1LEOA

P100s nucleoside diphosphate kinase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNSLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Nucleoside diphosphate kinase. Investigation of the intersubunit contacts by site-directed mutagenesis and crystallography.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
total genus 45
structure length 150
sequence length 150
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1996-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1leoA00
3DKDA 3Q83A 1NLKL 1PKUA 1B99A 3Q89A 4DI6A 4EK2A 4UOHA 5CABA 1BE4A 4KPCA 4ANEA 1S5ZA 3EVWA 3NGSA 1NPKA 4W98A 3Q86A 1KDNA 3BH6B 2CWKA 3FCWA 2DXEA 3FCVA 1HHQA 1WKLA 1BUXA 3EM1A 3VVUA 2VU5A 1UCNA 4ANDA 4C6AA 1B4SA 3EE3A 2BEFA 1NSQA 1S57A 1NB2A 1MN9A 1NSKL 3FBCA 3B54A 1NSPA 3FKBA 2AZ3A 4HR2A 3VGUA 3PRVA 3FC9A 1WKJA 3ZTSA 1NDPA 3ZTPA 3EVMA 4UOFA 1NDCA 4CP5A 3GPAA 4O0NA 3FBBA 1NCLA 1HIYA 2NCKL 3R9LA 3VGTA 1MN7A 4DZ6A 1VYAA 3VGSA 3ZTOA 1XIQA 3ELHA 3GP9A 2DXDA 4UOGA 2HVDA 5BXIA 3VVTA 1S59A 1XQIA 4S0MA 4ANCA 3EJMA 3EICA 1JXVA 3FBFA 1U8WA 1NDLA 2BX6A 4WBFA 3DDIA 3NGTA 3BH7B 5IOLA 3WX8A 2ZUAA 3B6BA 4DUTA 3EMTA 2B8PA 2B8QA 2DY9A 5C7PA 1LWXA 2HVEA 3FBEA 1LEOA 1W7WA 3BBCA 3Q8UA 1NDKA 1F3FA 1EHWA 2AZ1A 2DXFA 3EVOA 4FKYA 1F6TA 3BBFA 3L7UA 3VGVA 3Q8VA 3BBBA 1PAEX 3PJ9A 3NGRA 4ENOA 1ZS6A 4F36A 3G2XA 2HURA 3NGUA 2DYAA 1WKKA 4F4AA 1BHNA 3ETMA 1NHKL 3ZTQA 4FKXA 3Q8YA 1NUEA 3ENAA 3MPDA 5CAAA 3ZTRA 1HLWA 1K44A 3JS9A
chains in the Genus database with same CATH superfamily
5FIIA 1N36F 4HACB 1T3NA 3CMAS 1UETA 5E5NA 3KK3B 1L5UA 1C0TA 1EP4B 3CCVS 3CDBA 3LAKA 2Q66A 3GCXP 2BE7D 4ZA1A 5H9EJ 1W2BR 3M2RA 3CJ8A 2CFXA 1RT3A 2BKPA 2HFSA 2FHMA 5FLXY 4CT8A 2HQDA 2LA4A 3H5XA 3THPA 4IFYA 3P8BB 3EUNA 5KG3A 4WCEQ 4DQPA 3DRSA 3JYTB 2IRXA 4LF8F 4OHVA 4Z7CA 2ZM6F 2LCWA 1Y00A 3ENQA 4WBFA 1VFJA 2BJ7A 2WVDA 1VBXA 4OX9J 2IIHA 2XB2D 4DOZA 2DNLA 2WZ1A 2EFPA 1T9WA 4TY8B 3BS9A 5LMUJ 1HHSA 4B3RF 2HGLA 4DFJA 3K5LA 1HD0A 4IG3B 3J81Y 4LT6A 3AH6A 2C1EB 3CJ3A 3DLKB 1XMQF 2Y8YA 2LXFA 3VAMA 2CQ2A 1JLEB 2DNGA 4OFZA 3BQ2A 3HI9A 3PIPQ 5LXYA 2FHOB 3ETOA 1RU2A 2UUWA 2LFVA 5CZXA 4B9VA 3BJYA 5ETVA 4RUCA 2ZHBA 2EKYA 4G6VB 2F5GA 1FERA 3EWGA 2AX0A 3CTRA 3LO3A 5FJ4A 1FVSA 1AROP 1W2IA 4UOGA 4F0MA 4ZVHA 4C8NA 2F8HA 2CPYA 4NOHA 2JSXA 2RHQB 1TKTB 4LR7A 1IR1A 4LBHA 4BBYA 3F44A 1RDRA 5HVHA 2IBKA 2NXNA 1GK8A 4F4ZA 3G8SA 4Y2CA 2ILYA 2RSQA 5GAGU 1TMJA 1T9UA 2PFFB 4F4WA 1WUUA 5KFUA 4TXSA 2YQ0A 2D1CA 3CC4S 2IC3B 3ZNUA 3TVZA 3Q89A 3K8VA 2H4YB 1HKAA 2J5AA 4Y2AA 4Q8EA 3FCVA 3U02A 3QJJA 8AT1B 1SIWB 2MKYA 2JL9A 1N33J 4DR7F 4NZ7A 2X1FA 2YQ3A 4NXMJ 4DN9A 1FXDA 3GCWP 2JVRA 3HSGA 3MD1A 5IV4A 1XJWB 4DX8H 5CCLA 3K8WA 4XDCA 2C2OB 3EZUA 4ID8A 3MPWA 1LWXA 1EHWA 4C11B 1RUSA 2PDAA 2CQ0A 3NEKA 5DQHA 4XK8C 2E9TA 3D5MA 5J2NA 1X0FA 3DRRA 3P3DA 1URRA 3AA9A 5JVGQ 3CCTA 3IBWA 4ID5A 3FMBA 2RQKA 1YZ7A 2QA4S 1HBMB 1RYRA 4DV4J 3GMGA 2LDIA 4L74A 4ECRA 5F9LA 1UJ5A 5IT9Y 1JLCB 2ABYA 2W01A 2DGQA 3VGUA 1Y7PA 1U6FA 2QSFA 3CJSA 3HHLB 2Z2MA 2V8GA 1SQGA 4QQBA 4LF1A 1NXIA 4WTOB 1O6XA 3LGHA 4OX7A 2E1RA 3PFEA 1TL1A 1RA6A 5BXIA 4HH1A 2Q79A 3NCQA 2L9WA 2BACA 5KFTA 3TUIC 1S1XB 2QIFA 5AXNA 1RHMB 2Y8WA 3DHXA 1N0VC 3MF5A 4OI0A 3PO4A 5CYQB 3OVAA 2R7XA 3P5TL 3W5XA 1U1PA 4Y28C 3MCSA 2EWHA 1LQ9A 3DDKA 1N6QA 3HO1A 5GVQA 4MT1A 1RU1A 2RJZA 2JEJA 2I38A 2HQFA 3TR5A 1YJWS 4OHXA 1OPZA 1FRHA 4WZQA 4DI6A 2JFKA 3POTB 3UNGC 3NGKA 1T7PA 3LP2B 2BBEA 3KG4A 4MKVA 2CNLB 2WBRA 2F8MA 2R7TA 3BV8A 4N8OA 2PA3A 3JAMY 4YDDB 1RTHB 4LSNB 4OYWA 3CIMA 2R8IA 3QRQA 1G3OA 2ZVSA 2UVUA 2RDIA 5KFSA 1X4AA 4P7VA 4RU2A 4USWA 5THWA 2XS5A 2FPHX 3HX9A 2UUAJ 3U1LA 4ES3A 2GJFA 3W2VB 3BREA 2OD6A 2PE8A 3NOCA 5HMWA 3A8IA 1SIZA 2CDRB 5M2PA 2ILZA 3ETMA 3OL9A 1WC0A 4DV0J 2ZEJA 3NMRA 1CLFA 4LSZB 2RU9A 1SQEA 4DZDA 1HLWA 3MM8A 4UUWA 2AGPA 3OTOF 3T5HA 4YDXA 4O0IA 1NPRA 4EGLA 1WHXA 2W7OA 2HAFA 1YBTA 2MZQA 1UCNA 1T02A 4FPRA 2BEFA 3CCWA 1R27B 3LA0A 4KGMA 1QJHA 1VMBA 2MKSA 3RUBL 5KFIA 1HBUB 4OI4A 2XSFA 4PEOA 3NNAA 2AJFE 3H0PA 1X4EA 4DR3J 3I6PA 3ELHA 3I9V9 3KJVB 1JLAB 1WG4A 4CCHA 2LYVA 1U8WA 3NGTA 4A8OA 4IFVB 2LQ5A 1FFSB 4UT4A 1NK0A 1WDDA 2MB0B 5HAOA 2CJBA 3AQPA 2YKNA 2KDOA 4ENOA 4OI3A 1Y5LB 3JSRA 4ED0A 3GB0A 3GYNA 2YNHA 2Q1LA 2QC3A 1RTJA 3DCAA 4E8UA 1CBKA 4TVAB 2W9BB 1KR4A 4JI1F 1U2CA 3GV7B 1NKBA 2PC6A 2DRBA 2DGVA 5KFNA 4JYAF 3D3CJ 2E9RX 2XBPA 1UW9A 4X4QA 4QCLA 2DTJA 1ZAWA 3IWLA 1RI7A 5F3TA 1VC0A 2WVEA 1SV5A 4M5KA 1RBAA 2ALZA 2VHGA 4JV2A 4PG5A 5BJRA 3KWMA 3P4UB 4PCQA 1RCXB 3JQKA 1TK0A 1HMVB 1KLMB 1Q8LA 2J6UA 4K4UA 2D41A 3CCQS 3PYDA 3FQKA 4XPEA 4NYOA 2DYAA 1TK8A 1XN9A 4JI8J 1C1BB 2VBZA 1ZYQA 1I51B 4OZLA 1MROA 3ZFVA 2CVIA 1S0MA 1IKXA 3OR1B 5K14B 3PW7A 4Z2XA 3C6TB 2HHPA 2UUBF 4RW9B 3FVYA 2I2YA 1DQAA 4KT0C 5I42A 5H9FK 5LJ5Y 2MQ8A 2VU5A 4I2QB 3BF4A 3M2UA 1JXLA 2XGQA 2RIJA 3VAHA 3NXZA 3RR7A 1ZTTA 2AF6A 4PWUA 2DH8A 5IFMA 3FEYB 2L3MA 3OR2B 2HS4A 4C0HA 2Z8QA 2HZCA 3PR5B 1UVKA 4YB1P 2M4MA 1RABB 5HANA 2W9CA 5JVHQ 4P6QA 4TU9A 5CQGA 1YJ9S 3PJWA 2XY7A 3MEGA 1UPMB 2W8KA 3LGNA 4KHPJ 2B5JA 4N76A 5KG4A 4HACA 4B9NA 2RQMA 1SCJB 4NLVA 2DNOA 1WEYA 5JXSA 2VFVA 3KK3A 1LFWA 4IOAQ 2V9KA 4YN3B 4K2JA 5F8HA 4O3SA 3BQ0A 4EUVA 2AEFA 1JLGB 4TLRA 1HNVA 3IAS9 4J9VA 3OFHA 4DL2A 3C6UA 2KM8B 2XNRA 1HBNB 2ZKTA 4C8KA 2Z58B 3QIDA 5JJBA 3UR0A 5D4OA 3NCRA 3V6DB 2KT3A 2XMMA 2J6SA 3B54A 1YRUA 3BYRA 5K8MA 4G1QA 4J9MA 2YNGA 3RTVA 3OFEA 1OY9A 1TKXA 4NLYA 4JI5F 2EXUA 4LFAF 4HKQA 1RTDB 2G2ZA 4R5PB 5DDRC 1QUPA 1WTFA 4RW4B 4ED6A 1M1GA 4ECVA 4DSFA 4O3QA 2ACMA 2MKHA 4PR6A 1KEKA 1IKYA 1ZM9A 5J1EB 1OS5A 2DO0A 4L75A 1P1LA 1J2VA 1YLXA 2K2PA 2FY1A 1YBUA 5GMKa 5LJ3Y 2QJ3A 1WELA 3AD9C 2WONB 2MZJA 2XO7A 2QZ8A 3DLKA 2V2QA 4MJKA 3LW5C 1S12A 4LQ9A 4NZ6A 4GO7X 3PYFA 2AJQA 4DV5J 1D3WA 4ECTA 4B17A 1JLEA 4M95A 3GSIA 4NA1A 4WYWA 3OSNA 4A8YA 1S6QB 4HDHA 4DLGA 2DPIA 2ZFHA 4XPCA 2DD8S 3CD0A 4USIA 2FYXA 2H5JB 2HIYA 2YWFA 2ZD1B 5CD4H 3KLVA 3MOZA 4ERDA 2B4VA 4G1PA 4A8KA 3DNCA 3FBCA 2NREA 2B43A 1HNZF 1WEZA 1U6ZA 4LBPA 4CP5A 2A6OA 2LXUA 1RT4B 3R9LA 4HHUA 1DAXA 2DR8A 1KHVA 1TKTA 4AQYJ 3VVTA 1HQEB 1LWEB 1LK5A 4BDPA 1B0TA 5IOLA 1OQ3A 3IG1A 1FE0A 5ETPA 4IDKB 2B8QA 1NK9A 4UY85 2H4WB 3KG0A 1RP5A 3PJXA 1UA1A 3MM7B 3D66A 1KOHA 2ZNYA 3PCOB 1N34J 5F9NA 2B51A 3EZ5A 3TAMA 2XZTB 4BLGA 3CJRA 5H1SV 2YX7A 2OEJA 2C2ZB 4F0HA 1S6OA 2WW8A 4MK9A 3MOJB 3QGIA 4K50A 1FHTA 1YJNS 5A8RA 4RW7B 4KFBB 2C2DA 1Y11A 2DXEA 4RUHA 2CWXA 1MMLA 2VUGA 2CZ4A 3AB4B 2FHJA 4P71A 1WWHA 4UF4A 1UL3A 3HP6A 3HVWA 5J1NA 3H20A 3SQGB 1S48A 1LW2A 4AXJA 1TUWA 4ZPTR 3PW2A 1QAYA 1RTZA 4B9MA 2ROGA 1FCAA 4K0KJ 5A0YB 3MR7A 3MAQA 3HPOA 3TZWA 2IHR1 1WC5A 1YVFA 3FK4A 2RQ4A 4PRFA 2D69A 4QR2A 4PWDB 5IC6B 2HLTA 3JSMA 3KNGA 4QW9A 4RWWA 2IY5B 2VG7A 2R8KA 3CNQP 4EFAC 4JI6F 2CPXA 2W24A 2UV8G 1OPIA 2Z56B 1UP1A 4K4TA 2HHQA 2JC0A 2UUTA 3ZTPA 2UVWA 1JJ4A 4CNZA 1S1XA 3QMQA 4I7FA 4RO0A 2C2MB 4HEA9 4CO3A 5MLCV 3UI3A 5CYQA 4O4GA 5GAGI 1T11A 4LJMA 2LEBA 2J76E 3A1YG 2M70A 4O44A 5LT5A 4ZCLA 2B9YA 2GV1A 2F4VJ 2V34A 3V2UC 2GIRA 2YPYA 1ZS6A 3CIZA 3POTA 3S1TA 1N0UA 2R8GA 3D1OA 2R7WA 2CPHA 3HSZA 2MSTA 1VQSA 3LP2A 2MY7A 3OSPA 1DQ8A 4PXEA 2I5JB 4C3KA 1RE1B 2PEBA 3QATA 5KFGA 3ZZRA 1RTHA 4Q2MA 2V0NA 3M8RA 2VICA 4FBUA 3J80U 4M63A 1U24A 1FJGF 4BS2A 2R7VA 1LWCB 2FQQB 1GEHA 1TMMA 3OTBA 2IFXA 5KT2A 3MEEB 2YQ1A 5B7WA 2O01C 3KDOA 2KYZA 3VGTA 3HVAA 2BM0A 3B82A 1NK6A 4NA3A 4N77A 2QG9B 1DJ0A 2BX6A 1UMJA 2CJYB 4RPFA 4MAKA 2BQUA 4PPDA 1X4DA 3QLHB 3QSIA 2DB1A 4WP9A 3ZC4A 2E7VA 4YQWA 1KONA 4X66J 4UTGA 3HVTB 1ZETA 3TO8A 3CF5Q 3JB9k 4LF5F 3K0JA 2VC0A 4PG4A 2KFNA 2YH1A 4V19J 1HBUA 4ZVGA 1J5EF 1HHQA 3EM1A 3HHLD 1Q4RA 2ZOMA 4KR0B 2DR5A 2D3OR 4QYRA 3I9ZA 4ILLA 4CIOA 4IFVA 4OX8A 3D4JA 3MDFA 5D4LA 4UOCA 1QTNB 3R5CA 5DM7Q 4Y34A 2COLA 3M8PA 3ZTOA 4BC9A 3FDSA 1XQIA 1VQOS 2GHPA 3TAPA 3L9ZA 1FNOA 3HVRA 2HHUA 5G0RA 2EVZA 1Q78A 4CO5A 2EFOA 1UVJA 2B6AB 1N36J 3G2XA 4HDGA 2AMCB 4CLWA 1BHNA 2LMIA 2ZBQA 3KK1B 2W9BA 3NGDA 3G71S 3D6HB 1XC9A 3JTNA 5F41A 4PXDA 1QSYA 2AIRB 2W2QP 1HPZA 1JK9B 5E3PA 1GX6A 3GONA 1PC4A 4TNOA 2VOOA 2N4DA 1EX8A 3QAUA 3DGVA 5HROB 4D3HA 4KV8B 1NK5A 1E6VB 4IO1A 4LF8J 3TUPA 2ZM6J 2RAQA 3QNWB 4M5JA 2YKPA 2H5EA 4CYUB 1JKHB 1UVLA 1T03A 3TQ1A 3V81B 3IBFB 1S77D 8RUCA 3DRPB 2HK2A 1GT8A 2AU0A 1HNXF 2OJ3A 3SFUA 3MM6B 2J9EA 4C0BA 4B3RJ 1C1BA 3FFIA 4EZ9A 3GJTB 2X3GA 4NMLA 5E33A 3OR1A 1OY8A 3OXLA 1XMQJ 3W60A 1D0EA 3M30B 4OYXA 5IWAF 1O51A 4FS2A 1JIHA 4RW9A 5HQLA 5JUMA 3FZ2A 4FXWA 4I2QA 4U7UD 4WK1A 1WTBA 3GIMA 4ZIVA 1H98A 2HQIA 2B7CB 5GMEA 2RKIB 5F8MA 5EUHA 1N5TA 2J7UA 3I0SB 5HATA 4LUBA 3DOLA 4OJ1A 2KRBA 3BH6B 4LRFA 1LKZA 2D9PA 1CG2A 3OVBA 1I3OB 1ZZFA 4I56A 1CS4A 1H7WA 3HKZD 2VFUA 3CPWR 2R4FA 2KFZA 3NOGA 2HVZA 4LF6F 4RNMA 3IFEA 5LM7E 2FIUA 2LVWA 5G4DA 3WDOA 1H2VZ 1L3TA 1AXQA 3HSDA 1TL4A 4NWBA 4WJBA 2J8SA 3KYLA 2F3JA 3ILIA 2AHOB 3IXQA 2J7WA 1FTRA 1QVGR 2J8AA 3MAAB 2PI4A 4EO6A 2E5JA 5B0BA 4RW8A 2VG5B 3W2WA 3RRGA 3BN7A 3UN3A 3PV8A 1C1CB 2CDQA 1RT1B 1JLGA 2P9GA 3IO1A 2XLKA 1YI2S 2YPZA 3KTQA 2VDIA 3L4BC 2EI5A 2W1BA 4IR1A 2HQ3A 1Y5IB 1RWVB 1XNRF 4J9RA 4CZCA 3G6VA 2HKEA 2ZBIA 3V6DA 4DR7J 1VGYA 5KG7A 2FGCA 1BQMB 1RWKB 1CVJA 4KSEB 5K8OA 3UD5A 3EX7B 2YNIB 1X0PA 1RTDA 4KKOA 3THTA 4RW4A 4ECYA 1UVNA 3SYZA 3EVMA 3RRHA 5J1EA 3GPAA 1R43A 1VQ6S 2VBXA 2H1YA 3LWLA 2DH9A 2VB6A 5D3GB 1FJ7A 2BR0A 4LRBA 3GP9A 4I2PB 4NRTA 4CQ1A 2WONA 2ZZMA 1HYSA 4ANCA 4ALZA 1QAIA 1HW9A 3RZAA 2LLZA 3WC2A 4ETZA 4OZJA 1DHMA 2L9NA 5LOQA 5KFDA 4K5SA 2R42A 1RSCA 3MPVA 2E5HA 3UR3C 4Z37A 2IVFB 4DSIA 4DWIA 2QYCA 1S6QA 1NJYA 2HGMA 4QWCA 3L95X 3AFGA 4R0EA 4BCAA 1TL3A 3Q8SB 3UN5A 4WZMA 3QO9A 4ZVEA 3VV2B 2AJ0A 1V5IB 4NCAA 1WEXA 1IKVB 1KDNA 4YB7A 5KFAA 1KQGB 4F4KA 2JH3A 4KY3A 2HNYB 4H4OA 1NB2A 2N7YA 1VBZA 2GMLA 3M2VB 1B7YB 2A10A 2LECA 4TN2A 3CDEA 2LQJA 2VBWA 1HQEA 1LWEA 2CQ1A 3ISND 1WG1A 5FD1A 1RT2B 4IDKA 2RF2B 2HFUA 3OHBA 2KT2A 5LL6d 3GR1A 2RUGA 3QSYB 2MZ1A 3TP2A 3DLBA 5IC4B 4FPIA 1UWBB 5ETTA 3ZNJ1 5DG9A 4FP9A 2YX1A 3D0IE 1ROFA 3Q8VA 5KG1A 3FZBA 1VK8A 5EGYA 1V3RA 4OYBA 4J9NA 5ITHA 2ZHAA 4YOEA 1BMQB 4FKXA 3D6TB 4RW7A 4KFBA 3CDAA 4LSLB 5L1IA 5L1KA 4XAKA 3IS9B 4HL9A 4KPYA 4YMEA 4X65F 3NP5A 4NMXA 2OPSB 1HBOB 1BQNB 1BXNA 3QJLA 1Q82T 3UDLA 3Q86A 1SL0A 2Q6CA 2A1BA 1JX4A 1YRTA 1A9NB 1X4CA 1VI7A 1Q53A 1Q5YA 1CULB 1C4AA 5DJBA 2EFVA 1U4BA 4EBDA 3BSOA 4YR0A 2FVRA 3DLGB 3M32A 5A0YA 4FYVB 3CWJA 3ZZUA 1DRZA 2WB4A 2AYGA 4J9OA 2M9KA 4Q7AA 4CT9A 1N32F 1TR0A 4C2MA 2YXLA 3C15A 1CJTB 5A8WB 4WU2A 2OO4A 1TP7A 2RVJA 3HDSA 2DHGA 3NAIA 3VF0B 4PWDA 2JVOA 3OTOJ 2CPJA 4DR2F 1DLOB 3PHEA 1BD6A 4PYAA 2W9AA 1ZM3A 1SJ1A 3CUNA 4RZRA 3Q8YA 4CNYA 3RYLA 1AA1B 1KS2A 5A8KB 2EFGA 2CJ9A 3KLGB 3I4PA 4AD6A 2DVIA 2JZ5A 3ONQA 3MCNA 2W8LA 1GTHA 2GAGC 2AV5A 3MFHA 2MJNA 4TQSA 1C0TB 4IOBA 2UU9F 1HWUA 3W8PA 4B3MF 1WHWA 3PTWA 4IH7A 3M2RB 4XDDA 3G8QA 1SJFA 3MUMP 1OSDA 2UP1A 2HEKA 3DRSB 1FX4A 3AAWB 1HQ2A 4K2XA 3WQPA 1PIEA 4FBTA 4F67A 2MLYA 4PQAA 3G6XA 4A48A 4DPXA 2IM2A 2ZUAA 2I9SA 3UCGA 3TVKA 3T5LA 2HHXA 4ZS6A 3W7BA 4N7TA 1H0HB 2HZAA 5KFBA 1OYEA 1RHUB 3PRDA 2V69A 1MNEA 2YH0A 4OYAA 2DO4A 1IUJA 4F4YA 3ILOA 4JI1J 2RRBA 5HVGA 4JYAJ 1U1RA 4WKYA 3CULA 5GMDA 1LWCA 2M0GB 1T9VA 2OLWA 2NZCA 2IVYA 4ZHRA 4DCOB 3MEEA 2KZZA 2FVQA 5LMNF 2KB2A 3GG1A 4AL6A 1NJWA 3HT0A 4I1TA 2DGXA 3JQJA 3PW5A 4DBQA 3FC9A 1H38A 1FRIA 5ADZA 3CCSS 3HCXA 3EYZA 3RW6A 2HWIA 1JLFB 3RBZA 5T14A 1AW0A 5HMYA 3MM9A 1WOOA 1JMTA 4LREA 1ZAVA 3M6WA 2GFFA 4HYKA 3QLHA 2DXDA 1IBKF 2HNDA 3K57A 3W9IA 3TZZA 1YTYA 4UY8T 1BLUA 4RL1A 2AEJA 4LRCA 4P2MA 3LANA 2UUBJ 4M1KA 1S1TB 1UEUA 2ZBRA 4Y3CA 3R6LB 5GAHU 3QT5A 3MPDA 2MKKA 4DL5A 3HT3A 2AX1A 3W64A 2FJWA 1S49A 1VQNS 4LIRA 3NGSA 1SJ4P 2V67A 3FCWA 4ATNA 1RCOB 3C14A 4PG8A 3GJQB 4C48A 3LALA 2HWTA 2OIHA 3OD2A 2AWZA 1ITPA 2VODA 2XULA 3IR7B 3UN2A 3O2IA 3FBBA 1NCLA 4W4MA 1TK5A 2GCFA 3O1LA 5KFQA 1GX5A 2FJBB 4HVZA 2B6AA 2PFDA 3TEGA 2C2EA 2FHKA 1KVJA 1MSWD 6FDRA 4L72B 5IM0B 2BKOA 1LEOA 1PAUB 2JDJA 5KFLA 3TOQA 2U2FA 4USMA 4FF2A 3V5RA 4OI1A 5F8IA 1AFJA 3NGUA 2BJEA 4OQJA 1QVFR 2RRNA 2XI3A 5B0GA 2R7RA 1GFWB 5D0GA 4NI2B 5J2NB 4N41A 1RQ0A 2DHAA 2RRAA 5HROA 2PA8D 5DETA 1L3VA 1P1TA 1R89A 1E6VA 3HXMA 1GNKA 4M5DB 2E5IA 3TAQA 2BJDA 1RT7B 4JI5J 4G3IA 4F3OA 2GO9A 4LFAJ 4BWMA 2LQBA 4PYDA 2GVDA 1WKLA 1FT8A 3EDRB 5HMZA 4WE1A 3V81A 3NBPA 1QUVA 2OI2A 4FVMA 2PD1A 2WK4A 1OQ6A 2MLXA 1ZTWA 3W9JA 4OJGA 4EYIB 4ELUA 5AXKA 3TI0A 1EZZB 2W4CA 4DL7A 6AT1B 4DR1F 1K73T 1ZA1B 2DRDA 2GGPA 3M30A 3HZGA 4A8WA 4NLRA 3HHDA 4ICLA 1DARA 4B08A 1FI4A 3AJ1A 2XMAA 1WF2A 3KKFA 1YDLA 2U1AA 2KL8A 3HHNB 4ETXA 2MY8A 4DF8A 1WKKA 3K5PA 2W7PA 1UKUA 3I0SA 4GVLA 1N4LA 2H48B 2F1FA 1M5VC 1HWLA 1UZDA 1F5CA 3U1MA 3D1HA 3M6XA 4I67A 3E51A 2OTLS 3MMBB 1HNZJ 1N56A 3AQOA 2Y3YA 3JQMA 2G2OA 4N5SA 3IC1A 3MR3A 2DNQA 1T3OA 1K9MT 4LRAA 1G7CB 2GAHC 1VDHA 1X4BA 4B3SF 2KN4A 2WVCA 5A2QU 4JI4F 3SI8A 1RT6B 3PW4A 1CPZA 1VQMS 3FMWA 2MPUA 3OW2R 4A8FA 4UOFA 4NLDA 4FDFA 3I87A 4CO4A 1G1XA 4AE5A 2R9LA 4J5OA 2GHWA 3BB5A 3MAAA 1VYAA 3PG9A 3NNHA 4YP3A 2I1RA 5EDWA 1YQHA 1C1CA 1KFSA 4IO9Q 1RT1A 1WOSA 3CCLS 4CM0A 2YKMB 1GXLA 1HNWF 5LSOA 2JLGA 1D8YA 2ZOFA 3I5BA 5KT7A 2NZ4A 4AL7A 3BBBA 4OZ1A 3V6JA 2BRLA 5KFFA 1X4HA 3WIUA 2MGZA 3LWMA 1RLDA 4U95A 4NLSA 2YKOA 2GIFA 1X9MA 3M8SA 3LOUA 4I69A 1PGZA 3I96A 3MM8B 2DKOB 1GH8A 1YITS 2CYYA 1SJ3P 4KPCA 1K0TA 2G1HA 2G9OA 1NPKA 2QTWA 4R8UA 3GE9A 5D3GA 3AT1B 4C8YA 3M8QB 3RBEA 2LU1A 3NWRA 2AZ3A 3V4MA 1FD8A 1WKJA 3DFEA 2KT5A 1UEVA 1PG5B 2KO1A 3LQVA 2Z30B 3VAJA 2DH7A 5KFEA 4CLUA 3T41A 4WK3A 1H72C 3D28A 5BYQA 2V2VA 5C2GA 2AYMA 4DX6A 3QT8A 2DY9A 2CQ3A 4LR8A 4C8ZA 1DTTB 3SFGA 3BGUA 3M6UA 2YKNB 2V63A 4FKYA 4P75A 1F6TA 3VAIA 3N9UC 1R0AA 4CWBA 2DJWA 3KHHA 2DNZA 3QIPA 4JI6J 3MURP 4I68A 2CRLA 4ILMA 2G0JA 2W4PA 1DURA 1VJWA 4GRSA 3M2VA 1SUQB 2HLUA 4Y0FA 1VRUB 2YNHB 5J2QB 3PX4A 1NLKL 1J27A 2C2KB 5HI7A 3GIKA 2YY3A 3W65A 1U1KA 2CG8A 4F4XA 4RNOA 3HLUA 1RT2A 4ZKAA 4NLPA 3ILJA 2RF2A 1RAOA 3T6BA 3VQSA 3EGNA 5E2QA 1PJ5A 2QL7B 3R1HA 3C46A 3CO9A 4MKAA 1S6PB 4ZLLA 2UVVA 5IT0A 2N82B 1G6BA 1SH2A 2NQPA 2DCLA 2G1DA 3C19A 1SV5B 2OSQA 2C3OA 4N47A 2HHWA 1U0HA 1NJIT 3SV3A 1YJUA 4ZN3A 2APOA 2MSSA 1UZHA 4P72A 1NDLA 1Q0NA 4WU3A 2VQEF 3T5JA 2ATCB 2V2ZA 1W25A 1N48A 1UAWA 4LSLA 2AJ4A 2EK1A 4RLEA 3CJ0A 2E66A 2EFQA 4GKKF 3S8SA 5HP1A 2FJVA 2OPSA 1HBOA 1BQNA 2D3O1 2W2NP 4NLOA 1BY9A 1Z4UA 2Y1LB 4DV6F 2V8HA 2I0XA 1EKRA 1FJGJ 3P45B 4KGKA 1FKOA 3AD8C 2XYHB 5E3CA 1RGVA 1NB7A 4Y65A 4ANEA 2VKZG 3KHRA 5I42B 1VQYA 9RUBA 3OL8A 3M8YA 2MMYA 5BYRA 4KTQA 1PSDA 5EWGA 3DLGA 1PJ6A 4EYHB 5EWEA 1YSJA 1LOUA 2DNHA 3HFZB 4ZJOA 3H2VE 4ZOSA 1TU0B 5E3QA 5CHCB 1CJVB 4JUZA 2VPYB 4U9RA 2FC9A 3C3LA 4LQ3A 2O5DA 2W9CB 1DLOA 3IN5A 2BUNA 3OLBA 2CQIA 3MEGB 2DEIA 5A8KA 2JWNA 2I6WA 4Y6IA 4LF5J 2UV8A 2B5JB 3CJQA 3TJ9A 2ZITA 4DF4A 1NEEA 4U7UK 3BM7A 1QSSA 1J5EJ 2BOPA 3CSKA 4DPTA 5F0WA 1YJ7A 5AXMA 2HZVA 4ZITA 3OPKA 1HNVB 2JLEA 4KAIA 2J0SD 4WP8A 1EETA 3C6UB 4NZ0A 1OJ4A 4KHMA 4F8RA 4KIAA 5KG6A 2ZH4A 3L7OA 4G1QB 3PFOA 1R8AA 2YNGB 2RNEA 1XR7A 2UXCF 1O0PA 2XLJA 1TKXB 5KT6A 4I64A 4GMKA 3CJ2A 3LH2S 2BANB 2E7WA 4OYOA 1F5BA 3HJVA 1U02A 1Q7LB 3MEKA 2QA2A 4QIEA 1FF2A 3RRKA 1IKYB 2RQCA 3BSCA 2YNFB 5K5MA 2CG4A 4EMDA 2HK3A 3DRYA 1OY6A 2IAJB 4OI6A 4RW6B 2DIUA 1KNZA 1FDBA 5F8NA 4HTJA 1I94F 1TUGB 2ZJPQ 1IN0A 3SDEB 2NUUG 5HMXA 2A2CA 4UW2A 1K44A 2DHSA 1YKWA 5GADU 2OPPB 1J5OB 3V4IB 2O3DA 4K7QA 5I3PA 4BC7A 1JLFA 2J9DA 3EDQB 4C6AA 1HNXJ 3DXBA 2LEPA 1C0UA 2FGOA 4DUZF 1UFLA 4ES1A 4USJC 3IP0A 2M52A 4OLPA 2YWGA 2MHEA 4FYYB 3V6HA 1M5PC 3CGIA 2XY5A 5EWFA 3DLHA 5AE3A 2PGCA 1HR0F 2DISA 5IWAJ 4QBUA 2NUHA 1S1TA 4QYZJ 2BW7A 3IG1B 3GSDA 2OEKA 3AJDA 3MGJA 3O6QA 1S9EA 2J0WA 5E0OA 3D7SB 5L9XA 1L3UA 4NLWA 3B8HA 4DDFA 5KG5A 1REGX 2BM1A 2OFGX 3TAMB 4I0WA 2CUYA 1S7HA 1FJCA 4WKRA 3OJSA 1WORA 2WSFC 2CPFA 4ZCIA 4UOHA 1HL6A 4LF6J 1K1QA 3UD4P 5A8RB 3J7Z5 2OH2A 1RTIB 3CDWA 3I32A 3PO5A 5IQ6A 1H6KX 3IR6B 3NCPA 1SC3B 4CLZA 4ZLPA 1OIAA 4HR2A 3C66A 2XCPA 3TW0A 3A13A 5IM0A 3DLJA 2MLZA 4QWDA 4M5GA 4P2SA 4B3OA 4RNFA 3IRWP 1XMOF 1LW2B 2BOAA 2XS2A 5IS2A 3EJMA 4NI2A 2LEAA 1XNRJ 5DQGA 1GMWA 4AXIA 3EVOA 3BKTA 1DTQB 2BJ9A 3DHWC 4F4AA 4M5DA 1EKSA 4HTIA 2R7SA 1RT7A 3OTCA 1T0TV 1X5TA 3WIVA 3ILLA 1OO0B 5CAAA 4NX9A 3KK2B 5DDPC 3D0HE 3TARA 2DT9A 3JSMB 4OYZA 3LP1B 2VG7B 1RISA 1NH7A 4DHVA 1KQFB 2OELA 4NLTA 3TRGA 2GW8A 1FEEA 1FXRA 5ETMA 1PC5A 1AT1B 1S57A 2EPIA 3JSBA 1RHRB 2XY6A 2V8VA 3FKBA 3DDNA 1P8GA 3BYPA 4I7FB 1WACA 3GG0A 4G65A 4JV5F 1YBAA 1WDTA 2V8PA 1LK7A 4OZ3A 2JOQA 1KOOA 4O4GB 2OMOA 5GAHI 4DQSA 5CYMB 3HHKA 1VR6A 1SC4B 5KFRA 4O44B 2D9OA 3N28A 2VFRA 2QX0A 2CNOB 4F0KA 4IYQA 2WB1D 3MMBA 4MK7A 1FJEB 2MQNA 1GXTA 2JEFA 4MYUA 3I0RA 2YWWA 3E01B 4LMZA 3BGRB 1S0NA 4OJHA 1VK3A 4IQXA 3H90A 4PXCA 1RT6A 2NSCA 1M5KC 4OL8A 3M4XA 5EX3A 2IDEA 4X4SA 3TJ8A 1SBRA 1ACMB 2RD5C 3UQSA 3W3SA 2HS0A 3MMAA 2VPZB 4X4PA 4K4VA 4FNIA 2Q43A 2FZKB 4Q45A 3NG8A 3VTIA 2DHXA 2XLIA 2VBYA 2YKMA 2CZVC 2F7VA 2B4OA 1B0PA 3AXKA 4TY9A 4USUA 4ZK7M 3JSYA 1BGXT 5D4PA 3IGVA 3G6ES 1SH3A 2VJVA 2DGSA 1JJHA 1A6LA 2QA1A 5HBMA 4LVOP 2IDLA 3ISZA 4X65J 4IUFA 2Z57B 1S9FA 3KLEA 1JJCB 4P9SA 1D9FA 2NLWA 4E98A 2XEXA 2IJNA 2R8HA 5KFJA 2ZC3A 1OWXA 3UDVA 4DFKA 4DL4A 3M8QA 2EW9A 4UQGA 3O44A 2L08A 1UVIA 2V2KA 1WC1A 2A0FB 2GQQA 2X1AA 2MKJA 1R31A 4NLQA 2CWKA 1T9TA 3F56A 4PQUB 2FUG9 4P2FA 5GAEU 3CXCR 1M90T 4M5NA 1N32J 3K7RA 1RAGB 1AZSA 3QWPA 2X1GA 4A47A 1NDPA 2HFZA 3LTOA 2OD4A 4RR5A 3TUZC 1DTTA 3M8PB 5C25A 4DR2J 1Y0HA 3H4DA 3J7YU 2VIHA 4ECWA 5G0RB 3UPFA 5CA5A 1NHVA 1ELOA 2IJFA 4R25A 4KH0B 4RU9A 3S6EA 2VL1A 3MTKA 5KT4A 1SUQA 1VRUA 5J2QA 2IMWP 3S7RA 1RLCL 3D1QA 1IWAA 3MD3A 2UU9J 1JQGA 1IBLF 1FDNA 4DL3A 1PILA 5D77A 2MTLA 4B3MJ 2FJDB 1FDDA 2KRRA 1S7IA 2UVRA 3I82A 1HPZB 1IXKA 4OYIA 4ZP9A 2E9ZA 2DNNA 4FVCA 3R3TA 1S6PA 2ZE2B 5DM6Q 4B9TA 4O3OA 3FRZA 2EKNA 2HRTA 1U09A 4DUYF 4ECQA 4X62F 3BO4A 1S79A 4OHYA 3KFWX 5KFVA 3IR5B 2IM3A 2MKIA 1YJRA 2LKZA 3MR2A 5J2MA 4IRKA 1V3SA 2PO4A 3HULA 3DLEB 1F5AA 1RKIA 3RAQA 3MMCB 1T03B 1FRKA 5D0RA 3T3FA 1ZM4A 4CLPA 3VALA 1VQ4S 2BABA 3W62A 4JI3F 2V50A 4NLUA 2DCUB 2VASA 4ELVA 3FFIB 2JRSA 2XMJA 5K8NA 4JI2F 1S1VB 1M5OC 4ECSA 3LP0A 3NRBA 5HO4A 2VQFF 2QSWA 5U47A 3QRPA 3J80Y 2PEHA 2YWHA 3GLJA 2VA2A 5B09A 5KFKA 1S72S 2QE5A 3H25A 1P9QC 2Z2YB 3US5A 4FF4A 2GQ2A 4DPOA 4CTAB 2IRUA 5LMNJ 5KOWA 4GO5X 3M8ZA 5DS7A 4YS2A 3E2EA 2NXCA 3M05A 2IJRA 4C3LA 1ICEB 3CB4A 1AYEA 5KTQA 1NKCA 1XWLA 2MZRA 4DV3F 4DQRA 1XERA 1UPPA 3DOLB 2R2TA 2DPJA 4O23A 2OPRA 1RT5A 2W2OP 1CJVA 1QD1A 1IBKJ 1CS4B 4U7CA 4Y2MA 1ZOTA 4WFYA 2HBYB 2CNNB 3TYTA 1VHIA 1X8DA 2LA6A 1Z1ZA 1HI8A 3CJTA 2GIQA 3HFKA 2E5LF 4OLOA 4NCBA 2ROPA 2FB0A 3KUEA 5B0FA 2GVZA 2XSJB 1LW0B 3TX0A 2KJWA 3DDIA 4RKUC 1VJQA 2VDHA 5T7LA 4F02A 5C7PA 4RW8B 3W2WB 1SVDA 2WBMA 2B4PA 2F9DA 2DGWA 2MDAA 4LFBF 2M2BA 4RX6A 1F2GA 4A46A 3BKUA 1CC8A 3CD6S 2QFIA 3T1HF 2E1CA 1X4GA 1W26A 1Y5NB 1PJ7A 4ZDNA 8ATCB 3R5JB 2XQCA 3S01A 4MIAA 3R27A 4USVA 3IBCB 3SV4A 4DCPB 3GIIA 5L1LA 4NYZA 2HSEB 2HPUA 4WWSA 5BR8F 2FLOA 2NYIA 4KKOB 2BANA 1ULRA 3CCRS 4NEZA 2ZH2A 3N01A 1Q8IA 2YNFA 3BEGB 2M7SA 3UDCA 1XMBA 2IAJA 1JLQB 4RW6A 4LR9A 2CQBA 1Q16B 1YG0A 2PIIA 1HYSB 1RKJA 3R97A 1RWWB 3FEXB 2JX2A 4P74A 4OHWA 4DJBA 3Q2SC 1QY7A 3SDEA 3P96A 4NCGB 5E3RA 3OTEA 1VS3A 1HA1A 4NPOA 2E29A 4Q0BB 1EJ7L 3LAMA 1EQ0A 2BE2B 2OPPA 2M8HA 4U96A 1OYDA 1X5PA 4IQMA 1J5OA 3V4IA 1WNEA 3D0GE 3SCIE 1TL3B 4DR4F 1RWPB 4WFZA 1O5JA 3TUJC 3QO9B 2RH3A 1R0CB 4PZVA 2OEMA 1HARA 1RA7A 1Y4ZB 4MKYA 1YJVA 3V6KA 1LNQA 3EVWA 2KTQA 3OFFA 1ZAXA 2CNKB 1U1QA 4ED2A 2XTJP 3K89A 4DR1J 4QIWD 2XMUA 5HJYA 4H4OB 3UE2A 1B3TA 4DQQA 1URNA 2ACYA 1NSKL 1R8BA 4KGZB 4E0DA 3F73A 2QLFB 4N8NA 1MU2A 2DBBA 3IWNC 4ZLJA 4H4KC 2H3EB 2WOMB 5E41A 4DR5F 5KFWA 4F2RA 2N4CA 4DXLA 2GQCA 4WFNQ 3FBEA 4KGXB 4F26A 4X4UA 5DZ6A 1T9XA 3TVYA 3CJKA 2HURA 1PYTA 3KDNA 3QGPA 5KAKA 2GMJA 2GZOA 3D2WA 1RTIA 5CXTA 2X3DA 5DDQC 4B3SJ 2UXDJ 3RB6A 4K59A 4JI4J 2ATLA 4B3TF 4CH0S 4DFPA 4USKA 1HD1A 3PEJA 2MZTA 2ZVIA 5KFYA 2KG1A 3KJFB 5HVFA 1HHTP 4W98A 3X3UA 4QW8A 1H73A 2K3IA 4YY3F 3I4HX 3U7JA 3BQ1A 2OP5A 4ED5A 1B7FA 1MN9A 2BJ3A 4CLSA 4NA2A 1HNWJ 1TTHB 3K59A 3K5NA 3GV5B 5ETOA 3M32B 2DNKA 1BC6A 4WIQA 5IQQA 1NAQA 1S1WB 2BA9A 1V6HA 1U1MA 1WHVA 1DTQA 1LWFB 5D4NA 3PVXA 4WIIA 4QU7A 4I6YA 3QBCA 3C15B 2NR0A 3BO3A 3WX8A 3GFYA 1KN6A 3RJMB 4MH8A 5GADI 2HVEA 4DSJA 3KK2A 1KVKA 1IBMF 5E7OB 2JEGA 3LP1A 3MM5A 4JI0F 4U8VA 4UQTA 4USTA 1FD2A 1T9YA 2DR9A 1B64A 1FWKA 1SJRA 1N52B 2NPFA 1WSVA 1KRPA 2NXEA 3U1NA 1F3VA 4ED1A 2BQRA 3T1AA 3N79A 3T19A 3SZ2A 4ZIWA 1FDAA 1VQ8S 2CPEA 2DGOA 2DIVA 1PYOB 1B4SA 2C3MA 2PMHA 3AXMA 1DY3A 4ER8A 4H54A 2K7JA 2OSRA 5CYMA 2EBGA 1UVMA 3MTJA 2BYCA 2ZWPA 2AP6A 1S97A 3R2DJ 4LF2A 3T5KA 4ZVUB 3M1VA 1T05B 3R7BB 3CT9A 3JTPA 2V9WA 1U0SA 3EGZA 5AE1A 5KFXA 4DUTA 3E01A 5BYSA 2AQ4A 3BGRA 1KFDA 3CJ4A 2FZGB 4J9UE 2CZ9A 2DXFA 2XYGB 3QQCD 1MLAA 3G87A 3HJFA 2P5VA 3W8GA 3FSXA 1X31C 4HLBA 2KXFA 4KHRA 1F60B 2QV6A 3H40A 2KKHA 3RG6A 3AOBA 4URGA 1HI1A 5A6WA 3MFIA 2FHJD 4ZHRB 3KUHA 2HRUA 1NSAA 2ZDPA 4JBCA 2IM1A 4X4TA 1H3DA 2RB7A 3G8TA 3BSNA 3MUTP 1RAJA 4MIBA 1NH8A 4WFAQ 1F9EB 2VQEJ 1ZM2A 2QA4G 4C7QA 1X4FA 5ETKA 5KOXA 3GJSB 4C98A 2HHSA 3MM9B 3DYAB 1CC7A 1R7IA 3P5BP 3MAHA 2OUGA 4GKKJ 1S76D 4TU7A 2HNDB 1O8BA 3EXCX 4GKJF 4DV6J 1RWXB 3D6FB 2I8EA 2R2RA 2BRKA 1TKDA 3ZXWA 1GAOA 3MEDA 1U2FA 2L41A 2Y9HA 4YR3A 2Y1IA 1D1UA 2J9DE 2W7AA 1VQ5S 3GJRB 3CMQA 2V4QA 1I5OB 2G13A 2CPZA 4PQUA 3M8WA 3B4MA 1H74A 2AGOA 2D74B 1BQXA 4RWXA 1N5QA 4ZVQB 2Q3PA 3J7ZT 4QR1A 4HHJA 5HLFB 2IM0A 1NJZA 3PEHA 3C14B 4A8QA 4X4OA 1YX2A 3EGVA 2MEWA 3WX4A 3ET6B 4PPZA 3T1YF 1UA0A 3PRVA 1Y3KA 1SXLA 2ZBPA 1VQ9S 2F4FA 4LF7F 5C42B 3VQTA 1JJ2R 4S0MA 3R2CJ 4WP3A 1SL2A 3GIRA 1WC6A 1WI8A 1ZPVA 2E1MC 3K5MA 2H5IB 3QT6A 2XC9A 3CCES 1MG7A 4NE9C 3PRBA 2CQPA 3G82A 1LXJA 3DXSX 1M0SA 2JHEA 3WHIA 1JLBA 5LXRA 2ZE2A 3SSSA 4RJVA 1M5SA 1SH0A 4HI1A 4M5HA 3J7AN 5CZVA 5C5JA 3MPUB 1KHWA 2DRAA 1IR0A 2V4JB 5L39A 2ZBCA 3DGPB 1Q95G 1JNRB 2UXCJ 4EEYA 3GR0A 3OXFA 4MMOA 1FWPA 5DQIA 4EI2A 3DLEA 2VPXB 4QJVA 3MMCA 1TV6A 2GVDB 2RDDA 3SQOP 2VA3A 1Q5VA 4WE1B 4AYBD 2CQ4A 1VLYA 3NBPB 3PR4A 4P2XA 2CKWA 3PKMA 2VG6A 1S1VA 1L3KA 1U1NA 1HIYA 2IYIA 3NAHA 1FK9A 4O3PA 1P9YA 3IM9A 2QMUB 2LU2A 1UJ6A 4K4YA 2GGPB 1I94J 1GMUA 1GQEA 4JV1A 1RAAB 3FRYA 5MAOA 3HF5A 2Z2ZA 3BH7B 1YWXA 4YUDA 4MK8A 4CTAA 4ICLB 3D54A 3NS5A 2M88A 2R3VA 4QIFA 2AZ1A 5DG8A 4ECZA 4H4KA 1HNIB 5GAEI 2XHCA 3JTOA 1NHKL 2GJIA 3AOAA 1IJFB 4KGVB 3W1YC 2Y1JA 3PYGA 1IR2A 3OL7A 4DUZJ 3I5AA 1KBRA 2PMZD 1TKZB 1YGYA 4YB5A 1FXLA 2KVQE 4IH6A 4OV6A 3PYEA 2A2DA 3TZYA 2WTFA 1X7VA 2W4DA 3J7YI 1HR0J 3R5BA 2LDYA 2HHHF 4DSKA 2AYBA 2XSJA 1LW0A 5I3UB 4O0NA 1CJUA 2Q6BA 3IAM9 3QT7A 3GYGA 1NBEB 4PABA 3DN9A 4JP8A 1IJEB 4NXNF 1R3NA 2K7KA 2YBVA 1XNQF 3QPIA 1U49A 1RK8A 2HFOA 2BE9B 4WFXA 4ES2A 2UXBF 1N5VA 3KLFA 3UVJA 2DR6A 1DFDA 1NM2A 2JNJA 2MGZB 2V94A 2N7CA 3HKWA 5FLXU 2VOPA 2C3PA 4JI7F 4Y00A 4P10A 5IT4A 4DV2F 3E8OA 3OQ2A 2OHDA 2ZC4A 2IPOB 2PT0A 1N5YB 2NXUA 4J9KA 4NL5A 4R8UB 1FEHA 1U1LA 3MXHP 3BR8A 2XMTA 3HHLC 3G96A 3MECB 3NL0A 2UUCF 1JLQA 1XMOJ 3OUYB 3ZZPA 4UZCA 3DI6B 3LPEA 3N0VA 2F9JA 2K1RA 3VHQA 2MXYA 3UDEA 2FJAB 4LFCF 3DMJA 4KO0B 3EZOA 3J81U 1VC6A 1VHFA 4NCGA 2QEXS 1RWOB 1RHQB 1L3SA 4Q0BA 4K4WA 3C16A 2BE2A 2KG0A 1ZBTA 3EICA 3N5BA 1S1UA 4TYBA 1S0OA 4ZLNA 3IWXA 4CLTA 3PNIA 4HT5A 1R0AB 2ZJRQ 4X64F 5C24B 3KHGA 3PJ9A 3NS7B 2QFJA 3KUGA 3RB0A 1TL7A 4C97A 3QIPB 4NLXA 1WC3A 4QWAA 2B7BB 1A7GE 3SIPB 5A76A 2NSBA 2RHSB 2RE1A 2JFDA 3HSJA 4F7VA 3AD7C 4HH0A 3O8WA 5KT3A 1FA0A 4JV5J 2GC8A 2CQCA 1TL5A 1TVRA 2R7QA 4O4RA 1RB0A 4OIXA 1QM9A 3X1LB 2WOMA 2M8DB 2QL9B 3HZEA 4WYLA 1TQLA 1V5VA 1F1BB 3QZ8A 2RT3A 1U0HB 3R1LA 4I6WA 3KOAA 4W90B 2W2PP 1RXOB 4QPTA 3PDNA 3DLLQ 2W2MP 5D0HA 2MQPA 4DR6F 2OKQA 5F8JA 3R5AA 3PXGa 2EFNA 3CC2S 5H9EK 4XTTA 3ITHA 2XS7A 5SZTA 4F2SA 3L09A 2CJQA 2B56A 5FDLB 4EO8A 4DX5A 5A2QY 5B0CA 5HP1B 4OI2A 2ZWOA 2XCAA 1EAYC 2YWKA 3QFHA 3RW7A 2XG8A 4MFBB 4DSEA 2RILA 4LBIA 1CEZA 4MTPA 4ED4A 4X4RA 2OPQA 5CH7B 3UWTA 3PKYA 1FKOB 3FQLA 1QAXA 3L3CA 2Y0SD 4TKTA 5T41A 3CD5A 3CCMS 4CO2A 4DN0A 1KQSR 3GZ7A 1S6UA 4JB8B 1IWGA 1EP4A 3Q23A 4DLEA 5DO2A 4GC7A 3AA8A 1S1WA 4IG0B 1LWFA 1HI0P 4YHHF 4L6V3 1RACB 4FNHA 2A6MA 1FNXH 1WG5A 2CQHA 5DLFA 3VAKA 1T8EA 1V9OA 1R6VA 5KFOA 1XR6A 4MYTA 2HVDA 1S59A 1UWAA 4H4MB 3JYTA 4AUKA 4NLGA 4FZVA 2AEMA 4J90A 5IT9U 4KH1B 4OZ0A 3BBCA 1D09B 2NPIA 2FJEB 4FYWB 3K2YA 4TY8A 1UTAA 2V4RA 4Y2IA 7AT1B 3D67A 4ZVSB 4KRWA 4IG3A 3DC2A 2Z2LA 2Z0GA 2MQQA 2ASYA 4YFUA 4PUOB 2MJUA 3SCKE 1EETB 1YZ6A 1RAIB 1N54B 1R8PA 2ASDA 4UUXA 4QYZK 4GC6A 1KVIA 2E7XA 2HQCA 1T05A 3VZHA 3ZTSA 5ETSA 4DS5A 5L46A 1FNMA 3AY0A 1DBDA 2NCKL 4OYMA 1VCTA 1VBKA 1F9FA 4ZMMA 1SKUB 2H9ZA 4C9DA 1G4CA 2K06A 4HI2A 2GS8A 2BZ2A 3HHEA 1REVB 1IBLJ 2RDJA 1ZZNA 1LXNA 1TAUA 3QYYA 3IM8A 3KG1A 1SKRA 1ZPWX 3ZZTA 4X2BA 6FD1A 5E3AA 1SPBP 3JAMU 5AXLA 1YJTA 1Z2LA 3UO0A 3BPDA 3LF0A 2HBRB 3BGOP 4DUYJ 4J9QA 4X62J 3IMQJ 4G1IA 2X7IA 2YX4A 1FKPB 4FYXB 5AE2A 3ZZZA 2IC3A 1NHUA 3KLIB 2HMIB 5KFHA 4JI3J 3DYAA 1S0VA 3ICLA 1C0UB 4CO0A 2A18A 4QPXA 4JI2J 3I31A 2FDNA 3ISNC 3DOKB 2WRMA 2VQFJ 3D3BJ 2RS8A 1D8ZA 2IVMA 2EBEA 2KHDA 3PX0A 1KTVA 3KNAA 4CLKA 3KHLA 2KJVA 3Q8PB 5HQMA 1S9EB 3OV7A 4I6AA 4C11A 4DV3J 1JNZB 2MHNA 4LRDA 5D0EA 5HLFA 3RBXA 2KM8C 4CI0B 2J0QD 1F0XA 2MKCA 3ET6A 2VC1A 3VGSA 5KFZA 2BQ3A 1BE4A 2QLBB 2HAIA 1HBMA 4OMFG 1CQMA 2Y0BB 4B02A 1YHQS 4L76A 3HK2A 2E5LJ 4LF4F 2QRRA 4FN5A 3CCJS 3N6MA 1NNDA 2ZH6A 1JLCA 2YWEA 5C42A 3GIJA 5RUBA 2DNMA 1B70B 2VPWB 1S4EA 1SKSA 5J2PB 2QO3A 3HHLA 5IZHA 3I56S 1H7XA 4YEAA 2ZNZA 4U8YA 3BR9A 4B3OB 4LFBJ 1QAJA 1HW8A 1JXVA 1U2RA 5ETQA 3T1HJ 1FX2A 1X9WA 3DOMB 3PIOQ 2FVCA 3WC0A 2V4JA 3MR6A 3DGPA 3L7UA 3D68A 5DDOC 3BSAA 4NEYA 4DV1F 3UD3P 5ETLA 2OMLA 5B0AA 1FFGB 2XGPA 1WHYA 4WXWA 3HMJG 3DM2B 3AOCA 3ENAA 3OT9A 5BR8J 2OGUA 3BDEA 2M5YA 3H98A 2GJ2A 2ADCA 2P9CA 4QIVA 2ASLA 3AHPA 2GNKA 2JJ4D 3EE3A 3I55S 3R7SB 4ZPBA 2MQOA 1NSPA 4UZBA 3I5CA 5KG2A 4ITSA 5IV3A 3BO2A 4LSNA 4B9LA 4QR0A 1E6YB 4L3NA 5AJ3F 3A3OB 4CO1A 1XIQA 2ZDOA 1HNIA 3GFHA 1Y10A 1EARA 4CRJA 2V6AA 2L48A 2GA7A 1M1HA 4DR4J 1APSA 4KYZA 4NYPA 2CJAA 1VRQC 3W2VA 3VGVA 3TX8A 2G0CA 4DQIA 1TKZA 4A8SA 3ZTQA 3I0RB 2AYEA 1NUEA 4PAAA 3ULHA 1QLNA 4TLQA 4ZCKA 4ZVTB 2UXDF 2BXJA 1WF1A 5I3QA 1Q79A 2CPIA 2ZZTA 3DKDA 4J7CA 3OFGA 3BN4A 5CABA 1KC8T 3OLAA 2P2CB 2G0IA 5I3UA 3NMAA 1PBUA 1HQUB 2DY1A 4LF9F 4WXOA 4DV7F 2ZZNA 4CLFA 3MMAB 7FD1A 2IRYA 4ZCMA 3DRXA 5HQ8A 4DR5J 4DPUA 4AT1B 1C4CA 4A4JA 4RUAA 1P6TA 2CJXB 1NDCA 2HNZB 3VCDA 1MWZA 4Q5VA 2K3KA 2O67A 1NRKA 2ZH7A 3A8EA 4IR9A 3LUYA 4F50A 2DNPA 3CD7A 3W63A 2RU3A 1U45A 3KJVA 1JLAA 2DEJA 2FZCB 4P7TA 3IRXB 5D15A 2BDPA 5HBMB 4B3TJ 4ZPCA 4F3QA 1RBLA 3KLEB 3H4BA 3HM9A 1N5YA 1KWMA 4HT7A 3T6JA 1ZH5A 2EG1A 1UEKA 4YY3J 3J7A1 3CO0P 4Q2LA 3MECA 2ROEA 9ATCB 4OX9F 2B9WA 3OUYA 1T95A 3DI6A 2YTCA 1F2HA 5LMUF 4KO0A 3ENVA 1IQZA 3VR1A 4DFMA 4E2FB 1U6BA 1PBAA 3FNNA 1R6YA 4X84A 4F25A 3VWSA 4DEZA 2CQDA 1AZSB 2IA0A 3NKYA 2J9CA 4JOUA 1SC6A 5I4MA 3TEHB 2AJ1A 1VRTB 4IRCA 3GWCA 2ZOGA 3H7HB 1NKEA 1IBMJ 4JI0J 5C24A 5C25B 1IKWB 4M8LA 1RAEB 2W25A 2X1BA 3MUVP 4ZVFA 3HFVA 2CXEA 2ALYB 1RWNB 4EWTA 1NO8A 3AODA 5K20B 4ZP8A 3WBZA 2AJ2A 4B9UA 1TFYA 1F3FA 1C2PA 1HMVA 1KLMA 5EN1A 1K1SA 1SC1B 3G9CA 1PAEX 3NGRA 3R8YA 4EBEA 1RJJA 5F8LA 3R7NB 1XEZA 1N88A 2P6TA 2F65A 4B9SA 2PMWA 2WAQD 4PWWA 3OVSA 2UZAA 2XNQA 4ECUA 2VZ9A 2K8GA 3A4TA 2DNRA 5K14A 3ADAC 3QJPA 2MQMA 3C6TA 2P6SA 3VAFA 3K5OA 4N56A 5L9NA 4YR2A 3VVUA 5KFPA 2HBQB 2RMLA 5J2MB 4DU8A 4TU8A 1MMNA 3C2PA 2ZKUA 3AJ2A 4QZVB 3H8YA 4EBCA 4J9LA 2GHVC 4K5RA 3OR2A 4AFFA 3BDPA 3HD1A 3OTDA 4ZJLA 3MR5A 3IGNA 5FDLA 3H5YA 2C3YA 1U48A 2HQGA 4MKBA 4WFBQ 5J1PA 1N33F 1U7LA 4NASA 2GO8A 4MFBA 3LP0B 1U1OA 4O3RA 3NWGA 4NXMF 4BHQA 4U6PA 3EGWB 2RS2A 2V5HG 4M5MA 3LGMA 3E3XA 1S4FA 4GVBB 2R7UA 2LQ9A 2C22A 2CQGA 2P9EA 1Z2ZA 3PY8A 1SL1A 4IG0A 4X4VA 2H54B 3JS9A 1X5SA 4ZPAA 5B0DA 1FRMA 1IM4A 1NJXA 2FLLA 5M2RA 3D9BA 2OPRB 1HBNA 1RT5B 2E1AA 3OBIA 1CQNA 4J9PA 3SXLA 4GKJJ 4IRDA 4H4MA 1IQTA 3EPGA 2F40A 5ETRA 3DU5A 3QGGA 4DV4F 3MMJA 4A8MP 5D8HB 2C3UA 5HJXA 3T9NA 2ZH5A 4R5PA 5H9FJ 1HWKA 2CAJA 2R7OA 2GVZB 1KD1T 4F04B 1FWLA 3EMTA 5T7LB 5ETNA 2XMVA 3SMZA 2C42A 2CADA 3N5FA 3VZIA 1RBOB 3A8KA 3G86A 4PUOA 2Y1RI 1S99A 1UFKA 4DL0C 4J37A 4FF3A 2FLNA 3U27A 2EK6A 4QWBA 3Q2TC 2C2RA 1H2UX 1IBCB 1WOPA 3T1YJ 4CH1A 1VIXA 4LVNP 1TUVA 4ECXA 2NS1B 1X60A 4EZ6A 2ZD1A 2YVSA 4LF7J 3CW2C 1VISA 1X5OA 1YRXA 2IA6A 3PZPA 2NXJA 1NZ8A 2KZMA 1REVA 1RT4A 5AT1B 1WI6A 3PACA 4FXVA 2FVPA 5LSLA 1AFIA 3M9OB 1CSJA 4CH7A 2ASJA 1TAQA 2JLFA 1VQKS 3RU0A 3SSQA 1XR5A 4RBTA 1VQPS 1FKPA 4QOTA 4ZVOB 3TA0A 3GILA 5DG7A 2KI2A 3MM7A 4Z7YA 5DGAA 3KLIA 2HMIA 1WF0A 3B4DA 1I6JA 2R2SA 2QMWA 4OV1A 2UUAF 1GTEA 3KLHB 4MIWA 2CVEA 3F0NA 1QE1B 3DOKA 3M6VA 3M9NB 4JV0A 3K58A 3H5SA 4DV0F 1Q8KA 2VF3A 3RB4A 2FC8A 4PG7A 3DU6A 5KG0A 4C8OA 2G2YA 1FRJA 4XO0A 1MWQA 4DMZA 1NK8A 4C4WA 1Y3JA 3GQCA 1MU2B 1JB0C 4ED3A 1AUDA 3KMQA 1QSLA 2CJKA 1BWVA 2HGNA 3SQGA 1MW7A 2BJ1A 3JXOA 3Q22A 2ADBA 4OZ2A 3CDUA 4DG1B 2VV5A 3H2LA 3ZZ0A 5DZ7A 5L1JA 4PG6A 1V3ZA 3CJKB 3TZXA 4DR3F 1RAFB 2XZWA 1CJKB 2DR7A 4QU6A 1S9GB 3W5ZA 3MCMA 2HWHA 2X51A 4V19X 2HFNA 3ZTRA 1U26A 2HHHJ 1FE4A 1ZA2B 2GX8A 3SBMA 2DITA 3K17A 2LP4A 4ZN1A 2JEIA 5J2PA 1P27B 3TJAA 4ZPVR 1VQ7S 2KYXA 4U67Q 2DGUA 4ANDA 2WHOA 1NMEB 1NSQA 5HN0A 4WPAA 4NXNJ 2F63A 1MWYA 3W5YA 1MMDA 3FCHA 4Y2KA 3T9ZA 1M5HA 1SB6A 1XNQJ 1SJQA 2G4BA 1RWMB 1DZ5A 3TQEA 2XZDB 2UXBJ 2E1PA 3O5TB 3FEZA 2QGFB 3IA0A 3DOMA 4L3KA 4QWEA 3CCZA 4FF1A 1BWEA 1FTCA 1HFEL 3FJ2A 3PW0A 2HVIA 1RT3B 4XIUA 3A3PB 4DPWA 4JI7J 3RBDA 3DM2A 3OXGA 2HS3A 4DV2J 3CCUS 1G2EA 2V8DA 1Q81T 4IFYB 1EIYB 4RNHA 4HHHA 4IOCQ 3PM9A 2P8IA 4CLYA 3MM5B 1DQ9A 3UW1A 4DS4A 3TWZA 2OAUA 5KT5A 3Q8RB 4QIGA 2VFSA 3NY0A 2UUCJ 3CMES 5M2UA 4OX6A 2I5JA 3M9MB 2AT1B 2GMHA 2V68A 1A0OB 4KE5A 1Y9OA 5DLGA 2FLPA 2FD2A 5KFMA 4LFCJ 5A6PA 1K8AT 1Q8BA 3BZQA 2WVFA 4JI8F 1WC4A 1B0VA 3VAGA 3H2UB 3KJQB 1E6YA 3G4SS 4DPYA 1VOMA 3WZ0A 3SCJE 3G6YA 5D78A 2MZSA 4AL5A 1KSPA 3RR8A 4X64J 3M1VB 3ENWA 1YK9A 4D3GA 4ZJQA 3SCLE 2B3TB 3D6MB 1XK8A 2D7SA 4ELTA 3LPYA 1NPPA 2BVZA 2M3DA 3P6YC 3CE8A 5HSPA 1F9HA 2C28A 3H59A 2YKAA 2HG4A 2XI2A 2CA9A 3BBFA 3QRRA 2YKQA 3THVA 3M7VA 2L9DA 4WTYA 2WSCC 3QGHA 1HQUA 5SUHA 2VONA 2ERRA 3ZZOA 3HVTA 4W92B 3BPSP 1SKWA 1EB0A 2J0XA 1I1GA 2IYGA 4IH5A 3F41A 4BWJA 2N3LA 4KHPF 1IVZA 1IM6A 1S5ZA 5CD4A 2HNZA 3FGVA 2QN6B 2LQ8A 2B9EA 1BUXA 4DR6J 2HHTA 3TANA 4CM2A 2POKA 2AKWB 4KC5A 3UCUP 2ZH9A 3GYXB 1FO1A 3IRXA 4M94A 3QFWA 4OZNA 2XO6A 1LV5A 2O66A 2E5GA 1RHJB 4KB7A 4ILRA 3P49B 4M5IA 1GMWD 2A3JA 1TELA 5CYJA 3C8YA 5C2CA 3B6BA 4PKDB 1QTMA 1RYSA 3MEDB 3W66A 4P52A 3FSIA 2QT7A 4F36A 4FS1A 2AW0A 2VD3A 1AUSL 4ED7A 3GTYX 4KQZA 3KK1A 2XHWA 5B08A 2B0GA 1S10A 4ZPWR 1GMVA 2CIMA 4Q8FA 4I4BA 2EC2A 2KXHA 3CJ5A 4YHHJ 2WW4A 4OJ3A 3NNCA 1FESA 1KTQA 1R8HA 1U8SA 2J6TA 2QYGA 1QDUB 3DRRB 3RB3A 1VRTA 1PYSB 1VQLS 4RBVA 4LIWA 1OMSA 2HBZB 4DV5F 3N4WA 4KV8A 4ID5B 1IKWA 1Q86T 3MI7X 1VC5A 1R8CA 4ZP7A 3HD2A 4K4XA 1FRLA 4NRUA 4CYUA 1JKHA 1SI9A 1KLNA 2LXIA 1MN7A 1M1KT 3ZO7A 3DRPA 1VIOA 3QWUA 2BW2A 3AB2B 3MM6A 1RADB 1TFWA 2KFYA 1RZMA 2KH9A 2H51B 2VJUA 4WF9Q 2PI5A 3Q8UA 2CPDA 2D3ZA 3KXDA 1U25A 3G82B 1TL1B 2AGQA 3R5GA 1K47A 4AQYF 1FRXA 1JLBB 2D3UA 3KJNB 4FXDA 4DSLA 5KFCA 2QLWA 1AB8A 4RUBA 1VBYA 2NYHA 2R8JA 2QL5B 5F0UA 1R0BG 2HIQA 3QAEA 2VKRA 3H42A 3GFXA 2OTJS 3RGIA 5B0EA 4DX7A 2BMBA 2B4UA 2RKIA 4C3MA 1N34F 1TV6B 1X9SA 1D9DA 1N6QB 3EXYA 3OL6A 2HW3A 1KQKA 3W9HA 3OHAA 2QLXA 1T94A 2BJ8A 1PO6A 2ZH3A 4DU7A 2VG6B 5L38A 3MZIA 3R6GB 2XWYA 4O3NA 2N3OA 5F8GA 1FK9B 2XMKA 2EEYA 4OYPA 4FYDA 3PHTA 3J81j 3H5UA 4GVBA 3GV8B 2B8PA 4RNNA 1NDKA 1XTZA 2QMXA 2VG5A 2WSEC 3PX6A 2WVBA 2DGTA 1WSRA 2JC1A 4R0JA 2HYIB 3GU0A 4Q44A 4C0OC 4DCJB 3N6LA 4K0KF 3BGFA 2E44A 4URQU 1PKUA 1B99A 1BQMA 4EK2A 3A3NB 3TA1A 3A8JA 4X4NA 2ZUGA 2BKNA 3NS6A 3MHYA 2EG2A 1FFWB 5HK4A 5EHHA 2YNIA 2HRYA 1KKHA 2KU7A 4K4ZA 4C8MA 1NK4A 1FKAF 1XBWA 2ZHOA 1K0VA 1CJUB 1N5SA 4OHZA 4DL6A 4ZVRB 3BKFA 1YIJS 2FTRA 3CC7S 1NK7A 4I2PA 2F8EX 4J9SA 1PCAA 4URSA 4A8XA 2BV3A 1RAHB 2DHHA 4PXBA 3KLFB 3UVJB 3SSRA 1TZ0A 2OFHX 2MQLA 1U47A 2QLJB 5HL7Q 4LF4J 2XM3A 4K4SA 3NLCA 5DGBA 4CDIA 2Z4PA 1HWIA 2F4VF 4ZP6A 1NZAA 2B9XA 1EQMA 3SEOA 3O3LA 1N8RT 1IKVA 1UW4A 2XWXA 4TYAA 1UJ4A 5K9FA 5EX0A 3CVKA 5F3ZA 2KXNB 2HNYA 1RHKB 1GXUA 2K1RB 1NU4A 1JWWA 4OZ5A 1RTJB 2IMOA 3DMJB 5CCMA 2FJXA 5IXUA 3Q0AA 2KVIA 2HHVA 3MCOA 3CEDA 2DK2A 3C16B 4DV1J 3GFZA 2J7KA 3N6NA 1S1UB 2FY8A 4RBUA 1RWUA 1HWJA 1UWBA 4KBIA 1FVQA 3KLHA 2HFVA 2IBOA 4P73A 5JMNA 2XYPB 2ZH8A 1JXEA 4TQRA 1TL7B 2R2UA 1QE1A 2RUSA 5L8RC 2XMWA 3BGLA 1KP6A 3W61A 3UCZP 3UFCX 3OJUA 3B78A 2VFTA 3IS9A 4ZVPB 3A12A 1D9AA 2AD9A 4F3MA 2EC0A 3RAMA 3Q83A 1Q1KA 2PN6A 2H65B 1SQFA 3KMSA 3MPYA 1UFWA 1MROB 5AJ3J 1WJ9A 3UNYA 1TVRB 4X66F 2KHCA 1IKXB 2ZH1A 4USHA 2WCXA 1CULA 4V1Ak 4ED8A 2O1PA 3TA2A 3Q8QB 3Q24A 4DG1A 4C8LA 3RAXA 1Q7YT 4IKAA 3ZZYA 4L73A 4DZ6A 3M2UB 2SXLA 2HVHA 5LSRA 3MWBA 5K8PA 1LFPA 3FBFA 3FUYA 5A8WA 1CJTA 3ITHB 1WD6A 4Q43A 1CJKA 2ZJQQ 4ZPDA 4CLLA 2FVSA 3QZ7A 4J91A 3L7PA 1S9GA 1W7WA 3R5DA 4EU0A 4KJIA 4YB6A 4K8RA 2MYFA 2C2NA 1H2TZ 7FDRA 4M5LA 1OSCA 2VH7A 2PSZA 3EPIA 5D6GA 1VLOA 4LF9J 3FSYA 5DRKA 4DV7J 2DNYA 2OPQB 3TNVA 3KLGA
chains in the Genus database with same CATH topology
3DKDA 3Q83A 1NLKL 1PKUA 1B99A 3Q89A 4DI6A 4EK2A 4UOHA 5CABA 1BE4A 4KPCA 4ANEA 1S5ZA 3EVWA 3NGSA 1NPKA 4W98A 3Q86A 1KDNA 3BH6B 2CWKA 3FCWA 2DXEA 3FCVA 1HHQA 1WKLA 1BUXA 3EM1A 3VVUA 2VU5A 1UCNA 4ANDA 4C6AA 1B4SA 3EE3A 2BEFA 1NSQA 1S57A 1NB2A 1MN9A 1NSKL 3FBCA 3B54A 1NSPA 3FKBA 2AZ3A 4HR2A 3VGUA 3PRVA 3FC9A 1WKJA 3ZTSA 1NDPA 3ZTPA 3EVMA 4UOFA 1NDCA 4CP5A 3GPAA 4O0NA 3FBBA 1NCLA 1HIYA 2NCKL 3R9LA 3VGTA 1MN7A 4DZ6A 1VYAA 3VGSA 3ZTOA 1XIQA 3ELHA 3GP9A 2DXDA 4UOGA 2HVDA 5BXIA 3VVTA 1S59A 1XQIA 4S0MA 4ANCA 3EJMA 3EICA 1JXVA 3FBFA 1U8WA 1NDLA 2BX6A 4WBFA 3DDIA 3NGTA 3BH7B 5IOLA 3WX8A 2ZUAA 3B6BA 4DUTA 3EMTA 2B8PA 2B8QA 2DY9A 5C7PA 1LWXA 2HVEA 3FBEA 1LEOA 1W7WA 3BBCA 3Q8UA 1NDKA 1F3FA 1EHWA 2AZ1A 2DXFA 3EVOA 4FKYA 1F6TA 3BBFA 3L7UA 3VGVA 3Q8VA 3BBBA 1PAEX 3PJ9A 3NGRA 4ENOA 1ZS6A 4F36A 3G2XA 2HURA 3NGUA 2DYAA 1WKKA 4F4AA 1BHNA 3ETMA 1NHKL 3ZTQA 4FKXA 3Q8YA 1NUEA 3ENAA 3MPDA 5CAAA 3ZTRA 1HLWA 1K44A 3JS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DKD A;  3Q83 A;  1NLK L;  1PKU A;  1B99 A;  3Q89 A;  4DI6 A;  4EK2 A;  4UOH A;  5CAB A;  1BE4 A;  4KPC A;  4ANE A;  1S5Z A;  3EVW A;  3NGS A;  1NPK A;  4W98 A;  3Q86 A;  1KDN A;  3BH6 B;  2CWK A;  3FCW A;  2DXE A;  3FCV A;  1HHQ A;  1WKL A;  1BUX A;  3EM1 A;  3VVU A;  2VU5 A;  1UCN A;  4AND A;  4C6A A;  1B4S A;  3EE3 A;  2BEF A;  1NSQ A;  1S57 A;  1NB2 A;  1MN9 A;  1NSK L;  3FBC A;  3B54 A;  1NSP A;  3FKB A;  2AZ3 A;  4HR2 A;  3VGU A;  3PRV A;  3FC9 A;  1WKJ A;  3ZTS A;  1NDP A;  3ZTP A;  3EVM A;  4UOF A;  1NDC A;  4CP5 A;  3GPA A;  4O0N A;  3FBB A;  1NCL A;  1HIY A;  2NCK L;  3R9L A;  3VGT A;  1MN7 A;  4DZ6 A;  1VYA A;  3VGS A;  3ZTO A;  1XIQ A;  3ELH A;  3GP9 A;  2DXD A;  4UOG A;  2HVD A;  5BXI A;  3VVT A;  1S59 A;  1XQI A;  4S0M A;  4ANC A;  3EJM A;  3EIC A;  1JXV A;  3FBF A;  1U8W A;  1NDL A;  2BX6 A;  4WBF A;  3DDI A;  3NGT A;  3BH7 B;  5IOL A;  3WX8 A;  2ZUA A;  3B6B A;  4DUT A;  3EMT A;  2B8P A;  2B8Q A;  2DY9 A;  5C7P A;  1LWX A;  2HVE A;  3FBE A;  1LEO A;  1W7W A;  3BBC A;  3Q8U A;  1NDK A;  1F3F A;  1EHW A;  2AZ1 A;  2DXF A;  3EVO A;  4FKY A;  1F6T A;  3BBF A;  3L7U A;  3VGV A;  3Q8V A;  3BBB A;  1PAE X;  3PJ9 A;  3NGR A;  4ENO A;  1ZS6 A;  4F36 A;  3G2X A;  2HUR A;  3NGU A;  2DYA A;  1WKK A;  4F4A A;  1BHN A;  3ETM A;  1NHK L;  3ZTQ A;  4FKX A;  3Q8Y A;  1NUE A;  3ENA A;  3MPD A;  5CAA A;  3ZTR A;  1HLW A;  1K44 A;  3JS9 A; 
#chains in the Genus database with same CATH topology
 5FII A;  1N36 F;  4HAC B;  1T3N A;  3CMA S;  1UET A;  5E5N A;  3KK3 B;  1L5U A;  1C0T A;  1EP4 B;  3CCV S;  3CDB A;  3LAK A;  2Q66 A;  3GCX P;  2BE7 D;  4ZA1 A;  5H9E J;  1W2B R;  3M2R A;  3CJ8 A;  2CFX A;  1RT3 A;  2BKP A;  2HFS A;  2FHM A;  5FLX Y;  4CT8 A;  2HQD A;  2LA4 A;  3H5X A;  3THP A;  4IFY A;  3P8B B;  3EUN A;  5KG3 A;  4WCE Q;  4DQP A;  3DRS A;  3JYT B;  2IRX A;  4LF8 F;  4OHV A;  4Z7C A;  2ZM6 F;  2LCW A;  1Y00 A;  3ENQ A;  4WBF A;  1VFJ A;  2BJ7 A;  2WVD A;  1VBX A;  4OX9 J;  2IIH A;  2XB2 D;  4DOZ A;  2DNL A;  2WZ1 A;  2EFP A;  1T9W A;  4TY8 B;  3BS9 A;  5LMU J;  1HHS A;  4B3R F;  2HGL A;  4DFJ A;  3K5L A;  1HD0 A;  4IG3 B;  3J81 Y;  4LT6 A;  3AH6 A;  2C1E B;  3CJ3 A;  3DLK B;  1XMQ F;  2Y8Y A;  2LXF A;  3VAM A;  2CQ2 A;  1JLE B;  2DNG A;  4OFZ A;  3BQ2 A;  3HI9 A;  3PIP Q;  5LXY A;  2FHO B;  3ETO A;  1RU2 A;  2UUW A;  2LFV A;  5CZX A;  4B9V A;  3BJY A;  5ETV A;  4RUC A;  2ZHB A;  2EKY A;  4G6V B;  2F5G A;  1FER A;  3EWG A;  2AX0 A;  3CTR A;  3LO3 A;  5FJ4 A;  1FVS A;  1ARO P;  1W2I A;  4UOG A;  4F0M A;  4ZVH A;  4C8N A;  2F8H A;  2CPY A;  4NOH A;  2JSX A;  2RHQ B;  1TKT B;  4LR7 A;  1IR1 A;  4LBH A;  4BBY A;  3F44 A;  1RDR A;  5HVH A;  2IBK A;  2NXN A;  1GK8 A;  4F4Z A;  3G8S A;  4Y2C A;  2ILY A;  2RSQ A;  5GAG U;  1TMJ A;  1T9U A;  2PFF B;  4F4W A;  1WUU A;  5KFU A;  4TXS A;  2YQ0 A;  2D1C A;  3CC4 S;  2IC3 B;  3ZNU A;  3TVZ A;  3Q89 A;  3K8V A;  2H4Y B;  1HKA A;  2J5A A;  4Y2A A;  4Q8E A;  3FCV A;  3U02 A;  3QJJ A;  8AT1 B;  1SIW B;  2MKY A;  2JL9 A;  1N33 J;  4DR7 F;  4NZ7 A;  2X1F A;  2YQ3 A;  4NXM J;  4DN9 A;  1FXD A;  3GCW P;  2JVR A;  3HSG A;  3MD1 A;  5IV4 A;  1XJW B;  4DX8 H;  5CCL A;  3K8W A;  4XDC A;  2C2O B;  3EZU A;  4ID8 A;  3MPW A;  1LWX A;  1EHW A;  4C11 B;  1RUS A;  2PDA A;  2CQ0 A;  3NEK A;  5DQH A;  4XK8 C;  2E9T A;  3D5M A;  5J2N A;  1X0F A;  3DRR A;  3P3D A;  1URR A;  3AA9 A;  5JVG Q;  3CCT A;  3IBW A;  4ID5 A;  3FMB A;  2RQK A;  1YZ7 A;  2QA4 S;  1HBM B;  1RYR A;  4DV4 J;  3GMG A;  2LDI A;  4L74 A;  4ECR A;  5F9L A;  1UJ5 A;  5IT9 Y;  1JLC B;  2ABY A;  2W01 A;  2DGQ A;  3VGU A;  1Y7P A;  1U6F A;  2QSF A;  3CJS A;  3HHL B;  2Z2M A;  2V8G A;  1SQG A;  4QQB A;  4LF1 A;  1NXI A;  4WTO B;  1O6X A;  3LGH A;  4OX7 A;  2E1R A;  3PFE A;  1TL1 A;  1RA6 A;  5BXI A;  4HH1 A;  2Q79 A;  3NCQ A;  2L9W A;  2BAC A;  5KFT A;  3TUI C;  1S1X B;  2QIF A;  5AXN A;  1RHM B;  2Y8W A;  3DHX A;  1N0V C;  3MF5 A;  4OI0 A;  3PO4 A;  5CYQ B;  3OVA A;  2R7X A;  3P5T L;  3W5X A;  1U1P A;  4Y28 C;  3MCS A;  2EWH A;  1LQ9 A;  3DDK A;  1N6Q A;  3HO1 A;  5GVQ A;  4MT1 A;  1RU1 A;  2RJZ A;  2JEJ A;  2I38 A;  2HQF A;  3TR5 A;  1YJW S;  4OHX A;  1OPZ A;  1FRH A;  4WZQ A;  4DI6 A;  2JFK A;  3POT B;  3UNG C;  3NGK A;  1T7P A;  3LP2 B;  2BBE A;  3KG4 A;  4MKV A;  2CNL B;  2WBR A;  2F8M A;  2R7T A;  3BV8 A;  4N8O A;  2PA3 A;  3JAM Y;  4YDD B;  1RTH B;  4LSN B;  4OYW A;  3CIM A;  2R8I A;  3QRQ A;  1G3O A;  2ZVS A;  2UVU A;  2RDI A;  5KFS A;  1X4A A;  4P7V A;  4RU2 A;  4USW A;  5THW A;  2XS5 A;  2FPH X;  3HX9 A;  2UUA J;  3U1L A;  4ES3 A;  2GJF A;  3W2V B;  3BRE A;  2OD6 A;  2PE8 A;  3NOC A;  5HMW A;  3A8I A;  1SIZ A;  2CDR B;  5M2P A;  2ILZ A;  3ETM A;  3OL9 A;  1WC0 A;  4DV0 J;  2ZEJ A;  3NMR A;  1CLF A;  4LSZ B;  2RU9 A;  1SQE A;  4DZD A;  1HLW A;  3MM8 A;  4UUW A;  2AGP A;  3OTO F;  3T5H A;  4YDX A;  4O0I A;  1NPR A;  4EGL A;  1WHX A;  2W7O A;  2HAF A;  1YBT A;  2MZQ A;  1UCN A;  1T02 A;  4FPR A;  2BEF A;  3CCW A;  1R27 B;  3LA0 A;  4KGM A;  1QJH A;  1VMB A;  2MKS A;  3RUB L;  5KFI A;  1HBU B;  4OI4 A;  2XSF A;  4PEO A;  3NNA A;  2AJF E;  3H0P A;  1X4E A;  4DR3 J;  3I6P A;  3ELH A;  3I9V 9;  3KJV B;  1JLA B;  1WG4 A;  4CCH A;  2LYV A;  1U8W A;  3NGT A;  4A8O A;  4IFV B;  2LQ5 A;  1FFS B;  4UT4 A;  1NK0 A;  1WDD A;  2MB0 B;  5HAO A;  2CJB A;  3AQP A;  2YKN A;  2KDO A;  4ENO A;  4OI3 A;  1Y5L B;  3JSR A;  4ED0 A;  3GB0 A;  3GYN A;  2YNH A;  2Q1L A;  2QC3 A;  1RTJ A;  3DCA A;  4E8U A;  1CBK A;  4TVA B;  2W9B B;  1KR4 A;  4JI1 F;  1U2C A;  3GV7 B;  1NKB A;  2PC6 A;  2DRB A;  2DGV A;  5KFN A;  4JYA F;  3D3C J;  2E9R X;  2XBP A;  1UW9 A;  4X4Q A;  4QCL A;  2DTJ A;  1ZAW A;  3IWL A;  1RI7 A;  5F3T A;  1VC0 A;  2WVE A;  1SV5 A;  4M5K A;  1RBA A;  2ALZ A;  2VHG A;  4JV2 A;  4PG5 A;  5BJR A;  3KWM A;  3P4U B;  4PCQ A;  1RCX B;  3JQK A;  1TK0 A;  1HMV B;  1KLM B;  1Q8L A;  2J6U A;  4K4U A;  2D41 A;  3CCQ S;  3PYD A;  3FQK A;  4XPE A;  4NYO A;  2DYA A;  1TK8 A;  1XN9 A;  4JI8 J;  1C1B B;  2VBZ A;  1ZYQ A;  1I51 B;  4OZL A;  1MRO A;  3ZFV A;  2CVI A;  1S0M A;  1IKX A;  3OR1 B;  5K14 B;  3PW7 A;  4Z2X A;  3C6T B;  2HHP A;  2UUB F;  4RW9 B;  3FVY A;  2I2Y A;  1DQA A;  4KT0 C;  5I42 A;  5H9F K;  5LJ5 Y;  2MQ8 A;  2VU5 A;  4I2Q B;  3BF4 A;  3M2U A;  1JXL A;  2XGQ A;  2RIJ A;  3VAH A;  3NXZ A;  3RR7 A;  1ZTT A;  2AF6 A;  4PWU A;  2DH8 A;  5IFM A;  3FEY B;  2L3M A;  3OR2 B;  2HS4 A;  4C0H A;  2Z8Q A;  2HZC A;  3PR5 B;  1UVK A;  4YB1 P;  2M4M A;  1RAB B;  5HAN A;  2W9C A;  5JVH Q;  4P6Q A;  4TU9 A;  5CQG A;  1YJ9 S;  3PJW A;  2XY7 A;  3MEG A;  1UPM B;  2W8K A;  3LGN A;  4KHP J;  2B5J A;  4N76 A;  5KG4 A;  4HAC A;  4B9N A;  2RQM A;  1SCJ B;  4NLV A;  2DNO A;  1WEY A;  5JXS A;  2VFV A;  3KK3 A;  1LFW A;  4IOA Q;  2V9K A;  4YN3 B;  4K2J A;  5F8H A;  4O3S A;  3BQ0 A;  4EUV A;  2AEF A;  1JLG B;  4TLR A;  1HNV A;  3IAS 9;  4J9V A;  3OFH A;  4DL2 A;  3C6U A;  2KM8 B;  2XNR A;  1HBN B;  2ZKT A;  4C8K A;  2Z58 B;  3QID A;  5JJB A;  3UR0 A;  5D4O A;  3NCR A;  3V6D B;  2KT3 A;  2XMM A;  2J6S A;  3B54 A;  1YRU A;  3BYR A;  5K8M A;  4G1Q A;  4J9M A;  2YNG A;  3RTV A;  3OFE A;  1OY9 A;  1TKX A;  4NLY A;  4JI5 F;  2EXU A;  4LFA F;  4HKQ A;  1RTD B;  2G2Z A;  4R5P B;  5DDR C;  1QUP A;  1WTF A;  4RW4 B;  4ED6 A;  1M1G A;  4ECV A;  4DSF A;  4O3Q A;  2ACM A;  2MKH A;  4PR6 A;  1KEK A;  1IKY A;  1ZM9 A;  5J1E B;  1OS5 A;  2DO0 A;  4L75 A;  1P1L A;  1J2V A;  1YLX A;  2K2P A;  2FY1 A;  1YBU A;  5GMK a;  5LJ3 Y;  2QJ3 A;  1WEL A;  3AD9 C;  2WON B;  2MZJ A;  2XO7 A;  2QZ8 A;  3DLK A;  2V2Q A;  4MJK A;  3LW5 C;  1S12 A;  4LQ9 A;  4NZ6 A;  4GO7 X;  3PYF A;  2AJQ A;  4DV5 J;  1D3W A;  4ECT A;  4B17 A;  1JLE A;  4M95 A;  3GSI A;  4NA1 A;  4WYW A;  3OSN A;  4A8Y A;  1S6Q B;  4HDH A;  4DLG A;  2DPI A;  2ZFH A;  4XPC A;  2DD8 S;  3CD0 A;  4USI A;  2FYX A;  2H5J B;  2HIY A;  2YWF A;  2ZD1 B;  5CD4 H;  3KLV A;  3MOZ A;  4ERD A;  2B4V A;  4G1P A;  4A8K A;  3DNC A;  3FBC A;  2NRE A;  2B43 A;  1HNZ F;  1WEZ A;  1U6Z A;  4LBP A;  4CP5 A;  2A6O A;  2LXU A;  1RT4 B;  3R9L A;  4HHU A;  1DAX A;  2DR8 A;  1KHV A;  1TKT A;  4AQY J;  3VVT A;  1HQE B;  1LWE B;  1LK5 A;  4BDP A;  1B0T A;  5IOL A;  1OQ3 A;  3IG1 A;  1FE0 A;  5ETP A;  4IDK B;  2B8Q A;  1NK9 A;  4UY8 5;  2H4W B;  3KG0 A;  1RP5 A;  3PJX A;  1UA1 A;  3MM7 B;  3D66 A;  1KOH A;  2ZNY A;  3PCO B;  1N34 J;  5F9N A;  2B51 A;  3EZ5 A;  3TAM A;  2XZT B;  4BLG A;  3CJR A;  5H1S V;  2YX7 A;  2OEJ A;  2C2Z B;  4F0H A;  1S6O A;  2WW8 A;  4MK9 A;  3MOJ B;  3QGI A;  4K50 A;  1FHT A;  1YJN S;  5A8R A;  4RW7 B;  4KFB B;  2C2D A;  1Y11 A;  2DXE A;  4RUH A;  2CWX A;  1MML A;  2VUG A;  2CZ4 A;  3AB4 B;  2FHJ A;  4P71 A;  1WWH A;  4UF4 A;  1UL3 A;  3HP6 A;  3HVW A;  5J1N A;  3H20 A;  3SQG B;  1S48 A;  1LW2 A;  4AXJ A;  1TUW A;  4ZPT R;  3PW2 A;  1QAY A;  1RTZ A;  4B9M A;  2ROG A;  1FCA A;  4K0K J;  5A0Y B;  3MR7 A;  3MAQ A;  3HPO A;  3TZW A;  2IHR 1;  1WC5 A;  1YVF A;  3FK4 A;  2RQ4 A;  4PRF A;  2D69 A;  4QR2 A;  4PWD B;  5IC6 B;  2HLT A;  3JSM A;  3KNG A;  4QW9 A;  4RWW A;  2IY5 B;  2VG7 A;  2R8K A;  3CNQ P;  4EFA C;  4JI6 F;  2CPX A;  2W24 A;  2UV8 G;  1OPI A;  2Z56 B;  1UP1 A;  4K4T A;  2HHQ A;  2JC0 A;  2UUT A;  3ZTP A;  2UVW A;  1JJ4 A;  4CNZ A;  1S1X A;  3QMQ A;  4I7F A;  4RO0 A;  2C2M B;  4HEA 9;  4CO3 A;  5MLC V;  3UI3 A;  5CYQ A;  4O4G A;  5GAG I;  1T11 A;  4LJM A;  2LEB A;  2J76 E;  3A1Y G;  2M70 A;  4O44 A;  5LT5 A;  4ZCL A;  2B9Y A;  2GV1 A;  2F4V J;  2V34 A;  3V2U C;  2GIR A;  2YPY A;  1ZS6 A;  3CIZ A;  3POT A;  3S1T A;  1N0U A;  2R8G A;  3D1O A;  2R7W A;  2CPH A;  3HSZ A;  2MST A;  1VQS A;  3LP2 A;  2MY7 A;  3OSP A;  1DQ8 A;  4PXE A;  2I5J B;  4C3K A;  1RE1 B;  2PEB A;  3QAT A;  5KFG A;  3ZZR A;  1RTH A;  4Q2M A;  2V0N A;  3M8R A;  2VIC A;  4FBU A;  3J80 U;  4M63 A;  1U24 A;  1FJG F;  4BS2 A;  2R7V A;  1LWC B;  2FQQ B;  1GEH A;  1TMM A;  3OTB A;  2IFX A;  5KT2 A;  3MEE B;  2YQ1 A;  5B7W A;  2O01 C;  3KDO A;  2KYZ A;  3VGT A;  3HVA A;  2BM0 A;  3B82 A;  1NK6 A;  4NA3 A;  4N77 A;  2QG9 B;  1DJ0 A;  2BX6 A;  1UMJ A;  2CJY B;  4RPF A;  4MAK A;  2BQU A;  4PPD A;  1X4D A;  3QLH B;  3QSI A;  2DB1 A;  4WP9 A;  3ZC4 A;  2E7V A;  4YQW A;  1KON A;  4X66 J;  4UTG A;  3HVT B;  1ZET A;  3TO8 A;  3CF5 Q;  3JB9 k;  4LF5 F;  3K0J A;  2VC0 A;  4PG4 A;  2KFN A;  2YH1 A;  4V19 J;  1HBU A;  4ZVG A;  1J5E F;  1HHQ A;  3EM1 A;  3HHL D;  1Q4R A;  2ZOM A;  4KR0 B;  2DR5 A;  2D3O R;  4QYR A;  3I9Z A;  4ILL A;  4CIO A;  4IFV A;  4OX8 A;  3D4J A;  3MDF A;  5D4L A;  4UOC A;  1QTN B;  3R5C A;  5DM7 Q;  4Y34 A;  2COL A;  3M8P A;  3ZTO A;  4BC9 A;  3FDS A;  1XQI A;  1VQO S;  2GHP A;  3TAP A;  3L9Z A;  1FNO A;  3HVR A;  2HHU A;  5G0R A;  2EVZ A;  1Q78 A;  4CO5 A;  2EFO A;  1UVJ A;  2B6A B;  1N36 J;  3G2X A;  4HDG A;  2AMC B;  4CLW A;  1BHN A;  2LMI A;  2ZBQ A;  3KK1 B;  2W9B A;  3NGD A;  3G71 S;  3D6H B;  1XC9 A;  3JTN A;  5F41 A;  4PXD A;  1QSY A;  2AIR B;  2W2Q P;  1HPZ A;  1JK9 B;  5E3P A;  1GX6 A;  3GON A;  1PC4 A;  4TNO A;  2VOO A;  2N4D A;  1EX8 A;  3QAU A;  3DGV A;  5HRO B;  4D3H A;  4KV8 B;  1NK5 A;  1E6V B;  4IO1 A;  4LF8 J;  3TUP A;  2ZM6 J;  2RAQ A;  3QNW B;  4M5J A;  2YKP A;  2H5E A;  4CYU B;  1JKH B;  1UVL A;  1T03 A;  3TQ1 A;  3V81 B;  3IBF B;  1S77 D;  8RUC A;  3DRP B;  2HK2 A;  1GT8 A;  2AU0 A;  1HNX F;  2OJ3 A;  3SFU A;  3MM6 B;  2J9E A;  4C0B A;  4B3R J;  1C1B A;  3FFI A;  4EZ9 A;  3GJT B;  2X3G A;  4NML A;  5E33 A;  3OR1 A;  1OY8 A;  3OXL A;  1XMQ J;  3W60 A;  1D0E A;  3M30 B;  4OYX A;  5IWA F;  1O51 A;  4FS2 A;  1JIH A;  4RW9 A;  5HQL A;  5JUM A;  3FZ2 A;  4FXW A;  4I2Q A;  4U7U D;  4WK1 A;  1WTB A;  3GIM A;  4ZIV A;  1H98 A;  2HQI A;  2B7C B;  5GME A;  2RKI B;  5F8M A;  5EUH A;  1N5T A;  2J7U A;  3I0S B;  5HAT A;  4LUB A;  3DOL A;  4OJ1 A;  2KRB A;  3BH6 B;  4LRF A;  1LKZ A;  2D9P A;  1CG2 A;  3OVB A;  1I3O B;  1ZZF A;  4I56 A;  1CS4 A;  1H7W A;  3HKZ D;  2VFU A;  3CPW R;  2R4F A;  2KFZ A;  3NOG A;  2HVZ A;  4LF6 F;  4RNM A;  3IFE A;  5LM7 E;  2FIU A;  2LVW A;  5G4D A;  3WDO A;  1H2V Z;  1L3T A;  1AXQ A;  3HSD A;  1TL4 A;  4NWB A;  4WJB A;  2J8S A;  3KYL A;  2F3J A;  3ILI A;  2AHO B;  3IXQ A;  2J7W A;  1FTR A;  1QVG R;  2J8A A;  3MAA B;  2PI4 A;  4EO6 A;  2E5J A;  5B0B A;  4RW8 A;  2VG5 B;  3W2W A;  3RRG A;  3BN7 A;  3UN3 A;  3PV8 A;  1C1C B;  2CDQ A;  1RT1 B;  1JLG A;  2P9G A;  3IO1 A;  2XLK A;  1YI2 S;  2YPZ A;  3KTQ A;  2VDI A;  3L4B C;  2EI5 A;  2W1B A;  4IR1 A;  2HQ3 A;  1Y5I B;  1RWV B;  1XNR F;  4J9R A;  4CZC A;  3G6V A;  2HKE A;  2ZBI A;  3V6D A;  4DR7 J;  1VGY A;  5KG7 A;  2FGC A;  1BQM B;  1RWK B;  1CVJ A;  4KSE B;  5K8O A;  3UD5 A;  3EX7 B;  2YNI B;  1X0P A;  1RTD A;  4KKO A;  3THT A;  4RW4 A;  4ECY A;  1UVN A;  3SYZ A;  3EVM A;  3RRH A;  5J1E A;  3GPA A;  1R43 A;  1VQ6 S;  2VBX A;  2H1Y A;  3LWL A;  2DH9 A;  2VB6 A;  5D3G B;  1FJ7 A;  2BR0 A;  4LRB A;  3GP9 A;  4I2P B;  4NRT A;  4CQ1 A;  2WON A;  2ZZM A;  1HYS A;  4ANC A;  4ALZ A;  1QAI A;  1HW9 A;  3RZA A;  2LLZ A;  3WC2 A;  4ETZ A;  4OZJ A;  1DHM A;  2L9N A;  5LOQ A;  5KFD A;  4K5S A;  2R42 A;  1RSC A;  3MPV A;  2E5H A;  3UR3 C;  4Z37 A;  2IVF B;  4DSI A;  4DWI A;  2QYC A;  1S6Q A;  1NJY A;  2HGM A;  4QWC A;  3L95 X;  3AFG A;  4R0E A;  4BCA A;  1TL3 A;  3Q8S B;  3UN5 A;  4WZM A;  3QO9 A;  4ZVE A;  3VV2 B;  2AJ0 A;  1V5I B;  4NCA A;  1WEX A;  1IKV B;  1KDN A;  4YB7 A;  5KFA A;  1KQG B;  4F4K A;  2JH3 A;  4KY3 A;  2HNY B;  4H4O A;  1NB2 A;  2N7Y A;  1VBZ A;  2GML A;  3M2V B;  1B7Y B;  2A10 A;  2LEC A;  4TN2 A;  3CDE A;  2LQJ A;  2VBW A;  1HQE A;  1LWE A;  2CQ1 A;  3ISN D;  1WG1 A;  5FD1 A;  1RT2 B;  4IDK A;  2RF2 B;  2HFU A;  3OHB A;  2KT2 A;  5LL6 d;  3GR1 A;  2RUG A;  3QSY B;  2MZ1 A;  3TP2 A;  3DLB A;  5IC4 B;  4FPI A;  1UWB B;  5ETT A;  3ZNJ 1;  5DG9 A;  4FP9 A;  2YX1 A;  3D0I E;  1ROF A;  3Q8V A;  5KG1 A;  3FZB A;  1VK8 A;  5EGY A;  1V3R A;  4OYB A;  4J9N A;  5ITH A;  2ZHA A;  4YOE A;  1BMQ B;  4FKX A;  3D6T B;  4RW7 A;  4KFB A;  3CDA A;  4LSL B;  5L1I A;  5L1K A;  4XAK A;  3IS9 B;  4HL9 A;  4KPY A;  4YME A;  4X65 F;  3NP5 A;  4NMX A;  2OPS B;  1HBO B;  1BQN B;  1BXN A;  3QJL A;  1Q82 T;  3UDL A;  3Q86 A;  1SL0 A;  2Q6C A;  2A1B A;  1JX4 A;  1YRT A;  1A9N B;  1X4C A;  1VI7 A;  1Q53 A;  1Q5Y A;  1CUL B;  1C4A A;  5DJB A;  2EFV A;  1U4B A;  4EBD A;  3BSO A;  4YR0 A;  2FVR A;  3DLG B;  3M32 A;  5A0Y A;  4FYV B;  3CWJ A;  3ZZU A;  1DRZ A;  2WB4 A;  2AYG A;  4J9O A;  2M9K A;  4Q7A A;  4CT9 A;  1N32 F;  1TR0 A;  4C2M A;  2YXL A;  3C15 A;  1CJT B;  5A8W B;  4WU2 A;  2OO4 A;  1TP7 A;  2RVJ A;  3HDS A;  2DHG A;  3NAI A;  3VF0 B;  4PWD A;  2JVO A;  3OTO J;  2CPJ A;  4DR2 F;  1DLO B;  3PHE A;  1BD6 A;  4PYA A;  2W9A A;  1ZM3 A;  1SJ1 A;  3CUN A;  4RZR A;  3Q8Y A;  4CNY A;  3RYL A;  1AA1 B;  1KS2 A;  5A8K B;  2EFG A;  2CJ9 A;  3KLG B;  3I4P A;  4AD6 A;  2DVI A;  2JZ5 A;  3ONQ A;  3MCN A;  2W8L A;  1GTH A;  2GAG C;  2AV5 A;  3MFH A;  2MJN A;  4TQS A;  1C0T B;  4IOB A;  2UU9 F;  1HWU A;  3W8P A;  4B3M F;  1WHW A;  3PTW A;  4IH7 A;  3M2R B;  4XDD A;  3G8Q A;  1SJF A;  3MUM P;  1OSD A;  2UP1 A;  2HEK A;  3DRS B;  1FX4 A;  3AAW B;  1HQ2 A;  4K2X A;  3WQP A;  1PIE A;  4FBT A;  4F67 A;  2MLY A;  4PQA A;  3G6X A;  4A48 A;  4DPX A;  2IM2 A;  2ZUA A;  2I9S A;  3UCG A;  3TVK A;  3T5L A;  2HHX A;  4ZS6 A;  3W7B A;  4N7T A;  1H0H B;  2HZA A;  5KFB A;  1OYE A;  1RHU B;  3PRD A;  2V69 A;  1MNE A;  2YH0 A;  4OYA A;  2DO4 A;  1IUJ A;  4F4Y A;  3ILO A;  4JI1 J;  2RRB A;  5HVG A;  4JYA J;  1U1R A;  4WKY A;  3CUL A;  5GMD A;  1LWC A;  2M0G B;  1T9V A;  2OLW A;  2NZC A;  2IVY A;  4ZHR A;  4DCO B;  3MEE A;  2KZZ A;  2FVQ A;  5LMN F;  2KB2 A;  3GG1 A;  4AL6 A;  1NJW A;  3HT0 A;  4I1T A;  2DGX A;  3JQJ A;  3PW5 A;  4DBQ A;  3FC9 A;  1H38 A;  1FRI A;  5ADZ A;  3CCS S;  3HCX A;  3EYZ A;  3RW6 A;  2HWI A;  1JLF B;  3RBZ A;  5T14 A;  1AW0 A;  5HMY A;  3MM9 A;  1WOO A;  1JMT A;  4LRE A;  1ZAV A;  3M6W A;  2GFF A;  4HYK A;  3QLH A;  2DXD A;  1IBK F;  2HND A;  3K57 A;  3W9I A;  3TZZ A;  1YTY A;  4UY8 T;  1BLU A;  4RL1 A;  2AEJ A;  4LRC A;  4P2M A;  3LAN A;  2UUB J;  4M1K A;  1S1T B;  1UEU A;  2ZBR A;  4Y3C A;  3R6L B;  5GAH U;  3QT5 A;  3MPD A;  2MKK A;  4DL5 A;  3HT3 A;  2AX1 A;  3W64 A;  2FJW A;  1S49 A;  1VQN S;  4LIR A;  3NGS A;  1SJ4 P;  2V67 A;  3FCW A;  4ATN A;  1RCO B;  3C14 A;  4PG8 A;  3GJQ B;  4C48 A;  3LAL A;  2HWT A;  2OIH A;  3OD2 A;  2AWZ A;  1ITP A;  2VOD A;  2XUL A;  3IR7 B;  3UN2 A;  3O2I A;  3FBB A;  1NCL A;  4W4M A;  1TK5 A;  2GCF A;  3O1L A;  5KFQ A;  1GX5 A;  2FJB B;  4HVZ A;  2B6A A;  2PFD A;  3TEG A;  2C2E A;  2FHK A;  1KVJ A;  1MSW D;  6FDR A;  4L72 B;  5IM0 B;  2BKO A;  1LEO A;  1PAU B;  2JDJ A;  5KFL A;  3TOQ A;  2U2F A;  4USM A;  4FF2 A;  3V5R A;  4OI1 A;  5F8I A;  1AFJ A;  3NGU A;  2BJE A;  4OQJ A;  1QVF R;  2RRN A;  2XI3 A;  5B0G A;  2R7R A;  1GFW B;  5D0G A;  4NI2 B;  5J2N B;  4N41 A;  1RQ0 A;  2DHA A;  2RRA A;  5HRO A;  2PA8 D;  5DET A;  1L3V A;  1P1T A;  1R89 A;  1E6V A;  3HXM A;  1GNK A;  4M5D B;  2E5I A;  3TAQ A;  2BJD A;  1RT7 B;  4JI5 J;  4G3I A;  4F3O A;  2GO9 A;  4LFA J;  4BWM A;  2LQB A;  4PYD A;  2GVD A;  1WKL A;  1FT8 A;  3EDR B;  5HMZ A;  4WE1 A;  3V81 A;  3NBP A;  1QUV A;  2OI2 A;  4FVM A;  2PD1 A;  2WK4 A;  1OQ6 A;  2MLX A;  1ZTW A;  3W9J A;  4OJG A;  4EYI B;  4ELU A;  5AXK A;  3TI0 A;  1EZZ B;  2W4C A;  4DL7 A;  6AT1 B;  4DR1 F;  1K73 T;  1ZA1 B;  2DRD A;  2GGP A;  3M30 A;  3HZG A;  4A8W A;  4NLR A;  3HHD A;  4ICL A;  1DAR A;  4B08 A;  1FI4 A;  3AJ1 A;  2XMA A;  1WF2 A;  3KKF A;  1YDL A;  2U1A A;  2KL8 A;  3HHN B;  4ETX A;  2MY8 A;  4DF8 A;  1WKK A;  3K5P A;  2W7P A;  1UKU A;  3I0S A;  4GVL A;  1N4L A;  2H48 B;  2F1F A;  1M5V C;  1HWL A;  1UZD A;  1F5C A;  3U1M A;  3D1H A;  3M6X A;  4I67 A;  3E51 A;  2OTL S;  3MMB B;  1HNZ J;  1N56 A;  3AQO A;  2Y3Y A;  3JQM A;  2G2O A;  4N5S A;  3IC1 A;  3MR3 A;  2DNQ A;  1T3O A;  1K9M T;  4LRA A;  1G7C B;  2GAH C;  1VDH A;  1X4B A;  4B3S F;  2KN4 A;  2WVC A;  5A2Q U;  4JI4 F;  3SI8 A;  1RT6 B;  3PW4 A;  1CPZ A;  1VQM S;  3FMW A;  2MPU A;  3OW2 R;  4A8F A;  4UOF A;  4NLD A;  4FDF A;  3I87 A;  4CO4 A;  1G1X A;  4AE5 A;  2R9L A;  4J5O A;  2GHW A;  3BB5 A;  3MAA A;  1VYA A;  3PG9 A;  3NNH A;  4YP3 A;  2I1R A;  5EDW A;  1YQH A;  1C1C A;  1KFS A;  4IO9 Q;  1RT1 A;  1WOS A;  3CCL S;  4CM0 A;  2YKM B;  1GXL A;  1HNW F;  5LSO A;  2JLG A;  1D8Y A;  2ZOF A;  3I5B A;  5KT7 A;  2NZ4 A;  4AL7 A;  3BBB A;  4OZ1 A;  3V6J A;  2BRL A;  5KFF A;  1X4H A;  3WIU A;  2MGZ A;  3LWM A;  1RLD A;  4U95 A;  4NLS A;  2YKO A;  2GIF A;  1X9M A;  3M8S A;  3LOU A;  4I69 A;  1PGZ A;  3I96 A;  3MM8 B;  2DKO B;  1GH8 A;  1YIT S;  2CYY A;  1SJ3 P;  4KPC A;  1K0T A;  2G1H A;  2G9O A;  1NPK A;  2QTW A;  4R8U A;  3GE9 A;  5D3G A;  3AT1 B;  4C8Y A;  3M8Q B;  3RBE A;  2LU1 A;  3NWR A;  2AZ3 A;  3V4M A;  1FD8 A;  1WKJ A;  3DFE A;  2KT5 A;  1UEV A;  1PG5 B;  2KO1 A;  3LQV A;  2Z30 B;  3VAJ A;  2DH7 A;  5KFE A;  4CLU A;  3T41 A;  4WK3 A;  1H72 C;  3D28 A;  5BYQ A;  2V2V A;  5C2G A;  2AYM A;  4DX6 A;  3QT8 A;  2DY9 A;  2CQ3 A;  4LR8 A;  4C8Z A;  1DTT B;  3SFG A;  3BGU A;  3M6U A;  2YKN B;  2V63 A;  4FKY A;  4P75 A;  1F6T A;  3VAI A;  3N9U C;  1R0A A;  4CWB A;  2DJW A;  3KHH A;  2DNZ A;  3QIP A;  4JI6 J;  3MUR P;  4I68 A;  2CRL A;  4ILM A;  2G0J A;  2W4P A;  1DUR A;  1VJW A;  4GRS A;  3M2V A;  1SUQ B;  2HLU A;  4Y0F A;  1VRU B;  2YNH B;  5J2Q B;  3PX4 A;  1NLK L;  1J27 A;  2C2K B;  5HI7 A;  3GIK A;  2YY3 A;  3W65 A;  1U1K A;  2CG8 A;  4F4X A;  4RNO A;  3HLU A;  1RT2 A;  4ZKA A;  4NLP A;  3ILJ A;  2RF2 A;  1RAO A;  3T6B A;  3VQS A;  3EGN A;  5E2Q A;  1PJ5 A;  2QL7 B;  3R1H A;  3C46 A;  3CO9 A;  4MKA A;  1S6P B;  4ZLL A;  2UVV A;  5IT0 A;  2N82 B;  1G6B A;  1SH2 A;  2NQP A;  2DCL A;  2G1D A;  3C19 A;  1SV5 B;  2OSQ A;  2C3O A;  4N47 A;  2HHW A;  1U0H A;  1NJI T;  3SV3 A;  1YJU A;  4ZN3 A;  2APO A;  2MSS A;  1UZH A;  4P72 A;  1NDL A;  1Q0N A;  4WU3 A;  2VQE F;  3T5J A;  2ATC B;  2V2Z A;  1W25 A;  1N48 A;  1UAW A;  4LSL A;  2AJ4 A;  2EK1 A;  4RLE A;  3CJ0 A;  2E66 A;  2EFQ A;  4GKK F;  3S8S A;  5HP1 A;  2FJV A;  2OPS A;  1HBO A;  1BQN A;  2D3O 1;  2W2N P;  4NLO A;  1BY9 A;  1Z4U A;  2Y1L B;  4DV6 F;  2V8H A;  2I0X A;  1EKR A;  1FJG J;  3P45 B;  4KGK A;  1FKO A;  3AD8 C;  2XYH B;  5E3C A;  1RGV A;  1NB7 A;  4Y65 A;  4ANE A;  2VKZ G;  3KHR A;  5I42 B;  1VQY A;  9RUB A;  3OL8 A;  3M8Y A;  2MMY A;  5BYR A;  4KTQ A;  1PSD A;  5EWG A;  3DLG A;  1PJ6 A;  4EYH B;  5EWE A;  1YSJ A;  1LOU A;  2DNH A;  3HFZ B;  4ZJO A;  3H2V E;  4ZOS A;  1TU0 B;  5E3Q A;  5CHC B;  1CJV B;  4JUZ A;  2VPY B;  4U9R A;  2FC9 A;  3C3L A;  4LQ3 A;  2O5D A;  2W9C B;  1DLO A;  3IN5 A;  2BUN A;  3OLB A;  2CQI A;  3MEG B;  2DEI A;  5A8K A;  2JWN A;  2I6W A;  4Y6I A;  4LF5 J;  2UV8 A;  2B5J B;  3CJQ A;  3TJ9 A;  2ZIT A;  4DF4 A;  1NEE A;  4U7U K;  3BM7 A;  1QSS A;  1J5E J;  2BOP A;  3CSK A;  4DPT A;  5F0W A;  1YJ7 A;  5AXM A;  2HZV A;  4ZIT A;  3OPK A;  1HNV B;  2JLE A;  4KAI A;  2J0S D;  4WP8 A;  1EET A;  3C6U B;  4NZ0 A;  1OJ4 A;  4KHM A;  4F8R A;  4KIA A;  5KG6 A;  2ZH4 A;  3L7O A;  4G1Q B;  3PFO A;  1R8A A;  2YNG B;  2RNE A;  1XR7 A;  2UXC F;  1O0P A;  2XLJ A;  1TKX B;  5KT6 A;  4I64 A;  4GMK A;  3CJ2 A;  3LH2 S;  2BAN B;  2E7W A;  4OYO A;  1F5B A;  3HJV A;  1U02 A;  1Q7L B;  3MEK A;  2QA2 A;  4QIE A;  1FF2 A;  3RRK A;  1IKY B;  2RQC A;  3BSC A;  2YNF B;  5K5M A;  2CG4 A;  4EMD A;  2HK3 A;  3DRY A;  1OY6 A;  2IAJ B;  4OI6 A;  4RW6 B;  2DIU A;  1KNZ A;  1FDB A;  5F8N A;  4HTJ A;  1I94 F;  1TUG B;  2ZJP Q;  1IN0 A;  3SDE B;  2NUU G;  5HMX A;  2A2C A;  4UW2 A;  1K44 A;  2DHS A;  1YKW A;  5GAD U;  2OPP B;  1J5O B;  3V4I B;  2O3D A;  4K7Q A;  5I3P A;  4BC7 A;  1JLF A;  2J9D A;  3EDQ B;  4C6A A;  1HNX J;  3DXB A;  2LEP A;  1C0U A;  2FGO A;  4DUZ F;  1UFL A;  4ES1 A;  4USJ C;  3IP0 A;  2M52 A;  4OLP A;  2YWG A;  2MHE A;  4FYY B;  3V6H A;  1M5P C;  3CGI A;  2XY5 A;  5EWF A;  3DLH A;  5AE3 A;  2PGC A;  1HR0 F;  2DIS A;  5IWA J;  4QBU A;  2NUH A;  1S1T A;  4QYZ J;  2BW7 A;  3IG1 B;  3GSD A;  2OEK A;  3AJD A;  3MGJ A;  3O6Q A;  1S9E A;  2J0W A;  5E0O A;  3D7S B;  5L9X A;  1L3U A;  4NLW A;  3B8H A;  4DDF A;  5KG5 A;  1REG X;  2BM1 A;  2OFG X;  3TAM B;  4I0W A;  2CUY A;  1S7H A;  1FJC A;  4WKR A;  3OJS A;  1WOR A;  2WSF C;  2CPF A;  4ZCI A;  4UOH A;  1HL6 A;  4LF6 J;  1K1Q A;  3UD4 P;  5A8R B;  3J7Z 5;  2OH2 A;  1RTI B;  3CDW A;  3I32 A;  3PO5 A;  5IQ6 A;  1H6K X;  3IR6 B;  3NCP A;  1SC3 B;  4CLZ A;  4ZLP A;  1OIA A;  4HR2 A;  3C66 A;  2XCP A;  3TW0 A;  3A13 A;  5IM0 A;  3DLJ A;  2MLZ A;  4QWD A;  4M5G A;  4P2S A;  4B3O A;  4RNF A;  3IRW P;  1XMO F;  1LW2 B;  2BOA A;  2XS2 A;  5IS2 A;  3EJM A;  4NI2 A;  2LEA A;  1XNR J;  5DQG A;  1GMW A;  4AXI A;  3EVO A;  3BKT A;  1DTQ B;  2BJ9 A;  3DHW C;  4F4A A;  4M5D A;  1EKS A;  4HTI A;  2R7S A;  1RT7 A;  3OTC A;  1T0T V;  1X5T A;  3WIV A;  3ILL A;  1OO0 B;  5CAA A;  4NX9 A;  3KK2 B;  5DDP C;  3D0H E;  3TAR A;  2DT9 A;  3JSM B;  4OYZ A;  3LP1 B;  2VG7 B;  1RIS A;  1NH7 A;  4DHV A;  1KQF B;  2OEL A;  4NLT A;  3TRG A;  2GW8 A;  1FEE A;  1FXR A;  5ETM A;  1PC5 A;  1AT1 B;  1S57 A;  2EPI A;  3JSB A;  1RHR B;  2XY6 A;  2V8V A;  3FKB A;  3DDN A;  1P8G A;  3BYP A;  4I7F B;  1WAC A;  3GG0 A;  4G65 A;  4JV5 F;  1YBA A;  1WDT A;  2V8P A;  1LK7 A;  4OZ3 A;  2JOQ A;  1KOO A;  4O4G B;  2OMO A;  5GAH I;  4DQS A;  5CYM B;  3HHK A;  1VR6 A;  1SC4 B;  5KFR A;  4O44 B;  2D9O A;  3N28 A;  2VFR A;  2QX0 A;  2CNO B;  4F0K A;  4IYQ A;  2WB1 D;  3MMB A;  4MK7 A;  1FJE B;  2MQN A;  1GXT A;  2JEF A;  4MYU A;  3I0R A;  2YWW A;  3E01 B;  4LMZ A;  3BGR B;  1S0N A;  4OJH A;  1VK3 A;  4IQX A;  3H90 A;  4PXC A;  1RT6 A;  2NSC A;  1M5K C;  4OL8 A;  3M4X A;  5EX3 A;  2IDE A;  4X4S A;  3TJ8 A;  1SBR A;  1ACM B;  2RD5 C;  3UQS A;  3W3S A;  2HS0 A;  3MMA A;  2VPZ B;  4X4P A;  4K4V A;  4FNI A;  2Q43 A;  2FZK B;  4Q45 A;  3NG8 A;  3VTI A;  2DHX A;  2XLI A;  2VBY A;  2YKM A;  2CZV C;  2F7V A;  2B4O A;  1B0P A;  3AXK A;  4TY9 A;  4USU A;  4ZK7 M;  3JSY A;  1BGX T;  5D4P A;  3IGV A;  3G6E S;  1SH3 A;  2VJV A;  2DGS A;  1JJH A;  1A6L A;  2QA1 A;  5HBM A;  4LVO P;  2IDL A;  3ISZ A;  4X65 J;  4IUF A;  2Z57 B;  1S9F A;  3KLE A;  1JJC B;  4P9S A;  1D9F A;  2NLW A;  4E98 A;  2XEX A;  2IJN A;  2R8H A;  5KFJ A;  2ZC3 A;  1OWX A;  3UDV A;  4DFK A;  4DL4 A;  3M8Q A;  2EW9 A;  4UQG A;  3O44 A;  2L08 A;  1UVI A;  2V2K A;  1WC1 A;  2A0F B;  2GQQ A;  2X1A A;  2MKJ A;  1R31 A;  4NLQ A;  2CWK A;  1T9T A;  3F56 A;  4PQU B;  2FUG 9;  4P2F A;  5GAE U;  3CXC R;  1M90 T;  4M5N A;  1N32 J;  3K7R A;  1RAG B;  1AZS A;  3QWP A;  2X1G A;  4A47 A;  1NDP A;  2HFZ A;  3LTO A;  2OD4 A;  4RR5 A;  3TUZ C;  1DTT A;  3M8P B;  5C25 A;  4DR2 J;  1Y0H A;  3H4D A;  3J7Y U;  2VIH A;  4ECW A;  5G0R B;  3UPF A;  5CA5 A;  1NHV A;  1ELO A;  2IJF A;  4R25 A;  4KH0 B;  4RU9 A;  3S6E A;  2VL1 A;  3MTK A;  5KT4 A;  1SUQ A;  1VRU A;  5J2Q A;  2IMW P;  3S7R A;  1RLC L;  3D1Q A;  1IWA A;  3MD3 A;  2UU9 J;  1JQG A;  1IBL F;  1FDN A;  4DL3 A;  1PIL A;  5D77 A;  2MTL A;  4B3M J;  2FJD B;  1FDD A;  2KRR A;  1S7I A;  2UVR A;  3I82 A;  1HPZ B;  1IXK A;  4OYI A;  4ZP9 A;  2E9Z A;  2DNN A;  4FVC A;  3R3T A;  1S6P A;  2ZE2 B;  5DM6 Q;  4B9T A;  4O3O A;  3FRZ A;  2EKN A;  2HRT A;  1U09 A;  4DUY F;  4ECQ A;  4X62 F;  3BO4 A;  1S79 A;  4OHY A;  3KFW X;  5KFV A;  3IR5 B;  2IM3 A;  2MKI A;  1YJR A;  2LKZ A;  3MR2 A;  5J2M A;  4IRK A;  1V3S A;  2PO4 A;  3HUL A;  3DLE B;  1F5A A;  1RKI A;  3RAQ A;  3MMC B;  1T03 B;  1FRK A;  5D0R A;  3T3F A;  1ZM4 A;  4CLP A;  3VAL A;  1VQ4 S;  2BAB A;  3W62 A;  4JI3 F;  2V50 A;  4NLU A;  2DCU B;  2VAS A;  4ELV A;  3FFI B;  2JRS A;  2XMJ A;  5K8N A;  4JI2 F;  1S1V B;  1M5O C;  4ECS A;  3LP0 A;  3NRB A;  5HO4 A;  2VQF F;  2QSW A;  5U47 A;  3QRP A;  3J80 Y;  2PEH A;  2YWH A;  3GLJ A;  2VA2 A;  5B09 A;  5KFK A;  1S72 S;  2QE5 A;  3H25 A;  1P9Q C;  2Z2Y B;  3US5 A;  4FF4 A;  2GQ2 A;  4DPO A;  4CTA B;  2IRU A;  5LMN J;  5KOW A;  4GO5 X;  3M8Z A;  5DS7 A;  4YS2 A;  3E2E A;  2NXC A;  3M05 A;  2IJR A;  4C3L A;  1ICE B;  3CB4 A;  1AYE A;  5KTQ A;  1NKC A;  1XWL A;  2MZR A;  4DV3 F;  4DQR A;  1XER A;  1UPP A;  3DOL B;  2R2T A;  2DPJ A;  4O23 A;  2OPR A;  1RT5 A;  2W2O P;  1CJV A;  1QD1 A;  1IBK J;  1CS4 B;  4U7C A;  4Y2M A;  1ZOT A;  4WFY A;  2HBY B;  2CNN B;  3TYT A;  1VHI A;  1X8D A;  2LA6 A;  1Z1Z A;  1HI8 A;  3CJT A;  2GIQ A;  3HFK A;  2E5L F;  4OLO A;  4NCB A;  2ROP A;  2FB0 A;  3KUE A;  5B0F A;  2GVZ A;  2XSJ B;  1LW0 B;  3TX0 A;  2KJW A;  3DDI A;  4RKU C;  1VJQ A;  2VDH A;  5T7L A;  4F02 A;  5C7P A;  4RW8 B;  3W2W B;  1SVD A;  2WBM A;  2B4P A;  2F9D A;  2DGW A;  2MDA A;  4LFB F;  2M2B A;  4RX6 A;  1F2G A;  4A46 A;  3BKU A;  1CC8 A;  3CD6 S;  2QFI A;  3T1H F;  2E1C A;  1X4G A;  1W26 A;  1Y5N B;  1PJ7 A;  4ZDN A;  8ATC B;  3R5J B;  2XQC A;  3S01 A;  4MIA A;  3R27 A;  4USV A;  3IBC B;  3SV4 A;  4DCP B;  3GII A;  5L1L A;  4NYZ A;  2HSE B;  2HPU A;  4WWS A;  5BR8 F;  2FLO A;  2NYI A;  4KKO B;  2BAN A;  1ULR A;  3CCR S;  4NEZ A;  2ZH2 A;  3N01 A;  1Q8I A;  2YNF A;  3BEG B;  2M7S A;  3UDC A;  1XMB A;  2IAJ A;  1JLQ B;  4RW6 A;  4LR9 A;  2CQB A;  1Q16 B;  1YG0 A;  2PII A;  1HYS B;  1RKJ A;  3R97 A;  1RWW B;  3FEX B;  2JX2 A;  4P74 A;  4OHW A;  4DJB A;  3Q2S C;  1QY7 A;  3SDE A;  3P96 A;  4NCG B;  5E3R A;  3OTE A;  1VS3 A;  1HA1 A;  4NPO A;  2E29 A;  4Q0B B;  1EJ7 L;  3LAM A;  1EQ0 A;  2BE2 B;  2OPP A;  2M8H A;  4U96 A;  1OYD A;  1X5P A;  4IQM A;  1J5O A;  3V4I A;  1WNE A;  3D0G E;  3SCI E;  1TL3 B;  4DR4 F;  1RWP B;  4WFZ A;  1O5J A;  3TUJ C;  3QO9 B;  2RH3 A;  1R0C B;  4PZV A;  2OEM A;  1HAR A;  1RA7 A;  1Y4Z B;  4MKY A;  1YJV A;  3V6K A;  1LNQ A;  3EVW A;  2KTQ A;  3OFF A;  1ZAX A;  2CNK B;  1U1Q A;  4ED2 A;  2XTJ P;  3K89 A;  4DR1 J;  4QIW D;  2XMU A;  5HJY A;  4H4O B;  3UE2 A;  1B3T A;  4DQQ A;  1URN A;  2ACY A;  1NSK L;  1R8B A;  4KGZ B;  4E0D A;  3F73 A;  2QLF B;  4N8N A;  1MU2 A;  2DBB A;  3IWN C;  4ZLJ A;  4H4K C;  2H3E B;  2WOM B;  5E41 A;  4DR5 F;  5KFW A;  4F2R A;  2N4C A;  4DXL A;  2GQC A;  4WFN Q;  3FBE A;  4KGX B;  4F26 A;  4X4U A;  5DZ6 A;  1T9X A;  3TVY A;  3CJK A;  2HUR A;  1PYT A;  3KDN A;  3QGP A;  5KAK A;  2GMJ A;  2GZO A;  3D2W A;  1RTI A;  5CXT A;  2X3D A;  5DDQ C;  4B3S J;  2UXD J;  3RB6 A;  4K59 A;  4JI4 J;  2ATL A;  4B3T F;  4CH0 S;  4DFP A;  4USK A;  1HD1 A;  3PEJ A;  2MZT A;  2ZVI A;  5KFY A;  2KG1 A;  3KJF B;  5HVF A;  1HHT P;  4W98 A;  3X3U A;  4QW8 A;  1H73 A;  2K3I A;  4YY3 F;  3I4H X;  3U7J A;  3BQ1 A;  2OP5 A;  4ED5 A;  1B7F A;  1MN9 A;  2BJ3 A;  4CLS A;  4NA2 A;  1HNW J;  1TTH B;  3K59 A;  3K5N A;  3GV5 B;  5ETO A;  3M32 B;  2DNK A;  1BC6 A;  4WIQ A;  5IQQ A;  1NAQ A;  1S1W B;  2BA9 A;  1V6H A;  1U1M A;  1WHV A;  1DTQ A;  1LWF B;  5D4N A;  3PVX A;  4WII A;  4QU7 A;  4I6Y A;  3QBC A;  3C15 B;  2NR0 A;  3BO3 A;  3WX8 A;  3GFY A;  1KN6 A;  3RJM B;  4MH8 A;  5GAD I;  2HVE A;  4DSJ A;  3KK2 A;  1KVK A;  1IBM F;  5E7O B;  2JEG A;  3LP1 A;  3MM5 A;  4JI0 F;  4U8V A;  4UQT A;  4UST A;  1FD2 A;  1T9Y A;  2DR9 A;  1B64 A;  1FWK A;  1SJR A;  1N52 B;  2NPF A;  1WSV A;  1KRP A;  2NXE A;  3U1N A;  1F3V A;  4ED1 A;  2BQR A;  3T1A A;  3N79 A;  3T19 A;  3SZ2 A;  4ZIW A;  1FDA A;  1VQ8 S;  2CPE A;  2DGO A;  2DIV A;  1PYO B;  1B4S A;  2C3M A;  2PMH A;  3AXM A;  1DY3 A;  4ER8 A;  4H54 A;  2K7J A;  2OSR A;  5CYM A;  2EBG A;  1UVM A;  3MTJ A;  2BYC A;  2ZWP A;  2AP6 A;  1S97 A;  3R2D J;  4LF2 A;  3T5K A;  4ZVU B;  3M1V A;  1T05 B;  3R7B B;  3CT9 A;  3JTP A;  2V9W A;  1U0S A;  3EGZ A;  5AE1 A;  5KFX A;  4DUT A;  3E01 A;  5BYS A;  2AQ4 A;  3BGR A;  1KFD A;  3CJ4 A;  2FZG B;  4J9U E;  2CZ9 A;  2DXF A;  2XYG B;  3QQC D;  1MLA A;  3G87 A;  3HJF A;  2P5V A;  3W8G A;  3FSX A;  1X31 C;  4HLB A;  2KXF A;  4KHR A;  1F60 B;  2QV6 A;  3H40 A;  2KKH A;  3RG6 A;  3AOB A;  4URG A;  1HI1 A;  5A6W A;  3MFI A;  2FHJ D;  4ZHR B;  3KUH A;  2HRU A;  1NSA A;  2ZDP A;  4JBC A;  2IM1 A;  4X4T A;  1H3D A;  2RB7 A;  3G8T A;  3BSN A;  3MUT P;  1RAJ A;  4MIB A;  1NH8 A;  4WFA Q;  1F9E B;  2VQE J;  1ZM2 A;  2QA4 G;  4C7Q A;  1X4F A;  5ETK A;  5KOX A;  3GJS B;  4C98 A;  2HHS A;  3MM9 B;  3DYA B;  1CC7 A;  1R7I A;  3P5B P;  3MAH A;  2OUG A;  4GKK J;  1S76 D;  4TU7 A;  2HND B;  1O8B A;  3EXC X;  4GKJ F;  4DV6 J;  1RWX B;  3D6F B;  2I8E A;  2R2R A;  2BRK A;  1TKD A;  3ZXW A;  1GAO A;  3MED A;  1U2F A;  2L41 A;  2Y9H A;  4YR3 A;  2Y1I A;  1D1U A;  2J9D E;  2W7A A;  1VQ5 S;  3GJR B;  3CMQ A;  2V4Q A;  1I5O B;  2G13 A;  2CPZ A;  4PQU A;  3M8W A;  3B4M A;  1H74 A;  2AGO A;  2D74 B;  1BQX A;  4RWX A;  1N5Q A;  4ZVQ B;  2Q3P A;  3J7Z T;  4QR1 A;  4HHJ A;  5HLF B;  2IM0 A;  1NJZ A;  3PEH A;  3C14 B;  4A8Q A;  4X4O A;  1YX2 A;  3EGV A;  2MEW A;  3WX4 A;  3ET6 B;  4PPZ A;  3T1Y F;  1UA0 A;  3PRV A;  1Y3K A;  1SXL A;  2ZBP A;  1VQ9 S;  2F4F A;  4LF7 F;  5C42 B;  3VQT A;  1JJ2 R;  4S0M A;  3R2C J;  4WP3 A;  1SL2 A;  3GIR A;  1WC6 A;  1WI8 A;  1ZPV A;  2E1M C;  3K5M A;  2H5I B;  3QT6 A;  2XC9 A;  3CCE S;  1MG7 A;  4NE9 C;  3PRB A;  2CQP A;  3G82 A;  1LXJ A;  3DXS X;  1M0S A;  2JHE A;  3WHI A;  1JLB A;  5LXR A;  2ZE2 A;  3SSS A;  4RJV A;  1M5S A;  1SH0 A;  4HI1 A;  4M5H A;  3J7A N;  5CZV A;  5C5J A;  3MPU B;  1KHW A;  2DRA A;  1IR0 A;  2V4J B;  5L39 A;  2ZBC A;  3DGP B;  1Q95 G;  1JNR B;  2UXC J;  4EEY A;  3GR0 A;  3OXF A;  4MMO A;  1FWP A;  5DQI A;  4EI2 A;  3DLE A;  2VPX B;  4QJV A;  3MMC A;  1TV6 A;  2GVD B;  2RDD A;  3SQO P;  2VA3 A;  1Q5V A;  4WE1 B;  4AYB D;  2CQ4 A;  1VLY A;  3NBP B;  3PR4 A;  4P2X A;  2CKW A;  3PKM A;  2VG6 A;  1S1V A;  1L3K A;  1U1N A;  1HIY A;  2IYI A;  3NAH A;  1FK9 A;  4O3P A;  1P9Y A;  3IM9 A;  2QMU B;  2LU2 A;  1UJ6 A;  4K4Y A;  2GGP B;  1I94 J;  1GMU A;  1GQE A;  4JV1 A;  1RAA B;  3FRY A;  5MAO A;  3HF5 A;  2Z2Z A;  3BH7 B;  1YWX A;  4YUD A;  4MK8 A;  4CTA A;  4ICL B;  3D54 A;  3NS5 A;  2M88 A;  2R3V A;  4QIF A;  2AZ1 A;  5DG8 A;  4ECZ A;  4H4K A;  1HNI B;  5GAE I;  2XHC A;  3JTO A;  1NHK L;  2GJI A;  3AOA A;  1IJF B;  4KGV B;  3W1Y C;  2Y1J A;  3PYG A;  1IR2 A;  3OL7 A;  4DUZ J;  3I5A A;  1KBR A;  2PMZ D;  1TKZ B;  1YGY A;  4YB5 A;  1FXL A;  2KVQ E;  4IH6 A;  4OV6 A;  3PYE A;  2A2D A;  3TZY A;  2WTF A;  1X7V A;  2W4D A;  3J7Y I;  1HR0 J;  3R5B A;  2LDY A;  2HHH F;  4DSK A;  2AYB A;  2XSJ A;  1LW0 A;  5I3U B;  4O0N A;  1CJU A;  2Q6B A;  3IAM 9;  3QT7 A;  3GYG A;  1NBE B;  4PAB A;  3DN9 A;  4JP8 A;  1IJE B;  4NXN F;  1R3N A;  2K7K A;  2YBV A;  1XNQ F;  3QPI A;  1U49 A;  1RK8 A;  2HFO A;  2BE9 B;  4WFX A;  4ES2 A;  2UXB F;  1N5V A;  3KLF A;  3UVJ A;  2DR6 A;  1DFD A;  1NM2 A;  2JNJ A;  2MGZ B;  2V94 A;  2N7C A;  3HKW A;  5FLX U;  2VOP A;  2C3P A;  4JI7 F;  4Y00 A;  4P10 A;  5IT4 A;  4DV2 F;  3E8O A;  3OQ2 A;  2OHD A;  2ZC4 A;  2IPO B;  2PT0 A;  1N5Y B;  2NXU A;  4J9K A;  4NL5 A;  4R8U B;  1FEH A;  1U1L A;  3MXH P;  3BR8 A;  2XMT A;  3HHL C;  3G96 A;  3MEC B;  3NL0 A;  2UUC F;  1JLQ A;  1XMO J;  3OUY B;  3ZZP A;  4UZC A;  3DI6 B;  3LPE A;  3N0V A;  2F9J A;  2K1R A;  3VHQ A;  2MXY A;  3UDE A;  2FJA B;  4LFC F;  3DMJ A;  4KO0 B;  3EZO A;  3J81 U;  1VC6 A;  1VHF A;  4NCG A;  2QEX S;  1RWO B;  1RHQ B;  1L3S A;  4Q0B A;  4K4W A;  3C16 A;  2BE2 A;  2KG0 A;  1ZBT A;  3EIC A;  3N5B A;  1S1U A;  4TYB A;  1S0O A;  4ZLN A;  3IWX A;  4CLT A;  3PNI A;  4HT5 A;  1R0A B;  2ZJR Q;  4X64 F;  5C24 B;  3KHG A;  3PJ9 A;  3NS7 B;  2QFJ A;  3KUG A;  3RB0 A;  1TL7 A;  4C97 A;  3QIP B;  4NLX A;  1WC3 A;  4QWA A;  2B7B B;  1A7G E;  3SIP B;  5A76 A;  2NSB A;  2RHS B;  2RE1 A;  2JFD A;  3HSJ A;  4F7V A;  3AD7 C;  4HH0 A;  3O8W A;  5KT3 A;  1FA0 A;  4JV5 J;  2GC8 A;  2CQC A;  1TL5 A;  1TVR A;  2R7Q A;  4O4R A;  1RB0 A;  4OIX A;  1QM9 A;  3X1L B;  2WOM A;  2M8D B;  2QL9 B;  3HZE A;  4WYL A;  1TQL A;  1V5V A;  1F1B B;  3QZ8 A;  2RT3 A;  1U0H B;  3R1L A;  4I6W A;  3KOA A;  4W90 B;  2W2P P;  1RXO B;  4QPT A;  3PDN A;  3DLL Q;  2W2M P;  5D0H A;  2MQP A;  4DR6 F;  2OKQ A;  5F8J A;  3R5A A;  3PXG a;  2EFN A;  3CC2 S;  5H9E K;  4XTT A;  3ITH A;  2XS7 A;  5SZT A;  4F2S A;  3L09 A;  2CJQ A;  2B56 A;  5FDL B;  4EO8 A;  4DX5 A;  5A2Q Y;  5B0C A;  5HP1 B;  4OI2 A;  2ZWO A;  2XCA A;  1EAY C;  2YWK A;  3QFH A;  3RW7 A;  2XG8 A;  4MFB B;  4DSE A;  2RIL A;  4LBI A;  1CEZ A;  4MTP A;  4ED4 A;  4X4R A;  2OPQ A;  5CH7 B;  3UWT A;  3PKY A;  1FKO B;  3FQL A;  1QAX A;  3L3C A;  2Y0S D;  4TKT A;  5T41 A;  3CD5 A;  3CCM S;  4CO2 A;  4DN0 A;  1KQS R;  3GZ7 A;  1S6U A;  4JB8 B;  1IWG A;  1EP4 A;  3Q23 A;  4DLE A;  5DO2 A;  4GC7 A;  3AA8 A;  1S1W A;  4IG0 B;  1LWF A;  1HI0 P;  4YHH F;  4L6V 3;  1RAC B;  4FNH A;  2A6M A;  1FNX H;  1WG5 A;  2CQH A;  5DLF A;  3VAK A;  1T8E A;  1V9O A;  1R6V A;  5KFO A;  1XR6 A;  4MYT A;  2HVD A;  1S59 A;  1UWA A;  4H4M B;  3JYT A;  4AUK A;  4NLG A;  4FZV A;  2AEM A;  4J90 A;  5IT9 U;  4KH1 B;  4OZ0 A;  3BBC A;  1D09 B;  2NPI A;  2FJE B;  4FYW B;  3K2Y A;  4TY8 A;  1UTA A;  2V4R A;  4Y2I A;  7AT1 B;  3D67 A;  4ZVS B;  4KRW A;  4IG3 A;  3DC2 A;  2Z2L A;  2Z0G A;  2MQQ A;  2ASY A;  4YFU A;  4PUO B;  2MJU A;  3SCK E;  1EET B;  1YZ6 A;  1RAI B;  1N54 B;  1R8P A;  2ASD A;  4UUX A;  4QYZ K;  4GC6 A;  1KVI A;  2E7X A;  2HQC A;  1T05 A;  3VZH A;  3ZTS A;  5ETS A;  4DS5 A;  5L46 A;  1FNM A;  3AY0 A;  1DBD A;  2NCK L;  4OYM A;  1VCT A;  1VBK A;  1F9F A;  4ZMM A;  1SKU B;  2H9Z A;  4C9D A;  1G4C A;  2K06 A;  4HI2 A;  2GS8 A;  2BZ2 A;  3HHE A;  1REV B;  1IBL J;  2RDJ A;  1ZZN A;  1LXN A;  1TAU A;  3QYY A;  3IM8 A;  3KG1 A;  1SKR A;  1ZPW X;  3ZZT A;  4X2B A;  6FD1 A;  5E3A A;  1SPB P;  3JAM U;  5AXL A;  1YJT A;  1Z2L A;  3UO0 A;  3BPD A;  3LF0 A;  2HBR B;  3BGO P;  4DUY J;  4J9Q A;  4X62 J;  3IMQ J;  4G1I A;  2X7I A;  2YX4 A;  1FKP B;  4FYX B;  5AE2 A;  3ZZZ A;  2IC3 A;  1NHU A;  3KLI B;  2HMI B;  5KFH A;  4JI3 J;  3DYA A;  1S0V A;  3ICL A;  1C0U B;  4CO0 A;  2A18 A;  4QPX A;  4JI2 J;  3I31 A;  2FDN A;  3ISN C;  3DOK B;  2WRM A;  2VQF J;  3D3B J;  2RS8 A;  1D8Z A;  2IVM A;  2EBE A;  2KHD A;  3PX0 A;  1KTV A;  3KNA A;  4CLK A;  3KHL A;  2KJV A;  3Q8P B;  5HQM A;  1S9E B;  3OV7 A;  4I6A A;  4C11 A;  4DV3 J;  1JNZ B;  2MHN A;  4LRD A;  5D0E A;  5HLF A;  3RBX A;  2KM8 C;  4CI0 B;  2J0Q D;  1F0X A;  2MKC A;  3ET6 A;  2VC1 A;  3VGS A;  5KFZ A;  2BQ3 A;  1BE4 A;  2QLB B;  2HAI A;  1HBM A;  4OMF G;  1CQM A;  2Y0B B;  4B02 A;  1YHQ S;  4L76 A;  3HK2 A;  2E5L J;  4LF4 F;  2QRR A;  4FN5 A;  3CCJ S;  3N6M A;  1NND A;  2ZH6 A;  1JLC A;  2YWE A;  5C42 A;  3GIJ A;  5RUB A;  2DNM A;  1B70 B;  2VPW B;  1S4E A;  1SKS A;  5J2P B;  2QO3 A;  3HHL A;  5IZH A;  3I56 S;  1H7X A;  4YEA A;  2ZNZ A;  4U8Y A;  3BR9 A;  4B3O B;  4LFB J;  1QAJ A;  1HW8 A;  1JXV A;  1U2R A;  5ETQ A;  3T1H J;  1FX2 A;  1X9W A;  3DOM B;  3PIO Q;  2FVC A;  3WC0 A;  2V4J A;  3MR6 A;  3DGP A;  3L7U A;  3D68 A;  5DDO C;  3BSA A;  4NEY A;  4DV1 F;  3UD3 P;  5ETL A;  2OML A;  5B0A A;  1FFG B;  2XGP A;  1WHY A;  4WXW A;  3HMJ G;  3DM2 B;  3AOC A;  3ENA A;  3OT9 A;  5BR8 J;  2OGU A;  3BDE A;  2M5Y A;  3H98 A;  2GJ2 A;  2ADC A;  2P9C A;  4QIV A;  2ASL A;  3AHP A;  2GNK A;  2JJ4 D;  3EE3 A;  3I55 S;  3R7S B;  4ZPB A;  2MQO A;  1NSP A;  4UZB A;  3I5C A;  5KG2 A;  4ITS A;  5IV3 A;  3BO2 A;  4LSN A;  4B9L A;  4QR0 A;  1E6Y B;  4L3N A;  5AJ3 F;  3A3O B;  4CO1 A;  1XIQ A;  2ZDO A;  1HNI A;  3GFH A;  1Y10 A;  1EAR A;  4CRJ A;  2V6A A;  2L48 A;  2GA7 A;  1M1H A;  4DR4 J;  1APS A;  4KYZ A;  4NYP A;  2CJA A;  1VRQ C;  3W2V A;  3VGV A;  3TX8 A;  2G0C A;  4DQI A;  1TKZ A;  4A8S A;  3ZTQ A;  3I0R B;  2AYE A;  1NUE A;  4PAA A;  3ULH A;  1QLN A;  4TLQ A;  4ZCK A;  4ZVT B;  2UXD F;  2BXJ A;  1WF1 A;  5I3Q A;  1Q79 A;  2CPI A;  2ZZT A;  3DKD A;  4J7C A;  3OFG A;  3BN4 A;  5CAB A;  1KC8 T;  3OLA A;  2P2C B;  2G0I A;  5I3U A;  3NMA A;  1PBU A;  1HQU B;  2DY1 A;  4LF9 F;  4WXO A;  4DV7 F;  2ZZN A;  4CLF A;  3MMA B;  7FD1 A;  2IRY A;  4ZCM A;  3DRX A;  5HQ8 A;  4DR5 J;  4DPU A;  4AT1 B;  1C4C A;  4A4J A;  4RUA A;  1P6T A;  2CJX B;  1NDC A;  2HNZ B;  3VCD A;  1MWZ A;  4Q5V A;  2K3K A;  2O67 A;  1NRK A;  2ZH7 A;  3A8E A;  4IR9 A;  3LUY A;  4F50 A;  2DNP A;  3CD7 A;  3W63 A;  2RU3 A;  1U45 A;  3KJV A;  1JLA A;  2DEJ A;  2FZC B;  4P7T A;  3IRX B;  5D15 A;  2BDP A;  5HBM B;  4B3T J;  4ZPC A;  4F3Q A;  1RBL A;  3KLE B;  3H4B A;  3HM9 A;  1N5Y A;  1KWM A;  4HT7 A;  3T6J A;  1ZH5 A;  2EG1 A;  1UEK A;  4YY3 J;  3J7A 1;  3CO0 P;  4Q2L A;  3MEC A;  2ROE A;  9ATC B;  4OX9 F;  2B9W A;  3OUY A;  1T95 A;  3DI6 A;  2YTC A;  1F2H A;  5LMU F;  4KO0 A;  3ENV A;  1IQZ A;  3VR1 A;  4DFM A;  4E2F B;  1U6B A;  1PBA A;  3FNN A;  1R6Y A;  4X84 A;  4F25 A;  3VWS A;  4DEZ A;  2CQD A;  1AZS B;  2IA0 A;  3NKY A;  2J9C A;  4JOU A;  1SC6 A;  5I4M A;  3TEH B;  2AJ1 A;  1VRT B;  4IRC A;  3GWC A;  2ZOG A;  3H7H B;  1NKE A;  1IBM J;  4JI0 J;  5C24 A;  5C25 B;  1IKW B;  4M8L A;  1RAE B;  2W25 A;  2X1B A;  3MUV P;  4ZVF A;  3HFV A;  2CXE A;  2ALY B;  1RWN B;  4EWT A;  1NO8 A;  3AOD A;  5K20 B;  4ZP8 A;  3WBZ A;  2AJ2 A;  4B9U A;  1TFY A;  1F3F A;  1C2P A;  1HMV A;  1KLM A;  5EN1 A;  1K1S A;  1SC1 B;  3G9C A;  1PAE X;  3NGR A;  3R8Y A;  4EBE A;  1RJJ A;  5F8L A;  3R7N B;  1XEZ A;  1N88 A;  2P6T A;  2F65 A;  4B9S A;  2PMW A;  2WAQ D;  4PWW A;  3OVS A;  2UZA A;  2XNQ A;  4ECU A;  2VZ9 A;  2K8G A;  3A4T A;  2DNR A;  5K14 A;  3ADA C;  3QJP A;  2MQM A;  3C6T A;  2P6S A;  3VAF A;  3K5O A;  4N56 A;  5L9N A;  4YR2 A;  3VVU A;  5KFP A;  2HBQ B;  2RML A;  5J2M B;  4DU8 A;  4TU8 A;  1MMN A;  3C2P A;  2ZKU A;  3AJ2 A;  4QZV B;  3H8Y A;  4EBC A;  4J9L A;  2GHV C;  4K5R A;  3OR2 A;  4AFF A;  3BDP A;  3HD1 A;  3OTD A;  4ZJL A;  3MR5 A;  3IGN A;  5FDL A;  3H5Y A;  2C3Y A;  1U48 A;  2HQG A;  4MKB A;  4WFB Q;  5J1P A;  1N33 F;  1U7L A;  4NAS A;  2GO8 A;  4MFB A;  3LP0 B;  1U1O A;  4O3R A;  3NWG A;  4NXM F;  4BHQ A;  4U6P A;  3EGW B;  2RS2 A;  2V5H G;  4M5M A;  3LGM A;  3E3X A;  1S4F A;  4GVB B;  2R7U A;  2LQ9 A;  2C22 A;  2CQG A;  2P9E A;  1Z2Z A;  3PY8 A;  1SL1 A;  4IG0 A;  4X4V A;  2H54 B;  3JS9 A;  1X5S A;  4ZPA A;  5B0D A;  1FRM A;  1IM4 A;  1NJX A;  2FLL A;  5M2R A;  3D9B A;  2OPR B;  1HBN A;  1RT5 B;  2E1A A;  3OBI A;  1CQN A;  4J9P A;  3SXL A;  4GKJ J;  4IRD A;  4H4M A;  1IQT A;  3EPG A;  2F40 A;  5ETR A;  3DU5 A;  3QGG A;  4DV4 F;  3MMJ A;  4A8M P;  5D8H B;  2C3U A;  5HJX A;  3T9N A;  2ZH5 A;  4R5P A;  5H9F J;  1HWK A;  2CAJ A;  2R7O A;  2GVZ B;  1KD1 T;  4F04 B;  1FWL A;  3EMT A;  5T7L B;  5ETN A;  2XMV A;  3SMZ A;  2C42 A;  2CAD A;  3N5F A;  3VZI A;  1RBO B;  3A8K A;  3G86 A;  4PUO A;  2Y1R I;  1S99 A;  1UFK A;  4DL0 C;  4J37 A;  4FF3 A;  2FLN A;  3U27 A;  2EK6 A;  4QWB A;  3Q2T C;  2C2R A;  1H2U X;  1IBC B;  1WOP A;  3T1Y J;  4CH1 A;  1VIX A;  4LVN P;  1TUV A;  4ECX A;  2NS1 B;  1X60 A;  4EZ6 A;  2ZD1 A;  2YVS A;  4LF7 J;  3CW2 C;  1VIS A;  1X5O A;  1YRX A;  2IA6 A;  3PZP A;  2NXJ A;  1NZ8 A;  2KZM A;  1REV A;  1RT4 A;  5AT1 B;  1WI6 A;  3PAC A;  4FXV A;  2FVP A;  5LSL A;  1AFI A;  3M9O B;  1CSJ A;  4CH7 A;  2ASJ A;  1TAQ A;  2JLF A;  1VQK S;  3RU0 A;  3SSQ A;  1XR5 A;  4RBT A;  1VQP S;  1FKP A;  4QOT A;  4ZVO B;  3TA0 A;  3GIL A;  5DG7 A;  2KI2 A;  3MM7 A;  4Z7Y A;  5DGA A;  3KLI A;  2HMI A;  1WF0 A;  3B4D A;  1I6J A;  2R2S A;  2QMW A;  4OV1 A;  2UUA F;  1GTE A;  3KLH B;  4MIW A;  2CVE A;  3F0N A;  1QE1 B;  3DOK A;  3M6V A;  3M9N B;  4JV0 A;  3K58 A;  3H5S A;  4DV0 F;  1Q8K A;  2VF3 A;  3RB4 A;  2FC8 A;  4PG7 A;  3DU6 A;  5KG0 A;  4C8O A;  2G2Y A;  1FRJ A;  4XO0 A;  1MWQ A;  4DMZ A;  1NK8 A;  4C4W A;  1Y3J A;  3GQC A;  1MU2 B;  1JB0 C;  4ED3 A;  1AUD A;  3KMQ A;  1QSL A;  2CJK A;  1BWV A;  2HGN A;  3SQG A;  1MW7 A;  2BJ1 A;  3JXO A;  3Q22 A;  2ADB A;  4OZ2 A;  3CDU A;  4DG1 B;  2VV5 A;  3H2L A;  3ZZ0 A;  5DZ7 A;  5L1J A;  4PG6 A;  1V3Z A;  3CJK B;  3TZX A;  4DR3 F;  1RAF B;  2XZW A;  1CJK B;  2DR7 A;  4QU6 A;  1S9G B;  3W5Z A;  3MCM A;  2HWH A;  2X51 A;  4V19 X;  2HFN A;  3ZTR A;  1U26 A;  2HHH J;  1FE4 A;  1ZA2 B;  2GX8 A;  3SBM A;  2DIT A;  3K17 A;  2LP4 A;  4ZN1 A;  2JEI A;  5J2P A;  1P27 B;  3TJA A;  4ZPV R;  1VQ7 S;  2KYX A;  4U67 Q;  2DGU A;  4AND A;  2WHO A;  1NME B;  1NSQ A;  5HN0 A;  4WPA A;  4NXN J;  2F63 A;  1MWY A;  3W5Y A;  1MMD A;  3FCH A;  4Y2K A;  3T9Z A;  1M5H A;  1SB6 A;  1XNQ J;  1SJQ A;  2G4B A;  1RWM B;  1DZ5 A;  3TQE A;  2XZD B;  2UXB J;  2E1P A;  3O5T B;  3FEZ A;  2QGF B;  3IA0 A;  3DOM A;  4L3K A;  4QWE A;  3CCZ A;  4FF1 A;  1BWE A;  1FTC A;  1HFE L;  3FJ2 A;  3PW0 A;  2HVI A;  1RT3 B;  4XIU A;  3A3P B;  4DPW A;  4JI7 J;  3RBD A;  3DM2 A;  3OXG A;  2HS3 A;  4DV2 J;  3CCU S;  1G2E A;  2V8D A;  1Q81 T;  4IFY B;  1EIY B;  4RNH A;  4HHH A;  4IOC Q;  3PM9 A;  2P8I A;  4CLY A;  3MM5 B;  1DQ9 A;  3UW1 A;  4DS4 A;  3TWZ A;  2OAU A;  5KT5 A;  3Q8R B;  4QIG A;  2VFS A;  3NY0 A;  2UUC J;  3CME S;  5M2U A;  4OX6 A;  2I5J A;  3M9M B;  2AT1 B;  2GMH A;  2V68 A;  1A0O B;  4KE5 A;  1Y9O A;  5DLG A;  2FLP A;  2FD2 A;  5KFM A;  4LFC J;  5A6P A;  1K8A T;  1Q8B A;  3BZQ A;  2WVF A;  4JI8 F;  1WC4 A;  1B0V A;  3VAG A;  3H2U B;  3KJQ B;  1E6Y A;  3G4S S;  4DPY A;  1VOM A;  3WZ0 A;  3SCJ E;  3G6Y A;  5D78 A;  2MZS A;  4AL5 A;  1KSP A;  3RR8 A;  4X64 J;  3M1V B;  3ENW A;  1YK9 A;  4D3G A;  4ZJQ A;  3SCL E;  2B3T B;  3D6M B;  1XK8 A;  2D7S A;  4ELT A;  3LPY A;  1NPP A;  2BVZ A;  2M3D A;  3P6Y C;  3CE8 A;  5HSP A;  1F9H A;  2C28 A;  3H59 A;  2YKA A;  2HG4 A;  2XI2 A;  2CA9 A;  3BBF A;  3QRR A;  2YKQ A;  3THV A;  3M7V A;  2L9D A;  4WTY A;  2WSC C;  3QGH A;  1HQU A;  5SUH A;  2VON A;  2ERR A;  3ZZO A;  3HVT A;  4W92 B;  3BPS P;  1SKW A;  1EB0 A;  2J0X A;  1I1G A;  2IYG A;  4IH5 A;  3F41 A;  4BWJ A;  2N3L A;  4KHP F;  1IVZ A;  1IM6 A;  1S5Z A;  5CD4 A;  2HNZ A;  3FGV A;  2QN6 B;  2LQ8 A;  2B9E A;  1BUX A;  4DR6 J;  2HHT A;  3TAN A;  4CM2 A;  2POK A;  2AKW B;  4KC5 A;  3UCU P;  2ZH9 A;  3GYX B;  1FO1 A;  3IRX A;  4M94 A;  3QFW A;  4OZN A;  2XO6 A;  1LV5 A;  2O66 A;  2E5G A;  1RHJ B;  4KB7 A;  4ILR A;  3P49 B;  4M5I A;  1GMW D;  2A3J A;  1TEL A;  5CYJ A;  3C8Y A;  5C2C A;  3B6B A;  4PKD B;  1QTM A;  1RYS A;  3MED B;  3W66 A;  4P52 A;  3FSI A;  2QT7 A;  4F36 A;  4FS1 A;  2AW0 A;  2VD3 A;  1AUS L;  4ED7 A;  3GTY X;  4KQZ A;  3KK1 A;  2XHW A;  5B08 A;  2B0G A;  1S10 A;  4ZPW R;  1GMV A;  2CIM A;  4Q8F A;  4I4B A;  2EC2 A;  2KXH A;  3CJ5 A;  4YHH J;  2WW4 A;  4OJ3 A;  3NNC A;  1FES A;  1KTQ A;  1R8H A;  1U8S A;  2J6T A;  2QYG A;  1QDU B;  3DRR B;  3RB3 A;  1VRT A;  1PYS B;  1VQL S;  4RBV A;  4LIW A;  1OMS A;  2HBZ B;  4DV5 F;  3N4W A;  4KV8 A;  4ID5 B;  1IKW A;  1Q86 T;  3MI7 X;  1VC5 A;  1R8C A;  4ZP7 A;  3HD2 A;  4K4X A;  1FRL A;  4NRU A;  4CYU A;  1JKH A;  1SI9 A;  1KLN A;  2LXI A;  1MN7 A;  1M1K T;  3ZO7 A;  3DRP A;  1VIO A;  3QWU A;  2BW2 A;  3AB2 B;  3MM6 A;  1RAD B;  1TFW A;  2KFY A;  1RZM A;  2KH9 A;  2H51 B;  2VJU A;  4WF9 Q;  2PI5 A;  3Q8U A;  2CPD A;  2D3Z A;  3KXD A;  1U25 A;  3G82 B;  1TL1 B;  2AGQ A;  3R5G A;  1K47 A;  4AQY F;  1FRX A;  1JLB B;  2D3U A;  3KJN B;  4FXD A;  4DSL A;  5KFC A;  2QLW A;  1AB8 A;  4RUB A;  1VBY A;  2NYH A;  2R8J A;  2QL5 B;  5F0U A;  1R0B G;  2HIQ A;  3QAE A;  2VKR A;  3H42 A;  3GFX A;  2OTJ S;  3RGI A;  5B0E A;  4DX7 A;  2BMB A;  2B4U A;  2RKI A;  4C3M A;  1N34 F;  1TV6 B;  1X9S A;  1D9D A;  1N6Q B;  3EXY A;  3OL6 A;  2HW3 A;  1KQK A;  3W9H A;  3OHA A;  2QLX A;  1T94 A;  2BJ8 A;  1PO6 A;  2ZH3 A;  4DU7 A;  2VG6 B;  5L38 A;  3MZI A;  3R6G B;  2XWY A;  4O3N A;  2N3O A;  5F8G A;  1FK9 B;  2XMK A;  2EEY A;  4OYP A;  4FYD A;  3PHT A;  3J81 j;  3H5U A;  4GVB A;  3GV8 B;  2B8P A;  4RNN A;  1NDK A;  1XTZ A;  2QMX A;  2VG5 A;  2WSE C;  3PX6 A;  2WVB A;  2DGT A;  1WSR A;  2JC1 A;  4R0J A;  2HYI B;  3GU0 A;  4Q44 A;  4C0O C;  4DCJ B;  3N6L A;  4K0K F;  3BGF A;  2E44 A;  4URQ U;  1PKU A;  1B99 A;  1BQM A;  4EK2 A;  3A3N B;  3TA1 A;  3A8J A;  4X4N A;  2ZUG A;  2BKN A;  3NS6 A;  3MHY A;  2EG2 A;  1FFW B;  5HK4 A;  5EHH A;  2YNI A;  2HRY A;  1KKH A;  2KU7 A;  4K4Z A;  4C8M A;  1NK4 A;  1FKA F;  1XBW A;  2ZHO A;  1K0V A;  1CJU B;  1N5S A;  4OHZ A;  4DL6 A;  4ZVR B;  3BKF A;  1YIJ S;  2FTR A;  3CC7 S;  1NK7 A;  4I2P A;  2F8E X;  4J9S A;  1PCA A;  4URS A;  4A8X A;  2BV3 A;  1RAH B;  2DHH A;  4PXB A;  3KLF B;  3UVJ B;  3SSR A;  1TZ0 A;  2OFH X;  2MQL A;  1U47 A;  2QLJ B;  5HL7 Q;  4LF4 J;  2XM3 A;  4K4S A;  3NLC A;  5DGB A;  4CDI A;  2Z4P A;  1HWI A;  2F4V F;  4ZP6 A;  1NZA A;  2B9X A;  1EQM A;  3SEO A;  3O3L A;  1N8R T;  1IKV A;  1UW4 A;  2XWX A;  4TYA A;  1UJ4 A;  5K9F A;  5EX0 A;  3CVK A;  5F3Z A;  2KXN B;  2HNY A;  1RHK B;  1GXU A;  2K1R B;  1NU4 A;  1JWW A;  4OZ5 A;  1RTJ B;  2IMO A;  3DMJ B;  5CCM A;  2FJX A;  5IXU A;  3Q0A A;  2KVI A;  2HHV A;  3MCO A;  3CED A;  2DK2 A;  3C16 B;  4DV1 J;  3GFZ A;  2J7K A;  3N6N A;  1S1U B;  2FY8 A;  4RBU A;  1RWU A;  1HWJ A;  1UWB A;  4KBI A;  1FVQ A;  3KLH A;  2HFV A;  2IBO A;  4P73 A;  5JMN A;  2XYP B;  2ZH8 A;  1JXE A;  4TQR A;  1TL7 B;  2R2U A;  1QE1 A;  2RUS A;  5L8R C;  2XMW A;  3BGL A;  1KP6 A;  3W61 A;  3UCZ P;  3UFC X;  3OJU A;  3B78 A;  2VFT A;  3IS9 A;  4ZVP B;  3A12 A;  1D9A A;  2AD9 A;  4F3M A;  2EC0 A;  3RAM A;  3Q83 A;  1Q1K A;  2PN6 A;  2H65 B;  1SQF A;  3KMS A;  3MPY A;  1UFW A;  1MRO B;  5AJ3 J;  1WJ9 A;  3UNY A;  1TVR B;  4X66 F;  2KHC A;  1IKX B;  2ZH1 A;  4USH A;  2WCX A;  1CUL A;  4V1A k;  4ED8 A;  2O1P A;  3TA2 A;  3Q8Q B;  3Q24 A;  4DG1 A;  4C8L A;  3RAX A;  1Q7Y T;  4IKA A;  3ZZY A;  4L73 A;  4DZ6 A;  3M2U B;  2SXL A;  2HVH A;  5LSR A;  3MWB A;  5K8P A;  1LFP A;  3FBF A;  3FUY A;  5A8W A;  1CJT A;  3ITH B;  1WD6 A;  4Q43 A;  1CJK A;  2ZJQ Q;  4ZPD A;  4CLL A;  2FVS A;  3QZ7 A;  4J91 A;  3L7P A;  1S9G A;  1W7W A;  3R5D A;  4EU0 A;  4KJI A;  4YB6 A;  4K8R A;  2MYF A;  2C2N A;  1H2T Z;  7FDR A;  4M5L A;  1OSC A;  2VH7 A;  2PSZ A;  3EPI A;  5D6G A;  1VLO A;  4LF9 J;  3FSY A;  5DRK A;  4DV7 J;  2DNY A;  2OPQ B;  3TNV A;  3KLG A; 
#chains in the Genus database with same CATH homology
 3DKD A;  3Q83 A;  1NLK L;  1PKU A;  1B99 A;  3Q89 A;  4DI6 A;  4EK2 A;  4UOH A;  5CAB A;  1BE4 A;  4KPC A;  4ANE A;  1S5Z A;  3EVW A;  3NGS A;  1NPK A;  4W98 A;  3Q86 A;  1KDN A;  3BH6 B;  2CWK A;  3FCW A;  2DXE A;  3FCV A;  1HHQ A;  1WKL A;  1BUX A;  3EM1 A;  3VVU A;  2VU5 A;  1UCN A;  4AND A;  4C6A A;  1B4S A;  3EE3 A;  2BEF A;  1NSQ A;  1S57 A;  1NB2 A;  1MN9 A;  1NSK L;  3FBC A;  3B54 A;  1NSP A;  3FKB A;  2AZ3 A;  4HR2 A;  3VGU A;  3PRV A;  3FC9 A;  1WKJ A;  3ZTS A;  1NDP A;  3ZTP A;  3EVM A;  4UOF A;  1NDC A;  4CP5 A;  3GPA A;  4O0N A;  3FBB A;  1NCL A;  1HIY A;  2NCK L;  3R9L A;  3VGT A;  1MN7 A;  4DZ6 A;  1VYA A;  3VGS A;  3ZTO A;  1XIQ A;  3ELH A;  3GP9 A;  2DXD A;  4UOG A;  2HVD A;  5BXI A;  3VVT A;  1S59 A;  1XQI A;  4S0M A;  4ANC A;  3EJM A;  3EIC A;  1JXV A;  3FBF A;  1U8W A;  1NDL A;  2BX6 A;  4WBF A;  3DDI A;  3NGT A;  3BH7 B;  5IOL A;  3WX8 A;  2ZUA A;  3B6B A;  4DUT A;  3EMT A;  2B8P A;  2B8Q A;  2DY9 A;  5C7P A;  1LWX A;  2HVE A;  3FBE A;  1LEO A;  1W7W A;  3BBC A;  3Q8U A;  1NDK A;  1F3F A;  1EHW A;  2AZ1 A;  2DXF A;  3EVO A;  4FKY A;  1F6T A;  3BBF A;  3L7U A;  3VGV A;  3Q8V A;  3BBB A;  1PAE X;  3PJ9 A;  3NGR A;  4ENO A;  1ZS6 A;  4F36 A;  3G2X A;  2HUR A;  3NGU A;  2DYA A;  1WKK A;  4F4A A;  1BHN A;  3ETM A;  1NHK L;  3ZTQ A;  4FKX A;  3Q8Y A;  1NUE A;  3ENA A;  3MPD A;  5CAA A;  3ZTR A;  1HLW A;  1K44 A;  3JS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...