1KR4A

Structure genomics, protein tm1056, cuta
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
ALYFMGHMILVYSTFPNEEKALEIGRKLLEKRLIACFNAFEIRSGYWWKGEIVQDKEWAAIFKTTEEKEKELYEELRKLHPYETPAIFTLKVENILTEYMNWLRESVLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Protein TM1056, cutA
publication title X-ray crystal structure of CutA from Thermotoga maritima at 1.4 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 25
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kr4A00
4CO2A 4WK3A 1OSCA 4C3KA 3AA8A 3LF0A 2J9DE 1Q1KA 2NUHA 4OZNA 3CE8A 1NAQA 1UKUA 2XULA 4Y6IA 5DS7A 1V3SA 3AHPA 4RWWA 4C3MA 3O8WA 4CNZA 4WK1A 2XG8A 1XK8A 2O67A 4R25A 4D3GA 4IYQA 1NZAA 2GW8A 2RD5C 1QY7A 4RX6A 1V3RA 2GNKA 3TA2A 3TA0A 4CO4A 3M05A 2J9CA 3X3UA 1NH7A 4USHA 2JJ4D 1VFJA 1NH8A 4CNYA 3OPKA 3O5TB 1UL3A 2ZFHA 3GSDA 2PIIA 4C3LA 4YB6A 5L9NA 5D4LA 3L7PA 1KR4A 5DRKA 4USJC 3MHYA 3AH6A 1J2VA 4CO0A 2VD3A 1GNKA 4ZK7M 4OZLA 2NS1B 2CZ4A 4USIA 3TA1A 4YB7A 1V6HA 3AA9A 4NYPA 2J9EA 1PILA 2Z0GA 3HLUA 2EG1A 2GX8A 1H3DA 4D3HA 1V9OA 1VHFA 1UFLA 3NCPA 1UMJA 4CO3A 4OZJA 4NYOA 2XBPA 3BZQA 2XZWA 4RLEA 1HWUA 2V5HG 5D4PA 1O5JA 2O66A 2NUUG 4Y65A 2EG2A 4YB5A 1O51A 4CO5A 4CO1A 4E98A 4RWXA 3T9ZA 4AFFA 2J9DA 3NCRA 1P1LA 3N5BA 3DFEA 2DCLA 3NCQA 5D4NA 5D4OA 2E66A 2ZOMA
chains in the Genus database with same CATH superfamily
1WKJA 2J7WA 3S01A 3MR6A 4UF4A 5DJBA 1J5EJ 4DQQA 4QQBA 4NL5A 4B3TF 8ATCB 1X5SA 2ZUGA 3OL8A 4O3PA 4DX8H 2AQ4A 1EIYB 5HP1B 2RMLA 2HFZA 1XMQF 2XGQA 1KC8T 3ISND 4NA1A 2ZOGA 4LSNB 1RA6A 2MZSA 3C16A 2E9ZA 1IKVB 2HGNA 1N0UA 5L9XA 3W5ZA 3OR1A 1HPZA 5KG5A 1VBYA 4KBIA 2AWZA 1GAOA 2AJ2A 4HHJA 2IRUA 1AYEA 4I7FA 1L3SA 4KYZA 2RHSB 4X66F 2V68A 5HROA 4MFBA 3E8OA 4OI3A 4EO8A 2QE5A 1S1WA 4LSLB 2CQ2A 5AE2A 2PI5A 2HMIA 2OD4A 5K8MA 2MMYA 2CQPA 1VQ6S 1S57A 4OX8A 1Y10A 1N34F 1VRTB 2OD6A 4AQYJ 5BYSA 2KU7A 3JSYA 3HFZB 1ZTTA 5BXIA 3WDOA 4H4KC 2MGZA 1AB8A 1ZM9A 4KKOA 2ZITA 4K4SA 1PC5A 4FP9A 1FXLA 3M05A 2AX0A 3FCWA 3I9ZA 3CJ2A 3WBZA 3CJKB 3NLCA 2VG5A 1RHMB 4ZVOB 2K8GA 1TKZA 1ZETA 3EVMA 4KR0B 3TUIC 3SQGB 5B0EA 2AKWB 4C97A 1RWUA 5IXUA 4LF2A 5M2RA 2JSXA 1TKXA 1T02A 3MUTP 3CB4A 3ELHA 2J7KA 2A10A 1I94J 1FERA 3RAXA 5BYQA 1QSLA 2M2BA 2R7TA 4JI4J 2GJFA 1T9UA 3Q2SC 5A2QY 3QZ7A 3PFEA 4QU7A 4G1QA 3OFHA 2VBYA 4JBCA 4BDPA 5DG8A 2C2KB 2C3MA 3A8JA 2K3IA 2P9GA 4ECTA 1JKHA 3OVSA 3H59A 1U2RA 3I0RA 8RUCA 3E01B 2HSEB 5IT9Y 4FS2A 2VA3A 4ZCMA 1S4EA 1WI8A 4ZPDA 4DL4A 3BH6B 1I5OB 1H74A 3R5JB 4YR3A 2XQCA 1HWJA 3OSPA 1V3RA 4J9MA 4EEYA 3D6FB 3DI6A 1VQLS 3GIMA 1FVQA 3R27A 4QPTA 1B7FA 2AYGA 4KC5A 2EBEA 4NLYA 4CYUB 4LRDA 2JVOA 1YJ9S 5C7PA 4F4KA 5A6WA 3RJMB 4NLPA 4TXSA 5DDOC 1X9SA 4DUYJ 2BXJA 4X4TA 1H73A 1IKWA 2ZD1B 3P4UB 2M70A 5KT7A 2BM0A 4YB5A 3W66A 2MKHA 2J76E 3VAHA 3KLIB 3OTDA 3HZGA 3PW2A 4F4ZA 2RU9A 4DR3J 3T1YJ 3CWJA 5A2QU 3O3LA 1S9GB 4EMDA 4PG7A 4B02A 4C6AA 3QGPA 4NASA 3DMJB 3A12A 2F5GA 2BJ3A 3M8QA 4RR5A 2YQ3A 4GKJJ 2COLA 4WE1B 5IT9U 2FHKA 2XS2A 3SI8A 2VPWB 4OYPA 3DRRB 4ETZA 4U6PA 1UETA 2ZJPQ 4IQXA 4DR5J 3SCIE 3HCXA 1RP5A 2VOOA 1VISA 2Z2MA 1NSQA 1T03A 4CM0A 1R8HA 2YNIB 3I0SA 2DR5A 3SEOA 4DCPB 1UZHA 4ITSA 2R7OA 2QT7A 3GR1A 1NMEB 2FHJD 5KFWA 1PG5B 5BYRA 5F9NA 4ZOSA 2CQHA 2RIJA 3T5LA 3TUZC 2E5HA 4J37A 3TZXA 1VBKA 1VBZA 2CG4A 2H1YA 2OFGX 3SBMA 3TWZA 4L73A 2AV5A 3MM9B 4LVNP 4C2MA 4OLOA 4O3RA 4AL6A 3ZNJ1 1XWLA 3CJ4A 1KS2A 4Y6IA 4Z37A 4WJBA 2CJQA 2HKEA 1SBRA 4DV1F 1QY7A 4KGMA 3Q24A 3PW4A 4IFYB 4FS1A 4DL2A 2AJ1A 2A1BA 1VRUB 2W9CA 1K1QA 4AXIA 1CPZA 2YKAA 4DFMA 1N8RT 2DKOB 2CJ9A 3D66A 1J2VA 2AW0A 2R7XA 5IC4B 2D3ZA 3FQLA 1N32J 1YJNS 1KTVA 3TQEA 3NOGA 1Z2LA 2VQEF 2AP6A 2EPIA 4ZP9A 5T7LB 3FRYA 1QAXA 4CLLA 3R1HA 2XBPA 1HL6A 2ZVIA 1TV6B 2ASLA 3NXZA 2RRBA 2VC0A 3V6KA 1IBKJ 4O44A 2XSJB 2I5JA 2LU1A 3MM7B 4ZPBA 5KFBA 2MKKA 2P6TA 4TLQA 1XNRF 2CPFA 3TNVA 3V6DA 3QIPB 5F8NA 3NWGA 5THWA 5D0HA 2CQDA 1B4SA 3ZO7A 1WELA 4MAKA 3D9BA 4GKKF 1YBTA 2JOQA 1TL4A 1QM9A 2CQIA 4UOFA 1WOOA 4LF7F 3CUNA 5D3GB 5GVQA 3CMAS 5DGBA 2H54B 3DOMB 1AZSA 2XMAA 1T95A 1N56A 4LVOP 3IRXB 4RU9A 1S0OA 2KG0A 1E6VA 1T11A 5I3QA 4DG1A 3BGRB 1RDRA 4X65F 3I9V9 4NE9C 4DJBA 3RR8A 1JNZB 3EJMA 1S6UA 4AXJA 2NPIA 4IOBA 2FHOB 4BWMA 2ATLA 1NHUA 1WTBA 2BEFA 4KHPF 5B0BA 5DGAA 1CSJA 2KI2A 1AXQA 2QV6A 3O6QA 2FZCB 3GG1A 2V9KA 1VLYA 1QAIA 3QSYB 5CH7B 2AJQA 2BANA 4B3OA 4EI2A 4EWTA 1TL3A 4M5NA 2VBXA 3PHTA 3IWXA 3DFEA 1VQ4S 2KB2A 4ED7A 4DR1J 2KXFA 4FF3A 2AEMA 3D0GE 3CD5A 3UFCX 3Q2TC 4QWBA 1TUWA 4PPZA 2CAJA 4NYZA 2RNEA 3QJLA 3P49B 4ED0A 3H5UA 4DUTA 4PXEA 3NG8A 3ZZRA 2MB0B 1U8SA 2M52A 2YKPA 3W5YA 1D3WA 1ROFA 4CLTA 4ZPTR 2A2DA 1S0VA 4ZN3A 3GCWP 2IVFB 2VF3A 4RNNA 5DG7A 2IC3B 2ALYB 1AFIA 1QAYA 3Q23A 2FHJA 2HVIA 2E29A 1RXOB 3R5DA 4KY3A 5JMNA 1AUDA 2JVRA 2UXCF 1LFPA 5DO2A 2HQ3A 2CQBA 1NSPA 3ISNC 4YB1P 1U02A 4BWJA 2XMKA 4ECWA 1HNIA 1R7IA 1U0SA 2DTJA 2VA2A 5CA5A 5CYMB 1TL7A 3MM8A 1Y3KA 3HHEA 1FRJA 1R8AA 1IR2A 3V2UC 1FJGJ 3BH7B 2CJBA 2HYIB 5DETA 4URGA 1EETB 2DIVA 3VAGA 5ETNA 3JSMA 4HEA9 2XTJP 3QRQA 3M8WA 1W25A 2AYMA 2D3UA 4M63A 4PEOA 4LFBJ 1V3SA 5KT3A 3PYDA 4IR9A 4NCAA 4B3TJ 3L9ZA 1AA1B 3MURP 4RBVA 1RWKB 1HMVB 1SJQA 4ZHRA 2F1FA 2KXHA 2B3TB 2M7SA 1FRXA 1TAUA 3L7PA 2HAFA 1U2CA 5HN0A 1S0NA 1C1BB 2YWKA 3OJSA 5LXRA 3HVWA 2QMUB 2BZ2A 5L1IA 5L46A 5LXYA 4UY8T 1NB7A 1BXNA 2CNLB 1V3ZA 3BQ1A 1J5OB 5J2PA 1K0VA 1SC4B 4N47A 4J9PA 2XMTA 2UXBJ 1BQNB 4KJIA 2MQQA 3T3FA 3QFHA 4ETXA 3G6YA 1IUJA 3US5A 2B9YA 2HFOA 3GFZA 3QQCD 4ZJQA 3J81Y 3TZWA 4EBEA 2VDIA 1NUEA 4RW7B 1M5PC 1NEEA 4U8VA 1KRPA 4DR2J 1HNZF 3VGUA 1NK5A 2HHWA 3HSJA 1C0TA 2AYEA 4H4MA 1L3UA 2JHEA 3KJQB 4J9KA 1DRZA 2JC0A 2R8IA 4DPWA 1TUVA 1TVRB 3PO5A 4QYZJ 3LQVA 1JLAB 4PAAA 2FJEB 4OI2A 3FUYA 1F3FA 3BN7A 1VQ8S 4N77A 4OJHA 2BABA 3PEJA 4EFAC 3K59A 2P9EA 3MOZA 1TMJA 3LP2A 1SQFA 1TKDA 2HEKA 2EW9A 2FY1A 1HQ2A 2QEXS 4M5IA 3IBFB 4PG4A 2Q6BA 4MKBA 4A8SA 2VFVA 2HNDB 5HATA 3V81A 2V5HG 5ETSA 2D3OR 4ECRA 1BUXA 3CCLS 4Q44A 2FTRA 3MMAA 1NM2A 2J9DA 3AJDA 3QO9B 3D3CJ 2YKMB 4TQSA 1LWEA 3R3TA 1YBAA 1H6KX 2GVDA 4KT0C 2E9RX 1H2UX 4LRAA 3KYLA 4Q0BA 3RB6A 2FLOA 3SXLA 2MLYA 2IRXA 2B8PA 3BGOP 4ZPWR 1YRUA 4Y00A 4CLKA 2NZCA 1HWKA 3EGZA 4DUZF 3D1QA 1FK9B 3H8YA 4ZVUB 1YSJA 1ZPWX 5H1SV 1EB0A 5KFOA 2QLFB 3DLHA 3PYEA 3M6VA 1NSKL 2R8HA 1JLFA 1JLBB 5DQIA 4N8NA 3RYLA 2OEMA 3FBEA 2HS4A 3OW2R 1N5VA 1KFDA 2LQBA 5I42A 4QW9A 4LRBA 4TY8B 3HPOA 5JUMA 4ZVEA 3PW7A 4CO5A 2W01A 2BYCA 5E3CA 2VZ9A 3QJPA 4K2XA 3M6XA 3VZIA 2ZH2A 2OELA 4GO7X 3JTNA 1CJTB 2UP1A 2FY8A 3U27A 2F3JA 4QW8A 2E7WA 2AGQA 4JP8A 1IVZA 4OZNA 3CC7S 1JK9B 3M2VB 5KT2A 4XTTA 1KNZA 2QA2A 4OHYA 3CCVS 4R25A 3RBEA 4WP9A 1HQEB 5AE1A 2FIUA 2DXDA 3PEHA 1FHTA 2F9DA 1SH2A 4K7QA 1T9WA 2XB2D 5HL7Q 4DCOB 3GTYX 4Q7AA 4W90B 5DRKA 3D67A 3O2IA 2VKZG 1FTCA 2FJDB 3TR5A 3HJFA 2HNZB 1NPPA 3BSNA 2AJ0A 3IFEA 5CYQB 3W62A 1QUPA 3H0PA 4YB7A 3AA9A 3PYGA 1XMBA 2PEHA 1VMBA 4C8LA 2L48A 4RLEA 5D4PA 1NRKA 3TO8A 4J5OA 3CT9A 2A3JA 3Q8UA 2PA8D 1GMUA 3T6JA 2ABYA 3HHLB 4IOCQ 4HTIA 1CC7A 4S0MA 2CKWA 3KFWX 4B3RJ 2ZKUA 5GMEA 1LW2A 3RAMA 1U6BA 5IZHA 5L1LA 4A8YA 1OSCA 1X4BA 4JI8F 5DM7Q 1ZZNA 3KK1A 4B3SF 1FRIA 2XI3A 1CEZA 1UKUA 2XULA 1R8CA 2NQPA 1FEHA 4JI0J 1SV5B 3NBPB 3S1TA 4EYIB 4ZVQB 1UFKA 2QFIA 2W1BA 2MQNA 5T41A 5F8MA 3MCSA 4P7VA 4XK8C 2EXUA 4UT4A 5KFMA 2FPHX 2DNYA 1VIXA 2HQCA 1JLCA 2VFTA 2A18A 1SIWB 2ZM6J 3DDIA 3DC2A 3L3CA 3CCUS 4LF4J 2V50A 1Y9OA 1CLFA 4RW4B 2HHHF 4NLSA 3JYTB 3EXYA 1DARA 1ZZFA 4ID8A 3LAMA 1RSCA 1U0HB 4OMFG 1H7XA 3PW5A 1T05B 3QJJA 1WACA 1O6XA 4CLZA 3W5XA 1SL0A 2PE8A 1IKYB 4LQ9A 2IMOA 1X9MA 3L95X 1JJ2R 1XNRJ 2BE7D 4ES1A 1TFYA 3KHHA 2GHWA 3CD0A 4ILLA 1RT4A 1NZ8A 4DV4F 2KO1A 5HMYA 3VV2B 4C3MA 3IS9A 5F8HA 2VIHA 1WG5A 4CNZA 4AL7A 3EGWB 4ZVPB 1DTQA 2V4JB 2CG8A 4DU8A 4V1Ak 1BC6A 2F4VJ 4KHRA 4GMKA 4DCJB 1REVB 3FSIA 2HQGA 2E1AA 2L41A 4BS2A 1VCTA 3BYPA 1U48A 3DLJA 4KO0B 4JB8B 2V4RA 3HKWA 4DV5J 4QWCA 4C11B 1DHMA 3R6GB 2XMMA 3D6MB 3TW0A 1KEKA 4DR7F 3G87A 2YKOA 2XS7A 1OS5A 3KLFA 1S6QB 1SKUB 4Y34A 4CO3A 3ZC4A 1Y5LB 2HHVA 1A0OB 4CTAB 3G8SA 2JFDA 3MAHA 3KUGA 3FEZA 4NZ0A 2KZZA 1HBUB 4ID5A 4G3IA 3OUYA 2B5JB 1X4GA 3LGMA 2DY1A 3MXHP 2AX1A 2RSQA 3BGFA 2CPZA 3CF5Q 3BB5A 4OYOA 5F8LA 4QPXA 4JI2J 3M6UA 2OJ3A 1NJYA 2BKOA 1YQHA 5KG4A 1Q16B 3PX4A 4ZKAA 5FDLB 1YK9A 2KTQA 2VG6B 2XY5A 2WCXA 1WWHA 3PX6A 1XERA 4YMEA 2Y8YA 2FJBB 1D9AA 5LJ5Y 1F3VA 2X3DA 2W25A 4M5DB 2MQPA 4HTJA 2U1AA 3BV8A 3ITHA 3JB9k 1IJFB 5J1NA 2Y1JA 4U67Q 2JEGA 3P96A 2V69A 4I67A 2AJ4A 4DS5A 4EBCA 5K8NA 2EG1A 4AUKA 2VG7A 4UOGA 2C2RA 4F4YA 5RUBA 1S1TB 5JXSA 2WAQD 2GC8A 3W2VB 3CCWA 3GE9A 4UZCA 3GPAA 1RTDA 2GIQA 2IJRA 4OYWA 3GQCA 4CWBA 2R2RA 4C8YA 2HURA 1RQ0A 3HO1A 1Q53A 3BO4A 3TVZA 4OJ3A 3W7BA 2RVJA 3FJ2A 3NP5A 2RUGA 2D9OA 2O1PA 4OI1A 4KE5A 4WKYA 1XMOF 4OHXA 4QIGA 1N5YB 1YJ7A 4LQ3A 3C6TA 1Q8BA 3VVTA 4K4YA 3LP0B 3M2UB 2X1BA 2ZBRA 1BQXA 4WFAQ 3MEEA 3HMJG 3H4BA 3SFUA 3TX8A 1DLOB 4YS2A 2B0GA 5IM0B 1BQMB 2Y1RI 3M8RA 3BPDA 4LMZA 4K5SA 2DBBA 1MNEA 3IBCB 4UOHA 1UJ5A 3DRPA 2JC1A 1RISA 3ET6B 4U96A 3PRBA 3CCRS 1HR0F 1YTYA 1HHTP 2GIRA 2GGPB 3OQ2A 5KFPA 1NKBA 1ACMB 4K4TA 4B9VA 3OR2A 3PRVA 1AT1B 4ED3A 5LM7E 5KFLA 1RAJA 3IG1B 2CJKA 2HIYA 5BR8F 4AE5A 4B9NA 1DQ9A 4QR2A 2G1DA 4FYVB 4N7TA 5C25A 1H2TZ 3GSDA 5E5NA 3IWNC 3EGNA 4FF1A 2DNLA 3KK2A 2MY7A 4CH7A 1JQGA 2W4DA 2OPRB 4L6V3 4KGVB 3H25A 4URSA 1BD6A 1HBMB 5IC6B 1CULA 4LIWA 1RT1A 5HJXA 2H65B 1FFSB 3N0VA 2R7RA 1TL5A 3DLKA 2GVZA 1KP6A 2ZH3A 4ZIWA 3NGSA 1FKOB 3LGNA 1JLEA 2AEJA 2X3GA 3FMBA 1FE0A 5KT5A 5D4NA 1VQ5S 4ZVSB 2HZAA 1SKSA 3D28A 2D69A 4OLPA 2C2EA 2IA6A 3OFFA 3UQSA 1OWXA 2CPXA 5CCMA 2HBYB 2D1CA 1S1XA 2K2PA 3GIKA 3A3PB 2CIMA 3MPVA 4K4WA 3EPIA 4DOZA 4LFCF 4DF8A 3UD4P 1R31A 1RT5A 3MMBB 1S10A 1Q95G 1Q0NA 2ADBA 4ZVTB 3NNHA 4C7QA 1DQAA 4DDFA 3PJWA 1RWPB 1WD6A 1MW7A 3OTOJ 1SB6A 1HHSA 4RNMA 3V4IA 2DNZA 5KG7A 1Y11A 2LA6A 2J8SA 1WSVA 4OV1A 1S1VA 1GT8A 5L38A 4RZRA 4I2PB 4DFKA 1IQTA 4GO5X 1O51A 3MECA 4NCGA 1PKUA 1A9NB 2LVWA 4QR1A 2RQMA 3G82B 2JLFA 3HVRA 4P9SA 5CABA 1ZBTA 1SUQB 1W2BR 2OH2A 3BKFA 4LF9F 2IVMA 1PJ7A 1YLXA 3BS9A 4FYWB 3DLGB 4B3MJ 2XHCA 2J0SD 2VFRA 1CS4A 2BQRA 1N0VC 2MKYA 1JLQB 2KRBA 3PHEA 4WTOB 1RWMB 2B8QA 4C4WA 4G65A 4WU3A 4CLFA 4B9UA 2ATCB 2CYYA 4NZ6A 1YJVA 3B4DA 2VICA 1C1CB 2RS2A 5K8PA 1VDHA 3WIUA 2Y1IA 3V6HA 4C8ZA 2HNYB 1M5SA 3MEGB 4O3SA 1X4EA 5M2PA 2UUAF 1CQNA 3MTKA 4HVZA 1JJHA 2ZHBA 2OTLS 1URRA 3SIPB 3H98A 1CBKA 1CJUA 3RU0A 1RB0A 2E7VA 1BY9A 2YKNA 1SJ3P 4OZJA 4USMA 4EZ9A 1NK9A 2EFQA 5ETTA 3UDEA 1UWBB 1CG2A 3K58A 2W2OP 4MMOA 2DVIA 1NO8A 4IG0B 3DXSX 4WWSA 1PYTA 5F8JA 2ZOMA 4ZCIA 2G4BA 3VALA 3BBCA 2CNKB 4USVA 4OQJA 3BO2A 3IXQA 3PKYA 3NS7B 1IM6A 2HHTA 1MWZA 3HVTA 3EE3A 4WXWA 1X5OA 5C42B 1A6LA 2O3DA 2CQGA 4RU2A 1ZYQA 2CJYB 2XLJA 5E3RA 2G1HA 4F50A 1T8EA 1U1MA 2BW7A 2W4PA 4LSNA 4USHA 3JAMY 2MZ1A 3WC0A 4C3LA 4R5PA 1IKVA 1HWIA 3MD1A 1XTZA 1N88A 4DI6A 3T6BA 3Q86A 2C22A 1MN9A 2OUGA 2DH8A 3BSOA 2QLBB 3MEDB 4KAIA 3IMQJ 4NYPA 2J9EA 3GV7B 2AGPA 4QJVA 3DM2B 3CDWA 2HZVA 1Z1ZA 2UUBF 1KONA 2B4UA 6FDRA 5KFTA 2H9ZA 2HVEA 3IN5A 3N01A 1VRTA 4DL0C 5C24B 2HG4A 2V67A 2XHWA 1NSAA 4WF9Q 4KSEB 3LF0A 3PR5B 3NL0A 4DV2J 3V6JA 2V2VA 2MXYA 2H3EB 3OXGA 2IY5B 3FDSA 4PXCA 1RHQB 2PFDA 4DQSA 1TK0A 4OJ1A 2HS0A 1X4AA 1FDBA 3I4HX 1ZA2B 3TA2A 4Q2LA 2XMWA 3OSNA 1F60B 3J7Z5 4JI3F 3Q0AA 3BKTA 4XDDA 4IH5A 5KFVA 4A8XA 2DRDA 3KUEA 3UO0A 1OQ6A 4ECUA 1X8DA 2VONA 3CJKA 4E8UA 2C1EB 5LT5A 3PVXA 4ZLPA 1JLGB 3GIJA 2C3OA 3QAUA 4DV3F 3JAMU 4PUOB 3GG0A 1YJWS 4JI5F 3EZOA 4P2FA 1S0MA 3WC2A 4ZVRB 3PNIA 3MMCB 1MLAA 3OR1B 2OPSB 3M30B 1S5ZA 1T7PA 2VHGA 4YEAA 3TEHB 7FD1A 2HS3A 2MHNA 4CZCA 1RTHB 1SC3B 1FXRA 5F0UA 4Q45A 4BHQA 4I7FB 4OFZA 2V8PA 1I6JA 3MR2A 3THVA 2D41A 3MUVP 1R0AB 2DGVA 3E01A 5HROB 4RNHA 3FBBA 4DX7A 5KT4A 3CGIA 2B6AB 2H4WB 3QWUA 2G0JA 2DK2A 3LP1B 2AD9A 4LBHA 3THPA 2MZJA 1TP7A 4P2XA 5AJ3F 4O4RA 1NKEA 1KKHA 2OGUA 2MGZB 1W7WA 3MUMP 4DV6F 1NJZA 4USJC 2UZAA 1RAGB 3IBWA 1RWWB 2MEWA 1FESA 2XSFA 2M88A 4J9VA 2KHDA 1H72C 3N6MA 1FCAA 1FKPB 1PILA 4LF1A 4EK2A 2ACYA 1TU0B 4OHZA 1S79A 2VG5B 2YNGB 4LFAF 3S8SA 4DLGA 1SJ1A 4FPRA 1XNQF 3B6BA 1XBWA 3ZZZA 2ZBQA 3MEKA 5J2NB 4DV7F 2UUCF 1FI4A 2IAJB 3MWBA 1S6PB 1B99A 1XEZA 4WK3A 5IWAF 5IT4A 3PX0A 3RTVA 1S9GA 2P2CB 2K7JA 1Q7YT 2RRNA 4I6AA 5ETLA 2KXNB 1RWXB 2XMVA 4DSIA 5KOXA 1QVGR 3D1OA 1RT2B 2HK2A 2FGOA 1B0PA 2YKQA 4WK1A 2KM8C 3D1HA 4CLWA 3EUNA 4WE1A 4ED8A 3HD1A 3DRRA 2EFGA 4YHHJ 1S59A 3LAKA 2ROPA 4ZPVR 2C3PA 2QZ8A 3SCJE 2HWHA 2BJEA 1XMOJ 2WONA 2YNIA 4RW8B 4R8UB 3RRGA 3NS5A 1P8GA 3DHXA 5A76A 5KFUA 4DR6J 1VBXA 2V4QA 2MQ8A 2Z2LA 3H20A 3OD2A 3UR3C 2XO6A 1JMTA 2NZ4A 4ALZA 3H5YA 1Q5YA 2UU9F 1OYEA 4X4RA 4WFZA 1U6FA 1IKWB 5B0GA 3OLBA 1URNA 1PYOB 3K7RA 1Q82T 2DR7A 2QSWA 2RQKA 3T1HJ 1LNQA 3TP2A 2DHAA 4ES2A 1YKWA 3ZFVA 4OX9F 4B9MA 2XWXA 1X60A 4IFYA 5HI7A 2CZ9A 1VRUA 4DV0F 2JEFA 2E44A 3RRKA 2CJAA 4ECZA 4X2BA 4F4WA 2NXJA 3K5OA 2XEXA 2GQQA 1SH3A 3CDAA 1R3NA 4ED1A 3M8QB 4GVLA 2QO3A 2RILA 4A46A 4HDGA 1J27A 2XNQA 4HLBA 2ZBIA 1WTFA 2R7QA 4YDDB 1DY3A 1WG4A 2W8KA 3JTOA 1RAEB 3PRDA 5T7LA 2V8GA 1TMMA 4DQPA 1TV6A 4Y2KA 1U4BA 4DSEA 2CQ3A 2EK6A 3D4JA 4E98A 3MM7A 2B4OA 2AJFE 2QMWA 4OYXA 2ZE2B 2ZHAA 1WHXA 4QIEA 2Q66A 4NXMJ 4FYDA 2ZH4A 3KXDA 4KHMA 5DZ6A 2C28A 2RKIB 4DR4J 3W3SA 1UJ4A 3TX0A 1U1NA 1X0FA 1PJ6A 2HWIA 5SUHA 1GXLA 1RTJB 1UPMB 1FVSA 5D3GA 1F1BB 5LSLA 4DX5A 3AB2B 3DOMA 2C42A 1GTHA 1F2HA 4J9UE 1SI9A 3IRXA 1RWNB 2NCKL 3UD3P 1GFWB 3I6PA 1RU1A 4YY3F 1RHRB 2ZUAA 2X1AA 2ZDOA 3N79A 3BGRA 4QWDA 4Q2MA 2J6UA 1SPBP 4KFBB 3HULA 3PYFA 2CZVC 3IAS9 4EO6A 2W9CB 4X4QA 4U7UK 4YOEA 3ILIA 1OY8A 5KFFA 3RBXA 3B78A 4UZBA 3BR9A 4Y65A 1MWQA 1KHWA 2E1PA 4NI2B 1JJ4A 3W64A 2E66A 2OI2A 1UP1A 2UV8A 1RHJB 3EZ5A 3VQSA 3SCKE 1Z4UA 4O44B 1Q1KA 3SCLE 2B9EA 1RGVA 2QA4G 3DXBA 3F56A 5GAGU 1SKWA 3PDNA 4X62J 5LSOA 4DHVA 1RAFB 2A2CA 4PR6A 2NXUA 5J2QB 3AB4B 2RAQA 3QRRA 2IC3A 3N5FA 4WTYA 4MT1A 3ILJA 1BWEA 4IH7A 3PIOQ 3QLHB 2BJ7A 4CO0A 2K06A 1FJEB 1YRTA 2N4DA 2WBRA 3TA1A 2HZCA 2QLWA 5CYMA 2U2FA 2VJVA 2LXUA 2B9WA 1UMJA 1OPIA 4LF5J 2JRSA 3MM5B 3R5CA 1IBCB 1IWAA 2HLUA 1EETA 1EHWA 1FWPA 3CCTA 3D0HE 3BQ0A 3SDEA 2YVSA 1M5OC 4L74A 1APSA 4MTPA 4WFNQ 2QLXA 3SV4A 1TTHB 3THTA 4C8KA 1GXUA 4PKDB 3T19A 1JIHA 2PMWA 4ANDA 3H2UB 1VGYA 3BSAA 1NK4A 3LWMA 3GWCA 1PO6A 1HMVA 1HD1A 2VODA 5FJ4A 5KFIA 3W65A 4A47A 3F73A 3HX9A 2BQUA 1U47A 4F36A 2P6SA 2UVWA 4KTQA 2E5LJ 3W61A 3CJTA 4RBTA 3G4SS 4HHHA 5AXNA 4NLUA 2WSFC 3J81j 4O0NA 1KQSR 4PZVA 2GQCA 1GXTA 1RADB 1IR1A 3BBFA 3NNCA 1UVJA 2NYHA 3MTJA 1IBLJ 1K9MT 3CJ3A 2BDPA 2R2SA 1BQNA 1V9OA 1Y3JA 2PFFB 2QTWA 4ILRA 1UA1A 3W9IA 2RF2B 2O66A 1KLNA 3VAJA 4I56A 4LREA 3LW5C 3MPDA 4J91A 3ONQA 3VAFA 4V19J 2KT2A 2Z2YB 4RW7A 5DM6Q 4A8FA 1NJIT 4ATNA 5HQMA 4WP8A 3PXGa 2D3O1 4MYUA 3T41A 2WVBA 4TKTA 3HHLD 4E0DA 2YWEA 2G13A 3IRWP 4F02A 2R7VA 3TZZA 4F4AA 4P10A 1TVRA 3LWLA 1HQUB 4YB6A 1JLAA 1HLWA 2LQJA 2HRYA 3MAQA 5CQGA 3G71S 5A0YB 1H7WA 1N33J 2WTFA 4AD6A 3OTCA 1BE4A 3GMGA 3KLGB 3R1LA 1HHQA 1DBDA 2Z0GA 5IT0A 4H4OB 5HO4A 2HNDA 1TFWA 2Z4PA 4X64J 4HT5A 2YQ0A 2V9WA 2JLGA 4ZMMA 1EARA 2WVCA 2YKMA 5DDPC 1QUVA 5DQGA 2EFVA 3ULHA 4J9LA 2QSFA 5EX3A 2NREA 4NLQA 1UJ6A 4IRKA 2EWHA 2WBMA 1FRMA 1VC0A 2MY8A 1RACB 2PA3A 2RDJA 4JI6F 3KG1A 1FK9A 3JS9A 3EMTA 2BJ1A 3TJAA 5L39A 2IM0A 4NEZA 4KV8B 5AE3A 2FVCA 2DCUB 2BVZA 3LTOA 4HI1A 2G9OA 2VU5A 3NEKA 4CT8A 4HH1A 4GC6A 2W7AA 4H4MB 3NWRA 4JI1F 2QFJA 2HVDA 3TI0A 2EKNA 1MMLA 3DLBA 2RU3A 4A8KA 2OEJA 4IG3B 3CNQP 5DLGA 3K5LA 5EGYA 4OZ1A 5ETVA 3QT6A 3VAKA 4TY8A 2WVDA 2DGSA 5IOLA 5CZXA 3GILA 3T5HA 1P1LA 4L75A 1X4FA 5SZTA 2F8EX 2ZZMA 1CJTA 2ZNZA 3C2PA 5HBMB 3V81B 2DNNA 3K8WA 4LRCA 2EKYA 3TJ9A 3VAMA 4PG8A 3LGHA 3M2VA 4MH8A 4CLYA 3JQKA 5DDRC 5D0RA 2ZZNA 5K9FA 1LWEB 3FC9A 5G4DA 5GAGI 2QG9B 1WI6A 3PZPA 4Q0BB 5T14A 1HKAA 5AXMA 1XR6A 3W8PA 4URQU 1KVKA 4TN2A 1JXEA 4DZDA 2HNZA 1WORA 3BDEA 3G2XA 3CJSA 1VC5A 2DB1A 2NS1B 2LYVA 1VQKS 5EHHA 1KWMA 4RKUC 4L3KA 2I38A 1TQLA 3OT9A 4GC7A 2KZMA 2YWWA 2IYGA 2QX0A 3N28A 4FN5A 3T5KA 5K20B 4NXNJ 1VQSA 3HHLA 3ADAC 5B0DA 3TQ1A 4JYAJ 4HHUA 5A8WB 3FCHA 2UU9J 1WUUA 4LF6F 3EX7B 3CULA 3D7SB 3POTB 1HNVB 3DRSB 3H5XA 4JV5F 3RB0A 2XGPA 3BJYA 2DNQA 3HD2A 1HA1A 2L3MA 3NRBA 1OO0B 4KGXB 2ZJRQ 2MZRA 1SV5A 3QZ8A 2B7BB 4PPDA 2CPDA 3NBPA 1WEXA 3CDUA 2GZOA 1OJ4A 1CJKB 1NNDA 1XIQA 4JUZA 4USTA 1BGXT 1VQMS 3AFGA 4OI6A 4P75A 3RAQA 3BDPA 2YNHB 1EP4B 4PG5A 5IQQA 1HD0A 4F0HA 4DSJA 5DLFA 4G1PA 3UNYA 2R7WA 2MJUA 4HKQA 4UUWA 4OL8A 4LF8F 1FKAF 4ERDA 2FLLA 4RNFA 4RW4A 2ROGA 4D3HA 2BE2A 3U02A 4U8YA 2QMXA 4HACB 3DLEB 3C15B 2LQ9A 2IJNA 2BBEA 4F04B 1VYAA 1QDUB 1T05A 2FB0A 3R7NB 2N3LA 1LKZA 3TUPA 1IKYA 2E1MC 1MU2A 5J2MB 1JB0C 1YBUA 3AXKA 1PSDA 3KNGA 1MROB 2XYHB 2B43A 3ZNUA 5KFDA 2MSTA 4WFBQ 4QOTA 2WRMA 1N5TA 1J5EF 4J9OA 4R0JA 4NMXA 4L76A 2V4JA 2EC0A 1P6TA 3GYNA 2UUTA 2I6WA 1F2GA 4F2RA 4NPOA 1REVA 1T9XA 3HK2A 8AT1B 2LEPA 2LQ5A 2NSBA 4C11A 1K0TA 5KFZA 2N4CA 5J1EB 2F40A 1RT3B 1TKTB 3AT1B 5LMNJ 1S6QA 2XZWA 4CTAA 1JXLA 1S6OA 3MPYA 1HBUA 3FSXA 2B5JA 2F8MA 2Q79A 3F0NA 5KOWA 3ZZOA 2XMUA 4F25A 3VHQA 3DDNA 3NOCA 2BMBA 4NZ7A 5ETQA 3SYZA 3DOKB 3R7SB 3BEGB 3ZTSA 5A8RA 3PACA 4WYWA 2VL1A 3GIIA 3CC2S 4AQYF 1DFDA 5FDLA 2AF6A 2VG6A 3MPUB 4FZVA 4A48A 3RR7A 3GZ7A 1P1TA 4C8OA 1LWCB 4M5DA 2V2QA 4W92B 2KKHA 4P52A 4NEYA 3AJ2A 4OZLA 3GIRA 1NJWA 1N4LA 3QSIA 2RRAA 5CCLA 4F67A 4OI0A 1HARA 2FYXA 2Y1LB 3OL6A 4B9SA 1S1TA 2M3DA 1U7LA 2FQQB 1VQNS 2L08A 2ZC3A 4OJGA 3TAQA 3GCXP 1X7VA 3W2VA 3EYZA 1FEEA 3HHNB 1RK8A 2BJDA 1HNWJ 1I94F 3QNWB 3L4BC 2Z2ZA 3QBCA 2UXDJ 5HLFA 4JI4F 1WC1A 2CWXA 2BKPA 2AT1B 4CO2A 1DQ8A 4NLGA 2ZKTA 1Y5NB 5LJ3Y 4KIAA 2OAUA 1F5AA 2F63A 4P71A 1PAUB 2GO9A 1NAQA 5DS7A 1S4FA 4MKVA 1NDLA 3L7OA 3G8QA 1FDAA 3BREA 3WZ0A 2LFVA 2W2QP 4ZP6A 3TJ8A 3RRHA 2QA4S 1KQGB 3JQJA 1B7YB 5EUHA 3BO3A 3W1YC 3HHLC 1OIAA 1TZ0A 4A4JA 6FD1A 5HMXA 4WFXA 3LP0A 5CD4H 1GNKA 5D0EA 1QLNA 2GQ2A 3W8GA 2K1RB 3FZ2A 1IBMJ 3C8YA 2WB4A 2B9XA 4CCHA 4J9SA 3EDQB 1UVMA 1BQMA 5KAKA 1FA0A 4DUYF 3NMAA 3QT7A 5I3UA 5FLXU 4DPYA 6AT1B 2LDYA 1NXIA 3ET6A 1T0TV 2DJWA 4PWWA 2MKCA 1JX4A 2Z57B 5ETMA 2JWNA 1QD1A 2VOPA 4NLTA 2GGPA 4HI2A 5L8RC 3HT0A 1UVLA 4IDKB 4DR3F 3DKDA 4DZ6A 1F6TA 4LJMA 5B08A 3GYGA 2CPHA 3WHIA 1YJRA 3I5BA 2GAGC 3I5CA 2MZTA 3GJTB 3SSSA 2L9DA 2J0QD 4GKJF 1WF2A 2JX2A 4LR8A 5CAAA 3P5BP 4YFUA 1LW0B 2WW4A 1GH8A 4DR5F 2ZBCA 3BF4A 5U47A 4YQWA 2FC9A 1HBMA 1R6VA 4ZLNA 1WG1A 3W60A 2XZDB 1H3DA 4XPCA 1D8YA 2R8KA 2VDHA 3MCNA 4JV2A 1FKOA 3TANA 3W9JA 3GJRB 2OPQB 1FX2A 3QGHA 3BGUA 1XJWB 1LV5A 1RAHB 5L1KA 3MEEB 3KJVB 1RTIB 4OYBA 3LO3A 2VBWA 2LXFA 3FVYA 4XO0A 2XLIA 1XMQJ 3JSRA 2RS8A 4QWEA 3M6WA 4X4PA 4USKA 1VJWA 1HNXF 3CMES 2J0WA 1VS3A 3FBCA 3MMBA 2DITA 5HK4A 3UDCA 3IA0A 4N5SA 1KLMB 2R4FA 2GJIA 2IDLA 2DR9A 2VFSA 4F8RA 2QRRA 2QL7B 1FNXH 1RT7B 2C2MB 5KFCA 2FJAB 2MZQA 2CZ4A 4O4GB 3M2RA 1VK8A 4X66J 1I51B 2AMCB 5C25B 4FF2A 1N32F 3UVJB 3KUHA 1YHQS 4OYMA 2LEBA 1FNOA 4WCEQ 3CW2C 1H98A 4ZCKA 4I2PA 4TY9A 2C2OB 2DHGA 1N34J 2R42A 3KK3B 3M9OB 4K4UA 3TAMB 2LEAA 3C3LA 3G82A 9ATCB 1IBKF 1GX6A 1QJHA 3CPWR 2DH7A 1SUQA 4C0BA 2XM3A 4CLPA 5HVGA 4V19X 2WOMB 2YX7A 3WX8A 2B4VA 1D0EA 3DLGA 4ANCA 2FVPA 1ZM3A 1WNEA 1FWKA 4EGLA 1JLQA 1UEVA 1X31C 1NDCA 4M5KA 1NH7A 2RT3A 1C1CA 3MOJB 3BSCA 2MLZA 1CJVA 2HNYA 4ECYA 5B0AA 2KFZA 4DL7A 1D1UA 3OV7A 3CVKA 3AAWB 3ZTRA 4NLOA 4IQMA 1QTMA 4DL6A 3CCZA 1X4CA 1Y4ZB 4C0OC 4C0HA 1KD1T 3RW6A 1UWBA 2F65A 2YQ1A 2LECA 4B17A 1D9FA 1RABB 2E5IA 2LCWA 1R6YA 2J8AA 1B70B 4IG0A 2MQOA 2ADCA 2OO4A 3M7VA 3PJXA 5K8OA 2I0XA 2VFUA 4LF6J 1WKLA 5MAOA 4DR1F 4B9TA 3HFKA 3CCES 3E3XA 1XR7A 4QCLA 2ILZA 4M5GA 3P8BB 5AXKA 3TUJC 3K5MA 5E3QA 1R0BG 1F5CA 2DNRA 2DNPA 2YH1A 3PW0A 1TL1B 2I8EA 2GS8A 4K4VA 3NGUA 4C8NA 3CD6S 3M9MB 3MEDA 3C19A 1VJQA 2HBRB 3C14B 2DNGA 2FDNA 1PYSB 3DM2A 2J5AA 3HM9A 4LF8J 2AEFA 1H2VZ 4MIAA 3HDSA 3PR4A 2XYGB 1FDDA 5LMUF 3K0JA 2GHPA 3BYRA 2KHCA 2M4MA 2DY9A 5KG3A 3KKFA 2IM3A 2YKNB 1FJGF 2AZ3A 4KGZB 1VIOA 1TUGB 1OQ3A 5C24A 4ER8A 1VI7A 1EX8A 1T9YA 1SJRA 3G9CA 3I56S 2DO4A 4Y28C 4HR2A 3K57A 3MR5A 3A3OB 3A13A 1N36F 1A7GE 3C66A 4RX6A 4CIOA 1O0PA 4RW6A 4LFBF 2DHXA 2KFNA 2GO8A 4PQUB 3OPKA 3R2DJ 4B9LA 1Y5IB 3Q22A 1LWFB 3HVTB 4NCBA 4C8MA 3ZZTA 1RYSA 2BA9A 2N7YA 4QYZK 1SIZA 1JLGA 3VGSA 3OHBA 1H0HB 4PUOA 4ICLB 4QIVA 1QTNB 1YITS 4R5PB 5KT6A 3J80Y 3MMCA 4F0KA 4NYOA 3IR6B 2OPSA 1WDTA 3M30A 2UXBF 2ZHOA 2PMHA 2WHOA 5D0GA 1N6QB 1RTHA 3MMJA 4W98A 3G6ES 3J7A1 2XY6A 2VBZA 1K8AT 4DWIA 2ASDA 5ETOA 2HVZA 1JWWA 3CCQS 2CPYA 3AD7C 1OYDA 5I3PA 3S6EA 1R0AA 5D77A 1ULRA 4DV1J 3NKYA 2DISA 2B6AA 3LP1A 1VQPS 2ZC4A 4DR2F 2ZH5A 3ZZPA 4QIFA 3J7ZT 3TVKA 4FXVA 3SSRA 2KL8A 1B0VA 2UVRA 4Q43A 3W9HA 4X84A 2VQEJ 4RW9A 2D74B 2LA4A 4MKAA 3EVWA 3CJ0A 2OMOA 2BRLA 1FKPA 4MK9A 3K8VA 1UEKA 1Q79A 1FF2A 2YNGA 3H2LA 2OSQA 3KMQA 3DYAB 1R43A 2F4FA 4DF4A 3KLHB 1V5IB 2DGWA 5KFNA 5J2NA 3NGRA 3J80U 2IAJA 2P9CA 1S6PA 3ETOA 4GKKJ 1GQEA 1AUSL 1KOHA 2BJ9A 3KJFB 2IBKA 2UVUA 4LF7J 1C4CA 2XMJA 3Q8RB 4PG6A 3J7AN 2PT0A 3QFWA 3CE8A 2W9BB 3FMWA 3GFHA 1RT2A 4ZDNA 4J9RA 5KFQA 4QIWD 4IRDA 1JJCB 2HQDA 4NX9A 4F7VA 1FX4A 2DGTA 1NCLA 3Q89A 2AHOB 4DPUA 4X65J 1HYSB 3JSBA 3T1AA 2ASYA 1UL3A 5G0RA 1DURA 3MR3A 1U1QA 2IJFA 2ROEA 1C0UB 4KHPJ 2ZWOA 1QVFR 4LRFA 5C5JA 1RT6B 4DFJA 5IQ6A 4RW8A 3GV5B 4R8UA 4I0WA 4TVAB 1LQ9A 1KTQA 2G2ZA 2NR0A 4W4MA 1RAIB 5LSRA 3F44A 2EVZA 5D15A 3P6YC 1NDKA 4KH1B 2I1RA 1YRXA 3RZAA 3PO4A 4NWBA 2HFNA 4RUBA 4EU0A 4QBUA 5B0FA 2O67A 2HQIA 3JQMA 2UV8G 3K5NA 5CYJA 2YX1A 2UXCJ 3CTRA 3AQOA 5JVHQ 2HGMA 4QU6A 3MM6B 2LQ8A 3UN3A 1Q8IA 4AYBD 1TK8A 4Y0FA 1OMSA 2GX8A 2CQCA 2QJ3A 3GJSB 2C3UA 4ECSA 3HJVA 4AT1B 4GVBB 4YR2A 2WONB 3QT8A 2IRYA 4O3NA 5D8HB 1MMNA 2NLWA 2ZH6A 4MIWA 5B7WA 1PBUA 3OXFA 2ZE2A 2QYCA 2CUYA 1IKXA 5KTQA 1WEYA 2RKIA 3PG9A 2NXCA 3CMQA 4B3RF 4WPAA 3UN5A 2IMWP 1SH0A 4A8MP 3NGKA 2NSCA 3VGTA 1RTJA 4ENOA 1LXNA 2GW8A 1ZS6A 4X4OA 2E1RA 3CCSS 2O01C 2OMLA 4JI0F 1HNXJ 2VJUA 1NU4A 3C6UB 3MCMA 2W8LA 3PJ9A 3RB3A 4NLWA 4I4BA 3ZTQA 3N4WA 4Q8FA 3OL9A 4KFBA 2HWTA 3UPFA 4LR7A 3D54A 2GJ2A 3R2CJ 2QL5B 2F9JA 1B64A 3EZUA 1LK7A 3ICLA 5K14B 1SVDA 1VQ7S 2HFUA 1S1UB 2ZM6F 2OTJS 3K89A 3GR0A 4LF4F 2FUG9 3V5RA 1UW9A 2ALZA 4NI2A 1NK6A 1PAEX 2V8HA 4TU7A 1HNZJ 2IM1A 3M1VB 2G2YA 3TOQA 1AROP 1S9EA 2KDOA 1RHKB 3PFOA 2VASA 5DG9A 4I69A 1FRLA 2H48B 5J2QA 3GJQB 4FF4A 3U1MA 2YNFB 1RBLA 3GLJA 1LFWA 2ZVSA 3QAEA 3UCZP 1HBNB 2WSCC 2M0GB 3QLHA 2F4VF 1YZ7A 3R7BB 3O1LA 3A3NB 4ED6A 2VD3A 3FEYB 2E5JA 2CPJA 3F41A 3RW7A 1FD2A 3HKZD 5ETKA 4CLSA 4DV5F 3VVUA 3ILLA 2OSRA 3W2WB 1MG7A 5KFJA 1U1PA 3KHLA 1VHFA 3OFEA 2M9KA 4CH0S 4A8QA 2AGOA 2MDAA 3MCOA 2BX6A 1RU2A 3MM5A 3Q8YA 1QE1B 3M4XA 2R2TA 3TARA 3DCAA 4RWXA 1NDPA 1S48A 1TELA 3LH2S 5ETRA 4IFVA 2PD1A 1IN0A 2HPUA 4C3KA 3AA8A 5DZ7A 2J9DE 1E6YA 4DUZJ 3H40A 2V63A 2AIRB 4RUCA 1KN6A 5M2UA 1CC8A 3BM7A 1BLUA 3DOLB 4JI2F 1BHNA 4OYIA 5ADZA 3ZZYA 3DGPB 3UWTA 2FD2A 1YJUA 4IR1A 4O3QA 2PSZA 3ENVA 5A8KB 2RH3A 4JOUA 2DGQA 3GONA 2LLZA 1RE1B 4RO0A 4C9DA 2E5GA 1XC9A 2Q43A 2HHPA 2LP4A 4J9NA 3D68A 2NPFA 2RQ4A 2EC2A 2OPPB 4WBFA 4UOCA 2RF2A 3BQ2A 2GAHC 1F5BA 4M95A 3C46A 1EZZB 5LMUJ 4Y2IA 3VWSA 4PWUA 5EWEA 1H38A 2BKNA 3CDEA 3EM1A 4WFYA 1RHUB 4MK8A 4FNIA 1HW8A 3L09A 4ZLJA 2K7KA 4PCQA 4DL5A 3SDEB 1KDNA 1PCAA 2VB6A 4DMZA 2D9PA 1ZAWA 1N36J 4FYYB 3S7RA 4PWDB 2JJ4D 2HBQB 2B4PA 1HQUA 5KG6A 3LPYA 2PIIA 3ZZUA 3OVBA 3I32A 4I2QB 4A8OA 1F9FA 2ZH8A 2XYPB 2Q1LA 2E7XA 5A0YA 2DD8S 4X4SA 4ZP7A 1RZMA 5LOQA 1YZ6A 1LEOA 4ECXA 3M32B 1U1RA 3KLGA 4CQ1A 4ED2A 2ZNYA 1DTTB 3A8KA 2FJXA 4DLEA 3H7HB 4H4OA 4N56A 1SC1B 3ETMA 2QL9B 3RGIA 3FFIB 2XCAA 1FDNA 4JI8J 5F8GA 4RJVA 1U45A 4B3SJ 2VV5A 1SJ4P 5HP1A 1XQIA 2N3OA 4P72A 2J6SA 4ECVA 3MAAB 4KB7A 5CHCB 5D78A 1MN7A 3DN9A 3FRZA 2V94A 2ASJA 3FCVA 5KFYA 2WVEA 1X5PA 3KMSA 3M9NB 3T5JA 3CIZA 3TA0A 3KHGA 2VH7A 1FWLA 4OI4A 2APOA 2EFPA 4KV8A 4K5RA 3A1YG 2HHUA 1QSSA 4M1KA 2GIFA 3M8PB 3KLEB 3GSIA 5KG2A 2HHHJ 5GMKa 4LSLA 2GMHA 3DRXA 1EKRA 1HBOB 1WEZA 4IG3A 3BPSP 2XZTB 1QAJA 1ZPVA 5E0OA 2DHHA 5AT1B 1O5JA 1KSPA 4ELTA 3DRYA 2EEYA 4IUFA 3HP6A 2GHVC 3MZIA 2WB1D 2V2ZA 5D4OA 1REGX 4DV4J 4WZQA 5F9LA 3FEXB 1R8BA 1TAQA 2KH9A 5HBMA 1UVNA 1FFGB 1RTZA 3D2WA 1R8PA 1WF0A 2ZH9A 3JXOA 4UQTA 2YBVA 4LR9A 4M5LA 4ANEA 3GFXA 2LDIA 1RWVB 2X1GA 4I64A 1I1GA 5IS2A 3SQGA 2CNNB 3AODA 3X3UA 4RNOA 1G3OA 3C16B 5B0CA 3J81U 3Q8QB 4USUA 3BGLA 2ZZTA 4DR7J 3NAHA 1HPZB 3HFVA 4NRUA 3J7YU 3AOBA 4YP3A 4TU9A 4ZK7M 1YJTA 4X4VA 1HIYA 2POKA 3OTOF 3FKBA 1ZOTA 3CJ8A 3IM9A 1S77D 1RUSA 3P3DA 3RUBL 5D6GA 2AYBA 4MFBB 4DEZA 1S1WB 1U1KA 2HMIB 5HJYA 5A8WA 3MD3A 1S9FA 1WC0A 2F7VA 4U7UD 3POTA 1HNVA 3DRSA 2CADA 1L3KA 3EVOA 3GYXB 3X1LB 2OEKA 3HHDA 4CYUA 3RB4A 5MLCV 4KKOB 4MJKA 2VPXB 1CJKA 1O8BA 4B3MF 1P9YA 1M1HA 2YX4A 4ZP8A 2Y8WA 3NNAA 2JNJA 1WC4A 3N9UC 5EN1A 4ZVGA 5H9EK 2ZD1A 1W26A 3LALA 2VPYB 2YNHA 1EP4A 3K17A 4CLUA 4WP3A 3OJUA 3CCJS 5HMWA 1TKZB 2QGFB 5IV4A 3OL7A 1IM4A 3OVAA 4M5HA 1TKXB 3KLIA 3G96A 3BKUA 2CDQA 2MHEA 4HACA 3DLEA 1XN9A 3C15A 1SL2A 1FXDA 4P2MA 1HWUA 2ERRA 3FNNA 4K8RA 2E9TA 1FT8A 1M5KC 3B54A 3WX4A 3R5AA 3W63A 2GMLA 4G1QB 3DMJA 4DL3A 4TU8A 2R8JA 1KHVA 1MMDA 4O23A 3SQOP 2HIQA 1YWXA 5J2MA 3H42A 2Z58B 1JKHB 3VZHA 4Z7CA 1MROA 3UW1A 1UAWA 3A4TA 3I0RB 4ELUA 1KQFB 2DO0A 2NXEA 4FVCA 1WF1A 4K4XA 2P5VA 1OY6A 3DGVA 1F9EB 3O8WA 2XG8A 2RHQB 4WIIA 2PGCA 3UI3A 2IYIA 3FSYA 5KFGA 4F3MA 4PYDA 4NRTA 2KVQE 3DI6B 5KFHA 4DSLA 2DT9A 2ZFHA 1ELOA 3L7UA 4DN0A 1M5VC 2HBZB 5BJRA 2YPYA 1D09B 4OV6A 2PEBA 3HF5A 2JL9A 3VAIA 4YDXA 5J1EA 2W9AA 1RT3A 1TKTA 2W2NP 2CQ1A 3WIVA 4I1TA 4ZS6A 3MM9A 1HR0J 2DXFA 3KJNB 1M1GA 3AQPA 4IO1A 4ED4A 1ZAXA 3LANA 7FDRA 3A8IA 3VGVA 2BE2B 4TYAA 4JI7F 1GX5A 2MQMA 1VQOS 3UR0A 1Q5VA 1S12A 4ZCLA 2YWFA 2GV1A 4DSKA 3DOKA 4P6QA 3MR7A 5BR8J 1IJEB 3UN2A 1EJ7L 4ED5A 4CI0B 4DV2F 1MU2B 4U95A 2GNKA 1B0TA 3OTEA 3FGVA 5DQHA 1U49A 4LIRA 1U26A 4CRJA 4OHWA 4Z2XA 1AFJA 1LWCA 1ZAVA 2JLEA 2NYIA 3A8EA 4UW2A 5A6PA 2A0FB 3V4MA 2XSJA 1T03B 4ES3A 3K2YA 1RBAA 1OPZA 2OLWA 3I0SB 1G1XA 3R9LA 2V34A 1D8ZA 3PIPQ 2WZ1A 3QIPA 1S7IA 3N6NA 1UFWA 3QIDA 2DRBA 2RDDA 3H4DA 4I6YA 3CEDA 5CXTA 2KG1A 1U1OA 4F3QA 4CT9A 3R8YA 3ZXWA 4XIUA 3EPGA 3TRGA 4MYTA 2CQ0A 4A8WA 5F3TA 4NLRA 4LFCJ 5HANA 2UUWA 4PXDA 2J7UA 4HDHA 5GADU 1N5QA 2X51A 4DSFA 1VQYA 2Z30B 5KFEA 1VR6A 4DPOA 1S7HA 4MKYA 4O3OA 3IP0A 4P74A 1HW9A 1PJ5A 3CD7A 1ITPA 5A8RB 3AXMA 4Y3CA 1RWOB 2B7CB 1DZ5A 4N41A 3QGIA 4QZVB 2W2MP 4DS4A 1M5HA 1OY9A 4OIXA 3SMZA 2K1RA 1EQMA 2X7IA 3J7YI 1XR5A 2CFXA 4FDFA 3BBBA 4F26A 4K0KF 3CDBA 1B3TA 1SJFA 3KWMA 3ILOA 3MF5A 3HSZA 5F41A 4NA3A 4K4ZA 3VQTA 3Q8PB 2PMZD 2I5JB 1YG0A 2MYFA 2ZOFA 1YDLA 3NS6A 2KYXA 1NK0A 4LF9J 2FLNA 3V6DB 1Z2ZA 1IQZA 4LSZB 1T9VA 3QT5A 4NA2A 1T94A 2NUHA 5AXLA 3CIMA 3CCMS 2CJXB 4IDKA 2YWGA 4C98A 2HK3A 5EX0A 5HLFB 4IYQA 2VQFF 4RL1A 4HH0A 2Y3YA 1WHWA 3EICA 2MSSA 5HAOA 1AZSB 3UCUP 1YI2S 2CPIA 2IPOB 4OX6A 2UUAJ 3O5TB 1E6VB 4O0IA 1KBRA 2VUGA 2DHSA 4DG1B 1FTRA 1U2FA 1LW0A 4YHHF 1N54B 4WIQA 5E3PA 2DXEA 3AOCA 3QWPA 1VQ9S 4FVMA 2LU2A 1LXJA 3IGVA 2ZDPA 5KFXA 4MIBA 2CA9A 4J90A 2HFVA 1G4CA 2OPQA 1WHYA 2CVIA 2PDAA 2DGUA 2DNHA 2EG2A 2BANB 4B3OB 1QSYA 4DR6F 1TL3B 3D6HB 3KJVA 1RTIA 3B82A 3R6LB 3GP9A 3DU5A 1DJ0A 3D5MA 2CRLA 5I3UB 2FGCA 1Q4RA 3FZBA 3WQPA 1C1BA 5FIIA 3MGJA 5H9FK 3B4MA 2BQ3A 3T1HF 4HYKA 2H5IB 3I82A 2DIUA 1Q8KA 5HMZA 2QLJB 1J5OA 3PY8A 2O5DA 3QGGA 1UPPA 2XS5A 1KLMA 2IHR1 1FJ7A 1MSWD 3ISZA 4UY85 4ZJOA 4NMLA 1RT7A 3MFIA 3BR8A 4FKXA 4KPCA 4USIA 1RCXB 4O4GA 3I87A 1HNIB 4J9QA 5KG0A 5F8IA 2YXLA 2UUBJ 4DXLA 2M8HA 2IA0A 1RLCL 1TL7B 3UVJA 3NCPA 5K5MA 3MM8B 2KYZA 4ZJLA 3BZQA 2KJVA 1GEHA 3KK3A 3OTBA 3KHRA 3NCRA 4BC7A 3TAMA 5HQ8A 2FC8A 3CO0P 3IAM9 2GCFA 3OHAA 1PGZA 2MKSA 3UNGC 5L1JA 3HSGA 4K50A 3JSMB 1RCOB 2VKRA 2WOMA 1X4HA 1N48A 3QRPA 2BV3A 4NOHA 2DR8A 4NXMF 4JI3J 1KVJA 4RWWA 2HRTA 2K3KA 1VOMA 3BN4A 4WU2A 3CJ5A 2R7UA 4HL9A 2G2OA 4DR4F 2KFYA 3D0IE 2R2UA 3PM9A 4XDCA 4DBQA 3T9NA 4ZHRB 2KRRA 2BR0A 3H90A 4DV3J 3PV8A 1UCNA 3HZEA 3IO1A 4JI5J 3MHYA 4E2FB 4FBUA 2HHSA 4I6WA 2RDIA 4I68A 1VC6A 1WDDA 3GFYA 2R8GA 3QO9A 5J2PB 1X5TA 2GFFA 1YGYA 2A6OA 2DPJA 5GAHU 4YUDA 1NJXA 2BACA 4KRWA 5GAEU 3TVYA 3T9ZA 2CDRB 4YR0A 3M2RB 4F3OA 1UVIA 2HAIA 1IWGA 2HW3A 2DEIA 3SZ2A 5J1PA 2P8IA 3R5GA 4FXDA 2BM1A 4PABA 3SFGA 4IKAA 3CJQA 4M5JA 3ENAA 2JFKA 4K59A 1GMVA 1R0CB 1JLBA 1C0TB 4L3NA 5AJ3J 1XK8A 1P27B 2XNRA 5GADI 1Q81T 5DDQC 2LXIA 4DV6J 2CNOB 1CQMA 2ZJQQ 1RYRA 4X62F 1YVFA 4CNYA 2BE9B 1RLDA 3IC1A 3LUYA 4P7TA 4Q5VA 2DYAA 1TL1A 5ITHA 2PO4A 3GV8B 4LFAJ 3LP2B 3C14A 3EGVA 4KPYA 5EWGA 1XNQJ 1U25A 1RKIA 1CJVB 3SV3A 4B08A 4DV7J 2KN4A 2FJVA 2UUCJ 3CO9A 4ZPCA 2X1FA 2ZBPA 1IXKA 5IWAJ 3MMAB 1HWLA 1SL1A 4LF5F 4RUAA 1ZM4A 4ILMA 2FLPA 2GVDB 1HQEA 3KG0A 4TYBA 3Q83A 2FVQA 1NHKL 4N8OA 3EDRB 3PTWA 2C3YA 5LL6d 1L3TA 2VPZB 1K44A 2W2PP 4RPFA 2H4YB 2EI5A 2CQ4A 3G8TA 3TYTA 1WJ9A 2DNKA 3OBIA 5CYQA 4PQUA 1NH8A 1NB2A 1ZTWA 5FD1A 3B8HA 1LWFA 1S72S 5ETPA 1JLFB 1K1SA 2DEJA 5HSPA 3KLVA 2M8DB 3UCGA 1KOOA 2XCPA 3UDVA 5H9EJ 2XI2A 3MFHA 1DAXA 3E51A 2E5LF 4ICLA 1HFEL 3U1LA 4QR0A 1Q8LA 2E1CA 1UFLA 1X9WA 5I42B 2IFXA 1IBLF 1JNRB 2R3VA 1N6QA 2B56A 2OP5A 2OKQA 5F0WA 4JV0A 1CVJA 2W24A 3I5AA 5EWFA 1EAYC 5HVHA 3VF0B 4OX9J 4JI7J 4PXBA 4P2SA 4OZ5A 3Q8VA 1SQGA 2BRKA 4MK7A 3AHPA 2W7PA 4G1IA 4DPTA 4DV0J 2WW8A 4PRFA 2EFNA 3U1NA 4OZ3A 3DLLQ 1NZAA 1WOSA 4R0EA 2XWYA 4ZITA 1R27B 4OYAA 3AY0A 1HI8A 1LOUA 4TNOA 2NXNA 2CWKA 3JYTA 4GRSA 3RBDA 3DDKA 3DHWC 1U0HA 2MKIA 3VTIA 2ZH1A 1N5SA 2HHXA 1BWVA 4RW6B 1RKJA 5C2GA 2QYGA 4OX7A 3MPWA 3HLUA 4NLDA 1N33F 1YIJS 2KJWA 3DYAA 1W2IA 2FJWA 3KLHA 3IGNA 4LBIA 4AFFA 2MQLA 3D6TB 4X64F 1M1KT 1NK7A 2H5EA 1Y7PA 4BC9A 1LW2B 3O44A 2JZ5A 3RG6A 1S76D 3KK1B 2XO7A 4FBTA 4Y2MA 2W9BA 3JTPA 3G6XA 4BBYA 4KO0A 3HSDA 4H54A 1IR0A 4YY3J 1F9HA 4D3GA 2FZKB 1GTEA 3FBFA 4P73A 4WYLA 2D7SA 1HYSA 3G86A 2J6TA 1U6ZA 2DNMA 2JEIA 3FK4A 4DU7A 1C0UA 2FVRA 2C2DA 2HHQA 2CXEA 1RT6A 3AD9C 2YY3A 1JLCB 3NGDA 2L9NA 2V6AA 1VLOA 1EKSA 1PC4A 1VK3A 5E41A 5KFRA 2KT5A 4K0KJ 2AZ1A 3NY0A 3IR5B 4RW9B 5GAHI 2C2ZB 4FNHA 2HQFA 3KOAA 2B51A 4KQZA 4KH0B 4WZMA 5GAEI 2LMIA 4M94A 2V0NA 2OIHA 4QYRA 2R9LA 3P5TL 1G2EA 2EBGA 2JDJA 2Q6CA 2XC9A 4CH1A 1RT4B 3VCDA 5CD4A 2JEJA 3AOAA 3IS9B 4X4NA 3I31A 2KT3A 1DTQB 1K47A 1UEUA 2PN6A 2EK1A 3HT3A 3M8YA 1C2PA 2VQFJ 5FLXY 4OHVA 3CSKA 4C48A 3P45B 1EQ0A 3IWLA 2LKZA 3QYYA 1GMWD 1U8WA 3MM6A 2YTCA 1FRHA 4DQRA 2Y0SD 5G0RB 3PKMA 4Y2CA 3KLFB 4ZLLA 1FRKA 5KFAA 1SKRA 3R97A 4GVBA 3OLAA 2G0CA 3HXMA 2NUUG 3ENWA 4CO1A 4EBDA 2KVIA 4ID5B 4YN3B 4PYAA 3OUYB 3NCQA 2QN6B 2Q3PA 4FKYA 1WSRA 2WVFA 4NXNF 4DPXA 4JYAF 1G7CB 5C2CA 2ILYA 3KNAA 4DFPA 1BMQB 4FXWA 3QMQA 2HRUA 4IRCA 4X4UA 1WC6A 4OZ2A 1V5VA 1F0XA 1RBOB 2IIHA 2PI4A 4UUXA 2MPUA 1RJJA 5HVFA 1N5YA 2GMJA 2MTLA 3M2UA 1FO1A 2AU0A 4CO4A 2A6MA 1R89A 1SCJB 1NKCA 2J9CA 1D9DA 4XAKA 2FZGB 2CVEA 3C6UA 3IR7B 1SQEA 1VFJA 1WC5A 4U9RA 4DQIA 3H2VE 1DLOA 5IM0A 4ZVFA 4LUBA 2W4CA 3ITHB 1RAOA 4ZIVA 3UD5A 7AT1B 1PBAA 1T3NA 3UDLA 3CXCR 2BOPA 1NHVA 5K14A 3DNCA 1U24A 2VG7B 1S1UA 3LPEA 4F2SA 1S49A 3KDNA 4G6VB 4CP5A 5E7OB 4LT6A 5E3AA 3HVAA 3T1YF 1RTDB 1JXVA 1VHIA 3ZTPA 2RB7A 3M1VA 3IG1A 2SXLA 4Y2AA 4CM2A 4UTGA 4OYZA 2W7OA 3GU0A 2Z56B 4BCAA 3PCOB 4HT7A 2YWHA 3AJ1A 5HQLA 4DN9A 1C4AA 1T9TA 1IKXB 2OPRA 4OZ0A 1PIEA 3QATA 5H9FJ 3CC4S 1LK5A 4WKRA 2MLXA 2YNFA 2BUNA 1G6BA 2IBOA 3KTQA 5JJBA 3H5SA 1KR4A 2ZH7A 2H5JB 1HBNA 3MDFA 3HHKA 1SXLA 3IM8A 3G6VA 2R7SA 3C6TB 1L3VA 1SC6A 3E2EA 1S97A 1V6HA 4IH6A 3W2WA 1ZH5A 1ZA1B 3NMRA 1I3OB 5EDWA 1WHVA 1QE1A 2DGXA 1MWYA 4BLGA 2DH9A 5LMNF 3TZYA 3DRPB 2GA7A 1T3OA 3D3BJ 1FE4A 1FJCA 2RJZA 4ELVA 2FHMA 4FPIA 1ICEB 4M5MA 2HVHA 1L5UA 3UE2A 4EUVA 4JI6J 1RA7A 3I55S 2I9SA 3OFGA 2XY7A 2J0XA 1K73T 4F0MA 3OR2B 4LBPA 1GMWA 3DOLA 2ZEJA 2FVSA 1UVKA 5B09A 1S9EB 3DGPA 2BW2A 4IOAQ 5L9NA 4JI1J 5CZVA 3KK2B 1NBEB 1FNMA 4JV1A 3AH6A 5A8KA 2L9WA 2ACMA 5E33A 2YH0A 4J7CA 4H4KA 4NLVA 3AD8C 4Z7YA 1Y0HA 5KG1A 1CULB 3EXCX 1HI1A 1RT1B 1X0PA 3MI7X 1S99A 1KFSA 2ZWPA 3DLKB 2GVZB 3TEGA 3NGTA 1U1LA 2OPPA 3ZTOA 1U09A 2DRAA 1JLEB 3QPIA 3CJRA 3DU6A 1RAAB 3N5BA 4DX6A 4TLRA 4UQGA 1GK8A 5F3ZA 1VRQC 2JH3A 3ENQA 4AL5A 3FQKA 1RI7A 3KG4A 5IFMA 3VR1A 2QA1A 1HNWF 4K2JA 2QIFA 1TK5A 2UXDF 4ZPAA 2Z8QA 5KFKA 1NLKL 4RBUA 2BOAA 1S1XB 2N82B 4NLXA 1Q7LB 1Q86T 1OSDA 3LOUA 3N6LA 2M5YA 2RD5C 3MEGA 1M90T 3GB0A 4IFVB 4XPEA 4ZN1A 3LA0A 4ZVHA 1RT5B 4PWDA 1E6YB 1UZDA 4N76A 1LWXA 5D4LA 1AW0A 4I2QA 2YPZA 2MJNA 2PC6A 1HI0P 3V4IB 3NAIA 1WC3A 2WK4A 3M32A 2V2KA 2DGOA 2HLTA 1FFWB 3KDOA 1DTTA 1NPKA 1YX2A 1UA0A 3I4PA 5GMDA 1KQKA 2H51B 1X4DA 1IBMF 1S1VB 1WKKA 3FFIA 3MECB 4F4XA 1UTAA 4NCGB 4RUHA 3U7JA 4JV5J 4QWAA 1Y00A 1KVIA 2Y0BB 5C42A 4WXOA 2IVYA 4EZ6A 3K5PA 2RE1A 3MAAA 4PQAA 2BJ8A 2VC1A 1UW4A 1WOPA 5I4MA 2XLKA 1N52B 5JVGQ 1NK8A 3HI9A 3ZZ0A 5E2QA 1Q78A 4TQRA 4ECQA 4EYHB 4CDIA 3OXLA 1FD8A 2MKJA 1CS4B 2UVVA 4M8LA 4KGKA 3M8SA 2C2NA 2HFSA 3TAPA 4L72B 3R5BA 2QC3A 2DR6A 2IM2A 3M8PA 9RUBA 3I96A 3KLEA 2IDEA 2DNOA 1ZM2A 3EWGA 2V8DA 1NPRA 1UWAA 3SSQA 2OHDA 3Q8SB 5IV3A 2WSEC 2KM8B 2RQCA 4FYXB 1CJUB 4ZA1A 4USWA 2G0IA 1TR0A 3M8ZA 1HBOA 3RBZA 2Y9HA 2HGLA 2EFOA 2N7CA 1P9QC 4IO9Q 4U7CA 1M0SA 2V8VA 4Q8EA 2DPIA 5KFSA 2RUSA 2F8HA 2DCLA 2CPEA 2OFHX 2I2YA
chains in the Genus database with same CATH topology
5J2MA 4CO2A 1SKSA 1JKHB 2J7WA 3S01A 3D28A 1DQ8A 3MR6A 4NLGA 3VZHA 5DJBA 4OLPA 1MROA 2ZKTA 1UAWA 3UW1A 4DQQA 1Y5NB 3I0RB 5LJ3Y 2C2EA 4KIAA 2IA6A 4QQBA 1KQFB 4ELUA 2DO0A 2OAUA 3OFFA 1F5AA 4FVCA 4NL5A 1OWXA 3UQSA 1WF1A 4K4XA 4B3TF 2CPXA 5CCMA 2GO9A 1X5SA 1NAQA 2P5VA 5DS7A 2ZUGA 2D1CA 1S1XA 3OL8A 2K2PA 1S4FA 4O3PA 3GIKA 4DX8H 3O8WA 2AQ4A 2XG8A 2CIMA 4WIIA 5HP1B 2RMLA 3L7OA 3MPVA 2HFZA 3G8QA 1XMQF 2PGCA 4K4WA 3EPIA 4DOZA 2XGQA 1KC8T 1FDAA 3UI3A 2IYIA 3FSYA 5KFGA 3ISND 4LFCF 4DF8A 3BREA 4F3MA 3UD4P 4NA1A 4NRTA 3DI6B 1R31A 2ZOGA 3WZ0A 5KFHA 1RT5A 4DSLA 4ZP6A 3MMBB 1S10A 4LSNB 1RA6A 2ADBA 3RRHA 2MZSA 3NNHA 2QA4S 1KQGB 4C7QA 2DT9A 2ZFHA 1DQAA 1ELOA 4DDFA 2E9ZA 1IKVB 3PJWA 5EUHA 4DN0A 3BO3A 1M5VC 2HGNA 5BJRA 1WD6A 1MW7A 1N0UA 5L9XA 3HHLC 1SB6A 1HHSA 3OR1A 1HPZA 1OIAA 5KG5A 4RNMA 1TZ0A 4A4JA 3HF5A 2JL9A 6FD1A 5HMXA 4WFXA 3VAIA 3LP0A 5CD4H 4YDXA 1GNKA 1VBYA 5J1EA 3V4IA 4KBIA 1QLNA 2DNZA 2AWZA 2GQ2A 1GAOA 2K1RB 2W9AA 3FZ2A 1RT3A 1TKTA 4HHJA 5KG7A 3C8YA 2WB4A 2B9XA 2IRUA 4I7FA 4CCHA 2CQ1A 4J9SA 2LA6A 1L3SA 4I1TA 1UVMA 4ZS6A 1BQMA 4OV1A 1S1VA 3MM9A 1GT8A 4X66F 5L38A 4RZRA 4I2PB 5KAKA 5HROA 4DFKA 1FA0A 1IQTA 4DUYF 3NMAA 4GO5X 4MFBA 3E8OA 4OI3A 4EO8A 2QE5A 1O51A 5I3UA 3MECA 1S1WA 4LSLB 4NCGA 2CQ2A 2LDYA 1A9NB 5AE2A 2PI5A 2LVWA 3AQPA 2HMIA 4IO1A 2OD4A 2RQMA 1ZAXA 4QR1A 5K8MA 2MMYA 2CQPA 3LANA 7FDRA 2JLFA 3HVRA 1VQ6S 2BE2B 4TYAA 2DJWA 4JI7F 4OX8A 2MKCA 1GX5A 2MQMA 1N34F 1VQOS 1VRTB 1JX4A 3UR0A 2JWNA 2OD6A 1ZBTA 5BYSA 1SUQB 1W2BR 2OH2A 4ZCLA 2YWFA 2GV1A 2VOPA 2KU7A 3JSYA 4NLTA 4DSKA 2GGPA 4HI2A 3DOKA 5L8RC 4LF9F 1ZTTA 4P6QA 1UVLA 2IVMA 3WDOA 3BS9A 4IDKB 1IJEB 4H4KC 2MGZA 3DLGB 4DR3F 1ZM9A 4KKOA 2J0SD 2VFRA 4ED5A 4CI0B 4DV2F 2ZITA 1MU2B 4K4SA 2BQRA 1N0VC 2GNKA 1PC5A 4LJMA 5B08A 4FP9A 2CPHA 1B0TA 1FXLA 1JLQB 3M05A 2AX0A 3OTEA 3FGVA 2KRBA 3PHEA 5DQHA 1U49A 1YJRA 1U26A 4LIRA 4WU3A 4C4WA 3I5BA 4B9UA 3I5CA 2CYYA 4NZ6A 1YJVA 2MZTA 3I9ZA 4OHWA 3SSSA 3CJ2A 3WBZA 2L9DA 3B4DA 4Z2XA 1AFJA 1C1CB 1LWCA 2RS2A 2J0QD 4GKJF 5K8PA 1ZAVA 1WF2A 2JLEA 3CJKB 2JX2A 2NYIA 2Y1IA 3A8EA 3NLCA 4UW2A 2VG5A 3V6HA 4C8ZA 5A6PA 2K8GA 2HNYB 1TKZA 3V4MA 1ZETA 4YFUA 1LW0B 1M5SA 3MEGB 4KR0B 1GH8A 4O3SA 1X4EA 5M2PA 3TUIC 2UUAF 1CQNA 3SQGB 3MTKA 5B0EA 4DR5F 2ZBCA 1JJHA 2XSJA 3BF4A 4HVZA 5U47A 1URRA 4YQWA 2ZHBA 2OTLS 1T03B 4C97A 2FC9A 4ES3A 1RWUA 1HBMA 3K2YA 3H98A 1OPZA 5IXUA 3RU0A 1WG1A 2OLWA 3I0SB 5M2RA 1G1XA 1BY9A 2JSXA 1TKXA 2YKNA 1D8ZA 1T02A 3PIPQ 1H3DA 3QIPA 4XPCA 1D8YA 2R8KA 1SJ3P 3N6NA 3MUTP 4OZJA 1UFWA 4EZ9A 1NK9A 3CB4A 4JV2A 1FKOA 2J7KA 3TANA 2A10A 2EFQA 3QIDA 2DRBA 1FERA 2OPQB 3RAXA 1UWBB 5BYQA 1QSLA 1CG2A 2M2BA 2R7TA 3K58A 3QZ7A 3Q2SC 5A2QY 3PFEA 4QU7A 3QGHA 3H4DA 3BGUA 1LV5A 4I6YA 4MMOA 2DVIA 4G1QA 3CEDA 1NO8A 3OFHA 3MEEB 4IG0B 5L1KA 5CXTA 2KG1A 2VBYA 3DXSX 4JBCA 3KJVB 4BDPA 1RTIB 5DG8A 2C3MA 5F8JA 3LO3A 2K3IA 2P9GA 1U1OA 2ZOMA 4F3QA 4CT9A 4ZCIA 2VBWA 4ECTA 2LXFA 2G4BA 1JKHA 3OVSA 4XIUA 3FVYA 4XO0A 3H59A 1U2RA 2XLIA 3VALA 3I0RA 3E01B 3EPGA 5IT9Y 3TRGA 3JSRA 2CQ0A 4MYTA 4A8WA 4FS2A 2VA3A 2RS8A 4OQJA 4ZCMA 4QWEA 3IXQA 5F3TA 4NLRA 3BO2A 3M6WA 3PKYA 2UUWA 4PXDA 4X4PA 2J7UA 1WI8A 4HDHA 4ZPDA 4DL4A 2HHTA 1MWZA 1VJWA 3HVTA 5GADU 4WXWA 1N5QA 1X5OA 5C42B 1A6LA 2X51A 4YR3A 4DSFA 2O3DA 1HNXF 1HWJA 3OSPA 1VQYA 3CMES 2CQGA 2J0WA 4RU2A 1VS3A 5KFEA 2XLJA 1ZYQA 1V3RA 4J9MA 5E3RA 4EEYA 4F50A 4DPOA 3DI6A 1S7HA 1T8EA 4MKYA 1VQLS 3GIMA 4O3OA 1U1MA 1FVQA 3R27A 3MMBA 2W4PA 2DITA 1HW9A 4LSNA 4USHA 4QPTA 3JAMY 1B7FA 3UDCA 3IA0A 2MZ1A 3WC0A 1KLMB 2R4FA 4KC5A 2EBEA 4C3LA 4N5SA 3CD7A 4R5PA 1IKVA 4NLYA 5A8RB 2GJIA 2DR9A 4Y3CA 2B7CB 1HWIA 3MD1A 1XTZA 2VFSA 1DZ5A 1N88A 4N41A 2JVOA 3QGIA 4QZVB 3T6BA 1YJ9S 4DS4A 2C22A 1M5HA 4F8RA 4F4KA 2DH8A 2QRRA 5A6WA 1FNXH 1RT7B 5KFCA 4OIXA 2FJAB 3BSOA 2MZQA 4NLPA 4TXSA 2CZ4A 2K1RA 3MEDB 3SMZA 4KAIA 4O4GB 3M2RA 1XR5A 1VK8A 3J7YI 2CFXA 5C25B 5DDOC 4FF2A 1X9SA 4F26A 2BXJA 4K0KF 4NYPA 3CDBA 2J9EA 3GV7B 2AGPA 4QJVA 4X4TA 3DM2B 1IKWA 1SJFA 2ZD1B 1N32F 3CDWA 2M70A 3KWMA 2LEBA 1YHQS 3MF5A 1FNOA 4WCEQ 1H98A 1Z1ZA 5F41A 4ZCKA 4I2PA 4NA3A 4TY9A 5KT7A 4K4ZA 3VQTA 3Q8PB 2BM0A 2UUBF 1KONA 4YB5A 2DHGA 2B4UA 6FDRA 3KK3B 2PMZD 3M9OB 4K4UA 2I5JB 5KFTA 2MKHA 2J76E 1YG0A 2MYFA 2H9ZA 3TAMB 2ZOFA 3NS6A 2LEAA 3VAHA 2KYXA 3C3LA 3IN5A 1NK0A 3KLIB 2FLNA 3OTDA 3HZGA 3V6DB 1IBKF 3PW2A 1GX6A 3N01A 1QJHA 4F4ZA 3CPWR 1Z2ZA 1VRTA 2DH7A 4DL0C 2RU9A 5C24B 2HG4A 2XHWA 1SUQA 4C0BA 1IQZA 4V19X 4KSEB 4WF9Q 2WOMB 3CWJA 3LF0A 3PR5B 3NL0A 3O3LA 3V6JA 1S9GB 2MXYA 3OXGA 4NA2A 2YX7A 3FDSA 1T94A 4PG7A 4PXCA 2NUHA 4B02A 2B4VA 5AXLA 3CIMA 3QGPA 3CCMS 1D0EA 4IDKA 4DQSA 1TK0A 2YWGA 3DLGA 4OJ1A 3DMJB 4C98A 5EX0A 2HS0A 2FVPA 1X4AA 1FDBA 3M8QA 5HLFB 1ZM3A 3I4HX 4IYQA 2VQFF 2YQ3A 2COLA 3TA2A 4HH0A 4Q2LA 1WNEA 2XMWA 4WE1B 4EGLA 3J7Z5 1F60B 1JLQA 1UEVA 3OSNA 1WHWA 2FHKA 3Q0AA 3SI8A 2MSSA 2XS2A 2VPWB 4XDDA 3UCUP 4PUOA 4IH5A 5KFVA 4A8XA 1YI2S 4U6PA 3DRRB 1NH7A 2CPIA 4ETZA 1UETA 4OX6A 3O5TB 2ZJPQ 2RT3A 1C1CA 1OQ6A 4IQXA 1E6VB 4ECUA 4O0IA 3MOJB 1X8DA 2VUGA 3BSCA 2VONA 2DHSA 3CJKA 4DG1B 4E8UA 1FTRA 5LT5A 3PVXA 3SCIE 1U2FA 2HNYA 1LW0A 1RP5A 4YHHF 4ECYA 1N54B 5E3PA 5B0AA 4ZLPA 2VOOA 1JLGB 2KFZA 4DL7A 1D1UA 3GIJA 3OV7A 3CVKA 2C3OA 2Z2MA 3AAWB 3QAUA 3QWPA 4DV3F 4FVMA 1T03A 1VQ9S 4NLOA 1R8HA 4IQMA 1QTMA 2LU2A 4PUOB 2YNIB 3GG0A 1LXJA 1YJWS 4JI5F 3I0SA 4DL6A 2DR5A 3SEOA 3CCZA 1S0MA 3IGVA 3WC2A 2ZDPA 1X4CA 3PNIA 4ITSA 2R7OA 1Y4ZB 3MMCB 5KFXA 2QT7A 4C0OC 4MIBA 3GR1A 4C0HA 3OR1B 1KD1T 2OPSB 2OPQA 3RW6A 1WHYA 3M30B 2PDAA 2CVIA 1UWBA 2DGUA 1T7PA 2FHJD 5KFWA 2DNHA 5BYRA 2LECA 5F9NA 4ZOSA 2CQHA 2EG2A 2RIJA 2BANB 4YEAA 4B17A 1D9FA 2E5IA 2LCWA 7FD1A 3T5LA 1R6YA 2HS3A 4B3OB 3TUZC 1QSYA 2J8AA 2E5HA 4DR6F 2MHNA 1TL3B 4CZCA 1RTHB 4J37A 4IG0A 2MQOA 1FXRA 2OO4A 5F0UA 2ADCA 4Q45A 3PJXA 3KJVA 2CG4A 1VBZA 2OFGX 1RTIA 4BHQA 3B82A 4I7FB 4OFZA 1I6JA 5K8OA 3MR2A 2I0XA 2D41A 3THVA 2AV5A 3MUVP 3DU5A 1R0AB 3MM9B 4LVNP 4C2MA 4OLOA 2DGVA 4O3RA 2VFUA 3E01A 5HROB 1DJ0A 4AL6A 3D5MA 2AYGA 2CRLA 4RNHA 5I3UB 2FGCA 1Q4RA 5MAOA 1XWLA 3CJ4A 1KS2A 3FZBA 4DR1F 4B9TA 3HFKA 4Y6IA 5KT4A 4Z37A 4WJBA 2CJQA 2B6AB 3CGIA 3QWUA 3CCES 1C1BA 5FIIA 3MGJA 2DK2A 3B4MA 3E3XA 1XR7A 3LP1B 2AD9A 2BQ3A 1SBRA 3T1HF 4DV1F 4HYKA 1QY7A 4KGMA 4QCLA 3THPA 3Q24A 3PW4A 3I82A 4IFYB 4FS1A 2DIUA 2MZJA 4DL2A 1TP7A 5HMZA 2AJ1A 1J5OA 2A1BA 1VRUB 2ILZA 3PY8A 2O5DA 2W9CA 1K1QA 3QGGA 5AJ3F 4O4RA 5AXKA 3TUJC 2XS5A 1KLMA 2IHR1 1FJ7A 1MSWD 1NKEA 4AXIA 1CPZA 3K5MA 2YKAA 2MGZB 4DFMA 1N8RT 5E3QA 3MUMP 3ISZA 2CJ9A 4DV6F 1NJZA 4USJC 2UZAA 4UY85 1F5CA 4NMLA 2DNRA 1J2VA 2AW0A 2R7XA 2DNPA 3IBWA 2YH1A 2D3ZA 3FQLA 3PW0A 1TL1B 2I8EA 1RT7A 3MFIA 1YJNS 1KTVA 4K4VA 3BR8A 4C8NA 3CD6S 3M9MB 3MEDA 1FESA 4USIA 2XSFA 2M88A 4O4GA 1Z2LA 3I87A 2VQEF 1HNIB 2KHDA 4J9QA 5KG0A 2AP6A 5F8IA 3N6MA 2EPIA 4ZP9A 1FCAA 2DNGA 2FDNA 1FKPB 2IA0A 2M8HA 3DM2A 1PILA 5T7LB 3FRYA 1QAXA 2J5AA 3HM9A 3NCPA 5K5MA 3MM8B 1H2VZ 3R1HA 2ACYA 2KYZA 4OHZA 4MIAA 3HDSA 1S79A 2XBPA 1HL6A 2VG5B 1TV6B 3BZQA 3PR4A 2ASLA 2YNGB 2RRBA 2VC0A 4LFAF 1FDDA 5LMUF 3S8SA 3K0JA 2KJVA 3V6KA 4DLGA 4O44A 2GHPA 1SJ1A 2KHCA 2M4MA 2XSJB 3OTBA 4FPRA 2I5JA 3KK3A 3KHRA 1XNQF 1XBWA 2LU1A 3NCRA 3ZZZA 5KG3A 3TAMA 4BC7A 5HQ8A 2FC8A 3MM7B 3MEKA 3IAM9 4ZPBA 2GCFA 5KFBA 3OHAA 1PGZA 2MKKA 2P6TA 2MKSA 5J2NB 4TLQA 3UNGC 3KKFA 2IM3A 4DV7F 2YKNB 1XNRF 2CPFA 5L1JA 3TNVA 2IAJB 3V6DA 2UUCF 1FJGF 3MWBA 3QIPB 1VIOA 1S6PB 5F8NA 3NWGA 4K50A 1OQ3A 3JSMB 1XEZA 4WK3A 5C24A 5IWAF 1VI7A 5THWA 5IT4A 2VKRA 2WOMA 3PX0A 2CQDA 1X4HA 3RTVA 1S9GA 1SJRA 1N48A 1WELA 2BV3A 4MAKA 2K7JA 1Q7YT 3G9CA 4NOHA 2RRNA 4I6AA 2DR8A 2KXNB 4GKKF 2XMVA 3I56S 4DSIA 2DO4A 4JI3F 5KOXA 4NXMF 2JOQA 4Y28C 1KVJA 1QVGR 3D1OA 4RWWA 1TL4A 2K3KA 3K57A 1QM9A 2CQIA 1VOMA 3MR5A 1RT2B 2FGOA 3BN4A 4WU2A 1B0PA 3CJ5A 2R7UA 2YKQA 4HL9A 4WK1A 2KM8C 1N36F 4LF7F 3CUNA 3D1HA 5D3GB 4DR4F 5GVQA 2KFYA 1A7GE 3D0IE 3CMAS 5DGBA 3C66A 4RX6A 2R2UA 3PM9A 4XDCA 4CIOA 4DBQA 3EUNA 4WE1A 1O0PA 4RW6A 4ED8A