4I0WA

Structure of the clostridium perfringens cspb protease
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
92
structure length
91
Chain Sequence
AKVGIDFINTIPKQILTSLIEQYSPNNGEIELVVLYGDNFLRFKNSVDVIGAKVEDLGYGFGILIIKVNDLNRIIELEGLQIELPKILYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease CspB
publication title Structural and functional analysis of the CspB protease required for Clostridium spore germination.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
total genus 23
structure length 91
sequence length 92
chains with identical sequence C
ec nomenclature ec 3.4.-.-:
pdb deposition date 2012-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18425 CspB_prodomain Csp protease B prodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4i0wA00
4I0WA
chains in the Genus database with same CATH superfamily
3BV8A 1YVFA 2HVEA 2CYYA 4LF6J 3TP2A 4AQYJ 3QT7A 3TNVA 2VASA 4EI2A 2LYVA 2J0WA 2HRUA 1NH8A 2VF3A 4PQAA 1M1KT 4H4KC 2V68A 4X62J 1I1GA 3HF5A 1DLOA 5J1NA 1TVRB 4GVBA 3TUJC 3NOCA 1TUVA 1AFIA 5L1KA 2JLEA 3D1HA 1HPZB 3KNGA 3W9IA 2QSWA 1VYAA 2Z2YB 5KOWA 4TY8A 2EC0A 2ASJA 1PGZA 1R3NA 1T94A 1MWYA 4OI6A 3FRYA 2VOPA 1HFEL 3M2VB 4RW6B 5E3CA 2OH2A 1GTHA 3SEOA 2HVDA 2I38A 4RX6A 4LF4J 2W9AA 1NDCA 4LJMA 3J80Y 2YBVA 3OVAA 3C8YA 1KKHA 1S1WB 2R2UA 3G82B 2RF2B 3J80U 4ZS6A 2BM1A 2UXCF 1NM2A 4PRFA 3M2UB 2ZVIA 2YWHA 2UXDF 3C6UB 4FS1A 2HHHF 5BYSA 2OPRB 1EB0A 3HKZD 3RR8A 1EQMA 4M5KA 1MROA 3T19A 1VBXA 2UP1A 4QYZJ 2HHPA 4A8SA 4IDKB 1U1LA 3OT9A 4ZVTB 4NLXA 3JTPA 3KFWX 3D4JA 1HBMA 3NMAA 3SQGA 1MWQA 1LFPA 2LEAA 2PA3A 3TVZA 1E6VA 3N0VA 3QNWB 1PJ6A 4ECTA 3TAPA 4DV5J 1HBUB 1K73T 4O0IA 2N7YA 2BKOA 2VIHA 3AAWB 3SCKE 5EX0A 3DCAA 1P1LA 2RU9A 2VG5B 3VVTA 4ANDA 4J9OA 3OFEA 2ZHOA 1TL7A 3R1HA 1KONA 1PYTA 4NLYA 1OS5A 5F9LA 5C7PA 1I94J 2KM8B 3P3DA 2YX4A 2V4RA 1B4SA 3U02A 4O4RA 1RT4A 3Q2TC 1WDTA 2IA6A 4PPZA 3NGSA 6FD1A 3I82A 2GHPA 4JI1F 2Z0GA 5HQMA 3UDCA 2XEXA 2YKQA 4DL0C 4NLVA 4NRTA 2KXFA 2CPDA 1LEOA 1N5YB 2W25A 4ILLA 1AYEA 2AV5A 3KK1B 3LP2B 4LR8A 1RTIB 1YBUA 4Q2LA 3P8BB 3ZZZA 4OZ0A 5DDOC 1PBAA 4DFKA 2HGMA 3MR6A 4PG8A 2RDDA 2NZCA 1WELA 3DI6B 3M8QA 1N32F 3HP6A 4R0JA 3CDWA 4L76A 4MKVA 2MZ1A 4FF3A 1GXLA 4ETXA 3DLKA 3UNGC 1WEZA 2BJ9A 3M30A 4OZJA 4Q0BB 3BGRB 1NSPA 2NXJA 5L9XA 1KHWA 2F9DA 3FSXA 3BJYA 3SYZA 3LAKA 3M6UA 3EGWB 5A0YA 1F9EB 1FTRA 4NLOA 3VAIA 3U27A 2MQLA 1QAJA 3CD5A 1G4CA 3U1NA 1VRTB 1MG7A 1N33F 3DU6A 4LMZA 3CC2S 3G8TA 2U1AA 1QD1A 2J7UA 3O3LA 3M6WA 1T9XA 3TUIC 1BMQB 1SJFA 4JI8J 3O5TB 2FC8A 2FVRA 1LWEB 2Q79A 2YNFB 4J37A 4PG6A 3PRVA 1WD6A 1RI7A 4OIXA 5CYJA 1MN9A 3NCQA 4NE9C 4DV1J 1M1GA 2W9CB 2YNGA 4I56A 3KHRA 3ETOA 3DN9A 2XLJA 4F3QA 2DH7A 1XNQJ 1N6QA 1RISA 3AT1B 4EU0A 2ZDOA 4PXCA 1UEKA 1K0VA 3CO0P 3H4BA 3DDIA 3OLAA 3QMQA 5CXTA 4DV3F 1S6PB 4F4YA 1PYOB 4CT8A 1X9WA 4YB6A 1KP6A 4WTOB 1WORA 1U0SA 5F8HA 2WW8A 1HQEA 4IFVB 3OBIA 2C2ZB 3T9ZA 2WK4A 3D6MB 4PR6A 2MY7A 3N01A 3QT8A 3FGVA 3H25A 1Q53A 2JEFA 1MMLA 4NXNF 3KJVA 4DR4J 5E3QA 1NCLA 1P6TA 2HAFA 4O3OA 4Q7AA 2QJ3A 2IRYA 1AUDA 2WCXA 5D78A 1JB0C 1YGYA 1TELA 3G87A 5KFSA 3H42A 3V6JA 1RAGB 3T5JA 4ED2A 1LFWA 1OYEA 1JJ4A 1N8RT 1UZDA 4WBFA 4U7UD 2F3JA 3WC2A 3MEDB 2KM8C 1N34J 3Q89A 1HR0F 1R31A 4WWSA 5HQ8A 2GAGC 4P2FA 2CA9A 1BY9A 1Q86T 3AQPA 4CLUA 2AW0A 4FKXA 5KFBA 4E2FB 2A10A 3RRKA 1FXDA 2E66A 4ZJOA 3PW2A 3THPA 4LREA 4WCEQ 4EMDA 5HROA 1U4BA 3G6XA 4JI6F 2R8HA 2H1YA 3WZ0A 4LQ3A 3V6KA 3JS9A 4OZLA 1VGYA 2NYHA 4DUTA 1NAQA 2XWYA 3POTB 4CO5A 1IWAA 1UJ4A 2GCFA 4O3RA 3D5MA 4R5PB 2OP5A 2Y1IA 5BYQA 2F40A 5KFRA 2LDIA 4OYXA 3CCVS 1HLWA 3J7ZT 2CQCA 4URQU 3EVWA 3QGHA 5B0CA 4I68A 3I0SB 3DM2A 4I2PB 4MIBA 3KLHB 2VOOA 3EDQB 5HK4A 2P9CA 3QIPA 1WUUA 3MMAB 2GJIA 3GQCA 4C8MA 3VQSA 3CD0A 2Y0BB 3PO5A 1HMVA 3H5XA 4EZ6A 2LDYA 2ACMA 4F25A 4P10A 3GE9A 1R0CB 2PMZD 1RTHA 4J91A 1U1QA 2FVQA 3V2UC 5EHHA 2HNDB 3MM5A 3A12A 4J9LA 3UVJA 4DQPA 1M0SA 1HHSA 3H5YA 4DZDA 3SV4A 2DISA 2ZNZA 1J5OB 2B3TB 2L9NA 2XGQA 4YDXA 2CQ1A 2W7AA 2OKQA 2DR5A 1GMWA 2MTLA 3M8ZA 1VC0A 4Y34A 4DSKA 3BSOA 1UPPA 1U2CA 2RRNA 3EX7B 1XMOJ 1X5SA 4UY8T 2QL5B 2ASYA 1WWHA 1XIQA 2F63A 3NKYA 2FHKA 1RLDA 1SC1B 4NLDA 1SQGA 4C3LA 2XMAA 4C8OA 5KFWA 1S77D 1M5VC 2V9KA 3N6MA 2GW8A 3CXCR 3ULHA 4XTTA 4KH0B 1VFJA 2HQFA 4TY9A 4K4XA 4ID5B 1GMWD 4PZVA 2ZH5A 5H9EJ 3DKDA 3PDNA 2OD4A 4HKQA 2HHWA 2XI3A 1KR4A 1RCXB 4J90A 3MAAA 4NA2A 1UVMA 2UUCF 2GMLA 2YH1A 5KFQA 3IG1B 2AJ0A 1JLQB 4Q5VA 2IFXA 4NXMF 3IGVA 3NWRA 4NCGB 4DL2A 4MYTA 1A7GE 2KFYA 2KRRA 2GGPB 4ZPDA 5D0EA 3MWBA 3D6TB 2XY6A 5GAEU 3DLJA 1RT1B 4LUBA 1SV5B 1IBLF 3MZIA 2IDEA 4NLGA 1Q79A 1JIHA 1S0MA 4HHHA 4O44A 4EFAC 2I2YA 1GNKA 4MMOA 5CCLA 4TU9A 4NPOA 1ZTWA 4O3PA 3T1YJ 5KFCA 2GQQA 2HHUA 3WIVA 4RLEA 2AT1B 2JDJA 3RYLA 5BYRA 3GFHA 1UA1A 1YTYA 1WI6A 4X4OA 3NEKA 3ZC4A 2Z56B 2F9JA 1WC4A 4AL6A 3N5FA 1N0VC 1NZ8A 5KT6A 3VV2B 1SH3A 4YOEA 4IOCQ 4RUAA 1G1XA 3NP5A 4I6YA 4U67Q 5A8RB 1HNXJ 4B9TA 4DR6J 4ANCA 4ED5A 3HXMA 2BKNA 2DB1A 1S6QB 2E5JA 2MQOA 2J9DA 2B5JA 4JV0A 1NK7A 1RKJA 4FPIA 5L8RC 3UW1A 3GZ7A 2AHOB 4P6QA 3EMTA 3GYNA 4OJGA 2GZOA 2C2KB 2UUBF 1JJCB 4M95A 4NOHA 4CLYA 1RWNB 2F1FA 2XQCA 1HHTP 4CTAB 1KWMA 1FRXA 1YJRA 2DNLA 2M52A 3CJQA 1TV6A 1UVLA 1CJTB 3FJ2A 5E5NA 1VQYA 2Z8QA 1TL1B 2CNOB 1FXLA 4MAKA 2B4VA 1S79A 1JLGA 4Z2XA 1VJWA 5B0BA 2BANA 3IRXB 2MPUA 2D9PA 4X65J 3D68A 2CQGA 4CLZA 2XHCA 2VBWA 1IKXB 1R89A 2FJEB 1T9TA 1T11A 3US5A 1U2FA 2PEHA 3LUYA 3TW0A 1TL3B 1RB0A 3W5XA 2MDAA 3IO1A 1UMJA 1Q78A 4OZ1A 3ZZYA 2YKPA 2IJFA 3D54A 4LBHA 1M5HA 1T95A 3GCWP 2MQQA 2B7CB 2BJ3A 4OYOA 1TKTA 2ZDPA 3RB6A 1RTDB 2JC1A 4U7UK 3CULA 4UT4A 3CTRA 2FLNA 1DQAA 2FB0A 1MWZA 3LP1B 4USMA 4OHVA 2K7KA 2PN6A 4LF5F 1SKRA 2ZVSA 2YKNA 4USTA 2H3EB 3HT0A 1R8BA 4A8WA 2CPJA 2MKKA 1PAEX 3TUPA 1RWVB 2YY3A 4QIEA 2G13A 3F0NA 1C0TB 2MKJA 3ZZOA 2KZMA 1CJKB 2JX2A 3M8WA 2CZ4A 2C3UA 4LF7F 3M9MB 4G6VB 1SH0A 4J9PA 1AXQA 4DF4A 2VC0A 1T9YA 3MMBB 4HR2A 3QJLA 2R2TA 4ZPAA 1J5EF 3WIUA 3PYEA 4RWXA 4QWEA 4BC9A 3BQ2A 1IXKA 4A8OA 3R5DA 1F5AA 2OTJS 5LSOA 1FF2A 2DHHA 2ZH6A 3VGVA 4BCAA 4AL5A 4JI5J 5ETMA 3C14B 4CDIA 3K8WA 4NCAA 3KLFA 1Q4RA 1X5PA 3QLHB 2HQDA 5CYQB 4LFCJ 1DZ5A 4DEZA 1N36F 1RHUB 1N52B 1JWWA 1V5VA 2IBKA 3OFFA 4QU6A 2YNHB 4OYAA 5DLGA 4OHXA 3HULA 2R7WA 4WZQA 2XY5A 1WF0A 1HD0A 5E7OB 1O5JA 2V4QA 2VPXB 4JI3F 4D3GA 3ONQA 2HKEA 3DRYA 2VB6A 3FSIA 4BS2A 1Q8BA 1NHUA 4ZPTR 2A6MA 2KI2A 4RUBA 4F04B 2VKZG 3KMQA 2RSQA 3LQVA 2AYBA 1X4HA 2M9KA 1TFWA 1TUWA 2JZ5A 4CNZA 4ZK7M 4ZMMA 5HSPA 1QDUB 4FVMA 4ZCIA 3TX0A 2E29A 2XMMA 3CF5Q 2A6OA 3MFHA 4OYBA 1RKIA 3Q23A 3BH6B 2F7VA 5DG9A 3A3PB 4HTIA 5LMNF 4XO0A 4X64J 3DRSA 4X4QA 2GJ2A 2KYZA 3SFGA 2DNMA 2W8KA 4PKDB 2X1GA 4EO6A 4C3KA 5BXIA 3H4DA 5JXSA 1REGX 1VQ7S 3BDEA 4ZPCA 3ILLA 2DNRA 3KLEA 2V9WA 2JH3A 4IFYA 5JUMA 3R6GB 4Y6IA 5DZ7A 1KD1T 3C66A 1EX8A 1FJ7A 1B7FA 2OJ3A 2C2NA 3MM6A 3MR2A 2LQBA 7AT1B 5CQGA 2FZCB 5FIIA 2GVZA 2B56A 3MM9B 4WFNQ 3S7RA 3UD4P 4OJ1A 3HSJA 1L3TA 4HVZA 4DUZF 1LQ9A 1S0OA 2F65A 4MFBA 5F8MA 1X4FA 3UD3P 3CW2C 3QIDA 1JNZB 1KLNA 1GTEA 2HNZB 1FFSB 3CB4A 2KYXA 1WJ9A 1CC8A 5HO4A 1VI7A 1RE1B 5H9FK 4NWBA 3RUBL 3H5UA 2EBGA 4LF9F 1B64A 5KFGA 3GIJA 1IKWA 3TWZA 3GFXA 3HSZA 1FJEB 1N0UA 1HNZJ 1NHVA 3UD5A 3GJQB 1EIYB 5I3UB 1R8CA 3I56S 4BLGA 3A8EA 3KYLA 1YZ6A 1IN0A 1F1BB 4B3SJ 1SIWB 2MLZA 2JEIA 4JYAJ 4LRFA 3G86A 1RWPB 2FD2A 1RBAA 2G4BA 1EETB 3HVAA 4LBPA 4GKKJ 2BE7D 3JB9k 1KQSR 1B70B 2IYGA 4IUFA 1W26A 1Z1ZA 3V81A 4ICLA 3D0HE 4H4KA 2Z4PA 5KFVA 5ETQA 2NS1B 5K8OA 2IM1A 1VJQA 5KFFA 5HMYA 2C3OA 1JXLA 2XSJA 2OD6A 3UN3A 2WW4A 3VWSA 1FJGJ 3W62A 3ENWA 4MK7A 3BPSP 2YPYA 1VLYA 1FKPA 4CO0A 4P52A 2QYCA 1JK9B 3TO8A 3AD9C 1HQUA 2DYAA 4NEYA 1AZSA 1H73A 4GRSA 3A4TA 1NH7A 3MPYA 3LWMA 1RA6A 3UE2A 1VC5A 1LK7A 1S1UA 4OJHA 4J9QA 2QLJB 1YBTA 1FVSA 1CVJA 2AKWB 4F2SA 3OW2R 3GIIA 2CQHA 2M5YA 4B3RJ 4DPYA 2BRLA 5HJYA 5B0DA 3DOLA 3TVKA 2FVSA 4YHHF 2EVZA 4BWJA 3T3FA 1TL4A 4DL3A 1SQEA 3OR2B 5HL7Q 2CIMA 4FP9A 1ZETA 2CFXA 4DFJA 4P9SA 4DWIA 1S97A 1RT2B 2QSFA 3MEGB 1G6BA 1D9DA 1RWOB 4MKAA 3C6TB 3KJVB 1RZMA 1LWCB 2AF6A 3MUMP 3LPEA 3GP9A 4LT6A 4C7QA 4ENOA 2UVUA 4Y2MA 2HHTA 2IDLA 2ZKTA 1NUEA 2WOMA 3T6JA 4ZPBA 4DMZA 1X4DA 2NXCA 5THWA 2C2RA 3OXLA 5K8NA 1NNDA 4F2RA 2BMBA 5IWAJ 3BEGB 3H5SA 1CS4A 2FPHX 2GC8A 1FHTA 5EGYA 3QFWA 2HIYA 5DQGA 2E9TA 4C8NA 4FN5A 3OPKA 2KB2A 2YNIA 5E2QA 3MECA 4A8QA 4ED3A 1HYSA 2DPIA 3M9NB 2O1PA 3DXSX 2H5IB 4RO0A 2MQPA 4TNOA 1SPBP 3ZTOA 1FKOA 3N79A 3DDKA 1JLAA 3EYZA 5HP1A 1ZTTA 3O8WA 2HMIB 1KLMA 3GWCA 4RBTA 2E7WA 2XS7A 3CO9A 3R8YA 1AA1B 1DARA 4IOAQ 1QUPA 1EJ7L 4A46A 1TP7A 5AJ3J 1DQ9A 2D9OA 4N5SA 3QZ7A 4GC7A 5BJRA 1VHIA 4RUCA 2Z58B 1ZBTA 1RWXB 3HI9A 6FDRA 5E0OA 2P9GA 2UXBJ 4NYZA 1RBLA 3FUYA 3BO4A 3AY0A 4WFBQ 1LNQA 3K8VA 5AXNA 4KTQA 1M1HA 3HVRA 4N56A 1KSPA 2BX6A 4DR5J 3CMAS 2VODA 1P27B 2KO1A 1UWBB 2XMUA 4U8YA 3JYTA 3CJSA 3IBFB 1D0EA 3NGDA 4FKYA 3W9JA 1RTHB 4M94A 2NXUA 4DV7J 4ZVPB 4ILMA 1NK6A 3WHIA 2DR8A 1RADB 4Y0FA 1TVRA 1QAYA 4ZIVA 2DNQA 3PTWA 3QQCD 1WHVA 4L75A 1HPZA 4B9NA 3QSYB 1XQIA 3MUTP 2XYHB 2EPIA 4DU8A 4TLQA 5ETVA 1WEYA 1OPIA 3G8QA 4Y2AA 3ZZPA 3DGVA 3QZ8A 4KHPJ 2WTFA 2V67A 2CPIA 3I9V9 2LVWA 3MOZA 1VLOA 2CQ3A 2MZTA 3M2VA 4RW6A 4G1QB 4B3TJ 5T41A 1WOOA 4ZHRB 1IR1A 1ZAXA 2CQ2A 2DJWA 4X4SA 4QWCA 3GLJA 3D66A 2OTLS 4HLBA 2R7QA 3F73A 4CIOA 2OSRA 4O4GB 3PW0A 4FXVA 1M5KC 2CJYB 1AW0A 1S1WA 3G82A 2PIIA 2RF2A 1RT3B 1ZOTA 2AX1A 1XR5A 4FYYB 1D9FA 2A2CA 4R25A 4ECRA 3I55S 4OI3A 3KMSA 2KJWA 1MLAA 2UVRA 5KFLA 4YR3A 2ZZMA 1HWUA 3M2UA 4RUHA 2YKMB 3RZAA 1HWIA 2KZZA 4JI0J 3FFIB 5AE1A 3GJRB 3C6UA 1N54B 2PA8D 5BR8F 3VCDA 2OPRA 1U09A 2AU0A 2D69A 3M8PB 1VRUB 1C1CB 4IDKA 1TKXB 1XTZA 3IWLA 1TK8A 3FQKA 4V19J 3CMES 1S76D 2DHSA 1S10A 1UKUA 1U0HB 1TMJA 3QT6A 3RAQA 4EUVA 3MCOA 4DV6J 1HBUA 2E9RX 4KGKA 1N56A 2CJAA 2CG4A 3CDAA 4A8XA 4YN3B 5AE2A 1HKAA 4B9SA 1UVJA 5KFMA 1CSJA 1JMTA 2VG5A 2GIFA 4B9VA 2IBOA 4IG0B 4DFPA 4USJC 2N3LA 4GC6A 1M5PC 1ZA1B 1ZM4A 3T6BA 1ZAWA 1QVFR 5CAAA 1H2VZ 5JVGQ 1DTQB 4WFAQ 1KDNA 2XMWA 2LEBA 2H4WB 3G9CA 3I87A 2E7XA 1TTHB 3CJKB 1S4FA 2AYMA 2ABYA 4J7CA 4OQJA 2R7XA 2B6AB 1NK5A 1T02A 1TKZA 5KG0A 2IIHA 1S7IA 2QT7A 1FK9B 2ZM6J 1NSKL 4JV5J 1N5SA 1LK5A 3KK1A 2FJAB 3LP2A 2HGLA 1RTIA 3DLHA 3W60A 1RHRB 4XAKA 3OXFA 3DI6A 4DR2J 2KTQA 2R8KA 1IR2A 3K58A 3M4XA 4ZCLA 1WC6A 1FFGB 1RJJA 3D2WA 2Y9HA 1OPZA 5HVGA 2NQPA 3AXKA 3GYXB 4OX9F 4DR7F 4Q0BA 3MPVA 2JHEA 4MTPA 3BGRA 2MKIA 1BLUA 2OAUA 3E3XA 4EGLA 3KXDA 3H59A 2B9WA 3D1QA 5LM7E 5D3GB 3P45B 2WONB 2HHQA 1T9UA 2OUGA 3S01A 5LL6d 5F3TA 3AODA 3IRWP 4DV1F 1X60A 5ETOA 2VQFJ 4P74A 3EGVA 2J0XA 1U6BA 2SXLA 1VRTA 2XZDB 2PI5A 1XNQF 3U1MA 5AXLA 3O2IA 5I42B 2AP6A 3CJTA 2LA4A 3P96A 1GFWB 4UTGA 3MR7A 5MLCV 3ZZUA 1GXUA 4F02A 2DH9A 2Z2LA 2AZ3A 3OFHA 1RHMB 1PYSB 3EZUA 5FLXU 1VCTA 2OI2A 2EEYA 5A2QY 4IRDA 1LWEA 2F4VF 5LT5A 4DHVA 2BRKA 4KGZB 4NCBA 2HHVA 1U1KA 1TKTB 3VZHA 3BN7A 3RJMB 1ZPWX 2G1HA 5U47A 1KTQA 5DG7A 3ICLA 3CCJS 2YPZA 1WHWA 2HS4A 2G0IA 2DXDA 2BZ2A 3AB4B 4DR1F 3IA0A 3R9LA 3QGIA 3DGPB 4PCQA 4YB7A 2YKNB 1Y4ZB 4ELVA 4DCJB 4P71A 4AYBD 3JSRA 5CZXA 3R5JB 4QR2A 2DIUA 3T1HF 2P5VA 1S6PA 1U48A 5HJXA 4ED8A 3I32A 5A8WA 5HLFB 1WKKA 4FXWA 1Q5YA 2XMTA 2UUAJ 1N34F 1IKVB 3F56A 4IFVA 4DPUA 4K2XA 1VQPS 2BE2B 1H2TZ 1WKJA 3KKFA 4ZVHA 3QAEA 2E1PA 3A8JA 5L46A 3FQLA 4LBIA 1HI0P 1RT6B 4OI0A 1RWUA 4CP5A 2MJNA 1OIAA 3DLBA 1UJ6A 3V4MA 3OL9A 2QA4S 1VQMS 2ROPA 2KVQE 3Q8YA 2HBYB 4XDDA 5D15A 1Q1KA 4ETZA 2CRLA 2GMJA 2CZVC 1DTTB 4JUZA 1TR0A 1P8GA 3MEDA 2O3DA 3AJDA 4PG5A 3M32B 3CD7A 2QEXS 4KPCA 2WBMA 1PSDA 4HL9A 2C1EB 2J7WA 2PGCA 4EYIB 4ZCKA 5GMDA 3TJAA 2ZOFA 1BQMA 3HVWA 4N8OA 4PXDA 1TQLA 3ADAC 3FMWA 5CABA 1B0VA 2ADCA 2DGUA 1PJ5A 2ACYA 3GILA 4DUYF 1WI8A 2N4CA 3POTA 5GMEA 3OTDA 3EGNA 3H90A 1SC6A 4JBCA 5KFPA 3I5AA 5SZTA 2APOA 4R5PA 2ZH8A 5EN1A 3UCZP 1URRA 1XNRF 1HNVB 3H2VE 4A48A 3W5YA 4I67A 1K8AT 4FNIA 2KFNA 3KG1A 3OL6A 1GEHA 1UFLA 2M0GB 1FD8A 4RBVA 1RT7B 2QMWA 3LWLA 3HZEA 4G1PA 4ZKAA 3J7AN 3I0SA 2XC9A 2RQMA 3CCES 2LKZA 4M5JA 4I2PA 2R7SA 4KFBB 3CJRA 1Y10A 3KLHA 2FYXA 2QL7B 1FJCA 1EARA 2LECA 2FVPA 2WVFA 2PSZA 2CPEA 2YX7A 1R8HA 2I0XA 4RW9B 4HACB 2UXCJ 4QYRA 4ZJQA 2G0CA 1XMOF 4KGXB 3RAMA 3QSIA 2RNEA 4HH1A 3L7PA 1JLEB 3G6ES 5DJBA 2UXDJ 2ROGA 4P2XA 4UQTA 2V6AA 1RABB 1EAYC 2HNDA 3KHGA 2CJ9A 2LFVA 3QWUA 5KG1A 4KO0B 2VPYB 1L5UA 2GQCA 3DMJB 1FFWB 3OSNA 3W7BA 1WOPA 1R0BG 4WFXA 3GCXP 1J5OA 5IT9Y 1H74A 1TL5A 1X9MA 1R43A 2PT0A 1T03B 2XTJP 3LPYA 4DV0F 3CPWR 5FDLB 2R2RA 5IT9U 3Q8QB 4WJBA 4W92B 2IVMA 1U45A 5IQQA 5DGAA 1O6XA 1GH8A 4EO8A 4MYUA 2AEFA 2BM0A 3OFGA 2P9EA 1IKWB 4QIWD 5EDWA 3P49B 5L1LA 2ZKUA 1NJIT 4WP3A 2C2EA 2WSFC 4KBIA 4LFBF 3ZZ0A 4ID5A 4JB8B 3I5CA 3ILOA 4C8YA 1WEXA 3GV5B 2VFVA 2VG6B 5J2QB 1TUGB 1PG5B 2DD8S 3G2XA 4CRJA 1XR6A 4F4XA 3DLGA 2OLWA 3BN4A 1DBDA 9RUBA 3LGMA 1JLQA 2DNPA 3NS6A 1RBOB 4WP8A 4CH7A 3T1YF 2WSCC 5ETTA 5DDQC 4DLEA 2X1FA 3V81B 3MF5A 5KT7A 2DNHA 2GGPA 3EDRB 1RT1A 2AEJA 3BGOP 2X1BA 3V6HA 3MM8B 2YWWA 2ROEA 3DHWC 2M2BA 1SV5A 3VAFA 3DLLQ 3S8SA 2DNOA 1V3ZA 4UOCA 2FY8A 1FRKA 2DNKA 4I2QB 2CXEA 4KSEB 3PX0A 2WBRA 3DHXA 4QOTA 4B08A 3PRBA 1Z2LA 5E3PA 3NCRA 5A6PA 5B0FA 2W9BB 2CQ0A 3JSBA 1WTBA 5GMKa 5C2CA 2HS3A 1NKCA 2HHSA 5C25A 4ECSA 1AUSL 1CJUA 5E3AA 3DRXA 4KHRA 1LW2B 5D6GA 4ZCMA 1RAIB 3MR5A 4ECUA 4P73A 2DHAA 1N33J 3CT9A 3FCHA 3ZZRA 2RJZA 4RZRA 4ALZA 1FKAF 1IQZA 2VDHA 2KJVA 3VVUA 3L3CA 2MZQA 2HQGA 4DSFA 3JQKA 1KN6A 5A8RA 1DHMA 4LR7A 4GVLA 4QIFA 4E0DA 5L1JA 2H54B 3HD1A 4YEAA 3A3OB 2KU7A 4X65F 1S6QA 2B8PA 1FNXH 2KN4A 4Y28C 3T1AA 3MI7X 3TUZC 3O44A 2HPUA 3PZPA 4CO3A 5ETRA 2HNYB 1H6KX 2RUSA 4ED7A 4AUKA 1KVIA 4WP9A 2OMOA 3GSIA 4ILRA 1C4CA 1SI9A 4CTAA 4F3OA 2CDQA 4CLSA 1GMVA 1S6OA 1CJTA 3IR7B 2XMJA 2VFUA 2V34A 1TL1A 1IBKF 2W4PA 3RB0A 1M5OC 4DV4F 4TVAB 4ELTA 2IAJB 2BQRA 3IRXA 5KG2A 1PO6A 4L73A 3A8KA 2HW3A 4TU8A 1IKXA 2NUHA 3RTVA 3MECB 1YRTA 3VGUA 4KH1B 2HG4A 3Q22A 2AYEA 4TYBA 2R7TA 5GAHI 2XS5A 2PMWA 1TL3A 4DPTA 4NRUA 2QFIA 4NXNJ 2HFVA 4WXOA 2HBZB 1YK9A 5IM0A 4H4MB 2W2PP 4UUWA 3KJQB 1MW7A 3MR3A 4F4AA 1KFSA 4BDPA 5KFZA 3HHLB 3HZGA 1QE1B 2DCUB 2JL9A 4B9UA 2L3MA 3G6VA 3MFIA 1S49A 3KUGA 1RTDA 2GX8A 2B8QA 1DY3A 2JEJA 1RAJA 5M2RA 2DRBA 1HR0J 3CEDA 3LP1A 3VAMA 5KFYA 4Y65A 3GR0A 2R4FA 4K5SA 3CCRS 1V3RA 4ZN3A 1ROFA 2POKA 1DJ0A 2ASDA 4IRKA 4K7QA 4N77A 5KFNA 1MNEA 5DQIA 4QWBA 3JYTB 2AIRB 3R1LA 2AEMA 2DR7A 3TRGA 2N3OA 4EBEA 1GXTA 2I8EA 4OZ3A 4LFCF 2F8HA 1SUQB 1C0TA 4JI4F 1CJKA 2C22A 2LLZA 3KG4A 1WG5A 5KG6A 2GQ2A 2R8JA 3HT3A 3EJMA 2IRUA 2VFTA 4M5MA 4HH0A 3OUYB 2DXFA 3E51A 4QW9A 3MMBA 3KJFB 2OPPB 3OHBA 2N82B 2DGOA 2YWEA 4M5GA 4QR0A 4ZLJA 4DV2J 3C14A 3MAHA 4ES2A 2J6UA 3CSKA 2HVZA 2ZBPA 2VBXA 5D4NA 2DHGA 4Z7CA 4K4TA 3QLHA 4ZVGA 5CYQA 4ZP7A 2CWXA 4K8RA 3MEEB 5T7LB 1S48A 2J0QD 2YNHA 1Y00A 1WC5A 3MMCB 2EW9A 4QYZK 2QLFB 3R5BA 4URGA 3HFVA 1GQEA 1VQOS 2XZWA 1HHQA 2JVOA 2FY1A 2RKIB 1WTFA 1F9HA 5AXMA 4I1TA 4PQUA 2H5JB 4OYIA 3CIMA 5C24B 1CQMA 1T7PA 2DRAA 1YJNS 2D7SA 1Q81T 4NMXA 4GO5X 1SL1A 1R8AA 2FLLA 1K44A 2WB4A 4NLRA 2DK2A 4I64A 2DGQA 4RW7B 2CJXB 4UZCA 2Q6CA 4DF8A 3T5LA 4ZPWR 3NAIA 2BW7A 1JLFB 4DX6A 2HWHA 4DN0A 1F2GA 3N5BA 3NGRA 3DYAA 4GMKA 2J9DE 1C1BB 9ATCB 3ISNC 4J5OA 3B6BA 2EC2A 2KKHA 4QWDA 3CNQP 2VKRA 1X4CA 1RTZA 1NDLA 4ZVEA 3BKUA 5HATA 4QZVB 3CE8A 1SKSA 4YB1P 1HBNB 3T41A 2AMCB 2UUCJ 2ZBCA 4CNYA 2KRBA 2DVIA 1NJYA 5AXKA 3TZZA 4WF9Q 1RT5A 1H2UX 4I6WA 4NXMJ 1D3WA 1QLNA 1P1TA 3E8OA 3MM9A 1HNZF 2XB2D 2E9ZA 2RS8A 3FEXB 2Q66A 2KL8A 3RU0A 3HHLC 5CHCB 5G4DA 1RK8A 1TKZB 1IBLJ 3PEJA 2E1CA 4XIUA 4HDGA 4K50A 3OTOJ 2DXEA 2FJBB 3GIKA 4NA1A 2HNZA 2MEWA 4AE5A 4ZVFA 2W4DA 1F3VA 1APSA 5ETPA 1SC4B 4GKKF 1S0VA 3Q83A 4RJVA 2KFZA 3AFGA 5ETKA 2D41A 1JLCB 2VJVA 4ECWA 5F8IA 2UV8A 4TXSA 5KG7A 3UWTA 5I3UA 3C3LA 2Y8YA 4YFUA 1NLKL 3PYGA 3M7VA 2XO7A 3HO1A 3PM9A 4NLWA 4ZP6A 4KKOB 4QWAA 4Y2CA 4M5NA 1N48A 4ZIWA 5A8KB 2H48B 2M88A 3RR7A 2AGQA 1SKWA 4PABA 4F4ZA 1EETA 1BXNA 5L39A 5B08A 2B51A 3LGHA 3F44A 2R2SA 2YWGA 3ZZTA 3GFZA 3N6NA 3U7JA 3C15A 3GYGA 3TZXA 4C0HA 5GADI 4FZVA 4H4OB 3C19A 3EZ5A 3QJJA 2MMYA 2DY1A 2HRTA 5KFXA 2NXNA 2E5LJ 3PACA 2V69A 5DDRC 4K4SA 2PE8A 4F8RA 3D28A 4J9VA 2EG1A 2C3PA 4U9RA 5J2PB 1SJ1A 1FE0A 4OX6A 2HHXA 4C11A 2ILYA 2YWFA 2V8HA 4NX9A 3L09A 1S9GB 1OYDA 4DSEA 2QYGA 2VPWB 2LU2A 4P2SA 2XNRA 1YZ7A 3KUHA 3W5ZA 2A2DA 2BJ7A 4Y00A 3I0RB 3JSMB 5A8WB 3LO3A 1UVIA 3OR1B 2QL9B 1IJFB 4JI7F 2C28A 2BOPA 2EWHA 2VQEF 5CA5A 4NZ6A 3UNYA 1QTMA 3OR2A 3M8RA 4OLPA 4WTYA 2Z30B 3IC1A 1S7HA 1VRQC 1L3SA 1RT2A 3MEGA 3HHEA 2GMHA 4DLGA 2HZAA 2RQKA 1U02A 3C6TA 1LWCA 1RACB 2HFZA 1FX4A 5ITHA 2MQ8A 3TJ9A 3BGLA 2V8PA 3A1YG 3T5KA 2V0NA 3SCLE 1FA0A 1FNOA 5LSRA 1NSAA 3ZTRA 4LF5J 3FBFA 2ZNYA 2UUWA 2LCWA 3MD1A 3HKWA 2C2MB 1KFDA 1CJVB 3HJVA 4ZVOB 3THVA 4F67A 3OLBA 5LOQA 4GKJF 5F0UA 3ITHB 3CCQS 1H72C 4OYMA 2DO0A 2P2CB 1RGVA 1NHKL 2ZJRQ 5AJ3F 3J7Z5 1QM9A 3CJ0A 1BQMB 2M3DA 1NEEA 2MSSA 2CJKA 2RMLA 2QIFA 4B02A 3Q0AA 2V4JB 2VV5A 2OHDA 4KT0C 2PFDA 3FSYA 3Q8UA 1J5EJ 4DQSA 3CJ4A 5FJ4A 1TK0A 4IQXA 2HMIA 3GU0A 2HWIA 2LQJA 2HQ3A 3LP0B 1RAAB 3FBEA 4CH1A 2ZH9A 4U96A 2NUUG 3HJFA 3DU5A 1W2IA 4LRCA 2GNKA 1OY9A 2ZC3A 5KFEA 3HVTB 3M6XA 4Q8EA 1IBCB 3QPIA 3MCMA 5GAHU 1N36J 3R7SB 2YH0A 4KIAA 2GA7A 4USHA 3HMJG 4X4RA 3M2RB 5F3ZA 2OSQA 3SCIE 1ZZFA 1KQFB 2ZOMA 1LXNA 2ATLA 3TZWA 2HBQB 1C0UB 3UO0A 2QGFB 4Y2KA 3R6LB 3GPAA 4WU3A 4CLLA 4RNNA 1LW0B 1YQHA 5G0RB 5SUHA 3LGNA 2WRMA 4B3MJ 2BW2A 4KHPF 5K20B 1UWBA 1S9FA 4UY85 5KFJA 2GHWA 1H7XA 4R8UB 1NPPA 4A8FA 1U6FA 4DU7A 3QO9B 1A0OB 2V5HG 2M8HA 2R42A 2JSXA 3Q24A 1HNIB 3FVYA 4A47A 5H9EK 3IAM9 4RW4B 2HVHA 1H98A 1U1MA 1NO8A 2W1BA 1UTAA 2MQNA 1UA0A 2OEJA 2ZUGA 4QPXA 1CULB 5LMNJ 3W66A 1SXLA 2NPFA 4Y3CA 3RBXA 1FEEA 4JI0F 3GG0A 1HW9A 4M8LA 2YXLA 1IJEB 3DLEB 2Y1JA 4G1QA 2VBYA 4ZHRA 2JRSA 2PMHA 3RW7A 4P2MA 2RE1A 3K7RA 3TJ8A 5EX3A 3KTQA 2QLXA 2QMXA 2VA3A 2KT5A 2BJ8A 2EBEA 2PC6A 4O4GA 2HYIB 2IHR1 1VQNS 2CPXA 2YQ1A 3G8SA 1OSDA 1RT3A 2WSEC 1HNWJ 2AYGA 2D74B 2XO6A 4DBQA 3M1VB 5DG8A 4WZMA 4DUZJ 3DLGB 1Y5LB 1T05B 3EE3A 4HDHA 1YKWA 2YKMA 2IPOB 3FFIA 1P9QC 1OY6A 2VG7A 1WF2A 1VIOA 1VISA 2BYCA 2YWKA 2MLXA 5C42B 3Q8RB 1A6LA 1F5BA 5HBMA 1TAQA 2J8SA 1KEKA 3M8PA 4BWMA 2B0GA 1CBKA 5L38A 1VRUA 1C1CA 1TKXA 3ENQA 2YQ0A 3CCWA 1OMSA 1VQKS 2ZH2A 2I5JB 5KFIA 1FWKA 1G3OA 3KK3B 1U0HA 3BH7B 1NK8A 3MCSA 4F4KA 1XK8A 2WB1D 2CPZA 2ZM6F 4JV5F 2BA9A 3TOQA 5LSLA 3R5CA 2HFNA 5D4LA 1LV5A 5C25B 5LXRA 4IG3B 1REVB 1KC8T 1CJUB 4IG0A 3ZNJ1 3PR4A 4DR3F 4C6AA 1HQ2A 3DOMB 1Z4UA 3K5NA 2DIVA 2FUG9 1DTQA 3UN2A 2FQQB 2FZKB 3GMGA 4OI2A 4PG7A 3CJKA 2V63A 3RBZA 2OPSA 5E3RA 2B6AA 1SVDA 4O3QA 1HWJA 2ZD1B 1FK9A 3PKMA 2VQFF 2BKPA 2OIHA 3J7A1 3TQ1A 2GAHC 5B0GA 1XMQJ 2F8EX 3TEGA 2VPZB 3P6YC 3NGTA 4DJBA 2PO4A 2DRDA 2ZJPQ 1S9EA 4K4YA 2IJNA 2ZOGA 1JLBA 3CCUS 4FBTA 2IM3A 4CT9A 5HVHA 2VFRA 2BVZA 4TQRA 4K59A 2FJDB 5D3GA 2WONA 3MAQA 4OLOA 1ULRA 1MMNA 1K1SA 3TEHB 2EKYA 3HX9A 4OZ5A 4LSLB 3VAHA 1SC3B 2V2QA 4QCLA 2MKHA 4H54A 5DRKA 4J9RA 1BD6A 1LXJA 2CWKA 3QRPA 3A8IA 5I42A 3TANA 5KFTA 3D3CJ 2V8VA 1R27B 1W25A 5IM0B 4O23A 2C2DA 3PG9A 4PWUA 2HIQA 3LALA 3PX6A 3DOKB 1S6UA 4KE5A 3KUEA 2BJ1A 2XCPA 4J9MA 1Q8LA 4C48A 1XWLA 1IR0A 3CJ3A 4YY3F 3PO4A 1U2RA 5EUHA 3K0JA 3TZYA 1HA1A 1NB2A 1IUJA 3FRZA 1O0PA 5GADU 3DGPA 1QY7A 1R6YA 4ZVSB 2B9YA 1Q16B 2R7OA 2HAIA 1NKEA 3Q8VA 1TKDA 3IM9A 4F0MA 4DSJA 5KFAA 3AA9A 4EBDA 5HLFA 2V8GA 2ZBQA 1RTJB 1U1PA 3G96A 1IKVA 4YP3A 3TAQA 3ZFVA 2BE2A 4UOFA 1FWLA 4ED6A 4ERDA 2XYPB 4G65A 2FHJA 3UFCX 4CM0A 1Q5VA 1RT6A 1K47A 4ZOSA 1S1XB 3OTBA 1BGXT 1CQNA 5HAOA 2L9WA 2HLUA 5I3PA 4FDFA 4NLQA 2XM3A 4BBYA 2RT3A 2ZE2B 2CPYA 1HD1A 4LIWA 1T8EA 4UF4A 2XS2A 2FHJD 1DTTA 1ZH5A 3N6LA 1FRMA 1V3SA 4I4BA 1FERA 4IH5A 2ZH7A 4WFZA 1K0TA 4JI2F 4P72A 3M32A 3OQ2A 1O8BA 4CLPA 3DRRB 1ICEB 1TFYA 4A4JA 2FZGB 2QRRA 2QA1A 2VJUA 1KRPA 2RIJA 2K2PA 1U24A 4I7FB 4PQUB 2BABA 2R7UA 2QMUB 3JSYA 2AQ4A 2F8MA 3W65A 5GAEI 3MTJA 3ELHA 5IQ6A 1Q7YT 4IQMA 1OY8A 2J5AA 2COLA 3MM7B 4WXWA 2YKAA 4WKYA 2V2ZA 3D7SB 1XR7A 1HNVA 3IS9B 2ZBRA 3W2WA 5KOXA 1T3OA 3ETMA 2E5GA 3EXCX 4EZ9A 3K5OA 3UDLA 4EYHB 1FD2A 3QWPA 1S5ZA 2W01A 1RT7A 4EEYA 4TQSA 3DYAB 2RD5C 3A3NB 4N7TA 4CQ1A 5HANA 4LSZB 2CNNB 4KFBA 5DO2A 1U47A 4U6PA 8RUCA 3DRPB 2GFFA 2R9LA 1YWXA 5KFOA 2IA0A 4QIGA 4CO1A 4RW9A 2KT3A 4HACA 2CJQA 2XYGB 3NWGA 1JLEA 1YJWS 1RT5B 1S59A 1JKHB 1NSQA 3JTNA 4IR1A 4KJIA 2W4CA 1GAOA 2XSFA 5BR8J 4LRDA 4I0WA 5LMUF 1SH2A 1NZAA 3PVXA 4CYUB 4CZCA 4C97A 4KO0A 5F41A 3DMJA 2CQDA 1WG1A 2J0SD 2XMVA 5RUBA 1SQFA 4ECYA 1URNA 2P8IA 1RCOB 3BR9A 1T03A 1VK8A 5FDLA 3LOUA 2DH8A 4UOHA 4RW8B 3KWMA 1RHKB 4USIA 1UETA 2I1RA 2H51B 2X1AA 3QGPA 4F7VA 1VOMA 2ALYB 2EFGA 5JJBA 4MH8A 1YJ7A 3RGIA 2UV8G 2P6SA 2BQUA 1YSJA 2VG6A 4HHJA 5J2QA 3OXGA 1I3OB 1EHWA 4U8VA 1ZM2A 4N47A 3DNCA 4NEZA 1RQ0A 1EZZB 2K8GA 2XZTB 4OV6A 3CDEA 5F8NA 1WC3A 1WHXA 2G2OA 2X7IA 4MIWA 2ZC4A 3C15B 3JQMA 1NPRA 2YKOA 4Q43A 2MXYA 2EI5A 2ZHBA 2EFPA 3MM8A 1MN7A 1WF1A 5K9FA 3PJ9A 1F3FA 2VFSA 3UR3C 2B9EA 1RAEB 1EP4B 4UOGA 2Y0SD 4PYAA 2RQCA 4I2QA 2VICA 1NJXA 4OX9J 4DR7J 2HK2A 3S1TA 4B3OB 1Y9OA 3J81Y 4LSNB 4K4ZA 3UDEA 1QTNB 4FVCA 4GO7X 1R6VA 3PRDA 2W9BA 4OHYA 3J81U 5JMNA 3AXMA 3BBFA 3ZXWA 1VQ8S 1VS3A 3ISZA 4C11B 1YJTA 2CPHA 3QRRA 2QC3A 4TLRA 1SKUB 2MY8A 3IR6B 1LW2A 2U2FA 4FBUA 2ZITA 3K57A 1BE4A 3N28A 1YRXA 3PHEA 3PJWA 1X31C 2DBBA 5IV3A 3PNIA 1Y5IB 4RU9A 3ET6B 4PG4A 3VQTA 5CCMA 2LMIA 4X66J 4BC7A 2VZ9A 3R2DJ 3B4DA 4NYPA 3K89A 5AE3A 2UU9J 4LF1A 3H20A 2F4VJ 5A6WA 2BJEA 1OQ3A 1D8ZA 2A0FB 3GTYX 1E6YB 4KQZA 2YX1A 1Y0HA 2RHSB 1VIXA 2MHNA 2HNYA 1IM6A 4QBUA 2F5GA 1WNEA 2GHVC 4DR1J 2UZAA 4OI1A 2L48A 3VGSA 3C2PA 5DDPC 4QPTA 5CYMB 2IVFB 4ECZA 2A18A 2K7JA 3E01A 3SZ2A 3T1HJ 4X2BA 2OPQB 1GX5A 2EFQA 4TYAA 2FHMA 4NZ0A 4JOUA 2IAJA 2KH9A 3NL0A 4WK1A 3AHPA 3VGTA 3PIPQ 1UEVA 1NJWA 4K2JA 3DXBA 3AOBA 4F0HA 1X4GA 2R3VA 5CD4H 2ASLA 2Y1RI 4KV8B 3W61A 1R7IA 2EK6A 2HQCA 3UN5A 2CQPA 4LF6F 3ISND 1OSCA 1IBMJ 5KT5A 1YJ9S 3C16B 4RR5A 3X3UA 4AQYF 3NS5A 3JQJA 1MSWD 5LJ5Y 3EZOA 3BYRA 4H4MA 4R0EA 3P5BP 4NI2A 5J1EB 2N4DA 4RPFA 5K5MA 2FGOA 3GONA 3HHLA 5C2GA 1YJUA 1QE1A 1BHNA 4X62F 4OJ3A 5J2NB 3EXYA 3ZTQA 1WACA 1ITPA 2W2QP 3NNHA 2HVIA 3BGUA 1VQ9S 1CLFA 4C2MA 3KLIB 2MLYA 3V4IB 1U1NA 4DL4A 3W3SA 3FC9A 3HHLD 4MK8A 4DV2F 2Z2ZA 1IKYB 2ZWPA 4M5DA 1XN9A 3MTKA 2HS0A 3DFEA 1S57A 4DUYJ 2CNKB 3SDEB 4J9SA 3WBZA 5EWFA 3MXHP 1SUQA 3P5TL 2O01C 4LF4F 3D9BA 3NY0A 4DFMA 3UCUP 1G7CB 4DDFA 3BQ0A 4D3HA 1PBUA 1XNRJ 3OUYA 4IH6A 2QA2A 2W7OA 1Q95G 5HMXA 3GV7B 3CCLS 2NXEA 2OPPA 2NZ4A 1LKZA 2RHQB 3GIMA 1R8PA 3BB5A 1CC7A 1PCAA 4ED4A 2X3GA 4O0NA 3UDVA 3TAMB 2QO3A 4NYOA 3HPOA 5D0HA 1YLXA 4WYLA 2RUGA 4HT5A 4YB5A 1LWFB 4DXLA 4ZA1A 5E41A 1V9OA 1P9YA 2DR6A 2L9DA 3MEEA 2D1CA 4L3KA 5D0RA 5T7LA 4Q8FA 3W2VB 4YQWA 5C5JA 1IQTA 1HBOB 1SBRA 5GVQA 1FNMA 4L72B 4RNHA 4DS4A 3MMCA 2I6WA 4U7CA 4RWWA 2MGZB 2UUTA 2RKIA 4CI0B 2FJWA 4LFAJ 2XG8A 3I4PA 2ZWOA 3IR5B 1CPZA 5C24A 4DV5F 1I6JA 2VG7B 4V19X 1FX2A 4Z7YA 3H0PA 3P4UB 4WFYA 4DV0J 2G9OA 4RW7A 1XC9A 2HSEB 5HBMB 1VQ6S 1I94F 4PYDA 2ATCB 3FBBA 1JLFA 3QRQA 1XBWA 3BM7A 2NSCA 1D09B 1NU4A 1Q82T 1ZYQA 7FD1A 2WVDA 4CM2A 2IC3B 4XPEA 4ES1A 1C1BA 4OHWA 2B43A 3KHHA 5CD4A 1HI1A 4A8YA 3VZIA 4FS2A 3N4WA 4ITSA 4LFBJ 4DG1A 3R5AA 1S1TA 4WE1B 1PC4A 3OTOF 3GB0A 4M5HA 4P75A 1HBNA 1QJHA 4ZVUB 4DX8H 1UWAA 4LRAA 4RNMA 3Q8PB 1PC5A 1RWKB 3CJ8A 1JX4A 1RWWB 3VR1A 3QAUA 4PWDB 2DGSA 5IOLA 7FDRA 2GJFA 3AQOA 3PFEA 4PUOB 2KT2A 3B4MA 3GR1A 5KFUA 4K0KJ 2V2VA 2QN6B 1XERA 4MKYA 3W9HA 1QVGR 2OPSB 3K5MA 3BKTA 1Z2ZA 3KDOA 2HZCA 3FDSA 1F60B 4PXBA 3EVMA 3I4HX 3AJ1A 3NBPB 2EFOA 5J2MB 1FXRA 2EFVA 1T9WA 3KJNB 1T0TV 5DETA 5IZHA 3CUNA 1SL0A 2N7CA 3L9ZA 3PFOA 3NMRA 3EM1A 3PW7A 1JLCA 5K14A 4USWA 2D3UA 1NKBA 1RYRA 3B8HA 2R7VA 1QSSA 4NLPA 3FNNA 4JI8F 1S9EB 1RU2A 1UW9A 2O66A 5KFHA 2G0JA 1JLBB 2CDRB 1AB8A 4KKOA 3D3BJ 3IXQA 1YIJS 3A13A 2EG2A 2E5LF 5HQLA 4PWWA 5A8KA 3PEHA 4F4WA 2BACA 4YDDB 4JV2A 5IC6B 3ENVA 4RU2A 3PY8A 1RHQB 3BS9A 1WDDA 4M5IA 1ACMB 1BQNB 3JXOA 3R7NB 4C4WA 4IO9Q 5FLXY 4ER8A 2LA6A 3MPWA 3QT5A 3PIOQ 4H4OA 1L3VA 3IAS9 3GG1A 1NB7A 5IXUA 3IMQJ 3K5PA 4YMEA 3CCSS 3BYPA 2MKCA 3VHQA 3MMJA 3SCJE 1IBKJ 3EWGA 2NLWA 5J2PA 3TA0A 4DV4J 4L3NA 1NK9A 1MU2A 3WX8A 2RS2A 1KVJA 2XGPA 2CNLB 4HT7A 1S9GA 1I5OB 1S1VA 4DR4F 1JJ2R 4UQGA 3RB4A 3EICA 2LP4A 2EKNA 2IYIA 4A8KA 3MHYA 3FZBA 1VQ4S 2QTWA 3R5GA 3SV3A 3I0RA 2NCKL 1YDLA 3JSMA 4X84A 1FVQA 3OR1A 1VBKA 1X7VA 4NLUA 2G2YA 4OL8A 4RNOA 1WC1A 3BGFA 1H38A 4MIAA 4UUXA 2GV1A 3ZO7A 2Z2MA 1B99A 3BDPA 1DQ8A 3ILIA 5L1IA 2JFKA 2XWXA 4X4TA 2HFOA 1DLOB 1FE4A 3RRHA 2QLWA 4UZBA 4GVBB 4KGMA 2AJ4A 2IM0A 2RQ4A 2B7BB 3UPFA 3WDOA 1KNZA 3IBCB 1TK5A 2Q43A 2KXNB 2PDAA 4LF8J 2ZFHA 1OO0B 2H4YB 2HGNA 3FCVA 3J81j 1UZHA 1TMMA 4TY8B 4ZVQB 3B54A 4HHUA 2QA4G 2LEPA 2MQMA 1CJVA 1D1UA 2L41A 1FDAA 3SQOP 2IMOA 2QZ8A 3VAJA 3ITHA 1FDNA 1F0XA 3JTOA 4JI4J 1T9VA 2G2ZA 3MUVP 3V6DA 2RVJA 2HBRB 4ED1A 1IVZA 2V4JA 3PW5A 2IM2A 4N41A 1WG4A 3M8SA 3G6YA 4ES3A 1X5TA 5KT2A 1GT8A 2DNGA 2X51A 2OO4A 1BQXA 2GO8A 3G4SS 2WVBA 1PILA 4B3MF 3MCNA 2QG9B 4ECVA 2OGUA 3RRGA 5FD1A 3CCTA 3LP0A 3SI8A 4DPOA 2QE5A 1RAOA 3T5HA 1FRJA 3NCPA 4MJKA 2AJ1A 1N4LA 1ZM9A 3W2WB 4FPRA 2LQ5A 3HSGA 2WVCA 3HVTA 2FIUA 2DEJA 1MROB 4J9KA 2AGOA 2JLFA 4OMFG 1QAXA 3M2RA 2DITA 4JP8A 4KR0B 5B7WA 4USVA 3NOGA 2W2MP 3O1LA 4PAAA 1X0FA 1C0UA 4XK8C 1NPKA 1HBMB 1LW0A 3SQGB 5G0RA 4QJVA 1E6VB 2J6TA 4MKBA 4CO4A 2E1MC 5DM7Q 2Q1LA 3TA1A 1X4EA 3LF0A 2VONA 3MEKA 2ADBA 4IOBA 4OZ2A 4R8UA 2VD3A 2J9CA 2GVDA 2HHHJ 2VU5A 3JAMY 2YVSA 3RAXA 3E2EA 3QO9A 4ZP9A 1TL7B 2RRAA 4FF4A 3JAMU 2CQIA 1HNIA 2MHEA 3PV8A 2LXIA 2RDIA 2CUYA 1F5CA 2WAQD 1RT4B 4J9NA 1HNWF 2HFUA 4RW4A 3EGZA 1HL6A 3AOAA 4AT1B 1CULA 3PCOB 4F0KA 1JNRB 3EUNA 5IT0A 3NNAA 3CDUA 2C3MA 1J27A 3DLEA 2CVIA 4PXEA 4CH0S 2ZBIA 1VR6A 2OEKA 4DSLA 3KLGA 2ZUAA 4ED0A 1FRIA 3M8QB 1BWEA 5D0GA 3IWNC 3K17A 3BPDA 3N9UC 3DLKB 4KC5A 3CVKA 3TARA 3M30B 3AD8C 2CADA 3M1VA 5H1SV 3PW4A 2MZRA 3HHDA 3NGUA 3SBMA 3D1OA 1Y3KA 1FT8A 4C98A 4JI1J 4DX7A 2WZ1A 5DQHA 1T05A 3L7OA 5A0YB 2OFHX 1U49A 2KVIA 3FKBA 4LIRA 5C42A 1RDRA 4ECXA 5H9FJ 3GIRA 1WSVA 2MYFA 3H7HB 1UEUA 4QU7A 1HI8A 3Q86A 1VK3A 1N32J 4I69A 4NMLA 4NLTA 3VAGA 4W98A 5MAOA 3M05A 2DHXA 3J7YI 4KB7A 4DN9A 3NNCA 2I5JA 3D67A 3VALA 5HI7A 1HNXF 5I3QA 3KK3A 4FYVB 3NS7B 4DR6F 3KHLA 4Z37A 3LANA 4NLSA 3CJ2A 3TX8A 3L4BC 2XLIA 4IG3A 1REVA 1GMUA 3FK4A 2NR0A 2XI2A 2YNGB 2RDJA 3DOMA 5M2PA 3MURP 2GO9A 1XMQF 2DGVA 3IWXA 5EWEA 4F3MA 3CGIA 4PEOA 4XDCA 4DSIA 4QIVA 1N6QB 3L95X 2K1RA 3K2YA 3PXGa 1R0AA 2KHDA 3OJUA 2ZJQQ 3SSRA 2BBEA 1L3KA 3W8GA 3KK2A 3CWJA 3BO3A 5ETLA 2RU3A 4CO2A 1SIZA 2ZD1A 4C8ZA 1D8YA 1HQEB 2RH3A 1C2PA 4IYQA 1BC6A 5GAGI 4HTJA 4AFFA 1Y5NB 1HIYA 4G1IA 4Q45A 2CJBA 3DC2A 2VA2A 4CLKA 4ZITA 3EPIA 1FO1A 2BDPA 3B78A 1XEZA 2FC9A 5L9NA 4OFZA 2RAQA 4BHQA 3M9OB 2XCAA 3E01B 4OX7A 4ZDNA 1FDBA 2H5EA 4DV3J 4FYDA 4ZLPA 4K4WA 3ZTSA 3L7UA 3FMBA 2JNJA 2JFDA 2M7SA 3OHAA 4G3IA 1WSRA 2D3OR 1NDKA 3MGJA 1UW4A 3OD2A 3FEZA 2CKWA 4LSLA 4JI7J 2LQ8A 2ZH3A 2IMWP 2HLTA 2VQEJ 2JJ4D 2VBZA 4Y2IA 4X4NA 2K06A 1GK8A 2JVRA 1M90T 1DRZA 1KQGB 1S72S 5J1PA 4ATNA 2NREA 1RU1A 3FBCA 2K3KA 5HROB 3ENAA 4JV1A 1HWLA 2JWNA 4Q2MA 3M8YA 2P6TA 1QSLA 5KAKA 4NI2B 1V6HA 2MKYA 3DOKA 1MMDA 1Y11A 2HZVA 2OEMA 2W8LA 4FYXB 3SSSA 4TN2A 2O67A 2CQBA 1UAWA 4KHMA 3TYTA 2E7VA 3HD2A 4OHZA 1UFWA 3OL8A 4ZP8A 3F41A 1J2VA 3Q8SB 4ZLLA 4GKJJ 1U25A 2RRBA 1HARA 2IVYA 1U1RA 2Z57B 3PKYA 2Y3YA 3ZTPA 3IBWA 2KG1A 2B4UA 2HFSA 3DM2B 3R3TA 4JI5F 4JI6J 3BBBA 4M5DB 2D3ZA 1SCJB 2VL1A 2XY7A 4W90B 2C42A 3QIPB 1UFKA 3CC7S 1CEZA 3LA0A 5ETNA 4J9UE 1RTJA 4AD6A 5CH7B 8AT1B 4S0MA 4RBUA 1HMVB 2Q6BA 1XJWB 1VBYA 4WPAA 2LXUA 3SSQA 2PI4A 4X4PA 5B0EA 3H2LA 3TA2A 2MZSA 2LXFA 1S1XA 3MM5B 4DL6A 4LRBA 3UVJB 3OV7A 2KG0A 4DQQA 6AT1B 1VQ5S 1WOSA 1DAXA 4URSA 1UVNA 1NBEB 1KS2A 2ZE2A 4X4UA 2AX0A 5F8JA 4HI2A 4RNFA 3CCZA 4WIIA 4X4VA 4M5LA 3R2CJ 1AT1B 1FEHA 2X3DA 2EXUA 3DRRA 4OYWA 2PEBA 4IR9A 2GS8A 2JC0A 2XHWA 1B3TA 2BJDA 1UP1A 2CZ9A 2ERRA 3SMZA 4X64F 3AJ2A 1TU0B 4C0BA 3H40A 2BUNA 4I7FA 2WHOA 4K4UA 3OL7A 2F4FA 3M6VA 2MZJA 4OI4A 2ALZA 3MAAB 2FGCA 2W2OP 4WIQA 1N5QA 3AOCA 1UVKA 3MM7A 3NXZA 1BWVA 2E1AA 5JVHQ 2ZZTA 3HFZB 4C8LA 1FI4A 3IS9A 4DZ6A 5KT3A 5HMZA 2V2KA 5AT1B 3D6FB 4EWTA 1IWGA 2ZZNA 3H98A 1K9MT 4RL1A 1F9FA 2O5DA 4DG1B 1S1TB 2DGWA 2DTJA 2FLPA 4C8KA 5KG4A 2GIQA 2W24A 3DRPA 3BSNA 1NRKA 3IN5A 4TKTA 2DEIA 1RXOB 2VC1A 4O44B 1ZAVA 3I9ZA 1WKLA 3AA8A 3BF4A 1Y7PA 3AD7C 1BUXA 1O51A 5HMWA 3PR5B 4OX8A 4DL7A 1JKHA 4CLWA 1UPMB 1M5SA 5M2UA 2DNZA 4CYUA 4B17A 1JQGA 1KQKA 3Q2SC 1N88A 1YHQS 3AB2B 4B3SF 5D8HB 1I51B 1FCAA 1C4AA 4YR2A 2FTRA 2B9XA 4JYAF 4E8UA 4WU2A 3KG0A 5HN0A 3CD6S 1D9AA 2D3O1 4LVNP 3X1LB 1X4BA 2AWZA 1FRHA 4RW8A 1LWXA 3PYDA 3FZ2A 2AZ1A 5F8GA 4QQBA 2FJXA 1X4AA 1U8WA 1N5YA 4YUDA 3GJTB 5K14B 2PD1A 2B5JB 3QJPA 1SB6A 3ZNUA 1TAUA 4DR3J 3CMQA 4AL7A 3UI3A 1U8SA 3BO2A 2ZH1A 5DM6Q 1EQ0A 3W1YC 3NG8A 1FJGF 5KG3A 1H3DA 1VBZA 1RAFB 2E1RA 1Q7LB 2KXHA 4FF2A 1A9NB 4IRCA 1TV6B 1PJ7A 4CCHA 1K1QA 1YRUA 1JLGB 5DZ6A 3TVYA 3LTOA 1RUSA 4ECQA 2BANB 3QFHA 2HWTA 4DPWA 2OFGX 1PAUB 4L74A 3WQPA 4QR1A 3LW5C 3B82A 2ZH4A 1FWPA 1JJHA 1RYSA 2UUBJ 5CZVA 4B3RF 3HLUA 2LQ9A 5I4MA 2G1DA 1GX6A 1EP4A 4ANEA 4DCPB 2K3IA 3LAMA 3SXLA 3H2UB 2CQ4A 4B3OA 4X66F 4LSNA 2CG8A 3BSCA 5F0WA 1UCNA 1V5IB 2UVVA 5F8LA 1OQ6A 3R97A 2UU9F 2YNFA 2EK1A 1MU2B 3HSDA 2FHOB 1FDDA 5A2QU 4DS5A 1YX2A 1S1VB 1X5OA 4ZN1A 2PFFB 2W9CA 3J7YU 4UW2A 1DURA 5KFDA 4USKA 3R27A 4KPYA 1FESA 3GFYA 1EKRA 3RBEA 3PJXA 2VHGA 3ET6A 4CLTA 4ZLNA 1S12A 4E98A 5IWAF 1SJ4P 4HI1A 3BSAA 1VQLS 3NRBA 1AROP 1RSCA 2Y8WA 2M8DB 3OSPA 3BBCA 2OELA 1X8DA 2W7PA 2DNNA 5IV4A 1E6YA 3BR8A 1RWMB 1PKUA 4YY3J 2EFNA 2UVWA 4WYWA 3SFUA 4ELUA 4OZNA 3TQEA 1IBMF 2DT9A 2WVEA 2M4MA 5CYMA 1QSYA 4F36A 2AJFE 2AGPA 1TZ0A 1ZS6A 4LR9A 2OPQA 3QGGA 4W4MA 5GAGU 2YQ3A 3GSDA 3KLFB 3CJ5A 4OYPA 2VH7A 1F2HA 4C9DA 2MKSA 3OTEA 3T9NA 3VAKA 4P7VA 3KDNA 2HK3A 2HEKA 1ZPVA 1NXIA 1NDPA 4LF7J 3V6DB 2AJQA 4KV8A 4KGVB 3GV8B 1JXEA 4DQIA 3W64A 1B0TA 4WK3A 5DS7A 5HVFA 3KNAA 4L6V3 2UXBF 2HURA 1Q0NA 5D4OA 3DDNA 4AXJA 3C16A 8ATCB 4DI6A 4DR5F 2B4PA 2QLBB 2YTCA 4WKRA 5J1EA 2KHCA 3HHKA 4M1KA 1U26A 1RP5A 3EVOA 2BR0A 2W2NP 5J2NA 4DV7F 5F9NA 5T14A 3HDSA 1Q8IA 3I31A 1IM4A 2HQIA 4Q44A 1OWXA 2XMKA 2XLKA 2FVCA 2ZEJA 1KVKA 1U1OA 4JI2J 1KHVA 4N76A 4HEA9 2BE9B 3KLIA 3PHTA 5K8MA 1SL2A 2LU1A 1PIEA 3V4IA 3U1LA 4IO1A 2NPIA 3DRSB 4OV1A 1HWKA 4JI3J 1IKYA 3CIZA 3O6QA 2MSTA 5IT4A 1S0NA 1S99A 4USUA 5E33A 4B3TF 3BREA 3MMAA 3SDEA 2GVDB 3KLEB 3BKFA 4IFYB 4U95A 2V8DA 1T3NA 1B0PA 5KG5A 3HCXA 2ZHAA 1XMBA 2DO4A 2J7KA 1UL3A 3KOAA 2R8GA 1Q8KA 3IFEA 2JLGA 3MM6B 3QYYA 2XBPA 2B4OA 2GVZB 2V50A 2XULA 4I6AA 4LFAF 4O3NA 3V5RA 1U6ZA 1N5VA 2DKOB 4FYWB 3D6HB 4MFBB 5KTQA 3D0GE 3TAMA 5B0AA 1KBRA 2Q3PA 2CAJA 4MK9A 5LXYA 3RB3A 1HW8A 4FNHA 1ELOA 3I6PA 3IP0A 2J76E 1B7YB 1WHYA 1LWFA 3MD3A 4DL5A 1AFJA 4ZJLA 3GJSB 3MPDA 4CWBA 3RG6A 3KLGB 3W2VA 5LJ3Y 2QX0A 2I9SA 3OTCA 2A1BA 3UQSA 1HBOA 3IGNA 1KTVA 4KYZA 3OVSA 1QAIA 2H65B 5D4PA 2BOAA 2DGXA 5IFMA 4HYKA 4KY3A 5LMUJ 2MGZA 3QATA 2DPJA 3MOJB 2IY5B 1YG0A 2FLOA 3VTIA 1ZZNA 3I96A 4DV6F 2IJRA 3PYFA 4ZVRB 4YS2A 4B9MA 3UCGA 1S4EA 5IC4B 1VMBA 4IKAA 2C2OB 4DPXA 3IG1A 1RA7A 4QW8A 3BQ1A 3HHNB 4YR0A 4LF9J 2ILZA 1KOHA 4K4VA 4NCGA 4K0KF 1H0HB 4ICLB 4NL5A 2DNYA 2IC3A 4ID8A 1YI2S 1F6TA 3I5BA 1U7LA 4FXDA 1NMEB 3S6EA 1OJ4A 2XSJB 3BZQA 2J9EA 2JEGA 4WE1A 3IM8A 2BQ3A 1FKPB 2R7RA 3HFKA 1H7WA 1VQSA 1ZA2B 3QBCA 1EKSA 5KT4A 3PX4A 1YBAA 3CC4S 5EWGA 3EPGA 4LQ9A 1NJZA 2VDIA 1HQUB 4M63A 3WX4A 2DY9A 1AZSB 4DR2F 2E5HA 2FJVA 3K5LA 2CPFA 2AJ2A 2NYIA 3OJSA 4PWDA 5KFKA 2IRXA 1NK0A 3UR0A 4O3SA 4PUOA 5DLFA 1S1UB 2E44A 1WC0A 2R8IA 2XNQA 3MDFA 2K1RB 4IH7A 1W7WA 2BEFA 3D0IE 1R0AB 3SIPB 3KK2B 3NGKA 2GIRA 2DR9A 4C3MA 3HM9A 4XPCA 3G71S 1FTCA 4PPDA 2Y1LB 3DOLB 5K8PA 1X0PA 3NBPA 5J2MA 4EBCA 1RAHB 1W2BR 3HK2A 2FDNA 2NSBA 4N8NA 3ILJA 1N5TA 4NZ7A 1UJ5A 5B09A 1NK4A 1RHJB 4AXIA 4DX5A 2J6SA 3KLVA 4FF1A 1X9SA 5ETSA 2JOQA 2MB0B 3NAHA 3W63A 4P7TA 1SJ3P 5ADZA 2MJUA 2H9ZA 3MPUB 2J8AA 2OMLA 1Y3JA 4LVOP 4DQRA 2QFJA 4B9LA 2WOMB 2E5IA 4YHHJ 1VC6A 2L08A 3CCMS 4V1Ak 2M70A 3LH2S 4MT1A 5DGBA 4A8MP 4F50A 1RLCL 2DGTA 3AH6A 1CS4B 3THTA 2RB7A 3NLCA 1BQNA 1G2EA 4KRWA 3R7BB 4DOZA 1SJRA 3RBDA 4RKUC 2A3JA 1FRLA 1QUVA 5D77A 2YNIB 3TI0A 4C0OC 5IS2A 1DFDA 1HYSB 3FEYB 3RW6A 4F26A 1KOOA 3W8PA 3OVBA 3CDBA 1ZM3A 1VDHA 2KDOA 2AD9A 1LOUA 4LF2A 3FCWA 3VF0B 1FKOB 3K59A 4CLFA 4KAIA 1JLAB 5HP1B 2V94A 2VUGA 1KLMB 2UUAF 4TU7A 5A76A 4OYZA 1JXVA 3TR5A 1YJVA 2DCLA 4DCOB 3C46A 2BXJA 1L3UA 4NASA 2RILA 3WC0A 4NA3A 1CG2A 1SJQA 4K5RA 1VHFA 4ZPVR 1YITS 2BV3A 4EK2A 2C3YA 2CVEA 2QV6A 2HRYA 3H8YA 4LF8F
chains in the Genus database with same CATH topology
3O8WA 3THVA 2JFKA 2XWXA 1YVFA 4X4TA 2HFOA 1DLOB 4F67A 1FE4A 3OLBA 2HMIB 1KLMA 3RRHA 2QLWA 4GKJF 5F0UA 4KGMA 2AJ4A 2IM0A 3GWCA 4RBTA 2RQ4A 2E7WA 3ITHB 3CCQS 2B7BB 3UPFA 2CYYA 3WDOA 1KNZA 2XS7A 3TP2A 1TK5A 2DO0A 2Q43A 1RGVA 2ZJRQ 2KXNB 5AJ3F 2PDAA 3CO9A 3J7Z5 1QM9A 2ZFHA 3CJ0A 1OO0B 2HGNA 3TNVA 1DARA 1BQMB 2M3DA 1NEEA 2MSSA 2VASA 4IOAQ 2LYVA 2J0WA 2CJKA 2RMLA 2QIFA 4TY8B 1QUPA 4B02A 3Q0AA 2V4JB 2VV5A 2HRUA 1NH8A 4KT0C 4A46A 3FSYA 1TP7A 4PQAA 1M1KT 2QA4G 4H4KC 2LEPA 1DQ9A 2D9OA 2MQMA 4DQSA 3CJ4A 5FJ4A 4N5SA 1D1UA 1I1GA 1TK0A 2L41A 3QZ7A 4GC7A 5BJRA 1FDAA 3HF5A 4RUCA 4IQXA 1ZBTA 1DLOA 2IMOA 2HMIA 3HI9A 5J1NA 1TVRB 2HWIA 6FDRA 3TUJC 2LQJA 2QZ8A 5E0OA 3VAJA 2HQ3A 3ITHA 3LP0B 4CH1A 1TUVA 2P9GA 2ZH9A 1FDNA 4NYZA 1AFIA 1F0XA 3JTOA 5L1KA 2JLEA 2NUUG 3D1HA 3DU5A 1HPZB 3MUVP 3BO4A 3AY0A 3KNGA 3HJFA 1W2IA 4WFBQ 3K8VA 5AXNA 4KTQA 2GNKA 2QSWA 3HVRA 4N56A 3V6DA 1KSPA 2ZC3A 5KFEA 2RVJA 3CMAS 3HVTB 2VODA 1P27B 3M6XA 4ED1A 2KO1A 4Q8EA 5KOWA 4TY8A 3QPIA 1UWBB 2XMUA 5GAHU 2EC0A 2V4JA 3JYTA 1D0EA 3PW5A 2ASJA 2IM2A 4N41A 1PGZA 1R3NA 1WG4A 2YH0A 3NGDA 1RTHB 3M8SA 3G6YA 1T94A 4ES3A 1X5TA 4KIAA 2GA7A 1GT8A 4USHA 2DNGA 3HMJG 3M2RB 5F3ZA 2X51A 5KT2A 2OO4A 4M94A 2NXUA 2OSQA 1BQXA 3SCIE 1NK6A 1MWYA 1ZZFA 2GO8A 3G4SS 4OI6A 1KQFB 2DR8A 4ILMA 2ZOMA 1LXNA 3FRYA 2VOPA 4Y0FA 2ATLA 1PILA 4B3MF 1HFEL 3M2VB 4RW6B 5E3CA 4X66F 2OH2A 1TVRA 4ECVA 1GTHA 1QAYA 3RRGA 3SEOA 5FD1A 3CCTA 3LP0A 2DNQA 2I38A 3SI8A 1C0UB 4Y2KA 4DPOA 2QE5A 1WHVA 3T5HA 4RX6A 4WU3A 4RNNA 1FRJA 1LW0B 1HPZA 4B9NA 1YQHA 3NCPA 5G0RB 5SUHA 3LGNA 2WRMA 2W9AA 4MJKA 4LJMA 2AJ1A 2BW2A 1N4LA 3J80Y 1ZM9A 3W2WB 4FPRA 3MUTP 4KHPF 3OVAA 2LQ5A 2EPIA 3C8YA 3HVTA 2FIUA 4TLQA 1S1WB 1UWBA 2R2UA 1S9FA 2RF2B 4UY85 5KFJA 1MROB 2GHWA 1H7XA 4J9KA 1WEYA 2AGOA 1OPIA 3G8QA 4Y2AA 3ZZPA 4R8UB 2JLFA 4OMFG 4ZS6A 1QAXA 3M2RA 3QZ8A 2WTFA 2DITA 1U6FA 4A8FA 2BM1A 2CPIA 3I9V9 4KR0B 2UXCF 5B7WA 2LVWA 3QO9B 3MOZA 4F02A 2V5HG 2M8HA 2CQ3A 3M2UB 4PRFA 2MZTA 3M2VA 4RW6A 4G1QB 2JSXA 3O1LA 5T41A 3Q24A 4ZHRB 1X0FA 1ZAXA 2CQ2A 4X4SA 2DJWA 1C0UA 4QWCA 4XK8C 2YWHA 1HNIB 3FVYA 4A47A 1HBMB 2UXDF 1LW0A 3IAM9 3SQGB 2OTLS 5G0RA 4QJVA 4RW4B 4HLBA 2R7QA 2HVHA 3C6UB 1H98A 1E6VB 4FS1A 1U1MA 2HHHF 2J6TA 3F73A 4MKBA 4CO4A 5BYSA 4CIOA 1NO8A 2OSRA 2E1MC 2OPRB 5DM7Q 2Q1LA 3HKZD 4O4GB 3TA1A 4FXVA 2MQNA 3PW0A 1X4EA 1UA0A 3LF0A 3RR8A 1M5KC 1AW0A 1S1WA 2ZUGA 4QPXA 2PIIA 2RF2A 3MEKA 2VONA 1MROA 1RT3B 3T19A 1SXLA 2ADBA 1ZOTA 2AX1A 4IOBA 1XR5A 2NPFA 1D9FA 2A2CA 4R25A 4ECRA 4R8UA 2VD3A 2J9CA 3I55S 1VBXA 2UP1A 4Y3CA 4OI3A 1FEEA 3KMSA 2KJWA 4JI0F 3JAMY 2YVSA 3GG0A 1HW9A 3RAXA 2UVRA 4M8LA 4QYZJ 3E2EA 3QO9A 4ZP9A 2HHPA 4A8SA 4IDKB 1U1LA 5KFLA 4YR3A 2RRAA 2ZZMA 1IJEB 3DLEB 2Y1JA 1HWUA 3M2UA 4G1QA 4FF4A 4RUHA 4NLXA 2YKMB 2VBYA 4ZHRA 2JRSA 3RZAA 1HWIA 2CQIA 2PMHA 1HNIA 2MHEA 3RW7A 3PV8A 2KZZA 3JTPA 3FFIB 3KFWX 2LXIA 2RDIA 2RE1A 1HBMA 3K7RA 1F5CA 2WAQD 1RT4B 3SQGA 4J9NA 1HNWF 5AE1A 3NMAA 1LFPA 5EX3A 4RW4A 2LEAA 2PA3A 3KTQA 3EGZA 3C6UA 3TVZA 1E6VA 1N54B 2QLXA 3N0VA 2PA8D 5BR8F 2QMXA 1HL6A 3VCDA 2VA3A 2KT5A 4ECTA 2EBEA 2OPRA 2PC6A 4O4GA 3TAPA 1HBUB 2HYIB 1K73T 2IHR1 2N7YA 4O0IA 1VQNS 2CPXA 1JNRB 3G8SA 1OSDA 1RT3A 2WSEC 3AAWB 3SCKE 1U09A 2AU0A 5EX0A 3M8PB 3DCAA 3EUNA 5IT0A 1P1LA 2AYGA 2D74B 2RU9A 2VG5B 4DBQA 3M1VB 5DG8A 4J9OA 3OFEA 1VRUB 3NNAA 1C1CB 2ZHOA 3CDUA 2C3MA 3R1HA 4IDKA 1TKXB 1KONA 4WZMA 1XTZA 3IWLA 3DLGB 4NLYA 3DLEA 1OS5A 1Y5LB 2CVIA 4PXEA 5F9LA 1T05B 4HDHA 4CH0S 2ZBIA 3FQKA 1TK8A 2YKMA 2KM8B 4V19J 3P3DA 2YX4A 2V4RA 3CMES 1S76D 3FFIA 1P9QC 2DHSA 2VG7A 3U02A 1WF2A 4O4RA 1RT4A 1S10A 4DSLA 3KLGA 4ED0A 1VIOA 1FRIA 1UKUA 3M8QB 2IA6A 2BYCA 3Q2TC 1BWEA 2YWKA 4PPZA 3RAQA 5C42B 4EUVA 3IWNC 6FD1A 3Q8RB 3N9UC 1HBUA 2E9RX 4KGKA 1N56A 3DLKB 4KC5A 2CJAA 3I82A 1A6LA 1F5BA 2GHPA 4JI1F 3CVKA 2Z0GA 5HBMA 1TAQA 2CG4A 3CDAA 3UDCA 2XEXA 4A8XA 3TARA 1UVJA 5AE2A 1KEKA 4B9SA 3M8PA 3M30B 4BWMA 5KFMA 1CSJA 1JMTA 2YKQA 2VG5A 2B0GA 3M1VA 5L38A 5H1SV 1VRUA 4B9VA 2IBOA 1C1CA 4IG0B 2MZRA 3HHDA 4DL0C 4DFPA 3PW4A 4NLVA 4USJC 4NRTA 2N3LA 2KXFA 2CPDA 1TKXA 3ENQA 3D1OA 1N5YB 1Y3KA 4GC6A 1FT8A 4C98A 1M5PC 2W25A 1ZM4A 3CCWA 5DQHA 3T6BA 1T05A 4ILLA 2AV5A 1VQKS 3KK1B 1ZAWA 1QVFR 3LP2B 3L7OA 2ZH2A 1RTIB 1H2VZ 4Q2LA 3ZZZA 2I5JB 4OZ0A 5A0YB 5DDOC 5JVGQ 1DTQB 4WFAQ 4DFKA 2HGMA 3MR6A 4PG8A 2OFHX 1U49A 5KFIA 2XMWA 2KVIA 1WELA 1G3OA 3KK3B 3DI6B 3M8QA 2LEBA 1N32F 4LIRA 3I87A 4R0JA 3CDWA 5C42A 3HP6A 2MZ1A 4FF3A 3G9CA 1NK8A 3MCSA 1GXLA 1RDRA 2E7XA 4ETXA 4ECXA 4F4KA 1XK8A 3DLKA 3CJKB 2WB1D 1S4FA 2AYMA 2CPZA 3UNGC 2ZM6F 5H9FJ 4JV5F 2ABYA 2BA9A 3TOQA 4OQJA 2R7XA 5LSLA 2MYFA 2HFNA 1WEZA 3R5CA 3M30A 1UEUA 4QU7A 5D4LA 2B6AB 1HI8A 1LV5A 4OZJA 1VK3A 5C25B 5LXRA 4Q0BB 4IG3B 1NK5A 3BGRB 1REVB 4I69A 1T02A 5L9XA 1TKZA 4IG0A 5KG0A 4X4RA 1KC8T 4NMLA 1KHWA 2F9DA 4NLTA 3FSXA 3PR4A 3BJYA 4DR3F 2QT7A 3VAGA 3SYZA 1FK9B 3LAKA 3M05A 5MAOA 1N5SA 2DHXA 1Z4UA 1LK5A 3J7YI 3K5NA 3KK1A 3M6UA 2DIVA 2FJAB 4KB7A 2FUG9 3LP2A 4DN9A 3NNCA 2HGLA 1RTIA 3DLHA 2I5JA 3EGWB 5A0YA 3VALA 1DTQA 1FTRA 4XAKA 5HI7A 4NLOA 1HNXF 5I3QA 3OXFA 3DI6A 3KK3A 2KTQA 4DR6F 3VAIA 2R8KA 3KHLA 3U27A 3GMGA 4OI2A 4Z37A 4PG7A 2MQLA 3LANA 4NLSA 3CJKA 3K58A 3M4XA 4ZCLA 1QAJA 2OPSA 3CJ2A 3CD5A 1RJJA 3D2WA 5E3RA 3TX8A 1OPZA 2NQPA 3GYXB 4OX9F 4DR7F 3U1NA 1VRTB 2B6AA 4Q0BA 3MPVA 2XLIA 2JHEA 4IG3A 4MTPA 3BGRA 1REVA 4O3QA 1N33F 1HWJA 2MKIA 1BLUA 3DU6A 2NR0A 2OAUA 2ZD1B 3E3XA 2XI2A 2YNGB 2RDJA 3DOMA 4EGLA 4LMZA 5M2PA 1FK9A 3MURP 2GO9A 3CC2S 3G8TA 2U1AA 3H59A 2B9WA 2DGVA 1XMQF 3PKMA 3IWXA 5EWEA 2J7UA 3O3LA 3D1QA 3M6WA 4F3MA 3CGIA 2VQFF 2OIHA 5D3GB 3TUIC 4XDCA 2WONB 4DSIA 4QIVA 2HHQA 1SJFA 3S01A 1N6QB 3L95X 3J7A1 5LL6d 3TQ1A 2K1RA 3K2YA 3O5TB 5F3TA 3PXGa 3IRWP 2FC8A 5B0GA 1R0AA 2KHDA 3OJUA 1LWEB 2F8EX 2ZJQQ 4DV1F 2Q79A 2FVRA 2YNFB 3SSRA 2BBEA 4J37A 1L3KA 3KK2A 4PG6A 2VPZB 3P6YC 3CWJA 1WD6A 4DJBA 2PO4A 3BO3A 1RI7A 2J0XA 1U6BA 2SXLA 2RU3A 4OIXA 1VRTA 5CYJA 3NCQA 4CO2A 1SIZA 2PI5A 1XNQF 2ZD1A 2W9CB 1S9EA 3U1MA 2ZJPQ 2YNGA 5AXLA 4C8ZA 4K4YA 4I56A 3O2IA 5I42B 2IJNA 3KHRA 3ETOA 2AP6A 2ZOGA 2LA4A 1JLBA 3CCUS 3DN9A 4FBTA 2IM3A 3P96A 4CT9A 1D8YA 2VFRA 5MLCV 2BVZA 1GXUA 1HQEB 2DH9A 1C2PA 2RH3A 2FJDB 4K59A 3ZZUA 4TQRA 2Z2LA 4IYQA 2XLJA 1BC6A 4F3QA 4HTJA 5GAGI 5D3GA 2DH7A 2WONA 3OFHA 4OLOA 3MAQA 3EZUA 1ULRA 1MMNA 1K1SA 4AFFA 1Y5NB 1N6QA 2EKYA 3HX9A 4OZ5A 1RISA 5A2QY 4IRDA 4EU0A 4LSLB 4G1IA 4Q45A 3VAHA 1LWEA 2ZDOA 4PXCA 2CJBA 4QCLA 2F4VF 2MKHA 3DC2A 5LT5A 1K0VA 2VA2A 4DHVA 2BRKA 3EPIA 4NCBA 2HHVA 3H4BA 4H54A 5DRKA 3OLAA 3QMQA 1U1KA 1FO1A 1TKTB 5CXTA 2BDPA 3VZHA 3B78A 3BN7A 4DV3F 1S6PB 1XEZA 2FC9A 1ZPWX 5L9NA 4OFZA 5U47A 4J9RA 4F4YA 1KTQA 5DG7A 4CT8A 3ICLA 3CCJS 1WHWA 2HS4A 1X9WA 4YB6A 4BHQA 3M9OB 1BD6A 2XCAA 1LXJA 3E01B 5I42A 4OX7A 5F8HA 4ZDNA 1FDBA 2H5EA 2BZ2A 4FYDA 3TANA 2WW8A 3AB4B 5KFTA 4DR1F 3IA0A 4ZLPA 4K4WA 1HQEA 3QGIA 4IFVB 2V8VA 1R27B 3FMBA 1W25A 4PCQA 2JFDA 5IM0B 2M7SA 3OHAA 4O23A 3OBIA 4G3IA 3T9ZA 2D3OR 2WK4A 4YB7A 2C2DA 3MGJA 4PWUA 1UW4A 4PR6A 2HIQA 3FEZA 3LALA 3PX6A 2MY7A 2CKWA 4LSLA 2YKNB 1Y4ZB 4ELVA 3N01A 3DOKB 1S6UA 2ZH3A 2IMWP 3FGVA 4KE5A 3H25A 1Q53A 4AYBD 2JEFA 2HLTA 3JSRA 5CZXA 2XCPA 1MMLA 2JJ4D 4QR2A 2DIUA 2VBZA 4J9MA 3T1HF 4NXNF 1Q8LA 1XWLA 4Y2IA 2P5VA 4X4NA 3KJVA 2JVRA 1S6PA 5E3QA 1IR0A 1M90T 1U48A 1DRZA 4ED8A 3CJ3A 3I32A 1P6TA 1KQGB 4O3OA 1S72S 4Q7AA 5J1PA 4YY3F 4ATNA 2NREA 5A8WA 2IRYA 1AUDA 5HLFB 3PO4A 1U2RA 5EUHA 2K3KA 2WCXA 3K0JA 5D78A 1JB0C 4FXWA 1YGYA 1HA1A 2XMTA 5KFSA 1IUJA 3FRZA 1IKVB 1O0PA 3F56A 5HROB 4IFVA 3DGPA 5GADU 3V6JA 4JV1A 1HWLA 2JWNA 4K2XA 3T5JA 1VQPS 2BE2B 1H2TZ 4Q2MA 4ED2A 1LFWA 2P6TA 3KKFA 1QSLA 4ZVHA 1JJ4A 1QY7A 5KAKA 3QAEA 1N8RT 1R6YA 1V6HA 3FQLA 1HI0P 3DOKA 1MMDA 1RT6B 2F3JA 2B9YA 3WC2A 3MEDB 2KM8C 2W8LA 4OI0A 1Q16B 1RWUA 2R7OA 1HR0F 2HAIA 1R31A 2MJNA 1OIAA 1NKEA 3DLBA 3SSSA 4TN2A 5HQ8A 1TKDA 2O67A 2CQBA 1UJ6A 1BY9A 3V4MA 1UAWA 4DSJA 5KFAA 1Q86T 4KHMA 3AQPA 3TYTA 3AA9A 2AW0A 5KFBA 4EBDA 4OHZA 5HLFA 1UFWA 3OL9A 2A10A 2V8GA 3RRKA 1FXDA 2E66A 3OL8A 2QA4S 1VQMS 2ROPA 4ZP8A 3F41A 3PW2A 1RTJB 3THPA 1J2VA 4WCEQ 1U1PA 3G96A 3Q8SB 5HROA 1U25A 1U4BA 1IKVA 3G6XA 4JI6F 4YP3A 2RRBA 3TAQA 4XDDA 3ZFVA 2R8HA 1HARA 2IVYA 2BE2A 1U1RA 1Q1KA 3WZ0A 4ETZA 3PKYA 4LQ3A 2CRLA 2GMJA 4ED6A 4ERDA 3V6KA 2CZVC 2FHJA 4OZLA 3UFCX 3IBWA 1DTTB 1VGYA 2KG1A 4JUZA 2B4UA 1RT6A 1TR0A 1NAQA 1P8GA 2XWYA 3MEDA 3DM2B 3R3TA 3POTB 4ZOSA 4JI5F 4CO5A 1S1XB 4M5DB 2O3DA 1UJ4A 2D3ZA 2VL1A 2XY7A 4W90B 3OTBA 4PG5A 2GCFA 3M32B 2C42A 3CD7A 1BGXT 3QIPB 3D5MA 2QEXS 4O3RA 2WBMA 4R5PB 1PSDA 4HL9A 1CQNA 2OP5A 2J7WA 3CC7S 2L9WA 1CEZA 2HLUA 2PGCA 5I3PA 4EYIB 4ZCKA 1RTJA 2Y1IA 2ZOFA 5BYQA 2F40A 5CH7B 5KFRA 1BQMA 3HVWA 2LDIA 4N8OA 4NLQA 4PXDA 1TQLA 3FMWA 3CCVS