2QYCA

Crystal structure of a dimeric ferredoxin-like protein (bb1511) from bordetella bronchiseptica rb50 at 1.90 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
b'GMTMFLHVVMMEFDDGIDAGFFRTVDEYVARMKRECDGLLLYHFGENVAARSQGYTHATSSAFVDAAAHDAYQVCPAHVAMKAFMGPRIKRVVVYDGEVPAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-like protein
publication title Crystal structure of dimeric ferredoxin-like protein (NP_888056.1) from Bordetella bronchiseptica at 1.90 A resolution
rcsb
source organism Bordetella bronchiseptica rb50
molecule tags Unknown function
total genus 17
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qycA00
1X7VA 1K0VA 4HL9A 3UDCA 2K2PA 2N4DA 3BM7A 4OIXA 4Q2LA 4Y2MA 5A6WA 2N7YA 5B0FA 1OQ3A 1TL4A 1IUJA 1N5TA 2K7KA 3MZIA 1N5SA 4OJ1A 2OD4A 1Y3JA 5T7LB 2IYGA 2K1RA 1P6TA 1YG0A 4HH0A 1LQ9A 2OFGX 2ROGA 2CRLA 2K7JA 1FE4A 1GXUA 3LGNA 4A48A 2GFFA 1YJVA 2GO8A 4A46A 2VH7A 1RJJA 4U9RA 2VV5A 2XMVA 4ZA1A 5T7LA 1X8DA 4HI1A 1R6YA 4Q2MA 2HFOA 2ZDPA 2KT2A 4DPOA 3MCSA 5B0CA 1CC8A 2XMWA 3FMBA 1YJTA 1FVSA 3CJKB 4DN9A 1S6UA 1TR0A 2KT3A 1AFIA 3BR8A 3QGPA 1P8GA 2OD6A 3HHLB 3KG1A 4Y2KA 1JWWA 1S6OA 1VQYA 2KKHA 1Q8BA 2GV1A 3HFKA 4OJHA 2HIQA 3HDSA 2OMOA 3CJKA 1KQKA 3BGUA 2W4CA 3FGVA 2KYZA 1YJUA 1YRXA 2HQIA 2LQBA 1SI9A 1FESA 2LDIA 2QLXA 2XMKA 3HHLA 2W4DA 3IWXA 4NL5A 1N5QA 4FNHA 2BJDA 4DL0C 1SB6A 2LQ9A 4FNIA 2XMMA 2OKQA 1FE0A 1TL5A 1ULRA 2PD1A 3DXSX 3BDEA 4A47A 2AW0A 2QYCA 3T9NA 1N5VA 3K7RA 2ROEA 2W4PA 1OQ6A 2ROPA 1Q53A 2N4CA 2FHMA 2RILA 4OJ3A 5B0AA 3E8OA 1OPZA 2JDJA 3HHLD 1X0PA 2BYCA 4YDXA 2G9OA 3WDOA 4A4JA 2ACYA 4HI2A 3TOQA 2IFXA 1Q4RA 1CC7A 3HF5A 1APSA 1Y0HA 1KVJA 3LO3A 5F0WA 1URRA 1AW0A 2XMJA 2FTRA 5F0UA 5B0EA 3HHLC 4OJGA 2ASYA 3IWLA 1QUPA 3HX9A 2L3MA 3KKFA 5B09A 2XMUA 4EFAC 2PGCA 1OSDA 1VQSA 4Y2IA 1MWZA 1W2IA 2IYIA 2K1RB 1FVQA 4QOTA 3TNVA 2AJ0A 3BN7A 1AFJA 2Q3PA 2QLWA 1Q8LA 5B0BA 3F44A 5B0DA 3LGMA 2OFHX 3QMQA 1JK9B 5B08A 3DCAA 1MWYA 2FB0A 2RMLA 3KG0A 1FEEA 5IXUA 2AP6A 3KNGA 2OP5A 3BB5A 1TUVA 4YEAA 4NPOA 2GA7A 2RSQA 2GGPB 4ZOSA 5A6PA 2XMTA 2ZDOA 3I9ZA 2AJ1A 1FD8A 2LXFA 2HLUA 1GXTA 2QIFA 2RU9A 5K9FA 3FRYA 1SQEA 2BBEA 2HFNA 2OAUA 3VTIA 1U7LA 1KVIA 2BJEA 5B0GA 1V3ZA 3TRGA 4F67A 2HLTA 1TZ0A 1YJRA 2FIUA 1Y3KA 2GGPA 4HH1A 5KAKA 1WD6A 2BUNA 1Y9OA 2GCFA 3GZ7A 1CPZA 1XBWA 2EW9A 3BF4A
chains in the Genus database with same CATH superfamily
1SC3B 3GE9A 4WXWA 1NJYA 1X9MA 2VFUA 2UVVA 4OX6A 4P73A 2IDLA 4UY8T 3MEKA 2ZH9A 1CS4B 1EB0A 2FGOA 1UEKA 1VR6A 4P10A 3RBDA 5K8OA 4ZHRA 1VQMS 3NOGA 3ZZ0A 3A12A 4ZPTR 2RRBA 2W4CA 5KFQA 3QBCA 2B51A 3ONQA 2CPJA 4NL5A 1QAJA 3HJVA 3V4IB 2ERRA 3VGVA 3H59A 3NNHA 4YR0A 4F4YA 1RHJB 1REVA 4DEZA 1NU4A 4Z7CA 2LQ5A 3SCJE 3FBEA 3K2YA 4ED2A 4OV6A 3K5OA 2D9OA 3AA9A 3L95X 3O1LA 5AE1A 3F0NA 3WC0A 2XMAA 2KFNA 3UNYA 3T5LA 1L3SA 3K17A 4F26A 3QRQA 1JLFA 4KH1B 2DO0A 2L08A 3LGMA 2QFJA 2UUCF 2PA8D 1VQPS 2IDEA 4DR5F 1RADB 2IM0A 3LP2A 2LXFA 4X4TA 3MGJA 1XWLA 1TAUA 4ECTA 2JRSA 3E01B 2GJFA 3IP0A 5KFWA 4MFBB 2W24A 1TKZB 4X4PA 1IQZA 2RAQA 3OR1A 1SIZA 1H7XA 4KB7A 4JV5F 2V8PA 1VC6A 3AD9C 1YZ7A 1WACA 3RRGA 3CJ2A 2ZBQA 1G6BA 2MSTA 3W2WA 2NSBA 2DGOA 5GAEU 1T94A 1FRLA 1B0VA 1Q8KA 3HCXA 2M3DA 1BQMA 3W65A 1XMOF 1S59A 3GQCA 2WB1D 3N01A 2FJXA 1QAYA 3FGVA 4XAKA 4DF4A 3Q8RB 1QDUB 3MR5A 5DDRC 3C6TA 3DGPA 1HWLA 2F63A 3SCKE 4U7CA 2PA3A 1FT8A 5A8WA 4M5JA 2DR5A 1KDNA 3OTOF 3ISZA 3HHLD 2YNHA 5GAHU 2W7OA 2Q43A 5LSRA 1BWEA 2YKMA 2CFXA 3ZNJ1 3EZUA 4QIWD 2BV3A 4ED3A 3CCTA 5FLXY 2E5IA 3UD4P 2U1AA 1D09B 1LKZA 3F73A 2HBZB 2AU0A 1U49A 4A8YA 4NI2B 1RT3B 1O51A 2G1DA 2XB2D 1UWBB 1U1PA 1HQUA 2E5LF 1CEZA 4OX7A 1TQLA 1WG5A 3OL7A 3CDUA 1EETA 2N7YA 1Q86T 1WNEA 1HBMA 2F65A 3HVTA 4AXIA 3PNIA 4FS1A 3FUYA 2FUG9 3D0GE 4DV3F 2XG8A 1S6OA 2HNDA 3W61A 2BACA 1FXLA 1NB2A 2OTJS 5F9NA 2HHPA 1YBTA 2QZ8A 4BHQA 2CNKB 4B3MF 3IRXB 4MK9A 1LWEA 2AHOB 5KFJA 3G6YA 1ZOTA 4CLTA 3CDAA 2M7SA 2C3YA 1YLXA 2BKPA 2R8GA 4LSNB 1J2VA 2W9BB 3H5UA 2V9KA 4F2SA 1S9EB 3RZAA 3IGVA 2CJBA 2GGPB 1CJUA 3Q89A 3TAMB 2XMTA 1Y00A 1R0AA 3ZZPA 2FQQB 4EEYA 2DJWA 2QV6A 2N7CA 2AD9A 4W4MA 3AHPA 3EVMA 4F67A 4YHHF 4ZIWA 1NNDA 4CNZA 4USWA 2BQRA 2QRRA 5D3GB 3U27A 1R43A 1T9WA 2GJ2A 4PXEA 4ZVUB 3MM5B 2LEBA 5D77A 3M8WA 3JTPA 1Q16B 3UDLA 2GV1A 2HIQA 1XR7A 2C3PA 3HDSA 4JI4J 3L7OA 2A18A 4ZPBA 3G8TA 4QWCA 3R5DA 4IG0B 2BJDA 2NXUA 2PD1A 4KQZA 1Q53A 3EGWB 2EG1A 2GMHA 1SUQB 2MZJA 2VFSA 4U95A 4L76A 3LOUA 1OSDA 4G3IA 2HK2A 3GG1A 4O3PA 3FCHA 2FLPA 2MQNA 3KLVA 2OSQA 3I9ZA 3AJ1A 5DQGA 3PW4A 4DBQA 1JLBA 1TZ0A 2V8HA 2ASJA 4PXCA 4QWDA 2R8HA 2EW9A 4MMOA 2K2PA 1WKJA 1UAWA 3C14A 1KLMB 3GLJA 2CVEA 2CKWA 3GJRB 5CXTA 2J7WA 3UN3A 1RTDA 1GEHA 2MLYA 1UVNA 3JTNA 1S0VA 2L9NA 3DMJA 1RDRA 1WC3A 3PKYA 4DFKA 1HWUA 3EXYA 3HFKA 3KTQA 1K73T 4E2FB 2MLZA 2KZZA 3Q22A 3CD0A 1BC6A 3PRBA 3OT9A 5C42B 4BDPA 1UEVA 2C2ZB 1S6PA 1S4FA 4CH7A 2C2EA 2EWHA 1SJ1A 1CS4A 5KT3A 4JYAJ 1WHYA 4AXJA 3KLIB 1JLAB 4YOEA 1C1BB 4J37A 1LK5A 3ETOA 3D3CJ 2YKQA 4Q45A 1YGYA 2FVRA 3LP1B 3JAMY 1DARA 1DTTA 2M0GB 4X84A 2JLFA 1FNMA 3TO8A 4CP5A 4LFAF 3NL0A 3M9OB 2B6AB 2AKWB 4DQQA 3K5LA 2CPZA 4BC9A 2KVQE 3TRGA 3MECB 1HBNB 4MT1A 4I6YA 2BVZA 2WVCA 2DR9A 2HZAA 2I5JB 5L1JA 1S48A 1F2GA 1FE4A 4A48A 1FWLA 2VFTA 3I4HX 4TYAA 4NRUA 4DSJA 2H51B 4EMDA 2Z2MA 1ZAXA 3CJKA 2WCXA 3GPAA 1L3VA 1T0TV 1N54B 2W4DA 1ZTWA 1SB6A 4JI7F 1VK8A 4ZP7A 2DNHA 3Q24A 3N5BA 2Y3YA 2QE5A 3I0RB 2W7AA 4HI2A 4ZIVA 2QYGA 3UQSA 2W9CB 2XULA 4RUHA 1PCAA 3Q8QB 2B9YA 2QT7A 2LCWA 4RW6A 1RKIA 3H2VE 3M30B 1LFPA 2R42A 3N28A 5DQIA 2JJ4D 2K3IA 2UUCJ 3UDVA 1KQGB 3DU5A 3I87A 2AEJA 3TA1A 5AE2A 4DR5J 1Y9OA 2SXLA 1HQ2A 2E1CA 3OSNA 1K44A 4DU7A 1VQ8S 2OFGX 3VAKA 4X4OA 2IJRA 3QJPA 3B54A 1RAOA 1KKHA 3VZHA 1T11A 4Q5VA 1LW0B 2WONB 4NI2A 4MKVA 1RT3A 2I38A 1UWBA 3EVWA 3G71S 1CJVB 3QWUA 3KJNB 1N48A 5E41A 2CQHA 4LUBA 2RQ4A 3HHLA 2HMIB 3LP0B 4CCHA 2DNNA 1U8SA 4JI0J 1Q81T 1T9VA 2JOQA 5KFPA 4GO7X 2G9OA 4JV1A 2DISA 4C48A 3OTOJ 4F50A 4J9NA 1NPKA 3UWTA 4DQPA 4OJGA 3JSYA 2R7VA 4AE5A 2H48B 2H54B 2ADBA 1Q1KA 2MZ1A 3CJRA 3AQOA 1OY6A 4NYOA 1MWYA 1EP4B 5LL6d 1D0EA 2ZH5A 1C2PA 3OVAA 3MWBA 3JB9k 3S6EA 2CPIA 3W9IA 1NPPA 3DLLQ 1O0PA 2V8VA 4LSNA 3K58A 4NEZA 1U2FA 1S9EA 3MPWA 3C15B 4A8KA 4MYUA 3TAMA 3H40A 4HYKA 2MKJA 4DPXA 1JWWA 4ETZA 3PYGA 1FK9B 3LPEA 3VQTA 3B82A 2OEJA 4JI3F 4DV3J 1YDLA 2AJ2A 4OHXA 1BHNA 2XM3A 1S0NA 3D5MA 2LQ9A 2VOPA 1TL5A 1KD1T 3Q86A 2N3OA 3WX4A 5D3GA 3CXCR 2IC3B 2BJ8A 4B08A 3IR5B 3GYNA 3CJ4A 3MM5A 3ILJA 3CCJS 2ZZTA 5KG7A 3CCUS 3CNQP 2W7PA 2DRDA 5H9EJ 1NO8A 1J5EJ 2DGSA 2IJNA 3R7SB 4IG0A 1S76D 3KLHB 1T9YA 2XTJP 4NPOA 3QJJA 4F0MA 2GIFA 4X4RA 3VAHA 3UVJB 5EWFA 3G87A 5KFOA 1SUQA 1X5OA 1OIAA 1VCTA 3AB4B 3OHAA 5KG1A 5DG7A 4OJ1A 2BQUA 1XN9A 3PYDA 3P45B 3HSGA 2Z2ZA 3D6MB 5HLFA 1VBZA 5F41A 1N8RT 4C8MA 2E29A 3J7YI 2HGMA 3PJXA 4FYDA 4DLGA 1KLMA 3MURP 2GMJA 3CTRA 2RDIA 1ZZFA 4P2XA 4PYAA 4OZ2A 5DS7A 4PWDB 2AF6A 3Q2SC 4XK8C 5DG9A 2QSFA 1CQMA 2DITA 2K1RB 4FVCA 2E1MC 2ZJRQ 3G8SA 4DOZA 4GC6A 1NK5A 3TP2A 2HVZA 5C42A 4KRWA 5H9EK 3A8EA 5LM7E 1FD8A 3HSJA 4FPRA 4NXNJ 5KAKA 1JLAA 2ZVIA 5A2QU 1D1UA 4NA1A 5D0RA 3EMTA 3DYAB 1ITPA 1JLGA 5AXMA 3LP1A 4IH6A 1RT6B 4MH8A 4XDCA 3AB2B 5D0GA 5HMWA 2J7UA 4I56A 3QAEA 1F2HA 4WKYA 4FZVA 1HD0A 1CULB 3QGPA 3H5XA 2CQIA 2ZJPQ 1HBNA 3VGTA 3KK3B 3OTBA 1TL7A 4Y2AA 3M6VA 1RT1B 3L7UA 1ZM9A 4NZ7A 4Y65A 4CM2A 4OZJA 1X0PA 4KHPJ 5KFLA 1Y5IB 4ECSA 3FZBA 2DH7A 2KM8B 2AMCB 3KLGB 1AW0A 3ZTRA 3GG0A 4EFAC 3ENAA 5KFBA 1OO0B 4DCJB 1RWWB 3J81Y 1TKXB 4FN5A 4AUKA 4FP9A 3I0RA 4LFBJ 2KXFA 1UVJA 3RW6A 3CJQA 1RB0A 2LA6A 4YMEA 3J81U 3K57A 4ECZA 5HMXA 3D9BA 3RB6A 1RTZA 4OHYA 3T1YJ 3M30A 4OX9J 4ZN3A 3R5BA 5T41A 1SH0A 3GTYX 4NCBA 4RPFA 2KKHA 2EC0A 2BABA 4CZCA 4YB7A 1R8HA 3VAFA 3CUNA 4OHZA 3HMJG 1U8WA 4OI2A 1OQ6A 4XTTA 4JI7J 2ASLA 5CYMB 4ZPCA 1VHIA 2PMZD 4A8WA 2UXDF 1LW0A 2WONA 1FRIA 4NLGA 2MSSA 1CJVA 2BJ1A 3OJUA 1EHWA 1RTJB 1S5ZA 1AFJA 5CABA 1KTQA 2HMIA 2AYBA 3D7SB 1QM9A 1TUVA 4JI2F 1TKTB 1MLAA 3TA2A 3EZOA 4D3GA 1RQ0A 4LREA 2LDYA 4IRCA 2EPIA 5J2QA 2B9EA 5ETRA 2KJVA 4RUCA 2NCKL 4KGZB 3DN9A 4DV5F 4PUOB 2GQ2A 5D8HB 3HHEA 2FGCA 1EP4A 4Y34A 3OQ2A 4RW4B 2EK1A 5KFUA 2QEXS 2HHQA 5KFEA 1T9TA 2DD8S 4ECXA 4J9MA 4LFCJ 2NR0A 3CCES 2KT5A 1G1XA 1YJ9S 3PZPA 1ZS6A 4Q0BB 2BOAA 4LMZA 3CJ3A 2N4CA 2FHMA 2V5HG 5L39A 4ELTA 2JLEA 3FCVA 1UJ6A 2F4FA 4WBFA 4OV1A 3IN5A 3RAXA 2ZH7A 4NLVA 4UOFA 1VQ7S 5GMEA 3TW0A 1FK9A 2CZ9A 2HQGA 2X1FA 3IBFB 3BKTA 1TTHB 2A2CA 2PC6A 3NXZA 4OQJA 4QIEA 2IC3A 1YJWS 2MY8A 2B7BB 9RUBA 4CT9A 2BM0A 1S1WB 2MKHA 5F8GA 3HT0A 4YP3A 1S6QA 4FF4A 4PABA 4LQ3A 1U24A 1ZBTA 3IFEA 1KEKA 1LWCA 2JZ5A 5KFVA 5LXYA 3KLHA 1RA7A 8AT1B 1F9EB 2Q1LA 2COLA 1D9DA 2HQFA 2BJ3A 5DM7Q 5KFDA 4RW9B 1Y5NB 2VG7A 4KIAA 3IR7B 4ID8A 4CLZA 4EZ9A 3N6LA 2XHWA 2C3MA 2DNOA 4DL4A 5AJ3J 2FJDB 2JEJA 4QJVA 4LF7F 2O5DA 4UUXA 3TZWA 1N52B 1BY9A 4KSEB 4C0HA 2BDPA 3HD2A 3BR9A 4WZMA 5ETPA 4FPIA 4I64A 3GCXP 3NP5A 2I9SA 2FD2A 4WCEQ 2DR7A 4M5GA 5KG0A 1BXNA 3ZTSA 3ZNUA 3O6QA 2LQJA 5D6GA 1F5BA 4PCQA 1XQIA 1RWPB 4ZS6A 3HLUA 4UOHA 4QIFA 3NAHA 2HHHF 1X7VA 1HR0J 4G1PA 1YTYA 2A1BA 2QL7B 2NXJA 2DK2A 4CLSA 2YKNB 3NGRA 2K1RA 1EKSA 3QJLA 3PM9A 3EICA 2JWNA 2UV8A 2DXDA 4K4YA 3CCVS 4A8OA 2W2OP 1WF2A 2ADCA 4YS2A 2IM1A 3MMBA 3AJ2A 2ASDA 5M2RA 1RT6A 4KGKA 2CQ2A 4ZDNA 1DAXA 3TA0A 2RIJA 2VICA 4K4TA 3PHEA 3J81j 3Q8YA 2JL9A 2XNRA 2W25A 2JFDA 2CZ4A 5F0UA 1UFWA 3C16A 4ZJLA 1WOSA 2JEFA 1HYSB 1VLOA 1U1QA 3G82A 1F60B 2VKRA 2C2OB 1RT1A 2GO9A 2J6SA 1HW9A 1Y3KA 1S72S 3AJDA 1KR4A 2LXIA 3KLGA 3CD7A 2HFSA 1J5OB 1IBKJ 5KFZA 4X4QA 1NDLA 3I6PA 1ROFA 2CQCA 3M05A 4ELUA 1HW8A 2HZVA 1NM2A 3THTA 4ZMMA 3BS9A 3ZZOA 2EFVA 1TKXA 3MAQA 2MZTA 5HK4A 4X65F 2CNOB 2CVIA 4P71A 4F4AA 4E0DA 4RLEA 1BD6A 1NSKL 2IA6A 3HT3A 2F4VF 4KJIA 1JIHA 2LDIA 1PC5A 2ZH1A 4LF5F 1D3WA 1WG4A 4ILRA 3BDEA 3NGDA 2GVDB 5ETKA 1FRJA 1OPZA 2RJZA 3L7PA 2KDOA 4FYWB 4NYPA 5F0WA 1UCNA 2AQ4A 5J2NB 3GCWP 3BH7B 1TV6B 2O67A 1FRMA 4ANDA 4RNHA 4J9SA 4YR2A 1M5HA 2GAGC 2RSQA 3AQPA 1F1BB 5JJBA 1U7LA 3OFFA 4IRDA 2BJEA 3CCMS 1YSJA 5CYMA 1TUWA 3DRSB 4NLTA 3BYPA 2V2ZA 3J7YU 4K4WA 1CJKB 2XZTB 1AA1B 3UI3A 3JYTB 2O3DA 1E6VA 3UCGA 4YB1P 2FHKA 4I6WA 1U0HA 1DTQB 5FDLB 4F02A 5K8NA 3M9NB 1LEOA 2VBYA 3GONA 4F0KA 1A7GE 1FWPA 2ACMA 1S97A 4ZCIA 3DHWC 2XI3A 2H9ZA 2HQIA 3ADAC 1HBOB 4ID5B 1B7FA 1WSRA 3O5TB 3U1MA 1K9MT 2OGUA 3MCNA 5KFRA 3EYZA 4PUOA 4CO2A 3HSDA 2ZH2A 1RWNB 1OY9A 3DI6B 1U02A 3C3LA 3NCQA 4LF1A 4B9NA 3KJQB 3BYRA 3QNWB 4QIVA 2MJNA 4IDKA 4OFZA 2UXDJ 2P5VA 3DOLB 2KYXA 4M5NA 4W92B 1S0MA 2AGOA 1H0HB 3DLKB 4Q0BA 3D1QA 3PCOB 1DQ9A 1E6YB 1FA0A 3MPYA 1Q79A 2LU1A 1QSLA 4EZ6A 1FKAF 2MGZA 3P6YC 3R5CA 4P2MA 3QT6A 4OYWA 2CJKA 2V67A 3CCSS 1HHQA 1VIXA 2Z30B 1Q8IA 1MROA 1S1WA 3QWPA 2B43A 1Q8BA 2FVCA 1UL3A 4RU2A 1TU0B 4L74A 1GX5A 3I9V9 2VA3A 2YWKA 1IBMF 1KSPA 4C11B 2HEKA 2LKZA 4KT0C 3IAM9 1UPMB 4GRSA 2JLGA 1M90T 3K5NA 5C24A 3DLGB 2RF2B 4O4GA 1Y0HA 1HLWA 1RT5A 4I7FA 5I4MA 1VC0A 4RW9A 4ES1A 3MEEA 1HPZB 3TNVA 4CH1A 5LMUJ 3AD7C 1MW7A 1WEZA 3DLBA 1R0BG 1JKHA 2ZBPA 3US5A 3MR3A 4DZ6A 3QZ8A 3NG8A 5ADZA 2GW8A 3ZZYA 2OPPB 3PEHA 3SZ2A 4C8KA 3DOKB 4WIQA 2ZITA 1Y3JA 3MM7A 3NCPA 5DDPC 2LEPA 4A46A 1RJJA 1HNWF 1RI7A 1U2CA 1HNZJ 4WFAQ 2A6OA 1VFJA 1WSVA 1WC4A 2HVHA 5BYRA 3SCLE 1RZMA 2G0CA 3HULA 4K5SA 4F0HA 2OEKA 3EZ5A 4CLYA 2I2YA 4ED4A 4C7QA 4KV8B 2V2KA 2YKNA 4F4WA 2HFUA 1JLCA 5AE3A 4EU0A 1N5VA 4DX5A 4CWBA 2ZHAA 1FHTA 3MUMP 2M9KA 3TAPA 1Q4RA 3M6UA 2J0QD 4C8YA 3MEDA 3W62A 3FKBA 3D67A 2PEHA 3E51A 1N56A 4DV1J 5CD4H 2XY6A 1VQ5S 2VL1A 3PW5A 3CEDA 1S1TA 2XBPA 2H5EA 4YN3B 4NEYA 2G0IA 5SUHA 3QAUA 4I68A 3BBBA 2FJBB 1JLEB 1OSCA 3C46A 3MOZA 1WC5A 4CI0B 5E2QA 1H2UX 2OD4A 4OZ1A 1HYSA 1GXUA 2VF3A 3QIPB 1N0VC 2M88A 4Y0FA 3IM8A 2IAJB 4TQSA 2DNMA 4NA3A 3LAMA 3UR0A 3KJFB 2E7XA 2BX6A 4DX8H 3J7A1 2BZ2A 5KFAA 5HQ8A 2FJAB 2ZOGA 1EKRA 4YB5A 3NKYA 2B4OA 4PKDB 3R27A 3L09A 1MMLA 5CCMA 4P52A 1RWMB 7FDRA 5I42B 1EARA 1XJWB 3QGIA 1VISA 1TKDA 2CNNB 3TJ8A 4K5RA 4OYXA 4J9VA 3TJ9A 4S0MA 2IM2A 1AYEA 2DNKA 3RGIA 2BBEA 2C28A 4MKAA 3L9ZA 3MM6B 2L48A 5J2NA 2HYIB 4HHHA 3AXKA 4V19J 1WI8A 1G4CA 2WRMA 1T3NA 2Y0BB 2P6SA 2D7SA 3T5JA 4IFYB 4ZPWR 3OL9A 5IC6B 1FNOA 1UZDA 2EKNA 4KKOB 1N34F 4XO0A 2QSWA 1P8GA 2GIQA 2IRXA 5F8MA 4H4MA 3DRSA 2VA2A 1CJTB 2Y9HA 5I3UB 2UU9J 2BEFA 3JYTA 2F4VJ 2QA1A 4LIWA 1SVDA 2DH9A 3WDOA 1DTQA 5CA5A 1M5SA 3DOMB 5FDLA 5C25B 1TL1B 4RWWA 3W66A 1RWXB 4O3NA 1DZ5A 1FFSB 4UOGA 5HVHA 4CO5A 1SC1B 2NPFA 4PG8A 1I5OB 2XGPA 1VLYA 1WKLA 1QAIA 2D9PA 3H98A 4AT1B 2XHCA 4QYZJ 5KTQA 3M6XA 1ELOA 5EDWA 3W2VB 2E5GA 3KWMA 1C0UB 2E1RA 5M2UA 2UUBF 5F8IA 3C6UA 1YJVA 4P6QA 3QPIA 1EJ7L 5GVQA 2WW8A 2B3TB 1RAIB 1IKWB 1I94J 3ZTQA 3D1OA 4DPTA 4DR3F 2OPSB 2RHSB 2I1RA 3H4BA 1E6YA 4USHA 4EUVA 1URNA 1YKWA 5HROB 2A6MA 3HK2A 2BANB 2DRAA 1PJ7A 1B7YB 4I1TA 4C0BA 2KL8A 4RW8B 1RU2A 3FBBA 2V0NA 3TUJC 1FO1A 1SIWB 2ILZA 3BQ2A 2ASYA 3OL8A 1W2IA 2RB7A 4QBUA 2BW7A 2LYVA 2DEJA 4C11A 2CJ9A 4C3MA 2NUUG 4JP8A 2R2TA 2RU9A 2QFIA 5IFMA 3DLGA 5FIIA 2RF2A 4AYBD 1VDHA 3EVOA 2C2DA 4OI4A 1OWXA 1HPZA 2XZDB 3DC2A 1O5JA 1FX2A 1R89A 3LTOA 2YBVA 3EM1A 4PPZA 4PQAA 2J7KA 1N4LA 2QLBB 4TN2A 2ZH4A 3M2UA 1RCXB 1WJ9A 4X2BA 4DV7J 5A8KB 2LQBA 3OXFA 3DOKA 1U6BA 1ZA1B 1GNKA 2KXNB 1IBMJ 2ROPA 1MSWD 2BYCA 5GAHI 4M63A 4JUZA 2C2RA 1NK6A 3R9LA 1RTHA 3OFHA 2YX7A 1ZA2B 1IBCB 1FVQA 1XR6A 2CQ3A 3CW2C 2AJ0A 2EG2A 2C42A 1RHUB 1AT1B 1VRQC 4A8XA 4P74A 4KV8A 1N5YB 4X66J 2B9WA 4KO0B 5K9FA 2Q79A 5EGYA 1HNIA 4M95A 1H3DA 2HLTA 2J0XA 1UVMA 4B9TA 4NLUA 4PG7A 2HRTA 4CLUA 3H8YA 4J90A 5JUMA 2RH3A 1T05B 2DR6A 1FI4A 1S9GB 4WU3A 1R8CA 2ZC4A 5GADU 5AT1B 3OL6A 4TVAB 1S6UA 4KGXB 2FLNA 1TFYA 2J8AA 4OJHA 3B4DA 2GQCA 3TEHB 2VOOA 4CIOA 1JLEA 4J9QA 4O44A 4FF1A 4ZJOA 5K14B 3FBFA 3G9CA 2RUGA 4FYYB 2OELA 2ZNZA 1IJFB 1KRPA 2IAJA 1U4BA 4RJVA 2BXJA 1VQSA 3MF5A 1IR0A 1RTIB 1U2RA 4NZ0A 4USIA 1ZZNA 3PY8A 1C1CA 3FMWA 4TXSA 4HKQA 4N56A 3OD2A 2Q66A 4UTGA 5DZ7A 2FY8A 4ZPAA 4GC7A 1QAXA 4LSLA 4RNNA 1WOOA 4CDIA 2R7XA 4J7CA 4DPWA 1PBAA 5IZHA 4BCAA 4EO8A 4UW2A 3UNGC 4IR1A 1VIOA 3QO9A 4N5SA 2W2MP 4DPOA 3MDFA 1RBLA 3W8GA 1UVIA 3GMGA 2YKOA 3SEOA 5SZTA 2BE9B 4CH0S 2D1CA 1LFWA 2HS4A 3CO0P 3MM6A 2VBZA 1FESA 3HHKA 1IQTA 1ZPWX 3K8VA 2AYGA 3KLFA 2HHTA 5IT0A 4A4JA 2FZGB 5JVHQ 1HWKA 1WTFA 4KKOA 1AUDA 2RT3A 1PYTA 1YITS 2C3UA 3DDNA 4K2JA 3DRXA 4N41A 4TU9A 3MFHA 3W5ZA 1JX4A 2HS3A 1H73A 5I3UA 3N9UC 3D54A 3CDEA 3OUYB 1FTCA 3D1HA 3M1VA 2PN6A 4EK2A 1KOOA 5HATA 1X5PA 3DOMA 4H54A 4KAIA 1TL1A 2BUNA 2QA4G 1HARA 2J8SA 3TVKA 3UCZP 3V81B 3T9ZA 5A6WA 3BJYA 2R8IA 4ZVRB 1IUJA 1NJIT 2BE2B 2C2NA 2P8IA 3MM9B 4KHMA 2XZWA 3M2VB 2EVZA 5FJ4A 2ZWPA 2BRLA 3T1AA 1V5VA 3PJWA 3MD3A 5F8NA 3OBIA 3TVZA 4DR2J 1N34J 2LU2A 2MQOA 2IY5B 2DPJA 3BSAA 3ZZUA 1UJ5A 3QIDA 3KG4A 2PMWA 2OPQB 1JLQA 4KPCA 4DS5A 4B9VA 3LA0A 1OPIA 3VVUA 2L41A 3KXDA 1IKWA 3M6WA 4RZRA 2M70A 2OPSA 3HJFA 1T03A 3P5TL 2QTWA 3FQLA 2FDNA 1S10A 2XS7A 1UW4A 5HROA 2Y1LB 1FXRA 4IFVB 2HQDA 3KNGA 4C9DA 4P75A 1S7HA 4E8UA 2HLUA 3P8BB 3JTOA 4BBYA 5B0GA 1FFWB 1DQAA 2WB4A 5F3ZA 2E1AA 4ERDA 2KM8C 2HBYB 4LR7A 1LXNA 3WC2A 3TUZC 4C6AA 1QJHA 1V3RA 2IVFB 4F7VA 1DRZA 2UUBJ 1NAQA 1GX6A 5I3PA 3V6HA 4N77A 4I67A 1QSYA 2Y1JA 1GTEA 4J9PA 2KG0A 4LIRA 5KFIA 4DL0C 3OHBA 4DL5A 3PV8A 2R7TA 3AAWB 4DV4F 5LSLA 3RRHA 1X5TA 3V2UC 3DRRB 1D9AA 3VAJA 1A9NB 5ITHA 4MK8A 1S1UB 2R9LA 2YWGA 4G1QB 4R25A 3ZTOA 3CJ8A 3I32A 4DX7A 1R27B 5A8KA 1QE1B 2KFYA 1Y7PA 4DG1B 3GILA 1Z2LA 4HVZA 3G2XA 4AD6A 2QMUB 5J1EB 1MU2A 2U2FA 5IT9U 1KVKA 1V3ZA 2Z4PA 2PFDA 4F3OA 2Z0GA 1RE1B 5H1SV 7AT1B 3UN2A 4NX9A 4WKRA 4ED1A 3MR7A 2UVWA 4AFFA 3KLEB 1DQ8A 1M5OC 1L3TA 2MQQA 3LGNA 3FCWA 3P5BP 3W60A 4HR2A 4JYAF 1HQEA 2D3OR 1OYEA 1R6YA 2EI5A 2QLFB 4KO0A 3DDIA 3LANA 2DIUA 2DGWA 1B70B 4HHUA 1F9FA 2AGPA 2ZKTA 3TAQA 4CT8A 4ZITA 2FZCB 4OMFG 4RU9A 5DO2A 1T05A 3TI0A 4ZVSB 4LBIA 3MFIA 4PG4A 1GAOA 1WEYA 1QUPA 2XMUA 1B3TA 3W1YC 1NK0A 1LW2B 2ILYA 2YNGB 3C19A 2DYAA 4WYLA 2B5JA 2CPEA 2V2VA 5K14A 3A13A 1WUUA 3BREA 2CG8A 5KT5A 5D78A 2AJ1A 4DUTA 2HAIA 1ICEB 1BQNA 4P7VA 2E44A 4FBTA 2FJEB 3HM9A 4DS4A 4C98A 4EI2A 4UQGA 3RBZA 5IT4A 3GIJA 4O3RA 1H2TZ 1HNVB 5T7LA 2AX1A 4ED7A 2JC0A 4C2MA 1F3FA 1WDTA 4UZCA 2R7WA 4ZK7M 1W7WA 3JSRA 5GMKa 5D4OA 3G6VA 1VK3A 4H4KC 3QLHA 3S1TA 3EX7B 3HXMA 4OHWA 2W8KA 3SDEA 3MUTP 1M0SA 2NYHA 5KG5A 1S77D 3GJQB 3PR5B 2RRAA 2RS2A 1J27A 3DXBA 1P9YA 1VBKA 3DRPB 3FQKA 2RRNA 1Q8LA 3WX8A 1Z1ZA 2B8PA 3B6BA 2ALZA 1JJ4A 1UEUA 3KHHA 5GAGI 2AWZA 2VDHA 2GVZB 1KWMA 2ZDOA 5LSOA 2FVSA 4LRDA 4G1IA 4TU7A 4BLGA 3GZ7A 4PG5A 2BRKA 5ETNA 1KFSA 2VFRA 4NLYA 2OJ3A 4EO6A 4CYUB 4JI0F 2GFFA 1WORA 1FJEB 3OUYA 3D28A 4ZP8A 3FJ2A 3MTKA 2YNFB 2QJ3A 3IAS9 3SIPB 2D3O1 1VI7A 1U1MA 5THWA 4Y2KA 4A8FA 3IBCB 1N0UA 1RHMB 2V69A 3V81A 4MKBA 2J9DE 2V4JB 2RDDA 2CQDA 4TQRA 4M5MA 2AEMA 2WZ1A 1YJNS 4PQUB 2Z56B 2GIRA 1G3OA 2KB2A 1RT4B 2BOPA 2HVDA 5FLXU 4M5KA 3NS6A 1PYSB 2VG6B 2XY7A 4YQWA 1TAQA 3Q83A 3W5XA 5KG2A 5DM6Q 4WK3A 2OPQA 1NHKL 2C22A 1YRTA 2Y8YA 5ETVA 2H5JB 3OFEA 4NLOA 3HPOA 1QY7A 1BQXA 3MMCB 4CLPA 3BO2A 4DCPB 4KFBB 2CRLA 2LQ8A 3IRWP 3G8QA 3RG6A 1MNEA 3TR5A 2GJIA 3NCRA 1CQNA 2H65B 3H7HB 3V6DB 4NXMJ 1PC4A 3MCSA 4DR6J 5CCLA 3AFGA 2DY1A 4JI1F 2P9GA 5CYQB 3BH6B 5KFFA 1J5EF 1ZETA 2ZH6A 1SI9A 3W3SA 2IPOB 4IQMA 3MUVP 4WIIA 2ZOMA 4IO9Q 4Q7AA 1HI1A 4ZN1A 4HT7A 4ZVOB 3FFIA 5K8PA 4U6PA 3F41A 2XYHB 2UXBF 5IQQA 4CTAB 4JI5F 3EWGA 2Q3PA 5CD4A 3ZZZA 3HSZA 2WBRA 4ED0A 4GKJF 1WHVA 3WZ0A 1BWVA 2XEXA 3JXOA 1QSSA 5LXRA 3DRRA 2HVIA 3CSKA 1S1UA 3PKMA 5B0FA 3OVSA 1N5SA 2ZKUA 4B9UA 1QE1A 2DNGA 4DG1A 4ZCLA 2XMVA 2CQ1A 1SC4B 5J1EA 2KT3A 2IJFA 1M1HA 1N6QA 2PMHA 2HRUA 4OLPA 2RKIB 4UT4A 3UD5A 1N5QA 3KLEA 4IOBA 1VYAA 3EUNA 3NBPA 3CCLS 2HQ3A 3M9MB 3GP9A 4DV2J 3CMES 1RAHB 5MAOA 4DV4J 4NXNF 4KR0B 1Q5YA 3D6FB 2LMIA 1FKOA 1IKXB 3OPKA 5HN0A 1VRTB 2PGCA 1FJCA 5C2GA 4Q44A 3PEJA 2EFQA 2FC9A 2AEFA 5B0DA 5ETLA 2RVJA 1RKJA 1VJQA 2V63A 2KI2A 3O3LA 2DY9A 5A6PA 1S79A 4NLWA 3MI7X 3QRRA 3WIUA 3DU6A 2XC9A 1DURA 3NS7B 2EFGA 2M2BA 4QIGA 2V50A 1B0PA 1RWKB 3FEXB 4DQIA 4RNOA 2XLIA 4OHVA 2YNGA 4L75A 2OMLA 1X4HA 2HKEA 3DNCA 1KQFB 2VH7A 1F5AA 3GU0A 4KHPF 5J2PB 4WZQA 1KONA 5B0CA 1LWFB 1HHSA 3RJMB 4WTOB 3R8YA 1KQKA 4LRCA 2FPHX 2Y1IA 5JXSA 1NZ8A 1KHVA 1F0XA 5G0RB 1FFGB 1IM6A 1K8AT 5F8LA 2V8DA 3K8WA 5DJBA 3PW2A 3T5HA 3V4IA 3KFWX 1HNVA 2V8GA 4LFBF 1IKVB 4QR2A 5L1IA 3HF5A 3LO3A 3JAMU 1F5CA 4LRFA 1SL0A 5ETSA 1VQLS 1RGVA 1RACB 3WQPA 3KKFA 1S0OA 3I5BA 2OEMA 3VHQA 1BLUA 3H20A 3OW2R 4B02A 1PAUB 3MHYA 3T1YF 4DUZJ 3KG0A 3K5MA 3CD5A 4OX9F 3OR2B 2QX0A 3AT1B 1LXJA 3VTIA 3MR6A 2N3LA 3TQ1A 4HLBA 1TMMA 1R8BA 3V6KA 3R2DJ 3B4MA 4Y28C 4OIXA 2E66A 3E01A 2UUTA 2HNYB 1NUEA 2JH3A 1SKRA 4MFBA 3NGTA 5L9NA 1TKZA 5HQLA 5FD1A 2R4FA 1QUVA 2HBRB 2PI4A 2Z2YB 3W8PA 3CC7S 3M8YA 1F6TA 2GVZA 2XMWA 4NCGB 2F8MA 2LLZA 1KFDA 4ANEA 1SJ3P 5A8RB 3V6JA 4XDDA 1MG7A 4ZKAA 1V9OA 4B17A 1UPPA 1HKAA 3HZEA 2UVRA 2B9XA 4CYUA 2X3GA 2V2QA 2VB6A 1U1LA 1H72C 1PKUA 2V94A 1R3NA 2GAHC 4OX8A 2ACYA 2YNFA 4DQRA 4ED6A 1MN7A 4LBPA 4DHVA 2XO6A 3MM8B 1V3SA 2KN4A 3ISNC 2RMLA 2V4JA 3KK1B 1PBUA 4CNYA 4ECQA 5J1PA 3OLBA 1FEHA 2HZCA 5K8MA 3V4MA 3HVWA 2QG9B 1WHWA 4OZ0A 1FTRA 2P9EA 4UUWA 1ZTTA 4LVOP 4X62J 4NLPA 4PQUA 4O23A 4LFCF 3BGLA 1RT4A 1SJFA 4URSA 4DQSA 4B3OB 1Q7LB 1Y10A 2QGFB 2Z57B 4KBIA 3HZGA 1YWXA 3AOBA 4IH5A 3R1LA 2DCUB 2X3DA 1X4DA 2MB0B 4N7TA 4A8QA 4YY3J 1YRXA 5CZXA 1REVB 4I2PB 4KFBA 3EDRB 3KJVB 1OYDA 1H2VZ 2X1GA 1YBUA 2J0WA 2QN6B 2I0XA 3V6DA 4Q43A 2DBBA 4KGVB 4OYZA 4HHJA 3LWLA 3IRXA 1WOPA 4DFJA 1T9XA 5CYQA 4ZLPA 1K1QA 4P2SA 3E3XA 4FF3A 4PXBA 4ZVTB 2G13A 4FXVA 2E1PA 1GT8A 4MIAA 2AZ1A 2EBGA 2CAJA 2W9BA 2F9JA 3OR1B 5ETQA 2GGPA 5HVFA 3W2WB 3CGIA 2KO1A 3ZC4A 2UP1A 5IWAF 4ZLNA 2DCLA 3H2LA 2LP4A 1R7IA 5AJ3F 1Q95G 1BQMB 4EYHB 4DR1F 6AT1B 4USMA 4QU6A 2MZQA 1S4EA 2E7WA 2KJWA 1RP5A 4JI1J 2OSRA 2NREA 1S1XB 3C6TB 3DGPB 2G2ZA 1X60A 5A8WB 2HWTA 2NLWA 2YNHB 1U25A 2H1YA 1V5IB 3DXSX 5L46A 3K7RA 1IJEB 5GAGU 5A0YB 7FD1A 1X4GA 2CPDA 3QFHA 3BGFA 3OSPA 1HR0F 2IYIA 3M7VA 3F44A 2M5YA 2UXBJ 3H4DA 1M5VC 4JI5J 1HQUB 4K0KF 3CIZA 3FC9A 1GXTA 3QT5A 3RR7A 3IA0A 4GKJJ 4RX6A 1X5SA 3P4UB 5KFNA 1HBMB 2UZAA 2CPFA 1IKXA 2OIHA 4O3SA 4URGA 2IRYA 3HO1A 4ILMA 3A8KA 4MJKA 4B9SA 1UA1A 1N32J 2VZ9A 2E7VA 1JXVA 4J9RA 3PO4A 4USTA 4ZVGA 3JQMA 4M1KA 3G96A 3NRBA 1KP6A 3UFCX 1X4CA 1RBOB 2GNKA 2CPXA 4W98A 2FHJD 3D68A 4OI0A 3THVA 4FNHA 1NKCA 3VQSA 2NXNA 1UKUA 3FNNA 1OS5A 2PI5A 5J2PA 4RBTA 4DPUA 3C8YA 1LWFA 2I6WA 3EGZA 2E9TA 1IBKF 3KLIA 3N0VA 4A8SA 2ZM6J 1CBKA 1C1BA 3ENWA 3SCIE 5KFHA 1CJUB 4USJC 3UDEA 1R0AB 5L9XA 3MMJA 1UZHA 3K59A 5JVGQ 4ED5A 1IKVA 2B6AA 3BF4A 3A3PB 2KRBA 3MECA 2VC1A 2Y1RI 4EBDA 2XY5A 1O8BA 2MKKA 4X4UA 2DHGA 2VPYB 5MLCV 2VJVA 2I5JA 2KT2A 3OR2A 1H6KX 1TP7A 2D74B 2HS0A 3X3UA 3Q8UA 3HKWA 4L72B 4V19X 2YQ3A 3N4WA 4LR9A 3KOAA 4B3RJ 3R2CJ 1RUSA 2Q6CA 1BE4A 3T19A 4RNMA 2R7RA 3HHNB 2ROEA 1B0TA 2BJ7A 4Y3CA 2CJQA 3PRDA 2XYPB 3T1HJ 4NCGA 2XNQA 2H5IB 3KHGA 2CZVC 5A8RA 3SMZA 1S49A 1AXQA 4QOTA 1SQFA 3R5GA 4MTPA 3KMQA 2W9CA 1DBDA 3NGSA 3HVRA 2OP5A 4Y2CA 4L3KA 1JLBB 2YWWA 1X4EA 3BKUA 1RHKB 1QVGR 3G4SS 1R6VA 1SPBP 4ZP6A 1X4AA 4Q8EA 4F4KA 4OYOA 2NXCA 1KTVA 4R8UB 4Y00A 4ES3A 2J0SD 3LF0A 1RTDB 3OFGA 2JX2A 3MM8A 4YDDB 3SSQA 2AJ4A 5EWEA 4R0EA 1U1NA 5HVGA 3KK1A 3FMBA 1RISA 3BPSP 3PRVA 3W63A 2XSJB 1FXDA 1S6PB 2DKOB 2AIRB 3IM9A 3Q8PB 2J9CA 3IR6B 4B3OA 4DN0A 1PGZA 3IXQA 3SFUA 3LP0A 1KHWA 1DJ0A 5C5JA 5E3PA 3RU0A 1DTTB 2ZFHA 1TK8A 3IWLA 3P96A 4TY8B 3AOCA 1K1SA 1K0TA 3BBFA 3GIMA 4RUBA 4KHRA 2E5HA 1UW9A 1RAGB 1O6XA 4I2PA 1NRKA 1TVRB 3KJVA 3PX4A 4J5OA 3FK4A 2A10A 1HIYA 2MJUA 2OLWA 3SI8A 5DLFA 4N76A 4Y2MA 5L1KA 3T3FA 2FY1A 3MMAB 4HT5A 2ROGA 1X9WA 2HFVA 2CXEA 1X0FA 1REGX 4F25A 3CJKB 1ZM4A 2PT0A 2UXCF 2YPYA 3C15A 4QWBA 1S7IA 2OTLS 4U8YA 5LMUF 4Q2MA 2ZVSA 3LPYA 1RWUA 1FE0A 4D3HA 1RA6A 3I55S 1GK8A 3D0HE 2QL9B 3IGNA 2P9CA 1SKSA 1VQ6S 3GFHA 2YXLA 2CNLB 4RW6B 3HX9A 1WC1A 1W25A 3PACA 1S1XA 3HVAA 2ZBRA 2ZEJA 1T8EA 3K0JA 1S1VB 5IXUA 3BB5A 3D0IE 1HNZF 3DDKA 1HWJA 2KU7A 5A0YA 1OJ4A 1HI8A 1FNXH 1YZ6A 3CE8A 1SQGA 2N4DA 3UVJA 5HQMA 2CA9A 3KHRA 5IWAJ 3R1HA 2AGQA 4M5DB 3U7JA 2J76E 2QO3A 1NH8A 1NHVA 4DR1J 1XMQJ 2BA9A 3M32B 3HHLB 2OD6A 4NLDA 3K89A 2IBKA 1FJGF 3TARA 3KDNA 2FVQA 1Y5LB 4DV1F 5HO4A 2CUYA 1WKKA 3KUEA 5KT7A 3QFWA 5C2CA 2FHOB 1S9FA 4OJ3A 3BPDA 3W9HA 1SXLA 3I4PA 2NPIA 2G2OA 3PX6A 1SH3A 3LGHA 1UTAA 4PWDA 4PPDA 4F3QA 2RNEA 1PILA 1EIYB 5KT2A 4WP8A 5B08A 4YEAA 2K06A 1SJRA 2VG5B 4K0KJ 4C3KA 2QL5B 3CDBA 2EBEA 2ZE2B 1WI6A 3HFZB 5E7OB 3DYAA 4DR7F 3RB4A 2YKPA 3R5JB 4DV0J 2FHJA 2WVBA 4YFUA 4B3SF 4AL6A 4BWJA 3KHLA 2O1PA 1CULA 5E3AA 4CO0A 2EFOA 3AD8C 4HEA9 1ZPVA 1GXLA 5H9FJ 4F04B 1A6LA 1XTZA 4TU8A 4DWIA 1IR2A 2K3KA 3KK3A 1OY8A 1JB0C 5KFKA 4LF6F 3PX0A 3FEYB 1R8PA 2H3EB 4IOAQ 1NBEB 3O44A 4ZLJA 5DQHA 2KXHA 3BKFA 3OV7A 1NKEA 3TX8A 1HWIA 4TY9A 5BR8J 1VOMA 4KC5A 2IVYA 4KY3A 4ATNA 3SQGB 4ECUA 2MDAA 3NY0A 3VZIA 4DN9A 3NMAA 4IG3B 4PAAA 5KFXA 3UO0A 5L38A 1SCJB 5KFCA 5HLFB 2UU9F 2YH1A 1YBAA 2A0FB 4JI6J 3DGVA 1VQKS 4HDHA 4GKKF 4Z37A 3FDSA 3GYXB 4DR4F 1GMWA 3DHXA 1FERA 1L3UA 4X64J 3MOJB 4R8UA 2LVWA 2KYZA 1SV5B 1YJUA 4OZLA 2POKA 2KG1A 3CD6S 4ES2A 3OTCA 1T95A 1ULRA 2XCAA 4MIBA 2R2RA 5EUHA 2ATLA 3CULA 5H9FK 2XS5A 2DNLA 5B0EA 2C2MB 4R0JA 3C2PA 2XSJA 1VRUB 1JNZB 3DCAA 1NPRA 5D0EA 1RTJA 3NS5A 1I94F 3GIIA 3TUPA 4ECWA 1JLGB 2W2QP 5CYJA 1TKTA 4Q2LA 1SJ4P 1GFWB 4TY8A 1VBYA 3W64A 4GO5X 2EEYA 4ZVQB 2VV5A 1I1GA 1CVJA 5GADI 3RUBL 1TVRA 4FS2A 5DZ6A 1G2EA 3OLAA 3NNCA 1TL7B 4RW4A 2XWXA 1YRUA 2R8KA 2IMOA 1XMBA 1RAJA 1RCOB 3M8PB 4UY85 3X1LB 2JVOA 3MMAA 4K4ZA 4U7UD 2ZUAA 4OYMA 5EX0A 5HJYA 2ZHOA 4DMZA 1CC7A 1T9UA 2HWIA 1U48A 1H98A 2X1AA 1EAYC 2RS8A 3JQJA 2OH2A 3VV2B 2HVEA 2YTCA 4MIWA 2XI2A 4K4XA 3QSYB 3EGVA 4OL8A 3RBXA 1WF1A 4NOHA 3GFYA 3R3TA 3FRYA 2OAUA 3CIMA 4DLEA 1WD6A 1A0OB 4U96A 4DV7F 1NEEA 4WP3A 1PJ6A 3Q8SB 5KFGA 3K5PA 1YX2A 3PW7A 2EFNA 4H4KA 4XIUA 4RWXA 1NJWA 1Z2ZA 4WTYA 2J5AA 1S1VA 2VUGA 2HFZA 5F8HA 3Q0AA 2L9DA 4J9OA 2AX0A 2V4RA 4Y6IA 5LT5A 4R5PB 3QGHA 2ZHBA 4DSLA 3A4TA 2UXCJ 1Q5VA 4YB6A 4JV5J 3KMSA 2R7UA 4C0OC 5LOQA 1ZAWA 2XQCA 2DHXA 2HRYA 4X66F 2H4YB 1R31A 4M5DA 3NAIA 3UCUP 2V9WA 4DF8A 4GMKA 2J9DA 5BYQA 1XMOJ 3M32A 2RQMA 5DLGA 4F2RA 3ISND 4DSFA 1LOUA 4LF9F 4X4VA 3GR0A 3GYGA 2IMWP 3H5YA 1FF2A 1MN9A 6FD1A 1FDDA 2QC3A 3CCQS 1R8AA 3W5YA 5J2QB 1C4CA 3I0SB 1RYRA 2VDIA 4LF4F 3CCWA 3BEGB 3KUGA 4QW9A 4HH0A 2L9WA 2MMYA 5KFYA 4OZNA 5HMZA 1PAEX 2K8GA 4LF8F 5KOWA 3UW1A 4AL5A 2AJFE 4I6AA 3BR8A 3PFEA 2VG5A 3THPA 1CG2A 2E5LJ 1FDNA 3L3CA 2VHGA 4OI1A 1T3OA 2ZE2A 2QA4S 1U1RA 1FJGJ 2DHAA 2MZSA 2VASA 4CO4A 4EBCA 2WVEA 3BSOA 1KC8T 2EK6A 1BMQB 3TANA 3J80Y 2BJ9A 5E3RA 1NK8A 4B3TF 3QQCD 4B9MA 2HPUA 5ETMA 1HI0P 4C8ZA 1KNZA 3W9JA 3BSNA 5M2PA 2F40A 2FLLA 2B4PA 3J80U 3TEGA 3ULHA 3VGSA 1FEEA 3N79A 2AP6A 2DB1A 1LWXA 2RUSA 1D8ZA 4ETXA 4B3MJ 3CJSA 1S6QB 2N82B 3LUYA 4O0NA 1C4AA 1VS3A 2YVSA 5LJ3Y 2F8EX 3RYLA 2IM3A 1LWCB 2ALYB 4O3OA 2DGQA 1K0VA 2VONA 3CPWR 4TYBA 4ECVA 2J6UA 3MZIA 1BUXA 1PO6A 3WIVA 2DGXA 1J5OA 4JV0A 1LK7A 3OTDA 5K20B 4ZVFA 3LAKA 2VG7B 4DR7J 4MK7A 4YHHJ 3GFXA 2YX4A 3DM2B 3QSIA 3SQGA 2CG4A 4IG3A 5KG6A 1NHUA 2B8QA 4TLRA 4WXOA 1SKWA 4B3SJ 5KT6A 1H7WA 3SSRA 2GHWA 1KOHA 3JSMB 4J9KA 2BKNA 4A47A 1V6HA 1QVFR 4DU8A 2JHEA 2H4WB 2GVDA 3NGUA 4C97A 1WC0A 2KVIA 3SQOP 4LF6J 4Y2IA 4FXDA 3GSDA 3KDOA 3T5KA 1SV5A 4NASA 2OFHX 3QMQA 3NLCA 3ICLA 3GV7B 4PR6A 2DNYA 2MQ8A 3G86A 3P3DA 4NA2A 1TV6A 2LXUA 3QGGA 4P72A 4H4OB 3OTEA 4B9LA 2GS8A 1RLDA 2CDRB 2JSXA 4K8RA 3W7BA 5BJRA 4WE1B 3DFEA 4P2FA 3TYTA 4C8LA 4DR2F 4Q8FA 3VF0B 2VU5A 3I31A 4F4XA 1RAEB 4QQBA 4EYIB 5A2QY 1I51B 5D4LA 2BM1A 3SV3A 3D4JA 5LMNF 4IRKA 1VRUA 1CJKA 3MAAB 1NKBA 3MPDA 2O01C 3POTB 4USVA 3SV4A 3EJMA 2BR0A 1UJ4A 1HD1A 3MMBB 4FXWA 2DNQA 4GKKJ 4PYDA 3EPGA 2OMOA 3NWGA 4DR4J 3JQKA 4QR1A 4RBVA 1NSQA 5D15A 1S99A 1HL6A 2JC1A 1HBOA 2DHSA 4ID5A 2FVPA 5RUBA 4YDXA 4WK1A 4ZP9A 4N47A 1X31C 1FRHA 3C16B 2IFXA 4LT6A 3G82B 3DI6A 4FYVB 3T41A 1S12A 3DLEB 3M8PA 2MHNA 3PIOQ 5HP1B 1XR5A 4NLQA 1RK8A 3DOLA 2W1BA 3LH2S 3BSCA 2PIIA 2C2KB 3G6ES 3DLKA 3N6MA 2F7VA 3DLJA 3BGRB 3M2RB 5J1NA 1LQ9A 3UE2A 1YVFA 3RB3A 1NK7A 3CMQA 4LFAJ 5AXLA 3TQEA 3Q23A 4BS2A 2GHPA 4LSZB 1C0TB 1NXIA 1HBUB 2A2DA 1QTMA 1XNQF 5LJ5Y 5E0OA 3KUHA 5D4PA 2CQBA 1TK5A 4YR3A 2AW0A 1NZAA 3ELHA 2HK3A 4J91A 2ABYA 5E33A 3UD3P 2G4BA 4WFZA 2DR8A 1ACMB 1EX8A 2CWXA 4R5PA 1NJZA 4M5HA 3FVYA 1Z4UA 4ZVHA 2XLJA 3MD1A 1CSJA 2CPYA 2OPRB 4QYZK 2R7OA 1HNXF 3A8JA 2B56A 3FEZA 2WVDA 2OI2A 4L3NA 4ALZA 1YIJS 4KGMA 3S8SA 1E6VB 2ZH8A 3J7ZT 2LECA 4NLXA 1N88A 3BDPA 1U0HB 2JFKA 3PXGa 1U6ZA 1SL1A 2OPPA 2MY7A 2K7JA 1UVKA 1EQMA 5CQGA 3LWMA 4P9SA 3FRZA 3VAGA 3VR1A 3GJTB 1TR0A 5KFMA 1U26A 1U1KA 3I0SA 4HDGA 2X51A 2VD3A 2W01A 2DH8A 1AUSL 4LBHA 1IWGA 4C8NA 2FJWA 1TFWA 4OYPA 1T7PA 3AY0A 3ZTPA 5HMYA 1RT2B 4IDKB 1P1LA 2ZZNA 1R0CB 1PIEA 2PEBA 2YQ1A 2VC0A 2NQPA 4LJMA 4UOCA 2Q6BA 3T6JA 1WTBA 2A3JA 2GHVC 3VALA 2MQMA 5KT4A 4WWSA 4LF9J 4NMXA 1SC6A 1AROP 3V5RA 4DDFA 3PHTA 2MGZB 2HHUA 1CPZA 2O66A 2NS1B 4L6V3 4LF4J 4EGLA 2GQQA 5CH7B 4W90B 4LF2A 1K47A 2YNIB 3AOAA 1MROB 2BQ3A 3PYFA 1TUGB 4K4UA 1WEXA 4L73A 3ZXWA 3MR2A 1NK9A 3PDNA 3QIPA 4KH0B 5E3CA 4LF8J 2EXUA 3D3BJ 2HQCA 5C24B 1N33F 3S01A 4WFXA 2HHSA 2F9DA 4O4GB 2CQGA 4TLQA 1RT5B 1B64A 4I7FB 4U8VA 3Q8VA 3MEEB 2PDAA 3QT8A 2DRBA 4QCLA 2HHXA 1MMDA 3DM2A 5B09A 4B3TJ 1JKHB 2WSFC 4KYZA 4JI3J 4U67Q 1U1OA 4WF9Q 1VGYA 2VFVA 5I42A 5DG8A 4HACB 3JSMA 2WSEC 4FKXA 1KVIA 3MAHA 4J9UE 1DLOB 3CO9A 2CADA 3MM7B 3M8RA 4WFNQ 1CLFA 3UDCA 4QU7A 2RE1A 1UP1A 2BMBA 4I0WA 2IYGA 5IOLA 3D2WA 4OYAA 2HGLA 3O8WA 4Z7YA 3G6XA 4WFYA 3GV5B 4H4OA 2NUHA 4FDFA 4WE1A 4UZBA 4IFYA 2DHHA 4QW8A 2MEWA 1JLCB 4F3MA 1NDPA 1CJTA 2UUAF 3MEDB 3GB0A 3CC2S 3MAAA 1VBXA 4OYIA 3POTA 5J2MB 3R7BB 3VAIA 5C25A 2ZD1B 2MQPA 1IN0A 2J6TA 5KG3A 4PXDA 3FSIA 2B0GA 2MHEA 1S1TB 1HFEL 5DETA 1FDBA 1Y11A 1FX4A 4NXMF 4DR6F 2CPHA 5EHHA 3M8ZA 2IBOA 1GMUA 2HURA 4ZPDA 3PW0A 3T6BA 3WHIA 3SYZA 1TL4A 2AYMA 1SL2A 4O0IA 2KZMA 1HA1A 3W2VA 2ZC3A 3DLEA 4DJBA 2CQPA 4AL7A 3H90A 3L4BC 4U9RA 1C0UA 3TVYA 5LMNJ 4DV6F 2WOMB 5HP1A 4ZVPB 1X8DA 1JJCB 1DFDA 1VQ9S 4BC7A 3KK2B 2F8HA 1VQYA 4WU2A 2MXYA 4DL7A 3ET6B 3RB0A 1F9HA 2MYFA 4XPCA 2XMKA 2V68A 1IKYB 4DL6A 3BGRA 2E5JA 3M2RA 2W9AA 1Q82T 3IBWA 1FD2A 1GMVA 3KNAA 2BANA 4OZ5A 3ZO7A 4WFBQ 2NXEA 1C0TA 5KFSA 4RW8A 1HBUA 5DRKA 1FRKA 2VBWA 1MMNA 3AA8A 4BWMA 2MQLA 4ED8A 5HI7A 3EGNA 2WBMA 4ICLB 1UA0A 1ZAVA 1AZSB 5CHCB 3BQ1A 1S57A 2AZ3A 3FSXA 3A3NB 3JSBA 3TZYA 2BKOA 3R6LB 3WBZA 4IR9A 2APOA 3PIPQ 3MTJA 4GVLA 4DSIA 2OPRA 4DV2F 2G2YA 1JXEA 1TK0A 4QPXA 4H4MB 3VVTA 4RUAA 1VJWA 1WG1A 3VGUA 2CIMA 1SJQA 4CLLA 2OKQA 1XNQJ 3TX0A 2WSCC 4IKAA 3MCOA 2GZOA 4MYTA 4IQXA 2WHOA 1HHTP 3GIRA 3ETMA 4JBCA 2FTRA 4ILLA 2MKSA 3NOCA 2GC8A 2QLWA 4RKUC 2VBXA 5JMNA 2ZJQQ 2W2PP 3U1LA 1IWAA 4JOUA 2UVUA 4QWEA 1HNXJ 4F4ZA 1XK8A 1RT2A 1N5YA 4F36A 3CB4A 3C6UB 2M8DB 1RBAA 5KG4A 2P6TA 4NRTA 3D6TB 4CO1A 5F9LA 5HANA 4PWUA 1I6JA 3QT7A 4USUA 1HMVB 4E98A 3BGOP 4JI2J 4NCAA 2HFOA 3N5FA 1S9GA 1UWAA 2EFPA 1RLCL 1X4FA 1RABB 2FZKB 4QYRA 3HHDA 1GH8A 1FRXA 4ANCA 1I3OB 4DUZF 1EZZB 4DV5J 1SH2A 2KH9A 1NK4A 3NGKA 2YNIA 4IH7A 2VPWB 4C4WA 2I8EA 2JEIA 3RRKA 4AQYF 4C3LA 2VQEF 3CJ5A 1U09A 1M1KT 2EC2A 2PFFB 1RTIA 5L8RC 2ZZMA 2FIUA 1XEZA 1SBRA 3DLHA 3PYEA 3FBCA 2DGVA 2AT1B 2M8HA 3ZFVA 3M2UB 3D66A 4HACA 4I2QB 1XIQA 5D0HA 2UUWA 4CLFA 1H74A 1FWKA 4DCOB 2DGUA 1DLOA 4PG6A 1SKUB 1U47A 5D4NA 4DXLA 3I56S 4JB8B 1WELA 2XMMA 2Y8WA 1D8YA 5IQ6A 2RDJA 5B0AA 1RTHB 4EWTA 1N33J 2RD5C 1AB8A 3ZZRA 1M1GA 3CJTA 4X62F 3KYLA 5C7PA 3HHLC 4FBUA 3R6GB 3A8IA 1JK9B 2XCPA 3OXGA 1X4BA 1HNIB 5AXNA 4G6VB 4ZVEA 3I96A 2CDQA 4LF7J 2F3JA 2B7CB 2KHCA 1YI2S 4LRAA 1PYOB 4YY3F 5J2MA 2HNZB 3EPIA 4HL9A 3GJSB 5IS2A 1Y4ZB 2ZD1A 5E3QA 2WAQD 4LR8A 1G7CB 3IC1A 4OLOA 1T02A 2BE2A 3MM9A 3IG1B 4WPAA 3F56A 3M2VA 4M5LA 1FVSA 1KS2A 1X9SA 4ZJQA 1DHMA 4WYWA 1M5KC 4O44B 2E9RX 3I5AA 3DRYA 1ZYQA 4F8RA 2YPZA 2HHHJ 3D6HB 3MXHP 1JJHA 2OUGA 2FYXA 2DIVA 3BO3A 3ZZTA 4DL2A 2W4PA 2ZNYA 4WP9A 2UUAJ 2WOMA 3QRPA 3QZ7A 4ECRA 4DX6A 3KK2A 3H25A 2KRRA 1C1CB 1ZH5A 3ET6A 2W8LA 5DGBA 2HHWA 2Z2LA 2VQFF 2V34A 3BBCA 1FKPB 4CO3A 1IKYA 4PWWA 5DGAA 3E2EA 4LSLB 2FJVA 4I4BA 4IFVA 4LVNP 3H42A 3HFVA 2ZWOA 4ENOA 2AJQA 2HSEB 1YHQS 1WHXA 3IS9B 3TWZA 2DXFA 2G0JA 3QO9B 4OI3A 1IBLF 3CDWA 3OXLA 4X4NA 4O4RA 1U0SA 4IO1A 4ZA1A 3R97A 1UVLA 3M8QB 4QR0A 4HI1A 1VQ4S 2IIHA 2JNJA 4ICLA 2IVMA 2WVFA 1AZSA 3LQVA 4DV6J 1AFIA 3BO4A 3GV8B 1NLKL 2JEGA 1VC5A 1JQGA 2HBQB 4LRBA 2MKYA 1RAAB 2WK4A 3I82A 5EN1A 3NMRA 3KLFB 1KLNA 2FLOA 4FNIA 4C8OA 1VHFA 3R7NB 1TMJA 9ATCB 1QD1A 4TNOA 3GWCA 4LQ9A 2UV8G 1NJXA 2KHDA 2ZBIA 4X65J 2GX8A 3ENQA 2B4UA 2VIHA 2RQCA 2YH0A 2CJXB 1NH7A 2R3VA 4FF2A 3BN7A 4G1QA 4WJBA 3M1VB 1N32F 4RW7B 4URQU 4LF5J 2JVRA 2MTLA 2E9ZA 1KBRA 2GA7A 1DY3A 4ZOSA 3FZ2A 2CQ0A 4KTQA 4RO0A 2DNRA 4DZDA 3GR1A 3GIKA 5BYSA 1XBWA 2DNPA 4ITSA 3BM7A 2YWFA 2RQKA 4GVBB 2CJAA 4RL1A 1LNQA 1ZM2A 1IM4A 1BGXT 3EDQB 3NWRA 2DT9A 2VPZB 2B4VA 1D9FA 2ZM6F 4JI8F 4Z2XA 3CJ0A 3FSYA 1JLQB 4OI6A 4DFPA 4K4SA 2ATCB 1XNRF 5IV4A 5K5MA 1HMVA 3QATA 1T03B 2MPUA 2HGNA 4NZ6A 4A8MP 2OHDA 2MKIA 2XMJA 1RHRB 3ENVA 4TKTA 2L3MA 2NZCA 5IV3A 2DGTA 3ILOA 3BZQA 4P7TA 1WC6A 3UPFA 4DL3A 4CRJA 1LW2A 2DO4A 2XS2A 3MCMA 1Q78A 3J7AN 1NCLA 3U02A 1FCAA 4EBEA 2F5GA 4HH1A 3CMAS 1JNRB 4DSEA 4B3RF 3B78A 2CWKA 1FJ7A 2CYYA 2ZH3A 1RWVB 2ZOFA 3BQ0A 4NYZA 1ZM3A 2R2SA 3T1HF 2HAFA 2AYEA 5ETOA 3JS9A 4NLRA 5HJXA 3BGUA 1B99A 5GAEI 3B8HA 1U6FA 4CQ1A 5A76A 1RT7B 2NYIA 3HI9A 5L1LA 2QYCA 2D3UA 2M52A 4ECYA 1RWOB 4DPYA 5EX3A 4KPYA 3MEGB 4I2QA 4M5IA 4X4SA 2LFVA 3NEKA 2ZUGA 3PO5A 2ZBCA 3QYYA 4QZVB 5E5NA 5HBMB 4AQYJ 1MU2B 5DDOC 3CCRS 2YX1A 2VQEJ 2P2CB 2PSZA 3ITHB 1N36F 2F1FA 3RAMA 4YUDA 1RHQB 3DRPA 3UN5A 2XGQA 2DXEA 1WF0A 3AH6A 4DUYF 2YKAA 2HFNA 4K2XA 5CZVA 2OO4A 1YJRA 3RAQA 3U1NA 3N6NA 1NB7A 3BN4A 4PZVA 1HQEB 5IM0B 1N5TA 4K4VA 2R8JA 4HTIA 2IA0A 2WW4A 2DEIA 4QWAA 2R2UA 2R7QA 1FDAA 3LALA 3AODA 4IYQA 2D3ZA 1MWQA 2DVIA 2C3OA 2HNZA 1TL3B 3H5SA 1RYSA 2XO7A 1H38A 1IR1A 3PR4A 1NMEB 1HNWJ 8RUCA 3TOQA 5DDQC 3IG1A 4ZCKA 1M5PC 3P49B 1NSPA 1QTNB 4OZ3A 2M4MA 2B5JB 2PO4A 2XYGB 5KOXA 4QPTA 5B0BA 3M4XA 1TELA 2FC8A 3SBMA 2W2NP 3C66A 1BQNB 2VJUA 2QMWA 4XPEA 2VG6A 1RU1A 4ZHRB 2HW3A 2BW2A 5HL7Q 1OQ3A 2LEAA 3SFGA 1GQEA 4FYXB 5T7LB 1P6TA 3HD1A 4JV2A 2HWHA 1FKPA 3MMCA 2DPIA 4NLSA 2ZDPA 2KTQA 1CC8A 1YJTA 2VPXB 4M94A 2X1BA 2Y0SD 3QLHB 2WTFA 4I69A 1W26A 4UQTA 3IS9A 3SDEB 1JLFB 3IWXA 3Q2TC 5I3QA 1RXOB 1WDDA 1YJ7A 3T9NA 3LP2B 3GFZA 3EXCX 2VKZG 1UETA 2HHVA 3E8OA 2JDJA 1W2BR 4NMLA 3M8QA 1UMJA 4NWBA 1QLNA 1URRA 4IUFA 4ZCMA 4ZPVR 1VQOS 1UFLA 3H2UB 3OJSA 3IO1A 4CTAA 2VQFJ 3PFOA 8ATCB 5F3TA 3PVXA 1XMQF 1SQEA 2R7SA 4CM0A 5G4DA 1RSCA 3TZZA 3HKZD 3EE3A 3SXLA 1F3VA 3PTWA 2XLKA 2YWEA 4PRFA 4ER8A 1PG5B 2Z58B 4RW7A 2GO8A 4PEOA 3VCDA 2AV5A 1IBLJ 1VQNS 2YKMB 2YQ0A 3CF5Q 5ETTA 2CJYB 1JMTA 5T14A 5HAOA 4V1Ak 4NE9C 3VAMA 2IRUA 1EQ0A 3CVKA 2EKYA 3H0PA 1NSAA 1IVZA 4GVBA 4CLWA 2J9EA 1U45A 4K59A 2RKIA 1YK9A 2QA2A 2D69A 4J9LA 2BE7D 1EETB 4DSKA 1YQHA 2D41A 3CC4S 4CLKA 2NZ4A 1PJ5A 3TJAA 4USKA 3HVTB 5HSPA 4HTJA 2FB0A 1VRTA 1IXKA 4OYBA 4DV0F 4K7QA 3IWNC 2NSCA 4RNFA 3A1YG 1XERA 4N8OA 3MPVA 2HNDB 1KN6A 3BV8A 2RHQB 2GCFA 4G65A 3PG9A 5U47A 2K7KA 5CAAA 1LV5A 4MKYA 1Q0NA 3NNAA 1YG0A 1WWHA 1UFKA 3OVBA 2MZRA 2V6AA 1LWEB 2MLXA 2HG4A 3UR3C 3RBEA 1P1TA 4FKYA 4JI4F 5IC4B 3KG1A 2VODA 3RTVA 2PE8A 3AXMA 1JJ2R 1P27B 4FVMA 4M8LA 2V4QA 2XWYA 5F8JA 3VWSA 3M8SA 3S7RA 1JXLA 2GMLA 3FFIB 4JI8J 5BR8F 1L5UA 2DTJA 2RILA 4KE5A 2CQ4A 1XNRJ 5G0RA 3R5AA 4N8NA 3ILLA 1L3KA 4DR3J 3ILIA 3MPUB 3RW7A 3I5CA 2YY3A 1MWZA 1P9QC 2QLJB 4JI6F 1B4SA 2YWHA 2Z8QA 1RT7A 2G1HA 5KFTA 2RU3A 3IMQJ 1PSDA 3MEGA 5IT9Y 3LW5C 1NDCA 3CWJA 4X64F 3O2IA 4U7UK 5GMDA 4RBUA 5HBMA 1NDKA 4ELVA 2HNYA 3PJ9A 2KFZA 1GMWD 3ITHA 1RAFB 2QMXA 1N6QB 2LA4A 3CT9A 2C1EB 2XSFA 2HIYA 4DI6A 2DNZA 2MKCA 3NBPB 2IHR1 3CCZA 2QLXA 3TZXA 1GTHA 5IM0A 5AXKA 3A3OB 5BXIA 1FKOB 3TUIC 3J7Z5 1APSA 1KVJA 3SSSA 1VMBA 4RR5A 3C14B 4ZLLA 1OMSA 4UF4A 2X7IA 5B7WA 1KQSR 4K50A 1Q7YT 1TL3A 1XC9A 4MAKA 3HP6A 3RR8A 3GSIA 4IOCQ 3DKDA 6FDRA 3DMJB 2QIFA 1N36J 4O3QA 5EWGA 4DFMA 4DUYJ
chains in the Genus database with same CATH topology
3J7ZT 4Y28C 2LECA 2LU1A 3GE9A 4WXWA 1NJYA 4NLXA 4OIXA 1X9MA 1QSLA 1FKAF 4EZ6A 2E66A 3E01A 2VFUA 1N88A 2HNYB 2UUTA 2JH3A 2MGZA 1SKRA 2UVVA 4MFBA 3BDPA 4OX6A 3P6YC 5L9NA 3R5CA 1TKZA 2JFKA 3PXGa 4UY8T 1U6ZA 5FD1A 1SL1A 2OPPA 2MY7A 3MEKA 2R4FA 2K7JA 1UVKA 2ZH9A 5CQGA 3LWMA 1QUVA 2CJKA 2FGOA 3CCSS 2PI4A 3CC7S 1VIXA 3FRZA 3RBDA 5K8OA 2XMWA 3VAGA 4ZHRA 4NCGB 1Q8IA 3VR1A 1VQMS 3ZZ0A 1TR0A 2F8MA 2LLZA 1KFDA 1MROA 1S1WA 3QWPA 2B43A 5KFMA 1U26A 1Q8BA 1U1KA 2FVCA 3I0SA 1SJ3P 5A8RB 1UL3A 4RU2A 4ZPTR 4HDGA 2X51A 2RRBA 2VD3A 1GX5A 3I9V9 2W4CA 5KFQA 3V6JA 2YWKA 2VA3A 2B51A 2DH8A 4XDDA 3ONQA 2CPJA 4ZKAA 4NL5A 1IBMF 1KSPA 1V9OA 4B17A 4C11B 1QAJA 3V4IB 2ERRA 4C8NA 2FJWA 2LKZA 4KT0C 3HZEA 2UVRA 1TFWA 3IAM9 1T7PA 3AY0A 3H59A 2B9XA 2X3GA 3NNHA 2VB6A 1U1LA 4YR0A 5HMYA 2JLGA 4F4YA 2V94A 1M90T 1R3NA 1REVA 3K5NA 4OX8A 5C24A 1NU4A 4DEZA 2ACYA 1RT2B 2YNFA 4IDKB 2LQ5A 3SCJE 4DQRA 3DLGB 4ED6A 1P1LA 2RF2B 2ZZNA 3K2YA 1Y0HA 4O4GA 4ED2A 4DHVA 1RT5A 2D9OA 3K5OA 3AA9A 4I7FA 3L95X 3O1LA 5AE1A 2VC0A 3WC0A 5I4MA 1VC0A 2NQPA 2KFNA 4RW9A 4LJMA 3T5LA 4UOCA 1L3SA 3MM8B 4ES1A 1V3SA 3MEEA 4F26A 1HPZB 3TNVA 2Q6BA 4CH1A 3T6JA 1WTBA 2A3JA 1JLFA 2DO0A 2L08A 3LGMA 2GHVC 2QFJA 1MW7A 2MQMA 3VALA 1WEZA 2UUCF 2KN4A 5KT4A 2PA8D 3DLBA 3ISNC 2RMLA 2V4JA 1JKHA 1VQPS 3KK1B 4CNYA 4DR5F 4ECQA 5J1PA 2IM0A 3US5A 3OLBA 1SC6A 1AROP 1FEHA 2LXFA 3LP2A 2HZCA 4X4TA 3MR3A 3MGJA 3V5RA 1XWLA 4DDFA 5K8MA 3V4MA 1TAUA 3HVWA 4ECTA 2JRSA 3E01B 1WHWA 4OZ0A 3QZ8A 5KFWA 1FTRA 2MGZB 4MFBB 2HHUA 3NG8A 5ADZA 2W24A 2P9EA 2GW8A 4UUWA 1ZTTA 4LVOP 1TKZB 1CPZA 4X4PA 4NLPA 2O66A 4O23A 3ZZYA 4PQUA 1IQZA 2NS1B 2OPPB 3OR1A 4LFCF 1SIZA 3PEHA 3SZ2A 1H7XA 3BGLA 4KB7A 4C8KA 4JV5F 1VC6A 1RT4A 1SJFA 4URSA 4L6V3 1WACA 4DQSA 3RRGA 4B3OB 3DOKB 3CJ2A 2ZITA 1G6BA 1Y3JA 2MSTA 1Q7LB 3W2WA 4EGLA 3MM7A 3NCPA 2NSBA 2GQQA 5DDPC 2LEPA 2DGOA 5GAEU 1T94A 5CH7B 4W90B 4KBIA 2YNIB 3HZGA 1YWXA 4A46A 1MROB 1RJJA 2BQ3A 1FRLA 1B0VA 1HNWF 4IH5A 3R1LA 1RI7A 4K4UA 2M3DA 4WFAQ 2DCUB 1VFJA 1BQMA 1WEXA 3MR2A 1NK9A 1XMOF 2HVHA 3PDNA 5BYRA 3SCLE 3QIPA 1X4DA 5E3CA 3GQCA 2MB0B 4A8QA 2WB1D 3N01A 2FJXA 2G0CA 4K5SA 3EZ5A 1QAYA 3FGVA 4XAKA 2I2YA 4DF4A 1YRXA 5CZXA 4C7QA 3Q8RB 4KV8B 3MR5A 1REVB 2V2KA 5DDRC 5C24B 1N33F 2YKNA 3S01A 4F4WA 4I2PB 4WFXA 4KFBA 1JLCA 3C6TA 3DGPA 1HWLA 3SCKE 4U7CA 5AE3A 2HHSA 2F9DA 2PA3A 1FT8A 4O4GB 4EU0A 5A8WA 1N5VA 2CQGA 3KJVB 2DR5A 4TLQA 2ZHAA 1FHTA 3OTOF 3MUMP 1RT5B 3ISZA 1B64A 4I7FB 2M9KA 3HHLD 1H2VZ 2X1GA 2YNHA 5GAHU 2W7OA 2J0WA 2Q43A 5LSRA 2I0XA 3V6DA 3TAPA 1BWEA 1Q4RA 3M6UA 2J0QD 2YKMA 4Q43A 2DBBA 2CFXA 4C8YA 3MEDA 4HHJA 3LWLA 3MEEB 3IRXA 2PDAA 2DRBA 4QCLA 3EZUA 4DFJA 4QIWD 2HHXA 5CYQA 2BV3A 4ZLPA 1K1QA 1MMDA 3DM2A 3CCTA 4P2SA 5B09A 4ED3A 1JKHB 2WSFC 3E3XA 2PEHA 3E51A 4U67Q 1N56A 4FF3A 5FLXY 1U1OA 4PXBA 5CD4H 1VGYA 2XY6A 4WF9Q 2E5IA 3UD4P 2G13A 2U1AA 4FXVA 1GT8A 2VFVA 1LKZA 5I42A 3F73A 1VQ5S 2VL1A 3PW5A 4MIAA 5DG8A 3JSMA 2EBGA 3CEDA 2WSEC 2W9BA 2AU0A 1U49A 4A8YA 2F9JA 3OR1B 1RT3B 1S1TA 1O51A 2G1DA 2XBPA 1KVIA 2H5EA 1UWBB 3MAHA 2XB2D 1U1PA 1DLOB 1HQUA 2GGPA 2E5LF 5SUHA 3CO9A 3QAUA 4I68A 1CEZA 4OX7A 3W2WB 1TQLA 3CGIA 1WG5A 2FJBB 3MM7B 3OL7A 3M8RA 2KO1A 1JLEB 4WFNQ 1CLFA 3CDUA 3UDCA 1EETA 1OSCA 3C46A 3ZC4A 4QU7A 3MOZA 4CI0B 2N7YA 2UP1A 5E2QA 5IWAF 1H2UX 1Q86T 2DCLA 3H2LA 2RE1A 1WNEA 1UP1A 2OD4A 4OZ1A 1R7IA 1HYSA 4I0WA 2IYGA 3D2WA 1HBMA 2HGLA 5AJ3F 1GXUA 3O8WA 3HVTA 4AXIA 1BQMB 3G6XA 4EYHB 4WFYA 3GV5B 4DR1F 3PNIA 4FS1A 3QIPB 1N0VC 2M88A 4Y0FA 2FUG9 2IAJB 4H4OA 4TQSA 4QU6A 2DNMA 2MZQA 4NA3A 3D0GE 4DV3F 2XG8A 3LAMA 1S6OA 2NUHA 2E7WA 2HNDA 4IFYA 4WE1A 2KJWA 3UR0A 2BACA 1FXLA 2E7XA 1RP5A 4QW8A 2OSRA 4DX8H 2NREA 1S1XB 1JLCB 3C6TB 3J7A1 2BZ2A 2OTJS 5A8WB 5KFAA 2HWTA 2NLWA 4F3MA 5F9NA 2HHPA 5HQ8A 2YNHB 1U25A 2UUAF 2FJAB 3DXSX 2QZ8A 4BHQA 2ZOGA 3MEDB 3GB0A 4B3MF 3K7RA 1IJEB 3IRXB 3CC2S 1VBXA 4MK9A 1LWEA 5GAGU 5A0YB 7FD1A 4YB5A 1X4GA 3NKYA 3POTA 2CPDA 2B4OA 3BGFA 3OSPA 5J2MB 5KFJA 4PKDB 3R27A 3G6YA 3L09A 1MMLA 1ZOTA 1HR0F 3CDAA 2M7SA 3VAIA 5CCMA 2C3YA 5C25A 7FDRA 2ZD1B 5I42B 2R8GA 2MQPA 2IYIA 1IN0A 2J6TA 4LSNB 5KG3A 3QGIA 1TKDA 1J2VA 3F44A 3H5UA 2W9BB 2V9KA 2M5YA 4F2SA 4PXDA 3FSIA 1S9EB 2B0GA 2MHEA 1S1TB 1HFEL 3RZAA 3H4DA 4K5RA 3IGVA 1FDBA 5DETA 1M5VC 1HQUB 2CJBA 4K0KF 3CIZA 2GGPB 4NXMF 3TAMB 2XMTA 4DR6F 1Y00A 2IM2A 1R0AA 3ZZPA 4EEYA 1GXTA 2DJWA 2CPHA 2QV6A 2DNKA 5EHHA 2N7CA 2BBEA 2AD9A 2IBOA 3AHPA 3RR7A 4F67A 2C28A 4YHHF 3IA0A 4ZPDA 4RX6A 1X5SA 4MKAA 3PW0A 5KFNA 1HBMB 2UZAA 3MM6B 2CPFA 1NNDA 2L48A 3T6BA 4CNZA 5J2NA 1IKXA 3SYZA 2HYIB 1TL4A 2OIHA 2AYMA 1SL2A 4O3SA 4URGA 2IRYA 3HO1A 4ILMA 2BQRA 2QRRA 4O0IA 4MJKA 2KZMA 5D3GB 3U27A 1HA1A 4V19J 3W2VA 4B9SA 1WI8A 2ZC3A 1UA1A 3DLEA 1R43A 4DJBA 2CQPA 2VZ9A 2GJ2A 4AL7A 2WRMA 4PXEA 1T3NA 2P6SA 1C0UA 4U9RA 3TVYA 3MM5B 4DV6F 2WOMB 5HP1A 2D7SA 3T5JA 2LEBA 1X8DA 4IFYB 4J9RA 4ZPWR 5D77A 3OL9A 3PO4A 1FNOA 4ZVGA 3JTPA 4M1KA 1DFDA 3G96A 1VQ9S 4KKOB 1Q16B 1N34F 4XO0A 3UDLA 4BC7A 2QSWA 1P8GA 3NRBA 2F8HA 3KK2B 1VQYA 4WU2A 2MXYA 2GIQA 2GV1A 2IRXA 4DL7A 5F8MA 2HIQA 1XR7A 2C3PA 3HDSA 4H4MA 3DRSA 3UFCX 2VA2A 1X4CA 3L7OA 3RB0A 2GNKA 2A18A 2CPXA 2MYFA 4ZPBA 3G8TA 2FHJD 5I3UB 4QWCA 3R5DA 4XPCA 4OI0A 2XMKA 4IG0B 3THVA 1IKYB 4FNHA 4DL6A 1NKCA 2BJDA 3BGRA 2E5JA 3M2RA 3VQSA 2NXUA 3JYTA 1UKUA 2QA1A 3FNNA 2PD1A 1OS5A 2W9AA 4KQZA 4LIWA 1Q82T 3IBWA 1Q53A 2PI5A 1FD2A 2DH9A 3WDOA 1DTQA 5CA5A 3EGWB 3KNAA 2EG1A 5J2PA 1M5SA 2BANA 4OZ5A 4RBTA 5FDLA 2GMHA 3C8YA 5C25B 1TL1B 1SUQB 2MZJA 1LWFA 4RWWA 4WFBQ 3EGZA 1C0TA 2VFSA 4O3NA 5KFSA 1DZ5A 2E9TA 4RW8A 1IBKF 3KLIA 3LOUA 3N0VA 1HBUA 5DRKA 4A8SA 1FRKA 2VBWA 1MMNA 3AA8A 4CO5A 1OSDA 1C1BA 3ENWA 4G3IA 2NPFA 3SCIE 4BWMA 5KFHA 2MQLA 3GG1A 4O3PA 3FCHA 2FLPA 4USJC 1R0AB 2MQNA 4PG8A 5L9XA 2XGPA 4ED8A 1VLYA 5HI7A 1QAIA 2D9PA 3EGNA 3MMJA 2WBMA 4ICLB 3K59A 3H98A 3KLVA 2OSQA 1UA0A 1ZAVA 3I9ZA 3AJ1A 5DQGA 4QYZJ 5CHCB 5JVGQ 3PW4A 4ED5A 5KTQA 3M6XA 3BQ1A 4DBQA 1JLBA 1IKVA 1TZ0A 2V8HA 1ELOA 2ASJA 4PXCA 5EDWA 4QWDA 2R8HA 2B6AA 3FSXA 3JSBA 2EW9A 3BF4A 3W2VB 4MMOA 2K2PA 1UAWA 3WBZA 1KLMB 2E5GA 3KWMA 2CVEA 2KRBA 4IR9A 3MECA 2APOA 1C0UB 2CKWA 2VC1A 2E1RA 2Y1RI 4EBDA 2XY5A 5CXTA 5M2UA 2UUBF 1O8BA 5F8IA 3PIPQ 2J7WA 3MTJA 2MKKA 4X4UA 3C6UA 2DHGA 1RTDA 2VPYB 5MLCV 1YJVA 4P6QA 3QPIA 4DSIA 5GVQA 2OPRA 4DV2F 2WW8A 2B3TB 1UVNA 1JXEA 3JTNA 1S0VA 2I5JA 1IKWB 2KT2A 3OR2A 4QPXA 1TK0A 2L9NA 4H4MB 1H6KX 1TP7A 2D74B 3DMJA 4RUAA 1RDRA 3D1OA 2HS0A 3PKYA 3X3UA 4DR3F 3HKWA 4DFKA 2OPSB 2I1RA 3H4BA 1E6YA 1HWUA 3EXYA 3HFKA 4L72B 2YQ3A 4V19X 4USHA 3N4WA 4EUVA 1URNA 3KTQA 3KOAA 1K73T 1VJWA 1WG1A 5HROB 2KZZA 3Q22A 3CD0A 1BC6A 2CIMA 2Q6CA 3T19A 4RNMA 1SJQA 3PRBA 2OKQA 5C42B 3HK2A 2BANB 4BDPA 1UEVA 2DRAA 1S6PA 2R7RA 1S4FA 4CH7A 2C2EA 2EWHA 1SJ1A 2WSCC 3HHNB 2ROEA 4IKAA 5KT3A 1B0TA 1WHYA 4MYTA 4Y3CA 4I1TA 2WHOA 4C0BA 4IQXA 4AXJA 4RW8B 3KLIB 1HHTP 1JLAB 2CJQA 2V0NA 3PRDA 3TUJC 1FO1A 4YOEA 1C1BB 4J37A 4NCGA 1LK5A 1SIWB 2XNQA 3ETOA 4JBCA 2ILZA 2YKQA 3BQ2A 2FTRA 4Q45A 1YGYA 3KHGA 2ASYA 2FVRA 4ILLA 2CZVC 2MKSA 3OL8A 5A8RA 3LP1B 3SMZA 3JAMY 2GC8A 1W2IA 1S49A 1DARA 1AXQA