2W2MP

Wt pcsk9-deltac bound to wt egf-a of ldlr
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
publication title Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/receptor
total genus 20
structure length 92
sequence length 92
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2w2mP01
2ZWOA 3P5BP 3WIVA 1SCJB 3WHIA 4JP8A 2Z57B 3WIUA 2PMWA 3H42A 4YN3B 1SPBP 3VHQA 4K8RA 1ITPA 3BPSP 3GCXP 2W2PP 2Z56B 3AFGA 2Z2ZA 4NMXA 4OV6A 2W2OP 3CNQP 2W2MP 2Z30B 2XTJP 1R6VA 2ZWPA 2W2NP 4NE9C 3CO0P 3BGOP 3T41A 3A3OB 3A3PB 3SQOP 1V5IB 3GCWP 3A3NB 2Z2YB 3QFHA 2QTWA 2Z58B 2E1PA 3VV2B 2W2QP
chains in the Genus database with same CATH superfamily
3PV8A 4EK2A 2O67A 1SCJB 3VVUA 1NO8A 1OPZA 4N76A 1OYEA 2C2MB 4P2SA 4TLRA 5J2MA 2MKSA 3PHTA 4C3LA 4WTOB 2YQ0A 2GNKA 2HGMA 3A3PB 2VQFJ 2XI2A 1FJGJ 4BDPA 1S12A 4RWWA 4IDKB 1VYAA 5A8RA 2W25A 3T9NA 5KFFA 3LW5C 3MR2A 2NS1B 3GLJA 4RL1A 2MGZB 2E5IA 4DF8A 2P9CA 2QA4G 1JLBB 3GJQB 1XK8A 5CCLA 5DRKA 4U7UD 4DR3F 1Q1KA 1S6QA 2FC9A 3MAAA 1C0TB 4QR1A 4L75A 1NHVA 3HFKA 5KFIA 2GHVC 2AU0A 3UR0A 5K8MA 1RT5B 3OTOF 2VOPA 2QA4S 4QWDA 3CCVS 1PSDA 1FX2A 2BDPA 2AYEA 1Q8BA 3IRWP 8RUCA 3ILIA 3J81U 2BQ3A 2NYHA 4QIVA 5ETTA 2VICA 4AFFA 2GVZB 3CGIA 2WSEC 3BEGB 2C3PA 3H5YA 2OPPA 1ZOTA 4KBIA 2IJNA 2BW2A 2H4WB 1MN9A 3KLEA 2DTJA 2A1BA 3AB4B 1QVFR 2EG2A 5L8RC 2V68A 4I2PB 4L74A 1MU2B 3PO4A 3BKUA 3GIMA 2C2DA 4FBTA 5IWAJ 3FCWA 5J1EB 4PG8A 2HVDA 1Y0HA 1YRUA 4MJKA 4JV1A 3MM8A 5K8OA 3PNIA 4FXVA 2X1BA 2PIIA 4EBEA 3SMZA 4F7VA 5L1LA 2B9YA 5ETNA 5LXYA 4DS5A 3OSPA 3W2VB 1C1BA 1HQUB 3BYPA 5D4PA 2IYGA 2M7SA 4CDIA 2AGPA 2GHWA 2AGQA 3OTCA 1ULRA 4QZVB 3DLKB 3S6EA 1YDLA 4RZRA 3KYLA 2WHOA 1SL1A 1QVGR 2KVIA 3DRPB 4LIWA 1LXJA 3A1YG 1WF2A 2GQQA 2MY7A 4FF3A 5D0GA 5A8KB 2KZMA 3RJMB 1RTJA 4I64A 2G1DA 4X62J 2QV6A 2R2UA 1VLYA 4N56A 3R7NB 2VFSA 4YHHJ 3R7SB 5T14A 3W2WA 1DARA 4QWAA 2C3YA 1Z2ZA 2YPZA 1RKJA 4G1QA 3I32A 4KQZA 3MEDB 3A13A 1RWXB 4PPDA 1HW8A 2MKKA 4O0NA 2VH7A 2AT1B 3Q22A 2RU3A 2G13A 1QUVA 1VISA 4LVNP 1VQ9S 3P49B 1U1NA 5D3GA 4ZPTR 4KGMA 4DV2F 3MPDA 4DXLA 4USJC 4TQSA 2OEKA 2DD8S 2YWGA 2ZH9A 1VBKA 5J2NB 2W01A 2GHPA 4WP3A 3NXZA 1N34J 3CD7A 2ZUAA 4UQTA 5DLGA 3OJSA 4K4WA 3JXOA 2XGPA 4C8NA 3M2VB 4JI8J 1VLOA 1YWXA 2R7VA 1AT1B 3ZO7A 1QSYA 3FCVA 1LQ9A 5DQGA 2RT3A 3HLUA 4X4UA 4CO2A 4X66F 3NWGA 4IFVA 4NX9A 2W4CA 1IUJA 1C1CB 2HS3A 4DN0A 2JEIA 1QM9A 4ANCA 1Q86T 2DPJA 4EZ9A 2KU7A 4G1IA 1NCLA 5CZVA 3QLHA 4L76A 4OX9J 3DRSA 2F8MA 3R3TA 1S77D 3R5DA 1OYDA 1N33F 4NXMF 3I4PA 5B7WA 1B7FA 4JI6F 2EC2A 4YDDB 3GCWP 3C6TB 5B0GA 4PXDA 2W8LA 4DQQA 3BBBA 1JK9B 1JLCB 4R5PA 3IN5A 4USTA 3A12A 2IDLA 3RB0A 2GMLA 3VAHA 3MDFA 5F0UA 1X5SA 4IRDA 1W25A 3P4UB 1XNRF 1DAXA 1IVZA 3CCMS 1QAXA 3MPVA 1GMUA 1B4SA 4C11B 1RBAA 2FC8A 3QFWA 3SQOP 2LFVA 3A3NB 1KD1T 5HL7Q 1UFLA 2E1PA 1LK5A 3EGZA 1HD0A 4F0HA 4EWTA 4TU9A 4ED4A 3PM9A 3HSGA 4DV6F 4OI1A 2VD3A 4IYQA 1NU4A 4USIA 5THWA 1N54B 4I7FB 3KK1B 2B7CB 2M52A 3K2YA 4FPRA 3AD9C 1IWGA 3DYAA 4K8RA 1EB0A 4Y3CA 3T9ZA 1RLDA 4IOBA 4LFCF 4MIWA 2ZH1A 3I56S 4QBUA 4FZVA 3RB4A 2APOA 3H2UB 3R6GB 5HROA 2M2BA 4BWJA 4DFJA 1FKPB 4KGXB 4PEOA 5KFKA 2QN6B 1X4CA 2XB2D 2BJ8A 4WF9Q 1G6BA 1U1PA 1T9UA 1O51A 1REGX 4DV4F 4WZMA 1RT6B 2GQCA 2WVDA 2V5HG 2FUG9 4TU7A 3VGTA 1K8AT 3EPIA 5JVGQ 3QYYA 1H2TZ 4ZVRB 2E7WA 1GXUA 1U8WA 2VONA 4ANDA 2HQDA 1ZA2B 2H48B 4TN2A 2HWTA 3PVXA 4URGA 3MM9A 1RHUB 2KH9A 4MKYA 2Y3YA 4NLQA 3M2UA 2SXLA 2B7BB 1WG1A 3ULHA 5K14B 1SPBP 2F7VA 2R2SA 3AOAA 2YKPA 1RABB 4IG0B 1S1VB 1Z4UA 2JOQA 3OUYA 1SKUB 3DI6B 3DDIA 4LJMA 3C15A 2HSEB 2KT5A 2FIUA 1UEVA 4OX6A 2ASDA 4ETZA 3G6XA 2QA2A 1SQEA 3P8BB 4DR1F 4OJHA 3RRKA 5KOWA 1FWPA 2VG7A 1WHWA 5J1PA 1S9GB 1QDUB 4WYLA 2M4MA 2ZBIA 3D6MB 2PMHA 2XM3A 1DY3A 4WIQA 5ETMA 5GMEA 4CLZA 4K0KF 2BA9A 4Q2LA 1D8YA 1NZ8A 2JHEA 3MM7A 4P2XA 4B3TF 2UU9F 1YIJS 2ZBPA 4P75A 3KKFA 3FSIA 4KHRA 3QSYB 2PMWA 1IKWB 2E66A 1Q79A 1IQZA 1JLAB 4OI2A 3W7BA 4M5DA 2RHSB 3NMRA 2ZH5A 2HLUA 1SVDA 1TKXA 1TK5A 2JEFA 1HKAA 1HNWF 1LW2A 1X5OA 2EBEA 3HZEA 2KFZA 4J7CA 4QPTA 1JIHA 2ABYA 1QSLA 3IM9A 2E1CA 2OAUA 3US5A 1UVNA 3CSKA 1BE4A 3MEGA 2UV8G 2EFPA 3U7JA 2HURA 3A8EA 3THTA 4IR9A 1BQNA 3K7RA 4FF1A 5I3QA 3MMAA 1XERA 4LF2A 2JVOA 1YVFA 4MK7A 1T95A 5L39A 2PA8D 3OXLA 2XULA 4AL6A 1TL1A 2GO9A 4R0JA 2MDAA 3PFEA 1RAGB 1TTHB 3TX0A 2BXJA 3TA1A 1XNQF 5RUBA 4ZK7M 2VPYB 4ICLA 3Q8PB 4PUOA 4MIBA 3HHDA 5F3ZA 4HHHA 8AT1B 4ZCIA 2ZNZA 4DUZF 2ATLA 4IUFA 1XMQJ 3OTBA 2HWHA 3CNQP 1QE1A 2ZM6F 3OR1B 2YWKA 3T1YJ 4GKJF 1N5VA 1JLQA 1QAYA 3RAQA 2F40A 4GVBA 3SFUA 1FTRA 2LDIA 2V4JA 4FKYA 1GQEA 2NXNA 1HI1A 2XGQA 2MLYA 1WTBA 4NLYA 5LJ5Y 4HHUA 1N8RT 1RTIB 1WC5A 4F04B 2I2YA 2QYCA 2XSJB 1TFYA 2LA4A 1E6VB 5DQHA 2IM2A 2KT3A 1G4CA 3EVMA 4OYPA 1ZAVA 1APSA 5H1SV 4FP9A 1O8BA 2NZCA 1TKTB 1UJ4A 4URSA 4TYBA 1DHMA 1WKJA 3KUGA 1HMVA 1LW0A 1FRIA 2A3JA 1KLMA 4JYAF 3HSJA 3BJYA 2PI5A 1WELA 1B0TA 3SIPB 4DI6A 1V5IB 1EAYC 2RVJA 2OPQA 4NEYA 4ILMA 4IRKA 1EX8A 2UVWA 3CC4S 4ZPWR 4EGLA 2OMLA 1Q4RA 4X4RA 3D6TB 3QT5A 1EETA 2ZD1B 2HQFA 3EJMA 2FLOA 2XS5A 4Q5VA 2GMJA 3DLGA 4P2FA 3KLVA 9RUBA 3BGOP 3C46A 5KG0A 3JTPA 5D4LA 2CRLA 3IAS9 2PD1A 4YDXA 1DQ8A 4OQJA 4YN3B 3HT0A 2IBOA 1F5CA 3ZNUA 5IM0B 1AXQA 3WX8A 3N4WA 1HBOB 4KPCA 5A8WB 5C2CA 4UUWA 1YRXA 2OPRA 4DCJB 4NLXA 1R8BA 5DS7A 2M0GB 3HHNB 2IMWP 3J7AN 3M8PA 2VA2A 2KKHA 2CQ3A 3H20A 1ZZNA 1PJ7A 1WDDA 4OZLA 4DR6F 2WONB 1VQ8S 1BQXA 3B6BA 3UCZP 2OJ3A 4MTPA 1LWFA 2KVQE 4M5HA 5KFTA 4K4VA 1YGYA 2Y1LB 2XS2A 3BQ2A 2FGOA 3KWMA 2DGSA 3VAMA 4OZ2A 3A3OB 3M9NB 1JWWA 1FFWB 2M70A 1KBRA 4M63A 2BE7D 4ZVPB 4HACB 2RUSA 1M5KC 1YI2S 4LSLB 5HAOA 2XS7A 4HHJA 4NWBA 1Y10A 1B0VA 3L7OA 4AL5A 4DPTA 3ISND 2LQBA 2NYIA 2I8EA 1VBXA 3H2LA 3NS6A 2CQDA 3DN9A 2FHJA 2CPHA 1LWEB 1RT7A 1CULB 2MQQA 1RE1B 3BBCA 2QL7B 1KHVA 1IBMF 4C8KA 4X4OA 4FVMA 4PG7A 4Y65A 2MJNA 3K58A 2VFVA 1S1TB 3UPFA 2D3UA 1R8AA 2W9BB 1WC6A 4K4XA 4JI2F 2JEJA 3IM8A 2HS0A 3HF5A 4RNMA 3DLHA 2WK4A 1TL7B 2CADA 4B9VA 4DZDA 3M8QB 3C8YA 4FNIA 4ZP6A 1FK9B 3PKMA 2EBGA 1VQKS 3HK2A 2GJ2A 3IR7B 1SJFA 5LMNF 4HH1A 3TZZA 4Y2IA 3EVWA 1JXEA 5C24B 1TAUA 2BX6A 3MAQA 2N4DA 4Q0BA 4RW8A 3F0NA 2YX7A 1YJVA 3M6VA 3Q2SC 4FBUA 4HKQA 3SXLA 2IIHA 1PO6A 3T5KA 4C8LA 1V9OA 4YMEA 1S4FA 5D8HB 4RU9A 2DRAA 4QW9A 2HFSA 4RLEA 1MLAA 2LMIA 2F3JA 2QC3A 1ZM9A 5D4OA 5I3UB 4CT8A 4L72B 4OZ0A 2IA6A 3TW0A 3GIRA 3NBPA 1R0AB 2KFNA 2FZCB 1NXIA 2R9LA 1R6VA 1R8PA 1U0HA 1U1MA 4OYXA 4NLOA 4ZS6A 2OP5A 1K0VA 5ETSA 1S0MA 2EKNA 3HM9A 3MMCA 3CULA 2BW7A 1P6TA 2RB7A 2ZJQQ 5A6PA 4AQYJ 4NLUA 1QAIA 1RAJA 4ELTA 4JI7F 4NASA 2CA9A 1HBNA 4MT1A 2QL5B 3SQGB 5AXKA 2GGPB 1MROA 4DPYA 1VQYA 3N6MA 3VF0B 4LF6J 3GIIA 3Q8YA 5ETVA 4LIRA 2V2VA 2UXBJ 2ZWOA 6FD1A 3KDOA 4A4JA 1UZDA 2G2OA 4JOUA 1L3UA 3VAIA 4ERDA 4K7QA 2PGCA 3C16B 2AZ3A 3OW2R 4YB7A 3LGNA 1PBAA 2E7XA 4FS2A 2MQLA 2DGOA 2V8DA 3WZ0A 2H5IB 2DGXA 3NGRA 4ZVTB 3SCKE 2ADBA 3FRZA 3ENWA 5D77A 5LM7E 1U4BA 2WOMB 3CMQA 2ZVIA 3FQLA 5KG6A 2CNOB 1HNZJ 4ZN3A 1LXNA 3ENAA 1S97A 1J2VA 2EWHA 3BSAA 1RISA 3T1AA 2H54B 3NRBA 1WEXA 4MH8A 1DQ9A 1S1XA 1SB6A 4EO6A 1PBUA 3FNNA 3ZZOA 1VC5A 2DO0A 1X5PA 2YNFB 3M05A 2AJFE 2ILZA 2FY8A 4U8VA 4ED0A 2JH3A 3UFCX 3AHPA 2GAGC 5ETOA 3VALA 3NGSA 3T5JA 4GRSA 4YB5A 3M30B 4QJVA 3FZBA 2CAJA 4B08A 4DPOA 1RT1A 3CCTA 2XTJP 2MSTA 3LAMA 3VZHA 4IOAQ 1JLFB 1A6LA 5JJBA 2UUAF 2J6UA 2NLWA 1N52B 1D1UA 2J76E 4YFUA 1Q5VA 1KN6A 2ZOGA 4NYPA 4WU3A 2QZ8A 4X84A 1B0PA 3ZTSA 3C66A 1HYSB 4A8XA 1VQ7S 2B43A 3OD2A 1RCOB 2RNEA 1HBUB 1GX6A 2ZE2B 1F3VA 4KH0B 4JI1J 5C5JA 1JXLA 2G1HA 2H4YB 3HHLB 5F8IA 3N5BA 4R25A 3EDRB 1S0VA 1U6FA 1HWIA 2XI3A 3K8WA 2VL1A 1SXLA 3FDSA 1IBCB 1CS4B 1MMNA 4LR8A 2DGQA 1F2GA 5CQGA 3PY8A 4TVAB 5AE2A 4DV0F 4DU7A 2KO1A 2PN6A 1NM2A 3Q8SB 3MECB 2PO4A 3LUYA 2K7KA 3T19A 4I68A 3MUVP 4DWIA 4HDHA 3VR1A 2ZH7A 1BWVA 2XWXA 4IFYB 3U1LA 4Y28C 3PIPQ 1R31A 2DH7A 3NY0A 4ES1A 2LDYA 4P73A 3HKWA 2IY5B 1MMDA 4XDDA 3CT9A 2RQ4A 4CH7A 4O4GB 3HXMA 2V2ZA 3VAKA 4P7TA 2CXEA 5CZXA 4CI0B 2W7PA 2P8IA 2RKIA 1FFSB 4H4OA 1OMSA 2HK2A 3IO1A 1FNOA 4N41A 1X4AA 1ROFA 3GMGA 3MTKA 2MKHA 4TKTA 4RJVA 4IG3A 1UEUA 1F0XA 5FDLB 2VASA 4EMDA 3GU0A 3LTOA 2XO7A 4N8NA 3PYFA 4UT4A 2VDIA 2ASLA 1QSSA 3CJSA 3ET6A 1U02A 1RKIA 2CJYB 4OV6A 3BDEA 4NLVA 2HNZB 1IBLJ 1REVA 1FEHA 3CVKA 5D0HA 1FF2A 3DRXA 3KJFB 1FD8A 2HMIB 1UP1A 3GJSB 2VPXB 3HHLD 2KM8B 2PMZD 1TU0B 3QPIA 1TFWA 3E3XA 4NXNF 3Q86A 2ASYA 3AQPA 1DLOB 4LR7A 2CFXA 3RGIA 1U47A 1NPKA 3LWLA 3IS9A 4XPEA 2B9EA 4MMOA 2BM1A 2Y9HA 1W2IA 3HHKA 4FPIA 2ZH3A 1I51B 1VC0A 1OY9A 1IM4A 3G86A 2AV5A 2RJZA 1YKWA 1SIWB 1HWLA 2VC1A 5C25B 2ASJA 1WD6A 3HX9A 3I82A 2B3TB 4JUZA 4CO0A 3BQ1A 3MEEB 3D68A 2OSQA 5GMKa 2DNOA 3IWXA 3H5UA 1RCXB 1TUGB 2HQGA 4NZ7A 4U7UK 3TARA 4N5SA 5HN0A 3U27A 1U2CA 1XNRJ 5JUMA 2ZUGA 2E9RX 2KT2A 2VQEF 3GYNA 2DT9A 1G1XA 4O3PA 2WVBA 2O5DA 2V8VA 3U1MA 2CPDA 1OPIA 1WF0A 2IJRA 3H7HB 4QIEA 2PSZA 4KFBB 3I9V9 1FRHA 2DNKA 4NLGA 4CCHA 1VRTA 2CQHA 1RK8A 3G96A 3UD3P 1SC6A 5DM6Q 4A47A 2RDIA 1JB0C 5BYQA 3GZ7A 4LR9A 3GFZA 3BYRA 4FKXA 4DQSA 4WK3A 1M5VC 3JTNA 4WXOA 4B3RJ 1VQ5S 2ZBQA 1SV5A 2MJUA 3FCHA 1V6HA 1NK4A 3CCZA 3V6HA 1BUXA 3KHRA 1Q82T 4LT6A 3EM1A 5DDQC 4ZIWA 2ZH8A 2GIQA 3T1HF 4BC7A 3RBXA 5KFDA 3WHIA 3R9LA 5LOQA 4JV0A 1FKAF 1SH3A 5HVFA 1SKSA 5L9XA 1GMWA 4ZVUB 2ROPA 3JQJA 4QIGA 4USUA 4B9LA 4DCPB 1B7YB 2VC0A 1C4CA 4DSKA 3IP0A 1S6QB 4GVLA 3MAAB 4YP3A 2KB2A 3VAJA 2VJVA 2UV8A 1VJWA 4RX6A 1HWUA 1TV6A 3E8OA 1PJ6A 4RUCA 2HYIB 3MCOA 2C2NA 3QBCA 5F0WA 3H90A 3BPSP 1WWHA 2X3DA 4O23A 3OL8A 1S72S 5HI7A 3LPYA 1Q16B 5L1JA 1CJUA 2G0IA 3ITHB 3IRXA 1LWXA 4K4UA 1VHFA 4IO1A 3P5BP 3OFHA 1Y7PA 3LP2B 2FHJD 2WBRA 2HQ3A 3KLEB 4DR5J 1FE4A 1S6UA 2RRBA 3DLJA 3NNHA 2CQIA 4LRBA 2CZVC 2H65B 1VR6A 1KOOA 4M5KA 3K57A 3DDKA 2VZ9A 2GFFA 2L9WA 2DHAA 1WEZA 1GT8A 4LBPA 2MZRA 3GILA 4P74A 4ED1A 3R2DJ 1HNXF 2E5HA 1SQFA 3DHWC 2UXDJ 2LXUA 7AT1B 3N01A 2E5LJ 5J2QA 4DLGA 3G71S 3KK2B 3KJNB 3WIUA 2CUYA 3CDBA 3JYTB 1HNVB 1NSQA 3CCLS 4X64F 3DLBA 4ITSA 4LSNA 3VQSA 2X1FA 2GW8A 2W9AA 3PIOQ 2AEJA 3UW1A 2ZC3A 3QZ7A 3BF4A 3ZTQA 3CCUS 2KG0A 5B0CA 1N32F 1BQMA 1N5QA 2EKYA 3IGNA 2CWKA 3DRYA 4C6AA 5E3PA 4KGKA 1QTNB 1K9MT 2FVQA 2LQJA 2ZEJA 2AP6A 5I42A 2OLWA 1XIQA 3PX4A 2BE9B 2QLXA 2AGOA 2U2FA 1HIYA 1ZZFA 3NMAA 4LF8J 5B0BA 2U1AA 1RU2A 2CKWA 2YNIA 1MMLA 5HSPA 4CLUA 2FY1A 1XBWA 2P5VA 1X60A 2CDRB 1LWCB 4I4BA 1ZA1B 4AXIA 3O6QA 3M1VA 3DLEA 3ZZUA 4FN5A 3N5FA 4Z37A 1S1UA 1TVRB 2MHEA 2RUGA 4K2XA 1LV5A 1S6PB 3UDEA 3IWNC 1ZM3A 4QU6A 2FJVA 2G4BA 4KV8A 3D28A 3L9ZA 1HR0F 2CJBA 1T05B 2RSQA 1XNQJ 4I0WA 2QMUB 5G0RB 5DGBA 2E1AA 2DB1A 2BANB 4PXEA 1ZTWA 3PR5B 2R7SA 1JX4A 4DR2F 1DTTA 4RBTA 1DBDA 2BE2A 1JLGB 2PFFB 3HZGA 4ID5B 2BUNA 4P7VA 1GNKA 3C6UA 2MKIA 5IT0A 1HBMA 4OIXA 4ECSA 4F4XA 4ECYA 4ED3A 3GG1A 4USMA 4C0HA 1IKVB 3MM5A 2ZH4A 4LBHA 3JSMB 4EBDA 3CJKB 3WQPA 4HT5A 3CB4A 5C42B 2ZVSA 1ZPWX 1PC5A 2QEXS 4LF9J 2J7UA 4LF7F 4ES2A 3QLHB 3QIPB 4NRTA 4P52A 5EWGA 2H1YA 1RT4A 3BN7A 1SH0A 5HJXA 2YKNB 2RQCA 5A2QY 2BACA 3DRRA 1GAOA 2HNYA 3S7RA 3DOMA 1U1LA 3MR6A 3K5LA 4CTAA 3HFVA 4NZ6A 1FJEB 2Q66A 2GC8A 3QO9B 4O3RA 4W98A 4DX5A 3DDNA 3LANA 4JI5F 3VZIA 4DUYF 2NPFA 2XQCA 1DTQB 3J7ZT 3BZQA 4Y2CA 1VK8A 3CJ5A 1LNQA 1HQ2A 3ZXWA 4C4WA 1URNA 1AYEA 3V4IB 3OTDA 5SUHA 1VQSA 1RHJB 3O2IA 5KFSA 1Q78A 2MGZA 2PFDA 1TL5A 3I5AA 1JLBA 4WPAA 1I94F 2B9XA 5E3QA 2DR6A 1C0TA 5KFNA 2CJQA 3M9OB 2YTCA 3HJFA 1CPZA 4NA3A 3PW0A 4A8FA 4KAIA 2V69A 4ZCKA 4DR6J 3IXQA 3PRDA 1P8GA 3G4SS 5HBMA 3NL0A 1NNDA 5ETKA 5DLFA 2GVZA 4UUXA 3DYAB 1UW9A 4ZLNA 3EYZA 3TAMB 5HK4A 3W1YC 1RWMB 1W2BR 2Z30B 1RWWB 2F5GA 4PXBA 5K8NA 1R43A 3CJ4A 2AJ1A 3JSRA 5K20B 5HROB 4ALZA 4I2PA 1A7GE 4IR1A 4U9RA 2KG1A 4KHPJ 1MU2A 4AT1B 3GFXA 2XCAA 1NK9A 2XYHB 2DRBA 2XY6A 2CG8A 4DFMA 5J1EA 2N82B 2YWWA 3O5TB 1JKHA 1NB2A 1H73A 3H59A 2J0WA 3I4HX 2WB1D 2CQGA 4G65A 1XC9A 1DFDA 2MEWA 2I5JB 2F4FA 3PW7A 1P9YA 3MOZA 3QJLA 2EPIA 1A9NB 2EXUA 3QGPA 3BPDA 1VBYA 2RQKA 3W2VA 3MM9B 1HQUA 1EIYB 3WC2A 4FXDA 2ZHOA 2L3MA 3TR5A 1UFWA 2ZHAA 2QTWA 4R8UA 3D1OA 3KXDA 1OSCA 2ALYB 3FBCA 3DRPA 4K5SA 1RAEB 4WFNQ 2MYFA 3Q89A 3OL9A 3RBDA 2FJAB 2VB6A 3GJRB 3KNAA 2RIJA 4F2SA 5A8KA 2OUGA 4UOFA 4WYWA 2CZ4A 2LKZA 2DO4A 1KLNA 3MF5A 3IA0A 2VPWB 1CJVB 2B4PA 1PIEA 5L9NA 1H6KX 5IZHA 2YVSA 2VIHA 4DV7J 1EQMA 2ZHBA 2YBVA 4RPFA 1F9EB 1H2VZ 2HFNA 3MEDA 1GMVA 4BLGA 3KLIB 2P9GA 2W2PP 4NA1A 2GIRA 1VK3A 1HA1A 4IH7A 1W7WA 4NYZA 3W5ZA 3CCES 5KFVA 4CLLA 1CJKB 3HD1A 4F3OA 5LSLA 2HVIA 4NLRA 3UD5A 3AXKA 3CXCR 2OHDA 4ES3A 2DNMA 4M5DB 2CIMA 5F3TA 1I3OB 1Q8LA 3Q23A 4J9RA 2VBXA 1TKXB 1FEEA 1Y00A 1VQOS 5J2NA 2N4CA 3PXGa 2ROEA 4IQMA 5HP1A 2PEHA 3F41A 3M9MB 3BM7A 3G82B 4OHZA 4ZHRB 2AMCB 2FJEB 3D1HA 5KG5A 3CC7S 1YQHA 3DM2A 3KLGB 1H38A 5HO4A 1BQNB 4CH1A 1FXRA 4PQUA 4M8LA 2KI2A 4GKKF 2EI5A 2XLIA 1C1CA 2ERRA 3OT9A 1TL1B 4U95A 1S0OA 3M6UA 4RW7B 3SSSA 1NSKL 2GA7A 3V81A 4ICLB 4PUOB 4OJGA 4O3NA 1X0PA 1TP7A 4DL7A 3QAEA 4S0MA 5AT1B 5FD1A 3PW4A 4M5LA 1VCTA 3C6TA 5KFOA 2DIVA 1QE1B 3SV4A 2W24A 4FDFA 2B5JB 1IWAA 4CNYA 3UN2A 1UKUA 4LRFA 3FQKA 2JZ5A 1IBKJ 2XMMA 4CM0A 3MPUB 1S79A 5HLFA 3BR8A 4LF5F 5EX0A 2UXCJ 3PRVA 2HWIA 2W2OP 1RWKB 2BJ9A 4ETXA 4DL2A 1C2PA 4RW9B 3P96A 1S9EB 3AA8A 4BS2A 1YLXA 3KJQB 4C11A 4LFBF 1YHQS 3PJXA 2I9SA 1UPMB 4DR7F 4WKRA 4EYHB 3Q0AA 1CG2A 1HMVB 4F3QA 1QTMA 1M5PC 2QT7A 3G9CA 2YH1A 1HL6A 1NKEA 4OHWA 4DV5F 3GIKA 4I7FA 2C3UA 3KK1A 4P9SA 4DV1J 2AYMA 2CNNB 2DKOB 3RUBL 1N36J 3HDSA 2DGUA 4ECZA 4LRAA 3CCWA 2KHCA 3MUTP 3BGUA 4DQPA 2VQFF 1FJGF 3L3CA 3M4XA 3Q2TC 3K17A 1FKPA 3ETOA 2ZOMA 3DMJB 3H2VE 3CCSS 1BXNA 4I6AA 1MG7A 5CCMA 4QWCA 3MUMP 4NMLA 2JLEA 4QOTA 4N47A 2G0CA 4ZLLA 1RT6A 2ZDOA 1RAOA 1VJQA 3NCPA 3GV8B 4USKA 4I6WA 2DY9A 4DPXA 3A8JA 3OLBA 2P2CB 4AD6A 4V19J 2R8JA 2Z56B 2MZSA 3J7A1 4OV1A 4UOGA 2XWYA 3PACA 3RRGA 2E29A 3UNGC 3V2UC 2KRBA 1KVKA 3QGGA 4J9MA 2D3OR 3DOLB 3HP6A 4YOEA 2E7VA 1FI4A 3KHLA 1VS3A 1KR4A 5K14A 3CTRA 3LAKA 1PYSB 2QSFA 2N7CA 4NE9C 5E7OB 4C8OA 2GZOA 4IG0A 4OHVA 3VGUA 1S1VA 4HYKA 3J80Y 1LK7A 3DI6A 2XEXA 3GSDA 2FHKA 2PI4A 3KNGA 3PFOA 5IWAF 4IQXA 3DXBA 3HKZD 3KUEA 4WKYA 1L3VA 4P10A 2DEJA 5ETPA 4CLWA 1S9GA 3PYGA 2OD4A 2W9CB 2KL8A 2UZAA 3CD0A 2QFIA 4HH0A 1YZ6A 3O8WA 4N8OA 5HATA 5KT5A 3SSQA 4KO0B 3BR9A 1U2RA 2QMXA 2FYXA 2VDHA 1RB0A 4LF4J 1CSJA 3TANA 1S4EA 1IKWA 2UVUA 1KDNA 3B54A 1JLAA 2OD6A 3RAXA 4UQGA 2M8DB 3OSNA 5GAGI 5CABA 1RTZA 3ILOA 4Q43A 1CVJA 2HHXA 2WB4A 1M1KT 1TMJA 2DCUB 3RR8A 1BGXT 1DZ5A 5F8HA 1MNEA 4JI0J 4OFZA 4X62F 4TY8B 2P6SA 4YHHF 2L08A 2MQMA 3D66A 1NJYA 3C2PA 3DGVA 4E8UA 4Q0BB 3F44A 4J9QA 4P72A 3AD7C 1FDDA 1U45A 2UUTA 1HHTP 3BQ0A 1U49A 2M88A 3BREA 3ICLA 4H54A 2AZ1A 3K0JA 4WXWA 3PW2A 2JFKA 3OHAA 3VWSA 1FKOB 2MSSA 3H25A 1NAQA 4IOCQ 3SEOA 5B0EA 1NUEA 2VF3A 1FRLA 1ZAWA 4C3MA 1S76D 3LP0A 3P45B 4PCQA 4DL4A 3MM6B 2KJVA 2IM1A 4DEZA 2W4DA 1UWAA 1HI0P 1MW7A 1X7VA 2VA3A 1AA1B 2F1FA 1EHWA 1N34F 4X4TA 3GG0A 4QWBA 1WNEA 1MWYA 3KLFB 4F4ZA 2J8SA 4IH5A 4DR4F 4X2BA 4JI8F 4DUTA 3MMBB 2D69A 2EFQA 1RUSA 2DHHA 1NB7A 2FVRA 1T7PA 1FX4A 3HULA 1VHIA 4ZCMA 2V9WA 5GAEU 2XSJA 3O44A 1B64A 3W66A 1E6VA 4ZKAA 3VGVA 4Z2XA 1N6QA 4NCGB 1SUQB 4DV3J 1VGYA 5I4MA 3TZWA 1SL2A 4OX9F 2DXEA 2XMVA 3GQCA 4E98A 4LMZA 2HQIA 3K5PA 5EN1A 3BKTA 3H4BA 3C19A 1O0PA 2XYGB 1UVLA 2VODA 4LUBA 2AEMA 4UY8T 2E44A 2VHGA 2LQ8A 1KFSA 3BGRA 1BC6A 2R7WA 2DISA 3AH6A 1Y5IB 1YX2A 1YBTA 3P3DA 2I6WA 1FVQA 4AXJA 3GR1A 4JI3J 2M5YA 2ZD1A 4A8WA 3E2EA 1S1XB 3EICA 3C3LA 4PZVA 1AB8A 3JAMY 4B9SA 2XMJA 4LF1A 2DPIA 4Y0FA 2D1CA 4HEA9 1NPRA 2HEKA 4TU8A 4RNHA 3SDEB 4ECWA 2W7OA 1X4BA 4OJ3A 2ZOFA 3NNCA 4ER8A 5HANA 4A8QA 1IXKA 2CG4A 1HBOA 5LJ3Y 5A8WA 3DC2A 5K9FA 3NGDA 3AODA 1RT1B 4DX7A 4B17A 3W63A 2LLZA 1U48A 4A8KA 3D54A 3I5BA 1J27A 1KS2A 1R8CA 2WONA 2BKNA 3QNWB 5CYQA 2FHOB 2FLNA 2Y1IA 1FJ7A 2DH8A 4DU8A 3MURP 2KYZA 3IR5B 4FYVB 1HNXJ 4F36A 2HVEA 3KG1A 1K47A 1OQ6A 4R0EA 2FHMA 3JQMA 1D3WA 2QGFB 3D1QA 3IBWA 5LMUF 3ZTOA 1NDCA 4RO0A 1PILA 2PE8A 5IC4B 4O0IA 3PZPA 1WJ9A 3ELHA 1IN0A 1X4EA 2XMAA 4ATNA 3DGPA 2DGVA 2HBZB 4G1PA 2QIFA 2AJ2A 4DCOB 3SYZA 2W8KA 1U25A 4EYIB 2RRAA 1LWEA 2Y0BB 4QQBA 1NDPA 4U8YA 4UZBA 4JI4J 2IA0A 1IKXB 3BGFA 4CO3A 4LFAJ 2G0JA 4J9NA 1R27B 3ILJA 1F5AA 2LQ5A 1VI7A 1WOSA 4E0DA 3EGVA 2LYVA 4A8MP 2HW3A 5CD4A 1I6JA 1GXTA 1YK9A 2W9BA 2NQPA 3MAHA 4KTQA 4DDFA 1WOOA 2V2QA 1TL7A 5BJRA 3M8QA 1X4GA 5F8NA 1FK9A 9ATCB 2AEFA 2FDNA 2HK3A 4PWWA 2UVVA 4CQ1A 2IFXA 1IM6A 4CWBA 5C24A 2GMHA 2XMWA 4DG1B 4H4OB 4XO0A 3K8VA 3EXCX 4CYUA 2XZDB 2Z58B 1NHKL 2GS8A 3CEDA 3TVZA 5M2UA 4EU0A 3S1TA 5F9LA 4CLPA 2Y1JA 5DDRC 4FNHA 2YQ3A 1WC4A 5AXLA 1IR2A 1RHMB 4J9UE 3AY0A 1S10A 1SQGA 5FLXY 4XPCA 5AJ3J 4EFAC 1NLKL 2KHDA 4YY3J 2YWFA 5I3UA 3D2WA 3KG0A 2MMYA 4F0MA 1R0AA 3TJ8A 1REVB 1H74A 4C0BA 2HAFA 1KTVA 4ILLA 1WC0A 3ZFVA 4I56A 5M2PA 4ZP8A 2HAIA 4ZVGA 4ECRA 3BN4A 3NKYA 5KAKA 4ZJQA 4WFXA 3GIJA 3BH6B 3BO2A 1RZMA 3UDVA 1KKHA 1NSPA 2J7KA 2MQNA 3SCJE 5ETLA 3R8YA 3SQGA 1PJ5A 1AUSL 1RTHB 2RRNA 4W4MA 3T6JA 2GGPA 2ZBRA 3D7SB 3MHYA 1AFJA 1NJWA 2M9KA 3UQSA 1BWEA 3UCUP 2AF6A 1RI7A 1HWJA 3FBFA 1F60B 2UUBJ 3QT8A 2BEFA 3TVYA 1TL3B 3MD1A 4HI2A 3PR4A 5IQ6A 3HVTA 4JI5J 2OI2A 1SIZA 4B9MA 5LT5A 1JJHA 1FESA 5GVQA 3KMQA 1WHVA 3BO3A 1FDAA 2PC6A 3EZUA 1GTEA 1XMQF 2DY1A 4KT0C 5IT4A 4RW6B 3T1YF 1YSJA 4EBCA 1D8ZA 3CW2C 2WRMA 2ZZTA 7FDRA 1S9FA 5JVHQ 2Y1RI 3E01B 4CLKA 2DNNA 1VRTB 5A76A 2OIHA 3CD6S 2YWHA 3X1LB 2JNJA 2ZJRQ 5T7LB 1Q8KA 4OYIA 1LFPA 3WDOA 5KT7A 2ZBCA 1PC4A 3B4MA 1XMOJ 1T9WA 3FGVA 2FZGB 1HI8A 2BVZA 1D9FA 2DH9A 3W3SA 1GXLA 2WVFA 2YKQA 1Q8IA 4U67Q 1OS5A 2HVZA 3TUIC 5CYMB 5CD4H 2NREA 1JLFA 1RYSA 1ICEB 5G4DA 3MPWA 3B82A 1RT2B 1JNRB 3QRPA 1V3SA 3DLLQ 2CNKB 2OFGX 3S01A 2YNHA 4PXCA 1T03A 2HGLA 5KFWA 1S6OA 3ETMA 1FT8A 3IR6B 3G6ES 2BRKA 3KK3A 1KQSR 1UWBB 1KQKA 2IVMA 1I1GA 2UUCF 5L1KA 2FLLA 2DNPA 2FJDB 1HQEB 4OL8A 1T9TA 3T5HA 1HYSA 4OZ1A 4B3SJ 5DG9A 2XSFA 1TV6B 4WP9A 1J5OB 2QE5A 4YEAA 1U8SA 2ZE2A 3TOQA 3DCAA 2R4FA 1SJRA 3R5GA 3HHLA 2CQ4A 4DSFA 3D0GE 1U1KA 1CJUB 2ZDPA 2FTRA 4J37A 4PWDB 4D3HA 1CS4A 2XMTA 3AB2B 5DZ7A 1CJTA 2ZKUA 2M8HA 2QL9B 3AJ2A 2MY8A 5J1NA 5HQ8A 3MECA 1FXDA 3BGLA 2DHXA 1Q7YT 1D9DA 5GAHI 3D5MA 4GC6A 4DHVA 2B51A 3V4MA 3R1LA 3OR2B 1RAIB 3R2CJ 5E3CA 2GJFA 1K0TA 1IJFB 2HFUA 4K4YA 5J2QB 4KR0B 3GONA 2YKAA 2Q43A 2V50A 1C0UA 4CLYA 2ZC4A 2J8AA 4LSNB 4DBQA 4O4GA 5L38A 2BKOA 1VRUB 3R1HA 3A4TA 2X7IA 1KRPA 3M2RB 3HD2A 3NOGA 3NCRA 4Q44A 2JVRA 5JXSA 4B9UA 2QJ3A 1VOMA 5EUHA 2MQOA 2XNQA 1QLNA 2ADCA 3L09A 4NI2B 4F4AA 1K1QA 4JV5J 1YBUA 1ZETA 1EARA 4FVCA 3W8PA 1VRQC 1UCNA 4MYUA 2XG8A 5FDLA 3JSBA 3M8WA 3OFGA 2A6MA 4JBCA 1WC1A 2I1RA 3FBBA 4OI0A 2VKRA 4B9TA 3Q8VA 2HMIA 3H98A 3M1VB 5FJ4A 3HFZB 2K1RA 1Q0NA 2H51B 2XMUA 1NJXA 1TKZB 4K5RA 2RF2B 4OZJA 2KXFA 4DMZA 1Q95G 1RTDB 3H5XA 4GKKJ 2Z2LA 2DNLA 4MIAA 1FO1A 2WTFA 2Z8QA 1NKCA 3W62A 2ZZNA 2AYGA 2RHQB 5HQMA 2RE1A 2OELA 3KLHB 1NK6A 1V3ZA 2JWNA 1DTTB 3MMJA 5DETA 5IV3A 3QFHA 5C25A 4J9SA 5IT9Y 2QMWA 4EUVA 2OTJS 4CO4A 1JLEB 3GSIA 3E51A 4ZP7A 4X65J 4F67A 1TZ0A 1SJQA 3W9IA 3I9ZA 4XDCA 4YR0A 3CD5A 3CDEA 3CWJA 2DITA 5KFJA 4WU2A 1EQ0A 1S5ZA 3POTA 1RYRA 1B3TA 2QRRA 2GVDB 4LFBJ 5AXNA 4CZCA 1X8DA 4AQYF 2EK1A 2NCKL 4K59A 2RILA 1RHKB 3K59A 4U6PA 2IC3A 3QT7A 2K2PA 3MCSA 3CJ0A 3CO9A 4KFBA 2HHHJ 2V94A 2FJBB 4KRWA 1QUPA 1RT4B 3LP1B 2JX2A 2Q6CA 4M5MA 3MTJA 4ZVFA 3NOCA 4OLPA 3QWPA 4LF6F 2HNYB 3DOMB 3MZIA 2I0XA 3MFIA 2YNGB 2UXBF 2VU5A 4ECVA 1H2UX 2BOAA 2DEIA 3J81j 1RWVB 1UPPA 3KJVA 2VBYA 5HJYA 3D3CJ 3TRGA 3NAHA 3PCOB 2MZ1A 1RWOB 3VGSA 3KHHA 4RU2A 3QIDA 2HFOA 3DFEA 3IG1B 3NWRA 2OTLS 2VFUA 1NJIT 1WOPA 2DR9A 4C98A 2DNRA 3QQCD 1KVJA 1EP4B 1X4FA 3I0RB 3FMBA 1HNZF 2QLJB 4ZVEA 4X4PA 1YZ7A 1L3KA 3R97A 3W65A 3PEJA 4ZVOB 1FERA 1P27B 4I67A 2QFJA 3UDLA 5ITHA 3CJ8A 2F4VJ 1CC8A 2G2ZA 2LA6A 1Y9OA 2QA1A 8ATCB 1HD1A 2R7QA 3FEXB 1T9VA 1J5EF 4J91A 5DO2A 1WG5A 2IRUA 4Q2MA 3NS5A 5HBMB 1N5SA 3TZYA 2MTLA 3ITHA 3G2XA 1M1HA 2H9ZA 3ZNJ1 1JMTA 2DCLA 3W5YA 1RAFB 3LP2A 2FLPA 5KFLA 1FD2A 3WBZA 2XNRA 4NLDA 5MLCV 3GWCA 3D6FB 2OPSA 2E5JA 4O4RA 1X4HA 2VG5A 2L48A 2W7AA 5KFMA 3I0SB 4DSIA 5KG7A 3D0HE 2ZH2A 2V4QA 2J5AA 4N7TA 5B08A 1KP6A 3BB5A 4KE5A 1JKHB 1N48A 3B78A 3RRHA 3KK2A 2KTQA 4UOHA 3JYTA 1HNVA 1Y5LB 3BSOA 1ZM4A 4NLSA 4Z7CA 1P1LA 2HZAA 4WTYA 1U24A 3SBMA 2YPYA 4JI1F 5EHHA 3I5CA 5GAEI 3R5BA 3RTVA 2NSCA 2P9EA 2FVCA 1O5JA 2R7XA 4ZA1A 5ETRA 4R8UB 2BJDA 1VQ6S 2L9DA 2CQPA 1R0CB 4ZITA 3EUNA 2E9TA 1AZSB 4DR3J 3PX6A 2F65A 5KFZA 4PRFA 1RGVA 1BD6A 3NGKA 4JV2A 3OTOJ 2CJAA 4PG5A 1N0VC 3SCIE 3FMWA 1LWCA 4A8YA 2IAJB 1RT3A 1D0EA 1N56A 1BMQB 1WSRA 5LL6d 1H72C 1TVRA 3HT3A 4PG4A 1U0SA 4ECQA 1S6PA 2AHOB 5JMNA 3JSYA 3TEHB 4O44B 3C14A 3M6XA 1BY9A 1UMJA 3M8ZA 1OSDA 1UJ5A 4OHYA 1T05A 1WTFA 2F9DA 3W64A 1OY6A 4RW4A 5G0RA 3GV5B 2CPJA 1UVKA 2BANA 4J9KA 2JC0A 2FZKB 2XLKA 1AW0A 2V8HA 1RXOB 2Z2YB 1XEZA 3TWZA 1JLGA 2WCXA 2HS4A 4ZIVA 4J9PA 1GTHA 5HP1B 4ID5A 4C97A 2FQQB 1WORA 4PWUA 1XWLA 4KYZA 4B3OB 1HPZA 1WACA 5D4NA 4DR4J 1IBLF 4ZDNA 3FJ2A 1IKVA 2OFHX 2R7RA 4HI1A 5F8MA 3DM2B 3JSMA 2BOPA 2MKCA 3CJKA 5C42A 3H5SA 4PQUB 2AD9A 1R8HA 4KY3A 4B3MF 2J7WA 2ZITA 1WG4A 2A2DA 2JJ4D 4MFBA 2C3OA 2R8IA 2ZFHA 3QIPA 3FUYA 4WE1B 3V81B 2ZKTA 3D3BJ 3OFFA 4I2QB 4M94A 1SC3B 2YKNA 1RWUA 1IKYA 4C3KA 1G3OA 1SL0A 5GADU 3V6DA 5F8JA 4KH1B 3QO9A 2B8QA 3W60A 3EVOA 4FS1A 4DPUA 1NK7A 1ZTTA 5HLFB 2BKPA 1PCAA 1XTZA 1V3RA 2MZJA 2YKMA 1DTQA 1UVIA 1AROP 4OX8A 1Y3JA 4DJBA 5J2PB 2R42A 2LQ9A 3HMJG 2CPXA 1JJ4A 4DV2J 1Q5YA 1DRZA 1RA7A 3V4IA 3RBZA 4HTIA 4LREA 1UA0A 5HMXA 1F9FA 4DFKA 2WW4A 2B8PA 4Y2MA 2Q79A 3VVTA 4FF4A 3LGMA 5DM7Q 2CPYA 3EPGA 5KFYA 1NBEB 3CE8A 3J81Y 2BZ2A 3V5RA 5DG7A 1TQLA 5CH7B 1KEKA 2DR8A 2O1PA 1U09A 1HW9A 3PYDA 2QX0A 4USVA 4B3RF 5IV4A 3FRYA 4X66J 3TAMA 4IO9Q 1N0UA 4LRCA 4DN9A 2MB0B 3OQ2A 4UY85 2ALZA 2R7TA 3LALA 4LQ9A 3RYLA 3H40A 4FYXB 5LMUJ 2E1MC 1FNMA 2HNDB 1T9YA 3W5XA 3AFGA 2IVYA 1N33J 3FSYA 4NXMJ 3GJTB 4JI6J 2O66A 3PKYA 2OEMA 3HSZA 2VG6A 3IWLA 2EEYA 3G8SA 2RU9A 4QYRA 3MCMA 4JB8B 3M32A 2HIYA 4QCLA 2IRYA 3IFEA 1T8EA 2J6TA 1S1WB 2W2MP 4CO5A 3QRQA 3UN3A 3TJ9A 3CC2S 3MR7A 2I5JA 4M1KA 4ZVHA 5KT3A 5GMDA 4F02A 3OV7A 4PAAA 3KOAA 1ZM2A 3EZOA 4Y2KA 3BDPA 1R89A 3PRBA 4BC9A 1WKLA 4P6QA 2DNGA 1Y3KA 2V34A 4F50A 1RA6A 2DVIA 4I1TA 1IR0A 2QLFB 5E5NA 4DR5F 5KFXA 4C8ZA 1WKKA 1MWZA 5MAOA 3GPAA 4A48A 3LH2S 3UNYA 2IM0A 2IPOB 2ZH6A 2RDDA 1OIAA 3N0VA 1M90T 2B6AB 2F8HA 3W9HA 3MR3A 2Z2ZA 1CJVA 2LXFA 4WCEQ 4DV6J 4WK1A 2ZJPQ 2UXDF 1EZZB 3G87A 5ADZA 1KTQA 2E5LF 1D9AA 3HJVA 1DURA 2VOOA 5GAGU 2YY3A 5A2QU 3JS9A 4ZJOA 2XC9A 4ZLPA 1NK0A 5J2MB 3KLIA 2E1RA 5BXIA 1F3FA 4LFCJ 2HG4A 3EDQB 2E5GA 2VPZB 5DQIA 4H4MA 5A8RB 3TUPA 2NR0A 4MK9A 5DDOC 2DNZA 1CJKA 5H9FJ 2BV3A 3ISNC 2FD2A 1F5BA 1UJ6A 2LP4A 1CQMA 3Q8UA 4C8YA 4DV4J 2RDJA 2XY7A 1U2FA 2NXCA 2HHWA 3NG8A 1X4DA 3G82A 1YITS 4V1Ak 4EI2A 2HBYB 4LF8F 2NUHA 4Q8EA 4ZHRA 2D7SA 5FIIA 5KFCA 4CLSA 5D15A 2W4PA 1RJJA 3KLGA 1RHRB 4NMXA 3PHEA 3DKDA 1FRMA 1S48A 3K5NA 4LQ3A 4LBIA 5HQLA 2OPPB 5A0YA 1LKZA 3NEKA 4L6V3 1TK8A 1FCAA 2JRSA 4RW7A 5E0OA 2FPHX 3QJJA 3OBIA 4ECTA 1QJHA 1NDLA 3QSIA 5SZTA 4EZ6A 5KG2A 3LP0B 3CIMA 4ZPDA 2D74B 2DGWA 1HNIA 4NRUA 4NL5A 4DR1J 4ECUA 2QSWA 1E6YA 2RD5C 1KHWA 2NZ4A 2V2KA 4HR2A 1U1RA 2B5JA 4CRJA 1S59A 3MM8B 4L73A 4J9LA 3CCRS 4K0KJ 1BLUA 4WFYA 2OH2A 2ILYA 3D4JA 1EKRA 2UUWA 4B3TJ 3UDCA 2UU9J 3BS9A 1C1BB 4AUKA 4RW9A 4ELUA 1S9EA 2VFTA 3FFIA 1LOUA 3UVJA 5LSOA 1Q81T 2XZTB 3ONQA 1N6QB 5E3RA 2DK2A 3L7PA 7FD1A 2EFVA 2NUUG 3M8SA 4LF9F 4RR5A 4K50A 1HNWJ 3AJDA 3EXYA 4CP5A 2YKOA 5AXMA 4IRCA 2HPUA 2RH3A 1SI9A 2H3EB 1RTJB 3GFYA 2CQ1A 5ETQA 1C4AA 4H4KA 2I38A 3NCQA 4ENOA 4DSLA 1RQ0A 4YR2A 3W2WB 3BKFA 4G1QB 4KKOA 3BGRB 3LOUA 3L95X 2Z2MA 1QD1A 3CDUA 4C48A 1Z1ZA 4OLOA 3SI8A 4ANEA 5KFHA 2Q1LA 2Z57B 3KMSA 5BYRA 1M0SA 2UUCJ 3AOBA 1N5YA 1NDKA 2VBWA 1UA1A 1WHXA 5D3GB 3TP2A 3PX0A 2CPEA 3DMJA 3R5JB 3T41A 4ED5A 2FJXA 4C9DA 1CBKA 1ELOA 2D3O1 3BV8A 4DUZJ 3CF5Q 2QO3A 5LXRA 1T94A 2ZM6J 1SKWA 4OI6A 1XR6A 4GKJJ 3GTYX 1T02A 4DSJA 3O3LA 4MYTA 2Y8WA 2J6SA 3QAUA 4USHA 2JEGA 1UEKA 3RAMA 1L3SA 3H0PA 2DGTA 5F41A 1R3NA 4X4SA 1YJUA 4OZNA 1T0TV 2CWXA 2R8GA 5CYQB 2B4OA 1X9SA 1YJ9S 3DOLA 2VV5A 2V4RA 3M6WA 4IFVB 5D78A 4X4VA 2QLWA 5AE1A 3LPEA 5AE3A 2XZWA 1B70B 1T3OA 1Y11A 1MSWD 3DRSB 2MKYA 3IC1A 1NH8A 4WP8A 5KFAA 1SC4B 4KHPF 4JYAJ 3QZ8A 4ZPCA 4FF2A 3CDWA 5DG8A 3DGPB 4QYZJ 3DOKA 5CA5A 4ECXA 3OXFA 4BWMA 1OWXA 4F25A 2W9CA 3CUNA 1FJCA 4WWSA 4R5PB 4YUDA 4FYYB 1D09B 2ZWPA 1ZPVA 1JQGA 1WC3A 2M3DA 4PQAA 1YJRA 5M2RA 3AOCA 3OJUA 4K4TA 3FEYB 5DJBA 4IDKA 4KO0A 3ZZ0A 3K89A 1FE0A 2CVIA 3PYEA 3ZZTA 3RW7A 2XY5A 3MEKA 2H5EA 3J7YI 2IJFA 2D41A 1H0HB 1YTYA 2AJQA 2HQCA 2HBRB 3A8KA 4DOZA 4GO7X 1RAHB 3L7UA 4DL0C 3TJAA 1CQNA 1Y5NB 1K44A 4HLBA 1RT5A 4TY8A 4Z7YA 2ATCB 4CIOA 2B0GA 4CYUB 4OZ5A 1WI6A 1ZYQA 2JFDA 4DV7F 4M5NA 4ZVQB 3M8RA 2MZQA 4WBFA 1ITPA 1FKOA 2N3OA 2KZZA 1VDHA 3Q8RB 4MAKA 4E2FB 2C2OB 3LQVA 4HTJA 3BH7B 2BMBA 3NGUA 4XK8C 2WZ1A 1IQTA 4NZ0A 1M5SA 1RWPB 4KGZB 3MM6A 2CQCA 2OMOA 2WSFC 4LVOP 2MLZA 3IBCB 1U1OA 2HRTA 4O3QA 2K06A 2DIUA 4KC5A 1M1GA 1Q53A 3KLFA 1IBMJ 3LWMA 4UF4A 3T6BA 3MMBA 2IVFB 2YXLA 1S7HA 1N5TA 1HFEL 2CYYA 2RS2A 4Q7AA 3K5MA 3S8SA 1NK5A 1VFJA 3MD3A 3ADAC 3HHLC 3B4DA 4KPYA 5KT2A 3DLKA 3M2UB 2R2RA 4JI2J 2J9CA 3MOJB 4NCGA 1CC7A 3U02A 1SUQA 6AT1B 1N4LA 4YB6A 4NYOA 3HVTB 6FDRA 5F8LA 4RNFA 1X9MA 2YWEA 5IFMA 3OUYB 1RSCA 1VIOA 2LU2A 1SH2A 5LMNJ 1YRTA 1EKSA 3C15B 1FXLA 3ZZRA 3TI0A 3PW5A 1FRKA 2OO4A 1DQAA 3UI3A 3J80U 2VG7B 2GAHC 4F2RA 1RBLA 3FK4A 3FZ2A 1IBKF 4PR6A 4U7CA 3SZ2A 5BR8F 2UXCF 3MM7B 3OPKA 1RLCL 3W9JA 3OFEA 4NLPA 3X3UA 2OKQA 2IMOA 4A46A 1SJ3P 2LVWA 3GV7B 1SKRA 1J5EJ 4WIIA 3SDEA 1URRA 3OHBA 2HHPA 4DX8H 1LW2B 5EDWA 1VQPS 2VKZG 3P5TL 2AWZA 2R3VA 1VQMS 1JJ2R 1IJEB 3QGHA 4QR2A 3M2VA 1NSAA 4JI7J 3N79A 2G2YA 3MEGB 1T11A 4NPOA 3TA0A 1HARA 4M5IA 3KHGA 4DV1F 2HFZA 3KFWX 4ID8A 3RB3A 4V19X 2F8EX 2YNHB 2PDAA 1T03B 2EC0A 2J9EA 1N36F 5KG1A 1KVIA 3MMAB 2IYIA 2V63A 2MLXA 3OVAA 3DHXA 2IDEA 3KK3B 3AAWB 2XYPB 1KOHA 2KM8C 4Y34A 2O3DA 2AX1A 5KFRA 3CIZA 5K8PA 4RNNA 5EGYA 4CM2A 3EE3A 3OTEA 2KRRA 3PDNA 1W26A 3AD8C 3F73A 2PA3A 4TLQA 4AE5A 1FWKA 2CQ2A 5GAHU 3D0IE 1R0BG 1FDBA 4MKVA 4OX7A 3QJPA 2CPFA 4K4ZA 1JLQB 3RU0A 4GVBB 1JLCA 2V4JB 2QG9B 3TO8A 3TQ1A 3R6LB 3QWUA 1IKXA 1NKBA 3QMQA 3EGWB 1CJTB 2KXNB 3WC0A 1YG0A 4DL6A 2HGNA 3NGTA 1TR0A 2J9DA 1PGZA 4DF4A 5GADI 3V6JA 2DHGA 1FRJA 5HMWA 4ED8A 2LEPA 3MFHA 3UN5A 1NRKA 4F4WA 2JL9A 2VJUA 2PEBA 3MI7X 1U1QA 3GYXB 3HPOA 2C28A 3IBFB 1C0UB 1LW0B 1JNZB 2V8GA 1KLMB 4HL9A 4DFPA 3GCXP 3SSRA 3PTWA 2N3LA 4K4SA 4URQU 2MPUA 2HHSA 4DG1A 3F56A 2EK6A 1KQGB 1VQ4S 1V5VA 3KTQA 3NNAA 1FDNA 3G8TA 2UUAJ 4HDGA 2G9OA 2R7UA 2OPQB 2V67A 4CLFA 4L3NA 5H9FK 2POKA 2OSRA 1UTAA 4F0KA 3ENQA 3GYGA 2HZVA 1X9WA 1X0FA 2V8PA 1KWMA 5T41A 1S0NA 1EETB 1UL3A 3NS7B 4JP8A 2CJKA 4LF4F 3DLGB 1PYTA 4F8RA 4UTGA 1UAWA 5KG3A 1XQIA 3R5AA 3CJTA 2QYGA 3MR5A 4ZJLA 2CJXB 4MKBA 1HHSA 3AJ1A 5DGAA 1TMMA 1PYOB 3JAMU 2LCWA 2CDQA 2K1RB 5KFBA 1NEEA 5F9NA 1H98A 2BJ7A 1UFKA 2AKWB 2CQ0A 4PYDA 1MN7A 2HKEA 4JI0F 3Q8QB 4B3MJ 1GH8A 4FXWA 2OPRB 2EFOA 4KSEB 3OLAA 1HHQA 4DV0J 4HVZA 2CPIA 3M8PB 2HHQA 2CJ9A 1R7IA 2KJWA 1YJWS 1RTHA 3SFGA 1LWFB 2VFRA 3JQKA 4ZOSA 2BJ1A 2YX4A 4G3IA 1FNXH 4C0OC 1OY8A 4QR0A 5L46A 4J9VA 3VAGA 1RAAB 1RP5A 1TL3A 5KFQA 4DX6A 5HVHA 2AJ4A 4AYBD 1I5OB 1XR5A 3WIVA 3FVYA 4NCAA 4KB7A 2DJWA 2QLBB 3CJ2A 1G2EA 2OEJA 1L5UA 2DR5A 1YBAA 2DBBA 1UZHA 5HMYA 4DQIA 3CO0P 1YJTA 3POTB 4RW6A 1RWNB 1N88A 4CH0S 1DJ0A 2HBQB 3B8HA 3UWTA 4A8OA 1RT7B 1GEHA 2IRXA 2WW8A 2JC1A 4PABA 4Q8FA 3ZZYA 3MXHP 4RBUA 1T9XA 2IC3B 4ZLJA 3E01A 5KT4A 1H7WA 4OI4A 2WVEA 2BJ3A 2BQUA 3IGVA 4NOHA 3IMQJ 4O3OA 2GX8A 3RR7A 2MQ8A 2GQ2A 3BSNA 5T7LA 4B9NA 2LU1A 3I87A 3RG6A 4C8MA 1FA0A 2GO8A 3CJQA 2A2CA 3WX4A 4DV3F 4NLTA 2B4VA 5B0FA 2D9PA 1FHTA 3KJVB 1HWKA 3UR3C 5KTQA 5D0EA 4NXNJ 2KXHA 1P9QC 4WJBA 2O01C 5CYMA 2B9WA 3EGNA 3A8IA 4OYOA 1NPPA 4RW8B 3I55S 4OYAA 1RT2A 4GC7A 2C2KB 4TQRA 2AX0A 2XLJA 1MWQA 5H9EJ 1KNZA 2YH0A 2HZCA 4WFAQ 3LA0A 4ZN1A 4W90B 4JI3F 1UWBA 3CJ3A 1KFDA 4DL5A 4YS2A 4CO1A 1HQEA 2MZTA 2FVPA 3TUZC 2J0SD 1J5OA 3CCQS 3NBPB 2DR7A 2HRUA 2MXYA 3PEHA 1RADB 5FLXU 4F4KA 2ZNYA 3R7BB 3HI9A 1U0HB 3TQEA 1FWLA 4P71A 3VTIA 1GFWB 2K3IA 3QRRA 3OR1A 2LXIA 4M5GA 2GCFA 2A18A 1NZAA 2VQEJ 1Y4ZB 3KDNA 4OYMA 4PWDA 3ZC4A 3MMCB 1KC8T 3DXSX 2X3GA 1NK8A 4ELVA 1QAJA 5CAAA 2XCPA 3MCNA 1HBNB 2EW9A 1HLWA 2DRDA 2OPSB 4XAKA 2COLA 2W2QP 1XN9A 2VG5B 1TUVA 1MROB 1RTIA 3R5CA 4RKUC 4KJIA 3EZ5A 4YQWA 5D0RA 4UZCA 1LFWA 2BJEA 2HHTA 3OR2A 3CJRA 3TNVA 5K5MA 3G6YA 3VV2B 1Q7LB 4MKAA 1TELA 4QYZK 5CYJA 2EG1A 2C2ZB 3PJWA 3I6PA 1TKTA 2V0NA 2AW0A 4QIFA 1QY7A 2OGUA 2X1AA 4XTTA 2ACYA 1SJ1A 3PG9A 4DSEA 2EFGA 1VRUA 2V6AA 3T1HJ 1GX5A 3M2RA 2BABA 4KHMA 3W8GA 2FGCA 4NI2A 3RZAA 1TUWA 2BRLA 3EWGA 4JI4F 2KN4A 2PT0A 1WHYA 4LFAF 5E2QA 2C22A 1ZAXA 2HHVA 4PKDB 2C3MA 2Y8YA 4KIAA 2UP1A 1WUUA 2N7YA 1ZS6A 4RNOA 1UETA 4Q45A 3N9UC 3GR0A 1RT3B 1U26A 4ZPAA 5E3AA 5IM0A 1FVSA 1VBZA 1TKZA 2RF2A 1BHNA 2WVCA 4N77A 1RTDA 2XHCA 3V6KA 2HFVA 4DS4A 4GO5X 4LRDA 2Z4PA 4B02A 3R27A 5L1IA 3C14B 4YR3A 5C2GA 2HVHA 2DNYA 4F4YA 3SCLE 3D9BA 4M95A 4RW4B 3TUJC 2E9ZA 1XMBA 4OMFG 4I69A 3KLHA 4NCBA 4IKAA 3K5OA 5KT6A 3T5LA 2A10A 1JXVA 5EX3A 2AQ4A 1RU1A 5AJ3F 1M5OC 2D9OA 3ENVA 3N6NA 2H5JB 4NEZA 4HACA 4YY3F 5KOXA 1K1SA 1KONA 4X64J 4LSLA 3QT6A 1HPZB 2IHR1 1JLEA 1OJ4A 3M8YA 4UOCA 4RWXA 1XR7A 4D3GA 3N28A 1N32J 4UW2A 2GVDA 5BYSA 2NSBA 3IAM9 1H7XA 1CULA 3FSXA 3GP9A 1FFGB 4OJ1A 4ZVSB 2D3ZA 3HCXA 4MFBB 3MPYA 5IXUA 4DZ6A 2NXJA 4Y2AA 3SV3A 3O1LA 3LP1A 2W2NP 1S1TA 1IKYB 2HIQA 2GV1A 2EVZA 1GK8A 4QWEA 4DLEA 4A8SA 2YNGA 1WI8A 2UUBF 3JB9k 3ILLA 3V6DB 5DZ6A 3EX7B 1AFIA 4OYBA 2FB0A 4ED7A 2ROGA 5IQQA 3ZZPA 2BM0A 4U96A 1NHUA 2YKMB 4K2JA 3UD4P 2AIRB 3DU5A 2HRYA 5CHCB 3IG1A 4QW8A 4CLTA 2NPIA 4OZ3A 1HR0J 2RKIB 1S7IA 2LEAA 3PJ9A 2DXFA 3OVBA 1SBRA 1EP4A 2J0XA 4X4NA 1TAQA 3I0RA 1TKDA 3CMES 2NXEA 3TVKA 4IG3B 4P2MA 5D6GA 4DR2J 1TL4A 4BHQA 1KSPA 1UW4A 3OVSA 2FVSA 2X1GA 4BCAA 3LGHA 1WEYA 4ZPBA 3BSCA 3ET6B 5E41A 3JTOA 2NXUA 5HVGA 3W61A 3RBEA 5KFEA 1RDRA 3GE9A 5C7PA 4DPWA 1XMOF 2RAQA 5EWEA 5IOLA 1U6ZA 1F1BB 2DNHA 1PKUA 4TXSA 3CPWR 1SJ4P 2J0QD 3UCGA 3TZXA 5KFPA 1F9HA 4C7QA 3FC9A 4I6YA 4J90A 2Q3PA 3HHEA 4LF7J 3IS9B 3G8QA 2KFYA 1F2HA 2ACMA 5B09A 3T3FA 2DNQA 2MHNA 1SC1B 1P1TA 2JLFA 2WSCC 2XBPA 3Q24A 3I0SA 4F3MA 2VG6B 4ILRA 2XO6A 1WDTA 4QPXA 3M32B 2WAQD 3THVA 1X31C 3BO4A 1FRXA 2CVEA 5E33A 1X5TA 2XMKA 1PAUB 5KG4A 3NLCA 3C16A 4J9OA 2KYXA 4B3SF 2CQBA 4HT7A 4DUYJ 2W1BA 1RACB 4QU7A 1AUDA 1YJNS 2FJWA 3AT1B 3MGJA 3QATA 2YX1A 3H42A 4EEYA 3H4DA 2J9DE 5IT9U 2JDJA 2XHWA 3CMAS 5I3PA 1H3DA 4RUHA 2HHUA 2WOMA 2K8GA 1NH7A 3THPA 1OQ3A 1M5HA 3VAFA 5DDPC 3EMTA 1KQFB 1I94J 1AZSA 4GMKA 2F9JA 2MQPA 2DXDA 3MWBA 4IH6A 3ZZZA 2YNFA 4OHXA 2BBEA 4TNOA 3AA9A 4CNZA 5B0DA 5KFGA 2R2TA 4BBYA 1WSVA 2IAJA 2AYBA 4TY9A 2MKJA 1ZBTA 1RHQB 3NP5A 4MK8A 2IBKA 2C1EB 4RUBA 3TX8A 1SV5B 3M30A 2YQ1A 3RW6A 2CPZA 4O44A 4H4MB 4WFZA 4KGVB 4H4KC 4QIWD 2RMLA 5KFUA 2K7JA 5CXTA 1B99A 3U1NA 4JV5F 3TAPA 3J7Z5 2VUGA 4AL7A 2DYAA 3HO1A 3LF0A 1U7LA 3D6HB 3CDAA 1JJCB 3HVAA 2KDOA 4OI3A 5LSRA 5U47A 1XJWB 4G6VB 4B3OA 1EJ7L 1HBUA 4PPZA 1R6YA 4WFBQ 3UE2A 1Z2LA 3VHQA 4O3SA 1TK0A 3ZTPA 3N6LA 2L41A 3FBEA 2RQMA 1S99A 2R8KA 4YB1P 4FYDA 3IRXB 5A0YB 3AQOA 3OL6A 4EO8A 1CLFA 1S49A 4CT9A 3P6YC 1PG5B 3HVWA 1K73T 4WE1A 1VIXA 3FEZA 1YJ7A 3GFHA 4I2QA 3Q83A 3VCDA 3FKBA 4DQRA 3OXGA 3VQTA 3TEGA 4ED2A 4F26A 4IFYA 1HNIB 4W92B 2GIFA 2F63A 1E6YB 4Y00A 4M5JA 1U6BA 2BR0A 5F8GA 3L4BC 2LEBA 5EWFA 5IS2A 2X51A 4OYWA 2C2EA 2BYCA 3KG4A 5BR8J 2CNLB 4PYAA 2UVRA 4X65F 2EFNA 2JSXA 5J2PA 2RS8A 1NMEB 4XIUA 3TA2A 1L3TA 1PAEX 3H8YA 3FFIB 3DNCA 1BQMB 3UVJB 2IM3A 1A0OB 1VQNS 1GMWD 4NLWA 4Y6IA 2Z0GA 2DHSA 3ISZA 3UO0A 2B56A 2K3KA 3DU6A 5I42B 2HHHF 1WF1A 2C42A 4OYZA 1OO0B 4WZQA 2R7OA 2JLGA 2HNZA 2CZ9A 2YNIB 1UVJA 2A0FB 1S57A 1VC6A 4L3KA 4PG6A 3G6VA 4KKOB 1RBOB 3DLEB 1S1UB 5HMZA 4ZPVR 4LSZB 3AXMA 2AJ0A 4J5OA 4RUAA 4ZCLA 1NJZA 1DLOA 5H9EK 4KV8B 1N5YB 4ZP9A 2LECA 1LEOA 4FYWB 5IC6B 1F6TA 2HNDA 2ZZMA 3D67A 3TYTA 1CEZA 2HLTA 2B4UA 2L9NA 3HSDA 2F4VF 2BE2B 1S1WA 1VQLS 3C6UB 2A6OA 2VBZA 2BQRA 1HBMB 3OL7A 3MEEA 4LF5J 3TAQA 1VMBA 1ACMB 4RBVA 4ED6A 1T3NA 4USWA 3MM5B 2C2RA 3PO5A 1O6XA 1UVMA 1G7CB 1IR1A 2P6TA 3I31A 3HVRA 4NA2A 3I96A 4C2MA 3QGIA 4TYAA 5B0AA 3BBFA 1ZH5A 3NAIA 2GJIA 2V9KA 4DR7J 2Q6BA 5A6WA 3M7VA 3GB0A 4ZMMA 3CCJS 1FTCA 4X4QA 3LO3A 3KUHA 3RB6A 2B6AA 3DRRB 2WBMA 4DL3A 2Y0SD 3ZTRA 2R8HA 4DV5J 3DOKB 3J7YU 4CTAB
chains in the Genus database with same CATH topology
2ZWOA 3P5BP 3WIVA 1SCJB 3WHIA 4JP8A 2Z57B 3WIUA 2PMWA 3H42A 4YN3B 1SPBP 3VHQA 4K8RA 1ITPA 3BPSP 3GCXP 2W2PP 2Z56B 3AFGA 2Z2ZA 4NMXA 4OV6A 2W2OP 3CNQP 2W2MP 2Z30B 2XTJP 1R6VA 2ZWPA 2W2NP 4NE9C 3CO0P 3BGOP 3T41A 3A3OB 3A3PB 3SQOP 1V5IB 3GCWP 3A3NB 2Z2YB 3QFHA 2QTWA 2Z58B 2E1PA 3VV2B 2W2QP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZWO A;  3P5B P;  3WIV A;  1SCJ B;  3WHI A;  4JP8 A;  2Z57 B;  3WIU A;  2PMW A;  3H42 A;  4YN3 B;  1SPB P;  3VHQ A;  4K8R A;  1ITP A;  3BPS P;  3GCX P;  2W2P P;  2Z56 B;  3AFG A;  2Z2Z A;  4NMX A;  4OV6 A;  2W2O P;  3CNQ P;  2W2M P;  2Z30 B;  2XTJ P;  1R6V A;  2ZWP A;  2W2N P;  4NE9 C;  3CO0 P;  3BGO P;  3T41 A;  3A3O B;  3A3P B;  3SQO P;  1V5I B;  3GCW P;  3A3N B;  2Z2Y B;  3QFH A;  2QTW A;  2Z58 B;  2E1P A;  3VV2 B;  2W2Q P; 
#chains in the Genus database with same CATH topology
 3PV8 A;  4EK2 A;  2O67 A;  1SCJ B;  3VVU A;  1NO8 A;  1OPZ A;  4N76 A;  1OYE A;  2C2M B;  4P2S A;  4TLR A;  5J2M A;  2MKS A;  3PHT A;  4C3L A;  4WTO B;  2YQ0 A;  2GNK A;  2HGM A;  3A3P B;  2VQF J;  2XI2 A;  1FJG J;  4BDP A;  1S12 A;  4RWW A;  4IDK B;  1VYA A;  5A8R A;  2W25 A;  3T9N A;  5KFF A;  3LW5 C;  3MR2 A;  2NS1 B;  3GLJ A;  4RL1 A;  2MGZ B;  2E5I A;  4DF8 A;  2P9C A;  2QA4 G;  1JLB B;  3GJQ B;  1XK8 A;  5CCL A;  5DRK A;  4U7U D;  4DR3 F;  1Q1K A;  1S6Q A;  2FC9 A;  3MAA A;  1C0T B;  4QR1 A;  4L75 A;  1NHV A;  3HFK A;  5KFI A;  2GHV C;  2AU0 A;  3UR0 A;  5K8M A;  1RT5 B;  3OTO F;  2VOP A;  2QA4 S;  4QWD A;  3CCV S;  1PSD A;  1FX2 A;  2BDP A;  2AYE A;  1Q8B A;  3IRW P;  8RUC A;  3ILI A;  3J81 U;  2BQ3 A;  2NYH A;  4QIV A;  5ETT A;  2VIC A;  4AFF A;  2GVZ B;  3CGI A;  2WSE C;  3BEG B;  2C3P A;  3H5Y A;  2OPP A;  1ZOT A;  4KBI A;  2IJN A;  2BW2 A;  2H4W B;  1MN9 A;  3KLE A;  2DTJ A;  2A1B A;  3AB4 B;  1QVF R;  2EG2 A;  5L8R C;  2V68 A;  4I2P B;  4L74 A;  1MU2 B;  3PO4 A;  3BKU A;  3GIM A;  2C2D A;  4FBT A;  5IWA J;  3FCW A;  5J1E B;  4PG8 A;  2HVD A;  1Y0H A;  1YRU A;  4MJK A;  4JV1 A;  3MM8 A;  5K8O A;  3PNI A;  4FXV A;  2X1B A;  2PII A;  4EBE A;  3SMZ A;  4F7V A;  5L1L A;  2B9Y A;  5ETN A;  5LXY A;  4DS5 A;  3OSP A;  3W2V B;  1C1B A;  1HQU B;  3BYP A;  5D4P A;  2IYG A;  2M7S A;  4CDI A;  2AGP A;  2GHW A;  2AGQ A;  3OTC A;  1ULR A;  4QZV B;  3DLK B;  3S6E A;  1YDL A;  4RZR A;  3KYL A;  2WHO A;  1SL1 A;  1QVG R;  2KVI A;  3DRP B;  4LIW A;  1LXJ A;  3A1Y G;  1WF2 A;  2GQQ A;  2MY7 A;  4FF3 A;  5D0G A;  5A8K B;  2KZM A;  3RJM B;  1RTJ A;  4I64 A;  2G1D A;  4X62 J;  2QV6 A;  2R2U A;  1VLY A;  4N56 A;  3R7N B;  2VFS A;  4YHH J;  3R7S B;  5T14 A;  3W2W A;  1DAR A;  4QWA A;  2C3Y A;  1Z2Z A;  2YPZ A;  1RKJ A;  4G1Q A;  3I32 A;  4KQZ A;  3MED B;  3A13 A;  1RWX B;  4PPD A;  1HW8 A;  2MKK A;  4O0N A;  2VH7 A;  2AT1 B;  3Q22 A;  2RU3 A;  2G13 A;  1QUV A;  1VIS A;  4LVN P;  1VQ9 S;  3P49 B;  1U1N A;  5D3G A;  4ZPT R;  4KGM A;  4DV2 F;  3MPD A;  4DXL A;  4USJ C;  4TQS A;  2OEK A;  2DD8 S;  2YWG A;  2ZH9 A;  1VBK A;  5J2N B;  2W01 A;  2GHP A;  4WP3 A;  3NXZ A;  1N34 J;  3CD7 A;  2ZUA A;  4UQT A;  5DLG A;  3OJS A;  4K4W A;  3JXO A;  2XGP A;  4C8N A;  3M2V B;  4JI8 J;  1VLO A;  1YWX A;  2R7V A;  1AT1 B;  3ZO7 A;  1QSY A;  3FCV A;  1LQ9 A;  5DQG A;  2RT3 A;  3HLU A;  4X4U A;  4CO2 A;  4X66 F;  3NWG A;  4IFV A;  4NX9 A;  2W4C A;  1IUJ A;  1C1C B;  2HS3 A;  4DN0 A;  2JEI A;  1QM9 A;  4ANC A;  1Q86 T;  2DPJ A;  4EZ9 A;  2KU7 A;  4G1I A;  1NCL A;  5CZV A;  3QLH A;  4L76 A;  4OX9 J;  3DRS A;  2F8M A;  3R3T A;  1S77 D;  3R5D A;  1OYD A;  1N33 F;  4NXM F;  3I4P A;  5B7W A;  1B7F A;  4JI6 F;  2EC2 A;  4YDD B;  3GCW P;  3C6T B;  5B0G A;  4PXD A;  2W8L A;  4DQQ A;  3BBB A;  1JK9 B;  1JLC B;  4R5P A;  3IN5 A;  4UST A;  3A12 A;  2IDL A;  3RB0 A;  2GML A;  3VAH A;  3MDF A;  5F0U A;  1X5S A;  4IRD A;  1W25 A;  3P4U B;  1XNR F;  1DAX A;  1IVZ A;  3CCM S;  1QAX A;  3MPV A;  1GMU A;  1B4S A;  4C11 B;  1RBA A;  2FC8 A;  3QFW A;  3SQO P;  2LFV A;  3A3N B;  1KD1 T;  5HL7 Q;  1UFL A;  2E1P A;  1LK5 A;  3EGZ A;  1HD0 A;  4F0H A;  4EWT A;  4TU9 A;  4ED4 A;  3PM9 A;  3HSG A;  4DV6 F;  4OI1 A;  2VD3 A;  4IYQ A;  1NU4 A;  4USI A;  5THW A;  1N54 B;  4I7F B;  3KK1 B;  2B7C B;  2M52 A;  3K2Y A;  4FPR A;  3AD9 C;  1IWG A;  3DYA A;  4K8R A;  1EB0 A;  4Y3C A;  3T9Z A;  1RLD A;  4IOB A;  4LFC F;  4MIW A;  2ZH1 A;  3I56 S;  4QBU A;  4FZV A;  3RB4 A;  2APO A;  3H2U B;  3R6G B;  5HRO A;  2M2B A;  4BWJ A;  4DFJ A;  1FKP B;  4KGX B;  4PEO A;  5KFK A;  2QN6 B;  1X4C A;  2XB2 D;  2BJ8 A;  4WF9 Q;  1G6B A;  1U1P A;  1T9U A;  1O51 A;  1REG X;  4DV4 F;  4WZM A;  1RT6 B;  2GQC A;  2WVD A;  2V5H G;  2FUG 9;  4TU7 A;  3VGT A;  1K8A T;  3EPI A;  5JVG Q;  3QYY A;  1H2T Z;  4ZVR B;  2E7W A;  1GXU A;  1U8W A;  2VON A;  4AND A;  2HQD A;  1ZA2 B;  2H48 B;  4TN2 A;  2HWT A;  3PVX A;  4URG A;  3MM9 A;  1RHU B;  2KH9 A;  4MKY A;  2Y3Y A;  4NLQ A;  3M2U A;  2SXL A;  2B7B B;  1WG1 A;  3ULH A;  5K14 B;  1SPB P;  2F7V A;  2R2S A;  3AOA A;  2YKP A;  1RAB B;  4IG0 B;  1S1V B;  1Z4U A;  2JOQ A;  3OUY A;  1SKU B;  3DI6 B;  3DDI A;  4LJM A;  3C15 A;  2HSE B;  2KT5 A;  2FIU A;  1UEV A;  4OX6 A;  2ASD A;  4ETZ A;  3G6X A;  2QA2 A;  1SQE A;  3P8B B;  4DR1 F;  4OJH A;  3RRK A;  5KOW A;  1FWP A;  2VG7 A;  1WHW A;  5J1P A;  1S9G B;  1QDU B;  4WYL A;  2M4M A;  2ZBI A;  3D6M B;  2PMH A;  2XM3 A;  1DY3 A;  4WIQ A;  5ETM A;  5GME A;  4CLZ A;  4K0K F;  2BA9 A;  4Q2L A;  1D8Y A;  1NZ8 A;  2JHE A;  3MM7 A;  4P2X A;  4B3T F;  2UU9 F;  1YIJ S;  2ZBP A;  4P75 A;  3KKF A;  3FSI A;  4KHR A;  3QSY B;  2PMW A;  1IKW B;  2E66 A;  1Q79 A;  1IQZ A;  1JLA B;  4OI2 A;  3W7B A;  4M5D A;  2RHS B;  3NMR A;  2ZH5 A;  2HLU A;  1SVD A;  1TKX A;  1TK5 A;  2JEF A;  1HKA A;  1HNW F;  1LW2 A;  1X5O A;  2EBE A;  3HZE A;  2KFZ A;  4J7C A;  4QPT A;  1JIH A;  2ABY A;  1QSL A;  3IM9 A;  2E1C A;  2OAU A;  3US5 A;  1UVN A;  3CSK A;  1BE4 A;  3MEG A;  2UV8 G;  2EFP A;  3U7J A;  2HUR A;  3A8E A;  3THT A;  4IR9 A;  1BQN A;  3K7R A;  4FF1 A;  5I3Q A;  3MMA A;  1XER A;  4LF2 A;  2JVO A;  1YVF A;  4MK7 A;  1T95 A;  5L39 A;  2PA8 D;  3OXL A;  2XUL A;  4AL6 A;  1TL1 A;  2GO9 A;  4R0J A;  2MDA A;  3PFE A;  1RAG B;  1TTH B;  3TX0 A;  2BXJ A;  3TA1 A;  1XNQ F;  5RUB A;  4ZK7 M;  2VPY B;  4ICL A;  3Q8P B;  4PUO A;  4MIB A;  3HHD A;  5F3Z A;  4HHH A;  8AT1 B;  4ZCI A;  2ZNZ A;  4DUZ F;  2ATL A;  4IUF A;  1XMQ J;  3OTB A;  2HWH A;  3CNQ P;  1QE1 A;  2ZM6 F;  3OR1 B;  2YWK A;  3T1Y J;  4GKJ F;  1N5V A;  1JLQ A;  1QAY A;  3RAQ A;  2F40 A;  4GVB A;  3SFU A;  1FTR A;  2LDI A;  2V4J A;  4FKY A;  1GQE A;  2NXN A;  1HI1 A;  2XGQ A;  2MLY A;  1WTB A;  4NLY A;  5LJ5 Y;  4HHU A;  1N8R T;  1RTI B;  1WC5 A;  4F04 B;  2I2Y A;  2QYC A;  2XSJ B;  1TFY A;  2LA4 A;  1E6V B;  5DQH A;  2IM2 A;  2KT3 A;  1G4C A;  3EVM A;  4OYP A;  1ZAV A;  1APS A;  5H1S V;  4FP9 A;  1O8B A;  2NZC A;  1TKT B;  1UJ4 A;  4URS A;  4TYB A;  1DHM A;  1WKJ A;  3KUG A;  1HMV A;  1LW0 A;  1FRI A;  2A3J A;  1KLM A;  4JYA F;  3HSJ A;  3BJY A;  2PI5 A;  1WEL A;  1B0T A;  3SIP B;  4DI6 A;  1V5I B;  1EAY C;  2RVJ A;  2OPQ A;  4NEY A;  4ILM A;  4IRK A;  1EX8 A;  2UVW A;  3CC4 S;  4ZPW R;  4EGL A;  2OML A;  1Q4R A;  4X4R A;  3D6T B;  3QT5 A;  1EET A;  2ZD1 B;  2HQF A;  3EJM A;  2FLO A;  2XS5 A;  4Q5V A;  2GMJ A;  3DLG A;  4P2F A;  3KLV A;  9RUB A;  3BGO P;  3C46 A;  5KG0 A;  3JTP A;  5D4L A;  2CRL A;  3IAS 9;  2PD1 A;  4YDX A;  1DQ8 A;  4OQJ A;  4YN3 B;  3HT0 A;  2IBO A;  1F5C A;  3ZNU A;  5IM0 B;  1AXQ A;  3WX8 A;  3N4W A;  1HBO B;  4KPC A;  5A8W B;  5C2C A;  4UUW A;  1YRX A;  2OPR A;  4DCJ B;  4NLX A;  1R8B A;  5DS7 A;  2M0G B;  3HHN B;  2IMW P;  3J7A N;  3M8P A;  2VA2 A;  2KKH A;  2CQ3 A;  3H20 A;  1ZZN A;  1PJ7 A;  1WDD A;  4OZL A;  4DR6 F;  2WON B;  1VQ8 S;  1BQX A;  3B6B A;  3UCZ P;  2OJ3 A;  4MTP A;  1LWF A;  2KVQ E;  4M5H A;  5KFT A;  4K4V A;  1YGY A;  2Y1L B;  2XS2 A;  3BQ2 A;  2FGO A;  3KWM A;  2DGS A;  3VAM A;  4OZ2 A;  3A3O B;  3M9N B;  1JWW A;  1FFW B;  2M70 A;  1KBR A;  4M63 A;  2BE7 D;  4ZVP B;  4HAC B;  2RUS A;  1M5K C;  1YI2 S;  4LSL B;  5HAO A;  2XS7 A;  4HHJ A;  4NWB A;  1Y10 A;  1B0V A;  3L7O A;  4AL5 A;  4DPT A;  3ISN D;  2LQB A;  2NYI A;  2I8E A;  1VBX A;  3H2L A;  3NS6 A;  2CQD A;  3DN9 A;  2FHJ A;  2CPH A;  1LWE B;  1RT7 A;  1CUL B;  2MQQ A;  1RE1 B;  3BBC A;  2QL7 B;  1KHV A;  1IBM F;  4C8K A;  4X4O A;  4FVM A;  4PG7 A;  4Y65 A;  2MJN A;  3K58 A;  2VFV A;  1S1T B;  3UPF A;  2D3U A;  1R8A A;  2W9B B;  1WC6 A;  4K4X A;  4JI2 F;  2JEJ A;  3IM8 A;  2HS0 A;  3HF5 A;  4RNM A;  3DLH A;  2WK4 A;  1TL7 B;  2CAD A;  4B9V A;  4DZD A;  3M8Q B;  3C8Y A;  4FNI A;  4ZP6 A;  1FK9 B;  3PKM A;  2EBG A;  1VQK S;  3HK2 A;  2GJ2 A;  3IR7 B;  1SJF A;  5LMN F;  4HH1 A;  3TZZ A;  4Y2I A;  3EVW A;  1JXE A;  5C24 B;  1TAU A;  2BX6 A;  3MAQ A;  2N4D A;  4Q0B A;  4RW8 A;  3F0N A;  2YX7 A;  1YJV A;  3M6V A;  3Q2S C;  4FBU A;  4HKQ A;  3SXL A;  2IIH A;  1PO6 A;  3T5K A;  4C8L A;  1V9O A;  4YME A;  1S4F A;  5D8H B;  4RU9 A;  2DRA A;  4QW9 A;  2HFS A;  4RLE A;  1MLA A;  2LMI A;  2F3J A;  2QC3 A;  1ZM9 A;  5D4O A;  5I3U B;  4CT8 A;  4L72 B;  4OZ0 A;  2IA6 A;  3TW0 A;  3GIR A;  3NBP A;  1R0A B;  2KFN A;  2FZC B;  1NXI A;  2R9L A;  1R6V A;  1R8P A;  1U0H A;  1U1M A;  4OYX A;  4NLO A;  4ZS6 A;  2OP5 A;  1K0V A;  5ETS A;  1S0M A;  2EKN A;  3HM9 A;  3MMC A;  3CUL A;  2BW7 A;  1P6T A;  2RB7 A;  2ZJQ Q;  5A6P A;  4AQY J;  4NLU A;  1QAI A;  1RAJ A;  4ELT A;  4JI7 F;  4NAS A;  2CA9 A;  1HBN A;  4MT1 A;  2QL5 B;  3SQG B;  5AXK A;  2GGP B;  1MRO A;  4DPY A;  1VQY A;  3N6M A;  3VF0 B;  4LF6 J;  3GII A;  3Q8Y A;  5ETV A;  4LIR A;  2V2V A;  2UXB J;  2ZWO A;  6FD1 A;  3KDO A;  4A4J A;  1UZD A;  2G2O A;  4JOU A;  1L3U A;  3VAI A;  4ERD A;  4K7Q A;  2PGC A;  3C16 B;  2AZ3 A;  3OW2 R;  4YB7 A;  3LGN A;  1PBA A;  2E7X A;  4FS2 A;  2MQL A;  2DGO A;  2V8D A;  3WZ0 A;  2H5I B;  2DGX A;  3NGR A;  4ZVT B;  3SCK E;  2ADB A;  3FRZ A;  3ENW A;  5D77 A;  5LM7 E;  1U4B A;  2WOM B;  3CMQ A;  2ZVI A;  3FQL A;  5KG6 A;  2CNO B;  1HNZ J;  4ZN3 A;  1LXN A;  3ENA A;  1S97 A;  1J2V A;  2EWH A;  3BSA A;  1RIS A;  3T1A A;  2H54 B;  3NRB A;  1WEX A;  4MH8 A;  1DQ9 A;  1S1X A;  1SB6 A;  4EO6 A;  1PBU A;  3FNN A;  3ZZO A;  1VC5 A;  2DO0 A;  1X5P A;  2YNF B;  3M05 A;  2AJF E;  2ILZ A;  2FY8 A;  4U8V A;  4ED0 A;  2JH3 A;  3UFC X;  3AHP A;  2GAG C;  5ETO A;  3VAL A;  3NGS A;  3T5J A;  4GRS A;  4YB5 A;  3M30 B;  4QJV A;  3FZB A;  2CAJ A;  4B08 A;  4DPO A;  1RT1 A;  3CCT A;  2XTJ P;  2MST A;  3LAM A;  3VZH A;  4IOA Q;  1JLF B;  1A6L A;  5JJB A;  2UUA F;  2J6U A;  2NLW A;  1N52 B;  1D1U A;  2J76 E;  4YFU A;  1Q5V A;  1KN6 A;  2ZOG A;  4NYP A;  4WU3 A;  2QZ8 A;  4X84 A;  1B0P A;  3ZTS A;  3C66 A;  1HYS B;  4A8X A;  1VQ7 S;  2B43 A;  3OD2 A;  1RCO B;  2RNE A;  1HBU B;  1GX6 A;  2ZE2 B;  1F3V A;  4KH0 B;  4JI1 J;  5C5J A;  1JXL A;  2G1H A;  2H4Y B;  3HHL B;  5F8I A;  3N5B A;  4R25 A;  3EDR B;  1S0V A;  1U6F A;  1HWI A;  2XI3 A;  3K8W A;  2VL1 A;  1SXL A;  3FDS A;  1IBC B;  1CS4 B;  1MMN A;  4LR8 A;  2DGQ A;  1F2G A;  5CQG A;  3PY8 A;  4TVA B;  5AE2 A;  4DV0 F;  4DU7 A;  2KO1 A;  2PN6 A;  1NM2 A;  3Q8S B;  3MEC B;  2PO4 A;  3LUY A;  2K7K A;  3T19 A;  4I68 A;  3MUV P;  4DWI A;  4HDH A;  3VR1 A;  2ZH7 A;  1BWV A;  2XWX A;  4IFY B;  3U1L A;  4Y28 C;  3PIP Q;  1R31 A;  2DH7 A;  3NY0 A;  4ES1 A;  2LDY A;  4P73 A;  3HKW A;  2IY5 B;  1MMD A;  4XDD A;  3CT9 A;  2RQ4 A;  4CH7 A;  4O4G B;  3HXM A;  2V2Z A;  3VAK A;  4P7T A;  2CXE A;  5CZX A;  4CI0 B;  2W7P A;  2P8I A;  2RKI A;  1FFS B;  4H4O A;  1OMS A;  2HK2 A;  3IO1 A;  1FNO A;  4N41 A;  1X4A A;  1ROF A;  3GMG A;  3MTK A;  2MKH A;  4TKT A;  4RJV A;  4IG3 A;  1UEU A;  1F0X A;  5FDL B;  2VAS A;  4EMD A;  3GU0 A;  3LTO A;  2XO7 A;  4N8N A;  3PYF A;  4UT4 A;  2VDI A;  2ASL A;  1QSS A;  3CJS A;  3ET6 A;  1U02 A;  1RKI A;  2CJY B;  4OV6 A;  3BDE A;  4NLV A;  2HNZ B;  1IBL J;  1REV A;  1FEH A;  3CVK A;  5D0H A;  1FF2 A;  3DRX A;  3KJF B;  1FD8 A;  2HMI B;  1UP1 A;  3GJS B;  2VPX B;  3HHL D;  2KM8 B;  2PMZ D;  1TU0 B;  3QPI A;  1TFW A;  3E3X A;  4NXN F;  3Q86 A;  2ASY A;  3AQP A;  1DLO B;  4LR7 A;  2CFX A;  3RGI A;  1U47 A;  1NPK A;  3LWL A;  3IS9 A;  4XPE A;  2B9E A;  4MMO A;  2BM1 A;  2Y9H A;  1W2I A;  3HHK A;  4FPI A;  2ZH3 A;  1I51 B;  1VC0 A;  1OY9 A;  1IM4 A;  3G86 A;  2AV5 A;  2RJZ A;  1YKW A;  1SIW B;  1HWL A;  2VC1 A;  5C25 B;  2ASJ A;  1WD6 A;  3HX9 A;  3I82 A;  2B3T B;  4JUZ A;  4CO0 A;  3BQ1 A;  3MEE B;  3D68 A;  2OSQ A;  5GMK a;  2DNO A;  3IWX A;  3H5U A;  1RCX B;  1TUG B;  2HQG A;  4NZ7 A;  4U7U K;  3TAR A;  4N5S A;  5HN0 A;  3U27 A;  1U2C A;  1XNR J;  5JUM A;  2ZUG A;  2E9R X;  2KT2 A;  2VQE F;  3GYN A;  2DT9 A;  1G1X A;  4O3P A;  2WVB A;  2O5D A;  2V8V A;  3U1M A;  2CPD A;  1OPI A;  1WF0 A;  2IJR A;  3H7H B;  4QIE A;  2PSZ A;  4KFB B;  3I9V 9;  1FRH A;  2DNK A;  4NLG A;  4CCH A;  1VRT A;  2CQH A;  1RK8 A;  3G96 A;  3UD3 P;  1SC6 A;  5DM6 Q;  4A47 A;  2RDI A;  1JB0 C;  5BYQ A;  3GZ7 A;  4LR9 A;  3GFZ A;  3BYR A;  4FKX A;  4DQS A;  4WK3 A;  1M5V C;  3JTN A;  4WXO A;  4B3R J;  1VQ5 S;  2ZBQ A;  1SV5 A;  2MJU A;  3FCH A;  1V6H A;  1NK4 A;  3CCZ A;  3V6H A;  1BUX A;  3KHR A;  1Q82 T;  4LT6 A;  3EM1 A;  5DDQ C;  4ZIW A;  2ZH8 A;  2GIQ A;  3T1H F;  4BC7 A;  3RBX A;  5KFD A;  3WHI A;  3R9L A;  5LOQ A;  4JV0 A;  1FKA F;  1SH3 A;  5HVF A;  1SKS A;  5L9X A;  1GMW A;  4ZVU B;  2ROP A;  3JQJ A;  4QIG A;  4USU A;  4B9L A;  4DCP B;  1B7Y B;  2VC0 A;  1C4C A;  4DSK A;  3IP0 A;  1S6Q B;  4GVL A;  3MAA B;  4YP3 A;  2KB2 A;  3VAJ A;  2VJV A;  2UV8 A;  1VJW A;  4RX6 A;  1HWU A;  1TV6 A;  3E8O A;  1PJ6 A;  4RUC A;  2HYI B;  3MCO A;  2C2N A;  3QBC A;  5F0W A;  3H90 A;  3BPS P;  1WWH A;  2X3D A;  4O23 A;  3OL8 A;  1S72 S;  5HI7 A;  3LPY A;  1Q16 B;  5L1J A;  1CJU A;  2G0I A;  3ITH B;  3IRX A;  1LWX A;  4K4U A;  1VHF A;  4IO1 A;  3P5B P;  3OFH A;  1Y7P A;  3LP2 B;  2FHJ D;  2WBR A;  2HQ3 A;  3KLE B;  4DR5 J;  1FE4 A;  1S6U A;  2RRB A;  3DLJ A;  3NNH A;  2CQI A;  4LRB A;  2CZV C;  2H65 B;  1VR6 A;  1KOO A;  4M5K A;  3K57 A;  3DDK A;  2VZ9 A;  2GFF A;  2L9W A;  2DHA A;  1WEZ A;  1GT8 A;  4LBP A;  2MZR A;  3GIL A;  4P74 A;  4ED1 A;  3R2D J;  1HNX F;  2E5H A;  1SQF A;  3DHW C;  2UXD J;  2LXU A;  7AT1 B;  3N01 A;  2E5L J;  5J2Q A;  4DLG A;  3G71 S;  3KK2 B;  3KJN B;  3WIU A;  2CUY A;  3CDB A;  3JYT B;  1HNV B;  1NSQ A;  3CCL S;  4X64 F;  3DLB A;  4ITS A;  4LSN A;  3VQS A;  2X1F A;  2GW8 A;  2W9A A;  3PIO Q;  2AEJ A;  3UW1 A;  2ZC3 A;  3QZ7 A;  3BF4 A;  3ZTQ A;  3CCU S;  2KG0 A;  5B0C A;  1N32 F;  1BQM A;  1N5Q A;  2EKY A;  3IGN A;  2CWK A;  3DRY A;  4C6A A;  5E3P A;  4KGK A;  1QTN B;  1K9M T;  2FVQ A;  2LQJ A;  2ZEJ A;  2AP6 A;  5I42 A;  2OLW A;  1XIQ A;  3PX4 A;  2BE9 B;  2QLX A;  2AGO A;  2U2F A;  1HIY A;  1ZZF A;  3NMA A;  4LF8 J;  5B0B A;  2U1A A;  1RU2 A;  2CKW A;  2YNI A;  1MML A;  5HSP A;  4CLU A;  2FY1 A;  1XBW A;  2P5V A;  1X60 A;  2CDR B;  1LWC B;  4I4B A;  1ZA1 B;  4AXI A;  3O6Q A;  3M1V A;  3DLE A;  3ZZU A;  4FN5 A;  3N5F A;  4Z37 A;  1S1U A;  1TVR B;  2MHE A;  2RUG A;  4K2X A;  1LV5 A;  1S6P B;  3UDE A;  3IWN C;  1ZM3 A;  4QU6 A;  2FJV A;  2G4B A;  4KV8 A;  3D28 A;  3L9Z A;  1HR0 F;  2CJB A;  1T05 B;  2RSQ A;  1XNQ J;  4I0W A;  2QMU B;  5G0R B;  5DGB A;  2E1A A;  2DB1 A;  2BAN B;  4PXE A;  1ZTW A;  3PR5 B;  2R7S A;  1JX4 A;  4DR2 F;  1DTT A;  4RBT A;  1DBD A;  2BE2 A;  1JLG B;  2PFF B;  3HZG A;  4ID5 B;  2BUN A;  4P7V A;  1GNK A;  3C6U A;  2MKI A;  5IT0 A;  1HBM A;  4OIX A;  4ECS A;  4F4X A;  4ECY A;  4ED3 A;  3GG1 A;  4USM A;  4C0H A;  1IKV B;  3MM5 A;  2ZH4 A;  4LBH A;  3JSM B;  4EBD A;  3CJK B;  3WQP A;  4HT5 A;  3CB4 A;  5C42 B;  2ZVS A;  1ZPW X;  1PC5 A;  2QEX S;  4LF9 J;  2J7U A;  4LF7 F;  4ES2 A;  3QLH B;  3QIP B;  4NRT A;  4P52 A;  5EWG A;  2H1Y A;  1RT4 A;  3BN7 A;  1SH0 A;  5HJX A;  2YKN B;  2RQC A;  5A2Q Y;  2BAC A;  3DRR A;  1GAO A;  2HNY A;  3S7R A;  3DOM A;  1U1L A;  3MR6 A;  3K5L A;  4CTA A;  3HFV A;  4NZ6 A;  1FJE B;  2Q66 A;  2GC8 A;  3QO9 B;  4O3R A;  4W98 A;  4DX5 A;  3DDN A;  3LAN A;  4JI5 F;  3VZI A;  4DUY F;  2NPF A;  2XQC A;  1DTQ B;  3J7Z T;  3BZQ A;  4Y2C A;  1VK8 A;  3CJ5 A;  1LNQ A;  1HQ2 A;  3ZXW A;  4C4W A;  1URN A;  1AYE A;  3V4I B;  3OTD A;  5SUH A;  1VQS A;  1RHJ B;  3O2I A;  5KFS A;  1Q78 A;  2MGZ A;  2PFD A;  1TL5 A;  3I5A A;  1JLB A;  4WPA A;  1I94 F;  2B9X A;  5E3Q A;  2DR6 A;  1C0T A;  5KFN A;  2CJQ A;  3M9O B;  2YTC A;  3HJF A;  1CPZ A;  4NA3 A;  3PW0 A;  4A8F A;  4KAI A;  2V69 A;  4ZCK A;  4DR6 J;  3IXQ A;  3PRD A;  1P8G A;  3G4S S;  5HBM A;  3NL0 A;  1NND A;  5ETK A;  5DLF A;  2GVZ A;  4UUX A;  3DYA B;  1UW9 A;  4ZLN A;  3EYZ A;  3TAM B;  5HK4 A;  3W1Y C;  1RWM B;  1W2B R;  2Z30 B;  1RWW B;  2F5G A;  4PXB A;  5K8N A;  1R43 A;  3CJ4 A;  2AJ1 A;  3JSR A;  5K20 B;  5HRO B;  4ALZ A;  4I2P A;  1A7G E;  4IR1 A;  4U9R A;  2KG1 A;  4KHP J;  1MU2 A;  4AT1 B;  3GFX A;  2XCA A;  1NK9 A;  2XYH B;  2DRB A;  2XY6 A;  2CG8 A;  4DFM A;  5J1E A;  2N82 B;  2YWW A;  3O5T B;  1JKH A;  1NB2 A;  1H73 A;  3H59 A;  2J0W A;  3I4H X;  2WB1 D;  2CQG A;  4G65 A;  1XC9 A;  1DFD A;  2MEW A;  2I5J B;  2F4F A;  3PW7 A;  1P9Y A;  3MOZ A;  3QJL A;  2EPI A;  1A9N B;  2EXU A;  3QGP A;  3BPD A;  1VBY A;  2RQK A;  3W2V A;  3MM9 B;  1HQU A;  1EIY B;  3WC2 A;  4FXD A;  2ZHO A;  2L3M A;  3TR5 A;  1UFW A;  2ZHA A;  2QTW A;  4R8U A;  3D1O A;  3KXD A;  1OSC A;  2ALY B;  3FBC A;  3DRP A;  4K5S A;  1RAE B;  4WFN Q;  2MYF A;  3Q89 A;  3OL9 A;  3RBD A;  2FJA B;  2VB6 A;  3GJR B;  3KNA A;  2RIJ A;  4F2S A;  5A8K A;  2OUG A;  4UOF A;  4WYW A;  2CZ4 A;  2LKZ A;  2DO4 A;  1KLN A;  3MF5 A;  3IA0 A;  2VPW B;  1CJV B;  2B4P A;  1PIE A;  5L9N A;  1H6K X;  5IZH A;  2YVS A;  2VIH A;  4DV7 J;  1EQM A;  2ZHB A;  2YBV A;  4RPF A;  1F9E B;  1H2V Z;  2HFN A;  3MED A;  1GMV A;  4BLG A;  3KLI B;  2P9G A;  2W2P P;  4NA1 A;  2GIR A;  1VK3 A;  1HA1 A;  4IH7 A;  1W7W A;  4NYZ A;  3W5Z A;  3CCE S;  5KFV A;  4CLL A;  1CJK B;  3HD1 A;  4F3O A;  5LSL A;  2HVI A;  4NLR A;  3UD5 A;  3AXK A;  3CXC R;  2OHD A;  4ES3 A;  2DNM A;  4M5D B;  2CIM A;  5F3T A;  1I3O B;  1Q8L A;  3Q23 A;  4J9R A;  2VBX A;  1TKX B;  1FEE A;  1Y00 A;  1VQO S;  5J2N A;  2N4C A;  3PXG a;  2ROE A;  4IQM A;  5HP1 A;  2PEH A;  3F41 A;  3M9M B;  3BM7 A;  3G82 B;  4OHZ A;  4ZHR B;  2AMC B;  2FJE B;  3D1H A;  5KG5 A;  3CC7 S;  1YQH A;  3DM2 A;  3KLG B;  1H38 A;  5HO4 A;  1BQN B;  4CH1 A;  1FXR A;  4PQU A;  4M8L A;  2KI2 A;  4GKK F;  2EI5 A;  2XLI A;  1C1C A;  2ERR A;  3OT9 A;  1TL1 B;  4U95 A;  1S0O A;  3M6U A;  4RW7 B;  3SSS A;  1NSK L;  2GA7 A;  3V81 A;  4ICL B;  4PUO B;  4OJG A;  4O3N A;  1X0P A;  1TP7 A;  4DL7 A;  3QAE A;  4S0M A;  5AT1 B;  5FD1 A;  3PW4 A;  4M5L A;  1VCT A;  3C6T A;  5KFO A;  2DIV A;  1QE1 B;  3SV4 A;  2W24 A;  4FDF A;  2B5J B;  1IWA A;  4CNY A;  3UN2 A;  1UKU A;  4LRF A;  3FQK A;  2JZ5 A;  1IBK J;  2XMM A;  4CM0 A;  3MPU B;  1S79 A;  5HLF A;  3BR8 A;  4LF5 F;  5EX0 A;  2UXC J;  3PRV A;  2HWI A;  2W2O P;  1RWK B;  2BJ9 A;  4ETX A;  4DL2 A;  1C2P A;  4RW9 B;  3P96 A;  1S9E B;  3AA8 A;  4BS2 A;  1YLX A;  3KJQ B;  4C11 A;  4LFB F;  1YHQ S;  3PJX A;  2I9S A;  1UPM B;  4DR7 F;  4WKR A;  4EYH B;  3Q0A A;  1CG2 A;  1HMV B;  4F3Q A;  1QTM A;  1M5P C;  2QT7 A;  3G9C A;  2YH1 A;  1HL6 A;  1NKE A;  4OHW A;  4DV5 F;  3GIK A;  4I7F A;  2C3U A;  3KK1 A;  4P9S A;  4DV1 J;  2AYM A;  2CNN B;  2DKO B;  3RUB L;  1N36 J;  3HDS A;  2DGU A;  4ECZ A;  4LRA A;  3CCW A;  2KHC A;  3MUT P;  3BGU A;  4DQP A;  2VQF F;  1FJG F;  3L3C A;  3M4X A;  3Q2T C;  3K17 A;  1FKP A;  3ETO A;  2ZOM A;  3DMJ B;  3H2V E;  3CCS S;  1BXN A;  4I6A A;  1MG7 A;  5CCM A;  4QWC A;  3MUM P;  4NML A;  2JLE A;  4QOT A;  4N47 A;  2G0C A;  4ZLL A;  1RT6 A;  2ZDO A;  1RAO A;  1VJQ A;  3NCP A;  3GV8 B;  4USK A;  4I6W A;  2DY9 A;  4DPX A;  3A8J A;  3OLB A;  2P2C B;  4AD6 A;  4V19 J;  2R8J A;  2Z56 B;  2MZS A;  3J7A 1;  4OV1 A;  4UOG A;  2XWY A;  3PAC A;  3RRG A;  2E29 A;  3UNG C;  3V2U C;  2KRB A;  1KVK A;  3QGG A;  4J9M A;  2D3O R;  3DOL B;  3HP6 A;  4YOE A;  2E7V A;  1FI4 A;  3KHL A;  1VS3 A;  1KR4 A;  5K14 A;  3CTR A;  3LAK A;  1PYS B;  2QSF A;  2N7C A;  4NE9 C;  5E7O B;  4C8O A;  2GZO A;  4IG0 A;  4OHV A;  3VGU A;  1S1V A;  4HYK A;  3J80 Y;  1LK7 A;  3DI6 A;  2XEX A;  3GSD A;  2FHK A;  2PI4 A;  3KNG A;  3PFO A;  5IWA F;  4IQX A;  3DXB A;  3HKZ D;  3KUE A;  4WKY A;  1L3V A;  4P10 A;  2DEJ A;  5ETP A;  4CLW A;  1S9G A;  3PYG A;  2OD4 A;  2W9C B;  2KL8 A;  2UZA A;  3CD0 A;  2QFI A;  4HH0 A;  1YZ6 A;  3O8W A;  4N8O A;  5HAT A;  5KT5 A;  3SSQ A;  4KO0 B;  3BR9 A;  1U2R A;  2QMX A;  2FYX A;  2VDH A;  1RB0 A;  4LF4 J;  1CSJ A;  3TAN A;  1S4E A;  1IKW A;  2UVU A;  1KDN A;  3B54 A;  1JLA A;  2OD6 A;  3RAX A;  4UQG A;  2M8D B;  3OSN A;  5GAG I;  5CAB A;  1RTZ A;  3ILO A;  4Q43 A;  1CVJ A;  2HHX A;  2WB4 A;  1M1K T;  1TMJ A;  2DCU B;  3RR8 A;  1BGX T;  1DZ5 A;  5F8H A;  1MNE A;  4JI0 J;  4OFZ A;  4X62 F;  4TY8 B;  2P6S A;  4YHH F;  2L08 A;  2MQM A;  3D66 A;  1NJY A;  3C2P A;  3DGV A;  4E8U A;  4Q0B B;  3F44 A;  4J9Q A;  4P72 A;  3AD7 C;  1FDD A;  1U45 A;  2UUT A;  1HHT P;  3BQ0 A;  1U49 A;  2M88 A;  3BRE A;  3ICL A;  4H54 A;  2AZ1 A;  3K0J A;  4WXW A;  3PW2 A;  2JFK A;  3OHA A;  3VWS A;  1FKO B;  2MSS A;  3H25 A;  1NAQ A;  4IOC Q;  3SEO A;  5B0E A;  1NUE A;  2VF3 A;  1FRL A;  1ZAW A;  4C3M A;  1S76 D;  3LP0 A;  3P45 B;  4PCQ A;  4DL4 A;  3MM6 B;  2KJV A;  2IM1 A;  4DEZ A;  2W4D A;  1UWA A;  1HI0 P;  1MW7 A;  1X7V A;  2VA3 A;  1AA1 B;  2F1F A;  1EHW A;  1N34 F;  4X4T A;  3GG0 A;  4QWB A;  1WNE A;  1MWY A;  3KLF B;  4F4Z A;  2J8S A;  4IH5 A;  4DR4 F;  4X2B A;  4JI8 F;  4DUT A;  3MMB B;  2D69 A;  2EFQ A;  1RUS A;  2DHH A;  1NB7 A;  2FVR A;  1T7P A;  1FX4 A;  3HUL A;  1VHI A;  4ZCM A;  2V9W A;  5GAE U;  2XSJ A;  3O44 A;  1B64 A;  3W66 A;  1E6V A;  4ZKA A;  3VGV A;  4Z2X A;  1N6Q A;  4NCG B;  1SUQ B;  4DV3 J;  1VGY A;  5I4M A;  3TZW A;  1SL2 A;  4OX9 F;  2DXE A;  2XMV A;  3GQC A;  4E98 A;  4LMZ A;  2HQI A;  3K5P A;  5EN1 A;  3BKT A;  3H4B A;  3C19 A;  1O0P A;  2XYG B;  1UVL A;  2VOD A;  4LUB A;  2AEM A;  4UY8 T;  2E44 A;  2VHG A;  2LQ8 A;  1KFS A;  3BGR A;  1BC6 A;  2R7W A;  2DIS A;  3AH6 A;  1Y5I B;  1YX2 A;  1YBT A;  3P3D A;  2I6W A;  1FVQ A;  4AXJ A;  3GR1 A;  4JI3 J;  2M5Y A;  2ZD1 A;  4A8W A;  3E2E A;  1S1X B;  3EIC A;  3C3L A;  4PZV A;  1AB8 A;  3JAM Y;  4B9S A;  2XMJ A;  4LF1 A;  2DPI A;  4Y0F A;  2D1C A;  4HEA 9;  1NPR A;  2HEK A;  4TU8 A;  4RNH A;  3SDE B;  4ECW A;  2W7O A;  1X4B A;  4OJ3 A;  2ZOF A;  3NNC A;  4ER8 A;  5HAN A;  4A8Q A;  1IXK A;  2CG4 A;  1HBO A;  5LJ3 Y;  5A8W A;  3DC2 A;  5K9F A;  3NGD A;  3AOD A;  1RT1 B;  4DX7 A;  4B17 A;  3W63 A;  2LLZ A;  1U48 A;  4A8K A;  3D54 A;  3I5B A;  1J27 A;  1KS2 A;  1R8C A;  2WON A;  2BKN A;  3QNW B;  5CYQ A;  2FHO B;  2FLN A;  2Y1I A;  1FJ7 A;  2DH8 A;  4DU8 A;  3MUR P;  2KYZ A;  3IR5 B;  4FYV B;  1HNX J;  4F36 A;  2HVE A;  3KG1 A;  1K47 A;  1OQ6 A;  4R0E A;  2FHM A;  3JQM A;  1D3W A;  2QGF B;  3D1Q A;  3IBW A;  5LMU F;  3ZTO A;  1NDC A;  4RO0 A;  1PIL A;  2PE8 A;  5IC4 B;  4O0I A;  3PZP A;  1WJ9 A;  3ELH A;  1IN0 A;  1X4E A;  2XMA A;  4ATN A;  3DGP A;  2DGV A;  2HBZ B;  4G1P A;  2QIF A;  2AJ2 A;  4DCO B;  3SYZ A;  2W8K A;  1U25 A;  4EYI B;  2RRA A;  1LWE A;  2Y0B B;  4QQB A;  1NDP A;  4U8Y A;  4UZB A;  4JI4 J;  2IA0 A;  1IKX B;  3BGF A;  4CO3 A;  4LFA J;  2G0J A;  4J9N A;  1R27 B;  3ILJ A;  1F5A A;  2LQ5 A;  1VI7 A;  1WOS A;  4E0D A;  3EGV A;  2LYV A;  4A8M P;  2HW3 A;  5CD4 A;  1I6J A;  1GXT A;  1YK9 A;  2W9B A;  2NQP A;  3MAH A;  4KTQ A;  4DDF A;  1WOO A;  2V2Q A;  1TL7 A;  5BJR A;  3M8Q A;  1X4G A;  5F8N A;  1FK9 A;  9ATC B;  2AEF A;  2FDN A;  2HK3 A;  4PWW A;  2UVV A;  4CQ1 A;  2IFX A;  1IM6 A;  4CWB A;  5C24 A;  2GMH A;  2XMW A;  4DG1 B;  4H4O B;  4XO0 A;  3K8V A;  3EXC X;  4CYU A;  2XZD B;  2Z58 B;  1NHK L;  2GS8 A;  3CED A;  3TVZ A;  5M2U A;  4EU0 A;  3S1T A;  5F9L A;  4CLP A;  2Y1J A;  5DDR C;  4FNH A;  2YQ3 A;  1WC4 A;  5AXL A;  1IR2 A;  1RHM B;  4J9U E;  3AY0 A;  1S10 A;  1SQG A;  5FLX Y;  4XPC A;  5AJ3 J;  4EFA C;  1NLK L;  2KHD A;  4YY3 J;  2YWF A;  5I3U A;  3D2W A;  3KG0 A;  2MMY A;  4F0M A;  1R0A A;  3TJ8 A;  1REV B;  1H74 A;  4C0B A;  2HAF A;  1KTV A;  4ILL A;  1WC0 A;  3ZFV A;  4I56 A;  5M2P A;  4ZP8 A;  2HAI A;  4ZVG A;  4ECR A;  3BN4 A;  3NKY A;  5KAK A;  4ZJQ A;  4WFX A;  3GIJ A;  3BH6 B;  3BO2 A;  1RZM A;  3UDV A;  1KKH A;  1NSP A;  2J7K A;  2MQN A;  3SCJ E;  5ETL A;  3R8Y A;  3SQG A;  1PJ5 A;  1AUS L;  1RTH B;  2RRN A;  4W4M A;  3T6J A;  2GGP A;  2ZBR A;  3D7S B;  3MHY A;  1AFJ A;  1NJW A;  2M9K A;  3UQS A;  1BWE A;  3UCU P;  2AF6 A;  1RI7 A;  1HWJ A;  3FBF A;  1F60 B;  2UUB J;  3QT8 A;  2BEF A;  3TVY A;  1TL3 B;  3MD1 A;  4HI2 A;  3PR4 A;  5IQ6 A;  3HVT A;  4JI5 J;  2OI2 A;  1SIZ A;  4B9M A;  5LT5 A;  1JJH A;  1FES A;  5GVQ A;  3KMQ A;  1WHV A;  3BO3 A;  1FDA A;  2PC6 A;  3EZU A;  1GTE A;  1XMQ F;  2DY1 A;  4KT0 C;  5IT4 A;  4RW6 B;  3T1Y F;  1YSJ A;  4EBC A;  1D8Z A;  3CW2 C;  2WRM A;  2ZZT A;  7FDR A;  1S9F A;  5JVH Q;  2Y1R I;  3E01 B;  4CLK A;  2DNN A;  1VRT B;  5A76 A;  2OIH A;  3CD6 S;  2YWH A;  3X1L B;  2JNJ A;  2ZJR Q;  5T7L B;  1Q8K A;  4OYI A;  1LFP A;  3WDO A;  5KT7 A;  2ZBC A;  1PC4 A;  3B4M A;  1XMO J;  1T9W A;  3FGV A;  2FZG B;  1HI8 A;  2BVZ A;  1D9F A;  2DH9 A;  3W3S A;  1GXL A;  2WVF A;  2YKQ A;  1Q8I A;  4U67 Q;  1OS5 A;  2HVZ A;  3TUI C;  5CYM B;  5CD4 H;  2NRE A;  1JLF A;  1RYS A;  1ICE B;  5G4D A;  3MPW A;  3B82 A;  1RT2 B;  1JNR B;  3QRP A;  1V3S A;  3DLL Q;  2CNK B;  2OFG X;  3S01 A;  2YNH A;  4PXC A;  1T03 A;  2HGL A;  5KFW A;  1S6O A;  3ETM A;  1FT8 A;  3IR6 B;  3G6E S;  2BRK A;  3KK3 A;  1KQS R;  1UWB B;  1KQK A;  2IVM A;  1I1G A;  2UUC F;  5L1K A;  2FLL A;  2DNP A;  2FJD B;  1HQE B;  4OL8 A;  1T9T A;  3T5H A;  1HYS A;  4OZ1 A;  4B3S J;  5DG9 A;  2XSF A;  1TV6 B;  4WP9 A;  1J5O B;  2QE5 A;  4YEA A;  1U8S A;  2ZE2 A;  3TOQ A;  3DCA A;  2R4F A;  1SJR A;  3R5G A;  3HHL A;  2CQ4 A;  4DSF A;  3D0G E;  1U1K A;  1CJU B;  2ZDP A;  2FTR A;  4J37 A;  4PWD B;  4D3H A;  1CS4 A;  2XMT A;  3AB2 B;  5DZ7 A;  1CJT A;  2ZKU A;  2M8H A;  2QL9 B;  3AJ2 A;  2MY8 A;  5J1N A;  5HQ8 A;  3MEC A;  1FXD A;  3BGL A;  2DHX A;  1Q7Y T;  1D9D A;  5GAH I;  3D5M A;  4GC6 A;  4DHV A;  2B51 A;  3V4M A;  3R1L A;  3OR2 B;  1RAI B;  3R2C J;  5E3C A;  2GJF A;  1K0T A;  1IJF B;  2HFU A;  4K4Y A;  5J2Q B;  4KR0 B;  3GON A;  2YKA A;  2Q43 A;  2V50 A;  1C0U A;  4CLY A;  2ZC4 A;  2J8A A;  4LSN B;  4DBQ A;  4O4G A;  5L38 A;  2BKO A;  1VRU B;  3R1H A;  3A4T A;  2X7I A;  1KRP A;  3M2R B;  3HD2 A;  3NOG A;  3NCR A;  4Q44 A;  2JVR A;  5JXS A;  4B9U A;  2QJ3 A;  1VOM A;  5EUH A;  2MQO A;  2XNQ A;  1QLN A;  2ADC A;  3L09 A;  4NI2 B;  4F4A A;  1K1Q A;  4JV5 J;  1YBU A;  1ZET A;  1EAR A;  4FVC A;  3W8P A;  1VRQ C;  1UCN A;  4MYU A;  2XG8 A;  5FDL A;  3JSB A;  3M8W A;  3OFG A;  2A6M A;  4JBC A;  1WC1 A;  2I1R A;  3FBB A;  4OI0 A;  2VKR A;  4B9T A;  3Q8V A;  2HMI A;  3H98 A;  3M1V B;  5FJ4 A;  3HFZ B;  2K1R A;  1Q0N A;  2H51 B;  2XMU A;  1NJX A;  1TKZ B;  4K5R A;  2RF2 B;  4OZJ A;  2KXF A;  4DMZ A;  1Q95 G;  1RTD B;  3H5X A;  4GKK J;  2Z2L A;  2DNL A;  4MIA A;  1FO1 A;  2WTF A;  2Z8Q A;  1NKC A;  3W62 A;  2ZZN A;  2AYG A;  2RHQ B;  5HQM A;  2RE1 A;  2OEL A;  3KLH B;  1NK6 A;  1V3Z A;  2JWN A;  1DTT B;  3MMJ A;  5DET A;  5IV3 A;  3QFH A;  5C25 A;  4J9S A;  5IT9 Y;  2QMW A;  4EUV A;  2OTJ S;  4CO4 A;  1JLE B;  3GSI A;  3E51 A;  4ZP7 A;  4X65 J;  4F67 A;  1TZ0 A;  1SJQ A;  3W9I A;  3I9Z A;  4XDC A;  4YR0 A;  3CD5 A;  3CDE A;  3CWJ A;  2DIT A;  5KFJ A;  4WU2 A;  1EQ0 A;  1S5Z A;  3POT A;  1RYR A;  1B3T A;  2QRR A;  2GVD B;  4LFB J;  5AXN A;  4CZC A;  1X8D A;  4AQY F;  2EK1 A;  2NCK L;  4K59 A;  2RIL A;  1RHK B;  3K59 A;  4U6P A;  2IC3 A;  3QT7 A;  2K2P A;  3MCS A;  3CJ0 A;  3CO9 A;  4KFB A;  2HHH J;  2V94 A;  2FJB B;  4KRW A;  1QUP A;  1RT4 B;  3LP1 B;  2JX2 A;  2Q6C A;  4M5M A;  3MTJ A;  4ZVF A;  3NOC A;  4OLP A;  3QWP A;  4LF6 F;  2HNY B;  3DOM B;  3MZI A;  2I0X A;  3MFI A;  2YNG B;  2UXB F;  2VU5 A;  4ECV A;  1H2U X;  2BOA A;  2DEI A;  3J81 j;  1RWV B;  1UPP A;  3KJV A;  2VBY A;  5HJY A;  3D3C J;  3TRG A;  3NAH A;  3PCO B;  2MZ1 A;  1RWO B;  3VGS A;  3KHH A;  4RU2 A;  3QID A;  2HFO A;  3DFE A;  3IG1 B;  3NWR A;  2OTL S;  2VFU A;  1NJI T;  1WOP A;  2DR9 A;  4C98 A;  2DNR A;  3QQC D;  1KVJ A;  1EP4 B;  1X4F A;  3I0R B;  3FMB A;  1HNZ F;  2QLJ B;  4ZVE A;  4X4P A;  1YZ7 A;  1L3K A;  3R97 A;  3W65 A;  3PEJ A;  4ZVO B;  1FER A;  1P27 B;  4I67 A;  2QFJ A;  3UDL A;  5ITH A;  3CJ8 A;  2F4V J;  1CC8 A;  2G2Z A;  2LA6 A;  1Y9O A;  2QA1 A;  8ATC B;  1HD1 A;  2R7Q A;  3FEX B;  1T9V A;  1J5E F;  4J91 A;  5DO2 A;  1WG5 A;  2IRU A;  4Q2M A;  3NS5 A;  5HBM B;  1N5S A;  3TZY A;  2MTL A;  3ITH A;  3G2X A;  1M1H A;  2H9Z A;  3ZNJ 1;  1JMT A;  2DCL A;  3W5Y A;  1RAF B;  3LP2 A;  2FLP A;  5KFL A;  1FD2 A;  3WBZ A;  2XNR A;  4NLD A;  5MLC V;  3GWC A;  3D6F B;  2OPS A;  2E5J A;  4O4R A;  1X4H A;  2VG5 A;  2L48 A;  2W7A A;  5KFM A;  3I0S B;  4DSI A;  5KG7 A;  3D0H E;  2ZH2 A;  2V4Q A;  2J5A A;  4N7T A;  5B08 A;  1KP6 A;  3BB5 A;  4KE5 A;  1JKH B;  1N48 A;  3B78 A;  3RRH A;  3KK2 A;  2KTQ A;  4UOH A;  3JYT A;  1HNV A;  1Y5L B;  3BSO A;  1ZM4 A;  4NLS A;  4Z7C A;  1P1L A;  2HZA A;  4WTY A;  1U24 A;  3SBM A;  2YPY A;  4JI1 F;  5EHH A;  3I5C A;  5GAE I;  3R5B A;  3RTV A;  2NSC A;  2P9E A;  2FVC A;  1O5J A;  2R7X A;  4ZA1 A;  5ETR A;  4R8U B;  2BJD A;  1VQ6 S;  2L9D A;  2CQP A;  1R0C B;  4ZIT A;  3EUN A;  2E9T A;  1AZS B;  4DR3 J;  3PX6 A;  2F65 A;  5KFZ A;  4PRF A;  1RGV A;  1BD6 A;  3NGK A;  4JV2 A;  3OTO J;  2CJA A;  4PG5 A;  1N0V C;  3SCI E;  3FMW A;  1LWC A;  4A8Y A;  2IAJ B;  1RT3 A;  1D0E A;  1N56 A;  1BMQ B;  1WSR A;  5LL6 d;  1H72 C;  1TVR A;  3HT3 A;  4PG4 A;  1U0S A;  4ECQ A;  1S6P A;  2AHO B;  5JMN A;  3JSY A;  3TEH B;  4O44 B;  3C14 A;  3M6X A;  1BY9 A;  1UMJ A;  3M8Z A;  1OSD A;  1UJ5 A;  4OHY A;  1T05 A;  1WTF A;  2F9D A;  3W64 A;  1OY6 A;  4RW4 A;  5G0R A;  3GV5 B;  2CPJ A;  1UVK A;  2BAN A;  4J9K A;  2JC0 A;  2FZK B;  2XLK A;  1AW0 A;  2V8H A;  1RXO B;  2Z2Y B;  1XEZ A;  3TWZ A;  1JLG A;  2WCX A;  2HS4 A;  4ZIV A;  4J9P A;  1GTH A;  5HP1 B;  4ID5 A;  4C97 A;  2FQQ B;  1WOR A;  4PWU A;  1XWL A;  4KYZ A;  4B3O B;  1HPZ A;  1WAC A;  5D4N A;  4DR4 J;  1IBL F;  4ZDN A;  3FJ2 A;  1IKV A;  2OFH X;  2R7R A;  4HI1 A;  5F8M A;  3DM2 B;  3JSM A;  2BOP A;  2MKC A;  3CJK A;  5C42 A;  3H5S A;  4PQU B;  2AD9 A;  1R8H A;  4KY3 A;  4B3M F;  2J7W A;  2ZIT A;  1WG4 A;  2A2D A;  2JJ4 D;  4MFB A;  2C3O A;  2R8I A;  2ZFH A;  3QIP A;  3FUY A;  4WE1 B;  3V81 B;  2ZKT A;  3D3B J;  3OFF A;  4I2Q B;  4M94 A;  1SC3 B;  2YKN A;  1RWU A;  1IKY A;  4C3K A;  1G3O A;  1SL0 A;  5GAD U;  3V6D A;  5F8J A;  4KH1 B;  3QO9 A;  2B8Q A;  3W60 A;  3EVO A;  4FS1 A;  4DPU A;  1NK7 A;  1ZTT A;  5HLF B;  2BKP A;  1PCA A;  1XTZ A;  1V3R A;  2MZJ A;  2YKM A;  1DTQ A;  1UVI A;  1ARO P;  4OX8 A;  1Y3J A;  4DJB A;  5J2P B;  2R42 A;  2LQ9 A;  3HMJ G;  2CPX A;  1JJ4 A;  4DV2 J;  1Q5Y A;  1DRZ A;  1RA7 A;  3V4I A;  3RBZ A;  4HTI A;  4LRE A;  1UA0 A;  5HMX A;  1F9F A;  4DFK A;  2WW4 A;  2B8P A;  4Y2M A;  2Q79 A;  3VVT A;  4FF4 A;  3LGM A;  5DM7 Q;  2CPY A;  3EPG A;  5KFY A;  1NBE B;  3CE8 A;  3J81 Y;  2BZ2 A;  3V5R A;  5DG7 A;  1TQL A;  5CH7 B;  1KEK A;  2DR8 A;  2O1P A;  1U09 A;  1HW9 A;  3PYD A;  2QX0 A;  4USV A;  4B3R F;  5IV4 A;  3FRY A;  4X66 J;  3TAM A;  4IO9 Q;  1N0U A;  4LRC A;  4DN9 A;  2MB0 B;  3OQ2 A;  4UY8 5;  2ALZ A;  2R7T A;  3LAL A;  4LQ9 A;  3RYL A;  3H40 A;  4FYX B;  5LMU J;  2E1M C;  1FNM A;  2HND B;  1T9Y A;  3W5X A;  3AFG A;  2IVY A;  1N33 J;  3FSY A;  4NXM J;  3GJT B;  4JI6 J;  2O66 A;  3PKY A;  2OEM A;  3HSZ A;  2VG6 A;  3IWL A;  2EEY A;  3G8S A;  2RU9 A;  4QYR A;  3MCM A;  4JB8 B;  3M32 A;  2HIY A;  4QCL A;  2IRY A;  3IFE A;  1T8E A;  2J6T A;  1S1W B;  2W2M P;  4CO5 A;  3QRQ A;  3UN3 A;  3TJ9 A;  3CC2 S;  3MR7 A;  2I5J A;  4M1K A;  4ZVH A;  5KT3 A;  5GMD A;  4F02 A;  3OV7 A;  4PAA A;  3KOA A;  1ZM2 A;  3EZO A;  4Y2K A;  3BDP A;  1R89 A;  3PRB A;  4BC9 A;  1WKL A;  4P6Q A;  2DNG A;  1Y3K A;  2V34 A;  4F50 A;  1RA6 A;  2DVI A;  4I1T A;  1IR0 A;  2QLF B;  5E5N A;  4DR5 F;  5KFX A;  4C8Z A;  1WKK A;  1MWZ A;  5MAO A;  3GPA A;  4A48 A;  3LH2 S;  3UNY A;  2IM0 A;  2IPO B;  2ZH6 A;  2RDD A;  1OIA A;  3N0V A;  1M90 T;  2B6A B;  2F8H A;  3W9H A;  3MR3 A;  2Z2Z A;  1CJV A;  2LXF A;  4WCE Q;  4DV6 J;  4WK1 A;  2ZJP Q;  2UXD F;  1EZZ B;  3G87 A;  5ADZ A;  1KTQ A;  2E5L F;  1D9A A;  3HJV A;  1DUR A;  2VOO A;  5GAG U;  2YY3 A;  5A2Q U;  3JS9 A;  4ZJO A;  2XC9 A;  4ZLP A;  1NK0 A;  5J2M B;  3KLI A;  2E1R A;  5BXI A;  1F3F A;  4LFC J;  2HG4 A;  3EDQ B;  2E5G A;  2VPZ B;  5DQI A;  4H4M A;  5A8R B;  3TUP A;  2NR0 A;  4MK9 A;  5DDO C;  2DNZ A;  1CJK A;  5H9F J;  2BV3 A;  3ISN C;  2FD2 A;  1F5B A;  1UJ6 A;  2LP4 A;  1CQM A;  3Q8U A;  4C8Y A;  4DV4 J;  2RDJ A;  2XY7 A;  1U2F A;  2NXC A;  2HHW A;  3NG8 A;  1X4D A;  3G82 A;  1YIT S;  4V1A k;  4EI2 A;  2HBY B;  4LF8 F;  2NUH A;  4Q8E A;  4ZHR A;  2D7S A;  5FII A;  5KFC A;  4CLS A;  5D15 A;  2W4P A;  1RJJ A;  3KLG A;  1RHR B;  4NMX A;  3PHE A;  3DKD A;  1FRM A;  1S48 A;  3K5N A;  4LQ3 A;  4LBI A;  5HQL A;  2OPP B;  5A0Y A;  1LKZ A;  3NEK A;  4L6V 3;  1TK8 A;  1FCA A;  2JRS A;  4RW7 A;  5E0O A;  2FPH X;  3QJJ A;  3OBI A;  4ECT A;  1QJH A;  1NDL A;  3QSI A;  5SZT A;  4EZ6 A;  5KG2 A;  3LP0 B;  3CIM A;  4ZPD A;  2D74 B;  2DGW A;  1HNI A;  4NRU A;  4NL5 A;  4DR1 J;  4ECU A;  2QSW A;  1E6Y A;  2RD5 C;  1KHW A;  2NZ4 A;  2V2K A;  4HR2 A;  1U1R A;  2B5J A;  4CRJ A;  1S59 A;  3MM8 B;  4L73 A;  4J9L A;  3CCR S;  4K0K J;  1BLU A;  4WFY A;  2OH2 A;  2ILY A;  3D4J A;  1EKR A;  2UUW A;  4B3T J;  3UDC A;  2UU9 J;  3BS9 A;  1C1B B;  4AUK A;  4RW9 A;  4ELU A;  1S9E A;  2VFT A;  3FFI A;  1LOU A;  3UVJ A;  5LSO A;  1Q81 T;  2XZT B;  3ONQ A;  1N6Q B;  5E3R A;  2DK2 A;  3L7P A;  7FD1 A;  2EFV A;  2NUU G;  3M8S A;  4LF9 F;  4RR5 A;  4K50 A;  1HNW J;  3AJD A;  3EXY A;  4CP5 A;  2YKO A;  5AXM A;  4IRC A;  2HPU A;  2RH3 A;  1SI9 A;  2H3E B;  1RTJ B;  3GFY A;  2CQ1 A;  5ETQ A;  1C4A A;  4H4K A;  2I38 A;  3NCQ A;  4ENO A;  4DSL A;  1RQ0 A;  4YR2 A;  3W2W B;  3BKF A;  4G1Q B;  4KKO A;  3BGR B;  3LOU A;  3L95 X;  2Z2M A;  1QD1 A;  3CDU A;  4C48 A;  1Z1Z A;  4OLO A;  3SI8 A;  4ANE A;  5KFH A;  2Q1L A;  2Z57 B;  3KMS A;  5BYR A;  1M0S A;  2UUC J;  3AOB A;  1N5Y A;  1NDK A;  2VBW A;  1UA1 A;  1WHX A;  5D3G B;  3TP2 A;  3PX0 A;  2CPE A;  3DMJ A;  3R5J B;  3T41 A;  4ED5 A;  2FJX A;  4C9D A;  1CBK A;  1ELO A;  2D3O 1;  3BV8 A;  4DUZ J;  3CF5 Q;  2QO3 A;  5LXR A;  1T94 A;  2ZM6 J;  1SKW A;  4OI6 A;  1XR6 A;  4GKJ J;  3GTY X;  1T02 A;  4DSJ A;  3O3L A;  4MYT A;  2Y8W A;  2J6S A;  3QAU A;  4USH A;  2JEG A;  1UEK A;  3RAM A;  1L3S A;  3H0P A;  2DGT A;  5F41 A;  1R3N A;  4X4S A;  1YJU A;  4OZN A;  1T0T V;  2CWX A;  2R8G A;  5CYQ B;  2B4O A;  1X9S A;  1YJ9 S;  3DOL A;  2VV5 A;  2V4R A;  3M6W A;  4IFV B;  5D78 A;  4X4V A;  2QLW A;  5AE1 A;  3LPE A;  5AE3 A;  2XZW A;  1B70 B;  1T3O A;  1Y11 A;  1MSW D;  3DRS B;  2MKY A;  3IC1 A;  1NH8 A;  4WP8 A;  5KFA A;  1SC4 B;  4KHP F;  4JYA J;  3QZ8 A;  4ZPC A;  4FF2 A;  3CDW A;  5DG8 A;  3DGP B;  4QYZ J;  3DOK A;  5CA5 A;  4ECX A;  3OXF A;  4BWM A;  1OWX A;  4F25 A;  2W9C A;  3CUN A;  1FJC A;  4WWS A;  4R5P B;  4YUD A;  4FYY B;  1D09 B;  2ZWP A;  1ZPV A;  1JQG A;  1WC3 A;  2M3D A;  4PQA A;  1YJR A;  5M2R A;  3AOC A;  3OJU A;  4K4T A;  3FEY B;  5DJB A;  4IDK A;  4KO0 A;  3ZZ0 A;  3K89 A;  1FE0 A;  2CVI A;  3PYE A;  3ZZT A;  3RW7 A;  2XY5 A;  3MEK A;  2H5E A;  3J7Y I;  2IJF A;  2D41 A;  1H0H B;  1YTY A;  2AJQ A;  2HQC A;  2HBR B;  3A8K A;  4DOZ A;  4GO7 X;  1RAH B;  3L7U A;  4DL0 C;  3TJA A;  1CQN A;  1Y5N B;  1K44 A;  4HLB A;  1RT5 A;  4TY8 A;  4Z7Y A;  2ATC B;  4CIO A;  2B0G A;  4CYU B;  4OZ5 A;  1WI6 A;  1ZYQ A;  2JFD A;  4DV7 F;  4M5N A;  4ZVQ B;  3M8R A;  2MZQ A;  4WBF A;  1ITP A;  1FKO A;  2N3O A;  2KZZ A;  1VDH A;  3Q8R B;  4MAK A;  4E2F B;  2C2O B;  3LQV A;  4HTJ A;  3BH7 B;  2BMB A;  3NGU A;  4XK8 C;  2WZ1 A;  1IQT A;  4NZ0 A;  1M5S A;  1RWP B;  4KGZ B;  3MM6 A;  2CQC A;  2OMO A;  2WSF C;  4LVO P;  2MLZ A;  3IBC B;  1U1O A;  2HRT A;  4O3Q A;  2K06 A;  2DIU A;  4KC5 A;  1M1G A;  1Q53 A;  3KLF A;  1IBM J;  3LWM A;  4UF4 A;  3T6B A;  3MMB A;  2IVF B;  2YXL A;  1S7H A;  1N5T A;  1HFE L;  2CYY A;  2RS2 A;  4Q7A A;  3K5M A;  3S8S A;  1NK5 A;  1VFJ A;  3MD3 A;  3ADA C;  3HHL C;  3B4D A;  4KPY A;  5KT2 A;  3DLK A;  3M2U B;  2R2R A;  4JI2 J;  2J9C A;  3MOJ B;  4NCG A;  1CC7 A;  3U02 A;  1SUQ A;  6AT1 B;  1N4L A;  4YB6 A;  4NYO A;  3HVT B;  6FDR A;  5F8L A;  4RNF A;  1X9M A;  2YWE A;  5IFM A;  3OUY B;  1RSC A;  1VIO A;  2LU2 A;  1SH2 A;  5LMN J;  1YRT A;  1EKS A;  3C15 B;  1FXL A;  3ZZR A;  3TI0 A;  3PW5 A;  1FRK A;  2OO4 A;  1DQA A;  3UI3 A;  3J80 U;  2VG7 B;  2GAH C;  4F2R A;  1RBL A;  3FK4 A;  3FZ2 A;  1IBK F;  4PR6 A;  4U7C A;  3SZ2 A;  5BR8 F;  2UXC F;  3MM7 B;  3OPK A;  1RLC L;  3W9J A;  3OFE A;  4NLP A;  3X3U A;  2OKQ A;  2IMO A;  4A46 A;  1SJ3 P;  2LVW A;  3GV7 B;  1SKR A;  1J5E J;  4WII A;  3SDE A;  1URR A;  3OHB A;  2HHP A;  4DX8 H;  1LW2 B;  5EDW A;  1VQP S;  2VKZ G;  3P5T L;  2AWZ A;  2R3V A;  1VQM S;  1JJ2 R;  1IJE B;  3QGH A;  4QR2 A;  3M2V A;  1NSA A;  4JI7 J;  3N79 A;  2G2Y A;  3MEG B;  1T11 A;  4NPO A;  3TA0 A;  1HAR A;  4M5I A;  3KHG A;  4DV1 F;  2HFZ A;  3KFW X;  4ID8 A;  3RB3 A;  4V19 X;  2F8E X;  2YNH B;  2PDA A;  1T03 B;  2EC0 A;  2J9E A;  1N36 F;  5KG1 A;  1KVI A;  3MMA B;  2IYI A;  2V63 A;  2MLX A;  3OVA A;  3DHX A;  2IDE A;  3KK3 B;  3AAW B;  2XYP B;  1KOH A;  2KM8 C;  4Y34 A;  2O3D A;  2AX1 A;  5KFR A;  3CIZ A;  5K8P A;  4RNN A;  5EGY A;  4CM2 A;  3EE3 A;  3OTE A;  2KRR A;  3PDN A;  1W26 A;  3AD8 C;  3F73 A;  2PA3 A;  4TLQ A;  4AE5 A;  1FWK A;  2CQ2 A;  5GAH U;  3D0I E;  1R0B G;  1FDB A;  4MKV A;  4OX7 A;  3QJP A;  2CPF A;  4K4Z A;  1JLQ B;  3RU0 A;  4GVB B;  1JLC A;  2V4J B;  2QG9 B;  3TO8 A;  3TQ1 A;  3R6L B;  3QWU A;  1IKX A;  1NKB A;  3QMQ A;  3EGW B;  1CJT B;  2KXN B;  3WC0 A;  1YG0 A;  4DL6 A;  2HGN A;  3NGT A;  1TR0 A;  2J9D A;  1PGZ A;  4DF4 A;  5GAD I;  3V6J A;  2DHG A;  1FRJ A;  5HMW A;  4ED8 A;  2LEP A;  3MFH A;  3UN5 A;  1NRK A;  4F4W A;  2JL9 A;  2VJU A;  2PEB A;  3MI7 X;  1U1Q A;  3GYX B;  3HPO A;  2C28 A;  3IBF B;  1C0U B;  1LW0 B;  1JNZ B;  2V8G A;  1KLM B;  4HL9 A;  4DFP A;  3GCX P;  3SSR A;  3PTW A;  2N3L A;  4K4S A;  4URQ U;  2MPU A;  2HHS A;  4DG1 A;  3F56 A;  2EK6 A;  1KQG B;  1VQ4 S;  1V5V A;  3KTQ A;  3NNA A;  1FDN A;  3G8T A;  2UUA J;  4HDG A;  2G9O A;  2R7U A;  2OPQ B;  2V67 A;  4CLF A;  4L3N A;  5H9F K;  2POK A;  2OSR A;  1UTA A;  4F0K A;  3ENQ A;  3GYG A;  2HZV A;  1X9W A;  1X0F A;  2V8P A;  1KWM A;  5T41 A;  1S0N A;  1EET B;  1UL3 A;  3NS7 B;  4JP8 A;  2CJK A;  4LF4 F;  3DLG B;  1PYT A;  4F8R A;  4UTG A;  1UAW A;  5KG3 A;  1XQI A;  3R5A A;  3CJT A;  2QYG A;  3MR5 A;  4ZJL A;  2CJX B;  4MKB A;  1HHS A;  3AJ1 A;  5DGA A;  1TMM A;  1PYO B;  3JAM U;  2LCW A;  2CDQ A;  2K1R B;  5KFB A;  1NEE A;  5F9N A;  1H98 A;  2BJ7 A;  1UFK A;  2AKW B;  2CQ0 A;  4PYD A;  1MN7 A;  2HKE A;  4JI0 F;  3Q8Q B;  4B3M J;  1GH8 A;  4FXW A;  2OPR B;  2EFO A;  4KSE B;  3OLA A;  1HHQ A;  4DV0 J;  4HVZ A;  2CPI A;  3M8P B;  2HHQ A;  2CJ9 A;  1R7I A;  2KJW A;  1YJW S;  1RTH A;  3SFG A;  1LWF B;  2VFR A;  3JQK A;  4ZOS A;  2BJ1 A;  2YX4 A;  4G3I A;  1FNX H;  4C0O C;  1OY8 A;  4QR0 A;  5L46 A;  4J9V A;  3VAG A;  1RAA B;  1RP5 A;  1TL3 A;  5KFQ A;  4DX6 A;  5HVH A;  2AJ4 A;  4AYB D;  1I5O B;  1XR5 A;  3WIV A;  3FVY A;  4NCA A;  4KB7 A;  2DJW A;  2QLB B;  3CJ2 A;  1G2E A;  2OEJ A;  1L5U A;  2DR5 A;  1YBA A;  2DBB A;  1UZH A;  5HMY A;  4DQI A;  3CO0 P;  1YJT A;  3POT B;  4RW6 A;  1RWN B;  1N88 A;  4CH0 S;  1DJ0 A;  2HBQ B;  3B8H A;  3UWT A;  4A8O A;  1RT7 B;  1GEH A;  2IRX A;  2WW8 A;  2JC1 A;  4PAB A;  4Q8F A;  3ZZY A;  3MXH P;  4RBU A;  1T9X A;  2IC3 B;  4ZLJ A;  3E01 A;  5KT4 A;  1H7W A;  4OI4 A;  2WVE A;  2BJ3 A;  2BQU A;  3IGV A;  4NOH A;  3IMQ J;  4O3O A;  2GX8 A;  3RR7 A;  2MQ8 A;  2GQ2 A;  3BSN A;  5T7L A;  4B9N A;  2LU1 A;  3I87 A;  3RG6 A;  4C8M A;  1FA0 A;  2GO8 A;  3CJQ A;  2A2C A;  3WX4 A;  4DV3 F;  4NLT A;  2B4V A;  5B0F A;  2D9P A;  1FHT A;  3KJV B;  1HWK A;  3UR3 C;  5KTQ A;  5D0E A;  4NXN J;  2KXH A;  1P9Q C;  4WJB A;  2O01 C;  5CYM A;  2B9W A;  3EGN A;  3A8I A;  4OYO A;  1NPP A;  4RW8 B;  3I55 S;  4OYA A;  1RT2 A;  4GC7 A;  2C2K B;  4TQR A;  2AX0 A;  2XLJ A;  1MWQ A;  5H9E J;  1KNZ A;  2YH0 A;  2HZC A;  4WFA Q;  3LA0 A;  4ZN1 A;  4W90 B;  4JI3 F;  1UWB A;  3CJ3 A;  1KFD A;  4DL5 A;  4YS2 A;  4CO1 A;  1HQE A;  2MZT A;  2FVP A;  3TUZ C;  2J0S D;  1J5O A;  3CCQ S;  3NBP B;  2DR7 A;  2HRU A;  2MXY A;  3PEH A;  1RAD B;  5FLX U;  4F4K A;  2ZNY A;  3R7B B;  3HI9 A;  1U0H B;  3TQE A;  1FWL A;  4P71 A;  3VTI A;  1GFW B;  2K3I A;  3QRR A;  3OR1 A;  2LXI A;  4M5G A;  2GCF A;  2A18 A;  1NZA A;  2VQE J;  1Y4Z B;  3KDN A;  4OYM A;  4PWD A;  3ZC4 A;  3MMC B;  1KC8 T;  3DXS X;  2X3G A;  1NK8 A;  4ELV A;  1QAJ A;  5CAA A;  2XCP A;  3MCN A;  1HBN B;  2EW9 A;  1HLW A;  2DRD A;  2OPS B;  4XAK A;  2COL A;  2W2Q P;  1XN9 A;  2VG5 B;  1TUV A;  1MRO B;  1RTI A;  3R5C A;  4RKU C;  4KJI A;  3EZ5 A;  4YQW A;  5D0R A;  4UZC A;  1LFW A;  2BJE A;  2HHT A;  3OR2 A;  3CJR A;  3TNV A;  5K5M A;  3G6Y A;  3VV2 B;  1Q7L B;  4MKA A;  1TEL A;  4QYZ K;  5CYJ A;  2EG1 A;  2C2Z B;  3PJW A;  3I6P A;  1TKT A;  2V0N A;  2AW0 A;  4QIF A;  1QY7 A;  2OGU A;  2X1A A;  4XTT A;  2ACY A;  1SJ1 A;  3PG9 A;  4DSE A;  2EFG A;  1VRU A;  2V6A A;  3T1H J;  1GX5 A;  3M2R A;  2BAB A;  4KHM A;  3W8G A;  2FGC A;  4NI2 A;  3RZA A;  1TUW A;  2BRL A;  3EWG A;  4JI4 F;  2KN4 A;  2PT0 A;  1WHY A;  4LFA F;  5E2Q A;  2C22 A;  1ZAX A;  2HHV A;  4PKD B;  2C3M A;  2Y8Y A;  4KIA A;  2UP1 A;  1WUU A;  2N7Y A;  1ZS6 A;  4RNO A;  1UET A;  4Q45 A;  3N9U C;  3GR0 A;  1RT3 B;  1U26 A;  4ZPA A;  5E3A A;  5IM0 A;  1FVS A;  1VBZ A;  1TKZ A;  2RF2 A;  1BHN A;  2WVC A;  4N77 A;  1RTD A;  2XHC A;  3V6K A;  2HFV A;  4DS4 A;  4GO5 X;  4LRD A;  2Z4P A;  4B02 A;  3R27 A;  5L1I A;  3C14 B;  4YR3 A;  5C2G A;  2HVH A;  2DNY A;  4F4Y A;  3SCL E;  3D9B A;  4M95 A;  4RW4 B;  3TUJ C;  2E9Z A;  1XMB A;  4OMF G;  4I69 A;  3KLH A;  4NCB A;  4IKA A;  3K5O A;  5KT6 A;  3T5L A;  2A10 A;  1JXV A;  5EX3 A;  2AQ4 A;  1RU1 A;  5AJ3 F;  1M5O C;  2D9O A;  3ENV A;  3N6N A;  2H5J B;  4NEZ A;  4HAC A;  4YY3 F;  5KOX A;  1K1S A;  1KON A;  4X64 J;  4LSL A;  3QT6 A;  1HPZ B;  2IHR 1;  1JLE A;  1OJ4 A;  3M8Y A;  4UOC A;  4RWX A;  1XR7 A;  4D3G A;  3N28 A;  1N32 J;  4UW2 A;  2GVD A;  5BYS A;  2NSB A;  3IAM 9;  1H7X A;  1CUL A;  3FSX A;  3GP9 A;  1FFG B;  4OJ1 A;  4ZVS B;  2D3Z A;  3HCX A;  4MFB B;  3MPY A;  5IXU A;  4DZ6 A;  2NXJ A;  4Y2A A;  3SV3 A;  3O1L A;  3LP1 A;  2W2N P;  1S1T A;  1IKY B;  2HIQ A;  2GV1 A;  2EVZ A;  1GK8 A;  4QWE A;  4DLE A;  4A8S A;  2YNG A;  1WI8 A;  2UUB F;  3JB9 k;  3ILL A;  3V6D B;  5DZ6 A;  3EX7 B;  1AFI A;  4OYB A;  2FB0 A;  4ED7 A;  2ROG A;  5IQQ A;  3ZZP A;  2BM0 A;  4U96 A;  1NHU A;  2YKM B;  4K2J A;  3UD4 P;  2AIR B;  3DU5 A;  2HRY A;  5CHC B;  3IG1 A;  4QW8 A;  4CLT A;  2NPI A;  4OZ3 A;  1HR0 J;  2RKI B;  1S7I A;  2LEA A;  3PJ9 A;  2DXF A;  3OVB A;  1SBR A;  1EP4 A;  2J0X A;  4X4N A;  1TAQ A;  3I0R A;  1TKD A;  3CME S;  2NXE A;  3TVK A;  4IG3 B;  4P2M A;  5D6G A;  4DR2 J;  1TL4 A;  4BHQ A;  1KSP A;  1UW4 A;  3OVS A;  2FVS A;  2X1G A;  4BCA A;  3LGH A;  1WEY A;  4ZPB A;  3BSC A;  3ET6 B;  5E41 A;  3JTO A;  2NXU A;  5HVG A;  3W61 A;  3RBE A;  5KFE A;  1RDR A;  3GE9 A;  5C7P A;  4DPW A;  1XMO F;  2RAQ A;  5EWE A;  5IOL A;  1U6Z A;  1F1B B;  2DNH A;  1PKU A;  4TXS A;  3CPW R;  1SJ4 P;  2J0Q D;  3UCG A;  3TZX A;  5KFP A;  1F9H A;  4C7Q A;  3FC9 A;  4I6Y A;  4J90 A;  2Q3P A;  3HHE A;  4LF7 J;  3IS9 B;  3G8Q A;  2KFY A;  1F2H A;  2ACM A;  5B09 A;  3T3F A;  2DNQ A;  2MHN A;  1SC1 B;  1P1T A;  2JLF A;  2WSC C;  2XBP A;  3Q24 A;  3I0S A;  4F3M A;  2VG6 B;  4ILR A;  2XO6 A;  1WDT A;  4QPX A;  3M32 B;  2WAQ D;  3THV A;  1X31 C;  3BO4 A;  1FRX A;  2CVE A;  5E33 A;  1X5T A;  2XMK A;  1PAU B;  5KG4 A;  3NLC A;  3C16 A;  4J9O A;  2KYX A;  4B3S F;  2CQB A;  4HT7 A;  4DUY J;  2W1B A;  1RAC B;  4QU7 A;  1AUD A;  1YJN S;  2FJW A;  3AT1 B;  3MGJ A;  3QAT A;  2YX1 A;  3H42 A;  4EEY A;  3H4D A;  2J9D E;  5IT9 U;  2JDJ A;  2XHW A;  3CMA S;  5I3P A;  1H3D A;  4RUH A;  2HHU A;  2WOM A;  2K8G A;  1NH7 A;  3THP A;  1OQ3 A;  1M5H A;  3VAF A;  5DDP C;  3EMT A;  1KQF B;  1I94 J;  1AZS A;  4GMK A;  2F9J A;  2MQP A;  2DXD A;  3MWB A;  4IH6 A;  3ZZZ A;  2YNF A;  4OHX A;  2BBE A;  4TNO A;  3AA9 A;  4CNZ A;  5B0D A;  5KFG A;  2R2T A;  4BBY A;  1WSV A;  2IAJ A;  2AYB A;  4TY9 A;  2MKJ A;  1ZBT A;  1RHQ B;  3NP5 A;  4MK8 A;  2IBK A;  2C1E B;  4RUB A;  3TX8 A;  1SV5 B;  3M30 A;  2YQ1 A;  3RW6 A;  2CPZ A;  4O44 A;  4H4M B;  4WFZ A;  4KGV B;  4H4K C;  4QIW D;  2RML A;  5KFU A;  2K7J A;  5CXT A;  1B99 A;  3U1N A;  4JV5 F;  3TAP A;  3J7Z 5;  2VUG A;  4AL7 A;  2DYA A;  3HO1 A;  3LF0 A;  1U7L A;  3D6H B;  3CDA A;  1JJC B;  3HVA A;  2KDO A;  4OI3 A;  5LSR A;  5U47 A;  1XJW B;  4G6V B;  4B3O A;  1EJ7 L;  1HBU A;  4PPZ A;  1R6Y A;  4WFB Q;  3UE2 A;  1Z2L A;  3VHQ A;  4O3S A;  1TK0 A;  3ZTP A;  3N6L A;  2L41 A;  3FBE A;  2RQM A;  1S99 A;  2R8K A;  4YB1 P;  4FYD A;  3IRX B;  5A0Y B;  3AQO A;  3OL6 A;  4EO8 A;  1CLF A;  1S49 A;  4CT9 A;  3P6Y C;  1PG5 B;  3HVW A;  1K73 T;  4WE1 A;  1VIX A;  3FEZ A;  1YJ7 A;  3GFH A;  4I2Q A;  3Q83 A;  3VCD A;  3FKB A;  4DQR A;  3OXG A;  3VQT A;  3TEG A;  4ED2 A;  4F26 A;  4IFY A;  1HNI B;  4W92 B;  2GIF A;  2F63 A;  1E6Y B;  4Y00 A;  4M5J A;  1U6B A;  2BR0 A;  5F8G A;  3L4B C;  2LEB A;  5EWF A;  5IS2 A;  2X51 A;  4OYW A;  2C2E A;  2BYC A;  3KG4 A;  5BR8 J;  2CNL B;  4PYA A;  2UVR A;  4X65 F;  2EFN A;  2JSX A;  5J2P A;  2RS8 A;  1NME B;  4XIU A;  3TA2 A;  1L3T A;  1PAE X;  3H8Y A;  3FFI B;  3DNC A;  1BQM B;  3UVJ B;  2IM3 A;  1A0O B;  1VQN S;  1GMW D;  4NLW A;  4Y6I A;  2Z0G A;  2DHS A;  3ISZ A;  3UO0 A;  2B56 A;  2K3K A;  3DU6 A;  5I42 B;  2HHH F;  1WF1 A;  2C42 A;  4OYZ A;  1OO0 B;  4WZQ A;  2R7O A;  2JLG A;  2HNZ A;  2CZ9 A;  2YNI B;  1UVJ A;  2A0F B;  1S57 A;  1VC6 A;  4L3K A;  4PG6 A;  3G6V A;  4KKO B;  1RBO B;  3DLE B;  1S1U B;  5HMZ A;  4ZPV R;  4LSZ B;  3AXM A;  2AJ0 A;  4J5O A;  4RUA A;  4ZCL A;  1NJZ A;  1DLO A;  5H9E K;  4KV8 B;  1N5Y B;  4ZP9 A;  2LEC A;  1LEO A;  4FYW B;  5IC6 B;  1F6T A;  2HND A;  2ZZM A;  3D67 A;  3TYT A;  1CEZ A;  2HLT A;  2B4U A;  2L9N A;  3HSD A;  2F4V F;  2BE2 B;  1S1W A;  1VQL S;  3C6U B;  2A6O A;  2VBZ A;  2BQR A;  1HBM B;  3OL7 A;  3MEE A;  4LF5 J;  3TAQ A;  1VMB A;  1ACM B;  4RBV A;  4ED6 A;  1T3N A;  4USW A;  3MM5 B;  2C2R A;  3PO5 A;  1O6X A;  1UVM A;  1G7C B;  1IR1 A;  2P6T A;  3I31 A;  3HVR A;  4NA2 A;  3I96 A;  4C2M A;  3QGI A;  4TYA A;  5B0A A;  3BBF A;  1ZH5 A;  3NAI A;  2GJI A;  2V9K A;  4DR7 J;  2Q6B A;  5A6W A;  3M7V A;  3GB0 A;  4ZMM A;  3CCJ S;  1FTC A;  4X4Q A;  3LO3 A;  3KUH A;  3RB6 A;  2B6A A;  3DRR B;  2WBM A;  4DL3 A;  2Y0S D;  3ZTR A;  2R8H A;  4DV5 J;  3DOK B;  3J7Y U;  4CTA B; 
#chains in the Genus database with same CATH homology
 2ZWO A;  3P5B P;  3WIV A;  1SCJ B;  3WHI A;  4JP8 A;  2Z57 B;  3WIU A;  2PMW A;  3H42 A;  4YN3 B;  1SPB P;  3VHQ A;  4K8R A;  1ITP A;  3BPS P;  3GCX P;  2W2P P;  2Z56 B;  3AFG A;  2Z2Z A;  4NMX A;  4OV6 A;  2W2O P;  3CNQ P;  2W2M P;  2Z30 B;  2XTJ P;  1R6V A;  2ZWP A;  2W2N P;  4NE9 C;  3CO0 P;  3BGO P;  3T41 A;  3A3O B;  3A3P B;  3SQO P;  1V5I B;  3GCW P;  3A3N B;  2Z2Y B;  3QFH A;  2QTW A;  2Z58 B;  2E1P A;  3VV2 B;  2W2Q P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...