4I0WA

Structure of the clostridium perfringens cspb protease
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
92
structure length
91
Chain Sequence
AKVGIDFINTIPKQILTSLIEQYSPNNGEIELVVLYGDNFLRFKNSVDVIGAKVEDLGYGFGILIIKVNDLNRIIELEGLQIELPKILYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease CspB
publication title Structural and functional analysis of the CspB protease required for Clostridium spore germination.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 23
structure length 91
sequence length 92
chains with identical sequence C
ec nomenclature ec 3.4.-.-:
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18425 CspB_prodomain Csp protease B prodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i0wA00
4I0WA
chains in the Genus database with same CATH superfamily
4DR7J 4IFVA 1KLNA 4IFVB 2ZH8A 2E9ZA 4KFBA 5J1EA 2BJDA 2DO4A 3WHIA 4F4XA 4KFBB 1Y9OA 5J1EB 4G1QA 2HLUA 2EBEA 2ZJPQ 3M8RA 5D8HB 1MMLA 2CPZA 4G1QB 1E6VA 2KFZA 3IFEA 2BXJA 1ACMB 4NWBA 4IQMA 1E6VB 4HI2A 3FQKA 1SVDA 3I4HX 4ZLLA 2LECA 5IZHA 4WFNQ 2F65A 2KVQE 1QAXA 5J1PA 2E5IA 1F9EB 3IBFB 2AGPA 1WWHA 2BE7D 4M63A 2HHVA 1ZBTA 3TP2A 2H5IB 2F7VA 2VG5B 5CYMA 1Y5IB 2CPFA 3J80U 5CYMB 4DX7A 5K9FA 3VGVA 2DXFA 2E7WA 3V5RA 2DPIA 4PG7A 4PPZA 4ZP7A 4HEA9 4DU8A 3WQPA 3CDEA 3TUIC 5LJ5Y 2DGUA 3UDLA 3P5BP 1FKAF 1S4FA 3BYRA 2D7SA 1W25A 2HHHJ 3PYEA 2XB2D 3CJ0A 1I51B 1RKIA 4DV3F 1F9HA 2P6SA 4AL7A 2MLXA 4YHHF 4NLXA 3CMQA 3G2XA 3K5LA 4CO2A 3DYAA 3ZZYA 3DYAB 1FJGJ 1RWVB 3UFCX 2ZHAA 2XZTB 3DLHA 3KJQB 3H90A 3SFGA 1K44A 3VAMA 2WBRA 2O67A 5ADZA 4NRTA 2DY9A 1ZAVA 3R5BA 4YP3A 2WCXA 4WJBA 3MZIA 3QGIA 3DDIA 5F9LA 5ETQA 5HN0A 1ZZFA 2I5JA 1TAQA 6AT1B 3UW1A 5LM7E 5KFUA 3IP0A 1WSVA 3MTJA 2I5JB 1NSQA 4DV1J 1TZ0A 2G4BA 4DN0A 2UZAA 1AW0A 2WVCA 5A6PA 1NKBA 2ASJA 5KT7A 3A1YG 4QWDA 3LPEA 1GXLA 2XY7A 3NOCA 1AZSA 2MHEA 1AZSB 2Q79A 3MD1A 3SFUA 2UXDJ 1KVJA 3A3PB 4KQZA 1BQMA 2F9DA 1UWAA 1BQMB 2Q3PA 2HBYB 2K7KA 4W92B 3G8QA 1L3UA 3B4MA 1HIYA 2IM2A 3GSIA 1SQGA 3MPVA 4CH7A 2DR8A 4X4UA 3R1HA 1RCOB 3RB6A 3MOJB 1S57A 5CYJA 1G3OA 1R8AA 4OFZA 1JK9B 2EFVA 3RU0A 2A6OA 2DRBA 1X0FA 3M7VA 3KK3A 3MHYA 2I8EA 1NPRA 3KK3B 4DR3F 3EM1A 2BEFA 4IYQA 4IUFA 3HK2A 2M52A 1WG1A 5CYQA 2YWKA 1VLOA 2CQ0A 2I2YA 3ENAA 4O0NA 1KOHA 5CYQB 1JXLA 2ZHBA 3DLLQ 3KG4A 3GFXA 2HS0A 3QMQA 3TVYA 1WEZA 2XYHB 1WHVA 1U02A 4Y2MA 4OZ1A 1KVIA 2A18A 3H25A 2QA4G 4CNYA 3UD5A 4DLEA 2BE9B 2GNKA 3PFOA 4ECQA 4ATNA 1TKZA 1TFWA 4LFCF 1HL6A 1TKZB 3HFKA 2JEGA 4Q8EA 2ZITA 1VQ4S 5KFNA 2FLNA 1KR4A 1SI9A 2HQFA 3RBZA 2GQ2A 2VPZB 1RA6A 4ZPAA 4CLYA 4PXDA 4U8YA 2FC8A 4NI2A 3MPUB 2ZBIA 4OZ0A 1S59A 1MLAA 2B7BB 4NI2B 4J9UE 2HWTA 4V19X 2CFXA 1OY6A 3DNCA 4PABA 2PI4A 1N48A 2DCLA 4P2XA 3P6YC 3K7RA 2KFYA 4X66J 4RWXA 4L75A 3TA2A 2B5JA 4KIAA 4NEYA 4ZVRB 1LW2A 1OWXA 3FC9A 1RB0A 1Y4ZB 3BDPA 1LW2B 3QIPA 5AXNA 1WOSA 5C25A 3QIPB 1Q5VA 5C25B 4ECTA 2NXCA 2R2UA 3OFHA 3J7AN 2E7XA 4C8MA 4L74A 3CJ8A 2BJ1A 5BJRA 1U1MA 1OPZA 3KG0A 3HFVA 1MMDA 3X3UA 4M8LA 2BM1A 3WIUA 2F8MA 2KXHA 4KC5A 3LOUA 3TX0A 1I94F 4UZBA 3TX8A 2C3YA 1Q8BA 3OFGA 5HQLA 2NSCA 4ZPVR 2ZUGA 4LFBJ 4Y0FA 4OHYA 2DNOA 4I56A 3NL0A 4L72B 2FDNA 4KH1B 3M32A 1L3VA 4LT6A 3M32B 4RU9A 3BQ2A 3H5XA 3TOQA 3SYZA 4LF9F 2K3KA 4N47A 4CNZA 1HWLA 4PEOA 3BYPA 5FJ4A 1OYEA 4DZ6A 4F50A 4M5NA 4YEAA 2ROEA 3B4DA 3FBFA 1R31A 4A46A 2V8HA 2DNQA 2VQEF 4WPAA 3LP1A 2VHGA 3ITHA 3LP1B 4DV7F 3ITHB 4CO5A 1DURA 2KVIA 2B4VA 3MAAA 3C3LA 2WVDA 3W60A 4DL2A 3HZGA 4DI6A 3MAAB 3PW7A 4BWMA 5F8MA 2RQMA 3ZZOA 2DH8A 2AQ4A 3NNAA 4FPRA 3M9NB 1T9TA 4NRUA 2H1YA 2E1CA 2XNQA 3MTKA 1QM9A 1HHSA 2JFDA 3KYLA 2F1FA 1S0OA 4AUKA 1N5YA 4PG5A 5K8OA 1N5YB 2HPUA 1T03A 3AH6A 4ILRA 1QVFR 2MKCA 4OIXA 2RS2A 4YY3F 3PX6A 2W9BA 1T03B 4P52A 4RJVA 3CC2S 2M3DA 2W9BB 2G13A 3G6VA 2GV1A 3N5BA 1RGVA 3TRGA 2M0GB 1FF2A 2OEMA 5LMNF 5KT5A 1U6ZA 5KFYA 1DQ8A 1U0SA 3Q86A 1GXUA 1BHNA 5DLFA 3RBEA 4H54A 2RRNA 5KFWA 2B4UA 2HFVA 4YB1P 1F9FA 3BS9A 1IBCB 2FJVA 3DHXA 4IH6A 2R8JA 2OD4A 1UEKA 4I6WA 1LWEA 1V5IB 4K8RA 5KFSA 2G2ZA 2KG0A 2AD9A 4I2PA 1LWEB 1NHVA 2X3DA 4DZDA 4I2PB 2DGVA 4WZQA 1NM2A 3R6GB 2P5VA 2AW0A 1I5OB 2FUG9 1B64A 3HF5A 1VQYA 1HWJA 4JI7F 2V8DA 4F4ZA 2J0SD 4H4OA 1LV5A 4QR1A 4WXWA 2MKIA 2QEXS 5KFRA 4H4OB 4JI5J 1HNWF 2DHHA 4LRBA 2NZCA 4USJC 1T7PA 3PEHA 3A13A 4USUA 4BBYA 3MCSA 3PRDA 2W25A 3JQKA 2CNLB 3BPDA 2U2FA 1ZTTA 2YH1A 2WAQD 5HI7A 4RL1A 4F4WA 1X8DA 3P4UB 2XO7A 1VQNS 1HHQA 1X60A 2UV8G 2VFVA 2XBPA 4CZCA 3CCQS 3K57A 3K8WA 2VA3A 5IFMA 5L8RC 2EC0A 1RAFB 2JEJA 2KYXA 1OIAA 4JOUA 4ED0A 1YJUA 2C2MB 3FCWA 5B0CA 4TY8A 4O3OA 1FXDA 3T1YJ 1F2GA 1DQ9A 2FVPA 4TY8B 2AKWB 2JEIA 4O4RA 5L9XA 4ALZA 2EKYA 3RW7A 3GJTB 2BDPA 2HHQA 7FDRA 4DV0F 5KFJA 4LBPA 5LSOA 1VR6A 2HFUA 3UN3A 4BHQA 3HHNB 2MZRA 4ZHRA 4XAKA 4FF4A 3AA9A 2FZCB 4ZHRB 3UNYA 4TLRA 2E1AA 3OXFA 5HBMA 3PW4A 2DNZA 4F67A 4X65J 5HBMB 3IN5A 2IMOA 2KI2A 3RR7A 2AT1B 4AYBD 2WSFC 4MMOA 1ZYQA 5J2MA 4F3OA 1RBOB 5J2MB 4IDKA 1S9GA 3T5LA 2QMXA 4IDKB 1S9GB 2JHEA 1VLYA 2E1PA 1CS4A 2BJEA 4CM2A 1S9EA 5DZ6A 1CS4B 4TY9A 1S9EB 5EN1A 4HLBA 1LWCA 1X5OA 1O0PA 4ZVQB 2IIHA 3SDEA 3ZTSA 3NMRA 1LWCB 4JUZA 3NGSA 2NXNA 3SDEB 2JRSA 5LJ3Y 1XJWB 2C2OB 1S77D 3HVTA 1AYEA 2BMBA 1QLNA 3MFIA 4KYZA 3G96A 3HVTB 4E0DA 1TUVA 1WC1A 2E29A 1FRIA 1RTIA 4Q5VA 3HCXA 2R7RA 2PE8A 3PHTA 1RWKB 1BMQB 1RTIB 2E5HA 4GKKJ 3IWXA 4LQ3A 2B51A 1Z2LA 3W65A 3GLJA 1RLDA 2GVZB 4LBIA 2MZQA 1PYSB 2YWFA 2DJWA 2DRDA 2IA0A 2R7VA 2EEYA 4OI2A 1KWMA 1CQMA 3NGUA 3MUMP 3RAXA 3EVMA 2FGOA 2WW8A 2G1DA 4DR1F 2MJNA 1Y3JA 2ABYA 2DKOB 2RHSB 5D4PA 2HRYA 1FDAA 4J9PA 1Y10A 5L1IA 2QL9B 2V4QA 2LXIA 1IQTA 1H98A 5DG8A 2HK3A 2DGOA 4DDFA 4CRJA 2GAHC 3BREA 1CSJA 4OZJA 2XCAA 3FBBA 2ZKTA 4ES3A 1S12A 4U6PA 3BGOP 4ILMA 1RTJA 1IBKF 1ZA1B 1I3OB 3A3OB 1RTJB 3UDVA 4E98A 2J8SA 4YOEA 2AX0A 2CA9A 5A76A 4DUZJ 1X9MA 3MEDA 4QWAA 4A8SA 5F8HA 3MEDB 4XPEA 2IY5B 1VMBA 2FLOA 4KHRA 2A3JA 3ET6A 5J2NA 1IJFB 3ET6B 4G6VB 5J2NB 4FXWA 5HVHA 3LW5C 2BQ3A 1NDCA 2B0GA 2PFFB 1JX4A 2RB7A 5GMDA 1S0NA 2WSCC 1H2UX 1WF2A 2DH9A 5E3CA 2YY3A 4X4NA 1UFLA 1G2EA 3BQ0A 3N6NA 1WJ9A 3IAS9 4PCQA 5IWAF 1Q95G 3OFEA 5D4NA 4HTJA 3ILLA 2R8HA 2BOAA 3H4DA 1HA1A 3ELHA 1JNRB 4B9SA 2Q6BA 3I32A 4QW9A 4X4SA 3EPIA 3C6TA 2OUGA 1YG0A 3FCHA 4OI6A 3CD0A 1H6KX 2RQKA 3H40A 2ZBRA 2G0IA 3L4BC 4TQSA 4MT1A 2MZTA 5KFTA 3SI8A 3M8QA 1PJ6A 1RBLA 2GGPA 3VGSA 2OIHA 5C7PA 3M8QB 1M1GA 2OPPA 4X62J 3OHAA 3LWMA 1NK7A 2GGPB 2HWIA 2OPPB 1U1OA 3HHLA 3M8PA 2OMOA 4HH1A 4LSNA 1FEEA 3M8PB 4F26A 3GWCA 4Z2XA 4LSNB 3PTWA 3QZ8A 4FVCA 1XNRF 5IOLA 5C5JA 2RT3A 4K2XA 4MIAA 2YBVA 2VOOA 1FDDA 1Z4UA 3CDUA 4DQQA 2CNOB 3SCJE 4DS5A 4YB6A 4Y00A 1NSPA 4MYUA 5B0BA 1RCXB 4Q45A 3Q8UA 2GZOA 1J5EJ 1TK5A 5ITHA 4C8LA 3HSJA 5M2RA 3BJYA 1NBEB 5IQQA 3TAMA 3H8YA 1OSCA 1IR2A 2M4MA 3TAMB 3CB4A 2BW7A 3GCWP 1NPPA 1U25A 5I3PA 1LK5A 1UA0A 1WHYA 2RIJA 4XPCA 4ECRA 5D0HA 4KPCA 3MMAA 4ZJLA 4CQ1A 4DFJA 2EFOA 3FFIB 1N33J 3MMAB 1D9DA 3MM6A 4ER8A 2LDIA 3PZPA 3MM6B 1YX2A 3BGFA 3N0VA 4Q43A 5DQIA 2C3UA 4TLQA 2MZSA 1SUQA 2YQ3A 3TUZC 4K4YA 1SUQB 1S7IA 1VQ8S 4C8KA 3W1YC 1RADB 4NZ6A 1R6VA 2GCFA 3DLBA 1RAOA 1GT8A 3P8BB 3M2RA 2YH0A 1CBKA 3M2RB 2X1GA 5A8WA 2V63A 1GNKA 1L3TA 3W63A 5KG0A 2XWXA 4I0WA 2EC2A 5A8WB 1X4HA 4HHJA 2ZZTA 4QWEA 4DV5F 2GMHA 4U7UD 2VZ9A 4USHA 2XY6A 3MI7X 2Z4PA 1UAWA 4NZ0A 4K5RA 1VHIA 2NR0A 3CMAS 2CQ2A 3KLVA 3KUHA 3SIPB 4UOGA 4DR2F 2RRBA 4ZCIA 2Q66A 5GMEA 1VJQA 3UD3P 1CULA 3CF5Q 3I9V9 2NYIA 8ATCB 1CULB 3B82A 4BC9A 4G1PA 3AB4B 2HLTA 2RDJA 1Q7YT 1KP6A 4TNOA 1RBAA 2V8VA 4KB7A 2MZJA 3ISND 2YX7A 1FK9A 4K0KJ 1HPZA 3QAEA 4PWWA 1FK9B 1HPZB 1Z1ZA 1S1UA 1WDDA 3KUGA 1KBRA 3IAM9 4NLPA 1JMTA 2UXCF 2W9CA 1S1UB 1RAAB 4W4MA 2VJVA 1UA1A 2DD8S 4EMDA 2OTJS 2W9CB 1HYSA 1T02A 1HYSB 2ZM6J 3KHHA 4ELUA 2LQBA 1BGXT 4QBUA 2A10A 1TQLA 1AUDA 2BM0A 1ZM2A 2IVYA 4M95A 4R5PA 5HP1A 5FLXY 1QAYA 3VZHA 4R5PB 5HP1B 1Q86T 3NWGA 3GV5B 3BO3A 3KMSA 1Y3KA 4OYBA 1VC0A 3DCAA 2B9WA 3VQTA 1XTZA 2A2CA 2A6MA 3Q23A 5EUHA 3VHQA 2HGNA 2EI5A 3AQOA 2HFSA 2WB4A 1SC1B 4GVLA 3FMWA 1NHUA 4A8MP 1C4AA 3MECA 2HFNA 2L41A 3NKYA 1UJ4A 2IA6A 3MECB 3ZNJ1 1FD8A 5JUMA 3JAMU 4DPOA 4TKTA 1RU2A 3CJTA 2CJBA 2QG9B 1IBMJ 4CP5A 4BCAA 1UZDA 4NXNJ 1CJKB 1GMUA 4U95A 5T41A 1J2VA 1HI8A 3T1HJ 3W5ZA 2CKWA 4LR7A 2PEHA 5GAEI 1ZPVA 2J9EA 4DR6J 2PA8D 4QWBA 3GYGA 1EETA 3VAJA 1ZS6A 3S6EA 3ENWA 4QIGA 3W61A 3H5SA 2IRXA 1JNZB 4FYWB 2ZBCA 4RWWA 2NUUG 2QA4S 4O3QA 1NZAA 5BXIA 3EWGA 1AB8A 1C1CA 4HL9A 4KGZB 4X2BA 2RNEA 2ZWOA 4WFYA 1C1CB 2EBGA 4RNNA 2Q6CA 1UFKA 3FEZA 3FDSA 2HW3A 1NH7A 2CQDA 4DX8H 3C14A 1JLQA 3CJKA 4ECWA 2PMZD 4YMEA 4PRFA 3C14B 3MEGA 1JLQB 2VC0A 4CIOA 3CJKB 2CJYB 4FKXA 3MEGB 1F3VA 4XO0A 4JI8F 4EK2A 1SJ1A 1KKHA 3BBFA 4OJ3A 1VCTA 2ROPA 4C98A 5L1KA 6FD1A 5IS2A 2P9CA 3KK1A 2VBYA 1TV6A 3AT1B 4U7CA 4ED5A 1DTTA 3UCGA 3KK1B 2PC6A 1TV6B 4CLLA 1U8SA 5SUHA 5KG2A 2ZBPA 3DMJA 2AEFA 4NLUA 3DMJB 1U2CA 4URSA 4KBIA 2ZH6A 2B9EA 1XR6A 1G7CB 2O66A 1OJ4A 5GVQA 3QQCD 2DBBA 2QTWA 2LXUA 1T95A 3KXDA 2R8IA 5DQGA 2CG8A 3KJFB 2ASYA 4JI0F 2DYAA 4NYZA 4EBDA 2C2EA 4ZPWR 2XWYA 1UZHA 4KAIA 3B54A 1PILA 2APOA 3PRBA 4OLOA 1LWXA 4DCJB 4FDFA 2QRRA 2B7CB 3D7SB 1NJXA 4CLPA 4QPTA 4MAKA 2WVFA 4B02A 4DV4J 4O23A 1XMQF 3QGPA 1UPMB 1YHQS 5KG4A 1VQMS 4QCLA 2QX0A 3D2WA 1PBUA 2JFKA 1Q81T 4M5HA 2HVEA 4X4OA 2B8QA 3GV7B 3H42A 2D3OR 3MPWA 3D0GE 1CG2A 1N5QA 2CG4A 4KJIA 5MAOA 3H7HB 1VQ7S 3O5TB 2DHAA 3PR5B 2PSZA 3SSQA 4KE5A 3C19A 2WW4A 4RBUA 1URRA 2BVZA 4H4MA 5DO2A 3PR4A 2KM8C 3JSMA 1FNXH 4DS4A 1C0UA 4H4MB 2DISA 3CIZA 5K8PA 3JSMB 1XEZA 1C0UB 1JXEA 3HVWA 2OTLS 1WG4A 3FBEA 1IKXA 1OY8A 3OHBA 3CUNA 1S6QA 1YI2S 1IKXB 5BR8J 2E5LF 2HNDA 2HK2A 1B7YB 1S6QB 4ZPCA 2HNDB 2FY8A 2AF6A 3NLCA 4LR8A 2KRBA 2M7SA 3QT8A 4I4BA 4USMA 4WXOA 2HKEA 2QIFA 1Q8KA 4DUYF 2W8KA 1WOOA 2QLFB 3TQ1A 5LT5A 4NYPA 5KFPA 2DO0A 2KHCA 2AJQA 2OO4A 3N79A 2QT7A 2BJ3A 1YSJA 5JXSA 1YRXA 3TJ9A 1NH8A 1QUVA 4N7TA 3BO2A 5SZTA 2HQIA 4LFAJ 1SC4B 4DV2J 1T05B 4ANDA 5K8NA 2VKRA 3PCOB 4RPFA 1RZMA 1KQGB 4NPOA 2M88A 1KRPA 4MYTA 2RVJA 3O8WA 2DXEA 2P6TA 3SQGA 1R0CB 2QE5A 4MKYA 1SC6A 3KLEA 3SQGB 2MLYA 3KLEB 1TL3A 2J9CA 3NOGA 3AD8C 1MN7A 1TL3B 1YRTA 4YR0A 3QSIA 4J90A 3CCVS 3QRQA 2ZH1A 5KFDA 3L3CA 4ANEA 3Q8QB 3W3SA 3LF0A 2H48B 2Y1LB 3G9CA 2DNYA 2F5GA 4DU7A 1HNXF 4LSZB 2BUNA 3KHGA 3I56S 1Q1KA 1VQ6S 1WC4A 1VHFA 3DLEA 2HEKA 5C42B 3DLEB 2VFUA 1REVA 3GR0A 4K59A 3HMJG 2HZCA 1SL2A 1REVB 5E5NA 4ED6A 4WIQA 2FHJD 4TYBA 2PGCA 4YB5A 3R2CJ 2UUTA 4DWIA 3MCMA 3TEGA 3LP2A 3LP2B 4OX9J 3ETMA 4BDPA 4NLDA 4LRAA 1MROA 4MH8A 1IM4A 1MROB 2IDLA 2FQQB 3MM8A 3K5OA 2BANA 3N4WA 5DG7A 1B4SA 3MM8B 3TZWA 2BANB 1WKJA 9ATCB 4J9OA 4OYMA 4AXJA 3CCWA 1VDHA 2DY1A 1IXKA 5HK4A 3MEEA 2QYCA 1MW7A 4C4WA 3MEEB 4DV6F 3TAPA 2MZ1A 4KHPF 3LALA 1RSCA 4KSEB 3CC7S 5DRKA 1XN9A 3I96A 2VPWB 2OEJA 2UUCJ 2QSWA 2V4RA 1NHKL 4OI4A 4DR4F 1FRKA 2VIHA 1XMOJ 4QU7A 1DQAA 4IO9Q 1IR1A 2HRTA 2OPSA 3FNNA 2HIQA 2OPSB 5LSRA 2HS3A 5HSPA 1RABB 5D4OA 3ZO7A 3BDEA 5HVFA 4LF7F 4OJHA 4JV5F 2W9AA 1RI7A 1SIZA 4FKYA 2ZH2A 1RJJA 1WSRA 2KHDA 4DSIA 2FD2A 2H3EB 1IKVA 2UVUA 3GIKA 3CT9A 2VBZA 1IKVB 3AD9C 4F3QA 3NGDA 3THTA 2W4CA 2IJFA 5AE1A 3TNVA 1RHKB 3D6HB 4OI1A 4RLEA 2UUBJ 1JLFA 1S49A 3A8EA 1JLFB 4K2JA 2IYGA 3I0SA 5AE2A 3I0SB 2H4WB 5KFIA 2VOPA 3NCQA 4JI3F 3RRGA 4KHMA 3G4SS 1JB0C 2XI3A 5LL6d 1FHTA 1VQSA 4TN2A 1U49A 2MQ8A 2JOQA 2VQFJ 3BZQA 2EFNA 3IWLA 5KAKA 4BLGA 1Z2ZA 1U48A 2LQ5A 4JI2J 2W2OP 4IO1A 2FJXA 2D69A 5DGBA 1NB2A 2DR9A 2B3TB 3IG1B 1WNEA 2LEAA 3QWUA 4P72A 2Z8QA 2C3MA 3NAHA 4UUWA 3SCLE 2F4VJ 4ERDA 2OD6A 4CM0A 1H74A 3HVRA 2ZBQA 2UVRA 3CCES 2EXUA 1SH3A 4M5LA 3CGIA 5HMYA 3MURP 1FD2A 3BBCA 3ULHA 3BF4A 1FE0A 2JH3A 1FRXA 2VPYB 3CD5A 1KD1T 3OXLA 2DR6A 3LWLA 2IRUA 3KKFA 1FKOA 2ZNZA 4CI0B 1FKOB 5H9FK 1U8WA 3HD2A 1A0OB 4KV8A 1RT4A 4I6AA 2DITA 4HACA 4CYUA 5A0YA 3I4PA 4KV8B 1RT4B 1N5VA 5A0YB 4DL3A 3EGNA 1SKWA 4LVOP 4ELVA 1Y5NB 2Q1LA 4GRSA 4DHVA 2J76E 1KOOA 4DR7F 5FD1A 2WHOA 1K0TA 2KM8B 2MB0B 1X5SA 3J81U 1KHVA 2VBWA 2LEPA 3E8OA 5D6GA 3Q8RB 4E2FB 1JJ2R 5HQ8A 1CPZA 1HBOA 4A4JA 2DGTA 2HAIA 3CDBA 3Q0AA 1HBOB 2DEIA 4Y3CA 5ETNA 3IO1A 1NNDA 1SH0A 2F4FA 5KFOA 1FESA 3KK2A 1BC6A 3JYTA 1BLUA 1FX2A 2XMUA 3KK2B 1IWGA 3JYTB 2LEBA 3SV4A 4DJBA 1S1XA 5LXYA 5L39A 1TVRB 2IYIA 3QO9A 3CDWA 3OTDA 3SCIE 3J7ZT 4YFUA 3R2DJ 4WE1B 3QO9B 3PDNA 3SBMA 4DG1A 3JXOA 4L73A 4DG1B 3L9ZA 1S97A 3L7PA 4NLOA 1AUSL 2PMWA 3K5PA 3IC1A 4DOZA 3PW2A 3RYLA 3MF5A 1C2PA 5KT3A 2GX8A 3DKDA 4Q2MA 1RYRA 2DRAA 4K4WA 4RUCA 1YBAA 1UPPA 1D0EA 3KG1A 1HQEA 3FMBA 3LGHA 1JXVA 2ZNYA 3EZUA 2HHHF 1TL1A 1HQEB 3FZBA 4DF4A 2YWWA 2H54B 1XERA 3M8ZA 1TL1B 1D8ZA 1F1BB 1G4CA 4HI1A 2B43A 1UP1A 3IA0A 4C0BA 1B3TA 4AQYJ 4OHXA 4ZVEA 5F8GA 1EQ0A 4OZLA 1WC6A 1IBLJ 3M6WA 1RT2A 2I1RA 2LQJA 1FJGF 4OJGA 2DHGA 2XGPA 6FDRA 2F63A 2IFXA 1U45A 4EO8A 4DCPB 1YJ7A 1NSKL 4RW7A 2AJ2A 5HO4A 4CCHA 8AT1B 4RW7B 4UTGA 4C0OC 4I64A 1NJWA 4C3KA 1QDUB 4LQ9A 2J7UA 4MFBA 1ITPA 1RWUA 2EG2A 3PJXA 2N4CA 3LH2S 1M1HA 4MFBB 4DV1F 2JLGA 4FNIA 3GJRB 3GB0A 3BPSP 3DOLA 3ZZTA 1YDLA 3EE3A 4LF1A 2BABA 1D3WA 1E6YA 2BX6A 3CW2C 3CD7A 1E6YB 4ZVFA 2OEKA 1Q82T 1UL3A 5B0FA 3TA0A 2UXDF 2E9TA 3P5TL 3HJVA 4RW8A 4RW8B 5F8IA 2KN4A 2XLIA 1DZ5A 1BY9A 1X5PA 3BGRA 3UPFA 4IOAQ 3DI6A 1RKJA 4JI6J 3BGRB 2F8HA 2PA3A 3PJWA 4P71A 3DI6B 4JB8B 2E7VA 4CO0A 4USKA 1HMVB 3IR6B 5EX3A 2VKZG 1S72S 1HNIA 2JJ4D 4G1IA 3JQMA 3E2EA 4QQBA 3LGNA 4QIWD 1HNIB 4XK8C 4NLGA 2YNGA 4ZPDA 1WC0A 2V2QA 3D0IE 3W62A 4DF8A 2YNGB 1VRUA 4UF4A 1B7FA 3EICA 3QGHA 1VRUB 2IM0A 1FT8A 2G2OA 4ETZA 4YQWA 2BACA 2I6WA 3PM9A 1M0SA 3M6UA 1VQKS 2DNMA 4C8ZA 2LQ9A 1TAUA 1S6OA 3W2VA 1S1WA 4P2SA 5AXKA 3FGVA 3EMTA 2LU2A 3LAKA 2U1AA 1S1WB 5C24A 3J81j 3W9JA 4F2SA 5K8MA 5C24B 1N32J 1QAIA 2O5DA 4AXIA 3BM7A 3M8YA 4HH0A 5KFAA 3T6JA 4GO5X 5KFHA 2V94A 3DRRA 3DRRB 3PIOQ 4AD6A 1X5TA 2F9JA 3HHDA 3DGPB 2D9PA 2EWHA 4M5GA 1RHJB 1EJ7L 3DRSA 4PG6A 2H5EA 3V6JA 2DH7A 4F0HA 2YKMA 3I0RA 3DRSB 3OJSA 4EFAC 2OKQA 2LA4A 3MGJA 2PEBA 2YKMB 3I0RB 2AYMA 3KLFA 1HHTP 1XK8A 1FFGB 1R0AA 4WFAQ 3K0JA 3FK4A 3HI9A 1GX6A 3TVZA 1CQNA 1R0AB 1H2VZ 3HX9A 3MMBA 4I68A 3HD1A 4NMXA 1T8EA 1V3RA 5DDRC 2UXBJ 3MMBB 1KC8T 1SPBP 2MSSA 4U67Q 4YR2A 2VFTA 1KTVA 4X66F 4K4XA 3AQPA 2RD5C 5CCMA 2W24A 3N9UC 4DMZA 3WX4A 2MQLA 1V9OA 4NLQA 1PCAA 2QFIA 3EGVA 4M5KA 2UUAJ 3QJJA 4PZVA 4ECZA 4WTYA 1GTEA 1A6LA 1MWYA 3PXGa 2DR5A 1JJ4A 1QD1A 5ETOA 1MN9A 5F3TA 5AT1B 1SKRA 4M1KA 3MPYA 1V3ZA 1FWKA 5KG3A 3GYNA 1ZAWA 4RW9A 1SH2A 4RW9B 2MGZA 2E1MC 4UOHA 2XZDB 5F8JA 2VB6A 2MGZB 2OMLA 1P1TA 2Y1JA 2CXEA 2ATLA 4B9LA 1NKCA 5DDQC 4USWA 5IT0A 4F04B 4LFBF 4DL0C 1L3SA 2OH2A 3OV7A 3KLIA 1SC3B 3DN9A 1RT5A 4B3OA 5ETVA 2VA2A 2LP4A 4IG3A 2J6SA 3V6KA 4J9MA 3KLIB 3HZEA 4B3OB 4USVA 4IG3B 4TU7A 2KZZA 3K59A 5A8KA 2YKAA 2GO9A 5A8KB 1VBXA 2B6AA 2EK6A 4G3IA 2B6AB 2JLEA 4NL5A 4R0EA 5D0GA 3AOBA 1REGX 2E66A 4GVBA 2ZH5A 4GVBB 3AJDA 3FUYA 1DJ0A 4EYHB 2XSJA 2XSJB 2ILZA 3IRWP 5HJXA 3J7Z5 4FF1A 4HT5A 1NDLA 4NMLA 3UI3A 3RRKA 3R9LA 4J37A 2HMIA 4WFZA 3KUEA 5KFGA 2YXLA 3HDSA 2HMIB 4WYLA 2OI2A 3BKUA 1EAYC 1TUGB 5I3QA 5I3UA 1QJHA 3JTNA 2Z57B 5I3UB 4W90B 5HANA 1KTQA 4NEZA 3SSSA 1KNZA 2KJVA 3QAUA 3PYFA 1U09A 2ZFHA 5CAAA 1ICEB 4QU6A 3G71S 1D9FA 2KT5A 3DRPA 4CLFA 3DRPB 2OFHX 3QT5A 2QLXA 4UT4A 4PXBA 4KGVB 3R7SB 4FNHA 4NCGA 2OLWA 2W2NP 4NCGB 3P45B 3LPYA 1TKTA 4PKDB 4YN3B 5E3QA 1YRUA 1TKTB 4QR0A 3HT0A 3QBCA 3D1OA 1LWFA 4YDDB 4I7FA 4QIVA 5KFVA 4I7FB 4CDIA 4ZCKA 4D3GA 1U6BA 3CPWR 1RAHB 4ZN3A 4WIIA 2KH9A 1PSDA 1PO6A 2NQPA 3KFWX 3ISZA 1M5SA 2R7SA 2JLFA 2XQCA 3CE8A 3JS9A 4PAAA 2K2PA 3LQVA 1NRKA 2CJQA 3OTOJ 2W8LA 4JI5F 4QR2A 1VYAA 2YWEA 1SJ3P 1WHWA 4RU2A 4IKAA 1A7GE 2KT2A 3RB3A 2VICA 4UUXA 1U0HA 4Q7AA 1YJNS 2EG1A 3BKFA 1FVQA 2ATCB 4ZJQA 1VJWA 4HDGA 1KQFB 4B3TJ 2C2DA 5B0DA 3GU0A 2CWKA 4OYAA 2YX4A 1DARA 1Q7LB 2BRLA 3H5UA 3D5MA 1TR0A 2C3PA 2QL7B 4OZ5A 4N8OA 2IVFB 2V5HG 3HPOA 1ELOA 2A0FB 2J0WA 3Q2SC 1CC8A 1P1LA 1NJZA 1UVMA 2KJWA 2MKYA 3T1YF 4F7VA 3J7YU 4JYAJ 3BO4A 2CQPA 3QT6A 4N5SA 4C8NA 1PC4A 1SJFA 3J7A1 1F6TA 2XYGB 2V4JA 5EGYA 1M5HA 2V4JB 2B56A 3HFZB 3S1TA 1CLFA 2KT3A 2G0CA 3T5HA 2NREA 1FCAA 1JLAA 5IV3A 1Q0NA 1YBTA 1YGYA 3D4JA 1JLAB 2BQRA 2B9XA 4CO1A 5H9EJ 2LLZA 1QE1A 4UOFA 4OYPA 1YITS 4WF9Q 4X65F 4PXCA 3TARA 3GR1A 2QV6A 3NGTA 2FJBB 1Y11A 3M8WA 5IXUA 3PV8A 1N0VC 3OSPA 4TQRA 3EDQB 4QW8A 4OV6A 1ZM3A 4QYRA 4ZVOB 4WCEQ 1HI1A 3JB9k 4LJMA 1ZM4A 4EBCA 4FZVA 2HG4A 3T41A 4B3SJ 1RHQB 1SV5A 2HQGA 1O6XA 4FBTA 1FNOA 2POKA 1SV5B 2B5JB 1FNMA 3ZXWA 4TYAA 4WK1A 3AJ2A 2ZJQQ 3WC2A 3UQSA 2MQQA 2CPEA 3LO3A 3K89A 2RH3A 4OMFG 3W9IA 2YVSA 1UEUA 2AJ0A 2MKHA 4GKKF 1R7IA 4DEZA 3ZZZA 2YX1A 3OVBA 5KG6A 2HHPA 2X1BA 2HVIA 4LRFA 5LSLA 1S10A 3NBPA 5ETSA 3NBPB 2CADA 3ZTPA 4LR9A 2LCWA 4F02A 4K7QA 3ZC4A 2RE1A 2O3DA 1C0TA 2XMVA 2Y1IA 4UQTA 1C0TB 4C2MA 4DQIA 4AL6A 4KPYA 2FVSA 1TUWA 3D68A 5MLCV 2EFGA 3GFHA 1GH8A 2IMWP 2HQDA 1WEXA 4XIUA 3N5FA 3SZ2A 2UUWA 4K4ZA 3CCJS 3BBBA 4LF5J 3DXBA 2BJ8A 9RUBA 2G2YA 2ILYA 1H38A 4WU2A 4JV1A 5EWEA 5KG7A 2MQMA 2FPHX 3OLAA 4DUZF 2G1HA 2DGSA 2SXLA 2HGLA 3LA0A 1W7WA 1VI7A 2CDQA 2V9WA 4RUHA 2CDRB 3PO5A 2D3ZA 4DSFA 3NS6A 4B9TA 4ZPBA 4Y2IA 5KFQA 1WDTA 3C2PA 1TK0A 3CULA 2O1PA 3W5XA 3QFWA 4NLYA 4N77A 2AU0A 3BN4A 2VH7A 3W2WA 5J2PA 3W2WB 4ED8A 5K20B 4QJVA 5J2PB 1X4EA 4ZMMA 2FVRA 4Z37A 1R0BG 2AJ4A 3WZ0A 3U27A 1U24A 2MMYA 1RYSA 2X7IA 4WKRA 5AJ3J 3MMCA 1B0PA 2W2MP 3MMCB 4Q44A 4ZLJA 2ZZNA 3ZTQA 3VV2B 2CQIA 4RNHA 1FXLA 3DC2A 4ZIVA 1TELA 4FYXB 3Q8PB 2Y9HA 2QL5B 4K4TA 4DPYA 3HHLC 3R97A 1Q78A 3A4TA 2WVEA 2GQQA 2WBMA 2Z56B 2AGQA 4HTIA 2E9RX 4X62F 4ID8A 4L6V3 5B7WA 4A8KA 2KDOA 1ZTWA 1NMEB 1DBDA 3L7OA 1GFWB 4WBFA 3SQOP 2HNYA 2H65B 2NPIA 2HNYB 3B78A 3GIRA 2R7XA 3FSXA 3Q2TC 4DQPA 2RILA 2CIMA 2HURA 1R27B 3P3DA 1J5EF 2XO6A 2H4YB 2VL1A 1CJTA 3PX0A 1M90T 1LFPA 3MR2A 1CJTB 3GYXB 2KKHA 5E2QA 1UEVA 4ZJOA 1FFWB 1S1VA 4YS2A 2BR0A 2JDJA 4K4SA 1S1VB 2V2KA 1EHWA 4RNOA 2BV3A 1RWOB 1H2TZ 2M9KA 2ZH3A 3D67A 3CNQP 1N33F 5KFFA 2KRRA 1OYDA 1XQIA 1H0HB 1PG5B 2L9WA 5KFCA 4C3LA 3KHLA 4FYDA 4C97A 4DX6A 4HHHA 3TAQA 1RHRB 1ZPWX 2ROGA 3KJVA 5LMUJ 4Y2AA 2O01C 3M2UA 3KJVB 2PIIA 4MKAA 3M2UB 3RW6A 4ZCMA 3CJ4A 2VD3A 5HLFA 3VGUA 3AOCA 1WKLA 3AY0A 5HLFB 2VASA 4KHPJ 3VTIA 4FF3A 2QSFA 4NXMJ 2DT9A 3PYDA 5U47A 1VBYA 1N6QA 5CHCB 4ENOA 4F0KA 1N6QB 2QN6B 1KDNA 1Q4RA 2Z2YB 1X0PA 3FRYA 3S01A 4ZVSB 1TMMA 1GXTA 5CD4H 2MQNA 2RHQB 3UVJA 2DGXA 2XSFA 3UVJB 4GMKA 2IC3A 1I6JA 4ELTA 3UO0A 1RWNB 4O3SA 2IC3B 1Q53A 3TUJC 2B4OA 1HW8A 1WHXA 4NLTA 3G8SA 4ZLNA 4DL4A 1PKUA 4J9RA 3QRPA 3CCRS 3VVTA 1MU2A 2ZHOA 4O4GA 4OL8A 3O6QA 3BV8A 3I5BA 1MU2B 4K0KF 3MPDA 4O4GB 3OR2A 3GG0A 1B99A 3OR2B 3CJSA 3CIMA 2AGOA 5DM7Q 1XNQJ 3NNHA 3EGWB 1ZZNA 4EUVA 4U9RA 1M1KT 2DCUB 3LANA 4S0MA 2MKJA 2DNHA 1Q79A 4HDHA 2R4FA 2ZM6F 1U6FA 5A6WA 1ZH5A 2PD1A 1FX4A 2W4DA 2V50A 3KLHA 3RJMB 3KLHB 4IQXA 5HMWA 4CT9A 2OPRA 3OL7A 1BWVA 3UR3C 2OPRB 1OMSA 4LVNP 4RUBA 1NK9A 4FXVA 3OD2A 3R5GA 3FZ2A 4GKJJ 1PJ5A 4JI4J 2XS2A 2HSEB 3CJQA 5CXTA 3H59A 2MEWA 1UVKA 1ZETA 5F0UA 1AT1B 3N01A 1FDNA 5FLXU 3PVXA 4O3PA 2AP6A 1NEEA 4PQAA 3AODA 2FB0A 4DX5A 2QYGA 1B70B 3QZ7A 1IBMF 3US5A 3HLUA 1MNEA 4NXNF 1LK7A 2HBQB 4ZK7M 4O3NA 1FWLA 3F41A 2WK4A 1S0VA 3T1HF 2P9GA 3AXKA 3EUNA 2QC3A 1HNVA 3O44A 2JL9A 3LTOA 3N6LA 4DR6F 3D3BJ 1HBUA 1HNVB 1HBUB 4L76A 2ZH4A 3H2LA 2W1BA 1HNZJ 4TU8A 2CPXA 1LNQA 2VG7A 3MWBA 3GSDA 3TVKA 4TVAB 2VG7B 4J9NA 5CCLA 5F8LA 1FDBA 1N54B 2RUSA 4WFBQ 2QGFB 2QLJB 1S0MA 3KLGA 5D77A 2RF2A 4CH0S 1EKSA 1UKUA 3Q24A 4CT8A 3KLGB 2RF2B 2CPDA 1HR0J 1RACB 4C7QA 5DQHA 3NG8A 3IM9A 3CD6S 4N8NA 5DDPC 3MM5A 2W01A 5D0EA 1UVNA 4KR0B 4FN5A 3MM5B 3A8JA 5DLGA 1N52B 3CCMS 1RT3A 2FZGB 1GMWA 2BJ7A 1RT3B 3C6TB 4ITSA 3GE9A 3ILJA 4HT7A 1NSAA 2IDEA 2IM1A 1PAEX 1P8GA 2VG5A 3HO1A 2EKNA 4A8QA 4ZCLA 3CTRA 1WD6A 3H2VE 4WYWA 5DG9A 3IMQJ 2RU9A 3LGMA 1XWLA 2ZEJA 3OJUA 4OLPA 4K4UA 4TU9A 1T3NA 2AIRB 4DQSA 2HS4A 3HHLB 2PT0A 4B9NA 3CVKA 4Z7CA 1D09B 4F0MA 2WSEC 1XC9A 2WVBA 1O8BA 3A3NB 2DVIA 1SBRA 3G86A 2XLKA 4WK3A 4ZVPB 2DGQA 3TZZA 2DR7A 2HFZA 1C4CA 3QLHA 4DR5J 1JJCB 3DLGA 3QLHB 3DLGB 5GAHU 1YWXA 3ILOA 3EPGA 1VC6A 1SCJB 4DN9A 3M6XA 3OL9A 4Z7YA 2EFQA 3HSGA 1A9NB 2JZ5A 3RAMA 2MPUA 2YNFA 2KTQA 2BBEA 4F4AA 2YNFB 4DV4F 1OPIA 4XDCA 3ZTRA 3KNGA 3DDNA 1KHWA 4N56A 1SQEA 5ETKA 3IS9A 1LFWA 2QA1A 4O44A 3IS9B 3UE2A 4O44B 1H7XA 3MCNA 1S6PA 4P2FA 2IHR1 1N34J 4L3NA 1S6PB 4B3MJ 3GG1A 1SJQA 2BOPA 5IQ6A 3DOKA 4C11A 3O1LA 3CCUS 4WFXA 2DK2A 1XIQA 2XEXA 3DOKB 3HSDA 4C11B 3W66A 1TL5A 4JBCA 2B4PA 1T11A 3SXLA 1SJRA 2GFFA 2ZDPA 3KMQA 3DU5A 1OO0B 2RQ4A 1N5TA 1F5AA 1X4CA 1IUJA 2W2PP 3MMJA 2FLLA 2HBRB 5B0GA 1YQHA 2COLA 5BR8F 2E5JA 3RGIA 4B3RJ 3JTPA 4KKOA 3CJRA 2MTLA 4G65A 2OSRA 4KKOB 3BSOA 3GJQB 1JWWA 2R7TA 1MG7A 5AXLA 4P9SA 1R8BA 1BQNA 1J5OA 1FKPA 1BQNB 2BKOA 1J5OB 2L9DA 1FKPB 5AE3A 1QVGR 2L08A 3E51A 4OI3A 4URGA 3OLBA 1SIWB 4HR2A 2DNKA 1GX5A 1FJCA 2C2ZB 1S48A 4I2QA 2J7WA 2ZOGA 4OYXA 4I2QB 4DXLA 4LF4J 4C8YA 4ZVTB 2FVCA 1P6TA 3ZZPA 1PAUB 4LFAF 4DSLA 2M8DB 1EZZB 5F9NA 4DV2F 4LF6J 5JVHQ 2IVMA 1OQ3A 5IC4B 2LDYA 4ILLA 4F2RA 3ADAC 1JIHA 2XI2A 1GEHA 1FI4A 1CVJA 1Q5YA 1R8HA 3D1HA 3KJNB 4LF8J 4LIRA 5HJYA 1WUUA 4JP8A 4JI1J 4RO0A 1NJYA 3H2UB 5BYSA 3L95X 1X31C 2ZKUA 2GHWA 2RRAA 1V6HA 4Q8FA 3GTYX 4X64J 4PQUA 5A2QU 2YWHA 2HVDA 2K06A 4PQUB 2CZVC 1TL7A 2BKNA 2NLWA 1TL7B 2VG6A 3WIVA 2YQ1A 2CYYA 2VG6B 2HHUA 1R8CA 3HHKA 3M4XA 1LEOA 4DLGA 4EU0A 3F73A 4J5OA 3DGVA 1AXQA 1U47A 4IRDA 3EGZA 3DOMA 2AMCB 5E33A 3DOMB 1YVFA 4H4KC 4Y65A 1VFJA 1NDKA 3TQEA 4D3HA 2RU3A 4OX9F 4I67A 3TZYA 2L3MA 1TTHB 2ASDA 2R7WA 1W26A 1SB6A 1QY7A 1UFWA 2QFJA 2UU9J 2J9DA 3JSBA 4UQGA 3Q8YA 4OYOA 5IC6B 1TK8A 4IR9A 3ZFVA 1EETB 3GJSB 1IKWA 2JVOA 1IKWB 1IKYA 3NWRA 1YJ9S 1H3DA 1X4BA 1IKYB 2ZE2A 2ZUAA 3CO9A 4BWJA 3NGKA 3VGTA 3R5JB 5THWA 2ZE2B 1SKSA 1IQZA 2DGWA 2DHXA 3PO4A 2VONA 4F25A 2UUCF 3U1MA 3JTOA 2CRLA 3SCKE 4NA3A 1RQ0A 1WEYA 3J80Y 3VALA 1FA0A 1XMOF 3WX8A 2AYGA 2C2NA 3IBCB 3G8TA 4CTAA 2IAJA 4CTAB 2IAJB 4PPDA 3BKTA 4P7VA 1K0VA 2D74B 4ZP9A 1VK3A 4ZKAA 1BE4A 4KGMA 1H72C 2XZWA 1HQ2A 4USIA 3DHWC 3HJFA 1DTTB 4NLWA 3L7UA 1M5VC 3M9MB 3VWSA 4OQJA 2R7QA 1UTAA 1R43A 4KGXB 2M2BA 3RB4A 2UUBF 1RT6A 2N82B 3ETOA 1M5OC 1RT6B 2HVHA 4YDXA 2MJUA 2E1RA 3OT9A 2FHJA 4X4QA 3F44A 3MAQA 1RU1A 1S79A 2NYHA 4ZOSA 2EVZA 4PG4A 4P6QA 2X1FA 1WG5A 3ZZRA 4DV3J 2QA2A 1TU0B 1NAQA 3MAHA 4YHHJ 1ROFA 4DUTA 3K17A 1RUSA 5L9NA 1L3KA 1WTFA 2VQFF 5K14A 2FVQA 4RNFA 2XYPB 5H9EK 1MSWD 1KVKA 1YJTA 5K14B 3FEYB 3FKBA 4JI2F 4ED2A 1N5SA 2Y1RI 2AZ3A 1N36F 3G6ES 2XG8A 3MUVP 2RMLA 1YJVA 4WP9A 2R2TA 3L09A 3A12A 3HXMA 2HZVA 2RS8A 1O5JA 4M5IA 3UCZP 2F4VF 3KOAA 2H51B 3VVUA 1VOMA 2ZC3A 1TKXA 5K5MA 1TKXB 3UD4P 3CCSS 3ENQA 1PBAA 2CAJA 1QTNB 3C16A 3GPAA 4Y6IA 3FQLA 5A8RA 1GTHA 2OHDA 3C16B 5A8RB 3OW2R 1SL1A 1DY3A 5F0WA 2RDIA 5EWFA 4RBVA 3UR0A 1H73A 1U1NA 1RWWB 5DS7A 5D4LA 4I69A 2VFRA 2V67A 4R25A 4KY3A 1RK8A 2XGQA 4ECUA 4M5MA 4FS1A 2HZAA 4EI2A 3OVAA 3SV3A 3QFHA 5FIIA 1FTCA 4HYKA 2XS5A 3R3TA 1KQSR 1BUXA 3IWNC 4FVMA 4ECYA 4DR3J 2E44A 1LXNA 2QJ3A 3RB0A 4NZ7A 5BYRA 5B09A 4FXDA 1HARA 1FRJA 3D6FB 3CJ2A 3KTQA 1R6YA 3D66A 4P10A 4MKVA 5EWGA 5GAGI 1FERA 4EBEA 3UWTA 1RA7A 2I38A 4OX6A 4OHVA 1JLBA 1YIJS 4J9VA 1JLBB 3E3XA 4LREA 3CJ3A 4LFCJ 5AXMA 3OL8A 4MIWA 3TWZA 3HT3A 1T9WA 3FBCA 1R8PA 1U4BA 3C6UA 2J6UA 2FJWA 2GJIA 5KFZA 3G82A 2YPZA 3DU6A 1HBMA 2FGCA 3C6UB 3RBXA 1KN6A 4ED7A 3G82B 3BQ1A 1HBMB 1OY9A 1RE1B 1QSLA 2PO4A 2KXNB 2ZH7A 2LQ8A 5DGAA 1QTMA 2P8IA 5L46A 4AQYF 2CJAA 2Z2LA 3FSYA 1F5BA 4PWUA 3N6MA 3PACA 4ZP6A 5KFXA 1V5VA 1IBLF 2LFVA 3PG9A 3ZZ0A 1TL4A 4N41A 1ZOTA 2JSXA 3DM2A 3DM2B 2NPFA 4JV2A 3D6TB 3C15A 1O51A 1X9SA 3C15B 3QPIA 1M5PC 4RKUC 1D9AA 1T0TV 2VDHA 1QSSA 4X4RA 2R2RA 2KYZA 3IXQA 4QWCA 3GFZA 2N7YA 2UP1A 4PYAA 4F8RA 3MR5A 4MKBA 5H9FJ 2ZVIA 4ED3A 4H4KA 2GVZA 2XS7A 3CMES 4B9VA 2ERRA 5CZXA 3K2YA 2VC1A 4LRDA 4R0JA 3VAGA 1X4GA 2D3O1 3W5YA 1NPKA 3G6YA 1EARA 2J6TA 4PXEA 5HMXA 3OSNA 4M5JA 2FYXA 1VBZA 1I94J 2IBOA 2B8PA 4ZS6A 3R5CA 2DPJA 1Q8IA 1LKZA 3C46A 4JI6F 3V6HA 4OYWA 2ZOFA 3NAIA 2HYIB 3JSRA 3E01A 3IGNA 4EZ6A 5HAOA 3E01B 1D8YA 2IM3A 2C2RA 4LF9J 1SKUB 3R5AA 1T9XA 2XMAA 4TXSA 2MQOA 4Q2LA 2Y0SD 4KRWA 4CLKA 3GIIA 5E7OB 5C2CA 1NJIT 4Y28C 2VQEJ 1WACA 1U1LA 1TKDA 2AWZA 2C42A 3NMAA 4C3MA 1NXIA 3Q8SB 4LF2A 4DV7J 5JJBA 1VQ5S 3AOAA 4A48A 4DPUA 1YZ6A 2DEJA 4ZVUB 2C28A 1K47A 2R8KA 2A1BA 1PJ7A 4I1TA 1N32F 2V8GA 2VFSA 1IWAA 2F40A 2MDAA 4IFYA 3FVYA 1JQGA 3ZZUA 4IFYB 2W4PA 1P9YA 2L9NA 4DFKA 4YY3J 4QOTA 1F3FA 3AFGA 3PYGA 5E3AA 2H9ZA 2D9OA 2FHOB 1S7HA 1HWKA 2ADCA 1CEZA 2D1CA 5CA5A 4K4VA 1Q8LA 4LSLA 3K5MA 5DM6Q 4LSLB 1ZAXA 4IOBA 4IRKA 3IRXA 5ETRA 5LMNJ 3IRXB 1NB7A 4I6YA 1UJ5A 3DLJA 4DCOB 1Y0HA 1YLXA 3CWJA 4UY8T 1JKHA 3OL6A 3S8SA 2UXBF 4C6AA 3H98A 3PRVA 2HHTA 1T3OA 2EPIA 1JKHB 5G4DA 4XTTA 3PY8A 3OTEA 4DL7A 4AT1B 2QMUB 2FJDB 3RBDA 4P7TA 1RAJA 4MK9A 2LVWA 3OTBA 2J8AA 4NA2A 2UUAF 2GJFA 1NUEA 5GAGU 2LYVA 2KB2A 2V2VA 3IR7B 2GIFA 2XC9A 3RTVA 3AJ1A 4JI7J 3QJPA 5D3GA 1N4LA 1RWMB 5D3GB 1CJVA 2DTJA 2NS1B 2R8GA 1HNWJ 4EGLA 1CJVB 5C2GA 5ETTA 3CSKA 4HACB 4CYUB 1HWIA 2OP5A 5IT9U 1GK8A 4A47A 5CZVA 1MWZA 1BQXA 1S99A 2MSTA 3THVA 1Y00A 3GZ7A 3MM9A 4U8VA 3NXZA 3MM9B 1P9QC 3EDRB 4QYZJ 1UMJA 3MEKA 4LRCA 1HW9A 1P27B 2WZ1A 2JWNA 1HD0A 4QPXA 1VC5A 4FPIA 2MKKA 1NLKL 4DSJA 4EYIB 3I9ZA 2YPYA 4JV0A 3TYTA 2R3VA 3BSCA 5GADI 4KTQA 4NASA 3FFIA 3QJLA 3MXHP 3FJ2A 1BXNA 1YJWS 5F41A 2ZWPA 4UOCA 4LBHA 1S1XB 2CNKB 3RG6A 4DV0J 2GA7A 4DL5A 2BQUA 1ZA2B 3M8SA 3VCDA 1APSA 2XMMA 4IH5A 4O3RA 1WI8A 4X4TA 3OQ2A 3LP0A 2RUGA 4ED1A 1K8AT 2Y8YA 5EDWA 3LP0B 1SQFA 3OPKA 4WU3A 2I0XA 4PG8A 3CXCR 3KDOA 4CLWA 2WB1D 2LXFA 2JNJA 4HHUA 1UWBA 2NXUA 1JLGA 1H7WA 1UWBB 2MQPA 1JLGB 2JEFA 1RTDA 1LOUA 3R7NB 4AE5A 3U7JA 1RHUB 1FJEB 1X4FA 3T9NA 2F3JA 1RTDB 3RRHA 5E41A 2BYCA 1RHMB 3EXCX 1RT2B 2M70A 3I55S 2OELA 2XMJA 3LUYA 1VISA 2IJNA 1NKEA 1G6BA 4ZVHA 3I82A 2J5AA 5HATA 1FRHA 2VBXA 2J7KA 3MR6A 3NRBA 1X4AA 2GS8A 3EX7B 3MR7A 1NK0A 3BSNA 4YB7A 1CC7A 3C66A 4A8XA 4KH0B 2M5YA 2H5JB 2VV5A 3V4IA 2BZ2A 2HHXA 3V4IB 1V3SA 3R1LA 2MY8A 2DXDA 2AZ1A 2CZ4A 3DOLB 2V68A 2DNRA 3O2IA 4WP3A 3T9ZA 2XLJA 4BC7A 3U1LA 1X7VA 3T5JA 3GILA 5KFEA 2XHWA 3OTOF 1GMWD 1NK8A 4FBUA 4DR1J 3AD7C 2KG1A 5B08A 3HM9A 3ONQA 4F36A 2Z2ZA 2GW8A 3D1QA 5CH7B 4MTPA 3IM8A 4Y2CA 3I6PA 1FO1A 3A8IA 4P75A 5HVGA 4NLRA 3TA1A 3HHLD 5JVGQ 4HVZA 4B3TF 3F56A 1UETA 3R7BB 5T14A 5RUBA 5J1NA 3NEKA 3N28A 1IBKJ 1QUPA 4ID5A 3H4BA 1G1XA 2ACMA 4NX9A 4ID5B 4V1Ak 3SMZA 3QGGA 4CLSA 3VAIA 2UVVA 3GIMA 4IG0A 1RAIB 1CJKA 4IG0B 1EQMA 1KFDA 5I4MA 3W8PA 2G0JA 3WDOA 1KFSA 3W2VB 2Y3YA 4JYAF 5KFMA 3D28A 3QNWB 1TP7A 1KEKA 4CLZA 5B0AA 4MK8A 3MUTP 2L48A 2QZ8A 1PYTA 3OBIA 3RUBL 5M2UA 2NSBA 5KT6A 1LQ9A 1Y5LB 2K7JA 2BA9A 2UV8A 3BEGB 4CH1A 1W2BR 5J2QA 3PKMA 1RISA 4A8OA 1AA1B 3IBWA 5J2QB 5H1SV 5T7LA 3A8KA 3MD3A 3I87A 5T7LB 3T6BA 4DSEA 2PDAA 3M05A 3HSZA 5IWAJ 1UJ6A 2HHSA 4DFPA 2K1RA 3ZTOA 2K1RB 1VIXA 2CQ3A 1OS5A 5KOWA 5DZ7A 2ZZMA 4NCAA 3KLFB 1WC5A 2CNNB 1XMBA 5FDLA 2X51A 1YKWA 3H20A 5FDLB 3QRRA 2YNIA 3D0HE 1R89A 2K3IA 2MXYA 2YNIB 1RLCL 2GHVC 3KHRA 4UY85 2LU1A 4B3SF 1F2HA 4CLTA 1NO8A 2HAFA 3J7YI 5JMNA 3D3CJ 4OZ3A 5GADU 1VRTA 4UW2A 3K8VA 4OV1A 4N76A 1VRTB 1UW4A 2IPOB 4RBTA 5G0RA 4OZ2A 3RZAA 3R5DA 5G0RB 1LW0A 2HWHA 3ZNUA 1WELA 1LW0B 1T9VA 1FE4A 3M1VA 3CCLS 4LMZA 3M1VB 1XNRJ 5DDOC 5CD4A 2RDDA 1I1GA 2XCPA 4ECXA 2CUYA 1S5ZA 2HIYA 1S1TA 1OSDA 1RT7A 1S1TB 1T94A 2PN6A 3ILIA 2EW9A 4EZ9A 1RT7B 1EB0A 3NGRA 4DFMA 3VQSA 2X1AA 4PWDA 3CDAA 1IVZA 1FEHA 4PWDB 1L5UA 2QO3A 1RT5B 4GC7A 1S76D 4P73A 3VR1A 2NUHA 2LA6A 1IJEB 3POTA 3LAMA 1RT1A 1K9MT 2VJUA 1GMVA 3POTB 1TFYA 4CWBA 4E8UA 1RT1B 4LF5F 3BSAA 1K1SA 3KNAA 4NE9C 4ECVA 8RUCA 5EHHA 2NXJA 4J9LA 3BN7A 2R2SA 2FC9A 2D3UA 3AB2B 2EK1A 3JQJA 2MKSA 1HBNA 3MOZA 3TUPA 3Q22A 1HBNB 1YTYA 1DFDA 1VRQC 1IM6A 1VQLS 2VU5A 1XBWA 2Z58B 1UCNA 3HKZD 4ZDNA 3SSRA 4MIBA 3V4MA 2DNPA 4X4PA 3O3LA 4DV5J 3BB5A 5KTQA 1FVSA 2V34A 4URQU 3PNIA 5ETLA 4GO7X 1QSYA 1HI0P 4PYDA 4FYVB 4ES1A 3GIJA 3MM7A 3U02A 2E5GA 2HGMA 3BH7B 2ZVSA 3MM7B 1WC3A 3PJ9A 2YKNA 3NNCA 5CABA 5EX0A 4DR2J 2YKNB 4O0IA 2XY5A 4C48A 5AJ3F 4USTA 2B9YA 1N8RT 2HQ3A 4ED4A 3QWPA 1KSPA 4KO0A 4AFFA 1HQUA 1GQEA 3T3FA 4KO0B 4OHZA 1HQUB 2HQCA 5KFKA 4Q0BA 2XM3A 1T05A 4Q0BB 4C9DA 4ZP8A 3RR8A 3PW5A 3TEHB 5A2QY 1JJHA 1LWFB 2UXCJ 3BGUA 3HP6A 4GC6A 3BH6B 3R6LB 4RW4A 3MR3A 1RWXB 3PKYA 4KT0C 4RW4B 3MFHA 4YR3A 3NS7B 1JLEA 3QYYA 7FD1A 1JLEB 4M5DA 3FSIA 2XMKA 2W7OA 4M5DB 5GAEU 3NS5A 4RZRA 4ES2A 1QAJA 4RNMA 1AROP 3JAMY 5KFLA 3H0PA 1AFJA 1VQOS 5D0RA 2C22A 3DRYA 2AHOB 2W7PA 2NZ4A 4ZIWA 2ZJRQ 4DPTA 1DHMA 3GP9A 3TANA 2ZD1A 3B8HA 1S6UA 2ZD1B 2ZDOA 2Z2MA 1Q16B 2N3OA 2DIUA 4J9KA 1U0HB 2R7OA 1VBKA 1MWQA 5HL7Q 2GIRA 1DLOA 3FRZA 2MLZA 1DLOB 5C42A 1X4DA 1FWPA 5L38A 5I42A 2PMHA 5I42B 2OPQA 2CPJA 1N0UA 4DPWA 5B0EA 2OPQB 3CCTA 3EZOA 3Q8VA 2M8HA 2XMWA 1RAEB 2FHMA 3NCRA 4OX7A 3RAQA 2HBZB 1NK6A 3T5KA 2AV5A 4OHWA 4ZA1A 2LKZA 4WKYA 3VAHA 2D41A 5D15A 4ICLA 1CJUA 1WOPA 3DDKA 5LMUF 2V0NA 4ICLB 1CJUB 5F3ZA 4Y2KA 4FP9A 1PIEA 1HFEL 3PIPQ 4K5SA 1YK9A 2BJ9A 4C8OA 4A8FA 3SEOA 3UN2A 4NXMF 2IJRA 2JX2A 3UDEA 4F3MA 3IGVA 2GAGC 4X4VA 1QE1B 2FHKA 2CVEA 1B0VA 2WOMA 1EKRA 2HRUA 2BRKA 2FJEB 7AT1B 2N7CA 3HKWA 1KLMA 1HKAA 2WOMB 2HHWA 1PC5A 1GAOA 2CZ9A 2IBKA 1KLMB 3OTCA 2JC1A 4J9SA 1JLCA 2DNNA 4PUOA 4J7CA 1RP5A 5F8NA 1JLCB 1YZ7A 4JI8J 3GQCA 4PUOB 5IM0A 4EWTA 3P96A 3T1AA 3QSYB 5IM0B 2BKPA 3T19A 3I5AA 2CVIA 2QLWA 4PR6A 1ZM9A 3AHPA 4F4YA 2G9OA 1MMNA 2CQBA 3AAWB 1FTRA 3R27A 4IR1A 4QIFA 1RWPB 4R8UA 2CQHA 1RDRA 4R8UB 1UW9A 4M94A 1IN0A 1WTBA 1HLWA 1KONA 1XNQF 1KQKA 3GV8B 4ZITA 4WZMA 2YNHA 2XNRA 2YNHB 2AYBA 3HHEA 4LIWA 2FZKB 4JI0J 4J91A 3I31A 2FJAB 3MDFA 2GJ2A 3G87A 3EXYA 2P2CB 2OFGX 4RUAA 3M30A 1U1RA 3M30B 4NA1A 4DQRA 2CPIA 2XHCA 1M5KC 5E0OA 1D1UA 4ZLPA 2FY1A 2ALZA 1S9FA 4NOHA 3AXMA 4W98A 1F0XA 1C1BA 1UVJA 4GKJF 1XMQJ 3IG1A 1C1BB 4MJKA 4P74A 1N36J 2OJ3A 4JI4F 2CJXB 3NP5A 1WF1A 3CC4S 2V2ZA 3V6DA 1RTHA 5DJBA 3W7BA 2RKIA 3PW0A 3V6DB 1RTHB 3U1NA 2RKIB 3P49B 4EO6A 1DTQA 2N4DA 3QT7A 1DTQB 2CWXA 4L3KA 4KGKA 2RSQA 2UVWA 3BGLA 3D54A 3TI0A 3ISNC 2C1EB 1NCLA 3UDCA 4B08A 3PX4A 3MCOA 5KOXA 1RXOB 3ICLA 1PYOB 3C8YA 3OUYA 2NCKL 3QATA 3OUYB 4V19J 2DNLA 2YKQA 2E5LJ 2N3LA 1HNZF 1UVLA 4P2MA 1VK8A 3TO8A 2OAUA 3WC0A 4OJ1A 4K50A 2VPXB 4DUYJ 2A2DA 2FTRA 1U2RA 4DPXA 1SL0A 2YTCA 2ZOMA 5KG5A 2I9SA 5D78A 3NY0A 1XR7A 1HR0F 1VGYA 3FCVA 2R7UA 5L1JA 3CCZA 5CQGA 2C3OA 2Z0GA 2DIVA 2WTFA 1K73T 3G6XA 5LXRA 2R42A 4YUDA 2YKPA 5HMZA 4QZVB 2K8GA 4RR5A 1NK5A 2HNZA 1DRZA 3R8YA 1SJ4P 2GQCA 2ACYA 2GVDA 2HNZB 1TVRA 3GCXP 2GVDB 5HQMA 4WE1A 4BS2A 4IOCQ 2XTJP 3AA8A 4NLVA 4A8YA 1F5CA 4A8WA 3CJ5A 2J0XA 2CQGA 5LOQA 3PFEA 2GHPA 1J27A 2P9EA 3UNGC 2KO1A 2WONA 5IT4A 2J0QD 1S4EA 2KL8A 3FEXB 3GMGA 3TJAA 2WONB 2FLPA 1YJRA 2MYFA 3PEJA 4Y34A 2Y8WA 1YBUA 3KWMA 4U7UK 2V9KA 3W9HA 2AEJA 5KG1A 3VAFA 1HNXJ 4DR5F 2DNGA 2KU7A 1FXRA 2HVZA 3NCPA 4B17A 1EIYB 1U7LA 5BYQA 2FIUA 2YWGA 2MHNA 1U26A 2W7AA 3K58A 1AFIA 4C0HA 2RQCA 2KXFA 1U1QA 4F4KA 4DSKA 1VIOA 4AL5A 2Y0BB 2ALYB 3VF0B 3BR8A 1HWUA 1Y7PA 1N56A 2DHSA 3OFFA 1BWEA 2W2QP 1N88A 1TMJA 2CQ1A 1X9WA 5ETPA 3TR5A 1KS2A 4MK7A 1K1QA 1N34F 4J9QA 4B3MF 2V69A 2ZH9A 5E3RA 2YQ0A 2KZMA 3B6BA 2AYEA 4CLUA 4B9UA 2QMWA 2BE2A 3EVWA 1BD6A 2RAQA 3V81A 2BE2B 4RW6A 5KT4A 4DV6J 3V81B 3D6MB 1VS3A 4RW6B 4RX6A 3DLKA 1WKKA 3HVAA 3DLKB 2VODA 2J9DE 4CO3A 3W64A 2GO8A 3UCUP 5GAHI 3M9OB 1ULRA 3THPA 2XULA 2R9LA 2DB1A 4B3RF 2GMJA 4DR4J 4WP8A 3GFYA 3KDNA 2AEMA 3HULA 2BW2A 2CPHA 1NK4A 1HMVA 2VF3A 2V8PA 2VDIA 3QIDA 4QIEA 2JVRA 1RAGB 3K5NA 1UVIA 1PGZA 2NXEA 2WRMA 4ANCA 2OGUA 4XDDA 2CPYA 3IR5B 4LF7J 3GONA 4UZCA 3DRXA 4JV5J 3Q83A 1T9YA 4QYZK 1T9UA 4FS2A 2VUGA 2EFPA 1EP4A 2ADBA 3S7RA 2PI5A 4LUBA 1EP4B 2CJKA 4LF4F 1WF0A 3CO0P 1W2IA 1NU4A 4LF6F 4OYZA 3H5YA 4FF2A 5HROA 3EJMA 2LMIA 5HROB 4WTOB 2QLBB 5GMKa 1DAXA 4ECSA 1XR5A 3UN5A 1IR0A 2V6AA 2GC8A 2MY7A 4ZPTR 2HFOA 1FJ7A 3JSYA 1VQPS 5DETA 4LF8F 4OX8A 4NYOA 4OZNA 4NCBA 1R3NA 4WWSA 5L1LA 4JI1F 4JI3J 3EVOA 1FRMA 4X64F 4HKQA 3DGPA 2Q43A 3OVSA 5E3PA 2CQ4A 1NDPA 1FRLA 2PFDA 2XMTA 2RJZA 3Q89A 3X1LB 3BR9A 1LXJA 1VQ9S 4B9MA 3TW0A 4X84A 4DL6A 3DFEA 1U1KA 2AJ1A 2ASLA 2AJFE 3W8GA 3OR1A 4OYIA 1F60B 2JC0A 2YKOA 3OR1B 5KFBA 3OXGA 2Z30B 5IV4A 3M6VA 1NZ8A 4ZN1A 5KT2A 3ENVA 2C2KB 1U1PA 5IT9Y 3PHEA 1RTZA 4NLSA 1FFSB 2AX1A 1WORA 3F0NA 3I5CA 1OQ6A 4DBQA 2GIQA 2ZC4A 3CEDA 3J81Y 2IRYA 1HD1A 3TJ8A 5M2PA 2UU9F 1SXLA 3TZXA 4U96A 2KFNA 4FYYB 3WBZA 4EEYA 3M2VA 3EYZA 1B0TA 4IH7A 4IRCA 3DXSX 3M2VB 2GMLA 4ZVGA 1U2FA 4OI0A 3VZIA 1WI6A 2F8EX 4ETXA 3V2UC 2OSQA 4CO4A 1URNA 2CJ9A 2CQCA 3D9BA 1EX8A 2X3GA 3VAKA 3EZ5A 5ETMA
chains in the Genus database with same CATH topology
4I6YA 1UJ5A 2FPHX 4IFVA 3OLAA 4DUZF 5GVQA 3DLJA 2DBBA 2DGSA 2SXLA 2LXUA 2HGLA 1KLNA 4IFVB 2ZH8A 2E9ZA 1T95A 1Y0HA 1VI7A 2CDQA 2R8IA 3CWJA 5DQGA 2V9WA 4UY8T 4RUHA 1JKHA 3OL6A 3S8SA 2UXBF 3PO5A 2ASYA 2D3ZA 3H98A 4JI0F 4DSFA 4KFBA 4NYZA 4EBDA 1T3OA 5J1EA 2BJDA 2EPIA 2DO4A 3NS6A 4ZPWR 2C2EA 1JKHB 4B9TA 2XWYA 4F4XA 4KFBB 4ZPBA 1Y9OA 5J1EB 4G1QA 4Y2IA 5KFQA 2HLUA 2EBEA 5G4DA 2ZJPQ 3M8RA 5D8HB 1MMLA 2CPZA 4KAIA 3C2PA 4G1QB 3PY8A 1TK0A 1PILA 3OTEA 1E6VA 3CULA 2APOA 2O1PA 4DL7A 2KFZA 3IFEA 2BXJA 4NWBA 3PRBA 4OLOA 4IQMA 1E6VB 2FJDB 3RBDA 4NLYA 4N77A 4HI2A 2AU0A 3BN4A 2VH7A 3FQKA 4P7TA 3W2WA 1RAJA 3I4HX 2QRRA 2LECA 5IZHA 5J2PA 4WFNQ 4MK9A 2B7CB 3W2WB 2LVWA 3OTBA 4ED8A 2J8AA 4NA2A 4QJVA 2UUAF 5J2PB 1QAXA 1X4EA 5GAGU 2LYVA 5J1PA 2E5IA 1NJXA 4ZMMA 2KB2A 2FVRA 2AGPA 4QPTA 1WWHA 4MAKA 3IR7B 2XC9A 3RTVA 4M63A 4Z37A 3AJ1A 4B02A 2AJ4A 2HHVA 3QJPA 1ZBTA 4O23A 3TP2A 3WZ0A 1XMQF 5D3GA 3U27A 1U24A 1N4LA 2F7VA 5D3GB 2DTJA 2NS1B 2VG5B 5CYMA 2R8GA 2MMYA 3QGPA 1YHQS 1Y5IB 5KG4A 4EGLA 1VQMS 4QCLA 1RYSA 2CPFA 5CYMB 4WKRA 3CSKA 3MMCA 1B0PA 1HWIA 5K9FA 3D2WA 3MMCB 2OP5A 4Q44A 2JFKA 4A47A 2ZZNA 1Q81T 2E7WA 3V5RA 5CZVA 2DPIA 4PG7A 4PPZA 1MWZA 1BQXA 1S99A 2MSTA 4X4OA 4ZP7A 3THVA 1Y00A 3GZ7A 3MM9A 4HEA9 3GV7B 2D3OR 3MPWA 3D0GE 1CG2A 2CQIA 4RNHA 1FXLA 1N5QA 2CG4A 3CDEA 1P9QC 3DC2A 3MM9B 3TUIC 1UMJA 4KJIA 5MAOA 4QYZJ 5LJ5Y 2DGUA 3UDLA 1VQ7S 3O5TB 2DHAA 3PR5B 2PSZA 3SSQA 1FKAF 4KE5A 3Q8PB 3MEKA 1S4FA 4RBUA 2D7SA 1URRA 2BVZA 1HW9A 1P27B 1W25A 4K4TA 2XB2D 3HHLC 3CJ0A 4H4MA 5DO2A 3PR4A 2JWNA 1HD0A 2KM8C 4QPXA 3JSMA 1RKIA 1VC5A 4DS4A 1C0UA 1FNXH 4H4MB 4DV3F 2DISA 3CIZA 5K8PA 2P6SA 3JSMB 1XEZA 1C0UB 4AL7A 1Q78A 1JXEA 3HVWA 2OTLS 2MKKA 4YHHF 4DSJA 4NLXA 1WG4A 4EYIB 3K5LA 2GQQA 1IKXA 3OHBA 4CO2A 3I9ZA 3DYAA 3CUNA 2WBMA 3ZZYA 1S6QA 4JV0A 3TYTA 1YI2S 1IKXB 3BSCA 2E5LF 3DYAB 2HNDA 5GADI 4KTQA 3FFIA 4ZPCA 1S6QB 3QJLA 2AGQA 4HTIA 2HNDB 3MXHP 3FJ2A 2AF6A 3NLCA 2E9RX 3UFCX 4X62F 2ZHAA 1YJWS 3DLHA 2KRBA 4ID8A 5F41A 4L6V3 2M7SA 4I4BA 4UOCA 5B7WA 1S1XB 4A8KA 2KDOA 3SFGA 1ZTWA 3VAMA 4WXOA 2WBRA 2O67A 5ADZA 4NRTA 1DBDA 2QIFA 1ZAVA 3L7OA 3R5BA 4YP3A 2W8KA 4DUYF 2GA7A 2HNYA 2WCXA 4DL5A 4WJBA 3MZIA 3QGIA 2NPIA 2BQUA 2HNYB 3B78A 5F9LA 3TQ1A 3M8SA 5LT5A 4NYPA 3VCDA 2R7XA 1APSA 5KFPA 5HN0A 2XMMA 3FSXA 1ZZFA 2DO0A 2I5JA 4IH5A 1WI8A 4O3RA 1TAQA 4X4TA 2KHCA 3UW1A 3Q2TC 5KFUA 2AJQA 2OO4A 3OQ2A 3LP0A 4DQPA 2RUGA 3MTJA 2RILA 2I5JB 4ED1A 3N79A 2QT7A 1K8AT 2CIMA 5EDWA 1YSJA 3LP0B 1YRXA 5JXSA 1NH8A 1QUVA 3OPKA 1TZ0A 3BO2A 1R27B 2HQIA 5SZTA 4WU3A 2G4BA 2I0XA 3P3DA 4DN0A 2UZAA 1J5EF 1AW0A 5A6PA 4PG8A 1NKBA 2ASJA 2VL1A 5KT7A 3A1YG 4QWDA 3CXCR 1T05B 1GXLA 2XY7A 2WB1D 3PX0A 2LXFA 5K8NA 2VKRA 1M90T 1LFPA 3MR2A 1KQGB 1UWBA 2MHEA 2NXUA 1JLGA 3GYXB 1H7WA 4NPOA 2KKHA 2M88A 1UWBB 2Q79A 5E2QA 3MD1A 2MQPA 1JLGB 1UEVA 1KRPA 4MYTA 1S1VA 2RVJA 2BR0A 2JDJA 3O8WA 4K4SA 3SFUA 2P6TA 3SQGA 1S1VB 2QE5A 2V2KA 4MKYA 1SC6A 1KVJA 2JEFA 3KLEA 4RNOA 3SQGB 1RTDA 1LOUA 2BV3A 4AE5A 4KQZA 3U7JA 1BQMA 1FJEB 1X4FA 3T9NA 1H2TZ 3KLEB 2F3JA 1RTDB 3RRHA 5E41A 1TL3A 2F9DA 1BQMB 2J9CA 2M9KA 2BYCA 2ZH3A 3EXCX 2Q3PA 2K7KA 1RT2B 1TL3B 2M70A 3I55S 1YRTA 4W92B 1N33F 2XMJA 3G8QA 5KFFA 2KRRA 1L3UA 4YR0A 3LUYA 3B4MA 2IM2A 3CCVS 1H0HB 2IJNA 1NKEA 3MPVA 2L9WA 4CH7A 2DR8A 2ZH1A 3R1HA 1G6BA 4ZVHA 5KFDA 3I82A 4X4UA 5KFCA 2J5AA 4C3LA 1FRHA 2VBXA 3KHLA 3RB6A 2J7KA 4C97A 4FYDA 3MOJB 3L3CA 5CYJA 3Q8QB 3W3SA 3MR6A 1G3OA 3TAQA 3LF0A 3NRBA 1X4AA 1R8AA 4OFZA 3EX7B 1ZPWX 1NK0A 2ROGA 3BSNA 4YB7A 3KJVA 1JK9B 3G9CA 4Y2AA 2DNYA 1CC7A 3C66A 2EFVA 2O01C 4A8XA 3M2UA 3RU0A 3KJVB 2PIIA 2M5YA 2DRBA 4MKAA 1X0FA 3M2UB 3RW6A 4ZCMA 3KK3A 3CJ4A 2VD3A 3MHYA 1HNXF 5HLFA 2I8EA 2VV5A 3KK3B 2BUNA 4DR3F 3V4IA 3AY0A 5HLFB 3KHGA 2BZ2A 2VASA 3I56S 2HHXA 4IYQA 3VTIA 4IUFA 3V4IB 2QSFA 4FF3A 3HK2A 1Q1KA 2M52A 1WG1A 1V3SA 3R1LA 2DT9A 5CYQA 2MY8A 2YWKA 1VQ6S 2CQ0A 2I2YA 1KOHA 5U47A 1VBYA 5CYQB 1JXLA 1VHFA 3DLEA 2ZHBA 1N6QA 2CZ4A 3DLLQ 3DOLB 5CHCB 5C42B 3DLEB 2DNRA 1N6QB 3O2IA 3KG4A 3GFXA 2HS0A 1Q4RA 1REVA 2VFUA 3GR0A 4K59A 3T9ZA 2XLJA 4BC7A 3HMJG 3U1LA 1X7VA 2HZCA 2MQMA 3T5JA 1X0PA 1SL2A 3FRYA 1REVB 5E5NA 3GILA 3S01A 4ED6A 5KFEA 2FHJD 3QMQA 1GXTA 4TYBA 2XHWA 3TVYA 1WEZA 2PGCA 4YB5A 1WHVA 2UUTA 5CD4H 4Y2MA 4OZ1A 2MQNA 4DWIA 3OTOF 1KVIA 1NK8A 4FBUA 3LP2A 2DGXA 2A18A 2XSFA 3H25A 4GMKA 3LP2B 2QA4G 2IC3A 1I6JA 2KG1A 4ELTA 4CNYA 5B08A 4DLEA 2GNKA 3PFOA 4ECQA 4NLDA 4BDPA 4O3SA 4ATNA 3HM9A 2IC3B 3ONQA 1MROA 4MH8A 1TKZA 1TFWA 1IM4A 4LFCF 1Q53A 3TUJC 2B4OA 1HL6A 1MROB 1HW8A 2GW8A 1TKZB 3D1QA 1WHXA 3HFKA 2JEGA 3MM8A 4NLTA 5CH7B 4Q8EA 3K5OA 3G8SA 4MTPA 2BANA 3N4WA 4DL4A 5DG7A 4J9RA 4Y2CA 3I6PA 2ZITA 3MM8B 1FO1A 1VQ4S 3CCRS 1MU2A 2BANB 5KFNA 2ZHOA 2FLNA 4O4GA 4OL8A 4J9OA 3O6QA 3I5BA 1KR4A 1MU2B 1SI9A 4AXJA 4K0KF 3CCWA 4O4GB 3OR2A 1IXKA 4NLRA 3GG0A 3TA1A 2GQ2A 3HHLD 2VPZB 5JVGQ 4HVZA 3OR2B 4B3TF 3F56A 1RA6A 3MEEA 1UETA 1MW7A 2QYCA 4ZPAA 4PXDA 3CIMA 5T14A 4C4WA 3MEEB 2AGOA 5DM7Q 4DV6F 2FC8A 3TAPA 5J1NA 3NNHA 3EGWB 2MZ1A 1ZZNA 2ZBIA 3N28A 4KHPF 4OZ0A 1QUPA 3LALA 2B7BB 4EUVA 4ID5A 4U9RA 3H4BA 2HWTA 1M1KT 1G1XA 4NX9A 2DCUB 4KSEB 4V19X 3LANA 2CFXA 3CC7S 2MKJA 4ID5B 2DNHA 3QGGA 3SMZA 3DNCA 1Q79A 4HDHA 2R4FA 5DRKA 2ZM6F 1U6FA 3VAIA 3GIMA 1XN9A 3I96A 2VPWB 4IG0A 2UVVA 2QSWA 1N48A 2PI4A 2V4RA 5A6WA 4IG0B 4OI4A 1KFDA 4DR4F 5I4MA 1ZH5A 2PD1A 1FRKA 2W4DA 3KLHA 3WDOA 2DCLA 1KFSA 4QU7A 1DQAA 3W2VB 4IO9Q 3KLHB 4JYAF 5KFMA 4IQXA 3D28A 5HMWA 3P6YC 3K7RA 2KFYA 4RWXA 1TP7A 3TA2A 2OPSA 3FNNA 1KEKA 2B5JA 2HIQA 4KIAA 1LW2A 4CT9A 1OWXA 2OPSB 1Y4ZB 5B0AA 5LSRA 3BDPA 2HS3A 1LW2B 2OPRA 4MK8A 3MUTP 3OL7A 2L48A 3UR3C 3QIPA 5D4OA 2QZ8A 3OBIA 5M2UA 2OPRB 3BDEA 5AXNA 2NSBA 5C25A 3QIPB 4LF7F 4OJHA 4LVNP 5KT6A 1LQ9A 1Y5LB 4JV5F 2K7JA 5C25B 2W9AA 1RI7A 1SIZA 2BA9A 2UV8A 1NK9A 4ECTA 4FXVA 3BEGB 4CH1A 2ZH2A 1W2BR 5J2QA 3PKMA 1RJJA 1RISA 4A8OA 2R2UA 3FZ2A 3IBWA 3OFHA 2KHDA 4DSIA 5J2QB 5H1SV 2E7XA 2FD2A 4C8MA 5T7LA 2XS2A 5BJRA 3MD3A 1OPZA 3KG0A 3I87A 1U1MA 1MMDA 5T7LB 1IKVA 3T6BA 4DSEA 2UVUA 3GIKA 3CT9A 2PDAA 5CXTA 3H59A 2VBZA 3M05A 1UVKA 1IKVB 3X3UA 4F3QA 1ZETA 4M8LA 5F0UA 3NGDA 3N01A 1FDNA 1UJ6A 2BM1A 3THTA 3PVXA 2W4CA 2IJFA 2HHSA 4DFPA 4O3PA 3TNVA 2K1RA 5AE1A 2AP6A 1NEEA 4OI1A 2F8MA 2KXHA 4RLEA 4PQAA 4KC5A 2K1RB 2FB0A 1VIXA 3LOUA 2CQ3A 1OS5A 1I94F 1JLFA 5KOWA 2ZZMA 1S49A 4NCAA 3KLFB 3TX8A 3A8EA 3QZ7A 1IBMF 1XMBA 1JLFB 2C3YA 3US5A 1Q8BA 5FDLA 2X51A 2IYGA 3HLUA 3OFGA 1MNEA 4NXNF 1LK7A 2NSCA 3H20A 5FDLB 4ZPVR 2YNIA 2ZUGA 4ZK7M 4O3NA 3D0HE 4Y0FA 1R89A 2K3IA 4OHYA 2DNOA 3I0SA 2MXYA 4I56A 2YNIB 3F41A 2GHVC 2WK4A 3KHRA 1S0VA 3T1HF 4UY85 5AE2A 3NL0A 3I0SB 2P9GA 4L72B 2LU1A 4B3SF 3EUNA 2FDNA 5KFIA 2VOPA 3NCQA 1NO8A 3M32A 1HNVA 3J7YI 4JI3F 3O44A 2JL9A 4KHMA 3RRGA 3G4SS 1L3VA 1JB0C 3N6LA 4LT6A 3M32B 1HBUA 4DR6F 2XI3A 1HNVB 4RU9A 3BQ2A 3H5XA 5LL6d 1FHTA 3TOQA 1VQSA 3SYZA 4LF9F 2K3KA 4TN2A 5GADU 1VRTA 1HBUB 4UW2A 1U49A 4N47A 3K8VA 2ZH4A 4OV1A 4N76A 4CNZA 3H2LA 1VRTB 2JOQA 1HWLA 1UW4A 3BZQA 4TU8A 2CPXA 4RBTA 5G0RA 2EFNA 3IWLA 5KAKA 5FJ4A 2VG7A 1Z2ZA 3MWBA 3RZAA 1U48A 3GSDA 3TVKA 3R5DA 2LQ5A 5G0RB 4F50A 4YEAA 2VG7B 2ROEA 4J9NA 3B4DA 5CCLA 5F8LA 1R31A 1FDBA 2V8HA 4IO1A 4A46A 1LW0A 2HWHA 2FJXA 5DGBA 2DR9A 2DNQA 2B3TB 3IG1B 2VQEF 1WELA 1N54B 1LW0B 3LP1A 4WFBQ 1WNEA 1FE4A 3M1VA 3CCLS 3ITHA 2LEAA 4LMZA 3QWUA 3LP1B 1S0MA 4DV7F 3M1VB 3ITHB 3KLGA 4CO5A 2Z8QA 5D77A 2C3MA 2RF2A 3NAHA 4CH0S 1DURA 5DDOC 1UKUA 2KVIA 2B4VA 3Q24A 3C3LA 4CT8A 3KLGB 4DL2A 2RF2B 3HZGA 4UUWA 3PW7A 3SCLE 4BWMA 2CPDA 1I1GA 4ERDA 2OD6A 2XCPA 5F8MA 2RQMA 4ECXA 3ZZOA 4C7QA 2DH8A 2AQ4A 5DQHA 3HVRA 3NNAA 4FPRA 3NG8A 3M9NB 1S1TA 3CD6S 4NRUA 4N8NA 5DDPC 2UVRA 2E1CA 3MM5A 3CCES 1SH3A 1OSDA 1RT7A 1S1TB 1T94A 2PN6A 2XNQA 4KR0B 3CGIA 1UVNA 3MTKA 1QM9A 1HHSA 4FN5A 5HMYA 3MM5B 3MURP 2EW9A 2JFDA 1FD2A 4EZ9A 1RT7B 3ULHA 3KYLA 2F1FA 3BF4A 4DFMA 1FE0A 5DLGA 4AUKA 1S0OA 2JH3A 1N52B 3CCMS 3VQSA 2X1AA 1RT3A 1FRXA 2VPYB 3CD5A 3CDAA 1N5YA 1KD1T 4PG5A 4PWDA 5K8OA 1FEHA 1N5YB 2HPUA 1RT3B 3C6TB 3OXLA 1T03A 4PWDB 3AH6A 1L5UA 2QO3A 4ILRA 1RT5B 1QVFR 4ITSA 2MKCA 4GC7A 4OIXA 2RS2A 3GE9A 4YY3F 3PX6A 3LWLA 2W9BA 1T03B 1S76D 3CC2S 2IRUA 3KKFA 3VR1A 4HT7A 2M3DA 2NUHA 2LA6A 1IJEB 1FKOA 2ZNZA 4CI0B 2IM1A 3POTA 2W9BB 2G13A 3G6VA 1P8GA 3LAMA 1RT1A 2VG5A 2GV1A 3HO1A 1K9MT 1FKOB 3N5BA 3POTB 1TFYA 4A8QA 4ZCLA 4E8UA 1RT1B 4LF5F 3CTRA 1WD6A 3H2VE 4WYWA 4KV8A 5DG9A 1RT4A 4I6AA 2RU9A 2DITA 3LGMA 1XWLA 1RGVA 3BSAA 3TRGA 5A0YA 3OJUA 1K1SA 3I4PA 4KV8B 2M0GB 1RT4B 1FF2A 1N5VA 3KNAA 5A0YB 4DL3A 4OLPA 4ECVA 5EHHA 4K4UA 4TU9A 1T3NA 3EGNA 4J9LA 3BN7A 5LMNF 1SKWA 4LVOP 2R2SA 4ELVA 1Y5NB 5KT5A 2Q1LA 4DHVA 2HS4A 2J76E 4DQSA 2FC9A 1KOOA 1U6ZA 2D3UA 2PT0A 3AB2B 3CVKA 3HHLB 2EK1A 4B9NA