2QYCA

Crystal structure of a dimeric ferredoxin-like protein (bb1511) from bordetella bronchiseptica rb50 at 1.90 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
GMTMFLHVVMMEFDDGIDAGFFRTVDEYVARMKRECDGLLLYHFGENVAARSQGYTHATSSAFVDAAAHDAYQVCPAHVAMKAFMGPRIKRVVVYDGEVPAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-like protein
publication title Crystal structure of dimeric ferredoxin-like protein (NP_888056.1) from Bordetella bronchiseptica at 1.90 A resolution
rcsb
source organism Bordetella bronchiseptica rb50
molecule tags Unknown function
total genus 17
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qycA00
1JWWA 1S6OA 2Q3PA 3I9ZA 2XMVA 5T7LB 3IWLA 2RU9A 5B0GA 2BJEA 2HFOA 2N4DA 2OP5A 2W4PA 4HH1A 2HLTA 3MCSA 4DN9A 2ACYA 2KYZA 2FIUA 2ZDPA 3KG1A 1AFJA 1TL5A 3FGVA 3HDSA 4OIXA 4OJGA 4A47A 1FEEA 2ROPA 2W4DA 3CJKB 5F0WA 1XBWA 2EW9A 3LGMA 1VQSA 1APSA 1OPZA 2ASYA 4Y2IA 1N5TA 2XMTA 1FESA 1YJVA 2K7KA 4Y2KA 2GO8A 2RMLA 5B0BA 3LGNA 1X0PA 2RILA 2L3MA 2XMWA 3E8OA 1GXTA 2HFNA 2BJDA 1Y3KA 2GCFA 2AJ0A 3HHLA 1FD8A 1TL4A 3FRYA 4ZOSA 3MZIA 4F67A 2ROGA 1SB6A 1U7LA 2KT3A 1Y0HA 2QIFA 2LQBA 4OJ1A 1SI9A 3BF4A 2FHMA 2XMUA 1TR0A 4YEAA 3K7RA 1N5VA 1YJUA 4HH0A 4ZA1A 2HLUA 2AW0A 1Y9OA 2GGPA 1MWZA 3F44A 2OAUA 2XMJA 5B09A 3T9NA 1OSDA 2LXFA 2IYGA 3KKFA 2K2PA 4HL9A 1AFIA 1IUJA 1ULRA 3LO3A 3HF5A 2K1RA 2LDIA 2LQ9A 1YJRA 2W4CA 1YJTA 3VTIA 1W2IA 2PGCA 2GFFA 2QYCA 4A4JA 1VQYA 4A46A 1OQ6A 2AJ1A 2N7YA 1JK9B 1SQEA 1TUVA 1URRA 2PD1A 3DXSX 3FMBA 3HHLB 2OMOA 3WDOA 2JDJA 4Y2MA 5T7LA 3HHLC 4Q2MA 1N5QA 1CC7A 1P8GA 1K0VA 1KVJA 1QUPA 5B0FA 5B0EA 2HQIA 2XMMA 1GXUA 2OD4A 4FNHA 1Q8BA 1KQKA 3CJKA 3TOQA 5B08A 4NL5A 5A6WA 1YRXA 2OFGX 1OQ3A 3HFKA 2BYCA 5B0AA 3UDCA 2OD6A 1TZ0A 5IXUA 4OJ3A 1FVQA 1Y3JA 5A6PA 1P6TA 4OJHA 2BBEA 1CC8A 2OFHX 2QLWA 1Q53A 2N4CA 2ZDOA 1X7VA 3DCAA 3HHLD 4FNIA 1S6UA 4U9RA 4EFAC 2FB0A 2VH7A 1MWYA 1AW0A 4DPOA 1CPZA 2IYIA 1V3ZA 4NPOA 4QOTA 5F0UA 3TNVA 2VV5A 3HX9A 4HI1A 3IWXA 1FE4A 2GV1A 1YG0A 3KG0A 2XMKA 5B0CA 2BUNA 5KAKA 5K9FA 2CRLA 1X8DA 2GGPB 2G9OA 1WD6A 3GZ7A 2KKHA 4Q2LA 2FTRA 2QLXA 3KNGA 4YDXA 2RSQA 1LQ9A 1FE0A 3BGUA 1FVSA 5B0DA 3BM7A 3QGPA 2IFXA 1Q8LA 1RJJA 2GA7A 3QMQA 4A48A 2AP6A 2K1RB 1N5SA 2OKQA 4HI2A 3BDEA 3BB5A 3TRGA 2ROEA 3BN7A 2K7JA 1KVIA 2HIQA 4DL0C 3BR8A 1Q4RA 1R6YA 2KT2A
chains in the Genus database with same CATH superfamily
4Q8FA 3EPGA 5KT4A 4EU0A 2DEJA 2XBPA 3TVYA 4C4WA 2IRXA 3R1HA 1UEKA 1FXLA 1XK8A 3DLEA 3NGTA 1IQZA 4PXEA 1QVFR 1F5BA 4HEA9 2B3TB 5G0RA 2MY7A 2QT7A 2OGUA 1YITS 3UNGC 1X0FA 2HMIB 2UUCF 2K2PA 4JI6F 3QJPA 3QRQA 1XMOF 5EWGA 1IBMJ 1JK9B 2CZ4A 2HNDB 5GAEU 2KZZA 2V50A 2V2QA 3WX8A 4C6AA 3HFKA 1EARA 2CDRB 2YKNA 1Y3JA 5KFOA 1XTZA 3JTOA 3NAHA 3TVKA 1NNDA 4C8OA 5B0CA 4RBTA 4TLQA 1I94J 2DNQA 3R5DA 3R1LA 1VBXA 3AFGA 2ROEA 3L09A 1E6YA 3MM6B 3DLKB 1NK6A 4QW8A 1B64A 3L9ZA 1QAXA 2VICA 3S1TA 3W9IA 4ZN1A 1X4FA 1FEEA 3CJ2A 5GAGU 3EZUA 1VJQA 3M8ZA 1Y0HA 3JS9A 3THTA 1FD2A 1YJUA 2XYGB 3T9NA 2MXYA 2J9DA 5LOQA 2NYHA 4KGXB 1YJRA 5DQIA 3J80Y 2CQIA 2KVIA 2AJ1A 1U49A 4KFBA 4RWWA 2G2YA 3HK2A 1HNVB 1WSVA 4ER8A 1NK8A 3ETMA 2GVDA 3NRBA 2IM0A 2KT5A 5MLCV 3FBCA 4LR8A 4NZ0A 3JYTB 2DGOA 1FWKA 3Q8QB 2KFYA 3GCXP 3ITHB 2GHVC 4OI2A 5HLFB 5HL7Q 1W26A 4EGLA 3PACA 4EMDA 3H5YA 1NKBA 4LVNP 2HMIA 4ZCMA 3RYLA 1WG4A 1T94A 4PPZA 3KLFB 2PFFB 2JLEA 3FVYA 4M5DA 1BQNB 4NA1A 1IR1A 4N8NA 2QLFB 5DZ7A 3VWSA 3MCNA 3U1NA 4I67A 2KRBA 2JVOA 2J8AA 4K5SA 1AZSB 3OTCA 1OMSA 4UOGA 3CMES 2C2DA 2RDJA 4F04B 3KJFB 1A0OB 3C15A 2QRRA 3PJ9A 2B5JB 3MPUB 2PMHA 3JSBA 3BSOA 1WHXA 3MM6A 5AXLA 2BE2B 2IDLA 2IVMA 3DLKA 5CQGA 3TA0A 2R7VA 3CDEA 2C3PA 5BYRA 1YI2S 4JYAF 1NJIT 5LMUF 1RHKB 4NMLA 2ZC4A 1VS3A 2HPUA 3SV3A 1WC6A 1KLMB 4MT1A 3T1AA 2FB0A 3MCMA 2FJWA 5ETSA 4B9LA 1FE4A 1HWIA 2MZJA 1ITPA 1R3NA 5CD4H 3G8QA 1NM2A 4A48A 2LA4A 4XIUA 2CPYA 3MEGB 2PT0A 3CJ5A 1D9FA 2V9KA 1SH2A 2JEJA 2ERRA 2HGNA 3Q83A 3CEDA 2BJ8A 2UXBF 3JYTA 2DR5A 5EGYA 3ILLA 1JXEA 2XTJP 3ITHA 2A6OA 1VQ7S 1RGVA 2AGPA 3PHEA 5HLFA 2KHDA 4FKXA 2AW0A 4R8UB 1GT8A 3JB9k 5HP1B 5I4MA 1M90T 3KLFA 1UETA 2W4CA 1BQNA 2F1FA 1VMBA 1ZPWX 4LF6F 4F0KA 1U47A 3HO1A 1PYTA 3OVSA 3RRHA 4IFYB 5E2QA 2OIHA 1Q8KA 3VGVA 3CC7S 1AZSA 1X4BA 2QA4S 5IWAF 1BXNA 5JJBA 1D3WA 4FYVB 2G9OA 2B5JA 1RCXB 4NE9C 4FF3A 2BE2A 4Q8EA 4ECVA 3VQSA 2I8EA 2DHSA 1H72C 2DHHA 2N7CA 2Q3PA 4OV6A 2ABYA 3I9ZA 1FDAA 2CPEA 4DQSA 1T9YA 3TI0A 4UZCA 4DLEA 4LRBA 3G82B 3FEYB 5HJYA 1KLMA 3DLGA 5DG9A 3AQPA 3O2IA 4OZ0A 2XO6A 4O4GB 2BACA 4P7VA 3M6XA 2OUGA 2KG1A 1QAIA 3EUNA 1RADB 4ILLA 1SV5B 3HCXA 1U1QA 3KYLA 3O5TB 1IKVA 3MEGA 2ATCB 4DV2F 4ED1A 1T03B 3SFUA 2UP1A 1NZAA 3PXGa 1WUUA 4X4OA 1ZM2A 2R7UA 1KLNA 2M9KA 1RISA 2I6WA 4ZS6A 1RTZA 2XGPA 1MLAA 3O1LA 2GIQA 2FZKB 3BREA 3IGVA 2IYIA 2X1AA 5F0UA 3ENVA 5HP1A 1FXRA 4GKJF 4KB7A 5HAOA 3POTB 1R31A 4J9UE 1TQLA 1G4CA 2M70A 4JI0F 3HMJG 3W64A 4G1QB 2N4DA 4DFMA 4PWUA 4IFYA 2CQ2A 1NXIA 4OV1A 5CD4A 4Y65A 3R7BB 5D8HB 1T3NA 3DYAA 3CCSS 1RWXB 2MKJA 1FA0A 2W2NP 4K8RA 3U1LA 2ZZNA 4AE5A 2IMWP 1PCAA 4I6WA 1ZZFA 3O3LA 3L7PA 3TAPA 1SJQA 2HFSA 2JEIA 2QC3A 5GMEA 5CYJA 2VFTA 2L48A 1R0BG 3BQ2A 3OFEA 4DHVA 3SQGB 4X4QA 1IVZA 4USMA 4K4VA 4DX5A 3AOBA 2AT1B 1X4HA 4A8MP 3AB4B 4FBTA 3TOQA 1QLNA 3PEHA 3NBPB 2NXNA 2D3OR 3TJ9A 2Y8WA 1CBKA 1N8RT 3RRGA 1SC1B 2A3JA 4F0HA 4O4GA 5D0EA 3L95X 4C8YA 3GFYA 4X66F 2YVSA 5HMXA 1G3OA 3I5AA 1U1OA 2AP6A 1UJ4A 3JSMB 4YB5A 4URGA 3DLLQ 5KT2A 3OLBA 5EHHA 1RAOA 3GIJA 3G6ES 1AFJA 3L7OA 4LJMA 3GV7B 3UDEA 1FESA 2PFDA 4L73A 2MQNA 4PG8A 3N6NA 2ZJRQ 4JOUA 1BGXT 3KJVA 1NJXA 2W7OA 2OTJS 3H90A 2RDIA 1SIWB 2HFVA 1RAAB 2FJBB 4IG0B 2HQFA 4MYTA 4ZVTB 4IKAA 3POTA 5HQMA 2E66A 3BKFA 3WDOA 5ETRA 3DU5A 4G1QA 4ILMA 2LLZA 2XMMA 1NHKL 2WSEC 4XDCA 2DR6A 3EYZA 3K5PA 1RE1B 2WVCA 3UN3A 4NLTA 1QAJA 4I68A 2H51B 4U9RA 4NMXA 1FX2A 2HHPA 1UL3A 4DFKA 2XY6A 5K14B 2XLIA 1PJ6A 3SQGA 2LYVA 3R5AA 4USUA 3QIDA 1H2VZ 1RKIA 5B0GA 3MCSA 4QR2A 3DN9A 3NXZA 3BS9A 3VZIA 2RILA 3MURP 1L5UA 2YQ3A 1S1TB 2OTLS 2A2DA 3R6LB 1XNQJ 2P9GA 1JLCB 2V6AA 1RWWB 3TEGA 2XSFA 3BV8A 3GILA 1NPPA 1NK0A 1OO0B 4DR6F 2QYCA 1R27B 1TUVA 4PXCA 4TY9A 4LIRA 3G6VA 5C2CA 3CCQS 3WHIA 1N34J 1WF1A 1YX2A 4URSA 4PABA 2BYCA 1Y00A 3RZAA 2GS8A 3QZ7A 4ZHRB 4ZVUB 3VV2B 1IBMF 4H4KC 4GMKA 4C2MA 2HZVA 1TL1B 2BEFA 4IG0A 1KD1T 3A3OB 3MMJA 4C8ZA 3OQ2A 5F9NA 1DY3A 5HBMB 1FI4A 1WEYA 3KFWX 5JVHQ 3UCGA 4GO5X 1S5ZA 3UNYA 2L9NA 1TKTA 1NSQA 1YLXA 3NMAA 2MKSA 2FHMA 4WK1A 3QSYB 4JI8J 4F4WA 3IAS9 4I64A 5CZXA 4ED3A 4LF1A 4ANCA 2XCAA 3THVA 3JSRA 4DR1J 5K14A 3HJVA 2IJNA 3HKZD 1LV5A 1DARA 1HARA 5DRKA 2WB1D 3V6JA 4G1IA 3RJMB 5GAHI 2A1BA 1RT7B 4Y2AA 1H98A 5B0EA 4DQQA 2H3EB 1EQMA 4GVLA 3CF5Q 3MM9B 2UUWA 2GC8A 3V4MA 1S1TA 2QMWA 3D3BJ 3PO5A 1VISA 3JQKA 1HMVB 2Z2YB 3PYGA 5K9FA 4UUXA 1VBZA 1KDNA 2MLXA 1DQAA 2VG7B 3G96A 1HWUA 1ZTWA 3D7SB 2W4DA 1MMDA 4DL3A 5HANA 2MQLA 4TY8B 1H7WA 4KAIA 2P6SA 2HG4A 1H3DA 1IM6A 3MCOA 2F4VJ 1RTDB 3EGZA 4OMFG 1TR0A 3LH2S 2DXEA 4YMEA 1TL1A 1GMWA 2KN4A 2MKIA 2VPZB 3QNWB 2LQ5A 3THPA 5C7PA 4A8YA 1H2UX 1W25A 2DRAA 3MMBA 3CD0A 3HLUA 3UW1A 4LF9J 1FWLA 5IC6B 3FFIB 1AA1B 4Q43A 3R27A 3GJRB 2MSSA 1Z4UA 3R5BA 1PSDA 2YX1A 1MROB 2ZM6J 4U95A 3HSGA 2EKYA 1UVMA 1M5KC 2F40A 3I4HX 4MIBA 1PBUA 2PI5A 5LXYA 2BV3A 3TZZA 2V94A 1BD6A 3RB3A 4ID5B 1KWMA 2O1PA 2QLBB 2BMBA 2CUYA 2Y9HA 3EPIA 1U8SA 1FDNA 4P52A 3UD4P 1S0NA 1RT7A 1JWWA 1FF2A 1YJWS 3CDAA 1T11A 3ILJA 4I2PB 2O5DA 3MM9A 3SFGA 3NEKA 1QM9A 3M2VB 3D6FB 2HFNA 1T0TV 2GCFA 1D8YA 4E2FB 4F7VA 3MZIA 5J2QB 1DTQA 1HMVA 2FVRA 4KV8B 4ZJQA 4TU7A 1RWUA 4CO0A 5IV4A 4X4NA 3W2WB 2NZ4A 2X1FA 3KLVA 2X3GA 3CJ0A 4EUVA 3BGLA 3BGOP 4JV5F 2CQ0A 2NCKL 4KKOA 2HHUA 2X1BA 3K57A 4TLRA 4TY8A 3KJNB 3EDQB 2HZCA 2VODA 1U26A 4USVA 1R7IA 1UZHA 1RTDA 3C14B 3J7A1 3EM1A 3HX9A 2W9AA 5K8NA 4NCBA 1VQLS 3KNGA 3CD7A 1WC1A 1WKKA 1A7GE 2GA7A 3SBMA 1KVIA 4J9MA 1SL0A 4HR2A 1GXLA 2VBXA 4KRWA 1N36J 2KT2A 3FFIA 1M0SA 1R43A 4ELUA 3UD3P 5D4PA 7AT1B 1KP6A 2J7UA 3N01A 3RAQA 1MROA 1CS4B 4I1TA 3BN4A 3CD6S 4WU2A 4NX9A 1JKHB 3RGIA 4ID5A 2VONA 2K06A 3D4JA 4DCJB 1OSDA 2P5VA 3GE9A 3GIMA 3PW0A 2AD9A 4GRSA 1IUJA 2GMHA 1NH8A 1KHVA 3HM9A 1XWLA 3RBDA 4U6PA 1ZAVA 4EYIB 2PIIA 3BZQA 3UCUP 1S7HA 4I2PA 3CCLS 2WOMA 3OTBA 1GXUA 2DR9A 1TV6A 2NREA 4LF2A 3VAHA 1HNIB 2B4UA 1RT6B 2QSWA 4RUAA 3GIIA 4KTQA 2BKOA 4OJHA 5J2QA 1Z1ZA 4DPWA 1U1RA 2DVIA 4KV8A 3HT0A 2CQCA 5THWA 2YX4A 1NEEA 3FUYA 1T3OA 3HJFA 2ZNZA 3EGWB 3PZPA 1MU2B 2W2OP 2R7QA 3MPVA 3ZNJ1 2AWZA 4DN9A 4MFBB 4B3RJ 1OPIA 5AXNA 4P75A 4F4ZA 1VBYA 2ASYA 1S6PB 1VJWA 5CH7B 1RI7A 4NLPA 2I2YA 2AJ0A 3C14A 1WTBA 2DR8A 2I9SA 3CC2S 4ECRA 1EP4B 1X60A 4RNFA 2GX8A 1TFYA 3UDLA 2RVJA 4PQUA 3B4MA 3GV5B 4OI0A 4EK2A 4FS2A 4NXMJ 4C3KA 3W62A 3EGVA 2V4RA 1X9SA 1CS4A 3SZ2A 1TZ0A 3T41A 4NYOA 1JKHA 1URNA 2VH7A 3C16B 1ZAXA 3PW5A 3UD5A 2IMOA 3CNQP 3K8VA 2XG8A 2WCXA 3KMQA 2GV1A 4RLEA 2ZH1A 1WC4A 1BWVA 1KQFB 5ETPA 4C9DA 3ZTRA 3HHEA 4KT0C 1LKZA 1HNZF 4DV5F 4OX7A 4DFJA 1FFWB 1RWOB 2Z8QA 2W25A 4OHVA 3UR3C 2NS1B 1RK8A 4AYBD 1HNXJ 1U0HA 3O8WA 1D9AA 2OAUA 1P9QC 5DG7A 4WIQA 2ZH5A 3NMRA 4ANDA 4CDIA 4DL5A 1RYSA 1MU2A 2OO4A 2MJNA 4V1Ak 2ZE2B 4ICLA 4LRAA 4O3RA 3VAJA 4Y3CA 2RH3A 3ZZOA 3GB0A 1S6PA 2ZKTA 4F02A 2HHSA 1VK8A 2V68A 2H65B 2OFHX 4X4UA 2DGQA 3PTWA 4KHRA 1EP4A 1HW8A 1WEZA 4ZLPA 4NEYA 2MGZB 2RD5C 2MYFA 4UY85 1ZM9A 1R8PA 4JI1J 2CQBA 5HJXA 1S99A 4M95A 1Z2LA 5DDPC 1FJCA 4OHZA 2XWXA 4OZJA 4B3OB 2YPZA 4LUBA 3H25A 2P9EA 4LSLB 5KG7A 4U7CA 4C3MA 4B3SJ 3C16A 1TUWA 1FCAA 4O0NA 1RHRB 1SKRA 2BM1A 1Y4ZB 2DY1A 2YXLA 2IYGA 4D3GA 1NDPA 2BE7D 2EBEA 3DMJA 1S4EA 3V6HA 2OPSB 4ZK7M 5HMZA 2KDOA 2HHHF 2KL8A 2M4MA 2EI5A 2UXDF 3SI8A 4LSNA 1HQ2A 2V4QA 1ZPVA 4DZ6A 1KFDA 3DRSB 1XNQF 4FS1A 5FLXU 1HBNB 4N5SA 2VQEJ 1U1MA 4USHA 5F8LA 1DZ5A 3M1VA 4Q5VA 5DQHA 2CQPA 3CSKA 3MEKA 4NA3A 2DNKA 7FD1A 3QJLA 1N33F 2ZE2A 3P4UB 4FXVA 3DRRB 2LQJA 4IOAQ 3D6HB 3AA9A 4C48A 3SQOP 1JJ4A 4RUCA 2YH1A 4DL6A 1HYSA 4WYWA 4MKVA 5KFUA 4DCOB 5IT0A 3C6TB 3KHRA 4WZQA 3MFIA 4LF7J 4OFZA 3ISNC 3BGRA 4L72B 4YB1P 1XEZA 4OZ5A 1MMLA 2F8EX 2XO7A 5CZVA 5DETA 2ZHBA 4KIAA 3TW0A 2C1EB 2DBBA 3BYPA 3CO0P 1VQ4S 3Q8VA 4CWBA 2XC9A 4MK9A 4J9VA 2GO9A 1S6QB 1K1QA 2QL5B 1QSYA 4X4PA 4OYZA 1CVJA 5E41A 4JI8F 2AYEA 1OQ3A 3MR7A 3A8EA 1XMBA 2VB6A 4UT4A 3BO3A 2XSJA 2XM3A 3MFHA 4DR1F 1T8EA 1S6UA 1T95A 3OHBA 3HD2A 2MZSA 4NXNJ 4EZ6A 3DKDA 2J9CA 3W9HA 3I56S 1XR5A 4I7FB 2WVEA 3RBZA 5CA5A 1OIAA 4DV6J 5KOXA 1UVIA 1GEHA 1UA1A 3N5FA 3HI9A 3KMSA 1S97A 1FRJA 3DRSA 3M8YA 5DM7Q 4S0MA 2E5GA 3HD1A 5KFPA 4Y0FA 3MWBA 3H5XA 4KGMA 1HBNA 3EXCX 1K8AT 4KH0B 2B9YA 3BPDA 2AGOA 4ECYA 2LKZA 5F8JA 5IT4A 4AL6A 8RUCA 1FRMA 4DZDA 4FYWB 2JX2A 4HTJA 1VI7A 3MF5A 3MR3A 2LQ9A 3GG0A 4BC7A 1I3OB 1F0XA 3B4DA 3WX4A 3FJ2A 1N48A 3TVZA 1NK4A 2HW3A 3IXQA 2F4VF 2OD4A 4I2QB 3JTPA 2DPIA 5KFMA 2IAJB 1SKUB 3EXYA 3ET6B 3SYZA 4KPYA 4W90B 5H9EK 1DFDA 2DYAA 2G0JA 3NS5A 3RB0A 2OI2A 3A13A 2WSFC 3QIPB 4LF9F 5LMNF 4TVAB 4ECSA 3A8IA 2DNOA 3VAIA 1NPRA 1S6QA 3LPYA 2M0GB 4F2RA 3FBFA 2O66A 1U6FA 2ZM6F 4PG7A 4I6AA 5EX0A 2LEBA 2E9ZA 3PFOA 1NZ8A 2DXDA 1TL5A 4MK7A 2DNGA 2MKYA 1VFJA 1HI0P 2UVRA 1B99A 2YKOA 1R8CA 5DDRC 4LFCJ 3IR6B 3B82A 3R8YA 2FHOB 2W9BB 5IZHA 5KG6A 5FDLB 2WRMA 2MDAA 4I7FA 5KFCA 3BQ1A 2W2PP 3ONQA 4ZPTR 3AA8A 2B43A 4WP8A 1Y10A 4ETXA 3ISND 1VQYA 4A46A 3AHPA 1UVNA 2BQRA 1M1GA 4JV1A 3DC2A 5H9EJ 3Q2SC 4N41A 2P9CA 3KUEA 2QO3A 3NY0A 3D6MB 3OLAA 4O44A 1QSLA 3OV7A 4IOBA 4EEYA 4EBEA 2E29A 4NWBA 1KQGB 5CYQA 4ECZA 4ZITA 2ALYB 5GMDA 5ETQA 3VVTA 3I5BA 1ZM3A 4RUHA 1NKEA 1J5EJ 3BJYA 2ZD1A 1M5SA 2NUHA 3O44A 3HDSA 1HQEB 4RU9A 1APSA 3VGSA 3CJ3A 2JOQA 4IQMA 1X0PA 2FD2A 4NASA 4IOCQ 5E33A 3IS9B 3QIPA 4WXWA 2XMJA 1RXOB 2AEMA 4GVBB 2WHOA 1VC5A 1SKSA 2OSRA 3SSRA 4KO0A 3CCMS 3P8BB 4ZCLA 2ZBRA 4N7TA 1IJFB 3MOZA 3HSJA 3ENAA 1NSKL 5AE1A 2WBMA 4CLYA 3E3XA 5FDLA 3TNVA 1NB7A 5C5JA 1SH0A 3QWPA 2RB7A 2MQPA 4FXWA 3SCJE 3BGUA 2XY5A 3MDFA 5GAHU 1FDBA 5J1PA 2CJKA 3NS6A 3AXKA 5A0YB 1JLFA 3TEHB 4ED7A 2Y1RI 2V5HG 4KJIA 4TN2A 3LGMA 2AIRB 1U02A 5B7WA 2BW2A 4MK8A 4KC5A 2VFUA 3QAUA 1RWKB 2C3UA 4DUTA 1BWEA 1TKXB 5EX3A 3RBEA 2FY8A 3DLJA 4HL9A 4UQTA 5CYMB 4B9MA 4B3RF 3OW2R 2MQOA 3V4IB 1S10A 2N7YA 4MAKA 2UVVA 1PAUB 3GMGA 1NUEA 2JDJA 1YIJS 4P73A 3PJXA 2FY1A 1WC5A 2CZ9A 2VOOA 2VBYA 4PXBA 2BOPA 1PKUA 4DSIA 3UDCA 3J80U 3W8GA 1KN6A 3DRXA 3CVKA 4K4XA 3BEGB 1TK0A 4RO0A 4K4UA 1X4AA 3DI6B 2AEFA 3IS9A 4WF9Q 2UUCJ 4P7TA 5E3RA 4ZJOA 2E5IA 3T5JA 3DOLB 4GVBA 5L9XA 2CA9A 3DOMA 2ZC3A 2WB4A 3TRGA 5HATA 4TQSA 1S9FA 3ZNUA 2HFOA 4WFNQ 3BBFA 2LU2A 5CHCB 1RAIB 1EB0A 2XMTA 2HQDA 2CJYB 5CCLA 5E0OA 1GXTA 3MPDA 1UVLA 2PSZA 5DS7A 2IDEA 6AT1B 3E51A 1VBKA 4I0WA 2CPDA 3PCOB 3UCZP 5IS2A 4FZVA 6FDRA 2ZVSA 4DPTA 1KEKA 4RNMA 4YS2A 3M32B 4RL1A 1RHJB 4KQZA 1XR6A 4DI6A 3ZC4A 1YSJA 1HNXF 4X4VA 2LXUA 1GNKA 1B3TA 4O3SA 3BH6B 3N0VA 3NLCA 1H2TZ 2WBRA 4ZPBA 1JMTA 2UUAF 3QRRA 2VFVA 1H38A 4OL8A 1YJNS 2VDHA 3CMQA 2OEJA 1SKWA 2QLJB 5HROB 1LXNA 1TKXA 3C6UA 3CDWA 5CYMA 3GZ7A 4OHXA 4QIWD 2YTCA 3QT7A 1IKWA 2HAFA 2GJFA 5M2PA 4J90A 1HBOB 4IUFA 1YKWA 1X4GA 2CQ3A 4RZRA 1S1VA 3GLJA 2R9LA 4DOZA 4UTGA 4U67Q 4IRCA 3CJTA 2F9JA 1T9UA 3QYYA 3DI6A 4FVCA 4KSEB 3DOLA 1MWZA 1RA7A 4WJBA 4CLSA 1GFWB 4N56A 2LCWA 3HHLB 3H59A 2M8HA 4RW6B 1VIXA 2ZOGA 4OYIA 2FVPA 1RLDA 2ZEJA 5K8PA 3I55S 2J9DE 2G13A 2NUUG 3LQVA 1DLOB 3IRXB 2UV8G 1Q95G 1KS2A 4JV0A 2VKRA 2V8PA 2MHNA 5DDOC 4JYAJ 4A8KA 4Z2XA 1RU1A 3M32A 3R5CA 3ZZTA 2BJEA 4WCEQ 4QZVB 3A1YG 4ZVFA 4PUOB 1GH8A 2YNGB 5HVGA 1H73A 1IKXB 3RAMA 4NLXA 4F67A 3ENQA 4Y34A 2YNFB 4M5IA 2R8JA 4ZPCA 2RS8A 4TYBA 5HROA 5LSRA 2HRUA 4PWWA 2C22A 2DHGA 3MEDB 2EK6A 4RW4B 2MEWA 2Z2MA 5A2QU 2J0QD 1HBOA 4M5NA 2FJDB 3N28A 4QQBA 4LF7F 1S48A 3FEXB 4DQIA 5U47A 1VK3A 1UZDA 2DY9A 1V9OA 1CQNA 1F9HA 1FVQA 2Z2ZA 2B7BB 3D0GE 1OS5A 1AW0A 3OTDA 3E01B 3K5MA 1NMEB 4IH5A 3H0PA 4YDXA 2NXEA 3MUMP 1NDKA 2CPHA 2MLYA 3BGFA 2HSEB 4HACB 3DGPB 1B0PA 1GMVA 2AZ1A 4RW6A 5EWFA 2OPRB 3CJSA 1HQUB 4YR2A 2C42A 3G8SA 2ASJA 5IWAJ 2ADCA 3FGVA 3CCUS 4NXNF 4JV2A 4WP9A 1BMQB 2UUTA 2BKNA 2BANB 2YNHB 3Q8SB 1TL4A 2D3ZA 2CQ4A 4DV6F 3IRXA 3CT9A 2K8GA 3EJMA 2CNKB 1RTIB 2M88A 2BQUA 2CWXA 3KK2A 4YY3F 2HKEA 2MZQA 4BDPA 3SDEB 4Z7YA 1M5OC 2D41A 3TZXA 3JAMY 3TJ8A 1FO1A 1FJEB 2QJ3A 1U25A 2M8DB 4PUOA 3I32A 2QE5A 1LWCA 1IKXA 3KLEB 1P6TA 3LAMA 6FD1A 1JJ2R 2YNFA 5DM6Q 1F1BB 2Y0SD 2DNPA 4DV2J 2EVZA 5ETVA 3CJ8A 4RW4A 4ZPDA 2V8VA 1FRKA 1D8ZA 1U2FA 3D28A 4J9SA 1NHVA 1LW2A 2XI2A 1U2RA 1HFEL 1D1UA 1K1SA 1N54B 3E01A 3OR2A 2POKA 1CULA 4CT9A 4I4BA 3T19A 4YB7A 4KR0B 2J76E 4ES1A 4ED5A 4HACA 4OI1A 4A8FA 2W01A 4AXIA 4DV3F 4NI2B 1UCNA 1LWFB 1UFKA 2OPRA 2YX7A 1HQUA 4LFCF 2QFJA 5M2UA 5BR8F 1RT3B 3MMCB 3KLGB 3FBBA 2RKIB 3RU0A 2BANA 2ZWPA 3LAKA 1NSPA 1RT4B 2RRAA 1FK9B 4RBVA 2HWIA 3FRZA 1RTIA 2Z56B 4UW2A 1X8DA 3QJJA 2DGSA 4LBPA 3D1HA 2R7WA 1YBAA 4UUWA 3FCHA 3EDRB 3SDEA 1IKYB 3IGNA 2AMCB 4F26A 1X5PA 3OR1B 3C46A 2HURA 2C2MB 1UKUA 3H8YA 3H4DA 4F3OA 3BKUA 2PA8D 4PG5A 3CIMA 2MTLA 2DNMA 1UFLA 4X66J 4FYDA 1NAQA 1HBUB 1CLFA 2ROGA 3D66A 3MAAA 3NAIA 2PA3A 1K44A 4DWIA 3M8RA 4DSEA 1Q16B 1J5OA 3KG4A 3IMQJ 1T9TA 5HI7A 2L9WA 2CQ1A 2HWHA 2W1BA 3M2RA 2PEHA 4ZPAA 1G1XA 3DLEB 1BUXA 5G0RB 2OEKA 1VQKS 4J7CA 4KH1B 5B08A 3PX4A 2EFPA 5HSPA 2VQFF 2OD6A 3QT6A 4WPAA 5A6PA 1FEHA 2WTFA 3M7VA 3OL8A 1VGYA 1B7FA 2J8SA 2Q6BA 1QAYA 4C0OC 2RE1A 1KC8T 4LVOP 3UPFA 4NI2A 4CYUA 1SC6A 2HIQA 3MM5B 5F9LA 1CQMA 4CIOA 5BYSA 4ELVA 2VC1A 1RT3A 1A6LA 1RT1B 2RKIA 4B3MF 2NLWA 1RACB 3BKTA 5KFNA 3ELHA 5A8KB 3VQTA 2VOPA 1E6YB 4DMZA 1FK9A 1RQ0A 2FGCA 5D4LA 1JXLA 3MM8A 5KFJA 3SSQA 1C1BA 1Y5IB 3E2EA 3GR0A 1YZ6A 1TAQA 1UWAA 3WC0A 1IKYA 2B7CB 3L3CA 5IM0B 4U7UD 3CDBA 1KVJA 2RQ4A 3ZTPA 4J9LA 2FVSA 1NJZA 1H6KX 1R89A 4YDDB 1HBUA 2JEGA 1ZA1B 3EZ5A 4KFBB 1HWJA 1LNQA 2B9EA 4DR6J 2GVDB 2RUSA 3ENWA 3K89A 3OJUA 3SIPB 2DD8S 5B0DA 2G4BA 4LF4F 2V69A 1Y7PA 4AFFA 1YRTA 1VC6A 2CVIA 5CAAA 4Q44A 4M5LA 1TL7A 2NPIA 5ETTA 2MQQA 3OL7A 4M5DB 2EG2A 3RR8A 4OJ1A 3EVMA 2R8HA 3LP2B 1P1LA 4J9OA 4DSJA 3HVTB 2VG6B 4O23A 1NPKA 1QVGR 2HGLA 2G2ZA 1N52B 2YQ1A 3MM5A 2YWFA 2RJZA 3ZZZA 4O3PA 1RT1A 4CQ1A 1QTNB 1JNZB 2VC0A 1KKHA 3TQEA 3EGNA 5IT9Y 3C3LA 2J5AA 1NRKA 4DV4J 3C15B 3IA0A 2MSTA 5A8KA 1BLUA 1M1HA 2CXEA 3M6UA 1J2VA 4WFBQ 1HKAA 1XN9A 5A8RA 3PX0A 1AUDA 4ETZA 1VRQC 1TKZA 4CH7A 3N6MA 2CJ9A 4M5MA 2R7OA 3AB2B 5IM0A 3OTOJ 3FCVA 4Z7CA 4LRDA 3ICLA 3SCIE 3GJTB 1HD0A 1XR7A 3TJAA 3J7YI 1JLBB 1YBUA 4ZVRB 2ACMA 2CIMA 4LRCA 3HULA 3A4TA 3P3DA 1FD8A 3FRYA 4KYZA 3VAKA 1ZZNA 2NSCA 2VA2A 5D15A 1F2HA 4LFAJ 2DR7A 1HHQA 4ZA1A 3V5RA 1UVKA 1JJHA 2G0IA 4FF2A 3QAEA 5E7OB 5C42A 4CLWA 4ECQA 4K4YA 2B56A 4A8SA 2IJFA 2YPYA 1NK7A 1XJWB 2IHR1 4L75A 2AYBA 4X64J 5DGAA 4Y2MA 1M5PC 5EUHA 3WBZA 1QUPA 4ED6A 2DNNA 4LRFA 4USKA 3RAXA 9RUBA 2AYGA 3I5CA 4L6V3 1CC8A 1C1CB 5LL6d 1T02A 2LDYA 3LP2A 2RT3A 1NU4A 2V67A 3HVTA 1WC0A 2VG6A 2W24A 3LTOA 4HT7A 4B9NA 2GZOA 4I56A 4F4KA 3RR7A 4PCQA 4KBIA 2VZ9A 1WORA 1VQNS 1S6OA 1JLGA 1JIHA 2VD3A 1VRTB 2C2OB 2E7WA 4MMOA 1KTVA 3RW6A 2EFOA 5B0BA 4AL5A 4YUDA 3E8OA 1Y3KA 3PNIA 4W92B 4F3QA 3B6BA 4AUKA 3C66A 4CLLA 3GYXB 2FJVA 3NGDA 3FBEA 1RAJA 2HHVA 3DLGB 3H20A 3QPIA 1GTHA 1SJFA 4M1KA 1RT5B 3MEEB 2FLPA 1JLBA 1VQ9S 4WIIA 1BC6A 1R8HA 1IKVB 2M52A 4NA2A 2MB0B 3AY0A 1UW9A 4YFUA 1V3ZA 1XIQA 2ZNYA 2F8MA 3LP1B 3PKYA 2DXFA 4JV5J 4PYAA 5KFDA 5D0HA 1Q5YA 2CJQA 2Z4PA 3BR8A 3K5LA 5CCMA 3PVXA 1HWKA 1PILA 1RTJA 5LM7E 1RKJA 1GMWD 1KOHA 5F3TA 2M3DA 2ZH6A 5F8NA 4NLGA 4WFAQ 1C1CA 2EC2A 4NCAA 1HIYA 4JB8B 4EI2A 1FKPB 3S6EA 2JRSA 2V9WA 2WONA 5AE3A 4WZMA 4L3NA 1AFIA 2LDIA 2J0WA 4WKYA 4X65J 3DYAB 1H7XA 2L41A 3SEOA 1WEXA 1UAWA 4MKBA 4FP9A 1VRTA 4XK8C 4A8WA 5C24B 1S0OA 3OFHA 1WJ9A 4FNIA 3OD2A 1IJEB 1OWXA 2MKHA 3ISZA 2DGWA 2H9ZA 2H5IB 3DNCA 1LW0A 2VBWA 2RSQA 3TAMB 3PJWA 4PYDA 1RWNB 4ED0A 3HFZB 5L1IA 2HFZA 3S8SA 5AXMA 4WXOA 1RT5A 3MEEA 2E1CA 4LQ3A 1Q5VA 4OI6A 5HQ8A 3TP2A 4K2JA 5HN0A 3GYNA 3KK1A 4ELTA 2PI4A 5EN1A 4ED8A 4K4TA 3V6DA 3BF4A 1YDLA 2XMUA 3LP1A 1U6BA 1S9EA 1CG2A 3M05A 1K73T 3EWGA 1YVFA 1WG5A 3U27A 4F3MA 2GMLA 1EKSA 1PJ7A 4QU6A 1P8GA 5B0FA 2IPOB 2JSXA 4OYMA 2IA0A 4QPXA 3KJVB 3I31A 4B02A 4FNHA 2AF6A 3PX6A 2KU7A 5IXUA 2HK2A 4E8UA 1PG5B 3IAM9 1Q82T 1FKPA 4QIGA 4UQGA 2DT9A 5SZTA 2RRBA 4DSKA 4MYUA 3G2XA 2RHQB 3SMZA 1AYEA 2H4WB 2HS4A 3OT9A 1EJ7L 2RDDA 2OMLA 5KG2A 5KFKA 3TARA 3OSPA 1FJ7A 4P2FA 1MG7A 5C24A 1MSWD 1G6BA 3QFWA 4M63A 2ATLA 2RF2B 2XYPB 3MAQA 4P2MA 1DJ0A 1MMNA 1YJ9S 1DURA 1T05A 3KJQB 2WZ1A 1YRUA 1OY6A 2I5JB 2Y8YA 3TAMA 3U1MA 3AD7C 4O4RA 1IQTA 3IM8A 5T41A 4N8OA 1S0VA 4K4WA 2GNKA 4HYKA 1HNZJ 4DV5J 3QGGA 1U24A 2AKWB 3T9ZA 5ETOA 4CLFA 2KM8C 2B51A 5MAOA 3OVAA 5AE2A 3M8SA 3IC1A 2ZWOA 1X4DA 2DIVA 2UZAA 4CCHA 4DPOA 1EIYB 4X4RA 3HZEA 3HHDA 2XMKA 1NBEB 3GWCA 4HDHA 4ECUA 1VHIA 2QEXS 3T1YJ 3QT5A 3Q89A 4RKUC 2MY8A 4HLBA 4M94A 5KTQA 4YB6A 5E3QA 4CI0B 3R5JB 4R25A 1FNOA 3KG1A 4CLZA 3A8KA 4PXDA 3I6PA 1D09B 1YJVA 1RU2A 3BBBA 2KFZA 3L4BC 1HD1A 4ILRA 2JWNA 3MHYA 4ZIWA 3FNNA 1S0MA 4B3TJ 1NK5A 3TAQA 3KKFA 4DR5F 3IM9A 2OPQA 3UI3A 1TKTB 2ZKUA 1N4LA 7FDRA 3D67A 3H5SA 2HQGA 2NSBA 2C3OA 2FJXA 2RF2A 2DB1A 1X4CA 3VAMA 2XHWA 5KFZA 1UJ6A 3QGIA 4K7QA 2DGVA 2PO4A 2QG9B 3M8WA 2I5JA 1TU0B 4BCAA 2HHHJ 2UXDJ 3MD1A 1HR0J 3DU6A 2QV6A 1JLEB 4C8LA 2P2CB 2VIHA 4MIWA 2FZGB 3ZFVA 3IWLA 2XZDB 3PR4A 3V81B 1JJCB 4NLRA 4RNHA 3MPWA 1WNEA 4OZLA 2QIFA 4X4TA 2BA9A 2B9WA 1E6VB 1DRZA 2H4YB 1IBCB 1N33J 4IH6A 2H5JB 2ZJQQ 3FKBA 4QIFA 3RW7A 4ITSA 1Y5NB 4ECWA 3FMBA 3W7BA 2IA6A 2HVEA 4LMZA 2E7VA 2FJAB 2QYGA 2VU5A 3OL9A 4B9VA 4JI2J 1HI1A 4EWTA 4DUYF 1DBDA 3MMBB 3LP0A 3UE2A 1N32J 3T5LA 2CRLA 2GGPB 4DPXA 5KFAA 1TKDA 2FLNA 3LF0A 5F8HA 2IIHA 3BSAA 5KG1A 3PG9A 1Q8LA 2YQ0A 8AT1B 1N5SA 4DV4F 4UOFA 3TZYA 1UVJA 3KLHA 2LFVA 3QLHA 2A2CA 2BRLA 3R9LA 4CO5A 2HVZA 1NH7A 1IN0A 3PY8A 3PV8A 4TYAA 4J9NA 2Q79A 3T6BA 3R3TA 4IQXA 1V3SA 2AJ2A 3ZTOA 1RP5A 2FUG9 4KHMA 1SC3B 1WC3A 3OTOF 1PJ5A 2M2BA 2EBGA 3QZ8A 5LT5A 1UTAA 2EFGA 1HW9A 3CW2C 2WW4A 2DGUA 2U1AA 1JLEA 1G7CB 4ES2A 2LP4A 2Y1IA 4QPTA 4LQ9A 1FNMA 1DTQB 1K0VA 3W66A 3V81A 4USWA 3UN5A 4H54A 2IM3A 2K3IA 3H2UB 3PO4A 4LFAF 4C0BA 3TUPA 5LXRA 4ZJLA 2F3JA 1ZBTA 3D9BA 2CG8A 2JFDA 1MWYA 1E6VA 2Y1JA 2A6MA 4KKOB 3DRPA 4X64F 3PYEA 3FSIA 1JLAB 1U1LA 5J1EB 2APOA 2X51A 2F7VA 2VDIA 3Q8RB 1VRUA 3KK3B 5FJ4A 1RTHA 3AXMA 2PE8A 1LFWA 5M2RA 5KT7A 1MW7A 2PC6A 4CLPA 5J2MB 9ATCB 3GIKA 1O8BA 2C2NA 3T3FA 4C7QA 3DLHA 1XQIA 1EAYC 1I51B 2J6TA 1QUVA 4DL4A 3K17A 1VDHA 4CRJA 4UZBA 2XMWA 2FGOA 4JI7J 2BZ2A 5LMNJ 2FLLA 1F3FA 4BHQA 2HVHA 1IR2A 4YEAA 1WACA 4DSLA 2ASLA 2GGPA 1RHUB 4ANEA 3LGHA 4MTPA 2VASA 4ZP7A 4JI3J 1U1NA 3UVJB 1T9WA 3GONA 4QWCA 1L3TA 3KHGA 1SCJB 1YQHA 4Q2MA 2MKKA 3D0IE 4USIA 3HP6A 4KGKA 3PRBA 2J7KA 1RAHB 1REGX 2ZDOA 3FZBA 2HEKA 3IN5A 4CO1A 3F41A 3UWTA 1NHUA 4DR7J 5KFQA 2WOMB 1TV6B 1TK8A 3S01A 1BHNA 1VR6A 2A0FB 4ID8A 2IJRA 4EBCA 3EICA 3CC4S 2HHQA 2C28A 3HKWA 2XZWA 3OSNA 2VPYB 1UPPA 1VOMA 2ASDA 3DDNA 4Y2IA 3FZ2A 3MGJA 1RHMB 1Q1KA 4YHHJ 1FRXA 3AOAA 3DOKB 1JLAA 2DHAA 4WBFA 2B4PA 5J1EA 2V8HA 3F44A 3FCWA 3KK3A 2JHEA 3FSYA 4DPUA 1UJ5A 3GJQB 1HPZB 1LFPA 2PGCA 3RB6A 4O3QA 1Q79A 2BX6A 5KFBA 1JNRB 2OMOA 1IWAA 4QWBA 5J2MA 4PRFA 1FTRA 1TFWA 1WF0A 1FFSB 4CLUA 1Q0NA 2J6UA 2ZFHA 5KFYA 2B8PA 3DHWC 1P9YA 4EFAC 2OHDA 2RIJA 1RHQB 4PQUB 4X65F 4ERDA 3IG1B 1MWQA 2AZ3A 1S72S 2Y0BB 3RBXA 4ZDNA 3PW7A 3P6YC 2R7TA 3UVJA 1VQPS 4HI2A 2J6SA 5SUHA 4IDKA 1LOUA 1KONA 3OBIA 5IC4B 1NJYA 5I3UB 5JUMA 4IRDA 4Y28C 4ES3A 3FDSA 4O3OA 1CJTB 4CTAB 2MJUA 3I4PA 4FYYB 3NG8A 3CULA 3J81U 1I6JA 2ILYA 5J2PB 5BXIA 4F25A 3IO1A 3NGKA 2LMIA 2DJWA 5L39A 2VFSA 3TUIC 1RUSA 2RRNA 5JXSA 4M5KA 3TWZA 2JJ4D 2CJBA 3J7YU 5HVFA 4U8VA 1U0HB 4OYPA 1WOPA 2V8GA 4IR9A 1I1GA 4YR3A 5B0AA 2B4VA 1NKCA 2LEAA 1TTHB 3DOKA 1FJGJ 3DRYA 3JQJA 1Q86T 4N77A 2RS2A 4LREA 4QOTA 4ICLB 2Z57B 5I42B 5IV3A 3D54A 4IRKA 3W2VB 2M5YA 2DCUB 1HPZA 3Q8UA 5ADZA 4L76A 3FEZA 2BR0A 1TK5A 5LSLA 4K2XA 3X3UA 2GAHC 1V3RA 4XPCA 4FYXB 2HHXA 2OP5A 1F5CA 2BJ9A 5GADI 3T6JA 2R2SA 4W4MA 4DUZF 4E0DA 1B7YB 2E7XA 1VQSA 2FHJD 2GO8A 3LGNA 1QD1A 2HNDA 1NO8A 3IG1A 4NZ6A 4J37A 3OXFA 2ADBA 4P74A 1SJ3P 3NOGA 1RZMA 2BOAA 2HS0A 4CH1A 2E9TA 2C2EA 1Q7YT 3X1LB 3DDIA 3SV4A 4B08A 4BC9A 4WFYA 2OELA 4WFZA 1L3KA 1XNRF 2CFXA 5I3UA 2MLZA 1FKAF 2D9OA 3DMJB 2Q1LA 1CJTA 4CTAA 1X7VA 3CWJA 2CPZA 1X9WA 1EETB 5J2PA 4WP3A 1NDCA 4LSNB 5ETKA 3KG0A 2BUNA 4C8KA 2KHCA 4WKRA 1QY7A 2V0NA 1LQ9A 4OZ1A 4DF8A 2JVRA 3IR7B 1LK7A 5HMWA 1NJWA 4NLWA 5A8WB 4YN3B 3M1VB 3J7ZT 4DL0C 1VCTA 4KPCA 2DNRA 1AROP 4AQYJ 4CO4A 2LECA 1K47A 2G1HA 2E9RX 2UUAJ 2XLKA 5CABA 1NCLA 2CNLB 1KNZA 4BWMA 2ZZTA 1HNVA 3T1YF 2HRTA 5I42A 2HK3A 3W2VA 4ZVOB 2HQCA 3QBCA 1HYSB 5IFMA 2BDPA 2E5HA 4ZLJA 4DN0A 3LO3A 3WQPA 1FNXH 2G2OA 5ETMA 3VTIA 4ZLNA 4DU8A 3BGRB 4NRTA 3VF0B 2HVIA 1S9GB 3W5XA 3H40A 2LU1A 2W2QP 2ZHAA 3OVBA 2O3DA 1YRXA 1SJ1A 4A8QA 3NCQA 3I0SB 2GW8A 3SSSA 5DQGA 4B3TF 2CDQA 5D6GA 2QLWA 1MN7A 3NNCA 4CZCA 2VA3A 2HHWA 4K4SA 3H2LA 2R4FA 2E1RA 2OSQA 3QMQA 4OLOA 2XSJB 2J9EA 5DZ6A 3LWMA 2RQMA 1KOOA 2PMZD 4JBCA 1HA1A 4PR6A 2LEPA 3BDPA 2NQPA 1EETA 2D3O1 3A3NB 1SL2A 3HVWA 1HR0F 1N5VA 5AJ3J 2R3VA 4YOEA 4JP8A 2W8LA 2X1GA 4QU7A 4HTIA 5A8WA 1N6QB 3UO0A 2YKPA 5A2QY 4J91A 3W3SA 1U4BA 3ZZ0A 3K8WA 3HHLC 1AB8A 3G4SS 3PR5B 3RUBL 3M6WA 1FFGB 3ETOA 1U2CA 3CD5A 3GYGA 4NLSA 4NYPA 4HT5A 4NLDA 1PO6A 4LR7A 3G86A 5KT5A 3OXLA 1MN9A 2H1YA 1KTQA 3JAMU 4HI1A 1R0CB 3G8TA 1TMMA 5T14A 4DDFA 3N4WA 1AXQA 2L9DA 1RYRA 1U09A 2YKQA 2I1RA 1AT1B 1S9GA 4JI2F 1FKOB 5LSOA 2HQ3A 1U1PA 2V8DA 4R8UA 2XHCA 1N32F 3I0SA 2CNNB 3FQLA 5JVGQ 3CGIA 5L9NA 4IO1A 4WE1B 2HBRB 3EX7B 3BSCA 4H4OB 2VFRA 3W5ZA 2J7WA 2E5JA 4WK3A 2YBVA 2MZ1A 2W7PA 5D77A 2LQ8A 2QN6B 4ZVHA 3U7JA 2CYYA 2B4OA 1GX6A 2KJWA 3OJSA 4B9TA 3A8JA 4NL5A 2W2MP 4LR9A 3VALA 4OJ3A 3N9UC 4QWDA 3OL6A 2VV5A 2J0SD 2HHTA 1VHFA 3NNAA 3M9MB 3G82A 4YY3J 4ECXA 3NCPA 1FT8A 3GFHA 1N6QA 4O44B 2RNEA 2DCLA 2IFXA 3BDEA 4P6QA 2DRDA 2KXNB 3BH7B 1R6YA 3PW2A 4TU9A 3VCDA 5CYQB 3W65A 1RBOB 1KVKA 3JSYA 1SV5A 1OYEA 3PW4A 2R7RA 4P9SA 1T03A 4DLGA 5E3PA 1RCOB 2ZD1B 1T7PA 1G2EA 4X4SA 4FDFA 3LWLA 3MD3A 4FKYA 2GMJA 1FKOA 2F8HA 3JXOA 5K20B 1S4FA 4BWJA 3WC2A 1XERA 4JI7F 2D1CA 2CPJA 3CCWA 1R8BA 3FQKA 4OHWA 2XCPA 2AJQA 2HBYB 3HHLD 4WE1A 4JI3F 4H4OA 2ZVIA 3V2UC 2B0GA 4A8OA 2CNOB 1WKJA 4PQAA 2VJUA 4KO0B 4DV3J 2KO1A 3ZZYA 1WOSA 4NLUA 3GIRA 4KE5A 2C3MA 5BR8J 3QSIA 4ZVEA 1PGZA 1DQ9A 3CE8A 5C2GA 2R8IA 4QW9A 4OIXA 4QCLA 4DR7F 5F0WA 1PYSB 2R42A 1IBLJ 2YY3A 3HSDA 4ZOSA 1TVRB 4EO6A 5HMYA 3R7SB 1JLFB 4AD6A 3NBPA 4R0EA 1UEUA 2QTWA 5KFEA 2MZRA 2V2ZA 3IWNC 2PD1A 3HPOA 1FHTA 4YHHF 2V63A 1QSSA 5I3PA 5ETLA 4DV7F 3VGUA 3GSDA 4IH7A 1R0AB 3JSMA 2XEXA 1C2PA 3TUZC 5KFFA 4NPOA 2E1PA 4OYAA 1TL3B 2PMWA 2VUGA 4JI4J 1DHMA 5DJBA 2JC1A 2KKHA 1ZOTA 4UOCA 3BQ0A 1RJJA 3GPAA 3G9CA 1PAEX 1U48A 4GC7A 2AV5A 2WK4A 2VQFJ 2W4PA 4HHHA 3AQOA 2HS3A 5IQ6A 3DOMB 4RX6A 2HBQB 1NSAA 4QYRA 4ZLLA 1PC5A 1CJVB 3R5GA 2X7IA 2CPXA 2QA4G 3CJ4A 3M8PB 2XS5A 4C8MA 4LBIA 1RA6A 4B17A 2QL7B 2H48B 1UPMB 4OI4A 3OTEA 3DGVA 1TP7A 5HK4A 3JTNA 3HF5A 4IR1A 3KUGA 2YWKA 3F56A 1SQEA 1I94F 2DH8A 4B3MJ 3LALA 2JNJA 1KQKA 2GQQA 2Q43A 1SQFA 1M1KT 1S77D 4Q0BB 8ATCB 2BRKA 3MR5A 1F3VA 4F4XA 1TVRA 3MOJB 2D69A 5KFWA 2XI3A 4TXSA 3M9OB 2RU3A 5IT9U 4HHJA 2XS7A 1WHWA 5I3QA 3AAWB 1L3VA 2GHPA 1Z2ZA 3EE3A 2VG5B 2IC3B 4I69A 3BO4A 2NZCA 3VVUA 1JLCA 2G0CA 1FJGF 2RU9A 3C6UB 2ZDPA 2VHGA 1KRPA 1OPZA 3PM9A 1R0AA 4HKQA 2Z0GA 4F2SA 5HO4A 1IKWB 1IWGA 4NLVA 2O67A 3ULHA 2LQBA 1D0EA 1TL3A 3VGTA 1S1VB 4PG6A 5KG3A 4LF4J 1FRIA 2EG1A 3DFEA 1ULRA 2E5LJ 3J7AN 1OQ6A 1UEVA 4ZHRA 3QWUA 3ADAC 4BS2A 1FWPA 5DG8A 1HHTP 2XULA 3TX0A 4DR3J 2DNLA 1LK5A 2EEYA 2OJ3A 4K5RA 2ZUAA 1WI8A 1CJVA 1RWMB 2CQHA 2PN6A 4P2SA 4C8NA 4DX6A 1V6HA 3HHKA 1JQGA 4RW7B 5IOLA 3M8PA 3H2VE 1CJKB 2LXIA 3TA1A 5HBMA 3TYTA 2EXUA 1U0SA 2FTRA 1OJ4A 4R0JA 3R6GB 1NK9A 1TELA 4RBUA 4PG4A 3AD9C 1UA0A 1F5AA 2ZHOA 1WELA 3CCRS 4Q0BA 3GR1A 3DXBA 2WSCC 4TQRA 2KB2A 3WZ0A 1O6XA 2B8QA 1WWHA 3EVWA 2DNZA 2BQ3A 1JX4A 3K2YA 4AQYF 2HBZB 1H74A 1NDLA 2XGQA 3NS7B 2H5EA 2VG5A 2XB2D 2CKWA 2IC3A 2QX0A 3NOCA 2ZJPQ 2DK2A 2VG7A 1ZETA 1VQ6S 2E1AA 2VKZG 1R6VA 3GSIA 4UOHA 2EC0A 1DQ8A 3Q24A 2J0XA 4OX6A 1VYAA 1I5OB 4XTTA 2BXJA 3R2CJ 2C2ZB 1KSPA 3C19A 3W63A 2UXCJ 3BN7A 4ZVGA 4CLTA 2JH3A 3H42A 1WDDA 2NXUA 2HRYA 4HH1A 3EMTA 1S49A 1N0UA 1IBKJ 2YWHA 1QDUB 1SIZA 3UQSA 1EZZB 3AJDA 1B0TA 4RW7A 2MQMA 1YGYA 3RTVA 3CTRA 1SL1A 4OX8A 1WDTA 1CJKA 2BKPA 3OFGA 3K7RA 1S1UB 3G87A 5E5NA 2OEMA 3AT1B 3CXCR 3V6KA 5KT6A 3RRKA 1X5TA 4D3HA 4OHYA 4ZCIA 5L46A 3LANA 2Z58B 2F65A 4PZVA 4RR5A 4DCPB 1N56A 4IO9Q 2C2RA 1S12A 5D78A 5AJ3F 4MIAA 4RJVA 1VIOA 1S1XB 3TANA 3KUHA 3CUNA 3KK2B 4ZVPB 4U8YA 1TAUA 2CADA 4DEZA 4ZN3A 2ZZMA 4P71A 2C2KB 3LW5C 3M8QB 4W98A 3D6TB 1KR4A 3M2VA 2XYHB 1RT2B 2YNIB 4OYWA 5LJ3Y 4FXDA 4C98A 1LWCB 2GAGC 4KY3A 3CCZA 2XLJA 5GVQA 2CJAA 5FD1A 3DLBA 4PWDB 2EFNA 2F5GA 2P6TA 4DJBA 2ACYA 2CAJA 2RQCA 3W2WA 4P72A 1UWBB 2YKMB 1PYOB 1ZAWA 1WG1A 2K7KA 3EZOA 3DM2B 2ZH8A 2R8KA 5IQQA 2LA6A 2QA2A 1O0PA 3PEJA 2HZAA 1RB0A 1LW2B 3DHXA 4WFXA 4DQRA 4Y6IA 3QGHA 3OR2B 2QMUB 1WSRA 1CULB 5GADU 1HI8A 1TMJA 3MR6A 5F8IA 2F9DA 2EFVA 5H1SV 3F73A 1S1UA 3FK4A 2KM8B 1B0VA 1WD6A 2ZH9A 1FERA 3R97A 4WYLA 1WI6A 3BB5A 2K7JA 3D0HE 2DH9A 3CO9A 1L3SA 2QFIA 1P27B 2KI2A 1S1XA 3MI7X 4RWXA 3VZHA 4ED4A 3RG6A 1GQEA 2RUGA 4QIVA 3W61A 1CJUB 3PDNA 2K3KA 1HNIA 3M8QA 4OYXA 1RT6A 1CSJA 1J27A 1RT2A 2YNIA 5DDQC 2MQ8A 2ZH2A 3R2DJ 3M30B 1JB0C 2Q66A 1ZM4A 3U02A 2EKNA 3I0RB 4PWDA 3MAAB 2BABA 3M2UB 2CZVC 1C4AA 1W2BR 4GKKJ 1UWBA 2YKMA 4DSFA 4DV1J 3UDVA 1YTYA 3DM2A 1J5OB 4QWEA 3M2RB 3W9JA 4I6YA 2HNZB 4K0KJ 1HBMB 2GHWA 1SVDA 4MFBA 1V5VA 4ZPWR 2HVDA 3FSXA 3QGPA 4F36A 3QRPA 4DR4J 1F9EB 1EQ0A 2B9XA 3G6XA 3B54A 1P1TA 4RU2A 2XMVA 2JEFA 4X62J 2SXLA 2AX0A 2KYZA 5F8MA 2UUBJ 4FBUA 2DKOB 5K8MA 4WU3A 1M5VC 4DQPA 1F6TA 4CYUB 2HFUA 2DNYA 2QSFA 5C25B 2XNRA 2AX1A 3D68A 1U8WA 4HH0A 2YWGA 5B09A 3Q22A 4ZP6A 2U2FA 4A4JA 4U96A 4ZMMA 4LIWA 3GFXA 1IBLF 1PC4A 5KFHA 2DTJA 3MM8B 1HNWJ 4RW9B 2IVYA 1C1BB 5A6WA 4RNOA 2JLFA 4USTA 3ZXWA 3NWRA 4JI5J 5L1JA 5L38A 2UU9J 2N3LA 2FPHX 1GX5A 3KXDA 1CJUA 5KFRA 2WW8A 4CT8A 3OXGA 2BJ3A 4OZNA 4Q2LA 3M30A 4NZ7A 3I0RA 3PYFA 3M2UA 5BYQA 4CP5A 3PFEA 4LF5J 2V34A 4ZKAA 2HLTA 3LA0A 1OSCA 4JI4F 1N34F 5E3AA 1RABB 4WWSA 2HNZA 1U7LA 4OX9J 1HBMA 4MH8A 4R5PB 1VQ8S 5KG0A 1TL7B 1WOOA 5FIIA 4J5OA 2GFFA 3MECB 1UP1A 2BM0A 4EZ9A 2AGQA 2MGZA 1RAGB 3QT8A 4YP3A 5D4OA 2R2TA 3NP5A 3MR2A 2COLA 4G65A 1ICEB 3IP0A 3DCAA 2MHEA 5C25A 2Y3YA 4DR5J 3ZZRA 3IWXA 4B3OA 1ZA2B 2FZCB 3OHAA 4NRUA 2QLXA 3BYRA 4LSLA 1YBTA 2Y1LB 4RPFA 4F8RA 3IRWP 4DFPA 4DV0J 4ZP8A 4FF4A 2KTQA 2NPFA 5A8RB 3NL0A 4DS5A 4RW9A 4RUBA 1OYDA 1HL6A 5HVHA 3FC9A 4NEZA 1TKZB 5ETNA 3SCLE 4NYZA 4Z37A 2L3MA 4K50A 4E98A 1XMQJ 2OPSA 4G6VB 3MUTP 2BJ7A 4H4KA 1N88A 1GTEA 4FVMA 3TO8A 4K59A 3CDUA 3Q0AA 4L3KA 3M4XA 1WF2A 3PRVA 3TX8A 3Q8PB 3PIPQ 3BBCA 3AODA 4DPYA 3G6YA 4ED2A 1SUQB 3QO9B 1T9XA 3D1OA 3S7RA 5C42B 3T1HJ 1K9MT 3CCVS 5H9FK 1FRHA 4QJVA 3I9V9 3DRRA 3WIVA 3ZTSA 2R7SA 2JLGA 5K8OA 2E5LF 2YH0A 4G1PA 2FYXA 4R5PA 4ZIVA 4LF8J 2RAQA 2X3DA 3C6TA 2FQQB 2XZTB 3IBCB 3MECA 4DR3F 1AUSL 1TUGB 3AH6A 2OLWA 3OFFA 1OY8A 5J2NB 1FX4A 5GAEI 4X84A 4DUYJ 3CJKB 4OI3A 1XBWA 1N5TA 4NCGB 2AQ4A 1IM4A 4KGVB 4F4YA 5ITHA 3ZO7A 4OYOA 1SI9A 3PKMA 3MM7B 1JLGB 1RWVB 3HT3A 2CJXB 3K58A 3Q2TC 4TKTA 1X5OA 2NXJA 4P10A 5JMNA 3TR5A 3KOAA 5H9FJ 3K59A 1CC7A 2F4FA 2N82B 4G3IA 2DPJA 2R2UA 1N5YB 2GJ2A 1S79A 3QATA 1WKLA 4XPEA 5D3GB 4XO0A 4U7UK 4KHPJ 1YHQS 4HDGA 3NNHA 3GTYX 5GAGI 5E3CA 3MPYA 4DR2J 1S57A 2IM2A 1YG0A 3D1QA 2M7SA 4ENOA 3PYDA 2ZH3A 1YK9A 1SH3A 1SUQA 3QO9A 4DS4A 2UVWA 2CQGA 2MKCA 1UMJA 4QIEA 4Y00A 2FJEB 2ZBPA 3K0JA 4GC6A 3C8YA 2RHSB 1IXKA 3NKYA 4LFBJ 3B78A 2VL1A 2AHOB 2QGFB 3AJ2A 1UW4A 2UXCF 1SJ4P 2Z30B 4AXJA 4I2QA 1RTJB 3UN2A 4DBQA 4XAKA 2IAJA 3SXLA 5LJ5Y 3ET6A 2IRUA 1YJTA 1IBKF 3CB4A 1A9NB 1VQOS 1SBRA 5J2NA 2V4JB 1Q8IA 2AEJA 1GK8A 3TUJC 1H0HB 2CG4A 1EHWA 2WONB 2CVEA 3CJKA 1N36F 3AD8C 4AT1B 2FVQA 4NCGA 2FHJA 2NXCA 2KG0A 4CNYA 2A18A 2HWTA 3HFVA 1Q53A 2OPPB 4JUZA 4MKAA 1KFSA 3AJ1A 3MM7A 2W8KA 4TU8A 1SQGA 5F3ZA 2FDNA 5KAKA 5DLGA 2R2RA 4PKDB 3EVOA 5KG4A 4OLPA 1O51A 2W9BA 1N5YA 5D3GA 2FIUA 2FLOA 4XDDA 4FPIA 3GU0A 1LW0B 4CNZA 3Q86A 2KYXA 4EBDA 2HYIB 3PIOQ 2W9CB 2WVFA 4FN5A 1LXJA 2DHXA 2P8IA 4RW8B 4C97A 5DO2A 3CCJS 2GIFA 2WAQD 2Z2LA 2IVFB 3KWMA 3KK1B 3PHTA 3W8PA 3DXSX 3HHNB 5KFGA 3GP9A 4C0HA 2HNYB 3V6DB 4QR1A 1N5QA 4TNOA 3P49B 2HQIA 4X2BA 1S9EB 2BE9B 1C0UB 2DISA 5D0RA 1DTTB 1F9FA 4CM2A 3US5A 3KLIB 4MJKA 4QBUA 3ILIA 2D7SA 2O01C 4V19X 2IM1A 3JQMA 5G4DA 2WVBA 1HQEA 4A8XA 2G1DA 3OUYB 1U45A 3O6QA 2DNHA 1ZYQA 5KT3A 2VBZA 2V4JA 2BVZA 4O3NA 4FF1A 3KHHA 4J9KA 4J9RA 1RLCL 4JI6J 2KRRA 3TA2A 1WHYA 2B6AB 1XMOJ 4A47A 4L74A 4NXMF 2OPPA 4UF4A 2KT3A 2KZMA 1HHSA 3ZZPA 1QE1B 3J81Y 1WHVA 4ZVQB 1YZ7A 2ZBQA 3F0NA 3HVAA 2QL9B 2XQCA 1X5SA 3M9NB 5KFSA 2QA1A 3UR0A 5KG5A 1F60B 1T05B 5KFXA 3CIZA 3CJQA 2YWWA 1BY9A 2ZH4A 3AOCA 3MXHP 3VAGA 2UV8A 3VHQA 1X4EA 2DO0A 2W9CA 3HXMA 2DGXA 2R7XA 2XY7A 1Y5LB 1DAXA 5A0YA 5L1KA 1FTCA 2OH2A 3KNAA 2MMYA 1VQ5S 5AT1B 5D4NA 4RW8A 1RAFB 4GKKF 1VLYA 4DV1F 2FHKA 1BE4A 1O5JA 3P5BP 1VQMS 4M5HA 2HNYA 1RSCA 1HLWA 2LVWA 1L3UA 2AU0A 3IBFB 1C0UA 2HAIA 1DTTA 1M5HA 4K0KF 4DG1B 3G71S 4PPDA 1LEOA 3KLIA 3V4IA 2WVDA 3HSZA 2ZOFA 4IG3B 3UFCX 4DR4F 1S59A 3A3PB 4M8LA 2GQ2A 4M5GA 5DGBA 4OZ2A 1RAEB 2IBOA 1HWLA 2DH7A 3OUYA 2EPIA 1F2GA 5RUBA 1SXLA 4X62F 4UY8T 2UUBF 2JL9A 1URRA 4JI1F 2BJ1A 2A10A 4DUZJ 2IRYA 2L08A 2B6AA 2DEIA 3ILOA 4NLOA 3NGUA 1YWXA 3GCWP 2OPQB 2D9PA 2ZOMA 4WTOB 2BBEA 3LOUA 4YQWA 5KOWA 1Y11A 4PEOA 5DLFA 1QE1A 4B3SF 2Q6CA 4H4MB 1NLKL 4WTYA 5AXKA 4ZP9A 1FE0A 1HNWF 5EDWA 2OKQA 4K4ZA 1JLQB 1B70B 1XNRJ 2DGTA 1R8AA 5CXTA 4JI5F 3H5UA 2UU9F 5T7LB 1CEZA 3IR5B 3K5OA 4V19J 4RNNA 2EW9A 1BQXA 3L7UA 2RMLA 3LUYA 1QJHA 2V2KA 1VLOA 2ILZA 5LMUJ 1FRLA 1SB6A 2VQEF 2XS2A 2JZ5A 4C3LA 2VPXB 3W5YA 3H98A 3VAFA 4LF5F 4CO3A 2VJVA 1EKRA 5F41A 4URQU 3J7Z5 4F50A 2NR0A 3NWGA 2GVZB 3TQ1A 1BQMB 1B4SA 4OX9F 1Q8BA 4DG1A 2XWYA 2ZBCA 1D9DA 2ZBIA 4LSZB 2CPIA 3H4BA 1X9MA 4IG3A 3GFZA 2DIUA 2DO4A 4HHUA 3CPWR 3BO2A 3H7HB 3I82A 2UXBJ 3A12A 1KQSR 4J9QA 4NLYA 3MAHA 4NLQA 2K1RB 2EWHA 3P45B 5BJRA 3N6LA 3LP0B 1FDDA 2KH9A 2H54B 4USJC 2HGMA 4ZPVR 3W1YC 4CM0A 3ZZUA 2ROPA 4LF6J 4QR0A 4OYBA 3GJSB 1KBRA 3W60A 3BPSP 3B8HA 3HHLA 2PEBA 4MKYA 3KLHB 3QLHB 4H4MA 5HQLA 4ZCKA 4DXLA 4N47A 2HLUA 3SCKE 3MTJA 3BSNA 4DV0F 5KFTA 3VR1A 4OQJA 5FLXY 1W2IA 5K5MA 1JLQA 3ZTQA 1OY9A 3TZWA 3MUVP 4DF4A 3OPKA 1DLOA 1KHWA 4M5JA 1SPBP 5T7LA 3T5KA 1T9VA 4DU7A 1XMQF 4P2XA 1QTMA 2MPUA 3CMAS 1S7IA 1W7WA 4DL7A 1GMUA 4PAAA 3NGSA 1Q81T 1N0VC 3P5TL 1SC4B 2CPFA 4LBHA 3KTQA 3PRDA 4BLGA 4IFVB 4DX8H 2I38A 2N3OA 2YNGA 4NOHA 1IR0A 3T1HF 2GVZA 3IBWA 1BQMA 1C4CA 3I87A 4J9PA 3DRPB 2HIYA 3MEDA 2E1MC 1REVB 4OJGA 2VPWB 3MMAB 4LF8F 1VRUB 3D2WA 1RTHB 3WIUA 5A76A 3HZGA 2KXFA 3MTKA 2ZITA 2W7AA 3I96A 4EYHB 4N76A 2K1RA 3FMWA 4B9UA 3K5NA 2F63A 3IFEA 1VC0A 4KGZB 3QFHA 4GKJJ 4C11B 2FC8A 1S1WB 4DL2A 2OFGX 1LWEB 4OZ3A 4QYZK 1K0TA 3DGPA 3KHLA 4JI0J 3NCRA 3D5MA 2UVUA 4LT6A 2YKAA 2NYIA 5KFIA 1RDRA 4AL7A 2XMAA 3GG1A 1FVSA 2BW7A 1ZTTA 2CWKA 5GMKa 3N5BA 2YNHA 1NB2A 4KHPF 5KFLA 3NGRA 4BBYA 2DRBA 1RBAA 2YWEA 4ATNA 4DR2F 4Y2CA 1ROFA 1U1KA 2IBKA 4Y2KA 2BJDA 5J1NA 2EFQA 3CCES 3N79A 3QQCD 4IFVA 2JC0A 1Y9OA 1RWPB 2ZH7A 2GQCA 3T5HA 1C0TB 3P96A 2LXFA 1S76D 2GIRA 3KLEA 4F4AA 2V2VA 2E44A 2EK1A 4LFBF 3DDKA 4QYZJ 3KDOA 4HVZA 3D3CJ 3HVRA 4ECTA 1V5IB 5F8GA 1REVA 1J5EF 2ZUGA 5KFVA 1UFWA 3MMAA 2DITA 2FC9A 4QWAA 4CO2A 1PBAA 3R7NB 4FPRA 5EWEA 3CJRA 1MNEA 4O0IA 1CPZA 2ALZA 2C3YA 1Q7LB 4IYQA 2GJIA 2KVQE 1U6ZA 4Q7AA 5D0GA 5L8RC 3RB4A 2XNQA 4YR0A 1YJ7A 1JXVA 2QMXA 1ZS6A 1EX8A 2VF3A 1Q4RA 2PDAA 2RQKA 4C11A 2AJFE 4F0MA 1S1WA 4ZVSB 4EO8A 4GO7X 1LWEA 3J81j 1ZH5A 2I0XA 2YKNB 1ACMB 1X31C 2R8GA 1LWFA 4IDKB 2AYMA 4CLKA 3MMCA 3KLGA 3C2PA 4ALZA 1RBLA 3Q8YA 1RT4A 3M6VA 2KFNA 1LWXA 1SJRA 3GV8B 2KXHA 2AJ4A 1GAOA 1WTFA 3Q23A 4B9SA 4DX7A 2N4CA 2CQDA 3LPEA 2D74B 3OR1A 5L1LA 2D3UA 2IY5B 1C0TA 1FXDA 3CCTA 2QZ8A 1ELOA 1Q78A 1XC9A 3BM7A 1PIEA 2KJVA 3KDNA 2FVCA 4Q45A 3GQCA 4DV7J 4CH0S 2MZTA 3BR9A 2JFKA
chains in the Genus database with same CATH topology
1FRJA 4Q8FA 2NXUA 3DRSA 2HRYA 2OMLA 3EPGA 5KG2A 5KFKA 5KT4A 4HH1A 5DM7Q 4EU0A 3TARA 1S49A 2E5GA 5KFPA 4Y0FA 3MWBA 3OSPA 2XBPA 1N0UA 3TVYA 1FJ7A 3H5XA 4KGMA 1HBNA 4C4WA 2YWHA 2IRXA 3EXCX 1SIZA 3R1HA 5C24A 1MSWD 1K8AT 1G6BA 3UQSA 2B9YA 1FXLA 2ATLA 4M63A 2AGOA 2RF2B 1B0TA 4ECYA 3MAQA 4RW7A 2MQMA 1XK8A 3DLEA 1YGYA 2LKZA 1IQZA 4PXEA 3RTVA 1DJ0A 1QVFR 1MMNA 3CTRA 1F5BA 1YJ9S 1SL1A 4OX8A 5IT4A 4AL6A 5F8JA 3OFGA 1DURA 4HEA9 2B3TB 5G0RA 2MY7A 2QT7A 3K7RA 1S1UB 1T05A 1YITS 1FRMA 3UNGC 1YRUA 5E5NA 1X0FA 2JX2A 2HMIB 2UUCF 2K2PA 4HTJA 4JI6F 3QJPA 1VI7A 3MF5A 2I5JB 3MR3A 3TAMA 3CXCR 3U1MA 2LQ9A 3GG0A 3V6KA 5KT6A 1XMOF 3RRKA 4BC7A 4O4RA 5EWGA 1F0XA 1X5TA 1IQTA 3B4DA 3WX4A 1JK9B 5T41A 4D3HA 3FJ2A 4OHYA 2CZ4A 4N8OA 4ZCIA 4K4WA 1S0VA 1N48A 2GNKA 3TVZA 4HYKA 2HNDB 3LANA 1NK4A 2HW3A 3QGGA 1N56A 5GAEU 1U24A 2KZZA 4IO9Q 3IXQA 2C2RA 3T9ZA 2F4VF 5D78A 2OD4A 4I2QB 3JTPA 2KM8C 2B51A 2DPIA 5MAOA 3HFKA 5KFMA 5AJ3F 4MIAA 3OVAA 2IAJB 5AE2A 1VIOA 1S1XB 3TANA 3EXYA 3M8SA 2YKNA 3CUNA 3IC1A 3SYZA 1Y3JA 4KPYA 1X4DA 2DIVA 5KFOA 4W90B 1XTZA 3KK2B 2UZAA 1DFDA 3JTOA 4CCHA 4DPOA 3NAHA 3TVKA 4X4RA 1NNDA 1TAUA 3HZEA 3NS5A 3RB0A 4DEZA 4C8OA 2WSFC 3HHDA 3QIPB 2ZZMA 2XMKA 5B0CA 4LF9F 5LMNF 4ECSA 4RBTA 3LW5C 3GWCA 4TLQA 3M8QB 2DNOA 4HDHA 3VAIA 1KR4A 2DNQA 1S6QA 3LPYA 3M2VA 4ECUA 3R5DA 3R1LA 1VBXA 1RT2B 2YNIB 2QEXS 5LJ3Y 4FXDA 2M0GB 4C98A 2ROEA 1LWCB 2MY8A 4RKUC 3L09A 1E6YA 4F2RA 4HLBA 3CCZA 2XLJA 3MM6B 5GVQA 4M94A 2CJAA 2O66A 1U6FA 3DLKB 2ZM6F 5FD1A 1NK6A 4QW8A 1B64A 3DLBA 1QAXA 5KTQA 4PG7A 4YB6A 4PWDB 2EFNA 4I6AA 5E3QA 4CI0B 5EX0A 2LEBA 2E9ZA 3PFOA 4R25A 2P6TA 4DJBA 2ACYA 1FNOA 3KG1A 3S1TA 1TL5A 2RQCA 4MK7A 1X4FA 2DNGA 3W2WA 1FEEA 4PXDA 1UWBB 2YKMB 1VFJA 1HI0P 1ZAWA 1WG1A 3I6PA 2UVRA 2K7KA 1YJVA 3DM2B 2ZH8A 3CJ2A 2R8KA 5GAGU 3EZUA 2YKOA 1R8CA 5IQQA 5DDRC 2LA6A 2KFZA 3IR6B 3B82A 2QA2A 1HD1A 2FHOB 1Y0HA 4ILRA 2W9BB 3THTA 1O0PA 5IZHA 2JWNA 3PEJA 5FDLB 3MHYA 5KG6A 1FD2A 1YJUA 2WRMA 2MDAA 4I7FA 5KFCA 3BQ1A 3FNNA 3ONQA 4ZPTR 1S0MA 3AA8A 3T9NA 2B43A 2MXYA 1NK5A 3TAQA 2J9DA 3KKFA 4DR5F 4ETXA 3ISND 2OPQA 1YJRA 1LW2B 3DHXA 5DQIA 3UI3A 3J80Y 2CQIA 4WFXA 2KVIA 1VQYA 4A46A 1TKTB 3AHPA 2ZKUA 1N4LA 1UVNA 2AJ1A 4DQRA 1U49A 7FDRA 4Y6IA 4KFBA 4RWWA 2BQRA 3H5SA 3QGHA 3HK2A 1HNVB 3OR2B 1NK8A 3DC2A 5H9EJ 4JV1A 5GADU 1HI8A 3Q2SC 3NRBA 4N41A 2IM0A 2P9CA 2KT5A 2QO3A 2NSBA 5MLCV 2C3OA 3MR6A 3OLAA 2FJXA 4O44A 5F8IA 1QSLA 2RF2A 4NZ0A 3JYTB 3OV7A 2F9DA 2DGOA 2DB1A 3Q8QB 2KFYA 3ITHB 2GHVC 4IOBA 4OI2A 1X4CA 2EFVA 3VAMA 2XHWA 5KFZA 5HLFB 4EEYA 5H1SV 4EBEA 2E29A 1UJ6A 4NWBA 5HL7Q 3F73A 1KQGB 1S1UA 5CYQA 4EGLA 3QGIA 4ECZA 3PACA 2DGVA 2PO4A 3H5YA 1NKBA 4LVNP 2KM8B 2HMIA 3CC2S 1B0VA 2I5JA 4ECRA 1WD6A 3I5BA 1ZM3A 4ZCMA 3RYLA 1WG4A 1T94A 2ZH9A 4PPZA 1FERA 4BCAA 4RUHA 3KLFB 4WYLA 1WI6A 2JLEA 3FVYA 3MD1A 4M5DA 3BB5A 2PFFB 2K7JA 1BQNB 4NA1A 1NKEA 3D0HE 3DU6A 2QV6A 1JLEB 2DH9A 4C8LA 3BJYA 2ZD1A 3CO9A 4MIWA 3ZFVA 3IWLA 4N8NA 3PR4A 1M5SA 1L3SA 2NUHA 3VWSA 3V81B 3O44A 3U1NA 3HDSA 4I67A 1P27B 2KI2A 1S1XA 1HQEB 4RU9A 2KRBA 3MI7X 4RWXA 2JVOA 4NLRA 1APSA 2J8AA 4RNHA 3VZHA 3CJ3A 2JOQA 4K5SA 1GQEA 2RUGA 4IQMA 1X0PA 4QIVA 3MPWA 3OTCA 1WNEA 2FD2A 4OZLA 4IOCQ 2QIFA 4X4TA 3CMES 5E33A 2BA9A 2B9WA 1E6VB 2C2DA 3IS9B 2RDJA 1DRZA 3QIPA 3PDNA 4WXWA 2XMJA 2K3KA 1HNIA 3M8QA 4IH6A 1RT6A 1CSJA 2QRRA 2ZJQQ 1RT2A 2YNIA 5DDQC 2B5JB 4QIFA 3RW7A 4ITSA 2ZH2A 2PMHA 3JSBA 2WHOA 3M30B 1JB0C 2Q66A 1VC5A 3BSOA 1WHXA 1ZM4A 3MM6A 1SKSA 5AXLA 2OSRA 2BE2B 2IVMA 3DLKA 3U02A 3I0RB 1Y5NB 4ECWA 3FMBA 3W7BA 2IA6A 4LMZA 5CQGA 3TA0A 4PWDA 2R7VA 3CDEA 2C3PA 5BYRA 1YI2S 4JYAF 2BABA 3SSRA 3M2UB 2FJAB 1NJIT 4KO0A 2CZVC 5LMUF 1C4AA 3CCMS 1W2BR 4ZCLA 1UWBA 2YKMA 3OL9A 4DSFA 4NMLA 1YTYA 1IJFB 2ZC4A 3MOZA 1VS3A 3DM2A 1J5OB 4B9VA 2HPUA 5AE1A 2WBMA 1HI1A 4QWEA 3SV3A 1KLMB 4EWTA 3T1AA 4DUYF 1DBDA 3E3XA 3M2RB 3MMBB 4I6YA 2FB0A 3LP0A 5FDLA 3UE2A 2HNZB 3TNVA 1NB7A 2FJWA 1HBMB 2GHWA 4B9LA 4MFBA 3T5LA 1FE4A 5C5JA 1SH0A 3QWPA 2RB7A 2MQPA 2CRLA 2GGPB 4FXWA 4ZPWR 5KFAA 1TKDA 2FLNA 1HWIA 3LF0A 5F8HA 3BSAA 3SCJE 5KG1A 2MZJA 3BGUA 1R3NA 5CD4H 3FSXA 3QGPA 1Q8LA 3G8QA 4A48A 1N5SA 2LA4A 4XIUA 4DV4F 2CPYA 2XY5A 3MEGB 2PT0A 2B9XA 1UVJA 3CJ5A 3MDFA 5GAHU 3G6XA 3KLHA 2V9KA 1D9FA 1SH2A 2JEJA 1FDBA 3QLHA 5J1PA 2A2CA 1P1TA 2BRLA 2ERRA 4RU2A 2CJKA 2XMVA 4CO5A 2JEFA 2HVZA 2HGNA 2SXLA 1NH7A 3CEDA 3NS6A 5A0YB 1IN0A 2AX0A 2KYZA 1JLFA 3PY8A 3PV8A 4ED7A 4TYAA 5F8MA 2Y1RI 4J9NA 4FBUA 2V5HG 2UXBF 4KJIA 4TN2A 3JYTA 2DR5A 2Q79A 3LGMA 5EGYA 3T6BA 5K8MA 4WU3A 3R3TA 1JXEA 3ITHA 4IQXA 1V3SA 1VQ7S 1RGVA 5B7WA 2BW2A 4MK8A 1RP5A 2AGPA 1M5VC 3PHEA 5HLFA 2KHDA 4DQPA 4KC5A 2FUG9 2VFUA 3QAUA 4KHMA 2DNYA 2C3UA 2QSFA 5C25B 2XNRA 2AX1A 4HH0A 2AW0A 1BWEA 2YWGA 3OTOF 4R8UB 1GT8A 3JB9k 5B09A 2M2BA 5HP1B 2EBGA 1TKXB 5EX3A 3QZ8A 3RBEA 5I4MA 3Q22A 1M90T 5LT5A 3DLJA 2EFGA 1HW9A 4HL9A 4UQTA 5CYMB 4ZP6A 3KLFA 1UETA 4B9MA 2W4CA 2MQOA 2U2FA 3OW2R 4B3RF 2DGUA 1BQNA 4A4JA 2F1FA 3V4IB 1S10A 4ZMMA 2N7YA 4MAKA 2U1AA 1VMBA 1ZPWX 4LIWA 2UVVA 1JLEA 3GMGA 1G7CB 4LF6F 3GFXA 1IBLF 4ES2A 2Y1IA 1PC4A 2JDJA 4QPTA 5KFHA 4LQ9A 1YIJS 1U47A 3HO1A 1FNMA 1DTQB 3PJXA 1K0VA 3V81A 2FY1A 2DTJA 2VOOA 3MM8B 4RW9B 3OVSA 2IVYA 4H54A 2IM3A 2K3IA 3H2UB 3PO4A 2VBYA 4LFAF 4PXBA 1C1BB 4C0BA 5A6WA 3RRHA 4IFYB 5E2QA 4RNOA 2BOPA 2OIHA 5LXRA 2JLFA 3UDCA 4DSIA 3CC7S 2F3JA 1X4BA 2QA4S 1ZBTA 1KN6A 3DRXA 5L38A 5IWAF 5L1JA 3CVKA 2N3LA 4K4XA 2JFDA 3BEGB 1TK0A 2FPHX 1MWYA 1GX5A 4K4UA 1X4AA 1E6VA 3DI6B 5JJBA 3IS9A 4WF9Q 2Y1JA 5KFRA 4KKOB 3DRPA 4P7TA 2WW8A 5E3RA 1JLAB 4X64F 3FSIA 1U1LA 4CT8A 3OXGA 2E5IA 3T5JA 3DOLB 5J1EB 2APOA 1D3WA 2X51A 4OZNA 2G9OA 2F7VA 4Q2LA 5L9XA 2B5JA 3DOMA 3Q8RB 1VRUA 3KK3B 2ZC3A 3M30A 4FF3A 2WB4A 4NZ7A 3TRGA 5FJ4A 1RTHA 2BE2A 3I0RA 2PE8A 4Q8EA 1LFWA 4ECVA 5M2RA 5KT7A 3VQSA 2I8EA 2DHSA 4TQSA 3M2UA 5BYQA 2N7CA 2Q3PA 1S9FA 1MW7A 2PC6A 2ABYA 3I9ZA 5J2MB 3PFEA 1FDAA 3GIKA 1O8BA 2CPEA 2HFOA 4ZKAA 4DQSA 2HLTA 3T3FA 3TI0A 4C7QA 4WFNQ 4DLEA 3DLHA 1OSCA 2J6TA 1QUVA 3FEYB 2LU2A 5CHCB 4DL4A 2XMTA 1KLMA 4JI4F 3DLGA 1N34F 5CCLA 5E3AA 2XMWA 2FGOA 5E0OA 1GXTA 2BZ2A 5DG9A 3AQPA 3O2IA 1UVLA 4OZ0A 2HNZA 1U7LA 2FLLA 1HBMA 4O4GB 2PSZA 4MH8A 4BHQA 2HVHA 2BACA 4P7VA 5DS7A 4YEAA 3M6XA 1WACA 4R5PB 2KG1A 4DSLA 1QAIA 2ASLA 2GGPA 3EUNA 1VQ8S 5KG0A 3E51A 4MTPA 5FIIA 4ILLA 1SV5B 2VASA 4I0WA 4ZP7A 3O5TB 3KYLA 1U1QA 1IKVA 1U1NA 2CPDA 4J5OA 2GFFA 3UCZP 3MEGA 5IS2A 4DV2F 3MECB 4FZVA 6FDRA 2ZVSA 1UP1A 1KEKA 4QWCA 4ED1A 1T03B 3SFUA 4RNMA 1L3TA 2BM0A 3KHGA 4EZ9A 2UP1A 1YQHA 1NZAA 4Q2MA 2AGQA 3M32B 2MKKA 3PXGa 3D0IE 4X4OA 4KQZA 2MGZA 1ZM2A 1XR6A 4USIA 4YP3A 5D4OA 1KLNA 2R7UA 2M9KA 1RISA 3ZC4A 1YSJA 3HP6A 2R2TA 3NP5A 4ZS6A 2XGPA 4KGKA 1HNXF 2LXUA 3O1LA 3MR2A 4X4VA 1GNKA 2GIQA 2COLA 4O3SA 3N0VA 3PRBA 2J7KA 3NLCA 1H2TZ 2WBRA 3BREA 2ZDOA 3DCAA 3FZBA 2MHEA 1JMTA 4ZPBA 2UUAF 2VFVA 3IN5A 1H38A 4OL8A 5C25A 4CO1A 3IGVA 1YJNS 2IYIA 2X1AA 5F0UA 3ZZRA 3F41A 3ENVA 1NHUA 3IWXA 3UWTA 1SKWA 5HP1A 5HROB 1LXNA 1TKXA 5KFQA 3C6UA 4B3OA 3CDWA 2WOMB 5CYMA 4NRUA 3OHAA 1TV6B 3GZ7A 1FXRA 2QLXA 4OHXA 3S01A 4QIWD 2YTCA 4KB7A 4LSLA 1TK8A