2H51B

Crystal structure of human caspase-1 (glu390->asp and arg286->lys) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
87
structure length
87
Chain Sequence
IKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTDRVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Caspase-1
publication title An allosteric circuit in caspase-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 87
sequence length 87
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2h51B00
1RWXB 2HBZB 2XZDB 2CNNB 1RHKB 1RHQB 5IC4B 1GFWB 3KJQB 1RHMB 2FQQB 3D6MB 1RWKB 3KJFB 4ZVPB 2C2ZB 2Y0BB 4ZVSB 3IBCB 2C2KB 1RWPB 1ICEB 2C2OB 2QL9B 1PYOB 2QL5B 1RWMB 2P2CB 3IBFB 1NMEB 1I3OB 1QDUB 2H4YB 3R5JB 3KJNB 2HBQB 2CNOB 1PAUB 3GJQB 3EDQB 2CJYB 1RHUB 3EDRB 5IC6B 3GJSB 2H54B 1F9EB 1RWOB 1RWNB 1IBCB 1RWWB 3GJRB 2H48B 1SC4B 3R6GB 1RWVB 4ZVOB 2C2MB 3NS7B 2XZTB 3SIPB 1BMQB 2XYGB 4LSZB 2QLFB 4ZVUB 1RHRB 4ZVQB 2QL7B 3GJTB 2HBRB 4ZVRB 1QTNB 2H65B 3R7NB 2CDRB 2CNLB 2QLBB 1RE1B 2CJXB 3D6HB 2HBYB 2H51B 2CNKB 3R6LB 3P4UB 4DCJB 2XYPB 2XYHB 1I51B 3RJMB 1RHJB 2DKOB 2H5IB 3R7BB 1SC3B 2H4WB 3R7SB 4DCPB 2Y1LB 3D6FB 3QNWB 4DCOB 3P45B 4ZVTB 5K20B 1SC1B 2C1EB 2H5JB 2QLJB 4JB8B
chains in the Genus database with same CATH superfamily
4PG5A 1S76D 2E1MC 1GNKA 3EGZA 4F4XA 1VK8A 5A2QU 5CCMA 1KQGB 3NNHA 4M5HA 1XR5A 3MI7X 1S9EB 4UF4A 3N4WA 2XNRA 1N33F 1YHQS 3HHEA 4ED2A 3BGRB 1SB6A 1T3OA 4P7TA 2BRKA 1D9FA 3AD7C 5K8PA 2Z2ZA 5ETKA 1KSPA 1SL0A 1X5OA 3OVBA 2KU7A 1N32J 7AT1B 3DRRA 3OR1B 1OPZA 2F9DA 1Y9OA 1RT6A 4QCLA 4IH7A 1TQLA 3OL6A 3C6TA 4BC9A 3GYNA 4HR2A 3D6HB 1VBYA 1U8SA 4G65A 1VDHA 4OI0A 4HHUA 2ZOFA 1YRXA 4WE1A 4WJBA 3CCJS 2JHEA 4Z7YA 4EBCA 1NNDA 5BYRA 4USTA 3I9V9 4ZP9A 2CQHA 2K3IA 3QFWA 2OP5A 4OZ0A 1QD1A 1DURA 4H4OA 4IOCQ 3PX4A 1TAQA 3UDVA 5SZTA 4M5DA 1SL2A 1FKPA 2QJ3A 1RSCA 2IVFB 4TNOA 3CDEA 5E2QA 1U2CA 2VPXB 3N79A 1HBNA 2VFSA 2HIQA 4ZVSB 2NUUG 1G2EA 1M1KT 2GJ2A 2LQJA 3TO8A 4OYMA 3UI3A 4A46A 3CIZA 2OD4A 1EAYC 2B43A 2E9TA 3M30A 3QT5A 3KXDA 1XN9A 2W2QP 2SXLA 1RWVB 1GX5A 2HLTA 2E5LJ 3ENAA 1SJFA 1UZDA 2ROGA 4FVMA 1NK5A 3PFOA 2KO1A 1X0FA 4NLOA 1TKDA 3NGDA 1YJNS 3OFGA 1T9XA 4DI6A 2P9EA 2J76E 3G8QA 2MGZA 2XULA 1QAJA 1HNZJ 3O5TB 3TAPA 1RWUA 2P5VA 1RT2A 1S6QA 2E5HA 1S1VA 4C7QA 1WEYA 3EUNA 2JC1A 1OWXA 2FC9A 1FWKA 3A3OB 1NDCA 3NS6A 3PCOB 5FDLB 2G1HA 4JI8J 1VQYA 3IWLA 4C0HA 2GAHC 4DX5A 2XMUA 1RLDA 2LCWA 2VA2A 4N77A 2W7OA 3HF5A 4K8RA 1T9UA 2MZRA 4DV7J 3D6TB 2F5GA 6FDRA 5DO2A 3N5BA 4WXOA 2ZC4A 5LSOA 3TRGA 3SCLE 3V5RA 3DI6B 4UUXA 1SQEA 4NYZA 2ZZNA 4FF4A 4AXJA 1RKIA 4DU7A 4PG8A 5KFCA 2FYXA 4O4RA 1KFSA 1ULRA 1CQMA 3QRQA 3OL7A 2EVZA 4RBVA 2C2RA 2CZVC 3V4IA 1N0UA 1I51B 1RAHB 1YIJS 5F3ZA 1ZM4A 4OZJA 1CJVA 3VV2B 3C46A 3OXGA 4F3MA 1R6VA 3HHLC 1R0AB 4QR0A 3KHRA 4NA2A 4TQSA 2A2DA 1M5PC 4P2SA 3KLVA 1FFSB 1FRIA 2XY6A 4EK2A 1LNQA 3NCQA 3MMCB 2C2OB 2HW3A 2J0XA 5CH7B 2FHMA 4LF9J 3OL8A 3MAQA 4DV0F 1IKYA 2OMLA 3CJSA 4OJ1A 4FZVA 1G7CB 1Z4UA 4DQRA 5GAEU 3THTA 4KH0B 1P6TA 3SFGA 3NGKA 4CH1A 3EGWB 2BJEA 2YPZA 4DN0A 2RF2A 2BKPA 1GMWD 4J9MA 2B9YA 1JK9B 3ET6A 2NZCA 4DXLA 3GR1A 2XLKA 2I2YA 4PZVA 1K1SA 4DCJB 3M8QA 1Q0NA 2YNHB 1PC5A 4K4TA 2F1FA 1C4AA 2MYFA 3FEXB 4E8UA 1LWCB 2J6TA 3HVWA 2RU9A 4BHQA 1U26A 2DPIA 4ED1A 2ROPA 4XDCA 1LK5A 3FC9A 1ZAXA 4R5PA 2BUNA 1UEUA 1VQ4S 3P5BP 2XB2D 5KFJA 4JI3F 2KI2A 1FRXA 2MTLA 4WXWA 3T19A 4LR8A 1FFGB 1ZPVA 2AJ2A 2FZCB 3J7YI 3LTOA 1P8GA 3Q24A 3FEYB 2W9BB 2OLWA 2V8HA 4E98A 1RUSA 3R7NB 1LWFB 4X64J 2HVEA 1RT6B 4DOZA 3BN4A 1A0OB 1CULA 1H73A 5F8JA 2PEBA 4O3NA 3R1LA 3BGFA 5L1LA 2CQ0A 3JTPA 2VPZB 4K50A 2POKA 3DYAA 3UNYA 3VAGA 1T03B 3HJFA 3PHEA 1AT1B 2H9ZA 2C3PA 4O0IA 1WEZA 2VPWB 2I8EA 4LF1A 1E6VB 2ZJQQ 2CQ4A 2ADCA 1HBNB 2PMHA 1N54B 1ZOTA 1PYOB 1MWYA 2BJDA 2ZNZA 4CRJA 1CPZA 2HLUA 3FSIA 4ID5A 3OPKA 1Q86T 1G6BA 1TL1B 1FT8A 3FMWA 3CCES 4W92B 1LW0B 1WC4A 4NI2B 4CYUA 2YX1A 3LP2B 3K59A 2UVVA 1JLQA 2HS4A 2PDAA 3DM2A 1GXLA 5J1PA 4YB5A 1SVDA 3FK4A 2GIFA 4ECUA 4URQU 1FDAA 1S79A 5D3GB 1BXNA 2AGPA 4U7UD 1HNWJ 2MPUA 2K7KA 3CC2S 2J8AA 2MGZB 2DEJA 2AMCB 1KQSR 3FFIB 3EE3A 3FMBA 1HQUA 1RT2B 3HSGA 4BBYA 1NZAA 1VQ7S 5KFFA 3F73A 2IFXA 4KTQA 1K73T 4M5LA 4PWUA 3NCRA 1ZH5A 1ZM9A 1VQ5S 1WG4A 1A9NB 3C66A 3KLFA 2AYMA 1WKKA 3MM8B 2IRUA 4HHHA 3ENQA 2J5AA 1Y5IB 4M8LA 2EFPA 5D4OA 3T5HA 3E3XA 2NPFA 1YGYA 2VHGA 1MWQA 1JLGA 2AGQA 1QSLA 4I6WA 4EO6A 2IMOA 2YNFA 1MROB 5J2MB 2WB4A 2VV5A 2YH0A 5KT4A 4CLZA 2LU1A 3W62A 2KZZA 2WVBA 4LF6F 4F4AA 4B9LA 1SCJB 5HMZA 2LXUA 3SQGA 1SH3A 1K47A 1RU1A 4BWMA 3EMTA 4DV2J 2CVEA 4ED4A 3PTWA 3VHQA 2W2NP 4FXWA 2I6WA 4FBUA 1EKRA 1YRTA 2GMLA 3MUTP 2QA4G 4J7CA 5E3AA 2M52A 5IV3A 2FQQB 3AT1B 3KNGA 4YUDA 1U1RA 1BC6A 5CYMB 3S6EA 2ZZMA 3BJYA 2WOMA 2QL5B 2LLZA 3T5LA 4FYYB 5A0YA 1YJVA 4RW6B 4Y2MA 2B6AA 2FB0A 2NR0A 3DKDA 3POTB 3R6GB 3D5MA 4IUFA 4NXMF 5D77A 1HNVB 4C11A 4JV0A 2BQUA 4QR1A 4NLTA 4CQ1A 4NZ0A 1BLUA 1KTVA 3AXKA 4K7QA 1IKVA 2ZNYA 3TQ1A 2BW2A 1GMUA 1XNRJ 4JI7F 5J2QA 1I1GA 2YVSA 2F65A 1HWUA 3W8GA 1UWBB 4K5RA 3OVSA 3W5ZA 3NWRA 3SDEB 5KFOA 2CQGA 1IJFB 3PYEA 1EKSA 4LF4J 1L3UA 5AT1B 1VQSA 3I31A 4JI1J 1ACMB 4FNHA 2WONA 4P72A 3QMQA 1LWEA 1IR2A 2ALYB 1FE4A 3DLLQ 3U1MA 9RUBA 3BZQA 2EKYA 3DLEA 1T05A 2DH7A 1NKBA 2FY1A 4LQ9A 3BR9A 3OBIA 4PQAA 5F0WA 1JJHA 2CIMA 2VFUA 1RTJB 1N5YA 2V69A 5CYJA 4M5NA 2UXBF 2KXHA 2X7IA 2B3TB 2DRBA 4DR7J 2D3O1 3HHKA 4N5SA 2IJFA 4RW8A 3R27A 1CULB 4BCAA 4UTGA 4X4VA 2A0FB 2VQEF 1S77D 3HM9A 2RE1A 2XY7A 2KVQE 1RDRA 1S4FA 5CYQB 2X3DA 1RLCL 2I38A 4LT6A 1O8BA 5K14A 4HACB 4QIWD 2C3OA 1Z2LA 4AL5A 2L9DA 3FRYA 4JUZA 5K8MA 4FF3A 5IT9Y 1RCXB 1UFLA 3VQSA 3M2RA 5J2NA 4I69A 5I3PA 2ZE2B 4LR7A 5HO4A 2AJ0A 3HMJG 4ID5B 4C97A 3KLGB 1BY9A 5HJXA 1S1XA 2BOPA 1HWLA 1EETB 4ED6A 3M6UA 1SQFA 1QAIA 4JI2F 4FPIA 3MMAA 1IBLF 4R25A 1UFWA 2A2CA 2AZ1A 2B4PA 2ZD1B 4KFBB 2DISA 1C1CB 4ZP6A 4ZLNA 2FIUA 1T8EA 3QAEA 4TU8A 5L39A 2V5HG 3KG0A 4EBEA 4FBTA 4KGZB 1CJUA 2LP4A 2ZDPA 2NUHA 2AEJA 4IFVA 1R8PA 2QLJB 1U25A 4MIWA 4HL9A 1S97A 2XNQA 1S1WA 2EK1A 3BBBA 4F36A 1H72C 1YDLA 3M8YA 2HAIA 3TAMA 2WCXA 1S99A 2NREA 3DRSA 3LA0A 2QLXA 4ZLLA 4V19J 2M9KA 4JOUA 3HULA 1GMVA 3NRBA 4OV1A 1N6QA 2GHPA 3VAJA 2O3DA 1AXQA 2HWHA 1DBDA 2KL8A 1BWVA 4CLKA 1X60A 3NS7B 1TKZA 3W5XA 3HT3A 4F0MA 3TOQA 3ZNJ1 2CNLB 2YNFB 2Z30B 4HYKA 2D3OR 4ECYA 4QWBA 4X4UA 4ZDNA 2YNGA 1F9FA 2OPPA 3MCOA 2XS2A 5KG4A 3R7BB 1MN9A 2LQBA 3V4MA 4Q0BA 1CS4A 4IR9A 2ZH7A 3VAMA 1NPRA 3ZZ0A 2ZHOA 2GMHA 4OHVA 3OSNA 2B8QA 2XSFA 4NZ7A 2PC6A 1U1OA 4J9NA 1NB2A 3IP0A 1WHXA 2J0QD 2M0GB 3CJKA 2OO4A 1NU4A 1TUVA 3TUPA 2APOA 1KLMB 1FD8A 4N8OA 3EX7B 3GFZA 3ULHA 1UL3A 1S6UA 2WVFA 5D0GA 3CT9A 4JI7J 5J2PB 1J2VA 1V5VA 1IKXB 2DO0A 2AYEA 3I6PA 3PKYA 2CADA 3TA0A 5KFSA 2UXCJ 4F2SA 2QLBB 3MECB 3MF5A 3W64A 2HRTA 3CCVS 2B4UA 2R7WA 2ZBIA 4HKQA 1WF0A 3MAHA 3NWGA 1UWAA 2BJ9A 3OTOJ 5HLFB 3CSKA 1IKVB 3EXCX 3MUMP 1RI7A 2IRXA 3BPSP 1DLOB 3TZYA 4ZCLA 2MKSA 4Q2MA 5I3UA 2BM1A 5CZXA 1TMMA 2YWGA 4ILLA 1RWXB 1H38A 4TVAB 1DQAA 2RUGA 2BANA 2DXDA 3AA8A 2V4JB 4PEOA 2M88A 2Y8WA 3TW0A 3QJJA 1QDUB 2H4YB 1RXOB 3TEGA 2QX0A 2F4VJ 2RIJA 3KMQA 3VGUA 3TNVA 3KJVA 3OTEA 4L3NA 1S49A 3AJ1A 5KFLA 1N88A 1RYSA 2N7YA 5BYSA 1C0UB 2Y1RI 4IFYB 5IWAF 1D8YA 3QZ8A 4OIXA 4NEYA 3JB9k 3FNNA 2FHJA 4FKXA 2QSFA 4RNFA 4X4OA 3G71S 2Q6BA 1IBMJ 4IH5A 4RUCA 3CD5A 3D4JA 3VTIA 4R8UB 2I5JA 4S0MA 1QVGR 2XYHB 1Q5VA 2ZUGA 3CCMS 3RBDA 4KKOA 1SUQB 4RW8B 4C8LA 1RBAA 1N8RT 1P27B 2GZOA 2CPJA 5KFQA 4J9RA 5ETVA 3T9NA 5ETPA 1RAIB 2IC3A 1OPIA 2XY5A 2R2UA 4Y65A 1SIZA 5D78A 4F3QA 5F8NA 1OY8A 4DR5J 4ZLPA 1WSRA 2OTLS 2D69A 1ZAWA 2N4DA 1FWPA 5F3TA 4YDXA 5K14B 1Y7PA 2QN6B 4KBIA 4M94A 4PQUA 1MWZA 2P2CB 5H1SV 3HZGA 3A1YG 1KNZA 3MR7A 4R0JA 1JXEA 4DPUA 5E33A 1X4EA 4MK8A 3CJ5A 1RABB 2B9WA 2FVSA 2U2FA 4QW8A 4RW9B 1G4CA 2JLGA 3V81A 1NKEA 1N5SA 3I5CA 4JYAJ 1S1XB 1RT3B 3BB5A 3LANA 2BXJA 1VI7A 2XMJA 3NGTA 1FNOA 1PBAA 3IM8A 2XZWA 3MWBA 1AW0A 1NH8A 3NGUA 2C22A 4G6VB 5KFNA 1B0VA 3NGSA 2XYPB 2XGPA 3PR4A 2LEPA 1GAOA 2YY3A 3DXSX 2ZUAA 4ES3A 4NYPA 5M2PA 3JSBA 2RHSB 3ITHA 4ZPVR 2XCPA 2AGOA 1CJUB 1RT1B 2QYGA 4LF8F 1F0XA 4DV4F 3MPWA 4RWWA 1M5KC 5L9XA 3HJVA 1S1WB 1TL7A 1TUWA 2UUCJ 4ZLJA 1TKXA 4MH8A 1ICEB 4P10A 4RWXA 3KDOA 3OV7A 2XS5A 2ZBPA 3UQSA 1RT7A 1ZAVA 1D0EA 3AJDA 4DV1F 5ETRA 2ZVSA 2KZMA 4ECQA 4J9PA 3DRSB 5DM7Q 1ZZFA 3C14A 4DBQA 3WIVA 3QATA 3MD3A 5DGAA 2QGFB 4DJBA 2EI5A 1YBTA 2FTRA 4ZPTR 3C15A 3I0SA 3MXHP 3DGVA 4LRFA 3GCXP 3MM9A 4Y2CA 1WACA 3FGVA 3UVJB 3SSRA 2AJQA 3MCNA 5F8LA 4ID8A 4Y3CA 2B0GA 3AOBA 1X9SA 1U02A 1X4BA 3PG9A 4OL8A 2XI3A 1UJ6A 2DNYA 4K4VA 3WX4A 4ICLA 3GV8B 3ZNUA 4RW7A 1FDNA 3BGOP 4USVA 4IRCA 3DDIA 4OI6A 4OHWA 5C24B 3T9ZA 1DZ5A 4U7UK 1RTIB 4Q0BB 4C3KA 2XWYA 2MKCA 4RPFA 4CLTA 3QSYB 5A8WB 4DV5J 2ERRA 5T7LB 4U95A 4TYAA 2FJDB 1HARA 3G96A 3CJKB 2CNOB 1TK8A 3GJQB 3SQOP 4EYIB 1LFPA 3CCZA 4N41A 3D68A 1JQGA 2OEJA 3CB4A 4O23A 2O67A 1HHQA 4ERDA 2Z57B 1Q5YA 4KT0C 2CZ4A 2HS3A 3K17A 2EFVA 2H51B 4QQBA 3QJLA 3KUEA 3MEKA 2XMVA 4NYOA 3JSRA 1KTQA 2JH3A 2UUBF 3NNCA 3OQ2A 4C8KA 2Y0SD 2E5IA 1KQFB 5HMYA 2UUAJ 2BX6A 1HBOA 2R7TA 2VG7B 3KFWX 2MQOA 1F3FA 4UOHA 2FJEB 2GVZA 4P74A 3O3LA 2ZOMA 3Q8VA 3G82B 1EQ0A 2EC2A 5G0RB 2HYIB 2JRSA 3CDUA 4YDDB 3KJNB 4K4YA 3MGJA 1JNRB 1JJ2R 2F8HA 3DRPA 2FHOB 1G3OA 2OI2A 3MMJA 2IBOA 4KH1B 4O44A 3PXGa 2CPYA 4DG1B 3W5YA 3ZZTA 4EUVA 3GG0A 1SJRA 3TUJC 1U48A 3ISZA 3FBCA 4ED8A 5GAEI 1T3NA 5HQMA 1WHVA 3W2WB 3NLCA 2V9WA 2WSCC 4YB6A 4LSNB 3PRBA 3B8HA 3ZFVA 2YWKA 3SSQA 1TK0A 2HS0A 5KFIA 4DR2J 4J9OA 3D1QA 1KBRA 2DNPA 2YKMA 3NEKA 1U09A 2VG5A 3KG4A 1EP4B 2FJBB 4KYZA 5IQ6A 3BBFA 4DV6F 3UD4P 5K20B 1YG0A 2IC3B 1R8BA 2E5JA 5ITHA 1YBUA 2DYAA 4OYWA 2C2ZB 3ZZOA 5D15A 1TL3A 2PT0A 4LF5F 2CJAA 2JNJA 3SZ2A 3EVMA 2FPHX 4I67A 3TVZA 3K89A 5AXKA 3QFHA 4YP3A 4O3RA 3FBBA 4FP9A 4C3LA 2DNZA 1YTYA 3CCTA 1TP7A 1W26A 1CEZA 4JI4J 4PUOA 4PG6A 3V81B 4X65J 4NCGB 4OYZA 4AQYF 4W98A 3VGTA 4XPEA 1WC5A 5F9NA 4B3RF 3K7RA 1WG1A 2GIQA 3FBEA 4OV6A 4FN5A 4GC7A 2QFJA 5LXYA 1AUSL 1W2BR 2DIUA 4AUKA 4JI0F 1JLBA 1HA1A 2FGCA 4IRDA 2G0IA 4RU9A 4OHXA 1LEOA 4P52A 2DR9A 5KFVA 3CDWA 4ECTA 2Y9HA 2ILYA 3L3CA 4GKJF 2XS7A 4TY8B 2F8MA 4DCOB 4JBCA 1F1BB 4XTTA 4F4YA 3ITHB 2AZ3A 3C3LA 4J9VA 4DFJA 3E01A 2V0NA 3EM1A 1RK8A 5L1KA 3ILIA 4GVBA 4TYBA 2GO8A 3DRXA 2GS8A 1N56A 1TFYA 3OJUA 1HYSB 5KT3A 5ETNA 2LXIA 3W8PA 2R7RA 5A8RA 1RT7B 4Q45A 1DFDA 4NOHA 3HKWA 3UFCX 2G1DA 3NMRA 3P49B 4HT5A 1I94J 4N47A 3QO9A 2R7UA 2CKWA 3K5LA 2V2KA 1S10A 3FSYA 3I5AA 4DL2A 2YKQA 2VKRA 4O3QA 2H65B 1GQEA 5F8IA 2JEFA 1RT4A 4Y00A 2W24A 2E9RX 3BKFA 3MCMA 2OPSB 1NK7A 3M32B 1WI8A 4RW7B 2DY9A 1HBUA 2FLLA 3CJ4A 2GGPB 3RR7A 1R3NA 2L9NA 1Q7YT 1Y5NB 4CLLA 2UUTA 4F0KA 3EZUA 2ZVIA 1SQGA 5KG7A 4CTAA 2U1AA 4EI2A 1NK0A 3WQPA 3H2UB 4ZP7A 1RCOB 2Y0BB 3SCJE 3LPYA 2HHHJ 4LFBF 1VIOA 3MTKA 1LV5A 1UAWA 3CXCR 2W2PP 3L4BC 4ZPAA 4MK9A 1C4CA 3LALA 1OQ6A 4LFAF 1U2FA 2MQ8A 1J5OA 3CULA 4MTPA 2NPIA 2R7SA 3MAAB 4XAKA 4DL0C 3I0RB 1HW9A 5ETLA 4ANDA 2AD9A 4B3MJ 3D1HA 3KLEB 3FKBA 1QY7A 3HXMA 1QE1A 1FKAF 4JI5F 1TFWA 3R5CA 2KFYA 2KJWA 1XMOJ 3MEEB 5H9EJ 1V9OA 4IG3B 2H5IB 1L3KA 1QSYA 1S1UA 4ALZA 3CJ8A 2WW8A 1R8HA 2MDAA 2QA4S 1F2HA 4QWAA 5JUMA 3GMGA 4YR3A 2QYCA 2KRRA 2V8GA 2ZH5A 5LMUJ 1XEZA 5U47A 3CJQA 5DLFA 2CNNB 2FHKA 2WBRA 4CZCA 4A48A 2GVZB 2ZBRA 3RRHA 1MMDA 4IQMA 3GSIA 3EVWA 4A8WA 2RMLA 2D9OA 4USUA 3MM7B 2NZ4A 4BC7A 4IG0A 4G1QB 3M8SA 4RLEA 1N36F 2E7WA 3IN5A 2XSJB 5L8RC 3JSYA 4X4QA 3F41A 3T41A 3OTDA 4F4ZA 1RBLA 1LW2A 3L7OA 2GW8A 4ZPWR 3HHDA 1FO1A 4OJ3A 3KLIA 1VRUB 3V6DB 4K5SA 1VBZA 2A18A 3LP1A 2G0CA 3IC1A 1C1BA 3TEHB 3JSMB 3HVAA 3BM7A 1HWKA 2BE7D 1UJ5A 5CZVA 3HVTB 4XDDA 4KO0B 4O4GA 3I9ZA 2YKMB 2B5JA 2XMTA 2YNIA 1FK9A 3PIPQ 4PWDA 1CBKA 1MSWD 1SKWA 3QGGA 1U1KA 4NLUA 3RAXA 3ZZUA 3G8TA 1Y00A 3GONA 3OFEA 4I6AA 4B17A 4Q2LA 5KFPA 4KQZA 3SCKE 4PPZA 1Y0HA 1TL3B 4AYBD 3TWZA 4LVOP 3AODA 1Q79A 4BDPA 2HRUA 3G2XA 2BDPA 1GT8A 2CXEA 3D3BJ 2JWNA 2OHDA 5E7OB 1X4GA 3KK2B 3FBFA 3CO9A 2DNMA 2E7XA 4PUOB 1SKUB 4UY85 4DUYJ 2RS2A 3LUYA 3D2WA 5HI7A 1QJHA 2BM0A 2VQFJ 2G0JA 2R7VA 3PW4A 2BYCA 4LFCJ 5KFMA 2KYZA 4KE5A 4NLVA 4CLSA 2E29A 1PC4A 2OPRA 5ETTA 1JLEA 2C1EB 2CPIA 2CPZA 5EUHA 3EICA 5IC4B 2V67A 1X7VA 3G6VA 2BMBA 4DQSA 3KMSA 3CD0A 5KOXA 4CNZA 2V94A 2JL9A 1IVZA 3OLAA 4DDFA 2Q1LA 4OJGA 2JFDA 3LF0A 2YKAA 5A8RB 4B08A 3NY0A 1JWWA 2NLWA 2CJQA 1PJ7A 3OVAA 3N5FA 4ES2A 5C42A 4B9SA 1HPZA 1Q8LA 1WSVA 2XYGB 2LQ8A 4ECZA 3EZ5A 2AJ4A 3G6XA 3D28A 4F3OA 2BKOA 3SEOA 1R7IA 3QIDA 4DL3A 1TELA 4U8YA 4RUAA 1FJGJ 3U1NA 2VG6B 3K2YA 5T41A 4WFAQ 4FDFA 4G1PA 1D3WA 3J81Y 1IN0A 2KT5A 1P9QC 3GSDA 5DDRC 1S9EA 1NSQA 1HBUB 2CPEA 4ANCA 1XBWA 4TXSA 3RB4A 1U8WA 4OQJA 3BGRA 4FPRA 4WP9A 2LFVA 2V2QA 4K0KJ 5BR8F 3BYPA 2E1RA 2GIRA 4M63A 5D4PA 2HHTA 1KP6A 3ONQA 4DUZF 3DLBA 4F7VA 4IO9Q 4KHPJ 4DSKA 2VKZG 2DTJA 4HTIA 3TANA 3KNAA 4X4RA 4WFYA 4MKBA 1JB0C 1S6OA 1SC4B 1UTAA 5E3QA 2AJ1A 2HNYA 2PSZA 4YHHJ 3GWCA 3FZ2A 4J9KA 5HSPA 2R2RA 4RU2A 4TKTA 2DNKA 1N32F 3ZTSA 2F7VA 1D9DA 2H1YA 1NH7A 2CPXA 3OTCA 5JMNA 1FESA 3CIMA 2HFVA 3ZZYA 5IT0A 3F0NA 4EMDA 4NLPA 4QIFA 5AXLA 5MAOA 2DNGA 3UO0A 1T9YA 3KJFB 2D1CA 3KKFA 3HHLD 5HVFA 3MDFA 4YOEA 3I4HX 1TUGB 2EFOA 3NL0A 3LAKA 4P2XA 3MHYA 1S72S 2C2NA 5HBMB 3Q2SC 3KHLA 4Q44A 2CQ1A 1YRUA 1REGX 4XPCA 1S0OA 3P5TL 5CD4A 4ZVUB 2E1CA 1WF1A 5BYQA 3IAM9 5EGYA 1V5IB 4F04B 2HHQA 3ZZPA 1LW2B 1ZA1B 4C48A 5MLCV 3VZHA 2QA1A 3DOMB 1HQ2A 2E5LF 4NA1A 3R6LB 2CJKA 3LP1B 2F9JA 2QO3A 3J81U 2WSFC 4N7TA 4I2QB 2RAQA 3WDOA 1F60B 3R7SB 2GHVC 2HFSA 3TI0A 4KY3A 3I4PA 1WEXA 2R4FA 1EIYB 1EJ7L 4DEZA 3M9NB 2HURA 5BXIA 4OI1A 4UZBA 3DGPB 3LQVA 3D7SB 4P2MA 2CG8A 2HNZB 1RQ0A 2EPIA 2XEXA 1N34J 4PXBA 2V9KA 3M2VA 2DGUA 3ILLA 1KVIA 1VQ8S 5D0EA 1OIAA 5EWEA 1HFEL 1QLNA 4JI8F 3D0HE 1XERA 1SJQA 2QG9B 5L1IA 2VDHA 3H8YA 4AE5A 3NNAA 4L76A 1R0AA 2JX2A 5GADU 4DV7F 3WX8A 4GRSA 5HP1B 4U8VA 4FYVB 2COLA 4N8NA 1RT5B 3RYLA 4F8RA 1C2PA 1BQMA 2IPOB 1FXDA 1Q78A 1WNEA 3LWLA 1UCNA 2W9CB 3MMCA 3PFEA 2MY7A 4IQXA 4L3KA 2OFGX 3T1HJ 1VQ9S 5K5MA 1VGYA 2ATLA 2C2DA 1T11A 1BWEA 3H90A 5CXTA 2OPRB 4ZVFA 4FYWB 3AXMA 4IRKA 2JFKA 4DZDA 1S0MA 2CAJA 5I4MA 3HO1A 2WW4A 1QUPA 3IBWA 4P6QA 1GH8A 4FS2A 3M2UB 2CG4A 5HL7Q 2MY8A 4H4MB 4RR5A 2PA3A 3CJ0A 3PY8A 2BJ1A 2PMZD 4UT4A 1WD6A 3W65A 2YWWA 4LF9F 3R97A 1AZSB 1BHNA 1TTHB 4RO0A 2V4QA 2RRNA 2PIIA 5HAOA 1LWCA 1HPZB 2OIHA 1U45A 5K8NA 1SV5A 3QAUA 4L75A 2ZC3A 3GFHA 1S57A 1IM4A 2XTJP 2CQBA 2I0XA 3UN5A 3JQKA 2UXDJ 2N3OA 1T9WA 1RA6A 1YJ9S 4C8ZA 1FDBA 2GJFA 5B0AA 3H25A 4NLDA 2WVDA 2MQNA 5HVHA 2GC8A 4HVZA 3B78A 3R3TA 4DUTA 4YB1P 1JNZB 2W9BA 3W9IA 3BO2A 2AYBA 3DDNA 1CLFA 1LWFA 1MMNA 1R8CA 1ITPA 3GYXB 2V2VA 1X4HA 4NMLA 4CLWA 4IOBA 1Q95G 1S7HA 5DQGA 4TN2A 1PG5B 3GPAA 1IR0A 2CQ2A 1HNXJ 4ZCKA 4CH7A 8AT1B 3DC2A 1DTTB 1KD1T 2HNYB 2Z56B 1T03A 1JLAA 5CHCB 3R1HA 2JC0A 4OYPA 3F56A 3HKZD 4QBUA 4UOFA 2HEKA 4B3TF 4WZMA 1E6VA 1UA1A 3UN2A 3R2DJ 4X64F 2BKNA 1MMLA 1XJWB 3ZTQA 4TLQA 2RQCA 1FNXH 3HX9A 1QM9A 1TL1A 2Q43A 3HD1A 1XK8A 1K9MT 1LW0A 3KUHA 3PIOQ 4NI2A 2KHCA 1T9VA 3KHGA 4NLWA 4KV8A 1IM6A 2IVMA 3LP2A 2B4VA 1LKZA 2MLZA 2DR5A 3V2UC 3NCPA 4U96A 4ZITA 1HNIB 3HSDA 4AFFA 4ZN3A 2LMIA 3AY0A 3J7A1 3DHWC 1YJWS 5D3GA 4JV5J 9ATCB 2JZ5A 3WBZA 4B02A 3SXLA 3CCSS 4X4TA 1F9EB 3KYLA 1J5EJ 3E51A 1U1MA 2HHXA 3QYYA 1LK7A 3FFIA 5AE2A 2LDIA 1WC1A 3BF4A 2DPJA 3GB0A 4X62J 1RAGB 3N6LA 1SXLA 4MFBB 3W60A 1HWJA 4DR4F 2JJ4D 1F9HA 3PX0A 5GMKa 2DRDA 2V34A 5DG7A 4DSLA 3PYDA 4USKA 5AJ3J 3RU0A 3MM8A 2UP1A 1PJ5A 1U1LA 4J37A 3HVRA 1HNWF 1NZ8A 1V3RA 4I1TA 3ADAC 3VZIA 2OSQA 1K1QA 3MM5B 3VGSA 1X5SA 4QIGA 3DLHA 5FLXU 4NCAA 3CNQP 3AD9C 4USJC 1VQMS 3IA0A 1MROA 3IXQA 1WI6A 2DHXA 5J2MA 2Z2YB 1RJJA 1ELOA 3M2VB 1VYAA 5E3CA 4OZ1A 4RBUA 5GMDA 5DZ6A 2J0SD 3M7VA 2M2BA 1RWOB 3BREA 2HGLA 4UQGA 2KM8C 5GAHU 3IWXA 4DS4A 3DNCA 3S8SA 1HIYA 4ZVQB 3KG1A 4AL7A 2OJ3A 3K5NA 3AJ2A 2H5EA 4U9RA 3VAHA 3J81j 4JI6J 4DPTA 3A8JA 1BQMB 1FX4A 1WTFA 2WVEA 3W61A 1W25A 1D09B 4K4ZA 2ZH3A 2G2ZA 3BGLA 4Y34A 5CYMA 5IM0B 4EFAC 1X4DA 1M0SA 3GG1A 3BDEA 3H7HB 5KFBA 4RW6A 2EK6A 3LP0B 4U7CA 2PD1A 2IM3A 4CO5A 2CZ9A 3POTA 1RHMB 2DHGA 4MK7A 4NLGA 2W4DA 4DV2F 4DX6A 1MW7A 2D9PA 1ZTTA 2UU9J 1HNVA 2AP6A 3TUIC 1JLFB 4ZCMA 1NHVA 3C6UA 2XLJA 3OR2B 2HWTA 2FVQA 3MPDA 5HROB 2FZGB 3SV4A 2GO9A 1KQKA 1RWNB 3O8WA 3T6BA 3TZZA 4LSZB 5AXMA 2GQCA 5J1EB 3PZPA 2VA3A 3FRZA 4LJMA 1YBAA 3GU0A 5IFMA 3BO4A 1UWBA 2CQPA 3PJWA 2Z2LA 1SV5B 3Q86A 4O0NA 3LGMA 3RR8A 3SDEA 5A76A 3TJAA 1VS3A 2DKOB 3H5YA 2QT7A 1PKUA 3M6WA 2CQDA 3S7RA 3HFKA 4QU7A 1ZZNA 3N9UC 3GLJA 1UA0A 1RKJA 4OYIA 4E2FB 2IJRA 2VD3A 4RNHA 7FD1A 1RGVA 2GMJA 3ETOA 1XNRF 1LXNA 4NASA 2O5DA 4X66F 2XWXA 5T14A 2GAGC 1N0VC 1RTJA 3EPIA 1NSKL 4FKYA 4B3TJ 4A47A 2IM1A 3EDRB 3DLJA 2LDYA 3W2VA 1U6FA 4LF4F 4DQPA 1B4SA 2JVRA 1UVLA 4JI1F 3BYRA 3LGHA 1QSSA 5CYQA 2IHR1 2AIRB 3ILJA 4CO3A 1JLAB 4HACA 1WC6A 1OS5A 2F40A 2RU3A 2W7AA 2DH9A 2AWZA 2G2YA 2LQ5A 1HLWA 2NYIA 2QE5A 2DNRA 2Y1LB 2XG8A 1X31C 1VBXA 5DDQC 2ZE2A 3KHHA 1ZTWA 4DR7F 3THVA 5B0GA 3MMBB 3QWPA 1CG2A 2R42A 3EVOA 3KLGA 3NGRA 4GKKJ 2W2MP 2MSTA 4OX9J 1EETA 1CJKB 1FKOB 3NG8A 3ZTOA 4KV8B 1AA1B 1RWMB 3J7AN 4DR4J 1JLCB 2G13A 3OXLA 4FS1A 2HVHA 2VDIA 3CD6S 1N48A 1CQNA 2ZD1A 4DL6A 1YJ7A 4NRUA 4KFBA 4MYUA 1C1CA 2HGNA 1IXKA 3K5MA 2YXLA 1V6HA 4B3SJ 1WC0A 3H40A 2RRBA 5KG0A 5HJYA 3GQCA 2IYIA 5EX3A 4UOCA 5KFEA 1Q8KA 4XIUA 4DL7A 2YWEA 3GFYA 3QZ7A 1IKWB 2IYGA 3RRGA 3FQLA 5E3RA 3PEHA 5DQIA 3K5PA 3C19A 1O5JA 2XO7A 1VMBA 4F0HA 2CWKA 4ED7A 2BE2A 1XNQJ 1R43A 5C25B 4FYXB 4HTJA 4NLYA 2HQ3A 2QMUB 4X84A 3PV8A 5EX0A 4DHVA 3KK1A 1RHQB 2MQPA 4ED0A 2CFXA 1E6YB 2OEMA 4Q5VA 4X4PA 2BJ7A 3VQTA 5H9FJ 2FVCA 3VWSA 1RACB 5AE3A 2DJWA 1M5SA 5KT7A 5THWA 3EGVA 3NKYA 2MB0B 2HK2A 5F8GA 5KFDA 3CVKA 2H48B 3SCIE 4DQIA 4DSEA 5LMNJ 4NLSA 2HKEA 1JKHB 3OUYB 2CVIA 3BR8A 2K8GA 4X4SA 2ZKTA 4DR6J 3T5KA 2DGTA 3CDAA 4DX8H 1REVB 2X1BA 2IA6A 4NCBA 4C3MA 2RD5C 4F26A 3M8RA 3HHLA 5ADZA 4CO0A 1KLMA 2FY8A 2X1AA 1DY3A 1SC1B 2EW9A 3OHBA 4O3SA 4LBHA 1A6LA 1XR7A 1OY6A 2GQ2A 3WIUA 2HQIA 4EZ6A 4DV3J 3QLHA 5J2PA 3JQMA 1BQNB 1I5OB 2NXEA 4ENOA 1RWPB 1IKXA 4ETZA 1DARA 2KB2A 1I3OB 1KRPA 3R5JB 1FVQA 3UN3A 1YK9A 3MECA 1W2IA 4KGMA 1K0TA 4LUBA 4IR1A 3DOLB 2BE9B 3C6UB 3GV5B 2RQ4A 1NJZA 2VONA 3I56S 4ECXA 5HLFA 2R8GA 2QIFA 2DNQA 2HFUA 3OL9A 1DLOA 4ETXA 1TV6B 2AF6A 4DX7A 2FC8A 5HQ8A 2JLFA 3JXOA 2OH2A 4X66J 3T6JA 3US5A 2YQ3A 3V6HA 2NCKL 1MU2B 2RSQA 2Z0GA 2R8JA 3HT0A 2V4JA 4WWSA 1S0VA 2B7BB 1SC3B 2H4WB 2UXCF 1T02A 5KFZA 5CAAA 2DGSA 2JSXA 1QVFR 5LSLA 3UCZP 2JOQA 2ZM6J 4WKRA 4RNNA 1NK6A 4QPXA 3D54A 3OTOF 1C0UA 1SL1A 2O1PA 4IFYA 1Y5LB 3CCLS 3K8VA 2VU5A 4WU3A 1Q16B 1UPMB 3PW7A 4MIAA 4CCHA 3FCHA 2UZAA 1I6JA 5E5NA 3W7BA 2DITA 5B7WA 4R8UA 5B0CA 3H2LA 3IO1A 2NXUA 3MPVA 2MSSA 3CJRA 2XC9A 3W2VB 1KEKA 5KTQA 1SUQA 3PJXA 4BS2A 3KTQA 4DSJA 2YWFA 2Z2MA 2F4VF 4I7FB 1XMQJ 2O01C 3CPWR 1PO6A 2Q3PA 1RE1B 3IRXB 2QV6A 2J7UA 3IRWP 2ASJA 1H98A 3BV8A 3BKTA 3QT8A 5F0UA 3EXYA 2AV5A 2Q66A 2OEKA 4AD6A 4WZQA 3QGPA 2R7OA 2CPFA 1IBKF 5LXRA 4LIWA 3BKUA 2OMOA 2RNEA 1IBMF 1UVNA 2W1BA 4QIVA 1KDNA 1ZA2B 2PO4A 4K2XA 2F3JA 2DT9A 2QC3A 3T3FA 1DRZA 3HHNB 4QW9A 2HQDA 2HNDB 5EHHA 3BO3A 5KG2A 3OHAA 4RW9A 3LH2S 4B3OA 1H7XA 5F8MA 1RT3A 4LBIA 4HI2A 3OSPA 1AFJA 5IZHA 1RP5A 3CUNA 1VC5A 5CA5A 4DR5F 3DHXA 2F4FA 1YZ6A 3CJ2A 5ETOA 1NDLA 2ACYA 3GJSB 2AQ4A 1UVMA 2CPHA 1IBCB 3GJRB 4V1Ak 4TU7A 4B9UA 5DQHA 3BN7A 5EWGA 2KVIA 2N4CA 2MKIA 1RT1A 4WBFA 1HMVB 2L9WA 1F3VA 4X4NA 1A7GE 2NSBA 4DZ6A 3E8OA 3CO0P 1U2RA 1NPPA 2ZWPA 3ZTPA 3TX0A 1RTHA 4JYAF 4DR1J 3T1YJ 1L5UA 4LF7J 3CCQS 5K9FA 3Q8YA 2BE2B 2LA6A 4CM2A 1O0PA 1QUVA 1CJTB 1HI0P 1HBMB 1PIEA 3KK1B 2VPYB 2EBGA 5CABA 3RBXA 4F02A 5LJ5Y 4QU6A 3J7Z5 3UVJA 3JTOA 2J9DA 5CCLA 2ZH1A 2A10A 1VHFA 2UV8G 3A4TA 3QGHA 3GCWP 3ISNC 2UUCF 5KOWA 2YH1A 2BABA 3H2VE 4OI2A 3H20A 4WK3A 4K2JA 5KT5A 3P3DA 1HHTP 1OSCA 1B0PA 3TZWA 2E44A 5C24A 5LL6d 2L41A 1HL6A 3H5XA 2Y1IA 1RTIA 2V4RA 1TAUA 4NWBA 2JLEA 2BA9A 2HZVA 8RUCA 4K4UA 2J7KA 1AB8A 1D8ZA 4WFZA 1S4EA 1MG7A 2MZQA 2DNNA 1BD6A 4Y2AA 5A8WA 2KM8B 5T7LA 4FF1A 2RRAA 1BQXA 1S1TB 4KB7A 4DPYA 4ZVTB 3HHLB 4J5OA 3SI8A 1VRTB 3M8PB 3BSNA 4CO2A 4HH1A 3O1LA 3X1LB 2DXFA 3KWMA 3MUVP 4OI4A 3QLHB 3I55S 3LGNA 2KYXA 1DJ0A 5KG5A 2ZBCA 1X0PA 3EPGA 2RB7A 4DSFA 1AYEA 2IRYA 1FHTA 5IC6B 1VR6A 5A8KA 5KFWA 3CTRA 4OYBA 3SFUA 2BJ3A 3FQKA 4DV5F 5H9EK 3H0PA 4CWBA 5RUBA 1URRA 4W4MA 2GVDB 4EGLA 4MKVA 2N7CA 4A8KA 1PJ6A 2VG7A 3KUGA 5G4DA 1FRMA 1EHWA 3MZIA 4I6YA 4OI3A 2E1PA 1X8DA 4YY3J 3J80Y 5GADI 1RZMA 3MOJB 1YQHA 1YJTA 4CP5A 3I96A 3IG1B 1IJEB 1SH0A 2MMYA 3W1YC 3G82A 4ZMMA 1HR0J 5G0RA 2HSEB 4IDKB 4ZN1A 3MPUB 4B9NA 4GC6A 2YWHA 1H2TZ 1DTQB 3RW6A 4D3GA 2OSRA 4PRFA 3BGUA 1CSJA 3CJTA 1M5VC 3D6MB 5EDWA 4PG4A 4DG1A 4F4WA 2UUAF 5KFUA 4USWA 4DS5A 1L3VA 3IBFB 1C0TA 3UE2A 3W2WA 1FEHA 3BS9A 4DU8A 3D0IE 3CGIA 2MXYA 4LSNA 2YKPA 2HK3A 4RNMA 1IBKJ 1PYSB 3HLUA 2VODA 2VF3A 3QT6A 4NX9A 2VUGA 4L72B 2PE8A 2IM0A 2RDIA 4J91A 1YI2S 2HQCA 1S5ZA 1EP4A 1RHRB 3P8BB 1JXVA 2QFIA 2M8DB 2EBEA 4ZJOA 3T5JA 2YQ0A 3K5OA 1WF2A 1U47A 1HI1A 1S12A 2FJXA 4K59A 1XTZA 2IIHA 3IWNC 2J8SA 2RH3A 3Q8SB 2R2SA 1VFJA 4LRBA 3FVYA 4Y2IA 3WHIA 1UEVA 2AKWB 3AFGA 1NM2A 4ZOSA 3L7UA 4MYTA 2WVCA 2CQ3A 4DR2F 5M2UA 3AOAA 1GMWA 2BJ8A 2FHJD 1ZS6A 3I82A 2NSCA 1QTMA 3PYFA 4M5IA 2V6AA 4B3OB 4NCGA 3QPIA 3CF5Q 1MLAA 1H3DA 1TVRB 4ELUA 5KFXA 2PFDA 5DRKA 2YX7A 4JV1A 4GO7X 3VAIA 1F5AA 2C2MB 4ECVA 2M3DA 1B7FA 3CMAS 1SPBP 4TY8A 2XM3A 3EWGA 2PGCA 1XQIA 2DHAA 4TY9A 1TKTB 1OSDA 4Q43A 3CCUS 2KTQA 1RAJA 3CCWA 3J80U 4JI4F 3CC4S 4PYAA 1YJUA 4WP8A 1WDTA 2QZ8A 2V63A 5KT2A 5KT6A 4X65F 1U1QA 1RTHB 4L6V3 2DVIA 4OZ5A 2KG0A 1HYSA 1OY9A 2ASLA 2DNHA 1UEKA 3Q8UA 5I3QA 2VICA 2JEGA 3UR3C 1WHYA 3ELHA 1TK5A 4F25A 1GTEA 3P96A 4U6PA 4UQTA 4ZPBA 1N33J 4OZ2A 1OO0B 4I56A 4WFXA 3IFEA 1WELA 3AQPA 3DMJA 3Q23A 3PHTA 4C8OA 2OFHX 1NMEB 3IS9B 1UKUA 4OMFG 3QIPA 2EXUA 3SSSA 1KN6A 2M8HA 2MHEA 5ETSA 1O51A 3F44A 1M1HA 3MR5A 3U27A 6FD1A 5B0FA 3MD1A 2FLOA 1P9YA 1RB0A 1OJ4A 2OPSA 2A3JA 3AA9A 3M32A 4YS2A 3ILOA 1N5TA 2GQQA 1SJ4P 4QIEA 3PACA 2GGPA 4B9TA 4ELTA 1I94F 3RB3A 5AE1A 4M95A 4CM0A 1BGXT 3IGVA 1JIHA 4UOGA 2KDOA 4NXNF 3HPOA 2Z8QA 4A4JA 3DRRB 3O2IA 3M4XA 1VIXA 5EN1A 4PABA 2RHQB 5KFGA 2EFQA 3C6TB 1UZHA 3NOCA 3EJMA 2R8HA 3G6YA 4A8MP 2XCAA 2I9SA 1APSA 1AFIA 2ZHAA 4RZRA 4WE1B 3GIMA 1YVFA 3MAAA 1JMTA 3N01A 4HDGA 3I0RA 2C2KB 2ZHBA 4EZ9A 2ZDOA 4H4OB 3D1OA 4Y28C 1UP1A 1ZM2A 3DDKA 4JP8A 3KLEA 1MN7A 2OPQA 3PW5A 2R8KA 4M5DB 1FKPB 3HP6A 1KR4A 3MOZA 3OJSA 2LA4A 2KJVA 3KK3A 2VFRA 1R31A 3MEEA 2DH8A 2HHHF 1XR6A 4IG3A 5A8KB 4KRWA 2QA2A 2PA8D 5IT4A 2B9XA 3EGNA 2W9AA 4DPXA 4GO5X 4WFNQ 4L74A 2CJXB 4I68A 5GAHI 1HD1A 4YQWA 3M30B 2GHWA 4B3MF 5F41A 2OELA 4PXCA 1P1TA 3MM7A 3D6FB 4WU2A 4G1QA 2D3UA 1XMOF 1N4LA 2XSJA 5KFKA 3AOCA 4ZIVA 2IDEA 3A8EA 3ETMA 2EKNA 2NQPA 3D0GE 1OMSA 1FF2A 5LMUF 4RW4A 4EO8A 1S6QB 3IGNA 1VRUA 1S1VB 4GMKA 3V6DA 3DU6A 2D74B 3JTNA 3NP5A 1C0TB 1FEEA 1WHWA 5I42A 3G4SS 3R2CJ 5KFRA 3UDEA 1D9AA 3SBMA 1FD2A 3JSMA 4ECWA 3VGVA 4X2BA 2LKZA 3HVTA 2I1RA 3MTJA 2V8PA 4KO0A 4QZVB 3VF0B 2A1BA 2BRLA 3MR2A 4QYZJ 2HQGA 1VQ6S 1NK4A 4ZVGA 1SJ3P 2CNKB 5GAGU 4NLRA 4NRTA 3PX6A 5M2RA 3QRPA 2DNLA 5D0HA 4ITSA 3L7PA 2QEXS 4ATNA 1TR0A 4MMOA 2P9CA 2VC0A 4DV0J 4KPCA 2HFNA 1KOHA 4HHJA 4HLBA 4WIIA 4M5GA 4ER8A 2F63A 4Y0FA 1M5OC 3V4IB 4U67Q 3RRKA 2QMWA 4ILMA 1U1PA 1VJQA 1NEEA 1CJVB 2F8EX 3G6ES 3KK2A 3K58A 3THPA 1P1LA 4PG7A 2VIHA 1KKHA 1KS2A 1DHMA 4DPWA 2GFFA 1M5HA 4YFUA 3BEGB 2MZ1A 5HN0A 2UVWA 1U6ZA 2XHCA 1JJCB 2WZ1A 1IKYB 1VBKA 2W2OP 1TL4A 3N6MA 1UETA 2M7SA 3Q8QB 1Q7LB 1Q53A 2CJ9A 4FXVA 2DHSA 2Q79A 3N0VA 3PRDA 2MJUA 2FUG9 2HHSA 1RHJB 5DS7A 5KG3A 4ZA1A 1S0NA 2WHOA 3GE9A 2RF2B 2HMIA 2W8LA 5EWFA 4JI3J 1RBOB 3G87A 4DUYF 3RBZA 3ET6B 1FJ7A 2VQFF 4DR3F 5D8HB 2OTJS 3M1VA 4JB8B 4LFCF 1NLKL 5DETA 4W90B 4KJIA 3HZEA 3M8QB 3RTVA 3PEJA 3M9OB 3QT7A 3TA2A 3DMJB 4Y6IA 2CJBA 1B0TA 3JS9A 4DSIA 4NXNJ 5ETMA 3RBEA 2Y1JA 2Y8YA 3QIPB 2VG6A 3OFHA 1WOOA 1LWXA 3PJ9A 2NS1B 2E9ZA 3UCGA 4R5PB 3LO3A 2IBKA 3SIPB 3TJ8A 3ZXWA 3R5DA 1YWXA 2WSEC 1XWLA 3OFFA 1F5BA 1M90T 2W7PA 3B4DA 1URNA 2LEAA 2V8VA 1RAOA 4KGVB 2BZ2A 1KONA 4J9QA 2ZBQA 1GXUA 2LECA 3N28A 3JAMY 1FJGF 2LYVA 1B64A 5ETQA 2N82B 4UY8T 2HAFA 3W63A 3M6XA 2R2TA 3IM9A 5C2GA 2KFZA 2HHUA 4M1KA 2AX1A 2CQCA 4I64A 4HH0A 3I32A 2B8PA 4Z7CA 2RKIA 3WC0A 4D3HA 1T0TV 2HBQB 3DYAB 1NB7A 4K0KF 4NA3A 1PAUB 5LSRA 1B3TA 2YBVA 3C2PA 1S59A 2OPQB 3R5AA 4HT7A 3QGIA 1FRHA 4Q7AA 3KK3B 1O6XA 4C8NA 5L9NA 1J27A 1TL5A 3H4BA 4KHPF 1G1XA 4CH0S 1EQMA 3WZ0A 2B9EA 2HPUA 5HVGA 1Y10A 2RS8A 4J9UE 3QSIA 4B9VA 3AB2B 4CYUB 2KT2A 1NDPA 1UW9A 4YHHF 2UVRA 1Q4RA 4N56A 1JX4A 2C42A 3CE8A 1JLQB 3DM2B 2JEJA 4I4BA 5IOLA 2BOAA 4MKYA 2XI2A 2ZH6A 4LMZA 4O3PA 2NXCA 1TMJA 3PNIA 1FWLA 5HBMA 3H98A 2E5GA 2VFVA 3HSJA 2RILA 3VVTA 2Z58B 2D41A 3D66A 2ZKUA 3CW2C 5DG9A 1HQUB 4RW4B 3OD2A 2CJYB 3OW2R 3LW5C 4PPDA 3DOMA 3SYZA 1HHSA 5I42B 4LF6J 2WK4A 2P6SA 1VRQC 3QWUA 1WKLA 4I2QA 4I0WA 1U49A 4USMA 5HMWA 2UVUA 3KLFB 4ZS6A 1FRLA 2HZCA 2QMXA 1M1GA 1VQKS 2FVPA 1R0BG 3DGPA 4PWWA 3NAHA 3GP9A 2HNZA 4ECRA 1JLGB 2HG4A 1X4FA 2WRMA 1LQ9A 1FXLA 2WB1D 4M5MA 1RISA 5JJBA 1WWHA 3JAMU 3OLBA 2VC1A 4WTYA 3RG6A 1L3SA 3NOGA 1SIWB 4XO0A 3TVYA 1BUXA 4ZVHA 3O44A 2FJWA 2HVDA 2EFNA 3SQGB 3NXZA 3FCWA 5HP1A 1X5TA 4Y2KA 4LF2A 4NXMJ 1RT5A 2ABYA 1WTBA 4CO1A 1DQ8A 1U7LA 1N34F 2AYGA 4BWJA 2DR6A 5IT9U 3B4MA 2W9CA 4DR3J 1T94A 4C4WA 1PCAA 5D6GA 2WOMB 3BH6B 2R7QA 2X3GA 3MM6A 5A0YB 5GMEA 4C98A 5KG1A 2DD8S 2XMWA 4OYAA 2B6AB 3ZC4A 2ILZA 4OJHA 5JVGQ 2IJNA 3UW1A 3W3SA 1KLNA 2DGXA 4BLGA 2BEFA 1AUDA 1NK8A 1ZETA 2V8DA 3M2UA 2HFOA 4C11B 4H4MA 2ASYA 2HMIB 1NPKA 3CDBA 4DN9A 1R6YA 4PXDA 4TLRA 2HBZB 3M1VB 2VASA 4OX6A 1AZSA 3U1LA 3T1HF 2DGVA 1R27B 1V3SA 2C3YA 4HEA9 1X9MA 1H7WA 5CD4H 2C3UA 2X1GA 5L1JA 5J2QB 4LSLA 4JV2A 2IMWP 3FUYA 6AT1B 4DPOA 1RWWB 1X5PA 2W4CA 2UXBJ 3K0JA 5LOQA 1VQLS 5KFYA 2YPYA 2H3EB 1U6BA 2MZTA 2HBRB 2FDNA 2PI5A 2ZH8A 2VQEJ 2RT3A 2WONB 1RTZA 3TJ9A 1MNEA 1LWEB 4K4WA 4MIBA 2BV3A 2HIYA 1NJWA 1KHWA 3DLEB 1T05B 4OLOA 1RTDA 5DLGA 3I87A 2V2ZA 3IR6B 4DLGA 3R8YA 1N5QA 4FXDA 3CJ3A 2FD2A 3QNWB 1N5YB 2W01A 4OLPA 4WK1A 2KRBA 4WF9Q 5L46A 4ILRA 1R8AA 3VAFA 1KVJA 4MKAA 3L95X 3S01A 5JXSA 3DLKA 2ASDA 4Q8FA 4J9LA 1CC8A 2Z4PA 3DU5A 4PAAA 3VAKA 1PILA 3G8SA 2UXDF 1DTTA 1Q81T 3ZZRA 3AH6A 1UVIA 2RKIB 3PM9A 2ZJRQ 4NMXA 2KFNA 2XMKA 4LVNP 2RQKA 8ATCB 4JI2J 5J1NA 1VC6A 3U7JA 5D0RA 1IBLJ 2QRRA 3EYZA 1WDDA 4ZP8A 2WBMA 5E41A 1FJCA 2HHWA 1UMJA 3M2RB 5J2NB 2DGOA 4CLYA 3RB0A 4YMEA 2MLXA 5LJ3Y 5IQQA 1U1NA 2CUYA 1QAYA 2DGWA 2J9DE 1U0SA 2DIVA 2QTWA 1OQ3A 1HNXF 2DHHA 2YTCA 3TAQA 3TX8A 4PCQA 4ZPDA 2K3KA 3M05A 1S48A 1QAXA 1HNIA 3DLGA 4WFBQ 3QJPA 3N6NA 2BACA 1Y3KA 3ENVA 3CCRS 5DJBA 5HMXA 1X4CA 4ZVEA 3MMAB 3DOKA 3HFZB 4ECSA 1GEHA 3KLHA 4DLEA 2LEBA 5F8HA 3D67A 4IOAQ 4DFKA 3X3UA 1VHIA 3DRYA 4IFVB 2DNOA 1R0CB 1K44A 2BVZA 2L3MA 2IY5B 3WC2A 1B70B 4MFBA 1H0HB 2MJNA 3RAQA 2DGQA 4H4KA 4ANEA 1RU2A 4XK8C 5DZ7A 1DQ9A 3NBPA 1FDDA 2BQ3A 3TAMB 3LWMA 3M6VA 4JV5F 3TYTA 4ED5A 2GA7A 5DGBA 3G9CA 1J5EF 1K8AT 2GJIA 2R3VA 1N6QB 3AD8C 4NL5A 3MM5A 3RJMB 2K06A 1FE0A 4CDIA 3GILA 3OTBA 3UCUP 1TKZB 3W9HA 1FX2A 4OHYA 5H9FK 2VB6A 3GIIA 4X62F 2L48A 2HWIA 4DQQA 2GNKA 1CVJA 3UDLA 3M8ZA 4YR0A 1RWKB 2YNGB 2OPPB 3C16A 4LREA 1YX2A 4YB7A 5DM6Q 3DXBA 5AJ3F 3MFIA 4EEYA 1TZ0A 3BSAA 1CS4B 4I2PA 2AU0A 3IR7B 3ICLA 2K2PA 3BSOA 1YZ7A 4LRAA 3MR6A 2HHVA 5E0OA 4P9SA 2EFGA 4LIRA 1VQNS 1VC0A 4OYXA 3GIRA 2ZJPQ 4HDHA 4F2RA 4PXEA 4RL1A 5IM0A 2ACMA 3MURP 1NJYA 2D7SA 2IVYA 2UUWA 2G4BA 1WG5A 1Z2ZA 1B99A 2Q6CA 3RW7A 3V6KA 3LP0A 3MM6B 3SV3A 2MQLA 3SMZA 3FCVA 3IMQJ 5B0BA 4ZJQA 5B0DA 4WP3A 2ZH2A 1ZM3A 1H6KX 2XMAA 2ADBA 2PEHA 1Q8BA 1JLFA 4EYHB 4JI6F 5AXNA 2VBYA 3OR2A 5DG8A 3R9LA 5HROA 5C5JA 1H2UX 1GFWB 3AAWB 5CQGA 5KFTA 2AJFE 5IWAJ 5B09A 2QL9B 1F2GA 5J1EA 1SKSA 4RBTA 5I3UB 2HHPA 4C8YA 2KHDA 4LSLB 3H4DA 3JQJA 3NS5A 2CA9A 4C0OC 2PFFB 1NCLA 2BANB 2UU9F 1NK9A 3A3PB 5IS2A 1XC9A 4EU0A 3UD3P 1WOSA 2QL7B 4KHMA 2CDRB 3T1AA 2K1RA 3KDNA 1ZPWX 1R89A 3PKMA 1RA7A 3KJVB 1NKCA 2YKNA 3DN9A 3BH7B 1B7YB 2IM2A 1Q1KA 3D9BA 4ZIWA 4ZK7M 2B7CB 2ZWOA 5FLXY 1RTDB 2MHNA 1NHUA 3PO5A 1FJEB 2I5JB 1CC7A 1F5CA 2VOPA 2ATCB 2PN6A 3BSCA 2FJVA 3IBCB 3DLKB 4KKOB 1UPPA 4CT9A 2OGUA 1U0HA 4WYLA 3Q2TC 4G3IA 2JVOA 3FZBA 4OFZA 4N76A 1XMBA 4ZJLA 1JJ4A 3BDPA 2VJUA 4DF8A 4RNOA 4NLQA 1NO8A 2ZH9A 3BPDA 1YKWA 3VALA 2HRYA 4FNIA 4PQUB 3R5GA 3QRRA 3ZZZA 3CEDA 1HW8A 4A8XA 2M4MA 1KC8T 3MMBA 1PSDA 4NEZA 2ZOGA 4LF8J 4DV4J 4B9MA 2JDJA 1CJKA 1FKOA 2J6SA 4P7VA 5A6WA 4EBDA 3PDNA 3GV7B 1JLCA 3DLGB 4O3OA 1F6TA 2ZEJA 2E7VA 2MKYA 5KG6A 4KGKA 2MQMA 4DV1J 1RHKB 2RJZA 4LQ3A 1KWMA 1Y3JA 3DOKB 2CWXA 3GZ7A 2J7WA 3MEGA 3KLHB 1EB0A 4ZPCA 1DAXA 2IA0A 4KIAA 3J7YU 3B6BA 5LM7E 4UUWA 2CDQA 1IKWA 4GKKF 1RHUB 2X51A 4OX9F 4ZHRA 3RAMA 3TR5A 4IH6A 1H74A 4NPOA 3Q83A 1TL7B 1WUUA 4P75A 3MCSA 3G86A 2YX4A 1TKXB 2PI4A 1SJ1A 2P8IA 5A6PA 3GJTB 3NBPB 5C25A 1VQPS 2EEYA 2KXFA 2DR8A 4B3SF 3C14B 1NXIA 1E6YA 2VBWA 3E2EA 2OD6A 3C15B 3I0SB 3MM9B 3L09A 3CWJA 4QOTA 1S7IA 3P45B 3QQCD 4M5KA 1IQZA 4YN3B 4WKYA 1S9FA 2AT1B 3VCDA 3GTYX 1WOPA 4ICLB 1S6PA 1FXRA 2MZSA 1XNQF 1TU0B 1IUJA 2YQ1A 2MKHA 2QSWA 3UR0A 3GR0A 3C16B 2PMWA 4C8MA 2IAJA 1JKHA 3PO4A 1LOUA 3OUYA 4KPYA 2XGQA 3Q89A 3V6JA 2XHWA 4I2PB 3PYGA 5IXUA 3HK2A 4RJVA 1AROP 4ZVOB 1REVA 3LPEA 1H2VZ 3HFVA 2UUBJ 1KHVA 2N3LA 1QTNB 2EG2A 2UV8A 3TQEA 4P73A 3MR3A 1FVSA 2B4OA 4AXIA 1EZZB 4PYDA 3AB4B 4RKUC 5LMNF 1BQNA 4KR0B 4WIQA 2DY1A 4TU9A 1NDKA 1FNMA 3TZXA 4AL6A 3K57A 4A8YA 1IWAA 1RAAB 4DR6F 5GAGI 4OZLA 4RUBA 3RZAA 3DOLA 2H5JB 1X4AA 2LXFA 3AQOA 2DEIA 1SC6A 5E3PA 5D4LA 3ZTRA 2ZFHA 4UW2A 3HDSA 3KOAA 1IQTA 4URGA 1TV6A 1SI9A 4RX6A 1HBOB 2AW0A 2OAUA 3EDQB 4DV3F 1VCTA 1YSJA 5HATA 1MU2A 4EWTA 2HZAA 2WAQD 1SH2A 2VL1A 3PRVA 2MKKA 2DXEA 1NAQA 4KC5A 1S9GA 3GIKA 1XIQA 2HGMA 3W9JA 3L9ZA 3I5BA 3ENWA 5KFHA 3JYTA 4AT1B 4H4KC 2AEMA 4LBPA 2K1RB 3DRPB 4IKAA 4DV6J 2V50A 2RQMA 2FGOA 3CMQA 5K8OA 4O44B 1FTCA 4QWDA 4C9DA 2YKNB 1UVKA 4CO4A 1VJWA 3B54A 2CPDA 4ZKAA 4A8QA 1VLYA 1SKRA 2XMMA 2R9LA 1RADB 4LF5J 3EZOA 4IYQA 1VISA 4ED3A 2XZDB 2MKJA 3UNGC 1GTHA 2FLNA 3GYGA 2EWHA 4DWIA 4F67A 1Y4ZB 2VG5B 4F50A 2MLYA 2P9GA 2FVRA 4I7FA 2ZM6F 1VOMA 4UZCA 1U0HB 3IRXA 2FLPA 4OHZA 4AQYJ 1WORA 2H54B 4QJVA 3A8KA 2WTFA 4B3RJ 4QYRA 5D4NA 1T95A 4JI0J 2R8IA 2MZJA 2R7XA 4J9SA 3UWTA 1K0VA 3D3CJ 2J0WA 1LXJA 1KVKA 2KT3A 1OYEA 1WC3A 4GKJJ 4KHRA 4OYOA 4KAIA 5FJ4A 4HI1A 2HNDA 3ISND 2E1AA 2BBEA 2OUGA 3VR1A 4USIA 2DBBA 1XMQF 4OX7A 3CD7A 1VK3A 3H5UA 5FIIA 2EG1A 2K7JA 2NXJA 4ELVA 3CC7S 2DR7A 2AHOB 3UD5A 4V19X 3HI9A 5IV4A 1BE4A 1NJIT 4WYWA 4MT1A 1OYDA 2VZ9A 4DL4A 2X1FA 4F4KA 1JLBB 1NSPA 3UPFA 1HQEA 1UJ4A 3MEDA 2ZZTA 2XBPA 2J9CA 1T7PA 3MEGB 3BQ1A 2DB1A 5KAKA 1HMVA 4LRDA 1FI4A 1HD0A 2NXNA 3O6QA 1KOOA 2G9OA 3R5BA 3E01B 3B82A 2EC0A 4CLUA 1RAEB 4CLFA 4ZHRB 4GVBB 1NBEB 2VBXA 1D1UA 3A13A 2XZTB 3LOUA 1BMQB 2LVWA 3RUBL 3PVXA 2ZH4A 2KN4A 1Q82T 3C8YA 4URSA 1FFWB 4OZ3A 1ROFA 2GX8A 1FCAA 1SBRA 3UDCA 5HQLA 1IR1A 2L08A 1CJTA 3DFEA 4Z2XA 4P71A 3BBCA 1HBMA 3P4UB 2M5YA 3BQ0A 1LFWA 3QO9B 5DDPC 2BR0A 2FZKB 3A8IA 3P6YC 3MFHA 3M8WA 2J9EA 1UVJA 3M9MB 4LFBJ 5LT5A 2CRLA 4QR2A 4DR1F 3T1YF 2LU2A 1RT4B 3KJQB 4LF7F 1GK8A 4LR9A 2AEFA 4LFAJ 3TA1A 1N52B 2ALZA 2HQFA 4CNYA 2A6OA 2JEIA 1S6PB 4DFPA 2IDLA 2RUSA 2CYYA 2W8KA 2XO6A 1VLOA 4CI0B 4IO1A 2IAJB 3FSXA 1X9WA 1EARA 2E66A 4CTAB 1N5VA 3OR1A 2OKQA 5B0EA 4NE9C 4JI5J 4QWEA 3S1TA 1YJRA 1GXTA 1U4BA 2MQQA 1S1TA 5JVHQ 1VQOS 2VBZA 4C2MA 4NZ6A 3NMAA 3FJ2A 2J6UA 1Y11A 2D3ZA 2M70A 1VRTA 3QBCA 4PR6A 3VVUA 2ZITA 2KG1A 3M8PA 3K8WA 2VH7A 1J5OB 3TP2A 1JXLA 1Z1ZA 4FYDA 4DCPB 5KFAA 2B56A 2RVJA 4TQRA 3RB6A 1NRKA 2KXNB 4KGXB 4NLXA 3A12A 2C28A 1QE1B 4K4XA 4GVLA 1T9TA 4MJKA 2ROEA 1U24A 3PR5B 1N36J 2GVDA 7FDRA 3LAMA 2DO4A 1S1UB 1V3ZA 2B51A 3OT9A 2HFZA 3W66A 3HD2A 3NAIA 3A3NB 3H42A 5SUHA 1RYRA 4KSEB 3AHPA 1WKJA 1YITS 2CQIA 4M5JA 4FVCA 3Q22A 1GX6A 1NUEA 3GIJA 3IG1A 4YEAA 1HI8A 2XQCA 3GFXA 2FJAB 4CT8A 5HK4A 3J7ZT 1ZBTA 4IDKA 4ZVRB 3PW2A 2W4PA 1S9GB 1YLXA 4A8FA 1FRJA 1DTQA 2HVIA 4IG0B 2HBYB 5C2CA 3JYTB 5GVQA 4Q8EA 2RDDA 2VOOA 4A8OA 3FDSA 3BQ2A 4DF4A 3H5SA 4OX8A 2GV1A 3KLIB 4K4SA 5FDLA 2HVZA 2W25A 4YY3F 2QLWA 1C1BB 5FD1A 4DMZA 3TUZC 3H59A 1HR0F 5A2QY 2KH9A 4C6AA 1KFDA 4CIOA 4O4GB 3CMES 4FF2A 2DRAA 2B5JB 2YNIB 1FK9B 4PWDB 1FERA 5C7PA 4ES1A 1HNZF 1NSAA 4QYZK 1NJXA 2DCUB 3DI6A 2KKHA 1IWGA 4P2FA 3HSZA 2V68A 3Q0AA 4PKDB 2Y3YA 1UW4A 1L3TA 4MAKA 4A8SA 4DFMA 4LRCA 1W7WA 4C0BA 3IAS9 1PBUA 4J90A 4ZCIA 3RGIA 2VFTA 1HWIA 1EX8A 2BQRA 1RAFB 4E0DA 2VJVA 1TVRA 2A6MA 4Z37A 3Q8PB 4WPAA 5B08A 1UFKA 2C2EA 1NHKL 1PAEX 4ZVPB 5L38A 4WCEQ 3TARA 1WJ9A 5BJRA 4DL5A 1PGZA 2MEWA 1HQEB 3MEDB 2DCLA 4WTOB 3IR5B 1TKTA 1JLEB 3PW0A 1PYTA 5F9LA 4G1IA 2G2OA 3OXFA 4CLPA 2P6TA 4USHA 2LQ9A 1FTRA 4QPTA 3ZO7A 3FEZA 2QLFB 3U02A 2YKOA 3DCAA 1FA0A 2XLIA 2RDJA 1Q8IA 2O66A 2YNHA 4OZNA 3MPYA 4R0EA 5C42B 5BR8J 1FRKA 4H54A 5HANA 4QWCA 3HCXA 4RUHA 2C3MA 2GCFA 1ZYQA 2NYHA 3IS9A 5DDOC 3TVKA 1HKAA 3Q8RB 4L73A 4DUZJ 2AX0A 2DK2A 2BW7A 4YR2A
chains in the Genus database with same CATH topology
1RWXB 2HBZB 2XZDB 2CNNB 1RHKB 1RHQB 5IC4B 1GFWB 3KJQB 1RHMB 2FQQB 3D6MB 1RWKB 3KJFB 4ZVPB 2C2ZB 2Y0BB 4ZVSB 3IBCB 2C2KB 1RWPB 1ICEB 2C2OB 2QL9B 1PYOB 2QL5B 1RWMB 2P2CB 3IBFB 1NMEB 1I3OB 1QDUB 2H4YB 3R5JB 3KJNB 2HBQB 2CNOB 1PAUB 3GJQB 3EDQB 2CJYB 1RHUB 3EDRB 5IC6B 3GJSB 2H54B 1F9EB 1RWOB 1RWNB 1IBCB 1RWWB 3GJRB 2H48B 1SC4B 3R6GB 1RWVB 4ZVOB 2C2MB 3NS7B 2XZTB 3SIPB 1BMQB 2XYGB 4LSZB 2QLFB 4ZVUB 1RHRB 4ZVQB 2QL7B 3GJTB 2HBRB 4ZVRB 1QTNB 2H65B 3R7NB 2CDRB 2CNLB 2QLBB 1RE1B 2CJXB 3D6HB 2HBYB 2H51B 2CNKB 3R6LB 3P4UB 4DCJB 2XYPB 2XYHB 1I51B 3RJMB 1RHJB 2DKOB 2H5IB 3R7BB 1SC3B 2H4WB 3R7SB 4DCPB 2Y1LB 3D6FB 3QNWB 4DCOB 3P45B 4ZVTB 5K20B 1SC1B 2C1EB 2H5JB 2QLJB 4JB8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RWX B;  2HBZ B;  2XZD B;  2CNN B;  1RHK B;  1RHQ B;  5IC4 B;  1GFW B;  3KJQ B;  1RHM B;  2FQQ B;  3D6M B;  1RWK B;  3KJF B;  4ZVP B;  2C2Z B;  2Y0B B;  4ZVS B;  3IBC B;  2C2K B;  1RWP B;  1ICE B;  2C2O B;  2QL9 B;  1PYO B;  2QL5 B;  1RWM B;  2P2C B;  3IBF B;  1NME B;  1I3O B;  1QDU B;  2H4Y B;  3R5J B;  3KJN B;  2HBQ B;  2CNO B;  1PAU B;  3GJQ B;  3EDQ B;  2CJY B;  1RHU B;  3EDR B;  5IC6 B;  3GJS B;  2H54 B;  1F9E B;  1RWO B;  1RWN B;  1IBC B;  1RWW B;  3GJR B;  2H48 B;  1SC4 B;  3R6G B;  1RWV B;  4ZVO B;  2C2M B;  3NS7 B;  2XZT B;  3SIP B;  1BMQ B;  2XYG B;  4LSZ B;  2QLF B;  4ZVU B;  1RHR B;  4ZVQ B;  2QL7 B;  3GJT B;  2HBR B;  4ZVR B;  1QTN B;  2H65 B;  3R7N B;  2CDR B;  2CNL B;  2QLB B;  1RE1 B;  2CJX B;  3D6H B;  2HBY B;  2H51 B;  2CNK B;  3R6L B;  3P4U B;  4DCJ B;  2XYP B;  2XYH B;  1I51 B;  3RJM B;  1RHJ B;  2DKO B;  2H5I B;  3R7B B;  1SC3 B;  2H4W B;  3R7S B;  4DCP B;  2Y1L B;  3D6F B;  3QNW B;  4DCO B;  3P45 B;  4ZVT B;  5K20 B;  1SC1 B;  2C1E B;  2H5J B;  2QLJ B;  4JB8 B; 
#chains in the Genus database with same CATH topology
 4PG5 A;  1S76 D;  2E1M C;  1GNK A;  3EGZ A;  4F4X A;  1VK8 A;  5A2Q U;  5CCM A;  1KQG B;  3NNH A;  4M5H A;  1XR5 A;  3MI7 X;  1S9E B;  4UF4 A;  3N4W A;  2XNR A;  1N33 F;  1YHQ S;  3HHE A;  4ED2 A;  3BGR B;  1SB6 A;  1T3O A;  4P7T A;  2BRK A;  1D9F A;  3AD7 C;  5K8P A;  2Z2Z A;  5ETK A;  1KSP A;  1SL0 A;  1X5O A;  3OVB A;  2KU7 A;  1N32 J;  7AT1 B;  3DRR A;  3OR1 B;  1OPZ A;  2F9D A;  1Y9O A;  1RT6 A;  4QCL A;  4IH7 A;  1TQL A;  3OL6 A;  3C6T A;  4BC9 A;  3GYN A;  4HR2 A;  3D6H B;  1VBY A;  1U8S A;  4G65 A;  1VDH A;  4OI0 A;  4HHU A;  2ZOF A;  1YRX A;  4WE1 A;  4WJB A;  3CCJ S;  2JHE A;  4Z7Y A;  4EBC A;  1NND A;  5BYR A;  4UST A;  3I9V 9;  4ZP9 A;  2CQH A;  2K3I A;  3QFW A;  2OP5 A;  4OZ0 A;  1QD1 A;  1DUR A;  4H4O A;  4IOC Q;  3PX4 A;  1TAQ A;  3UDV A;  5SZT A;  4M5D A;  1SL2 A;  1FKP A;  2QJ3 A;  1RSC A;  2IVF B;  4TNO A;  3CDE A;  5E2Q A;  1U2C A;  2VPX B;  3N79 A;  1HBN A;  2VFS A;  2HIQ A;  4ZVS B;  2NUU G;  1G2E A;  1M1K T;  2GJ2 A;  2LQJ A;  3TO8 A;  4OYM A;  3UI3 A;  4A46 A;  3CIZ A;  2OD4 A;  1EAY C;  2B43 A;  2E9T A;  3M30 A;  3QT5 A;  3KXD A;  1XN9 A;  2W2Q P;  2SXL A;  1RWV B;  1GX5 A;  2HLT A;  2E5L J;  3ENA A;  1SJF A;  1UZD A;  2ROG A;  4FVM A;  1NK5 A;  3PFO A;  2KO1 A;  1X0F A;  4NLO A;  1TKD A;  3NGD A;  1YJN S;  3OFG A;  1T9X A;  4DI6 A;  2P9E A;  2J76 E;  3G8Q A;  2MGZ A;  2XUL A;  1QAJ A;  1HNZ J;  3O5T B;  3TAP A;  1RWU A;  2P5V A;  1RT2 A;  1S6Q A;  2E5H A;  1S1V A;  4C7Q A;  1WEY A;  3EUN A;  2JC1 A;  1OWX A;  2FC9 A;  1FWK A;  3A3O B;  1NDC A;  3NS6 A;  3PCO B;  5FDL B;  2G1H A;  4JI8 J;  1VQY A;  3IWL A;  4C0H A;  2GAH C;  4DX5 A;  2XMU A;  1RLD A;  2LCW A;  2VA2 A;  4N77 A;  2W7O A;  3HF5 A;  4K8R A;  1T9U A;  2MZR A;  4DV7 J;  3D6T B;  2F5G A;  6FDR A;  5DO2 A;  3N5B A;  4WXO A;  2ZC4 A;  5LSO A;  3TRG A;  3SCL E;  3V5R A;  3DI6 B;  4UUX A;  1SQE A;  4NYZ A;  2ZZN A;  4FF4 A;  4AXJ A;  1RKI A;  4DU7 A;  4PG8 A;  5KFC A;  2FYX A;  4O4R A;  1KFS A;  1ULR A;  1CQM A;  3QRQ A;  3OL7 A;  2EVZ A;  4RBV A;  2C2R A;  2CZV C;  3V4I A;  1N0U A;  1I51 B;  1RAH B;  1YIJ S;  5F3Z A;  1ZM4 A;  4OZJ A;  1CJV A;  3VV2 B;  3C46 A;  3OXG A;  4F3M A;  1R6V A;  3HHL C;  1R0A B;  4QR0 A;  3KHR A;  4NA2 A;  4TQS A;  2A2D A;  1M5P C;  4P2S A;  3KLV A;  1FFS B;  1FRI A;  2XY6 A;  4EK2 A;  1LNQ A;  3NCQ A;  3MMC B;  2C2O B;  2HW3 A;  2J0X A;  5CH7 B;  2FHM A;  4LF9 J;  3OL8 A;  3MAQ A;  4DV0 F;  1IKY A;  2OML A;  3CJS A;  4OJ1 A;  4FZV A;  1G7C B;  1Z4U A;  4DQR A;  5GAE U;  3THT A;  4KH0 B;  1P6T A;  3SFG A;  3NGK A;  4CH1 A;  3EGW B;  2BJE A;  2YPZ A;  4DN0 A;  2RF2 A;  2BKP A;  1GMW D;  4J9M A;  2B9Y A;  1JK9 B;  3ET6 A;  2NZC A;  4DXL A;  3GR1 A;  2XLK A;  2I2Y A;  4PZV A;  1K1S A;  4DCJ B;  3M8Q A;  1Q0N A;  2YNH B;  1PC5 A;  4K4T A;  2F1F A;  1C4A A;  2MYF A;  3FEX B;  4E8U A;  1LWC B;  2J6T A;  3HVW A;  2RU9 A;  4BHQ A;  1U26 A;  2DPI A;  4ED1 A;  2ROP A;  4XDC A;  1LK5 A;  3FC9 A;  1ZAX A;  4R5P A;  2BUN A;  1UEU A;  1VQ4 S;  3P5B P;  2XB2 D;  5KFJ A;  4JI3 F;  2KI2 A;  1FRX A;  2MTL A;  4WXW A;  3T19 A;  4LR8 A;  1FFG B;  1ZPV A;  2AJ2 A;  2FZC B;  3J7Y I;  3LTO A;  1P8G A;  3Q24 A;  3FEY B;  2W9B B;  2OLW A;  2V8H A;  4E98 A;  1RUS A;  3R7N B;  1LWF B;  4X64 J;  2HVE A;  1RT6 B;  4DOZ A;  3BN4 A;  1A0O B;  1CUL A;  1H73 A;  5F8J A;  2PEB A;  4O3N A;  3R1L A;  3BGF A;  5L1L A;  2CQ0 A;  3JTP A;  2VPZ B;  4K50 A;  2POK A;  3DYA A;  3UNY A;  3VAG A;  1T03 B;  3HJF A;  3PHE A;  1AT1 B;  2H9Z A;  2C3P A;  4O0I A;  1WEZ A;  2VPW B;  2I8E A;  4LF1 A;  1E6V B;  2ZJQ Q;  2CQ4 A;  2ADC A;  1HBN B;  2PMH A;  1N54 B;  1ZOT A;  1PYO B;  1MWY A;  2BJD A;  2ZNZ A;  4CRJ A;  1CPZ A;  2HLU A;  3FSI A;  4ID5 A;  3OPK A;  1Q86 T;  1G6B A;  1TL1 B;  1FT8 A;  3FMW A;  3CCE S;  4W92 B;  1LW0 B;  1WC4 A;  4NI2 B;  4CYU A;  2YX1 A;  3LP2 B;  3K59 A;  2UVV A;  1JLQ A;  2HS4 A;  2PDA A;  3DM2 A;  1GXL A;  5J1P A;  4YB5 A;  1SVD A;  3FK4 A;  2GIF A;  4ECU A;  4URQ U;  1FDA A;  1S79 A;  5D3G B;  1BXN A;  2AGP A;  4U7U D;  1HNW J;  2MPU A;  2K7K A;  3CC2 S;  2J8A A;  2MGZ B;  2DEJ A;  2AMC B;  1KQS R;  3FFI B;  3EE3 A;  3FMB A;  1HQU A;  1RT2 B;  3HSG A;  4BBY A;  1NZA A;  1VQ7 S;  5KFF A;  3F73 A;  2IFX A;  4KTQ A;  1K73 T;  4M5L A;  4PWU A;  3NCR A;  1ZH5 A;  1ZM9 A;  1VQ5 S;  1WG4 A;  1A9N B;  3C66 A;  3KLF A;  2AYM A;  1WKK A;  3MM8 B;  2IRU A;  4HHH A;  3ENQ A;  2J5A A;  1Y5I B;  4M8L A;  2EFP A;  5D4O A;  3T5H A;  3E3X A;  2NPF A;  1YGY A;  2VHG A;  1MWQ A;  1JLG A;  2AGQ A;  1QSL A;  4I6W A;  4EO6 A;  2IMO A;  2YNF A;  1MRO B;  5J2M B;  2WB4 A;  2VV5 A;  2YH0 A;  5KT4 A;  4CLZ A;  2LU1 A;  3W62 A;  2KZZ A;  2WVB A;  4LF6 F;  4F4A A;  4B9L A;  1SCJ B;  5HMZ A;  2LXU A;  3SQG A;  1SH3 A;  1K47 A;  1RU1 A;  4BWM A;  3EMT A;  4DV2 J;  2CVE A;  4ED4 A;  3PTW A;  3VHQ A;  2W2N P;  4FXW A;  2I6W A;  4FBU A;  1EKR A;  1YRT A;  2GML A;  3MUT P;  2QA4 G;  4J7C A;  5E3A A;  2M52 A;  5IV3 A;  2FQQ B;  3AT1 B;  3KNG A;  4YUD A;  1U1R A;  1BC6 A;  5CYM B;  3S6E A;  2ZZM A;  3BJY A;  2WOM A;  2QL5 B;  2LLZ A;  3T5L A;  4FYY B;  5A0Y A;  1YJV A;  4RW6 B;  4Y2M A;  2B6A A;  2FB0 A;  2NR0 A;  3DKD A;  3POT B;  3R6G B;  3D5M A;  4IUF A;  4NXM F;  5D77 A;  1HNV B;  4C11 A;  4JV0 A;  2BQU A;  4QR1 A;  4NLT A;  4CQ1 A;  4NZ0 A;  1BLU A;  1KTV A;  3AXK A;  4K7Q A;  1IKV A;  2ZNY A;  3TQ1 A;  2BW2 A;  1GMU A;  1XNR J;  4JI7 F;  5J2Q A;  1I1G A;  2YVS A;  2F65 A;  1HWU A;  3W8G A;  1UWB B;  4K5R A;  3OVS A;  3W5Z A;  3NWR A;  3SDE B;  5KFO A;  2CQG A;  1IJF B;  3PYE A;  1EKS A;  4LF4 J;  1L3U A;  5AT1 B;  1VQS A;  3I31 A;  4JI1 J;  1ACM B;  4FNH A;  2WON A;  4P72 A;  3QMQ A;  1LWE A;  1IR2 A;  2ALY B;  1FE4 A;  3DLL Q;  3U1M A;  9RUB A;  3BZQ A;  2EKY A;  3DLE A;  1T05 A;  2DH7 A;  1NKB A;  2FY1 A;  4LQ9 A;  3BR9 A;  3OBI A;  4PQA A;  5F0W A;  1JJH A;  2CIM A;  2VFU A;  1RTJ B;  1N5Y A;  2V69 A;  5CYJ A;  4M5N A;  2UXB F;  2KXH A;  2X7I A;  2B3T B;  2DRB A;  4DR7 J;  2D3O 1;  3HHK A;  4N5S A;  2IJF A;  4RW8 A;  3R27 A;  1CUL B;  4BCA A;  4UTG A;  4X4V A;  2A0F B;  2VQE F;  1S77 D;  3HM9 A;  2RE1 A;  2XY7 A;  2KVQ E;  1RDR A;  1S4F A;  5CYQ B;  2X3D A;  1RLC L;  2I38 A;  4LT6 A;  1O8B A;  5K14 A;  4HAC B;  4QIW D;  2C3O A;  1Z2L A;  4AL5 A;  2L9D A;  3FRY A;  4JUZ A;  5K8M A;  4FF3 A;  5IT9 Y;  1RCX B;  1UFL A;  3VQS A;  3M2R A;  5J2N A;  4I69 A;  5I3P A;  2ZE2 B;  4LR7 A;  5HO4 A;  2AJ0 A;  3HMJ G;  4ID5 B;  4C97 A;  3KLG B;  1BY9 A;  5HJX A;  1S1X A;  2BOP A;  1HWL A;  1EET B;  4ED6 A;  3M6U A;  1SQF A;  1QAI A;  4JI2 F;  4FPI A;  3MMA A;  1IBL F;  4R25 A;  1UFW A;  2A2C A;  2AZ1 A;  2B4P A;  2ZD1 B;  4KFB B;  2DIS A;  1C1C B;  4ZP6 A;  4ZLN A;  2FIU A;  1T8E A;  3QAE A;  4TU8 A;  5L39 A;  2V5H G;  3KG0 A;  4EBE A;  4FBT A;  4KGZ B;  1CJU A;  2LP4 A;  2ZDP A;  2NUH A;  2AEJ A;  4IFV A;  1R8P A;  2QLJ B;  1U25 A;  4MIW A;  4HL9 A;  1S97 A;  2XNQ A;  1S1W A;  2EK1 A;  3BBB A;  4F36 A;  1H72 C;  1YDL A;  3M8Y A;  2HAI A;  3TAM A;  2WCX A;  1S99 A;  2NRE A;  3DRS A;  3LA0 A;  2QLX A;  4ZLL A;  4V19 J;  2M9K A;  4JOU A;  3HUL A;  1GMV A;  3NRB A;  4OV1 A;  1N6Q A;  2GHP A;  3VAJ A;  2O3D A;  1AXQ A;  2HWH A;  1DBD A;  2KL8 A;  1BWV A;  4CLK A;  1X60 A;  3NS7 B;  1TKZ A;  3W5X A;  3HT3 A;  4F0M A;  3TOQ A;  3ZNJ 1;  2CNL B;  2YNF B;  2Z30 B;  4HYK A;  2D3O R;  4ECY A;  4QWB A;  4X4U A;  4ZDN A;  2YNG A;  1F9F A;  2OPP A;  3MCO A;  2XS2 A;  5KG4 A;  3R7B B;  1MN9 A;  2LQB A;  3V4M A;  4Q0B A;  1CS4 A;  4IR9 A;  2ZH7 A;  3VAM A;  1NPR A;  3ZZ0 A;  2ZHO A;  2GMH A;  4OHV A;  3OSN A;  2B8Q A;  2XSF A;  4NZ7 A;  2PC6 A;  1U1O A;  4J9N A;  1NB2 A;  3IP0 A;  1WHX A;  2J0Q D;  2M0G B;  3CJK A;  2OO4 A;  1NU4 A;  1TUV A;  3TUP A;  2APO A;  1KLM B;  1FD8 A;  4N8O A;  3EX7 B;  3GFZ A;  3ULH A;  1UL3 A;  1S6U A;  2WVF A;  5D0G A;  3CT9 A;  4JI7 J;  5J2P B;  1J2V A;  1V5V A;  1IKX B;  2DO0 A;  2AYE A;  3I6P A;  3PKY A;  2CAD A;  3TA0 A;  5KFS A;  2UXC J;  4F2S A;  2QLB B;  3MEC B;  3MF5 A;  3W64 A;  2HRT A;  3CCV S;  2B4U A;  2R7W A;  2ZBI A;  4HKQ A;  1WF0 A;  3MAH A;  3NWG A;  1UWA A;  2BJ9 A;  3OTO J;  5HLF B;  3CSK A;  1IKV B;  3EXC X;  3MUM P;  1RI7 A;  2IRX A;  3BPS P;  1DLO B;  3TZY A;  4ZCL A;  2MKS A;  4Q2M A;  5I3U A;  2BM1 A;  5CZX A;  1TMM A;  2YWG A;  4ILL A;  1RWX B;  1H38 A;  4TVA B;  1DQA A;  2RUG A;  2BAN A;  2DXD A;  3AA8 A;  2V4J B;  4PEO A;  2M88 A;  2Y8W A;  3TW0 A;  3QJJ A;  1QDU B;  2H4Y B;  1RXO B;  3TEG A;  2QX0 A;  2F4V J;  2RIJ A;  3KMQ A;  3VGU A;  3TNV A;  3KJV A;  3OTE A;  4L3N A;  1S49 A;  3AJ1 A;  5KFL A;  1N88 A;  1RYS A;  2N7Y A;  5BYS A;  1C0U B;  2Y1R I;  4IFY B;  5IWA F;  1D8Y A;  3QZ8 A;  4OIX A;  4NEY A;  3JB9 k;  3FNN A;  2FHJ A;  4FKX A;  2QSF A;  4RNF A;  4X4O A;  3G71 S;  2Q6B A;  1IBM J;  4IH5 A;  4RUC A;  3CD5 A;  3D4J A;  3VTI A;  4R8U B;  2I5J A;  4S0M A;  1QVG R;  2XYH B;  1Q5V A;  2ZUG A;  3CCM S;  3RBD A;  4KKO A;  1SUQ B;  4RW8 B;  4C8L A;  1RBA A;  1N8R T;  1P27 B;  2GZO A;  2CPJ A;  5KFQ A;  4J9R A;  5ETV A;  3T9N A;  5ETP A;  1RAI B;  2IC3 A;  1OPI A;  2XY5 A;  2R2U A;  4Y65 A;  1SIZ A;  5D78 A;  4F3Q A;  5F8N A;  1OY8 A;  4DR5 J;  4ZLP A;  1WSR A;  2OTL S;  2D69 A;  1ZAW A;  2N4D A;  1FWP A;  5F3T A;  4YDX A;  5K14 B;  1Y7P A;  2QN6 B;  4KBI A;  4M94 A;  4PQU A;  1MWZ A;  2P2C B;  5H1S V;  3HZG A;  3A1Y G;  1KNZ A;  3MR7 A;  4R0J A;  1JXE A;  4DPU A;  5E33 A;  1X4E A;  4MK8 A;  3CJ5 A;  1RAB B;  2B9W A;  2FVS A;  2U2F A;  4QW8 A;  4RW9 B;  1G4C A;  2JLG A;  3V81 A;  1NKE A;  1N5S A;  3I5C A;  4JYA J;  1S1X B;  1RT3 B;  3BB5 A;  3LAN A;  2BXJ A;  1VI7 A;  2XMJ A;  3NGT A;  1FNO A;  1PBA A;  3IM8 A;  2XZW A;  3MWB A;  1AW0 A;  1NH8 A;  3NGU A;  2C22 A;  4G6V B;  5KFN A;  1B0V A;  3NGS A;  2XYP B;  2XGP A;  3PR4 A;  2LEP A;  1GAO A;  2YY3 A;  3DXS X;  2ZUA A;  4ES3 A;  4NYP A;  5M2P A;  3JSB A;  2RHS B;  3ITH A;  4ZPV R;  2XCP A;  2AGO A;  1CJU B;  1RT1 B;  2QYG A;  4LF8 F;  1F0X A;  4DV4 F;  3MPW A;  4RWW A;  1M5K C;  5L9X A;  3HJV A;  1S1W B;  1TL7 A;  1TUW A;  2UUC J;  4ZLJ A;  1TKX A;  4MH8 A;  1ICE B;  4P10 A;  4RWX A;  3KDO A;  3OV7 A;  2XS5 A;  2ZBP A;  3UQS A;  1RT7 A;  1ZAV A;  1D0E A;  3AJD A;  4DV1 F;  5ETR A;  2ZVS A;  2KZM A;  4ECQ A;  4J9P A;  3DRS B;  5DM7 Q;  1ZZF A;  3C14 A;  4DBQ A;  3WIV A;  3QAT A;  3MD3 A;  5DGA A;  2QGF B;  4DJB A;  2EI5 A;  1YBT A;  2FTR A;  4ZPT R;  3C15 A;  3I0S A;  3MXH P;  3DGV A;  4LRF A;  3GCX P;  3MM9 A;  4Y2C A;  1WAC A;  3FGV A;  3UVJ B;  3SSR A;  2AJQ A;  3MCN A;  5F8L A;  4ID8 A;  4Y3C A;  2B0G A;  3AOB A;  1X9S A;  1U02 A;  1X4B A;  3PG9 A;  4OL8 A;  2XI3 A;  1UJ6 A;  2DNY A;  4K4V A;  3WX4 A;  4ICL A;  3GV8 B;  3ZNU A;  4RW7 A;  1FDN A;  3BGO P;  4USV A;  4IRC A;  3DDI A;  4OI6 A;  4OHW A;  5C24 B;  3T9Z A;  1DZ5 A;  4U7U K;  1RTI B;  4Q0B B;  4C3K A;  2XWY A;  2MKC A;  4RPF A;  4CLT A;  3QSY B;  5A8W B;  4DV5 J;  2ERR A;  5T7L B;  4U95 A;  4TYA A;  2FJD B;  1HAR A;  3G96 A;  3CJK B;  2CNO B;  1TK8 A;  3GJQ B;  3SQO P;  4EYI B;  1LFP A;  3CCZ A;  4N41 A;  3D68 A;  1JQG A;  2OEJ A;  3CB4 A;  4O23 A;  2O67 A;  1HHQ A;  4ERD A;  2Z57 B;  1Q5Y A;  4KT0 C;  2CZ4 A;  2HS3 A;  3K17 A;  2EFV A;  2H51 B;  4QQB A;  3QJL A;  3KUE A;  3MEK A;  2XMV A;  4NYO A;  3JSR A;  1KTQ A;  2JH3 A;  2UUB F;  3NNC A;  3OQ2 A;  4C8K A;  2Y0S D;  2E5I A;  1KQF B;  5HMY A;  2UUA J;  2BX6 A;  1HBO A;  2R7T A;  2VG7 B;  3KFW X;  2MQO A;  1F3F A;  4UOH A;  2FJE B;  2GVZ A;  4P74 A;  3O3L A;  2ZOM A;  3Q8V A;  3G82 B;  1EQ0 A;  2EC2 A;  5G0R B;  2HYI B;  2JRS A;  3CDU A;  4YDD B;  3KJN B;  4K4Y A;  3MGJ A;  1JNR B;  1JJ2 R;  2F8H A;  3DRP A;  2FHO B;  1G3O A;  2OI2 A;  3MMJ A;  2IBO A;  4KH1 B;  4O44 A;  3PXG a;  2CPY A;  4DG1 B;  3W5Y A;  3ZZT A;  4EUV A;  3GG0 A;  1SJR A;  3TUJ C;  1U48 A;  3ISZ A;  3FBC A;  4ED8 A;  5GAE I;  1T3N A;  5HQM A;  1WHV A;  3W2W B;  3NLC A;  2V9W A;  2WSC C;  4YB6 A;  4LSN B;  3PRB A;  3B8H A;  3ZFV A;  2YWK A;  3SSQ A;  1TK0 A;  2HS0 A;  5KFI A;  4DR2 J;  4J9O A;  3D1Q A;  1KBR A;  2DNP A;  2YKM A;  3NEK A;  1U09 A;  2VG5 A;  3KG4 A;  1EP4 B;  2FJB B;  4KYZ A;  5IQ6 A;  3BBF A;  4DV6 F;  3UD4 P;  5K20 B;  1YG0 A;  2IC3 B;  1R8B A;  2E5J A;  5ITH A;  1YBU A;  2DYA A;  4OYW A;  2C2Z B;  3ZZO A;  5D15 A;  1TL3 A;  2PT0 A;  4LF5 F;  2CJA A;  2JNJ A;  3SZ2 A;  3EVM A;  2FPH X;  4I67 A;  3TVZ A;  3K89 A;  5AXK A;  3QFH A;  4YP3 A;  4O3R A;  3FBB A;  4FP9 A;  4C3L A;  2DNZ A;  1YTY A;  3CCT A;  1TP7 A;  1W26 A;  1CEZ A;  4JI4 J;  4PUO A;  4PG6 A;  3V81 B;  4X65 J;  4NCG B;  4OYZ A;  4AQY F;  4W98 A;  3VGT A;  4XPE A;  1WC5 A;  5F9N A;  4B3R F;  3K7R A;  1WG1 A;  2GIQ A;  3FBE A;  4OV6 A;  4FN5 A;  4GC7 A;  2QFJ A;  5LXY A;  1AUS L;  1W2B R;  2DIU A;  4AUK A;  4JI0 F;  1JLB A;  1HA1 A;  2FGC A;  4IRD A;  2G0I A;  4RU9 A;  4OHX A;  1LEO A;  4P52 A;  2DR9 A;  5KFV A;  3CDW A;  4ECT A;  2Y9H A;  2ILY A;  3L3C A;  4GKJ F;  2XS7 A;  4TY8 B;  2F8M A;  4DCO B;  4JBC A;  1F1B B;  4XTT A;  4F4Y A;  3ITH B;  2AZ3 A;  3C3L A;  4J9V A;  4DFJ A;  3E01 A;  2V0N A;  3EM1 A;  1RK8 A;  5L1K A;  3ILI A;  4GVB A;  4TYB A;  2GO8 A;  3DRX A;  2GS8 A;  1N56 A;  1TFY A;  3OJU A;  1HYS B;  5KT3 A;  5ETN A;  2LXI A;  3W8P A;  2R7R A;  5A8R A;  1RT7 B;  4Q45 A;  1DFD A;  4NOH A;  3HKW A;  3UFC X;  2G1D A;  3NMR A;  3P49 B;  4HT5 A;  1I94 J;  4N47 A;  3QO9 A;  2R7U A;  2CKW A;  3K5L A;  2V2K A;  1S10 A;  3FSY A;  3I5A A;  4DL2 A;  2YKQ A;  2VKR A;  4O3Q A;  2H65 B;  1GQE A;  5F8I A;  2JEF A;  1RT4 A;  4Y00 A;  2W24 A;  2E9R X;  3BKF A;  3MCM A;  2OPS B;  1NK7 A;  3M32 B;  1WI8 A;  4RW7 B;  2DY9 A;  1HBU A;  2FLL A;  3CJ4 A;  2GGP B;  3RR7 A;  1R3N A;  2L9N A;  1Q7Y T;  1Y5N B;  4CLL A;  2UUT A;  4F0K A;  3EZU A;  2ZVI A;  1SQG A;  5KG7 A;  4CTA A;  2U1A A;  4EI2 A;  1NK0 A;  3WQP A;  3H2U B;  4ZP7 A;  1RCO B;  2Y0B B;  3SCJ E;  3LPY A;  2HHH J;  4LFB F;  1VIO A;  3MTK A;  1LV5 A;  1UAW A;  3CXC R;  2W2P P;  3L4B C;  4ZPA A;  4MK9 A;  1C4C A;  3LAL A;  1OQ6 A;  4LFA F;  1U2F A;  2MQ8 A;  1J5O A;  3CUL A;  4MTP A;  2NPI A;  2R7S A;  3MAA B;  4XAK A;  4DL0 C;  3I0R B;  1HW9 A;  5ETL A;  4AND A;  2AD9 A;  4B3M J;  3D1H A;  3KLE B;  3FKB A;  1QY7 A;  3HXM A;  1QE1 A;  1FKA F;  4JI5 F;  1TFW A;  3R5C A;  2KFY A;  2KJW A;  1XMO J;  3MEE B;  5H9E J;  1V9O A;  4IG3 B;  2H5I B;  1L3K A;  1QSY A;  1S1U A;  4ALZ A;  3CJ8 A;  2WW8 A;  1R8H A;  2MDA A;  2QA4 S;  1F2H A;  4QWA A;  5JUM A;  3GMG A;  4YR3 A;  2QYC A;  2KRR A;  2V8G A;  2ZH5 A;  5LMU J;  1XEZ A;  5U47 A;  3CJQ A;  5DLF A;  2CNN B;  2FHK A;  2WBR A;  4CZC A;  4A48 A;  2GVZ B;  2ZBR A;  3RRH A;  1MMD A;  4IQM A;  3GSI A;  3EVW A;  4A8W A;  2RML A;  2D9O A;  4USU A;  3MM7 B;  2NZ4 A;  4BC7 A;  4IG0 A;  4G1Q B;  3M8S A;  4RLE A;  1N36 F;  2E7W A;  3IN5 A;  2XSJ B;  5L8R C;  3JSY A;  4X4Q A;  3F41 A;  3T41 A;  3OTD A;  4F4Z A;  1RBL A;  1LW2 A;  3L7O A;  2GW8 A;  4ZPW R;  3HHD A;  1FO1 A;  4OJ3 A;  3KLI A;  1VRU B;  3V6D B;  4K5S A;  1VBZ A;  2A18 A;  3LP1 A;  2G0C A;  3IC1 A;  1C1B A;  3TEH B;  3JSM B;  3HVA A;  3BM7 A;  1HWK A;  2BE7 D;  1UJ5 A;  5CZV A;  3HVT B;  4XDD A;  4KO0 B;  4O4G A;  3I9Z A;  2YKM B;  2B5J A;  2XMT A;  2YNI A;  1FK9 A;  3PIP Q;  4PWD A;  1CBK A;  1MSW D;  1SKW A;  3QGG A;  1U1K A;  4NLU A;  3RAX A;  3ZZU A;  3G8T A;  1Y00 A;  3GON A;  3OFE A;  4I6A A;  4B17 A;  4Q2L A;  5KFP A;  4KQZ A;  3SCK E;  4PPZ A;  1Y0H A;  1TL3 B;  4AYB D;  3TWZ A;  4LVO P;  3AOD A;  1Q79 A;  4BDP A;  2HRU A;  3G2X A;  2BDP A;  1GT8 A;  2CXE A;  3D3B J;  2JWN A;  2OHD A;  5E7O B;  1X4G A;  3KK2 B;  3FBF A;  3CO9 A;  2DNM A;  2E7X A;  4PUO B;  1SKU B;  4UY8 5;  4DUY J;  2RS2 A;  3LUY A;  3D2W A;  5HI7 A;  1QJH A;  2BM0 A;  2VQF J;  2G0J A;  2R7V A;  3PW4 A;  2BYC A;  4LFC J;  5KFM A;  2KYZ A;  4KE5 A;  4NLV A;  4CLS A;  2E29 A;  1PC4 A;  2OPR A;  5ETT A;  1JLE A;  2C1E B;  2CPI A;  2CPZ A;  5EUH A;  3EIC A;  5IC4 B;  2V67 A;  1X7V A;  3G6V A;  2BMB A;  4DQS A;  3KMS A;  3CD0 A;  5KOX A;  4CNZ A;  2V94 A;  2JL9 A;  1IVZ A;  3OLA A;  4DDF A;  2Q1L A;  4OJG A;  2JFD A;  3LF0 A;  2YKA A;  5A8R B;  4B08 A;  3NY0 A;  1JWW A;  2NLW A;  2CJQ A;  1PJ7 A;  3OVA A;  3N5F A;  4ES2 A;  5C42 A;  4B9S A;  1HPZ A;  1Q8L A;  1WSV A;  2XYG B;  2LQ8 A;  4ECZ A;  3EZ5 A;  2AJ4 A;  3G6X A;  3D28 A;  4F3O A;  2BKO A;  3SEO A;  1R7I A;  3QID A;  4DL3 A;  1TEL A;  4U8Y A;  4RUA A;  1FJG J;  3U1N A;  2VG6 B;  3K2Y A;  5T41 A;  4WFA Q;  4FDF A;  4G1P A;  1D3W A;  3J81 Y;  1IN0 A;  2KT5 A;  1P9Q C;  3GSD A;  5DDR C;  1S9E A;  1NSQ A;  1HBU B;  2CPE A;  4ANC A;  1XBW A;  4TXS A;  3RB4 A;  1U8W A;  4OQJ A;  3BGR A;  4FPR A;  4WP9 A;  2LFV A;  2V2Q A;  4K0K J;  5BR8 F;  3BYP A;  2E1R A;  2GIR A;  4M63 A;  5D4P A;  2HHT A;  1KP6 A;  3ONQ A;  4DUZ F;  3DLB A;  4F7V A;  4IO9 Q;  4KHP J;  4DSK A;  2VKZ G;  2DTJ A;  4HTI A;  3TAN A;  3KNA A;  4X4R A;  4WFY A;  4MKB A;  1JB0 C;  1S6O A;  1SC4 B;  1UTA A;  5E3Q A;  2AJ1 A;  2HNY A;  2PSZ A;  4YHH J;  3GWC A;  3FZ2 A;  4J9K A;  5HSP A;  2R2R A;  4RU2 A;  4TKT A;  2DNK A;  1N32 F;  3ZTS A;  2F7V A;  1D9D A;  2H1Y A;  1NH7 A;  2CPX A;  3OTC A;  5JMN A;  1FES A;  3CIM A;  2HFV A;  3ZZY A;  5IT0 A;  3F0N A;  4EMD A;  4NLP A;  4QIF A;  5AXL A;  5MAO A;  2DNG A;  3UO0 A;  1T9Y A;  3KJF B;  2D1C A;  3KKF A;  3HHL D;  5HVF A;  3MDF A;  4YOE A;  3I4H X;  1TUG B;  2EFO A;  3NL0 A;  3LAK A;  4P2X A;  3MHY A;  1S72 S;  2C2N A;  5HBM B;  3Q2S C;  3KHL A;  4Q44 A;  2CQ1 A;  1YRU A;  1REG X;  4XPC A;  1S0O A;  3P5T L;  5CD4 A;  4ZVU B;  2E1C A;  1WF1 A;  5BYQ A;  3IAM 9;  5EGY A;  1V5I B;  4F04 B;  2HHQ A;  3ZZP A;  1LW2 B;  1ZA1 B;  4C48 A;  5MLC V;  3VZH A;  2QA1 A;  3DOM B;  1HQ2 A;  2E5L F;  4NA1 A;  3R6L B;  2CJK A;  3LP1 B;  2F9J A;  2QO3 A;  3J81 U;  2WSF C;  4N7T A;  4I2Q B;  2RAQ A;  3WDO A;  1F60 B;  3R7S B;  2GHV C;  2HFS A;  3TI0 A;  4KY3 A;  3I4P A;  1WEX A;  2R4F A;  1EIY B;  1EJ7 L;  4DEZ A;  3M9N B;  2HUR A;  5BXI A;  4OI1 A;  4UZB A;  3DGP B;  3LQV A;  3D7S B;  4P2M A;  2CG8 A;  2HNZ B;  1RQ0 A;  2EPI A;  2XEX A;  1N34 J;  4PXB A;  2V9K A;  3M2V A;  2DGU A;  3ILL A;  1KVI A;  1VQ8 S;  5D0E A;  1OIA A;  5EWE A;  1HFE L;  1QLN A;  4JI8 F;  3D0H E;  1XER A;  1SJQ A;  2QG9 B;  5L1I A;  2VDH A;  3H8Y A;  4AE5 A;  3NNA A;  4L76 A;  1R0A A;  2JX2 A;  5GAD U;  4DV7 F;  3WX8 A;  4GRS A;  5HP1 B;  4U8V A;  4FYV B;  2COL A;  4N8N A;  1RT5 B;  3RYL A;  4F8R A;  1C2P A;  1BQM A;  2IPO B;  1FXD A;  1Q78 A;  1WNE A;  3LWL A;  1UCN A;  2W9C B;  3MMC A;  3PFE A;  2MY7 A;  4IQX A;  4L3K A;  2OFG X;  3T1H J;  1VQ9 S;  5K5M A;  1VGY A;  2ATL A;  2C2D A;  1T11 A;  1BWE A;  3H90 A;  5CXT A;  2OPR B;  4ZVF A;  4FYW B;  3AXM A;  4IRK A;  2JFK A;  4DZD A;  1S0M A;  2CAJ A;  5I4M A;  3HO1 A;  2WW4 A;  1QUP A;  3IBW A;  4P6Q A;  1GH8 A;  4FS2 A;  3M2U B;  2CG4 A;  5HL7 Q;  2MY8 A;  4H4M B;  4RR5 A;  2PA3 A;  3CJ0 A;  3PY8 A;  2BJ1 A;  2PMZ D;  4UT4 A;  1WD6 A;  3W65 A;  2YWW A;  4LF9 F;  3R97 A;  1AZS B;  1BHN A;  1TTH B;  4RO0 A;  2V4Q A;  2RRN A;  2PII A;  5HAO A;  1LWC A;  1HPZ B;  2OIH A;  1U45 A;  5K8N A;  1SV5 A;  3QAU A;  4L75 A;  2ZC3 A;  3GFH A;  1S57 A;  1IM4 A;  2XTJ P;  2CQB A;  2I0X A;  3UN5 A;  3JQK A;  2UXD J;  2N3O A;  1T9W A;  1RA6 A;  1YJ9 S;  4C8Z A;  1FDB A;  2GJF A;  5B0A A;  3H25 A;  4NLD A;  2WVD A;  2MQN A;  5HVH A;  2GC8 A;  4HVZ A;  3B78 A;  3R3T A;  4DUT A;  4YB1 P;  1JNZ B;  2W9B A;  3W9I A;  3BO2 A;  2AYB A;  3DDN A;  1CLF A;  1LWF A;  1MMN A;  1R8C A;  1ITP A;  3GYX B;  2V2V A;  1X4H A;  4NML A;  4CLW A;  4IOB A;  1Q95 G;  1S7H A;  5DQG A;  4TN2 A;  1PG5 B;  3GPA A;  1IR0 A;  2CQ2 A;  1HNX J;  4ZCK A;  4CH7 A;  8AT1 B;  3DC2 A;  1DTT B;  1KD1 T;  2HNY B;  2Z56 B;  1T03 A;  1JLA A;  5CHC B;  3R1H A;  2JC0 A;  4OYP A;  3F56 A;  3HKZ D;  4QBU A;  4UOF A;  2HEK A;  4B3T F;  4WZM A;  1E6V A;  1UA1 A;  3UN2 A;  3R2D J;  4X64 F;  2BKN A;  1MML A;  1XJW B;  3ZTQ A;  4TLQ A;  2RQC A;  1FNX H;  3HX9 A;  1QM9 A;  1TL1 A;  2Q43 A;  3HD1 A;  1XK8 A;  1K9M T;  1LW0 A;  3KUH A;  3PIO Q;  4NI2 A;  2KHC A;  1T9V A;  3KHG A;  4NLW A;  4KV8 A;  1IM6 A;  2IVM A;  3LP2 A;  2B4V A;  1LKZ A;  2MLZ A;  2DR5 A;  3V2U C;  3NCP A;  4U96 A;  4ZIT A;  1HNI B;  3HSD A;  4AFF A;  4ZN3 A;  2LMI A;  3AY0 A;  3J7A 1;  3DHW C;  1YJW S;  5D3G A;  4JV5 J;  9ATC B;  2JZ5 A;  3WBZ A;  4B02 A;  3SXL A;  3CCS S;  4X4T A;  1F9E B;  3KYL A;  1J5E J;  3E51 A;  1U1M A;  2HHX A;  3QYY A;  1LK7 A;  3FFI A;  5AE2 A;  2LDI A;  1WC1 A;  3BF4 A;  2DPJ A;  3GB0 A;  4X62 J;  1RAG B;  3N6L A;  1SXL A;  4MFB B;  3W60 A;  1HWJ A;  4DR4 F;  2JJ4 D;  1F9H A;  3PX0 A;  5GMK a;  2DRD A;  2V34 A;  5DG7 A;  4DSL A;  3PYD A;  4USK A;  5AJ3 J;  3RU0 A;  3MM8 A;  2UP1 A;  1PJ5 A;  1U1L A;  4J37 A;  3HVR A;  1HNW F;  1NZ8 A;  1V3R A;  4I1T A;  3ADA C;  3VZI A;  2OSQ A;  1K1Q A;  3MM5 B;  3VGS A;  1X5S A;  4QIG A;  3DLH A;  5FLX U;  4NCA A;  3CNQ P;  3AD9 C;  4USJ C;  1VQM S;  3IA0 A;  1MRO A;  3IXQ A;  1WI6 A;  2DHX A;  5J2M A;  2Z2Y B;  1RJJ A;  1ELO A;  3M2V B;  1VYA A;  5E3C A;  4OZ1 A;  4RBU A;  5GMD A;  5DZ6 A;  2J0S D;  3M7V A;  2M2B A;  1RWO B;  3BRE A;  2HGL A;  4UQG A;  2KM8 C;  5GAH U;  3IWX A;  4DS4 A;  3DNC A;  3S8S A;  1HIY A;  4ZVQ B;  3KG1 A;  4AL7 A;  2OJ3 A;  3K5N A;  3AJ2 A;  2H5E A;  4U9R A;  3VAH A;  3J81 j;  4JI6 J;  4DPT A;  3A8J A;  1BQM B;  1FX4 A;  1WTF A;  2WVE A;  3W61 A;  1W25 A;  1D09 B;  4K4Z A;  2ZH3 A;  2G2Z A;  3BGL A;  4Y34 A;  5CYM A;  5IM0 B;  4EFA C;  1X4D A;  1M0S A;  3GG1 A;  3BDE A;  3H7H B;  5KFB A;  4RW6 A;  2EK6 A;  3LP0 B;  4U7C A;  2PD1 A;  2IM3 A;  4CO5 A;  2CZ9 A;  3POT A;  1RHM B;  2DHG A;  4MK7 A;  4NLG A;  2W4D A;  4DV2 F;  4DX6 A;  1MW7 A;  2D9P A;  1ZTT A;  2UU9 J;  1HNV A;  2AP6 A;  3TUI C;  1JLF B;  4ZCM A;  1NHV A;  3C6U A;  2XLJ A;  3OR2 B;  2HWT A;  2FVQ A;  3MPD A;  5HRO B;  2FZG B;  3SV4 A;  2GO9 A;  1KQK A;  1RWN B;  3O8W A;  3T6B A;  3TZZ A;  4LSZ B;  5AXM A;  2GQC A;  5J1E B;  3PZP A;  2VA3 A;  3FRZ A;  4LJM A;  1YBA A;  3GU0 A;  5IFM A;  3BO4 A;  1UWB A;  2CQP A;  3PJW A;  2Z2L A;  1SV5 B;  3Q86 A;  4O0N A;  3LGM A;  3RR8 A;  3SDE A;  5A76 A;  3TJA A;  1VS3 A;  2DKO B;  3H5Y A;  2QT7 A;  1PKU A;  3M6W A;  2CQD A;  3S7R A;  3HFK A;  4QU7 A;  1ZZN A;  3N9U C;  3GLJ A;  1UA0 A;  1RKJ A;  4OYI A;  4E2F B;  2IJR A;  2VD3 A;  4RNH A;  7FD1 A;  1RGV A;  2GMJ A;  3ETO A;  1XNR F;  1LXN A;  4NAS A;  2O5D A;  4X66 F;  2XWX A;  5T14 A;  2GAG C;  1N0V C;  1RTJ A;  3EPI A;  1NSK L;  4FKY A;  4B3T J;  4A47 A;  2IM1 A;  3EDR B;  3DLJ A;  2LDY A;  3W2V A;  1U6F A;  4LF4 F;  4DQP A;  1B4S A;  2JVR A;  1UVL A;  4JI1 F;  3BYR A;  3LGH A;  1QSS A;  5CYQ A;  2IHR 1;  2AIR B;  3ILJ A;  4CO3 A;  1JLA B;  4HAC A;  1WC6 A;  1OS5 A;  2F40 A;  2RU3 A;  2W7A A;  2DH9 A;  2AWZ A;  2G2Y A;  2LQ5 A;  1HLW A;  2NYI A;  2QE5 A;  2DNR A;  2Y1L B;  2XG8 A;  1X31 C;  1VBX A;  5DDQ C;  2ZE2 A;  3KHH A;  1ZTW A;  4DR7 F;  3THV A;  5B0G A;  3MMB B;  3QWP A;  1CG2 A;  2R42 A;  3EVO A;  3KLG A;  3NGR A;  4GKK J;  2W2M P;  2MST A;  4OX9 J;  1EET A;  1CJK B;  1FKO B;  3NG8 A;  3ZTO A;  4KV8 B;  1AA1 B;  1RWM B;  3J7A N;  4DR4 J;  1JLC B;  2G13 A;  3OXL A;  4FS1 A;  2HVH A;  2VDI A;  3CD6 S;  1N48 A;  1CQN A;  2ZD1 A;  4DL6 A;  1YJ7 A;  4NRU A;  4KFB A;  4MYU A;  1C1C A;  2HGN A;  1IXK A;  3K5M A;  2YXL A;  1V6H A;  4B3S J;  1WC0 A;  3H40 A;  2RRB A;  5KG0 A;  5HJY A;  3GQC A;  2IYI A;  5EX3 A;  4UOC A;  5KFE A;  1Q8K A;  4XIU A;  4DL7 A;  2YWE A;  3GFY A;  3QZ7 A;  1IKW B;  2IYG A;  3RRG A;  3FQL A;  5E3R A;  3PEH A;  5DQI A;  3K5P A;  3C19 A;  1O5J A;  2XO7 A;  1VMB A;  4F0H A;  2CWK A;  4ED7 A;  2BE2 A;  1XNQ J;  1R43 A;  5C25 B;  4FYX B;  4HTJ A;  4NLY A;  2HQ3 A;  2QMU B;  4X84 A;  3PV8 A;  5EX0 A;  4DHV A;  3KK1 A;  1RHQ B;  2MQP A;  4ED0 A;  2CFX A;  1E6Y B;  2OEM A;  4Q5V A;  4X4P A;  2BJ7 A;  3VQT A;  5H9F J;  2FVC A;  3VWS A;  1RAC B;  5AE3 A;  2DJW A;  1M5S A;  5KT7 A;  5THW A;  3EGV A;  3NKY A;  2MB0 B;  2HK2 A;  5F8G A;  5KFD A;  3CVK A;  2H48 B;  3SCI E;  4DQI A;  4DSE A;  5LMN J;  4NLS A;  2HKE A;  1JKH B;  3OUY B;  2CVI A;  3BR8 A;  2K8G A;  4X4S A;  2ZKT A;  4DR6 J;  3T5K A;  2DGT A;  3CDA A;  4DX8 H;  1REV B;  2X1B A;  2IA6 A;  4NCB A;  4C3M A;  2RD5 C;  4F26 A;  3M8R A;  3HHL A;  5ADZ A;  4CO0 A;  1KLM A;  2FY8 A;  2X1A A;  1DY3 A;  1SC1 B;  2EW9 A;  3OHB A;  4O3S A;  4LBH A;  1A6L A;  1XR7 A;  1OY6 A;  2GQ2 A;  3WIU A;  2HQI A;  4EZ6 A;  4DV3 J;  3QLH A;  5J2P A;  3JQM A;  1BQN B;  1I5O B;  2NXE A;  4ENO A;  1RWP B;  1IKX A;  4ETZ A;  1DAR A;  2KB2 A;  1I3O B;  1KRP A;  3R5J B;  1FVQ A;  3UN3 A;  1YK9 A;  3MEC A;  1W2I A;  4KGM A;  1K0T A;  4LUB A;  4IR1 A;  3DOL B;  2BE9 B;  3C6U B;  3GV5 B;  2RQ4 A;  1NJZ A;  2VON A;  3I56 S;  4ECX A;  5HLF A;  2R8G A;  2QIF A;  2DNQ A;  2HFU A;  3OL9 A;  1DLO A;  4ETX A;  1TV6 B;  2AF6 A;  4DX7 A;  2FC8 A;  5HQ8 A;  2JLF A;  3JXO A;  2OH2 A;  4X66 J;  3T6J A;  3US5 A;  2YQ3 A;  3V6H A;  2NCK L;  1MU2 B;  2RSQ A;  2Z0G A;  2R8J A;  3HT0 A;  2V4J A;  4WWS A;  1S0V A;  2B7B B;  1SC3 B;  2H4W B;  2UXC F;  1T02 A;  5KFZ A;  5CAA A;  2DGS A;  2JSX A;  1QVF R;  5LSL A;  3UCZ P;  2JOQ A;  2ZM6 J;  4WKR A;  4RNN A;  1NK6 A;  4QPX A;  3D54 A;  3OTO F;  1C0U A;  1SL1 A;  2O1P A;  4IFY A;  1Y5L B;  3CCL S;  3K8V A;  2VU5 A;  4WU3 A;  1Q16 B;  1UPM B;  3PW7 A;  4MIA A;  4CCH A;  3FCH A;  2UZA A;  1I6J A;  5E5N A;  3W7B A;  2DIT A;  5B7W A;  4R8U A;  5B0C A;  3H2L A;  3IO1 A;  2NXU A;  3MPV A;  2MSS A;  3CJR A;  2XC9 A;  3W2V B;  1KEK A;  5KTQ A;  1SUQ A;  3PJX A;  4BS2 A;  3KTQ A;  4DSJ A;  2YWF A;  2Z2M A;  2F4V F;  4I7F B;  1XMQ J;  2O01 C;  3CPW R;  1PO6 A;  2Q3P A;  1RE1 B;  3IRX B;  2QV6 A;  2J7U A;  3IRW P;  2ASJ A;  1H98 A;  3BV8 A;  3BKT A;  3QT8 A;  5F0U A;  3EXY A;  2AV5 A;  2Q66 A;  2OEK A;  4AD6 A;  4WZQ A;  3QGP A;  2R7O A;  2CPF A;  1IBK F;  5LXR A;  4LIW A;  3BKU A;  2OMO A;  2RNE A;  1IBM F;  1UVN A;  2W1B A;  4QIV A;  1KDN A;  1ZA2 B;  2PO4 A;  4K2X A;  2F3J A;  2DT9 A;  2QC3 A;  3T3F A;  1DRZ A;  3HHN B;  4QW9 A;  2HQD A;  2HND B;  5EHH A;  3BO3 A;  5KG2 A;  3OHA A;  4RW9 A;  3LH2 S;  4B3O A;  1H7X A;  5F8M A;  1RT3 A;  4LBI A;  4HI2 A;  3OSP A;  1AFJ A;  5IZH A;  1RP5 A;  3CUN A;  1VC5 A;  5CA5 A;  4DR5 F;  3DHX A;  2F4F A;  1YZ6 A;  3CJ2 A;  5ETO A;  1NDL A;  2ACY A;  3GJS B;  2AQ4 A;  1UVM A;  2CPH A;  1IBC B;  3GJR B;  4V1A k;  4TU7 A;  4B9U A;  5DQH A;  3BN7 A;  5EWG A;  2KVI A;  2N4C A;  2MKI A;  1RT1 A;  4WBF A;  1HMV B;  2L9W A;  1F3V A;  4X4N A;  1A7G E;  2NSB A;  4DZ6 A;  3E8O A;  3CO0 P;  1U2R A;  1NPP A;  2ZWP A;  3ZTP A;  3TX0 A;  1RTH A;  4JYA F;  4DR1 J;  3T1Y J;  1L5U A;  4LF7 J;  3CCQ S;  5K9F A;  3Q8Y A;  2BE2 B;  2LA6 A;  4CM2 A;  1O0P A;  1QUV A;  1CJT B;  1HI0 P;  1HBM B;  1PIE A;  3KK1 B;  2VPY B;  2EBG A;  5CAB A;  3RBX A;  4F02 A;  5LJ5 Y;  4QU6 A;  3J7Z 5;  3UVJ A;  3JTO A;  2J9D A;  5CCL A;  2ZH1 A;  2A10 A;  1VHF A;  2UV8 G;  3A4T A;  3QGH A;  3GCW P;  3ISN C;  2UUC F;  5KOW A;  2YH1 A;  2BAB A;  3H2V E;  4OI2 A;  3H20 A;  4WK3 A;  4K2J A;  5KT5 A;  3P3D A;  1HHT P;  1OSC A;  1B0P A;  3TZW A;  2E44 A;  5C24 A;  5LL6 d;  2L41 A;  1HL6 A;  3H5X A;  2Y1I A;  1RTI A;  2V4R A;  1TAU A;  4NWB A;  2JLE A;  2BA9 A;  2HZV A;  8RUC A;  4K4U A;  2J7K A;  1AB8 A;  1D8Z A;  4WFZ A;  1S4E A;  1MG7 A;  2MZQ A;  2DNN A;  1BD6 A;  4Y2A A;  5A8W A;  2KM8 B;  5T7L A;  4FF1 A;  2RRA A;  1BQX A;  1S1T B;  4KB7 A;  4DPY A;  4ZVT B;  3HHL B;  4J5O A;  3SI8 A;  1VRT B;  3M8P B;  3BSN A;  4CO2 A;  4HH1 A;  3O1L A;  3X1L B;  2DXF A;  3KWM A;  3MUV P;  4OI4 A;  3QLH B;  3I55 S;  3LGN A;  2KYX A;  1DJ0 A;  5KG5 A;  2ZBC A;  1X0P A;  3EPG A;  2RB7 A;  4DSF A;  1AYE A;  2IRY A;  1FHT A;  5IC6 B;  1VR6 A;  5A8K A;  5KFW A;  3CTR A;  4OYB A;  3SFU A;  2BJ3 A;  3FQK A;  4DV5 F;  5H9E K;  3H0P A;  4CWB A;  5RUB A;  1URR A;  4W4M A;  2GVD B;  4EGL A;  4MKV A;  2N7C A;  4A8K A;  1PJ6 A;  2VG7 A;  3KUG A;  5G4D A;  1FRM A;  1EHW A;  3MZI A;  4I6Y A;  4OI3 A;  2E1P A;  1X8D A;  4YY3 J;  3J80 Y;  5GAD I;  1RZM A;  3MOJ B;  1YQH A;  1YJT A;  4CP5 A;  3I96 A;  3IG1 B;  1IJE B;  1SH0 A;  2MMY A;  3W1Y C;  3G82 A;  4ZMM A;  1HR0 J;  5G0R A;  2HSE B;  4IDK B;  4ZN1 A;  3MPU B;  4B9N A;  4GC6 A;  2YWH A;  1H2T Z;  1DTQ B;  3RW6 A;  4D3G A;  2OSR A;  4PRF A;  3BGU A;  1CSJ A;  3CJT A;  1M5V C;  3D6M B;  5EDW A;  4PG4 A;  4DG1 A;  4F4W A;  2UUA F;  5KFU A;  4USW A;  4DS5 A;  1L3V A;  3IBF B;  1C0T A;  3UE2 A;  3W2W A;  1FEH A;  3BS9 A;  4DU8 A;  3D0I E;  3CGI A;  2MXY A;  4LSN A;  2YKP A;  2HK3 A;  4RNM A;  1IBK J;  1PYS B;  3HLU A;  2VOD A;  2VF3 A;  3QT6 A;  4NX9 A;  2VUG A;  4L72 B;  2PE8 A;  2IM0 A;  2RDI A;  4J91 A;  1YI2 S;  2HQC A;  1S5Z A;  1EP4 A;  1RHR B;  3P8B B;  1JXV A;  2QFI A;  2M8D B;  2EBE A;  4ZJO A;  3T5J A;  2YQ0 A;  3K5O A;  1WF2 A;  1U47 A;  1HI1 A;  1S12 A;  2FJX A;  4K59 A;  1XTZ A;  2IIH A;  3IWN C;  2J8S A;  2RH3 A;  3Q8S B;  2R2S A;  1VFJ A;  4LRB A;  3FVY A;  4Y2I A;  3WHI A;  1UEV A;  2AKW B;  3AFG A;  1NM2 A;  4ZOS A;  3L7U A;  4MYT A;  2WVC A;  2CQ3 A;  4DR2 F;  5M2U A;  3AOA A;  1GMW A;  2BJ8 A;  2FHJ D;  1ZS6 A;  3I82 A;  2NSC A;  1QTM A;  3PYF A;  4M5I A;  2V6A A;  4B3O B;  4NCG A;  3QPI A;  3CF5 Q;  1MLA A;  1H3D A;  1TVR B;  4ELU A;  5KFX A;  2PFD A;  5DRK A;  2YX7 A;  4JV1 A;  4GO7 X;  3VAI A;  1F5A A;  2C2M B;  4ECV A;  2M3D A;  1B7F A;  3CMA S;  1SPB P;  4TY8 A;  2XM3 A;  3EWG A;  2PGC A;  1XQI A;  2DHA A;  4TY9 A;  1TKT B;  1OSD A;  4Q43 A;  3CCU S;  2KTQ A;  1RAJ A;  3CCW A;  3J80 U;  4JI4 F;  3CC4 S;  4PYA A;  1YJU A;  4WP8 A;  1WDT A;  2QZ8 A;  2V63 A;  5KT2 A;  5KT6 A;  4X65 F;  1U1Q A;  1RTH B;  4L6V 3;  2DVI A;  4OZ5 A;  2KG0 A;  1HYS A;  1OY9 A;  2ASL A;  2DNH A;  1UEK A;  3Q8U A;  5I3Q A;  2VIC A;  2JEG A;  3UR3 C;  1WHY A;  3ELH A;  1TK5 A;  4F25 A;  1GTE A;  3P96 A;  4U6P A;  4UQT A;  4ZPB A;  1N33 J;  4OZ2 A;  1OO0 B;  4I56 A;  4WFX A;  3IFE A;  1WEL A;  3AQP A;  3DMJ A;  3Q23 A;  3PHT A;  4C8O A;  2OFH X;  1NME B;  3IS9 B;  1UKU A;  4OMF G;  3QIP A;  2EXU A;  3SSS A;  1KN6 A;  2M8H A;  2MHE A;  5ETS A;  1O51 A;  3F44 A;  1M1H A;  3MR5 A;  3U27 A;  6FD1 A;  5B0F A;  3MD1 A;  2FLO A;  1P9Y A;  1RB0 A;  1OJ4 A;  2OPS A;  2A3J A;  3AA9 A;  3M32 A;  4YS2 A;  3ILO A;  1N5T A;  2GQQ A;  1SJ4 P;  4QIE A;  3PAC A;  2GGP A;  4B9T A;  4ELT A;  1I94 F;  3RB3 A;  5AE1 A;  4M95 A;  4CM0 A;  1BGX T;  3IGV A;  1JIH A;  4UOG A;  2KDO A;  4NXN F;  3HPO A;  2Z8Q A;  4A4J A;  3DRR B;  3O2I A;  3M4X A;  1VIX A;  5EN1 A;  4PAB A;  2RHQ B;  5KFG A;  2EFQ A;  3C6T B;  1UZH A;  3NOC A;  3EJM A;  2R8H A;  3G6Y A;  4A8M P;  2XCA A;  2I9S A;  1APS A;  1AFI A;  2ZHA A;  4RZR A;  4WE1 B;  3GIM A;  1YVF A;  3MAA A;  1JMT A;  3N01 A;  4HDG A;  3I0R A;  2C2K B;  2ZHB A;  4EZ9 A;  2ZDO A;  4H4O B;  3D1O A;  4Y28 C;  1UP1 A;  1ZM2 A;  3DDK A;  4JP8 A;  3KLE A;  1MN7 A;  2OPQ A;  3PW5 A;  2R8K A;  4M5D B;  1FKP B;  3HP6 A;  1KR4 A;  3MOZ A;  3OJS A;  2LA4 A;  2KJV A;  3KK3 A;  2VFR A;  1R31 A;  3MEE A;  2DH8 A;  2HHH F;  1XR6 A;  4IG3 A;  5A8K B;  4KRW A;  2QA2 A;  2PA8 D;  5IT4 A;  2B9X A;  3EGN A;  2W9A A;  4DPX A;  4GO5 X;  4WFN Q;  4L74 A;  2CJX B;  4I68 A;  5GAH I;  1HD1 A;  4YQW A;  3M30 B;  2GHW A;  4B3M F;  5F41 A;  2OEL A;  4PXC A;  1P1T A;  3MM7 A;  3D6F B;  4WU2 A;  4G1Q A;  2D3U A;  1XMO F;  1N4L A;  2XSJ A;  5KFK A;  3AOC A;  4ZIV A;  2IDE A;  3A8E A;  3ETM A;  2EKN A;  2NQP A;  3D0G E;  1OMS A;  1FF2 A;  5LMU F;  4RW4 A;  4EO8 A;  1S6Q B;  3IGN A;  1VRU A;  1S1V B;  4GMK A;  3V6D A;  3DU6 A;  2D74 B;  3JTN A;  3NP5 A;  1C0T B;  1FEE A;  1WHW A;  5I42 A;  3G4S S;  3R2C J;  5KFR A;  3UDE A;  1D9A A;  3SBM A;  1FD2 A;  3JSM A;  4ECW A;  3VGV A;  4X2B A;  2LKZ A;  3HVT A;  2I1R A;  3MTJ A;  2V8P A;  4KO0 A;  4QZV B;  3VF0 B;  2A1B A;  2BRL A;  3MR2 A;  4QYZ J;  2HQG A;  1VQ6 S;  1NK4 A;  4ZVG A;  1SJ3 P;  2CNK B;  5GAG U;  4NLR A;  4NRT A;  3PX6 A;  5M2R A;  3QRP A;  2DNL A;  5D0H A;  4ITS A;  3L7P A;  2QEX S;  4ATN A;  1TR0 A;  4MMO A;  2P9C A;  2VC0 A;  4DV0 J;  4KPC A;  2HFN A;  1KOH A;  4HHJ A;  4HLB A;  4WII A;  4M5G A;  4ER8 A;  2F63 A;  4Y0F A;  1M5O C;  3V4I B;  4U67 Q;  3RRK A;  2QMW A;  4ILM A;  1U1P A;  1VJQ A;  1NEE A;  1CJV B;  2F8E X;  3G6E S;  3KK2 A;  3K58 A;  3THP A;  1P1L A;  4PG7 A;  2VIH A;  1KKH A;  1KS2 A;  1DHM A;  4DPW A;  2GFF A;  1M5H A;  4YFU A;  3BEG B;  2MZ1 A;  5HN0 A;  2UVW A;  1U6Z A;  2XHC A;  1JJC B;  2WZ1 A;  1IKY B;  1VBK A;  2W2O P;  1TL4 A;  3N6M A;  1UET A;  2M7S A;  3Q8Q B;  1Q7L B;  1Q53 A;  2CJ9 A;  4FXV A;  2DHS A;  2Q79 A;  3N0V A;  3PRD A;  2MJU A;  2FUG 9;  2HHS A;  1RHJ B;  5DS7 A;  5KG3 A;  4ZA1 A;  1S0N A;  2WHO A;  3GE9 A;  2RF2 B;  2HMI A;  2W8L A;  5EWF A;  4JI3 J;  1RBO B;  3G87 A;  4DUY F;  3RBZ A;  3ET6 B;  1FJ7 A;  2VQF F;  4DR3 F;  5D8H B;  2OTJ S;  3M1V A;  4JB8 B;  4LFC F;  1NLK L;  5DET A;  4W90 B;  4KJI A;  3HZE A;  3M8Q B;  3RTV A;  3PEJ A;  3M9O B;  3QT7 A;  3TA2 A;  3DMJ B;  4Y6I A;  2CJB A;  1B0T A;  3JS9 A;  4DSI A;  4NXN J;  5ETM A;  3RBE A;  2Y1J A;  2Y8Y A;  3QIP B;  2VG6 A;  3OFH A;  1WOO A;  1LWX A;  3PJ9 A;  2NS1 B;  2E9Z A;  3UCG A;  4R5P B;  3LO3 A;  2IBK A;  3SIP B;  3TJ8 A;  3ZXW A;  3R5D A;  1YWX A;  2WSE C;  1XWL A;  3OFF A;  1F5B A;  1M90 T;  2W7P A;  3B4D A;  1URN A;  2LEA A;  2V8V A;  1RAO A;  4KGV B;  2BZ2 A;  1KON A;  4J9Q A;  2ZBQ A;  1GXU A;  2LEC A;  3N28 A;  3JAM Y;  1FJG F;  2LYV A;  1B64 A;  5ETQ A;  2N82 B;  4UY8 T;  2HAF A;  3W63 A;  3M6X A;  2R2T A;  3IM9 A;  5C2G A;  2KFZ A;  2HHU A;  4M1K A;  2AX1 A;  2CQC A;  4I64 A;  4HH0 A;  3I32 A;  2B8P A;  4Z7C A;  2RKI A;  3WC0 A;  4D3H A;  1T0T V;  2HBQ B;  3DYA B;  1NB7 A;  4K0K F;  4NA3 A;  1PAU B;  5LSR A;  1B3T A;  2YBV A;  3C2P A;  1S59 A;  2OPQ B;  3R5A A;  4HT7 A;  3QGI A;  1FRH A;  4Q7A A;  3KK3 B;  1O6X A;  4C8N A;  5L9N A;  1J27 A;  1TL5 A;  3H4B A;  4KHP F;  1G1X A;  4CH0 S;  1EQM A;  3WZ0 A;  2B9E A;  2HPU A;  5HVG A;  1Y10 A;  2RS8 A;  4J9U E;  3QSI A;  4B9V A;  3AB2 B;  4CYU B;  2KT2 A;  1NDP A;  1UW9 A;  4YHH F;  2UVR A;  1Q4R A;  4N56 A;  1JX4 A;  2C42 A;  3CE8 A;  1JLQ B;  3DM2 B;  2JEJ A;  4I4B A;  5IOL A;  2BOA A;  4MKY A;  2XI2 A;  2ZH6 A;  4LMZ A;  4O3P A;  2NXC A;  1TMJ A;  3PNI A;  1FWL A;  5HBM A;  3H98 A;  2E5G A;  2VFV A;  3HSJ A;  2RIL A;  3VVT A;  2Z58 B;  2D41 A;  3D66 A;  2ZKU A;  3CW2 C;  5DG9 A;  1HQU B;  4RW4 B;  3OD2 A;  2CJY B;  3OW2 R;  3LW5 C;  4PPD A;  3DOM A;  3SYZ A;  1HHS A;  5I42 B;  4LF6 J;  2WK4 A;  2P6S A;  1VRQ C;  3QWU A;  1WKL A;  4I2Q A;  4I0W A;  1U49 A;  4USM A;  5HMW A;  2UVU A;  3KLF B;  4ZS6 A;  1FRL A;  2HZC A;  2QMX A;  1M1G A;  1VQK S;  2FVP A;  1R0B G;  3DGP A;  4PWW A;  3NAH A;  3GP9 A;  2HNZ A;  4ECR A;  1JLG B;  2HG4 A;  1X4F A;  2WRM A;  1LQ9 A;  1FXL A;  2WB1 D;  4M5M A;  1RIS A;  5JJB A;  1WWH A;  3JAM U;  3OLB A;  2VC1 A;  4WTY A;  3RG6 A;  1L3S A;  3NOG A;  1SIW B;  4XO0 A;  3TVY A;  1BUX A;  4ZVH A;  3O44 A;  2FJW A;  2HVD A;  2EFN A;  3SQG B;  3NXZ A;  3FCW A;  5HP1 A;  1X5T A;  4Y2K A;  4LF2 A;  4NXM J;  1RT5 A;  2ABY A;  1WTB A;  4CO1 A;  1DQ8 A;  1U7L A;  1N34 F;  2AYG A;  4BWJ A;  2DR6 A;  5IT9 U;  3B4M A;  2W9C A;  4DR3 J;  1T94 A;  4C4W A;  1PCA A;  5D6G A;  2WOM B;  3BH6 B;  2R7Q A;  2X3G A;  3MM6 A;  5A0Y B;  5GME A;  4C98 A;  5KG1 A;  2DD8 S;  2XMW A;  4OYA A;  2B6A B;  3ZC4 A;  2ILZ A;  4OJH A;  5JVG Q;  2IJN A;  3UW1 A;  3W3S A;  1KLN A;  2DGX A;  4BLG A;  2BEF A;  1AUD A;  1NK8 A;  1ZET A;  2V8D A;  3M2U A;  2HFO A;  4C11 B;  4H4M A;  2ASY A;  2HMI B;  1NPK A;  3CDB A;  4DN9 A;  1R6Y A;  4PXD A;  4TLR A;  2HBZ B;  3M1V B;  2VAS A;  4OX6 A;  1AZS A;  3U1L A;  3T1H F;  2DGV A;  1R27 B;  1V3S A;  2C3Y A;  4HEA 9;  1X9M A;  1H7W A;  5CD4 H;  2C3U A;  2X1G A;  5L1J A;  5J2Q B;  4LSL A;  4JV2 A;  2IMW P;  3FUY A;  6AT1 B;  4DPO A;  1RWW B;  1X5P A;  2W4C A;  2UXB J;  3K0J A;  5LOQ A;  1VQL S;  5KFY A;  2YPY A;  2H3E B;  1U6B A;  2MZT A;  2HBR B;  2FDN A;  2PI5 A;  2ZH8 A;  2VQE J;  2RT3 A;  2WON B;  1RTZ A;  3TJ9 A;  1MNE A;  1LWE B;  4K4W A;  4MIB A;  2BV3 A;  2HIY A;  1NJW A;  1KHW A;  3DLE B;  1T05 B;  4OLO A;  1RTD A;  5DLG A;  3I87 A;  2V2Z A;  3IR6 B;  4DLG A;  3R8Y A;  1N5Q A;  4FXD A;  3CJ3 A;  2FD2 A;  3QNW B;  1N5Y B;  2W01 A;  4OLP A;  4WK1 A;  2KRB A;  4WF9 Q;  5L46 A;  4ILR A;  1R8A A;  3VAF A;  1KVJ A;  4MKA A;  3L95 X;  3S01 A;  5JXS A;  3DLK A;  2ASD A;  4Q8F A;  4J9L A;  1CC8 A;  2Z4P A;  3DU5 A;  4PAA A;  3VAK A;  1PIL A;  3G8S A;  2UXD F;  1DTT A;  1Q81 T;  3ZZR A;  3AH6 A;  1UVI A;  2RKI B;  3PM9 A;  2ZJR Q;  4NMX A;  2KFN A;  2XMK A;  4LVN P;  2RQK A;  8ATC B;  4JI2 J;  5J1N A;  1VC6 A;  3U7J A;  5D0R A;  1IBL J;  2QRR A;  3EYZ A;  1WDD A;  4ZP8 A;  2WBM A;  5E41 A;  1FJC A;  2HHW A;  1UMJ A;  3M2R B;  5J2N B;  2DGO A;  4CLY A;  3RB0 A;  4YME A;  2MLX A;  5LJ3 Y;  5IQQ A;  1U1N A;  2CUY A;  1QAY A;  2DGW A;  2J9D E;  1U0S A;  2DIV A;  2QTW A;  1OQ3 A;  1HNX F;  2DHH A;  2YTC A;  3TAQ A;  3TX8 A;  4PCQ A;  4ZPD A;  2K3K A;  3M05 A;  1S48 A;  1QAX A;  1HNI A;  3DLG A;  4WFB Q;  3QJP A;  3N6N A;  2BAC A;  1Y3K A;  3ENV A;  3CCR S;  5DJB A;  5HMX A;  1X4C A;  4ZVE A;  3MMA B;  3DOK A;  3HFZ B;  4ECS A;  1GEH A;  3KLH A;  4DLE A;  2LEB A;  5F8H A;  3D67 A;  4IOA Q;  4DFK A;  3X3U A;  1VHI A;  3DRY A;  4IFV B;  2DNO A;  1R0C B;  1K44 A;  2BVZ A;  2L3M A;  2IY5 B;  3WC2 A;  1B70 B;  4MFB A;  1H0H B;  2MJN A;  3RAQ A;  2DGQ A;  4H4K A;  4ANE A;  1RU2 A;  4XK8 C;  5DZ7 A;  1DQ9 A;  3NBP A;  1FDD A;  2BQ3 A;  3TAM B;  3LWM A;  3M6V A;  4JV5 F;  3TYT A;  4ED5 A;  2GA7 A;  5DGB A;  3G9C A;  1J5E F;  1K8A T;  2GJI A;  2R3V A;  1N6Q B;  3AD8 C;  4NL5 A;  3MM5 A;  3RJM B;  2K06 A;  1FE0 A;  4CDI A;  3GIL A;  3OTB A;  3UCU P;  1TKZ B;  3W9H A;  1FX2 A;  4OHY A;  5H9F K;  2VB6 A;  3GII A;  4X62 F;  2L48 A;  2HWI A;  4DQQ A;  2GNK A;  1CVJ A;  3UDL A;  3M8Z A;  4YR0 A;  1RWK B;  2YNG B;  2OPP B;  3C16 A;  4LRE A;  1YX2 A;  4YB7 A;  5DM6 Q;  3DXB A;  5AJ3 F;  3MFI A;  4EEY A;  1TZ0 A;  3BSA A;  1CS4 B;  4I2P A;  2AU0 A;  3IR7 B;  3ICL A;  2K2P A;  3BSO A;  1YZ7 A;  4LRA A;  3MR6 A;  2HHV A;  5E0O A;  4P9S A;  2EFG A;  4LIR A;  1VQN S;  1VC0 A;  4OYX A;  3GIR A;  2ZJP Q;  4HDH A;  4F2R A;  4PXE A;  4RL1 A;  5IM0 A;  2ACM A;  3MUR P;  1NJY A;  2D7S A;  2IVY A;  2UUW A;  2G4B A;  1WG5 A;  1Z2Z A;  1B99 A;  2Q6C A;  3RW7 A;  3V6K A;  3LP0 A;  3MM6 B;  3SV3 A;  2MQL A;  3SMZ A;  3FCV A;  3IMQ J;  5B0B A;  4ZJQ A;  5B0D A;  4WP3 A;  2ZH2 A;  1ZM3 A;  1H6K X;  2XMA A;  2ADB A;  2PEH A;  1Q8B A;  1JLF A;  4EYH B;  4JI6 F;  5AXN A;  2VBY A;  3OR2 A;  5DG8 A;  3R9L A;  5HRO A;  5C5J A;  1H2U X;  1GFW B;  3AAW B;  5CQG A;  5KFT A;  2AJF E;  5IWA J;  5B09 A;  2QL9 B;  1F2G A;  5J1E A;  1SKS A;  4RBT A;  5I3U B;  2HHP A;  4C8Y A;  2KHD A;  4LSL B;  3H4D A;  3JQJ A;  3NS5 A;  2CA9 A;  4C0O C;  2PFF B;  1NCL A;  2BAN B;  2UU9 F;  1NK9 A;  3A3P B;  5IS2 A;  1XC9 A;  4EU0 A;  3UD3 P;  1WOS A;  2QL7 B;  4KHM A;  2CDR B;  3T1A A;  2K1R A;  3KDN A;  1ZPW X;  1R89 A;  3PKM A;  1RA7 A;  3KJV B;  1NKC A;  2YKN A;  3DN9 A;  3BH7 B;  1B7Y B;  2IM2 A;  1Q1K A;  3D9B A;  4ZIW A;  4ZK7 M;  2B7C B;  2ZWO A;  5FLX Y;  1RTD B;  2MHN A;  1NHU A;  3PO5 A;  1FJE B;  2I5J B;  1CC7 A;  1F5C A;  2VOP A;  2ATC B;  2PN6 A;  3BSC A;  2FJV A;  3IBC B;  3DLK B;  4KKO B;  1UPP A;  4CT9 A;  2OGU A;  1U0H A;  4WYL A;  3Q2T C;  4G3I A;  2JVO A;  3FZB A;  4OFZ A;  4N76 A;  1XMB A;  4ZJL A;  1JJ4 A;  3BDP A;  2VJU A;  4DF8 A;  4RNO A;  4NLQ A;  1NO8 A;  2ZH9 A;  3BPD A;  1YKW A;  3VAL A;  2HRY A;  4FNI A;  4PQU B;  3R5G A;  3QRR A;  3ZZZ A;  3CED A;  1HW8 A;  4A8X A;  2M4M A;  1KC8 T;  3MMB A;  1PSD A;  4NEZ A;  2ZOG A;  4LF8 J;  4DV4 J;  4B9M A;  2JDJ A;  1CJK A;  1FKO A;  2J6S A;  4P7V A;  5A6W A;  4EBD A;  3PDN A;  3GV7 B;  1JLC A;  3DLG B;  4O3O A;  1F6T A;  2ZEJ A;  2E7V A;  2MKY A;  5KG6 A;  4KGK A;  2MQM A;  4DV1 J;  1RHK B;  2RJZ A;  4LQ3 A;  1KWM A;  1Y3J A;  3DOK B;  2CWX A;  3GZ7 A;  2J7W A;  3MEG A;  3KLH B;  1EB0 A;  4ZPC A;  1DAX A;  2IA0 A;  4KIA A;  3J7Y U;  3B6B A;  5LM7 E;  4UUW A;  2CDQ A;  1IKW A;  4GKK F;  1RHU B;  2X51 A;  4OX9 F;  4ZHR A;  3RAM A;  3TR5 A;  4IH6 A;  1H74 A;  4NPO A;  3Q83 A;  1TL7 B;  1WUU A;  4P75 A;  3MCS A;  3G86 A;  2YX4 A;  1TKX B;  2PI4 A;  1SJ1 A;  2P8I A;  5A6P A;  3GJT B;  3NBP B;  5C25 A;  1VQP S;  2EEY A;  2KXF A;  2DR8 A;  4B3S F;  3C14 B;  1NXI A;  1E6Y A;  2VBW A;  3E2E A;  2OD6 A;  3C15 B;  3I0S B;  3MM9 B;  3L09 A;  3CWJ A;  4QOT A;  1S7I A;  3P45 B;  3QQC D;  4M5K A;  1IQZ A;  4YN3 B;  4WKY A;  1S9F A;  2AT1 B;  3VCD A;  3GTY X;  1WOP A;  4ICL B;  1S6P A;  1FXR A;  2MZS A;  1XNQ F;  1TU0 B;  1IUJ A;  2YQ1 A;  2MKH A;  2QSW A;  3UR0 A;  3GR0 A;  3C16 B;  2PMW A;  4C8M A;  2IAJ A;  1JKH A;  3PO4 A;  1LOU A;  3OUY A;  4KPY A;  2XGQ A;  3Q89 A;  3V6J A;  2XHW A;  4I2P B;  3PYG A;  5IXU A;  3HK2 A;  4RJV A;  1ARO P;  4ZVO B;  1REV A;  3LPE A;  1H2V Z;  3HFV A;  2UUB J;  1KHV A;  2N3L A;  1QTN B;  2EG2 A;  2UV8 A;  3TQE A;  4P73 A;  3MR3 A;  1FVS A;  2B4O A;  4AXI A;  1EZZ B;  4PYD A;  3AB4 B;  4RKU C;  5LMN F;  1BQN A;  4KR0 B;  4WIQ A;  2DY1 A;  4TU9 A;  1NDK A;  1FNM A;  3TZX A;  4AL6 A;  3K57 A;  4A8Y A;  1IWA A;  1RAA B;  4DR6 F;  5GAG I;  4OZL A;  4RUB A;  3RZA A;  3DOL A;  2H5J B;  1X4A A;  2LXF A;  3AQO A;  2DEI A;  1SC6 A;  5E3P A;  5D4L A;  3ZTR A;  2ZFH A;  4UW2 A;  3HDS A;  3KOA A;  1IQT A;  4URG A;  1TV6 A;  1SI9 A;  4RX6 A;  1HBO B;  2AW0 A;  2OAU A;  3EDQ B;  4DV3 F;  1VCT A;  1YSJ A;  5HAT A;  1MU2 A;  4EWT A;  2HZA A;  2WAQ D;  1SH2 A;  2VL1 A;  3PRV A;  2MKK A;  2DXE A;  1NAQ A;  4KC5 A;  1S9G A;  3GIK A;  1XIQ A;  2HGM A;  3W9J A;  3L9Z A;  3I5B A;  3ENW A;  5KFH A;  3JYT A;  4AT1 B;  4H4K C;  2AEM A;  4LBP A;  2K1R B;  3DRP B;  4IKA A;  4DV6 J;  2V50 A;  2RQM A;  2FGO A;  3CMQ A;  5K8O A;  4O44 B;  1FTC A;  4QWD A;  4C9D A;  2YKN B;  1UVK A;  4CO4 A;  1VJW A;  3B54 A;  2CPD A;  4ZKA A;  4A8Q A;  1VLY A;  1SKR A;  2XMM A;  2R9L A;  1RAD B;  4LF5 J;  3EZO A;  4IYQ A;  1VIS A;  4ED3 A;  2XZD B;  2MKJ A;  3UNG C;  1GTH A;  2FLN A;  3GYG A;  2EWH A;  4DWI A;  4F67 A;  1Y4Z B;  2VG5 B;  4F50 A;  2MLY A;  2P9G A;  2FVR A;  4I7F A;  2ZM6 F;  1VOM A;  4UZC A;  1U0H B;  3IRX A;  2FLP A;  4OHZ A;  4AQY J;  1WOR A;  2H54 B;  4QJV A;  3A8K A;  2WTF A;  4B3R J;  4QYR A;  5D4N A;  1T95 A;  4JI0 J;  2R8I A;  2MZJ A;  2R7X A;  4J9S A;  3UWT A;  1K0V A;  3D3C J;  2J0W A;  1LXJ A;  1KVK A;  2KT3 A;  1OYE A;  1WC3 A;  4GKJ J;  4KHR A;  4OYO A;  4KAI A;  5FJ4 A;  4HI1 A;  2HND A;  3ISN D;  2E1A A;  2BBE A;  2OUG A;  3VR1 A;  4USI A;  2DBB A;  1XMQ F;  4OX7 A;  3CD7 A;  1VK3 A;  3H5U A;  5FII A;  2EG1 A;  2K7J A;  2NXJ A;  4ELV A;  3CC7 S;  2DR7 A;  2AHO B;  3UD5 A;  4V19 X;  3HI9 A;  5IV4 A;  1BE4 A;  1NJI T;  4WYW A;  4MT1 A;  1OYD A;  2VZ9 A;  4DL4 A;  2X1F A;  4F4K A;  1JLB B;  1NSP A;  3UPF A;  1HQE A;  1UJ4 A;  3MED A;  2ZZT A;  2XBP A;  2J9C A;  1T7P A;  3MEG B;  3BQ1 A;  2DB1 A;  5KAK A;  1HMV A;  4LRD A;  1FI4 A;  1HD0 A;  2NXN A;  3O6Q A;  1KOO A;  2G9O A;  3R5B A;  3E01 B;  3B82 A;  2EC0 A;  4CLU A;  1RAE B;  4CLF A;  4ZHR B;  4GVB B;  1NBE B;  2VBX A;  1D1U A;  3A13 A;  2XZT B;  3LOU A;  1BMQ B;  2LVW A;  3RUB L;  3PVX A;  2ZH4 A;  2KN4 A;  1Q82 T;  3C8Y A;  4URS A;  1FFW B;  4OZ3 A;  1ROF A;  2GX8 A;  1FCA A;  1SBR A;  3UDC A;  5HQL A;  1IR1 A;  2L08 A;  1CJT A;  3DFE A;  4Z2X A;  4P71 A;  3BBC A;  1HBM A;  3P4U B;  2M5Y A;  3BQ0 A;  1LFW A;  3QO9 B;  5DDP C;  2BR0 A;  2FZK B;  3A8I A;  3P6Y C;  3MFH A;  3M8W A;  2J9E A;  1UVJ A;  3M9M B;  4LFB J;  5LT5 A;  2CRL A;  4QR2 A;  4DR1 F;  3T1Y F;  2LU2 A;  1RT4 B;  3KJQ B;  4LF7 F;  1GK8 A;  4LR9 A;  2AEF A;  4LFA J;  3TA1 A;  1N52 B;  2ALZ A;  2HQF A;  4CNY A;  2A6O A;  2JEI A;  1S6P B;  4DFP A;  2IDL A;  2RUS A;  2CYY A;  2W8K A;  2XO6 A;  1VLO A;  4CI0 B;  4IO1 A;  2IAJ B;  3FSX A;  1X9W A;  1EAR A;  2E66 A;  4CTA B;  1N5V A;  3OR1 A;  2OKQ A;  5B0E A;  4NE9 C;  4JI5 J;  4QWE A;  3S1T A;  1YJR A;  1GXT A;  1U4B A;  2MQQ A;  1S1T A;  5JVH Q;  1VQO S;  2VBZ A;  4C2M A;  4NZ6 A;  3NMA A;  3FJ2 A;  2J6U A;  1Y11 A;  2D3Z A;  2M70 A;  1VRT A;  3QBC A;  4PR6 A;  3VVU A;  2ZIT A;  2KG1 A;  3M8P A;  3K8W A;  2VH7 A;  1J5O B;  3TP2 A;  1JXL A;  1Z1Z A;  4FYD A;  4DCP B;  5KFA A;  2B56 A;  2RVJ A;  4TQR A;  3RB6 A;  1NRK A;  2KXN B;  4KGX B;  4NLX A;  3A12 A;  2C28 A;  1QE1 B;  4K4X A;  4GVL A;  1T9T A;  4MJK A;  2ROE A;  1U24 A;  3PR5 B;  1N36 J;  2GVD A;  7FDR A;  3LAM A;  2DO4 A;  1S1U B;  1V3Z A;  2B51 A;  3OT9 A;  2HFZ A;  3W66 A;  3HD2 A;  3NAI A;  3A3N B;  3H42 A;  5SUH A;  1RYR A;  4KSE B;  3AHP A;  1WKJ A;  1YIT S;  2CQI A;  4M5J A;  4FVC A;  3Q22 A;  1GX6 A;  1NUE A;  3GIJ A;  3IG1 A;  4YEA A;  1HI8 A;  2XQC A;  3GFX A;  2FJA B;  4CT8 A;  5HK4 A;  3J7Z T;  1ZBT A;  4IDK A;  4ZVR B;  3PW2 A;  2W4P A;  1S9G B;  1YLX A;  4A8F A;  1FRJ A;  1DTQ A;  2HVI A;  4IG0 B;  2HBY B;  5C2C A;  3JYT B;  5GVQ A;  4Q8E A;  2RDD A;  2VOO A;  4A8O A;  3FDS A;  3BQ2 A;  4DF4 A;  3H5S A;  4OX8 A;  2GV1 A;  3KLI B;  4K4S A;  5FDL A;  2HVZ A;  2W25 A;  4YY3 F;  2QLW A;  1C1B B;  5FD1 A;  4DMZ A;  3TUZ C;  3H59 A;  1HR0 F;  5A2Q Y;  2KH9 A;  4C6A A;  1KFD A;  4CIO A;  4O4G B;  3CME S;  4FF2 A;  2DRA A;  2B5J B;  2YNI B;  1FK9 B;  4PWD B;  1FER A;  5C7P A;  4ES1 A;  1HNZ F;  1NSA A;  4QYZ K;  1NJX A;  2DCU B;  3DI6 A;  2KKH A;  1IWG A;  4P2F A;  3HSZ A;  2V68 A;  3Q0A A;  4PKD B;  2Y3Y A;  1UW4 A;  1L3T A;  4MAK A;  4A8S A;  4DFM A;  4LRC A;  1W7W A;  4C0B A;  3IAS 9;  1PBU A;  4J90 A;  4ZCI A;  3RGI A;  2VFT A;  1HWI A;  1EX8 A;  2BQR A;  1RAF B;  4E0D A;  2VJV A;  1TVR A;  2A6M A;  4Z37 A;  3Q8P B;  4WPA A;  5B08 A;  1UFK A;  2C2E A;  1NHK L;  1PAE X;  4ZVP B;  5L38 A;  4WCE Q;  3TAR A;  1WJ9 A;  5BJR A;  4DL5 A;  1PGZ A;  2MEW A;  1HQE B;  3MED B;  2DCL A;  4WTO B;  3IR5 B;  1TKT A;  1JLE B;  3PW0 A;  1PYT A;  5F9L A;  4G1I A;  2G2O A;  3OXF A;  4CLP A;  2P6T A;  4USH A;  2LQ9 A;  1FTR A;  4QPT A;  3ZO7 A;  3FEZ A;  2QLF B;  3U02 A;  2YKO A;  3DCA A;  1FA0 A;  2XLI A;  2RDJ A;  1Q8I A;  2O66 A;  2YNH A;  4OZN A;  3MPY A;  4R0E A;  5C42 B;  5BR8 J;  1FRK A;  4H54 A;  5HAN A;  4QWC A;  3HCX A;  4RUH A;  2C3M A;  2GCF A;  1ZYQ A;  2NYH A;  3IS9 A;  5DDO C;  3TVK A;  1HKA A;  3Q8R B;  4L73 A;  4DUZ J;  2AX0 A;  2DK2 A;  2BW7 A;  4YR2 A; 
#chains in the Genus database with same CATH homology
 1RWX B;  2HBZ B;  2XZD B;  2CNN B;  1RHK B;  1RHQ B;  5IC4 B;  1GFW B;  3KJQ B;  1RHM B;  2FQQ B;  3D6M B;  1RWK B;  3KJF B;  4ZVP B;  2C2Z B;  2Y0B B;  4ZVS B;  3IBC B;  2C2K B;  1RWP B;  1ICE B;  2C2O B;  2QL9 B;  1PYO B;  2QL5 B;  1RWM B;  2P2C B;  3IBF B;  1NME B;  1I3O B;  1QDU B;  2H4Y B;  3R5J B;  3KJN B;  2HBQ B;  2CNO B;  1PAU B;  3GJQ B;  3EDQ B;  2CJY B;  1RHU B;  3EDR B;  5IC6 B;  3GJS B;  2H54 B;  1F9E B;  1RWO B;  1RWN B;  1IBC B;  1RWW B;  3GJR B;  2H48 B;  1SC4 B;  3R6G B;  1RWV B;  4ZVO B;  2C2M B;  3NS7 B;  2XZT B;  3SIP B;  1BMQ B;  2XYG B;  4LSZ B;  2QLF B;  4ZVU B;  1RHR B;  4ZVQ B;  2QL7 B;  3GJT B;  2HBR B;  4ZVR B;  1QTN B;  2H65 B;  3R7N B;  2CDR B;  2CNL B;  2QLB B;  1RE1 B;  2CJX B;  3D6H B;  2HBY B;  2H51 B;  2CNK B;  3R6L B;  3P4U B;  4DCJ B;  2XYP B;  2XYH B;  1I51 B;  3RJM B;  1RHJ B;  2DKO B;  2H5I B;  3R7B B;  1SC3 B;  2H4W B;  3R7S B;  4DCP B;  2Y1L B;  3D6F B;  3QNW B;  4DCO B;  3P45 B;  4ZVT B;  5K20 B;  1SC1 B;  2C1E B;  2H5J B;  2QLJ B;  4JB8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...