1KR4A

Structure genomics, protein tm1056, cuta
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
ALYFMGHMILVYSTFPNEEKALEIGRKLLEKRLIACFNAFEIRSGYWWKGEIVQDKEWAAIFKTTEEKEKELYEELRKLHPYETPAIFTLKVENILTEYMNWLRESVLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of CutA from Thermotoga maritima at 1.4 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
molecule keywords Protein TM1056, cutA
total genus 25
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kr4A00
3TA0A 4Y65A 2RD5C 1UMJA 1PILA 1VHFA 4OZJA 2JJ4D 2NUHA 2VD3A 4RX6A 4YB6A 4RWXA 4WK1A 4IYQA 3O8WA 3M05A 1NAQA 1V9OA 4C3MA 1UKUA 4YB5A 4CO4A 4Y6IA 1NZAA 2J9CA 4E98A 2O66A 4CO5A 2DCLA 2J9DE 4NYPA 2ZOMA 2O67A 3X3UA 2J9DA 2XZWA 1O5JA 2ZFHA 2XULA 1V3SA 4OZNA 4ZK7M 2XBPA 4CO0A 1P1LA 3LF0A 1VFJA 2GX8A 2V5HG 3AH6A 2NUUG 1V6HA 3AA8A 1KR4A 3HLUA 2CZ4A 2GNKA 4D3HA 2EG1A 1XK8A 4OZLA 4CO2A 5L9NA 5D4PA 4CNZA 1UL3A 4CO3A 2J9EA 1NH8A 3L7PA 4RLEA 5D4NA 2XG8A 3DFEA 2EG2A 2PIIA 3AA9A 1V3RA 3T9ZA 3GSDA 4USHA 3TA1A 2E66A 1H3DA 4AFFA 1GNKA 3N5BA 4D3GA 3NCPA 4YB7A 1HWUA 4R25A 3MHYA 4CNYA 4WK3A 5D4OA 5D4LA 5DS7A 3OPKA 4RWWA 3O5TB 3CE8A 4CO1A 1J2VA 1QY7A 3TA2A 1NH7A 2NS1B 4USJC 2GW8A 4C3LA 3AHPA 4USIA 5DRKA 1OSCA 4NYOA 1Q1KA 3BZQA 3NCRA 2Z0GA 1O51A 4C3KA 3NCQA 1UFLA
chains in the Genus database with same CATH superfamily
3HHLA 2MZ1A 4Y65A 4KRWA 4CLYA 2GGPA 3RJMB 4DR3F 1LW0A 1NSAA 2MKSA 4UZCA 3MEDB 5EGYA 5KFJA 1ZH5A 2QLFB 3DMJB 1O6XA 1Y9OA 5J1PA 4RX6A 3CCQS 3BSAA 1IBCB 2L48A 1HPZB 5I42B 2PO4A 1MMLA 2EKYA 3LTOA 3PTWA 1Y11A 3OV7A 1K1QA 2LCWA 2MKHA 4I6AA 3HJVA 1JB0C 4ENOA 3FRZA 3RB0A 4RW8B 2O1PA 5A8RB 2QEXS 1YBUA 1NAQA 2HHUA 5LJ3Y 5DJBA 4J5OA 4ED7A 1A7GE 1P9YA 3V4MA 2JX2A 3MM7A 1XBWA 2B4UA 3W2VA 2HNZB 4Z2XA 1X31C 3I56S 2JVRA 1VIXA 4WZMA 4LF9F 1N5TA 2GS8A 3DDKA 4B9TA 2CQ0A 2HHPA 5CAAA 1TK5A 4L75A 1CULA 2FJEB 3BGUA 2MKCA 3HZEA 1JLCA 4RBUA 1C0TB 3W2WA 1VCTA 1F9FA 3BPSP 2IM1A 3KJQB 3O44A 3R5DA 3UR3C 3AD7C 2UXCF 2G0IA 3SDEA 2YBVA 4YY3F 1RT3B 2KJVA 1LFWA 2DO0A 1NDPA 1UJ5A 1SC4B 1NSKL 2HPUA 3ONQA 3JB9k 5F8LA 1J5EF 2G1DA 2HAIA 3B4DA 1MSWD 2RQMA 1KONA 3DMJA 2V8GA 3R3TA 1F2HA 1HNWJ 3K59A 2RF2B 5FIIA 5KG4A 3AA8A 4IO9Q 4F26A 1NKBA 4USKA 2AEFA 1T9WA 2DR5A 2AT1B 1OY6A 1F9HA 4EI2A 1NK7A 5FDLA 1PAEX 3FMBA 5K14A 3ENVA 2HHHJ 1ZM3A 3CDWA 2YH1A 1W25A 4OZLA 1X8DA 2FJAB 3NP5A 2Q3PA 4M5KA 4ZPTR 2MQPA 1DTQA 2J9EA 5KG1A 4HKQA 4K4UA 2J6SA 4JI4J 2QJ3A 4DV4F 3TX0A 1T05A 1DTQB 3Q8SB 2ATLA 2IM3A 2W4DA 4KV8A 5SUHA 4DUZJ 4FYDA 2J8AA 1YBAA 4ZVSB 4DOZA 1OY9A 4JI0J 2JEGA 1WG4A 3T9ZA 2RHSB 4PEOA 1PGZA 2UXCJ 4M5GA 5KFNA 3JSYA 1CJKB 1PG5B 1S72S 4H4MA 3GQCA 2G13A 1W2IA 1R8CA 1LFPA 2H9ZA 4J9QA 3TAMB 4AFFA 1FK9A 4ZN3A 2AJQA 2HQCA 5CYJA 4U95A 3Q8VA 1QJHA 1GK8A 3MHYA 1YZ6A 1OY8A 4OJ1A 3OPKA 2DNNA 4NXNJ 2R7VA 5D8HB 1S48A 1XMOJ 3NWRA 3VAGA 4G6VB 1HARA 1GFWB 4K2XA 5CCMA 3A8EA 4CDIA 4FN5A 5ITHA 3OL8A 3OHAA 3QT5A 2YVSA 2YWGA 4KQZA 4TNOA 2FYXA 3TQ1A 4LF5J 1HNXJ 2W2NP 2FVRA 3ILJA 1RAFB 4X64J 4Y28C 4B3MJ 2CQGA 5KTQA 2QLBB 1T9YA 5DRKA 3ZTRA 2UU9F 3NCRA 1EAYC 4E2FB 5M2RA 2PC6A 1U48A 2K2PA 5HMYA 2DISA 3UO0A 2C2DA 4NXNF 4PWDA 2DGWA 1CQMA 4OHZA 2D3ZA 2DD8S 4PAAA 4UOGA 2A1BA 4DG1B 4EBCA 3IWNC 3TRGA 1S1VA 1TL7A 2V9KA 2D74B 4OZJA 5C7PA 1VR6A 4KSEB 2J6UA 2NZCA 1PJ7A 4J91A 2V67A 4N7TA 4RW9A 1OMSA 3CCJS 1TVRA 3KXDA 4PWWA 4ZOSA 2ZC3A 4URGA 2W8LA 3UN5A 4IYQA 5ETVA 2GFFA 2RKIB 1P8GA 1YJWS 3O8WA 3RR8A 4ELUA 2V34A 4ED6A 2WK4A 5E3PA 3CULA 1MWZA 2AD9A 1FTRA 3W64A 2QTWA 3RG6A 3UE2A 2HBYB 5IOLA 1GX5A 2YNGB 3HFKA 2H5EA 5GAEU 1R3NA 4NLOA 1VQKS 3GLJA 1Q78A 2RF2A 2J9CA 4DMZA 1F9EB 5LSRA 2YY3A 3BSOA 1Q7YT 2CVEA 1PBUA 3MEDA 4MT1A 1KFDA 4HLBA 1F5AA 3PKYA 3F73A 3EZOA 4LFAJ 5F0UA 3R7SB 4DFJA 2XO6A 2B0GA 4B3SF 4FBTA 1FEEA 3MOJB 2B9XA 2V94A 2GQ2A 3E8OA 3OR2B 4OHXA 2P5VA 1CS4B 3EM1A 5KFGA 4CQ1A 4RNOA 3HD2A 2CJXB 1C1BA 2VF3A 2XSJA 4ETZA 4J7CA 5IC4B 2BQUA 1FNXH 4R8UA 2QA4S 1HHTP 2G1HA 2MYFA 3K5PA 4OX9F 4A47A 3JYTA 4JOUA 4JI8J 4F2SA 2E29A 1AROP 2IPOB 4NMLA 1P1LA 3EYZA 4WXWA 3FFIB 1VQ6S 1WDDA 2G2ZA 4ZP6A 1REGX 2NUUG 3ULHA 2GO9A 1XERA 1RK8A 1WWHA 1ICEB 4EZ9A 3NNAA 3TR5A 2FY8A 2H51B 3EX7B 5HMWA 2MY8A 1C0TA 2H5IB 3DM2B 4MAKA 5IC6B 4I1TA 2KFYA 2H4YB 3V6DB 4K4VA 1YSJA 4F36A 1AFIA 2J0WA 1S76D 4F4WA 2RHQB 1JWWA 4NASA 3M6XA 3G96A 4K0KJ 1RT5A 3CDUA 4D3HA 4S0MA 2Z57B 2VC1A 4JI8F 3C6TA 2R2TA 1UW4A 5FLXY 5I42A 4H4OA 2NPIA 1N4LA 3OL6A 2AEMA 2K3IA 2KVQE 3J81U 1U1MA 2MSSA 3UCZP 4JV0A 2FVCA 4FXVA 2Z2MA 2OPRA 3UQSA 3J81j 2IDLA 1MWQA 2NSCA 4DR4F 3FDSA 3CCMS 2ACMA 2UVRA 2CPIA 4F3OA 4HTIA 1TMJA 3PIOQ 1UVMA 1TKXA 2HHXA 4NLRA 2QMUB 4ZVEA 3MM5A 3PACA 3GSDA 3T19A 2OD6A 3HF5A 3EVMA 4NCGA 2LU2A 2QL5B 2XGQA 3M9NB 4KPYA 4R0EA 4F7VA 4E8UA 1FVSA 2RS8A 4JBCA 2HWTA 4DPTA 2EBEA 4F4ZA 1A9NB 1HWIA 2XZTB 2F4VF 1C2PA 2KL8A 1VRUA 2VBZA 1RHQB 4LBHA 4WPAA 1X4BA 2XMJA 2IRYA 4C9DA 2ATCB 3MEGB 1F5BA 3O5TB 2X3GA 1I5OB 4DUYJ 1J5OB 4Y3CA 2DNRA 1RYSA 4L76A 4M5DB 2KKHA 4QIWD 3TJ8A 1S6PB 1D9FA 5THWA 4LSLB 4JI6F 3M8RA 1HWKA 5L46A 3V6JA 4DU8A 1NK4A 1RT1A 4OYAA 4TVAB 1SV5B 2PMHA 4N41A 4RO0A 1Y00A 4DBQA 2IY5B 3A3PB 4I67A 3N4WA 2CFXA 2YXLA 2HWIA 3CB4A 3SFGA 2V2VA 2GCFA 3G82B 4U7UK 1UMJA 4K4SA 1UFLA 5HANA 2ZKTA 3TZWA 3CVKA 1UEKA 4CYUB 3L7UA 5IS2A 1RWPB 4NLGA 3ZTQA 1LWCB 2HK3A 4OYWA 3MDFA 1IVZA 3W8GA 2FTRA 1YJUA 1BE4A 2H65B 3KLIB 3N6MA 4WKRA 3PCOB 3PX4A 4JI6J 2Y1RI 3D6MB 2KRBA 4RNHA 3DOKB 1PJ5A 3SCLE 5DQIA 3POTB 2W1BA 4Y0FA 2KXNB 4DF8A 3MPYA 4ILLA 2EFNA 2PGCA 2BYCA 4OYOA 4WYLA 3RBEA 4FF4A 1GXUA 1JLAB 3CEDA 4A8OA 5DDPC 2DY9A 2ZUAA 1EKRA 3U1MA 3DM2A 3ZZYA 3PR4A 4KTQA 1FJCA 3FCVA 2OELA 1UKUA 4H4MB 3WBZA 1LWFB 3QFWA 2MLXA 2F4VJ 4DN0A 2XS5A 3GV5B 4TKTA 3R27A 1FCAA 4NL5A 2L41A 3IM8A 5A6WA 5DGAA 4ILRA 1JLGA 2AJFE 3CCVS 1K8AT 4B3OB 5KFDA 3QRQA 3LALA 1Q82T 4DUYF 2XZWA 3OXFA 1RTDA 1N32F 4PQAA 2QV6A 4M5DA 4LFBJ 2CQCA 3R97A 3IR6B 4CM0A 2GIFA 4IO1A 1HQUB 2BMBA 1KKHA 3TVKA 1LK7A 1NPKA 1TKZA 2HKEA 3CT9A 3IS9B 3NGUA 3W8PA 1VQPS 2D3O1 3QGHA 1AUSL 2G0CA 3MM5B 1MWYA 2V5HG 3T41A 2K8GA 2XI3A 3BO4A 4JV1A 3CMAS 5B0DA 2KFZA 4L3KA 9ATCB 3P96A 2MZQA 3BS9A 1VQOS 2I5JB 3IBFB 3KK1A 3Q83A 4DEZA 2C2MB 1SH0A 3GTYX 3TUZC 2DH7A 2CZ4A 1AZSA 2EFVA 1T9VA 1MNEA 1S59A 4OFZA 5CABA 3TAQA 1HYSB 1PSDA 2MZTA 1L3KA 4HTJA 4Q5VA 3MMBA 2IVFB 4CO2A 3MFHA 2X1AA 2J0SD 3CNQP 3PHEA 3ZC4A 1CQNA 1JNZB 2HBZB 2B5JB 5E0OA 4P7TA 3AB4B 2Z2LA 2B43A 3MUMP 4UY85 2BEFA 5KT5A 4PRFA 1WC1A 1TKTA 2W2PP 2V69A 4YDDB 3BH6B 2JC0A 3H59A 3V4IB 3M6WA 4ZMMA 1EP4A 4P6QA 1M5PC 3DRSA 2RVJA 2QA2A 1ACMB 2HQGA 2RT3A 4HT5A 7FD1A 3K58A 4DQQA 3Q8QB 2DXDA 4ZITA 2DNHA 4OV1A 4U6PA 2HZVA 2BKOA 2OUGA 3Q2SC 4OZ0A 1DRZA 1HQ2A 3DRRB 3OXGA 3G6XA 5GAHU 3IA0A 1U1RA 4OYZA 1U1PA 4LF6F 1B70B 1N54B 2K7JA 3N5BA 1NU4A 2AJ1A 3FBFA 5EN1A 2PMZD 2XY6A 2RUGA 3IO1A 1RXOB 4HDHA 4KO0A 4USWA 3W5ZA 5KFCA 2ZOFA 3I5CA 3VGTA 3DOKA 4KGKA 4N8OA 1S9GA 1E6YB 3RR7A 1WELA 3DXBA 3BQ0A 2F8HA 4XO0A 2IDEA 5EHHA 1FXLA 2HHSA 3P4UB 1WC5A 1FX4A 3PYDA 5D0RA 2IAJA 1QY7A 1TP7A 2R7WA 1TFWA 1EARA 1H0HB 1HWLA 2NS1B 1CPZA 1SVDA 2W2OP 2BANB 4QBUA 2J76E 4ICLB 3C3LA 1H73A 3MPWA 3R6GB 2BE2B 1EZZB 4DL6A 3WDOA 1LV5A 5D78A 1JLAA 5KG2A 4ERDA 2R7OA 4NI2B 2IIHA 1SIZA 2GJFA 4DSLA 1Q8KA 2ZJPQ 1C4AA 2NZ4A 1BMQB 3NL0A 4X4UA 1EETA 2GQQA 1RTHA 1O51A 3OLAA 1N6QA 5CZXA 2CJKA 2OHDA 3R5AA 2OJ3A 4NLSA 2NYHA 1HQUA 1JLGB 1H2UX 3ETOA 2R9LA 4B3OA 2QMXA 4Q2MA 3BKUA 1WEXA 2V8DA 3CD5A 4ZCKA 2CQHA 3F41A 3W62A 3LWMA 1WI8A 2OEMA 1MROB 3K8VA 4OJGA 5IXUA 4DV3J 1NBEB 2CNKB 5GMDA 3M9MB 3Q89A 2LDIA 1KD1T 3NGTA 2LEAA 4AUKA 1XC9A 4LF6J 3BKFA 2C28A 1HKAA 2QLXA 4MJKA 2BX6A 2OP5A 4X66J 2ZBCA 2G2OA 1OPIA 2BJ7A 4CO4A 2IAJB 1RYRA 2LDYA 5KG0A 1FNOA 3QSYB 4UY8T 1U02A 3THVA 2FC8A 2ZH8A 4QYZK 1SH2A 2J0XA 4FXWA 3BYRA 3P49B 4ECWA 1GXTA 3H2VE 3JSMA 2XMUA 3OFEA 4URSA 3L4BC 3S7RA 1S1XA 3BBBA 3VZIA 2DHAA 2R7QA 3HP6A 1MN9A 1RDRA 2O5DA 4IFVA 4M5HA 4DJBA 4DN9A 4USMA 3FSYA 1RHMB 3MEEA 4C0HA 3ZNJ1 2AHOB 2OEJA 2XULA 1V3SA 3MCOA 2BJEA 2UV8A 5DG9A 3M8WA 4H54A 4WP8A 3HHDA 2MJUA 3SCIE 4BC9A 2RDJA 5CYQB 4K7QA 3FZ2A 2ZITA 4F04B 1KLMB 3I5AA 4YHHJ 2YX4A 4CLZA 4DR1F 1X9SA 2WSCC 4L74A 2V4JB 1RT3A 1FE4A 2YKAA 4EWTA 3B54A 3R2CJ 4OI6A 1VOMA 4TYAA 2DGOA 2QZ8A 1B99A 2W7AA 1EP4B 3RZAA 3TAMA 1WC0A 3AFGA 4O3OA 4DPWA 4ETXA 2FY1A 2VQFJ 2W01A 2FLPA 3CUNA 1JKHB 2ZD1A 3M8SA 1IWGA 1DY3A 5K20B 3MURP 2HVIA 4CP5A 1Q81T 1RAOA 1S99A 3I9V9 4FZVA 4I69A 1F60B 2Y3YA 3R5CA 1DTTB 1FRMA 3CO9A 4KGVB 3GJRB 3VVUA 4DHVA 4YY3J 1YVFA 3BV8A 3JYTB 3HULA 5HVHA 1FRKA 5ETNA 4TQSA 1S4EA 1QTNB 1N52B 3D6HB 4ZVUB 5JUMA 2AYGA 4B3TJ 3AOBA 1RU1A 2LLZA 3DOLB 3OFHA 3MM7B 5EWFA 1YK9A 3KK1B 4M5NA 1Q16B 2QGFB 3D0GE 3MEKA 3GIJA 3CD6S 2Y1IA 5DG7A 2PIIA 3W5YA 4K5RA 2PEBA 1M5SA 3J80U 5LXYA 4HHJA 4YOEA 5J2NB 5HBMB 3DLHA 4J9LA 4MYTA 4NA3A 1SQEA 2HHHF 2J0QD 2YNIA 2CQIA 2E66A 3VCDA 5DQGA 2ZWOA 3QMQA 4QR1A 4YR0A 3M8YA 1WTFA 3NCPA 4I0WA 4OL8A 4DL0C 4F3QA 2A6OA 4YMEA 4ED5A 1VQSA 3BO2A 4G1PA 1U7LA 2IMOA 3DNCA 3VHQA 3SCJE 3OFFA 3BQ1A 3ZZZA 5FD1A 1S0NA 1EQ0A 3KJVB 1KTQA 4QW8A 3A12A 1LXJA 4DUTA 1J2VA 5B0FA 3I87A 2BQ3A 4QYRA 4USJC 2E5LJ 5ETLA 1HPZA 2R8JA 3KHLA 1HBUB 4O4GA 4C3LA 3C2PA 3SSRA 6FD1A 4ITSA 2DNMA 1WTBA 5E7OB 2JHEA 3UPFA 3OLBA 4X4NA 1UVKA 4C48A 5HL7Q 2YQ3A 3QIPA 2RILA 4I2QB 1AUDA 2VOOA 2HS4A 4RW6A 2IM2A 4FKXA 3W2VB 2M8DB 3QT6A 2NLWA 5I4MA 1QSYA 4M8LA 2O01C 2V2QA 2XMTA 3MEEB 1NHKL 1LWEA 5J2PB 3IBWA 2LEBA 4NEZA 1N8RT 2FZGB 2W7PA 4LFCF 1FJGJ 3DKDA 4UUXA 4OYMA 2MQLA 4BCAA 3AB2B 4PZVA 4H4KC 3JTOA 2CQ1A 1WUUA 2LQ5A 4KGMA 2DNQA 3M2RA 2WONB 3H5UA 1S1WB 3RAMA 5F9LA 2E9TA 2HLTA 3EICA 1TL3B 3PKMA 1NHUA 1BGXT 4CTAA 2RNEA 2XY5A 1YTYA 4ECZA 4EFAC 3J7YI 3W60A 2WTFA 4ANEA 2EK1A 4R5PB 3AJ2A 1JLQA 4YP3A 1IKVB 1S79A 5F0WA 1LWCA 1ZAVA 4X4SA 3UDEA 1VQMS 1QTMA 2ZOMA 2O67A 1NZ8A 1GH8A 4URQU 1TKZB 3IS9A 1EB0A 4PXCA 1VQLS 2IM0A 3ISZA 5IFMA 4DQIA 1SKWA 4AT1B 4M63A 3NOCA 4WTYA 1RT7A 4A8SA 1VQYA 4X84A 2DR6A 5BJRA 3VTIA 3KK3B 1ZYQA 4F2RA 2MKKA 1HNZF 1BC6A 3VAMA 3K2YA 1YQHA 5AXNA 4K59A 2X51A 1JK9B 3M8QA 4QZVB 4RJVA 4DSKA 4MK8A 2HFOA 3AH6A 3QWPA 5HQLA 1KTVA 2ZDOA 2F1FA 1EKSA 1HBNA 4PPDA 2SXLA 4C98A 3QQCD 2X1BA 1S49A 1L5UA 4DUZF 3CJ5A 1QAIA 2QYGA 2BANA 2BE9B 3PW5A 3QAEA 1VRUB 4LFAF 4K2JA 3JTNA 3QRPA 3LOUA 2F3JA 3NBPB 3SSSA 2EPIA 4KH0B 1X4AA 3U1LA 2O3DA 5A2QY 1VQ8S 4KPCA 1VYAA 4ZPVR 2A18A 4ZVTB 3OR1A 2E9ZA 4KYZA 4LRBA 3IR7B 4C97A 1RJJA 2D1CA 4EBEA 2R7UA 1BHNA 1NH8A 2DEIA 2VDHA 3D9BA 2RRAA 4ZVGA 5KFSA 4WFAQ 4GO7X 1NPPA 2H3EB 4LJMA 4OI2A 3SCKE 4KC5A 4IUFA 4F50A 3MI7X 2UZAA 2J8SA 3RAXA 4EO8A 3TARA 1RHKB 1S4FA 3DN9A 3G8QA 3ILOA 3JAMY 1N5VA 4Y2MA 3RRGA 4ED1A 3RUBL 1U09A 1PYOB 4EYHB 3T5LA 1AXQA 4J9VA 3M8QB 3KJFB 4X64F 4KY3A 1MU2B 2HRUA 2P8IA 4O4GB 4WFZA 2IFXA 2GMJA 1RZMA 3DRPA 4MIAA 4CLTA 3VVTA 3TZXA 4FS1A 2IC3A 3WHIA 3RAQA 4D3GA 5L1JA 3DXSX 2ROPA 4DQRA 4IRCA 2OTJS 5GAHI 2GVZA 1X5SA 3H40A 3OVBA 3CC4S 3KOAA 2ZZTA 3QGGA 2CNOB 3BR8A 2XZDB 1T03B 1CULB 1Y7PA 2Y0BB 2QLJB 1EX8A 4ECTA 2XHWA 1RTIA 3MOZA 5BYRA 3UNYA 2MHNA 3LPEA 3W5XA 4F3MA 1CEZA 1NK5A 1QUVA 3EPGA 2XMWA 4M5LA 1G3OA 3RGIA 3HVTB 4DV1J 2E1CA 3KWMA 2GW8A 3DRRA 1S1TA 4PYAA 2F9JA 1IR2A 2YTCA 4AYBD 3HT3A 4JYAF 3NGKA 1RT5B 2W8KA 3V4IA 4BS2A 1XMQJ 3MMAA 4ELTA 2ERRA 2MQOA 3C16A 2HQFA 2ZKUA 1Q4RA 2YWWA 4Q8FA 3TJAA 4DZ6A 2BJDA 1QAYA 4BWJA 3KK2A 1S97A 3KUGA 4KBIA 3Q23A 5A0YB 1XMOF 1IWAA 4BWMA 1JXVA 2MB0B 3FSXA 3H0PA 3H4DA 2IC3B 5LMUF 2LXIA 3H5XA 3FZBA 2HFSA 3ZTSA 3PRDA 1UVLA 4OZ2A 2VFTA 4R0JA 4YB6A 1D8YA 3H20A 4MKBA 2BVZA 2BZ2A 2JH3A 2BKPA 2V6AA 2ZHBA 2BOPA 2KN4A 4ED2A 2VU5A 1DLOB 3RB4A 1J5EJ 3CCRS 3CJKA 1K0TA 1JIHA 2DR8A 3CCZA 4DI6A 3MM9B 2R8HA 2FIUA 2MHEA 3A8JA 1PC4A 2PFDA 1RQ0A 3GWCA 4OX8A 4C8MA 1N5YB 5ETMA 3ZZTA 2MXYA 3R5JB 2DNYA 5F41A 2RRNA 2LFVA 3MM6A 5F9NA 1ZM2A 2HIYA 1IKYA 3IWLA 5ETPA 5C42A 5F8HA 4AXIA 1RGVA 5L38A 4EEYA 4EYIB 4OLOA 3VGSA 1WACA 2ADCA 1NB7A 5T14A 1TELA 2DPJA 1UEVA 2HFUA 1S6UA 1N48A 3K8WA 4TY8A 1MW7A 1IR1A 2VPWB 4C0OC 4ZK7M 4NA1A 1CSJA 3IG1A 3FNNA 3OBIA 4NLUA 3R7NB 4B17A 1FD2A 1PYSB 1U2RA 3VQSA 4C0BA 4CO0A 1ZZFA 2EC2A 1F3FA 1H2VZ 3LF0A 2ZNYA 3V6DA 4RU2A 4DV6F 2GX8A 4A8FA 3DC2A 3DLEA 3LAKA 1BQNA 1JNRB 3DI6B 5E3CA 2ZDPA 3HX9A 4MKVA 5KFTA 4USUA 3NMRA 1ZTWA 2F4FA 2CA9A 2CQPA 2VV5A 3C14A 4WP3A 4G3IA 3W65A 4RUAA 1U1KA 2C3MA 3QJJA 4DV7F 2QE5A 3H5SA 2VPYB 2XS7A 1FNMA 1KQGB 2RU3A 3OJSA 1YJ9S 1YJVA 1SL2A 7AT1B 1RWMB 1YJNS 5D4PA 5KG5A 2OTLS 2B8QA 2PE8A 3GP9A 4ZVHA 2E5JA 3DOMB 2H5JB 5L1IA 1TL5A 1I6JA 1RA7A 1ZM9A 2WVBA 4B9VA 3HXMA 3GJSB 2N82B 1WC6A 1U25A 3NMAA 4YEAA 1VMBA 5I3UA 1GMVA 1LWFA 1RA6A 3HKZD 3F56A 4FYVB 4L73A 5B0AA 1GMWA 1RB0A 3HZGA 2XLJA 2W9CB 3DFEA 5HN0A 3FQKA 4EZ6A 4JI3F 1BY9A 3R9LA 5I3UB 2ZH3A 2CPZA 4UTGA 4X4RA 4TQRA 3DCAA 2MZJA 4XPEA 2XCAA 1SJ3P 2VPXB 4HT7A 2AX1A 1R8BA 3C15A 3IFEA 3NGRA 1CJUA 2HBRB 4PPZA 2XY7A 1N36J 3IRWP 5KFVA 1JJHA 2IRXA 2CPDA 5HVGA 1UAWA 3OL9A 1OYEA 3UD4P 3ISND 4TLRA 3GIIA 1U1QA 3AOCA 3AXKA 5KOXA 4IKAA 4DL3A 2FJWA 1FERA 2YNFA 4DLGA 4ILMA 3QLHB 3C6TB 1M0SA 3M8PA 2P6SA 1RADB 4LSZB 3G8TA 3DI6A 2XC9A 3FBBA 1HFEL 4IH7A 2COLA 5CCLA 3MPDA 4DV0F 3MAHA 4P75A 4IRKA 4P7VA 1E6YA 1P27B 2EFQA 1TL1A 3LP2A 2BJ3A 4KE5A 2C42A 3BH7B 4MK7A 5A8WB 5EWEA 2HYIB 3CJKB 3T1HF 1FE0A 4F0KA 2IBKA 4OHVA 4ID8A 1EJ7L 4HI2A 4UF4A 2RH3A 1N88A 3FQLA 2ZM6F 2GHPA 1GXLA 1RCXB 1OJ4A 2D69A 1FRIA 4GO5X 4GVBB 3JXOA 5ETOA 2E1RA 3S1TA 4C3KA 5DETA 5DLFA 1G6BA 1HA1A 5AXLA 2KT5A 1SJFA 3VGUA 3AD8C 2PD1A 4NLYA 4XAKA 1IJEB 2PA3A 3MM8A 5G4DA 4EU0A 3HJFA 3EPIA 1CC8A 2RMLA 1FKPB 4AL6A 2NUHA 3F0NA 5BXIA 3VWSA 3BSNA 5J1EA 2DVIA 4LF7J 3M4XA 1PJ6A 3BN7A 4HVZA 3N6LA 1SQFA 1YZ7A 2WSFC 4GRSA 3U7JA 1HMVA 1NXIA 3ZZUA 2ALZA 4NLQA 1VJWA 3WIVA 1URNA 3C6UA 3CDBA 2R8GA 4C3MA 4O3SA 3Q2TC 4DL5A 4WJBA 2I9SA 1VC6A 1M5VC 4JI2J 4Y6IA 2DGTA 1K47A 2CAJA 4CM2A 5LMUJ 2L9NA 2M9KA 3U27A 5CA5A 2FLNA 3GPAA 3D1QA 1CJTA 4O44B 3LGMA 4ZIVA 5DM6Q 1X0FA 3KJNB 4NCAA 3CJ0A 2EEYA 3OTBA 2HWHA 2KHDA 1FWPA 3CF5Q 3PFEA 2XI2A 2VBYA 2G0JA 4PG5A 3TUPA 1NLKL 2VQEF 1KVJA 3BDEA 1RWXB 4IG3B 4WIIA 4HACA 2VPZB 3EUNA 4OLPA 2K7KA 2NXNA 1RWWB 3EGWB 4RW4B 5IM0B 3CMES 3LP2B 1NJXA 2VC0A 2YKNB 5H1SV 3UI3A 1FHTA 2BBEA 1T9TA 3I6PA 2DTJA 3OUYA 3FSIA 3E2EA 2Q1LA 3EXYA 1NB2A 3IGNA 3FFIA 2QG9B 4FYYB 5CHCB 1I51B 2HW3A 1RBLA 3TANA 3IBCB 2UUBF 3HVTA 5EDWA 4IR1A 1IBKJ 3I96A 4KGXB 4LRFA 4Q2LA 1SCJB 3TVZA 1QUPA 1D3WA 3MAAA 2ZH7A 1FVQA 3M1VB 3DLLQ 3PX6A 2MGZA 3PIPQ 4QIFA 4C8NA 4QR0A 3SSQA 2ZJQQ 3T5JA 4NRUA 3SEOA 1GTHA 2ASLA 1RHUB 1X9WA 2PI5A 1JXEA 3GIKA 4TXSA 4A8WA 2E7WA 2JNJA 4XDDA 5IV3A 2JZ5A 2GMLA 1SKRA 3LGHA 2WSEC 4A8QA 1SB6A 2ZHOA 3U02A 3WIUA 2XG8A 3CC7S 4P10A 1NSQA 4KHPF 3C8YA 3N01A 3G71S 2IJNA 4NYZA 3OL7A 2VICA 2HHTA 2HRTA 2KYZA 4Z7CA 4NLPA 2FVPA 3P5TL 2PSZA 1TV6B 4MYUA 4NLDA 3SV4A 3SQGA 2DH9A 3V81B 2LU1A 4QYZJ 1I94J 3ICLA 3K5MA 5BR8F 4I56A 2FVSA 5SZTA 2P9GA 5D15A 1J5OA 1UVNA 2HNYA 3MCSA 1T8EA 1YWXA 4ZLJA 5T41A 2BA9A 5HO4A 4GVLA 1Z2ZA 2JL9A 2D9OA 1U6FA 1ZPVA 3VGVA 4BC7A 3DLEB 1Y5LB 4A8KA 1IKXA 4C8LA 2YWFA 1PC5A 4R5PA 4FYWB 4ANCA 4NZ6A 2P9EA 4QQBA 4CLFA 1XN9A 1TAQA 5B08A 3W61A 3I5BA 2ROGA 4XTTA 1R7IA 1OS5A 1TUWA 1F0XA 1X5TA 3IAS9 4NYOA 3UFCX 2CIMA 3CJ2A 3J7A1 4DSEA 2FJBB 2PT0A 3L95X 1N34F 1RBOB 5E3RA 1RT1B 1TMMA 4FVCA 8RUCA 1CLFA 2Z0GA 2RQ4A 2DGSA 3VAFA 3A3OB 1S7IA 3GR1A 4ZCMA 3OTOF 1S9EA 2GV1A 2YWKA 4IOBA 4MH8A 4NCGB 4CT8A 2J6TA 1PILA 2APOA 1HIYA 1YI2S 4W90B 1FJ7A 4I6WA 1WKKA 3G9CA 2MPUA 2IVMA 5KT3A 3J80Y 4FVMA 4QIGA 4KAIA 3W7BA 5JVGQ 4ZPAA 4LVOP 2PI4A 1LWEB 1PYTA 2JLFA 3K5OA 5J2PA 2ZUGA 3QWUA 2X3DA 4ZS6A 4BBYA 2LP4A 4NCBA 1U2FA 3M6UA 1Q8IA 4RKUC 2Y9HA 3UVJB 2CXEA 3K7RA 4KV8B 3HPOA 2QFJA 2JFDA 1PAUB 3P8BB 4YR2A 3MR5A 2VG7A 1S6PA 3T6BA 2CJYB 3CCLS 3CDAA 1VLOA 2UXBF 2NREA 2HVDA 4KT0C 2J9DE 1C1CB 3AQPA 1DZ5A 5KFAA 2Y0SD 1HWJA 2QFIA 4DCOB 2FHMA 1QM9A 3BBCA 3IG1B 3A13A 4OMFG 3KLEA 4LF8F 1FD8A 1Z2LA 2RQKA 4X4VA 4C11B 4F0HA 1ZPWX 3FC9A 5D6GA 2J7KA 2GGPB 4OI3A 2EKNA 2XM3A 5HP1A 2DO4A 1ZAWA 1M5OC 2VFUA 4TN2A 4XK8C 3KKFA 1HD0A 1KQSR 2Z56B 4QPXA 4EK2A 2EW9A 5IQQA 5HP1B 2HMIA 1RWOB 3BN4A 3D54A 5J2QB 5J2NA 3HHKA 4O23A 5DZ7A 3AD9C 3JS9A 1M90T 5F8NA 1V6HA 3MM6B 1QAJA 2CPJA 2MZRA 4ZA1A 2CPFA 1KR4A 3AY0A 2EFGA 2YKPA 3JQJA 3JAMU 3G4SS 3HHLC 2FGOA 2BJ8A 4YDXA 4DV7J 2GIQA 3JTPA 3H2LA 3R5BA 4YHHF 2R2UA 4ZVRB 1IBLF 2HVEA 5EUHA 3RU0A 2C22A 1TK8A 4RW7B 1AZSB 3KLFA 2CRLA 2WBRA 3G6VA 3KUEA 3PO4A 1OWXA 2YNIB 2QL7B 5HROA 4WIQA 1IM6A 4QIEA 4LBPA 1TL7B 2R42A 3PRBA 4ELVA 3QATA 4ZPWR 2ZM6J 3IR5B 4J9OA 4YFUA 1T3NA 1HBUA 3GMGA 3W1YC 4RW9B 2LA4A 3QSIA 4WCEQ 1LOUA 5KFBA 3BO3A 1AB8A 4DL4A 2F9DA 1W26A 1TKTB 3PJXA 2OPQB 3CJSA 2FDNA 2MQQA 2BRKA 6FDRA 2V4JA 3QT7A 4DR6J 1VHIA 2BKNA 3T3FA 1RT6A 1C0UB 1RWKB 2ROEA 4Z7YA 5LXRA 4A4JA 5MLCV 5DGBA 4ZP8A 2VJVA 4KFBA 3DHXA 1GNKA 2UVWA 1C1BB 2XSJB 4CH1A 5C25A 1Q79A 4FNHA 5GMKa 4N5SA 2DITA 2XLIA 1RAEB 1OIAA 3GG0A 1ZM4A 3I31A 2NYIA 4ECQA 5D4LA 3PW2A 2B6AA 3GE9A 1Q53A 5AXKA 3QYYA 1HBNB 1X7VA 4IG0A 1WF2A 3OVSA 3MCMA 1ZTTA 2E7XA 4JUZA 2DRBA 3LP0B 2WB1D 1IKWA 3DGPB 4ZP9A 3ZNUA 1HQEB 2E1MC 1YG0A 3H42A 3C15B 3MMCB 1HBOA 1XMQF 5F8JA 1XWLA 1UCNA 1OSCA 1IJFB 2BW2A 2KT3A 3QJLA 4Q0BB 1XR5A 1KDNA 3ENAA 4Q43A 1HNWF 1HI1A 1SUQB 5F3TA 1D8ZA 2GIRA 5DG8A 1FESA 5KFKA 1S77D 4PXDA 2AWZA 2XNQA 1JJ2R 4Q8EA 4Q7AA 1FEHA 2V68A 1IKVA 2YKMB 4RUCA 4DPXA 4I7FA 3LAMA 4K4YA 4RWXA 4PYDA 4B9UA 2HBQB 3CWJA 3T9NA 2KZZA 3GU0A 4I7FB 3MR7A 4DV1F 4N47A 4PR6A 1LEOA 2YH0A 1RAIB 2GC8A 1H6KX 5C24A 4CLKA 4RBVA 2V9WA 5JJBA 1V9OA 4Q44A 5KT6A 2DIVA 3LH2S 4HI1A 1TV6A 3QZ8A 5BYQA 4DV4J 3V6KA 3V81A 2M3DA 3FVYA 2PDAA 1RTJB 2C2OB 2MJNA 4QOTA 2W24A 2NPFA 1RWVB 2XTJP 4IFYA 3VAKA 3BREA 2LECA 1RTJA 1KC8T 2CQ4A 3I9ZA 4LRDA 4LFCJ 2J9DA 4ZPDA 3GIRA 4CLPA 4B9LA 1GMWD 4QIVA 3MUVP 2OGUA 1F6TA 4TY8B 3VQTA 1VC0A 2E44A 3LP0A 5C42B 3A1YG 3BQ2A 4B9NA 4DR7J 3CMQA 1WC4A 4FPRA 3TP2A 3MR3A 1TK0A 4QCLA 2MKYA 2WAQD 4LSLA 1N34J 4NLVA 4N77A 2M52A 1VFJA 2KU7A 2VG5B 5K8OA 4DFMA 1R0CB 1XR6A 4QWAA 1ULRA 1YRXA 4PKDB 3PY8A 5GMEA 3TEGA 2HZCA 2J7UA 3BSCA 4DR3J 3LPYA 4W98A 3HSJA 2QO3A 1NK0A 1S9FA 3X1LB 2OSQA 4O0IA 4MIWA 3RBDA 1XQIA 2N4DA 2D41A 3D2WA 1B3TA 4DR7F 5IT9U 9RUBA 1JLQB 3FCWA 1YIJS 5GADU 4M95A 1TFYA 2HNZA 2EG1A 4Y2CA 4F02A 3I0SB 5L1KA 4HH1A 1L3VA 2A10A 3OD2A 1WJ9A 1UL3A 4K50A 3E01B 3BGFA 4KO0B 2VG6B 3P6YC 2YWEA 5HLFA 2LQ9A 2B6AB 2VH7A 3BR9A 2UV8G 1DBDA 1MN7A 1LW2A 2BJ1A 1RWNB 2FHJA 3M2VB 4GMKA 3MECA 4LF2A 2IA6A 3OJUA 1JJ4A 4ED0A 1IXKA 4U7CA 2OH2A 4WU2A 4OJHA 4UZBA 4YB1P 2VB6A 2CWXA 3HVRA 3KTQA 1RKIA 4DWIA 1M1HA 3VZHA 4LF5F 2XLKA 3HHLB 1X4GA 1FX2A 2UUTA 4DLEA 1NJWA 4K4ZA 2GA7A 2DR7A 4L3NA 4U8YA 2DHXA 3FJ2A 5LL6d 4HEA9 2OAUA 1KFSA 3CXCR 2MDAA 2OLWA 3IC1A 4OYBA 2M0GB 2QLWA 1NJIT 3MMAB 3OSPA 3RBXA 4JV5J 3BYPA 3QGPA 3J7Z5 3RRHA 2DXFA 1VI7A 1QE1B 2HS0A 2JVOA 3DLGB 3T1YJ 4B3SJ 3CE8A 1OPZA 1JLEB 3KYLA 2OFHX 4F4AA 4F4XA 2GQCA 4CLWA 3DLGA 2VDIA 2HURA 1N5SA 2P6TA 4FS2A 4C8YA 1LK5A 3K0JA 4WFYA 5HLFB 2HFNA 1HR0J 1HI8A 2KB2A 4LT6A 2CJAA 3GCWP 3OR2A 3NS5A 4WBFA 3D5MA 2HFZA 3FEYB 2CG4A 3PM9A 4EO6A 2R2RA 4OX7A 1YHQS 3GB0A 3NEKA 1FKOB 1VQ9S 1NCLA 1X4FA 1MU2A 1R8PA 2RD5C 4DCJB 1UEUA 1S6OA 2IJFA 2YKOA 1JX4A 2WW4A 4ER8A 1XIQA 2GAGC 3TI0A 4LUBA 5L9NA 2VA3A 4C8KA 4LSNA 3OHBA 2FJXA 1UFWA 1VIOA 1VISA 3MECB 2FPHX 4NXMJ 1IBMF 1XNRF 3MCNA 4B3RJ 5KFRA 4GKJF 3MGJA 4JP8A 2RSQA 5AT1B 2AGPA 3ZZRA 1C4CA 4CT9A 1DARA 2QMWA 3M05A 1RE1B 5KFEA 4JYAJ 4PG4A 3GFHA 3PEJA 5K8MA 2ZVSA 2AZ1A 1SUQA 4DQSA 2LQ8A 4W92B 1NRKA 4KIAA 3G82A 2VODA 4NLTA 2CQDA 2OPPA 3GV7B 2KM8B 3GILA 5JVHQ 1RHJB 4ZJLA 3V2UC 1OO0B 3KMQA 1FDAA 1LXNA 3DRYA 1SV5A 1T3OA 3I0RA 1DAXA 3NY0A 1WD6A 2DCLA 3PYFA 3CJRA 3M8PB 4YUDA 2JFKA 3HFZB 3CJ3A 2HEKA 1SL1A 1R27B 4JI1F 1IN0A 3FBEA 2QA4G 2HZAA 3CCSS 4NLXA 2HS3A 1RP5A 1FT8A 1S10A 1G2EA 4WXOA 2ZFHA 5L39A 4RBTA 5B7WA 2IHR1 4IH6A 2ASJA 4IDKB 3MMCA 1I1GA 1SH3A 3HM9A 4LSNB 3ZFVA 2OMLA 4ZVOB 2NXEA 4F4YA 4IFYB 3PW7A 4Q0BA 1Y3KA 1X4CA 4LF4F 4EUVA 1GQEA 3CSKA 4WYWA 1RLCL 1N5QA 3TZYA 2UUBJ 2UUCF 3MD3A 3BJYA 1FFWB 2V4RA 1VBYA 4JI1J 2AKWB 2W9CA 4AL5A 4ECXA 2HNYB 2U1AA 2MGZB 1IBLJ 3UDVA 2AYBA 2VFRA 3SDEB 2YKMA 4O3QA 4ATNA 2RQCA 1GTEA 2BM0A 3P45B 2AYMA 4M5IA 2OPPB 4A48A 4EGLA 4GKJJ 2VA2A 2I1RA 4A8MP 4NA2A 1WG1A 2GAHC 3JSRA 5HMZA 5GADI 5D77A 1Y5NB 2VBXA 1SXLA 3JQMA 1WOPA 2C2NA 1JLEA 1Z4UA 3OFGA 2X1FA 4IQMA 4P72A 2UUCJ 4FP9A 4IR9A 1KBRA 1TKXB 4WFXA 4A8XA 1UVIA 3KNAA 2FHOB 1S9GB 1RACB 4ID5B 1RHRB 3M2UB 2XCPA 4DR2J 3ZTOA 2EG2A 3I0RB 2AIRB 1U0HB 3AAWB 5DDRC 3PG9A 3D6FB 5K14B 2AGOA 3A8KA 2GZOA 3MPVA 1UZDA 5JXSA 4J9PA 1FKOA 5KFYA 1R0AA 2G2YA 1JLCB 4KH1B 3CTRA 5CH7B 4M94A 1YBTA 4DR1J 1SKSA 2DNOA 1WSRA 3QGIA 4DXLA 2V63A 4ES1A 1HYSA 4H4KA 2WCXA 2H54B 1U26A 3SIPB 3W2WB 2IA0A 4OYIA 2PA8D 2WBMA 1B4SA 4OZ1A 2JRSA 2BACA 2Y1LB 3KFWX 3GJTB 1X4DA 1AT1B 3LQVA 3S01A 5IWAJ 2MQMA 1D09B 5ETKA 4ES3A 3CCUS 1MMDA 3FUYA 2JC1A 2WOMA 2B5JA 4IH5A 3KHGA 3NGSA 2MMYA 4LF7F 3HK2A 5KAKA 4KHRA 3MMJA 1CG2A 1C1CA 2AEJA 4B08A 3NOGA 4QWEA 4J9MA 1Y3JA 4JI7J 2A2CA 2XHCA 1FDDA 3M1VA 2VFVA 5KFPA 3D1HA 2C3UA 4O3RA 3FRYA 5A8KB 4PUOB 1K0VA 4B3TF 1TAUA 3CGIA 3Q86A 1RAAB 5D3GA 2L3MA 1F5CA 3TJ9A 2F65A 3K17A 4TU8A 2ZHAA 2FHJD 3VAJA 3A8IA 1VBKA 1SJ4P 1CVJA 2CPHA 1ZZNA 3LP1B 3BB5A 3FMWA 4ANDA 2JEJA 3EMTA 1DQAA 4U67Q 5F8MA 1DFDA 2OEKA 3DYAB 3O2IA 4MFBB 5G0RA 4KJIA 3RRKA 4YQWA 1IQZA 3H8YA 3GR0A 2XGPA 2B8PA 2D7SA 3DYAA 4RUHA 3VALA 2I8EA 3GV8B 2XSFA 5M2PA 3EGZA 3POTA 4HHHA 5U47A 2HLUA 1UJ6A 2DGQA 1TUGB 2ZH6A 2V2ZA 1BQMA 1RAJA 4DV6J 3EWGA 2GMHA 4V19X 3ZZ0A 1AW0A 3UNGC 1WF1A 5GAEI 4DSFA 3V5RA 3BEGB 4CRJA 3ISNC 1APSA 1HNZJ 1TR0A 3ILIA 1RBAA 2N4CA 3UN2A 5CD4H 2NCKL 2OPSB 1WEYA 3DDNA 4GVBA 3OXLA 1OQ6A 3ENWA 4Y2IA 1R89A 3RW7A 4IQXA 2DYAA 1BLUA 1E6VA 1FRHA 1I3OB 2KDOA 3FEXB 3UDLA 4I2PA 3TVYA 4OZNA 4UT4A 3OVAA 1HR0F 3F44A 3Q8RB 3CD0A 2YNGA 3TAPA 1QLNA 3TUJC 2YNFB 4ZN1A 2DRAA 2NR0A 2RU9A 1K73T 2PFFB 1BWEA 2EBGA 3K5NA 4P2XA 2F40A 1SQGA 5ETTA 1H7WA 2ABYA 1HD1A 2DK2A 4ID5A 1YJ7A 4OZ3A 3SQGB 3D4JA 1VRQC 2RDIA 3GYXB 4N8NA 4KR0B 2Z4PA 3TX8A 2ZH1A 3SZ2A 1N32J 4RPFA 4ALZA 3CIMA 5HMXA 4I6YA 3OTDA 4EMDA 4LF8J 1S1VB 1P6TA 4I64A 3EDQB 2LYVA 2W2MP 1KOHA 4K5SA 2AP6A 4YN3B 1SL0A 3JSMB 3BKTA 5EX3A 1UWAA 4TU9A 1IKWB 1SI9A 3DGPA 5KFFA 2ASDA 4JI5F 4CH0S 2OKQA 3HI9A 3KUHA 2M70A 4DX7A 1FKAF 2XB2D 3Q24A 1FA0A 3MEGA 1H2TZ 4ZHRA 2NXCA 3RBZA 4DFKA 2BJ9A 1UTAA 1WF0A 1Q8LA 2MY7A 2ZWPA 4ZPCA 4CIOA 4TY9A 2ACYA 1FRXA 1NSPA 2BRLA 4FYXB 2ZH2A 1R6YA 5L1LA 3PZPA 1NHVA 2MSTA 1KHWA 2ZH9A 3N0VA 2B9EA 4Y34A 3G2XA 4USHA 2KG0A 4A46A 4CWBA 2YPYA 1S1UB 3H5YA 1S9EB 1NK9A 4LFBF 1KWMA 2F5GA 1UP1A 1XNRJ 2ILYA 1D9DA 3T1AA 2D9PA 1H3DA 3J7ZT 3CPWR 3I82A 2W4PA 1VRTA 2B9YA 2Q6BA 4QPTA 2OO4A 5KFXA 3KMSA 3R2DJ 1G4CA 1HW8A 1FDNA 5KG7A 4R25A 2N7CA 2QL9B 1QSLA 4J9NA 4LF4J 3V6HA 4IDKA 4WF9Q 2BE7D 2KRRA 2V50A 3O3LA 3HVWA 1PKUA 3GIMA 1VC5A 3BPDA 1J27A 5HATA 1NDCA 5DM7Q 1VQ5S 1K1SA 5IT4A 3JSBA 4PG8A 4AL7A 5D0GA 3TA2A 2D3OR 3DOMA 1DURA 2BW7A 1NUEA 2EK6A 4WTOB 5H9EK 4ECSA 1U1OA 3R8YA 3GONA 4G1IA 3ENQA 3UWTA 3D7SB 4CTAB 2FZCB 2C2KB 2MQ8A 4P2MA 3NNHA 3C46A 1RT4A 2QX0A 1BQMB 1HBOB 3S8SA 1HNIA 1H98A 2WZ1A 5B0EA 1L3UA 4IOAQ 3K89A 3W9IA 4V19J 2HQIA 1LWXA 4DSJA 3ZTPA 2B56A 2JJ4D 3MAAB 1N33J 2NSBA 2VL1A 4CLSA 1HNVB 2VD3A 3C19A 2DB1A 3JQKA 4JB8B 2HMIB 2DNPA 4H4OB 4C6AA 1NJZA 4M1KA 3LANA 1FFSB 4ED3A 3EGVA 3S6EA 3EZ5A 2FC9A 3CCES 3GFXA 5KFLA 4CLUA 5KOWA 4RNNA 3KHRA 2DGUA 1WC3A 5C2GA 5L8RC 3ZXWA 3H98A 3R1LA 3NXZA 1SJRA 5J1NA 1PCAA 2CQ2A 4NE9C 1NO8A 2KT2A 4TLQA 5CZVA 4RW8A 5A8RA 3UN3A 1X5PA 3ET6A 2GO8A 5KFHA 4FBUA 2LKZA 5ETSA 3CJ8A 4DG1A 6AT1B 5IWAF 4HL9A 3E01A 4ECUA 4B9MA 4NYPA 1U1LA 1MMNA 1D9AA 3NGDA 1A0OB 1WKLA 2AYEA 2DBBA 3Q8UA 1RTDB 1JLBA 1FRJA 3AOAA 3KG1A 4J9RA 4DF4A 1O5JA 5H9FJ 5I3PA 4PG6A 4WZQA 3TNVA 1RTIB 3KLGB 3WC0A 2B4VA 3W3SA 2XYGB 3OUYB 1KLMA 3K5LA 4QWCA 2FUG9 2ZEJA 3DRSB 4KHMA 4TYBA 2ZH4A 2B7BB 4NRTA 1YRTA 3N5FA 5IM0A 2DPIA 4X2BA 1YX2A 4ZVFA 2CADA 5E41A 2CJBA 3KHHA 2GJ2A 3KJVA 1SBRA 3MFIA 1B0TA 5E3AA 2AV5A 5B0CA 4DPOA 1X60A 4ZLLA 3LO3A 4FKYA 3C6UB 2JSXA 3FKBA 4ZKAA 2DHGA 4J9SA 1HHSA 5E33A 3IRXA 1HL6A 2XMAA 4K0KF 2VFSA 5LM7E 2KFNA 2BV3A 2XEXA 3EGNA 3TO8A 2HVZA 4LIRA 5FJ4A 3N6NA 4QWDA 4CYUA 4YS2A 2Y8WA 1HBMB 2C2RA 3EVWA 2A6MA 2HVHA 2DXEA 5E5NA 2KM8C 2H4WB 1GMUA 1DHMA 1FDBA 1U0HA 2OMOA 4UQTA 2G9OA 3EE3A 1WOSA 5D0EA 1NMEB 2W7OA 4DSIA 1FF2A 2XMKA 3KK3A 3BGRB 3R5GA 1RT2B 2AW0A 3DOLA 3LWLA 4N76A 2PEHA 2LXFA 2MLYA 2YX7A 2IMWP 2P9CA 1B7YB 2ILZA 3AXMA 1VJQA 1WHVA 1XMBA 3NBPA 4DPUA 3N79A 1TL1B 4YR3A 1NK6A 4XPCA 1WHYA 3ILLA 1M1KT 2WRMA 3G87A 1FFGB 2VKZG 1UA1A 5IQ6A 5DQHA 4ECRA 3DRXA 1NNDA 5ETRA 1N36F 3IGVA 5BYSA 1WI6A 1OYDA 3EVOA 4I4BA 1R0BG 1WHXA 4DX5A 4LBIA 4X65F 3CO0P 2QN6B 2WB4A 2DR9A 2KJWA 1VLYA 3RYLA 1JKHA 2ZD1B 5CYQA 3NKYA 4WK3A 1JQGA 2AQ4A 1G1XA 3D1OA 2WVCA 1NK8A 4ZPBA 4X4PA 4DQPA 4PABA 4F25A 1U1NA 2HAFA 3QO9A 2EI5A 2JOQA 4PXBA 2Y1JA 3PW0A 1E6VB 1BQNB 1SC3B 1ZA1B 4HH0A 2VQFF 2EXUA 2A0FB 5KT4A 4J9KA 5IT9Y 3QO9B 4UOFA 4CLLA 4NPOA 3D66A 4UOHA 3THPA 1RT6B 2KH9A 8ATCB 2ASYA 1REVB 3CJQA 3O6QA 4OI4A 5A76A 2E7VA 2E1AA 3HHLD 4G1QA 2UU9J 2B4OA 1S0MA 3SV3A 4PQUA 4GKKJ 2GVDA 3ETMA 3PX0A 2FQQB 2DNLA 2BDPA 4OYXA 4X4QA 4QW9A 3D67A 3HD1A 4MFBA 5GAGU 4W4MA 4U9RA 2PMWA 4I2QA 5KFIA 1U4BA 2F63A 2FLLA 2ZE2A 4WFBQ 3CIZA 3U1NA 2W4CA 4WE1B 2W9BB 7FDRA 1U24A 1U8WA 3CC2S 3PJWA 3BDPA 1S1WA 3GCXP 1JLBB 4HR2A 2E5LF 3BGRA 1QVFR 4J37A 2KI2A 3NAIA 1EQMA 1GT8A 1B64A 1N0VC 3TOQA 3M32B 1NDKA 4NMXA 1YDLA 5A6PA 3TUIC 3PYEA 3OQ2A 3HHNB 2DGVA 2C1EB 4IG0B 5ADZA 3M2RB 3MXHP 3FCHA 1ZOTA 2B51A 2K1RA 2E5HA 2K3KA 5F8GA 1N6QB 1RU2A 3B8HA 3H4BA 3L09A 3Q22A 4B3RF 2F8MA 1U45A 2IRUA 2J7WA 2WW8A 1U6ZA 4BLGA 4X62J 2BM1A 1LKZA 4DFPA 1IM4A 1VDHA 5KG3A 4E98A 1LW0B 1RABB 1ZBTA 2MTLA 2F7VA 3W63A 5A2QU 4GC7A 4DV5F 2CG8A 3FEZA 3KDNA 3VF0B 1HBMA 4ZCLA 4ZLPA 1M1GA 4P2SA 1DQ8A 2Z2YB 4R8UB 3QIPB 4P2FA 1MG7A 5AJ3J 1S12A 2N3OA 2KVIA 3UCGA 5LT5A 3J81Y 3Q8PB 1FO1A 5H9EJ 1AA1B 4KFBB 2D3UA 3HSGA 4HYKA 2R7SA 1DQ9A 1HHQA 2WVEA 3T6JA 3W9HA 3G6ES 2CPXA 1K9MT 1KNZA 4ICLA 3HSZA 3SFUA 4ZLNA 2RS2A 4GKKF 2JLGA 2CYYA 1X0PA 3R6LB 4JI4F 2R7XA 3ET6B 3HHEA 3GJQB 4C2MA 4K4XA 1HI0P 1M5HA 2RUSA 3T5HA 2B4PA 3D3CJ 2VKRA 3NWGA 3RB6A 2R3VA 1KVIA 2JLEA 4PG7A 2GVZB 4LR8A 1Z1ZA 4WWSA 5HBMA 2DT9A 2HK2A 1SIWB 2EFPA 3AJDA 3MPUB 2MLZA 4KGZB 3WX8A 1TVRB 1XK8A 2KXFA 1FXRA 2X7IA 3LW5C 3KG0A 2HNDA 2KHCA 1HNIB 1YKWA 3M32A 3WQPA 3EJMA 1D0EA 5KFWA 4CO3A 5HQ8A 2M4MA 1BXNA 4PWDB 4ZDNA 1W7WA 2QC3A 4JV5F 3MR6A 4FF2A 5I3QA 2GHVC 2I2YA 2BXJA 1T11A 3B4MA 4ZVPB 4DU7A 3IAM9 5KG6A 4RLEA 5D4NA 4RU9A 3BF4A 3CJTA 2J5AA 3HSDA 1JLFB 2I5JA 3WX4A 3I4PA 2UUWA 3L7OA 3M9OB 4KKOA 2VBWA 3NG8A 5C2CA 5H9FK 1HNXF 1NPRA 2XWYA 3D0HE 3TA1A 1F2GA 1Y4ZB 1SC1B 1CBKA 3ELHA 3I32A 4OQJA 1B0VA 3KLVA 3OTEA 4OYPA 4B02A 2CQBA 4Y2KA 3QT8A 4DV3F 3N9UC 2DGXA 2VG6A 5BR8J 1HWUA 4DR5F 4QU7A 4LRAA 2Q43A 2YPZA 2H48B 4X66F 4C8OA 2FLOA 3C66A 2UUAF 3DLJA 3ITHB 4U7UD 4RWWA 2WHOA 3EZUA 1FWKA 1B0PA 3M6VA 4WKYA 3CDEA 3MM8B 4P74A 4XDCA 3R7BB 4NLWA 1JXLA 1NM2A 1ZA2B 1G7CB 2V8HA 1H38A 2EC0A 2HHVA 1IBMJ 5K8PA 3FK4A 1ZS6A 1AYEA 1RTZA 3A4TA 5MAOA 3QNWB 4USTA 1URRA 4DX8H 3AHPA 3PYGA 4RL1A 1X5OA 4LMZA 1IUJA 2RDDA 5K5MA 5K9FA 4OIXA 2VG5A 1WORA 2R7TA 2KTQA 2GJIA 2YNHA 2FVQA 2HFVA 2IJRA 1ZETA 1JJCB 3NCQA 1LQ9A 3VAIA 3RW6A 3H25A 2DHHA 4Z37A 3TA0A 3G6YA 1GAOA 2M88A 4JI3J 2CNLB 4I2PB 1RT7B 2FB0A 3J7YU 5GAGI 4FF1A 2C3OA 2NXUA 1FK9B 5FDLB 4CI0B 2N3LA 3PEHA 1KQKA 1R6VA 1Y0HA 3DU6A 3OT9A 5LSOA 1IBKF 1M5KC 1T9UA 2ADBA 3QFHA 4FXDA 3QPIA 3IM9A 1YGYA 4J9UE 5HJXA 5AE2A 1RI7A 5KT7A 3D3BJ 4WK1A 3B82A 4NEYA 2VJUA 3MTJA 1Q5VA 2L08A 4PQUB 2K06A 3CCTA 2Q6CA 5DZ6A 3HFVA 4RW6B 2DH8A 2LQBA 2YQ0A 4YB5A 1RTHB 2CPEA 4DR5J 4Y2AA 4ZJQA 2XO7A 1NZAA 3B78A 3PHTA 1IR0A 5IV4A 1TUVA 4TU7A 5HSPA 1V3ZA 4L6V3 5EX0A 2VONA 3NNCA 1KS2A 2DNZA 3RB3A 3X3UA 2ZBIA 3QZ7A 1CJKA 2YNHB 2VIHA 2X1GA 4X4OA 4M5MA 1AFJA 2M7SA 1TQLA 3MTKA 3DHWC 4UUWA 2Z8QA 4ED4A 5IT0A 2OPSA 2JEIA 1JLFA 1XNQF 3GSIA 4EBDA 3OTOJ 2XBPA 3HKWA 2AMCB 2KG1A 5KFUA 2CWKA 4PUOA 4IRDA 1ZAXA 3PDNA 3UW1A 1KVKA 2QRRA 3OTCA 1UETA 4MKAA 3VV2B 5C5JA 2M8HA 1V5VA 3KK2B 3LGNA 3M30A 4JI0F 2FHKA 3M7VA 1FJGF 4FNIA 2ALYB 4O3NA 2CQ3A 3MMBB 3MM9A 1PIEA 1V5IB 5B09A 5M2UA 1ELOA 1VBXA 1U8SA 2Y8YA 3HCXA 2HGMA 2HRYA 1RAGB 2Q66A 3TWZA 2XYPB 1RISA 3VR1A 2QYCA 1RUSA 4JI5J 3I4HX 1YRUA 5DO2A 5FLXU 2JDJA 3NS7B 5C25B 4Q45A 1CJVB 4USVA 3IWXA 1XJWB 1CS4A 2E5GA 2MEWA 3MAQA 2KXHA 1Y10A 4O0NA 2A2DA 2N7YA 4RNFA 5HROB 1T03A 4RNMA 2ZVIA 2Z58B 4ZJOA 1EIYB 2YKNA 3IMQJ 4MMOA 5CYMA 1UA0A 5A8KA 1H7XA 5KFZA 3C16B 5HQMA 2V2KA 2CDQA 3WC2A 1V3RA 1HMVB 2IBOA 2XYHB 5CYMB 4B3MF 2BABA 3B6BA 2CZVC 2FD2A 2HNDB 1MLAA 3H2UB 2AJ2A 2OI2A 3TZZA 2V4QA 1FKPA 4B9SA 2I6WA 4DPYA 1B7FA 4P71A 3CCWA 1XNQJ 5E3QA 5CD4A 2ZC4A 1OQ3A 5IZHA 4ZVQB 4JI2F 3G86A 3W9JA 3HVAA 4CNYA 1ROFA 4DS5A 2POKA 4MIBA 5D4OA 5F3ZA 3W66A 3KNGA 5DS7A 3EXCX 2HIQA 3QIDA 2DCUB 3Q8YA 5AXMA 4AE5A 3THTA 4LF1A 1QDUB 2A3JA 1RLDA 4OHWA 4C11A 4CO1A 2W2QP 3T1YF 4OZ5A 4DV5J 2VHGA 1Q95G 3I55S 2G4BA 3DRPB 3TEHB 3NS6A 4DV2F 3SI8A 1KSPA 4C8ZA 1T9XA 1RT4B 2KO1A 2ZBRA 4USIA 5C24B 1KEKA 5AJ3F 5J2MA 4UOCA 1Q1KA 3BZQA 5DLGA 1IQTA 2ZE2B 1NEEA 4C7QA 1SPBP 3GFZA 1QVGR 3D0IE 2WVDA 3UVJA 4ED8A 3L9ZA 1KQFB 1KRPA 2LA6A 2B9WA 1R0AB 3KLEB 1HNVA 3ADAC 1SJ1A 2HG4A 5B0BA 4LRCA 3ZZOA 4DS4A 1KLNA 1VQ7S 4NX9A 2OD4A 2Z2ZA 2XS2A 4P73A 4FF3A 4LVNP 2ZZMA 1XR7A 1YITS 1UPMB 3HO1A 3OR1B 2IYIA 4LR9A 2K1RB 5B0GA 3IN5A 2CNNB 1WOOA 4ES2A 2MQNA 1U0SA 3P3DA 1UVJA 8AT1B 1RCOB 3H90A 4OX9J 4JI7F 4G1QB 1FI4A 2LXUA 2M2BA 2ZBQA 1WEZA 2RKIA 3PFOA 4P9SA 3UR0A 4WFNQ 1MROA 2AGQA 3UDCA 4O3PA 3UCUP 5RUBA 4OI0A 2YX1A 5HK4A 3O1LA 2C3PA 1VS3A 2O66A 3MR2A 1X9MA 5HVFA 4QR2A 1U47A 1A6LA 3D28A 1R8AA 2FJDB 2DIUA 1S7HA 1R8HA 4CCHA 3C14B 3DLBA 1N33F 3MZIA 3H7HB 2FZKB 4AXJA 1T95A 4IOCQ 3PV8A 3BGOP 4DZDA 1YJRA 2NXJA 3UD3P 2UVUA 3MUTP 3DU5A 4NWBA 1I94F 4AD6A 1S1XB 2XMVA 3N28A 2R2SA 3D6TB 1HQEA 2XWXA 4M5JA 1S6QB 1BQXA 2BUNA 5CQGA 1EHWA 3WZ0A 2ZJRQ 1X4HA 2AJ4A 2CPYA 1OSDA 5KT2A 2HHQA 5LJ5Y 2HQDA 2RB7A 3BM7A 2E9RX 3HLUA 2KYXA 1WNEA 1Q5YA 1S57A 5DDOC 2VQEJ 2M5YA 5HI7A 1WKJA 2DKOB 4OJ3A 3D68A 1L3SA 3BBFA 3GFYA 4A8YA 3PW4A 1C0UA 1R43A 4CNZA 1S0OA 3NRBA 3DLKB 2MKIA 1NKEA 2FJVA 2YQ1A 3DDIA 1X4EA 3KLHA 2HQ3A 3AQOA 1RT2A 5LSLA 2CJ9A 3ZO7A 2RJZA 3PO5A 3FGVA 1NKCA 1N5YA 5G0RB 1N0UA 2ZOGA 2DHSA 1UPPA 4DR4J 4PXEA 1P1TA 5KFMA 1Q86T 5GVQA 1FRLA 1DLOA 4DR2F 3OSNA 4GC6A 5J2QA 1T05B 4OHYA 3M8ZA 2PN6A 2CKWA 1NJYA 1O8BA 1QSSA 3CJ4A 1HW9A 4I68A 2HSEB 5ETQA 2JEFA 1H72C 3HMJG 4X65J 3KLGA 3RTVA 4V1Ak 2DNGA 4L72B 1IKYB 4YB7A 4NI2A 1T7PA 2NQPA 2WONA 2VZ9A 2HGNA 2LQJA 2Z30B 3AJ1A 2UUAJ 4LF9J 3K57A 1NDLA 1UFKA 2C3YA 3SMZA 4OI1A 3QAUA 2VOPA 4NZ0A 1SKUB 4QJVA 2UVVA 2BOAA 4KKOB 1TL4A 2VG7B 4KB7A 3SQOP 4RZRA 3T5KA 2R4FA 1UJ4A 2CJQA 2LMIA 2MKJA 1QE1A 3LA0A 4ZP7A 4QWBA 4MKYA 2KZMA 4WU3A 3CD7A 2QA1A 2CZ9A 5D3GB 2MZSA 1CJTB 4O44A 2LVWA 3PNIA 1H74A 3SYZA 3QJPA 1UWBB 3TW0A 2DEJA 2OPQA 3NLCA 4PWUA 5A0YA 4LIWA 3SBMA 2WVFA 4LQ3A 2ZBPA 2YKQA 3E51A 3A3NB 4HHUA 3M30B 3VAHA 1TKDA 3E3XA 5K8NA 1XTZA 3KLHB 1SJQA 4HACB 1CC7A 2DJWA 1T02A 4RW4A 4UW2A 3MD1A 1U2CA 1CJVA 1VHFA 5AE1A 1VRTB 2RAQA 2UP1A 2AJ0A 2HGLA 3TYTA 3US5A 2UXBJ 3LP1A 4KHPJ 4NOHA 1VGYA 2V0NA 1BD6A 3I0SA 3FBCA 1T0TV 4O4RA 4WP9A 1LW2B 1BUXA 3M2VA 5T7LB 3TQEA 2AF6A 5JMNA 3KLIA 2C2EA 2JWNA 2IYGA 1F3VA 2RE1A 4MK9A 4WE1A 4Y00A 2W9BA 3R1HA 1HLWA 2R7RA 4U8VA 4E0DA 1UZHA 5KFOA 2L9WA 1R31A 1S0VA 1S6QA 2F8EX 1CJUB 1TTHB 2AX0A 1S5ZA 1W2BR 2LEPA 2ZZNA 1WDTA 3J7AN 1VK8A 2OFGX 2L9DA 2C2ZB 1KP6A 4RUBA 5EWGA 1KN6A 4CO5A 5KFQA 3AODA 2XNRA 3DLKA 1VQNS 2RRBA 1Q8BA 5J1EB 2ZNZA 3QLHA 4DX6A 1S1UA 4LQ9A 1VBZA 1VQ4S 2QSFA 4NZ7A 4U96A 1IKXB 2CUYA 1SC6A 1K44A 4DV2J 1U49A 1UW9A 1Y5IB 3GZ7A 1GX6A 1LNQA 4OV6A 3L3CA 2RIJA 1D1UA 4ZCIA 3P5BP 3CW2C 2P2CB 1DTTA 5E2QA 1RKJA 5A8WA 1QAXA 3IP0A 4CZCA 2BR0A 2GVDB 4G65A 4QU6A 5L9XA 4X62F 4F8RA 2HHWA 4AQYJ 1DJ0A 4K4WA 1FXDA 3PVXA 3M2UA 3LUYA 2EFOA 4P52A 1BWVA 3NAHA 4DDFA 2GNKA 3PJ9A 3PRVA 3PXGa 4DL7A 1T94A 1YLXA 2R8KA 2E5IA 4FDFA 3G8SA 3Q0AA 4DR6F 3QRRA 4JV2A 1P9QC 2XMMA 2H1YA 3MWBA 4ZHRB 2Q79A 1PO6A 5LMNJ 4DL2A 5HJYA 2ZH5A 1WHWA 4C4WA 2B7CB 2YWHA 3DGVA 4IFVB 2QIFA 3EDRB 4AQYF 3L7PA 1TZ0A 2DNKA 1REVA 4BHQA 3KG4A 5D0HA 1YJTA 3BGLA 2I0XA 2R8IA 2XQCA 1JMTA 5CXTA 4N56A 2OPRB 3AA9A 4F67A 1RAHB 2EVZA 4XIUA 4NXMF 1WG5A 2UXDJ 4K4TA 4F0MA 4ZIWA 1Q0NA 1XEZA 4HDGA 1RWUA 2CVIA 4LREA 4X4TA 2AU0A 1U6BA 5LMNF 2VASA 1UWBA 2CDRB 2V8VA 2OSRA 3IRXB 5F8IA 4CH7A 1FJEB 2VUGA 2QSWA 5T7LA 1RSCA 2DRDA 1PBAA 3GYNA 2GHWA 4BDPA 2FGCA 5HAOA 1Q7LB 4RW7A 3AT1B 5AE3A 1F1BB 3KLFB 3PR5B 2BQRA 4DV0J 1KHVA 3QBCA 4IG3A 2W25A 1O0PA 3IXQA 3UD5A 5J2MB 2UXDF 3GYGA 4K8RA 1FWLA 1NH7A 4LR7A 3ITHA 4F4KA 3ZZPA 1FTCA 2DY1A 2V8PA 2EWHA 4J90A 3HT0A 4MTPA 5DDQC 1EETB 2B3TB 3HDSA 3KDOA 5LOQA 2U2FA 4UQGA 1KOOA 3OW2R 3T1HJ 1N56A 2WOMB 2QT7A 1QD1A 2OIHA 1TL3A 2W9AA 2E1PA 1L3TA 1WSVA 1ITPA 1GEHA 1TU0B 3GG1A 1VK3A 2I38A 4RR5A 2AZ3A 2BE2A 2IVYA 3SXLA 4PCQA 4DCPB 4OX6A 1S1TB 4ECVA 4ECYA 4FPIA 3MF5A
chains in the Genus database with same CATH topology
3HHLA 2MZ1A 4Y65A 4KRWA 2GGPA 4DR3F 1LW0A 5KFJA 2MKSA 5EGYA 3MEDB 1ZH5A 3DMJB 1Y9OA 5J1PA 4RX6A 3CCQS 3BSAA 5I42B 2L48A 1HPZB 2PO4A 1MMLA 2EKYA 3OV7A 1K1QA 2LCWA 2MKHA 4I6AA 3RB0A 1JB0C 3FRZA 4RW8B 2O1PA 5A8RB 2QEXS 1NAQA 2HHUA 5LJ3Y 5DJBA 4J5OA 4ED7A 1A7GE 3W2VA 3V4MA 2JX2A 3MM7A 1XBWA 2B4UA 4Z2XA 2HNZB 3I56S 2JVRA 1VIXA 4WZMA 4LF9F 1N5TA 3DDKA 4B9TA 2CQ0A 2HHPA 1TK5A 2FJEB 3BGUA 3HZEA 2MKCA 4RBUA 1JLCA 3W2WA 1C0TB 3V6DA 3O44A 1F9FA 3R5DA 2IM1A 3UR3C 1HNZF 2UXCF 3SDEA 4YY3F 1RT3B 2KJVA 1LFWA 2DO0A 2HPUA 1UJ5A 3ONQA 1J5EF 3JB9k 5F8LA 2G1DA 2HAIA 3B4DA 2RQMA 1KONA 3DMJA 2V8GA 3R3TA 3K59A 2RF2B 5FIIA 5KG4A 3AA8A 4IO9Q 4F26A 1NKBA 2DR5A 1NK7A 5FDLA 3FMBA 5K14A 3ENVA 1ZM3A 3CDWA 1W25A 4OZLA 1X8DA 2FJAB 3NP5A 2Q3PA 4ZPTR 2MQPA 1DTQA 2J9EA 5KG1A 4HKQA 4K4UA 2J6SA 4DV4F 1T05A 1DTQB 3Q8SB 2ATLA 2IM3A 2W4DA 4KV8A 5SUHA 4FYDA 2J8AA 1YBAA 4DOZA 2JEGA 1WG4A 3T9ZA 5KFNA 3JSYA 1S72S 4H4MA 3GQCA 2G13A 1W2IA 1R8CA 1LFPA 2H9ZA 4J9QA 3TAMB 4AFFA 1FK9A 2AJQA 5CYJA 1QJHA 3MHYA 4OJ1A 3OPKA 2DNNA 2R7VA 5D8HB 1S48A 3VAGA 4G6VB 1HARA 4K2XA 5CCMA 5ITHA 3A8EA 3OHAA 4FN5A 3OL8A 4TNOA 2YVSA 2YWGA 4KQZA 3TQ1A 2FVRA 4Y28C 2CQGA 5KTQA 5DRKA 2UU9F 3NCRA 5M2RA 2PC6A 1U48A 2K2PA 5HMYA 2DISA 2C2DA 4NXNF 2DGWA 1CQMA 4OHZA 2D3ZA 2DD8S 4EBCA 2A1BA 4DG1B 3IWNC 3TRGA 1S1VA 2V9KA 2D74B 4OZJA 4KSEB 2J6UA 4RW9A 3CCJS 1TVRA 2W8LA 4ZOSA 4F02A 2ZC3A 4URGA 1YJWS 4IYQA 2GFFA 2RKIB 1P8GA 4ELUA 3O8WA 3RR8A 4ED6A 2WK4A 5E3PA 3CULA 1MWZA 2AD9A 1FTRA 1FXLA 3UE2A 5GAEU 1GX5A 2YNGB 3HFKA 2H5EA 1R3NA 4NLOA 1VQKS 1Q78A 2RF2A 2J9CA 4DMZA 5LSRA 2YY3A 3BSOA 1Q7YT 2CVEA 3MEDA 1KFDA 4HLBA 1F5AA 3PKYA 3F73A 4DFJA 5F0UA 4B3SF 3MOJB 2B0GA 4FBTA 1FEEA 2B9XA 2V94A 2GQ2A 3E8OA 3OR2B 4OHXA 2P5VA 5KFGA 4RNOA 4CQ1A 1C1BA 2XSJA 4ETZA 1FNXH 2BQUA 4R8UA 2QA4S 1HHTP 2MYFA 3K5PA 4OX9F 4A47A 3JYTA 4JOUA 4F2SA 2E29A 1AROP 4NMLA 1P1LA 3EYZA 4WXWA 3FFIB 1VQ6S 4ZP6A 2NUUG 3ULHA 1WWHA 1RK8A 1XERA 2GO9A 4EZ9A 3NNAA 3TR5A 3EX7B 5HMWA 2MY8A 1C0TA 3DM2B 4MAKA 2KFYA 3V6DB 4I1TA 4K4VA 1YSJA 1AFIA 2J0WA 1S76D 4F4WA 1JWWA 3M6XA 3G96A 1RT5A 3CDUA 4D3HA 2VC1A 4JI8F 3C6TA 2R2TA 1UW4A 5FLXY 5I42A 4H4OA 2NPIA 1N4LA 3OL6A 2K3IA 1U1MA 2MSSA 3UCZP 4JV0A 2FVCA 4FXVA 2Z2MA 2OPRA 3UQSA 4DR4F 2NSCA 3FDSA 3CCMS 2UVRA 2CPIA 4F3OA 4HTIA 3PIOQ 1UVMA 1TKXA 4NLRA 4ZVEA 3MM5A 3PACA 3GSDA 3T19A 2OD6A 3HF5A 4NCGA 2LU2A 2XGQA 3M9NB 4KPYA 4R0EA 4E8UA 1FVSA 2RS8A 4JBCA 2HWTA 1A9NB 2EBEA 4F4ZA 1HWIA 2F4VF 1C2PA 2VBZA 1VRUA 1X4BA 2XMJA 2IRYA 4C9DA 3MEGB 1F5BA 3O5TB 2X3GA 1J5OB 4Y3CA 2DNRA 1RYSA 4M5DB 4QIWD 2KKHA 1D9FA 1S6PB 5THWA 4LSLB 4JI6F 3M8RA 1HWKA 3V6JA 1NK4A 1RT1A 1SV5B 2PMHA 4N41A 1Y00A 4DBQA 4I67A 3N4WA 2CFXA 3CB4A 2HWIA 3SFGA 2GCFA 4U7UK 1UMJA 4K4SA 1UFLA 5IS2A 2ZKTA 3CVKA 4NLGA 1LWCB 3MDFA 2FTRA 1YJUA 3N6MA 3KLIB 4WKRA 3PX4A 2Y1RI 2KRBA 4RNHA 3DOKB 3SCLE 5DQIA 3POTB 4Y0FA 2KXNB 4DF8A 3MPYA 4ILLA 2EFNA 2PGCA 2BYCA 4WYLA 4FF4A 3RBEA 1GXUA 1JLAB 3CEDA 4A8OA 5DDPC 3U1MA 4DS5A 3ZZYA 3DM2A 3PR4A 4KTQA 1FJCA 1UKUA 4H4MB 3WBZA 1LWFB 4DN0A 2XS5A 3GV5B 4TKTA 3R27A 1FCAA 4NL5A 2L41A 5A6WA 5DGAA 4ILRA 1JLGA 2AJFE 3CCVS 1K8AT 4B3OB 5KFDA 3LALA 1Q82T 4DUYF 2XZWA 3OXFA 1N32F 4PQAA 2QV6A 4M5DA 2CQCA 3IR6B 4IO1A 1HQUB 3TVKA 1LK7A 1TKZA 3CT9A 3IS9B 1VQPS 3QGHA 2G0CA 3MM5B 1MWYA 2V5HG 2K8GA 2XI3A 3BO4A 4JV1A 3CMAS 5B0DA 2KFZA 1VQOS 3P96A 2MZQA 3BS9A 2I5JB 3KK1A 4DEZA 1SH0A 3TUZC 2DH7A 2CZ4A 2EFVA 4OFZA 1MNEA 1HYSB 3TAQA 1PSDA 2MZTA 1L3KA 4HTJA 4Q5VA 3MMBA 2IVFB 4CO2A 3MFHA 2X1AA 2J0SD 3PHEA 3ZC4A 1CQNA 1JNZB 5E0OA 2B5JB 4UY85 4P7TA 3AB4B 2Z2LA 2B43A 3MUMP 5KT5A 4PRFA 1TKTA 4YDDB 3V4IB 2JC0A 3H59A 3M6WA 4ZMMA 1EP4A 4P6QA 1M5PC 3DRSA 2RVJA 2QA2A 2RT3A 4HT5A 7FD1A 3K58A 4DQQA 3Q8QB 4U6PA 2DNHA 4OV1A 3Q2SC 4OZ0A 1DRZA 3DRRB 3OXGA 3G6XA 5GAHU 3IA0A 1U1RA 1U1PA 4LF6F 1N54B 2K7JA 3N5BA 1NU4A 2AJ1A 5EN1A 2PMZD 2XY6A 2RUGA 3IO1A 4HDHA 4KO0A 5KFCA 2ZOFA 3I5CA 3DOKA 4KGKA 4N8OA 1S9GA 1E6YB 3RR7A 1WELA 3DXBA 3BQ0A 2F8HA 4XO0A 5EHHA 2HHSA 2R7WA 2IAJA 1QY7A 1TP7A 1TFWA 2NS1B 1H0HB 1HWLA 1CPZA 2BANB 4QBUA 2J76E 4ICLB 3C3LA 3MPWA 1LV5A 2BE2B 4DL6A 3WDOA 5D78A 1JLAA 5KG2A 4ERDA 2R7OA 4DSLA 1SIZA 1C4AA 2NZ4A 3NL0A 4X4UA 1EETA 2GQQA 1RTHA 1O51A 3OLAA 1N6QA 5CZXA 2CJKA 3R5AA 2OJ3A 4NLSA 1HQUA 1JLGB 1H2UX 3ETOA 2R9LA 4B3OA 2QMXA 4Q2MA 1WEXA 2V8DA 3CD5A 4ZCKA 2CQHA 3F41A 3LWMA 1WI8A 1MROB 3K8VA 4OJGA 5IXUA 3M9MB 1KD1T 2LDIA 4AUKA 2LEAA 1XC9A 2C28A 2QLXA 4MJKA 2OP5A 2ZBCA 1OPIA 4CO4A 2IAJB 1RYRA 2LDYA 5KG0A 1FNOA 4UY8T 3THVA 2FC8A 2ZH8A 1SH2A 2J0XA 4FXWA 4ECWA 1GXTA 3H2VE 3JSMA 2XMUA 3OFEA 4URSA 3S7RA 1S1XA 3VZIA 2DHAA 2R7QA 3HP6A 1RDRA 2O5DA 4IFVA 4DJBA 4DN9A 3FSYA 3MEEA 4C0HA 3KLEA 2XULA 1V3SA 5DG9A 2BJEA 2UV8A 2RDJA 4H54A 3HHDA 2MJUA 3SCIE 4BC9A 5CYQB 3FZ2A 2ZITA 1KLMB 3I5AA 4DR1F 2YX4A 1X9SA 2WSCC 2V4JB 1RT3A 1FE4A 2YKAA 4EWTA 4OI6A 1VOMA 4TYAA 2QZ8A 2DGOA 3RZAA 2W7AA 1EP4B 3TAMA 4ETXA 3KMQA 4O3OA 3P49B 2FY1A 2FLPA 3CUNA 1JKHB 2ZD1A 3M8SA 3MURP 2HVIA 1Q81T 1S99A 3I9V9 4FZVA 4I69A 1F60B 3R5CA 4DHVA 1DTTB 1FRMA 3CO9A 3JYTB 1YVFA 1FRKA 4TQSA 1N52B 5JUMA 2AYGA 2LLZA 3OFHA 3DOLB 5EWFA 3MM7B 3KK1B 1Q16B 3D0GE 3MEKA 3GIJA 2Y1IA 5DG7A 2PIIA 4K5RA 4YOEA 1M5SA 5LXYA 4HHJA 5J2NB 5HBMB 3DLHA 4J9LA 4MYTA 4NA3A 1SQEA 2HHHF 2J0QD 2YNIA 2CQIA 2E66A 3VCDA 5DQGA 3QMQA 4QR1A 4YR0A 4I0WA 1WTFA 3NCPA 4OL8A 4DL0C 4F3QA 4YMEA 4ED5A 1VQSA 3BO2A 4G1PA 1U7LA 2IMOA 3DNCA 3SCJE 3OFFA 3BQ1A 3ZZZA 5FD1A 1S0NA 3KJVB 1KTQA 4QW8A 1LXJA 1J2VA 5B0FA 3I87A 2BQ3A 4QYRA 4USJC 1HPZA 2R8JA 3KHLA 1HBUB 4O4GA 4C3LA 3C2PA 3SSRA 6FD1A 4ITSA 2DNMA 1WTBA 5E7OB 2JHEA 3UPFA 3OLBA 4X4NA 1UVKA 5HL7Q 2YQ3A 3QIPA 2RILA 4I2QB 1AUDA 2VOOA 2HS4A 4RW6A 2IM2A 3W2VB 2M8DB 2NLWA 5I4MA 1QSYA 4M8LA 2O01C 3MEEB 2XMTA 1LWEA 5J2PB 3IBWA 1N8RT 2W7PA 4LFCF 4UUXA 2MQLA 4BCAA 3AB2B 4H4KC 3JTOA 2CQ1A 2LQ5A 4KGMA 3RAMA 2DNQA 3M2RA 2WONB 3H5UA 1S1WB 5F9LA 2E9TA 2HLTA 1TL3B 3PKMA 1NHUA 1BGXT 4CTAA 2RNEA 2XY5A 1YTYA 4ECZA 4EFAC 3J7YI 2WTFA 2EK1A 4R5PB 3AJ2A 1JLQA 4YP3A 1IKVB 1S79A 5F0WA 1LWCA 1ZAVA 4X4SA 1VQMS 1QTMA 2ZOMA 2O67A 1GH8A 4URQU 1TKZB 3IS9A 4PXCA 1VQLS 2IM0A 3ISZA 5IFMA 4DQIA 1SKWA 4M63A 4WTYA 4A8SA 1RT7A 1VQYA 4X84A 5BJRA 3VTIA 3KK3B 1ZYQA 4F2RA 2MKKA 1BC6A 3VAMA 3K2YA 1YQHA 5AXNA 4K59A 2X51A 1JK9B 3M8QA 4QZVB 4DSKA 4MK8A 2HFOA 3AH6A 3QWPA 1KTVA 2ZDOA 2F1FA 4PPDA 1HBNA 2SXLA 4C98A 2X1BA 1S49A 1L5UA 4DUZF 3CJ5A 1QAIA 2BANA 3PW5A 3QAEA 1VRUB 4LFAF 3JTNA 3LOUA 2F3JA 3NBPB 3SSSA 2EPIA 1X4AA 3U1LA 2O3DA 5A2QY 1VQ8S 4ZPVR 2E9ZA 2A18A 3OR1A 4C97A 3IR7B 2R7UA 1RJJA 2D1CA 4EBEA 1NH8A 2RRAA 4ZVGA 5KFSA 4WFAQ 4GO7X 4LJMA 4OI2A 3SCKE 4IUFA 4KC5A 4F50A 3MI7X 2UZAA 3RAXA 4EO8A 3TARA 3JAMY 1S4FA 3DN9A 3G8QA 1N5VA 4Y2MA 3RRGA 4ED1A 1U09A 4EYHB 3T5LA 1AXQA 3M8QB 4X64F 4O4GB 1MU2B 2HRUA 4WFZA 2IFXA 2GMJA 3DRPA 4MIAA 1RTDA 4FS1A 2IC3A 3RAQA 4D3GA 5L1JA 3DXSX 2ROPA 4DQRA 4IRCA 2OTJS 5GAHI 1X5SA 3H40A 3OVBA 3KOAA 3QGGA 3BR8A 1T03B 1Y7PA 4ECTA 2XHWA 1RTIA 3MOZA 5BYRA 2MHNA 4F3MA 1CEZA 1NK5A 1QUVA 3EPGA 2XMWA 1G3OA 3HVTB 2E1CA 3KWMA 2GW8A 3DRRA 1S1TA 2F9JA 2YTCA 4AYBD 3HT3A 4JYAF 3NGKA 1RT5B 2W8KA 3V4IA 4BS2A 3MMAA 4ELTA 2ERRA 2MQOA 2ZKUA 1Q4RA 4Q8FA 3KK2A 2BJDA 1QAYA 4BWJA 1S97A 4KBIA 3Q23A 5A0YB 1XMOF 4BWMA 2MB0B 3FSXA 5LMUF 3H4DA 2IC3B 2LXIA 3H5XA 3FZBA 1UVLA 3PRDA 4YB6A 2VFTA 4R0JA 1D8YA 3H20A 4MKBA 2BVZA 2BZ2A 2JH3A 2BOPA 2ZHBA 2KN4A 4ED2A 1DLOB 3RB4A 3CCRS 3CJKA 1K0TA 1JIHA 2DR8A 3CCZA 3MM9B 2R8HA 2FIUA 2MHEA 4OX8A 1PC4A 3GWCA 1RQ0A 4C8MA 1N5YB 3ZZTA 2MXYA 2DNYA 5F41A 2RRNA 3MM6A 5F9NA 1ZM2A 1IKYA 3IWLA 5C42A 5F8HA 4AXIA 1RGVA 5L38A 4EEYA 4EYIB 4OLOA 1WACA 2ADCA 1NB7A 5T14A 2DPJA 1UEVA 1N48A 1S6UA 3K8WA 4TY8A 1MW7A 2VPWB 4C0OC 4ZK7M 4NA1A 1CSJA 3IG1A 3FNNA 3OBIA 4NLUA 4B17A 4C2MA 1FD2A 1U2RA 3VQSA 4C0BA 4CO0A 4JV2A 1ZZFA 3LF0A 1H2VZ 4RU2A 2ZNYA 4DV6F 2GX8A 4A8FA 3DC2A 3DLEA 3LAKA 1BQNA 1JNRB 3DI6B 5E3CA 2ZDPA 3HX9A 5KFTA 3NMRA 1ZTWA 4G3IA 2CQPA 2VV5A 4RUAA 1U1KA 2C3MA 3QJJA 4DV7F 2QE5A