2DH8A

Solution structure of the n-terminal rna binding domain in daz-associated protein 1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
105
structure length
105
Chain Sequence
b'GSSGSSGMNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHTLDGRNIDPKPCTPRGMQPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DAZ-associated protein 1
publication title Solution structure of the N-terminal RNA binding domain in DAZ-associated protein 1
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 12
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2dh8A01
1X4DA 5D78A 2XS7A 3CCES 3I56S 3OW2R 2KU7A 3BO4A 5JVGQ 3THTA 1VQOS 2RQCA 1YJWS 1U1PA 2F9DA 3R1HA 5CYJA 2E5HA 2ZJQQ 2MKKA 1UFWA 2RUGA 1X5PA 4ED5A 1WG1A 2LECA 2PEHA 2UP1A 2J0SD 3CCQS 4UQTA 2M8HA 4QPTA 1X5SA 2KG1A 3PIPQ 2L08A 2KM8B 3VF0B 3D2WA 3CCJS 3G71S 5JVHQ 4IO9Q 3TO8A 4P6QA 3CMAS 3UCZP 1YHQS 5ITHA 3J7ZT 1A9NB 2CQGA 3DLLQ 2DGUA 1QVGR 1X5TA 2N82B 2LYVA 1YIJS 1SJFA 1X0FA 1WG5A 1OWXA 2DITA 3SDEA 5CA5A 2LEBA 2LXIA 2MSSA 2J76E 2U1AA 3N9UC 4YB1P 1X4FA 2KYXA 2YKAA 1WF0A 3CCUS 2VODA 2MY7A 2CQBA 3UCUP 3IRWP 2CQ3A 3G8TA 1HL6A 1U6FA 3UE2A 1SJ4P 5GVQA 4PR6A 2MQOA 1VQLS 3P5TL 1KD1T 2K8GA 2KG0A 2YH0A 5GAGU 2WBRA 1Q82T 3MUTP 1VC0A 3CCSS 1SJQA 2MSTA 2V94A 2KXNB 5GAHU 2DK2A 4WFAQ 2MJNA 2MKJA 2E5IA 3LPYA 3BO2A 2MZQA 1R8HA 2CQIA 3THPA 2DH8A 2DIVA 4FXVA 2X1FA 1N8RT 1RKJA 2KM8C 3MI7X 2DGQA 3ULHA 3CTRA 2LCWA 2OJ3A 2FC9A 3V4MA 2YTCA 3CUNA 3P6YC 3U1MA 1VC6A 1DBDA 3VAIA 2G0CA 2OSRA 5DM7Q 2RVJA 3G8SA 1M5PC 2DIUA 1YITS 2NZ4A 4WFBQ 1NU4A 2DNQA 1FJ7A 2MYFA 5IM0A 1SXLA 2DGTA 2MQPA 2CJKA 2X1GA 2CPIA 2MXYA 2DGXA 4EGLA 2ERRA 2VOPA 1NO8A 4WCEQ 3SMZA 1M5OC 1AUDA 1A7GE 1WWHA 2I38A 2L41A 2MZTA 4CQ1A 2AD9A 4ERDA 2GO9A 2FHOB 2MKHA 3EGZA 1PGZA 2XB2D 4UY8T 1P1TA 2D9PA 5MLCV 1DHMA 2O3DA 2DB1A 2HGLA 2DNHA 3CD6S 2HGMA 2RS8A 5DDQC 1X4CA 3I55S 2EK6A 2Q79A 1M90T 4W90B 2MPUA 2DGOA 2NLWA 3VAJA 1U1LA 4C4WA 2DNGA 2L9WA 3NS6A 2YWKA 1M5VC 3VAFA 2FC8A 2DNKA 1Q81T 3Q2SC 3VAHA 2VOOA 1VBYA 3G9CA 1UW4A 2N3LA 1FJEB 3DXBA 2J0QD 2CPFA 2M4MA 3EX7B 2CPEA 1X4HA 1O0PA 1RK8A 2JVRA 4F25A 2LA4A 2DGSA 5LJ3Y 1VQ6S 4TU9A 1HD1A 2VONA 2M0GB 3VAGA 4WIIA 5LSLA 1N54B 1IQTA 2KXFA 3BO3A 1S72S 1YWXA 3CCLS 2M2BA 1K73T 2MGZB 4CH0S 1VC5A 1U1QA 1VQ7S 1FJCA 3B4DA 4CIOA 3CF5Q 4WKRA 1N52B 3MD1A 1YJNS 2N7CA 3UWTA 3CCMS 2X1AA 2F9JA 1YTYA 1G2EA 3HI9A 2DO0A 2AYEA 4YUDA 1WEZA 3R1LA 4QU6A 1VQMS 3CCRS 1QVFR 1D9AA 2DNPA 2SXLA 2RNEA 2MY8A 2DH9A 2M70A 1B7FA 2KH9A 2K3KA 2LA6A 2G1DA 3UCGA 1KC8T 2MKCA 2RU3A 2J8AA 3MURP 4RU2A 4C0OC 3VAKA 3UD3P 3TP2A 2XNRA 4TU8A 1FT8A 1HD0A 2D3OR 2DNMA 2DHAA 4QQBA 1WHVA 2LEAA 2KVIA 1NJIT 1SJRA 3VALA 1VQ4S 2ZJPQ 2JX2A 2LQ5A 2E5GA 2CPZA 3CMES 3JB9k 4QU7A 1UP1A 1BY9A 1FO1A 2DH7A 2OTLS 2CQCA 3K0JA 4F26A 1UAWA 3L3CA 4BS2A 1JMTA 1OPIA 1SJ3P 2CQHA 1WI6A 2KN4A 3H2VE 3G4SS 1U1KA 1WEXA 2DNRA 1URNA 1H2UX 1M1KT 3BS9A 3BEGB 2KT5A 2XNQA 2MJUA 2CQ1A 4WFNQ 2QFJA 2MZSA 2M8DB 4A8XA 4CH1A 4M5DB 1Q7YT 1KOHA 5LJ5Y 2HYIB 2MQMA 5EN1A 2XSFA 1X4BA 1JJ4A 2DGWA 3B4MA 3RW6A 2KRBA 3FEXB 3S8SA 1FNXH 3CXCR 4Y0FA 4U67Q 2PE8A 4LJMA 2RS2A 2EVZA 5DDPC 4V19X 2MZRA 2MQNA 1K8AT 1H2TZ 2MMYA 3H2UB 3Q2TC 1VQ9S 2OTJS 2CQ4A 4OZ0A 5LSOA 5D77A 1VBXA 3S6EA 2U2FA 1WHYA 3NMRA 1YI2S 1VQ8S 2RRAA 4TLQA 1ZZFA 5DM6Q 3ZZYA 2M52A 3NNAA 2N3OA 2CPDA 1YJ9S 1DZ5A 4W92B 2MZ1A 2MHNA 1KOOA 2CQPA 3EGNA 1Q86T 5HO4A 1DRZA 1ZH5A 2QA4S 2CPYA 3SDEB 2MKIA 5LXRA 4LIRA 1N88A 1WF1A 2AYMA 2DGVA 3MDFA 1WEYA 2XS2A 1K9MT 1VQPS 3MXHP 2KHCA 3R27A 2DHGA 4J5OA 2DNLA 3PIOQ 2M88A 5DDRC 1U6BA 5GADU 2QEXS 1F9FA 1WI8A 2KI2A 2MZJA 3ZZZA 2BZ2A 4FXWA 5BJRA 2DISA 3RW7A 2AYBA 4IOCQ 2EK1A 2AYGA 1PO6A 5H1SV 2M7SA 4LMZA 2JVOA 2KRRA 2ADCA 2YH1A 2DHXA 4IUFA 2CQDA 1FHTA 3MUVP 1H2VZ 1FXLA 1X4GA 3NS5A 2KXHA 3CC2S 3IWNC 4Z2XA 3MD3A 2FPHX 2BOPA 2DNOA 2MKSA 3CULA 5IQQA 2OSQA 1ZZNA 1H6KX 4F02A 2G4BA 1VQNS 2RRBA 2I2YA 1VQKS 1M5KC 3J7YU 2DNNA 4C7QA 2HVZA 1U1RA 1W2BR 5GAEU 3CC4S 1X4AA 2MGZA 3CCVS 3US5A 1WTBA 1QM9A 2KFYA 1WHWA 2HZCA 5IM0B 2MQQA 2DNZA 5HL7Q 1KQSR 5DETA 1U2FA 1X4EA 3MUMP 2XS5A 2CQ2A 5DDOC 1VQ5S 1OO0B 1L3KA 3LQVA 2CPXA 2LMIA 3G6ES 2B0GA 3FEYB 1U1MA 1WG4A 2E5JA 1JJ2R 2LKZA 2HGNA 1WF2A 2CQ0A 1S79A 2X1BA 2LXUA 2MQLA 1WHXA 1U1OA 3SXLA 1XN9A 4IOAQ 3P49B 5CXTA 3NNCA 2JRSA 2ZJRQ 2FY1A 2ADBA 2DO4A 2CPHA 4YOEA 3UD4P 1D8ZA 3MOJB 5FJ4A 5IFMA 4PKDB 1U1NA 1R8PA 2E44A 3VAMA 2M9KA 5LXYA 3U1LA 3CPWR 4WF9Q 2F3JA 2DNYA 2RQ4A 3S01A 2JWNA 1CVJA 2GHPA 3G96A 1WELA 2MB0B 2D9OA 4TU7A 3S7RA 2DHSA 1X5OA 3TYTA 1VBZA 3HHNB 3CC7S 4OZ1A 2RT3A 4ZKAA 3P3DA 4Y00A 4PRFA 2CPJA 1P27B 2OIHA 5GMKa 1JJHA 3NNHA 2A3JA 1OIAA 1HA1A
chains in the Genus database with same CATH superfamily
2EWHA 5BYQA 1XBWA 3BO4A 2A2DA 4NLOA 3MPWA 2XWYA 2UP1A 2V8GA 2XGQA 4IO9Q 3G71S 2ZH1A 3MEGA 2OP5A 2O01C 1H38A 2V69A 4C9DA 1OWXA 4EMDA 3Q0AA 4DBQA 2UUBJ 2E1AA 4X66J 1S59A 1UL3A 2VQFF 2J6TA 2VPXB 5GVQA 2UVRA 1Y9OA 2YH0A 3C6UB 1JLBB 4G6VB 2R7XA 2VPWB 3CO0P 1Q8IA 3BB5A 4F3MA 2A10A 2N4DA 1XNQJ 3OSPA 1HR0J 1S77D 3I5CA 2E5IA 1R8HA 1TFWA 5DZ7A 3C14A 3DLEB 5F8JA 4DHVA 2IMWP 1C4AA 1W25A 2DGQA 4OZLA 5SZTA 3DLBA 3TARA 2LCWA 3BKUA 3P6YC 1RWUA 1IBMJ 4XDDA 3HSGA 3ICLA 4WFBQ 3W9JA 3MCOA 1FJ7A 2MYFA 3I6PA 3W5XA 2MXYA 3T41A 3E2EA 5D3GA 3L4BC 2LXFA 2AX1A 2VC1A 3OXFA 4RPFA 2DCLA 5E3CA 1ZM9A 3X1LB 2RS8A 2FVQA 5L46A 2Q79A 1U1LA 1M5VC 2YWKA 4U7UD 3OXGA 3K89A 3HD1A 4ID5B 1X4HA 3BDPA 2VUGA 4ZJQA 4TKTA 4R5PA 2DT9A 3Q8RB 2IFXA 1RHRB 3FDSA 2J0XA 3BGUA 2PIIA 3KLHA 2BJ9A 3DOKB 1YJNS 3UWTA 4FPIA 4E8UA 3QGGA 2HRUA 2RNEA 2DH9A 3WBZA 4OYBA 2WBMA 3CDEA 2FHKA 4TU8A 5E7OB 4LT6A 3DGVA 2FVRA 2AEMA 5I3UB 3Q8VA 4USKA 4DV5F 1IWGA 2RJZA 5B0DA 3JB9k 4WFXA 1JMTA 2WOMA 1EETB 4AD6A 1KVJA 2DNRA 4DR1J 3BEGB 4DQRA 2JSXA 3V81B 1VIOA 3T1HF 3DOLB 2KO1A 5HROB 1X4BA 4M5HA 1FKOA 4PABA 2HLTA 2GVZB 1QSSA 5LMUJ 3WC2A 4E0DA 1ZBTA 1XWLA 2MMYA 2VBXA 3JSYA 2FZGB 2QMWA 5KFHA 2W25A 2OPRB 1EP4A 1AB8A 3Q8PB 3NNAA 1M5SA 4RL1A 3GIRA 1UJ4A 4ILLA 3GV8B 1DRZA 2LQJA 1RT7B 5K9FA 4F50A 1K0VA 4F36A 2M3DA 2HHQA 2AYMA 1R0AA 2K2PA 1P1LA 2ZE2A 2DR6A 3VGSA 4FPRA 4L3KA 2NCKL 2M88A 3D4JA 2XMAA 3LP1A 2BXJA 4MFBA 2OO4A 3OL9A 3I0SB 2AYBA 3GLJA 2VFUA 3ISNC 5AT1B 2ADCA 3O3LA 2W7OA 2VA2A 4B3OA 3DRRB 2Z58B 1VQNS 2FJVA 1IBKF 2LDIA 3W3SA 3M2VA 2VG5B 5DZ6A 3BQ2A 1RP5A 1RA6A 2WW8A 5ADZA 1X4EA 2GHVC 1VQ5S 5IS2A 1O6XA 1YJTA 2ILYA 2RIJA 1R7IA 2H9ZA 2FZKB 1XN9A 1R8BA 2LP4A 4KHMA 2ZJRQ 5D8HB 4NZ0A 1OQ3A 4OHZA 3OTOJ 1U24A 5LXYA 3CPWR 4WF9Q 2V2VA 2JWNA 1CVJA 1REVA 4O0NA 4NI2B 3OSNA 2PMHA 1ZOTA 2G0JA 1SC4B 1VK3A 1RZMA 3HF5A 3RR7A 1T3OA 3CJKB 3AJ1A 2OIHA 5E3PA 2B8QA 5HMYA 1FRIA 5CYQB 2XS7A 3M32A 4NCGA 1QUVA 3IBCB 3N5BA 1VQOS 4ED5A 4R0JA 1TAQA 1VLYA 1WG1A 2DR7A 1S97A 2QC3A 1BQMA 1GFWB 4OZNA 4LSLB 2Z0GA 2XLJA 2N82B 1BE4A 4OI1A 5E41A 2MSSA 4F4AA 2H65B 1MU2A 3TVYA 1TUVA 1X4FA 2POKA 5AXLA 4BC7A 2ABYA 2VG6A 2X51A 3PKYA 1REGX 1JLQB 1BQNA 3TUJC 1FXRA 3MUTP 4OZJA 6AT1B 4KE5A 3IBWA 3T1YF 4RNNA 2RHQB 3QFHA 3THPA 3UW1A 1A6LA 5DLFA 3ULHA 4UOGA 3EE3A 1F6TA 2YTCA 3IG1B 2HEKA 5A0YB 2G0CA 3KHRA 1PYOB 5L1LA 1YITS 4EK2A 3FCWA 1P9QC 3BR8A 2NZ4A 2QTWA 2MQPA 1Q53A 3ETMA 3SYZA 4PXCA 3LALA 4DSKA 2HVEA 2DPIA 3TUZC 2YKNA 3OFFA 2BW7A 4XIUA 1SVDA 5KG1A 4O4GB 2C1EB 4DV5J 3M2UB 3Q2SC 1VBYA 1UW4A 3LH2S 3M9NB 1VIXA 3D68A 2CPFA 1HLWA 2YVSA 3HHDA 4C3MA 5LJ3Y 2HQFA 3B82A 3CIMA 1I1GA 4AT1B 1N54B 2W4DA 3PFEA 3PNIA 1NSPA 4JV5F 1VJQA 3GSIA 3CJ2A 4RW7A 4CH0S 4X4SA 4K2XA 2DBBA 3EPIA 3NMAA 3JAMY 4QU6A 1S7IA 4CCHA 3RG6A 5CD4A 3NCRA 1SQFA 4DV2F 2UXDF 3LANA 2ZJPQ 1EKRA 4QU7A 3DYAA 4X4NA 2JC1A 4F26A 1V3RA 1D9DA 3AFGA 3CD5A 3TOQA 3PRBA 4MYTA 3K5MA 4KAIA 2CA9A 1NKBA 1RCOB 3NWRA 2MJUA 1PYTA 2JNJA 4O3PA 4CLKA 4X2BA 2QLJB 3GJRB 2VG7B 5DGAA 1Q7YT 2OKQA 1FNXH 2V8HA 4U67Q 3F73A 3W9HA 4IRCA 4MAKA 1S1XB 4H54A 1VQ9S 4FF4A 2ZOFA 2XO6A 2ZHBA 5KFXA 2IVMA 2U2FA 5K8NA 4ELVA 4G65A 4TLQA 2ZD1B 3GJQB 1HYSB 1TKXA 1PJ7A 1DZ5A 2NXCA 3VGTA 1ZAWA 5IV3A 1ZH5A 4PCQA 2HNZA 4NYZA 1CJVB 2YNHB 3QAEA 3N4WA 4ZMMA 3W2VB 3MECA 3VVUA 5E3AA 1U6BA 2DPJA 1WI8A 4PZVA 1TELA 1EJ7L 5K20B 4IOCQ 1H7XA 1I94F 4HACA 1PO6A 1QE1B 3DLHA 2DTJA 1HNXF 2IA0A 1MNEA 4DZDA 4G1QB 1DTQA 3SBMA 1J5OA 3KUEA 2B5JB 4YHHJ 1Z4UA 1KHVA 1S0OA 3MD3A 3NWGA 3P96A 3LW5C 4DFPA 2OSQA 1GX5A 2GAGC 4J9RA 3AXMA 3J7YU 3CE8A 4HI2A 1WHWA 4J9OA 1MMLA 1NJYA 3DN9A 2GW8A 3KHHA 3FJ2A 3I5BA 2QRRA 3IRXB 5M2PA 3HP6A 1YSJA 4Q0BB 4ECSA 2ZZTA 2XTJP 1U6ZA 5KFEA 4FKXA 1FDBA 2DO4A 4LFCF 3W1YC 5ETMA 4B9NA 4GVBA 2BE9B 3RAMA 2OPPB 2F8EX 5KFGA 3ET6B 2JDJA 4ZIVA 4B9TA 2YWHA 2IDLA 1NK8A 2R7TA 2COLA 2GX8A 3CJ0A 4ZVUB 2WK4A 4DMZA 4LFAJ 4DU8A 4K4VA 2MTLA 1KP6A 2J9EA 1YJWS 1X0PA 3GG1A 4FDFA 3DM2B 3MCNA 1RT5B 3GZ7A 3UCZP 3J80Y 2C2NA 2BQUA 5IWAJ 5GAHI 2BW2A 4L74A 2HFZA 1GAOA 4QJVA 1SQGA 5F9LA 3FCHA 3QNWB 4CWBA 4XPCA 4NLVA 3ZO7A 3FUYA 4FYYB 5K5MA 4C8YA 2WBRA 2MLXA 4M5KA 5IZHA 3ENWA 2UXCF 3W5YA 2OD6A 1C0TA 4OYXA 1NSAA 3CDWA 4URQU 2MZQA 4YS2A 2DJWA 4DR7F 3LA0A 3CTRA 4OHWA 4A8WA 4IRDA 1HHQA 1DBDA 2PFFB 3GSDA 2HNYB 2FJWA 3D1QA 2R8GA 1WD6A 2AEFA 4K4TA 2CJKA 1K44A 2VOPA 3K59A 4DQPA 3V5RA 2V4JA 4LFBF 1U48A 3M8PA 5K8OA 1TKZA 2E29A 2YKOA 3AOAA 3TZWA 2J9DE 5J1EA 2WCXA 4DPYA 4G1PA 5IT0A 2E5LF 2MLZA 3BR9A 2XYGB 1NBEB 4C8OA 1A0OB 4Y2MA 4LSNB 1RJJA 4KTQA 3PTWA 3A8JA 3R5DA 3ENVA 3G6VA 3W63A 3Q23A 2AJ4A 3BO3A 1YWXA 2XMMA 2ASLA 2AJ1A 5B0GA 4DI6A 2P9GA 4ECUA 4BC9A 1UKUA 1GQEA 4K4YA 4JYAJ 2HRYA 4PQUA 2QMUB 3BPDA 1XR5A 4DUTA 2Y1JA 3LP0B 2ZOMA 2IPOB 2QLXA 4DV3F 4LBHA 2CJ9A 3MEEA 1DARA 2W9BA 3MURP 3X3UA 3FRZA 2A18A 2LEAA 1SJRA 2DKOB 2QLBB 2Y1IA 2D3UA 2C3OA 2H5EA 3WX8A 3PY8A 2CQCA 4EZ6A 2HAIA 3SFUA 4QYRA 1KTQA 4Q2LA 3M4XA 1OPIA 4HT7A 3EGWB 3LGMA 4DL3A 3TZXA 4EBCA 1IR2A 3OHAA 3OFEA 2B51A 4ZPWR 1I94J 3GV5B 1MN9A 1HNXJ 1TMJA 4V19X 4DV7F 1RCXB 2DXFA 1V6HA 1TFYA 4WPAA 2B43A 4A8OA 3CDAA 2W2QP 2BUNA 1PCAA 3F0NA 4NLSA 4KHPF 4GO5X 1VRQC 1R31A 2JFKA 3VQSA 2WVDA 5HO4A 1FDNA 5D4NA 2KJWA 3GU0A 4LIRA 4ZPDA 5M2RA 3HSZA 4PAAA 1HNIB 1S4EA 4JI6F 2LDYA 3SQGB 5DDRC 2WVBA 1V5IB 1SH3A 4LFCJ 1RTDB 2DISA 3H8YA 2EK1A 2UUAF 2I5JB 2JVOA 1CULB 3GR0A 2Y8YA 1HWUA 4WTOB 2CJXB 2K1RA 1TL7B 4GRSA 2VDHA 4Z2XA 2YKMB 4FNIA 3W60A 3B54A 2FPHX 2MKSA 3GCWP 1H6KX 1SQEA 1OY6A 1X9WA 2XS5A 2JLFA 1TL3A 4U6PA 4ES1A 3AA9A 3FFIA 5G0RA 1HQ2A 2VPZB 2AF6A 3U1NA 4DEZA 2XLIA 1NDPA 4I0WA 2GQCA 4HHJA 4ZVRB 2ZVSA 1SKSA 4P71A 3PYGA 3W2WB 4DF8A 5KFQA 3W5ZA 2HNDA 2CVEA 1X9SA 5KG4A 3T6JA 5ETTA 1VBZA 1RXOB 2GIQA 4LF2A 3ILLA 4M5DA 1BGXT 1JXEA 2CXEA 2ZBCA 2XC9A 3F56A 1SBRA 4FVCA 1VI7A 4X4TA 1HHTP 1TQLA 4DXLA 2OPQB 1TL5A 3AH6A 1RWKB 4DR6J 2ALZA 2PEHA 1F3FA 1S9EB 1RT2A 3DMJB 4BWMA 3DI6A 2HQIA 2WVFA 4MJKA 5IC6B 1FA0A 4BCAA 2FGOA 5J2MB 4M5GA 1SL1A 2FTRA 3MM5B 3SDEA 2LXIA 2J76E 1HMVB 2KYXA 2YKAA 3Q8UA 1UJ6A 1RDRA 4WZQA 2EFGA 3KJVB 3GCXP 3KLGB 4NLQA 5A8RB 4NMLA 1N32J 3P5TL 1RT4A 1AA1B 4RZRA 1P8GA 1JNRB 1U0HA 4K7QA 2KB2A 2E5LJ 4WXOA 1SV5B 2ZWPA 1RKIA 2DK2A 5L39A 3P8BB 1RHMB 3LP2A 4K5SA 4NEYA 1HW9A 2OHDA 3HULA 1RACB 1S1UB 1RTJB 4DPUA 5DQGA 3VV2B 5C24B 1UWBB 3QPIA 3LOUA 3DOMA 5B0FA 4I1TA 3ZTPA 1TU0B 4WU2A 3UVJA 5J2QA 3NAIA 2BQRA 1H7WA 4IYQA 4DV3J 1KQKA 2XB2D 1X8DA 1T9YA 4RNHA 1T9WA 2HWIA 3IR7B 3HVAA 1KTVA 3J7AN 3CD6S 1O5JA 3RBXA 3J7A1 3WC0A 2NLWA 1FK9A 3KK1B 4IQMA 2V5HG 3DRSA 4UUWA 1JLAB 2OD4A 4J37A 3UI3A 1EHWA 4IH6A 1UPMB 1CS4A 3BH7B 4U96A 1F1BB 4DV7J 4CLLA 1TL1B 1S6UA 2ROGA 1WSRA 4FS1A 2BDPA 4M5LA 5KG7A 2DO0A 3D0HE 4NCAA 4DR2J 2JC0A 3NL0A 1B7FA 4KHPJ 1D1UA 4RU2A 4IG3A 3LF0A 2GO8A 1NJIT 4B02A 5HMZA 3QT8A 4R25A 3CJQA 5IT9Y 3OT9A 2RAQA 3MM7B 2HHHF 4ICLB 4JI6J 2ZH3A 4DPXA 3P4UB 1B70B 3VCDA 3SCJE 4KO0A 5H9EK 3ZTRA 1FESA 2XHCA 1NPRA 1VGYA 5EN1A 2UUAJ 2EPIA 2YXLA 3W61A 5FLXY 1PSDA 2HBQB 3I0RB 1YJUA 5C25B 1B99A 5ETSA 1MG7A 2NSBA 1TAUA 1FXDA 1E6YA 4ETZA 3PJXA 1RYRA 3QSIA 1W7WA 3MEGB 3FKBA 2DRBA 1LK7A 4OYOA 1TUGB 2PMZD 3AXKA 3HJVA 4OJ3A 1NJZA 1IKYA 1LW0A 4KPCA 2F4VJ 2HMIA 5DG9A 3NXZA 4USJC 5KT4A 4OI4A 2KHCA 1NJWA 3R27A 2YQ0A 4OYZA 1WDTA 4OYMA 1NK0A 5LMNF 3TJAA 2PO4A 3MR6A 2A6OA 3TAPA 3JSMA 1TK8A 2BZ2A 4QYZK 5H1SV 1XTZA 3ENQA 2CNKB 5HVHA 2OEJA 2DHXA 3PM9A 5AE3A 4F4WA 1RWWB 3C14B 4TYBA 3CIZA 5CD4H 4ZHRA 1LV5A 2G4BA 3H5UA 1RBOB 3EPGA 4DR5F 1KLNA 4HDGA 4NYOA 2NYIA 3HXMA 4KRWA 2C22A 5B0AA 3BM7A 4NASA 3FEYB 2R8HA 4ZLJA 3FEZA 4P72A 4FP9A 3HKWA 5IQ6A 3NCQA 1D0EA 4ZCMA 2IM3A 2RMLA 3M1VA 3MOJB 2FUG9 2BE2A 4HKQA 4NXMF 3U1LA 1KHWA 1FFGB 2CRLA 1WELA 2D9OA 1IVZA 3W66A 3KLEA 5KFZA 4LRFA 4IR1A 2H5JB 4R5PB 2HHSA 2CYYA 2ZEJA 1SC3B 3W7BA 4C11B 4PXEA 5AJ3F 2YNGA 4O44A 3PEJA 3KLHB 3KG4A 1RAGB 2GS8A 3CVKA 3DGPA 1FRMA 2M8HA 1RTZA 5GAEI 3PIPQ 5JVHQ 3TNVA 3J81U 1EIYB 1X0FA 4GKKF 1YDLA 1FEEA 2XI2A 3SSQA 1PKUA 5K8MA 1RAOA 3D67A 4LF1A 2Z2YB 1SCJB 1TP7A 4RBVA 5B08A 4RW6A 4DPWA 1VC0A 2E7WA 3SSRA 4D3GA 4DS4A 1FKOB 1YBTA 3PXGa 1O8BA 4HHHA 3CWJA 2H1YA 3WQPA 2CUYA 4MK7A 3IP0A 1YG0A 4B9MA 2P2CB 3H98A 2EXUA 4DX8H 4Y2KA 1NB2A 3AY0A 1EP4B 3K5PA 3C66A 2RUSA 2KVQE 3G8SA 3I32A 2O1PA 5C7PA 5CZVA 2DGXA 2AZ1A 3TVZA 3SMZA 5U47A 1R0AB 1A7GE 1OPZA 2AD9A 4RW8A 4IG0A 1HNZF 2CDRB 3C15B 2YX7A 2CNNB 1JX4A 4OHVA 2LU2A 3JTNA 3LP1B 4NEZA 4MFBB 3SEOA 5HN0A 2MPUA 1QAJA 3NLCA 3CJSA 2DGOA 2KZMA 3PHTA 2DNGA 2L9WA 3VAFA 1T9TA 4ECWA 2M4MA 4MK8A 2HHHJ 4FVMA 4B3OB 1RAJA 1ZM3A 1NK4A 2M0GB 2V4RA 1S6OA 1ELOA 4USHA 4DL7A 3MEKA 4ZVPB 1MLAA 4HH1A 4QR1A 5DQHA 3M2VB 1FWKA 1F0XA 1VC5A 3HMJG 1WDDA 4AE5A 4GKJJ 3JYTA 4HH0A 4CIOA 4USMA 1N52B 1AT1B 2VZ9A 2BA9A 3CCMS 3TX0A 3HI9A 5C2CA 4O4RA 4YEAA 2W1BA 4K59A 2F65A 3C6TA 2KH9A 2K3KA 3PW5A 3DC2A 1IM4A 5B0CA 1XC9A 2DHAA 1VISA 2B8PA 2Q43A 2ZKTA 5T14A 4LF4F 3D3BJ 4C8LA 4WZMA 3QGPA 4ATNA 2ROEA 3O1LA 4ZJLA 1HQUA 1LK5A 1REVB 5LMNJ 1UZDA 2DHHA 2CJYB 3W8GA 1RAFB 1RHQB 1RGVA 1K0TA 2Z56B 5IV4A 3QWUA 5J2PA 3Q24A 1HWKA 3ZZOA 3M32B 4NCGB 3O8WA 4MIAA 2R7RA 4ALZA 3EXCX 2CNLB 2IM2A 1CLFA 2R4FA 5D77A 4DOZA 5HBMA 3NMRA 4ZS6A 1DQAA 1F60B 1BQMB 4ZJOA 5ETVA 3C8YA 1T05B 2GCFA 4MK9A 4NXNJ 3WHIA 3IMQJ 4EEYA 1WEYA 4ZVFA 4DSJA 1EQMA 2XQCA 4PXDA 1T02A 4DL5A 3RRKA 7AT1B 1BQNB 2HBYB 3PO4A 1RTIA 3LAMA 4FXWA 2EBGA 2DRDA 1BMQB 4PG6A 2FB0A 3NGDA 3CT9A 5LM7E 2W4PA 3HM9A 4NXMJ 1F5CA 3Q86A 1MWYA 1KQGB 1FXLA 1QSLA 3H0PA 2HHTA 4NLRA 5AE1A 2BOPA 3CULA 2JEJA 1B0TA 3DHWC 1RI7A 3CC4S 2MGZA 4DV0F 1RQ0A 1QM9A 5HQMA 4ED0A 5HMWA 3SCKE 3O44A 1U2FA 4ELTA 5DDOC 3UR0A 2FLPA 3G6ES 1NK6A 3VQTA 3OPKA 2FJEB 4GVLA 2JZ5A 2PMWA 2CDQA 2XULA 2WHOA 1WG4A 5I4MA 3FZBA 2YKNB 3SXLA 2IVYA 2XSJA 3ELHA 4Q2MA 1FTCA 5IXUA 4LRDA 3CO9A 5CH7B 2AMCB 2NXNA 1FRLA 4PKDB 1KNZA 1R8PA 4ZCIA 4OFZA 3GB0A 3SCLE 2F1FA 1J5EF 3A3NB 2AWZA 3S7RA 2FLLA 2HS0A 2HS4A 2RT3A 2AV5A 3NP5A 3HKZD 4PRFA 2VFTA 1VDHA 1JKHB 1EQ0A 4KFBA 4EO6A 1S9GA 4RW7B 2FY8A 2E7XA 2PI4A 3MCSA 1Q0NA 4PG4A 1U4BA 2CAJA 5CYJA 1IKVA 2FVCA 1UFWA 1P6TA 2XMWA 2B4OA 3AOBA 4X64F 1SJ1A 1X5SA 1N34F 2KG1A 2VFVA 4P6QA 3CMAS 4NWBA 3R2DJ 4NLPA 5KT7A 4ETXA 2IRYA 5C2GA 4CNZA 1SJFA 5THWA 3MAAA 3DYAB 4LQ9A 2V6AA 1WF0A 3CCUS 1TVRA 3KLIA 3MM8A 3MR2A 5EGYA 5D0EA 2Y1RI 4NLDA 1GH8A 2KG0A 4WIQA 1UPPA 2MSTA 1JXVA 2BBEA 3IR6B 2I6WA 4C8KA 2HK3A 1ZTWA 2W7AA 4DPOA 4FXVA 4PEOA 1UMJA 2O67A 1M1HA 2H4YB 3RB6A 1GX6A 3Q8SB 3M6VA 1TKXB 1FFWB 5RUBA 3EMTA 4OLPA 1OSDA 1F2GA 5IM0A 2WSEC 5L1KA 2WONA 4ZPAA 3TEHB 2HNZB 3LAKA 4I56A 1R6VA 1NO8A 1AUDA 5CQGA 1VQYA 4CO0A 4C98A 3MECB 4I2PB 2HGLA 4DLEA 8ATCB 2RDIA 4M5MA 1N5YA 2A2CA 2FC8A 4HACB 2N3LA 3QRQA 3FNNA 1ULRA 3DXBA 1AUSL 1DTQB 3OV7A 1T8EA 1J5OB 3NGKA 1VS3A 2DGSA 3MR5A 2HWHA 4OI0A 1QY7A 3BZQA 5LSLA 2XBPA 4TQSA 4ZCKA 2PC6A 1HWLA 1LWXA 1R6YA 4ZA1A 2OPSA 2QJ3A 3MM6A 1NDKA 4YUDA 1VQMS 4EFAC 5M2UA 1SL0A 2J5AA 2BANA 2JHEA 5HQLA 1UTAA 3D0GE 4DR4J 2JX2A 2H3EB 1VCTA 5KFMA 4GVBB 3CDBA 3KG1A 1S1WA 3D6FB 1RT1A 1M5HA 3QGHA 1M1KT 4QW8A 4P9SA 3V4IB 4K4WA 1KVIA 2MZSA 1VFJA 2J7KA 2CZ4A 1DLOA 1QUPA 3ITHA 3AB2B 2MZRA 2K7JA 3VTIA 5A8KA 1RT3A 3MM9A 3ZFVA 4P73A 3PJ9A 1VQ8S 2VICA 4DF4A 3M9MB 5DG7A 3QRPA 2NUUG 2N3OA 3TAMA 2MZ1A 4P74A 2NPFA 2BMBA 4DV0J 3EGNA 1Q8KA 4RBUA 3RB4A 2PSZA 2CPYA 1NDLA 3KDOA 3MMAA 2DCUB 1C2PA 3PACA 3DNCA 2GFFA 3ADAC 3MXHP 4B3TF 5IC4B 2HFVA 5K14A 2OGUA 2V50A 4NLUA 2DVIA 4CM0A 3P45B 5EWEA 2LVWA 3S1TA 1C0TB 3BBCA 4MMOA 3BKTA 1L3VA 2Y0SD 4CLPA 1F2HA 4TLRA 4JI4F 2Z57B 2F8HA 2R7SA 1ZZNA 4QIFA 4ZPVR 3HT3A 4C7QA 1W2BR 5GAEU 4ED6A 1TK0A 2BV3A 2DNZA 4Z37A 3K5OA 1R0BG 1OO0B 4X64J 2V4JB 3TVKA 3C2PA 1JLBA 1Q1KA 4PG7A 4ZLNA 4ZLLA 3M8PB 1FD2A 1TKZB 4EBDA 4AFFA 5J1EB 1FVSA 3I5AA 2A6MA 1VJWA 2MB0B 4TU7A 4H4KC 1XMQF 2QZ8A 3FC9A 4RWXA 1RHJB 4HR2A 4OZ3A 3D5MA 4CYUA 4HI1A 3TI0A 3CJRA 4PQUB 3JQJA 1WJ9A 2VA3A 4LRBA 2J0SD 5L9NA 3PYFA 1R3NA 4QPTA 3OHBA 2GHWA 2LQBA 4ER8A 3VF0B 3MEEB 2W9BB 2B56A 2CQGA 3A1YG 1RADB 1SL2A 4DSIA 5ETNA 1WG5A 1VRTA 5L8RC 4ECTA 3N28A 3JTPA 2U1AA 1IJEB 4JI3F 4LF5F 1FNMA 1HL6A 4HL9A 2MQOA 3R6LB 4MH8A 2JEFA 1C1BA 3LTOA 2XCAA 5F9NA 3MPDA 4F2RA 2HFOA 4J7CA 1HBOB 2BR0A 1SI9A 3EZ5A 3CGIA 4DSLA 3I9ZA 2PFDA 3DDIA 1XR6A 2XMTA 1RKJA 4WWSA 3NEKA 2QN6B 3JAMU 3GFYA 3SSSA 5DM7Q 3CJ5A 1NU4A 3W62A 2RDJA 5KFWA 2B9EA 1YRTA 1DFDA 3RJMB 5B0BA 1EETA 3QT6A 5HANA 2L41A 3GJSB 5KOWA 2FHOB 1MWQA 2XY5A 5MLCV 3DRPA 4DV6F 4YB7A 2GVZA 3NG8A 4R8UB 3T3FA 4F4ZA 3VAHA 3GMGA 4ECZA 4UOCA 2H4WB 3OQ2A 1FRHA 2K1RB 1OYDA 1FJGF 2QFIA 3F44A 2VONA 3Q8QB 3KTQA 4FYDA 3Q8YA 3CCLS 2EKNA 4DUYF 1L5UA 2FJXA 4UOFA 4JI2J 1RBLA 4ZP6A 3FFIB 5G0RB 1Y0HA 3KUGA 1R43A 4ED4A 2P9CA 1KC8T 4EU0A 2HFUA 2PGCA 4G1IA 4L3NA 3TP2A 3EVOA 4BBYA 1IR1A 1CSJA 4FYXB 2FQQB 1NDCA 2DH7A 4OI6A 4KV8B 2HNDB 4ECYA 3L3CA 2CQHA 4B3TJ 2CZVC 1R8CA 2IJNA 1WEXA 1H2UX 1YRXA 1NKCA 3OFGA 1Y3KA 5DO2A 2ZDOA 2RKIA 4ZVEA 4OV1A 4M5DB 4IOBA 4DFMA 3BH6B 3KDNA 3R7SB 3VHQA 2G13A 3RW6A 2W9CA 4J9LA 2W8LA 2P8IA 1H2TZ 1G1XA 2E9RX 3G86A 3OTDA 5JJBA 1VBXA 2YY3A 4W98A 4DCOB 5KG3A 3D7SB 3IXQA 2VFRA 1RT2B 3DI6B 3ZZYA 3ILJA 2ZC3A 4QIGA 2XLKA 4C3LA 2IYIA 4DR3J 1W2IA 2HHXA 2QL7B 3Q83A 4J9MA 5B09A 3H90A 4ZPBA 3SDEB 4L75A 3DRYA 2UUCF 1N88A 2WW4A 1FCAA 3MDFA 3TA0A 4WP9A 5KFJA 4LR7A 4P52A 2ROPA 4N7TA 2KI2A 3J7YI 1RT4B 1U0HB 3TA2A 1X31C 2M7SA 2AJFE 2ZH4A 1LWEA 3DU6A 4LF6F 2KJVA 3LP2B 2FDNA 3AA8A 3CC2S 1FX2A 4B3SJ 1IBLF 4Y2IA 1XMQJ 4M63A 2RRBA 1F3VA 4CT9A 4J91A 5F8HA 3K57A 2ZBPA 3U7JA 1AROP 3HK2A 2IM1A 4YY3F 4NA2A 5JMNA 3ISND 4I6AA 3J80U 1WSVA 3DOMB 5J2QB 2C2KB 1U02A 1OSCA 1S0NA 2ZH8A 4LREA 2P6TA 2CJBA 1KFDA 1JJ2R 1Q5YA 1QD1A 2BVZA 2ZVIA 1ZTTA 3BBFA 2KYZA 2L3MA 3P49B 3LWMA 4O23A 3I9V9 3K2YA 5A6PA 4URGA 4OV6A 4EO8A 3W8PA 2FJBB 4JI3J 3S01A 1UJ5A 5KG2A 3DRSB 3CC7S 1V5VA 4OZ1A 2R42A 2HHWA 4HEA9 2G9OA 4MKBA 1TL4A 3PRVA 1CS4B 2RILA 3M05A 1AW0A 4LF7F 4LBPA 3THTA 1LEOA 3K17A 4JI1J 3MHYA 2NS1B 2C2DA 2KT2A 4OLOA 4L72B 1RHKB 2B6AA 2H5IB 1T7PA 1U2CA 4IG3B 1JLEA 1X5TA 2CJQA 2DITA 1U0SA 5CA5A 4UW2A 2Y3YA 1KN6A 2BJ1A 4X84A 3MEDA 5F0WA 4Y6IA 3M2RA 2HQ3A 1OS5A 2K06A 2CQ3A 1U6FA 3ZZTA 4A8SA 2UV8G 1U7LA 2W9AA 5KFFA 4KO0B 3FVYA 3D6TB 1HI0P 3UN2A 2ZHAA 4RLEA 2HZVA 1N33F 2ZNZA 1S0MA 2ZUAA 3IM8A 4CLZA 3I4HX 2DH8A 3IA0A 1FJGJ 3O2IA 4ZOSA 1E6YB 1GK8A 4I7FB 3ZNUA 4N5SA 3KK3A 1GNKA 4DUYJ 1B3TA 4JI7F 2DGTA 4KC5A 4FKYA 1IKYB 1LW0B 4EI2A 2HMIB 1B7YB 2O5DA 2GO9A 1U2RA 3BGRB 1ZETA 4USIA 2E9TA 1EX8A 2DNHA 3JSMB 4QYZJ 4W90B 2ZH2A 4FF1A 1RU2A 1KR4A 4DL6A 3MTJA 2B9WA 1SC1B 1GXLA 3EX7B 3ZZPA 1UEKA 2KHDA 2JVRA 4WFYA 4LUBA 2ALYB 5GAGI 3CEDA 4TU9A 1GTEA 1PAEX 3VAGA 2E9ZA 3N6NA 3G8QA 4ZHRB 2KXFA 5ETRA 2V2ZA 1JWWA 3M8YA 1MMNA 3LWLA 1FJCA 4P10A 1BXNA 5F8MA 3AD7C 3CF5Q 5HVGA 1T94A 2UVVA 4N8NA 3VGUA 4R0EA 4LF9J 1QLNA 3TR5A 3NS7B 2J0WA 2CG8A 2VBZA 1QVFR 1IUJA 4ITSA 2EC2A 4C0OC 4Z7YA 1D9FA 1FT8A 2NREA 2D3OR 3VALA 4G1QA 3UPFA 2L9DA 2BQ3A 2BE2B 2VIHA 1UP1A 1FO1A 2OTLS 5B7WA 3PJWA 3V6KA 1NPPA 4BS2A 3G4SS 4H4KA 3CCZA 3KLEB 1J2VA 5CAAA 3UFCX 2BACA 5KFSA 5HK4A 1B0VA 2V67A 3L09A 1S6PA 3NGRA 3M8RA 2VV5A 3M8QA 2W2OP 2G0IA 2KRBA 4LJMA 5CYMA 2BJ7A 4LF6J 2YNGB 1X60A 2HHPA 3H2UB 5LSOA 4QWBA 1IBLJ 3DGPB 3JXOA 1UVNA 2VQFJ 2V2KA 4W92B 3DKDA 1CJTA 4WKYA 2V0NA 3R97A 4YY3J 1ZM4A 3FMWA 4E2FB 3EXYA 4PWDA 4PQAA 4ZN3A 2YNIB 1SKRA 3V6DA 3T9ZA 1VQPS 4N8OA 4RX6A 2DHGA 2J9CA 4J5OA 1ZPVA 3PIOQ 1LNQA 2O66A 4WP8A 4X4RA 4F0MA 3H5YA 1BC6A 1U25A 4RW6B 2EFPA 1NSKL 4K2JA 3R8YA 4FBTA 4ZVTB 2OFHX 4DX5A 2KRRA 4I68A 3H25A 2YH1A 3M8WA 1KQFB 1FHTA 1PJ6A 3TZZA 1N5SA 2KXHA 4NL5A 1B64A 4K4SA 2D7SA 3HT0A 2NZCA 2HHVA 3R5JB 4HTJA 5EUHA 2RU9A 4Q43A 2H48B 2YNFA 3WZ0A 5IOLA 1Y4ZB 2MQQA 4GO7X 4M95A 2QX0A 3BYPA 4MT1A 4USVA 4RW8B 3RBZA 1NK7A 3H42A 2FLNA 3SFGA 2CQ0A 1WHXA 4U7CA 4ECRA 4IOAQ 1S7HA 3D6HB 3RR8A 1TKTA 3UDEA 1YJVA 1D8ZA 1U1NA 1GMUA 4AL6A 4KHRA 2RF2A 3QWPA 2RQ4A 3EJMA 2VB6A 1CC7A 4PXBA 3ZTSA 4WFZA 1YK9A 2I1RA 5JUMA 5HAOA 2A3JA 1XEZA 3AJ2A 4KGZB 2D69A 3JYTB 5IT4A 5A2QY 3NCPA 2B9YA 1PAUB 4WP3A 1DURA 4AL5A 5CCLA 4JV1A 4ILMA 4DV1F 1JB0C 1YHQS 3C6TB 4M5IA 1ZYQA 3T1HJ 1JLCA 4IRKA 2E1CA 2FYXA 4YB1P 4K0KF 2FJAB 4KYZA 5BYRA 4N41A 1HQUB 3M7VA 4PR6A 4KGVB 3MPVA 1G6BA 4ZP7A 4UY85 5AXKA 2Q1LA 2VASA 3AT1B 1NLKL 3EVWA 5J2PB 1C4CA 2V94A 1AZSA 1S4FA 1NUEA 3BV8A 4ZPCA 5K8PA 5KTQA 4I67A 1YVFA 2X1FA 4C8NA 1FFSB 4B9VA 4L73A 5HBMB 2HQDA 5AXNA 3KK2A 4RJVA 3H7HB 3C16A 2EW9A 4MTPA 1VYAA 3H20A 1EB0A 3GG0A 5KFTA 3QT7A 2GMJA 2ZITA 1UW9A 1M5OC 4OX6A 1WWHA 2MZTA 4CQ1A 1H3DA 2MKHA 4ANEA 4JI8F 4CT8A 2D9PA 3QSYB 3N01A 3I55S 1RTIB 1X7VA 1IBKJ 3VAJA 4N56A 4F4YA 8AT1B 4K8RA 1NXIA 3FBBA 3KMSA 3C3LA 2EFVA 1LFWA 3K8VA 2XCPA 4ELUA 5FLXU 3I82A 2FGCA 2ZBIA 4P75A 1YX2A 3GR1A 4JI5F 3KLFA 2HK2A 2J8SA 2M2BA 1IM6A 3TJ9A 2QO3A 2MGZB 2XWXA 2B9XA 4CLYA 5MAOA 5CZXA 1GT8A 4IO1A 5CCMA 2QA4G 5D4OA 2AJQA 5D6GA 4A8QA 3CB4A 3QFWA 3KNAA 2MY8A 2M70A 1JLGA 1K1QA 2J8AA 1AFJA 4UTGA 4NPOA 2XSJB 4IFVB 3VZIA 2E5GA 5BYSA 2XY7A 4FBUA 3R7NB 4QW9A 1SJ3P 3HHKA 3ZTOA 1UVLA 3IBFB 5BR8F 4N77A 4LF8F 4H4OB 5D0GA 4WFNQ 2AZ3A 3HZGA 4CH1A 3JTOA 5LJ5Y 2PI5A 3H40A 2R7UA 6FDRA 2DGWA 1S9GB 3BGOP 2RS2A 3R5AA 3R5CA 2UUBF 4CO5A 3NBPA 3QLHA 1VRUA 3RTVA 3VWSA 2QGFB 4M1KA 1E6VA 3D1HA 5F41A 2MEWA 1S12A 3SCIE 2RRAA 1ZZFA 4QBUA 2ZH7A 1NEEA 1BUXA 3CJ8A 2NXUA 4P2MA 1XNQF 4U9RA 1HR0F 3MAAB 5I42A 3FQLA 3BSCA 3T1YJ 3D6MB 2E1MC 3BGLA 4RNOA 2F8MA 1TVRB 3KLIB 4EBEA 1K47A 4K4XA 3MM8B 1CJUA 2CWXA 2F4FA 4GMKA 1IBMF 3WIUA 4ANCA 4OHXA 2RQMA 2XMJA 1ZS6A 4CO1A 2NSCA 3OUYA 1U8SA 4RUHA 2GJFA 3MMCA 2QL5B 2IBOA 2NQPA 1HBUA 3NS5A 5EWFA 4OX9F 4ZVOB 3AQPA 3C19A 1N48A 3D1OA 5LOQA 1LFPA 5FD1A 3NAHA 3CCVS 2R2TA 4N76A 3KFWX 1Q78A 5IM0B 2WONB 3ETOA 3MUMP 4A8MP 2P9EA 1TK5A 2Q3PA 2AKWB 4DU7A 1OY9A 1U1MA 1Y11A 3OL8A 2W01A 5EWGA 3IN5A 2IY5B 3RYLA 1HQEA 4Y28C 1SIWB 1SV5A 1NB7A 3NNCA 2JRSA 3A8KA 2IA6A 4JV5J 3EVMA 3QIPA 1N5YB 2HG4A 4OZ5A 2VDIA 1FDAA 2HLUA 5GADI 2D74B 2KFZA 2Q66A 4IH5A 1FF2A 3A8IA 3TZYA 1WNEA 4CLTA 4DV2J 3DCAA 2UXDJ 1KLMB 1OIAA 1PILA 1HA1A 1RISA 5I3QA 2MKYA 2OPSB 1RB0A 4Z7CA 4J90A 2RQCA 1H74A 3Q22A 3MM6B 4X65F 3QZ7A 3ZZUA 2R8JA 5D15A 1R89A 2L08A 2R2UA 1HBNA 2BANB 2J9DA 4ZPTR 1YIJS 1VBKA 2B4VA 2K7KA 3N9UC 1LKZA 1HNWF 3GONA 1HBMB 1RWMB 1S1WB 1B0PA 4F04B 1ZA1B 1KD1T 5GAGU 4U7UK 4ZP9A 2CADA 1DLOB 3CCWA 5KFUA 4P7TA 2DR8A 4C2MA 2CWKA 3BO2A 3CW2C 5A8KB 3PW7A 1T9XA 1RT3B 4AXIA 3QT5A 3PR4A 3FRYA 2RB7A 5C5JA 4C8MA 2VF3A 4LIWA 4W4MA 4JI5J 3TAMB 5D0RA 4NMXA 2NXEA 1D8YA 3TJ8A 5KFCA 4EGLA 1ICEB 3RBDA 3GE9A 3MMAB 4RW4A 4WCEQ 3A3PB 3FBEA 2QG9B 1S6QB 3AQOA 4KB7A 1P1TA 1DHMA 5JXSA 2DB1A 4F0HA 3E01A 4Y2CA 2QIFA 2G1HA 3SV4A 4OL8A 4P2FA 2GJ2A 4QR2A 4C4WA 3QO9B 3I0RA 1NHKL 1SPBP 5C25A 4BLGA 3NGSA 1RWOB 3D9BA 1CPZA 1IN0A 2GC8A 4QR0A 1TKDA 1JLFA 5G4DA 3ZC4A 2YBVA 1J27A 1UWAA 4NLYA 5BR8J 3HD2A 1ACMB 4LF8J 2CKWA 2KDOA 3A13A 3RU0A 1MMDA 2B7CB 3OTOF 1WKLA 1VQ7S 1S57A 1S76D 4C0HA 1WC6A 3TWZA 2AYEA 1WEZA 1BHNA 2DNPA 2JOQA 3H4DA 3GWCA 1S48A 4ZVGA 2IYGA 3KMQA 1HD0A 4ILRA 1WHVA 2LQ5A 3ILIA 4PUOA 4LQ3A 3OTBA 1LWCA 4JUZA 3O6QA 1URNA 1FE0A 1IJFB 1N36F 1HPZA 4RUCA 2HYIB 3PCOB 4ED3A 3FEXB 3HX9A 2ZBQA 3TA1A 4P2XA 4CYUB 4M94A 4H4MA 1ITPA 4RU9A 3T5KA 4OX9J 2LU1A 4NE9C 2NXJA 4WU3A 3ILOA 4FYVB 4RUAA 4DCPB 2KZZA 2WB4A 3HHEA 5T7LA 2QA2A 2BRKA 3HHLC 4YDXA 2QMXA 4RBTA 2QA4S 1VRTB 4B9SA 5E3QA 2L9NA 2UXCJ 4NYPA 1OQ6A 1WF1A 2WVCA 1RABB 2WAQD 1H73A 2PEBA 3DLJA 3OVBA 1K9MT 5L1IA 2QA1A 5BXIA 1KONA 3NOCA 3HVWA 5T41A 5KFIA 3CDUA 3F41A 4CNYA 4DR7J 3A4TA 2FHJA 1H0HB 1C1BB 4C11A 4WXWA 1VQSA 4WYLA 5F8IA 3AOCA 4QIWD 3THVA 3ZZRA 2CQDA 4IUFA 4U95A 3AB4B 2ZUGA 3JQKA 1SUQB 4LFBJ 3UDVA 4F02A 3PEHA 5J1NA 3ISZA 1X4AA 1HIYA 2J7WA 1TR0A 2HZCA 3IM9A 1UCNA 5FDLA 3N0VA 4KBIA 1DTTA 4AQYF 2CQ2A 4X65J 2OEMA 2LMIA 4RW9A 1JQGA 2E5JA 3DRPB 2LXUA 4PYDA 4CP5A 2APOA 3J7Z5 1LWFA 2ADBA 4JB8B 2IAJA 4Q44A 1M0SA 4YOEA 4F7VA 1HNWJ 3BBBA 3T5HA 1S1TA 3VAMA 4OX7A 2CVIA 2DNYA 4F67A 2GHPA 3G96A 2ZH5A 4J9SA 3TYTA 4DPTA 2BJEA 4ECXA 1BLUA 1NH7A 3JQMA 4KGKA 2YKQA 3BSOA 1X4DA 3CCES 4OI3A 4KPYA 4O3RA 1S5ZA 2KTQA 4MKYA 3C15A 2MKKA 1I51B 3IC1A 2LECA 3NGTA 3OR1A 5EDWA 2BKOA 3VR1A 3ZZ0A 2VFSA 3SIPB 1UVJA 1D3WA 4B9UA 3MMJA 4DFKA 3OL7A 3E51A 5KFNA 2MY7A 4NLTA 4UF4A 1SJ4P 3FBFA 3R6GB 1VQLS 1T0TV 2RKIB 3E3XA 1NZAA 3FSYA 1IKXA 4NZ6A 3ONQA 3OLBA 2W9CB 2KXNB 4A4JA 4OX8A 5DJBA 2MJNA 2MKJA 3UQSA 2CQIA 1T03A 4DX7A 3KJFB 2DY1A 1JXLA 2UV8A 3R2CJ 4FN5A 1ZPWX 3CUNA 3IS9A 5F3TA 1C0UA 3PR5B 4OYIA 3VAIA 1ZAXA 3T5JA 4F2SA 2CPIA 3HJFA 2ERRA 4YHHF 1NHVA 4EZ9A 4YFUA 2W7PA 2Y1LB 4CLFA 4Y2AA 4LBIA 4ZITA 5HVFA 4I2QA 3MCMA 3MR3A 4IKAA 3HDSA 2BE7D 2K3IA 3KYLA 2DNKA 4HYKA 2GAHC 1LWEB 2J0QD 2F5GA 3OBIA 1WC1A 4TNOA 5L1JA 4IFYA 3MAHA 4OJ1A 4KKOA 2JFDA 2LA4A 4QIVA 4M5NA 3T9NA 4CLSA 3H2LA 1N36J 2GVDA 1S72S 3DDNA 1T05A 2UVUA 2HVIA 3EZUA 3BQ0A 1URRA 3B4DA 4XK8C 4EWTA 2X1AA 1G2EA 2YPZA 3D0IE 5KFDA 3CCRS 2OAUA 3ENAA 3OJUA 2C2EA 3BN7A 2V9WA 3BYRA 4TY8A 3OR2A 3VAKA 3UD3P 2XNRA 4LFAF 4HHUA 3MMBA 1VQ4S 2YWWA 4DWIA 2ACYA 1CQMA 1SB6A 3K0JA 4Y3CA 4HT5A 2HFNA 2GZOA 5D3GB 5HATA 2ZH6A 5IWAF 4TVAB 3QIDA 3B4MA 3GTYX 4A8FA 3CXCR 9RUBA 5L38A 3HVTA 1UETA 4CDIA 2AJ2A 5B0EA 4TN2A 3G6YA 2R2RA 3GYGA 2CQ4A 4OZ0A 2FLOA 4IDKA 3GIMA 1XK8A 1HWJA 1YI2S 2J6UA 4KJIA 1B4SA 4JV2A 1RAHB 2LLZA 1BWEA 2B6AB 2XG8A 2CQPA 1JLEB 4WJBA 4AQYJ 3HCXA 1VR6A 2B7BB 7FDRA 3MEDB 3M2RB 2ZDPA 5KG6A 3HFVA 1QDUB 1JKHA 2ZOGA 4HTIA 4UZBA 1DAXA 5GADU 4J9PA 2MZJA 4KQZA 3ZZZA 2DRAA 2R3VA 1CBKA 4WK3A 1MWZA 8RUCA 3U27A 3GILA 3IWNC 2LQ8A 3TQ1A 2WOMB 2XO7A 2AGPA 3GP9A 1VQKS 3HSDA 1S10A 1NNDA 3GFZA 2DNNA 3EICA 3KK3B 3QRRA 1Q79A 3T19A 5HL7Q 1NMEB 1IKWA 5ETOA 2F63A 3QGIA 4CTAA 4BHQA 3ZNJ1 2MLYA 2EC0A 3BN4A 5EHHA 1XMOF 2XMKA 2RQKA 1XJWB 1NH8A 4JYAF 2LEPA 1U45A 1QSYA 2E44A 4ZN1A 1RWPB 3V2UC 3H59A 2RE1A 4ED1A 2FHMA 3UNYA 4CO3A 3SQOP 5D4PA 2ZZNA 2OFGX 3B8HA 4ZKAA 3TUIC 2E1PA 2ZE2B 3GYXB 2Q6BA 4X4UA 4DSEA 3DFEA 3UR3C 2OI2A 5A8WA 5HLFA 1NJXA 2V9KA 2I0XA 3CCTA 2R2SA 1WACA 3UDCA 3I56S 1I6JA 2OH2A 4RUBA 2ZJQQ 4DG1A 4I2PA 3PDNA 4OYAA 2QYCA 5J1PA 3HO1A 2KM8B 4DSFA 1T3NA 3TO8A 2MDAA 4IR9A 3NOGA 2LYVA 2B3TB 2XMVA 1FRKA 4I4BA 3IR5B 2XYPB 3CNQP 2C2ZB 1VMBA 4QIEA 3UCUP 1DQ9A 3DXSX 1EZZB 1N0VC 3TQEA 4JOUA 1WKKA 1S0VA 1S6PB 2IJFA 4DV4F 2MQ8A 3M8QB 2OELA 1K1SA 1V3ZA 3AD8C 5CYMB 2ZM6F 1RSCA 1VHIA 2WB1D 2ASYA 2HPUA 3MI7X 1HHSA 3KJQB 1WC4A 2OJ3A 3D28A 1Y5NB 1NPKA 2OUGA 2C2MB 5KFPA 2VBWA 2ZKUA 4QWAA 3HHLA 1M5PC 1CJTB 4ED2A 1SXLA 1TUWA 4PWDB 2ATCB 1RT6A 1IR0A 2I38A 4ERDA 3V4IA 3V6DB 2DXEA 1DJ0A 4DL0C 1PGZA 2OLWA 4UY8T 2Z30B 3RB3A 2HGMA 1PG5B 2C2RA 4XO0A 1N6QA 4YR0A 4X4OA 2R8IA 4DR5J 1JJCB 3GIIA 2C2OB 2BKNA 1O0PA 4F25A 3H5XA 1MU2B 1RWVB 2OMLA 2QLWA 1VQ6S 1HD1A 2VG6B 4WIIA 2VBYA 4ES2A 1IQTA 4B3MF 2ZBRA 1GTHA 2YNFB 2GGPA 1U1QA 1FNOA 4URSA 1O51A 4WKRA 2N7CA 3EWGA 2ZH9A 2ZC4A 4D3HA 1N0UA 1WOOA 1NKEA 2E7VA 1PC4A 2MKCA 2AT1B 4JP8A 2DNMA 4QQBA 1FD8A 1TKTB 4WE1A 3M30A 2E1RA 4Q45A 3LGNA 1ZA2B 4A46A 1UA1A 5AJ3J 1FE4A 4DR6F 2RF2B 4Y65A 2GIRA 3H2VE 1U1KA 3GIKA 4B9LA 2XZDB 2N4CA 5J2NA 2QFJA 1GMVA 3EM1A 4E98A 1WUUA 4PYAA 4Y0FA 4KY3A 3LO3A 4YMEA 4GKKJ 1MROA 1RHUB 2OTJS 3FK4A 2CFXA 4OHYA 1N32F 1WC3A 1SH0A 3FSXA 2Y0BB 3B6BA 2VPYB 4CO4A 3POTA 1VHFA 5HP1A 1T9UA 1JLCB 1C1CA 2Y8WA 3IWLA 5A76A 2IVFB 4ZVQB 5LL6d 5D0HA 1XMOJ 3HLUA 4UOHA 1AZSB 3D3CJ 1Q7LB 2C3YA 4CLUA 3MUVP 1KEKA 3T5LA 4OZ2A 2J6SA 1N5QA 1H98A 5C42A 5E2QA 4I64A 1HKAA 2YKPA 1HNZJ 3KK2B 3C16B 2ASJA 2HVZA 4AL7A 4FXDA 4WK1A 4EUVA 3CJTA 3K8WA 3PRDA 5DETA 4V19J 4NLWA 1CJKA 4AXJA 3K58A 2CPXA 1RLDA 3T1AA 1KDNA 3IFEA 1TV6A 2JJ4D 1WC5A 2X1BA 2R7WA 1HBOA 3QATA 4YP3A 2FY1A 2EEYA 3DLGA 2C28A 5IFMA 1WORA 2OEKA 4OQJA 2M9KA 5LSRA 2YWFA 1HFEL 2XEXA 3RZAA 4DR2F 2RH3A 2QSFA 4EYIB 4Y00A 4MYUA 1HWIA 4CO2A 2CPJA 3HSJA 3KLFB 1NK5A 2AU0A 4DV4J 1JNZB 3UNGC 3JSBA 1LW2A 3W64A 1YZ6A 5HMXA 1NM2A 4XTTA 2ZM6J 4P2SA 1OY8A 3R1HA 1FWPA 5F8GA 2Q6CA 2R7QA 4A8YA 2E5HA 4LF4J 1CC8A 1HNVA 2RUGA 4O3NA 2VL1A 2ZWOA 4ZP8A 2PN6A 3M6XA 2R7VA 4R8UA 3UN3A 1JLGB 4RWWA 2HBZB 3DLLQ 4IQXA 3BSAA 1FRXA 2HQGA 4PG5A 3M9OB 1Z2ZA 5KFAA 1SIZA 3DU5A 2HS3A 5KT3A 4CI0B 3C46A 4QPXA 4A48A 2P5VA 1IXKA 4F8RA 2IRUA 1DY3A 2A1BA 4O3QA 3R3TA 4N47A 3R5BA 4F3OA 2F4VF 2EG2A 5H9FK 4KSEB 3NBPB 4WFAQ 1GMWD 4MIBA 3QLHB 5F8LA 2R8KA 1VRUB 2DIVA 1E6VB 3MR7A 2IJRA 4YDDB 4J9UE 3UO0A 3LGHA 3B78A 3OLAA 4B3MJ 5EX3A 3VZHA 2IC3A 4KV8A 2D3O1 1PC5A 2Z2LA 3OVAA 3CJ4A 2X1GA 5I42B 3BREA 5KFOA 3QZ8A 2JEGA 3RB0A 3PO5A 1RTHA 1N5VA 1CJUB 2O3DA 2F7VA 5ETPA 3R9LA 2QSWA 1FVQA 3IGNA 2EK6A 2V2QA 4DUZF 3NS6A 1S1VA 3OUYB 2VOOA 3G9CA 2PA8D 3MMCB 4QWCA 1Y00A 7FD1A 1HBUB 1RK8A 3MFHA 2KFNA 3GJTB 4KH1B 2X3DA 4CM2A 3DLKA 3G82A 3NRBA 2BM1A 3WIVA 1FKPA 1Q4RA 1MN7A 1TZ0A 4EYHB 3GFXA 3DRXA 3MD1A 1Y10A 3HPOA 5E3RA 1YTYA 1J5EJ 3K5LA 3R1LA 5LT5A 2NPIA 3H4BA 1HQEB 2LA6A 3UCGA 4DN9A 1WC0A 1N4LA 1UA0A 3QIPB 4I6WA 3CMES 3I87A 3DHXA 4UUXA 4L6V3 2YPYA 4XAKA 1WI6A 3GV7B 1HI1A 1YJRA 1SH2A 2EI5A 1JIHA 1N34J 2CQ1A 4KH0B 3C6UA 1XIQA 2G2YA 2MQNA 1TMMA 1KFSA 4LRAA 1QTNB 1W26A 1SKWA 2EFQA 3OTEA 3MF5A 2V63A 3DLEA 3FQKA 3SZ2A 2BRLA 1VLOA 1V3SA 1FRJA 1Y3JA 1HARA 4KR0B 1HBNB 2CPDA 1YJ9S 3QJJA 2MHNA 4J9QA 1LQ9A 1Z1ZA 3QJLA 3AAWB 1Q86T 4A8KA 2VJUA 2UUTA 2XYHB 4DN0A 3BF4A 1UEUA 3HFKA 4FF3A 4C6AA 3FSIA 3GQCA 4Q5VA 2V8PA 2KL8A 4Y34A 5GMDA 2R9LA 1PIEA 1F9FA 4LR8A 4FYWB 2CJAA 4F4KA 5FIIA 1RWNB 2JEIA 2LFVA 4ID5A 1UVKA 5A2QU 1FTRA 4DQQA 2HQCA 5HJYA 2GNKA 1AFIA 4RR5A 4S0MA 4ID8A 2CIMA 1WTBA 2KFYA 3NGUA 2JL9A 3OTCA 3BDEA 2Z4PA 3DOKA 2YX4A 4RW4B 2ATLA 2B0GA 4UQGA 2XM3A 1YBUA 4LRCA 4MKAA 4OYPA 2LKZA 4X4QA 3E01B 4UT4A 1U1OA 2WSFC 3AHPA 3GFHA 3OXLA 2CPHA 4GKJF 3RRGA 5I3UA 1APSA 3G87A 4J9KA 3UD4P 5KAKA 5FJ4A 4DQIA 5KFRA 2R7OA 4ANDA 1JLFB 2RRNA 1YRUA 2UVWA 4I7FA 3KHLA 3HHNB 2PDAA 1KWMA 2GMLA 3MOZA 1V9OA 3P3DA 3V81A 3T6BA 3DOLA 1MSWD 3R7BB 5HROA 2RSQA 3OL6A 2GV1A 3AODA 1U1PA 2F9DA 3BGRA 1G7CB 2IMOA 3OFHA 3JS9A 2OPRA 3PVXA 2AW0A 1RAAB 4YN3B 3J7ZT 3UD5A 2FVPA 2IBKA 2DGUA 3BKFA 2JLGA 1CQNA 3EDQB 3QBCA 1S49A 1RT7A 2LEBA 4PUOB 3TUPA 2QLFB 1LWCB 1YJ7A 3RGIA 1TL3B 2YQ1A 5CABA 3JSRA 2K8GA 3GPAA 4V1Ak 4LR9A 1U09A 1Q82T 4DUZJ 2XMUA 1HPZB 1Q8BA 4CH7A 3I0SA 1HI8A 2WSCC 4NZ7A 3DDKA 5GAHU 4NXNF 4H4MB 1RAIB 3HZEA 3RBEA 3PX6A 3DRRA 2CG4A 1N56A 3N6LA 2XI3A 2FC9A 3EYZA 1VC6A 5L9XA 5T7LB 4J9VA 5KFLA 1WOPA 2VG5A 2DNQA 3CJ3A 1U49A 2KT3A 2EG1A 1OYEA 2AQ4A 5E33A 4JI4J 4ZVSB 4X4PA 5DDQC 1X4CA 4FF2A 2HURA 3UN5A 3IO1A 4RKUC 4YQWA 1FJEB 3CSKA 3OVSA 4ZLPA 2BX6A 3IGVA 2YX1A 4WBFA 2G2OA 4USUA 4NI2A 2VKRA 4B17A 4C48A 3CJKA 1FWLA 3BPSP 2AHOB 3EUNA 1K73T 5CYQA 5DGBA 1XR7A 2YNIA 4YR3A 4PWUA 5FDLB 4DZ6A 1DTTB 2VKZG 1G4CA 2HKEA 1Y5IB 2C3PA 4DDFA 5ETQA 2F9JA 4BDPA 4OMFG 4CLWA 4RW9B 2SXLA 3KLVA 3QJPA 3PG9A 2HZAA 4ECQA 2GJIA 4LSLA 3KJNB 2XHWA 2HIQA 2VD3A 3N5FA 1LWFB 1QAIA 2IAJB 3EGVA 3M6WA 4RNMA 1Y7PA 4FNHA 1S1TB 4YB6A 2IHR1 1UAWA 4LSZB 4DL4A 3UVJB 2LQ9A 1JLQA 1H72C 4K5RA 2M8DB 4A8XA 1GXTA 2XSFA 2AEJA 1KRPA 2EVZA 3BGFA 1NSQA 3CMQA 1FK9B 2C42A 1RU1A 2VC0A 3OR1B 4LF5J 5KT2A 5DM6Q 3IG1A 5A0YA 1I5OB 3P5BP 4MIWA 2V4QA 1FX4A 2QT7A 4AUKA 1HW8A 2XS2A 1VK8A 4WTYA 2F40A 4ZK7M 4CZCA 3Q89A 1R27B 2DD8S 2IRXA 1M1GA 3KOAA 1IKXB 5KFKA 4O4GA 5GMEA 1X9MA 3M2UA 2AYGA 1L3UA 4IH7A 1FEHA 4NRUA 5EX0A 1N5TA 2HW3A 1T03B 4DS5A 1H2VZ 1X4GA 1UFLA 1KKHA 2DNOA 5IQQA 3IS9B 1C0UB 3A12A 3PHEA 3TEGA 4DV6J 5H9EJ 2GIFA 1L3KA 3LQVA 2V8VA 1Z2LA 4KGXB 2W2MP 2NR0A 5E5NA 1NK9A 2V68A 1PJ5A 3QAUA 4I2QB 3HVRA 1PYSB 4C3KA 2UUWA 4IFYB 4KKOB 1X5OA 3N6MA 4QCLA 4F3QA 2IDEA 2GVDB 4X4VA 2G2ZA 1P27B 2VG7A 4DR4F 3V6JA 3TW0A 3WX4A 2UZAA 4JI0F 2VU5A 5HQ8A 3OW2R 5JVGQ 2ACMA 1S1XA 3K7RA 2MHEA 5ETLA 5AXMA 3CCQS 2EKYA 4TXSA 1XMBA 2ZD1A 3D2WA 1S9FA 2X3GA 1I3OB 4RNFA 1HYSA 3I96A 4TY8B 3OR2B 2D1CA 2JH3A 3OD2A 2I9SA 4YB5A 1IWAA 3MMBB 4QWDA 4DQSA 4PPZA 1CJVA 2YNHA 3O5TB 2VODA 1F9EB 4FS2A 2YWGA 3AJDA 3W2VA 3IRWP 1ZAVA 3PFOA 4M5JA 1YBAA 2AGQA 2J7UA 3CCSS 1SJQA 4NA1A 1QE1A 3HVTB 3M1VB 3NY0A 2HSEB 2B5JA 2UUCJ 4IDKB 1N8RT 1F5AA 1PBAA 4I69A 1T95A 2HAFA 4ENOA 2FJDB 3V4MA 4KGMA 2WRMA 4B08A 1IBCB 2YWEA 3U1MA 2X7IA 4IFVA 2OSRA 5DRKA 4TYAA 2FHJD 1Y5LB 1U8WA 2RHSB 3IRXA 2V34A 3QQCD 4DJBA 4RO0A 3MPYA 1WKJA 2DYAA 4O44B 4X62F 2Z2ZA 4OYWA 4Q0BA 1LOUA 3EGZA 1RA7A 4H4OA 2RD5C 2WVEA 3EDRB 4USTA 1T9VA 1MW7A 2PA3A 1ZM2A 3N79A 4M8LA 1Q81T 1ROFA 2AP6A 2FD2A 1NZ8A 4HDHA 3SI8A 1UVMA 1GMWA 2OPPA 1LXNA 2CPEA 2YQ3A 3ET6A 3TX8A 1WOSA 1CG2A 1Q8LA 1R8AA 3FGVA 3ZXWA 1AYEA 4DL2A 1YLXA 1U26A 4F0KA 3M6UA 3J81j 2N7YA 1L3SA 1T11A 5DQIA 3LPEA 1IKWB 4ECVA 3L95X 4CTAB 2BKPA 2ZFHA 3DM2A 1D9AA 1RT5A 1TTHB 5KFBA 4DCJB 2IM0A 5F0UA 2G1DA 4UZCA 3NKYA 4AYBD 1KSPA 2P6SA 3TRGA 4O0IA 2CPZA 1GEHA 2RDDA 3FZ2A 3TANA 1BY9A 4LF7J 3H5SA 5CHCB 4USWA 1UEVA 1Q16B 3M8ZA 2KT5A 2XNQA 4IG0B 2W8KA 3R5GA 5D4LA 2AIRB 1RYSA 1YGYA 2BYCA 2I8EA 4C8ZA 5A8WB 5HLFB 2B4UA 1JJ4A 2Z8QA 3GYNA 2UU9F 1K8AT 3QYYA 2VH7A 3GIJA 3Q2TC 2XY6A 2W2NP 4DG1B 5DLGA 2HIYA 1D09B 4ZVHA 1WHYA 2NUHA 5AE2A 2C3MA 2FZCB 2M52A 1YQHA 1P9YA 2HNYA 5ETKA 2ZZMA 2HFSA 1N33J 2HBRB 2DGVA 1S99A 4NLXA 1BQXA 2ZNYA 2V8DA 4XDCA 5KG5A 2DNLA 5I3PA 1YZ7A 1KLMA 2QEXS 3RAXA 3FCVA 4NRTA 1QJHA 3IAM9 4KIAA 5BJRA 1FERA 3RW7A 4YR2A 5F8NA 3G6XA 4L76A 4DLGA 1OJ4A 4JI7J 5E0OA 1QAYA 3K5NA 2AJ0A 4LSNA 3UDLA 2HRTA 1WTFA 3KWMA 1XNRF 2CZ9A 4K50A 1GXUA 2GQQA 3HHLB 4NCBA 3US5A 4JI0J 4P7VA 1L3TA 1HBMA 3M8SA 1KQSR 4B3RF 4BWJA 4HLBA 3IWXA 1RT6B 3LP0A 4OJHA 2HGNA 1S79A 2HWTA 2QL9B 4ZIWA 1QAXA 2DR5A 2QYGA 3L9ZA 1N6QB 3PKMA 3I4PA 3CD7A 4JI2F 4TQRA 3PX4A 4HVZA 2QV6A 1NHUA 3D66A 2JLEA 2B4PA 2F3JA 2DXDA 2ASDA 2W2PP 1SC6A 2GA7A 3BSNA 3PYEA 3L7PA 4TY9A 2BM0A 2XZTB 3W65A 5IT9U 5GMKa 1JJHA 2VQEF 4KT0C 3KXDA 2PT0A 2GGPB 5D78A 1UZHA 2KU7A 3EZOA 1S6QA 2HVHA 3LUYA 2UXBF 1F5BA 1X5PA 3PW0A 1NCLA 4UQTA 3E8OA 3CCJS 5KT6A 5ITHA 3QO9A 3MTKA 1A9NB 4U8VA 1QVGR 4O3OA 2ZHOA 3G2XA 4WE1B 3M30B 3KUHA 4DX6A 4X62J 5A6WA 2WZ1A 1HNIA 2CQBA 5KFVA 3G8TA 3UE2A 3SQGA 1RLCL 4DR3F 3VGVA 5J2NB 3KNGA 1RTDA 4WYWA 3MFIA 3QMQA 2I5JA 2IIHA 1CULA 1MROB 3LPYA 2Y9HA 2GMHA 2BJ8A 2L48A 1KVKA 1TL7A 1CEZA 1EAYC 2YKMA 2KM8C 1RWXB 4JV0A 3PYDA 1G3OA 4ED7A 3MPUB 3POTB 2XGPA 4ZDNA 1NAQA 5KFYA 2RVJA 3OJSA 2DIUA 2E66A 4DFJA 2EFOA 5HP1B 3SV3A 1U47A 1LXJA 3KG0A 2W24A 3HFZB 4KFBB 1C1CB 2HVDA 3I31A 4NX9A 4B3SF 2AX0A 3FMBA 5KOXA 1VOMA 3J81Y 4X66F 3CD0A 1IKVB 4G3IA 4F4XA 1NRKA 1QTMA 2KKHA 3A3OB 1M90T 1EARA 1KBRA 4OIXA 2H54B 4PG8A 3W2WA 3FBCA 4LVOP 2BOAA 4Q7AA 3RAQA 4C0BA 2BJDA 3ZTQA 2VHGA 3RRHA 5C42B 3W9IA 1RE1B 5HI7A 3KKFA 3BJYA 5SUHA 4JBCA 1R0CB 5KG0A 2D3ZA 2ILZA 1IQZA 2UU9J 1FDDA 2W4CA 1CJKB 2OPQA 4PWWA 2OMOA 4ED8A 2QE5A 2FVSA 1S9EA 1XQIA 1TV6B 1KS2A 3DMJA 4QOTA 2Z2MA 2RU3A 2DEJA 5J2MA 4O3SA 3V6HA 3PW4A 4K4ZA 2KVIA 3DLGB 3MM5A 3MAQA 1BD6A 4JI1F 2FIUA 4NA3A 1HMVA 4LVNP 1SUQA 1SKUB 2DR9A 9ATCB 2KN4A 4MKVA 3KJVA 2BEFA 3KLGA 3TAQA 3BS9A 5A8RA 3U02A 4DV1J 3D54A 1KOHA 4K4UA 3PV8A 2MQMA 5HSPA 1LW2B 3S8SA 2GQ2A 2PE8A 5DDPC 2H51B 2EBEA 1UVIA 3VVTA 4C97A 1EKSA 2AGOA 2VJVA 2DY9A 3A8EA 2EFNA 1HNVB 4K0KJ 3S6EA 2BABA 1XNRJ 4Q8EA 4CRJA 1S1UA 1RTJA 3AD9C 5HJXA 1KOOA 4OI2A 5C24A 2DEIA 4ES3A 1UWBA 1PBUA 4B3RJ 3PX0A 2MKIA 5LXRA 4U8YA 2M5YA 3MZIA 1YKWA 6FD1A 1UFKA 4DR1F 3WDOA 4I6YA 1Q5VA 4A47A 4GC7A 3KK1A 3HHLD 5H9FJ 4LMZA 5LMUF 2HHUA 3PZPA 5DG8A 4PPDA 1XERA 1BWVA 1RAEB 1JLAA 5KT5A 2WTFA 4Q8FA 2XZWA 4JI8J 4ZCLA 1RT1B 2I2YA 1M5KC 2CNOB 2VQEJ 5F3ZA 1U1RA 4FZVA 2IC3B 4QZVB 1TL1A 1AXQA 3ITHB 2UXBJ 1RUSA 4OJGA 3PW2A 1FKAF 4XPEA 1RTHB 1RBAA 3BQ1A 1Q95G 3MM9B 4NLGA 4NOHA 1OMSA 1WF2A 2MQLA 5CXTA 1DQ8A 3KHGA 3RUBL 1S1VB 3IAS9 4J9NA 2PD1A 2NYHA 4QWEA 4LF9F 2C3UA 3MM7A 2D41A 4ICLA 2DHSA 1JK9B 3L7OA 2BJ3A 1F9HA 3L7UA 1FI4A 2A0FB 3DLKB 3G82B 3MWBA 5DS7A 5K14B 3NNHA 1FKPB 3MGJA 4GC6A
chains in the Genus database with same CATH topology
2EWHA 5BYQA 1XBWA 5HMXA 4C11B 4PXEA 5AJ3F 2YNGA 3JYTB 4O44A 2A2DA 5IT4A 3NCPA 2B9YA 3PEJA 4NLOA 4P2SA 5A2QY 3KLHB 3R1HA 5F8GA 2Q6CA 2R7QA 3KG4A 2E5HA 3MPWA 4A8YA 1CC8A 1DURA 1HNVA 2RUGA 4O3NA 3CVKA 4AL5A 3DGPA 5CCLA 2VL1A 4JV1A 2XWYA 1FRMA 2UP1A 4ZP8A 2V8GA 2PN6A 4ILMA 2M8HA 3M6XA 2R7VA 2XGQA 4DV1F 1JB0C 5GAEI 3PIPQ 4R8UA 4IO9Q 5JVHQ 3G71S 2ZH1A 3C6TB 1YHQS 1JLGB 3MEGA 4RWWA 3TNVA 2OP5A 1ZYQA 3DLLQ 4IQXA 2O01C 3BSAA 1JLCA 1H38A 4IRKA 1FRXA 1X0FA 2E1CA 4PG5A 4GKKF 4C9DA 1OWXA 1FEEA 2XI2A 3SSQA 3Q0AA 4DBQA 4YB1P 3M9OB 2E1AA 4K0KF 5K8MA 2FJAB 1Z2ZA 5KFAA 1SIZA 2J6TA 1UL3A 3DU5A 5BYRA 2VQFF 2HS3A 5KT3A 4CI0B 3C46A 1HQUB 2VPXB 4N41A 5GVQA 4QPXA 4PR6A 4A48A 2UVRA 1Y9OA 3MPVA 1G6BA 4ZP7A 2P5VA 4UY85 1IXKA 4F8RA 2YH0A 3C6UB 1TP7A 4RBVA 5AXKA 1JLBB 5B08A 2IRUA 4G6VB 2Q1LA 4RW6A 2R7XA 1VC0A 2A1BA 2E7WA 2VASA 4O3QA 5J2PB 2VPWB 3SSRA 4D3GA 3R3TA 4N47A 4DS4A 1C4CA 2V94A 1FKOB 1Q8IA 1S4FA 3BB5A 3R5BA 4F3MA 3PXGa 4F3OA 2F4VF 2EG2A 1O8BA 2A10A 4KSEB 2N4DA 3NBPB 3OSPA 4WFAQ 3CWJA 4MIBA 2R8KA 3QLHB 3I5CA 2E5IA 5F8LA 1S77D 1R8HA 1VRUB 4ZPCA 4MK7A 5K8PA 5KTQA 1TFWA 2DIVA 1YG0A 1E6VB 4B9MA 4YDDB 4I67A 1YVFA 3H98A 2X1FA 4C8NA 4B9VA 3DLEB 5F8JA 4DHVA 2IMWP 1C4AA 1W25A 2DGQA 4OZLA 5HBMB 4DX8H 5SZTA 3DLBA 4Y2KA 3TARA 2LCWA 3B78A 3AY0A 1EP4B 3K5PA 3OLAA 5AXNA 3C66A 3KK2A 5EX3A 3P6YC 3VZHA 1RWUA 2EW9A 4XDDA 3G8SA 3I32A 3ICLA 4WFBQ 2O1PA 2IC3A 4KV8A 1FJ7A 2MYFA 4MTPA 1PC5A 2Z2LA 3I6PA 3OVAA 3H20A 3CJ4A 2X1GA 2MXYA 5CZVA 3GG0A 5KFTA 5I42B 2DGXA 3E2EA 3BREA 2GMJA 5KFOA 3TVZA 5D3GA 3SMZA 2ZITA 5U47A 1M5OC 1R0AB 3QZ8A 4OX6A 1A7GE 1WWHA 1OPZA 2AD9A 2MZTA 4RW8A 2LXFA 4CQ1A 2AX1A 4IG0A 3RB0A 1RTHA 3PO5A 1H3DA 2MKHA 4JI8F 1HNZF 2VC1A 3OXFA 1N5VA 2DCLA 5E3CA 4CT8A 2D9PA 2YX7A 2O3DA 1JX4A 1ZM9A 4OHVA 3X1LB 2LU2A 3JTNA 2F7VA 2RS8A 2FVQA 2QSWA 1FVQA 3N01A 3IGNA 3I55S 3LP1B 2EK6A 2Q79A 3SEOA 4MFBB 1RTIB 5HN0A 1X7VA 2MPUA 4DUZF 1QAJA 3NLCA 2DGOA 2KZMA 3VAJA 1U1LA 2DNGA 2L9WA 3NS6A 2YWKA 1M5VC 3VAFA 1S1VA 4N56A 4F4YA 3OXGA 3OUYB 2VOOA 3G9CA 2PA8D 3MMCB 4ECWA 4QWCA 1Y00A 3KMSA 2M4MA 3C3LA 4ID5B 7FD1A 1HBUB 4MK8A 1LFWA 1X4HA 2EFVA 1RK8A 4FVMA 4B3OB 1RAJA 3MFHA 3K8VA 2XCPA 2KFNA 3BDPA 4ELUA 3I82A 1ZM3A 2FGCA 1NK4A 2ZBIA 2VUGA 2M0GB 2V4RA 3DLKA 1S6OA 4TKTA 4R5PA 1ELOA 2DT9A 3GR1A 4USHA 3NRBA 4DL7A 3MEKA 4JI5F 2BM1A 3KLFA 3Q8RB 4HH1A 2M2BA 4QR1A 1FKPA 2QO3A 2MGZB 2IFXA 5DQHA 3M2VB 1Q4RA 2B9XA 2XWXA 3FDSA 5MAOA 1F0XA 5CZXA 2J0XA 1TZ0A 3HMJG 1VC5A 4AE5A 3BGUA 1GT8A 3JYTA 4EYHB 4IO1A 2PIIA 3GFXA 5CCMA 3KLHA 4HH0A 4CIOA 3DRXA 3DOKB 1N52B 3MD1A 2VZ9A 1YJNS 3UWTA 2QA4G 5D4OA 2BA9A 3HPOA 5E3RA 2AJQA 3CCMS 1YTYA 3HI9A 4E8UA 3K5LA 4O4RA 4YEAA 5D6GA 4A8QA 3R1LA 3QGGA 3CB4A 2HRUA 4K59A 5LT5A 2RNEA 3KNAA 2MY8A 2NPIA 2DH9A 3WBZA 3C6TA 2M70A 3H4BA 2KH9A 2K3KA 1JLGA 1HQEB 2LA6A 1K1QA 3PW5A 3UCGA 4DN9A 2WBMA 3DC2A 2J8AA 3CDEA 1AFJA 2FHKA 4NPOA 4TU8A 1IM4A 5E7OB 5B0CA 4LT6A 2XSJB 1XC9A 2DHAA 1N4LA 2FVRA 5I3UB 1UA0A 3QIPB 4IFVB 4I6WA 3VZIA 2E5GA 4DV5F 5BYSA 2Q43A 3CMES 3I87A 3DHXA 2RJZA 2ZKTA 4UUXA 4L6V3 5B0DA 5T14A 2XY7A 3JB9k 4LF4F 4C8LA 4WZMA 4FBUA 3QGPA 4WFXA 4XAKA 1JMTA 2WOMA 4ATNA 4QW9A 1SJ3P 1WI6A 2ROEA 1EETB 3GV7B 1KVJA 1HI1A 3HHKA 3O1LA 1YJRA 1HQUA 1SH2A 2DNRA 1UVLA 1LK5A 1REVB 2EI5A 3BEGB 5BR8F 4DQRA 4N77A 2JSXA 1JIHA 3V81B 1RGVA 2CQ1A 4LF8F 4H4OB 3C6UA 1K0TA 1VIOA 3T1HF 4WFNQ 3HZGA 4CH1A 3DOLB 3QWUA 3JTOA 5LJ5Y 5J2PA 2PI5A 2KO1A 5HROB 3H40A 2R7UA 1X4BA 6FDRA 2DGWA 3Q24A 1HWKA 3ZZOA 1S9GB 1FKOA 2HLTA 1QSSA 3M32B 2RS2A 3WC2A 3R5AA 1ZBTA 4E0DA 4NCGB 3O8WA 3R5CA 4MIAA 4CO5A 2R7RA 2UUBF 4ALZA 2MQNA 3NBPA 1KFSA 3EXCX 3QLHA 1XWLA 2IM2A 2MMYA 2R4FA 1VRUA 3RTVA 2VBXA 3VWSA 3JSYA 1CLFA 4M1KA 1E6VA 3D1HA 5F41A 2QMWA 1SKWA 2EFQA 3OTEA 5D77A 5KFHA 3MF5A 3FQKA 3DLEA 4DOZA 3SZ2A 5HBMA 2W25A 3SCIE 2OPRB 2BRLA 3NMRA 4ZS6A 1DQAA 1V3SA 2RRAA 1EP4A 1F60B 1BQMB 1FRJA 1Y3JA 1ZZFA 4QBUA 1HARA 3Q8PB 2ZH7A 1NEEA 4KR0B 3NNAA 1HBNB 2CPDA 1YJ9S 3QJJA 1M5SA 2MHNA 4J9QA 2NXUA 1UJ4A 4ILLA 1LQ9A 3GV8B 1Z1ZA 3QJLA 3AAWB 1Q86T 3C8YA 4A8KA 2UUTA 1DRZA 1XNQF 4U9RA 4DN0A 1HR0F 2LQJA 1RT7B 5K9FA 4F50A 1K0VA 3BF4A 5I42A 3FQLA 1T05B 1UEUA 3BSCA 3HFKA 4FF3A 2M3DA 2HHQA 2AYMA 2E1MC 2GCFA 4MK9A 3BGLA 1R0AA 4EEYA 1WEYA 3FSIA 2K2PA 1P1LA 4Q5VA 4RNOA 2F8MA 3GQCA 1TVRB 3KLIB 4EBEA 2ZE2A 4ZVFA 4K4XA 4Y34A 3MM8B 4FPRA 2R9LA 4DSJA 2M88A 4PXDA 4GMKA 1IBMF 1T02A 4DL5A 3RRKA 1F9FA 1BQNB 4OHXA 3PO4A 3LP1A 2RQMA 2BXJA 2XMJA 1RTIA 3LAMA 4MFBA 2OO4A 4FXWA 3OL9A 2CJAA 3I0SB 2EBGA 2AYBA 4PG6A 2VFUA 3ISNC 4CO1A 2FB0A 3NGDA 2NSCA 3CT9A 3OUYA 4F4KA 1U8SA 4RUHA 2ADCA 3MMCA 2W4PA 5FIIA 3HM9A 1F5CA 1MWYA 1KQGB 2IBOA 2NQPA 2JEIA 3O3LA 4ID5A 2W7OA 1HBUA 2VA2A 1FXLA 1QSLA 4B3OA 3NS5A 5EWFA 2HHTA 1UVKA 3DRRB