2W2MP

Wt pcsk9-deltac bound to wt egf-a of ldlr
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
92
Chain Sequence
TATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/receptor
molecule keywords PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
publication title Structural and Biochemical Characterization of the Wild Type Pcsk9/Egf-Ab Complex and Natural Fh Mutants.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 92
sequence length 92
ec nomenclature ec 3.4.21.-:
pdb deposition date 2008-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF05922 Inhibitor_I9 Peptidase inhibitor I9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 2w2mP01
2QTWA 1R6VA 3GCXP 2ZWOA 3CNQP 3P5BP 3WHIA 4K8RA 2Z58B 2XTJP 3A3PB 2W2MP 3H42A 3BGOP 3BPSP 2PMWA 2W2OP 3AFGA 4OV6A 3GCWP 3A3OB 2Z57B 3A3NB 2W2PP 1SPBP 3WIUA 1V5IB 2E1PA 3QFHA 2Z2YB 2Z30B 4YN3B 3VHQA 3WIVA 2Z56B 4NMXA 1ITPA 2W2NP 3T41A 4JP8A 3CO0P 4NE9C 3VV2B 2Z2ZA 3SQOP 2ZWPA 1SCJB 2W2QP
chains in the Genus database with same CATH superfamily
1UJ5A 3ZZ0A 3SCLE 2ADBA 3BS9A 4F4KA 3VQSA 2Z30B 2Z56B 3H2LA 3MPDA 3K58A 1IR0A 2XY5A 4PWDB 4LIRA 3NG8A 3W2WB 4AT1B 3OVBA 3AJDA 2UXDF 4JV5F 4ZVOB 3C15B 4EK2A 4RW6B 2MZQA 4L74A 4NLDA 5HMWA 2DR6A 2P9GA 4UY85 5F0UA 4WTOB 3I9V9 2QGFB 2JC1A 4ZVFA 4XTTA 2AYMA 1KOHA 2UUCJ 2JLGA 2NYHA 1E6YB 1RT5A 4DSIA 5HQMA 3Q8VA 1N5YA 3L9ZA 4YMEA 1FRKA 3GJQB 3OR1A 3BZQA 1PYOB 1EJ7L 4KKOB 1MU2A 4J91A 5DDRC 1YJ7A 3W9JA 2UVWA 1GQEA 4EO8A 4N8OA 2XHWA 3MM8B 2WBMA 2CAJA 4F02A 2QA4S 4URQU 2FJDB 4JI0J 1JLEA 1BQNB 4NPOA 2RIJA 1FJ7A 1N4LA 3VV2B 2KN4A 4DSJA 1WSVA 4KFBB 2XS5A 2NUHA 2ZWOA 1PYTA 3SV4A 2HQFA 4DQPA 1SJFA 4PXCA 4H4OA 3OVSA 4DU8A 2XZWA 3A1YG 3CB4A 1WHVA 1JK9B 3I5BA 2DYAA 1Q4RA 3Q22A 5EGYA 2LQBA 2A2DA 2DHAA 1QJHA 4DV7F 4UF4A 3RTVA 3V6DA 1OS5A 2GGPB 2HZCA 2HFZA 5KT3A 5GADI 2MZSA 5L46A 2H1YA 1W25A 1T3OA 2E1MC 2DJWA 1HHQA 1WORA 3GV5B 1KNZA 2FC8A 3HHEA 2MQOA 2HFVA 1AW0A 1TZ0A 3TA1A 4Y2MA 1WG1A 2VPXB 2HZVA 4DSLA 4IFVA 1N5VA 2EFNA 4OX7A 2V9WA 1SH3A 4I1TA 4Y0FA 2FYXA 2ZDOA 3EJMA 2FVCA 1T8EA 1TP7A 2DXFA 1QAYA 2DO0A 4A8FA 2YTCA 2VONA 4B3OB 4OV6A 1DY3A 3D67A 5JJBA 3TNVA 4ELVA 1QY7A 3CCQS 5DQHA 5IC4B 4KIAA 4DFKA 1K1SA 3FZBA 1SKRA 2V8HA 2ZVSA 1UEUA 1RXOB 5DQIA 1UWBA 5T7LA 1NJZA 3A8JA 4TY8A 2CPJA 2OFHX 2R7XA 2PC6A 3M05A 2OPPA 1EP4A 1S12A 5IOLA 3HDSA 3W5ZA 1K73T 1X8DA 3T19A 3PKMA 3MM9A 3BPSP 5JMNA 2QSFA 1Q82T 1PYSB 2CA9A 1PSDA 1UEKA 4ZVEA 2HVIA 2UUCF 4FS1A 4LFAF 4Y2CA 2HHQA 4LR7A 1RAHB 2XMTA 4M63A 4URGA 2EEYA 1NAQA 4A48A 1FX2A 4C8MA 1HD1A 3QJPA 2DRDA 4IUFA 1IM4A 3SXLA 2VIHA 2DNHA 5JVGQ 5DZ6A 4X66J 3O2IA 5CXTA 1HMVA 3CJRA 3C46A 2J9DA 2LA6A 2QX0A 4OJ1A 2M8DB 3LAKA 1R43A 4DN0A 3FDSA 1IWGA 2GVZB 2IA0A 2LDYA 3MR6A 2HS3A 4J9MA 5ITHA 3IAM9 1CG2A 2G13A 5A76A 2KT5A 3KOAA 4ZCMA 3E2EA 3QT6A 4EGLA 3QJLA 3UN3A 3HCXA 1NZ8A 5HO4A 5KG1A 1RT6B 4DR7J 3LA0A 4RU2A 1YJWS 4B02A 4C8ZA 1RAGB 5HVHA 2MB0B 2AJFE 1JLAA 1CJTB 2IDLA 4WE1A 3OFGA 1Q78A 3DDIA 3HULA 1YZ6A 3M8PB 3JAMU 3MGJA 3THTA 4PEOA 3IBCB 2BW2A 1KQFB 1QAXA 5J2PB 1UVKA 1KQSR 3GONA 2ZBCA 1TU0B 3TWZA 1PKUA 1U1RA 1I51B 1VRUB 2O01C 1QAJA 4K2XA 2HS4A 4GKKJ 3W8GA 3Q86A 1BWEA 4I2QB 3CW2C 1N36F 2HFNA 2QRRA 4CLTA 3MFIA 2ZBRA 2U1AA 2KRBA 4UY8T 1FRIA 2YKOA 5D3GB 3UVJA 4NLYA 5D0HA 3UNGC 3VF0B 1OQ6A 2HQGA 1N32F 1MG7A 3RW7A 2MKSA 5KFNA 1O8BA 2QJ3A 3C19A 2XEXA 2AD9A 2VBWA 3X3UA 3THPA 3DCAA 4C11A 4ZPVR 3BPDA 2DNRA 1S6PA 2LKZA 1NZAA 4KPYA 3VALA 3CF5Q 1MWZA 2FB0A 1X4AA 1B0TA 3MM7B 2MY7A 4P52A 3KHGA 2PMHA 3VTIA 2IMOA 1SL2A 5LJ5Y 2XMMA 2RDIA 3DRRA 1T7PA 2VG5B 1C2PA 3PR5B 7FD1A 3DHWC 2F8MA 1GMVA 1RWWB 2MSSA 4LMZA 3WIVA 4J9QA 1S9EB 2BX6A 2KJVA 2A10A 2XMKA 3X1LB 5DGAA 2KXFA 2OEKA 2JC0A 2ZBQA 1VQLS 4X66F 1AROP 5LM7E 1Q95G 3SCIE 3C8YA 3T5LA 3VQTA 5B0AA 1HYSA 3IG1B 1HR0F 4F4ZA 1PJ7A 4G6VB 3J7YI 1YTYA 4OZNA 5B0CA 4M5JA 2OHDA 4GVBB 3GSIA 3UFCX 3MEEA 5KFAA 3RBXA 1URNA 2IFXA 2QA4G 2AIRB 3HHLB 2XBPA 4KPCA 1FDDA 1NKCA 2DITA 4UTGA 1YZ7A 3A3NB 3B6BA 5IWAF 5D4NA 5LL6d 4DR7F 5J1NA 4FBTA 2CVEA 3NY0A 2M0GB 3LP0B 3V2UC 1X0FA 2HHVA 2LQ5A 1M5VC 3MD3A 1U4BA 2E7WA 1T9VA 2LYVA 5F0WA 1JKHB 1NBEB 2M5YA 3DHXA 3ELHA 4RW8A 1XERA 1DLOB 4X2BA 3HSZA 2PDAA 5F41A 1AB8A 5KG7A 2V8PA 1XTZA 5ETLA 3GPAA 2NREA 3K8VA 4TY9A 2V9KA 1IKWA 2GAGC 4ALZA 2KO1A 2LU2A 4DV0J 1CJKA 1U0HA 3MAQA 4F4XA 3RAMA 1H7XA 2ATLA 1HIYA 2W9BA 1T9YA 4KQZA 3EDQB 4CNZA 4USMA 2Q6BA 2V2ZA 3SI8A 2OPQB 1DTTA 2AX1A 1WKJA 4KB7A 2EPIA 3AXKA 5J2NA 4MKAA 2BYCA 4LSNA 3NL0A 1KTVA 4U7UD 2E5HA 1SC1B 5GAGI 2V34A 3MI7X 3H25A 5C24A 4PXBA 1PG5B 3LGMA 4QU7A 3KUHA 3V4IB 1K0VA 2XHCA 4MIBA 3KKFA 3CJKB 1TQLA 4FF4A 3UR0A 2VFSA 1T3NA 1NDLA 5E3PA 2XS7A 4B9LA 3PTWA 9RUBA 2LA4A 5J1EB 2QIFA 4ZP6A 2ZH2A 2ILYA 3JQMA 2CJKA 2H9ZA 1B64A 2HWHA 2BANB 4C0HA 3AD9C 2DT9A 4YHHJ 5GMKa 3IRWP 1FJCA 3N6NA 2KT3A 3D1QA 4F8RA 1VDHA 2FIUA 2KL8A 2R2TA 3D5MA 3DC2A 2HHPA 2ZHAA 3VAMA 1E6VA 3DLKB 4FF3A 3OPKA 3EMTA 2BXJA 3MURP 4DR2J 2YVSA 2VQEJ 2AX0A 3TA0A 1MMDA 1U8SA 2VPZB 4QW8A 4NLRA 1YQHA 1OYDA 3D4JA 3HD1A 1SJ3P 3QAEA 4TN2A 1T0TV 1LEOA 1YJTA 2J5AA 3AA9A 4NASA 3I0RB 2JEJA 1FEEA 1IJEB 4MYTA 3D0IE 3UD3P 3EXCX 4H4MA 5EN1A 2KFZA 2QFIA 4TYBA 4M94A 2ZJRQ 3D1HA 5KT5A 3PW4A 3FQLA 1GEHA 3E51A 1WEXA 2M7SA 2HHTA 1VQPS 1FI4A 5DRKA 3LWMA 1REVA 3QT7A 1IXKA 3EZ5A 2CJAA 2WSCC 1IBMJ 3BSOA 1JLBA 2ROGA 1KVJA 5AE2A 2ZH7A 4O4RA 3UO0A 3QO9A 5FDLA 3W5XA 2E5IA 1MWYA 5CD4H 3RR8A 3HF5A 4I56A 1JNZB 1TELA 1R6VA 4J7CA 5ETPA 4DV0F 4WFAQ 4YB5A 4FYYB 2GQ2A 5CH7B 1YX2A 3ONQA 2R7TA 2XO7A 3QIPA 3K5NA 2GAHC 3ILIA 3EWGA 3AXMA 1HPZB 1OSDA 3TAMA 4CH7A 1CJUB 4B9NA 4YN3B 1I3OB 4RLEA 2B7CB 4NLXA 1VQMS 3HZEA 4GMKA 3KWMA 1HNXJ 4JBCA 4LSLA 3RB3A 4B3TF 3FMWA 3AB4B 4W98A 5HK4A 3AFGA 4LJMA 1R27B 2MY8A 4PPDA 3SIPB 3E01B 4DV5F 1FKOB 1S1XB 2HNYB 1FD8A 3CCMS 2AQ4A 2NSCA 3Q89A 4KO0B 3OUYA 3JTNA 4ZITA 5B0DA 1TMJA 4P2FA 4A8MP 3GV8B 2HNDB 4DS4A 3J81j 2JHEA 2BVZA 3DGPA 3KLGA 1RTIA 1VJQA 4YHHF 3CD5A 5KFRA 3UDCA 3PV8A 4I6AA 1SJ4P 1C1BB 4OFZA 2W2MP 5C25A 1T03B 3QFWA 3LP1B 1WF0A 2OMOA 1FXRA 2P2CB 2ZH5A 1VFJA 2DHHA 1FTCA 1WHWA 4G1QB 3ZZUA 1EZZB 2QE5A 3GWCA 5HVFA 2R2RA 5K8MA 3KDOA 4NLVA 4DR2F 2DNQA 4O44B 1A7GE 4K59A 3GG1A 4NI2A 2R3VA 2WONA 3PCOB 4ES3A 2VQFJ 3PO5A 3ZXWA 3MUTP 1T02A 3BDPA 4OL8A 5K14A 2BW7A 2VODA 1HI1A 4FYXB 4KHMA 2ZD1A 1HI0P 1OPZA 1QVGR 3HVWA 4KY3A 2NZCA 5BJRA 2IM2A 1RT3B 2NCKL 4ED5A 1TKDA 2PSZA 5FJ4A 2KB2A 4I6WA 2BJEA 5CYMB 4ZPCA 1U6FA 2EI5A 5IQ6A 2E5JA 3LP2B 1GFWB 4O3NA 1S0OA 2DNOA 2KRRA 3L7OA 2DKOB 1DTQB 3I4PA 2QLFB 3SV3A 1D9DA 3P6YC 2QFJA 2CQ1A 5AXKA 3OVAA 2UZAA 1V9OA 1WI8A 1VRQC 4PQUA 1K9MT 4ZA1A 3M30B 2E66A 1HQUB 1KWMA 3L7UA 1FFWB 2YQ1A 2CQCA 3CDUA 1T94A 1RYRA 5HJYA 3SDEA 3MF5A 1KN6A 4NYPA 3T6BA 1S1VB 3P45B 3CCJS 2VJUA 2PA3A 5K20B 4BWJA 8ATCB 4Q7AA 5KFWA 3DOLB 5HP1A 2GJIA 2LQJA 4ILMA 2ZVIA 2YPYA 3FBCA 1X9SA 2H4WB 2NQPA 2Y1LB 1OMSA 4O3OA 3BO3A 4O3RA 3KG4A 2BQRA 2F63A 2GW8A 5LMNJ 5B09A 3AQPA 1NK8A 4DPXA 1FNXH 2D3O1 4PUOB 1FA0A 1KLNA 1TFYA 4HDGA 2YNGA 3BKTA 1GK8A 2V0NA 2VFUA 1U25A 1TL7B 1AXQA 1H2UX 4EEYA 2VF3A 3RRHA 3PIOQ 1Y4ZB 3HXMA 1WJ9A 4B3RJ 5CCLA 5IT9Y 3QSYB 3LUYA 2YNFB 2EFPA 3U1LA 5K8PA 3KLHA 2CNNB 3IA0A 3TYTA 4GO5X 4X4PA 2L08A 2CJBA 1V3ZA 1CC7A 4F2RA 2GMJA 4NRUA 2HAIA 3KG1A 3SYZA 2M9KA 1U1MA 2ZKUA 2BE7D 1XBWA 1Y5IB 4CIOA 2K3KA 2ALYB 5DDOC 2XMUA 4C48A 4Y34A 2VFVA 1FESA 2R7RA 3GP9A 3KHLA 3R9LA 5C5JA 4KHPJ 2YKMB 2GCFA 3POTB 1OWXA 2EG2A 2CPIA 5MLCV 4ECUA 2MKIA 2HFOA 4LREA 1KVKA 3NKYA 2OAUA 1TAUA 2WOMB 5T14A 2XYPB 3DDNA 3CCVS 4R8UB 1S4EA 4WBFA 3CSKA 1RAAB 4WP8A 4TLRA 1ZBTA 4OI4A 1C4AA 2H5JB 4ZVUB 2JEFA 2D9OA 1IM6A 3C6TA 4DF8A 1S79A 3ZC4A 1U8WA 1FDAA 1FK9A 1R0AB 1LXNA 5G0RB 2KFYA 4R0EA 4FZVA 3MPYA 3C6UA 5F8HA 4PWUA 3BB5A 4C2MA 4DUYJ 2VDHA 1IR2A 3MM6A 5HBMA 1VK8A 3NOCA 2PMWA 1S76D 3UD4P 3PRDA 1SL0A 2WAQD 1ZAWA 3LPEA 2ZOFA 4ZPDA 3CJ4A 4HHHA 2HSEB 4NLUA 1KQGB 4WYWA 2OSRA 4BHQA 4WWSA 4O3SA 3CJ0A 4OHWA 2HQCA 1U1QA 5HLFB 1RT1B 2WW4A 3EGVA 3FEXB 2ZBIA 1IKXB 1QAIA 2GJ2A 4UOFA 1JLQB 1Z4UA 3DLGB 4TQRA 4LFBJ 5LMNF 2P9EA 3D0GE 1D09B 1W26A 2BKNA 1RABB 2PO4A 1ZTTA 4EBEA 4RNNA 2BE2B 3BYRA 5E33A 4HI1A 2IIHA 4TU8A 1TFWA 3ZZYA 4IFYA 2AGOA 3DOKB 3WX4A 2LECA 3CDEA 2PGCA 3OTDA 1FRHA 4MFBA 3W65A 1RTHA 3WX8A 3MAAA 1S9GB 4ECWA 2CQBA 4FYDA 1FFGB 1CQNA 2VASA 4H54A 1BE4A 2DRBA 1U02A 2G1HA 2NLWA 3PR4A 2DNMA 4P73A 1GX5A 3FNNA 3UN5A 2D1CA 4Q0BB 4DXLA 2BMBA 1FJGJ 4F3QA 5KFCA 3TO8A 2V68A 3ITHA 2OEJA 2F9JA 1L5UA 4K4ZA 4NA1A 4KHPF 5EWFA 4PWDA 3BN7A 1HWLA 3W2WA 1VIOA 1TUWA 2LMIA 1F0XA 3L3CA 5K8NA 3C15A 2F8EX 1MNEA 4RW6A 3J81Y 3G2XA 3GQCA 1YRUA 3ZNJ1 2DNLA 3CEDA 1MN7A 1E6YA 1KR4A 1FCAA 1RAIB 2LXFA 3DRXA 5J2QB 1TKZA 1GXUA 3QQCD 2B6AA 3D0HE 4CLKA 3ET6B 3UCGA 3V6HA 2OMLA 1EAYC 3OXGA 4KKOA 5HN0A 5DG9A 1S7IA 2CVIA 2EC0A 3E3XA 2V4JB 2WVBA 3C14A 2GIRA 1X4EA 2Q6CA 4JI4F 1VGYA 1CQMA 2X1AA 4DUYF 1SC6A 2K8GA 5D6GA 1R8HA 4F0KA 1X4FA 4ECYA 2VUGA 4KFBA 1D1UA 2C1EB 4F0HA 4WXOA 4JV2A 3L95X 1YRTA 3I0SB 4G1PA 3U7JA 5K9FA 4YR3A 2XS2A 2OO4A 3IP0A 5THWA 2CIMA 4J37A 1S1UB 3VR1A 1OIAA 4GVLA 1CEZA 2LU1A 3K59A 4FPRA 1RT4B 1TUVA 3J7Z5 1YWXA 3BGRB 5DETA 2J6SA 1UEVA 4FVCA 3PX4A 5HQLA 3C16A 2GGPA 1OQ3A 1MMNA 4ZVPB 5BYQA 4OYIA 2HLUA 1VISA 1DQAA 3MMBB 3N6MA 1B3TA 2C2EA 2XZDB 4P75A 4UT4A 1SPBP 4LFBF 3PW0A 1Q8IA 2ALZA 2PEHA 3KK2A 4I6YA 5F8GA 2KTQA 4G65A 1BHNA 2LXUA 2NXCA 2K1RA 1PAUB 3KJFB 4DI6A 1S0VA 4RPFA 2ZJPQ 2GHVC 5L1IA 4NA3A 3GLJA 1BUXA 3T6JA 1SJ1A 2ZITA 1R8PA 3U1MA 3J80U 3BJYA 4DV6J 1ZM9A 3THVA 4WU2A 3TAPA 3R27A 1CJVB 4DCPB 3M1VA 3AD7C 4I64A 1N34J 4E0DA 4B3OA 2ZHBA 1AZSB 2C2DA 1VI7A 5IV3A 2Z4PA 4ZIWA 2OUGA 4RX6A 2IPOB 3AAWB 2QLBB 1J5EJ 3VAKA 2BOAA 2MGZA 3JSYA 1IKVB 1HWKA 2DNKA 2HVZA 2WHOA 2WVEA 3BREA 5AJ3J 3GFXA 2YWGA 3JYTB 3H42A 4I7FB 3MPVA 4P71A 4USWA 1UA0A 3GJTB 1P1TA 4OZLA 1FE4A 4ETZA 1U6ZA 1KONA 4B08A 4EYIB 1T05A 2HHSA 2QSWA 4RBVA 3OXLA 3OJSA 4TQSA 2KJWA 4J9LA 2JZ5A 1NK5A 1PJ6A 2W1BA 2G2OA 4DR5J 2B4PA 4YY3J 3CC7S 2P5VA 3JAMY 4NZ0A 2W9AA 1AUDA 5EDWA 1XC9A 1RISA 1UJ6A 4LBHA 2RKIA 3B82A 4NYOA 2QO3A 4QJVA 2BZ2A 2EVZA 3KK1B 3NNCA 2CPHA 1KFDA 4I2PB 4DV2J 2J9EA 4JI7J 2GVZA 1T9TA 4O3QA 2CG4A 1H2VZ 5KFPA 2HQDA 2AF6A 1QM9A 3T5HA 4QYZK 1WC3A 2B51A 2QL7B 1UJ4A 4OHYA 2B4OA 4DBQA 1T9UA 1QDUB 3MFHA 4ANDA 5DS7A 2JVRA 5KFDA 2G9OA 3R7SB 1NHUA 4MIWA 2R7UA 3DM2B 4KGMA 2O66A 1L3KA 3PJWA 4J90A 3KLFB 4V1Ak 3GFYA 3EPIA 4HDHA 1P1LA 1ZM3A 2ZH4A 1DAXA 1CJTA 4C8OA 1RBAA 4FXWA 1NM2A 1I94F 1DQ8A 1TTHB 2V4RA 5M2RA 1UAWA 3D6HB 4RW7B 2V8DA 1WEZA 5J2PA 4FN5A 5ADZA 2VH7A 1VQ8S 2GJFA 4YR0A 1NJYA 4ZVSB 2FHJA 1V5VA 1IKYB 1SKUB 3FFIB 3W8PA 5HROB 4I2QA 2DNZA 4N41A 5FD1A 1D9FA 4YUDA 3VAFA 2FQQB 2CDRB 2CKWA 5DGBA 1X5SA 1YVFA 1Q86T 3VAGA 3FGVA 5D3GA 2MKHA 3HHDA 3MECA 2DCUB 1LWCB 3TZYA 5KFZA 3TRGA 2DTJA 1HBMB 3LAMA 1P9QC 3DLLQ 3IR7B 5BXIA 2FJVA 3EYZA 1CULB 4P7TA 2NXUA 5GAHU 5AJ3F 5ETQA 1VBXA 3DXBA 4F36A 4N8NA 3NMRA 5DM7Q 1VRTB 4KBIA 3MM7A 7AT1B 4RUAA 3P49B 5K5MA 4J9SA 3OTOJ 2JVOA 1UW4A 1X4GA 4RO0A 2OD4A 3W9IA 1M5OC 2W01A 3HT0A 4LF5F 1DHMA 3FJ2A 2IY5B 2E7XA 1M5KC 3AQOA 3VWSA 5A0YB 4OYXA 1W2BR 1F9HA 2XY7A 5DJBA 3R5JB 4ELTA 4DR5F 4YY3F 3HX9A 1MW7A 3TVYA 3E8OA 5A6PA 2QMXA 2RU9A 2C28A 2HRTA 4DU7A 4E2FB 3P4UB 3VZHA 2JFDA 2ZWPA 3IRXB 4DV2F 3IG1A 2QA2A 1FRMA 3HVTA 4CM0A 4GVBA 1RGVA 1U2CA 1RJJA 3OBIA 3QYYA 1NLKL 1TL1A 4ZVHA 4U8VA 3HHLA 5KT6A 2A0FB 2CQHA 3TR5A 1UKUA 4DPWA 5IM0B 3DU6A 2RVJA 4LIWA 4ZPBA 3IR5B 2QL5B 3NBPA 3CWJA 3DRSB 3JXOA 2AYEA 2E1AA 4ZVTB 4NMLA 2B9XA 4KSEB 2JLFA 3FCWA 3LP0A 1OSCA 1NK7A 1RT7B 1V5IB 4IKAA 4LQ9A 4MYUA 4GKJJ 1RLDA 1TKXB 3PZPA 2AEJA 4ZVRB 1RHRB 1FFSB 2E5GA 4PYDA 5HAOA 3OXFA 4DL5A 2VB6A 3H20A 2CDQA 3DU5A 1DLOA 1HNVB 1U7LA 2K2PA 2ZE2B 3CO9A 3R5BA 2DNGA 4U7UK 2FD2A 4B9VA 3BYPA 4K4WA 1RWPB 2ZC4A 4HI2A 1TL3B 1S6UA 2Y3YA 3CCLS 4RNHA 3CJQA 1X9WA 4WP3A 3JSBA 2OPQA 5CZXA 6AT1B 2BBEA 2YNIB 4NX9A 3JSMA 2FLNA 1TL4A 4ID8A 2PT0A 3LOUA 4ZCKA 1IUJA 1B0PA 4IOBA 3CCWA 1NJIT 1HBOB 4EU0A 2JDJA 4M5DB 1EKRA 3ZTPA 2IMWP 1Y7PA 1U09A 3RBZA 4Q43A 2JEIA 4ID5A 2VZ9A 3LPYA 3I31A 4QWEA 3MR7A 3V4IA 3UDEA 4PXDA 5IT4A 3D66A 4ZLJA 4P72A 3CJKA 3RRKA 1QD1A 3M6VA 2FJXA 3OTOF 1OY8A 1YK9A 3TEGA 2R4FA 4EI2A 1B99A 3BBFA 3B54A 1KBRA 1RWVB 5L9NA 2BANA 1TVRB 5CQGA 3HFVA 2LEPA 4ZN3A 4K7QA 2KM8B 2LEAA 3R2CJ 3M6XA 4PYAA 4ILRA 3RR7A 4LQ3A 4KGVB 3C2PA 1RZMA 1FE0A 1WWHA 4DCOB 3HHLC 3OHBA 4AQYJ 2HFUA 4WIIA 2DPIA 1UFWA 1LXJA 2YX4A 2DISA 1PIEA 3IBWA 3H7HB 4JI3F 4DWIA 1H73A 3TP2A 2C2MB 2IDEA 2JNJA 2VDIA 2POKA 2KYXA 3PNIA 1FVSA 3A8EA 5ETSA 2F4VF 2VA2A 4FKYA 4KT0C 3RRGA 5D0EA 3KLIA 4ATNA 3GMGA 5B0EA 2MQPA 4USKA 5L1JA 3TUPA 1RWOB 2MLYA 3NGTA 1W2IA 4CLPA 2VBZA 2QL9B 3QT5A 4RUHA 1RE1B 1XN9A 2VG7B 2ZH9A 1G4CA 3KHRA 2CXEA 4DSKA 3AD8C 1HNIB 1Q8LA 4GKJF 4DFJA 2OPSA 3KDNA 4QQBA 4ERDA 1ICEB 4DCJB 4CCHA 1SH0A 3IS9B 1N48A 3GIJA 2J0QD 1QSLA 3MUMP 4OZJA 4PCQA 1XWLA 1RT5B 4UQGA 1N5YB 2RUGA 2AEMA 3OR1B 4ZDNA 3OL9A 4I68A 2ZJQQ 2YWFA 1WOPA 3UCUP 4QOTA 5E3QA 5GAEU 1RWXB 2JWNA 1CC8A 3VHQA 4U8YA 1FRXA 1D0EA 2XCPA 2BJDA 3R5DA 3UNYA 3G6XA 1UZHA 1H6KX 6FDRA 1SKSA 4OX9J 2RSQA 4L3KA 5CYQA 3CJ8A 1JJCB 1CJUA 1T95A 4NCGA 2HRYA 1RSCA 1RTJB 2PFFB 5L39A 3D6MB 1QUPA 4FF2A 2KHDA 4ZLLA 1LW2B 1P8GA 5I3UB 1TK5A 2OLWA 2HNYA 3PYEA 4V19X 1XMOJ 3V6DB 3S6EA 2F4FA 4OYMA 4J9VA 3MAHA 1EHWA 1QUVA 2RU3A 1Z2LA 1S59A 1JJ4A 1Y5LB 4WCEQ 4Y00A 3N79A 2KDOA 4H4KA 2OJ3A 3DFEA 1QVFR 3EDRB 4IRDA 3A3OB 3WQPA 2EC2A 1DURA 1T03A 4Q45A 2F1FA 3H98A 1NKEA 3GTYX 3LP1A 4IFVB 1RA6A 4AQYF 4C3MA 4L72B 4MK8A 1WEYA 3LW5C 4R0JA 4KJIA 1FF2A 3N0VA 4LRDA 2HIQA 1HW8A 4ANEA 4CLYA 1BQXA 4C9DA 2FGOA 2ZUAA 1Q0NA 3BV8A 4DL6A 1RAOA 2IM3A 5CYJA 3Q2TC 2H5IB 2C3YA 3RUBL 5K8OA 5T7LB 1AA1B 2AP6A 2HZAA 1RT3A 5E7OB 3UWTA 3N01A 4TY8B 3KK3B 3JTPA 1FKPA 5H9EK 3HO1A 3HM9A 4CYUA 4Q8EA 4CRJA 5AE1A 3O1LA 2OPPB 5DG8A 5JUMA 4RNFA 3DOMA 3MEDA 3SEOA 2WRMA 4DZDA 3BGFA 2XGQA 1C0TA 4ZS6A 3LP2A 4YB1P 3Q24A 2RS2A 1DTQA 3NS5A 2QMWA 1S49A 1Q16B 2JLEA 2RUSA 2NPFA 3L09A 4DX5A 3BSNA 2P6SA 1HFEL 3AA8A 4WFBQ 2B8QA 3FK4A 1HQUA 1FTRA 3BH6B 3EVMA 3MZIA 4X4VA 1ZM2A 5KFYA 3CGIA 3OFEA 2AGPA 2DCLA 2AZ1A 1R8AA 2R7SA 2MYFA 2EXUA 5C2GA 1OO0B 3CJ2A 4NL5A 4LRBA 1S1VA 2GZOA 5C7PA 4RR5A 4QWBA 1YJNS 2Y1RI 4DMZA 1GTHA 3BSCA 2CNLB 3I4HX 3BKFA 1SC3B 1V6HA 1G7CB 2NUUG 3CIMA 1EQ0A 4PR6A 3U1NA 3ENAA 4KRWA 5CAAA 3ZZOA 1XQIA 2G0JA 4A8WA 5DG7A 3TARA 4H4KC 5BR8F 4KGZB 3DDKA 3M8ZA 2Y0SD 3GYGA 1TL7A 2RDDA 5B08A 3DMJB 3P8BB 3DNCA 1Q53A 3KUEA 4Z7YA 4K50A 4YS2A 2E9TA 3Q8YA 5F8JA 2CQGA 3KFWX 2HVHA 1BWVA 2CQ3A 3VGTA 1S1WB 4OQJA 4WE1B 1KD1T 3FKBA 1RAJA 2YNFA 4DV1J 2R9LA 1V3RA 3DRYA 3ULHA 1H98A 1LW0B 3MM5A 2HRUA 3CC2S 4OLPA 4FYWB 1UVLA 4KTQA 5KFGA 2YKNA 1B0VA 4KH0B 1Y11A 1S6QB 1HBNB 2KXHA 1UTAA 3PG9A 4YFUA 2MQMA 3NOGA 1W7WA 2YKMA 1EB0A 1QE1B 1F5BA 3POTA 3QGGA 4JV1A 2ZNYA 2CPYA 1SB6A 2H54B 4DPYA 2RRBA 1FDNA 3S1TA 2MHNA 4LFAJ 5J1PA 3BF4A 3FMBA 3G8TA 3FEYB 2MDAA 3CDWA 2GO8A 4N5SA 4C11B 3OL8A 1CPZA 2Z2ZA 1MROA 4W92B 1UVIA 4HH1A 3BQ0A 3OD2A 3V4MA 2BJ7A 3HJFA 2HLTA 3QIDA 1H0HB 4O0NA 1R0AA 5KFJA 5G0RA 2HBQB 2ROPA 5B0FA 1U6BA 3GIMA 4ICLB 4DUZF 3TANA 3MOJB 3RAXA 4IO9Q 3NCPA 4GO7X 4NWBA 4PQAA 3O3LA 2MQLA 2MLXA 3IC1A 4UUXA 2FC9A 3GR1A 4L6V3 1JXVA 4DL4A 1HYSB 2FVPA 5DO2A 2X1FA 5FLXU 2UP1A 3S8SA 4Y28C 1RT1A 2MPUA 5KFLA 3S01A 1KSPA 1JLQA 4KH1B 2EK1A 1X60A 4MKYA 2GHWA 2WW8A 4LT6A 1IN0A 2VKRA 2R2UA 2N4DA 3T1HJ 1UPPA 2HNZA 1D3WA 1WC6A 2IAJB 2DNNA 2OPRB 3H8YA 4NLTA 4XDDA 2IYGA 3T3FA 3TOQA 3ILOA 2Z0GA 3DOKA 1N36J 2BRKA 1SXLA 3A8KA 4BCAA 2HQ3A 3MMCB 3DYAA 3OFHA 3M8WA 4DV1F 2D9PA 4F0MA 4WP9A 1S9GA 1J2VA 1N32J 2MJNA 5HVGA 3Q8RB 4N7TA 2GMHA 2C2OB 2OKQA 1P9YA 2NXEA 3KMQA 4JI2F 1WI6A 4QR2A 4IOAQ 1Q5YA 2CWKA 1WDTA 1CJKB 2Y1JA 4Q0BA 4XDCA 4LFCJ 1ZYQA 2W9BB 1GMWA 1S99A 1S0MA 3ICLA 1CVJA 3PYDA 3TI0A 4C98A 4ZCLA 3K5PA 4USHA 1WG5A 1DTTB 5E3AA 2ADCA 4K4YA 1FRJA 1U49A 4ED7A 4OZ2A 2Z8QA 2NZ4A 2C2ZB 2JFKA 5DM6Q 4C3LA 2HEKA 1PJ5A 3UDLA 4BC7A 5KOWA 1LWXA 3MMAB 4P6QA 3T5JA 3DGVA 4B3MJ 2KH9A 1JIHA 4DQRA 5J2QA 3RZAA 2R7OA 2AYBA 1RI7A 3ET6A 1YIJS 2CQIA 3KLEB 4DQQA 2G0IA 2XMWA 1ELOA 2DHGA 2DH9A 2MQQA 5JVHQ 4B9MA 3MCMA 2V5HG 3V81B 5HATA 1ITPA 1HR0J 1M0SA 2ZZNA 4DOZA 1VHIA 4FBUA 3CCUS 4QWCA 2UVRA 2OELA 1O5JA 4LSZB 2EWHA 4ZOSA 3J80Y 4C3KA 3GSDA 2KFNA 2BACA 1RTDA 3HFKA 3I0SA 4M5MA 2IJNA 4NXMJ 2E44A 2ZOMA 4D3GA 5KT4A 5IWAJ 2FHKA 1S1UA 1BMQB 3GJSB 2HGLA 1K8AT 1RT4A 2R42A 3BGRA 4MK7A 5GMDA 4L73A 2U2FA 3EUNA 1NO8A 3MMBA 4AFFA 2KXNB 3SQOP 4BC9A 1RAEB 2B56A 2LXIA 3H2VE 3IFEA 3M8YA 2RQ4A 3T1HF 1B7YB 5A2QU 2GX8A 2WK4A 5A8KB 5ETVA 5DQGA 2N7CA 2XULA 3SBMA 1RUSA 3TW0A 2LCWA 2L41A 3D3CJ 5IQQA 2J9DE 4KAIA 4QR1A 2HK2A 1UW9A 4DZ6A 5E3RA 4WTYA 1PO6A 2IYIA 2A1BA 2FZCB 3M9NB 3IM9A 5KFTA 5F3ZA 4ED2A 4RNMA 3M8RA 2ACYA 4J5OA 2XI3A 1NNDA 4I69A 4BLGA 2AU0A 2L48A 3JSRA 4LFCF 3CD7A 3SCJE 2R7WA 2VPYB 1IKVA 2GC8A 3DXSX 1V3SA 2GQCA 3JYTA 1NU4A 3PEJA 4X4NA 5KFOA 2ZFHA 3HFZB 4PABA 4IG3B 4OI1A 2VA3A 2D3OR 2YWEA 3QWUA 5L1LA 5KG5A 2J7KA 4B3MF 1VQYA 2C3UA 2IA6A 2BQ3A 3T1YJ 1F60B 2XLIA 3K2YA 4IH6A 5D15A 3NGKA 3QRPA 3ZZRA 1BY9A 4OHZA 3T9NA 4ZHRA 1NSQA 4AXJA 1APSA 3H5SA 3KK1A 3ZTOA 1UWAA 1WDDA 2CNKB 3KXDA 2CQPA 1IBLJ 4LRFA 1VBYA 1O51A 3CUNA 4QR0A 2VU5A 2RRNA 4K2JA 4NXMF 3R6LB 4N76A 2W4CA 4HH0A 1SUQB 1JB0C 3R5AA 2QLXA 2HBZB 3QPIA 1NXIA 2E1PA 2GNKA 2IBOA 5F8MA 2I0XA 2K06A 3OR2A 2K7KA 2DIUA 4F4WA 1JNRB 2HGMA 4ECQA 4ZVGA 1DQ9A 1FXLA 5LSOA 1KOOA 3ZFVA 3QNWB 3G9CA 1RCOB 2CPDA 1XR6A 5AXLA 4NI2B 3W3SA 2WONB 1HWUA 2MTLA 2Q79A 3RB6A 3R97A 5K14B 2OGUA 4W90B 2ZD1B 2O3DA 1GH8A 4PAAA 2G2YA 1VQ7S 5LT5A 1WACA 4UOGA 1LWFB 3QLHB 4TYAA 4TVAB 3M8QA 3V5RA 4UOHA 2ASJA 1S48A 2N4CA 5KFQA 3V6JA 5HROA 3HZGA 3IXQA 4NZ6A 1QSYA 4QIVA 3KYLA 2HHHJ 4J9UE 4OYOA 5J2MA 1DARA 2XZTB 4ITSA 2DGOA 1LWCA 4PRFA 4CO4A 1Q8BA 1F2GA 1HBMA 4IQXA 2DGTA 1XNRF 4B3TJ 4A8QA 4Y2AA 2RQCA 2LVWA 3ETMA 4RJVA 3SDEB 1L3TA 1NB2A 3I82A 2UV8G 2HVEA 3RB4A 1TV6A 4ENOA 4DV5J 1M5SA 4IDKA 2XNQA 3NXZA 2BKOA 5HP1B 4LF4J 2KI2A 4HEA9 4DV4J 5KFEA 1YJUA 2B0GA 3CCES 3M32A 2WSEC 1NDKA 1I1GA 1HKAA 3T1YF 1MN9A 2MHEA 3SSQA 4WKRA 2ATCB 4RKUC 2H48B 1G1XA 1DJ0A 1TKTB 4URSA 5A0YA 2OIHA 2BUNA 1ROFA 5KFHA 3V6KA 2YNGB 1YGYA 1VQKS 2I1RA 1Y9OA 3QGHA 3NNHA 1GT8A 1K1QA 4BWMA 1VCTA 4N47A 4A8XA 3IRXA 2HKEA 4ZKAA 1U1KA 3KHHA 2AZ3A 1N5TA 1IBLF 2W9CA 1SIWB 3AT1B 4DDFA 1JLFB 4J9PA 4X4TA 3VZIA 2XC9A 3KLVA 1KRPA 3RW6A 3HHKA 3EVWA 2FHJD 3AOCA 3M2UA 3W60A 5D4OA 2DH8A 4ZIVA 4C8LA 4CTAB 3GYXB 1KHWA 3DRSA 2AWZA 3GZ7A 2MZ1A 1KLMA 1RWNB 5EX3A 4RW9A 2OTLS 2IVMA 1JXEA 4XK8C 1MWQA 1R0CB 2RE1A 4O23A 5GAHI 1RT7A 2KT2A 1RA7A 1ZAXA 1X31C 4IG0A 1TKXA 1QTNB 3LGHA 1U1OA 4DQIA 2DH7A 1HNVA 2VG6B 4MAKA 2L9DA 3JTOA 1X4BA 1HL6A 2FUG9 3CMQA 3RG6A 2IM0A 5ETMA 2WZ1A 4XPCA 4ES1A 4X4UA 3HD2A 3D7SB 3A12A 2HHHF 2NPIA 4ED8A 5LSLA 2F5GA 4R25A 2FZGB 3WHIA 4EZ9A 3CD0A 4LF2A 2XSJB 2CQ4A 2QT7A 2YNIA 1GTEA 3C6UB 2FGCA 2DHXA 4O0IA 3LH2S 5CA5A 5L8RC 1TMMA 1HBOA 1GX6A 4M5DA 2YBVA 4DG1B 3IO1A 3WC0A 1HBUA 1PILA 3UN2A 1N0VC 4USTA 4K5SA 5KFFA 2I6WA 2XB2D 4AE5A 2Y0BB 2J0SD 4ZPAA 3VGSA 5KG4A 1H72C 3HPOA 4LF4F 3AOAA 1S10A 4HVZA 1HLWA 4DV4F 1RAFB 1FWKA 2B9EA 5HL7Q 2VOOA 3EICA 3HHLD 1K0TA 4QBUA 5KG3A 3QRRA 2O5DA 4DN9A 3HVAA 2IM1A 2BEFA 5LXYA 2WBRA 4EO6A 3N6LA 4BDPA 3FCHA 2L9NA 2ZBPA 5T41A 4P74A 1RHKB 1S6OA 4X84A 2C3PA 4IOCQ 4EUVA 2F9DA 4IFYB 1J5OB 3IGVA 1RU1A 4OIXA 1HQEA 4M1KA 1YJVA 3PFOA 1H74A 3FSYA 4LF1A 3PKYA 1SI9A 2X51A 4MFBB 3DRPB 3Q8PB 3TZZA 1Y00A 1NHVA 3D2WA 2V94A 3MAAB 3R1HA 3U27A 4KE5A 5EUHA 3G82B 4WFNQ 5LJ3Y 1VQ5S 4Q2LA 1OY9A 3QJJA 4R5PA 2FY1A 3SSSA 2ZC3A 3F73A 3MTJA 2GVDB 5ETOA 3ENQA 1VYAA 1SV5B 1GXTA 3LGNA 2VG7A 5F9NA 3ITHB 3W62A 1HNIA 2VOPA 4JI6J 1YLXA 1UL3A 3BGOP 4ZPTR 3TEHB 4M5KA 1RQ0A 4X65J 3IS9A 1DZ5A 2B3TB 4WK1A 1TAQA 5IT0A 2AMCB 3GILA 3T1AA 3CT9A 4G3IA 4YEAA 3SCKE 3JB9k 1U1NA 1TKZB 1XNQF 3EVOA 4MT1A 2B6AB 2OTJS 1LWEB 1GNKA 2VV5A 3PM9A 2YH1A 3JQKA 1S0NA 4CLFA 1GAOA 2NXJA 2M70A 3G6VA 1VMBA 1Q7YT 3AJ2A 3TQ1A 2BKPA 3QGIA 3CNQP 3VGUA 3C14B 4LVOP 2QN6B 2BR0A 1N33J 3SSRA 3Q83A 2OEMA 4PG5A 1ZA1B 4USJC 1BQMA 1VQ4S 1VBZA 1F2HA 4JOUA 1RTJA 4AYBD 2R8JA 2GFFA 3EXYA 1JX4A 3HSDA 3F41A 3ZZZA 2J9CA 1IR1A 4OX8A 1LW2A 3OHAA 1VJWA 1CS4B 2KM8C 5I3UA 3J81U 2M4MA 5DDPC 4QWDA 3W7BA 1UVMA 1EQMA 2B8PA 4ILLA 1L3UA 3C16B 5H9EJ 2ZHOA 5HMXA 3ISZA 4CM2A 1CBKA 4WZMA 2ASDA 3KK2B 4OMFG 5H9FJ 3B78A 4C97A 4ETXA 4N77A 2K1RB 2VICA 5A8RA 3TJ8A 4LF8J 2X7IA 3G86A 1VQOS 5GMEA 5IC6B 4LUBA 2DK2A 1WOOA 2DNYA 3ZTRA 1F9FA 4K0KJ 1VQNS 2CQ2A 4AD6A 1D9AA 5D78A 2OSQA 2YNHA 4FXDA 4USVA 2UVUA 4IRKA 2JX2A 5KFIA 1Q81T 5GAEI 3M1VB 2B5JA 4K8RA 4OYBA 1BLUA 2GO9A 1RB0A 4UW2A 1VHFA 2QG9B 4WU3A 2CNOB 1ZZNA 3KMSA 3VAHA 2M52A 1UZDA 4KV8A 1MSWD 4PKDB 4DL2A 5KFSA 3KK3A 1LNQA 2MGZB 4HYKA 1ULRA 3PYFA 3LQVA 4JI6F 2CWXA 5E5NA 2R7QA 4JI4J 1ZS6A 4X65F 4Q2MA 4PG4A 1Y3KA 1T05B 2C2KB 1NEEA 2IJRA 2DR7A 4WFYA 3QRQA 1UP1A 1PGZA 1L3SA 3RU0A 2HFSA 1FWPA 1TK8A 1LV5A 4DJBA 3MR3A 4JI5J 3UQSA 1NJXA 4ZN1A 2N7YA 2RKIB 2RS8A 4JI0F 1N33F 2KG0A 1JLCB 2QMUB 1D8YA 2R7VA 2XY6A 3T9ZA 1RBLA 3OLAA 4DF4A 3TAQA 3H5YA 4JV0A 3OW2R 5EWGA 2CPEA 3WZ0A 3NWGA 3MR2A 4RW4A 1X9MA 2OI2A 5EX0A 3MCNA 1KHVA 4RWXA 2DY1A 1NMEB 1RK8A 2M88A 3NGSA 3KG0A 3FCVA 1RHQB 1VS3A 3DMJA 2ZKTA 2DO4A 4JI8J 2XLJA 1LOUA 4DFMA 3CMES 4CI0B 3J7A1 4X62J 1S1WA 4OYPA 1ZOTA 3VAIA 1U24A 4FKXA 1VK3A 2W2NP 3T41A 5F9LA 3BBCA 4FVMA 2Z2LA 3W2VA 4ECZA 4LF8F 2HIYA 1LW0A 2NYIA 2RF2A 2GMLA 1RHJB 1NK6A 4K0KF 2CJQA 4QIFA 3I6PA 2CZ4A 1VR6A 4L3NA 2R8HA 3MWBA 1J27A 3M9MB 2YX7A 1S6QA 1N0UA 1HBNA 1UVNA 2Z2MA 3O5TB 1VQSA 1S57A 1X0PA 2RQKA 2D7SA 2I38A 2F40A 5D77A 2WVDA 5DLGA 1Q79A 3MECB 1QE1A 1SJQA 2KVIA 3P5TL 3W61A 3MOZA 5HJXA 1K47A 1FDBA 3NCQA 2WSFC 3RAQA 5FLXY 4NZ7A 2RHQB 1M1GA 3ZTQA 1JJ2R 1XJWB 5U47A 3EZUA 1WHYA 2CQDA 4OX6A 1U2RA 2C42A 3CTRA 2HBRB 3HMJG 1VLOA 3MM8A 2GIQA 1Y5NB 3Q23A 4OZ3A 2V2KA 1BQNA 4LF9J 1KKHA 1N56A 1EETB 4ICLA 4M5GA 3K57A 2CPZA 1SH2A 3GIKA 3ISNC 4FNHA 1YBTA 5I3PA 1RDRA 5JXSA 2VHGA 6FD1A 4B17A 2PFDA 2H51B 1FHTA 4NLOA 4K4TA 3BO2A 3CJTA 4YDXA 2IHR1 1Q7LB 4JI5F 4ED0A 4NYZA 2HWIA 1IJFB 4OHVA 3QZ7A 1GMUA 2IC3B 3DI6B 1SC4B 2RNEA 4P2MA 4AL7A 2HHUA 3HVTB 3K7RA 3M2VB 5IZHA 1I94J 1TL1B 5D8HB 5ETNA 1WG4A 2AJ1A 4N56A 4MTPA 2MJUA 2AJ4A 4HTJA 2YPZA 4A8KA 2GV1A 2XYHB 4FDFA 3NBPB 1FNMA 1LQ9A 2IAJA 5E0OA 2OPRA 4KGKA 1WOSA 3C66A 3Q8UA 4JI8F 4U6PA 4DL7A 1QSSA 4X62F 3MMCA 5L38A 1JLGB 3LF0A 5SZTA 5KT7A 3BO4A 2HMIB 2BA9A 4Z2XA 4DL3A 4PG8A 3HKZD 4C8NA 3N28A 2A2CA 5IV4A 1C1CB 2CUYA 1F5AA 3BKUA 2R2SA 4DR6J 3DKDA 2YKAA 3O8WA 3CULA 4ZP8A 1U48A 2IRXA 5B0GA 4NA2A 1L3VA 4GKKF 2R8GA 3SQGB 5KFVA 3G96A 2UU9J 3BGUA 2CG8A 2O1PA 4RL1A 1UFKA 4JI1J 2OH2A 2Z57B 4DX7A 2PIIA 2ROEA 1QLNA 3UDVA 2IVYA 4HLBA 4OYZA 4C6AA 3VCDA 3JSMB 3S7RA 1JJHA 2PI4A 3JQJA 4LBIA 1TUGB 2NR0A 4LRCA 4PXEA 4CLSA 1A6LA 4X64J 1NH7A 3I5CA 4LF5J 2ZH1A 3EPGA 3BH7B 3FVYA 2DY9A 3EX7B 2VFRA 3MMAA 2YQ3A 3K8WA 3R1LA 5I42B 4YDDB 5C42B 1XMQJ 4ID5B 2IBKA 3KLEA 4B9TA 1PAEX 1N52B 1SJRA 5A8WB 5KOXA 2BJ8A 1KEKA 3MXHP 2CZ9A 2H4YB 4ZLPA 3V81A 2V6AA 3RBEA 5A2QY 4LF9F 2WVFA 3R5CA 3K5MA 1NJWA 2CZVC 4ZJLA 2CPFA 2C2NA 2DGUA 1Q8KA 3EZOA 4YB7A 4A8OA 1LK5A 3HK2A 4OZ0A 3MCSA 2JSXA 3R7BB 2LLZA 1HW9A 4I0WA 4QZVB 1RT6A 1M5PC 2W24A 5DZ7A 3DLEB 5KG0A 5EWEA 1FKAF 2FJBB 9ATCB 2AHOB 3FBFA 4OV1A 4CZCA 4YOEA 2WB1D 4P9SA 5CD4A 1FNOA 4AUKA 4EBCA 1SL1A 2V69A 4ED3A 3OLBA 3M6UA 1FO1A 2EW9A 3M8PA 3UI3A 1HNZJ 1HQ2A 1S1TB 4TXSA 3TQEA 5KFBA 1RTZA 3MEGB 4OI2A 3HVRA 3PRBA 4DPUA 3KLIB 4DX8H 1GMWD 5A8KA 2XMAA 3QAUA 1VRUA 3FQKA 1TL5A 4RUBA 3BQ2A 4LR9A 4JUZA 2BM1A 2HQIA 4A8YA 4DR4J 2OPSB 1H38A 4ZMMA 4U67Q 1FRLA 1NUEA 3M7VA 3OTEA 2ZH3A 4DUTA 1S97A 4FYVB 4OYWA 2RDJA 2J7UA 2V50A 3R3TA 2R8KA 1KTQA 5CABA 4CO1A 2ZH8A 1G6BA 4O4GB 4QW9A 4DR6F 2G2ZA 2V8GA 5LSRA 4UUWA 4D3HA 3H4BA 2IVFB 4CT8A 3D28A 4ES2A 3H90A 2XTJP 2UU9F 1S9FA 4JI1F 1C4CA 4QIWD 3CMAS 1I5OB 3MUVP 3PDNA 4OLOA 1AFJA 3A13A 3IWLA 3K5OA 3Q0AA 3CCZA 3ZO7A 1IBKJ 4F4YA 2AV5A 1N8RT 4IG3A 4X64F 5CYQB 1RWUA 2VG5A 1NRKA 4DL0C 4OI3A 4JP8A 4NCGB 1NB7A 4MJKA 1S9EA 2ILZA 4HT5A 3LWLA 3GB0A 1VIXA 1ZTWA 1XMQF 4GRSA 2W2OP 3J7ZT 4RBUA 1SIZA 3GIRA 3D68A 3PACA 2L9WA 3MDFA 3G8QA 1RKJA 1TK0A 5L9XA 3HI9A 4CNYA 4KR0B 4WFXA 1HWJA 2WCXA 4JI3J 4A8SA 4DR1J 2EFOA 4J9OA 1C0UB 4LRAA 4HACB 5H1SV 3W66A 2EBGA 3PIPQ 2F4VJ 4LR8A 4O3PA 1SUQA 3TUIC 2J76E 2KVQE 2XCAA 3M8SA 4BS2A 1FEHA 1SVDA 4ZP9A 4KGXB 4S0MA 2VQEF 2MZTA 3LO3A 3T5KA 2N82B 1HD0A 3CCSS 1JKHA 1HNZF 1ZPVA 4WZQA 3D54A 3NAIA 3KNAA 4UZCA 1WF1A 2DGSA 1KS2A 2FJEB 4F25A 1U47A 3OTCA 3W9HA 1FKPB 1LWFA 3QLHA 3W64A 4CYUB 2BDPA 3I56S 2DR8A 4DR4F 3DOMB 3MEDB 1UVJA 3BDEA 2XWYA 4CP5A 3PW5A 2VC1A 3CE8A 1C0TB 3IR6B 3H5UA 1ZZFA 2HHXA 2MQ8A 4X4SA 1IBMF 2ASYA 4ER8A 3R8YA 1GXLA 3TVZA 2D41A 2VBXA 5BYSA 4X4OA 4CLWA 1U26A 1U45A 3OSNA 1A9NB 2RAQA 1JMTA 7FDRA 1R31A 3MR5A 3R6GB 1OJ4A 4IH5A 3CXCR 2LQ9A 2XWXA 3D6TB 4Q8FA 1JQGA 3ENVA 1X5OA 3GG0A 1IBKF 3N9UC 2QC3A 3A3PB 3FSXA 2FVRA 5J1EA 2HGNA 5IFMA 1NK9A 2E9ZA 2MXYA 1FERA 4QIGA 5KFXA 3CO0P 3KJVB 2DNPA 1VC6A 3TA2A 4USUA 1HNXF 2QEXS 4E8UA 4Q44A 2AKWB 4TNOA 3P3DA 1TKTA 1Z2ZA 2FLLA 5M2PA 4NCAA 3DN9A 1RT2B 2XNRA 2PI5A 3M2RB 4WF9Q 4TLQA 4OZ5A 3DLKA 5CHCB 2MSTA 3QWPA 1N6QB 5HMYA 4DEZA 1YKWA 4AL5A 1O0PA 5MAOA 4DHVA 3A8IA 4DR1F 3ZZPA 1JLFA 4WJBA 3J7AN 1Q1KA 1X7VA 5G4DA 2I5JB 4UZBA 3AOBA 2MKKA 2PD1A 3PYGA 3MM5B 2WVCA 3I0RA 3OV7A 5KFUA 2B9WA 4Y2KA 4FXVA 1VOMA 4KHRA 1G3OA 2A6MA 3EE3A 3HHNB 2YKNB 5GADU 4CT9A 2LDIA 4RNOA 4CTAA 4YB6A 2FJAB 2Q1LA 3NGUA 2HVDA 4JB8B 3OL6A 2Q66A 1SCJB 2V2QA 5I3QA 4U7CA 2VQFF 1HA1A 2BRLA 2UXBJ 2X1BA 4MH8A 2W2PP 4PG7A 3BM7A 2XI2A 2PMZD 2EG1A 2H3EB 2VG6A 4A46A 2C2RA 2H5EA 1ZM4A 1NK4A 3C3LA 2QLWA 1MU2B 1S4FA 2BM0A 2G1DA 4K4VA 4K4XA 3GV7B 1R8BA 5LXRA 1MROB 3NS7B 1RHMB 4MKBA 4YR2A 3JS9A 4MK9A 4ED1A 1JLEB 2VPWB 2DXDA 4NEYA 1YJRA 3OJUA 3QT8A 1HPZA 4HT7A 2XSJA 2D74B 2W4PA 4USIA 3R5GA 4Z7CA 5KG6A 4OJ3A 4MIAA 3MHYA 1DBDA 4H4OB 4DG1A 4IO1A 2H65B 3E01A 2MMYA 3UE2A 1FKOA 2MQNA 1S1XA 5BR8J 4XO0A 5KTQA 2F7VA 1R0BG 4KO0A 1UFLA 4J9NA 2J0WA 4DS5A 3TZWA 2HNDA 3KNGA 2FLPA 2F65A 2N3OA 3PO4A 2Y1IA 2SXLA 3F56A 1S7HA 1WNEA 3VVUA 4IR1A 1Y0HA 1C1BA 2DGWA 3NCRA 3W63A 4HHUA 2WB4A 2W7AA 3KJQB 4V19J 1RBOB 4DPOA 2CRLA 3H5XA 4CH1A 3EM1A 3FC9A 1PBUA 3FZ2A 4G1QA 3G71S 1FVQA 2HNZB 4MKVA 2DGVA 2A6OA 2JL9A 4DSFA 3WIUA 4O44A 3WBZA 1J5OA 2QZ8A 3FSIA 2DHSA 4AL6A 4B3RF 3DYAB 3MEKA 2D69A 3DRPA 4U9RA 4C7QA 2KZMA 1D8ZA 2BQUA 1VC0A 3FUYA 3I55S 1EIYB 4CO5A 3G82A 2DGQA 2RMLA 5D0GA 3D1OA 1UWBB 4RWWA 3OL7A 4XPEA 2QYCA 2W7PA 2V2VA 1YITS 1N5SA 2GVDA 1ZETA 1WKKA 5CYMA 2HWTA 2MLZA 2XLKA 1SV5A 1EP4B 2CJ9A 3MM9B 3CC4S 5KG2A 2ZEJA 1BD6A 4QPTA 2W7OA 3VGVA 4AXIA 1ZAVA 3BBBA 2VD3A 2UXBF 1RU2A 2ACMA 4X4RA 1XR7A 2MEWA 3IWXA 1H3DA 2FVQA 4DUZJ 3QSIA 3A4TA 3M30A 1KC8T 1PC5A 1U2FA 2FLOA 4RBTA 1HNWJ 1NCLA 3ZNUA 3UD5A 4CWBA 1EKSA 1LWEA 1X4HA 3O44A 3IMQJ 3OT9A 2P9CA 2N3LA 3VVTA 2DR5A 1HMVB 2B9YA 1KDNA 4ECTA 1AYEA 4HTIA 4PPZA 1DFDA 3B4MA 1NH8A 4Y6IA 3DOLA 4DV3J 3KUGA 4XAKA 3SMZA 5ETRA 4M5HA 4C8YA 1U1PA 1RTDB 1VQ6S 1IBCB 3G8SA 1HHTP 5GVQA 5KFMA 3TUJC 1Z1ZA 5A6WA 2IRUA 3W5YA 1VQ9S 3BR8A 3FRYA 2W2QP 4PUOA 3GR0A 4QIEA 5AXMA 1WSRA 2E29A 1FX4A 4KYZA 1CS4A 3RJMB 2YQ0A 1RACB 1JLAB 2FHMA 4P10A 1X5PA 2YY3A 5F3TA 2AJQA 2HYIB 2A18A 3PHTA 5B0BA 3LANA 3I87A 4EWTA 2ERRA 2M3DA 2YX1A 2FTRA 1R8CA 1YDLA 1NPRA 5LMUJ 2UUAJ 1FXDA 4JI2J 2EBEA 4C0OC 4QCLA 5HQ8A 2CADA 3J7YU 1KFSA 4KC5A 5L1KA 4I4BA 4WPAA 1LK7A 4DLEA 5ETKA 2IRYA 4Y3CA 2XMVA 3DLBA 1Y10A 2G0CA 2XO6A 2QV6A 1NPPA 2Y8YA 1QTMA 3UVJB 2DD8S 5CZVA 3CJ5A 2WTFA 1Q5VA 2YH0A 3GIIA 3U02A 2Y8WA 3OTBA 3P5BP 2WOMA 1F5CA 2DEJA 3KJNB 4R8UA 3MD1A 1K44A 4UQTA 4QPXA 4TU7A 3NWRA 1S6PB 1FJGF 4JYAJ 1REGX 3NP5A 3K17A 5D0RA 3R7NB 3PFEA 3Q8QB 2C3MA 2O67A 2Q3PA 3NRBA 4NCBA 1S77D 4EMDA 2YKPA 3GE9A 2UUWA 3DRRB 3G6YA 2M8HA 1RCXB 1XMBA 1KQKA 4QYRA 3FRZA 5BYRA 1HNWF 3CIZA 2B43A 1Y3JA 4Y2IA 1RHUB 4IR9A 2DXEA 3FBBA 1UPMB 1SQGA 3MPWA 4L75A 4F7VA 1F3VA 3P96A 4A47A 2B4UA 1M1KT 3US5A 5I4MA 4YP3A 3F44A 4OJGA 4NLGA 4DV3F 4IQMA 3HP6A 2JRSA 4ZHRB 3PX0A 1NHKL 4CO3A 1H7WA 1WHXA 2P8IA 5HLFA 3TZXA 2CYYA 1JLCA 2GA7A 5GAGU 4OZ1A 2AW0A 4F50A 1IKXA 2MZRA 3MEEB 1RKIA 1P27B 2YKQA 4HR2A 2YWWA 3DLGA 3EGWB 4RU9A 1S5ZA 3MMJA 1KP6A 2I8EA 4F3MA 5C2CA 1CLFA 3G87A 2PA8D 4WYLA 4FNIA 4ECVA 4NLPA 2W8KA 1NK0A 2BE2A 1IVZA 5E41A 3IGNA 1YHQS 3EGZA 2X1GA 3OR2B 2FY8A 2ZNZA 3PVXA 1ZPWX 4LVNP 3HJVA 3W1YC 2FDNA 3D6FB 1R7IA 1LFWA 4WIQA 4F3OA 1YBUA 4K4UA 3PJXA 3UW1A 4PZVA 1FJEB 3QFHA 2DPJA 4DX6A 4RW8B 5IXUA 3BQ1A 5LMUF 2UUAF 3H2UB 2AYGA 3BGLA 2HG4A 2MZJA 3NGRA 3GCWP 1IKWB 1YG0A 2RILA 3I32A 2UV8A 4PG6A 3M8QB 3ZZTA 1U0HB 4NXNJ 4OI6A 4IH7A 2A3JA 3BN4A 3CJSA 3QGPA 3AH6A 4DV6F 2ZZMA 4EBDA 2K7JA 1FT8A 2FHOB 1WC0A 1HWIA 4CH0S 2VKZG 1N34F 1X5TA 2E1RA 8AT1B 4E98A 2KKHA 2XSFA 3NEKA 2V4QA 5J2MB 4TKTA 2KYZA 2GS8A 1RLCL 3CCTA 5J2NB 4LSNB 3K89A 1VLYA 4J9KA 2KU7A 4Q5VA 4FF1A 4QU6A 1J5EF 5C24B 4DR3J 1M5HA 4JYAF 3K0JA 1U0SA 1YJ9S 3ISND 2UUBJ 1TV6B 1ZA2B 3N5FA 3UCZP 4IDKB 2V4JA 3L7PA 5KAKA 3SFGA 1CSJA 2ZZTA 3PJ9A 3QZ8A 5IS2A 3L4BC 3PXGa 2F8HA 2DGXA 5FIIA 3ILLA 2EFGA 4C8KA 2HS0A 1EETA 4I67A 4HKQA 3M32B 5F8NA 4FPIA 1RADB 1NKBA 4IRCA 2ZH6A 2QA1A 4DPTA 1ACMB 5HI7A 4DQSA 2YWHA 2B7BB 3WDOA 3FEZA 3AODA 1E6VB 3BR9A 2EFQA 1R89A 3SFUA 4M5IA 1R6YA 1EX8A 4F2SA 1WUUA 1UCNA 2GIFA 3M9OB 2FPHX 3OSPA 2EKNA 4U95A 4JI7F 2IC3A 1XIQA 3DI6A 3GFZA 4HL9A 1O6XA 1NDPA 2W9CB 4ELUA 1BGXT 1HARA 5M2UA 3EGNA 4GC6A 3M2VA 4G1IA 1RWMB 3CDBA 2C22A 3OQ2A 2E9RX 2ZDPA 2KHCA 3M2UB 4H4MB 4F67A 4DLGA 2ABYA 3IBFB 3RYLA 2Z58B 1KLMB 5F8IA 4RW9B 2LFVA 1NPKA 2GQQA 2MKYA 2D3UA 1CJVA 2J6UA 4ZJOA 1PCAA 1REVB 1SBRA 2UVVA 1B4SA 4IG0B 3LTOA 2HURA 1BC6A 2JEGA 4B3SJ 1JLGA 1WD6A 4QWAA 2HMIA 2GHPA 1AZSA 2HBYB 4TU9A 4OI0A 4NEZA 1JLBB 1MMLA 4F4AA 3QO9B 2UUTA 5FDLB 3UPFA 1C1CA 3R2DJ 4ECSA 4ZLNA 2HW3A 2XMJA 4NXNF 1XNRJ 4L76A 4QYZJ 3PW7A 1FWLA 1F1BB 3AB2B 4CLZA 1S72S 3SQGA 4ZCIA 4Y65A 3N4WA 4ED4A 2AGQA 3IAS9 4I7FA 4XIUA 2YXLA 2V8VA 3QIPB 5HMZA 4IYQA 2QLJB 2YWKA 4ZJQA 4UOCA 5D4PA 3I9ZA 4B9UA 2RT3A 3TAMB 2XYGB 1RYSA 3TJAA 4EFAC 3MCOA 3QMQA 4LF6J 1R3NA 2LQ8A 4OJHA 3PX6A 4LF7J 5D4LA 2DVIA 4B9SA 2XM3A 2RD5C 2PEBA 2CQ0A 3OFFA 4LSLB 4WKYA 3DLHA 3Q2SC 1HBUB 4DR3F 2DEIA 2CPXA 5I42A 4ZP7A 1X4DA 2UUBF 1WC1A 1URRA 1WC5A 5C42A 2W4DA 2E5LJ 3NMAA 5ETTA 5A8WA 2ZOGA 3OUYB 1XR5A 2EKYA 4RUCA 4I2PA 2KG1A 3HSGA 3PHEA 2DRAA 1HHSA 3DGPB 3KLGB 1RTIB 2ZUGA 1WF2A 1A0OB 1JWWA 4GC7A 5C25B 5B7WA 2NXNA 2HAFA 4ZPWR 4FP9A 4NRTA 2B4VA 1T9WA 4ECXA 5E3CA 2V63A 5DDQC 2AT1B 3TX8A 3AHPA 3DM2A 4CLLA 2CJYB 4J9RA 3ZTSA 3M6WA 3KLFA 2V67A 3PW2A 3I96A 1HQEB 1JXLA 3DLEA 3BEGB 2BABA 2Z2YB 3ILJA 2F3JA 3SZ2A 3WC2A 1SQFA 1NSKL 2MKJA 3GYNA 3M4XA 4NLWA 5KT2A 2VFTA 2DBBA 1I6JA 5HSPA 4RW7A 1S1TA 3VAJA 3IM8A 4R5PB 5RUBA 2BJ3A 2BJ9A 4NMXA 3MEGA 1MLAA 3DLJA 1UA1A 4WK3A 1YSJA 1B70B 2J8SA 1NSAA 1FD2A 4X4QA 2D3ZA 1IKYA 3FFIA 4CO2A 1T11A 4OHXA 3RGIA 3CD6S 1IQZA 3PRVA 3NS6A 2I2YA 3HLUA 4B3SF 3TX0A 5F8LA 4CO0A 5EHHA 2LP4A 4EZ6A 2G4BA 4DSEA 1M1HA 3AJ1A 1IWAA 1EARA 2OP5A 2R8IA 4PQUB 2UXCJ 4K5RA 1YBAA 1NSPA 4O4GA 2RH3A 1OYEA 1YRXA 2I9SA 2QTWA 2APOA 2VBYA 1CULA 1PBAA 1T9XA 1WC4A 4CLUA 3TUZC 1VRTA 3IWNC 4OYAA 5AT1B 2FVSA 1F6TA 1SQEA 1X4CA 1AUSL 4LF6F 2P6TA 1N54B 2L3MA 4LF7F 3ETOA 2EFVA 2BOPA 1BQMB 2PN6A 1VBKA 3D3BJ 2DR9A 2VC0A 1F3FA 1IQTA 1BXNA 2J7WA 3K5LA 1UMJA 2CJXB 3F0NA 1HI8A 5CCMA 2HHWA 3ENWA 4RZRA 3MTKA 3N5BA 2HPUA 2E5LF 3TJ9A 2E7VA 1NDCA 4P2SA 2ASLA 2PE8A 2NS1B 3NNAA 2BE9B 4NLQA 4P2XA 4BBYA 1P6TA 4M5NA 2BJ1A 1KVIA 2KZZA 3I5AA 3HKWA 3BSAA 2RB7A 3HT3A 3KLHB 2XGPA 1ZH5A 1WTFA 3GCXP 3RB0A 1C0UA 2IJFA 4HACA 4CDIA 2COLA 2ZM6J 5A8RB 2OFGX 5IM0A 1B7FA 2BV3A 1DRZA 2W25A 4WXWA 2XQCA 5E2QA 2YNHB 5AE3A 1SKWA 3CJ3A 3PEHA 2RQMA 1TR0A 3GU0A 4F04B 2B5JB 1PC4A 2XG8A 4LBPA 4W4MA 8RUCA 5KFKA 3D9BA 2UXDJ 4JV5J 4PWWA 4Z37A 4M8LA 3CDAA 4A4JA 2OD6A 5HANA 2ZE2A 1AT1B 3PY8A 2QYGA 3NAHA 1LFPA 2JJ4D 4KV8B 1XNQJ 1RWKB 5IT9U 1TL3A 2X3GA 3C6TB 2MKCA 1G2EA 1RP5A 4WFZA 1N5QA 2E1CA 1FK9B 3TVKA 3G4SS 5H9FK 3GFHA 2VL1A 4C4WA 3O6QA 4EYHB 2UXCF 5AXNA 3LALA 1WTBA 3ADAC 3MM6B 5HBMB 4MMOA 4U96A 2RRAA 4CQ1A 4YQWA 2J8AA 3H0PA 2AJ2A 4ZK7M 2HK3A 5SUHA 3NGDA 1WELA 1U1LA 1OPIA 4NE9C 3NLCA 3B8HA 3KTQA 2VJVA 3HSJA 3AY0A 4NOHA 4ED6A 2JH3A 2Q43A 3CPWR 3FBEA 1XK8A 1XEZA 4DV7J 1M90T 4OX9F 2AJ0A 2DB1A 2NSBA 2C3OA 1AFIA 2J6TA 1VC5A 3B4DA 3QATA 3KJVA 1TVRA 4K4SA 3CCRS 2M2BA 4FS2A 2RJZA 1OY6A 4C0BA 1N88A 4HHJA 4F26A 3CVKA 1YI2S 3RBDA 4RW4B 2CFXA 1RT2A 5LOQA 1UETA 5DLFA 3M2RA 2EK6A 2J0XA 4NLSA 3H4DA 1XMOF 3GJRB 2AEFA 2K3IA 2RHSB 3MPUB 1N6QA 3G6ES 2FJWA 3Q8SB 2DIVA 1LKZA 3H59A 1RTHB 3QBCA 4M95A 3UR3C 4ZVQB 2Y9HA 2FZKB 1WKLA 4P7VA 2LEBA 4M5LA 4ANCA 2I5JA 2W8LA 2ZM6F 3W2VB 1H2TZ 3IN5A 1F9EB 4DFPA 4ECRA 2X3DA 2RF2B 2JOQA 3H40A
chains in the Genus database with same CATH topology
2QTWA 1R6VA 3GCXP 2ZWOA 3CNQP 3P5BP 3WHIA 4K8RA 2Z58B 2XTJP 3A3PB 2W2MP 3H42A 3BGOP 3BPSP 2PMWA 2W2OP 3AFGA 4OV6A 3GCWP 3A3OB 2Z57B 3A3NB 2W2PP 1SPBP 3WIUA 1V5IB 2E1PA 3QFHA 2Z2YB 2Z30B 4YN3B 3VHQA 3WIVA 2Z56B 4NMXA 1ITPA 2W2NP 3T41A 4JP8A 3CO0P 4NE9C 3VV2B 2Z2ZA 3SQOP 2ZWPA 1SCJB 2W2QP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QTW A;  1R6V A;  3GCX P;  2ZWO A;  3CNQ P;  3P5B P;  3WHI A;  4K8R A;  2Z58 B;  2XTJ P;  3A3P B;  2W2M P;  3H42 A;  3BGO P;  3BPS P;  2PMW A;  2W2O P;  3AFG A;  4OV6 A;  3GCW P;  3A3O B;  2Z57 B;  3A3N B;  2W2P P;  1SPB P;  3WIU A;  1V5I B;  2E1P A;  3QFH A;  2Z2Y B;  2Z30 B;  4YN3 B;  3VHQ A;  3WIV A;  2Z56 B;  4NMX A;  1ITP A;  2W2N P;  3T41 A;  4JP8 A;  3CO0 P;  4NE9 C;  3VV2 B;  2Z2Z A;  3SQO P;  2ZWP A;  1SCJ B;  2W2Q P; 
#chains in the Genus database with same CATH topology
 1UJ5 A;  3ZZ0 A;  3SCL E;  2ADB A;  3BS9 A;  4F4K A;  3VQS A;  2Z30 B;  2Z56 B;  3H2L A;  3MPD A;  3K58 A;  1IR0 A;  2XY5 A;  4PWD B;  4LIR A;  3NG8 A;  3W2W B;  4AT1 B;  3OVB A;  3AJD A;  2UXD F;  4JV5 F;  4ZVO B;  3C15 B;  4EK2 A;  4RW6 B;  2MZQ A;  4L74 A;  4NLD A;  5HMW A;  2DR6 A;  2P9G A;  4UY8 5;  5F0U A;  4WTO B;  3I9V 9;  2QGF B;  2JC1 A;  4ZVF A;  4XTT A;  2AYM A;  1KOH A;  2UUC J;  2JLG A;  2NYH A;  1E6Y B;  1RT5 A;  4DSI A;  5HQM A;  3Q8V A;  1N5Y A;  3L9Z A;  4YME A;  1FRK A;  3GJQ B;  3OR1 A;  3BZQ A;  1PYO B;  1EJ7 L;  4KKO B;  1MU2 A;  4J91 A;  5DDR C;  1YJ7 A;  3W9J A;  2UVW A;  1GQE A;  4EO8 A;  4N8O A;  2XHW A;  3MM8 B;  2WBM A;  2CAJ A;  4F02 A;  2QA4 S;  4URQ U;  2FJD B;  4JI0 J;  1JLE A;  1BQN B;  4NPO A;  2RIJ A;  1FJ7 A;  1N4L A;  3VV2 B;  2KN4 A;  4DSJ A;  1WSV A;  4KFB B;  2XS5 A;  2NUH A;  2ZWO A;  1PYT A;  3SV4 A;  2HQF A;  4DQP A;  1SJF A;  4PXC A;  4H4O A;  3OVS A;  4DU8 A;  2XZW A;  3A1Y G;  3CB4 A;  1WHV A;  1JK9 B;  3I5B A;  2DYA A;  1Q4R A;  3Q22 A;  5EGY A;  2LQB A;  2A2D A;  2DHA A;  1QJH A;  4DV7 F;  4UF4 A;  3RTV A;  3V6D A;  1OS5 A;  2GGP B;  2HZC A;  2HFZ A;  5KT3 A;  5GAD I;  2MZS A;  5L46 A;  2H1Y A;  1W25 A;  1T3O A;  2E1M C;  2DJW A;  1HHQ A;  1WOR A;  3GV5 B;  1KNZ A;  2FC8 A;  3HHE A;  2MQO A;  2HFV A;  1AW0 A;  1TZ0 A;  3TA1 A;  4Y2M A;  1WG1 A;  2VPX B;  2HZV A;  4DSL A;  4IFV A;  1N5V A;  2EFN A;  4OX7 A;  2V9W A;  1SH3 A;  4I1T A;  4Y0F A;  2FYX A;  2ZDO A;  3EJM A;  2FVC A;  1T8E A;  1TP7 A;  2DXF A;  1QAY A;  2DO0 A;  4A8F A;  2YTC A;  2VON A;  4B3O B;  4OV6 A;  1DY3 A;  3D67 A;  5JJB A;  3TNV A;  4ELV A;  1QY7 A;  3CCQ S;  5DQH A;  5IC4 B;  4KIA A;  4DFK A;  1K1S A;  3FZB A;  1SKR A;  2V8H A;  2ZVS A;  1UEU A;  1RXO B;  5DQI A;  1UWB A;  5T7L A;  1NJZ A;  3A8J A;  4TY8 A;  2CPJ A;  2OFH X;  2R7X A;  2PC6 A;  3M05 A;  2OPP A;  1EP4 A;  1S12 A;  5IOL A;  3HDS A;  3W5Z A;  1K73 T;  1X8D A;  3T19 A;  3PKM A;  3MM9 A;  3BPS P;  5JMN A;  2QSF A;  1Q82 T;  1PYS B;  2CA9 A;  1PSD A;  1UEK A;  4ZVE A;  2HVI A;  2UUC F;  4FS1 A;  4LFA F;  4Y2C A;  2HHQ A;  4LR7 A;  1RAH B;  2XMT A;  4M63 A;  4URG A;  2EEY A;  1NAQ A;  4A48 A;  1FX2 A;  4C8M A;  1HD1 A;  3QJP A;  2DRD A;  4IUF A;  1IM4 A;  3SXL A;  2VIH A;  2DNH A;  5JVG Q;  5DZ6 A;  4X66 J;  3O2I A;  5CXT A;  1HMV A;  3CJR A;  3C46 A;  2J9D A;  2LA6 A;  2QX0 A;  4OJ1 A;  2M8D B;  3LAK A;  1R43 A;  4DN0 A;  3FDS A;  1IWG A;  2GVZ B;  2IA0 A;  2LDY A;  3MR6 A;  2HS3 A;  4J9M A;  5ITH A;  3IAM 9;  1CG2 A;  2G13 A;  5A76 A;  2KT5 A;  3KOA A;  4ZCM A;  3E2E A;  3QT6 A;  4EGL A;  3QJL A;  3UN3 A;  3HCX A;  1NZ8 A;  5HO4 A;  5KG1 A;  1RT6 B;  4DR7 J;  3LA0 A;  4RU2 A;  1YJW S;  4B02 A;  4C8Z A;  1RAG B;  5HVH A;  2MB0 B;  2AJF E;  1JLA A;  1CJT B;  2IDL A;  4WE1 A;  3OFG A;  1Q78 A;  3DDI A;  3HUL A;  1YZ6 A;  3M8P B;  3JAM U;  3MGJ A;  3THT A;  4PEO A;  3IBC B;  2BW2 A;  1KQF B;  1QAX A;  5J2P B;  1UVK A;  1KQS R;  3GON A;  2ZBC A;  1TU0 B;  3TWZ A;  1PKU A;  1U1R A;  1I51 B;  1VRU B;  2O01 C;  1QAJ A;  4K2X A;  2HS4 A;  4GKK J;  3W8G A;  3Q86 A;  1BWE A;  4I2Q B;  3CW2 C;  1N36 F;  2HFN A;  2QRR A;  4CLT A;  3MFI A;  2ZBR A;  2U1A A;  2KRB A;  4UY8 T;  1FRI A;  2YKO A;  5D3G B;  3UVJ A;  4NLY A;  5D0H A;  3UNG C;  3VF0 B;  1OQ6 A;  2HQG A;  1N32 F;  1MG7 A;  3RW7 A;  2MKS A;  5KFN A;  1O8B A;  2QJ3 A;  3C19 A;  2XEX A;  2AD9 A;  2VBW A;  3X3U A;  3THP A;  3DCA A;  4C11 A;  4ZPV R;  3BPD A;  2DNR A;  1S6P A;  2LKZ A;  1NZA A;  4KPY A;  3VAL A;  3CF5 Q;  1MWZ A;  2FB0 A;  1X4A A;  1B0T A;  3MM7 B;  2MY7 A;  4P52 A;  3KHG A;  2PMH A;  3VTI A;  2IMO A;  1SL2 A;  5LJ5 Y;  2XMM A;  2RDI A;  3DRR A;  1T7P A;  2VG5 B;  1C2P A;  3PR5 B;  7FD1 A;  3DHW C;  2F8M A;  1GMV A;  1RWW B;  2MSS A;  4LMZ A;  3WIV A;  4J9Q A;  1S9E B;  2BX6 A;  2KJV A;  2A10 A;  2XMK A;  3X1L B;  5DGA A;  2KXF A;  2OEK A;  2JC0 A;  2ZBQ A;  1VQL S;  4X66 F;  1ARO P;  5LM7 E;  1Q95 G;  3SCI E;  3C8Y A;  3T5L A;  3VQT A;  5B0A A;  1HYS A;  3IG1 B;  1HR0 F;  4F4Z A;  1PJ7 A;  4G6V B;  3J7Y I;  1YTY A;  4OZN A;  5B0C A;  4M5J A;  2OHD A;  4GVB B;  3GSI A;  3UFC X;  3MEE A;  5KFA A;  3RBX A;  1URN A;  2IFX A;  2QA4 G;  2AIR B;  3HHL B;  2XBP A;  4KPC A;  1FDD A;  1NKC A;  2DIT A;  4UTG A;  1YZ7 A;  3A3N B;  3B6B A;  5IWA F;  5D4N A;  5LL6 d;  4DR7 F;  5J1N A;  4FBT A;  2CVE A;  3NY0 A;  2M0G B;  3LP0 B;  3V2U C;  1X0F A;  2HHV A;  2LQ5 A;  1M5V C;  3MD3 A;  1U4B A;  2E7W A;  1T9V A;  2LYV A;  5F0W A;  1JKH B;  1NBE B;  2M5Y A;  3DHX A;  3ELH A;  4RW8 A;  1XER A;  1DLO B;  4X2B A;  3HSZ A;  2PDA A;  5F41 A;  1AB8 A;  5KG7 A;  2V8P A;  1XTZ A;  5ETL A;  3GPA A;  2NRE A;  3K8V A;  4TY9 A;  2V9K A;  1IKW A;  2GAG C;  4ALZ A;  2KO1 A;  2LU2 A;  4DV0 J;  1CJK A;  1U0H A;  3MAQ A;  4F4X A;  3RAM A;  1H7X A;  2ATL A;  1HIY A;  2W9B A;  1T9Y A;  4KQZ A;  3EDQ B;  4CNZ A;  4USM A;  2Q6B A;  2V2Z A;  3SI8 A;  2OPQ B;  1DTT A;  2AX1 A;  1WKJ A;  4KB7 A;  2EPI A;  3AXK A;  5J2N A;  4MKA A;  2BYC A;  4LSN A;  3NL0 A;  1KTV A;  4U7U D;  2E5H A;  1SC1 B;  5GAG I;  2V34 A;  3MI7 X;  3H25 A;  5C24 A;  4PXB A;  1PG5 B;  3LGM A;  4QU7 A;  3KUH A;  3V4I B;  1K0V A;  2XHC A;  4MIB A;  3KKF A;  3CJK B;  1TQL A;  4FF4 A;  3UR0 A;  2VFS A;  1T3N A;  1NDL A;  5E3P A;  2XS7 A;  4B9L A;  3PTW A;  9RUB A;  2LA4 A;  5J1E B;  2QIF A;  4ZP6 A;  2ZH2 A;  2ILY A;  3JQM A;  2CJK A;  2H9Z A;  1B64 A;  2HWH A;  2BAN B;  4C0H A;  3AD9 C;  2DT9 A;  4YHH J;  5GMK a;  3IRW P;  1FJC A;  3N6N A;  2KT3 A;  3D1Q A;  4F8R A;  1VDH A;  2FIU A;  2KL8 A;  2R2T A;  3D5M A;  3DC2 A;  2HHP A;  2ZHA A;  3VAM A;  1E6V A;  3DLK B;  4FF3 A;  3OPK A;  3EMT A;  2BXJ A;  3MUR P;  4DR2 J;  2YVS A;  2VQE J;  2AX0 A;  3TA0 A;  1MMD A;  1U8S A;  2VPZ B;  4QW8 A;  4NLR A;  1YQH A;  1OYD A;  3D4J A;  3HD1 A;  1SJ3 P;  3QAE A;  4TN2 A;  1T0T V;  1LEO A;  1YJT A;  2J5A A;  3AA9 A;  4NAS A;  3I0R B;  2JEJ A;  1FEE A;  1IJE B;  4MYT A;  3D0I E;  3UD3 P;  3EXC X;  4H4M A;  5EN1 A;  2KFZ A;  2QFI A;  4TYB A;  4M94 A;  2ZJR Q;  3D1H A;  5KT5 A;  3PW4 A;  3FQL A;  1GEH A;  3E51 A;  1WEX A;  2M7S A;  2HHT A;  1VQP S;  1FI4 A;  5DRK A;  3LWM A;  1REV A;  3QT7 A;  1IXK A;  3EZ5 A;  2CJA A;  2WSC C;  1IBM J;  3BSO A;  1JLB A;  2ROG A;  1KVJ A;  5AE2 A;  2ZH7 A;  4O4R A;  3UO0 A;  3QO9 A;  5FDL A;  3W5X A;  2E5I A;  1MWY A;  5CD4 H;  3RR8 A;  3HF5 A;  4I56 A;  1JNZ B;  1TEL A;  1R6V A;  4J7C A;  5ETP A;  4DV0 F;  4WFA Q;  4YB5 A;  4FYY B;  2GQ2 A;  5CH7 B;  1YX2 A;  3ONQ A;  2R7T A;  2XO7 A;  3QIP A;  3K5N A;  2GAH C;  3ILI A;  3EWG A;  3AXM A;  1HPZ B;  1OSD A;  3TAM A;  4CH7 A;  1CJU B;  4B9N A;  4YN3 B;  1I3O B;  4RLE A;  2B7C B;  4NLX A;  1VQM S;  3HZE A;  4GMK A;  3KWM A;  1HNX J;  4JBC A;  4LSL A;  3RB3 A;  4B3T F;  3FMW A;  3AB4 B;  4W98 A;  5HK4 A;  3AFG A;  4LJM A;  1R27 B;  2MY8 A;  4PPD A;  3SIP B;  3E01 B;  4DV5 F;  1FKO B;  1S1X B;  2HNY B;  1FD8 A;  3CCM S;  2AQ4 A;  2NSC A;  3Q89 A;  4KO0 B;  3OUY A;  3JTN A;  4ZIT A;  5B0D A;  1TMJ A;  4P2F A;  4A8M P;  3GV8 B;  2HND B;  4DS4 A;  3J81 j;  2JHE A;  2BVZ A;  3DGP A;  3KLG A;  1RTI A;  1VJQ A;  4YHH F;  3CD5 A;  5KFR A;  3UDC A;  3PV8 A;  4I6A A;  1SJ4 P;  1C1B B;  4OFZ A;  2W2M P;  5C25 A;  1T03 B;  3QFW A;  3LP1 B;  1WF0 A;  2OMO A;  1FXR A;  2P2C B;  2ZH5 A;  1VFJ A;  2DHH A;  1FTC A;  1WHW A;  4G1Q B;  3ZZU A;  1EZZ B;  2QE5 A;  3GWC A;  5HVF A;  2R2R A;  5K8M A;  3KDO A;  4NLV A;  4DR2 F;  2DNQ A;  4O44 B;  1A7G E;  4K59 A;  3GG1 A;  4NI2 A;  2R3V A;  2WON A;  3PCO B;  4ES3 A;  2VQF J;  3PO5 A;  3ZXW A;  3MUT P;  1T02 A;  3BDP A;  4OL8 A;  5K14 A;  2BW7 A;  2VOD A;  1HI1 A;  4FYX B;  4KHM A;  2ZD1 A;  1HI0 P;  1OPZ A;  1QVG R;  3HVW A;  4KY3 A;  2NZC A;  5BJR A;  2IM2 A;  1RT3 B;  2NCK L;  4ED5 A;  1TKD A;  2PSZ A;  5FJ4 A;  2KB2 A;  4I6W A;  2BJE A;  5CYM B;  4ZPC A;  1U6F A;  2EI5 A;  5IQ6 A;  2E5J A;  3LP2 B;  1GFW B;  4O3N A;  1S0O A;  2DNO A;  2KRR A;  3L7O A;  2DKO B;  1DTQ B;  3I4P A;  2QLF B;  3SV3 A;  1D9D A;  3P6Y C;  2QFJ A;  2CQ1 A;  5AXK A;  3OVA A;  2UZA A;  1V9O A;  1WI8 A;  1VRQ C;  4PQU A;  1K9M T;  4ZA1 A;  3M30 B;  2E66 A;  1HQU B;  1KWM A;  3L7U A;  1FFW B;  2YQ1 A;  2CQC A;  3CDU A;  1T94 A;  1RYR A;  5HJY A;  3SDE A;  3MF5 A;  1KN6 A;  4NYP A;  3T6B A;  1S1V B;  3P45 B;  3CCJ S;  2VJU A;  2PA3 A;  5K20 B;  4BWJ A;  8ATC B;  4Q7A A;  5KFW A;  3DOL B;  5HP1 A;  2GJI A;  2LQJ A;  4ILM A;  2ZVI A;  2YPY A;  3FBC A;  1X9S A;  2H4W B;  2NQP A;  2Y1L B;  1OMS A;  4O3O A;  3BO3 A;  4O3R A;  3KG4 A;  2BQR A;  2F63 A;  2GW8 A;  5LMN J;  5B09 A;  3AQP A;  1NK8 A;  4DPX A;  1FNX H;  2D3O 1;  4PUO B;  1FA0 A;  1KLN A;  1TFY A;  4HDG A;  2YNG A;  3BKT A;  1GK8 A;  2V0N A;  2VFU A;  1U25 A;  1TL7 B;  1AXQ A;  1H2U X;  4EEY A;  2VF3 A;  3RRH A;  3PIO Q;  1Y4Z B;  3HXM A;  1WJ9 A;  4B3R J;  5CCL A;  5IT9 Y;  3QSY B;  3LUY A;  2YNF B;  2EFP A;  3U1L A;  5K8P A;  3KLH A;  2CNN B;  3IA0 A;  3TYT A;  4GO5 X;  4X4P A;  2L08 A;  2CJB A;  1V3Z A;  1CC7 A;  4F2R A;  2GMJ A;  4NRU A;  2HAI A;  3KG1 A;  3SYZ A;  2M9K A;  1U1M A;  2ZKU A;  2BE7 D;  1XBW A;  1Y5I B;  4CIO A;  2K3K A;  2ALY B;  5DDO C;  2XMU A;  4C48 A;  4Y34 A;  2VFV A;  1FES A;  2R7R A;  3GP9 A;  3KHL A;  3R9L A;  5C5J A;  4KHP J;  2YKM B;  2GCF A;  3POT B;  1OWX A;  2EG2 A;  2CPI A;  5MLC V;  4ECU A;  2MKI A;  2HFO A;  4LRE A;  1KVK A;  3NKY A;  2OAU A;  1TAU A;  2WOM B;  5T14 A;  2XYP B;  3DDN A;  3CCV S;  4R8U B;  1S4E A;  4WBF A;  3CSK A;  1RAA B;  4WP8 A;  4TLR A;  1ZBT A;  4OI4 A;  1C4A A;  2H5J B;  4ZVU B;  2JEF A;  2D9O A;  1IM6 A;  3C6T A;  4DF8 A;  1S79 A;  3ZC4 A;  1U8W A;  1FDA A;  1FK9 A;  1R0A B;  1LXN A;  5G0R B;  2KFY A;  4R0E A;  4FZV A;  3MPY A;  3C6U A;  5F8H A;  4PWU A;  3BB5 A;  4C2M A;  4DUY J;  2VDH A;  1IR2 A;  3MM6 A;  5HBM A;  1VK8 A;  3NOC A;  2PMW A;  1S76 D;  3UD4 P;  3PRD A;  1SL0 A;  2WAQ D;  1ZAW A;  3LPE A;  2ZOF A;  4ZPD A;  3CJ4 A;  4HHH A;  2HSE B;  4NLU A;  1KQG B;  4WYW A;  2OSR A;  4BHQ A;  4WWS A;  4O3S A;  3CJ0 A;  4OHW A;  2HQC A;  1U1Q A;  5HLF B;  1RT1 B;  2WW4 A;  3EGV A;  3FEX B;  2ZBI A;  1IKX B;  1QAI A;  2GJ2 A;  4UOF A;  1JLQ B;  1Z4U A;  3DLG B;  4TQR A;  4LFB J;  5LMN F;  2P9E A;  3D0G E;  1D09 B;  1W26 A;  2BKN A;  1RAB B;  2PO4 A;  1ZTT A;  4EBE A;  4RNN A;  2BE2 B;  3BYR A;  5E33 A;  4HI1 A;  2IIH A;  4TU8 A;  1TFW A;  3ZZY A;  4IFY A;  2AGO A;  3DOK B;  3WX4 A;  2LEC A;  3CDE A;  2PGC A;  3OTD A;  1FRH A;  4MFB A;  3W65 A;  1RTH A;  3WX8 A;  3MAA A;  1S9G B;  4ECW A;  2CQB A;  4FYD A;  1FFG B;  1CQN A;  2VAS A;  4H54 A;  1BE4 A;  2DRB A;  1U02 A;  2G1H A;  2NLW A;  3PR4 A;  2DNM A;  4P73 A;  1GX5 A;  3FNN A;  3UN5 A;  2D1C A;  4Q0B B;  4DXL A;  2BMB A;  1FJG J;  4F3Q A;  5KFC A;  3TO8 A;  2V68 A;  3ITH A;  2OEJ A;  2F9J A;  1L5U A;  4K4Z A;  4NA1 A;  4KHP F;  5EWF A;  4PWD A;  3BN7 A;  1HWL A;  3W2W A;  1VIO A;  1TUW A;  2LMI A;  1F0X A;  3L3C A;  5K8N A;  3C15 A;  2F8E X;  1MNE A;  4RW6 A;  3J81 Y;  3G2X A;  3GQC A;  1YRU A;  3ZNJ 1;  2DNL A;  3CED A;  1MN7 A;  1E6Y A;  1KR4 A;  1FCA A;  1RAI B;  2LXF A;  3DRX A;  5J2Q B;  1TKZ A;  1GXU A;  3QQC D;  2B6A A;  3D0H E;  4CLK A;  3ET6 B;  3UCG A;  3V6H A;  2OML A;  1EAY C;  3OXG A;  4KKO A;  5HN0 A;  5DG9 A;  1S7I A;  2CVI A;  2EC0 A;  3E3X A;  2V4J B;  2WVB A;  3C14 A;  2GIR A;  1X4E A;  2Q6C A;  4JI4 F;  1VGY A;  1CQM A;  2X1A A;  4DUY F;  1SC6 A;  2K8G A;  5D6G A;  1R8H A;  4F0K A;  1X4F A;  4ECY A;  2VUG A;  4KFB A;  1D1U A;  2C1E B;  4F0H A;  4WXO A;  4JV2 A;  3L95 X;  1YRT A;  3I0S B;  4G1P A;  3U7J A;  5K9F A;  4YR3 A;  2XS2 A;  2OO4 A;  3IP0 A;  5THW A;  2CIM A;  4J37 A;  1S1U B;  3VR1 A;  1OIA A;  4GVL A;  1CEZ A;  2LU1 A;  3K59 A;  4FPR A;  1RT4 B;  1TUV A;  3J7Z 5;  1YWX A;  3BGR B;  5DET A;  2J6S A;  1UEV A;  4FVC A;  3PX4 A;  5HQL A;  3C16 A;  2GGP A;  1OQ3 A;  1MMN A;  4ZVP B;  5BYQ A;  4OYI A;  2HLU A;  1VIS A;  1DQA A;  3MMB B;  3N6M A;  1B3T A;  2C2E A;  2XZD B;  4P75 A;  4UT4 A;  1SPB P;  4LFB F;  3PW0 A;  1Q8I A;  2ALZ A;  2PEH A;  3KK2 A;  4I6Y A;  5F8G A;  2KTQ A;  4G65 A;  1BHN A;  2LXU A;  2NXC A;  2K1R A;  1PAU B;  3KJF B;  4DI6 A;  1S0V A;  4RPF A;  2ZJP Q;  2GHV C;  5L1I A;  4NA3 A;  3GLJ A;  1BUX A;  3T6J A;  1SJ1 A;  2ZIT A;  1R8P A;  3U1M A;  3J80 U;  3BJY A;  4DV6 J;  1ZM9 A;  3THV A;  4WU2 A;  3TAP A;  3R27 A;  1CJV B;  4DCP B;  3M1V A;  3AD7 C;  4I64 A;  1N34 J;  4E0D A;  4B3O A;  2ZHB A;  1AZS B;  2C2D A;  1VI7 A;  5IV3 A;  2Z4P A;  4ZIW A;  2OUG A;  4RX6 A;  2IPO B;  3AAW B;  2QLB B;  1J5E J;  3VAK A;  2BOA A;  2MGZ A;  3JSY A;  1IKV B;  1HWK A;  2DNK A;  2HVZ A;  2WHO A;  2WVE A;  3BRE A;  5AJ3 J;  3GFX A;  2YWG A;  3JYT B;  3H42 A;  4I7F B;  3MPV A;  4P71 A;  4USW A;  1UA0 A;  3GJT B;  1P1T A;  4OZL A;  1FE4 A;  4ETZ A;  1U6Z A;  1KON A;  4B08 A;  4EYI B;  1T05 A;  2HHS A;  2QSW A;  4RBV A;  3OXL A;  3OJS A;  4TQS A;  2KJW A;  4J9L A;  2JZ5 A;  1NK5 A;  1PJ6 A;  2W1B A;  2G2O A;  4DR5 J;  2B4P A;  4YY3 J;  3CC7 S;  2P5V A;  3JAM Y;  4NZ0 A;  2W9A A;  1AUD A;  5EDW A;  1XC9 A;  1RIS A;  1UJ6 A;  4LBH A;  2RKI A;  3B82 A;  4NYO A;  2QO3 A;  4QJV A;  2BZ2 A;  2EVZ A;  3KK1 B;  3NNC A;  2CPH A;  1KFD A;  4I2P B;  4DV2 J;  2J9E A;  4JI7 J;  2GVZ A;  1T9T A;  4O3Q A;  2CG4 A;  1H2V Z;  5KFP A;  2HQD A;  2AF6 A;  1QM9 A;  3T5H A;  4QYZ K;  1WC3 A;  2B51 A;  2QL7 B;  1UJ4 A;  4OHY A;  2B4O A;  4DBQ A;  1T9U A;  1QDU B;  3MFH A;  4AND A;  5DS7 A;  2JVR A;  5KFD A;  2G9O A;  3R7S B;  1NHU A;  4MIW A;  2R7U A;  3DM2 B;  4KGM A;  2O66 A;  1L3K A;  3PJW A;  4J90 A;  3KLF B;  4V1A k;  3GFY A;  3EPI A;  4HDH A;  1P1L A;  1ZM3 A;  2ZH4 A;  1DAX A;  1CJT A;  4C8O A;  1RBA A;  4FXW A;  1NM2 A;  1I94 F;  1DQ8 A;  1TTH B;  2V4R A;  5M2R A;  1UAW A;  3D6H B;  4RW7 B;  2V8D A;  1WEZ A;  5J2P A;  4FN5 A;  5ADZ A;  2VH7 A;  1VQ8 S;  2GJF A;  4YR0 A;  1NJY A;  4ZVS B;  2FHJ A;  1V5V A;  1IKY B;  1SKU B;  3FFI B;  3W8P A;  5HRO B;  4I2Q A;  2DNZ A;  4N41 A;  5FD1 A;  1D9F A;  4YUD A;  3VAF A;  2FQQ B;  2CDR B;  2CKW A;  5DGB A;  1X5S A;  1YVF A;  1Q86 T;  3VAG A;  3FGV A;  5D3G A;  2MKH A;  3HHD A;  3MEC A;  2DCU B;  1LWC B;  3TZY A;  5KFZ A;  3TRG A;  2DTJ A;  1HBM B;  3LAM A;  1P9Q C;  3DLL Q;  3IR7 B;  5BXI A;  2FJV A;  3EYZ A;  1CUL B;  4P7T A;  2NXU A;  5GAH U;  5AJ3 F;  5ETQ A;  1VBX A;  3DXB A;  4F36 A;  4N8N A;  3NMR A;  5DM7 Q;  1VRT B;  4KBI A;  3MM7 A;  7AT1 B;  4RUA A;  3P49 B;  5K5M A;  4J9S A;  3OTO J;  2JVO A;  1UW4 A;  1X4G A;  4RO0 A;  2OD4 A;  3W9I A;  1M5O C;  2W01 A;  3HT0 A;  4LF5 F;  1DHM A;  3FJ2 A;  2IY5 B;  2E7X A;  1M5K C;  3AQO A;  3VWS A;  5A0Y B;  4OYX A;  1W2B R;  1F9H A;  2XY7 A;  5DJB A;  3R5J B;  4ELT A;  4DR5 F;  4YY3 F;  3HX9 A;  1MW7 A;  3TVY A;  3E8O A;  5A6P A;  2QMX A;  2RU9 A;  2C28 A;  2HRT A;  4DU7 A;  4E2F B;  3P4U B;  3VZH A;  2JFD A;  2ZWP A;  3IRX B;  4DV2 F;  3IG1 A;  2QA2 A;  1FRM A;  3HVT A;  4CM0 A;  4GVB A;  1RGV A;  1U2C A;  1RJJ A;  3OBI A;  3QYY A;  1NLK L;  1TL1 A;  4ZVH A;  4U8V A;  3HHL A;  5KT6 A;  2A0F B;  2CQH A;  3TR5 A;  1UKU A;  4DPW A;  5IM0 B;  3DU6 A;  2RVJ A;  4LIW A;  4ZPB A;  3IR5 B;  2QL5 B;  3NBP A;  3CWJ A;  3DRS B;  3JXO A;  2AYE A;  2E1A A;  4ZVT B;  4NML A;  2B9X A;  4KSE B;  2JLF A;  3FCW A;  3LP0 A;  1OSC A;  1NK7 A;  1RT7 B;  1V5I B;  4IKA A;  4LQ9 A;  4MYU A;  4GKJ J;  1RLD A;  1TKX B;  3PZP A;  2AEJ A;  4ZVR B;  1RHR B;  1FFS B;  2E5G A;  4PYD A;  5HAO A;  3OXF A;  4DL5 A;  2VB6 A;  3H20 A;  2CDQ A;  3DU5 A;  1DLO A;  1HNV B;  1U7L A;  2K2P A;  2ZE2 B;  3CO9 A;  3R5B A;  2DNG A;  4U7U K;  2FD2 A;  4B9V A;  3BYP A;  4K4W A;  1RWP B;  2ZC4 A;  4HI2 A;  1TL3 B;  1S6U A;  2Y3Y A;  3CCL S;  4RNH A;  3CJQ A;  1X9W A;  4WP3 A;  3JSB A;  2OPQ A;  5CZX A;  6AT1 B;  2BBE A;  2YNI B;  4NX9 A;  3JSM A;  2FLN A;  1TL4 A;  4ID8 A;  2PT0 A;  3LOU A;  4ZCK A;  1IUJ A;  1B0P A;  4IOB A;  3CCW A;  1NJI T;  1HBO B;  4EU0 A;  2JDJ A;  4M5D B;  1EKR A;  3ZTP A;  2IMW P;  1Y7P A;  1U09 A;  3RBZ A;  4Q43 A;  2JEI A;  4ID5 A;  2VZ9 A;  3LPY A;  3I31 A;  4QWE A;  3MR7 A;  3V4I A;  3UDE A;  4PXD A;  5IT4 A;  3D66 A;  4ZLJ A;  4P72 A;  3CJK A;  3RRK A;  1QD1 A;  3M6V A;  2FJX A;  3OTO F;  1OY8 A;  1YK9 A;  3TEG A;  2R4F A;  4EI2 A;  1B99 A;  3BBF A;  3B54 A;  1KBR A;  1RWV B;  5L9N A;  2BAN A;  1TVR B;  5CQG A;  3HFV A;  2LEP A;  4ZN3 A;  4K7Q A;  2KM8 B;  2LEA A;  3R2C J;  3M6X A;  4PYA A;  4ILR A;  3RR7 A;  4LQ3 A;  4KGV B;  3C2P A;  1RZM A;  1FE0 A;  1WWH A;  4DCO B;  3HHL C;  3OHB A;  4AQY J;  2HFU A;  4WII A;  2DPI A;  1UFW A;  1LXJ A;  2YX4 A;  2DIS A;  1PIE A;  3IBW A;  3H7H B;  4JI3 F;  4DWI A;  1H73 A;  3TP2 A;  2C2M B;  2IDE A;  2JNJ A;  2VDI A;  2POK A;  2KYX A;  3PNI A;  1FVS A;  3A8E A;  5ETS A;  2F4V F;  2VA2 A;  4FKY A;  4KT0 C;  3RRG A;  5D0E A;  3KLI A;  4ATN A;  3GMG A;  5B0E A;  2MQP A;  4USK A;  5L1J A;  3TUP A;  1RWO B;  2MLY A;  3NGT A;  1W2I A;  4CLP A;  2VBZ A;  2QL9 B;  3QT5 A;  4RUH A;  1RE1 B;  1XN9 A;  2VG7 B;  2ZH9 A;  1G4C A;  3KHR A;  2CXE A;  4DSK A;  3AD8 C;  1HNI B;  1Q8L A;  4GKJ F;  4DFJ A;  2OPS A;  3KDN A;  4QQB A;  4ERD A;  1ICE B;  4DCJ B;  4CCH A;  1SH0 A;  3IS9 B;  1N48 A;  3GIJ A;  2J0Q D;  1QSL A;  3MUM P;  4OZJ A;  4PCQ A;  1XWL A;  1RT5 B;  4UQG A;  1N5Y B;  2RUG A;  2AEM A;  3OR1 B;  4ZDN A;  3OL9 A;  4I68 A;  2ZJQ Q;  2YWF A;  1WOP A;  3UCU P;  4QOT A;  5E3Q A;  5GAE U;  1RWX B;  2JWN A;  1CC8 A;  3VHQ A;  4U8Y A;  1FRX A;  1D0E A;  2XCP A;  2BJD A;  3R5D A;  3UNY A;  3G6X A;  1UZH A;  1H6K X;  6FDR A;  1SKS A;  4OX9 J;  2RSQ A;  4L3K A;  5CYQ A;  3CJ8 A;  1JJC B;  1CJU A;  1T95 A;  4NCG A;  2HRY A;  1RSC A;  1RTJ B;  2PFF B;  5L39 A;  3D6M B;  1QUP A;  4FF2 A;  2KHD A;  4ZLL A;  1LW2 B;  1P8G A;  5I3U B;  1TK5 A;  2OLW A;  2HNY A;  3PYE A;  4V19 X;  1XMO J;  3V6D B;  3S6E A;  2F4F A;  4OYM A;  4J9V A;  3MAH A;  1EHW A;  1QUV A;  2RU3 A;  1Z2L A;  1S59 A;  1JJ4 A;  1Y5L B;  4WCE Q;  4Y00 A;  3N79 A;  2KDO A;  4H4K A;  2OJ3 A;  3DFE A;  1QVF R;  3EDR B;  4IRD A;  3A3O B;  3WQP A;  2EC2 A;  1DUR A;  1T03 A;  4Q45 A;  2F1F A;  3H98 A;  1NKE A;  3GTY X;  3LP1 A;  4IFV B;  1RA6 A;  4AQY F;  4C3M A;  4L72 B;  4MK8 A;  1WEY A;  3LW5 C;  4R0J A;  4KJI A;  1FF2 A;  3N0V A;  4LRD A;  2HIQ A;  1HW8 A;  4ANE A;  4CLY A;  1BQX A;  4C9D A;  2FGO A;  2ZUA A;  1Q0N A;  3BV8 A;  4DL6 A;  1RAO A;  2IM3 A;  5CYJ A;  3Q2T C;  2H5I B;  2C3Y A;  3RUB L;  5K8O A;  5T7L B;  1AA1 B;  2AP6 A;  2HZA A;  1RT3 A;  5E7O B;  3UWT A;  3N01 A;  4TY8 B;  3KK3 B;  3JTP A;  1FKP A;  5H9E K;  3HO1 A;  3HM9 A;  4CYU A;  4Q8E A;  4CRJ A;  5AE1 A;  3O1L A;  2OPP B;  5DG8 A;  5JUM A;  4RNF A;  3DOM A;  3MED A;  3SEO A;  2WRM A;  4DZD A;  3BGF A;  2XGQ A;  1C0T A;  4ZS6 A;  3LP2 A;  4YB1 P;  3Q24 A;  2RS2 A;  1DTQ A;  3NS5 A;  2QMW A;  1S49 A;  1Q16 B;  2JLE A;  2RUS A;  2NPF A;  3L09 A;  4DX5 A;  3BSN A;  2P6S A;  1HFE L;  3AA8 A;  4WFB Q;  2B8Q A;  3FK4 A;  1HQU A;  1FTR A;  3BH6 B;  3EVM A;  3MZI A;  4X4V A;  1ZM2 A;  5KFY A;  3CGI A;  3OFE A;  2AGP A;  2DCL A;  2AZ1 A;  1R8A A;  2R7S A;  2MYF A;  2EXU A;  5C2G A;  1OO0 B;  3CJ2 A;  4NL5 A;  4LRB A;  1S1V A;  2GZO A;  5C7P A;  4RR5 A;  4QWB A;  1YJN S;  2Y1R I;  4DMZ A;  1GTH A;  3BSC A;  2CNL B;  3I4H X;  3BKF A;  1SC3 B;  1V6H A;  1G7C B;  2NUU G;  3CIM A;  1EQ0 A;  4PR6 A;  3U1N A;  3ENA A;  4KRW A;  5CAA A;  3ZZO A;  1XQI A;  2G0J A;  4A8W A;  5DG7 A;  3TAR A;  4H4K C;  5BR8 F;  4KGZ B;  3DDK A;  3M8Z A;  2Y0S D;  3GYG A;  1TL7 A;  2RDD A;  5B08 A;  3DMJ B;  3P8B B;  3DNC A;  1Q53 A;  3KUE A;  4Z7Y A;  4K50 A;  4YS2 A;  2E9T A;  3Q8Y A;  5F8J A;  2CQG A;  3KFW X;  2HVH A;  1BWV A;  2CQ3 A;  3VGT A;  1S1W B;  4OQJ A;  4WE1 B;  1KD1 T;  3FKB A;  1RAJ A;  2YNF A;  4DV1 J;  2R9L A;  1V3R A;  3DRY A;  3ULH A;  1H98 A;  1LW0 B;  3MM5 A;  2HRU A;  3CC2 S;  4OLP A;  4FYW B;  1UVL A;  4KTQ A;  5KFG A;  2YKN A;  1B0V A;  4KH0 B;  1Y11 A;  1S6Q B;  1HBN B;  2KXH A;  1UTA A;  3PG9 A;  4YFU A;  2MQM A;  3NOG A;  1W7W A;  2YKM A;  1EB0 A;  1QE1 B;  1F5B A;  3POT A;  3QGG A;  4JV1 A;  2ZNY A;  2CPY A;  1SB6 A;  2H54 B;  4DPY A;  2RRB A;  1FDN A;  3S1T A;  2MHN A;  4LFA J;  5J1P A;  3BF4 A;  3FMB A;  3G8T A;  3FEY B;  2MDA A;  3CDW A;  2GO8 A;  4N5S A;  4C11 B;  3OL8 A;  1CPZ A;  2Z2Z A;  1MRO A;  4W92 B;  1UVI A;  4HH1 A;  3BQ0 A;  3OD2 A;  3V4M A;  2BJ7 A;  3HJF A;  2HLT A;  3QID A;  1H0H B;  4O0N A;  1R0A A;  5KFJ A;  5G0R A;  2HBQ B;  2ROP A;  5B0F A;  1U6B A;  3GIM A;  4ICL B;  4DUZ F;  3TAN A;  3MOJ B;  3RAX A;  4IO9 Q;  3NCP A;  4GO7 X;  4NWB A;  4PQA A;  3O3L A;  2MQL A;  2MLX A;  3IC1 A;  4UUX A;  2FC9 A;  3GR1 A;  4L6V 3;  1JXV A;  4DL4 A;  1HYS B;  2FVP A;  5DO2 A;  2X1F A;  5FLX U;  2UP1 A;  3S8S A;  4Y28 C;  1RT1 A;  2MPU A;  5KFL A;  3S01 A;  1KSP A;  1JLQ A;  4KH1 B;  2EK1 A;  1X60 A;  4MKY A;  2GHW A;  2WW8 A;  4LT6 A;  1IN0 A;  2VKR A;  2R2U A;  2N4D A;  3T1H J;  1UPP A;  2HNZ A;  1D3W A;  1WC6 A;  2IAJ B;  2DNN A;  2OPR B;  3H8Y A;  4NLT A;  4XDD A;  2IYG A;  3T3F A;  3TOQ A;  3ILO A;  2Z0G A;  3DOK A;  1N36 J;  2BRK A;  1SXL A;  3A8K A;  4BCA A;  2HQ3 A;  3MMC B;  3DYA A;  3OFH A;  3M8W A;  4DV1 F;  2D9P A;  4F0M A;  4WP9 A;  1S9G A;  1J2V A;  1N32 J;  2MJN A;  5HVG A;  3Q8R B;  4N7T A;  2GMH A;  2C2O B;  2OKQ A;  1P9Y A;  2NXE A;  3KMQ A;  4JI2 F;  1WI6 A;  4QR2 A;  4IOA Q;  1Q5Y A;  2CWK A;  1WDT A;  1CJK B;  2Y1J A;  4Q0B A;  4XDC A;  4LFC J;  1ZYQ A;  2W9B B;  1GMW A;  1S99 A;  1S0M A;  3ICL A;  1CVJ A;  3PYD A;  3TI0 A;  4C98 A;  4ZCL A;  3K5P A;  4USH A;  1WG5 A;  1DTT B;  5E3A A;  2ADC A;  4K4Y A;  1FRJ A;  1U49 A;  4ED7 A;  4OZ2 A;  2Z8Q A;  2NZ4 A;  2C2Z B;  2JFK A;  5DM6 Q;  4C3L A;  2HEK A;  1PJ5 A;  3UDL A;  4BC7 A;  5KOW A;  1LWX A;  3MMA B;  4P6Q A;  3T5J A;  3DGV A;  4B3M J;  2KH9 A;  1JIH A;  4DQR A;  5J2Q A;  3RZA A;  2R7O A;  2AYB A;  1RI7 A;  3ET6 A;  1YIJ S;  2CQI A;  3KLE B;  4DQQ A;  2G0I A;  2XMW A;  1ELO A;  2DHG A;  2DH9 A;  2MQQ A;  5JVH Q;  4B9M A;  3MCM A;  2V5H G;  3V81 B;  5HAT A;  1ITP A;  1HR0 J;  1M0S A;  2ZZN A;  4DOZ A;  1VHI A;  4FBU A;  3CCU S;  4QWC A;  2UVR A;  2OEL A;  1O5J A;  4LSZ B;  2EWH A;  4ZOS A;  3J80 Y;  4C3K A;  3GSD A;  2KFN A;  2BAC A;  1RTD A;  3HFK A;  3I0S A;  4M5M A;  2IJN A;  4NXM J;  2E44 A;  2ZOM A;  4D3G A;  5KT4 A;  5IWA J;  2FHK A;  1S1U A;  1BMQ B;  3GJS B;  2HGL A;  1K8A T;  1RT4 A;  2R42 A;  3BGR A;  4MK7 A;  5GMD A;  4L73 A;  2U2F A;  3EUN A;  1NO8 A;  3MMB A;  4AFF A;  2KXN B;  3SQO P;  4BC9 A;  1RAE B;  2B56 A;  2LXI A;  3H2V E;  3IFE A;  3M8Y A;  2RQ4 A;  3T1H F;  1B7Y B;  5A2Q U;  2GX8 A;  2WK4 A;  5A8K B;  5ETV A;  5DQG A;  2N7C A;  2XUL A;  3SBM A;  1RUS A;  3TW0 A;  2LCW A;  2L41 A;  3D3C J;  5IQQ A;  2J9D E;  4KAI A;  4QR1 A;  2HK2 A;  1UW9 A;  4DZ6 A;  5E3R A;  4WTY A;  1PO6 A;  2IYI A;  2A1B A;  2FZC B;  3M9N B;  3IM9 A;  5KFT A;  5F3Z A;  4ED2 A;  4RNM A;  3M8R A;  2ACY A;  4J5O A;  2XI3 A;  1NND A;  4I69 A;  4BLG A;  2AU0 A;  2L48 A;  3JSR A;  4LFC F;  3CD7 A;  3SCJ E;  2R7W A;  2VPY B;  1IKV A;  2GC8 A;  3DXS X;  1V3S A;  2GQC A;  3JYT A;  1NU4 A;  3PEJ A;  4X4N A;  5KFO A;  2ZFH A;  3HFZ B;  4PAB A;  4IG3 B;  4OI1 A;  2VA3 A;  2D3O R;  2YWE A;  3QWU A;  5L1L A;  5KG5 A;  2J7K A;  4B3M F;  1VQY A;  2C3U A;  2IA6 A;  2BQ3 A;  3T1Y J;  1F60 B;  2XLI A;  3K2Y A;  4IH6 A;  5D15 A;  3NGK A;  3QRP A;  3ZZR A;  1BY9 A;  4OHZ A;  3T9N A;  4ZHR A;  1NSQ A;  4AXJ A;  1APS A;  3H5S A;  3KK1 A;  3ZTO A;  1UWA A;  1WDD A;  2CNK B;  3KXD A;  2CQP A;  1IBL J;  4LRF A;  1VBY A;  1O51 A;  3CUN A;  4QR0 A;  2VU5 A;  2RRN A;  4K2J A;  4NXM F;  3R6L B;  4N76 A;  2W4C A;  4HH0 A;  1SUQ B;  1JB0 C;  3R5A A;  2QLX A;  2HBZ B;  3QPI A;  1NXI A;  2E1P A;  2GNK A;  2IBO A;  5F8M A;  2I0X A;  2K06 A;  3OR2 A;  2K7K A;  2DIU A;  4F4W A;  1JNR B;  2HGM A;  4ECQ A;  4ZVG A;  1DQ9 A;  1FXL A;  5LSO A;  1KOO A;  3ZFV A;  3QNW B;  3G9C A;  1RCO B;  2CPD A;  1XR6 A;  5AXL A;  4NI2 B;  3W3S A;  2WON B;  1HWU A;  2MTL A;  2Q79 A;  3RB6 A;  3R97 A;  5K14 B;  2OGU A;  4W90 B;  2ZD1 B;  2O3D A;  1GH8 A;  4PAA A;  2G2Y A;  1VQ7 S;  5LT5 A;  1WAC A;  4UOG A;  1LWF B;  3QLH B;  4TYA A;  4TVA B;  3M8Q A;  3V5R A;  4UOH A;  2ASJ A;  1S48 A;  2N4C A;  5KFQ A;  3V6J A;  5HRO A;  3HZG A;  3IXQ A;  4NZ6 A;  1QSY A;  4QIV A;  3KYL A;  2HHH J;  4J9U E;  4OYO A;  5J2M A;  1DAR A;  2XZT B;  4ITS A;  2DGO A;  1LWC A;  4PRF A;  4CO4 A;  1Q8B A;  1F2G A;  1HBM A;  4IQX A;  2DGT A;  1XNR F;  4B3T J;  4A8Q A;  4Y2A A;  2RQC A;  2LVW A;  3ETM A;  4RJV A;  3SDE B;  1L3T A;  1NB2 A;  3I82 A;  2UV8 G;  2HVE A;  3RB4 A;  1TV6 A;  4ENO A;  4DV5 J;  1M5S A;  4IDK A;  2XNQ A;  3NXZ A;  2BKO A;  5HP1 B;  4LF4 J;  2KI2 A;  4HEA 9;  4DV4 J;  5KFE A;  1YJU A;  2B0G A;  3CCE S;  3M32 A;  2WSE C;  1NDK A;  1I1G A;  1HKA A;  3T1Y F;  1MN9 A;  2MHE A;  3SSQ A;  4WKR A;  2ATC B;  4RKU C;  2H48 B;  1G1X A;  1DJ0 A;  1TKT B;  4URS A;  5A0Y A;  2OIH A;  2BUN A;  1ROF A;  5KFH A;  3V6K A;  2YNG B;  1YGY A;  1VQK S;  2I1R A;  1Y9O A;  3QGH A;  3NNH A;  1GT8 A;  1K1Q A;  4BWM A;  1VCT A;  4N47 A;  4A8X A;  3IRX A;  2HKE A;  4ZKA A;  1U1K A;  3KHH A;  2AZ3 A;  1N5T A;  1IBL F;  2W9C A;  1SIW B;  3AT1 B;  4DDF A;  1JLF B;  4J9P A;  4X4T A;  3VZI A;  2XC9 A;  3KLV A;  1KRP A;  3RW6 A;  3HHK A;  3EVW A;  2FHJ D;  3AOC A;  3M2U A;  3W60 A;  5D4O A;  2DH8 A;  4ZIV A;  4C8L A;  4CTA B;  3GYX B;  1KHW A;  3DRS A;  2AWZ A;  3GZ7 A;  2MZ1 A;  1KLM A;  1RWN B;  5EX3 A;  4RW9 A;  2OTL S;  2IVM A;  1JXE A;  4XK8 C;  1MWQ A;  1R0C B;  2RE1 A;  4O23 A;  5GAH I;  1RT7 A;  2KT2 A;  1RA7 A;  1ZAX A;  1X31 C;  4IG0 A;  1TKX A;  1QTN B;  3LGH A;  1U1O A;  4DQI A;  2DH7 A;  1HNV A;  2VG6 B;  4MAK A;  2L9D A;  3JTO A;  1X4B A;  1HL6 A;  2FUG 9;  3CMQ A;  3RG6 A;  2IM0 A;  5ETM A;  2WZ1 A;  4XPC A;  4ES1 A;  4X4U A;  3HD2 A;  3D7S B;  3A12 A;  2HHH F;  2NPI A;  4ED8 A;  5LSL A;  2F5G A;  4R25 A;  2FZG B;  3WHI A;  4EZ9 A;  3CD0 A;  4LF2 A;  2XSJ B;  2CQ4 A;  2QT7 A;  2YNI A;  1GTE A;  3C6U B;  2FGC A;  2DHX A;  4O0I A;  3LH2 S;  5CA5 A;  5L8R C;  1TMM A;  1HBO A;  1GX6 A;  4M5D A;  2YBV A;  4DG1 B;  3IO1 A;  3WC0 A;  1HBU A;  1PIL A;  3UN2 A;  1N0V C;  4UST A;  4K5S A;  5KFF A;  2I6W A;  2XB2 D;  4AE5 A;  2Y0B B;  2J0S D;  4ZPA A;  3VGS A;  5KG4 A;  1H72 C;  3HPO A;  4LF4 F;  3AOA A;  1S10 A;  4HVZ A;  1HLW A;  4DV4 F;  1RAF B;  1FWK A;  2B9E A;  5HL7 Q;  2VOO A;  3EIC A;  3HHL D;  1K0T A;  4QBU A;  5KG3 A;  3QRR A;  2O5D A;  4DN9 A;  3HVA A;  2IM1 A;  2BEF A;  5LXY A;  2WBR A;  4EO6 A;  3N6L A;  4BDP A;  3FCH A;  2L9N A;  2ZBP A;  5T41 A;  4P74 A;  1RHK B;  1S6O A;  4X84 A;  2C3P A;  4IOC Q;  4EUV A;  2F9D A;  4IFY B;  1J5O B;  3IGV A;  1RU1 A;  4OIX A;  1HQE A;  4M1K A;  1YJV A;  3PFO A;  1H74 A;  3FSY A;  4LF1 A;  3PKY A;  1SI9 A;  2X51 A;  4MFB B;  3DRP B;  3Q8P B;  3TZZ A;  1Y00 A;  1NHV A;  3D2W A;  2V94 A;  3MAA B;  3R1H A;  3U27 A;  4KE5 A;  5EUH A;  3G82 B;  4WFN Q;  5LJ3 Y;  1VQ5 S;  4Q2L A;  1OY9 A;  3QJJ A;  4R5P A;  2FY1 A;  3SSS A;  2ZC3 A;  3F73 A;  3MTJ A;  2GVD B;  5ETO A;  3ENQ A;  1VYA A;  1SV5 B;  1GXT A;  3LGN A;  2VG7 A;  5F9N A;  3ITH B;  3W62 A;  1HNI A;  2VOP A;  4JI6 J;  1YLX A;  1UL3 A;  3BGO P;  4ZPT R;  3TEH B;  4M5K A;  1RQ0 A;  4X65 J;  3IS9 A;  1DZ5 A;  2B3T B;  4WK1 A;  1TAQ A;  5IT0 A;  2AMC B;  3GIL A;  3T1A A;  3CT9 A;  4G3I A;  4YEA A;  3SCK E;  3JB9 k;  1U1N A;  1TKZ B;  1XNQ F;  3EVO A;  4MT1 A;  2B6A B;  2OTJ S;  1LWE B;  1GNK A;  2VV5 A;  3PM9 A;  2YH1 A;  3JQK A;  1S0N A;  4CLF A;  1GAO A;  2NXJ A;  2M70 A;  3G6V A;  1VMB A;  1Q7Y T;  3AJ2 A;  3TQ1 A;  2BKP A;  3QGI A;  3CNQ P;  3VGU A;  3C14 B;  4LVO P;  2QN6 B;  2BR0 A;  1N33 J;  3SSR A;  3Q83 A;  2OEM A;  4PG5 A;  1ZA1 B;  4USJ C;  1BQM A;  1VQ4 S;  1VBZ A;  1F2H A;  4JOU A;  1RTJ A;  4AYB D;  2R8J A;  2GFF A;  3EXY A;  1JX4 A;  3HSD A;  3F41 A;  3ZZZ A;  2J9C A;  1IR1 A;  4OX8 A;  1LW2 A;  3OHA A;  1VJW A;  1CS4 B;  2KM8 C;  5I3U A;  3J81 U;  2M4M A;  5DDP C;  4QWD A;  3W7B A;  1UVM A;  1EQM A;  2B8P A;  4ILL A;  1L3U A;  3C16 B;  5H9E J;  2ZHO A;  5HMX A;  3ISZ A;  4CM2 A;  1CBK A;  4WZM A;  2ASD A;  3KK2 B;  4OMF G;  5H9F J;  3B78 A;  4C97 A;  4ETX A;  4N77 A;  2K1R B;  2VIC A;  5A8R A;  3TJ8 A;  4LF8 J;  2X7I A;  3G86 A;  1VQO S;  5GME A;  5IC6 B;  4LUB A;  2DK2 A;  1WOO A;  2DNY A;  3ZTR A;  1F9F A;  4K0K J;  1VQN S;  2CQ2 A;  4AD6 A;  1D9A A;  5D78 A;  2OSQ A;  2YNH A;  4FXD A;  4USV A;  2UVU A;  4IRK A;  2JX2 A;  5KFI A;  1Q81 T;  5GAE I;  3M1V B;  2B5J A;  4K8R A;  4OYB A;  1BLU A;  2GO9 A;  1RB0 A;  4UW2 A;  1VHF A;  2QG9 B;  4WU3 A;  2CNO B;  1ZZN A;  3KMS A;  3VAH A;  2M52 A;  1UZD A;  4KV8 A;  1MSW D;  4PKD B;  4DL2 A;  5KFS A;  3KK3 A;  1LNQ A;  2MGZ B;  4HYK A;  1ULR A;  3PYF A;  3LQV A;  4JI6 F;  2CWX A;  5E5N A;  2R7Q A;  4JI4 J;  1ZS6 A;  4X65 F;  4Q2M A;  4PG4 A;  1Y3K A;  1T05 B;  2C2K B;  1NEE A;  2IJR A;  2DR7 A;  4WFY A;  3QRQ A;  1UP1 A;  1PGZ A;  1L3S A;  3RU0 A;  2HFS A;  1FWP A;  1TK8 A;  1LV5 A;  4DJB A;  3MR3 A;  4JI5 J;  3UQS A;  1NJX A;  4ZN1 A;  2N7Y A;  2RKI B;  2RS8 A;  4JI0 F;  1N33 F;  2KG0 A;  1JLC B;  2QMU B;  1D8Y A;  2R7V A;  2XY6 A;  3T9Z A;  1RBL A;  3OLA A;  4DF4 A;  3TAQ A;  3H5Y A;  4JV0 A;  3OW2 R;  5EWG A;  2CPE A;  3WZ0 A;  3NWG A;  3MR2 A;  4RW4 A;  1X9M A;  2OI2 A;  5EX0 A;  3MCN A;  1KHV A;  4RWX A;  2DY1 A;  1NME B;  1RK8 A;  2M88 A;  3NGS A;  3KG0 A;  3FCV A;  1RHQ B;  1VS3 A;  3DMJ A;  2ZKT A;  2DO4 A;  4JI8 J;  2XLJ A;  1LOU A;  4DFM A;  3CME S;  4CI0 B;  3J7A 1;  4X62 J;  1S1W A;  4OYP A;  1ZOT A;  3VAI A;  1U24 A;  4FKX A;  1VK3 A;  2W2N P;  3T41 A;  5F9L A;  3BBC A;  4FVM A;  2Z2L A;  3W2V A;  4ECZ A;  4LF8 F;  2HIY A;  1LW0 A;  2NYI A;  2RF2 A;  2GML A;  1RHJ B;  1NK6 A;  4K0K F;  2CJQ A;  4QIF A;  3I6P A;  2CZ4 A;  1VR6 A;  4L3N A;  2R8H A;  3MWB A;  1J27 A;  3M9M B;  2YX7 A;  1S6Q A;  1N0U A;  1HBN A;  1UVN A;  2Z2M A;  3O5T B;  1VQS A;  1S57 A;  1X0P A;  2RQK A;  2D7S A;  2I38 A;  2F40 A;  5D77 A;  2WVD A;  5DLG A;  1Q79 A;  3MEC B;  1QE1 A;  1SJQ A;  2KVI A;  3P5T L;  3W61 A;  3MOZ A;  5HJX A;  1K47 A;  1FDB A;  3NCQ A;  2WSF C;  3RAQ A;  5FLX Y;  4NZ7 A;  2RHQ B;  1M1G A;  3ZTQ A;  1JJ2 R;  1XJW B;  5U47 A;  3EZU A;  1WHY A;  2CQD A;  4OX6 A;  1U2R A;  2C42 A;  3CTR A;  2HBR B;  3HMJ G;  1VLO A;  3MM8 A;  2GIQ A;  1Y5N B;  3Q23 A;  4OZ3 A;  2V2K A;  1BQN A;  4LF9 J;  1KKH A;  1N56 A;  1EET B;  4ICL A;  4M5G A;  3K57 A;  2CPZ A;  1SH2 A;  3GIK A;  3ISN C;  4FNH A;  1YBT A;  5I3P A;  1RDR A;  5JXS A;  2VHG A;  6FD1 A;  4B17 A;  2PFD A;  2H51 B;  1FHT A;  4NLO A;  4K4T A;  3BO2 A;  3CJT A;  4YDX A;  2IHR 1;  1Q7L B;  4JI5 F;  4ED0 A;  4NYZ A;  2HWI A;  1IJF B;  4OHV A;  3QZ7 A;  1GMU A;  2IC3 B;  3DI6 B;  1SC4 B;  2RNE A;  4P2M A;  4AL7 A;  2HHU A;  3HVT B;  3K7R A;  3M2V B;  5IZH A;  1I94 J;  1TL1 B;  5D8H B;  5ETN A;  1WG4 A;  2AJ1 A;  4N56 A;  4MTP A;  2MJU A;  2AJ4 A;  4HTJ A;  2YPZ A;  4A8K A;  2GV1 A;  2XYH B;  4FDF A;  3NBP B;  1FNM A;  1LQ9 A;  2IAJ A;  5E0O A;  2OPR A;  4KGK A;  1WOS A;  3C66 A;  3Q8U A;  4JI8 F;  4U6P A;  4DL7 A;  1QSS A;  4X62 F;  3MMC A;  5L38 A;  1JLG B;  3LF0 A;  5SZT A;  5KT7 A;  3BO4 A;  2HMI B;  2BA9 A;  4Z2X A;  4DL3 A;  4PG8 A;  3HKZ D;  4C8N A;  3N28 A;  2A2C A;  5IV4 A;  1C1C B;  2CUY A;  1F5A A;  3BKU A;  2R2S A;  4DR6 J;  3DKD A;  2YKA A;  3O8W A;  3CUL A;  4ZP8 A;  1U48 A;  2IRX A;  5B0G A;  4NA2 A;  1L3V A;  4GKK F;  2R8G A;  3SQG B;  5KFV A;  3G96 A;  2UU9 J;  3BGU A;  2CG8 A;  2O1P A;  4RL1 A;  1UFK A;  4JI1 J;  2OH2 A;  2Z57 B;  4DX7 A;  2PII A;  2ROE A;  1QLN A;  3UDV A;  2IVY A;  4HLB A;  4OYZ A;  4C6A A;  3VCD A;  3JSM B;  3S7R A;  1JJH A;  2PI4 A;  3JQJ A;  4LBI A;  1TUG B;  2NR0 A;  4LRC A;  4PXE A;  4CLS A;  1A6L A;  4X64 J;  1NH7 A;  3I5C A;  4LF5 J;  2ZH1 A;  3EPG A;  3BH7 B;  3FVY A;  2DY9 A;  3EX7 B;  2VFR A;  3MMA A;  2YQ3 A;  3K8W A;  3R1L A;  5I42 B;  4YDD B;  5C42 B;  1XMQ J;  4ID5 B;  2IBK A;  3KLE A;  4B9T A;  1PAE X;  1N52 B;  1SJR A;  5A8W B;  5KOX A;  2BJ8 A;  1KEK A;  3MXH P;  2CZ9 A;  2H4Y B;  4ZLP A;  3V81 A;  2V6A A;  3RBE A;  5A2Q Y;  4LF9 F;  2WVF A;  3R5C A;  3K5M A;  1NJW A;  2CZV C;  4ZJL A;  2CPF A;  2C2N A;  2DGU A;  1Q8K A;  3EZO A;  4YB7 A;  4A8O A;  1LK5 A;  3HK2 A;  4OZ0 A;  3MCS A;  2JSX A;  3R7B B;  2LLZ A;  1HW9 A;  4I0W A;  4QZV B;  1RT6 A;  1M5P C;  2W24 A;  5DZ7 A;  3DLE B;  5KG0 A;  5EWE A;  1FKA F;  2FJB B;  9ATC B;  2AHO B;  3FBF A;  4OV1 A;  4CZC A;  4YOE A;  2WB1 D;  4P9S A;  5CD4 A;  1FNO A;  4AUK A;  4EBC A;  1SL1 A;  2V69 A;  4ED3 A;  3OLB A;  3M6U A;  1FO1 A;  2EW9 A;  3M8P A;  3UI3 A;  1HNZ J;  1HQ2 A;  1S1T B;  4TXS A;  3TQE A;  5KFB A;  1RTZ A;  3MEG B;  4OI2 A;  3HVR A;  3PRB A;  4DPU A;  3KLI B;  4DX8 H;  1GMW D;  5A8K A;  2XMA A;  3QAU A;  1VRU A;  3FQK A;  1TL5 A;  4RUB A;  3BQ2 A;  4LR9 A;  4JUZ A;  2BM1 A;  2HQI A;  4A8Y A;  4DR4 J;  2OPS B;  1H38 A;  4ZMM A;  4U67 Q;  1FRL A;  1NUE A;  3M7V A;  3OTE A;  2ZH3 A;  4DUT A;  1S97 A;  4FYV B;  4OYW A;  2RDJ A;  2J7U A;  2V50 A;  3R3T A;  2R8K A;  1KTQ A;  5CAB A;  4CO1 A;  2ZH8 A;  1G6B A;  4O4G B;  4QW9 A;  4DR6 F;  2G2Z A;  2V8G A;  5LSR A;  4UUW A;  4D3H A;  3H4B A;  2IVF B;  4CT8 A;  3D28 A;  4ES2 A;  3H90 A;  2XTJ P;  2UU9 F;  1S9F A;  4JI1 F;  1C4C A;  4QIW D;  3CMA S;  1I5O B;  3MUV P;  3PDN A;  4OLO A;  1AFJ A;  3A13 A;  3IWL A;  3K5O A;  3Q0A A;  3CCZ A;  3ZO7 A;  1IBK J;  4F4Y A;  2AV5 A;  1N8R T;  4IG3 A;  4X64 F;  5CYQ B;  1RWU A;  2VG5 A;  1NRK A;  4DL0 C;  4OI3 A;  4JP8 A;  4NCG B;  1NB7 A;  4MJK A;  1S9E A;  2ILZ A;  4HT5 A;  3LWL A;  3GB0 A;  1VIX A;  1ZTW A;  1XMQ F;  4GRS A;  2W2O P;  3J7Z T;  4RBU A;  1SIZ A;  3GIR A;  3D68 A;  3PAC A;  2L9W A;  3MDF A;  3G8Q A;  1RKJ A;  1TK0 A;  5L9X A;  3HI9 A;  4CNY A;  4KR0 B;  4WFX A;  1HWJ A;  2WCX A;  4JI3 J;  4A8S A;  4DR1 J;  2EFO A;  4J9O A;  1C0U B;  4LRA A;  4HAC B;  5H1S V;  3W66 A;  2EBG A;  3PIP Q;  2F4V J;  4LR8 A;  4O3P A;  1SUQ A;  3TUI C;  2J76 E;  2KVQ E;  2XCA A;  3M8S A;  4BS2 A;  1FEH A;  1SVD A;  4ZP9 A;  4KGX B;  4S0M A;  2VQE F;  2MZT A;  3LO3 A;  3T5K A;  2N82 B;  1HD0 A;  3CCS S;  1JKH A;  1HNZ F;  1ZPV A;  4WZQ A;  3D54 A;  3NAI A;  3KNA A;  4UZC A;  1WF1 A;  2DGS A;  1KS2 A;  2FJE B;  4F25 A;  1U47 A;  3OTC A;  3W9H A;  1FKP B;  1LWF A;  3QLH A;  3W64 A;  4CYU B;  2BDP A;  3I56 S;  2DR8 A;  4DR4 F;  3DOM B;  3MED B;  1UVJ A;  3BDE A;  2XWY A;  4CP5 A;  3PW5 A;  2VC1 A;  3CE8 A;  1C0T B;  3IR6 B;  3H5U A;  1ZZF A;  2HHX A;  2MQ8 A;  4X4S A;  1IBM F;  2ASY A;  4ER8 A;  3R8Y A;  1GXL A;  3TVZ A;  2D41 A;  2VBX A;  5BYS A;  4X4O A;  4CLW A;  1U26 A;  1U45 A;  3OSN A;  1A9N B;  2RAQ A;  1JMT A;  7FDR A;  1R31 A;  3MR5 A;  3R6G B;  1OJ4 A;  4IH5 A;  3CXC R;  2LQ9 A;  2XWX A;  3D6T B;  4Q8F A;  1JQG A;  3ENV A;  1X5O A;  3GG0 A;  1IBK F;  3N9U C;  2QC3 A;  3A3P B;  3FSX A;  2FVR A;  5J1E A;  2HGN A;  5IFM A;  1NK9 A;  2E9Z A;  2MXY A;  1FER A;  4QIG A;  5KFX A;  3CO0 P;  3KJV B;  2DNP A;  1VC6 A;  3TA2 A;  4USU A;  1HNX F;  2QEX S;  4E8U A;  4Q44 A;  2AKW B;  4TNO A;  3P3D A;  1TKT A;  1Z2Z A;  2FLL A;  5M2P A;  4NCA A;  3DN9 A;  1RT2 B;  2XNR A;  2PI5 A;  3M2R B;  4WF9 Q;  4TLQ A;  4OZ5 A;  3DLK A;  5CHC B;  2MST A;  3QWP A;  1N6Q B;  5HMY A;  4DEZ A;  1YKW A;  4AL5 A;  1O0P A;  5MAO A;  4DHV A;  3A8I A;  4DR1 F;  3ZZP A;  1JLF A;  4WJB A;  3J7A N;  1Q1K A;  1X7V A;  5G4D A;  2I5J B;  4UZB A;  3AOB A;  2MKK A;  2PD1 A;  3PYG A;  3MM5 B;  2WVC A;  3I0R A;  3OV7 A;  5KFU A;  2B9W A;  4Y2K A;  4FXV A;  1VOM A;  4KHR A;  1G3O A;  2A6M A;  3EE3 A;  3HHN B;  2YKN B;  5GAD U;  4CT9 A;  2LDI A;  4RNO A;  4CTA A;  4YB6 A;  2FJA B;  2Q1L A;  3NGU A;  2HVD A;  4JB8 B;  3OL6 A;  2Q66 A;  1SCJ B;  2V2Q A;  5I3Q A;  4U7C A;  2VQF F;  1HA1 A;  2BRL A;  2UXB J;  2X1B A;  4MH8 A;  2W2P P;  4PG7 A;  3BM7 A;  2XI2 A;  2PMZ D;  2EG1 A;  2H3E B;  2VG6 A;  4A46 A;  2C2R A;  2H5E A;  1ZM4 A;  1NK4 A;  3C3L A;  2QLW A;  1MU2 B;  1S4F A;  2BM0 A;  2G1D A;  4K4V A;  4K4X A;  3GV7 B;  1R8B A;  5LXR A;  1MRO B;  3NS7 B;  1RHM B;  4MKB A;  4YR2 A;  3JS9 A;  4MK9 A;  4ED1 A;  1JLE B;  2VPW B;  2DXD A;  4NEY A;  1YJR A;  3OJU A;  3QT8 A;  1HPZ A;  4HT7 A;  2XSJ A;  2D74 B;  2W4P A;  4USI A;  3R5G A;  4Z7C A;  5KG6 A;  4OJ3 A;  4MIA A;  3MHY A;  1DBD A;  4H4O B;  4DG1 A;  4IO1 A;  2H65 B;  3E01 A;  2MMY A;  3UE2 A;  1FKO A;  2MQN A;  1S1X A;  5BR8 J;  4XO0 A;  5KTQ A;  2F7V A;  1R0B G;  4KO0 A;  1UFL A;  4J9N A;  2J0W A;  4DS5 A;  3TZW A;  2HND A;  3KNG A;  2FLP A;  2F65 A;  2N3O A;  3PO4 A;  2Y1I A;  2SXL A;  3F56 A;  1S7H A;  1WNE A;  3VVU A;  4IR1 A;  1Y0H A;  1C1B A;  2DGW A;  3NCR A;  3W63 A;  4HHU A;  2WB4 A;  2W7A A;  3KJQ B;  4V19 J;  1RBO B;  4DPO A;  2CRL A;  3H5X A;  4CH1 A;  3EM1 A;  3FC9 A;  1PBU A;  3FZ2 A;  4G1Q A;  3G71 S;  1FVQ A;  2HNZ B;  4MKV A;  2DGV A;  2A6O A;  2JL9 A;  4DSF A;  3WIU A;  4O44 A;  3WBZ A;  1J5O A;  2QZ8 A;  3FSI A;  2DHS A;  4AL6 A;  4B3R F;  3DYA B;  3MEK A;  2D69 A;  3DRP A;  4U9R A;  4C7Q A;  2KZM A;  1D8Z A;  2BQU A;  1VC0 A;  3FUY A;  3I55 S;  1EIY B;  4CO5 A;  3G82 A;  2DGQ A;  2RML A;  5D0G A;  3D1O A;  1UWB B;  4RWW A;  3OL7 A;  4XPE A;  2QYC A;  2W7P A;  2V2V A;  1YIT S;  1N5S A;  2GVD A;  1ZET A;  1WKK A;  5CYM A;  2HWT A;  2MLZ A;  2XLK A;  1SV5 A;  1EP4 B;  2CJ9 A;  3MM9 B;  3CC4 S;  5KG2 A;  2ZEJ A;  1BD6 A;  4QPT A;  2W7O A;  3VGV A;  4AXI A;  1ZAV A;  3BBB A;  2VD3 A;  2UXB F;  1RU2 A;  2ACM A;  4X4R A;  1XR7 A;  2MEW A;  3IWX A;  1H3D A;  2FVQ A;  4DUZ J;  3QSI A;  3A4T A;  3M30 A;  1KC8 T;  1PC5 A;  1U2F A;  2FLO A;  4RBT A;  1HNW J;  1NCL A;  3ZNU A;  3UD5 A;  4CWB A;  1EKS A;  1LWE A;  1X4H A;  3O44 A;  3IMQ J;  3OT9 A;  2P9C A;  2N3L A;  3VVT A;  2DR5 A;  1HMV B;  2B9Y A;  1KDN A;  4ECT A;  1AYE A;  4HTI A;  4PPZ A;  1DFD A;  3B4M A;  1NH8 A;  4Y6I A;  3DOL A;  4DV3 J;  3KUG A;  4XAK A;  3SMZ A;  5ETR A;  4M5H A;  4C8Y A;  1U1P A;  1RTD B;  1VQ6 S;  1IBC B;  3G8S A;  1HHT P;  5GVQ A;  5KFM A;  3TUJ C;  1Z1Z A;  5A6W A;  2IRU A;  3W5Y A;  1VQ9 S;  3BR8 A;  3FRY A;  2W2Q P;  4PUO A;  3GR0 A;  4QIE A;  5AXM A;  1WSR A;  2E29 A;  1FX4 A;  4KYZ A;  1CS4 A;  3RJM B;  2YQ0 A;  1RAC B;  1JLA B;  2FHM A;  4P10 A;  1X5P A;  2YY3 A;  5F3T A;  2AJQ A;  2HYI B;  2A18 A;  3PHT A;  5B0B A;  3LAN A;  3I87 A;  4EWT A;  2ERR A;  2M3D A;  2YX1 A;  2FTR A;  1R8C A;  1YDL A;  1NPR A;  5LMU J;  2UUA J;  1FXD A;  4JI2 J;  2EBE A;  4C0O C;  4QCL A;  5HQ8 A;  2CAD A;  3J7Y U;  1KFS A;  4KC5 A;  5L1K A;  4I4B A;  4WPA A;  1LK7 A;  4DLE A;  5ETK A;  2IRY A;  4Y3C A;  2XMV A;  3DLB A;  1Y10 A;  2G0C A;  2XO6 A;  2QV6 A;  1NPP A;  2Y8Y A;  1QTM A;  3UVJ B;  2DD8 S;  5CZV A;  3CJ5 A;  2WTF A;  1Q5V A;  2YH0 A;  3GII A;  3U02 A;  2Y8W A;  3OTB A;  3P5B P;  2WOM A;  1F5C A;  2DEJ A;  3KJN B;  4R8U A;  3MD1 A;  1K44 A;  4UQT A;  4QPX A;  4TU7 A;  3NWR A;  1S6P B;  1FJG F;  4JYA J;  1REG X;  3NP5 A;  3K17 A;  5D0R A;  3R7N B;  3PFE A;  3Q8Q B;  2C3M A;  2O67 A;  2Q3P A;  3NRB A;  4NCB A;  1S77 D;  4EMD A;  2YKP A;  3GE9 A;  2UUW A;  3DRR B;  3G6Y A;  2M8H A;  1RCX B;  1XMB A;  1KQK A;  4QYR A;  3FRZ A;  5BYR A;  1HNW F;  3CIZ A;  2B43 A;  1Y3J A;  4Y2I A;  1RHU B;  4IR9 A;  2DXE A;  3FBB A;  1UPM B;  1SQG A;  3MPW A;  4L75 A;  4F7V A;  1F3V A;  3P96 A;  4A47 A;  2B4U A;  1M1K T;  3US5 A;  5I4M A;  4YP3 A;  3F44 A;  4OJG A;  4NLG A;  4DV3 F;  4IQM A;  3HP6 A;  2JRS A;  4ZHR B;  3PX0 A;  1NHK L;  4CO3 A;  1H7W A;  1WHX A;  2P8I A;  5HLF A;  3TZX A;  2CYY A;  1JLC A;  2GA7 A;  5GAG U;  4OZ1 A;  2AW0 A;  4F50 A;  1IKX A;  2MZR A;  3MEE B;  1RKI A;  1P27 B;  2YKQ A;  4HR2 A;  2YWW A;  3DLG A;  3EGW B;  4RU9 A;  1S5Z A;  3MMJ A;  1KP6 A;  2I8E A;  4F3M A;  5C2C A;  1CLF A;  3G87 A;  2PA8 D;  4WYL A;  4FNI A;  4ECV A;  4NLP A;  2W8K A;  1NK0 A;  2BE2 A;  1IVZ A;  5E41 A;  3IGN A;  1YHQ S;  3EGZ A;  2X1G A;  3OR2 B;  2FY8 A;  2ZNZ A;  3PVX A;  1ZPW X;  4LVN P;  3HJV A;  3W1Y C;  2FDN A;  3D6F B;  1R7I A;  1LFW A;  4WIQ A;  4F3O A;  1YBU A;  4K4U A;  3PJX A;  3UW1 A;  4PZV A;  1FJE B;  3QFH A;  2DPJ A;  4DX6 A;  4RW8 B;  5IXU A;  3BQ1 A;  5LMU F;  2UUA F;  3H2U B;  2AYG A;  3BGL A;  2HG4 A;  2MZJ A;  3NGR A;  3GCW P;  1IKW B;  1YG0 A;  2RIL A;  3I32 A;  2UV8 A;  4PG6 A;  3M8Q B;  3ZZT A;  1U0H B;  4NXN J;  4OI6 A;  4IH7 A;  2A3J A;  3BN4 A;  3CJS A;  3QGP A;  3AH6 A;  4DV6 F;  2ZZM A;  4EBD A;  2K7J A;  1FT8 A;  2FHO B;  1WC0 A;  1HWI A;  4CH0 S;  2VKZ G;  1N34 F;  1X5T A;  2E1R A;  8AT1 B;  4E98 A;  2KKH A;  2XSF A;  3NEK A;  2V4Q A;  5J2M B;  4TKT A;  2KYZ A;  2GS8 A;  1RLC L;  3CCT A;  5J2N B;  4LSN B;  3K89 A;  1VLY A;  4J9K A;  2KU7 A;  4Q5V A;  4FF1 A;  4QU6 A;  1J5E F;  5C24 B;  4DR3 J;  1M5H A;  4JYA F;  3K0J A;  1U0S A;  1YJ9 S;  3ISN D;  2UUB J;  1TV6 B;  1ZA2 B;  3N5F A;  3UCZ P;  4IDK B;  2V4J A;  3L7P A;  5KAK A;  3SFG A;  1CSJ A;  2ZZT A;  3PJ9 A;  3QZ8 A;  5IS2 A;  3L4B C;  3PXG a;  2F8H A;  2DGX A;  5FII A;  3ILL A;  2EFG A;  4C8K A;  2HS0 A;  1EET A;  4I67 A;  4HKQ A;  3M32 B;  5F8N A;  4FPI A;  1RAD B;  1NKB A;  4IRC A;  2ZH6 A;  2QA1 A;  4DPT A;  1ACM B;  5HI7 A;  4DQS A;  2YWH A;  2B7B B;  3WDO A;  3FEZ A;  3AOD A;  1E6V B;  3BR9 A;  2EFQ A;  1R89 A;  3SFU A;  4M5I A;  1R6Y A;  1EX8 A;  4F2S A;  1WUU A;  1UCN A;  2GIF A;  3M9O B;  2FPH X;  3OSP A;  2EKN A;  4U95 A;  4JI7 F;  2IC3 A;  1XIQ A;  3DI6 A;  3GFZ A;  4HL9 A;  1O6X A;  1NDP A;  2W9C B;  4ELU A;  1BGX T;  1HAR A;  5M2U A;  3EGN A;  4GC6 A;  3M2V A;  4G1I A;  1RWM B;  3CDB A;  2C22 A;  3OQ2 A;  2E9R X;  2ZDP A;  2KHC A;  3M2U B;  4H4M B;  4F67 A;  4DLG A;  2ABY A;  3IBF B;  3RYL A;  2Z58 B;  1KLM B;  5F8I A;  4RW9 B;  2LFV A;  1NPK A;  2GQQ A;  2MKY A;  2D3U A;  1CJV A;  2J6U A;  4ZJO A;  1PCA A;  1REV B;  1SBR A;  2UVV A;  1B4S A;  4IG0 B;  3LTO A;  2HUR A;  1BC6 A;  2JEG A;  4B3S J;  1JLG A;  1WD6 A;  4QWA A;  2HMI A;  2GHP A;  1AZS A;  2HBY B;  4TU9 A;  4OI0 A;  4NEZ A;  1JLB B;  1MML A;  4F4A A;  3QO9 B;  2UUT A;  5FDL B;  3UPF A;  1C1C A;  3R2D J;  4ECS A;  4ZLN A;  2HW3 A;  2XMJ A;  4NXN F;  1XNR J;  4L76 A;  4QYZ J;  3PW7 A;  1FWL A;  1F1B B;  3AB2 B;  4CLZ A;  1S72 S;  3SQG A;  4ZCI A;  4Y65 A;  3N4W A;  4ED4 A;  2AGQ A;  3IAS 9;  4I7F A;  4XIU A;  2YXL A;  2V8V A;  3QIP B;  5HMZ A;  4IYQ A;  2QLJ B;  2YWK A;  4ZJQ A;  4UOC A;  5D4P A;  3I9Z A;  4B9U A;  2RT3 A;  3TAM B;  2XYG B;  1RYS A;  3TJA A;  4EFA C;  3MCO A;  3QMQ A;  4LF6 J;  1R3N A;  2LQ8 A;  4OJH A;  3PX6 A;  4LF7 J;  5D4L A;  2DVI A;  4B9S A;  2XM3 A;  2RD5 C;  2PEB A;  2CQ0 A;  3OFF A;  4LSL B;  4WKY A;  3DLH A;  3Q2S C;  1HBU B;  4DR3 F;  2DEI A;  2CPX A;  5I42 A;  4ZP7 A;  1X4D A;  2UUB F;  1WC1 A;  1URR A;  1WC5 A;  5C42 A;  2W4D A;  2E5L J;  3NMA A;  5ETT A;  5A8W A;  2ZOG A;  3OUY B;  1XR5 A;  2EKY A;  4RUC A;  4I2P A;  2KG1 A;  3HSG A;  3PHE A;  2DRA A;  1HHS A;  3DGP B;  3KLG B;  1RTI B;  2ZUG A;  1WF2 A;  1A0O B;  1JWW A;  4GC7 A;  5C25 B;  5B7W A;  2NXN A;  2HAF A;  4ZPW R;  4FP9 A;  4NRT A;  2B4V A;  1T9W A;  4ECX A;  5E3C A;  2V63 A;  5DDQ C;  2AT1 B;  3TX8 A;  3AHP A;  3DM2 A;  4CLL A;  2CJY B;  4J9R A;  3ZTS A;  3M6W A;  3KLF A;  2V67 A;  3PW2 A;  3I96 A;  1HQE B;  1JXL A;  3DLE A;  3BEG B;  2BAB A;  2Z2Y B;  3ILJ A;  2F3J A;  3SZ2 A;  3WC2 A;  1SQF A;  1NSK L;  2MKJ A;  3GYN A;  3M4X A;  4NLW A;  5KT2 A;  2VFT A;  2DBB A;  1I6J A;  5HSP A;  4RW7 A;  1S1T A;  3VAJ A;  3IM8 A;  4R5P B;  5RUB A;  2BJ3 A;  2BJ9 A;  4NMX A;  3MEG A;  1MLA A;  3DLJ A;  1UA1 A;  4WK3 A;  1YSJ A;  1B70 B;  2J8S A;  1NSA A;  1FD2 A;  4X4Q A;  2D3Z A;  1IKY A;  3FFI A;  4CO2 A;  1T11 A;  4OHX A;  3RGI A;  3CD6 S;  1IQZ A;  3PRV A;  3NS6 A;  2I2Y A;  3HLU A;  4B3S F;  3TX0 A;  5F8L A;  4CO0 A;  5EHH A;  2LP4 A;  4EZ6 A;  2G4B A;  4DSE A;  1M1H A;  3AJ1 A;  1IWA A;  1EAR A;  2OP5 A;  2R8I A;  4PQU B;  2UXC J;  4K5R A;  1YBA A;  1NSP A;  4O4G A;  2RH3 A;  1OYE A;  1YRX A;  2I9S A;  2QTW A;  2APO A;  2VBY A;  1CUL A;  1PBA A;  1T9X A;  1WC4 A;  4CLU A;  3TUZ C;  1VRT A;  3IWN C;  4OYA A;  5AT1 B;  2FVS A;  1F6T A;  1SQE A;  1X4C A;  1AUS L;  4LF6 F;  2P6T A;  1N54 B;  2L3M A;  4LF7 F;  3ETO A;  2EFV A;  2BOP A;  1BQM B;  2PN6 A;  1VBK A;  3D3B J;  2DR9 A;  2VC0 A;  1F3F A;  1IQT A;  1BXN A;  2J7W A;  3K5L A;  1UMJ A;  2CJX B;  3F0N A;  1HI8 A;  5CCM A;  2HHW A;  3ENW A;  4RZR A;  3MTK A;  3N5B A;  2HPU A;  2E5L F;  3TJ9 A;  2E7V A;  1NDC A;  4P2S A;  2ASL A;  2PE8 A;  2NS1 B;  3NNA A;  2BE9 B;  4NLQ A;  4P2X A;  4BBY A;  1P6T A;  4M5N A;  2BJ1 A;  1KVI A;  2KZZ A;  3I5A A;  3HKW A;  3BSA A;  2RB7 A;  3HT3 A;  3KLH B;  2XGP A;  1ZH5 A;  1WTF A;  3GCX P;  3RB0 A;  1C0U A;  2IJF A;  4HAC A;  4CDI A;  2COL A;  2ZM6 J;  5A8R B;  2OFG X;  5IM0 A;  1B7F A;  2BV3 A;  1DRZ A;  2W25 A;  4WXW A;  2XQC A;  5E2Q A;  2YNH B;  5AE3 A;  1SKW A;  3CJ3 A;  3PEH A;  2RQM A;  1TR0 A;  3GU0 A;  4F04 B;  2B5J B;  1PC4 A;  2XG8 A;  4LBP A;  4W4M A;  8RUC A;  5KFK A;  3D9B A;  2UXD J;  4JV5 J;  4PWW A;  4Z37 A;  4M8L A;  3CDA A;  4A4J A;  2OD6 A;  5HAN A;  2ZE2 A;  1AT1 B;  3PY8 A;  2QYG A;  3NAH A;  1LFP A;  2JJ4 D;  4KV8 B;  1XNQ J;  1RWK B;  5IT9 U;  1TL3 A;  2X3G A;  3C6T B;  2MKC A;  1G2E A;  1RP5 A;  4WFZ A;  1N5Q A;  2E1C A;  1FK9 B;  3TVK A;  3G4S S;  5H9F K;  3GFH A;  2VL1 A;  4C4W A;  3O6Q A;  4EYH B;  2UXC F;  5AXN A;  3LAL A;  1WTB A;  3ADA C;  3MM6 B;  5HBM B;  4MMO A;  4U96 A;  2RRA A;  4CQ1 A;  4YQW A;  2J8A A;  3H0P A;  2AJ2 A;  4ZK7 M;  2HK3 A;  5SUH A;  3NGD A;  1WEL A;  1U1L A;  1OPI A;  4NE9 C;  3NLC A;  3B8H A;  3KTQ A;  2VJV A;  3HSJ A;  3AY0 A;  4NOH A;  4ED6 A;  2JH3 A;  2Q43 A;  3CPW R;  3FBE A;  1XK8 A;  1XEZ A;  4DV7 J;  1M90 T;  4OX9 F;  2AJ0 A;  2DB1 A;  2NSB A;  2C3O A;  1AFI A;  2J6T A;  1VC5 A;  3B4D A;  3QAT A;  3KJV A;  1TVR A;  4K4S A;  3CCR S;  2M2B A;  4FS2 A;  2RJZ A;  1OY6 A;  4C0B A;  1N88 A;  4HHJ A;  4F26 A;  3CVK A;  1YI2 S;  3RBD A;  4RW4 B;  2CFX A;  1RT2 A;  5LOQ A;  1UET A;  5DLF A;  3M2R A;  2EK6 A;  2J0X A;  4NLS A;  3H4D A;  1XMO F;  3GJR B;  2AEF A;  2K3I A;  2RHS B;  3MPU B;  1N6Q A;  3G6E S;  2FJW A;  3Q8S B;  2DIV A;  1LKZ A;  3H59 A;  1RTH B;  3QBC A;  4M95 A;  3UR3 C;  4ZVQ B;  2Y9H A;  2FZK B;  1WKL A;  4P7V A;  2LEB A;  4M5L A;  4ANC A;  2I5J A;  2W8L A;  2ZM6 F;  3W2V B;  1H2T Z;  3IN5 A;  1F9E B;  4DFP A;  4ECR A;  2X3D A;  2RF2 B;  2JOQ A;  3H40 A; 
#chains in the Genus database with same CATH homology
 2QTW A;  1R6V A;  3GCX P;  2ZWO A;  3CNQ P;  3P5B P;  3WHI A;  4K8R A;  2Z58 B;  2XTJ P;  3A3P B;  2W2M P;  3H42 A;  3BGO P;  3BPS P;  2PMW A;  2W2O P;  3AFG A;  4OV6 A;  3GCW P;  3A3O B;  2Z57 B;  3A3N B;  2W2P P;  1SPB P;  3WIU A;  1V5I B;  2E1P A;  3QFH A;  2Z2Y B;  2Z30 B;  4YN3 B;  3VHQ A;  3WIV A;  2Z56 B;  4NMX A;  1ITP A;  2W2N P;  3T41 A;  4JP8 A;  3CO0 P;  4NE9 C;  3VV2 B;  2Z2Z A;  3SQO P;  2ZWP A;  1SCJ B;  2W2Q P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...