1KR4A

Structure genomics, protein tm1056, cuta
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
ALYFMGHMILVYSTFPNEEKALEIGRKLLEKRLIACFNAFEIRSGYWWKGEIVQDKEWAAIFKTTEEKEKELYEELRKLHPYETPAIFTLKVENILTEYMNWLRESVLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein TM1056, cutA
publication title X-ray crystal structure of CutA from Thermotoga maritima at 1.4 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 25
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kr4A00
1UKUA 1P1LA 3GSDA 2NUHA 4YB5A 5DS7A 2GW8A 4USJC 4Y65A 2VD3A 3N5BA 2J9CA 1NAQA 4CO5A 2EG2A 2V5HG 2O66A 4NYPA 2NS1B 1UMJA 3AH6A 1GNKA 4RX6A 2GNKA 4CNZA 3HLUA 2PIIA 4ZK7M 2Z0GA 1UFLA 5DRKA 4CNYA 4E98A 4C3KA 4IYQA 1OSCA 4OZNA 4RWWA 4YB6A 4OZJA 2J9EA 1NZAA 2J9DE 2XULA 4D3GA 4RWXA 3O5TB 2GX8A 3M05A 2ZOMA 3TA1A 1V3RA 4USHA 1KR4A 2E66A 1Q1KA 1NH8A 3MHYA 3O8WA 4CO3A 3T9ZA 1QY7A 1H3DA 4CO1A 4NYOA 4CO0A 4CO2A 4WK3A 2XG8A 3AA9A 2EG1A 3OPKA 1UL3A 2XZWA 2ZFHA 3TA0A 3X3UA 4CO4A 3CE8A 1V6HA 3TA2A 1VFJA 1O5JA 1NH7A 3AHPA 2J9DA 1XK8A 5D4OA 3NCRA 4YB7A 3DFEA 4C3MA 1PILA 3NCQA 2JJ4D 2DCLA 3L7PA 5L9NA 2RD5C 5D4PA 3BZQA 4OZLA 4C3LA 2NUUG 4D3HA 5D4LA 1V3SA 3AA8A 1J2VA 1O51A 3LF0A 4USIA 4Y6IA 5D4NA 4WK1A 3NCPA 2CZ4A 1V9OA 1VHFA 2O67A 4AFFA 2XBPA 4R25A 4RLEA 1HWUA
chains in the Genus database with same CATH superfamily
1RE1B 1SJ1A 3ETOA 3L7OA 1JNZB 3PTWA 2YQ3A 2V5HG 3SEOA 2OPQA 1RBOB 2YH1A 4I2QA 4NLUA 3O44A 3DN9A 4HLBA 1S0VA 4R0JA 1S12A 3D1OA 3HLUA 1ZA2B 2NXUA 4C3KA 3KK3B 4ZMMA 4QPXA 2J0WA 1OY9A 2W8LA 2WW4A 3UVJB 3K5LA 5B0GA 2E5JA 1KD1T 4OL8A 1NH8A 2RT3A 4CLLA 1NXIA 3BSAA 5E3QA 3VR1A 2PO4A 3FMBA 3N28A 2JH3A 4WE1A 4RW6B 2ASLA 1FTCA 3O2IA 3BJYA 1D3WA 4DWIA 2VG5A 2GJFA 4I7FB 3QRRA 1IXKA 5E2QA 1NKEA 1OJ4A 5HLFB 2SXLA 4Q0BB 4PYDA 1RA6A 1FHTA 4DX7A 3QZ8A 5AJ3J 4QIGA 2MEWA 4NX9A 5JJBA 4WXOA 3D1HA 4AXIA 1LWXA 2ALYB 3GG0A 3MM9A 3QIDA 1HYSB 4DR1F 2UUAJ 1FXDA 2YKPA 5DRKA 4NZ7A 3Q89A 1DQ9A 1UWBB 4CYUA 2JDJA 2VOOA 3TA1A 2XNRA 2BW7A 2GMHA 3ZZZA 1X9MA 2J7KA 1FXRA 1UZHA 2V0NA 5DQGA 3OR1A 2BOPA 1NK9A 5J2QB 1EARA 1RAOA 3IBWA 2UP1A 3H7HB 2DCUB 3J7A1 1RZMA 1EKRA 4UZBA 1VK3A 1RTJB 2WSEC 4X84A 3FUYA 2BABA 3CUNA 3NY0A 2MGZA 1LWCB 4DL2A 3MMCB 2YNFA 5D0HA 5D15A 3P6YC 3KLEB 1WWHA 5F3TA 5HAOA 5CYQB 3EZ5A 5HJYA 1WC3A 2D9PA 1X4EA 2HHSA 4Q8EA 4LBIA 2MLXA 4DXLA 5G0RA 4DUYJ 4YEAA 1Q0NA 3MR3A 2HRYA 2ZBCA 2AF6A 2KRBA 1C1BA 1REVA 2H5EA 2LECA 2PFFB 1WJ9A 3U7JA 2NYIA 5DETA 3CCVS 4O44B 5RUBA 1HL6A 2XLIA 3NS6A 4NA1A 2EEYA 5J1NA 2NREA 3H59A 3W2WA 2MB0B 2W9CB 3UE2A 3WC2A 5KT6A 5L1IA 1U2RA 5ITHA 4ECTA 2UUAF 1DAXA 2ALZA 3M8PB 3R5GA 3F41A 2XMJA 1KLNA 2FY1A 1RA7A 5JVHQ 3CMES 1NZ8A 2CUYA 4F4XA 3IRXA 3CJ2A 2Y9HA 3GJRB 2BM1A 5KFAA 1R0AB 3A8JA 1SIZA 6FDRA 1VRUB 3SQGB 4C4WA 3NWGA 1XNRJ 1MU2B 1CBKA 2CQ4A 5JUMA 2DVIA 2CPEA 1M90T 1HMVB 5FIIA 4DDFA 2ZJPQ 5HVGA 2CZ4A 3TANA 4DL6A 3RZAA 2B9XA 1YZ6A 5IT0A 3D2WA 1SKRA 2ABYA 2VPXB 4JI8J 4L3NA 2LA4A 1JLBA 3KG4A 3SDEA 3MEEB 3P8BB 1S1WB 1AYEA 4LRCA 1RTIA 1F2GA 4W98A 1VBZA 2OPPA 2V4JB 3TUIC 1R7IA 3GFZA 4YY3F 1KVIA 3NOCA 1IKWA 2GS8A 4DUYF 5K8MA 4WK3A 1WG5A 3CULA 4NLYA 3DRRB 5E0OA 4ECUA 3H90A 3TJ9A 5D77A 3ZZOA 2CIMA 4DQRA 3KHHA 3RUBL 4Z2XA 3GYXB 4RR5A 8AT1B 5J2MA 1N88A 2MQOA 4CRJA 3QAEA 3W3SA 1J2VA 3H2LA 1X4BA 5CA5A 2EFPA 1H38A 4ZHRA 2DJWA 4C2MA 1H98A 3PYDA 4F67A 3MM6A 4R25A 5DGBA 4P71A 4IG3A 4ELTA 2LKZA 1APSA 1RACB 1QSSA 4I69A 1AZSA 4MK7A 4IO9Q 3C66A 1RT4A 4F0HA 3PACA 4EZ9A 3M8QA 2NSCA 4M5KA 3VAJA 1U1KA 4AT1B 1DTTA 3QJPA 1RU2A 2C3YA 2IAJB 3VAMA 2RS2A 2ZOMA 2HZAA 4IG0A 2WZ1A 4RU9A 1QLNA 3DOLB 1QAIA 4DCPB 2ZBRA 1H7XA 4L75A 2NR0A 4Z37A 2VODA 3ZFVA 1Z1ZA 4UZCA 2AHOB 2MSTA 1WD6A 3G6XA 5KG1A 2FD2A 1U1QA 2DNMA 2LEPA 2HHPA 2LQJA 2PA8D 5KFJA 2IVMA 2MZQA 4PAAA 2FGCA 1KVJA 1NJWA 5IWAJ 3VVUA 1HBUA 4RNMA 2DGQA 1J5EJ 2R7UA 2KT5A 4EMDA 3IR6B 3GV7B 2DIVA 1KWMA 4V19X 4K0KJ 2R7SA 1GK8A 2ASYA 2E1PA 3QWUA 2NXCA 4YB5A 3C6UB 3U1LA 2AGOA 2CFXA 4NLQA 3FC9A 4C11B 1MWQA 1FRMA 2BANB 1RT5B 3MM5B 4DUZJ 2ROPA 4RO0A 3Q86A 3TUPA 1NPPA 2J6TA 1HQEB 2E66A 1D8ZA 3ISZA 1HHQA 4O4GA 1EP4A 4MK9A 2XB2D 2XZWA 3M1VB 4Y2MA 4KGKA 4ZVFA 1WF1A 3DU5A 3BEGB 2JWNA 2YNHB 4DV6F 4KR0B 2CPYA 4P2SA 4USTA 3EUNA 4XTTA 2UXDJ 3EGVA 2HNYA 2A0FB 2GO9A 4KGZB 2RF2A 5GMDA 1AB8A 1Y4ZB 2ZZTA 3MAHA 1T9UA 2XZDB 3VGSA 1XN9A 1C1CA 3EE3A 3R2CJ 1S9FA 1QVFR 3M6VA 2YPZA 4CLPA 3HHDA 1W25A 3B4MA 5LSRA 3C16B 4CNZA 1WKLA 4RPFA 1RSCA 4RWWA 1XMOF 1HQUA 2V8VA 2IYGA 4K0KF 1U02A 2DEIA 2NZCA 5F8MA 2W8KA 1NLKL 1HWKA 5AXLA 4DL5A 2JVOA 2FIUA 4ZVTB 5I3UA 3BKUA 1U1PA 2MQLA 1OIAA 4NZ0A 3US5A 4HL9A 3NL0A 5H1SV 1X9SA 1S7HA 4IOCQ 4OHZA 2ZBQA 2G2ZA 3HVTA 4DUZF 1U4BA 1MMDA 3MUMP 5HMWA 1REGX 2CG8A 2ZKUA 1Y9OA 3GJQB 2K1RA 2ILZA 3M8YA 1RWWB 3MCNA 4NLTA 5CYMA 1HNIB 2HW3A 3AB4B 2E7WA 5CHCB 4MK8A 4FXVA 3D68A 3QYYA 4Y28C 1IBLJ 1UFKA 3VQTA 2BEFA 5I3QA 3BBFA 1VK8A 3QGHA 4LREA 3IM9A 2HRUA 4DPOA 3J7YU 3G9CA 1RYSA 3O1LA 1RWXB 1RAAB 4DV3J 2YKOA 2DO0A 3NGUA 3ETMA 5GAGI 2VOPA 1N6QA 2DY9A 1T3NA 4CLZA 4F36A 5HVHA 1VGYA 3WHIA 4F0KA 4ELUA 2P2CB 1TUGB 2BE9B 1RAEB 1LWEB 1RHRB 3V81A 1G6BA 1TL1B 4USUA 3FK4A 1N5TA 1CJKB 4R5PB 3CMQA 3VZHA 4M5DA 1FVQA 2DISA 3EGWB 4UUWA 4ZPAA 1KQKA 5KFGA 2HHUA 5CABA 3MPDA 1C0UB 1PJ7A 5HN0A 5C7PA 4OIXA 3DRSA 4OZ0A 1DLOB 1WUUA 2ZH2A 2MZ1A 5KFYA 1FJEB 3GIRA 5KFMA 4RNHA 4DV5J 3VALA 4IOAQ 3M2VB 2Z4PA 3Q0AA 3GFHA 5M2RA 2MKJA 2OEKA 5T41A 3BKTA 2AEJA 4Y00A 4YR2A 1Y3JA 4ZVHA 1VC0A 2PEBA 1IBLF 3J81Y 3GR1A 1VQ7S 2D3UA 4QR2A 3NMAA 3CCZA 3W62A 2H5IB 4TLRA 1OYDA 3CSKA 2FLNA 2H54B 1BUXA 3IWLA 2JVRA 4DV3F 3VAIA 3T3FA 2R7QA 1JK9B 1PBAA 2YVSA 2RVJA 1U45A 1R6VA 1Q8KA 1X4DA 1PYTA 4KHRA 2HFSA 1SKSA 2B7BB 4IFVB 4OYWA 4OLOA 1NHVA 2XLJA 2H1YA 1HI8A 2VUGA 3DLKB 2VFRA 4M8LA 2HFOA 2Z57B 3BPSP 2W7OA 3MCMA 3RRKA 4DSEA 1GMVA 5GMEA 1T9XA 4OI1A 4LFCF 1M5OC 2DR5A 2J0XA 2W2NP 4TYBA 2M88A 1GAOA 2L08A 5C24A 2R4FA 4I2PB 4TXSA 4F2SA 2VDHA 4DV5F 4HHUA 4DQPA 3KUGA 4XPCA 4GC7A 1SB6A 3OBIA 3NAIA 2UXBJ 1NJYA 2AJ0A 3T9ZA 3THTA 3TZYA 5D6GA 3TQEA 1QJHA 4LQ9A 2WSFC 2XNQA 3N79A 1SL1A 3AD7C 4K4WA 1OPZA 2V63A 2RUGA 3UDVA 1FXLA 3TVYA 2BQUA 1FJGJ 3BGOP 1R8HA 2MKKA 4C0HA 5DM7Q 4J9NA 2M0GB 1RTDA 1NPRA 3OTEA 2HGLA 5F8IA 2FJEB 3FBBA 4OZ2A 3QPIA 4K4UA 1PKUA 2MZJA 2XO6A 5AE3A 3DGVA 3MMAA 4LQ3A 5CYJA 4ZVRB 1H7WA 2Z56B 4F26A 2VHGA 2ZJQQ 4FF3A 1Q82T 1JNRB 4QR0A 3QO9B 1HBMA 1VOMA 3QGPA 1SJRA 2H9ZA 4NYZA 3GU0A 2N4CA 4P2MA 4C6AA 3KLGA 2EWHA 4ECQA 2W4DA 5KFDA 2HKEA 2FZCB 1JJ4A 3NNCA 5H9FK 2HS0A 3L7UA 5ETRA 3PHTA 1RHMB 1YJTA 5KT5A 1GMWA 3MECB 2VDIA 3IM8A 3LW5C 2AJ2A 1F9HA 4H4MB 2HFUA 4NLGA 4R8UB 1WHYA 3OT9A 4CZCA 4LIRA 4C0BA 3T9NA 5DQHA 4DL0C 3M4XA 3FQLA 3SV3A 4CTAB 5A6WA 3BDEA 2NUUG 2VQEJ 2B51A 2W9BA 1TMJA 2XBPA 4X4NA 4D3GA 1P27B 5LJ3Y 5FLXU 3QGIA 2GQQA 1FJGF 3KLFB 3A3PB 4RBTA 3MAAB 4NA3A 2B43A 2YWKA 2L48A 3T41A 3R5CA 4PEOA 3LPYA 3OHAA 5K20B 2J6SA 3EVMA 4DV7J 2DXEA 3JTNA 5FD1A 2K2PA 1QM9A 4KV8A 5ETPA 4I56A 3G86A 1F6TA 1D9DA 3QATA 4ER8A 4K2JA 2CQ0A 3DHWC 4DZDA 4P75A 2RUSA 2HHHJ 4YHHJ 4G1QB 1YZ7A 3MFHA 3NAHA 1TL7A 4C7QA 2QFIA 4A4JA 3C3LA 1T7PA 1TKZB 1S49A 2UU9J 3FJ2A 2GCFA 1WF2A 2J0QD 2XEXA 2DGXA 2XI3A 4C8YA 2DGVA 5IZHA 5DLFA 3T5KA 4TYAA 1ZPVA 1VQNS 3UQSA 2DXDA 3AD8C 3Q83A 4LF6F 1KRPA 5KOXA 3KMSA 1RB0A 2Q3PA 1RHKB 5GAEI 4NYPA 4WU2A 5J2NB 5HP1A 4GO7X 3TJ8A 1QE1A 2VG5B 1DJ0A 4DSLA 4PG7A 2H3EB 3EDRB 4FPIA 3DGPB 3QLHA 1UVMA 1JIHA 5GAHI 1U6ZA 4LFAF 4LUBA 1FRXA 4DR2F 3VF0B 1TKDA 2IJNA 2B9YA 4DCOB 1X31C 5JVGQ 3LP1A 2XMWA 4J9LA 3CIZA 1VQMS 3HZEA 4DV7F 3OW2R 3N4WA 3W64A 1CS4A 2QMWA 4B9TA 4MTPA 2ZDOA 3QT5A 5DM6Q 1RGVA 3JTPA 1RT1A 4B08A 3IBFB 1I51B 1N5YA 2ADCA 5KT3A 4FF4A 3AA8A 4RW7B 2IBOA 2ZNYA 3G6ES 3NCPA 1FA0A 2MZSA 2HHHF 5IOLA 3JAMY 4YHHF 3OR1B 3KUHA 3MTKA 2J76E 1LEOA 1NHKL 3IS9B 1R8PA 3JQJA 3M2UA 4ILRA 3DOMA 2UU9F 3HVRA 1YJWS 3K8WA 2Y8WA 4JI4F 3G8SA 1HNZF 4FYVB 4WPAA 2GX8A 3CWJA 2YX1A 4TLQA 2OH2A 2DRBA 2DRDA 4WTYA 2CZ9A 2BE2A 1IKYA 5HANA 4J5OA 2DGTA 3RRGA 3OJSA 3OUYA 5DLGA 3HM9A 3RG6A 3W7BA 2DNZA 1V6HA 1WHVA 2W7AA 3JSMA 4Q45A 1LW0A 3M2RB 1F60B 4C3MA 1UFWA 4UT4A 1S6QA 2JJ4D 3TEHB 5ETMA 4QYZK 2FJWA 2JRSA 3EICA 2FHJA 1RADB 4B3SF 3AODA 1WSRA 4OZ3A 3IMQJ 3PFOA 1WC1A 4V1Ak 3CC2S 2KYZA 3VAGA 5KFEA 4ZITA 2KJVA 4DFJA 4FVCA 2DH7A 4N77A 2CPIA 2X3GA 3E2EA 3BGRA 1TV6B 3GE9A 1GXLA 1FWPA 2ZH8A 3MAQA 4URQU 2VC0A 4E0DA 3IRXB 2Z58B 1CPZA 4IYQA 3QRQA 2VKZG 1YDLA 3FSYA 1T95A 4MKBA 4NWBA 1CJTB 1TL5A 1WI6A 2MQQA 3L95X 4RBUA 2J0SD 4KO0A 2ZH6A 3J80U 2MSSA 5DJBA 1VQPS 2HS3A 3PYEA 3CO0P 3D0GE 1FNMA 2HZVA 3L09A 1JLBB 3GFYA 4O0NA 2KXHA 1F5CA 1N36F 2OO4A 5KT4A 5GMKa 2XWXA 2H48B 5C42A 3CDAA 4C98A 3CPWR 2F63A 2YPYA 4KFBA 2BKPA 1VQ6S 2VBWA 3QT7A 3NLCA 3JYTB 4CLYA 2KHDA 4DCJB 3FVYA 2I2YA 1Y5LB 4HI1A 4N7TA 4BLGA 2JEIA 1FE4A 1G4CA 2FJAB 1DRZA 1JXEA 3OFGA 3A8EA 3ITHB 5L46A 3Q22A 1KQSR 2CJYB 1U0HA 3BYRA 4WP8A 1EJ7L 5J2MB 2FVPA 3W8PA 1WKKA 3G82A 1URNA 3LA0A 4QBUA 2EW9A 5IM0A 4WIQA 4NXNJ 4KB7A 3TNVA 3I9V9 2WAQD 3MM6B 4CO2A 3KK3A 3V6KA 1QAJA 3UVJA 3IRWP 2XGPA 5CZVA 5C2CA 3NBPA 3UI3A 2R7VA 3PW7A 1O5JA 1NH7A 4PRFA 3G71S 1KDNA 4ED8A 5DG8A 5DQIA 2IM3A 4ZPBA 3M8QB 1ZM3A 2OD6A 2DR7A 3QWPA 3MR7A 3TRGA 1K8AT 1DTTB 2G1DA 2OGUA 4RJVA 5EWGA 1HNWJ 1ZM9A 1RABB 4CH1A 3RBZA 4ZPTR 4IG0B 4RW6A 1RAGB 4USMA 1XC9A 2GQCA 2X3DA 2RQCA 2Q66A 3FRZA 3D3CJ 2VFUA 4EBCA 1HWUA 4ANEA 1PJ6A 3GCWP 5HLFA 7FDRA 4Q0BA 1F9FA 5L1JA 3HHLD 3PIPQ 3CEDA 3VHQA 3HHEA 3R9LA 4RUBA 3H5XA 2RRNA 4NCGB 2B8QA 4MIWA 4X4QA 3R5BA 2Y8YA 1NZAA 2GVZA 2FY8A 1WEZA 2V8DA 3Q8PB 5ETNA 2CADA 2HHXA 3T1HF 2FYXA 1HYSA 3OFFA 2B9EA 3E01A 1OQ6A 1M1GA 1FEHA 2ZBIA 1U6FA 1JXVA 1KNZA 3MFIA 1GH8A 3CCWA 3OV7A 2Y1JA 4JI0J 1QTMA 4YDDB 3RBDA 2DGSA 5E7OB 4QW9A 2HVHA 1JLEB 2RILA 4OV6A 4AQYF 4I1TA 3OTOJ 5J2QA 2ZNZA 2C3OA 4ZKAA 3HDSA 4NXNF 1UVJA 4CT8A 3I5BA 2KZMA 3OXGA 3W61A 1D8YA 2DNNA 4Y6IA 4HYKA 3BSOA 4W92B 1BLUA 2RH3A 2EXUA 4O4GB 3R7NB 5IT9U 2HWTA 1AFIA 1R0CB 4F3OA 5F8GA 4HDGA 4RW4B 3DLEB 2HWIA 2EBEA 3KMQA 4OFZA 2KXNB 3KLEA 5D3GB 4AYBD 3IGNA 2ZHAA 2GNKA 1DURA 1HNWF 1VIOA 1RT3A 5CYQA 4E98A 5F8NA 4RWXA 3PDNA 4URGA 2RF2B 1KR4A 5B08A 1Q1KA 4ZVSB 3EM1A 4BDPA 3TW0A 5IXUA 4EZ6A 4RNNA 3VAFA 1EQMA 1N33F 4O44A 2DHAA 3CB4A 5B0FA 2CNOB 1C1CB 2W2MP 1S6PB 2ZWPA 3N5FA 3MWBA 2LMIA 2IC3B 3DYAB 3KFWX 2VPWB 2M3DA 3QBCA 1IBKJ 2VONA 1YITS 4TU7A 2J8SA 3I5AA 3ISND 5F8JA 1HQUB 1KFSA 4F4YA 1I1GA 3M8PA 1BC6A 2GQ2A 2APOA 2M4MA 2ZBPA 2G4BA 3LF0A 4CQ1A 3CJRA 4JI0F 4PXEA 2XCAA 4QJVA 5KFIA 2Q6BA 1X4HA 3CJ0A 2RU3A 1R0AA 3AD9C 4NMLA 1KOOA 4WP9A 1YRUA 1MU2A 3HVTB 3UDLA 5CQGA 1HMVA 1S1VB 3OLBA 4J90A 2K1RB 2KO1A 3UNGC 3DLBA 3CCES 3PJ9A 4QR1A 4JV0A 3MEEA 3BO4A 3CJKB 4FPRA 2ZZNA 3N6MA 4K59A 1S1WA 4NYOA 2KVIA 2X7IA 2HAFA 2W1BA 2Q1LA 3H2VE 2UV8A 4ID8A 4QWAA 1NB2A 2V4JA 5KAKA 4WZMA 3H20A 5HQLA 4LF2A 1RTZA 3FSXA 1W7WA 5KFUA 1HKAA 4DV4J 4AXJA 1H2VZ 4B9MA 1FKAF 3BYPA 1KONA 4K5SA 4IH7A 4KTQA 4A8XA 4D3HA 2GA7A 1UVNA 1YG0A 1RT7A 9RUBA 2RDDA 1IBKF 2B7CB 3KKFA 3NGKA 1SUQA 1GMUA 1K1SA 2XTJP 1UPPA 4KE5A 1WOOA 3DRSB 4UF4A 3IXQA 2FDNA 3J7Z5 4JUZA 1SL2A 1R31A 5A76A 3IR7B 3SFUA 2Z2YB 1U8SA 3ENWA 1HR0F 3RR7A 3PYFA 4ED1A 4JI1J 1K0TA 3HSZA 2HPUA 1HWLA 4KIAA 2XHCA 3MF5A 2GMLA 2BJ1A 1JLCA 5ETOA 1JLQA 3IWXA 1QVGR 3DOLA 2L9NA 4XIUA 1Q7LB 3WX4A 5LMUJ 2HQIA 6FD1A 3J7ZT 2AZ3A 2GGPB 4RUCA 4M94A 1JJ2R 4X66F 4ZVEA 4ZPDA 2KM8C 2VJUA 3ZNJ1 1LV5A 3NRBA 3U27A 2DNRA 1ZM4A 2FB0A 2Q43A 1XMQJ 1RTHB 4DPWA 3IA0A 2F7VA 3IAM9 3T19A 2V69A 3I5CA 4ZVUB 1GXUA 2FLPA 4DV4F 1ITPA 2H65B 1CULA 5HMYA 2RQMA 2R2UA 5E33A 4M1KA 1JKHB 3PG9A 3THVA 1NK8A 3SSRA 2AEMA 2JLEA 4Q2MA 4ZVPB 2FC8A 2P5VA 1KHWA 3E8OA 3C6UA 2DXFA 3RW7A 4C11A 2BANA 5J2PB 2ZHOA 3GJSB 1EETB 3HZGA 4FYWB 1RT5A 4A8FA 3I0SB 1H3DA 5BYRA 2EK1A 1PG5B 2ASDA 1N4LA 1T03A 5KFOA 2IHR1 4NLRA 2PEHA 2E5IA 1U0SA 4CCHA 2DRAA 1ZM2A 1EKSA 3I4HX 4B3MJ 2Z2LA 3L3CA 5AE2A 1VBKA 1FTRA 2MQNA 3BF4A 3M1VA 3AOBA 2VG7B 1HBOA 3GMGA 4ZCIA 4JI1F 3FRYA 4JI2J 2IRYA 2YNHA 2PMWA 4MKVA 1TFYA 3C46A 2KH9A 1VISA 1UVKA 4F3QA 5LMUF 1NAQA 3CT9A 3IWNC 1ZZFA 2EKNA 3ONQA 2XQCA 5BR8F 4H54A 3JQMA 3TI0A 4NZ6A 4OZJA 4DS5A 3J81j 4HHJA 3OQ2A 3LP2A 3PO4A 3HMJG 1Y0HA 1B64A 3C16A 1HBNB 4K50A 2FC9A 3I6PA 4B3RJ 2IRUA 3HP6A 2IY5B 3QSIA 2KFZA 1HA1A 1NJIT 1YBUA 3MMAB 1KTQA 1UTAA 3WQPA 1ZH5A 4X4SA 3KLGB 3SSQA 5GAGU 4DZ6A 3F0NA 1WKJA 3TEGA 2NPFA 2QZ8A 2F1FA 3GJTB 1WEXA 2JFKA 2ERRA 2E1CA 2O5DA 2IJRA 2YXLA 3LWMA 3DU6A 1MROB 4B3MF 2J9CA 2WHOA 2RDIA 1KTVA 3AFGA 2G9OA 2B4PA 1ZOTA 5IS2A 2W01A 1NSQA 1FF2A 1OSCA 4ATNA 7FD1A 2XMTA 3MEGA 3CJQA 4ZDNA 3QFWA 2VBXA 4X65J 3D54A 1S9EB 4CO3A 1CJUB 3LOUA 3ET6B 4RNFA 2PC6A 3P5TL 4C48A 1W26A 4OYZA 2W2OP 2PMHA 2QRRA 3CW2C 3RB3A 1S6OA 4WYLA 4PXCA 1LWEA 2MJUA 1YBAA 3N01A 2FVSA 2AIRB 2HHQA 1TL1A 3GCXP 3MPVA 4QIWD 5K8OA 2JC1A 3TX8A 4R5PA 1H72C 2ZOGA 4JI5J 4KV8B 1CG2A 4B3RF 1EX8A 3C15B 1J5OB 3MGJA 2L41A 1C0UA 1Z2ZA 3Q2TC 3R3TA 2DD8S 2UVWA 5KFLA 4PCQA 4LF7J 3X1LB 2ZOFA 1FX2A 1DLOA 1T8EA 2CQ1A 4MIBA 3NEKA 4AE5A 4TQSA 1UCNA 2I5JA 1FDAA 2J7UA 4DL7A 2K3IA 3AJ2A 3I82A 2PD1A 4FNHA 4U7UD 2LVWA 2HG4A 2HNZB 2HAIA 2PE8A 3FEZA 4XPEA 3V6DB 3CVKA 4DF8A 3NNHA 3BGUA 4JB8B 2E5GA 1L3TA 2CJAA 1JX4A 3NWRA 2XS7A 1Y7PA 2JC0A 4OHVA 4DF4A 2BACA 4FN5A 5KG3A 4KT0C 3ZXWA 4CH7A 5HP1B 2BBEA 4RW8B 3TAMA 4JV5J 2ZD1B 4X65F 1FRIA 3MEDB 1IQTA 2WSCC 5HBMB 2W9AA 1DARA 3QLHB 2HBYB 2UVVA 2O3DA 4MKAA 4A47A 4IDKA 2OFHX 4U7UK 1RBLA 3JS9A 4R0EA 4P7VA 2CAJA 4QYZJ 3Q24A 3DLGA 2YWWA 4IFVA 1ZPWX 3AJ1A 5A8KA 2H4WB 4GKJJ 3SFGA 4LT6A 3FZ2A 1O6XA 3DLKA 1HD0A 4JI5F 3W9IA 2I6WA 4NXMJ 1RWUA 5C5JA 2QLFB 2KRRA 2VF3A 3W8GA 1N5YB 4X4RA 2QEXS 2DHSA 4UOGA 1FDNA 4F4AA 4LF7F 2LQ8A 3DCAA 1GX6A 2B9WA 2X51A 4PXBA 1YSJA 2XMVA 4I2PA 3MR6A 2AWZA 1UWAA 3T1YJ 1PAUB 4CO4A 2B56A 2XMAA 1RISA 3GIIA 1QSLA 4I6YA 2YWHA 3FFIB 1TVRA 2DCLA 3QNWB 1NPKA 3HXMA 1RAJA 2AYMA 4EUVA 1RKJA 4WIIA 1Q8IA 2DB1A 2KG1A 3NGRA 5EHHA 4RUAA 3OUYB 5K8PA 1VBYA 1U1MA 3F44A 3PRBA 1ROFA 3I31A 4KYZA 4JV5F 2XMKA 3LH2S 1AW0A 4DS4A 4MFBB 3KDOA 4L74A 1X4CA 4LF8J 4OYPA 4YMEA 2CJBA 1S48A 3TR5A 5ETVA 4PABA 2GHWA 2YKNA 3O6QA 2FZGB 3DNCA 3V4IA 2F4FA 2K8GA 2OPRB 3HHNB 5LSLA 2B0GA 4U8YA 2MXYA 4OMFG 4GKJF 4L72B 1H0HB 2UUCF 1T9VA 4ENOA 1Q86T 3CXCR 2QSWA 1UJ6A 3JTOA 3M9OB 3MECA 3G8QA 1NMEB 4H4MA 3LALA 4R8UA 1FVSA 4OZLA 4OHXA 4ZA1A 2CZVC 2RKIB 5D4LA 2OTJS 1MNEA 1FKPB 4DR3J 4KSEB 3T1YF 4ETXA 2ZJRQ 5FJ4A 4KO0B 2VPYB 1KFDA 2IDLA 2HEKA 5J1PA 2POKA 1P8GA 2Y3YA 4CLFA 3MMJA 2EG2A 3PRVA 4DR5F 1FERA 2LU1A 4NEYA 2E44A 3OR2B 3QAUA 3OL6A 4N5SA 2YH0A 3HHLB 4N41A 2AYEA 2VV5A 2Y1IA 2EKYA 2JL9A 4P74A 3K7RA 3MAAA 1ACMB 2YWGA 4DSIA 4CLWA 4CO1A 1KOHA 3FGVA 5KFCA 2LCWA 4LRFA 2ZH7A 4LF8F 4DR1J 2QMUB 3TA2A 2UXCF 3DOKA 2C2ZB 2KU7A 5GAEU 1IR0A 2VB6A 1OYEA 1S5ZA 3AOAA 4G1IA 3POTA 5K14B 2V9KA 4E2FB 3K17A 4N76A 4OX9F 2CQ3A 3QJLA 2E1AA 3BKFA 3G82B 2HVEA 4F0MA 3PJXA 5GAHU 2MJNA 5IM0B 2GJIA 4USKA 4FF2A 4G1QA 3DM2A 2B5JB 3VCDA 3MPUB 3FMWA 1LFPA 3WX8A 1TKZA 3F56A 2D3ZA 5EN1A 3NBPB 4WYWA 3DRPB 3K57A 3D0IE 2RHQB 5L39A 1YRTA 4CNYA 4DR3F 1RT6B 4ANDA 1IR2A 4B3OA 2OLWA 1G2EA 4DG1A 3WBZA 2DNHA 1FRKA 3PIOQ 4NLSA 3ZZUA 3MURP 2C22A 4USHA 5J2NA 1C4CA 1S4EA 4DQQA 1X7VA 4K8RA 4EO8A 3DGPA 3DRYA 2DKOB 5A6PA 2PFDA 2E7VA 2NQPA 1BHNA 4CLKA 2WTFA 4ED7A 2F9DA 3ZTQA 5EWEA 3G6VA 3C2PA 2HNDA 1ZETA 1FEEA 2GHVC 2GVZB 4ED2A 5L9NA 4FNIA 4JYAJ 4O3QA 3ELHA 1X5TA 1GFWB 3FEXB 3UD3P 4W4MA 2U1AA 3E01B 1NK7A 4P2FA 3I4PA 3MM7A 3EJMA 3OLAA 2BE7D 2J5AA 5E3PA 1NK0A 2OEMA 1NSAA 4J9OA 2QG9B 2YNIB 4Z7CA 2MLZA 1K44A 3ILLA 1Q16B 3MM8A 2ZKTA 3HSJA 4A46A 1XBWA 2DR8A 4RW7A 4J9VA 4DV2J 4Y2IA 1NJZA 5F8LA 2WB1D 1Z2LA 2XM3A 3M6XA 1MG7A 2OFGX 4IO1A 3IS9A 4X64J 3OSPA 3HVAA 4IR1A 2QLWA 5HVFA 4XAKA 3A13A 1RBAA 1M5SA 3W60A 3KDNA 2B6AB 1UL3A 4ZOSA 4UQGA 4DSJA 2ZDPA 3BBBA 1RT3B 4EYHB 2GIFA 3V4MA 4WFNQ 3TYTA 3DDKA 2RRBA 1D9AA 3GYNA 4YY3J 3NNAA 2D41A 4LIWA 2GJ2A 4F7VA 1G7CB 4H4OB 1TK8A 2Y1LB 2EPIA 2QIFA 2WBRA 1W2IA 3M2RA 3BS9A 1WC0A 2CQGA 2IM1A 3H42A 2UVRA 1P1LA 3GONA 4Z7YA 2PN6A 3CD7A 4LSZB 1PBUA 4JYAF 5ETTA 2E29A 5L8RC 1FE0A 3HPOA 4TU9A 1RJJA 4YB6A 4DL3A 1VC6A 5DO2A 1TV6A 2MYFA 4JI7J 1TKTB 2CDRB 1LW2B 3QMQA 4WJBA 4Q8FA 1SVDA 3ZTSA 2DH9A 4U8VA 1OO0B 4M5HA 4U96A 1FKOA 3UDEA 3GV5B 4ZJLA 2BOAA 3B6BA 5K9FA 3W5YA 3C6TB 3IBCB 3LGMA 4UUXA 2NXEA 1CJTA 4DV2F 2V50A 2EFQA 1KSPA 4ZCMA 2AJ4A 2G13A 1U26A 2E9ZA 1GTHA 2P9CA 2IMWP 2WVCA 2CNNB 5AXNA 4X64F 2W7PA 2KN4A 4ED5A 2JLGA 5A2QY 2HQCA 3H8YA 2HGMA 4DI6A 3L7PA 3G6YA 3SCLE 3BQ0A 2PDAA 3VVTA 1RCXB 1SQGA 2ACYA 2MHEA 3EDQB 3T1AA 4HKQA 1HI1A 3KNGA 3EPGA 4N47A 3H0PA 4O3OA 2GIQA 3VWSA 1VJQA 2V8GA 4RL1A 2HQGA 5F9LA 3BDPA 2B4VA 2LDYA 3WC0A 2R9LA 2G0JA 1NUEA 3JYTA 2VJVA 5B0AA 2IDEA 1A0OB 3GB0A 3R7BB 4EEYA 1TL3B 4NCBA 3VTIA 2BQRA 1RU1A 1FD8A 4ZVGA 4P6QA 4OYIA 4FF1A 3RAMA 3ITHA 2XMUA 1H2UX 2MKIA 2LDIA 4L6V3 3UNYA 4RUHA 1RT7B 4MKYA 1YIJS 1S76D 2AKWB 2MKCA 3MD3A 1SUQB 3MCOA 2JEGA 3KK2A 1F3FA 4GVBB 4ED0A 2A10A 4JI7F 4EWTA 5D0EA 4KGMA 5J1EA 3W9HA 3PX4A 1B99A 5KG0A 2W4PA 1FO1A 3ENVA 4TY9A 2X1GA 4G6VB 4LR7A 1Q95G 1SQEA 4KH1B 2FQQB 2NZ4A 4OI4A 2A2CA 4U67Q 2LXIA 4ZPWR 2QYCA 2D3O1 4OI2A 1XEZA 1YWXA 4A8YA 3PHEA 1MWYA 4HH1A 4DV6J 5LOQA 3ZTPA 2RIJA 1BQMA 3OXFA 2AJQA 1JLCB 1FFGB 1JLQB 1AUDA 3PX6A 2A6OA 3LPEA 4E8UA 4G1PA 3CC4S 1SH3A 1RWVB 1Y5NB 2Z8QA 4Q7AA 2C2NA 1RKIA 2QMXA 2VC1A 2CJ9A 2KJWA 3G8TA 4ES1A 3D6FB 3AXKA 3BH7B 2MLYA 4NCGA 3C14A 1T9YA 1VQ5S 1R8CA 2OAUA 2DK2A 1VRTA 1CULB 2K06A 5LXRA 3H5SA 1B0PA 2D9OA 1XMOJ 1RAFB 3KLHB 2QYGA 4M5JA 3MD1A 2XS5A 1LK5A 1NDCA 1UA0A 2UV8G 2VICA 3UD4P 3RRHA 1FWLA 4C8MA 1JLEA 3HFZB 4RBVA 3MDFA 1R6YA 1UETA 3CC7S 2QSFA 4A8KA 4DPTA 1M1HA 1T03B 4ZIWA 2BDPA 5KFXA 1NDKA 2RNEA 4HR2A 1S4FA 5KFPA 1PIEA 3AH6A 3OJUA 1WNEA 5F0UA 4QW8A 3NP5A 1PO6A 4ITSA 4BBYA 2HYIB 1TR0A 1HBOB 4RW4A 4V19J 3KJVB 1S57A 3DLEA 1N8RT 2EFOA 5D3GA 3PY8A 5DDPC 3OTDA 4LJMA 3GR0A 1XIQA 4MIAA 3H40A 1S10A 2VZ9A 2AJ1A 3TOQA 4WZQA 4KHMA 3Q8VA 4QPTA 1HWIA 4Q2LA 3LP2B 2HBZB 1S6PA 2BMBA 3G4SS 2IC3A 4WKRA 3DYAA 2FJVA 1TMMA 2FPHX 4ALZA 2BA9A 5B09A 1ZTWA 2JLFA 1T0TV 2RHSB 4KKOA 1NJXA 1OY8A 1SIWB 2CPDA 2NXJA 3J81U 4HT5A 3R1LA 1TL4A 5HK4A 3TAQA 2LQ9A 2V4RA 5GVQA 3CCMS 4LF4J 4AD6A 2CQPA 1L3VA 2GAGC 5T7LA 1YLXA 3OXLA 4CH0S 1S1VA 1FK9A 1NKBA 1BGXT 3G96A 2RRAA 1L3SA 3BSNA 4PKDB 4MYTA 3QT8A 1TU0B 2MKHA 4J9SA 1WDDA 3D4JA 1HARA 2DNOA 3CJKA 4LBHA 5L38A 2C2KB 2JZ5A 5KG5A 5SZTA 1CSJA 4GO5X 1RYRA 3MEGB 1B0TA 2IRXA 3RTVA 4PWDA 5I42B 3LTOA 2DNGA 2D1CA 3PKMA 5AXKA 3UFCX 2XY6A 3RU0A 4OYAA 1R0BG 2F65A 1HD1A 1LQ9A 2JNJA 3PW5A 4GVLA 1PC5A 4DPUA 5LT5A 5CCMA 1E6VB 5KTQA 1RWOB 2R7OA 3R7SB 1I6JA 2I38A 1R3NA 4J9KA 3M6WA 3RW6A 1FFWB 1WACA 3K58A 1IBCB 3JXOA 4Q43A 2CPHA 5EX0A 1GEHA 4ED6A 4LFCJ 1XQIA 2VASA 3T6JA 1D09B 1KVKA 1H6KX 3OFEA 2DO4A 4LF4F 4PQAA 1TKXB 2QN6B 3MTJA 1MN7A 4DL4A 4DPXA 2I5JB 4EU0A 2R2RA 3KYLA 2HQDA 1TTHB 5DZ6A 3HO1A 2DYAA 3E51A 4FVMA 2UZAA 3LP0A 3K5NA 4DLEA 1N0VC 4QYRA 4QU7A 2HVZA 3UCGA 4M63A 1SL0A 5B0CA 4CM0A 3ISNC 3I0RB 5GADI 4ECRA 4EGLA 3D6TB 3MR2A 4M5GA 2ZEJA 4LFBJ 4LSNA 2XHWA 2GGPA 1S6UA 1V3ZA 5DS7A 3JB9k 5BJRA 3TAMB 1MWZA 2KL8A 1X8DA 4W90B 4DSKA 1RTHA 4QQBA 4DV0J 4PWUA 2V2ZA 3NGTA 5LL6d 3VAHA 1Q78A 4IDKB 5ADZA 1RHQB 1CC7A 1V3RA 3FCWA 1LOUA 2CG4A 1JKHA 4F25A 3DLGB 2OSRA 3U02A 3B78A 2PMZD 4CWBA 3J7AN 4LF5F 4J9QA 1SQFA 3WIVA 3GLJA 4DSFA 2MQPA 5A8KB 1RHJB 2VQFF 2JFDA 5J2PA 5IC6B 4AL5A 1EETA 2UUWA 3CGIA 1Q7YT 3I0SA 3Q2SC 3M8WA 1X4FA 1JB0C 2ADBA 3OL8A 1B7YB 4WTOB 1AA1B 1WHWA 1QAXA 4LR9A 4OI3A 3R6GB 1TZ0A 5B0BA 1XERA 3K0JA 1EIYB 4NA2A 3PO5A 3HD2A 4ECZA 1VYAA 4CLSA 1G3OA 2ZH1A 4ZS6A 4K4VA 2VG7A 1WOPA 3FZBA 2KT2A 4ANCA 1P9YA 3I87A 2M70A 3TARA 4OYOA 2YY3A 1TVRB 4LBPA 1MMNA 1RK8A 4LFBF 3TQ1A 5LM7E 3EXCX 3A12A 2LFVA 5E3CA 4DX8H 4TY8A 5A0YB 2ZVSA 1QY7A 3KHRA 4JV1A 3U1MA 2AX0A 2XSFA 4MT1A 2EFGA 1VQKS 1F0XA 1F5AA 4DV0F 1FRJA 2P6SA 2OELA 1FRHA 1HBNA 4QOTA 5ETSA 4YB7A 3AT1B 4O3NA 5EDWA 2YKNB 2N3LA 3MPYA 2HLTA 2HK3A 3KWMA 3BR9A 3LANA 5KFKA 3V4IB 3ILIA 3S01A 2WOMA 2O67A 3NGDA 2X1AA 4WFBQ 3GYGA 2JX2A 1HI0P 3ZO7A 3T6BA 2ROGA 2RE1A 3QSYB 2ZC4A 1I3OB 4JI6F 4F4KA 1S79A 2D74B 5A8RB 4BS2A 4K5RA 4HTIA 4LSLB 2K3KA 2V68A 1MROA 2IJFA 3R6LB 4DLGA 5CZXA 5EUHA 1VLYA 2J7WA 5KFZA 2YBVA 1DQ8A 3MCSA 3PEHA 4ED3A 4CIOA 3CCRS 4LF6J 1M0SA 3BQ1A 1VHIA 2M2BA 4DX5A 5K5MA 2PI5A 4EI2A 2BKNA 4ELVA 2A18A 4O0IA 5ETKA 2QL5B 1C0TB 4TNOA 2PI4A 1S9EA 2J9DA 1CJUA 4UTGA 3ET6A 5KG4A 1YX2A 4LFAJ 4KC5A 1PC4A 4DR2J 2IA6A 2EI5A 4NE9C 3ULHA 3JAMU 4AUKA 3V6HA 3I9ZA 4C8NA 3V6JA 2ZVIA 2GO8A 3A1YG 1RT2B 5L9XA 2P9GA 2HFNA 4ECYA 4GKKJ 2ACMA 2C42A 1U1OA 2D7SA 4DR7J 1ZZNA 4EBEA 3DOKB 1RUSA 3OTBA 3C15A 1J5OA 2DR9A 1KN6A 1VQ8S 3POTB 1HW9A 1YK9A 2F40A 1S0OA 3SV4A 1JLGB 2AD9A 2WCXA 1M5VC 3R97A 4B9LA 1NSPA 4ID5B 1I94J 3PW4A 3SBMA 4FYYB 3DM2B 4K4XA 1SBRA 1SKUB 3AQPA 1RQ0A 3UCZP 1OSDA 2HNZA 1ZTTA 4J9UE 4CI0B 3HFVA 4KGVB 1U25A 4JI4J 3KK1B 3BR8A 5KFFA 4UOCA 1U1LA 1HPZB 3V6DA 1HNZJ 3BREA 1VR6A 2NYHA 1UP1A 3SYZA 4B3OB 2OHDA 4DG1B 1Y5IB 1IKXA 2M9KA 3FEYB 3TJAA 1MW7A 4PPDA 4Y2CA 3S8SA 4RW8A 2B8PA 2ZD1A 2EK6A 1R8AA 3MEDA 2IIHA 2R2SA 3OVAA 1DQAA 1UW9A 5HBMA 3OVBA 2E5LJ 1URRA 4OX7A 1HNVB 1T02A 3GIKA 2O1PA 1U8WA 4PQUB 3BGLA 4DMZA 3TX0A 1YJ7A 4B3SJ 1PJ5A 2HNDB 2V4QA 1SJ3P 4O3SA 4NLWA 1U1NA 2E9TA 4PPZA 3FNNA 2BX6A 2XULA 4F04B 2QL9B 3W65A 1B4SA 3HSGA 2HHTA 4GKKF 4WCEQ 4DR7F 3MM7B 2J6UA 2KTQA 2V2VA 3T5LA 3P4UB 2CQ2A 1HHSA 6AT1B 5THWA 1S0MA 2VA2A 2BJDA 5AJ3F 3MM8B 4TU8A 3EXYA 3UW1A 5KFBA 3B4DA 1RWPB 4OJGA 4OLPA 3GQCA 4M95A 3PNIA 4HEA9 5H9EJ 1VLOA 4KJIA 1KHVA 1I94F 3AQOA 2AT1B 2OSQA 2N7YA 4B9SA 1WEYA 3QJJA 2M8DB 3D6MB 5IQ6A 5D0GA 3UO0A 3FFIA 1YJRA 3N6NA 1N36J 3NXZA 5LJ5Y 2HQFA 4NLDA 3AAWB 2DHXA 2H4YB 4DV1J 2HWHA 1KC8T 4YB1P 3THPA 4QIEA 1U24A 2LLZA 2F8MA 3QRPA 2DGUA 1FDBA 4DFPA 1CVJA 1RAIB 2HFVA 4MFBA 2E5LF 4NLOA 5C25B 2ZHBA 3T5JA 2VKRA 3CMAS 2BR0A 2JEFA 4I68A 1K0VA 2WONA 2KXFA 4X4VA 2GVDB 4ECXA 1OWXA 2CPXA 3R5AA 5DDRC 4OJ3A 3SCJE 1RCOB 1XR5A 3BSCA 2OPRA 2ZC3A 4B9UA 5LMNJ 1PILA 4MYUA 2LEBA 1GQEA 1M1KT 2Q79A 2RQ4A 1FKOB 2XSJB 3TAPA 4DU8A 2BVZA 1EAYC 4H4KA 3NGSA 2QO3A 4PR6A 2ZITA 5IT4A 2YNGB 4GMKA 2RKIA 1FKPA 3DMJB 5FDLA 2YKAA 1VC5A 2QA4S 2U2FA 2DT9A 1Q8LA 4EFAC 2XLKA 4K4YA 2W24A 3N9UC 4I4BA 3W5ZA 4DV1F 3OR2A 2F5GA 1XNRF 3BPDA 3HJFA 4ICLB 3HHLA 4HH0A 4LF9J 3X3UA 3CJ4A 3R5JB 3NS7B 1F5BA 2YWEA 4JI8F 3BB5A 4FXWA 2CQDA 2N3OA 1OS5A 1KP6A 2WVDA 5B0DA 2AP6A 4ZN1A 4N8NA 3T1HJ 3EGZA 5M2PA 2V2KA 4ILLA 3OL7A 3HK2A 2W4CA 1KEKA 2V2QA 1O51A 2RQKA 3RBEA 5K14A 1CJVA 4Y2KA 1MSWD 4XO0A 1IWGA 3SI8A 2A2DA 5LMNF 4AQYJ 3BV8A 3KK2B 1Q81T 3M8ZA 3HI9A 5KFTA 5J1EB 4OI6A 2YKMB 5CD4H 2B5JA 2E9RX 3RYLA 2OPSB 3B54A 2AGPA 5KFWA 3ZZYA 1WTBA 5D0RA 3DRPA 1FFSB 2IM2A 4XDDA 2N82B 2K7KA 5LXYA 2R8IA 3HFKA 1YJVA 1VIXA 1RT6A 2XYPB 5T14A 2EG1A 3DRXA 3QZ7A 3TA0A 2FVRA 1BQMB 1MN9A 5E3RA 2QFJA 1QUPA 1VFJA 3A3OB 3NKYA 3FCHA 4IQMA 4A8MP 2J8AA 1AXQA 1IQZA 3KTQA 1D9FA 2GV1A 4UOHA 4EBDA 3D67A 4O3PA 1N33J 2EFNA 3R27A 3C14B 4LF9F 2W25A 1U6BA 3UN5A 4FYDA 1S1TA 2QLJB 1RP5A 1VRTB 4LRBA 3ZTOA 4F3MA 5HQ8A 2C2DA 3GSIA 3G2XA 3N6LA 1KLMB 4WF9Q 5BXIA 2WK4A 1K47A 4KPCA 3PZPA 1YVFA 3MEKA 2YNIA 3Q8UA 1JQGA 1VQOS 2QJ3A 2WVBA 1WDTA 3B8HA 2FHOB 3LWLA 4PUOB 1WELA 5HI7A 5IWAF 1IM6A 1J5EF 3M7VA 3FKBA 1IBMJ 4MH8A 2CJXB 4ETZA 1TUVA 1OPIA 4B3TJ 3BN4A 3P96A 5HMZA 4PYAA 2B6AA 3ZZ0A 4ZJQA 5HJXA 3K59A 2GAHC 2FHMA 3ILOA 4TN2A 3CJTA 1EHWA 3K8VA 3D7SB 3KJFB 4NCAA 2W2QP 2MY7A 2GW8A 1S1UB 5ETQA 2B4UA 3D1QA 4C8ZA 4NI2B 4ZN3A 5KOWA 4H4OA 2R7XA 1SV5A 1LXNA 5HL7Q 4NEZA 2KFNA 4EYIB 2CVIA 1BWVA 1AROP 3M8SA 3D28A 5KFNA 1SCJB 1ZYQA 2DTJA 1IN0A 2BRKA 1N48A 2QTWA 4U7CA 2VBZA 3MMBB 3K5PA 2UXDF 3P45B 4PG6A 4N56A 3AA9A 4KKOB 4IH5A 4L76A 5MLCV 1TKTA 5EGYA 1LW2A 3U1NA 4IH6A 5HMXA 2IA0A 1T9TA 2ZM6J 1DTQA 3C6TA 1LWFB 2QA1A 4QCLA 1ZAXA 1HR0J 1EB0A 2C3UA 5D4PA 2HHVA 2HQ3A 5T7LB 1S1XA 1VS3A 1IBMF 3A8KA 1FK9B 4C97A 4I64A 4Q5VA 3F73A 3A4TA 1UAWA 4AFFA 2HMIA 5IFMA 4B3TF 3DI6B 2OP5A 2XCPA 3CJ3A 1B70B 3W5XA 1UJ5A 2VFTA 1T9WA 2JEJA 4IRCA 5KFRA 4X66J 1IJEB 2P8IA 1T05A 3KLIA 3GZ7A 4IKAA 1VRQC 3Q8YA 2LU2A 3LUYA 1J27A 3CD0A 4PWDB 2V9WA 2OUGA 2KVQE 4F2RA 1TP7A 1VDHA 2HSEB 1RLCL 1TL3A 1UJ4A 4LRDA 2I0XA 1YBTA 3MUTP 2AU0A 1GTEA 2E5HA 4L3KA 5F41A 1QTNB 4DJBA 2IMOA 1TK0A 1PGZA 2VBYA 3AY0A 2RB7A 1UEKA 1RHUB 3FQKA 4DQIA 3M9MB 2FLLA 2C1EB 4UQTA 4WWSA 3UR0A 4GVBA 2LEAA 1NRKA 1IKVB 3W63A 1GX5A 1AT1B 2V6AA 2RJZA 1V5IB 5CD4A 2ZM6F 1RXOB 5A8WB 4NOHA 1PCAA 4BCAA 1GNKA 1LNQA 2PT0A 4WFXA 4DUTA 4ECSA 1SJQA 5I4MA 3LP0B 1N56A 4ZP6A 1TELA 3D6HB 2IVYA 4QU6A 2XO7A 3LAMA 1VQSA 5DDQC 1U2CA 1U2FA 1VMBA 3TP2A 4LSNB 5F8HA 4X4UA 1WORA 2IVFB 1YGYA 4X2BA 2BYCA 2NXNA 5BR8J 1JLAB 2UVUA 2C3PA 4P73A 4CM2A 2AYGA 2RDJA 1BXNA 2EFVA 4OJHA 1R89A 3M32B 3G87A 3BZQA 5HQMA 2M7SA 2DIUA 5CCLA 4K4SA 5DZ7A 2IM0A 1QUVA 1KQFB 3IGVA 3BN7A 3KLHA 2V8HA 1ZAWA 1IVZA 2VG6B 4M5LA 4RW9B 4ZLNA 5KG7A 1S72S 3TZXA 1SH0A 4DN0A 2R8KA 1E6YB 2X1BA 4ZJOA 2MQ8A 3OVSA 3GTYX 2MZRA 4YR0A 2KHCA 1K1QA 1VQLS 4YDXA 4A8SA 3EPIA 1NK5A 1DHMA 1N5VA 2FUG9 2ZZMA 1F2HA 4A8WA 3ILJA 1Q5YA 1IUJA 2OKQA 3R2DJ 1V5VA 2MKYA 3PR4A 3M30A 1XR7A 3KJVA 3DDNA 4NRUA 3A3NB 2ZUGA 2ZE2A 4URSA 1ZAVA 3TZWA 1L3KA 1U1RA 3KLVA 3CD5A 3W2VB 4ZLJA 3VV2B 4FZVA 4FXDA 4DFKA 2R7TA 1AFJA 4TY8B 2Z2ZA 1WI8A 2VL1A 2CWKA 5E3AA 4BC9A 2UUTA 4K4TA 2G1HA 4ES2A 4ERDA 1H2TZ 4J37A 9ATCB 2UXBF 4TVAB 5E41A 3ZZTA 2AGQA 1D1UA 2IPOB 1BQNA 2ILYA 2QA2A 2XWYA 2BUNA 2FVQA 2QV6A 4F4WA 2GZOA 3PCOB 2HK2A 2C2OB 4DQSA 2LA6A 2CVEA 2WOMB 3ENQA 2CQHA 4QWBA 1DFDA 3JSRA 3UWTA 1S59A 3GILA 1NO8A 1UEVA 1PSDA 1S7IA 5HROA 1YJNS 1NU4A 1JLFB 4IFYB 5KG6A 3ZZPA 3HD1A 1F1BB 2QT7A 3IG1A 4P10A 1BQXA 5CXTA 2L9WA 1FNOA 2OPQB 1LKZA 1N54B 4I6AA 5KFQA 4I2QB 3KG1A 2K7JA 3CF5Q 1HNXJ 3OSNA 3BQ2A 1IJFB 4EK2A 1GMWD 2HZCA 3H4BA 3SXLA 4Y65A 3D3BJ 3N5BA 4B17A 3TO8A 1B3TA 4ECVA 5I42A 1SI9A 5DG9A 2HURA 2DHGA 4RNOA 2YWFA 2CNKB 4AL7A 1SPBP 4OZNA 2RSQA 3PXGa 4PZVA 5HO4A 3QIPA 2CA9A 1E6VA 4TQRA 3DXSX 4WE1B 1D0EA 1FT8A 3O8WA 4NRTA 3RBXA 1SC3B 1XWLA 5GADU 3RB0A 2VQEF 1YQHA 5JMNA 1A6LA 1SC1B 2JHEA 1F3VA 3KXDA 4JP8A 4C0OC 3I32A 2A3JA 3KJQB 2LP4A 2DITA 4BWJA 1S97A 4DFMA 2MQMA 3CNQP 4JOUA 3BM7A 5LSOA 2OTLS 1WHXA 2OD4A 2ZUAA 1TKXA 2NLWA 3MM9B 2EC0A 1NKCA 1SH2A 2M52A 3PX0A 2P9EA 2WVFA 2DH8A 1HIYA 3MR5A 5K8NA 1WC5A 4CYUB 4DU7A 1YI2S 2AW0A 3I0RA 2CWXA 2Y1RI 5FLXY 2VPZB 3RR8A 3HT3A 2QL7B 2KM8B 5KT7A 2AMCB 3P5BP 2CQCA 3HKZD 4RZRA 1TQLA 1IKXB 2FJBB 1HNXF 3KJNB 4M5NA 1LXJA 4OZ5A 3RB6A 4U95A 1PYOB 3NS5A 1M5HA 2Q6CA 3RAXA 2XG8A 2DBBA 4X4PA 2ZFHA 1FCAA 2XC9A 4ZP8A 1HWJA 2MGZB 1Q8BA 4IRDA 2I1RA 2YNFB 2KI2A 2M8HA 4RU2A 4OI0A 2XZTB 2F4VJ 2CKWA 3OTCA 1QDUB 4HT7A 2RD5C 1U48A 3BH6B 4WFAQ 5G0RB 4M5IA 1MLAA 3LAKA 5IV4A 1VQ9S 2UUCJ 3P3DA 1C1BB 1SKWA 1REVB 2XYGB 4OJ1A 5F9NA 2COLA 3JSBA 3FBFA 4RLEA 4UOFA 2GHPA 5KFHA 2R3VA 4OYXA 4Y34A 3GP9A 3QT6A 3H25A 1NDLA 2IFXA 3W2WB 1EQ0A 4LVOP 5BYSA 3CD6S 4K2XA 4NASA 2HBQB 4Y2AA 1U49A 4YUDA 4OX6A 3O5TB 1S9GA 4FBUA 1RWNB 2XS2A 1U47A 2YX4A 1M5PC 3PV8A 1BMQB 3OL9A 1R43A 2C2MB 2FLOA 4J9MA 8ATCB 3R8YA 4DR5J 4S0MA 5U47A 2KB2A 4WFYA 2VA3A 4C8OA 3FSIA 2CYYA 1N34J 2BZ2A 5A0YA 5MAOA 3CJ8A 3HCXA 5AXMA 4LMZA 3BBCA 4M5MA 3SDEB 1QD1A 4HACA 1VQYA 4WK1A 4N8OA 2BM0A 1L3UA 3FDSA 2UXCJ 2BJ9A 5KG2A 1RTIB 2BW2A 2WONB 4HTJA 3DLHA 2OPPB 4PG5A 2LYVA 2I9SA 2F4VF 1TUWA 2L3MA 2XMMA 4OX9J 3MOZA 4HHHA 1IKWB 2PSZA 5G4DA 2E1MC 1GXTA 2HIQA 1X0FA 1K73T 4G3IA 1RLDA 4X4OA 1Q53A 3HHKA 4CLUA 3D66A 2N7CA 1O8BA 3CCQS 3PW0A 1Y10A 2XI2A 2YQ1A 1BD6A 1I5OB 2FHJD 2BJEA 2C28A 3HF5A 3DKDA 5A8RA 1DY3A 4DR6J 1L5UA 3QQCD 4BWMA 4LSLA 2VU5A 4PG4A 4WKYA 1P6TA 2QGFB 3IC1A 2WB4A 2R2TA 4DPYA 3TUJC 4O4RA 4ZHRB 5FDLB 2KKHA 1XMBA 1ICEB 1C2PA 4IG3B 1S77D 3OD2A 5M2UA 1C0TA 1AZSB 4J9PA 2B3TB 2R8HA 1RT4B 2CJKA 2F8HA 2CDQA 3H2UB 2ZWOA 2R7WA 1N34F 4GC6A 4KY3A 3KUEA 3PRDA 3CCUS 2MDAA 3PYGA 4LRAA 4LF1A 1JJCB 2FZKB 3MZIA 1RT2A 3H4DA 3C19A 4I7FA 1XJWB 5AE1A 2J9EA 4KQZA 1IR1A 2KFYA 4XDCA 4KH0B 3T5HA 1PYSB 1R8BA 2YKQA 2ZH9A 4ED4A 4IRKA 2AEFA 3KHGA 3VAKA 1CJVB 2H51B 2BXJA 2A1BA 3GIMA 1UZDA 4FDFA 1JLGA 3EZOA 2V8PA 3AOCA 3J80Y 1WC6A 1HBUB 3BO3A 4ID5A 4YR3A 3DHXA 2LXFA 2YTCA 1XK8A 1ZA1B 4B9VA 1XNQJ 1UVIA 4WFZA 4PWWA 3AJDA 1UWBA 2XY7A 4DR6F 4Q44A 3KK1A 4DHVA 3K2YA 1HPZA 3VZIA 2GC8A 1A7GE 2D69A 5AT1B 3Q8RB 1UKUA 2H5JB 1WSVA 1CLFA 4DOZA 5SUHA 1RWKB 4OZ1A 3CDEA 3Q8SB 3TVKA 3JSYA 2V94A 2DNQA 1RTJA 3W9JA 1EP4B 1W2BR 1HNVA 2MHNA 4CP5A 1CEZA 4O3RA 1LWCA 3MMCA 4A48A 4PQUA 2R8GA 4PG8A 4O23A 3ENAA 1S1TB 2HLUA 2HS4A 1BWEA 2V34A 1S0NA 4I6WA 2HNYB 5A2QU 2DHHA 5C2GA 1NHUA 2XY5A 1B0VA 4C9DA 3MI7X 2NCKL 4HI2A 3S1TA 1WOSA 2LXUA 1VJWA 4UW2A 1ZBTA 3OFHA 1PAEX 1U7LA 4USVA 2W9CA 3RB4A 3D5MA 2Y0SD 1NDPA 1WTFA 4YS2A 2PA3A 3ZNUA 4OHWA 2KT3A 2P6TA 4I0WA 4A8QA 2KZZA 1RI7A 2YQ0A 1XNQF 3CJ5A 2FHKA 1Q4RA 3HKWA 2HVDA 3DC2A 4KHPJ 1X5OA 1N0UA 5BYQA 3SIPB 2AX1A 4CDIA 4HVZA 5I3UB 2I8EA 4CT9A 1VRUA 3SQGA 2FJDB 3OTOF 1H73A 3MXHP 4NLXA 5F0WA 2HBRB 5CYMB 7AT1B 2Y0BB 1VCTA 1SC6A 4IOBA 1SV5B 5C25A 3S6EA 3DFEA 4DN9A 3S7RA 4DBQA 5KFVA 2GVDA 2RAQA 2FTRA 1V3SA 2BJ7A 4USWA 1FX4A 4J91A 3PW2A 3K89A 1NK6A 2OMLA 1N6QB 1LFWA 2R8JA 3IAS9 2GMJA 3QFHA 4NLPA 1NBEB 5CH7B 4PXDA 1YRXA 2O66A 4JBCA 3IN5A 3DRRA 1NM2A 1RDRA 5IT9Y 2AQ4A 3V81B 2XSJA 2DGOA 1DTQB 2F3JA 3TVZA 3DLLQ 4JV2A 3EMTA 2ZH4A 5H9EK 4M5DB 1TAUA 2YNGA 5E5NA 2N4DA 1WG1A 3R1HA 1S1XB 5I3PA 3SCKE 2PGCA 2CRLA 3L9ZA 2CPZA 3DMJA 3PJWA 2HMIB 2X1FA 3J7YI 4CO0A 3GV8B 4KHPF 1DBDA 1JMTA 2XGQA 4P2XA 3WZ0A 4BHQA 3BO2A 1Z4UA 2MPUA 3PFEA 5DG7A 2EVZA 5B0EA 1F9EB 2C2RA 1T05B 3KLIB 1Q79A 3NCQA 2XYHB 4A8OA 2UUBJ 4ICLA 1HQ2A 1YJUA 3RAQA 1N5QA 5EX3A 2IAJA 3EGNA 1UEUA 3DLJA 1LK7A 3NMRA 3DDIA 1TFWA 4ZVOB 4FKYA 2AV5A 2DY1A 2YX7A 4ZIVA 2AZ1A 3A8IA 2HGNA 2AYBA 4P7TA 2DPJA 3W66A 1NCLA 2ROEA 4MAKA 2DGWA 4QWDA 3UR3C 4P72A 4CO5A 3D9BA 4QZVB 1K9MT 1CQMA 1T11A 1YJ9S 1RWMB 2LQBA 1UMJA 1IWAA 2C3MA 2CXEA 1WF0A 3B82A 4ES3A 5D78A 2DEJA 3EVWA 4B9NA 2FGOA 3LQVA 3CTRA 1YTYA 4AL6A 1Y11A 2YKMA 1N32J 3ICLA 1NK4A 3IR5B 4P52A 1SJFA 2OPSA 3OHBA 1KBRA 4IUFA 1QAYA 2M5YA 3D0HE 4ILMA 1IM4A 3CE8A 4F50A 2IBKA 3CDBA 4F8RA 3HT0A 3AHPA 4U6PA 3M6UA 1DZ5A 2G2OA 1M5KC 3MM5A 3EWGA 3I55S 1FWKA 3IO1A 5H9FJ 1YHQS 1FI4A 1XR6A 2ATCB 3C8YA 3ZZRA 4C3LA 1HW8A 1HQEA 2QE5A 2QC3A 2B4OA 4MJKA 3E3XA 3CDUA 5C24B 2JOQA 2G2YA 1JXLA 1UA1A 1X9WA 1FDDA 5L1LA 2CQBA 4QIVA 2UUBF 4UY85 2CQIA 4ZK7M 2BV3A 4WU3A 1TK5A 2J9DE 4B02A 2E7XA 3LGNA 4TKTA 4HDHA 3MHYA 1FRLA 2CJQA 1KS2A 2VH7A 1KLMA 1NSKL 3VGUA 1QSYA 1WG4A 2QX0A 4X62J 1T3OA 4UY8T 1Y00A 3EX7B 1RTDB 2F9JA 1XMQF 2F8EX 1YKWA 5D4OA 1X4AA 4PUOA 5EWFA 3TUZC 3I96A 3AXMA 2MY8A 1N32F 4FBTA 3UDCA 3EZUA 5D4NA 3SSSA 3JQKA 1HBMB 2G0IA 5IC4B 3CCSS 1O0PA 4DR4J 5L1KA 3PVXA 3M30B 4YOEA 2QA4G 3AB2B 2OIHA 2ZE2B 5D8HB 2PIIA 3Q8QB 2Z0GA 1HNIA 3V2UC 4RKUC 5IV3A 2R7RA 3HVWA 3M9NB 1S1UA 4ZLLA 4EO6A 4NI2A 2R42A 4H4KC 4WXWA 4QWCA 1OMSA 3CDWA 2E1RA 2Z30B 2HFZA 4Y0FA 4JI2F 3CIMA 3H98A 1Q5VA 1P9QC 1JJHA 4KPYA 4I67A 1BQNB 2BJ3A 2V67A 2W9BB 4K4ZA 3MMBA 2W2PP 1BY9A 2WW8A 1VBXA 3VGTA 1A9NB 2ASJA 1X5PA 3CO9A 2HHWA 3TWZA 4X62F 3GG1A 4FKXA 4DEZA 3HHLC 4K7QA 1LWFA 3LGHA 5KT2A 1KKHA 4P9SA 3ZC4A 3GSDA 2RS8A 1CJKA 1OQ3A 2ATLA 1FJ7A 5HROB 5DDOC 2OI2A 3UPFA 2G0CA 2CPFA 3IG1B 3DI6A 2DNYA 3HSDA 2CNLB 4FS1A 4DR4F 3GWCA 3N0VA 4ZPVR 1FJCA 1HLWA 8RUCA 3UCUP 4QIFA 5HSPA 3L4BC 1R27B 3M2VA 3BGFA 1TL7B 4NPOA 3KG0A 4OV1A 2VIHA 4ZCLA 3SQOP 4NL5A 4NMXA 3ZTRA 4OYBA 3MPWA 2JSXA 3NCRA 4ZP9A 4IR9A 3FBCA 2MMYA 2VFVA 2HVIA 2O01C 3RJMB 3QIPB 3QGGA 2BQ3A 3M8RA 4KRWA 4LF5J 1U09A 1BE4A 1Y3KA 1QE1B 4ZCKA 3ADAC 2VQFJ 2DNLA 3SZ2A 3MUVP 1VQ4S 4USJC 1UPMB 2NS1B 3W1YC 4RX6A 4JI3J 1WC4A 3CCLS 1IKVA 2KDOA 3FCVA 2Z2MA 3O3LA 3LP1B 1HHTP 2A6MA 5A8WA 3IP0A 1FNXH 1T94A 1CS4B 3CCJS 2D3OR 4NLVA 1X4GA 1SJ4P 2L9DA 1SC4B 3VGVA 4FP9A 1RT1B 2AJFE 1FD2A 3H5UA 3CCTA 3MOJB 3NOGA 1P1TA 1FESA 4ZVQB 1JWWA 1S99A 4ZLPA 2BRLA 2KYXA 4J7CA 1GT8A 2KG0A 5JXSA 4XK8C 3IFEA 1ELOA 4YQWA 1JLAA 3M2UB 4L73A 3DOMB 3K5OA 5B7WA 3CJSA 1V9OA 2NSBA 5IQQA 1MMLA 1CQNA 3KOAA 2NUHA 1ZS6A 3M32A 4F4ZA 4YN3B 5KFSA 3VQSA 1X5SA 4WBFA 3R5DA 4OHYA 2DPIA 2BE2B 1IKYB 3GIJA 1UFLA 2VG6A 4RW9A 1C4AA 4KGXB 1N5SA 1X60A 1N52B 4YP3A 5ETLA 4DX6A 3UD5A 3HULA 3KHLA 1E6YA 2QLXA 3Q23A 2ZH5A 5HATA 2OJ3A 3JSMB 2OMOA 2WRMA 1LW0B 4JI6J 1S6QB 1OY6A 4JI3F 2VFSA 3LO3A 1X0PA 1UVLA 3HJVA 4MMOA 3EYZA 1VI7A 4C8LA 1HFEL 3QO9A 2ZH3A 4WP3A 4U9RA 2IYIA 5CAAA 3BGRB 3V5RA 2EC2A 4KBIA 4BC7A 1B7FA 1S9GB 4NXMF 2DNPA 4QWEA 2QLBB 4USIA 1H74A 2LQ5A 5F3ZA 3HX9A 2DR6A 2DNKA 3W2VA 1G1XA 2MTLA 2VD3A 2C2EA 3PEJA 2GIRA 4G65A 4FYXB 4LR8A 3P49B 4OX8A 1NNDA 4OYMA 2WBMA 3GFXA 3UN3A 5DGAA 3WDOA 4C8KA 2HIYA 3K5MA 2WVEA 4CTAA 2RMLA 1TAQA 3PR5B 1RAHB 3TZZA 2GFFA 3M05A 4GRSA 3PM9A 4HACB 4ZPCA 2OEJA 1ULRA 4OQJA 4IQXA 3SCIE 5C42B 3RGIA 1EZZB 4X4TA 4ECWA 3H5YA 2FJXA 3GPAA 3OPKA 4Y3CA 3I56S 4KFBB 3WIUA 3KLFA 2FVCA 4KAIA 1AUSL 2CPJA 1KQGB 4ZP7A 4J9RA 2BJ8A 2BKOA 3SMZA 2HRTA 1CC8A 4LVNP 2RU9A 4YFUA 3EVOA 3UN2A 1NEEA 2MZTA 3NG8A 2NPIA 3KNAA 3FBEA 4F02A 1XTZA 1JLFA 3PKYA 2EBGA 4IFYA 1UW4A 1U0HB 1VHFA 3DXBA 4FS2A 1SXLA 1NB7A 4CLTA 2MKSA
chains in the Genus database with same CATH topology
1T03B 4ES2A 1SJ1A 4ERDA 2BDPA 1H2TZ 4J37A 3ETOA 3L7OA 5KFXA 5HLFA 1JNZB 2UXBF 7FDRA 4Q0BA 1F9FA 2RNEA 5L1JA 5E41A 1S4FA 2V5HG 2YQ3A 3SEOA 3HHLD 2OPQA 3ZZTA 3CEDA 5KFPA 3PIPQ 2AGQA 1D1UA 2YH1A 3AH6A 3OJUA 3HHEA 1BQNA 4I2QA 4NLUA 3O44A 3DN9A 2ILYA 4HLBA 1WNEA 2RRNA 3H5XA 5F0UA 4NCGB 3NP5A 4QW8A 1S0VA 4R0JA 1PO6A 3D1OA 3HLUA 4ITSA 2QA2A 4BBYA 2NXUA 4MIWA 4C3KA 4X4QA 3R5BA 2XWYA 3KK3B 2BUNA 2FVQA 2QV6A 1NZAA 4F4WA 4ZMMA 1WEZA 2V8DA 2J0WA 4QPXA 2W8LA 2HYIB 1TR0A 1HBOB 3K5LA 3Q8PB 4RW4A 4V19J 5B0GA 2E5JA 3KJVB 2HHXA 3T1HF 3DLEA 1N8RT 4DQSA 1KD1T 2EFOA 4OL8A 1HYSA 1NH8A 5D3GA 2LA6A 3OFFA 2CVEA 2RT3A 3PY8A 5DDPC 3E01A 1OQ6A 2WOMB 3OTDA 4LJMA 3ENQA 1FEHA 2ZBIA 3GR0A 2CQHA 1U6FA 4QWBA 4MIAA 1DFDA 3JSRA 3BSAA 3UWTA 3H40A 1S10A 1KNZA 3MFIA 5E3QA 1GH8A 3VR1A 3GILA 2PO4A 3CCWA 2VZ9A 3OV7A 2Y1JA 3FMBA 2AJ1A 1NO8A 1UEVA 3N28A 3TOQA 1QTMA 1PSDA 4YDDB 3RBDA 5HROA 2JH3A 2ZZNA 4WZQA 2DGSA 4KHMA 5E7OB 4QW9A 4WE1A 1YJNS 4QPTA 4RW6B 2HVHA 1NU4A 2ASLA 1JLFB 1JLEB 1FTCA 3O2IA 2RILA 4IFYB 3BJYA 1D3WA 5KG6A 4DWIA 2VG5A 3ZZPA 1HWIA 4AQYF 4I1TA 4I7FB 4Q2LA 2QT7A 5J2QA 1IXKA 2C3OA 2ZNZA 3IG1A 5E2QA 1NKEA 3LP2B 1BQXA 4ZKAA 3HDSA 5HLFB 4NXNF 2SXLA 1UVJA 4CT8A 5CXTA 1S6PA 2L9WA 3I5BA 4Q0BB 1FNOA 3G4SS 2OPQB 1LKZA 2KZMA 1RA6A 1N54B 2IC3A 4WKRA 3DYAA 4I6AA 3OXGA 1FHTA 5KFQA 4I2QB 1D8YA 2DNNA 4Y6IA 4HYKA 3BSOA 4W92B 1BLUA 3QZ8A 2FJVA 3KG1A 2FPHX 2K7JA 4QIGA 3CF5Q 4NX9A 3OSNA 2RH3A 3BQ2A 1IJFB 5JJBA 4O4GB 4ALZA 4WXOA 2HWTA 2BA9A 5B09A 1ZTWA 2JLFA 1AFIA 2HZCA 3H4BA 3SXLA 4KKOA 4Y65A 3N5BA 4B17A 1NJXA 4F3OA 3TO8A 3D1HA 1SIWB 4ECVA 5F8GA 5I42A 4HDGA 2CPDA 4RW4B 4AXIA 1SI9A 4HT5A 5DG9A 3R1LA 3DLEB 2HWIA 2EBEA 3KMQA 3GG0A 2DHGA 1TL4A 3MM9A 3QIDA 4OFZA 4RNOA 2KXNB 3KLEA 5D3GB 1HYSB 4AYBD 3IGNA 3TAQA 2ZHAA 2LQ9A 2GNKA 2YWFA 2V4RA 4AL7A 1DURA 4DR1F 1HNWF 1FXDA 1VIOA 2YKPA 1RT3A 5CYQA 5GVQA 5DRKA 3CCMS 4E98A 4OZNA 2CQPA 4NZ7A 1L3VA 2RSQA 3PXGa 1DQ9A 1UWBB 5F8NA 4RWXA 3PDNA 5HO4A 3QIPA 1E6VA 4TQRA 2JDJA 2VOOA 5T7LA 3DXSX 3TA1A 4URGA 2XNRA 2RF2B 1KR4A 4WE1B 1D0EA 1FT8A 1Q1KA 2GMHA 3ZZZA 5B08A 1X9MA 3O8WA 2J7KA 3OXLA 4NRTA 4CH0S 4BDPA 1XWLA 1S1VA 3TW0A 5GADU 1FXRA 5IXUA 4EZ6A 1FK9A 2V0NA 1NKBA 1BGXT 4RNNA 3VAFA 5DQGA 3RB0A 3G96A 2RRAA 2VQEF 1N33F 1YQHA 1L3SA 1A6LA 4O44A 3BSNA 3OR1A 4PKDB 2BOPA 1NK9A 5J2QB 2DHAA 2JHEA 3CB4A 5B0FA 4MYTA 1C1CB 4C0OC 3IBWA 1S6PB 2UP1A 2DCUB 3J7A1 3N5FA 3I32A 3MWBA 2MKHA 2A3JA 2LMIA 4J9SA 2IC3B 3DYAB 1HARA 2DITA 2DNOA 3KFWX 2VPWB 3CJKA 2M3DA 5L38A 2VONA 4BWJA 1S97A 2JZ5A 5KG5A 5SZTA 4DFMA 4TU7A 1YITS 2MQMA 1VK3A 1RTJB 2WSEC 4X84A 4JOUA 2BABA 1CSJA 4GO5X 3CUNA 3BM7A 3MEGB 1B0TA 3I5AA 3ISND 5LSOA 1RYRA 2OTLS 5F8JA 1HQUB 1KFSA 2IRXA 4F4YA 1WHXA 3RTVA 2OD4A 4PWDA 2MGZA 5I42B 1I1GA 3M8PA 1LWCB 1BC6A 2GQ2A 4DL2A 1TKXA 2APOA 2M4MA 3MMCB 2DNGA 2YNFA 2G4BA 2NLWA 3P6YC 3MM9B 3KLEB 3LF0A 2EC0A 1NKCA 4CQ1A 2D1CA 3PKMA 1SH2A 1WWHA 5AXKA 3UFCX 2M52A 5F3TA 1NB7A 4JI0F 4PXEA 2XY6A 3RU0A 2XCAA 4QJVA 3PX0A 5CYQB 3EZ5A 5KFIA 2Q6BA 1X4HA 2P9EA 2D9PA 2DH8A 1X4EA 1HD1A 2HHSA 3CJ0A 1LQ9A 4Q8EA 2RU3A 3MR5A 3PW5A 1R0AA 5K8NA 1PC5A 1KOOA 4NMLA 5LT5A 5CCMA 5G0RA 1E6VB 1YRUA 4YEAA 1MU2A 3MR3A 5KTQA 1YI2S 2AW0A 2HRYA 3I0RA 3HVTB 2ZBCA 3UDLA 2AF6A 2KRBA 2Y1RI 5CQGA 1HMVA 5FLXY 2VPZB 1S1VB 1C1BA 3RR8A 3OLBA 1REVA 2H5EA 3HT3A 2R7OA 2LECA 2KM8B 2PFFB 2K1RB 5KT7A 1I6JA 2I38A 3U7JA 2NYIA 5DETA 3CCVS 4O44B 2CQCA 1HL6A 2KO1A 3HKZD 3UNGC 1R3NA 2XLIA 4RZRA 3DLBA 4J9KA 1TQLA 1IKXB 3NS6A 4NA1A 2FJBB 3CCES 5J1NA 1HNXF 3M6WA 3RW6A 1LXJA 4QR1A 4JV0A 4OZ5A 3MEEA 3BO4A 3RB6A 2NREA 3H59A 3W2WA 3CJKB 4FPRA 1WACA 3NS5A 1M5HA 2Q6CA 3N6MA 4K59A 3UE2A 2W9CB 3K58A 2MB0B 3RAXA 3WC2A 4Q43A 1S1WA 2CPHA 5KT6A 5EX0A 4NYOA 4ED6A 2KVIA 5L1IA 2XG8A 2VASA 3T6JA 1U2RA 5ITHA 2Q1LA 2DBBA 3H2VE 2ZFHA 2UV8A 4ID8A 4X4PA 1DAXA 1FCAA 4ZP8A 4QWAA 2V4JA 2XC9A 2ALZA 1HWJA 5KAKA 2MGZB 4WZMA 3M8PB 1H6KX 3H20A 2DO4A 3OFEA 4LF4F 4PQAA 1TKXB 1Q8BA 3MTJA 4IRDA 2I1RA 2YNFB 3F41A 2XMJA 1KLNA 2FY1A 1RA7A 3FSXA 2KI2A 4DL4A 2M8HA 5JVHQ 2I5JB 4EU0A 4RU2A 2R2RA 3KYLA 5KFUA 3CMES 3HO1A 4OI0A 3E51A 4F4XA 4FVMA 3IRXA 4AXJA 2UZAA 1H2VZ 3CJ2A 1FKAF 4B9MA 2CKWA 3OTCA 3LP0A 4HT7A 3K5NA 2RD5C 1U48A 2BM1A 5KFAA 4DLEA 1R0AB 1N0VC 1SIZA 6FDRA 4QYRA 4QU7A 1VRUB 2HVZA 3SQGB 3UCGA 4WFAQ 4M63A 4C4WA 3NWGA 5G0RB 1KONA 1SL0A 4K5SA 5B0CA 4IH7A 1MU2B 3LAKA 4KTQA 3ISNC 4A8XA 4D3HA 1VQ9S 3I0RB 2CQ4A 5GADI 2GA7A 4ECRA 5JUMA 2DVIA 3P3DA 2CPEA 1M90T 1HMVB 5FIIA 4EGLA 1C1BB 4DDFA 1SKWA 2ZJPQ 1REVB 2CZ4A 3MR2A 1UVNA 1YG0A 3TANA 4LSNA 2XHWA 4OJ1A 4DL6A 3RZAA 2B9XA 5IT0A 1RT7A 5F9NA 2COLA 3JSBA 3D2WA 4RLEA 2GGPA 1SKRA 2ABYA 5KFHA 2GHPA 1S6UA 1V3ZA 2VPXB 4L3NA 5DS7A 1IBKF 2B7CB 3KKFA 2LA4A 1JLBA 3NGKA 3KG4A 1SUQA 4Y34A 3JB9k 3SDEA 5BJRA 3H25A 3MEEB 2IFXA 3TAMB 3W2WB 1MWZA 1X8DA 4W90B 1K1SA 4DSKA 1S1WB 4KE5A 4LVOP 1RTHA 4QQBA 5BYSA 3DRSB 1RTIA 4PWUA 1F2GA 5LL6d 3CD6S 3IXQA 4K2XA 1VBZA 2OPPA 4Y2AA 1U49A 2FDNA 3J7Z5 4YUDA 3VAHA 2V4JB 4JUZA 1SL2A 1R31A 4OX6A 1Q78A 4IDKB 3TUIC 3O5TB 3IR7B 1S9GA 3SFUA 5ADZA 1CC7A 4FBUA 1V3RA 1U47A 2XS2A 1R7IA 1U8SA 2YX4A 1M5PC 3GFZA 1LOUA 4YY3F 3PV8A 2CG4A 1JKHA 3ENWA 1IKWA 1HR0F 1KVIA 3RR7A 3OL9A 1R43A 4F25A 4DUYF 3DLGB 5K8MA 2FLOA 4J9MA 4ED1A 2OSRA 3U02A 3B78A 4WK3A 2PMZD 4LF5F 5U47A 4J9QA 1K0TA 2KB2A 1WG5A 4WFYA 2VA3A 3CULA 4NLYA 4C8OA 2HPUA 3FSIA 4DSFA 1HWLA 2MQPA 3DRRB 4KIAA 5A8KB 3MF5A 2GMLA 5E0OA 4ECUA 2VQFF 1JLCA 1JLQA 3IWXA 5D77A 2CIMA 2CYYA 3ZZOA 3KHHA 3DOLA 2BZ2A 2JFDA 2L9NA 4DQRA 5J2PA 4XIUA 1QVGR 4AL5A 1EETA 1Q7LB 2UUWA 3CGIA 3WX4A 4Z2XA 5A0YA 2HQIA 3GYXB 1Q7YT 3I0SA 6FD1A 3J7ZT 3Q2SC 1X4FA 5MAOA 2GGPB 4RUCA 5J2MA 1JB0C 5AXMA 1JJ2R 4M94A 4LMZA 4X66F 2ADBA 1N88A 3OL8A 3SDEB 2MQOA 4ZVEA 3QAEA 3W3SA 4ZPDA 2KM8C 1J2VA 3H2LA 1X4BA 1WHWA 5CA5A 1LV5A 3NRBA 2EFPA 1H38A 1QAXA 1VQYA 4ZHRA 3U27A 2DJWA 2DNRA 4WK1A 1ZM4A 2FB0A 4N8OA 2BM0A 2Q43A 1H98A 4OI3A 4C2MA 1TZ0A 5B0BA 1XERA 1RTHB 3K0JA 3FDSA 4NA2A 3PO5A 4F67A 3IA0A 4ECZA 2F7VA 5KG2A 3MM6A 3IAM9 4R25A 3T19A 5DGBA 1RTIB 4IG3A 2BW2A 2WONB 3I5CA 4HTJA 4ELTA 3DLHA 2OPPB 4PG5A 1GXUA 2LYVA 1G3OA 2LKZA 2FLPA 2ZH1A 4DV4F 4ZS6A 4K4VA 1APSA 2I9SA 2F4VF 2VG7A 1QSSA 4I69A 2L3MA 5HMYA 2RQMA 2XMMA 2R2UA 4MK7A 5E33A 4IO9Q 3FZBA 3MOZA 3C66A 2KT2A 4M1KA 1RT4A 3I87A 1JKHB 1IKWB 2M70A 2PSZA 5G4DA 2E1MC 3THVA 3TARA 3PACA 4EZ9A 1GXTA 3M8QA 1NK8A 3SSRA 2HIQA 2YY3A 2NSCA 3VAJA 1X0FA 1TVRB 1K73T 4G3IA 2JLEA 4Q2MA 1MMNA 2FC8A 1U1KA 4X4OA 1DTTA 2P5VA 3QJPA 1Q53A 1KHWA 3E8OA 3HHKA 3C6UA 1RK8A 2C3YA 2N7CA 1O8BA 2IAJB 4LFBF 3RW7A 3VAMA 3CCQS 4C11A 2RS2A 2ZOMA 3TQ1A 3PW0A 3EXCX 2XI2A 2BANA 1BD6A 4IG0A 2FHJD 2BJEA 4RU9A 1QLNA 3DOLB 5J2PB 2C28A 1QAIA 2ZHOA 1EETB 3HF5A 3HZGA 5E3CA 5A8RA 1RT5A 4DX8H 4TY8A 5A0YB 4A8FA 2ZVSA 3I0SB 1QY7A 1H3DA 5BYRA 2EK1A 1H7XA 3KHRA 1L5UA 4JV1A 4BWMA 3U1MA 2AX0A 2XSFA 4LSLA 2ASDA 1N4LA 4PG4A 1T03A 5KFOA 4WKYA 2NR0A 1P6TA 2IHR1 4NLRA 2PEHA 4Z37A 2VODA 3IC1A 2R2TA 2E5IA 2WB4A 2EFGA 3ZFVA 1Z1ZA 1VQKS 1F0XA 1F5AA 4DV0F 4CCHA 3TUJC 1FRJA 2MSTA 2DRAA 1ZM2A 2P6SA 4O4RA 4ZHRB 1FRHA 1WD6A 3I4HX 3G6XA 1HBNA 5KG1A 2FD2A 1U1QA 4QOTA 2DNMA 2Z2LA 4YB7A 5FDLB 3L3CA 2LEPA 2HHPA 5AE2A 2LQJA 2KKHA 1XMBA 1C2PA 4O3NA 1FTRA 2MQNA 4IG3B 2PA8D 5KFJA 1S77D 5EDWA 2IVMA 3BF4A 2MZQA 2FGCA 3M1VA 1KVJA 5M2UA 2YKNB 2N3LA 2VG7B 1NJWA 1HBOA 3GMGA 4ZCIA 1C0TA 4JI1F 3MPYA 2HLTA 3FRYA 3KWMA 1HBUA 4RNMA 2DGQA 3BR9A 3LANA 5KFKA 4J9PA 2B3TB 2IRYA 2YNHA 2KT5A 2R8HA 1RT4B 3V4IB 2R7UA 3S01A 3IR6B 2CJKA 2F8HA 2CDQA 3GV7B 2WOMA 1TFYA 2O67A 3NGDA 2X1AA 2DIVA 3H2UB 4WFBQ 2KH9A 3C46A 4V19X 2R7SA 2JX2A 2ASYA 1HI0P 2R7WA 1N34F 3QWUA 4GC6A 1UVKA 4YB5A 3T6BA 4F3QA 2ROGA 2RE1A 3C6UB 5LMUF 3U1LA 3PRDA 2AGOA 3CCUS 2MDAA 2CFXA 1NAQA 3CT9A 4NLQA 3IWNC 2ZC4A 4C11B 1ZZFA 4JI6F 1FRMA 2BANB 4F4KA 3ONQA 1S79A 2D74B 3MZIA 5A8RB 4BS2A 1RT5B 1RT2A 3H4DA 5BR8F 4H54A 4K5RA 3TI0A 3MM5B 4I7FA 4NZ6A 4HTIA 4LSLB 5AE1A 2K3KA 2J9EA 4OZJA 4DS5A 4KQZA 4HHJA 2ROPA 1MROA 2IJFA 3OQ2A 3LP2A 2KFYA