3S1TA

Structure of the regulatory domain of aspartokinase (rv3709c; ak-beta) in complex with threonine from mycobacterium tuberculosis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
158
structure length
158
Chain Sequence
DPILTGVAHDRSEAKVTIVGLPDIPGYAAKVFRAVADADVNIDMVLQNVSKVEDGKTDITFTCSRDVGPAAVEKLDSLRNEIGFSQLLYDDHIGKVSLIGAGMRSHPGVTATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartokinase
publication title High-resolution X-ray structure of the regulatory domain of the mycobacterial aspartokinase in complex with threonine
rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 40
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01842 ACT ACT domain
A PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3s1tA02
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3s1tA01
3U7JA 3LOUA 3OFEA 3ENWA 1RWUA 3P96A 2CDQA 3TUIC 2RE1A 5IS2A 4LUBA 3OFGA 2F1FA 4X84A 3OBIA 2P9EA 3NRBA 3TUJC 4PWUA 2P9GA 3LUYA 3DC2A 2DTJA 1UJ6A 4M8LA 2J0XA 1LK7A 1UJ4A 1UJ5A 2DT9A 3AB2B 3ENQA 2J0WA 3W7BA 3AAWB 5JJBA 2QMWA 1ZPVA 3N0VA 2ZHOA 2H9ZA 1Y7PA 2FGCA 1LKZA 3K5PA 3CEDA 2LVWA 3O1LA 2PC6A 4GMKA 1SC6A 1YGYA 2JHEA 1U8SA 1PSDA 4GO5X 3MAHA 3DDNA 3HHEA 5IT4A 2MDAA 2PA3A 2F8MA 3MWBA 2NYIA 2LQJA 1O8BA 3KWMA 2RQMA 5IT0A 2JOQA 3S1TA 1LK5A 3MTJA 3OFHA 2I9SA 4NMLA 4GO7X 3TUZC 2QMXA 3OFFA 5T41A 3L7OA 3DHWC 1YBAA 1KS2A 4IO1A 2KO1A 3ENVA 5FIIA 1XTZA 3UW1A 2RQKA 3IBWA 1M0SA 2QSWA 3AB4B 3DHXA 2P9CA 2QRRA 3IXQA
chains in the Genus database with same CATH superfamily
4DF8A 2AGOA 1BWEA 3H5XA 4DG1A 5LSOA 3TA2A 5AJ3F 2DNZA 2P5VA 4UTGA 1D0EA 1N6QB 1YJ7A 1HPZB 1XMBA 4C0BA 4DR1J 4FS1A 4CLFA 3P8BB 5CH7B 4Q43A 2QE5A 3KLEA 3MCNA 1LWXA 2UXBF 2WSCC 4XO0A 1UEKA 4IG0B 4PR6A 2PMZD 1RWXB 3Q2TC 2HK2A 2RMLA 1QDUB 2LCWA 2Y1RI 4ZVOB 4CIOA 4OZ2A 3C16B 1PILA 4QW9A 2QIFA 5C25B 1HWLA 2YQ0A 4P74A 3FDSA 4LIRA 2ROGA 2EC2A 3QWUA 5J2MB 3OL6A 3GQCA 4DR1F 5E33A 2GS8A 4NLGA 3FCHA 3IO1A 4RNFA 2GJFA 2J7WA 3R1HA 3IR7B 1Q81T 5B0DA 3ENVA 4WPAA 2OEMA 2V68A 4DZDA 3IWLA 3N5BA 1P8GA 1C0UA 4Z37A 3GCWP 3MCSA 2XLJA 2JEIA 3CD6S 2P2CB 1EIYB 2DPIA 3P6YC 2HGNA 2J7UA 3TUJC 2B0GA 3N28A 4H4MA 2FVRA 3AD7C 2G9OA 2FZCB 3M2RB 2J9DE 4X4UA 4DX5A 3RUBL 3DGPA 1TMJA 5EHHA 4QR0A 1Q8BA 5KFYA 4JOUA 4DFMA 2GMHA 1S99A 3RBDA 1NK4A 4DL5A 1YGYA 3NS5A 5IM0B 3MAHA 4N47A 3HHDA 1TK5A 3ZTOA 2CJQA 5E7OB 4Q0BA 1M90T 3TI0A 2B8PA 1WOOA 3BN4A 1LK5A 2LFVA 4KBIA 4ECWA 2GV1A 2O66A 3EVOA 3EZUA 2VBZA 5C7PA 3OUYB 2G4BA 3UQSA 2HWIA 3GZ7A 4CYUB 2E44A 2IVMA 3OPKA 2WW4A 1FERA 4I64A 3S6EA 2P9GA 5I3PA 1B64A 4QPXA 2IRUA 4Q7AA 3I0SB 4I4BA 1X4AA 4M8LA 3OXFA 3HFZB 1RT1A 3G86A 2ZVSA 1TV6A 2L3MA 4USKA 1WHVA 3GFZA 2HG4A 1Q5VA 1RWPB 4LQ9A 1S1UB 2XULA 3ZZPA 4UZBA 3WC2A 1NZAA 3D68A 1EKSA 5D0HA 2VBWA 2CJBA 3IC1A 2JH3A 1E6YB 1AT1B 3T1YJ 1VC6A 2CG4A 2QA4G 2K7JA 3PYGA 5L1LA 3JAMU 3MM7B 4G1QA 3PRVA 4ZP9A 4UQTA 2VC1A 3OTEA 2DR8A 1VS3A 1P9YA 1ZS6A 2OKQA 1TAQA 1RWUA 1BQNA 2E7XA 1Y5LB 4C4WA 3Q8VA 1AYEA 1K73T 2Z2LA 5IS2A 1AFJA 1X4BA 4MAKA 3BSOA 2H3EB 2KU7A 2R7OA 1TL5A 2GNKA 3NGTA 3Q0AA 5EX0A 3OR1A 3T1YF 2EFNA 3BSNA 1FRKA 1FEHA 4OZ1A 3GFYA 2UV8G 2ZHOA 4IQXA 1UVKA 1ZA1B 4UOFA 5H9EK 2W4CA 5KFNA 3FBCA 1H38A 4QWBA 1CJUA 1QUVA 5M2RA 1F60B 4AL5A 1WKKA 2PC6A 3PIPQ 2IRYA 4AL6A 4ICLB 4C3LA 3VF0B 2OP5A 4FBUA 2RRBA 3H25A 3K7RA 2O01C 5IFMA 2DNHA 4DUTA 4C9DA 5KFHA 4IOBA 4BC7A 3KJVB 3H20A 1YLXA 3SSSA 1R7IA 4LBIA 3AOAA 4PWDB 2QSWA 5KFJA 4ZJOA 1VK8A 4QYZK 3MECA 3CULA 1LW2A 1AZSA 3T1HJ 1UW9A 2YNFA 4XPCA 5KFPA 1HI1A 5DDOC 1M1HA 4RR5A 1FF2A 4NLXA 1XNRJ 1HLWA 4CWBA 1X9SA 3EVMA 1RAJA 3LUYA 1VQPS 3AT1B 1JWWA 3DKDA 1SL2A 3BKTA 5GAHI 3BGOP 4WKRA 4ALZA 1IKWB 3PEJA 1I51B 2YKNB 5KFVA 1Q5YA 1U1NA 1YKWA 3LWLA 1G3OA 2NS1B 3CD5A 2KHDA 2CPJA 2MY8A 3DLHA 3CC4S 3G9CA 3CJ0A 2ACYA 1XNRF 1VCTA 2ATLA 2FJBB 1UFLA 1UP1A 3Q89A 3BB5A 1R43A 1MMNA 2ZUGA 3H5UA 2ZWOA 1YX2A 3NGRA 3Q22A 4KC5A 4CZCA 3U1NA 2CQDA 2KN4A 2CQIA 2LEBA 1QLNA 3EDRB 3A12A 3V6DA 4RNMA 2Z58B 2W8KA 2QYGA 2K7KA 3QFHA 2W9AA 3W61A 5J2QB 2ASDA 1PYTA 1U4BA 1YJUA 1BMQB 4ZPWR 3R5AA 2W2PP 1WUUA 3ZZRA 4F50A 1IN0A 4F4ZA 2FQQB 4JI8J 4P75A 3EXYA 4DPOA 4EI2A 5IC6B 5HBMB 1G6BA 2X3DA 4TLRA 4EBEA 4EFAC 5KT5A 5CAAA 2I5JB 1RWNB 3VAIA 3Q8PB 3RG6A 1TVRA 1FKOA 1CS4B 2V4JB 1CJTB 3U1MA 5GADU 4URSA 3M8SA 3TZXA 2IDLA 4K2JA 3KK1B 2FZGB 3QT6A 2AX0A 4J9NA 1J5OA 3AODA 2MHEA 1RTIA 2Z4PA 5G4DA 2KFNA 2C2MB 4JI8F 2HVIA 1QE1B 2CYYA 2C2KB 1A9NB 2WVDA 2YNIB 2G13A 1S4FA 1NZ8A 5D78A 1X4EA 1CJVA 2BR0A 1R89A 2C3YA 3NY0A 2B51A 2XNRA 4BHQA 2BQRA 1NDLA 4PXCA 3KNAA 2MKJA 3CC2S 1ZPVA 2CWKA 2HHUA 4FPIA 4X4OA 3NOCA 4YHHJ 1UVNA 3DDKA 2IM2A 2BMBA 1REVB 1NU4A 1RA7A 1EETB 1OY8A 2M52A 1S12A 4DG1B 1G4CA 3MM8B 5JVHQ 2FVSA 2Q79A 5ETPA 2V9KA 4GKKJ 3QSYB 2N3OA 3VAMA 2Z30B 4OHXA 1RTHB 5EUHA 2JC0A 4BC9A 1PKUA 2DNRA 3M8QB 3PHTA 4A46A 3KLEB 3SCLE 1S0NA 2WOMA 5L9NA 3NNCA 4NPOA 2DGXA 2ZM6J 4RJVA 5G0RB 2DIUA 1WF1A 4YHHF 1K0TA 3JTOA 1VQ8S 2HVDA 2OPSA 3HHLC 3LAKA 3AFGA 4OLOA 1PGZA 1KTVA 1U26A 2PFDA 1P9QC 2ALYB 4B9UA 5F8IA 5HMYA 4HH0A 1TK8A 5F8GA 2F8EX 3PHEA 3PRDA 1SJ1A 3E3XA 2A3JA 4GKKF 3HD2A 3DOLA 3O6QA 1N54B 3IFEA 3RBXA 1Y7PA 5DLGA 1T9WA 2M88A 4QR1A 4HLBA 4I56A 2HZAA 5F8MA 3MM5A 5LJ3Y 1FJCA 4NLOA 2QL9B 1S6PB 3G96A 3VCDA 3HJVA 2ZM6F 3MR2A 3P5BP 2J7KA 1WG5A 1C0UB 3H98A 3HVRA 2CZ9A 2HZCA 2DITA 5IT0A 4DPWA 2OPPA 2ZE2A 4N76A 3OVAA 3VTIA 2OEJA 4H4MB 2IBKA 5KFAA 2ZITA 3GB0A 3QAEA 2DY9A 1KLMB 1FXDA 4IO9Q 3K5LA 2QRRA 2DJWA 2NREA 3M32B 3FQKA 1GMUA 5F9NA 1M1GA 1ZYQA 4QIVA 2NPIA 4DV1J 3MR5A 3GV7B 3GMGA 5KFWA 4M94A 2D7SA 3WIVA 1B0PA 5KFKA 5KFEA 3CMES 3ELHA 1BHNA 5KFBA 3AOBA 5EGYA 2HRTA 4WFBQ 1RQ0A 3DM2B 4PG4A 3B78A 2HVEA 2E9RX 8AT1B 1RB0A 1WWHA 1H7XA 1O5JA 3BDPA 4M5DA 2ADBA 3DOMB 3N01A 3LAMA 4GVBA 3MURP 1N88A 2XM3A 4M5MA 3RR7A 3DRSA 2RHSB 3L7OA 1Z4UA 1X4FA 1R0BG 3D4JA 4DV1F 3BR8A 2OEKA 3RB4A 3M8PA 1DTQA 1TV6B 2BYCA 3DCAA 3LOUA 3MMCB 1U2RA 2NXJA 4BS2A 2DGTA 1VIOA 3T9ZA 3C6UA 1M1KT 4OYMA 2LP4A 2RS2A 2KG0A 4P7TA 2P8IA 1WF0A 1JKHA 1R0AB 5FLXY 3MM6A 4EMDA 3MR6A 4JI0J 2G1DA 2UUBJ 1OQ3A 5BYQA 4AD6A 1X5SA 1GMWA 5CCMA 4P7VA 2X1AA 3OQ2A 3MPDA 3G8SA 1JLAB 4L75A 1S1VA 2MKHA 4K5RA 1S9GB 4ANDA 5THWA 4U6PA 2DNMA 1TKDA 3TO8A 1CPZA 1RAEB 2JNJA 2J8SA 2A6MA 2VKZG 4J9OA 2W9BB 4JI0F 3B8HA 4NYPA 5DRKA 3OR1B 4KT0C 4F7VA 2UUBF 3TQEA 3CCQS 4GVLA 3A4TA 4IDKA 1ZZFA 2DGUA 1RAIB 2W7AA 1T7PA 1U6BA 2ZFHA 2M0GB 5D6GA 4EZ6A 2DKOB 3AD8C 3V4MA 3MFIA 4FDFA 4DV2J 2CQBA 5KFTA 4K4TA 3NMRA 4LBHA 3PFEA 2YQ1A 1UFKA 2POKA 1RTDB 2DNPA 2RB7A 2AJ0A 1R0CB 2LLZA 4NRTA 4I2QA 2IVFB 5DM6Q 1VR6A 3RRHA 2CIMA 1DLOA 3T6BA 3DYAA 4F0KA 4B9TA 3H2UB 2NXNA 4WE1A 3IR5B 4QOTA 3PVXA 1UWBB 3MEGB 2KB2A 3HHLD 1X0PA 3BH6B 3QZ7A 3IRXB 1U1KA 3G87A 1KONA 4CLPA 4BCAA 3JSYA 4ECVA 1AZSB 3SCIE 2I2YA 1YJ9S 1SQFA 4WFZA 2QMUB 3SQGA 3L7UA 1UTAA 5KG5A 3HVTA 4PXBA 1HWUA 2C3UA 2DBBA 3M1VB 2J6TA 1VMBA 3QJJA 5KG7A 2ZOFA 4WK3A 5CYMA 4IRDA 4Y65A 1WOPA 4Y2IA 4F4YA 3E2EA 1GQEA 3CXCR 1TTHB 4OX6A 2M70A 3FMBA 3UFCX 4MKYA 3C2PA 4NXMJ 3UDEA 5KG4A 2V34A 2C2DA 3JSRA 4J37A 5T7LA 3KLHA 1RT6A 3W64A 2KXHA 4OX8A 4ED3A 4R5PA 1DJ0A 4ZVPB 2IC3A 2C2OB 4NCBA 5LT5A 4B02A 1B99A 5HROA 4M5JA 4F2SA 1ZAWA 2AZ1A 3W65A 4P2XA 2KXNB 4D3GA 1NJYA 4LSLA 4DZ6A 2GVZA 1H98A 4ITSA 2AU0A 1BE4A 5IV3A 1MU2B 5D4OA 3GFXA 4EBCA 3OFFA 2RVJA 4NXMF 2MQ8A 3GIMA 4IYQA 5KG6A 1YBAA 2FD2A 4RKUC 4EUVA 5H1SV 4ZS6A 1D9FA 1U2FA 2N7CA 4YB1P 1J5EJ 3KMQA 3ICLA 4P6QA 1NAQA 4NYZA 4ECSA 3IGNA 4Q2MA 2R7WA 2UUTA 2YWHA 2DPJA 4YDDB 5K20B 1Q86T 1RAGB 5DDRC 2J0QD 1C2PA 3CDWA 4UY8T 3C6TA 3UPFA 2XMUA 4LVNP 1TVRB 1FKOB 2MMYA 3AB2B 3TARA 3LP0B 5D3GA 1E6VA 4RO0A 3TP2A 4DSKA 2QLXA 5DO2A 2GHPA 1N0VC 1J5EF 5JVGQ 3K0JA 4YOEA 1C4CA 3P3DA 1RTIB 2R9LA 2CQCA 4N77A 3HHEA 3I82A 4CLUA 3M6XA 2X1BA 1OY9A 3MPUB 2CNKB 2AT1B 2EG1A 4F36A 3M4XA 5LL6d 2AGQA 1N5SA 3X3UA 1RABB 1GX5A 4OI3A 1BWVA 2ZBPA 2W2OP 1IKXA 2VG6B 2DY1A 4RW4A 2MEWA 1N52B 2AYEA 3MZIA 4WZMA 2XHWA 3G6YA 2LKZA 1C1CB 3SYZA 1NPRA 1TL3B 5ADZA 3KLFA 1U2CA 1IWAA 4JV0A 2XTJP 4E0DA 4LF1A 2W7OA 3PW7A 3WX4A 3FVYA 1TL1B 1DY3A 4PQUA 2HVZA 4RBVA 3RB3A 2U2FA 1SH0A 1LEOA 4DL4A 4JI1J 9ATCB 2OHDA 3HT0A 3FSYA 2WOMB 4ZPBA 1AFIA 1S4EA 2HHVA 2HFOA 1SKSA 3OXLA 2FJAB 2MKSA 4RW7A 4C8MA 4J9MA 1VISA 4P52A 4DV4J 3OW2R 4L74A 5E3PA 3BYRA 4EGLA 2AW0A 3QO9A 2WW8A 3B4DA 1T3OA 3QT5A 4DUYJ 3IXQA 3ZZOA 1ZM4A 3FFIA 1XJWB 4JI1F 4ID5B 3V6JA 5M2UA 2N3LA 2VICA 5J1EA 3UD3P 3J7AN 1BQMA 4TYAA 3PJXA 3VVTA 1ITPA 3CD7A 3EMTA 4HKQA 3N79A 1EAYC 3MGJA 4N8OA 4MK9A 1IBLJ 2HRUA 3GR1A 1ZM2A 5FLXU 4V19X 1KDNA 2VJVA 4M63A 1BC6A 1H2VZ 4DV4F 1S1TA 2ZE2B 4OYZA 4NZ6A 1HQEA 3PX0A 1M5SA 2MGZB 1FWLA 4B08A 3ULHA 3NEKA 4LFCJ 4F04B 4KFBA 2K1RA 4DUYF 4DLGA 4RZRA 5IT4A 5AE3A 5IC4B 3KLGA 1M5VC 3A8IA 3OR2B 2VDIA 2CQ2A 1B7YB 1Q0NA 2WSEC 2XC9A 3MAAA 4Y3CA 2COLA 1XBWA 4C11A 1OSDA 2FJWA 1RKJA 3G2XA 1IBLF 3AA9A 1O0PA 3KJQB 4FN5A 1T05B 4B9NA 3NKYA 1NMEB 2XQCA 3CDAA 5E41A 1RWMB 1TZ0A 4NCGB 2OSRA 1RAAB 3CMQA 4LFCF 4A8SA 1UPPA 2D3UA 2JX2A 1MW7A 2WONA 4C2MA 2YKMA 4OMFG 2OO4A 3NGDA 4ECZA 4L6V3 5DDQC 3OLAA 4LQ3A 4JYAJ 3SEOA 2O67A 3H5YA 2H54B 3NP5A 3LANA 2UP1A 4E98A 3HPOA 4EU0A 3EVWA 3M8PB 2R3VA 1PSDA 1SQGA 2VQEJ 1N5VA 3T5LA 4TU7A 2A2CA 3A13A 4IQMA 4IOAQ 3CMAS 2E1MC 2PMHA 4EYIB 2FVPA 1MLAA 5IT9U 1PBUA 1JLFB 4MIWA 1SL0A 3VHQA 2HQ3A 1RLCL 4I2PA 2O3DA 1L3TA 1N5QA 4URQU 3GE9A 4LF2A 3CSKA 1IUJA 2MJNA 4I69A 4USHA 3ISNC 1KEKA 4CLWA 1KKHA 4JYAF 1LWCA 2XY6A 2RU3A 2ZBCA 1RAFB 1X4CA 1ZM9A 4TKTA 4IFYB 3K5MA 1GH8A 1D1UA 2ROPA 5ETKA 3VVUA 2VQEF 4JUZA 2MQMA 3JSMB 1M5HA 2ZDPA 3QMQA 2XGPA 1NDPA 3AJDA 4YB6A 3LGHA 1PG5B 1UJ4A 4Y2MA 1NJIT 4RNOA 4P2SA 4WKYA 2O5DA 4I68A 4H4OA 2HFNA 2MXYA 1UFWA 2MLZA 3TX8A 3KXDA 5KT4A 3DLKB 1DQ8A 3SSRA 2E1PA 3SSQA 2BKPA 3K58A 4IDKB 2HHXA 3KLIB 3VGTA 2DVIA 1HBMA 1O8BA 2E7VA 5KT3A 3FEYB 5L38A 5CZXA 2BE7D 4DL3A 4ZPAA 4Q2LA 2LU2A 2HBQB 2OGUA 3R97A 1VQ7S 3K2YA 1N5TA 1GXUA 4PG8A 4P10A 2AX1A 4KO0A 2HMIA 2HFVA 3OFEA 3R9LA 3A8KA 3TJ9A 4AYBD 2F4VJ 5F9LA 1FD8A 3TAPA 1RT5A 2QA1A 2ASLA 3CJKA 1U1PA 3TAMA 2A18A 3POTB 4JI3J 1K8AT 2YKOA 3HFKA 4FP9A 4XK8C 3F44A 5B0GA 2IM0A 4TY8A 4CO5A 3J7ZT 4P2MA 3VAGA 3R7NB 1Y00A 3MMAA 3PR5B 3BGLA 4X4PA 2BV3A 4MTPA 3MAQA 3DMJA 2OUGA 2B4OA 1JK9B 1HHTP 1HYSA 4CO1A 1VQ5S 2F4VF 3H8YA 4ZIWA 2AJ4A 2YWKA 4F0MA 3PKYA 2B5JB 3THPA 4JV5J 4JI3F 3QZ8A 2V8GA 2V8VA 1F1BB 4KJIA 1JLQA 1RHJB 3RGIA 1XTZA 2B6AB 5MLCV 3PZPA 3QPIA 2GFFA 3EWGA 1VHFA 2RDDA 1JLEB 2HZVA 3CJ2A 2AZ3A 2HFUA 2H5IB 1JLGA 2G2ZA 1DBDA 1CJKB 1RT6B 1H74A 5IQ6A 2OFHX 1K1SA 3I6PA 1ZH5A 3PW2A 1C4AA 3HM9A 2AEJA 3T19A 2BJ7A 3NRBA 5KFZA 2VASA 2KVIA 3DLBA 2BJEA 4CM2A 3Q24A 1WTFA 1OY6A 3T3FA 1Y5NB 2XSJA 2GVZB 2FVQA 1TFWA 4JV5F 3GJRB 1NHUA 1TQLA 1U0HA 1QAXA 4QIWD 2R2SA 3PYEA 1VBKA 3V5RA 2DGSA 3LP2A 3PV8A 4ER8A 2UVWA 1C1BB 5DS7A 2YX4A 5GVQA 3D3CJ 3EGZA 3C14A 3ILIA 2B9WA 5C24B 4KHPJ 1S49A 2DRAA 2GIQA 2ABYA 4HH1A 1HBOA 5T41A 2HYIB 5K8NA 3IN5A 2NSCA 4OZ0A 2YPZA 1JLCB 3W5YA 3V81A 1NSQA 5D15A 1E6VB 3UNYA 1Q16B 1NK7A 1PJ6A 3NOGA 3ZXWA 1NRKA 1ZAVA 2V8PA 2RUSA 4ZCKA 3CJ3A 4W92B 2BZ2A 4ECRA 3ITHA 3HVWA 4AXIA 2O1PA 2FYXA 1U1RA 4KHPF 3PW0A 1RT2B 1GTEA 4W4MA 2ZHAA 5I3UA 4C3KA 3RW6A 1FKPB 3CCRS 4V19J 2BRLA 1CVJA 3UDVA 5HO4A 2GMJA 2CNNB 4ZVGA 1F3FA 3GJTB 4L3KA 4NA3A 2R4FA 2YH1A 4WYLA 1RAHB 3TW0A 3I56S 2MQNA 3BGRB 4DPYA 2WBMA 4OJ1A 5KG2A 2KT5A 2XMMA 5A8RA 4J9QA 1G2EA 1ELOA 1MROA 1X5OA 2DXEA 5IWAJ 3IM8A 2HBYB 2XNQA 3KHRA 1CBKA 4U9RA 3I9ZA 5L8RC 3JQKA 4LR8A 1I3OB 1U0SA 3TZZA 4OLPA 3KFWX 2GHVC 3HZEA 1RBOB 1HFEL 5J2NB 2ERRA 2DHSA 3F56A 3DNCA 2CPDA 2UVUA 4DS4A 1TKXA 1HBUA 1S59A 2E1AA 5HMXA 1Y11A 1HBNA 4OQJA 4X2BA 2JC1A 2FY1A 5GAHU 1KN6A 1SH3A 1XWLA 4MK8A 3DLEB 4MKBA 3D7SB 3SI8A 5LOQA 1FRIA 2XBPA 1VRUB 1MWZA 4OL8A 2DO4A 1Y4ZB 2C2NA 2DT9A 1T03A 1M5PC 5IWAF 3MPWA 1LNQA 4HDHA 4J9KA 3EE3A 4LF6J 2DGQA 4TVAB 4AFFA 2YWFA 4QR2A 4TN2A 3UN3A 1ZTWA 1YI2S 2FC9A 2W24A 4O3NA 3TEHB 2HHQA 4X64J 1KFSA 3IS9B 4K59A 1HWJA 2MHNA 3NGKA 2CPHA 4CLKA 2LECA 1BQMB 4JV1A 1FJGJ 5A8WA 1PAUB 2GGPA 1LW0A 2ZH3A 1WI6A 4OJGA 1FVQA 4YR3A 5E2QA 2R8GA 1IR0A 5BJRA 2KM8C 3DRPB 4ZPTR 1FKAF 2NXCA 3DRRA 4AL7A 1SV5A 4LF6F 3QT8A 3UI3A 1RT3A 2H65B 3TUIC 1W2IA 1PO6A 2ATCB 2EFGA 4KFBB 2KFZA 1HHQA 1U02A 1EJ7L 4X64F 3KLGB 4PPDA 2ZKTA 1TR0A 1FJGF 2IA0A 1Z1ZA 1V6HA 2OTJS 3GR0A 2J76E 5H9FJ 2QLJB 3LH2S 4PPZA 4DL2A 3LQVA 4LFBJ 3WQPA 1RU2A 4UW2A 4CM0A 3RJMB 2WK4A 3GCXP 3RRGA 2CAJA 2FHJA 3OFHA 1IVZA 2WONB 3S7RA 1D8ZA 4TQRA 2B4VA 2ASJA 2JRSA 7FD1A 4O44B 2KFYA 4PAAA 3TRGA 3U7JA 1WKLA 5KTQA 4KPCA 2LQ9A 2JFDA 1S1XB 3AJ1A 3NCQA 4B3MJ 1TL7B 4OYIA 2QT7A 5EWGA 2MZTA 1HNVA 3V4IA 1U49A 4LFBF 2GX8A 1V3SA 2VH7A 3CTRA 4FXDA 1HL6A 2EK6A 2EBGA 2H9ZA 5A0YB 4I2PB 4CNYA 5CA5A 2RD5C 3QGHA 2YY3A 4F3MA 1MNEA 2V9WA 3G6XA 3MHYA 4DF4A 3CCES 9RUBA 5AXMA 4G1PA 2LXFA 2WB1D 2E1RA 1FT8A 3OL7A 2DNKA 3FRZA 4R25A 1OO0B 2GO8A 4I0WA 3IG1B 4B3MF 1YK9A 2ZOGA 3UE2A 3MTJA 4TYBA 1URRA 2YWEA 1T9VA 4USTA 4ZVRB 5HQ8A 3BQ1A 2PMWA 4YMEA 1TUGB 4FS2A 3QATA 4K4YA 4O0NA 3I31A 2G1HA 3BQ0A 2IHR1 1JMTA 4ILMA 2XZWA 1N36J 3OFGA 1UMJA 2F1FA 4X62J 4CO3A 4DV7J 4ZN3A 3EPGA 2DTJA 1HBMB 2QTWA 1HQUB 1XQIA 4KE5A 1NPKA 4CP5A 4R0EA 4MFBB 3LP1B 3D9BA 5EWEA 3KK3B 3WIUA 2M4MA 3HFVA 2HNZB 5HI7A 1VJQA 2A1BA 3DU6A 2FLLA 5KT7A 3MMBA 4RW8B 1RT7B 3CJSA 1RP5A 3Q8UA 1WKJA 1FX2A 4HR2A 2V8HA 1A7GE 3D5MA 2G2YA 4DI6A 1N36F 1WDDA 2NZCA 1RT5B 4ZHRA 1NSKL 1BXNA 3ZNUA 5HQMA 4EBDA 1KWMA 4ELTA 4X62F 4RNNA 3R2DJ 4O3PA 4DV7F 1HI0P 2JVRA 2AYBA 5GMEA 1BLUA 1QM9A 4FPRA 1XNQJ 5KFFA 4NYOA 2R2TA 3ZTSA 4FF2A 5CYQA 1X5TA 1WC0A 2DCUB 1D09B 1T0TV 3I4PA 3NWRA 3AD9C 2VPWB 2AEFA 3CJTA 2P9EA 4J7CA 3TZYA 1GMWD 2N4CA 2E7WA 4DV0J 1SPBP 3MM9A 2B7CB 3BF4A 2BX6A 2MZRA 1JNRB 5D0GA 3NAHA 3OHAA 3VQSA 3BGUA 2E5LJ 4B9MA 3CPWR 1XNQF 2DRDA 3JAMY 3ET6B 5DETA 3HO1A 1JJ2R 3BREA 1H7WA 4DU7A 4LFAF 4MJKA 1XC9A 2BQ3A 1GT8A 1NH7A 4CT8A 1PJ5A 1D8YA 3C15B 2E5GA 2Y0BB 2ZVIA 3H5SA 3CNQP 4IRCA 2DIVA 4QYRA 2FHOB 4UOGA 2RQ4A 4F25A 5F3TA 2YKAA 2D3OR 4DV0F 3HSJA 2YNGB 4ECYA 4ECTA 3CIMA 2F9JA 2QC3A 2EW9A 3W2WA 4K4VA 4QIGA 3ETOA 4XPEA 1UPMB 3CDEA 4I7FA 2EFPA 4Y34A 2E5LF 1RBLA 1NK5A 2C2RA 1Q4RA 3SXLA 1VC0A 2CJAA 1SVDA 2BANB 1UW4A 2V2ZA 4X84A 1X8DA 2IMOA 3RAXA 3T5KA 5HAOA 3JYTA 3M30B 4TU8A 1UJ5A 1YRXA 2BJ8A 4EWTA 1VQYA 1MN9A 2DH7A 3W9IA 4J9UE 2B3TB 3JS9A 2YBVA 4ERDA 4DQQA 4ZOSA 3I87A 3M8YA 4DS5A 2YNHA 4Z2XA 3Q8RB 3N4WA 3ILJA 3MEDB 4TNOA 4KR0B 5LMNJ 4LRAA 2VBYA 2VOPA 3O8WA 2OIHA 2BACA 4F0HA 4OYPA 2V2QA 3TVKA 2IAJA 3ITHB 4OJHA 5B0BA 3RZAA 3CWJA 3GWCA 2BRKA 3JSBA 4X4TA 4HTIA 1T11A 1MG7A 2L08A 1YIJS 1RT4A 3TQ1A 1X5PA 5DLFA 3GTYX 1C0TA 2ASYA 3EYZA 2QYCA 1KSPA 4BDPA 1S6UA 2CQ1A 3TJAA 4ZLPA 3CT9A 1VQOS 3GV5B 3I0RA 2VKRA 4LR7A 4AE5A 3D0IE 2V8DA 1EKRA 3U1LA 4Y2KA 3KUHA 1R8BA 4OHYA 3OSPA 1VLYA 5LMNF 4ZVFA 1NM2A 1S9EA 1AW0A 2MSTA 4HTJA 1Q8IA 4FF3A 4OYAA 1IKVB 4DPUA 1LWFB 1ZTTA 1PC4A 1SJRA 4GMKA 5AXLA 4KKOA 2E9ZA 3SMZA 2XY7A 2AGPA 1FX4A 3EM1A 1TKXB 1HBUB 1F3VA 3G82A 3ZFVA 1MMDA 2HHTA 2YTCA 3TUZC 3IAS9 2QA2A 5I42B 2ZH6A 4DCJB 4KGVB 1RWWB 3EJMA 5KFOA 4M5HA 2DGVA 3BSAA 2A6OA 4RW6A 3D1QA 2CJXB 4CI0B 2GJ2A 4DN0A 2KVQE 3K17A 5MAOA 2PEHA 4PG7A 2R8JA 4K0KJ 2KJWA 4KV8A 5E3CA 4ID8A 2H1YA 3UVJB 1UJ6A 2W2MP 4ZITA 2LA4A 1BQXA 4YN3B 1NSAA 3QYYA 4QCLA 3MEEA 3BO2A 1X4DA 4YEAA 4NXNJ 2ZOMA 4P72A 1CG2A 3QJLA 4C97A 4YQWA 1WSVA 2ZZMA 1QSLA 3QLHA 1SCJB 2ZJQQ 1TUWA 2GQ2A 3CCTA 2DR5A 1MN7A 3J80Y 5HP1B 3MD1A 4JI6J 2FLOA 4YS2A 1I94J 1U25A 1IR2A 5D77A 1H6KX 1J2VA 2QA4S 3PDNA 1CEZA 4ZIVA 4K0KF 4A8OA 5IXUA 3DHWC 2BW7A 2ZC3A 2D1CA 1OIAA 4A8YA 3H7HB 4NXNF 2EI5A 5K8OA 1R8AA 2F40A 5C2CA 1B70B 3CC7S 3Q86A 3HT3A 3DLLQ 2ZH1A 2GVDA 4JI6F 4NLSA 1I94F 3PX6A 1SL1A 2YX7A 3VAHA 3KUEA 4BWJA 1H2UX 5D0EA 1UWAA 1PCAA 1UCNA 2VG5A 3R5JB 3M2VA 4KH1B 1UVJA 4L3NA 4ED8A 2HNDA 3H59A 5J2PA 2R8KA 1GNKA 1RAOA 5BYRA 3A8JA 4NLWA 1S1WA 3JB9k 3PYDA 3K8VA 1KHVA 3T41A 4DX7A 2J0SD 2VOOA 4LJMA 4LSNA 2XLIA 2BJDA 1RI7A 5ETMA 1RGVA 3KMSA 4LF8J 4HHUA 3AQOA 3D1OA 4YB7A 3BSCA 1YHQS 3C8YA 1TUVA 3BN7A 4B3OA 2NYHA 3RBZA 4KPYA 2CVIA 3MD3A 2KI2A 2CVEA 4USIA 2DYAA 1LWEA 1D9DA 5ETLA 1VRTB 2RE1A 1FRXA 3HHLB 1OJ4A 5L1JA 2OJ3A 2HIYA 4E8UA 5HLFB 2RS8A 1RWOB 2MZJA 3D66A 3C3LA 3DC2A 1L3VA 4GC7A 1VFJA 2QLBB 2WVFA 2VV5A 2HWHA 4YDXA 1U45A 2BKOA 3L09A 3M8RA 1X4GA 2HFSA 4LF8F 5DZ7A 3BKUA 2DISA 2NSBA 2ZH7A 3CEDA 1FNXH 1RWVB 4KGKA 2IJFA 2WVBA 4NI2A 1DTTB 1F5BA 2Z8QA 2FPHX 5HN0A 3DI6A 5IV4A 4ZPCA 3J81j 2FHMA 2W2QP 3W9HA 1RDRA 2EG2A 3BEGB 4NEZA 2R7VA 1ZM3A 2MTLA 3OVBA 3PKMA 2H4WB 2FVCA 2WZ1A 2Y8YA 3CF5Q 4KTQA 1JXEA 1TKZB 1Q7LB 3OL9A 3QRQA 4ECXA 2HNYB 1DARA 4MH8A 3M7VA 2MY7A 2DH9A 4KH0B 2R8IA 4RWWA 4QWEA 1EP4B 3SDEB 1WD6A 2M9KA 4BBYA 3MMBB 3R6LB 1PIEA 2RKIA 1CULA 2ZJRQ 2Y9HA 4IG3B 2M3DA 2G0CA 5BR8J 1YITS 2QSFA 5EWFA 2FLNA 3UR0A 4Q5VA 1WC6A 3VAJA 3NG8A 4ZVUB 1AXQA 4PG5A 3TZWA 1YQHA 3KK2B 3R8YA 3TR5A 3M2UB 2OPQB 4FKXA 2IVYA 4RW9A 4QYZJ 1N34J 3MUTP 1VDHA 3JXOA 2W9CB 1RHMB 2MZ1A 2M8HA 4QWAA 4IFVA 4A8WA 1WORA 3BR9A 4WP8A 1EB0A 4NZ0A 1N6QA 2KZZA 4DX8H 2C2EA 1FK9B 3NWGA 4N7TA 1F0XA 4F3QA 2YKQA 3UWTA 5BR8F 2RILA 5T14A 3C19A 2LYVA 1LFWA 3TJ8A 2OMOA 3K5NA 4IG0A 2WVEA 1G1XA 5F8HA 5GAEI 2NQPA 2FGOA 1U1OA 1RCXB 2OH2A 4PUOB 1RSCA 1N34F 5K8PA 2R7RA 3D1HA 4ZMMA 3SCKE 3C16A 2VG7B 2DNYA 5C25A 3GLJA 4ETXA 1J27A 2AJ2A 3T1HF 2DCLA 1IR1A 3P45B 2QL5B 2U1AA 4KQZA 1FNMA 1K9MT 4JP8A 4G6VB 1RK8A 3LPEA 5DGBA 5KOWA 3NS6A 3IR6B 2DK2A 2VF3A 3OSNA 5A76A 1SUQB 4QIFA 4OHZA 2EWHA 1FWPA 3OV7A 2MPUA 1YTYA 2B8QA 3B82A 4DCPB 6FDRA 1VQNS 3FNNA 3JTNA 4DV6J 2E5JA 1KS2A 4B9LA 3PNIA 3UNGC 3JYTB 4LVOP 2JDJA 4HACB 3UW1A 4DOZA 1WTBA 4I6WA 3I32A 1HI8A 2HW3A 3M2RA 1ZETA 1T94A 4BLGA 2RHQB 2JLEA 1I1GA 1IJEB 2OTLS 3NS7B 4USUA 5JUMA 4DQIA 3VAKA 5F3ZA 1QAIA 1T9YA 5IM0A 2B4PA 2YNHB 5K14A 2R7QA 1S6OA 4DWIA 5ETTA 3FBFA 4WTYA 4NLUA 4Q8EA 1B3TA 3M9NB 1SC3B 1VQ4S 4ED5A 3J7YI 2LMIA 4ECUA 4KSEB 1SXLA 4UUWA 4DV6F 1S6QA 3DOKB 2KYZA 2CADA 4NLTA 4FKYA 1UZHA 2ACMA 2XY5A 1RTJB 3OUYA 3OT9A 2OAUA 2E66A 1RT4B 3GSDA 3J80U 3DRYA 4UZCA 2CNOB 3FEZA 4CYUA 1JX4A 2XI3A 3K59A 2NPFA 3H4DA 1S0OA 1JLBA 3PW4A 2KHCA 1Q78A 3OTOJ 1KFDA 4NA1A 3PIOQ 5A6PA 3I0SA 1QVGR 5KT2A 2DXDA 2CZ4A 4ANEA 4B17A 3GJQB 1TK0A 1Q1KA 2HEKA 1VQSA 2X1FA 1D9AA 3CCVS 4UQGA 3CCWA 1R3NA 5E3AA 1S79A 1RLDA 2C1EB 1KVJA 4CDIA 2WAQD 3HF5A 1S1UA 5CQGA 5KT6A 2XYGB 3MI7X 4ZP7A 2PSZA 2OPRB 3WC0A 3D6FB 4F4XA 4W90B 1E6YA 3OTOF 5KFRA 4CNZA 4UUXA 5KFGA 4QPTA 3QNWB 2AJFE 4XDDA 2V5HG 1DRZA 4J91A 3PYFA 1B4SA 1RU1A 3QGIA 2HRYA 3NL0A 1WEZA 1UZDA 3L3CA 2CUYA 4UY85 4PG6A 2QMXA 4LF4J 3MR7A 1YJNS 1SKWA 1WC4A 2CQ3A 3BO3A 4IKAA 3CIZA 4NRUA 1NKCA 2NCKL 2PI4A 3S8SA 5DJBA 3AB4B 3LALA 4RL1A 1N4LA 2ZNYA 3D2WA 3B6BA 4WXWA 1RA6A 1HMVA 2CDRB 4ICLA 4ZP8A 3FSIA 2I0XA 5LMUJ 1NKBA 4F67A 3P5TL 4LF4F 3A1YG 1KNZA 2MLYA 3U27A 4X65J 3KJVA 2UXDJ 1K1QA 1XK8A 4WU2A 5LXRA 1L3SA 2BBEA 3M8ZA 4JBCA 4HT5A 1KTQA 4PWDA 3GYNA 1SB6A 3KG4A 1TP7A 5D4NA 1S7IA 2EPIA 3KJFB 3NMAA 2XWXA 4ZLJA 3BDEA 3PM9A 1Y0HA 2CJ9A 2V50A 2WVCA 3DGPB 3HHNB 3CCUS 3ZC4A 3LPYA 4PXEA 1YZ7A 4OI0A 2GAHC 3OJSA 4O4GA 4A4JA 5LMUF 4NWBA 2CJKA 3MPYA 2GVDB 4Q8FA 1NEEA 4ZKAA 2BE2A 4JB8B 4X65F 4M5IA 4Q0BB 3SFGA 2UXDF 4KHRA 2N4DA 3FBBA 3C46A 1KD1T 4M5GA 3M2VB 5HATA 2F8HA 4J9SA 2VUGA 2YKNA 3R5GA 1FI4A 5CD4H 1UETA 5ETNA 3ZTPA 2NZ4A 4IOCQ 3ENAA 1HW8A 2YQ3A 3N9UC 1VQMS 4LBPA 4QU7A 1V9OA 1NJZA 1LXJA 3GIKA 3KNGA 2PT0A 5C42A 3HHKA 3PFOA 3IWNC 3ILOA 3SV3A 5DQGA 3FSXA 4B3RJ 5GMDA 4ZCMA 3W1YC 1RT1B 3Q23A 4F4AA 1V5IB 3TEGA 1UVMA 1RCOB 3AXKA 2V6AA 5AT1B 4WIIA 1TFYA 3H40A 3CB4A 2DR7A 3L95X 3QFWA 1WI8A 4JI5J 4QWDA 4B9VA 1RXOB 4Q45A 1RZMA 2JJ4D 4E2FB 4Q44A 1FDAA 1RADB 4C48A 3VAFA 3TA1A 1KQFB 5HBMA 3DGVA 3W66A 1A6LA 3D67A 4G1QB 4B3RF 4JI4J 2GJIA 2YH0A 1HR0J 5DGAA 2Y1IA 3T5JA 1Y9OA 1CS4A 5DDPC 2HHSA 2V4JA 1CJTA 3ETMA 3NGUA 1SH2A 1HA1A 1BQNB 1SJQA 1AUSL 2J9DA 5I3QA 1W25A 3KK1A 1N8RT 3M6VA 1ICEB 4WFXA 4JI5F 1FFGB 2FHJD 2J5AA 4ED4A 3TX0A 3FBEA 3JTPA 1JJHA 2CRLA 1QE1A 2RQMA 2XYHB 4OZJA 2XGQA 3EDQB 3PEHA 1IKYA 5AE2A 1S77D 2YNIA 4WTOB 2ROEA 2AYGA 4JI4F 1CSJA 1CJUB 1HR0F 2IY5B 3BBBA 3UR3C 1S57A 2VC0A 4CH0S 4PKDB 4NOHA 2HQDA 3OTCA 1S76D 1X9WA 1OYEA 3NCPA 1JB0C 1NB2A 4PYAA 4PWWA 5L1IA 1X4HA 4TXSA 5B0EA 4U7UD 1QSSA 3T5HA 1REVA 5JMNA 5ETSA 2BM0A 4X4RA 2IMWP 2FZKB 2XSFA 1EETA 3UCUP 2ZBQA 3CO9A 2J0WA 3MM8A 4IFVB 3MECB 4DHVA 3RR8A 1LW2B 4OI6A 1EARA 1ZOTA 4U7UK 2YNFB 2CPEA 4NASA 5IT9Y 3CCSS 1RTHA 5KFIA 2GA7A 3H2LA 4YY3J 4DV2F 3ADAC 1SKUB 3M8QA 3N6MA 5ETQA 3MUMP 3HSGA 2PA3A 5G0RA 2PN6A 4XIUA 3GJSB 2DR9A 5D8HB 1WHXA 3HK2A 3PACA 3BJYA 1NJXA 1BUXA 2R7XA 2E29A 5AXNA 1N56A 1RACB 4H4KC 2R2RA 3D54A 1S9FA 2HQFA 4YY3F 1FDBA 1HWIA 2I8EA 2RDJA 2AEMA 1FDNA 3FUYA 2AV5A 2AP6A 4FYVB 5DM7Q 1WHYA 2LQBA 1R6YA 2F63A 1S6PA 3I5CA 1VIXA 2HLUA 3TANA 3NCRA 4IH6A 2ALZA 1RYRA 3OL8A 4AXJA 3V6DB 4C7QA 1ZAXA 4EO8A 4DFPA 1NNDA 3ZTQA 2HQGA 3K5PA 3AJ2A 4ZVEA 2BW2A 4KYZA 4MYTA 4DSJA 4OX7A 4ZJQA 1QVFR 1KLMA 3LF0A 4F02A 3Q8YA 4HT7A 4ZPDA 3GONA 3EXCX 4LIWA 1XR6A 2BXJA 3S1TA 3CVKA 4RUHA 3M32A 4DX6A 3EUNA 3CJ8A 5K14B 4JI7J 3BM7A 1BD6A 3QGPA 3RTVA 2RQCA 3G8TA 2CA9A 3J7Z5 4X4NA 2RJZA 1IQZA 4DJBA 4CLYA 4ETZA 1KQSR 4F4WA 1F2GA 2V2VA 1Y5IB 1S6QB 4OZNA 3WZ0A 1KQKA 3TVZA 2PFFB 3DM2A 2EKNA 4RUBA 4FYWB 5EDWA 2F4FA 1F2HA 4M5KA 1J5OB 3CE8A 1WHWA 2R42A 1TKTA 1N5YA 3D28A 1HIYA 2XMVA 2WCXA 1JLBB 3DLJA 2JWNA 3FJ2A 3DOMA 5D0RA 3QJPA 2L9DA 1OWXA 3BPSP 4JI7F 4I6YA 3W8PA 1QTNB 5KFQA 3OXGA 3HD1A 3IRWP 4DR4J 1CJVB 3G6ES 2XMTA 2XMKA 3W2VA 4HL9A 1U6ZA 2QX0A 3MMCA 4RBTA 1H72C 2BEFA 1OSCA 2OSQA 4NL5A 4K4WA 3T6JA 3IP0A 4YFUA 1CQNA 2CPXA 2KL8A 2ZDOA 1IJFB 3HMJG 1R0AA 4DEZA 4K4XA 4U8VA 3R7BB 2OD6A 1P1TA 3C66A 4FF1A 1IWGA 1CC8A 3TVYA 2PO4A 2ILZA 3P96A 2AQ4A 4C0OC 1JLAA 4DR4F 3ZZ0A 2CZVC 1B0TA 4DQRA 3KKFA 2VB6A 1S9GA 4CQ1A 3PW5A 1WELA 5B0CA 3Q8QB 1LXNA 2IFXA 2V63A 2XG8A 3WHIA 3QIDA 3U02A 3ISZA 1OS5A 4J9RA 3W63A 4M1KA 3IMQJ 2OPSB 2NXEA 2ZEJA 5CYJA 3RB6A 2W9BA 8ATCB 3VWSA 2UUAJ 2EBEA 2QO3A 1QAJA 2Q43A 1YZ6A 4N41A 1BY9A 4OI4A 2F9DA 3DOLB 5E3RA 5D4PA 2JVOA 1PJ7A 1X7VA 4H54A 3BS9A 4OV6A 1HMVB 3RB0A 2MQOA 3MM5B 1K0VA 2DHGA 2XYPB 8RUCA 2CFXA 2JL9A 1RTDA 3R5BA 5LM7E 1KC8T 4ELUA 4OYWA 3DLGA 4USWA 1VBXA 1JJCB 2OPPB 3LGNA 2BVZA 3W5ZA 1UVIA 4N5SA 2UUAF 3D0GE 4CT9A 4OYOA 1UWBA 3MEGA 3MOZA 3US5A 3IRXA 2C22A 1T02A 2GIFA 2J0XA 5DG9A 4K2XA 1PC5A 4FYYB 1PYOB 2FB0A 3TOQA 3KLVA 6FD1A 5EX3A 2MZSA 3H4BA 4OIXA 2ZUAA 2Q66A 4X4VA 4O4GB 2VFTA 1FXRA 4DSIA 4CRJA 1DQ9A 3M1VA 3OTDA 3UN2A 2BE2B 1XN9A 2LQJA 3HP6A 1WACA 2PDAA 1FEEA 3H0PA 4RLEA 2I1RA 4PABA 2RUGA 5KFSA 1H3DA 4IO1A 4NE9C 1TMMA 2A0FB 4AT1B 1KVKA 1DZ5A 2LA6A 4ZPVR 1XIQA 3ZZUA 4M5DB 3HKZD 4CTAA 2G2OA 4USVA 5C42B 2ZBIA 3W60A 4GVBB 4OZ5A 5C5JA 5A6WA 3DRSB 3HULA 5A2QY 1QJHA 2HHWA 3UN5A 4DV5J 5F41A 3FCVA 1DTQB 2V94A 4J9LA 2KKHA 3SV4A 1MU2A 4X66J 3T1AA 5KG3A 3C6UB 3VGVA 4WCEQ 2JEGA 2VA3A 4WJBA 4EYHB 4NLDA 2R7TA 1JKHB 2HKEA 2CWXA 1WNEA 3EGVA 3MM6B 2VD3A 3LWMA 3KWMA 1YJTA 3M6UA 2L41A 1YRTA 2HSEB 2G0JA 4DV5F 2XS5A 3CJ4A 1S1VB 4WK1A 3QGGA 5FIIA 2RQKA 5F0WA 4U8YA 5E3QA 4X66F 2KM8B 2QN6B 3I9V9 3LP0A 3L9ZA 3A8EA 4MYUA 1VI7A 5ETRA 3FEXB 3MDFA 3GIJA 3G71S 5F8NA 5E5NA 4XAKA 4DBQA 1QY7A 3AHPA 2W2NP 1F9HA 1CLFA 4B3SJ 1FDDA 2D9PA 5DG8A 2NXUA 1B0VA 3R7SB 4DUZJ 1IKYB 5DQHA 4ATNA 3GSIA 3R27A 1U1QA 1JQGA 2VG6A 4X4QA 4OYXA 4DU8A 2X51A 1V3ZA 4KHMA 2RRNA 3KYLA 3AA8A 4QQBA 4KAIA 3MWBA 2NYIA 2UZAA 4RWXA 1C1CA 1CC7A 5HANA 2Q3PA 4YR2A 4ENOA 1LV5A 1TL3A 4PCQA 4I2QB 3UO0A 2IBOA 3PJWA 1DLOB 4C8ZA 3DYAB 1KVIA 4B3SF 2W1BA 4WE1B 2HBRB 4UOCA 1NK8A 1TL1A 1UEVA 4DUZF 4BWMA 4MKAA 2MJUA 1N33J 4B9SA 2BOPA 2JEFA 4NLPA 4C8KA 2OFGX 3SQGB 2IJRA 3HVTB 4LF9J 1HKAA 1RTZA 1QUPA 2X3GA 1WSRA 3TA0A 1SIWB 2LQ8A 4LRFA 2MQLA 2E9TA 1SC4B 4DSLA 4DR5J 2HHHJ 4RU2A 2KT3A 3F73A 1YVFA 4C3MA 1TAUA 5CYMB 1U47A 4ZVTB 1TELA 3F41A 4DPTA 1NHKL 4RUAA 2UVVA 5GAGI 4NEYA 2MKCA 1Y3KA 2JSXA 1N33F 4DFKA 2C3OA 4ID5A 4ECQA 1XERA 2AMCB 2ZH8A 4YP3A 4LF9F 5T7LB 4QZVB 3KLHB 4FNHA 4R5PB 3W62A 2IC3B 2HBZB 5CXTA 4DR5F 2HHHF 1GK8A 4DL7A 5HROB 1RJJA 1AA1B 4CLSA 1R31A 1XMOJ 2JFKA 4HI2A 1YG0A 3HI9A 3CJRA 4ZVSB 2UUWA 4LSLB 4WFYA 5LXYA 2MGZA 4LUBA 4ES1A 1U24A 4G3IA 1Q8KA 2DO0A 3N6NA 3OR2A 2LXIA 3ENQA 4PYDA 4IH5A 1U8WA 3CW2C 1FFWB 5FD1A 2H4YB 1V5VA 2DR6A 5F8LA 1NXIA 4HI1A 5KFDA 2C3MA 4FYXB 3AY0A 2CQHA 3IBFB 3CJ5A 2CPFA 1XMOF 1RE1B 1T05A 1YBTA 4QBUA 2MKKA 3C6TB 4DL6A 4DDFA 3BPDA 4EEYA 1MSWD 4NCGA 5D3GB 1KP6A 4IUFA 2QFJA 4C98A 3LO3A 1Q79A 2D41A 3FC9A 5RUBA 1TKTB 4YB5A 4G1IA 5B09A 1N5YB 4KRWA 5KG0A 2XB2D 2EKYA 2XHCA 3JQMA 1SQEA 1K44A 3HJFA 3R6GB 2F3JA 5U47A 4MMOA 2QL7B 3ISND 2MB0B 3SZ2A 2Z0GA 3LW5C 1NO8A 1L3KA 2EVZA 1JXVA 4EK2A 3W2VB 1IKXB 3O5TB 4NZ7A 4RW4B 3R3TA 1LFPA 3QBCA 1JLFA 2NUHA 2Z57B 2FJVA 1S5ZA 2IRXA 3LA0A 3MCOA 3KLFB 1R8HA 4DPXA 4PXDA 1X9MA 2ZKUA 1Y3JA 3EX7B 2WSFC 3BH7B 4F4KA 4F8RA 4PQUB 2MKYA 4IFYA 5B08A 4AUKA 2I9SA 4HHJA 1GFWB 3HLUA 2HPUA 5GAEU 1SJ3P 4G65A 2KO1A 3HXMA 5KG1A 3JSMA 3WBZA 2GZOA 3WX8A 3ZZYA 1O6XA 4DMZA 2RIJA 2OLWA 3BQ2A 1GEHA 1Q95G 2C42A 4RX6A 4RW7B 2RRAA 5HSPA 1QTMA 2Q6CA 4L72B 3OBIA 5A2QU 3DLKA 2ZH2A 4K5SA 2EXUA 4FBTA 2DXFA 3QO9B 2KH9A 3KLIA 1FWKA 4LRBA 5HMZA 1ZA2B 2C2ZB 2OD4A 3FFIB 5D4LA 5J1EB 3HSZA 3KDNA 2GQCA 2PD1A 2NR0A 3MPVA 4IR1A 1NK0A 4DN9A 3Q8SB 3RAQA 2CJYB 1ACMB 4R8UA 3DLGB 2XLKA 2MKIA 3UD5A 3MXHP 4KGMA 3MR3A 1S1TB 2JOQA 2GW8A 2HS3A 2UV8A 2V2KA 3LGMA 1HQEB 3CJQA 1UA0A 2RF2A 3POTA 4U7CA 5EN1A 2HVHA 5SUHA 3RYLA 4YUDA 2K1RB 2DEIA 5I4MA 1RYSA 1F6TA 2G0IA 3FCWA 4OHVA 5HL7Q 3HDSA 3EICA 1R8CA 3MAAB 4FF4A 3PTWA 3LTOA 4O3SA 4WXOA 4K4ZA 4C11B 3ZO7A 1Q82T 3J7YU 1UKUA 1TU0B 2MQPA 3D3BJ 3THTA 4DR3J 2XMWA 3DXSX 4EZ9A 2Q6BA 2J6SA 1WJ9A 1XEZA 3UDCA 2HFZA 2W7PA 4NX9A 3AAWB 2IM1A 3B54A 4M95A 1NLKL 2DRBA 2B5JA 4WP3A 1LKZA 1X0FA 1KRPA 3J7A1 1W7WA 2B6AA 1U8SA 4HHHA 4A8QA 2YKMB 4Y0FA 2AF6A 1JLEA 2VZ9A 4QW8A 4J5OA 4S0MA 4MT1A 2W4DA 5IOLA 1CJKA 4CTAB 2BJ3A 5K8MA 4DR3F 1VBYA 1NDCA 1IM4A 2VFVA 5L46A 2B9EA 4AQYJ 3IBWA 3H2VE 2QV6A 1U09A 2EEYA 1F9FA 3R5CA 4DQSA 5K9FA 3VALA 3PX4A 3KDOA 2KZMA 3IGVA 3VR1A 2FJXA 2OI2A 5C2GA 4KB7A 3V2UC 3QAUA 4QWCA 2JEJA 2D9OA 1C1BA 2GCFA 2KTQA 1LWCB 3L7PA 3K89A 5C24A 3W7BA 2ZWPA 4ZVHA 1WC3A 1WDTA 3O2IA 1VHIA 3D6HB 1V3RA 4AQYF 2VFUA 1QAYA 3IA0A 4ED6A 5ITHA 1JLCA 2CQ4A 4NLQA 2M7SA 2YPYA 2F5GA 1FE4A 1FRMA 3R5DA 2BJ9A 4Y2AA 4ZLLA 2CQ0A 2GIRA 4ZCIA 2MYFA 3EZOA 4R0JA 4XTTA 2C3PA 4H4OB 2ZD1A 1WC1A 1URNA 4LSZB 2J8AA 3KJNB 2LDYA 1GXLA 3QRRA 1FRLA 1RKIA 1NDKA 1RT2A 1FKPA 2M5YA 3HX9A 3ENWA 2RT3A 3HKWA 2DGOA 2ZZNA 3FRYA 1O51A 4NLVA 4L73A 3GIRA 4A8XA 5LJ5Y 3BBCA 3BGRA 1HNIA 2Y1LB 4NA2A 3WDOA 1BGXT 1NUEA 1N0UA 4QIEA 3K5OA 2CQGA 4KO0B 2HMIB 1HQ2A 2DB1A 1FFSB 3N0VA 2DNLA 2VPYB 3KHLA 4DXLA 1REGX 3MOJB 2HGMA 3CJKB 2KYXA 1R27B 1HNZJ 5HQLA 3TAMB 2YWGA 3PR4A 3E01A 1NKEA 1SBRA 1VYAA 4ZA1A 2F8MA 5J2NA 4TY8B 1DQAA 2HAFA 1F5AA 3N5FA 4WFAQ 3MMAB 2V67A 4V1Ak 5ETOA 3M8WA 3UCZP 1MMLA 2PIIA 2E1CA 3DMJB 3DLEA 3P4UB 1U7LA 3BV8A 2Y3YA 1VRUA 1FJEB 1YDLA 1HYSB 2ZJPQ 2FUG9 2APOA 1UEUA 2CDQA 1HNZF 3H42A 5KAKA 2WHOA 2PI5A 3G6VA 3H90A 3SBMA 1F5CA 1JLQB 1EHWA 4Y28C 1FE0A 4QJVA 1LK7A 3IS9A 4A48A 1JLGB 4A8MP 5CD4A 4K8RA 4Y6IA 2JLFA 2AIRB 2E5IA 2AJ1A 2R8HA 1X60A 3ZNJ1 1SJ4P 3RBEA 5DG7A 4IR9A 2JHEA 3DRPA 4CLZA 1WF2A 2DNGA 2XSJB 2B7BB 3ONQA 1AB8A 2XWYA 1U0HB 2V0NA 4LRDA 1T9TA 4ED2A 4CO4A 5KOXA 4FVMA 4WWSA 1F9EB 1LOUA 3NBPA 2WRMA 3LP2B 2QZ8A 1OPIA 2LU1A 3C14B 2KXFA 4NCAA 4I67A 5HK4A 2FTRA 3RU0A 2V4RA 2Y8WA 2NUUG 4FXWA 1HBOB 2H51B 2GAGC 3UDLA 1VLOA 4DR7J 5SZTA 3AOCA 3S01A 1EX8A 4WBFA 3V81B 4OFZA 2ADCA 1G7CB 2VIHA 1Q53A 4M5LA 1B7FA 1YBUA 2ZBRA 4C0HA 4JI2J 2C28A 1NB7A 2BJ1A 1KOOA 2HWTA 3IAM9 4O44A 4HVZA 2EFVA 2BE9B 4ZP6A 5I3UB 3VQTA 2DNOA 1S1XA 1HHSA 3VGSA 4CO0A 1TL7A 4ZDNA 4DR7F 5HVGA 5FDLA 1YJRA 4NMXA 5BXIA 2Z56B 3TYTA 2GHWA 3FZ2A 3FK4A 5CABA 2EFOA 3W5XA 2CG8A 2R2UA 1Z2LA 2QGFB 3I5AA 4P73A 4A47A 3THVA 4JI2F 1DAXA 5A8RB 2VONA 5A0YA 3BO4A 3A3PB 3MF5A 1MROB 4DCOB 1VQ9S 2XZTB 4O3OA 3TWZA 2M2BA 1U1MA 1EZZB 2JZ5A 2XMJA 3V6HA 1VJWA 2RU9A 2HIQA 2BOAA 2F7VA 2Y0SD 2XMAA 7AT1B 4RNHA 3IG1A 5E0OA 3O3LA 3HVAA 4H4KA 3K8WA 2FGCA 1HBNB 3GG0A 4LF5J 2W01A 4CH7A 4UOHA 4DL0C 4RBUA 3FMWA 1OQ6A 1AROP 1JNZB 2QLWA 3FQLA 1Y10A 1T03B 1YWXA 2HS0A 2HK3A 4O3QA 3ZTRA 2K3IA 3OD2A 1HD1A 4OYBA 2GQQA 1VQ6S 2FJEB 2KJVA 3CCMS 2WBRA 1HQUA 3DHXA 5GADI 1VK3A 2RAQA 1QD1A 1HARA 4WZQA 2YXLA 4MFBA 3N6LA 2DNNA 3LP1A 4KGXB 3KK3A 3SQOP 4LF5F 1S0MA 5L1KA 1TL4A 2HNZA 2AJQA 3NAIA 5A8WB 2VPXB 2GGPB 1LW0B 3PY8A 3HZGA 1RT7A 2H5JB 4RW8A 3D6MB 1RHKB 3QSIA 4R8UB 2XCPA 3DRRB 3KOAA 3E51A 3PG9A 1SV5B 2YWWA 3MTKA 2BQUA 4ELVA 1RT3B 4LT6A 3GFHA 2QJ3A 2RF2B 4F2RA 4KIAA 3O1LA 5LSRA 1I5OB 3G8QA 1FO1A 3NNAA 4GO5X 2K3KA 3AH6A 3GV8B 1RISA 5J1PA 1JJ4A 1APSA 2HAIA 1H2TZ 2RSQA 3FKBA 1N32J 2IJNA 2Z2YB 1M5KC 2VFSA 4C8LA 2LXUA 3G4SS 4LREA 1SKRA 3DDIA 4O0IA 2P9CA 4Y2CA 2VODA 1OMSA 4J9PA 1YSJA 2PA8D 2K8GA 2J6UA 1HNWJ 5K5MA 3X1LB 3ET6A 3D0HE 2HHPA 2XCAA 1PYSB 2CPYA 3GPAA 1MWQA 1HNXJ 1GX6A 2CPIA 2ZH4A 4WFNQ 4UT4A 2B43A 1L5UA 5L9XA 3C15A 1N32F 4USMA 1DURA 1PBAA 3I96A 4JV2A 2LVWA 3BKFA 1H0HB 2N82B 2YNGA 4ZJLA 3V6KA 1SC6A 5KFCA 1HNVB 3V4IB 2F65A 3L4BC 4NLRA 1NJWA 1YRUA 3QIPA 2I6WA 3PO5A 4F3OA 1GAOA 3VGUA 1HNWF 1JIHA 2YX1A 3CDUA 3GYXB 2BANA 1HNXF 4TU9A 2HURA 3GIIA 4CLLA 3UD4P 3NNHA 3M30A 4ED7A 3GU0A 2LDIA 2CNLB 2BKNA 2ZH5A 3R1LA 1UVLA 2LQ5A 2AD9A 3QQCD 2MZQA 2PE8A 4K7QA 2PGCA 7FDRA 3EZ5A 2QLFB 1FNOA 1ROFA 4PWUA 3Q2SC 4C8YA 1XMQJ 1IM6A 5B7WA 2D3O1 3KG0A 5KFUA 2BABA 3MEDA 1NH8A 3KHHA 2QFIA 2IYGA 2ZD1B 1VBZA 5IZHA 1WEYA 1VOMA 3GYGA 4O4RA 4DLEA 1Z2ZA 4PQAA 2ILYA 5DZ6A 1VC5A 4LMZA 2P6SA 2D74B 3DU5A 1HD0A 1YJWS 4LR9A 2KG1A 4DSFA 1OPZA 4DR6J 3I4HX 3BZQA 5HVHA 5H9EJ 4WU3A 2ZC4A 3OJUA 1XMQF 1HNIB 2H48B 2YVSA 1NBEB 1CQMA 2FY8A 1M0SA 1FA0A 2XZDB 4K4SA 2CKWA 1ULRA 3ILLA 3CGIA 1S48A 2R7UA 4OZ3A 3SCJE 1OYDA 1W2BR 2GO9A 1FRHA 4ZHRB 1IKVA 1LWFA 4P9SA 3DN9A 2FHKA 3E01B 2D69A 4EO6A 3F0NA 2XS7A 5A8KA 1U6FA 4ED1A 3FZBA 3A3OB 3TUPA 4DR6F 3CCZA 2BUNA 5CYQB 1NSPA 4U67Q 3CCJS 2VL1A 5I42A 1K47A 3ZZZA 3NGSA 1HPZA 3J81Y 4DFJA 4L76A 1FCAA 1VRQC 3MM9B 4P2FA 3KUGA 5DQIA 1SIZA 4Y00A 1DFDA 1NHVA 4HDGA 4MIBA 4GC6A 5B0FA 4ANCA 2OELA 4NMLA 1Q7YT 4B3TJ 2IA6A 1S72S 4TY9A 1RUSA 3UVJA 2JLGA 1QSYA 4D3HA 3OTBA 2J9EA 1T8EA 1KQGB 1YJVA 4OI1A 4WYWA 2KDOA 2XS2A 2BDPA 2AYMA 1VGYA 2ZH9A 1FTRA 1FTCA 2DD8S 5J2MA 3JQJA 2HQIA 2IYIA 4C6AA 4J9VA 3GILA 4RPFA 3I5BA 4C8OA 5BYSA 2KT2A 4MIAA 3M9MB 2DNQA 2EFQA 4K50A 5HP1A 4DR2J 2L9NA 4OI2A 3W2WB 2VPZB 2SXLA 4GRSA 5F8JA 4B3TF 4I7FB 2Y1JA 4FZVA 2V69A 3CCLS 1HWKA 4ZLNA 1P1LA 3NBPB 6AT1B 1WEXA 1A0OB 2MDAA 5HJXA 2MSSA 3ZZTA 1N48A 3RW7A 4WP9A 1MWYA 3W8GA 4FVCA 2L9WA 3I55S 1JXLA 5H9FK 3AQPA 4MKVA 4DR2F 3K57A 1GMVA 1PAEX 3T9NA 1EQMA 1IBKJ 4ES2A 2QG9B 5AXKA 4PEOA 3M6WA 1FD2A 3RAMA 3PO4A 1WOSA 2IAJB 4A8KA 3PRBA 2VFRA 3BGFA 4FYDA 1T95A 1RHRB 5HMWA 3DRXA 1R6VA 3NXZA 5FDLB 3EGNA 1C0TB 5F0UA 3HCXA 3IM9A 2FDNA 4Z7CA 2UU9J 5CZVA 3I0RB 1UA1A 1IBKF 1KR4A 5CHCB 1H73A 4ILRA 3W9JA 1AUDA 1IBCB 2IDEA 3NLCA 1S9EB 3KHGA 2UVRA 2IM3A 4OX9J 1VRTA 1M5OC 3HHLA 2KRRA 2WB4A 1IQTA 1GTHA 5AE1A 5HLFA 1KBRA 2LEPA 4OZLA 4KKOB 2W25A 4O23A 4X4SA 1W26A 4HEA9 2EK1A 3AXMA 4LF7J 3CD0A 3E8OA 3KG1A 3IBCB 3G82B 4W98A 2HLTA 2UU9F 2ZZTA 2VDHA 4M5NA 4ED0A 4CLTA 1DTTA 1NCLA 1XR5A 3MM7A 4XDCA 2FJDB 4ILLA 5M2PA 4IH7A 3CUNA 5CCLA 1D3WA 5GAGU 4ZK7M 2BA9A 2EC0A 4O3RA 4FXVA 2HS4A 4RW6B 4OX9F 4CO2A 4YR0A 4Z7YA 2UXCJ 3GG1A 1FXLA 1EQ0A 2Z2MA 3Q83A 1P27B 2CQPA 2DHAA 2B9YA 2XEXA 4GKJJ 1FVSA 2HGLA 3SFUA 1TKZA 1RBAA 4KV8B 4LF7F 2HNYA 3MMJA 1HW9A 1WC5A 3BYPA 1I6JA 3MEEB 4KY3A 3PCOB 4ES3A 2H5EA 1NK6A 1EP4A 3SDEA 4USJC 4GO7X 1DHMA 2FLPA 2X1GA 2UUCJ 4FNIA 2VHGA 4DQPA 3MFHA 1VQKS 3VZHA 2CPZA 2X7IA 4CH1A 1KHWA 3QLHB 4IG3A 2BM1A 1T9XA 3QWPA 2UXCF 1KLNA 1IBMJ 1ZZNA 2MQQA 3VZIA 2KRBA 4I1TA 5HVFA 1FESA 2DEJA 4GKJF 2CXEA 3TAQA 3KK2A 3M2UA 2OPQA 1UL3A 4UF4A 1VQLS 3TNVA 4LFAJ 2HQCA 2VBXA 1UAWA 2W9CA 3OLBA 3OVSA 5JJBA 2D3ZA 2UUCF 4I6AA 2P6TA 2Z2ZA 2WTFA 2M8DB 2FIUA 1S97A 2GMLA 1FK9A 2QEXS 2VJUA 3CO0P 4TQSA 3FGVA 3D6TB 2VU5A 1IBMF 5B0AA 5IQQA 4IRKA 3IWXA 3HSDA 2IPOB 4J90A 4URGA 2DGWA 1T3NA 2NLWA 5KFMA 4WIQA 5L39A 2B9XA 3O44A 3EPIA 2AKWB 2VG5B 4PUOA 2AWZA 1IKWA 1P6TA 2MLXA 1FRJA 2HNDB 1NK9A 1LQ9A 5J2PB 2AHOB 3EGWB 1R8PA 2RNEA 2VG7A 1S1WB 3MCMA 1NPPA 2V4QA 3CDBA 4LSNB 2IIHA 1Q8LA 4DSEA 4RUCA 3QIPB 2PEBA 5GMKa 4U95A 3GP9A 1SJFA 3BBFA 4OJ3A 4K4UA 4MK7A 4B3OB 3KTQA 3R2CJ 1SUQA 3M05A 4ZVQB 5KFLA 1S10A 4N56A 4P71A 1LWEB 2K06A 2RDIA 2W4PA 1WG1A 1FHTA 2Q1LA 4HACA 4HYKA 5JXSA 3J81U 5J2QA 2J9CA 4CCHA 2LEAA 5ETVA 1RHQB 1S7HA 5HJYA 1XR7A 4QU6A 1RHUB 1RWKB 5LSLA 3W3SA 1IXKA 4DV3J 4NI2B 2FC8A 4N8NA 2VA2A 4TLQA 2XI2A 3DI6B 4ZCLA 2ZNZA 5J1NA 4F26A 2W8LA 2B4UA 2YKPA 1X31C 2N7YA 2I5JA 4KGZB 1ZPWX 4OHWA 3B4MA 1WG4A 2A10A 4ZN1A 5FJ4A 1ZBTA 2K2PA 3VV2B 2XO7A 1S0VA 3DOKA 2DHXA 4C8NA 2OMLA 3QRPA 1KOHA 1SI9A 1GXTA 2L48A 4A8FA 1RTJA 3UCGA 2VQFJ 1T9UA 3A3NB 3P49B 4PRFA 2A2DA 3DFEA 2QMWA 4LRCA 3SIPB 4DV3F 2ZHBA 2B56A 5AJ3J 3M9OB 2RKIB 1U48A 1CULB 2DH8A 3PJ9A 4NLYA 5KFXA 3DDNA 1U1LA 4OV1A 2R7SA 4PZVA 3RRKA 2I38A 4U96A 3MUVP 3PXGa 2UXBJ 1SC1B 2DHHA 3QT7A 3MEKA 2XO6A 4RU9A 2GC8A 5A8KB 2VQFF 1FJ7A 2E5HA 2RH3A 3DXBA 4RW9B 1L3UA 2OPRA 4WF9Q 3OHBA
chains in the Genus database with same CATH topology
4DF8A 2AGOA 1BWEA 2RU3A 3HDSA 2ZBCA 1ZETA 3H5XA 1X4CA 1T94A 1R8CA 4DG1A 5LSOA 4FF4A 1ZM9A 4TKTA 4O3SA 4IFYB 3TA2A 4WXOA 5AJ3F 2JLEA 3K5MA 1GH8A 2DNZA 2P5VA 1D1UA 4K4ZA 4C11B 1I1GA 2ROPA 1N6QB 1D0EA 1IJEB 1HPZB 1Q82T 2OTLS 3J7YU 1XMBA 5JUMA 4DQIA 4C0BA 3VAKA 1UKUA 2VQEF 5F3ZA 4FS1A 2MQPA 1QAIA 3THTA 5IM0A 2XMWA 2B4PA 2YNHB 3DXSX 4JUZA 5K14A 4EZ9A 5CH7B 2R7QA 2Q6BA 1S6OA 2MQMA 4Q43A 3JSMB 2J6SA 4DWIA 1M5HA 1XEZA 2ZDPA 3QMQA 2XGPA 2QE5A 4YB6A 3UDCA 3KLEA 4WTYA 4NLUA 2HFZA 1UJ4A 4Y2MA 1NJIT 2W7PA 4RNOA 4Q8EA 4NX9A 4P2SA 3AAWB 2UXBF 4WKYA 2WSCC 4XO0A 2IM1A 3M9NB 1VQ4S 4M95A 4IG0B 4PR6A 2DRBA 2O5DA 4ED5A 2PMZD 3J7YI 2LMIA 2B5JA 4I68A 4H4OA 4ECUA 2HFNA 4KSEB 1SXLA 2MXYA 4UUWA 4DV6F 3Q2TC 1UFWA 3TX8A 2RMLA 1S6QA 1LKZA 3DOKB 1X0FA 2LCWA 1KRPA 3J7A1 2Y1RI 2KYZA 5KT4A 2B6AA 4NLTA 1U8SA 4A8QA 2YKMB 4Y0FA 3DLKB 2AF6A 1DQ8A 1JLEA 2VZ9A 3SSRA 4QW8A 2XY5A 1RTJB 4CIOA 4J5OA 3SSQA 3OUYA 1PILA 2E66A 2OAUA 4QW9A 1RT4B 3K58A 3GSDA 2W4DA 4IDKB 2HHXA 3KLIB 2QIFA 2DVIA 5C25B 1HBMA 1HWLA 1O8BA 3DRYA 3FDSA 4CTAB 5KT3A 3FEZA 3FEYB 2ROGA 4LIRA 5L38A 1JX4A 2XI3A 3QWUA 2NPFA 3K59A 5CZXA 5J2MB 3OL6A 3H4DA 1JLBA 1S0OA 3GQCA 4DR1F 3PW4A 4DL3A 5K8MA 2KHCA 4ZPAA 1Q78A 4DR3F 4Q2LA 2LU2A 1VBYA 1KFDA 5E33A 4NA1A 3PIOQ 4NLGA 3FCHA 3IO1A 5A6PA 4RNFA 1IM4A 2VFVA 2J7WA 1VQ7S 3K2YA 3R1HA 3IR7B 1Q81T 5B0DA 3ENVA 1N5TA 3I0SA 1GXUA 4PG8A 3IBWA 1QVGR 5KT2A 3H2VE 2QV6A 1U09A 2CZ4A 1F9FA 4B17A 3IWLA 3N5BA 1TK0A 1P8GA 1Q1KA 2AX1A 4KO0A 3R5CA 2HMIA 4DQSA 1C0UA 1VQSA 3OFEA 4Z37A 5K9FA 3VALA 2X1FA 3PX4A 1D9AA 3CCVS 2KZMA 4UQGA 3IGVA 4AYBD 3CCWA 1R3NA 3MCSA 5F9LA 1FD8A 3TAPA 1RT5A 5E3AA 3VR1A 2QA1A 1S79A 2FJXA 1KVJA 2ASLA 2XLJA 3CJKA 2JEIA 2WAQD 4KB7A 3HF5A 1U1PA 3CD6S 1S1UA 5CQGA 3TAMA 3V2UC 5KT6A 2A18A 3POTB 2DPIA 3P6YC 2HGNA 2J7UA 3TUJC 1K8AT 3MI7X 2B0GA 3QAUA 3N28A 2YKOA 4H4MA 4ZP7A 4QWCA 2JEJA 2D9OA 1C1BA 3HFKA 2GCFA 2PSZA 4FP9A 2KTQA 4XK8C 2FVRA 3F44A 5B0GA 2OPRB 3WC0A 2G9OA 1LWCB 2IM0A 3L7PA 4TY8A 4F4XA 3M2RB 5C24A 4W90B 2J9DE 3W7BA 1E6YA 4X4UA 4CO5A 4ZVHA 3OTOF 3J7ZT 3VAGA 3DGPA 3O2IA 1Y00A 5KFRA 4CNZA 5EHHA 3MMAA 4QR0A 3PR5B 3BGLA 4UUXA 4X4PA 5KFGA 4QPTA 1V3RA 2AJFE 1Q8BA 4XDDA 4AQYF 2BV3A 4MTPA 5KFYA 2VFUA 3MAQA 3DMJA 2V5HG 4JOUA 1QAYA 3IA0A 4DFMA 4ED6A 2B4OA 5ITHA 1DRZA 2GMHA 1S99A 1JLCA 1JK9B 2CQ4A 3RBDA 1NK4A 4DL5A 1YGYA 3NS5A 4NLQA 5IM0B 1HHTP 1HYSA 2M7SA 3MAHA 4CO1A 1VQ5S 4N47A 3HHDA 3QGIA 1TK5A 1FE4A 1FRMA 3R5DA 2CJQA 4Y2AA 3H8YA 5E7OB 2F4VF 1M90T 3TI0A 2HRYA 4Q0BA 2CQ0A 2AJ4A 3NL0A 2GIRA 1WEZA 2YWKA 4ZCIA 3PKYA 2MYFA 3BN4A 4R0JA 1LK5A 2C3PA 2B5JB 3L3CA 3THPA 4PG6A 4H4OB 4UY85 4KBIA 2ZD1A 4ECWA 4JI3F 2GV1A 1URNA 2QMXA 3QZ8A 2J8AA 2O66A 1YJNS 2V8GA 2V8VA 1SKWA 4KJIA 2LDYA 1GXLA 3EZUA 2VBZA 1JLQA 2CQ3A 3BO3A 1FRLA 4IKAA 1XTZA 2B6AB 5MLCV 1RKIA 3PZPA 3QPIA 3CIZA 2GFFA 4NRUA 1NKCA 1RT2A 1VHFA 2PI4A 1JLEB 3CJ2A 5DJBA 3S8SA 3AB4B 3OUYB 1FKPA 2G4BA 3LALA 1JLGA 3UQSA 2M5YA 1DBDA 3HX9A 2HWIA 3GZ7A 3ENWA 1RT6B 1N4LA 2RT3A 3HKWA 5IQ6A 2DGOA 2OFHX 2E44A 2IVMA 2ZZNA 1K1SA 3I6PA 3OPKA 1ZH5A 3PW2A 1C4AA 2ZNYA 3HM9A 3FRYA 3D2WA 1O51A 4NLVA 4WXWA 1RA6A 3T19A 3NRBA 5KFZA 1FERA 4I64A 3S6EA 2P9GA 4A8XA 5I3PA 5LJ5Y 2VASA 1B64A 4QPXA 1HMVA 3BGRA 2IRUA 1HNIA 4ICLA 4NA2A 3I0SB 2KVIA 4Q7AA 4ZP8A 3WDOA 3DLBA 3FSIA 2BJEA 2I0XA 4I4BA 1X4AA 1BGXT 1NKBA 4M8LA 3Q24A 3OXFA 1WTFA 4F67A 1N0UA 4QIEA 3T3FA 1Y5NB 2XSJA 1RT1A 3P5TL 3G86A 3K5OA 2FVQA 2CQGA 4KO0B 2HMIB 1TFWA 4JV5F 2ZVSA 2DB1A 4LF4F 1NHUA 1TV6A 3A1YG 2DNLA 1TQLA 2L3MA 3N0VA 1KNZA 1WHVA 2VPYB 3GFZA 3U27A 1QAXA 2HG4A 3KHLA 4QIWD 3KJVA 1K1QA 1XK8A 4WU2A 2R2SA 3MOJB 2HGMA 5LXRA 4LQ9A 3CJKB 2KYXA 1R27B 1L3SA 2BBEA 1S1UB 3TAMB 2XULA 4JBCA 2YWGA 3ZZPA 3PR4A 3E01A 4HT5A 3V5RA 3WC2A 1NKEA 1SBRA 2DGSA 1NZAA 1KTQA 3LP2A 4PWDA 3GYNA 3PV8A 1SB6A 2UVWA 1C1BB 3KG4A 1TP7A 5DS7A 4ZA1A 2F8MA 2VBWA 2YX4A 5GVQA 5J2NA 5D4NA 2EPIA 2CJBA 3IC1A 4TY8B 3EGZA 3NMAA 2XWXA 2B9WA 5C24B 1DQAA 2JH3A 3BDEA 1S49A 2DRAA 1E6YB 3PM9A 1Y0HA 1F5AA 3N5FA 4WFAQ 1VC6A 2CJ9A 2CG4A 2GIQA 3HHNB 3CCUS 2ABYA 3LPYA 3ZC4A 2QA4G 2K7JA 3MMAB 4PXEA 4HH1A 5L1LA 4OI0A 1HBOA 3MM7B 5T41A 2HYIB 5K8NA 3OJSA 4O4GA 4A4JA 3UCZP 4G1QA 1MMLA 2PIIA 3IN5A 5LMUF 2E1CA 3DMJB 2NSCA 3DLEA 4NWBA 3MPYA 4OZ0A 4UQTA 4ZP9A 2CJKA 2VC1A 4Q8FA 1JLCB 3OTEA 1U7LA 1NEEA 2DR8A 3V81A 1VRUA 1FJEB 4ZKAA 1HYSB 2ZJPQ 2BE2A 1VS3A 1E6VB 4X65F 1Q16B 4Q0BB 2OKQA 3SFGA 1NK7A 2UXDF 1TAQA 2FUG9 1RWUA 2N4DA 1BQNA 1Y5LB 2APOA 1UEUA 2E7XA 4KHRA 4C4WA 1NRKA 1ZAVA 2CDQA 3C46A 1K73T 1HNZF 1KD1T 5KAKA 3M2VB 2Z2LA 2F8HA 5IS2A 1AFJA 4J9SA 2VUGA 1X4BA 4ZCKA 2YKNA 2WHOA 4MAKA 3BSOA 3CJ3A 2KU7A 5CD4H 2PI5A 4W92B 3G6VA 2R7OA 1UETA 1TL5A 2GNKA 2BZ2A 4ECRA 1F5CA 1JLQB 3ITHA 3HVWA 4AXIA 3Q0AA 2O1PA 1U1RA 5EX0A 4Y28C 4KHPF 1FE0A 2NZ4A 3OR1A 1RT2B 4IOCQ 3PW0A 3T1YF 1GTEA 2EFNA 4QJVA 1HW8A 1LK7A 3IS9A 3BSNA 1FRKA 2ZHAA 5I3UA 2YQ3A 3N9UC 4C3KA 1FEHA 1VQMS 1FKPB 3CCRS 4V19J 2BRLA 4OZ1A 3RW6A 4A48A 1JLGB 4A8MP 1CVJA 5HO4A 3GFYA 2GMJA 2UV8G 2ZHOA 4IQXA 4QU7A 4Y6IA 1UVKA 2JLFA 2E5IA 1V9OA 1NJZA 2W4CA 4ZVGA 1LXJA 5KFNA 3GIKA 2AJ1A 1H38A 4QWBA 1QUVA 2R8HA 5M2RA 1F60B 4AL5A 3KNGA 4NA3A 2PT0A 5C42A 3HHKA 1SJ4P 2PC6A 3RBEA 3PIPQ 3PFOA 2IRYA 3IWNC 5DG7A 4IR9A 2R4FA 4AL6A 2YH1A 2JHEA 3SV3A 3DRPA 4WYLA 3TW0A 5DQGA 2MQNA 3BGRB 3I56S 3FSXA 4ICLB 4C3LA 3VF0B 1WF2A 2WBMA 2OP5A 4OJ1A 2DNGA 5KG2A 4ZCMA 2KT5A 4FBUA 2XSJB 2XMMA 1RT1B 2B7BB 2RRBA 5A8RA 3Q23A 3H25A 3ONQA 4J9QA 1G2EA 1UVMA 1ELOA 1MROA 1X5OA 3K7RA 2O01C 5IFMA 2XWYA 2DNHA 2V0NA 2XNQA 4CO4A 3KHRA 4ED2A 4C9DA 4U9RA 3I9ZA 4FVMA 5KOXA 4IOBA 4BC7A 5KFHA 3KJVB 5L8RC 4WIIA 1TFYA 3H40A 4OLPA 3H20A 3CB4A 3KFWX 3SSSA 2GHVC 2DR7A 1R7IA 3L95X 1LOUA 3HZEA 3NBPA 1WI8A 2WRMA 4QWDA 4B9VA 1HFEL 3LP2B 4PWDB 2QZ8A 2QSWA 5KFJA 5J2NB 4Q45A 2ERRA 2DHSA 1VK8A 1OPIA 3F56A 3DNCA 3MECA 3CULA 1LW2A 2LU1A 2JJ4D 2CPDA 4Q44A 2UVUA 2KXFA 4DS4A 1FDAA 1TKXA 2YNFA 1HBUA 4XPCA 4NCAA 3VAFA 4I67A 2FTRA 5KFPA 1HI1A 3RU0A 3TA1A 5DDOC 2V4RA 1KQFB 2NUUG 5HBMA 1FF2A 2E1AA 5HMXA 1HBNA 4FXWA 4NLXA 4OQJA 1HBOB 4X2BA 2JC1A 1A6LA 2FY1A 5GAHU 3UDLA 1X9SA 1KN6A 1SH3A 1XWLA 4G1QB 5SZTA 4MK8A 4B3RF 3DLEB 4MKBA 2GJIA 1RAJA 3SI8A 2YH0A 3S01A 1FRIA 3LUYA 3V81B 2XBPA 1VRUB 4OFZA 5DGAA 2Y1IA 3T5JA 1VQPS 1Y9OA 1MWZA 4OL8A 2DO4A 1Y4ZB 2DT9A 1T03A 1M5PC 2ADCA 1JWWA 5IWAF 1G7CB 5DDPC 2HHSA 2V4JA 1SL2A 1Q53A 1SH2A 3MPWA 4HDHA 4J9KA 1B7FA 1HA1A 1BQNB 1SJQA 5GAHI 2DGQA 2FLLA 4ALZA 4C0HA 4WKRA 2J9DA 5I3QA 1IKWB 2C28A 3PEJA 4AFFA 2YWFA 1W25A 3KK1A 1N8RT 3M6VA 4QR2A 1NB7A 4WFXA 4JI5F 2YKNB 2FHJD 1KOOA 4TN2A 5KFVA 2J5AA 2HWTA 1ZTWA 1U1NA 1YI2S 3LWLA 3IAM9 1G3OA 2FC9A 2NS1B 4O44A 2W24A 3JTPA 3CD5A 1JJHA 4O3NA 2CRLA 2KHDA 2HHQA 2CPJA 2MY8A 4HVZA 3DLHA 1QE1A 1KFSA 3IS9B 4K59A 4ZP6A 2EFVA 5I3UB 3CC4S 3VQTA 1HWJA 2MHNA 3CJ0A 2RQMA 2DNOA 3NGKA 3G9CA 2ACYA 2CPHA 1S1XA 1XNRF 1HHSA 4OZJA 2ATLA 4CO0A 2XGQA 3PEHA 2LECA 1IKYA 1BQMB 4JV1A 4ZDNA 5AE2A 1S77D 2YNIA 4DR7F 2FJBB 5A8WA 2AYGA 2ROEA 4JI4F 1UFLA 5FDLA 1YJRA 1UP1A 1CSJA 1LW0A 2GGPA 2ZH3A 1HR0F 1WI6A 4OJGA 3TYTA 3BB5A 1FVQA 1R43A 2GHWA 3UR3C 4YR3A 3FZ2A 1MMNA 2ZUGA 3H5UA 5E2QA 2VC0A 4CH0S 2R8GA 1IR0A 5BJRA 2KM8C 3DRPB 4PKDB 4ZPTR 1FKAF 2EFOA 3Q22A 3DRRA 4KC5A 3U1NA 4CZCA 4NOHA 4AL7A 2R2UA 1SV5A 1Z2LA 2CQDA 3I5AA 4LF6F 3OTCA 4A47A 3THVA 2KN4A 2CQIA 2LEBA 1QLNA 3UI3A 1S76D 1X9WA 4JI2F 1DAXA 3V6DA 1RT3A 5A8RB 2VONA 3NCPA 5A0YA 1JB0C 3BO4A 4RNMA 3MF5A 1MROB 2W8KA 5L1IA 1X4HA 3TUIC 1VQ9S 4TXSA 1W2IA 4O3OA 5B0EA 2K7KA 1PO6A 2W9AA 2M2BA 2EFGA 4KFBB 1U1MA 5J2QB 1QSSA 3T5HA 2KFZA 2ASDA 1REVA 2JZ5A 1U4BA 2XMJA 1YJUA 3V6HA 2BM0A 4X64F 4X4RA 2IMWP 4ZPWR 3R5AA 1VJWA 2XSFA 3KLGB 4PPDA 1EETA 2RU9A 2HIQA 3UCUP 2F7VA 2Y0SD 2ZKTA 3CO9A 3ZZRA 1TR0A 4F50A 4RNHA 1IN0A 2J0WA 3MM8A 3IG1A 4IFVB 4F4ZA 3MECB 4DHVA 5E0OA 3RR8A 1FJGF 1LW2B 4OI6A 2IA0A 3O3LA 1ZOTA 4U7UK 3HVAA 4H4KA 1Z1ZA 2YNFB 2CPEA 1V6HA 4DPOA 3EXYA 2OTJS 3GR0A 5IT9Y 3K8WA 3CCSS 5HBMB 2J76E 5H9FJ 1RTHA 2FGCA 1G6BA 2GA7A 3H2LA 5KFIA 1HBNB 3GG0A 4DV2F 4CH7A 3M8QA 3LH2S 4TLRA 4PPZA 3N6MA 4DL0C 4RBUA 4EBEA 4EFAC 4DL2A 3MUMP