2DH8A

Solution structure of the n-terminal rna binding domain in daz-associated protein 1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
105
structure length
105
Chain Sequence
GSSGSSGMNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DAZ-associated protein 1
publication title Solution structure of the N-terminal RNA binding domain in DAZ-associated protein 1
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 12
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dh8A01
3I55S 3VAGA 1UP1A 5GAHU 1WHVA 2LCWA 1N52B 1URNA 1U6FA 1VQNS 4W90B 3FEYB 1VQ6S 1WWHA 2CQ0A 3CULA 2I2YA 3CCLS 1FT8A 1NO8A 2LQ5A 5DDOC 3L3CA 5LXRA 2DNPA 2PE8A 5GAEU 4BS2A 3BO2A 2EVZA 3PIPQ 2EK1A 3MUMP 3G4SS 2CQIA 2JWNA 4Z2XA 4OZ1A 4TU8A 2M8HA 1RKJA 4PRFA 2LXIA 4CH1A 2VODA 4QPTA 1X4AA 3EGNA 4WFAQ 1WI8A 2RS8A 2XSFA 2MKSA 2OSRA 2NZ4A 1Q7YT 3TP2A 1BY9A 2E5GA 2MSTA 5DDPC 4ED5A 4C7QA 5GADU 3MXHP 4CQ1A 2KM8B 4YB1P 2HVZA 4CIOA 1SXLA 1UW4A 1WG4A 4QU7A 1P27B 2JRSA 1M5KC 3V4MA 3CCJS 1KOHA 1FHTA 1VQMS 2CQ2A 3CCQS 4WFNQ 1QVGR 2RQ4A 2DGVA 2M9KA 4WKRA 3UCZP 4TLQA 2QEXS 2DH7A 1WHXA 1M5OC 2MZRA 2D9OA 2CPXA 2MMYA 3DLLQ 2DNYA 2KG0A 2ZJPQ 1A9NB 1X5SA 1VC0A 1WF0A 2RVJA 3UCGA 2KYXA 3TO8A 2QA4S 2DIVA 3CUNA 1U6BA 2MY8A 1U1MA 2OTLS 3U1MA 2JVOA 2M88A 1K73T 1VQ4S 1X4HA 2DNNA 1X4EA 3UD3P 2LKZA 2CPEA 2DGOA 1VC5A 1KOOA 1VQPS 2FC8A 5LSOA 2DB1A 1D9AA 3BO4A 2M4MA 2MXYA 1WELA 3G6ES 4W92B 2YTCA 2PEHA 1CVJA 3UD4P 5JVGQ 2XS5A 2WBRA 1X4GA 3VF0B 1VQKS 1H2TZ 3VALA 2KXHA 2X1GA 2DGUA 1HA1A 1M1KT 4PR6A 3MD3A 2EK6A 3MURP 3OW2R 2CQDA 2Q79A 2U2FA 1W2BR 3P6YC 1UFWA 1O0PA 3P49B 2MQPA 2A3JA 2CQ3A 3SDEA 4YUDA 1VQ9S 2YWKA 3S01A 1K8AT 1YJWS 2FHOB 1WEXA 3B4MA 2XNQA 2E44A 1YIJS 2M2BA 3THPA 1FO1A 1VBYA 4Y0FA 4QQBA 3CC2S 5LJ5Y 2MHNA 2AYMA 4F25A 3S8SA 2XS2A 1JJ2R 1X4DA 2J0SD 3IWNC 2KRBA 2ADCA 4F26A 3G8TA 2VOPA 3BS9A 1NJIT 2DGSA 2RNEA 1YWXA 1M90T 5MLCV 5FJ4A 1U1QA 2DNLA 1ZZFA 2RU3A 2CJKA 4ERDA 2DGQA 5HO4A 2MJUA 2KVIA 2DHAA 1YITS 2DNOA 2F9DA 2M7SA 5DM7Q 2DNZA 2DIUA 1KD1T 2D3OR 1KQSR 2AYEA 1YJ9S 3NNCA 3ZZYA 3CMAS 2YKAA 1WEZA 2CQ4A 1HD1A 2L41A 2M0GB 2RRBA 1U1KA 2MZSA 2LA4A 2J0QD 4J5OA 4A8XA 3CCMS 4PKDB 1R8PA 4P6QA 1A7GE 2CPIA 4FXWA 4WIIA 2N3LA 1Q81T 2MQMA 1QM9A 4WCEQ 2KH9A 3J7YU 2ZJQQ 1SJ3P 1U1PA 3VAKA 2CPFA 3Q2SC 1WG5A 2DNKA 2CQBA 1VBZA 4CH0S 2DGWA 5IM0B 5LJ3Y 2MJNA 3NMRA 3SDEB 1X4BA 1M5VC 4OZ0A 3JB9k 1FJ7A 2CQCA 2RT3A 2MZTA 3TYTA 2MPUA 3VAJA 1VQOS 1WHWA 1VQ5S 3P3DA 1RK8A 1X5TA 2CPDA 2DNRA 2MY7A 3I56S 2LEAA 2KT5A 5DETA 5GMKa 2XS7A 2CPHA 4QU6A 2JX2A 4C4WA 2CQ1A 2N3OA 2MGZB 2HGNA 2DO0A 2AD9A 3G9CA 1OIAA 1FJCA 4Y00A 2N82B 2UP1A 2OJ3A 3J7ZT 2RRAA 3R1LA 2NLWA 2E5HA 1P1TA 1X0FA 3MD1A 3US5A 1Q82T 3SXLA 1U2FA 2DNMA 1FNXH 3H2UB 1L3KA 3MI7X 5LSLA 3FEXB 4IOCQ 1U1RA 2J8AA 1UAWA 2HGLA 5LXYA 2L08A 3CXCR 2KU7A 2MQNA 5IM0A 1VC6A 2QFJA 2KN4A 3RW6A 1SJQA 2DGTA 1FXLA 1NU4A 1DHMA 1YTYA 4LIRA 2KXFA 3CC4S 4LMZA 1X5PA 2FPHX 3THTA 3BO3A 5GAGU 2DK2A 2DHXA 5BJRA 3R27A 1JMTA 1WG1A 2KFYA 1AUDA 3P5TL 3PIOQ 2RQCA 2MZ1A 5CA5A 2ADBA 2DO4A 2MQOA 1SJFA 2MQQA 1PGZA 1D8ZA 1JJHA 3EX7B 3HHNB 1S72S 5H1SV 4IOAQ 2J76E 5CYJA 2CQPA 2MGZA 2MKHA 3BEGB 2MKIA 2DHGA 2DITA 3G71S 1Q86T 3IRWP 2DNQA 2ERRA 1SJ4P 1ZZNA 2D9PA 2MYFA 1F9FA 3R1HA 2MKCA 2DNHA 2YH0A 3CCVS 2FY1A 2F3JA 5D77A 2OIHA 2MKKA 2JVRA 3VAMA 2X1BA 4F02A 4C0OC 2OSQA 1WTBA 3CD6S 4V19X 3SMZA 1QVFR 1OO0B 2DISA 2KI2A 3ULHA 3DXBA 5DDQC 1VQ8S 1G2EA 2YH1A 3CCSS 1WI6A 3CTRA 1JJ4A 1WHYA 3UCUP 1HD0A 2MSSA 3Q2TC 3MUVP 2AYBA 3UWTA 3MDFA 3EGZA 3U1LA 3NS6A 1DRZA 4RU2A 3CPWR 2MZJA 1VQLS 1H6KX 4IUFA 4TU9A 2CPYA 5JVHQ 4WF9Q 2KG1A 1OWXA 3NS5A 1VQ7S 3MUTP 2K3KA 3RW7A 1YJNS 3ZZZA 3LPYA 4WFBQ 3VAFA 1S79A 2LA6A 4UQTA 4YOEA 4UY8T 2CPJA 4U67Q 2FC9A 2BOPA 1PO6A 1WEYA 1X4CA 2RS2A 1DZ5A 3HI9A 2DH8A 1N88A 2MQLA 2MB0B 2DHSA 2DNGA 2E5JA 2KRRA 1XN9A 4TU7A 1U1NA 3LQVA 1U1LA 4ZKAA 2U1AA 2KM8C 5CXTA 3NNAA 3UE2A 1FJEB 2CQHA 3CCRS 2XNRA 3CCUS 2SXLA 2OTJS 3S7RA 2X1FA 5GVQA 1YHQS 2B0GA 1VBXA 2VOOA 2DH9A 1KC8T 2GO9A 2K8GA 1N54B 1X4FA 1U1OA 5HL7Q 2I38A 2GHPA 2F9JA 5DM6Q 2BZ2A 2ZJRQ 1SJRA 2HGMA 2LYVA 1WF2A 3CMES 5D78A 1DBDA 4EGLA 3G96A 5IQQA 5ITHA 4IO9Q 2RUGA 2E5IA 2G1DA 5IFMA 2G0CA 3K0JA 4LJMA 2HYIB 2LMIA 3MOJB 1ZH5A 3NNHA 2M52A 3CC7S 1WF1A 1K9MT 2G4BA 5EN1A 2AYGA 2M70A 1M5PC 2MKJA 5DDRC 2HZCA 2LXUA 4FXVA 3B4DA 2N7CA 3VAIA 2VONA 3VAHA 2CQGA 2LECA 1B7FA 2KHCA 2MZQA 1OPIA 4M5DB 2X1AA 3G8SA 1H2VZ 2O3DA 1H2UX 2XB2D 3N9UC 1IQTA 2V94A 3CF5Q 1YI2S 2DGXA 2LEBA 1HL6A 2KXNB 3D2WA 2L9WA 2M8DB 1X5OA 3H2VE 3S6EA 1N8RT 2CPZA 1R8HA 3CCES
chains in the Genus database with same CATH superfamily
2UUAJ 4O4GA 4ES1A 5KFIA 2EXUA 2LCWA 4WU2A 2BKOA 2ZVIA 1CJUA 4MT1A 4C8KA 3OBIA 2E1CA 1X7VA 3MR6A 5CD4H 1HBOB 2UVWA 4V1Ak 2OPPB 4OI0A 4XPEA 4NLGA 4GC7A 3POTB 5CABA 1U0HB 3TAMA 4PQUA 3K2YA 4AQYJ 5HK4A 1XWLA 4RW7B 3CCQS 2KHDA 4WKRA 3K8VA 3HLUA 4TLQA 4FKYA 3PX6A 3AB2B 1WF0A 4C8NA 3BGRA 3RU0A 2C22A 4ID8A 2GW8A 4JI7J 3GCWP 4H4MB 4P2XA 1WELA 2YTCA 1FKPA 4OYBA 3L7PA 2CQDA 2FVPA 1T03A 3P6YC 1YJVA 3WBZA 1KKHA 2DY9A 1K8AT 3UQSA 2OPRA 1RE1B 2XNQA 2YPZA 3JSBA 3M32A 4Y0FA 2C1EB 1UFKA 2V4JA 2XS2A 3PZPA 5KT7A 4LSLB 2LQJA 2ZDOA 2Z2YB 4KSEB 3I96A 2VKRA 2DGQA 4Y65A 3PX4A 2BJ9A 3OLBA 2DHAA 1S6PB 3DRRA 4NLTA 2V4QA 5IT9Y 5FLXU 2BABA 1YJ9S 2NSCA 3HHLC 4RW9B 3PYGA 3OUYA 4J9LA 1VHFA 4A46A 1B4SA 3MMAB 2IA6A 1YZ6A 1CEZA 2I9SA 4PKDB 4RR5A 5E3PA 3OD2A 1RI7A 3R7NB 1C1BB 2N3LA 4F4WA 4PG5A 4FBUA 3ZO7A 1FX4A 4F36A 5KFQA 2FIUA 1VIXA 4PG8A 4MMOA 4CO1A 3HX9A 1R27B 3V6JA 2WCXA 3PHTA 5B0BA 4DF8A 3NY0A 2CPHA 4NA3A 3R3TA 4OI2A 1WC3A 5IT9U 4QW9A 3CEDA 3OTEA 4B9MA 5LSLA 4IOCQ 2D3UA 5LXYA 4DN0A 1DHMA 4FF3A 3CC4S 4OZNA 1U2CA 1SIWB 3K7RA 2DHXA 2KFYA 4OIXA 2RQCA 1YLXA 2DO4A 4F3MA 1AW0A 3J81j 5DG7A 4RX6A 1QLNA 4DUYF 1SQGA 3ZXWA 3TVZA 3R1HA 2B6AB 1NNDA 2H65B 2DEJA 4CO0A 1RAFB 3X1LB 4MFBB 3KOAA 3W64A 4X65F 4TY8B 1T95A 4HHUA 4R5PB 4BHQA 1PILA 1OSCA 3CTRA 4O3NA 4K4WA 3Q2TC 3EYZA 2UV8G 5E7OB 3HULA 4USVA 1UJ5A 1H6KX 2HVIA 4EMDA 3GLJA 1GX5A 3KLHA 1TK8A 2ALYB 4DUZF 3OJUA 3PW4A 1TL7B 4DQRA 4QIVA 2CFXA 5IV3A 1ZOTA 3NAHA 2B8PA 3LAKA 3PKMA 1XK8A 2GQCA 1IBCB 5THWA 1M0SA 3CO9A 2B9XA 3RR8A 1S0NA 4Y2KA 2GJFA 5D6GA 3M2VA 2HHQA 2OTJS 1KTQA 3O2IA 2UV8A 3IR5B 2YKPA 2R4FA 2LYVA 3MM6B 1DBDA 5IWAF 1RTDB 1CJKB 1TL1B 2RKIA 4CRJA 3EICA 1LK5A 2I5JA 2WVFA 2C2DA 1N5QA 4LFAF 1RYSA 3FBFA 3OFEA 3HF5A 4JI3F 4P2SA 2NREA 2QL7B 3HCXA 3N9UC 1ZYQA 1HI0P 3M1VA 5F8GA 1HPZA 5HSPA 1XR6A 2E5LF 3KLVA 3FQKA 4X4PA 2CPZA 2AEMA 1SL0A 3A1YG 3KHRA 1R0BG 7FDRA 5DLFA 3D1HA 1Y5NB 1TK5A 4DSLA 3KG1A 5GAEU 3BO2A 3KG0A 4O0IA 5KFSA 4QBUA 1RKJA 4X4UA 1C2PA 4TQSA 2XSFA 2KB2A 3RAMA 2HBYB 2MSTA 5LMNF 3M8PB 4NCGB 1WG4A 4ID5B 1RAEB 5KFMA 3BSAA 3HFVA 1PC5A 5DO2A 1VYAA 4CZCA 1RTJB 1FDBA 3OSNA 5FDLA 1VC0A 4BBYA 3V2UC 4DS4A 1DQ8A 2JVOA 2FLNA 2CPEA 2B9EA 3IBFB 4DUYJ 1VC5A 2BJ7A 3TOQA 3MAAA 2DTJA 4DCOB 3BO4A 3DLJA 1S48A 1CVJA 4DSKA 3K59A 2ZNZA 1H2TZ 1JLEA 8RUCA 1W25A 2KFZA 5HAOA 4HACB 2G2ZA 3MEEB 4RUHA 2VPZB 3VR1A 1MNEA 5C42A 5K8PA 1QE1B 3IXQA 3HFZB 3MHYA 2F4VF 4QQBA 3S8SA 4JV0A 2LU2A 3G8QA 5HJXA 2JHEA 2DGSA 5KFRA 1B0PA 2ZH4A 1ZZFA 2HQCA 3TEHB 1QUVA 1UVNA 3GFXA 1VJWA 2NQPA 2XHCA 4ZHRB 1S1UB 1MSWD 4AL7A 2ABYA 4R0EA 1WSRA 4ZDNA 4D3HA 4G1QB 1TFYA 3HKWA 5D3GA 3KUGA 3GU0A 3EM1A 3UR3C 2GGPA 2W9CA 2XGQA 3DRSA 1N6QB 3BREA 3DRYA 4DR7F 3VAKA 3DI6A 3T9ZA 2AJ1A 5IWAJ 4ED2A 2HHVA 2EKYA 4NLUA 4OZJA 3BQ1A 4A8QA 2CQCA 3M8QA 1JLBA 1UEUA 2VFRA 3HSZA 1S9FA 2F8HA 1TVRB 3MAHA 2HAFA 1SQEA 1RT3A 3TWZA 4C9DA 3J7ZT 1HQUB 3PW0A 4K4XA 3FVYA 4KV8A 5C24A 4YHHF 1DTTA 2HGLA 4P71A 2XYPB 4WE1B 4N8OA 1VC6A 3PNIA 2HHUA 2VBXA 3THTA 1RBOB 4HDGA 2ADBA 1SJFA 2VD3A 2Z2MA 3PR4A 3ZNJ1 1JLGA 1GX6A 4DCPB 3NGKA 2DHGA 4PG7A 5BYQA 3QIPB 4UT4A 4LSNA 3A8EA 3D6FB 3BGLA 1OO0B 2VPWB 3DXBA 4FYXB 2XMKA 2BE9B 2IC3A 1RT7B 3EGZA 4DZ6A 3SEOA 3F41A 5DGBA 1HMVB 3GR1A 3ZTQA 3NOGA 3ZZZA 2QLWA 2BR0A 2C3PA 1TR0A 5E33A 4U67Q 2WTFA 1BQNA 3ZZUA 3K5PA 3RRHA 1R8BA 2DHHA 2MB0B 5J2NB 2F8EX 5FIIA 4ZKAA 2GFFA 5KFHA 3BJYA 4CO2A 2I0XA 5EHHA 5KG2A 4K8RA 4QPXA 1VBXA 1S6QB 1N54B 1SJ1A 4K4TA 3O8WA 1GMWD 5KT4A 2F4FA 3H4BA 2R9LA 2DR8A 4YB5A 3AH6A 2R7RA 2LFVA 3W2WB 1LXNA 2UXBF 4ZN1A 3EXCX 2HZCA 5CYQA 1X8DA 4WP9A 2Y8WA 2VG7B 1CJTA 4B9NA 1HNVA 4L3NA 5L9XA 2XYHB 2X1AA 5F3TA 2NYHA 4QYRA 2GNKA 4Q44A 4Q7AA 4N41A 4S0MA 4CT9A 3CCES 3GFHA 4ETZA 5I3UA 1VQNS 1R8CA 3T6JA 2CQ0A 1UW9A 2Y9HA 5KG7A 4PQAA 4YS2A 1U7LA 3WDOA 4DQPA 3GIJA 4UUWA 4M5DA 1S1XB 1T7PA 2FJEB 3B78A 2Z0GA 3LTOA 3UN3A 2GX8A 2QA1A 1MU2B 1GT8A 3OSPA 3LALA 3C3LA 4C8LA 2MLZA 2IBKA 3CCJS 2Z2LA 4YHHJ 1NB7A 3KYLA 2FY8A 4Z7CA 4YDXA 1TKDA 1KBRA 3PEJA 3GIKA 2LQ8A 5CD4A 4IFYB 2GIFA 1QAXA 2Y1RI 4NX9A 3RBZA 4QWCA 2RE1A 2XY5A 1ZAWA 2K06A 5DJBA 4J9SA 1CULA 4ECZA 1NK7A 5BR8F 1OQ3A 1U0HA 3MZIA 3ENVA 5JVGQ 3HPOA 2GIRA 3PW2A 1BLUA 2X1GA 4V19J 4QWBA 4PR6A 2LQBA 3O5TB 3C16B 3PO4A 4FP9A 1NPKA 4H4OB 3KFWX 4B3RJ 1ZAVA 2YWKA 4QIFA 3VVUA 3TUJC 3C19A 1RAJA 1NXIA 1I51B 1LFWA 3QFWA 2R7WA 1YG0A 3DOKA 2XMUA 3E01A 3UW1A 1YWXA 4MYTA 1KFSA 2WVCA 2HK2A 1RHKB 3H0PA 3D3BJ 2KVIA 4HYKA 4NASA 4C3KA 2JNJA 1Y9OA 2H54B 2R7UA 5B7WA 1HHSA 2VG6A 3MECA 4L75A 1SCJB 1T3OA 2YNFB 2BJEA 4ES2A 4RUBA 4DL4A 1YBAA 2YX1A 2R7OA 2BUNA 3H42A 3D54A 5J2PB 2MQMA 3J7YU 5HQLA 1VDHA 1FESA 1YJRA 3JTNA 1AA1B 3KLGB 4ZVQB 3SDEB 3NCRA 3T5KA 1Z2ZA 1M5VC 4FNIA 4PXCA 5U47A 5IS2A 3H4DA 3VAJA 3D0GE 4X62J 5J1PA 2QRRA 3I56S 4I7FB 4JI2J 4DQIA 4XDCA 3M6XA 4QIWD 2CQ1A 4P73A 4KE5A 4MH8A 1C1BA 2NLWA 1MROA 3AAWB 1LWEA 1TQLA 4MKVA 2ZEJA 2F1FA 1SJQA 2P9GA 2XLIA 3KLIB 1C0TB 1KEKA 3WX4A 4ANDA 1GMVA 5DRKA 1NZ8A 2HFNA 4Q0BB 3Q86A 4EO6A 2G2YA 3SCKE 2RRNA 2V8VA 2YH0A 3IG1A 2OIHA 4PAAA 3D6HB 2HNDB 3A3OB 3PHEA 2IBOA 4Y28C 4X66F 4FPIA 4AL6A 3GJQB 1QTMA 4HH1A 3BQ2A 3NS6A 4RNHA 2JH3A 1JLFA 5EUHA 5KOWA 2AJFE 3H5XA 2ZWOA 4JI5F 3RRGA 5KFGA 3UO0A 1XTZA 1PAUB 1NJWA 2LA6A 4F4KA 2B6AA 1S57A 1RAOA 3D9BA 4J9MA 1PAEX 4ZJQA 5BR8J 3H59A 1HIYA 1KQGB 3HDSA 3GPAA 2DNGA 2E5JA 2MEWA 1TUWA 1FJEB 4ZMMA 3CCRS 3N6MA 1FK9B 3T6BA 2X1FA 1E6VA 3GV5B 3Q22A 2E7WA 1YHQS 1IBKJ 3DM2A 4N7TA 4NEYA 2IIHA 5LSRA 4BWJA 3C6TB 5IFMA 4NXMJ 4LJMA 2HYIB 1G4CA 3CJTA 2QL5B 1WF1A 4DU8A 2RIJA 3FGVA 2R2RA 1NB2A 2VQEJ 1WOSA 5IV4A 2K1RA 2LECA 4FZVA 3KK2B 4NMXA 5HN0A 3SSQA 1HNIA 4YR2A 4RLEA 3QLHA 1LOUA 4ZPBA 2DGXA 1FKAF 5CQGA 3D1QA 5GAHU 3N28A 2HS0A 2BQUA 4RW8A 1CJKA 3GYNA 2CJQA 1EAYC 3M8SA 2HFSA 3BSOA 4WFYA 1UVIA 3MUMP 2EK1A 3G4SS 3OVSA 2BM0A 4N56A 3JSYA 3PYFA 3NGUA 4CM0A 2Y1LB 2OSRA 2HWIA 4BLGA 2B3TB 3TP2A 2V2ZA 1T05B 4YB6A 3NXZA 2DKOB 1U6ZA 1IKYB 2EBGA 3AD8C 1TKZA 4HHHA 3WIVA 2QMUB 4G65A 4CO4A 3D4JA 4W98A 5EDWA 4W4MA 1AB8A 1T9WA 1VOMA 3SV3A 1LKZA 4JI8F 2D9OA 1Q78A 1A9NB 4AD6A 2HZAA 4YY3J 3CDAA 1U1MA 1OYDA 4K2JA 3U1MA 3KG4A 3VGTA 2YNHB 3UD3P 2O5DA 4LF6F 1TFWA 1D9AA 3QZ7A 3IBWA 2K2PA 1NK5A 4BDPA 3IR6B 4DQSA 1GH8A 3M8PA 4NCGA 2H4WB 3AXMA 3DHWC 1SL2A 1W2BR 3GV8B 3D1OA 1R0AB 5HQMA 4X66J 4OZ5A 1RTJA 5B08A 3KUHA 3Q83A 3F0NA 2PN6A 4B3MJ 4O44A 2AYMA 1RLDA 5L1KA 4OJHA 2KRBA 2ADCA 4QWEA 3UDCA 4ECVA 1RCXB 1BE4A 1UWBA 4DZDA 4JI5J 2LEPA 2UU9J 4RJVA 2XZTB 2R3VA 4UTGA 2R7VA 2DNZA 5I4MA 1KQSR 4Q8EA 3TARA 2QL9B 1CJVB 4IRDA 2HLTA 1VRTB 1LNQA 5F41A 3LW5C 1JX4A 4NLXA 1L3VA 3MR5A 2VJUA 3Q8QB 3SZ2A 2C3MA 3D67A 2HQ3A 4F4ZA 3W5YA 1MMNA 1Q81T 2XGPA 4IDKB 2C28A 5A6WA 2XLJA 2XI2A 4ZJOA 1VBZA 5A0YA 1P6TA 4I6AA 4O3SA 4OZ0A 3BKUA 2HNYB 4X4QA 2MY7A 2AJQA 4IRCA 2OAUA 2YNIA 5GMKa 4Y6IA 4K0KF 1ZTWA 2N82B 4PXBA 3EJMA 2VBYA 3N01A 4B9UA 5KFCA 4OX6A 4CT8A 4R8UB 2EFOA 1YX2A 2CUYA 3FEXB 3UDEA 2J8AA 2OD4A 1F5BA 3FQLA 3AQOA 1SH2A 1X60A 4LMZA 2EFPA 2N4DA 3CO0P 2BE7D 2X3GA 2IVFB 3OL6A 1AUDA 4KHPF 4J9PA 1HYSB 4LF2A 1SKRA 3T1YF 1PGZA 1YQHA 2BXJA 4KGKA 2EEYA 4C6AA 2DBBA 5HMXA 3G71S 4M94A 2ZBQA 4OX8A 3IS9A 4C0OC 4IR1A 2OSQA 3BSNA 3A3NB 1MWYA 1IBLF 4UOFA 4DR6F 1WI6A 3LP1A 3M30B 4NLYA 1OMSA 1TKTB 2QA2A 4LBHA 1F9EB 4KT0C 3R8YA 4RU2A 2XMWA 1VQLS 3AJ2A 2UUCJ 1VQ7S 4U9RA 3MUTP 3QAEA 6AT1B 1IKXA 3UR0A 3QIPA 1MN9A 2G13A 1CC7A 3HHLA 4WKYA 2VDIA 3RTVA 4OI6A 1S6UA 1K47A 4LR7A 2WONB 3FRZA 3DLKA 1FWPA 5CXTA 1RT7A 3DGVA 2AZ1A 1N33F 2BJ1A 2SXLA 5HROA 1PYOB 1JKHB 2BE2A 3LUYA 2QLBB 1RT2A 3IGVA 4DR1F 5DM6Q 2P9EA 2CJYB 3GIMA 1KVJA 2HGMA 2JFKA 2J7WA 2HFUA 2E5IA 1DTQA 1O8BA 3QO9B 4LF7F 4EU0A 3CIZA 2ZHAA 4DR5F 3JYTA 2ZH2A 2YKQA 1K9MT 2DXDA 5J2NA 5J2MB 3KK1A 3VAIA 5KFXA 2VA3A 2QV6A 1WJ9A 3QSYB 2BKPA 2CJ9A 4ATNA 5A8WA 2LEBA 4AXIA 3RR7A 4ZPVR 2HSEB 2M8DB 1WKJA 3FZBA 1X5OA 4F2SA 3I55S 3ZC4A 4G3IA 4QW8A 1ZTTA 1OYEA 3FEYB 2P6SA 4DV7F 4UZBA 2EFQA 2GJIA 4JI0F 3W9HA 2QLXA 2ATLA 2CQIA 5FD1A 4ITSA 3OFGA 2M8HA 4B3SJ 4ZP7A 5LM7E 2W9AA 2ZZNA 2VODA 4F67A 1NH7A 2RS8A 5F9LA 3MR3A 1XMBA 5I3PA 3HXMA 4U7UK 3GONA 1VISA 3K8WA 4F3QA 1ICEB 3BKFA 4IFVB 3I32A 1EETB 1KOHA 5KAKA 2MZRA 4IKAA 2ACYA 3R6GB 4F04B 2AV5A 2GVDA 1X5SA 1JXEA 5ETVA 2KYXA 1UJ6A 1TP7A 1V5VA 1N5YA 3UDVA 1YK9A 1GXUA 1S1XA 4I4BA 2DNNA 1F1BB 3ZZTA 2OPQB 1MU2A 1N5VA 3LA0A 1VK8A 1RWMB 4X4TA 1FRLA 2A1BA 3CD7A 4DFKA 3GFYA 2CQ3A 2YKNB 2EC2A 3S01A 4OYMA 2V2QA 5L46A 2HHTA 4IFYA 3JTOA 4FYVB 3UFCX 4OMFG 2E7VA 4LF9F 4P7VA 1H72C 3RGIA 4F25A 4Q2LA 3G8TA 3PKYA 2KJWA 2RU3A 3SQGA 3CDWA 4I64A 1IBMF 2F9DA 1RSCA 5DM7Q 1L5UA 2V8PA 1F6TA 3HVTB 3DFEA 2OO4A 4H4OA 4I68A 2IY5B 2YKAA 4DV3F 3D5MA 2A0FB 2LA4A 4I0WA 3MFIA 1APSA 2AWZA 2ACMA 1Y3KA 2BRLA 4FXWA 2IPOB 1UL3A 3MMCA 2WB4A 1LQ9A 4LFBF 1NK6A 5JUMA 2HIQA 1MMDA 5IM0B 1JLCB 5KFOA 4LF7J 4DR5J 1Z4UA 2XMVA 4G1IA 4B02A 2QLJB 1ITPA 1RWWB 1LXJA 5HJYA 1IM6A 2L9NA 1FEEA 3OTCA 5F3ZA 1XNRF 4QWAA 1U1RA 4C8ZA 1RWXB 2AJ4A 3PCOB 1S76D 3LO3A 1DAXA 2DJWA 2V2KA 1X9SA 9ATCB 5KFEA 1JJHA 3Q8SB 3BEGB 3FSXA 3PX0A 2Z57B 5DG8A 2J8SA 5AT1B 4XDDA 3GJRB 4LF4F 3BPDA 1FJGJ 2X1BA 5I42B 3HZEA 1WTBA 1L3UA 2CVIA 4I56A 2FQQB 3VQTA 4I2PB 1VQ8S 1REGX 5B0EA 4USIA 1EARA 3TZZA 1C0TA 4YR3A 1Y0HA 5KFZA 2R7SA 3ADAC 1TELA 4P72A 3GB0A 4TU9A 5KG1A 1HKAA 4WPAA 1YJNS 1DFDA 3LPYA 3MM8B 4LT6A 1GQEA 4LREA 3MPYA 5MAOA 4ED7A 3QWPA 4I2QB 2E29A 2V69A 4RWWA 2EKNA 2MQLA 2YWGA 1H3DA 1TKXA 2AZ3A 3UE2A 4YFUA 4ILRA 5GVQA 3DC2A 4ZVUB 2EBEA 1FD8A 1ZA2B 1NK0A 4FF2A 2GO9A 4I6WA 4IOBA 1B64A 1T9VA 2CRLA 2GVZB 1P9QC 3IGNA 4F3OA 2V2VA 3EDQB 2DD8S 2VG5B 2VICA 3CGIA 1UZDA 3GR0A 1HBMA 1ZPVA 1V3SA 4DL3A 5ETTA 4F50A 2G4BA 5DDRC 3EGWB 5B0FA 1FK9A 4DV3J 2O3DA 2XB2D 4K5SA 3FCWA 3I9V9 3JQMA 3SIPB 4X84A 1G3OA 2IAJB 3QGPA 2A6MA 4B3OA 1MW7A 1U6FA 5KFTA 2IMOA 3PDNA 1KN6A 1T9UA 2OEJA 2QG9B 2EVZA 1EKSA 1C0UA 1C4CA 4ZLNA 3KK2A 2OPSB 5KFNA 4JI4J 2PEBA 4TVAB 1KLMB 3NCPA 2CXEA 4DSEA 3ENAA 1YRXA 4ICLA 4CQ1A 5ETSA 1K0TA 1TAUA 4KH1B 3W65A 1WDDA 4CIOA 1RT6A 2EPIA 1P27B 2JRSA 1XNRJ 4A8OA 5A8RB 2EC0A 1TAQA 4Q8FA 1JQGA 1U0SA 4TKTA 2BW7A 4PABA 4OI4A 1Y00A 3T5JA 1J5EF 3TR5A 1RTIA 3CJ8A 3DYAB 4EYHB 3BBFA 1UVLA 3DMJB 3NKYA 2Z4PA 1NK4A 2MXYA 1IKYA 3ILIA 2VZ9A 3EGVA 3NMAA 1YRTA 1D8YA 1Y7PA 2HWHA 2NUUG 5LL6d 4DX5A 3KNGA 5JMNA 2O66A 1YDLA 2E1PA 5JXSA 3PYEA 3UNYA 1V3ZA 1YJTA 2NZCA 3OL7A 5HMWA 1C4AA 3V6KA 2H9ZA 4RU9A 4OZ2A 2EWHA 2KVQE 2C3YA 5I3QA 3M9OB 1EP4B 1YJUA 1EB0A 3MM5B 1CC8A 1YITS 3MEGB 1T8EA 3PO5A 2OFGX 3QPIA 3MWBA 2RDDA 3KKFA 1EHWA 1S1WA 2MDAA 4NXNF 4J9QA 1R0AA 3O6QA 1P1LA 1WEZA 4QR1A 1HD1A 2NXNA 4ZLPA 2IYIA 2RRBA 3Q89A 5AXLA 3FUYA 3VGSA 5D0RA 4URSA 2HW3A 4HTJA 4JV5J 4B9LA 2BANB 2CPFA 3Q2SC 1UEVA 3K57A 4DF4A 1LWCB 1I94J 3I82A 1HFEL 5SZTA 3IWXA 1VQYA 5IZHA 3MTJA 2RAQA 3F56A 3LP0A 1CJVA 1S7IA 1N4LA 3RBXA 3LWMA 3M9MB 2POKA 2N3OA 2VIHA 2HHPA 5K8NA 3H8YA 5D0EA 2UP1A 2VC1A 3ZZ0A 1TMMA 2GMHA 2WSFC 3BR8A 4YEAA 3JSMA 5HANA 4NPOA 4WXOA 2GMLA 3VZIA 5K14A 3QT5A 1SQFA 4KC5A 2BQ3A 3RYLA 2ZDPA 1S9GB 3PV8A 3BBBA 5AXNA 3NGTA 3BO3A 2DK2A 5BJRA 4OYIA 2E9TA 3FMWA 3BGFA 4C3MA 2MQQA 4NLDA 3CWJA 4ZP9A 5F8LA 5HP1B 3MM7B 3RB4A 1R3NA 2F40A 1VLYA 3R5JB 2XTJP 4M8LA 1LV5A 1SJ4P 4WYWA 3K5LA 2D9PA 4M5MA 1UFLA 4PPZA 3D0IE 3CD6S 2A2DA 4KY3A 1KQFB 2YH1A 2BV3A 3EZ5A 3UCUP 4LF8J 1HNXF 3UWTA 4D3GA 3CT9A 3U1LA 2CJAA 2V50A 4USTA 2FZCB 3CPWR 2MZJA 3WX8A 2A18A 4FYDA 1RWVB 1J5EJ 3W2VB 3RW7A 2ZH3A 3PEHA 4DV1J 1C1CB 1IWAA 2JEGA 2CPJA 5CZVA 3MFHA 3RB3A 3V6DA 1RDRA 4K59A 3HVRA 2HEKA 1ACMB 2HVHA 2PSZA 1U1LA 5J2QA 1RHJB 1TKTA 2CQHA 3ENWA 3M2RB 2XNRA 5IOLA 1BQXA 3EE3A 3I0RB 1S9EA 4C11B 2DYAA 1U8SA 3T41A 2VFVA 2ZOMA 3H25A 1CLFA 3IA0A 2ZKUA 1G6BA 3TJ9A 3CMES 5F8MA 3M4XA 3T5LA 3AD7C 2KZZA 5F8IA 2AIRB 2DR5A 1UTAA 5KT3A 2B51A 3GSDA 3FBEA 3J81U 2M52A 4J9KA 1U48A 3V81B 2NCKL 1UVMA 2CNLB 3GIRA 1FE0A 1LW2B 2LXUA 4JI6F 2ZZMA 3M8YA 2HZVA 2CQGA 2EFGA 4L76A 4NXNJ 1JKHA 3IMQJ 5HLFB 5HI7A 4CYUB 3I5BA 4DV5F 3BBCA 1Y5IB 2VA2A 4C97A 3CJRA 1WHVA 4GVBA 1F5AA 4TLRA 1XMQJ 4WWSA 3CCLS 4RW6B 2JEJA 1RACB 5ETOA 2JJ4D 1B99A 2ZNYA 3PIPQ 3C6UB 5KFBA 2RQMA 4PRFA 3C8YA 3ZZRA 4O4RA 3EGNA 1PIEA 1WI8A 1VRUA 1RP5A 3FCHA 4CLZA 2JLGA 4ED5A 2FHJD 2ASJA 4ECXA 3MXHP 2UUAF 4YB1P 1RKIA 1FRJA 1NH8A 2XEXA 4C3LA 2CIMA 4JI1J 3RAQA 4C0HA 2HS4A 3R5DA 4NEZA 1RA7A 3K17A 2BJ8A 4WTYA 2YWEA 2CPXA 5IT4A 2X7IA 5F9NA 2DIVA 4YP3A 1RZMA 3KLFB 5HBMB 2M88A 4MKYA 2ALZA 2JOQA 2ZH7A 4X4NA 2HG4A 1YBTA 2OEKA 4NYZA 1QJHA 4AQYF 2H3EB 2C2MB 1S10A 2WRMA 2HFOA 4USMA 2U2FA 4M5IA 2JEIA 1SKWA 1NPPA 4NL5A 2B5JB 1YJWS 1ZETA 2ASLA 4J7CA 3R7SB 1YIJS 1HNXJ 1T11A 2YWFA 5E41A 1JJ2R 1RWUA 3KHLA 3MCSA 1BUXA 1NSKL 3TVKA 2R8GA 5FJ4A 3U1NA 4ERDA 2ASDA 4M5GA 3IAM9 3FSIA 2W2NP 5H9EK 1FRKA 4JBCA 2MQ8A 3RBEA 4PUOA 2RD5C 4WFZA 1RWNB 3IM8A 2OKQA 3BB5A 3GSIA 2YKNA 5K20B 1DQ9A 1VHIA 2YKMA 4UOGA 2ZUAA 4MIWA 4OHZA 3ET6B 2WOMB 1IM4A 4DHVA 1WSVA 4WCEQ 2VPYB 1XR5A 4I69A 2UUTA 3OXLA 1WG5A 5DQIA 4BWMA 1R31A 4LFCF 1X4BA 1VQOS 3FFIB 1VQ5S 1X5TA 2YX7A 4X64J 3TEGA 3DOLB 2KT5A 4JI6J 2AP6A 2MGZB 2W4CA 2WVDA 2HHHF 3FMBA 2DCUB 1JWWA 4Y00A 5IQ6A 1LW0A 4B9TA 3AY0A 1Q82T 4N76A 5DS7A 3VWSA 2ZBIA 4M5NA 4CLFA 3KK3B 2GZOA 4J9VA 1FI4A 5ETMA 4DV5J 4NI2A 1J2VA 2LLZA 2MQNA 2RSQA 5IM0A 4DI6A 3QRPA 3R5BA 3M8RA 2XY7A 3UVJB 4KAIA 2RDIA 5BXIA 8AT1B 5G0RB 3M2UB 2MZ1A 3OR1B 3SCJE 1S72S 3FDSA 1G1XA 1F60B 4X4VA 3UN2A 1Q0NA 1HBUB 2HQGA 4C8YA 4IG3B 1RHRB 1AFIA 3AOAA 2HNZA 5ETKA 2VQFF 2UXDJ 3IC1A 2RHQB 4ED8A 2E1RA 1WTFA 3B82A 3OQ2A 3DDKA 4ANEA 5C7PA 4A8KA 1N34J 2ROGA 3UPFA 3GJSB 1SC1B 2YWHA 2BOPA 1SUQA 5I42A 4QOTA 3SSRA 3DOMB 3IRXA 3JSRA 1F3FA 1RAIB 4I2PA 3L09A 1TL4A 3GYXB 4OYXA 2J9CA 3ILJA 1B0VA 1G7CB 2Q43A 2DXFA 1D1UA 1IUJA 5HL7Q 1SVDA 2F9JA 5IT0A 3CMQA 5FLXY 4PYAA 1S0MA 3BPSP 2NXUA 2HHWA 4I2QA 2QMWA 3NNHA 2OMOA 2M70A 2COLA 3NAIA 3ZZPA 3DDNA 2ZD1A 4OZ3A 1CBKA 1QAYA 2LVWA 4WFXA 2W4DA 3GFZA 1EJ7L 3HP6A 2W7PA 2GVZA 4R25A 2VG5A 3HSJA 4OI3A 2YX4A 2I2YA 3H40A 4I6YA 1K1SA 1S6OA 4LFCJ 2M5YA 1NSPA 3HZGA 3H5YA 4Y2AA 1JXLA 1LWFB 4OZ1A 2C2ZB 1BWVA 2ZITA 2XC9A 1ZA1B 2HHHJ 3JQKA 1BY9A 2E5GA 2HQDA 5M2PA 2QMXA 2ZBPA 3TX8A 3J80Y 1PSDA 1REVA 2IM2A 3G82A 4WFNQ 2RQ4A 4KO0A 2M9KA 3NGDA 2FHJA 3LWLA 4MJKA 1RWPB 1F9HA 1ZBTA 2RQKA 3DLEA 4FXDA 3CUNA 1VMBA 2PIIA 1E6YB 4KFBA 2BJ3A 1T9TA 4N8NA 4F4AA 1KLMA 4RWXA 1VQ4S 2ZZTA 4O4GB 2LKZA 3U02A 4M63A 3KDOA 1CJUB 2XS5A 4NLQA 1NDLA 2WBRA 4U7CA 2BMBA 2PI5A 2XSJA 4A8SA 4F0HA 3VGVA 1MLAA 4FF4A 4P10A 1D09B 4USJC 2VQFJ 1VQ9S 1WEXA 1VFJA 3J80U 2B9WA 3TAMB 3GILA 4PQUB 4TYAA 3SFGA 2NXJA 5CCMA 2JFDA 2H51B 3DMJA 1EQ0A 3BN4A 2QX0A 3QNWB 1DLOA 2EI5A 2V8GA 3HHEA 2NPFA 2RF2A 5F8HA 3NNCA 4C98A 4CTAA 3BGRB 2DRAA 1RBLA 4A4JA 4HVZA 3C15A 4XTTA 3A13A 2R2TA 2Z58B 4B17A 3T1AA 4NA2A 1RTZA 5A8KB 1FKPB 2HLUA 3EVMA 1GXTA 2BEFA 2DR6A 1JLAB 3PACA 1ULRA 1T03B 4ECYA 4QZVB 3CW2C 3JB9k 2OPRB 2XMTA 3BSCA 2HURA 4A47A 2DVIA 2JSXA 3M8WA 3M32B 1FRIA 3FC9A 1RB0A 3TJ8A 2V4JB 2XO6A 1SH0A 2B7BB 3OJSA 5GMEA 5HVHA 3G9CA 1P9YA 3KLEA 1Z2LA 3NOCA 1RQ0A 4DWIA 5IXUA 5AJ3J 3FK4A 3CDEA 2UUBF 2DPIA 4P52A 4LIRA 4KGZB 3P4UB 3DXSX 3CJKA 2FPHX 3RAXA 3OUYB 1QUPA 5GAGU 4OX7A 3W61A 3TZWA 3GMGA 1WD6A 4JV2A 3M6UA 2BRKA 5H1SV 3ITHB 4DX8H 3Q0AA 4RKUC 1RU1A 4O3RA 4URGA 2OD6A 4ED0A 3BGUA 5F8JA 3Q8YA 2BM1A 3R5CA 2DRDA 2HVDA 5D4OA 5F0UA 5DDQC 1HQEA 1KP6A 2MSSA 3MUVP 3HHKA 4E0DA 1BQMA 3MM7A 3EWGA 4O0NA 3WIUA 4LRCA 3BN7A 3QGIA 4LQ3A 3VAFA 5LMUJ 2D3ZA 3A3PB 4ZVHA 2DH8A 4A8MP 4WZQA 5F8NA 3HK2A 3OTOF 1S12A 1VRQC 3TUIC 3TAPA 1KC8T 3W5XA 3W2VA 3QT7A 3HVWA 2HHSA 1WF2A 4EGLA 1C1CA 2RUGA 2FGCA 1NKCA 5L1LA 2AMCB 4R0JA 4YMEA 2F63A 2GQ2A 2GA7A 1KVKA 1Q4RA 2LDYA 4RBUA 1NKEA 1IKWA 3FBBA 4MIAA 2ZUGA 3SQOP 3KLHB 1B7FA 1N5SA 2MZQA 1P8GA 1FKOB 2IM0A 3NBPA 1S1TB 4L73A 3H2VE 2HMIA 3CJ2A 4OV6A 3I9ZA 3N5BA 1RTHA 1URNA 4IRKA 4I1TA 1V6HA 3CULA 2LU1A 4BC9A 2LQ5A 2B4UA 4K5RA 5KT2A 3M2VB 2DNPA 3G87A 4NYPA 1LW2A 1HQ2A 2WB1D 3Q8UA 1NDPA 3CVKA 1X4AA 5HMYA 1HBNA 3RJMB 4DV4J 2RKIB 3LP2A 2I5JB 1UW4A 2FLLA 4ZK7M 4LRBA 2HRYA 4U7UD 2UUBJ 1ZAXA 4F0KA 3DLLQ 2DNYA 2KG0A 1CS4A 5T41A 3M1VB 4MK9A 3AOCA 2B56A 1U6BA 2MY8A 4DU7A 2LXFA 5K8MA 1UVKA 2C3UA 2AJ2A 1FVQA 1JLQA 1X4EA 4ZPAA 4WTOB 2HQIA 1U47A 1KOOA 4CO5A 1JIHA 1VQPS 3DNCA 5LSOA 4WXWA 2M4MA 1U2RA 3EMTA 1X4GA 4PZVA 1VQKS 3KJVB 4BCAA 3SI8A 1GAOA 4J37A 2QTWA 5DQGA 1I1GA 1O0PA 3QFHA 1SC4B 3H2LA 1D9FA 1TV6B 2MKYA 2E44A 3GYGA 3HD2A 1BGXT 2XCAA 4NCAA 3A8IA 4H4KC 3ETOA 1NJIT 5MLCV 4K4VA 2OFHX 2VFUA 4J9NA 5HVFA 2I1RA 3GWCA 2YXLA 2HIYA 4KGVB 2DNOA 3BYRA 1KD1T 2D3OR 4ZOSA 5FDLB 4DQQA 4B3RF 4WYLA 3QRQA 1BC6A 1PYSB 4MKAA 3T1HF 2IJNA 2AW0A 2GHVC 3DLBA 3OTOJ 3MAAB 3A12A 4KYZA 2ZJQQ 3U7JA 3TUZC 1JLEB 1RHUB 1UVJA 2HKEA 4FVMA 4CLPA 2VL1A 5BYSA 3KJFB 2R8HA 5LJ3Y 4FDFA 1SV5B 3NMRA 4ENOA 3RB6A 2VF3A 3FBCA 2RT3A 5GAEI 1RK8A 2CPDA 3JAMY 2FVCA 1R0CB 4FVCA 2LEAA 4M5LA 1B0TA 3CB4A 2E7XA 1IN0A 2ZH1A 1RU2A 4XK8C 2FUG9 1Q8IA 3ET6A 1RXOB 4OYZA 3C14A 4CP5A 2KJVA 3V4IA 4IH5A 3N6LA 1P1TA 3MD1A 1FNXH 2J9EA 1PJ7A 3E8OA 3GZ7A 5L9NA 1UMJA 4P7TA 1FXLA 2KXFA 4MAKA 2WSEC 2GQQA 4X62F 3IP0A 3R7BB 3QGHA 1KRPA 4JI2F 1S1VA 4KHMA 4GRSA 3C2PA 4PCQA 2MGZA 2ROPA 1W7WA 3DRSB 2Y0BB 4PWWA 3VHQA 1O51A 1Q86T 3DI6B 4KPCA 3W3SA 1NJXA 2F3JA 2L9DA 3JAMU 3MMBB 3M8QB 1R6YA 3SV4A 1JLBB 4K2XA 1G2EA 2J6SA 2V5HG 4DFPA 3UVJA 4DG1A 4GKKJ 1HD0A 3DDIA 3M05A 5K5MA 2YKOA 2CG4A 3D66A 5J1EA 4IUFA 5L1JA 4PXDA 3EVOA 2CAJA 4KV8B 1DTTB 2JLFA 1H7XA 1FFWB 1MMLA 4DLEA 3GP9A 4ECQA 4NCBA 1DZ5A 5T7LB 1Y5LB 4DL6A 3C46A 5KFDA 5EX0A 1W2IA 2B4VA 3NNAA 1JLGB 1VQSA 4GO7X 3W8PA 1HBOA 1DURA 2OPPA 4ECUA 3IR7B 1U1OA 2I38A 2E1AA 2NSBA 4LSNB 2W25A 4NZ6A 4USKA 3G96A 4RPFA 2KZMA 1NDCA 4ECTA 3POTA 2G1HA 2FDNA 3PR5B 3PXGa 2IC3B 5EN1A 2AYGA 1FTRA 4RW7A 2CZ4A 3B4DA 3D3CJ 1KHVA 2XI3A 1HHTP 2VONA 3P8BB 4HLBA 3G8SA 3MTKA 3J7A1 1IBKF 5KT6A 4MK8A 1IQTA 4DFJA 3T1HJ 1T02A 1X0PA 3TUPA 1U02A 1BQNB 4NZ7A 4ILMA 4LQ9A 3VAGA 4NMLA 1YJ7A 4NXMF 4H4MA 4W90B 4HT5A 5E3QA 2VQEF 1HI1A 4JYAJ 5CZXA 2ZHOA 4CWBA 3QZ8A 4QPTA 4WFAQ 1BWEA 1S59A 2APOA 1WKKA 3H20A 3PW7A 1TZ0A 2Y1IA 4LSLA 1SXLA 1R7IA 1Y11A 5ETPA 3OHBA 1XMOJ 4CO3A 5CYQB 2QN6B 4MIBA 2J6UA 1CJTB 3PRBA 1HNVB 1S6PA 5EX3A 1QSYA 1XEZA 4ECSA 2FJVA 4FPRA 4RW9A 2OGUA 1RLCL 2BJDA 3BYPA 3MMAA 3R9LA 2Q66A 4ES3A 1K0VA 2VKZG 5I3UB 1YSJA 2HRUA 2FHKA 2PEHA 4DPWA 4PWUA 4ED4A 2XMJA 2KXHA 1UA1A 2ILYA 2Q79A 2X51A 1SB6A 1UFWA 2QE5A 4YUDA 4Y2MA 4YY3F 1KLNA 1N56A 4WZMA 3HMJG 2IA0A 1QAIA 1WACA 4WBFA 1VR6A 2H5JB 2AX0A 2Y8YA 4DS5A 4F26A 1NPRA 1M90T 3T5HA 3ELHA 5AXMA 2F5GA 1RAGB 2XY6A 1F2GA 4H54A 1Q16B 2ZOGA 2DIUA 4ETXA 1VI7A 4RNNA 2CQ4A 2IFXA 3OFHA 2M0GB 4B3MF 1CULB 4FYYB 3CCMS 3L7OA 5DZ7A 3CD5A 3W7BA 3WC0A 1T0TV 2KYZA 3ZTPA 4DL5A 4K4UA 1RJJA 2YY3A 1RBAA 2UU9F 2FD2A 4XPCA 1D3WA 3OL8A 4MFBA 4TY8A 4R5PA 3P3DA 1XIQA 4USWA 4C4WA 4WJBA 3FNNA 3DOKB 3E01B 3MCNA 2QGFB 2FVQA 4ZIVA 2HS3A 3H98A 3US5A 5A8KA 1U2FA 3B8HA 2AEFA 4ZN3A 4E2FB 1JLAA 3TNVA 1TL7A 4DSFA 3D28A 1AXQA 3F44A 3L95X 2KN4A 3RW6A 2VG6B 3MECB 2OEMA 1JMTA 3FRYA 1GMWA 3SSSA 4ZCIA 1GMUA 3E51A 1ZZNA 4EZ6A 2W7OA 1RADB 2MKCA 2D74B 2ILZA 3VAMA 2W2QP 3M7VA 4CCHA 3MM6A 1RCOB 3OLAA 1FXRA 3EPIA 4YDDB 4V19X 1RTDA 3AQPA 1TL1A 4LR9A 4NZ0A 4DSJA 3DLGB 1OY9A 3FSYA 1O6XA 4URQU 2V8DA 4GMKA 1FE4A 5JVHQ 4WF9Q 1MROB 1HW8A 3ITHA 1LWEB 3CJ5A 2QFIA 4Y3CA 4QCLA 1S79A 2IRUA 5CCLA 2E9ZA 1T94A 5HQ8A 3BZQA 1UPPA 1PKUA 3HI9A 4QJVA 1N88A 1FF2A 2UZAA 1EKRA 1VCTA 3KWMA 1RT1B 2KM8C 3H5SA 2P5VA 3S7RA 2XHWA 2AU0A 4UY85 4KB7A 5M2UA 2QT7A 2VOOA 1Q8LA 2UUCF 3IG1B 2EG1A 1V3RA 2GHPA 4QYZK 2PD1A 2Y0SD 1N32J 5IQQA 3J7YI 3X3UA 2WAQD 2G1DA 4ER8A 4TQRA 5D4PA 1VS3A 5A2QY 3MOJB 2IRYA 1AROP 2XM3A 3VCDA 2BW2A 2CG8A 4ID5A 1JLFB 5EWFA 3AODA 3MEDB 3FEZA 3BF4A 2KHCA 1CQMA 2XWYA 3DHXA 2V94A 1AZSB 3TVYA 5AE3A 4OHVA 2W9BB 2KXNB 3D2WA 1HWUA 5E3AA 3Q24A 1IQZA 1MN7A 1N8RT 1R8HA 2VV5A 4L6V3 1UP1A 3BM7A 2OI2A 3ILOA 3QJLA 3NWGA 3EXYA 3AXKA 4KRWA 5C25B 5DZ6A 2LQ9A 5H9EJ 1E6VB 1Q7LB 1OSDA 3VGUA 4HACA 2XMAA 2KL8A 3MEEA 3SBMA 3DM2B 1QE1A 1FKOA 4ZP6A 2XBPA 5A2QU 1VIOA 1RUSA 2WK4A 2NZ4A 4ZVTB 1Q7YT 1S1TA 4N77A 5GADU 2IVYA 4OJ1A 3A4TA 3OR2B 3T19A 3PJWA 4OJ3A 4L72B 4Q45A 3CJ4A 4QU7A 1FRHA 4WP3A 1VQMS 1QVGR 2K1RB 3MM9B 4ZHRA 1S1UA 4IG0B 1M5OC 4DL7A 1HNIB 3GTYX 4DOZA 2ZJPQ 4KH0B 3QLHB 4G1QA 3W1YC 2H5IB 2QA4S 5HATA 3PRVA 4B3SF 4ELTA 1IR1A 4NLPA 1GNKA 2D7SA 1B3TA 4RW8B 2BBEA 2IRXA 3UD4P 3DLHA 1N6QA 2HAIA 1M1KT 5AXKA 4JV1A 3P49B 2A3JA 3WQPA 4AUKA 2L3MA 4U95A 3KJQB 2O01C 2M2BA 1JNZB 3THPA 4NE9C 4RUAA 3BQ0A 3LAMA 4ECWA 3MGJA 2ZH9A 1TVRA 2VOPA 4M5KA 1TKZB 2R8KA 1HQUA 1SH3A 1KS2A 1QY7A 1NAQA 3UNGC 3KJVA 3VVTA 1CPZA 1NSAA 2V0NA 4WE1A 4RNMA 4ZLJA 3ZZYA 2ZC4A 4JOUA 1TV6A 2R2SA 2GO8A 1LEOA 4EZ9A 4QR2A 1A6LA 3RG6A 4WIIA 1BMQB 1V9OA 3ZTSA 1QM9A 3PFOA 2KH9A 4M1KA 1Y4ZB 5C2CA 1SJ3P 3MOZA 4OJGA 5AE1A 5GAHI 3O3LA 4DDFA 2Q3PA 1JJCB 1EX8A 1NEEA 2BYCA 2W2MP 4NA1A 4DPXA 1OJ4A 2QC3A 2XZWA 3K58A 5B0GA 4O44B 2PMZD 2ZH8A 3ZNUA 2DO0A 4ZCLA 1FJCA 1UWBB 2J6TA 2Y1JA 1HARA 2W1BA 3SCIE 2RRAA 2EFVA 2ZFHA 1HMVA 3SXLA 2YVSA 3H2UB 5KG0A 1NRKA 3KDNA 2AGQA 1SIZA 3TZXA 3ISZA 4X65J 4OYWA 1HWKA 1SV5A 4B9VA 1J5OB 3CE8A 3PYDA 1AUSL 4ZPWR 3R27A 1WG1A 5C2GA 3P5TL 3UN5A 4N5SA 3KMSA 2PA3A 3EX7B 3HHNB 1XR7A 2E9RX 2CQPA 2MKIA 1XJWB 1S4EA 3IRWP 3TW0A 4DUZJ 2V4RA 1S6QA 1SPBP 5A0YB 2JVRA 4AYBD 3SCLE 2DISA 4CLKA 2K7KA 3MCOA 2YNIB 4ZPDA 3MR2A 3W2WA 2O67A 3ICLA 4ZJLA 1WC4A 1WUUA 2GIQA 2PC6A 3QAUA 3V5RA 2VG7A 3TQEA 2KG1A 2K3KA 4TYBA 3N0VA 1TU0B 1YKWA 1FJGF 4YOEA 2EG2A 1YZ7A 5D4NA 4FN5A 2FC9A 4FS2A 5CH7B 2AQ4A 3MMBA 2QZ8A 4ED3A 3Q8VA 3LGNA 1XN9A 2GV1A 2DR9A 3G86A 4LFAJ 2FJBB 4JI3J 1DARA 1U25A 4NYOA 3RRKA 2K3IA 4RW4B 2D69A 5GADI 2VHGA 3IS9B 4KGMA 2E5LJ 2V63A 4USUA 4ED1A 2CNNB 2JEFA 1S7HA 4DMZA 3PTWA 2G0CA 3LP1B 3NGSA 3IFEA 4F7VA 5T7LA 3VZHA 1S4FA 1M5PC 4FXVA 1MG7A 2KT2A 3CDUA 1TTHB 4QIGA 1FVSA 2OUGA 1IJEB 1SBRA 1IKXB 5EGYA 1U26A 4RL1A 7AT1B 1Q1KA 4EBEA 3HHLB 2EFNA 3S6EA 4HL9A 5LMNJ 1JB0C 4Y2IA 2AHOB 4A48A 1JNRB 2VFTA 1RABB 4MTPA 3HM9A 2G0IA 3DLKB 1EQMA 3K5MA 2KFNA 4DPYA 5HROB 2BE2B 1RT2B 1F5CA 3C16A 4TXSA 2JWNA 5KFAA 5KFLA 4A8WA 4O3OA 2RB7A 1N48A 4NRTA 4OLOA 1DTQB 2MTLA 4C7QA 3QMQA 3JYTB 3I87A 2KM8B 3DKDA 2XMMA 4B3TF 2CDQA 4CLLA 4X2BA 3ETMA 2Q6CA 2CQ2A 3KK1B 2OHDA 3UCZP 4DLGA 4ZVEA 4HKQA 1LK7A 1U09A 4IH7A 3BDEA 5A8WB 2RVJA 1Q95G 2F4VJ 4JI4F 1K73T 2YNFA 3NLCA 1PYTA 4F4YA 1YRUA 4ZCKA 5J2PA 3GV7B 2BDPA 2DGUA 2HQFA 4PXEA 4WP8A 3MURP 3LH2S 2ZH5A 3FKBA 3JTPA 2ATCB 3KLGA 3NCQA 2HRTA 3SDEA 4KTQA 2FGOA 2IJRA 3E2EA 2FHOB 4NLVA 3G6XA 6FDRA 1VBYA 2EW9A 4I7FA 3K89A 4AT1B 4C48A 5B09A 2BKNA 1TK0A 3KMQA 3T9NA 2J7UA 3T3FA 4IYQA 3CJ0A 4DR7J 4DX7A 2ZOFA 1KFDA 3W66A 3KHGA 3L7UA 1A0OB 4LRDA 1KTVA 5ADZA 2GVDB 4O3PA 2P2CB 1HWLA 3CMAS 1N5YB 4F4XA 3KLIA 2E1MC 1N36F 3A8KA 2PA8D 4OHXA 4EWTA 4HEA9 4C8MA 1AYEA 4J5OA 3AFGA 3TQ1A 4DXLA 3IO1A 1RA6A 4LSZB 4Q0BA 4PWDB 1S97A 2M3DA 1S0VA 3AHPA 4YQWA 2DT9A 3OL9A 4CH0S 4Q5VA 2PMWA 1TL3B 4ZVGA 2OMLA 1FJ7A 2HNDA 2MZTA 3TYTA 3N5FA 4BC7A 4J9UE 5DETA 5HMZA 3ISND 2FZGB 3HJVA 2AD9A 1OY8A 2HWTA 3TA0A 3M8ZA 1YGYA 3S1TA 1LWXA 4JV5F 3SQGB 7FD1A 1K44A 1L3KA 2L08A 2MHEA 1I94F 1YTYA 3CCWA 1W26A 4MK7A 3BH7B 3PIOQ 2C42A 2GS8A 1D8ZA 3DN9A 1IR2A 2O1PA 3MPDA 3MMCB 2MKHA 3I0SB 1NK8A 2PI4A 3LGHA 1QD1A 3DU5A 2DITA 4ZPTR 1BXNA 1F9FA 1JXVA 3KHHA 2C3OA 5LT5A 4F02A 1FEHA 1S49A 1IKVB 4ED6A 1Q53A 3RB0A 5ETRA 2HBZB 3LPEA 4B3TJ 3C6TA 4WU3A 2XCPA 1LFPA 3OHAA 1ZPWX 4H4KA 3EZOA 3HO1A 2A2CA 4NLOA 4NLWA 1N0UA 2ZH6A 3WZ0A 2CPYA 3Q8PB 1Y3JA 3W60A 1OWXA 5DLGA 5ETQA 3I5AA 4KPYA 4UQTA 1H74A 2GAGC 4OL8A 3ZFVA 4WK1A 1PO6A 4L74A 1X4CA 2GJ2A 1Q8BA 1NKBA 5KFWA 4ZLLA 2BOAA 4UW2A 2UXBJ 3HT3A 4LF8F 2JL9A 2J5AA 3DLGA 2FVRA 4UZCA 4J91A 2B0GA 3IBCB 2ZE2B 4OZLA 1TMJA 4U6PA 2GC8A 1U24A 3TA1A 1SJRA 1WORA 3LF0A 4DV1F 2R7QA 5ITHA 8ATCB 4PG6A 3FZ2A 2B4PA 1T05A 3HJFA 1H73A 2B43A 2ZHBA 1HHQA 2UUWA 4L3KA 5B0CA 1GTEA 1TUVA 4UOCA 1VGYA 1RT1A 5ETNA 3MCMA 5H9FK 1H2VZ 1N36J 1GK8A 1H2UX 3MF5A 5L38A 4LVNP 2RMLA 3I4HX 1WOPA 1HL6A 4U8VA 3U27A 4KKOB 2IMWP 4IH6A 2YNHA 4EFAC 2UXCF 1TKXB 4LUBA 5KG4A 5DDOC 2PE8A 4BS2A 1Q8KA 3HHLD 3MEDA 2D3O1 2NPIA 1TL5A 4TU8A 1QSSA 2H1YA 9RUBA 1AZSA 4DV6F 2CDRB 2W9BA 2CVEA 3GQCA 1HBMB 2F65A 2HVZA 4ZVRB 1M5KC 3NWRA 1XMQF 3V4MA 1GFWB 1XQIA 4DV2F 1UETA 3CJSA 2DGVA 2JDJA 2QEXS 2DH7A 5C25A 4J9OA 3P5BP 3Q23A 4P74A 4CLUA 3UDLA 1VRTA 3F73A 4B3OB 1KQKA 5BYRA 2RUSA 1IXKA 2PGCA 2FC8A 2RU9A 2XO7A 2H48B 2OELA 3OR2A 4JI1F 3VALA 4IDKA 1HA1A 2RDJA 4Q43A 3PVXA 1C0UB 3KXDA 3MM9A 4HT7A 3L4BC 4IG0A 5E2QA 3I6PA 5B0AA 2Q6BA 3BV8A 3TJAA 2HNYA 4K4SA 1FO1A 2J0WA 1HWJA 2MHNA 1Y10A 4ICLB 5L1IA 2J0SD 1DQAA 3IWNC 2V68A 1RT5B 1RT6B 4EI2A 3LANA 1RGVA 2DNLA 2P8IA 2W4PA 1KVIA 2CJKA 1NHUA 4R8UA 4DN9A 1AT1B 2QJ3A 2WSCC 4KGXB 2KDOA 1RTIB 1WC1A 4PYDA 4GVLA 4ZITA 1HNZF 2MZSA 1KSPA 1HYSA 4P6QA 3J81Y 4FYWB 2C2NA 2FZKB 1SL1A 2VDHA 2CJXB 1QTNB 4LRAA 5F0WA 4IR9A 4XAKA 4K4YA 2QYGA 1NJYA 3CCZA 3I31A 1Q5YA 3PJ9A 1WHWA 4RUCA 1KONA 1CG2A 3M30A 2XS7A 2JX2A 1OQ6A 2W2OP 2GAHC 2OJ3A 3M6WA 2NS1B 4JUZA 4ZVFA 2C2EA 2QLFB 3QATA 1CSJA 1ZM9A 4NRUA 4RBVA 2IYGA 1S1WB 5KG6A 1NU4A 3WHIA 4EYIB 1FNMA 2UXCJ 4WK3A 4X64F 1ZM4A 3FJ2A 4UUXA 3OTBA 5CYMB 2ROEA 5CHCB 3RUBL 3EZUA 2WONA 4GKJF 4P2FA 4IOAQ 5CYJA 3GG1A 5GMDA 1GEHA 4LVOP 2BX6A 4RZRA 2Z56B 2MYFA 2HPUA 4DV6J 2MKKA 1FRMA 3R5GA 4DUTA 3IAS9 5KFKA 3SMZA 1RYRA 2NUHA 3QO9A 3LP0B 4FKXA 1NZAA 3AJ1A 1J5OA 3CCSS 3QIDA 4DV2J 4YB7A 3AOBA 5J2MA 3D0HE 3JSMB 3QBCA 4HH0A 4J90A 4OYAA 2IM1A 2QYCA 5KFYA 4WFBQ 2RHSB 5K14B 2IHR1 4UY8T 2DRBA 2CYYA 4E98A 3BDPA 2VBWA 3AT1B 2UXDF 3PG9A 3OXGA 1ZS6A 3UI3A 3QT6A 2CADA 1UWAA 3LQVA 5JJBA 2AF6A 4USHA 2PDAA 2UVRA 2FJWA 1N34F 2IM3A 1PJ5A 3CCTA 5D15A 4KIAA 3RBDA 1L3SA 1SC6A 2WHOA 1R6VA 3QJJA 3VQSA 3CC7S 2J9DE 1IWGA 4IFVA 4CNYA 2MKJA 1T9XA 1EETA 1F2HA 1KR4A 1PBAA 1SC3B 2WVBA 4UF4A 3R2CJ 4OI1A 3JS9A 2FJDB 1H38A 1HNZJ 1YI2S 4RW4A 1U4BA 3CNQP 1I5OB 1HLWA 2YQ1A 4IO9Q 5KOXA 3V6DB 2HFVA 2OPQA 2UVVA 1VQ6S 5J2QB 1NO8A 4Y2CA 3L3CA 1EIYB 1O5JA 4JI8J 1S9EB 5EWGA 2J0XA 2VASA 4DCJB 2V9KA 4OYPA 4F2RA 1ROFA 2CKWA 1FDNA 2MKSA 2ASYA 4CI0B 1F0XA 1FX2A 4LF6J 1S99A 3PRDA 5DDPC 1V5IB 2A10A 2CNOB 1FXDA 3D7SB 1RT4B 3QGGA 4LR8A 4KQZA 4ZS6A 1F3VA 2L48A 2UVUA 1FWLA 1WHXA 3MPUB 2XYGB 4EEYA 3HVTA 3M9NB 4EBDA 1UPMB 3TO8A 4GKJJ 5D8HB 2PFFB 2R2UA 4GVBB 3GG0A 3N6NA 3HVAA 2XQCA 3G6ES 4W92B 1WNEA 4U96A 5IC6B 4ANCA 5LOQA 1VK3A 1JLCA 1NK9A 2MQPA 4KJIA 4MKBA 2R7XA 2Q1LA 4CDIA 5KFUA 1FA0A 1VRUB 4DR2F 1J27A 3CC2S 1X4DA 3PFEA 3BS9A 5E0OA 4HI2A 2OLWA 5HO4A 3BKTA 2W8KA 1TUGB 2IJFA 1N5TA 3W8GA 2P9CA 1IJFB 2NYIA 1QDUB 4JP8A 1XNQF 2PO4A 4X4RA 1U1KA 5EWEA 4K0KJ 1T9YA 1R8PA 1A7GE 3BR9A 1YBUA 2C2KB 3NS7B 2AGPA 3DRPB 3ZZOA 1U1PA 4ZVSB 3BH6B 2DNKA 2B4OA 1BD6A 2B9YA 1HNWF 4AL5A 2MPUA 2AKWB 2FLPA 4KHPJ 1KNZA 3T1YJ 2A6OA 1JK9B 2E5HA 1X0FA 2CNKB 3GE9A 2HFZA 4QYZJ 3N79A 4PWDA 3MM8A 1UAWA 4EO8A 4PUOB 2LP4A 3CXCR 2AT1B 2XG8A 2WVEA 1IBLJ 4DR6J 1TL3A 1WC6A 2DPJA 2YKMB 4ZPCA 2H4YB 3K5NA 4M5HA 3W9JA 2MQOA 3R5AA 3GCXP 3CSKA 1MWQA 2ZKTA 2YWWA 4OV1A 2YNGB 2G0JA 5AE2A 3HHDA 2DNQA 2GMJA 2ERRA 1FERA 1M1GA 2DNHA 5D77A 2NR0A 4DV0F 2ZM6F 1SI9A 5AJ3F 5D0GA 4P9SA 1QVFR 2KI2A 3ULHA 2DR7A 1R89A 2BQRA 2RJZA 4OQJA 1WHYA 4E8UA 3BGOP 2VC0A 1N33J 1NJZA 1DRZA 5CAAA 1LW0B 4G1PA 3I0SA 2FVSA 2N7YA 4DR1J 3NS5A 3QQCD 1B7YB 1UZHA 2CWKA 4LIWA 4NI2B 4LBIA 2FYXA 2AJ0A 3DGPB 1FDAA 1WEYA 3RZAA 2ZVSA 2IAJA 4FF1A 4HI1A 1IKVA 1XBWA 4MYUA 4WIQA 4K7QA 4TU7A 1WC5A 1UEKA 2HBQB 2U1AA 1WDTA 5K9FA 3ONQA 3CDBA 3NEKA 3R6LB 4KR0B 4DPUA 1X4FA 2IVMA 4DR2J 3R97A 3QJPA 2OPSA 1L3TA 1H0HB 2HNZB 3G2XA 5LMUF 3B6BA 4DL2A 3AJDA 4ALZA 5D0HA 4IQXA 5K8OA 3K0JA 2P6TA 2LMIA 4DV7J 3D6MB 2WW4A 4LRFA 1QAJA 4JI0J 1QSLA 3W9IA 5A8RA 2N7CA 4FNHA 4RNOA 3NP5A 1XNQJ 1UCNA 3J7AN 2ZE2A 4X4SA 1M5HA 1SUQB 2L9WA 5E5NA 3DYAA 4CLSA 2OH2A 3THVA 3LOUA 2WW8A 4IQMA 3IRXB 3CJQA 4UOHA 1RHQB 1WWHA 4OHYA 4AXJA 4TNOA 1ELOA 2D1CA 4AFFA 3G6VA 1CQNA 4K50A 3QSIA 3NG8A 4G6VB 3K5OA 1HNWJ 4Z2XA 3HKZD 1OPZA 3LGMA 3G6YA 2CA9A 3HSGA 4I67A 1X9MA 4KKOA 2QA4G 2MLYA 2R7TA 3CIMA 3H90A 1PJ6A 1Z1ZA 1FHTA 1EP4A 2GCFA 2MLXA 2ZD1B 3MM5A 2WBMA 3TX0A 3MEGA 5KTQA 2YPYA 4Q2MA 4OX9F 4DL0C 4PPDA 4LF9J 1HR0F 2CZVC 4FBTA 1X4HA 1D9DA 4B9SA 3PM9A 3TRGA 4DV4F 3AA9A 2BANA 4DV0J 4EBCA 2ZM6J 3V6HA 1IBMJ 2VFSA 3DRRB 3MD3A 2EK6A 3OW2R 2FHMA 2N4CA 3MPWA 3IWLA 2HVEA 1WC0A 1LWCA 1NM2A 3M6VA 1XERA 1PG5B 2NXCA 3VTIA 4NOHA 1NSQA 4YR0A 4PEOA 1U1QA 4DPOA 1REVB 1GTHA 3G82B 3W63A 4KO0B 4LFBJ 5B0DA 2MJUA 4LBPA 4LF1A 3DLEB 3OVBA 1PC4A 4KFBB 1T3NA 1S9GA 4NLRA 4CH7A 5KG5A 3A8JA 2L41A 1FDDA 2J0QD 2DY1A 2YQ3A 4DR3F 2WZ1A 2CWXA 2YBVA 5KFPA 5HP1A 1R8AA 1RT5A 1FCAA 2G2OA 4DPTA 4A8YA 4ILLA 4HTIA 2XSJB 3KJNB 1SKUB 2CQBA 4KBIA 1RHMB 2KKHA 2MJNA 1FTCA 5IC4B 1NLKL 2VBZA 4Y34A 3IN5A 1BHNA 2DNRA 3VV2B 4A8FA 4U8YA 3SFUA 1H98A 2IDEA 1S5ZA 4QU6A 1RAHB 4F0MA 2ZWPA 3GIIA 4QWDA 2FJXA 2IDLA 2W8LA 1DLOB 4CLWA 4EK2A 4LF4J 3D6TB 2V6AA 2DNMA 3PW5A 3MI7X 2RF2B 4DJBA 1KDNA 2C2RA 2V67A 1M1HA 3N4WA 2QFJA 2DGTA 2XLKA 4CTAB 1PBUA 1NMEB 2LDIA 4NLSA 1U8WA 1FWKA 5L8RC 3J7Z5 1RISA 3C15B 4C8OA 4DR4F 4UQGA 3O44A 5E3RA 4ZIWA 5KFJA 1D0EA 2J76E 3M2RA 4DBQA 2DCLA 3I0RA 4C11A 2KTQA 2F8MA 4P2MA 4QR0A 3AD9C 1NHVA 3ZTRA 1MWZA 2YQ0A 1GXLA 2QSWA 1JJ4A 2BACA 2Y3YA 1VLOA 1RWOB 3V81A 1NUEA 3MDFA 2CZ9A 3KLEB 2KO1A 5CYMA 3Q8RB 2R8IA 2V8HA 4OX9J 3QYYA 3KUEA 4NWBA 1ZM3A 2Z30B 2K7JA 3NGRA 4C2MA 2VUGA 1HR0J 4LF5F 5HLFA 5T14A 5DGAA 1I3OB 2X3DA 4CYUA 3QRRA 3AB4B 3CJKB 5A76A 1N0VC 4XO0A 4CLYA 4GKKF 5KFVA 2VH7A 4RW6A 3PJXA 4IO1A 4OHWA 3UD5A 3CCUS 3HSDA 1WOOA 5L39A 2DH9A 2HK3A 3C6UA 1HPZB 2F7VA 2K8GA 4M5JA 3OXFA 4DFMA 3C66A 5D78A 1FFSB 2J7KA 5DG9A 4Z37A 1HQEB 1DJ0A 5D4LA 2FTRA 2W2PP 3HFKA 3MAQA 2ZBRA 4N47A 2FJAB 4GO5X 4JB8B 1BQMB 4TY9A 3VAHA 2C2OB 3D68A 3CF5Q 1KWMA 2JC1A 4GC6A 4PG4A 2R42A 3KLFA 4DR3J 1UA0A 2OP5A 5HBMA 3WC2A 1SKSA 5G4DA 1N52B 4KHRA 3MPVA 4RO0A 2QO3A 1FT8A 2HBRB 4O23A 2AEJA 5LXRA 2JC0A 3AA8A 4YN3B 5GAGI 3QT8A 4C0BA 2W7AA 1HI8A 1Q5VA 2VB6A 2LXIA 2B5JA 4OYOA 1OY6A 1IR0A 4CH1A 3L9ZA 3H5UA 1URRA 1NCLA 1NBEB 2QSFA 2XULA 5KFFA 1IKWB 1FFGB 2DXEA 4K4ZA 1ZM2A 4DEZA 1FNOA 5C42B 4JYAF 2MMYA 1HW9A 5ETLA 1NHKL 3NBPB 3UCGA 2I8EA 1AFJA 2R8JA 3I4PA 2KT3A 4OLPA 5HVGA 2OTLS 4DR4J 2HMIB 3OPKA 3W62A 1RTHB 1FD2A 2DGOA 2WOMA 2PFDA 3NRBA 2DB1A 4CM2A 4ZCMA 1YVFA 2QIFA 3VF0B 1RT4A 1XMOF 3DU6A 5E3CA 4QIEA 2XWXA 3DCAA 5D3GB 2DEIA 4CNZA 4DX6A 1S0OA 3E3XA 1S77D 1EZZB 3B4MA 3TI0A 3FFIA 1HBNB 1RAAB 1FRXA 1B70B 3DOLA 5LJ5Y 5SUHA 3GJTB 4DSIA 2GGPB 2W9CB 2VU5A 3IM9A 3LP2B 5A6PA 2W01A 2RNEA 2V34A 3KTQA 4LF5J 3B54A 2M7SA 3EPGA 4ZVPB 3KK3A 4ECRA 1CS4B 3ZTOA 3DRXA 2AYEA 3MEKA 1RWKB 4ZP8A 4RNFA 4HHJA 1JLQB 5G0RA 3M2UA 4A8XA 3HD1A 1UJ4A 3OR1A 2CPIA 1RT3B 1U45A 4O3QA 3KNAA 5KT5A 3FCVA 3OTDA 5C24B 1HBUA 2DGWA 2E66A 4IG3A 2I6WA 2HHXA 3TAQA 3HT0A 1PCAA 4ZA1A 4J9RA 4ZVOB 3OVAA 3TANA 2RILA 3MMJA 1WKLA 3MR7A 2HGNA 2JLEA 1OIAA 2B8QA 1KHWA 3R1LA 2GHWA 3DRPA 1X9WA 1UKUA 2KU7A 3OT9A 4FS1A 1DY3A 2Z2ZA 1X5PA 2RH3A 1HWIA 3DOMA 1R43A 2FLOA 3OV7A 5CA5A 4Z7YA 1OS5A 3P45B 3JXOA 1U49A 4JI7F 1VBKA 4XIUA 3EVWA 5KG3A 5H9FJ 4ELVA 3CD0A 4CLTA 4M95A 3SYZA 2FB0A 3CCVS 2FY1A 4RBTA 5J1NA 3I5CA 2G9OA 2PT0A 5C5JA 2BVZA 3TA2A 4AE5A 2B7CB 2AYBA 5M2RA 4TN2A 3CJ3A 3C14B 3V4IB 3TZYA 2JZ5A 2YNGA 1M5SA 2W24A 4X4OA 3W5ZA 3ILLA 5RUBA 2VPXB 4EUVA 3QWUA 3PY8A 1H7WA 2RS2A 3ENQA 1S1VB 4ELUA 4HDHA 2DHSA 2KRRA 1U1NA 1K1QA 5DQHA 2PMHA 2NXEA 1NDKA 3ISNC 4OFZA 2AGOA 1I6JA 3NL0A 2ZC3A 3P96A 1LWFA 3R2DJ 2Z8QA 2BZ2A 2ZJRQ 3H7HB 2XZDB 3EDRB 3OFFA 2VJVA 2CJBA 2H5EA 3DGPA 2BA9A 4F8RA 4HR2A 6FD1A 4DG1B 1ZH5A 1VJQA 2D41A 2ZBCA 2V9WA 5J1EB 3JQJA 4B08A 1XC9A 1OPIA 2J9DA 4M5DB 3O1LA 1Q79A 4P75A 3EUNA 2AX1A 1IVZA 1E6YA 1N32F 1X31C
chains in the Genus database with same CATH topology
3I55S 3CJ2A 3ZC4A 2YNHA 4O4GA 3I9ZA 3N5BA 1RTHA 4ES1A 5KFIA 4G3IA 2LCWA 1URNA 4QW8A 4EFAC 1ZTTA 4IRKA 3FEYB 4I1TA 2P6SA 2UXCF 1TKXB 1V6HA 4WU2A 3CULA 4DV7F 4LUBA 2LU1A 5KG4A 4BC9A 2LQ5A 5DDOC 2B4UA 4K5RA 2EFQA 2GJIA 5KT2A 4C8KA 3M2VB 4JI0F 3OBIA 2DNPA 2E1CA 2PE8A 4BS2A 1X7VA 4NYPA 1LW2A 3MR6A 2QLXA 5CD4H 1HBOB 2ATLA 2CQIA 3HHLD 3MEDA 2UVWA 2NPIA 2OPPB 5FD1A 4ITSA 1TL5A 2WB1D 3OFGA 4TU8A 1QSSA 2M8HA 3CVKA 4ZP7A 2W9AA 2ZZNA 2VODA 4F67A 1NH7A 1X4AA 4OI0A 5HMYA 2RS8A 5F9LA 4XPEA 1HBNA 3MR3A 4DV6F 1XMBA 4NLGA 5I3PA 4GC7A 2W9BA 2CVEA 3POTB 3HXMA 3TAMA 3GQCA 4U7UK 4PQUA 2RKIB 3K8WA 3LP2A 1HBMB 3K2YA 4F3QA 2HVZA 2I5JB 4IFVB 1UW4A 3I32A 2FLLA 1M5KC 1XMQF 1EETB 3V4MA 1KOHA 4ZK7M 4DV2F 1XWLA 4RW7B 5KAKA 1UETA 3CCQS 2HRYA 2KHDA 2DGVA 4WKRA 3K8VA 3HLUA 4TLQA 2JDJA 2QEXS 2DH7A 2MZRA 4IKAA 1ZAXA 5C25A 3DLLQ 2ACYA 2DNYA 2KG0A 5T41A 4J9OA 2AV5A 3Q23A 3M1VB 3PX6A 1X5SA 4MK9A 1JXEA 3AB2B 1WF0A 4C8NA 2KYXA 1UJ6A 2B56A 1TP7A 1N5YA 3BGRA 3UDLA 1U6BA 2MY8A 1VRTA 3RU0A 3F73A 4B3OB 1GXUA 1S1XA 2LXFA 2C22A 1KQKA 1UVKA 5BYRA 4I4BA 2C3UA 4ID8A 5K8MA 1FVQA 2DNNA 1JLQA 1X4EA 2GW8A 4ZPAA 3ZZTA 2HQIA 1U47A 1IXKA 2PGCA 2OPQB 1KOOA 4H4MB 1JIHA 4CO5A 1VQPS 2FC8A 3DNCA 5LSOA 2RU9A 2XO7A 4WXWA 2M4MA 1MU2A 1WELA 1U2RA 2YTCA 1N5VA 3OR2A 1X4GA 1VQKS 4JI1F 1VK8A 3VALA 1FKPA 4IDKA 3KJVB 4BCAA 3SI8A 1GAOA 3L7PA 4J37A 1HA1A 2RDJA 4Q43A 4X4TA 2CQDA 3PVXA 5DQGA 1FRLA 2FVPA 2A1BA 3CD7A 4DFKA 1T03A 1C0UB 3GFYA 1I1GA 3P6YC 1O0PA 3MM9A 4HT7A 2CQ3A 4IG0A 2YKNB 1YJVA 5E2QA 3I6PA 5B0AA 3WBZA 3H2LA 3S01A 1D9FA 2Q6BA 1K8AT 1TV6B 3UQSA 2OPRA 2HNYA 2HHTA 2XNQA 2E44A 4K4SA 3JSBA 3JTOA 4IFYA 3UFCX 1FO1A 3M32A 1BGXT 4Y0FA 2J0WA 4OMFG 4LF9F 2XCAA 1HWJA 2MHNA 4P7VA 4NCAA 4F25A 2V4JA 4ICLB 4H4KC 2XS2A 3PZPA 5KT7A 5L1IA 2J0SD 4Q2LA 1DQAA 3IWNC 3ETOA 1RT5B 3G8TA 1RT6B 4LSLB 1NJIT 2LQJA 2ZDOA 5MLCV 4KSEB 3PKYA 3LANA 4K4VA 1RGVA 2DNLA 2KJWA 2OFHX 2W4PA 3I96A 2VFUA 2VKRA 4J9NA 2I1RA 3GWCA 2RU3A 2CJKA 1KVIA 1NHUA 2DGQA 4Y65A 3PX4A 3OLBA 4R8UA 3SQGA 4DN9A 3CDWA 4I64A 2DHAA 1IBMF 2DNOA 2F9DA 1S6PB 5DM7Q 1L5UA 3DRRA 4NLTA 3HVTB 2V4QA 5IT9Y 2WSCC 1KD1T 2BABA 3DFEA 2OO4A 2D3OR 4ZOSA 2NSCA 1YJ9S 2KDOA 4H4OA 4I68A 5FDLB 4DQQA 1RTIB 4B3RF 2YKAA 4WYLA 4DV3F 1BC6A 3D5MA 3HHLC 4RW9B 3OUYA 4J9LA 1VHFA 4A46A 1HNZF 4MKAA 3T1HF 2IJNA 3MMAB 2AW0A 2GHVC 2MZSA 2LA4A 4I0WA 3MFIA 2IA6A 3DLBA 1CEZA 1KSPA 1APSA 2AWZA 2I9SA 1HYSA 4PKDB 1Y3KA 5E3PA 2BRLA 4P6QA 1RI7A 3J81Y 4FXWA 1UL3A 1C1BB 2N3LA 4F4WA 1SL1A 3MMCA 2ZJQQ 3U7JA 3TUZC 1JLEB 4PG5A 1UVJA 2WB4A 4FBUA 4FVMA 5F0WA 2VL1A 5KFQA 4IR9A 2FIUA 5BYSA 1LQ9A 4XAKA 4LFBF 1VIXA 2R8HA 1NK6A 4PG8A 5JUMA 2HIQA 1MMDA 4K4YA 5IM0B 1JLCB 4MMOA 5KFOA 1NJYA 4CO1A 5LJ3Y 1SV5B 3NMRA 3HX9A 3RB6A 3CCZA 1R27B 3I31A 3V6JA 2WCXA 1Z4UA 2RT3A 5B0BA 2XMVA 1WHWA 4RUCA 4G1IA 4DF8A 5GAEI 1KONA 1RK8A 2CPDA 3JAMY 2FVCA 4FVCA 4B02A 2LEAA 1CG2A 3M30A 1B0TA 3CB4A 2XS7A 2CPHA 2JX2A 4NA3A 2E7XA 1IN0A 3R3TA 2ZH1A 1OQ6A 4XK8C 4OI2A 2FUG9 1Q8IA 1LXJA 2L9NA 2OJ3A 1FEEA 2KJVA 3V4IA 3M6WA 4IH5A 3N6LA 2NS1B 4JUZA 4ZVFA 2C2EA 1P1TA 3OTCA 4QW9A 3MD1A 5F3ZA 3CEDA 1CSJA 1ZM9A 3OTEA 1FNXH 1XNRF 4QWAA 5LSLA 4IOCQ 2J9EA 4B9MA 4NRUA 1U1RA 3E8OA 2D3UA 3GZ7A 5L9NA 5LXYA 4C8ZA 4RBVA 4DN0A 1UMJA 4P7TA 2IYGA 1FXLA 1S1WB 2AJ4A 5KG6A 1NU4A 4EYIB 1DHMA 4FF3A 1FNMA 2KXFA 3CC4S 4OZNA 1SIWB 1S76D 3LO3A 4MAKA 2WSEC 2GQQA 1DAXA 4X62F 3K7RA 1KRPA 2DHXA 3QGHA 2KFYA 2DJWA 4OIXA 4WK3A 1ZM4A 4X64F 3FJ2A 2V2KA 4JI2F 1S1VA 2RQCA 4UUXA 3OTBA 1X9SA 5CYMB 2ROEA 2DO4A 5CHCB 4F3MA 5KFEA 4KHMA 1AW0A 3EZUA 2WONA 1JJHA 3C2PA 4GKJF 5DG7A 4PCQA 4IOAQ 5CYJA 3Q8SB 2MGZA 2ROPA 3BEGB 3GG1A 4RX6A 1QLNA 3FSXA 3PX0A 3DRSB 4DUYF 5DG8A 4LVOP 1O51A 1Q86T 3DI6B 4XDDA 4RZRA 3TVZA 3W3SA 4LF4F 2MYFA 3R1HA 2B6AB 1NNDA 2HPUA 2F3JA 2L9DA 1NJXA 2MKKA 1FRMA 2X1BA 5I42B 4CO0A 3X1LB 3IAS9 3MMBB 4MFBB 3HZEA 1WTBA 1L3UA 2CVIA 4I56A 3KOAA 3M8QB 4X65F 4TY8B 1T95A 5KFKA 1R6YA 3SMZA 3VQTA 4R5PB 3SV4A 1JLBB 1RYRA 4I2PB 2NUHA 4BHQA 1VQ8S 5B0EA 4K2XA 3QO9A 3LP0B 4USIA 1NZAA 1G2EA 3AJ1A 1J5OA 2J6SA 3CCSS 1PILA 2V5HG 3QIDA 1OSCA 4DFPA 3CTRA 4O3NA 4K4WA 4DG1A 1C0TA 4YR3A 4YB7A 1HD0A 3Q2TC 1Y0HA 3EYZA 2UV8G 3M05A 5E7OB 5KFZA 2R7SA 5K5MA 2YKOA 2CG4A 5J2MA 3D0HE 3GB0A 1UJ5A 1H6KX 5J1EA 4IUFA 2HVIA 4TU9A 3JSMB 5KG1A 1GX5A 3KLHA 5L1JA 4PXDA 4HH0A 1YJNS 2IM1A 1TK8A 4KV8B 1DFDA 2QYCA 3LPYA 1DTTB 3MM8B 5KFYA 4WFBQ 3OJUA 4DUZF 3PW4A 2JLFA 4DQRA 1H7XA 4LT6A 5K14B 1GQEA 2IHR1 4QIVA 3MPYA 4UY8T 5MAOA 2CFXA 4ED7A 2DRBA 1MMLA 1ZOTA 2CYYA 3NAHA 4DLEA 3LAKA 3QWPA 4I2QB 2E29A 4E98A 4ECQA 3BDPA 4NCBA 3PKMA 1DZ5A 5T7LB 1XK8A 4RWWA 2GQCA 2VBWA 1Y5LB 5THWA 4DL6A 2UXDF 3C46A 5KFDA 1M0SA 2MQLA 3CO9A 2B9XA 2YWGA 3OXGA 3UI3A 1H3DA 3RR8A 5EX0A 1TKXA 1S0NA 3LQVA