1N32J

Structure of the thermus thermophilus 30s ribosomal subunit bound to codon and near-cognate transfer rna anticodon stem-loop mismatched at the first codon position at the a site with paromomycin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 9
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1n32J00
2MTLA 2UXDJ 2KL8A 4KY3A 4JI8J 4DV5J 2E5LJ 4K0KJ 4X62J 4KHPJ 1XMQJ 3T1YJ 4NEYA 1HR0J 2UXBJ 2VQEJ 4AQYJ 4LFCJ 2UUAJ 3R2DJ 1J5EJ 4LFAJ 4DUZJ 4DV0J 5A2QU 4JI6J 4B3TJ 4V1Ak 4JI0J 3J80U 1N34J 4DV2J 4DR1J 4LF7J 1XNRJ 4DR4J 1HNZJ 2UUBJ 4JI4J 4DUYJ 4LF6J 5LMUJ 4DR6J 3J81U 4LF8J 3D3BJ 3W1YC 1FJGJ 5LMNJ 5IT9U 4DR5J 4JV5J 4DR2J 4B3MJ 4DR7J 4X64J 4NXNJ 5IWAJ 4JYAJ 4DV1J 3T1HJ 1N33J 4X65J 5LM7E 4JI5J 4DV6J 1HNXJ 4YY3J 4KYZA 2VQFJ 4X66J 2UU9J 1N36J 3J7AN 2MQ8A 4JI7J 1XMOJ 2MEWA 3R2CJ 2ZM6J 2F4VJ 4GKJJ 3IMQJ 4LF4J 5BR8J 1I94J 4NEZA 4DV3J 3JAMU 3OTOJ 4DV7J 1IBLJ 2UUCJ 4JI3J 1HNWJ 1IBKJ 2KVQE 4GKKJ 1IBMJ 4DR3J 4LF5J 4PWWA 4RJVA 4LF9J 2UXCJ 4B3SJ 4HHUA 1N32J 4JI1J 4JI2J 2HHHJ 4NXMJ 4LFBJ 4B3RJ 5FLXU 4DV4J 4YHHJ 1XNQJ 5AJ3J 3D3CJ 4OX9J
chains in the Genus database with same CATH superfamily
1SKUB 4IKAA 1HWIA 4BWJA 3OHAA 4WZMA 3I0RA 3JQMA 2QRRA 5DDQC 1NO8A 1GMWD 1S99A 2NXCA 1T7PA 4ANDA 1RTHB 4M95A 3LQVA 4LFBF 5HVHA 2F4VF 2ZVSA 1RT3B 4LF2A 3BO2A 3W5XA 4RBUA 4HKQA 2CJBA 3MXHP 5B0CA 3NNHA 4Q8EA 4WFAQ 2UUAF 4FBTA 2ZH1A 3QGIA 1B0PA 1OO0B 1REVA 5D0GA 3MMCA 3EVWA 4DPWA 5DQHA 2CJYB 1TKTB 4KGZB 2WBMA 3D6HB 2CNKB 2J0QD 1WG1A 3KK3A 4HACB 2FZGB 3I4HX 4JYAF 2VZ9A 3H8YA 4TN2A 4RWXA 2RKIB 2XCPA 3HJFA 2MKSA 2AV5A 4PEOA 1W2BR 2Z2ZA 4GMKA 2W01A 4F3QA 2X3DA 1S9EB 2V63A 4FYXB 4KJIA 1JLEA 2BX6A 1G3OA 4ZVGA 2WOMA 2BJEA 3VAJA 1Y5IB 4E8UA 4FNIA 1RXOB 3L4BC 3EGZA 3VAMA 1FWKA 4X4PA 3M30A 3MMAA 3IGVA 1R0AB 1RA7A 4A47A 3HPOA 3K8VA 2GNKA 4NLVA 1ZZNA 5E3AA 1RWMB 2J9CA 3D54A 2KJVA 1YBUA 2AX1A 4BC7A 3M4XA 1JIHA 2VBYA 3BGRA 2D3O1 1XMQF 1IQZA 4G1QB 4X66J 4QIGA 1RYSA 5B0DA 3DLLQ 4OX9F 4DR1F 3TVKA 1UJ4A 2M4MA 1KEKA 2QA4G 3CTRA 4CLUA 2RQMA 2QYGA 2WONB 5IV3A 4X64F 4ITSA 2GQCA 4F4YA 4LF9J 2VJUA 4O4RA 3GYGA 3I9V9 2XLIA 2G0IA 1JKHB 2OEKA 1WEZA 5A0YA 3MR6A 2YWGA 4LFCJ 3JXOA 1OYDA 2NSBA 1LW0A 4DV0J 2IY5B 2HNYA 4CLWA 4K4VA 4HYKA 1IR1A 1TKZA 4YDXA 3S01A 1TK8A 4JI4J 1UWAA 4DPYA 3SSSA 3NOGA 4LF8J 3QWUA 4TYBA 5B09A 4ZPWR 3GE9A 1T03B 2HAIA 2E5LF 1GTEA 4LVOP 4OX8A 3KG1A 1RWUA 2UXBF 1XTZA 2F9DA 1NRKA 1B99A 3B54A 1D09B 1IJEB 1RT2B 4WP9A 3T3FA 2ZUGA 2N3LA 3D1OA 1WEYA 3G6VA 3K7RA 3LPYA 2ZITA 4YOEA 2IYGA 1HBNB 3CCSS 4PUOA 4ZP8A 2WZ1A 2J5AA 3QJPA 1S7IA 3W60A 2C2DA 3CCTA 2VKZG 1VHIA 5FLXU 2LQBA 4U8YA 1U25A 1ZPWX 3PHTA 4X84A 4RR5A 3PW7A 1A0OB 3T9ZA 5ETLA 2BXJA 2UUWA 3POTA 2QA1A 3J7YI 3MR3A 2VBXA 2IVMA 2Z58B 1R7IA 1WKLA 4NCGA 4O3OA 1SCJB 2QC3A 2G0CA 1HA1A 1C1CA 2M0GB 4NLTA 1H0HB 2DEJA 5I4MA 2RQ4A 2DNPA 3L95X 4UUXA 3HULA 2XHWA 4DFKA 2M88A 1I5OB 5G4DA 2CPFA 2EC2A 1W26A 3A1YG 1F9HA 4DV1J 3QFHA 1RWWB 2HQGA 4DMZA 1SB6A 5GMKa 4A8XA 3OL6A 5HATA 2H5JB 2AEMA 1TKXB 2DISA 2PMZD 4P74A 2DHHA 1DTQB 3AOBA 2MKJA 1N5VA 4F2RA 4K2XA 5HSPA 3T1HF 2GMHA 4P7TA 4JV2A 2D3UA 5EUHA 3ENVA 4D3GA 2A6OA 1SKWA 5CYQB 2FZKB 2AU0A 4RW7B 4KKOA 4Y2AA 3KLIA 3VTIA 3OTCA 3CJ4A 4V19X 3BSCA 2J8AA 3NGDA 4ZIWA 1RI7A 3QRPA 5D4OA 2MKKA 1ZAXA 1MMDA 4M8LA 4ZVPB 1HWUA 3MM6B 3OW2R 4ICLA 2PFFB 3G6ES 3CJSA 3T6JA 5KG5A 4ED2A 4DU7A 1LWFA 3CCQS 3TZYA 1EX8A 4RNNA 4I67A 3A3PB 3BPDA 1H2UX 2CZ4A 3SBMA 2IBKA 3MR7A 1RT5B 2MPUA 1FXDA 5F0WA 1RU1A 1TL5A 2QA2A 2RUGA 4CLLA 2C2EA 3W8PA 1W7WA 2HQFA 1YDLA 3QGHA 2LA4A 4DSIA 2BKOA 2CQ2A 3K8WA 3BZQA 1X5TA 4N5SA 3F44A 5AJ3J 3FVYA 4FYDA 1S6QB 2MLZA 3VALA 4NXNF 2ERRA 2G4BA 1N33F 1CLFA 3MM9A 2ZHOA 4MJKA 2V94A 4UY85 1VHFA 3ETMA 3IR5B 2UZAA 3IC1A 1PYOB 4WK3A 1SBRA 2IMOA 3DLBA 3KUGA 2X3GA 1Q79A 4LSNB 2LKZA 4DJBA 3NNCA 1IXKA 3N79A 2AJ0A 3IWXA 3LANA 2QIFA 4U7CA 2CNOB 2MMYA 4C2MA 3VZIA 2YNGB 2HURA 2L9DA 2JFDA 2ROEA 4XPEA 1IKYA 3CDBA 1NK8A 4DV7J 3M2UA 2K2PA 3IG1A 2HHUA 1HNWJ 2KVQE 5KOWA 2UXCJ 4O3RA 2P6TA 1GK8A 2LQ9A 1GNKA 4DX7A 4I69A 1XNRF 5CD4A 1XR5A 2CKWA 2ZM6F 3ISZA 4P9SA 1HKAA 3CT9A 3MURP 1XN9A 3ENWA 3H4BA 3FMWA 2YTCA 4AQYJ 5HI7A 4I4BA 2DY9A 3ZNUA 1J5EJ 3RBZA 3GSIA 4RKUC 2OJ3A 1TAQA 3G96A 4K59A 2R7SA 3QLHA 2VDIA 4IDKA 1HNZJ 1PBAA 2ZOGA 2IHR1 2WVEA 3EPIA 4NXMF 3K57A 2HNDB 4WBFA 5IC4B 1YBTA 3DYAA 1WC5A 2ZH5A 1ZBTA 5DO2A 3GIIA 2RDIA 4MKAA 4ZCIA 3D28A 4OLPA 2I6WA 5KFLA 3KLFB 3CJTA 5E3RA 5IV4A 5KOXA 3IAM9 1P27B 5J2QA 3A3NB 3OV7A 1VJQA 1S6OA 1KVJA 2OGUA 1JLGB 1C0UA 2OPQB 4ZDNA 2DNLA 2CAJA 2R9LA 2VICA 2ZH8A 2MSTA 1HNVA 4XTTA 3P8BB 2UUTA 2ZBRA 3TI0A 3DDIA 1GT8A 1HYSA 4JOUA 1REGX 4KGMA 5JUMA 1JQGA 1WHXA 1IKVA 2W2OP 2YX4A 1VK8A 3ISND 3H5YA 1N0UA 5KG6A 4I1TA 1U1PA 1NEEA 3HP6A 1CQNA 1SUQB 3QQCD 3H0PA 2AGOA 2VFTA 1S48A 3KNAA 4F67A 1UAWA 3LH2S 3DOLB 1HW8A 3NWRA 2VG6A 1JX4A 2LU1A 2A0FB 5DDRC 4WU3A 4HT7A 4RWWA 5LM7E 1ZH5A 3CSKA 4OYIA 4JI1F 3L7UA 4P10A 2EXUA 5HQLA 1FRKA 3THVA 1Q82T 1RABB 3QATA 1LFWA 2YKQA 3VAFA 3VVTA 3OTBA 4LF1A 3GONA 4KGXB 4HTJA 2RS2A 2O66A 1RT7B 1AFJA 2AJ4A 2XC9A 4EU0A 2AWZA 1VLYA 4DBQA 2FJAB 1ZM4A 4X66F 1XQIA 2V4JB 3D5MA 5DGBA 4NWBA 3PW0A 3AA8A 2MQLA 2WRMA 4CO2A 3CE8A 1QAYA 1KP6A 1VK3A 2J8SA 2JVOA 2YWKA 2DCLA 3TJ8A 4LF9F 3C6TB 4ELVA 5G0RA 1U47A 5FDLB 1WSVA 2ZC4A 5LJ3Y 2HWHA 3VVUA 3CVKA 3UO0A 2DY1A 4XK8C 5CZVA 2W7PA 1X4DA 5KFHA 3IBWA 3ILLA 4LFCF 1OQ3A 3FSIA 4DV6J 3BKFA 1FJ7A 3UD4P 2QG9B 1UPMB 4DV0F 4FP9A 3HSJA 4DZDA 1E6YA 1WTBA 2U1AA 4JI4F 3V6DA 4MK8A 4BDPA 2OEMA 1LEOA 2R3VA 3AT1B 1T8EA 4Q0BA 1X9WA 2VFUA 3OFGA 4RW9B 4ANEA 1WHYA 1QM9A 4A4JA 3N9UC 4DS4A 3N6MA 5KFJA 2CADA 1ZZFA 4WJBA 4ENOA 5LL6d 1AZSA 1UFWA 5MAOA 3CW2C 1RT4A 5KG2A 1KQSR 3AXMA 2WW4A 1X0FA 1FFWB 2IIHA 1YJVA 3FBEA 4USWA 5C2CA 3V6JA 2AYEA 2XY6A 1B0TA 5GADU 2CJQA 1WWHA 4DSJA 1AB8A 2I1RA 4F4AA 4MFBB 2Q6CA 3G6XA 3PTWA 1O8BA 4ZJOA 2B51A 2IM3A 3FJ2A 1TMMA 1AUSL 4CO1A 3PXGa 4WYWA 4ZVEA 1O6XA 5F8MA 5KFEA 4JP8A 2I0XA 4K4TA 4NMLA 2YBVA 4EZ6A 3QJLA 1DURA 4B3OB 1IBLJ 3H90A 2FLPA 2K1RB 4ZS6A 3KHLA 1IBKJ 4XAKA 3JYTA 2C2NA 1D8YA 4ILMA 1HHSA 4IH7A 4Y00A 2VJVA 3T41A 1YITS 2KHCA 1SIZA 5M2UA 2EKNA 3MEDB 1U1MA 5ETRA 4Q45A 1P1LA 4K0KJ 2CQ0A 3B4MA 3BN4A 2R8HA 4DOZA 3OVAA 2MLXA 2BW7A 1NKEA 2FJBB 3EZOA 1T9WA 3MHYA 4U6PA 1Q95G 3RRGA 3RYLA 3FGVA 3FUYA 1RYRA 5HQMA 1OY6A 1BXNA 4ILRA 1R27B 2BQRA 3F41A 2NXJA 4QIWD 3H5XA 1U24A 4OYWA 3NKYA 1JJ4A 4OYOA 4ECSA 2E5JA 3PX0A 3BGLA 4X4SA 4H4KC 3CDWA 5HAOA 4IG0B 3AJDA 1WI8A 3TZWA 5DLFA 1WOOA 3KK1B 2DGXA 2E1MC 4DL7A 1X8DA 4J9LA 3VGVA 3GJSB 1RA6A 1YJUA 1JMTA 3MECA 2HQDA 4L76A 3ICLA 2HS4A 2LDIA 1RWPB 3E01A 1T3NA 1C1BA 3FSXA 2CJAA 2XGQA 3GFZA 2HBYB 3PO5A 1WF0A 2K7KA 2QEXS 3CD5A 2HHSA 2E7XA 1MSWD 5KT3A 5L38A 3KJVA 2JLEA 3L7PA 4I2QB 1FRHA 5AJ3F 3RAMA 1U4BA 4WF9Q 1S5ZA 1UZHA 3PW2A 1RTDB 1NAQA 2G1HA 1IKWB 1YSJA 2OD6A 3D6MB 4OJ3A 3M9MB 4UOGA 5J1NA 1FNXH 5LSLA 1RSCA 4YB1P 4Z2XA 2LQ5A 2IRUA 4GKJJ 3BBBA 4M5NA 2M8HA 1RT6B 4BLGA 2CZ9A 1YZ6A 3K2YA 4KIAA 1JNRB 1RHQB 1V5IB 2CDQA 2C2KB 4ZVRB 1KC8T 2AF6A 2HHQA 1HBOB 1YX2A 3CMES 1P9YA 1ITPA 5M2PA 1HMVB 3OXFA 3C6UB 3ITHB 1RHJB 4DFJA 4OYPA 2R7UA 4LT6A 3C19A 4QR2A 4OYZA 3OFEA 2NS1B 2JC0A 1HNWF 5DM7Q 1QJHA 4YS2A 4JI6J 2UXCF 2Y1RI 3NY0A 4OZ2A 1S49A 5IM0B 3EUNA 3F56A 4L73A 1G4CA 3MM5B 1SQFA 2DIVA 4N76A 2WHOA 3FMBA 5IT9U 2OPSB 3ZO7A 1L3UA 2NPIA 1SJQA 4CO0A 2VF3A 2MKIA 2YKNB 4AQYF 4ZLNA 1J5EF 3RW6A 1FHTA 2AZ1A 3ZC4A 3CEDA 2OH2A 1RHUB 3VQSA 1PJ6A 3EZUA 3NL0A 5L9NA 3PEHA 2VG7B 2DR5A 1WKJA 5E0OA 2H51B 3IRWP 1NHUA 3M8QA 5KFNA 1Y0HA 1DTTB 2HFSA 2ATCB 2B9YA 3CC4S 2BQUA 2K3KA 4J9MA 2JVRA 4B9LA 1TKTA 3UE2A 4KAIA 3VHQA 4IH6A 3KLGB 3MOJB 1GMVA 1FRLA 2OPRB 4MH8A 1MG7A 3HVTA 3G8TA 4DG1B 4CLFA 1VCTA 3R5CA 5A2QY 1ZTTA 3BQ1A 5KFVA 3R3TA 1GTHA 2MKCA 2DXDA 1GMWA 2M8DB 2F8MA 3C15A 4M5HA 2BJ1A 1WOSA 4QPTA 4X4OA 2QX0A 5K8NA 2HYIB 4J9NA 2MY7A 1EP4A 1FVSA 4OZ1A 2DNQA 1NPKA 4ZPBA 3BKTA 4ZHRA 4J9QA 3CJKB 2CVIA 3I55S 3PDNA 3HHKA 5F0UA 1KHVA 3NGTA 1YWXA 2W7OA 5T14A 5I42B 2EFVA 2QO3A 4MK9A 2QLJB 4G6VB 3OTEA 2ZHAA 2HRTA 1F2HA 4AL6A 4LSLA 2VG5A 5HROB 2RS8A 2IM1A 3Q83A 3ZZ0A 2DR7A 3TAQA 3SDEA 1EIYB 3NS5A 4O44A 5DRKA 5DGAA 2WONA 5A8WB 2G2YA 2O67A 3BQ2A 4USJC 4O0NA 4Y0FA 4GVBA 5K20B 3P96A 2JHEA 3SSQA 1N54B 1C2PA 1RAEB 1JKHA 1D9DA 3LWLA 3BR8A 3WDOA 2EC0A 1QE1A 3TEGA 4Y28C 4BWMA 1VC0A 2BJ3A 1GXLA 1HPZA 2LECA 2JC1A 3I0RB 1RAJA 3HZEA 5EX0A 1VQNS 2C3OA 1X5SA 2V2QA 2PO4A 5C24B 2Q66A 3I5AA 2KRRA 3W5ZA 2DHGA 2R8IA 4ZJQA 3KLHB 2DGTA 2V9WA 4DV6F 2ZBCA 3GB0A 4JI2J 3G4SS 1URRA 2Y3YA 4DR6F 1X7VA 2VH7A 5K14A 1GX5A 2IBOA 2ACYA 3M9NB 3H98A 1WC0A 1REVB 2B6AA 2XYGB 3MMCB 1FKOA 1Q8IA 3A8KA 1WEXA 3GJQB 3IGNA 2VFSA 3QJJA 1QVGR 4OYMA 3HVAA 3KK3B 2HVIA 2QLWA 4QWAA 1Q16B 2LXIA 4AT1B 2GJ2A 3CJ0A 4HR2A 4EYHB 1PAUB 1KDNA 2E66A 4EFAC 5IWAJ 3FEYB 5JVGQ 3HO1A 5GAGU 1F5BA 1ZM9A 3ZZPA 1QSSA 2QA4S 1N36J 1JLEB 2LDYA 2WOMB 3SCLE 2DJWA 3MTKA 1GX6A 3MMAB 3B82A 2V4QA 1NZ8A 3THPA 1LWCA 4DSEA 2ZVIA 2OTLS 1KTQA 1SL1A 2GMJA 4XIUA 1O0PA 3CDAA 4CH7A 3OT9A 1R3NA 3BGRB 3V4MA 3MD1A 4ZP9A 1VQ4S 1M5VC 4MT1A 1FDBA 1T95A 1WUUA 4NA1A 5L1JA 2AJ2A 4ZCKA 3P4UB 3D7SB 1TKXA 1Y00A 1ZA1B 4USUA 4KFBA 2XO6A 1LV5A 1BQXA 3W7BA 1RE1B 4MYTA 5CCMA 3K58A 1IBLF 2NPFA 5KFCA 1IBKF 1R8HA 3CWJA 2XQCA 5LMUJ 4QW8A 1VDHA 1IKXA 2FVRA 4LRFA 4TXSA 3PZPA 2NLWA 4AD6A 4K0KF 2K7JA 3HSZA 5HMYA 3O1LA 5ETQA 4QOTA 1SQGA 2NXEA 4WFXA 2HNYB 3D9BA 1N5QA 1TKZB 5CCLA 1M90T 1F60B 5DDOC 1EKRA 4NEZA 3KJFB 2XMJA 4RU9A 4NPOA 1NK5A 2WSFC 3GFYA 1U1OA 2XSJA 4IFYB 5H9EJ 3KOAA 4TYAA 3DI6B 1Y10A 1AT1B 1D1UA 4LVNP 3K5MA 1I6JA 1Y11A 3R9LA 1Y3JA 1WSRA 4OZNA 2KFZA 1S1TA 2FLOA 1NJWA 3SZ2A 2WTFA 4QWBA 4PUOB 3AD8C 3NGUA 1DAXA 3AQPA 3VGTA 2CG8A 4DR7J 5F8IA 4HDHA 2HVZA 3POTB 1UCNA 4ZCMA 2HBZB 1WF2A 1ZS6A 1XC9A 1YJRA 4M5LA 4MIWA 1JLBA 4OI0A 3TW0A 2PI5A 1J5OA 2KT5A 2WSCC 4F0KA 1WC3A 2IA6A 2MHEA 3CCZA 4WE1A 2FGCA 1SH2A 5L1KA 3PRVA 4A8KA 2BDPA 3DMJB 2RD5C 1RBOB 1SJRA 1RCXB 1UW9A 4ATNA 1K9MT 1LKZA 1O51A 2YWWA 3V4IA 4JI8J 2XNQA 2UV8A 2CPYA 3EICA 3NRBA 4WCEQ 2ZOMA 2VB6A 1UFKA 4C3MA 1U2RA 4JI7F 4J9UE 1EZZB 2RQCA 3EE3A 4NLGA 2MZJA 3CPWR 4I6WA 4HTIA 1NH8A 2QZ8A 3MMBA 3KHRA 2KM8B 2Q79A 1T9YA 1TUWA 2LFVA 4JI6F 3KLIB 3PY8A 2ZD1A 2DHAA 3ILOA 2MEWA 3P49B 2BZ2A 2HKEA 2GAHC 4KRWA 4LF4J 2EEYA 3BKUA 2IC3A 1AW0A 2F40A 4PQAA 4ELUA 2YQ0A 1SJFA 4ICLB 3R7BB 4M63A 1RJJA 4B02A 1LWFB 4F36A 2FZCB 1H73A 3CCWA 4XDCA 1CJUA 2IDLA 4ECZA 3I9ZA 3SIPB 2XO7A 1UL3A 5F9NA 4I0WA 2V8DA 2VPXB 4F4ZA 3I96A 2AYBA 1QSYA 2RHSB 1Y5NB 4C11A 2E1AA 2K8GA 3LA0A 5GAEU 2J0XA 2XBPA 4FF1A 3QZ7A 2CRLA 2ASYA 1NK0A 4NYPA 2IM2A 3RGIA 4QJVA 1MNEA 4O3QA 2OFGX 3LP2A 3FFIA 1LWEB 1OIAA 4ZN3A 2WSEC 1SUQA 4TY8A 5KG4A 3SI8A 1VISA 4OQJA 4MKBA 2GHVC 2DNZA 4P72A 3O3LA 4Q2MA 2ZKTA 1HBMB 1IBCB 3CIZA 2ZEJA 5EWEA 4K4YA 2ZJPQ 1UVMA 1NNDA 2A18A 2QSWA 1H3DA 4KE5A 3QSYB 1R0CB 4DCOB 4B3SJ 1MWYA 3MAAB 4DF8A 3NXZA 4J9SA 2HGMA 1X4BA 2DPIA 5CZXA 5KFSA 2V8GA 2Z0GA 1L3SA 4RW8B 4RLEA 2V67A 2K3IA 2MDAA 2LYVA 3R2DJ 4FYYB 1IKYB 1QD1A 2RRNA 2DGOA 2JNJA 3M2UB 3FQKA 3M1VA 2V4JA 2R7XA 2GCFA 3BEGB 1PYTA 2V8PA 3HM9A 3KHHA 3H2UB 2C3PA 4CLYA 4W98A 1T0TV 4CO3A 4V19J 1RKJA 8ATCB 4ZIVA 2P9EA 3MF5A 4URQU 4ANCA 1FX4A 4B9NA 2N4CA 1FTCA 5E7OB 1HWJA 3LAKA 1YJWS 2ZOFA 1RUSA 5FDLA 1CJTA 3C66A 2PC6A 4CLTA 3QT7A 3KLEA 1VI7A 2IVYA 2F4VJ 4CNZA 3QLHB 3D1HA 2FLNA 1RTJA 2PIIA 3PHEA 1TK5A 2DRDA 4IDKB 2ILZA 3DXBA 3Q8VA 3DYAB 4LFAF 2QN6B 1GXUA 4JI0F 3Q22A 3OHBA 4C4WA 4B3RJ 3CD7A 4ECUA 2NQPA 4OX7A 4A8FA 4QYZJ 1U6BA 5AXNA 2WVCA 2RAQA 1PILA 4KH1B 2YWFA 4EMDA 4LRCA 4PWUA 5J2QB 3LO3A 2DH7A 1DJ0A 5A8KA 5KFGA 4B17A 1S9FA 3DN9A 1HNVB 4I6AA 4WFNQ 5HANA 2IPOB 3WX4A 1PKUA 4PXBA 2DGWA 1HYSB 2B0GA 2MQQA 5GMEA 2KYZA 1IKVB 1TVRA 3QGPA 4M5KA 3LALA 3ONQA 2AP6A 1FRIA 5AE2A 5JJBA 3RB6A 2YH1A 1RWOB 3SMZA 2W7AA 1X4GA 2ALZA 3I32A 2BOPA 1WACA 4GO7X 4ECWA 5KFUA 2HMIA 3OBIA 5IWAF 3MAQA 3R6GB 2VG6B 4UOHA 3RB0A 2ZWPA 4Q5VA 1N36F 3CNQP 1U45A 1M0SA 4A8WA 2DHXA 2RU3A 3D0GE 4OX9J 3T6BA 1BHNA 3C16A 1U6ZA 1PG5B 4QZVB 4EK2A 5LSRA 1SIWB 2XMKA 2IVFB 4CZCA 3Q86A 3OL7A 5K8OA 1JLFA 1C4AA 4FN5A 2Q6BA 4AE5A 3M8YA 2X1FA 2BA9A 3TUZC 5LMNJ 4NMXA 3NWGA 1SC3B 1S1XB 3HT0A 3BREA 1MROA 3E51A 5LXYA 2V6AA 1X4CA 4S0MA 3GIMA 4K4ZA 4F0MA 4BBYA 2MQ8A 2ABYA 1VQMS 2M5YA 4FXVA 4NZ0A 2QJ3A 1IWAA 1KQKA 5G0RB 1OMSA 2GAGC 2P9CA 2HPUA 5D15A 5IXUA 3M32A 2YKOA 2QFJA 1FE0A 2HFOA 2AQ4A 5F8JA 1FNOA 2YY3A 4W90B 3T5HA 3BBFA 2C2MB 2MTLA 4DX5A 4LBPA 2HLUA 2JEIA 3KK1A 2GFFA 4B3MF 1E6YB 2L48A 2OFHX 5KFKA 1EARA 2PDAA 3V6DB 1CULA 4CDIA 2FY8A 3Q23A 1U1QA 4Q0BB 2G9OA 3RZAA 4Y2IA 2KH9A 3D6TB 3M8SA 2KTQA 4GRSA 1XK8A 3AODA 4IO1A 2HW3A 3JQKA 1MU2A 4LREA 4ES1A 2RILA 1AZSB 1RT4B 4EGLA 3ULHA 4YFUA 1U6FA 1UFLA 1YI2S 2IRXA 3FDSA 1R0BG 3PYFA 3PACA 4YDDB 3R27A 2DNKA 3OR1B 4NLYA 1KOOA 3AA9A 4CYUA 4DR7F 4DSFA 2E1RA 4DQPA 4J9VA 1K44A 2DD8S 4MYUA 3EPGA 4FYVB 4KPYA 4BC9A 4C3LA 3Q8RB 1KQFB 2OPPA 4FVCA 5ETNA 4DL2A 2WVDA 2OI2A 3D0IE 1YJ9S 3KYLA 1WJ9A 1F9FA 2B9EA 3MUMP 4ETZA 4CM2A 3Q8QB 4HI2A 3GYNA 4DPXA 3JYTB 4A8MP 1CPZA 1VBYA 1FXLA 3G8QA 3J81Y 5F8GA 4ZPCA 3Q8UA 4NYOA 3CJ2A 1S6PA 3MTJA 4F8RA 4JI8F 4PYAA 2ZBPA 4ZJLA 4NA3A 4OZ0A 4DLGA 3CGIA 3UNGC 4IFVA 5IM0A 4ED1A 1B64A 1Y3KA 3UDEA 4ZLJA 4K4SA 2RE1A 4F50A 1SQEA 2QMWA 2DH9A 3ZTRA 3PG9A 5BR8J 4PPDA 4PZVA 4PG4A 2D9PA 2R4FA 4ZVSB 1K8AT 3HZGA 2EI5A 1S72S 3VF0B 4ZVQB 3EZ5A 2UVVA 4MTPA 3DKDA 3X1LB 3MCOA 3IM8A 1FA0A 4LF4F 4X62J 1UW4A 2QMXA 2LMIA 3I5BA 4C98A 2VHGA 2RB7A 1N34J 2R7WA 2FVQA 3QYYA 2XMWA 4NE9C 3MECB 3V5RA 2YQ3A 2OPRA 4DCJB 2F1FA 3E01B 1C1BB 1TELA 4HHJA 2EFQA 2ZFHA 4NXNJ 4XPCA 1N33J 4DL4A 1LXJA 1OY8A 4WTYA 1VQYA 1Z2LA 3BGOP 3F0NA 5C25A 1OYEA 4WPAA 1N5SA 3FZ2A 3GCXP 3A8EA 5CD4H 2B5JA 3ET6A 2SXLA 4DL5A 2RVJA 2PMHA 2C3UA 5M2RA 1LQ9A 4IRCA 4DUYF 4DN9A 3PIOQ 1ZETA 2DPJA 4G65A 2XZWA 4JV5F 2KZMA 3WHIA 1A6LA 1OQ6A 3IWLA 3OQ2A 2WBRA 4K5SA 4ECRA 4B3SF 2DBBA 2G2OA 1XNRJ 5GAHU 3AQOA 3EXCX 3PRDA 3PW5A 1B3TA 2CXEA 2V2KA 3NGRA 3CJQA 3PX4A 3HHEA 2P8IA 4FXWA 2CWKA 2K06A 4I68A 4NCAA 1SKRA 2HK3A 1S0NA 1E6VB 1RBAA 4C48A 1GEHA 3FCWA 4PG8A 3CCVS 3UWTA 3J7A1 3DRSA 3BYPA 2DNYA 1VRUB 1JJCB 3FSYA 2PSZA 2OLWA 2VC0A 2ZH7A 3BSNA 4QYRA 3FZBA 3MEEA 2CQ1A 1H98A 4N47A 1ZTWA 1BQMA 3KXDA 4R0EA 1S1VB 4EYIB 1S0OA 2MYFA 5C24A 1FRMA 3LP1A 1TL1B 4WXOA 1MN9A 1KLMA 1FE4A 4DFPA 2R2UA 2NZ4A 2KJWA 2ZZMA 3KLHA 1U1RA 2W2MP 3DGVA 3PRBA 2ZNYA 2P5VA 3FK4A 2ZBIA 3GYXB 3U7JA 3GIJA 3OL9A 4I2PA 3M8QB 2H9ZA 3VCDA 1U1NA 3DRRA 5IOLA 4B3RF 4NA2A 3TA1A 4AUKA 4ID5A 1NSPA 2YXLA 1FKPA 4K4XA 2DNGA 3M8PA 3KK2A 5KFPA 3VZHA 1JLAA 3HVTB 2E9TA 4B9UA 3NMAA 3DM2B 4U8VA 1WDDA 2KVIA 1WC1A 4X4UA 2VV5A 3RBEA 3P6YC 2GGPA 1CJVA 4CNYA 2RUSA 4C0OC 1P1TA 3C15B 3PO4A 4O23A 3PR5B 2I5JB 3MPWA 4ES3A 1EP4B 4TU8A 1QTMA 4JI1J 3BV8A 4ZHRB 4EI2A 3W9JA 2EKYA 1YJ7A 3CCRS 4Z37A 2WB1D 5IFMA 4PR6A 3FBFA 3A4TA 2XTJP 2DVIA 4R5PA 3HF5A 1N56A 2QL5B 1PYSB 1HI8A 1CG2A 3GIKA 2JRSA 1ACMB 4LSLB 4C7QA 3C8YA 2VG5B 3K17A 2GIRA 2OSQA 5KFWA 2RQKA 3P5TL 3SDEB 1K0TA 3M7VA 3G2XA 3SQGA 4O44B 2M7SA 3V2UC 4I7FA 2KM8C 4Y6IA 5GAGI 2H65B 2YNHA 3J7AN 3TZXA 3MFIA 4GVBB 4RW4A 2E29A 2R42A 3PM9A 4F2SA 1D3WA 5LMNF 2GC8A 2YKMA 4QBUA 1QE1B 2KG1A 2BKPA 1T9UA 4C8NA 1NJZA 3KDOA 1X31C 4LJMA 1UVLA 1HPZB 1OJ4A 3MAHA 3AXKA 2CUYA 2NUUG 3ZTPA 4M5GA 4RBTA 4Q8FA 2ZUAA 3EDQB 1IR2A 3CJRA 3DDKA 1IR0A 4IFYA 1KFSA 3DI6A 3NAIA 1YVFA 4OHZA 3K5PA 2C22A 5J1PA 3WC2A 3KJQB 2PE8A 4DDFA 2OAUA 4PABA 4YUDA 4LIWA 5H9FJ 3PR4A 3BO4A 4FNHA 4M94A 4HLBA 2VA2A 2HHPA 4DV3F 2Z4PA 2BJ9A 1I3OB 2KO1A 3BGUA 5L1LA 3DNCA 5K14B 3WBZA 2W4PA 1HW9A 3I82A 1VBKA 2B6AB 1FKOB 1QAXA 1XR7A 1P8GA 1QUVA 3JB9k 1N5TA 1WKKA 5DG7A 3PJ9A 2E5GA 3LWMA 1Y9OA 1Y4ZB 3KG0A 1KBRA 3W9HA 5J2PA 4AXJA 2B56A 4DR3J 3UDVA 2BW2A 2YNIA 3QAEA 1WORA 4RJVA 1UJ5A 2G1DA 2IFXA 3ELHA 2VOPA 1WHVA 2FVSA 1N48A 4PAAA 2C1EB 1ZAVA 3SFUA 1RWXB 1WELA 2CQ4A 2FYXA 3HHLC 3MI7X 2FD2A 1H2TZ 1CSJA 2DR8A 1D8ZA 2Z30B 4DUZJ 1LWCB 3DMJA 5KTQA 2DB1A 4JBCA 1HI1A 4HDGA 3WC0A 4KPCA 4BS2A 2E5IA 1VIXA 2FJXA 1VIOA 1VQ9S 1B70B 4X2BA 5F8HA 1NK4A 4KFBB 2XWYA 4N8NA 2WAQD 2VUGA 1M1HA 4M5DA 5JVHQ 4ZKAA 1YJTA 2OEJA 3KDNA 4LQ3A 4ECVA 2IJNA 1X9MA 2V34A 3ZTQA 4ZPDA 3MD3A 1BE4A 4USTA 3L7OA 4NRTA 2IJFA 1FD8A 4Q7AA 3IAS9 4Z7CA 2O1PA 1Q5YA 2I8EA 2KB2A 3W62A 3FNNA 4NCBA 1IKXB 1Q78A 2V8HA 3RUBL 4OX6A 1U2FA 2NCKL 5IT0A 4YQWA 3PKMA 2L9WA 2VODA 3VAKA 1X5PA 1FWLA 1ZM2A 3EWGA 5BR8F 3MWBA 1GXTA 4FPRA 2BV3A 1SJ1A 5F3TA 2N3OA 3H4DA 3NLCA 1U02A 4Q43A 2AMCB 2XSJB 2Q1LA 3JSRA 3QIPA 2FUG9 3LGHA 1UEKA 1FJGJ 4DEZA 4P6QA 4X62F 2A2DA 2HFVA 5MLCV 1S1TB 3GCWP 2RJZA 1D9AA 3C3LA 1M5PC 1H72C 5CYMA 3M05A 1N34F 5L8RC 5ETSA 1NKCA 5IS2A 1QUPA 5KFXA 2BRLA 1Q7LB 2XULA 1VQ5S 1LWEA 2BBEA 1RCOB 2H4WB 2UUCJ 2Q43A 1RAAB 3Q2TC 3NEKA 2Y0BB 5RUBA 1UTAA 3IA0A 1MMNA 2H5IB 5D4LA 2HRUA 1HBMA 3EDRB 4IH5A 2BE7D 3MUTP 3MOZA 5EHHA 1BWEA 1BUXA 3U1MA 1NU4A 3BM7A 2KT3A 1X4EA 4OYXA 3MAAA 4H4OB 1VRQC 1EB0A 3U1LA 3N01A 1JLBB 5GAEI 1J5OB 3DLEB 4O3PA 1HQUA 1NHKL 1YQHA 4E0DA 1C4CA 4WE1B 1UEVA 3QBCA 4RW8A 2YWHA 4K2JA 4RUCA 1VRTA 1YG0A 1U1LA 1QDUB 1TU0B 3WX8A 3EYZA 4F04B 3V4IB 2KZZA 1S59A 4QIVA 1VC6A 2FIUA 2MXYA 2DH8A 4NLSA 2NYIA 1A9NB 3EGVA 2FY1A 3SXLA 1F6TA 4QU6A 4LRAA 4DHVA 3CMAS 4ED8A 3DRPA 3BJYA 1ULRA 1ZPVA 2X1GA 5IZHA 4M5IA 1F0XA 2DXEA 3GU0A 3MMBB 3GR0A 3QIDA 4ED7A 2V2VA 3CDEA 1PJ7A 2ZD1B 4J9RA 1RLCL 1M5HA 2DXFA 2HQIA 1SH0A 1JWWA 3BS9A 4OZ5A 2HLTA 2ZC3A 1T9TA 2HBQB 2BR0A 2IC3B 4UW2A 1MMLA 4CLSA 1OSDA 3HFVA 5LJ5Y 3JQJA 1MLAA 3N5FA 1S10A 1CJUB 1I1GA 1SKSA 2D3ZA 3BGFA 3IXQA 2J7WA 2VBWA 4CLPA 4C11B 3TEHB 3DU6A 2UVUA 2W9AA 3AOCA 2R7RA 4PWDA 2J9EA 3TVZA 1VOMA 1N88A 4EO8A 4ECXA 2LEPA 3LP2B 3FFIB 4LBHA 5L39A 4TY8B 4RX6A 1OS5A 2EG2A 4J9PA 3OR2A 1KN6A 3AOAA 3EM1A 4CCHA 1HR0J 2EK6A 6AT1B 1UMJA 2F8EX 1WHWA 2XZTB 2AEJA 3AY0A 4UY8T 4P2XA 3M8RA 1JLQA 5IC6B 2W24A 3WIVA 1ZYQA 4C8YA 2X51A 4MKVA 2V8VA 4U7UD 2XY5A 1Q81T 2MQNA 4KO0A 1AUDA 2IRYA 4QWCA 2YH0A 3FEZA 2YPZA 4ZP6A 3DGPA 4U95A 1RGVA 1NHVA 2H3EB 3SCKE 4J9KA 5AE3A 2N7CA 3I5CA 1S1XA 4WIQA 3M1VB 1S9GA 3PYDA 3B6BA 1IJFB 2MJNA 3X3UA 4KR0B 2Y1LB 3M8WA 1NSQA 4A8OA 4ED3A 1QAJA 1U1KA 3IBCB 3L09A 4ZP7A 4CH1A 4TNOA 3TWZA 1U49A 2QLXA 5I3UA 3QAUA 4X4TA 1C0TA 5KFTA 3R1LA 4PG6A 4FYWB 1CJTB 2A2CA 4JB8B 3FRYA 3BH7B 3KLEB 2MLYA 1CBKA 4OLOA 1RTJB 2GMLA 2VKRA 1S1UB 3TJ9A 1XMOF 1UA1A 3AD9C 2V2ZA 4DR6J 3KLVA 2JZ5A 2W8LA 3J81j 1K1QA 3ZZTA 1YRXA 2Z8QA 5E3PA 2ZH2A 4IUFA 1LNQA 2FC8A 4IOBA 2O5DA 3IP0A 2MZ1A 2WW8A 1N32F 4LR9A 4TKTA 2HWIA 4D3HA 1PGZA 2AGQA 3SYZA 1X0PA 3FRZA 4L72B 2J9DA 2KYXA 2VPYB 5HMZA 5A8KB 2O01C 3BO3A 2VPWB 3G6YA 2RDJA 3SFGA 5HJYA 5KT6A 3QGGA 3UDCA 4NLRA 3TARA 1DBDA 4P52A 1HI0P 2QV6A 4OI4A 1BMQB 5THWA 1DHMA 1N52B 3GILA 3WQPA 2H48B 4CO5A 1TVRB 3UDLA 3GR1A 2DNOA 3OR1A 4CLKA 1EKSA 1R8PA 1LK7A 3W63A 1PC4A 5DETA 1OWXA 1EJ7L 2DIUA 4DR3F 3Q2SC 2FVPA 1FK9A 4A46A 4B9SA 1K47A 2HMIB 1M5OC 1U09A 1YHQS 1S7HA 4GVLA 4ZVFA 2BM0A 5BYQA 4X4QA 4QU7A 3DHXA 4KHMA 3VV2B 1FNMA 2RF2A 1JLCA 2X1BA 4A48A 3C16B 5K8PA 4DUZF 3LAMA 3UVJA 4NX9A 4OFZA 2JL9A 3TX8A 4CTAB 5ETTA 1HQEA 4PG7A 2HFZA 2ZH6A 1V3ZA 1JLFB 1NJXA 4G1PA 2XG8A 1M1KT 3D66A 3G9CA 4F7VA 2EBGA 1MROB 2BQ3A 2XMMA 3E2EA 3BSAA 3D3CJ 3QT6A 1S57A 2NSCA 1YTYA 3R6LB 1ZAWA 5DLGA 1NB7A 2R7VA 1ZOTA 1DRZA 1BGXT 5B0FA 4PQUA 2PT0A 3R5GA 2AYGA 1S1WA 2D9OA 1HNXF 1TL4A 5HBMB 1ZM3A 3HKZD 4B3TJ 1GFWB 3ZZYA 2CQDA 1M1GA 1PJ5A 3J80U 3T1AA 3M32B 1YGYA 4TLQA 1VQSA 4RUBA 2C2OB 3EVMA 3OLAA 3TA2A 1FTRA 1RP5A 3NP5A 2AX0A 1F1BB 3N5BA 3S6EA 2ILYA 1TV6B 1HARA 4CWBA 1S0VA 1SV5A 3FEXB 2IA0A 4OHXA 3LP0A 1CULB 2CVEA 1L3VA 3TAMA 3CD0A 3UNYA 2MQOA 3D68A 1FJGF 5KT2A 2I2YA 1L3KA 3KJNB 3GFXA 2RMLA 4N77A 3NAHA 7FD1A 4O4GA 3DOKA 1MU2B 1WNEA 3EX7B 1XIQA 5HJXA 2QSFA 1Y5LB 3R5BA 3T5KA 3CC2S 4OIXA 2J6UA 2BVZA 3K59A 1RISA 4E98A 3DLGA 4IOAQ 1F3FA 3HSDA 2UUCF 3HFKA 1FRXA 3MM7A 4QIFA 2VQFF 4ZLLA 2IAJA 5E3QA 3MR5A 2LXUA 3LOUA 4LF7J 4CYUB 2KN4A 1NH7A 5BXIA 4K8RA 3K5OA 1XBWA 6FD1A 2J6SA 6FDRA 3H20A 3MPDA 2QGFB 1KVIA 2VFVA 2J76E 2D41A 4ECYA 2OPPB 4WKRA 1MN7A 2OMLA 3SCJE 4ED5A 2HFUA 4F25A 2HAFA 4OJ1A 2PEBA 1VQLS 3ZZRA 2M2BA 3T5JA 4JI7J 1V3SA 2WK4A 2AT1B 2W1BA 3AAWB 4HL9A 4Y3CA 2HIYA 3GLJA 1I94J 1E6VA 4N41A 1RAIB 2B9XA 2CPZA 4USIA 2ASJA 2CQGA 2DGQA 3JTPA 4KTQA 1S6PB 1NK9A 2B3TB 1VRUA 1NDPA 2M52A 3DLKA 5EDWA 4IFVB 5KFZA 1YKWA 2B8PA 5AXMA 5E2QA 5HK4A 2ACMA 1YZ7A 2CJKA 1X4HA 1PC5A 3C14A 4FKXA 4NLDA 1HFEL 3OUYA 1S1VA 5ETKA 5LSOA 4DWIA 5DZ6A 1UWBA 3MCNA 4DV2J 1TL1A 5GAHI 4OMFG 4ILLA 3EGWB 4EZ9A 2J0WA 5CHCB 4EWTA 2CQHA 3GZ7A 3T5LA 3S1TA 1Q53A 1AXQA 4G3IA 2HRYA 2HVHA 2CFXA 3DHWC 4J9OA 4WWSA 3H7HB 3UR0A 3ZZZA 7AT1B 1B0VA 2W9CA 1YBAA 2CQBA 5L46A 1SJ3P 2VC1A 1WG4A 2C3MA 2LQJA 2QFIA 2F7VA 2CNLB 3G87A 3MEGB 5F3ZA 2B4PA 3CB4A 4WFYA 1T9VA 2AZ3A 3UD5A 4EBCA 5KFRA 1RAFB 3IM9A 4ZK7M 3DM2A 1Q8BA 3OVBA 4DL0C 3HSGA 5FLXY 3GG1A 1Z4UA 5E3CA 4OHYA 3R97A 1Z2ZA 2I5JA 4UTGA 5C25B 2FDNA 3Q8SB 2B5JB 3ET6B 2DNHA 3M2RA 3UW1A 3A8JA 5A2QU 4OI3A 5D78A 3O2IA 1AROP 3R5JB 2GJIA 4ZVHA 4FDFA 1N6QB 1RAHB 5D3GA 4PKDB 3MUVP 3QNWB 2DNMA 3UR3C 4LF5F 1HR0F 3BBCA 4NYZA 3ZTOA 2KKHA 2XCAA 3CD6S 5HLFA 1U0SA 4YMEA 2KRBA 2E7VA 4USKA 2XZDB 3CCLS 5KG7A 2CQIA 2DT9A 1IVZA 3CCES 4A8YA 3GPAA 5DQIA 2JX2A 2W2QP 3HD2A 4PRFA 1DQ9A 5L1IA 4FKYA 3OXGA 5D4NA 4X4NA 2XYPB 2XI3A 4AL7A 1RT1B 2EBEA 2RRBA 3DRSB 2DITA 1Q8KA 2DR6A 2E7WA 1VC5A 2COLA 5I3PA 2VA3A 4ZLPA 4LFAJ 2UP1A 3KWMA 2JLFA 4JI0J 1U0HA 3MEEB 2HWTA 2UVWA 4LF6J 1VQOS 1K1SA 5D0RA 3BN7A 1BQMB 1Q8LA 2C28A 5B0AA 1DLOA 2G13A 2QMUB 2BE2A 2PEHA 4DXLA 1IBMF 3LP1B 4E2FB 4LUBA 4DU8A 3IR7B 1SC1B 3RR8A 1KLMB 4W4MA 3FCVA 1R89A 4YY3J 4R25A 2UU9J 4ZPAA 2YKPA 2KFNA 2GQQA 4L75A 2R7QA 2BANB 2MGZA 1G2EA 2GVDB 1Q0NA 4I2PB 2Y8YA 1N5YA 4DX8H 3OL8A 1HBUA 3DRRB 2HFNA 3KNGA 4JI3J 2BRKA 1NB2A 4GKKJ 1EQ0A 2LA6A 1S12A 4ID5B 1FKPB 2ZBQA 3M8PB 2HHWA 1TQLA 3KK2B 4IRKA 2JEJA 1FJCA 5A6WA 1SL2A 2NREA 1WI6A 3MCMA 3PV8A 1IM4A 1JLAB 1X5OA 3OFHA 4C0HA 4DR2F 1EETB 3DLJA 2AYMA 3V6HA 3Q89A 4NLWA 3JSBA 2LVWA 2I38A 2GGPB 1CJVB 3R7SB 3CXCR 2BJDA 4IG3A 2OKQA 5F8LA 1FVQA 4OHWA 4ZCLA 2XMAA 2HHTA 1ICEB 5JMNA 3KHGA 4QW9A 3TYTA 2MZRA 4DL6A 3MMJA 3A3OB 3AD7C 2AJ1A 5EGYA 2BUNA 5J2MA 2DKOB 3TNVA 3RBXA 2OTJS 4RL1A 5KFQA 4IQXA 4FF2A 2VONA 3AB2B 1RACB 4R5PB 2UXDF 1XERA 3G82A 2FJEB 1LOUA 4WFZA 2LXFA 1F5AA 5JXSA 5CH7B 2XY7A 4YB5A 2Z56B 2ATLA 4GC7A 1TL7A 2ZKUA 2PI4A 3SQGB 3NCRA 3HHLA 1S4EA 4JUZA 2QYCA 4I7FB 2W9BB 3PJXA 2ZDPA 4C0BA 4AFFA 3PX6A 4B08A 3H2LA 2KU7A 2YNHB 4PCQA 4DV5J 2R7TA 3E8OA 1NK6A 4U7UK 4RW4B 3ENQA 4IRDA 1B4SA 3BB5A 9RUBA 3HMJG 4NLUA 4P73A 3OFFA 2YKMB 1MWZA 1YK9A 5A6PA 1EHWA 1HNIB 5B0EA 2XB2D 5HL7Q 1QY7A 4DSLA 3R7NB 1IWGA 4B3MJ 2J9DE 4L3NA 2CJ9A 1RK8A 5D6GA 4KYZA 4U96A 4B3TF 3C46A 4UF4A 1Q86T 1CS4A 1TL3B 1HD0A 2YWEA 1KVKA 4UT4A 3KMSA 5SUHA 1NSAA 2KI2A 4DSKA 3NS7B 2B4VA 4PYDA 5DM6Q 4F02A 4HHUA 4NL5A 5T7LA 1Z1ZA 2ZE2A 1VQ8S 1SXLA 5AE1A 5J2NA 4NEYA 3M6UA 2DGVA 2L41A 5GMDA 1HQ2A 2ZHBA 1RTIA 2F63A 3O6QA 5J2PB 1NMEB 2BJ7A 4F4WA 2RU9A 3UCUP 3DLHA 2JH3A 4EUVA 4YEAA 2YNIB 4RNMA 2VD3A 5ETPA 2CQ3A 2V4RA 2NZCA 3W8GA 2B4UA 2CQCA 4LQ9A 4H4OA 2X7IA 4M5MA 5F41A 1T05B 4ED4A 3DLEA 2Q3PA 1GMUA 2F5GA 4LF7F 2KDOA 3OJUA 2PGCA 1FI4A 1VJWA 2BABA 3ISNC 2OSRA 2G0JA 4ELTA 4G1IA 2WCXA 3BYRA 2IMWP 3W2VA 4LRDA 3PYEA 3BH6B 5D77A 3CO9A 1FFGB 2YNFA 5HMWA 3RAXA 4FPIA 4IYQA 1S97A 2XEXA 3VAHA 4CRJA 1DQ8A 2A10A 1J2VA 4M5DB 3V81A 2QLFB 4TQSA 1I94F 2IYIA 3B78A 2XS2A 2P9GA 5HMXA 2YX7A 3RR7A 3D2WA 2OUGA 4C8OA 2IDEA 3I0SA 3H25A 2JSXA 5I3QA 4ERDA 1TMJA 1BQNB 5HP1A 4FF4A 1KKHA 2MQMA 3NBPA 4X4VA 3G8SA 2GJFA 1NDCA 2WVFA 1NJIT 1N8RT 2BMBA 4L6V3 3HDSA 2ADCA 3UN2A 2E44A 3BR9A 2MQPA 2CYYA 3OSNA 4DQRA 4RW6A 3L3CA 2EWHA 4DV2F 3RW7A 2RIJA 3TQEA 3RG6A 2V5HG 2MJUA 4MKYA 4LR7A 3PVXA 3GJTB 2D74B 4OZ3A 2FHJD 3M2VA 2VBZA 3QIPB 2HEKA 3O44A 4OZLA 1FFSB 4CM0A 4TVAB 2HBRB 3HI9A 5BYSA 2HHHJ 3OXLA 4LF8F 1WF1A 4CO4A 3T9NA 5LT5A 4KY3A 5CYMB 1F5CA 5B0BA 4AL5A 3U27A 3P5BP 1HL6A 3PKYA 2EG1A 3IN5A 1S76D 4KSEB 1NKBA 4B9TA 3H5UA 2I9SA 2A6MA 1RADB 1VGYA 4DUTA 2M9KA 1UVIA 1KHWA 4DUYJ 3VAGA 4WXWA 2DNNA 2BKNA 1UA0A 1L3TA 4CIOA 1WDTA 3M9OB 1H38A 2VU5A 4K5RA 5CXTA 4QWDA 4JV5J 5C42A 4M1KA 2YX1A 2RHQB 1CVJA 3PFOA 4OJGA 2L9NA 2KHDA 3TVYA 3KMQA 4FXDA 1S6UA 2HNZA 2JFKA 3TO8A 2VASA 2XSFA 5AXLA 3QRQA 1HQUB 2JOQA 4QR1A 4X4RA 1U8SA 5J1EA 3G71S 2XHCA 1VBXA 5A8RA 1VRTB 3CF5Q 3M8ZA 2BOAA 1QLNA 4UOFA 2HIQA 4UQTA 1FESA 4HT5A 3DDNA 2D69A 3CO0P 4RNOA 2IM0A 3PW4A 2OIHA 2EW9A 2C3YA 3GFHA 4DV1F 1DZ5A 3RTVA 4TY9A 3JSMB 2FHKA 5EX3A 5U47A 4ZMMA 3S7RA 3DRPB 1WG5A 5EN1A 4U67Q 4K4WA 4K50A 1U2CA 3K5LA 3AHPA 3H42A 3ENAA 5DDPC 3DOMB 1S1UA 3QO9A 3J80Y 1V9OA 3CCUS 2UV8G 1YRUA 2Y1JA 2GVZA 3P3DA 4O3SA 5DS7A 4LF6F 5LOQA 3HLUA 4NI2B 4F0HA 3W2WA 1KLNA 1BLUA 4ES2A 4J5OA 4USMA 4DLEA 1SJ4P 4NRUA 1NDKA 4YY3F 2F65A 1NSKL 2UU9F 3RAQA 1KQGB 4RZRA 2PA8D 3EGNA 2HSEB 3CMQA 3T1YJ 2V50A 5K8MA 1JXLA 4TU7A 4JI3F 2XMUA 4GKKF 3B8HA 5CA5A 4K4UA 5T41A 4PWDB 2JEGA 4U9RA 4JV1A 3I87A 3MM8A 2UUBJ 4C97A 1JXVA 3I4PA 4ZITA 1LW2A 4QR0A 3UCZP 3K5NA 4DZ6A 3OR2B 3K0JA 4R8UA 2QL9B 2ADBA 1VR6A 1CJKA 2F4FA 1JLQB 2DRBA 9ATCB 5CQGA 4DQQA 3RRKA 3PCOB 3M6XA 1NPRA 1VBZA 1F3VA 2HZVA 3IFEA 3IS9A 5IQQA 4KO0B 3IRXA 3GV5B 4CTAA 2J0SD 4IR1A 3DGPB 3HKWA 2NYHA 3TUPA 3PJWA 4ZPVR 3KG4A 4USVA 1UVJA 3OTDA 4DFMA 4C6AA 1ROFA 4ECTA 1PAEX 3THTA 8AT1B 3BDPA 1S9GB 4UZCA 5H9EK 4ZVUB 1NK7A 3M6WA 5CAAA 1NPPA 1HWKA 2CPDA 5H1SV 1IN0A 2EK1A 2FHOB 5IT9Y 4DV7F 1VQPS 5ETOA 4DR5J 5I3UB 4DV5F 5HBMA 1C0TB 2DO4A 3NMRA 3GG0A 1SH3A 1UETA 4QIEA 2POKA 2HHXA 4DV3J 1TV6A 2B7CB 1RTHA 2CNNB 1APSA 2KXHA 4KGVB 4WKYA 2EPIA 3A13A 3BDEA 1RDRA 1X4FA 1NM2A 1RT3A 3GIRA 1HNZF 1KOHA 4DV4J 1SPBP 3KUHA 2UVRA 1JK9B 1VQ7S 4I56A 4ED6A 4B9VA 3A12A 5EWFA 3I31A 3TJAA 3QRRA 3CJ5A 3RU0A 3HJVA 1X9SA 2RRAA 3CIMA 4EO6A 2M70A 4H4KA 5F8NA 1FJEB 4GC6A 2BE9B 1UZDA 3W3SA 4HACA 1R8BA 4CT9A 1HWLA 5GVQA 2BJ8A 2RKIA 4KHRA 2HS0A 5KFMA 2APOA 5KFFA 3VWSA 4C8MA 5EWGA 2XMVA 3IWNC 1PO6A 2DEIA 3R2CJ 1S9EA 4CLZA 5C7PA 1FK9B 2MKYA 4N56A 2NUHA 2EVZA 4DI6A 1J27A 3PYGA 2JLGA 4C8KA 2ZH9A 1R0AA 2FTRA 3OVSA 2CA9A 2RF2B 1JLCB 1PIEA 4DPTA 2B43A 3IBFB 4UQGA 1CC8A 4C8LA 3UVJB 4EBEA 3BSOA 4G1QA 2AJFE 1TP7A 3RB3A 1HQEB 2GV1A 2C2ZB 1UVNA 4CT8A 4A8QA 3UN5A 1Q7YT 2EFOA 3ZZOA 4KV8B 1RHMB 2U2FA 1NCLA 1TUGB 3J81U 1U26A 4I6YA 3UN3A 4H4MB 1VS3A 3P45B 3TANA 1FEHA 2E5HA 4QWEA 2DGSA 1TFWA 2R8KA 3BQ0A 2P6SA 3VQTA 1FWPA 3NCPA 4PQUB 1M5KC 1TKDA 1S1WB 4ZN1A 2W25A 4OI6A 3TRGA 2E9RX 1Q4RA 2EFGA 4CQ1A 5F9LA 4I64A 2ZWOA 3ZTSA 3JAMU 2PA3A 1FDDA 5L9XA 4RUAA 4TLRA 2R8GA 2B9WA 1T03A 3K89A 4Y2CA 2GX8A 3EXYA 1CEZA 1SV5B 3AJ2A 1TK0A 4P71A 3MEGA 3LP0B 4NOHA 3H2VE 5D0EA 4NLQA 3TAMB 1RHRB 2MKHA 4P7VA 4Y34A 4OL8A 1RT2A 3GP9A 4WZQA 4QPXA 2V69A 7FDRA 2HVDA 4GO5X 2F9JA 5KFYA 4DR4J 2HHHF 2X1AA 4NASA 5IT4A 4O4GB 4MK7A 1HBNA 1UKUA 3DOKB 2HHVA 1H6KX 1NLKL 1OPZA 1T11A 1CC7A 3JSYA 2R7OA 3MGJA 4F3OA 1RAOA 1JXEA 3OPKA 3DLGB 3Q24A 1N6QA 3MM7B 2YKAA 3R5AA 2IAJB 3VGSA 4CH0S 2QTWA 1OSCA 3OTOJ 3QSIA 1T94A 1DY3A 4FS1A 4WFBQ 5DJBA 1V5VA 1DARA 2HGLA 3HK2A 2ASLA 1G6BA 2RSQA 3M30B 4ZVOB 2GIQA 2J6TA 2FGOA 1XJWB 1YLXA 1K73T 5KG0A 1EQMA 1WD6A 2ZZNA 3OSPA 4XDDA 3WIUA 4FS2A 4A8SA 4URGA 2ROGA 4O3NA 4F4KA 4DF4A 4FZVA 1RWKB 2CJXB 4Y2MA 4LR8A 3HCXA 3LW5C 3FKBA 2EFNA 1RT1A 1Q5VA 4WYLA 1DTQA 2XYHB 4FVMA 2MZTA 4QYZK 2ZNZA 2OMOA 3DLKB 2O3DA 4KB7A 3C2PA 3QWPA 2MZSA 4DPUA 3DCAA 1LXNA 2L3MA 5CYQA 3C14B 4RW7A 3OUYB 4RU2A 2C2RA 2GO8A 1XR6A 1TTHB 1RKIA 4RNFA 1UWBB 4O0IA 3UPFA 2H5EA 2NXNA 4UUWA 3LF0A 4C3KA 2D1CA 3TAPA 4KT0C 4MIBA 3AB4B 5A0YB 3W61A 4F4XA 3KTQA 1SC6A 2H54B 3RB4A 2DR9A 2ZJQQ 4Y65A 2MZQA 1LW0B 2BANA 3MM6A 2CPEA 1V3RA 2GVDA 1UVKA 1FO1A 4WP3A 4IOCQ 1VLOA 5D4PA 1S79A 1PCAA 4KH0B 4UOCA 1WTFA 3J7YU 4AXIA 3US5A 4WTOB 2W9CB 3FQLA 3R8YA 1D0EA 3W5YA 1RT5A 2DCUB 4CP5A 2LU2A 2ZH4A 2QLBB 2QL7B 3AH6A 1RLDA 3PNIA 1L5UA 1NBEB 3EVOA 1EETA 3HHNB 1NJYA 1UEUA 3H40A 4NLXA 2H1YA 2H4YB 2OD4A 1DQAA 3T1YF 4P2MA 1GH8A 2AW0A 1TR0A 1S6QA 4HEA9 1NDLA 2AEFA 3GWCA 4UZBA 1CQMA 1RU2A 2VIHA 3MFHA 3M2RB 1HLWA 4DCPB 2UUBF 4KQZA 5KFAA 4DQSA 4QQBA 3IMQJ 4P2SA 1S0MA 2YQ1A 2VL1A 3KKFA 5KG1A 4OI1A 3MPVA 3TX0A 1R6VA 1NZAA 3G86A 1P9QC 5D3GB 3DRYA 3LGMA 3CUNA 4OJHA 3LGNA 1QAIA 2W4CA 3I6PA 2KFYA 2N4DA 4NCGB 4YHHJ 1XNQJ 4LSNA 3M6VA 1C1CB 3KUEA 5HLFB 4URSA 2A1BA 2HS3A 3TP2A 2ZH3A 5CYJA 3DFEA 2GIFA 2E1PA 4TU9A 2YNGA 3MDFA 1MW7A 1BD6A 2Y8WA 4IR9A 1UP1A 1IQTA 2VPZB 4KBIA 3QT8A 2W9BA 2YPYA 1HHQA 3NCQA 2GQ2A 3NGKA 4GKJF 1G1XA 4NZ7A 2MSSA 3O8WA 2FVCA 1R8CA 1YJNS 3D1QA 3OLBA 2ZJRQ 2BEFA 2KT2A 3PIPQ 1TUVA 3R5DA 2ASDA 4K7QA 2AD9A 4PPZA 5KT5A 1HNIA 4EBDA 2J7KA 1XMOJ 1RWNB 3QT5A 3HHDA 4N7TA 4DL3A 2B4OA 1U0HB 3Q0AA 3BPSP 3UCGA 5DG8A 1VQ6S 4DR5F 2XM3A 4KKOB 3HX9A 1DLOB 2IJRA 1YIJS 3HD1A 2P2CB 4N8OA 4PWWA 1B7FA 5A76A 2BE2B 3W64A 1AA1B 3MEKA 2HNDA 2WB4A 1TL3A 1N32J 1XWLA 4J7CA 3OJSA 3RRHA 1T9XA 2XLJA 3H5SA 4KHPJ 3FCHA 2MGZB 3LPEA 3KLFA 3TQ1A 3W66A 2CPXA 3KFWX 3QZ8A 1IUJA 5KAKA 4YR2A 3AFGA 3PEJA 1N5YB 4J90A 1HBUB 1KR4A 1JLGA 2OPQA 5ITHA 5E33A 1LWXA 2RT3A 4DV4F 1Q1KA 2XWXA 3D3BJ 2HQCA 3GV7B 1TZ0A 2W4DA 1RB0A 3WZ0A 4X65J 3HHLD 4HH0A 4RUHA 2FPHX 5FIIA 4OHVA 1H74A 2GS8A 1FKAF 1UJ6A 3CULA 4JV0A 4IG3B 2CPIA 2DGUA 3H59A 4LSZB 4HH1A 2DO0A 5ETMA 4RBVA 1GAOA 1Y7PA 1YRTA 2BYCA 4WK1A 1T05A 3TOQA 1R43A 4M5JA 2FHMA 3MM9B 2LLZA 3QPIA 4F3MA 3DOLA 3SSRA 2RH3A 5FD1A 1S4FA 5J2MB 3JTNA 4W92B 3G82B 2VQEJ 2HGNA 2KG0A 4OV1A 1BC6A 1A7GE 2XLKA 3GJRB 4V1Ak 3O5TB 1KTVA 5ADZA 2Z2MA 4TQRA 3FBCA 2MHNA 2PD1A 4QCLA 4J37A 4ID8A 1TL7B 1RT7A 3HHLB 3GQCA 1K0VA 1KNZA 2HG4A 2W2PP 3N6NA 1V6HA 3FBBA 3IG1B 3MZIA 4BCAA 4JI5J 4WIIA 4DN0A 1HNXJ 2PFDA 1BQNA 4NZ6A 3SCIE 4L3KA 4Q2LA 5KFDA 1FDNA 3ZFVA 2M3DA 2E9ZA 2V9KA 4WU2A 3Q8PB 1XEZA 2OO4A 2V68A 3C6TA 3MPUB 4RNHA 3D4JA 3SV4A 1KONA 3UFCX 1AYEA 1EAYC 2FLLA 2LEBA 4YR3A 4HI1A 4LFBJ 2Z2YB 2FJWA 5LXRA 4KC5A 3NNAA 5KG3A 4NLOA 5DQGA 3SV3A 2CPJA 3CCJS 2L08A 5KFBA 2KL8A 1S77D 2DRAA 5K9FA 1CS4B 5HN0A 2FJDB 4DPOA 2UUAJ 1NXIA 1MWQA 2FC9A 4NLPA 2R8JA 1PBUA 4PG5A 2FJVA 1P6TA 3HVRA 5D8HB 5E5NA 2N7YA 5FJ4A 3TZZA 3SEOA 1H7XA 3F73A 2ROPA 2V0NA 3JS9A 2EFPA 2DHSA 1QTNB 1JJHA 5T7LB 4RW9A 1C0UB 3CJ8A 3N28A 2R2SA 2ZE2B 3EMTA 5J2NB 1KFDA 4JYAJ 2QT7A 3U02A 1SVDA 4JI2F 2VQFJ 5HVFA 2NR0A 1G7CB 2GZOA 4Q44A 1RTIB 3MCSA 4C8ZA 4DR4F 1H2VZ 2XS7A 1QVFR 4L74A 2PN6A 2G2ZA 4Y2KA 1KRPA 2DNRA 5B08A 1QSLA 1HD1A 2LQ8A 2Y1IA 3GSDA 3TUIC 4OI2A 4LBIA 1AFIA 2FHJA 4MMOA 5E41A 1FERA 2AKWB 2AGPA 1T02A 4P75A 4MFBA 2GHPA 3D67A 4FBUA 1FD2A 1RBLA 1JJ2R 4J91A 1XMQJ 3OTOF 1ELOA 3NS6A 1FX2A 1JB0C 4PXCA 1KD1T 3MPYA 3J7Z5 2N82B 3W2VB 3HT3A 4DR1J 4ZA1A 4B3OA 2R2RA 1RQ0A 2FQQB 2K1RA 2YNFB 1W25A 2AHOB 4BHQA 5DZ7A 4X64J 5KFOA 3JSMA 1LK5A 3QMQA 3V81B 4OYAA 1FT8A 3OD2A 1FRJA 3MEDA 2LCWA 2LEAA 2FB0A 2XI2A 5GADI 3I56S 1RAGB 4PXEA 3I0SB 3NG8A 2CQPA 1R31A 1FDAA 2AIRB 3DOMA 5HQ8A 5HP1B 3W9IA 3NBPB 1N0VC 4OV6A 5HVGA 1FCAA 4YN3B 5LMUF 2CDRB 4DQIA 4ALZA 4NI2A 4CI0B 4RW6B 2BM1A 3W65A 1JNZB 3ADAC 3E3XA 2R2TA 2E5LJ 3FC9A 2UXBJ 1I51B 1WOPA 3D0HE 4IG0A 2DTJA 3M2VB 2XS5A 3HFZB 1OY9A 3ETOA 2JDJA 4MAKA 4ETXA 2HQ3A 4EEYA 8RUCA 3ZNJ1 4IQMA 4C9DA 2XNRA 3ILJA 4ZOSA 1RTZA 2HZCA 2Z2LA 3T19A 2AJQA 2RDDA 4OYBA 4HVZA 4R0JA 5AXKA 2OELA 5IQ6A 4YB7A 2B8QA 2PMWA 1M5SA 1H7WA 3QFWA 3DXSX 1VYAA 1FEEA 1RZMA 3NGSA 4LF5J 1X4AA 3RJMB 4I2QA 5C42B 5C2GA 1KWMA 4YP3A 1W2IA 1O5JA 1F9EB 3UI3A 2B7BB 2Y0SD 1RTDA 1TFYA 2CIMA 1IKWA 4ED0A 2HNZB 2HVEA 2LP4A 2F8HA 3ZXWA 1HHTP 3GMGA 1F2GA 3S8SA 3NOCA 2KXNB 2GO9A 4ECQA 5J1EB 2W8KA 3ZZUA 1RT6A 5A8RB 2GA7A 1VFJA 4IO9Q 2VFRA 1XNQF 4YHHF 1KSPA 3W1YC 1TAUA 1GQEA 1D9FA 4Z7YA 1HBOA 2J7UA 4DX6A 3J7ZT 3T1HJ 1HMVA 3C6UA 3BF4A 3ITHA 2QE5A 3VR1A 3U1NA 1LFPA 2CZVC 3VGUA 3D6FB 2DK2A 3DRXA 1B7YB 2GHWA 3VAIA 2VDHA 3RBDA 4LIRA 5H9FK 4B9MA 1N4LA 2OHDA 3LTOA 1IBMJ 3CCMS 3TA0A 2DYAA 3MM5A 3DU5A 3GV8B 1DFDA 5AT1B 1HIYA 3B4DA 1FXRA 3N4WA 2OPSA 1T3OA 3QO9B 1WC4A 1UPPA 5SZTA 1U8WA 1SL0A 3JAMY 5B0GA 2YKNA 1RWVB 2GVZB 3TUJC 4KGKA 3W2WB 3N6LA 4USHA 5ETVA 2GW8A 3EJMA 5K5MA 3Q8YA 4P2FA 2VG7A 3HXMA 2ZZTA 1FF2A 1SC4B 4AYBD 4RPFA 2XGPA 1DTTA 4DR2J 2OP5A 4KHPF 4OZJA 3A8IA 4DS5A 3LUYA 1U48A 4LMZA 4LRBA 4PXDA 4H54A 3KLGA 2Z57B 1WC6A 1IM6A 3N0VA 2E1CA 2BACA 3IR6B 4DG1A 2D3OR 4FF3A 4YB6A 3MM8B 2ALYB 1X60A 2WVBA 1R6YA 1NUEA 3CJ3A 2HZAA 4ER8A 2F3JA 5DG9A 4X65F 4XO0A 2CPHA 4ZPTR 1RHKB 1LW2B 2HK2A 1U7LA 5BYRA 1URNA 2D7SA 1PSDA 3KJVB 2NXUA 4R8UB 2UXDJ 5CABA 3CJKA 2W2NP 5KT7A 1CJKB 3R1HA 4MIAA 3MR2A 3ILIA 2XMTA 5I42A 3IS9B 4ZVTB 5BJRA 2JWNA 3UD3P 3IRXB 5B7WA 3L9ZA 1VQKS 1R8AA 2MY8A 3DC2A 3UQSA 5D0HA 5HROA 4RO0A 4HHHA 4WP8A 3JTOA 1BY9A 1XMBA 2JEFA 3IO1A 1ZA2B 2VQEF 2KXFA 4KV8A 2Y9HA 1SI9A 2YVSA 5KFIA 3GTYX 5KT4A 1BWVA 2A3JA 5A8WA 4H4MA 2ZM6J 3CC7S 3AJ1A 2VOOA 2MB0B 1VMBA 2JJ4D 3TR5A 1KS2A 3PFEA 5C5JA 2ZDOA 2C42A 2RNEA 4JI5F 4YR0A 2CG4A 4F26A 1OPIA 4NXMJ 3CDUA 3V6KA 3HVWA 3SQOP 2CWXA 5HO4A
chains in the Genus database with same CATH topology
2MTLA 2UXDJ 2KL8A 4KY3A 4JI8J 4DV5J 2E5LJ 4K0KJ 4X62J 4KHPJ 1XMQJ 3T1YJ 4NEYA 1HR0J 2UXBJ 2VQEJ 4AQYJ 4LFCJ 2UUAJ 3R2DJ 1J5EJ 4LFAJ 4DUZJ 4DV0J 5A2QU 4JI6J 4B3TJ 4V1Ak 4JI0J 3J80U 1N34J 4DV2J 4DR1J 4LF7J 1XNRJ 4DR4J 1HNZJ 2UUBJ 4JI4J 4DUYJ 4LF6J 5LMUJ 4DR6J 3J81U 4LF8J 3D3BJ 3W1YC 1FJGJ 5LMNJ 5IT9U 4DR5J 4JV5J 4DR2J 4B3MJ 4DR7J 4X64J 4NXNJ 5IWAJ 4JYAJ 4DV1J 3T1HJ 1N33J 4X65J 5LM7E 4JI5J 4DV6J 1HNXJ 4YY3J 4KYZA 2VQFJ 4X66J 2UU9J 1N36J 3J7AN 2MQ8A 4JI7J 1XMOJ 2MEWA 3R2CJ 2ZM6J 2F4VJ 4GKJJ 3IMQJ 4LF4J 5BR8J 1I94J 4NEZA 4DV3J 3JAMU 3OTOJ 4DV7J 1IBLJ 2UUCJ 4JI3J 1HNWJ 1IBKJ 2KVQE 4GKKJ 1IBMJ 4DR3J 4LF5J 4PWWA 4RJVA 4LF9J 2UXCJ 4B3SJ 4HHUA 1N32J 4JI1J 4JI2J 2HHHJ 4NXMJ 4LFBJ 4B3RJ 5FLXU 4DV4J 4YHHJ 1XNQJ 5AJ3J 3D3CJ 4OX9J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MTL A;  2UXD J;  2KL8 A;  4KY3 A;  4JI8 J;  4DV5 J;  2E5L J;  4K0K J;  4X62 J;  4KHP J;  1XMQ J;  3T1Y J;  4NEY A;  1HR0 J;  2UXB J;  2VQE J;  4AQY J;  4LFC J;  2UUA J;  3R2D J;  1J5E J;  4LFA J;  4DUZ J;  4DV0 J;  5A2Q U;  4JI6 J;  4B3T J;  4V1A k;  4JI0 J;  3J80 U;  1N34 J;  4DV2 J;  4DR1 J;  4LF7 J;  1XNR J;  4DR4 J;  1HNZ J;  2UUB J;  4JI4 J;  4DUY J;  4LF6 J;  5LMU J;  4DR6 J;  3J81 U;  4LF8 J;  3D3B J;  3W1Y C;  1FJG J;  5LMN J;  5IT9 U;  4DR5 J;  4JV5 J;  4DR2 J;  4B3M J;  4DR7 J;  4X64 J;  4NXN J;  5IWA J;  4JYA J;  4DV1 J;  3T1H J;  1N33 J;  4X65 J;  5LM7 E;  4JI5 J;  4DV6 J;  1HNX J;  4YY3 J;  4KYZ A;  2VQF J;  4X66 J;  2UU9 J;  1N36 J;  3J7A N;  2MQ8 A;  4JI7 J;  1XMO J;  2MEW A;  3R2C J;  2ZM6 J;  2F4V J;  4GKJ J;  3IMQ J;  4LF4 J;  5BR8 J;  1I94 J;  4NEZ A;  4DV3 J;  3JAM U;  3OTO J;  4DV7 J;  1IBL J;  2UUC J;  4JI3 J;  1HNW J;  1IBK J;  2KVQ E;  4GKK J;  1IBM J;  4DR3 J;  4LF5 J;  4PWW A;  4RJV A;  4LF9 J;  2UXC J;  4B3S J;  4HHU A;  1N32 J;  4JI1 J;  4JI2 J;  2HHH J;  4NXM J;  4LFB J;  4B3R J;  5FLX U;  4DV4 J;  4YHH J;  1XNQ J;  5AJ3 J;  3D3C J;  4OX9 J; 
#chains in the Genus database with same CATH topology
 1SKU B;  4IKA A;  1HWI A;  4BWJ A;  3OHA A;  4WZM A;  3I0R A;  3JQM A;  2QRR A;  5DDQ C;  1NO8 A;  1GMW D;  1S99 A;  2NXC A;  1T7P A;  4AND A;  1RTH B;  4M95 A;  3LQV A;  4LFB F;  5HVH A;  2F4V F;  2ZVS A;  1RT3 B;  4LF2 A;  3BO2 A;  3W5X A;  4RBU A;  4HKQ A;  2CJB A;  3MXH P;  5B0C A;  3NNH A;  4Q8E A;  4WFA Q;  2UUA F;  4FBT A;  2ZH1 A;  3QGI A;  1B0P A;  1OO0 B;  1REV A;  5D0G A;  3MMC A;  3EVW A;  4DPW A;  5DQH A;  2CJY B;  1TKT B;  4KGZ B;  2WBM A;  3D6H B;  2CNK B;  2J0Q D;  1WG1 A;  3KK3 A;  4HAC B;  2FZG B;  3I4H X;  4JYA F;  2VZ9 A;  3H8Y A;  4TN2 A;  4RWX A;  2RKI B;  2XCP A;  3HJF A;  2MKS A;  2AV5 A;  4PEO A;  1W2B R;  2Z2Z A;  4GMK A;  2W01 A;  4F3Q A;  2X3D A;  1S9E B;  2V63 A;  4FYX B;  4KJI A;  1JLE A;  2BX6 A;  1G3O A;  4ZVG A;  2WOM A;  2BJE A;  3VAJ A;  1Y5I B;  4E8U A;  4FNI A;  1RXO B;  3L4B C;  3EGZ A;  3VAM A;  1FWK A;  4X4P A;  3M30 A;  3MMA A;  3IGV A;  1R0A B;  1RA7 A;  4A47 A;  3HPO A;  3K8V A;  2GNK A;  4NLV A;  1ZZN A;  5E3A A;  1RWM B;  2J9C A;  3D54 A;  2KJV A;  1YBU A;  2AX1 A;  4BC7 A;  3M4X A;  1JIH A;  2VBY A;  3BGR A;  2D3O 1;  1XMQ F;  1IQZ A;  4G1Q B;  4X66 J;  4QIG A;  1RYS A;  5B0D A;  3DLL Q;  4OX9 F;  4DR1 F;  3TVK A;  1UJ4 A;  2M4M A;  1KEK A;  2QA4 G;  3CTR A;  4CLU A;  2RQM A;  2QYG A;  2WON B;  5IV3 A;  4X64 F;  4ITS A;  2GQC A;  4F4Y A;  4LF9 J;  2VJU A;  4O4R A;  3GYG A;  3I9V 9;  2XLI A;  2G0I A;  1JKH B;  2OEK A;  1WEZ A;  5A0Y A;  3MR6 A;  2YWG A;  4LFC J;  3JXO A;  1OYD A;  2NSB A;  1LW0 A;  4DV0 J;  2IY5 B;  2HNY A;  4CLW A;  4K4V A;  4HYK A;  1IR1 A;  1TKZ A;  4YDX A;  3S01 A;  1TK8 A;  4JI4 J;  1UWA A;  4DPY A;  3SSS A;  3NOG A;  4LF8 J;  3QWU A;  4TYB A;  5B09 A;  4ZPW R;  3GE9 A;  1T03 B;  2HAI A;  2E5L F;  1GTE A;  4LVO P;  4OX8 A;  3KG1 A;  1RWU A;  2UXB F;  1XTZ A;  2F9D A;  1NRK A;  1B99 A;  3B54 A;  1D09 B;  1IJE B;  1RT2 B;  4WP9 A;  3T3F A;  2ZUG A;  2N3L A;  3D1O A;  1WEY A;  3G6V A;  3K7R A;  3LPY A;  2ZIT A;  4YOE A;  2IYG A;  1HBN B;  3CCS S;  4PUO A;  4ZP8 A;  2WZ1 A;  2J5A A;  3QJP A;  1S7I A;  3W60 A;  2C2D A;  3CCT A;  2VKZ G;  1VHI A;  5FLX U;  2LQB A;  4U8Y A;  1U25 A;  1ZPW X;  3PHT A;  4X84 A;  4RR5 A;  3PW7 A;  1A0O B;  3T9Z A;  5ETL A;  2BXJ A;  2UUW A;  3POT A;  2QA1 A;  3J7Y I;  3MR3 A;  2VBX A;  2IVM A;  2Z58 B;  1R7I A;  1WKL A;  4NCG A;  4O3O A;  1SCJ B;  2QC3 A;  2G0C A;  1HA1 A;  1C1C A;  2M0G B;  4NLT A;  1H0H B;  2DEJ A;  5I4M A;  2RQ4 A;  2DNP A;  3L95 X;  4UUX A;  3HUL A;  2XHW A;  4DFK A;  2M88 A;  1I5O B;  5G4D A;  2CPF A;  2EC2 A;  1W26 A;  3A1Y G;  1F9H A;  4DV1 J;  3QFH A;  1RWW B;  2HQG A;  4DMZ A;  1SB6 A;  5GMK a;  4A8X A;  3OL6 A;  5HAT A;  2H5J B;  2AEM A;  1TKX B;  2DIS A;  2PMZ D;  4P74 A;  2DHH A;  1DTQ B;  3AOB A;  2MKJ A;  1N5V A;  4F2R A;  4K2X A;  5HSP A;  3T1H F;  2GMH A;  4P7T A;  4JV2 A;  2D3U A;  5EUH A;  3ENV A;  4D3G A;  2A6O A;  1SKW A;  5CYQ B;  2FZK B;  2AU0 A;  4RW7 B;  4KKO A;  4Y2A A;  3KLI A;  3VTI A;  3OTC A;  3CJ4 A;  4V19 X;  3BSC A;  2J8A A;  3NGD A;  4ZIW A;  1RI7 A;  3QRP A;  5D4O A;  2MKK A;  1ZAX A;  1MMD A;  4M8L A;  4ZVP B;  1HWU A;  3MM6 B;  3OW2 R;  4ICL A;  2PFF B;  3G6E S;  3CJS A;  3T6J A;  5KG5 A;  4ED2 A;  4DU7 A;  1LWF A;  3CCQ S;  3TZY A;  1EX8 A;  4RNN A;  4I67 A;  3A3P B;  3BPD A;  1H2U X;  2CZ4 A;  3SBM A;  2IBK A;  3MR7 A;  1RT5 B;  2MPU A;  1FXD A;  5F0W A;  1RU1 A;  1TL5 A;  2QA2 A;  2RUG A;  4CLL A;  2C2E A;  3W8P A;  1W7W A;  2HQF A;  1YDL A;  3QGH A;  2LA4 A;  4DSI A;  2BKO A;  2CQ2 A;  3K8W A;  3BZQ A;  1X5T A;  4N5S A;  3F44 A;  5AJ3 J;  3FVY A;  4FYD A;  1S6Q B;  2MLZ A;  3VAL A;  4NXN F;  2ERR A;  2G4B A;  1N33 F;  1CLF A;  3MM9 A;  2ZHO A;  4MJK A;  2V94 A;  4UY8 5;  1VHF A;  3ETM A;  3IR5 B;  2UZA A;  3IC1 A;  1PYO B;  4WK3 A;  1SBR A;  2IMO A;  3DLB A;  3KUG A;  2X3G A;  1Q79 A;  4LSN B;  2LKZ A;  4DJB A;  3NNC A;  1IXK A;  3N79 A;  2AJ0 A;  3IWX A;  3LAN A;  2QIF A;  4U7C A;  2CNO B;  2MMY A;  4C2M A;  3VZI A;  2YNG B;  2HUR A;  2L9D A;  2JFD A;  2ROE A;  4XPE A;  1IKY A;  3CDB A;  1NK8 A;  4DV7 J;  3M2U A;  2K2P A;  3IG1 A;  2HHU A;  1HNW J;  2KVQ E;  5KOW A;  2UXC J;  4O3R A;  2P6T A;  1GK8 A;  2LQ9 A;  1GNK A;  4DX7 A;  4I69 A;  1XNR F;  5CD4 A;  1XR5 A;  2CKW A;  2ZM6 F;  3ISZ A;  4P9S A;  1HKA A;  3CT9 A;  3MUR P;  1XN9 A;  3ENW A;  3H4B A;  3FMW A;  2YTC A;  4AQY J;  5HI7 A;  4I4B A;  2DY9 A;  3ZNU A;  1J5E J;  3RBZ A;  3GSI A;  4RKU C;  2OJ3 A;  1TAQ A;  3G96 A;  4K59 A;  2R7S A;  3QLH A;  2VDI A;  4IDK A;  1HNZ J;  1PBA A;  2ZOG A;  2IHR 1;  2WVE A;  3EPI A;  4NXM F;  3K57 A;  2HND B;  4WBF A;  5IC4 B;  1YBT A;  3DYA A;  1WC5 A;  2ZH5 A;  1ZBT A;  5DO2 A;  3GII A;  2RDI A;  4MKA A;  4ZCI A;  3D28 A;  4OLP A;  2I6W A;  5KFL A;  3KLF B;  3CJT A;  5E3R A;  5IV4 A;  5KOX A;  3IAM 9;  1P27 B;  5J2Q A;  3A3N B;  3OV7 A;  1VJQ A;  1S6O A;  1KVJ A;  2OGU A;  1JLG B;  1C0U A;  2OPQ B;  4ZDN A;  2DNL A;  2CAJ A;  2R9L A;  2VIC A;  2ZH8 A;  2MST A;  1HNV A;  4XTT A;  3P8B B;  2UUT A;  2ZBR A;  3TI0 A;  3DDI A;  1GT8 A;  1HYS A;  4JOU A;  1REG X;  4KGM A;  5JUM A;  1JQG A;  1WHX A;  1IKV A;  2W2O P;  2YX4 A;  1VK8 A;  3ISN D;  3H5Y A;  1N0U A;  5KG6 A;  4I1T A;  1U1P A;  1NEE A;  3HP6 A;  1CQN A;  1SUQ B;  3QQC D;  3H0P A;  2AGO A;  2VFT A;  1S48 A;  3KNA A;  4F67 A;  1UAW A;  3LH2 S;  3DOL B;  1HW8 A;  3NWR A;  2VG6 A;  1JX4 A;  2LU1 A;  2A0F B;  5DDR C;  4WU3 A;  4HT7 A;  4RWW A;  5LM7 E;  1ZH5 A;  3CSK A;  4OYI A;  4JI1 F;  3L7U A;  4P10 A;  2EXU A;  5HQL A;  1FRK A;  3THV A;  1Q82 T;  1RAB B;  3QAT A;  1LFW A;  2YKQ A;  3VAF A;  3VVT A;  3OTB A;  4LF1 A;  3GON A;  4KGX B;  4HTJ A;  2RS2 A;  2O66 A;  1RT7 B;  1AFJ A;  2AJ4 A;  2XC9 A;  4EU0 A;  2AWZ A;  1VLY A;  4DBQ A;  2FJA B;  1ZM4 A;  4X66 F;  1XQI A;  2V4J B;  3D5M A;  5DGB A;  4NWB A;  3PW0 A;  3AA8 A;  2MQL A;  2WRM A;  4CO2 A;  3CE8 A;  1QAY A;  1KP6 A;  1VK3 A;  2J8S A;  2JVO A;  2YWK A;  2DCL A;  3TJ8 A;  4LF9 F;  3C6T B;  4ELV A;  5G0R A;  1U47 A;  5FDL B;  1WSV A;  2ZC4 A;  5LJ3 Y;  2HWH A;  3VVU A;  3CVK A;  3UO0 A;  2DY1 A;  4XK8 C;  5CZV A;  2W7P A;  1X4D A;  5KFH A;  3IBW A;  3ILL A;  4LFC F;  1OQ3 A;  3FSI A;  4DV6 J;  3BKF A;  1FJ7 A;  3UD4 P;  2QG9 B;  1UPM B;  4DV0 F;  4FP9 A;  3HSJ A;  4DZD A;  1E6Y A;  1WTB A;  2U1A A;  4JI4 F;  3V6D A;  4MK8 A;  4BDP A;  2OEM A;  1LEO A;  2R3V A;  3AT1 B;  1T8E A;  4Q0B A;  1X9W A;  2VFU A;  3OFG A;  4RW9 B;  4ANE A;  1WHY A;  1QM9 A;  4A4J A;  3N9U C;  4DS4 A;  3N6M A;  5KFJ A;  2CAD A;  1ZZF A;  4WJB A;  4ENO A;  5LL6 d;  1AZS A;  1UFW A;  5MAO A;  3CW2 C;  1RT4 A;  5KG2 A;  1KQS R;  3AXM A;  2WW4 A;  1X0F A;  1FFW B;  2IIH A;  1YJV A;  3FBE A;  4USW A;  5C2C A;  3V6J A;  2AYE A;  2XY6 A;  1B0T A;  5GAD U;  2CJQ A;  1WWH A;  4DSJ A;  1AB8 A;  2I1R A;  4F4A A;  4MFB B;  2Q6C A;  3G6X A;  3PTW A;  1O8B A;  4ZJO A;  2B51 A;  2IM3 A;  3FJ2 A;  1TMM A;  1AUS L;  4CO1 A;  3PXG a;  4WYW A;  4ZVE A;  1O6X A;  5F8M A;  5KFE A;  4JP8 A;  2I0X A;  4K4T A;  4NML A;  2YBV A;  4EZ6 A;  3QJL A;  1DUR A;  4B3O B;  1IBL J;  3H90 A;  2FLP A;  2K1R B;  4ZS6 A;  3KHL A;  1IBK J;  4XAK A;  3JYT A;  2C2N A;  1D8Y A;  4ILM A;  1HHS A;  4IH7 A;  4Y00 A;  2VJV A;  3T41 A;  1YIT S;  2KHC A;  1SIZ A;  5M2U A;  2EKN A;  3MED B;  1U1M A;  5ETR A;  4Q45 A;  1P1L A;  4K0K J;  2CQ0 A;  3B4M A;  3BN4 A;  2R8H A;  4DOZ A;  3OVA A;  2MLX A;  2BW7 A;  1NKE A;  2FJB B;  3EZO A;  1T9W A;  3MHY A;  4U6P A;  1Q95 G;  3RRG A;  3RYL A;  3FGV A;  3FUY A;  1RYR A;  5HQM A;  1OY6 A;  1BXN A;  4ILR A;  1R27 B;  2BQR A;  3F41 A;  2NXJ A;  4QIW D;  3H5X A;  1U24 A;  4OYW A;  3NKY A;  1JJ4 A;  4OYO A;  4ECS A;  2E5J A;  3PX0 A;  3BGL A;  4X4S A;  4H4K C;  3CDW A;  5HAO A;  4IG0 B;  3AJD A;  1WI8 A;  3TZW A;  5DLF A;  1WOO A;  3KK1 B;  2DGX A;  2E1M C;  4DL7 A;  1X8D A;  4J9L A;  3VGV A;  3GJS B;  1RA6 A;  1YJU A;  1JMT A;  3MEC A;  2HQD A;  4L76 A;  3ICL A;  2HS4 A;  2LDI A;  1RWP B;  3E01 A;  1T3N A;  1C1B A;  3FSX A;  2CJA A;  2XGQ A;  3GFZ A;  2HBY B;  3PO5 A;  1WF0 A;  2K7K A;  2QEX S;  3CD5 A;  2HHS A;  2E7X A;  1MSW D;  5KT3 A;  5L38 A;  3KJV A;  2JLE A;  3L7P A;  4I2Q B;  1FRH A;  5AJ3 F;  3RAM A;  1U4B A;  4WF9 Q;  1S5Z A;  1UZH A;  3PW2 A;  1RTD B;  1NAQ A;  2G1H A;  1IKW B;  1YSJ A;  2OD6 A;  3D6M B;  4OJ3 A;  3M9M B;  4UOG A;  5J1N A;  1FNX H;  5LSL A;  1RSC A;  4YB1 P;  4Z2X A;  2LQ5 A;  2IRU A;  4GKJ J;  3BBB A;  4M5N A;  2M8H A;  1RT6 B;  4BLG A;  2CZ9 A;  1YZ6 A;  3K2Y A;  4KIA A;  1JNR B;  1RHQ B;  1V5I B;  2CDQ A;  2C2K B;  4ZVR B;  1KC8 T;  2AF6 A;  2HHQ A;  1HBO B;  1YX2 A;  3CME S;  1P9Y A;  1ITP A;  5M2P A;  1HMV B;  3OXF A;  3C6U B;  3ITH B;  1RHJ B;  4DFJ A;  4OYP A;  2R7U A;  4LT6 A;  3C19 A;  4QR2 A;  4OYZ A;  3OFE A;  2NS1 B;  2JC0 A;  1HNW F;  5DM7 Q;  1QJH A;  4YS2 A;  4JI6 J;  2UXC F;  2Y1R I;  3NY0 A;  4OZ2 A;  1S49 A;  5IM0 B;  3EUN A;  3F56 A;  4L73 A;  1G4C A;  3MM5 B;  1SQF A;  2DIV A;  4N76 A;  2WHO A;  3FMB A;  5IT9 U;  2OPS B;  3ZO7 A;  1L3U A;  2NPI A;  1SJQ A;  4CO0 A;  2VF3 A;  2MKI A;  2YKN B;  4AQY F;  4ZLN A;  1J5E F;  3RW6 A;  1FHT A;  2AZ1 A;  3ZC4 A;  3CED A;  2OH2 A;  1RHU B;  3VQS A;  1PJ6 A;  3EZU A;  3NL0 A;  5L9N A;  3PEH A;  2VG7 B;  2DR5 A;  1WKJ A;  5E0O A;  2H51 B;  3IRW P;  1NHU A;  3M8Q A;  5KFN A;  1Y0H A;  1DTT B;  2HFS A;  2ATC B;  2B9Y A;  3CC4 S;  2BQU A;  2K3K A;  4J9M A;  2JVR A;  4B9L A;  1TKT A;  3UE2 A;  4KAI A;  3VHQ A;  4IH6 A;  3KLG B;  3MOJ B;  1GMV A;  1FRL A;  2OPR B;  4MH8 A;  1MG7 A;  3HVT A;  3G8T A;  4DG1 B;  4CLF A;  1VCT A;  3R5C A;  5A2Q Y;  1ZTT A;  3BQ1 A;  5KFV A;  3R3T A;  1GTH A;  2MKC A;  2DXD A;  1GMW A;  2M8D B;  2F8M A;  3C15 A;  4M5H A;  2BJ1 A;  1WOS A;  4QPT A;  4X4O A;  2QX0 A;  5K8N A;  2HYI B;  4J9N A;  2MY7 A;  1EP4 A;  1FVS A;  4OZ1 A;  2DNQ A;  1NPK A;  4ZPB A;  3BKT A;  4ZHR A;  4J9Q A;  3CJK B;  2CVI A;  3I55 S;  3PDN A;  3HHK A;  5F0U A;  1KHV A;  3NGT A;  1YWX A;  2W7O A;  5T14 A;  5I42 B;  2EFV A;  2QO3 A;  4MK9 A;  2QLJ B;  4G6V B;  3OTE A;  2ZHA A;  2HRT A;  1F2H A;  4AL6 A;  4LSL A;  2VG5 A;  5HRO B;  2RS8 A;  2IM1 A;  3Q83 A;  3ZZ0 A;  2DR7 A;  3TAQ A;  3SDE A;  1EIY B;  3NS5 A;  4O44 A;  5DRK A;  5DGA A;  2WON A;  5A8W B;  2G2Y A;  2O67 A;  3BQ2 A;  4USJ C;  4O0N A;  4Y0F A;  4GVB A;  5K20 B;  3P96 A;  2JHE A;  3SSQ A;  1N54 B;  1C2P A;  1RAE B;  1JKH A;  1D9D A;  3LWL A;  3BR8 A;  3WDO A;  2EC0 A;  1QE1 A;  3TEG A;  4Y28 C;  4BWM A;  1VC0 A;  2BJ3 A;  1GXL A;  1HPZ A;  2LEC A;  2JC1 A;  3I0R B;  1RAJ A;  3HZE A;  5EX0 A;  1VQN S;  2C3O A;  1X5S A;  2V2Q A;  2PO4 A;  5C24 B;  2Q66 A;  3I5A A;  2KRR A;  3W5Z A;  2DHG A;  2R8I A;  4ZJQ A;  3KLH B;  2DGT A;  2V9W A;  4DV6 F;  2ZBC A;  3GB0 A;  4JI2 J;  3G4S S;  1URR A;  2Y3Y A;  4DR6 F;  1X7V A;  2VH7 A;  5K14 A;  1GX5 A;  2IBO A;  2ACY A;  3M9N B;  3H98 A;  1WC0 A;  1REV B;  2B6A A;  2XYG B;  3MMC B;  1FKO A;  1Q8I A;  3A8K A;  1WEX A;  3GJQ B;  3IGN A;  2VFS A;  3QJJ A;  1QVG R;  4OYM A;  3HVA A;  3KK3 B;  2HVI A;  2QLW A;  4QWA A;  1Q16 B;  2LXI A;  4AT1 B;  2GJ2 A;  3CJ0 A;  4HR2 A;  4EYH B;  1PAU B;  1KDN A;  2E66 A;  4EFA C;  5IWA J;  3FEY B;  5JVG Q;  3HO1 A;  5GAG U;  1F5B A;  1ZM9 A;  3ZZP A;  1QSS A;  2QA4 S;  1N36 J;  1JLE B;  2LDY A;  2WOM B;  3SCL E;  2DJW A;  3MTK A;  1GX6 A;  3MMA B;  3B82 A;  2V4Q A;  1NZ8 A;  3THP A;  1LWC A;  4DSE A;  2ZVI A;  2OTL S;  1KTQ A;  1SL1 A;  2GMJ A;  4XIU A;  1O0P A;  3CDA A;  4CH7 A;  3OT9 A;  1R3N A;  3BGR B;  3V4M A;  3MD1 A;  4ZP9 A;  1VQ4 S;  1M5V C;  4MT1 A;  1FDB A;  1T95 A;  1WUU A;  4NA1 A;  5L1J A;  2AJ2 A;  4ZCK A;  3P4U B;  3D7S B;  1TKX A;  1Y00 A;  1ZA1 B;  4USU A;  4KFB A;  2XO6 A;  1LV5 A;  1BQX A;  3W7B A;  1RE1 B;  4MYT A;  5CCM A;  3K58 A;  1IBL F;  2NPF A;  5KFC A;  1IBK F;  1R8H A;  3CWJ A;  2XQC A;  5LMU J;  4QW8 A;  1VDH A;  1IKX A;  2FVR A;  4LRF A;  4TXS A;  3PZP A;  2NLW A;  4AD6 A;  4K0K F;  2K7J A;  3HSZ A;  5HMY A;  3O1L A;  5ETQ A;  4QOT A;  1SQG A;  2NXE A;  4WFX A;  2HNY B;  3D9B A;  1N5Q A;  1TKZ B;  5CCL A;  1M90 T;  1F60 B;  5DDO C;  1EKR A;  4NEZ A;  3KJF B;  2XMJ A;  4RU9 A;  4NPO A;  1NK5 A;  2WSF C;  3GFY A;  1U1O A;  2XSJ A;  4IFY B;  5H9E J;  3KOA A;  4TYA A;  3DI6 B;  1Y10 A;  1AT1 B;  1D1U A;  4LVN P;  3K5M A;  1I6J A;  1Y11 A;  3R9L A;  1Y3J A;  1WSR A;  4OZN A;  2KFZ A;  1S1T A;  2FLO A;  1NJW A;  3SZ2 A;  2WTF A;  4QWB A;  4PUO B;  3AD8 C;  3NGU A;  1DAX A;  3AQP A;  3VGT A;  2CG8 A;  4DR7 J;  5F8I A;  4HDH A;  2HVZ A;  3POT B;  1UCN A;  4ZCM A;  2HBZ B;  1WF2 A;  1ZS6 A;  1XC9 A;  1YJR A;  4M5L A;  4MIW A;  1JLB A;  4OI0 A;  3TW0 A;  2PI5 A;  1J5O A;  2KT5 A;  2WSC C;  4F0K A;  1WC3 A;  2IA6 A;  2MHE A;  3CCZ A;  4WE1 A;  2FGC A;  1SH2 A;  5L1K A;  3PRV A;  4A8K A;  2BDP A;  3DMJ B;  2RD5 C;  1RBO B;  1SJR A;  1RCX B;  1UW9 A;  4ATN A;  1K9M T;  1LKZ A;  1O51 A;  2YWW A;  3V4I A;  4JI8 J;  2XNQ A;  2UV8 A;  2CPY A;  3EIC A;  3NRB A;  4WCE Q;  2ZOM A;  2VB6 A;  1UFK A;  4C3M A;  1U2R A;  4JI7 F;  4J9U E;  1EZZ B;  2RQC A;  3EE3 A;  4NLG A;  2MZJ A;  3CPW R;  4I6W A;  4HTI A;  1NH8 A;  2QZ8 A;  3MMB A;  3KHR A;  2KM8 B;  2Q79 A;  1T9Y A;  1TUW A;  2LFV A;  4JI6 F;  3KLI B;  3PY8 A;  2ZD1 A;  2DHA A;  3ILO A;  2MEW A;  3P49 B;  2BZ2 A;  2HKE A;  2GAH C;  4KRW A;  4LF4 J;  2EEY A;  3BKU A;  2IC3 A;  1AW0 A;  2F40 A;  4PQA A;  4ELU A;  2YQ0 A;  1SJF A;  4ICL B;  3R7B B;  4M63 A;  1RJJ A;  4B02 A;  1LWF B;  4F36 A;  2FZC B;  1H73 A;  3CCW A;  4XDC A;  1CJU A;  2IDL A;  4ECZ A;  3I9Z A;  3SIP B;  2XO7 A;  1UL3 A;  5F9N A;  4I0W A;  2V8D A;  2VPX B;  4F4Z A;  3I96 A;  2AYB A;  1QSY A;  2RHS B;  1Y5N B;  4C11 A;  2E1A A;  2K8G A;  3LA0 A;  5GAE U;  2J0X A;  2XBP A;  4FF1 A;  3QZ7 A;  2CRL A;  2ASY A;  1NK0 A;  4NYP A;  2IM2 A;  3RGI A;  4QJV A;  1MNE A;  4O3Q A;  2OFG X;  3LP2 A;  3FFI A;  1LWE B;  1OIA A;  4ZN3 A;  2WSE C;  1SUQ A;  4TY8 A;  5KG4 A;  3SI8 A;  1VIS A;  4OQJ A;  4MKB A;  2GHV C;  2DNZ A;  4P72 A;  3O3L A;  4Q2M A;  2ZKT A;  1HBM B;  1IBC B;  3CIZ A;  2ZEJ A;  5EWE A;  4K4Y A;  2ZJP Q;  1UVM A;  1NND A;  2A18 A;  2QSW A;  1H3D A;  4KE5 A;  3QSY B;  1R0C B;  4DCO B;  4B3S J;  1MWY A;  3MAA B;  4DF8 A;  3NXZ A;  4J9S A;  2HGM A;  1X4B A;  2DPI A;  5CZX A;  5KFS A;  2V8G A;  2Z0G A;  1L3S A;  4RW8 B;  4RLE A;  2V67 A;  2K3I A;  2MDA A;  2LYV A;  3R2D J;  4FYY B;  1IKY B;  1QD1 A;  2RRN A;  2DGO A;  2JNJ A;  3M2U B;  3FQK A;  3M1V A;  2V4J A;  2R7X A;  2GCF A;  3BEG B;  1PYT A;  2V8P A;  3HM9 A;  3KHH A;  3H2U B;  2C3P A;  4CLY A;  4W98 A;  1T0T V;  4CO3 A;  4V19 J;  1RKJ A;  8ATC B;  4ZIV A;  2P9E A;  3MF5 A;  4URQ U;  4ANC A;  1FX4 A;  4B9N A;  2N4C A;  1FTC A;  5E7O B;  1HWJ A;  3LAK A;  1YJW S;  2ZOF A;  1RUS A;  5FDL A;  1CJT A;  3C66 A;  2PC6 A;  4CLT A;  3QT7 A;  3KLE A;  1VI7 A;  2IVY A;  2F4V J;  4CNZ A;  3QLH B;  3D1H A;  2FLN A;  1RTJ A;  2PII A;  3PHE A;  1TK5 A;  2DRD A;  4IDK B;  2ILZ A;  3DXB A;  3Q8V A;  3DYA B;  4LFA F;  2QN6 B;  1GXU A;  4JI0 F;  3Q22 A;  3OHB A;  4C4W A;  4B3R J;  3CD7 A;  4ECU A;  2NQP A;  4OX7 A;  4A8F A;  4QYZ J;  1U6B A;  5AXN A;  2WVC A;  2RAQ A;  1PIL A;  4KH1 B;  2YWF A;  4EMD A;  4LRC A;  4PWU A;  5J2Q B;  3LO3 A;  2DH7 A;  1DJ0 A;  5A8K A;  5KFG A;  4B17 A;  1S9F A;  3DN9 A;  1HNV B;  4I6A A;  4WFN Q;  5HAN A;  2IPO B;  3WX4 A;  1PKU A;  4PXB A;  2DGW A;  1HYS B;  2B0G A;  2MQQ A;  5GME A;  2KYZ A;  1IKV B;  1TVR A;  3QGP A;  4M5K A;  3LAL A;  3ONQ A;  2AP6 A;  1FRI A;  5AE2 A;  5JJB A;  3RB6 A;  2YH1 A;  1RWO B;  3SMZ A;  2W7A A;  1X4G A;  2ALZ A;  3I32 A;  2BOP A;  1WAC A;  4GO7 X;  4ECW A;  5KFU A;  2HMI A;  3OBI A;  5IWA F;  3MAQ A;  3R6G B;  2VG6 B;  4UOH A;  3RB0 A;  2ZWP A;  4Q5V A;  1N36 F;  3CNQ P;  1U45 A;  1M0S A;  4A8W A;  2DHX A;  2RU3 A;  3D0G E;  4OX9 J;  3T6B A;  1BHN A;  3C16 A;  1U6Z A;  1PG5 B;  4QZV B;  4EK2 A;  5LSR A;  1SIW B;  2XMK A;  2IVF B;  4CZC A;  3Q86 A;  3OL7 A;  5K8O A;  1JLF A;  1C4A A;  4FN5 A;  2Q6B A;  4AE5 A;  3M8Y A;  2X1F A;  2BA9 A;  3TUZ C;  5LMN J;  4NMX A;  3NWG A;  1SC3 B;  1S1X B;  3HT0 A;  3BRE A;  1MRO A;  3E51 A;  5LXY A;  2V6A A;  1X4C A;  4S0M A;  3GIM A;  4K4Z A;  4F0M A;  4BBY A;  2MQ8 A;  2ABY A;  1VQM S;  2M5Y A;  4FXV A;  4NZ0 A;  2QJ3 A;  1IWA A;  1KQK A;  5G0R B;  1OMS A;  2GAG C;  2P9C A;  2HPU A;  5D15 A;  5IXU A;  3M32 A;  2YKO A;  2QFJ A;  1FE0 A;  2HFO A;  2AQ4 A;  5F8J A;  1FNO A;  2YY3 A;  4W90 B;  3T5H A;  3BBF A;  2C2M B;  2MTL A;  4DX5 A;  4LBP A;  2HLU A;  2JEI A;  3KK1 A;  2GFF A;  4B3M F;  1E6Y B;  2L48 A;  2OFH X;  5KFK A;  1EAR A;  2PDA A;  3V6D B;  1CUL A;  4CDI A;  2FY8 A;  3Q23 A;  1U1Q A;  4Q0B B;  2G9O A;  3RZA A;  4Y2I A;  2KH9 A;  3D6T B;  3M8S A;  2KTQ A;  4GRS A;  1XK8 A;  3AOD A;  4IO1 A;  2HW3 A;  3JQK A;  1MU2 A;  4LRE A;  4ES1 A;  2RIL A;  1AZS B;  1RT4 B;  4EGL A;  3ULH A;  4YFU A;  1U6F A;  1UFL A;  1YI2 S;  2IRX A;  3FDS A;  1R0B G;  3PYF A;  3PAC A;  4YDD B;  3R27 A;  2DNK A;  3OR1 B;  4NLY A;  1KOO A;  3AA9 A;  4CYU A;  4DR7 F;  4DSF A;  2E1R A;  4DQP A;  4J9V A;  1K44 A;  2DD8 S;  4MYU A;  3EPG A;  4FYV B;  4KPY A;  4BC9 A;  4C3L A;  3Q8R B;  1KQF B;  2OPP A;  4FVC A;  5ETN A;  4DL2 A;  2WVD A;  2OI2 A;  3D0I E;  1YJ9 S;  3KYL A;  1WJ9 A;  1F9F A;  2B9E A;  3MUM P;  4ETZ A;  4CM2 A;  3Q8Q B;  4HI2 A;  3GYN A;  4DPX A;  3JYT B;  4A8M P;  1CPZ A;  1VBY A;  1FXL A;  3G8Q A;  3J81 Y;  5F8G A;  4ZPC A;  3Q8U A;  4NYO A;  3CJ2 A;  1S6P A;  3MTJ A;  4F8R A;  4JI8 F;  4PYA A;  2ZBP A;  4ZJL A;  4NA3 A;  4OZ0 A;  4DLG A;  3CGI A;  3UNG C;  4IFV A;  5IM0 A;  4ED1 A;  1B64 A;  1Y3K A;  3UDE A;  4ZLJ A;  4K4S A;  2RE1 A;  4F50 A;  1SQE A;  2QMW A;  2DH9 A;  3ZTR A;  3PG9 A;  5BR8 J;  4PPD A;  4PZV A;  4PG4 A;  2D9P A;  2R4F A;  4ZVS B;  1K8A T;  3HZG A;  2EI5 A;  1S72 S;  3VF0 B;  4ZVQ B;  3EZ5 A;  2UVV A;  4MTP A;  3DKD A;  3X1L B;  3MCO A;  3IM8 A;  1FA0 A;  4LF4 F;  4X62 J;  1UW4 A;  2QMX A;  2LMI A;  3I5B A;  4C98 A;  2VHG A;  2RB7 A;  1N34 J;  2R7W A;  2FVQ A;  3QYY A;  2XMW A;  4NE9 C;  3MEC B;  3V5R A;  2YQ3 A;  2OPR A;  4DCJ B;  2F1F A;  3E01 B;  1C1B B;  1TEL A;  4HHJ A;  2EFQ A;  2ZFH A;  4NXN J;  4XPC A;  1N33 J;  4DL4 A;  1LXJ A;  1OY8 A;  4WTY A;  1VQY A;  1Z2L A;  3BGO P;  3F0N A;  5C25 A;  1OYE A;  4WPA A;  1N5S A;  3FZ2 A;  3GCX P;  3A8E A;  5CD4 H;  2B5J A;  3ET6 A;  2SXL A;  4DL5 A;  2RVJ A;  2PMH A;  2C3U A;  5M2R A;  1LQ9 A;  4IRC A;  4DUY F;  4DN9 A;  3PIO Q;  1ZET A;  2DPJ A;  4G65 A;  2XZW A;  4JV5 F;  2KZM A;  3WHI A;  1A6L A;  1OQ6 A;  3IWL A;  3OQ2 A;  2WBR A;  4K5S A;  4ECR A;  4B3S F;  2DBB A;  2G2O A;  1XNR J;  5GAH U;  3AQO A;  3EXC X;  3PRD A;  3PW5 A;  1B3T A;  2CXE A;  2V2K A;  3NGR A;  3CJQ A;  3PX4 A;  3HHE A;  2P8I A;  4FXW A;  2CWK A;  2K06 A;  4I68 A;  4NCA A;  1SKR A;  2HK3 A;  1S0N A;  1E6V B;  1RBA A;  4C48 A;  1GEH A;  3FCW A;  4PG8 A;  3CCV S;  3UWT A;  3J7A 1;  3DRS A;  3BYP A;  2DNY A;  1VRU B;  1JJC B;  3FSY A;  2PSZ A;  2OLW A;  2VC0 A;  2ZH7 A;  3BSN A;  4QYR A;  3FZB A;  3MEE A;  2CQ1 A;  1H98 A;  4N47 A;  1ZTW A;  1BQM A;  3KXD A;  4R0E A;  1S1V B;  4EYI B;  1S0O A;  2MYF A;  5C24 A;  1FRM A;  3LP1 A;  1TL1 B;  4WXO A;  1MN9 A;  1KLM A;  1FE4 A;  4DFP A;  2R2U A;  2NZ4 A;  2KJW A;  2ZZM A;  3KLH A;  1U1R A;  2W2M P;  3DGV A;  3PRB A;  2ZNY A;  2P5V A;  3FK4 A;  2ZBI A;  3GYX B;  3U7J A;  3GIJ A;  3OL9 A;  4I2P A;  3M8Q B;  2H9Z A;  3VCD A;  1U1N A;  3DRR A;  5IOL A;  4B3R F;  4NA2 A;  3TA1 A;  4AUK A;  4ID5 A;  1NSP A;  2YXL A;  1FKP A;  4K4X A;  2DNG A;  3M8P A;  3KK2 A;  5KFP A;  3VZH A;  1JLA A;  3HVT B;  2E9T A;  4B9U A;  3NMA A;  3DM2 B;  4U8V A;  1WDD A;  2KVI A;  1WC1 A;  4X4U A;  2VV5 A;  3RBE A;  3P6Y C;  2GGP A;  1CJV A;  4CNY A;  2RUS A;  4C0O C;  1P1T A;  3C15 B;  3PO4 A;  4O23 A;  3PR5 B;  2I5J B;  3MPW A;  4ES3 A;  1EP4 B;  4TU8 A;  1QTM A;  4JI1 J;  3BV8 A;  4ZHR B;  4EI2 A;  3W9J A;  2EKY A;  1YJ7 A;  3CCR S;  4Z37 A;  2WB1 D;  5IFM A;  4PR6 A;  3FBF A;  3A4T A;  2XTJ P;  2DVI A;  4R5P A;  3HF5 A;  1N56 A;  2QL5 B;  1PYS B;  1HI8 A;  1CG2 A;  3GIK A;  2JRS A;  1ACM B;  4LSL B;  4C7Q A;  3C8Y A;  2VG5 B;  3K17 A;  2GIR A;  2OSQ A;  5KFW A;  2RQK A;  3P5T L;  3SDE B;  1K0T A;  3M7V A;  3G2X A;  3SQG A;  4O44 B;  2M7S A;  3V2U C;  4I7F A;  2KM8 C;  4Y6I A;  5GAG I;  2H65 B;  2YNH A;  3J7A N;  3TZX A;  3MFI A;  4GVB B;  4RW4 A;  2E29 A;  2R42 A;  3PM9 A;  4F2S A;  1D3W A;  5LMN F;  2GC8 A;  2YKM A;  4QBU A;  1QE1 B;  2KG1 A;  2BKP A;  1T9U A;  4C8N A;  1NJZ A;  3KDO A;  1X31 C;  4LJM A;  1UVL A;  1HPZ B;  1OJ4 A;  3MAH A;  3AXK A;  2CUY A;  2NUU G;  3ZTP A;  4M5G A;  4RBT A;  4Q8F A;  2ZUA A;  3EDQ B;  1IR2 A;  3CJR A;  3DDK A;  1IR0 A;  4IFY A;  1KFS A;  3DI6 A;  3NAI A;  1YVF A;  4OHZ A;  3K5P A;  2C22 A;  5J1P A;  3WC2 A;  3KJQ B;  2PE8 A;  4DDF A;  2OAU A;  4PAB A;  4YUD A;  4LIW A;  5H9F J;  3PR4 A;  3BO4 A;  4FNH A;  4M94 A;  4HLB A;  2VA2 A;  2HHP A;  4DV3 F;  2Z4P A;  2BJ9 A;  1I3O B;  2KO1 A;  3BGU A;  5L1L A;  3DNC A;  5K14 B;  3WBZ A;  2W4P A;  1HW9 A;  3I82 A;  1VBK A;  2B6A B;  1FKO B;  1QAX A;  1XR7 A;  1P8G A;  1QUV A;  3JB9 k;  1N5T A;  1WKK A;  5DG7 A;  3PJ9 A;  2E5G A;  3LWM A;  1Y9O A;  1Y4Z B;  3KG0 A;  1KBR A;  3W9H A;  5J2P A;  4AXJ A;  2B56 A;  4DR3 J;  3UDV A;  2BW2 A;  2YNI A;  3QAE A;  1WOR A;  4RJV A;  1UJ5 A;  2G1D A;  2IFX A;  3ELH A;  2VOP A;  1WHV A;  2FVS A;  1N48 A;  4PAA A;  2C1E B;  1ZAV A;  3SFU A;  1RWX B;  1WEL A;  2CQ4 A;  2FYX A;  3HHL C;  3MI7 X;  2FD2 A;  1H2T Z;  1CSJ A;  2DR8 A;  1D8Z A;  2Z30 B;  4DUZ J;  1LWC B;  3DMJ A;  5KTQ A;  2DB1 A;  4JBC A;  1HI1 A;  4HDG A;  3WC0 A;  4KPC A;  4BS2 A;  2E5I A;  1VIX A;  2FJX A;  1VIO A;  1VQ9 S;  1B70 B;  4X2B A;  5F8H A;  1NK4 A;  4KFB B;  2XWY A;  4N8N A;  2WAQ D;  2VUG A;  1M1H A;  4M5D A;  5JVH Q;  4ZKA A;  1YJT A;  2OEJ A;  3KDN A;  4LQ3 A;  4ECV A;  2IJN A;  1X9M A;  2V34 A;  3ZTQ A;  4ZPD A;  3MD3 A;  1BE4 A;  4UST A;  3L7O A;  4NRT A;  2IJF A;  1FD8 A;  4Q7A A;  3IAS 9;  4Z7C A;  2O1P A;  1Q5Y A;  2I8E A;  2KB2 A;  3W62 A;  3FNN A;  4NCB A;  1IKX B;  1Q78 A;  2V8H A;  3RUB L;  4OX6 A;  1U2F A;  2NCK L;  5IT0 A;  4YQW A;  3PKM A;  2L9W A;  2VOD A;  3VAK A;  1X5P A;  1FWL A;  1ZM2 A;  3EWG A;  5BR8 F;  3MWB A;  1GXT A;  4FPR A;  2BV3 A;  1SJ1 A;  5F3T A;  2N3O A;  3H4D A;  3NLC A;  1U02 A;  4Q43 A;  2AMC B;  2XSJ B;  2Q1L A;  3JSR A;  3QIP A;  2FUG 9;  3LGH A;  1UEK A;  1FJG J;  4DEZ A;  4P6Q A;  4X62 F;  2A2D A;  2HFV A;  5MLC V;  1S1T B;  3GCW P;  2RJZ A;  1D9A A;  3C3L A;  1M5P C;  1H72 C;  5CYM A;  3M05 A;  1N34 F;  5L8R C;  5ETS A;  1NKC A;  5IS2 A;  1QUP A;  5KFX A;  2BRL A;  1Q7L B;  2XUL A;  1VQ5 S;  1LWE A;  2BBE A;  1RCO B;  2H4W B;  2UUC J;  2Q43 A;  1RAA B;  3Q2T C;  3NEK A;  2Y0B B;  5RUB A;  1UTA A;  3IA0 A;  1MMN A;  2H5I B;  5D4L A;  2HRU A;  1HBM A;  3EDR B;  4IH5 A;  2BE7 D;  3MUT P;  3MOZ A;  5EHH A;  1BWE A;  1BUX A;  3U1M A;  1NU4 A;  3BM7 A;  2KT3 A;  1X4E A;  4OYX A;  3MAA A;  4H4O B;  1VRQ C;  1EB0 A;  3U1L A;  3N01 A;  1JLB B;  5GAE I;  1J5O B;  3DLE B;  4O3P A;  1HQU A;  1NHK L;  1YQH A;  4E0D A;  1C4C A;  4WE1 B;  1UEV A;  3QBC A;  4RW8 A;  2YWH A;  4K2J A;  4RUC A;  1VRT A;  1YG0 A;  1U1L A;  1QDU B;  1TU0 B;  3WX8 A;  3EYZ A;  4F04 B;  3V4I B;  2KZZ A;  1S59 A;  4QIV A;  1VC6 A;  2FIU A;  2MXY A;  2DH8 A;  4NLS A;  2NYI A;  1A9N B;  3EGV A;  2FY1 A;  3SXL A;  1F6T A;  4QU6 A;  4LRA A;  4DHV A;  3CMA S;  4ED8 A;  3DRP A;  3BJY A;  1ULR A;  1ZPV A;  2X1G A;  5IZH A;  4M5I A;  1F0X A;  2DXE A;  3GU0 A;  3MMB B;  3GR0 A;  3QID A;  4ED7 A;  2V2V A;  3CDE A;  1PJ7 A;  2ZD1 B;  4J9R A;  1RLC L;  1M5H A;  2DXF A;  2HQI A;  1SH0 A;  1JWW A;  3BS9 A;  4OZ5 A;  2HLT A;  2ZC3 A;  1T9T A;  2HBQ B;  2BR0 A;  2IC3 B;  4UW2 A;  1MML A;  4CLS A;  1OSD A;  3HFV A;  5LJ5 Y;  3JQJ A;  1MLA A;  3N5F A;  1S10 A;  1CJU B;  1I1G A;  1SKS A;  2D3Z A;  3BGF A;  3IXQ A;  2J7W A;  2VBW A;  4CLP A;  4C11 B;  3TEH B;  3DU6 A;  2UVU A;  2W9A A;  3AOC A;  2R7R A;  4PWD A;  2J9E A;  3TVZ A;  1VOM A;  1N88 A;  4EO8 A;  4ECX A;  2LEP A;  3LP2 B;  3FFI B;  4LBH A;  5L39 A;  4TY8 B;  4RX6 A;  1OS5 A;  2EG2 A;  4J9P A;  3OR2 A;  1KN6 A;  3AOA A;  3EM1 A;  4CCH A;  1HR0 J;  2EK6 A;  6AT1 B;  1UMJ A;  2F8E X;  1WHW A;  2XZT B;  2AEJ A;  3AY0 A;  4UY8 T;  4P2X A;  3M8R A;  1JLQ A;  5IC6 B;  2W24 A;  3WIV A;  1ZYQ A;  4C8Y A;  2X51 A;  4MKV A;  2V8V A;  4U7U D;  2XY5 A;  1Q81 T;  2MQN A;  4KO0 A;  1AUD A;  2IRY A;  4QWC A;  2YH0 A;  3FEZ A;  2YPZ A;  4ZP6 A;  3DGP A;  4U95 A;  1RGV A;  1NHV A;  2H3E B;  3SCK E;  4J9K A;  5AE3 A;  2N7C A;  3I5C A;  1S1X A;  4WIQ A;  3M1V B;  1S9G A;  3PYD A;  3B6B A;  1IJF B;  2MJN A;  3X3U A;  4KR0 B;  2Y1L B;  3M8W A;  1NSQ A;  4A8O A;  4ED3 A;  1QAJ A;  1U1K A;  3IBC B;  3L09 A;  4ZP7 A;  4CH1 A;  4TNO A;  3TWZ A;  1U49 A;  2QLX A;  5I3U A;  3QAU A;  4X4T A;  1C0T A;  5KFT A;  3R1L A;  4PG6 A;  4FYW B;  1CJT B;  2A2C A;  4JB8 B;  3FRY A;  3BH7 B;  3KLE B;  2MLY A;  1CBK A;  4OLO A;  1RTJ B;  2GML A;  2VKR A;  1S1U B;  3TJ9 A;  1XMO F;  1UA1 A;  3AD9 C;  2V2Z A;  4DR6 J;  3KLV A;  2JZ5 A;  2W8L A;  3J81 j;  1K1Q A;  3ZZT A;  1YRX A;  2Z8Q A;  5E3P A;  2ZH2 A;  4IUF A;  1LNQ A;  2FC8 A;  4IOB A;  2O5D A;  3IP0 A;  2MZ1 A;  2WW8 A;  1N32 F;  4LR9 A;  4TKT A;  2HWI A;  4D3H A;  1PGZ A;  2AGQ A;  3SYZ A;  1X0P A;  3FRZ A;  4L72 B;  2J9D A;  2KYX A;  2VPY B;  5HMZ A;  5A8K B;  2O01 C;  3BO3 A;  2VPW B;  3G6Y A;  2RDJ A;  3SFG A;  5HJY A;  5KT6 A;  3QGG A;  3UDC A;  4NLR A;  3TAR A;  1DBD A;  4P52 A;  1HI0 P;  2QV6 A;  4OI4 A;  1BMQ B;  5THW A;  1DHM A;  1N52 B;  3GIL A;  3WQP A;  2H48 B;  4CO5 A;  1TVR B;  3UDL A;  3GR1 A;  2DNO A;  3OR1 A;  4CLK A;  1EKS A;  1R8P A;  1LK7 A;  3W63 A;  1PC4 A;  5DET A;  1OWX A;  1EJ7 L;  2DIU A;  4DR3 F;  3Q2S C;  2FVP A;  1FK9 A;  4A46 A;  4B9S A;  1K47 A;  2HMI B;  1M5O C;  1U09 A;  1YHQ S;  1S7H A;  4GVL A;  4ZVF A;  2BM0 A;  5BYQ A;  4X4Q A;  4QU7 A;  3DHX A;  4KHM A;  3VV2 B;  1FNM A;  2RF2 A;  1JLC A;  2X1B A;  4A48 A;  3C16 B;  5K8P A;  4DUZ F;  3LAM A;  3UVJ A;  4NX9 A;  4OFZ A;  2JL9 A;  3TX8 A;  4CTA B;  5ETT A;  1HQE A;  4PG7 A;  2HFZ A;  2ZH6 A;  1V3Z A;  1JLF B;  1NJX A;  4G1P A;  2XG8 A;  1M1K T;  3D66 A;  3G9C A;  4F7V A;  2EBG A;  1MRO B;  2BQ3 A;  2XMM A;  3E2E A;  3BSA A;  3D3C J;  3QT6 A;  1S57 A;  2NSC A;  1YTY A;  3R6L B;  1ZAW A;  5DLG A;  1NB7 A;  2R7V A;  1ZOT A;  1DRZ A;  1BGX T;  5B0F A;  4PQU A;  2PT0 A;  3R5G A;  2AYG A;  1S1W A;  2D9O A;  1HNX F;  1TL4 A;  5HBM B;  1ZM3 A;  3HKZ D;  4B3T J;  1GFW B;  3ZZY A;  2CQD A;  1M1G A;  1PJ5 A;  3J80 U;  3T1A A;  3M32 B;  1YGY A;  4TLQ A;  1VQS A;  4RUB A;  2C2O B;  3EVM A;  3OLA A;  3TA2 A;  1FTR A;  1RP5 A;  3NP5 A;  2AX0 A;  1F1B B;  3N5B A;  3S6E A;  2ILY A;  1TV6 B;  1HAR A;  4CWB A;  1S0V A;  1SV5 A;  3FEX B;  2IA0 A;  4OHX A;  3LP0 A;  1CUL B;  2CVE A;  1L3V A;  3TAM A;  3CD0 A;  3UNY A;  2MQO A;  3D68 A;  1FJG F;  5KT2 A;  2I2Y A;  1L3K A;  3KJN B;  3GFX A;  2RML A;  4N77 A;  3NAH A;  7FD1 A;  4O4G A;  3DOK A;  1MU2 B;  1WNE A;  3EX7 B;  1XIQ A;  5HJX A;  2QSF A;  1Y5L B;  3R5B A;  3T5K A;  3CC2 S;  4OIX A;  2J6U A;  2BVZ A;  3K59 A;  1RIS A;  4E98 A;  3DLG A;  4IOA Q;  1F3F A;  3HSD A;  2UUC F;  3HFK A;  1FRX A;  3MM7 A;  4QIF A;  2VQF F;  4ZLL A;  2IAJ A;  5E3Q A;  3MR5 A;  2LXU A;  3LOU A;  4LF7 J;  4CYU B;  2KN4 A;  1NH7 A;  5BXI A;  4K8R A;  3K5O A;  1XBW A;  6FD1 A;  2J6S A;  6FDR A;  3H20 A;  3MPD A;  2QGF B;  1KVI A;  2VFV A;  2J76 E;  2D41 A;  4ECY A;  2OPP B;  4WKR A;  1MN7 A;  2OML A;  3SCJ E;  4ED5 A;  2HFU A;  4F25 A;  2HAF A;  4OJ1 A;  2PEB A;  1VQL S;  3ZZR A;  2M2B A;  3T5J A;  4JI7 J;  1V3S A;  2WK4 A;  2AT1 B;  2W1B A;  3AAW B;  4HL9 A;  4Y3C A;  2HIY A;  3GLJ A;  1I94 J;  1E6V A;  4N41 A;  1RAI B;  2B9X A;  2CPZ A;  4USI A;  2ASJ A;  2CQG A;  2DGQ A;  3JTP A;  4KTQ A;  1S6P B;  1NK9 A;  2B3T B;  1VRU A;  1NDP A;  2M52 A;  3DLK A;  5EDW A;  4IFV B;  5KFZ A;  1YKW A;  2B8P A;  5AXM A;  5E2Q A;  5HK4 A;  2ACM A;  1YZ7 A;  2CJK A;  1X4H A;  1PC5 A;  3C14 A;  4FKX A;  4NLD A;  1HFE L;  3OUY A;  1S1V A;  5ETK A;  5LSO A;  4DWI A;  5DZ6 A;  1UWB A;  3MCN A;  4DV2 J;  1TL1 A;  5GAH I;  4OMF G;  4ILL A;  3EGW B;  4EZ9 A;  2J0W A;  5CHC B;  4EWT A;  2CQH A;  3GZ7 A;  3T5L A;  3S1T A;  1Q53 A;  1AXQ A;  4G3I A;  2HRY A;  2HVH A;  2CFX A;  3DHW C;  4J9O A;  4WWS A;  3H7H B;  3UR0 A;  3ZZZ A;  7AT1 B;  1B0V A;  2W9C A;  1YBA A;  2CQB A;  5L46 A;  1SJ3 P;  2VC1 A;  1WG4 A;  2C3M A;  2LQJ A;  2QFI A;  2F7V A;  2CNL B;  3G87 A;  3MEG B;  5F3Z A;  2B4P A;  3CB4 A;  4WFY A;  1T9V A;  2AZ3 A;  3UD5 A;  4EBC A;  5KFR A;  1RAF B;  3IM9 A;  4ZK7 M;  3DM2 A;  1Q8B A;  3OVB A;  4DL0 C;  3HSG A;  5FLX Y;  3GG1 A;  1Z4U A;  5E3C A;  4OHY A;  3R97 A;  1Z2Z A;  2I5J A;  4UTG A;  5C25 B;  2FDN A;  3Q8S B;  2B5J B;  3ET6 B;  2DNH A;  3M2R A;  3UW1 A;  3A8J A;  5A2Q U;  4OI3 A;  5D78 A;  3O2I A;  1ARO P;  3R5J B;  2GJI A;  4ZVH A;  4FDF A;  1N6Q B;  1RAH B;  5D3G A;  4PKD B;  3MUV P;  3QNW B;  2DNM A;  3UR3 C;  4LF5 F;  1HR0 F;  3BBC A;  4NYZ A;  3ZTO A;  2KKH A;  2XCA A;  3CD6 S;  5HLF A;  1U0S A;  4YME A;  2KRB A;  2E7V A;  4USK A;  2XZD B;  3CCL S;  5KG7 A;  2CQI A;  2DT9 A;  1IVZ A;  3CCE S;  4A8Y A;  3GPA A;  5DQI A;  2JX2 A;  2W2Q P;  3HD2 A;  4PRF A;  1DQ9 A;  5L1I A;  4FKY A;  3OXG A;  5D4N A;  4X4N A;  2XYP B;  2XI3 A;  4AL7 A;  1RT1 B;  2EBE A;  2RRB A;  3DRS B;  2DIT A;  1Q8K A;  2DR6 A;  2E7W A;  1VC5 A;  2COL A;  5I3P A;  2VA3 A;  4ZLP A;  4LFA J;  2UP1 A;  3KWM A;  2JLF A;  4JI0 J;  1U0H A;  3MEE B;  2HWT A;  2UVW A;  4LF6 J;  1VQO S;  1K1S A;  5D0R A;  3BN7 A;  1BQM B;  1Q8L A;  2C28 A;  5B0A A;  1DLO A;  2G13 A;  2QMU B;  2BE2 A;  2PEH A;  4DXL A;  1IBM F;  3LP1 B;  4E2F B;  4LUB A;  4DU8 A;  3IR7 B;  1SC1 B;  3RR8 A;  1KLM B;  4W4M A;  3FCV A;  1R89 A;  4YY3 J;  4R25 A;  2UU9 J;  4ZPA A;  2YKP A;  2KFN A;  2GQQ A;  4L75 A;  2R7Q A;  2BAN B;  2MGZ A;  1G2E A;  2GVD B;  1Q0N A;  4I2P B;  2Y8Y A;  1N5Y A;  4DX8 H;  3OL8 A;  1HBU A;  3DRR B;  2HFN A;  3KNG A;  4JI3 J;  2BRK A;  1NB2 A;  4GKK J;  1EQ0 A;  2LA6 A;  1S12 A;  4ID5 B;  1FKP B;  2ZBQ A;  3M8P B;  2HHW A;  1TQL A;  3KK2 B;  4IRK A;  2JEJ A;  1FJC A;  5A6W A;  1SL2 A;  2NRE A;  1WI6 A;  3MCM A;  3PV8 A;  1IM4 A;  1JLA B;  1X5O A;  3OFH A;  4C0H A;  4DR2 F;  1EET B;  3DLJ A;  2AYM A;  3V6H A;  3Q89 A;  4NLW A;  3JSB A;  2LVW A;  2I38 A;  2GGP B;  1CJV B;  3R7S B;  3CXC R;  2BJD A;  4IG3 A;  2OKQ A;  5F8L A;  1FVQ A;  4OHW A;  4ZCL A;  2XMA A;  2HHT A;  1ICE B;  5JMN A;  3KHG A;  4QW9 A;  3TYT A;  2MZR A;  4DL6 A;  3MMJ A;  3A3O B;  3AD7 C;  2AJ1 A;  5EGY A;  2BUN A;  5J2M A;  2DKO B;  3TNV A;  3RBX A;  2OTJ S;  4RL1 A;  5KFQ A;  4IQX A;  4FF2 A;  2VON A;  3AB2 B;  1RAC B;  4R5P B;  2UXD F;  1XER A;  3G82 A;  2FJE B;  1LOU A;  4WFZ A;  2LXF A;  1F5A A;  5JXS A;  5CH7 B;  2XY7 A;  4YB5 A;  2Z56 B;  2ATL A;  4GC7 A;  1TL7 A;  2ZKU A;  2PI4 A;  3SQG B;  3NCR A;  3HHL A;  1S4E A;  4JUZ A;  2QYC A;  4I7F B;  2W9B B;  3PJX A;  2ZDP A;  4C0B A;  4AFF A;  3PX6 A;  4B08 A;  3H2L A;  2KU7 A;  2YNH B;  4PCQ A;  4DV5 J;  2R7T A;  3E8O A;  1NK6 A;  4U7U K;  4RW4 B;  3ENQ A;  4IRD A;  1B4S A;  3BB5 A;  9RUB A;  3HMJ G;  4NLU A;  4P73 A;  3OFF A;  2YKM B;  1MWZ A;  1YK9 A;  5A6P A;  1EHW A;  1HNI B;  5B0E A;  2XB2 D;  5HL7 Q;  1QY7 A;  4DSL A;  3R7N B;  1IWG A;  4B3M J;  2J9D E;  4L3N A;  2CJ9 A;  1RK8 A;  5D6G A;  4KYZ A;  4U96 A;  4B3T F;  3C46 A;  4UF4 A;  1Q86 T;  1CS4 A;  1TL3 B;  1HD0 A;  2YWE A;  1KVK A;  4UT4 A;  3KMS A;  5SUH A;  1NSA A;  2KI2 A;  4DSK A;  3NS7 B;  2B4V A;  4PYD A;  5DM6 Q;  4F02 A;  4HHU A;  4NL5 A;  5T7L A;  1Z1Z A;  2ZE2 A;  1VQ8 S;  1SXL A;  5AE1 A;  5J2N A;  4NEY A;  3M6U A;  2DGV A;  2L41 A;  5GMD A;  1HQ2 A;  2ZHB A;  1RTI A;  2F63 A;  3O6Q A;  5J2P B;  1NME B;  2BJ7 A;  4F4W A;  2RU9 A;  3UCU P;  3DLH A;  2JH3 A;  4EUV A;  4YEA A;  2YNI B;  4RNM A;  2VD3 A;  5ETP A;  2CQ3 A;  2V4R A;  2NZC A;  3W8G A;  2B4U A;  2CQC A;  4LQ9 A;  4H4O A;  2X7I A;  4M5M A;  5F41 A;  1T05 B;  4ED4 A;  3DLE A;  2Q3P A;  1GMU A;  2F5G A;  4LF7 F;  2KDO A;  3OJU A;  2PGC A;  1FI4 A;  1VJW A;  2BAB A;  3ISN C;  2OSR A;  2G0J A;  4ELT A;  4G1I A;  2WCX A;  3BYR A;  2IMW P;  3W2V A;  4LRD A;  3PYE A;  3BH6 B;  5D77 A;  3CO9 A;  1FFG B;  2YNF A;  5HMW A;  3RAX A;  4FPI A;  4IYQ A;  1S97 A;  2XEX A;  3VAH A;  4CRJ A;  1DQ8 A;  2A10 A;  1J2V A;  4M5D B;  3V81 A;  2QLF B;  4TQS A;  1I94 F;  2IYI A;  3B78 A;  2XS2 A;  2P9G A;  5HMX A;  2YX7 A;  3RR7 A;  3D2W A;  2OUG A;  4C8O A;  2IDE A;  3I0S A;  3H25 A;  2JSX A;  5I3Q A;  4ERD A;  1TMJ A;  1BQN B;  5HP1 A;  4FF4 A;  1KKH A;  2MQM A;  3NBP A;  4X4V A;  3G8S A;  2GJF A;  1NDC A;  2WVF A;  1NJI T;  1N8R T;  2BMB A;  4L6V 3;  3HDS A;  2ADC A;  3UN2 A;  2E44 A;  3BR9 A;  2MQP A;  2CYY A;  3OSN A;  4DQR A;  4RW6 A;  3L3C A;  2EWH A;  4DV2 F;  3RW7 A;  2RIJ A;  3TQE A;  3RG6 A;  2V5H G;  2MJU A;  4MKY A;  4LR7 A;  3PVX A;  3GJT B;  2D74 B;  4OZ3 A;  2FHJ D;  3M2V A;  2VBZ A;  3QIP B;  2HEK A;  3O44 A;  4OZL A;  1FFS B;  4CM0 A;  4TVA B;  2HBR B;  3HI9 A;  5BYS A;  2HHH J;  3OXL A;  4LF8 F;  1WF1 A;  4CO4 A;  3T9N A;  5LT5 A;  4KY3 A;  5CYM B;  1F5C A;  5B0B A;  4AL5 A;  3U27 A;  3P5B P;  1HL6 A;  3PKY A;  2EG1 A;  3IN5 A;  1S76 D;  4KSE B;  1NKB A;  4B9T A;  3H5U A;  2I9S A;  2A6M A;  1RAD B;  1VGY A;  4DUT A;  2M9K A;  1UVI A;  1KHW A;  4DUY J;  3VAG A;  4WXW A;  2DNN A;  2BKN A;  1UA0 A;  1L3T A;  4CIO A;  1WDT A;  3M9O B;  1H38 A;  2VU5 A;  4K5R A;  5CXT A;  4QWD A;  4JV5 J;  5C42 A;  4M1K A;  2YX1 A;  2RHQ B;  1CVJ A;  3PFO A;  4OJG A;  2L9N A;  2KHD A;  3TVY A;  3KMQ A;  4FXD A;  1S6U A;  2HNZ A;  2JFK A;  3TO8 A;  2VAS A;  2XSF A;  5AXL A;  3QRQ A;  1HQU B;  2JOQ A;  4QR1 A;  4X4R A;  1U8S A;  5J1E A;  3G71 S;  2XHC A;  1VBX A;  5A8R A;  1VRT B;  3CF5 Q;  3M8Z A;  2BOA A;  1QLN A;  4UOF A;  2HIQ A;  4UQT A;  1FES A;  4HT5 A;  3DDN A;  2D69 A;  3CO0 P;  4RNO A;  2IM0 A;  3PW4 A;  2OIH A;  2EW9 A;  2C3Y A;  3GFH A;  4DV1 F;  1DZ5 A;  3RTV A;  4TY9 A;  3JSM B;  2FHK A;  5EX3 A;  5U47 A;  4ZMM A;  3S7R A;  3DRP B;  1WG5 A;  5EN1 A;  4U67 Q;  4K4W A;  4K50 A;  1U2C A;  3K5L A;  3AHP A;  3H42 A;  3ENA A;  5DDP C;  3DOM B;  1S1U A;  3QO9 A;  3J80 Y;  1V9O A;  3CCU S;  2UV8 G;  1YRU A;  2Y1J A;  2GVZ A;  3P3D A;  4O3S A;  5DS7 A;  4LF6 F;  5LOQ A;  3HLU A;  4NI2 B;  4F0H A;  3W2W A;  1KLN A;  1BLU A;  4ES2 A;  4J5O A;  4USM A;  4DLE A;  1SJ4 P;  4NRU A;  1NDK A;  4YY3 F;  2F65 A;  1NSK L;  2UU9 F;  3RAQ A;  1KQG B;  4RZR A;  2PA8 D;  3EGN A;  2HSE B;  3CMQ A;  3T1Y J;  2V50 A;  5K8M A;  1JXL A;  4TU7 A;  4JI3 F;  2XMU A;  4GKK F;  3B8H A;  5CA5 A;  4K4U A;  5T41 A;  4PWD B;  2JEG A;  4U9R A;  4JV1 A;  3I87 A;  3MM8 A;  2UUB J;  4C97 A;  1JXV A;  3I4P A;  4ZIT A;  1LW2 A;  4QR0 A;  3UCZ P;  3K5N A;  4DZ6 A;  3OR2 B;  3K0J A;  4R8U A;  2QL9 B;  2ADB A;  1VR6 A;  1CJK A;  2F4F A;  1JLQ B;  2DRB A;  9ATC B;  5CQG A;  4DQQ A;  3RRK A;  3PCO B;  3M6X A;  1NPR A;  1VBZ A;  1F3V A;  2HZV A;  3IFE A;  3IS9 A;  5IQQ A;  4KO0 B;  3IRX A;  3GV5 B;  4CTA A;  2J0S D;  4IR1 A;  3DGP B;  3HKW A;  2NYH A;  3TUP A;  3PJW A;  4ZPV R;  3KG4 A;  4USV A;  1UVJ A;  3OTD A;  4DFM A;  4C6A A;  1ROF A;  4ECT A;  1PAE X;  3THT A;  8AT1 B;  3BDP A;  1S9G B;  4UZC A;  5H9E K;  4ZVU B;  1NK7 A;  3M6W A;  5CAA A;  1NPP A;  1HWK A;  2CPD A;  5H1S V;  1IN0 A;  2EK1 A;  2FHO B;  5IT9 Y;  4DV7 F;  1VQP S;  5ETO A;  4DR5 J;  5I3U B;  4DV5 F;  5HBM A;  1C0T B;  2DO4 A;  3NMR A;  3GG0 A;  1SH3 A;  1UET A;  4QIE A;  2POK A;  2HHX A;  4DV3 J;  1TV6 A;  2B7C B;  1RTH A;  2CNN B;  1APS A;  2KXH A;  4KGV B;  4WKY A;  2EPI A;  3A13 A;  3BDE A;  1RDR A;  1X4F A;  1NM2 A;  1RT3 A;  3GIR A;  1HNZ F;  1KOH A;  4DV4 J;  1SPB P;  3KUH A;  2UVR A;  1JK9 B;  1VQ7 S;  4I56 A;  4ED6 A;  4B9V A;  3A12 A;  5EWF A;  3I31 A;  3TJA A;  3QRR A;  3CJ5 A;  3RU0 A;  3HJV A;  1X9S A;  2RRA A;  3CIM A;  4EO6 A;  2M70 A;  4H4K A;  5F8N A;  1FJE B;  4GC6 A;  2BE9 B;  1UZD A;  3W3S A;  4HAC A;  1R8B A;  4CT9 A;  1HWL A;  5GVQ A;  2BJ8 A;  2RKI A;  4KHR A;  2HS0 A;  5KFM A;  2APO A;  5KFF A;  3VWS A;  4C8M A;  5EWG A;  2XMV A;  3IWN C;  1PO6 A;  2DEI A;  3R2C J;  1S9E A;  4CLZ A;  5C7P A;  1FK9 B;  2MKY A;  4N56 A;  2NUH A;  2EVZ A;  4DI6 A;  1J27 A;  3PYG A;  2JLG A;  4C8K A;  2ZH9 A;  1R0A A;  2FTR A;  3OVS A;  2CA9 A;  2RF2 B;  1JLC B;  1PIE A;  4DPT A;  2B43 A;  3IBF B;  4UQG A;  1CC8 A;  4C8L A;  3UVJ B;  4EBE A;  3BSO A;  4G1Q A;  2AJF E;  1TP7 A;  3RB3 A;  1HQE B;  2GV1 A;  2C2Z B;  1UVN A;  4CT8 A;  4A8Q A;  3UN5 A;  1Q7Y T;  2EFO A;  3ZZO A;  4KV8 B;  1RHM B;  2U2F A;  1NCL A;  1TUG B;  3J81 U;  1U26 A;  4I6Y A;  3UN3 A;  4H4M B;  1VS3 A;  3P45 B;  3TAN A;  1FEH A;  2E5H A;  4QWE A;  2DGS A;  1TFW A;  2R8K A;  3BQ0 A;  2P6S A;  3VQT A;  1FWP A;  3NCP A;  4PQU B;  1M5K C;  1TKD A;  1S1W B;  4ZN1 A;  2W25 A;  4OI6 A;  3TRG A;  2E9R X;  1Q4R A;  2EFG A;  4CQ1 A;  5F9L A;  4I64 A;  2ZWO A;  3ZTS A;  3JAM U;  2PA3 A;  1FDD A;  5L9X A;  4RUA A;  4TLR A;  2R8G A;  2B9W A;  1T03 A;  3K89 A;  4Y2C A;  2GX8 A;  3EXY A;  1CEZ A;  1SV5 B;  3AJ2 A;  1TK0 A;  4P71 A;  3MEG A;  3LP0 B;  4NOH A;  3H2V E;  5D0E A;  4NLQ A;  3TAM B;  1RHR B;  2MKH A;  4P7V A;  4Y34 A;  4OL8 A;  1RT2 A;  3GP9 A;  4WZQ A;  4QPX A;  2V69 A;  7FDR A;  2HVD A;  4GO5 X;  2F9J A;  5KFY A;  4DR4 J;  2HHH F;  2X1A A;  4NAS A;  5IT4 A;  4O4G B;  4MK7 A;  1HBN A;  1UKU A;  3DOK B;  2HHV A;  1H6K X;  1NLK L;  1OPZ A;  1T11 A;  1CC7 A;  3JSY A;  2R7O A;  3MGJ A;  4F3O A;  1RAO A;  1JXE A;  3OPK A;  3DLG B;  3Q24 A;  1N6Q A;  3MM7 B;  2YKA A;  3R5A A;  2IAJ B;  3VGS A;  4CH0 S;  2QTW A;  1OSC A;  3OTO J;  3QSI A;  1T94 A;  1DY3 A;  4FS1 A;  4WFB Q;  5DJB A;  1V5V A;  1DAR A;  2HGL A;  3HK2 A;  2ASL A;  1G6B A;  2RSQ A;  3M30 B;  4ZVO B;  2GIQ A;  2J6T A;  2FGO A;  1XJW B;  1YLX A;  1K73 T;  5KG0 A;  1EQM A;  1WD6 A;  2ZZN A;  3OSP A;  4XDD A;  3WIU A;  4FS2 A;  4A8S A;  4URG A;  2ROG A;  4O3N A;  4F4K A;  4DF4 A;  4FZV A;  1RWK B;  2CJX B;  4Y2M A;  4LR8 A;  3HCX A;  3LW5 C;  3FKB A;  2EFN A;  1RT1 A;  1Q5V A;  4WYL A;  1DTQ A;  2XYH B;  4FVM A;  2MZT A;  4QYZ K;  2ZNZ A;  2OMO A;  3DLK B;  2O3D A;  4KB7 A;  3C2P A;  3QWP A;  2MZS A;  4DPU A;  3DCA A;  1LXN A;  2L3M A;  5CYQ A;  3C14 B;  4RW7 A;  3OUY B;  4RU2 A;  2C2R A;  2GO8 A;  1XR6 A;  1TTH B;  1RKI A;  4RNF A;  1UWB B;  4O0I A;  3UPF A;  2H5E A;  2NXN A;  4UUW A;  3LF0 A;  4C3K A;  2D1C A;  3TAP A;  4KT0 C;  4MIB A;  3AB4 B;  5A0Y B;  3W61 A;  4F4X A;  3KTQ A;  1SC6 A;  2H54 B;  3RB4 A;  2DR9 A;  2ZJQ Q;  4Y65 A;  2MZQ A;  1LW0 B;  2BAN A;  3MM6 A;  2CPE A;  1V3R A;  2GVD A;  1UVK A;  1FO1 A;  4WP3 A;  4IOC Q;  1VLO A;  5D4P A;  1S79 A;  1PCA A;  4KH0 B;  4UOC A;  1WTF A;  3J7Y U;  4AXI A;  3US5 A;  4WTO B;  2W9C B;  3FQL A;  3R8Y A;  1D0E A;  3W5Y A;  1RT5 A;  2DCU B;  4CP5 A;  2LU2 A;  2ZH4 A;  2QLB B;  2QL7 B;  3AH6 A;  1RLD A;  3PNI A;  1L5U A;  1NBE B;  3EVO A;  1EET A;  3HHN B;  1NJY A;  1UEU A;  3H40 A;  4NLX A;  2H1Y A;  2H4Y B;  2OD4 A;  1DQA A;  3T1Y F;  4P2M A;  1GH8 A;  2AW0 A;  1TR0 A;  1S6Q A;  4HEA 9;  1NDL A;  2AEF A;  3GWC A;  4UZB A;  1CQM A;  1RU2 A;  2VIH A;  3MFH A;  3M2R B;  1HLW A;  4DCP B;  2UUB F;  4KQZ A;  5KFA A;  4DQS A;  4QQB A;  3IMQ J;  4P2S A;  1S0M A;  2YQ1 A;  2VL1 A;  3KKF A;  5KG1 A;  4OI1 A;  3MPV A;  3TX0 A;  1R6V A;  1NZA A;  3G86 A;  1P9Q C;  5D3G B;  3DRY A;  3LGM A;  3CUN A;  4OJH A;  3LGN A;  1QAI A;  2W4C A;  3I6P A;  2KFY A;  2N4D A;  4NCG B;  4YHH J;  1XNQ J;  4LSN A;  3M6V A;  1C1C B;  3KUE A;  5HLF B;  4URS A;  2A1B A;  2HS3 A;  3TP2 A;  2ZH3 A;  5CYJ A;  3DFE A;  2GIF A;  2E1P A;  4TU9 A;  2YNG A;  3MDF A;  1MW7 A;  1BD6 A;  2Y8W A;  4IR9 A;  1UP1 A;  1IQT A;  2VPZ B;  4KBI A;  3QT8 A;  2W9B A;  2YPY A;  1HHQ A;  3NCQ A;  2GQ2 A;  3NGK A;  4GKJ F;  1G1X A;  4NZ7 A;  2MSS A;  3O8W A;  2FVC A;  1R8C A;  1YJN S;  3D1Q A;  3OLB A;  2ZJR Q;  2BEF A;  2KT2 A;  3PIP Q;  1TUV A;  3R5D A;  2ASD A;  4K7Q A;  2AD9 A;  4PPZ A;  5KT5 A;  1HNI A;  4EBD A;  2J7K A;  1XMO J;  1RWN B;  3QT5 A;  3HHD A;  4N7T A;  4DL3 A;  2B4O A;  1U0H B;  3Q0A A;  3BPS P;  3UCG A;  5DG8 A;  1VQ6 S;  4DR5 F;  2XM3 A;  4KKO B;  3HX9 A;  1DLO B;  2IJR A;  1YIJ S;  3HD1 A;  2P2C B;  4N8O A;  4PWW A;  1B7F A;  5A76 A;  2BE2 B;  3W64 A;  1AA1 B;  3MEK A;  2HND A;  2WB4 A;  1TL3 A;  1N32 J;  1XWL A;  4J7C A;  3OJS A;  3RRH A;  1T9X A;  2XLJ A;  3H5S A;  4KHP J;  3FCH A;  2MGZ B;  3LPE A;  3KLF A;  3TQ1 A;  3W66 A;  2CPX A;  3KFW X;  3QZ8 A;  1IUJ A;  5KAK A;  4YR2 A;  3AFG A;  3PEJ A;  1N5Y B;  4J90 A;  1HBU B;  1KR4 A;  1JLG A;  2OPQ A;  5ITH A;  5E33 A;  1LWX A;  2RT3 A;  4DV4 F;  1Q1K A;  2XWX A;  3D3B J;  2HQC A;  3GV7 B;  1TZ0 A;  2W4D A;  1RB0 A;  3WZ0 A;  4X65 J;  3HHL D;  4HH0 A;  4RUH A;  2FPH X;  5FII A;  4OHV A;  1H74 A;  2GS8 A;  1FKA F;  1UJ6 A;  3CUL A;  4JV0 A;  4IG3 B;  2CPI A;  2DGU A;  3H59 A;  4LSZ B;  4HH1 A;  2DO0 A;  5ETM A;  4RBV A;  1GAO A;  1Y7P A;  1YRT A;  2BYC A;  4WK1 A;  1T05 A;  3TOQ A;  1R43 A;  4M5J A;  2FHM A;  3MM9 B;  2LLZ A;  3QPI A;  4F3M A;  3DOL A;  3SSR A;  2RH3 A;  5FD1 A;  1S4F A;  5J2M B;  3JTN A;  4W92 B;  3G82 B;  2VQE J;  2HGN A;  2KG0 A;  4OV1 A;  1BC6 A;  1A7G E;  2XLK A;  3GJR B;  4V1A k;  3O5T B;  1KTV A;  5ADZ A;  2Z2M A;  4TQR A;  3FBC A;  2MHN A;  2PD1 A;  4QCL A;  4J37 A;  4ID8 A;  1TL7 B;  1RT7 A;  3HHL B;  3GQC A;  1K0V A;  1KNZ A;  2HG4 A;  2W2P P;  3N6N A;  1V6H A;  3FBB A;  3IG1 B;  3MZI A;  4BCA A;  4JI5 J;  4WII A;  4DN0 A;  1HNX J;  2PFD A;  1BQN A;  4NZ6 A;  3SCI E;  4L3K A;  4Q2L A;  5KFD A;  1FDN A;  3ZFV A;  2M3D A;  2E9Z A;  2V9K A;  4WU2 A;  3Q8P B;  1XEZ A;  2OO4 A;  2V68 A;  3C6T A;  3MPU B;  4RNH A;  3D4J A;  3SV4 A;  1KON A;  3UFC X;  1AYE A;  1EAY C;  2FLL A;  2LEB A;  4YR3 A;  4HI1 A;  4LFB J;  2Z2Y B;  2FJW A;  5LXR A;  4KC5 A;  3NNA A;  5KG3 A;  4NLO A;  5DQG A;  3SV3 A;  2CPJ A;  3CCJ S;  2L08 A;  5KFB A;  2KL8 A;  1S77 D;  2DRA A;  5K9F A;  1CS4 B;  5HN0 A;  2FJD B;  4DPO A;  2UUA J;  1NXI A;  1MWQ A;  2FC9 A;  4NLP A;  2R8J A;  1PBU A;  4PG5 A;  2FJV A;  1P6T A;  3HVR A;  5D8H B;  5E5N A;  2N7Y A;  5FJ4 A;  3TZZ A;  3SEO A;  1H7X A;  3F73 A;  2ROP A;  2V0N A;  3JS9 A;  2EFP A;  2DHS A;  1QTN B;  1JJH A;  5T7L B;  4RW9 A;  1C0U B;  3CJ8 A;  3N28 A;  2R2S A;  2ZE2 B;  3EMT A;  5J2N B;  1KFD A;  4JYA J;  2QT7 A;  3U02 A;  1SVD A;  4JI2 F;  2VQF J;  5HVF A;  2NR0 A;  1G7C B;  2GZO A;  4Q44 A;  1RTI B;  3MCS A;  4C8Z A;  4DR4 F;  1H2V Z;  2XS7 A;  1QVF R;  4L74 A;  2PN6 A;  2G2Z A;  4Y2K A;  1KRP A;  2DNR A;  5B08 A;  1QSL A;  1HD1 A;  2LQ8 A;  2Y1I A;  3GSD A;  3TUI C;  4OI2 A;  4LBI A;  1AFI A;  2FHJ A;  4MMO A;  5E41 A;  1FER A;  2AKW B;  2AGP A;  1T02 A;  4P75 A;  4MFB A;  2GHP A;  3D67 A;  4FBU A;  1FD2 A;  1RBL A;  1JJ2 R;  4J91 A;  1XMQ J;  3OTO F;  1ELO A;  3NS6 A;  1FX2 A;  1JB0 C;  4PXC A;  1KD1 T;  3MPY A;  3J7Z 5;  2N82 B;  3W2V B;  3HT3 A;  4DR1 J;  4ZA1 A;  4B3O A;  2R2R A;  1RQ0 A;  2FQQ B;  2K1R A;  2YNF B;  1W25 A;  2AHO B;  4BHQ A;  5DZ7 A;  4X64 J;  5KFO A;  3JSM A;  1LK5 A;  3QMQ A;  3V81 B;  4OYA A;  1FT8 A;  3OD2 A;  1FRJ A;  3MED A;  2LCW A;  2LEA A;  2FB0 A;  2XI2 A;  5GAD I;  3I56 S;  1RAG B;  4PXE A;  3I0S B;  3NG8 A;  2CQP A;  1R31 A;  1FDA A;  2AIR B;  3DOM A;  5HQ8 A;  5HP1 B;  3W9I A;  3NBP B;  1N0V C;  4OV6 A;  5HVG A;  1FCA A;  4YN3 B;  5LMU F;  2CDR B;  4DQI A;  4ALZ A;  4NI2 A;  4CI0 B;  4RW6 B;  2BM1 A;  3W65 A;  1JNZ B;  3ADA C;  3E3X A;  2R2T A;  2E5L J;  3FC9 A;  2UXB J;  1I51 B;  1WOP A;  3D0H E;  4IG0 A;  2DTJ A;  3M2V B;  2XS5 A;  3HFZ B;  1OY9 A;  3ETO A;  2JDJ A;  4MAK A;  4ETX A;  2HQ3 A;  4EEY A;  8RUC A;  3ZNJ 1;  4IQM A;  4C9D A;  2XNR A;  3ILJ A;  4ZOS A;  1RTZ A;  2HZC A;  2Z2L A;  3T19 A;  2AJQ A;  2RDD A;  4OYB A;  4HVZ A;  4R0J A;  5AXK A;  2OEL A;  5IQ6 A;  4YB7 A;  2B8Q A;  2PMW A;  1M5S A;  1H7W A;  3QFW A;  3DXS X;  1VYA A;  1FEE A;  1RZM A;  3NGS A;  4LF5 J;  1X4A A;  3RJM B;  4I2Q A;  5C42 B;  5C2G A;  1KWM A;  4YP3 A;  1W2I A;  1O5J A;  1F9E B;  3UI3 A;  2B7B B;  2Y0S D;  1RTD A;  1TFY A;  2CIM A;  1IKW A;  4ED0 A;  2HNZ B;  2HVE A;  2LP4 A;  2F8H A;  3ZXW A;  1HHT P;  3GMG A;  1F2G A;  3S8S A;  3NOC A;  2KXN B;  2GO9 A;  4ECQ A;  5J1E B;  2W8K A;  3ZZU A;  1RT6 A;  5A8R B;  2GA7 A;  1VFJ A;  4IO9 Q;  2VFR A;  1XNQ F;  4YHH F;  1KSP A;  3W1Y C;  1TAU A;  1GQE A;  1D9F A;  4Z7Y A;  1HBO A;  2J7U A;  4DX6 A;  3J7Z T;  3T1H J;  1HMV A;  3C6U A;  3BF4 A;  3ITH A;  2QE5 A;  3VR1 A;  3U1N A;  1LFP A;  2CZV C;  3VGU A;  3D6F B;  2DK2 A;  3DRX A;  1B7Y B;  2GHW A;  3VAI A;  2VDH A;  3RBD A;  4LIR A;  5H9F K;  4B9M A;  1N4L A;  2OHD A;  3LTO A;  1IBM J;  3CCM S;  3TA0 A;  2DYA A;  3MM5 A;  3DU5 A;  3GV8 B;  1DFD A;  5AT1 B;  1HIY A;  3B4D A;  1FXR A;  3N4W A;  2OPS A;  1T3O A;  3QO9 B;  1WC4 A;  1UPP A;  5SZT A;  1U8W A;  1SL0 A;  3JAM Y;  5B0G A;  2YKN A;  1RWV B;  2GVZ B;  3TUJ C;  4KGK A;  3W2W B;  3N6L A;  4USH A;  5ETV A;  2GW8 A;  3EJM A;  5K5M A;  3Q8Y A;  4P2F A;  2VG7 A;  3HXM A;  2ZZT A;  1FF2 A;  1SC4 B;  4AYB D;  4RPF A;  2XGP A;  1DTT A;  4DR2 J;  2OP5 A;  4KHP F;  4OZJ A;  3A8I A;  4DS5 A;  3LUY A;  1U48 A;  4LMZ A;  4LRB A;  4PXD A;  4H54 A;  3KLG A;  2Z57 B;  1WC6 A;  1IM6 A;  3N0V A;  2E1C A;  2BAC A;  3IR6 B;  4DG1 A;  2D3O R;  4FF3 A;  4YB6 A;  3MM8 B;  2ALY B;  1X60 A;  2WVB A;  1R6Y A;  1NUE A;  3CJ3 A;  2HZA A;  4ER8 A;  2F3J A;  5DG9 A;  4X65 F;  4XO0 A;  2CPH A;  4ZPT R;  1RHK B;  1LW2 B;  2HK2 A;  1U7L A;  5BYR A;  1URN A;  2D7S A;  1PSD A;  3KJV B;  2NXU A;  4R8U B;  2UXD J;  5CAB A;  3CJK A;  2W2N P;  5KT7 A;  1CJK B;  3R1H A;  4MIA A;  3MR2 A;  3ILI A;  2XMT A;  5I42 A;  3IS9 B;  4ZVT B;  5BJR A;  2JWN A;  3UD3 P;  3IRX B;  5B7W A;  3L9Z A;  1VQK S;  1R8A A;  2MY8 A;  3DC2 A;  3UQS A;  5D0H A;  5HRO A;  4RO0 A;  4HHH A;  4WP8 A;  3JTO A;  1BY9 A;  1XMB A;  2JEF A;  3IO1 A;  1ZA2 B;  2VQE F;  2KXF A;  4KV8 A;  2Y9H A;  1SI9 A;  2YVS A;  5KFI A;  3GTY X;  5KT4 A;  1BWV A;  2A3J A;  5A8W A;  4H4M A;  2ZM6 J;  3CC7 S;  3AJ1 A;  2VOO A;  2MB0 B;  1VMB A;  2JJ4 D;  3TR5 A;  1KS2 A;  3PFE A;  5C5J A;  2ZDO A;  2C42 A;  2RNE A;  4JI5 F;  4YR0 A;  2CG4 A;  4F26 A;  1OPI A;  4NXM J;  3CDU A;  3V6K A;  3HVW A;  3SQO P;  2CWX A;  5HO4 A; 
#chains in the Genus database with same CATH homology
 2MTL A;  2UXD J;  2KL8 A;  4KY3 A;  4JI8 J;  4DV5 J;  2E5L J;  4K0K J;  4X62 J;  4KHP J;  1XMQ J;  3T1Y J;  4NEY A;  1HR0 J;  2UXB J;  2VQE J;  4AQY J;  4LFC J;  2UUA J;  3R2D J;  1J5E J;  4LFA J;  4DUZ J;  4DV0 J;  5A2Q U;  4JI6 J;  4B3T J;  4V1A k;  4JI0 J;  3J80 U;  1N34 J;  4DV2 J;  4DR1 J;  4LF7 J;  1XNR J;  4DR4 J;  1HNZ J;  2UUB J;  4JI4 J;  4DUY J;  4LF6 J;  5LMU J;  4DR6 J;  3J81 U;  4LF8 J;  3D3B J;  3W1Y C;  1FJG J;  5LMN J;  5IT9 U;  4DR5 J;  4JV5 J;  4DR2 J;  4B3M J;  4DR7 J;  4X64 J;  4NXN J;  5IWA J;  4JYA J;  4DV1 J;  3T1H J;  1N33 J;  4X65 J;  5LM7 E;  4JI5 J;  4DV6 J;  1HNX J;  4YY3 J;  4KYZ A;  2VQF J;  4X66 J;  2UU9 J;  1N36 J;  3J7A N;  2MQ8 A;  4JI7 J;  1XMO J;  2MEW A;  3R2C J;  2ZM6 J;  2F4V J;  4GKJ J;  3IMQ J;  4LF4 J;  5BR8 J;  1I94 J;  4NEZ A;  4DV3 J;  3JAM U;  3OTO J;  4DV7 J;  1IBL J;  2UUC J;  4JI3 J;  1HNW J;  1IBK J;  2KVQ E;  4GKK J;  1IBM J;  4DR3 J;  4LF5 J;  4PWW A;  4RJV A;  4LF9 J;  2UXC J;  4B3S J;  4HHU A;  1N32 J;  4JI1 J;  4JI2 J;  2HHH J;  4NXM J;  4LFB J;  4B3R J;  5FLX U;  4DV4 J;  4YHH J;  1XNQ J;  5AJ3 J;  3D3C J;  4OX9 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...