1KR4A

Structure genomics, protein tm1056, cuta
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
b'ALYFMGHMILVYSTFPNEEKALEIGRKLLEKRLIACFNAFEIRSGYWWKGEIVQDKEWAAIFKTTEEKEKELYEELRKLHPYETPAIFTLKVENILTEYMNWLRESVLGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein TM1056, cutA
publication title X-ray crystal structure of CutA from Thermotoga maritima at 1.4 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
total genus 25
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kr4A00
4Y6IA 2J9EA 3NCRA 4IYQA 2GX8A 5D4NA 4NYOA 5DRKA 1V3SA 2VD3A 3L7PA 2RD5C 1P1LA 3T9ZA 3DFEA 2XULA 1Q1KA 3LF0A 1H3DA 4RLEA 4USIA 3TA1A 1VHFA 2CZ4A 3X3UA 2O66A 2ZFHA 3O5TB 1HWUA 4CO0A 1V9OA 5D4LA 2DCLA 2GW8A 4YB6A 1NZAA 3GSDA 4WK3A 2J9DE 4YB7A 4C3LA 4CNZA 4OZLA 2JJ4D 2PIIA 4RX6A 2EG2A 1NH7A 1PILA 1VFJA 1XK8A 1KR4A 4NYPA 3AA9A 1UL3A 2GNKA 1J2VA 4C3KA 3HLUA 1OSCA 4USHA 1NAQA 2V5HG 4CO4A 4CO2A 4CO5A 2O67A 4WK1A 4RWWA 2XZWA 3M05A 1QY7A 1UFLA 2NS1B 1UKUA 3AA8A 5D4OA 3TA2A 1V6HA 2J9CA 4YB5A 4RWXA 5D4PA 1GNKA 3CE8A 3O8WA 2XG8A 2Z0GA 2NUUG 4ZK7M 1UMJA 4AFFA 1O5JA 5DS7A 4E98A 4CO3A 3TA0A 2XBPA 4CO1A 2NUHA 1O51A 3NCQA 2ZOMA 1NH8A 3N5BA 2EG1A 4CNYA 3NCPA 4D3HA 3AHPA 2E66A 2J9DA 3AH6A 3OPKA 4D3GA 1V3RA 4C3MA 4USJC 4Y65A 3MHYA 3BZQA 4R25A 5L9NA 4OZNA 4OZJA
chains in the Genus database with same CATH superfamily
1X8DA 4IFVB 3VGTA 2VBWA 1T03B 3AB2B 3CJKA 1HHQA 1U0HA 2V8DA 5GMEA 3UN5A 1TFWA 1RTIB 2Q1LA 5LMNF 3CW2C 2IA0A 1N0UA 1YJ7A 3NGTA 2ILYA 4QYZK 1N52B 1J5OA 3MCMA 3C6TA 4B3OA 4AL7A 3CJQA 3OL7A 2VUGA 5E3RA 3R5DA 4FYWB 3H7HB 2HRUA 2V4JA 1W2IA 3ILIA 2ZVSA 1QUVA 1L3VA 1FNXH 2HSEB 1N33J 2A18A 3M32A 4C0BA 3I31A 2V2QA 4UOHA 3J7A1 4DV1J 2I8EA 1T02A 3RB0A 1UMJA 4DX8H 2AJ4A 1BWVA 3NOCA 4M5IA 3Q89A 4XK8C 4LRDA 2MKIA 2C2RA 2EKNA 2GO9A 2HNDB 2M3DA 3N5BA 3DRRB 1WF2A 2A2CA 4WU3A 5I3UA 3AODA 3LP1A 3HSGA 5DQIA 1FK9B 3HCXA 1QE1B 5J2NB 3QO9B 2DXEA 3EZ5A 1X60A 4B3TF 3ZZYA 4CT8A 3QWPA 2WVCA 3MMAB 5A8KB 1ZPVA 1R7IA 2WZ1A 4F4YA 2DNQA 1U1NA 5EUHA 5DDQC 5IT0A 5C25A 2WSCC 3GV8B 2FHOB 3ZC4A 3KHGA 1U47A 4DQRA 4NCGA 1WG1A 1MLAA 7FD1A 5ETTA 1RT3A 3OT9A 3C46A 2P5VA 4R0JA 4AQYJ 5DDPC 4U67Q 1KP6A 3DU6A 5B0EA 4ES1A 5B0FA 5I3PA 1R27B 2HMIB 1HNIA 2KYXA 3KDOA 3T9NA 2JZ5A 5LJ5Y 2B6AA 1OPZA 4JOUA 1SH0A 3G71S 5M2UA 1UVIA 2RH3A 4OYAA 3PJ9A 3EVOA 1Y5LB 4Q8FA 1R43A 1SIWB 3HSDA 2AX0A 2D1CA 4DCOB 5KFNA 1S0OA 2KT3A 3FQKA 4IYQA 3I4PA 1VGYA 3IG1A 2R7SA 3BB5A 4NOHA 3K58A 3K5LA 5L39A 2HW3A 3CJTA 1URNA 3KLEA 2DGQA 3DLEA 2AGPA 1SVDA 4ZP6A 3CO9A 3JTOA 4P75A 4GKKJ 3KLGB 4WFYA 4OYZA 5L1IA 3OSNA 4WK3A 5KG3A 2JX2A 3RAXA 1NK9A 2JJ4D 2UVRA 1PC4A 4NLVA 4WYWA 1XK8A 1RGVA 2IC3B 4PWDA 4RZRA 3R5GA 2MQPA 1KLMB 1XBWA 2FUG9 3ILOA 2QYCA 1X4GA 1AFIA 4ECXA 1F3VA 3LPYA 2C42A 3LP2A 1H7XA 2BBEA 1R8BA 3CD5A 1SL0A 1VIXA 3AXKA 1HR0J 1IWGA 1UFWA 4ZPDA 1RAHB 2HGLA 3BN7A 2XO6A 4DR6J 1V3SA 2C3PA 1S6OA 4CH7A 2KRBA 1U6ZA 5KAKA 2W7PA 2IAJA 4FP9A 3EXCX 3M8PA 2UUAF 2XYHB 1TUVA 4DHVA 3GFXA 1K8AT 5MAOA 4A8QA 2HEKA 1M90T 2B4OA 4DV3F 2DR6A 3DOMB 3TUIC 2DXDA 2UXCJ 2MPUA 4DR7J 2C2DA 1N34F 2HRYA 3AT1B 1S9FA 2G1HA 4RNNA 5A2QU 1NZ8A 4TY9A 2JHEA 4HT7A 4G6VB 2JVRA 1V3ZA 3HFKA 1IJFB 4F3QA 4CYUA 2JEJA 3TAMA 2K7JA 2HK3A 1SB6A 3J80Y 2Z58B 1S0VA 4X65F 1BQNA 3OQ2A 3C15A 4DPWA 1UFKA 1WACA 2EKYA 1ZYQA 4D3GA 1SH3A 3W2VA 1KTVA 3LA0A 4B9UA 2UUTA 3O1LA 3ZZZA 2IBOA 3MURP 3WBZA 2CQCA 3PX6A 4RW9A 3FEZA 3EZUA 5K9FA 2DKOB 3CSKA 1G3OA 2V50A 1E6YA 1BGXT 2RF2B 2XI3A 1W7WA 2EK6A 5E3PA 4O4RA 2VFSA 2WK4A 4HI1A 2FC8A 4ZPVR 4EZ9A 1NJZA 4L75A 4NLSA 3FCVA 1UAWA 5IT4A 1H2UX 3RBDA 1IR2A 2G1DA 2GHPA 4U7UD 3ZXWA 1VQOS 1WKLA 2GNKA 4CM2A 3KMQA 2ZD1B 1VC5A 1T8EA 5I42B 1F2GA 4OJ3A 1TKTA 2E5HA 1TL3A 4DJBA 1NXIA 3ETOA 3EJMA 4PG4A 4IG0A 4LREA 2CADA 5DDRC 2HURA 3QQCD 1B0PA 1NDCA 1RBOB 3WDOA 4FKXA 3EYZA 4HACA 2HVEA 4R5PA 1M1KT 3DLGA 3I5AA 3H90A 4LSZB 5L46A 2DPIA 4J9VA 3R1HA 4RUBA 5B09A 2YKAA 1RBAA 2ZBIA 5CD4A 1TK0A 1RT6A 1H72C 1L3UA 3KJQB 3R97A 3G6YA 4ED7A 5H9FK 1EAYC 1GTHA 4L76A 3EXYA 3KK2A 2AJ2A 3PO5A 2BXJA 3FUYA 1JLBB 2RILA 4ZVEA 3BH6B 1MU2A 1J27A 2JRSA 4BC9A 2A0FB 1X4AA 5DG9A 1NH7A 2ZBRA 4Y2CA 2AQ4A 4LFCF 4H4KC 3D28A 1N36F 2OEJA 3BBBA 1NK4A 1CULA 2KFZA 2Z8QA 5HBMB 5AXKA 3CC4S 1ZM4A 4HHHA 1S6QB 3HHNB 1DBDA 2HGNA 1MWQA 4PXBA 4JI0J 4ETXA 4HI2A 1RHQB 3N5FA 3PZPA 2X7IA 4KT0C 2M8DB 1DZ5A 4F2RA 1WC0A 2FJVA 2F8HA 2EXUA 1B99A 1XMQJ 2PMHA 1DQ8A 1S9GA 2FGOA 2N4CA 5CYQA 1TL3B 2W2PP 4J91A 2KB2A 3O2IA 3VGVA 2XYGB 1WELA 1I3OB 4G1QA 1HKAA 4J9SA 2G0JA 4UTGA 2CQDA 2YNIB 4PXCA 2IFXA 3V81A 1U1LA 1VBYA 3M1VB 5FLXU 4CLFA 3BYRA 1VIOA 3G8SA 1WSVA 1S77D 1GMWD 4PPDA 4FYDA 4IDKB 2H4YB 3UDLA 3KG0A 3A3PB 4NX9A 3DRXA 4DZ6A 4IOCQ 2BJ3A 5CCLA 4KYZA 4PG5A 5GAHU 4ED3A 3GG0A 1K44A 5LOQA 3DLKA 3DRPA 4DN9A 5DZ7A 3GIKA 4OLOA 5K8OA 1Q7LB 3DRYA 4DL3A 3KHRA 1WOOA 2XO7A 4OV6A 5A0YA 2OPRB 2KKHA 2YXLA 4F04B 2VJUA 1R31A 2RQCA 5HJYA 2J9EA 2YNHB 4I69A 2GS8A 1CC8A 5IC4B 3P5BP 2BABA 1LWEB 1GFWB 2ATCB 4UOCA 1GXTA 5JJBA 2JWNA 1RWUA 2CPYA 2HHQA 1T9WA 2GHVC 2MXYA 5KFTA 3QFHA 3MM8A 5GADI 2V9KA 1GK8A 3S1TA 2ZOGA 1T94A 4P52A 2Y0BB 2C3YA 1FE4A 5KG6A 3SQOP 5D6GA 3GFYA 3FJ2A 4OIXA 4KPYA 1FKAF 3QLHB 3VZHA 4P2SA 2ZWPA 5DJBA 2C2OB 3L9ZA 3PYEA 1O6XA 2JC0A 1E6VB 4F4WA 1ZAXA 3KLFA 4RW6A 2KHDA 1SQGA 4DLGA 2ZKTA 5H9EJ 2HHWA 3KG1A 3KJVA 1S12A 3DYAA 1Q81T 2XY6A 1OY6A 4U8VA 1SKRA 2DH8A 2XCPA 2BKNA 1HBOA 2AT1B 3GPAA 2L48A 4MKBA 1JLEB 2W4CA 3MMJA 1YSJA 4TN2A 2QFJA 3K59A 2CIMA 2D74B 3NG8A 4WFXA 4A4JA 3H42A 5CYMA 1NPRA 2G4BA 3GMGA 1PIEA 2F63A 1V9OA 1U25A 3UN3A 3MPVA 5HROB 3TX8A 4K2JA 2FJAB 2J0SD 2VDHA 2F5GA 5IOLA 1HNVA 1D9FA 1RT5B 1ULRA 5HMWA 2OGUA 1NJIT 2UXDF 3S6EA 2W2QP 4QWBA 3J7Z5 4EFAC 2L41A 4JV2A 3PX0A 1L3TA 2ZH3A 3H2UB 5GMKa 2DGOA 1WEXA 5J2QA 3A3NB 2ZHBA 4OZ1A 1WUUA 3P4UB 2IIHA 3DRSA 4EGLA 1ZZNA 2XBPA 1NSKL 3OTEA 3IXQA 4MFBA 2ZH2A 2HQFA 3MAQA 4EBCA 3A1YG 3TW0A 3IO1A 2HS0A 4L3KA 3GR1A 1WOPA 5DO2A 1WSRA 3L7OA 2IM0A 2DIVA 3W2WB 4RW6B 4X64F 1JLQB 2ZKUA 3KXDA 4F3MA 3T1HF 4F7VA 4M8LA 3CEDA 2GAGC 4QWEA 3MI7X 4JV0A 1IWAA 2FVQA 1HWUA 2IYGA 2R4FA 3SDEA 4ETZA 3PRBA 2F4VF 3UVJA 3GSDA 2EW9A 5KFJA 2BOAA 2M4MA 5T7LB 1C1CA 5HLFA 3VGUA 4CT9A 1IKWB 3E8OA 3NS7B 2ZUGA 2I9SA 1Y3KA 3ET6B 4KKOB 1FWKA 1QJHA 1RUSA 2RQ4A 5D4OA 1IKXA 1JJCB 3QIPB 2ROGA 5DGBA 4DV4F 4JI6F 3Q8QB 4I68A 1S1XB 1FDBA 4NPOA 3CJ5A 5KFKA 4QWDA 5HMXA 4ECQA 2GQCA 1JLCA 5KFCA 3L09A 3BKFA 1T95A 4B3MF 2HQ3A 1GQEA 3MCSA 2D9PA 3RR7A 2AF6A 4CLTA 1BE4A 3K5OA 2HQGA 5AJ3J 2Q79A 1VBZA 2ZNZA 4LSLB 1IM4A 2FZGB 4GKJF 3HXMA 1CJVA 4KGVB 3ZTQA 1YBUA 1VLYA 2VBYA 3PJWA 1Y10A 4RNOA 1RTHA 3IAM9 2ZJQQ 4DQQA 3WZ0A 2G2OA 3SFGA 3KLVA 4I6YA 2W9CB 2KH9A 2W7AA 5CH7B 1RQ0A 4ELUA 4WK1A 4RWWA 3AB4B 3J7YI 2M0GB 3MEDB 4FF2A 1NM2A 1SQEA 1S49A 2E5JA 2C3UA 1JB0C 2RAQA 4P73A 2HGMA 4H4KA 4IUFA 3I5BA 5ETKA 4CH1A 5L9XA 1RT1A 4H4OB 2MKJA 2EFVA 1WD6A 1KD1T 2DR7A 1FJGJ 1IKXB 4ELTA 3KOAA 4DR5F 4ALZA 2N4DA 2NR0A 3MR6A 1IVZA 2QLXA 2KVIA 4JV5F 4CTAB 2BOPA 4KHRA 3FFIA 4CLKA 2M88A 2DR8A 2V6AA 4EWTA 1VQ7S 5B0CA 3BJYA 1NSPA 1N48A 3E2EA 2OO4A 2OTJS 3UR0A 5ETVA 3GP9A 1SJFA 1OQ3A 4DV5J 3U1LA 1RTJA 1BY9A 1C0TB 1S5ZA 5CA5A 4MYUA 3FSXA 2Z56B 5AE2A 1F5BA 3ISNC 4HTIA 4NYPA 4RBVA 2IJRA 4KRWA 1YBAA 5F8JA 4ZIVA 2X3DA 2DT9A 1MROB 2AEJA 2HHHJ 3U7JA 2RDIA 1N5SA 3JSBA 2DR5A 1X5SA 3LOUA 3M8SA 2CPXA 2BKOA 4M63A 4U7CA 3NNAA 1VRUB 1U1OA 3FSIA 3M2RA 2PO4A 1HNZF 4LF6F 1Z2LA 2WVEA 2Z2YB 2UXBF 2OPQA 1U2FA 3U27A 3M6XA 2PI5A 1UVNA 3KFWX 2ZDOA 1XMOF 1AA1B 2GMHA 4PEOA 3RB3A 4WJBA 5IQQA 4A8XA 3NGDA 1HYSB 3SZ2A 2DTJA 1EETB 3HKWA 1H38A 5FDLA 2RKIA 4DR4F 4A8FA 5KOXA 1CG2A 4A47A 4PWUA 2DHXA 4M5LA 1IQZA 1VQ6S 3D3BJ 2YWHA 2PC6A 2HHXA 3RZAA 3IBFB 1FXDA 3CC2S 2MY8A 1F1BB 2IMWP 3OFFA 1UFLA 3PDNA 4DPTA 2Y3YA 1KN6A 3LW5C 1FEEA 3V6HA 4K4XA 1JQGA 3H5XA 1TV6A 4WBFA 2UUBJ 4FYYB 3DLHA 3KLIA 1R6YA 4EYHB 5F0WA 1HBNB 3A8IA 5L9NA 2RVJA 2OFHX 4DV2F 1I1GA 1UVMA 4F25A 4S0MA 3CMQA 3H40A 1KLNA 1WC6A 2GJIA 3P8BB 1YRXA 2AWZA 3T9ZA 3N01A 1RBLA 1M1HA 3W5XA 2O66A 3JQKA 3RRHA 2HWHA 3PEJA 4LRBA 3IS9A 4ZVOB 2MSTA 2CJBA 3W65A 1U26A 3CD7A 3DDKA 2FB0A 1TL7A 3QZ7A 5F41A 1T3OA 2ALZA 5K14A 1C1BA 4X62J 4XTTA 3GFHA 1YQHA 2HNZB 2Q6CA 4Y28C 1LW2A 3BV8A 1LK7A 2YQ0A 3ETMA 2ILZA 5HATA 3V4IA 4F4ZA 2V8GA 3W1YC 3MEGB 2QL7B 1DQ9A 3BREA 4C8OA 3NOGA 2A6OA 3HDSA 5D3GB 4LR8A 2QG9B 2PEBA 1IKYA 2JNJA 2KN4A 5KFFA 2I1RA 1RWPB 4ZCLA 3PY8A 3PRDA 1XQIA 5FLXY 4ZHRA 3THTA 3X3UA 3FBBA 2GVDA 4OFZA 3FCHA 4PYAA 2W9BB 4A8SA 2PT0A 3MEKA 1TQLA 2DHAA 2JFKA 2LDYA 5D0HA 2ALYB 2R7OA 3HHLC 2XB2D 4DR3J 2LXUA 3CGIA 5HP1B 1MNEA 2ZHOA 5ETQA 1VRTA 1KSPA 1UWBA 1TL7B 1OYDA 3MFHA 1NO8A 3QAUA 4L3NA 4MJKA 5LMUJ 3A4TA 3KK3A 2KM8B 3D0IE 4OYPA 4LIRA 3HHDA 1WTBA 1S48A 2WRMA 2BJ1A 1N33F 2PE8A 3DGPA 4FF4A 4DV1F 1NUEA 1X5PA 3L3CA 4ZVFA 1XR7A 3D6TB 1Z1ZA 1KFDA 3QNWB 4EYIB 3O6QA 4OYXA 2LECA 3ULHA 3HKZD 2W9AA 2ZH4A 3TEGA 2E44A 2RNEA 2K7KA 5E3CA 4Q2LA 2VHGA 2YKNB 1HWLA 2E1AA 4K4VA 3L7UA 2BR0A 4CM0A 4ED2A 2IDEA 4DDFA 1LW0B 1TKXA 3OVBA 3M8WA 2F8EX 5GAGU 4OHWA 2C28A 1QY7A 4IFYA 2DNPA 4OZ5A 5I3QA 3BBCA 1REVA 4HYKA 4LFBJ 1RACB 4JI5J 3VAJA 2M5YA 3M2VA 2VFRA 4AQYF 4F0MA 4C8MA 4OHVA 5E3QA 2RRAA 1FJCA 1B0VA 4JBCA 1S4FA 4AXIA 3ENAA 3FRZA 4HH0A 5AXNA 2B8PA 1WC5A 1CBKA 3BM7A 4Q45A 3TUZC 2VB6A 4KJIA 4Y3CA 4ED4A 2Y8YA 3TNVA 2D41A 1T05A 5EHHA 4V19X 2R3VA 2IY5B 2CQIA 4UUWA 1QSLA 3LAKA 3DGPB 4ICLB 4FVCA 3G82A 4XIUA 1CJTA 3DHXA 4XDDA 4LF9F 3IC1A 2P9CA 4KV8B 3DM2A 5JVGQ 5IZHA 1FCAA 4J9OA 5EDWA 1FDNA 5HK4A 3HHEA 1YRTA 3SI8A 2AIRB 3LTOA 2ATLA 4EU0A 1HBMA 2OLWA 4GKKF 1L3KA 1RU2A 3OUYA 1KOOA 4U96A 3EUNA 3TAQA 2Z2LA 3CWJA 1N5YA 3KG4A 1EP4B 1SBRA 2O1PA 1BQXA 4RUHA 5IV4A 4OHXA 3Q8PB 1Q8LA 4UZCA 5D4NA 1QAYA 1LK5A 3ZZTA 2DNYA 4F50A 3QAEA 3HVTA 4YHHJ 2UUCJ 1LFPA 2BZ2A 5A8WB 1S4EA 4K4TA 4I2PB 2XNQA 1KEKA 1M5VC 4JP8A 2OPPB 1HR0F 2FDNA 2KT5A 2CDQA 2F4FA 5J2PA 1KVIA 2OPSA 3NKYA 1X0FA 4Q44A 4I6WA 2AJQA 2FVSA 4CWBA 2QA1A 5T14A 4CH0S 2GVZB 2KHCA 4WPAA 1RT4B 4PQUA 4FNIA 1DJ0A 4IH7A 2CG4A 2E7WA 2NXCA 3I9V9 2M8HA 2OHDA 3UCUP 4YB1P 2HFVA 2MJUA 4ECTA 1Q5VA 2UXCF 1VYAA 2DIUA 4DR7F 1QVGR 3OTBA 2DPJA 1S1UB 3SCIE 1RWMB 3BSCA 4KO0B 5HMZA 2VPYB 4ZPWR 3MAAB 5F3TA 5HQMA 5DDOC 3IR7B 4HL9A 3GFZA 1T0TV 2QV6A 2YNGB 4DV0J 5D78A 4LVOP 5KT7A 4DG1B 2FHJA 2MEWA 3JSMA 4O4GA 1VHFA 3BGUA 1OY9A 3M6VA 3DMJB 3TI0A 2VC0A 3HX9A 3TZWA 1S10A 3M7VA 2HVHA 2DNGA 1M5OC 5DQHA 1SJ4P 1HIYA 3Q0AA 4AD6A 4IH6A 2E1MC 2VOPA 4FDFA 5KG7A 1HWIA 2N3LA 1IXKA 2FHKA 2YWFA 2GIRA 3A8EA 2HAIA 2AJFE 4GVBB 2KDOA 4N76A 2OEMA 4Y34A 1N6QB 4HH1A 3SEOA 2AP6A 5GAEI 1SL2A 3K57A 4F67A 5J2MB 4AXJA 1TL1A 4TU7A 4NLYA 5BYSA 4YFUA 2HZCA 3GLJA 1NJWA 3NGUA 2Y8WA 1WKKA 3GYXB 1N32F 2Y0SD 1W26A 3FSYA 2VFTA 3MMBA 1EZZB 1OY8A 3IRXB 3H5SA 4F4XA 3C6UB 4FPRA 4K4ZA 2R8HA 5FJ4A 3AOBA 4IR9A 1FRJA 5KT2A 3CB4A 2QJ3A 3TZXA 2B4PA 2A2DA 2PMWA 4LVNP 4JI1F 2KZZA 2FLPA 2XC9A 1TP7A 1TUWA 1TFYA 1C0UB 2ZZMA 4J9MA 3DOKB 1LKZA 2DR9A 1FFGB 1U48A 3GQCA 2B7BB 1BLUA 4ZJOA 4DR1J 1GH8A 2MZQA 2GA7A 2GGPB 2PIIA 4LQ9A 1R0CB 4ZVSB 5EWFA 1ZAWA 2YPZA 4USHA 2AZ1A 4CO5A 1RAOA 3AA8A 3IBWA 3FMWA 2R2SA 4AT1B 3E01B 4ID5B 5G0RA 5C24A 4N56A 2VQEJ 3QGGA 2VOOA 5SZTA 2IRYA 2LKZA 3HHLA 1O51A 4N47A 3SCKE 3IWLA 2AJ1A 1V3RA 4IRDA 2HNYA 2Y1RI 4IOBA 3NNHA 4ES3A 4M5GA 3MCNA 5B0DA 1KDNA 3KK1B 3GIJA 4JYAJ 5KG0A 3NXZA 3ZTRA 1LWFB 2DO0A 4N77A 4KFBA 4MIWA 3CNQP 4JI0F 3GJQB 3R3TA 4IRCA 4LJMA 4LR9A 1FTCA 1XTZA 3LP0A 2POKA 5B08A 3KKFA 2OFGX 1VI7A 5A8RB 3BSNA 1HQEB 4P74A 1SC4B 1S57A 3MR7A 2CJQA 5J1EB 1P9YA 4P2XA 3U1MA 2RIJA 3K17A 1YHQS 4O3OA 3ITHA 2VODA 1Y5NB 2NYIA 4AL6A 2DGTA 1DTTA 1J5EJ 2VKZG 3TJ9A 3FEYB 1X9MA 4OHYA 4G65A 4TY8A 2MTLA 3EICA 4WTOB 2C2EA 2QN6B 2XMTA 4OX6A 3EM1A 4DQSA 1VQLS 2AMCB 4OZNA 1NDPA 1TK5A 1RAJA 5L1JA 1WOSA 3HHLB 1AROP 1UEUA 1EX8A 1GMVA 4LUBA 3OLAA 3G4SS 4ZPCA 3PW4A 4ZJQA 1H74A 2E7XA 1IUJA 4LF8F 3UO0A 5JVHQ 3H5UA 4X64J 2DNHA 4YB7A 4L74A 5EWGA 3R27A 5LM7E 4XO0A 3SBMA 5IT9U 2B56A 2LU2A 2CZ9A 4C3KA 3K0JA 2W24A 3KLHA 2DHGA 2H51B 1RCOB 4EK2A 3G86A 2EFNA 1R0AA 1UZHA 1DHMA 3GR0A 1SJRA 5DM6Q 8ATCB 1JXVA 3AOCA 4I56A 3GZ7A 5KOWA 2HBQB 5KG2A 4TKTA 1GEHA 1QSSA 2NYHA 1Y11A 1RP5A 4LSNB 4ZP9A 4PCQA 1RWOB 2XGPA 1W25A 1TVRB 4Y65A 2B5JB 5EX0A 4ZCIA 3T1AA 3PEHA 4LF5F 2CWKA 2P6TA 1JJ2R 4OX8A 1U02A 4YY3J 4JI6J 4ZVGA 1Q79A 1YWXA 4P6QA 3HM9A 4A48A 1FA0A 2ZM6J 3QMQA 5KG4A 2HPUA 4KQZA 1EIYB 2VL1A 5CXTA 3I9ZA 1F9HA 3V6KA 4ZN1A 5M2PA 4JB8B 2IJFA 1WDTA 1G2EA 1S1WA 4NI2A 2CVEA 4O3RA 3FEXB 4DL2A 4EZ6A 4JI7F 3F41A 3QRQA 4FBTA 2WONB 3GIIA 1GX5A 4QIWD 4ZPBA 2P9GA 4DFPA 3RRKA 2O5DA 2CWXA 2KZMA 1FDAA 2WCXA 3RAQA 3CDUA 2EFGA 2EG1A 1SJ3P 4P2MA 1OMSA 3ISND 4K5SA 5J1NA 2QC3A 1VHIA 4PR6A 3C19A 2DHHA 1G7CB 2F1FA 3PRVA 3R5AA 1IKVB 1BHNA 1P9QC 1UVJA 3R6GB 4WIIA 3HPOA 1AB8A 2BVZA 8AT1B 5BYQA 1D3WA 4OZ0A 4WFZA 4JV5J 3TO8A 4ZA1A 4MT1A 3IBCB 2DRDA 2GMLA 5C5JA 2DH9A 4WP3A 3IM8A 4FPIA 1PYOB 1ROFA 3MWBA 5KFRA 5RUBA 4LIWA 2M7SA 2FLOA 2VDIA 2X3GA 3ZFVA 1KWMA 1W2BR 2DB1A 4QOTA 5KFOA 2D3OR 2CJYB 3CMAS 4Q0BB 4I67A 4DPOA 1A7GE 4YMEA 2J9DA 3W61A 3B4MA 4FS2A 3ZTSA 4GC7A 3W63A 1SJ1A 2FPHX 1P8GA 2ACYA 4LFAJ 2KXHA 3OFEA 2V8VA 4ZVTB 3C8YA 2BANA 2IYIA 2HWTA 3T41A 4H4MB 4W90B 4W92B 2HLTA 5CHCB 2ZDPA 4WE1B 3N0VA 2MKSA 1DARA 2FHJD 2Q66A 3F73A 3MPYA 1SUQB 4U95A 3I87A 4NA1A 5AJ3F 2JEIA 1LNQA 4CO4A 1XMOJ 3MECB 3PTWA 4A8YA 4F3OA 4I7FA 4HTJA 4OL8A 1FERA 4M5DA 1F0XA 4Z7CA 1HPZA 2W1BA 2LEAA 5LSRA 1T11A 2MKHA 1NKEA 4YDDB 5L38A 3HZEA 3GIMA 1U6FA 3EVMA 3D5MA 1UJ4A 2ZZTA 2J0WA 4C11A 1RAGB 4Q5VA 2UP1A 2XMMA 3FDSA 1D09B 5IWAF 4MKAA 1JLAA 2HIYA 3CPWR 2JL9A 2RD5C 3PV8A 4L73A 2KFYA 3NS5A 3ZNJ1 2BRLA 2PN6A 2NPFA 1VC6A 1FJGF 3JYTA 1FDDA 3TZYA 2C2KB 5KFGA 1F5AA 2D3UA 2EFOA 1HQUA 3BF4A 1FD8A 3I32A 2QA4G 4OQJA 1NLKL 1CS4A 3WC2A 4IOAQ 3J81U 1NPKA 1U2CA 5GAHI 5LXYA 4NLXA 4MH8A 4J37A 5JUMA 4X4VA 2JSXA 2YKMA 2BJ9A 5HL7Q 1S1TB 1FVQA 2RT3A 4X4SA 2RUSA 1NSAA 4WKYA 5L8RC 1Q8KA 1CJUB 5C42B 2XLIA 3OL8A 3GU0A 2RRNA 4DV5F 5HQLA 4JI8J 3WC0A 2FJBB 4A8WA 4MTPA 3ILJA 2Y1LB 4G1PA 4MKVA 1K73T 1XWLA 3FBCA 5DETA 3HHLD 4KR0B 4CDIA 2HHHF 1HBUA 1NKBA 2VA2A 3FZ2A 2N7CA 3CCSS 1PJ7A 4ATNA 2BM0A 4C8NA 2YQ3A 1HW8A 1RT7A 1R8CA 1TU0B 5F3ZA 3VAFA 2HAFA 1UVLA 3M4XA 2GCFA 1T9UA 5D4LA 4URQU 4X66J 3BO2A 3M6WA 1T9TA 2KTQA 1HARA 3MZIA 2KFNA 1Y3JA 1HWKA 4F26A 1RAIB 2YNFB 2DEJA 1B64A 3ONQA 3I0RA 2L9WA 4JI4J 4CQ1A 3MGJA 4RUAA 4RW7B 2G2YA 2JEGA 4Z37A 3HJFA 2GJ2A 1REGX 1JK9B 4RW8B 2DD8S 5F9NA 4OZ2A 4M5MA 2XG8A 1HI1A 3AQPA 3G8TA 4KSEB 3O3LA 1RZMA 1AW0A 3CDAA 1UP1A 2CAJA 1RE1B 1ZZFA 2X1FA 2ZH8A 4C8LA 2NUHA 1MWZA 4OYIA 1PKUA 5C2GA 3GCWP 3CDWA 2UUWA 1JLFB 1APSA 1ZOTA 4IKAA 3MR2A 5DLGA 3Q86A 2IHR1 4J9NA 4DUZJ 1D9DA 1KFSA 4WU2A 4C0HA 3MPWA 2VD3A 4DSJA 2P8IA 5JXSA 5CZVA 4OZ3A 1S1VA 1T9YA 5F0UA 2UUBF 4KGKA 1Q1KA 3Q24A 4ED5A 3MM6B 3J7ZT 1VQPS 4MKYA 1NKCA 2JLGA 2FTRA 1RHKB 3V4MA 4RW4B 2QT7A 1YJRA 3DI6B 3VAGA 4WZMA 4LBIA 4G1IA 2VG7A 4NCAA 3UNYA 3MXHP 1LWCA 3MM7B 4Y2KA 4YUDA 2H3EB 1ZETA 3EPGA 2RJZA 2WOMB 5KFWA 2CNNB 2ACMA 1OPIA 3VQTA 3UDCA 2C1EB 4CCHA 2V2ZA 3K2YA 2HQDA 5EN1A 3GJTB 2V0NA 1S6PB 2YWGA 1R3NA 2E1CA 1R0BG 1FRLA 2B51A 2ZOMA 4J9KA 4CNYA 4C6AA 4X62F 3BPDA 2W4PA 3T5LA 1DAXA 1HW9A 1TKZA 2AU0A 1TKDA 4OMFG 3SCLE 2WVBA 2CPDA 3CJKB 1U0HB 3THVA 4JV1A 4KBIA 4AE5A 2R7WA 4ECVA 3JAMU 1FRHA 1SPBP 1K0VA 2WBMA 1R8PA 1C2PA 2CJKA 4P9SA 1PCAA 4RU2A 2KXNB 1MWYA 4OJGA 2DITA 1L3SA 2VF3A 4KE5A 4DQIA 2YWKA 1J5OB 3SXLA 3C6TB 3FBFA 3D1OA 4B3OB 5KFQA 2DK2A 4UQGA 4B08A 2V4JB 3OVSA 1FKOA 4F0KA 1PYTA 4FBUA 3D3CJ 1NB2A 2R8GA 2YKQA 2J76E 1D8ZA 1V6HA 3M32B 2RUGA 1FFWB 2JH3A 1A6LA 1BWEA 3CCUS 1X31C 4LF9J 3TEHB 2AJ0A 1ZM3A 1CJKA 2RS2A 2XLKA 4PAAA 1XC9A 1TUGB 3HULA 4D3HA 5I3UB 5J1PA 3EMTA 2MZSA 1VBXA 3LP1B 4QR0A 5F8GA 4DR3F 3THPA 1KQGB 4O44A 1VMBA 2QLWA 3KNGA 1KRPA 2FQQB 1H2TZ 2R7QA 2G13A 1U1KA 1Q53A 3J7YU 1YJ9S 3IGVA 3NS6A 5LMUF 3H20A 2CZ4A 4QBUA 3AY0A 5C25B 4ED0A 5IT9Y 1SQFA 2CQ1A 1PAEX 3JTNA 4F4AA 4NCGB 1VLOA 2HKEA 4C8YA 4BWJA 2B9WA 2WVFA 2YQ1A 1RT3B 3RBEA 4FZVA 1YBTA 4PG6A 4P7TA 2MDAA 1IBLJ 2Z57B 2SXLA 2B0GA 3P49B 1RAFB 4QU6A 3OXGA 2GJFA 1QAXA 1MN7A 2QLBB 1GT8A 4ER8A 1HNIB 1VS3A 4EO6A 3MMCA 3AQOA 4AUKA 3BGOP 3PNIA 2B6AB 2JDJA 2IVYA 3MR5A 1F9FA 2FVRA 2VG6A 3G8QA 3H98A 2KYZA 3NCQA 3HD2A 4P71A 2PA8D 3D67A 3J7AN 1F5CA 3R2CJ 1UCNA 3QGPA 3TUJC 2V9WA 4NXNJ 4DEZA 1Q5YA 2QTWA 2D9OA 2ZE2A 3HK2A 2XHCA 4ZVHA 3IG1B 2Y9HA 4LFBF 4JI5F 4KIAA 3I55S 1WORA 3MEEA 2H65B 3KLEB 3DLEB 1XN9A 3Q23A 4IG3A 1VJWA 1URRA 1R6VA 1BMQB 4HKQA 1UZDA 1Y0HA 4ANDA 3CDBA 2FLNA 2HS4A 4DL4A 3SV3A 2XS2A 1JJHA 6FD1A 2MHEA 1UEVA 2K3IA 1EARA 3OTCA 3AD8C 4K5RA 4ZN3A 2VZ9A 3QPIA 2NPIA 2BEFA 5IV3A 2YWWA 4PWDB 1RABB 3UD3P 3HSZA 3OXFA 3WQPA 2XWXA 3WIVA 2J9CA 4TVAB 3M2UA 2XMWA 2CYYA 3KMSA 3LP2B 2AEMA 5AXLA 1Y7PA 1SC6A 4N8OA 2CG8A 4HLBA 5KFLA 1NNDA 2CPIA 2Q43A 1IBKJ 4BWMA 4KH0B 3AHPA 1PYSB 4HR2A 2MZTA 2CFXA 4CLZA 1RTDA 2VV5A 2MLXA 2VG6B 5ETPA 2LQ8A 4HDHA 2BQ3A 3Q2SC 4L6V3 4OX9J 1NRKA 2K8GA 3KJNB 2CJAA 1N32J 3B54A 2HFOA 2IAJB 2XS7A 1JLGA 3OD2A 3M8PB 3BO4A 2R7UA 3W64A 3AXMA 2HK2A 1U2RA 2XZDB 1BUXA 3M8QA 3B78A 2DNMA 2HG4A 4Z2XA 3PX4A 1UEKA 4B9VA 4M94A 3QWUA 3MEEB 1UW9A 4FF1A 1SC1B 2EG2A 2ZH5A 4RUCA 4YHHF 2QL5B 2UUCF 4DSLA 4JI1J 1F3FA 4F4KA 2XS5A 1CQMA 2MQQA 4FXVA 4FS1A 3PO4A 2HHUA 3US5A 4CYUB 3VAHA 4RO0A 1NK7A 4DX5A 3TAMB 1LEOA 3OTOJ 1BQNB 2UV8A 3C15B 1QTNB 1M5HA 2WW8A 2OD6A 1N0VC 2ASDA 4XPEA 3OPKA 3G2XA 3W2VB 4LF2A 4KGZB 2ZOFA 3Q83A 3PW5A 4DCJB 4OI4A 4OI6A 5FIIA 5KFVA 1DLOA 5ETNA 4RW9B 4Y2AA 5F8LA 3MM9A 1LXJA 3A13A 1B7FA 1E6YB 1YITS 4WF9Q 5KFIA 3S7RA 4OI0A 4NEYA 2B43A 2XEXA 4ZLJA 5G4DA 3ADAC 4ECWA 1ZTWA 3OR2A 4PABA 4NXMF 4B3SF 5KFYA 1FX4A 2CNKB 4DV0F 3EWGA 4DSIA 4GO7X 4FYXB 1NJXA 4QIEA 5DQGA 3LUYA 4FVMA 3ZO7A 2BUNA 2MLZA 4PWWA 5BXIA 1AXQA 3M9NB 2R8KA 3BR8A 3MM5A 2K1RA 1HMVA 2MKYA 3BGRA 3BH7B 1TKTB 1QDUB 2I5JA 3SSRA 4IG0B 3WX4A 5L1LA 2E1RA 2VQFJ 3SMZA 3EGWB 2UZAA 1VK8A 4Y0FA 2XNRA 4HACB 3GJRB 2DNKA 1VQ4S 4R5PB 3H5YA 4U7UK 3DLGB 4E0DA 3LO3A 4ZS6A 4OYMA 1HNWF 2B9YA 2OSRA 5D77A 1RT6B 4I2QA 1FO1A 1A9NB 3OV7A 2F8MA 1X9SA 2HZAA 3CCJS 2HHTA 2KL8A 3KK2B 1HD0A 2BE2A 2V69A 3G96A 4ECYA 1HI0P 3HF5A 2MY7A 1MU2B 2BM1A 2KG0A 1MN9A 2R2TA 1SIZA 2NXUA 2QMWA 3V6DA 1KNZA 1QTMA 3TZZA 1U45A 3ENQA 3GWCA 2V5HG 5IM0A 2M2BA 2ZC4A 1CULB 3M8ZA 3FVYA 2FIUA 1KQSR 4LF8J 4B02A 4DR1F 4MIBA 3L4BC 1RAAB 2EC2A 4X4PA 1MMNA 1YVFA 2WVDA 1WF0A 5GVQA 1S9GB 2MZ1A 3OR1A 1DTQA 1MSWD 5CYQB 1O8BA 2IBKA 1Q7YT 4FF3A 3NL0A 1FXRA 4DPUA 2L08A 1AZSA 2VQEF 4G1QB 1JKHA 1VRQC 1QVFR 3G6VA 1BQMA 2LXIA 1F2HA 2H5JB 1UJ5A 2MYFA 4R8UA 3VTIA 4Q43A 1KVJA 3VCDA 3V81B 2YX1A 4UZBA 4X4OA 5GAGI 3VGSA 4QPXA 3SSQA 4LF5J 1ACMB 2X1BA 5KG5A 1YKWA 2DBBA 2HFNA 2LA6A 2DXFA 1T9VA 4L72B 4JYAF 4QJVA 2B8QA 4QYZJ 2FYXA 5IFMA 3K8VA 1HNXF 3I0SA 3ILLA 2H9ZA 2VC1A 4B9NA 4X4TA 3TA2A 1RWWB 2HQIA 3UI3A 2U1AA 4F2SA 1P27B 1N56A 1LXNA 1FE0A 3B6BA 2J0QD 3RAMA 9ATCB 2CDRB 3POTA 4ZLPA 3R1LA 2XSJA 3T3FA 3DLKB 2OP5A 3DRPB 3FCWA 3LPEA 3VV2B 5BR8J 3FZBA 1SV5A 1HHTP 3IWXA 4OX7A 2M9KA 2E66A 1S59A 4JI7J 4TLQA 4DMZA 5A0YB 4I4BA 4NLRA 1Q8BA 2I6WA 1WEYA 2DY9A 2PSZA 4IR1A 4WTYA 1YDLA 1TL4A 1J5EF 4J9RA 2YPYA 3GSIA 4ID8A 2LVWA 1IR0A 3C16A 3RUBL 4LRFA 1D0EA 2HRTA 2ZC3A 2DYAA 3NBPA 3MM8B 5LXRA 1S76D 3RW7A 2JLFA 1QAIA 4LBPA 3MUVP 2RRBA 4J9UE 2Q3PA 1FF2A 3HFVA 1FRMA 3OXLA 4M5NA 4C98A 3C14A 4DV7J 2X1GA 3V6JA 2DRBA 4F8RA 2LDIA 3TYTA 3KLFB 1U1PA 2ZHAA 1OWXA 2I0XA 4CLPA 3PACA 3TA0A 4GRSA 1VQKS 5F8IA 2BE9B 2QL9B 2A3JA 3KJVB 3DYAB 2E9RX 1QUPA 2CJXB 5AT1B 3AH6A 4HDGA 2K06A 4BCAA 3JAMY 2GHWA 1HBOB 3QSIA 2Z30B 1H98A 4C97A 4YR0A 3OHAA 2M70A 4DV6J 1T03A 1WHVA 2R42A 4ECRA 5D0GA 3DKDA 4K7QA 3LWLA 1RTIA 5CYMB 2BRKA 4PUOA 3MR3A 2JVOA 3I6PA 4MYTA 2MQOA 4O3PA 2YY3A 3FC9A 4RKUC 4TU8A 1R89A 3ZTPA 4NRTA 2JC1A 2CQBA 4YY3F 4M95A 1HNVB 1CVJA 2MGZA 4OJHA 3OLBA 2ZM6F 1SJQA 3CCVS 2NSCA 4A8OA 1T7PA 3JXOA 2LQBA 4QYRA 4O3QA 5J2QB 2Z0GA 2XTJP 3DLJA 4KHPJ 2IDLA 2DVIA 1GX6A 3DRSB 3BQ1A 4MFBB 1FTRA 2HNDA 1RLDA 3DRRA 3QIDA 4RJVA 1KHWA 1VQNS 1MG7A 3MPUB 1NDKA 1FK9A 3K5PA 1QE1A 4N5SA 4R25A 5J2NA 3MOZA 2LQ5A 3QO9A 3DLBA 2LQ9A 4YEAA 2MKCA 2YVSA 5HI7A 1Z4UA 1B70B 1IBCB 3CCLS 1RU1A 5LT5A 3MMAA 5A8KA 3EDRB 1KVKA 1WHXA 2HVZA 1WC4A 4ILLA 3QJJA 1X4DA 2LXFA 1TAUA 2PDAA 3SDEB 3JSRA 2E1PA 1XMBA 3PYFA 5IWAJ 2LEPA 3UVJB 2QGFB 2ASJA 4BBYA 4OZLA 5KFDA 1C1CB 3TVYA 4DU8A 5HLFB 1M1GA 4PUOB 1FT8A 4ILRA 3AA9A 3K5NA 2RQMA 1GMWA 5H9EK 2XMJA 1JX4A 2HMIA 2WSFC 4PYDA 1QAJA 1GNKA 3JSYA 2BE7D 2NCKL 1FD2A 2J0XA 1RISA 2MGZB 4IRKA 2EBGA 2U2FA 2LLZA 5KFSA 4DF8A 3MD1A 4CI0B 3QRRA 4LT6A 1JLCB 4YQWA 3G87A 3PR4A 3WHIA 5A2QY 1R8HA 3N6LA 3H2VE 4DL5A 2OUGA 1CJVB 3D54A 1L5UA 3D7SB 3IWNC 2CQPA 5KT6A 5KFPA 4FNHA 2UVUA 3KLGA 1Q82T 1RTHB 4F0HA 2FD2A 4DL6A 4LFAF 2E9ZA 1KR4A 1A0OB 2DGXA 1UA1A 1U49A 3HSJA 2IC3A 3JQJA 3CIMA 2MB0B 3VVUA 2M52A 1KLMA 2CQHA 2ZH1A 4JUZA 2CPHA 1I94J 4MMOA 1N5QA 2H5EA 2OH2A 2Z2MA 4LF4J 1O0PA 3PYDA 4USWA 3CULA 3T5HA 3LWMA 1RT1B 3NRBA 2H48B 3ZZUA 2CPFA 4NLOA 5T41A 2VG5A 2DHSA 5L1KA 2HLUA 2EPIA 1CC7A 2KI2A 2GX8A 3PIOQ 1FRIA 3OL9A 4ZJLA 4OLPA 1SL1A 2HZVA 3FFIB 2VA3A 1ZAVA 2XGQA 4OYBA 4WKRA 1SXLA 2NREA 3HVRA 2IA6A 3CJRA 1EKSA 2QYGA 3PW2A 4CO0A 3TAPA 3EGNA 2O3DA 2VFUA 1WTFA 4BLGA 3K8WA 3GE9A 1RTJB 2VPXB 3PJXA 3D2WA 2OMOA 5H9FJ 2P6SA 5B0BA 2CQ0A 3DOMA 4WP8A 3S01A 4KHMA 3QZ8A 1X4FA 2Y1IA 4K2XA 3A12A 3VAIA 2KO1A 3KTQA 3FBEA 3BDPA 4DWIA 2QO3A 2AV5A 3SQGA 3QT7A 4IO1A 1X9WA 3SSSA 3NCPA 4ITSA 3V2UC 5A76A 1KTQA 5HVHA 1GXUA 2W4DA 3W8GA 2H54B 3M2RB 3G6XA 2LA4A 4J7CA 3SIPB 4JI8F 3B82A 2OPQB 1ELOA 5CYJA 2BKPA 1PGZA 3NGRA 2RF2A 4NZ7A 4NLTA 3N9UC 2VG5B 4RNFA 1UPPA 1S72S 1FVSA 4IH5A 2C2NA 1HFEL 3ELHA 2APOA 3CJ4A 4ANEA 5FDLB 2RKIB 1DY3A 4LRCA 2EI5A 1ZA1B 4DFJA 3D68A 2LYVA 4WZQA 1C4CA 4WFNQ 3D6FB 2ZD1A 4K8RA 1WNEA 4M5HA 2BW2A 3JQMA 2RMLA 2NS1B 5ETLA 3MFIA 2F7VA 2RB7A 5I42A 3UDEA 3OJSA 4X66F 2L9NA 4UOFA 4ZK7M 4EUVA 3RR8A 1TV6B 4ZLNA 3K7RA 2PFFB 2DJWA 5LSLA 3CO0P 2RE1A 3FMBA 3KLIB 3C66A 2L3MA 4JI4F 4KTQA 2GZOA 5C7PA 4EO8A 1GXLA 2R8JA 2PEHA 2JFDA 2BX6A 3SQGB 1JJ4A 4DSFA 3DGVA 2EWHA 2VASA 3CCZA 4W4MA 1KBRA 1WEZA 4CLSA 3IS9B 1RWNB 2KT2A 1YTYA 1JLBA 2CPJA 3CDEA 4DUZF 2ZH9A 1CLFA 2ZBQA 1RLCL 4HVZA 2XMVA 1KHVA 1RAEB 5K14B 1C1BB 1YZ7A 3A3OB 3HLUA 3NNCA 2I2YA 5HBMA 2XY5A 1LW2B 4NLDA 1V5VA 3O8WA 5E41A 1ZH5A 3H4BA 2ROEA 1S6QA 2OEKA 5IC6B 3OJUA 4DUYJ 2H1YA 4ANCA 4ERDA 3R5JB 4K59A 2AD9A 2XI2A 3V4IB 3RB4A 3R8YA 2H4WB 6FDRA 4NRUA 3BQ2A 1WHYA 2IMOA 3PFOA 4NA2A 2LU1A 3NCRA 1IKYB 3DLLQ 2KJVA 6AT1B 1H6KX 2AZ3A 3CCQS 4NL5A 4ZHRB 1ZS6A 4RLEA 5DLFA 2YNIA 2IVFB 5ETRA 3T1YJ 3UQSA 3PM9A 2GIFA 2E5LJ 1RYRA 2GVDB 5EX3A 1FWLA 4U8YA 3M1VA 3OTDA 1S0MA 3MTKA 3AJDA 3IM9A 2CPEA 4ED6A 3PVXA 2LFVA 4KC5A 3JS9A 1XNRJ 5KFUA 3UR3C 2L9DA 4IDKA 3OVAA 2V4RA 2LP4A 3GJSB 4K4WA 4NYZA 2C2MB 1VRTB 5D4PA 2CZVC 3CE8A 1UWBB 4EI2A 1O5JA 2QA2A 2QZ8A 3HJVA 3I5CA 3U02A 3KK3B 2W25A 3LGNA 3HFZB 3NWGA 5D8HB 4JI2J 2HFSA 3PYGA 1SKUB 2V67A 2OPRA 1YGYA 3EX7B 4Y2IA 2YNHA 1X4CA 2CA9A 1LFWA 2PI4A 1LWEA 1FEHA 4DS5A 2EFPA 2CQ4A 1VC0A 4FKYA 3RB6A 1KOHA 4QZVB 2FJXA 4DFMA 1F6TA 1NB7A 1IBMJ 2X1AA 2PFDA 1Q86T 3NLCA 2FJDB 3VWSA 3CIZA 4CLWA 3N6MA 3MCOA 1TKXB 2R8IA 4B3RJ 4C9DA 4AL5A 4USVA 4WWSA 1JWWA 4F36A 3BR9A 2WTFA 1HQ2A 3QLHA 4IFYB 1UKUA 2RHQB 3Q8VA 1RHJB 2HVIA 2LCWA 1E6VA 4MK7A 2HFUA 3M30A 1REVB 5E2QA 2HWIA 3Q8YA 4KGMA 3PKMA 3M2VB 3M9MB 1VQ5S 5DZ6A 2C3OA 2HHSA 1IBLF 2AW0A 3D6HB 4YR3A 3I4HX 3D1QA 4OHZA 5CABA 4QPTA 5EWEA 2OJ3A 3R2DJ 4ZITA 1JNZB 4PXEA 5HJXA 1JLEA 1XNQJ 3CD6S 4TQRA 5CD4H 4KPCA 1S79A 1T05B 3Q8SB 4LF1A 1YIJS 3DFEA 1FXLA 4KH1B 2C22A 4YS2A 3D4JA 2ADCA 3G82B 4ZCMA 2EFQA 1LV5A 4EBDA 5HROA 1CJTB 3W9JA 4NXNF 5H1SV 3B8HA 2QSFA 3DM2B 1RT5A 3IN5A 3D0GE 3VALA 3UCGA 1NPPA 1VQMS 2G9OA 3MUTP 7FDRA 4DL0C 2GV1A 3PHEA 3KHLA 2Y1JA 2GQQA 2OIHA 3QGHA 1UWAA 4GMKA 2WB1D 4UF4A 1OQ6A 5KTQA 2FJEB 3VVTA 4UY85 3GILA 1HBMB 4NXMJ 4DLEA 1U0SA 3OUYB 1VQSA 4B3SJ 1UPMB 3MAHA 1QLNA 4V19J 2QMXA 1N5YB 4ZPAA 2CQ3A 2ZEJA 1BXNA 5GMDA 4R0EA 3M30B 1VBKA 3W2WA 3H4DA 4TU9A 5SUHA 1JLQA 3MPDA 2V68A 4F02A 2BJDA 1U1RA 1K0TA 3DXBA 5B0AA 3M8RA 3HVTB 4B9LA 2D7SA 3CC7S 2VICA 2XZTB 4UT4A 1IBKF 4BDPA 2DGWA 1I5OB 2UVVA 1RWKB 4P2FA 4NLQA 4QIVA 1HNWJ 5J2PB 1HL6A 5DG7A 3R7NB 2ZWOA 1FX2A 3I56S 2OPSB 5T7LA 3TUPA 3O44A 3QATA 1IKWA 4CLLA 2ZJRQ 3IFEA 4OX9F 3ET6A 4E8UA 1SC3B 3KDNA 4KKOA 3OFGA 2KM8C 2MJNA 2XCAA 2IPOB 3QIPA 4PQUB 2QEXS 1U4BA 1S97A 3DC2A 2RHSB 1DRZA 3T6BA 2YH1A 4WFBQ 4AFFA 3DCAA 2CNLB 1I6JA 3IRWP 2DNRA 1FRXA 1CQNA 2GQ2A 1S1XA 1RA6A 3B4DA 4JI3J 1PJ5A 3DXSX 2PMZD 3AAWB 1U8SA 2R7RA 1QSYA 2QSWA 1RHMB 4QR2A 1X4EA 1RT2A 2NSBA 1AYEA 3OTOF 2R9LA 3R9LA 4LSLA 1X5TA 3U1NA 1H3DA 3JSMB 4O4GB 3TARA 5BJRA 2B3TB 3LH2S 3T19A 1YJNS 2J8SA 1AFJA 1LQ9A 2YX4A 1K1SA 2XWYA 1NHKL 1OJ4A 2BACA 4NLGA 4CNZA 2XSFA 5E5NA 4K4YA 4GC6A 1OYEA 2W9CA 5IQ6A 3BSOA 2IJNA 4J5OA 4LF7J 2HBZB 3MEDA 1G6BA 4O3NA 3BDEA 1U09A 2QIFA 4BS2A 3AJ1A 1TL1B 5AXMA 1OO0B 5M2RA 2ZBPA 3FNNA 2EK1A 1P6TA 4H4OA 1MMDA 4X4UA 3C3LA 4FYVB 1X4BA 4RBUA 2W01A 5K8MA 4KAIA 2IM2A 4C3MA 1S0NA 1HNXJ 3MMBB 1G1XA 4UQTA 5ITHA 3WX8A 4ZCKA 3KUEA 2E5IA 3W60A 4CTAA 2GFFA 3AD9C 4O3SA 3BGFA 1R8AA 3JTPA 2AEFA 2VQFF 2V4QA 4J90A 4P7VA 4B9MA 1CEZA 4DSKA 3RBXA 3QT5A 5FD1A 2J7WA 4MK8A 1YI2S 1YJTA 1RT2B 4U6PA 1U8WA 3X1LB 1RCXB 3VQSA 4TXSA 4J9QA 2DISA 2MSSA 4J9LA 1C0TA 3VAMA 3HZGA 1VDHA 3GCXP 4B9SA 1RK8A 3EPIA 4N41A 1OSCA 1NBEB 5CCMA 1MROA 1HHSA 3RRGA 3M9OB 3UFCX 5G0RB 1PO6A 1H0HB 1K1QA 3HI9A 5C24B 3WIUA 1UW4A 4C8ZA 1X0PA 4K0KF 4O23A 1Q0NA 3K89A 1RADB 4MIAA 1TMJA 1U1QA 1VRUA 2HNYB 3MHYA 2QX0A 1AT1B 3GV5B 4OJ1A 1LWXA 2HFZA 3MTJA 4IQMA 4OI2A 4KFBB 4DXLA 3L7PA 2E9TA 2PA3A 2NXNA 3QSYB 2D3ZA 3Q22A 3PR5B 2GIQA 2YKOA 3GB0A 4WXOA 2EC0A 2ZFHA 3F44A 1HYSA 3CT9A 3KYLA 1NHVA 2WW4A 2ZITA 4K50A 3LP0B 1EETA 4ED1A 3DN9A 3RW6A 5DM7Q 2CUYA 1MMLA 4QW9A 2VIHA 4XPCA 1F9EB 2V2KA 4LRAA 2VONA 3GG1A 4Y2MA 3UD4P 1U7LA 2ADBA 5KFZA 1UJ6A 4Y00A 2AGOA 1XJWB 2MZJA 2NZ4A 1NK6A 3ENWA 2OAUA 5THWA 3ITHB 2UU9J 5C2CA 5MLCV 1DTTB 4DI6A 3TWZA 4DL7A 1ZM2A 1M5SA 2BA9A 3ZNUA 4TY8B 2N7YA 1S6UA 2OKQA 4TNOA 4PRFA 4FXWA 5HSPA 1HBNA 3BZQA 5KFHA 2G2ZA 1M0SA 1RA7A 1OS5A 1RWXB 2VH7A 4NYOA 1KONA 2FVCA 2VBZA 3SCJE 1ZA2B 1B7YB 2ABYA 3IA0A 2O01C 5ADZA 1RHUB 5BR8F 1FHTA 1GMUA 3EE3A 1WC1A 4QCLA 4DCPB 3DHWC 4ECSA 2XHWA 3P96A 4M5JA 3EZOA 4DR2J 1IN0A 1IM6A 3J81j 3EGZA 3GYNA 3ZZRA 4HHJA 4NZ0A 2MLYA 1VFJA 2E29A 5ETMA 4ELVA 4LBHA 2Z4PA 1AUDA 4RNHA 1VR6A 3KLHB 1XIQA 4BC7A 1R0AB 2HNZA 1S9EA 4FN5A 2UV8G 5CAAA 4C7QA 1OIAA 5DS7A 2PD1A 4LR7A 4RBTA 2FZKB 1RKJA 3QFWA 3MEGA 1WG4A 4X2BA 5LMNJ 1SKSA 3D9BA 1EQMA 4DFKA 2N82B 4TYAA 3ZTOA 2RSQA 3R5CA 5E7OB 4DV7F 5D3GA 1HWJA 4E2FB 4ZDNA 3CCRS 2NXEA 2KVQE 4CLUA 3NEKA 4DQPA 1UETA 2EEYA 5AE1A 2VU5A 1HA1A 3HHKA 3RYLA 3PIPQ 3R6LB 3O5TB 3SYZA 1YK9A 4U9RA 2XYPB 1RHRB 1EQ0A 3BN4A 4RU9A 4RNMA 4DV6F 2W9BA 2GMJA 1S1WB 4NI2B 5HQ8A 4A46A 5D0EA 3QBCA 3DDIA 3BSAA 4PKDB 2DNOA 4PXDA 1IJEB 1Q16B 1XERA 4ZVRB 2GC8A 5HP1A 2RQKA 2XM3A 1JXLA 5B0GA 2B4VA 4B3TJ 4H54A 2BQRA 3CCWA 4NEZA 2JOQA 2VPZB 1VJQA 3QT8A 3V5RA 2B7CB 5HN0A 5E33A 3QJLA 1S9EB 1N5VA 1RSCA 1SKWA 3TP2A 4CIOA 2V8HA 2R7TA 2YH0A 1WG5A 1TAQA 2HBRB 4PZVA 2I38A 3E51A 1Y00A 4KHPF 3D6MB 1WKJA 4KY3A 1RDRA 3M8YA 1N4LA 1I51B 2LMIA 2YKNA 1Q78A 2BV3A 3RGIA 4QWCA 4YB6A 4ZOSA 5K8PA 2DEIA 4RX6A 4TLRA 2W8KA 4DN0A 4TYBA 1JMTA 1Q95G 1BD6A 2FLLA 1YZ6A 1LW0A 4PQAA 4IO9Q 4J9PA 3EDQB 1KQFB 1PAUB 1Q4RA 4DUTA 4DPYA 1SI9A 3PG9A 3VZIA 1B3TA 4X4RA 5ETSA 3H2LA 2JEFA 1MW7A 5JMNA 4ILMA 1TZ0A 4I6AA 4ECUA 3MUMP 2FVPA 1T3NA 2W2NP 2ZVIA 4PG7A 1HI8A 4XAKA 2MQMA 4QR1A 3LQVA 3LGMA 1FNOA 5DRKA 2BANB 3R7BB 3KUHA 3CF5Q 1D8YA 2AYBA 2VJVA 4CRJA 4USIA 4HHUA 3K5MA 3FK4A 2GAHC 4ICLA 4UUXA 4WYLA 2WSEC 5A6WA 1TELA 2P2CB 1FI4A 1NSQA 3DU5A 3NMRA 3KNAA 2Q6BA 3N79A 1FJEB 4ZPTR 3RJMB 4KV8A 3W5YA 3OL6A 2OSQA 1XEZA 2KU7A 3BKUA 2NZCA 3ISZA 4PPZA 5GADU 2IM3A 4I7FB 1WDDA 1RWVB 4M5DB 3TJAA 1XR5A 1HPZB 2LQJA 1YJVA 4ZIWA 5F8HA 3I96A 3D1HA 2HVDA 4ZP7A 1GAOA 4C11B 5CQGA 2VKRA 2D3O1 2UUAJ 1EP4A 1UA0A 2IM1A 3RBZA 3IR5B 2EVZA 1JLAB 3OBIA 3CJ8A 1NHUA 1I94F 2YX7A 4DV3J 4LF4F 4NMXA 3HVAA 1VQ8S 2C2ZB 4WP9A 2VPWB 2CQ2A 1N34J 2QE5A 1ZTTA 5A8WA 5DG8A 3W9IA 4LQ3A 4I2PA 3EGVA 1K47A 3JYTB 2OPPA 4DF4A 2J6SA 1SCJB 2DCLA 4Q7AA 1RKIA 4URSA 5E3AA 3N4WA 5B7WA 1HQUB 2HHVA 1VOMA 3TRGA 3PW0A 4X65J 3L95X 3IAS9 2IVMA 1CS4B 2ROPA 4ENOA 3QRPA 2YKMB 2FY1A 3W66A 2LEBA 2BDPA 3NY0A 3KJFB 3T6JA 2GVZA 2HQCA 1RT4A 3CUNA 2W8LA 2OI2A 4BHQA 3KHHA 3EVWA 3FQLA 2NXJA 4RL1A 4O0IA 1NH8A 2F3JA 3JB9k 1H73A 1S1UA 3UDVA 4B17A 4KO0A 4ZP8A 3UWTA 3UN2A 1UVKA 3MAAA 4GO5X 3G6ES 2YNGA 2RS8A 1HBUB 1RB0A 1WF1A 3NGKA 2C3MA 2R2RA 3W62A 4TQSA 8RUCA 4DG1A 1RT7B 2RU3A 3GIRA 1U6BA 3LF0A 4NASA 5ETOA 1KC8T 2G0IA 3DMJA 1M5KC 4V1Ak 3DDNA 1G4CA 4OI1A 5I4MA 3I0RB 4GVBA 5KFAA 1N6QA 2MMYA 1EKRA 3AJ2A 4YN3B 5J2MA 5HMYA 2N3OA 4DR6F 2DGVA 2F9DA 4CLYA 1ITPA 4ZLLA 2B4UA 3UPFA 4NLWA 4RPFA 1Y4ZB 3IRXA 4AYBD 2ERRA 1AUSL 4Y6IA 2CXEA 4NWBA 3C6UA 2E5GA 4W98A 3ICLA 4C48A 5E0OA 4C2MA 4LFCJ 2HYIB 1S1VB 1N36J 2QLJB 1YLXA 2Z2ZA 4P72A 1PC5A 2CJ9A 1C0UA 3P6YC 2DCUB 4WXWA 3DOKA 3CD0A 1EB0A 3CTRA 5CZXA 4M5KA 1TK8A 1P1TA 2VG7B 3VHQA 1NZAA 4HT5A 2K3KA 1HLWA 1BC6A 2DH7A 1C4AA 3AOAA 1LWCB 2GGPA 2AYEA 3BKTA 3PCOB 3IR6B 2CQGA 1J2VA 3BS9A 4N7TA 1WWHA 2A1BA 2O67A 5KG1A 3LGHA 3LAMA 1OSDA 1X4HA 3E01A 4ID5A 2W2OP 1FJ7A 2WB4A 2DNZA 3Q8UA 2H5IB 5LJ3Y 3N28A 2V2VA 1ZM9A 4KB7A 1TKZB 3QGIA 1N88A 3KK1A 4DUYF 4YP3A 2QRRA 4QIGA 1LWFA 1FKPA 2DNNA 2DNLA 2MQNA 2BQUA 1D9AA 4WFAQ 2XMUA 5HAOA 2KXFA 2WHOA 3HT3A 1CPZA 1ICEB 2B9EA 3IMQJ 5A8RA 3FRYA 1HQEA 3OHBA 2R2UA 1PILA 4YR2A 4ECZA 1FKOB 3KWMA 3W5ZA 5J1EA 1ZBTA 2XLJA 1JNRB 1DQAA 3T1YF 2BJ8A 2E5LF 2BYCA 2KRRA 2EBEA 4DBQA 1NK5A 1Q8IA 1S7IA 1CJKB 1VCTA 4CO3A 3FKBA 2MZRA 1XNRF 2KJWA 3GYGA 1NK8A 3BPSP 1H2VZ 1QD1A 3DOLA 4O44B 4URGA 2NLWA 2QLFB 3NP5A 3TQEA 2CKWA 1Y5IB 3P3DA 5D0RA 4USTA 4OYWA 4Z7YA 5EGYA 3ZZ0A 1NJYA 3KUGA 3TA1A 4HEA9 3RU0A 4JI2F 3H25A 3D0HE 3D66A 1WJ9A 1PJ6A 1RI7A 2BJ7A 2AGQA 3CJ3A 5KFXA 4KGXB 1FKPB 3H59A 1D1UA 3LANA 5F8NA 5KFEA 5HVGA 3QYYA 2DGUA 3TOQA 2ZUAA 1XMQF 2AYMA 2YWEA 2DRAA 2XZWA 2WAQD 4DS4A 1GTEA 4YB5A 3MMCB 2CPZA 1IR1A 1IBMF 2A6MA 3BBFA 3Q2TC 3W3SA 4QIFA 1VQ9S 3UNGC 1DFDA 1QM9A 4LSNA 3H8YA 2AKWB 3HP6A 2AHOB 4DU7A 4B3RF 1TVRA 2B5JA 2A10A 4OZJA 1ZPWX 2ZE2B 2GO8A 2JLEA 2AYGA 2COLA 2UXDJ 1KKHA 3UCZP 3CCTA 2F9JA 4IG3B 3CVKA 3DOLB 3NAIA 2OTLS 1JXEA 4NZ6A 4B9TA 2RDJA 3FGVA 4ZMMA 4K4UA 2J9DE 1XNQF 4C3LA 4IQXA 3T5KA 2J7UA 5KT5A 3TJ8A 3MD3A 4QW8A 2W7OA 1TL5A 5HANA 3PW7A 1S7HA 1KQKA 1TTHB 4G3IA 5K5MA 3UD5A 2J6TA 2FJWA 2FHMA 2WONA 3DNCA 3F56A 3M2UB 3GONA 3T1HJ 2BW7A 2NUUG 2J6UA 5HO4A 4UW2A 2XY7A 4NMLA 3TANA 5F8MA 1U24A 3ZZPA 3AD7C 4QQBA 1RJJA 4NCBA 3VR1A 2J7KA 1RTDB 2F4VJ 1DURA 5LSOA 4EEYA 2D69A 1Z2ZA 2ZJPQ 4I1TA 2OD4A 2HBYB 3E3XA 1IKVA 1EJ7L 1YRUA 3IP0A 1FRKA 1JLGB 5LL6d 4DV4J 4QU7A 1NMEB 3TQ1A 2OMLA 3M8QB 3OFHA 1JIHA 2XMKA 2QMUB 2HS3A 4DZDA 4M1KA 3HMJG 1WI8A 2YBVA 5K8NA 4X4QA 2F40A 1NEEA 2XMAA 2WBRA 3OSPA 2IRXA 4OV1A 5A6PA 2NQPA 4B3MJ 4C4WA 1YX2A 3UW1A 2KG1A 4X84A 3VF0B 1M5PC 5BYRA 2P9EA 4ZVUB 2ZH7A 1HD1A 3ENVA 2V94A 1F60B 2YKPA 4Q0BA 4GKJJ 2BJEA 4MK9A 4EBEA 9RUBA 1NU4A 3J81Y 4ES2A 3J80U 1FWPA 3NAHA 4CZCA 1VK3A 3NGSA 5DGAA 1DLOB 1KS2A 3CXCR 3BO3A 3NMAA 3RTVA 3MM9B 4K4SA 4K0KJ 2YTCA 3RG6A 4WCEQ 4JI3F 4H4MA 4ZVQB 4NLUA 1VQYA 1X5OA 4WE1A 5F9LA 2GW8A 3OR2B 4Q2MA 2QFIA 3R5BA 3P5TL 2QA4S 3ZZOA 2MQ8A 3M6UA 1SUQA 4A8MP 3F0NA 4NA3A 1UL3A 3HT0A 4DR5J 3S8SA 3MECA 3MM5B 1B0TA 2K1RB 4DSEA 1HMVB 3BGRB 2FGCA 2I5JB 1XR6A 1NDLA 1YG0A 3PFEA 3PXGa 4DOZA 3NWRA 2ASLA 2R7XA 2CVIA 1RXOB 4LF7F 1WC3A 4YOEA 2X51A 2PGCA 2VFVA 1S99A 2HHPA 5IXUA 1Y9OA 1TMMA 1NCLA 2ZH6A 1U1MA 4P10A 4I2QB 2B9XA 2BMBA 4ZKAA 1X7VA 3UE2A 3CJ0A 2BE2B 3BYPA 3QT6A 4C8KA 4OYOA 2K2PA 3GTYX 3W7BA 4ED8A 3HO1A 4YDXA 4DX6A 3TVZA 2CNOB 3V6DB 4O0NA 5KFMA 3W8PA 3CJSA 1S1TA 4DPXA 5IM0B 4ZVPB 3C2PA 2AX1A 1FESA 1HNZJ 4LF6J 4GVLA 4USUA 1CJUA 5C42A 4RWXA 1PSDA 2V63A 7AT1B 2RDDA 2OELA 3HD1A 2UXBJ 4PG8A 1EHWA 4NE9C 5KT3A 4E98A 2DY1A 4RR5A 2MHNA 1WHWA 2G0CA 3T5JA 2DO4A 2ZZNA 2V34A 2CRLA 3BEGB 1RYSA 1WI6A 3W9HA 2F65A 3R7SB 5KT4A 3OR1B 4QWAA 1DTQB 4XDCA 4LMZA 1UTAA 5D15A 4DR4J 2VBXA 4CP5A 2UVWA 2J5AA 3A8KA 3I82A 1AZSB 1T9XA 1JKHB 4Q8EA 4WIQA 3LALA 1SH2A 1YJWS 1BQMB 4X4NA 2RU9A 3CCMS 4R8UB 2ZNYA 1CSJA 4I0WA 3QJPA 4FXDA 2FY8A 4DX7A 2E7VA 1B4SA 3OW2R 3BQ0A 2MQLA 5U47A 4N8NA 2YNFA 3SV4A 4EMDA 1H7WA 4OI3A 2ZBCA 1N54B 4RW7A 3Q8RB 3I0SB 3M05A 4RW8A 2R7VA 4DV2J 5KFBA 5HVFA 3POTB 2XSJB 4IFVA 1VISA 3N6NA 3AFGA 3BGLA 2V8PA 4USKA 4CO1A 3MF5A 3CMES 5AE3A 3IGNA 3HVWA 1SV5B 2MKKA 3G9CA 3PKYA 1JLFA 3H0PA 4I64A 2FC9A 3TVKA 1N5TA 1PBAA 4A8KA 1NK0A 1K9MT 3SFUA 2UU9F 4NLPA 1P1LA 3GV7B 2W2MP 4USMA 1TR0A 2XULA 2ASYA 3MM6A 3C16B 3CJ2A 4RW4A 1FFSB 3DI6A 3NBPB 1PBUA 4C0OC 2J8AA 4UY8T 3CCES 4UOGA 2HIQA 1YJUA 3A8JA 3MM7A 3PHTA 1LOUA 3TR5A 1IQTA 1NAQA 4CO2A 3MOJB 1RTZA 3C14B 2IRUA 1FNMA 3MDFA 2WOMA 3VAKA 2XQCA 1N8RT 4DR2F 1S6PA 3P45B 5K20B 5GAEU 3TX0A 1V5IB 1PG5B 2FZCB 2DGSA 5IS2A 4MAKA 4USJC
chains in the Genus database with same CATH topology
2HFZA 1X8DA 3MTJA 4HH0A 4IFVB 5AXNA 3PW5A 4IQMA 2VBWA 4OI4A 3BM7A 4Q45A 4OI6A 5FIIA 3TUZC 1T03B 5KFVA 3AB2B 4OI2A 3CJKA 1DLOA 2VB6A 2V8DA 4RW9B 4KJIA 4Y3CA 4Y2AA 3TNVA 5F8LA 4KFBB 1TFWA 2D41A 3MM9A 3L7PA 2E9TA 2PA3A 1LXJA 1B7FA 1T05A 1E6YB 5EHHA 1YITS 2D3ZA 3Q22A 4V19X 1RTIB 3PR5B 4WF9Q 2GIQA 2YKOA 2Q1LA 5LMNF 5KFIA 2CQIA 4UUWA 3S7RA 1QSLA 2IA0A 3GB0A 4WXOA 4OI0A 2EC0A 1N0UA 2ZFHA 2B43A 2XEXA 3F44A 3LAKA 1HYSA 5G4DA 3CT9A 3KYLA 1NHVA 4ICLB 4FVCA 4ECWA 2ZITA 4K50A 1ZTWA 3LP0B 1EETA 2ILYA 3OR2A 4XIUA 4ED1A 1N52B 3DN9A 3RW6A 3DHXA 4XDDA 4LF9F 4NXMF 3IC1A 1J5OA 2P9CA 5DM7Q 3C6TA 4B3OA 4B3SF 1MMLA 4KV8B 3DM2A 5KFYA 4QW9A 3OL7A 4DV0F 2VUGA 4AL7A 5JVGQ 5E3RA 3R5DA 4XPCA 4DSIA 2V2KA 4GO7X 1NJXA 4QIEA 2VONA 5IZHA 5DQGA 2HRUA 1FCAA 2V4JA 3LUYA 3GG1A 4Y2MA 3UD4P 4J9OA 4FVMA 5EDWA 1W2IA 2BUNA 1FDNA 3HHEA 2ZVSA 1U7LA 2ADBA 1QUVA 1L3VA 1YRTA 5KFZA 3SI8A 1AXQA 1FNXH 3M9NB 1UJ6A 2R8KA 2A18A 3BR8A 3M32A 3MM5A 4Y00A 4C0BA 2ATLA 2AGOA 2K1RA 3I31A 2MZJA 1HMVA 2NZ4A 3J7A1 3BGRA 1NK6A 3ENWA 2I8EA 1T02A 2OAUA 4EU0A 1TKTB 3ITHB 2I5JA 5THWA 3RB0A 1HBMA 1UMJA 4DX8H 2OLWA 2AJ4A 4GKKF 1L3KA 3SSRA 4IG0B 5MLCV 1DTTB 3OUYA 3WX4A 5L1LA 4XK8C 1KOOA 2E1RA 3EUNA 2MKIA 3TAQA 2C2RA 4DL7A 2Z2LA 1ZM2A 2GO9A 1M5SA 2HNDB 2M3DA 3CWJA 2BA9A 3N5BA 3KG4A 3EGWB 2UZAA 3SMZA 1VK8A 3DRRB 1WF2A 2A2CA 4TY8B 4Y0FA 4WU3A 5I3UA 2XNRA 3LP1A 2N7YA 2DNKA 1EP4B 1S6UA 1SBRA 2OKQA 4TNOA 4R5PB 1VQ4S 4PRFA 5DQIA 1FK9B 4U7UK 3H5YA 1QE1B 4FXWA 1HBNA 3BZQA 3DLGB 5KFHA 4E0DA 2O1PA 1BQXA 5J2NB 3QO9B 4RUHA 3LO3A 4ZS6A 4OHXA 3EZ5A 3Q8PB 1HNWF 1M0SA 1Q8LA 4B3TF 3ZZYA 5D4NA 1RA7A 1OS5A 2B9YA 1QAYA 2OSRA 2VH7A 4NYOA 1KONA 5D77A 1RT6B 1LK5A 2FVCA 2DNYA 3ZZTA 4CT8A 4F50A 3QAEA 2VBZA 3SCJE 3HVTA 3IA0A 2ABYA 3QWPA 2O01C 3MMAB 5ADZA 1LFPA 4I2QA 5A8KB 1ZPVA 1R7IA 2BZ2A 1FO1A 5A8WB 5BR8F 1A9NB 1FHTA 3OV7A 4I2PB 4K4TA 4F4YA 2DNQA 1U1NA 5EUHA 2F8MA 1X9SA 2XNQA 5DDQC 1KEKA 5IT0A 3CCJS 3KK2B 5C25A 1M5VC 2WSCC 4QCLA 2HHTA 3GV8B 2FHOB 1HD0A 2BE2A 2OPPB 3ZC4A 3KHGA 1U47A 3DHWC 4ECSA 4DQRA 4NCGA 1WG1A 3G96A 4ECYA 1HI0P 2XHWA 1HR0F 2FDNA 2KT5A 2CDQA 3P96A 3HF5A 7FD1A 1RT3A 2MY7A 5J2PA 1IN0A 3C46A 1MU2B 1KVIA 3EGZA 2OPSA 2BM1A 3NKYA 2P5VA 3GYNA 4R0JA 2KG0A 3ZZRA 4HHJA 4NZ0A 2R2TA 5DDPC 4Q44A 1SIZA 2NXUA 2QMWA 4I6WA 1VFJA 3V6DA 1KNZA 1QTMA 2AJQA 2FVSA 2E29A 1U45A 2QA1A 4ELVA 3ENQA 4U67Q 3GWCA 2Z4PA 1AUDA 4RNHA 3DU6A 2V5HG 5B0EA 5IM0A 3KLHB 4ES1A 5B0FA 2M2BA 5I3PA 2ZC4A 4BC7A 5T14A 1R0AB 2HNZA 1R27B 3FVYA 4CH0S 2HMIB 1S9EA 2FIUA 4FN5A 1X0FA 2UV8G 1HNIA 2KHCA 1KQSR 1RT4B 4PQUA 2KYXA 4FNIA 4C7QA 1DJ0A 4IH7A 1OIAA 2CG4A 2E7WA 4B02A 3T9NA 4DR1F 4MIBA 2JZ5A 5LJ5Y 2B6AA 5DS7A 1OPZA 3I9V9 4JOUA 2M8HA 2PD1A 4RBTA 1SH0A 4X4PA 1MMNA 1YVFA 1RKJA 3UCUP 3G71S 4YB1P 1WF0A 2MJUA 3MEGA 5M2UA 1UVIA 1WG4A 4ECTA 4X2BA 2RH3A 2UXCF 2DIUA 1SKSA 1Y5LB 5GVQA 4DR7F 1QVGR 3OTBA 4DFKA 4Q8FA 1R43A 1S1UB 2DPJA 2N82B 3SCIE 4TYAA 1S9GB 1SIWB 2RSQA 2AX0A 3BSCA 4KO0B 3R5CA 2MZ1A 3OR1A 5E7OB 1DTQA 1MSWD 5HMZA 2D1CA 5CYQB 2VPYB 1O8BA 4ZPWR 5KFNA 5F3TA 4DV7F 5D3GA 1HWJA 5DDOC 2IBKA 1S0OA 3IR7B 4HL9A 4ZDNA 1Q7YT 3CCRS 2KT3A 4FF3A 3GFZA 3NL0A 3FQKA 2QV6A 2YNGB 4IYQA 3I4PA 1VGYA 1FXRA 2L08A 3IG1A 3BB5A 5D78A 2R7SA 4DQPA 1UETA 2VQEF 4G1QB 1JKHA 4NOHA 3K58A 5AE1A 4LVOP 3K5LA 5L39A 1HA1A 2HW3A 5KT7A 3HHKA 4DG1B 1QVFR 1URNA 3G6VA 3KLEA 1BQMA 2DGQA 3DLEA 3RYLA 2LXIA 2AGPA 2FHJA 3PIPQ 1UJ5A 2MYFA 3JSMA 4R8UA 4O4GA 1VHFA 3BGUA 3O5TB 3SYZA 3VTIA 3M6VA 4ZP6A 3DMJB 4Q43A 3TI0A 3CO9A 2VC0A 3HX9A 1KVJA 3VCDA 3V81B 2YX1A 3JTOA 4X4OA 5GAGI 1S10A 2HVHA 4U9RA 2DNGA 1M5OC 5DQHA 3KLGB 1SJ4P 4QPXA 4WFYA 3BN4A 3SSQA 4RU9A 4RNMA 3Q0AA 5L1IA 2W9BA 4DV6F 3OSNA 4WK3A 5KG3A 2X1BA 4IH6A 5KG5A 2E1MC 2JX2A 5KG7A 3RAXA 1HWIA 2DBBA 1NK9A 2VOPA 2HFNA 2LA6A 2N3LA 2GMJA 2JJ4D 2UVRA 1S1WB 4L72B 4JYAF 1PC4A 4NLVA 1IXKA 2FHKA 4QJVA 4WYWA 2YWFA 1XK8A 5HQ8A 2GIRA 4A46A 3A8EA 2HAIA 3BSAA 4QYZJ 2AJFE 1RGVA 2IC3B 4PKDB 2KDOA 4PWDA 4N76A 4RZRA 4Y34A 5IFMA 1N6QB 4HH1A 3K8VA 2DNOA 4PXDA 3SEOA 2MQPA 1HNXF 1KLMB 1IJEB 1Q16B 1XERA 3I0SA 2AP6A 1XBWA 2FUG9 5GAEI 1SL2A 2H9ZA 2GC8A 2VC1A 3K57A 2RQKA 3TA2A 2QYCA 4X4TA 5HP1A 4B9NA 1JXLA 1X4GA 1AFIA 2HQIA 4F67A 3UI3A 2U1AA 4ECXA 4F2SA 1P27B 5J2MB 5B0GA 1N56A 1LXNA 2B4VA 4AXJA 4H54A 1FE0A 2BQRA 2J0QD 3RAMA 3CCWA 1TL1A 3POTA 4ZLPA 4TU7A 3R1LA 2XSJA 3LPYA 4NLYA 2JOQA 3T3FA 5BYSA 2C42A 3DLKB 1H7XA 2OP5A 3DRPB 3LP2A 2HZCA 2VPZB 4YFUA 1NJWA 2BBEA 1R8BA 3CD5A 1SL0A 3FZBA 1SV5A 3GYXB 1HHTP 1N32F 2Y0SD 3V5RA 2B7CB 3IWXA 4OX7A 5HN0A 3FSYA 5E33A 2M9KA 1VIXA 1S9EB 1N5VA 3QJLA 2E66A 2VFTA 1SKWA 4TLQA 4DMZA 5A0YB 3TP2A 4CIOA 2V8HA 2R7TA 4I4BA 2YH0A 1WG5A 3MMBA 4NLRA 1Q8BA 1TAQA 1WEYA 3IRXB 3H5SA 2I38A 1UFWA 4ZPDA 4F4XA 2HGLA 2PSZA 3C6UB 4FPRA 4IR1A 4K4ZA 2R8HA 3BN7A 4WTYA 5FJ4A 3E51A 1Y00A 4IR9A 1TL4A 4KHPF 1FRJA 1V3SA 3CB4A 5KT2A 2C3PA 1J5EF 4J9RA 2B4PA 2A2DA 4LVNP 4ID8A 4JI1F 2KZZA 2FLPA 1S6OA 4CH7A 2KRBA 1U6ZA 1RDRA 2XC9A 1N4LA 2LVWA 1IR0A 1TP7A 1TFYA 1C0UB 2LMIA 5KAKA 2IAJA 2W7PA 2ZZMA 4FP9A 3EXCX 3M8PA 4J9MA 2UUAF 3DOKB 1D0EA 2YKNA 1LKZA 1Q78A 2DR9A 2ZC3A 1TUVA 1U48A 2BV3A 3NBPA 3GQCA 2B7BB 1BLUA 3MM8B 1GH8A 4DHVA 5LXRA 4YB6A 3GFXA 4QWCA 1S76D 3RW7A 2JLFA 1K8AT 2MZQA 5MAOA 4ZOSA 5K8PA 4A8QA 2GA7A 1M90T 2B4OA 1QAIA 3MUVP 2GGPB 2PIIA 4RX6A 4TLRA 4DV3F 2W8KA 2RRBA 3TUIC 4DN0A 4LQ9A 4TYBA 1JMTA 2Q3PA 1FF2A 5EWFA 1BD6A 1ZAWA 2MPUA 2C2DA 1N34F 1FRMA 3OXLA 2FLLA 1LW0A 2HRYA 4PQAA 1S9FA 4C98A 4USHA 4CO5A 4RNNA 4IO9Q 4J9PA 4TY9A 2JHEA 4HT7A 3AA8A 3IBWA 4G6VB 2JVRA 2X1GA 3FMWA 1KQFB 1V3ZA 3HFKA 3V6JA 2DRBA 1IJFB 1Q4RA 4F3QA 4F8RA 2R2SA 1SI9A 2JEJA 3VZIA 3E01B 4ID5B 5G0RA 2LDIA 2K7JA 3TAMA 4X4RA 3TYTA 5C24A 3KLFB 1U1PA 1SB6A 4N56A 2ZHAA 3J80Y 3QGGA 1OWXA 2I0XA 1S0VA 2VOOA 4X65F 3H2LA 1BQNA 3PACA 3TA0A 2IRYA 2LKZA 3OQ2A 5F8IA 5SZTA 1VQKS 1MW7A 3HHLA 4ILMA 1O51A 2A3JA 3KJVB 1TZ0A 4I6AA 3DYAB 4N47A 1WACA 4ECUA 3SCKE 3IWLA 3MUMP 2E9RX 1QUPA 2EKYA 1ZYQA 2AJ1A 3AH6A 4D3GA 1SH3A 1V3RA 3W2VA 1KTVA 4HDGA 2FVPA 1T3NA 4B9UA 4IRDA 2HNYA 4BCAA 3JAMY 2GHWA 1HBOB 2UUTA 2Y1RI 3O1LA 1H98A 4IOBA 3NNHA 3ZZZA 4PG7A 4C97A 4ES3A 4YR0A 2IBOA 1HI8A 5B0DA 3MURP 3WBZA 3OHAA 4XAKA 2MQMA 2M70A 4QR1A 1T03A 2CQCA 1WHVA 3KK1B 3LQVA 3GIJA 3PX6A 4RW9A 3LGMA 4ECRA 5KG0A 3FEZA 1FNOA 5DRKA 1LWFB 2DO0A 3EZUA 2BANB 4N77A 4KFBA 4MIWA 5K9FA 3CSKA 4JI0F 1G3OA 3CF5Q 1E6YA 1D8YA 1BGXT 2RF2B 3LWLA 1RTIA 3R3TA 2AYBA 5CYMB 2BRKA 4IRCA 2XI3A 4LJMA 4PUOA 3MR3A 4USIA 2JVOA 3I6PA 2EK6A 4MYTA 2MQOA 5E3PA 4O4RA 4O3PA 1FTCA 2YY3A 4RKUC 1XTZA 3K5MA 4ICLA 4UUXA 2VFSA 4WYLA 2WK4A 2WSEC 4HI1A 4TU8A 5A6WA 3LP0A 2POKA 2FC8A 5B08A 4ZPVR 1R89A 4EZ9A 1NJZA 3KKFA 4NLSA 2OFGX 3DU5A 1UAWA 3NMRA 1VI7A 3KNAA 2Q6BA 3N79A 1FJEB 4ZPTR 4NRTA 5A8RB 3BSNA 2JC1A 1HQEB 2CQBA 5IT4A 1H2UX 4YY3F 4KV8A 3RBDA 4M95A 1HNVB 2G1DA 1CVJA 2GHPA 3OL6A 2OSQA 1VQOS 1XEZA 2GNKA 2KU7A 2MGZA 2CJQA 4OJHA 3OLBA 5J1EB 2ZM6F 3ISZA 1SJQA 3CCVS 3U1MA 4PPZA 2NSCA 3KMQA 2ZD1B 4A8OA 2RIJA 5GADU 1T7PA 2IM3A 4I7FB 1VC5A 1YHQS 1T8EA 4M5DB 4O3OA 2LQBA 5I42B 1F2GA 4QYRA 4OJ3A 4O3QA 5J2QB 2Z0GA 1XR5A 1TKTA 2E5HA 3DLJA 1HPZB 3ITHA 2VODA 1Y5NB 1TL3A 4DJBA 2NYIA 3ETOA 4PG4A 2LQJA 4AL6A 4IG0A 2DGTA 1DTTA 1GX6A 3DRSB 2DVIA 1YJVA 2VKZG 5DDRC 3BQ1A 5F8HA 3I96A 3D1HA 4MFBB 1B0PA 3FEYB 1X9MA 1FTRA 2HNDA 3WDOA 4OHYA 3DRRA 3QIDA 4TY8A 1KHWA 1VQNS 4ZP7A 3EYZA 1GAOA 4C11B 5CQGA 2VKRA 2C2EA 1EP4A 4R5PA 2XMTA 1UA0A 1FK9A 2IM1A 3K5PA 1QE1A 4OX6A 4DQSA 4N5SA 3DLGA 4R25A 1M1KT 1VQLS 5J2NA 3I5AA 3MOZA 2LQ5A 3QO9A 3DLBA 4OZNA 3IR5B 2DPIA 2EVZA 1JLAB 2LQ9A 3OBIA 3R1HA 1TK5A 1NHUA 1RAJA 5B09A 5L1JA 2YKAA 1I94F 3HHLB 2YX7A 4YEAA 2ZBIA 4LF4F 2MKCA 3HVAA 2YVSA 1AROP 5HI7A 1Z4UA 1UEUA 1TK0A 1RT6A 1VQ8S 3CCLS 4LUBA 5LT5A 2VPWB 3OLAA 3MMAA 2CQ2A 2QE5A 1L3UA 5A8KA 3G4SS 4ZPCA 1ZTTA 5A8WA 5DG8A 3PW4A 4LQ3A 3G6YA 4ED7A 4I2PA 1WHXA 2HVZA 1GTHA 3KK2A 3EXYA 4ILLA 3QJJA 1X4DA 2LXFA 3JYTB 3PO5A 1TAUA 2OPPA 4DF4A 2J6SA 2PDAA 3SDEB 2DCLA 4Q7AA 2BXJA 3JSRA 1JLB