3S1TA

Structure of the regulatory domain of aspartokinase (rv3709c; ak-beta) in complex with threonine from mycobacterium tuberculosis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
158
structure length
158
Chain Sequence
DPILTGVAHDRSEAKVTIVGLPDIPGYAAKVFRAVADADVNIDMVLQNVSKVEDGKTDITFTCSRDVGPAAVEKLDSLRNEIGFSQLLYDDHIGKVSLIGAGMRSHPGVTATFCEALAAVGVNIELISTSEIRISVLCRDTELDKAVVALHEAFGLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Aspartokinase
publication title High-resolution X-ray structure of the regulatory domain of the mycobacterial aspartokinase in complex with threonine
rcsb
source organism Mycobacterium tuberculosis
total genus 40
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature ec 2.7.2.4: Aspartate kinase.
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01842 ACT ACT domain
A PF13840 ACT_7 ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3s1tA02
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3s1tA01
1UJ5A 2QMWA 1M0SA 2QMXA 3TUZC 3OFHA 3DHXA 1RWUA 3O1LA 1Y7PA 2J0XA 2P9EA 3IBWA 4GMKA 2JOQA 2J0WA 3NRBA 3ENVA 3OBIA 4IO1A 4NMLA 3UW1A 3HHEA 2LVWA 3AB2B 3ENWA 4GO5X 1KS2A 2FGCA 4GO7X 3MAHA 1UJ6A 1U8SA 2ZHOA 3TUIC 5FIIA 3N0VA 5IT4A 4M8LA 1UJ4A 3ENQA 3OFFA 1ZPVA 1PSDA 4PWUA 2QSWA 1SC6A 5T41A 5IT0A 5JJBA 2QRRA 3DDNA 5IS2A 2P9GA 4X84A 2JHEA 2CDQA 1XTZA 2DT9A 2H9ZA 3DHWC 2KO1A 3CEDA 1LK5A 2RQMA 2P9CA 2I9SA 3MTJA 2NYIA 2RE1A 2F1FA 3L7OA 3P96A 3LUYA 1YBAA 3TUJC 3AAWB 2MDAA 1LK7A 3OFEA 3DC2A 3MWBA 2LQJA 3IXQA 3S1TA 3AB4B 1O8BA 4LUBA 1LKZA 3W7BA 3KWMA 2DTJA 3LOUA 1YGYA 2PA3A 2F8MA 3K5PA 3OFGA 2RQKA 3U7JA 2PC6A
chains in the Genus database with same CATH superfamily
3CW2C 2HW3A 4C8OA 4F02A 2YKNB 1UWAA 1OJ4A 4JOUA 1T3NA 5B09A 1P8GA 3LPYA 4RBVA 4WWSA 1UVNA 1Q0NA 4Y2AA 4BWJA 2AX0A 3ENVA 5E3AA 4B08A 3W62A 2WVEA 1HHTP 3OVSA 5T7LA 4IKAA 4YP3A 4K5RA 4B3TF 1WG5A 3AD8C 4ER8A 5JMNA 4AQYJ 2XMUA 3ZTRA 4HHHA 2RS8A 2Y1JA 4M5KA 2CJ9A 4OYXA 1Y3JA 4Y28C 3H5UA 4L6V3 2LQ5A 1RT5A 1LWEA 2UUTA 3G6ES 2FGOA 1WHWA 3I0SA 4ZP7A 1IQTA 3M6WA 2RU9A 2FB0A 2HFSA 3MM6B 1RAJA 4HH1A 1J5OB 2P9CA 1N0UA 1SL1A 2E5IA 4NA1A 4Q7AA 1R8AA 5KG0A 3IP0A 2W2QP 2DNYA 1HWIA 2XZTB 1HWLA 4AL7A 5KFUA 5LXRA 2VH7A 2BZ2A 1S1VA 1RSCA 1V9OA 3VCDA 1ZA2B 4NA2A 3J80U 4X62F 2V2QA 5G0RA 5K8OA 2RHQB 4KV8B 4DR3J 1MNEA 3MM9B 3ZZPA 2VC1A 4OYAA 2HAFA 3I55S 3TJ8A 4J9UE 1FRXA 3G8QA 3DRYA 1U6FA 5F8NA 4K4TA 2BRLA 3H8YA 1Q79A 1HNVA 3AFGA 2QX0A 3VZHA 2WB4A 5E3CA 4X4RA 4IR1A 2B9WA 2AX1A 2Z57B 2OO4A 3NNAA 3IFEA 3UE2A 4IYQA 4DG1A 2L48A 1JXVA 1U0HA 2JNJA 4DZ6A 3R27A 3Q8UA 4UQGA 2ZDPA 2ZD1B 4NCBA 2UUBF 1JLGB 5L1KA 4DUZF 4PQUB 2XGPA 1LW2A 1N33F 3DI6B 3KLIA 3FRYA 4DR7J 1SC1B 4MT1A 4F7VA 3LOUA 3UWTA 4YDDB 4ZCMA 4ZITA 5A8WB 3TNVA 1ZS6A 2EFGA 3HULA 1QAXA 3NNCA 2ZFHA 1W2IA 3HT3A 3BYRA 2DNRA 5IQ6A 3ILJA 4J9OA 5C2CA 1IVZA 3MM8B 4K50A 2HKEA 4CH7A 4A8XA 1CJTA 1N32F 2QIFA 1Q7LB 1CS4B 1IKXA 5L38A 2ZKTA 1PBUA 4L74A 4DV1F 5KT6A 3QO9A 3NMRA 2F9DA 3MAHA 3CJKB 1NAQA 2ROGA 2AJFE 4LR9A 4JI0F 1WC5A 4PWDB 1BWEA 2XC9A 2OPRB 2HNZB 4OYWA 4X66F 2CPXA 4FYVB 5IS2A 5F8HA 4X84A 4N8NA 4KGZB 4JV5J 3QQCD 2QMUB 4PG4A 3T9NA 5DG9A 3RBEA 3G4SS 1KHWA 3OFEA 4MTPA 3OTOF 1SL2A 4UZCA 3F41A 1FDNA 1FA0A 5IZHA 3ETMA 2CQBA 2I0XA 2JJ4D 4F25A 4J37A 2J0SD 3GR0A 1VR6A 1RAHB 3H5YA 2HHSA 4KO0A 3M2VA 3BS9A 4P74A 2ACMA 4CO5A 1YHQS 4DV5J 2C2EA 4ID5A 2AJ0A 3O2IA 2CWXA 4JV0A 3DLEB 3GB0A 5BYRA 3CNQP 1UAWA 1UP1A 4RBUA 3KLFA 2ZE2A 2ZUGA 4MJKA 1J5EJ 2ASJA 1F3VA 3NAHA 1SJ1A 2OKQA 2BKNA 1YQHA 1YRXA 4URSA 1YJRA 1JLFA 4OQJA 1AYEA 4RNMA 3BSNA 4NWBA 2WVDA 2VUGA 2Z2LA 2X3GA 2B7CB 5T7LB 1FE0A 5K5MA 1QDUB 5KG1A 2ZH1A 2XI2A 1NK6A 4CCHA 2HHXA 1WC4A 4ECUA 5E3QA 2FC8A 2QN6B 4ZJQA 4CLYA 3FEXB 5HJYA 4YB7A 5HMZA 1RT5B 2AKWB 1LWEB 5A2QU 3I0SB 2DRAA 4ZIWA 1ZOTA 1VQ7S 4NLQA 2X1GA 1SL0A 2QLFB 4USWA 2YH1A 5KFVA 1YI2S 2BJ1A 1ZZNA 2OGUA 4JI3F 3UFCX 4F67A 4ZCIA 2F65A 4A46A 4F0HA 3IMQJ 3ZNUA 3LAMA 5F8IA 1S1VB 2H4YB 5HLFA 2ZH4A 1TTHB 2QA2A 4EWTA 1S10A 3D2WA 3CCES 3PIPQ 3BSOA 4EI2A 2FD2A 1W26A 2HRUA 5G0RB 2G13A 1SPBP 4KRWA 1RU1A 5C24A 2DHAA 1YZ7A 3I0RA 4C98A 3TI0A 2E5LJ 3PTWA 4QZVB 2HIQA 3BEGB 2PDAA 1NH7A 2KRRA 3UCUP 3VGSA 2AT1B 2HQIA 1RKIA 1VYAA 4LF5F 3LP1A 2LFVA 3M7VA 4ILLA 4P75A 1HNVB 4HVZA 3W9HA 2QL9B 2V5HG 3DU6A 2YX4A 3A8KA 1SI9A 2QEXS 5EX3A 3CCWA 2ZOGA 4PYAA 1VCTA 3DGPA 4OYZA 4LF1A 3W2VA 4FNIA 3H5SA 2J7KA 3CVKA 3LA0A 4DG1B 2MB0B 2J0XA 3IO1A 1EARA 4YQWA 1U0HB 1TUVA 3MCSA 2ZHBA 1S7HA 4HDHA 1K73T 2ZH2A 1LW2B 3R1HA 3KLIB 2M70A 4EZ9A 1JJ2R 3R5CA 2BJ3A 2PEHA 3K8WA 4UUXA 3VGUA 3KG1A 2HGMA 1T02A 3PJXA 1CJTB 3HK2A 1IKXB 2E66A 1KQSR 2IJFA 3OXGA 4ZPVR 4B9SA 1KOOA 3FSIA 3JAMU 1YTYA 4NOHA 2NLWA 3IA0A 4F4WA 1NK7A 1X60A 1HBNA 2OEKA 3QO9B 2C2ZB 4RNFA 1MWZA 1DLOA 3HDSA 4NZ7A 2IA6A 2GIQA 3BPSP 3BBFA 1KHVA 1HLWA 3CJ0A 4KKOA 1CBKA 1X5OA 4PXDA 1VLOA 3GIJA 3G6YA 3PRVA 3TOQA 3NOGA 2O66A 4K2JA 1SC3B 2CUYA 3ZZYA 2ACYA 1RT3A 3MUMP 2PFDA 3CD0A 3AH6A 2LDYA 4E8UA 4R8UA 3E01A 4F26A 1S6OA 1I94F 3A3NB 3WX4A 2N7YA 2DHSA 3QYYA 1Q16B 4EBDA 2IY5B 4DI6A 1YKWA 3HFKA 1NDKA 4FF1A 5DETA 2CYYA 1FERA 1H7XA 5IT9U 4KO0B 3M2VB 2FHKA 1WD6A 1M5KC 1NJIT 1RE1B 4ID5B 4M5MA 1N56A 2EI5A 5K14A 3TJ9A 3VHQA 1DY3A 5K8NA 1HIYA 1LWXA 2E29A 1Y0HA 3GJQB 3KLFB 2ZE2B 4DV6F 2V34A 2D9OA 1KVJA 2XG8A 1S12A 2LCWA 4O0NA 1JLFB 1RHMB 4FNHA 3U7JA 1FJEB 1KRPA 2QMXA 1KR4A 2FVCA 2Z4PA 3VAGA 4WP9A 1RI7A 5KFLA 3CCSS 1OQ6A 4FKYA 5KFHA 1SJRA 3SCIE 3LWLA 3B4MA 4CH1A 1X4FA 3TR5A 4U8YA 2B4OA 1KVKA 2DXFA 1RHQB 5HSPA 2UXDJ 5HI7A 3AQPA 4URQU 3PHEA 4LF7F 1FRLA 3FUYA 4I69A 4B17A 1U0SA 4IRKA 1U6ZA 2VDIA 1HPZA 1FCAA 3R7BB 2OHDA 2LU2A 2DHGA 1DURA 5HLFB 4CRJA 1GMVA 2HHWA 2ZVIA 2EFQA 1YBAA 4DS5A 1ICEB 4DL2A 3CWJA 2EXUA 1OY6A 2HFNA 3TQEA 2A6OA 5C24B 3I0RB 2CAJA 2KHCA 5J1EA 4DR1J 3PIOQ 3CT9A 4H4OA 2ATLA 4W90B 5J2MA 3LP1B 4Z7CA 4IRDA 2ALZA 1LWFA 3H0PA 4IOCQ 2DRDA 4KGMA 3DGPB 1QTNB 4IG3A 3ISNC 1ZAXA 2HS4A 2WOMA 2XYHB 1BQNA 3MURP 3W2VB 5D4OA 2ZHOA 1X5PA 4AD6A 5CH7B 1V5IB 2RS2A 3TX0A 3TZWA 2BW2A 1Y9OA 4OI0A 4HKQA 2E1PA 4KPCA 3NCPA 3NS5A 1RYRA 1FF2A 3M4XA 4F2RA 2CJKA 3MD1A 2MKYA 3LUYA 3OSPA 3MR6A 4CT8A 3J7Z5 4RO0A 5DDRC 2RRNA 1SJFA 2PA3A 5HMYA 1EKSA 3PYDA 1HNWF 2GX8A 3LP2A 2ADBA 2C1EB 4J9RA 2LXFA 3SFUA 1ZM9A 4LSZB 2CDRB 4LREA 4TYAA 5EWGA 2CKWA 3MR7A 1HNZJ 3UNGC 2KVQE 2HWHA 3TAQA 1HBNB 2C3PA 1YRUA 1K1SA 3R9LA 4LR8A 1DLOB 4KKOB 3GJTB 4JYAF 2VQEJ 3QIPA 4JI6F 1RWKB 1RZMA 3I56S 2ZJQQ 2QFIA 1F5AA 2UXBJ 4UY85 4HI2A 1N54B 1SBRA 3EZ5A 4ED8A 2Z2ZA 1WF2A 1RT3B 1DQ8A 4JI5J 5KFJA 1ZPVA 4FVCA 1FXRA 2CQCA 1NO8A 2MQOA 2JFKA 3DXSX 1NCLA 2DNZA 5HQLA 4R8UB 3AD7C 3E01B 2H5EA 3T1YJ 1RA7A 1EP4A 3W7BA 2W9AA 2CPHA 4A8YA 2DR8A 2AYMA 3GYGA 1FDDA 1GTEA 2M9KA 1NB7A 5E2QA 5K14B 4DV3F 1OS5A 3UCZP 4ZVGA 3L09A 1XQIA 3DGVA 4NYZA 5AE2A 2CRLA 2CZ4A 2Y0SD 2FJXA 4GKJJ 1QY7A 1K47A 2YKOA 3SV4A 1W2BR 1MWQA 1FFWB 1SJQA 2J5AA 2WBMA 3WBZA 3KXDA 1X9SA 2HGNA 4K0KF 2Z0GA 3MCMA 3R6GB 3PR4A 4I67A 1D8ZA 4DZDA 3BO3A 4HT5A 1VQMS 4BC9A 4LBPA 5KT3A 3JSYA 1VBZA 1N5YA 2GJFA 5DDOC 2F5GA 4QIVA 3FBCA 2XMKA 3L7OA 5KAKA 5J2PA 4ZPBA 4A8WA 4KGXB 3S1TA 1IUJA 3FBFA 4C8LA 1HPZB 3MM5A 8RUCA 1FJGF 1SIWB 5KFSA 1DRZA 1GX5A 1HQ2A 3HVWA 1NJWA 4OJGA 2PA8D 1EAYC 5LXYA 2R2TA 2KN4A 4O4RA 2R4FA 4QYZJ 3I4PA 2M7SA 2CQ4A 3LQVA 3VVTA 2D3O1 4DSEA 4MYUA 1NJYA 2MSSA 4KIAA 2RILA 1L3KA 9RUBA 5J1EB 3UR3C 4DV2F 3C6TA 5IC6B 3Q8SB 3BBBA 2EK1A 4H4OB 4QIEA 1WHXA 2DO4A 2UUBJ 4DUZJ 5J2MB 3KTQA 1N33J 3MAQA 3NWGA 4F4AA 1LWFB 2UVRA 3CE8A 2DRBA 2MY8A 2KO1A 1LK5A 3I96A 4IG3B 3EGZA 2XYGB 4R0EA 2WOMB 1BQNB 4FN5A 4Y65A 2CFXA 2RUSA 4NLSA 2MDAA 1LK7A 3QGIA 2NYHA 3CJ4A 2WSCC 1JNRB 3IWNC 2MEWA 5HL7Q 3PFOA 1HNXJ 1RU2A 1D9DA 2MHEA 3KMSA 2HVZA 1XR7A 1BE4A 5D4PA 3ZZZA 4RUBA 1T3OA 1LOUA 3QT7A 3LANA 5CD4H 1H6KX 3N4WA 1EX8A 4A8KA 2W7AA 2IRXA 2CQ3A 2UZAA 4Y0FA 1FNOA 4C6AA 5FLXY 1BMQB 3LP2B 2Q6CA 3BZQA 5FIIA 1IBLF 3SXLA 4J9QA 1S9EA 4FP9A 4EBEA 4P52A 1WKKA 4IFYA 2DNQA 4USKA 3US5A 3QIPB 3BR9A 2NXCA 1P27B 1OY8A 1F9EB 1PC5A 4QPTA 3Q8PB 2IVFB 3EZOA 1X4CA 5JXSA 1SVDA 2GS8A 2PC6A 3TVYA 3MPWA 3OFHA 1IKVA 3F44A 2V9KA 3HVRA 5DDPC 5KFAA 1QSSA 2GFFA 2HAIA 3VF0B 3GYXB 1FKPA 4ZJOA 1VI7A 4ED1A 2FHOB 2F63A 2BQ3A 1HNIA 1G1XA 1EP4B 1NDPA 4OHWA 2O3DA 4ELUA 4K4UA 1XEZA 3RR8A 4OHVA 3GV8B 1KQFB 2HFVA 3JTPA 2G9OA 4CM0A 4E98A 4QWDA 3PNIA 1B0TA 3D1OA 1KNZA 3VGVA 2GVDB 4C0BA 5KFDA 2IA0A 4M5DA 4U8VA 3EICA 1RYSA 1DAXA 3DXBA 3ILOA 2A18A 1SCJB 3GCXP 2Y9HA 5D15A 5H9FK 4CI0B 4I2QA 3MUVP 2LECA 3RRGA 3B78A 4LF6F 3J7A1 2HVIA 3GLJA 4ES3A 5ADZA 1TP7A 5K8PA 2Z2YB 5KFCA 5EGYA 5DLFA 4OI3A 3W63A 4DWIA 1U45A 4WIIA 2ZH6A 2NSCA 1N5YB 3SQOP 1WKLA 1VQ6S 3GFZA 4C7QA 1JIHA 1EKRA 3QSIA 3ZTOA 4LMZA 4DCJB 2K2PA 5J2PB 5E3PA 5U47A 3FSXA 1FWLA 2MLZA 2DITA 4CT9A 2W9BA 4CLLA 1TMJA 3MM5B 3HFZB 4A8FA 5AXLA 2FLLA 1UFLA 3MZIA 4CLUA 4NLDA 1PCAA 1RLCL 3MD3A 1SH3A 3V6HA 4ZIVA 5E33A 4DR5F 2VOOA 2CDQA 3ISZA 2NPIA 1U49A 2ZH5A 4LQ3A 1RBOB 3KDNA 4CLKA 4DOZA 4P2SA 3UDLA 2C3MA 5D78A 1JMTA 3AAWB 1T9TA 1UPMB 3C6TB 3O3LA 1WUUA 1HW8A 1U2CA 4CLSA 1VK8A 2HFUA 4BLGA 5LM7E 5CAAA 2BW7A 3M1VA 5F9LA 5KG5A 3IRWP 1XJWB 3W5YA 3IAM9 3PEJA 2M3DA 3RRHA 1Q86T 3OTCA 2H51B 3OXLA 1DTQA 3OVBA 2V63A 1S99A 5IC4B 2QLJB 1KOHA 1F3FA 4NZ6A 2ZOFA 3PVXA 1GFWB 5E0OA 4KHPF 1D8YA 1NJZA 2W2NP 1EQ0A 2EWHA 2ZVSA 4RU9A 4ZA1A 5AJ3F 4LBHA 4EUVA 3GTYX 4C97A 5FJ4A 2NCKL 4HHUA 2DVIA 3BSCA 1FWKA 1GQEA 3OFFA 3M8ZA 4N56A 1VGYA 3KK2A 2ZC4A 1XBWA 1CJVA 2V8VA 3FZBA 2VICA 3VAKA 4FYYB 1X4EA 7FD1A 4QOTA 4DU7A 2MSTA 2ALYB 4DL3A 4MKBA 2C2MB 2LP4A 2KFYA 3KWMA 3GJSB 1IBKJ 2V2VA 4I1TA 1FVSA 1G4CA 4QWBA 2M5YA 4USUA 1UW9A 1S9EB 1KBRA 1K44A 2MQPA 4IFYB 3IM9A 2V8GA 3CUNA 1I94J 5A76A 2YH0A 2Q79A 2OP5A 1Y5NB 2Z8QA 1P9YA 2B8PA 3PW5A 2VBWA 4ZPWR 2J9CA 1RUSA 2CQDA 2V4JA 2DGXA 3KUEA 5GAGU 5KFGA 1DQAA 4LFCF 2OLWA 1FK9A 2XMWA 1IKVB 1YITS 1GK8A 3GQCA 2WZ1A 4NXNJ 2W2MP 2DCLA 3SCJE 4DR2F 4NLTA 4MAKA 2GW8A 3GCWP 1FKPB 1QTMA 4DXLA 2BJ7A 1HNIB 4UTGA 1MU2A 1EQMA 2WB1D 5AXNA 4HYKA 2I9SA 3HO1A 2FLOA 1FI4A 4WIQA 2XQCA 3UVJA 3DFEA 4KT0C 2KJWA 4DBQA 5SZTA 4ZMMA 2P5VA 3DLGA 5CYQA 1XMOF 1UEVA 2HLTA 4M5DB 2W01A 4CP5A 4WP8A 4JI7F 1WOPA 1WC0A 2MZJA 2K1RA 1T03A 1UVLA 4KSEB 4I2QB 3DYAA 4WZQA 2XNRA 4X64F 2WW8A 5HBMA 1HYSA 1DBDA 5LJ5Y 4PXBA 3LPEA 2RRAA 1Z4UA 1NSAA 4FVMA 3QWPA 2R7VA 3FNNA 3H98A 5GAGI 4Q44A 1W25A 2GO9A 4YHHF 3SSSA 4IUFA 2VFTA 2CJAA 3BPDA 4P6QA 2AWZA 3TO8A 2W9BB 3C19A 3UD5A 1DHMA 2BACA 3O44A 1IJEB 2NXJA 2IVYA 4ZDNA 2R8IA 1AXQA 3V81A 4BC7A 3N6NA 1UTAA 1JXLA 2D3UA 1X4AA 4DPYA 2RDDA 3BV8A 3OPKA 1UCNA 4TU7A 4YR0A 2J0QD 5KFQA 2MHNA 4CO1A 1NDLA 5IXUA 1GXTA 2YNFA 1ZETA 4CWBA 3TEGA 3NGUA 2EKNA 3NRBA 4IRCA 4QPXA 4ZCKA 1WG1A 1TK8A 2PEBA 4OZNA 1DFDA 3CDWA 1IN0A 4QWCA 4N47A 1F1BB 3M1VB 4UOFA 1U09A 1KONA 4RWXA 1H2TZ 5L9XA 2ZOMA 4O44A 3QRRA 1RAOA 1WHVA 3I82A 1DTQB 1VC5A 4J9KA 1NJXA 5IV3A 1CSJA 1EZZB 2V8HA 1Z2LA 3G86A 4WU3A 1REGX 3H42A 4X4PA 2K7JA 3BN4A 3I31A 3VV2B 1T9VA 1CLFA 5B0EA 1S76D 4XDCA 4MMOA 3LALA 1NZ8A 1TKDA 3C3LA 2FJVA 4DV4F 3H90A 1M5VC 5CABA 4EU0A 4KB7A 1WKJA 1WG4A 5B0DA 1RQ0A 2F4FA 2P8IA 3KK2B 3PACA 4PEOA 4AE5A 1PIEA 2GC8A 4JI6J 1CJVB 3WIVA 5IFMA 1FJCA 2HBZB 3D6TB 2QJ3A 4I0WA 4QR2A 2RD5C 1X0FA 4OI2A 3GSDA 1J27A 2XCPA 4URGA 1ZZFA 1VK3A 5KFYA 3EUNA 2RDIA 4JI2F 3SZ2A 2AJ1A 1FFSB 1FRMA 3FBBA 2W7PA 2AYGA 4NXMJ 4ILMA 2KYXA 5KFPA 3P4UB 4OJ1A 4WPAA 4AXJA 5L9NA 3FDSA 1SQEA 3HJFA 3OJUA 1G7CB 3CSKA 1TVRA 2E1RA 2DHHA 1NUEA 1HWUA 3EVMA 3AOCA 3MFIA 2V4JB 3JSMA 1U4BA 1FX2A 4J9PA 4ECXA 1UPPA 4UY8T 1FK9B 1WC3A 2D1CA 2PFFB 1VBXA 4K2XA 3OTEA 2IMWP 3QJLA 2E5HA 3KJVA 4O23A 4ES2A 2LLZA 2MLYA 2OUGA 3I5CA 4RU2A 2QO3A 2BMBA 3BGOP 3AY0A 1MU2B 4QR1A 4G1QA 2Z30B 4IO1A 4K0KJ 2H4WB 3UD4P 4DEZA 3R6LB 3QJJA 2N4CA 3UVJB 1RTZA 3VTIA 2PI5A 3I87A 4P2FA 2BQUA 3DLGB 5CYQB 3R5DA 2AZ3A 3P3DA 4W92B 2EC0A 3TAPA 3QT5A 2V50A 1S4EA 3KUHA 5CD4A 2K1RB 1T03B 2DNKA 4C8ZA 3DRXA 3OT9A 3DYAB 3AJDA 3MMCA 2UUAF 5HBMB 2LQ8A 4ZVOB 1HYSB 1HWJA 1Y4ZB 1S1WA 5HROA 1R89A 2FJDB 5D0EA 4C8MA 5D77A 1MMDA 2G2YA 3B54A 3AOAA 2Q3PA 2VG7A 1IBMJ 3BKUA 3K5PA 4DN9A 4ZVFA 2AEFA 3CPWR 4I64A 2HZCA 2WK4A 2ZJPQ 2A2DA 1M5HA 1LV5A 2E7VA 2IAJA 1NSPA 2XTJP 4WU2A 3D3BJ 3SSRA 2QC3A 1DTTA 4L72B 2V9WA 4YS2A 3V81B 1UVMA 5F8LA 3EYZA 4Y3CA 2DH8A 4YB1P 2B4VA 1J2VA 1QUVA 1KKHA 4RWWA 3ZO7A 3FC9A 4HH0A 2CQ1A 2P6TA 1OWXA 3HHLC 1IWGA 2BYCA 2YNFB 4WBFA 1HBUA 1TV6A 5AT1B 1NKCA 2ZM6J 1FDAA 5CHCB 2QA1A 1U1KA 1KN6A 3QT6A 4RNNA 3GONA 2A0FB 1GMWD 5KFMA 4DV0F 1A6LA 4HI1A 1N5SA 3MOZA 2E1MC 3QLHA 4CYUA 2FHJD 3NNHA 4DV7J 2IM2A 3CC2S 2MZ1A 4KHRA 4MH8A 5DZ7A 1KTVA 2DGVA 3OQ2A 4LUBA 1WNEA 2E1AA 1LKZA 1Q78A 4O44B 1XNRJ 4EEYA 3CCRS 2F9JA 1VFJA 6AT1B 2UP1A 2HZVA 4ECTA 2HQCA 3A13A 2OIHA 5KG6A 4P73A 1QLNA 4PR6A 2HGLA 3QFWA 1JLAA 5B0AA 2IMOA 4OYMA 3KJQB 3ULHA 3M8RA 1KP6A 2WCXA 2MKCA 4OYOA 4C2MA 3FEZA 3FJ2A 3D68A 4PKDB 4DFKA 4AL5A 1PJ5A 4OLOA 1WTBA 4NLRA 4N77A 2X7IA 3KK1A 4B3SF 1T94A 2I6WA 1V5VA 2LXUA 2OSRA 3C16A 5KT4A 4Q8EA 1CC7A 3G71S 4OX9F 1MMNA 4OIXA 1RACB 3CMES 1NDCA 1FRKA 4M5NA 1H0HB 2ZZMA 2H1YA 3EVWA 2B43A 1K0VA 5B0GA 3ILLA 3MPUB 3U1LA 3AB4B 3MR3A 1LNQA 2QGFB 2V8PA 2JDJA 2QL7B 3CC7S 5HQMA 4X4SA 2FJAB 2Q66A 1TVRB 3MECA 1WEZA 3TX8A 1DARA 4RR5A 5GMEA 5ETKA 3JSMB 4QCLA 1VQNS 3HKZD 1WF1A 3I9V9 2JZ5A 2BVZA 1HR0J 1WORA 2HHQA 4ZPCA 3CCJS 3THTA 2XWYA 3M8SA 4ZVPB 2DB1A 4LF8F 3KJVB 1GMUA 3O5TB 3QPIA 3B8HA 2RF2A 2DNLA 4TVAB 3T3FA 4UOCA 1QVFR 4C8NA 3C6UA 4JI8J 1KD1T 1Q8LA 3CMAS 1SJ3P 4G1QB 4OYIA 3Q22A 2G2OA 3PY8A 4DF8A 4FS2A 4QR0A 1YZ6A 3E8OA 4KBIA 3FSYA 1FDBA 4DPTA 4FPIA 3OL6A 3KNGA 2Y1RI 4PXCA 1ULRA 2PGCA 3WIUA 3T19A 2XLJA 5CQGA 3UCGA 2J6UA 3WDOA 5JVHQ 1FNXH 1LFWA 4MK9A 1QUPA 3L9ZA 4KE5A 3MMCB 3RB0A 4WXOA 3QGHA 1S1WB 5HROB 2UUCJ 1TFWA 3AODA 1WHYA 4RL1A 4P7TA 3HCXA 1G6BA 2VG7B 2JEIA 1S6QA 4FS1A 3DLKA 3GE9A 1Q82T 3MI7X 5E3RA 1U7LA 2VA2A 1HA1A 4HDGA 4NLYA 2XWXA 2WONA 2IAJB 2GIFA 2VPZB 4LFAJ 2F8EX 3BSAA 1DTTB 5I4MA 2QSWA 2XY7A 3W2WA 2J8SA 1SKUB 4B3RF 2W4DA 5KG3A 1NKEA 2HRYA 2F4VJ 3CCTA 5MAOA 1HBUB 2EBGA 3HHDA 1UJ5A 1TV6B 4LFBF 4WJBA 2QFJA 1YJVA 1VIOA 1JJCB 2FVRA 4AT1B 2KZZA 4YUDA 3QLHB 4CYUB 1WC6A 4WK3A 2K8GA 1JXEA 2ZEJA 2FLPA 1ZM4A 4ERDA 2EK6A 3GILA 1ZH5A 1N36J 3T5JA 2J7WA 2HEKA 5LMNJ 2IBOA 3D6HB 4ZLLA 4RW9A 5ETLA 3HVAA 4HHJA 1T8EA 4DR6F 1JLAB 1WI6A 5IWAJ 2KB2A 2FY1A 2B8QA 1N34J 5KG7A 2DGWA 4F04B 4OZ3A 1ZTWA 4RW8A 3CJ2A 3KK1B 2DTJA 3SIPB 2OD4A 3C16B 1IKYA 2DXEA 2RUGA 4LF4F 2MZTA 1H3DA 2ZKUA 2DGTA 4LFCJ 2FZCB 3SMZA 3X3UA 1GT8A 1RWPB 2QA4G 5G4DA 1JX4A 4TQRA 5HVGA 4QWAA 3PW4A 2G1DA 2N7CA 4M95A 2ZBRA 3ZC4A 3RRKA 2VQFJ 1UZDA 4V19J 2H54B 1ACMB 3CJTA 1BUXA 1BQXA 1X0PA 4C3MA 3MECB 2R9LA 3ENQA 1U2RA 4RUCA 2QLBB 4Q43A 2C3YA 2R7OA 1NSQA 5LL6d 5HN0A 2R8HA 2GJIA 5CYMA 3BN7A 1XTZA 3B6BA 4ZVUB 3K58A 4A8MP 3SDEA 2HPUA 1XR6A 2RF2B 2XBPA 5H1SV 1IJFB 2XMVA 5KOXA 4PPZA 1TU0B 1P6TA 3C6UB 1XNQF 3EXYA 3J81Y 5KOWA 2E7XA 4F0MA 2DKOB 3PW7A 3VQTA 4B3MF 1I1GA 1S9FA 3D0HE 1NPRA 3CCMS 3T1HF 3M8PA 5DGBA 4X65J 2AJQA 1Y5LB 4JI4F 4N41A 3DKDA 3NGRA 3W65A 2QLWA 4WXWA 3AB2B 4DLGA 2W8KA 4TXSA 3DLJA 3OL8A 5KG4A 4NLPA 4NYOA 2YTCA 4QBUA 2AU0A 2R8GA 3R1LA 3IR7B 5C2GA 4OX6A 4XDDA 1MW7A 5HMWA 2XSFA 1GTHA 3JYTA 2RQ4A 4Q0BA 1PSDA 1MN7A 4FXDA 4B9NA 5H9FJ 1YLXA 3MF5A 2YNGA 1S6QB 3A3OB 4AFFA 1TUWA 3DLKB 4JI1J 4XTTA 4K7QA 2CJXB 2IRUA 1KTQA 1VJWA 1Q8IA 1T7PA 4KQZA 2L08A 4AQYF 1Z2ZA 5ETTA 2AD9A 2WONB 1TAUA 1TL7A 4NEYA 2ILYA 4X4OA 4ELVA 1S72S 2H65B 4XIUA 4FBUA 3W2WB 2AGQA 2I1RA 2ZWOA 2MKHA 3HVTA 2W1BA 2PMWA 1GX6A 3JS9A 3CJ3A 1TL3A 1LXJA 1M5SA 2L41A 4OZ0A 4O3OA 4WP3A 2MKIA 1XWLA 2MQLA 4NX9A 1YRTA 4IH7A 4CO4A 5J2NA 2DNPA 3N0VA 2JWNA 2V69A 4KY3A 3J80Y 2CJQA 4ANEA 4NE9C 1SC6A 4DV4J 4DR3F 2KTQA 4DFMA 2RB7A 2ZC3A 4M1KA 4DUYJ 1FRHA 2F7VA 3RG6A 1UMJA 3TZXA 1QAYA 3I32A 1B0PA 3QAUA 2L3MA 3EPGA 2ADCA 2AJ4A 4O3RA 3W60A 2VA3A 2U2FA 3GFXA 3IBCB 3KG0A 3VAHA 4RW9B 2YWWA 3J81j 3LGHA 3O1LA 4F4XA 4YB6A 4QWEA 1JLBA 2D41A 2YWEA 2GQCA 2YPZA 3Q23A 1NU4A 3M32A 5GADU 4DQSA 2ZNZA 3FRZA 3V4IA 3BBCA 4RW8B 3RAQA 2KM8C 1FE4A 4KYZA 1PYSB 5L1IA 3I9ZA 4IDKA 1U02A 4X4UA 3CDEA 4F8RA 1IKYB 2D9PA 4USTA 2DNMA 4WCEQ 1IR1A 2LMIA 1NB2A 4M5GA 1P9QC 4I2PA 3NLCA 4WZMA 2FPHX 1N0VC 2I2YA 2KYZA 5LSRA 1Q1KA 2E1CA 4NEZA 4DHVA 3LGMA 3CEDA 2UVUA 3CJ8A 5B7WA 2B6AA 3ONQA 1G3OA 2ZH7A 5DS7A 1FRJA 1FNMA 2OEMA 4DL6A 4ITSA 5DZ6A 4CQ1A 3OTBA 4UZBA 3DHXA 3DNCA 3VAIA 1U48A 1TL1A 1KLNA 2GV1A 1RT6A 5C42A 5D3GA 1ZM3A 5CYMB 5E5NA 4OI1A 2VFVA 5F0WA 2WVCA 4M5JA 4FF3A 2CPFA 4CLWA 2R2UA 4JV5F 3SDEB 5KFEA 5DQGA 2XGQA 3T6JA 3DOMA 4CDIA 3Q89A 1EHWA 4PCQA 5GADI 1S4FA 2IBKA 1XN9A 4GO7X 3KLEA 4ECSA 1UVJA 2HURA 4H54A 3M8PB 3HSJA 1QSLA 3DCAA 3MCOA 1X7VA 3QRQA 2IFXA 1YBUA 2V2ZA 4L73A 3C2PA 2ZH8A 1N4LA 1RBAA 2KT2A 2HK2A 4DV5F 1XC9A 2GZOA 1RHKB 3WHIA 2LQ9A 1BGXT 3KMQA 1RJJA 2MTLA 2VG6A 2HBQB 2A1BA 1IM4A 1RKJA 2PI4A 1U8WA 4L75A 4TY9A 3NGDA 1UKUA 2BEFA 1J5EF 3OFGA 3JYTB 2IYIA 4Q0BB 2IM3A 4ZP6A 1BC6A 4GVLA 3QFHA 1X5TA 4NRTA 4YFUA 2YNGB 4UF4A 4GMKA 3TZYA 1RABB 3SQGA 1VISA 1PYTA 4IQXA 3Q8YA 1CQMA 1F6TA 3FFIA 2QYGA 4C48A 5HQ8A 4IR9A 1VJQA 4ANDA 1SUQA 4HR2A 1TL7B 1HKAA 3CULA 5MLCV 3D5MA 4KC5A 4MIWA 1T95A 2O01C 2X1AA 2CQHA 4PG5A 1ZYQA 2DH7A 5A2QY 3HVTB 3PX6A 2JC0A 3IM8A 3QJPA 1HD0A 1TL3B 4Q5VA 1PILA 2MJUA 1L3VA 5F8JA 5DJBA 2ROPA 2KDOA 3K17A 3Q8QB 3W8PA 4USJC 3DC2A 4TKTA 5J2NB 3GMGA 2YKMA 2R2SA 3K8VA 3UR0A 1N6QA 5C25A 2UU9J 4GKKJ 4DQQA 2E5LF 4ZPTR 4ED5A 2N4DA 3FK4A 4U95A 4QJVA 1PJ6A 1NK9A 3SEOA 4KTQA 2B9YA 3BB5A 1S1XA 1ITPA 2AYEA 1K8AT 3ICLA 4LF9J 4OX9J 1LFPA 2GMHA 1NHUA 3HHKA 1IKWA 3KOAA 2OPQA 2YKQA 2BOAA 1JLBB 2BX6A 3TA1A 3A8IA 2JLFA 3KNAA 3M32B 2L9DA 3CGIA 5DG7A 1TZ0A 2BANA 1NPKA 1OSDA 3MDFA 4ANCA 3V4IB 3D3CJ 4LRFA 2HHHJ 2DT9A 2NXNA 2KRBA 1L3UA 3BYPA 4IDKB 4O3NA 1RP5A 1FRIA 4OV1A 3W5XA 2ILZA 1OMSA 2SXLA 1TL4A 4OFZA 2H48B 3R7NB 4YB5A 2R7SA 1YG0A 4I2PB 2DNHA 4EO8A 4PG6A 2DH9A 4OL8A 4CLTA 5KT2A 2JVRA 4FXWA 1TKZA 2BE7D 1SH2A 2DR5A 4J5OA 2M2BA 4TYBA 2GAHC 2B6AB 3JAMY 1U24A 1N48A 3C46A 4O3SA 1K1QA 3AJ1A 3FCHA 1IXKA 2XULA 1HMVA 1FXDA 1TL1B 2AP6A 1L3SA 1RT6B 5C42B 5D3GB 1K0TA 3X1LB 1VQPS 1V3ZA 4K4WA 3DLHA 2MMYA 2YX1A 4OX8A 2CZ9A 2LKZA 3NEKA 1XMQJ 3DOMB 4LIRA 1OIAA 3PCOB 3HX9A 4NLXA 4S0MA 1S59A 2VASA 3MR5A 1I5OB 3NG8A 3KLEB 2ZWPA 3MPVA 3LW5C 1A9NB 3BDEA 1X4HA 5FDLA 5KFNA 2FQQB 1YJ9S 2FJWA 5IT9Y 3THPA 5KT7A 4RW6A 1RT4A 5D0RA 1M5OC 4C9DA 3MR2A 3ISND 4DLEA 3RB4A 2B5JA 4F0KA 3TANA 1I6JA 2VG6B 4M5LA 2NREA 1D9AA 4IO9Q 2Q1LA 1CJKA 1KDNA 1VQSA 3VGTA 1HW9A 3CF5Q 4F4KA 1UJ6A 3QBCA 4RLEA 2XHCA 4CH0S 2ZUAA 2BE2A 2HRTA 3CJ5A 1UJ4A 2HBYB 4MK7A 3KYLA 3BQ2A 1S5ZA 1S77D 1UFWA 5KFOA 3IGNA 3Q86A 1JNZB 4PAAA 5KG2A 4WFYA 2XSJA 3SQGB 3FFIB 1H7WA 4WTYA 2IIHA 1SUQB 3K5MA 1N5TA 4I7FA 2F1FA 3RB3A 2FIUA 4YMEA 4JUZA 5B08A 8AT1B 4C8KA 2UXDF 3H59A 2UXCJ 2AQ4A 3M8YA 3QWUA 2W2PP 3GV7B 1OO0B 4ILRA 5AE1A 1FEEA 4DDFA 3UN2A 3CIZA 3RW7A 4NLVA 2PMZD 1E6YA 4CTAA 2JOQA 4J7CA 1ZBTA 1RGVA 5IOLA 4JBCA 3OLBA 2OI2A 2B4UA 4KHMA 1YBTA 2C2KB 3OVAA 4Z7YA 2YKMB 1T9XA 1F2HA 3R8YA 3FQLA 1N6QB 2M0GB 3GPAA 3AD9C 5C25B 4U6PA 3MXHP 4R5PA 1M1GA 2GMLA 3BGRA 3NY0A 1Y5IB 2JH3A 4DR1F 5HATA 3HF5A 4ZVEA 3MEKA 1V3SA 4RX6A 4NCGA 2Y8WA 5GVQA 1O51A 2FZGB 2DK2A 2EW9A 2YQ3A 5D8HB 1S1XB 1Q5VA 2LEAA 4LF4J 1IKWB 3EMTA 2LQJA 2B3TB 2OPQB 4C3LA 1IR2A 3R5GA 2BA9A 2DEJA 1NLKL 1CG2A 1IR0A 2R42A 5BR8J 3R2CJ 5D4NA 4XPCA 4KGKA 2CPYA 2OTJS 4USMA 4PZVA 2BANB 3M2UA 4BS2A 4NASA 4QIGA 1S57A 1C4CA 1DQ9A 3AA9A 1T11A 3OL9A 1YWXA 2G2ZA 1U1RA 1FHTA 1UZHA 3K57A 4C0OC 5D4LA 2PIIA 6FD1A 2KFNA 1RCOB 2NR0A 1D3WA 1HHQA 2CG4A 2HNYA 3R2DJ 2Z58B 1R8CA 5C5JA 1TKZB 4ECQA 1PYOB 4OZ2A 5IT0A 4OHYA 3VAJA 1HNZF 4WKRA 4NRUA 1V6HA 3THVA 2QT7A 2NYIA 3KG4A 4B3TJ 2R7QA 2VQEF 5KFZA 3VR1A 1HMVB 2OTLS 2YKPA 5HK4A 5I3QA 5HO4A 2UXBF 1AROP 3RBZA 3TQ1A 1U2FA 1RAEB 2A3JA 1RHUB 3CDAA 4J9NA 2CNNB 3KLHA 4CZCA 5ETSA 2DNNA 5F0UA 4JI5F 5ETPA 3QAEA 3N5FA 3DRRA 2XZWA 2J0WA 4IG0A 2Y3YA 3M30A 2I8EA 5DQHA 1WEXA 3SSQA 2H3EB 3T1YF 2KG0A 2GJ2A 4P7VA 1Q4RA 1QD1A 4MKYA 2HNDA 3CTRA 3MEEA 4G65A 1UW4A 3D9BA 5FDLB 2OMOA 4CO2A 1C0UA 4ID8A 2MKJA 4RW6B 4X62J 1RT4B 2V2KA 5EHHA 2JX2A 2B5JB 1S48A 1CC8A 4FKXA 2MKSA 2Q43A 3DN9A 1RTHA 3AA8A 3IG1A 1CQNA 3QNWB 4IH5A 1URNA 4WKYA 1ZM2A 4GKJF 1CJKB 2J7UA 5M2UA 2KZMA 4OJ3A 1U1LA 5BJRA 2CNLB 1GNKA 1N52B 3A4TA 2BE2B 4ZKAA 2K3IA 1U1MA 2RQKA 3FQKA 2M88A 4UQTA 2YWGA 1O6XA 3S8SA 1HL6A 4Z2XA 3NCQA 2XSJB 2P9EA 3D0IE 2B7BB 1YJNS 3HSZA 2C3UA 4DL0C 2DEIA 4RKUC 2OPPA 4YR3A 3OSNA 4TU9A 4I7FB 3L7PA 4DSFA 3Q2SC 4RPFA 2AEJA 3V6JA 2VKRA 1GEHA 3WZ0A 4P10A 2E44A 4DR4F 3GSIA 5D0HA 4QQBA 2G0JA 2RRBA 2M52A 3H4DA 4EBCA 3KJNB 3FBEA 3L3CA 4JB8B 1XERA 3DLBA 3K89A 3UO0A 4H4KA 4ZVHA 3ZTPA 3CDUA 4DPWA 1E6YB 4FZVA 4CTAB 4ECYA 3CO0P 5KFRA 5HMXA 3CCQS 2FVSA 4X4NA 4HL9A 4PXEA 1N32J 1QE1A 2CPIA 4DFPA 2HWIA 2MZRA 2YY3A 2B0GA 2LA6A 2HQ3A 4DV1J 2RDJA 1VLYA 3OXFA 4R5PB 3BGRB 1WF0A 2CJYB 4FPRA 4JI0J 3CC4S 4TY8A 3KHRA 2BDPA 5J1PA 3WC0A 4NCGB 1GXLA 4X4QA 1VMBA 4X66J 2P6SA 2RNEA 1PG5B 5T14A 3E51A 3IWXA 3D6MB 4Y6IA 1RAIB 2M8HA 4IH6A 1Y10A 1MLAA 4NLWA 2ZBPA 3OTOJ 2QYCA 2K06A 4ED0A 3ITHA 4BCAA 2CA9A 1HNXF 2MYFA 3M2UB 2RMLA 4U67Q 4WFZA 2FHMA 2Z2MA 3V6KA 1R0CB 3BKTA 3DDKA 1BQMA 1HHSA 2ERRA 1OPIA 3H2UB 4ZN3A 1SIZA 2R7WA 3MWBA 2KXHA 2EBEA 2ZHAA 2QTWA 2HNYB 2HVHA 5K9FA 1PKUA 3C8YA 5EN1A 1YJ7A 1HFEL 1RWXB 2BM1A 1KLMA 2F40A 4U9RA 2WHOA 3GIIA 2HHVA 3F73A 4HLBA 4AXIA 3MFHA 2VPXB 5SUHA 4G1IA 3CD6S 4B9LA 1WSVA 2JC1A 1D1UA 2DPJA 3P49B 3KLHB 3BQ0A 3QT8A 1YDLA 3HM9A 3PRBA 3DRRB 3GG0A 2GCFA 2J76E 3O8WA 4IG0B 4FDFA 3M30B 4DCPB 3NMAA 2VJUA 1LEOA 3JSBA 2I38A 1XIQA 3EWGA 4JI3J 1ZTTA 1KFSA 2EEYA 1AUDA 2HNDB 4Y00A 3A12A 5LMUF 3MEEB 2QL5B 4MK8A 2Q6BA 1NK0A 2CG8A 2CQ0A 2Z56B 1Q53A 1C0UB 1O8BA 1R31A 2HHPA 2RQCA 3TAMA 4EYHB 4F3QA 4RUAA 5E7OB 2VOPA 5EX0A 1R8HA 4LQ9A 2O5DA 3ZZOA 1X4GA 4OI4A 2W24A 2A6MA 1RTHB 3PYEA 3HSGA 3IBWA 3IG1B 2HG4A 4PWWA 1Q5YA 1Y11A 4WTOB 4LF5J 2GHVC 3QIDA 4BBYA 2C3OA 4WYWA 2BABA 5LSLA 2FVQA 4M5HA 2M4MA 1U25A 4RNHA 4W98A 1VBYA 2OFGX 3R97A 1CEZA 3NCRA 4BHQA 1R6VA 2AGOA 4K59A 1SKRA 3OHAA 5JUMA 2G4BA 1M90T 1O0PA 3T41A 3HMJG 2OPPB 5F8MA 2GGPA 4F50A 3UPFA 3GIMA 3L4BC 1KSPA 2W9CA 5A6WA 3OHBA 2DNOA 5DM7Q 1UA0A 2AHOB 1RWNB 2EFOA 4YN3B 3ET6A 5A8KA 2BJ9A 2KKHA 1WEYA 4ZLNA 1HI0P 2R2RA 3QMQA 1GH8A 2F8MA 3RR7A 4ZVSB 4DMZA 3OD2A 5THWA 1QE1B 3M8QA 4KPYA 3TVKA 4L3KA 1GAOA 1N88A 4DFJA 4KR0B 1ROFA 3CB4A 2NUHA 2CWKA 2DYAA 2BUNA 3G9CA 1NNDA 1SC4B 4OYPA 5GMKa 2DGSA 2X3DA 4ES1A 2J9DA 3NP5A 4TY8B 2G0CA 4WK1A 4NCAA 1HQEA 3D6FB 5M2PA 4DX7A 2KJVA 4ZJLA 3CDBA 2J6TA 2LU1A 2IYGA 4JP8A 2BXJA 2BJDA 2WVFA 1RAAB 2IM1A 3OJSA 2BKOA 1MSWD 5B0BA 5CZXA 4H4KC 1Y00A 3ITHB 2MXYA 3CD5A 3EDQB 5DO2A 2FJEB 5H9EK 4ICLA 2VG5A 2UVVA 5KFWA 4B3OA 4F2SA 3JB9k 1FT8A 2CZVC 1PAUB 1YJUA 5ETMA 1S9GA 2W2OP 4PQAA 1BQMB 3D4JA 4ED2A 3S7RA 5D0GA 2VJVA 3N79A 1URRA 2V6AA 1NM2A 2FJBB 3W9IA 4I6WA 1O5JA 1N5QA 3HD1A 1B99A 1LW0A 1KFDA 4N8OA 2EFVA 1BD6A 3ENWA 2YVSA 1WELA 3OR2A 4DV6J 3TARA 2YQ0A 2VPWB 4CLPA 2XHWA 1C2PA 2L9WA 4K4YA 2AW0A 1KLMB 2YWHA 1IBKF 3PZPA 3C14A 3Q24A 1Q8KA 1U1OA 5F3TA 1WDDA 4QW9A 3NGSA 3AHPA 2G0IA 4USIA 2IHR1 3A3PB 1WI8A 4OZ5A 2MZSA 4LRAA 4CM2A 1CVJA 2IRYA 4OV6A 2AJ2A 3RBXA 1YJWS 3TUJC 5BXIA 4WFNQ 4IOBA 3TW0A 3HHLA 2IDLA 2BRKA 3EXCX 4LF7J 3RB6A 1Q8BA 2AIRB 1SQFA 5A0YA 2J8AA 4NXNF 2XLKA 3LAKA 5LOQA 3M6UA 1RAGB 4LJMA 1M1HA 1KEKA 3KHLA 2ASYA 3EJMA 4DCOB 3HPOA 3TVZA 3MM7A 4FYDA 2DIUA 3ILIA 4O3PA 3TAMB 4J9MA 2J9DE 1QM9A 1X4BA 3PEHA 1GXUA 4Q2MA 2H5JB 7FDRA 3FCVA 4B9VA 2DGUA 3CXCR 3EX7B 4TQSA 3TZZA 2NZ4A 4OX7A 4U96A 3P8BB 1RWVB 3JTNA 4PG7A 1NK8A 4K4ZA 3PX0A 2KHDA 5KFXA 2D74B 2GQ2A 4AL6A 2JL9A 2PO4A 1R6YA 3RYLA 4ELTA 4R0JA 4UUWA 1U47A 3DRPA 2GGPB 1REVA 1WC1A 3PKMA 3A1YG 5ETNA 2W9CB 4A48A 3GIRA 1RBLA 4GVBA 3ET6B 1NK5A 3B82A 3FCWA 2FUG9 4LT6A 4ZK7M 5A8KB 3IC1A 2ZNYA 1Q81T 2OPSA 2RIJA 4PYDA 1TMMA 3NOCA 1FX4A 1OYDA 3IBFB 3RJMB 2RHSB 1JKHA 1HNWJ 4ETXA 1RISA 2FYXA 3M8QB 2HZAA 3JXOA 2WSEC 1P1TA 2GNKA 2HQDA 2NZCA 3PFEA 2ZBIA 4K4VA 4WFBQ 3HZEA 1PAEX 4JYAJ 4DSLA 2OAUA 1HQEB 2XO6A 3PYGA 3R5BA 2KH9A 4NMXA 5GMDA 3EE3A 5BYQA 3G8SA 2PSZA 4I4BA 4WYLA 2CXEA 3H7HB 3TUZC 1RWUA 3KKFA 3ZTQA 2I5JA 3OTDA 3MAAA 4F36A 2GHWA 5IQQA 3PV8A 3M05A 1FESA 3AQOA 4NL5A 2ABYA 3M6XA 3PW2A 3NGKA 4Y2IA 4ICLB 2VG5B 3FMBA 2JEFA 3MPYA 1C4AA 4B3OB 4RUHA 4CLZA 1T9WA 1S9GB 2A10A 4F4YA 3U1NA 4KJIA 3QGPA 4DL5A 4DV3J 1WACA 3PRDA 4U7CA 2AEMA 3PJ9A 4QU7A 1LW0B 2POKA 3H2LA 3OR2B 2NXEA 3TP2A 1QAJA 2FDNA 4ZHRA 5J2QA 3IRXA 4EO6A 4IOAQ 1B64A 3C14B 1S0NA 4NZ0A 4IQMA 2IPOB 4TNOA 4NXMF 2APOA 3GJRB 5KFTA 4M5IA 3LO3A 3D7SB 3DMJA 3EVOA 4L3NA 4LSLA 2DJWA 1QSYA 4G3IA 4CO3A 1PO6A 4B9MA 2LQBA 3D1HA 2JFDA 2QA4S 1AT1B 4MKAA 3HHLD 1N8RT 3HHLB 1UFKA 4LRDA 2GVDA 4DUTA 5A0YB 3J7YU 3D1QA 1Q95G 3TUIC 3UDVA 2JLEA 1FJGJ 1EETA 3K2YA 3G6XA 4TLRA 1C0TA 1OYEA 2WW4A 4J90A 2PT0A 2JEJA 3R5AA 4H4MA 3MM7B 2KVIA 2CQPA 4YR2A 4KGVB 2IC3A 3UN3A 3C15A 3N9UC 2K3KA 3OV7A 1M5PC 2E9ZA 3H5XA 1JJ4A 5K20B 4DV2J 5IM0A 1KC8T 2K7KA 1X8DA 4DSIA 3K59A 2OMLA 2VV5A 4DR4J 2MKKA 4C0HA 1X9MA 5EUHA 4ZPAA 1S79A 2X51A 4C3KA 1RWOB 5GAHU 4J9LA 5FD1A 4A47A 5DLGA 3PM9A 3AXMA 1FO1A 1BLUA 4CLFA 5IV4A 3W64A 2DR6A 3MEDA 3FKBA 2HK3A 1IBMF 1X5SA 2OD6A 3DRPB 3EPIA 3Q8RB 4UOGA 3HSDA 1REVB 3J7YI 1RWMB 4PUOA 2RKIA 4GVBB 1RK8A 2BM0A 5HJXA 1VRUA 2KFZA 3BDPA 1RT2A 1X4DA 2OPSB 2CPJA 4RNOA 3T6BA 3PR5B 5FLXU 3CIMA 4WE1A 3ZNJ1 4O0IA 1JKHB 2WSFC 2GA7A 3T5KA 1IBLJ 5CXTA 5ETVA 4OMFG 1AW0A 5A8RA 3W8GA 4GC6A 2C28A 2ZH3A 1LWCA 2CPDA 3HZGA 2ZM6F 3SYZA 2GIRA 4P72A 1VS3A 1FWPA 1YK9A 8ATCB 3KK3A 3BH7B 3QGGA 5DRKA 2DISA 2CQIA 5F41A 3MHYA 3HP6A 1H2UX 1JK9B 1RTIA 1W7WA 5GAHI 1YVFA 4DV7F 4HTIA 3OR1A 4DPUA 4RW4A 3D0GE 4OHZA 4ECRA 2Y1LB 2NUUG 4ALZA 3CCZA 1YJTA 2XMTA 3EDRB 1XNRF 2ZH9A 2I5JB 5IT4A 2XS5A 3MAAB 3KJFB 4MIBA 5LSOA 1AZSA 2U1AA 3SBMA 4PWUA 3W1YC 1RHRB 4JV2A 2HHTA 2XB2D 2EFNA 2NXUA 4LF2A 3C66A 2H5IB 2ZBCA 2RT3A 3AJ2A 2EG1A 3P96A 2R8KA 2W4PA 3IAS9 3MGJA 1NHKL 4GC7A 1L5UA 1B0VA 3T5HA 1VC0A 2RJZA 2CVEA 4V1Ak 1T9UA 2VC0A 1S0OA 1A0OB 2RH3A 2B4PA 4ZLPA 4ZHRB 5J2QB 3IRXB 4FYXB 4LF6J 2HVDA 2FY8A 5RUBA 2DR7A 1BY9A 5CCMA 1QJHA 1NPPA 1VQLS 4M8LA 1S1TA 3TWZA 1H38A 3DMJB 4XO0A 3HKWA 5LMUJ 4LSLB 2YKAA 3L7UA 2BE9B 2V8DA 1U1QA 3K5OA 4TU8A 4OZ1A 2JSXA 3TA2A 4BWMA 2O67A 4NLOA 1HR0F 2OFHX 3GFYA 4OI6A 1AB8A 2DPIA 3U02A 2WAQD 2YX7A 1R0BG 3IXQA 1X31C 2CPEA 1F5CA 1EETB 1VC6A 1C0TB 3IGVA 4ZVQB 1NMEB 4JI8F 2DGQA 3EM1A 3MMBA 2VZ9A 4H4MB 2XO7A 4L76A 2KI2A 4DR5J 4YOEA 3M8WA 2IC3B 3C15B 4NA3A 3CD7A 4I6YA 2X1FA 2W7OA 2VBYA 4C11A 2OH2A 1SQGA 2LVWA 4PPDA 3POTA 2HS0A 4J9VA 3G96A 5KT5A 3KLVA 2BR0A 5IM0B 1TELA 2MZQA 1F0XA 1ZA1B 3Q2TC 1UVIA 5J1NA 3BGFA 3KFWX 1TL5A 2FC9A 3RUBL 5CA5A 2GVZA 3LWMA 1A7GE 1VQOS 3GR1A 3HFVA 4N5SA 1S6PA 2UUCF 3WX8A 5L46A 2R3VA 3QZ8A 2H9ZA 3DOKA 1WSRA 2MQMA 3NGTA 3MEDB 1Q7YT 3VAFA 4ZP8A 4KHPJ 2VFUA 4YY3F 3J7AN 1HBOA 2YXLA 1TK5A 1D0EA 5AJ3J 2HVEA 1TK0A 1VQYA 4FXVA 1F5BA 4PUOB 1RTJA 2RKIB 2XNQA 1R8BA 4LFAF 1VRUB 1K9MT 1HD1A 1UVKA 1RT2B 4TLQA 2BV3A 1UETA 3LP0A 2YNHA 3MCNA 4WE1B 3T1AA 2CQ2A 4I56A 4G6VB 3U27A 1FKAF 2OELA 3ZZRA 4ZVTB 3DM2A 1WWHA 2QV6A 1CJUA 1KS2A 5L39A 2F4VF 2FGCA 5HVHA 2V68A 1BHNA 5A8RB 1VQ8S 1LWCB 2VPYB 1LXNA 4U7UK 2Y8YA 3JSRA 4NPOA 3MOJB 1R27B 1VRTA 3KK3B 5ETOA 3BO2A 3ZTSA 1RTIB 4A4JA 3WC2A 2R8JA 1PJ7A 3FZ2A 3OR1B 2W4CA 4RW4B 3GZ7A 3S01A 4WFXA 1D9FA 3BH6B 3IS9A 2RAQA 2IJNA 2RE1A 2YWFA 2C22A 1NH8A 3IWLA 4OHXA 3UQSA 1SJ4P 3GWCA 2D69A 4XPEA 1N36F 3K0JA 1NXIA 3EZUA 1LQ9A 5LMNF 2LEPA 1AZSB 2GO8A 4LVNP 2JVOA 3KDOA 4LR7A 3MUTP 2IJRA 1YSJA 4QU6A 4DR2J 1VOMA 4PG8A 1L3TA 1VIXA 3VQSA 2HMIA 3JTOA 4EK2A 1U1NA 3UD3P 2DCUB 5ITHA 3P45B 3I6PA 1PGZA 4A8OA 5IWAF 1WOOA 1N34F 2UUWA 1VQ4S 4B02A 4KH1B 1SXLA 4G1PA 3BM7A 4E2FB 1AUSL 1JLQA 2HQFA 4HTJA 1XMOJ 3GU0A 2XS7A 4KH0B 1Y3KA 1CPZA 3RZAA 4JI7J 3Q0AA 2WRMA 4NLUA 2OSQA 1X9WA 2HSEB 4X64J 4AYBD 3HLUA 3MTJA 3VVUA 3QATA 2Y1IA 3Q8VA 2CNOB 3W9JA 2JEGA 2COLA 3MPDA 2YNIA 4EZ6A 2VQFF 1S1TB 2UV8G 2NPFA 1I3OB 3I5BA 1H98A 3QSYB 3B4DA 3UI3A 2KG1A 3O6QA 4E0DA 2CADA 4YHHJ 4Y2KA 3FGVA 4LIWA 3FMWA 3NS7B 3DDIA 3ZZTA 5HP1A 1MG7A 5C7PA 3VZIA 4USVA 1JQGA 3G6VA 4C8YA 4P9SA 3G2XA 3IR6B 1F60B 3UW1A 4O3QA 1RLDA 2ASDA 4QYRA 2ZDOA 1FFGB 4OYBA 1S0MA 4V19X 4Y2CA 1HQUA 4NI2A 3PHTA 2XY5A 2DD8S 3P6YC 3FEYB 3MMBB 1MMLA 2BQRA 5ETQA 3M9MB 5EWFA 5DG8A 3KHHA 2R7TA 1B70B 9ATCB 4P2MA 2C2OB 4X65F 5I42A 4C11B 4GRSA 3POTB 1C1CA 1FKOA 4QIFA 2KT3A 1BWVA 3NL0A 3UDCA 3N01A 2EPIA 2LXIA 3N6LA 3HD2A 1KWMA 4PRFA 2GQQA 2MJNA 3LTOA 3DLLQ 5CCLA 1NBEB 2AZ1A 4FF4A 2FVPA 2D3ZA 1HARA 3L95X 3TA0A 3PDNA 5CYJA 2GVZB 4OLPA 4ZVRB 2HWTA 3OUYA 1WDTA 1S6PB 3HHNB 5EDWA 2O1PA 2KM8B 3CCVS 3DOKB 1R8PA 1FTRA 4X4TA 4JI1F 2KU7A 3E3XA 2HFOA 3W5ZA 1HBOB 2RU3A 3N5BA 4GO5X 5KFFA 2BJ8A 3GFHA 2B51A 4F3MA 4J9SA 4NLGA 3W3SA 1V3RA 1RTJB 2DR9A 2XY6A 5ETRA 1F2GA 2VB6A 3GP9A 3KUGA 3S6EA 4Q2LA 5HVFA 2X1BA 1RTDA 3CCLS 2N3LA 4DPXA 1U1PA 1GMWA 5K8MA 3LP0B 4F4ZA 1KQGB 2YNHB 3V4MA 1FD8A 2FHJA 3D67A 3RAMA 2VBZA 3DM2B 1CJUB 4EYIB 1M1KT 2XS2A 2XI3A 2QG9B 5AE3A 4ED6A 2QZ8A 4QW8A 4I6AA 1ZAWA 1S49A 3HI9A 1S0VA 4JI2J 3DRSA 2XMJA 3BQ1A 4D3HA 1YGYA 1B7YB 3NS6A 3I4HX 3R5JB 1VRTB 2PMHA 1R0AA 5KTQA 4C4WA 1MROA 2E5GA 4UOHA 4WFAQ 2XMMA 1IM6A 1ELOA 4ZCLA 3PJWA 3BF4A 2B9EA 4DR7F 3DU5A 3UNYA 4D3GA 3IS9B 2VDHA 2NSBA 1MN9A 1UEUA 4DUYF 3HHEA 4FYWB 2F3JA 1U6BA 1DJ0A 3ZZ0A 5I3UA 4OJHA 1HWKA 1U26A 1SB6A 2XCAA 4DQPA 3PW0A 1NKBA 5F8GA 4K8RA 1PC4A 5B0CA 4OZLA 2DNGA 4Y2MA 2HMIB 3J7ZT 2VL1A 4ZPDA 1WJ9A 1ZAVA 3RU0A 2XZDB 5T41A 4DS4A 1RAFB 1E6VA 4Q45A 3IN5A 4J91A 3A8EA 3R3TA 4YDXA 2JHEA 3LGNA 4EMDA 3K5LA 1TKXA 4DL7A 5H9EJ 4M63A 1P1LA 3Q83A 5EWEA 4TN2A 3RW6A 4FF2A 1JLQB 1I51B 1QVGR 4ECWA 2IM0A 4KAIA 3QRPA 1FVQA 1RADB 1B4SA 2QMWA 4F3OA 4DU8A 2VF3A 2BOPA 4DJBA 3KLGA 3ETOA 2G1HA 2EC2A 3ADAC 5E41A 2BKPA 5KFKA 2UUAJ 3E2EA 5HANA 4DSJA 3M6VA 3CO9A 2HHUA 2DXDA 1UL3A 2GAGC 3CJQA 3LF0A 2F8HA 2YNIB 4DL4A 2D3OR 3M2RA 3VWSA 1TQLA 4O4GA 4MFBA 4ZP9A 4DX6A 1TKTA 4YEAA 2QE5A 3R7SB 3I5AA 1PBAA 5HP1B 1JLEA 2EVZA 1FJ7A 3HJVA 2CIMA 3UDEA 3W66A 1AA1B 2QRRA 1FD2A 1QAIA 3M9NB 3M9OB 4Z37A 2RQMA 1EB0A 2V4QA 2ROEA 3N28A 4UT4A 3ZXWA 1HQUB 4NI2B 2MGZA 2ZZTA 4DX8H 1DZ5A 2HQGA 4ATNA 2CPZA 1OSCA 2RVJA 3PXGa 1FTCA 1M0SA 1S6UA 2OEJA 3F0NA 2YQ1A 5I42B 3WQPA 3V6DA 2MPUA 1C1CB 1FKOB 3DOLA 2GHPA 1SKWA 2E9TA 4RW7A 4ZOSA 3V5RA 3SV3A 5LJ3Y 4CO0A 4DV0J 2XEXA 2DY1A 4CNZA 4KFBA 3MTKA 1R3NA 2PN6A 3NKYA 5F3ZA 3CCUS 3OUYB 5KFBA 1JB0C 1D09B 1T9YA 4LSNA 3AT1B 2VFSA 1RT7A 2XMAA 2CNKB 5GAEU 4HACA 4AUKA 3H40A 3BGUA 1AFIA 4N7TA 1NSKL 3DHWC 3GV5B 4LBIA 4PABA 1RT1A 1C1BA 2UVWA 5DDQC 1UWBA 2VU5A 1TR0A 4XK8C 1RDRA 4ED4A 1MWYA 5I3PA 3KHGA 1RTDB 4B3SJ 1YIJS 3K7RA 2DBBA 2GMJA 1HBMA 2N3OA 3U1MA 1WOSA 2LEBA 2JLGA 3UN5A 1SV5A 2EFPA 2V4RA 1HI1A 2EG2A 3OW2R 4X4VA 4K4SA 4DN0A 3IR5B 2HFZA 3PO4A 4X2BA 3G82A 2B9XA 3DRSB 2AYBA 3AXKA 1ZPWX 1F9FA 1S1UA 2V0NA 3MEGA 3K5NA 1R0AB 3TEHB 4ZS6A 1NZAA 1MROB 3NBPA 5L1JA 4UW2A 3RAXA 4CNYA 4DQIA 5L8RC 2UU9F 5F9NA 4GKKF 2ZITA 2OJ3A 4IFVA 3BJYA 3TUPA 2M8DB 2P9GA 2NQPA 3F56A 3ELHA 3W61A 5I3UB 5GAEI 2ZBQA 1H72C 4OZJA 1HI8A 3MMAA 3TRGA 5JVGQ 1FEHA 4DSKA 3GIKA 2YPYA 4LF8J 4LF9F 4JV1A 3NAIA 3OL7A 3JQMA 1NK4A 1KVIA 1VQ9S 1NHVA 2MQNA 1T05A 2L9NA 2FLNA 2KXNB 3SFGA 1TFYA 4CIOA 1E6VB 1VBKA 4QIWD 2JRSA 1JLCA 3RGIA 1TKXB 1VQKS 2WVBA 3NWRA 4XAKA 3BO4A 2HHHF 4NMLA 1EJ7L 3TYTA 2B56A 2WTFA 4LRBA 4DX5A 4ZN1A 2P2CB 3SCLE 2AMCB 1CULA 5DQIA 3H4BA 3LH2S 2YBVA 2QLXA 3KLGB 1R43A 1F9HA 3N6MA 5KFIA 4ECVA 1N5VA 1B3TA 3V2UC 2YKNA 1RB0A 1R7IA 4HEA9 5AXMA 2MQQA 4ECZA 3DDNA 3RTVA 3BKFA 5AXKA 2MY7A 1OQ3A 2ASLA 3PKYA 3M2RB 2AGPA 4I68A 4EFAC 3CMQA 4DPOA 4O4GB 4MFBB 1VHFA 2CJBA 1TAQA 4RBTA 2FTRA 4EGLA 1TKTB 2UV8A 2XYPB 1JLEB 4DF4A 4RJVA 5D6GA 1JJHA 1UA1A 2KT5A 3OLAA 2PE8A 2HBRB 4MIAA 3PO5A 3D28A 3OBIA 3GYNA 3T5LA 2E7WA 2N82B 2PD1A 1XMQF 3MM6A 1XMBA 2HIYA 2MGZB 2R7UA 4ED7A 1TUGB 1J5OA 3RBDA 3D54A 1T0TV 4B3RJ 3QZ7A 5HAOA 2VODA 2DHXA 3TJAA 4BDPA 4QYZK 1WTFA 5DGAA 2MLXA 4B9TA 2E5JA 3G8TA 2LYVA 5B0FA 3V6DB 4LFBJ 3DOLB 3PG9A 7AT1B 2BBEA 4RW7B 4ENOA 3H25A 2Y0BB 2J9EA 4YY3J 1RCXB 4U7UD 5JJBA 4FBTA 3T9ZA 3BR8A 2XM3A 4KV8A 3P5TL 4RZRA 3MM9A 1H2VZ 3FVYA 1FXLA 2LDIA 1JWWA 2DGOA 4KFBB 2VFRA 2W8LA 3H2VE 2YWKA 3PYFA 1VQ5S 1S7IA 2W25A 4ETZA 1VDHA 3EGWB 2VD3A 4LSNB 3AOBA 4N76A 2QSFA 3CJSA 1RT7B 2A2CA 1Y7PA 4HACB 2BJEA 4K5SA 2R7RA 4DR6J 1RT1B 1C1BB 4K4XA 1UWBB 2CVIA 4WF9Q 1S97A 1Z1ZA 3CJRA 1OY9A 2EKYA 2DO0A 1VRQC 2ZD1A 2UXCF 1JLGA 4A8QA 4USHA 4PQUA 1SH0A 3P5BP 1U8SA 4HT7A 3EGNA 1G2EA 2MQ8A 3DI6A 2VIHA 2J6SA 1HBMB 3ZFVA 3SCKE 3VAMA 2VHGA 2VBXA 1SV5B 2C42A 3SI8A 1APSA 5A8WA 4B9UA 4NYPA 2C2DA 3GG1A 3HXMA 4A8SA 1VHIA 3VALA 4ED3A 3G82B 3G87A 3MM8A 5LT5A 2DY9A 3HT0A 4Y34A 5DM6Q 3BGLA 3JQJA 4ZLJA 2IVMA 1CS4A 3ENAA 1S1UB 3MEGB 2KXFA 2FZKB 3NBPB 2KL8A 4MYTA 1BXNA 2C2RA 3MMJA 3JQKA 2RSQA 2WBRA 2V67A 3H20A 3BREA 4P71A 3CJKA 1NRKA 4Q8FA 1OPZA 4IFVB 3NXZA 2HYIB 3EGVA 1RA6A 4MKVA 1XR5A 1NEEA 4PWDA 3PX4A 2OPRA 4W4MA 2HNZA 1RHJB 4LVOP 3MMAB 2AF6A 5A6PA 1IBCB 3ZZUA 1IQZA 4LRCA 2IDEA 2ZJRQ 4M94A 5BYSA 1T05B 2XLIA 1B7FA 3J81U 2ZZNA 2D7SA 2LA4A 1RXOB 1KQKA 1XNQJ 2VKZG 2R7XA 2HLUA 5BR8F 4B3MJ 1AFJA 4R25A 1JLCB 1IWAA 5CZVA 2C2NA 1RWWB 3T1HJ 1XK8A 1SKSA 4JI4J 3D66A 2V94A 2CQGA 2HS3A 5L1LA 2AV5A 1CULB 6FDRA 1YX2A 1UEKA 2DIVA 1H74A 2ATCB 5M2RA 3DLEA 4DQRA 4P2XA 1EIYB 3A8JA 2NS1B 2E9RX 2VONA 1H73A
chains in the Genus database with same CATH topology
1X8DA 3UR0A 1N6QA 2HW3A 4C8OA 4F02A 2YKNB 4I1TA 1FVSA 4DSIA 4QWBA 4JOUA 2M5YA 1S9EB 5C25A 3K59A 1T3NA 5B09A 1P8GA 2OMLA 3LPYA 4RBVA 2VV5A 2MKKA 4C0HA 1X9MA 5EUHA 2MQPA 1UVNA 4DQQA 4ZPAA 4IFYB 1S79A 2E5LF 2V8GA 3CUNA 2YH0A 4ZPTR 2X51A 4C3KA 4ED5A 2Q79A 4Y2AA 4BWJA 2OP5A 2AX0A 3ENVA 2N4DA 5GAHU 1Y5NB 4J9LA 5E3AA 2Z8QA 4QJVA 4B08A 1HHTP 3OVSA 3PW5A 5FD1A 4A47A 2VBWA 5DLGA 1NK9A 4ZPWR 2J9CA 3PM9A 5T7LA 2CQDA 4IKAA 3SEOA 4YP3A 4KTQA 4K5RA 4B3TF 2B9YA 2V4JA 1WG5A 3BB5A 1FO1A 1BLUA 1S1XA 2DGXA 2AYEA 1K8AT 2XMUA 5KFGA 3MEDA 3ICLA 5GAGU 1DQAA 1LFPA 2GMHA 1NHUA 4LFCF 2RS8A 2OLWA 1FK9A 1IBMF 3HHKA 2Y1JA 2XMWA 1IKWA 3KOAA 2CJ9A 1IKVB 1X5SA 1YITS 2OPQA 2OD6A 3DRPB 3EPIA 2YKQA 3Q8RB 1REVB 1JLBB 1Y3JA 3TA1A 4Y28C 3GQCA 3H5UA 4L6V3 2LQ5A 1RT5A 1LWEA 3J7YI 2UUTA 3SCJE 2DCLA 3G6ES 2FGOA 2JLFA 4DR2F 1WHWA 3I0SA 4ZP7A 4NLTA 4MAKA 3KNAA 1IQTA 2GW8A 4PUOA 2RKIA 3M6WA 2RU9A 2FB0A 3M32B 2L9DA 3MM6B 3CGIA 1RK8A 1RAJA 5DG7A 1TZ0A 1FKPB 2BM0A 4HH1A 1QTMA 2BANA 1OSDA 1J5OB 1VRUA 3MDFA 3V4IB 2KFZA 1HNIB 2DT9A 1MU2A 2KRBA 2WB1D 1L3UA 5AXNA 3BDPA 2P9CA 1N0UA 1RT2A 1X4DA 2OPSB 2E5IA 2I9SA 4IDKB 4NA1A 4O3NA 4Q7AA 4HYKA 2CPJA 1RP5A 4RNOA 1R8AA 3HO1A 1FRIA 3T6BA 2FLOA 5KG0A 3PR5B 3CIMA 4WE1A 4OV1A 4O0IA 2DNYA 2ILZA 1JKHB 1HWIA 5KFUA 1HWLA 2SXLA 3DFEA 1TL4A 5LXRA 2VH7A 4KT0C 2KJWA 4OFZA 4DBQA 2WSFC 2BZ2A 1S1VA 4ZMMA 2GA7A 5SZTA 2P5VA 3T5KA 3DLGA 4YB5A 2R7SA 5CXTA 1YG0A 5CYQA 1XMOF 4I2PB 1V9OA 2DNHA 4EO8A 4OMFG 3VCDA 4PG6A 1AW0A 2DH9A 1UEVA 4NA2A 2HLTA 4M5DB 4X62F 5A8RA 4OL8A 2C28A 4GC6A 5KT2A 2ZH3A 2JVRA 1LWCA 4FXWA 2CPDA 5G0RA 4JI7F 3HZGA 2ZM6F 5K8OA 4KV8B 1MNEA 3MM9B 2MZJA 3ZZPA 3SYZA 2K1RA 2GIRA 1TKZA 2VC1A 1T03A 1VS3A 1UVLA 3KK3A 4KSEB 4I2QB 3DYAA 3QGGA 5DRKA 3I55S 4WZQA 1SH2A 2DISA 2CQIA 2XNRA 4X64F 5F41A 2DR5A 2WW8A 3MHYA 4J5OA 2M2BA 5HBMA 4TYBA 1HYSA 3HP6A 1DBDA 1H2UX 2B6AB 1FRXA 1JK9B 5LJ5Y 1RTIA 3JAMY 3G8QA 3DRYA 5GAHI 4PXBA 1U24A 1YVFA 1N48A 4DV7F 2RRAA 4HTIA 3C46A 1U6FA 3OR1A 1K1QA 3D0GE 4RW4A 1Z4UA 4O3SA 5F8NA 4FVMA 3AJ1A 4K4TA 2BRLA 3FCHA 1Q79A 1IXKA 1HNVA 3H8YA 3QWPA 4OHZA 4ECRA 2R7VA 2XULA 2NUUG 3VZHA 4ALZA 3CCZA 1YJTA 2XMTA 1HMVA 1XNRF 1FXDA 1TL1B 2AP6A 3FNNA 2ZH9A 1L3SA 2I5JB 3H98A 1RT6B 5IT4A 5C42B 2WB4A 1W25A 5E3CA 5GAGI 4Q44A 4X4RA 2GO9A 5D3GB 4IR1A 2XS5A 1K0TA 4YHHF 3X1LB 1VQPS 1V3ZA 3SSSA 4IUFA 4K4WA 2B9WA 2AX1A 4MIBA 5LSOA 3DLHA 2VFTA 2U1AA 2OO4A 3NNAA 2CJAA 2MMYA 2YX1A 4OX8A 3IFEA 3UE2A 4PWUA 4IYQA 4P6QA 4DG1A 2AWZA 2L48A 2LKZA 4JV2A 2HHTA 3TO8A 2XB2D 2EFNA 2NXUA 2W9BB 3R27A 1DHMA 2BACA 3O44A 3C66A 1IJEB 4LIRA 1OIAA 2IVYA 3HX9A 4NLXA 4ZDNA 2ZBCA 4UQGA 2RT3A 3AJ2A 2EG1A 2R8IA 1AXQA 3P96A 2ZDPA 2VASA 2ZD1B 3V81A 3MR5A 2R8KA 2W4PA 2UUBF 4NCBA 3IAS9 1JLGB 5L1KA 3NG8A 3MGJA 4BC7A 3N6NA 4DUZF 4PQUB 3KLEB 2XGPA 1LW2A 4GC7A 1N33F 1L5UA 3DI6B 3KLIA 3FRYA 1B0VA 1JXLA 3T5HA 3LOUA 1VC0A 3UWTA 2RJZA 3MPVA 2D3UA 4YDDB 3LW5C 1A9NB 3BDEA 4ZCMA 1X4HA 1X4AA 5FDLA 5A8WB 5KFNA 3TNVA 3OPKA 1YJ9S 2EFGA 4TU7A 2FJWA 4YR0A 1QAXA 3NNCA 2ZFHA 2CVEA 5IT9Y 1W2IA 2J0QD 5KFQA 3HT3A 3THPA 2MHNA 4CO1A 5KT7A 4RW6A 5IXUA 2DNRA 5IQ6A 1GXTA 1RT4A 2VC0A 2YNFA 4J9OA 1ZETA 1S0OA 1M5OC 4C9DA 3MR2A 3MM8B 4K50A 3NRBA 4CH7A 4IRCA 2RH3A 3ISND 4A8XA 1N32F 4QPXA 2QIFA 4ZCKA 4DLEA 3RB4A 2B5JA 1Q7LB 2B4PA 1WG1A 3TANA 4ZLPA 1IKXA 2VG6B 1TK8A 1I6JA 4ZHRB 5J2QB 4OZNA 3IRXB 1DFDA 2NREA 3CDWA 5L38A 2ZKTA 1IN0A 4QWCA 4DV1F 1D9AA 4N47A 4IO9Q 2Q1LA 3M1VB 2DR7A 1VQSA 5KT6A 3QO9A 1U09A 1BY9A 3NMRA 1HW9A 3CF5Q 1KONA 4F4KA 2F9DA 3MAHA 5CCMA 1UJ6A 4RWXA 1NAQA 3CJKB 1QJHA 4RLEA 1VQLS 2ROGA 4CH0S 2AJFE 4JI0F 1H2TZ 5L9XA 2ZOMA 2BE2A 3CJ5A 4M8LA 1UJ4A 4O44A 1S1TA 1H38A 1WHVA 3DMJB 3I82A 4MK7A 4XO0A 3KYLA 4PWDB 3HKWA 3BQ2A 4LSLB 2YKAA 1DTQB 1BWEA 2XC9A 2OPRB 1VC5A 4J9KA 2HNZB 1S77D 1UFWA 4X66F 2CPXA 5KFOA 1NJXA 1CSJA 3IGNA 1JNZB 2V8DA 2V8HA 5KG2A 3K5OA 5IS2A 1Z2LA 1U1QA 5F8HA 4AL7A 3G86A 2XSJA 4WFYA 4TU8A 3SQGB 4OZ1A 2JSXA 4WU3A 4X84A 3TA2A 4BWMA 4X4PA 2K7JA 4N8NA 3BN4A 3I31A 1CLFA 5B0EA 1S76D 3FFIB 4XDCA 1H7WA 2O67A 4NLOA 4WTYA 1HR0F 2OFHX 4MMOA 3GFYA 4OI6A 4PG4A 1SUQB 3T9NA 3LALA 5DG9A 3K5MA 1N5TA 4I7FA 1TKDA 2F1FA 3RBEA 2DPIA 3U02A 3RB3A 2FIUA 4YMEA 3G4SS 3C3LA 1KHWA 2WAQD 3OFEA 2FJVA 2YX7A 4JUZA 5B08A 4MTPA 4DV4F 4C8KA 3OTOF 1M5VC 3IXQA 2UXDF 1SL2A 2CPEA 4EU0A 3H59A 1F5CA 3F41A 1EETB 4KB7A 1FDNA 1FA0A 5IZHA 1WG4A 1VC6A 2AQ4A 1C0TB 3IGVA 2CQBA 3QWUA 5B0DA 1RQ0A 2I0XA 3GV7B 2JJ4D 1OO0B 4F25A 3KK2B 4J37A 3PACA 4JI8F 4ILRA 2J0SD 5AE1A 3GR0A 2DGQA 4AE5A 3H5YA 1FEEA 2HHSA 4DDFA 3MMBA 2GC8A 3CIZA 2VZ9A 4H4MB 4NLVA 3RW7A 2PMZD 2XO7A 4KO0A 3M2VA 1E6YA 5IFMA 2KI2A 4YOEA 1FJCA 4CTAA 2JOQA 3BS9A 2IC3B 4I0WA 4QR2A 4CO5A 4NA3A 1ZBTA 1RGVA 3CD7A 2RD5C 4I6YA 1YHQS 1X0FA 4JBCA 3OLBA 2C2EA 4ID5A 4OI2A 2X1FA 3GSDA 2W7OA 2AJ0A 3O2IA 2XCPA 2VBYA 4C11A 2B4UA 4KHMA 2OH2A 4JV0A 3DLEB 3OVAA 2LVWA 4PPDA 3GB0A 3POTA 4URGA 1ZZFA 2HS0A 1VK3A 5BYRA 3G96A 5KT5A 2YKMB 3KLVA 2BR0A 1UAWA 5IM0B 1UP1A 3FQLA 5KFYA 4RBUA 1N6QB 2MZQA 3EUNA 3KLFA 1F0XA 2RDIA 2M0GB 2ZE2A 2ZUGA 4JI2F 5C25B 4MJKA 4U6PA 1UVIA 3Q2TC 3SZ2A 2ASJA 3MXHP 5J1NA 4R5PA 2AJ1A 3BGFA 2GMLA 1SJ1A 2OKQA 1FRMA 3BGRA 3NAHA 3KFWX 1YQHA 1TL5A 1YRXA 1Y5IB 4URSA 2W7PA 2AYGA 2FC9A 4ILMA 1YJRA 1JLFA 2JH3A 2KYXA 4OQJA 5KFPA 4OJ1A 4AXJA 5L9NA 4DR1F 3FDSA 5CA5A 4RNMA 3BSNA 3HF5A 3LWMA 1SQEA 4ZVEA 1A7GE 4NWBA 1VQOS 3GR1A 2VUGA 3MEKA 1V3SA 4N5SA 4RX6A 3HJFA 2Z2LA 3OJUA 1G7CB 3CSKA 2X3GA 1TVRA 4NCGA 2E1RA 2B7CB 1S6PA 5GVQA 5T7LB 2UUCF 1HWUA 1FE0A 1O51A 5K5MA 2DK2A 2EW9A 2YQ3A 3QZ8A 3MFIA 5KG1A 2H9ZA 2V4JB 3JSMA 2ZH1A 1U4BA 5D8HB 1S1XB 2XI2A 1NK6A 4CCHA 4J9PA 3DOKA 2MQMA 3MEDB 4ECXA 1Q7YT 2HHXA 3VAFA 4ZP8A 2LEAA 2VFUA 4ECUA 5E3QA 2FC8A 4UY8T 1FK9B 1IKWB 2LQJA 2B3TB 2D1CA 4YY3F 1HBOA 2OPQB 4C3LA 1TK5A 1D0EA 2PFFB 1VBXA 4K2XA 2BA9A 3OTEA 3FEXB 2IMWP 3QJLA 2E5HA 4YB7A 1TK0A 1CG2A 1IR0A 5HMZA 1RT5B 3KJVA 1LWEB 4O23A 1VQYA 4ES2A 2LLZA 3I0SB 2DRAA 5D4NA 3I5CA 4FXVA 1F5BA 4XPCA 4PUOB 1RTJA 2RKIB 4KGKA 4RU2A 2XNQA 2CPYA 1R8BA 2QO3A 1ZOTA 2OTJS 4LFAF 1VQ7S 4NLQA 2BANB 3M2UA 2X1GA 1VRUB 1SL0A 4BS2A 1K9MT 3AY0A 4QIGA 1HD1A 2YH1A 1MU2B 1UVKA 5KFVA 4QR1A 1YI2S 4G1QA 1RT2B 4TLQA 1C4CA 2BV3A 1DQ9A 4IO1A 1UETA 1ZZNA 3AA9A 3LP0A 3OL9A 4JI3F 2YNHA 3UFCX 1YWXA 3UD4P 1U1RA 4WE1B 4DEZA 3T1AA 2CQ2A 1FHTA 4F67A 4ZCIA 4A46A 3K57A 4C0OC 5D4LA 2PIIA 4I56A 6FD1A 2N4CA 3QJJA 4G6VB 3U27A 1FKAF 2KFNA 3VTIA 2PI5A 3ZZRA 3I87A 3DM2A 2BQUA 1WWHA 3LAMA 5F8IA 1S1VB 5HLFA 2NR0A 2QV6A 2ZH4A 1KS2A 3DLGB 2QA2A 4EWTA 5L39A 5CYQB 3R5DA 2F4VF 1S10A 2FGCA 3D2WA 1D3WA 3CCES 3P3DA 5A8RB 4W92B 3PIPQ 1VQ8S 3BSOA 2EC0A 1LWCB 2FD2A 2VPYB 1LXNA 2HRUA 4U7UK 2CG4A 3TAPA 5G0RB 2HNYA 2G13A 4KRWA 3JSRA 5C24A 2DHAA 4NPOA 3MOJB 3I0RA 1R8CA 5C5JA 2K1RB 1R27B 1VRTA 1TKZB 4C98A 4ECQA 1T03B 2DNKA 3TI0A 4C8ZA 3DRXA 3KK3B 3DYAB 4QZVB 2HIQA 3BO2A 5IT0A 4OHYA 3BEGB 3VAJA 2PDAA 1HNZF 4WKRA 3MMCA 4NRUA 2UUAF 1V6HA 5HBMB 1HYSB 1NH7A 3THVA 2KRRA 3UCUP 1RTIB 4A4JA 1HWJA 3WC2A 2R8JA 2QT7A 1Y4ZB 1S1WA 1RKIA 2HQIA 3FZ2A 5HROA 1R89A 3OR1B 2W4CA 4RW4B 3GZ7A 2FJDB 3S01A 4WFXA 4LF5F 1D9FA 3LP1A 3IS9A 4C8MA 1HNVB 4HVZA 2NYIA 2IJNA 2RE1A 3KG4A 4ILLA 2YWFA 5D77A 2V5HG 2R7QA 2C22A 1NH8A 1MMDA 2VQEF 5KFZA 3DU6A 3IWLA 2YX4A 4OHXA 3VR1A 1HMVB 1SI9A 2Q3PA 2OTLS 2YKPA 2VG7A 3CCWA 5EX3A 3UQSA 5I3QA 1SJ4P 5HO4A 3GWCA 4XPEA 2ZOGA 2UXBF 1N36F 3K0JA 3DGPA 1AROP 3EZUA 3TQ1A 1U2FA 1LQ9A 2A3JA 2LEPA 3K5PA 4DN9A 5LMNF 3CDAA 4J9NA 4ZVFA 2GO8A 4LVNP 3W2VA 2JVOA 4FNIA 3H5SA 3KLHA 3MUTP 2J7KA 4CZCA 4I64A 3CVKA 3CPWR 1YSJA 2HZCA 2DNNA 2WK4A 5F0UA 4JI5F 4DG1B 2ZJPQ 2MB0B 2A2DA 4QU6A 2J0XA 1VOMA 3IO1A 4PG8A 1M5HA 3QAEA 4YQWA 1LV5A 2IAJA 1TUVA 3MCSA 3N5FA 1L3TA 1VIXA 3DRRA 4WU2A 3VQSA 2ZHBA 2HMIA 2XZWA 3JTOA 1U1NA 2J0WA 3SSRA 4IG0A 1S7HA 1DTTA 4L72B 2DCUB 3UD3P 2V9WA 5ITHA 3V81B 1UVMA 3I6PA 3M30A 4HDHA 4Y3CA 5F8LA 3EYZA 2I8EA 5DQHA 2DH8A 1WEXA 4A8OA 4YB1P 1PGZA 1K73T 3SSQA 5IWAF 2ZH2A 1LW2B 2B4VA 1J2VA 1QUVA 1N34F 3R1HA 3KLIB 3T1YF 2M70A 2UUWA 1VQ4S 2KG0A 4B02A 4RWWA 4EZ9A 2GJ2A 3R5CA 1JJ2R 4P7VA 1Q4RA 4MKYA 1SXLA 2HNDA