2H51B

Crystal structure of human caspase-1 (glu390->asp and arg286->lys) in complex with 3-[2-(2-benzyloxycarbonylamino-3-methyl-butyrylamino)-propionylamino]-4-oxo-pentanoic acid (z-vad-fmk)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
87
structure length
87
Chain Sequence
IKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTDRVTLTRCFYLFPGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Caspase-1
publication title An allosteric circuit in caspase-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 15
structure length 87
sequence length 87
ec nomenclature ec 3.4.22.36: Caspase-1.
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Caspase-like 2h51B00
2CNLB 2QLFB 2C2OB 1RHKB 3D6FB 4DCJB 1GFWB 2C2ZB 3D6HB 2DKOB 2CDRB 2FQQB 3GJSB 1RWPB 3RJMB 4DCOB 2XZDB 1RHUB 2CNKB 2C1EB 4ZVOB 4ZVTB 3NS7B 1F9EB 3P45B 1QDUB 2HBQB 2XYHB 2QLJB 1RWXB 1NMEB 1RHQB 3GJRB 3IBCB 1RWKB 1RHRB 1SC1B 2C2KB 5IC4B 2QL5B 1IBCB 2H51B 2Y1LB 2P2CB 2XYPB 1RWOB 4ZVQB 3R6GB 3R5JB 2CJXB 1PYOB 3KJNB 4JB8B 1RE1B 3P4UB 1RWVB 3D6MB 1RWWB 2QLBB 4LSZB 2HBRB 2H48B 2H65B 3R6LB 2H5IB 2XYGB 2H4YB 4DCPB 4ZVRB 2HBZB 1RWNB 2H5JB 2C2MB 5K20B 2HBYB 4ZVSB 2CNOB 1ICEB 1RHJB 3SIPB 1RHMB 3GJTB 3EDQB 2H54B 2Y0BB 2CJYB 1I51B 2CNNB 3KJFB 1SC4B 4ZVPB 1SC3B 3R7BB 3R7SB 2H4WB 2QL7B 1PAUB 5IC6B 3QNWB 1QTNB 1I3OB 2QL9B 1BMQB 3IBFB 3GJQB 4ZVUB 3R7NB 2XZTB 3KJQB 3EDRB 1RWMB
chains in the Genus database with same CATH superfamily
3GWCA 4J9NA 4LVNP 1APSA 5KT2A 4B3SF 3CJ8A 4MK7A 4RWWA 4U95A 1Y7PA 2NZCA 2EFOA 3RTVA 3EZ5A 2M7SA 1E6YA 3NY0A 3I82A 5B0BA 1HNXF 2C1EB 2VPWB 2FC8A 1SH3A 3K5PA 3MAAB 3C15B 2C3YA 2I38A 4KR0B 3V6JA 3GJRB 4NLQA 5KT7A 4M1KA 3CD0A 3UR3C 1T94A 1YK9A 3OHBA 3KLEA 1GMWA 2M9KA 1ZOTA 4DV6J 2F3JA 1Y3JA 3OTOF 1JMTA 3W2VB 3MM7B 1NDLA 1M0SA 3CC7S 4FXWA 2IA0A 3CCVS 1G3OA 2X1FA 3ULHA 4IRKA 2XB2D 3FQLA 5JJBA 1A7GE 1KN6A 2KTQA 3OD2A 3UNYA 3AFGA 2XMAA 2W7OA 4TQSA 4ZPBA 2K1RA 5AE1A 2R9LA 3KK1B 1Q82T 3J81Y 1ZYQA 4B08A 3ZTPA 2FJWA 4M5DA 2LP4A 4ECUA 1FD2A 4X65J 2RQMA 1C1CB 3MFHA 1S79A 4UQTA 4ERDA 1U8WA 1WSVA 1Y3KA 2PN6A 4FYVB 3KHLA 2UUBJ 4TNOA 4HHHA 4M5HA 1UVLA 3BKFA 4DMZA 1K1SA 4DSIA 4ZPCA 3N6LA 1R0AB 2LLZA 3AJ2A 1NLKL 2EK1A 4UY8T 1RAHB 2VHGA 5J2NA 1QDUB 2NXJA 4OYBA 2ASDA 3PYFA 2EG1A 2QL5B 1GXLA 2GVDA 1L3UA 3A3OB 3BYRA 2YNIA 2DJWA 2RKIA 2CJXB 5LL6d 4UQGA 3I5AA 2RQCA 3CDAA 4C8KA 4Q45A 2HZVA 5ETPA 3KK2A 5CXTA 4F50A 1S48A 1OQ6A 1UFKA 3ILOA 1NZ8A 1KONA 4IYQA 1CQMA 1RU2A 5KFMA 4PWDA 4IFYB 2WONA 3H20A 4PKDB 4F2SA 4DPWA 2XS5A 2WCXA 2LFVA 4QPTA 3MWBA 3GJQB 4UUXA 4Z7CA 3SBMA 4DPOA 4JI8J 2VOPA 1BWVA 3DMJB 4O3RA 3D1OA 1VS3A 1S10A 1XQIA 3BO4A 2GJ2A 3DXSX 3OFEA 1HNZF 4D3HA 2MQ8A 5L1KA 3W63A 3NCQA 3U27A 4HTIA 3DLEA 4B3TF 4UUWA 2UVUA 2MZ1A 2RAQA 2QIFA 4ILLA 4DPYA 4OJ1A 4J9VA 3OHAA 4FYYB 1LWEB 3QAEA 1N36F 2V63A 3DOLA 1OYEA 2LEPA 2Q79A 1HBNB 2P6SA 4CO0A 1F60B 4NXMF 1N0VC 1ICEB 4K4SA 4RW9A 2Y0BB 4OZNA 1O8BA 3HLUA 3L9ZA 3T1YF 1WC1A 1J5OA 1H3DA 4DPUA 3MOZA 2UU9F 1WKKA 3JTNA 3EPIA 4WXWA 2HEKA 2XMVA 1S9GA 4CM2A 4ANDA 1LWFB 4X66F 2QV6A 3I6PA 3MPVA 2C3UA 3MR5A 3PO4A 5H1SV 1Q8LA 4IDKB 1WNEA 2VJVA 1U1KA 3C8YA 5CYMB 2CPFA 5IFMA 2XCPA 3D6TB 1K8AT 1FJCA 2VBXA 4F4XA 4EO6A 4M5GA 3SCKE 5L9NA 1LK7A 5LXRA 2MKCA 2OI2A 5B0AA 3R97A 2DGOA 2VUGA 3ZZYA 3MOJB 2H51B 3M8SA 1B99A 2X51A 1AW0A 3LALA 1S6QA 3CCES 1UPPA 3HFVA 2DGXA 3IO1A 3EGVA 2A6MA 3U1MA 3NWGA 1TUVA 2ZKUA 1S12A 1YBTA 1X4CA 4IH6A 1OWXA 4U6PA 5J2PA 1ELOA 3DLBA 3TAPA 2IC3B 2DCLA 1AROP 1U26A 4CH7A 4ZIWA 3MEGA 1RKJA 1HNWJ 4K4ZA 1RTHA 3U1LA 4KB7A 5LMNF 4LF6J 4DR6J 1JJHA 2BE9B 2CDQA 3FUYA 4FVCA 1BUXA 1GAOA 1DFDA 2DHSA 4DFKA 4JI7J 3MMCB 3TA0A 2E1PA 1J2VA 4MIBA 2HAIA 5IC4B 1N32F 2FHJA 2R2TA 4YQWA 1F2HA 2RU9A 1CJTA 4G1PA 1H2UX 3V4MA 3NGKA 2J0WA 4R5PA 2R7XA 1E6VA 2B4PA 4NWBA 1NU4A 2DGUA 4CLLA 1JXEA 2HLTA 2XMMA 3UE2A 2W7PA 1FWLA 4ZVGA 2J0SD 2IM2A 2FIUA 1DQ9A 5FJ4A 2ZH3A 3RUBL 3HVWA 2Q3PA 1WC6A 1FKAF 3QBCA 3OBIA 5DQIA 2QSFA 3OXFA 5H9EJ 2V2VA 4F3QA 4K0KJ 3GR0A 2PMWA 3I0SB 3ZC4A 4B3MJ 1WELA 3A13A 3SI8A 1HWUA 1ZH5A 2FY1A 3W7BA 1ZTWA 5BYQA 2XLKA 3WDOA 1EETA 1SQFA 3KHGA 2V68A 3NNCA 1FJGF 4ZP6A 2VZ9A 4ED6A 1UFWA 3C15A 3GQCA 2IBOA 2Z56B 5CQGA 4TU8A 2HGNA 3EXYA 3BR8A 5KOXA 2C2RA 1S1VB 3EWGA 2UUAF 3DN9A 4J9RA 4DV5F 2EFNA 2ZOFA 3PRBA 3MM7A 4QIGA 1IVZA 4LF7F 3P96A 1MWZA 2UXBJ 1X5PA 2ZOMA 2H4WB 1ZZFA 2DY9A 4DV1F 4K59A 1LW2A 3BH6B 4IOCQ 3PW7A 4I2QB 4Y2KA 3LP1B 4C6AA 3KK1A 2HPUA 1S59A 3C16B 1MMNA 1S99A 4MKYA 3QFWA 2B8QA 1HNVA 1HQEB 3MURP 6FD1A 1YZ6A 5ETNA 1U1NA 4HHUA 5J1EB 3THVA 4KIAA 4KO0B 3WHIA 5D4OA 3N6NA 2C22A 2VG7B 2E66A 2X1BA 3K5LA 4LF4F 1HI8A 3IR5B 2DO0A 2BVZA 4XPEA 2CQ1A 1NDCA 1YWXA 3VVUA 4EO8A 2MQLA 3RAQA 4K4VA 1VC0A 3H42A 3GFHA 1TVRA 4UY85 1C0UA 3PTWA 4I0WA 4YHHJ 3CXCR 3ZXWA 2JEIA 2JL9A 1EKSA 4EMDA 2K06A 1HPZB 4ZVEA 1GTHA 2LU1A 1BE4A 2E44A 3C6TA 2IM3A 1SV5B 4U7UK 1T0TV 4CLFA 4RW4B 3R7BB 3ISNC 1TQLA 2UZAA 1KRPA 3HPOA 3EPGA 1F9FA 2FD2A 3P6YC 4IFYA 4ZJQA 4DFJA 4BWJA 1U45A 1TELA 1QAYA 1WG4A 1Q5VA 3H59A 4F4YA 1BLUA 1TTHB 3I32A 2MQNA 3JB9k 1X31C 4W98A 1HQUB 1V6HA 3IRXA 4URQU 4GKJJ 4MKAA 1F9EB 2Z58B 4QYZK 3QWPA 3GILA 2VH7A 3KJNB 5GAEI 2OTJS 2P6TA 2DRDA 4Y2AA 2WVFA 4J37A 1NBEB 1HMVA 4OYMA 5LJ3Y 1HIYA 1ZPVA 4DL6A 3FCWA 5IXUA 3Q2TC 3UCGA 1TUGB 2RDIA 2RB7A 2EBGA 3TA2A 5EGYA 1UEVA 1NB2A 2JSXA 1NDPA 1VQNS 3K57A 1KTVA 3M05A 2D41A 1KS2A 2W9CB 1RWUA 4IFVB 1TAQA 1AT1B 3BYPA 4EK2A 1D0EA 3W61A 3QO9A 5KFBA 1XMQJ 3EDRB 1TKZB 3HK2A 3CGIA 5D0HA 2BQRA 4PG4A 4OX9F 1DAXA 2W4PA 2VC0A 1ZS6A 4IDKA 4F0MA 2GMJA 3F0NA 5CYMA 1RT4B 2HZAA 2WOMB 3UD4P 4JI1F 4ZVOB 2HWIA 2RRNA 4F4ZA 5KAKA 1Q7YT 3OPKA 2C3MA 1VQMS 4RBTA 1DY3A 5T7LA 3I31A 2W1BA 1IR2A 3KLHB 4MMOA 1R8PA 4AL5A 5T41A 1XNQJ 1VBKA 4TU7A 1SB6A 3IAS9 3RW6A 5IZHA 2B7CB 1NEEA 1YZ7A 3JYTA 5KG4A 3FSYA 5HP1A 3GYGA 2QA1A 4JYAJ 5D4LA 2XEXA 1WI6A 2KO1A 4NCGA 4A8XA 1HLWA 3LGNA 3MMJA 3F73A 1YJWS 1NSPA 3BGLA 1HW8A 2YBVA 1B0VA 1UVMA 4LMZA 3MTKA 1YTYA 2IC3A 2MKJA 2R7RA 1X9WA 4KSEB 2C2OB 1RHKB 2YNHB 4NA1A 1VFJA 4EUVA 4WFNQ 3N9UC 3KHHA 2LXFA 3G6XA 4C8OA 4Q43A 4NZ6A 1WC0A 4KBIA 1SQEA 3TZXA 1FRXA 2R7SA 1SKRA 3SYZA 4DV4J 4BLGA 3TYTA 5F8NA 2DGQA 2OO4A 4WPAA 5JVGQ 2XI2A 3FK4A 4ZPAA 4LSNB 1MWYA 3UVJB 2HVEA 1X8DA 1CG2A 2ZC4A 3DRXA 4NLWA 2ZDPA 2FLLA 1FJ7A 2CQ3A 4OMFG 4RR5A 3W3SA 2ACYA 1OQ3A 2Y0SD 2XS7A 4CH1A 4HDHA 2AJ4A 4ITSA 5A76A 4C2MA 1T03B 1AUDA 1SJQA 2CPIA 2LQ5A 2PSZA 5E41A 4FZVA 1X4DA 5A8KB 4NI2A 2YWFA 1VJWA 3W66A 1LFWA 5LMUF 2FC9A 1EB0A 4F7VA 1HHSA 4P72A 2B9XA 3IA0A 4RNFA 2NYHA 3SMZA 4OZ0A 1FERA 1O6XA 4QR0A 3I0SA 1WI8A 2FQQB 5ETTA 2VIHA 4FXDA 4JV2A 4M5IA 3DGPB 3J81j 4USIA 4CM0A 3B4DA 5EX0A 2A6OA 4K5RA 1FXRA 4X65F 4YB6A 1MMDA 4G1QB 4XDCA 1I6JA 4E8UA 2AKWB 2JOQA 2DR8A 3P5BP 1U1RA 2UUBF 3AHPA 1U6BA 5D3GA 4BWMA 3Q86A 2IMWP 4G6VB 3TX8A 5C25B 2FPHX 2R42A 5E5NA 2ZHBA 5G0RB 2C2MB 2EG2A 1OY9A 5KG0A 4LBHA 2HQ3A 1S1VA 4AL7A 3IRWP 3GZ7A 1RI7A 2MZTA 3L09A 2L41A 3THPA 3X1LB 2G4BA 3MEEA 1NHKL 3Q83A 1SIZA 4DR7J 1FXLA 3U7JA 3MM9B 3BGRA 1UEUA 1RWMB 5J2MB 4V19X 1JLEB 1Q0NA 5DS7A 4I2QA 2IA6A 2X7IA 2BJDA 3K89A 2L9DA 3LP1A 3NLCA 1QAJA 2YKOA 2QLWA 5CYJA 2Y1RI 1HQEA 3KKFA 1NSQA 3NAIA 1BGXT 1QSLA 4X4OA 5J1EA 1IKXB 4RUCA 5F3ZA 2HHUA 4B9TA 2AV5A 4DF8A 3GONA 2FVSA 4WP9A 5CH7B 2VG7A 3CEDA 4C8LA 2QA4S 3HD1A 4NLRA 2LQBA 2V0NA 2E29A 2YKNB 5HMYA 3R2DJ 2FYXA 4LF8J 2MY7A 4ZJLA 1FRHA 4NLTA 1ZM4A 4B3RJ 4IO1A 2AF6A 1PC5A 3KNGA 3ISND 2XWXA 1R8HA 5D4NA 3SXLA 1X4EA 1SV5A 4PUOB 5KFZA 1JWWA 4RW7B 1HR0J 1RAJA 4F04B 5DLGA 2M2BA 2AHOB 2UUCJ 5HMZA 3RR7A 1FKPB 4YFUA 4CT8A 4HHJA 3PEJA 2HLUA 1ZBTA 4U96A 1X5SA 4QOTA 4YY3J 4KH1B 3LAKA 1R8BA 1CC7A 4PCQA 1NK7A 4OHZA 3OXGA 5I3QA 1YI2S 5KG6A 1QVFR 2FJDB 3ETOA 4DEZA 3CJKA 2IDEA 1HQUA 2C2DA 4DU8A 4B9UA 1BC6A 4WCEQ 1PO6A 3TP2A 1JLFB 3OW2R 4EBCA 2VASA 4GC7A 5FIIA 1I5OB 4I6AA 3DLLQ 4R8UB 2XS2A 1NJIT 3MR3A 2EKYA 1N5TA 4WKRA 3MMBB 4FF1A 4TLRA 1EKRA 3IS9A 2QYGA 5CA5A 3FBFA 1F2GA 1VIOA 1GTEA 3CCTA 2FVQA 3SCIE 4X4TA 5T14A 2YVSA 2ZE2A 3GCWP 2IY5B 2KZMA 2DCUB 4HR2A 2HFNA 4KGKA 1RZMA 1MU2B 1UW4A 1CJKB 2CWXA 2HK2A 1GT8A 2GMHA 1B70B 4YP3A 2W9CA 4ICLB 3KJQB 4Y2CA 4X4PA 3RYLA 1IQZA 1U2RA 4K5SA 2JH3A 2MLXA 2DNQA 3DI6A 3PYEA 4KHMA 1H2TZ 4PG8A 1LFPA 2D9OA 4WK1A 5L1IA 3RJMB 1RT5A 4ZVTB 3P45B 4LR9A 1RT4A 2W9BA 2WOMA 3EGNA 3H7HB 4QWBA 1YHQS 5AE3A 5HK4A 3HZGA 3DLGA 1PYOB 3CC4S 4CLWA 3QJPA 4JI7F 2HIYA 3KLHA 3K17A 1P1TA 1DZ5A 1T7PA 4C98A 1ZETA 1N0UA 3RB6A 1S4FA 1FKOB 3NG8A 2MHEA 1JLAA 5HROA 2R8HA 3G96A 4QR1A 4LVOP 3KLGA 3KG1A 1H7WA 4Y65A 5FLXY 3NGRA 3JSBA 2IRYA 2XZTB 2DXFA 2MSTA 3THTA 3QFHA 2AT1B 2CNLB 1Y10A 2DNOA 4P2XA 1W7WA 2HNYA 4L3KA 4DBQA 2HWTA 4YMEA 3AJ1A 3D7SB 2DRBA 3HX9A 2YNHA 2R8IA 1U1PA 4YR3A 1YQHA 5KFCA 2XZDB 4ZN1A 1H38A 4Z2XA 3GG0A 3T6JA 2BACA 5D8HB 4RJVA 1MROA 2GHWA 3CD6S 2ZH9A 5ITHA 3QGGA 4Y3CA 1CPZA 5DDQC 4R25A 4B3MF 3RBEA 3FRYA 4LSNA 3UVJA 2N4CA 4FYDA 4H4MB 4OI6A 4ED2A 1RTDA 1GK8A 4B17A 4WU3A 4YDXA 1TL4A 2HNDB 1YJ7A 3ZZ0A 5IC6B 3GFZA 3KTQA 4X4UA 2CA9A 4ZVUB 4LRCA 2ZBRA 1UWBA 1X4FA 3AOAA 4P6QA 2OMOA 1S9EB 3VCDA 2UXBF 3DYAB 2VOOA 1P1LA 1UWAA 2B51A 4P7VA 2I2YA 1EP4B 5HSPA 1CJVB 3PKYA 5KFYA 3CB4A 3DGPA 3MUMP 1L3TA 2N7YA 2RQ4A 3M1VA 2C42A 1T02A 3FEZA 1N8RT 4HVZA 3IC1A 1IKVB 4RW6A 5C5JA 1SH2A 3OTEA 3QGIA 3GIMA 1ZM2A 1XR5A 1N5SA 4ATNA 4WJBA 2V8PA 2NQPA 1JQGA 5ETRA 1FNMA 4HEA9 3RB4A 3JSYA 2IJFA 1RAFB 2B9EA 2YX4A 5B7WA 4F4AA 2VKRA 5HBMA 1D09B 1YVFA 2AJ2A 4QWDA 2E1AA 1YJUA 3D1QA 3GE9A 5KFXA 2CPJA 3DDNA 4EU0A 1RA7A 3US5A 4QZVB 1DBDA 7FD1A 5J2MA 1JLEA 4ZDNA 2I5JB 2YQ0A 4DSFA 1AYEA 1TL3A 2EWHA 4OZ3A 2IRUA 3H98A 2H1YA 1DARA 2JEFA 3KLVA 3W9JA 2PA3A 1RB0A 2ABYA 4F0HA 1VDHA 1RE1B 3FBEA 3MCSA 4RUHA 3M9OB 2DTJA 2H3EB 3HT0A 5J2QA 4USUA 4ZHRB 5HLFB 1JB0C 5B08A 1X5OA 4L74A 4NYZA 2FTRA 2QA4G 3RGIA 2KDOA 3D3BJ 3AXKA 2NUHA 3O8WA 2XSJB 5E2QA 2CNNB 2RT3A 1QUPA 3C46A 3I5BA 1C0TB 3B6BA 2QL7B 1KLMB 2DIVA 1PAUB 1LK5A 3QNWB 2FGCA 2B4UA 4GMKA 2JWNA 4LREA 3HHLD 1XTZA 5KTQA 2OPQA 2OPSB 1RYRA 4GKKJ 3T1HF 4DN9A 4DG1A 1FKPA 2GJFA 3GMGA 2ATLA 2JLEA 1VRQC 5F0UA 4LFBJ 3I87A 4GVLA 1OO0B 3VR1A 2KRBA 2VFUA 1WC4A 2CYYA 3PJ9A 1ZA1B 3UR0A 4PABA 4MIWA 1SC6A 2ASYA 1JJ4A 1XBWA 3QRPA 1IBCB 4DR1J 1RWOB 4ES3A 3ZNJ1 1JLFA 4B3SJ 4R0JA 1IQTA 1U47A 2VFRA 2G9OA 3PKMA 5LSRA 1L3KA 3DHXA 2FJAB 4ZVRB 5AXKA 4ES1A 2YX1A 3MMBA 3HSGA 1NK6A 3ZNUA 2B6AA 4I69A 3LQVA 4USMA 4DQPA 4OI2A 5DGBA 2ALYB 5MLCV 3OSNA 1VRUA 3OTOJ 2CZVC 3OFFA 2CVEA 1K44A 4LF2A 4DN0A 1MU2A 1VJQA 3PIOQ 5HO4A 1SJ3P 1TKTA 2XMWA 2J6SA 1N5QA 4ICLA 3K58A 1MNEA 4DDFA 3D6HB 4CO1A 3HVRA 2OH2A 4RNHA 2AYGA 4C4WA 2XO6A 4JYAF 2K7KA 5KFRA 3FSXA 2FJBB 1JLBB 3CJ2A 3IG1A 2KZZA 4PXEA 3MCOA 4J90A 2XMTA 2FVPA 2EFPA 2LEBA 1NK9A 4FXVA 3HSDA 2V8VA 2XI3A 3TQ1A 1F3VA 4OHVA 2E1CA 1XR6A 1CULA 2E1MC 2YNGB 3N01A 4DV4F 1T05A 2AGQA 2PMZD 3H2VE 5K8NA 5HN0A 1FK9B 4D3GA 2XY7A 2FHMA 8AT1B 2UUWA 3UN3A 4FP9A 4UZBA 3HO1A 4LFCJ 2U2FA 4OJHA 3M9NB 5SUHA 3TZYA 2V2ZA 3IBFB 1LQ9A 2EC2A 2BUNA 2BR0A 1VHFA 2A1BA 3BS9A 4A8SA 1PSDA 4DZ6A 2BABA 4N47A 4FYWB 3QJLA 2LMIA 2K8GA 4BC9A 3BEGB 3A8EA 5IOLA 3JAMU 4NLXA 2Q43A 5HQLA 4U8YA 3ONQA 2HWHA 2AJFE 1N54B 2P2CB 3TANA 3W60A 4LSLB 1SKSA 5ETQA 4ZVFA 4DR3J 3SZ2A 1X7VA 1DTQA 4NYPA 3T5LA 3MECA 4ED8A 1IXKA 3LF0A 1KHWA 2DITA 2RHQB 3RRHA 3MM5B 2RS8A 2SXLA 3ENAA 2OIHA 5ETMA 2YKMB 1WHYA 4WZQA 3CWJA 1Q78A 2RMLA 4H4MA 4ECZA 3HKZD 2U1AA 3PRDA 1R6YA 1FNOA 4O0NA 2PDAA 1RKIA 3RRKA 3VAHA 3H5XA 3AT1B 1N36J 3UQSA 4JV1A 1PYTA 5AXMA 3D4JA 2C3OA 2V5HG 1JXLA 1YRUA 2C2NA 2R3VA 1PJ6A 3W64A 3BB5A 1LWCB 3IFEA 3SQGB 1OS5A 2DHAA 1GX6A 2LXUA 2BJ9A 5A8WB 2DR6A 4O3OA 3RG6A 1NH8A 3LGHA 2UU9J 5L38A 5D6GA 1JIHA 3DYAA 4ZLLA 4DCOB 2NUUG 3C19A 4K50A 4X66J 3PV8A 4QW8A 2P8IA 3WX8A 4FBUA 4DXLA 2OTLS 2IIHA 1KBRA 3AD9C 3W9IA 1JNRB 3N28A 3QAUA 2F4VJ 4FF3A 2Z2YB 3PHEA 3GTYX 4UOCA 3IXQA 2KXNB 2R2UA 1OYDA 3G6ES 4DSLA 2YWKA 3MEDA 1IKVA 2Q6BA 4Y28C 2LDIA 4WIIA 5KG5A 4L3NA 3DFEA 1RADB 4GC6A 3VGTA 4ELUA 1FFGB 4OYXA 1M5VC 5L1LA 3Q8SB 2FY8A 4JV0A 1PC4A 5E0OA 2MJUA 2VPYB 3R7NB 2YH1A 2B5JB 1EZZB 4E98A 4ZIVA 3KOAA 3M2RB 3L95X 4B3RF 2QMWA 2GX8A 1R8AA 2VFSA 3J80U 1XK8A 2DGWA 2DIUA 2WBMA 2E5JA 3BM7A 2HMIB 2FZGB 5K14A 2HFUA 4USVA 1H2VZ 1BY9A 1T9VA 3TAMB 3BKTA 2FZKB 4CIOA 3Q22A 3CIZA 1S6PB 1TV6A 3ZTSA 1OMSA 4ED5A 3HKWA 5HVGA 5K20B 2CFXA 2HQIA 1UMJA 3BV8A 4WIQA 2PGCA 4DQQA 2FJXA 1N32J 2IHR1 4QBUA 1F3FA 4J9MA 1TFWA 1XERA 3CCZA 1BMQB 5KG7A 3MHYA 2VQFJ 1HWKA 2ZWOA 1C0TA 1VMBA 3CCRS 2IYGA 2CADA 5KFNA 1KLMA 4YB7A 4ECRA 2YWWA 3Q8YA 1Z4UA 4KE5A 4O3NA 4FKXA 3D66A 4JP8A 3KLEB 2MSSA 4RNNA 3IBWA 4DQSA 3CDEA 1SCJB 3H90A 4MK9A 4CNZA 3DRRA 3QSYB 3LAMA 1RHRB 1H74A 2DPIA 4B3OA 1M5HA 4F8RA 1Q1KA 4ZOSA 1NPRA 4IUFA 3QGPA 1WC3A 1KC8T 3ZFVA 4MJKA 4A47A 5IT9Y 2Q6CA 2A0FB 4O4RA 3PVXA 3V6DA 4USHA 4IQMA 5AJ3J 2F8EX 1N48A 4UZCA 1HHQA 2CJYB 2EK6A 3UDLA 4AL6A 2E5LF 5KFVA 2HQFA 2RNEA 3GG1A 5KT4A 1EX8A 2QL9B 2QX0A 2HHXA 5J2NB 2KKHA 1HBOA 1U1OA 2JC0A 3VV2B 3FEXB 3ET6A 2YNIB 2OPPA 4DV5J 5D78A 1UTAA 2AQ4A 5C7PA 4KPCA 2Z57B 4LF7J 3SCJE 1H98A 3JSMA 4ZCIA 1YJ9S 4DHVA 2GS8A 3SSQA 1VHIA 2APOA 2KHCA 1UETA 3P3DA 1C4CA 1GQEA 2J7KA 3HFZB 4OLOA 2WONB 1S1WB 4K4YA 3G4SS 1K1QA 2CZ9A 3DRPA 1RWWB 2O3DA 3RAMA 2KXHA 4AFFA 3OTBA 4I7FB 3C66A 4J9KA 2ZJRQ 3GLJA 4ZS6A 4LF4J 4FKYA 5DETA 4LF5F 3EM1A 3SV3A 3LO3A 1IKWA 4PYDA 3DLEB 2IYIA 3G82A 2Z2MA 1WG5A 4WBFA 1JK9B 3IP0A 3BSNA 4NCBA 1WEYA 4J5OA 3WX4A 3TR5A 3UDCA 3DOLB 2PE8A 3FC9A 3H5YA 3ILLA 2VPXB 4OX6A 3BSOA 3AB2B 4RW9B 3PW0A 3TUIC 2UXDF 1J5OB 2EBEA 1WUUA 3AB4B 3T41A 5DDOC 4GVBA 3R5JB 2GVZB 4RBUA 3R1HA 3JTOA 3CW2C 1S9GB 4FF2A 4LSLA 1VK8A 3AOCA 1HD0A 4JI2F 3ENVA 2MQPA 2I9SA 4I4BA 2O01C 1T8EA 4IH5A 2BM0A 2PC6A 1OY8A 4ZN3A 3O5TB 3MM5A 2BJEA 2HHWA 2AU0A 3PCOB 3DOMB 2YKMA 4NLGA 1HFEL 4EGLA 4LFAF 2QT7A 5DG7A 3J81U 3M8ZA 3Q2SC 3V81A 1KQSR 2MKHA 2WVDA 2K3KA 1O51A 2E5HA 2KU7A 2JFDA 2J5AA 1KOHA 4N77A 3IWLA 2CPYA 5CHCB 4EBEA 1HWJA 1LWCA 4PRFA 1FO1A 3MFIA 2N3OA 4KH0B 4A8QA 1S7HA 3IM9A 2VFVA 1HI1A 2XLJA 1WKJA 1N34J 2IVYA 3H8YA 1RJJA 5LSOA 3K59A 3EZUA 4B9NA 4OX9J 1TAUA 4CLTA 4K8RA 1HL6A 2HGLA 2JC1A 4O0IA 1Y5IB 3R6LB 2G1DA 1RTHB 4M95A 4JI1J 4O44A 4KGVB 2CNOB 2O66A 2ZH1A 1IBMJ 2GQQA 9RUBA 2CKWA 1RBOB 3R2CJ 2VQEF 4ECXA 2A3JA 3HJVA 2NLWA 2HRTA 5EX3A 3VAMA 3G71S 4DUYF 3ZTQA 4DR4F 2A2DA 1NKCA 4CNYA 3H2LA 1NPPA 3Q23A 2B5JA 2XTJP 4WF9Q 3M2RA 4R5PB 4U7CA 3BDPA 1E6VB 1O0PA 1R7IA 2BXJA 4UOGA 4TY9A 5DDPC 1TL5A 4DZDA 4CO3A 4HT7A 1TK5A 1LXJA 3NCPA 2HMIA 4GKKF 3O2IA 4EEYA 2ZUAA 5DZ7A 4CLKA 5I3UA 3JQJA 1I94J 5I3PA 3VAKA 1S6PA 2GIQA 4Y2MA 1LWXA 5LSLA 2R7QA 3A4TA 1S1UA 1VQPS 4ANCA 4GRSA 4TKTA 4WP3A 1RT6A 4G1IA 3EVMA 1B0PA 1CJUA 3HT3A 1NJZA 2DGSA 4JUZA 1FTCA 2ROPA 4DR1F 3KJFB 4OZJA 2KFZA 1EETB 2HYIB 3DOKA 4HI2A 1PAEX 3NXZA 5L9XA 5GMEA 4DV7F 1VQ9S 2W2NP 1JLQA 2L9WA 4OHYA 9ATCB 2DRAA 1HKAA 2CRLA 2W01A 4OQJA 3UD3P 1LNQA 3DLJA 2NPFA 2R7WA 4DV3F 4LQ3A 4ZLJA 4ZKAA 4LIRA 3FCHA 2JRSA 4PXBA 1U2FA 3I9V9 2HNZA 1IN0A 4DX5A 5LMUJ 4AQYJ 3R3TA 4P2SA 5FDLA 1UW9A 3U1NA 1MG7A 3NOGA 2E1RA 1WEZA 1HI0P 2VDHA 1WTFA 3R5BA 2GAGC 4JB8B 2KH9A 1ZPWX 4YOEA 3DM2A 1LW2B 3QT6A 1FE0A 2ZBQA 2H65B 2PO4A 1VC6A 4IR9A 4OJ3A 5K8OA 5HQMA 2DHGA 1JLGB 1O5JA 4B9MA 1HNVB 2B43A 3GJTB 2ZKTA 3SQOP 2GHPA 4DLGA 1L3VA 2CPEA 2MY8A 1SC3B 4C3MA 1V3RA 5JMNA 3KMSA 2J9DE 5KT3A 1U6ZA 1IWAA 1HBMB 2YKQA 1JJ2R 3JQMA 1U02A 3M2UA 3PW4A 2MGZB 7AT1B 2N7CA 3POTA 1Q7LB 2E7VA 4N41A 1UJ5A 3FRZA 3H40A 1TVRB 2QRRA 1C0UB 1MWQA 2QE5A 3MF5A 2AYBA 4NLSA 3IR7B 1HNIA 4LFCF 2LDYA 5KFGA 1RT3A 3N79A 2ZH8A 1JNZB 3B54A 3C6TB 2CQ4A 2QLJB 3QT7A 3TUJC 1FF2A 3MM8B 4OHXA 1S1WA 2V6AA 1SKUB 1FT8A 3OLBA 4C8ZA 3GIJA 2B4OA 2MTLA 2HFZA 2RRAA 4I7FA 2DNGA 7FDRA 4NRUA 4URGA 4UF4A 4DR3F 3IRXB 4AE5A 2PA8D 4DX8H 4USWA 1QVGR 4WK3A 4DR2F 1TMMA 5IS2A 1T9XA 1IM4A 4LJMA 5IM0B 2Q66A 3QSIA 4CO2A 4DOZA 4P75A 3HHEA 5IWAF 3VGSA 5F8MA 2CPXA 3M32A 2RDJA 1TU0B 2FGOA 1HMVB 5LM7E 2R8JA 3EGZA 2M8HA 2BMBA 4BC7A 1RWPB 2RSQA 2V4QA 1T9WA 5CABA 5MAOA 1NK5A 1N5YA 1IM6A 1F5CA 1OJ4A 1SXLA 1BQNA 2PD1A 2ROEA 4Q8FA 2B0GA 3KHRA 2EXUA 2J9CA 1S0OA 2DISA 5DGAA 4YB5A 5DQHA 1R6VA 4NZ7A 4MFBB 2DHHA 4RU2A 1PBUA 1S49A 3CCMS 2XGPA 3QO9B 1WACA 2LKZA 2GVZA 3GIIA 4C8MA 4HYKA 4ZPWR 2OPRB 2P9CA 3KJVA 2UV8G 1NJWA 4ED7A 2DVIA 4PQUA 2MZQA 1L3SA 2WBRA 3OJUA 3DHWC 1FRJA 4NE9C 1S0MA 3GR1A 3JQKA 1YKWA 3DCAA 2DGTA 4YS2A 2F4VF 3NGSA 1VRTB 2NS1B 3VVTA 3OR1B 4OI3A 1GXTA 4HTJA 4DF4A 3DOMA 4AXIA 5KG1A 3HM9A 4EBDA 5T7LB 3HSJA 3GFYA 5I42A 3D6FB 5HVHA 5B0EA 1S76D 2ZHAA 3E51A 1RTJA 2RU3A 2J6TA 4RZRA 4X2BA 3LH2S 3W8PA 2ASLA 1RT7A 4F3MA 3JYTB 3T3FA 4QQBA 3KMQA 5HP1B 2Z30B 1JLCB 1RT2A 3BO3A 3K5OA 1RSCA 1ZAXA 4NCGB 4L72B 2B56A 1RWVB 3HFKA 5F8JA 4HH0A 3FZBA 2HZCA 2K7JA 2MDAA 1NM2A 1S77D 2YX7A 2HW3A 3AD7C 4KAIA 5A6WA 3ITHA 1K9MT 1XMBA 1YRTA 1VBXA 1NNDA 2HIQA 1Q79A 3MGJA 4DPTA 2PFFB 4H4OA 4NYOA 4ED0A 2D3O1 3TW0A 4ECQA 1DURA 4OX8A 5DM6Q 4G65A 3BH7B 3WC0A 2W8LA 3IWXA 3BQ0A 4KGMA 3D2WA 4IG3B 3A8JA 5DQGA 3TO8A 2FHOB 2Q1LA 4N5SA 1URNA 4YUDA 5E3PA 3NAHA 5CZXA 3S01A 4CO5A 2VQFF 1D9AA 5A2QU 3OXLA 2KT3A 1SJFA 3TUPA 4NI2B 2NSBA 2HFVA 4OYZA 3UN2A 1EAYC 4ZP9A 4CT9A 3AH6A 2AGPA 4TU9A 4IH7A 2EVZA 1KD1T 2LXIA 5KT6A 1V5VA 2XHCA 1R0BG 4C11A 3RB3A 2JVRA 4ZVPB 1FFWB 1MN7A 1YSJA 4KV8B 3EUNA 4BHQA 3SSSA 4W92B 4JI5F 2DEJA 4WE1A 1X4AA 4CI0B 3QRQA 1ZA2B 2M52A 5AJ3F 2CPZA 2AEJA 3F56A 2QLFB 4A48A 3EJMA 2CDRB 1B3TA 3KLFA 5D3GB 1NSKL 1FNXH 3C3LA 2CQHA 3FFIB 5B09A 1S72S 1F6TA 2XNRA 1FRMA 2YWHA 1RUSA 1W25A 3B82A 2E5GA 2KFNA 4Q0BB 2Y1LB 5KFJA 3HHLB 3MEEB 3D6MB 3IR6B 5M2RA 3H25A 3BGRB 2HFOA 2H5JB 2RUSA 2AWZA 3WC2A 4DFMA 3DC2A 2AMCB 1NO8A 2JZ5A 3OFGA 1UP1A 4FVMA 3S8SA 3PHTA 1RTIB 1JLGA 2F8MA 1DTTA 2R7UA 2WK4A 3KLIA 4EYHB 5HMXA 1QTNB 1KSPA 5HMWA 3G86A 3CJTA 2XC9A 2NPIA 1S4EA 4I6WA 2VD3A 1HBMA 3WBZA 4JI0J 3GV5B 4DX7A 1XNRF 5K5MA 4ZITA 4K4TA 4I2PB 1ZAWA 2MGZA 1FJEB 2EFGA 4NXNJ 4QPXA 5C42A 4ZA1A 3BGUA 2V8DA 3E01A 3QPIA 4DL5A 4ED1A 3PDNA 2KM8B 3CIMA 1WWHA 2MEWA 4QWCA 1V3SA 1NKEA 2Y8YA 5GVQA 2DR7A 3ELHA 2ZZNA 2ZJQQ 1M5PC 5GMDA 3MM8A 3L3CA 2V2QA 5KG2A 2O67A 1VQKS 5LXYA 3IM8A 4ID5B 3J7YU 1UVIA 3ADAC 3TA1A 1HWIA 2DH7A 2XMKA 1XR7A 2RQKA 4HL9A 3NMRA 4LT6A 2GIFA 3CJKB 3OL6A 1QD1A 1UFLA 1IJEB 1VI7A 2BQUA 2W2OP 1UEKA 2PIIA 1N33F 4PQAA 5L8RC 1RLCL 5IM0A 3RZAA 2YKAA 2D9PA 3OJSA 3QLHB 1TMJA 3I4HX 3IS9B 2RVJA 5DJBA 3MR2A 5BR8J 2YNFA 1HARA 3H4BA 1SL2A 5E3RA 1J5EF 4F2RA 2ZE2B 3T1HJ 3KYLA 3J80Y 3AJDA 2HG4A 3CO9A 3ILIA 1HW9A 5ETSA 5THWA 2AIRB 3PG9A 4PWUA 2P9GA 1QTMA 2NXEA 4IOAQ 1GNKA 1WJ9A 4MFBA 5CAAA 3LP2A 2W24A 4ZVSB 3VQSA 1N34F 3DI6B 4RW8A 2OPRA 3T5KA 3FMWA 4DQRA 3BN7A 3GV7B 2FLNA 2J8SA 1S1TB 3M8PA 2W2PP 1RT5B 5LOQA 4Q2MA 2A2CA 3W5XA 2OP5A 3PXGa 1VISA 2D3OR 3HSZA 5DZ6A 4F67A 2W9BB 2CQCA 1VRTA 1SVDA 6AT1B 2O5DA 3OR1A 3DLGB 2B9YA 1RP5A 5EN1A 1YIJS 3M6XA 5BYSA 3M8YA 1VQLS 3TVZA 1Y11A 3D0IE 1IBMF 3K8WA 5KOWA 4U9RA 5F9LA 2CWKA 1Q53A 2HHSA 3NGUA 1TUWA 1U2CA 4P52A 5F9NA 1JLAB 5HROB 1RBLA 2R2RA 4FNHA 3WIVA 3KLGB 2BM1A 2FB0A 3I55S 1M90T 1JLCA 2CQIA 2RIJA 2ZJPQ 2ZZMA 1DLOA 2FVRA 1MSWD 3H2UB 5E7OB 1NUEA 4Q5VA 1AUSL 3M8QA 3RW7A 2HNYB 1YJNS 1RXOB 3M9MB 5F8IA 2CQ2A 1NXIA 3I0RB 2VJUA 2J0XA 3R8YA 1I94F 3FZ2A 1I3OB 3EMTA 1REVA 5ETVA 4LBIA 4OHWA 1MROB 5K8PA 3DLKA 4ZMMA 1OSDA 3MM6B 3FDSA 1B0TA 2JEGA 3OVBA 3CO0P 3C6UA 3PACA 3UD5A 3IWNC 3BQ2A 1KFSA 2VFTA 3PR5B 4F4KA 2HBQB 4IG3A 3D67A 3ZTRA 1RTDB 1Z2LA 4FS1A 2HKEA 2MMYA 4FF4A 4MYTA 2W4CA 1D3WA 1RA6A 2HHVA 3UNGC 1IKYB 5KFOA 1OPIA 4QCLA 1ACMB 2QGFB 1G6BA 1M1GA 1TL1A 1WDDA 2HBRB 3MUTP 2IM1A 2DNHA 5DDRC 1UWBB 4JI4F 3Q89A 2DD8S 3L4BC 2J76E 1YJRA 2BJ1A 4AQYF 2ZBCA 4PPDA 4CYUB 2IRXA 4DSJA 3CNQP 4RWXA 5KFTA 1Q8KA 2QO3A 3CJ0A 1OIAA 1KLNA 2LECA 1CSJA 3JXOA 4KV8A 3UI3A 1GXUA 4FNIA 1F1BB 2C28A 5GMKa 4CCHA 3M1VB 1UVKA 1YJTA 2AZ3A 5CD4H 1EJ7L 1VQ7S 2NZ4A 2W2QP 3ILJA 4RW6B 2D69A 3G87A 4RNOA 4QR2A 1UL3A 2XHWA 2RUGA 3FFIA 1NHVA 4KHRA 2HS4A 5A8RA 2XMJA 4KC5A 2WVEA 5HBMB 1XIQA 4Q0BA 4ILRA 2FDNA 3HHLA 4DCPB 5GADU 4DL4A 1Q16B 2BE2B 2W25A 2QSWA 4IG0A 4PG6A 2WSEC 2ADBA 3D28A 4H4KC 4A46A 1TL3B 5FLXU 1RTIA 2ZBIA 2R4FA 3K0JA 2WZ1A 4ECSA 5HATA 1JKHA 2F40A 4OFZA 4JI6F 4KFBA 2DNRA 4CLZA 2HSEB 3MZIA 4IR1A 2ZOGA 4I2PA 2LA6A 5F8LA 5J2QB 3OT9A 4DFPA 5D0RA 1PCAA 2WVBA 1ITPA 3LWLA 4UW2A 1QM9A 2J7WA 1UVJA 3AQPA 3CJ3A 4LIWA 4RLEA 1PGZA 4J9QA 1VQ4S 3VGVA 3K5MA 4FPRA 1Y5NB 3EVOA 3BZQA 1U0HA 1NDKA 1WF0A 1HYSB 2CJQA 3CD5A 4M5KA 1SI9A 2OPQB 4NL5A 2FJVA 4FPIA 4DG1B 4DL2A 4TYBA 1AZSA 1CEZA 4ID5A 1HBUA 1IR0A 3VAIA 2EEYA 1PIEA 3F41A 2F63A 3J7A1 2VV5A 3AXMA 1RT1A 5L39A 4DUZJ 2OAUA 2D1CA 2M0GB 4WYWA 1S7IA 2OEJA 3Q8PB 1VGYA 2V4RA 3M6VA 1P8GA 2MZSA 2R7VA 4F25A 4Y0FA 1UA1A 1VQYA 3E8OA 1U1LA 5LJ5Y 3D0GE 3M8RA 1T9UA 4WFBQ 3Q24A 1CS4A 1NCLA 1SJRA 3FBCA 3QLHA 3J7ZT 2CQPA 3PW2A 2B6AB 3DU6A 3CMES 4AT1B 1N6QA 4F0KA 4FBTA 4Y6IA 2BKNA 3MR6A 2POKA 2BJ8A 2IJRA 1MN9A 1N4LA 4X84A 3T9NA 2BJ7A 1VRUB 4OV1A 4ZPDA 3AAWB 1RK8A 4E0DA 3UW1A 4KGZB 1YX2A 3OL9A 1VC5A 1TKTB 4MKVA 5AE2A 3F44A 2BZ2A 3KK3A 4B02A 3GB0A 1Q86T 1OPZA 2VBYA 5KFPA 1IR1A 4BCAA 3A8KA 1FTRA 5HVFA 3MI7X 3IG1B 1R8CA 4DL7A 1FHTA 3QT5A 3R9LA 2YPYA 2WAQD 1S1TA 3G6VA 4JV5J 2ZH5A 1G7CB 2QFJA 4IOBA 8ATCB 2MKKA 1FDBA 4KGXB 4XDDA 1XEZA 2W4DA 2E5LJ 4ZCLA 2I0XA 1CULB 3KUGA 4USTA 1NK0A 4ZPVR 2DR5A 1T05B 1M5KC 1RTZA 4OLPA 2UVWA 2J9DA 4DV0J 3Q8QB 5E33A 3KWMA 3RBXA 3BGFA 4EI2A 2H9ZA 1F9HA 4NLDA 2QLBB 2OGUA 2LA4A 2R8KA 2DNMA 4EFAC 3OR2B 2KHDA 4PYAA 4AYBD 4DI6A 5IV4A 4DR5F 2KJVA 1HHTP 2FLPA 1RISA 5JUMA 4X64F 2WSFC 3IMQJ 2E9RX 3D54A 2XQCA 4P71A 4TY8A 4EZ9A 2W8KA 1IJFB 2R7TA 3DNCA 1FDNA 3M6WA 3PJWA 2J7UA 3W5YA 4DPXA 4ZCMA 3I0RA 1RAIB 2A10A 3M2VA 5K8MA 3ETMA 1LOUA 1LXNA 2GZOA 2RF2B 3NMAA 1Y4ZB 5H9EK 1U8SA 1AXQA 1PJ7A 1P6TA 2F65A 1DTQB 4J9UE 1ZM3A 4LF5J 5HQ8A 3A3NB 2L3MA 3MM6A 3MECB 1TK0A 1RABB 2BANA 2GAHC 5A0YB 3LPYA 1U48A 3C2PA 3ZZUA 4C3LA 2OLWA 3GU0A 2E9TA 3RBZA 3UCUP 1SKWA 1FESA 2B8PA 4KQZA 2DNLA 1RAEB 3MMAA 5CCLA 2YWEA 3FNNA 3HF5A 2VU5A 5EWEA 1H7XA 3VZIA 2L9NA 2DNZA 2AX1A 5DM7Q 3L7UA 1IKYA 4U67Q 4MK8A 4NRTA 4C0OC 3QGHA 4F4WA 1CVJA 1I51B 4ANEA 2UXDJ 3WIUA 1R3NA 2LU2A 3G9CA 2ASJA 1KQKA 4CYUA 2V4JB 1DJ0A 1GMUA 3HVAA 2HVIA 3N0VA 4JI2J 2MQOA 2GNKA 5AXNA 3W5ZA 3VZHA 1A6LA 1C1BB 5GAHU 1URRA 3TEHB 2VG6A 1HWLA 2WB1D 3FBBA 4Q8EA 2ALZA 3EVWA 4C7QA 1TR0A 3NS5A 4LFAJ 3MEDB 2G2YA 3FMBA 3QATA 1XMOJ 4ZCKA 4IQXA 3PX6A 1SUQB 4JI0F 3T6BA 3LWMA 3B8HA 5KT5A 1K0TA 3OFHA 3CULA 2BV3A 1VYAA 4NXNF 1VR6A 4LRDA 3KXDA 1X4HA 4RUBA 1BD6A 4OI4A 3BPSP 1X60A 1C4AA 1FD8A 1W2IA 3MAAA 4DJBA 3BJYA 1FEEA 3PW5A 1GX5A 1H72C 2BE2A 1EIYB 4M8LA 1X9SA 4ID8A 5K14B 2ZH4A 1TKDA 4QJVA 4P73A 4A8OA 1FXDA 1TZ0A 2UUTA 3W2VA 5KFSA 1UCNA 4MKBA 2JDJA 2CG8A 2XBPA 4WKYA 3CPWR 1TV6B 3UO0A 2OSRA 2V50A 4RPFA 2AX0A 3TUZC 1FWPA 3OQ2A 2IJNA 3WQPA 4LQ9A 4YN3B 2KFYA 2VQEJ 3S1TA 2MKSA 4M5NA 3CCLS 3ISZA 1S97A 3IBCB 4DUYJ 4DR4J 1C1CA 1EHWA 5EWFA 3PYGA 1UJ4A 2MJNA 3IGVA 4C8YA 2CZ4A 2Z2ZA 2M5YA 1LW0B 2DK2A 1FCAA 2OKQA 3CJ4A 2COLA 1R0AA 1IBKJ 3D3CJ 2DPJA 5BR8F 1HYSA 2WVCA 1AB8A 4KYZA 5DRKA 4PG5A 3FEYB 2YQ3A 3CCQS 5KFAA 1PYSB 4NLOA 3BN4A 3KG4A 3R7SB 2YTCA 3T9ZA 3HVTB 3GCXP 1GMWD 1RGVA 4KTQA 3MCNA 3DRRB 2AEFA 5KFUA 2XULA 2AYMA 4B3OB 2NXCA 5CZVA 3CD7A 4U8VA 2WHOA 4RU9A 2KYXA 2WW8A 5D0GA 3J7YI 1P27B 4X62F 4J9LA 2QN6B 4CLYA 3CCJS 3UDEA 2FLOA 4AXJA 2KJWA 2B7BB 3V6DB 1V5IB 3CVKA 2XG8A 2JLFA 5G4DA 3MR7A 4K4XA 3QYYA 2J8AA 1KVIA 1S6OA 4DV7J 3DMJA 4QIVA 2HFSA 5CYQB 2CJ9A 4CO4A 3GYXB 4DV2F 2GCFA 2HK3A 4DV3J 1HBOB 4BDPA 4O3QA 4PG7A 1VLYA 3CT9A 2CJAA 3KDOA 3J7Z5 1KR4A 5A2QY 3ET6B 3DLHA 1NSAA 1RAOA 2OPPB 5EDWA 4WFYA 2PI4A 2VODA 2HS3A 5C24B 3BBBA 2VONA 1S6UA 4A8YA 3JSMB 3ZTOA 4XIUA 1LWEA 1AFIA 1N5VA 4M94A 4CDIA 1UAWA 4ETXA 1H0HB 3M6UA 1EARA 1HBNA 3PR4A 3CE8A 3QT8A 3AA8A 4MTPA 2C2ZB 3NBPB 3DRPB 4X4SA 1NK4A 2VC1A 2JLGA 1D8ZA 1PJ5A 3VHQA 2ILYA 2R7OA 5EUHA 1WHVA 3A3PB 2KT5A 1VOMA 2ZM6J 2JJ4D 1LWFA 1QY7A 2V34A 4WYLA 3ZZZA 1SC1B 1DRZA 2GJIA 3D0HE 4HLBA 3FVYA 2IBKA 3M30B 4PZVA 1IKWB 3G6YA 3P4UB 3HZEA 3R27A 2MXYA 5D0EA 1T3OA 2CJBA 3OTCA 3ZZOA 3QZ8A 2JFKA 2H48B 2CPDA 4O4GB 2XNQA 3G82B 3AY0A 1YBAA 1T11A 1UZHA 2V69A 2DNNA 2O1PA 3GSIA 4CQ1A 3OR2A 4J91A 1S0NA 2ACMA 1VQ8S 2GC8A 4DQIA 3W2WB 4I1TA 4GO5X 3T19A 2WSCC 2CQ0A 2PMHA 3BREA 3A12A 1WOPA 4RX6A 3E3XA 3CCUS 3B78A 3QIPB 4GVBB 3HCXA 1NAQA 5KFIA 1LV5A 1KKHA 2RF2A 4C0BA 3N6MA 2V67A 2OMLA 4HH1A 1U0SA 4YR2A 3E2EA 1GH8A 1B7YB 3TRGA 3LTOA 4ED3A 4Z7YA 4DR2J 2V94A 1KQFB 5A0YA 1FE4A 4F3OA 2BW2A 5BYRA 2V9KA 1U6FA 4V1Ak 4KRWA 2VL1A 5IWAJ 1PBAA 3H5SA 2HVDA 3FQKA 1VIXA 3CF5Q 5IT9U 1MLAA 3R5DA 1W2BR 1QSYA 3V81B 1KHVA 2H4YB 3MMCA 1HA1A 2AJ0A 3IGNA 3MD1A 3AOBA 1T95A 3NGTA 2Y3YA 3V6HA 2Y1JA 2MKIA 4IO9Q 1K73T 1IUJA 1U49A 2FUG9 3CSKA 5B0FA 2G0IA 2V4JA 1T9TA 4USKA 3DDKA 4ZP8A 4ILMA 2OHDA 4ECYA 3TVKA 3OL7A 1A9NB 3CC2S 3MPYA 2RHSB 4KPYA 1S0VA 3PO5A 2RDDA 4DL0C 4NEZA 1KFDA 5F3TA 3HD2A 2W9AA 3CDUA 1F0XA 2D7SA 1C1BA 4DV6F 3GJSB 1NKBA 2DNPA 1P9QC 3Q8RB 4FDFA 4UOHA 4O44B 2GGPB 2UXCJ 1NHUA 2HQCA 4TYAA 1WG1A 2UV8A 3TVYA 3LANA 4LBPA 4OZ5A 5E3AA 2LQ8A 2E5IA 5FD1A 1SUQA 3UWTA 2HVHA 4ZK7M 4ES2A 3VQTA 2HQGA 2H5IB 2IDLA 3BDEA 2HBZB 4LF9J 1KVKA 4S0MA 4OYWA 2HBYB 1JX4A 1BXNA 2CQDA 2VA3A 3ZZRA 1QJHA 4H54A 4HI1A 4I64A 1C2PA 2FHJD 2VBWA 1RYSA 5I4MA 2QYCA 5JXSA 1UJ6A 2KB2A 5SZTA 1ZM9A 3ZZTA 4NLUA 2XO7A 2EC0A 2MPUA 5GADI 4LRAA 1RAAB 4EZ6A 3UFCX 2D3UA 5A6PA 5I3UB 4C48A 4DCJB 4NLVA 2QLXA 1IBLJ 4P2FA 2QMXA 1S1UB 2RRBA 2UVVA 3P8BB 3BO2A 5BJRA 1RT6B 3P49B 4DUZF 1CJUB 1BWEA 3QQCD 3MEKA 2XYPB 1RCOB 4ZVQB 1V3ZA 1NB7A 4KHPJ 5GAGU 3C16A 2BQ3A 2F9DA 3RU0A 5AXLA 1QAXA 4GO7X 1N52B 4OX7A 3DOKB 3KFWX 2KYZA 5DLFA 1N88A 1HD1A 1B64A 3MDFA 4KO0A 1LW0A 2C3PA 4JI8F 5H9FJ 2JEJA 3DXBA 1JLQB 4U7UD 5HANA 2JHEA 3D68A 1WF1A 4K2JA 2N3LA 4PXCA 4ZVHA 2XY6A 4RO0A 3TWZA 4LRBA 4QWAA 4P7TA 3QJJA 2HNZB 4OYAA 3LPEA 3HVTA 5B0DA 4V19J 5FDLB 1HPZA 2J6UA 3B4MA 4P2MA 2KVQE 2KL8A 3NNAA 3DM2B 2FZCB 2Z0GA 4RW4A 2Z2LA 1YGYA 3A8IA 4JI5J 4WWSA 4MIAA 4ENOA 1KOOA 3HHLC 4NEYA 1SL1A 4B9LA 2G13A 3DGVA 4XK8C 4F02A 2CG4A 4JV5F 2ZBPA 2MQQA 1T3NA 1M1HA 2HRYA 2OD6A 1QE1B 3NWRA 2ERRA 5KFLA 1QLNA 3HDSA 1SIWB 2Z4PA 4LR7A 2CAJA 1Q95G 3V6KA 4P9SA 1M5OC 1MMLA 1U09A 3M2UB 2BRKA 3Q8VA 5CYQA 3EICA 3POTB 4P74A 1X0FA 1FFSB 3MXHP 4NA2A 4DV0F 2ZUGA 3HJFA 3VGUA 2AYEA 2QC3A 2ROGA 1R89A 2ZNYA 1HNIB 4OI1A 4B9SA 4UTGA 5C24A 5ETKA 1RT3B 3ENWA 2M4MA 4MH8A 3RRGA 1S57A 2AW0A 5CD4A 4OZ2A 2MHNA 1NRKA 2ZFHA 3IAM9 4ZLPA 3OV7A 2LQ9A 3VTIA 2KM8C 2DY1A 4WFXA 2KRRA 2RH3A 3NBPA 3ENQA 2KG1A 2WRMA 4NPOA 4IFVA 3S7RA 1FDDA 1FVSA 3EZOA 1VBYA 5L1JA 3FCVA 3CJQA 3S6EA 2ZEJA 1TKZA 5KFHA 3NOCA 1XNRJ 3OSPA 3CJRA 3ICLA 3SV4A 2P9EA 2MLZA 3A1YG 3M30A 3D9BA 2JVOA 3O44A 1HNWF 1GMVA 3ZZPA 3OUYB 3Q8UA 4LF6F 4DR6F 2F1FA 4O4GA 3LA0A 4WFZA 3PIPQ 4KY3A 2GA7A 1TFYA 1FX2A 3PFEA 1CLFA 3M32B 1NZAA 2OD4A 1X5TA 5F8HA 2VBZA 4CLPA 4LF1A 3VWSA 1RQ0A 3W2WA 2FHKA 3GFXA 1N5YB 3TJAA 2ZVSA 4UT4A 1BQNB 1WD6A 3UCZP 2QJ3A 1YITS 3RR8A 2ATCB 1QUVA 4N7TA 1LKZA 2AZ1A 5BXIA 4MT1A 4Y34A 2YPZA 1BQMB 4F36A 4DU7A 2GQCA 3LUYA 3QIPA 1VQSA 4QIEA 1FDAA 2GFFA 4ZP7A 3FGVA 4DS5A 2LVWA 1SH0A 3LW5C 3KJVB 3JSRA 2EKNA 3HMJG 4PQUB 2RJZA 5HL7Q 1Z2ZA 3MCMA 1D8YA 1N33J 2GV1A 2EW9A 2YXLA 2HS0A 4M63A 5KFQA 3BBCA 5J1PA 2UP1A 1F5BA 4FYXB 4JBCA 4CLSA 2L08A 3BR9A 4K0KF 3GPAA 2G1HA 1WOSA 1XMOF 3FSIA 5I42B 1ULRA 1S5ZA 1BQXA 2DXEA 3EDQB 2K3IA 3PEHA 1J5EJ 3PZPA 2RS2A 3DRSB 3M4XA 1RTJB 2VG5B 1Y0HA 2BA9A 1YJVA 5HJXA 3BSCA 3R1LA 1V9OA 2EPIA 1YLXA 4CH0S 1RT7B 2PI5A 1TKXB 2HHHJ 3CMAS 1ZZNA 1RT2B 3HHNB 1Z1ZA 4C8NA 3W65A 2XMUA 3O1LA 2NXUA 1T03A 2V9WA 2J9EA 1FI4A 2M3DA 5A8KA 4Y2IA 1XN9A 1U1MA 2LCWA 2CUYA 4A8FA 2IVMA 2KVIA 1XC9A 5KFEA 4OIXA 4JI3J 3CDWA 4M5MA 2OUGA 5F0WA 2GGPA 5KFWA 3ITHB 3R6GB 5GAHI 4DX6A 2VB6A 3OLAA 4URSA 4F26A 1Y9OA 2R2SA 4BS2A 2DHXA 3WZ0A 3TARA 2MYFA 3BQ1A 5E3CA 4H4OB 2M8DB 4WFAQ 2BX6A 1RCXB 3VF0B 3SFGA 1EQMA 2CIMA 4G1QA 3TJ9A 2RE1A 2ZH6A 2OEKA 2AJ1A 2BEFA 2YH0A 5ETLA 1VQ6S 1KDNA 3RBDA 1FWKA 2FVCA 1FEHA 2V2KA 1Y00A 1IBKF 5C25A 5IQQA 5G0RA 3KNAA 3MAQA 1KEKA 2M88A 4OYIA 4YHHF 4W4MA 4ZPTR 4Y00A 3H5UA 3CJ5A 4X4VA 3U02A 2OJ3A 2LYVA 3TJ8A 2GMLA 2CPHA 2XYHB 4M5LA 3MM9A 4MAKA 1REGX 4C11B 1N56A 3GP9A 2HURA 4O23A 1RBAA 2F9JA 2R8GA 4L73A 4N56A 2G0JA 4WE1B 1SJ1A 4ECVA 1KNZA 1VBZA 4QW9A 1Q4RA 2BE7D 2ZITA 3EXCX 2G2ZA 4MYUA 5EHHA 2X1GA 1IKXA 1WF2A 2VPZB 1D9DA 3EYZA 4ELTA 3KLFB 3SFUA 2HGMA 3LP0B 1PKUA 1JXVA 2YWGA 3VAJA 2AEMA 4Q2LA 3D1HA 2ZD1B 4GKJF 2YKNA 4BBYA 2IM0A 4JI4J 4QIFA 4L76A 4NX9A 2CVIA 4RL1A 1TL7B 2ZH7A 4EWTA 5D77A 3DU5A 5AT1B 2WW4A 4ALZA 1F5AA 4PUOA 3CMQA 4RW7A 1SJ4P 2DYAA 4CWBA 2EI5A 4RBVA 2MZRA 4IRCA 2DXDA 2C2KB 3M7VA 1S1XB 4A4JA 3G8SA 1DTTB 3UPFA 3KLIB 2GHVC 2E7XA 1QE1A 1XWLA 3R5AA 2HAFA 2XWYA 1R31A 1XMQF 4CZCA 5IT0A 5D4PA 2ZM6F 4ED4A 2C2EA 2YY3A 2MB0B 1RHMB 2MQMA 3CJSA 5C42B 2Y8WA 3E01B 4Q7AA 4R8UA 2A18A 4NLPA 4QYRA 1Q81T 1HNXJ 3SCLE 4C3KA 4HKQA 2ZDOA 1Q8IA 2E7WA 3GV8B 3AD8C 2Z8QA 1B4SA 2QA2A 3K2YA 4K2XA 5D15A 4R0EA 4N76A 1XNQF 4DSKA 3MPDA 2VF3A 5C2GA 1JJCB 2F8HA 2J0QD 4RUAA 2NR0A 4HACB 2Y1IA 2GQ2A 1CJKA 2BJ3A 4CTAB 3HP6A 3HHKA 4JI6J 1W26A 1D9FA 3GSDA 4NCAA 5J1NA 2X3GA 4K4UA 1UVNA 2G0CA 2QEXS 2V8GA 2KN4A 2JX2A 4A8KA 4ELVA 3ZO7A 2BDPA 1HQ2A 2BKOA 2WB4A 3I96A 5JVHQ 3I4PA 1NH7A 1RU1A 3OUYA 1VQOS 4M5JA 2W2MP 1KTQA 2B3TB 2XLIA 3PX4A 3T1AA 1DQ8A 1ROFA 3FJ2A 2PEHA 4PPZA 3KUHA 3PY8A 4PWWA 2VICA 2YNFB 3L7PA 2GW8A 2GO8A 4Q44A 3PJXA 3TNVA 3D5MA 1P9YA 4X4QA 3C14B 2ADCA 2UVRA 1FKOA 1SL0A 1BQMA 4TXSA 3LP2B 3MAHA 5EWGA 3OVSA 1Q8BA 2DEIA 4E2FB 4RW8B 3JTPA 3HI9A 1U7LA 4LR8A 2XCAA 4J9SA 3M8PB 2HHQA 3TQEA 3NGDA 1WSRA 2KI2A 3W8GA 5ADZA 3MD3A 3V4IB 5DO2A 4P10A 1RWNB 2UXCF 1XJWB 2CXEA 2HVZA 3CUNA 4ZJOA 1RACB 3QZ7A 3GIKA 1DQAA 3T5HA 1HNZJ 5M2PA 3OVAA 4A8WA 4YR0A 1PILA 2YKPA 4I68A 2X1AA 1OSCA 3DKDA 4A8MP 3DRSA 1SPBP 2QZ8A 3PX0A 4B3TJ 2VG5A 2IAJB 4LF9F 4OV6A 1UZDA 1WDTA 5IQ6A 1TKXA 3N5BA 1K0VA 1KP6A 3NKYA 1VCTA 1Q5YA 2G2OA 2HNDA 1DLOB 3H0PA 1X4BA 4ECTA 2NSCA 1OY6A 2XY5A 4NXMJ 3M8QB 3TZZA 4RNMA 3W1YC 3H4DA 3T1YJ 2DH8A 3W62A 1S9EA 4WZMA 1REVB 1IWGA 3HULA 2YQ1A 1IBLF 4DR7F 4XAKA 3DLKB 4OYOA 2VA2A 5B0GA 1EP4A 4OZ1A 1CJVA 4YEAA 1GEHA 3Q0AA 2IVFB 1J27A 3PYDA 3BSAA 2DNKA 1B7FA 4KHPF 3C6UB 4NMXA 1WTBA 5M2UA 4DWIA 3BKUA 4I67A 4ZLNA 4YB1P 4DLEA 5H9FK 1CQNA 4EYIB 2BYCA 4DR5J 2I6WA 3CTRA 2DB1A 1R0CB 3BGOP 5E3QA 4X64J 1GFWB 1CBKA 4C0HA 3AA9A 1UPMB 1TL1B 1NJXA 3VAFA 1A0OB 4LF8F 1WORA 3NS6A 4OZLA 2HQDA 1H6KX 2ZZTA 1R43A 2HHPA 2H5EA 3TAQA 1RHQB 4PAAA 2GO9A 3CCSS 3G8TA 2X3DA 5DG8A 3KG0A 1HR0F 4KKOB 3T5JA 1NK8A 2DBBA 2AD9A 2UUCF 2I5JA 2WTFA 2AGOA 5ETOA 1S9FA 1M5SA 1Y5LB 5LMNJ 4PXDA 2BOAA 2VDIA 2QFIA 3VALA 3TEGA 5KG3A 2IMOA 1T9YA 1G2EA 4YY3F 2OSQA 2MLYA 5GAGI 2JNJA 3SDEB 2KG0A 4USJC 1VK3A 3O6QA 3LP0A 4WXOA 4ZHRA 5U47A 5HLFA 5A8RB 3GIRA 2ZD1A 1VQ5S 1E6YB 4TVAB 2EFVA 2XSJA 3CCWA 2VKZG 3I5CA 1EQ0A 2GIRA 4L6V3 4XPCA 3GYNA 1TL7A 2I1RA 2FJEB 3HHDA 2ZNZA 5K9FA 3TI0A 2CNKB 3K7RA 4Z37A 3EX7B 3VAGA 4IKAA 4IG0B 2XGQA 3JAMY 5KFFA 4C9DA 3BPDA 1WOOA 3K5NA 3TZWA 2OPSA 1AA1B 4K7QA 4DSEA 1FA0A 4X4RA 2OELA 1S1XA 2Y9HA 3G8QA 1KQGB 1TP7A 4XTTA 1JKHB 4QIWD 2DGVA 4KFBB 3RB0A 3KDNA 1H73A 2LEAA 2F4FA 2K1RB 3SEOA 3TOQA 2DH9A 3N5FA 2ZWPA 4OI0A 3JS9A 3LGMA 4M5DB 1WHXA 4B9VA 2BRLA 1FJGJ 3CDBA 2KT2A 2NREA 3O3LA 1PG5B 4G3IA 4WTOB 4X4NA 4NA3A 1U1QA 2HRUA 1U0HB 1SQGA 4QU6A 1X0PA 2CQBA 3UDVA 2I8EA 5C2CA 2UUAJ 4N8NA 2GVDB 2AJQA 3M8WA 2B9WA 1G4CA 2ZC3A 1AZSB 2RKIB 2NCKL 2OFGX 3I9ZA 1LEOA 4HACA 1DHMA 2XZWA 4J7CA 4J9OA 2CJKA 1RDRA 2D74B 1I1GA 4L75A 3KK2B 1HBUB 2P5VA 2MZJA 4CTAA 4DV1J 2RILA 2W7AA 1RT1B 3QWUA 5HJYA 4FN5A 4PEOA 4OL8A 4PWDB 2XSFA 2HHTA 4QU7A 1JLBA 1VLOA 3NNHA 1RHJB 2OEMA 4WP8A 3R5GA 3SIPB 1BHNA 4UOFA 1RLDA 3QRRA 1SC4B 2XM3A 1G1XA 4W90B 3PFOA 1CS4B 3X3UA 2IPOB 3NEKA 3P5TL 6FDRA 2YNGA 1N6QB 4DL3A 4LRFA 2BBEA 1FK9A 2DR9A 5GAEU 2KXFA 4JOUA 4RKUC 3C14A 3OL8A 3MPUB 1UA0A 1U25A 3NP5A 3NS7B 2HHHF 1M1KT 3DDIA 3MPWA 5HAOA 8RUCA 2EFQA 4NLYA 3KK3B 3HXMA 5IT4A 1YDLA 5F8GA 4C97A 4X62J 3EE3A 2N4DA 3DRYA 4ETZA 4LSZB 4ECWA 2N82B 2F5GA 2CQGA 2DNYA 5HI7A 5KFDA 2K2PA 2AP6A 1FX4A 3SSRA 4K4WA 2OFHX 4JI3F 1SBRA 3V4IA 4TQRA 4AD6A 2BW7A 4XO0A 1TK8A 1YRXA 1WHWA 2PT0A 4TN2A 4DV2J 3MTJA 2LQJA 2NYIA 3IN5A 2MKYA 2V8HA 4QWEA 4QYZJ 2M70A 5CCMA 3KUEA 2BOPA 3V2UC 2D3ZA 1ZAVA 1FRIA 2QG9B 2IAJA 2NXNA 4J9PA 2ZH2A 4HDGA 2PFDA 1RAGB 4WU2A 3I56S 4OJGA 3L7OA 5KFKA 4FS2A 2ZHOA 1CC8A 1AFJA 3AQOA 1NMEB 1S6QB 1UKUA 3J7AN 2QTWA 4KJIA 4TY8B 3SQGA 5IV3A 2QMUB 4NZ0A 4CLUA 3UN5A 5A8WA 1NPKA 3V5RA 3BBFA 1FRKA 3M2VB 5B0CA 4N8OA 4NASA 5RUBA 5J2PB 1FVQA 2E9ZA 1R27B 4O3SA 3TX0A 3NL0A 4IRDA 4DS4A 3R5CA 1WKLA 3MEGB 3K8VA 2BANB 4I56A 4O3PA 4PR6A 1ZTTA 3LOUA 1YBUA 4CP5A 2L48A 3MMAB 3AODA 4AUKA 2DO4A 2F7VA 1QAIA 2DKOB 3NCRA 5LT5A 1KVJA 4KT0C 1X4GA 1RHUB 5L46A 3EGWB 1WC5A 1L5UA 1WEXA 1D1UA 5DG9A 2DT9A 2IFXA 2BKPA 1RWXB 1RWKB 3MUVP 4H4KA 1CJTB 1X9MA 3BF4A 4ER8A 4TLQA 3G2XA 2B4VA 2ZVIA 4NMLA 3FKBA 4OYPA 2XYGB 1FRLA 1KWMA 5F41A 2PEBA 4HT5A 4KKOA 3QMQA 3RAXA 3QIDA 1QSSA 3N4WA 3TAMA 4YDDB 1NJYA 2H54B 2VG6B 3PRVA 2ILZA 3NRBA 3PM9A 2RD5C 1MW7A 4LFBF 4LUBA 1U24A 4DUTA 1K47A 3SDEA 3PNIA 4CRJA 3W9HA 4WTYA 1U4BA 3OTDA 4NOHA 4I6YA 1YG0A
chains in the Genus database with same CATH topology
2CNLB 2QLFB 2C2OB 1RHKB 3D6FB 4DCJB 1GFWB 2C2ZB 3D6HB 2DKOB 2CDRB 2FQQB 3GJSB 1RWPB 3RJMB 4DCOB 2XZDB 1RHUB 2CNKB 2C1EB 4ZVOB 4ZVTB 3NS7B 1F9EB 3P45B 1QDUB 2HBQB 2XYHB 2QLJB 1RWXB 1NMEB 1RHQB 3GJRB 3IBCB 1RWKB 1RHRB 1SC1B 2C2KB 5IC4B 2QL5B 1IBCB 2H51B 2Y1LB 2P2CB 2XYPB 1RWOB 4ZVQB 3R6GB 3R5JB 2CJXB 1PYOB 3KJNB 4JB8B 1RE1B 3P4UB 1RWVB 3D6MB 1RWWB 2QLBB 4LSZB 2HBRB 2H48B 2H65B 3R6LB 2H5IB 2XYGB 2H4YB 4DCPB 4ZVRB 2HBZB 1RWNB 2H5JB 2C2MB 5K20B 2HBYB 4ZVSB 2CNOB 1ICEB 1RHJB 3SIPB 1RHMB 3GJTB 3EDQB 2H54B 2Y0BB 2CJYB 1I51B 2CNNB 3KJFB 1SC4B 4ZVPB 1SC3B 3R7BB 3R7SB 2H4WB 2QL7B 1PAUB 5IC6B 3QNWB 1QTNB 1I3OB 2QL9B 1BMQB 3IBFB 3GJQB 4ZVUB 3R7NB 2XZTB 3KJQB 3EDRB 1RWMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CNL B;  2QLF B;  2C2O B;  1RHK B;  3D6F B;  4DCJ B;  1GFW B;  2C2Z B;  3D6H B;  2DKO B;  2CDR B;  2FQQ B;  3GJS B;  1RWP B;  3RJM B;  4DCO B;  2XZD B;  1RHU B;  2CNK B;  2C1E B;  4ZVO B;  4ZVT B;  3NS7 B;  1F9E B;  3P45 B;  1QDU B;  2HBQ B;  2XYH B;  2QLJ B;  1RWX B;  1NME B;  1RHQ B;  3GJR B;  3IBC B;  1RWK B;  1RHR B;  1SC1 B;  2C2K B;  5IC4 B;  2QL5 B;  1IBC B;  2H51 B;  2Y1L B;  2P2C B;  2XYP B;  1RWO B;  4ZVQ B;  3R6G B;  3R5J B;  2CJX B;  1PYO B;  3KJN B;  4JB8 B;  1RE1 B;  3P4U B;  1RWV B;  3D6M B;  1RWW B;  2QLB B;  4LSZ B;  2HBR B;  2H48 B;  2H65 B;  3R6L B;  2H5I B;  2XYG B;  2H4Y B;  4DCP B;  4ZVR B;  2HBZ B;  1RWN B;  2H5J B;  2C2M B;  5K20 B;  2HBY B;  4ZVS B;  2CNO B;  1ICE B;  1RHJ B;  3SIP B;  1RHM B;  3GJT B;  3EDQ B;  2H54 B;  2Y0B B;  2CJY B;  1I51 B;  2CNN B;  3KJF B;  1SC4 B;  4ZVP B;  1SC3 B;  3R7B B;  3R7S B;  2H4W B;  2QL7 B;  1PAU B;  5IC6 B;  3QNW B;  1QTN B;  1I3O B;  2QL9 B;  1BMQ B;  3IBF B;  3GJQ B;  4ZVU B;  3R7N B;  2XZT B;  3KJQ B;  3EDR B;  1RWM B; 
#chains in the Genus database with same CATH topology
 3GWC A;  4J9N A;  4LVN P;  1APS A;  5KT2 A;  4B3S F;  3CJ8 A;  4MK7 A;  4RWW A;  4U95 A;  1Y7P A;  2NZC A;  2EFO A;  3RTV A;  3EZ5 A;  2M7S A;  1E6Y A;  3NY0 A;  3I82 A;  5B0B A;  1HNX F;  2C1E B;  2VPW B;  2FC8 A;  1SH3 A;  3K5P A;  3MAA B;  3C15 B;  2C3Y A;  2I38 A;  4KR0 B;  3V6J A;  3GJR B;  4NLQ A;  5KT7 A;  4M1K A;  3CD0 A;  3UR3 C;  1T94 A;  1YK9 A;  3OHB A;  3KLE A;  1GMW A;  2M9K A;  1ZOT A;  4DV6 J;  2F3J A;  1Y3J A;  3OTO F;  1JMT A;  3W2V B;  3MM7 B;  1NDL A;  1M0S A;  3CC7 S;  4FXW A;  2IA0 A;  3CCV S;  1G3O A;  2X1F A;  3ULH A;  4IRK A;  2XB2 D;  3FQL A;  5JJB A;  1A7G E;  1KN6 A;  2KTQ A;  3OD2 A;  3UNY A;  3AFG A;  2XMA A;  2W7O A;  4TQS A;  4ZPB A;  2K1R A;  5AE1 A;  2R9L A;  3KK1 B;  1Q82 T;  3J81 Y;  1ZYQ A;  4B08 A;  3ZTP A;  2FJW A;  4M5D A;  2LP4 A;  4ECU A;  1FD2 A;  4X65 J;  2RQM A;  1C1C B;  3MFH A;  1S79 A;  4UQT A;  4ERD A;  1U8W A;  1WSV A;  1Y3K A;  2PN6 A;  4FYV B;  3KHL A;  2UUB J;  4TNO A;  4HHH A;  4M5H A;  1UVL A;  3BKF A;  4DMZ A;  1K1S A;  4DSI A;  4ZPC A;  3N6L A;  1R0A B;  2LLZ A;  3AJ2 A;  1NLK L;  2EK1 A;  4UY8 T;  1RAH B;  2VHG A;  5J2N A;  1QDU B;  2NXJ A;  4OYB A;  2ASD A;  3PYF A;  2EG1 A;  2QL5 B;  1GXL A;  2GVD A;  1L3U A;  3A3O B;  3BYR A;  2YNI A;  2DJW A;  2RKI A;  2CJX B;  5LL6 d;  4UQG A;  3I5A A;  2RQC A;  3CDA A;  4C8K A;  4Q45 A;  2HZV A;  5ETP A;  3KK2 A;  5CXT A;  4F50 A;  1S48 A;  1OQ6 A;  1UFK A;  3ILO A;  1NZ8 A;  1KON A;  4IYQ A;  1CQM A;  1RU2 A;  5KFM A;  4PWD A;  4IFY B;  2WON A;  3H20 A;  4PKD B;  4F2S A;  4DPW A;  2XS5 A;  2WCX A;  2LFV A;  4QPT A;  3MWB A;  3GJQ B;  4UUX A;  4Z7C A;  3SBM A;  4DPO A;  4JI8 J;  2VOP A;  1BWV A;  3DMJ B;  4O3R A;  3D1O A;  1VS3 A;  1S10 A;  1XQI A;  3BO4 A;  2GJ2 A;  3DXS X;  3OFE A;  1HNZ F;  4D3H A;  2MQ8 A;  5L1K A;  3W63 A;  3NCQ A;  3U27 A;  4HTI A;  3DLE A;  4B3T F;  4UUW A;  2UVU A;  2MZ1 A;  2RAQ A;  2QIF A;  4ILL A;  4DPY A;  4OJ1 A;  4J9V A;  3OHA A;  4FYY B;  1LWE B;  3QAE A;  1N36 F;  2V63 A;  3DOL A;  1OYE A;  2LEP A;  2Q79 A;  1HBN B;  2P6S A;  4CO0 A;  1F60 B;  4NXM F;  1N0V C;  1ICE B;  4K4S A;  4RW9 A;  2Y0B B;  4OZN A;  1O8B A;  3HLU A;  3L9Z A;  3T1Y F;  1WC1 A;  1J5O A;  1H3D A;  4DPU A;  3MOZ A;  2UU9 F;  1WKK A;  3JTN A;  3EPI A;  4WXW A;  2HEK A;  2XMV A;  1S9G A;  4CM2 A;  4AND A;  1LWF B;  4X66 F;  2QV6 A;  3I6P A;  3MPV A;  2C3U A;  3MR5 A;  3PO4 A;  5H1S V;  1Q8L A;  4IDK B;  1WNE A;  2VJV A;  1U1K A;  3C8Y A;  5CYM B;  2CPF A;  5IFM A;  2XCP A;  3D6T B;  1K8A T;  1FJC A;  2VBX A;  4F4X A;  4EO6 A;  4M5G A;  3SCK E;  5L9N A;  1LK7 A;  5LXR A;  2MKC A;  2OI2 A;  5B0A A;  3R97 A;  2DGO A;  2VUG A;  3ZZY A;  3MOJ B;  2H51 B;  3M8S A;  1B99 A;  2X51 A;  1AW0 A;  3LAL A;  1S6Q A;  3CCE S;  1UPP A;  3HFV A;  2DGX A;  3IO1 A;  3EGV A;  2A6M A;  3U1M A;  3NWG A;  1TUV A;  2ZKU A;  1S12 A;  1YBT A;  1X4C A;  4IH6 A;  1OWX A;  4U6P A;  5J2P A;  1ELO A;  3DLB A;  3TAP A;  2IC3 B;  2DCL A;  1ARO P;  1U26 A;  4CH7 A;  4ZIW A;  3MEG A;  1RKJ A;  1HNW J;  4K4Z A;  1RTH A;  3U1L A;  4KB7 A;  5LMN F;  4LF6 J;  4DR6 J;  1JJH A;  2BE9 B;  2CDQ A;  3FUY A;  4FVC A;  1BUX A;  1GAO A;  1DFD A;  2DHS A;  4DFK A;  4JI7 J;  3MMC B;  3TA0 A;  2E1P A;  1J2V A;  4MIB A;  2HAI A;  5IC4 B;  1N32 F;  2FHJ A;  2R2T A;  4YQW A;  1F2H A;  2RU9 A;  1CJT A;  4G1P A;  1H2U X;  3V4M A;  3NGK A;  2J0W A;  4R5P A;  2R7X A;  1E6V A;  2B4P A;  4NWB A;  1NU4 A;  2DGU A;  4CLL A;  1JXE A;  2HLT A;  2XMM A;  3UE2 A;  2W7P A;  1FWL A;  4ZVG A;  2J0S D;  2IM2 A;  2FIU A;  1DQ9 A;  5FJ4 A;  2ZH3 A;  3RUB L;  3HVW A;  2Q3P A;  1WC6 A;  1FKA F;  3QBC A;  3OBI A;  5DQI A;  2QSF A;  3OXF A;  5H9E J;  2V2V A;  4F3Q A;  4K0K J;  3GR0 A;  2PMW A;  3I0S B;  3ZC4 A;  4B3M J;  1WEL A;  3A13 A;  3SI8 A;  1HWU A;  1ZH5 A;  2FY1 A;  3W7B A;  1ZTW A;  5BYQ A;  2XLK A;  3WDO A;  1EET A;  1SQF A;  3KHG A;  2V68 A;  3NNC A;  1FJG F;  4ZP6 A;  2VZ9 A;  4ED6 A;  1UFW A;  3C15 A;  3GQC A;  2IBO A;  2Z56 B;  5CQG A;  4TU8 A;  2HGN A;  3EXY A;  3BR8 A;  5KOX A;  2C2R A;  1S1V B;  3EWG A;  2UUA F;  3DN9 A;  4J9R A;  4DV5 F;  2EFN A;  2ZOF A;  3PRB A;  3MM7 A;  4QIG A;  1IVZ A;  4LF7 F;  3P96 A;  1MWZ A;  2UXB J;  1X5P A;  2ZOM A;  2H4W B;  1ZZF A;  2DY9 A;  4DV1 F;  4K59 A;  1LW2 A;  3BH6 B;  4IOC Q;  3PW7 A;  4I2Q B;  4Y2K A;  3LP1 B;  4C6A A;  3KK1 A;  2HPU A;  1S59 A;  3C16 B;  1MMN A;  1S99 A;  4MKY A;  3QFW A;  2B8Q A;  1HNV A;  1HQE B;  3MUR P;  6FD1 A;  1YZ6 A;  5ETN A;  1U1N A;  4HHU A;  5J1E B;  3THV A;  4KIA A;  4KO0 B;  3WHI A;  5D4O A;  3N6N A;  2C22 A;  2VG7 B;  2E66 A;  2X1B A;  3K5L A;  4LF4 F;  1HI8 A;  3IR5 B;  2DO0 A;  2BVZ A;  4XPE A;  2CQ1 A;  1NDC A;  1YWX A;  3VVU A;  4EO8 A;  2MQL A;  3RAQ A;  4K4V A;  1VC0 A;  3H42 A;  3GFH A;  1TVR A;  4UY8 5;  1C0U A;  3PTW A;  4I0W A;  4YHH J;  3CXC R;  3ZXW A;  2JEI A;  2JL9 A;  1EKS A;  4EMD A;  2K06 A;  1HPZ B;  4ZVE A;  1GTH A;  2LU1 A;  1BE4 A;  2E44 A;  3C6T A;  2IM3 A;  1SV5 B;  4U7U K;  1T0T V;  4CLF A;  4RW4 B;  3R7B B;  3ISN C;  1TQL A;  2UZA A;  1KRP A;  3HPO A;  3EPG A;  1F9F A;  2FD2 A;  3P6Y C;  4IFY A;  4ZJQ A;  4DFJ A;  4BWJ A;  1U45 A;  1TEL A;  1QAY A;  1WG4 A;  1Q5V A;  3H59 A;  4F4Y A;  1BLU A;  1TTH B;  3I32 A;  2MQN A;  3JB9 k;  1X31 C;  4W98 A;  1HQU B;  1V6H A;  3IRX A;  4URQ U;  4GKJ J;  4MKA A;  1F9E B;  2Z58 B;  4QYZ K;  3QWP A;  3GIL A;  2VH7 A;  3KJN B;  5GAE I;  2OTJ S;  2P6T A;  2DRD A;  4Y2A A;  2WVF A;  4J37 A;  1NBE B;  1HMV A;  4OYM A;  5LJ3 Y;  1HIY A;  1ZPV A;  4DL6 A;  3FCW A;  5IXU A;  3Q2T C;  3UCG A;  1TUG B;  2RDI A;  2RB7 A;  2EBG A;  3TA2 A;  5EGY A;  1UEV A;  1NB2 A;  2JSX A;  1NDP A;  1VQN S;  3K57 A;  1KTV A;  3M05 A;  2D41 A;  1KS2 A;  2W9C B;  1RWU A;  4IFV B;  1TAQ A;  1AT1 B;  3BYP A;  4EK2 A;  1D0E A;  3W61 A;  3QO9 A;  5KFB A;  1XMQ J;  3EDR B;  1TKZ B;  3HK2 A;  3CGI A;  5D0H A;  2BQR A;  4PG4 A;  4OX9 F;  1DAX A;  2W4P A;  2VC0 A;  1ZS6 A;  4IDK A;  4F0M A;  2GMJ A;  3F0N A;  5CYM A;  1RT4 B;  2HZA A;  2WOM B;  3UD4 P;  4JI1 F;  4ZVO B;  2HWI A;  2RRN A;  4F4Z A;  5KAK A;  1Q7Y T;  3OPK A;  2C3M A;  1VQM S;  4RBT A;  1DY3 A;  5T7L A;  3I31 A;  2W1B A;  1IR2 A;  3KLH B;  4MMO A;  1R8P A;  4AL5 A;  5T41 A;  1XNQ J;  1VBK A;  4TU7 A;  1SB6 A;  3IAS 9;  3RW6 A;  5IZH A;  2B7C B;  1NEE A;  1YZ7 A;  3JYT A;  5KG4 A;  3FSY A;  5HP1 A;  3GYG A;  2QA1 A;  4JYA J;  5D4L A;  2XEX A;  1WI6 A;  2KO1 A;  4NCG A;  4A8X A;  1HLW A;  3LGN A;  3MMJ A;  3F73 A;  1YJW S;  1NSP A;  3BGL A;  1HW8 A;  2YBV A;  1B0V A;  1UVM A;  4LMZ A;  3MTK A;  1YTY A;  2IC3 A;  2MKJ A;  2R7R A;  1X9W A;  4KSE B;  2C2O B;  1RHK B;  2YNH B;  4NA1 A;  1VFJ A;  4EUV A;  4WFN Q;  3N9U C;  3KHH A;  2LXF A;  3G6X A;  4C8O A;  4Q43 A;  4NZ6 A;  1WC0 A;  4KBI A;  1SQE A;  3TZX A;  1FRX A;  2R7S A;  1SKR A;  3SYZ A;  4DV4 J;  4BLG A;  3TYT A;  5F8N A;  2DGQ A;  2OO4 A;  4WPA A;  5JVG Q;  2XI2 A;  3FK4 A;  4ZPA A;  4LSN B;  1MWY A;  3UVJ B;  2HVE A;  1X8D A;  1CG2 A;  2ZC4 A;  3DRX A;  4NLW A;  2ZDP A;  2FLL A;  1FJ7 A;  2CQ3 A;  4OMF G;  4RR5 A;  3W3S A;  2ACY A;  1OQ3 A;  2Y0S D;  2XS7 A;  4CH1 A;  4HDH A;  2AJ4 A;  4ITS A;  5A76 A;  4C2M A;  1T03 B;  1AUD A;  1SJQ A;  2CPI A;  2LQ5 A;  2PSZ A;  5E41 A;  4FZV A;  1X4D A;  5A8K B;  4NI2 A;  2YWF A;  1VJW A;  3W66 A;  1LFW A;  5LMU F;  2FC9 A;  1EB0 A;  4F7V A;  1HHS A;  4P72 A;  2B9X A;  3IA0 A;  4RNF A;  2NYH A;  3SMZ A;  4OZ0 A;  1FER A;  1O6X A;  4QR0 A;  3I0S A;  1WI8 A;  2FQQ B;  5ETT A;  2VIH A;  4FXD A;  4JV2 A;  4M5I A;  3DGP B;  3J81 j;  4USI A;  4CM0 A;  3B4D A;  5EX0 A;  2A6O A;  4K5R A;  1FXR A;  4X65 F;  4YB6 A;  1MMD A;  4G1Q B;  4XDC A;  1I6J A;  4E8U A;  2AKW B;  2JOQ A;  2DR8 A;  3P5B P;  1U1R A;  2UUB F;  3AHP A;  1U6B A;  5D3G A;  4BWM A;  3Q86 A;  2IMW P;  4G6V B;  3TX8 A;  5C25 B;  2FPH X;  2R42 A;  5E5N A;  2ZHB A;  5G0R B;  2C2M B;  2EG2 A;  1OY9 A;  5KG0 A;  4LBH A;  2HQ3 A;  1S1V A;  4AL7 A;  3IRW P;  3GZ7 A;  1RI7 A;  2MZT A;  3L09 A;  2L41 A;  3THP A;  3X1L B;  2G4B A;  3MEE A;  1NHK L;  3Q83 A;  1SIZ A;  4DR7 J;  1FXL A;  3U7J A;  3MM9 B;  3BGR A;  1UEU A;  1RWM B;  5J2M B;  4V19 X;  1JLE B;  1Q0N A;  5DS7 A;  4I2Q A;  2IA6 A;  2X7I A;  2BJD A;  3K89 A;  2L9D A;  3LP1 A;  3NLC A;  1QAJ A;  2YKO A;  2QLW A;  5CYJ A;  2Y1R I;  1HQE A;  3KKF A;  1NSQ A;  3NAI A;  1BGX T;  1QSL A;  4X4O A;  5J1E A;  1IKX B;  4RUC A;  5F3Z A;  2HHU A;  4B9T A;  2AV5 A;  4DF8 A;  3GON A;  2FVS A;  4WP9 A;  5CH7 B;  2VG7 A;  3CED A;  4C8L A;  2QA4 S;  3HD1 A;  4NLR A;  2LQB A;  2V0N A;  2E29 A;  2YKN B;  5HMY A;  3R2D J;  2FYX A;  4LF8 J;  2MY7 A;  4ZJL A;  1FRH A;  4NLT A;  1ZM4 A;  4B3R J;  4IO1 A;  2AF6 A;  1PC5 A;  3KNG A;  3ISN D;  2XWX A;  1R8H A;  5D4N A;  3SXL A;  1X4E A;  1SV5 A;  4PUO B;  5KFZ A;  1JWW A;  4RW7 B;  1HR0 J;  1RAJ A;  4F04 B;  5DLG A;  2M2B A;  2AHO B;  2UUC J;  5HMZ A;  3RR7 A;  1FKP B;  4YFU A;  4CT8 A;  4HHJ A;  3PEJ A;  2HLU A;  1ZBT A;  4U96 A;  1X5S A;  4QOT A;  4YY3 J;  4KH1 B;  3LAK A;  1R8B A;  1CC7 A;  4PCQ A;  1NK7 A;  4OHZ A;  3OXG A;  5I3Q A;  1YI2 S;  5KG6 A;  1QVF R;  2FJD B;  3ETO A;  4DEZ A;  3CJK A;  2IDE A;  1HQU A;  2C2D A;  4DU8 A;  4B9U A;  1BC6 A;  4WCE Q;  1PO6 A;  3TP2 A;  1JLF B;  3OW2 R;  4EBC A;  2VAS A;  4GC7 A;  5FII A;  1I5O B;  4I6A A;  3DLL Q;  4R8U B;  2XS2 A;  1NJI T;  3MR3 A;  2EKY A;  1N5T A;  4WKR A;  3MMB B;  4FF1 A;  4TLR A;  1EKR A;  3IS9 A;  2QYG A;  5CA5 A;  3FBF A;  1F2G A;  1VIO A;  1GTE A;  3CCT A;  2FVQ A;  3SCI E;  4X4T A;  5T14 A;  2YVS A;  2ZE2 A;  3GCW P;  2IY5 B;  2KZM A;  2DCU B;  4HR2 A;  2HFN A;  4KGK A;  1RZM A;  1MU2 B;  1UW4 A;  1CJK B;  2CWX A;  2HK2 A;  1GT8 A;  2GMH A;  1B70 B;  4YP3 A;  2W9C A;  4ICL B;  3KJQ B;  4Y2C A;  4X4P A;  3RYL A;  1IQZ A;  1U2R A;  4K5S A;  2JH3 A;  2MLX A;  2DNQ A;  3DI6 A;  3PYE A;  4KHM A;  1H2T Z;  4PG8 A;  1LFP A;  2D9O A;  4WK1 A;  5L1I A;  3RJM B;  1RT5 A;  4ZVT B;  3P45 B;  4LR9 A;  1RT4 A;  2W9B A;  2WOM A;  3EGN A;  3H7H B;  4QWB A;  1YHQ S;  5AE3 A;  5HK4 A;  3HZG A;  3DLG A;  1PYO B;  3CC4 S;  4CLW A;  3QJP A;  4JI7 F;  2HIY A;  3KLH A;  3K17 A;  1P1T A;  1DZ5 A;  1T7P A;  4C98 A;  1ZET A;  1N0U A;  3RB6 A;  1S4F A;  1FKO B;  3NG8 A;  2MHE A;  1JLA A;  5HRO A;  2R8H A;  3G96 A;  4QR1 A;  4LVO P;  3KLG A;  3KG1 A;  1H7W A;  4Y65 A;  5FLX Y;  3NGR A;  3JSB A;  2IRY A;  2XZT B;  2DXF A;  2MST A;  3THT A;  3QFH A;  2AT1 B;  2CNL B;  1Y10 A;  2DNO A;  4P2X A;  1W7W A;  2HNY A;  4L3K A;  4DBQ A;  2HWT A;  4YME A;  3AJ1 A;  3D7S B;  2DRB A;  3HX9 A;  2YNH A;  2R8I A;  1U1P A;  4YR3 A;  1YQH A;  5KFC A;  2XZD B;  4ZN1 A;  1H38 A;  4Z2X A;  3GG0 A;  3T6J A;  2BAC A;  5D8H B;  4RJV A;  1MRO A;  2GHW A;  3CD6 S;  2ZH9 A;  5ITH A;  3QGG A;  4Y3C A;  1CPZ A;  5DDQ C;  4R25 A;  4B3M F;  3RBE A;  3FRY A;  4LSN A;  3UVJ A;  2N4C A;  4FYD A;  4H4M B;  4OI6 A;  4ED2 A;  1RTD A;  1GK8 A;  4B17 A;  4WU3 A;  4YDX A;  1TL4 A;  2HND B;  1YJ7 A;  3ZZ0 A;  5IC6 B;  3GFZ A;  3KTQ A;  4X4U A;  2CA9 A;  4ZVU B;  4LRC A;  2ZBR A;  1UWB A;  1X4F A;  3AOA A;  4P6Q A;  2OMO A;  1S9E B;  3VCD A;  2UXB F;  3DYA B;  2VOO A;  1P1L A;  1UWA A;  2B51 A;  4P7V A;  2I2Y A;  1EP4 B;  5HSP A;  1CJV B;  3PKY A;  5KFY A;  3CB4 A;  3DGP A;  3MUM P;  1L3T A;  2N7Y A;  2RQ4 A;  3M1V A;  2C42 A;  1T02 A;  3FEZ A;  1N8R T;  4HVZ A;  3IC1 A;  1IKV B;  4RW6 A;  5C5J A;  1SH2 A;  3OTE A;  3QGI A;  3GIM A;  1ZM2 A;  1XR5 A;  1N5S A;  4ATN A;  4WJB A;  2V8P A;  2NQP A;  1JQG A;  5ETR A;  1FNM A;  4HEA 9;  3RB4 A;  3JSY A;  2IJF A;  1RAF B;  2B9E A;  2YX4 A;  5B7W A;  4F4A A;  2VKR A;  5HBM A;  1D09 B;  1YVF A;  2AJ2 A;  4QWD A;  2E1A A;  1YJU A;  3D1Q A;  3GE9 A;  5KFX A;  2CPJ A;  3DDN A;  4EU0 A;  1RA7 A;  3US5 A;  4QZV B;  1DBD A;  7FD1 A;  5J2M A;  1JLE A;  4ZDN A;  2I5J B;  2YQ0 A;  4DSF A;  1AYE A;  1TL3 A;  2EWH A;  4OZ3 A;  2IRU A;  3H98 A;  2H1Y A;  1DAR A;  2JEF A;  3KLV A;  3W9J A;  2PA3 A;  1RB0 A;  2ABY A;  4F0H A;  1VDH A;  1RE1 B;  3FBE A;  3MCS A;  4RUH A;  3M9O B;  2DTJ A;  2H3E B;  3HT0 A;  5J2Q A;  4USU A;  4ZHR B;  5HLF B;  1JB0 C;  5B08 A;  1X5O A;  4L74 A;  4NYZ A;  2FTR A;  2QA4 G;  3RGI A;  2KDO A;  3D3B J;  3AXK A;  2NUH A;  3O8W A;  2XSJ B;  5E2Q A;  2CNN B;  2RT3 A;  1QUP A;  3C46 A;  3I5B A;  1C0T B;  3B6B A;  2QL7 B;  1KLM B;  2DIV A;  1PAU B;  1LK5 A;  3QNW B;  2FGC A;  2B4U A;  4GMK A;  2JWN A;  4LRE A;  3HHL D;  1XTZ A;  5KTQ A;  2OPQ A;  2OPS B;  1RYR A;  4GKK J;  3T1H F;  4DN9 A;  4DG1 A;  1FKP A;  2GJF A;  3GMG A;  2ATL A;  2JLE A;  1VRQ C;  5F0U A;  4LFB J;  3I87 A;  4GVL A;  1OO0 B;  3VR1 A;  2KRB A;  2VFU A;  1WC4 A;  2CYY A;  3PJ9 A;  1ZA1 B;  3UR0 A;  4PAB A;  4MIW A;  1SC6 A;  2ASY A;  1JJ4 A;  1XBW A;  3QRP A;  1IBC B;  4DR1 J;  1RWO B;  4ES3 A;  3ZNJ 1;  1JLF A;  4B3S J;  4R0J A;  1IQT A;  1U47 A;  2VFR A;  2G9O A;  3PKM A;  5LSR A;  1L3K A;  3DHX A;  2FJA B;  4ZVR B;  5AXK A;  4ES1 A;  2YX1 A;  3MMB A;  3HSG A;  1NK6 A;  3ZNU A;  2B6A A;  4I69 A;  3LQV A;  4USM A;  4DQP A;  4OI2 A;  5DGB A;  2ALY B;  5MLC V;  3OSN A;  1VRU A;  3OTO J;  2CZV C;  3OFF A;  2CVE A;  1K44 A;  4LF2 A;  4DN0 A;  1MU2 A;  1VJQ A;  3PIO Q;  5HO4 A;  1SJ3 P;  1TKT A;  2XMW A;  2J6S A;  1N5Q A;  4ICL A;  3K58 A;  1MNE A;  4DDF A;  3D6H B;  4CO1 A;  3HVR A;  2OH2 A;  4RNH A;  2AYG A;  4C4W A;  2XO6 A;  4JYA F;  2K7K A;  5KFR A;  3FSX A;  2FJB B;  1JLB B;  3CJ2 A;  3IG1 A;  2KZZ A;  4PXE A;  3MCO A;  4J90 A;  2XMT A;  2FVP A;  2EFP A;  2LEB A;  1NK9 A;  4FXV A;  3HSD A;  2V8V A;  2XI3 A;  3TQ1 A;  1F3V A;  4OHV A;  2E1C A;  1XR6 A;  1CUL A;  2E1M C;  2YNG B;  3N01 A;  4DV4 F;  1T05 A;  2AGQ A;  2PMZ D;  3H2V E;  5K8N A;  5HN0 A;  1FK9 B;  4D3G A;  2XY7 A;  2FHM A;  8AT1 B;  2UUW A;  3UN3 A;  4FP9 A;  4UZB A;  3HO1 A;  4LFC J;  2U2F A;  4OJH A;  3M9N B;  5SUH A;  3TZY A;  2V2Z A;  3IBF B;  1LQ9 A;  2EC2 A;  2BUN A;  2BR0 A;  1VHF A;  2A1B A;  3BS9 A;  4A8S A;  1PSD A;  4DZ6 A;  2BAB A;  4N47 A;  4FYW B;  3QJL A;  2LMI A;  2K8G A;  4BC9 A;  3BEG B;  3A8E A;  5IOL A;  3JAM U;  4NLX A;  2Q43 A;  5HQL A;  4U8Y A;  3ONQ A;  2HWH A;  2AJF E;  1N54 B;  2P2C B;  3TAN A;  3W60 A;  4LSL B;  1SKS A;  5ETQ A;  4ZVF A;  4DR3 J;  3SZ2 A;  1X7V A;  1DTQ A;  4NYP A;  3T5L A;  3MEC A;  4ED8 A;  1IXK A;  3LF0 A;  1KHW A;  2DIT A;  2RHQ B;  3RRH A;  3MM5 B;  2RS8 A;  2SXL A;  3ENA A;  2OIH A;  5ETM A;  2YKM B;  1WHY A;  4WZQ A;  3CWJ A;  1Q78 A;  2RML A;  4H4M A;  4ECZ A;  3HKZ D;  2U1A A;  3PRD A;  1R6Y A;  1FNO A;  4O0N A;  2PDA A;  1RKI A;  3RRK A;  3VAH A;  3H5X A;  3AT1 B;  1N36 J;  3UQS A;  4JV1 A;  1PYT A;  5AXM A;  3D4J A;  2C3O A;  2V5H G;  1JXL A;  1YRU A;  2C2N A;  2R3V A;  1PJ6 A;  3W64 A;  3BB5 A;  1LWC B;  3IFE A;  3SQG B;  1OS5 A;  2DHA A;  1GX6 A;  2LXU A;  2BJ9 A;  5A8W B;  2DR6 A;  4O3O A;  3RG6 A;  1NH8 A;  3LGH A;  2UU9 J;  5L38 A;  5D6G A;  1JIH A;  3DYA A;  4ZLL A;  4DCO B;  2NUU G;  3C19 A;  4K50 A;  4X66 J;  3PV8 A;  4QW8 A;  2P8I A;  3WX8 A;  4FBU A;  4DXL A;  2OTL S;  2IIH A;  1KBR A;  3AD9 C;  3W9I A;  1JNR B;  3N28 A;  3QAU A;  2F4V J;  4FF3 A;  2Z2Y B;  3PHE A;  3GTY X;  4UOC A;  3IXQ A;  2KXN B;  2R2U A;  1OYD A;  3G6E S;  4DSL A;  2YWK A;  3MED A;  1IKV A;  2Q6B A;  4Y28 C;  2LDI A;  4WII A;  5KG5 A;  4L3N A;  3DFE A;  1RAD B;  4GC6 A;  3VGT A;  4ELU A;  1FFG B;  4OYX A;  1M5V C;  5L1L A;  3Q8S B;  2FY8 A;  4JV0 A;  1PC4 A;  5E0O A;  2MJU A;  2VPY B;  3R7N B;  2YH1 A;  2B5J B;  1EZZ B;  4E98 A;  4ZIV A;  3KOA A;  3M2R B;  3L95 X;  4B3R F;  2QMW A;  2GX8 A;  1R8A A;  2VFS A;  3J80 U;  1XK8 A;  2DGW A;  2DIU A;  2WBM A;  2E5J A;  3BM7 A;  2HMI B;  2FZG B;  5K14 A;  2HFU A;  4USV A;  1H2V Z;  1BY9 A;  1T9V A;  3TAM B;  3BKT A;  2FZK B;  4CIO A;  3Q22 A;  3CIZ A;  1S6P B;  1TV6 A;  3ZTS A;  1OMS A;  4ED5 A;  3HKW A;  5HVG A;  5K20 B;  2CFX A;  2HQI A;  1UMJ A;  3BV8 A;  4WIQ A;  2PGC A;  4DQQ A;  2FJX A;  1N32 J;  2IHR 1;  4QBU A;  1F3F A;  4J9M A;  1TFW A;  1XER A;  3CCZ A;  1BMQ B;  5KG7 A;  3MHY A;  2VQF J;  1HWK A;  2ZWO A;  1C0T A;  1VMB A;  3CCR S;  2IYG A;  2CAD A;  5KFN A;  1KLM A;  4YB7 A;  4ECR A;  2YWW A;  3Q8Y A;  1Z4U A;  4KE5 A;  4O3N A;  4FKX A;  3D66 A;  4JP8 A;  3KLE B;  2MSS A;  4RNN A;  3IBW A;  4DQS A;  3CDE A;  1SCJ B;  3H90 A;  4MK9 A;  4CNZ A;  3DRR A;  3QSY B;  3LAM A;  1RHR B;  1H74 A;  2DPI A;  4B3O A;  1M5H A;  4F8R A;  1Q1K A;  4ZOS A;  1NPR A;  4IUF A;  3QGP A;  1WC3 A;  1KC8 T;  3ZFV A;  4MJK A;  4A47 A;  5IT9 Y;  2Q6C A;  2A0F B;  4O4R A;  3PVX A;  3V6D A;  4USH A;  4IQM A;  5AJ3 J;  2F8E X;  1N48 A;  4UZC A;  1HHQ A;  2CJY B;  2EK6 A;  3UDL A;  4AL6 A;  2E5L F;  5KFV A;  2HQF A;  2RNE A;  3GG1 A;  5KT4 A;  1EX8 A;  2QL9 B;  2QX0 A;  2HHX A;  5J2N B;  2KKH A;  1HBO A;  1U1O A;  2JC0 A;  3VV2 B;  3FEX B;  3ET6 A;  2YNI B;  2OPP A;  4DV5 J;  5D78 A;  1UTA A;  2AQ4 A;  5C7P A;  4KPC A;  2Z57 B;  4LF7 J;  3SCJ E;  1H98 A;  3JSM A;  4ZCI A;  1YJ9 S;  4DHV A;  2GS8 A;  3SSQ A;  1VHI A;  2APO A;  2KHC A;  1UET A;  3P3D A;  1C4C A;  1GQE A;  2J7K A;  3HFZ B;  4OLO A;  2WON B;  1S1W B;  4K4Y A;  3G4S S;  1K1Q A;  2CZ9 A;  3DRP A;  1RWW B;  2O3D A;  3RAM A;  2KXH A;  4AFF A;  3OTB A;  4I7F B;  3C66 A;  4J9K A;  2ZJR Q;  3GLJ A;  4ZS6 A;  4LF4 J;  4FKY A;  5DET A;  4LF5 F;  3EM1 A;  3SV3 A;  3LO3 A;  1IKW A;  4PYD A;  3DLE B;  2IYI A;  3G82 A;  2Z2M A;  1WG5 A;  4WBF A;  1JK9 B;  3IP0 A;  3BSN A;  4NCB A;  1WEY A;  4J5O A;  3WX4 A;  3TR5 A;  3UDC A;  3DOL B;  2PE8 A;  3FC9 A;  3H5Y A;  3ILL A;  2VPX B;  4OX6 A;  3BSO A;  3AB2 B;  4RW9 B;  3PW0 A;  3TUI C;  2UXD F;  1J5O B;  2EBE A;  1WUU A;  3AB4 B;  3T41 A;  5DDO C;  4GVB A;  3R5J B;  2GVZ B;  4RBU A;  3R1H A;  3JTO A;  3CW2 C;  1S9G B;  4FF2 A;  4LSL A;  1VK8 A;  3AOC A;  1HD0 A;  4JI2 F;  3ENV A;  2MQP A;  2I9S A;  4I4B A;  2O01 C;  1T8E A;  4IH5 A;  2BM0 A;  2PC6 A;  1OY8 A;  4ZN3 A;  3O5T B;  3MM5 A;  2BJE A;  2HHW A;  2AU0 A;  3PCO B;  3DOM B;  2YKM A;  4NLG A;  1HFE L;  4EGL A;  4LFA F;  2QT7 A;  5DG7 A;  3J81 U;  3M8Z A;  3Q2S C;  3V81 A;  1KQS R;  2MKH A;  2WVD A;  2K3K A;  1O51 A;  2E5H A;  2KU7 A;  2JFD A;  2J5A A;  1KOH A;  4N77 A;  3IWL A;  2CPY A;  5CHC B;  4EBE A;  1HWJ A;  1LWC A;  4PRF A;  1FO1 A;  3MFI A;  2N3O A;  4KH0 B;  4A8Q A;  1S7H A;  3IM9 A;  2VFV A;  1HI1 A;  2XLJ A;  1WKJ A;  1N34 J;  2IVY A;  3H8Y A;  1RJJ A;  5LSO A;  3K59 A;  3EZU A;  4B9N A;  4OX9 J;  1TAU A;  4CLT A;  4K8R A;  1HL6 A;  2HGL A;  2JC1 A;  4O0I A;  1Y5I B;  3R6L B;  2G1D A;  1RTH B;  4M95 A;  4JI1 J;  4O44 A;  4KGV B;  2CNO B;  2O66 A;  2ZH1 A;  1IBM J;  2GQQ A;  9RUB A;  2CKW A;  1RBO B;  3R2C J;  2VQE F;  4ECX A;  2A3J A;  3HJV A;  2NLW A;  2HRT A;  5EX3 A;  3VAM A;  3G71 S;  4DUY F;  3ZTQ A;  4DR4 F;  2A2D A;  1NKC A;  4CNY A;  3H2L A;  1NPP A;  3Q23 A;  2B5J A;  2XTJ P;  4WF9 Q;  3M2R A;  4R5P B;  4U7C A;  3BDP A;  1E6V B;  1O0P A;  1R7I A;  2BXJ A;  4UOG A;  4TY9 A;  5DDP C;  1TL5 A;  4DZD A;  4CO3 A;  4HT7 A;  1TK5 A;  1LXJ A;  3NCP A;  2HMI A;  4GKK F;  3O2I A;  4EEY A;  2ZUA A;  5DZ7 A;  4CLK A;  5I3U A;  3JQJ A;  1I94 J;  5I3P A;  3VAK A;  1S6P A;  2GIQ A;  4Y2M A;  1LWX A;  5LSL A;  2R7Q A;  3A4T A;  1S1U A;  1VQP S;  4ANC A;  4GRS A;  4TKT A;  4WP3 A;  1RT6 A;  4G1I A;  3EVM A;  1B0P A;  1CJU A;  3HT3 A;  1NJZ A;  2DGS A;  4JUZ A;  1FTC A;  2ROP A;  4DR1 F;  3KJF B;  4OZJ A;  2KFZ A;  1EET B;  2HYI B;  3DOK A;  4HI2 A;  1PAE X;  3NXZ A;  5L9X A;  5GME A;  4DV7 F;  1VQ9 S;  2W2N P;  1JLQ A;  2L9W A;  4OHY A;  9ATC B;  2DRA A;  1HKA A;  2CRL A;  2W01 A;  4OQJ A;  3UD3 P;  1LNQ A;  3DLJ A;  2NPF A;  2R7W A;  4DV3 F;  4LQ3 A;  4ZLJ A;  4ZKA A;  4LIR A;  3FCH A;  2JRS A;  4PXB A;  1U2F A;  3I9V 9;  2HNZ A;  1IN0 A;  4DX5 A;  5LMU J;  4AQY J;  3R3T A;  4P2S A;  5FDL A;  1UW9 A;  3U1N A;  1MG7 A;  3NOG A;  2E1R A;  1WEZ A;  1HI0 P;  2VDH A;  1WTF A;  3R5B A;  2GAG C;  4JB8 B;  2KH9 A;  1ZPW X;  4YOE A;  3DM2 A;  1LW2 B;  3QT6 A;  1FE0 A;  2ZBQ A;  2H65 B;  2PO4 A;  1VC6 A;  4IR9 A;  4OJ3 A;  5K8O A;  5HQM A;  2DHG A;  1JLG B;  1O5J A;  4B9M A;  1HNV B;  2B43 A;  3GJT B;  2ZKT A;  3SQO P;  2GHP A;  4DLG A;  1L3V A;  2CPE A;  2MY8 A;  1SC3 B;  4C3M A;  1V3R A;  5JMN A;  3KMS A;  2J9D E;  5KT3 A;  1U6Z A;  1IWA A;  1HBM B;  2YKQ A;  1JJ2 R;  3JQM A;  1U02 A;  3M2U A;  3PW4 A;  2MGZ B;  7AT1 B;  2N7C A;  3POT A;  1Q7L B;  2E7V A;  4N41 A;  1UJ5 A;  3FRZ A;  3H40 A;  1TVR B;  2QRR A;  1C0U B;  1MWQ A;  2QE5 A;  3MF5 A;  2AYB A;  4NLS A;  3IR7 B;  1HNI A;  4LFC F;  2LDY A;  5KFG A;  1RT3 A;  3N79 A;  2ZH8 A;  1JNZ B;  3B54 A;  3C6T B;  2CQ4 A;  2QLJ B;  3QT7 A;  3TUJ C;  1FF2 A;  3MM8 B;  4OHX A;  1S1W A;  2V6A A;  1SKU B;  1FT8 A;  3OLB A;  4C8Z A;  3GIJ A;  2B4O A;  2MTL A;  2HFZ A;  2RRA A;  4I7F A;  2DNG A;  7FDR A;  4NRU A;  4URG A;  4UF4 A;  4DR3 F;  3IRX B;  4AE5 A;  2PA8 D;  4DX8 H;  4USW A;  1QVG R;  4WK3 A;  4DR2 F;  1TMM A;  5IS2 A;  1T9X A;  1IM4 A;  4LJM A;  5IM0 B;  2Q66 A;  3QSI A;  4CO2 A;  4DOZ A;  4P75 A;  3HHE A;  5IWA F;  3VGS A;  5F8M A;  2CPX A;  3M32 A;  2RDJ A;  1TU0 B;  2FGO A;  1HMV B;  5LM7 E;  2R8J A;  3EGZ A;  2M8H A;  2BMB A;  4BC7 A;  1RWP B;  2RSQ A;  2V4Q A;  1T9W A;  5CAB A;  5MAO A;  1NK5 A;  1N5Y A;  1IM6 A;  1F5C A;  1OJ4 A;  1SXL A;  1BQN A;  2PD1 A;  2ROE A;  4Q8F A;  2B0G A;  3KHR A;  2EXU A;  2J9C A;  1S0O A;  2DIS A;  5DGA A;  4YB5 A;  5DQH A;  1R6V A;  4NZ7 A;  4MFB B;  2DHH A;  4RU2 A;  1PBU A;  1S49 A;  3CCM S;  2XGP A;  3QO9 B;  1WAC A;  2LKZ A;  2GVZ A;  3GII A;  4C8M A;  4HYK A;  4ZPW R;  2OPR B;  2P9C A;  3KJV A;  2UV8 G;  1NJW A;  4ED7 A;  2DVI A;  4PQU A;  2MZQ A;  1L3S A;  2WBR A;  3OJU A;  3DHW C;  1FRJ A;  4NE9 C;  1S0M A;  3GR1 A;  3JQK A;  1YKW A;  3DCA A;  2DGT A;  4YS2 A;  2F4V F;  3NGS A;  1VRT B;  2NS1 B;  3VVT A;  3OR1 B;  4OI3 A;  1GXT A;  4HTJ A;  4DF4 A;  3DOM A;  4AXI A;  5KG1 A;  3HM9 A;  4EBD A;  5T7L B;  3HSJ A;  3GFY A;  5I42 A;  3D6F B;  5HVH A;  5B0E A;  1S76 D;  2ZHA A;  3E51 A;  1RTJ A;  2RU3 A;  2J6T A;  4RZR A;  4X2B A;  3LH2 S;  3W8P A;  2ASL A;  1RT7 A;  4F3M A;  3JYT B;  3T3F A;  4QQB A;  3KMQ A;  5HP1 B;  2Z30 B;  1JLC B;  1RT2 A;  3BO3 A;  3K5O A;  1RSC A;  1ZAX A;  4NCG B;  4L72 B;  2B56 A;  1RWV B;  3HFK A;  5F8J A;  4HH0 A;  3FZB A;  2HZC A;  2K7J A;  2MDA A;  1NM2 A;  1S77 D;  2YX7 A;  2HW3 A;  3AD7 C;  4KAI A;  5A6W A;  3ITH A;  1K9M T;  1XMB A;  1YRT A;  1VBX A;  1NND A;  2HIQ A;  1Q79 A;  3MGJ A;  4DPT A;  2PFF B;  4H4O A;  4NYO A;  4ED0 A;  2D3O 1;  3TW0 A;  4ECQ A;  1DUR A;  4OX8 A;  5DM6 Q;  4G65 A;  3BH7 B;  3WC0 A;  2W8L A;  3IWX A;  3BQ0 A;  4KGM A;  3D2W A;  4IG3 B;  3A8J A;  5DQG A;  3TO8 A;  2FHO B;  2Q1L A;  4N5S A;  1URN A;  4YUD A;  5E3P A;  3NAH A;  5CZX A;  3S01 A;  4CO5 A;  2VQF F;  1D9A A;  5A2Q U;  3OXL A;  2KT3 A;  1SJF A;  3TUP A;  4NI2 B;  2NSB A;  2HFV A;  4OYZ A;  3UN2 A;  1EAY C;  4ZP9 A;  4CT9 A;  3AH6 A;  2AGP A;  4TU9 A;  4IH7 A;  2EVZ A;  1KD1 T;  2LXI A;  5KT6 A;  1V5V A;  2XHC A;  1R0B G;  4C11 A;  3RB3 A;  2JVR A;  4ZVP B;  1FFW B;  1MN7 A;  1YSJ A;  4KV8 B;  3EUN A;  4BHQ A;  3SSS A;  4W92 B;  4JI5 F;  2DEJ A;  4WE1 A;  1X4A A;  4CI0 B;  3QRQ A;  1ZA2 B;  2M52 A;  5AJ3 F;  2CPZ A;  2AEJ A;  3F56 A;  2QLF B;  4A48 A;  3EJM A;  2CDR B;  1B3T A;  3KLF A;  5D3G B;  1NSK L;  1FNX H;  3C3L A;  2CQH A;  3FFI B;  5B09 A;  1S72 S;  1F6T A;  2XNR A;  1FRM A;  2YWH A;  1RUS A;  1W25 A;  3B82 A;  2E5G A;  2KFN A;  4Q0B B;  2Y1L B;  5KFJ A;  3HHL B;  3MEE B;  3D6M B;  3IR6 B;  5M2R A;  3H25 A;  3BGR B;  2HFO A;  2H5J B;  2RUS A;  2AWZ A;  3WC2 A;  4DFM A;  3DC2 A;  2AMC B;  1NO8 A;  2JZ5 A;  3OFG A;  1UP1 A;  4FVM A;  3S8S A;  3PHT A;  1RTI B;  1JLG A;  2F8M A;  1DTT A;  2R7U A;  2WK4 A;  3KLI A;  4EYH B;  5HMX A;  1QTN B;  1KSP A;  5HMW A;  3G86 A;  3CJT A;  2XC9 A;  2NPI A;  1S4E A;  4I6W A;  2VD3 A;  1HBM A;  3WBZ A;  4JI0 J;  3GV5 B;  4DX7 A;  1XNR F;  5K5M A;  4ZIT A;  4K4T A;  4I2P B;  1ZAW A;  2MGZ A;  1FJE B;  2EFG A;  4NXN J;  4QPX A;  5C42 A;  4ZA1 A;  3BGU A;  2V8D A;  3E01 A;  3QPI A;  4DL5 A;  4ED1 A;  3PDN A;  2KM8 B;  3CIM A;  1WWH A;  2MEW A;  4QWC A;  1V3S A;  1NKE A;  2Y8Y A;  5GVQ A;  2DR7 A;  3ELH A;  2ZZN A;  2ZJQ Q;  1M5P C;  5GMD A;  3MM8 A;  3L3C A;  2V2Q A;  5KG2 A;  2O67 A;  1VQK S;  5LXY A;  3IM8 A;  4ID5 B;  3J7Y U;  1UVI A;  3ADA C;  3TA1 A;  1HWI A;  2DH7 A;  2XMK A;  1XR7 A;  2RQK A;  4HL9 A;  3NMR A;  4LT6 A;  2GIF A;  3CJK B;  3OL6 A;  1QD1 A;  1UFL A;  1IJE B;  1VI7 A;  2BQU A;  2W2O P;  1UEK A;  2PII A;  1N33 F;  4PQA A;  5L8R C;  1RLC L;  5IM0 A;  3RZA A;  2YKA A;  2D9P A;  3OJS A;  3QLH B;  1TMJ A;  3I4H X;  3IS9 B;  2RVJ A;  5DJB A;  3MR2 A;  5BR8 J;  2YNF A;  1HAR A;  3H4B A;  1SL2 A;  5E3R A;  1J5E F;  4F2R A;  2ZE2 B;  3T1H J;  3KYL A;  3J80 Y;  3AJD A;  2HG4 A;  3CO9 A;  3ILI A;  1HW9 A;  5ETS A;  5THW A;  2AIR B;  3PG9 A;  4PWU A;  2P9G A;  1QTM A;  2NXE A;  4IOA Q;  1GNK A;  1WJ9 A;  4MFB A;  5CAA A;  3LP2 A;  2W24 A;  4ZVS B;  3VQS A;  1N34 F;  3DI6 B;  4RW8 A;  2OPR A;  3T5K A;  3FMW A;  4DQR A;  3BN7 A;  3GV7 B;  2FLN A;  2J8S A;  1S1T B;  3M8P A;  2W2P P;  1RT5 B;  5LOQ A;  4Q2M A;  2A2C A;  3W5X A;  2OP5 A;  3PXG a;  1VIS A;  2D3O R;  3HSZ A;  5DZ6 A;  4F67 A;  2W9B B;  2CQC A;  1VRT A;  1SVD A;  6AT1 B;  2O5D A;  3OR1 A;  3DLG B;  2B9Y A;  1RP5 A;  5EN1 A;  1YIJ S;  3M6X A;  5BYS A;  3M8Y A;  1VQL S;  3TVZ A;  1Y11 A;  3D0I E;  1IBM F;  3K8W A;  5KOW A;  4U9R A;  5F9L A;  2CWK A;  1Q53 A;  2HHS A;  3NGU A;  1TUW A;  1U2C A;  4P52 A;  5F9N A;  1JLA B;  5HRO B;  1RBL A;  2R2R A;  4FNH A;  3WIV A;  3KLG B;  2BM1 A;  2FB0 A;  3I55 S;  1M90 T;  1JLC A;  2CQI A;  2RIJ A;  2ZJP Q;  2ZZM A;  1DLO A;  2FVR A;  1MSW D;  3H2U B;  5E7O B;  1NUE A;  4Q5V A;  1AUS L;  3M8Q A;  3RW7 A;  2HNY B;  1YJN S;  1RXO B;  3M9M B;  5F8I A;  2CQ2 A;  1NXI A;  3I0R B;  2VJU A;  2J0X A;  3R8Y A;  1I94 F;  3FZ2 A;  1I3O B;  3EMT A;  1REV A;  5ETV A;  4LBI A;  4OHW A;  1MRO B;  5K8P A;  3DLK A;  4ZMM A;  1OSD A;  3MM6 B;  3FDS A;  1B0T A;  2JEG A;  3OVB A;  3CO0 P;  3C6U A;  3PAC A;  3UD5 A;  3IWN C;  3BQ2 A;  1KFS A;  2VFT A;  3PR5 B;  4F4K A;  2HBQ B;  4IG3 A;  3D67 A;  3ZTR A;  1RTD B;  1Z2L A;  4FS1 A;  2HKE A;  2MMY A;  4FF4 A;  4MYT A;  2W4C A;  1D3W A;  1RA6 A;  2HHV A;  3UNG C;  1IKY B;  5KFO A;  1OPI A;  4QCL A;  1ACM B;  2QGF B;  1G6B A;  1M1G A;  1TL1 A;  1WDD A;  2HBR B;  3MUT P;  2IM1 A;  2DNH A;  5DDR C;  1UWB B;  4JI4 F;  3Q89 A;  2DD8 S;  3L4B C;  2J76 E;  1YJR A;  2BJ1 A;  4AQY F;  2ZBC A;  4PPD A;  4CYU B;  2IRX A;  4DSJ A;  3CNQ P;  4RWX A;  5KFT A;  1Q8K A;  2QO3 A;  3CJ0 A;  1OIA A;  1KLN A;  2LEC A;  1CSJ A;  3JXO A;  4KV8 A;  3UI3 A;  1GXU A;  4FNI A;  1F1B B;  2C28 A;  5GMK a;  4CCH A;  3M1V B;  1UVK A;  1YJT A;  2AZ3 A;  5CD4 H;  1EJ7 L;  1VQ7 S;  2NZ4 A;  2W2Q P;  3ILJ A;  4RW6 B;  2D69 A;  3G87 A;  4RNO A;  4QR2 A;  1UL3 A;  2XHW A;  2RUG A;  3FFI A;  1NHV A;  4KHR A;  2HS4 A;  5A8R A;  2XMJ A;  4KC5 A;  2WVE A;  5HBM B;  1XIQ A;  4Q0B A;  4ILR A;  2FDN A;  3HHL A;  4DCP B;  5GAD U;  4DL4 A;  1Q16 B;  2BE2 B;  2W25 A;  2QSW A;  4IG0 A;  4PG6 A;  2WSE C;  2ADB A;  3D28 A;  4H4K C;  4A46 A;  1TL3 B;  5FLX U;  1RTI A;  2ZBI A;  2R4F A;  3K0J A;  2WZ1 A;  4ECS A;  5HAT A;  1JKH A;  2F40 A;  4OFZ A;  4JI6 F;  4KFB A;  2DNR A;  4CLZ A;  2HSE B;  3MZI A;  4IR1 A;  2ZOG A;  4I2P A;  2LA6 A;  5F8L A;  5J2Q B;  3OT9 A;  4DFP A;  5D0R A;  1PCA A;  2WVB A;  1ITP A;  3LWL A;  4UW2 A;  1QM9 A;  2J7W A;  1UVJ A;  3AQP A;  3CJ3 A;  4LIW A;  4RLE A;  1PGZ A;  4J9Q A;  1VQ4 S;  3VGV A;  3K5M A;  4FPR A;  1Y5N B;  3EVO A;  3BZQ A;  1U0H A;  1NDK A;  1WF0 A;  1HYS B;  2CJQ A;  3CD5 A;  4M5K A;  1SI9 A;  2OPQ B;  4NL5 A;  2FJV A;  4FPI A;  4DG1 B;  4DL2 A;  4TYB A;  1AZS A;  1CEZ A;  4ID5 A;  1HBU A;  1IR0 A;  3VAI A;  2EEY A;  1PIE A;  3F41 A;  2F63 A;  3J7A 1;  2VV5 A;  3AXM A;  1RT1 A;  5L39 A;  4DUZ J;  2OAU A;  2D1C A;  2M0G B;  4WYW A;  1S7I A;  2OEJ A;  3Q8P B;  1VGY A;  2V4R A;  3M6V A;  1P8G A;  2MZS A;  2R7V A;  4F25 A;  4Y0F A;  1UA1 A;  1VQY A;  3E8O A;  1U1L A;  5LJ5 Y;  3D0G E;  3M8R A;  1T9U A;  4WFB Q;  3Q24 A;  1CS4 A;  1NCL A;  1SJR A;  3FBC A;  3QLH A;  3J7Z T;  2CQP A;  3PW2 A;  2B6A B;  3DU6 A;  3CME S;  4AT1 B;  1N6Q A;  4F0K A;  4FBT A;  4Y6I A;  2BKN A;  3MR6 A;  2POK A;  2BJ8 A;  2IJR A;  1MN9 A;  1N4L A;  4X84 A;  3T9N A;  2BJ7 A;  1VRU B;  4OV1 A;  4ZPD A;  3AAW B;  1RK8 A;  4E0D A;  3UW1 A;  4KGZ B;  1YX2 A;  3OL9 A;  1VC5 A;  1TKT B;  4MKV A;  5AE2 A;  3F44 A;  2BZ2 A;  3KK3 A;  4B02 A;  3GB0 A;  1Q86 T;  1OPZ A;  2VBY A;  5KFP A;  1IR1 A;  4BCA A;  3A8K A;  1FTR A;  5HVF A;  3MI7 X;  3IG1 B;  1R8C A;  4DL7 A;  1FHT A;  3QT5 A;  3R9L A;  2YPY A;  2WAQ D;  1S1T A;  3G6V A;  4JV5 J;  2ZH5 A;  1G7C B;  2QFJ A;  4IOB A;  8ATC B;  2MKK A;  1FDB A;  4KGX B;  4XDD A;  1XEZ A;  2W4D A;  2E5L J;  4ZCL A;  2I0X A;  1CUL B;  3KUG A;  4UST A;  1NK0 A;  4ZPV R;  2DR5 A;  1T05 B;  1M5K C;  1RTZ A;  4OLP A;  2UVW A;  2J9D A;  4DV0 J;  3Q8Q B;  5E33 A;  3KWM A;  3RBX A;  3BGF A;  4EI2 A;  2H9Z A;  1F9H A;  4NLD A;  2QLB B;  2OGU A;  2LA4 A;  2R8K A;  2DNM A;  4EFA C;  3OR2 B;  2KHD A;  4PYA A;  4AYB D;  4DI6 A;  5IV4 A;  4DR5 F;  2KJV A;  1HHT P;  2FLP A;  1RIS A;  5JUM A;  4X64 F;  2WSF C;  3IMQ J;  2E9R X;  3D54 A;  2XQC A;  4P71 A;  4TY8 A;  4EZ9 A;  2W8K A;  1IJF B;  2R7T A;  3DNC A;  1FDN A;  3M6W A;  3PJW A;  2J7U A;  3W5Y A;  4DPX A;  4ZCM A;  3I0R A;  1RAI B;  2A10 A;  3M2V A;  5K8M A;  3ETM A;  1LOU A;  1LXN A;  2GZO A;  2RF2 B;  3NMA A;  1Y4Z B;  5H9E K;  1U8S A;  1AXQ A;  1PJ7 A;  1P6T A;  2F65 A;  1DTQ B;  4J9U E;  1ZM3 A;  4LF5 J;  5HQ8 A;  3A3N B;  2L3M A;  3MM6 A;  3MEC B;  1TK0 A;  1RAB B;  2BAN A;  2GAH C;  5A0Y B;  3LPY A;  1U48 A;  3C2P A;  3ZZU A;  4C3L A;  2OLW A;  3GU0 A;  2E9T A;  3RBZ A;  3UCU P;  1SKW A;  1FES A;  2B8P A;  4KQZ A;  2DNL A;  1RAE B;  3MMA A;  5CCL A;  2YWE A;  3FNN A;  3HF5 A;  2VU5 A;  5EWE A;  1H7X A;  3VZI A;  2L9N A;  2DNZ A;  2AX1 A;  5DM7 Q;  3L7U A;  1IKY A;  4U67 Q;  4MK8 A;  4NRT A;  4C0O C;  3QGH A;  4F4W A;  1CVJ A;  1I51 B;  4ANE A;  2UXD J;  3WIU A;  1R3N A;  2LU2 A;  3G9C A;  2ASJ A;  1KQK A;  4CYU A;  2V4J B;  1DJ0 A;  1GMU A;  3HVA A;  2HVI A;  3N0V A;  4JI2 J;  2MQO A;  2GNK A;  5AXN A;  3W5Z A;  3VZH A;  1A6L A;  1C1B B;  5GAH U;  1URR A;  3TEH B;  2VG6 A;  1HWL A;  2WB1 D;  3FBB A;  4Q8E A;  2ALZ A;  3EVW A;  4C7Q A;  1TR0 A;  3NS5 A;  4LFA J;  3MED B;  2G2Y A;  3FMB A;  3QAT A;  1XMO J;  4ZCK A;  4IQX A;  3PX6 A;  1SUQ B;  4JI0 F;  3T6B A;  3LWM A;  3B8H A;  5KT5 A;  1K0T A;  3OFH A;  3CUL A;  2BV3 A;  1VYA A;  4NXN F;  1VR6 A;  4LRD A;  3KXD A;  1X4H A;  4RUB A;  1BD6 A;  4OI4 A;  3BPS P;  1X60 A;  1C4A A;  1FD8 A;  1W2I A;  3MAA A;  4DJB A;  3BJY A;  1FEE A;  3PW5 A;  1GX5 A;  1H72 C;  2BE2 A;  1EIY B;  4M8L A;  1X9S A;  4ID8 A;  5K14 B;  2ZH4 A;  1TKD A;  4QJV A;  4P73 A;  4A8O A;  1FXD A;  1TZ0 A;  2UUT A;  3W2V A;  5KFS A;  1UCN A;  4MKB A;  2JDJ A;  2CG8 A;  2XBP A;  4WKY A;  3CPW R;  1TV6 B;  3UO0 A;  2OSR A;  2V50 A;  4RPF A;  2AX0 A;  3TUZ C;  1FWP A;  3OQ2 A;  2IJN A;  3WQP A;  4LQ9 A;  4YN3 B;  2KFY A;  2VQE J;  3S1T A;  2MKS A;  4M5N A;  3CCL S;  3ISZ A;  1S97 A;  3IBC B;  4DUY J;  4DR4 J;  1C1C A;  1EHW A;  5EWF A;  3PYG A;  1UJ4 A;  2MJN A;  3IGV A;  4C8Y A;  2CZ4 A;  2Z2Z A;  2M5Y A;  1LW0 B;  2DK2 A;  1FCA A;  2OKQ A;  3CJ4 A;  2COL A;  1R0A A;  1IBK J;  3D3C J;  2DPJ A;  5BR8 F;  1HYS A;  2WVC A;  1AB8 A;  4KYZ A;  5DRK A;  4PG5 A;  3FEY B;  2YQ3 A;  3CCQ S;  5KFA A;  1PYS B;  4NLO A;  3BN4 A;  3KG4 A;  3R7S B;  2YTC A;  3T9Z A;  3HVT B;  3GCX P;  1GMW D;  1RGV A;  4KTQ A;  3MCN A;  3DRR B;  2AEF A;  5KFU A;  2XUL A;  2AYM A;  4B3O B;  2NXC A;  5CZV A;  3CD7 A;  4U8V A;  2WHO A;  4RU9 A;  2KYX A;  2WW8 A;  5D0G A;  3J7Y I;  1P27 B;  4X62 F;  4J9L A;  2QN6 B;  4CLY A;  3CCJ S;  3UDE A;  2FLO A;  4AXJ A;  2KJW A;  2B7B B;  3V6D B;  1V5I B;  3CVK A;  2XG8 A;  2JLF A;  5G4D A;  3MR7 A;  4K4X A;  3QYY A;  2J8A A;  1KVI A;  1S6O A;  4DV7 J;  3DMJ A;  4QIV A;  2HFS A;  5CYQ B;  2CJ9 A;  4CO4 A;  3GYX B;  4DV2 F;  2GCF A;  2HK3 A;  4DV3 J;  1HBO B;  4BDP A;  4O3Q A;  4PG7 A;  1VLY A;  3CT9 A;  2CJA A;  3KDO A;  3J7Z 5;  1KR4 A;  5A2Q Y;  3ET6 B;  3DLH A;  1NSA A;  1RAO A;  2OPP B;  5EDW A;  4WFY A;  2PI4 A;  2VOD A;  2HS3 A;  5C24 B;  3BBB A;  2VON A;  1S6U A;  4A8Y A;  3JSM B;  3ZTO A;  4XIU A;  1LWE A;  1AFI A;  1N5V A;  4M94 A;  4CDI A;  1UAW A;  4ETX A;  1H0H B;  3M6U A;  1EAR A;  1HBN A;  3PR4 A;  3CE8 A;  3QT8 A;  3AA8 A;  4MTP A;  2C2Z B;  3NBP B;  3DRP B;  4X4S A;  1NK4 A;  2VC1 A;  2JLG A;  1D8Z A;  1PJ5 A;  3VHQ A;  2ILY A;  2R7O A;  5EUH A;  1WHV A;  3A3P B;  2KT5 A;  1VOM A;  2ZM6 J;  2JJ4 D;  1LWF A;  1QY7 A;  2V34 A;  4WYL A;  3ZZZ A;  1SC1 B;  1DRZ A;  2GJI A;  3D0H E;  4HLB A;  3FVY A;  2IBK A;  3M30 B;  4PZV A;  1IKW B;  3G6Y A;  3P4U B;  3HZE A;  3R27 A;  2MXY A;  5D0E A;  1T3O A;  2CJB A;  3OTC A;  3ZZO A;  3QZ8 A;  2JFK A;  2H48 B;  2CPD A;  4O4G B;  2XNQ A;  3G82 B;  3AY0 A;  1YBA A;  1T11 A;  1UZH A;  2V69 A;  2DNN A;  2O1P A;  3GSI A;  4CQ1 A;  3OR2 A;  4J91 A;  1S0N A;  2ACM A;  1VQ8 S;  2GC8 A;  4DQI A;  3W2W B;  4I1T A;  4GO5 X;  3T19 A;  2WSC C;  2CQ0 A;  2PMH A;  3BRE A;  3A12 A;  1WOP A;  4RX6 A;  3E3X A;  3CCU S;  3B78 A;  3QIP B;  4GVB B;  3HCX A;  1NAQ A;  5KFI A;  1LV5 A;  1KKH A;  2RF2 A;  4C0B A;  3N6M A;  2V67 A;  2OML A;  4HH1 A;  1U0S A;  4YR2 A;  3E2E A;  1GH8 A;  1B7Y B;  3TRG A;  3LTO A;  4ED3 A;  4Z7Y A;  4DR2 J;  2V94 A;  1KQF B;  5A0Y A;  1FE4 A;  4F3O A;  2BW2 A;  5BYR A;  2V9K A;  1U6F A;  4V1A k;  4KRW A;  2VL1 A;  5IWA J;  1PBA A;  3H5S A;  2HVD A;  3FQK A;  1VIX A;  3CF5 Q;  5IT9 U;  1MLA A;  3R5D A;  1W2B R;  1QSY A;  3V81 B;  1KHV A;  2H4Y B;  3MMC A;  1HA1 A;  2AJ0 A;  3IGN A;  3MD1 A;  3AOB A;  1T95 A;  3NGT A;  2Y3Y A;  3V6H A;  2Y1J A;  2MKI A;  4IO9 Q;  1K73 T;  1IUJ A;  1U49 A;  2FUG 9;  3CSK A;  5B0F A;  2G0I A;  2V4J A;  1T9T A;  4USK A;  3DDK A;  4ZP8 A;  4ILM A;  2OHD A;  4ECY A;  3TVK A;  3OL7 A;  1A9N B;  3CC2 S;  3MPY A;  2RHS B;  4KPY A;  1S0V A;  3PO5 A;  2RDD A;  4DL0 C;  4NEZ A;  1KFD A;  5F3T A;  3HD2 A;  2W9A A;  3CDU A;  1F0X A;  2D7S A;  1C1B A;  4DV6 F;  3GJS B;  1NKB A;  2DNP A;  1P9Q C;  3Q8R B;  4FDF A;  4UOH A;  4O44 B;  2GGP B;  2UXC J;  1NHU A;  2HQC A;  4TYA A;  1WG1 A;  2UV8 A;  3TVY A;  3LAN A;  4LBP A;  4OZ5 A;  5E3A A;  2LQ8 A;  2E5I A;  5FD1 A;  1SUQ A;  3UWT A;  2HVH A;  4ZK7 M;  4ES2 A;  3VQT A;  2HQG A;  2H5I B;  2IDL A;  3BDE A;  2HBZ B;  4LF9 J;  1KVK A;  4S0M A;  4OYW A;  2HBY B;  1JX4 A;  1BXN A;  2CQD A;  2VA3 A;  3ZZR A;  1QJH A;  4H54 A;  4HI1 A;  4I64 A;  1C2P A;  2FHJ D;  2VBW A;  1RYS A;  5I4M A;  2QYC A;  5JXS A;  1UJ6 A;  2KB2 A;  5SZT A;  1ZM9 A;  3ZZT A;  4NLU A;  2XO7 A;  2EC0 A;  2MPU A;  5GAD I;  4LRA A;  1RAA B;  4EZ6 A;  3UFC X;  2D3U A;  5A6P A;  5I3U B;  4C48 A;  4DCJ B;  4NLV A;  2QLX A;  1IBL J;  4P2F A;  2QMX A;  1S1U B;  2RRB A;  2UVV A;  3P8B B;  3BO2 A;  5BJR A;  1RT6 B;  3P49 B;  4DUZ F;  1CJU B;  1BWE A;  3QQC D;  3MEK A;  2XYP B;  1RCO B;  4ZVQ B;  1V3Z A;  1NB7 A;  4KHP J;  5GAG U;  3C16 A;  2BQ3 A;  2F9D A;  3RU0 A;  5AXL A;  1QAX A;  4GO7 X;  1N52 B;  4OX7 A;  3DOK B;  3KFW X;  2KYZ A;  5DLF A;  1N88 A;  1HD1 A;  1B64 A;  3MDF A;  4KO0 A;  1LW0 A;  2C3P A;  4JI8 F;  5H9F J;  2JEJ A;  3DXB A;  1JLQ B;  4U7U D;  5HAN A;  2JHE A;  3D68 A;  1WF1 A;  4K2J A;  2N3L A;  4PXC A;  4ZVH A;  2XY6 A;  4RO0 A;  3TWZ A;  4LRB A;  4QWA A;  4P7T A;  3QJJ A;  2HNZ B;  4OYA A;  3LPE A;  3HVT A;  5B0D A;  4V19 J;  5FDL B;  1HPZ A;  2J6U A;  3B4M A;  4P2M A;  2KVQ E;  2KL8 A;  3NNA A;  3DM2 B;  2FZC B;  2Z0G A;  4RW4 A;  2Z2L A;  1YGY A;  3A8I A;  4JI5 J;  4WWS A;  4MIA A;  4ENO A;  1KOO A;  3HHL C;  4NEY A;  1SL1 A;  4B9L A;  2G13 A;  3DGV A;  4XK8 C;  4F02 A;  2CG4 A;  4JV5 F;  2ZBP A;  2MQQ A;  1T3N A;  1M1H A;  2HRY A;  2OD6 A;  1QE1 B;  3NWR A;  2ERR A;  5KFL A;  1QLN A;  3HDS A;  1SIW B;  2Z4P A;  4LR7 A;  2CAJ A;  1Q95 G;  3V6K A;  4P9S A;  1M5O C;  1MML A;  1U09 A;  3M2U B;  2BRK A;  3Q8V A;  5CYQ A;  3EIC A;  3POT B;  4P74 A;  1X0F A;  1FFS B;  3MXH P;  4NA2 A;  4DV0 F;  2ZUG A;  3HJF A;  3VGU A;  2AYE A;  2QC3 A;  2ROG A;  1R89 A;  2ZNY A;  1HNI B;  4OI1 A;  4B9S A;  4UTG A;  5C24 A;  5ETK A;  1RT3 B;  3ENW A;  2M4M A;  4MH8 A;  3RRG A;  1S57 A;  2AW0 A;  5CD4 A;  4OZ2 A;  2MHN A;  1NRK A;  2ZFH A;  3IAM 9;  4ZLP A;  3OV7 A;  2LQ9 A;  3VTI A;  2KM8 C;  2DY1 A;  4WFX A;  2KRR A;  2RH3 A;  3NBP A;  3ENQ A;  2KG1 A;  2WRM A;  4NPO A;  4IFV A;  3S7R A;  1FDD A;  1FVS A;  3EZO A;  1VBY A;  5L1J A;  3FCV A;  3CJQ A;  3S6E A;  2ZEJ A;  1TKZ A;  5KFH A;  3NOC A;  1XNR J;  3OSP A;  3CJR A;  3ICL A;  3SV4 A;  2P9E A;  2MLZ A;  3A1Y G;  3M30 A;  3D9B A;  2JVO A;  3O44 A;  1HNW F;  1GMV A;  3ZZP A;  3OUY B;  3Q8U A;  4LF6 F;  4DR6 F;  2F1F A;  4O4G A;  3LA0 A;  4WFZ A;  3PIP Q;  4KY3 A;  2GA7 A;  1TFY A;  1FX2 A;  3PFE A;  1CLF A;  3M32 B;  1NZA A;  2OD4 A;  1X5T A;  5F8H A;  2VBZ A;  4CLP A;  4LF1 A;  3VWS A;  1RQ0 A;  3W2W A;  2FHK A;  3GFX A;  1N5Y B;  3TJA A;  2ZVS A;  4UT4 A;  1BQN B;  1WD6 A;  3UCZ P;  2QJ3 A;  1YIT S;  3RR8 A;  2ATC B;  1QUV A;  4N7T A;  1LKZ A;  2AZ1 A;  5BXI A;  4MT1 A;  4Y34 A;  2YPZ A;  1BQM B;  4F36 A;  4DU7 A;  2GQC A;  3LUY A;  3QIP A;  1VQS A;  4QIE A;  1FDA A;  2GFF A;  4ZP7 A;  3FGV A;  4DS5 A;  2LVW A;  1SH0 A;  3LW5 C;  3KJV B;  3JSR A;  2EKN A;  3HMJ G;  4PQU B;  2RJZ A;  5HL7 Q;  1Z2Z A;  3MCM A;  1D8Y A;  1N33 J;  2GV1 A;  2EW9 A;  2YXL A;  2HS0 A;  4M63 A;  5KFQ A;  3BBC A;  5J1P A;  2UP1 A;  1F5B A;  4FYX B;  4JBC A;  4CLS A;  2L08 A;  3BR9 A;  4K0K F;  3GPA A;  2G1H A;  1WOS A;  1XMO F;  3FSI A;  5I42 B;  1ULR A;  1S5Z A;  1BQX A;  2DXE A;  3EDQ B;  2K3I A;  3PEH A;  1J5E J;  3PZP A;  2RS2 A;  3DRS B;  3M4X A;  1RTJ B;  2VG5 B;  1Y0H A;  2BA9 A;  1YJV A;  5HJX A;  3BSC A;  3R1L A;  1V9O A;  2EPI A;  1YLX A;  4CH0 S;  1RT7 B;  2PI5 A;  1TKX B;  2HHH J;  3CMA S;  1ZZN A;  1RT2 B;  3HHN B;  1Z1Z A;  4C8N A;  3W65 A;  2XMU A;  3O1L A;  2NXU A;  1T03 A;  2V9W A;  2J9E A;  1FI4 A;  2M3D A;  5A8K A;  4Y2I A;  1XN9 A;  1U1M A;  2LCW A;  2CUY A;  4A8F A;  2IVM A;  2KVI A;  1XC9 A;  5KFE A;  4OIX A;  4JI3 J;  3CDW A;  4M5M A;  2OUG A;  5F0W A;  2GGP A;  5KFW A;  3ITH B;  3R6G B;  5GAH I;  4DX6 A;  2VB6 A;  3OLA A;  4URS A;  4F26 A;  1Y9O A;  2R2S A;  4BS2 A;  2DHX A;  3WZ0 A;  3TAR A;  2MYF A;  3BQ1 A;  5E3C A;  4H4O B;  2M8D B;  4WFA Q;  2BX6 A;  1RCX B;  3VF0 B;  3SFG A;  1EQM A;  2CIM A;  4G1Q A;  3TJ9 A;  2RE1 A;  2ZH6 A;  2OEK A;  2AJ1 A;  2BEF A;  2YH0 A;  5ETL A;  1VQ6 S;  1KDN A;  3RBD A;  1FWK A;  2FVC A;  1FEH A;  2V2K A;  1Y00 A;  1IBK F;  5C25 A;  5IQQ A;  5G0R A;  3KNA A;  3MAQ A;  1KEK A;  2M88 A;  4OYI A;  4YHH F;  4W4M A;  4ZPT R;  4Y00 A;  3H5U A;  3CJ5 A;  4X4V A;  3U02 A;  2OJ3 A;  2LYV A;  3TJ8 A;  2GML A;  2CPH A;  2XYH B;  4M5L A;  3MM9 A;  4MAK A;  1REG X;  4C11 B;  1N56 A;  3GP9 A;  2HUR A;  4O23 A;  1RBA A;  2F9J A;  2R8G A;  4L73 A;  4N56 A;  2G0J A;  4WE1 B;  1SJ1 A;  4ECV A;  1KNZ A;  1VBZ A;  4QW9 A;  1Q4R A;  2BE7 D;  2ZIT A;  3EXC X;  2G2Z A;  4MYU A;  5EHH A;  2X1G A;  1IKX A;  1WF2 A;  2VPZ B;  1D9D A;  3EYZ A;  4ELT A;  3KLF B;  3SFU A;  2HGM A;  3LP0 B;  1PKU A;  1JXV A;  2YWG A;  3VAJ A;  2AEM A;  4Q2L A;  3D1H A;  2ZD1 B;  4GKJ F;  2YKN A;  4BBY A;  2IM0 A;  4JI4 J;  4QIF A;  4L76 A;  4NX9 A;  2CVI A;  4RL1 A;  1TL7 B;  2ZH7 A;  4EWT A;  5D77 A;  3DU5 A;  5AT1 B;  2WW4 A;  4ALZ A;  1F5A A;  4PUO A;  3CMQ A;  4RW7 A;  1SJ4 P;  2DYA A;  4CWB A;  2EI5 A;  4RBV A;  2MZR A;  4IRC A;  2DXD A;  2C2K B;  3M7V A;  1S1X B;  4A4J A;  3G8S A;  1DTT B;  3UPF A;  3KLI B;  2GHV C;  2E7X A;  1QE1 A;  1XWL A;  3R5A A;  2HAF A;  2XWY A;  1R31 A;  1XMQ F;  4CZC A;  5IT0 A;  5D4P A;  2ZM6 F;  4ED4 A;  2C2E A;  2YY3 A;  2MB0 B;  1RHM B;  2MQM A;  3CJS A;  5C42 B;  2Y8W A;  3E01 B;  4Q7A A;  4R8U A;  2A18 A;  4NLP A;  4QYR A;  1Q81 T;  1HNX J;  3SCL E;  4C3K A;  4HKQ A;  2ZDO A;  1Q8I A;  2E7W A;  3GV8 B;  3AD8 C;  2Z8Q A;  1B4S A;  2QA2 A;  3K2Y A;  4K2X A;  5D15 A;  4R0E A;  4N76 A;  1XNQ F;  4DSK A;  3MPD A;  2VF3 A;  5C2G A;  1JJC B;  2F8H A;  2J0Q D;  4RUA A;  2NR0 A;  4HAC B;  2Y1I A;  2GQ2 A;  1CJK A;  2BJ3 A;  4CTA B;  3HP6 A;  3HHK A;  4JI6 J;  1W26 A;  1D9F A;  3GSD A;  4NCA A;  5J1N A;  2X3G A;  4K4U A;  1UVN A;  2G0C A;  2QEX S;  2V8G A;  2KN4 A;  2JX2 A;  4A8K A;  4ELV A;  3ZO7 A;  2BDP A;  1HQ2 A;  2BKO A;  2WB4 A;  3I96 A;  5JVH Q;  3I4P A;  1NH7 A;  1RU1 A;  3OUY A;  1VQO S;  4M5J A;  2W2M P;  1KTQ A;  2B3T B;  2XLI A;  3PX4 A;  3T1A A;  1DQ8 A;  1ROF A;  3FJ2 A;  2PEH A;  4PPZ A;  3KUH A;  3PY8 A;  4PWW A;  2VIC A;  2YNF B;  3L7P A;  2GW8 A;  2GO8 A;  4Q44 A;  3PJX A;  3TNV A;  3D5M A;  1P9Y A;  4X4Q A;  3C14 B;  2ADC A;  2UVR A;  1FKO A;  1SL0 A;  1BQM A;  4TXS A;  3LP2 B;  3MAH A;  5EWG A;  3OVS A;  1Q8B A;  2DEI A;  4E2F B;  4RW8 B;  3JTP A;  3HI9 A;  1U7L A;  4LR8 A;  2XCA A;  4J9S A;  3M8P B;  2HHQ A;  3TQE A;  3NGD A;  1WSR A;  2KI2 A;  3W8G A;  5ADZ A;  3MD3 A;  3V4I B;  5DO2 A;  4P10 A;  1RWN B;  2UXC F;  1XJW B;  2CXE A;  2HVZ A;  3CUN A;  4ZJO A;  1RAC B;  3QZ7 A;  3GIK A;  1DQA A;  3T5H A;  1HNZ J;  5M2P A;  3OVA A;  4A8W A;  4YR0 A;  1PIL A;  2YKP A;  4I68 A;  2X1A A;  1OSC A;  3DKD A;  4A8M P;  3DRS A;  1SPB P;  2QZ8 A;  3PX0 A;  4B3T J;  2VG5 A;  2IAJ B;  4LF9 F;  4OV6 A;  1UZD A;  1WDT A;  5IQ6 A;  1TKX A;  3N5B A;  1K0V A;  1KP6 A;  3NKY A;  1VCT A;  1Q5Y A;  2G2O A;  2HND A;  1DLO B;  3H0P A;  1X4B A;  4ECT A;  2NSC A;  1OY6 A;  2XY5 A;  4NXM J;  3M8Q B;  3TZZ A;  4RNM A;  3W1Y C;  3H4D A;  3T1Y J;  2DH8 A;  3W62 A;  1S9E A;  4WZM A;  1REV B;  1IWG A;  3HUL A;  2YQ1 A;  1IBL F;  4DR7 F;  4XAK A;  3DLK B;  4OYO A;  2VA2 A;  5B0G A;  1EP4 A;  4OZ1 A;  1CJV A;  4YEA A;  1GEH A;  3Q0A A;  2IVF B;  1J27 A;  3PYD A;  3BSA A;  2DNK A;  1B7F A;  4KHP F;  3C6U B;  4NMX A;  1WTB A;  5M2U A;  4DWI A;  3BKU A;  4I67 A;  4ZLN A;  4YB1 P;  4DLE A;  5H9F K;  1CQN A;  4EYI B;  2BYC A;  4DR5 J;  2I6W A;  3CTR A;  2DB1 A;  1R0C B;  3BGO P;  5E3Q A;  4X64 J;  1GFW B;  1CBK A;  4C0H A;  3AA9 A;  1UPM B;  1TL1 B;  1NJX A;  3VAF A;  1A0O B;  4LF8 F;  1WOR A;  3NS6 A;  4OZL A;  2HQD A;  1H6K X;  2ZZT A;  1R43 A;  2HHP A;  2H5E A;  3TAQ A;  1RHQ B;  4PAA A;  2GO9 A;  3CCS S;  3G8T A;  2X3D A;  5DG8 A;  3KG0 A;  1HR0 F;  4KKO B;  3T5J A;  1NK8 A;  2DBB A;  2AD9 A;  2UUC F;  2I5J A;  2WTF A;  2AGO A;  5ETO A;  1S9F A;  1M5S A;  1Y5L B;  5LMN J;  4PXD A;  2BOA A;  2VDI A;  2QFI A;  3VAL A;  3TEG A;  5KG3 A;  2IMO A;  1T9Y A;  1G2E A;  4YY3 F;  2OSQ A;  2MLY A;  5GAG I;  2JNJ A;  3SDE B;  2KG0 A;  4USJ C;  1VK3 A;  3O6Q A;  3LP0 A;  4WXO A;  4ZHR A;  5U47 A;  5HLF A;  5A8R B;  3GIR A;  2ZD1 A;  1VQ5 S;  1E6Y B;  4TVA B;  2EFV A;  2XSJ A;  3CCW A;  2VKZ G;  3I5C A;  1EQ0 A;  2GIR A;  4L6V 3;  4XPC A;  3GYN A;  1TL7 A;  2I1R A;  2FJE B;  3HHD A;  2ZNZ A;  5K9F A;  3TI0 A;  2CNK B;  3K7R A;  4Z37 A;  3EX7 B;  3VAG A;  4IKA A;  4IG0 B;  2XGQ A;  3JAM Y;  5KFF A;  4C9D A;  3BPD A;  1WOO A;  3K5N A;  3TZW A;  2OPS A;  1AA1 B;  4K7Q A;  4DSE A;  1FA0 A;  4X4R A;  2OEL A;  1S1X A;  2Y9H A;  3G8Q A;  1KQG B;  1TP7 A;  4XTT A;  1JKH B;  4QIW D;  2DGV A;  4KFB B;  3RB0 A;  3KDN A;  1H73 A;  2LEA A;  2F4F A;  2K1R B;  3SEO A;  3TOQ A;  2DH9 A;  3N5F A;  2ZWP A;  4OI0 A;  3JS9 A;  3LGM A;  4M5D B;  1WHX A;  4B9V A;  2BRL A;  1FJG J;  3CDB A;  2KT2 A;  2NRE A;  3O3L A;  1PG5 B;  4G3I A;  4WTO B;  4X4N A;  4NA3 A;  1U1Q A;  2HRU A;  1U0H B;  1SQG A;  4QU6 A;  1X0P A;  2CQB A;  3UDV A;  2I8E A;  5C2C A;  2UUA J;  4N8N A;  2GVD B;  2AJQ A;  3M8W A;  2B9W A;  1G4C A;  2ZC3 A;  1AZS B;  2RKI B;  2NCK L;  2OFG X;  3I9Z A;  1LEO A;  4HAC A;  1DHM A;  2XZW A;  4J7C A;  4J9O A;  2CJK A;  1RDR A;  2D74 B;  1I1G A;  4L75 A;  3KK2 B;  1HBU B;  2P5V A;  2MZJ A;  4CTA A;  4DV1 J;  2RIL A;  2W7A A;  1RT1 B;  3QWU A;  5HJY A;  4FN5 A;  4PEO A;  4OL8 A;  4PWD B;  2XSF A;  2HHT A;  4QU7 A;  1JLB A;  1VLO A;  3NNH A;  1RHJ B;  2OEM A;  4WP8 A;  3R5G A;  3SIP B;  1BHN A;  4UOF A;  1RLD A;  3QRR A;  1SC4 B;  2XM3 A;  1G1X A;  4W90 B;  3PFO A;  1CS4 B;  3X3U A;  2IPO B;  3NEK A;  3P5T L;  6FDR A;  2YNG A;  1N6Q B;  4DL3 A;  4LRF A;  2BBE A;  1FK9 A;  2DR9 A;  5GAE U;  2KXF A;  4JOU A;  4RKU C;  3C14 A;  3OL8 A;  3MPU B;  1UA0 A;  1U25 A;  3NP5 A;  3NS7 B;  2HHH F;  1M1K T;  3DDI A;  3MPW A;  5HAO A;  8RUC A;  2EFQ A;  4NLY A;  3KK3 B;  3HXM A;  5IT4 A;  1YDL A;  5F8G A;  4C97 A;  4X62 J;  3EE3 A;  2N4D A;  3DRY A;  4ETZ A;  4LSZ B;  4ECW A;  2N82 B;  2F5G A;  2CQG A;  2DNY A;  5HI7 A;  5KFD A;  2K2P A;  2AP6 A;  1FX4 A;  3SSR A;  4K4W A;  2OFH X;  4JI3 F;  1SBR A;  3V4I A;  4TQR A;  4AD6 A;  2BW7 A;  4XO0 A;  1TK8 A;  1YRX A;  1WHW A;  2PT0 A;  4TN2 A;  4DV2 J;  3MTJ A;  2LQJ A;  2NYI A;  3IN5 A;  2MKY A;  2V8H A;  4QWE A;  4QYZ J;  2M70 A;  5CCM A;  3KUE A;  2BOP A;  3V2U C;  2D3Z A;  1ZAV A;  1FRI A;  2QG9 B;  2IAJ A;  2NXN A;  4J9P A;  2ZH2 A;  4HDG A;  2PFD A;  1RAG B;  4WU2 A;  3I56 S;  4OJG A;  3L7O A;  5KFK A;  4FS2 A;  2ZHO A;  1CC8 A;  1AFJ A;  3AQO A;  1NME B;  1S6Q B;  1UKU A;  3J7A N;  2QTW A;  4KJI A;  4TY8 B;  3SQG A;  5IV3 A;  2QMU B;  4NZ0 A;  4CLU A;  3UN5 A;  5A8W A;  1NPK A;  3V5R A;  3BBF A;  1FRK A;  3M2V B;  5B0C A;  4N8O A;  4NAS A;  5RUB A;  5J2P B;  1FVQ A;  2E9Z A;  1R27 B;  4O3S A;  3TX0 A;  3NL0 A;  4IRD A;  4DS4 A;  3R5C A;  1WKL A;  3MEG B;  3K8V A;  2BAN B;  4I56 A;  4O3P A;  4PR6 A;  1ZTT A;  3LOU A;  1YBU A;  4CP5 A;  2L48 A;  3MMA B;  3AOD A;  4AUK A;  2DO4 A;  2F7V A;  1QAI A;  2DKO B;  3NCR A;  5LT5 A;  1KVJ A;  4KT0 C;  1X4G A;  1RHU B;  5L46 A;  3EGW B;  1WC5 A;  1L5U A;  1WEX A;  1D1U A;  5DG9 A;  2DT9 A;  2IFX A;  2BKP A;  1RWX B;  1RWK B;  3MUV P;  4H4K A;  1CJT B;  1X9M A;  3BF4 A;  4ER8 A;  4TLQ A;  3G2X A;  2B4V A;  2ZVI A;  4NML A;  3FKB A;  4OYP A;  2XYG B;  1FRL A;  1KWM A;  5F41 A;  2PEB A;  4HT5 A;  4KKO A;  3QMQ A;  3RAX A;  3QID A;  1QSS A;  3N4W A;  3TAM A;  4YDD B;  1NJY A;  2H54 B;  2VG6 B;  3PRV A;  2ILZ A;  3NRB A;  3PM9 A;  2RD5 C;  1MW7 A;  4LFB F;  4LUB A;  1U24 A;  4DUT A;  1K47 A;  3SDE A;  3PNI A;  4CRJ A;  3W9H A;  4WTY A;  1U4B A;  3OTD A;  4NOH A;  4I6Y A;  1YG0 A; 
#chains in the Genus database with same CATH homology
 2CNL B;  2QLF B;  2C2O B;  1RHK B;  3D6F B;  4DCJ B;  1GFW B;  2C2Z B;  3D6H B;  2DKO B;  2CDR B;  2FQQ B;  3GJS B;  1RWP B;  3RJM B;  4DCO B;  2XZD B;  1RHU B;  2CNK B;  2C1E B;  4ZVO B;  4ZVT B;  3NS7 B;  1F9E B;  3P45 B;  1QDU B;  2HBQ B;  2XYH B;  2QLJ B;  1RWX B;  1NME B;  1RHQ B;  3GJR B;  3IBC B;  1RWK B;  1RHR B;  1SC1 B;  2C2K B;  5IC4 B;  2QL5 B;  1IBC B;  2H51 B;  2Y1L B;  2P2C B;  2XYP B;  1RWO B;  4ZVQ B;  3R6G B;  3R5J B;  2CJX B;  1PYO B;  3KJN B;  4JB8 B;  1RE1 B;  3P4U B;  1RWV B;  3D6M B;  1RWW B;  2QLB B;  4LSZ B;  2HBR B;  2H48 B;  2H65 B;  3R6L B;  2H5I B;  2XYG B;  2H4Y B;  4DCP B;  4ZVR B;  2HBZ B;  1RWN B;  2H5J B;  2C2M B;  5K20 B;  2HBY B;  4ZVS B;  2CNO B;  1ICE B;  1RHJ B;  3SIP B;  1RHM B;  3GJT B;  3EDQ B;  2H54 B;  2Y0B B;  2CJY B;  1I51 B;  2CNN B;  3KJF B;  1SC4 B;  4ZVP B;  1SC3 B;  3R7B B;  3R7S B;  2H4W B;  2QL7 B;  1PAU B;  5IC6 B;  3QNW B;  1QTN B;  1I3O B;  2QL9 B;  1BMQ B;  3IBF B;  3GJQ B;  4ZVU B;  3R7N B;  2XZT B;  3KJQ B;  3EDR B;  1RWM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...