2QYCA

Crystal structure of a dimeric ferredoxin-like protein (bb1511) from bordetella bronchiseptica rb50 at 1.90 a resolution
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
102
structure length
102
Chain Sequence
GMTMFLHVVMMEFDDGIDAGFFRTVDEYVARMKRECDGLLLYHFGENVAARSQGYTHATSSAFVDAAAHDAYQVCPAHVAMKAFMGPRIKRVVVYDGEVPAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of dimeric ferredoxin-like protein (NP_888056.1) from Bordetella bronchiseptica at 1.90 A resolution
rcsb
source organism Bordetella bronchiseptica rb50
molecule tags Unknown function
molecule keywords Ferredoxin-like protein
total genus 17
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07876 Dabb Stress responsive A/B Barrel Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qycA00
2GO8A 3FMBA 5A6WA 2LQ9A 3DCAA 2PD1A 1FESA 2FHMA 4EFAC 2GV1A 2KT2A 4F67A 3HHLC 3BR8A 2CRLA 2XMVA 3BF4A 3BN7A 5T7LB 2HIQA 3TNVA 1GXTA 1FVQA 3LGMA 2KT3A 3MZIA 2ZDPA 5K9FA 2W4DA 2HQIA 3BGUA 4A48A 1P6TA 5B0AA 1AFJA 2AJ1A 3LO3A 2KKHA 2LDIA 2LQBA 4NPOA 5A6PA 2XMUA 2GGPA 3HHLA 2GCFA 2XMKA 4A4JA 1FE0A 4HL9A 1FVSA 2KYZA 1S6OA 2RU9A 2ASYA 2L3MA 2OAUA 3F44A 2IFXA 2BUNA 5IXUA 1KVIA 2K7JA 2BJEA 3FRYA 2FTRA 3MCSA 3KG0A 1Q4RA 1N5TA 1Y3JA 1N5VA 3WDOA 2BYCA 1CC7A 3HX9A 4DN9A 2K1RA 2ACYA 2W4CA 2QLXA 1N5QA 5B0CA 2OFGX 3BDEA 1LQ9A 2HLTA 2OP5A 5B08A 5KAKA 1CC8A 4A47A 1TZ0A 2RMLA 1JWWA 1YJUA 3CJKA 1ULRA 1APSA 4OIXA 3FGVA 3KG1A 4DPOA 1OQ3A 3QMQA 4HH0A 1QUPA 1YJTA 1FD8A 5B0BA 2LXFA 2G9OA 2AJ0A 4YEAA 3LGNA 1TR0A 1MWZA 1KQKA 1TL5A 5B0FA 2HLUA 2HFNA 4FNHA 3CJKB 1W2IA 1OSDA 2N7YA 4ZOSA 4ZA1A 4DL0C 1AFIA 1VQYA 2HFOA 1TUVA 5B0DA 1U7LA 5B0GA 4NL5A 1RJJA 1MWYA 2K1RB 2VH7A 3IWXA 2JDJA 3HHLD 3BM7A 2VV5A 1TL4A 1Y9OA 2W4PA 4HH1A 1X0PA 2IYGA 2IYIA 2QIFA 3K7RA 4OJ1A 1KVJA 1CPZA 3KKFA 3QGPA 1Q8BA 3HF5A 5F0WA 2GA7A 2ROEA 1S6UA 2XMWA 1GXUA 3HDSA 2OKQA 2RSQA 1AW0A 2ROGA 3UDCA 3E8OA 1WD6A 3I9ZA 1V3ZA 1YRXA 4Q2LA 5F0UA 2BJDA 3TRGA 2AP6A 2FIUA 1VQSA 3VTIA 2RILA 1Y0HA 1Q8LA 2N4DA 2K7KA 2OFHX 1R6YA 1XBWA 4OJGA 1SI9A 4QOTA 2N4CA 1SB6A 1JK9B 1YJRA 5T7LA 1N5SA 1FEEA 2QYCA 1Q53A 1OPZA 2OMOA 2XMTA 3DXSX 1SQEA 4OJHA 1Y3KA 2FB0A 2AW0A 2QLWA 5B09A 2XMJA 1YG0A 4Y2IA 4Y2MA 1YJVA 4HI2A 2PGCA 1K0VA 1P8GA 1X8DA 2XMMA 3IWLA 2Q3PA 4YDXA 3BB5A 1URRA 2GGPB 3HHLB 1OQ6A 2ROPA 2ZDOA 3TOQA 2K2PA 4Y2KA 4A46A 5B0EA 4Q2MA 2EW9A 2OD4A 1X7VA 1IUJA 2GFFA 3T9NA 1FE4A 4OJ3A 4HI1A 3HFKA 3KNGA 3GZ7A 4U9RA 2BBEA 2OD6A 4FNIA
chains in the Genus database with same CATH superfamily
2FJEB 1WEXA 2ZBRA 4TY9A 4QU7A 2ADBA 3PG9A 3D3CJ 4DV6F 2N82B 3UQSA 1S9FA 2ZJQQ 4LF5F 2B7CB 4ILMA 1M5SA 1C0TA 2MQNA 2WCXA 2GV1A 5E41A 3RRHA 3BDPA 4ELTA 1FFSB 2MLXA 2QLFB 3NGRA 2OMLA 3NRBA 2ZHBA 4UT4A 2I6WA 1QE1A 5J2PB 3SFGA 2EC0A 1RDRA 3C6TB 2ILZA 3G6YA 1UJ6A 4USUA 1RLDA 2M88A 3H5SA 5FIIA 5C42A 2OH2A 3DU5A 2AJFE 4X4RA 1IXKA 2HAFA 3G8TA 2MB0B 4QWAA 1RB0A 1TAQA 4DHVA 4JI8J 3CNQP 3MTJA 3CT9A 3CWJA 4J9KA 2RU9A 1G3OA 3Q23A 2OEKA 2RKIA 3KDOA 4CH7A 5D0EA 2IMWP 2V50A 2CQDA 3MDFA 2QL9B 2W9CB 4J9PA 1NK4A 3C3LA 1Q5YA 1QAXA 3R5CA 5CYJA 1Y3JA 2AKWB 1PGZA 1FXDA 1UVIA 2V8VA 4DR7J 3MAQA 3J7AN 1DJ0A 1SL1A 2DR5A 3IGNA 1UVMA 4ZPAA 1YITS 1NUEA 1RK8A 3R27A 4CO0A 2QYGA 3CJTA 2LYVA 1ULRA 1PYTA 1Y5LB 4M1KA 1HLWA 1OQ3A 2RT3A 3QMQA 2E5JA 1EETB 5KT6A 3M05A 4WBFA 2FVQA 2AT1B 4B9VA 4F36A 1K1SA 4O44A 4UUXA 2GS8A 2VPZB 3SSSA 2HLUA 2HNDB 3OR1B 2DGQA 1XMQF 3W5XA 3EVMA 1X9SA 3EZUA 1REVB 4LSLA 4AE5A 1NNDA 5CD4H 5I3PA 2UXBF 1WORA 2K1RB 3B82A 3M2VA 4L75A 3DXBA 3I5AA 3Q2SC 2PIIA 2DTJA 3T1HF 3HHNB 1WI8A 2YQ0A 3RBZA 3ZO7A 1RT3B 3O44A 3DDNA 4Q5VA 2BRLA 3GG1A 4DF8A 3HDSA 2AZ1A 3QPIA 1JJCB 2DGSA 1S76D 3UDCA 4Q0BA 1PJ5A 5HMXA 3DLHA 2Z2LA 3NCQA 3T5HA 5CHCB 1WD6A 2DXFA 2JVOA 4HACB 1YGYA 2E29A 5HO4A 5EWGA 3PZPA 1T3NA 2AWZA 1GX6A 3ILLA 1VQSA 2B6AB 4IH5A 1RXOB 2J9EA 3NBPA 1IBKF 2P9EA 3BO2A 4DWIA 3M1VB 3Q8YA 4CCHA 4QOTA 1J5OB 2N4CA 1JK9B 1RHJB 1RCOB 1H98A 2HNZA 4BCAA 3JQJA 3M1VA 2MQPA 2ZWOA 1EQMA 3BGLA 2OMOA 3CJRA 4GO5X 5BXIA 4A8MP 2YPYA 4HDHA 4O4GA 3T5LA 2RVJA 4Y00A 1FRKA 2UVVA 3VQSA 1FKPA 1YG0A 2NS1B 1JKHA 1H2TZ 1S1TB 2XMJA 1LK5A 3BS9A 4LR9A 2GIRA 4QIWD 3LWLA 1TKZA 1IKYA 2ZHOA 1WTBA 1HD0A 3RBEA 1FJ7A 3UPFA 3GIJA 1S72S 3EVOA 2N3LA 3UWTA 4LFBF 3CD7A 1R7IA 3PYDA 4IG0B 2QV6A 1V6HA 3MMCB 1GFWB 2ZH5A 2V8GA 5L46A 1C2PA 4CLWA 1PJ7A 1ROFA 2JFKA 3Q83A 1UJ4A 4OJ3A 4OX6A 1IQTA 1CJVA 1RT6A 2OD6A 2EC2A 3H90A 3PFEA 2EFPA 3M6XA 4KGXB 4C3LA 4QYZK 3DCAA 3LUYA 4LREA 3SQOP 1EB0A 1UMJA 1BQMA 3QRPA 4ID8A 3W64A 4EFAC 4DV0F 2QG9B 3ZTQA 2J8SA 4KHPJ 2I1RA 2R42A 1IR2A 3VGUA 3PRVA 3L7UA 3QT5A 5K9FA 1S1UB 2GX8A 3BGUA 1H72C 3HZGA 4WYWA 5KFBA 2HS3A 2RB7A 3MEEA 2ACMA 2XTJP 5B0AA 2KKHA 3A3OB 4LRDA 2QX0A 3R7NB 4Z7CA 4Q45A 4F4WA 2YX4A 2SXLA 3FUYA 3MEKA 1X4AA 4RWWA 2E1CA 2ASDA 2YWKA 1VIXA 2JX2A 1QD1A 1WHVA 3RBXA 1TKTA 5ETMA 2XMKA 2GJ2A 2RQKA 4EZ6A 4GKKF 1VJWA 1FD2A 3H2VE 4DR3F 3IR5B 1FE0A 2K06A 2JVRA 2VBZA 2KYZA 2DIUA 3ET6B 4M5NA 2YNFB 2ASYA 3EWGA 4LFAJ 4OHXA 1RQ0A 4I7FA 3R97A 4JV2A 4X64F 1QTNB 3FVYA 4WIQA 5BJRA 2ZM6F 2DNZA 3I5BA 3HD1A 5U47A 4X4SA 4B9MA 4OI1A 2PA8D 4L3KA 5IT0A 4ZK7M 3KLHB 3ILJA 2Y8YA 3JTOA 5A8KA 5EX3A 2WBRA 4C8KA 4ES2A 2HLTA 1PKUA 5DM6Q 1S99A 3C66A 3FCHA 5G0RA 2RF2B 3P5TL 2HURA 3PV8A 2QO3A 2YPZA 3FCWA 3I0SB 2VZ9A 4RW8A 4CLTA 4CP5A 3VGSA 2JLGA 1HFEL 3N5BA 4EO8A 1H7XA 3PO5A 2A0FB 3C15B 1SVDA 4KTQA 3VAIA 4K0KF 5HLFB 1CG2A 1AFIA 3SEOA 1U1QA 2ZBCA 4RU2A 2CJQA 5SZTA 5H9EK 3KXDA 3JYTB 2JRSA 2JC0A 2H4YB 3DOLA 4K4TA 4DV6J 4EYHB 3HCXA 5F8IA 4LF5J 1WI6A 3DKDA 3MECB 4C7QA 2BRKA 5AT1B 5F3TA 4MYUA 3GIKA 2KN4A 1R89A 3N9UC 5I4MA 1SKWA 2ZHAA 1RBOB 5HMYA 2GA7A 5ETNA 2H4WB 1RWWB 2ZNYA 4MYTA 1S6UA 3PRBA 4URSA 2FDNA 4U7UD 3SXLA 3OTBA 1F60B 2DNMA 2W24A 4B02A 3PO4A 4K50A 2FGCA 2AV5A 4ZJOA 5A8WB 2Z56B 3JS9A 3KLVA 2IRYA 1CJTA 4K4XA 1KFSA 2ZJRQ 1NPPA 2JLFA 4OI6A 4Q2LA 2M4MA 2QFJA 5J1EB 2YKQA 2XHWA 1KQGB 3W61A 1Q8LA 3Q8VA 2K7KA 1SUQA 1OMSA 2W7OA 1BWVA 4I0WA 5FD1A 3NGUA 1IKWA 1UCNA 4AL6A 3IS9A 2E7WA 2BOPA 1LWFB 4CLZA 4DUYJ 3UE2A 3QNWB 2MY8A 4DFKA 1W26A 2A18A 3FC9A 3HVTB 2V4QA 2RDJA 2KZZA 2OSRA 2R7WA 1MROB 1K0VA 1SQGA 4IG3A 4IOBA 1AXQA 2CVEA 4TU8A 4B9UA 2KRRA 3M8RA 3HM9A 1E6VA 1HL6A 2QRRA 3THVA 2MJUA 4K2JA 4QQBA 3BEGB 5KFWA 2HHHF 4YY3F 1MWQA 4PXDA 4CTAB 5K8PA 1U6FA 4FXVA 1LEOA 4C3KA 4BWJA 2CQ2A 2FZCB 4LSNA 5FDLB 2YKNB 1ZOTA 3B8HA 5JVGQ 3FSYA 1T9TA 2RRNA 5B0DA 3UDVA 4FYDA 1N48A 3WC0A 4P72A 4ZVQB 4JBCA 2W9BA 2PEHA 2AJ4A 4B9TA 3C6UA 1SH0A 1FRXA 2FC8A 2W25A 4CT9A 3CCRS 4AFFA 4JB8B 4DXLA 2B9WA 1FWLA 3M8PB 3HHLC 4HHJA 5KFCA 3GV8B 2CRLA 5D4PA 3ZFVA 3H2LA 3M2RB 3HKZD 3JTPA 4L3NA 3CJ4A 1M90T 4P52A 2HQIA 3OR2A 3OL6A 1U0HA 1UEUA 5A2QY 1AFJA 2W01A 4NMLA 3W2VB 3M8YA 3OFGA 2KXNB 4IR9A 2AD9A 2AU0A 3MOZA 1SJ4P 4USIA 2HHUA 1FNMA 4JI7J 3HHLA 3IR7B 2X7IA 5SUHA 2BQ3A 4Z7YA 4NLQA 2Z30B 2KG1A 2JFDA 2WOMB 2KVIA 1ZS6A 3DOMA 2Y8WA 3DRPA 4G1PA 4DUZF 1KDNA 3F44A 5DG9A 2IFXA 2XGPA 4LVOP 1GMWA 3QT6A 3KUEA 2CKWA 3BBFA 3PXGa 2ZH9A 1UP1A 4CYUB 2BYCA 5DGAA 2O01C 3M32B 1HI1A 3SFUA 2W4CA 3CJ2A 1N5QA 1CJKA 1FDDA 3OXLA 4P75A 4RPFA 4R5PA 1X4FA 3KDNA 4FP9A 4URGA 4A47A 4IH6A 1RU1A 2CPIA 1EJ7L 1JWWA 4A8OA 1F5AA 1RGVA 3HFZB 3KLFA 5KFUA 5IT9Y 2E5GA 3KUGA 3CC4S 4P74A 1IBMF 3K89A 3DMJA 5HP1B 2KB2A 3LP1A 3IP0A 5C2CA 4OI4A 3S01A 1YJ7A 2WSEC 3V5RA 2VQFF 5B0FA 2JEJA 4FBTA 2FVSA 4RUHA 5LSLA 4JI4F 2R7UA 2OPQA 3PW7A 1R27B 2CPZA 3AA9A 3C2PA 4A8FA 1YVFA 2MKHA 1G2EA 2ZWPA 3LGHA 4XTTA 1T9YA 1QJHA 4PG6A 2HRUA 3BGFA 2MHEA 3LP2B 4NI2A 3MUVP 3KLHA 1MNEA 1PC5A 2W4PA 1KVKA 3OUYA 3UN5A 2GVDB 1HA1A 2RS2A 2XCAA 2Q6CA 4IQMA 4NCBA 3FNNA 1B4SA 2Z2YB 4YR2A 2YWWA 4TYAA 4UQTA 3R5GA 3I87A 1S57A 1GK8A 1SC3B 3V4IB 3M8SA 1TKTB 2DISA 2ZH3A 3N6NA 2X3DA 3TEHB 4F04B 3W5ZA 1YX2A 2E5HA 3ELHA 2OPPB 3HT3A 2BM1A 4DFJA 3R3TA 3Q89A 3IGVA 1LW0A 1O51A 2BJ9A 3FBFA 5E5NA 6FD1A 2OFHX 2J0XA 4ED1A 3NGDA 1EZZB 1CJKB 4M8LA 3QZ7A 3MMBB 2BV3A 3TVYA 4H4OB 2BABA 3MPWA 3ZZZA 1S12A 1C1BB 2G13A 2FJDB 1T02A 1TK8A 1C1CA 4KQZA 2XMTA 4KB7A 4PCQA 1ZTTA 1QAJA 4O3PA 1N32F 4WZQA 3QIDA 1MU2B 4M5LA 3PY8A 4K4UA 2DGWA 1XN9A 1J5EF 5AJ3F 2Y1LB 2XULA 3QATA 1SJRA 2RU3A 2ZE2B 1NO8A 4RNFA 5L1KA 5CXTA 1M1HA 1Y5NB 3KG4A 4DPWA 3V6HA 4DR7F 1F6TA 2MKSA 4LF4J 2OI2A 2X1BA 5IC4B 2NR0A 3BR9A 4OI0A 4WKYA 1WC5A 3W2VA 4Y28C 3GIMA 3HO1A 5HATA 3CVKA 1PSDA 4ZCIA 4JI6J 1VYAA 3N28A 2WTFA 2D9PA 4NLSA 3VALA 3MCOA 4LR8A 4RBTA 2CJAA 4IDKB 3K5PA 4USTA 1RA6A 1RISA 2YNGB 4PABA 3M8WA 3MCMA 3OSPA 1YTYA 1S0MA 1RYSA 2KI2A 4DR4F 1MG7A 1TKXA 2NUUG 3EMTA 4ZP9A 1S6QA 3POTB 2ZH6A 4OYIA 3PW2A 2XLJA 4O4GB 5LXRA 3ONQA 1FRIA 2ILYA 3MPYA 1NHVA 1C1CB 2DB1A 2B56A 2YXLA 2I9SA 3AAWB 3ILOA 4AXJA 2V2ZA 4FN5A 3BF4A 4ZCKA 5BYQA 5DDRC 4YP3A 1C0UA 4BLGA 4E2FB 4KPYA 4NMXA 1B7FA 2EG2A 2W4DA 3QIPB 3W62A 2DNHA 5DO2A 2GQQA 3FZBA 4BBYA 4C0HA 3TAQA 1LFPA 2EFQA 3EICA 4DR6F 2ALYB 1NDLA 3O6QA 2DPJA 2CQ1A 2GGPA 3CJ0A 2QA4G 2V8PA 3TX0A 1C0UB 5E2QA 5J2QA 2ASJA 3M30A 2GVZB 3FEZA 2A3JA 1U09A 2C3PA 2IVYA 1PO6A 4DEZA 2DCUB 2HBZB 3W9IA 4NXMJ 3R5BA 2V69A 3I0RA 1RT3A 2BJ7A 3CCLS 4LMZA 3BSNA 1EKSA 3D67A 2IBKA 2QSWA 1QUVA 4UOCA 2HHTA 3L7OA 3CDWA 1R43A 3AODA 3D1OA 3M2UA 5LMUJ 3QSYB 2AGQA 1HHQA 2J6SA 1JLBB 2YKMA 5KFTA 1SUQB 2OFGX 5F3ZA 2VDIA 3KLIA 3NCPA 4IOCQ 5E0OA 2HNDA 1WACA 3OR1A 2VQEJ 1L3UA 1G4CA 4LRAA 2IVFB 3UDLA 3VZHA 2YQ3A 4IOAQ 4N5SA 2ZE2A 3D0IE 2BE2B 1TL5A 2CG4A 2HGNA 2H1YA 2HFNA 4OZ2A 2DO0A 4DSIA 2HIYA 3TVZA 3CULA 4Q44A 3Q24A 1J27A 3LP0B 3MM6B 3T19A 2HFOA 2R8JA 2ZNZA 2WRMA 2VBYA 2DITA 1VOMA 4C8NA 1FRMA 3ETMA 4PXBA 4PG8A 3FSXA 2J7KA 1HW8A 3K7RA 1CPZA 2ATLA 3G86A 3NOCA 4HLBA 4OV6A 1R8BA 5F0WA 2MKKA 3LP0A 2ROEA 3MM6A 2V34A 4KT0C 3OVSA 4MT1A 3G6VA 4PZVA 3VGVA 1WC3A 3L4BC 3DRPB 3CCES 1B64A 2MQ8A 4B17A 1P9YA 4KO0A 4W98A 2APOA 4X4VA 4NOHA 1V5VA 2G1HA 2UUWA 1HARA 2EEYA 3AY0A 1VMBA 2G2ZA 2DT9A 2UXDJ 1S9EB 2BJDA 4OI2A 2LEAA 2FIUA 3C16A 2R2TA 5AXLA 2KHCA 7FDRA 2N4DA 4DUTA 2KT5A 4M95A 1XBWA 3OUYB 2NREA 3QFWA 5HROB 3KK2B 4B3MF 2HWHA 2Q43A 4NI2B 1RAIB 1L3KA 4LF2A 3R2DJ 1Q53A 2HBYB 3EXYA 4HVZA 3T6JA 2KFYA 1IVZA 2ZKUA 2C2OB 1CQMA 2CQHA 2JJ4D 1MMDA 2YWGA 3C16B 4A8YA 3N5FA 1HBNA 3W2WA 4ED4A 3TUPA 1GTEA 2GMJA 3EVWA 3I96A 4QIEA 3A13A 4X65F 3J80U 3CCQS 5D4LA 2KFNA 4ITSA 3IWLA 2HAIA 1OIAA 3IRXA 4CH1A 1IKVA 2HVDA 1JLQA 3GR1A 5FDLA 3SCIE 3WQPA 1Y11A 4DG1B 3IWNC 1T9VA 1KWMA 3R9LA 3TANA 1LW2B 2BJ3A 3FBEA 3HSJA 5AE2A 1J2VA 1Q79A 3UVJB 4R5PB 1S10A 4B3TJ 4OI3A 1Q81T 1L3VA 3VCDA 1X0FA 2VHGA 3S6EA 1D09B 2X3GA 4O4RA 4U6PA 2R8IA 5LMNF 4FF2A 4WKRA 1FKOA 3JB9k 2AX0A 4OYMA 4MKVA 4ANDA 2B4UA 5L1IA 2R7SA 1SJ1A 3LALA 4EBDA 2MSSA 2KXFA 5ETTA 2QLJB 3PDNA 5L39A 1Q82T 4C8MA 4AD6A 1RADB 1WF1A 2VFUA 2YNHB 3MD3A 4U96A 4WCEQ 2HHSA 2RQMA 1LOUA 5HQMA 3RZAA 3GFXA 1TKDA 2WSCC 4YB6A 1XMBA 4L74A 1WHYA 2ZH7A 2UUBF 4U67Q 2PDAA 1LXNA 2FLOA 4JI2F 1V5IB 2HSEB 2R7QA 1WOSA 2D3ZA 1AA1B 2HBRB 1X31C 3F41A 3IBCB 3V2UC 4R0JA 1S0OA 2XMUA 3D68A 3OJSA 2CDQA 2ASLA 2DR8A 4MK9A 5ETLA 4J9UE 3RRKA 3D2WA 3CD5A 5IV4A 4F50A 2F5GA 2BW2A 3GR0A 3MEGB 1UWBA 1F1BB 4DLGA 4A8WA 4F4YA 3FRYA 2DR6A 4OYZA 1BWEA 3N79A 3NAHA 1Q4RA 4ECXA 3A12A 3TQ1A 3QT7A 2LVWA 1PAEX 2XO7A 4J9LA 2F63A 1RBLA 1RE1B 2EK1A 1TV6A 2HNYA 2YKNA 3VZIA 3BDEA 2DGXA 3UVJA 1UTAA 6FDRA 1R8CA 2AIRB 3MM9A 5HL7Q 1TZ0A 2NXUA 1YZ7A 4CO4A 9ATCB 4CTAA 2W8KA 4AL7A 1UA1A 2FLLA 3P6YC 4DSJA 1F9FA 3HP6A 1K1QA 1KR4A 2WSFC 1JLQB 1WDTA 1KFDA 1U6BA 3C19A 3PW0A 4M63A 2CNLB 2C2RA 5CAAA 1SV5B 1KQKA 4XO0A 5HBMA 3R7SB 2HK2A 4MKYA 1GXLA 1HMVB 3MM8A 3BQ0A 1EQ0A 5BYSA 2LP4A 2HQCA 1HBOA 3RB4A 1IWGA 2WBMA 1DLOB 2LEBA 1SKRA 3IS9B 3CDEA 1MWYA 4KHRA 2V4JB 4IKAA 2DNLA 2FY8A 1RP5A 1Y9OA 3DRSB 1N33J 1W7WA 2CQIA 1R8PA 3KK2A 5IT9U 3DLBA 3UN3A 1XNRF 4LQ9A 2AMCB 2EI5A 1QVFR 5KFZA 2IM2A 1VBKA 3K57A 4BS2A 2ZUGA 3H59A 2DKOB 3LTOA 4B3RF 4ILLA 4W92B 3QO9A 2OKQA 2RDDA 1P1LA 1R8AA 1T95A 2CQ4A 2EFVA 2VJUA 1WEZA 3LH2S 1JQGA 4PQAA 2XNRA 2XI2A 5H9EJ 5F8GA 4DPTA 4LFAF 3QLHB 8AT1B 5HN0A 3DRYA 5KFPA 1T9XA 2E1PA 3BPSP 2V4RA 4PEOA 2HHHJ 5LT5A 4OYOA 4OL8A 3TAMB 4H4MA 5KFVA 2NCKL 1DBDA 2ZM6J 1U1LA 1T03B 4X4QA 4K4YA 3G6ES 4QW9A 1AT1B 3KJVB 4IO9Q 1SJFA 2R7OA 3W5YA 1IBMJ 2OO4A 5K5MA 3M32A 1RKJA 1RAAB 3GJQB 2HQFA 2BEFA 1ZAXA 3RB0A 3LF0A 4X4OA 3JSYA 4CZCA 3KUHA 1A0OB 2QLWA 5AJ3J 4HI2A 2IM3A 4ZJQA 1FI4A 3EJMA 2B9XA 2LKZA 4RNMA 1SIZA 3OJUA 3C46A 1UVKA 3RGIA 2CJYB 1ZZNA 1E6YB 4IYQA 5C42B 2WB4A 4KIAA 1GMWD 3UNYA 4RW7A 4WTOB 3TUJC 3MMCA 4M5IA 4G1QA 3RB3A 5LJ5Y 3QWPA 4WP3A 4X66J 2E5LF 4DQPA 3AXKA 1DTTB 1V3SA 3OFHA 2MKYA 3MPVA 5CZVA 3UCZP 2JEIA 3UI3A 1HI0P 2PEBA 5HANA 3OFEA 2HVHA 3R6GB 5KFKA 3KHLA 4Y2CA 2VQFJ 1KS2A 3ZZ0A 1YJWS 4I7FB 1HNIB 4OYPA 1NDCA 2AYEA 3P96A 1YZ6A 1YRTA 2H48B 2W9AA 3F73A 3EGWB 1N33F 3DMJB 3OW2R 4KKOA 5HP1A 4AL5A 1TAUA 1RT4B 1LWEA 1P6TA 3ZZUA 1U8WA 1FHTA 3GILA 3AHPA 3PACA 1A6LA 4WFBQ 3PR4A 2J9CA 2J0WA 2XLIA 4J9QA 3DFEA 4CO2A 4C3MA 4CO3A 5D6GA 1PYOB 3G2XA 2RH3A 3A8EA 3ILIA 4J9RA 2MXYA 2RRAA 4DR5F 2ATCB 1XR7A 4PYAA 2D3OR 4HL9A 1FVSA 4NX9A 3I32A 3P49B 2VU5A 4ECWA 3QAUA 3G4SS 2BJEA 1UWBB 2QT7A 4GO7X 1CLFA 2FHJA 3GJSB 1MW7A 4KPCA 3WDOA 4ER8A 2QFIA 3KLGB 3TWZA 2K1RA 3SI8A 1U48A 1VHIA 4JI4J 4MH8A 1CS4B 1ZPVA 2MEWA 5B08A 2DR9A 4O0NA 2UVUA 2MKCA 1YJUA 5KFGA 4OIXA 3P45B 3TAPA 4I64A 3QZ8A 4IG0A 1CJTB 1GAOA 1U1RA 1JJ2R 4DJBA 4DL6A 1C4CA 1FD8A 2OHDA 2VODA 2CNOB 4WFYA 2R2UA 1IKYB 1RWUA 1OY9A 1BXNA 3B4DA 3SV4A 5M2PA 1B0TA 1UVLA 2YKPA 4NCGB 4FNHA 3IMQJ 4JOUA 1NDPA 2W7AA 2N7YA 4WU2A 2LECA 4ZOSA 3H25A 3NMAA 5E3RA 3MUMP 2BR0A 5HAOA 2X51A 4F4KA 1RTJA 1EP4B 2QC3A 1C1BA 4KH0B 2W9BB 1VFJA 4S0MA 4KV8B 4DL3A 1TUWA 4J9OA 1UW4A 4DOZA 5M2RA 1OS5A 4JV5J 1HIYA 4TLRA 4PXEA 2GQCA 2IHR1 4QR1A 2A6OA 5CYQA 5HVFA 3OFFA 5D0HA 2LMIA 2B9YA 1GTHA 1Y10A 2IM0A 4J9NA 2CQPA 5A76A 2Q66A 1DQ9A 5D78A 4ECZA 2MMYA 3J7Z5 2ZZNA 4UQGA 3NS7B 4O3SA 1H6KX 2FVCA 5F8MA 2VPWB 3T3FA 4H54A 1VRTA 4I2PA 4RW9B 4DV0J 3CTRA 2DRBA 2UP1A 3HI9A 4USKA 2R3VA 4KFBB 5JXSA 1ZM4A 4P7VA 2F9DA 4LF9F 1RCXB 2F3JA 3BBCA 4ZIVA 3EDQB 3OBIA 4ZVTB 1SQEA 2UUCF 2FB0A 2FHJD 2AW0A 2J7WA 4J9VA 4GRSA 5E3QA 4DU8A 4EU0A 5J1EA 3MPDA 5L8RC 2KG0A 2V5HG 1DAXA 3R7BB 2PGCA 5IQQA 1F3VA 2PT0A 4Q8FA 2LQ5A 3JSBA 2R7TA 4ZP6A 4KO0B 1NKBA 3T5JA 4DCJB 3S1TA 2WB1D 2CQCA 4WFNQ 5AXNA 3PTWA 4PG7A 4AUKA 2V63A 2YWHA 4RNOA 2EW9A 1XMOJ 3WHIA 2VQEF 1V9OA 3ISND 4NE9C 3UR3C 1FE4A 3M6WA 3H5YA 1VQNS 2QJ3A 5C2GA 1S4EA 4U9RA 4LF9J 2V2QA 4LSZB 1IN0A 3N6LA 4PKDB 4RR5A 3JYTA 1R31A 4C6AA 4OMFG 1JNZB 1Z2LA 3ENAA 3TI0A 1BQMB 2AJ2A 4CLPA 1NHKL 2F1FA 4IFYB 4CM0A 4R8UB 2A2CA 1FRLA 1JLFB 4OV1A 2MZQA 4QIFA 3LGMA 3LPEA 2PMWA 5CABA 2L41A 3B6BA 4RX6A 3MM5A 3FFIA 5IT4A 3TJ8A 3KHHA 3LO3A 2JLEA 3KK1B 1RT2B 2RF2A 2VA3A 2D7SA 1K73T 3KHRA 4UOHA 3GIRA 3VVUA 4YS2A 2EPIA 1B0VA 3H98A 2LXIA 2KJWA 3VF0B 3AXMA 5KFQA 1Q1KA 4DPUA 2XS7A 1DARA 3M2UB 4M5DA 3HULA 3J7YU 1EIYB 2XI3A 2UUCJ 4TU9A 5ETKA 2DHAA 1YRUA 2WONB 5KG0A 2KRBA 1VRUA 4DMZA 1WDDA 3WX4A 3Q8PB 3MF5A 1RT5B 1N0UA 1S79A 2FTRA 3FQKA 2PFDA 4IH7A 4KGMA 4H4KA 2LA6A 4F4ZA 2D3O1 4FPIA 2GVZA 2CPYA 3CO0P 2GC8A 3DNCA 4NLOA 3MFIA 1RT7A 3DU6A 3UO0A 3UNGC 2HZCA 2AX1A 2E1RA 4LSNB 3PX0A 2NXEA 1B99A 3B54A 4E8UA 4NASA 2N3OA 4C11A 4DPYA 2J5AA 4YB7A 3CJKA 5AXMA 3NNCA 1TL3A 3ZZTA 4N56A 1S1VA 3DLJA 4HKQA 4YY3J 4L76A 1MN9A 1UPMB 1S1UA 1Z1ZA 2DRDA 4ED0A 2E7VA 2VPYB 3AT1B 3IG1A 4I6WA 3MM7A 1PC4A 3DGVA 2BBEA 1KTQA 4PUOB 4MIAA 2KU7A 1W2IA 2QZ8A 3E01A 3GTYX 4X66F 2E5LJ 2BMBA 3GMGA 1UFWA 1IJEB 1U7LA 3HJVA 4F0MA 4B3MJ 1TKXB 2DH9A 2VH7A 2VD3A 4G3IA 3RG6A 4DSEA 4LF6F 2FHKA 3GP9A 4I2QA 1S9GB 1VS3A 1REVA 2RHSB 3D1QA 3QGPA 4KE5A 4CT8A 1NJZA 2R8KA 5I42B 2KO1A 2JOQA 3E01B 1CULB 2MQLA 1FA0A 2HWIA 2XYHB 3CDAA 4K2XA 3TA2A 3DLGB 1WG1A 3GIIA 3MM7B 2Y1IA 2D1CA 2YQ1A 1N54B 4OZNA 1X5TA 3RYLA 4QWEA 3AD9C 2ZH1A 3K58A 4O3RA 2OPSA 2VKZG 1JLAB 5DETA 3V6JA 1FKPB 4BC7A 4ZP7A 4M5KA 2KH9A 1NK8A 4RU9A 1REGX 4OZ0A 4CNYA 3MMAB 1RT4A 4OJGA 2XY7A 2ZKTA 1XJWB 2OEMA 3HZEA 1U1NA 2BKNA 2DGUA 2IPOB 4H4OA 4YB5A 3H4DA 3CJ5A 2VG7B 3EX7B 2FY1A 4GVBA 2B6AA 3DOKB 1B0PA 1XIQA 2MQOA 4BHQA 4KBIA 3L95X 3VVTA 2X1GA 3BH6B 1WC0A 3IA0A 3ZNJ1 2ZH2A 2EKNA 2WVCA 5HLFA 3PIOQ 2XMAA 1NJXA 3C15A 1H2UX 4KRWA 1FJCA 2D69A 4JI5J 1TVRA 3NXZA 3O8WA 1NJIT 1OQ6A 2QL7B 1HBMB 3SDEB 2K2PA 4ENOA 2XM3A 2MSTA 5HJYA 3TUIC 4F0HA 5B0EA 2F8EX 3KYLA 2AHOB 2GW8A 3LAMA 3W60A 2OD4A 5KFFA 5LJ3Y 1E6YA 3CJ8A 1Y5IB 3QJJA 2CDRB 2GVDA 2V8HA 3H5UA 1NJWA 3CDBA 3U27A 3KJFB 3PHEA 2C3UA 3G82B 3MR7A 2ZJPQ 1RKIA 2AEMA 2GHWA 4DV2J 1TFWA 5B7WA 4N76A 4Q7AA 1S7IA 4LSLB 4WXWA 5HSPA 4NYPA 1RTDA 3HLUA 2Q6BA 3AOCA 2WK4A 1NSKL 4MKBA 5EDWA 1UFLA 4F67A 2DK2A 4P2MA 1N4LA 3THTA 1GXTA 1HHSA 2DHXA 2KT3A 3K2YA 4TQRA 2BQUA 1EETA 4LF8F 3MMAA 3RB6A 1Q8IA 2E7XA 5JMNA 2BE9B 4NCAA 2LDIA 5F9LA 1T03A 4NA3A 1L5UA 3D9BA 4PG5A 3W8GA 4EEYA 1OYDA 4IRCA 5F8HA 1LWCB 5EWFA 2B0GA 3QLHA 5KFDA 1P27B 1ZM9A 3GSDA 1FFWB 3TO8A 2IRUA 3SSQA 3KMSA 3JAMY 3X3UA 4YMEA 3VHQA 2XY5A 2ZVSA 4ELUA 1RACB 4K5RA 2GAHC 2W9CA 5KG2A 1N56A 4LF7F 3MCSA 3KG0A 2Z0GA 3W9HA 2C22A 1SJQA 2AYMA 4DN0A 4JI5F 1NZAA 4PRFA 1Q16B 1HQEA 1OYEA 4KGVB 5A8RA 4USVA 5KFSA 4FS2A 2J8AA 2UUAF 4B3SJ 3ZTRA 4R0EA 2MGZB 2XBPA 2OP5A 2FJVA 4D3GA 2BDPA 4F2SA 3DYAB 3KNAA 3MCNA 1TU0B 1HMVA 3MM8B 4LQ3A 4IFVA 2D41A 3BH7B 3CO9A 3QWUA 3S8SA 2R7XA 4R25A 1APSA 2ALZA 1SV5A 2BKOA 4HH0A 1QE1B 3SDEA 3PX4A 4QU6A 2BXJA 1YJTA 5K8MA 4OZ3A 2G9OA 1IBLJ 1JXEA 1GEHA 3D6MB 3NY0A 3MAHA 1U2RA 1RWMB 1F2HA 3OT9A 2RUSA 1OSDA 1RTHA 6AT1B 1NDKA 3P8BB 1N32J 5L1JA 1F5CA 5H1SV 1VQPS 4A8SA 3PCOB 1JJ4A 4I1TA 2VG7A 3R5DA 1VQMS 3DLEA 4TKTA 4USWA 1D0EA 1CQNA 4ZPCA 3OD2A 1O0PA 1EP4A 3WIUA 5JJBA 1IJFB 1WC1A 2E9TA 5C24A 3O3LA 1RTHB 2BE7D 2QMXA 2XMWA 1FT8A 3G87A 4IO1A 4RJVA 5RUBA 2NPFA 5KFOA 2RSQA 1JLAA 1HNVA 4ECSA 1YBUA 2BQRA 2MLYA 1NH7A 3R1LA 3M8ZA 4ZPWR 1BLUA 4GKJF 2JNJA 3W65A 4AYBD 4C8OA 4QR0A 2MZTA 1L3SA 5D8HB 4A8XA 2DNRA 4FYXB 3ADAC 2HHQA 2J7UA 3QQCD 3VTIA 3UCGA 1XC9A 4ZCMA 4OZLA 3FFIB 4LT6A 1K9MT 3IBFB 4DQIA 4M5JA 4MKAA 1X4EA 3Q86A 4AQYF 1HNWF 1RUSA 3FBCA 3QFHA 2R7RA 4L6V3 3BPDA 1JB0C 2DXEA 3CCSS 5LMUF 2DEJA 4UY8T 1IBCB 1HW9A 3J7A1 2X1AA 2DR7A 1UL3A 2KM8B 2RQCA 4ZVGA 4RKUC 4PQUB 1D9FA 4JI1F 3DDKA 2QTWA 4YQWA 3ISNC 3NNHA 4ZJLA 3BBBA 4JI8F 4NRUA 2ROPA 5LXYA 2D3UA 3EPIA 4ZVSB 3EZ5A 1HPZB 3ZC4A 4ZLNA 1F2GA 1M5HA 5IZHA 4DG1A 4NLUA 2V8DA 2DNQA 5IWAF 1VBXA 1YJNS 2ZFHA 4C0OC 3L09A 3D1HA 2QE5A 3MHYA 4NLXA 4NYZA 4RL1A 3NGKA 2IJFA 1R0AB 3I56S 1H3DA 4ICLA 4NLWA 2AQ4A 1NAQA 1HNWJ 3OPKA 2UU9J 1HBNB 3W2WB 3OXFA 4RUBA 1HD1A 4FF4A 2MZRA 4RLEA 4LF6J 1NRKA 2K3IA 4F8RA 1CJUA 1R6VA 2M70A 5C25B 1S48A 4RBVA 3ZZYA 3I55S 3G82A 5DDPC 2HIQA 3BQ2A 4QYRA 3NL0A 5HROA 2DO4A 4B08A 1ZBTA 4NLVA 2O3DA 5KTQA 1H0HB 2LQBA 1AZSB 4CWBA 4IFVB 2FUG9 3RAXA 4K4WA 2B4PA 1XR6A 1UAWA 1YBAA 1FDBA 3T1YF 3CCJS 2W7PA 2I5JA 2NYIA 1UEKA 4DS5A 5ETOA 2DHGA 2K3KA 4B9NA 3OHAA 5KG3A 1CJUB 4ELVA 2ZBPA 4YHHF 1KLMB 1U25A 2E1MC 3DOKA 4JI6F 1LFWA 2RDIA 3BKFA 1XMOF 1GNKA 1FJGF 2YX7A 4F26A 4NEZA 3ET6A 5CYMB 4P2XA 2EWHA 2NLWA 1T7PA 1KP6A 1RAGB 1FO1A 2BVZA 3KJVA 4JI3J 3JSRA 2EVZA 5KAKA 1FWPA 1XEZA 1LWCA 4N77A 3ULHA 2DCLA 1K44A 3RAMA 2CJKA 1BD6A 4KYZA 4O0IA 2B5JA 3HHEA 3UD5A 1YQHA 1HPZA 2XSJA 2ZD1B 3ZZPA 2M8DB 4XPEA 3CCVS 1SKUB 4B9SA 4L73A 1VLOA 2PFFB 3RTVA 1K8AT 3DDIA 5K14A 3MI7X 4QIGA 3DLGA 5EGYA 1OO0B 3JSMB 2C42A 3NCRA 4DV2F 4J9SA 4C97A 3NOGA 5GVQA 3J81Y 2YKMB 4L72B 1DY3A 3UFCX 1RJJA 2V9WA 3CCWA 4WFZA 3BKTA 1L3TA 2MHNA 3KLGA 5KFHA 8RUCA 1TL7A 4G6VB 1X0PA 4HH1A 2M2BA 2QIFA 2H54B 3N4WA 3TA0A 3OHBA 2W2NP 2CPJA 3EGNA 1VRTB 4OLPA 4RW9A 4DV4F 2Y9HA 2GIQA 3K0JA 1TL1B 2MKJA 5F41A 5H9FJ 2ZVIA 5KG1A 3CC2S 3P3DA 4A8QA 3AJDA 3ENQA 3V81A 4V1Ak 3SCLE 5F9NA 4ED5A 4WTYA 1TKZB 3CB4A 3OVAA 1VBZA 2Z2ZA 2BOAA 1QTMA 2KZMA 1V3ZA 1YRXA 2ZBIA 3IXQA 3O5TB 2YH1A 4X4PA 2AGPA 3DM2A 4P7TA 4N7TA 4DV7J 3MTKA 3CMES 1HBUB 3DI6B 1TV6B 2HNYB 1S4FA 5H9FK 1QSSA 1SB6A 1YJRA 3OLAA 1UW9A 3DLEB 1S6PA 3VAKA 1TELA 5GAGI 1HNIA 2BKPA 1AROP 1WOPA 2HQGA 3TUZC 3VAMA 5F8LA 3V6KA 2HMIB 3QRRA 4TNOA 4OJHA 1BMQB 3DM2B 4LFCJ 2WAQD 3GU0A 3MEGA 4I67A 1K47A 2ZOFA 3W9JA 2VFTA 3NEKA 4UF4A 4HACA 1DTTA 1S0VA 1KOOA 1X4BA 1JLCB 2NSBA 3CMAS 2CJBA 2QLBB 4Q0BB 1WSVA 4G1QB 4A46A 3AH6A 2ZOMA 5DQHA 1HNZJ 2HFSA 2C2MB 4Q2MA 3EUNA 3US5A 4C9DA 4O3OA 4DV7F 3MR5A 1BQNB 4DR1F 2MGZA 2ERRA 2YY3A 4X4NA 3M7VA 3K59A 2DD8S 2WW4A 3HFKA 5HVHA 4J90A 4HT5A 1RTIA 3FCVA 4CM2A 3WBZA 2J9DA 4I69A 5A6WA 5E33A 4ZVFA 5K8OA 4ED6A 4NLYA 1N6QA 4YOEA 4DUYF 4F25A 3I6PA 3A8KA 3MURP 1LKZA 1KBRA 4WK3A 5BR8F 2MKIA 2FHMA 1LK7A 3FBBA 4HHUA 3D6FB 1U49A 1NB7A 5J2NB 5HVGA 3PYEA 3TP2A 3TNVA 2G1DA 3KK3A 5C7PA 2ZDPA 2E5IA 2J6TA 3NMRA 1X9MA 5IS2A 1XK8A 4RUAA 3CJQA 4TVAB 1S1VB 3GLJA 1Q7YT 1ZA1B 3HVAA 4NPOA 2GMLA 3DN9A 5A6PA 5DDQC 1X4GA 5GAHI 2XYGB 1FRHA 1Y7PA 5L9XA 3IRXB 2M7SA 1D3WA 4X65J 4FKYA 4EYIB 1RSCA 1JMTA 2PA3A 1U2FA 1WEYA 3DGPB 2WVBA 1VBYA 1TUGB 1IBKJ 2XC9A 2WW8A 4DX7A 1UVNA 4NZ0A 3PJ9A 1RTDB 2G0JA 2DY9A 4XK8C 3HHDA 4J91A 4PR6A 5LM7E 1EAYC 1LXJA 3B4MA 1NM2A 2E44A 3GFZA 4NXNJ 3GJTB 2PSZA 3IM9A 2I5JB 4K4VA 5FJ4A 2OPRB 2VG6A 3L9ZA 3SSRA 3KTQA 2I0XA 1BGXT 2R4FA 1I5OB 4PPZA 5C5JA 1VQKS 1U1OA 3JTNA 2RMLA 1UEVA 4N8OA 3OL9A 4DF4A 3VQTA 5HBMB 2P9GA 1FDAA 1VC6A 2HZVA 3LP1B 5A2QU 1HI8A 2LLZA 5CD4A 2F7VA 2Z2MA 3OSNA 4YEAA 4J7CA 1TR0A 1JLFA 1CBKA 2NXJA 2UZAA 3A4TA 3HSDA 5K20B 2VOPA 5C25A 3G8SA 4JI2J 5DQIA 1C0TB 3IAS9 4DUZJ 1YIJS 2HFZA 4JI0J 1KQSR 4C4WA 2IDEA 2HG4A 4LIWA 3CD0A 3D28A 2MJNA 3PW4A 2DXDA 3HJFA 1UFKA 1N36F 1NEEA 4ZHRB 1SIWB 3BN4A 3CJSA 1PIEA 2YBVA 1VJQA 3PFOA 1CEZA 2XWXA 1IQZA 4CO1A 2VG5B 4Z2XA 5T14A 3Q0AA 4AXIA 2F65A 2R2RA 2NYHA 4YR0A 2DGOA 2QA4S 4F2RA 2P2CB 2XNQA 2EFOA 3HT0A 3SYZA 1RA7A 2WOMA 3DOMB 3E8OA 3FSIA 2IVMA 1SC4B 2J76E 5I3UB 1JX4A 4V19J 1VQOS 3Q2TC 2OGUA 1WUUA 4LUBA 4WFXA 5D3GB 3TEGA 4TY8A 4CLUA 4ECUA 3TRGA 1DQAA 4DZDA 2XY6A 3T6BA 1U0HB 3KLIB 3MWBA 1Q86T 3SQGB 4X62J 4DFPA 1CS4A 2F9JA 1QAYA 2DNNA 4DBQA 4LF8J 2XS5A 3RR7A 2V4JA 1N5SA 1N88A 1NSPA 2LXUA 3NG8A 4BWMA 1NH8A 4XAKA 2C2EA 1OPZA 2EK6A 3GPAA 4EGLA 5EX0A 4DR2F 3HVWA 2UXCJ 2VC0A 4B9LA 1CVJA 2C28A 5ETRA 1KD1T 3P4UB 3KFWX 4PUOA 1G1XA 3L7PA 2EBEA 1FKOB 5E3AA 3RW7A 4OZ1A 2N7CA 2U2FA 3BB5A 3BGOP 2GGPB 3PJXA 1H73A 4X4TA 5A0YB 2ZDOA 3I9V9 3OTOJ 4ETXA 1M5KC 2MPUA 2FJWA 5IM0A 1NB2A 1UZHA 2Z57B 2DNGA 4F3QA 1IM4A 4I56A 2HQDA 4P2FA 5DG8A 3SV3A 3OXGA 4TXSA 4KH1B 4CIOA 1MN7A 1Y4ZB 1JXLA 2BJ1A 3KNGA 3GZ7A 2PI5A 5KFYA 4DX8H 2NZ4A 3FKBA 5KOWA 4FNIA 2GO8A 2DH8A 1RTJB 2GMHA 3QGGA 2UXCF 3CUNA 5GMKa 2P8IA 4CRJA 1DFDA 3KOAA 1KOHA 2OTLS 3P5BP 5D4OA 2FQQB 1JLEB 1H2VZ 3GWCA 4YB1P 3H0PA 2HHWA 3BN7A 1J5EJ 3TA1A 3TVKA 4AT1B 1N52B 1EARA 2V2KA 3EDRB 3GFHA 3SMZA 3EZOA 4HYKA 4ED8A 4QCLA 2XZDB 4A8KA 3SCJE 3GONA 4O23A 3MEDA 1BC6A 4FXWA 2GAGC 2YX1A 4TY8B 5KFEA 3MR6A 1VIOA 3KK1A 2RE1A 1NKEA 5D3GA 2CNKB 4EO6A 1TK5A 1AUDA 5GADI 1DTQA 1X60A 5A8RB 3I4PA 4QPXA 3PR5B 4DL2A 2IY5B 2YNHA 3B78A 3C14B 1H7WA 2HRTA 1UETA 2W1BA 4DCPB 2HYIB 4JV5F 1KVIA 3QBCA 4ERDA 2HZAA 3FEXB 1SC6A 2Y0SD 3CE8A 5DM7Q 2NPIA 2PO4A 2CWKA 4TLQA 2RNEA 3N6MA 4DN9A 2HS4A 4FKXA 3UCUP 2QLXA 2XLKA 3DLKB 5B0CA 2UVRA 3PJWA 4MTPA 2CJ9A 5KFJA 1CC8A 1LW0B 3R2CJ 3KJNB 2B3TB 3CCZA 1SH2A 5IOLA 2ZITA 3D6TB 3KG1A 4OHZA 4NWBA 1TMJA 2AEJA 3AOAA 1SC1B 3CIMA 4I6AA 1SJ3P 2IJNA 1M0SA 1YWXA 3FK4A 5D77A 2FGOA 3HMJG 2XQCA 5AE3A 1JLGA 4PG4A 1UJ5A 3IO1A 1WC6A 1R3NA 4NA2A 4P73A 4ZPDA 1XNQJ 1H38A 2IAJA 3N0VA 1VQYA 3FEYB 4NZ6A 1RWKB 4ES3A 2OPRA 2F4FA 2XZWA 2JH3A 2J9DE 3NS6A 1T11A 4PPDA 2FPHX 3U7JA 4FF3A 3K8WA 5KFNA 1ZM3A 1V3RA 2IYIA 3W1YC 4RO0A 4F4AA 4N47A 2O67A 3D7SB 3M9OB 2YWFA 3TZZA 1HBOB 2XB2D 2IAJB 2NUHA 2YVSA 4I4BA 4U95A 1F9EB 1NPKA 2OPQB 4RW7B 4KY3A 5T41A 3DGPA 3NGTA 1JLGB 1HBMA 4ECVA 1K0TA 4DU7A 5J2QB 5CA5A 3AOBA 2VUGA 3RAQA 4UTGA 3WZ0A 1VQ9S 2VIHA 2DJWA 4Z37A 3QAEA 1KHWA 2QMUB 4ILRA 2AP6A 4IR1A 4WFAQ 1KONA 2IJRA 1JNRB 1KRPA 2DHHA 3GCWP 5DLFA 3DLKA 3UD4P 5DJBA 2C2KB 1U0SA 3BSOA 4LF1A 4P10A 2ZUAA 3F0NA 1TK0A 1FEEA 2QYCA 1RT1A 1BUXA 4H4KC 4J5OA 2UU9F 2KTQA 2X1FA 4ECTA 8ATCB 1BY9A 1NK5A 3Q8QB 4DQQA 3F56A 1B3TA 2IA6A 1ITPA 4DR6J 4OFZA 3TAMA 1CSJA 2B43A 1RI7A 4JUZA 1DRZA 1NSAA 1RT6B 2A6MA 3SCKE 2VC1A 2HKEA 2IC3A 2IMOA 1P8GA 1WWHA 3ISZA 2DH7A 1PILA 3U1MA 2GQ2A 4K8RA 5FLXY 5GADU 3JAMU 1YJ9S 1MSWD 2VFVA 1FJEB 2UVWA 4Y2KA 4DL7A 3QO9B 2VPXB 4GC7A 2UXDF 1FX4A 4NXMF 3MEDB 5J2MB 1I3OB 4KR0B 1KC8T 2B9EA 2K8GA 3C8YA 2NQPA 1B70B 2IM1A 2JHEA 4RW4A 1HYSB 4JI0F 4FDFA 4I2QB 2GFFA 5E3PA 5KT7A 3T1YJ 1KNZA 1PYSB 3GJRB 2IC3B 2ABYA 2YTCA 3DRSA 2DNPA 3V6DB 2MYFA 2F4VJ 4F02A 2LQ9A 4UUWA 1W2BR 2HBQB 3BSAA 3DRRB 3TX8A 5DQGA 5DLGA 3AFGA 2Z8QA 3LWMA 4DS4A 2IA0A 3OTCA 4TN2A 2CG8A 4NLDA 4CLSA 3Q8SB 2KT2A 5CZXA 2HNZB 3EGZA 1S6PB 4P6QA 1UA0A 1N5YA 3PEJA 3IG1B 2JL9A 3G71S 1X5SA 2H51B 1HBUA 3DI6A 3OTEA 4RUCA 1F9HA 1HQ2A 1U02A 3BO4A 3VR1A 1LW2A 4N8NA 3DLLQ 1IKXB 1VCTA 4K5SA 3RW6A 4ED3A 2PE8A 1TP7A 1IKVB 1WTFA 3ZZRA 4IRKA 2UXBJ 1RT7B 4IG3B 2RS8A 4A4JA 4X62F 1DQ8A 1G7CB 1YK9A 4U8YA 5LMNJ 3V4IA 4IQXA 1Z2ZA 4F7VA 2B4VA 3IR6B 2CZVC 3HVTA 4DSLA 1HWKA 4FVCA 4DSKA 3QGIA 1VRUB 3M8QA 4FYWB 1QLNA 4WPAA 2I38A 2FJXA 4K59A 3E2EA 3E3XA 5D0RA 1CC7A 1WOOA 1X4CA 2YH0A 2RAQA 3A8JA 4NRTA 2DYAA 2YNGA 4QWCA 1VQ4S 1FK9B 1GQEA 3PKMA 3SQGA 4RW4B 2UUBJ 3O2IA 4CLYA 3JSMA 1S1XA 5BR8J 1RT2A 2EBGA 3FMWA 1SXLA 4LIRA 3MM5B 1SCJB 1IM6A 3D0HE 3M6UA 2J6UA 5L38A 4C2MA 5D0GA 2XSJB 3IAM9 3LOUA 3KLFB 4X4UA 2NSCA 5ETSA 1MU2A 3ETOA 4ZA1A 1P1TA 5LL6d 4ZKAA 4DCOB 2XO6A 1T05A 2VF3A 1VGYA 2CPEA 4MMOA 4WK1A 2D74B 3AQOA 1U1PA 5D15A 5F8NA 3CGIA 2WVFA 4TQSA 1SKSA 2DBBA 1TL4A 2QEXS 1VR6A 2IYGA 4FBUA 2H5IB 1RHUB 3NWRA 5CH7B 1QSLA 5KFRA 3HF5A 1KN6A 2C2NA 2L9WA 2H5EA 1T05B 2H5JB 1T0TV 2MY7A 1OY6A 2M3DA 2V6AA 4H4MB 3OV7A 2OPPA 4USJC 4UY85 3D54A 3PNIA 3GV5B 4FPRA 4WF9Q 1JIHA 2ROGA 4F0KA 2JSXA 2P6SA 1EHWA 4DFMA 2B8PA 1NXIA 3PKYA 3X1LB 1WKKA 1R0BG 4YUDA 3MD1A 1RWOB 1NZ8A 1PBUA 3R5AA 2R2SA 3J80Y 2FLNA 2CZ9A 4QJVA 1NKCA 1RABB 1XTZA 5JVHQ 1Y0HA 4DR1J 1NBEB 3R1HA 1FK9A 2HW3A 1M5PC 2HVIA 4JI3F 3MR3A 3DHXA 2CPDA 3D66A 4KSEB 2FJAB 4FS1A 4DV3F 2KHDA 3U1NA 3AJ1A 3DXSX 4I2PB 3MUTP 1Q5VA 1BQXA 4JP8A 1GMUA 5DDOC 3HPOA 2R7VA 1VQ6S 3R5JB 3IRWP 1U47A 4LBHA 1OJ4A 3LW5C 2JC1A 1S1WB 2CA9A 3PIPQ 2VASA 4OX8A 4CLKA 2ZH4A 3TOQA 1I94F 2XEXA 3QRQA 4XDDA 1T9WA 2FZKB 2H65B 5CYQB 1IKXA 4K4SA 2OSQA 4ZLJA 1FFGB 4ECYA 2CPHA 1X7VA 2BANA 4WE1A 3CXCR 2C3OA 2Y0BB 3GCXP 4PWDB 1F5BA 3EE3A 1UVJA 3AJ2A 3HD2A 3I31A 2CNNB 3O1LA 2XGQA 3PW5A 1YBTA 2BA9A 2LQJA 4CYUA 4DSFA 3FMBA 3ZXWA 4PYDA 1D8ZA 3EM1A 3QJLA 4DL4A 2BM0A 1W25A 2F8MA 3H8YA 2ZEJA 1A9NB 3VWSA 1RU2A 5DRKA 5IC6B 3AB4B 3D4JA 4ZPTR 1NLKL 4YR3A 2DNOA 1S6QB 3I5CA 3ITHA 4ZVHA 3CJ3A 1SQFA 2ZC4A 3W63A 1RTIB 4RWXA 3BR8A 3LANA 1U1MA 1TFYA 4U7UK 2FD2A 2RUGA 3MZIA 3QGHA 4CNZA 2WZ1A 2NZCA 4IDKA 3RUBL 4A48A 4ETZA 3EYZA 1FTCA 1H74A 1U45A 1RAHB 2R8HA 1ZYQA 1N36J 1HYSA 4JYAJ 1RAJA 1QDUB 1Q0NA 1U2CA 2H9ZA 4RW6A 5J1PA 4HHHA 4EZ9A 3AD7C 1KEKA 5A8WA 2M0GB 4LBPA 4ES1A 5KT4A 1S97A 5LOQA 5I3QA 2POKA 1N8RT 3VV2B 9RUBA 3ITHB 3EPGA 2L3MA 4DL5A 3QSIA 1S49A 2VA2A 2V0NA 4HTIA 3TR5A 4FF1A 3I0RB 4NLPA 2PMHA 2MZJA 3BGRA 4OX7A 5DS7A 1VC5A 1U26A 2L9DA 2AZ3A 3J7ZT 3M30B 5ETVA 1D1UA 2JEFA 4ZDNA 2PN6A 1KSPA 1LQ9A 2BANB 4WE1B 2QN6B 1RYRA 4PWDA 4MIBA 2EG1A 2V68A 4G1IA 3PHTA 5IM0B 4DR2J 4RZRA 2A10A 2C3MA 2LEPA 1HNXJ 1FXRA 4LFBJ 2RD5C 2RIJA 1LWEB 7AT1B 3AB2B 2JWNA 1ZAVA 1S1WA 2DVIA 1NHUA 3H40A 1OWXA 5ADZA 1MWZA 4DR5J 3I0SA 4RW8B 1VQ5S 1QSYA 1WJ9A 5J1NA 2XSFA 5KFIA 4CI0B 1NK7A 1Q95G 4RBUA 1PG5B 3KJQB 3POTA 2NXCA 3ENWA 2OTJS 1QAIA 4MFBB 5ETQA 4NL5A 4K4ZA 5A8KB 3PRDA 2QMWA 2JDJA 3BV8A 3HHLD 3CC7S 2VL1A 2YKOA 3G96A 4JYAF 2AEFA 2HWTA 3KKFA 2QA1A 4MIWA 2VBXA 3PYGA 3GYGA 3RU0A 4KAIA 2P6TA 3R6LB 2CQ0A 4Q8EA 1RWPB 1S9EA 4QWDA 3TARA 1IWAA 4OZJA 1OPIA 4WIIA 4CLLA 4K7QA 1RHKB 4O44B 3JQMA 4HT7A 4OYXA 4LRBA 2G4BA 2LU2A 3W66A 2QA2A 3S7RA 1VQLS 2M5YA 3H20A 2CJXB 2VG5A 4ZVPB 4HR2A 4NZ7A 1UWAA 2CADA 1WG4A 2RQ4A 3J81U 4GKKJ 1AB8A 3D0GE 4LR7A 4JV1A 4C8YA 4USMA 2CPFA 4X84A 2D9OA 5KG6A 3KK3B 5DG7A 2O1PA 1N34F 2J0SD 4OZ5A 3HSGA 4P71A 3PX6A 3E51A 4KC5A 4RNNA 1ZH5A 4XIUA 1N6QB 2R9LA 2CFXA 3NGSA 1FERA 2WVEA 4Y2IA 4ECQA 3G8QA 2BE2A 2G0IA 2XMMA 2Q3PA 1NMEB 1WF0A 4YDXA 3HHLB 2YWEA 3HHKA 3PM9A 4ZCLA 5IFMA 3KHGA 2G2YA 4WZMA 4Y6IA 1S1XB 1HHTP 4ZVUB 5G0RB 4ZPBA 5L1LA 4KGZB 4NA1A 3QYYA 2F40A 3OR2B 2CQBA 1TVRB 1JLBA 1X9WA 2UUTA 1S0NA 4K0KJ 3UDEA 3BKUA 1SPBP 1YSJA 3NWGA 1URNA 2PD1A 2V94A 3M8QB 1YHQS 4URQU 4WP9A 3BO3A 1NK0A 5KFLA 2CQ3A 2HMIA 3K5NA 2CQGA 2YNFA 1ZTWA 4QBUA 1FEHA 1MLAA 1C4AA 4ICLB 5LSRA 4DV4J 3MOJB 2VKRA 1J5OA 2AGOA 4UOFA 1FVQA 1S59A 3VGTA 3CF5Q 2FLPA 2FYXA 4Y34A 4ZLPA 5KG5A 1NU4A 2KM8C 1VHFA 3ZNUA 3RRGA 4DLEA 4WXOA 2CZ4A 2UV8A 1E6VB 1FX2A 3MEEB 2DNKA 5KFAA 4CH0S 1N34J 3QIPA 2CWXA 1ZZFA 3FZ2A 4LJMA 4OQJA 2ZZMA 5AE1A 3V81B 1MROA 2J0QD 1WHXA 1EX8A 2Q1LA 4HEA9 4ZS6A 1XNQF 3CW2C 1VISA 1TL1A 2DGVA 5DZ7A 5I42A 2K7JA 1UKUA 1HWJA 1WKJA 3DRRA 2C2ZB 3RJMB 4U7CA 4DQRA 3NP5A 3W7BA 3C14A 2FZGB 4O3NA 3HX9A 2KL8A 4F4XA 3GYNA 4DQSA 2PI4A 5JUMA 2E1AA 4F3OA 2MQMA 2F4VF 1XWLA 2ZC3A 2OJ3A 3BREA 1FF2A 1SBRA 4MJKA 2OUGA 2XZTB 4FYYB 3OL8A 5J2MA 4W4MA 1RAFB 4ANEA 1SL0A 3EXCX 3CD6S 3H4BA 1VC0A 1NK9A 1GT8A 5CCMA 1SL2A 1R0CB 4ZLLA 3MPUB 1P9QC 3VAJA 2LXFA 3MXHP 2QGFB 2HRYA 1KHVA 1ELOA 1BHNA 1X4HA 1TL3B 5E7OB 2F8HA 2B5JB 3JXOA 3MMJA 4FVMA 1HR0J 3WIVA 4KJIA 1O5JA 5EWEA 2BX6A 1S77D 3MAAB 1WNEA 5B0GA 1RT1B 4RNHA 3CCUS 3D6HB 2LFVA 5CYMA 3DHWC 2GHVC 4ZVRB 3SBMA 4XPCA 1Q8BA 5L9NA 5KT5A 2KYXA 3AA8A 1RHRB 2WONA 2KVQE 2HHPA 1FJGJ 3I82A 3LAKA 1ICEB 4D3HA 2JEGA 2CPXA 2HFUA 1HWLA 4DDFA 1YLXA 5MAOA 2U1AA 2Y1RI 4QIVA 1OSCA 3I9ZA 2W8LA 3K5MA 4QR2A 4DR4J 5GAHU 2B51A 4FYVB 2WHOA 2MTLA 3HXMA 4KGKA 4OHYA 4M5MA 2VICA 4E0DA 1ACMB 1R6YA 3CMQA 2VG6B 3OL7A 2Y1JA 2KJVA 4WP8A 3QJPA 2ZH8A 5HQ8A 4CDIA 3LA0A 1HQEB 4QPTA 3W8PA 4IFYA 2XCPA 2FC9A 4YN3B 2DNYA 1U24A 3FDSA 1PAUB 1NCLA 3RR8A 4OYBA 4J9MA 3BYPA 1KQFB 1PBAA 2QL5B 4ED2A 4Y2MA 2HQ3A 3HKWA 1WG5A 5K14B 2DRAA 3A1YG 1X8DA 4BDPA 2L9NA 2VFSA 2B7BB 2EKYA 4QWBA 5KG4A 3TZYA 3V4MA 4UZCA 2YNIB 2W2QP 5KG7A 4IUFA 3Q22A 2BJ8A 4ZVOB 1TTHB 4NLTA 4Y3CA 3V6DA 3KLEB 4ANCA 2XS2A 3LPYA 3T9NA 1X5OA 4HTJA 2WVDA 4ZHRA 2COLA 3NKYA 4QW8A 3OTDA 4PQUA 3M4XA 3UW1A 3THPA 4NEYA 4ATNA 4YHHJ 3H42A 2DHSA 2W2MP 1I51B 4ZP8A 1KLMA 1FESA 2ADCA 1AUSL 2I8EA 1FNOA 4M5GA 5T7LB 4YFUA 1CJVB 1DTQB 4KFBA 2MZSA 1NK6A 3RBDA 1BQNA 3M9NB 2HVEA 3DRXA 1MMNA 3H5XA 1AZSA 1RTZA 2I2YA 4USHA 4Q43A 2C1EB 3PVXA 1T94A 2V9KA 4B3RJ 1JLCA 4KHMA 2GCFA 3KWMA 2O66A 4NYOA 5DZ6A 3TW0A 4DPXA 5HQLA 4DX5A 3EGVA 4P2SA 1KTVA 1A7GE 3T1HJ 1KLNA 3LQVA 1VQ7S 1HNZF 2OAUA 2BUNA 3CIZA 5IXUA 2ZZTA 5C24B 3NLCA 5MLCV 2HGLA 3W3SA 1R8HA 4XDCA 3GE9A 2VJVA 1N5VA 1G6BA 3GV7B 2MDAA 3GFYA 3H2UB 1ZPWX 1FTRA 1JXVA 2ACYA 2LDYA 3IC1A 4JV0A 2LQ8A 3ZTSA 4IRDA 3AQPA 3HVRA 3NBPB 4GVLA 3BQ1A 5F8JA 4ID5B 2IDLA 3DC2A 4LBIA 4QZVB 4O3QA 1T3OA 4CQ1A 4DV3J 4ED7A 3FGVA 1Z4UA 1X4DA 2OPSB 2RRBA 5A0YA 3IBWA 1QUPA 4LF4F 4F3MA 4QYZJ 4MK8A 7FD1A 3SZ2A 2HPUA 2AYGA 2AJ0A 2MZ1A 1RHMB 3TZXA 1N5YB 1VK8A 1VQ8S 4M94A 3M9MB 5J2NA 2KFZA 1B7YB 5THWA 2E9ZA 1CULA 3A8IA 1N0VC 1YI2S 4HDGA 5KOXA 1GX5A 3NNAA 1LWFA 2PMZD 2XYPB 1VI7A 2ZBQA 4GC6A 4OX9F 2VOOA 1IR0A 1F3FA 3CDUA 2AF6A 3IWXA 5KT3A 3BM7A 2MLZA 2CYYA 2VFRA 3ZTOA 4C8ZA 4Y2AA 4UOGA 2UUAJ 2Z4PA 2GNKA 4B3SF 1KVJA 1HWIA 4EK2A 4ZMMA 4LFCF 4WYLA 3T9ZA 3Q8RB 3HK2A 4FXDA 4M5HA 1KKHA 2GZOA 1GXUA 2IBOA 3BSCA 3NAIA 1QY7A 3G6XA 1AW0A 1VLYA 5HJXA 3NS5A 2B4OA 5LSOA 1U8SA 3IM8A 2KDOA 4AQYJ 2EFGA 4J37A 4OYWA 4PWUA 3TYTA 3ZZOA 2HGMA 2L08A 2DGTA 3CEDA 1DURA 2XWYA 3D5MA 5F0UA 4ID5A 4EMDA 2LU1A 3IN5A 2RILA 3D3BJ 3PEHA 2CIMA 3N01A 4C98A 1HNXF 4CLFA 1WELA 2ZOGA 3U02A 4KKOB 3GG0A 2VBWA 4PAAA 3CCMS 4KHPF 1FXLA 2V67A 4OX9J 3AD8C 3L3CA 4ZN1A 4WJBA 1RWVB 2HVZA 3DOLB 3MMBA 4PWWA 4CO5A 4W90B 1VK3A 5DGBA 2RJZA 1XQIA 1Y3KA 3J81j 4TU7A 3HFVA 1O6XA 5B09A 4Y0FA 3PYFA 2M52A 2QSFA 4V19X 1ZAWA 1U4BA 5GMDA 4M5DB 1MMLA 3K17A 4EUVA 1PJ6A 1M1KT 1U6ZA 3TZWA 4ZPVR 3UD3P 4GKJJ 2Y3YA 1RAOA 1TMMA 2FVRA 2CXEA 2CUYA 2NXNA 4ZVEA 2HK3A 3GQCA 1RLCL 1DHMA 3I4HX 4ALZA 4LF7J 4OYAA 1IUJA 3ENVA 1XMQJ 4C48A 3K5OA 3IFEA 3OQ2A 3UN2A 3WX8A 4HI1A 4U8VA 4DZ6A 1WHWA 3M2VB 3GYXB 4GMKA 4R8UA 3LP2A 4OHVA 4C8LA 3T5KA 5GAEI 1OY8A 1DZ5A 2UV8G 1ZA2B 5HMZA 3K8VA 5IQ6A 1I1GA 4BC9A 4NXNF 4C0BA 2HHVA 4X2BA 4OLOA 1X5PA 2XMVA 1JJHA 1LWXA 3VAFA 1HQUA 1LNQA 3CCTA 4UZBA 3CPWR 4LRCA 1IBLF 1D9DA 2BZ2A 3VAHA 2W2PP 3M6VA 3KLEA 2GHPA 2AJ1A 2YKAA 2ZD1A 5K8NA 2EFNA 1M5OC 1WKLA 2DIVA 5CCLA 4EBEA 5IWAJ 2KXHA 1XERA 3HSZA 2VDHA 5EUHA 3CSKA 1NJYA 1FWKA 1HQUB 4G65A 4DI6A 1FDNA 4WWSA 2XHCA 3GB0A 4TYBA 2IRXA 1S6OA 4NLRA 1QM9A 5GMEA 3R8YA 1XNRJ 2P5VA 2OELA 3OLBA 2HHXA 2DY1A 5HI7A 1Q7LB 3SIPB 2E66A 1S9GA 1S7HA 2Q79A 1N5TA 5HMWA 2HEKA 2RKIB 1F0XA 5EHHA 1ZM2A 2C2DA 3A3PB 4WU3A 1O8BA 1I94J 4UW2A 3MFHA 1FRJA 4MK7A 1AYEA 4MFBA 2JZ5A 1DLOA 4Y65A 1Q8KA 4N41A 4ECRA 3FJ2A 5GAGU 1M5VC 2M8HA 1EKRA 3UR0A 3J7YI 4LRFA 1RBAA 2A1BA 1Y00A 3C6TA 5GAEU 4DPOA 5J2PA 1FNXH 3KMQA 2EXUA 3G9CA 2R8GA 4JI7F 3BJYA 1PCAA 1RWXB 3M2RA 5G4DA 5HK4A 1RZMA 5B0BA 3LGNA 2FVPA 2G2OA 2DPIA 1VDHA 3MGJA 1JLEA 1JKHB 1S1TA 2W2OP 3M8PA 3CJKB 2GJIA 1FCAA 2MQQA 1HKAA 3T1AA 4B3TF 1ZETA 4DL0C 5ETPA 3MM9B 4ZITA 1GMVA 1TUVA 3C6UB 4GVBB 5KFXA 3Q8UA 3H7HB 5EN1A 3T41A 1M1GA 1UZDA 2PC6A 2Z58B 4OHWA 3A3NB 4KV8A 3U1LA 5M2UA 3ICLA 4DV1J 1WC4A 2VV5A 4JI1J 2VONA 4OJ1A 1R0AA 3MAAA 3BGRB 4EBCA 1T9UA 1RT5A 2AJQA 2VB6A 3FRZA 1RWNB 3TQEA 2BACA 2V2VA 2FHOB 3K5LA 4NCGA 5CQGA 1NPRA 2G0CA 4DV5J 1U1KA 1D8YA 5ITHA 2OEJA 1YDLA 5BYRA 4LVNP 4PXCA 5FLXU 2AYBA 3VAGA 1SH3A 3FQLA 3OTOF 2IIHA 3WC2A 4I6YA 4RW6B 2A2DA 2LCWA 5D4NA 1LV5A 2E9RX 4EWTA 4B3OB 1TQLA 3DYAA 1FKAF 1VRQC 1WF2A 4MAKA 4DR3J 3GSIA 2L48A 4ZIWA 1SI9A 1TL7B 2CVIA 1IKWB 3BZQA 1BE4A 1WSRA 5T7LA 3TJAA 1HWUA 5KFMA 1GH8A 2B8QA 4X64J 5KT2A 1RHQB 4E98A 2OIHA 2C3YA 2GO9A 5IV3A 4NLGA 2DEIA 3ZTPA 1RAEB 1HR0F 4B3OA 1Q78A 1YKWA 1S5ZA 4FZVA 4P9SA 4ZN3A 5E3CA 3TJ9A 1NSQA 2HFVA 3QT8A 2GJFA 4DV5F 1YJVA 1T8EA 2FJBB 1UPPA 3JQKA 1I6JA 2XG8A 5I3UA 1URRA 3MR2A 1HNVB 2OLWA 2P9CA 1QVGR 1IR1A 2RHQB 4C11B 2YNIA 4DX6A 1XR5A 1D9AA 3OVBA 2CAJA 2BW7A 2H3EB 2M9KA 2O5DA 4DV1F 2HS0A 2LA4A 4EI2A 3BYRA 5AXKA 4I68A 3MECA 4YDDB 2GIFA
chains in the Genus database with same CATH topology
2FJEB 1WEXA 4TY9A 4QU7A 2ADBA 4DV6F 1S9FA 2N82B 3UQSA 4LF5F 2ZJQQ 4ILMA 2B7CB 2HHQA 1M5SA 1C0TA 2MQNA 2WCXA 2GV1A 5E41A 3RRHA 3BDPA 4ELTA 2OMLA 3NRBA 2ZHBA 1QE1A 5J2PB 3SFGA 2EC0A 1RDRA 3C6TB 2ILZA 3G6YA 1UJ6A 3H5SA 2M88A 5FIIA 2OH2A 5C42A 3DU5A 2AJFE 4X4RA 1IXKA 3G8TA 2MB0B 4QWAA 1TAQA 4DHVA 3MTJA 3CT9A 3CWJA 4J9KA 2RU9A 1G3OA 3Q23A 2RKIA 4CH7A 2IMWP 2CQDA 3MDFA 2W9CB 4J9PA 1NK4A 3C3LA 1QAXA 3R5CA 5CYJA 1Y3JA 1PGZA 1FXDA 1UVIA 2V8VA 3MAQA 1DJ0A 1SL1A 2DR5A 3IGNA 1UVMA 4ZPAA 1YITS 1RK8A 3R27A 4CO0A 2LYVA 1ULRA 4M1KA 1Y5LB 1WNEA 1OQ3A 2RT3A 3QMQA 2E5JA 1EETB 5KT6A 3M05A 2FVQA 4B9VA 1K1SA 4O44A 4UUXA 2VPZB 3SSSA 2HLUA 2HNDB 3OR1B 2DGQA 1XMQF 1X9SA 3EZUA 1REVB 4LSLA 4AE5A 1NNDA 5CD4H 5I3PA 2UXBF 2K1RB 3B82A 3M2VA 3DXBA 3I5AA 3Q2SC 2PIIA 2DTJA 3T1HF 3HHNB 1WI8A 1RT3B 3O44A 3DDNA 4Q5VA 2BRLA 3GG1A 4DF8A 3HDSA 3QPIA 1S76D 2DGSA 4Q0BA 3UDCA 5HMXA 3DLHA 2Z2LA 3NCQA 3T5HA 5CHCB 1WD6A 2JVOA 3PZPA 1YGYA 2E29A 5HO4A 5EWGA 2AWZA 1GX6A 1VQSA 2B6AB 4IH5A 2J9EA 3NBPA 1IBKF 2P9EA 3BO2A 4DWIA 3M1VB 4CCHA 4QOTA 1J5OB 2N4CA 1JK9B 1H98A 2HNZA 4BCAA 3M1VA 2MQPA 3BGLA 2OMOA 4GO5X 3T5LA 4A8MP 4HDHA 4O4GA 2RVJA 4Y00A 1FRKA 2UVVA 3VQSA 1FKPA 1YG0A 2NS1B 1JKHA 1H2TZ 1S1TB 3BS9A 1LK5A 2XMJA 4QIWD 2GIRA 3LWLA 1TK0A 2ZHOA 1TKZA 1IKYA 1WTBA 1HD0A 3RBEA 1FJ7A 3UPFA 3GIJA 1S72S 3UWTA 2N3LA 4LFBF 3CD7A 1R7IA 4IG0B 2QV6A 1V6HA 3MMCB 2ZH5A 2V8GA 1C2PA 1ROFA 2JFKA 1UJ4A 4OJ3A 4OX6A 1IQTA 1RT6A 2OD6A 4C3LA 3PFEA 2EFPA 3M6XA 3DCAA 3LUYA 1UMJA 1BQMA 4ID8A 4DV0F 4EFAC 2I1RA 5K9FA 1S1UB 2GX8A 3BGUA 4WYWA 3HZGA 5KFBA 1N33F 2HS3A 2RB7A 3MEEA 5B0AA 5F9LA 4Q45A 2KKHA 4IRCA 4F4WA 2YX4A 2SXLA 3MEKA 4RWWA 1X4AA 2E1CA 2ASDA 2YWKA 1VIXA 2JX2A 1WHVA 1TKTA 2XMKA 2GJ2A 2RQKA 4EZ6A 4GKKF 1VJWA 1FD2A 3H2VE 4DR3F 3IR5B 1FE0A 2VBZA 2JVRA 4QWEA 2KYZA 2DIUA 2YNFB 2ASYA 4OHXA 1RQ0A 4I7FA 4JV2A 4X64F 3FVYA 5BJRA 2ZM6F 2DNZA 3I5BA 5U47A 4X4SA 4B9MA 4OI1A 2PA8D 5IT0A 3KLHB 4ZK7M 3JTOA 5A8KA 5EX3A 2WBRA 4C8KA 4ES2A 2HLTA 5DM6Q 1S99A 3C66A 3FCHA 5G0RA 2RF2B 3P5TL 3PV8A 2QO3A 3I0SB 2VZ9A 4RW8A 2JLGA 1HFEL 3N5BA 4EO8A 1H7XA 3PO5A 4KTQA 3VAIA 5HLFB 1CG2A 1AFIA 3SEOA 1U1QA 2ZBCA 4RU2A 2CJQA 5SZTA 3JYTB 2JRSA 2JC0A 4K4TA 3DOLA 4EYHB 5F8IA 1WI6A 3MECB 4C7QA 2BRKA 5F3TA 4MYUA 3GIKA 2KN4A 1R89A 3N9UC 5I4MA 1SKWA 2ZHAA 5HMYA 2GA7A 2ZNYA 4MYTA 1S6UA 3PRBA 4URSA 2FDNA 3SXLA 3OTBA 1F60B 2DNMA 2W24A 4B02A 3PO4A 4K50A 2FGCA 2AV5A 5A8WB 3KLVA 4K4XA 1KFSA 2IRYA 2ZJRQ 2JLFA 4OI6A 4Q2LA 2M4MA 2QFJA 5J1EB 2YKQA 2XHWA 1KQGB 1Q8LA 2K7KA 1SUQA 2W7OA 4I0WA 5FD1A 1IKWA 4AL6A 2BOPA 3IS9A 2E7WA 1LWFB 3UE2A 2MY8A 4DFKA 2A18A 3HVTB 2RDJA 2KZZA 2V4QA 2OSRA 2R7WA 1MROB 1K0VA 4IG3A 4IOBA 1AXQA 2CVEA 4TU8A 4B9UA 2KRRA 3M8RA 3HM9A 1E6VA 1HL6A 2QRRA 3THVA 2MJUA 4QQBA 3BEGB 5KFWA 2HHHF 4YY3F 5K8PA 4PXDA 4CTAB 1U6FA 4FXVA 4C3KA 4BWJA 2CQ2A 4LSNA 5FDLB 2YKNB 1ZOTA 3B8HA 5JVGQ 3FSYA 2RRNA 5B0DA 4FYDA 1N48A 3WC0A 4JBCA 2W9BA 2PEHA 2AJ4A 4B9TA 3C6UA 1SH0A 1FRXA 2FC8A 2W25A 4CT9A 3CCRS 4AFFA 2B9WA 3M8PB 3HHLC 4HHJA 5KFCA 3GV8B 2CRLA 5D4PA 3ZFVA 3H2LA 3M2RB 3HKZD 3JTPA 4L3NA 3CJ4A 1M90T 2HQIA 3OR2A 3OL6A 1UEUA 5A2QY 1AFJA 4NMLA 3W2VB 2KXNB 3OFGA 4IR9A 2AD9A 2AU0A 3MOZA 1SJ4P 4USIA 2HHUA 1FNMA 3HHLA 3IR7B 5SUHA 2BQ3A 4NLQA 2KG1A 2JFDA 2WOMB 2KVIA 3DOMA 3DRPA 4G1PA 4DUZF 5DG9A 3F44A 2IFXA 2XGPA 4LVOP 2CKWA 3PXGa 2ZH9A 1UP1A 5DGAA 2BYCA 2O01C 3M32B 1HI1A 3SFUA 2W4CA 3CJ2A 1N5QA 3OXLA 1FDDA 4R5PA 1X4FA 4FP9A 4URGA 4A47A 4IH6A 2CPIA 1JWWA 4A8OA 1F5AA 1RGVA 3KLFA 5KFUA 5IT9Y 2E5GA 3CC4S 1IBMF 3DMJA 5HP1B 2KB2A 3LP1A 4OI4A 3S01A 3V5RA 2WSEC 2VQFF 2JEJA 5B0FA 4FBTA 4JI4F 2FVSA 4RUHA 5LSLA 2R7UA 2OPQA 3PW7A 1R27B 2CPZA 3AA9A 3C2PA 4A8FA 1YVFA 2MKHA 1G2EA 1QJHA 4PG6A 2HRUA 3BGFA 2MHEA 3LP2B 3MUVP 3KLHA 1MNEA 1PC5A 2W4PA 3OUYA 1HA1A 2RS2A 2XCAA 2Q6CA 4IQMA 4NCBA 3FNNA 4YR2A 4TYAA 4UQTA 3I87A 3V4IB 3M8SA 1TKTB 2DISA 2ZH3A 3N6NA 2E5HA 4DFJA 2OPPB 3HT3A 2BM1A 3R3TA 3IGVA 1LW0A 1O51A 5E5NA 6FD1A 4ED1A 2OFHX 2J0XA 3NGDA 4M8LA 3QZ7A 3MMBB 2BV3A 3TVYA 4H4OB 2BABA 3MPWA 3ZZZA 2G13A 1C1BB 2FJDB 1T02A 1TK8A 1C1CA 4KQZA 2XMTA 4KB7A 4PCQA 1ZTTA 1QAJA 4O3PA 1N32F 4WZQA 3QIDA 1MU2B 3PY8A 4K4UA 2DGWA 1XN9A 1J5EF 5AJ3F 2XULA 1SJRA 2RU3A 2ZE2B 1NO8A 4RNFA 5L1KA 5CXTA 1Y5NB 3KG4A 3V6HA 4DR7F 2MKSA 2X1BA 2NR0A 3BR9A 4OI0A 4WKYA 3GIMA 3W2VA 4Y28C 3HO1A 3CVKA 1PSDA 4ZCIA 3N28A 2WTFA 2D9PA 4NLSA 3VALA 4RBTA 2CJAA 4IDKB 3K5PA 5FLXY 1RA6A 1RISA 2YNGB 3OSPA 1S0MA 1YTYA 1RYSA 2KI2A 4DR4F 1TKXA 2NUUG 4ZP9A 1S6QA 3POTB 2ZH6A 3PW2A 2XLJA 4O4GB 5LXRA 3ONQA 1FRIA 2ILYA 3MPYA 1NHVA 1C1CB 2DB1A 2B56A 3AAWB 2I9SA 4AXJA 5DDRC 4FN5A 3BF4A 4ZCKA 5BYQA 4YP3A 1C0UA 4KPYA 1B7FA 2EG2A 2W4DA 3QIPB 4C0HA 2DNHA 5DO2A 2GQQA 3FZBA 4BBYA 3TAQA 1LFPA 2EFQA 4DR6F 3O6QA 2DPJA 2CQ1A 2GGPA 3CJ0A 2QA4G 1C0UB 5E2QA 5J2QA 2ASJA 3M30A 3FEZA 2A3JA 1U09A 2C3PA 2IVYA 1PO6A 4DEZA 2DCUB 3R5BA 3I0RA 1RT3A 3CCLS 3BSNA 2IBKA 2QSWA 1QUVA 4UOCA 2HHTA 3L7OA 3CDWA 1R43A 3D1OA 3M2UA 2AGQA 2J6SA 1JLBB 2YKMA 5KFTA 1SUQB 2OFGX 5F3ZA 3KLIA 3NCPA 4IOCQ 5E0OA 2HNDA 1WACA 3OR1A 1L3UA 2IVFB 3VZHA 3UDLA 2YQ3A 4IOAQ 4N5SA 2ZE2A 3D0IE 2BE2B 1TL5A 2CG4A 2HGNA 4DSIA 2HFNA 2DO0A 3TVZA 3CULA 4Q44A 3Q24A 3LP0B 3MM6B 3T19A 2HFOA 2R8JA 2ZNZA 2WRMA 2VBYA 2DITA 1VOMA 4C8NA 1FRMA 4PXBA 4PG8A 3FSXA 2J7KA 1HW8A 3K7RA 1CPZA 2ATLA 3G86A 2MKKA 4HLBA 3V6DB 1R8BA 5F0WA 3LP0A 2ROEA 3MM6A 4KT0C 3OVSA 3G6VA 3DRPB 3CCES 1B64A 4B17A 4KO0A 4X4VA 2APOA 4NOHA 2UUWA 1HARA 3AY0A 1VMBA 2DT9A 1S9EB 2BJDA 4OI2A 2LEAA 2FIUA 2R2TA 5AXLA 2KHCA 7FDRA 2N4DA 2KT5A 4M95A 1XBWA 3OUYB 2NREA 5HROB 3KK2B 4B3MF 2HWHA 2Q43A 1L3KA 1Q53A 3T6JA 3EXYA 4HVZA 2KFYA 2ZKUA 2CQHA 1CQMA 2JJ4D 2YWGA 1MMDA 4A8YA 3N5FA 1HBNA 3W2WA 1GTEA 2GMJA 3I96A 4QIEA 4X65F 3CCQS 2KFNA 5D4LA 4ITSA 3IWLA 2HAIA 1OIAA 3IRXA 4CH1A 1IKVA 3GR1A 1JLQA 5FDLA 3SCIE 4DG1B 3IWNC 3TANA 1LW2B 5AE2A 1J2VA 1Q79A 1S10A 4R5PB 4OI3A 1Q81T 1L3VA 3VCDA 1X0FA 2J6UA 3S6EA 2R8IA 2X3GA 4O4RA 4U6PA 5LMNF 4FF2A 4WKRA 1FKOA 3JB9k 2AX0A 2B4UA 5L1IA 2R7SA 1SJ1A 3LALA 4EBDA 2MSSA 2KXFA 3PDNA 5L39A 1Q82T 4C8MA 2VFUA 1WF1A 2YNHB 4WCEQ 3MD3A 2HHSA 2RQMA 1LOUA 3RZAA 3GFXA 1TKDA 2WSCC 4YB6A 1XMBA 1WHYA 2ZH7A 2UUBF 4U67Q 2PDAA 1LXNA 2FLOA 4JI2F 2R7QA 2D3ZA 3V2UC 3F41A 4R0JA 1S0OA 2XMUA 3OJSA 2ASLA 2CDQA 2DR8A 4MK9A 3RRKA 3D2WA 3CD5A 4F50A 2BW2A 3GR0A 3MEGB 1UWBA 4DLGA 4A8WA 4F4YA 3FRYA 1BWEA 3N79A 3NAHA 1Q4RA 4ECXA 3TQ1A 2LVWA 2XO7A 4J9LA 3VZIA 3WX4A 2EK1A 1TV6A 2HNYA 2YKNA 6FDRA 3BDEA 2DGXA 4X4OA 1R8CA 3MM9A 5HL7Q 1TZ0A 2NXUA 4CO4A 4AL7A 1UA1A 4CTAA 2W8KA 2FLLA 3P6YC 4DSJA 1F9FA 3HP6A 1K1QA 1KR4A 2WSFC 1JLQB 1U6BA 1KFDA 3PW0A 4M63A 2C2RA 1SV5B 1KQKA 4XO0A 5HBMA 4MKYA 1GXLA 1HMVB 3MM8A 3BQ0A 5BYSA 1HBOA 3RB4A 2WBMA 1DLOB 2LEBA 1SKRA 3IS9B 3CDEA 1MWYA 4KHRA 2V4JB 4IKAA 2DNLA 3DRSB 1RP5A 1Y9OA 2CQIA 3KK2A 1R8PA 3DLBA 1XNRF 4LQ9A 1QVFR 2EI5A 5KFZA 2IM2A 3K57A 4BS2A 2ZUGA 3H59A 4B3RF 4ILLA 4W92B 3QO9A 2OKQA 1P1LA 1R8AA 1T95A 2CQ4A 2EFVA 1WEZA 3LH2S 4PQAA 2XNRA 2XI2A 5H9EJ 5F8GA 4LFAF 3QLHB 5HN0A 5KFPA 3DRYA 2V4RA 4K0KF 4OL8A 5LT5A 3TAMB 4H4MA 5KFVA 1U1LA 1DBDA