4I0WA

Structure of the clostridium perfringens cspb protease
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
92
structure length
91
Chain Sequence
AKVGIDFINTIPKQILTSLIEQYSPNNGEIELVVLYGDNFLRFKNSVDVIGAKVEDLGYGFGILIIKVNDLNRIIELEGLQIELPKILYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the CspB protease required for Clostridium spore germination.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords Protease CspB
total genus 23
structure length 91
sequence length 92
chains with identical sequence C
ec nomenclature ec 3.4.-.-:
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18425 CspB_prodomain Csp protease B prodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i0wA00
4I0WA
chains in the Genus database with same CATH superfamily
2K7KA 4AL5A 2YPYA 4DV3F 1IKYA 3CJKB 3ILLA 3KK1A 2VG5A 1WEXA 1NK6A 4ZCLA 1SQGA 1KLMA 4DR3J 3QT5A 4KHPJ 5A0YA 4I69A 4KY3A 3MPDA 5DS7A 1G6BA 2RKIA 2CKWA 2Y0SD 4BLGA 4RNHA 4DPOA 2DNQA 2ZZNA 1V5IB 3ISND 2HGNA 2ZBRA 4I67A 1U2FA 2YBVA 5ITHA 3NL0A 3I31A 4OFZA 1XNQJ 3GYGA 1S1UA 1BLUA 2XEXA 2G13A 1OYDA 2G1HA 4WTOB 4ECQA 4C8OA 3NMAA 1UEUA 5T7LB 4M5DB 1F9HA 4K4XA 3PW2A 1J5OB 3MFIA 2KTQA 1UA0A 5F8GA 1JKHB 4TYBA 5F41A 2VDIA 1Y3JA 3DRSA 3H59A 3NBPB 1TK8A 3L7PA 1LW2A 2C2MB 1S5ZA 1QDUB 3C46A 1BGXT 1J2VA 3RTVA 5IT9Y 4IUFA 2UV8A 4E2FB 4K5SA 3HCXA 4KRWA 5CH7B 3I32A 1C0TB 1Z1ZA 2M7SA 1JXLA 3FRZA 2R7UA 2XHWA 3HZGA 1RHQB 4NXMF 3P3DA 5CYMA 3UDEA 3BGOP 2CZ4A 3QGGA 4OHXA 3R1LA 4A48A 3KK3A 4RBTA 4PG5A 4HH1A 1Q81T 4P7VA 4EBCA 1XR6A 4MK9A 4DX7A 2CWXA 2IJFA 1KSPA 1DQAA 4X4OA 3QSIA 2HFOA 1X9MA 3R2CJ 4ER8A 3MPYA 4LIWA 4CLFA 2H4WB 2LQ5A 2RRAA 1LV5A 4QWEA 7FD1A 4DFPA 4AQYF 3MF5A 4K4UA 2V8DA 4KH0B 4J9QA 1U1KA 1WDDA 1IBLF 5H9FK 5K8PA 1KDNA 1H0HB 4K2XA 5K14B 2EG2A 1KS2A 4KT0C 1CULA 3M2UB 2MQNA 1VOMA 1C1BB 2AT1B 4OX7A 2RQCA 2DYAA 2YKOA 2BDPA 4V19J 1T95A 4OHVA 4K5RA 2MKKA 4DSIA 2R7OA 4PUOB 2CNNB 3OXLA 4DV2J 1XNRJ 3FEYB 2IVMA 1N8RT 2Z8QA 3M6XA 1EJ7L 4OI4A 4QIGA 2UUBF 3JSBA 4A8YA 5L39A 1R43A 1SI9A 2E1RA 3RAQA 4B9LA 2JVRA 2MKSA 4LFAF 3QGPA 4KH1B 4WYLA 4ZP8A 4F7VA 4DF8A 1M5VC 2DKOB 2GC8A 4NMXA 3GR0A 4Y28C 3S8SA 3BEGB 2UUTA 3UN5A 2RAQA 3PO5A 4DEZA 2BEFA 2NXUA 1R0AA 4ZS6A 2F7VA 4E98A 3KYLA 4NLDA 1FT8A 3C3LA 2VBZA 1T11A 2DGSA 3R6GB 2QL7B 2GAGC 3RAXA 2XS2A 2J9DE 1R31A 3DCAA 2YWHA 1IR2A 2DR7A 2HHSA 1ZAWA 2X3DA 4JI7J 1WC1A 3W5YA 4JV2A 2ASLA 1XMBA 2FZGB 7FDRA 2OLWA 3RB6A 2EG1A 3CC4S 4FF3A 5KG4A 4WTYA 3SCJE 3HVTA 2J0SD 1VQ6S 2Z4PA 4F04B 4OYIA 5KFDA 4P52A 2R7SA 2L41A 4OI3A 1M1KT 4JI3J 4OYZA 4NXNJ 1V9OA 4ZLJA 1GXTA 4LF9F 5D0HA 4XK8C 5E3CA 1JLCB 1Q8BA 1ZZFA 2ZBCA 3HSZA 4RW4B 1DZ5A 3FBCA 2XS5A 4DR1J 4TLQA 5J2MB 1VQ5S 4O3SA 1RTIA 1UFLA 3VQTA 1UEVA 3FMWA 4KR0B 3OD2A 3R7NB 3MHYA 1M5KC 1TAUA 3KK1B 3MM9B 1I6JA 4CLPA 1BC6A 2J9EA 1C0UB 3BSAA 2CUYA 3JS9A 3GIIA 4UTGA 1DTQB 5BR8F 3T41A 3J7YU 4OI6A 4OYAA 1I94J 1YZ6A 4W90B 5AXKA 2GX8A 1GEHA 2JLFA 2VG6A 3JQKA 3H40A 4IQMA 1J5OA 1MMLA 4M5DA 4P2MA 3W63A 4IFVB 2VQEJ 1RU1A 3NEKA 3T3FA 3HFVA 4A4JA 4X65J 2W7PA 3MM6A 4X62J 2FC9A 1RCOB 2DEIA 3AQOA 4WF9Q 1ITPA 2XLJA 3H2UB 3IWLA 5E41A 4DLGA 1S59A 4LF8F 3LWLA 4N5SA 1VS3A 2D9PA 4ALZA 4DL4A 5D0EA 1S1TB 2YQ3A 1HWUA 1JLBB 1JLFA 2DB1A 2ZH2A 2IM1A 4DX5A 3PJWA 1P1TA 1PC5A 4MYUA 2SXLA 3QPIA 4J9MA 1K8AT 3HJFA 4GKJJ 1CC8A 2N7CA 4ELTA 1CS4B 2W7OA 1ZM3A 4NX9A 3SMZA 4HL9A 1HQUA 4YUDA 2WRMA 3GCWP 2J6UA 1UCNA 1R8CA 2KYZA 3CDEA 3DMJA 1KFSA 1N32F 1RWOB 4JI1J 4FKYA 2GS8A 3P96A 3V6KA 1IM6A 4I2PB 1OS5A 2WVEA 4MH8A 1S57A 3KNGA 4G1QA 2YKMB 2CQHA 5GAHI 4MIWA 5C25B 3JYTA 2MTLA 1SL2A 2FVSA 3C6TB 4HACA 1XN9A 5I3UA 1IKYB 4AD6A 2XLKA 1N52B 3TUJC 3WX4A 1JK9B 4L75A 1SJQA 2YTCA 1VK3A 1YRUA 2A1BA 5DQIA 2PFFB 1EX8A 2FIUA 2AX0A 5LM7E 5B0EA 3JSMA 1MROB 2BKPA 4WBFA 2MMYA 2KT2A 2OP5A 3EMTA 3T6JA 3UWTA 5AE1A 2FHKA 2WBMA 3T5HA 1X9WA 4ZVEA 2VPYB 9RUBA 3W2WA 4RZRA 1ZM2A 2GJ2A 1HYSA 1S48A 1RT2A 2HFVA 4NE9C 2HAFA 3TX0A 5LSLA 1CJKB 1R89A 3HXMA 1SUQB 1PGZA 1D9DA 4Y3CA 1MN9A 2EC2A 2Y8YA 4N56A 3QJPA 4GRSA 5SZTA 4PXDA 1G4CA 3CCES 4W98A 3TAQA 1QAYA 5BYQA 2K3KA 3HHEA 3NGKA 4WE1A 4EGLA 3Q8PB 3ZZ0A 4N8OA 2QA1A 4YB5A 4YS2A 2W9CA 3KHHA 1S6UA 4MYTA 5GAEU 3DN9A 3VAFA 4OJHA 3K5MA 3AQPA 1IBKF 4O3QA 4GO5X 4CLLA 3H5XA 4RR5A 3FBFA 5CQGA 2A10A 4USWA 2GVDA 3J7Z5 1HNZJ 2ROPA 1Q78A 1RWVB 1BXNA 2KRRA 1DY3A 2K3IA 2KXNB 3B8HA 3PIPQ 4ZPTR 3F73A 2F3JA 1RU2A 2IVYA 3UD3P 1S6QB 5KFUA 3SV3A 1S1VB 1JLCA 1RYRA 3OV7A 2DISA 2I5JA 2MZJA 2RB7A 4I7FB 3VAKA 3HT3A 1U2CA 3CD5A 2XS7A 4LMZA 1X31C 2FJVA 2E5HA 4L74A 2B7CB 5D4NA 3CJRA 4Y34A 1C1BA 2BQ3A 1BWVA 3BYPA 1FFGB 2RF2B 4ZVUB 3SFUA 3SI8A 2AYEA 2IDLA 1T8EA 2HNDB 2ZD1A 1MWYA 3V6HA 4DV7J 4ITSA 1VLOA 4DS5A 1VIOA 2UUWA 4XAKA 3TUPA 1YJTA 4OYMA 2DGUA 3UD5A 2N7YA 3R6LB 3WC2A 2AEFA 1X4BA 4MK7A 4OZLA 1T05A 2E5LJ 4ZITA 5F8JA 2MKHA 1S1UB 3R9LA 1A6LA 2ILYA 5E5NA 3NS7B 4DL0C 2BBEA 3TW0A 1CJUA 1OPZA 1U45A 3DRPB 3TAPA 4DR4J 2R8KA 4ED1A 1FJGF 1RHMB 1ZPVA 2CRLA 2C3YA 2HQCA 2MZTA 3M8YA 1RT2B 5CZVA 4A47A 4EO8A 3VWSA 5MLCV 3GIKA 3GV5B 3EPIA 4GC6A 2IBOA 3H90A 3DLEB 2Q6BA 4BC7A 2F9JA 2M88A 2DCLA 4DQSA 1HBNA 2BR0A 1SKRA 2XCPA 1C4AA 3VQSA 1F6TA 5C42A 2Z30B 3FEZA 5J1NA 4DV1F 5DG7A 1VBXA 1X4DA 3A4TA 3W5XA 2VONA 2EFQA 5D4LA 3BDPA 2R7WA 3V4IB 4BBYA 1RWKB 4HDGA 3SSRA 2XLIA 4PWWA 4BS2A 4FF2A 1LWCB 7AT1B 4QJVA 3FZ2A 1HPZB 5HATA 2R8IA 1YITS 1Q4RA 2DIUA 3FQLA 4KPYA 3OBIA 1KQKA 4GKJF 4YHHF 1HNIA 1LQ9A 3R5DA 4I64A 2IRUA 3VF0B 4ENOA 4MFBA 5IZHA 4FS1A 5ETTA 5HLFA 1Q1KA 3GFYA 4ZJLA 4DUZF 1GMWD 1VDHA 1FK9B 2RIJA 3AJ1A 4AFFA 1YSJA 5HVHA 5JJBA 4FVCA 2QYCA 1JJ4A 1N32J 4KGXB 2ZNYA 3NCQA 5AJ3J 3KJNB 1HL6A 2EVZA 2CQ4A 2RRNA 3HD1A 2PI5A 4FN5A 1DBDA 1TL1A 3QYYA 1WWHA 3FSYA 4PXBA 3VVTA 4P73A 2JLEA 3TUIC 3D6FB 5HVGA 8ATCB 4A8XA 2MB0B 5HMXA 4ZP9A 2CA9A 2CVEA 1D8ZA 2RDJA 3DXSX 1BE4A 4AYBD 1RAJA 1UEKA 4ZPCA 5E3RA 1YLXA 4IFVA 5FJ4A 4JI7F 2LQBA 1FXLA 3HHKA 2DRBA 4K4TA 3HSGA 3A13A 1B7YB 4GVLA 3TRGA 1QJHA 2GGPA 1DAXA 1CJUB 2DNOA 2CQ1A 2LVWA 2Y0BB 2Y3YA 5THWA 1F5CA 1SL1A 3DI6B 5A6WA 4DLEA 3JQJA 3TJ8A 3OR2B 4AL7A 3CO0P 2C2ZB 5DG8A 4V1Ak 4FNHA 5C42B 2QIFA 3AD9C 1TKZA 4EO6A 3Q0AA 3CDBA 3W64A 4HEA9 1H2UX 2VG7B 1JNRB 1KOOA 2XI3A 3BV8A 1RAIB 2I2YA 1VK8A 2RVJA 5CYJA 3RZAA 4RUCA 1NJIT 1E6VB 4KC5A 3QRQA 1LEOA 3LP1A 4OZNA 3TYTA 3V6JA 4EEYA 1QE1B 2B6AB 1RAGB 5DM6Q 5EX0A 1MMDA 1JLQA 2J0WA 2QLFB 3BN4A 2QX0A 3I96A 2W7AA 4M5JA 4URQU 2CQ3A 4ECWA 3PX6A 4R5PA 2NQPA 5ETMA 3KUHA 2NSBA 4G6VB 1FRLA 1P9QC 4MFBB 3ZZOA 2HMIB 2VODA 3BBBA 4XPCA 2JHEA 1O0PA 3HHLD 1FRHA 1QUPA 4DU8A 2BQRA 1SJFA 1EETB 1O51A 1URNA 5E3PA 4CCHA 2CPDA 2W4DA 4OZJA 4DDFA 3MUVP 2VFVA 3VZIA 2YWFA 2HBRB 1S9EB 3MMAB 2VASA 4JI8F 3R2DJ 2VG5B 1NJWA 1SH3A 4U8VA 4F4ZA 2RUGA 2MZQA 1MROA 2MZ1A 4LFBF 3GV8B 2KFZA 2UUCF 2HQFA 4LF8J 2BJDA 3M1VB 2HIQA 4DSFA 1YJ9S 1L3TA 3IRXA 3H2LA 3CD6S 4URSA 1RGVA 1RK8A 4PKDB 4Y00A 2MKYA 1AA1B 4M5NA 5L46A 1WSRA 3T5KA 1SC1B 2BKNA 2VFSA 2H54B 2M9KA 2IMWP 2GZOA 2F5GA 4BDPA 3FFIA 5K5MA 4ECTA 2WOMA 4NEYA 2XCAA 4J7CA 1S1WA 3S7RA 4FXDA 2YKAA 4NCGB 4LFCJ 2Q79A 1X4EA 3CC2S 4GKKJ 4RW8A 3BYRA 4JP8A 3PKYA 4CNYA 4GMKA 4YR3A 1NHUA 2A18A 1TL7B 3DDNA 1AUSL 3I6PA 2W9CB 1YKWA 2IDEA 4UUWA 2MSTA 4ED2A 5G0RA 1TKZB 1VJQA 3C14A 1WHXA 4C8MA 3PACA 2PMZD 1RT1A 3DXBA 3CULA 2O66A 4IOAQ 4K0KJ 4NL5A 2XO6A 4UT4A 5A6PA 1VC6A 2VPWB 4Y2CA 5HJXA 4DCOB 4J9VA 4ZPAA 3C6TA 1NXIA 2XTJP 2W4PA 2CDQA 2KI2A 2XMWA 2E66A 3IA0A 4HTJA 3TZWA 2E1CA 1NZAA 2CQ2A 1Q79A 2OEJA 3HHLC 2HVHA 2XGQA 5DM7Q 4H54A 3JSMB 4PWUA 2KHCA 1T9UA 4QU7A 4PPDA 1LKZA 4P2XA 2RE1A 1MMNA 1TL5A 2DIVA 2W2PP 3IR7B 1RT3B 1TUVA 4OYPA 1WKJA 4QBUA 1GNKA 1SBRA 2V69A 2QC3A 4M5KA 1FKPB 1TFWA 3ETMA 3NGSA 2V8VA 4OJ1A 4LRAA 4CM0A 3EPGA 5E2QA 5J1EA 3MD1A 4P9SA 1S6PB 4CP5A 3PRDA 4L73A 2AGPA 5HL7Q 3EVOA 4Q8EA 3MDFA 1S76D 4LBIA 1NHVA 2HNYB 2OPQA 2PIIA 1AFIA 2ZDOA 3CE8A 3M8QA 1RAFB 3VALA 1Y00A 5FD1A 2LXIA 3FJ2A 2FUG9 3K5LA 3TNVA 1IWGA 2G2ZA 3POTB 1RT7B 2DK2A 2BMBA 3OTBA 3N6NA 3OR2A 3A12A 5ETPA 4RUHA 1JJCB 5B08A 1HA1A 3MXHP 3LO3A 5HQ8A 2HLTA 1U1MA 3I0SA 4M8LA 5DDQC 3I55S 3DLGB 1VC5A 1CJKA 2BJ1A 3BN7A 2GNKA 3CCTA 3GU0A 4NZ0A 1SJ3P 3PYFA 2HHPA 1IBCB 2Y1IA 2OH2A 1IJFB 4FS2A 5E3AA 3S1TA 3D6TB 3MEGA 3D0GE 1RT4B 1IKWB 3OFEA 4NA3A 3T1AA 5KFGA 2B6AA 4Q8FA 4JI4F 1REVB 3ZTSA 2QMXA 4DS4A 3OXGA 4CDIA 5HANA 3TI0A 4KAIA 3HM9A 2ZOMA 1RT1B 2HKEA 5F8LA 2M4MA 3G86A 3L3CA 2QN6B 2MJNA 2CIMA 3OVAA 4DL6A 2C2EA 2HRYA 3TVKA 4FPRA 3M6UA 5IV4A 3KLIB 1PBAA 2A2CA 2OHDA 5L9NA 3OL6A 3BBFA 3NLCA 3MUTP 3JYTB 3RBEA 2CYYA 4I7FA 1S4EA 2QE5A 1FA0A 4DR2J 4IKAA 2ZH6A 4DPTA 3F56A 3K8VA 4R5PB 1S1VA 1SIWB 2JC1A 4PG6A 1KQGB 1S72S 5K8OA 5HJYA 4C3LA 2V6AA 2ALZA 4Z2XA 4JV1A 1IR1A 5A0YB 2WHOA 1NB2A 3OR1A 1S0MA 4DZDA 2HNZB 1OWXA 1RWWB 2HNYA 1NRKA 3O6QA 1RLDA 1FWKA 5JMNA 4JV0A 5H9EJ 4J9SA 1SJ4P 3FZBA 1DURA 1RT5A 2FYXA 3T5JA 2J76E 3HSJA 4KHPF 1C2PA 2LECA 3G8SA 3H5UA 1NJYA 1N34F 1PYOB 4YDDB 3TANA 2EWHA 1EP4B 2GO9A 2V67A 4X4QA 1U1RA 5CAAA 3HMJG 3F44A 4HHHA 1M1HA 1ZS6A 1RXOB 4NCGA 4ECYA 2VB6A 4UOGA 2XWXA 1U24A 2L9NA 1HBUA 5HMWA 4EBEA 4IYQA 1XMQF 3R5CA 2JOQA 4N76A 2FTRA 2AP6A 3R5JB 4QWBA 1VRUB 1HR0F 4CLUA 2D41A 3MR7A 1ELOA 3OQ2A 1NKCA 2DXEA 1VQ4S 2IVFB 1TFYA 4YHHJ 3PX4A 3ZXWA 4CYUA 5HI7A 2R8GA 3DYAB 3B78A 3OHAA 3J7AN 4XPEA 2VFTA 2ZDPA 2DBBA 3R5AA 1T3OA 1N48A 4IDKB 3H42A 4RUAA 1MWQA 2OEKA 4NXMJ 3KLGB 1XC9A 2XGPA 3C2PA 1D0EA 1FVSA 3EXCX 2QL5B 2HZVA 4QIFA 2R7RA 4IQXA 1RSCA 1X60A 2AJ4A 5GADI 1RQ0A 1NHKL 2RF2A 3MGJA 4OX8A 4ZMMA 5KT6A 2BJ9A 4NYOA 2BQUA 3CJTA 2YX4A 2YWEA 3X3UA 4P75A 2ZH9A 2GW8A 3G87A 5B0CA 1KVIA 4CLYA 2MEWA 2PEHA 1HI8A 3DU5A 2M52A 2DNGA 2KG0A 2O3DA 1MN7A 2DGXA 2V2QA 3EGVA 3LPYA 4O4RA 5FLXU 2F8MA 4BWJA 4A8SA 1APSA 1S99A 2ZHOA 2ZEJA 1MG7A 1IBMF 2K06A 1RA6A 5DDOC 2YKNB 5AXLA 4Y65A 3FEXB 2NXCA 4C0BA 3M30B 3NG8A 4PG7A 2GO8A 3SV4A 3M2VB 4C8KA 4W4MA 3GJTB 4ZCMA 1R6VA 2DGOA 2LP4A 3UW1A 4YMEA 1QAIA 1TKXA 2JLGA 1C1CB 5GAGI 4IRDA 3TO8A 1S1WB 1IBLJ 3BGLA 3DLGA 4LSLB 2KRBA 1H72C 4DZ6A 3PZPA 4J9UE 5ETQA 4DUYF 2XZTB 2CJAA 3M2RB 4QIEA 3VVUA 1FJ7A 1X4FA 4FYYB 4KGZB 2MYFA 1HQUB 2CWKA 1BUXA 5F8IA 2GQQA 3DGVA 1OY9A 3NOGA 2R4FA 3N28A 2E5LF 1RCXB 1TMJA 1VBKA 2QA4S 3RRKA 1HPZA 1TK0A 4I56A 1MU2B 2AJFE 2AWZA 2GVDB 3AXKA 1TAQA 2DHGA 2DNRA 4IH5A 4WJBA 2YH1A 1KHVA 3N6MA 4U7UD 3ZTOA 1AFJA 4DV0F 4AXIA 1R0CB 1ZH5A 2RILA 1RLCL 1NEEA 3I0RB 5EHHA 4WFXA 2OGUA 3G71S 1AZSB 3K7RA 1EETA 1GX6A 3LQVA 2MGZB 4KJIA 4C8ZA 1RWXB 2CQBA 3FNNA 5K14A 1FK9A 1OPIA 1S79A 4OX9J 1KNZA 1CC7A 1M5OC 5L1KA 2RKIB 4M63A 3GSIA 3ZNUA 3FCHA 1T03A 3K89A 4E0DA 3QAUA 3Q8SB 3DM2A 1CEZA 2ILZA 3IFEA 3MFHA 3QAEA 2E44A 2DT9A 1S6PA 4O23A 1HKAA 1UAWA 3GZ7A 3Q8QB 2YH0A 1X0PA 4DL5A 1F2GA 2H9ZA 1FRIA 2RU3A 2B8PA 3A8EA 5M2UA 1R7IA 1RKIA 2GCFA 4I6YA 1HNXF 4HTIA 4IR1A 1JIHA 2IYIA 3UVJA 3BQ1A 4YB1P 2DHXA 2KZMA 5GMDA 5JVGQ 1N5VA 2D69A 4WXOA 3CMES 4YP3A 1UFKA 3PIOQ 4LQ3A 1QTNB 3AFGA 2PSZA 2EEYA 5IT4A 4JI0J 4DR1F 4F3OA 4N7TA 1KRPA 1BD6A 4ZPDA 1FX4A 3CO9A 4OYXA 4ZCKA 5DG9A 3M2RA 5ETNA 2RHSB 3ZNJ1 2BABA 4EUVA 1K47A 2NLWA 4ZVHA 2R7TA 2IRYA 1CS4A 2VOPA 3B4MA 1KTVA 2CJQA 1OQ3A 2UVUA 3CW2C 4XO0A 2ZC3A 1RHRB 2CNLB 1LWCA 2KM8B 4Y2MA 3I0RA 4WFAQ 2R7VA 2NYIA 3H4BA 3P8BB 3A8KA 2MXYA 4H4OB 2JH3A 4WCEQ 1WC0A 1UTAA 2O5DA 4IOBA 5SUHA 3BJYA 4DFJA 3CWJA 2MZSA 2DGVA 4F4XA 1YTYA 3AH6A 1Y0HA 2D74B 3ENAA 5HBMA 2MPUA 1HWIA 2YWGA 4X65F 4O3OA 1FRXA 1RWUA 3SQOP 5CD4A 2FHJD 2XO7A 1QSLA 3QZ8A 1RTIB 2JEIA 5AXMA 1FTCA 2M0GB 4KO0A 3US5A 3D0IE 4MJKA 2GAHC 5HQLA 2IYGA 2KL8A 3MCNA 5LJ5Y 3MR5A 2FHJA 3DGPB 3L9ZA 2CQGA 3MZIA 4PG4A 5IT0A 1LW0B 1CJTA 4WU3A 2V9KA 1RB0A 3DGPA 5KFKA 2R8HA 1KLNA 4DQIA 3DLHA 2Z2LA 3G2XA 4ZHRA 4JYAJ 5E7OB 2V4QA 1UPPA 1U0HA 5KG1A 4B9VA 2B4OA 2L08A 2ZC4A 4DMZA 4DFKA 2JDJA 3L09A 1PYSB 9ATCB 2C2OB 1YBUA 4BHQA 3L4BC 1DLOA 4UQGA 1KN6A 2QGFB 2GHVC 4JI6F 4RNFA 1WOOA 3P5BP 2FY1A 4WE1B 4YB7A 3MM6B 2KJWA 1DHMA 1QVFR 4BCAA 3J81Y 2J9CA 2X51A 4F50A 2ZH5A 4KFBB 2AW0A 4OZ0A 4DXLA 3HFKA 4L72B 2BV3A 4RU2A 5KFJA 3Q8UA 5E0OA 1RT6A 4RL1A 1VI7A 2W1BA 1VR6A 4F4KA 3CCVS 3A1YG 3KOAA 1N0VC 1JLEB 2C3MA 3OVSA 1YK9A 1P27B 1U47A 2AEJA 3TWZA 1M90T 2FLPA 4CRJA 2ACYA 4CT9A 2MLZA 2WB4A 1B99A 4MK8A 3DC2A 1YBAA 2BKOA 3Q24A 2IMOA 2VG7A 2ZE2B 4F0MA 4DR2F 2G2OA 5IWAJ 5FLXY 3H8YA 2HBYB 3T1HJ 4H4OA 3HO1A 2KM8C 2VZ9A 3NS5A 4C97A 1F3VA 1X4CA 3W1YC 2QSWA 1VBYA 1SH0A 3AHPA 1X4GA 3U1NA 3GCXP 4K4SA 5ETKA 3K57A 2FPHX 3D28A 2AYBA 5I3UB 2WSEC 2QFIA 3PHEA 3MMCB 1N6QA 4NLPA 5C25A 5L1IA 2ZITA 4WP9A 1PILA 1HWLA 2IA0A 2QMWA 5CA5A 1S0VA 2FJAB 5GVQA 3K5NA 3KMSA 1GMWA 3MEKA 3BKUA 2Q43A 3ELHA 1JQGA 4QWCA 2GJIA 2B5JA 3MPVA 4QR1A 4UF4A 3OL8A 4P72A 1NDPA 4BWMA 3QO9B 1YRTA 2XYPB 2UXDJ 2I1RA 4KGVB 3UVJB 3RJMB 3MCOA 2X1FA 2BE2A 3OTOJ 4ES3A 4OJ3A 4MIAA 4ZVPB 1VLYA 4NZ6A 1Q5YA 3PJXA 2DJWA 4I4BA 4CTAB 1UWAA 3KWMA 3SYZA 1X0FA 1YJVA 1PG5B 4CTAA 4M5GA 2B4PA 3ZTRA 2ADCA 5IM0B 1F9FA 3KJVA 1NKEA 4OL8A 5HMZA 3BGRB 5CYQB 3OHBA 1PAUB 2KN4A 4PR6A 1RE1B 2L9DA 2VH7A 3GR1A 4TXSA 4ZN3A 3M8SA 1EARA 2HSEB 1YIJS 4L76A 4LF4F 1REVA 4MIBA 3K59A 3GG1A 1QSSA 3PX0A 4Z37A 3CUNA 3LANA 4DSLA 1IKWA 3D4JA 3THTA 2IPOB 1FRJA 3BS9A 4RW9B 1FKOA 3L7OA 4DSJA 1EAYC 1NNDA 4L3KA 1RT6B 2I9SA 3MM7A 3OJSA 2JWNA 2EPIA 1U48A 2LA4A 3EM1A 5HK4A 3O44A 2RUSA 3W8GA 3WIUA 3TZZA 5KFBA 1DRZA 3HD2A 2JFKA 4CLZA 1RKJA 2DNZA 1IKVB 3FQKA 3QT6A 4RLEA 4C0HA 4DCJB 5IOLA 1PO6A 2ZWPA 3VGVA 4KIAA 2BW2A 2F40A 4C48A 1WHVA 1WKKA 2DY9A 1YX2A 2BE9B 2KO1A 3IS9A 2E5IA 4YY3J 4B02A 3KK2A 8AT1B 4ZHRB 2MSSA 4C8LA 4QW9A 4WFNQ 2VFUA 1W26A 2G2YA 1RAAB 1NPRA 2WSCC 3HHLB 3R97A 5F9LA 2HMIA 1LXJA 2BE2B 1U02A 4J9LA 3LP0A 4WKRA 3UN3A 4QPXA 3O1LA 3BDEA 2XY5A 5T41A 5EGYA 3BQ0A 1FXDA 1YGYA 2EK1A 3CNQP 3QO9A 1Q53A 3J7ZT 2RNEA 4DV5F 3J7A1 1G1XA 5KOXA 3LGMA 1WHYA 3M8QB 3OXFA 5L9XA 1XMOJ 1RTHA 2W2NP 2H1YA 2IAJB 1U2RA 2PA3A 1O5JA 1F0XA 1XIQA 3W62A 5AJ3F 4ECZA 1S97A 2GQCA 3SIPB 3HHDA 2FLLA 2QEXS 4DL3A 3PO4A 3PXGa 4B3OA 4ZVFA 5KFXA 2HFZA 2JRSA 4LF2A 3UQSA 1NKBA 4ED6A 4CO1A 4CO2A 3RR7A 3CIMA 1YJNS 5GMEA 2HVEA 2APOA 1R0AB 3DYAA 4X84A 1Q7LB 3CT9A 3UDCA 4DR6F 2MLXA 3LPEA 2J7UA 2C2NA 4ZPBA 3ENVA 2CQ0A 1QUVA 4C8YA 4QOTA 1DQ8A 2G9OA 3OTDA 4DN9A 2XI2A 1AUDA 2XSJB 3CJ2A 1HMVB 2ADBA 3A8JA 4Z7CA 2UUAF 1U49A 5FDLA 1S1XB 1JMTA 1Y3KA 3M05A 3OFFA 1UL3A 3DLKA 4G1IA 5FIIA 4DX6A 1WACA 3O5TB 1NJXA 2GIFA 3C6UB 4DG1A 1WD6A 3LWMA 1N0UA 1Q8KA 3KK2B 3R3TA 1SJRA 4R8UA 2VQFF 2HYIB 3G8QA 3PFOA 3AA8A 4NLTA 3M9NB 1FNOA 4UOHA 3RB0A 4DQRA 2EFNA 3E2EA 2HQIA 4HACB 2HVDA 4YOEA 2XMKA 2ZZTA 4TY9A 1HQEB 1K0VA 5D3GB 1VQ7S 1KQSR 2WONA 3FSXA 1XEZA 3FC9A 2ZBQA 2HNZA 2VKZG 1RA7A 2ZJQQ 2V68A 1XQIA 3MM5A 1RHJB 3TX8A 3BH6B 1RWPB 3M7VA 3OR1B 5C24A 3WDOA 4F0HA 1HI0P 4N8NA 2HPUA 1V3SA 5DETA 4DQPA 4ED0A 3MUMP 4N41A 3IBWA 3B6BA 3IGVA 1K44A 4FYWB 4H4KA 3TAMA 4C98A 1NUEA 4JI1F 3UN2A 5C7PA 1IXKA 2CPJA 4JI8J 2X1AA 3D5MA 1TKXB 3CCZA 4USHA 2MHNA 2HEKA 2OMLA 2OUGA 3GB0A 3MAAB 3BR9A 5I42A 3IM8A 2YWKA 2XG8A 4UY85 4LFBJ 2CPFA 4B9UA 2XNRA 2JVOA 1X5TA 3QWPA 2ZFHA 3LALA 1RP5A 1QD1A 1NB7A 3DDKA 3U27A 2FJXA 4RW8B 3Q23A 3MPWA 5LSOA 4DPYA 5LMUF 1NAQA 2GQ2A 1U8WA 4QPTA 2BZ2A 3W60A 1HMVA 2OPPB 4ES2A 3MI7X 1S0NA 3ZZTA 2PI4A 4PXCA 5A8RA 1T3NA 2J0XA 5IC6B 1IBMJ 3CMQA 1TKTB 2M2BA 1LWEB 2CPXA 2P9CA 3R5BA 2UU9F 2D1CA 1Y5IB 4NEZA 3A3OB 3NRBA 4YDXA 6AT1B 4DR3F 3EGZA 5LSRA 2DCUB 3I82A 4WXWA 3G4SS 2MKJA 2UXDF 2F8EX 2MY8A 1BQNB 4I2QB 4Z7YA 4HDHA 4IFYA 3LP1B 1Z2ZA 3W9JA 3MURP 3D2WA 2AD9A 3NCRA 2J0QD 1W7WA 2N4CA 1T9VA 2HQDA 1UZDA 2QA2A 4I0WA 2PC6A 2W24A 1XWLA 2YQ0A 3CJSA 3KFWX 2K7JA 1JLAB 4R25A 2PGCA 2NXJA 2WONB 3MEDA 4X64F 4CQ1A 5DDPC 3OUYB 1CSJA 2HNDA 2ZD1B 3KG4A 2ZKTA 3W65A 4F67A 1IN0A 2OPSB 3L95X 4AQYJ 4Q0BB 5EWGA 1TL1B 4WU2A 5EUHA 3VGTA 2AJ1A 2ASDA 1UJ6A 3IXQA 2G4BA 2HBQB 1R8HA 2R2RA 3R7SB 1F5AA 3BM7A 1WC3A 4HYKA 4IOCQ 3TQ1A 5A76A 4B9SA 3N5BA 1VRTB 2EFVA 4ZLPA 4TLRA 3G6VA 1V3RA 1WOSA 2OPQB 2CQIA 1L3UA 1PJ7A 2BA9A 1U7LA 3J80U 4WP8A 4YR0A 3U1MA 4K0KF 3T19A 1HYSB 2GIRA 4TU9A 3FKBA 4J9KA 3SZ2A 3SXLA 4U7CA 1MSWD 1TTHB 5CYQA 4QWDA 4DV2F 2HRTA 3MAAA 1EQMA 1JWWA 3ENWA 4EYIB 2BOAA 2AZ3A 2DNMA 1LW2B 1Y9OA 1F9EB 3PW4A 4CYUB 2QLBB 4WYWA 1UVNA 4Y6IA 2GMJA 2RQMA 2W2OP 1V3ZA 3KG1A 4KGKA 1WI6A 4USTA 5F0UA 3NNAA 4WK3A 2QSFA 4A8FA 1FWLA 3MM7B 4WWSA 5KFVA 1IQZA 2X1GA 1PJ5A 2ATLA 1FKOB 1N4LA 1ZBTA 5K8NA 3WX8A 5F8NA 1FTRA 3O8WA 1D09B 3PTWA 4G65A 5FDLB 1TVRB 2VDHA 1JLEA 3VR1A 4DL7A 4UZCA 3HJVA 3ILIA 2FY8A 2BRKA 2HLUA 3CJ4A 2H4YB 1U1LA 5ETVA 4ZIWA 3QWUA 1WF1A 1H98A 4ID5B 4DX8H 2ZOGA 1W2BR 1X5SA 4JI5F 1LWFA 2MQOA 1Y11A 1LWXA 3P45B 5KT7A 1VBZA 1QE1A 2DNKA 4LRCA 3QSYB 5LT5A 4C6AA 5KFQA 4EU0A 2OJ3A 2NUHA 3RRGA 1GQEA 3GFXA 3MECB 4CM2A 1RAEB 4GC7A 4X66J 1NSKL 4OZ3A 2AJ2A 1YDLA 3ZTPA 3HULA 4FVMA 2C28A 1T03B 2VU5A 2OTLS 1GMUA 2LXUA 3TOQA 2L3MA 4ZIVA 1KC8T 4P6QA 2H48B 5EWFA 3H2VE 3KXDA 4O0IA 2CQPA 3H98A 4N47A 2L9WA 2C2RA 3AJDA 1VRTA 1U6BA 2WSFC 3GQCA 2QLJB 1VQ8S 3VAHA 1T05B 1RHKB 4Q7AA 1NH8A 4USKA 4LF4J 1UVLA 2YNIB 2RQKA 2QYGA 2DNNA 1DQ9A 3TJ9A 3U7JA 5KG7A 5KT3A 3R5GA 4DWIA 2HWIA 2U1AA 3CJ8A 5KFAA 4C9DA 5K8MA 1TL3B 2NCKL 2OSRA 2IM0A 2VUGA 4RW6A 4DCPB 3SSQA 1VQPS 2W9BB 1X7VA 2I8EA 3CCSS 1ZPWX 3NGUA 3U02A 3R27A 4C8NA 2WB1D 5KFOA 5D0RA 4X62F 4X4UA 2B8QA 2IJNA 4LF7F 2IIHA 5IT9U 4RO0A 2Y1JA 2R7QA 2XNQA 3ENQA 2FC8A 3GONA 3TEGA 1XMQJ 1WEYA 3THPA 1SV5A 4X4PA 2G1DA 2OPRA 1VQOS 4QU6A 2VBWA 4NPOA 3JTPA 1AROP 4RU9A 4OV6A 2ZZMA 2E1AA 2NPIA 3AD7C 4RBVA 3NNCA 4K4ZA 1M5PC 1RBAA 4B3SJ 5D8HB 3KLFA 1H73A 3KLHB 3EGWB 4ZOSA 3BQ2A 1H6KX 2FGOA 4M1KA 1RBOB 5CXTA 4UOCA 3FVYA 4OI2A 2QFJA 3MWBA 1HBOA 1R3NA 4ZVSB 4F2SA 2UXCF 3K2YA 1OSDA 2ROGA 3A8IA 4TU8A 2MJUA 2ZM6F 2DH7A 3W2VB 5J2PA 1ULRA 2J8SA 3AOAA 2FDNA 3M6WA 4ANDA 1BQMA 3R8YA 5IV3A 3ISNC 4WFBQ 3D0HE 5DRKA 1KWMA 4QYZJ 5C2CA 2UV8G 4OYBA 4XDDA 3EXYA 2BM0A 1RT7A 2POKA 1R8PA 2ZBIA 3C8YA 2IM2A 4RNNA 4WK1A 3MR3A 2G0JA 4TY8B 4DBQA 3KHGA 1KOHA 2GMHA 4ED3A 3NKYA 1U4BA 1ZAVA 3K0JA 5J2QB 2DITA 4USMA 4IG3B 1N5SA 3EVWA 2XC9A 4ATNA 2LKZA 1R6YA 1YRXA 1KHWA 1FE4A 3WQPA 1TK5A 4LSNB 1X5PA 4O0NA 5KG0A 1Q8IA 5B0AA 5CYMB 4CT8A 5B7WA 1HNVB 2KG1A 2VICA 4LSNA 3V4IA 3GPAA 3S01A 2RMLA 1NU4A 2PN6A 2RQ4A 2FB0A 1MU2A 3PCOB 2RJZA 4RW6B 2R2UA 3J80Y 3DLKB 3IAS9 3CD0A 3PYDA 5KT2A 1G3OA 1TVRA 2ZH4A 3ET6A 3BPDA 1L5UA 3MD3A 1EKSA 4HT5A 4CLSA 1A7GE 3TUZC 1N56A 1XJWB 4JV5J 2OFHX 3UR0A 1NCLA 3BBCA 1FNXH 3A3NB 2VD3A 1X8DA 4ZP7A 3NS6A 2ASJA 1SC4B 4CWBA 1UVKA 3AOBA 3GFZA 4I2QA 3K5PA 3IWXA 1S77D 1RUSA 2ZH8A 1PJ6A 1T0TV 1N5YB 1GXLA 2MHEA 4ILRA 4MT1A 2OTJS 2D3ZA 3GG0A 4RPFA 3MEEA 3NXZA 1PIEA 3GJQB 2XULA 4CH0S 1RZMA 6FD1A 2EXUA 5LOQA 3VV2B 3HVRA 4LRDA 4GKKF 1LK5A 1HD1A 3ZTQA 4DFMA 3PW5A 1S0OA 2RU9A 4QW8A 1XNQF 3IM9A 1EKRA 2VPXB 3QLHA 4DUYJ 1JXVA 1D3WA 4NLXA 2AGQA 2ZOFA 2AV5A 4ZP6A 1OMSA 2F1FA 4F02A 1DLOB 1FEEA 1IWAA 4DV6J 5KFFA 3CIZA 4ECVA 1UFWA 4X66F 4OHWA 4USJC 5HSPA 3W61A 1F1BB 1QM9A 1OO0B 2PFDA 1ZA1B 2VG6B 5LMUJ 1QLNA 2C42A 4A8KA 3GSDA 3ICLA 1NK4A 3C19A 3CGIA 3JB9k 5D77A 4YR2A 2RT3A 3LA0A 3NP5A 4CO3A 2UU9J 4O3NA 3MM8A 1RI7A 4KV8B 5B0GA 2M70A 3MM8B 4ILLA 4EWTA 2ABYA 2MKCA 4DQQA 3BF4A 1FJGJ 3HT0A 3DKDA 1KONA 5L1LA 1WNEA 5JUMA 2UUBJ 1KTQA 3DI6A 3LGHA 2W2QP 4JI0F 3JSYA 5L38A 1XMOF 4KE5A 2CPYA 4DV7F 1RDRA 4ILMA 5DZ7A 1U26A 2DNYA 4X2BA 3N0VA 3VAMA 1NK0A 1TKTA 2P9EA 1FNMA 2DY1A 2XYGB 5G4DA 3D67A 1HLWA 3T6BA 1NK9A 2E9TA 2NPFA 1HQ2A 3FCVA 1S6QA 5KFLA 2ALYB 2XZDB 3BGFA 1R8BA 5DGAA 3IP0A 3ITHB 3HSDA 1WOPA 2Z2YB 3GJSB 3RW7A 1GFWB 3ZFVA 4C11A 1KLMB 5BJRA 2FJEB 3RB4A 4ELVA 3D66A 4Y2AA 4F8RA 2KHDA 1XR7A 4U96A 4Q44A 1HWJA 2YNGA 1AXQA 2OI2A 2P6TA 3GE9A 5ETRA 4KKOA 4XTTA 2ROEA 2D7SA 2FJWA 5F3ZA 3I9V9 3UPFA 4O4GB 4NRUA 3OLBA 1Q5VA 1VQSA 2BUNA 1OY8A 2O1PA 1B3TA 2UUAJ 3NGDA 2YX7A 3IBFB 1RWNB 2XHCA 4HT7A 4PZVA 5CCLA 2GIQA 2CJXB 3DOMB 2B4VA 5U47A 2FLNA 1EQ0A 1S9EA 4U7UK 2WW8A 4QIWD 4Q2LA 3BSOA 3V4MA 4LF9J 4Q45A 1Z4UA 3KKFA 4X4NA 1Y7PA 3HLUA 3I4HX 1YWXA 2V9WA 3D54A 4OI1A 4EFAC 1FFWB 1XERA 4ANCA 3BB5A 2QO3A 3IN5A 4ICLA 3OJUA 2R7XA 2FVCA 2Z58B 6FDRA 4PQUB 2LU1A 2N3OA 4A8QA 5EDWA 4XDCA 2XMAA 4B3TF 4B3RJ 3H7HB 1HNVA 1T94A 4DV4F 3KJVB 2OPPA 4DUZJ 4JI6J 1ICEB 3IMQJ 1I5OB 2ZUGA 4OLPA 2H5EA 4PCQA 2BM1A 3KDNA 3CCUS 2KFNA 2YWWA 2VBXA 2MDAA 4NXNF 1N54B 1KP6A 3KLEB 3G96A 3AAWB 2ZE2A 3TZYA 3RYLA 2XSJA 3CC7S 3AB4B 3DMJB 2YVSA 2XMUA 3IC1A 2DRAA 3ITHA 3EICA 2EK6A 3MEEB 3WHIA 2OPRB 3QIPB 1XK8A 1U09A 2L48A 3QT7A 3M6VA 4I6AA 3VAIA 2DPJA 2YKPA 2QRRA 3G6ES 3UCUP 2C1EB 3KLIA 1S7IA 3MMCA 1N6QB 1JX4A 2YKQA 5I4MA 4LR7A 1I94F 1NMEB 4LRBA 4D3HA 4ED5A 3EUNA 3AB2B 3CJKA 1TV6A 2WVFA 1D9FA 3MMAA 1WELA 5D6GA 2W4CA 2OSQA 1CULB 2YKNA 5M2PA 5EX3A 4NLUA 1ZM9A 1C0UA 5KT5A 1RTHB 5HN0A 1Q0NA 1VHIA 3MM9A 1WSVA 5HAOA 2YX1A 1YQHA 3MAHA 3J81U 3BKTA 5IM0A 1RT3A 1U0HB 1VGYA 4KB7A 3H25A 5T7LA 4O3PA 2Y8WA 2M3DA 2OMOA 3NOCA 3ZO7A 3MCMA 4NOHA 3O3LA 4DSKA 3I0SB 4S0MA 1K73T 3OVBA 2EI5A 3VTIA 4EI2A 5GADU 4TY8A 1NDLA 1S4FA 2HVIA 2DNPA 4KFBA 2ASYA 2J7WA 3N4WA 3AD8C 4PABA 3IR5B 2CPIA 3MOZA 3P49B 2CZVC 3V6DB 4O44B 1TQLA 2HHXA 1V5VA 2DEJA 3CJQA 3J81j 3BO2A 3EZUA 4TNOA 5AE2A 4AE5A 3E8OA 3FBBA 3G82A 2DRDA 5IXUA 2C3OA 4KPCA 2WVBA 4DV3J 3FMBA 4HKQA 1U6ZA 5DDRC 2QA4G 2X1BA 1A0OB 2ZVIA 1CJVA 2ZJPQ 1H7WA 1RTJA 2LYVA 3D7SB 4ZA1A 3RBZA 2IBKA 4OLOA 1UZHA 3ZZZA 1RWMB 2XM3A 1SC6A 1W25A 3FRYA 4H4MA 2UUCJ 2BJ8A 2DGWA 2RSQA 3T1YJ 5T14A 3LAKA 2CJKA 4DHVA 1JB0C 3LF0A 4DU7A 4YB6A 2F4VJ 4ED7A 3AT1B 1RAOA 2HFNA 3BREA 1SCJB 2AKWB 2LU2A 2PEBA 3D3BJ 3KJQB 1BY9A 3D1QA 4QR0A 1KVKA 1HNIB 3LP0B 4ZKAA 2M8DB 2CXEA 2F4FA 2V63A 3N01A 3FDSA 5HBMB 2OIHA 3QFWA 1TUWA 5DLGA 3PEJA 2WBRA 4C3MA 5J1EB 3VAJA 1PC4A 5H9EK 2B9WA 4IG0A 1UA1A 1FKPA 3D1OA 3KMQA 4ZVRB 2BVZA 4J91A 3SCKE 2ERRA 4WZQA 1HBOB 2B3TB 1FESA 3PFEA 5DQGA 4LF5J 3I5AA 5IQ6A 1IR0A 4FBUA 1KBRA 1N36J 4NI2B 5CABA 1FJEB 1T9WA 2H65B 2LQ9A 1CVJA 4M94A 1X5OA 4OZ1A 3ILJA 3MMJA 1URRA 3DOKA 2DGTA 1TL4A 3MTJA 3WZ0A 3QRRA 5AT1B 5H9FJ 3GMGA 3RGIA 3UDVA 3M8WA 4FP9A 5A8RB 4Q2MA 2A6MA 3KHRA 3TZXA 5KFSA 4J37A 3OSNA 1IM4A 1YBTA 4P71A 2A6OA 2DR5A 2IFXA 3ZZRA 3IG1A 3C15A 2UXBF 4ECSA 2DHSA 4OIXA 4TKTA 4FBTA 3KTQA 3K8WA 1S9GA 3D3CJ 1U1OA 4B3TJ 4B3RF 4QCLA 2FHOB 2ZKUA 1S9GB 3RR8A 4WKYA 4MKYA 3W3SA 1HIYA 1FD8A 3QFHA 4LBHA 4DR5J 2HZCA 4GO7X 1NH7A 3B82A 3Q2SC 3KLHA 5KAKA 3BPSP 4DV5J 5KTQA 2VF3A 3Q83A 5L1JA 1LWFB 3CJ5A 2QJ3A 5KFPA 1H2VZ 2DVIA 4B3MJ 2JEJA 3V81A 5DLFA 1FD2A 5ADZA 2G0IA 2HQGA 3UR3C 3HPOA 3UI3A 3OL9A 3NWGA 3DLBA 1H74A 4IRKA 1NZ8A 3MM5B 1JLQB 4OYWA 2B5JB 3IGNA 3EX7B 3ZZUA 1FDAA 1NDCA 2AGOA 2R42A 3RAMA 1LFWA 2LMIA 3TJAA 2C2DA 1TP7A 1WORA 2D3UA 3WC0A 5IQQA 4X4TA 2HWHA 1N36F 4K8RA 2GHPA 3OUYA 4ECRA 1VC0A 3W2WB 4FF1A 3QLHB 4DR6J 4DPUA 4I6WA 1WTFA 1UVJA 4CO4A 1E6YA 5D4OA 3CCLS 4ZK7M 1VQYA 5I42B 1RT5B 4MKVA 5A8WB 5H1SV 4IG0B 2IC3A 1S6OA 1T9YA 1T9TA 3LOUA 2B9EA 5KFIA 2AF6A 4IG3A 3OL7A 3W8PA 5GMKa 3F41A 3OT9A 2YNIA 2PA8D 3L7UA 5GAGU 2WAQD 2HGLA 3ISZA 3SFGA 3V6DA 3O2IA 5KFHA 1MNEA 1ROFA 2J7KA 2VPZB 4J9OA 1VQMS 2DNLA 3BO3A 4DR7J 3EDRB 4PQUA 1HW9A 3M32B 2DR8A 3WBZA 1G2EA 4WZMA 1GXUA 2DH9A 2KXFA 2HK3A 3DRRB 3TEHB 2XYHB 3DRPA 4E8UA 3DRRA 3I5BA 2DGQA 2CQCA 1N34J 3NCPA 2KVQE 2XSFA 1RTDA 2GVZB 1SXLA 3LW5C 4G1PA 4JBCA 1TELA 2QL9B 2OEMA 2AU0A 2H51B 2UP1A 2VKRA 4J5OA 2LCWA 5GAEI 4U9RA 4IDKA 5KFRA 4AT1B 1FX2A 2ATCB 3IBCB 2CNKB 3MPUB 3PR4A 4NCAA 2LEBA 3KJFB 2CVIA 4X4RA 1WF2A 3ADAC 3GP9A 4LF6J 4A8OA 2XY6A 3H20A 4WIIA 5DO2A 2KH9A 3R7BB 2LQJA 1WC6A 2I6WA 1N33F 1SQFA 2FVQA 2DR6A 1QAJA 5F8HA 4CLKA 1VQLS 2KZZA 3VZHA 2BOPA 2FVRA 3RBDA 1DTTA 3UNYA 3D6MB 2DXFA 2HAIA 4ZJOA 3TA1A 5HP1A 3GJRB 1MW7A 2MGZA 1HQEA 1SJ1A 1UMJA 3CSKA 4ED4A 2NXEA 3T5LA 4JOUA 5A8WA 2BW7A 4RW7A 4KKOB 3IS9B 1B70B 1KQFB 2IA6A 1NSQA 4LJMA 3QBCA 1P6TA 4LR8A 1WKLA 1HR0J 4W92B 1BQXA 4H4KC 1FVQA 4F0KA 4JV5F 2KKHA 4B3OB 2YY3A 4C3KA 1QTMA 4D3GA 2KYXA 2B43A 2K8GA 2E9ZA 1FO1A 1U6FA 1VISA 4EYHB 1D1UA 3M2VA 1HW8A 4M5MA 4ZLLA 2BJ3A 3CDUA 3K58A 3I87A 4MMOA 2N3LA 2ZH3A 3CCWA 1EB0A 3AY0A 1YZ7A 1VYAA 4FZVA 3T9NA 2FD2A 4LF5F 2FHMA 4OZ2A 5BYRA 4M5HA 1RBLA 2O67A 4ICLB 4B17A 3QZ7A 4A8WA 3G9CA 4WFZA 2C3UA 3DHWC 4OYOA 5B0BA 2WZ1A 2J5AA 2BX6A 2V4JA 1C4CA 1CQNA 4F4YA 1SKSA 1WJ9A 2K1RB 1JLFB 1JLBA 3HVTB 3JQMA 1UPMB 1YJWS 4QQBA 2NZ4A 2CFXA 2HW3A 3PNIA 1NLKL 1FEHA 2BJ7A 3H0PA 4M5LA 2MQPA 4FYXB 5LXYA 1SL0A 3KLFB 1KVJA 1YJRA 2GHWA 2MY7A 3ETOA 1B7FA 2R2TA 2HVZA 4LRFA 3GIRA 4P2FA 1H7XA 4BC9A 2AQ4A 2HHQA 4U67Q 5KG5A 1TUGB 1PBUA 1X4HA 4ZN1A 1SPBP 1DFDA 3MAQA 4PXEA 1WTBA 4LFCF 3H5SA 1LK7A 4NA2A 3AA9A 4FYDA 4P10A 1S7HA 1U25A 3DM2B 4C7QA 4RJVA 2ZUAA 1D9AA 1O6XA 3DNCA 3QMQA 1B4SA 1HBMB 1SQEA 1NK5A 4JI5J 5LL6d 2G0CA 4URGA 1J5EF 3OTEA 5A8KA 3FGVA 4QYRA 3S6EA 4ZPVR 3TA2A 1CG2A 3T1HF 3NGTA 3GTYX 3DFEA 1VIXA 4USVA 1K1SA 3HVAA 3SDEA 3W5ZA 2W9AA 4JB8B 5J2PB 1GH8A 1IUJA 2MQLA 2CPZA 2YNFB 4MAKA 2DXDA 2Z56B 2PD1A 2NSCA 5C2GA 5K20B 1S9FA 4L3NA 4OHYA 1G7CB 1FI4A 3HDSA 2YXLA 4NYZA 4C0OC 2PO4A 2XWYA 5C5JA 4K2JA 3CJ0A 3GIJA 4YY3F 5CD4H 3DOKB 3G82B 1FKAF 3Q8VA 1A9NB 4Q5VA 4UY8T 4IH7A 1VQKS 3NMRA 8RUCA 5D4PA 4OHZA 2CJBA 3PKMA 2WTFA 3DHXA 3PW0A 2QG9B 3CTRA 1RYSA 2OFGX 1WF0A 4NLQA 1FHTA 3CDWA 3NGRA 1DJ0A 4JUZA 2VJUA 2JEGA 3TVYA 3KLEA 2HFUA 4WPAA 2NS1B 1I3OB 3GYXB 3CXCR 1V6HA 3HP6A 2F4VF 2E7WA 3VHQA 3QJLA 3KLVA 1F5BA 4K4WA 3MEDB 1ZM4A 2N4DA 1SIZA 1CJVB 5G0RB 4ID5A 3UNGC 2AYMA 3ZC4A 2E1MC 2P9GA 1T7PA 1IKXA 5HLFB 2XMTA 3RU0A 3T9ZA 5JVHQ 1D8YA 2Y1LB 4KYZA 4LREA 4MTPA 5F9NA 1BQNA 4J9PA 5J2MA 4DR4F 3QGHA 1ZTWA 4LF6F 2F9DA 3GFHA 3VGSA 3R1HA 1XNRF 1EHWA 4V19X 1WC4A 2B9YA 2W2MP 3FBEA 4DOZA 2BRLA 3QQCD 1I1GA 3W2VA 2MZRA 2H3EB 2JX2A 3BSCA 4ZLNA 1OY6A 2KFYA 2M5YA 2YQ1A 3M9OB 3OW2R 3MCSA 1JLGB 5ETSA 2X7IA 3D6HB 3HHLA 2YNFA 1J27A 3IRXB 4Q0BA 3LUYA 4EBDA 3EDQB 3ILOA 2IC3B 3TA0A 1FF2A 4TQRA 4U95A 1ZTTA 1KD1T 2KU7A 1EIYB 2HS0A 2UXCJ 1OYEA 1QY7A 3N9UC 1GTHA 4HH0A 2EBEA 4K7QA 4X4SA 2HHTA 5A2QY 2EFOA 1N5QA 1HNWF 2LEAA 3AOCA 4HHUA 1TMMA 2V94A 5M2RA 5J1PA 1FXRA 4U6PA 2V4JB 3Q22A 4ECUA 3UCZP 2UXBJ 3PYGA 3D1HA 2HZAA 3Q2TC 2LEPA 4K4YA 3MR2A 2DD8S 2HS4A 3W9IA 5E33A 2WK4A 3PRVA 4DUTA 2E5GA 3POTA 3UFCX 5BR8J 3CCRS 2IM3A 5HO4A 5LMNJ 2Z57B 3CVKA 4DPWA 4U8YA 1KFDA 1UP1A 1C0TA 4B08A 2Q1LA 2AHOB 1WEZA 1E6VA 1HI1A 4ECXA 4CO5A 2AYGA 4YEAA 1I51B 3KG0A 3JAMU 3FSIA 1JLAA 5D15A 1M5HA 2VQEF 1LNQA 1RT4A 2H5JB 4GVBB 4RNMA 1X4AA 2KVIA 5JXSA 2R2SA 1R0BG 1ZOTA 2KDOA 3DLJA 1QVGR 1VHFA 3KUGA 4F4AA 1BWEA 5BYSA 1NSPA 3KUEA 3N79A 3JAMY 1DTTB 2C3PA 2B7BB 3PDNA 3HF5A 2YPZA 3EVMA 1FDDA 3P5TL 4TYAA 1WG5A 3V81B 2RHQB 5B0FA 2XB2D 1LOUA 3QIDA 2Z0GA 1SVDA 4WIQA 4F4WA 3RBXA 3D9BA 4RWXA 1P1LA 3MECA 2CJ9A 4USIA 1DTQA 2V34A 1BQMB 2NXNA 3TARA 4DR7F 3I4PA 2MQ8A 3T1YF 2PMWA 2JC0A 3BGRA 2CAJA 1GAOA 2PDAA 3EZOA 2HHHJ 1CQMA 3OTCA 4LVOP 2OAUA 2V2ZA 1XTZA 4F3MA 4NZ7A 3GWCA 2AZ1A 4QR2A 1OIAA 5HMYA 2W9BA 3OSPA 2DR9A 4ES1A 3G6YA 2KJVA 2IAJA 5J2QA 1XBWA 4Y2KA 2OKQA 2BJEA 2Q3PA 2OELA 4O44A 2LLZA 3HKWA 3CMAS 4AL6A 4NA1A 3M32A 2EFGA 3KHLA 3AODA 1NK8A 2C2KB 5F3TA 4IRCA 1HBUB 4PPZA 4CO0A 3PR5B 1HHQA 1R27B 1Z2LA 2RD5C 2AIRB 3J7YI 1CBKA 1SV5B 4J90A 3CCJS 1GTEA 4OQJA 1LXNA 2JSXA 3GYNA 4NLRA 5RUBA 4QWAA 3NY0A 4DF4A 1S12A 1LWEA 1SKUB 2B51A 2E7XA 1UW9A 3I9ZA 2B4UA 3G8TA 5KFZA 4RNOA 2CG8A 5LJ3Y 4FYVB 2NZCA 4OX6A 2QLXA 3BR8A 3DDIA 5CZXA 3ZZPA 3OTOF 1U1QA 2QT7A 3BSNA 1F2HA 3NAHA 3C16B 4PWDB 2JNJA 2Z2ZA 1S1XA 1Y5NB 4LF1A 4DN0A 4ETXA 4ZJQA 5I3QA 3JTNA 4X4VA 2Z2MA 2GA7A 5KFTA 3PVXA 2JEFA 1P8GA 1JLGA 4EZ9A 2UVWA 4OZ5A 3IO1A 3DRYA 3LP2A 3VAGA 1HBMA 1NJZA 2GMLA 3PEHA 3LH2S 4M95A 1JXEA 2CDRB 3AJ2A 3V5RA 1U8SA 1KEKA 2MQMA 3E01A 2Q66A 3TAMB 2VA3A 3E01B 1FWPA 1UJ5A 2F63A 2ZBPA 4KO0B 1YJUA 1M0SA 2FJBB 4JI2F 5K9FA 3PYEA 4KBIA 4KGMA 3VGUA 4OJGA 4KSEB 1TZ0A 1VMBA 1OSCA 2D9OA 2B9XA 2QV6A 1ZETA 2HBZB 2XQCA 4CIOA 4NI2A 1AB8A 1WC5A 2J8AA 5KT4A 4DV1J 4HI2A 4UQTA 4DI6A 1W2IA 2DNHA 3H5YA 1BHNA 1WHWA 3RRHA 5ETOA 1GT8A 3IR6B 3WIVA 2W01A 1PYTA 5DQHA 2RDIA 1IBKJ 1YVFA 2K1RA 2RS8A 1KKHA 4F25A 2CZ9A 1HNZF 3FK4A 3CCQS 2DPIA 4C2MA 4WFYA 1N88A 3BKFA 3TQEA 5HROB 4UUXA 2RS2A 4LSLA 2J6TA 4B9NA 5KFCA 2U2FA 2EFPA 1JNZB 2CPEA 1RAHB 3M4XA 1KR4A 3HKZD 2V4RA 1NPPA 3QGIA 1U1NA 4ETZA 2DTJA 3KK3B 1RHUB 2RRBA 3GV7B 3MR6A 4DV4J 3TVZA 4NLGA 2FZKB 1HNXJ 1U0SA 3TR5A 5IC4B 2YNHA 4ED8A 2DHAA 5D0GA 3DRXA 3TP2A 5LMNF 3GLJA 2WVDA 1TR0A 4A46A 4UW2A 4ERDA 3EZ5A 1TU0B 4RWWA 3H4DA 2MQQA 1HHSA 4LFAJ 3X1LB 1TV6B 1U1PA 1J5EJ 3MMBB 3Q86A 2MKIA 3W9HA 2R8JA 1S10A 2COLA 1X9SA 1CLFA 4RW7B 1GX5A 5A8KB 3I56S 1L3VA 4PYAA 4C11B 2E9RX 1DARA 1YHQS 4F26A 2KT3A 4HR2A 4LF7J 3A3PB 3LGNA 2VJVA 4FF4A 5F8MA 4USUA 3SQGB 1FRMA 3M8PB 1BMQB 4MKAA 3HHNB 4O3RA 2DO0A 3PW7A 2FVPA 1FERA 1UWBB 4HHJA 4IR9A 4DV0J 2H5IB 1ZA2B 3RW6A 3LTOA 4OI0A 4DPXA 2HS3A 1NDKA 4FNIA 3QATA 3RG6A 2WW4A 2VHGA 4PUOA 3SDEB 4ANEA 1SB6A 3PHTA 3CCMS 2ZHBA 4JI3F 3BGUA 5DJBA 2VQFJ 2F8HA 3LAMA 3M30A 3EYZA 4IO1A 2Y9HA 4NLSA 4NRTA 4I68A 3E3XA 1RISA 2BXJA 4ZVGA 2FJDB 2WCXA 4KTQA 1SUQA 4IH6A 2E1PA 5A2QU 2X3GA 1PAEX 1FJCA 3UCGA 3MTKA 4CI0B 4P7TA 3CJ3A 1HHTP 2WOMB 2VOOA 5KG2A 3SBMA 4KQZA 3PG9A 1B64A 4NYPA 1B0PA 1F3FA 3JTOA 2EKYA 4F36A 1Q82T 3RUBL 2NUUG 3PRBA 2I5JB 2CQDA 3IRWP 3N6LA 4RW9A 3IWNC 3MMBA 5F0WA 2V0NA 4QIVA 1Q7YT 2J9DA 2PMHA 4EMDA 3M2UA 2HHWA 3C16A 3DU6A 4ZPWR 4PWDA 2FQQB 3CD7A 4PRFA 2HK2A 4NMLA 1M1GA 5GAHU 3FUYA 3VCDA 2BANA 1SH2A 3W66A 1PSDA 1TKDA 1VCTA 5KFNA 2W25A 2ZWOA 4Y0FA 4A8MP 2C22A 2HIYA 4WP3A 1IKVA 2E29A 3KDOA 3P4UB 3SSSA 3MOJB 2XMVA 3IAM9 3PV8A 2LDYA 2E7VA 2BE7D 2HFSA 4KHMA 4UZBA 1SC3B 4RW4A 2V2KA 5HP1B 4ZCIA 3M9MB 1UWBA 2GV1A 2ZVSA 1WI8A 2P6SA 1HD0A 1RABB 1IQTA 2XZWA 2CG4A 2VA2A 4TVAB 5C24B 3M8PA 4Y2IA 2I0XA 3V2UC 4TN2A 2A3JA 1FDNA 4TU7A 4RUBA 2ZH7A 4OV1A 4DL2A 1FCAA 2KT5A 1WG1A 3EGNA 1TL3A 2JL9A 3QNWB 1R8AA 3Q89A 3SEOA 2GFFA 4DJBA 3FCWA 2LQ8A 4KV8A 2AMCB 2R9LA 2ZNZA 3M8ZA 4L6V3 1ZAXA 4JI2J 2QLWA 5B09A 3SCIE 1HWKA 5EWEA 1EZZB 2VL1A 3BH7B 3ULHA 3PM9A 4X64J 3IG1B 1L3KA 2DHHA 3B54A 1CPZA 2O01C 2PE8A 2CADA 2VFRA 4KHRA 3DOLA 2QTWA 4LR9A 4PEOA 4NLYA 4CNZA 3JSRA 5IWAF 2CNOB 1GMVA 2GGPB 4RBUA 2YNHB 1OQ6A 2V8HA 4ZVTB 3DLEA 1VRUA 1B0VA 4DV6F 1TL7A 1XR5A 1K0TA 2J6SA 1O8BA 3K17A 1VQNS 1Q95G 2B56A 5MAOA 3HFZB 3OFGA 2MLYA 3W7BA 4PG8A 3ET6B 4HVZA 4EK2A 2ACMA 4FKXA 3AXMA 5KFMA 1WUUA 4EZ6A 2EBGA 2XBPA 2F65A 2UZAA 1Y4ZB 5KFWA 1M5SA 1IKXB 3PJ9A 1AZSA 2GJFA 3HZEA 4HI1A 1HARA 4YFUA 4NLOA 3F0NA 3KLGA 2CPHA 2LXFA 4GVBA 4ID8A 4FXWA 4UOFA 4NASA 4DR5F 4C4WA 1UW4A 2YKMA 1Q86T 5IS2A 4LBPA 4I2PA 5DZ6A 1E6YB 2HG4A 2XMMA 5KG3A 5AE3A 1RTZA 4CH1A 1H2TZ 2ZH1A 4QYZK 2HHHF 3DLLQ 1UVIA 2VC0A 1VQ9S 4M5IA 1VFJA 4OMFG 1L3SA 2IHR1 2DH8A 1YG0A 3DOMA 3THVA 4JYAF 2V2VA 1F60B 2BYCA 4I1TA 2JJ4D 1CJTB 1LW0A 1OJ4A 1S49A 2E5JA 3CB4A 1P9YA 4PYDA 4ZDNA 3M1VA 5B0DA 2D3OR 3PY8A 2P2CB 1JJHA 1FRKA 3OLAA 2CJYB 4YN3B 3RB3A 2V8GA 2NREA 2UVRA 2XY7A 3JXOA 4P2SA 1NO8A 5EN1A 1FDBA 5L8RC 1WDTA 2VBYA 4RKUC 1AT1B 1IJEB 2FLOA 2LDIA 2GVZA 3EJMA 5HQMA 4B3MF 3UDLA 2QZ8A 5AXNA 2KXHA 1Y5LB 1T02A 2XMJA 4LSZB 3ZZYA 1PKUA 4OX9F 2EW9A 4RX6A 3GILA 2Q6CA 3DRSB 3NBPA 4R0EA 3HVWA 5I3PA 3I5CA 3UE2A 3MEGB 5CHCB 3FFIB 1RADB 2FGCA 3N5FA 1Q8LA 4F3QA 3HX9A 3Q8YA 4FXVA 4NLVA 2ZJRQ 5HROA 2HHVA 2I38A 2A0FB 5BXIA 2V50A 3BZQA 4IFYB 1QSYA 1NM2A 5KOWA 2IRXA 3GIMA 2WVCA 1K1QA 3CF5Q 4HLBA 4LVNP 4TQSA 1MLAA 3QIPA 2IY5B 2AJ0A 5J2NA 4ELUA 2UVVA 1AYEA 1HFEL 2Y1RI 4Q43A 3QJJA 4FDFA 2BANB 1UJ4A 2AX1A 4IO9Q 1NK7A 1VJWA 4NCBA 4G1QB 3E51A 5D3GA 1T9XA 1Y10A 2OO4A 2P8IA 3OFHA 1LFPA 3ONQA 2W8KA 4LIRA 1FE0A 2LFVA 3HI9A 4P74A 1N5YA 4B3SF 2YNGB 4B9MA 1Q16B 4R0JA 2HHUA 4K4VA 2FZCB 4XIUA 4JI4J 4LT6A 4MKBA 3OPKA 2P5VA 5IFMA 1ZYQA 2HQ3A 4CLWA 3Q8RB 2V8PA 1JJ2R 1PCAA 3NWRA 2RDDA 3SQGA 5KFEA 3D68A 3EE3A 4YQWA 3BO4A 1SKWA 3QT8A 3P6YC 4AXJA 1YJ7A 3K5OA 5HVFA 1UETA 4CLTA 3M8RA 1C1CA 3EWGA 1MWZA 1ZZNA 1IVZA 2OD6A 5D78A 2ZM6J 5KFYA 4DSEA 1NPKA 3G6XA 1EP4A 2HURA 2VC1A 4LQ9A 5ETLA 2OD4A 4AUKA 4FPIA 1HNWJ 2NYHA 1NBEB 2N82B 2AEMA 2JFDA 3B4DA 3DOLB 4F2RA 1NSAA 2HWTA 2EC0A 1VRQC 3C15B 5CCMA 1N33J 4ZVOB 2D3O1 4PQAA 1REGX 3U1LA 2IJRA 1ACMB 4B9TA 1JKHA 1N5TA 2LA6A 3C14B 1H3DA 1RTJB 4N77A 2A2DA 5E3QA 1HBNB 3UD4P 1S1TA 4J9NA 2BACA 3QRPA 4J9RA 1B0TA 2RH3A 4LUBA 1RTDB 3HK2A 3CEDA 3NAIA 2R3VA 3CDAA 1GK8A 5J2NB 4K59A 2JZ5A 4PAAA 4ZVQB 1UVMA 4NWBA 1WG4A 2DO4A 1RACB 2M8HA 5LXRA 2HGMA 2V5HG 2W8LA 4H4MB 2KB2A 3C66A 4NLWA 3KNAA 2ZHAA 1K9MT 1FFSB 1YI2S 1AW0A 1H38A 2VIHA 2NR0A 4CZCA 2B0GA 1UKUA 3LP2B 3NNHA 2PT0A 2VV5A 5KG6A 4CH7A 3SCLE 4R8UB 2HRUA 1RJJA 4K50A 2K2PA 3UO0A 2AJQA 2OPSA 4O4GA 3C6UA 4DG1B 2EKNA 3CPWR 1QAXA 4G3IA 4QZVB 2QMUB 5DGBA
chains in the Genus database with same CATH topology
2K7KA 4AL5A 4DV3F 1IKYA 3CJKB 3KK1A 2VG5A 1WEXA 1NK6A 4ZCLA 1KLMA 5A0YA 4I69A 5DS7A 1G6BA 2RKIA 2CKWA 2Y0SD 4DPOA 4RNHA 2DNQA 2ZZNA 3ISND 2HGNA 4I67A 1U2FA 5ITHA 3NL0A 3I31A 4OFZA 1S1UA 2XEXA 1BLUA 2G13A 4ECQA 3NMAA 4C8OA 1UEUA 5T7LB 4M5DB 4K4XA 3PW2A 1J5OB 3MFIA 2KTQA 1UA0A 5F8GA 1JKHB 4TYBA 5F41A 3H59A 1Y3JA 3DRSA 3NBPB 1TK8A 3C46A 3L7PA 1LW2A 5IT9Y 1BGXT 1J2VA 3RTVA 4IUFA 2UV8A 4K5SA 4KRWA 5CH7B 3I32A 1C0TB 1Z1ZA 2M7SA 1JXLA 3FRZA 2R7UA 2XHWA 3HZGA 4NXMF 3P3DA 5CYMA 3QGGA 2CZ4A 4OHXA 3R1LA 4A48A 3KK3A 4RBTA 4PG5A 4HH1A 1Q81T 4P7VA 4EBCA 1XR6A 4MK9A 2IJFA 1KSPA 1DQAA 4X4OA 2HFOA 1X9MA 3MPYA 4LIWA 2LQ5A 2RRAA 1LV5A 4QWEA 7FD1A 4DFPA 4AQYF 3MF5A 4K4UA 2V8DA 4J9QA 1IBLF 5K8PA 1H0HB 4K2XA 5K14B 2EG2A 1KS2A 4KT0C 3M2UB 2MQNA 1VOMA 1C1BB 4OX7A 2RQCA 2YKOA 2BDPA 4V19J 1T95A 4OHVA 4K5RA 2MKKA 4DSIA 2R7OA 4PUOB 3OXLA 3FEYB 2IVMA 1N8RT 2Z8QA 3M6XA 4OI4A 4QIGA 2UUBF 3JSBA 4A8YA 5L39A 1R43A 1SI9A 2E1RA 3RAQA 2JVRA 2MKSA 4LFAF 3QGPA 4ZP8A 4WYLA 1M5VC 4DF8A 3S8SA 2GC8A 3GR0A 4Y28C 3BEGB 2UUTA 3PO5A 4DEZA 2NXUA 1R0AA 4ZS6A 2F7VA 4E98A 3KYLA 4NLDA 1FT8A 3C3LA 2VBZA 2DGSA 3RAXA 2XS2A 2J9DE 1R31A 3DCAA 2YWHA 2DR7A 2HHSA 1ZAWA 4JV2A 2ASLA 1XMBA 7FDRA 2OLWA 3RB6A 2EG1A 3CC4S 4FF3A 5KG4A 4WTYA 3SCJE 3HVTA 2J0SD 1VQ6S 2Z4PA 5KFDA 2R7SA 2L41A 4OI3A 1M1KT 1V9OA 1GXTA 4LF9F 4XK8C 5E3CA 1JLCB 1Q8BA 1ZZFA 2ZBCA 1DZ5A 4RW4B 2XS5A 4TLQA 5J2MB 1VQ5S 4O3SA 1RTIA 1UFLA 3VQTA 1UEVA 3FMWA 4KR0B 3MHYA 1M5KC 1TAUA 3KK1B 3MM9B 1I6JA 2J9EA 1C0UB 3BSAA 3GIIA 1DTQB 5BR8F 3J7YU 4OI6A 4W90B 5AXKA 2GX8A 2JLFA 2VG6A 3H40A 1J5OA 4IQMA 1MMLA 4M5DA 3T3FA 4IFVB 4A4JA 2W7PA 3MM6A 4WF9Q 2FC9A 3AQOA 2XLJA 3H2UB 3IWLA 5E41A 4DLGA 4LF8F 3LWLA 4N5SA 1VS3A 2D9PA 4ALZA 4DL4A 1S1TB 2YQ3A 1HWUA 1JLBB 1JLFA 2DB1A 2ZH2A 2IM1A 3PJWA 1P1TA 1PC5A 4MYUA 2SXLA 3QPIA 4J9MA 1K8AT 3HJFA 1CC8A 2N7CA 4ELTA 2W7OA 1ZM3A 4NX9A 3SMZA 4HL9A 1HQUA 4YUDA 2WRMA 2J6UA 1R8CA 2KYZA 3CDEA 3DMJA 1KFSA 1N32F 3P96A 3V6KA 4I2PB 1OS5A 4MH8A 3KNGA 5GAHI 4G1QA 2YKMB 2CQHA 3JYTA 4MIWA 5C25B 1SL2A 2FVSA 3C6TB 1XN9A 5I3UA 1IKYB 2XLKA 1N52B 3TUJC 3WX4A 1JK9B 2YTCA 1SJQA 1VK3A 1YRUA 2A1BA 5DQIA 2PFFB 2FIUA 2AX0A 5B0EA 3JSMA 1MROB 2MMYA 2KT2A 2OP5A 3T6JA 3UWTA 5AE1A 1X9WA 2FHKA 2WBMA 3T5HA 4ZVEA 2VPYB 3W2WA 4RZRA 1ZM2A 2GJ2A 1HYSA 1S48A 1RT2A 5LSLA 1R89A 3HXMA 1SUQB 1PGZA 1D9DA 4Y3CA 4N56A 3QJPA 3CCES 5SZTA 4PXDA 3TAQA 1QAYA 5BYQA 2K3KA 3HHEA 3NGKA 4WE1A 4EGLA 3Q8PB 3ZZ0A 4N8OA 2QA1A 4YB5A 2W9CA 3KHHA 1U1KA 1S6UA 4MYTA 5GAEU 3DN9A 3VAFA 4OJHA 3K5MA 3AQPA 1IBKF 4O3QA 4GO5X 3H5XA 5CQGA 3J7Z5 2A10A 2ROPA 1Q78A 2KXNB 2KRRA 2K3IA 3B8HA 3PIPQ 4ZPTR 3F73A 2F3JA 2IVYA 3UD3P 1S6QB 5KFUA 3SV3A 1S1VB 1JLCA 1RYRA 3OV7A 2DISA 2I5JA 2MZJA 2RB7A 4I7FB 3VAKA 3HT3A 3CD5A 2XS7A 4LMZA 2FJVA 2E5HA 2B7CB 5D4NA 4Y34A 1C1BA 2BQ3A 3SI8A 2RF2B 3SFUA 2AYEA 1T8EA 2HNDB 2ZD1A 1MWYA 3V6HA 4ITSA 4DS5A 1VIOA 2UUWA 4XAKA 1YJTA 2DGUA 3WC2A 2N7YA 1X4BA 4MK7A 4OZLA 1T05A 5F8JA 2MKHA 1S1UB 1A6LA 2ILYA 5E5NA 4DL0C 2BBEA 3TW0A 1OPZA 1U45A 3DRPB 3TAPA 2R8KA 4ED1A 1FJGF 1ZPVA 2CRLA 2C3YA 2MZTA 5CZVA 1RT2B 4EO8A 4A47A 3GIKA 3VWSA 5MLCV 3GV5B 3EPIA 4GC6A 2IBOA 3DLEB 2Q6BA 4BC7A 2F9JA 2M88A 2DCLA 4DQSA 1HBNA 2BR0A 1SKRA 2XCPA 1C4AA 3VQSA 5C42A 5J1NA 3FEZA 5DG7A 1VBXA 1X4DA 2VONA 2EFQA 5D4LA 3BDPA 2R7WA 3V4IB 4BBYA 4HDGA 3SSRA 2XLIA 4BS2A 4FF2A 1LWCB 4QJVA 3FZ2A 1HPZB 2R8IA 1YITS 1Q4RA 2DIUA 3FQLA 4KPYA 3OBIA 1KQKA 4GKJF 4YHHF 1HNIA 1LQ9A 3R5DA 4I64A 2IRUA 3VF0B 4MFBA 5IZHA 4FS1A 5HLFA 1Q1KA 3GFYA 4DUZF 1FK9B 2RIJA 3AJ1A 4AFFA 1YSJA 5JJBA 1JJ4A 4FVCA 2QYCA 2ZNYA 3NCQA 1HL6A 2EVZA 2CQ4A 2RRNA 2PI5A 4FN5A 1DBDA 1TL1A 3QYYA 1WWHA 3FSYA 4PXBA 2JLEA 3TUIC 2MB0B 4A8XA 5HMXA 4ZP9A 1D8ZA 2CVEA 2RDJA 3DXSX 4AYBD 1RAJA 4ZPCA 5E3RA 4IFVA 5FJ4A 4JI7F 2LQBA 1FXLA 3HHKA 2DRBA 4K4TA 3TRGA 1QJHA 2GGPA 1DAXA 2DNOA 5THWA 2CQ1A 2LVWA 1SL1A 1F5CA 3DI6B 5A6WA 4DLEA 3OR2B 4AL7A 5DG8A 4FNHA 5C42B 2QIFA 1TKZA 4EO6A 3Q0AA 3CDBA 4HEA9 1H2UX 2VG7B 1JNRB 1KOOA 2XI3A 2I2YA 1VK8A 2RVJA 5CYJA 3RZAA 4RUCA 1NJIT 1E6VB 4KC5A 3LP1A 4OZNA 3TYTA 3V6JA 4EEYA 1QE1B 2B6AB 5DM6Q 5EX0A 1MMDA 1JLQA 2J0WA 3BN4A 3I96A 2W7AA 4URQU 2CQ3A 4ECWA 3PX6A 4R5PA 2NQPA 2NSBA 4G6VB 1FRLA 1P9QC 4MFBB 3ZZOA 2HMIB 2VODA 4XPCA 2BQRA 2JHEA 1O0PA 3HHLD 1FRHA 1QUPA 1SJFA 1URNA 1EETB 1O51A 5E3PA 4CCHA 2CPDA 2W4DA 4OZJA 4DDFA 3MUVP 2VFVA 3VZIA 2YWFA 3MMAB 1S9EB 4JI8F 2VASA 2VG5B 1NJWA 1SH3A 4F4ZA 2RUGA 2MZQA 1MROA 2MZ1A 4LFBF 3GV8B 2KFZA 2UUCF 2BJDA 3M1VB 2HIQA 4DSFA 1YJ9S 1L3TA 3IRXA 3H2LA 3CD6S 4URSA 1RGVA 1RK8A 4PKDB 4Y00A 3T5KA 2VFSA 2M9KA 2IMWP 4BDPA 3FFIA 5K5MA 4ECTA 2WOMA 2XCAA 4FXDA 1S1WA 3S7RA 2YKAA 4NCGB 2Q79A 1X4EA 3CC2S 4RW8A 3PKYA 4CNYA 4GMKA 4YR3A 1NHUA 2A18A 3DDNA 3I6PA 2W9CB 4UUWA 2MSTA 4ED2A 5G0RA 1TKZB 4C8MA 1WHXA 3PACA 2PMZD 1RT1A 3DXBA 3CULA 2O66A 4IOAQ 4NL5A 5A6PA 1VC6A 2VPWB 4Y2CA 4ZPAA 3C6TA 2W4PA 2CDQA 2KI2A 2XMWA 2E66A 3IA0A 4HTJA 2E1CA 1NZAA 2CQ2A 1Q79A 2HVHA 3HHLC 2XGQA 5DM7Q 4H54A 3JSMB 4PWUA 2KHCA 4QU7A 4PPDA 1LKZA 2RE1A 1MMNA 1TL5A 2DIVA 3IR7B 1RT3B 1TUVA 4QBUA 1GNKA 1SBRA 1FKPB 1TFWA 4OJ1A 2V8VA 3EPGA 5E2QA 5J1EA 3MD1A 1S6PB 4Q8EA 3PRDA 2AGPA 5HL7Q 3MDFA 1S76D 1NHVA 2HNYB 2OPQA 2PIIA 1AFIA 2ZDOA 3CE8A 3M8QA 3VALA 1Y00A 5FD1A 2LXIA 3FJ2A 2FUG9 3K5LA 3TNVA 3Q8SB 3POTB 1RT7B 2DK2A 3OTBA 4RUHA 3N6NA 3OR2A 3MXHP 5B08A 1HA1A 3LO3A 5HQ8A 2HLTA 1U1MA 3I0SA 4M8LA 5DDQC 3I55S 3DLGB 1VC5A 3BN7A 3CCTA 2HHXA 2GNKA 4NZ0A 1SJ3P 2HHPA 2Y1IA 2OH2A 1IJFB 4FS2A 5E3AA 3S1TA 5KFGA 3MEGA 3D0GE 1RT4B 1IKWB 3OFEA 4NA3A 3T1AA 4Q8FA 2B6AA 4JI4F 1REVB 4DS4A 2QMXA 3OXGA 3TI0A 4KAIA 2ZOMA 1RT1B 5F8LA 2M4MA 3G86A 3L3CA 2MJNA 2CIMA 3OVAA 4DL6A 2C2EA 2HRYA 3TVKA 4FPRA 3M6UA 3OL6A 3KLIB 2A2CA 5L9NA 2KG1A 3CCSS 3RBEA 3NLCA 3JYTB 3MUTP 2FLPA 2CYYA 4I7FA 2QE5A 1QVGR 1FA0A 4IKAA 2ZH6A 3F56A 3K8VA 1S1VA 1SIWB 2JC1A 4PG6A 1KQGB 1S72S 5K8OA 4C3LA 2ALZA 4Z2XA 4JV1A 5A0YB 2WHOA 3OR1A 1S0MA 2HNZB 1OWXA 2HNYA 1NRKA 3O6QA 4JV0A 5H9EJ 4J9SA 1SJ4P 3FZBA 1DURA 1RT5A 3T5JA 2J76E 4KHPF 1C2PA 2LECA 3G8SA 3H5UA 1NJYA 1N34F 4YDDB 3TANA 2EWHA 1EP4B 2GO9A 4X4QA 1U1RA 3HMJG 3F44A 4ECYA 4NCGA 2VB6A 2XWXA 1U24A 2L9NA 1HBUA 5HMWA 4EBEA 4IYQA 1XMQF 3R5CA 2JOQA 4N76A 2FTRA 2AP6A 4QWBA 1VRUB 1HR0F 2D41A 1ELOA 3OQ2A 1NKCA 1VQ4S 1TFYA 2IVFB 3PX4A 5HI7A 2R8GA 3DYAB 3B78A 4XPEA 2VFTA 2ZDPA 2DBBA 3R5AA 1T3OA 1N48A 4IDKB 4RUAA 3KLGB 1XC9A 2XGPA 3C2PA 1D0EA 1FVSA 3EXCX 4QIFA 2R7RA 4IQXA 2AJ4A 5GADI 1RQ0A 2RF2A 3MGJA 4OX8A 4ZMMA 5KT6A 2BQUA 4NYOA 2YX4A 2YWEA 3X3UA 2ZH9A 2GW8A 5B0CA 1KVIA 2PEHA 1HI8A 3DU5A 2M52A 2DNGA 2KG0A 2O3DA 2DGXA 3LPYA 4O4RA 2F8MA 4BWJA 4A8SA 1APSA 1S99A 2ZHOA 1IBMF 1RA6A 5DDOC 2YKNB 5AXLA 4Y65A 3FEXB 4C0BA 3M30B 3NG8A 4PG7A 2GO8A 3SV4A 3M2VB 4C8KA 4ZCMA 2DGOA 4YMEA 3UW1A 1QAIA 1TKXA 2JLGA 1C1CB 5GAGI 4IRDA 3TO8A 1S1WB 3BGLA 3DLGA 4LSLB 2KRBA 3PZPA 4DUYF 1FJ7A 2CJAA 3M2RB 4QIEA 1X4FA 2MYFA 1HQUB 5F8IA 2GQQA 2R4FA 3N28A 2E5LF 2QA4S 1TK0A 3RRKA 1HPZA 4I56A 1MU2B 2AJFE 2AWZA 1TAQA 2DHGA 2DNRA 4IH5A 4WJBA 2YH1A 1KHVA 3N6MA 1AFJA 4DV0F 4AXIA 1ZH5A 2RILA 1NEEA 3I0RB 5EHHA 4WFXA 3G71S 3K7RA 1EETA 1GX6A 3LQVA 2MGZB 4KJIA 4C8ZA 3FNNA 2CQBA 5K14A 1FK9A 1OPIA 1S79A 1KNZA 1CC7A 1M5OC 5L1KA 2RKIB 4M63A 3FCHA 1T03A 4E0DA 3QAUA 3DM2A 1CEZA 2ILZA 3IFEA 3MFHA 3QAEA 2E44A 2DT9A 1S6PA 4O23A 1UAWA 3GZ7A 3Q8QB 2YH0A 1X0PA 4DL5A 1F2GA 2H9ZA 1FRIA 2RU3A 5M2UA 3A8EA 1R7IA 1RKIA 2GCFA 4I6YA 1HNXF 4HTIA 4IR1A 1JIHA 2IYIA 3BQ1A 4YB1P 2DHXA 2KZMA 5JVGQ 1N5VA 4WXOA 3CMES 4YP3A 3PIOQ 4LQ3A 2PSZA 5IT4A 4DR1F 4F3OA 1KRPA 1BD6A 4ZPDA 3CO9A 4ZCKA 5DG9A 3M2RA 4EUVA 2BABA 2NLWA 4ZVHA 2R7TA 2IRYA 2VOPA 3B4MA 1KTVA 2CJQA 1OQ3A 2UVUA 4XO0A 2ZC3A 1LWCA 2KM8B 4Y2MA 3I0RA 4WFAQ 2R7VA 2NYIA 3H4BA 2MXYA 4H4OB 2JH3A 4WCEQ 2O5DA 4IOBA 5SUHA 3BJYA 4DFJA 3CWJA 2MZSA 2DGVA 4F4XA 1YTYA 3AH6A 1Y0HA 2D74B 5HBMA 2MPUA 1HWIA 2YWGA 4X65F 4O3OA 1FRXA 1RWUA 2XO7A 2FHJD 1QSLA 3QZ8A 1RTIB 2JEIA 5AXMA 1FTCA 2M0GB 4KO0A 3US5A 3D0IE 4MJKA 5LJ5Y 2IYGA 2J6TA 3MR5A 2FHJA 2CQGA 3MZIA 4PG4A 5IT0A 1LW0B 4WU3A 5KFKA 2V9KA 2R8HA 3DGPA 1KLNA 4DQIA 3DLHA 2Z2LA 4ZHRA 5E7OB 2V4QA 5KG1A 4B9VA 2B4OA 2L08A 2ZC4A 4DMZA 4DFKA 2JDJA 3L09A 4BHQA 1DLOA 4UQGA 1KN6A 2GHVC 4JI6F 4RNFA 2FY1A 4WE1B 4YB7A 3MM6B 2KJWA 1DHMA 1QVFR 4BCAA 3J81Y 2J9CA 2X51A 4F50A 2ZH5A 4KFBB 2AW0A 4OZ0A 4RU2A 3HFKA 4L72B 2BV3A 5KFJA 5E0OA 1RT6A 1VI7A 4F4KA 3CCVS 3A1YG 3KOAA 1N0VC 1JLEB 2C3MA 3OVSA 4B9LA 1P27B 1U47A 1M90T 2ACYA 4CT9A 2WB4A 4MK8A 3DC2A 1YBAA 3Q24A 2IMOA 2VG7A 2ZE2B 4DR2F 5FLXY 3H8YA 3HO1A 4H4OA 2VZ9A 3NS5A 4C97A 1X4CA 2QSWA 1VBYA 1SH0A 3AHPA 1X4GA 3U1NA 4K4SA 3K57A 2FPHX 3D28A 2AYBA 5I3UB 2WSEC 3PHEA 3MMCB 1N6QA 4NLPA 5C25A 5L1IA 2ZITA 1PILA 1HWLA 2IA0A 2QMWA 5CA5A 1S0VA 2FJAB <