1KR4A

Structure genomics, protein tm1056, cuta
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
110
structure length
110
Chain Sequence
ALYFMGHMILVYSTFPNEEKALEIGRKLLEKRLIACFNAFEIRSGYWWKGEIVQDKEWAAIFKTTEEKEKELYEELRKLHPYETPAIFTLKVENILTEYMNWLRESVLGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of CutA from Thermotoga maritima at 1.4 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Structural genomics, unknown function
molecule keywords Protein TM1056, cutA
total genus 25
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 2002-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03091 CutA1 CutA1 divalent ion tolerance protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kr4A00
1V6HA 4RX6A 4WK1A 5D4PA 4CO0A 4OZNA 1V9OA 2RD5C 2XZWA 3AHPA 4AFFA 2GNKA 1V3RA 4YB7A 1UKUA 3OPKA 1NH7A 3NCQA 3L7PA 4C3LA 4CO5A 5DRKA 2ZOMA 4OZJA 3BZQA 1O5JA 4CNYA 1OSCA 1P1LA 3N5BA 3NCRA 3M05A 3TA1A 5DS7A 2EG1A 2O67A 3NCPA 3HLUA 3X3UA 3AH6A 3TA0A 2NS1B 2J9DE 2V5HG 3O8WA 2ZFHA 4Y65A 2J9EA 3CE8A 3AA9A 2GX8A 4IYQA 2J9DA 3DFEA 2Z0GA 3MHYA 5D4OA 4NYOA 4RWWA 5D4NA 4ZK7M 1UFLA 4CO3A 1NZAA 4CO4A 2JJ4D 1V3SA 1QY7A 4E98A 4NYPA 1J2VA 2XBPA 4RLEA 5D4LA 2DCLA 1H3DA 2EG2A 4USJC 1Q1KA 1VHFA 1XK8A 1UMJA 2XG8A 4CO1A 2CZ4A 4RWXA 2NUHA 3TA2A 3T9ZA 4C3KA 1GNKA 4OZLA 4USIA 2PIIA 1O51A 4CO2A 4Y6IA 2VD3A 1KR4A 1VFJA 4WK3A 3GSDA 4C3MA 1NAQA 2J9CA 3O5TB 2XULA 3LF0A 4R25A 2NUUG 1PILA 2E66A 4D3GA 4USHA 4YB5A 1HWUA 4D3HA 3AA8A 2GW8A 5L9NA 2O66A 1UL3A 4YB6A 1NH8A 4CNZA
chains in the Genus database with same CATH superfamily
1V6HA 2J5AA 1SPBP 4AL6A 2B9YA 4NZ6A 2M8DB 4HT5A 1F5AA 1H2UX 1S6PB 1NEEA 4OZNA 5HL7Q 3A3OB 3MECA 2QC3A 3JAMU 1FVSA 2BQRA 4JI2J 2JX2A 3DRRA 4PUOB 2XMAA 3A8IA 1NSQA 4LF6F 5C2CA 1WELA 1IWAA 3SCJE 2G2YA 4WBFA 4F4ZA 4QR1A 2VA3A 4HKQA 3UDCA 3MEDB 5BR8F 5E3CA 2UXBJ 1PJ7A 3D54A 3IAM9 4YB7A 4B9LA 2PEBA 3D7SB 3PNIA 4TYAA 4OHZA 3MM5A 1OY9A 3QFHA 5AXNA 1HQEA 3D9BA 4EO6A 2A6MA 3A1YG 4JI7F 3T5JA 2PEHA 3BKFA 1S1VA 3CC4S 2DHGA 3EGWB 3FZBA 1OSCA 1ELOA 1T3NA 4QCLA 3UW1A 5F9LA 2YX7A 4GRSA 2NXUA 2GVZA 4QZVB 2XI2A 1MROA 4M8LA 4FNIA 4N8OA 4EU0A 4ZVRB 4ES3A 3OTBA 4K5RA 3W8GA 1X5TA 2BBEA 3CIZA 5IXUA 4N56A 1X9SA 2HYIB 1GMVA 3MXHP 3HI9A 1UEVA 1S6QB 2EG1A 2OP5A 2OPSB 3CGIA 4RW6A 4F3QA 4YY3J 1S0VA 4USVA 4AXJA 3H42A 1R0CB 3OBIA 4NLOA 2R7XA 1OJ4A 1NPKA 1OQ6A 2VFUA 3BKTA 2V5HG 4G1PA 5F0UA 3W5XA 2FIUA 4C98A 1KNZA 4ED5A 2NQPA 1UAWA 1IN0A 4EK2A 2MGZB 2XO6A 2IAJA 4TQRA 5DG7A 2R7VA 2A2DA 2A1BA 1AFIA 1RT7A 1S6QA 3GCWP 3NGUA 2ZZNA 3E51A 3H0PA 1BLUA 2ZH2A 1EETB 4ZJLA 4EO8A 3MOJB 3ENQA 5IT9Y 1YQHA 2RS8A 1DQAA 3THVA 4WFXA 2V6AA 2L48A 2XMVA 4O3OA 1JNRB 2DTJA 4CO3A 5H1SV 2CPIA 2JJ4D 3HVWA 4ZMMA 2C2RA 4B3SJ 4JOUA 1JK9B 1ZM4A 2M4MA 5CYQB 3SBMA 3TAMA 3ZZUA 4Z7CA 4DXLA 2R2UA 4AQYJ 2WVEA 3OVBA 4FVMA 2NZ4A 3MPVA 1N52B 1WI6A 3OR2A 3G8TA 4OLPA 2IBKA 1HFEL 3PFOA 1LK5A 4HACA 2YQ3A 4KAIA 3LPYA 4I68A 2N4CA 2HURA 2BKNA 3AJDA 3C14A 2ILZA 2Y0BB 4LIRA 4EYIB 1I94F 4CO2A 2FLPA 1IVZA 2MGZA 1KQKA 2DH7A 4HVZA 3PW4A 1KR4A 2WK4A 3FBCA 4DR7F 5IS2A 5B09A 4JI8F 4YR0A 1UCNA 1MMDA 2VKRA 4QWCA 2BV3A 2FYXA 1N0UA 1O6XA 3DLJA 4U95A 2YKPA 3A8KA 1NAQA 4NRTA 1NSAA 3UCZP 1UPPA 3PEHA 2V4RA 5BYQA 4LMZA 1DBDA 3PX6A 3PYDA 1VRTB 3OL6A 2ATLA 3UVJA 1KBRA 4CH1A 3JSYA 4F2RA 2Z2YB 2CNNB 2MQ8A 3M6XA 4BDPA 1S57A 4UF4A 3W3SA 2DYAA 3DLGB 4MK8A 2VG7B 3BJYA 2MZ1A 2HNDA 3BH7B 1L5UA 3OLBA 2B7BB 2V63A 4RW8B 2CPJA 3JTOA 2DHXA 1UWBB 2YWKA 2FY8A 1PBUA 3R5DA 4ED2A 1YJWS 2KFYA 2H5JB 4V1Ak 3CJ0A 2OAUA 2OELA 4DR7J 1U48A 2M52A 4WE1B 2SXLA 1T8EA 3OW2R 1TKXA 2FLOA 2D69A 4CZCA 4DFMA 1GAOA 2QMWA 3CCQS 1FKOB 1WORA 3MCNA 2F9JA 3PR5B 3VALA 3VAGA 3QRQA 4OYAA 5EDWA 2ASDA 1I6JA 1RP5A 1Y5IB 3D1QA 4C48A 1S48A 1GEHA 2DH8A 2H54B 1VISA 4PG6A 3K0JA 3C6TB 2ZKTA 3OXGA 4C7QA 4ZS6A 2NYIA 4FF3A 4DZ6A 5KTQA 1FFSB 3M8RA 2VDIA 2R7QA 2XTJP 1QAYA 3ZTPA 1TVRB 1U4BA 4IG3A 4M5HA 3HK2A 1ROFA 1H2VZ 2MSSA 4DPXA 3Q0AA 3PW5A 3H7HB 1NBEB 3HCXA 4KTQA 4OYMA 1JLAB 3FEYB 4PG7A 4QWAA 2LYVA 3NCRA 4KGZB 4DPWA 3IWLA 5KFCA 2W7PA 3AD8C 3CPWR 2E1CA 4KHMA 1YJ7A 4JI2F 4DL3A 1QAJA 1JXVA 2J7UA 1MN7A 4WP8A 1D3WA 2KT2A 1E6VA 4KC5A 1NK0A 1T0TV 4YR3A 4ECUA 2CDQA 1IR0A 1CS4B 3X3UA 3K57A 3I4PA 3C8YA 2M8HA 3G96A 2VOPA 3PACA 2DO4A 2QE5A 3B8HA 2VQFF 2QA4S 4FBUA 1TL1A 4Y65A 1N5YB 2CPZA 2NPFA 2UU9J 2MLZA 3AODA 3QGPA 1YBAA 4IFYA 4DSFA 4ILMA 4A8OA 4C8KA 3TZXA 1HBOB 3VCDA 4KGXB 5J2MB 4YFUA 3ISZA 4Y2IA 4WPAA 2R8HA 4L6V3 1D9DA 3IR6B 2F4VJ 3EMTA 2JHEA 2AJ0A 3BBBA 4CM0A 2WOMB 3MHYA 1IR2A 4KKOA 3PIOQ 1TL7B 4DX8H 2H9ZA 4DOZA 2QG9B 2U1AA 1PC5A 3ICLA 4OZ1A 5IWAF 2FC8A 2JWNA 4ZPCA 3MMJA 1V3SA 2DPIA 1Q79A 3F44A 4F0KA 1N54B 1P1TA 3Q8QB 1N6QB 4M63A 2MJUA 5EWEA 2OEMA 2X3DA 3RW6A 5J1PA 2DNRA 3M8ZA 3EVWA 4YP3A 1VQ5S 2DXDA 1NJZA 3CCWA 2H1YA 4X2BA 4JI3F 5JMNA 2BACA 5D8HB 4NLSA 2FUG9 3TEHB 3ET6A 1YLXA 4OZ3A 3DLEA 4QW8A 2CZ4A 2ROEA 2FHJD 3MMAA 2EC0A 1A6LA 3MM7B 4Y00A 5LT5A 1U24A 1KC8T 4OI1A 1YJVA 1O51A 1HI8A 2QL9B 4G1QA 3OFGA 1FTRA 2VD3A 4IQMA 5KAKA 2HS4A 2EW9A 3GIKA 2DR9A 1YBTA 2AEFA 2WVDA 2QLWA 3OJUA 3CDWA 4PWDB 2KXHA 3R3TA 2PSZA 2V8DA 2C2ZB 2LQBA 2VZ9A 1YG0A 5ETPA 1KEKA 3G4SS 4ED7A 1U1NA 4LFBJ 4NXMJ 2MKHA 3G71S 3AB4B 3KJVA 1VI7A 3HSGA 1H74A 2NYHA 4OLOA 4X4PA 1WHWA 2KVIA 3DRXA 2CIMA 1TL3A 4ZLLA 2G9OA 3NMRA 3KUGA 3IC1A 3M1VB 1ZZNA 4ZITA 3FCWA 5D6GA 1S12A 1LWFB 4F3MA 1S7IA 1G3OA 5GADU 4QWBA 1Q53A 3MEGB 2XB2D 4WXOA 3AA8A 2ACYA 3PJ9A 3RW7A 4DPTA 3US5A 4TNOA 4DV2J 2EK1A 1QLNA 1UL3A 3W2WB 4Q8EA 2YWWA 3R5CA 3KLGB 3KLEB 1HNVA 3V4IA 1CEZA 2JFKA 2HS0A 4FDFA 3I31A 2UUWA 3TUPA 3GZ7A 3K7RA 4LRFA 4J9RA 4C8YA 2FZCB 4WFAQ 5L1LA 2XWYA 2Z30B 1H72C 2AYGA 2G0IA 1SV5B 5F3ZA 1FE0A 4IRDA 5L1JA 4K59A 4DV5F 4Y2CA 3SYZA 1LW2A 2DRAA 4K2XA 3SEOA 1C1BA 1RUSA 1C2PA 4CM2A 4DU8A 4F26A 3O1LA 1Y11A 4O4GB 1FNOA 3CO9A 1RA7A 3C16B 1YVFA 2YH0A 2K2PA 2PDAA 5EX3A 1UKUA 2RE1A 3OV7A 1DURA 5ETMA 3K2YA 2L41A 3MR3A 1SJ3P 1FWPA 1FDBA 1W2BR 1XMBA 2PMHA 3L7PA 4DV0F 4EWTA 1VBZA 4F8RA 2N3LA 5LSOA 1G7CB 3W2WA 4LSLB 3GCXP 5DO2A 4DV7F 1VHIA 3N9UC 4CIOA 2HNYA 3O2IA 1YJNS 2HWIA 1RHKB 4F4KA 1HWJA 2J8AA 1P1LA 1SH3A 3C66A 3IWXA 1WEXA 4U96A 4JI0F 1F2GA 2ATCB 4X66F 1FA0A 2APOA 2B9XA 4KIAA 1RHMB 1Y00A 3O6QA 2UUAF 2ZVIA 1JLBA 1ICEB 2J7KA 3M2UA 2CDRB 2RKIB 3CVKA 3NCPA 4JB8B 3HLUA 4LF4F 5LSLA 1OQ3A 5KG4A 4WFBQ 5F8GA 4F50A 1UZDA 2GJIA 2HFOA 3M9MB 3CJ3A 3UR3C 1T7PA 4N76A 3FKBA 3EZUA 5FD1A 4PRFA 3SCIE 1SUQA 1VIOA 2FPHX 1ZTWA 1JJ4A 1P8GA 4FXDA 3QAUA 4W98A 5GAEU 3WC2A 2H48B 1YITS 4ELUA 5ETKA 4BC7A 4MIBA 3CJKB 4CWBA 2RUSA 4KO0A 1T02A 5IFMA 1LNQA 1ZYQA 4J37A 2N82B 1HNZJ 5L39A 1HQUA 5KG0A 4WKRA 3ONQA 3TWZA 4DN0A 4ICLB 4NYZA 1SL2A 4AT1B 4DSJA 2LQ5A 1MWQA 4JBCA 3GPAA 1U0HA 1WOSA 4P6QA 4B3TF 2W9CB 4JI6J 5L1KA 2CQPA 3HVTA 1LOUA 1J2VA 3UNYA 2QZ8A 3UD4P 4HTJA 2XBPA 2AX1A 3FBBA 5BR8J 2W9CA 2BJ8A 3DGVA 1NU4A 3QGHA 3CCMS 1B7YB 2W9BB 2HQCA 2EG2A 3MEGA 1N36J 1RWKB 3I5CA 1X7VA 4PQUB 3R8YA 4A8FA 2MYFA 3DM2A 5K8OA 3S7RA 3OLAA 4DR3J 1PAUB 1JWWA 1TL3B 2B3TB 4OIXA 3MR7A 1Q86T 4FKXA 2VQEF 4GKJJ 2LCWA 2CJXB 2DGXA 2IMOA 2MKYA 2DBBA 2NUHA 3HX9A 3LANA 5KFQA 3Q8SB 2R8GA 2F4VF 4NLXA 4C8ZA 2PA3A 5HAOA 2DB1A 3RG6A 2ZDPA 1SJQA 4UOGA 5LMUF 3JTPA 2YKMB 2RS2A 2UUBJ 4GMKA 3CC7S 4FPIA 2XS5A 3KLEA 4B3TJ 4AYBD 4KHRA 1F2HA 4A47A 2LP4A 5JVGQ 3MUTP 3TQ1A 1ZPVA 1Q8KA 3U1MA 2IDEA 3CT9A 4R25A 5KG5A 1HPZB 3MCSA 4USHA 4HHJA 1RKJA 4GVBB 1IBKF 1CULA 5L1IA 4PPZA 4NASA 2ZH4A 3CMAS 2AHOB 1VYAA 1HHTP 2Q79A 3UDEA 4X4VA 4JYAJ 3QIPB 2JSXA 4XTTA 5ETNA 5HVFA 2HRTA 5KT7A 1CJTA 4J5OA 2IM3A 1JNZB 4W4MA 3KJVB 3PVXA 4C8LA 4C2MA 3HSZA 4K4WA 1NDKA 1V5IB 3QJJA 4IO1A 2GJ2A 9ATCB 4UY85 1U6FA 3HVAA 3NBPA 3ISNC 1RT4A 3D1OA 2WBMA 3P96A 1M5OC 3BDPA 4DBQA 4PAAA 1S10A 1R6VA 2BDPA 2V4QA 2UUBF 2KB2A 5HP1A 2ZH1A 1KSPA 5E41A 4DLGA 2HBYB 5KFMA 2ZD1A 3ZTQA 3DNCA 1DRZA 2FVSA 2BJ9A 4M5DB 1HBOA 3SV4A 4JV5F 5J1EA 1VQYA 4OYIA 2ZWOA 3W64A 5F8MA 1NHVA 4DWIA 3CD6S 2EBEA 1FK9B 1VJWA 2GC8A 2LQ9A 1UWBA 2B7CB 4NCGB 2M9KA 3F0NA 4HDGA 1X4CA 2V8HA 1WOPA 2C42A 2FTRA 2KT5A 4ILRA 1RTHA 4O0NA 4G6VB 3AFGA 4OJGA 4X84A 3PIPQ 3EZOA 1SJFA 3EPGA 3N6LA 4TY9A 1SQGA 4LJMA 4AE5A 3PHTA 4DS5A 5J2PA 2V4JB 3JQMA 3LP1B 3TZWA 1KDNA 1QE1A 3OXLA 5HBMB 3KK3A 1RAFB 2MQOA 2RAQA 2EFPA 2FC9A 3IMQJ 2BUNA 2XM3A 3LAMA 2DVIA 4IR9A 5DLGA 4X65J 4IFVB 1LFPA 1NSPA 4M5NA 2FJVA 1U1RA 2IHR1 2VPWB 1P9YA 5D77A 5HQ8A 5A8KB 1T95A 1RCXB 3K5LA 1S9FA 3CJTA 4Q2MA 2F8MA 5H9FK 1WG5A 1WDDA 2DNOA 4PWWA 2R7TA 1NZ8A 2G1HA 2BE2B 3KLIA 3TA0A 4DR2J 3HFZB 3LALA 1XN9A 4M5MA 1RADB 3QWUA 1NUEA 4ZVPB 1FVQA 1S9EA 1RT1B 1WDTA 3V6HA 3CJRA 4DPYA 5B7WA 4J9VA 3TARA 2BR0A 2YQ0A 2I38A 3X1LB 2AZ3A 2FJEB 2ILYA 5FLXY 5E3AA 1U6BA 4H4MB 1IR1A 4NMXA 2YTCA 1S1XA 2O01C 2V2VA 3GSIA 2HZVA 1FFGB 4M5GA 3PR4A 3UCUP 2GAHC 1X9WA 3BN7A 2BM0A 1YGYA 4ZP8A 2PO4A 1QUPA 5A8WB 4RUCA 2B8QA 2QSWA 3CCTA 3CO0P 3W2VB 3TAMB 3MMBA 2VL1A 2XEXA 4ZPVR 4CH0S 4I7FB 4J9NA 2Y1IA 1SL0A 4QQBA 4DEZA 5KG2A 1D0EA 3IAS9 2KJVA 2HGMA 1WUUA 3JAMY 5KFSA 2LU1A 2CZVC 5SZTA 3PW7A 1GXUA 2BVZA 4L76A 7FD1A 2MQPA 1Q1KA 4ED3A 5KT3A 1JLGA 2DXEA 4B9NA 2Y1LB 1VQ9S 3AD9C 3IBWA 1TFWA 3H2VE 2CQ0A 2VQFJ 3OTOJ 3L4BC 1RYRA 2CAJA 2BZ2A 2XSJB 2JH3A 1VBYA 5E2QA 1IJFB 1H98A 1RAJA 2EVZA 2BRKA 4RR5A 3TJ8A 3BQ1A 2W2PP 4FNHA 2HFSA 3TQEA 2XY6A 2IPOB 3GJRB 3HFKA 3M8PB 2Y8YA 2WAQD 4ID5B 4EGLA 1N32J 5LMNF 4U7UK 3TYTA 1EHWA 4OV1A 2OPQA 2Q6BA 2CA9A 3HJVA 4DU7A 2QLXA 2GQCA 1QVGR 4KT0C 1PILA 1M5SA 2XMUA 5L38A 2RU9A 1RBLA 4RW4B 3R7NB 2FVPA 4WIQA 2BRLA 4CLPA 1VRQC 1D8YA 2VFVA 4QYRA 2HZAA 3CF5Q 5F8LA 1U1KA 2XGPA 1E6YB 2D3O1 3BGRA 2B6AB 3KG1A 4DCOB 4OJ3A 2WCXA 2AQ4A 4MT1A 5D0EA 2QYGA 1MMLA 2CJAA 3MM9B 4ETXA 1RAHB 1UA1A 2GMLA 1K0VA 1HBUB 4ZN3A 2NSBA 3PO4A 2EI5A 8RUCA 1XIQA 2C3MA 3MTJA 3QIDA 2ZZMA 1TTHB 1NLKL 4ZIWA 1MWZA 1RWUA 4K2JA 2PFDA 1N8RT 4FYWB 2X1AA 4LF5F 3V81A 1ZBTA 3FCVA 3EICA 3OR1A 4AFFA 1SCJB 1RACB 3KJQB 1CSJA 1YX2A 3AOCA 4CT8A 4B3MF 3LOUA 4FXWA 1RABB 2QN6B 2XLJA 2HVHA 2C2MB 2VG6B 1HL6A 2IRYA 3FCHA 3G82B 2CVEA 3DRPB 1X4DA 2DH9A 1FERA 2E5GA 2IRXA 3CB4A 3HHKA 3CMQA 1NM2A 3PFEA 4BBYA 1FJGJ 5D15A 2CNKB 4R5PB 5HQMA 3VQTA 2LEPA 4LR7A 3P5BP 1R27B 3ENVA 4CNYA 1WHVA 2KI2A 2OIHA 1XQIA 2VUGA 2R7SA 2KL8A 2VU5A 3ZNJ1 1S1TA 4YHHJ 3EXYA 4AQYF 2RRNA 2QEXS 2CJKA 1CC7A 5A76A 2N7CA 1B4SA 1S1VB 2CQDA 2UUCF 1M5PC 3Q23A 4DSEA 2D74B 1HHQA 4AL5A 3BS9A 3NNCA 2GHWA 3G9CA 2V94A 2IJNA 2R3VA 2Y3YA 3VAIA 1HIYA 2AV5A 4DR5J 4WU3A 1Z1ZA 2GO8A 2MSTA 3W5ZA 3D6FB 2JDJA 1Q82T 5T41A 2P9EA 3D6TB 1KHWA 3KDOA 3ZZPA 1XNRF 4FYVB 3BM7A 1PCAA 4NZ7A 3SIPB 5J2NB 4I67A 4DV6J 4RPFA 3MUMP 1FE4A 4MYTA 1HD0A 5D78A 3IBCB 3Q8YA 1S1TB 3V6DA 4NYOA 2QA1A 3A8JA 3DDNA 3IR7B 3IA0A 5EX0A 4CLKA 1NHKL 6FD1A 2E9TA 1JJCB 1NZAA 2DR6A 5K20B 4B3SF 3MOZA 5D3GA 1XNQF 2ADBA 4USKA 1TQLA 2JNJA 4PWUA 3CW2C 4X4SA 3MPWA 3SCKE 1RZMA 4USUA 1B0TA 1KTVA 4GKKF 3BGRB 2HMIB 2H3EB 3W9IA 4ITSA 4WTOB 4X4QA 3BYRA 3LTOA 3SQGA 2A0FB 1WC6A 2VG6A 2PE8A 2KM8C 1R0BG 1EETA 3ULHA 4ECTA 5HVHA 1R89A 3DU5A 5CZVA 2KG1A 4URSA 5J2NA 1Q16B 4GO7X 4EBCA 1F9HA 3DKDA 3QSIA 4WIIA 3V81B 3FC9A 1L3VA 5MAOA 4C3KA 4N77A 4DSLA 3B6BA 4OYXA 5LJ5Y 2ZUGA 3T1HF 1S9EB 1J27A 1B0PA 2UV8A 3G6XA 3QT7A 1KKHA 2LFVA 1IBLJ 3U1LA 1WHXA 1QUVA 5HANA 2ZWPA 1SI9A 1WSVA 2OI2A 3MM9A 4U6PA 1URNA 2WSEC 3R97A 3R7BB 2GJFA 5E0OA 1PG5B 4CYUA 4P71A 3NGTA 1KONA 2LA6A 4IOAQ 1XR6A 4I4BA 3DLHA 2E1MC 1DHMA 2MTLA 2NPIA 3EYZA 2UUTA 3MEEA 1BUXA 3DLBA 1XMOJ 3B78A 2VBWA 3NOCA 3QT8A 4A48A 3GQCA 2OD4A 4PYDA 4LUBA 5L9NA 1K44A 5DQHA 3ENAA 3PW2A 3KLHB 4USMA 1R7IA 4DUZJ 3DYAB 3R5JB 3DOKB 3M8SA 3CNQP 4O44B 4YB1P 3ZZYA 1BHNA 2YX1A 1B99A 1F9EB 2YKQA 1HR0J 4JI1F 3OL7A 3G82A 3J7A1 2VIHA 2YWHA 3MEDA 4U7CA 3AOBA 5F8HA 4H4MA 4FYXB 2XZWA 1FXDA 2XSJA 4ED6A 4KRWA 5LMNJ 1HNIB 1DZ5A 3OFFA 2R7WA 3UI3A 4L3KA 5E3QA 1OS5A 3KG4A 2MQLA 2XHCA 3ZC4A 2QRRA 1REGX 2CQCA 1Y7PA 2I5JA 3KLFB 4AL7A 1P6TA 2DNQA 1S6OA 3KKFA 1S6PA 1IBMJ 2XLKA 3NWGA 3VZIA 4B3OB 3OUYA 5DLFA 1RT4B 3G8QA 1ZTTA 3VZHA 4DI6A 3KK1B 3PG9A 5B0CA 4F7VA 4IR1A 3OHBA 4ZKAA 1RTDB 1JLEB 1Q95G 1RLCL 2GQ2A 3V4MA 2CWXA 2KRBA 2W7AA 1U45A 3N01A 2VG5B 3W8PA 4DQPA 3OSPA 5F8JA 4WP9A 2P9GA 1SH0A 2ABYA 2BXJA 3TRGA 3QLHA 4MIWA 3QZ7A 4UOFA 3NEKA 4DHVA 3QAEA 3F41A 4YN3B 3VF0B 1VQ8S 4H54A 5DS7A 3OVAA 2IVYA 3GYXB 1R8CA 4OZ0A 2XMJA 4J91A 5C42B 1NK4A 1IJEB 1FF2A 5IV3A 2MHNA 4Y34A 3JB9k 3M32B 3W9JA 3PV8A 2CQBA 2VHGA 1RT1A 1UVKA 5GAEI 2UVRA 3M8PA 2B0GA 4EUVA 1KD1T 4LBIA 2I0XA 4NCGA 1T9TA 4OQJA 5HMWA 1AYEA 2FGCA 2QSFA 2V68A 3HD2A 4ECVA 3WHIA 1N34J 2MY8A 1YRTA 1X0FA 2KRRA 2AJFE 2LXFA 4AXIA 4LSNA 4O3RA 2Z2LA 5DQIA 3FNNA 4ZVEA 1HYSA 5KFAA 5KFHA 2EWHA 4N47A 3SSRA 2QLJB 2I2YA 2KJWA 4DPOA 1UFLA 4CO4A 4M94A 2V4JA 2GIFA 3LP1A 3OTEA 1O0PA 2F7VA 4ZPDA 3WC0A 4F4XA 4B9MA 4E98A 5BXIA 3VVTA 5IC4B 2QO3A 1RTHB 2YNGA 3EJMA 4MK7A 3CCZA 1CJTB 4P52A 4F25A 1DLOB 5D4LA 2CJBA 5A8WA 3G6YA 1C0TB 3QO9A 2CNOB 4QYZJ 4UTGA 5L46A 1IKYA 1FWLA 3BF4A 5ADZA 1YJUA 4DUTA 2R7RA 4QR0A 2C2DA 2DO0A 3WIVA 1RK8A 2HWHA 2XG8A 4P72A 3VGTA 4XDCA 2IJFA 4J9SA 3RBXA 3HD1A 3FEXB 2GHPA 2GCFA 4TY8A 5I3UB 4TQSA 4USIA 1VC0A 2CPEA 1NK9A 3HF5A 3E01B 3GG1A 2AGQA 4DV5J 4ANEA 2BJEA 4B08A 4OI6A 2HG4A 5B0GA 2C28A 5HN0A 1KN6A 4LFAJ 1OYEA 4DG1A 3HP6A 1FI4A 3THTA 3HJFA 2XULA 4NEZA 3CDAA 1NSKL 3QBCA 1BQMA 1DQ9A 2QX0A 3H98A 6AT1B 4ER8A 5KFVA 2GIQA 4MAKA 1CULB 4XDDA 3UNGC 3ILLA 3D67A 1FDNA 3T3FA 5EWFA 1HWUA 1U02A 3UE2A 3H25A 3MFIA 4DV7J 3GG0A 4DFPA 3UD3P 3HVRA 5ETLA 4GO5X 5CYJA 1CQNA 5FIIA 5KFWA 1HNXJ 1HWKA 2BW7A 4WF9Q 2VF3A 4FYDA 4JI4F 3BGUA 1X8DA 3LWLA 1Q78A 3VGUA 5KT4A 4X62J 1N32F 1PIEA 4LF8J 3M9OB 3KDNA 2C3UA 3Q8RB 5CYMB 3VAHA 1U1QA 1SC4B 3GR0A 1U2RA 3VAFA 2GMJA 4M5DA 4WCEQ 4JV0A 4UOCA 1VMBA 4Y2AA 2ZH6A 5HP1B 1HMVA 1SC3B 1EIYB 3CIMA 3C6UB 1NB2A 4LF2A 2EFVA 1J5EF 2P6SA 4HYKA 3M8QA 5RUBA 2MEWA 3QGGA 5KFYA 2ZUAA 3MDFA 3TP2A 4WWSA 5DM7Q 3I0SA 1OSDA 2YNIA 4LRDA 4P7TA 2VBYA 2XNRA 3TZYA 2EEYA 5DRKA 3SDEB 1VLYA 3HZGA 5LXRA 3IRWP 1LKZA 3PCOB 5JJBA 2V9WA 5C24A 5CAAA 2HZCA 4XPEA 4PXEA 1YJRA 3ILJA 3LO3A 3H20A 3NOGA 4M5IA 2DNNA 3CCLS 1SJ4P 2DY9A 3MF5A 4PYAA 2UUAJ 2HPUA 3Q2TC 4PG4A 1RTZA 2HNYB 4P2SA 3W60A 4FVCA 4OX9J 1S0NA 4C9DA 2KZMA 3GFYA 2Z4PA 3T41A 2KFNA 2HFNA 3I0SB 5KFZA 3OFHA 1SIWB 3R1LA 4IH6A 3EZ5A 3CJ4A 1Q8BA 1IBMF 4ZHRB 2DGVA 4PWDA 4C8NA 2JEJA 1X4GA 2E1AA 2J76E 1VQOS 2UZAA 3ITHA 3G6ES 4OHXA 3I5AA 2RHQB 4Z2XA 1NKCA 3VGSA 5KT5A 2J9EA 5KG6A 2V9KA 2OFHX 3T19A 3G2XA 2J9DA 1JIHA 2DNLA 3UWTA 4OX6A 1BE4A 2CRLA 3DM2B 2ERRA 3J80U 3RBEA 1M1KT 4IH5A 4PG8A 4OL8A 1T9WA 1X4HA 1H2TZ 1RE1B 4WJBA 5D4NA 5IQQA 2W9BA 4LF6J 4DR4F 3CD7A 3ZZ0A 4DX7A 1HNVB 1XERA 1QY7A 4JI6F 4IG0B 1SKUB 2B4PA 3HULA 3NRBA 2W01A 4LSLA 3PHEA 4JP8A 1EZZB 1WG1A 1V3ZA 4KH1B 4KB7A 4UUXA 4ILLA 1IM4A 2IRUA 2IFXA 2L08A 2P5VA 2Y0SD 3GWCA 2R8JA 1LWFA 4QYZK 3Q24A 4KKOB 2VPXB 3C6UA 1K47A 4J9QA 1Y3JA 3M9NB 4BWJA 4F3OA 1WOOA 1HYSB 3NGKA 4C0BA 4C97A 1LW2B 3WBZA 3RGIA 2OO4A 2ZOFA 3LGHA 3FSXA 2M88A 4NLUA 1S4FA 4KFBA 4OZLA 3SSSA 1S97A 1X5SA 2HSEB 1VK3A 1B70B 2K7JA 3ITHB 1PO6A 3R2CJ 3GB0A 3Q83A 5KFXA 2DJWA 4G1IA 4DCJB 5CCMA 5MLCV 5H9EJ 1LV5A 2WONA 4WK3A 4HH1A 2R2TA 4TY8B 4V19J 2AJ2A 3RB4A 1T05B 4EYHB 3OT9A 1NO8A 2NSCA 3RRKA 5AJ3J 4N5SA 3V6JA 2H5IB 1RLDA 2ZKUA 5L9XA 1CG2A 4D3GA 2B5JB 5HLFA 1X4FA 3K5OA 1S0OA 2KHDA 5A6WA 5B0AA 5CZXA 4TXSA 2X1GA 1RTJB 4WXWA 2I6WA 3GLJA 4I2QA 4EMDA 5CA5A 1WD6A 4RNNA 2L9WA 2JFDA 3AOAA 3LW5C 3D2WA 3BSCA 2CPYA 2UXDF 2I8EA 1A0OB 2HBQB 1N5TA 2AF6A 2V8GA 2W4DA 1JLQA 3I0RB 4CO0A 4Q0BB 3C6TA 3R9LA 4CQ1A 3T5HA 1TKDA 4MFBB 1IKWB 5E3RA 2ZHBA 2NREA 4RNHA 3H5UA 3DRYA 4ED0A 3D3CJ 5K14A 5DZ7A 1RU2A 1PYTA 2ADCA 4E8UA 1HNIA 4J9MA 1GMWD 1HLWA 2YPZA 4WE1A 4TU8A 4BWMA 4DFKA 2OTJS 1SB6A 2RDJA 1FRXA 2IM1A 4ZN1A 2ZJQQ 2WBRA 2K06A 4KHPF 2GZOA 1EX8A 3IG1B 2CPDA 5IT9U 4P73A 1MLAA 3QT5A 1JXEA 4WFNQ 1E6VB 2MY7A 5KOXA 3HHDA 3PY8A 4Q2LA 1SL1A 2FVRA 2WSFC 2G13A 3CTRA 1BC6A 5DG9A 1CJKB 2GFFA 3W63A 5C7PA 3N6NA 3OTOF 2ZHOA 1XJWB 5ETVA 2OD6A 4YR2A 3C46A 1DTTB 3OQ2A 4IDKA 2LLZA 3EGVA 5K8PA 3NKYA 4LSNB 3J7Z5 8ATCB 2E5LJ 1EP4A 2VG5A 1KFDA 2BANA 1JLEA 1UTAA 1Q81T 4OZ2A 2DGTA 1ZM9A 2DIUA 1IQZA 2K1RB 2ZC4A 1KLMB 3E3XA 3KK1A 3BPSP 2LECA 3VTIA 3BO4A 3F56A 3RBZA 2B56A 1U1MA 3P8BB 3HHLC 2VASA 2Y1JA 4TKTA 3W5YA 2BJ7A 2VDHA 3RB3A 5CABA 3LP2B 4J7CA 2C3YA 2I5JB 4P2XA 1I51B 3S1TA 3KLFA 3M32A 1HI0P 3L7OA 2KYZA 3IR5B 4I2PA 2HIQA 5KFTA 1KQGB 1TKZB 5C42A 4ZVFA 3MAAB 3OHAA 3W65A 3EGNA 3B4MA 2HKEA 3JSBA 2CFXA 3RUBL 2QYCA 4CLTA 3K89A 3DFEA 4ZPWR 5GMKa 5JVHQ 2F63A 3CDUA 2JEIA 3IM9A 2FB0A 4KGMA 2VOOA 3NMAA 1VQ7S 2IM0A 2XYHB 3ZZTA 4DN9A 4WZMA 1C0TA 5CHCB 3U7JA 4I6AA 2ZEJA 4CDIA 5D0HA 2O1PA 4TU7A 3WX4A 1MU2A 2FY1A 2ZBPA 1MN9A 2YNFB 1EJ7L 1S9GB 2YH1A 4NLDA 3Q8VA 3ZO7A 3FBEA 5DGBA 1RT5A 1RGVA 4ALZA 1Q0NA 2BYCA 4A4JA 2LXIA 2HLTA 2QMXA 2DY1A 4DR1F 4RBUA 4RW7A 1VQNS 4XK8C 5CQGA 1WKKA 3EPIA 4LRCA 3I32A 2HWTA 3HT0A 2XI3A 4XPCA 4ZLJA 4QWEA 2RQCA 2ASLA 4CO1A 5M2RA 3CJQA 2V8VA 3FMWA 3RZAA 1D8ZA 4RWXA 4CYUB 4A8YA 3OL8A 3T9ZA 4LVNP 3MR2A 4W92B 4J90A 2G0CA 3D6HB 2FZKB 1TAQA 5KFKA 3TI0A 1VQLS 4F4WA 4TLQA 4YQWA 3QPIA 4I0WA 4ZVGA 5F9NA 4P7VA 1QSLA 1RBAA 4B3MJ 2XWXA 3R6GB 3MGJA 1YBUA 3PTWA 3HDSA 3R27A 4XAKA 3W1YC 4C3MA 3KMSA 1IBKJ 5GAHU 2HNDB 4DL5A 3CD0A 2MZRA 1NKEA 1IKVA 4NI2A 1DQ8A 5K8NA 1QSSA 2AIRB 1TR0A 1IXKA 4QIWD 2F65A 2V34A 4JUZA 5EWGA 1VQPS 2D3UA 4Q44A 4LF7J 4F4AA 4LFCJ 2YXLA 1B7FA 2HIYA 2H4WB 2JVOA 4ZPBA 3CXCR 2DKOB 1BQXA 1RTDA 3T1HJ 2A18A 1NH8A 4ELTA 2DRBA 2HVZA 4ENOA 4MKYA 1VQMS 2E44A 2X1BA 4A8WA 5M2UA 4LFAF 4ES1A 3MM5B 3VAJA 2MLXA 1HBMB 3KHLA 4B3RF 3DOMA 3RR8A 5BYRA 1IQTA 1TP7A 3S01A 4LF5J 2ROPA 3RU0A 2OEJA 2GQQA 2HGLA 1S6UA 3BBFA 5LJ3Y 2CNLB 3M30B 4RNMA 3HMJG 5KFBA 1MG7A 2Q43A 1WKJA 4OI2A 1C1CA 3U02A 4UOHA 4LF1A 1VQSA 2LKZA 1G6BA 1HWLA 2WW8A 2WZ1A 1NH7A 1YZ6A 5FDLA 2DCUB 3UO0A 2D7SA 4RU2A 4NMLA 3KUEA 3ZTOA 2MPUA 2XZDB 1VC5A 4FBTA 2AKWB 4L75A 3FMBA 4ZVOB 3CCJS 4FF2A 1JB0C 3OD2A 3THPA 3P5TL 3VHQA 3ZTSA 3JSMB 2LEBA 3DLGA 2RQKA 2JLEA 2QA2A 2YBVA 2E7WA 1REVB 3HHLA 3LGNA 3MEEB 1LK7A 3V5RA 4CP5A 5K5MA 1BQNB 2EFOA 3QRRA 5E5NA 2JC1A 3MPYA 4RW4A 1TV6B 3AB2B 1GX5A 2BMBA 4OHVA 2OPRB 1X5PA 2WHOA 3FRYA 3I6PA 4ZP7A 5F0WA 2ZZTA 5B08A 2OPQB 4X65F 4WKYA 1IBLF 4B9TA 2O67A 4PABA 2GVDA 5T7LB 2G4BA 1FDDA 2LQJA 3MWBA 2YWFA 2IAJB 3Q86A 1TK0A 1GFWB 4QIGA 5IZHA 1N0VC 3PX4A 3L09A 1PKUA 1RXOB 1QTMA 3DRPA 1GTEA 3DOLB 2UXCF 4G65A 2N7YA 3NS5A 2KG0A 6FDRA 1C1CB 2FQQB 4K4VA 4KHPJ 4PPDA 2BKPA 1LXNA 4WTYA 1WF2A 1X4BA 4KSEB 2KDOA 1VCTA 5A2QU 3H40A 3TUZC 1O8BA 5EGYA 2HAIA 3MECB 1HNZF 3CCES 3K8VA 2M5YA 3BR9A 1R0AB 1N5VA 5DDPC 4ECSA 1KS2A 2OMLA 3MZIA 4QIVA 4RUBA 4DUZF 2MZTA 4RW7B 1LW0A 4ZK7M 4Y0FA 1M5VC 1HBUA 4TLRA 4FYYB 1XNQJ 4TN2A 5KFIA 2E5LF 3DRSB 3DI6B 1JMTA 2QJ3A 4PCQA 5B0DA 8AT1B 5KFUA 4WP3A 4EI2A 2XO7A 4ERDA 4X64F 1E6YA 3DHXA 4A8SA 4TVAB 4ZVHA 4ZVQB 3I82A 1SC6A 3NY0A 3GV8B 1YJ9S 4ZCKA 1LEOA 1RAOA 3BGOP 2IYIA 3IXQA 2GGPA 3AD7C 1M5KC 1FEEA 2D9OA 3TVZA 4GC6A 1HR0F 2YY3A 4LQ9A 4B02A 5I3QA 2AT1B 2LA4A 1QD1A 2OEKA 3LWMA 3WX8A 3DOMB 3BQ2A 2MMYA 3G87A 4H4OA 2ZH5A 4DQSA 2ZC3A 1S1UB 4RKUC 1JJ2R 1VFJA 4DS4A 4CLSA 1OPIA 4KQZA 3SQOP 4E0DA 2W25A 1TAUA 4S0MA 2B4UA 4UQGA 3C2PA 1IBCB 4YDDB 3FSIA 3SI8A 2MKIA 4RZRA 2RU3A 2OPRA 2MQMA 2DHSA 3HKZD 4HI1A 2YKOA 3GP9A 5KOWA 2NUUG 3GILA 4IOCQ 4DR1J 3K58A 2E66A 1M1GA 1TV6A 5FJ4A 2QLFB 3GV5B 4FN5A 3QZ8A 2XS7A 4IH7A 4O3NA 3H8YA 1QE1B 1FHTA 1AUDA 5EUHA 3CDEA 4DV3F 5GMDA 3IN5A 3MI7X 4O23A 1HQEB 2H4YB 2Y8WA 3IG1A 5FDLB 2CQ2A 1FDAA 4RX6A 1FRMA 1S1WA 3RYLA 4HLBA 4L73A 4MK9A 5LOQA 1S1XB 1D9AA 1TK8A 2AD9A 4KJIA 2HQIA 3OFEA 1JLCB 2M0GB 3IGVA 1KQFB 5A8RB 3AHPA 5CCLA 4NCAA 3EM1A 1SJ1A 4C6AA 4ZLPA 1UVLA 3EGZA 4K4ZA 1CJUA 1R6YA 1RT2A 5G0RB 1PJ5A 3D0HE 4MMOA 4Y2KA 4U7UD 2DEJA 3PRDA 2HQFA 2Z2ZA 4PKDB 1JLGB 3MPDA 4ECWA 2NXCA 3NNHA 4RL1A 2HBZB 2RB7A 2XZTB 2PI5A 4OI0A 3U1NA 1DAXA 2X3GA 4Y2MA 4RNOA 3FEZA 1OO0B 3KFWX 2KN4A 2VFTA 1RWNB 5GAGI 3FFIA 3SV3A 1NDLA 3CDBA 4KGKA 3TUJC 4ATNA 1S76D 3KMQA 1T9XA 2RRBA 3NS7B 2HVEA 4C3LA 4Z37A 3GE9A 2LDYA 3MMBB 2XY7A 1S9GA 3LP0B 1N4LA 1S79A 1X4EA 3HO1A 3BZQA 1HARA 3ADAC 3IBFB 4NXNF 4XO0A 1UVJA 1AUSL 1N33J 1WC1A 5E3PA 4OHWA 3FZ2A 3BREA 3NAIA 1S72S 3FRZA 3TA1A 3KNAA 2C1EB 1CJKA 2AWZA 2ZM6J 2W8LA 4EZ6A 3KK3B 1UJ4A 2IC3B 3MCMA 2OHDA 3MAAA 3QT6A 3H2UB 2J0SD 2VJUA 5B0FA 5IT4A 2JC0A 5DDQC 5F8NA 4UUWA 1C0UA 4K7QA 3KK2A 1RISA 3LP2A 2PMWA 3M6WA 3AT1B 2W2MP 2FVCA 4OFZA 5DDOC 4DV1J 4DLEA 1T03A 2HHVA 2C2OB 3T6BA 1UVMA 2HGNA 3K8WA 4IRCA 2MZJA 3H5XA 2RJZA 5IQ6A 1HBNA 4KFBB 3TVKA 4CT9A 2UVWA 2BANB 4YEAA 2GV1A 1ACMB 2VB6A 2XSFA 4IYQA 1GK8A 1HKAA 2MHEA 5K14B 5SUHA 1VOMA 3VVUA 3P3DA 4X4UA 1FJCA 3M2RA 3DDIA 3NWRA 2ZJPQ 2KXNB 4X4NA 4OYOA 1GQEA 1U47A 3C15A 4RWWA 4ZJQA 1JLQB 1U25A 2CQ1A 1WEYA 2K3KA 3BN4A 3ZZOA 3IO1A 5AXKA 2J6UA 2IVMA 2V0NA 2J0XA 4LF8F 1K73T 4O0IA 3HVTB 1MU2B 1RTJA 2KVQE 5GADI 5HMYA 1MMNA 4ZP6A 1X5OA 3IS9B 2HHHF 2NZCA 2Z57B 3SZ2A 1F0XA 2DNZA 1UWAA 4ZCLA 3TJ9A 1UVIA 2IDLA 1N88A 2B5JA 3DGPA 1YJTA 5ETRA 5HLFB 2DNGA 3CC2S 1N56A 2EFQA 3FVYA 1GMUA 4FKYA 4I69A 3G86A 3Q8UA 5LL6d 3SCLE 5C25B 3J7AN 1FT8A 3MD3A 2DHAA 2P2CB 2WW4A 3MMCB 4K4XA 4LQ3A 4MKBA 4QBUA 5HJYA 2VA2A 4FXVA 2IYGA 4OYWA 4QU6A 2FHKA 2RMLA 2K1RA 3TEGA 2P9CA 2FHOB 2YNHA 3OXFA 2J0QD 3DLKA 3QQCD 2M2BA 2EKNA 4F0MA 3G6VA 4DR2F 1EP4B 2Q6CA 3Q22A 4I6WA 1JX4A 1BGXT 1S49A 1YHQS 1S59A 3AY0A 1DTTA 5GAGU 2DNKA 3A3NB 1K0TA 1DTQB 2FJAB 5AE3A 3TAPA 1WEZA 1BY9A 3BSNA 3D68A 1CVJA 5C24B 3KOAA 5J2PB 2KU7A 1R8BA 1RWMB 2HVDA 4LF9F 1K1QA 2VFRA 3KTQA 2H65B 2DITA 2W8KA 4DL4A 2YNIB 3BR8A 2DGQA 2AW0A 4IG0A 2JLGA 2VPYB 1XEZA 1U49A 3I55S 3T1YF 4CCHA 3MM6B 4I6YA 5IC6B 3SFGA 2F8HA 1V9OA 5HSPA 1EB0A 1HQUB 2PT0A 1FRHA 1RWXB 5FLXU 3MEKA 2LQ8A 4KYZA 2OUGA 2AYEA 2ZD1B 4EBDA 1X9MA 2GNKA 3N79A 4RU9A 3GYGA 1SV5A 4OX9F 1TK5A 1VS3A 3I0RA 2YKNB 3D4JA 4NA2A 4OX8A 1ZAWA 3UPFA 2A10A 2ASYA 3KG0A 4JV2A 3PJWA 1NDPA 1TKTA 4HR2A 3IRXA 1RT3A 2B4VA 3LQVA 5AE1A 9RUBA 3M2UB 4FS1A 1L3KA 4DR4J 2W4CA 1CPZA 1JLFA 2XMWA 2CVIA 1OYDA 2V69A 3D5MA 3L9ZA 1ULRA 4DZDA 5I4MA 4DL7A 3N5BA 4IRKA 4DV4F 1MSWD 2BX6A 1I94J 4GVBA 4Z7YA 3NL0A 3M1VA 2HHPA 2F3JA 1U1LA 1FKPA 4BS2A 4R8UA 4DCPB 4RJVA 1S77D 1RKIA 4N41A 4B3RJ 4J9PA 2ZBRA 2C2KB 3IRXB 2FHJA 4OYBA 3FJ2A 4DQQA 2P8IA 3CMES 4U8VA 2FZGB 1PJ6A 2YKMA 1RAGB 3AXKA 3LPEA 5KFEA 3HPOA 1XC9A 4MYUA 1WC5A 5DG8A 3CJ2A 2E5JA 4P2MA 1W2IA 3VV2B 2CPHA 3BQ0A 4OMFG 3IFEA 5DDRC 2RQMA 3KNGA 3KHRA 3IWNC 2NXEA 5J2QA 1G2EA 2RT3A 4MTPA 4PQUA 1H6KX 3NG8A 2CJYB 2O5DA 1W26A 1ZS6A 2RQ4A 2B9WA 3AJ1A 2ZM6F 3QO9B 1RJJA 2AU0A 4DQIA 2HHXA 5A0YA 3AJ2A 3KLGA 4W90B 3HHEA 3JYTB 1FNXH 1LWEA 3I87A 2XLIA 4KBIA 3MAQA 4RLEA 1L3TA 1QJHA 1U0HB 1U09A 1XTZA 3A4TA 4URQU 3T1AA 4J9LA 2AJQA 2UU9F 1KWMA 4CRJA 3MFHA 2CXEA 1X4AA 1HI1A 3C16A 3M2VB 5H9EK 2E1RA 5HJXA 1RAEB 5A2QY 2R4FA 1NXIA 1FRIA 2RVJA 2ZH9A 1VBKA 2E7XA 2C2NA 1AROP 2KYXA 3CD5A 3M2RB 1VQ4S 2W7OA 1KRPA 4IUFA 1BQMB 2B8PA 5M2PA 1LWCB 2HRUA 5CH7B 3TA2A 3JSRA 3H5SA 3QRPA 1UW4A 1BWEA 1GNKA 2CPFA 3D0IE 4ZIVA 1FJ7A 1FRJA 5I3PA 2HFUA 2BEFA 2YVSA 3EE3A 1U26A 1C4AA 2HFZA 2K8GA 4AD6A 3PX0A 1FWKA 1F60B 3WIUA 4E2FB 1FRLA 2P6TA 3P49B 4HI2A 3MMCA 3F73A 1CS4A 2J9CA 1DARA 1F5BA 2W2QP 1GXTA 2RSQA 4DR5F 4F02A 1FKPB 3BSAA 2WVBA 3MUVP 3CUNA 2V67A 4JI5J 1AZSB 2D1CA 2IIHA 3E8OA 4N8NA 2FLLA 4JV1A 2F4FA 1OY8A 2HHSA 1AFJA 2KTQA 4M5KA 3ZNUA 4X64J 2ZDOA 3A8EA 4OV6A 4NL5A 2V8PA 3ILIA 5D0RA 3OTDA 1RBOB 4KV8A 2O66A 5F3TA 4RBTA 1TVRA 2XHWA 4P2FA 4MIAA 4CNZA 3HZEA 3HFVA 4J9UE 3Q89A 2CKWA 1B64A 1IUJA 2C2EA 1UEKA 1Y4ZB 3M6UA 4J9OA 4FS2A 4ETZA 1YI2S 5HI7A 1F6TA 2HK2A 2WB4A 2WOMA 1HMVB 4O4GA 5HROB 1NB7A 1B3TA 2G0JA 2V50A 3UN3A 1LQ9A 1SC1B 2Z2MA 3MM7A 1C1BB 4N7TA 4DX5A 4CLUA 3FQKA 2QFJA 1J5EJ 3DLEB 3NLCA 2JVRA 5KFRA 4XIUA 1FKAF 2E29A 2C22A 1B0VA 4F36A 1S7HA 4ZA1A 4UY8T 2JEGA 4DX6A 3ZXWA 3BB5A 2DR7A 3AAWB 4A8MP 1TU0B 5L8RC 1M90T 1HHSA 2RDIA 2YX4A 3V4IB 3TW0A 2VBXA 1WHYA 2VC1A 3GYNA 3BGLA 3J7ZT 3PM9A 4NLYA 1SIZA 2DGOA 2LU2A 3VGVA 4OZJA 7FDRA 2NLWA 3QATA 3A12A 4F67A 1P27B 2IC3A 1FXRA 1KVJA 1Y10A 5ITHA 1WACA 3ENWA 3EVOA 2AYBA 2VONA 3I9ZA 1HNWF 4LF7F 5IWAJ 4ELVA 3BV8A 1RWVB 4CI0B 3CJSA 3HT3A 3W9HA 3QYYA 2ALYB 3QLHB 2W2OP 4RW9A 4K0KF 1IKXB 4KE5A 2HHTA 3I4HX 4IG3B 2QIFA 2G1DA 3K59A 5EN1A 1YRXA 1UZHA 1H73A 1HBNB 4QJVA 2YNHB 2HHUA 3PDNA 2GO9A 3AH6A 4NE9C 5IM0B 5CD4H 4WYLA 5ETQA 3I9V9 3O8WA 1I1GA 1PBAA 2HEKA 4RBVA 3OUYB 1R31A 1SKRA 1Y5LB 4U8YA 1AB8A 3W62A 1T03B 2M70A 4K0KJ 1VRUB 4JYAF 5I3UA 1RHJB 2QL5B 3DC2A 2B51A 1Q8IA 1CJVB 3KXDA 3CE8A 5C25A 3MPUB 3BEGB 5DETA 2MKKA 2F40A 4A8KA 1U0SA 2DGWA 2CUYA 1AA1B 1TKXB 2X1FA 1OIAA 3KYLA 4DV2F 2CWKA 3M8WA 2KKHA 1NPRA 3NS6A 3TUIC 1RT6A 1Q7YT 4Q7AA 1X60A 2OMOA 2CQ3A 3SQGB 4DJBA 3IS9A 4MKVA 4NLRA 1EQ0A 4K4YA 3ZZZA 1M1HA 2V2QA 4O44A 3MD1A 3GIMA 1CQMA 2FD2A 2W24A 4NYPA 1KP6A 1SVDA 2I1RA 3MM8B 4HHUA 2A3JA 4HDHA 3KLHA 2LDIA 4B9UA 4K50A 2D3OR 1P9QC 1G4CA 4X4TA 1UPMB 4NLQA 5B0EA 5LM7E 1WNEA 1XBWA 1BWVA 2BKOA 2PA8D 2HQ3A 2V2ZA 3UVJB 2DNMA 4ID8A 1UMJA 2L3MA 2IBOA 5KFOA 3BO2A 2EC2A 3GIJA 4B17A 4DL2A 3N0VA 4KPYA 1DFDA 1CJUB 1RT2B 1W7WA 5G0RA 3BSOA 1RT7B 4ZPAA 1VDHA 2BE7D 3QGIA 3BH6B 1FCAA 1JLCA 5B0BA 2BE9B 4Q8FA 1WG4A 2E9ZA 1CBKA 1X0PA 3DOLA 4NA1A 3BPDA 2RDDA 2CZ9A 1FX2A 3LAKA 5C2GA 3NNAA 1D09B 3DOKA 3DYAA 1XMQF 4G3IA 3CCVS 5HMZA 4USTA 1RAIB 1XR7A 3TNVA 1Q5VA 5KFPA 1NDCA 2XC9A 2ZHAA 2OPSA 3EWGA 2BM1A 2AMCB 3OL9A 5DM6Q 5KG7A 4H4KC 2U2FA 3ETMA 2YWGA 4K5SA 5EHHA 3RRGA 5AJ3F 3KHGA 2XMKA 4I56A 1WSRA 2GVZB 3DU6A 5HO4A 1BQNA 3RRHA 3RB0A 1TFYA 3K5NA 1Q4RA 4UW2A 2UVVA 1REVA 3HHLB 2AYMA 4DV0J 2XY5A 3NGDA 1UA0A 1NK7A 1SQFA 1XR5A 2GIRA 2EFNA 3JSMA 3P4UB 1NJXA 2ZBIA 5CYQA 3T5KA 2EBGA 2BQUA 2MDAA 4FZVA 2CQIA 1UP1A 3HM9A 3H4DA 3GIIA 1RAAB 1S1UA 4P74A 3POTB 2AZ1A 2V2KA 4TU9A 4JI8J 1N48A 1RB0A 3GR1A 3I96A 4DQRA 3N28A 4PXDA 1UFKA 1TZ0A 2D9PA 4U67Q 1KFSA 5A8RA 4K8RA 3KJNB 1T9YA 3RTVA 4A8QA 1PYSB 3CCRS 3UDVA 1Y9OA 7AT1B 3OR2B 3POTA 2FJXA 3OPKA 2R7UA 3WZ0A 4LT6A 5HMXA 2UVUA 2XQCA 1YK9A 3RAMA 4L74A 3WDOA 5KFFA 3KHHA 1QSYA 2F8EX 3C19A 2J0WA 3LUYA 1T11A 3DRSA 4RW6B 4FPRA 2WTFA 2W1BA 1RWOB 3N4WA 1T9UA 1MROB 1TUWA 2IJRA 4KPCA 3UN2A 4CLLA 1Y0HA 4KY3A 3QNWB 2OSQA 2UXBF 1FTCA 1GTHA 2EFGA 2FVQA 4R5PA 4DFJA 5E33A 3NXZA 4NX9A 3WQPA 2IMWP 3D66A 2OH2A 3PRVA 2BJDA 2ZFHA 3MR5A 3PW0A 4JI7J 4H4OB 4CLFA 2QTWA 1DJ0A 2W2NP 2E1PA 1L3SA 2F9DA 3DCAA 1Y3KA 3JTNA 2GVDB 5T7LA 2HFVA 1KLNA 1OMSA 3C14B 3AA9A 3M8YA 4OZ5A 3CCSS 3M30A 3RJMB 1R8PA 4O3SA 2GGPB 2LXUA 3FFIB 3OR1B 1LFWA 2GA7A 2AJ1A 4PUOA 1H7WA 1Q7LB 4DDFA 3B54A 2DHHA 1TL5A 1WJ9A 2VC0A 1UW9A 5D4OA 4YS2A 1Z2ZA 3J7YI 5E7OB 5IT0A 2KH9A 2R9LA 2AGOA 2JZ5A 3D3BJ 2IA0A 3GJQB 1HQ2A 1IWGA 4NLTA 4NZ0A 5AT1B 4Q5VA 4LR9A 2HMIA 2LEAA 1RT5B 4Q43A 4I7FA 3DI6A 3HHNB 3CJ8A 2AGPA 1LW0B 2DIVA 2XYPB 1EAYC 4ECRA 4KH0B 2PI4A 2C3PA 1ZM2A 3FDSA 1PSDA 2FGOA 2OGUA 3RAQA 1RSCA 1SKWA 1AXQA 2R7OA 1ZA2B 2VV5A 2QT7A 5G4DA 5KT6A 5BJRA 4ANDA 1SBRA 4JI3J 3R1HA 3C3LA 3MCOA 4NCBA 2QL7B 3DRRB 2AEMA 4BLGA 3FUYA 2BABA 4PR6A 1VRUA 1WTFA 2CG8A 2CYYA 3BGFA 1HBMA 1MW7A 2RH3A 3D28A 4L72B 2RILA 2X51A 4LIWA 1ITPA 4YY3F 2GMHA 2YQ1A 1KLMA 2LVWA 2XCAA 1AT1B 2RF2A 4WYWA 2BE2A 2WRMA 3KLIB 1FFWB 3UCGA 4QR2A 1WC0A 4F04B 3GSDA 3TX8A 2DR8A 4MH8A 3S6EA 4ZCIA 2B6AA 3O5TB 1RTIB 1SKSA 2HQGA 5KG1A 4LBHA 1WWHA 3TJAA 4DPUA 5A8KA 4ED8A 2A6OA 1C4CA 2Q1LA 4HTIA 4HL9A 1U2FA 2VBZA 1KOHA 4WFZA 5J1NA 2PMZD 4C11A 4NRUA 3UFCX 1RHRB 4D3HA 4KGVB 1IKVB 4NI2B 5IOLA 1NRKA 3SSQA 1EQMA 1N5QA 1Z2LA 3CEDA 3MM8A 4PXCA 4PXBA 4ZVSB 2JLFA 1GMWA 2YNFA 3B4DA 3FQLA 4ID5A 4P75A 3W2VA 2VJVA 3VAMA 4DR6F 3D0GE 4WK1A 5D4PA 3QWPA 4F4YA 4EEYA 4QU7A 1OPZA 1ZAXA 2IA6A 1FK9A 3W66A 2ZBQA 3GMGA 4LBPA 4QW9A 3OJSA 1F5CA 3KWMA 1HWIA 1QAIA 1M0SA 2MJNA 5LXYA 4ZLNA 2R2RA 3D6MB 2MZQA 3TOQA 3BO3A 2OKQA 1T9VA 3EX7B 4OX7A 3QJPA 1V3RA 4FF1A 4EZ9A 5KFNA 2ACMA 4ECYA 5AXLA 2K7KA 3UDLA 2CJQA 4GKJF 1T94A 4QOTA 1KVIA 1NPPA 5IM0A 1ZPWX 3BDEA 4IO9Q 3FK4A 2HQDA 4I2QB 4Q45A 2J6SA 3A13A 4GVLA 4KV8B 4RW9B 1HW9A 4RNFA 3QIPA 1JQGA 4M5LA 2H5EA 3N6MA 2UP1A 3P45B 1X31C 5KG3A 3TX0A 4K4UA 1RT6B 1ZAVA 4UZCA 1WF0A 2DEIA 1U1PA 1R8AA 2E5HA 1BMQB 1MNEA 2CPXA 3V2UC 4WZQA 4QIFA 2DGUA 2JOQA 1H0HB 4CLWA 4X66J 4I2PB 5D0GA 1FXLA 3KJFB 4QPXA 2QA4G 2HLUA 2DK2A 4JI5F 3CJ5A 3BBCA 2YKAA 2D41A 1FEHA 2DNYA 3H5YA 2HK3A 4ECXA 5GMEA 1FNMA 2AJ4A 5ETTA 3FGVA 2EPIA 4O3PA 4ANCA 3DN9A 3MAHA 5K9FA 2RHSB 3RAXA 4AUKA 4M5JA 1ZA1B 1IKXA 1HNWJ 1BXNA 1FD2A 5H9FJ 1IKWA 2JRSA 2WB1D 2Z0GA 3BYPA 2MKJA 1HW8A 1NMEB 2FDNA 2Z8QA 5ETOA 2FLNA 3GFHA 4LR8A 4Q0BA 2BOAA 4FP9A 3NBPB 4C4WA 5LSRA 1KQSR 1VGYA 3T1YJ 2Z56B 1R43A 1LWEB 1WF1A 3K17A 1UFWA 1TUGB 1R0AA 1N36F 4ZVTB 1FRKA 1YDLA 3R5GA 3R5AA 5KFLA 2HHHJ 2DCLA 2ZE2B 3GFZA 1QM9A 1H3DA 1ZM3A 2DXFA 4OYZA 4USJC 2ZOGA 1GT8A 1TUVA 4ICLA 1HPZA 2CADA 4OI3A 1R3NA 3DHWC 4MJKA 4YMEA 2XGQA 1MWYA 1QAXA 1J5OB 4LVOP 2VKZG 4CTAA 1RHUB 1TKZA 3LH2S 4HHHA 4C0OC 1PGZA 4FF4A 4HT7A 4OHYA 1CJVA 2N3OA 5HVGA 5LMUJ 4DL6A 1T05A 3FBFA 3P6YC 5HROA 2HHQA 3DMJA 2VQEJ 1SUQB 3QSYB 3R2DJ 3IM8A 2ZH8A 2I9SA 2EKYA 2FJBB 4P10A 4QWDA 4M95A 3ZFVA 4ZPTR 2ZNZA 3HSJA 1FO1A 5I42A 3TO8A 5CD4A 4CLZA 2HAFA 3EXCX 3JQJA 2UV8G 3NGSA 4YHHF 3OSNA 1LWCA 1QTNB 1XWLA 2RIJA 2X7IA 3VR1A 3W61A 1D1UA 4DSIA 4IDKB 2E9RX 3L7UA 5THWA 4IFVA 3EUNA 3M2VA 4ZP9A 4ECQA 4YB5A 4LFCF 1JKHA 3L95X 5HBMA 4DR3F 2NCKL 3K5MA 2E7VA 1YRUA 2PC6A 5CXTA 4LF9J 3U27A 1VBXA 1N5SA 4DV4J 4RUHA 3CULA 4DL0C 4YB6A 2EK6A 3UQSA 4LSZB 4DUYJ 5A0YB 1NNDA 2L9NA 2B4OA 2RNEA 4OJ1A 4NXMF 4DV3J 2OPPA 3KUHA 3PYEA 3LGMA 5KFGA 1WC4A 2G2ZA 3M6VA 1VK8A 1Y5NB 1NJWA 1GXLA 3ILOA 3NP5A 2IM2A 2PGCA 5J1EB 3L3CA 2CQHA 5J2QB 2GAGC 2RRAA 1FESA 3CJKA 2W9AA 1G1XA 2KHCA 1NHUA 3PXGa 4EFAC 3PZPA 2N4DA 3GV7B 1NK5A 2BW2A 4MFBA 2ZNYA 1H38A 1PC4A 4DV1F 2DRDA 1UJ5A 4GKKJ 4IOBA 2OPPB 2XNQA 2Y9HA 1RHQB 1RQ0A 3AQOA 2DNPA 3UR0A 3Q8PB 1WI8A 4PEOA 1S5ZA 1KTQA 2H51B 1SQEA 2OSRA 1Z4UA 5DGAA 1NJIT 3GJSB 2ZBCA 2OJ3A 3S8SA 1VR6A 1L3UA 5BYSA 3B82A 2BOPA 1JLBB 1O5JA 4PQAA 4DUYF 1K9MT 5A6PA 2KO1A 4LRAA 1JJHA 3ZTRA 4H4KA 3M05A 3GONA 2J7WA 2QFIA 2PN6A 3AQPA 3H2LA 4R0JA 4NXNJ 1AZSA 1I5OB 1M5HA 3JQKA 2ZH3A 4J9KA 1JLFB 4KO0B 3E2EA 1UETA 3SDEA 4NPOA 2J6TA 2Q66A 4X4RA 2MQNA 3K5PA 4WU2A 1RI7A 2R8IA 2QGFB 2WONB 3GIRA 2PFFB 1U6ZA 2J9DE 2KT3A 5HQLA 2VICA 4ZDNA 3UN5A 5AE2A 5DJBA 1ZOTA 2HW3A 2DPJA 3DMJB 2DNHA 2AX0A 1K1SA 4C0HA 2RKIA 4M1KA 2GX8A 1U7LA 4IKAA 3MMAB 1SXLA 4R8UB 1Q5YA 2DT9A 1JXLA 4V19X 2NXJA 5C5JA 3OTCA 1NKBA 2KXFA 5CYMA 2B43A 2HNZB 4X62F 2UXDJ 2Z58B 5HATA 3DGPB 3MM6A 1RDRA 1IKYB 2YPYA 2BQ3A 3PEJA 2ZVSA 4LF4J 3HSDA 2D3ZA 3TAQA 2KZZA 1U1OA 2FHMA 4JI0J 1APSA 4RO0A 3I56S 4JI1J 2MLYA 1TKTB 2YNGB 4P9SA 2QV6A 2MKCA 3JYTA 1EARA 4QIEA 3RBDA 1VQKS 2VODA 2DR5A 3NAHA 2R8KA 4A46A 4NLPA 4F0HA 2LMIA 3BKUA 4CLYA 1JKHB 2IY5B 2BJ3A 1TMJA 2YKNA 1DTQA 1QVFR 1ZH5A 1TL7A 2HRYA 1SJRA 2ZITA 3HHLD 3QFWA 2ZH7A 2HNZA 4GC7A 4IQXA 1A9NB 3JXOA 4NLWA 1KHVA 1U2CA 1PAEX 2WVFA 3KLVA 3M4XA 2A2CA 2ROGA 1I3OB 2R42A 3Q2SC 3ETOA 4MKAA 2CQ4A 2IVFB 4DG1B 2M3DA 2WVCA 2XYGB 1GH8A 4DSKA 4Y6IA 3W7BA 3ISND 2O3DA 2HS3A 4PG5A 3R6LB 4ZHRA 3MR6A 3O44A 4ED4A 3ELHA 3TVYA 5T14A 3PO5A 2DGSA 4CTAB 3DXSX 1J5OA 3TR5A 3H59A 4BCAA 4I64A 4K4SA 3NGRA 5JXSA 2CJ9A 3T6JA 2W4PA 4YOEA 4WFYA 3DLLQ 3DXBA 1JLAA 2WSCC 3GTYX 2AP6A 3R5BA 4NWBA 2R2SA 1RT3B 1SH2A 4LREA 1NCLA 3DLKB 4DF4A 1N6QA 1TL4A 3R7SB 4RUAA 1UEUA 5HK4A 2MXYA 1AW0A 2OFGX 3PKMA 3M8QB 4B9VA 4B3OA 2M7SA 2CG4A 3C15B 2XCPA 1VC6A 2BJ1A 3H90A 2Y1RI 3JS9A 4R0EA 2JL9A 1H7XA 1URRA 2RD5C 1HA1A 1KOOA 1OWXA 1RWPB 2E5IA 3I5BA 2F5GA 1CC8A 3ET6B 1YIJS 3SFUA 3T9NA 4EBEA 3IGNA 2Q3PA 2FJWA 2C3OA 3QJLA 3PRBA 3UD5A 3PKYA 1YZ7A 2EXUA 4NEYA 1V5VA 1W25A 3NCQA 5F8IA 4K4TA 3GJTB 1N34F 1UJ6A 1DLOA 4RW8A 3DDKA 1F1BB 4CO5A 3ZZRA 2ZOMA 3GU0A 1T3OA 1IM6A 4X4OA 2ASJA 1UVNA 1Q8LA 1LXJA 1N33F 4HH0A 2VH7A 3J81U 3RR7A 2UUCJ 1R8HA 4JV5J 4NOHA 1CLFA 4DF8A 1S0MA 1ZZFA 2DISA 1F9FA 4ED1A 2BA9A 4HEA9 1VRTA 1NJYA 2UXCJ 4LFBF 5J2MA 4ZJOA 1BD6A 3SMZA 2COLA 1NK8A 3LP0A 4IFYB 4YDXA 5ETSA 5JUMA 1QDUB 3J81j 2MB0B 2NR0A 3EDQB 5I42B 3T5LA 4QPTA 2NS1B 1OY6A 2NXNA 2RF2B 1WC3A 1XNRJ 5DQGA 1K8AT 3FSYA 2B9EA 3E01A 3EVMA 4G1QB 1FJGF 1S4EA 5KT2A 1C0UB 3KK2B 1FX4A 3N5FA 3PJXA 4NLVA 2K3IA 1FKOA 2G2OA 3GFXA 4ZVUB 3VQSA 2OTLS 2AEJA 4DR6J 2HVIA 2J8SA 2HBRB 4Y3CA 1FJEB 4NLGA 1YWXA 1HNXF 3PYFA 4A8XA 5GAHI 1LWXA 5DZ6A 4JI4J 2PD1A 3TANA 2RUGA 1S1WB 2ZE2A 3D1HA 3HKWA 4ZCMA 4UT4A 1RYSA 2VPZB 4DMZA 2KFZA 1RWWB 3AXMA 2JEFA 5F41A 2HHWA 2ZJRQ 3PYGA 3G8SA 4C8OA 5KFJA 3H4BA 2YWEA 3CWJA 4LRBA 3J7YU 3V6KA 3LA0A 1YTYA 3A3PB 4CH7A 5D3GB 1F3VA 4YUDA 2XS2A 2OLWA 5U47A 1EKRA 3HXMA 4F2SA 4Y28C 3VWSA 3V6DB 1VQ6S 1VHFA 1XK8A 5IV4A 2ALZA 2CQGA 3RB6A 4USWA 1YKWA 1VLOA 4O3QA 1DY3A 1A7GE 2MKSA 2VFSA 4NA3A 1RTIA 2F1FA 1U8SA 1KVKA 4DV6F 2DD8S 1HD1A 2QLBB 5AXMA 4O4RA 2KM8B 2FJDB 2PIIA 2POKA 1TL1B 4OI4A 1N5YA 4L3NA 1RA6A 3EDRB 2MQQA 3VAKA 4ZOSA 1XMQJ 2QMUB 4I1TA 4KR0B 1WTBA 4C8MA 1NK6A 1TELA 4BC9A 2L9DA 1PYOB 2XMMA 1S99A 3IP0A 3J81Y 3MURP 1ZETA 4TYBA 2VG7A 1YSJA 2XMTA 3CCUS 3LF0A 1U8WA 4UQTA 3SXLA 4UZBA 4HACB 5GVQA 1FD8A 3M7VA 4C11B 3J80Y 5K8MA 4ECZA 3MTKA 1VJQA 1EKSA 1RU1A 3CSKA 4BHQA 5KFDA 1F3FA 1GX6A 1WKLA 4URGA 3OVSA 2GHVC 4ES2A 2GW8A 1D9FA 4OJHA 2GS8A 4OYPA 1VIXA 2MZSA 4PZVA 1XMOF 3QMQA 1RCOB 4U9RA 4B9SA 3TZZA 1TMMA 3O3LA
chains in the Genus database with same CATH topology
1V6HA 2J5AA 4AL6A 2B9YA 4NZ6A 2M8DB 4HT5A 1F5AA 1H2UX 1S6PB 1NEEA 4OZNA 5HL7Q 3MECA 2BQRA 1FVSA 4PUOB 2JX2A 3DRRA 4LF6F 1WELA 3SCJE 4F4ZA 4QR1A 2VA3A 4HKQA 3UDCA 3MEDB 5BR8F 5E3CA 3D54A 3IAM9 4YB7A 4B9LA 3PNIA 4TYAA 4OHZA 3MM5A 5AXNA 1HQEA 4EO6A 3A1YG 4JI7F 3T5JA 2PEHA 1S1VA 3CC4S 2DHGA 3EGWB 3FZBA 1OSCA 1ELOA 1T3NA 4QCLA 3UW1A 5F9LA 2YX7A 2NXUA 4QZVB 2XI2A 1MROA 4M8LA 4FNIA 4N8OA 4EU0A 4ES3A 4N56A 3OTBA 4K5RA 5IXUA 1X5TA 2BBEA 3CIZA 1X9SA 2HYIB 3MXHP 3HI9A 1UEVA 1S6QB 2EG1A 2OP5A 2OPSB 3CGIA 4RW6A 4F3QA 1S0VA 4AXJA 3OBIA 4NLOA 2R7XA 2VFUA 1OQ6A 4G1PA 4C98A 2V5HG 5F0UA 1KNZA 2NQPA 2FIUA 4ED5A 1UAWA 1IN0A 2MGZB 2IAJA 4TQRA 5DG7A 2R7VA 2A2DA 2A1BA 1AFIA 1RT7A 1S6QA 2ZZNA 3E51A 1BLUA 2ZH2A 1EETB 3MOJB 4EO8A 3ENQA 5IT9Y 1YQHA 2RS8A 1DQAA 3THVA 4WFXA 2XMVA 2L48A 4O3OA 1JNRB 2DTJA 4CO3A 5H1SV 2CPIA 2JJ4D 3HVWA 4ZMMA 2C2RA 4JOUA 1JK9B 1ZM4A 2M4MA 5CYQB 3ZZUA 3TAMA 2R2UA 3OVBA 4FVMA 2NZ4A 3MPVA 1N52B 1WI6A 3OR2A 3G8TA 4OLPA 2IBKA 1HFEL 3PFOA 1LK5A 4KAIA 2YQ3A 3LPYA 4I68A 2N4CA 2ILZA 1I94F 4LIRA 4EYIB 4CO2A 2FLPA 2MGZA 1KQKA 2DH7A 4HVZA 3PW4A 1KR4A 2WK4A 4DR7F 5IS2A 5B09A 4JI8F 4YR0A 2VKRA 1MMDA 1M5VC 4QWCA 2BV3A 3DLJA 1N0UA 3Q8QB 2YKPA 4NRTA 1NAQA 3UCZP 4LMZA 2V4RA 3PEHA 5BYQA 1DBDA 3PX6A 1VRTB 3OL6A 2ATLA 4CH1A 3JSYA 4F2RA 3M6XA 4BDPA 3W3SA 3DLGB 4MK8A 2VG7B 3BJYA 2MZ1A 2HNDA 1L5UA 3OLBA 2B7BB 4RW8B 2CPJA 3JTOA 2DHXA 1UWBB 2YWKA 3R5DA 4ED2A 1YJWS 2KFYA 3CJ0A 2OAUA 1U48A 2M52A 4WE1B 2SXLA 1T8EA 3OW2R 1TKXA 2FLOA 4DFMA 4CZCA 1GAOA 2QMWA 3CCQS 1FKOB 2F9JA 3PR5B 3VALA 3VAGA 2ASDA 5EDWA 1I6JA 1RP5A 1Y5IB 3D1QA 3KMQA 1S48A 2DH8A 3K0JA 4PG6A 3C6TB 2ZKTA 3OXGA 4C7QA 4ZS6A 2NYIA 5KTQA 3M8RA 2R7QA 1QAYA 1TVRB 1U4BA 4IG3A 3HK2A 1ROFA 1H2VZ 2MSSA 3Q0AA 3PW5A 1JLAB 3FEYB 4QWAA 2LYVA 3NCRA 5KFCA 2W7PA 3IWLA 3CPWR 2E1CA 4KHMA 4JI2F 4DL3A 1QAJA 2J7UA 1D3WA 2KT2A 1E6VA 4KC5A 1NK0A 4YR3A 4ECUA 2CDQA 1IR0A 3X3UA 3K57A 3I4PA 3C8YA 2M8HA 3G96A 2VOPA 3PACA 2DO4A 2QE5A 3B8HA 2VQFF 2QA4S 4FBUA 1TL1A 4Y65A 1N5YB 2CPZA 2NPFA 3QGPA 1YBAA 4IFYA 4DSFA 4ILMA 4A8OA 4C8KA 1HBOB 3VCDA 4YFUA 5J2MB 3ISZA 4Y2IA 2R8HA 1D9DA 4L6V3 3IR6B 2JHEA 2AJ0A 2WOMB 3MHYA 4KKOA 3PIOQ 4DX8H 2H9ZA 4DOZA 2U1AA 5IWAF 1PC5A 3ICLA 4OZ1A 2FC8A 2JWNA 4ZPCA 3MMJA 1V3SA 2DPIA 1Q79A 3F44A 1N6QB 1N54B 1P1TA 4M63A 2MJUA 5EWEA 3RW6A 5J1PA 2DNRA 4YP3A 1VQ5S 1NJZA 3CCWA 4X2BA 4JI3F 2BACA 5D8HB 4NLSA 2FUG9 3DLEA 4QW8A 2CZ4A 2ROEA 2FHJD 3MMAA 2EC0A 1A6LA 3MM7B 4Y00A 5LT5A 1U24A 1KC8T 4OI1A 1YJVA 1O51A 1HI8A 4G1QA 3OFGA 1FTRA 2VD3A 4IQMA 5KAKA 2HS4A 2EW9A 3GIKA 2DR9A 3OJUA 2QLWA 3CDWA 4PWDB 2KXHA 3R3TA 2PSZA 2V8DA 2LQBA 2VZ9A 4CCHA 1YG0A 1KEKA 3G4SS 4ED7A 1U1NA 2MKHA 3G71S 3AB4B 3KJVA 1VI7A 4OLOA 4X4PA 1WHWA 2KVIA 3DRXA 2CIMA 1TL3A 3NMRA 2G9OA 3IC1A 3M1VB 1ZZNA 5D6GA 1LWFB 4F3MA 2XB2D 1G3OA 5GADU 4QWBA 1Q53A 3MEGB 4WXOA 3AA8A 2ACYA 3RW7A 3US5A 4TNOA 2EK1A 1QLNA 1UL3A 3W2WB 4Q8EA 3R5CA 3KLGB 3KLEB 1HNVA 3V4IA 1CEZA 2JFKA 2HS0A 3I31A 2UUWA 4C8YA 3GZ7A 3K7RA 4J9RA 5L1LA 4WFAQ 2XWYA 1SV5B 5F3ZA 1FE0A 4IRDA 5L1JA 4K59A 4DV5F 4Y2CA 3SYZA 1LW2A 2DRAA 4K2XA 3SEOA 1C1BA 1C2PA 4F26A 3O1LA 4O4GB 1FNOA 3CO9A 1RA7A 5EX3A 1YVFA 2YH0A 2K2PA 2PDAA 3OV7A 1UKUA 2RE1A 1DURA 1SJ3P 3K2YA 2L41A 3MR3A 1FDBA 1W2BR 1XMBA 2PMHA 3L7PA 4DV0F 4EWTA 1VBZA 4F8RA 2N3LA 5LSOA 1G7CB 3W2WA 4LSLB 5DO2A 4DV7F 3N9UC 4CIOA 2HNYA 3O2IA 1YJNS 2HWIA 4F4KA 1HWJA 2J8AA 1P1LA 1SH3A 3C66A 3IWXA 1WEXA 4JI0F 1F2GA 4X66F 1FA0A 2APOA 2B9XA 4KIAA 1Y00A 3O6QA 2UUAF 1JLBA 2J7KA 3M2UA 2RKIB 3CVKA 3NCPA 4LF4F 3HLUA 5LSLA 1OQ3A 5KG4A 4WFBQ 5F8GA 4F50A 3M9MB 2GJIA 2HFOA 1T7PA 3CJ3A 3UR3C 4N76A 3EZUA 5FD1A 4PRFA 3SCIE 1SUQA 1VIOA 2FPHX 1ZTWA 1JJ4A 1P8GA 4FXDA 3QAUA 5GAEU 3WC2A 4ELUA 1YITS 4BC7A 4MIBA 3CJKB 4KO0A 5IFMA 1T02A 1ZYQA 4J37A 2N82B 5L39A 1HQUA 5KG0A 4WKRA 3ONQA 4DN0A 4ICLB 4NYZA 1SL2A 4DSJA 2LQ5A 4JBCA 4P6QA 4B3TF 2W9CB 5L1KA 2CQPA 3HVTA 1LOUA 1J2VA 3UD4P 2QZ8A 4HTJA 2XBPA 2AX1A 2W9CA 3CCMS 1NU4A 3QGHA 2W9BB 3MEGA 2EG2A 3I5CA 1X7VA 4PQUB 4A8FA 2MYFA 3DM2A 5K8OA 3S7RA 3OLAA 1JWWA 1TL3B 2B3TB 4OIXA 1Q86T 2VQEF 2LCWA 2IMOA 2DGXA 3LANA 3HX9A 2DBBA 2NUHA 3Q8SB 2R8GA 5KFQA 2F4VF 4NLXA 4C8ZA 2PA3A 2DB1A 2ZDPA 1SJQA 5LMUF 3JTPA 2YKMB 2RS2A 4GMKA 3CC7S 2XS5A 3KLEA 4AYBD 4KHRA 4A47A 5JVGQ 3MUTP 3TQ1A 1ZPVA 3U1MA 3CT9A 4R25A 5KG5A 1HPZB 3MCSA 4USHA 4HHJA 1RKJA 1IBKF 5L1IA 4PPZA 2ZH4A 3CMAS 1HHTP 2Q79A 4X4VA 3QIPB 2JSXA 5KT7A 3PVXA 4J5OA 2IM3A 1JNZB 3KJVB 4C8LA 4C2MA 4K4WA 3QJJA 4IO1A 2GJ2A 4UY85 1U6FA 3HVAA 3NBPA 3ISNC 1RT4A 3D1OA 2WBMA 3P96A 1M5OC 3BDPA 4DBQA 1S10A 2BDPA 2V4QA 2UUBF 2KB2A 5HP1A 2ZH1A 1KSPA 5E41A 4DLGA 1DRZA 5KFMA 2ZD1A 2FVSA 3DNCA 4JV5F 4M5DB 1HBOA 3SV4A 5J1EA 1VQYA 5F8MA 1NHVA 4DWIA 3CD6S 2EBEA 1FK9B 1VJWA 2GC8A 2LQ9A 1UWBA 2B7CB 4NCGB 2M9KA 4HDGA 1X4CA 2V8HA 2C42A 2FTRA 2KT5A 4ILRA 1RTHA 4OJGA 4G6VB 4X84A 3PIPQ 1SJFA 3EPGA 3N6LA 4TY9A 4AE5A 4LJMA 4DS5A 5J2PA 2V4JB 3LP1B 4EZ6A 3OXLA 1QE1A 5HBMB 3KK3A 2MQOA 2EFPA 2FC9A 2BUNA 4IR9A 3LAMA 2DVIA 5DLGA 4IFVB 1LFPA 2FJVA 1U1RA 2IHR1 2VPWB 5D77A 5HQ8A 5A8KB 1T95A 1S9FA 3K5LA 4Q2MA 2F8MA 1WG5A 2DNOA 2R7TA 3TA0A 2BE2B 3KLIA 3LALA 1XN9A 3QWUA 1FVQA 1S9EA 1RT1B 3V6HA 5B7WA 3TARA 2BR0A 2I38A 3X1LB 2FJEB 2ILYA 5FLXY 5E3AA 1U6BA 4H4MB 2YTCA 1S1XA 2O01C 3PR4A 3UCUP 1X9WA 3BN7A 2BM0A 1YGYA 4ZP8A 2PO4A 1QUPA 5A8WB 4RUCA 3CCTA 2QSWA 3W2VB 1R0AB 3TAMB 3MMBA 2VL1A 2XEXA 4ZPVR 4CH0S 4I7FB 4J9NA 2Y1IA 1SL0A 4QQBA 4DEZA 5KG2A 1D0EA 3IAS9 2KJVA 2HGMA 3JAMY 5KFSA 2LU1A 2CZVC 5SZTA 3PW7A 1GXUA 2BVZA 7FD1A 4ED3A 2MQPA 1Q1KA 5KT3A 1JLGA 4B9NA 1VQ9S 3IBWA 1TFWA 3H2VE 2CQ0A 1RYRA 2BZ2A 2XSJB 2JH3A 1VBYA 5E2QA 1IJFB 1H98A 1RAJA 2EVZA 2BRKA 3BQ1A 4FNHA 2XY6A 3HFKA 3M8PB 2WAQD 4ID5B 4EGLA 5LMNF 4U7UK 3TYTA 4OV1A 2OPQA 2Q6BA 2QLXA 2GQCA 1QVGR 4KT0C 1PILA 1M5SA 2XMUA 5L38A 2RU9A 2FVPA 4RW4B 1D8YA 2BRLA 2VFVA 4QYRA 3CF5Q 5F8LA 1U1KA 2XGPA 1E6YB 3BGRA 2B6AB 3KG1A 4OJ3A 2WCXA 2AQ4A 1MMLA 2CJAA 3MM9B 4ETXA 1UA1A 2GMLA 1K0VA 1HBUB 2NSBA 3PO4A 2EI5A 2C3MA 3MTJA 3QIDA 2ZZMA 1N8RT 1MWZA 1RWUA 2X1AA 4LF5F 3V81A 1ZBTA 3OR1A 4AFFA 1CSJA 4CT8A 4B3MF 3LOUA 4FXWA 2XLJA 2HVHA 2VG6B 1HL6A 2IRYA 3FCHA 2CVEA 3DRPB 1X4DA 2DH9A 1FERA 2E5GA 2IRXA 3CB4A 3HHKA 4BBYA 3PFEA 3IWNC 4R5PB 3VQTA 2LEPA 2OIHA 1R27B 3ENVA 4CNYA 1WHVA 2KI2A 2VUGA 2R7SA 1S1TA 3EXYA 4AQYF 2RRNA 2QEXS 2CJKA 1CC7A 2N7CA 1S1VB 2CQDA 2UUCF 1M5PC 3Q23A 4DSEA 2D74B 4AL5A 3BS9A 3NNCA 2GHWA 3G9CA 2V94A 2IJNA 3VAIA 2AV5A 4WU3A 1Z1ZA 2GO8A 2MSTA 2JDJA 1Q82T 5T41A 2P9EA 1KHWA 3ZZPA 1XNRF 3BM7A 4NZ7A 5J2NB 4I67A 3MUMP 1FE4A 4MYTA 1HD0A 5D78A 1S1TB 3V6DA 4NYOA 2QA1A 3IR7B 3DDNA 3IA0A 5EX0A 6FD1A 2E9TA 5D3GA 1NZAA 4B3SF 3MOZA 1XNQF 1TQLA 4PWUA 4X4SA 3MPWA 3SCKE 4GKKF 1B0TA 1KTVA 3BGRB 2HMIB 4ITSA 4X4QA 3SQGA 2VG6A 2PE8A 2KM8C 1EETA 3ULHA 4ECTA 1R89A 3DU5A 5CZVA 2KG1A 4URSA 5J2NA 1Q16B 4GO7X 4EBCA 3V81B 4WIIA 1L3VA 5MAOA 4C3KA 4N77A 5LJ5Y 2ZUGA 3T1HF 1S9EB 1B0PA 3G6XA 2UV8A 3U1LA 1WHXA 1QUVA 1SI9A 1URNA 3MM9A 4U6PA 2WSEC 5E0OA 1KONA 2LA6A 4IOAQ 1XR6A 4I4BA 3DLHA 2E1MC 1DHMA 3EYZA 2NPIA 2UUTA 3MEEA 3DLBA 3B78A 2VBWA 4A48A 3GQCA 2OD4A 4LUBA 5L9NA 5DQHA 3PW2A 3KLHB 1R7IA 3DYAB 3DOKB 3M8SA 4O44B 4YB1P 3ZZYA 2YX1A 2YKQA 4JI1F 3OL7A 3J7A1 2YWHA 3MEDA 4U7CA 5F8HA 4H4MA 4ED6A 2XZWA 1FXDA 2XSJA 1DZ5A 4KRWA 4KTQA 1HNIB 3OFFA 2R7WA 3UI3A 5E3QA 1OS5A 3KG4A 2MQLA 3ZC4A 4AL7A 2QRRA 2CQCA 1Y7PA 2I5JA 3KLFB 1P6TA 2DNQA 1S6OA 3KKFA 1S6PA 2XLKA 3NWGA 3VZIA 4B3OB 3OUYA 5DLFA 1RT4B 3G8QA 1ZTTA 3VZHA 3KK1B 5B0CA 4IR1A 3OHBA 4ZKAA 1RTDB 1JLEB 3V4MA 2GQ2A 4DQPA 2KRBA 2W7AA 1U45A 3N01A 2VG5B 5F8JA 3OSPA 2P9GA 1SH0A 2ABYA 2BXJA 3TRGA 3QLHA 4MIWA 3QZ7A 4DHVA 3QAEA 3F41A 3VF0B 1VQ8S 4H54A 5DS7A 3OVAA 2IVYA 3GYXB 1R8CA 4OZ0A 2XMJA 1NK4A 5C42B 1IJEB 1FF2A 2MHNA 4Y34A 3JB9k 3M32B 3PV8A 2CQBA 1RT1A 1UVKA 5GAEI 2UVRA 3M8PA 2B0GA 4EUVA 1KD1T 2I0XA 4NCGA 4OQJA 5HMWA 2FGCA 2QSFA 4ECVA 2MY8A 1YRTA 1X0FA 2KRRA 2AJFE 2LXFA 4AXIA 4LSNA 4O3RA 2Z2LA 5DQIA 3FNNA 4ZVEA 1HYSA