2QYCA

Crystal structure of a dimeric ferredoxin-like protein (bb1511) from bordetella bronchiseptica rb50 at 1.90 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
GMTMFLHVVMMEFDDGIDAGFFRTVDEYVARMKRECDGLLLYHFGENVAARSQGYTHATSSAFVDAAAHDAYQVCPAHVAMKAFMGPRIKRVVVYDGEVPAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Ferredoxin-like protein
publication title Crystal structure of dimeric ferredoxin-like protein (NP_888056.1) from Bordetella bronchiseptica at 1.90 A resolution
rcsb
source organism Bordetella bronchiseptica rb50
total genus 17
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qycA00
2PD1A 3TNVA 4F67A 2LXFA 2XMWA 2OKQA 5B0BA 1TR0A 1YG0A 3HHLA 2K2PA 3HF5A 3LGNA 3BN7A 2GV1A 2ACYA 2XMKA 4OJHA 1YJUA 2OP5A 2K1RA 3E8OA 2JDJA 4A46A 1X0PA 3MCSA 2QLWA 3DXSX 1TL5A 3HX9A 3QMQA 2RILA 2OD6A 1TZ0A 2ROEA 1P6TA 1Q4RA 1FE0A 2FIUA 2PGCA 2N4CA 3KKFA 2HFOA 2OD4A 1AFIA 5IXUA 1AW0A 5F0UA 5B0AA 4A4JA 1Y3KA 2KKHA 2RMLA 3GZ7A 3LGMA 1FEEA 1YJRA 4YEAA 3WDOA 4DN9A 2ASYA 3FRYA 2K1RB 4NL5A 2XMJA 1TUVA 1XBWA 2AW0A 1QUPA 2OFGX 5A6WA 1MWZA 3BF4A 3LO3A 3BDEA 1S6UA 2FB0A 1K0VA 2EW9A 1OQ3A 2W4CA 3CJKA 3FMBA 4QOTA 3HHLC 3I9ZA 1P8GA 1CPZA 5A6PA 1FVSA 2OMOA 5B0FA 2BJEA 3BM7A 1MWYA 2IFXA 1OSDA 5B0GA 3DCAA 2HLUA 5B08A 2BUNA 1JWWA 2VV5A 2KT2A 2RSQA 3MZIA 2K7KA 5B09A 2CRLA 1R6YA 2G9OA 1FE4A 2W4DA 3HHLB 4U9RA 4YDXA 4OJ3A 3CJKB 1N5VA 4A48A 4ZA1A 1GXTA 3F44A 1YJVA 4ZOSA 5B0DA 2QIFA 1U7LA 3QGPA 2HLTA 1N5QA 1JK9B 1Y9OA 2Q3PA 1KVIA 4FNHA 2GA7A 5B0EA 4Q2MA 3T9NA 4DPOA 1ULRA 1Q53A 1SQEA 1YJTA 1GXUA 1OQ6A 1Q8BA 2HQIA 4HH0A 2VH7A 1Y0HA 2QYCA 4HI2A 1APSA 2XMTA 3BGUA 4OJ1A 4EFAC 3KG1A 4HH1A 3HHLD 1CC8A 2FTRA 2LQ9A 3TOQA 4FNIA 1VQSA 2AJ0A 2BBEA 4HI1A 2LQBA 2GGPA 1FD8A 3IWLA 3KG0A 1X8DA 2IYGA 2GO8A 2K7JA 1X7VA 2OAUA 2ROPA 2HIQA 4Q2LA 5KAKA 1WD6A 2KT3A 1Y3JA 1SI9A 2ZDPA 5B0CA 2IYIA 2RU9A 2BYCA 1LQ9A 2AP6A 3BB5A 1N5SA 1S6OA 1TL4A 2XMMA 5T7LA 1RJJA 3TRGA 2BJDA 1YRXA 1Q8LA 3KNGA 2GGPB 5F0WA 2ZDOA 3HDSA 2N7YA 2LDIA 1V3ZA 1VQYA 1IUJA 2FHMA 1N5TA 2KYZA 2GFFA 1KVJA 2L3MA 3IWXA 2XMVA 4NPOA 4Y2MA 2W4PA 4Y2IA 3HFKA 2XMUA 4DL0C 2OFHX 4OIXA 5T7LB 2HFNA 4OJGA 2ROGA 2QLXA 3K7RA 4Y2KA 1URRA 1AFJA 1KQKA 1FVQA 2N4DA 3FGVA 3BR8A 3UDCA 1OPZA 1W2IA 1FESA 2AJ1A 4HL9A 5K9FA 3VTIA 4A47A 2GCFA 1CC7A 1SB6A
chains in the Genus database with same CATH superfamily
1NJYA 4JI2F 3DXBA 1CJKB 3NGRA 2GQQA 1TKZA 1WEZA 1S12A 4I1TA 2J8AA 2A2CA 3Q8VA 3I96A 3MAQA 3AB2B 3G8QA 2QSWA 4I6WA 4G1PA 1A7GE 3B4DA 4X65F 1BY9A 3CNQP 2C2ZB 1XBWA 2B9XA 4F3MA 3J7AN 3TJ9A 2J9DA 1S79A 3QAEA 4PABA 1LWCB 4ED7A 2JVRA 3MPDA 4LSZB 4DR1F 4ZA1A 2IMWP 3PVXA 1LW2B 1GFWB 4ZHRB 4PG8A 2PEHA 2V4QA 2JL9A 3KJFB 2DHGA 3QATA 2F40A 5CYQA 1AYEA 2LXUA 4YB6A 2MSSA 5CABA 3T5HA 3CJ5A 2D9OA 3H4BA 3CPWR 1JLFB 4CLYA 2HWTA 4DQIA 3BB5A 1RHRB 5EWGA 1FK9A 3ISND 3T41A 4WFXA 3SV3A 1SPBP 4ZKAA 5LSRA 5T41A 4ZLPA 4XIUA 1FRXA 4IG0B 5C5JA 3QLHA 5D15A 4IFYB 4DDFA 1VC0A 1AROP 2RB7A 2ACMA 1RWKB 1S1XB 1SJFA 5ETTA 4DV5J 4PPZA 4LF1A 1NHUA 1PIEA 2AEJA 2R2TA 3MECB 1VQMS 2H65B 3B78A 1M90T 2AW0A 2J9CA 3NNCA 2W2PP 2DPJA 2OIHA 4DPWA 3JTNA 3ZFVA 2R8IA 4NXMJ 2OPPB 2NYIA 4X84A 2Z58B 4KFBA 4NMLA 1DLOB 3CC2S 2YY3A 2UUBJ 4I7FB 5DJBA 2E5LF 4A8WA 4LFBJ 5F9NA 2ZKTA 3BGOP 4FYWB 2MDAA 1CJTB 4KKOB 3UCUP 2N7CA 5L1KA 3MEGB 2YKMB 4C97A 2BJDA 3NAIA 2VG6B 3CGIA 2R7WA 4PWDA 1JQGA 5LMUF 4C8KA 2FVCA 2DNOA 1HBUB 2QN6B 5C42A 2F3JA 5THWA 4DSIA 5E7OB 4CNYA 2K3KA 4L75A 5KFWA 5F8MA 5ETRA 3PYFA 4ETXA 3OFHA 4BCAA 3JB9k 4ECQA 1NB2A 1S6UA 2R4FA 1KOHA 4GC6A 1AT1B 4OHXA 1FI4A 1P9YA 3CWJA 1RBAA 4IKAA 2YH0A 1S1TA 1HQ2A 4KGZB 3UN3A 2AJ4A 3CMAS 2ILZA 2FY1A 4RW4A 3NXZA 2I6WA 3J7A1 5C2GA 5KG2A 4NLRA 1S0OA 3LOUA 2CJBA 4HACB 5DQGA 3WC2A 4KHPJ 4P72A 3POTA 1Z1ZA 5A2QY 4BS2A 2BRLA 4QPXA 3J81Y 5F0WA 1F9EB 2ZC4A 3WX8A 3M8RA 4X4OA 2JEGA 4MJKA 4RO0A 1REGX 4DF4A 4USUA 3CIZA 3QJPA 3WC0A 4LF4J 1JLQA 1PCAA 1KQKA 2GO9A 4N76A 3GSDA 4Z37A 4WYWA 2ZE2B 3J81j 2XCPA 4U67Q 1NK6A 3BH7B 2MKCA 2V63A 4OL8A 4F36A 2JDJA 2NUHA 3TZYA 4BWMA 3HT0A 4RPFA 3IAM9 2ZBQA 1IBCB 4X4NA 5KOXA 5HMXA 1IR1A 2FD2A 3CDWA 3FRYA 3T1YF 4WE1B 3D0IE 3PHTA 2R7OA 2XZTB 1E6VA 2ALZA 2UP1A 2WK4A 4ZP6A 1RT7B 3CB4A 2CRLA 2C2EA 1FKPB 4P2FA 3GTYX 4RWXA 4H4OB 1LWEA 4LR9A 4EBEA 1S7IA 3DOKB 1MROA 1U0HB 2ROPA 1WTFA 4W98A 3TI0A 4M5DA 3CCTA 2HGNA 4WFYA 2AV5A 2XYHB 4PYDA 3LQVA 2XO6A 4NZ6A 2BW7A 4O0IA 3S7RA 3RG6A 3A1YG 2FY8A 3HZGA 1VQ5S 2CQCA 3G9CA 3G86A 2WBMA 1IQTA 3ITHA 2GCFA 3TNVA 1IN0A 3MEDA 2MLYA 2O3DA 1BQMA 2J6SA 2D1CA 4IH6A 3HP6A 4Y65A 3NOGA 2CA9A 5DG7A 3MTKA 2IBOA 4GRSA 3AJ1A 1CJUA 2KXFA 1QTMA 2KN4A 5IXUA 1AZSA 2DR5A 4IDKB 3IC1A 2IRYA 4FS1A 4F0KA 4K4WA 4WWSA 2V34A 4ECUA 4OHWA 1QAYA 2K7KA 1S0VA 1VGYA 1Y7PA 2GHVC 1IKXB 3OFFA 3N9UC 4MIAA 2C1EB 4KH1B 3VHQA 4X4TA 1RWOB 1H2TZ 5HLFA 5AE3A 2K7JA 3KDOA 1HHSA 1YBTA 1JJHA 4DSJA 3EGVA 2MLXA 3TRGA 8AT1B 3FMWA 1U2RA 4IQMA 2YTCA 3Q2SC 3VAIA 2XSFA 1IBLJ 1BC6A 2HZVA 5J1EA 4ZVRB 1PAEX 4NLDA 2UUCF 1YTYA 3CD5A 2RUSA 3HK2A 1MMNA 2JNJA 2DVIA 3GIMA 2VQFF 1YGYA 4DV1J 2HNYA 2P9GA 4J9MA 2M4MA 2QFJA 2W7PA 4BDPA 4YY3F 1N52B 1AW0A 4UTGA 1SL0A 1XMQF 2AYGA 3KWMA 4FF2A 3I32A 3MPVA 2AX0A 2VFSA 2KM8C 2EW9A 4H4KC 1JJ4A 2EBGA 2DK2A 3LALA 5KFKA 1IM4A 1N32J 1KNZA 1VBKA 4B3RJ 4E98A 2GMHA 1PC5A 1BUXA 4PG6A 1KOOA 2GJ2A 5IT4A 4P2MA 2W9CA 5GAEU 4C8NA 3G8TA 1Y0HA 1SKSA 2FJDB 2V4RA 2DIVA 4CT8A 2NS1B 5A8WB 3MUMP 5KFRA 3MFIA 4CLZA 1UMJA 4DN0A 3M9MB 2D3OR 3V6DB 4KB7A 1OMSA 1WORA 4O44A 5KFIA 3RUBL 3G71S 2B9WA 4DBQA 2LDIA 3S01A 1KDNA 3ZXWA 4B3SF 3KLVA 3N6LA 4FXWA 4TU8A 1DTTA 1AUSL 2XYGB 4MIBA 3Q89A 3M6VA 1NNDA 3SYZA 2XI2A 3E8OA 2AD9A 1JLBA 3T1HJ 1S0MA 1PSDA 3DDKA 4JI5J 4ELTA 2YQ3A 4AFFA 1AB8A 2QL7B 5LSLA 3PFOA 3IP0A 1KR4A 4Q7AA 5A6PA 3W66A 2E5JA 4CCHA 5EDWA 5HN0A 2XLIA 3CCMS 5K8OA 3TUZC 1WHWA 3W63A 4OI2A 3CJRA 4U9RA 3DOLB 3VAHA 2Q43A 4UY8T 1NK5A 5GADI 1UZHA 4FF1A 5KTQA 5K8PA 4RZRA 3BJYA 1QE1B 4DR6F 3RR8A 2AP6A 3DRYA 1U1KA 3EDQB 1TKDA 2Y1IA 1LK7A 4J5OA 1VQYA 4IG3A 3IWXA 4TQSA 1RWMB 3CDBA 1FRLA 2O67A 3M7VA 5I4MA 5ETMA 2XNRA 1CJVB 3D28A 2VG5A 4HHHA 3MM6A 3EXYA 5F8LA 1HQUB 3M2RB 2VPYB 4P10A 5HSPA 4DUYF 3KKFA 3LP2A 4PUOA 5GAGI 5D4LA 1UWBA 4EO8A 3DM2B 4AQYJ 2KJVA 3B6BA 4AL6A 1C2PA 1EQ0A 2K8GA 2IRUA 1S72S 3DCAA 2G2OA 2RF2A 3D4JA 1HR0F 3Q2TC 3MR7A 3N6MA 1HPZA 5L9XA 4KR0B 1QAJA 2WW4A 4YDDB 2Q3PA 1J5OB 1U1QA 4Q5VA 2I38A 2BVZA 2DNQA 2QLBB 2GGPA 5ETVA 3KG0A 1KQSR 2DNMA 3DI6A 4I2PA 1YBAA 2DJWA 4LF9J 5A8RB 4AL5A 3K58A 1V5IB 3J80Y 3FNNA 1LFWA 2L9NA 4E2FB 1C0TA 2HHVA 1NRKA 1KN6A 3QJLA 1CJKA 4LF8F 5DQHA 4L3KA 1UAWA 1B7YB 1XC9A 4UF4A 3W1YC 1WJ9A 1PGZA 3CCQS 3OHAA 3ISZA 1RT2B 4HTIA 4M5KA 1RT4B 3SI8A 5HBMA 3JQJA 1LWCA 5CYJA 4WP3A 4DV0J 1NHVA 1NKBA 5ETPA 2RH3A 1LW2A 4ECTA 4ZHRA 4DR7J 2C2DA 3MZIA 2EFQA 4M5IA 5J2MB 1FXDA 2CNKB 4C11B 2HHXA 1VISA 3NGDA 3KK1B 2AJ0A 1NH7A 1NM2A 5DG9A 1Y3JA 1T94A 4DUZF 2M8HA 4OV1A 4IG0A 3KK3B 1LEOA 1IKWB 3CJSA 4DFKA 4IFYA 2BRKA 2JJ4D 4YP3A 3TUIC 1R8AA 4OZ3A 3SDEB 1S1XA 1ZM9A 1H73A 1YDLA 1N0VC 4ANDA 4H4KA 2XMWA 3MECA 1TR0A 4NE9C 3L4BC 1UW4A 2MY8A 2FVRA 1O8BA 2IJFA 1K9MT 1Q4RA 2CZ4A 1D0EA 1XR6A 5HJXA 1P1TA 2DXFA 3E51A 4K7QA 3OQ2A 2OFGX 5GMKa 2OPPA 1JKHB 3LO3A 3FSXA 5C2CA 1DLOA 1HHQA 2MHEA 3C19A 4I7FA 3SZ2A 3FCVA 1PG5B 4PWWA 3RRKA 1HWLA 4DL6A 3RYLA 1BGXT 1CJTA 4KKOA 3ZTPA 3OVSA 5IV4A 2YKMA 3BGUA 2LQ9A 2P6SA 4J90A 2VG6A 1X9MA 4CLWA 3HVWA 1P27B 1XMOJ 1H7WA 3GCXP 5F8NA 4DL7A 4LIWA 3I55S 3AOCA 3NY0A 2WONB 4NRUA 1HBUA 5A8KB 2P8IA 2IC3B 4JI2J 3GLJA 4LRFA 4USIA 5KFMA 1ZOTA 3NBPB 3P49B 3ENVA 4DR3F 2AWZA 1SB6A 1RU2A 1Q5YA 4X65J 1NJZA 3DXSX 1HL6A 4G1QB 5CHCB 4OZLA 3LGMA 3W2WB 2WVFA 3GFHA 2ZD1B 2R3VA 4DR1J 1NMEB 3THPA 1VMBA 2ZOGA 3OVBA 3DOMB 1VR6A 3UD3P 1YBUA 3UW1A 1QSLA 1S5ZA 5B0DA 4WBFA 2Y1LB 4HACA 4K4VA 4X66F 4KO0B 2C3YA 5GVQA 1YVFA 1CC8A 2DRAA 3CT9A 5KT2A 3O44A 4DV6F 3H40A 3TQ1A 1SI9A 2HS4A 4GVLA 2F4FA 2FQQB 4Y00A 2M9KA 4KV8B 3UCZP 1TV6B 4ANEA 1YI2S 2JC1A 3BSOA 3ENAA 4YQWA 2ZE2A 2CNOB 5GAEI 4O4GB 3DRPB 3HFKA 2QC3A 4JBCA 3NEKA 4DR5F 3AOBA 3H2UB 2CJQA 5IM0B 1CBKA 5DETA 1FKOB 3K5NA 4UUXA 5IOLA 2C3PA 4LF7F 1M1KT 2H3EB 4WE1A 3CD0A 1L3UA 4LBHA 3QRQA 1NHKL 1H7XA 1RT7A 2XMJA 1TUVA 3FBFA 1WI6A 2ZH5A 1FKPA 3QRPA 1TK5A 1RWPB 4UOHA 3R7SB 1UVIA 2EI5A 4H4OA 3PEJA 3AQOA 1EKSA 1QVGR 2E5LJ 2IVFB 3DOKA 4DR4F 1U0HA 2Q6CA 1ITPA 2X1BA 3OXFA 1XNQJ 4YS2A 3ETOA 1RHUB 3TX0A 5HROB 1XR7A 1APSA 2J0QD 3X1LB 1GH8A 4JOUA 1L3KA 3P5TL 4DSLA 2J0SD 1IQZA 5LMUJ 3R2DJ 4RW9B 5FIIA 2HVHA 3R6GB 1RTDA 1R6VA 3D6FB 2HS3A 2HFSA 5D8HB 2UZAA 1XK8A 1SH2A 2DCUB 2KJWA 3ZZ0A 4PG4A 3KK2B 2VA3A 2OKQA 3HKWA 4ZN1A 4IDKA 1O0PA 4HDHA 5IWAJ 2R2RA 4G3IA 4A46A 3QMQA 3CC7S 3L7OA 1EZZB 2ZH9A 5FD1A 2D7SA 1B64A 3OW2R 2RUGA 1WNEA 4YOEA 1IKXA 1PKUA 2QEXS 3P96A 4TQRA 4WXWA 5FDLB 4B9NA 3IM9A 2E7XA 1LOUA 3VGSA 2AYEA 3Q8YA 3G6ES 1ZZNA 1KP6A 4QQBA 4LIRA 2MKIA 2LU2A 2F4VF 1FRMA 4HEA9 2RU9A 3PKMA 2JFKA 4WU2A 3SQOP 2VJUA 2E7WA 2QL9B 3VWSA 2XY5A 3QNWB 3HI9A 4CLTA 1MN7A 3OVAA 3KJVB 1X31C 3C14B 3C2PA 2V2QA 2LKZA 1R0AB 4CYUB 1FO1A 2ATLA 3ADAC 3PACA 1F1BB 5CXTA 4QIGA 3U7JA 2VC1A 2HPUA 3M8PB 3MUVP 1JLAB 2ZZNA 5KFTA 4EU0A 1XMBA 2DGSA 2OPRB 2WCXA 2GIQA 3D1HA 2MXYA 2DYAA 1N5VA 5HQ8A 4RW8B 1VCTA 2J5AA 3PCOB 1NK4A 3V6DA 5BYSA 3T19A 1Q8BA 2VH7A 2GQ2A 2VBYA 3FBEA 5KOWA 3AH6A 2BV3A 4KPYA 3CCWA 4IOBA 4GO5X 4NXNF 1U1RA 2ZUAA 3UPFA 1EQMA 2DD8S 1BD6A 3T1AA 4F4KA 2VONA 1DHMA 1Q0NA 4C7QA 3H2LA 1X5TA 2B4PA 2HKEA 4HHUA 1FFGB 4WKYA 3EE3A 5BXIA 3MEKA 3UR0A 5B0BA 2E5IA 2I8EA 3HZEA 3HPOA 3FEZA 3GG0A 1RLCL 5KFBA 1PYOB 2YX4A 3EPGA 3DRSB 1QDUB 4PPDA 3Q86A 2FVSA 3H0PA 3Q24A 4K4XA 1MMLA 1S1WA 1Y5IB 2OELA 3DOLA 4JYAF 3HHLC 2V2KA 1NPRA 1TL7A 2GNKA 2BUNA 2RRBA 3B8HA 3DLHA 2MQ8A 3G6XA 1SQFA 4J9SA 3G6YA 1SJ1A 1QE1A 2GMJA 1B70B 1MNEA 3W8GA 1EB0A 3RJMB 2M8DB 4DZ6A 1QAIA 2HIYA 2HURA 4F02A 4DCOB 4KSEB 1VQLS 4RLEA 4Y2CA 2EFGA 1N34F 4RKUC 3HULA 5K8NA 5LMNF 5L1IA 3UCGA 1KTVA 2GQCA 4AYBD 1SJQA 5I42B 2UUCJ 2J8SA 4CO3A 1F6TA 5DGBA 1CSJA 4DLGA 2NLWA 2FHMA 1F0XA 1CJVA 5DDQC 1FEHA 4ZPTR 2KFZA 3MUTP 4Y2KA 1HQUA 3M2RA 3KUGA 2AJ1A 2DNGA 2XS2A 3DMJB 2CPZA 3M8ZA 3CE8A 4DQRA 3PEHA 2SXLA 3DM2A 1JNZB 4CDIA 2UUTA 2C2NA 3K5PA 1TELA 4Y6IA 2CYYA 1FTRA 2VG7B 4M5HA 4EGLA 2V2VA 2FHKA 4E8UA 1YITS 1J5OA 2IAJB 1SQGA 1RAJA 2AIRB 1RU1A 2W7OA 1SCJB 4DUTA 1RGVA 1S9GB 4MKYA 2YWHA 4NYOA 4I6AA 3RGIA 5ETKA 5J1PA 1RT6B 4ZPBA 4L6V3 1FJ7A 2F7VA 3CTRA 4HI2A 5A8RA 4QCLA 2DXEA 3EPIA 3VR1A 2K3IA 2YWWA 1IBMF 2DNYA 3AD7C 4ALZA 2G2ZA 3DGVA 3L7UA 4LF2A 3CDAA 3R5JB 4QYRA 2R7RA 4NLOA 3H4DA 2EFVA 3DNCA 2HHQA 4ZVSB 3M8YA 1JLGB 5E0OA 4MTPA 1RT2A 2LLZA 1RT4A 4HLBA 2XMAA 2BE2B 3EVWA 3A3OB 1D8YA 1U2CA 5LJ5Y 2K2PA 3W3SA 3AY0A 4FPRA 5K14B 2W7AA 3TVZA 4TU9A 1RB0A 4Q8EA 1R31A 2ZH8A 4NCAA 2KT5A 1WELA 2CQ3A 2AT1B 2MY7A 3DLJA 2CPIA 2VASA 3GJSB 5J2MA 2V68A 4C11A 1R8PA 1ZAVA 3MCNA 2BOPA 1GTEA 1HI0P 1H3DA 1JJ2R 4V19X 4WZMA 2HG4A 3GSIA 6AT1B 1S1VB 3NS7B 2V69A 2C2MB 4DR6J 1BWEA 3KHGA 3KLEA 3KK3A 3V4IB 4WTOB 3M9OB 1U0SA 2K06A 3NOCA 1FF2A 3LTOA 3CO0P 4MMOA 2F8HA 1QTNB 3E01B 2DGWA 1M5HA 4ZVTB 5C24B 1IKVA 1PJ6A 4DUYJ 3ZO7A 1ZBTA 5HK4A 2OSRA 3GYXB 4CO0A 3A4TA 4DSEA 2RQ4A 2ZC3A 3M8QB 5AXKA 4F0MA 1S9FA 3G4SS 1H2UX 1HR0J 2O1PA 2DIUA 2WZ1A 4NEZA 4MKBA 4DX6A 3BO4A 3MOJB 2W2OP 2V9KA 4IOCQ 3CJKB 4ZP7A 2PMZD 2NUUG 4WP9A 1VRTB 2ZOFA 4O3QA 2BM0A 3CEDA 2WONA 3HHLD 4Z7CA 1C4CA 1E6YB 2QFIA 2DH9A 5A8KA 3KLHB 2KT3A 1OY8A 2IC3A 1MWQA 3HD1A 1KTQA 4IOAQ 4LF8J 4ZVQB 1NU4A 3UDVA 3NG8A 2R8JA 1F9FA 2C3MA 2L41A 2QLXA 2WVBA 1GX5A 4OZNA 4QR1A 2UU9F 2J7WA 3A8JA 3HHLA 4G1QA 3W2WA 2ZD1A 1RAAB 4N77A 4XO0A 3Q8QB 1HBMB 4X4PA 1UFKA 3N6NA 2XEXA 4N8OA 1OWXA 1XNRJ 4UUWA 4ZVGA 3DOMA 1M5PC 3BDPA 2POKA 1NXIA 2RIJA 3KLFB 1KHVA 3AB4B 4N5SA 1HI1A 3DFEA 5KG5A 3D6MB 1S10A 1L3TA 3EMTA 4KO0A 2XGPA 4CRJA 4ELUA 4Y3CA 4QWBA 5BR8F 1JK9B 4CM2A 4Q2MA 4DUZJ 3OV7A 1VQPS 5IT9Y 2M7SA 3MPYA 4KV8A 2DNHA 2VDHA 1KWMA 4H4MB 1D3WA 1WD6A 2B51A 4JI3F 2ZH1A 3MI7X 4O4GA 3DRPA 3PG9A 1WC6A 2BACA 3GIJA 2XS5A 2PIIA 3HDSA 3CCES 5IM0A 2A0FB 1FKOA 2DH7A 2RAQA 4KTQA 3W9JA 3MR6A 1KEKA 3WHIA 4K2JA 4OJHA 4B9MA 3CJ0A 3OL6A 4OZ0A 2HBRB 3PHEA 4RW6B 5E5NA 1YLXA 3N5BA 2OMLA 1M1GA 3T5KA 1FJEB 1N5YB 3HM9A 2R9LA 1UEVA 2VZ9A 3DLLQ 1J5EF 1Q1KA 2VD3A 5HROA 5A76A 4K4TA 1WC3A 4C4WA 1RA6A 4U6PA 1SUQA 4YR0A 2WOMB 1RBLA 1NK7A 2MHNA 4USJC 1QAXA 3TUPA 1V9OA 1BQNB 5B0EA 1T03B 2W2MP 1DBDA 5KFZA 5KFFA 3LAMA 4RW9A 2HW3A 4FYDA 4MYTA 2H4YB 3N0VA 1RTHB 4NA3A 1NSPA 2DHHA 1ZM3A 3UWTA 4CQ1A 2QRRA 4KGKA 4DR3J 3MR2A 3KK2A 2HHHF 2KYZA 3BYPA 5EX0A 1DURA 1FDAA 3E3XA 1KKHA 3M6WA 2R8KA 1SJ4P 3MOZA 3SCLE 3TR5A 1OPIA 4F3QA 4I56A 5HMZA 1UCNA 5E41A 4CTAB 3BGFA 2KL8A 2E44A 2DGVA 1Y5LB 3NNHA 2FJAB 2CZVC 2EFOA 2M88A 5FDLA 3KHLA 3G2XA 3OFGA 2A10A 4EWTA 2IIHA 4QOTA 1A9NB 3EVOA 5LM7E 1R7IA 3HFVA 4PKDB 4X66J 1TVRA 3PIOQ 1JWWA 3A8EA 1K47A 2DNRA 1VQOS 4DV6J 1KVIA 4DPOA 3A12A 2NXJA 1NSAA 3IO1A 1IR0A 4NCGB 3M32B 1LNQA 1X8DA 1YZ7A 1WG5A 2AJ2A 3ENQA 9ATCB 1VS3A 1XJWB 3OXLA 3DU5A 3L3CA 3KJVA 4XDCA 3C14A 2BA9A 2A18A 2FUG9 2VUGA 3CD7A 4F7VA 5KFQA 4DCPB 2IVYA 2HFVA 1R0AA 3IMQJ 4CYUA 2OEMA 3FCHA 4LQ3A 2Q66A 2NSBA 2P9EA 1OPZA 3CULA 2PD1A 2B5JA 1WEXA 4XDDA 4DQPA 1NSKL 2H5IB 3CSKA 3M8PA 3OTDA 4DSFA 3A13A 1SBRA 1HWKA 5HVFA 4DG1B 1JLAA 3GJQB 2KKHA 3L95X 3HXMA 2ASYA 4DQSA 2LDYA 2OPRA 2KZMA 4ICLB 4YR3A 1YJ9S 3AODA 2NSCA 3TYTA 4DR4J 4QU7A 4RW8A 5F41A 4XTTA 2AEMA 3PYGA 2L9WA 3PR4A 1MW7A 4JI6F 2JHEA 3QGPA 2FZGB 4P2SA 4AXIA 3CW2C 4IR1A 2EVZA 3RAQA 3SFGA 1DFDA 4JI7F 4QWEA 5DLFA 3BGLA 4MK7A 1U2FA 3GONA 4MAKA 1UW9A 3Q8PB 4LREA 4FYYB 4TKTA 1HARA 4GKJJ 3Q8SB 4LRAA 4MKVA 4QU6A 2KRRA 2V8HA 3BQ1A 3DRSA 3H59A 3CDUA 1RT1B 4WYLA 2QMUB 2XLKA 5KFXA 3JSBA 1RP5A 4DU8A 4YHHF 3QRRA 1UL3A 1UFLA 4QWDA 4U7CA 1QD1A 2J0XA 5B7WA 4RL1A 3RB6A 4CLUA 2CQBA 2DTJA 4DPXA 1I51B 1MWYA 1TUWA 2BE9B 3U1MA 4F3OA 1T9XA 3CCJS 4A48A 3Q23A 3PX0A 2X1GA 5E3PA 5IT0A 2Z4PA 2F4VJ 1NSQA 2Y1JA 2E29A 4USHA 2IM1A 4C3LA 2M0GB 3MPWA 5I42A 4KT0C 1KS2A 1VQNS 1N0UA 1VQKS 4P9SA 4G6VB 3RBDA 1LQ9A 4CO1A 3RB4A 4V1Ak 3D0HE 4JV5F 4Y34A 3DMJA 4XAKA 4CT9A 4C9DA 1F3FA 4IH7A 4LRBA 2UV8G 4FS2A 2VICA 4J91A 2GJFA 4FKXA 4FPIA 2VG7A 1HD1A 5CD4H 1TL3B 2PI4A 3KLGB 5J1NA 1S4FA 3MAHA 3K8WA 2AJQA 2IAJA 3W7BA 4O3RA 1SIZA 7AT1B 1TAUA 3BO3A 1RXOB 2ZHAA 2XC9A 1Q5VA 4DEZA 3QIPB 1RT6A 2HLUA 1VRQC 1RISA 3T5LA 2HHPA 2AHOB 1UVLA 4NASA 2W4DA 2MLZA 1HMVB 2XG8A 4F2SA 4NXNJ 4IYQA 1GQEA 3TWZA 2V94A 4FNIA 3WIUA 5K20B 2VJVA 2CQ0A 4GKKF 2IMOA 5HANA 1XN9A 1TL4A 3AD9C 4UY85 1KONA 4R0JA 1JLGA 4ZIVA 1HW8A 2MZJA 1M5KC 4F4XA 2AYMA 4L3NA 3NGSA 2DR7A 2PSZA 5K14A 2ROGA 1SIWB 4DX8H 1K73T 3PO5A 1X0FA 4DMZA 5I3UB 2CPDA 2HMIA 5L39A 3H25A 1HNIB 5L38A 2J76E 1U8WA 1QY7A 4DF8A 2OD6A 3AQPA 1Q82T 4JYAJ 3GMGA 3RAMA 2E9TA 4TVAB 3FMBA 3NMRA 1S1VA 3VZIA 3RBXA 1TMMA 2DNLA 1H98A 4FP9A 2R7SA 2RHQB 4BLGA 5M2PA 2DO4A 2GVZB 1N34J 3V4IA 3PYDA 3MMBB 5LMNJ 2LECA 2P9CA 1C1BB 3HJVA 1RA7A 3MEEB 2Q6BA 4Q43A 2C28A 3FSIA 3O5TB 4UOFA 1NB7A 2HIQA 2EKNA 5H9EK 4PYAA 3E01A 1RJJA 3M30B 3D68A 3I5BA 5C24A 4KJIA 1V3ZA 1LWXA 3BREA 3OL9A 4FKYA 2MQOA 3BZQA 5T7LB 5ETQA 4ZPAA 3M8QA 4U7UD 1KFDA 1IJFB 4PG7A 2B6AB 3CXCR 1I1GA 3PRDA 4DFPA 2D41A 1FJGF 4IFVB 2PMHA 2NQPA 2OD4A 2B4UA 1I94F 4C8LA 2AZ1A 3CO9A 1GMVA 1RACB 5F8GA 2IY5B 2N3OA 4O3SA 3CJKA 4TU7A 2E5HA 4JI0F 3JTOA 1T9YA 1VRTA 2XGQA 1U1LA 2VKZG 3HVTB 2CXEA 2HRYA 2MZ1A 1NDLA 1RKIA 1Q78A 3KLHA 1IBMJ 2CUYA 4FZVA 5CQGA 2JFDA 2CPJA 2DRDA 4F26A 1JLEB 1S99A 1B0TA 2RDIA 2HVDA 2HHTA 2OAUA 1X7VA 4B3TF 2QG9B 1VHIA 4B9LA 2Y1RI 2ZVSA 2XMMA 1UEUA 1GNKA 1Q8IA 4ED6A 2HHWA 5L46A 2PEBA 3D3CJ 3SCKE 3HFZB 4NLWA 3GV8B 5KFHA 5T14A 3GFYA 3C66A 1FNMA 1MN9A 4J9LA 1U26A 3B54A 4J9UE 4M95A 1HNWF 2RT3A 4ATNA 2BQ3A 3KLFA 1CS4B 3ILOA 4ENOA 2RDJA 2KI2A 2AX1A 3H2VE 4BC7A 4URGA 2Y0SD 3IM8A 1FFSB 3SCJE 3GFZA 1U1OA 3BBFA 3IS9B 2E1MC 2HAFA 4UT4A 2MQQA 1RTJB 4EUVA 2CJ9A 1PC4A 1U02A 4HYKA 4ES1A 2MKJA 3CC4S 5AXNA 4DL3A 4DL4A 2E1PA 4B9TA 3KXDA 3UN5A 3X3UA 2CJXB 3DN9A 3R6LB 2KHCA 4Z7YA 1L3SA 1PJ7A 2DB1A 2PO4A 3MMAB 4NX9A 2R8GA 2NPIA 1N4LA 3FKBA 1NO8A 3QPIA 4DX7A 2WHOA 1RHQB 3QGGA 3TUJC 3P6YC 2AGOA 4CH7A 3OD2A 1N5YA 3MTJA 3ILIA 1PAUB 1SJRA 4OFZA 3MM5B 1HWJA 3IRXB 1BQNA 1T03A 2BABA 4CM0A 3HSGA 1GTHA 4CNZA 1NKCA 2YNHB 4PR6A 1NK9A 2OPQA 3F73A 4ZVEA 2FYXA 1RTHA 3I9V9 4DX5A 2BEFA 3JAMY 2IJRA 2QLJB 3IGNA 3LGHA 3LH2S 1ZA2B 1U6BA 2B9YA 1FDBA 3LPEA 3M1VB 2UU9J 2J9DE 4Y2MA 2NR0A 1KBRA 4W90B 4CTAA 1FRHA 5GADU 2EC2A 5K5MA 1WKKA 3U02A 5K9FA 3Q22A 5D4OA 5D6GA 2C3OA 2U1AA 2H5EA 3GIRA 3MCOA 3L7PA 5MLCV 2J6TA 3MAAB 1R0BG 2N4CA 2CPYA 1T3NA 2QL5B 1FDDA 2VFRA 1SC3B 2ZJRQ 3C46A 5BR8J 3OTOJ 2QO3A 1BMQB 3GYNA 4L72B 4EK2A 2Y8WA 3BEGB 2ASLA 3M32A 2GHPA 3RBZA 4JI3J 1FRJA 4ZPVR 4DV5F 4EMDA 1H74A 3I4HX 3NRBA 4LSNB 2CZ9A 3GIIA 2ASJA 5GAGU 2HGMA 5M2UA 4F4ZA 4HI1A 2DBBA 4ECWA 5CH7B 4J37A 2J6UA 1RZMA 3P3DA 1F60B 2LXIA 2LEPA 2CWKA 2JLFA 2B7CB 2XB2D 1FHTA 5BYRA 3OUYB 1FWKA 4XK8C 2X1FA 1ZTTA 2GFFA 3NCQA 1VBZA 2W4PA 2I1RA 4Z2XA 4C8MA 4I67A 4FBUA 4ZCKA 1U48A 4NYZA 2XHCA 4HVZA 4DG1A 2UUBF 2OJ3A 5D4PA 3N28A 4H54A 2GIRA 1WHVA 1T95A 4DI6A 2CVEA 1U1PA 3EX7B 5JMNA 4I68A 3QWUA 1J5EJ 5KFNA 5FLXY 1R27B 3I6PA 4P75A 3DLEB 4ED3A 4O3NA 4KIAA 3R3TA 4L73A 5B09A 3SFUA 2NXEA 2VBZA 2DR6A 2HNDB 1TKZB 4X62F 1QVFR 1Q53A 4RNOA 1RHJB 1TKTB 4OJ1A 1YJNS 3I56S 4IRCA 2F9JA 3R5DA 2YX7A 2BJ8A 2HHHJ 2IDEA 4RBVA 3OJUA 1NJWA 4RBUA 4MK8A 2RS2A 5J2QB 3QT8A 3MURP 1B0VA 2DY9A 2PFDA 4NOHA 1KVJA 1HBNB 2GHWA 3KG4A 1RT1A 2F8MA 1D1UA 5IC6B 2V9WA 2HQFA 3MPUB 5BYQA 4A8MP 2CQ2A 3AD8C 4RR5A 4URQU 4XPCA 4EBCA 2ROEA 3IA0A 4ZIWA 1I3OB 4TY8B 2BANB 4QBUA 2ZHBA 1FK9B 4FDFA 3NWRA 1X5OA 3OFEA 1PO6A 3UDLA 2ZFHA 5M2RA 2JLGA 3BV8A 3B82A 3W9HA 5AJ3J 2F8EX 3K57A 3W62A 4LF4F 1NH8A 5IV3A 2RSQA 4C98A 1Z2ZA 2AEFA 4FVCA 2QIFA 5I3PA 4AE5A 3FVYA 2ZBPA 4OLPA 1SXLA 4DSKA 4LBPA 5D77A 1T05B 4GC7A 4KE5A 5AE1A 4OZ2A 3PDNA 1RWUA 1FJCA 5KFPA 4E0DA 3W65A 5KG7A 3G82A 1VHFA 4ZP8A 3HHDA 3QT6A 1R3NA 4KFBB 5L9NA 3T9ZA 3PFEA 5CA5A 2DKOB 2HSEB 4CP5A 1N36F 5H9EJ 4OZ5A 1PBAA 2J0WA 3CIMA 4DL5A 3KLGA 4F67A 3RAXA 3C15B 3I31A 3BSAA 1RT5B 1XQIA 2OTLS 4KY3A 4OQJA 1N33J 1JNRB 3M8WA 1EIYB 2IRXA 4OI1A 3QIPA 2B9EA 3WDOA 4NA2A 4MT1A 2HGLA 2ILYA 4CLKA 1WKLA 4JI6J 1HMVA 1DZ5A 4DCJB 1FT8A 4KHMA 1LXJA 5C42B 3SEOA 2DNNA 4YMEA 2IBKA 2IM3A 3O3LA 4FNHA 1X9WA 1OQ6A 2GJIA 3HHNB 3SQGA 3QO9B 4ZS6A 4X4QA 2H1YA 4Y0FA 2MKYA 3SMZA 3T5JA 1TL1B 3K5OA 1NPPA 2RKIB 2JOQA 4DR2J 1QLNA 5I3UA 3OTBA 1DQAA 5E3QA 3TA0A 1HNIA 4FF3A 1LKZA 4RW4B 1AFJA 3VTIA 2NZ4A 4J9OA 4ILRA 4NLPA 3BN7A 5DRKA 3DHWC 4AL7A 2XNQA 3T6JA 1LK5A 1X4DA 2MZRA 3AFGA 1Y4ZB 2LA4A 3DLKB 2XSJB 4YUDA 2WVCA 5BJRA 2GVZA 2FJEB 1BWVA 3GP9A 3MMBA 3DKDA 2BJEA 2VFUA 3UR3C 2DY1A 4KPCA 3C6TA 1C1BA 4C0HA 4ZLJA 1S49A 3MEEA 1REVB 4QIVA 1XR5A 5KG4A 1BHNA 6FDRA 1HA1A 1P1LA 2APOA 3M30A 3O1LA 4B3OB 4JV5J 3DRXA 2VOPA 5KAKA 2GO8A 2A1BA 3OSPA 2BE7D 4JI1F 1S6OA 5T7LA 1C1CB 4RNMA 3GILA 1VLYA 4ED0A 3GB0A 2B6AA 2FLLA 2MYFA 2YXLA 3QGHA 2J7KA 3EZOA 1NZAA 2IM2A 1JLCB 2VHGA 2KZZA 2O5DA 5AXMA 4MH8A 4FYXB 1YZ6A 3DDIA 1JJCB 2JSXA 3BS9A 3FBBA 4NI2B 3V6KA 1KRPA 4DFJA 3I5CA 4DL2A 2CG8A 4J9NA 1T9UA 3ENWA 2XBPA 3HVTA 3N01A 1U1MA 3M6XA 1OS5A 2V67A 1V6HA 2YKNB 1JXVA 4Y28C 1Q7LB 4PG5A 3C8YA 3UI3A 1RE1B 2UUWA 1UP1A 2NXCA 1JLEA 1R6YA 2G9OA 1FE4A 4TYAA 5CZXA 2OUGA 5KG0A 4P71A 2LP4A 1G2EA 5C7PA 4GKKJ 3TVYA 3GFXA 4RU2A 4FYVB 1CJUB 3PJWA 4LFAJ 2XS7A 1JX4A 2DPIA 3LA0A 2C42A 3IBFB 1M5SA 2FJWA 2UXBF 4X4VA 3VAKA 4JI4F 1LFPA 1N5TA 4P73A 2CNNB 9RUBA 3KLIB 1F5BA 1CULB 1PYTA 1CS4A 3MFHA 2XY7A 1OIAA 2DHXA 4ER8A 3PYEA 3IS9A 3KFWX 1SKUB 4LR8A 2XY6A 1RLDA 1RTJA 4CO2A 4DV7F 2EFPA 4DN9A 1GAOA 3PX4A 5JUMA 2F63A 2H9ZA 3QSYB 1S7HA 3I9ZA 1F5CA 5KT4A 4LF6F 4PAAA 2PFFB 2MZQA 4DZDA 4ES3A 4ZK7M 4YDXA 1RKJA 2V6AA 1B7FA 2DGQA 5KFLA 3OL8A 3MMAA 4HH0A 1EJ7L 2GC8A 5F8IA 4B9SA 4OLOA 2DT9A 1AXQA 4RJVA 1VJQA 4AQYF 2BYCA 2C2OB 5DO2A 1YK9A 5CD4A 2HYIB 3W2VB 4OYWA 1XIQA 1EAYC 1U47A 4IO1A 1FJGJ 1M0SA 2WSCC 4EO6A 3NCRA 1TAQA 1SH0A 1I94J 3D7SB 3HD2A 2HFUA 1NLKL 4ID8A 4ITSA 2PT0A 6FD1A 4JI0J 4OX9F 3IRXA 4HTJA 3K2YA 1S1UB 5KFDA 1U45A 1EARA 2R7VA 1JLFA 2YNHA 1T3OA 3BPDA 1CPZA 2UXCJ 4I2QB 3ILJA 1DTTB 3AT1B 2QGFB 3N79A 4B3TJ 3BH6B 2EWHA 3I5AA 1JLBB 2GAGC 2V2ZA 2D3UA 2QYCA 3RZAA 2X7IA 5K8MA 2DO0A 2FC9A 3M1VA 1TUGB 4ZLNA 3AA8A 2JC0A 4OHZA 4RNNA 1L3VA 2Q79A 3PX6A 2N82B 2KU7A 3BKTA 1W2BR 4P6QA 1WDTA 1HNWJ 5U47A 4ZCMA 2YKPA 2VPXB 4Q45A 3MM8B 5G0RB 3K17A 2XCAA 4MK9A 3HMJG 4UQGA 1X4EA 2XHWA 1JIHA 3TQEA 4WKRA 3QQCD 2N3LA 3MAAA 2I5JB 2QMWA 2G0IA 2ACYA 2RQCA 3HSJA 1TL5A 1VLOA 4O23A 2X3DA 3B4MA 2FHJA 3UDEA 4DJBA 5A2QU 3C6UB 2VC0A 2Z2ZA 3J81U 1NUEA 4LF5F 3FQLA 2VL1A 5J2PB 4O3PA 2KB2A 3MEGA 2HRTA 2AKWB 1X4CA 1M1HA 2VOOA 4PWUA 2UVUA 5B08A 4LSNA 1FRIA 3V81B 3D2WA 2XZDB 4DFMA 3TVKA 3S8SA 1F9HA 3EZUA 3G87A 4D3GA 2KTQA 3GQCA 4F04B 4YB7A 4D3HA 3THVA 1R8CA 2MMYA 3OXGA 3OUYA 1UWBB 1WOOA 4K8RA 4QIEA 4WF9Q 4I69A 1Q8LA 4CLSA 4ID5B 2ZNZA 2CQGA 5DM6Q 1X9SA 3J7YU 1CQNA 1URRA 4ZJQA 2LXFA 2YWEA 3FQKA 4X4SA 3V6HA 2DGOA 3KMQA 4X64F 3DLEA 2C2KB 4C48A 5DQIA 3MF5A 2HNDA 5ETLA 4TXSA 1U8SA 1TKTA 3CD6S 1MG7A 1GXTA 2HLTA 4NEYA 3IWNC 5CAAA 3I0SB 2XMTA 1ZM2A 5HBMB 2A2DA 4K2XA 2HNZB 1XERA 3V6JA 5J2QA 3ULHA 1HBNA 2LFVA 5KFGA 3BO2A 1TK8A 2PN6A 4PXCA 2YNGB 4B9VA 1N6QB 1R8HA 3NAHA 2FGCA 2YWGA 1CEZA 2LQ5A 1CLFA 3DDNA 1NDKA 3KJNB 2G1DA 3K7RA 1FRKA 3R27A 1FERA 2FJVA 4TY8A 2BANA 4WK3A 4PCQA 1HLWA 3PO4A 3ZZTA 4ED2A 2RD5C 2VIHA 1YIJS 2BXJA 2CQ4A 3PR5B 4OZ1A 1YJRA 3G8SA 2HRUA 5EN1A 3OL7A 2ZH3A 4U7UK 3IG1B 1TP7A 5A6WA 5H9FK 1UPMB 2HQCA 3W9IA 2FJXA 5LOQA 4YB5A 1NZ8A 2VBWA 4C2MA 2KM8B 2YKAA 2CJKA 3KUHA 1T05A 3F44A 4UZCA 4U95A 2U2FA 1ICEB 2A6MA 3D0GE 2B7BB 4DV2F 5RUBA 4ZVHA 3H5UA 3AJDA 4EI2A 5B0CA 1EETB 4QZVB 2E5GA 2NCKL 5HP1B 1OY6A 3D67A 3C16B 5E3RA 3KMSA 3R1LA 2HQDA 2JLEA 1T7PA 1WF0A 1BE4A 2MPUA 4ZPCA 3C15A 2P2CB 1OY9A 4QW8A 3D66A 3S1TA 1URNA 4F50A 3MGJA 1RT5A 1XNQF 4PXEA 4PXBA 1FESA 2WSEC 3PXGa 3SCIE 1CQMA 5IQ6A 3AXKA 4HT5A 5ETNA 2RILA 3WIVA 4TLRA 5HAOA 5HJYA 1RCXB 2IJNA 3RB0A 2AJFE 2Z57B 2VFVA 3F41A 3S6EA 1K8AT 3BF4A 3LANA 4B9UA 2CQHA 2AGPA 1F2HA 4X62J 2Z56B 4WCEQ 1UEKA 1Q95G 3QO9A 4LR7A 3BBBA 3MM9B 5IWAF 1NDPA 3D3BJ 2Z30B 3NLCA 2C2RA 1TL1A 2NPFA 4DLEA 1D8ZA 4EFAC 3MR5A 1I5OB 2DHSA 2RU3A 3BSNA 2RKIA 3EGNA 2B0GA 1B99A 1RAFB 4ILLA 1J27A 2YWKA 2HBZB 5H1SV 1RT3B 2MJUA 1KC8T 2CAJA 3HT3A 3T1YJ 2G13A 2AU0A 5GMDA 3CMES 4PXDA 5DM7Q 2CJYB 2ABYA 2EEYA 5D3GB 1LXNA 4R0EA 2ATCB 1M5OC 4IH5A 2HHSA 3H7HB 2I9SA 3JS9A 5EX3A 4R8UB 3DLKA 2XSJA 2JRSA 2FIUA 4BWJA 4USWA 2J9EA 5A8WA 2CQIA 3H98A 4NL5A 1ZS6A 3W61A 1CVJA 1REVA 5JXSA 2FB0A 1GXLA 3TZWA 2BW2A 1D9FA 2ZEJA 2P5VA 2UXDF 3T3FA 1FWPA 2GZOA 1F3VA 3BGRB 4B3OA 1S6QB 1BXNA 2B8QA 2G2YA 3ICLA 1G6BA 1FA0A 1U09A 3K0JA 1C1CA 3HHKA 2VPZB 3EGWB 3EVMA 1QJHA 2ZWPA 2D74B 5HVGA 1R0CB 1N36J 1JLCA 5F8HA 2A3JA 3BSCA 4B02A 4ZCIA 4OIXA 5KFOA 4NI2A 1FVQA 3IRWP 4CH0S 1UVKA 2LYVA 1V3RA 4ZCLA 2XMKA 2RS8A 1AUDA 2BMBA 3I0RB 4P7TA 1GEHA 5KFYA 3GJRB 2YKNA 5F0UA 2V8PA 3R9LA 3J80U 1RTDB 3EWGA 4U8VA 1IKYB 4QR2A 3TEHB 3BKFA 2QLFB 2NXUA 4LVOP 2B43A 4K4YA 1U1NA 4N7TA 3QFWA 2DNZA 2ZKUA 3GYGA 1YJTA 1IWAA 1K1QA 2VQFJ 3SV4A 2UV8A 2XI3A 1SC6A 1SC1B 2XQCA 4ZVUB 3EZ5A 4BBYA 4YY3J 1RHKB 1YX2A 5LXRA 3CF5Q 3KLIA 1XMQJ 1CULA 2H48B 2MQPA 3JSRA 4C8OA 4ECVA 3DGPB 2IDLA 3OSNA 4FF4A 4K5RA 3NKYA 3UDCA 1ACMB 4UOCA 2HS0A 2QYGA 3CCSS 2HWHA 1VYAA 3PTWA 4P74A 3JSMB 4P7VA 3AOAA 2W1BA 2ZVIA 2HWIA 4UW2A 1YJWS 1RWWB 3WBZA 4NLSA 3J7YI 3CUNA 2ZBIA 5G4DA 1VFJA 1G7CB 3BDEA 1KSPA 3EJMA 1LW0B 1KVKA 4NA1A 4RX6A 4B3SJ 4QW9A 1T8EA 1FXRA 4JI1J 5HL7Q 1N56A 2H54B 1SQEA 3J7Z5 3KOAA 1XTZA 2BX6A 4F8RA 3R8YA 2VQEF 2J7UA 2YKQA 5C25B 2BJ3A 4ZDNA 2LMIA 3TAMB 4A8XA 3W2VA 1X4GA 2IYIA 3UD4P 2E1CA 3HKZD 3ZZUA 2ZH2A 4OYMA 2KVQE 4AT1B 3D9BA 3I4PA 1S57A 1TQLA 1VDHA 3FFIB 3KHRA 2BJ1A 2EK1A 2DGTA 2EKYA 2COLA 3GR0A 4RW7B 4C0BA 1S1UA 5DS7A 4KAIA 1D9AA 3K8VA 3LF0A 4HDGA 1FNXH 3PJXA 4WK1A 3KK1A 4DV4F 2Z0GA 1RYRA 2YNFB 4I2QA 1HNZF 4Y2AA 2G4BA 3MD3A 4KRWA 2WTFA 1IKWA 2C3UA 4P2XA 4F4AA 2DCLA 3SDEA 5KFEA 4NLGA 2HVIA 3PIPQ 3T9NA 4OV6A 2UXBJ 4CZCA 2BDPA 3THTA 3K59A 4DS5A 4WTYA 4LFCF 4OYBA 3TZZA 1UA1A 4JI4J 1HQEB 4OYOA 2HZCA 3RRGA 1ZH5A 1X5PA 8ATCB 1WEYA 1S1WB 2CPEA 4M5GA 4FN5A 2QT7A 3MM8A 5G0RA 1EP4B 3KNGA 1TL7B 3VQSA 5IZHA 3N5FA 2I5JA 4DPTA 1JKHA 2F5GA 3FZBA 3KTQA 4QR0A 5HQMA 1Q7YT 2Z2LA 3ILLA 4C0OC 2N4DA 1RCOB 4QYZK 3BR8A 1Z2LA 3BYRA 4DV7J 2KRBA 3C6UA 2OGUA 4ZN3A 4DXLA 2YWFA 1J2VA 1Y10A 5J2PA 4DWIA 3OHBA 4LF6J 2MZSA 4YEAA 3VZHA 1QSSA 2FVPA 4JV2A 3ZZOA 1UPPA 2RNEA 3V81A 2DGXA 1FNOA 1HWUA 2C22A 4HHJA 3PM9A 4IQXA 2E66A 2HEKA 5D0GA 2OO4A 3H5YA 2DITA 3JYTB 4J9VA 3A3NB 1B3TA 4QIWD 4B08A 5H9FJ 1WOSA 1VK8A 1WF1A 3NBPA 3JQMA 1ULRA 1GXUA 4RUHA 2KH9A 2X3GA 3EDRB 4ID5A 4WFZA 4ZVFA 4CO4A 4G65A 5KT6A 3GV7B 3F56A 2V8VA 5LT5A 4DQQA 2Y9HA 2XULA 4I0WA 5L8RC 1PYSB 3MMCB 4OX9J 3BQ0A 2B4OA 2MJNA 2YH1A 1FX4A 4OX7A 1KQGB 3FRZA 4NCBA 4DPUA 2GAHC 2ZWOA 3BN4A 4U96A 5HQLA 2ZBRA 2YX1A 4K0KF 4AD6A 5D4NA 3FJ2A 1OQ3A 4LVNP 5F9LA 1ZZFA 4QIFA 3LUYA 3GR1A 4OZJA 1X4FA 1TV6A 3MDFA 3T6BA 2B4VA 3I0SA 1RABB 2HNZA 3TAPA 1Y11A 4WJBA 2KXHA 2R8HA 2KDOA 1JB0C 3R97A 1OO0B 2BBEA 1XNRF 2YNGA 1N6QA 2RRAA 1JMTA 4ECSA 4M1KA 4YB1P 2V5HG 3VQTA 3A8KA 5A0YB 3ZNJ1 4LMZA 3Q8UA 1IUJA 1H38A 5CCMA 3NMAA 3GIKA 2MZTA 2OFHX 3CJ3A 3C3LA 4A47A 3KLEB 3HCXA 4CI0B 1WF2A 4LF5J 2M70A 3GV5B 4JP8A 3ZZRA 2M52A 1X0PA 3IG1A 1NBEB 4JI8F 1P6TA 3MD1A 3GG1A 3IGVA 4O0NA 3HSZA 2WBRA 2R2UA 3SSSA 2AYBA 3IXQA 2BJ9A 3PW4A 1PILA 2V0NA 5DDOC 3QT7A 1IKVB 4NLQA 2CPFA 4JV0A 2LEAA 2WAQD 8RUCA 3LP0B 3H5XA 1MMDA 5HVHA 3FC9A 1EETA 1XWLA 4EZ6A 2KYXA 4J9KA 5HO4A 3PW7A 2QA1A 1IWGA 1WC4A 5HP1A 5IQQA 1B4SA 1VRUB 3CJTA 3C16A 3ET6B 3QBCA 1Q86T 2N7YA 1O6XA 3R5GA 5KFAA 4CH1A 3CDEA 2ZOMA 4AUKA 4X64J 2CKWA 3FGVA 3QWPA 2F9DA 1W2IA 3KYLA 5JVGQ 2DEIA 2CG4A 2DGUA 4LUBA 3O2IA 4QWCA 1GMWD 1H72C 4X4RA 1KLNA 2OEJA 4R5PB 2F1FA 5F3ZA 1AFIA 1YRTA 3DLBA 3I87A 1FEEA 3VVUA 1IR2A 1F2GA 4RNFA 1RAEB 4YFUA 3MM9A 5B0FA 2D69A 4Q0BB 5KT7A 1C4AA 3HHLB 5GAHU 1OJ4A 4DR5J 3VVTA 1Y9OA 3JTPA 2NYHA 1NKEA 1GMWA 4UQTA 3KG1A 1S76D 1RT3A 2ERRA 2YKOA 7FD1A 4LF7J 1Q8KA 4IR9A 1DQ8A 4USMA 1VIXA 3LPYA 4KC5A 1OYEA 5D3GA 4K59A 2FLOA 1RTZA 1OYDA 1H6KX 4R25A 3IR7B 4K4SA 4R8UA 4DL0C 2HBQB 2CFXA 2FPHX 2MKHA 2MGZB 5ITHA 3HF5A 1BQXA 1UJ6A 5ADZA 1D09B 1TZ0A 4B3MF 1VBYA 4TN2A 3SSQA 2DHAA 1R89A 1GX6A 3RTVA 5EHHA 1HI8A 3ZTSA 3CJQA 3BGRA 3QJJA 4YR2A 1S6QA 3CCLS 4A8KA 3D1OA 4QJVA 3UNGC 4UOGA 4OJ3A 4DV2J 3NNAA 3TEGA 1VI7A 2EK6A 1T11A 3ZC4A 2FC8A 2Y0BB 5D0RA 2LQBA 1VC5A 4CO5A 2QA2A 2DNKA 1A6LA 2Z2MA 2W2NP 4CLPA 4I64A 2XO7A 1ZPWX 3VF0B 3A8IA 2BM1A 1SUQB 4NZ0A 2V4JB 5EGYA 4ED8A 2BZ2A 4NPOA 2HQ3A 4LSLB 2OPSB 5CYMB 2W2QP 3EGZA 3A3PB 4WZQA 1GK8A 3I0RA 2UVRA 3R1HA 2LCWA 1SJ3P 1RWNB 3NWGA 2IVMA 2QLWA 2OTJS 1YQHA 1IKYA 4USVA 3OR2B 2MEWA 2K1RB 2BR0A 4A8QA 4N8NA 5L1LA 2ZZMA 4NLTA 2MTLA 4M8LA 4GKJF 5LL6d 1UJ4A 3QAUA 2KT2A 2PI5A 3IN5A 1FTCA 2H4WB 4F25A 5KFJA 3OBIA 2HAIA 2BKPA 2QX0A 1KQFB 4I4BA 4MFBB 4USKA 3R5BA 2CADA 1C0UB 2JEJA 2B3TB 3OR1B 3QZ7A 1G4CA 4ZP9A 4WFAQ 1T0TV 5DZ7A 1EX8A 3DGPA 3LP1B 4FXVA 1MU2B 3GCWP 4BHQA 1HNVB 1TVRB 1WG4A 2L3MA 2KO1A 2R7XA 3JSMA 3DYAB 1S9GA 4LRCA 3M4XA 1YG0A 3IFEA 4OMFG 3KNAA 1DTQB 3M2UB 3QFHA 3DRRB 2R7QA 1TKXB 4JV1A 2JH3A 2ALYB 4OYPA 4RBTA 3I82A 4NLUA 4KGXB 3RR7A 1LW0A 1RTIB 4A4JA 4QYZJ 2UXDJ 1NPKA 1Q79A 2FZCB 2UUAF 3EM1A 1FXLA 1W25A 1OSDA 3TARA 2CQDA 2B5JB 5C25A 1AA1B 1UVMA 4RUBA 3TAMA 2EBEA 4IRDA 4J9QA 3US5A 3L9ZA 2BE2A 5KG6A 2HFZA 4FXDA 3Q83A 3KDNA 3H90A 3ZTQA 3GE9A 1VK3A 3FFIA 1P9QC 1FKAF 4WXOA 3DLGB 2NXNA 5L1JA 1HWIA 4LRDA 2LQJA 3GJTB 5HMWA 5CCLA 3MHYA 2ZZTA 1IJEB 4NRTA 1RDRA 1Y5NB 4RW7A 2XMUA 3SIPB 2Y8YA 3GWCA 3CMQA 4HL9A 5JJBA 1X4BA 1QSYA 4NMXA 2R42A 2YNFA 1MLAA 2LA6A 5AT1B 2EG2A 4S0MA 1WACA 2DRBA 1NJXA 3AXMA 4MKAA 3P8BB 4YN3B 4J7CA 2IM0A 3N4WA 1P8GA 1ROFA 2W9AA 2FVQA 2XM3A 3ETMA 2EG1A 2YPZA 5KFUA 2FZKB 4ECRA 5EWFA 3D6HB 1HQEA 5J2NB 2GX8A 4C6AA 5KFCA 2MQLA 1K1SA 2XYPB 1EP4A 5E2QA 3H5SA 2IYGA 2ZH6A 3PW2A 3TO8A 1U6ZA 4OYXA 3UQSA 3TZXA 1SV5B 3LWMA 4W92B 1A0OB 3R7BB 1HYSB 1HBOB 1QM9A 2I2YA 3CCZA 3ZZZA 1S9EB 2QA4S 2I0XA 2Q1LA 2AF6A 3VAMA 3WZ0A 3QGIA 2YNIB 4DPYA 3M2VB 1W7WA 2DXDA 2CWXA 1KFSA 3IAS9 3TJAA 5IT9U 3SBMA 1TMJA 3IR5B 3NGKA 4WFBQ 1SKRA 1UVJA 3FSYA 4M5JA 3OTCA 4G1IA 4K4UA 1ZETA 1E6YA 1WUUA 2ZUGA 1QUVA 4LJMA 3IBCB 2RE1A 3JYTA 2QZ8A 1DJ0A 1SL2A 2MKKA 1H2VZ 2OMOA 2WVEA 2YVSA 1RAIB 1FWLA 3L09A 3W60A 4OI0A 3P5BP 2VQEJ 1JXLA 2FGOA 2GMLA 2AGQA 5IC4B 1SL1A 4ZLLA 2H51B 4ECYA 1HBMA 1VQ8S 2OH2A 2WB1D 1S6PB 4OYZA 2ZM6F 1D9DA 5GAHI 3MMCA 1HNXF 3CJ4A 2RRNA 4OX8A 4A8SA 4OJGA 5KG3A 2LEBA 1ZAXA 1NAQA 4DV4J 1NK8A 3TJ8A 1L5UA 2GV1A 1YJUA 1IBKF 3HX9A 2GW8A 1HNZJ 3UVJB 2D3O1 1FE0A 2DR9A 3HSDA 3Q0AA 1DY3A 1N54B 2M5YA 5B0AA 3CJ8A 5KFSA 2QSFA 4H4MA 3JXOA 2EC0A 2FLPA 1XEZA 4B17A 2BQRA 2H5JB 4ED1A 2VDIA 1RBOB 2L08A 1FVSA 2V8DA 3NL0A 2JEFA 4LFCJ 2HMIB 2OLWA 2PMWA 2D3ZA 1YJVA 3DHXA 3RB3A 3NCPA 3FZ2A 4DV3F 4PQAA 4IRKA 5AXLA 5A0YA 3PKYA 3IWLA 4N41A 2VPWB 4RW6A 2LU1A 3W64A 2XTJP 5GMEA 3OPKA 2ZDOA 4V19J 2EFNA 3DU6A 5MAOA 1WG1A 3EICA 5DGAA 2B8PA 1RADB 3EUNA 3VAFA 5JVHQ 1KLMB 5DLGA 1SVDA 2WOMA 1LWFB 2A6OA 3ZNUA 1EHWA 2MQNA 2NZCA 3D54A 3OLBA 1RAOA 4ZJOA 2RMLA 1GT8A 1DAXA 1WHYA 3EXCX 5KFVA 1KHWA 2RQKA 3LP0A 4GVBB 1ZAWA 3JQKA 1S0NA 1SC4B 5DZ6A 4F4WA 2UVWA 2XWXA 3BPSP 3HJFA 4J9PA 1U7LA 1VRUA 2VKRA 2CIMA 2W01A 2GA7A 1FD2A 3RW7A 3ET6A 2WW8A 2IA0A 2QA4G 2WSFC 1VQ6S 1RWVB 3WQPA 4M5MA 2ZDPA 1VQ9S 3O6QA 3RW6A 4IO9Q 2X51A 1HIYA 2CPXA 3MCMA 3HVAA 3PJ9A 3K89A 4Y2IA 3GU0A 2CDQA 2W8LA 1U24A 4K50A 1WDDA 4DU7A 4R5PA 1RWXB 2MSTA 1TFWA 4PQUB 2Z8QA 3MM7B 4AXJA 5E33A 1Q81T 1RAHB 3AJ2A 4K0KJ 2YBVA 2PGCA 3G96A 4W4MA 4NCGA 4Q0BA 2OHDA 2QV6A 1G3OA 4U8YA 1DRZA 2FDNA 1WI8A 5B0GA 2ZJQQ 2HHUA 3UD5A 1UFWA 1X4AA 2W9BB 4F2RA 3KHHA 3MXHP 3PZPA 4IUFA 1T9VA 3R5CA 3EYZA 5F3TA 4M63A 4OHYA 5D78A 4NXMF 5LSOA 2WRMA 4L76A 4BC9A 3UN2A 2GIFA 1N5SA 1UKUA 2ZHOA 3OTOF 4LFBF 1ZM4A 3FK4A 3KJQB 4ICLA 4EYHB 3V5RA 2MGZA 2Z2YB 1RHMB 4JI8J 2M2BA 4J9RA 3IR6B 5HMYA 3E2EA 2GVDB 4NLYA 2QJ3A 1IVZA 5E3AA 4O4RA 2FLNA 3OLAA 3FDSA 3DC2A 3AAWB 2HFOA 3TX8A 4NZ7A 2VFTA 3NGTA 3G6VA 3TW0A 2R7TA 3PY8A 4HT7A 2E7VA 2G1HA 1UTAA 3H8YA 2W25A 1RAGB 3TP2A 4QPTA 1WC0A 4URSA 5LXYA 3ONQA 4QWAA 1TFYA 3CVKA 4C8YA 2RJZA 4A8FA 3W5XA 3TOQA 3MWBA 4ECZA 3UO0A 1S97A 4OHVA 3PW0A 2V4JA 2AZ3A 3PW5A 4LSLA 2OPSA 4TY9A 5CYMA 3QZ8A 4ZVPB 5CYQB 4WIIA 3TA2A 1M5VC 1WC5A 2YPYA 4Q8FA 4KHPF 3D5MA 4NLXA 3R2CJ 2OPQB 3BQ2A 1RUSA 4WU3A 2XLJA 2DISA 1WHXA 4L74A 3OR2A 7FDRA 3V4MA 3QLHB 2K1RA 2CQ1A 3M6UA 3W8PA 1NCLA 2MQMA 4OX6A 4X4UA 4P52A 2O66A 1NJIT 4M5LA 1MWZA 2CNLB 1VIOA 2W4CA 2EPIA 2IFXA 1KD1T 2KG1A 4WP8A 4X2BA 4JUZA 1N48A 2KFNA 2YQ0A 3Q8RB 4MFBA 1C0UA 4HKQA 2ADCA 3AA9A 3OR1A 3LW5C 2CVIA 4NYPA 5E3CA 2HQIA 1HHTP 3LP1A 4OI4A 1S59A 1ZTWA 1MU2A 2ZNYA 1HNVA 4K4ZA 5KT5A 2DNPA 2ADBA 5F8JA 2LVWA 1TL3A 3VCDA 2Y3YA 3FEXB 5AJ3F 3SSRA 1YRXA 3CCUS 3DYAA 1T9WA 4A8OA 4RU9A 3TA1A 2LQ8A 4K5SA 2PA8D 4LBIA 2XMVA 2ZBCA 1DTQA 4JB8B 3M2UA 3DRRA 5D0HA 1TKXA 1IXKA 4B3MJ 4ZJLA 4PWDB 5D0EA 4WFNQ 4DS4A 2E9ZA 1RTIA 1RK8A 2RVJA 3VAJA 3RU0A 3CCRS 3VAGA 4I6YA 2X1AA 3MMJA 4ED5A 3V2UC 3OTEA 1G1XA 1Y3KA 4F4YA 2MB0B 3ZTRA 4RNHA 4JI7J 4RWWA 3RBEA 2HQGA 4OI3A 2O01C 3VGUA 4CWBA 1HKAA 3M9NB 3U1NA 2PC6A 1ZA1B 5EWEA 1Z4UA 4ZOSA 3HLUA 4ANCA 3D1QA 3D6TB 5FJ4A 3PRVA 4ILMA 1S1TB 1U25A 1N33F 2IPOB 3DLGA 3BBCA 3BKUA 1FD8A 4Q2LA 4WPAA 2AMCB 4YHHJ 2HBYB 2VB6A 2E1RA 2JVOA 2BKOA 3VALA 2CQPA 2W8KA 1V5VA 3POTB 5LJ3Y 4C8ZA 1NK0A 2JWNA 3UFCX 1Y00A 3UE2A 1IBLF 3LWLA 1JLQB 1GMUA 3FBCA 2R2SA 2OI2A 5CZVA 4N47A 2JZ5A 2JEIA 1R43A 4DV1F 1BLUA 4DR2F 3HVRA 1U4BA 1ELOA 3W5ZA 5J2NA 1U49A 2VODA 4KGMA 4CLLA 1H0HB 5DDRC 4Q44A 1WTBA 5SZTA 3RRHA 1E6VB 4OYIA 4KBIA 1N32F 1X4HA 4B3RF 4M94A 1SV5A 2FTRA 4ED4A 1OSCA 4WIQA 1HYSA 1HBOA 4ZITA 4IFVA 1LWEB 1VJWA 1SH3A 1S9EA 3QYYA 4NLVA 2G0JA 1MROB 4KHRA 3PRBA 2QE5A 2YNIA 1DQ9A 1IM6A 1VBXA 3M2VA 4M5DB 4PEOA 1PBUA 3FEYB 5IS2A 1NEEA 3AHPA 2V8GA 1MSWD 3OJSA 3HO1A 4FBTA 1UA0A 2ASDA 2RHSB 5ETSA 2UUAJ 3MCSA 2VBXA 1YKWA 1S48A 3ITHB 5DDPC 3M05A 3MEDB 4PZVA 2KVIA 1BQMB 5ETOA 4ZPWR 1QUPA 3G82B 3T1HF 1UJ5A 4UZBA 1K0VA 4JI5F 4HR2A 4A8YA 2WB4A 1AZSB 3QSIA 1I6JA 1FX2A 1YRUA 1V3SA 2VV5A 2RQMA 4LT6A 1N5QA 2ZH7A 4OI6A 4ZMMA 1CG2A 4XPEA 1RI7A 3PNIA 1S6PA 3NGUA 1VQSA 2KFYA 4C3MA 2YQ1A 2BJ7A 2PE8A 3ELHA 3QIDA 2DH8A 4M5NA 5HLFB 4EBDA 1VQ4S 2KHDA 3H20A 3ZTOA 2DEJA 3GPAA 3UVJA 3TANA 3M8SA 2GS8A 3SQGB 3JAMU 2CDRB 4LFAF 1JXEA 4F0HA 4KYZA 3NS6A 4KGVB 2OP5A 5J1EB 2XZWA 3ZZPA 1W26A 4RUAA 1DARA 2HNYB 1R8BA 1YSJA 1O5JA 2XWYA 4TYBA 2IA6A 1Q16B 3F0NA 1T9TA 3HHEA 3ISNC 2RDDA 2HK2A 1N8RT 2QTWA 4C3KA 5IFMA 3BR9A 2KG0A 2VF3A 3SXLA 3NP5A 1HFEL 2W9CB 1X5SA 1FDNA 2F65A 3U27A 4EZ9A 2CJAA 1RSCA 4FVMA 3CJ2A 1F5AA 1WWHA 2HVEA 3C6TB 3MM5A 1K0TA 5DG8A 1KLMA 1LWFA 3P4UB 4O44B 3PV8A 4LF9F 2HVZA 2M3DA 4GO7X 1RYSA 3LAKA 3WX4A 4KH0B 4DHVA 3IBWA 5HATA 2FJBB 2QMXA 3O8WA 4GVBA 4CIOA 2E9RX 1WSRA 3NS5A 1SKWA 2D9PA 4RUCA 1LV5A 4ECXA 2BKNA 1B0PA 1U6FA 4TLQA 1FCAA 3VV2B 3K5MA 2DR8A 5KT3A 3QT5A 3BM7A 4ZPDA 2BQUA 4USTA 1O51A 1S77D 1K44A 2W24A 2G0CA 2FHJD 4ES2A 4DV0F 2HZAA 1WKJA 2CPHA 4ZVOB 4DR7F 2P6TA 3J7ZT 5I3QA 2ZM6J 1YJ7A 1YHQS 4PRFA 5SUHA 3VGTA 5FLXU 4O3OA 4OYAA 1N88A 1WOPA 1HNXJ 1S4EA 3OT9A 3P45B 1NDCA 4EEYA 3JSYA 1TK0A 5HI7A 3U1LA 2VU5A 4ERDA 1UZDA 2FHOB 1WC1A 2UXCF 4NWBA 1X60A 1TTHB 4PQUA 5AE2A 3MM7A 1VC6A 2HFNA 3K5LA 2R7UA 3TAQA 3W5YA 3R5AA 3R7NB 1IBKJ 2OSQA 1UVNA 2IHR1 4MYUA 1CC7A 1RQ0A 3VGVA 4IG3B 3LGNA 2B56A 4MIWA 2VA2A 1WSVA 4ETZA 2EXUA 2L48A 1ZYQA 1YWXA 5EUHA 2UVVA 3FUYA 3GZ7A 2VG5B 2ZH4A 3MM6B 4LQ9A 3CCVS 4N56A 4DOZA 2W9BA 1UWAA 2BOAA 1HW9A 1EKRA 3LP2B 4PUOB 2V50A 2E1AA 1TU0B 4EYIB 2WVDA 1T02A 4DV3J 3MR3A 2PDAA 2JX2A 1FFWB 2OEKA 2ZJPQ 2AQ4A 5KG1A 2NREA 4ELVA 4KQZA 4TNOA 1ZPVA 1HD0A 2RF2B 3ZZYA 4HH1A 2L9DA 2HK3A 1HPZB 3FCWA 3UNYA 2MKSA 3H42A 2GGPB 3KUEA 4GMKA 1XMOF 3DI6B 2GVDA 4I2PB 1VOMA 2PA3A 1UETA 2KXNB 1PJ5A 1VQ7S 2ZITA 1C0TB 4CLFA
chains in the Genus database with same CATH topology
1NJYA 5ITHA 4NLPA 2K2PA 3HF5A 3BN7A 3W3SA 4JI2F 1BQXA 3AY0A 3DXBA 4FPRA 5DRKA 3DHWC 5K14B 2GQQA 4AL7A 2XNQA 1TKZA 1UJ6A 1WEZA 4I1TA 2J8AA 1LK5A 2W7AA 3T6JA 3TVZA 2A2CA 5ADZA 1TZ0A 3I96A 1X4DA 3MAQA 4B3MF 1VBYA 3AB2B 3G8QA 4TU9A 2QSWA 2MZRA 4TN2A 4Q8EA 3SSQA 1R31A 1Y4ZB 2DHAA 4I6WA 1R89A 2LA4A 4G1PA 1GX6A 2KT5A 1WELA 3DLKB 2XSJB 5EHHA 4YUDA 2ZH8A 1A7GE 2CQ3A 3B4DA 4X65F 1BY9A 1HI8A 1XBWA 2B9XA 4F3MA 5BJRA 3BGRA 2MY7A 3DLJA 2CPIA 2FJEB 4YR2A 3QJJA 1S6QA 2J9DA 2VASA 3CCLS 3MMBA 5J2MA 2BJEA 1S79A 2VFUA 3QAEA 3UR3C 1R8PA 4C11A 1ZAVA 2BOPA 1LWCB 4ED7A 1GTEA 3C6TA 1C1BA 1HI0P 4C0HA 2JVRA 4A8KA 1H3DA 3D1OA 4QJVA 1S49A 3MEEA 1JJ2R 1REVB 4QIVA 3UNGC 4V19X 4WZMA 2HG4A 4DR1F 4OJ3A 4ZA1A 2IMWP 3NNAA 1S1VB 3PVXA 1XR5A 1LW2B 5KG4A 1VI7A 4ZHRB 4PG8A 1BWEA 2PEHA 2EK6A 3KHGA 6FDRA 3KLEA 2V4QA 2JL9A 3ZC4A 1HA1A 1P1LA 2APOA 2DHGA 2FC8A 3KK3A 3M30A 3O1LA 4B3OB 2F40A 2LQBA 3DRXA 3V4IB 5CYQA 3M9OB 2VOPA 1VC5A 5KAKA 2GO8A 2A1BA 1FF2A 3OSPA 2LXUA 4CO5A 4YB6A 2QA2A 2MSSA 2DNKA 4JI1F 3T5HA 1G1XA 3CJ5A 2D9OA 3H4BA 3CPWR 1JLFB 4MMOA 2HWTA 4DQIA 3BB5A 1S6OA 5EWGA 2F8HA 1A6LA 1C1CB 1FK9A 5T7LA 3ISND 4WFXA 3SV3A 2Z2MA 4I64A 4RNMA 3GILA 4ZKAA 2XO7A 1ZPWX 5LSRA 1VLYA 5T41A 3VF0B 4ZLPA 4ED0A 2BM1A 1SUQB 4NZ0A 3GB0A 2V4JB 5EGYA 4XIUA 4ED8A 2BZ2A 4NPOA 2B6AA 2HQ3A 3E01B 2FLLA 1FRXA 4LSLB 2MYFA 2DGWA 4IG0B 2OPSB 2J7KA 3QGHA 1M5HA 3QLHA 5CYMB 5C5JA 1NZAA 2IM2A 5C24B 3EGZA 1JLCB 2KZZA 1IKVA 4WZQA 4IFYB 3I0RA 2UVRA 2O5DA 5AXMA 4MH8A 4DDFA 1VC0A 1AROP 3R1HA 2LCWA 1ZBTA 2OSRA 2RB7A 3GYXB 1SJ3P 4CO0A 2JSXA 4DSEA 2RQ4A 3BS9A 1S1XB 2ZC3A 3M8QB 1SJFA 3NWGA 2IVMA 2QLWA 2OTJS 1YQHA 1IKYA 4PPZA 3V6KA 1KRPA 4DFJA 5AXKA 3I5CA 4DL2A 1S9FA 3OR2B 1NHUA 3G4SS 4J9NA 2R2TA 1VQMS 3MECB 3ENWA 2XBPA 3HVTA 3B78A 1H2UX 2K1RB 3N01A 4A8QA 2BR0A 1M90T 2O1PA 2AW0A 2J9CA 2DIUA 1U1MA 3NNCA 3M6XA 1OS5A 4N8NA 5L1LA 2DPJA 2OIHA 1V6HA 2ZZMA 2YKNB 4NLTA 4Y28C 4MKBA 3BO4A 1Q7LB 4PG5A 3C8YA 3UI3A 3JTNA 4M8LA 3ZFVA 2R8IA 4GKJF 5LL6d 2UUWA 1UJ4A 1UP1A 3MOJB 3QAUA 2KT2A 2PI5A 2OPPB 1JLEA 2NYIA 4X84A 1R6YA 2G9OA 1FE4A 2V9KA 4TYAA 3IN5A 4IOCQ 4KFBA 5CZXA 3CJKB 4NMLA 5KG0A 1FTCA 4ZP7A 2PMZD 2NUUG 1G2EA 1VRTB 4F25A 5KFJA 3OBIA 3TVYA 3GFXA 1DLOB 2ZOFA 4RU2A 2HAIA 3CC2S 1KQFB 4O3QA 2YY3A 4I4BA 2BM0A 4I7FB 3PJWA 4MFBB 3CEDA 5DJBA 2WONA 3HHLD 1JX4A 2DPIA 2E5LF 2XS7A 1C4CA 3R5BA 4A8WA 1C0UB 2C42A 5F9NA 2ZKTA 1E6YB 2JEJA 2DH9A 1M5SA 2B3TB 3OR1B 5A8KA 3KLHB 2KT3A 2MDAA 2FJWA 3QZ7A 4KKOB 3UCUP 2IC3A 2UXBF 4ZP9A 2N7CA 4WFAQ 1KTQA 4IOAQ 5L1KA 4X4VA 3MEGB 2YKMB 3DGPA 3VAKA 3LP1B 4FXVA 4C97A 2BJDA 1MU2B 2VG6B 3NAIA 4BHQA 4JI4F 1HNVB 1TVRB 3CGIA 2R7WA 4PWDA 1WG4A 1LFPA 1NU4A 1N5TA 2L3MA 3NG8A 2R8JA 5LMUF 2KO1A 1F9FA 2R7XA 3KLIB 4C8KA 2FVCA 1F5BA 2DNOA 2C3MA 3JSMA 2L41A 2QLXA 1GX5A 3DYAB 1HBUB 4OZNA 4QR1A 2UU9F 2J7WA 5C42A 2F3JA 1S9GA 5THWA 3M4XA 1YG0A 3HHLA 3IFEA 4G1QA 3MFHA 2XY7A 4DSIA 4OMFG 3W2WA 1OIAA 3KNAA 2DHXA 1DTQB 2ZD1A 3M2UB 3DRRB 2R7QA 4N77A 1TKXB 3IS9A 3KFWX 5E7OB 4XO0A 3Q8QB 4JV1A 1HBMB 4CNYA 4X4PA 3N6NA 2JH3A 2XEXA 2XY6A 4RBTA 2K3KA 3I82A 4NLUA 3RR7A 1RTJA 4N8OA 1OWXA 1LW0A 1RTIB 4UUWA 4A4JA 5KFWA 4QYZJ 4CO2A 4DV7F 2EFPA 4ZVGA 5F8MA 4DN9A 1Q79A 3DOMA 1M5PC 4ETXA 3BDPA 3OFHA 2POKA 4BCAA 1GAOA 2UUAF 3PX4A 3JB9k 4ECQA 5JUMA 2RIJA 1FXLA 3KLFB 1S6UA 1KHVA 2H9ZA 2R4FA 3AB4B 4N5SA 1HI1A 1S7HA 3DFEA 1KOHA 3I9ZA 4GC6A 1F5CA 5KG5A 1S10A 4OHXA 1L3TA 5KT4A 1W25A 4LF6F 1OSDA 3CWJA 4IKAA 3TARA 2YH0A 1S1TA 2PFFB 4KO0A 2CQDA 2MZQA 2XGPA 2B5JB 4ES3A 4ELUA 4ZK7M 2AJ4A 4YDXA 1RKJA 4Y3CA 4QWBA 3CMAS 2ILZA 1B7FA 2DGQA 5C25A 5KFLA 3OL8A 2FY1A 4RW4A 1UVMA 5BR8F 1JK9B 3TAMA 2EBEA 3MMAA 4Q2MA 4IRDA 3OV7A 4HH0A 3J7A1 4J9QA 3US5A 2BE2A 1VQPS 5KG6A 5KG2A 4NLRA 1S0OA 2HFZA 2GC8A 4FXDA 5IT9Y 2M7SA 3MPYA 4KV8A 2DT9A 3LOUA 4OLOA 5F8IA 4B9SA 2DNHA 1AXQA 2CJBA 4H4MB 1D3WA 1WD6A 2B51A 5DQGA 2ZH1A 4JI3F 3WC2A 3GE9A 1VK3A 4AQYF 2BYCA 1P9QC 3FFIA 3DRPA 3MI7X 4O4GA 1FKAF 4WXOA 3DLGB 3POTA 5L1JA 1Z1ZA 5DO2A 5A2QY 4BS2A 2BACA 1HWIA 2BRLA 3GIJA 4QPXA 2LQJA 3J81Y 2XS5A 5F0WA 2PIIA 3HDSA 2ZC4A 3M8RA 5HMWA 4X4OA 2JEGA 5CCLA 3MHYA 3CCES 4MJKA 5IM0A 1IJEB 2HYIB 4NRTA 3W2VB 1FKOA 4DF4A 1RDRA 1Y5NB 4RW7A 2XMUA 3CIZA 2DH7A 3QJPA 3WC0A 4KTQA 3GWCA 1U47A 4IO1A 1JLQA 1KQKA 1M0SA 2GO9A 4HL9A 2WSCC 1X4BA 5JJBA 4N76A 3MR6A 1KEKA 1QSYA 3GSDA 4Z37A 4WYWA 4EO6A 2ZE2B 3NCRA 1TAQA 1SH0A 2XCPA 4U67Q 1NK6A 2MKCA 4OJHA 4B9MA 4OL8A 3CJ0A 2YNFA 2JDJA 3OL6A 2NUHA 4OZ0A 2LA6A 4ID8A 4ITSA 4BWMA 2PT0A 6FD1A 2EG2A 3PHEA 3IAM9 4RW6B 5E5NA 4OX9F 1WACA 3IRXA 4X4NA 4HTJA 3K2YA 5KOXA 5HMXA 1S1UB 2FD2A 2DRBA 3N5BA 2OMLA 3CDWA 5KFDA 1NJXA 3FRYA 3T5KA 1U45A 3T1YF 4WE1B 1FJEB 2R7VA 3D0IE 4MKAA 1JLFA 2YNHA 1N5YB 3HM9A 2IM0A 2R7OA 2R9LA 1UEVA 2VZ9A 3DLLQ 1T3OA 1P8GA 1ROFA 1Q1KA 3N4WA 1J5EF 1E6VA 2W9AA 2VD3A 1CPZA 2ALZA 2UP1A 2WK4A 2FVQA 4ZP6A 1RT7B 5HROA 4I2QB 4K4TA 4C4WA 1DTTB 1RA6A 2EG1A 4U6PA 3CB4A 1SUQA 4YR0A 2CRLA 2WOMB 5KFUA 2C2EA 1NK7A 2MHNA 4USJC 5EWFA 1FKPB 4ECRA 1HQEA 1QAXA 2GX8A 3N79A 5J2NB 1V9OA 1BQNB 2EWHA 3I5AA 1JLBB 5B0EA 1T03B 4RWXA 5KFCA 4H4OB 2D3UA 2QYCA 1DBDA 1LWEA 3RZAA 5KFZA 5KFFA 2MQLA 1K1SA 3LAMA 4EBEA 1EP4A 5E2QA 5K8MA 3DOKB 4RW9A 2DO0A 2HW3A 1MROA 2FC9A 3H5SA 4FYDA 2IYGA 3M1VA 2ROPA 2ZH6A 3PW2A 4MYTA 3AA8A 3N0VA 1WTFA 2JC0A 1RTHB 1U6ZA 4NA3A 3TO8A 4OHZA 3TI0A 4RNNA 3UQSA 4M5DA 1L3VA 3CCTA 1SV5B 1ZM3A 2HGNA 3UWTA 3LWMA 4CQ1A 2Q79A 4W92B 3PX6A 4WFYA 2QRRA 4KGKA 2AV5A 2N82B 2KU7A 1W2BR 4P6QA 3MR2A 3KK2A 2HHHF 3LQVA 5U47A 1HYSB 1HBOB 1QM9A 2KYZA 4ZCMA 4NZ6A 2YKPA 2VPXB 4Q45A 2I2YA 5EX0A 3CCZA 1DURA 1FDAA 4O0IA 3MM8B 1S9EB 5G0RB 3S7RA 3ZZZA 2XCAA 3A1YG 3E3XA 4MK9A 2QA4S 2I0XA 3M6WA 3HMJG 3HZGA 2Q1LA 2R8KA 4UQGA 2CQCA 1VQ5S 3G9CA 3G86A 1X4EA 1SJ4P 2AF6A 2WBMA 2XHWA 3MOZA 1JIHA 3SCLE 3VAMA 3TR5A 1IQTA 3ITHA 3WZ0A 4WKRA 2N3LA 1OPIA 3QGIA 2YNIB 2GCFA 2I5JB 4F3QA 4I56A 3TNVA 3M2VB 1IN0A 3MEDA 2O3DA 1KFSA 3IAS9 5HMZA 1BQMA 2QMWA 2J6SA 5E41A 2D1CA 2ACYA 4IH6A 3HP6A 4Y65A 4CTAB 3BGFA 2RQCA 3IR5B 5DG7A 3MTKA 2IBOA 1TL5A 3NGKA 2E44A 4WFBQ 1SKRA 4O23A 2DGVA 3AJ1A 3FSYA 1UVJA 3OTCA 1QTMA 2KXFA 4G1IA 1Y5LB 4K4UA 2KN4A 1ZETA 5IXUA 3B4MA 2FHJA 3NNHA 4DJBA 2FJAB 2DR5A 1E6YA 2VC0A 2CZVC 1QUVA 2EFOA 2ZUGA 3C6UB 4IDKB 4LJMA 3IC1A 4LF5F 2RE1A 3FQLA 2M88A 5FDLA 3JYTA 2QZ8A 3KHLA 2IRYA 2VL1A 4FS1A 4K4WA 3OFGA 2A10A 5J2PB 4EWTA 4O3PA 1DJ0A 2KB2A 3MEGA 1SL2A 4QOTA 1A9NB 4ECUA 1R7IA 4PKDB 2MKKA 1H2VZ 1X4CA 2OMOA 2VOOA 4PWUA 2UVUA 2YVSA 4OHWA 1QAYA 1TVRA 5B08A 3PIOQ 4LSNA 1JWWA 1FRIA 3A8EA 3V81B 3D2WA 3L09A 2K7KA 4OI0A 2DNRA 1S0VA 4DFMA 3TVKA 3S8SA 1VGYA 1VQOS 1Y7PA 2GHVC 1IKXB 3OFFA 3N9UC 1KVIA 3RTVA 3EZUA 4MIAA 4D3GA 4DPOA 2KTQA 3GQCA 1JXLA 2FGOA 2GMLA 4X4TA 2AGQA 4YB7A 1H2TZ 5HLFA 3IO1A 1SL1A 5AE3A 1IR0A 4NCGB 4D3HA 3M32B 3THVA 1X8DA 2K7JA 1R8CA 1HHSA 2MMYA 3OXGA 1WG5A 1UWBB 3OUYA 3ENQA 1VS3A 4ECYA 1HBMA 1VQ8S 1JJHA 3OXLA 2OH2A 2WB1D 4DSJA 4QIEA 4WF9Q 3TRGA 1S6PB 4I69A 3DU5A 2ZM6F 3L3CA 1D9DA 3KJVA 1Q8LA 4XDCA 3FMWA 1U2RA 4ID5B 4IQMA 2YTCA 5GAHI 2ZNZA 2BA9A 2A18A 2CQGA 5DM6Q 3MMCA 2FUG9 1HNXF 3CJ4A 2VUGA 1X9SA 3J7YU 3CD7