4I0WA

Structure of the clostridium perfringens cspb protease
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
92
structure length
91
Chain Sequence
AKVGIDFINTIPKQILTSLIEQYSPNNGEIELVVLYGDNFLRFKNSVDVIGAKVEDLGYGFGILIIKVNDLNRIIELEGLQIELPKILYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analysis of the CspB protease required for Clostridium spore germination.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords Protease CspB
total genus 23
structure length 91
sequence length 92
chains with identical sequence C
ec nomenclature ec 3.4.-.-:
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18425 CspB_prodomain Csp protease B prodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i0wA00
4I0WA
chains in the Genus database with same CATH superfamily
2JOQA 4QYRA 2G2OA 4QR0A 4CO2A 3HK2A 1ICEB 3DMJA 2NPIA 3MMAA 4C11A 3PYFA 3RB0A 2AQ4A 3IG1A 4AXIA 1FRJA 1RWXB 1U0SA 1YITS 3PR5B 2NCKL 3F0NA 1OY9A 1S1TA 2IA0A 2M9KA 1EP4A 1G4CA 1OSCA 1IWAA 8AT1B 4ED2A 1XC9A 2LU2A 5IQQA 3AH6A 7FDRA 2OD6A 1VK8A 4ZVFA 2ZDOA 2VQEJ 4IG0A 5KFIA 1T3OA 1IUJA 4KYZA 3FCVA 3CIMA 3L7UA 3QGHA 2LU1A 2Z2YB 4O44A 4WU2A 4Y2MA 5GMEA 5AXMA 3LP1B 3VVUA 3C2PA 2DXEA 5LOQA 3UE2A 2G9OA 3M8YA 1REGX 4G1QA 4OZ5A 2DJWA 2RE1A 2Z30B 4CO3A 1VQPS 1RT5B 5KG4A 1YI2S 2XY6A 4G1PA 3PIPQ 2HVZA 2JL9A 5KFFA 1FT8A 2JJ4D 4MKVA 2AT1B 4OX7A 4W4MA 3LQVA 1JLFA 5CYMB 4L72B 4F50A 2ZH2A 1U49A 3G82B 5HO4A 5HMZA 1UWAA 2QMUB 3QT5A 3MAQA 4LJMA 2FVRA 1UA1A 1N5SA 5JVHQ 2K8GA 5ETTA 2VBYA 3M30A 5IT0A 5HBMB 1NK8A 3J81Y 4DZ6A 3GJSB 4YDDB 4ELVA 5I3UA 3DDKA 1KLNA 4QIWD 2KXHA 1Q16B 1U25A 3LPEA 2RH3A 1MNEA 2W2PP 3KHLA 2VQFJ 4B3MF 1TKXB 1JJCB 2AF6A 3IM8A 1WI6A 1HBMA 4LREA 1UTAA 1U2CA 3IBWA 3UQSA 4CLWA 3DGVA 3VZIA 2YKMA 2MB0B 2EK1A 3DRSA 2CJ9A 3R5JB 1ZAWA 2H3EB 3DNCA 1JLBB 4H4OB 2YKAA 1JX4A 4KT0C 4IFYA 3GJRB 4LR8A 3W3SA 2MLZA 1I51B 1WNEA 2Z0GA 2D74B 2QGFB 2BBEA 2ZUAA 1IQTA 1QSLA 3EMTA 3L9ZA 3MCSA 3JB9k 2YWEA 3HVTA 3DLEA 1XQIA 2EC2A 4NL5A 4ZP6A 2NPFA 3T41A 3TA2A 4X62F 1S9FA 1N33J 1NPRA 3DM2A 2CG4A 3POTB 4N8OA 4DV4F 1XBWA 1XMQJ 2JZ5A 2Y1RI 1OPZA 3MM7B 2RKIB 1Q86T 1EHWA 4NX9A 5KFYA 3O44A 4NLWA 1RXOB 2DGXA 3U1MA 5HMYA 3H4BA 2MQ8A 5ETNA 5LJ3Y 1KEKA 3R5AA 4J9QA 1M0SA 2DNZA 2C3PA 3N28A 2DHGA 4USHA 3TR5A 2EFPA 5T41A 4CLYA 3G6YA 3UR3C 2PMZD 5A76A 4DS5A 2K1RA 3KK3B 1F1BB 4CLZA 5JUMA 1F9EB 2ZHOA 3KLIB 4WIQA 1Y0HA 4FS2A 1Q82T 2VKZG 2APOA 1N54B 4WKRA 1HI1A 5CD4A 2C42A 3TRGA 2FJVA 4DR3F 3P4UB 1HNWJ 2CZ4A 1KOHA 2BUNA 1QAYA 3EUNA 3P45B 2O5DA 2PT0A 1C1CB 2HG4A 3NGRA 3RG6A 4K4WA 3RB3A 3IMQJ 4ZLJA 2C1EB 3G82A 3NS7B 4A8WA 1WC4A 3QZ8A 2JEJA 1S48A 2IBKA 2UXBJ 1PJ6A 5D4PA 3MF5A 4V1Ak 3MM5B 4QIFA 1YLXA 1FK9A 4LQ3A 3VALA 3HPOA 4ED1A 4JI8J 2BRLA 2A2CA 3R5GA 5E3PA 1BGXT 3RU0A 2UUAJ 2C2ZB 5KFCA 5T14A 1IBMJ 3G71S 2OPSA 3V81A 3K0JA 4RZRA 5GAEI 3GU0A 3OVSA 2QA4G 1FERA 4NCGB 1FDNA 2QX0A 1S1VA 2IDEA 4TU8A 4CTAB 1N5YB 4MFBA 1GNKA 2EFNA 1SPBP 4O3RA 5C42B 2CJYB 1RKIA 3MMAB 3PYGA 3QPIA 1NK5A 4L73A 2F7VA 2W7OA 2B4VA 5JJBA 5A8KA 2BQUA 4EMDA 1RAFB 2XNQA 4ECTA 3KXDA 5DLGA 1GTEA 4DL2A 1KDNA 4RBVA 1KQFB 4EU0A 3J81j 4J9KA 1O0PA 3LOUA 1HWLA 3VAJA 2PC6A 4OJGA 1JLEB 4DPWA 4ED0A 1FVQA 3PDNA 4ANDA 1PBAA 2A1BA 1FESA 1U2FA 4Q45A 4YQWA 1M1GA 2AGQA 3L7PA 2MZSA 2RHSB 5KFEA 2WZ1A 2J0XA 2Z58B 4YHHJ 2K2PA 3UFCX 4DR7J 4XDDA 3BO2A 3M2UB 5EWFA 1RT1A 3FSXA 3MEGA 1EX8A 4R8UB 1QUVA 2WBMA 4LF8F 2BE2B 2LQJA 5HP1B 5CHCB 3CMAS 4JI0F 4QZVB 1SC4B 1LKZA 2G0CA 5D4NA 2XGQA 2XYPB 3A8IA 2YX1A 2FGCA 1U6BA 4C0OC 4L75A 1WEYA 1FK9B 1SC1B 2E1AA 4GKJF 4B08A 3Q8VA 1E6VA 2H4YB 3IN5A 3OFFA 3FBEA 4I4BA 3IR6B 2QL5B 5KAKA 3D1HA 1JKHA 3BDEA 1Y5LB 1I94F 1F2GA 1ZM9A 4PWUA 2KZMA 1T94A 3CNQP 3O3LA 4F04B 1R0BG 3R27A 4HDHA 5AE2A 3VWSA 3SSSA 2BKNA 3GCXP 2XMAA 1KR4A 4USIA 1DURA 1VRTA 1WTFA 3F56A 1NSQA 4QQBA 4DPXA 5LXYA 1XMOJ 3PRBA 5C42A 4Q44A 1JXEA 1Z2LA 1BLUA 4KKOB 3PX0A 2XLKA 1R89A 1ZPVA 1KHVA 1RT6A 4WU3A 1OQ6A 4IDKA 5IFMA 2BZ2A 1UJ5A 1JLAB 1QLNA 1RGVA 4YB1P 1ZTTA 4B9NA 1MWQA 1R6VA 2BVZA 1ACMB 7FD1A 4J9MA 2BM1A 1NH7A 4KIAA 1GK8A 1RTHB 3SFGA 3H90A 5L9NA 1C1BA 3K57A 1VI7A 5DO2A 4FF2A 2A3JA 1IN0A 2R7UA 1CVJA 1S9EB 2C3MA 3HVTB 3VQSA 5AE3A 2VPZB 2XCAA 3IS9A 1UAWA 3MOJB 5A6PA 2VJUA 2B9XA 2CNNB 2D7SA 1HPZB 1SC3B 1S79A 2LP4A 4K0KF 2DYAA 3Q0AA 1R7IA 1HNWF 4F4AA 3S8SA 1WG5A 3OXFA 3TAQA 1N6QA 2GVZB 3KMQA 3W63A 1DLOB 1YHQS 4QYZK 1LEOA 4LF5F 5HJXA 1YIJS 1NK4A 5CD4H 2W4DA 1TAUA 1GTHA 1RT1B 2GS8A 3M9MB 3PW5A 4OZJA 3KLHB 2LQ8A 1XEZA 4HI1A 1H7XA 3T5HA 2I5JB 4F0MA 1RA7A 3IFEA 3W9JA 4IRDA 1UVLA 3RUBL 1FWLA 5DM7Q 2MY8A 2C28A 3G2XA 1FJEB 3GSDA 1IBMF 4TQSA 1NJWA 3T5JA 4KTQA 4I2QA 1R43A 2LA4A 3DLKB 1FRXA 4UUXA 4C0HA 3GV8B 4F4YA 3KHHA 2XS2A 1FNMA 1LK5A 4DV4J 3M6XA 3PJXA 1IR2A 5K14B 2V2ZA 4MIWA 1F5BA 1TVRA 2H1YA 3UI3A 2IM1A 4J9RA 2UVUA 3P49B 5CAAA 4I67A 1U2RA 2V34A 5C24B 1K0TA 2NR0A 4EUVA 2VASA 5KFVA 2B4PA 2DNPA 4DQPA 4KGMA 4NLGA 4RNHA 4LF2A 6FDRA 2BJ1A 4CT9A 2UUBF 2DPIA 4X66J 3VAMA 3D6MB 3HHLA 2CPJA 4QIGA 2F8HA 1WACA 2GAGC 4M5DA 4TY8B 3SCJE 5GMKa 4UQGA 1UCNA 2GVDB 2J9EA 4MFBB 1B99A 4XTTA 4CT8A 4YUDA 3KJVB 4KHPF 3S1TA 2CDRB 3D5MA 1VQYA 3DOKB 1HBUB 4A8QA 1CJVA 1SH2A 5HATA 3KHRA 1P1LA 1RLCL 4CQ1A 4ED8A 1W2IA 3N6LA 4DFJA 2F4VF 2FC8A 1S0NA 4OMFG 4TQRA 3N01A 3THPA 1TV6A 4ZP9A 3RBDA 4P2FA 5EUHA 1WOPA 4F3MA 4I2PB 2RJZA 1IBLJ 1RWNB 5KFZA 3MMCB 1X4BA 2W4CA 2BV3A 4KR0B 5ETKA 2E5LF 4CCHA 1YJTA 4X4OA 2H48B 2FZKB 1KVKA 2FLLA 3CDUA 3M4XA 2FY8A 1FI4A 2RRNA 3BSCA 3FQLA 4DZDA 3OXGA 1CC8A 4IG3B 4WP3A 3CCZA 4WFXA 2BE7D 4P10A 2OSQA 4RW4B 4I68A 5D4LA 5F8HA 3I31A 3GILA 1TTHB 4OYBA 1VQSA 2R7SA 1NK0A 3FEYB 1IQZA 2CQCA 4S0MA 4EO6A 4FYDA 2FD2A 1RHMB 2W01A 3I82A 2F3JA 3RW6A 2LQ9A 1E6YA 2AKWB 1KRPA 5SZTA 1B7FA 3NGTA 1YRUA 2EVZA 4O0IA 2VV5A 3G8SA 2AJ2A 2HAFA 4URSA 3ZTPA 2AMCB 4DV2F 2UUTA 1SJQA 2HQCA 2VG5B 1A6LA 1YSJA 5B0AA 4RNFA 4NZ7A 3JSMB 1NJYA 4F0KA 1NJIT 3LWMA 1M5VC 3PYDA 1WC5A 4JI6J 4X4VA 4KO0A 2OPQB 1H6KX 2ZNZA 2ZJQQ 1B3TA 4NLUA 3FK4A 2UUCF 2NXNA 3QJJA 2EXUA 2XSJA 4F26A 2UUBJ 2OEKA 4QWAA 4JV5F 2R7VA 1RSCA 1VCTA 3SV3A 2V2KA 1U8WA 4Q5VA 4EZ9A 4DX7A 2OEJA 2HAIA 3DI6B 4M63A 1YZ6A 1N4LA 1TU0B 1UETA 1LWFA 1YRTA 1S4FA 3NOCA 3G86A 3MUVP 4LBPA 3CD7A 3SSQA 3MR7A 2QFIA 1BUXA 4Q2LA 2DR8A 4B3SF 3M6UA 2BEFA 2V8PA 2ZBRA 3WX4A 3M8PB 1NMEB 2ZH8A 1RCXB 4HHHA 4IR9A 5I42A 2CQ0A 3K7RA 3SSRA 2YKNA 2W7AA 2MSTA 3EDRB 1VISA 4M5IA 4YR0A 1J5EF 2HVHA 3BSAA 4UQTA 5BYRA 1UJ6A 2ASJA 2OMLA 5DGAA 3N79A 5E3RA 4YY3F 2WW4A 1N34F 4ZLNA 1HIYA 2QA2A 4ECXA 2C22A 2DHHA 1TK5A 2AX1A 3EVOA 1JNZB 5GMDA 2OHDA 3PCOB 3HVRA 1DBDA 3D4JA 2XLJA 5KG5A 1CJUA 3TJ9A 4P74A 3O8WA 1DJ0A 5E33A 2DGTA 3LPYA 1Y9OA 2OEMA 1DQ8A 1OY6A 4ZVEA 4PYDA 3VV2B 2X1AA 2OPPA 2ZNYA 1VDHA 3OBIA 4FYWB 2MQNA 1Q95G 4P72A 4WK3A 1X31C 4DU8A 3BDPA 5J2QB 5GAHI 2VONA 2ACYA 2AHOB 2RB7A 3CGIA 5IOLA 1RTZA 3KHGA 1Y4ZB 2HSEB 4KO0B 1F9FA 2E1PA 4YMEA 1ZETA 1D8ZA 1PYOB 5F8LA 1BQMB 2HNDA 2V4QA 1V6HA 5D8HB 4QPXA 2DTJA 3MMBA 1AB8A 2CVIA 1JLBA 2AYEA 4H4OA 2XG8A 3IGNA 2V2VA 4AL7A 1QDUB 1RHKB 1VC0A 1RKJA 1JMTA 2M8HA 2V4JB 5H9EJ 1B64A 2RQMA 1U26A 2BACA 3PNIA 5KFXA 3MAAA 1TP7A 3I0SA 4X84A 1FVSA 2IYGA 3R7NB 1V3ZA 2IDLA 3ETMA 3OR1B 3DHXA 4DQRA 1YVFA 2PFFB 4DSEA 4DR2J 1NB2A 4H54A 2LA6A 4MKAA 3BGUA 1BQXA 3MOZA 4OJHA 1VBKA 1HD0A 2VFRA 4B02A 4P52A 2DGUA 3RYLA 4LUBA 2M52A 4UOGA 2E44A 1HNZF 2NREA 3G6XA 3OD2A 3PHTA 3OV7A 2NSCA 4FVCA 1P9QC 4KKOA 4ZHRA 3CD0A 4RUBA 1Z4UA 4DHVA 3FRZA 3BBBA 1JJ2R 3B82A 1WHXA 1GMUA 4IFVA 5CZXA 1UVNA 1JNRB 2HURA 2HFVA 3JSYA 5G0RB 4DCOB 4C2MA 2W8LA 3V6DA 1FDAA 3C6UB 4DV3J 2ZITA 4V19J 3LA0A 4X65J 4NA2A 1Q0NA 2CIMA 2QV6A 4JI7F 2AJ0A 2DBBA 2G1DA 4UW2A 1Q81T 4O4RA 1E6VB 4OX6A 5B0GA 3QRQA 4OX8A 2E1CA 4QCLA 2YX4A 3AB2B 1XK8A 2DHAA 4FN5A 4QIEA 3EM1A 2L41A 1O51A 1RABB 3B8HA 2V2QA 1D3WA 3JTPA 4USTA 5CABA 2ZH6A 4A8KA 1CG2A 2BJ7A 3WDOA 4DR3J 2CJAA 2UUWA 3IG1B 4NMXA 2MZJA 3E8OA 1H0HB 4U9RA 1TKZA 1X0FA 1APSA 2DRDA 3KK1B 2F5GA 5LMNJ 2YPYA 1AW0A 1U4BA 4XK8C 3BQ2A 5C7PA 4MJKA 2WTFA 3F44A 3T1HF 1RAEB 4V19X 2G4BA 4HTJA 5KFMA 1BXNA 3CJ8A 4DSKA 4ES2A 5KFPA 2YWWA 2L9NA 4NLDA 3QSIA 1KFDA 4H4MB 1Y11A 1Y5IB 1KOOA 2IVMA 2QTWA 1G7CB 4NYZA 3US5A 1D0EA 2E9RX 2BJ8A 2V8HA 5I4MA 3Q23A 4DV3F 2IRYA 3GYXB 4ZVOB 3ULHA 2B7CB 4PXBA 4NEZA 3MEDA 4DPTA 4DX6A 1SVDA 2VBZA 2QEXS 5L1KA 3CMES 1H74A 2JWNA 3AY0A 3ZZUA 2D41A 2MLXA 1HBOA 1V5VA 3VQTA 1G3OA 1IJEB 2E5IA 3QIPA 3EVMA 4M1KA 3TX0A 5C25B 1H2TZ 2RD5C 1N34J 2CQPA 3DGPA 4Y2CA 3AA9A 4NZ0A 2RDDA 4A46A 5E5NA 2C2MB 2DNLA 4CH1A 4OZ0A 3HSGA 5KOXA 3A3NB 4F3OA 3C66A 3DRRB 4FXVA 4TLRA 4LF7F 1BMQB 1WDTA 2Z2LA 3BPDA 4ZCIA 1VIXA 5DG7A 3CDBA 3GMGA 4EK2A 5MAOA 4DSIA 1YGYA 2PA3A 1FJGF 2ZH3A 2DISA 1F60B 1NZ8A 2MEWA 3DFEA 4ZP8A 8RUCA 4ECUA 1VQ4S 2JEFA 1D8YA 2BJ9A 1CLFA 3AD9C 2BE9B 5B0CA 4YB7A 2QZ8A 4NI2A 2H9ZA 2HWHA 3GFYA 4YEAA 4ZPDA 4WFYA 4DPOA 4NXMF 3HXMA 1N8RT 2C2RA 1SJ4P 2J5AA 4F36A 4DFPA 2MZ1A 4OJ3A 4O3OA 3J7ZT 4LSNA 4C6AA 3CF5Q 4I7FB 4F67A 3OL7A 1S1UB 2FHMA 2CPFA 2BJEA 2CQDA 4WYWA 3UVJB 2QYGA 4UT4A 2CAJA 5EHHA 2FY1A 4RUAA 1U1PA 1S1WB 3I5BA 3I0RB 2DCLA 4DR2F 1RADB 2P9EA 2IAJA 2MKYA 1H98A 2NXJA 2B9WA 1S7IA 3PW7A 1MU2B 4P75A 1HWUA 3PTWA 3RB6A 4U7UK 2HNZB 2MTLA 2PFDA 4JV5J 3NBPB 4MKBA 2ADBA 1I3OB 3D6HB 4J9NA 5H9EK 1R31A 1SKWA 2PI5A 2XQCA 2GIQA 5LSLA 3ZTQA 2R7QA 5JMNA 2ZKUA 4QJVA 5KT5A 3I5CA 3OUYA 1ZYQA 1QTNB 3U27A 1S9GA 3NNAA 4NA1A 4A8MP 1KWMA 2ZBCA 3ZTOA 4CYUB 3DOMA 4Y65A 6FD1A 2K1RB 4UZCA 3CJTA 3KK3A 1S97A 2HGNA 2HQDA 3HKZD 4ZIWA 3RAQA 2LQBA 4NXNF 1OO0B 2LVWA 3QYYA 1FX4A 2VU5A 1GH8A 2W8KA 2DB1A 4ZDNA 2ZFHA 4R0JA 5A0YA 3BGLA 3AJ2A 4F3QA 1NBEB 1V5IB 4X2BA 2DNHA 2HIQA 1XR5A 3B54A 1PYSB 5ETSA 3BBFA 1YKWA 3W60A 3HMJG 2HYIB 4F2RA 2AV5A 1SCJB 2DGSA 1YBAA 2AJ1A 1PJ7A 2H5IB 3C16A 3KUEA 3Q8YA 3SBMA 3KFWX 4ECQA 1NK9A 4KAIA 4QOTA 1QD1A 2UP1A 1RTJB 3OTOJ 4O0NA 3LW5C 3TX8A 4YR3A 2HHQA 3FUYA 3SDEB 2GZOA 1IJFB 5ETOA 4B3RJ 1S0OA 2UUCJ 4OI6A 5J1NA 3ZZZA 1D9DA 3OL9A 4WTYA 1U1OA 4K4UA 4LMZA 3SQGA 2VH7A 3UVJA 3LANA 1U48A 2V63A 3EXYA 4ZPBA 2LEPA 5A8WA 4ID8A 4ZN1A 4D3GA 1X4FA 3DRSB 3TI0A 1C2PA 3H0PA 2X1GA 3ICLA 4M5NA 4EWTA 1VHIA 3A8KA 2J0QD 1TKXA 4KC5A 3GTYX 2QN6B 1WC0A 5D0HA 1ZH5A 2CUYA 4RL1A 1FF2A 1T3NA 3DLGB 1T02A 2PGCA 3K5NA 4ELUA 2V67A 2ZC3A 3G8TA 4DL6A 1IKXB 3QGIA 3RBXA 1TK0A 3HZGA 4ZCKA 2JEIA 3H2UB 2BJ3A 3Q8SB 3OSPA 3AB4B 2XBPA 2IY5B 4OZ1A 1IBKJ 1V9OA 2RUGA 3DLJA 3X3UA 4X66F 4MKYA 1NCLA 3UD4P 2R7TA 2ZD1A 2GFFA 4K4SA 1T9UA 5ETMA 2XZWA 2N3OA 4J9LA 2IYIA 4AT1B 3FDSA 4DR5F 1KTQA 2YX7A 1RT2B 3E2EA 1AZSB 3R7SB 4EZ6A 4OHVA 1DTQB 2E5GA 1X9SA 1UW9A 4LF8J 4ED3A 2JH3A 1FJGJ 3MEDB 1LWCA 1VJQA 2GGPA 3T6BA 2EC0A 3CJ2A 2WVBA 4FYXB 2LXFA 2DNOA 2HZCA 1KQGB 2P8IA 2VKRA 3ZZOA 2ZZTA 1HBNB 1AFJA 2KT3A 2XGPA 4PG4A 2I0XA 4ITSA 1FKOB 1NDLA 4LQ9A 2EBEA 4OJ1A 3TARA 4G3IA 2R8KA 3HVAA 2BX6A 1NHVA 5IWAF 4DV0J 1WEZA 3BPSP 3FEZA 3T1HJ 2OUGA 3OPKA 1SUQA 5K8MA 2OFHX 2YPZA 1RAOA 3BR9A 3FGVA 5J2PB 3BO4A 2QSWA 3UN3A 2R2RA 1QVGR 1LFPA 2Z56B 3EZUA 4FYYB 1IR0A 3AQOA 3O5TB 4LRDA 3W9IA 2XLIA 1X4HA 2KXFA 2BXJA 2NYIA 5KFTA 4B9TA 3HFKA 4W92B 4IDKB 4O3NA 2L9WA 5BYSA 2Q6CA 5F41A 3M30B 1S1WA 5GAGU 3PX6A 5CYQA 3UDEA 2COLA 1I6JA 1EAYC 4ZCLA 5GADU 1IKWB 2MDAA 2I1RA 3DRPA 5HJYA 1N32F 1SBRA 2DITA 1B4SA 2GNKA 3ITHA 4KFBB 4DX8H 3QZ7A 1SJ3P 2A2DA 3KLEA 4K2XA 4TLQA 2R8IA 3TP2A 1QAJA 4J37A 1FXDA 1X5TA 3HSDA 3NKYA 4QIVA 3GPAA 3ISNC 4OYWA 3TVZA 1LWFB 5B09A 2RS8A 2K7KA 2W25A 4EI2A 4AL6A 4CIOA 4KPCA 3GE9A 4DCPB 3DDIA 4O44B 3WC2A 1N5TA 5D0EA 5EN1A 3D67A 1CULA 2AEFA 1ZTWA 4PUOA 3EGWB 3ZTRA 3MEGB 2FUG9 1HA1A 1HBNA 3CJ0A 1LW0B 1TL7A 2KJVA 3QMQA 3I4PA 1S12A 1B70B 3VAGA 4JI5J 4K4ZA 1WHVA 3F41A 2WOMB 3M8QA 3MEEA 4OIXA 4B3SJ 4WZQA 2GQ2A 2RSQA 5DGBA 2N7CA 1Q78A 4OYAA 2WONA 3IWNC 1VR6A 1JLQA 4XIUA 3MXHP 5IC6B 2AZ1A 3TANA 3FFIB 4FNHA 3ZZTA 2QLXA 3FVYA 5T7LB 4BDPA 3PXGa 3VF0B 2NS1B 3QGGA 3RJMB 4N7TA 3H59A 1HNIA 1RU2A 3K5OA 2AJ4A 3LP0B 5E2QA 3JAMY 1EQ0A 3HVWA 1K8AT 3GSIA 4ZPTR 4EGLA 2R8HA 5J2PA 4RW6B 2MZQA 3TA1A 1C4CA 2F1FA 1F0XA 2HHVA 2KB2A 2DGQA 2RVJA 3BGRA 4IYQA 3HX9A 3N0VA 2YKPA 1WJ9A 2GA7A 2VICA 4RU9A 2CJKA 5HROB 4Y2KA 1RISA 1YJNS 2VA3A 2JSXA 3C6TB 3RAXA 4IFYB 3MPUB 4GKKF 1BQNB 2CQ2A 1R6YA 4LR9A 1WF2A 2PDAA 1IKXA 2QMWA 4ALZA 1NU4A 3MTJA 2WAQD 3C14B 1TV6B 5KFRA 2YY3A 1AUSL 2GMLA 3OL8A 3EPGA 1YBUA 1QM9A 1X5SA 1T7PA 1VQMS 3RRHA 5HVFA 1S1TB 4E98A 2ZD1B 2J9DE 2W2OP 4JI3F 1YRXA 3QFHA 2RQCA 1M5KC 1B0PA 2UV8A 2XSFA 3DXBA 5BJRA 1IVZA 2U1AA 2EG2A 1NM2A 4I0WA 4ZVGA 3G6ES 4HH1A 5ETPA 4ZPWR 1S4EA 3FMWA 3A8JA 1S6QA 2J8SA 1XNRJ 1FKPA 1LNQA 3DRYA 3Q24A 3W8PA 3RBEA 2FLPA 1KBRA 2G13A 2GHVC 3M8RA 2ZVIA 5D3GB 4CH7A 2ABYA 2HQGA 4F25A 3M8SA 1FFWB 1SKUB 3FZ2A 1Y00A 3GIMA 2CQGA 4Z7CA 2FQQB 3GCWP 3NXZA 4RWXA 2DXDA 1F3FA 1P27B 1KKHA 2N82B 1QSYA 3DKDA 3JSMA 1VQKS 2KHCA 1Z2ZA 3HFZB 1U1MA 1S57A 1KVIA 2PMWA 2DR5A 4Q0BA 1SL2A 4IH6A 2B5JA 4ICLB 2KKHA 2YVSA 1S6UA 4NEYA 1QTMA 1TL1A 2UUAF 4ZCMA 3TVKA 3C8YA 2MJUA 1TQLA 1Q7YT 5HK4A 4NA3A 1M1KT 1X5OA 3BR8A 1NK6A 1C0UB 2VG7B 2HVDA 3IXQA 4GO5X 1TL3B 1HWIA 1JQGA 5J1EB 2A0FB 3VZHA 3TEGA 4U95A 4C3LA 3CD5A 4GKJJ 2HWIA 4N56A 4JI6F 4CO0A 1T8EA 2OFGX 4OI4A 3H98A 4OI1A 1SQGA 2XMJA 3AJ1A 5K5MA 4NXNJ 3GIRA 3W61A 2CDQA 2ZBPA 2CZVC 4ILLA 2PEHA 1CS4B 1MMLA 3KNGA 1H73A 3T5LA 2XI2A 1NSPA 3PFOA 1PKUA 2KVIA 3AD7C 3I9V9 2E7XA 5SUHA 2LECA 2DPJA 4CLTA 2EBGA 1I5OB 2UVWA 2F40A 3PW2A 4NE9C 2VPWB 1R8CA 2A10A 2CVEA 2YQ3A 3BKFA 3QNWB 5IT4A 4L74A 1U02A 4YFUA 2P9GA 1RT4B 1D1UA 3MPWA 1X9WA 4IUFA 3ZFVA 1SV5B 2V6AA 2E29A 3NCPA 1J27A 2Q43A 3V6JA 1ZBTA 1VQ7S 3C3LA 1Y3KA 4OZ2A 4WKYA 3EXCX 1JKHB 1NPPA 2Z4PA 2GO9A 2QSFA 1M5HA 1R0CB 4CNYA 1RU1A 2H5JB 3KG1A 3BQ0A 3PZPA 4X4NA 2Z2MA 3UNGC 4WIIA 1VBZA 3CJRA 2NXUA 1VBYA 2YH0A 1HLWA 1JB0C 3KWMA 3MM6A 4DG1A 3PO5A 5G4DA 5K20B 4P6QA 2VZ9A 3NGDA 4AQYJ 3W64A 4L3NA 1Q5VA 5EX0A 3MFHA 2BKOA 2JLEA 4ZLLA 1HR0J 1F3VA 1T9VA 3CC2S 4WXOA 3J80U 3CCTA 1O8BA 1UKUA 3BYPA 3MDFA 3IRXB 4LR7A 4YS2A 2FHOB 4C11B 2OELA 4ED7A 1S9EA 2HBZB 3MAAB 1G6BA 4LIWA 4LVNP 4Q8FA 4PWWA 4ENOA 5J2MB 2QYCA 2W9BB 1FO1A 3ONQA 3H7HB 1VS3A 4RO0A 3TQEA 5B0BA 2YBVA 3GIJA 4N41A 2BM0A 3U7JA 1RWWB 3OTBA 4HHJA 4HYKA 5DDRC 3HHNB 1B7YB 5RUBA 1URNA 4KH1B 4ZN3A 1EARA 4CTAA 1L3SA 1KFSA 4DN0A 2V9KA 2WHOA 3KLFA 4JI0J 1W25A 2VODA 2E5LJ 2RDIA 4AYBD 4WFBQ 4NLSA 4OFZA 1UP1A 2VG6B 3UNYA 1C4AA 2JHEA 2OGUA 3GFZA 1FJCA 4X4QA 4PEOA 4OHWA 4DQQA 5H9FK 2C3YA 2X3GA 1JLGB 1F9HA 5CYMA 5FDLB 3V2UC 3J7YU 4B3TF 1RAJA 4USUA 2XMUA 1OWXA 1P9YA 2LKZA 4Q2MA 2HW3A 4M95A 2YWKA 1K47A 3IA0A 3V6DB 2XWYA 2QO3A 4LFBJ 3LAKA 2VQEF 3TAPA 3FSIA 2E5HA 2E66A 2OIHA 3CJQA 3MM8A 2F9JA 3UO0A 1CQMA 3M2VB 1R8BA 4JUZA 4EBDA 1EIYB 2MHNA 4CLKA 1HBMB 4QWCA 3IBCB 1B0VA 2VFSA 1VOMA 1FTCA 4MMOA 2W7PA 1N5VA 4LF1A 4UF4A 1Y5NB 2EPIA 2G0JA 1XMOF 3N5BA 4JP8A 3GB0A 4E2FB 2MKSA 5KT2A 1WWHA 1JWWA 4LRBA 4QU6A 2FDNA 4HLBA 3OSNA 3LUYA 1IKWA 5C24A 3O2IA 1I94J 4W90B 4XAKA 1OMSA 2QT7A 4DEZA 4IOCQ 4DL5A 4ECVA 4ZPVR 3WQPA 5A8RA 1DTTB 3CWJA 1KSPA 1NK7A 2KFZA 4EYIB 2V0NA 4PWDB 3H2LA 4QU7A 3IRXA 1DQAA 1H2VZ 1LOUA 2VJVA 2LXIA 2DO0A 2RNEA 1VLYA 2YNFB 3TOQA 3DOLB 3I6PA 1LQ9A 3TAMB 2HQFA 4PQAA 2V4JA 1JJ4A 2KZZA 4AE5A 2R2TA 4DUYJ 4WFAQ 3LF0A 2ROGA 3KK2A 4WE1A 4DSFA 1D9AA 7AT1B 2Z2ZA 3PV8A 3K89A 4IH5A 2GW8A 3QIPB 4Q7AA 4A48A 2JFKA 1JXVA 3MD1A 3Q22A 4OYOA 4YN3B 1VIOA 5FLXY 1RT7B 3ISZA 4NLYA 5CQGA 1DTQA 2ZE2B 1RJJA 3M6WA 4FYVB 1IKVA 1JK9B 1JLEA 2BQRA 4M8LA 4DR1J 3ELHA 1N6QB 3GFXA 3SV4A 3J7A1 2VDHA 4O4GA 2L48A 4TXSA 3OJSA 2ADCA 1TKTB 5GAEU 4DV5F 3TWZA 3D68A 4WZMA 4O3SA 3TW0A 4YR2A 2AD9A 1FX2A 4ZVHA 4DU7A 3AFGA 3BREA 3W2VA 3FBBA 3QRPA 4KQZA 3ET6A 2RT3A 3MAHA 1SIWB 3RZAA 3OL6A 1L3VA 4F4KA 1XWLA 3PACA 3QLHB 3FRYA 4DR4F 3KUHA 1TELA 2DEJA 2L08A 3Q8RB 1KP6A 2YNGA 4HR2A 2IM3A 2MGZA 2NYHA 4FNIA 2EFQA 1FTRA 5HSPA 4JI2J 2QG9B 2LMIA 2R42A 3AD8C 3PHEA 3T5KA 2D1CA 4WWSA 5CYQB 3UDVA 1N56A 2UVVA 1Q8KA 3EJMA 3EPIA 3Q2SC 3SDEA 2CKWA 1YJRA 4KRWA 2R7RA 3NMAA 1WTBA 1RTIB 1WEXA 2EK6A 3CSKA 3SI8A 2NLWA 4C98A 2XZTB 4RPFA 1RQ0A 1NRKA 3DDNA 3MR2A 2VPXB 3HHLB 1ULRA 1YK9A 3HLUA 1TMJA 3V4MA 5HL7Q 5KT3A 4ECSA 2ZH9A 1CEZA 1RT7A 1UPPA 1OYDA 2IIHA 1N88A 1K1QA 2J7KA 3TJ8A 2LQ5A 5MLCV 4K4TA 3M8PA 2W9CB 4DV0F 2B3TB 3GG0A 3DOKA 4DPYA 4KFBA 4DPUA 2WVFA 3AA8A 3DU6A 3SQOP 2MQQA 3CXCR 3ENVA 3V4IA 1GEHA 4I56A 1RHUB 3DLHA 2FPHX 3BN4A 2H5EA 3V6KA 2B8PA 1M1HA 2ZM6J 4JYAJ 3MECA 1TR0A 3W5ZA 3FZBA 2C2EA 5M2PA 2OLWA 3E01B 2B56A 2IMOA 3ILJA 1XMQF 4P7TA 3VAKA 2B4OA 2KT2A 2XMWA 1NUEA 5C2CA 2DK2A 3EVWA 3DLBA 1FKPB 2VD3A 4ZLPA 1QVFR 4K50A 1HNVA 4OZLA 4C48A 5DQGA 3GIKA 4BBYA 3EGZA 4ED6A 2IVYA 2JC0A 3OXLA 2HBQB 4GO7X 3T6JA 2F9DA 2M3DA 1FJ7A 4KPYA 4X4UA 3CCSS 1K0VA 1LW2A 2C3UA 3X1LB 1P8GA 1ITPA 1S1XB 1BQMA 2HNDB 3CIZA 1TL1B 3QT8A 4YDXA 3WBZA 4ETZA 3W9HA 5G0RA 2MKKA 1N32J 4WFNQ 4RW7B 2QA4S 1WSVA 2VUGA 4GRSA 5J2QA 3B6BA 1N33F 3R97A 1GXUA 4PABA 1SL0A 1SH3A 1RTIA 4KH0B 1E6YB 3M8WA 1D09B 2DHXA 2ZEJA 3VR1A 1QAXA 3I96A 2YH1A 3C46A 2XYGB 2K3IA 3T1YJ 4LF9J 1YQHA 3TEHB 3B4MA 4BWJA 3UWTA 5B08A 5IQ6A 5E41A 2HFOA 4NWBA 4DXLA 3VGTA 2LDIA 4DN9A 1T9YA 4FF3A 4CNZA 4ZITA 3J7Z5 5F9NA 3VGSA 3OR1A 3NGKA 4ZVSB 3SCIE 3JAMU 1N36F 2CPEA 3AAWB 2CPDA 2DNRA 1FCAA 2KN4A 3ZO7A 2FHJD 3W65A 2CQ4A 4UY85 2P6SA 4PCQA 3MPVA 2V94A 2V69A 1NDCA 4NCBA 1RAGB 2CQIA 4O23A 2AJFE 1Z1ZA 2CJBA 3DI6A 4G1IA 4OX9F 4CLUA 4R5PB 2ZHAA 1RWUA 1YTYA 1A9NB 3AXKA 4CO4A 2HFNA 4I1TA 4M5KA 4CZCA 1R0AB 4OLOA 1WG4A 4OLPA 4F8RA 2CNKB 3MR6A 3TA0A 3CO0P 3QBCA 2AGPA 2W9BA 5AJ3J 2HZAA 2OKQA 3HKWA 3UW1A 2XEXA 2M4MA 3IR7B 3RBZA 5LT5A 1RHQB 4QWDA 4NPOA 2ILZA 2DVIA 1LW2B 4B9VA 1VMBA 2AU0A 4NRTA 3AHPA 5KFNA 1U1NA 2WCXA 2RMLA 2C2OB 1KHWA 1FNOA 3M6VA 5DQHA 3DM2B 3DRXA 4XPEA 3OR2A 4USVA 4NLPA 5E3AA 2YKQA 1Q1KA 2Z57B 1MG7A 3M1VB 4FKXA 4JV0A 2BANA 3ISND 2IVFB 1GXTA 1WORA 4HH0A 4WFZA 2OPPB 3MURP 2XY7A 4C8OA 2XMTA 1WOSA 3CC4S 1TL4A 3P96A 4WP9A 2XCPA 3M32B 2BKPA 1HI8A 3UCUP 3RR7A 3PYEA 1DAXA 1WC6A 4ECWA 2CRLA 3D9BA 3AQPA 4WPAA 2FLNA 2IJNA 4A8SA 2R7XA 1QSSA 3ZNUA 1WC3A 1IM4A 1KQKA 3MR5A 3G96A 3ITHB 1UW4A 3VAIA 1AYEA 1BY9A 3BN7A 1C0TA 3NS5A 5F8MA 4LF4F 1CSJA 1QJHA 1U09A 2X7IA 4WXWA 4DV6J 4LT6A 5A6WA 2ZJPQ 2JC1A 2XMVA 5J2MA 4R25A 2MPUA 5L1JA 4LF7J 1UZDA 1ZM4A 1NKCA 4AL5A 4USKA 2NXCA 4YB5A 1VQLS 1NZAA 2FYXA 3D1QA 3LGNA 1HMVB 2OPRB 4Y2AA 1EQMA 4OYZA 3CW2C 4WBFA 4CLPA 1SKSA 2QLJB 1M90T 4HDGA 2FC9A 3N6NA 2BW2A 1HR0F 3OFGA 3HF5A 2DIUA 2OTJS 3AODA 2WK4A 4Y00A 3IBFB 5DS7A 3D2WA 3R1LA 3DC2A 3NL0A 4ETXA 3CJ5A 1EKSA 5KFKA 2RS2A 1LWXA 2J9DA 1AFIA 3KKFA 2N4CA 1FHTA 1S49A 2G1HA 3C14A 2JX2A 2QL9B 1GT8A 2PN6A 2DNGA 2YNIB 4OYPA 4X4RA 1BHNA 2HIYA 4LRCA 1DLOA 2KFYA 2GGPB 4EEYA 2HQIA 3SYZA 4B3OB 1JXLA 4N5SA 2N7YA 4DSJA 1RWPB 2WSEC 3GONA 2CPIA 1RT3B 4K7QA 5CYJA 1EJ7L 1SJ1A 1VQ6S 4RW6A 1S99A 5A0YB 2R8JA 2ZOGA 2GAHC 5HQLA 2HWTA 1R27B 2ATCB 2FJAB 3TNVA 1AROP 1SJRA 4HACB 3N5FA 4NLOA 4UUWA 4Y3CA 4LFBF 2DY9A 1ZS6A 2ZWPA 1TKZB 4TYAA 2YKOA 4DV1J 4QR1A 4FF4A 2BA9A 3GP9A 2IA6A 2KRBA 4C3MA 3RR8A 2DHSA 4X65F 2MQPA 5L9XA 1F5CA 5HLFA 1S7HA 3D1OA 3FSYA 2HKEA 2KT5A 1Q8BA 3KG4A 4ZOSA 1XTZA 2LXUA 3GJTB 3NBPA 1XR7A 1XMBA 1JJHA 3ZTSA 1U45A 2CQHA 4IH7A 4F2SA 4M5LA 1BWVA 3RGIA 1HHSA 1NNDA 2YXLA 3GR1A 4U8YA 1DFDA 1PAUB 1NH8A 4UOHA 1NHKL 2DNMA 1MSWD 2PA8D 5L1IA 1NO8A 2J9CA 4RBTA 5DG9A 2NQPA 5IM0B 2ERRA 4R5PA 4QBUA 2WB4A 4JV1A 2M5YA 2E9ZA 3G4SS 2Y1LB 4H4KC 5GAHU 1C1BB 2MQMA 4C0BA 1RHJB 1WUUA 2HHPA 2KI2A 3CJ3A 2ZKTA 3BZQA 3M2RA 4EBCA 3S6EA 4DR4J 4PG5A 1K1SA 2HHHF 3HSJA 1AA1B 4ZHRB 1SC6A 2LLZA 3BKTA 2IRXA 1GXLA 4ECRA 2C2DA 3NGUA 2YNGB 2KG0A 2BRKA 2XS5A 1RT5A 1ZZFA 3NAIA 3MGJA 4PXDA 1DQ9A 2QL7B 3NOGA 5LMUJ 2Y1JA 1SJFA 2HS0A 2JRSA 1XNQF 1U1RA 4LFAJ 3QJPA 3DYAA 3EYZA 1TAQA 2PMHA 5LSRA 2SXLA 4F4WA 1UVJA 3WZ0A 1DY3A 4ZJLA 2RAQA 5K9FA 4IFVB 2IFXA 3W2WA 3CCQS 3K5LA 2I5JA 5B7WA 2BYCA 4HHUA 4PXEA 3PR4A 2PE8A 3CJKA 2HRYA 5CXTA 2J6TA 2MKIA 4QYZJ 4XDCA 3AXMA 1VJWA 5HANA 2Q3PA 2VG7A 3TQ1A 3NNCA 5FJ4A 1FRHA 3VGUA 4IQXA 2WBRA 5F0WA 1ZM3A 2JDJA 1T9WA 2H51B 5HLFB 1S1VB 1YG0A 2AZ3A 3K2YA 3M9NB 1CJTA 2KL8A 4ZVPB 4GVBB 3EX7B 2P6TA 2B0GA 4DUYF 5AXNA 5KG2A 2FHJA 3LO3A 2XB2D 3DCAA 1UEVA 4LIRA 2E1MC 2G2ZA 1QUPA 5DRKA 4DFKA 5KFJA 1FD2A 2XI3A 5ITHA 2IM2A 3BJYA 4ATNA 4IQMA 2CXEA 3L3CA 2W4PA 3E01A 1FRKA 3KK1A 1OQ3A 2VDIA 4ZKAA 3F73A 4PKDB 3JQJA 4I6YA 1S6OA 3HM9A 1VHFA 2E7VA 3IRWP 1RT2A 3SFUA 3ZZPA 5H1SV 3T1AA 3HD1A 5BR8J 4JBCA 3CEDA 1R8HA 4MK7A 2EEYA 4N8NA 1UVMA 1T0TV 2FJDB 3WIUA 3CD6S 3MM6B 2IPOB 4DG1B 3K17A 3NCQA 3WIVA 2JLGA 1U47A 1WF0A 2GX8A 1GFWB 2DNKA 4EO8A 1CPZA 5D3GA 2LYVA 1HI0P 4KHRA 2DR6A 1WKJA 2ACMA 2M88A 4WYLA 3J80Y 4P2SA 3Q2TC 3RW7A 2FGOA 4PPDA 1VRUB 2HK3A 3CB4A 5AT1B 2GIRA 5KFUA 4M5GA 3VVTA 1YDLA 1X4EA 2V8DA 2KDOA 1QAIA 2ZZNA 2B6AB 1MLAA 3HULA 2YWGA 1HBUA 3JXOA 3IGVA 2KXNB 2MZRA 2HQ3A 4RR5A 2QRRA 2I8EA 2MGZB 4U8VA 4FPRA 2O1PA 1EETB 5L1LA 3GFHA 4LSLA 4PXCA 2E5JA 4TY9A 2QE5A 3R3TA 3JQMA 3FKBA 1Q8IA 1VYAA 3GV5B 4FVMA 5L8RC 2DT9A 2W2NP 4DWIA 3HP6A 1C1CA 1PC5A 1PJ5A 4P7VA 1ZM2A 3CMQA 3EE3A 4TYBA 2P5VA 1X60A 4ZJQA 2HFZA 3HSZA 3OTOF 4DF8A 2O66A 1IKYB 3GJQB 2CA9A 1UFKA 4BLGA 2XY5A 3HT0A 4RNNA 2D3UA 2NZ4A 1HD1A 4DUZJ 1CJKA 4KGXB 4OYXA 5M2RA 1CS4A 3HD2A 3SCLE 2OJ3A 5A2QY 1FDDA 3H4DA 3KJFB 2MZTA 2QLBB 1T9XA 3A13A 3POTA 4TU9A 1H38A 1IBLF 4LRFA 5L38A 3H40A 2JLFA 3U1LA 4DUTA 3M8QB 4NCGA 2XSJB 3RAMA 1HW8A 3T9ZA 2DNNA 1LW0A 3R7BB 4Y0FA 3LP2B 1YJWS 4HT7A 1SXLA 2WONB 3G9CA 2OPQA 3FQKA 2OO4A 4FZVA 2ROPA 5AE1A 3PM9A 4ZVUB 2HNZA 4KE5A 3V4IB 1HYSA 4CLFA 5HVHA 1S6PA 5IT9Y 2DNQA 1TL7B 4RU2A 4WE1B 3DLLQ 3M1VA 4Z2XA 4C7QA 2FZCB 1F6TA 2W24A 3CCUS 1R3NA 1WC1A 1IBKF 2W1BA 5HMWA 2CWXA 1A7GE 4Z37A 4ERDA 2GHPA 1WKKA 4C97A 1LWCB 3NCRA 2NUHA 1WOOA 4UY8T 4P9SA 3GG1A 4GC6A 1RCOB 5I3UB 2EI5A 3PKMA 4C8YA 4B9LA 1Q4RA 1VQ5S 5J2NA 2LFVA 1WHYA 5E0OA 3A1YG 4N76A 4FXDA 2B51A 3NLCA 2BR0A 3LTOA 5EGYA 1N0VC 2IHR1 4F4XA 3RRKA 2ZHBA 5HBMA 1Q7LB 1WI8A 4MIBA 5KG7A 1DTTA 4CDIA 2EFOA 5IC4B 3UCGA 5B0DA 4A8FA 2ZUGA 1RK8A 4O3QA 1UVKA 1JLCB 2FZGB 2IJRA 2D3OR 4ILMA 3GR0A 4DV6F 4NXMJ 5F8NA 2GJIA 3Q8UA 1FEHA 3KDOA 3WX8A 9RUBA 3MTKA 5D0GA 3SZ2A 3H5SA 2GJ2A 5EDWA 4IO9Q 3NWGA 4FXWA 4X64J 2K06A 3DLGA 3S01A 3DXSX 1N52B 3PJ9A 2DGWA 3OFHA 4QPTA 4TNOA 4MYUA 3QWPA 1XIQA 1RZMA 3IP0A 3D0HE 3DN9A 3MM7A 4CYUA 4I69A 4C8MA 5J1EA 1K73T 4JV2A 4RBUA 5ETRA 1GAOA 1EP4B 1KQSR 3VAHA 4B9UA 1L3UA 4DFMA 4OI0A 3DLEB 4WJBA 4DQSA 1RBLA 1M5SA 1FE4A 4QWBA 5K8NA 4LFCJ 2CPHA 2VG6A 3LP2A 1GX6A 3DMJB 3M9OB 4IKAA 9ATCB 5LMUF 1SB6A 3EZ5A 3DHWC 2UXCJ 2HMIA 3IS9B 3PX4A 1R8PA 4N77A 2QIFA 4DLEA 4EBEA 2YQ0A 1T05A 2Y0SD 2R8GA 3I5AA 1HNZJ 1HPZA 3LWLA 2EKNA 3KOAA 2WVCA 1TL5A 3MMJA 5F9LA 2HHHJ 3FFIA 3OW2R 2MKHA 3TVYA 3L4BC 4U7CA 2HZVA 3UN5A 2R7OA 5GVQA 3NS6A 4HT5A 1OPIA 3BKUA 1MWYA 4A8XA 1WHWA 3Q86A 4DCJB 5F3TA 5KFQA 1JLQB 1HQ2A 5F8IA 5FLXU 1B0TA 2XYHB 4JI7J 5ETVA 4CH0S 1JLAA 2OPSB 2OTLS 4JI3J 2DD8S 2YNHA 5HQ8A 4DLGA 1JLFB 1V3SA 5BXIA 4KBIA 5KFOA 1MN9A 3LGMA 1RYSA 3OT9A 2NXEA 3OLAA 2HGMA 3HO1A 2AYBA 2HHTA 4YP3A 1ZPWX 3TZXA 2L9DA 2XHCA 1IWGA 1NB7A 1WKLA 2CNLB 2WB1D 1PCAA 1FA0A 4RW7A 3TYTA 1HNXJ 4KJIA 2HFUA 2G2YA 4J90A 1UWBB 1J5OB 2VBXA 4ID5A 2IAJB 1O6XA 2ALYB 2CNOB 3FEXB 3DYAB 2B43A 3MM9B 1HMVA 2OPRA 4KHMA 1F5AA 4JI8F 4J91A 4A8YA 3PY8A 3J7AN 2Y3YA 2HS4A 1KLMB 3MEKA 4ZMMA 3PKYA 4BWMA 4DV1F 3TUPA 3TZYA 3Q83A 4X4SA 2H4WB 2RF2A 3P5BP 4X4PA 3BGFA 2XO7A 1W2BR 3IC1A 1CJVB 2DH9A 1RAIB 3D0IE 2QLWA 2KTQA 3IM9A 1RI7A 4P73A 2GVDA 3G6VA 1TFWA 1RWVB 2GMJA 4FDFA 4OQJA 1U1QA 2EWHA 2VPYB 2DO4A 3SXLA 4FBTA 3D7SB 1T9TA 1U8SA 5AXKA 3BH6B 2I38A 3H20A 3M2RB 3I32A 3DLKA 3R2DJ 2GCFA 2I6WA 2X1FA 4K4VA 2HFSA 5GAGI 2UXCF 3L7OA 2IJFA 1T05B 4M94A 1NDKA 2YQ1A 1A0OB 3ADAC 4CLSA 2J76E 4HEA9 1EKRA 3ZZYA 3TUJC 4B3RF 1SUQB 2GHWA 3K59A 1TUGB 4P71A 3TO8A 1S0MA 3H8YA 4YB6A 1MROB 2B9EA 2JNJA 4DBQA 4DS4A 1X9MA 4X62J 4NLRA 5I3QA 3TZWA 2RQKA 2DKOB 4M5JA 4H4KA 5C25A 2I9SA 1CC7A 4MT1A 4RW9A 4IR1A 2K7JA 1RT3A 3R6GB 2R2SA 3KG0A 2F65A 3C15A 1UL3A 2UV8G 3GYGA 4UOCA 2M8DB 4Q0BB 4OL8A 2PIIA 1CJTB 2WVEA 5D4OA 1LK7A 1YJVA 1RDRA 4L6V3 2BOAA 4USWA 2KM8B 4H4MA 4C9DA 4U7UD 1UWBA 2QLFB 1J5OA 2B4UA 3E3XA 2HLTA 4U67Q 2RU3A 4FPIA 1PO6A 3OJUA 1NKBA 3BGOP 1P6TA 2F8EX 4USJC 2H65B 4RWWA 4I7FA 2ZH1A 4DX5A 3CCJS 3L95X 1NHUA 3CCES 1S1UA 4XO0A 2E9TA 2RRBA 1RT6B 1RUSA 2C2NA 4D3HA 4ES3A 2X3DA 1ZA1B 3QT6A 3SCKE 3U1NA 1LXJA 4OX9J 5DDQC 2E7WA 2E1RA 1VFJA 3R1HA 2MKCA 3LALA 2HNYA 4O3PA 1VQNS 4DL3A 2Y8YA 3AJDA 4K8RA 1LWEB 3PO4A 4I2PA 4PG8A 1RWKB 3NRBA 4PG7A 2L3MA 2FJEB 5KG0A 4YHHF 3OVAA 2A18A 4K5SA 3M2VA 3G8QA 3ZZ0A 4C8LA 1AT1B 1VLOA 4ECYA 1NPKA 1FFSB 2ZH7A 3GIIA 4QW9A 3NAHA 3NGSA 3KLHA 1S10A 3CDAA 3QQCD 3CCVS 4J9VA 3W5YA 1MMNA 3LP1A 1S9GB 2RHQB 1XR6A 3C6UA 2KHDA 3FMBA 1OJ4A 2HK2A 4WCEQ 5I3PA 2GVZA 1PC4A 2LEBA 4PRFA 3JS9A 5HMXA 5ETQA 3PJWA 3FCWA 4AUKA 2BE2A 2CQBA 2Y9HA 4WF9Q 2IRUA 3M32A 2WSFC 2XO6A 2EFVA 1FNXH 2FVSA 1M5PC 4TKTA 3I56S 1AUDA 2F4FA 4IRKA 4OV1A 1YJUA 5F8GA 4KB7A 3IWLA 3NY0A 4WTOB 4KHPJ 5HP1A 4PWDA 3KYLA 4DOZA 2AX0A 3THVA 2J8AA 2DR7A 3CE8A 3JSBA 2G0IA 4GKKJ 1GMVA 3IWXA 4P2MA 3MWBA 4F0HA 3JYTB 4DUZF 1VQ9S 4LFCF 2LEAA 4OYIA 2IMWP 4DV2J 2BMBA 2UXDJ 3BBCA 3P8BB 2R2UA 3DOLA 5C5JA 3W5XA 1RBAA 2HRTA 2V8VA 3D6TB 4ZPAA 1X4AA 1IKYA 4K5RA 1W26A 2MHEA 4C3KA 4F02A 2FVCA 3EWGA 3ILLA 2DRAA 3ENAA 3H2VE 3HHKA 2ZC4A 5IZHA 1FE0A 3RTVA 1HQUB 1LFWA 4HACA 2V4RA 4OZNA 4X64F 3PEHA 3OTEA 2U2FA 2FJBB 2V8GA 3EGVA 5L46A 2HHSA 2MKJA 4CP5A 3A3OB 3A8EA 4I6WA 5DG8A 4LF4J 1OS5A 3UDCA 2YNIA 1HKAA 4Z7YA 4WK1A 2X51A 3MMCA 2HHUA 1KLMA 3KLGB 3UN2A 1H2UX 1FDBA 2AW0A 1K9MT 3W7BA 1DHMA 4QW8A 3D6FB 3K5PA 3MM9A 1VQOS 1IBCB 1RWOB 1KONA 2ZOFA 5DETA 2DXFA 4X4TA 1SI9A 4F7VA 1PSDA 3QIDA 1YJ7A 4GMKA 1U1KA 1N48A 4FKYA 1W7WA 4K0KJ 4PUOB 3W66A 3JTOA 4DL0C 1RB0A 2FJWA 2CQ1A 2F4VJ 1HL6A 2KVQE 3O1LA 3KJQB 3QLHA 4J9OA 2BABA 1Q5YA 1WD6A 2CADA 4RX6A 2FVPA 3DU5A 4DQIA 5DJBA 4ZK7M 3SQGB 2AGOA 4GVLA 2J0SD 1Q53A 2P2CB 1BWEA 2B7BB 5AXLA 3KLIA 1XNQJ 2V5HG 1IXKA 4A8OA 4DR6F 5KT6A 3BO3A 3ET6B 4CM2A 5IV4A 3N6MA 4DI6A 2K3KA 1N5QA 3OLBA 1S77D 3KNAA 2HGLA 2KFNA 5DQIA 4LBIA 3WC0A 2XMKA 3LP0A 8ATCB 3B4DA 3E51A 1S5ZA 2MXYA 3EDQB 3OHBA 1WF1A 2PSZA 3NP5A 4J5OA 3CCRS 3R9LA 1HWJA 3D66A 3LGHA 3GWCA 3H5UA 4ZVRB 4A47A 5BR8F 4JI1J 1UZHA 2FLOA 2HBRB 4BC7A 2R4FA 4I2QB 4HL9A 1TL3A 1TUVA 4MIAA 5HN0A 4Y2IA 3PRVA 2CZ9A 1FKOA 5EX3A 4OYMA 3R5DA 1BE4A 4IG0B 3CCLS 1O5JA 2W9CA 3C6TA 1PBUA 1SQFA 2R9LA 1YX2A 3KMSA 1L3KA 1ZAVA 5CA5A 4J9UE 3OFEA 1U24A 4YOEA 5KFSA 5LSOA 4MTPA 4NASA 4NYPA 2ZZMA 3J81U 3VTIA 4K59A 4NLQA 2J0WA 2JVRA 1Y7PA 2ZWOA 4HKQA 5HVGA 1X0PA 3QO9B 4UTGA 1NEEA 4C8KA 4RNOA 2O01C 1WDDA 2YKNB 3P5TL 3R6LB 4L3KA 4NMLA 5BYQA 5DM6Q 2BJDA 5I42B 2ZDPA 2EFGA 1NKEA 4J7CA 2ROEA 2XWXA 3KLEB 2M70A 5DDPC 1G2EA 4LBHA 2HEKA 2VFVA 4MH8A 1KVJA 2Z8QA 3Q8PB 2AYGA 6AT1B 1WELA 2XM3A 3CJSA 1LWEA 5GADI 2MY7A 4OHXA 2DNYA 4L76A 1R0AA 1HQEA 2KYXA 3HZEA 3VGVA 3W1YC 5A2QU 3I55S 2FJXA 1QE1A 2D3ZA 4RJVA 4USMA 1S6QB 2CYYA 4MK8A 5ETLA 3W2VB 5LL6d 2O67A 4JI4J 1U0HB 3ETOA 1RHRB 2KO1A 3CCWA 4UZBA 3MM8B 3JQKA 3MFIA 1TVRB 2ZH5A 1U6FA 2CPZA 3HHDA 2VBWA 2C2KB 2QFJA 3AOAA 4TU7A 3KTQA 3U02A 5K8OA 2OH2A 3C19A 2DGVA 3NMRA 2MMYA 3JSRA 4A4JA 5A8WB 2W2QP 4YY3J 3PFEA 4CLLA 2J7UA 3UPFA 5IT9U 5KFBA 4OHYA 1X4GA 2VL1A 3D28A 2BANB 5JVGQ 1FRLA 1UVIA 2BQ3A 5KT4A 1T95A 4ICLA 1NJXA 1VQ8S 4XPCA 2IBOA 2ZVSA 2UVRA 3J7YI 1RBOB 2ZM6F 2KM8C 2MJNA 4RKUC 1L3TA 4LF6J 2WW8A 1K44A 2PEBA 4KV8A 2KG1A 5K8PA 4ZVQB 1U7LA 1PILA 1KC8T 5H9FJ 4CI0B 2RUSA 2MQOA 3QJLA 2OMOA 3QWUA 1H72C 4C4WA 3CTRA 1HQUA 2POKA 1UA0A 1PGZA 2VG5A 3D3BJ 4RLEA 4RW9B 1KD1T 1S76D 3TAMA 1VC6A 2J7WA 3M8ZA 2C3OA 3QGPA 5DZ7A 4HVZA 2UU9F 4OI2A 4NOHA 4RW8A 4BS2A 2JEGA 1X4CA 1REVB 3MECB 3PW4A 4ANEA 5A8KB 1AZSA 4J9PA 4IO1A 1SH0A 4E0DA 1G1XA 2YNFA 2BW7A 2N3LA 3N4WA 3RRGA 5C2GA 1HNIB 5CCMA 3FNNA 2YWFA 1TFYA 2XHWA 3ZNJ1 2CFXA 5KFWA 2HMIB 2FTRA 2VFTA 3QATA 3R5BA 4ED5A 2ZE2A 1QE1B 1P1TA 3KUGA 3OR2B 4P2XA 5CH7B 1SQEA 1SKRA 2HHXA 5CCLA 2GJFA 4F4ZA 4LSLB 3UD3P 2ALZA 1AXQA 1VRUA 3OTDA 3EGNA 1PIEA 5KOWA 2V9WA 2ZOMA 2JFDA 2VIHA 2BOPA 3I0RA 2B6AA 3NEKA 1HNXF 4B3TJ 3V81B 1XJWB 4RNMA 4GC7A 3HFVA 5KG3A 2GQCA 5E3QA 1FXLA 2GIFA 3R5CA 3MR3A 4DV5J 4MAKA 4BHQA 3K5MA 4ILRA 4OHZA 2RDJA 3CC7S 2OD4A 2M7SA 5KFGA 1OSDA 3CVKA 2CWKA 2BDPA 5IWAJ 1S1XA 2QA1A 2NSBA 2VC1A 3C16B 2HRUA 5F3ZA 3ENWA 4PQUA 5D0RA 5K14A 4Y28C 3AOCA 1KN6A 4RUCA 2FHKA 3LAMA 2VOPA 4HI2A 3IAM9 4DF4A 5J2NB 2O3DA 2HBYB 4K4YA 3THTA 5EWGA 3PRDA 4U6PA 4PR6A 3HJFA 3DRPB 4DMZA 1S59A 2HHWA 2V50A 3HT3A 2DH8A 1VC5A 1VK3A 2X1BA 1J5EJ 1TMMA 2GV1A 4PPZA 3I0SB 2R7WA 2VHGA 3MI7X 4ZPCA 1ELOA 2LCWA 1VBXA 2RQ4A 2WSCC 2DEIA 1REVA 3JYTA 4HTIA 2GQQA 4O4GB 2MLYA 4BCAA 4AQYF 3H42A 2RIJA 4FBUA 1KNZA 1S0VA 2GMHA 3R8YA 3W62A 2DCUB 2RKIA 3VCDA 3V5RA 1HYSB 3DRRA 3GZ7A 3QO9A 1HWKA 1D9FA 3H5XA 1C0UA 1BC6A 1CULB 1WG1A 4B17A 1RTJA 3ZXWA 3HI9A 2Y8WA 4G65A 4DR6J 3BSNA 1RACB 1XERA 3NG8A 3DGPB 1V3RA 1JLGA 3ILIA 5FDLA 3RB4A 2HVEA 1NLKL 2WOMA 4UOFA 5AJ3F 2ATLA 1S72S 4CRJA 5KFHA 1HHTP 1PAEX 3O6QA 1X4DA 2UXBF 3R2CJ 1RAAB 3K8VA 3K8WA 3ZZRA 2MSSA 2QJ3A 4NZ6A 2WRMA 1I1GA 2XZDB 4TVAB 5HQMA 3EZOA 4ECZA 5E3CA 4NLXA 4KGVB 3MUTP 2B8QA 2NZCA 1X5PA 2OSRA 3OQ2A 3CT9A 2AP6A 1MROA 2DGOA 3PEJA 4LSNB 5CZVA 3QAEA 1QY7A 4Q8EA 3MPYA 5DDOC 4FP9A 4JB8B 3PVXA 2Q66A 1HQEB 2KU7A 4NRUA 3H25A 2YTCA 4G6VB 3HHLD 4JOUA 4NI2B 1JLCA 4W98A 3TUIC 3GV7B 1FRIA 4EYHB 1U1LA 4URQU 1SL1A 5L39A 1U0HA 2ASYA 5LM7E 3PIOQ 1EETA 4CO5A 4ED4A 4ELTA 3ZC4A 2XS7A 3OVBA 2EKYA 4DDFA 2VA2A 1XNRF 2KRRA 1JIHA 4PQUB 2KJWA 3MCOA 4KSEB 5LXRA 4DV7F 3KLVA 1BD6A 2OAUA 3N9UC 1HARA 1Y3JA 1NXIA 1N5YA 1FEEA 4OZ3A 4NLVA 1N36J 2PO4A 3SEOA 4JI2F 3T19A 3W8GA 1DARA 2AIRB 3BF4A 1Q8LA 3WHIA 3VAFA 1YJ9S 1RYRA 2HPUA 4LFAF 2CJXB 3KJVA 2A6OA 3MHYA 2IC3A 5KFDA 2UXDF 2HLUA 4M5DB 1RLDA 2Q79A 1NSKL 5J1PA 3M7VA 2Y0BB 3DOMB 3OHAA 4KGZB 2DIVA 3KLGA 1N0UA 1RP5A 1SV5A 5U47A 3SIPB 5IV3A 2F63A 3B78A 4E8UA 4J9SA 2QMXA 1VGYA 2QC3A 1RT4A 1S6PB 4TY8A 1HBOB 1Q79A 2CJQA 4NYOA 2WVDA 2HNYB 4NLTA 4FS1A 1DZ5A 3CPWR 2IM0A 3M2UA 4CM0A 3TZZA 2KYZA 2DR9A 1TK8A 2EW9A 4R8UA 4LSZB 1IM6A 1UEKA 2LDYA 3KLFB 4LVOP 5ADZA 3QFWA 4RW8B 2I2YA 4DL7A 3UCZP 2P9CA 4DL4A 2CPYA 4ZVTB 2AEMA 3CCMS 2M0GB 3CO9A 4JYAF 3ILOA 1TKTA 2D69A 2EG1A 5F0UA 3ENQA 1RWMB 2OP5A 3CDEA 3MUMP 3QSYB 4RW4A 4Y34A 4KY3A 2MQLA 4B3OA 4ZP7A 1X7VA 3D0GE 4ANCA 4CWBA 2XC9A 2W9AA 1EZZB 2VQFF 4B3MJ 1UFWA 3T9NA 4GVBA 1ZZNA 2J6UA 1VRTB 4LRAA 4IG3A 4JI5F 3PW0A 4TN2A 1FFGB 1NSAA 1RA6A 2GO8A 4WP8A 3T1YF 2D3O1 4DSLA 3L09A 4LF9F 5D78A 5B0FA 2VC0A 4ID5B 3BV8A 5B0EA 3FBFA 4B9SA 1XN9A 1MMDA 3EICA 2Q1LA 2FVQA 4AFFA 3UR0A 3QT7A 3MCNA 1UMJA 2B9YA 1HHQA 5KG6A 1PG5B 1RTHA 4LF5J 4QWEA 2IC3B 1WSRA 2RU9A 1MU2A 2DH7A 3BH7B 4PG6A 4RUHA 1FD8A 4K4XA 3Q89A 3BS9A 5LMNF 2ZBQA 1KTVA 3UDLA 5A8RB 1GQEA 3A12A 4OI3A 4ZJOA 2F8MA 1NJZA 4DJBA 3Q8QB 3FC9A 1ROFA 4B9MA 2XTJP 3A4TA 1C0TB 4PYAA 1FRMA 1SIZA 1R8AA 3MD3A 1T03B 2VOOA 1OIAA 5KT7A 4Q43A 1BQNA 2JVOA 4M5MA 2ASDA 3SMZA 1RTDB 1YBTA 1ZA2B 2Q6BA 3IO1A 3QAUA 2RRAA 4FF1A 3CULA 3MZIA 2CG8A 1MN7A 1UJ4A 3I9ZA 4QR2A 3K58A 3TJAA 5EWEA 5M2UA 2N4DA 1LV5A 3MCMA 2ILYA 3BSOA 2FB0A 2GC8A 4I6AA 1LXNA 3V6HA 1UPMB 4KGKA 2ASLA 3A3PB 5HI7A 3NNHA 5THWA 1L5UA 1J2VA 1UEUA 5T7LA 5KG1A 4BC9A 4MK9A 2CQ3A 4PZVA 3I4HX 5D77A 1FKAF 2HS3A 1F2HA 1X8DA 3UD5A 1FWPA 3T3FA 2FIUA 3BQ1A 2UU9J 2OI2A 2RILA 1U6ZA 2Y1IA 4DR7F 2YNHB 1IKVB 4EFAC 1YZ7A 1GX5A 1TUWA 1ZAXA 3KJNB 3AOBA 5HAOA 3JTNA 3OTCA 5IXUA 1CJUB 1GMWD 3G87A 3CJKB 2XNRA 1RE1B 1YWXA 5D6GA 5HROA 2W2MP 3TUZC 5KTQA 3S7RA 3W2WB 3HHLC 4KV8B 4JI4F 2YKMB 1EB0A 3HHEA 3KK2B 4LF6F 2MYFA 4I64A 2XMMA 2B5JB 4NCAA 3BYRA 4CO1A 4IOAQ 3FCHA 3P6YC 2AWZA 1GMWA 3LH2S 4MYTA 2ZH4A 5LJ5Y 5DZ6A 5DLFA 4JI1F 2AYMA 3MMBB 4Y6IA 5JXSA 1M5OC 3HDSA 1MW7A 5FD1A 1FXRA 4ES1A 1CBKA 1H3DA 1NAQA 2YWHA 5IS2A 4IRCA 1KS2A 2VFUA 3OUYB 4M5HA 1H7WA 2PI4A 2RF2B 3BB5A 4OV6A 1RTDA 5E7OB 2J6SA 1ZOTA 2R3VA 3M05A 3D3CJ 1MWZA 3BEGB 4IOBA 3MEEB 2ZBIA 3H5YA 1T11A 2D9PA 5KFLA 1TZ0A 3CJ4A 1VRQC 2M2BA 3GQCA 2H54B 2NUUG 2HVIA 3D54A 4G1QB 3QRRA 3MPDA 1Y10A 3PG9A 3CUNA 1T03A 1DRZA 4DV7J 4PAAA 4ZA1A 3I87A 2D9OA 2VB6A 1OYEA 1FWKA 5D15A 2V68A 3MM5A 5F8JA 3IR5B 2AEJA 4N47A 5KFAA 4URGA 5IM0A 2AJQA 4R0EA 1CQNA 2PD1A 3BM7A 3FBCA 3C15B 4ER8A 2XULA 1UFLA 4AXJA 3GLJA 5FIIA 2A6MA 4AD6A 4ZIVA 3VHQA 4DR1F 4DR5J 2DRBA 3BGRB 1PYTA 3AT1B 4C8NA 4U96A 1TKDA 2UZAA 1RAHB 3IAS9 1IR1A 1OY8A 3HCXA 1HNVB 1HW9A 3HJVA 4K2JA 2DY1A 3NWRA 2KH9A 3GYNA 2CPXA 3FJ2A 3KDNA 4ZS6A 4C8ZA 3P3DA 1NDPA 2VF3A 1URRA 1HFEL 2ZJRQ 1CJKB 3CDWA
chains in the Genus database with same CATH topology
2JOQA 4QYRA 4QR0A 4CO2A 3HK2A 3DMJA 3MMAA 2NPIA 3RB0A 4C11A 2AQ4A 3IG1A 4AXIA 1FRJA 1YITS 3PR5B 2IA0A 1S1TA 2M9KA 1EP4A 1OSCA 1XC9A 4ED2A 2LU2A 5IQQA 3AH6A 7FDRA 2OD6A 1VK8A 4ZVFA 2ZDOA 4IG0A 5KFIA 1T3OA 1IUJA 4Y2MA 3CIMA 3QGHA 4WU2A 2LU1A 4O44A 5AXMA 3C2PA 3LP1B 3UE2A 2G9OA 4G1QA 5D3GA 4OZ5A 1VQPS 2DJWA 2RE1A 4CO3A 1YI2S 1RT5B 5KG4A 2XY6A 4G1PA 3PIPQ 2HVZA 2JL9A 5KFFA 1FT8A 2JJ4D 4OX7A 3LQVA 1JLFA 5CYMB 4L72B 4F50A 2ZH2A 1U49A 5HO4A 5HMZA 4LJMA 2FVRA 1UA1A 1N5SA 5JVHQ 2K8GA 2VBYA 3M30A 5IT0A 5HBMB 1NK8A 3J81Y 4ELVA 4YDDB 5I3UA 3DDKA 1KLNA 4QIWD 2KXHA 1Q16B 1U25A 2RH3A 1MNEA 3KHLA 4B3MF 1TKXB 2AF6A 1WI6A 1HBMA 3IBWA 3UQSA 2MB0B 3VZIA 2YKMA 2EK1A 3DRSA 2CJ9A 1ZAWA 3DNCA 1JLBB 4H4OB 2YKAA 1JX4A 4KT0C 4IFYA 3W3SA 1WNEA 2Z0GA 2D74B 2BBEA 1IQTA 1QSLA 3MCSA 3JB9k 2YWEA 3HVTA 3DLEA 4ZP6A 4NL5A 1S9FA 2NPFA 3TA2A 4X62F 3DM2A 3POTB 2CG4A 4N8OA 4DV4F 1SL0A 1XBWA 2JZ5A 2Y1RI 1OPZA 3MM7B 2RKIB 1Q86T 4NX9A 5KFYA 3O44A 4NLWA 2DGXA 3U1MA 5HMYA 3H4BA 5LJ3Y 1KEKA 3R5AA 4J9QA 1M0SA 2DNZA 2C3PA 3N28A 2DHGA 4USHA 3TR5A 2EFPA 5T41A 3G6YA 3UR3C 2PMZD 4DS5A 2K1RA 3KK3B 5JUMA 2ZHOA 3KLIB 1Y0HA 4FS2A 1Q82T 2VKZG 2APOA 1N54B 4WKRA 1HI1A 2FJVA 2C42A 3TRGA 4DR3F 2CZ4A 1KOHA 2BUNA 1QAYA 3EUNA 2O5DA 2PT0A 1C1CB 2HG4A 3RB3A 4K4WA 4A8WA 3QZ8A 2JEJA 1S48A 2IBKA 5D4PA 3MF5A 3MM5B 4QIFA 1FK9A 4LQ3A 3VALA 3HPOA 4ED1A 2BRLA 2A2CA 5E3PA 3RU0A 1BGXT 5KFCA 5T14A 3G71S 2OPSA 3V81A 3K0JA 4RZRA 5GAEI 2QA4G 3OVSA 1FERA 4NCGB 1FDNA 1S1VA 4TU8A 4CTAB 1N5YB 4MFBA 1GNKA 2EFNA 4O3RA 5C42B 1NK5A 1RKIA 3MMAB 3QPIA 2F7VA 2W7OA 2B4VA 5JJBA 5A8KA 2BQUA 2XNQA 4ECTA 5DLGA 1GTEA 4DL2A 4RBVA 1KQFB 4EU0A 4J9KA 1O0PA 3LOUA 1HWLA 3VAJA 2PC6A 4OJGA 1JLEB 4ED0A 1FVQA 3PDNA 2A1BA 1FESA 1U2FA 4Q45A 4YQWA 2AGQA 3L7PA 2MZSA 5KFEA 2J0XA 2K2PA 3UFCX 4XDDA 3BO2A 3M2UB 5EWFA 1RT1A 3FSXA 3MEGA 4R8UB 1QUVA 2WBMA 4LF8F 2BE2B 2LQJA 5HP1B 5CHCB 3CMAS 4JI0F 4QZVB 5D4NA 1LKZA 2G0CA 2XGQA 2YX1A 2FGCA 1U6BA 4C0OC 1WEYA 1FK9B 2E1AA 4GKJF 4B08A 1E6VA 3IN5A 3OFFA 4I4BA 3IR6B 5KAKA 3D1HA 1JKHA 3BDEA 1Y5LB 1I94F 1F2GA 1ZM9A 4PWUA 2KZMA 1T94A 3O3LA 5AE2A 3Q22A 3H4DA 3R27A 4HDHA 1HR0F 3VWSA 3SSSA 4DSLA 1KR4A 4USIA 1DURA 1VRTA 1WTFA 3F56A 5LXYA 4QQBA 3PRBA 5C42A 4Q44A 1JXEA 1Z2LA 1BLUA 4KKOB 3PX0A 2XLKA 1R89A 1ZPVA 1KHVA 1RT6A 4WU3A 1OQ6A 4IDKA 5IFMA 2BZ2A 1UJ5A 1JLAB 1QLNA 1RGVA 4YB1P 1ZTTA 4B9NA 2BVZA 7FD1A 4J9MA 2BM1A 1NH7A 4KIAA 3SFGA 1RTHB 5L9NA 1C1BA 3K57A 1VI7A 5DO2A 4FF2A 2A3JA 1IN0A 2R7UA 1CVJA 1S9EB 2C3MA 3HVTB 3VQSA 5AE3A 2VPZB 2XCAA 3IS9A 1UAWA 3MOJB 5A6PA 2B9XA 2D7SA 1HPZB 1S79A 4K0KF 3Q0AA 1R7IA 1HNWF 3S8SA 1WG5A 3OXFA 3TAQA 1N6QA 3KMQA 1DLOB 1YHQS 4LF5F 1YIJS 1NK4A 5CD4H 2W4DA 1TAUA 1GTHA 1RT1B 3M9MB 3PW5A 4OZJA 3KLHB 4HI1A 1XEZA 1H7XA 3T5HA 2I5JB 1RA7A 3IFEA 4IRDA 1UVLA 4K4ZA 5DM7Q 2C28A 2MY8A 1FJEB 3GSDA 4TQSA 1NJWA 3T5JA 4KTQA 4I2QA 1R43A 2LA4A 3DLKB 1FRXA 4UUXA 4C0HA 3GV8B 4F4YA 3KHHA 2XS2A 1FNMA 1LK5A 3M6XA 3PJXA 5K14B 4ILLA 3P49B 1F5BA 1TVRA 3UI3A 4J9RA 2IM1A 2UVUA 4I67A 1K0TA 1U2RA 5C24B 2NR0A 4EUVA 2VASA 5KFVA 2B4PA 2DNPA 4DQPA 4KGMA 4NLGA 4RNHA 6FDRA 2UUBF 4CT9A 2DPIA 3VAMA 3HHLA 2CPJA 4QIGA 2F8HA 1WACA 3SCJE 4M5DA 4TY8B 5GMKa 4UQGA 2J9EA 4CT8A 4MFBB 3KJVB 4KHPF 4YUDA 3S1TA 3D5MA 1VQYA 3DOKB 1HBUB 4A8QA 1SH2A 3KHRA 1P1LA 4CQ1A 4DFJA 4ED8A 1W2IA 3N6LA 2F4VF 2FC8A 1S0NA 4OMFG 4TQRA 3N01A 3THPA 1TV6A 4ZP9A 3RBDA 5EUHA 4F3MA 4I2PB 2RJZA 5KFZA 3MMCB 1X4BA 2W4CA 2BV3A 4KR0B 2E5LF 4CCHA 1YJTA 4X4OA 2FLLA 3CDUA 3M4XA 3FQLA 2RRNA 3BSCA 3OXGA 1CC8A 4IG3B 3CCZA 4WFXA 2OSQA 4RW4B 4I68A 5D4LA 5F8HA 3I31A 3GILA 1VQSA 2R7SA 1NK0A 3FEYB 1IQZA 2CQCA 4EO6A 4FYDA 2FD2A 3I82A 2F3JA 3RW6A 2LQ9A 1E6YA 1KRPA 5SZTA 1B7FA 1YRUA 2EVZA 4O0IA 2VV5A 3G8SA 4DV2F 4URSA 2UUTA 2VG5B 1SJQA 1A6LA 1YSJA 5B0AA 4RNFA 4NZ7A 3JSMB 1NJYA 1NJIT 3LWMA 1M5VC 4X4VA 4KO0A 2OPQB 1H6KX 2ZNZA 2ZJQQ 4NLUA 2UUCF 3QJJA 2XSJA 4F26A 4QWAA 4JV5F 2R7VA 3SV3A 2V2KA 4Q5VA 4EZ9A 2HAIA 3DI6B 4M63A 1N4LA 1UETA 1LWFA 1YRTA 1S4FA 3G86A 3MUVP 3SSQA 3CD7A 2DR8A 4B3SF 4Q2LA 3M6UA 3WX4A 3M8PB 2ZH8A 4IR9A 5I42A 2CQ0A 3K7RA 3SSRA 2YKNA 2W7AA 2MSTA 4YR0A 2HVHA 1J5EF 3BSAA 4UQTA 5BYRA 1UJ6A 2ASJA 2OMLA 5DGAA 3N79A 5E3RA 4YY3F 1N34F 2QA2A 4ECXA 2C22A 1TK5A 2AX1A 1JNZB 3HVRA 1DBDA 2XLJA 5KG5A 3O8WA 1DJ0A 5E33A 2DGTA 3LPYA 1Y9OA 4ZVEA 1DQ8A 2X1AA 2OPPA 2ZNYA 3OBIA 4WK3A 3MAQA 2MQNA 3BDPA 5J2QB 5GAHI 2VONA 2ACYA 3CGIA 2RB7A 3KHGA 1Y4ZB 4KO0B 1F9FA 4YMEA 1ZETA 1D8ZA 5F8LA 1BQMB 2HNDA 2V4QA 1V6HA 5D8HB 4QPXA 2DTJA 3MMBA 2CVIA 1JLBA 2AYEA 4H4OA 2XG8A 3IGNA 4AL7A 1VC0A 1RKJA 1JMTA 2M8HA 2V4JB 5H9EJ 1B64A 2RQMA 1U26A 2BACA 3PNIA 5KFXA 1TP7A 3I0SA 4X84A 1FVSA 2IYGA 1V3ZA 3OR1B 3DHXA 4DQRA 1YVFA 2PFFB 4DSEA 4H54A 2LA6A 4MKAA 3BGUA 1BQXA 3MOZA 4OJHA 1HD0A 2VFRA 4B02A 3RYLA 2DGUA 4LUBA 2M52A 2E44A 1HNZF 2NREA 3G6XA 3OV7A 2NSCA 4FVCA 1P9QC 4KKOA 4ZHRA 3CD0A 1Z4UA 4DHVA 3FRZA 1JJ2R 3B82A 1WHXA 4IFVA 5CZXA 1UVNA 1JNRB 3V6DA 3JSYA 5G0RB 2W8LA 4C2MA 1FDAA 3C6UB 2ZITA 4V19J 4NA2A 2CIMA 2QV6A 4JI7F 2AJ0A 2DBBA 2G1DA 4UW2A 1Q81T 4O4RA 1E6VB 4OX6A 5B0GA 4OX8A 2E1CA 4QCLA 2YX4A 3AB2B 1XK8A 2DHAA 4FN5A 4QIEA 2L41A 1O51A 3JTPA 3B8HA 1D3WA 4A8KA 2ZH6A 1CG2A 3WDOA 2CJAA 2UUWA 3IG1B 2MZJA 3E8OA 1H0HB 4U9RA 1TKZA 1X0FA 1APSA 3KK1B 1AW0A 1U4BA 4XK8C 3BQ2A 4MJKA 2WTFA 3F44A 3T1HF 4V19X 2G4BA 4HTJA 5KFMA 4DSKA 4ES2A 5KFPA 2L9NA 4NLDA 1IBMF 1KFDA 4H4MB 1Y5IB 4NYZA 1KOOA 2IVMA 1G7CB 3US5A 2E9RX 2V8HA 5I4MA 3Q23A 4DV3F 2IRYA 3GYXB 3ULHA 3OUYB 2B7CB 4PXBA 3MEDA 2VBZA 2QEXS 5L1KA 3CMES 2JWNA 3AY0A 3ZZUA 2D41A 1HBOA 3VQTA 1G3OA 1IJEB 2E5IA 3QIPA 4M1KA 5C25B 1H2TZ 2RD5C 2CQPA 3DGPA 4Y2CA 3AA9A 4NZ0A 4A46A 5E5NA 2DNLA 4CH1A 4OZ0A 5KOXA 4F3OA 3C66A 3DRRB 4FXVA 4TLRA 4LF7F 2Z2LA 4ZCIA 1VIXA 5DG7A 3CDBA 3GMGA 5MAOA 4DSIA 1YGYA 2PA3A 1FJGF 2ZH3A 2DISA 1F60B 3DFEA 4ZP8A 4ECUA 1VQ4S 2JEFA 1D8YA 5B0CA 4YB7A 2QZ8A 4NXMF 2H9ZA 2HWHA 3GFYA 4YEAA 4ZPDA 4WFYA 4DPOA 3HXMA 1N8RT 2C2RA 1SJ4P 2J5AA 4DFPA 2MZ1A 4OJ3A 4O3OA 3J7ZT 4LSNA 3CF5Q 4I7FB 4F67A 3OL7A 1S1UB 2FHMA 2CPFA 2BJEA 2CQDA 4WYWA 2FY1A 5EHHA 4RUAA 1U1PA 1S1WB 3I5BA 3I0RB 2DCLA 4DR2F 2P9EA 2IAJA 1H98A 2B9WA 3PW7A 1MU2B 1HWUA 3RB6A 4U7UK 2HNZB 3NBPB 4MKBA 2ADBA 4J9NA 1R31A 1SKWA 2PI5A 2GIQA 5LSLA 2R7QA 2ZKUA 4QJVA 5KT5A 3I5CA 3OUYA 1ZYQA 3U27A 1S9GA 3NNAA 4NA1A 4A8MP 2ZBCA 3DOMA 4Y65A 6FD1A 2K1RB 3KK3A 1S97A 2HGNA 3HKZD 3RAQA 2LQBA 4NXNF 1OO0B 2LVWA 3QYYA 1GH8A 2W8KA 2DB1A 4ZDNA 2ZFHA 4R0JA 5A0YA 3BGLA 3AJ2A 4F3QA 4X2BA 2DNHA 2HIQA 1XR5A 2HYIB 4F2RA 3HMJG 2AV5A 2DGSA 1YBAA 2AJ1A 4ECQA 3KFWX 1NK9A 4KAIA 4QOTA 2UP1A 1RTJB 3LW5C 3TX8A 4YR3A 2HHQA 3SDEB 1IJFB 1S0OA 4OI6A 5J1NA 3ZZZA 1D9DA 3OL9A 4WTYA 1U1OA 4K4UA 4LMZA 3SQGA 2VH7A 3LANA 1U48A 3EXYA 4ZPBA 2LEPA 5A8WA 4ID8A 4D3GA 1X4FA 3DRSB 3TI0A 1C2PA 2X1GA 3ICLA 4EWTA 2J0QD 1TKXA 4KC5A 1ZH5A 1FF2A 1T3NA 3DLGB 1T02A 2PGCA 3K5NA 4ELUA 3G8TA 2ZC3A 4DL6A 4LF4F 1IKXB 3QGIA 1TK0A 3HZGA 4ZCKA 2JEIA 3H2UB 3Q8SB 3OSPA 3AB4B 2XBPA 4OZ1A 1V9OA 2RUGA 3DLJA 3X3UA 4X66F 4MKYA 3UD4P 2ZD1A 2GFFA 4K4SA 4J9LA 2XZWA 2N3OA 2IYIA 3FDSA 4DR5F 1KTQA 2YX7A 1RT2B 3E2EA 4EZ6A 4OHVA 1DTQB 2E5GA 1X9SA 4ED3A 2JH3A 3MEDB 1LWCA 3T6BA 2GGPA 2EC0A 3CJ2A 2LXFA 2DNOA 2HZCA 1KQGB 2VKRA 3ZZOA 1HBNB 1AFJA 2KT3A 2XGPA 4PG4A 2I0XA 4ITSA 1FKOB 4OJ1A 4LQ9A 2EBEA 3TARA 4G3IA 2R8KA 3HVAA 5IWAF 1NHVA 1WEZA 3FEZA 3OPKA 1SUQA 5K8MA 2OFHX 3FGVA 3BR9A 5J2PB 3BO4A 2QSWA 2R2RA 1QVGR 1LFPA 3EZUA 1IR0A 3AQOA 3O5TB 2XLIA 3P6YC 4B9TA 1X4HA 2KXFA 2BXJA 2NYIA 5KFTA 4W92B 3HFKA 4IDKB 4O3NA 2L9WA 5BYSA 2Q6CA 5F41A 3M30B 1S1WA 5GAGU 3PX6A 5CYQA 2COLA 1I6JA 4ZCLA 5GADU 1IKWB 2MDAA 2I1RA 3DRPA 1N32F 1SBRA 2DITA 2GNKA 3ITHA 3QZ7A 4KFBB 4DX8H 1SJ3P 2A2DA 3KLEA 4K2XA 4TLQA 2R8IA 3TP2A 1QAJA 4J37A 1FXDA 1X5TA 3NKYA 4QIVA 3ISNC 5B09A 3TVZA 1LWFB 2RS8A 2K7KA 2W25A 4AL6A 4CIOA 3GE9A 4O44B 3WC2A 1N5TA 5EN1A 1ZTWA 4PUOA 3EGWB 3MEGB 1HA1A 2FUG9 1HBNA 3CJ0A 1LW0B 3QMQA 2KJVA 4MIWA 3I4PA 3VAGA 1TFWA 1WHVA 3F41A 2WOMB 3M8QA 3MEEA 4OIXA 4WZQA 2GQ2A 2RSQA 5DGBA 2N7CA 1Q78A 2WONA 3IWNC 1JLQA 4XIUA 3MXHP 3TANA 3FFIB 4FNHA 3ZZTA 2QLXA 3FVYA 5T7LB 4BDPA 3PXGa 3VF0B 2NS1B 3QGGA 3H59A 1HNIA 3K5OA 5E2QA 2AJ4A 3LP0B 3JAMY 3HVWA 1K8AT 4ZPTR 4EGLA 2R8HA 5J2PA 4RW6B 2MZQA 3TA1A 1C4CA 1F0XA 2F1FA 2HHVA 3BGRA 2DGQA 2KB2A 2RVJA 4IYQA 3HX9A 3N0VA 2YKPA 2GA7A 2CJKA 4RU9A 5HROB 4Y2KA 1RISA 2VA3A 2JSXA 3C6TB 3RAXA 4IFYB 4GKKF 1BQNB 2CQ2A 1R6YA 1WF2A 2PDAA 1IKXA 2QMWA 4ALZA 1NU4A 3MTJA 2WAQD 1TV6B 5KFRA 2YY3A 3OL8A 2GMLA 3EPGA 1QM9A 1X5SA 1T7PA 1VQMS 3RRHA 1S1TB 4E98A 2ZD1B 2J9DE 4JI3F 1YRXA 2RQCA 1M5KC 1B0PA 2UV8A 2XSFA 3DXBA 5BJRA 2U1AA 2EG2A 4I0WA 4ZVGA 3G6ES 4HH1A 4ZPWR 3FMWA 1S6QA 1FKPA 3DRYA 3Q24A 3RBEA 2FLPA 2G13A 2GHVC 3M8RA 5D3GB 4CH7A <