2DH8A

Solution structure of the n-terminal rna binding domain in daz-associated protein 1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
105
structure length
105
Chain Sequence
b'GSSGSSGMNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DAZ-associated protein 1
molecule tags Rna binding protein
source organism Homo sapiens
publication title Solution structure of the N-terminal RNA binding domain in DAZ-associated protein 1
rcsb
total genus 12
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dh8A01
2MQPA 1FHTA 3THTA 1DBDA 1WF1A 2MKSA 1FT8A 1NO8A 1VQ7S 2N82B 2YKAA 3RW6A 5DM7Q 2CQDA 3EGNA 1KD1T 1M5KC 1DHMA 1WEXA 1WF2A 2DK2A 4WCEQ 1KC8T 3TYTA 1WHWA 3THPA 1SJ3P 1JJ4A 2YH1A 5HL7Q 2AYBA 2MZRA 4CH0S 1WG1A 2EVZA 3MUVP 3CD6S 3CCRS 1Q86T 1H2UX 5CYJA 5DETA 2DNPA 2RT3A 3S7RA 2KVIA 2OTJS 5MLCV 3NNHA 3PIOQ 2RS2A 2DGWA 2DNOA 2M88A 4C7QA 2CQCA 3VAMA 1VQPS 5D78A 2AYGA 1H6KX 1X4EA 1H2VZ 1OPIA 3V4MA 5JVHQ 4M5DB 1WHXA 1WG5A 2KM8B 3P49B 5DM6Q 3MUTP 3VALA 5CXTA 2L9WA 3CTRA 2DGXA 1R8HA 4UQTA 2XNQA 2D9PA 1A7GE 2OIHA 3MOJB 1YJNS 2JVOA 2DIUA 1WEZA 1VQ4S 1PGZA 2RS8A 4ED5A 2M4MA 4FXVA 2G1DA 1U1LA 3ZZZA 2DO4A 3BO4A 4LMZA 3SXLA 2LMIA 2MYFA 5LSLA 2KT5A 1U6FA 4QU6A 4C4WA 1N52B 4YOEA 3L3CA 4PRFA 3HHNB 3MURP 1YTYA 2KM8C 2MPUA 2CQ0A 4PKDB 2AYEA 2V94A 1U1OA 5GAGU 1DRZA 2KXNB 2PEHA 3VAKA 2LA4A 1YJWS 1UP1A 1VBXA 2ZJRQ 1OWXA 2CQHA 5LSOA 4CIOA 1U1RA 4IUFA 2DGUA 2MZJA 2AYMA 2LCWA 3R27A 3CCUS 2CPXA 2JRSA 2YH0A 1K8AT 1SJFA 3UD3P 2LEBA 3MXHP 3CCMS 1VBYA 2DNKA 1RKJA 1HL6A 3G96A 1X5OA 1X5SA 2GHPA 2MJUA 3VAGA 5EN1A 2MQQA 1WEYA 2XNRA 2HVZA 3JB9k 5GAEU 2OSQA 2X1BA 3MD3A 1NU4A 4V19X 5DDRC 1M90T 2DNMA 3K0JA 2KFYA 2MZ1A 2FC8A 2F9DA 5D77A 5GMKa 1VQ6S 4QPTA 4LJMA 1M5OC 5LJ5Y 3J7YU 2Q79A 4YUDA 2HGMA 4Z2XA 3CMES 1KOHA 5LXRA 3UWTA 2CPFA 2CJKA 4WIIA 3CF5Q 2DB1A 2DNNA 3P3DA 2DNZA 3MD1A 2MQNA 1WELA 3R1HA 2CQ2A 1VQLS 2ERRA 1K73T 1VQNS 2LXUA 4QQBA 1VQ5S 2RQ4A 1W2BR 3BEGB 5FJ4A 1X4CA 3UD4P 2CQBA 3UCGA 1O0PA 1N88A 1FO1A 2A3JA 3DLLQ 2MZSA 2DNLA 3PIPQ 2AD9A 3ULHA 1U1PA 4IO9Q 3CC2S 1XN9A 1HD1A 1OO0B 1WHYA 5DDQC 1JJ2R 2VOOA 1P27B 2KXFA 2X1FA 2RVJA 1U1QA 1D8ZA 2MY8A 2XSFA 2VONA 3NS5A 2O3DA 3LPYA 3VAJA 5H1SV 1CVJA 3IWNC 1JJHA 3G8SA 1D9AA 3G71S 2M7SA 1FJCA 1HA1A 2DH9A 3S6EA 1X0FA 3TP2A 2KXHA 2CPJA 1VC6A 1U1MA 1U2FA 4C0OC 3N9UC 2DNQA 1RK8A 2CPHA 5ITHA 2CQPA 4W92B 3SDEB 1WTBA 2LYVA 3BS9A 2QFJA 2CQ1A 1KOOA 1QVGR 2ZJQQ 2J8AA 1ZZFA 2LA6A 2CPYA 1SXLA 5GADU 1X4BA 2MGZA 2KN4A 3SMZA 3S8SA 3NNAA 1Q82T 2KH9A 4BS2A 3BO3A 2KRBA 1SJRA 2DGSA 3UE2A 1H2TZ 1FJEB 2HYIB 2DIVA 1WHVA 2M52A 1URNA 2BOPA 2MQLA 1Q7YT 1R8PA 4YB1P 1X4HA 3FEYB 2N7CA 3CPWR 1P1TA 2MQMA 3S01A 2LKZA 2D9OA 2NLWA 2G4BA 2J0SD 5DDPC 2E5JA 1X4AA 1VQKS 5HO4A 2DITA 2JX2A 2CQGA 3TO8A 5IM0B 4WKRA 1QVFR 1WG4A 2KYXA 4Y0FA 2EK6A 1PO6A 4FXWA 2BZ2A 2JVRA 1M5VC 1VQ9S 4RU2A 1YJ9S 1Q81T 3ZZYA 2MKCA 3Q2TC 4F02A 3CXCR 3NNCA 1S72S 2DHSA 2N3LA 3MUMP 3P6YC 1YITS 4WFBQ 3VAIA 4ERDA 4TLQA 4J5OA 2FPHX 2DISA 2HGNA 1VQ8S 2B0GA 2DH8A 2MY7A 3NMRA 2SXLA 2CPZA 2ZJPQ 5BJRA 2XB2D 2M2BA 2DGOA 4A8XA 1AUDA 4LIRA 2KRRA 3J7ZT 2PE8A 2XS5A 2MSTA 2K8GA 2X1AA 2DNYA 1N8RT 3G9CA 1VC0A 2OJ3A 2KG0A 2M9KA 3CCSS 2E5IA 4F26A 2WBRA 2OSRA 4Y00A 2OTLS 1VC5A 4QU7A 1HD0A 1UAWA 2DHXA 5CA5A 3UCZP 2MKKA 2E5HA 2DH7A 2D3OR 1BY9A 2RNEA 2LQ5A 2G0CA 2DHAA 2MHNA 4WFNQ 2F3JA 2DHGA 1K9MT 3LQVA 2MXYA 2K3KA 1ZH5A 2E5GA 2MKIA 4CH1A 1U1KA 2VODA 1S79A 2VOPA 3CCJS 3HI9A 3CCLS 3P5TL 5GAHU 3NS6A 5IFMA 1VQOS 2YTCA 4WFAQ 2MQOA 3RW7A 1X4FA 1SJ4P 4TU8A 1FXLA 2CPIA 3CMAS 3UCUP 2YWKA 2EK1A 3H2UB 2ADCA 4WF9Q 1UW4A 1FJ7A 1IQTA 2MMYA 5IQQA 1YHQS 2M8HA 1KQSR 5JVGQ 1JMTA 2FC9A 5LJ3Y 2J0QD 3SDEA 3IRWP 2XS7A 3VF0B 1YIJS 2FY1A 1YWXA 3CUNA 2E44A 1VBZA 3U1MA 3D2WA 4IOAQ 1F9FA 1NJIT 2XS2A 2L08A 4TU7A 2DGTA 2MZQA 4F25A 2QEXS 2M70A 4W90B 2MB0B 2J76E 5LXYA 3VAHA 1X5TA 1YI2S 3Q2SC 4UY8T 1VQMS 2JWNA 3G8TA 3H2VE 2DGQA 2KG1A 2DO0A 1B7FA 3MI7X 1M1KT 2I2YA 1WI8A 1L3KA 2MZTA 4ZKAA 2LECA 2CQ3A 5DDOC 4IOCQ 1M5PC 2GO9A 2MSSA 2M0GB 2N3OA 2U1AA 3EGZA 1N54B 1WF0A 3B4DA 3CCES 3CCQS 2MKJA 2DNRA 2FHOB 3BO2A 1WWHA 2DNHA 2DGVA 2L41A 3DXBA 5IM0A 3CC4S 2LXIA 2UP1A 2MGZB 4P6QA 2RQCA 1DZ5A 2HZCA 2MKHA 1X4DA 4EGLA 2CQIA 2U2FA 2RU3A 3R1LA 2HGLA 3FEXB 3CC7S 4OZ0A 2KHCA 4TU9A 1SJQA 3I56S 3G6ES 2RRAA 2NZ4A 1X4GA 2I38A 3EX7B 2X1GA 3B4MA 3U1LA 3CCVS 1U6BA 2ADBA 1U1NA 2KI2A 3OW2R 1A9NB 2CPDA 5GVQA 2CQ4A 2CPEA 4PR6A 3VAFA 3G4SS 3US5A 1ZZNA 2RUGA 1FNXH 1OIAA 3MDFA 2F9JA 2MJNA 1WI6A 1QM9A 4U67Q 4CQ1A 2KU7A 2RRBA 1UFWA 1X5PA 4OZ1A 2M8DB 1G2EA 3I55S 3CULA 2DNGA 2LEAA 2QA4S
chains in the Genus database with same CATH superfamily
3J7A1 3V6KA 1NM2A 5I3QA 2MQPA 3N0VA 1HHSA 1FT8A 4EFAC 5EGYA 2N82B 2XSJA 1Z2ZA 1BXNA 1U25A 4IQXA 3QRPA 3KK3A 2FJVA 2ASDA 2DRAA 1KC8T 3OT9A 3ADAC 1WEXA 2HS4A 3R7BB 1HBUA 2JLEA 3DGPA 4OJGA 3EDQB 2G0IA 3DC2A 3E51A 2BQ3A 1H73A 4LSZB 1WHWA 5DJBA 4CO4A 4LRBA 2ZDOA 1SJ3P 3L7PA 1IKYB 4NWBA 4ZVGA 2GAGC 1WG1A 2ZH4A 1NRKA 3MUVP 2ATCB 1N0UA 2GIRA 3UQSA 2I5JA 2NXJA 4IH6A 3I31A 3M6XA 3OR2B 4NZ7A 1RT2B 2UUAJ 5IV3A 3CD6S 1GQEA 3QQCD 2XI3A 3FSXA 5HQMA 1MLAA 4ECRA 2CG8A 2WRMA 3TUJC 3ZTQA 5J2NA 1Q86T 4PQUB 5DETA 4GKKF 2RT3A 2KVIA 3A3PB 3N01A 5MLCV 3NNHA 2DCLA 4Z37A 1LWFA 1MWQA 2RSQA 1UTAA 2GJIA 2V50A 3OR1B 3QFHA 3TZWA 1R8CA 2DNOA 3Q8QB 3L9ZA 2M88A 2EC0A 4R0JA 3VAMA 1UJ5A 1K47A 1ZPWX 2PO4A 4NLSA 4KB7A 3SFUA 4HT5A 4ECTA 3CJ2A 1L5UA 2JOQA 1CULB 2IMOA 1H2VZ 2BX6A 5JVHQ 2GC8A 3P49B 3MUTP 3ZC4A 2AJ4A 2BKNA 3RB0A 2DGXA 1R8HA 5EWEA 3MPUB 5ETPA 2N7YA 4UQTA 1UZDA 4DQRA 3JSBA 3TQ1A 3KLHA 3W66A 5F8IA 4ZITA 2FJEB 5HSPA 3X1LB 2HHWA 4J9RA 1RE1B 5HMWA 3EUNA 3TNVA 3WIVA 1YJNS 4CT8A 1WEZA 4X64F 1IKYA 3NAIA 5AXNA 4O4RA 1VRUA 2MLZA 3LAMA 4LBPA 4URQU 2B6AA 3W65A 4JI3J 4OX9J 2EFVA 1T0TV 2RRNA 3KDNA 3SCJE 3TAMB 4EMDA 5G4DA 4YHHJ 4NCBA 1WSVA 5HP1B 2QSFA 5H9FK 1F5AA 3GFYA 3K2YA 3KLIA 2F8HA 1HBNB 4UZBA 3ILOA 3ONQA 3RJMB 2XMJA 3VGUA 2KT5A 3AAWB 3DHWC 3HULA 3JS9A 4ILRA 1FFWB 3L3CA 4B9UA 4DEZA 1T05A 3HHNB 3EWGA 4C3MA 3T5HA 4ZP9A 4AXJA 3MHYA 1N33F 1SV5A 3MM7A 5KFGA 2HFOA 4E98A 3IFEA 3MFHA 2V94A 2V6AA 1OQ6A 4G1PA 5D4NA 3CJKA 1N0VC 3CIZA 4EBDA 3PW5A 2VA2A 1Z4UA 1SUQA 3MCOA 1H7XA 4K2JA 1ICEB 2RIJA 3SQGA 3W61A 3GJQB 4AE5A 4ETXA 3GV5B 3FJ2A 1DRZA 4A8OA 2AT1B 1RBAA 3HFKA 2AKWB 1YJWS 2HVHA 5F8JA 1NPKA 2OD6A 3J7Z5 1H74A 2BE2A 1TUWA 3SFGA 4KV8B 2CQHA 5LSOA 2BJ8A 2ZKUA 3DOLA 4CLWA 3QLHB 2VG7A 4DCPB 4F3OA 2QT7A 2CJQA 3RRKA 2DGUA 4LF6J 2LEPA 5HJXA 3UNYA 2POKA 2JRSA 3NMAA 3I5BA 5D0GA 5AXKA 2E5LF 2WOMB 4R5PA 2LEBA 1T9VA 2J6UA 4ZIVA 4AQYJ 1SI9A 3A8JA 1NSAA 2DNKA 2GCFA 1FDBA 1UFLA 3UVJA 1S7HA 3HDSA 4MKBA 1BWVA 4NCGA 4LR7A 4OYZA 5M2UA 2XY7A 2Y1IA 1KHWA 4P73A 1X5SA 3CJ8A 2ZBCA 4MKAA 5L1IA 2OFHX 2QA4G 1DLOB 5KAKA 1RSCA 1IBKF 2MQQA 4JI7J 2CNNB 2NXNA 4YDDB 1DARA 2B7BB 1TK0A 1UW9A 2DHHA 5KFJA 4K4ZA 1Q0NA 3V6DB 4I2PA 1REVB 1F1BB 4NLWA 2EPIA 2GQQA 1OMSA 2X1BA 1B3TA 4NMXA 4TYBA 1FRXA 3UN2A 1CLFA 1M5HA 4EU0A 3PO4A 1WD6A 4V19X 2KB2A 5C25B 5DDRC 2E1RA 1IBMF 3RAMA 2XGPA 1FERA 2MZ1A 4ECVA 1X9SA 2F9DA 1AA1B 4NZ6A 1VQ6S 2JZ5A 3JYTB 1FVQA 1NZAA 4GMKA 1YQHA 3BGFA 3QBCA 3SV4A 1KRPA 5LJ5Y 1PCAA 1EKRA 3HVRA 3PYGA 5SUHA 1BQXA 4ZOSA 1LW2B 4DSEA 4NLRA 1KOHA 2JFKA 1RHRB 2QL5B 4KHPF 5L46A 5LXRA 3V4IA 3UWTA 4MIBA 4BCAA 2HFVA 4YHHF 1RADB 2GVZB 3KKFA 4DSLA 2DB1A 1KTQA 2YKNA 1FRLA 2VG7B 3M32B 3N28A 4GVBA 5F8HA 2DEIA 3D7SB 1AYEA 1RTIA 5T14A 2C28A 6AT1B 1DAXA 1F2HA 1S6QA 2J0XA 3C66A 3K17A 4YFUA 4PUOA 4I68A 5DO2A 5JMNA 5I3UB 2HW3A 1MN9A 1SH2A 2VFSA 5F8LA 5K8OA 4B9SA 3BGRA 4PAAA 1ZPVA 3KJVB 1V9OA 3OXGA 4K8RA 4P7VA 4PPDA 4CLLA 2VB6A 1Q7LB 2LXUA 1VQLS 1UCNA 2AJ1A 1FVSA 4HDGA 2YKQA 3EXCX 4F3QA 2VZ9A 2V4JA 3C14B 1N33J 1X4CA 3UD4P 2DD8S 2CQBA 2RUSA 2H48B 1KONA 4LSNB 5HMZA 4OHYA 1N5SA 4RUBA 4DV2F 4GRSA 4KO0A 2GFFA 2DNLA 1U48A 4U9RA 1EARA 3R5DA 3VVUA 2YBVA 1HD1A 3MR5A 1OO0B 4K4VA 1NBEB 3VZHA 1C1BA 4ZPAA 3JXOA 1P27B 3NRBA 3H2LA 3QWPA 1UJ4A 2N4CA 4UW2A 5BYRA 4V19J 4N8OA 5IOLA 1FXRA 4OZJA 3LOUA 2V4QA 1D8ZA 2MY8A 4DV6F 1YK9A 2YWGA 2BRKA 1EP4B 4KFBB 2VONA 4OZ3A 3HHLD 2OUGA 3TR5A 3VAJA 5I4MA 4DR6F 3I0SB 1H3DA 3ILIA 3ZTRA 4DPXA 5CAAA 4DFPA 4JI5F 3IWNC 3I0RA 4IO1A 2NSBA 1BGXT 1VBKA 3S1TA 3C6UB 4S0MA 3MEEA 1RTHB 4F4ZA 5E3QA 1NPRA 1HA1A 2HWTA 4K4XA 4LSLA 3W5XA 3IAS9 1OY8A 3S6EA 4YR0A 2YKNB 3M05A 3DI6B 2ZH3A 3BR8A 2Y1JA 2V8PA 2NZCA 4XK8C 3MM6A 2YKMB 2KYZA 2ROGA 1X0FA 1NKCA 1FKOB 4XIUA 2CPJA 2AW0A 1U1MA 2WSEC 4RW9B 1RWWB 3I5AA 5HMYA 1SKSA 1SL2A 1YVFA 2QE5A 1IVZA 2J9EA 2IM1A 2DNQA 4FF2A 4LFBJ 3IMQJ 1PC5A 4W92B 2KJWA 3BS9A 3DRSA 4CP5A 2QC3A 1RT6A 4AT1B 3M6WA 2ZBQA 1KFSA 2IBOA 1CS4B 2BE9B 3C19A 4OJ3A 5CABA 2ALZA 4N56A 2C2DA 4KKOA 2HRTA 1WUUA 2E1PA 1NHVA 4AL7A 3DLEB 1QAYA 2EFQA 3M2UA 3KFWX 2A2DA 1CG2A 2ASYA 3IS9B 3U7JA 1EB0A 2MDAA 2PT0A 1FDNA 2RQKA 1IKWB 3GFZA 4UOGA 4CZCA 4ZVHA 4TQSA 1BQNB 2FD2A 3PX6A 3FCHA 3OVSA 3SMZA 1FKOA 1KLMB 1RZMA 2AEJA 5CHCB 4ZN1A 3JSYA 1H38A 2DR9A 1NSPA 4M5JA 3R97A 3T19A 1Q82T 3KMQA 2V69A 4CI0B 4N47A 1S1XA 3MM9B 3RB4A 4V1Ak 5HLFB 3MPVA 2AWZA 3TAQA 3M2VB 1NK0A 3NL0A 2WBMA 4KGKA 4UOCA 2HYIB 5IT9U 1RU2A 3I0SA 1V3RA 5ETNA 4XPEA 4N5SA 1N36J 5CD4H 1TAUA 2ROPA 1WHVA 2J6SA 5B0BA 3M8PB 2XO7A 2DTJA 5KFBA 4MYUA 3D28A 3EGWB 2M52A 5E3PA 1S1VA 1AROP 2XEXA 2GIFA 4ID5A 1URNA 1HI8A 3Q8YA 2XMVA 4ZVPB 1FEHA 3H5YA 1GAOA 1R8PA 3VWSA 3L4BC 4OFZA 4YB1P 4UQGA 3FEYB 3CGIA 4I1TA 2MQMA 1JLAA 1GX5A 3RBXA 3W7BA 1IUJA 2D9OA 2NLWA 3CCTA 4K4WA 2OEJA 4ZLNA 4UZCA 5DDPC 4DV2J 2NUUG 4DQIA 3I4HX 4J9OA 3C46A 3QWUA 2E5JA 3SQGB 5J2QA 2DITA 3C15A 5B0AA 1QAIA 1YJVA 5GMEA 1AZSB 2EK6A 3AY0A 1PO6A 1C0UA 1RTDA 2ZUGA 2HPUA 4MH8A 7AT1B 4DV6J 3TZXA 3M9MB 2AGQA 4FKYA 3JAMY 1LWCA 4ZJOA 1RWXB 4DL3A 1J5OB 4LF4J 4X4NA 1S72S 3DLJA 2DHSA 3QAUA 1LQ9A 4R5PB 1NB2A 4C8KA 4NLTA 5LM7E 5A8RB 3FSYA 1QSSA 2R8KA 1NHKL 4JI1J 3R9LA 1Q1KA 1YBUA 5BR8F 4ES3A 4WFBQ 1S9FA 1UA1A 1W2IA 3MM8B 1ROFA 4J5OA 1NK8A 4DS5A 4DSJA 1KR4A 4FVMA 4NI2B 3P8BB 5HP1A 2RB7A 2X7IA 2B0GA 3NGUA 4IFVA 3DHXA 2W2PP 4H4KC 2OPPA 3FZ2A 4YR3A 1N34F 2DH8A 3NMRA 1QTNB 1SBRA 3CJQA 2QFIA 1P9YA 2I1RA 3P45B 3W9JA 3LP0A 4PXDA 3V6DA 4DCJB 1SKUB 1J5EF 2M2BA 2R7QA 4NA1A 2HIYA 2CWXA 3PKYA 2KRRA 4LF9J 4ED3A 2YPZA 1AFIA 3O44A 4M5MA 2QA2A 4OX6A 3CVKA 1N8RT 3G9CA 1H98A 2V4RA 1CC7A 1NDLA 5L39A 2JEFA 1FI4A 2KG0A 3R5CA 2M9KA 3CCSS 2QJ3A 2E5IA 2VBYA 5KT4A 1U7LA 1FFGB 4F26A 3ICLA 4PG7A 4P7TA 2GX8A 3BM7A 1CQMA 2Y3YA 1SIWB 1ZS6A 2DEJA 3ETMA 5T41A 2OTLS 2IM3A 3T3FA 2Q66A 3O8WA 2V68A 1FTCA 1HD0A 2YPYA 4Y65A 3A3OB 1JIHA 5KT5A 3UCZP 1P9QC 2MKKA 1JJCB 2VDIA 2E5HA 2Q1LA 5ETQA 1U47A 1N36F 4J9NA 1B4SA 3BQ0A 4DR2F 4KTQA 1OYEA 2LQ5A 5IT4A 4KPYA 4DHVA 3CD7A 2VU5A 2F3JA 3H4DA 2WVCA 3BGRB 2XMUA 4HT7A 1K9MT 2ZZNA 2K3KA 4M1KA 3H5SA 2JEGA 3HD2A 5T7LB 2E5GA 1GK8A 1TQLA 1RTZA 3ENQA 2HS3A 1U1KA 4I69A 4ZPTR 2A1BA 2H5IB 3BKFA 3DDIA 3BBBA 3HVAA 4DU7A 1U4BA 2Y1RI 2XHCA 4DSFA 3CCLS 5M2RA 1RYRA 4OYXA 2C22A 1WC1A 4DWIA 3NS6A 4ZP8A 2PMHA 5IFMA 4LF5J 1RT3B 4ZDNA 4QW9A 2NXCA 5BXIA 4TU8A 4J9SA 2HFSA 3EMTA 3KJQB 1T9TA 4ZVSB 2CPIA 7FDRA 5IWAJ 2KL8A 2JFDA 1WACA 2VG6A 3HVTA 4X4QA 1VJWA 3GSDA 3H2UB 3RUBL 2HK2A 4NLOA 4YB7A 4L3NA 2FJDB 2E29A 3N4WA 1IQTA 4NLGA 3LP2B 2W9BA 4GC7A 1RTJA 2M8HA 3AHPA 1FD8A 2IJNA 4WK1A 3GV8B 5I42A 3IGVA 5ETSA 4LIWA 1JMTA 4LF4F 5LJ3Y 3C2PA 4EWTA 2KO1A 3OFGA 2CADA 3VF0B 4DU8A 2FY1A 3C6UA 2R8GA 2ZH8A 3CUNA 4LRFA 1VBZA 3D2WA 5KFQA 2IMWP 1UFKA 1NEEA 1HIYA 3KJFB 1J2VA 3QSIA 3MM6B 4WU3A 1ZM2A 2DGTA 3W9HA 4TU7A 4Y6IA 3JTPA 2DPJA 2VL1A 3BBFA 1YI2S 5LOQA 1FE4A 2CA9A 4QZVB 4BLGA 5F0UA 4KGVB 4UY8T 3EVOA 2PFFB 4HH0A 4ZPWR 3H2VE 2DGQA 3CD5A 2A10A 4O3NA 5THWA 2EKNA 3GG0A 3G8QA 1KVIA 2B3TB 5D3GA 1WI8A 1L3KA 2VC0A 5HVHA 2BEFA 2MZTA 1D1UA 4ZKAA 1OS5A 1IBLJ 2CQ3A 3ENAA 1M5PC 2GO9A 2WK4A 3FRZA 3GIRA 3OXFA 3RR8A 2VFTA 2M0GB 3CO9A 1VJQA 1T3NA 2UVVA 2MTLA 1HPZB 1N54B 4P2SA 1WF0A 3B4DA 3DOMA 3CCWA 2E7VA 4RJVA 5G0RB 3GSIA 2MKJA 2DNRA 3HF5A 3CJ4A 4OYPA 2P5VA 3W9IA 4X4PA 2JEIA 2XWXA 3FCWA 4U8YA 4C8NA 4Y34A 2KDOA 2IA6A 3EPGA 2DGVA 2L41A 2LQ9A 5AXLA 2B9EA 5C2CA 4O0NA 1T9XA 2D3UA 1OY6A 3HKZD 2UP1A 5DZ7A 4CO5A 2NQPA 2EBEA 5KOWA 1ZBTA 4ZPBA 2CZVC 1X4DA 4F7VA 2CQIA 3TQEA 2RU3A 3R1LA 2HGLA 3FEXB 1UVMA 1AW0A 4A4JA 2IAJA 2WONB 4MK7A 2KHCA 2DYAA 4OZ0A 4TU9A 3OPKA 1SJQA 2QX0A 2ZOGA 2D74B 2AX1A 1YZ7A 2I38A 1JLEA 2W24A 3ZTOA 2XLJA 3W62A 3DMJB 2G1HA 3IM9A 4J37A 3H5XA 3V5RA 4GKJJ 1MU2B 1D9DA 3M9OB 1U6BA 5CQGA 4F0HA 3GMGA 3K5PA 2ADBA 4EZ9A 5B0EA 3RTVA 4C11A 2KI2A 3OW2R 1A9NB 3ISZA 2HHHJ 5KFFA 3I4PA 3OD2A 2J9DE 4ZJLA 2CQ4A 4TY9A 3WHIA 4RLEA 2LP4A 4PR6A 5B08A 3G4SS 1ZZNA 4O23A 3TI0A 4NA2A 1T03A 3C15B 1T9UA 2B4VA 4DN9A 2I0XA 4NXNJ 1HW9A 5HK4A 2OPSB 2ZHBA 4YB6A 2OGUA 4I56A 4NX9A 2AX0A 2YXLA 4U7UD 1C2PA 1HNIA 2ABYA 2RRBA 3EYZA 1UFWA 1MSWD 3R3TA 2C3UA 4NYOA 1UVIA 4E0DA 4UOHA 2GMJA 4F4XA 1K0TA 5A0YA 3CULA 3I6PA 1PSDA 4OYAA 4BWJA 1RQ0A 2QLWA 4K0KJ 2XMTA 2XYPB 3DM2A 4QWEA 5A2QY 2XLIA 2EG2A 2JC1A 3MAAA 1XNRJ 4CRJA 1C1CA 2WCXA 2VQEF 1QUVA 1P8GA 5HBMB 1JKHA 2VIHA 4DF4A 1TL1B 2LU2A 3EGNA 3OQ2A 3C16A 1WF2A 3H25A 1EKSA 1Y11A 3QO9B 3Q23A 1UVNA 2AJQA 4P2XA 3PR4A 3GCWP 3IO1A 3N5BA 4PEOA 3KK1B 1PBUA 1NDCA 1RHKB 3TYTA 2YNIA 5D0EA 1N56A 5FD1A 3EZOA 3L7OA 2MZRA 1MMNA 4N7TA 2ASJA 4PUOB 2FHJA 4HH1A 3AA9A 2QIFA 1RAJA 2QLXA 4JI7F 2VFRA 4HHHA 3TVKA 4HHJA 4X4SA 1XMOF 1FK9B 1WC3A 2C2OB 3HJVA 3I5CA 1B70B 3CCRS 5LMUJ 2BQRA 4LF8F 1RAEB 4DG1B 5KFKA 2EG1A 4ID8A 4AUKA 4EBEA 4KT0C 5KT2A 1XTZA 4MK9A 4RWWA 4RNOA 1FNOA 2Z56B 2J7WA 3PIOQ 1ZTWA 3CMQA 1DQAA 5HBMA 1TMJA 2IHR1 3KK2A 1ZETA 1VYAA 1S9GB 3NBPB 1GX6A 1X31C 1KS2A 2W2OP 4WKYA 1RKIA 1S1TA 5A6WA 4KH1B 3K58A 1XBWA 2CQCA 3BSOA 2LQ8A 2CIMA 4LRCA 1GXTA 1M1HA 2QRRA 4H4MB 1C1BB 2VC1A 4YR2A 4OI0A 1YRTA 1H6KX 3M7VA 5H9FJ 3N5FA 1X4EA 2QMXA 2RILA 2Y9HA 3UN5A 4BBYA 2OLWA 5IC4B 4M95A 1TP7A 3Q8SB 5HQ8A 3P96A 4M5DB 3G6VA 5D0HA 3T1HF 4DJBA 4Y3CA 1CJKB 1NUEA 1S9EB 1GH8A 2L9WA 4XTTA 1CEZA 3JQMA 4KIAA 4U7UK 2RKIA 3GIKA 2CG4A 2D9PA 3FBEA 4C97A 5LSRA 2FTRA 5HVGA 1VHFA 3KG4A 3MOJB 2JVOA 3EDRB 1A6LA 3IS9A 5EX0A 4OLOA 1VQ4S 4CLSA 4R8UB 2H5EA 3IG1A 4DV3F 1NKEA 2QEXS 2ATLA 5KTQA 2ZOMA 3KLEB 1EETA 2OPQA 4UUXA 1U1LA 3HVTB 4Q45A 3H4BA 3LP2A 2UXCF 3W64A 3KHHA 4AL6A 4RNNA 3M9NB 5L1KA 5LSLA 3KNAA 1RTJB 2ZZTA 4DQQA 4P2FA 1EX8A 1LK5A 4LQ9A 3MEGA 1U6FA 1SIZA 1TTHB 1KSPA 3SZ2A 5ETKA 4X4OA 1HBMA 3P4UB 1N52B 3RB6A 4LF7J 4G1QA 2R7TA 1YTYA 4X66J 2MPUA 5KFCA 2AQ4A 2HQCA 4DSIA 4CLZA 3K57A 4ZLLA 1BQNA 1FRKA 2LFVA 3FQLA 3T5LA 3TJ8A 4Q8FA 4PYDA 2ZH1A 4HL9A 4JI6F 4DR6J 3OLAA 1Y3JA 4ED7A 4C3KA 1F3VA 4DR4F 5F9LA 4DL0C 3AT1B 4AD6A 2HIQA 4FDFA 1CJTB 2GO8A 2I5JB 5C42B 2KXNB 3VAKA 1AFJA 1YJ9S 1ZA1B 2WTFA 1VIXA 1B0PA 1RAAB 2W8LA 4RW4A 2ZJRQ 4WJBA 4DV7F 3MEGB 2ZZMA 2RMLA 2F4VF 4IUFA 2J6TA 4NOHA 1HBMB 2CPXA 4LRAA 4DFKA 3BGOP 4ZK7M 3UD3P 5DG7A 1PILA 2ACMA 1KFDA 5LMUF 3Q83A 2HNYA 2PFDA 2W25A 2VG5B 1GMWD 5L1JA 1U0HB 4P75A 5J1PA 3Q89A 2FHJD 1X5OA 2OAUA 1FDDA 5EN1A 2B6AB 4Q2LA 3M2RB 3MGJA 3M8ZA 4UT4A 4ECZA 3N6MA 2J7KA 2C3PA 2HVZA 3HLUA 1O6XA 3OL7A 3JB9k 3HXMA 2VOOA 1FEEA 2ZDPA 4RR5A 1TELA 1FTRA 1FXDA 4IFVB 2YWEA 1Q8BA 1IKVA 2YVSA 4WFZA 2ZHAA 3ENWA 3HX9A 5J1EB 4CLYA 2XCAA 3PJXA 2DNMA 1HWIA 2C3MA 1ZM4A 3AXMA 3B54A 4J9UE 4RO0A 4IG0B 1KQFB 3TA2A 5KFZA 1C4AA 1MWYA 1MU2A 1Q5YA 1RWNB 3FFIA 3GG1A 1YLXA 2DCUB 3GR1A 1WC4A 4QPTA 4WE1B 1UEUA 2VG5A 5A8RA 4URSA 4JBCA 4DR3J 3PW2A 4B3MF 2XZWA 3J7YU 1I1GA 2A0FB 2UUCJ 4Z2XA 2HGMA 5F0WA 2RDIA 3JSRA 3AA8A 4EZ6A 2RQMA 4RW4B 4EI2A 2BACA 1G6BA 2CPFA 3KUHA 2CJKA 2OEMA 1Q8KA 3EVMA 2DNNA 2A6OA 1ZM9A 3RGIA 1JLFA 3P3DA 3WC0A 2PI5A 4IDKA 4JI1F 4IG3A 2PC6A 1KDNA 4K2XA 4KH0B 3MD1A 3UPFA 2UXCJ 1TL3B 4IRDA 3M6VA 4OZLA 6FDRA 1JXLA 4QPXA 5KT7A 5JXSA 2CKWA 3NY0A 3R1HA 1IBKJ 1UKUA 5CZXA 1ITPA 3CB4A 4JOUA 1K73T 4C8OA 1KLMA 1VQNS 1CPZA 3GQCA 4LF7F 2BA9A 3TX0A 2Y0BB 2E9RX 3CJKB 3D66A 1NH8A 1VGYA 4DX8H 2XG8A 3VQSA 4QW8A 1YBTA 2HS0A 4FNIA 5EDWA 1EIYB 2QV6A 3KNGA 2A3JA 2RE1A 3DLLQ 3M8RA 1TVRB 5K8MA 1FFSB 1M0SA 1Z2LA 2UUWA 3CIMA 1DQ9A 3ULHA 4XAKA 3UW1A 3J81j 1WOOA 8RUCA 2ZE2B 3CC2S 4IO9Q 4DF8A 2ZH7A 2HRUA 1NNDA 2CJXB 2GHWA 3FVYA 3OTBA 1JJ2R 1LWFB 4B3OA 1TFYA 2KXFA 4Y2MA 4NPOA 2LDYA 1RWVB 2XBPA 3P5BP 1LFPA 1SH3A 4UTGA 3LH2S 4DV7J 1UWBA 1RT1B 4RWXA 5F3TA 3PJWA 1QSYA 3LPYA 3FUYA 1WKLA 1ACMB 4DDFA 3LGNA 1CJVA 3G8SA 3KLGA 3EGVA 3KHGA 5L9XA 3LWMA 3AOAA 4ZVQB 1GNKA 3OLBA 2W4DA 4RNMA 1RI7A 3LALA 4DG1A 3GV7B 1ULRA 3OSPA 1JLGA 5F8NA 5AE2A 1Y0HA 1YJTA 2CWKA 2YQ0A 4QCLA 1NK4A 4IG3B 3V4IB 4LREA 1VC6A 4TXSA 3HSJA 3DOMB 1DTTA 1EJ7L 2R3VA 3D4JA 3E01B 3MEDA 4ZP6A 1S1TB 3ISNC 4OHXA 4WK3A 4DOZA 2BR0A 3SDEB 1WTBA 1DURA 1NJXA 2DRBA 4NCAA 2ACYA 2QYCA 1S49A 2D69A 1FJGF 4ANDA 3O6QA 4CYUA 2LQBA 3DRYA 3WZ0A 2XQCA 2ZM6J 1QVGR 1Q95G 1T02A 4LF5F 2J8AA 2UV8G 5CH7B 2LA6A 1KLNA 1IR0A 2JLFA 3MEKA 1BWEA 4ZCLA 1I3OB 2R7OA 3H40A 3DNCA 5AJ3F 3QSYB 3K89A 2V4JB 2AHOB 2HAFA 1X4BA 3J81U 1HI1A 1E6VA 1C0TB 1YJRA 4Q2MA 1RTIB 4F02A 6FD1A 3RRGA 5L8RC 2K2PA 2AMCB 3NXZA 3RB3A 4X4UA 2K1RA 3EJMA 2NCKL 4USMA 3CWJA 2DVIA 1UA0A 1HNXF 2W2MP 3D68A 3MM5A 1RAGB 1AT1B 2EXUA 2L3MA 4USIA 2XI2A 3ZTPA 3L95X 2M3DA 1VOMA 4ZP7A 4LSNA 3NKYA 4L72B 1QY7A 4RUHA 2VICA 3V2UC 1EQ0A 1R7IA 2V63A 1FKPB 4IFYA 3O3LA 2VD3A 4K4UA 2N7CA 1DTTB 2C2KB 3DOLB 3GIMA 2LKZA 2VJUA 4HR2A 3BN4A 3KLHB 3TX8A 1DTQA 2G4BA 2J0SD 2AZ3A 4KGZB 1RAHB 1RBLA 5F3ZA 5IXUA 2GQCA 3ETOA 3HM9A 1RA7A 5DG8A 4JI8J 1X4AA 3K5OA 3DLKA 3ZFVA 2JX2A 2KVQE 3TO8A 4DL6A 2JH3A 5C42A 2F8MA 2L48A 5T7LA 2BZ2A 3D6FB 3H0PA 3JSMA 1UPPA 2X3GA 1IWAA 1RHQB 1PG5B 4J90A 1IBCB 2HKEA 3D0GE 2HBYB 1S59A 2QMUB 3Q2TC 3B82A 4Q44A 1HMVA 2IC3A 1F5CA 1NHUA 1OSDA 3CXCR 3DLGA 4I7FB 4KPCA 4PPZA 2N3LA 3NNCA 2E9ZA 3M2UB 2YNIB 5KFXA 3E2EA 3DRRB 1UEVA 4OZNA 3DGVA 2XMMA 3M8SA 1SCJB 1RXOB 2PEBA 3NG8A 4TLQA 4ERDA 1QUPA 1HHQA 4C11B 3OFFA 3GIJA 3LP1A 2FPHX 2QLFB 1KBRA 2DISA 2XZDB 2HGNA 2Z2LA 1FWLA 2DXEA 4DN0A 2HHTA 1FNMA 4FBUA 2JSXA 2YWHA 3LF0A 2AJFE 2GQ2A 2SXLA 4JV0A 2NSCA 3PG9A 1RT2A 4YN3B 1E6YA 3C6TA 2ZJPQ 2F40A 2HAIA 4TKTA 4O3OA 2H54B 1Y5IB 2WSCC 4NXMJ 1SJ1A 4J9QA 2DGOA 1AUDA 3BREA 4OZ2A 3J7ZT 4J9MA 3TW0A 2O66A 4OYBA 2HVIA 2C42A 5AJ3J 2ZHOA 4P52A 1VC0A 2FVSA 2WB1D 3K5MA 2YNFA 3IBWA 4WFYA 3PW0A 2CJAA 1DY3A 4IH5A 1NK5A 2WBRA 3BGLA 3CCZA 1XJWB 2OSRA 3MAAB 3POTA 4NCGB 2YX1A 1C1CB 3HHLA 1XNQF 4QU7A 1LNQA 3PRBA 4Q0BA 2FHKA 5CA5A 3NLCA 4JYAJ 4NA3A 2ZH2A 1HMVB 1R3NA 1RWUA 2DH7A 2IC3B 5KFTA 4MJKA 2RNEA 4RPFA 1GFWB 2MHNA 4WFNQ 4IRCA 2HVEA 3IG1B 1S10A 3W5ZA 3GJSB 1RHJB 2GW8A 4DX7A 5JJBA 1ZH5A 4I2QB 3PX0A 1DJ0A 1RDRA 1D9FA 4H4OB 4OQJA 5A8WB 3VGVA 2OH2A 1JLCB 1RWPB 2FVCA 4NXNF 4CM2A 5DGAA 2VOPA 3D1HA 3CCJS 2W4CA 3CJ3A 3HI9A 2B51A 3MPDA 2BVZA 4ICLB 4M5DA 1LWEA 1I94F 3NS7B 4F2RA 1RP5A 3KLFA 1VQOS 2YTCA 3NOCA 3SSRA 2MQOA 3BBCA 3TUPA 2HNDA 2CNKB 4ZN3A 1TKZA 1HBNA 1ZA2B 1RB0A 2DXFA 3CMAS 3UCUP 4CLKA 2GVZA 4X4TA 2HSEB 1F3FA 3HT3A 1HNWJ 2BJ7A 2VKRA 4RW8A 5C24B 3FCVA 3DRPB 4RW9A 5FLXU 3HK2A 1FJ7A 2GA7A 4R8UA 1TL7A 4M5GA 5CYMB 2VQEJ 2H1YA 1JX4A 5JVGQ 4NRTA 3KLEA 3ITHB 3AB2B 1L3VA 3VGTA 4CO1A 4PG5A 1YIJS 4IYQA 3ET6A 4DV4F 4IRKA 1W7WA 1MMDA 2E44A 4A8SA 3U1MA 1NJIT 1LWEB 2WW4A 3CW2C 4I4BA 1G4CA 3DRXA 1T03B 4JI4F 2MZQA 2ZOFA 3QGHA 5CZVA 2APOA 4AFFA 2M70A 3IWLA 3MWBA 3TA0A 3VAGA 4ER8A 2FJXA 4PWDB 1S1UB 2J76E 4W90B 3NCRA 3BH7B 3V81B 1GTEA 2HNYB 1R6YA 2B5JA 5H9EK 3GILA 3FBBA 1VK8A 3QAEA 3MI7X 4LBIA 2ILZA 1M1KT 4DL2A 3QIDA 3NGSA 2EFPA 1LWXA 3D9BA 2LECA 1HNVA 4IOCQ 1RCXB 2RU9A 3ITHA 3MMAB 2IJFA 3NGTA 1X0PA 1FCAA 3BPSP 1JK9B 4RX6A 3EGZA 1JLBB 3J81Y 3M30A 2V34A 1SQFA 1GXUA 2FGOA 5J2NB 4A8YA 2VKZG 4D3GA 1R0AA 1QAXA 3WBZA 1YZ6A 1KWMA 4K5SA 4OJHA 4WXWA 4PYAA 3BO2A 3LGHA 1WWHA 4Y2KA 5J1NA 5GAHI 3UNGC 1S1UA 3LA0A 4ES1A 1S97A 3QATA 4LFCF 2CRLA 2W1BA 3AH6A 4HHUA 4EO6A 1OY9A 2XM3A 3DXBA 2IM2A 1S0MA 2H5JB 3GIIA 3K59A 4BDPA 5E41A 2LXIA 2JC0A 1TV6B 3QIPA 5L1LA 1FF2A 3IP0A 2MGZB 2RQCA 4F4YA 2H65B 3G2XA 1V6HA 3FBCA 2ZBPA 4RU9A 2U2FA 3DLHA 4UY85 1UVJA 2W7OA 5B0DA 2AIRB 3IBFB 4X66F 5EWFA 3CDAA 4DQPA 4FYDA 1Q8IA 5J2QB 4NRUA 3PHTA 4DR5J 1RT6B 3IBCB 3W2WA 2RRAA 2BDPA 2OELA 3NCPA 1VCTA 1Y10A 4XO0A 1C4CA 4NLUA 2LQJA 1FKPA 4IFYB 2X1GA 4L75A 1R0AB 4F0KA 1U1NA 3H5UA 1LWCB 3GFHA 4OL8A 3FSIA 4FNHA 9ATCB 1GMWA 5GVQA 3T5JA 1TL4A 4J9KA 3PX4A 2HVDA 3TJAA 2CPEA 3PW4A 1VISA 3RR7A 3QGPA 1UZHA 3M1VB 3FFIB 4L73A 3QIPB 3US5A 2FJBB 5C2GA 1RABB 1FNXH 1OIAA 1S1XB 5HLFA 2CAJA 2PGCA 2MJNA 3BR9A 3ILJA 1NH7A 4FZVA 4HVZA 5EUHA 4C48A 1T3OA 3HSGA 1QM9A 3GB0A 4EYHB 4F4AA 4CQ1A 4OJ1A 2AU0A 1RT7A 1X5PA 2W01A 2CXEA 2GHVC 5KG4A 2M8DB 2G13A 1HPZA 3G87A 4USKA 1G2EA 3I55S 2DNGA 4DPYA 1T05B 2R8JA 2W2NP 4M8LA 2QA4S 5C7PA 3DYAB 3J7AN 1HWUA 1F6TA 4F4WA 1FHTA 1JLAB 3THTA 1S5ZA 1DBDA 1UL3A 5IC6B 4X4RA 5DQHA 1VQ7S 4Q8EA 3RBEA 1TK5A 3W60A 2CQDA 4NYZA 1KD1T 1DHMA 1G7CB 2IIHA 2DK2A 4LF1A 4QIGA 2Y8WA 1RGVA 4X2BA 5HQLA 5KFUA 4Z7YA 4CCHA 3BYPA 5ETMA 2XC9A 1RT7B 2YH1A 1ZAVA 4LR8A 3E01A 4ANCA 5A76A 2AEMA 2FY8A 5HL7Q 1S99A 3D6TB 5U47A 1NB7A 1RBOB 2BOAA 3UR3C 2HMIA 4MMOA 5LL6d 4DL7A 3A8KA 4YEAA 5KT6A 1QTMA 2QN6B 1LFWA 2V2ZA 4MYTA 2EWHA 3PEHA 4TN2A 1NK9A 2UUAF 1L3UA 5CYJA 1O51A 2MQ8A 1S6PA 2V8DA 2ZUAA 2DNPA 3AOCA 3MMCA 3S7RA 3UVJB 2W9AA 3SV3A 2OTJS 3MM8A 1CJVB 1QE1A 2C2EA 4DMZA 4ED2A 1T95A 5J2PB 3DRSB 3W3SA 3MAHA 3ZZUA 1MMLA 3KLIB 4NMLA 3KOAA 1HBOB 4C7QA 1NKBA 1P6TA 2C2MB 3DOKA 1SVDA 3HSDA 1QSLA 4K0KF 1CS4A 1UPMB 3J80U 4FF1A 4FF4A 3BKUA 1NSQA 1XNRF 4B3OB 2IY5B 2RF2A 2B8QA 3U02A 3OTDA 2J9CA 2BKOA 1RAOA 5KT3A 3GLJA 3DYAA 2CZ4A 3Q8RB 1R8AA 1NMEB 1WHXA 1WG5A 4X84A 2KM8B 4I2QA 3CTRA 3GZ7A 4ES2A 1SUQB 1X9MA 3GONA 3M2VA 2Z58B 1PJ5A 4OI3A 4USVA 3OXLA 2VASA 2R42A 3ISND 1EQMA 1HQUB 1VIOA 2BKPA 1TK8A 4IR1A 2NUHA 5D0RA 2Z4PA 2RS8A 4YDXA 3N6NA 2QA1A 4PWDA 4EK2A 5HMXA 5KFRA 3DGPB 5LMNJ 3GJTB 3BQ2A 3AJ1A 3A13A 2B7CB 4P72A 3ZZ0A 1F60B 2UV8A 5CYMA 2R7UA 4NLVA 2UUTA 3TZZA 3MMCB 2XO6A 2CVEA 2HHVA 4QU6A 1R31A 1UMJA 1V5VA 3R2CJ 4L3KA 5CD4A 3DKDA 1MNEA 1X9WA 1IR1A 4CO3A 4ENOA 4PRFA 4O44B 1KNZA 4KE5A 2CQ0A 3GU0A 3HKWA 2NYHA 4WBFA 1HHTP 1FWPA 2DT9A 4PKDB 3TVYA 4YMEA 1NJZA 1RWOB 3MOZA 3QJLA 4K4SA 1C0UB 4KBIA 3ZNUA 3HP6A 3IR6B 4I2PB 2M5YA 2Q6CA 2BJ1A 3M32A 3PYEA 1VR6A 1U8WA 5GAGU 2MEWA 3R2DJ 4TQRA 1HWJA 2G2YA 2WVEA 1UP1A 3HHDA 3IR7B 1TKDA 1BQMA 5BYQA 3H7HB 3OL8A 2W9BB 2BQUA 2WW8A 4QYZJ 3JYTA 5I42B 4Q43A 4CIOA 5F8GA 3R27A 2OMOA 2G2ZA 2VBXA 5E33A 1WKJA 4LF6F 3AJ2A 4C8YA 3CJRA 2Z2MA 1CJUB 3Q8UA 1JLBA 1MW7A 4PXCA 1SJFA 3MXHP 2HK3A 2EFOA 3CJTA 4OYOA 5K8PA 1VBYA 2OP5A 2ZE2A 4OLPA 2WVDA 3D1OA 2G2OA 1HWKA 3D54A 5IT9Y 1RUSA 2AEFA 2O1PA 2GHPA 2MJUA 4OV1A 2D1CA 3A12A 2UVUA 1KP6A 5K14B 3CDBA 1WEYA 2XNRA 1PYSB 2GMLA 2P9EA 1S0VA 3KJVA 1KEKA 4PABA 3BB5A 5KG7A 3KLGB 3EICA 2FIUA 3DDNA 1RWKB 2VPWB 4WP8A 4YY3J 3T5KA 1Z1ZA 2ZEJA 1Q8LA 3PFEA 2K06A 1FRJA 2RKIB 3MD3A 2I9SA 1NU4A 2BJEA 3QMQA 3BJYA 2KZZA 2Y1LB 4JI8F 1OQ3A 5D4PA 1FA0A 3PO5A 3GYXB 3U1NA 4FBTA 5ETLA 5D77A 1SL1A 4LFAF 4X62F 2JNJA 5GMKa 4LJMA 5EWGA 4Q5VA 1Q16B 2FHMA 3QYYA 4I64A 1M5OC 4B9TA 3BGUA 3GFXA 1UEKA 2BABA 4M5LA 4U7CA 1PAUB 2A6MA 4YUDA 5RUBA 3MR6A 4FS1A 1V5IB 4ECSA 3CMES 4B9LA 3W2VB 3IA0A 4TLRA 4ED6A 4RW7A 3OHAA 1BQMB 4WXOA 2IM0A 4RL1A 1VQSA 3M8WA 4HACA 3CF5Q 2D3ZA 3PRVA 4CLUA 2XZTB 2YKOA 4P74A 2NS1B 3M4XA 3PJ9A 4OYIA 2UU9J 2MQNA 2DY1A 3I0RB 5F41A 1RT5B 4CO0A 1QLNA 1F2GA 2B4OA 2HQ3A 1PJ6A 2IFXA 1QD1A 4KC5A 2QLJB 1HQ2A 1PAEX 2IRXA 2HLUA 4MFBB 1N6QA 3DI6A 3ELHA 1U6ZA 3SIPB 1C0TA 5B0GA 2ZH5A 4QQBA 1HARA 2BM1A 2RQ4A 2WZ1A 3UDEA 3CJ0A 1IKWA 3IGNA 2VPXB 3BEGB 4USUA 5FJ4A 1S57A 3UCGA 1O0PA 2UZAA 5EHHA 2ZBIA 3W2VA 1N88A 4WYLA 1FO1A 2R7XA 3A1YG 2MZSA 3AODA 4OYWA 4U8VA 4F3MA 4QWCA 5AXMA 2VFVA 3PIPQ 5H9EJ 2AD9A 1U1PA 1TKTB 1K0VA 2J7UA 1HW8A 1WHYA 2HQIA 1WDDA 2ZNYA 5ETOA 3WDOA 5GAEI 1BD6A 4DR3F 3HFZB 1S9GA 3M8PA 3RRHA 4U96A 1JQGA 1U1QA 1S1VB 4ID5B 4QIVA 4C98A 5J1EA 1HNIB 3D0HE 2BW7A 1J5OA 4MFBA 1N6QB 2XULA 2DRDA 4DPUA 1LW0B 3ENVA 2B9XA 2R2TA 3V6JA 3TANA 5H1SV 2R8HA 1CVJA 2W7AA 1JJHA 2PN6A 5DLGA 3G71S 2VQFJ 1N5YA 2QMWA 2P8IA 1JLCA 3CJ5A 1REGX 4N76A 2DH9A 2B4UA 1OYDA 1DFDA 1YRXA 4UOFA 3W63A 3HZEA 4DSKA 2CJBA 3TP2A 1KVKA 4H4KA 5M2PA 2FJWA 3HJFA 3C8YA 3TARA 1N4LA 1LKZA 1RT5A 4MTPA 1VRTA 1U2FA 2W2QP 3NP5A 4C0OC 4DV0F 1I6JA 2JDJA 2CNOB 4M94A 3A3NB 1HBOA 5ITHA 1PIEA 1RYSA 1SH0A 2CQPA 3F44A 1ZTTA 4GVBB 4LFBF 4QJVA 5J2MA 2CQ1A 3KK1A 2BRLA 2CJ9A 1VK3A 1I94J 1T7PA 4KSEB 4WE1A 5A6PA 4C6AA 3BZQA 1KKHA 4DX5A 2ZJQQ 1ZZFA 4QBUA 5SZTA 3VR1A 5ETVA 1Q53A 2CPYA 5FDLA 1SXLA 4X62J 5GADU 4JI3F 5E0OA 4DUYF 3G6YA 4QIEA 5KFDA 3W2WB 4X65J 3WX8A 2J8SA 4WP9A 4RW6A 5ETTA 1U2CA 3NNAA 3AXKA 3PEJA 1SL0A 3G86A 2KRBA 3CD0A 1F5BA 2C3YA 1SJRA 4K4YA 1NXIA 3OFHA 4OI6A 3OVBA 3AFGA 3UE2A 1HYSB 1H2TZ 4ZCMA 3T6JA 1FJEB 3R7SB 4ZCIA 2FZGB 4K7QA 2XTJP 3MR3A 2EKYA 2DIVA 3HZGA 3RBZA 3O1LA 4CT9A 1WOPA 3TAPA 4USJC 4Y2CA 3MTJA 2BOPA 2MQLA 2GAHC 4N77A 3T9ZA 3MMAA 3QJJA 2GJ2A 2PMWA 4QR0A 4USTA 2CJYB 4ED8A 1BC6A 2BANB 3F41A 1HNWF 4CTAA 1CBKA 2XGQA 4Q0BB 1X4HA 4HI1A 1LXJA 1P1TA 3HCXA 3S01A 2FJAB 3K8VA 1TKXA 2FYXA 1RT3A 2H4YB 3Q22A 3IRXA 1Q4RA 3KDOA 1HWLA 2OPSA 4YB5A 4ZLPA 4B3SF 1GMVA 2OD4A 4LUBA 4OZ5A 3RBDA 1VQKS 3WC2A 5AE3A 2CQGA 4XDDA 4WKRA 5KG3A 1QVFR 1TV6A 4EUVA 3QRQA 4LT6A 1JXEA 2DY9A 4FXWA 2AGPA 5FDLB 2AV5A 4WTYA 1YKWA 2Q6BA 4RU2A 2HHUA 1Y5NB 2ZD1B 1H72C 2V9KA 4ZHRB 1T9WA 3MR7A 4CDIA 4DLEA 4KR0B 1VHIA 1EP4A 4CTAB 5CYQA 2ZH6A 4ILMA 1FX2A 5K5MA 5D6GA 4GKJF 2ZFHA 4C8ZA 3CCVS 4DPOA 1IJFB 3GYGA 1SKWA 2V9WA 3P6YC 1Y3KA 2O01C 4F04B 1TL1A 4EBCA 4KV8A 1TKZB 3OHBA 1YITS 4F67A 3K5NA 5KG0A 3VAIA 1RLDA 3QO9A 4QIFA 4TYAA 5KG1A 1A0OB 3OUYB 2B8PA 3FNNA 3MMJA 3TWZA 2YX4A 2YKMA 3T41A 4DUZF 4F25A 4DV0J 3SEOA 2V67A 1S6PB 2EC2A 5L9NA 3KHLA 2NXUA 2MY7A 4GKKJ 5AE1A 1NSKL 3AQPA 3JTOA 3MECA 2L9DA 1AXQA 2B43A 1CJTA 4LBHA 2CPZA 1TUVA 2R9LA 3OVAA 2ZD1A 2D7SA 4TVAB 5BJRA 1DLOA 4LFCJ 1JLQB 1VI7A 4A47A 2B4PA 1ZYQA 1AZSA 4ZVRB 5KFLA 4IDKB 4M5NA 2DNYA 2MLXA 4PXEA 4DUYJ 4LQ3A 3R7NB 1JNRB 3MZIA 2RF2B 5K9FA 3ZNJ1 4DV1J 4DFJA 2OJ3A 1U02A 2F65A 4ZCKA 4I67A 1CSJA 2LDIA 4GC6A 1DTQB 1QAJA 3QRRA 1J27A 3M8QA 2IPOB 5E7OB 4JI2F 4H4MA 4Y00A 3BSAA 3VHQA 8AT1B 1VC5A 1JWWA 2VHGA 4KGXB 2NYIA 1NZ8A 1UAWA 2DHXA 2JLGA 2VPYB 3TAMA 3TEHB 2G9OA 2W9CB 3B6BA 1HNZF 3CO0P 3JAMU 1QDUB 2ZKTA 3CJSA 3R6GB 4CLPA 2DHAA 2DJWA 2HLTA 2FLOA 4DCOB 1ZAXA 2CNLB 1ZM3A 2F4FA 1AB8A 3E3XA 2HQFA 2KKHA 4J9VA 3TRGA 5KFWA 4B9VA 4O3RA 2LLZA 2VPZB 1UVKA 1FRHA 2OPRA 3LP0B 1B0VA 2VODA 3UDLA 1S79A 1Y5LB 2XYGB 3DLKB 1G1XA 4OHWA 1SV5B 3MM7B 3KLVA 1W25A 2VV5A 4RBUA 4NXMF 3O5TB 3UN3A 2Z2YB 5D15A 2V2VA 3EZUA 4WFAQ 4NEZA 3RW7A 1X4FA 1SJ4P 4JI0J 2A18A 4NI2A 5IWAF 3PR5B 4OX8A 3OJUA 5IV4A 2W9CA 4HDHA 4FS2A 1TKTA 2R4FA 1ELOA 3PTWA 3R5JB 4L6V3 1W26A 4WF9Q 3D1QA 3DLGB 3HHEA 3MCMA 1P1LA 3A4TA 3KG1A 4I7FA 4KY3A 2YX7A 2GZOA 1N5TA 4ZVOB 1YHQS 2P6TA 3KTQA 4YY3F 1RACB 2FLLA 2YNHA 4ELVA 4O3SA 2FC9A 4PQAA 2XS7A 2AP6A 3SDEA 3IRWP 2C1EB 2E1AA 2OPRB 3RAQA 4JB8B 1YWXA 3UDCA 4CO2A 2V8HA 2C2NA 1KTVA 4N41A 2ALYB 1S7IA 2EFNA 3BKTA 4G6VB 2Y0SD 2PD1A 2H9ZA 3NCQA 3RZAA 2RD5C 2GJFA 8ATCB 2MLYA 3MEEB 3QFWA 4O44A 5I3PA 3VAHA 1IM6A 3Q2SC 1LV5A 5KFEA 1VQMS 2VJVA 3SBMA 3G8TA 2ZBRA 2BXJA 4URGA 2DO0A 2XWYA 2ZNZA 1WDTA 2I2YA 4JUZA 3AQOA 3KK3B 5DDOC 1FD2A 4GO7X 5MAOA 3MR2A 4XPCA 1IBLF 2XHWA 4FP9A 4Z7CA 2W8KA 2E9TA 4ZLJA 1YJUA 1MN7A 1R8BA 2P9GA 3NWRA 3POTB 1CQNA 2U1AA 5A0YB 4DS4A 2FLNA 3PCOB 4DV1F 3DXSX 2J5AA 2FQQB 3MM5B 1NJWA 3I96A 3HHLB 3CCES 3MAQA 1IKXA 3CCQS 1T8EA 3LANA 5DQGA 2EBGA 4QR1A 4NE9C 2FVRA 3IM8A 3OR2A 2CDRB 5AT1B 3T1YJ 2DNHA 4Q7AA 3BSCA 3FGVA 1NK7A 2UXBF 4DR4J 1V3SA 5IM0A 1B0TA 3CC4S 3ZXWA 4P10A 1T94A 2GVDB 1DQ8A 1KQGB 1R27B 1T9YA 3I9ZA 1DZ5A 3CE8A 5DZ6A 3IR5B 3NGDA 2IRYA 2QL9B 3CNQP 4H4OA 1TL7B 1X60A 5A8WA 5I3UA 4PG4A 4HKQA 2RHQB 4OI2A 3I56S 1RAFB 3G6ES 2BJ9A 1X4GA 4D3HA 5DQIA 2LXFA 4A8MP 4NLDA 2D41A 2WAQD 1UETA 2V2KA 2HURA 2MKYA 4HYKA 4M5KA 2LVWA 2CVIA 3B4MA 1XR7A 2HNDB 2V8VA 3D6HB 1CJUA 1TAQA 4ZPDA 5B0FA 3PVXA 2OFGX 4A8WA 3DOKB 1HNXJ 2FZCB 2HBQB 3R5AA 4DUTA 5BR8J 1BLUA 5D4LA 5HATA 1AUSL 3NBPA 4O4GB 3GP9A 4PG6A 2ILYA 1G3OA 1REVA 2HQGA 3NAHA 1S48A 3LGMA 4ANEA 3VAFA 2R2UA 1SKRA 1HR0J 3VZIA 2CUYA 3ZZPA 2F9JA 2IRUA 4ELTA 1WC6A 2HWHA 2DR6A 4C8LA 2GIQA 2KT3A 3FC9A 1B7YB 1FK9A 1WORA 4AL5A 2KU7A 4KFBA 4L74A 2BBEA 1IM4A 4TY8A 1O8BA 4RNFA 4I6YA 5A2QU 1U26A 4OZ1A 2RJZA 4RBTA 1GEHA 2ZH9A 1Y7PA 2QLBB 1EHWA 2HZVA 1E6YB 4C8MA 3DFEA 2CYYA 3BH6B 5KFNA 4K5RA 4DV5F 1L3TA 2HHXA 2K7JA 2LEAA 3SCKE 5G0RA 1RISA 3MTKA 4NASA 2H51B 2J9DA 3DMJA 1RA6A 2HFNA 1WF1A 2MKSA 1O5JA 2WSFC 1NO8A 3FDSA 2BMBA 4WYWA 2YKAA 2HHSA 3D6MB 4KQZA 4BC9A 4E8UA 5DM7Q 3RW6A 1U0SA 4ZVFA 2BJDA 3VTIA 3DLBA 1HNVB 1M5KC 2NR0A 4BHQA 1BUXA 1NDPA 4OYMA 3D67A 3R6LB 1NDKA 1VRUB 4PWWA 4ILLA 1S4EA 5BYSA 3DU6A 4LFAJ 5IZHA 4U95A 4ZVEA 4WCEQ 3HD1A 3THPA 1XMQJ 2VUGA 2F8EX 4O0IA 1JJ4A 3Q86A 2AYBA 4CH0S 4CWBA 4F2SA 1IR2A 2EVZA 3BQ1A 1JLQA 3N6LA 5E2QA 1K1QA 3PDNA 4FPRA 3HVWA 3K8WA 3NGRA 2QGFB 2N4DA 1X7VA 3BDEA 1RT4B 4LF8J 4OMFG 1H2UX 2HEKA 5C5JA 2YNGB 4EEYA 3PKMA 5KFIA 1T11A 5KG6A 1WTFA 4MAKA 2UU9F 1R43A 3KG0A 2FGCA 4ECXA 1N48A 2RS2A 1PKUA 4WZQA 4KRWA 2DGWA 3LP1B 2WOMA 2VDHA 4DL4A 4CYUB 2WVFA 4Y2AA 2IVMA 1MROA 1TR0A 4NLQA 1VQPS 5D78A 2PSZA 3HPOA 2ASLA 1Y4ZB 2NPFA 2AYGA 3HFVA 3ZTSA 1JKHB 1XK8A 4DPWA 3W8PA 1VRTB 3PRDA 3IWXA 2RDJA 1OPIA 2UUBF 3V4MA 4C3LA 2BE2B 3HT0A 1D8YA 2Z0GA 2R7VA 2FDNA 2VH7A 4YP3A 2DR5A 3Q0AA 4ECQA 3PNIA 4ZMMA 4F8RA 4ZVTB 5DM6Q 3LUYA 3Q24A 3VALA 5CXTA 3DCAA 4YS2A 1GTHA 2XNQA 3F56A 3FMWA 2UVRA 5HN0A 2AGOA 1U45A 1A7GE 4ZA1A 1WSRA 2OIHA 4FYVB 2DIUA 3BF4A 2VF3A 3VV2B 1PGZA 3AOBA 1HR0F 1S76D 3M2RA 2C2ZB 4C9DA 3EVWA 4MKYA 2ZWPA 4ED5A 2M4MA 3C16B 3SYZA 4FXVA 4WFXA 2G1DA 1TU0B 1LW2A 3ZZZA 1S6UA 2V5HG 2DO4A 5D4OA 4QWAA 1U8SA 3BO4A 3SXLA 4LMZA 5D8HB 2LMIA 2MYFA 3MFIA 5KG5A 3H98A 2GS8A 2VG6B 4A46A 2UXDF 4QYZK 2HBRB 4EO8A 2HHPA 3WQPA 2G0JA 3EM1A 4HI2A 2HFUA 3KMSA 2QTWA 5HAOA 4A8QA 4C4WA 1S6OA 4YOEA 4AXIA 4B9MA 2BYCA 4MIWA 4WIQA 4ZHRA 3MURP 2RAQA 2KM8C 4DR7F 2HNZB 3KWMA 1FX4A 1GMUA 1QE1B 5DG9A 2KHDA 4FYWB 1XMBA 3H42A 4LF2A 3ILLA 2AYEA 2JEJA 2W4PA 1D09B 2MHEA 1PYOB 1U1OA 4GO5X 2XYHB 1FRIA 1GT8A 2OPPB 1R0CB 1N5QA 1Q5VA 2I6WA 1HQEB 4W98A 1MG7A 1TKXB 5HVFA 5E5NA 4DV4J 2PEHA 3W5YA 2LA4A 1HNZJ 2A2CA 2VFUA 3H59A 4JP8A 1H0HB 2IYGA 4PXBA 1S6QB 4YQWA 3OTOF 2BJ3A 1VBXA 3CDUA 3IAM9 3NEKA 1OWXA 4H54A 4B3RJ 4JV5J 3PHEA 1XEZA 1N34J 1U1RA 2F5GA 4OI4A 2MZJA 2AYMA 2LCWA 3L09A 3CCUS 2F4VJ 5D3GB 2R2RA 2YH0A 3DDKA 1K8AT 4WP3A 4IR9A 3H8YA 1WJ9A 2VBWA 2BANA 4MIAA 4IOBA 4P9SA 1S12A 1SQGA 2RDDA 3HSZA 4USHA 3CCMS 5CYQB 2O67A 3V6HA 2EW9A 2PDAA 1TFWA 1HL6A 1VRQC 3G96A 1TVRA 1Y9OA 4M5IA 2KFNA 2XMKA 1WC5A 2HHQA 1NK6A 2GVDA 4LSLB 1SC3B 1RU1A 3JQJA 5KFYA 2ZC4A 2B5JB 2ZWOA 1LW0A 4LR9A 1KQKA 2J0WA 2O5DA 4FVCA 4QWDA 2GGPA 1OPZA 5LT5A 5GAEU 4B02A 3AJDA 4P71A 3M1VA 3GCXP 4O3PA 2OSQA 1V3ZA 4QYRA 3TJ9A 3PM9A 3KUGA 4CLTA 3THVA 2K7KA 1YJ7A 3ZO7A 1I5OB 4DL5A 3K0JA 1M90T 2FB0A 1M5SA 1FKAF 5HROB 4HEA9 5KFPA 3OBIA 3H20A 2KFYA 4FYXB 2V8GA 2FC8A 3LPEA 3RAXA 1LEOA 2RHSB 2DR7A 3ZZOA 4BC7A 4G1QB 5L38A 1KHVA 1JLEB 3UFCX 1QJHA 1F0XA 1U2RA 2I8EA 2Q79A 2HZAA 2X3DA 2XSJB 2QO3A 2ZVIA 3IXQA 4J91A 5J2MB 1FWKA 1LOUA 5KFOA 3OSNA 3OUYA 4DR5F 2DR8A 4ZVUB 4WTOB 4U6PA 3HHLC 3KYLA 2B9YA 4WIIA 3F0NA 4PZVA 2UUCF 1RJJA 5GAGI 4NLXA 3G6XA 2DNZA 2E7WA 1PBAA 2QYGA 2H3EB 3PFOA 5ADZA 4TY8B 2PMZD 4DPTA 5IS2A 1YGYA 3MPYA 1WELA 3N79A 5HI7A 5KG2A 4WZMA 1M1GA 4OX7A 4B3SJ 1SC4B 3LAKA 2YWFA 2CQ2A 3QT7A 4KGMA 3EPIA 3SI8A 1JLGB 4DUZJ 2ERRA 4E2FB 1U49A 3W8GA 4RW6B 4ED0A 4J7CA 1VQ5S 5GADI 3IN5A 1W2BR 2IDEA 1PC4A 2YNHB 2OEKA 5FLXY 2DPIA 1EAYC 1HBUB 5IQ6A 4CM0A 4NEYA 4DXLA 1XNQJ 2Y8YA 3F73A 2R7SA 4RW8B 3M8QB 4DQSA 3BN7A 2GV1A 4JV1A 3AD8C 3DM2B 2E1CA 2D3O1 5KOXA 4JYAF 2RH3A 3OV7A 1XN9A 2XY6A 5DDQC 1R6VA 1S1WA 3TEGA 2FLPA 4FPIA 2XMAA 4ED4A 3OL6A 5HROA 2X1FA 2RVJA 4CH7A 3BDPA 1I51B 4K4TA 4B3RF 4JV5F 1APSA 2XSFA 4C2MA 2GNKA 3NS5A 2O3DA 1IKVB 4DX6A 4JI2J 4OX9F 3SCIE 2KT2A 1E6VB 4IH7A 4R25A 5CCMA 4LVNP 2VA3A 3D0IE 1D9AA 4IQMA 3PXGa 3T1HJ 1TL3A 3SSSA 3GWCA 1N5VA 1S4FA 3GJRB 2M7SA 1FJCA 2YNGA 1RHMB 2P9CA 3AD9C 4NL5A 1IXKA 3L7UA 5K14A 3OFEA 4RNHA 2V0NA 3J7YI 1UWAA 3PYDA 2ZVSA 4RW7B 2KXHA 1U0HA 4K59A 1KVJA 1IKXB 2YKPA 1XIQA 1CULA 4HACB 3A8EA 4QR2A 1SC1B 3N9UC 4B3TF 1B64A 1RK8A 2R7WA 2CPHA 4FXDA 1LXNA 3QZ8A 1SQEA 2ZITA 3LW5C 2LYVA 2E5LJ 2QFJA 1TZ0A 3KK2B 1FJGJ 3QGGA 3UDVA 2C2RA 1K1SA 1KOOA 2JHEA 3PYFA 5HJYA 2KFZA 3IC1A 4HTIA 1Q79A 1MWZA 3U27A 2ZM6F 1RWMB 5DS7A 3C3LA 1URRA 1UJ6A 4JI0F 1IN0A 3FKBA 1N32F 3I32A 3A8IA 3DU5A 3R5GA 4X65F 1XR5A 3EZ5A 3TZYA 3QGIA 3K5LA 1F9EB 2EFGA 3VVTA 4DFMA 2FVPA 2MGZA 3B8HA 2KN4A 1PJ7A 3I82A 4C0HA 3S8SA 5FIIA 1XC9A 2IDLA 4B9NA 4ETZA 2KH9A 3JSMB 1XERA 4BS2A 2VQFF 3BO3A 4JI6J 2HRYA 4X4VA 4MKVA 4KHRA 3PW7A 2DGSA 4KYZA 3OTEA 1U09A 1XQIA 2Z8QA 1RKJA 1IWGA 1TMMA 1JLFB 4WWSA 2XCPA 2HHHF 1S0OA 1XWLA 4QOTA 3QNWB 2PA3A 4DR1F 4B17A 1Q7YT 2HBZB 1F9HA 4KHPJ 3JTNA 4L76A 1B99A 4ECUA 3KXDA 1FE0A 3FEZA 3MMBA 4XDCA 1SPBP 5JUMA 3CPWR 4ECWA 2HQDA 3G82B 3KUEA 5B7WA 5DLFA 4ZPVR 4RUCA 5LMNF 2B9WA 2NXEA 1RLCL 4F0MA 1HQUA 4W4MA 1IBMJ 1XR6A 1R89A 4LF9F 5HO4A 2IYIA 3M8YA 5IM0B 4OV6A 2FZKB 5HANA 3HMJG 4A48A 1WG4A 2KYXA 4R0EA 4Y0FA 5K8NA 3FK4A 3FZBA 4O4GA 4DI6A 1N5YB 2JVRA 1M5VC 1YX2A 1VQ9S 4PCQA 4FF3A 4CNZA 2HFZA 1WOSA 3TA1A 2MKCA 3ZZYA 3T1YF 1RT1A 5A8KB 1Q81T 2F63A 2BUNA 2FVQA 2UXBJ 3ET6B 1VQYA 3MMBB 2YQ1A 3MUMP 3GYNA 4JV2A 3MPWA 1ZOTA 3RYLA 3CT9A 2XY5A 2GMHA 4ZPCA 4USWA 2R7RA 1JNZB 4OHZA 3I87A 4B3MJ 2IA0A 3D3BJ 2BV3A 2PIIA 4WU2A 1NJYA 4F36A 2OHDA 1RT4A 1YSJA 1VQ8S 4IKAA 4DZDA 1XMOJ 1FDAA 2AZ1A 3SSQA 3HHKA 3Q8VA 1HYSA 2AJ0A 3AB4B 2K1RB 3EE3A 3CSKA 3MEDB 2GGPB 2H4WB 2HG4A 3D3CJ 3MCNA 4ED1A 4A8KA 3CDEA 3SQOP 5K20B 4Y2IA 1D3WA 3T6BA 3ZZTA 1VLOA 4A8XA 1PYTA 2EI5A 4LIRA 4NZ0A 4ATNA 2PE8A 4QWBA 2XS5A 2AJ2A 2K8GA 2MSTA 3FBFA 4N8NA 4ALZA 2X1AA 5KFHA 1N32J 2UXDJ 3MCSA 2AF6A 4P2MA 2P6SA 2XMWA 5KFSA 2NREA 4RBVA 1X8DA 3WX4A 4KO0B 3QPIA 2QL7B 3TUZC 2Z2ZA 5C24A 3DRRA 3OR1A 2F1FA 1EZZB 1KN6A 2IVYA 3ZZRA 4M63A 1EETB 2OPQB 3TOQA 2PA8D 1HI0P 1NPPA 5A8KA 1JB0C 2CFXA 7FD1A 1UVLA 5C25A 4DV5J 2D3OR 2DBBA 1L3SA 1BY9A 2G0CA 3JQKA 1LK7A 2JJ4D 3R8YA 4DR1J 4I6WA 2DHGA 2C3OA 4A8FA 2DKOB 2WVBA 3LQVA 2LU1A 3LO3A 4QIWD 4ZS6A 3VQTA 2MXYA 1RCOB 4DV3J 2KZMA 4CH1A 2MKIA 4OIXA 2IAJB 2OMLA 2WONA 3C6TB 3TUIC 1RTHA 5IT0A 4NYPA 2IVFB 1GXLA 2OO4A 5GMDA 3CDWA 3DN9A 3NGKA 3J80Y 4AQYF 4G3IA 1IQZA 1TL5A 3FRYA 4KHMA 4EYIB 3KJNB 3UO0A 3P5TL 3QJPA 1S0NA 3QT8A 1XMQF 5GAHU 3UI3A 1YDLA 2KTQA 4NLYA 1YRUA 5EX3A 5KFMA 1JXVA 5E3RA 2ZC3A 1FXLA 4Y28C 2YQ3A 2VBZA 2YWKA 2Z57B 1S1WB 1S77D 1VS3A 3FQKA 2EK1A 1MROB 3AD7C 4MT1A 3QZ7A 2ADCA 3UR0A 4DBQA 4RZRA 2W7PA 4J9PA 5DRKA 1UW4A 3NOGA 4WPAA 2MMYA 4PWUA 1VDHA 5IQQA 3VGSA 3PACA 3R5BA 1KQSR 2UVWA 3HO1A 1WKKA 3C14A 3O2IA 4UUWA 4AYBD 2J0QD 2QZ8A 4GVLA 4LVOP 1ZAWA 3BSNA 5CCLA 3QT5A 2OKQA 1NCLA 4CLFA 3KHRA 3NWGA 4FYYB 4JI4J 1F9FA 4IOAQ 4PG8A 2R8IA 3BV8A 3BPDA 3SCLE 2L08A 2XS2A 1R0BG 4RKUC 2COLA 3GR0A 3MECB 3MF5A 4O3QA 4RUAA 2CZ9A 3H90A 2MB0B 2UUBJ 5LXYA 3PY8A 1X5TA 1VLYA 2BE7D 3RG6A 2JWNA 1SC6A 2HNZA 4I0WA 4ELUA 1RHUB 4FKXA 1RAIB 2KG1A 1B7FA 3I9V9 3EXYA 4G1IA 1WNEA 1OSCA 4KKOB 1CC8A 2P2CB 4LRDA 5F8MA 4ITSA 3QLHA 2MSSA 1H7WA 2WB4A 4DLGA 3LTOA 2YWWA 9RUBA 3CEDA 1HLWA 3GTYX 2XB2D 2N3OA 4DZ6A 2ROEA 2B56A 4IG0A 2QG9B 2BW2A 2EEYA 4F4KA 1TUGB 1U24A 3D5MA 4J9LA 2OI2A 3T1AA 3MM9A 2YNFB 1BHNA 2FHOB 1HFEL 2WHOA 4I6AA 5KFAA 2Q43A 4G65A 3VCDA 5J2PA 1D0EA 2IJRA 2QSWA 1SB6A 4ZJQA 1YBAA 2HWIA 2KJVA 1VMBA 1J5EJ 3Q8PB 3PZPA 1BMQB 1NLKL 2CDQA 4HTJA 3PV8A 5E3CA 4P6QA 4FN5A 1HQEA 2HZCA 3E8OA 4B08A 5F9NA 2MKHA 3OTCA 3IRXB 4EGLA 4HLBA 4M5HA 1RTDB 2PI4A 4ZIWA 2IBKA 3CC7S 4DR7J 3DLEA 3DRPA 2E7XA 2HMIB 4F50A 1BE4A 2NZ4A 4OHVA 4KJIA 2JL9A 2Q3PA 3EX7B 1YG0A 2BM0A 4MK8A 3WIUA 4NLPA 4JI5J 3X3UA 3U1LA 3G82A 1OJ4A 3B78A 3LWLA 3GPAA 2R2SA 5B09A 1WC0A 2L9NA 4UF4A 3M6UA 1FRMA 2CPDA 4ICLA 3QT6A 3BYRA 1Q78A 3RU0A 3OTOJ 4K50A 3UD5A 3GE9A 1Y00A 3KLFB 4BWMA 2F7VA 3TVZA 4PQUA 2RUGA 4ECYA 4X64J 3K7RA 5B0CA 3MDFA 3V81A 1HKAA 1VFJA 2YY3A 4C0BA 4B3TJ 1FESA 4CNYA 4OI1A 1WI6A 5KFVA 2DXDA 4U67Q 3OJSA 2XLKA 1UWBB 3OL9A 5E3AA 2X51A 2Z30B 5DGBA 5ETRA 4TNOA 3FMBA 1NAQA 2E1MC 2E66A 3W1YC 1CJKA 1S9EA 2K3IA 3M30B 3T9NA 4KAIA 4DR2J 2NPIA 1IJEB 1K44A 2V2QA 2FUG9
chains in the Genus database with same CATH topology
3J7A1 3V6KA 2MQPA 5I3QA 3N0VA 1HHSA 1FT8A 4EFAC 5EGYA 2N82B 2XSJA 1Z2ZA 1U25A 4IQXA 3KK3A 2FJVA 2ASDA 2DRAA 1WEXA 2HS4A 1HBUA 2JLEA 3DGPA 4OJGA 3DC2A 3E51A 2BQ3A 5DJBA 1KC8T 1WHWA 4CO4A 2ZDOA 1SJ3P 3L7PA 1IKYB 4NWBA 4ZVGA 2ZH4A 1WG1A 1NRKA 3MUVP 1N0UA 2GIRA 3UQSA 2I5JA 4IH6A 3I31A 3M6XA 3OR2B 4NZ7A 1RT2B 3CD6S 1GQEA 2XI3A 3FSXA 4ECRA 5HP1B 1Q86T 2WRMA 3TUJC 5J2NA 4PQUB 4GKKF 5DETA 2RT3A 2KVIA 3N01A 5MLCV 3NNHA 2DCLA 4Z37A 1LWFA 2RSQA 2GJIA 3OR1B 1R8CA 2DNOA 3Q8QB 2M88A 2EC0A 4R0JA 3VAMA 1UJ5A 1ZPWX 2PO4A 4NLSA 4KB7A 3SFUA 4HT5A 4ECTA 3CJ2A 1L5UA 2JOQA 2IMOA 1H2VZ 5JVHQ 2GC8A 3P49B 3MUTP 3ZC4A 2AJ4A 3RB0A 2DGXA 1R8HA 5EWEA 2N7YA 4UQTA 4DQRA 3JSBA 3TQ1A 3KLHA 5F8IA 3X1LB 2FJEB 4J9RA 5HMWA 3EUNA 3TNVA 1YJNS 4CT8A 1WEZA 4X64F 1IKYA 3NAIA 5AXNA 4O4RA 1VRUA 3LAMA 4URQU 2B6AA 2EFVA 2RRNA 3SCJE 3TAMB 5G4DA 4NCBA 2QSFA 1F5AA 3GFYA 3K2YA 3KLIA 2F8HA 1HBNB 3ONQA 2XMJA 2KT5A 3AAWB 3DHWC 4ILRA 3L3CA 4B9UA 4DEZA 1T05A 3HHNB 4C3MA 3T5HA 4ZP9A 4AXJA 3MHYA 1N33F 1SV5A 3MM7A 5KFGA 2HFOA 4E98A 3IFEA 3MFHA 2V94A 5D4NA 1OQ6A 4G1PA 3CJKA 4EBDA 1N0VC 3CIZA 3PW5A 2VA2A 1Z4UA 1SUQA 1H7XA 2RIJA 3SQGA 4AE5A 4ETXA 3GV5B 3FJ2A 1DRZA 4A8OA 3HFKA 1YJWS 2HVHA 5F8JA 2OD6A 3J7Z5 2BE2A 3SFGA 4KV8B 2CQHA 5LSOA 3DOLA 2ZKUA 3QLHB 2VG7A 4F3OA 2QT7A 2CJQA 3RRKA 2DGUA 2LEPA 2POKA 2JRSA 3NMAA 3I5BA 5AXKA 2E5LF 2WOMB 4R5PA 2LEBA 2J6UA 1SI9A 2DNKA 2GCFA 1FDBA 1UFLA 2W7PA 1S7HA 3HDSA 4MKBA 4NCGA 5M2UA 2XY7A 2Y1IA 1KHWA 5L1IA 1X5SA 3VAGA 2ZBCA 4MKAA 2OFHX 2QA4G 1DLOB 5KAKA 1IBKF 2MQQA 4YDDB 1DARA 2B7BB 1TK0A 5KFJA 4K4ZA 3V6DB 4I2PA 1REVB 4NLWA 2EPIA 2GQQA 2X1BA 4TYBA 1CLFA 1FRXA 1M5HA 4EU0A 3PO4A 1WD6A 4V19X 2KB2A 5C25B 5DDRC 2E1RA 1IBMF 3RAMA 2XGPA 1FERA 2MZ1A 4ECVA 1X9SA 2F9DA 4NZ6A 1VQ6S 2JZ5A 3JYTB 1FVQA 1NZAA 4GMKA 1YQHA 3BGFA 3SV4A 1KRPA 5LJ5Y 3HVRA 5SUHA 1BQXA 4ZOSA 1LW2B 4DSEA 4NLRA 1KOHA 2JFKA 4KHPF 5LXRA 3V4IA 3UWTA 4MIBA 4BCAA 4YHHF 3KKFA 4DSLA 2DB1A 1KTQA 2YKNA 1FRLA 2VG7B 3M32B 3N28A 5F8HA 2C28A 1RTIA 5T14A 1DAXA 1S6QA 2J0XA 3C66A 4YFUA 4PUOA 4I68A 5DO2A 5I3UB 2HW3A 1SH2A 2VFSA 5F8LA 5K8OA 4B9SA 3BGRA 1ZPVA 3KJVB 1V9OA 3OXGA 4P7VA 4PPDA 1VQLS 2VB6A 1Q7LB 2LXUA 2AJ1A 1FVSA 4HDGA 2YKQA 3EXCX 4F3QA 2VZ9A 2V4JA 1X4CA 3UD4P 2DD8S 2CQBA 4OHYA 1KONA 4LSNB 5HMZA 1N5SA 4DV2F 4KO0A 2GFFA 2DNLA 1U48A 4U9RA 3R5DA 1HD1A 3MR5A 1OO0B 4K4VA 3VZHA 1C1BA 4ZPAA 3NRBA 1P27B 2VOOA 3H2LA 3QWPA 1UJ4A 2N4CA 4UW2A 5BYRA 4V19J 4N8OA 1FXRA 4OZJA 3LOUA 2V4QA 1D8ZA 2MY8A 4DV6F 2YWGA 2BRKA 1EP4B 4KFBB 2VONA 3HHLD 3TR5A 3VAJA 5I4MA 4DR6F 3I0SB 1H3DA 4JI5F 3IWNC 4DFPA 3I0RA 4IO1A 2NSBA 1BGXT 3S1TA 3C6UB 3MEEA 1RTHB 4F4ZA 5E3QA 4K4XA 1HA1A 2HWTA 4EBEA 4LSLA 4YR0A 3IAS9 3S6EA 2Y1JA 2YKNB 3M05A 3DI6B 2ZH3A 3BR8A 4XK8C 3MM6A 2YKMB 2KYZA 2ROGA 1X0FA 1NKCA 1FKOB 4XIUA 2CPJA 2AW0A 1U1MA 2WSEC 4RW9B 3I5AA 1SKSA 1SL2A 1YVFA 2QE5A 2J9EA 2IM1A 2DNQA 4FF2A 1PC5A 4W92B 2KJWA 3BS9A 3DRSA 1RT6A 3M6WA 1KFSA 2IBOA 4OJ3A 2ALZA 4N56A 2C2DA 4KKOA 1NHVA 4AL7A 3DLEB 1QAYA 2EFQA 3M2UA 3KFWX 2A2DA 1CG2A 2ASYA 3IS9B 3U7JA 2MDAA 3GFZA 2PT0A 1FDNA 2RQKA 1IKWB 4CZCA 4X65F 4TQSA 4ZVHA 3PX6A 1BQNB 2FD2A 3FCHA 3OVSA 3SMZA 1FKOA 1KLMB 5CHCB 1H38A 2DR9A 2HHWA 3JSYA 3KMQA 3T19A 1Q82T 4CI0B 4N47A 1S1XA 3MM9B 3RB4A 5HLFB 3MPVA 2AWZA 3TAQA 3M2VB 1NK0A 3NL0A 2WBMA 4KGKA 4UOCA 2HYIB 3I0SA 1V3RA 4XPEA 4N5SA 5CD4H 1TAUA 2ROPA 1WHVA 2J6SA 5B0BA 3M8PB 2XO7A 2DTJA 5KFBA 4MYUA 3D28A 3EGWB 2M52A 5E3PA 1S1VA 1AROP 2XEXA 4ID5A 1URNA 1HI8A 2XMVA 1FEHA 3H5YA 1GAOA 1R8PA 3VWSA 4OFZA 4YB1P 4UQGA 3FEYB 3CGIA 4I1TA 2MQMA 1JLAA 1GX5A 3W7BA 1IUJA 2D9OA 2NLWA 3CCTA 4K4WA 5DDPC 4DQIA 2NUUG 3I4HX 4J9OA 3QWUA 2E5JA 3SQGB 5J2QA 2DITA 5B0AA 1QAIA 1YJVA 2EK6A 3AY0A 1PO6A 1C0UA 1RTDA 2ZUGA 2HPUA 4MH8A 3M9MB 2AGQA 3JAMY 1LWCA 4DL3A 1J5OB 4X4NA 1S72S 3DLJA 2DHSA 3QAUA 1LQ9A 4R5PB 4NLTA 5A8RB 3FSYA 1QSSA 2R8KA 1Q1KA 5BR8F 4ES3A 4WFBQ 1S9FA 1UA1A 1W2IA 3MM8B 1ROFA 4J5OA 1NK8A 4DS5A 4DSJA 1KR4A 4FVMA 5HP1A 2RB7A 2B0GA 4IFVA 4YR3A 3DHXA 4H4KC 1N34F 2OPPA 3FZ2A 2DH8A 3NMRA 1SBRA 2I1RA 3LP0A 4PXDA 3V6DA 1J5EF 2M2BA 2R7QA 4NA1A 3PKYA 2KRRA 4ED3A 1AFIA 3O44A 2QA2A 4OX6A 3CVKA 1N8RT 3G9CA 1H98A 2V4RA 1CC7A 2JEFA 5L39A 2KG0A 3R5CA 2M9KA 3CCSS 2E5IA 2VBYA 5KT4A 1U7LA 4F26A 3ICLA 4PG7A 4P7TA 2GX8A 3BM7A 1CQMA 1SIWB 5T41A 2OTLS 2IM3A 3T3FA 2Q66A 3O8WA 1FTCA 1HD0A 4Y65A 1JIHA 5KT5A 3UCZP 1P9QC 2MKKA 2E5HA 2Q1LA 1U47A 4KTQA 1N36F 4J9NA 4DR2F 3BQ0A 2LQ5A 4KPYA 5IT4A 4DHVA 3CD7A 2F3JA 3H4DA 3BGRB 4HT7A 2XMUA 1K9MT 2ZZNA 2K3KA 4M1KA 3H5SA 2JEGA 5T7LB 2E5GA 1TQLA 3ENQA 1U1KA 2HS3A 4I69A 4ZPTR 2A1BA 1U4BA 3HVAA 2Y1RI 4DSFA 3CCLS 5M2RA 1RYRA 2C22A 4DWIA 3NS6A 4ZP8A 2PMHA 5IFMA 1RT3B 4ZDNA 4QW9A 4TU8A 4J9SA 2CPIA 7FDRA 2JFDA 1WACA 2VG6A