VQF J;  3NWR A;  2Q66 A;  3DXS X;  1YSJ A;  2E9T A;  2LQ5 A;  4HTI A;  2MHN A;  8RUC A;  3H2U B;  5HVG A;  2GX8 A;  4V1A k;  5KFX A;  2DGS A;  3R6G B;  5ETN A;  3CSK A;  4Q0B B;  2KYX A;  2MHE A;  4PAB A;  5J1E B;  3R2D J;  2DRA A;  4PWD B;  4CLW A;  1PC4 A;  1B3T A;  1HBO A;  2AZ1 A;  4FVC A;  5IWA F;  2DHG A;  2JH3 A;  4UZB A;  3V4M A;  3W7B A;  4ED3 A;  3MEG A;  1GNK A;  1U8S A;  1C0U B;  2YNG B;  2L08 A;  1LOU A;  3IRX B;  4O3R A;  4F4Z A;  4YME A;  2CPE A;  3BKU A;  1LK7 A;  2ASY A;  1QUP A;  5L8R C;  3QT8 A;  4ITS A;  3CJ0 A;  5KT4 A;  4IG0 A;  4PEO A;  1GTH A;  2DVI A;  1OY6 A;  1PYT A;  2QLJ B;  3U1N A;  4OI2 A;  2OD6 A;  3R7N B;  2R4F A;  4ANE A;  4EU0 A;  4P52 A;  4WKR A;  1IQT A;  4YOE A;  3G8T A;  1V9O A;  2UXD J;  2CG4 A;  3HPO A;  1WHX A;  1F9H A;  3BGU A;  4YDX A;  1Q7Y T;  3GJT B;  1WKL A;  2ZE2 A;  1VQ4 S;  2VU5 A;  3IR7 B;  2GQQ A;  2PEB A;  4JI4 F;  2IIH A;  3N4W A;  4G1P A;  3PFE A;  2VH7 A;  2OEM A;  1G3O A;  4RNH A;  5BJR A;  1VC0 A;  5LMU J;  1R0A B;  1FTR A;  2HWI A;  5AJ3 F;  4C3L A;  2X51 A;  2HGM A;  3FJ2 A;  5D77 A;  4A8Q A;  3C19 A;  4L76 A;  2UV8 A;  3G6E S;  4OYX A;  2AU0 A;  4WII A;  5KG2 A;  2CWX A;  3MR3 A;  3M4X A;  3N5B A;  2ZBP A;  5HVF A;  3CC7 S;  1HBN A;  4R8U A;  3W2V A;  4DQS A;  1FO1 A;  3PW4 A;  2B9E A;  4YR2 A;  3GMG A;  3FRY A;  1B7F A;  5ETR A;  2OKQ A;  1L5U A;  4F0H A;  1FJG F;  2X1G A;  3OTE A;  4DL3 A;  1WSV A;  1GMU A;  4ZVR B;  4A8O A;  5AE2 A;  1TKT A;  5D3G B;  1PIE A;  3EIC A;  1VQK S;  1NSK L;  2HQG A;  5B09 A;  2W7O A;  2OFG X;  1N0V C;  1WF1 A;  2NRE A;  2NSC A;  4DDF A;  4FN5 A;  1IXK A;  5DQG A;  2VIH A;  3G96 A;  1RT2 B;  3QJP A;  1ITP A;  5A6W A;  2XMW A;  3LWL A;  3KHH A;  4N7T A;  3BV8 A;  1HWL A;  3D4J A;  1SJF A;  5T7L B;  4NL5 A;  4AL6 A;  4LFA F;  1KHV A;  2JOQ A;  1LWX A;  2MZJ A;  4OYW A;  3ZZP A;  2VG7 B;  2DH7 A;  2NUU G;  4M63 A;  2Z2Y B;  2N7C A;  3M8P B;  2JLG A;  1S4E A;  4CO4 A;  3QZ7 A;  4K8R A;  3M2V A;  2G0I A;  1RHJ B;  3I0S A;  5K8O A;  3IG1 A;  2HQF A;  1Q8L A;  2KB2 A;  2HND B;  3P96 A;  4LRA A;  1HAR A;  2VIC A;  1N6Q A;  5L39 A;  3HHL C;  2HWT A;  1KQS R;  3X1L B;  2X1B A;  2DGW A;  3POT A;  1U1P A;  1X4D A;  4OZJ A;  4LFC J;  4F2S A;  4I6Y A;  4DLE A;  2RML A;  3GJS B;  4YB6 A;  4RNN A;  3NCR A;  4ZN3 A;  1TAQ A;  2G2Z A;  1KC8 T;  1DQA A;  4CTA A;  1S49 A;  3C6T B;  1LV5 A;  2BJE A;  3JTN A;  4ID8 A;  3KHL A;  2LEC A;  2WSC C;  2IAJ A;  2JEI A;  2R3V A;  2YKM A;  3K5L A;  1M1H A;  4X62 J;  4PXC A;  1FD2 A;  1RI7 A;  4OI3 A;  3L95 X;  1IBK F;  4I4B A;  2OTJ S;  1U1Q A;  1S6Q A;  4EZ9 A;  3EVO A;  2VFR A;  1S48 A;  2JEG A;  1QE1 A;  3C16 B;  3KLG A;  4Y28 C;  3RRK A;  2AX0 A;  2V34 A;  2BRL A;  2GJ2 A;  2H5J B;  5ETP A;  2ZH7 A;  3PO4 A;  1H72 C;  3VQS A;  1NEE A;  3GE9 A;  3DN9 A;  5LXY A;  2GQ2 A;  3DRY A;  2HHU A;  2OFH X;  2WAQ D;  2VA3 A;  1YGY A;  3DM2 B;  2HBR B;  3UD3 P;  4LVN P;  1FES A;  4DWI A;  4QWD A;  2PN6 A;  3SEO A;  4WFX A;  2WVD A;  2A10 A;  3CTR A;  4A8Y A;  5DET A;  1B99 A;  5L1J A;  2HHQ A;  3AD7 C;  4HTJ A;  4KTQ A;  4PAA A;  3HX9 A;  2B9Y A;  4WXW A;  3GYN A;  1E6Y A;  1SIW B;  2XMT A;  1CJV A;  1HBM A;  3PHE A;  5I3Q A;  3L4B C;  5D4P A;  3EVW A;  1RTD B;  2MZT A;  4C4W A;  2WON A;  4ZLL A;  1DY3 A;  1PJ5 A;  1TVR A;  3ICL A;  4XPC A;  1H2U X;  2ZH3 A;  1S1V A;  3BSC A;  3FGV A;  2V68 A;  2AZ3 A;  2RKI A;  3Q8Y A;  1TL1 B;  2J0S D;  5L1K A;  5A2Q U;  1KRP A;  2C3U A;  1U1K A;  1D9F A;  3UDE A;  2RRA A;  3MAA A;  3IS9 A;  3GFX A;  1XNR F;  3JTP A;  5KFK A;  4WP9 A;  3HHL A;  2D9O A;  4YHH F;  2ZD1 A;  2BJ9 A;  3MCN A;  1H2T Z;  3OT9 A;  3G6V A;  4OYB A;  1C0T B;  4WFN Q;  4KHP J;  2JVR A;  3TJ9 A;  4I67 A;  1HQE A;  1BQM B;  4LR9 A;  3DCA A;  1Z2Z A;  3R5A A;  4NCB A;  3BO3 A;  1YBU A;  5DLF A;  3DMJ B;  4DPX A;  1KBR A;  1F9F A;  1NK8 A;  1YWX A;  3E8O A;  2CQ4 A;  1HNV B;  4AUK A;  2CDR B;  1IKV B;  1SH0 A;  3I0R B;  3P4U B;  2XGQ A;  3BRE A;  1NJZ A;  4YY3 F;  2HZV A;  4IRK A;  3R7B B;  3DLE A;  1VYA A;  3D3B J;  4K2X A;  4F0M A;  1YLX A;  2DXD A;  5GMK a;  1T0T V;  3TA0 A;  4JI6 J;  4MT1 A;  5HSP A;  3F41 A;  1RTJ B;  2D3U A;  5AXN A;  4DSI A;  2DCU B;  3I5A A;  5KFE A;  1NME B;  3DYA A;  3T5J A;  1KWM A;  1S72 S;  4FBT A;  2ROP A;  3B78 A;  4IFY B;  1U0H B;  3W60 A;  2RRB A;  3G86 A;  3NG8 A;  4AYB D;  4KHR A;  4N47 A;  1WOS A;  3I9Z A;  2VFU A;  1IQZ A;  2G1D A;  3KK1 A;  1DFD A;  2VV5 A;  3TX8 A;  2BRK A;  3M32 A;  4DV3 F;  5IM0 A;  1M0S A;  4NA2 A;  4FKX A;  1ZAX A;  4DX7 A;  3HJV A;  5F0U A;  4PYA A;  4C9D A;  1XK8 A;  5DZ6 A;  5CHC B;  5BXI A;  5DG9 A;  2W24 A;  3V4I A;  3MMJ A;  2AF6 A;  4B9S A;  3TAQ A;  1R8C A;  3HDS A;  3MUT P;  3MEC A;  2V2Z A;  2MKS A;  2DB1 A;  3LTO A;  4WXO A;  3O6Q A;  2Z56 B;  2DNN A;  5HAT A;  5F8L A;  5GME A;  3TUZ C;  2DIS A;  4QPX A;  3OD2 A;  2KZM A;  4X4P A;  3CVK A;  2KI2 A;  4QOT A;  3BR9 A;  4JI1 F;  2XEX A;  1FJE B;  2RIL A;  5HLF B;  4WYL A;  4DR3 F;  3QNW B;  1LW0 A;  3TOQ A;  1MMN A;  2BJ8 A;  1TV6 B;  2WVB A;  4FP9 A;  4C8M A;  2SXL A;  1CUL A;  3IGV A;  2HHV A;  1W26 A;  3VAL A;  4B3O A;  3JXO A;  3F73 A;  1U1M A;  5KFZ A;  2XS7 A;  1YRT A;  3LP0 A;  3AOD A;  2E5I A;  4PXE A;  4OYP A;  2KT5 A;  4ZIV A;  2N82 B;  2RB7 A;  5KOW A;  1T9X A;  3JSM B;  4XDD A;  2M5Y A;  4OJ1 A;  3K5P A;  3H2L A;  2XHC A;  1KTQ A;  2J9D A;  2N3O A;  2MQM A;  3T1H J;  1KD1 T;  3MR7 A;  2KM8 C;  5C2C A;  2CA9 A;  1MU2 A;  1S59 A;  1XMQ J;  3R3T A;  2E44 A;  4TY8 B;  1HR0 F;  2BKN A;  2XTJ P;  4DPY A;  1WTB A;  2F7V A;  2J9D E;  1RT7 A;  1YJ9 S;  5HL7 Q;  5KT7 A;  2XM3 A;  4ZP6 A;  4CO0 A;  1NSA A;  4BC9 A;  3HLU A;  1R6V A;  3M6V A;  4ZLN A;  4DR1 J;  4QJV A;  1PO6 A;  3WC2 A;  1WAC A;  1I94 F;  2PGC A;  2WBM A;  3PKM A;  2DGV A;  4IDK A;  1YG0 A;  4EBE A;  4DR6 F;  1RT3 B;  4QW8 A;  1S6O A;  5KFW A;  5ETT A;  1RHK B;  4C7Q A;  2HAI A;  1GQE A;  2XS5 A;  1XR6 A;  4KBI A;  1TR0 A;  4C0H A;  4C11 A;  4MKV A;  3EX7 B;  5J2M B;  1CC8 A;  1RWW B;  4F36 A;  1CJU A;  5IS2 A;  3SDE A;  3EGZ A;  3QO9 B;  2XMA A;  1RTZ A;  2MZR A;  3FEY B;  1WG1 A;  2PFD A;  4OZ5 A;  1RCX B;  3MMC A;  1O6X A;  4GKK J;  3TJ8 A;  4ZJO A;  3MOZ A;  4CO5 A;  4O3N A;  1DTQ B;  4ILR A;  3GIK A;  3PIO Q;  3CW2 C;  4DR7 F;  5LOQ A;  1FKO A;  4TQR A;  3X3U A;  4MKY A;  3T6J A;  2WW8 A;  1J5E F;  2M88 A;  3H5X A;  4WTY A;  2YPY A;  2W7A A;  4JI3 F;  4BDP A;  3H98 A;  5SUH A;  2IM2 A;  4K5R A;  3NGR A;  2CNL B;  1TKZ A;  5KT5 A;  2AYB A;  5HVH A;  5JUM A;  3OR1 A;  3CJK A;  3LW5 C;  4RO0 A;  4MK9 A;  1HBO B;  4ED7 A;  2YTC A;  3PX4 A;  6FDR A;  1Q16 B;  1DQ8 A;  4N8N A;  1R8P A;  4WFZ A;  4XPE A;  1KNZ A;  3RR8 A;  2YNI A;  3QZ8 A;  2ZNY A;  3LP2 A;  1BGX T;  1S79 A;  5KFQ A;  3HMJ G;  3IC1 A;  4IR9 A;  5J2N A;  4IG0 B;  1QAX A;  2FQQ B;  1V3Z A;  3BSA A;  4DR4 J;  5D0E A;  2MMY A;  3D66 A;  1FE0 A;  2D9P A;  2ZOM A;  2AJ2 A;  4C8L A;  4CLY A;  1D0E A;  2BAC A;  1YQH A;  4DV5 J;  4CO1 A;  4J7C A;  1XNQ J;  4X2B A;  2JZ5 A;  3VV2 B;  4Y6I A;  4IH7 A;  5ETQ A;  1L3K A;  2V5H G;  5BYR A;  2LCW A;  1IJE B;  2ZE2 B;  2HFS A;  4A8X A;  4ZVS B;  1NM2 A;  1K0V A;  1X4A A;  3R1L A;  1QVF R;  2PI5 A;  1QSS A;  2LU2 A;  3BGO P;  2XCP A;  4P2X A;  2ATL A;  4HDG A;  4O3P A;  4LF5 F;  2A3J A;  2R7X A;  1FXR A;  4DV6 J;  3A8K A;  3QGI A;  3ENA A;  1ZM9 A;  5KT2 A;  2O66 A;  2VFT A;  4JBC A;  4DR2 F;  3LUY A;  1WEY A;  1VBX A;  4DUY J;  3HZE A;  2A6M A;  1ROF A;  3EGV A;  3CWJ A;  1LNQ A;  3OHA A;  3MM6 A;  5KFR A;  1HBN B;  4R8U B;  2FGC A;  3LGN A;  1BXN A;  1TZ0 A;  1WC0 A;  4LF4 J;  2O67 A;  4TU8 A;  4F04 B;  2YX1 A;  4QWE A;  1UA1 A;  1RBA A;  4LRC A;  4V19 X;  1R7I A;  4LRF A;  1TTH B;  3FBB A;  2NCK L;  3K57 A;  1UA0 A;  4FF3 A;  1RAA B;  3P5B P;  4WPA A;  1CG2 A;  3NGU A;  2OEJ A;  1OPZ A;  2ZUA A;  5LJ3 Y;  2BKP A;  1TKT B;  3NMR A;  4RBT A;  3C14 A;  2VL1 A;  3M2R B;  3QSY B;  5KT6 A;  4O3O A;  1N34 J;  4ZVF A;  1BC6 A;  5HP1 B;  4ES1 A;  4DU7 A;  3VCD A;  1I1G A;  2OML A;  3OL9 A;  2MLX A;  4ZVP B;  5IOL A;  4IRC A;  2DEI A;  3OXL A;  2EFG A;  4UT4 A;  3FSY A;  1QVG R;  3KLI B;  5F8J A;  1HPZ A;  4JYA F;  4QIV A;  1FJ7 A;  2Z57 B;  4QWA A;  2LQB A;  3D1Q A;  2EG2 A;  3DHW C;  2E66 A;  3TVK A;  3T6B A;  5BR8 F;  5ETO A;  1AXQ A;  1EET A;  2MKJ A;  4CZC A;  3HKW A;  1FKP A;  2HFU A;  2V6A A;  2NZ4 A;  3M2V B;  1OYD A;  1B0P A;  2W2O P;  1M5V C;  1S76 D;  2AGO A;  5E33 A;  4CM0 A;  2QX0 A;  2QTW A;  1N33 J;  2GHP A;  4NLY A;  3DLB A;  4M95 A;  1WD6 A;  3RAM A;  4X4U A;  2AJ1 A;  4C6A A;  1NPP A;  3CD7 A;  3UDV A;  4NI2 B;  1KON A;  2VQF F;  1JMT A;  4DS5 A;  2XSF A;  2DNO A;  4NRU A;  2VD3 A;  3VAF A;  4B3R F;  1BY9 A;  3M1V A;  1F3F A;  4NLO A;  3EGN A;  4ER8 A;  3P49 B;  2DYA A;  4DV4 J;  5JXS A;  3G8Q A;  1ZOT A;  2G9O A;  2VKR A;  2FC9 A;  2KJW A;  2BZ2 A;  2UUW A;  3CJS A;  2HBZ B;  4NLV A;  4ZVH A;  3OTO J;  2QV6 A;  2YKM B;  1KEK A;  3KNG A;  2K7J A;  2UU9 J;  3IXQ A;  1JK9 B;  4BHQ A;  4C0B A;  4ECT A;  5DGA A;  3W5Z A;  1SJ1 A;  3W61 A;  1WI8 A;  3A3O B;  4LQ3 A;  4LF9 F;  4MKA A;  1QE1 B;  2BJ7 A;  3ILI A;  4RU9 A;  2FLL A;  4NYO A;  3T9Z A;  3KLG B;  3VAG A;  4F02 A;  1RQ0 A;  4ICL A;  3ISN D;  4WYW A;  2DNY A;  1IM6 A;  1Q8I A;  3F0N A;  4Q7A A;  2KKH A;  1RTI A;  2QA4 G;  1YJW S;  4O44 A;  3DC2 A;  3OSP A;  3S7R A;  1YKW A;  3MM7 A;  4H4K C;  4AXJ A;  3OXG A;  5ETK A;  1K73 T;  4I68 A;  1FWL A;  4F4K A;  5DLG A;  1RKI A;  3EWG A;  4P9S A;  3MPD A;  1V3S A;  2HBQ B;  4DZ6 A;  3LGH A;  4EYI B;  4BC7 A;  3KXD A;  5D78 A;  2B4V A;  3MI7 X;  1RA7 A;  3PJ9 A;  4ZA1 A;  3G87 A;  1XR7 A;  5IT4 A;  1PCA A;  4IR1 A;  1E6Y B;  4F4Y A;  1U4B A;  3PCO B;  4NXM F;  1HBM B;  2NLW A;  3KNA A;  1S12 A;  4DFM A;  2XMK A;  1VK8 A;  2IMW P;  4ZN1 A;  2WON B;  2V9W A;  5IZH A;  3Q83 A;  5AXM A;  3OPK A;  5CYQ A;  1JLF A;  3TVY A;  4DPO A;  5IT9 Y;  4LIW A;  2R7O A;  2RKI B;  3U1L A;  1SKS A;  4DS4 A;  2J6S A;  2VOD A;  2Q79 A;  1VIX A;  2BAN B;  2Z8Q A;  1PAU B;  2YWF A;  1JJ4 A;  4DSE A;  2QSF A;  2AP6 A;  4CLT A;  3C46 A;  5LSL A;  2CNK B;  2LQ8 A;  3MAA B;  3IS9 B;  2GCF A;  3NCQ A;  3OTB A;  3HHL B;  2UUC F;  3FK4 A;  1X5T A;  4PXB A;  2DR8 A;  3J7Y U;  2ZD1 B;  4F3Q A;  3DXB A;  2OPP A;  3T1Y J;  2B7B B;  3U02 A;  2AEF A;  3KKF A;  2XI2 A;  2DD8 S;  1FNM A;  2AT1 B;  3M8W A;  4J9K A;  5IV3 A;  4KT0 C;  2HS3 A;  4HYK A;  4LSN A;  1LW2 B;  4A8S A;  4JOU A;  3OVB A;  2IC3 A;  1NXI A;  4QIE A;  4Q43 A;  2ZC3 A;  3BYR A;  3KG0 A;  3Q0A A;  3A3N B;  3DLE B;  3TP2 A;  2MQP A;  3L7U A;  2DPI A;  3TEG A;  1P1T A;  2DT9 A;  4Y2M A;  3IM8 A;  4I2Q B;  4ELU A;  5EHH A;  3QMQ A;  2FYX A;  4DL6 A;  3Q8P B;  2B5J B;  3DYA B;  4J9V A;  3EDR B;  3MMB A;  4KIA A;  4CH0 S;  3MUR P;  3W3S A;  2LXI A;  2Y1L B;  4H4K A;  3UN5 A;  5HJY A;  4B08 A;  2QGF B;  4LFC F;  1C2P A;  4DZD A;  1RZM A;  3KK1 B;  4OFZ A;  4OYM A;  3M32 B;  1ZH5 A;  2FUG 9;  5IM0 B;  3TA1 A;  2Q6C A;  3UVJ A;  4MK7 A;  2NYH A;  3FCW A;  5D0H A;  1OS5 A;  2DXE A;  4DL4 A;  4WFY A;  1IBC B;  1V3R A;  5KFL A;  1VQ5 S;  4NLW A;  1BQX A;  2F1F A;  1MWY A;  2MY7 A;  4LSL A;  2I1R A;  2XHW A;  1OSC A;  5CD4 A;  3MR6 A;  5EGY A;  5K5M A;  1RWX B;  5U47 A;  3M6U A;  3V4I B;  1T05 A;  5DZ7 A;  5HAN A;  1IR0 A;  4LBI A;  1NDC A;  3MEC B;  4OX7 A;  4OIX A;  5H9F J;  2FLO A;  3K58 A;  2V9K A;  2YKQ A;  4LQ9 A;  2R7V A;  4DL7 A;  2ZJR Q;  5B7W A;  4LRB A;  3QT6 A;  5IT0 A;  4X66 J;  1AB8 A;  3OFG A;  2R2S A;  3SV4 A;  5HAO A;  1BE4 A;  2VBX A;  4B3T J;  3GV5 B;  1HIY A;  4DFP A;  3T3F A;  4GVB A;  1JX4 A;  4ES3 A;  1FJC A;  2ZH8 A;  3A8I A;  4Y0F A;  2MZ1 A;  5F8N A;  4DX5 A;  1J5O A;  2CQG A;  1KOH A;  2RQM A;  3Q8V A;  3IWL A;  4C3M A;  2LFV A;  3DGV A;  5E3R A;  2DNZ A;  2BMB A;  1VR6 A;  4B3O B;  5C24 A;  2NXE A;  1N54 B;  5KFA A;  4MH8 A;  4F8R A;  1TFY A;  3LP0 B;  4ZPW R;  5GMD A;  1WHV A;  1ZTT A;  1N5V A;  3HD2 A;  2UUB J;  4ZVE A;  1CJT A;  1KFS A;  1FDN A;  2FJW A;  4QIG A;  1F5C A;  4ECR A;  4RW8 A;  3PRD A;  4WF9 Q;  4RBU A;  2CJX B;  2DR6 A;  4TKT A;  1B0V A;  2N4C A;  1S97 A;  3QJJ A;  4U7U D;  1XMB A;  2J6T A;  1L3U A;  4J9L A;  2CPZ A;  4K4V A;  3BN4 A;  1H7W A;  1JJ2 R;  2YVS A;  1MU2 B;  1RAD B;  1D8Y A;  2IVM A;  8ATC B;  4QPT A;  3PW5 A;  3KJV A;  2IMO A;  1W25 A;  3R5B A;  2BYC A;  2BEF A;  2KU7 A;  1S10 A;  2FD2 A;  2B6A A;  1Q1K A;  1OQ3 A;  1RT7 B;  2Y0S D;  4M5D A;  1K9M T;  2D41 A;  5LL6 d;  1SH3 A;  3A8J A;  3VAK A;  4RW4 B;  3K0J A;  4F7V A;  3I6P A;  2KL8 A;  3ZTQ A;  1VJQ A;  3CCQ S;  4O4R A;  4NWB A;  2KXN B;  3TAM A;  1ICE B;  1TU0 B;  2XWX A;  2KFY A;  2C22 A;  4K4X A;  4ECW A;  3I9V 9;  2EFO A;  1R31 A;  3R5G A;  4G3I A;  2Y9H A;  4ZCM A;  2Z30 B;  4C11 B;  2WSE C;  4WKY A;  1N88 A;  2QEX S;  1EZZ B;  4CNZ A;  1CJU B;  3O1L A;  1IKW A;  4K7Q A;  3TNV A;  4JI6 F;  2CQH A;  3PNI A;  2R9L A;  2M8D B;  1QTN B;  2LDI A;  1NLK L;  3WZ0 A;  1FJG J;  2E1R A;  2AJQ A;  1GT8 A;  3MMC B;  3DLG A;  1XER A;  3JTO A;  1GAO A;  4HDH A;  1RU1 A;  4ZOS A;  3W5X A;  1RCO B;  2JDJ A;  4DLG A;  4CLL A;  5DM7 Q;  2ZOG A;  5DS7 A;  3ZZO A;  2VBY A;  1KOO A;  4LFB J;  2LA6 A;  3MEE A;  1DLO A;  2BE2 B;  1FKO B;  1SI9 A;  1KHW A;  3KLE A;  4K4Y A;  4L6V 3;  3M8Q A;  5LXR A;  1EAR A;  3PG9 A;  1UZH A;  3CCT A;  3J80 U;  1WOO A;  2V4R A;  4DI6 A;  2CKW A;  2XMV A;  3ZTS A;  1NSP A;  3OW2 R;  3PYG A;  4AFF A;  5F0W A;  1TKZ B;  2CPJ A;  1N5T A;  3IBC B;  5KTQ A;  1EP4 A;  1CSJ A;  3CJK B;  2MST A;  4AT1 B;  2Y8Y A;  1M5H A;  5IQ6 A;  3CIM A;  4A8F A;  3C15 B;  1K1Q A;  2VUG A;  1F6T A;  3NS6 A;  3CJ5 A;  2GAG C;  3M7V A;  2MQQ A;  2WW4 A;  1K0T A;  3G9C A;  2YNI B;  1VQP S;  2YKA A;  3LP2 B;  4ZHR B;  5E5N A;  3CJR A;  2K3K A;  1D09 B;  5J2N B;  1RIS A;  1UET A;  2BQ3 A;  3WX8 A;  3V81 A;  2V4J A;  2QT7 A;  3RBZ A;  2HK3 A;  3ULH A;  3DRX A;  4C8O A;  3HCX A;  3JSR A;  1WC5 A;  1EQ0 A;  4EEY A;  2BE7 D;  2WVC A;  2P8I A;  5HJX A;  4AD6 A;  2XNR A;  1SH2 A;  2LDY A;  1YK9 A;  2RF2 A;  1VI7 A;  3D3C J;  1GK8 A;  2W01 A;  4I69 A;  4G6V B;  1Y0H A;  4Q0B A;  2X7I A;  1HI8 A;  3QGG A;  2FZC B;  2ROE A;  2L9W A;  2F4F A;  4GC7 A;  1OMS A;  3TYT A;  1SXL A;  3AT1 B;  2H48 B;  4F2R A;  3KK2 A;  4ZMM A;  4J9M A;  2HEK A;  3LH2 S;  3N9U C;  3ILO A;  4RBV A;  4TYB A;  3NL0 A;  5DDP C;  3QRR A;  1D1U A;  4BWM A;  2E1M C;  2WOM B;  2XY7 A;  3OR2 A;  2MZS A;  1LWC A;  3WIU A;  3KJF B;  2GGP A;  4OLO A;  3T1H F;  2M70 A;  4DXL A;  3MR2 A;  2YWE A;  1H6K X;  2ADC A;  1IN0 A;  3TZY A;  1HQ2 A;  2EFN A;  3Q2S C;  2MPU A;  1YBA A;  4WZQ A;  2NPI A;  2DNG A;  2YQ0 A;  3MAH A;  2XZD B;  2RS2 A;  4DR1 F;  2VG5 A;  5CD4 H;  3W63 A;  4Q8F A;  4NEZ A;  2CPX A;  2UZA A;  2M8H A;  1U25 A;  2IM1 A;  2XGP A;  1HPZ B;  4DSJ A;  3EPI A;  1Q81 T;  3NS5 A;  2R2T A;  2HWH A;  4WCE Q;  1EET B;  2A18 A;  2H65 B;  3C6U A;  3QWP A;  4CRJ A;  2JL9 A;  5M2R A;  1CPZ A;  2RVJ A;  1FKP B;  4XDC A;  4Q44 A;  3DRP B;  3PY8 A;  3K17 A;  5HBM A;  1VIO A;  2OHD A;  4MYT A;  4V19 J;  1HWU A;  4OYA A;  2D1C A;  3VGT A;  2IRX A;  2DNP A;  1ZYQ A;  4XTT A;  3KDN A;  1WC6 A;  1XNR J;  2YWK A;  4P2F A;  4EFA C;  1Y3J A;  1OY8 A;  2LEB A;  3QT7 A;  2PI4 A;  1KN6 A;  2OPS A;  1URR A;  2I6W A;  4USU A;  2VDI A;  3M1V B;  4J90 A;  2ZM6 F;  4DQI A;  4KE5 A;  2QJ3 A;  4B9U A;  1I51 B;  5HMX A;  1WTF A;  1RT2 A;  1PKU A;  2QL5 B;  3OHB A;  3BS9 A;  3PHT A;  2E1P A;  2IM3 A;  3V6D B;  4YY3 J;  1RWO B;  4ZCL A;  2PMH A;  1UW4 A;  2V8V A;  3CD5 A;  4H4M A;  4PG5 A;  3P45 B;  1WF2 A;  1XQI A;  2H5I B;  3LAL A;  2DPJ A;  3R6L B;  5A2Q Y;  2HRU A;  2E5G A;  2Y3Y A;  4OX6 A;  2DRB A;  9RUB A;  1RT1 A;  3CJQ A;  1LXN A;  4ICL B;  4YB5 A;  1SL0 A;  1JLB B;  4NAS A;  2KN4 A;  4DR4 F;  3BBB A;  1XTZ A;  4TYA A;  3GZ7 A;  1RTI B;  2FIU A;  1DJ0 A;  3MM7 B;  4DV5 F;  2ZDP A;  1XR5 A;  1SC3 B;  3M30 A;  5KFH A;  1XNQ F;  3K2Y A;  2JHE A;  2B56 A;  3KUG A;  1GX6 A;  3GYX B;  2FJX A;  3R2C J;  4J9S A;  2ZH5 A;  3GSI A;  1UVL A;  3SCL E;  4Y2K A;  2R8J A;  4OZL A;  1QM9 A;  1SCJ B;  4LBP A;  4DV3 J;  1WEX A;  1ZZF A;  2W9B A;  4MTP A;  3C6T A;  4ILM A;  2YXL A;  2LXU A;  1HKA A;  4X4R A;  3ISN C;  1CBK A;  1HHT P;  4DV2 J;  3QSI A;  1S5Z A;  5H9E J;  5B0D A;  1Q82 T;  2I38 A;  1UAW A;  2R8G A;  4OZ2 A;  3VAI A;  3C16 A;  1YX2 A;  4UY8 T;  3MCS A;  1JXL A;  3GCX P;  5CYQ B;  1JLF B;  1UPM B;  2JJ4 D;  4RUH A;  2HG4 A;  2C2E A;  3EDQ B;  5E3A A;  2C2K B;  3W2W A;  5RUB A;  1G6B A;  3KUH A;  3QFH A;  2UVW A;  1TQL A;  2DO4 A;  1RHM B;  3M8S A;  2Z0G A;  3FSI A;  4C8N A;  4ZKA A;  1R89 A;  4ZVU B;  1NJX A;  1KLN A;  1B64 A;  4OI6 A;  4DR3 J;  2IBK A;  1VRU A;  4DG1 A;  1CJK B;  1HHS A;  2XSJ A;  3KK3 A;  4EBD A;  4QZV B;  4WIQ A;  3T1A A;  2OO4 A;  4HHH A;  1IJF B;  2AEJ A;  2KRR A;  2R7W A;  5DG8 A;  4QU6 A;  3Q86 A;  4XO0 A;  4JI7 J;  4OYO A;  2RQC A;  2BKO A;  1PYS B;  1RTD A;  3J81 Y;  3RB4 A;  3AQP A;  4IYQ A;  2GNK A;  1L3V A;  2BAB A;  1VC6 A;  4E8U A;  4ID5 A;  3OUY B;  1HNX J;  4ED0 A;  4K59 A;  2GC8 A;  1ZS6 A;  3PJW A;  4Q45 A;  2R42 A;  1R6Y A;  4WP3 A;  2Z4P A;  4AL5 A;  4EK2 A;  2APO A;  2HBY B;  4OJG A;  2FB0 A;  1HR0 J;  4X65 J;  3MMB B;  4H4O B;  5DJB A;  1T3N A;  3UCZ P;  3HHK A;  5BYQ A;  2PA8 D;  3AQO A;  1GTE A;  2RHS B;  1UPP A;  2RU3 A;  5A8K B;  2DH8 A;  4XIU A;  1PSD A;  3PVX A;  4OQJ A;  3QGH A;  2KRB A;  4KYZ A;  3SSQ A;  1EJ7 L;  3UVJ B;  1ZAW A;  1HNV A;  5ETV A;  3THV A;  1TL7 A;  2J7U A;  3PX6 A;  2A6O A;  3WC0 A;  4NXN J;  3MM5 B;  1VK3 A;  3FDS A;  2L41 A;  2UVR A;  2WBR A;  4FF2 A;  1TMM A;  1VRQ C;  4YUD A;  5KG6 A;  3VAM A;  2Q3P A;  4WFB Q;  4UZC A;  3GR1 A;  3CIZ A;  3QIP A;  2AHO B;  1O0P A;  4KGX B;  2HQI A;  1HNI A;  2NQP A;  4Y2I A;  3D54 A;  2FVQ A;  4XK8 C;  2WHO A;  2QMW A;  2W8K A;  5IT9 U;  4IFY A;  1NU4 A;  5IFM A;  1YVF A;  3PZP A;  4OX9 F;  5HO4 A;  3HZG A;  4ZLJ A;  4DR7 J;  2CJA A;  5LT5 A;  3NAH A;  3H20 A;  4OYZ A;  2W9C A;  5ITH A;  1J5E J;  4PG8 A;  3BGL A;  3M9N B;  4JI3 J;  2XYG B;  1YI2 S;  1X4H A;  4LR8 A;  5DQI A;  2JWN A;  3W65 A;  1J5O B;  2V67 A;  1KVJ A;  2CNN B;  3FRZ A;  4BWJ A;  3H8Y A;  4Z7Y A;  1MRO A;  4OX8 A;  2OJ3 A;  4O0I A;  1Q7L B;  4Y2C A;  4UUX A;  1WJ9 A;  4NLR A;  4TU9 A;  2K8G A;  2FPH X;  5HMZ A;  3KMS A;  4G65 A;  4FDF A;  1CJT B;  4RPF A;  3SFU A;  4RW8 B;  3UO0 A;  4NLQ A;  2QLW A;  7FD1 A;  2GV1 A;  3ETO A;  2DNQ A;  1RUS A;  4PQA A;  2D3Z A;  3K59 A;  4DUT A;  4ZJL A;  3KJV B;  4UOF A;  2GIF A;  3O2I A;  4B17 A;  2OP5 A;  4R0J A;  3HXM A;  2QN6 B;  3IAM 9;  2V8P A;  4ED5 A;  2DNK A;  1TKX A;  4DL5 A;  3K5N A;  2XWY A;  2XNQ A;  1KKH A;  2NXU A;  3H59 A;  2XG8 A;  2BW7 A;  2ABY A;  2MJU A;  4JI5 F;  3E01 A;  3UE2 A;  4DSL A;  3ILJ A;  5B0G A;  5C7P A;  4NPO A;  3TAM B;  1JLG A;  2NXC A;  1RE1 B;  1ZBT A;  3M2U B;  4DR2 J;  3H4B A;  1DTT B;  3BDP A;  4USK A;  4M5I A;  2J76 E;  5CYJ A;  4AL7 A;  4ELV A;  1UWA A;  3FFI B;  3QID A;  2AYM A;  1IKW B;  1AUD A;  2AX1 A;  2FVS A;  1IR1 A;  2I0X A;  5EN1 A;  1FRH A;  5KFM A;  3PKY A;  3A3P B;  4QCL A;  1RBL A;  2WK4 A;  1NBE B;  2XLI A;  3N6N A;  2EKY A;  3D1H A;  1N5Y A;  3MEE B;  1NK6 A;  3KLE B;  1APS A;  5F8G A;  2PFF B;  4KSE B;  1X4F A;  4OJ3 A;  4WK3 A;  2CQI A;  3H25 A;  4J9Q A;  3W64 A;  2EEY A;  1EP4 B;  4BBY A;  1YTY A;  4JYA J;  4FS1 A;  2FJD B;  4DJB A;  3R5D A;  1BLU A;  2R2U A;  5B08 A;  2DXF A;  5B0C A;  4MAK A;  1U6F A;  1X5O A;  2FJA B;  2GW8 A;  3MM9 A;  3KJN B;  4OJH A;  2FHK A;  4OZ3 A;  2FVC A;  1S0V A;  2OSR A;  3GQC A;  2RUS A;  2EXU A;  1IVZ A;  2OEL A;  1CVJ A;  3O5T B;  2V4J B;  3MUM P;  3BO2 A;  1XBW A;  2IVF B;  3JAM Y;  4ZPA A;  1Q0N A;  4NOH A;  2ZJQ Q;  3D2W A;  2IY5 B;  4PG4 A;  4B3T F;  2BJD A;  1FHT A;  3G4S S;  2VZ9 A;  2RF2 B;  3GII A;  4B3R J;  3J7Y I;  4DR5 J;  4NCA A;  2C2O B;  1LQ9 A;  3IA0 A;  4DU8 A;  1UWB A;  4R5P A;  3PR5 B;  2FTR A;  1C4A A;  4CYU A;  3KK2 B;  4IKA A;  2CQB A;  3GJQ B;  5E3Q A;  3LOU A;  3HVT A;  3MEK A;  4NEY A;  3D6F B;  2OD4 A;  1NK5 A;  5KFB A;  2ZZT A;  1QD1 A;  3D7S B;  2CJQ A;  2VB6 A;  4LF9 J;  1D8Z A;  2UUB F;  2ZH6 A;  3GWC A;  3ZTO A;  3OR2 B;  2ZJP Q;  2Y1J A;  3Q8Q B;  1LWC B;  3U27 A;  1L3T A;  2XMM A;  1SVD A;  4FYV B;  4TQS A;  2GGP B;  2HFZ A;  1HYS A;  2GJI A;  3JQJ A;  4LRD A;  4MYU A;  1NDL A;  2UV8 G;  2IHR 1;  2LP4 A;  4FPI A;  1IKX A;  2C3M A;  2VFV A;  4HH0 A;  4DPW A;  1RJJ A;  4LF6 F;  4M1K A;  1WF0 A;  4W92 B;  4EYH B;  1UMJ A;  3TZW A;  2VG5 B;  2H5E A;  3MPV A;  2DR7 A;  3ZZ0 A;  2UXC F;  1D3W A;  1OPI A;  3HSZ A;  1Y3K A;  1SQE A;  2PMW A;  2V63 A;  4JI0 J;  3GIL A;  1FXD A;  5L38 A;  1RAJ A;  4NXM J;  1YZ7 A;  2FJE B;  1VQN S;  2RD5 C;  3DI6 A;  3VGS A;  2CUY A;  2M4M A;  1PC5 A;  2X3D A;  2RDJ A;  3BF4 A;  2QFJ A;  3C6U B;  1J2V A;  2DGX A;  2JEF A;  2JC1 A;  1IR2 A;  1WUU A;  2AQ4 A;  2KG1 A;  4Y34 A;  2GJF A;  3MGJ A;  5HBM B;  2ALZ A;  1HQU B;  5KFJ A;  4DQR A;  2DRD A;  5KAK A;  1QLN A;  2HHS A;  3ADA C;  2HHW A;  1N5S A;  1UVJ A;  5M2U A;  5GAG I;  1CS4 B;  3D9B A;  3M2R A;  2UUC J;  1RYS A;  5KG4 A;  4JI2 J;  4LFB F;  2OPS B;  3NWG A;  5HP1 A;  3G6X A;  1F5A A;  4YDD B;  2JFD A;  3RR7 A;  2KXF A;  3B8H A;  2CXE A;  4Y2A A;  3EZU A;  2KTQ A;  3KLI A;  2MB0 B;  9ATC B;  3SMZ A;  2MGZ A;  2K7K A;  1HW9 A;  5F9L A;  1JNR B;  3CDA A;  4O4G A;  5DDO C;  3V6J A;  4H4M B;  2VKZ G;  3FC9 A;  2IA0 A;  4C97 A;  2HK2 A;  4DMZ A;  3CXC R;  1S7I A;  1RT1 B;  4U8Y A;  4W4M A;  3CMA S;  5B0F A;  3OV7 A;  1IWA A;  4C98 A;  1FVS A;  2PO4 A;  2CAJ A;  2DY9 A;  3I5B A;  2O1P A;  3GYG A;  4CT8 A;  4HAC A;  2LMI A;  1FX4 A;  2XO7 A;  4I56 A;  4A46 A;  3NRB A;  3K8V A;  5K8M A;  1DUR A;  3Q24 A;  3M30 B;  1BWV A;  3DLK A;  1HA1 A;  2HNY B;  4NI2 A;  4PWU A;  3PXG a;  2R7R A;  2CG8 A;  3M9O B;  2HLU A;  3BGF A;  3MFI A;  5IV4 A;  2KO1 A;  4ED6 A;  3WQP A;  3W9H A;  4Y65 A;  2XUL A;  3PRV A;  1WI6 A;  2IJF A;  2D69 A;  2W9B B;  2ACM A;  1F60 B;  1S6P B;  2DGU A;  1WEZ A;  3KFW X;  5KT3 A;  3IGN A;  1ZPW X;  3FUY A;  3RBE A;  2ASL A;  2F63 A;  1PBA A;  1G2E A;  4ECZ A;  5DDQ C;  2C1E B;  5KFO A;  1FXL A;  4JI8 J;  1R3N A;  3VTI A;  2LKZ A;  3T5L A;  2HS0 A;  1MN7 A;  1U2F A;  4RW7 A;  4RWX A;  2ZWO A;  2H4Y B;  4HHU A;  1ARO P;  2H4W B;  3TRG A;  2BXJ A;  1N5Q A;  3D6H B;  4CWB A;  5C5J A;  2JC0 A;  4USI A;  2IRY A;  1T3O A;  4NRT A;  3W2W B;  1X31 C;  4C8Y A;  3I5C A;  2B7C B;  3GFZ A;  4RWW A;  3CCL S;  1RLD A;  3OL6 A;  2K06 A;  1XMO F;  2Z2M A;  2HHT A;  4PG6 A;  1YIJ S;  1V5I B;  1ACM B;  1DAR A;  2ZC4 A;  2CQ2 A;  1T11 A;  4HI1 A;  4I7F A;  2DKO B;  2J7W A;  3T5K A;  1O5J A;  1VRU B;  4BS2 A;  3RGI A;  3AB4 B;  4LR7 A;  3T19 A;  2V50 A;  3M6X A;  2NXN A;  4DG1 B;  3BQ0 A;  2XSJ B;  2B0G A;  3RW7 A;  3KK3 B;  2GHV C;  3OJU A;  2UVU A;  3TI0 A;  3BEG B;  2RS8 A;  4ELT A;  2Q43 A;  2WCX A;  5C42 A;  3K5O A;  1RAF B;  1JLE B;  4M5H A;  3VQT A;  1U2C A;  3FSX A;  2W4P A;  2F9D A;  1N36 F;  1AUS L;  4DEZ A;  1YJN S;  1R0C B;  1VGY A;  2P9G A;  4ID5 B;  2VPY B;  3R7S B;  4C3K A;  2E5H A;  3H4D A;  1UFW A;  4KV8 B;  2BAN A;  2E7W A;  2EFP A;  4ZDN A;  5CXT A;  3H0P A;  4XAK A;  1RT4 B;  2KXH A;  1CQM A;  1RP5 A;  2B4O A;  3Q8U A;  1TK8 A;  4EMD A;  3PTW A;  4ERD A;  3EXY A;  5LM7 E;  4IOB A;  4ZCK A;  1T95 A;  1U6Z A;  3S1T A;  2ZVS A;  3F44 A;  2LLZ A;  3NNC A;  5GAE U;  2J8A A;  1JLQ A;  3ZXW A;  5L1L A;  1FF2 A;  2COL A;  1S0N A;  4I2P A;  1M1K T;  2UUT A;  4QYZ K;  4L3K A;  3NOC A;  1LW2 A;  1TL7 B;  3CC2 S;  5GAH I;  2CZV C;  4DSF A;  4PYD A;  3PAC A;  1VS3 A;  1V6H A;  5G0R B;  3BR8 A;  2DGQ A;  3N79 A;  3OLB A;  3S8S A;  2BE9 B;  3OVS A;  4I2Q A;  5KG5 A;  3QIP B;  5A0Y A;  5H9E K;  1HNI B;  3GLJ A;  5LMN F;  4E0D A;  4F50 A;  2H51 B;  2ZH1 A;  2B5J A;  4MIA A;  4QR1 A;  1A6L A;  1JJH A;  3PO5 A;  1T9Y A;  3MPU B;  3EPG A;  2R7S A;  3W1Y C;  2J8S A;  4AQY J;  1RWN B;  1RAI B;  1ELO A;  5IC4 B;  4WK1 A;  5T14 A;  2QLB B;  4DHV A;  4Q8E A;  4P7T A;  1Q95 G;  4P75 A;  3JYT A;  3CDE A;  3KUE A;  2W9C B;  3DOM A;  4YS2 A;  1RAH B;  3IFE A;  5THW A;  2HQ3 A;  4ILL A;  2GO9 A;  2Y8W A;  3W9J A;  1VFJ A;  2EVZ A;  3VF0 B;  5ADZ A;  4NA3 A;  4UOC A;  1H3D A;  1REG X;  4K5S A;  4CI0 B;  1MRO B;  1WG5 A;  2BUN A;  4PZV A;  1Q5Y A;  4O3Q A;  1KVI A;  2Z2Z A;  1NDK A;  3TEH B;  1LEO A;  3OJS A;  4DV2 F;  3UFC X;  3HT0 A;  4LMZ A;  2JSX A;  5BYS A;  3HSG A;  1TUG B;  4FZV A;  2CVE A;  1D9A A;  2CVI A;  1EQM A;  3TJA A;  1FNX H;  1YJV A;  3J81 U;  4Z37 A;  5E0O A;  4M5K A;  4UTG A;  2HAF A;  4FVM A;  1TUV A;  4MFB A;  3ENV A;  3P8B B;  3FVY A;  3J80 Y;  4W90 B;  1UFL A;  2H1Y A;  3LAK A;  1FA0 A;  3GR0 A;  4CLS A;  2GMH A;  2WB4 A;  1TKX B;  3PYF A;  3EYZ A;  2IYG A;  4DSK A;  5GAD U;  1JNZ B;  2HVE A;  2YQ3 A;  3TUI C;  2FJB B;  2YWW A;  4HR2 A;  1WSR A;  5L46 A;  2M52 A;  2YNH A;  3D5M A;  3CCJ S;  3IR6 B;  3MPW A;  2DNR A;  3E01 B;  2QRR A;  2QL7 B;  1JLG B;  3BYP A;  1FFW B;  4KJI A;  3GV7 B;  1VDH A;  2YX7 A;  4JI7 F;  2MKY A;  3M8R A;  1NJI T;  2F9J A;  1S4F A;  4O3S A;  3RAQ A;  4NCG A;  5EWE A;  2OPQ A;  1SUQ B;  2OGU A;  3MHY A;  3K8W A;  2FLP A;  1U26 A;  1HNX F;  2RQ4 A;  1UW9 A;  1M5P C;  2DHH A;  1F5B A;  3AOA A;  3BJY A;  3CME S;  1VHI A;  5AE1 A;  1ZA2 B;  2B9X A;  4A8K A;  4NZ6 A;  4X65 F;  3OFH A;  2VHG A;  4KB7 A;  4LBH A;  1NK7 A;  4EWT A;  1HNZ F;  3UCG A;  1G7C B;  1VBZ A;  1B70 B;  4FXW A;  1N5Y B;  5KFC A;  4QU7 A;  4RKU C;  4ZCI A;  2EFQ A;  2LEA A;  2E7V A;  3W8P A;  4RW4 A;  3DGP A;  3AFG A;  2KVI A;  3A13 A;  5E2Q A;  5E3P A;  4OZ0 A;  4TXS A;  4DF8 A;  3R97 A;  4IG3 A;  3H5S A;  4NXN F;  2O01 C;  1SB6 A;  3CED A;  2HQD A;  2DBB A;  1X4C A;  4CT9 A;  2VON A;  2RAQ A;  5FLX U;  3CO9 A;  3MM9 B;  3PEH A;  1AFI A;  3BQ2 A;  5MAO A;  3M9M B;  2KVQ E;  3FKB A;  1YJT A;  1ZA1 B;  1ZM3 A;  4OLP A;  3BN7 A;  3AJD A;  1JKH A;  1FI4 A;  4QW9 A;  2I5J A;  3LF0 A;  3CJ8 A;  5HI7 A;  2F3J A;  5KFI A;  3GPA A;  4GRS A;  2BE2 A;  4CLU A;  2UP1 A;  2BM0 A;  1X0F A;  2D3O 1;  3OLA A;  3GIJ A;  2WTF A;  2A0F B;  2YPZ A;  5E3C A;  1RHQ B;  1HWI A;  2ZM6 J;  4M8L A;  2ALY B;  2LQJ A;  3E3X A;  1PBU A;  2G0C A;  4X64 F;  3W8G A;  1UWB B;  5B0B A;  4R5P B;  1UEU A;  3VVU A;  3EZ5 A;  4CYU B;  3E51 A;  3C15 A;  3PFO A;  3HVT B;  1Q78 A;  1HLW A;  1ZZN A;  4NX9 A;  5J1N A;  5I42 B;  3SSR A;  4JV5 F;  2W8L A;  2HGN A;  2DHA A;  3CJ2 A;  1VJW A;  1NAQ A;  4ZHR A;  1SKR A;  2AIR B;  2CZ4 A;  3B82 A;  2V0N A;  3SXL A;  5D4N A;  5D6G A;  1HYS B;  3VAJ A;  4IOC Q;  2B43 A;  2HVD A;  4C0O C;  1I3O B;  1Q53 A;  3AJ1 A;  3RB6 A;  3EJM A;  1R8A A;  3SIP B;  1T03 A;  4DOZ A;  1KSP A;  1IKX B;  2CPF A;  3NBP B;  4QWB A;  4OHY A;  3EM1 A;  2ZNZ A;  2DJW A;  1F2H A;  2AJF E;  5EX0 A;  1FDB A;  2I8E A;  2F5G A;  2MSS A;  1FCA A;  1P6T A;  4FF4 A;  3S01 A;  2FJV A;  1T94 A;  2HUR A;  3PYE A;  4WU3 A;  2P9E A;  1HMV A;  3DI6 B;  2ZBC A;  4KRW A;  1U6B A;  2CIM A;  2GS8 A;  1XEZ A;  1LWF B;  2HMI A;  5CH7 B;  2WOM A;  3WBZ A;  1S9G A;  4DV7 J;  4F4X A;  5DO2 A;  4KR0 B;  4ZVQ B;  3QLH A;  4RW9 A;  3TR5 A;  5KFD A;  2F4V F;  3AXK A;  2N7Y A;  2HIQ A;  1VBY A;  2VPW B;  3M8Y A;  1NHK L;  2E29 A;  1S7H A;  1H73 A;  2NR0 A;  1ZM2 A;  3JAM U;  5HRO B;  3S6E A;  3BZQ A;  1VQ8 S;  4YFU A;  5IQQ A;  1NPK A;  4IQM A;  2XQC A;  1MSW D;  2HVZ A;  3THP A;  2AMC B;  3HO1 A;  3UDC A;  1RWM B;  3ENQ A;  1UFK A;  4MJK A;  5LSO A;  2MGZ B;  4EUV A;  4ED8 A;  4O4G B;  5I3U A;  2D3O R;  2XMJ A;  4ZPD A;  3DDI A;  2DY1 A;  2W2M P;  1Y00 A;  2XYP B;  3C8Y A;  2UXB F;  5D4O A;  2XS2 A;  2QIF A;  3JS9 A;  3DRP A;  4CLF A;  4LF8 F;  3QGP A;  4A8M P;  2VOO A;  4B3S J;  3DLJ A;  1E6V A;  2RSQ A;  2MQN A;  1UJ4 A;  1UJ5 A;  1RB0 A;  4CCH A;  2R8I A;  4HAC B;  2JEJ A;  1SJ3 P;  4GMK A;  4P73 A;  1U1L A;  1T02 A;  3THT A;  2L9D A;  4DFJ A;  2FLN A;  3PJX A;  3DLK B;  4JV1 A;  2XMU A;  4NML A;  1WKJ A;  2CQD A;  3TZX A;  3GG1 A;  5EDW A;  3BSO A;  2CPD A;  3TAP A;  2YH0 A;  3NCP A;  4DR5 F;  4P72 A;  1HL6 A;  2BVZ A;  2DNM A;  2J0W A;  1OIA A;  4U8V A;  3LWM A;  1XJW B;  3AD8 C;  1H38 A;  2MTL A;  3D6T B;  2L48 A;  3BPD A;  3V6D A;  2HZA A;  1RTH B;  4CP5 A;  4DV0 J;  1Z4U A;  1RBO B;  2DCL A;  2VJV A;  2HGL A;  1EX8 A;  1UTA A;  4UF4 A;  4N56 A;  2HW3 A;  5IC6 B;  4RW7 B;  3BO4 A;  3H42 A;  2C2Z B;  1NSQ A;  4K0K F;  1VQY A;  1QUV A;  5KFN A;  4QIF A;  3BGR A;  1YIT S;  3I56 S;  1JLB A;  1PGZ A;  2C3Y A;  2UUA F;  3ILL A;  2A2C A;  2VQE F;  2QLF B;  5JMN A;  2HHH F;  3CCZ A;  5DQH A;  3IN5 A;  4OX9 J;  4F25 A;  3DOL B;  1GMW D;  4WZM A;  2KHC A;  2QO3 A;  2VC0 A;  3D28 A;  3T5H A;  2HFN A;  4TVA B;  3IWN C;  1QAI A;  3MWB A;  4I7F B;  2E1A A;  3OSN A;  1S9E B;  2CJB A;  4KQZ A;  4DCO B;  1KLM A;  4KGK A;  1OJ4 A;  2LVW A;  3EMT A;  3EGW B;  3GJR B;  2HYI B;  3CJ3 A;  3ZNJ 1;  3ETM A;  2X1F A;  1H7X A;  4GKJ F;  2QZ8 A;  3CDW A;  1N0U A;  1SC4 B;  3BKF A;  3H90 A;  2HS4 A;  4NLX A;  4HT5 A;  4NLS A;  1HI1 A;  1FTC A;  4H54 A;  1FRX A;  4QQB A;  4JI0 F;  4UOG A;  3GIR A;  4NLT A;  5C42 B;  3N6M A;  1U1R A;  1JLC B;  4HL9 A;  2AWZ A;  3Q8R B;  4JV2 A;  4P71 A;  3VVT A;  3CNQ P;  1S1X B;  4C8Z A;  1TUW A;  4JUZ A;  1X9S A;  3HVR A;  1ZET A;  3DRS A;  5E41 A;  4ED4 A;  2ASD A;  1FRJ A;  5A6P A;  1IUJ A;  3HVA A;  4KFB B;  3L9Z A;  2VJU A;  3AOC A;  4BLG A;  3TVZ A;  4JP8 A;  1Q86 T;  1RGV A;  1DAX A;  2BOP A;  2A2D A;  1K47 A;  4DBQ A;  1LWE B;  4FYD A;  5I3P A;  3SFG A;  1FKA F;  1LXJ A;  7FDR A;  3BPS P;  4JI2 F;  1JWW A;  3NKY A;  4I1T A;  1JLQ B;  3G8S A;  1VQO S;  1CJK A;  1IKY B;  4I2P B;  4JI5 J;  1XWL A;  1TAU A;  2Y1R I;  4FYX B;  4LF1 A;  2W2N P;  2PA3 A;  4U96 A;  1S77 D;  4K4T A;  1YJR A;  4B9V A;  4ZLP A;  3KG4 A;  4ED2 A;  2RIJ A;  4Y3C A;  2IPO B;  2EC0 A;  2BW2 A;  3OUY A;  2M9K A;  4HVZ A;  4B9L A;  2WVE A;  4AND A;  1RHR B;  4GVL A;  5A0Y B;  3KMQ A;  1R8H A;  3I4P A;  1IWG A;  4QIW D;  5K8N A;  3ZTP A;  2AYE A;  1Y7P A;  4ENO A;  3UN3 A;  1IBL J;  4ZP7 A;  3KOA A;  4OMF G;  1P27 B;  3WHI A;  1HFE L;  3VGU A;  2GZO A;  4QR2 A;  3NGD A;  3IAS 9;  4H4O A;  3B4D A;  4CO3 A;  1N32 J;  1T7P A;  5A8W A;  2FC8 A;  3RUB L;  5A8K A;  3JYT B;  2P6T A;  3FQK A;  4PUO A;  3DOM B;  4RUB A;  2P5V A;  2FVP A;  3CCU S;  4FBU A;  3VZI A;  1AW0 A;  4RNF A;  1U2R A;  4E2F B;  3EE3 A;  3TAN A;  1S99 A;  2ZKT A;  4UUW A;  5J2Q A;  4N5S A;  3TWZ A;  3FZB A;  3MM5 A;  3R5J B;  3O8W A;  1X4E A;  2QFI A;  4UY8 5;  3CD0 A;  1S1W A;  1RAG B;  1UL3 A;  4M5N A;  2CPY A;  3GIM A;  2IRU A;  4JI8 F;  2JLE A;  4AXI A;  3C2P A;  3BDE A;  2ZUG A;  2GHW A;  2EFV A;  1T9T A;  2XYH B;  2XI3 A;  1FEE A;  2HIY A;  3G71 S;  2R7Q A;  1U49 A;  4TNO A;  1Y5N B;  1EKR A;  5KFP A;  5F9N A;  4G1I A;  1NZA A;  1A7G E;  4ZVG A;  2VAS A;  2VOP A;  1X60 A;  3HVW A;  4MFB B;  1VLO A;  1FX2 A;  2ZKU A;  1RT5 A;  1PAE X;  1EIY B;  1RT6 A;  4KPC A;  1O51 A;  3RB0 A;  2OMO A;  3N01 A;  5HMY A;  2DR9 A;  3MOJ B;  5K9F A;  1SL2 A;  4CNY A;  2YNH B;  5KFY A;  4USM A;  1WEL A;  2WVF A;  2A1B A;  3SQG A;  1UVK A;  2YKN A;  1NKC A;  3U1M A;  1U02 A;  2DGO A;  4MK8 A;  5K14 A;  3NXZ A;  4HT7 A;  2F65 A;  4USV A;  2PT0 A;  1BQN A;  4F3M A;  5JJB A;  4NCG B;  2OPQ B;  2ZH9 A;  2FZG B;  3ZNU A;  4FXD A;  1EB0 A;  1QSL A;  4M5J A;  1BMQ B;  2LU1 A;  3LP1 A;  4ETX A;  3MED A;  4KGV B;  3LAN A;  1B0T A;  2EK6 A;  2ZZM A;  5D0R A;  3TX0 A;  1NCL A;  4WWS A;  4UW2 A;  1NKE A;  2VPZ B;  3KG1 A;  4ETZ A;  1REV A;  2K2P A;  4LF6 J;  1VRT A;  1PJ6 A;  1G1X A;  1SJQ A;  5AXK A;  4WE1 B;  1FK9 A;  3HHE A;  2UXC J;  4ANC A;  3R27 A;  3DGP B;  4DN9 A;  5ETS A;  5KG3 A;  3MF5 A;  3MUV P;  4DF4 A;  4IG3 B;  1M5S A;  3E2E A;  4FYW B;  3M2U A;  1DTT A;  2LYV A;  4PR6 A;  3C66 A;  1FE4 A;  3CCS S;  3QYY A;  3CE8 A;  4ALZ A;  5C25 B;  3FFI A;  4OHZ A;  3NP5 A;  5CA5 A;  1SQG A;  3SI8 A;  2G0J A;  1OWX A;  3ET6 A;  4K50 A;  3SZ2 A;  3ZZY A;  2OAU A;  2HNZ B;  1XN9 A;  5CZV A;  5M2P A;  1EKS A;  1JKH B;  3ENW A;  3B4M A;  2W2P P;  4AQY F;  2PE8 A;  2J9E A;  2EW9 A;  4UQT A;  3RG6 A;  2I5J B;  2G13 A;  4QBU A;  2AKW B;  6FD1 A;  2AGP A;  2CAD A;  1NK4 A;  4J9O A;  2HHP A;  3CUN A;  3QAU A;  2I2Y A;  1RLC L;  2EWH A;  4X4Q A;  1VQ7 S;  2R8K A;  2B4P A;  5A76 A;  1TK0 A;  1HWJ A;  1ZAV A;  2IDL A;  5KFF A;  2MQL A;  4HLB A;  3KLF B;  2OTL S;  1S9F A;  3UCU P;  1URN A;  1YHQ S;  2RH3 A;  4ZPB A;  3ZZZ A;  3PW7 A;  2B3T B;  4PKD B;  2FHM A;  2ZBI A;  1NKB A;  1X7V A;  5JVG Q;  2BM1 A;  2GVZ B;  4U7C A;  3OL8 A;  5K8P A;  3PRB A;  2VFS A;  4BCA A;  1FD8 A;  3BQ1 A;  1R8B A;  4K2J A;  2CJK A;  1YJU A;  2ILZ A;  4PCQ A;  2OI2 A;  2BDP A;  5CZX A;  1T8E A;  1FER A;  1T03 B;  4ZIT A;  2K3I A;  4A8W A;  3LA0 A;  2B8P A;  4F26 A;  3TZZ A;  1P8G A;  3LAM A;  4RW6 A;  5EWG A;  3UQS A;  5LSR A;  3BBF A;  3LQV A;  5GAE I;  1AT1 B;  3SQO P;  4X4N A;  3BB5 A;  1FWK A;  4NLP A;  3M05 A;  1YRX A;  4EO6 A;  4DUZ F;  1IBM J;  3FBC A;  4WFA Q;  5KG1 A;  3US5 A;  3DHX A;  3MZI A;  4YQW A;  1T9W A;  2C2M B;  1HMV B;  3EVM A;  5CAA A;  2YY3 A;  3HJF A;  4M5G A;  2RNE A;  4FNH A;  4FYY B;  3PIP Q;  2LA4 A;  2O3D A;  2HMI B;  5L9X A;  1NK9 A;  2LQ9 A;  2FDN A;  4IRD A;  1UEK A;  2L9N A;  3RBX A;  1S9G B;  5SZT A;  5D8H B;  2R8H A;  4EBC A;  4KO0 A;  2F40 A;  3QLH B;  4RW9 B;  1RKJ A;  4MKB A;  2ZBR A;  1UZD A;  2DH9 A;  1XMO J;  1H74 A;  4LF7 J;  4PQU B;  1NZ8 A;  3J7Z 5;  5HQM A;  3T9N A;  2MKK A;  4CLK A;  1YJ7 A;  3FNN A;  2P6S A;  2AYG A;  1UP1 A;  3MD3 A;  3FCV A;  2RRN A;  2ZZN A;  1GXU A;  4B9T A;  2J0Q D;  3CO0 P;  3LPE A;  1W7W A;  5FD1 A;  2DO0 A;  2R7U A;  5IXU A;  3NNH A;  3N6L A;  2E9R X;  5J2P A;  2C3P A;  5K20 B;  2ZH4 A;  4M94 A;  2PEH A;  1MMD A;  1GEH A;  3JSY A;  5DM6 Q;  4OZ1 A;  2CPI A;  5KG0 A;  5I3U B;  1N36 J;  3MEG B;  2RU9 A;  3HUL A;  2Z2L A;  3UW1 A;  1DQ9 A;  1MML A;  4FF1 A;  1RYR A;  1JXE A;  3TW0 A;  4KH1 B;  4HI2 A;  4URS A;  3CCM S;  2D7S A;  1NK0 A;  1HQU A;  1SJR A;  4DFK A;  1E6V B;  1Y4Z B;  1C1C A;  2W1B A;  2WSF C;  1KQF B;  5HMW A;  4CLP A;  1CS4 A;  2GIR A;  2W2Q P;  5KFT A;  2HFV A;  3NGK A;  1K1S A;  1KTV A;  3FEZ A;  3I32 A;  2FHJ D;  4OL8 A;  4L75 A;  4U9R A;  4UQG A;  1R43 A;  4L3N A;  5GAD I;  4RNM A;  3OXF A;  1RXO B;  2IJN A;  3DNC A;  2YNF A;  1FRK A;  2KJV A;  4DCJ B;  3CPW R;  3F56 A;  3UR3 C;  3VHQ A;  2DR5 A;  3NS7 B;  5KFV A;  4TY9 A;  2IA6 A;  1W2I A;  2GMJ A;  3H5Y A;  1U0S A;  1QJH A;  1SV5 A;  3G82 A;  3W2V B;  3D1O A;  5LMN J;  1VQ6 S;  4FPR A;  4J9U E;  3BGR B;  3CCW A;  2CQC A;  4UOH A;  3WX4 A;  5DG7 A;  1S1U A;  2EBE A;  2ZEJ A;  2L3M A;  5KOX A;  2G2O A;  2QMX A;  1RWK B;  2HNY A;  1FFS B;  2QMU B;  2DHS A;  2GML A;  3EXC X;  2V4Q A;  3O44 A;  1KLM B;  2E5L F;  1TL3 A;  3N5F A;  4C48 A;  2EC2 A;  2E7X A;  3GP9 A;  1S6P A;  4USH A;  2FVR A;  4K4U A;  2QA4 S;  2BOA A;  4URQ U;  3L09 A;  3UWT A;  4F0K A;  3CCV S;  3GFH A;  4EZ6 A;  5AT1 B;  1VOM A;  4N41 A;  1WDT A;  3V2U C;  1FEH A;  1PIL A;  2J6U A;  2CJY B;  4WP8 A;  1U7L A;  2HRY A;  5F3Z A;  4EO8 A;  3DRS B;  2IYI A;  2VPX B;  4OI0 A;  3PEJ A;  3CB4 A;  3CMQ A;  4DV7 F;  2N4D A;  2F8E X;  3I0S B;  1VHF A;  1P1L A;  3MCO A;  3ZZU A;  2PMZ D;  3IG1 B;  4B3M F;  2G2Y A;  3IP0 A;  4LRE A;  4CO2 A;  1N6Q B;  4E98 A;  4JV0 A;  2MLZ A;  4UST A;  1RU2 A;  1VQM S;  2E5J A;  4OV1 A;  3POT B;  2D74 B;  4Q5V A;  2DEJ A;  2V69 A;  2U2F A;  3Q89 A;  4WJB A;  3QT5 A;  1F2G A;  4FXV A;  1NJW A;  1HHQ A;  3PDN A;  2DIT A;  1C1B A;  4DN0 A;  3PV8 A;  5KFU A;  3FZ2 A;  1RSC A;  1HW8 A;  2K1R A;  4CTA B;  3DRR A;  1WHW A;  3K5M A;  1B7Y B;  2RE1 A;  1CLF A;  3RRH A;  1OYE A;  2JVO A;  5LJ5 Y;  2PII A;  4RZR A;  1JLE A;  1VMB A;  2IAJ B;  5H1S V;  1DRZ A;  1GXT A;  2Y1I A;  2NPF A;  2MYF A;  2QA1 A;  4YB1 P;  3A12 A;  3BH7 B;  1S6Q B;  3H40 A;  1K44 A;  4G1Q A;  4ECV A;  3SCI E;  2ZBQ A;  4F4W A;  3BBC A;  4KV8 A;  3TA2 A;  4B3S F;  1U47 A;  4NMX A;  4C2M A;  2R7T A;  1ULR A;  1RT4 A;  4CIO A;  3LPY A;  2YX4 A;  1HNZ J;  4NA1 A;  1HNW J;  5B0E A;  5A8W B;  3HT3 A;  2UXD F;  3N28 A;  4MIW A;  3RAX A;  2J5A A;  1VQL S;  4PUO B;  3D0H E;  1KP6 A;  2BJ1 A;  2GVD A;  1BWE A;  1NH8 A;  1OY9 A;  3IBW A;  4CM2 A;  4YB7 A;  5LMU F;  2RQK A;  3KJQ B;  5J2Q B;  1HWK A;  4M5L A;  1F0X A;  5G0R A;  1CJV B;  1GXL A;  4DV0 F;  4ZS6 A;  1S1W B;  3RJM B;  2XO6 A;  5CYM A;  3IBF B;  3OFF A;  5HK4 A;  1TVR B;  2HRT A;  3MMA A;  4NZ7 A;  1Y9O A;  1BD6 A;  1S1T A;  2IVY A;  1S1V B;  4LUB A;  4DPU A;  3MAQ A;  1GMW A;  1MLA A;  4J9N A;  1W2B R;  1QTM A;  4NLU A;  4N76 A;  2XCA A;  1DBD A;  1S57 A;  1AZS A;  1RT5 B;  1P9Y A;  1LKZ A;  4YN3 B;  2WZ1 A;  1RT6 B;  4LJM A;  5DDR C;  2J9C A;  4ZJQ A;  2J7K A;  1HQE B;  2MQ8 A;  3GFY A;  5DRK A;  2ZHB A;  1FRI A;  3OTC A;  4X64 J;  1VLY A;  3UD5 A;  2OH2 A;  3SQG B;  1LFP A;  2CJ9 A;  2VBZ A;  5FLX Y;  4NLD A;  2YKN B;  3ONQ A;  4F4A A;  3CUL A;  1HI0 P;  2FY8 A;  4B9N A;  1A9N B;  5K14 B;  1LK5 A;  2I9S A;  3AD9 C;  1WDD A;  4JV5 J;  4RJV A;  2XZW A;  1KFD A;  1BQN B;  1FRM A;  1WC1 A;  4ZVO B;  2AJ4 A;  1FWP A;  2NS1 B;  4DX8 H;  2OPR A;  4ZIW A;  2N3L A;  3I55 S;  2QLX A;  3FBE A;  1JIH A;  4OV6 A;  4P74 A;  3IMQ J;  4KC5 A;  3KYL A;  5AE3 A;  1JQG A;  3LP1 B;  1S6U A;  4KKO A;  3RU0 A;  2QA2 A;  5JVH Q;  3I31 A;  3P3D A;  3MED B;  2QC3 A;  1KR4 A;  1RHU B;  3QBC A;  3QAT A;  4GO7 X;  3KHR A;  5G4D A;  4J9P A;  1I5O B;  1REV B;  1VRT B;  4Z7C A;  1GX5 A;  1NB2 A;  1LFW A;  1UCN A;  5FDL A;  1FK9 B;  3KLH A;  1CEZ A;  1CC7 A;  3QFW A;  3FEX B;  1WWH A;  3SYZ A;  4HKQ A;  1Y11 A;  3U7J A;  1YZ6 A;  2XY5 A;  4KAI A;  1BUX A;  3GSD A;  2OUG A;  2V2Q A;  2CQP A;  4X62 F;  1WOR A;  1SC6 A;  3GTY X;  3BSN A;  3UDL A;  3HHD A;  1SUQ A;  1WKK A;  3Q8S B;  3P6Y C;  3MCM A;  4S0M A;  3ET6 B;  4ZP8 A;  4KH0 B;  4ES2 A;  2Q1L A;  3ITH A;  1QDU B;  1U48 A;  5GAG U;  1X9W A;  2QE5 A;  1NND A;  2F4V J;  1IBL F;  5H9F K;  1NUE A;  4DV1 J;  2CWK A;  4CLZ A;  1U8W A;  4I6W A;  5FII A;  1N32 F;  1UKU A;  2KFZ A;  2WRM A;  4J91 A;  3HHN B;  3HK2 A;  3JB9 k;  1TEL A;  3Q23 A;  4WU2 A;  1WHY A;  1N8R T;  2DTJ A;  4IFV A;  2V2K A;  1LW0 B;  2MY8 A;  5MLC V;  3DLL Q;  3PR4 A;  3DU6 A;  2CQ3 A;  5EWF A;  1UVN A;  2HFO A;  1CUL B;  1KQK A;  1QAY A;  4IH6 A;  2QL9 B;  2XZT B;  3SBM A;  5IWA J;  3RZA A;  4A4J A;  3FBF A;  4X4O A;  1F9E B;  2ERR A;  3V6H A;  1JB0 C;  4X4S A;  2B9W A;  2BBE A;  2Y0B B;  2UXB J;  2CFX A;  1MNE A;  4ECY A;  3MFH A;  1TL4 A;  4LF8 J;  2RHQ B;  4ZK7 M;  2BA9 A;  3MR5 A;  5KFG A;  2IFX A;  3NY0 A;  1KDN A;  1NHV A;  1VCT A;  3AOB A;  4F67 A;  2YKO A;  4NYP A;  1RK8 A;  2C2R A;  2OLW A;  1FDD A;  4I64 A;  2H3E B;  2IM0 A;  3MTK A;  4MMO A;  5A8R A;  3H7H B;  4X4V A;  1WG4 A;  1HBU A;  4RW6 B;  1S0O A;  1SKW A;  3JSB A;  4KHP F;  4JI4 J;  4X84 A;  3OFE A;  2HVH A;  4Q2L A;  1KQG B;  1SC1 B;  2PD1 A;  5CCM A;  2MEW A;  5D15 A;  1H98 A;  4IDK B;  5AJ3 J;  4IO1 A;  1NDP A;  1YRU A;  3BM7 A;  3QRQ A;  4DL2 A;  3AB2 B;  3AA8 A;  4DQP A;  3WDO A;  5I42 A;  4GC6 A;  1AYE A;  3I82 A;  1TKD A;  4ZVT B;  5F8H A;  2V8H A;  5HQ8 A;  1RDR A;  4K0K J;  1X0P A;  3MM8 A;  2IDE A;  3SDE B;  3ZTR A;  3QPI A;  4RUA A;  4N77 A;  1Y10 A;  1L3S A;  2UUA J;  4KO0 B;  3ZFV A;  3ELH A;  2RUG A;  2CYY A;  4USJ C;  2VQE J;  1SL1 A;  2HHH J;  1M1G A;  1Q8B A;  1JXV A;  1FNO A;  2RJZ A;  2W25 A;  2JLF A;  2BJ3 A;  1QY7 A;  3HSJ A;  2C2D A;  3I96 A;  5CAB A;  3R8Y A;  2F8H A;  3Q2T C;  3NBP A;  2FZK B;  3MD1 A;  2AV5 A;  1Y5I B;  4ZP9 A;  1X4G A;  3DOK A;  2RDI A;  5B0A A;  5E7O B;  3AJ2 A;  1JLA A;  4GKJ J;  4OHW A;  1VQ9 S;  4TU7 A;  2ACY A;  2ZOF A;  2G1H A;  3CJ4 A;  3UD4 P;  1Q79 A;  5J2P B;  2EI5 A;  2AEM A;  2YKP A;  3J7A 1;  3OR1 B;  2VG6 A;  2V94 A;  2BQR A;  4P2M A;  3CD6 S;  3M6W A;  5EUH A;  2G4B A;  1U24 A;  2KYZ A;  5D4L A;  4LFA J;  2FY1 A;  4D3G A;  4O23 A;  2J0X A;  1LWF A;  3OBI A;  4NZ0 A;  1SQF A;  2E1C A;  4USW A;  4EGL A;  2KT2 A;  3AXM A;  1R27 B;  1C1C B;  4LSZ B;  3UI3 A;  5CQG A;  2H54 B;  1UEV A;  1NPR A;  5C2G A;  4M5M A;  4KGM A;  2KM8 B;  3CC4 S;  2BX6 A;  5F8M A;  3RTV A;  4I0W A;  2MZQ A;  4PPZ A;  3D0I E;  1PJ7 A;  3Q22 A;  2FGO A;  5HRO A;  2VDH A;  1M90 T;  2DNH A;  4MIB A;  3TQ1 A;  4EI2 A;  1M5K C;  3CDB A;  2MLY A;  3DFE A;  5J1E A;  4N8O A;  4PWD A;  5GAH U;  2YNF B;  4U7U K;  2POK A;  1SBR A;  4IOA Q;  2MJN A;  3JQK A;  3UN2 A;  2ASJ A;  4P7V A;  4PG7 A;  4ATN A;  1ZPV A;  4KPY A;  2NUH A;  1C4C A;  2B4U A;  1C0U A;  2YNG A;  1IBK J;  3IRX A;  1YDL A;  3MM6 B;  4NE9 C;  1SV5 B;  3G82 B;  2W9A A;  1RWV B;  1V5V A;  2KFN A;  4PPD A;  3ISZ A;  2KZZ A;  3HSD A;  1RAE B;  3AH6 A;  3HM9 A;  4L73 A;  1TFW A;  7AT1 B;  3R1H A;  4U67 Q;  4ZPV R;  5GVQ A;  2CRL A;  1S1U B;  3D68 A;  3HFV A;  1XMQ F;  2OIH A;  4U6P A;  1GMV A;  2HKE A;  3KWM A;  3C14 B;  3PX0 A;  2AJ0 A;  3EUN A;  2UVV A;  1WC3 A;  3FMW A;  4J5O A;  1TL5 A;  4KY3 A;  1TL3 B;  1U45 A;  2PSZ A;  1R0A A;  2ZVI A;  4QYR A;  3NGS A;  1TMJ A;  2EBG A;  1IM4 A;  2GFF A;  2NZC A;  1H2V Z;  1IBM F;  1EHW A;  1HD1 A;  4OZN A;  1RTH A;  3GON A;  3J7A N;  1DHM A;  1U1N A;  3T41 A;  4R0E A;  2PDA A;  4ECU A;  2MDA A;  4CH1 A;  4ED1 A;  1K8A T;  2ZHA A;  5J1P A;  1H0H B;  5D0G A;  3RBD A;  3O3L A;  1NB7 A;  3IO1 A;  4ECQ A;  1D9D A;  3H2V E;  4P2S A;  4ZPC A;  3TO8 A;  2R2R A;  3A4T A;  2CZ9 A;  2MKH A;  1SJ4 P;  3IWX A;  2AD9 A;  2CQ1 A;  4GKK F;  3KDO A;  5F8I A;  2GAH C;  2GO8 A;  3DOL A;  2DGT A;  4LF7 F;  5D3G A;  5DGB A;  5CCL A;  4YHH J;  3GU0 A;  2YWH A;  1RWP B;  1S9E A;  4FKY A;  1GH8 A;  3DDN A;  2VF3 A;  4C8K A;  1Q8K A;  1C1B B;  3HHL D;  2K1R B;  3K7R A;  4PRF A;  3MDF A;  3DRR B;  2OSQ A;  5T41 A;  5F41 A;  4K4S A;  4CH7 A;  1JLC A;  4L72 B;  4NLG A;  3HI9 A; 
#chains in the Genus database with same CATH homology
 3R7N B;  2HBY B;  1RHR B;  2QL7 B;  2C2K B;  3EDQ B;  4ZVP B;  2HBZ B;  3QNW B;  5IC6 B;  2XYP B;  2C2Z B;  4ZVR B;  1RHM B;  2QL9 B;  2XZT B;  2CNL B;  2CNO B;  2HBR B;  3KJF B;  1RWX B;  1GFW B;  1QTN B;  2C2O B;  1SC3 B;  1PYO B;  1F9E B;  4ZVU B;  2CJX B;  1RHK B;  4ZVT B;  3GJS B;  3KJQ B;  2QLF B;  1RWV B;  4ZVQ B;  2Y0B B;  2XYG B;  3GJT B;  3D6M B;  2C1E B;  4DCP B;  4DCJ B;  2CDR B;  3GJQ B;  2CNN B;  3R7S B;  5K20 B;  4ZVO B;  3RJM B;  3P4U B;  3EDR B;  1RE1 B;  4JB8 B;  1PAU B;  1I3O B;  1RWW B;  2XZD B;  3IBF B;  3D6F B;  2H4Y B;  3R6G B;  3R7B B;  4LSZ B;  3SIP B;  2H4W B;  2H54 B;  2H51 B;  4DCO B;  3NS7 B;  3GJR B;  2FQQ B;  2CJY B;  3D6H B;  2Y1L B;  2C2M B;  2CNK B;  1I51 B;  1QDU B;  1RWN B;  2QL5 B;  1RWP B;  1SC4 B;  5IC4 B;  3KJN B;  2QLB B;  3R5J B;  1RHU B;  1RWO B;  2HBQ B;  2H48 B;  3IBC B;  1NME B;  1RHQ B;  3P45 B;  1ICE B;  2H5I B;  1RWM B;  3R6L B;  1RHJ B;  2DKO B;  2P2C B;  2H5J B;  2H65 B;  1SC1 B;  1IBC B;  2QLJ B;  1RWK B;  2XYH B;  4ZVS B;  1BMQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...