4I0WA

Structure of the clostridium perfringens cspb protease
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
92
structure length
91
Chain Sequence
b'AKVGIDFINTIPKQILTSLIEQYSPNNGEIELVVLYGDNFLRFKNSVDVIGAKVEDLGYGFGILIIKVNDLNRIIELEGLQIELPKILYTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease CspB
publication title Structural and functional analysis of the CspB protease required for Clostridium spore germination.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 23
structure length 91
sequence length 92
chains with identical sequence C
ec nomenclature ec 3.4.-.-:
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18425 CspB_prodomain Csp protease B prodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i0wA00
4I0WA
chains in the Genus database with same CATH superfamily
1CJUB 4FF4A 3SSSA 4QWAA 2NR0A 2LA4A 2HK3A 5CQGA 5HBMB 3F56A 3CD7A 3K2YA 1WC4A 1RT3A 5GMKa 3DLEA 4NMXA 1BGXT 3CJSA 4HH1A 2VONA 3VAKA 1W2IA 1FRXA 4DUYJ 3PJ9A 2FYXA 4ETXA 2BQRA 2FVSA 2ZBQA 3A13A 2LA6A 1ICEB 4TVAB 2JVOA 3TVYA 1XMBA 3Q23A 4Z37A 1VJQA 2VJVA 4JI5F 3FUYA 1HBUB 1DBDA 4DZ6A 1TFWA 3J80U 3V6KA 1S9EB 3W2VA 3QIPA 2PMZD 3PRDA 2GAHC 2CDRB 2MKSA 5IC4B 2EBEA 3QGPA 3HMJG 4ZPTR 1VQ6S 3K5OA 3PYGA 2XY7A 1NK7A 4LRDA 4JI3J 3FCVA 3UDVA 1TL3A 3I6PA 5K9FA 3SYZA 3IFEA 2RRNA 1TR0A 1IWGA 2PIIA 2EBGA 1T0TV 4P2XA 3DOLB 4DUTA 2C2KB 2KFYA 1F2GA 2ZITA 1RLDA 3MEKA 2EPIA 2LQ9A 2FJAB 1HNZF 4NLVA 1S5ZA 1NCLA 3GMGA 2LCWA 3D0HE 1EX8A 4MAKA 3MTKA 1T8EA 3O3LA 4ZS6A 5C25B 2OGUA 1WKLA 1NDLA 3RG6A 4KGKA 1M0SA 4Y3CA 3MR5A 3WZ0A 1F5AA 3CJ5A 1FT8A 4U7UD 4JV2A 4DQQA 2HZVA 3H7HB 3H5SA 2CQHA 2LEPA 2VASA 3W63A 3FCWA 3B8HA 2YNIB 4JYAF 4G1QA 2KTQA 1Q8KA 1HD0A 4J9MA 2MMYA 1GXLA 1OPIA 2LYVA 3BDPA 1VQ4S 3DLLQ 2AT1B 1SJRA 4UW2A 2O5DA 1VRTB 1WTBA 1LNQA 2HQIA 2QX0A 3JSBA 1PBAA 2AGOA 1N5TA 4YUDA 4Q7AA 4URGA 4C8LA 3DYAA 1TAUA 1HHQA 1F9FA 3HSGA 4DLEA 2F9JA 1TZ0A 1XIQA 3PNIA 3LP2B 1SKRA 5EWGA 2G13A 1XNQF 2W9AA 3TJ8A 4DN9A 3C6UA 3P5TL 3RRKA 3NNHA 4DUZF 1TFYA 2P9CA 3IM9A 4X62J 2BQ3A 2N3LA 4DR5J 3L9ZA 1HPZA 1WEYA 4ED4A 1RYRA 2R8KA 2YQ3A 4OZJA 1I1GA 4WTYA 2XCPA 2CVEA 4PG5A 1NJYA 3T1HF 1FE4A 4JI6F 2AYGA 1RT2A 4HTJA 5F8IA 4LFAF 1R27B 1KWMA 1C0UA 3OVAA 2BMBA 4LSNB 5MAOA 2ZM6F 2VFRA 4FPRA 2H65B 4WP8A 1YJWS 4O0NA 2VD3A 2W2QP 2KL8A 4OZNA 3ITHB 2HNDB 3OQ2A 3LGMA 1KLMA 4JUZA 1CJKB 5A8KA 4TLQA 4OL8A 4YHHJ 2VH7A 4NLGA 4OHYA 3PFOA 2RU3A 4ZP7A 5ETLA 1YRUA 1HWKA 2AZ3A 4PG7A 4PUOA 3BSNA 4M95A 3BH7B 2IJRA 4OHVA 2XEXA 1H3DA 1UJ4A 1T9UA 3P96A 1CG2A 3N01A 1U0SA 4O4GA 1U02A 4HHJA 3QBCA 3OBIA 2AEJA 2PEBA 3AT1B 2DTJA 3K59A 5KT2A 2K3KA 2WK4A 5C2CA 1X9WA 3WHIA 2HGLA 3DLBA 1WJ9A 5LMUF 1GQEA 2DBBA 2AMCB 3BKFA 2DPIA 3IR7B 2W8KA 1U49A 1UZDA 2P9GA 1B0PA 1YI2S 2CQ4A 2KT3A 5C24A 4FBUA 4KY3A 2RF2B 4P7VA 2M0GB 4TU7A 3MPYA 4KV8A 4M5IA 1VIXA 3CDUA 5A8WB 2YVSA 3LO3A 1RAIB 4OZ1A 3I0RB 5KFLA 2RUGA 2A6MA 4OI2A 3L3CA 2VFTA 2EG1A 4F36A 2XM3A 3H90A 1T95A 2ALYB 2E5LF 5DG7A 3A3NB 5L1IA 1W2BR 1FRMA 1CJTB 2GGPB 4CH7A 2YKMA 4DV2J 1YBTA 4X66J 4ZLPA 1JLGA 1BQNA 1EKRA 3OL8A 3AJ2A 2BANB 3SDEB 2A10A 4RJVA 1RDRA 2H4YB 2B0GA 1SPBP 5KG4A 4JV1A 3SCJE 1RAJA 2OPQA 5D3GB 1L3KA 4O44A 2J6SA 1X5TA 3W2WA 4DL5A 2QE5A 2JVRA 3W5ZA 3X3UA 1FWKA 1LKZA 3FSIA 3HHDA 1MWYA 3I4PA 4PEOA 1SC1B 2PE8A 5IT0A 4B9MA 3IRXB 4M5DB 2A2DA 1PAUB 4RBUA 3FNNA 4M8LA 2MQLA 5J2PA 3RR7A 3PEJA 1H7WA 2ROPA 3I5AA 3CMQA 3LGHA 2WBMA 4Z2XA 2AYMA 2OFGX 1WNEA 1ZAVA 2GJIA 4EGLA 1DY3A 1RT5A 2DNGA 2MY7A 1YGYA 2CPHA 2C2DA 4DV0F 4ATNA 3ET6A 5L39A 3W9IA 3NBPB 4P9SA 3MEEA 3C46A 2QA2A 4FF3A 2QZ8A 2VC0A 3HSJA 2YPYA 3VALA 4CIOA 1O0PA 2R7VA 5IXUA 2F40A 2FTRA 3OXLA 4UUXA 4WJBA 5KT5A 1JLQB 1HQ2A 2JEIA 3CJ3A 1RHQB 2MHEA 3TUZC 4RBTA 2QLXA 2HKEA 3VQSA 1VQYA 1MN9A 4RR5A 2QMWA 3MEGA 3CIMA 3LTOA 4ENOA 4ECTA 1UPPA 1HL6A 1HYSA 3I32A 5E2QA 1O6XA 2BV3A 4EK2A 2DR9A 2WONB 2NYIA 1SC6A 1RISA 4K7QA 2V8PA 1Q7YT 3AB2B 4MYUA 2PC6A 3C15B 3UW1A 3DGPA 2BJDA 2B4UA 3GJQB 1HR0F 1KQGB 1B70B 3VVTA 1SKWA 1HQUA 1NZ8A 3DM2A 1BMQB 3WIUA 3D54A 3IBFB 4RW8B 1B7FA 4A8XA 2MSTA 1W7WA 5KFHA 4CO1A 2CPIA 1VQPS 3DHWC 3M1VB 1N34F 1AZSA 3S8SA 2EFOA 3MMJA 3NMAA 4U95A 5HSPA 2EVZA 1UJ6A 4Y00A 3M8QB 4JI7J 1RTIB 4IG3B 3H59A 4DL0C 3KOAA 3J81U 4ES3A 4MMOA 4ES2A 3CCTA 3BBFA 3BV8A 2BXJA 5I42B 3WBZA 2YWKA 1D9AA 3PO4A 1X4BA 3OHBA 4C98A 4ITSA 1V5VA 2BX6A 2MJUA 2BRKA 3GPAA 3MECA 4G65A 2E7XA 1FKAF 4ED0A 3GONA 2HPUA 2AIRB 3GIRA 5J2QA 2HQFA 1RQ0A 4ZPBA 3UDLA 4IQXA 3JQJA 4NLUA 2W2OP 2E5GA 2B4PA 3DNCA 3EZ5A 1S1VB 3G82A 2EFGA 3MM9A 2V67A 3JTOA 1HI0P 2FJXA 5LM7E 4OHZA 2KH9A 3KTQA 1LWFA 4C48A 2D3OR 2YH0A 1R31A 3D66A 1IKYA 3POTB 1R89A 2WVEA 3ZZPA 4Y6IA 3BO2A 1K1SA 2IIHA 2GNKA 4IDKA 3M9NB 4RNMA 1Q95G 1CULA 2VQEJ 3KK2A 1S79A 2JLFA 1HBMB 1NHKL 3QT8A 2B7CB 4LQ9A 2J9EA 1P1LA 1WACA 4DXLA 2DHHA 2IRUA 4LSLB 1WSRA 1G1XA 2C28A 3UO0A 5KAKA 2I2YA 5L46A 3VZHA 2UU9J 2HG4A 3MCOA 1FXDA 4PQUB 4OMFG 1SH3A 4EWTA 4JI0F 4USKA 4ECXA 1U0HB 1OY6A 3W8PA 5IZHA 3ZZTA 3HT0A 4M63A 3KDNA 2AU0A 4BHQA 1BC6A 4ZN1A 1JWWA 1SV5B 1FTRA 1UKUA 4YB5A 1VLOA 5JVHQ 2Q43A 1P9YA 2RE1A 3DLJA 3R1LA 2BJ3A 1C0TA 3DI6A 4C8NA 4U6PA 2GCFA 1T9XA 3PG9A 5GAGU 2IM3A 2Y0BB 4QIEA 3TUJC 4BBYA 3M4XA 2F8MA 5AJ3J 2JJ4D 3G71S 3CVKA 3BSCA 2RQ4A 4MK7A 1IQTA 2HVEA 4HVZA 4NZ0A 1U1RA 3G86A 1TELA 1RTJA 2MKYA 1JLCB 2HSEB 3DLKB 3BYPA 3FEZA 1RWKB 4ETZA 2DR7A 4MFBA 1RCOB 2ZVSA 2CJBA 4MIWA 3UPFA 3CD0A 4ZOSA 1H74A 3AOBA 2LFVA 2IA0A 3EGWB 4DUYF 3IGVA 3QZ7A 1T11A 2B43A 1K47A 5D6GA 3DGVA 5U47A 4OX6A 5HI7A 3QO9A 2MHNA 3GIJA 4ICLA 2ZOMA 1S6PA 1XR6A 4NLSA 3ETMA 4DR2F 5L1JA 2OEMA 3MGJA 1S1UA 5LSLA 4ED8A 2OJ3A 1TUGB 4O0IA 4WKRA 5CCMA 1PSDA 3NGDA 2QLBB 3CDBA 1KLNA 1HWLA 2ZNZA 2MZJA 1QAXA 2XMKA 4I0WA 5KG7A 5CYQA 2I5JA 4F2SA 1ULRA 1KD1T 2UUTA 3BN7A 4HT5A 3QT7A 2BKOA 4DFJA 1DLOB 4LF5J 1RU1A 3NS5A 4YEAA 3OTEA 4RUCA 4ZK7M 2EWHA 4OI3A 1BQMA 1PJ6A 2FLPA 4J7CA 3ZC4A 1RGVA 3G6YA 1QSYA 3AOCA 4WXWA 2UVUA 2BBEA 4CTAB 2IA6A 1PAEX 4TN2A 1ZM3A 4TQSA 1VC5A 2C3MA 2HK2A 1WOSA 4C97A 2B4OA 3MF5A 2AHOB 4YS2A 4WFAQ 2KM8B 3ZZ0A 1FDNA 2GS8A 2PI5A 2CKWA 2VBXA 5KOXA 2B9YA 5IFMA 2YNGA 1WTFA 2NCKL 3QIDA 3B6BA 1UVKA 4F50A 5T7LB 2DIUA 4A8YA 2CQPA 1D3WA 3AA8A 3EZUA 2UUBF 1FF2A 1AA1B 2JEJA 3W3SA 2W9CA 4DHVA 1ZBTA 4J9RA 2LKZA 4P10A 1JNRB 1XQIA 4DV1J 3ZTQA 1TAQA 1VFJA 2Z56B 5CA5A 3NLCA 3VGSA 1MU2A 2HBYB 4TU9A 1FE0A 4Q8FA 1LEOA 1PIEA 1H38A 2MKHA 5IM0B 1AUDA 2J76E 1N48A 3QJLA 4OX8A 4JP8A 3MPDA 4KHRA 2NXEA 3DRPB 2YWWA 4CYUA 2NUUG 5D77A 4P6QA 2YBVA 3PEHA 4OIXA 3PO5A 1HHSA 1HBNB 3EGVA 2ZFHA 4LFBJ 1KP6A 1KQSR 4EU0A 2WSCC 3QT6A 1P8GA 2YY3A 2BW2A 1U6FA 3PHTA 4OYMA 1YBAA 1AYEA 3WQPA 1E6VB 2BYCA 2R42A 4W92B 4YDDB 4JOUA 4OV1A 4RUAA 8RUCA 2IRXA 3H5UA 1RT6B 1YVFA 2QL5B 5DRKA 5F9NA 4ZPCA 1NJIT 4FYDA 3OPKA 3CB4A 2M8HA 4WTOB 4NLPA 5D4NA 4B9UA 4YHHF 2VA3A 3OFGA 2D9PA 4DV3J 2B5JB 2AQ4A 2F9DA 1FJ7A 4PG8A 3TQ1A 2AJ1A 5DZ6A 4USJC 1Q86T 5H9EJ 5HROB 3VQTA 4NA3A 2ZWPA 3HO1A 3BGRB 3BKTA 2IYIA 1ROFA 4FNHA 4B9NA 4N56A 1RHRB 2CNNB 1VRQC 5B0DA 2DXFA 2C3YA 1SH2A 1VR6A 3KXDA 1QE1B 3KK1B 4FXDA 2B6AA 3TI0A 2VG7B 1LFPA 5ETMA 4FF2A 5HLFB 1DTTA 3CD6S 3KHGA 1Q0NA 2GV1A 4OI6A 1S12A 1LW0B 1JIHA 2ILZA 4H54A 4ECWA 4OJ1A 1KBRA 1NM2A 3QFWA 2CJYB 1XMOF 4K4SA 2MQNA 2FJEB 5KT6A 4IOAQ 2R7WA 3UN5A 1D09B 3Q8SB 2MZ1A 2ABYA 1NDKA 4S0MA 1ACMB 2MGZB 2IAJA 3ILJA 1UETA 3JAMY 3AOAA 3DCAA 3R5JB 4DV2F 3HSZA 3CJKA 1EAYC 3AHPA 1TK5A 2AJ4A 3LOUA 4X66F 2UXBF 4ZCKA 2OPSA 4KH0B 4DR1J 2ASDA 2VC1A 2VPYB 4P7TA 2WVBA 3W9JA 1D8YA 2VL1A 1JNZB 4DMZA 1WG1A 4FDFA 2R2RA 3ILOA 5KT3A 5DLGA 4MKVA 2XHCA 5A2QU 3QNWB 1XN9A 5BJRA 2HHUA 3M2VB 1S9FA 2CPDA 2H54B 3PDNA 2OAUA 3IR5B 4CLSA 1X9SA 2UXDF 2XYPB 4OHXA 4CLTA 3Q86A 1NK9A 1JB0C 4F0HA 4DSEA 1R0CB 4A8FA 2ZDOA 2R8JA 2PMWA 4OJ3A 2JEFA 1SJFA 5D78A 5B0BA 4UT4A 1KHVA 2HMIA 5KFNA 1QUVA 4KGVB 1SQGA 1UFKA 3PIOQ 3DKDA 4IH5A 4CRJA 5F0UA 2JC0A 1WHVA 1VQ8S 2E1CA 2LXUA 5C42A 1VQLS 1JJ2R 4ZHRA 5LXRA 1K9MT 4I56A 2FPHX 2IMOA 1MG7A 1MMNA 3GTYX 3FK4A 4QR0A 2OEJA 1RT3B 3CF5Q 4ED6A 4DPTA 3NGKA 1LK7A 2DEJA 4PWDA 3TAMB 3OL7A 2M5YA 2F8EX 4HT7A 2J7WA 1FFGB 2ACMA 3GILA 4I2PA 3NNAA 4Q0BA 1AB8A 3KLEA 4GVBA 1DQ8A 2COLA 2Z2LA 2CFXA 4X4OA 4C2MA 2K7JA 1RT7A 4CM0A 2KRBA 4N7TA 1OSDA 1LQ9A 4FYXB 1FD8A 2W2PP 3ZNUA 4KR0B 1BWVA 4H4OA 2HHXA 5B0FA 4O3NA 4M5MA 3W2VB 4CDIA 4KFBA 3QIPB 2HVDA 3O2IA 3SQGA 1AFIA 2ZHOA 1OYEA 2PFFB 2GIQA 4DX6A 2ZH7A 1GMVA 3DRSA 2JZ5A 2AJ0A 2QMUB 1VOMA 5M2PA 3KLIB 5THWA 5K14B 3J7AN 4NX9A 2J9DA 1QLNA 4GMKA 5D0HA 3CPWR 3IG1B 5C5JA 3W9HA 3I0SA 3K8VA 1I5OB 4L75A 5CYJA 3NXZA 2MLZA 4USIA 4DQSA 1S48A 1QAIA 4LFCJ 2CNOB 4X4TA 2C2MB 3DMJA 1PYTA 2BJ7A 4GC7A 3M2RB 2IJFA 2DNRA 3BZQA 1T7PA 1HMVA 2B7BB 2DR6A 1SVDA 3IWXA 3NS6A 4WU3A 2XZWA 3NS7B 4NYZA 3B82A 1FKPA 2FVRA 3RAXA 3BPDA 1IJFB 4DR3J 3BSAA 4OI1A 1KVKA 2OMLA 1VBYA 1S97A 4XPCA 1Y4ZB 3KG4A 2LEAA 2QA4S 3JTNA 3GIMA 4AL6A 3UD5A 1NSPA 3TARA 3C8YA 1BXNA 3RW7A 3RRHA 5LOQA 3PYFA 3KLFB 3AD7C 3R6LB 1S1WA 4RW6B 1ELOA 4B3MF 2MSSA 4UZBA 2GVZA 2KT5A 2QLWA 4Y2KA 2EK6A 3V4IB 5T14A 2B8PA 3R27A 1N0UA 2XMMA 2ZZNA 1DRZA 3FQKA 1FA0A 4BC9A 4DPUA 2EC0A 2GMHA 2IDEA 4I6WA 4ES1A 2CQ0A 1VC6A 2BA9A 2VBWA 3E01B 2ZHAA 5F41A 4J91A 3IWLA 1T05B 1C0UB 4DQIA 2VQEF 2VOPA 4B9LA 2LECA 2DNYA 3QRRA 1JLBB 2XI2A 4QPXA 4X4PA 4ZIWA 1NU4A 3M8PB 2G1HA 3GV7B 2PA3A 4L3NA 2MLYA 3QFHA 1WOPA 1V3ZA 3BBCA 3LH2S 3ADAC 3PKYA 4DEZA 1RKIA 5DDQC 1N5YA 3FBEA 4P2MA 3I4HX 2GQQA 2AF6A 1JQGA 3CMAS 5BYSA 1EZZB 2DR5A 1NPRA 1N54B 4JI8J 4KPCA 5GAEI 1ZTTA 1IBKJ 4ZKAA 1TK8A 1DHMA 4PUOB 3CXCR 3CJ0A 3OL6A 4KRWA 2UUWA 2NZ4A 3O44A 5H1SV 5HJYA 4CLWA 1RAFB 4O4GB 5EX0A 5C7PA 1B0VA 2MTLA 2V4RA 1KDNA 2I0XA 2VV5A 2QIFA 5FIIA 1Y11A 4E98A 5D4LA 2IPOB 2VF3A 3AXKA 3SXLA 1EB0A 4R8UB 3H4BA 2Q66A 2RJZA 1ZPWX 4M5KA 4H4MB 4PKDB 5AXNA 3KK3A 1JLEB 4ZVHA 4YN3B 2CPJA 4KV8B 3TZWA 3RB3A 1HNIB 4C11A 2C2EA 3JYTA 5ETVA 4LF9J 4KKOA 2IDLA 3QRPA 2ATCB 4LMZA 2AWZA 4L3KA 1Q7LB 4TKTA 2KDOA 3M6UA 5HVHA 1GXTA 3CC4S 3GCXP 2WW4A 1CJVB 4LF7J 2B9WA 4OI0A 5IWAJ 4F4XA 3W65A 2OPRA 2RQKA 2YNFA 4ZITA 3VAMA 1RT4B 2W1BA 2DHXA 3HX9A 5IQ6A 2KFZA 1JLGB 1S59A 1CC7A 3A4TA 3LQVA 2CYYA 2GHWA 3D28A 3MAHA 3H8YA 3U7JA 1P27B 2AD9A 1FESA 1G4CA 5CZVA 4LRBA 2UXCF 3THVA 2V69A 3DOMB 2UUAJ 3W2WB 4KSEB 4CWBA 1ZTWA 4OZ0A 1DZ5A 1YKWA 2BVZA 2XWXA 3R5GA 3PJWA 2H1YA 5J2MA 3MM8B 3V2UC 4TU8A 3PXGa 2W2MP 1X4AA 3NCPA 2M70A 1HW9A 1UVMA 3M8YA 2PN6A 4E0DA 4DBQA 4OFZA 2C2ZB 2MQQA 4LQ3A 2ZH6A 3GFXA 3IAM9 4DG1B 5J2PB 3KMSA 4IH7A 1SC4B 3JSYA 4LIWA 1VLYA 4JI4J 1U09A 3EWGA 3N6LA 3V6JA 3EXYA 2CNKB 5KFIA 1U8SA 2RILA 4RO0A 2HW3A 4HDGA 1GXUA 3TA2A 1MROA 4F4WA 1QDUB 4K2XA 1RT5B 5KTQA 4MH8A 3OR2A 1NMEB 3WX4A 2K06A 1WUUA 1PJ5A 2P6TA 4CO5A 1SIZA 3ET6B 8AT1B 1F3FA 2Z8QA 1TL7B 3MEEB 2C3PA 2WZ1A 6FDRA 2FZGB 2C2OB 4LF6J 2B9XA 1IBLJ 1VGYA 3RYLA 1RHKB 5HMWA 2F5GA 3D1QA 3T5LA 2KYXA 4X4UA 3DFEA 3OW2R 4DV1F 4ZIVA 5E41A 2DRBA 3N4WA 3OTOJ 4KB7A 1NEEA 4U7CA 2EXUA 3QQCD 1RA7A 1U2FA 1HNXJ 2FLNA 1WHXA 2I38A 3LAKA 3P3DA 3G4SS 2W9BA 4RWXA 1HYSB 4C0BA 3D9BA 1RAHB 3OTCA 5KFKA 4BC7A 3WC0A 5M2RA 2HNZA 4DR4J 3D0IE 2XS2A 1LWEA 1SH0A 1CC8A 1C2PA 5DS7A 4DCPB 3D1OA 2YKNA 1S9GA 2BKNA 3W5XA 3DRYA 4RPFA 3DGPB 2HQ3A 4OX9J 3UCGA 2H5EA 3OSNA 4JV5J 3DM2B 4A46A 1QJHA 1H2UX 4NLOA 5KG5A 2GO8A 3BREA 1S0OA 2IFXA 1NHVA 2E29A 3GQCA 1U24A 4CLYA 1HNVA 1TL1B 4OZLA 2JEGA 1S1TA 3BKUA 4CLLA 5DETA 4ANEA 4LVNP 3MUMP 1PC5A 4DX8H 3D3BJ 3CSKA 4EZ9A 1J5EJ 3X1LB 3K0JA 2WCXA 4WIQA 1RJJA 1UWAA 4L76A 4K2JA 4QBUA 4Q2LA 2PT0A 1Q8IA 2ERRA 5GADI 2ATLA 4KBIA 5AT1B 2AX0A 5CD4H 4K8RA 3GP9A 1NK8A 1S6QA 1SJ1A 3UCUP 2ZD1A 4NASA 4HL9A 1H6KX 4TXSA 4A8WA 3KJNB 2JOQA 4WF9Q 2WOMA 3HHLB 5AXLA 1R6VA 3VR1A 2CIMA 5HQ8A 3MECB 4Y34A 2AJ2A 2GX8A 3D2WA 3HJVA 4FZVA 4IYQA 5AE1A 1MW7A 5KFEA 1XNRJ 4M1KA 5JXSA 4J9NA 2I6WA 3I9ZA 2IYGA 4ZN3A 3U1NA 3MM9B 1HBUA 1KRPA 4QIFA 3R5AA 4CCHA 4QCLA 3UR3C 4EI2A 1EQMA 1Q78A 1S77D 1LWFB 1EP4A 3AA9A 3I55S 1TV6B 3UN2A 1IKYB 1PYSB 3CMES 3ISZA 4WYLA 2I9SA 3F41A 4KHPF 4IDKB 2DO0A 2F63A 1XMQJ 2LQ5A 4Q45A 3GCWP 4DQPA 2YKAA 2WVCA 3GSIA 4B08A 4DR1F 3EUNA 1KVJA 3LAMA 2B4VA 1SJ4P 3ZNJ1 3DOLA 4UUWA 4XTTA 4DV6F 4OJHA 5B7WA 1K44A 1OY9A 4P75A 3R5CA 1FK9A 1S6UA 2XGPA 2IY5B 5ETSA 1X4EA 2O01C 4K50A 4O3QA 4ECQA 4N77A 2K8GA 2ZH4A 3GV8B 1FERA 3NGSA 5HN0A 1SQEA 2FHKA 1AFJA 5C25A 3N0VA 5LT5A 4HHUA 3TJAA 1QVFR 3I5CA 1IQZA 2XNQA 2V2ZA 2V50A 4F0MA 4V19X 2KYZA 1QSLA 2MZRA 4U8VA 1C0TB 2F4VF 4IFVA 1HNWJ 2YNIA 5EGYA 3CWJA 3G2XA 3UVJB 4F3MA 3TUIC 4X4SA 5KFFA 3Q8PB 3D3CJ 2F65A 2VUGA 2VODA 2W8LA 2QFJA 1RTJB 1UVNA 1V5IB 2E9RX 3LP2A 4LBPA 1U1PA 2CQ1A 4MFBB 3BQ0A 1G2EA 2CQBA 1RT1A 4H4KC 3UE2A 2DISA 2KHCA 5ETKA 4K0KJ 4QWEA 1WDDA 2JRSA 3QO9B 3PYDA 1RWOB 2K2PA 5CH7B 3PFEA 2HHSA 3EDQB 3B4MA 4ICLB 1S6PB 3KHRA 3PR5B 4QWCA 1FNMA 2LXFA 3C66A 3IXQA 3L95X 4EFAC 2XMJA 1LW2B 2FJVA 1S1UB 4W98A 5LL6d 4F26A 1OWXA 3RBZA 3WIVA 1R8AA 4J9OA 1N5QA 1SCJB 4NXNF 2VFUA 1APSA 4V1Ak 3S7RA 1Y10A 3KJVB 1IM6A 2CQGA 2P8IA 3BS9A 4D3HA 3MUTP 3ITHA 2DCUB 2CPZA 2HNDA 3OXFA 1UJ5A 2I5JB 1I51B 3C16A 3D1HA 4JI1F 2YWGA 4ED5A 4O3SA 2WB4A 4UF4A 4F04B 1CJKA 3CJ8A 1DQAA 5HATA 4LFCF 2CZVC 3OXGA 5F8GA 1FRLA 4YMEA 2JLEA 1BQMB 5CHCB 4B3RJ 2ZJQQ 3D68A 3A3OB 4DLGA 4A8QA 1Q8LA 7FD1A 4N8NA 3SCLE 3T9NA 2RRAA 4R5PA 2X1GA 2AYEA 2XZDB 4DV5J 3MD3A 1WC6A 5ETOA 3CEDA 4PCQA 4YQWA 6FD1A 5D0EA 3EX7B 3ENWA 3CTRA 1FJGJ 2F3JA 1QUPA 1JXEA 5E5NA 4C8YA 2YTCA 3T1YJ 3JSMB 1VJWA 2OPPB 4AFFA 1WG4A 3OUYA 2D3UA 1Y3KA 3C19A 2W9CB 1B4SA 3S01A 5SZTA 2XO7A 4FVMA 3T9ZA 1B0TA 5T41A 2DNOA 5LMNF 2QEXS 4WE1B 5A8WA 3N6NA 2VBZA 2BE7D 5HMXA 2O66A 1F5BA 2C3UA 3BPSP 2CJ9A 1MU2B 1REVB 4USTA 3VWSA 2EKYA 4PPDA 5KG1A 4WCEQ 2ZHBA 1SC3B 3TNVA 1CJTA 1YG0A 5LJ3Y 2GGPA 4OZ2A 2Y8WA 2R7TA 1TVRA 2YH1A 2VPZB 1BWEA 2O3DA 4C0HA 2J8AA 1UMJA 2DIVA 5M2UA 5CCLA 3T3FA 3BGOP 2R3VA 1B7YB 1UVJA 1OMSA 2BANA 2ROGA 2LQJA 2WVFA 3TZXA 2WTFA 3AD8C 2HQCA 2HQDA 1IR2A 4LT6A 4OHWA 2YNHB 1TL4A 3OFFA 4H4KA 2MLXA 2CPEA 4NCBA 5D3GA 4DR6F 4WFBQ 2RT3A 3HD2A 4IOBA 1RWVB 3G6ES 2VQFJ 1CQNA 1N33F 3TAPA 1SJQA 1U2RA 2N4DA 3PX6A 3OLBA 3G96A 2NXJA 4QZVB 4LRFA 2JX2A 3DRRA 3ICLA 4DF8A 3A1YG 1UEVA 4PXBA 3IRXA 4M5DA 1S6OA 2AX1A 2QC3A 1GFWB 2R7QA 2F4FA 4ED2A 1FX4A 2LVWA 2PGCA 3GB0A 4UQGA 2GQ2A 1IBKF 3BJYA 1RAGB 3N6MA 4XO0A 3R8YA 2WVDA 2J0QD 2B9EA 1XERA 3EPGA 2ZE2A 3NEKA 4R0EA 5K5MA 2FVPA 4MTPA 2E9TA 3Q24A 1FNOA 4CP5A 1X4CA 1DURA 3NBPA 2UV8G 4YR3A 1WC0A 1JKHA 2RRBA 3IAS9 1FI4A 2V2QA 1C1BA 4PWWA 4DPYA 1RWXB 2ZJRQ 1VIOA 2YQ0A 4P71A 4ZJLA 5ETTA 4ZJQA 1NK4A 3OTBA 3OV7A 1S10A 2FY1A 3L09A 4C3KA 1BHNA 1JLQA 4XPEA 3CJQA 2HGNA 1O51A 1M5KC 5DGAA 1NJZA 1IR0A 2XNRA 4MIBA 2MB0B 4RL1A 3AQOA 2AP6A 5DJBA 3FBBA 4FYVB 2ZBPA 2J7KA 1UA1A 1JLAB 4KYZA 1R3NA 3DU6A 4GKJF 3RB4A 1Q82T 1S72S 3ELHA 4DV4J 3CJKB 4LR9A 3FJ2A 3UDEA 3QJJA 2HHWA 5KG2A 3MCMA 1S0VA 1J5OA 4G1PA 3VHQA 1X8DA 2V4JB 2YKPA 2GJFA 1HNZJ 4HACA 1RHUB 2HWIA 1VBZA 5FLXY 2UUAF 4JB8B 3KNAA 3HKWA 4OYOA 4ZPAA 2UVWA 4DF4A 1WC1A 4LVOP 4UOHA 2OUGA 4O4RA 2DGOA 2D69A 3M1VA 3L7OA 4GVLA 2KFNA 1X4FA 4MKYA 1FRHA 2V2KA 4F3QA 4KO0B 2NREA 2CRLA 3S6EA 4RNFA 2DPJA 3AQPA 4X84A 4JYAJ 3KWMA 5EWEA 5C42B 1N32J 4DI6A 4NXMF 1N56A 3FDSA 2E7VA 4ZHRB 2HGMA 3MI7X 2XZTB 4OI4A 3FSYA 1XR7A 4FNIA 1VQNS 1FDDA 3H42A 2AYBA 4DWIA 2XI3A 3K5MA 2HFUA 4HYKA 1U1MA 5LXYA 4ED1A 2HVZA 2WAQD 2CZ9A 3SQOP 1OYDA 1Q4RA 1S76D 2QTWA 4LF6F 4TLRA 4PR6A 1NDCA 4GKKJ 5B0CA 2HS4A 3J80Y 1PKUA 3GIIA 1WKJA 3Q2TC 2AW0A 4DUZJ 4LR8A 4BWJA 3KLEB 4GVBB 5B09A 5HMYA 1A9NB 4DS4A 4X65J 2G2YA 4ZCIA 1TMMA 1RT7B 1CPZA 5EWFA 3HKZD 2QYGA 1KEKA 1PYOB 3K89A 3CCUS 4C9DA 3POTA 3T1HJ 4H4OB 1F60B 4DS5A 4JI6J 4J9KA 4KFBB 3SQGB 5I3UB 4FVCA 2ZUGA 3ZTPA 2Y1IA 2ZKUA 1NZAA 3KLVA 3DRSB 4QPTA 5HQLA 3IS9A 1CEZA 4X4VA 4F0KA 5H9FK 4IRDA 1HBMA 4M5HA 1PCAA 2KM8C 4LSLA 4I2QB 3CCMS 4DU7A 1RU2A 1VK3A 3MPWA 4NA1A 4Y28C 3NKYA 3GG1A 1WDTA 2LQBA 2AJQA 3CCLS 2IC3B 4RW7A 1R8PA 1Z4UA 1O8BA 4PQUA 3Q22A 3IR6B 3Q8VA 2XBPA 1DQ9A 3L7PA 4ZLJA 1U0HA 4OX9F 2I8EA 1U8WA 2HRUA 1S49A 2HBZB 2E5JA 4PRFA 3R6GB 4JV5F 4C3LA 1D9DA 4K4TA 4KJIA 4DFPA 2JWNA 3H98A 4A8SA 1RUSA 3CO9A 4DZDA 5AE2A 4Z7YA 3KDOA 3NP5A 3R97A 2DY9A 2ASYA 5E3RA 4B9TA 1X9MA 3AJDA 4NRUA 4I7FB 2ZDPA 2JC1A 4NEZA 4ZLLA 2R2UA 1FKPB 1UEKA 2AEFA 1R8HA 3CC7S 1N0VC 3GLJA 1ZM2A 4B3TJ 1XC9A 4X64F 5A76A 3ENVA 5E3PA 4ER8A 4CQ1A 2LMIA 2FLOA 4OZ5A 2R7RA 3EMTA 3E51A 3FBCA 5LMUJ 2CG4A 2OIHA 4ZCLA 2A0FB 4ZP8A 2DHGA 1K1QA 3FFIA 1LOUA 3I31A 3HP6A 3WX8A 3VGVA 1Y5LB 3TR5A 4HR2A 4ZMMA 1IKWB 2L08A 3QGHA 2G0CA 3TA1A 4CO0A 5E0OA 2YKOA 3R3TA 4TY8B 1PJ7A 3MTJA 5KFXA 2FGOA 2XMAA 4F4AA 4O3PA 4DPOA 2V8VA 3NG8A 4RX6A 4CO4A 1S1WB 2RVJA 2MY8A 1Q81T 1JLFB 1KVIA 4EBCA 2GVZB 3LPYA 4J9PA 2MKCA 1X4HA 4QU6A 1UCNA 1FHTA 3RBXA 3J7ZT 7AT1B 4IRKA 2ZBCA 4RLEA 3V5RA 1C4AA 3E2EA 2OD4A 1OQ3A 3FQLA 2KG1A 2FQQB 2ZBRA 3P6YC 3I9V9 3FEXB 1WEZA 1XTZA 4K5SA 5DLFA 4DU8A 2OEKA 5F3ZA 2FJDB 1SI9A 2R7UA 3DC2A 1S57A 3FGVA 2VOOA 1RCXB 1E6YA 3CE8A 4C6AA 2UUCJ 2W24A 2GO9A 1W25A 1N5YB 3DU5A 4P52A 4NI2A 1RAAB 3TW0A 4LSZB 2H5JB 4DSIA 3D6HB 1RBLA 3EDRB 4ID5B 3BR8A 3PVXA 3AB4B 3BF4A 1NK5A 2H5IB 3GFZA 2VFVA 4EEYA 1KQKA 1U2CA 3BO4A 1HNWF 3T5HA 3DRXA 1RSCA 2M9KA 3QMQA 1YZ6A 3R1HA 1K8AT 2HQGA 3GWCA 3O1LA 2FHOB 4USUA 2W4CA 4KTQA 3V81A 5T7LA 4ZVTB 4PG4A 1R6YA 1QAJA 1NK6A 1NBEB 2NSBA 5AE3A 1EKSA 1C1CA 1YIJS 4CLKA 4CH0S 3MMAB 2OHDA 5ITHA 5KFTA 1YRXA 4K0KF 4C11B 2Z2ZA 2DGUA 3JYTB 3UQSA 4KKOB 4XAKA 5AXKA 3DLGA 4IO9Q 2QRRA 4TY9A 2ASLA 4DDFA 3FMBA 3SIPB 4Q8EA 3T5KA 3T6JA 2P2CB 1S99A 2HBRB 1MWQA 1HIYA 2B51A 5D4PA 2YNFB 4OQJA 2LXIA 3ZO7A 1YJVA 4MKAA 2R7OA 2D1CA 5DG9A 3UD3P 1MWZA 4F4YA 4F8RA 2W4PA 1HBNA 4DSJA 2XTJP 3EE3A 3MM7A 3SCIE 4ECSA 4N76A 3G6XA 1HR0J 2ADBA 4HKQA 2IVFB 3SFGA 1YJ9S 2R7SA 1ZETA 1K0VA 5KFGA 1RT6A 4ERDA 4BWMA 2R8IA 5BYRA 5E3QA 4ZPWR 2NZCA 2KKHA 1IXKA 5FDLA 1S4FA 5HMZA 1T03B 2DH8A 1NB7A 3QZ8A 5J2MB 5IT9Y 2DD8S 2LDIA 2DCLA 1QAYA 2X3DA 5KFAA 1WC5A 2E66A 3PZPA 1N34J 2M88A 3GIKA 1PILA 4U8YA 3E8OA 2WB1D 1S7HA 2HHPA 2XSFA 3EVMA 4PXCA 2XLJA 4ZVPB 2CJQA 5KFPA 5HROA 2OKQA 2A3JA 1NHUA 1SUQA 5KFBA 3MOJB 4RU2A 2QL9B 2U1AA 5GMEA 4PXDA 3A8IA 2ZWOA 1WF2A 3OR2B 2CDQA 1KR4A 1QE1A 2OI2A 3KK1A 5D4OA 2BW7A 2G0IA 2VA2A 2U2FA 1AW0A 5HP1B 1PGZA 3LALA 1P1TA 2GMJA 1T9YA 5G0RB 3QLHB 1LW0A 1X31C 4ZVSB 2NLWA 3K57A 3NNCA 3A8KA 1RADB 2R7XA 1M5PC 4BDPA 3AY0A 1KQFB 1ZOTA 3CDWA 1HLWA 1VI7A 4LF8J 1KFDA 3PX4A 3C14B 2PEHA 1T02A 1VRUB 3K7RA 2ZKTA 2HAIA 2DB1A 2MGZA 2CAJA 1HA1A 3KLGB 2KXFA 4NA2A 3J7YU 2CQ3A 2KVQE 3OJUA 3CC2S 5EHHA 3TZZA 1IR1A 2HNYB 1VBXA 2EFQA 4EBEA 2HNZB 2BE2B 4NLXA 5GMDA 3DXSX 1L3SA 5EUHA 3PW7A 4HLBA 1KOHA 1S9GB 2VQFF 1HWIA 1GH8A 4JI0J 3T6BA 3T1AA 3M2VA 3GJSB 1KN6A 1CLFA 3KLHA 5EDWA 1S1XB 4WZQA 4OYBA 3P8BB 3H5XA 1Q1KA 3I56S 1TU0B 3AODA 4ZPVR 4P74A 3MPUB 2OSQA 3L7UA 1QVGR 1S0MA 1WELA 5L1KA 4NE9C 1HNVB 4K4YA 2IRYA 1S1TB 2VJUA 4UOCA 1H0HB 1PC4A 2J7UA 1VQOS 5E7OB 4JI3F 5IOLA 2RU9A 3SSRA 2Y0SD 4AL5A 2UVVA 2O67A 4QIWD 4A47A 3Q8QB 5F8JA 5J1NA 2VKZG 5A8RB 3L4BC 2ASJA 1A7GE 2A2CA 3CD5A 3LGNA 3CCRS 2RDJA 3G8QA 4KQZA 5D0GA 5DQIA 2HFSA 3N5FA 1IN0A 1R0AA 1R8CA 2XQCA 1NJWA 4EMDA 1S6QB 3TP2A 2ZD1B 5GAGI 2N7YA 1PO6A 3CCES 3TAMA 1HBOB 4NRTA 2WOMB 3LP0B 3M6WA 2BOPA 3HZEA 4IRCA 2FD2A 2VG6A 3MXHP 4NLWA 2B56A 3J7YI 3FRZA 4DCOB 4WFNQ 1NKCA 2VU5A 2DEIA 2Z2MA 1F1BB 1U6ZA 1T3OA 3DDNA 4P72A 4DJBA 4RNNA 1U26A 4NLQA 4DR2J 2GVDA 1LV5A 1I6JA 4GO7X 2DGWA 1EP4B 2XSJA 3V4MA 3TX0A 2DITA 4DV4F 3UR0A 3KLIA 2CXEA 5K14A 2DGXA 4ECUA 2PA8D 3MR3A 2IMWP 1SL2A 4DL4A 1X5PA 3IG1A 4CH1A 3CCSS 4FKYA 2DHAA 2VDHA 3EPIA 2OTLS 4X62F 1FK9B 2FHJA 3BH6B 1FNXH 2APOA 4K4WA 4DR5F 5KFVA 3M2UA 1Y5IB 2OLWA 3PJXA 5BR8J 4HI1A 3M2RA 3A8JA 5A6PA 3NAHA 3MCNA 2ALZA 2X3GA 1OPZA 4N47A 1WHYA 3QSYB 3J7A1 3HHNB 4R25A 3TYTA 4U9RA 4DFMA 4I6AA 2MYFA 1TKDA 3R7NB 2NSCA 2BQUA 3BSOA 3GV5B 4OYXA 3M30A 2X1FA 5L8RC 3MPVA 2QJ3A 4IFVB 1QTMA 3HCXA 3MM5A 1SB6A 1VDHA 1N32F 1UPMB 2L41A 2V34A 1M90T 4NYPA 3RAQA 3H20A 3FZBA 1J27A 3ZZUA 4CLFA 2E5IA 2KT2A 2UUBJ 1UWBB 4RU9A 2BUNA 1NH7A 3M32A 3BEGB 1YHQS 3NCRA 3ISNC 1LWCB 1MSWD 1KONA 4PAAA 2NS1B 2RKIB 1RTHA 3KLFA 4RW6A 4XIUA 4GKKF 1RT1B 3WDOA 2DGSA 1T9TA 4F3OA 4NL5A 5LJ5Y 4NCGA 3SBMA 5RUBA 1O5JA 2JFKA 1QSSA 1TKZB 3PCOB 4LIRA 2IVYA 3V4IA 2YX4A 4X65F 3GFHA 1HWUA 1F9HA 1GMUA 3MWBA 1YJTA 2V68A 2EFPA 2VHGA 2UP1A 3H5YA 3RBDA 3BBBA 3ENAA 1SL1A 2ROEA 1YX2A 3E01A 3KYLA 3OFEA 3MAAA 1KOOA 2HS0A 4IH6A 1T05A 3K5PA 2XYGB 3RW6A 2CA9A 3FEYB 1BD6A 4QIVA 2DT9A 3OR1B 2XS7A 1JLBA 1DTQB 2V8GA 2K1RB 2HWHA 1SKUB 1KC8T 3M8PA 4EBDA 2BJ9A 3HVRA 5IS2A 1B99A 1HQEA 3W60A 1KSPA 4LJMA 3QWPA 3ZTRA 3C16B 1ZA2B 2M7SA 3PX0A 4Y2CA 3MZIA 1EQ0A 5KT7A 3KJQB 3MFIA 1X5SA 3IWNC 3KJFB 1UTAA 4RW9A 2ZVIA 2V5HG 1QM9A 2DO4A 3GZ7A 5KFCA 1HI1A 4DSFA 4R5PB 4I6YA 3OHAA 1FKOB 3QJPA 3H2VE 1JJ4A 2JHEA 3MD1A 2BZ2A 1GNKA 3M6XA 1OQ6A 5HVGA 4WU2A 1UAWA 3GYGA 4B3TF 3Q8RB 4UY8T 3QWUA 1YJNS 3GFYA 3Q0AA 4M5JA 3PW0A 2V9WA 1NB2A 4R8UA 3OUYB 4KC5A 2DNLA 2HRYA 1NKBA 1FTCA 4ZLNA 1VQMS 4QOTA 3CJTA 3WC2A 1ITPA 3PW2A 3UFCX 4H4MA 4OYIA 1JLEA 2FHJD 1EETB 4UTGA 1M5VC 4YR0A 1HNIA 2VKRA 3F0NA 4NEYA 1N36J 2XC9A 1XMOJ 5CYMA 2XB2D 5F8MA 3A12A 2BEFA 1U48A 4URQU 4C3MA 2GQCA 4K5RA 2KO1A 4B9VA 2Y1LB 3P4UB 1CJVA 3M9MB 1VYAA 1SQFA 4F7VA 4NLDA 1L3UA 3TO8A 2QG9B 2UVRA 1TVRB 1RA6A 3DLEB 1RT4A 4B9SA 1UL3A 4EO8A 3NWGA 4PYDA 2UXBJ 4QYZK 1OSCA 3SFUA 4WFYA 1TTHB 3DDIA 1VQSA 5E3CA 3M7VA 3TVZA 1FEHA 3VAGA 1A0OB 3HJFA 1X0PA 2KJWA 4L72B 1S4EA 5IV3A 3KUGA 2DY1A 4RUBA 3NCQA 2R4FA 3DOMA 4C0OC 4Y2AA 1ZS6A 1ZYQA 4QR2A 1TUWA 3BN4A 2G4BA 2VIHA 2UUCF 2AGPA 3MM8A 3DRRB 3MUVP 2CPYA 5KFRA 3HHLC 5J1PA 2UXDJ 1FEEA 2BABA 3CCQS 2IM1A 1FFSB 1U1QA 3CJ4A 4ILLA 4DG1A 1OJ4A 2CNLB 1FD2A 2ZH3A 3CJRA 3PRBA 1TKXA 2PDAA 1TL3B 1UVLA 5IT9U 4WP9A 2FZCB 4QIGA 2MQMA 5J2NA 2V94A 3NRBA 4AQYJ 2N3OA 4K4ZA 2KB2A 3W62A 4B3OA 2ZE2B 1W26A 1AT1B 1TKTA 4N41A 4P2SA 3N9UC 2C2RA 2M4MA 3TANA 5J1EA 3ZZZA 2HHHJ 1WD6A 2WRMA 4CO3A 1TL7A 4RNOA 1JKHB 3FKBA 5CABA 2AEMA 1KFSA 1RB0A 5B0EA 2BKPA 4CO2A 1C1BB 1CS4A 1WKKA 2E1RA 3KHLA 4V19J 2CQIA 3HZGA 4X4RA 2HEKA 3OJSA 2EK1A 1KKHA 2D7SA 3DOKA 1I94J 1Y0HA 2DH7A 4NLYA 4MK9A 2JNJA 4A4JA 4A8MP 4JI7F 1FJCA 3IBWA 4G1QB 2E9ZA 5F9LA 2OMOA 2CUYA 3FC9A 4IG0A 2LU1A 3Q83A 2EFVA 1NLKL 1J2VA 1TL5A 3PACA 5L38A 2V8DA 2Z2YB 4M5GA 5DDRC 4NMLA 5A2QY 3DYAB 1Y7PA 2DGVA 1K73T 3H2UB 3HK2A 1ZA1B 1NAQA 1GX5A 3MHYA 1ZZFA 1P6TA 2Q6BA 1FRKA 1J5OB 2G2ZA 2M52A 3C6UB 2V63A 1M5SA 3UNYA 2RS8A 4D3GA 3C3LA 4HACB 1OY8A 3W64A 5FJ4A 1HPZB 4F25A 2L9NA 1R43A 2SXLA 1VQ5S 1TL1A 3RR8A 1V9OA 3BGFA 3RB0A 4LRCA 3C6TA 3KNGA 1RI7A 1RT2B 2MZQA 1YJRA 3EVOA 1DFDA 3JB9k 3JQMA 2FB0A 1JXVA 4HDHA 2Y1JA 1Y3JA 3GYNA 5AXMA 5ETQA 2ZH5A 3QT5A 1SBRA 4QU7A 2CVIA 2UU9F 5EX3A 4DV7J 2RDIA 3JSRA 2QL7B 3ISND 4WPAA 3VZIA 2FC8A 1KLMB 4FP9A 4K59A 2J9CA 5A8KB 3HHLA 4ALZA 5A6WA 3M8RA 1RWUA 2ZBIA 2WBRA 2Z4PA 1RTZA 4B3MJ 2FHMA 4FS1A 3K58A 3AD9C 4IFYA 2HFNA 1RTDA 4PABA 4LF8F 1T9VA 1XK8A 2BDPA 1ZM9A 1SJ3P 1UW9A 4AYBD 4U67Q 3QSIA 3BGLA 5AJ3F 2RAQA 4FS2A 4MJKA 1TV6A 1FCAA 1Z2ZA 2XWYA 1YRTA 2L9WA 3D6MB 3VGUA 2Z0GA 4NLRA 3PKMA 1BE4A 2KG0A 4ZVFA 1YQHA 3SCKE 4Y0FA 4IKAA 4BLGA 5A0YA 3IS9B 5BYQA 3B78A 1IUJA 1QY7A 5C24B 1DARA 3R7BB 1Q8BA 1PBUA 2J9DE 2DNKA 3NY0A 4RW4A 1DAXA 3TUPA 3HM9A 4OX7A 1N6QA 4RW7B 4FPIA 3PY8A 2AKWB 2MQPA 3OL9A 2N82B 1R8BA 2Y1RI 4RZRA 2Z30B 2L48A 2HS3A 3US5A 1HARA 4USHA 4ZVGA 2X1AA 3BQ1A 4N8OA 4GC6A 2MEWA 1UA0A 3LUYA 2DJWA 2KI2A 2YKMB 2KJVA 3UNGC 2BOAA 2GC8A 4MK8A 1BQNB 1TK0A 1KS2A 5JUMA 3T19A 3ZZYA 2XGQA 4QR1A 4O3OA 1R0BG 1RKJA 4F4ZA 2H51B 4PPZA 3UVJA 1REGX 1YBUA 2OPQB 2QO3A 4PQAA 4UQTA 2GAGC 3I82A 3MM6A 5JMNA 4O44B 3BDEA 5KT4A 2FVCA 3I96A 4LF5F 1NJXA 2LLZA 2BE9B 2C22A 3CCJS 4DSKA 2JLGA 4NWBA 3TA0A 3FFIB 4C8OA 2MDAA 1FJEB 3FMWA 1EIYB 3CGIA 2D3ZA 1WF0A 3UDCA 2HFOA 1N4LA 2LDYA 3MMBA 1SXLA 2QFIA 4X4QA 2B8QA 2Q1LA 1FXRA 2XCAA 1RACB 3NWRA 1U1NA 1WC3A 1F5CA 3NL0A 4DR7J 3VAJA 1G3OA 4NPOA 2YKQA 3VVUA 4QW9A 3ULHA 3HVAA 1Q53A 1LXNA 2DHSA 4ID8A 3HD1A 1IKVA 3UD4P 2D9OA 1N52B 3IGNA 3DDKA 3VAFA 2M3DA 2ZH9A 2IBOA 3K5NA 4J37A 1LW2A 2DNPA 3DXBA 2HIQA 1VHIA 2MJNA 3CCVS 4OYAA 5KFYA 4KHMA 4I68A 3ZXWA 4IOCQ 3U1MA 4Q43A 2DNZA 1NDPA 4W90B 2QA1A 1YLXA 3QYYA 1X5OA 4TYAA 4YB6A 2HRTA 3HVTA 3BO3A 1RBOB 3TQEA 3KJVA 4ED3A 4WK3A 2UXCJ 2CJXB 3HHLD 3CUNA 4E2FB 1N5SA 3MMCA 4DL3A 2DNHA 2XULA 3ENQA 3KFWX 2DRDA 1E6YB 2D74B 3MEGB 2AJFE 1HD1A 4U7UK 5BR8F 4ECZA 4NI2B 4EUVA 2H4WB 1Y9OA 2DGTA 1GMWA 1G7CB 3LP1A 4PXEA 1NXIA 1IBMJ 2C2NA 1EHWA 2VG5A 4HH0A 5IV4A 3BM7A 2QMXA 3VV2B 1GAOA 4PWUA 4U96A 4LFBF 2XY6A 1S0NA 5C2GA 4USWA 3EGNA 2DRAA 1GX6A 3JAMU 2YWFA 2N7CA 2VPWB 1GK8A 2Q3PA 4ED7A 2IM0A 1HQUB 3JSMA 2CQDA 2OPPA 5L1LA 2F8HA 4FYYB 4FN5A 3RRGA 2PSZA 3V81B 3K8WA 4YR2A 1JMTA 2W25A 3MEDA 2YWHA 4A48A 1VQ7S 5F0WA 2CWKA 3CDAA 3GJTB 1GEHA 1IKXA 3V6DA 4DV3F 1U6BA 2CPXA 1UW4A 2DNNA 3VTIA 4WE1A 2C42A 3EYZA 1C1CB 4I67A 1AZSB 4YB1P 3UCZP 4WXOA 2J0SD 3D7SB 4WBFA 1IVZA 1REVA 2OFHX 3MDFA 1RE1B 4ECRA 1B3TA 1CJUA 4BS2A 3NGTA 1RWMB 1HW8A 4EO6A 1YJ7A 3DLGB 3E3XA 5HBMA 4MT1A 2GIFA 1L3TA 4LREA 2BJ1A 4KGXB 1NPPA 2PO4A 3DHXA 2BACA 3HHKA 5DM6Q 1A6LA 4DL2A 1GTEA 2MPUA 4N5SA 4WFZA 4KH1B 1RAEB 4FXVA 3G87A 1U7LA 1ZZNA 3AJ1A 2YNHA 5J2QB 5K8NA 2WSEC 3RU0A 2ACYA 3W8GA 1M5HA 3MM7B 1U25A 1VK8A 3G82B 4O23A 1R7IA 3K17A 3Q8UA 3EZOA 4LF1A 2XYHB 3FBFA 2XMWA 5I3PA 3D4JA 1S9EA 4QW8A 1RP5A 3D0GE 3RGIA 2EC2A 5FDLB 2EEYA 3BB5A 3PRVA 4YB7A 3B54A 5DQGA 4JI2J 2OTJS 1TUVA 5E33A 3UI3A 1UEUA 5ETNA 1TMJA 1CULB 3KK2B 4J5OA 3GU0A 1T94A 3TOQA 2J0WA 2IVMA 2UV8A 3NGUA 7FDRA 1UVIA 1SUQB 1RK8A 2NYHA 1VISA 2HVHA 1X7VA 5HANA 3PIPQ 2JSXA 3J7Z5 2XG8A 3KMQA 2POKA 4GRSA 3PR4A 3KUHA 2XMTA 1VBKA 4A8KA 5GAHU 4IR9A 4G1IA 4P2FA 4KT0C 5FD1A 4CM2A 2H3EB 2KRRA 2ZEJA 3C2PA 3NGRA 5K20B 4ZJOA 1N36F 1FVQA 3DI6B 4AT1B 1GMWD 4UZCA 2ZH1A 2J0XA 3CT9A 1ZH5A 3CW2C 1JLAA 3CCWA 3ETOA 4ZVUB 1VRTA 1IBCB 1CBKA 3G8SA 1RAOA 4B02A 3MFHA 3IN5A 4YP3A 3CDEA 3RB6A 2EFNA 4NZ7A 4KHPJ 2VFSA 5B08A 3SMZA 3VAIA 3SSQA 5I4MA 2R2SA 3GE9A 1CQMA 2WSFC 3LA0A 5CAAA 3BGUA 2OP5A 1ZM4A 4B3SJ 4DV6J 2F7VA 1N5VA 4C7QA 2V4JA 5HJXA 2RQMA 5KG3A 4I1TA 1FRJA 2FUG9 2YWEA 5H9FJ 1V6HA 3GR0A 4YY3J 3HLUA 2X51A 1T9WA 4F2RA 1JJHA 4WFXA 2A1BA 3KLHB 1M1KT 1V3SA 4C8ZA 1FO1A 3W61A 3GSDA 5KFMA 4ELTA 1JJCB 2XO6A 1JK9B 1Z2LA 3OSPA 4LSNA 2G9OA 2RHQB 2ADCA 4KO0A 5DDPC 4KGZB 1TQLA 2F4VJ 5HVFA 2HVIA 4IUFA 4FYWB 5GAHI 4AQYF 1IM4A 3GG0A 5MLCV 3JS9A 4ZP6A 5CYQB 4YOEA 2HBQB 3AAWB 1Q5VA 4MKBA 1YTYA 2W2NP 2DVIA 3HF5A 3NOCA 2HHHF 3CNQP 3OTDA 1R0AB 4P73A 1Y5NB 2FIUA 4Y65A 3VCDA 1WOOA 1WF1A 4NZ6A 3LPEA 4JV0A 4C8MA 3F44A 2FJBB 2QSWA 2J6UA 1QD1A 2HHVA 4ZCMA 2NQPA 4B17A 4KIAA 1NUEA 4OYPA 4PYAA 3G6VA 4ECYA 2K3IA 2OD6A 2VG6B 4WP3A 3EGZA 3ZZOA 4AE5A 3FSXA 1I94F 4DR3F 1RHJB 3K5LA 2DR8A 2MKIA 2R8GA 3G9CA 1MMLA 1YK9A 3D6TB 2J5AA 1Z1ZA 2HFVA 2V0NA 2YNGB 1Q79A 1UZHA 3HVWA 2W4DA 1H7XA 1KNZA 1XBWA 5I3UA 2GVDB 2XLKA 4EYIB 2MXYA 3AXMA 1D0EA 4L74A 2YQ1A 2XSJB 5GVQA 3HI9A 2ZH8A 1WI6A 2HLTA 4Z7CA 1L3VA 2NPFA 4I2QA 4ANDA 2RF2A 4UOFA 1FVSA 1SIWB 4XDDA 1I3OB 1VC0A 4NXNJ 1UFLA 2IC3A 3I0RA 3MAQA 3MOZA 2HZCA 5KFOA 2OSRA 1U1KA 5DG8A 2DXDA 3NAIA 1MNEA 4JI1J 5DDOC 1FX2A 3PM9A 1HFEL 4RUHA 2ILYA 2X1BA 1H73A 1X4GA 1M1GA 4GO5X 3M2UB 4ZVQB 2E7WA 2V4QA 2RIJA 4ZDNA 2Z58B 4DQRA 1D9FA 2FLLA 1RWWB 2CWXA 4QWDA 3TZYA 2GFFA 4OYWA 2KHDA 4CYUB 1OIAA 3KHHA 1KTVA 4I7FA 3SDEA 1NPKA 1GT8A 1M1HA 1Q16B 5ETRA 4FBTA 3OVSA 4F67A 2A18A 3M30B 2RDDA 2MZSA 3VF0B 2AGQA 3P5BP 2CG8A 3MM5B 9RUBA 2XY5A 1VCTA 2RH3A 4DV7F 1YJUA 1PG5B 3AFGA 5GAEU 1KHWA 1HKAA 4DPWA 4R0JA 4RNHA 1EARA 3UWTA 2M2BA 3TWZA 4OZ3A 4L6V3 1RZMA 1YZ7A 4Q5VA 4AXJA 1JX4A 5L9XA 5KFDA 2FVQA 3M32B 1IKWA 1VHFA 1YDLA 2GHPA 2Y8YA 4G6VB 3UN3A 4TY8A 4Y2MA 2P6SA 2ZOGA 4JI8F 1RTHB 3FCHA 2H48B 5LMNJ 1AXQA 2W7AA 4Y2IA 1H2TZ 1JLFA 3T5JA 4LBIA 5KFSA 1H2VZ 2KVIA 4LF4J 3LANA 2QYCA 3LWMA 4NCGB 2QA4G 1NSAA 4ELVA 3THTA 3MR6A 2O1PA 1OS5A 5B0GA 4ZP9A 2PD1A 4CLPA 3J81j 3KUEA 1UFWA 2YXLA 2CPFA 1RLCL 2XHWA 2B6AB 1URRA 5HK4A 3IP0A 2FY8A 1VQ9S 3THPA 1DTTB 3MAAB 2VDIA 1JXLA 1P9QC 5HO4A 3HSDA 5CD4A 2XMVA 2FZKB 2QGFB 5HQMA 4CZCA 4DR6J 2H9ZA 2HWTA 1BY9A 4OV6A 3SV3A 1N33J 2QLJB 3DN9A 2RB7A 3W5YA 2J6TA 4LF9F 3Q89A 1NO8A 1XR5A 1HQEB 1RWNB 3JXOA 3KKFA 4JI5J 2HURA 3EJMA 4FKXA 2HIYA 1TP7A 3GYXB 4DFKA 4AL7A 2EKNA 4Q2MA 3VGTA 4IQMA 4QWBA 4LF7F 5IWAF 4RW9B 4ID5A 2IAJB 2HYIB 1F3VA 2GMLA 4USVA 1NH8A 4QYRA 1WG5A 2WONA 4NLTA 1BQXA 2V9KA 1MLAA 2OPSB 1YITS 3R2CJ 2EI5A 3MR2A 3C15A 2E44A 2XMUA 3FRYA 5F8NA 1F9EB 1QTNB 1VQKS 2ZOFA 2B3TB 4RW8A 2MZTA 2WW8A 1DJ0A 1BLUA 3JQKA 2HZAA 5H9EK 2RD5C 3EVWA 4USMA 3SEOA 3R9LA 3HT3A 3EICA 3N28A 3N5BA 2R8HA 3PW4A 4C4WA 4URSA 3MMAA 4CLUA 2HMIB 3TX8A 2PI4A 1SL0A 3RAMA 4JI4F 3ILIA 1ZAWA 3M8QA 3RUBL 2HFZA 1XWLA 1RBAA 5CYMB 3ZZRA 4TYBA 1V3RA 1RTIA 4IG3A 4DR7F 2DYAA 5G4DA 4EZ6A 1WWHA 4WYWA 1RABB 1SKSA 4IO1A 5I42A 2M8DB 5I3QA 4CI0B 4F02A 4DX7A 4J9SA 2PMHA 2BM1A 3R5BA 3EM1A 4GKJJ 5K8MA 1H98A 9ATCB 8ATCB 3O5TB 1X4DA 3IO1A 5HL7Q 4W4MA 3S1TA 2KZMA 4KGMA 1LK5A 4PWDB 1IBLF 3H0PA 2JDJA 3F73A 1XNQJ 3OFHA 4KAIA 1B64A 1F0XA 4AXIA 5F8LA 1S1VA 5DZ7A 4ZVRB 1WHWA 4I2PB 4Q0BB 2ZZMA 4L73A 4M5LA 5D8HB 2L3MA 4OLPA 5DM7Q 3OTOF 2VB6A 4ECVA 4DL7A 4CLZA 2VPXB 1T03A 2ZZTA 4LUBA 5ETPA 1HNXF 4XK8C 1CSJA 1YWXA 3LW5C 4LFAJ 1D8ZA 1G6BA 2GIRA 2PFDA 3IMQJ 3ZTOA 2E1PA 1K0TA 1IBMF 2GJ2A 2ZM6J 2CQCA 4DN0A 2N4CA 4DR4F 4QQBA 4F4KA 2G1DA 2R9LA 2BJEA 4FXWA 1TKXB 3PW5A 3PTWA 1VS3A 3QPIA 2MQOA 5J2NB 2IJNA 5JVGQ 3I0SB 2F1FA 3H40A 4NXMJ 4B3OB 2OO4A 4FF1A 3Q2SC 1TKTB 3MURP 2KZZA 1FXLA 4NYOA 1M5OC 4QJVA 5HAOA 5J1EB 5HP1A 3CIZA 1IWAA 2G0JA 2GA7A 4BCAA 2XLIA 3DMJB 3GJRB 5G0RA 3QLHA 3M8WA 3BYRA 1SV5A 5BXIA 4WZMA 1CS4B 1F2HA 3PYEA 4LRAA 1HMVB 4J9LA 4M94A 2NXCA 5GADU 4ILRA 2NPIA 3DOKB 1J5EF 3C14A 1L5UA 3PV8A 4X4NA 1VRUA 3M9OB 2GHVC 5F3TA 3LWLA 3SV4A 5SUHA 3M8ZA 2OELA 1Q5YA 4IG0B 1RXOB 1N8RT 4CNYA 3KLGA 1JLCA 4DPXA 3CULA 3DLKA 2HNYA 4WKYA 4K4UA 3U27A 2IM2A 2X7IA 3HULA 2ZC4A 2IHR1 1LWXA 3W7BA 4LR7A 2BE2A 2W7PA 1H72C 3HFKA 1BUXA 2LEBA 4CNZA 3ZFVA 4YFUA 4NCAA 4ZVEA 3M8SA 4EYHB 3QRQA 2HAFA 1XNRF 2JH3A 1LFWA 4ZVOB 2C3OA 1XEZA 2FC9A 4UY85 2CADA 4RBVA 3U02A 4DSLA 4PG6A 1NRKA 1HWJA 1WORA 1Y00A 1RYSA 4O3RA 1S1XA 6AT1B 1WEXA 1ZPVA 5K8PA 2MKJA 2ZJPQ 3FZ2A 2E5LJ 4HEA9 2FDNA 3TRGA 2EW9A 4OYZA 1VMBA 3M05A 2ZUAA 5DGBA 2DNMA 4JI2F 3C6TB 2C1EB 3I87A 3JTPA 4ELUA 4G3IA 2JL9A 2MQ8A 3HPOA 2QLFB 1XMQF 5KOWA 2Z57B 3RBEA 1WSVA 5IQQA 2HHQA 2RS2A 3N79A 3OT9A 2HHTA 2RHSB 3W66A 2DK2A 4J9QA 3BQ2A 5A8RA 1S7IA 4A8OA 4AUKA 2DH9A 3NOGA 2RNEA 3FVYA 4X64J 3P49B 2RSQA 3U1LA 1DLOA 2KU7A 2QT7A 1MN7A 5KFUA 2MKKA 4DCJB 2LU2A 3RJMB 1N88A 5LSRA 3NMRA 4OLOA 2P9EA 2I1RA 1HBOA 3D5MA 3HFZB 1HI8A 4CTAA 1EJ7L 3LP0A 1NSKL 1WI8A 3QGGA 4K4VA 2BM0A 3IC1A 3HXMA 4XDCA 5DO2A 4IFYB 5IT4A 2G2OA 2Y3YA 1RTDB 5KFJA 4CT8A 3OVBA 4DL6A 3SZ2A 1RHMB 3MR7A 4JBCA 5KFWA 2R2TA 4WK1A 4DV0J 3VAHA 2LP4A 3QGIA 2L9DA 1X60A 2FGCA 1FWPA 3KG0A 2QSFA 2NXUA 2EG2A 1ZAXA 2NUHA 1U47A 2UZAA 5A0YB 3OD2A 3TAQA 2Q79A 5CXTA 3CCZA 3I5BA 3PHEA 3KK3B 4LBHA 4RKUC 2V6AA 1LXJA 2WHOA 5EN1A 2FJWA 1FDBA 4B3SF 4RW4B 2P5VA 3IRWP 4CT9A 3OLAA 1MMDA 4I69A 1N6QB 2E5HA 2D41A 2V2VA 4DOZA 5IM0A 4YY3F 1NNDA 1F6TA 1OO0B 1T3NA 3W1YC 1URNA 3DRPA 1U45A 2E1AA 1HHTP 4WIIA 3A8EA 4KPYA 4TQRA 2OPRB 3TVKA 5L9NA 2ZH2A 2YPZA 4TNOA 1U1OA 1X0FA 5KG6A 2K7KA 3LF0A 3QAEA 2VICA 2Y9HA 1FFWB 3M6VA 3R5DA 1E6VA 5DQHA 1RWPB 4M5NA 4IR1A 4LF2A 2LQ8A 3CO0P 1D1UA 3MM6B 5F8HA 2DKOB 3R7SB 3QAUA 1UWBA 1AROP 2BR0A 1LWCA 3T41A 3IBCB 2RKIA 4B3RF 2B5JA 4HI2A 3H25A 2A6OA 3RTVA 4K4XA 2AZ1A 3KG1A 2BRLA 1FWLA 2GZOA 5D0RA 1U1LA 2Q6CA 1C4CA 3TEGA 3MMBB 4DV5F 1CVJA 4J9VA 5LSOA 4ANCA 2KN4A 4YDXA 3R2DJ 4X2BA 1TKZA 3BGRA 2GW8A 3QATA 2IBKA 3HDSA 4HTIA 1FJGF 3SI8A 2QN6B 1MROB 2NXNA 1YSJA 3O8WA 1IKVB 5E3AA 4MYTA 4OJGA 3T1YF 3ONQA 2D3O1 2W01A 2VG7A 4J90A 4NOHA 2DGQA 5HLFA 1FRIA 3IA0A 2J8SA 3HHEA 2QV6A 2VBYA 3OR1A 3H4DA 2KXHA 1DTQA 4I64A 2RUSA 2K1RA 2CJAA 4HHHA 3AH6A 1UP1A 4WWSA 2XS5A 3HVTB 1NKEA 2E1MC 2AV5A 3HFVA 4RWWA 1U4BA 4QYZJ 2OH2A 4E8UA 3A3PB 3MMCB 2KXNB 4C8KA 5KFQA 3ILLA 4PZVA 5JJBA 2YX1A 3BR9A 3O6QA 1XJWB 2VZ9A 4DX5A 2W9BB 3LP1B 5K8OA 3B4DA 2CJKA 1FKOA 2VG5B 1NK0A 2YX7A 1IJEB 1NSQA 3RZAA 1LWEB 3G8TA 2YKNB 1AUSL 4ZPDA 1GTHA 4ZA1A 3V6HA 2RMLA 3TEHB 3GR1A 3MCSA 1KTQA 3H2LA 3D67A 3Q8YA 3TJ9A 5CZXA 2CZ4A 3ZTSA 2CQ2A 5ADZA 2HLUA 2ZNYA 4KE5A 4ILMA 4I4BA 4UOGA 3MEDB 3D6FB 2BJ8A 1FDAA 4MIAA 1IKXB 1EETA 3V6DB 5B0AA 2DNQA 5FLXU 2W7OA 4AD6A 5IC6B 3J81Y 5D15A 3IM8A 5KG0A 3P45B 2DXEA 3DLHA 4J9UE 4LF4F 2JFDA 3EXCX 3CJ2A 2V8HA 2RQCA 5KFZA 4Q44A 2ZC3A
chains in the Genus database with same CATH topology
3CPWR 4EUVA 1Y9OA 2DGTA 4CO0A 5E0OA 3SSSA 2YKOA 3R3TA 4FF4A 4TY8B 1G7CB 3IG1B 5C5JA 3I0SA 3MTJA 5KFXA 2FGOA 4QWAA 2NR0A 2LA4A 3K8VA 3LP1A 4O3PA 4PXEA 4DPOA 2V8VA 3NG8A 4RX6A 5CYJA 5CQGA 4CO4A 1S1WB 5HBMB 3F56A 2RVJA 2MY8A 4USIA 3CD7A 1Q81T 3K2YA 1JLFB 1KVIA 1RT3A 5GMKa 4DQSA 1S48A 2VG5A 1QAIA 3DLEA 4EBCA 1BGXT 4HH0A 3BM7A 2QMXA 3LPYA 4X4TA 4HH1A 1GAOA 4J9PA 2MKCA 3DMJA 1X4HA 4PWUA 4QU6A 4GC7A 2VONA 1FHTA 4LFBF 3M2RB 2XY6A 1S0NA 3VAKA 1W2IA 1FRXA 2IJFA 2DNRA 3EGNA 2DRAA 1GX6A 3BZQA 4ETXA 1T7PA 2BQRA 2YWFA 2FVSA 1HMVA 2LA6A 3J7ZT 2B7BB 2N7CA 2VPWB 3IWXA 2Q3PA 4ED7A 3NS6A 2IM0A 1HQUB 2JVOA 3JSMA 4IRKA 2CQDA 3TVYA 2ZBCA 2OPPA 4RLEA 4WU3A 3V5RA 2XZWA 5L1LA 4NYZA 2F8HA 1C4AA 3B82A 1FKPA 3E2EA 4FN5A 2OD4A 1OQ3A 3FQLA 3RRGA 2PSZA 2KG1A 1XMBA 3Q23A 3V81B 2FVRA 3K8WA 4Z37A 4YR2A 3RAXA 1IJFB 1JMTA 2W25A 3BSAA 4OI1A 3MEDA 4JI5F 1HBUB 2YWHA 4A48A 1VQ7S 2OMLA 1DBDA 5F0WA 3P6YC 3I9V9 1TFWA 3CDAA 3V6KA 3FEXB 1S9EB 3W2VA 1IKXA 3QIPA 2PMZD 1WEZA 3V6DA 3PRDA 1XTZA 1VBYA 4DV3F 1S97A 4K5SA 1U6BA 5DLFA 4XPCA 2CPXA 1Y4ZB 3KG4A 5F3ZA 2MKSA 2FJDB 1UW4A 1SI9A 2LEAA 2DNNA 3VTIA 2EBEA 3QGPA 4WE1A 2R7UA 2C42A 3HMJG 3EYZA 1C1CB 3DC2A 4ZPTR 2QA4S 1VQ6S 4I67A 3JTNA 3FGVA 3GIMA 4AL6A 3K5OA 4YB1P 3UCZP 3TARA 2VOOA 4WXOA 3C8YA 1E6YA 3CE8A 2XY7A 1NK7A 2J0SD 1TL3A 3RW7A 3I6PA 1REVA 2OFHX 3RRHA 2W24A 5K9FA 2GO9A 1W25A 3MDFA 1N5YB 3DU5A 4ECRA 3SYZA 3TW0A 4BS2A 3IFEA 4DSIA 2RRNA 1HW8A 1TR0A 4EO6A 3DLGB 2PIIA 3KLFB 2EBGA 3E3XA 1S1WA 4ID5B 5HBMA 3BR8A 3DOLB 4RW6B 1ELOA 3PVXA 4B3MF 2KFYA 1F2GA 2ZITA 3AB4B 3MEKA 1L3TA 2EPIA 2LQ9A 2FJAB 2MSSA 1HNZF 4NLVA 3BF4A 3GMGA 2PO4A 2LCWA 3DHXA 1NK5A 2BACA 3HHKA 3D0HE 5DM6Q 3GFZA 2KT5A 2QLWA 2VFVA 1A6LA 4EEYA 4Y2KA 1KQKA 4DL2A 2EK6A 4MAKA 1GTEA 3MTKA 1T8EA 2MPUA 4N5SA 3V4IB 4WFZA 3BO4A 5T14A 3R27A 3O3LA 4FXVA 1N0UA 4ZS6A 1HNWF 3T5HA 5C25B 1U7LA 3DRXA 2M9KA 1ZZNA 3AJ1A 2XMMA 3QMQA 2YNHA 5J2QB 2ZZNA 5K8NA 2WSEC 3FQKA 1DRZA 3R1HA 3RU0A 2ACYA 1FA0A 1K8AT 4BC9A 3GWCA 1M5HA 3O1LA 2GMHA 2EC0A 4KGKA 1M0SA 4Y3CA 2FHOB 3MR5A 3MM7B 4I6WA 3WZ0A 2W4CA 1U25A 4KTQA 4ES1A 1F5AA 2CQ0A 3CJ5A 1VK8A 1VC6A 3V81A 2BA9A 5T7LA 2VBWA 1FT8A 3E01B 4O23A 2ZHAA 1R7IA 4JV2A 4DQQA 5F41A 4PG4A 1R6YA 3H5SA 1QAJA 3IWLA 1T05B 1C0UB 2CQHA 2LEPA 2VQEF 4DQIA 2VOPA 2VASA 2XMWA 1NK6A 5I3PA 4B9LA 2LECA 1S9EA 3B8HA 2YNIB 4JYAF 4QW8A 2DNYA 4G1QA 2KTQA 1RP5A 1HD0A 2NSBA 3D0GE 4J9MA 5FDLB 5AE3A 1JLBB 2MMYA 1GXLA 2XI2A 1OPIA 2LYVA 3BB5A 4QPXA 3BDPA 1C1CA 1VQ4S 3DLLQ 4YB7A 4X4PA 1YIJS 1SJRA 4UW2A 5DQGA 4CH0S 1NU4A 3MMAB 2OTJS 3M8PB 1TUVA 5E33A 5ITHA 3GV7B 2O5DA 1VRTB 2PA3A 4L3NA 1WTBA 2HQIA 1V3ZA 5KFTA 3LH2S 3JSBA 1YRXA 2AGOA 3UI3A 1N5TA 3PKYA 4YUDA 1UEUA 4DEZA 1RKIA 4Q7AA 4K0KF 4URGA 4C8LA 5DDQC 3KK2B 3DYAA 4C11B 1N5YA 4J5OA 1TAUA 2DGUA 3I4HX 2GQQA 1T94A 3TOQA 2AF6A 1F9FA 3JYTB 3UQSA 2J0WA 4KKOB 2IVMA 2UV8A 4XAKA 4DLEA 2F9JA 1TZ0A 3PNIA 5AXKA 3LP2B 7FDRA 3DLGA 1SKRA 5EWGA 4IO9Q 1UVIA 1SUQB 2G13A 2QRRA 1RK8A 4TY9A 3CMAS 5BYSA 2ASLA 1XNQF 2W9AA 4DDFA 2DR5A 3FMBA 1N54B 4DN9A 3C6UA 3P5TL 2HVHA 5GAEI 1ZTTA 1X7VA 4Q8EA 3RRKA 3T5KA 3T6JA 3NNHA 4ZKAA 1TK8A 3PIPQ 4DUZF 1DHMA 4PUOB 1TFYA 3CXCR 1S99A 2JSXA 2P9CA 3CJ0A 3OL6A 4KRWA 2UUWA 3J7Z5 2NZ4A 2BQ3A 2B51A 5D4PA 2XG8A 3KMQA 2N3LA 2YNFB 2POKA 1HPZA 2LXIA 4OQJA 1YJVA 3O44A 1WEYA 4MKAA 3PR4A 2R7OA 5H1SV 2D1CA 5DG9A 3UD3P 1MWZA 4F4YA 1RYRA 2YQ3A 2W4PA 4O4GB 2R8KA 4F8RA 4OZJA 5EX0A 1HBNA 1I1GA 2XMTA 4WTYA 4DSJA 1B0VA 4A8KA 2XCPA 2V4RA 5GAHU 2CVEA 4PG5A 4IR9A 3MM7A 3SCIE 2I0XA 1NJYA 4G1IA 4KT0C 3T1HF 5FD1A 1FE4A 2VV5A 4ECSA 4N76A 3G6XA 4JI6F 2AYGA 1RT2A 2KRRA 2QIFA 4HTJA 5FIIA 4E98A 5F8IA 2ADBA 5D4LA 3C2PA 4LFAF 4HKQA 1R27B 2IVFB 3SFGA 1YJ9S 2R7SA 1C0UA 1ZETA 1K0VA 1N36F 5KFGA 3SXLA 3OVAA 1RT6A 4ERDA 4BWMA 1FVQA 2R8IA 3DI6B 4R8UB 4LSNB 5MAOA 2ZM6F 2VFRA 4FPRA 5BYRA 5E3QA 4ZPWR 3H4BA 2KKHA 2ZH1A 1IXKA 2J0XA 1YJWS 5FDLA 2Q66A 1S4FA 5HMZA 3CT9A 1ZH5A 1T03B 2DH8A 2RJZA 1ZPWX 1NB7A 3QZ8A 5J2MB 5IT9Y 4H4MB 2DD8S 4PKDB 1JLAA 3CCWA 3ETOA 2VD3A 2LDIA 5AXNA 2DCLA 3KK3A 1JLEB 1QAYA 1VRTA 5KFAA 4OZNA 4ZVHA 2E66A 3G8SA 3PZPA 2CPJA 2M88A 4B02A 3ITHB 3MFHA 1PILA 2HNDB 3GIKA 3OQ2A 4KV8B 3IN5A 3RB3A 1HNIB 3E8OA 2WB1D 4YP3A 3CDEA 3RB6A 2EFNA 3LGMA 1KLMA 1S7HA 2HHPA 2XSFA 4C11A 4PXCA 4NZ7A 2XLJA 2C2EA 3JYTA 2VFSA 4JUZA 5B08A 4KKOA 3SMZA 2CJQA 5KFPA 5HROA 3VAIA 3SSQA 5I4MA 2OKQA 5A8KA 2R2SA 3GE9A 4LMZA 2AWZA 2A3JA 1NHUA 1SUQA 1Q7LB 1CQMA 4TLQA 5KFBA 3MOJB 4OL8A 4TKTA 2KDOA 2VH7A 2WSFC 3M6UA 4NLGA 4RU2A 1GXTA 4OHYA 2U1AA 3PFOA 3CC4S 3BGUA 2RU3A 2B9WA 4OI0A 4ZP7A 1YRUA 1HWKA 4PG7A 2OP5A 4PXDA 1ZM4A 4PUOA 2F7VA 1N5VA 4C7QA 2V4JA 4F4XA 3BSNA 4M95A 2RQMA 4OHVA 2XEXA 1WF2A 2OPRA 1H3DA 1UJ4A 2CDQA 1FRJA 1KR4A 2FUG9 2YWEA 1QE1A 4I1TA 5H9FJ 2RQKA 5D4OA 1V6HA 2YNFA 3P96A 3KK1A 3VAMA 1RT4B 3GR0A 1CG2A 3HLUA 2VA2A 2X51A 3N01A 2DHXA 2U2FA 1AW0A 5HP1B 3HX9A 1PGZA 3LALA 4O4GA 1P1TA 4F2RA 5IQ6A 1JJHA 4WFXA 2A1BA 4HHJA 1JLGB 3OBIA 2KFZA 2GMJA 3KLHB 1CC7A 1M1KT 5G0RB 3QLHB 1V3SA 3LQVA 2CYYA 2DTJA 4C8ZA 1FO1A 1LW0A 3K59A 5KT2A 2GHWA 2K3KA 3D28A 3MAHA 2WK4A 1X9WA 2HGLA 3H8YA 2NLWA 3K57A 3NNCA 3U7JA 1P27B 3GSDA 5KFMA 2AD9A 4ELTA 1FESA 2R7XA 3DLBA 5CZVA 2UXCF 3THVA 1M5PC 4BDPA 1JK9B 3AY0A 1Z2LA 3OSPA 5LMUF 1KQFB 1ZOTA 3CDWA 1GQEA 2DBBA 1VI7A 4LSNA 3W2WB 1KFDA 2G9OA 4KSEB 2DPIA 1ZTWA 2ADCA 4KO0A 3PX4A 5DDPC 3IR7B 4OZ0A 1DZ5A 2PEHA 2W8KA 2BVZA 1T02A 1U49A 2XWXA 2P9GA 1VRUB 1TQLA 3PJWA 1B0PA 5J2MA 3MM8B 1YI2S 2CQ4A 3V2UC 4TU8A 2KT3A 3PXGa 2HVIA 4IUFA 5C24A 3K7RA 1X4AA 2ZKTA 2HAIA 3NCPA 2DB1A 4FBUA 2M70A 1HW9A 2RF2B 5GAHI 4P7VA 2MGZA 4AQYF 2PN6A 2M0GB 1UVMA 1IM4A 4E0DA 4DBQA 3GG0A 5MLCV 4ZP6A 4TU7A 3MPYA 5CYQB 4KV8A 4OFZA 4YOEA 1VIXA 2MQQA 4LQ3A 2ZH6A 3CDUA 3GFXA 3IAM9 3AAWB 1HA1A 4DG1B 5A8WB 5J2PB 4MKBA 2YVSA 3KMSA 4IH7A 3KLGB 1YTYA 2KXFA 4NA2A 3JSYA 4LIWA 1VLYA 3J7YU 2CQ3A 3OJUA 3CC2S 2DVIA 5EHHA 3HF5A 1U09A 2HHHF 2HNYB 3LO3A 3OTDA 4Y65A 1Y5NB 2FIUA 4OZ1A 3I0RB 5KFLA 3VCDA 1R0AB 1WF1A 2RUGA 4NZ6A 4OI2A 1VBXA 3L3CA 2VFTA 2EG1A 3N6LA 3EXYA 4JV0A 5KFIA 2EFQA 4C8MA 3V6JA 1U8SA 4EBEA 2HNZB 2BE2B 2RILA 4NLXA 2HW3A 3F44A 2FJBB 4HDGA 1T95A 2QSWA 1GXUA 2J6UA 2E5LF 5DG7A 3DXSX 3TA2A 1MROA 2HHVA 1L3SA 5L1IA 1W2BR 4ZCMA 4F4WA 4K2XA 5EUHA 1RT5B 1FRMA 3PW7A 4HLBA 5KTQA 2NQPA 4MH8A 2GGPB 4B17A 3OR2A 4KIAA 1KOHA 1S9GB 4CH7A 3G6VA 2VQFF 2YKMA 1HWIA 3WX4A 4ECYA 1GH8A 2K3IA 2OD6A 2VG6B 3EGZA 3T6BA 3ZZOA 2P6TA 4CO5A 1SIZA 3M2VA 3T1AA 1KN6A 2Z8QA 4ZLPA 4AE5A 1JLGA 3FSXA 1CLFA 1I94F 1BQNA 3KLHA 4DR3F 5EDWA 1S1XB 3OL8A 4WZQA 3MEEB 3AJ2A 2BANB 2C3PA 3K5LA 3SDEB 2DR8A 2A10A 6FDRA 1RDRA 3H5XA 1Q1KA 2MKIA 3I56S 2R8GA 2B0GA 4ZPVR 3G9CA 1MMLA 2OSQA 2B9XA 1QVGR 1VGYA 3RYLA 2J5AA 5KG4A 1S0MA 1WELA 1Z1ZA 5HMWA 2V0NA 4JV1A 5L1KA 3D1QA 3SCJE 2YNGB 1RAJA 2OPQA 3T5LA 2KYXA 5D3GB 1HNVB 1Q79A 4K4YA 2IRYA 4X4UA 1S1TB 3HVWA 3DFEA 2W4DA 1L3KA 4O44A 1H7XA 2J6SA 1X5TA 1KNZA 4UOCA 3W2WA 1XBWA 5I3UA 1H0HB 2XLKA 4DL5A 4EYIB 1PC4A 2MXYA 3OW2R 2QE5A 2J7UA 4DV1F 2JVRA 1D0EA 1VQOS 5E7OB 4JI3F 2RU9A 3SSRA 5E41A 2Y0SD 2DRBA 2XSJB 3X3UA 1LKZA 4AL5A 5GVQA 3N4WA 3FSIA 3HHDA 3HI9A 2ZH8A 1MWYA 1WI6A 2HLTA 4KB7A 1NEEA 4U7CA 1L3VA 2O67A 2UVVA 3I4PA 1RA7A 2NPFA 4I2QA 2PE8A 2RF2A 5IT0A 1FVSA 3IRXB 4QIWD 4M5DB 4A47A 3Q8QB 1SIWB 1U2FA 4XDDA 5F8JA 2A2DA 5J1NA 2VKZG 4RBUA 5A8RB 3FNNA 1VC0A 2FLNA 4M8LA 2MQLA 1UFLA 1WHXA 2I38A 2ASJA 1A7GE 2IC3A 5J2PA 2A2CA 3LAKA 3CD5A 3LGNA 3P3DA 3PEJA 3RR7A 3G4SS 2W9BA 4RWXA 3CCRS 2RDJA 3G8QA 4C0BA 4KQZA 1HYSB 1H7WA 2ROPA 3I5AA 3OTCA 5DQIA 3N5FA 1IN0A 1R0AA 5KFKA 3I0RA 1R8CA 1NJWA 3MAQA 3MOZA 2HZCA 4BC7A 5KFOA 3WC0A 2OSRA 1U1KA 5DG8A 5M2RA 3NAIA 1S6QB 1MNEA 2WBMA 4Z2XA 3TP2A 2AYMA 2ZD1B 2HNZA 2OFGX 5DDOC 2N7YA 5GAGI 1WNEA 1PO6A 3D0IE 3CCES 3PM9A 3TAMA 1HBOB 2XS2A 1ZAVA 1HFEL 2GJIA 4EGLA 1LWEA 1SH0A 1CC8A 2ILYA 4RUHA 2X1BA 1X4GA 4NRTA 4GO5X 2WOMB 3M2UB 1C2PA 1RT5A 5DS7A 3LP0B 3M6WA 3D1OA 2E7WA 2BOPA 2YKNA 2DNGA 2RIJA 4ZDNA 2MY7A 3HZEA 2V4QA 1YGYA 4DQRA 1S9GA 1D9FA 3DRYA 2FLLA 4QWDA 4IRCA 2FD2A 2GFFA 2CPHA 2VG6A 2C2DA 4DV0F 2KHDA 4ATNA 3MXHP 4NLWA 2HQ3A 5L39A 3UCGA 3NBPB 2B56A 3J7YI 1OIAA 3KHHA 1KTVA 3MEEA 2H5EA 3FRZA 4I7FA 2QA2A 3DM2B 3OSNA 3C46A 3SDEA 4FF3A 1GT8A 2QZ8A 1Q16B 2VC0A 4A46A 1QJHA 1H2UX 4NLOA 4WFNQ 5KG5A 2GO8A 1NKCA 3BREA 4FBTA 1S0OA 3OVSA 2Z2MA 4F67A 3VALA 2IFXA 4CIOA 1NHVA 1O0PA 2E29A 3GQCA 2A18A 2R7VA 1U24A 3M30B 5IXUA 2F40A 1U6ZA 1T3OA 2MZSA 1HNVA 1TL1B 4OZLA 2JEGA 3DDNA 3VF0B 2AGQA 1S1TA 2FTRA 4DJBA 3MM5B 5DETA 4RNNA 4LVNP 1U26A 4NLQA 1LV5A 3OXLA 4UUXA 4WJBA 3MUMP 4GO7X 2XY5A 2RH3A 4DV7F 1I6JA 1PC5A 1YJUA 5KT5A 1JLQB 4DX8H 2DGWA 1EP4B 2JEIA 5GAEU 3CSKA 1KHWA 4EZ9A 3CJ3A 2XSJA 3V4MA 2MHEA 3TUZC 4RBTA 2DITA 2QLXA 4R0JA 3X1LB 4RNHA 3VQSA 3UWTA