1LEOA

P100s nucleoside diphosphate kinase
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNSLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Nucleoside diphosphate kinase. Investigation of the intersubunit contacts by site-directed mutagenesis and crystallography.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
total genus 45
structure length 150
sequence length 150
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 1996-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1leoA00
1BHNA 2HVEA 3EM1A 2ZUAA 1LWXA 5BXIA 3B54A 4C6AA 1PAEX 3FBFA 3DDIA 4W98A 4ANCA 3FBBA 1B4SA 3ETMA 3NGSA 3DKDA 4KPCA 3NGUA 4F4AA 4UOFA 2BEFA 2DXFA 2AZ1A 1BE4A 2HVDA 3EJMA 3Q86A 3VGTA 5CABA 4DI6A 3BH7B 3Q8YA 3WX8A 1S5ZA 1XQIA 1VYAA 2DYAA 4EK2A 1F3FA 3Q8UA 3BBBA 1F6TA 1MN7A 3PJ9A 3BH6B 5C7PA 3ZTOA 3FBCA 3Q89A 4O0NA 3VVUA 3FBEA 3Q83A 4F36A 1NDCA 5CAAA 4ANDA 3NGRA 1NSKL 3EE3A 1HHQA 3VGVA 3FCWA 4ENOA 3VGUA 3MPDA 3EVOA 1HLWA 4DUTA 1XIQA 3BBFA 3R9LA 1NHKL 3Q8VA 1BUXA 4CP5A 3GP9A 3PRVA 2NCKL 4S0MA 2HURA 1EHWA 4FKXA 4UOHA 1S59A 3VVTA 3ZTPA 3EICA 1S57A 2B8PA 3FCVA 4ANEA 1NSQA 1NDLA 1JXVA 3GPAA 2VU5A 1NDKA 3ENAA 1PKUA 1HIYA 2AZ3A 3JS9A 1NUEA 4HR2A 1K44A 1UCNA 3L7UA 3G2XA 1NLKL 3EVMA 3ZTSA 1WKLA 4DZ6A 1U8WA 1B99A 4FKYA 2DY9A 1LEOA 5IOLA 3FKBA 3ZTRA 3VGSA 1NB2A 1ZS6A 3ELHA 2BX6A 3EVWA 2B8QA 1WKJA 1NPKA 3NGTA 3ZTQA 2DXDA 3B6BA 2CWKA 1NSPA 3FC9A 4WBFA 3EMTA 1KDNA 1NDPA 1WKKA 4UOGA 2DXEA 3BBCA 1W7WA 1MN9A 1NCLA
chains in the Genus database with same CATH superfamily
3KUEA 2HVZA 1RT3A 3EPGA 1YLXA 4KY3A 4B9MA 1VK3A 4J9LA 1VBZA 3M2VA 3W63A 4LF5F 2J0SD 1QLNA 2ZH6A 2VV5A 1UA0A 3VGTA 4HVZA 1W2BR 3AH6A 4P7TA 2CWXA 1YI2S 7FDRA 2NZ4A 4ICLB 3VWSA 4PYAA 1XMQJ 2OP5A 1HNIB 5CD4A 4NYZA 1WTFA 3QJPA 3EX7B 3OLAA 1HBUA 2RAQA 1NHKL 2APOA 4L3KA 3PM9A 2WONA 2WOMB 3LQVA 1JLQB 1F0XA 5LJ5Y 1HWIA 4OHZA 2AJ2A 3DOLB 1VRUB 3TAMB 1G3OA 2R7QA 2DPIA 1HYSB 1X4GA 4BWJA 4O4RA 1XR6A 2QMUB 2VQEF 3T1YF 4Q0BB 1RWPB 3NGTA 5B0EA 2WVEA 3MGJA 3M8WA 3AA9A 1QAIA 2W01A 1JLEB 1WWHA 2Q1LA 3SSQA 4N56A 3V81B 1RBAA 4OYZA 2WCXA 4IDKB 2A1BA 1R0AB 2QLFB 4Q45A 3KK1A 3OL7A 3RG6A 3CPWR 2CPZA 3KLFA 2KRRA 3ZXWA 4MIWA 4G6VB 3HHNB 1MSWD 2YKNA 4QCLA 4WE1A 1N33J 1VRTB 3RRGA 5ETNA 2ZHBA 1H38A 2ZZTA 1RTIB 1LW0B 1A9NB 4M95A 3KLEB 5GAEU 4I2PA 4PUOA 3ZZTA 5HL7Q 4KRWA 5GMKa 3E3XA 3GG1A 5K8MA 4RPFA 2VBWA 3CVKA 3OL6A 3B78A 2F7VA 3DFEA 4X4QA 2ZH2A 2RDDA 2KL8A 4FVMA 1FRLA 3K5NA 2GW8A 1IN0A 2QLXA 2FJEB 3GR0A 4ZVEA 4JI8J 2IAJB 3IAM9 3HX9A 2QZ8A 1FDAA 2FY8A 5KG4A 1R8BA 3KOAA 2CAJA 4X62F 3KMQA 3W3SA 1TL5A 3MFHA 3CE8A 4N76A 5DQIA 2J9EA 5J2NB 1FDNA 4QR0A 1VQKS 4Q2LA 1S1UA 5K8OA 1VQ4S 1RT5B 1FO1A 1JLFA 2GO8A 3RB0A 4F4WA 2DH9A 3RAXA 4V1Ak 2C2DA 4HT7A 3RTVA 5KT3A 1GXTA 2MB0B 4ZP9A 5DZ7A 3FSIA 1VCTA 4EBDA 3NNCA 2ILYA 1T9TA 3C14B 1SJ3P 2HHTA 2CPEA 4YB6A 1S59A 2BXJA 2GQQA 2IMWP 4IFVB 1Q8KA 2DGTA 2ZWOA 2VU5A 2Y8WA 3C6TA 4OZ1A 2XLJA 1KQFB 1VIXA 5KOWA 2CG4A 5DDQC 5IC4B 2C2OB 1UFWA 2K06A 3W8GA 3QGIA 2Q6BA 3QWUA 2MY8A 4C0BA 2FJDB 3FDSA 1SQGA 2ROGA 3P5BP 1MROB 3EDQB 3OHBA 1QVFR 5CZXA 2EK1A 4ILLA 1B4SA 5C2GA 2A6OA 3HVAA 2W7AA 1KRPA 5LMNF 4M8LA 2PMWA 2VFRA 3HKWA 3ZNJ1 4YB1P 1HPZA 3PX0A 4OMFG 2A2CA 4DV5J 2X51A 3MR5A 1IUJA 4L73A 2VBYA 1WF2A 1JLQA 3Q8UA 4ZPBA 3QSIA 4Y2KA 3J7Z5 7AT1B 4JV5F 4PABA 1P6TA 1UEVA 1DARA 3FBEA 3CJ3A 4Q2MA 4ELUA 4CRJA 1GQEA 5B0AA 3QIPB 1RT1A 2V4QA 4CQ1A 4NOHA 2ZJQQ 4FF1A 3I0SA 1S1VA 2IPOB 3PJXA 4I2QA 2XS7A 1TFYA 4EZ6A 2CJQA 2QG9B 3C6UB 5C24A 2K7JA 1DFDA 3QIDA 4USJC 1D8ZA 1S48A 1H6KX 3DLKB 1IBLF 2J7KA 2UUCF 4G3IA 3NBPA 3EVWA 2HW3A 2EFPA 4OV6A 1KP6A 4NCBA 4DF8A 1B0VA 5F9NA 2YQ3A 5KG5A 2GQ2A 1HL6A 3IM9A 2LFVA 1S1WB 3O6QA 5I42B 3AHPA 3U7JA 1X4CA 4CLUA 2RVJA 2MKSA 4ELVA 3TANA 2BQ3A 2IAJA 1UFKA 5FLXU 1R31A 4ANDA 2CPFA 3FRZA 3LA0A 3G6VA 1ZA2B 3DM2B 3HDSA 4L75A 5GADI 3HHLC 4M5NA 1DURA 1SC4B 3BQ1A 2YKPA 2EWHA 1X5SA 3NGDA 3N79A 5D77A 1RT4A 3H2LA 2DHHA 1X60A 3MECB 1VHIA 3AJDA 4FF3A 2P9EA 3WHIA 3NCPA 5AXNA 1JX4A 2Z0GA 2RE1A 3RB6A 1S97A 4DSEA 4ETZA 2NXCA 2MHEA 4NL5A 4PG5A 2XYGB 3T9ZA 1RAEB 1NK5A 4OQJA 3DYAB 4WZMA 5IM0B 4DV6J 3AD8C 4KPCA 2W9CA 5DO2A 3IFEA 3ITHB 5EN1A 1WOSA 4PXCA 1F5CA 1T95A 1RAFB 2YWHA 2HYIB 3A8EA 4MIBA 5D4PA 1C4AA 1ULRA 4G1QA 5GVQA 2G1HA 3H42A 4O3RA 5KFUA 5DLFA 3F73A 2R4FA 4G1IA 5E33A 1YRTA 3QPIA 1OY9A 2J8SA 4DV3F 4ENOA 2MJUA 1O0PA 4FN5A 5J2QA 4OYPA 3DLEB 3HHLB 5ETPA 3CCQS 1DTTB 1X5PA 2WAQD 1NDLA 3KLIA 2L9NA 1OS5A 5BYQA 5GAHI 3B4DA 4F4ZA 1FXLA 2QL9B 4A8MP 3M1VB 3D6TB 2RMLA 4UY8T 2B0GA 4OI6A 2HWTA 2OPSB 4TNOA 2NR0A 3BGFA 2COLA 2O67A 1G4CA 1O51A 1BQXA 1AFIA 2J6TA 4F0KA 5KFYA 1KTVA 4HHJA 2ZE2A 5LM7E 3IR7B 1WG1A 3BS9A 1YZ6A 1FXDA 2CQBA 4DR4F 4JOUA 2N3LA 1HBOB 1RLCL 4WTYA 1T9VA 3HMJG 4YHHF 2C3PA 4WIIA 2CJXB 3SCJE 4MK7A 2WW4A 2YNHA 1RHJB 1RB0A 2E5IA 4OI3A 3BO3A 3T6BA 1CG2A 1OY6A 2V8DA 3V6DA 4NLPA 3MTKA 4KBIA 2I8EA 3A3NB 1NZ8A 4PQUB 5HN0A 1ZPWX 5HK4A 1N56A 4QBUA 2NUHA 3H59A 3G86A 1WHXA 1AT1B 3QO9A 4HACA 1UVKA 2G1DA 4UUWA 5K8NA 4O44A 1I94J 2DXDA 4I6YA 2WB1D 4I69A 5K14A 1E6VA 4ID8A 5EWFA 2HBYB 1CJTA 1JXLA 1MW7A 1C0UB 4DCOB 2FJBB 2B56A 1C0TB 1S6PB 1UKUA 5GAGI 4NMXA 4IFYB 3UE2A 4JI6J 4AD6A 4ZPAA 3P8BB 1SVDA 4TYAA 4RUHA 4RBVA 2OEKA 3CW2C 4A8XA 3C46A 2J6UA 4ZVOB 1Q5VA 4C8YA 1LWEB 1FK9B 3DNCA 5E3CA 4DSKA 3QMQA 3QRQA 2NLWA 3TQEA 3AOAA 5M2UA 2IM2A 2G2YA 2F3JA 3MEDB 2AEFA 2AJFE 1LKZA 1PG5B 2H65B 2WBMA 2Z2LA 4B3OB 5C25A 2AYBA 4X64J 4TLRA 5HVGA 1FFWB 3AOCA 2VPZB 5AE3A 4A8WA 3KUGA 3ENVA 1W7WA 2DKOB 4YR0A 1M5VC 2R2UA 1IKXB 4CYUA 3FBFA 2LXFA 3M2RB 4EMDA 4OYAA 3UW1A 4QIFA 4CLWA 1IWGA 1FWPA 4F0HA 1TL1B 2ZBCA 1BC6A 2DEIA 1XNQF 1YJRA 2ZOGA 3SYZA 2ZH9A 3OR2B 4KPYA 2BZ2A 1MN7A 1KQGB 2XZTB 2QRRA 3EGNA 4HI1A 5DM7Q 1QDUB 3BGRB 2DBBA 5AXLA 4JI0J 3ISNC 4F4YA 3GWCA 5H9FJ 3EZ5A 4WP3A 4B3TF 1UW4A 2M8HA 3TZZA 4DR5J 5HMWA 2WVBA 3ZTPA 3C66A 2C3UA 5BYSA 3NAHA 1UVLA 3THTA 2IRYA 4WP8A 2FLPA 3TUPA 5KFMA 1RUSA 5A8RA 3DRRB 4A4JA 4IH7A 2QL5B 4GRSA 3M9OB 1KC8T 1LQ9A 4KH0B 4PXEA 1V3RA 1S1XB 1U47A 2E9RX 2XCAA 3BKUA 1SJ1A 2EC0A 4WKRA 3T41A 3L7PA 2B4OA 3EJMA 1W25A 4NCAA 4DX8H 2D3ZA 3KNGA 1OYEA 4EO8A 3IN5A 5K20B 1ZM3A 2E44A 3I6PA 4YS2A 1EP4A 1QTNB 3LP1B 3KLHB 3OW2R 4DSJA 4M5IA 5LSRA 3OJUA 3SDEA 2XGPA 1XJWB 2V67A 5HLFA 1NPPA 4F50A 1U02A 2GAHC 2D9PA 2XSJB 2YNFB 4TYBA 2H4YB 1PCAA 2OELA 3GE9A 3G87A 4DMZA 4Y2AA 2E1MC 3I31A 2DNMA 4PG6A 2HFNA 2FVRA 3OT9A 1JMTA 1S6PA 1VLOA 3UFCX 5IV4A 3ISZA 2BYCA 1TKZA 3H5YA 2XEXA 5AXMA 2HQCA 4WK3A 1RA6A 4NMLA 2RRBA 1PC4A 3DHWC 2CNOB 1V9OA 4Y65A 1QE1A 1N54B 1FWKA 4CO1A 1YGYA 1IVZA 5KFFA 5CCMA 2OHDA 1X8DA 5E3AA 3CJTA 4RW9A 5CABA 3QZ8A 2HFOA 3WX8A 4JI1F 2LXIA 2I2YA 4IO9Q 1F6TA 1P9YA 3WZ0A 1HBMA 4LF9F 1FRXA 2ZHAA 4URQU 3MM9A 1HI1A 4H4MB 2WW8A 1K73T 4J7CA 4ZJQA 4NEZA 3BSNA 2RQ4A 3PDNA 2HIQA 2VDHA 4DLGA 2R8HA 4GKKF 5HSPA 4DR1F 2HFSA 2O1PA 4ATNA 1LK5A 3DLGB 3PYEA 3MOZA 4AUKA 5LMUF 4URSA 2CQPA 1SBRA 4IOBA 3CWJA 1ROFA 3EGVA 1DLOA 1BQMB 1SKUB 2MHNA 1HQEB 2WVCA 4B17A 1GX5A 4DR3F 5KTQA 2W25A 5BJRA 1VQ6S 2VPYB 4FF4A 1U09A 1IR0A 1UJ4A 1AA1B 1M90T 3BJYA 2OEJA 4LJMA 2P8IA 2VKZG 1S7HA 1CC7A 2PMHA 3ETMA 3LP0B 3T1YJ 3H2UB 4I56A 4LRDA 2ABYA 3NOGA 3LP2B 4N77A 1SCJB 3FQKA 2PFFB 1UMJA 2RH3A 4HDHA 3DRRA 2IMOA 1X7VA 1N52B 5HMXA 4KHPF 3GIRA 4OI0A 1FNOA 2AJQA 4ZVSB 1U4BA 2EFVA 1FXRA 3O8WA 4LFAF 1NSQA 2GVDB 5AJ3J 1BWEA 2R7VA 3IWNC 1VISA 3PW5A 4WZQA 2MQPA 2NUUG 4DX7A 2M88A 4ZKAA 1FKPA 2B9EA 3BR9A 3ELHA 4ILMA 4RUCA 3NEKA 1Q86T 2C42A 3UD3P 3KLHA 1FEEA 4DSLA 4XIUA 4ZIVA 2OPQB 1DTQA 4EZ9A 4Y00A 4LFCF 2B9WA 4GVBB 1C1BA 1I51B 2UUBF 3FSYA 1VFJA 1JJ4A 5J1NA 2W8LA 5B7WA 2YNGB 3IRXB 2FJWA 3K59A 4CZCA 3LAKA 4X4RA 1O8BA 3G6YA 3JB9k 2YPYA 2ZH3A 2HGLA 2DIVA 1UA1A 4JI4F 1RE1B 1RWWB 4F26A 3M6VA 2NZCA 1KHWA 3M8QA 3ET6B 5CQGA 2MKHA 1ZM9A 2FZCB 3M32A 4XTTA 3R5BA 1KONA 3BM7A 3LPEA 3H25A 1EETB 2QIFA 2Z4PA 4IOAQ 1UVNA 3A12A 1GT8A 3SV3A 3CSKA 3PO5A 4IYQA 3O44A 1NKBA 2VKRA 1Q16B 4NXNF 2H5IB 1ZAXA 1PSDA 2FHOB 2GJ2A 3A13A 3EMTA 2QA4S 2CQ0A 3Q23A 2IFXA 1S9EA 2CPYA 3OFHA 4JUZA 1R27B 1GH8A 1T02A 2NXUA 3EDRB 4DU7A 3PV8A 4OZJA 3PW2A 2CNNB 3GFXA 4U9RA 5KOXA 4ES2A 1LW2A 2RJZA 4UT4A 1PAUB 4KO0B 4JI5F 1X5TA 4X2BA 2M3DA 3AT1B 3LAMA 3PX4A 1RK8A 3SV4A 1N5SA 4HT5A 3NGRA 4IG3A 3OTOJ 2FC8A 2Y9HA 2HRYA 3D28A 2YKMB 2CUYA 5L1KA 4C8ZA 3HVTA 3R27A 4DX5A 2CQIA 2V2KA 1C2PA 4JI2F 4ZA1A 2OTLS 1HBNA 3GU0A 3TJAA 5EHHA 1JKHB 1JIHA 1TL4A 2C1EB 3OVAA 1VMBA 1HWKA 3Q2SC 2HGMA 5E3QA 2LEPA 5J2PB 1RSCA 4CO4A 3QSYB 1V3ZA 2CQHA 3R97A 1IKYA 4B3SF 4KGKA 2ZKUA 5CYJA 4NLVA 3R2CJ 4D3HA 4UOGA 3V6JA 4N8OA 3CO0P 2E1CA 3D0GE 5E3RA 3D5MA 4KHRA 3MPUB 2JFDA 3KG0A 2K1RB 3IS9B 3GYGA 3BSOA 2ALZA 2XQCA 4F0MA 4NE9C 5CYMA 4E0DA 4AXJA 3OUYA 3HD1A 4P2MA 3G9CA 3VAIA 1DY3A 2ZH4A 2CPHA 2QX0A 4HI2A 3I56S 4OLPA 1MMNA 1N32J 4LF6F 1FRJA 4AQYJ 2GVZB 5D3GA 4E2FB 3RAMA 1S10A 1SB6A 3N9UC 4GVBA 5KFNA 1VC6A 1RAJA 1QSYA 2BDPA 4DPOA 3QRRA 2RRAA 3MMBA 1X4AA 1RT2B 2CIMA 2B8QA 4IQMA 2YNGA 3UDEA 1TKXA 4FPRA 2OAUA 2HNZA 1N34J 1X4FA 1N5TA 1RISA 2H3EB 1AROP 2EKNA 4J9OA 3U1NA 4NEYA 2W9BB 3MAQA 4ZITA 5KFJA 1AUDA 1RAHB 3HFVA 4DLEA 2G0JA 3N5BA 4OX7A 2ZBIA 3SQGA 4K8RA 2AMCB 2HZCA 1F3FA 2M70A 3CJ0A 3BDPA 2R7XA 4AL5A 4FBUA 2BW2A 3VHQA 4QYRA 3J81j 4ERDA 4DL4A 4XDCA 4A47A 1L3TA 2GV1A 3BQ2A 3HVWA 2UUWA 3G8QA 3HP6A 5KFRA 4USKA 4B9NA 4TY8B 1PJ5A 4UY85 4A46A 1SJRA 2ROPA 1HNXJ 2OFHX 4P6QA 2XS5A 4C4WA 3ZZRA 1GEHA 1WEYA 3OR1B 4ID5A 3PIOQ 2X1BA 4FKYA 3I0RA 4F25A 5KT5A 3VR1A 1D3WA 1U1NA 1R89A 1FERA 2F4VF 4ELTA 3E8OA 2YWKA 3SCLE 5CA5A 3QAUA 4WU3A 4F02A 1PYTA 3M7VA 1UWAA 1U6ZA 3TW0A 3S1TA 4USVA 3UR0A 1QUPA 2AZ1A 3QJLA 2RF2B 3FMBA 2VPXB 1XR5A 4HEA9 1X4DA 4B02A 1RABB 2HNDB 1LWCA 2RS2A 1A6LA 4L74A 2IVYA 5IZHA 3KDOA 5J2PA 2I38A 1WC3A 4DV0F 2J7UA 3FCWA 4R25A 3O3LA 2GMHA 4E98A 3K7RA 4PAAA 3OL9A 3TVZA 5F8IA 4XDDA 1VLYA 2AKWB 4PR6A 5ETTA 2L9WA 3W1YC 2QO3A 2XGQA 1TUVA 3GONA 2CKWA 3MM5A 2KG0A 2JH3A 2XI2A 2F1FA 1X4EA 4X4TA 1SIWB 3B6BA 5B0FA 1F5AA 3D6MB 1FNMA 4LQ3A 3HKZD 2IA0A 2V6AA 2ZWPA 3FBBA 2HLTA 2QT7A 5DQGA 1S4EA 3MR7A 4UF4A 2AGOA 3T5KA 3RZAA 4C3KA 4F8RA 4TY9A 4CTAA 5GAEI 4I64A 5HROA 4NZ7A 4WFAQ 2XNRA 3M05A 3VGVA 3I9V9 2DD8S 4MFBA 3PNIA 5F3ZA 2HRUA 3NS5A 1M5HA 5HP1B 3RR8A 4ZMMA 1QSLA 2GHPA 2Q43A 2JEJA 1IKVB 4WK1A 3KWMA 1HFEL 1OMSA 4OZ2A 2W9BA 3GIKA 5HI7A 4C9DA 4IQXA 3SSSA 3D3BJ 3PY8A 1JQGA 5E2QA 4WPAA 3CJSA 1N33F 2AYEA 3JTOA 3FCHA 4QYZK 3GQCA 4B9LA 4LF2A 3I82A 4P9SA 2QSWA 3OV7A 3Q8PB 1WKKA 3L3CA 3P4UB 3HSDA 2HWHA 1NJZA 1YX2A 5F3TA 1RWXB 3UR3C 2X1GA 4DG1B 5A2QU 3N0VA 4FYDA 3FZBA 2M0GB 1TU0B 3HFZB 4KV8B 5KFCA 4OIXA 3DOMB 2B5JB 2AJ4A 4YY3J 1JJ2R 3MEEB 3KJVA 3UN5A 3ZTOA 2XY7A 4OZNA 2VIHA 2V0NA 3R5CA 3UCZP 4OX8A 4V19X 2H9ZA 1XMOJ 3MXHP 4DUTA 2DT9A 2NCKL 3HHEA 1G1XA 2PT0A 1KHVA 2E5GA 2WRMA 1TL7A 3A8KA 4WKYA 1XMBA 2AGPA 3AXMA 2QJ3A 4RW4B 4YR3A 4ECQA 2ZITA 3NWRA 5IT9U 2IVMA 4X4UA 5KT7A 2B4VA 3O1LA 3NNAA 1LXNA 2KO1A 1M1GA 2HVEA 3S01A 4YMEA 3AB4B 2OPRA 3KK2B 2HMIB 2DR6A 2RT3A 2BOAA 4DQIA 1S6OA 1X0FA 4LSNB 4PWUA 1VBKA 2SXLA 1XBWA 1GTHA 1R0CB 2EFNA 2BBEA 5ETKA 3I87A 1TK8A 2QYCA 4QWCA 1WC4A 1PGZA 4DR2J 3GP9A 3BPSP 3M30A 2MKYA 2CJBA 2N7YA 2VFVA 2XSFA 4DV5F 3AJ1A 4TVAB 4Q5VA 1RTHB 2E9TA 3HHLD 1RGVA 2YQ0A 5I3QA 4NLTA 3GV5B 4NA1A 2WVDA 3LO3A 4K50A 3LUYA 1EAYC 1CPZA 1YRXA 3MMCA 2VG5B 3Q8SB 2BR0A 3GFHA 5B09A 4QW8A 5HP1A 2C2ZB 5A2QY 2EK6A 2VF3A 1WTBA 2P6TA 5IQQA 1JLCB 2RHSB 2DGUA 1G2EA 2AV5A 3UN2A 1OIAA 2F5GA 2GX8A 2UXBJ 1VQYA 3QFWA 5HJYA 1NDCA 2ZD1A 4M94A 4DN0A 2OLWA 2CPIA 4K0KF 1VGYA 3TO8A 1L3UA 4TKTA 4LF1A 5F8LA 1CVJA 1S1TA 1KOOA 2X3DA 5A8KA 1OWXA 2VQFJ 1F1BB 3UD4P 3PEJA 2J76E 3MD3A 3GB0A 4PWWA 2JEGA 3BQ0A 3GJTB 2KFZA 2B5JA 3US5A 4DR1J 5IT9Y 3TUJC 3PXGa 4AL6A 4ZLPA 1DRZA 1WJ9A 2MZJA 3PTWA 1UJ5A 4X4VA 3ULHA 3HXMA 4K5RA 4Z37A 4X4NA 5L8RC 2W2OP 3MM8B 4N7TA 5AE1A 2BE9B 2UZAA 3VVUA 1OQ6A 4I7FB 4A8YA 3TRGA 4NA2A 2FLOA 5JVHQ 1K8AT 4RNHA 1R8PA 3TARA 4DPXA 3H40A 4OX9J 3W2WB 1RWUA 2V94A 2K8GA 2J0QD 2VL1A 3IGNA 1RWNB 3I55S 1YKWA 3L4BC 1EJ7L 3ENAA 4NA3A 5H9FK 3QLHA 3DRPA 3OPKA 3ZZPA 2HMIA 2PEHA 4LSNA 1LWFA 3GCXP 2ZFHA 4CO5A 1Q95G 3NGKA 1MMDA 2ZVIA 1VBYA 4OX6A 4ECVA 2HAIA 1QVGR 3R5DA 1VJQA 1FRIA 4EYIB 2DNRA 1YTYA 4NYOA 2Z2ZA 3EM1A 3P45B 5HMZA 4A8OA 4U8YA 1VQOS 4K59A 4DN9A 2AHOB 4C11A 1TL3A 1ZA1B 2RRNA 1J5OB 5IWAJ 5FDLA 5D4LA 2ZZNA 5LT5A 1HMVB 2QLBB 4TU8A 2D7SA 1OQ3A 4RW6B 3CJ5A 3QT6A 2YX1A 3BO4A 1N6QB 4LFCJ 3MTJA 1X0PA 1ZYQA 1NNDA 1JXEA 3EE3A 1SPBP 3A1YG 2HS4A 2J8AA 2IC3B 1NK8A 4Y34A 1H74A 1T9UA 4JYAJ 3KHHA 1FJGJ 2HVIA 2KJVA 1B64A 1SUQB 3EWGA 1SKWA 4HR2A 2KDOA 1KBRA 5BR8J 3M9NB 5A0YB 5KFGA 1T0TV 2WZ1A 4KJIA 4QIWD 1DQ9A 4DBQA 3FC9A 2MGZB 2HFUA 3RGIA 4RX6A 3M2UB 3R1HA 5IS2A 3IR6B 1LWXA 1S99A 3D4JA 3H5XA 1TKDA 2ZH8A 2EVZA 4DQRA 2E5LJ 5HQMA 4K4SA 1N88A 2XMMA 3W5YA 1NK0A 1C1CB 2R8KA 3N28A 4ZCLA 4RWXA 1IR1A 1I94F 1VK8A 1GMWA 2FHJD 2WK4A 2U2FA 4DR6F 1Q0NA 1SL1A 2ZZMA 5KG6A 4KHMA 2ZJPQ 2ZH7A 3ISND 1S4FA 4DSFA 2IIHA 2AX1A 4JI6F 3C16B 1KFSA 1Y3JA 2QFIA 1XERA 3JXOA 1B7YB 1JLAB 5DETA 2NXEA 1FDBA 3O5TB 2DNGA 2LVWA 4RU9A 4KGVB 2XY6A 1S0OA 1HD1A 4D3GA 3G82B 2XHCA 4DEZA 5ADZA 3FNNA 4H54A 1WUUA 3THVA 1NSPA 4JI2J 2BABA 2ALYB 5HBMA 1CJVB 3NL0A 4NLXA 5CH7B 3PVXA 1HI0P 4H4KA 5F8GA 4ANCA 4OYOA 2MQLA 1U24A 4F3QA 1RHUB 1JWWA 3W2WA 2YXLA 3IBCB 4WFZA 1RT3B 1F5BA 3BN4A 1XQIA 1Q53A 1VYAA 2R7UA 3W7BA 4CNYA 1NB7A 3M2VB 2AYGA 2EFQA 1FFSB 4X64F 3MPYA 4M5GA 2DGXA 3DRYA 4BLGA 4W92B 1QM9A 3RJMB 3CIZA 1U25A 3UVJA 5GMEA 4PG8A 1E6YA 1XIQA 3UPFA 4P72A 4URGA 3DLJA 4C8MA 1UEKA 1Q8IA 2W1BA 3K5OA 2KM8C 4E8UA 4ANEA 3EZOA 5D0EA 2QLJB 2JWNA 2MLXA 4AFFA 1HBUB 1H2VZ 1J5OA 1N4LA 2WONB 3ZTSA 1TR0A 2MSSA 2J6SA 2V34A 4LF6J 1IBCB 2DVIA 2H5JB 2HHWA 1JK9B 2FIUA 1S6QA 2VOPA 3DI6A 5CYQA 4OYMA 2DCUB 4LBIA 4ALZA 2J0XA 3VAMA 4P52A 4FYXB 3DXBA 3KHRA 1K0VA 1TUWA 3IWLA 2OH2A 3CCJS 3CCSS 2LQ8A 1VR6A 1NAQA 2BM1A 4IO1A 3KK1B 1RTDA 1KR4A 3B82A 3KLFB 3BGOP 2FPHX 4GO7X 2HPUA 4WE1B 1FX4A 2BE2A 3NP5A 2KM8B 2CQ2A 2DGQA 2XMJA 3M2UA 5F8HA 3PIPQ 3FCVA 1B0TA 2HAFA 3FEZA 4I2PB 4PUOB 4RNOA 1YWXA 3D0IE 3JSBA 2BE7D 2P9CA 3BEGB 3EXYA 3FQLA 1YBTA 1T94A 2QA1A 4RNNA 2JLGA 1HR0J 2JL9A 1HNZJ 1JNZB 5KFLA 2GQCA 3RB3A 5CHCB 4DUYJ 2JC0A 4IKAA 2ZNZA 4JV1A 4OZLA 3MCMA 3KK3A 4NLDA 5E7OB 4FNHA 4LSZB 3J7A1 1T11A 4MK8A 1RTJA 3CF5Q 4WFBQ 1NXIA 3I5BA 2F4VJ 1I6JA 3OFFA 3C15A 1EARA 4GC6A 2AX0A 4DX6A 3GYNA 1S1UB 2OPPA 3GG0A 3GLJA 5H9EJ 3D3CJ 2CJAA 1JLFB 3E01A 1BQNA 2CQ4A 4OL8A 4ED1A 2D74B 2I5JA 2J9DA 5I3UA 2FC9A 1CC8A 2M4MA 3AY0A 3VAHA 2NREA 5E41A 1S0MA 2B6AB 4NZ6A 2MKJA 1S57A 1RWMB 1X4HA 3R3TA 3BPDA 2R7TA 3ILIA 3D7SB 3FEXB 4LQ9A 1UW9A 3FSXA 3T5LA 1DAXA 2FJAB 2IVFB 3C6TB 4ES3A 1GTEA 4MTPA 4CLSA 2B4UA 1HA1A 1NEEA 2MZQA 2VJVA 2D3UA 1XTZA 3DRSA 2XO6A 3B54A 3BB5A 2OFGX 3H5SA 1ZM2A 1HNVA 3ENWA 1WF0A 4LF4J 1VRQC 2JRSA 1YJTA 1CLFA 4CO2A 3MPVA 5IT0A 2DYAA 5D6GA 3AQPA 2ZBPA 2BJ9A 5C7PA 1HPZB 1BXNA 3BKFA 2XI3A 2HHVA 3U1LA 3BR8A 1LOUA 5ITHA 1V6HA 1K1SA 4LVOP 1HLWA 4KFBB 1NZAA 1Y5NB 1RQ0A 4B3RJ 2B8PA 3CDAA 4EEYA 1RT1B 4NLYA 3I0SB 1S1VB 4I2QB 1NUEA 3H4BA 4U7UD 2EFOA 3KNAA 1IXKA 1X9WA 1CBKA 4K5SA 5C24B 3LWLA 2VODA 2DJWA 1VC0A 1SV5A 4X84A 3AODA 2JFKA 1P1LA 3VZIA 5BYRA 1R0BG 4H4OA 3NBPB 3KJFB 4O3PA 1MN9A 4KIAA 3AD7C 4Y6IA 2BQRA 5AJ3F 3I5AA 3NGSA 2VFUA 1IQZA 1PC5A 4EI2A 4GC7A 4CM0A 4DS5A 5HQ8A 4ZDNA 3ZNUA 4B9UA 1GMVA 3CIMA 3AXKA 3HD2A 3QGGA 4UQTA 1WC6A 3OXGA 3ADAC 1WDTA 3PYFA 5KFPA 4ECRA 9RUBA 1GX6A 5KFVA 3VAJA 1CULA 4O3QA 4R5PA 4USIA 3DN9A 4OI2A 5DZ6A 5KFSA 4HTIA 1BY9A 1NRKA 2JVOA 3UI3A 5LSOA 4ECXA 1RT4B 1S72S 3WC2A 3W5ZA 2DNOA 3LH2S 2MPUA 3GZ7A 1CJKA 2DRDA 3R7NB 5B0DA 4DL7A 1NO8A 2RNEA 2J0WA 3S7RA 3Q24A 2B6AA 1UPPA 4QIVA 3ENQA 3F41A 1L5UA 2X7IA 4KGZB 3Q86A 4CH1A 1FKOA 1YJVA 2BJ7A 4EYHB 1RT7A 3CO9A 2WHOA 4C48A 3D68A 1EKRA 1YRUA 2F40A 2W9CB 4M5MA 4YDDB 1QAXA 2MDAA 1JLBA 4WTOB 1IBKJ 3KMSA 1H2UX 2G2OA 2KZMA 4G1QB 4RW8A 5AXKA 3R5JB 4NXMF 4LFBJ 5MAOA 3UCGA 4CM2A 3IWXA 4ITSA 3CB4A 4WP9A 5IT4A 5KT4A 2E1AA 5J2QB 2E7WA 2VFTA 5HJXA 2CA9A 2HHPA 1YITS 3KLIB 1U1RA 5LJ3Y 3MAAA 3OTOF 3ZTQA 1Y0HA 2ZDOA 1S12A 2MQ8A 4QW9A 3GJRB 5C42A 4ECUA 2RHQB 1KD1T 1OYDA 4GVLA 2DISA 1U0HA 3UN3A 4OZ0A 1OPZA 3IR5B 4KFBA 4DFPA 1FRKA 2HS3A 2BJ8A 4J9UE 3CCZA 4KSEB 3K89A 2ZE2B 1QD1A 4DFJA 1TK5A 4ZN3A 3G6ES 4PG7A 1UJ6A 2VH7A 2HLUA 2FTRA 1MU2A 1UFLA 1N5YA 3Q8VA 4KGMA 2C2MB 1KSPA 4DXLA 3W5XA 4JP8A 2YNHB 3T1HJ 5C5JA 3M4XA 2OO4A 4K0KJ 3V6DB 1KVJA 3LGHA 5D4OA 2IJRA 4LR9A 4U95A 4O3SA 3ZTRA 2JEIA 4LR7A 4U67Q 2PN6A 4ED0A 4ZK7M 1F60B 1N32F 2POKA 2E1RA 3QO9B 4HACB 2OD6A 2V8GA 4O44B 4AQYF 2KB2A 4M5LA 1Q8BA 3VAKA 1OY8A 2CQCA 1B3TA 1NM2A 5K14B 1TKTA 4IRKA 3MEKA 1E6VB 3ZZYA 1Y3KA 2N7CA 1CJTB 2ZOMA 3CJKA 3RW7A 3MM7A 1EQMA 2ZUGA 2F9DA 4LSLA 1U45A 4NPOA 1WACA 5ETQA 1UWBA 4LRCA 4QYZJ 1FTRA 2ZH1A 1NSAA 3H8YA 1N34F 3DDNA 4J91A 4JI7J 5IXUA 3N4WA 4USWA 1Z4UA 3MPDA 2L3MA 3IMQJ 5KG3A 4ZIWA 2P2CB 4FS1A 3MUMP 3T9NA 5T41A 2LA6A 3RUBL 1YDLA 1TV6A 4WF9Q 4WJBA 3GFZA 1QJHA 2ZBRA 2ZVSA 4L76A 4JV0A 3M8RA 4ED5A 1IBMJ 3T6JA 3QGPA 3SCIE 2IBKA 1JB0C 2KFYA 3G71S 2IM0A 1N5VA 3SXLA 2HBRB 2M8DB 2ASLA 3PW7A 4KB7A 2V4RA 4UTGA 4UOCA 4BBYA 4ZVHA 2DIUA 5C25B 4Z2XA 1KNZA 1N48A 2B51A 2QEXS 2HHSA 1HQUA 4KKOA 3JYTA 3OTBA 4CO3A 3HVRA 1HNXF 1MWQA 4CCHA 2MQMA 1RTZA 1SJ4P 1DZ5A 1CJUA 2QA4G 4CYUB 2EPIA 4BC7A 1VQ7S 1FD2A 3C8YA 1CS4A 1OJ4A 2A0FB 3V6KA 3CCVS 1NKEA 5T14A 2BJDA 4PEOA 2UVWA 3EYZA 4WXOA 4F36A 4PZVA 1SXLA 1FNXH 4USTA 4MKAA 2XO7A 2UVVA 1S6UA 4A8FA 5HATA 2CPJA 5DG9A 1KWMA 3BV8A 4FKXA 5JXSA 3OHAA 3R2DJ 1Q1KA 2E7XA 3IGVA 3IG1A 1JLGA 1NH8A 2C3OA 4ECYA 4Q43A 2XBPA 1NKCA 2VBZA 1K0TA 4NCGA 2MQNA 5A8RB 1BWVA 2R7OA 4OI1A 3NNHA 4OLOA 2AQ4A 3MM6A 3A8JA 3MCOA 3WIVA 3DGPA 1YJWS 4X65J 4NI2A 3NGUA 2AGQA 5FLXY 4J37A 4DOZA 4MYUA 5THWA 3MD1A 4ZPDA 4ECTA 3DCAA 2U1AA 2LQ9A 1Q8LA 3CMAS 3QT7A 1YG0A 1YJNS 2Y0SD 3TVYA 1ZTTA 2X3GA 1ZAVA 2IRUA 4CIOA 1TUGB 2GMJA 2HRTA 2MZ1A 3FZ2A 3SQOP 2EG2A 4HLBA 5T7LA 2YNIA 2VA2A 1EP4B 4ZS6A 1Q7LB 1Y10A 1RCOB 2J7WA 5E0OA 3SDEB 4UZBA 1ZPVA 1ZETA 1RLDA 5HLFB 5C2CA 1X31C 1D0EA 2HHQA 4DR6J 1REVB 4O4GA 3P96A 2V4JA 2GC8A 4RBTA 2RKIA 3PG9A 4EGLA 3HF5A 3FEYB 1KLMA 3RBXA 2C2KB 2XZDB 2CADA 3TWZA 2VD3A 2PA8D 1TKZB 2MJNA 3OSNA 2QFJA 2W24A 2M52A 4I6AA 1VBXA 5L38A 3M8PA 3QRPA 1WORA 3MMAB 4F2SA 3ETOA 4DHVA 4AE5A 1QE1B 1MWYA 5JJBA 4KR0B 2LECA 2JLFA 4J90A 4USMA 4UZCA 2ERRA 2ACMA 4HH1A 3OFGA 1XWLA 3N6MA 4RW9B 4KTQA 3CCMS 2GGPA 3AQOA 2JOQA 3T3FA 4RUAA 1WOOA 1WEXA 4DFKA 1HBMB 3KLVA 2D1CA 3MOJB 3MM9B 4IR1A 3EGWB 4JI3J 4J9QA 3JSMA 2MEWA 4N5SA 2A3JA 1I3OB 4DR7J 1ZZFA 4K4UA 1WC1A 2GIRA 4HKQA 4YY3F 1WKLA 1R8AA 4WXWA 4RJVA 5F0WA 3SFGA 3VALA 2HHXA 5A76A 1PJ6A 3R7SB 1DLOB 5L1IA 4EUVA 2J9CA 1XMOF 1S0VA 1S9GA 5SUHA 4U6PA 1TFWA 1HNWJ 1N36J 4XO0A 4I6WA 6FDRA 2Z57B 1RAIB 2AIRB 4W4MA 5I3PA 2JHEA 3NS6A 5ETLA 2AEMA 4DSIA 1URRA 3P49B 4O0IA 3RBEA 2BA9A 4IG0A 1O6XA 2Y3YA 4FPIA 2NXNA 1SKRA 2HQGA 1NHVA 2V68A 1NSKL 3H2VE 3FFIA 1PIEA 3ILLA 1WD6A 4Y2CA 3OXFA 2FB0A 2DHXA 3VQTA 3BSAA 4CP5A 3S8SA 2DO4A 2W2QP 1HW8A 1SQEA 2YWGA 2G0IA 3HSGA 1FA0A 2OJ3A 3MF5A 2ZHOA 5KFEA 1U1PA 1HIYA 3AFGA 2Y1IA 3R8YA 3P6YC 1YJUA 3V4MA 3DU6A 2OSQA 5DDOC 3Q8QB 3J7YU 1FKPB 2AF6A 2VC0A 1BD6A 3KLGB 3OJSA 4DR2F 4IH5A 1NCLA 2P5VA 8AT1B 3DLLQ 3I96A 2WSFC 1H0HB 4PWDA 2FZGB 2UV8A 5SZTA 3OTDA 4IRDA 4C97A 1DTQB 3NS7B 4DI6A 4LBHA 2QE5A 1S5ZA 4IOCQ 1T05A 3A4TA 3L7OA 3TP2A 1NK6A 1REVA 2WTFA 3MR3A 1C1BB 1RADB 2F8MA 3CMQA 4FF2A 4ZJOA 3DOKA 2ILZA 4DV4J 1EX8A 3JQKA 5HMYA 4C3MA 3K5LA 2KG1A 2DR5A 1WHVA 4BCAA 3M8QB 5EUHA 1D9DA 2BQUA 1VQPS 3L7UA 3MMAA 3M32B 2UXBF 1YJ9S 1VOMA 2W2PP 1YHQS 4J9NA 3GJSB 4MYTA 4ZLLA 2JLEA 2UVUA 3H20A 2XMVA 2M9KA 1NPKA 3VZHA 2XMAA 1ELOA 2CJKA 1FVQA 2YWEA 4U96A 3G8SA 2VQFF 3HHDA 1WG4A 2BUNA 2VG6A 1U1LA 1S9EB 3CD6S 2BW7A 2PI5A 1SH2A 4K4ZA 2HVDA 3HJVA 4ZP7A 1RT6A 3N01A 1QTMA 3AD9C 4HDGA 4L3NA 3QBCA 1GFWB 2XYHB 1LW2B 4C0OC 2HNYA 4O23A 2R2SA 4OZ5A 5EWGA 4IG3B 1EHWA 3M6XA 4ZLNA 5J1EA 4R8UA 3POTA 5A6PA 3LTOA 2OMOA 3A8IA 3HVTB 2ASYA 4TN2A 1F3VA 1HBNB 4DV1J 4RU2A 4LMZA 1RHRB 2E1PA 4QU7A 4CLKA 2Z2MA 3GMGA 3TA1A 3QJJA 4C98A 5B0CA 3LW5C 3SI8A 4PXDA 3M8SA 4OX9F 4ZHRA 1AW0A 4UW2A 3UCUP 1IKYB 2V8VA 1ZBTA 3C19A 1LK7A 3J81U 1FE4A 3HZEA 1XEZA 2XULA 2R2RA 2CPDA 4DQPA 3PR4A 2RSQA 3J7AN 1S0NA 2GCFA 4QZVB 3A3OB 1AZSA 1T03A 2NSCA 1U49A 2LKZA 3NCQA 5CYMB 1J5EF 1H2TZ 2IM3A 1UAWA 3OUYB 3MEGA 4K4TA 4QPXA 1S76D 2EBGA 3KLGA 2UXDJ 3I4PA 5L39A 5IWAF 3FUYA 3BYRA 5L1JA 2XY5A 4RR5A 1SC3B 2XYPB 5D3GB 3FVYA 1ACMB 1KN6A 4ER8A 4DDFA 3SCKE 2H51B 3D1HA 5HQLA 3KFWX 3EUNA 4BS2A 4B3MJ 3MMBB 4X4SA 4YQWA 3GV8B 1TK0A 1KVKA 2ZUAA 1TKXB 3DDIA 2NPIA 4JYAF 5B08A 1FJGF 2BKPA 2OD4A 1HHTP 2QN6B 2HNZB 2JNJA 3PRDA 1RJJA 4C2MA 2QLWA 5BR8F 1KQSR 1RAAB 2UUTA 4CDIA 2DH7A 2GA7A 2CXEA 2LQ5A 2YWWA 4RLEA 4DL3A 1L3SA 3SQGB 1WF1A 3DMJA 3M8ZA 4RL1A 4A8SA 2PC6A 4L72B 2DHAA 2QL7B 1FESA 2PD1A 3RAQA 3WX4A 1NK9A 1DBDA 2IRXA 2BRKA 3CMES 4CLTA 1NJXA 5H9EK 5H1SV 2Y1JA 2E5LF 2MXYA 2FJVA 4F4XA 2IHR1 3IM8A 1X4BA 1D09B 1KOHA 2QYGA 1NLKL 1XR7A 4Y28C 3CCLS 3GIJA 1RP5A 4XPEA 4NXMJ 1RHKB 1WI6A 2EBEA 4Q8FA 1U1OA 3D66A 2OMLA 4ID5B 1Q82T 1Q7YT 1AXQA 3I0RB 3NOCA 4IR9A 2RDJA 2IYGA 4FNIA 2L41A 2DGVA 2HHUA 2C22A 4ICLA 2D41A 4QWBA 5RUBA 5KFWA 3D9BA 3J81Y 4CLLA 1H98A 2X1FA 3A3PB 2AW0A 1HNIA 4ZLJA 4PPDA 2IDEA 3R6LB 2UUAJ 2KT2A 2F8EX 4A8KA 4PXBA 4DV7F 1S49A 2ZC4A 3W62A 2HS0A 1RWVB 4J9SA 4ZCKA 4I4BA 3RRKA 2WOMA 1LWCB 1S7IA 1P9QC 3QT8A 4OHXA 1GNKA 2XWXA 3T5HA 3DOLA 4K4YA 1DJ0A 1VRUA 4QQBA 4FS2A 3TAMA 3B4MA 1HYSA 3K17A 4Q0BA 3LANA 1L3VA 3O2IA 4L6V3 3W2VB 2NSBA 1WHWA 4WYWA 3M9MB 2EKYA 2H5EA 1Z2ZA 4ZPCA 4F2RA 5IV3A 1JLEA 1HWJA 1U7LA 1D9FA 1RYRA 1PO6A 2RB7A 2V5HG 4U8VA 2R7SA 3V81A 3MM5B 1P8GA 4IDKA 1R0AA 3TOQA 4EFAC 2VA3A 1EZZB 4PRFA 1KQKA 3DGVA 2M2BA 3BKTA 3MHYA 1FT8A 1VRTA 4ZVUB 2ZBQA 2ADCA 1RTIA 4LRFA 1LW0A 3NMAA 3IO1A 3KLEA 4YB7A 2WVFA 1REGX 2EW9A 3CJ8A 1RCXB 2HQ3A 3BF4A 2I9SA 4YR2A 2LLZA 1RA7A 5L46A 1QY7A 1VQSA 4CTAB 5HROB 2E5HA 1I1GA 2YQ1A 4UOHA 2DPJA 2B7CB 4MFBB 4QR2A 3Q0AA 1I5OB 3KG1A 5D0RA 3BN7A 3CDUA 2H1YA 2MTLA 1U2FA 2Z8QA 4P7VA 4DZ6A 3KHLA 3B8HA 1G7CB 2E7VA 1ZS6A 4LUBA 2KXHA 4GMKA 3FJ2A 5J2NA 1U26A 5DGAA 2UXCJ 3BDEA 3BBCA 1RT5A 2XC9A 4Q8EA 1RBOB 5D4NA 4KQZA 2W2MP 3N5FA 3MAHA 1QUVA 2FGCA 1RWKB 5KFOA 2QSFA 3CC2S 2R7RA 5ETOA 4KGXB 5ETSA 1A7GE 3EGZA 4OJ3A 3JSYA 4TU9A 3SMZA 1HR0F 3DC2A 1ZOTA 1HNZF 1NK7A 1P27B 2BV3A 3CCES 3X1LB 3PKYA 3C14A 4DUYF 1RKJA 3CJ4A 2Z58B 3UD5A 3H4DA 5IQ6A 1WELA 4IFVA 3KJVB 2DNQA 4MIAA 2VICA 2LU1A 2K3IA 4YDXA 2OI2A 4TQRA 4CNZA 2VBXA 1URNA 1WHYA 1K1QA 2ASDA 2YKQA 1JNRB 3RBDA 2KYZA 4ZPVR 1MROA 4I68A 1TL7B 5G4DA 2I6WA 4DWIA 1LEOA 2VZ9A 3GJQB 3QFHA 1FI4A 2LQBA 3GTYX 3CNQP 3RYLA 2W7OA 2EC2A 2DNPA 2HHHF 3NKYA 2XLIA 1IR2A 1ZM4A 2QMWA 2NS1B 3QNWB 3R5GA 1K47A 3DDKA 2GJIA 2ZC3A 4OZ3A 1R8HA 2OPRB 2PE8A 3QIPA 3W2VA 2IA6A 5AE2A 2KKHA 4CLZA 2RUSA 4MKVA 2V2QA 2BRLA 3C6UA 3HI9A 1HWLA 3AAWB 2DRBA 3VQSA 4LF4F 2HURA 3KDNA 3DLKA 2HG4A 2CNKB 2AP6A 5AT1B 2D3OR 2G9OA 3KJNB 3TQ1A 3KXDA 3GSDA 2FUG9 3M30B 4DL2A 4DU8A 1XNRJ 3VGSA 4WIQA 2RUGA 1ZTWA 2FLNA 1RZMA 3LF0A 4OYWA 1TP7A 1NPRA 2LP4A 1S1WA 5I42A 4B3RF 5L1LA 3MMCB 4MKYA 3HPOA 5KFAA 2KVQE 1U2RA 3MCSA 1WSVA 5MLCV 3RW6A 4X4PA 3DM2A 2ZM6J 4ZVTB 1KKHA 1U1KA 1IM6A 3IBWA 3TZWA 4EWTA 5HVHA 2JC1A 2GAGC 1HHQA 2DGOA 5L9NA 2ZOFA 4C8OA 1GXLA 3H5UA 2ZD1B 4Q44A 3MECA 2I1RA 1YBUA 4EO6A 1SJQA 2BJEA 4G1PA 2GIQA 4FP9A 2AJ0A 2CZ9A 1WI8A 2IY5B 5ETMA 1S1TB 2R2TA 2GNKA 1UCNA 2F4FA 5A8KB 1Y4ZB 2KJWA 4FDFA 2CNLB 1NB2A 2NQPA 1PBAA 2L9DA 7FD1A 1H3DA 3DYAA 2N3OA 2C2EA 4WBFA 4RNFA 5IM0A 3QZ7A 2VB6A 3EPIA 2Q6CA 3ITHA 2YH0A 2B7BB 1PAEX 3SIPB 1YZ7A 4OJ1A 4ETXA 3TR5A 3RBZA 2FY1A 1T3OA 1NJYA 1SI9A 2E66A 4DV2J 2Y8YA 2UU9J 1ZAWA 4AYBD 2PIIA 1FWLA 2G0CA 4DPUA 3MURP 3DLEA 3HHLA 1FVSA 1FF2A 4OHWA 3JTNA 1DTTA 1L3KA 1M0SA 3TYTA 1U2CA 2G4BA 2E5JA 2BM0A 3ZO7A 4OYBA 2LEBA 2IDLA 2OGUA 3TJ8A 5ETVA 1FJ7A 3M1VA 1VJWA 2B4PA 2OPSA 2MKIA 4UUXA 2X1AA 5LXYA 2YH1A 3PKMA 2H4WB 3QLHB 3PO4A 1WG5A 1IBKF 5JUMA 3DRPB 3MUTP 1KDNA 3QWPA 4LFBF 2KRBA 3G6XA 1UZHA 2RQMA 1LWFB 1TMMA 2Z30B 2HZAA 4WU2A 2YWFA 1R7IA 1HBOA 2BJ3A 3SEOA 2WB4A 2WBRA 3CT9A 3H90A 4HHUA 4ED2A 2GMLA 4DL6A 5DDRC 1KTQA 4C11B 5CCLA 1MLAA 1TL3B 4ZJLA 5FDLB 3R5AA 1M5OC 3Q83A 2RS8A 2PI4A 2EG1A 1FRMA 4PQUA 2W4DA 4RW7B 1D9AA 2XTJP 3LGNA 4OYIA 1RBLA 4LF7F 2CVEA 3DLBA 2C2NA 1T7PA 1JXVA 3CJQA 4KYZA 3CDEA 4ED6A 1RHQB 2BMBA 1UP1A 2NPFA 9ATCB 3FKBA 1CSJA 4ECSA 3VF0B 1RU2A 3I9ZA 4NRTA 3Q2TC 1C0UA 4M63A 4QPTA 1NDPA 3AA8A 1NJWA 1SKSA 1C0TA 4LVNP 2KHCA 4IFYA 4DCJB 1LFWA 1BHNA 4DJBA 5BXIA 2MMYA 1KLNA 2MSTA 2LDIA 4NLQA 4NASA 3T1HF 2G2ZA 5K5MA 2B9XA 2MKKA 3FRYA 1Y11A 3F0NA 2LA4A 1LWEA 1FK9A 2VASA 1UZDA 4H4KC 3BH6B 3AOBA 2CG8A 3W9IA 2EI5A 1GXUA 2DO0A 4J9RA 1TVRB 6FD1A 5IC6B 3SBMA 4O3OA 3MEDA 2ZEJA 4DL5A 1RYSA 1N0UA 4Y2MA 4J9KA 3M6UA 4A48A 3V2UC 4M5KA 2OSRA 3PACA 5U47A 4B3OA 1D8YA 1RDRA 1HD0A 4LF5J 2AZ3A 3OTCA 5EGYA 1M5KC 1NMEB 2JX2A 4LRAA 5IOLA 3D54A 2XNQA 2CRLA 3DU5A 4USUA 3PW0A 4JI7F 1IKXA 4ECWA 2M5YA 4WFXA 3M2RA 3ILOA 1VDHA 2NXJA 4XK8C 5LOQA 2DNHA 1TL1A 2DNKA 1LXJA 1V5IB 3K58A 2RD5C 4OHYA 1RKIA 3OR2A 1KFDA 1WC0A 3UDVA 1SH0A 5KFXA 4QU6A 1GK8A 2LEAA 4LT6A 1IBMF 4J9MA 5HBMB 3BGRA 4TXSA 2XLKA 2YX4A 4QOTA 4F67A 1MWZA 1SJFA 1GMUA 5LSLA 4O0NA 2ZH5A 2C3MA 2DHSA 2VQEJ 2KT3A 2FVPA 3TAPA 3VGUA 3KYLA 2GJFA 3RR7A 1VQ9S 5DDPC 2FDNA 1UL3A 2FZKB 1Y7PA 2NYIA 3UVJB 4F3MA 5JVGQ 1E6YB 5FD1A 3KKFA 1J5EJ 3FMWA 3KG4A 2W7PA 2XS2A 4KH1B 3M8YA 3F56A 1H7XA 3U02A 1YIJS 4ZVGA 4U7UK 4FYWB 1S1XA 2HFZA 3MUVP 3V6HA 1A0OB 1AUSL 2FHJA 4M1KA 4P75A 4RW7A 2V2VA 1NHUA 1S6QB 3D67A 3MCNA 3DI6B 5CYQB 5DG8A 3NMRA 4ZPWR 3K2YA 3LP1A 2YX7A 1VQLS 2MYFA 3DXSX 4FXWA 3AJ2A 2HBZB 2HFVA 3WIUA 1GAOA 1SH3A 5KFKA 4CH0S 2DNYA 2XSJA 1VQ5S 2YNFA 2ZDPA 3VV2B 2KFNA 3EVOA 3HT0A 2Y1LB 4X62J 1NJIT 5I4MA 4RWWA 1RAOA 4ZVRB 4X65F 1RTDB 2IJFA 4I67A 3UNGC 1YVFA 2OKQA 3AB2B 1Z2LA 5F8JA 2HZVA 3CDBA 2PEBA 1U8SA 3T1AA 5DGBA 2BE2B 3G2XA 1SC6A 4ZP8A 1U8WA 2CVIA 1H72C 2VPWB 3QQCD 2HQIA 1SL0A 2XWYA 5EX0A 2DR9A 3RU0A 1V3SA 5GMDA 3G96A 1HI8A 4P2XA 4NLWA 1IJFB 4HH0A 1C4CA 1TVRA 3HHKA 4DCPB 4B08A 3GR1A 1TELA 4YEAA 3CCRS 2O3DA 4KC5A 3IA0A 3KK3B 2DR7A 3BH7B 1X9MA 4H4MA 3OXLA 3CCTA 4OHVA 1RTJB 4K4VA 1AB8A 3L9ZA 4EBCA 4ZN1A 1M1KT 3KTQA 5DRKA 2K3KA 3C15B 4LRBA 3QGHA 2XMTA 2ADBA 3DLGA 2OPPB 3PEHA 4LREA 2Q79A 4LR8A 2BKOA 4DS4A 3E01B 1BQNB 2PMZD 4GKJF 3BBFA 4TLQA 3PR5B 1BQMA 2I5JB 4G65A 4Q7AA 3HFKA 1HQEA 1YK9A 5I3UB 2JJ4D 3GIMA 3BGLA 1B70B 2Y1RI 4DV7J 2V9KA 3CULA 5LMNJ 1TAUA 5EDWA 3WQPA 4AL7A 4C8NA 1F9FA 1UVMA 4QIEA 3UNYA 1B0PA 2JEFA 4P71A 2BX6A 4JV5J 1R3NA 4LF8F 2GHWA 2K2PA 1FKAF 1H7WA 1OO0B 4MAKA 3LP0A 4QWAA 2V8PA 5DS7A 2F9JA 4V19J 4ZVPB 1V5VA 4JI3F 3LP2A 2O66A 3TX8A 8RUCA 4DR7F 1SL2A 5FJ4A 2JZ5A 2HKEA 4NRUA 1WEZA 3M6WA 2V9WA 2Q3PA 3DRSB 4HTJA 3RRHA 4QIGA 4EK2A 1HNVB 1RHMB 5HAOA 3BBBA 4C7QA 1IBLJ 3PJWA 1RI7A 2UUCJ 3IXQA 4CO0A 3LOUA 1HNWF 1N36F 2GVDA 2LU2A 1HQ2A 3OSPA 2DB1A 2VOOA 4QR1A 1XC9A 4Y3CA 1U6BA 1VI7A 4X66F 5D8HB 1PBUA 2CDRB 3UDCA 3PCOB 2VDIA 1FHTA 4ZP6A 3J7YI 4PYDA 4FZVA 2OPQA 3K5PA 2C28A 2HWIA 1ITPA 1S77D 2DCLA 5LXRA 1UVIA 1SV5B 3OTEA 2V63A 1FJEB 3QT5A 5J1PA 1Y5LB 4H4OB 4F3OA 3IRXA 3X3UA 3WC0A 5KFHA 1TQLA 4HHHA 3U1MA 2BANB 2Q66A 2CQ3A 2YKAA 5EWEA 4IUFA 2L08A 2K7KA 4QWDA 4DZDA 3CCWA 3SFUA 2DGWA 5B0GA 4DPWA 3FGVA 2W8KA 1LFPA 3ET6A 2R8IA 4LBPA 1XK8A 2JVRA 2UVRA 1UVJA 1JJCB 2WSCC 4TU7A 4WFYA 3ILJA 1QAJA 2QA2A 5KG1A 1EETA 2CDQA 4OJHA 4DUZF 5GADU 4QJVA 2QTWA 5KT6A 2FVQA 3HULA 3CJ2A 2AYMA 3PYGA 4K4WA 1NDKA 3TUZC 1CULB 4OI4A 3DLHA 2KTQA 5HVFA 2O01C 1Z1ZA 4R5PB 2B3TB 3HJFA 4DQQA 4MK9A 1BMQB 2IJNA 4ILRA 2DEJA 3MPWA 3TAQA 4N41A 4DV4F 4DV3J 3QATA 4M5DB 1YJ7A 2LQJA 3UWTA 4K4XA 1CJKB 5DG7A 4KO0A 3W9HA 3D6HB 2VG7B 2R3VA 4IH6A 5D15A 1S9FA 2OEMA 2HHHJ 4WFNQ 2MZSA 1FKOB 1ICEB 1FEHA 2YKMA 4NYPA 5F8NA 3UO0A 1RT7B 2OIHA 4B9TA 3KUHA 1OSCA 1JKHA 1FJCA 1BUXA 1JLBB 3DHXA 5KFDA 4ZOSA 4RW8B 4DFMA 4NLOA 3ZZOA 2HEKA 5DM6Q 4KE5A 3JS9A 3FK4A 2LMIA 1K44A 1RU1A 4B9VA 1AFJA 4DR4J 5GAHU 1FE0A 5A6WA 2HK2A 3D1OA 3GYXB 1R8CA 2HSEB 4LIRA 4RUBA 4YHHJ 3W9JA 3D1QA 5KFQA 2KU7A 4PG4A 2OTJS 2HQDA 5L9XA 3N6NA 2K1RA 3IS9A 4ED3A 3HCXA 1S79A 4P10A 1XMQF 3MAAB 2MZRA 4C6AA 4KT0C 2QC3A 5C42B 3CD7A 1U0HB 5KG7A 4ED4A 3OL8A 1HWUA 1VQNS 1CEZA 2KXNB 4M5HA 1QAYA 2EEYA 1WNEA 5B0BA 2W4CA 1YBAA 4DV1F 1UETA 4FXVA 4K7QA 3PJ9A 2RQCA 1BLUA 5D0HA 3MZIA 4NLGA 4MT1A 3MI7X 4DF4A 2DHGA 2DTJA 5LL6d 4RZRA 3CTRA 4NLUA 2GVZA 1FFGB 2EXUA 4PPZA 4XAKA 4O3NA 4C8LA 3RB4A 2KHDA 3R9LA 3CCUS 4FYVB 4ES1A 2AD9A 1NU4A 2CQDA 1MU2B 1UTAA 1RT2A 3NRBA 2DR8A 3K8WA 1N5YB 2LXUA 2GO9A 1WC5A 2VONA 2ZNYA 3Q8RB 1XN9A 1TTHB 2BANA 4CWBA 3HO1A 2N82B 2DY9A 2AEJA 2HBQB 3K57A 2RU9A 4F04B 2BOPA 2MQQA 3ONQA 1APSA 1W2IA 3CJRA 3W64A 3QAEA 4YN3B 3F44A 2KVIA 2UXDF 1X9SA 2KZZA 4ZVFA 3WBZA 2KH9A 4TQSA 5JMNA 2W9AA 1DQAA 4RBUA 2VC1A 2ROEA 4C3LA 1R43A 5GAGU 2ATLA 5G0RB 3KJQB 1TKTB 4XPCA 5KG2A 3IP0A 3CJKB 4B3MF 2A6MA 1B7FA 4MJKA 2EFGA 1Q5YA 3MM7B 4LSLB 4TY8A 4JI8F 1UWBB 2AT1B 2PSZA 4YP3A 2RILA 5J2MB 4F4KA 4M5DA 3OR1A 3UQSA 5A8WB 3ICLA 2CJYB 3GCWP 3L09A 2CZ4A 2VG7A 3NXZA 1SC1B 2ACYA 3TA2A 1TV6B 1XNQJ 5HO4A 3BZQA 2MY7A 2F63A 2DRAA 2BJ1A 1UEUA 5DLGA 4GO5X 3TX0A 1YQHA 2RF2A 5HANA 4B3TJ 1RACB 2G13A 2J9DE 5KG0A 5M2RA 1U1QA 5KFIA 1IM4A 2HNDA 3JSRA 3W66A 3TVKA 1HQUB 4KKOB 3JYTB 4DPTA 1FX2A 2Z56B 3U27A 1KEKA 3TEHB 1DQ8A 1WDDA 1CJUB 3C2PA 2YBVA 5CAAA 5FIIA 1CS4B 2D9OA 4J5OA 1M1HA 1FTCA 3R7BB 4AT1B 4P74A 3OD2A 5EX3A 2WSEC 3CEDA 4S0MA 4BHQA 3KHGA 3JTPA 4BC9A 2FJXA 3GPAA 1F9EB 2VHGA 1PKUA 1W26A 2UUAF 4MMOA 3EVMA 5F9LA 4IRCA 1QSSA 5ETRA 1VHFA 3R6GB 3TI0A 3IG1B 1JLGB 2CZVC 3TZXA 4LF7J 1EIYB 5E3PA 1Y5IB 2P9GA 1RXOB 3BSCA 4YB5A 4DPYA 2XMWA 3H98A 1EB0A 3D0HE 2ATCB 4NCGB 3DKDA 4WCEQ 2R7WA 2HIYA 2R8GA 3PHTA 1O5JA 4FBTA 3MM6B 2YY3A 1K9MT 3DGPB 3CDWA 3OQ2A 3N6LA 4NI2B 3K8VA 3ZZUA 2FGOA 1ZZNA 1HARA 3TZYA 3T19A 3HT3A 1IKVA 1EQ0A 2MKCA 4AXIA 2FHKA 3J7ZT 2QGFB 4CH7A 4PQAA 3EICA 3E51A 3OFEA 5T7LB 2O5DA 2YNIB 4CLYA 2NYHA 1JJHA 2FYXA 3UDLA 4ECZA 3D6FB 3C3LA 3PFOA 3JQMA 3PHEA 4HYKA 2MLZA 3CUNA 4JI1J 3TA0A 5G0RA 1WSRA 4UQGA 1VIOA 4O4GB 4LF9J 5K8PA 1N0VC 4DG1A 2V4JB 1U48A 4KAIA 4PKDB 2CPXA 1U1MA 2RKIB 4CLPA 2AJ1A 3TUIC 2XMUA 2HGNA 5CXTA 2FHMA 1VC5A 4C0HA 1KLMB 2L48A 4KV8A 1LNQA 4NZ0A 2B9YA 3VAFA 3DOMA 4GKKJ 4DL0C 5J2MA 3MEEA 4YUDA 5F41A 4P2SA 2DXFA 5KAKA 5A8WA 2R9LA 4J9PA 5LMUJ 3NAIA 2D69A 2DGSA 2C3YA 1F2HA 2AU0A 4WWSA 2CJ9A 4K2XA 4X4OA 3M8PB 4A8QA 2JDJA 4YFUA 4DR3J 2UXCF 2M7SA 3IRWP 1G6BA 4Y2IA 2I0XA 1Q79A 1VS3A 2FVCA 2GGPB 4CI0B 4RW4A 4PCQA 1DHMA 3S6EA 5K9FA 4ED8A 2XHWA 3JAMU 1T9YA 2HK3A 4Y0FA 2FLLA 1T9XA 3J80U 4P2FA 4ED7A 3JSMB 2CYYA 4DV6F 2F65A 4YOEA 4JV2A 5KFBA 4JBCA 1NBEB 1MG7A 3KK2A 2DXEA 3P5TL 2LDYA 2MLYA 3V4IB 1EKSA 1J27A 2KT5A 4KHPJ 2IBOA 3EZUA 1RWOB 4EU0A 2GHVC 2PDAA 4Z7CA 3PYDA 5IFMA 1S9GB 4C8KA 1NK4A 4J9VA 4F4AA 4QWEA 4LFAJ 3VAGA 3EXCX 2D3O1 4W90B 3IC1A 4FVCA 3TNVA 5DJBA 1LV5A 1PJ7A 1HKAA 2Z2YB 3CD0A 1NH7A 2A10A 4NLRA 3OVBA 5DQHA 2DK2A 1CQMA 4ZPTR 4IG0B 1Y9OA 2E9ZA 4R0JA 4MKBA 4N8NA 1RTHA 3PRVA 4OJGA 3OLBA 2DNNA 2V69A 2CQ1A 2RIJA 2UV8G 3FFIB 4NLSA 3VCDA 3P3DA 1TZ0A 2N4CA 1Q81T 1PYSB 3CC4S 1HHSA 2UUBJ 2FVSA 1IKWB 2LCWA 1B99A 1N8RT 1OSDA 3E2EA 3HM9A 5KT2A 2VG5A 5E5NA 3I5CA 3ZC4A 4B9SA 2DNZA 4DQSA 3BYPA 4JI4J 1JLCA 1FRHA 3I32A 2KYXA 3Q22A 3OVSA 3CD5A 2GIFA 4ZCMA 2DH8A 1BE4A 1FDDA 4EBEA 4USHA 4PWDB 1XNRF 3W8PA 3FBCA 3CGIA 4FYYB 4MH8A 3G4SS 1T3NA 1T05B 2V8HA 4RO0A 4NXNJ 3OBIA 1T8EA 5CZVA 2V50A 2QMXA 3NY0A 2C2RA 1UPMB 2DITA 2IYIA 1Q78A 3I4HX 1U6FA 3DOKB 3JAMY 4M5JA 3J80Y 2ZM6F 6AT1B 4GKJJ 4JI5J 2QV6A 3WDOA 5D0GA 1WKJA 4NWBA 4R0EA 2YKOA 1H73A 5CD4H 4LIWA 3ZFVA 3V5RA 3D2WA 4ZVQB 2A18A 3MM8A 2YTCA 2RQKA 3K0JA 3CC7S 3LPYA 4NX9A 1SIZA 2PA3A 3PRBA 4LF8J 3MMJA 2B43A 2RDIA 3HK2A 2P6SA 4U7CA 4I7FA 1BGXT 1Q4RA 2XZWA 2VG6B 3H0PA 2FQQB 2MQOA 2N4DA 3W61A 1RT6B 2F8HA 1P1TA 4BDPA 4B3SJ 1U0SA 2V2ZA 3SSRA 4FXDA 5F8MA 5KFTA 3V4IA 3LWMA 4JB8B 3GSIA 2HNYB 3SZ2A 4DV2F 2KI2A 2XM3A 3BO2A 2UU9F 3GIIA 3PX6A 4WYLA 2H54B 1Y00A 5KFZA 4BWMA 1KVIA 1GMWD 2KN4A 2VFSA 5J1EB 4R8UB 3POTB 3HZGA 1KS2A 1M5PC 3K5MA 3R1LA 2HQFA 3ZZZA 4CT9A 3GFYA 5D78A 4X66J 1R6YA 1T9WA 2YVSA 1HMVA 2KXFA 2RU3A 4JI0F 2IM1A 2VUGA 4RW6A 2GS8A 8ATCB 4ZHRB 4UOFA 2DY1A 4P73A 1N6QA 3Q8YA 3IBFB 3BREA 4DR5F 1PYOB 3PFEA 1IKWA 2IC3A 2MZTA 2XG8A 3NLCA 2ASJA 3MFIA 3T5JA 1M5SA 1AZSB 1X5OA 4OV1A 1T03B 3L95X 1TMJA 1F2GA 4I0WA 4CT8A 1SUQA 5F0UA 2HVHA 3MEGB 4HL9A 5A0YA 2BKNA 4N47A 2W4PA 1J2VA 2R8JA 3VTIA 1VQMS 4ZCIA 2YKNB 4Z7YA 2MGZA 1MMLA 3H7HB 3GV7B 2OUGA 3CXCR 1R6VA 2UP1A 1PILA 3ZZ0A 3HLUA 4DUZJ 4OFZA 2XB2D 1CQNA 3W65A 1ZH5A 4K2JA 1WOPA 1F9HA 3LALA 3PZPA 3NCRA 3BGUA 1SQFA 3HSZA 3IAS9 4W98A 1C1CA 2PFDA 2E29A 1IQTA 2PO4A 2ZJRQ 3HSJA 2BEFA 3MR6A 2JSXA 2GZOA 2BVZA 3JQJA 3G8TA 1YSJA 2Y0BB 2YPZA 3DRXA 3MR2A 1IJEB 3NG8A 4OYXA 3Q89A 1N5QA 3TEGA 2CQGA 2J5AA 4F7VA 1HW9A 3MDFA 1TAQA 5M2PA 2FD2A 2XMKA 3C16A 2W2NP 2ZKTA 3QYYA 3DMJB 3NWGA 2LYVA 4I1TA 1JLAA 2BACA 2R42A 2A2DA 3VVTA 3LGMA 2AWZA 1FD8A 3W60A 3THPA 2VJUA 3G82A 1AYEA 2DNLA 1OPIA 1RAGB 2H48B 2GFFA 1IWAA 3PW4A 1FCAA 2PGCA 4RKUC 1D1UA 1MNEA 1CJVA 4CLFA 3MWBA 2CWKA 3GILA 2CFXA 4DV0J 2XCPA 1VQ8S 3TJ9A 4RNMA
chains in the Genus database with same CATH topology
1BHNA 2HVEA 3EM1A 2ZUAA 1LWXA 5BXIA 3B54A 4C6AA 1PAEX 3FBFA 3DDIA 4W98A 4ANCA 3FBBA 1B4SA 3ETMA 3NGSA 3DKDA 4KPCA 3NGUA 4F4AA 4UOFA 2BEFA 2DXFA 2AZ1A 1BE4A 2HVDA 3EJMA 3Q86A 3VGTA 5CABA 4DI6A 3BH7B 3Q8YA 3WX8A 1S5ZA 1XQIA 1VYAA 2DYAA 4EK2A 1F3FA 3Q8UA 3BBBA 1F6TA 1MN7A 3PJ9A 3BH6B 5C7PA 3ZTOA 3FBCA 3Q89A 4O0NA 3VVUA 3FBEA 3Q83A 4F36A 1NDCA 5CAAA 4ANDA 3NGRA 1NSKL 3EE3A 1HHQA 3VGVA 3FCWA 4ENOA 3VGUA 3MPDA 3EVOA 1HLWA 4DUTA 1XIQA 3BBFA 3R9LA 1NHKL 3Q8VA 1BUXA 4CP5A 3GP9A 3PRVA 2NCKL 4S0MA 2HURA 1EHWA 4FKXA 4UOHA 1S59A 3VVTA 3ZTPA 3EICA 1S57A 2B8PA 3FCVA 4ANEA 1NSQA 1NDLA 1JXVA 3GPAA 2VU5A 1NDKA 3ENAA 1PKUA 1HIYA 2AZ3A 3JS9A 1NUEA 4HR2A 1K44A 1UCNA 3L7UA 3G2XA 1NLKL 3EVMA 3ZTSA 1WKLA 4DZ6A 1U8WA 1B99A 4FKYA 2DY9A 1LEOA 5IOLA 3FKBA 3ZTRA 3VGSA 1NB2A 1ZS6A 3ELHA 2BX6A 3EVWA 2B8QA 1WKJA 1NPKA 3NGTA 3ZTQA 2DXDA 3B6BA 2CWKA 1NSPA 3FC9A 4WBFA 3EMTA 1KDNA 1NDPA 1WKKA 4UOGA 2DXEA 3BBCA 1W7WA 1MN9A 1NCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BHN A;  2HVE A;  3EM1 A;  2ZUA A;  1LWX A;  5BXI A;  3B54 A;  4C6A A;  1PAE X;  3FBF A;  3DDI A;  4W98 A;  4ANC A;  3FBB A;  1B4S A;  3ETM A;  3NGS A;  3DKD A;  4KPC A;  3NGU A;  4F4A A;  4UOF A;  2BEF A;  2DXF A;  2AZ1 A;  1BE4 A;  2HVD A;  3EJM A;  3Q86 A;  3VGT A;  5CAB A;  4DI6 A;  3BH7 B;  3Q8Y A;  3WX8 A;  1S5Z A;  1XQI A;  1VYA A;  2DYA A;  4EK2 A;  1F3F A;  3Q8U A;  3BBB A;  1F6T A;  1MN7 A;  3PJ9 A;  3BH6 B;  5C7P A;  3ZTO A;  3FBC A;  3Q89 A;  4O0N A;  3VVU A;  3FBE A;  3Q83 A;  4F36 A;  1NDC A;  5CAA A;  4AND A;  3NGR A;  1NSK L;  3EE3 A;  1HHQ A;  3VGV A;  3FCW A;  4ENO A;  3VGU A;  3MPD A;  3EVO A;  1HLW A;  4DUT A;  1XIQ A;  3BBF A;  3R9L A;  1NHK L;  3Q8V A;  1BUX A;  4CP5 A;  3GP9 A;  3PRV A;  2NCK L;  4S0M A;  2HUR A;  1EHW A;  4FKX A;  4UOH A;  1S59 A;  3VVT A;  3ZTP A;  3EIC A;  1S57 A;  2B8P A;  3FCV A;  4ANE A;  1NSQ A;  1NDL A;  1JXV A;  3GPA A;  2VU5 A;  1NDK A;  3ENA A;  1PKU A;  1HIY A;  2AZ3 A;  3JS9 A;  1NUE A;  4HR2 A;  1K44 A;  1UCN A;  3L7U A;  3G2X A;  1NLK L;  3EVM A;  3ZTS A;  1WKL A;  4DZ6 A;  1U8W A;  1B99 A;  4FKY A;  2DY9 A;  1LEO A;  5IOL A;  3FKB A;  3ZTR A;  3VGS A;  1NB2 A;  1ZS6 A;  3ELH A;  2BX6 A;  3EVW A;  2B8Q A;  1WKJ A;  1NPK A;  3NGT A;  3ZTQ A;  2DXD A;  3B6B A;  2CWK A;  1NSP A;  3FC9 A;  4WBF A;  3EMT A;  1KDN A;  1NDP A;  1WKK A;  4UOG A;  2DXE A;  3BBC A;  1W7W A;  1MN9 A;  1NCL A; 
#chains in the Genus database with same CATH topology
 3KUE A;  2HVZ A;  1RT3 A;  3EPG A;  1YLX A;  4KY3 A;  4B9M A;  1VK3 A;  4J9L A;  1VBZ A;  3M2V A;  3W63 A;  4LF5 F;  2J0S D;  1QLN A;  2ZH6 A;  2VV5 A;  1UA0 A;  3VGT A;  4HVZ A;  1W2B R;  3AH6 A;  4P7T A;  2CWX A;  1YI2 S;  7FDR A;  2NZ4 A;  4ICL B;  3VWS A;  4PYA A;  1XMQ J;  2OP5 A;  1HNI B;  5CD4 A;  4NYZ A;  1WTF A;  3QJP A;  3EX7 B;  3OLA A;  1HBU A;  2RAQ A;  1NHK L;  2APO A;  4L3K A;  3PM9 A;  2WON A;  2WOM B;  3LQV A;  1JLQ B;  1F0X A;  5LJ5 Y;  1HWI A;  4OHZ A;  2AJ2 A;  3DOL B;  1VRU B;  3TAM B;  1G3O A;  2R7Q A;  2DPI A;  1HYS B;  1X4G A;  4BWJ A;  4O4R A;  1XR6 A;  2QMU B;  2VQE F;  3T1Y F;  4Q0B B;  1RWP B;  3NGT A;  5B0E A;  2WVE A;  3MGJ A;  3M8W A;  3AA9 A;  1QAI A;  2W01 A;  1JLE B;  1WWH A;  2Q1L A;  3SSQ A;  4N56 A;  3V81 B;  1RBA A;  4OYZ A;  2WCX A;  4IDK B;  2A1B A;  1R0A B;  2QLF B;  4Q45 A;  3KK1 A;  3OL7 A;  3RG6 A;  3CPW R;  2CPZ A;  3KLF A;  2KRR A;  3ZXW A;  4MIW A;  4G6V B;  3HHN B;  1MSW D;  2YKN A;  4QCL A;  4WE1 A;  1N33 J;  1VRT B;  3RRG A;  5ETN A;  2ZHB A;  1H38 A;  2ZZT A;  1RTI B;  1LW0 B;  1A9N B;  4M95 A;  3KLE B;  5GAE U;  4I2P A;  4PUO A;  3ZZT A;  5HL7 Q;  4KRW A;  5GMK a;  3E3X A;  3GG1 A;  5K8M A;  4RPF A;  2VBW A;  3CVK A;  3OL6 A;  3B78 A;  2F7V A;  3DFE A;  4X4Q A;  2ZH2 A;  2RDD A;  2KL8 A;  4FVM A;  1FRL A;  3K5N A;  2GW8 A;  1IN0 A;  2QLX A;  2FJE B;  3GR0 A;  4ZVE A;  4JI8 J;  2IAJ B;  3IAM 9;  3HX9 A;  2QZ8 A;  1FDA A;  2FY8 A;  5KG4 A;  1R8B A;  3KOA A;  2CAJ A;  4X62 F;  3KMQ A;  3W3S A;  1TL5 A;  3MFH A;  3CE8 A;  4N76 A;  5DQI A;  2J9E A;  5J2N B;  1FDN A;  4QR0 A;  1VQK S;  4Q2L A;  1S1U A;  5K8O A;  1VQ4 S;  1RT5 B;  1FO1 A;  1JLF A;  2GO8 A;  3RB0 A;  4F4W A;  2DH9 A;  3RAX A;  4V1A k;  2C2D A;  4HT7 A;  3RTV A;  5KT3 A;  1GXT A;  2MB0 B;  4ZP9 A;  5DZ7 A;  3FSI A;  1VCT A;  4EBD A;  3NNC A;  2ILY A;  1T9T A;  3C14 B;  1SJ3 P;  2HHT A;  2CPE A;  4YB6 A;  1S59 A;  2BXJ A;  2GQQ A;  2IMW P;  4IFV B;  1Q8K A;  2DGT A;  2ZWO A;  2VU5 A;  2Y8W A;  3C6T A;  4OZ1 A;  2XLJ A;  1KQF B;  1VIX A;  5KOW A;  2CG4 A;  5DDQ C;  5IC4 B;  2C2O B;  1UFW A;  2K06 A;  3W8G A;  3QGI A;  2Q6B A;  3QWU A;  2MY8 A;  4C0B A;  2FJD B;  3FDS A;  1SQG A;  2ROG A;  3P5B P;  1MRO B;  3EDQ B;  3OHB A;  1QVF R;  5CZX A;  2EK1 A;  4ILL A;  1B4S A;  5C2G A;  2A6O A;  3HVA A;  2W7A A;  1KRP A;  5LMN F;  4M8L A;  2PMW A;  2VFR A;  3HKW A;  3ZNJ 1;  4YB1 P;  1HPZ A;  3PX0 A;  4OMF G;  2A2C A;  4DV5 J;  2X51 A;  3MR5 A;  1IUJ A;  4L73 A;  2VBY A;  1WF2 A;  1JLQ A;  3Q8U A;  4ZPB A;  3QSI A;  4Y2K A;  3J7Z 5;  7AT1 B;  4JV5 F;  4PAB A;  1P6T A;  1UEV A;  1DAR A;  3FBE A;  3CJ3 A;  4Q2M A;  4ELU A;  4CRJ A;  1GQE A;  5B0A A;  3QIP B;  1RT1 A;  2V4Q A;  4CQ1 A;  4NOH A;  2ZJQ Q;  4FF1 A;  3I0S A;  1S1V A;  2IPO B;  3PJX A;  4I2Q A;  2XS7 A;  1TFY A;  4EZ6 A;  2CJQ A;  2QG9 B;  3C6U B;  5C24 A;  2K7J A;  1DFD A;  3QID A;  4USJ C;  1D8Z A;  1S48 A;  1H6K X;  3DLK B;  1IBL F;  2J7K A;  2UUC F;  4G3I A;  3NBP A;  3EVW A;  2HW3 A;  2EFP A;  4OV6 A;  1KP6 A;  4NCB A;  4DF8 A;  1B0V A;  5F9N A;  2YQ3 A;  5KG5 A;  2GQ2 A;  1HL6 A;  3IM9 A;  2LFV A;  1S1W B;  3O6Q A;  5I42 B;  3AHP A;  3U7J A;  1X4C A;  4CLU A;  2RVJ A;  2MKS A;  4ELV A;  3TAN A;  2BQ3 A;  2IAJ A;  1UFK A;  5FLX U;  1R31 A;  4AND A;  2CPF A;  3FRZ A;  3LA0 A;  3G6V A;  1ZA2 B;  3DM2 B;  3HDS A;  4L75 A;  5GAD I;  3HHL C;  4M5N A;  1DUR A;  1SC4 B;  3BQ1 A;  2YKP A;  2EWH A;  1X5S A;  3NGD A;  3N79 A;  5D77 A;  1RT4 A;  3H2L A;  2DHH A;  1X60 A;  3MEC B;  1VHI A;  3AJD A;  4FF3 A;  2P9E A;  3WHI A;  3NCP A;  5AXN A;  1JX4 A;  2Z0G A;  2RE1 A;  3RB6 A;  1S97 A;  4DSE A;  4ETZ A;  2NXC A;  2MHE A;  4NL5 A;  4PG5 A;  2XYG B;  3T9Z A;  1RAE B;  1NK5 A;  4OQJ A;  3DYA B;  4WZM A;  5IM0 B;  4DV6 J;  3AD8 C;  4KPC A;  2W9C A;  5DO2 A;  3IFE A;  3ITH B;  5EN1 A;  1WOS A;  4PXC A;  1F5C A;  1T95 A;  1RAF B;  2YWH A;  2HYI B;  3A8E A;  4MIB A;  5D4P A;  1C4A A;  1ULR A;  4G1Q A;  5GVQ A;  2G1H A;  3H42 A;  4O3R A;  5KFU A;  5DLF A;  3F73 A;  2R4F A;  4G1I A;  5E33 A;  1YRT A;  3QPI A;  1OY9 A;  2J8S A;  4DV3 F;  4ENO A;  2MJU A;  1O0P A;  4FN5 A;  5J2Q A;  4OYP A;  3DLE B;  3HHL B;  5ETP A;  3CCQ S;  1DTT B;  1X5P A;  2WAQ D;  1NDL A;  3KLI A;  2L9N A;  1OS5 A;  5BYQ A;  5GAH I;  3B4D A;  4F4Z A;  1FXL A;  2QL9 B;  4A8M P;  3M1V B;  3D6T B;  2RML A;  4UY8 T;  2B0G A;  4OI6 A;  2HWT A;  2OPS B;  4TNO A;  2NR0 A;  3BGF A;  2COL A;  2O67 A;  1G4C A;  1O51 A;  1BQX A;  1AFI A;  2J6T A;  4F0K A;  5KFY A;  1KTV A;  4HHJ A;  2ZE2 A;  5LM7 E;  3IR7 B;  1WG1 A;  3BS9 A;  1YZ6 A;  1FXD A;  2CQB A;  4DR4 F;  4JOU A;  2N3L A;  1HBO B;  1RLC L;  4WTY A;  1T9V A;  3HMJ G;  4YHH F;  2C3P A;  4WII A;  2CJX B;  3SCJ E;  4MK7 A;  2WW4 A;  2YNH A;  1RHJ B;  1RB0 A;  2E5I A;  4OI3 A;  3BO3 A;  3T6B A;  1CG2 A;  1OY6 A;  2V8D A;  3V6D A;  4NLP A;  3MTK A;  4KBI A;  2I8E A;  3A3N B;  1NZ8 A;  4PQU B;  5HN0 A;  1ZPW X;  5HK4 A;  1N56 A;  4QBU A;  2NUH A;  3H59 A;  3G86 A;  1WHX A;  1AT1 B;  3QO9 A;  4HAC A;  1UVK A;  2G1D A;  4UUW A;  5K8N A;  4O44 A;  1I94 J;  2DXD A;  4I6Y A;  2WB1 D;  4I69 A;  5K14 A;  1E6V A;  4ID8 A;  5EWF A;  2HBY B;  1CJT A;  1JXL A;  1MW7 A;  1C0U B;  4DCO B;  2FJB B;  2B56 A;  1C0T B;  1S6P B;  1UKU A;  5GAG I;  4NMX A;  4IFY B;  3UE2 A;  4JI6 J;  4AD6 A;  4ZPA A;  3P8B B;  1SVD A;  4TYA A;  4RUH A;  4RBV A;  2OEK A;  3CW2 C;  4A8X A;  3C46 A;  2J6U A;  4ZVO B;  1Q5V A;  4C8Y A;  1LWE B;  1FK9 B;  3DNC A;  5E3C A;  4DSK A;  3QMQ A;  3QRQ A;  2NLW A;  3TQE A;  3AOA A;  5M2U A;  2IM2 A;  2G2Y A;  2F3J A;  3MED B;  2AEF A;  2AJF E;  1LKZ A;  1PG5 B;  2H65 B;  2WBM A;  2Z2L A;  4B3O B;  5C25 A;  2AYB A;  4X64 J;  4TLR A;  5HVG A;  1FFW B;  3AOC A;  2VPZ B;  5AE3 A;  4A8W A;  3KUG A;  3ENV A;  1W7W A;  2DKO B;  4YR0 A;  1M5V C;  2R2U A;  1IKX B;  4CYU A;  3FBF A;  2LXF A;  3M2R B;  4EMD A;  4OYA A;  3UW1 A;  4QIF A;  4CLW A;  1IWG A;  1FWP A;  4F0H A;  1TL1 B;  2ZBC A;  1BC6 A;  2DEI A;  1XNQ F;  1YJR A;  2ZOG A;  3SYZ A;  2ZH9 A;  3OR2 B;  4KPY A;  2BZ2 A;  1MN7 A;  1KQG B;  2XZT B;  2QRR A;  3EGN A;  4HI1 A;  5DM7 Q;  1QDU B;  3BGR B;  2DBB A;  5AXL A;  4JI0 J;  3ISN C;  4F4Y A;  3GWC A;  5H9F J;  3EZ5 A;  4WP3 A;  4B3T F;  1UW4 A;  2M8H A;  3TZZ A;  4DR5 J;  5HMW A;  2WVB A;  3ZTP A;  3C66 A;  2C3U A;  5BYS A;  3NAH A;  1UVL A;  3THT A;  2IRY A;  4WP8 A;  2FLP A;  3TUP A;  5KFM A;  1RUS A;  5A8R A;  3DRR B;  4A4J A;  4IH7 A;  2QL5 B;  4GRS A;  3M9O B;  1KC8 T;  1LQ9 A;  4KH0 B;  4PXE A;  1V3R A;  1S1X B;  1U47 A;  2E9R X;  2XCA A;  3BKU A;  1SJ1 A;  2EC0 A;  4WKR A;  3T41 A;  3L7P A;  2B4O A;  3EJM A;  1W25 A;  4NCA A;  4DX8 H;  2D3Z A;  3KNG A;  1OYE A;  4EO8 A;  3IN5 A;  5K20 B;  1ZM3 A;  2E44 A;  3I6P A;  4YS2 A;  1EP4 A;  1QTN B;  3LP1 B;  3KLH B;  3OW2 R;  4DSJ A;  4M5I A;  5LSR A;  3OJU A;  3SDE A;  2XGP A;  1XJW B;  2V67 A;  5HLF A;  1NPP A;  4F50 A;  1U02 A;  2GAH C;  2D9P A;  2XSJ B;  2YNF B;  4TYB A;  2H4Y B;  1PCA A;  2OEL A;  3GE9 A;  3G87 A;  4DMZ A;  4Y2A A;  2E1M C;  3I31 A;  2DNM A;  4PG6 A;  2HFN A;  2FVR A;  3OT9 A;  1JMT A;  1S6P A;  1VLO A;  3UFC X;  5IV4 A;  3ISZ A;  2BYC A;  1TKZ A;  3H5Y A;  2XEX A;  5AXM A;  2HQC A;  4WK3 A;  1RA6 A;  4NML A;  2RRB A;  1PC4 A;  3DHW C;  2CNO B;  1V9O A;  4Y65 A;  1QE1 A;  1N54 B;  1FWK A;  4CO1 A;  1YGY A;  1IVZ A;  5KFF A;  5CCM A;  2OHD A;  1X8D A;  5E3A A;  3CJT A;  4RW9 A;  5CAB A;  3QZ8 A;  2HFO A;  3WX8 A;  4JI1 F;  2LXI A;  2I2Y A;  4IO9 Q;  1F6T A;  1P9Y A;  3WZ0 A;  1HBM A;  4LF9 F;  1FRX A;  2ZHA A;  4URQ U;  3MM9 A;  1HI1 A;  4H4M B;  2WW8 A;  1K73 T;  4J7C A;  4ZJQ A;  4NEZ A;  3BSN A;  2RQ4 A;  3PDN A;  2HIQ A;  2VDH A;  4DLG A;  2R8H A;  4GKK F;  5HSP A;  4DR1 F;  2HFS A;  2O1P A;  4ATN A;  1LK5 A;  3DLG B;  3PYE A;  3MOZ A;  4AUK A;  5LMU F;  4URS A;  2CQP A;  1SBR A;  4IOB A;  3CWJ A;  1ROF A;  3EGV A;  1DLO A;  1BQM B;  1SKU B;  2MHN A;  1HQE B;  2WVC A;  4B17 A;  1GX5 A;  4DR3 F;  5KTQ A;  2W25 A;  5BJR A;  1VQ6 S;  2VPY B;  4FF4 A;  1U09 A;  1IR0 A;  1UJ4 A;  1AA1 B;  1M90 T;  3BJY A;  2OEJ A;  4LJM A;  2P8I A;  2VKZ G;  1S7H A;  1CC7 A;  2PMH A;  3ETM A;  3LP0 B;  3T1Y J;  3H2U B;  4I56 A;  4LRD A;  2ABY A;  3NOG A;  3LP2 B;  4N77 A;  1SCJ B;  3FQK A;  2PFF B;  1UMJ A;  2RH3 A;  4HDH A;  3DRR A;  2IMO A;  1X7V A;  1N52 B;  5HMX A;  4KHP F;  3GIR A;  4OI0 A;  1FNO A;  2AJQ A;  4ZVS B;  1U4B A;  2EFV A;  1FXR A;  3O8W A;  4LFA F;  1NSQ A;  2GVD B;  5AJ3 J;  1BWE A;  2R7V A;  3IWN C;  1VIS A;  3PW5 A;  4WZQ A;  2MQP A;  2NUU G;  4DX7 A;  2M88 A;  4ZKA A;  1FKP A;  2B9E A;  3BR9 A;  3ELH A;  4ILM A;  4RUC A;  3NEK A;  1Q86 T;  2C42 A;  3UD3 P;  3KLH A;  1FEE A;  4DSL A;  4XIU A;  4ZIV A;  2OPQ B;  1DTQ A;  4EZ9 A;  4Y00 A;  4LFC F;  2B9W A;  4GVB B;  1C1B A;  1I51 B;  2UUB F;  3FSY A;  1VFJ A;  1JJ4 A;  5J1N A;  2W8L A;  5B7W A;  2YNG B;  3IRX B;  2FJW A;  3K59 A;  4CZC A;  3LAK A;  4X4R A;  1O8B A;  3G6Y A;  3JB9 k;  2YPY A;  2ZH3 A;  2HGL A;  2DIV A;  1UA1 A;  4JI4 F;  1RE1 B;  1RWW B;  4F26 A;  3M6V A;  2NZC A;  1KHW A;  3M8Q A;  3ET6 B;  5CQG A;  2MKH A;  1ZM9 A;  2FZC B;  3M32 A;  4XTT A;  3R5B A;  1KON A;  3BM7 A;  3LPE A;  3H25 A;  1EET B;  2QIF A;  2Z4P A;  4IOA Q;  1UVN A;  3A12 A;  1GT8 A;  3SV3 A;  3CSK A;  3PO5 A;  4IYQ A;  3O44 A;  1NKB A;  2VKR A;  1Q16 B;  4NXN F;  2H5I B;  1ZAX A;  1PSD A;  2FHO B;  2GJ2 A;  3A13 A;  3EMT A;  2QA4 S;  2CQ0 A;  3Q23 A;  2IFX A;  1S9E A;  2CPY A;  3OFH A;  4JUZ A;  1R27 B;  1GH8 A;  1T02 A;  2NXU A;  3EDR B;  4DU7 A;  3PV8 A;  4OZJ A;  3PW2 A;  2CNN B;  3GFX A;  4U9R A;  5KOX A;  4ES2 A;  1LW2 A;  2RJZ A;  4UT4 A;  1PAU B;  4KO0 B;  4JI5 F;  1X5T A;  4X2B A;  2M3D A;  3AT1 B;  3LAM A;  3PX4 A;  1RK8 A;  3SV4 A;  1N5S A;  4HT5 A;  3NGR A;  4IG3 A;  3OTO J;  2FC8 A;  2Y9H A;  2HRY A;  3D28 A;  2YKM B;  2CUY A;  5L1K A;  4C8Z A;  3HVT A;  3R27 A;  4DX5 A;  2CQI A;  2V2K A;  1C2P A;  4JI2 F;  4ZA1 A;  2OTL S;  1HBN A;  3GU0 A;  3TJA A;  5EHH A;  1JKH B;  1JIH A;  1TL4 A;  2C1E B;  3OVA A;  1VMB A;  1HWK A;  3Q2S C;  2HGM A;  5E3Q A;  2LEP A;  5J2P B;  1RSC A;  4CO4 A;  3QSY B;  1V3Z A;  2CQH A;  3R97 A;  1IKY A;  4B3S F;  4KGK A;  2ZKU A;  5CYJ A;  4NLV A;  3R2C J;  4D3H A;  4UOG A;  3V6J A;  4N8O A;  3CO0 P;  2E1C A;  3D0G E;  5E3R A;  3D5M A;  4KHR A;  3MPU B;  2JFD A;  3KG0 A;  2K1R B;  3IS9 B;  3GYG A;  3BSO A;  2ALZ A;  2XQC A;  4F0M A;  4NE9 C;  5CYM A;  4E0D A;  4AXJ A;  3OUY A;  3HD1 A;  4P2M A;  3G9C A;  3VAI A;  1DY3 A;  2ZH4 A;  2CPH A;  2QX0 A;  4HI2 A;  3I56 S;  4OLP A;  1MMN A;  1N32 J;  4LF6 F;  1FRJ A;  4AQY J;  2GVZ B;  5D3G A;  4E2F B;  3RAM A;  1S10 A;  1SB6 A;  3N9U C;  4GVB A;  5KFN A;  1VC6 A;  1RAJ A;  1QSY A;  2BDP A;  4DPO A;  3QRR A;  2RRA A;  3MMB A;  1X4A A;  1RT2 B;  2CIM A;  2B8Q A;  4IQM A;  2YNG A;  3UDE A;  1TKX A;  4FPR A;  2OAU A;  2HNZ A;  1N34 J;  1X4F A;  1N5T A;  1RIS A;  2H3E B;  1ARO P;  2EKN A;  4J9O A;  3U1N A;  4NEY A;  2W9B B;  3MAQ A;  4ZIT A;  5KFJ A;  1AUD A;  1RAH B;  3HFV A;  4DLE A;  2G0J A;  3N5B A;  4OX7 A;  2ZBI A;  3SQG A;  4K8R A;  2AMC B;  2HZC A;  1F3F A;  2M70 A;  3CJ0 A;  3BDP A;  2R7X A;  4AL5 A;  4FBU A;  2BW2 A;  3VHQ A;  4QYR A;  3J81 j;  4ERD A;  4DL4 A;  4XDC A;  4A47 A;  1L3T A;  2GV1 A;  3BQ2 A;  3HVW A;  2UUW A;  3G8Q A;  3HP6 A;  5KFR A;  4USK A;  4B9N A;  4TY8 B;  1PJ5 A;  4UY8 5;  4A46 A;  1SJR A;  2ROP A;  1HNX J;  2OFH X;  4P6Q A;  2XS5 A;  4C4W A;  3ZZR A;  1GEH A;  1WEY A;  3OR1 B;  4ID5 A;  3PIO Q;  2X1B A;  4FKY A;  3I0R A;  4F25 A;  5KT5 A;  3VR1 A;  1D3W A;  1U1N A;  1R89 A;  1FER A;  2F4V F;  4ELT A;  3E8O A;  2YWK A;  3SCL E;  5CA5 A;  3QAU A;  4WU3 A;  4F02 A;  1PYT A;  3M7V A;  1UWA A;  1U6Z A;  3TW0 A;  3S1T A;  4USV A;  3UR0 A;  1QUP A;  2AZ1 A;  3QJL A;  2RF2 B;  3FMB A;  2VPX B;  1XR5 A;  4HEA 9;  1X4D A;  4B02 A;  1RAB B;  2HND B;  1LWC A;  2RS2 A;  1A6L A;  4L74 A;  2IVY A;  5IZH A;  3KDO A;  5J2P A;  2I38 A;  1WC3 A;  4DV0 F;  2J7U A;  3FCW A;  4R25 A;  3O3L A;  2GMH A;  4E98 A;  3K7R A;  4PAA A;  3OL9 A;  3TVZ A;  5F8I A;  4XDD A;  1VLY A;  2AKW B;  4PR6 A;  5ETT A;  2L9W A;  3W1Y C;  2QO3 A;  2XGQ A;  1TUV A;  3GON A;  2CKW A;  3MM5 A;  2KG0 A;  2JH3 A;  2XI2 A;  2F1F A;  1X4E A;  4X4T A;  1SIW B;  3B6B A;  5B0F A;  1F5A A;  3D6M B;  1FNM A;  4LQ3 A;  3HKZ D;  2IA0 A;  2V6A A;  2ZWP A;  3FBB A;  2HLT A;  2QT7 A;  5DQG A;  1S4E A;  3MR7 A;  4UF4 A;  2AGO A;  3T5K A;  3RZA A;  4C3K A;  4F8R A;  4TY9 A;  4CTA A;  5GAE I;  4I64 A;  5HRO A;  4NZ7 A;  4WFA Q;  2XNR A;  3M05 A;  3VGV A;  3I9V 9;  2DD8 S;  4MFB A;  3PNI A;  5F3Z A;  2HRU A;  3NS5 A;  1M5H A;  5HP1 B;  3RR8 A;  4ZMM A;  1QSL A;  2GHP A;  2Q43 A;  2JEJ A;  1IKV B;  4WK1 A;  3KWM A;  1HFE L;  1OMS A;  4OZ2 A;  2W9B A;  3GIK A;  5HI7 A;  4C9D A;  4IQX A;  3SSS A;  3D3B J;  3PY8 A;  1JQG A;  5E2Q A;  4WPA A;  3CJS A;  1N33 F;  2AYE A;  3JTO A;  3FCH A;  4QYZ K;  3GQC A;  4B9L A;  4LF2 A;  3I82 A;  4P9S A;  2QSW A;  3OV7 A;  3Q8P B;  1WKK A;  3L3C A;  3P4U B;  3HSD A;  2HWH A;  1NJZ A;  1YX2 A;  5F3T A;  1RWX B;  3UR3 C;  2X1G A;  4DG1 B;  5A2Q U;  3N0V A;  4FYD A;  3FZB A;  2M0G B;  1TU0 B;  3HFZ B;  4KV8 B;  5KFC A;  4OIX A;  3DOM B;  2B5J B;  2AJ4 A;  4YY3 J;  1JJ2 R;  3MEE B;  3KJV A;  3UN5 A;  3ZTO A;  2XY7 A;  4OZN A;  2VIH A;  2V0N A;  3R5C A;  3UCZ P;  4OX8 A;  4V19 X;  2H9Z A;  1XMO J;  3MXH P;  4DUT A;  2DT9 A;  2NCK L;  3HHE A;  1G1X A;  2PT0 A;  1KHV A;  2E5G A;  2WRM A;  1TL7 A;  3A8K A;  4WKY A;  1XMB A;  2AGP A;  3AXM A;  2QJ3 A;  4RW4 B;  4YR3 A;  4ECQ A;  2ZIT A;  3NWR A;  5IT9 U;  2IVM A;  4X4U A;  5KT7 A;  2B4V A;  3O1L A;  3NNA A;  1LXN A;  2KO1 A;  1M1G A;  2HVE A;  3S01 A;  4YME A;  3AB4 B;  2OPR A;  3KK2 B;  2HMI B;  2DR6 A;  2RT3 A;  2BOA A;  4DQI A;  1S6O A;  1X0F A;  4LSN B;  4PWU A;  1VBK A;  2SXL A;  1XBW A;  1GTH A;  1R0C B;  2EFN A;  2BBE A;  5ETK A;  3I87 A;  1TK8 A;  2QYC A;  4QWC A;  1WC4 A;  1PGZ A;  4DR2 J;  3GP9 A;  3BPS P;  3M30 A;  2MKY A;  2CJB A;  2N7Y A;  2VFV A;  2XSF A;  4DV5 F;  3AJ1 A;  4TVA B;  4Q5V A;  1RTH B;  2E9T A;  3HHL D;  1RGV A;  2YQ0 A;  5I3Q A;  4NLT A;  3GV5 B;  4NA1 A;  2WVD A;  3LO3 A;  4K50 A;  3LUY A;  1EAY C;  1CPZ A;  1YRX A;  3MMC A;  2VG5 B;  3Q8S B;  2BR0 A;  3GFH A;  5B09 A;  4QW8 A;  5HP1 A;  2C2Z B;  5A2Q Y;  2EK6 A;  2VF3 A;  1WTB A;  2P6T A;  5IQQ A;  1JLC B;  2RHS B;  2DGU A;  1G2E A;  2AV5 A;  3UN2 A;  1OIA A;  2F5G A;  2GX8 A;  2UXB J;  1VQY A;  3QFW A;  5HJY A;  1NDC A;  2ZD1 A;  4M94 A;  4DN0 A;  2OLW A;  2CPI A;  4K0K F;  1VGY A;  3TO8 A;  1L3U A;  4TKT A;  4LF1 A;  5F8L A;  1CVJ A;  1S1T A;  1KOO A;  2X3D A;  5A8K A;  1OWX A;  2VQF J;  1F1B B;  3UD4 P;  3PEJ A;  2J76 E;  3MD3 A;  3GB0 A;  4PWW A;  2JEG A;  3BQ0 A;  3GJT B;  2KFZ A;  2B5J A;  3US5 A;  4DR1 J;  5IT9 Y;  3TUJ C;  3PXG a;  4AL6 A;  4ZLP A;  1DRZ A;  1WJ9 A;  2MZJ A;  3PTW A;  1UJ5 A;  4X4V A;  3ULH A;  3HXM A;  4K5R A;  4Z37 A;  4X4N A;  5L8R C;  2W2O P;  3MM8 B;  4N7T A;  5AE1 A;  2BE9 B;  2UZA A;  3VVU A;  1OQ6 A;  4I7F B;  4A8Y A;  3TRG A;  4NA2 A;  2FLO A;  5JVH Q;  1K8A T;  4RNH A;  1R8P A;  3TAR A;  4DPX A;  3H40 A;  4OX9 J;  3W2W B;  1RWU A;  2V94 A;  2K8G A;  2J0Q D;  2VL1 A;  3IGN A;  1RWN B;  3I55 S;  1YKW A;  3L4B C;  1EJ7 L;  3ENA A;  4NA3 A;  5H9F K;  3QLH A;  3DRP A;  3OPK A;  3ZZP A;  2HMI A;  2PEH A;  4LSN A;  1LWF A;  3GCX P;  2ZFH A;  4CO5 A;  1Q95 G;  3NGK A;  1MMD A;  2ZVI A;  1VBY A;  4OX6 A;  4ECV A;  2HAI A;  1QVG R;  3R5D A;  1VJQ A;  1FRI A;  4EYI B;  2DNR A;  1YTY A;  4NYO A;  2Z2Z A;  3EM1 A;  3P45 B;  5HMZ A;  4A8O A;  4U8Y A;  1VQO S;  4K59 A;  4DN9 A;  2AHO B;  4C11 A;  1TL3 A;  1ZA1 B;  2RRN A;  1J5O B;  5IWA J;  5FDL A;  5D4L A;  2ZZN A;  5LT5 A;  1HMV B;  2QLB B;  4TU8 A;  2D7S A;  1OQ3 A;  4RW6 B;  3CJ5 A;  3QT6 A;  2YX1 A;  3BO4 A;  1N6Q B;  4LFC J;  3MTJ A;  1X0P A;  1ZYQ A;  1NND A;  1JXE A;  3EE3 A;  1SPB P;  3A1Y G;  2HS4 A;  2J8A A;  2IC3 B;  1NK8 A;  4Y34 A;  1H74 A;  1T9U A;  4JYA J;  3KHH A;  1FJG J;  2HVI A;  2KJV A;  1B64 A;  1SUQ B;  3EWG A;  1SKW A;  4HR2 A;  2KDO A;  1KBR A;  5BR8 J;  3M9N B;  5A0Y B;  5KFG A;  1T0T V;  2WZ1 A;  4KJI A;  4QIW D;  1DQ9 A;  4DBQ A;  3FC9 A;  2MGZ B;  2HFU A;  3RGI A;  4RX6 A;  3M2U B;  3R1H A;  5IS2 A;  3IR6 B;  1LWX A;  1S99 A;  3D4J A;  3H5X A;  1TKD A;  2ZH8 A;  2EVZ A;  4DQR A;  2E5L J;  5HQM A;  4K4S A;  1N88 A;  2XMM A;  3W5Y A;  1NK0 A;  1C1C B;  2R8K A;  3N28 A;  4ZCL A;  4RWX A;  1IR1 A;  1I94 F;  1VK8 A;  1GMW A;  2FHJ D;  2WK4 A;  2U2F A;  4DR6 F;  1Q0N A;  1SL1 A;  2ZZM A;  5KG6 A;  4KHM A;  2ZJP Q;  2ZH7 A;  3ISN D;  1S4F A;  4DSF A;  2IIH A;  2AX1 A;  4JI6 F;  3C16 B;  1KFS A;  1Y3J A;  2QFI A;  1XER A;  3JXO A;  1B7Y B;  1JLA B;  5DET A;  2NXE A;  1FDB A;  3O5T B;  2DNG A;  2LVW A;  4RU9 A;  4KGV B;  2XY6 A;  1S0O A;  1HD1 A;  4D3G A;  3G82 B;  2XHC A;  4DEZ A;  5ADZ A;  3FNN A;  4H54 A;  1WUU A;  3THV A;  1NSP A;  4JI2 J;  2BAB A;  2ALY B;  5HBM A;  1CJV B;  3NL0 A;  4NLX A;  5CH7 B;  3PVX A;  1HI0 P;  4H4K A;  5F8G A;  4ANC A;  4OYO A;  2MQL A;  1U24 A;  4F3Q A;  1RHU B;  1JWW A;  3W2W A;  2YXL A;  3IBC B;  4WFZ A;  1RT3 B;  1F5B A;  3BN4 A;  1XQI A;  1Q53 A;  1VYA A;  2R7U A;  3W7B A;  4CNY A;  1NB7 A;  3M2V B;  2AYG A;  2EFQ A;  1FFS B;  4X64 F;  3MPY A;  4M5G A;  2DGX A;  3DRY A;  4BLG A;  4W92 B;  1QM9 A;  3RJM B;  3CIZ A;  1U25 A;  3UVJ A;  5GME A;  4PG8 A;  1E6Y A;  1XIQ A;  3UPF A;  4P72 A;  4URG A;  3DLJ A;  4C8M A;  1UEK A;  1Q8I A;  2W1B A;  3K5O A;  2KM8 C;  4E8U A;  4ANE A;  3EZO A;  5D0E A;  2QLJ B;  2JWN A;  2MLX A;  4AFF A;  1HBU B;  1H2V Z;  1J5O A;  1N4L A;  2WON B;  3ZTS A;  1TR0 A;  2MSS A;  2J6S A;  2V34 A;  4LF6 J;  1IBC B;  2DVI A;  2H5J B;  2HHW A;  1JK9 B;  2FIU A;  1S6Q A;  2VOP A;  3DI6 A;  5CYQ A;  4OYM A;  2DCU B;  4LBI A;  4ALZ A;  2J0X A;  3VAM A;  4P52 A;  4FYX B;  3DXB A;  3KHR A;  1K0V A;  1TUW A;  3IWL A;  2OH2 A;  3CCJ S;  3CCS S;  2LQ8 A;  1VR6 A;  1NAQ A;  2BM1 A;  4IO1 A;  3KK1 B;  1RTD A;  1KR4 A;  3B82 A;  3KLF B;  3BGO P;  2FPH X;  4GO7 X;  2HPU A;  4WE1 B;  1FX4 A;  2BE2 A;  3NP5 A;  2KM8 B;  2CQ2 A;  2DGQ A;  2XMJ A;  3M2U A;  5F8H A;  3PIP Q;  3FCV A;  1B0T A;  2HAF A;  3FEZ A;  4I2P B;  4PUO B;  4RNO A;  1YWX A;  3D0I E;  3JSB A;  2BE7 D;  2P9C A;  3BEG B;  3EXY A;  3FQL A;  1YBT A;  1T94 A;  2QA1 A;  4RNN A;  2JLG A;  1HR0 J;  2JL9 A;  1HNZ J;  1JNZ B;  5KFL A;  2GQC A;  3RB3 A;  5CHC B;  4DUY J;  2JC0 A;  4IKA A;  2ZNZ A;  4JV1 A;  4OZL A;  3MCM A;  3KK3 A;  4NLD A;  5E7O B;  4FNH A;  4LSZ B;  3J7A 1;  1T11 A;  4MK8 A;  1RTJ A;  3CF5 Q;  4WFB Q;  1NXI A;  3I5B A;  2F4V J;  1I6J A;  3OFF A;  3C15 A;  1EAR A;  4GC6 A;  2AX0 A;  4DX6 A;  3GYN A;  1S1U B;  2OPP A;  3GG0 A;  3GLJ A;  5H9E J;  3D3C J;  2CJA A;  1JLF B;  3E01 A;  1BQN A;  2CQ4 A;  4OL8 A;  4ED1 A;  2D74 B;  2I5J A;  2J9D A;  5I3U A;  2FC9 A;  1CC8 A;  2M4M A;  3AY0 A;  3VAH A;  2NRE A;  5E41 A;  1S0M A;  2B6A B;  4NZ6 A;  2MKJ A;  1S57 A;  1RWM B;  1X4H A;  3R3T A;  3BPD A;  2R7T A;  3ILI A;  3D7S B;  3FEX B;  4LQ9 A;  1UW9 A;  3FSX A;  3T5L A;  1DAX A;  2FJA B;  2IVF B;  3C6T B;  4ES3 A;  1GTE A;  4MTP A;  4CLS A;  2B4U A;  1HA1 A;  1NEE A;  2MZQ A;  2VJV A;  2D3U A;  1XTZ A;  3DRS A;  2XO6 A;  3B54 A;  3BB5 A;  2OFG X;  3H5S A;  1ZM2 A;  1HNV A;  3ENW A;  1WF0 A;  4LF4 J;  1VRQ C;  2JRS A;  1YJT A;  1CLF A;  4CO2 A;  3MPV A;  5IT0 A;  2DYA A;  5D6G A;  3AQP A;  2ZBP A;  2BJ9 A;  5C7P A;  1HPZ B;  1BXN A;  3BKF A;  2XI3 A;  2HHV A;  3U1L A;  3BR8 A;  1LOU A;  5ITH A;  1V6H A;  1K1S A;  4LVO P;  1HLW A;  4KFB B;  1NZA A;  1Y5N B;  1RQ0 A;  4B3R J;  2B8P A;  3CDA A;  4EEY A;  1RT1 B;  4NLY A;  3I0S B;  1S1V B;  4I2Q B;  1NUE A;  3H4B A;  4U7U D;  2EFO A;  3KNA A;  1IXK A;  1X9W A;  1CBK A;  4K5S A;  5C24 B;  3LWL A;  2VOD A;  2DJW A;  1VC0 A;  1SV5 A;  4X84 A;  3AOD A;  2JFK A;  1P1L A;  3VZI A;  5BYR A;  1R0B G;  4H4O A;  3NBP B;  3KJF B;  4O3P A;  1MN9 A;  4KIA A;  3AD7 C;  4Y6I A;  2BQR A;  5AJ3 F;  3I5A A;  3NGS A;  2VFU A;  1IQZ A;  1PC5 A;  4EI2 A;  4GC7 A;  4CM0 A;  4DS5 A;  5HQ8 A;  4ZDN A;  3ZNU A;  4B9U A;  1GMV A;  3CIM A;  3AXK A;  3HD2 A;  3QGG A;  4UQT A;  1WC6 A;  3OXG A;  3ADA C;  1WDT A;  3PYF A;  5KFP A;  4ECR A;  9RUB A;  1GX6 A;  5KFV A;  3VAJ A;  1CUL A;  4O3Q A;  4R5P A;  4USI A;  3DN9 A;  4OI2 A;  5DZ6 A;  5KFS A;  4HTI A;  1BY9 A;  1NRK A;  2JVO A;  3UI3 A;  5LSO A;  4ECX A;  1RT4 B;  1S72 S;  3WC2 A;  3W5Z A;  2DNO A;  3LH2 S;  2MPU A;  3GZ7 A;  1CJK A;  2DRD A;  3R7N B;  5B0D A;  4DL7 A;  1NO8 A;  2RNE A;  2J0W A;  3S7R A;  3Q24 A;  2B6A A;  1UPP A;  4QIV A;  3ENQ A;  3F41 A;  1L5U A;  2X7I A;  4KGZ B;  3Q86 A;  4CH1 A;  1FKO A;  1YJV A;  2BJ7 A;  4EYH B;  1RT7 A;  3CO9 A;  2WHO A;  4C48 A;  3D68 A;  1EKR A;  1YRU A;  2F40 A;  2W9C B;  4M5M A;  4YDD B;  1QAX A;  2MDA A;  1JLB A;  4WTO B;  1IBK J;  3KMS A;  1H2U X;  2G2O A;  2KZM A;  4G1Q B;  4RW8 A;  5AXK A;  3R5J B;  4NXM F;  4LFB J;  5MAO A;  3UCG A;  4CM2 A;  3IWX A;  4ITS A;  3CB4 A;  4WP9 A;  5IT4 A;  5KT4 A;  2E1A A;  5J2Q B;  2E7W A;  2VFT A;  5HJX A;  2CA9 A;  2HHP A;  1YIT S;  3KLI B;  1U1R A;  5LJ3 Y;  3MAA A;  3OTO F;  3ZTQ A;  1Y0H A;  2ZDO A;  1S12 A;  2MQ8 A;  4QW9 A;  3GJR B;  5C42 A;  4ECU A;  2RHQ B;  1KD1 T;  1OYD A;  4GVL A;  2DIS A;  1U0H A;  3UN3 A;  4OZ0 A;  1OPZ A;  3IR5 B;  4KFB A;  4DFP A;  1FRK A;  2HS3 A;  2BJ8 A;  4J9U E;  3CCZ A;  4KSE B;  3K89 A;  2ZE2 B;  1QD1 A;  4DFJ A;  1TK5 A;  4ZN3 A;  3G6E S;  4PG7 A;  1UJ6 A;  2VH7 A;  2HLU A;  2FTR A;  1MU2 A;  1UFL A;  1N5Y A;  3Q8V A;  4KGM A;  2C2M B;  1KSP A;  4DXL A;  3W5X A;  4JP8 A;  2YNH B;  3T1H J;  5C5J A;  3M4X A;  2OO4 A;  4K0K J;  3V6D B;  1KVJ A;  3LGH A;  5D4O A;  2IJR A;  4LR9 A;  4U95 A;  4O3S A;  3ZTR A;  2JEI A;  4LR7 A;  4U67 Q;  2PN6 A;  4ED0 A;  4ZK7 M;  1F60 B;  1N32 F;  2POK A;  2E1R A;  3QO9 B;  4HAC B;  2OD6 A;  2V8G A;  4O44 B;  4AQY F;  2KB2 A;  4M5L A;  1Q8B A;  3VAK A;  1OY8 A;  2CQC A;  1B3T A;  1NM2 A;  5K14 B;  1TKT A;  4IRK A;  3MEK A;  1E6V B;  3ZZY A;  1Y3K A;  2N7C A;  1CJT B;  2ZOM A;  3CJK A;  3RW7 A;  3MM7 A;  1EQM A;  2ZUG A;  2F9D A;  4LSL A;  1U45 A;  4NPO A;  1WAC A;  5ETQ A;  1UWB A;  4LRC A;  4QYZ J;  1FTR A;  2ZH1 A;  1NSA A;  3H8Y A;  1N34 F;  3DDN A;  4J91 A;  4JI7 J;  5IXU A;  3N4W A;  4USW A;  1Z4U A;  3MPD A;  2L3M A;  3IMQ J;  5KG3 A;  4ZIW A;  2P2C B;  4FS1 A;  3MUM P;  3T9N A;  5T41 A;  2LA6 A;  3RUB L;  1YDL A;  1TV6 A;  4WF9 Q;  4WJB A;  3GFZ A;  1QJH A;  2ZBR A;  2ZVS A;  4L76 A;  4JV0 A;  3M8R A;  4ED5 A;  1IBM J;  3T6J A;  3QGP A;  3SCI E;  2IBK A;  1JB0 C;  2KFY A;  3G71 S;  2IM0 A;  1N5V A;  3SXL A;  2HBR B;  2M8D B;  2ASL A;  3PW7 A;  4KB7 A;  2V4R A;  4UTG A;  4UOC A;  4BBY A;  4ZVH A;  2DIU A;  5C25 B;  4Z2X A;  1KNZ A;  1N48 A;  2B51 A;  2QEX S;  2HHS A;  1HQU A;  4KKO A;  3JYT A;  3OTB A;  4CO3 A;  3HVR A;  1HNX F;  1MWQ A;  4CCH A;  2MQM A;  1RTZ A;  1SJ4 P;  1DZ5 A;  1CJU A;  2QA4 G;  4CYU B;  2EPI A;  4BC7 A;  1VQ7 S;  1FD2 A;  3C8Y A;  1CS4 A;  1OJ4 A;  2A0F B;  3V6K A;  3CCV S;  1NKE A;  5T14 A;  2BJD A;  4PEO A;  2UVW A;  3EYZ A;  4WXO A;  4F36 A;  4PZV A;  1SXL A;  1FNX H;  4UST A;  4MKA A;  2XO7 A;  2UVV A;  1S6U A;  4A8F A;  5HAT A;  2CPJ A;  5DG9 A;  1KWM A;  3BV8 A;  4FKX A;  5JXS A;  3OHA A;  3R2D J;  1Q1K A;  2E7X A;  3IGV A;  3IG1 A;  1JLG A;  1NH8 A;  2C3O A;  4ECY A;  4Q43 A;  2XBP A;  1NKC A;  2VBZ A;  1K0T A;  4NCG A;  2MQN A;  5A8R B;  1BWV A;  2R7O A;  4OI1 A;  3NNH A;  4OLO A;  2AQ4 A;  3MM6 A;  3A8J A;  3MCO A;  3WIV A;  3DGP A;  1YJW S;  4X65 J;  4NI2 A;  3NGU A;  2AGQ A;  5FLX Y;  4J37 A;  4DOZ A;  4MYU A;  5THW A;  3MD1 A;  4ZPD A;  4ECT A;  3DCA A;  2U1A A;  2LQ9 A;  1Q8L A;  3CMA S;  3QT7 A;  1YG0 A;  1YJN S;  2Y0S D;  3TVY A;  1ZTT A;  2X3G A;  1ZAV A;  2IRU A;  4CIO A;  1TUG B;  2GMJ A;  2HRT A;  2MZ1 A;  3FZ2 A;  3SQO P;  2EG2 A;  4HLB A;  5T7L A;  2YNI A;  2VA2 A;  1EP4 B;  4ZS6 A;  1Q7L B;  1Y10 A;  1RCO B;  2J7W A;  5E0O A;  3SDE B;  4UZB A;  1ZPV A;  1ZET A;  1RLD A;  5HLF B;  5C2C A;  1X31 C;  1D0E A;  2HHQ A;  4DR6 J;  1REV B;  4O4G A;  3P96 A;  2V4J A;  2GC8 A;  4RBT A;  2RKI A;  3PG9 A;  4EGL A;  3HF5 A;  3FEY B;  1KLM A;  3RBX A;  2C2K B;  2XZD B;  2CAD A;  3TWZ A;  2VD3 A;  2PA8 D;  1TKZ B;  2MJN A;  3OSN A;  2QFJ A;  2W24 A;  2M52 A;  4I6A A;  1VBX A;  5L38 A;  3M8P A;  3QRP A;  1WOR A;  3MMA B;  4F2S A;  3ETO A;  4DHV A;  4AE5 A;  1QE1 B;  1MWY A;  5JJB A;  4KR0 B;  2LEC A;  2JLF A;  4J90 A;  4USM A;  4UZC A;  2ERR A;  2ACM A;  4HH1 A;  3OFG A;  1XWL A;  3N6M A;  4RW9 B;  4KTQ A;  3CCM S;  2GGP A;  3AQO A;  2JOQ A;  3T3F A;  4RUA A;  1WOO A;  1WEX A;  4DFK A;  1HBM B;  3KLV A;  2D1C A;  3MOJ B;  3MM9 B;  4IR1 A;  3EGW B;  4JI3 J;  4J9Q A;  3JSM A;  2MEW A;  4N5S A;  2A3J A;  1I3O B;  4DR7 J;  1ZZF A;  4K4U A;  1WC1 A;  2GIR A;  4HKQ A;  4YY3 F;  1WKL A;  1R8A A;  4WXW A;  4RJV A;  5F0W A;  3SFG A;  3VAL A;  2HHX A;  5A76 A;  1PJ6 A;  3R7S B;  1DLO B;  5L1I A;  4EUV A;  2J9C A;  1XMO F;  1S0V A;  1S9G A;  5SUH A;  4U6P A;  1TFW A;  1HNW J;  1N36 J;  4XO0 A;  4I6W A;  6FDR A;  2Z57 B;  1RAI B;  2AIR B;  4W4M A;  5I3P A;  2JHE A;  3NS6 A;  5ETL A;  2AEM A;  4DSI A;  1URR A;  3P49 B;  4O0I A;  3RBE A;  2BA9 A;  4IG0 A;  1O6X A;  2Y3Y A;  4FPI A;  2NXN A;  1SKR A;  2HQG A;  1NHV A;  2V68 A;  1NSK L;  3H2V E;  3FFI A;  1PIE A;  3ILL A;  1WD6 A;  4Y2C A;  3OXF A;  2FB0 A;  2DHX A;  3VQT A;  3BSA A;  4CP5 A;  3S8S A;  2DO4 A;  2W2Q P;  1HW8 A;  1SQE A;  2YWG A;  2G0I A;  3HSG A;  1FA0 A;  2OJ3 A;  3MF5 A;  2ZHO A;  5KFE A;  1U1P A;  1HIY A;  3AFG A;  2Y1I A;  3R8Y A;  3P6Y C;  1YJU A;  3V4M A;  3DU6 A;  2OSQ A;  5DDO C;  3Q8Q B;  3J7Y U;  1FKP B;  2AF6 A;  2VC0 A;  1BD6 A;  3KLG B;  3OJS A;  4DR2 F;  4IH5 A;  1NCL A;  2P5V A;  8AT1 B;  3DLL Q;  3I96 A;  2WSF C;  1H0H B;  4PWD A;  2FZG B;  2UV8 A;  5SZT A;  3OTD A;  4IRD A;  4C97 A;  1DTQ B;  3NS7 B;  4DI6 A;  4LBH A;  2QE5 A;  1S5Z A;  4IOC Q;  1T05 A;  3A4T A;  3L7O A;  3TP2 A;  1NK6 A;  1REV A;  2WTF A;  3MR3 A;  1C1B B;  1RAD B;  2F8M A;  3CMQ A;  4FF2 A;  4ZJO A;  3DOK A;  2ILZ A;  4DV4 J;  1EX8 A;  3JQK A;  5HMY A;  4C3M A;  3K5L A;  2KG1 A;  2DR5 A;  1WHV A;  4BCA A;  3M8Q B;  5EUH A;  1D9D A;  2BQU A;  1VQP S;  3L7U A;  3MMA A;  3M32 B;  2UXB F;  1YJ9 S;  1VOM A;  2W2P P;  1YHQ S;  4J9N A;  3GJS B;  4MYT A;  4ZLL A;  2JLE A;  2UVU A;  3H20 A;  2XMV A;  2M9K A;  1NPK A;  3VZH A;  2XMA A;  1ELO A;  2CJK A;  1FVQ A;  2YWE A;  4U96 A;  3G8S A;  2VQF F;  3HHD A;  1WG4 A;  2BUN A;  2VG6 A;  1U1L A;  1S9E B;  3CD6 S;  2BW7 A;  2PI5 A;  1SH2 A;  4K4Z A;  2HVD A;  3HJV A;  4ZP7 A;  1RT6 A;  3N01 A;  1QTM A;  3AD9 C;  4HDG A;  4L3N A;  3QBC A;  1GFW B;  2XYH B;  1LW2 B;  4C0O C;  2HNY A;  4O23 A;  2R2S A;  4OZ5 A;  5EWG A;  4IG3 B;  1EHW A;  3M6X A;  4ZLN A;  5J1E A;  4R8U A;  3POT A;  5A6P A;  3LTO A;  2OMO A;  3A8I A;  3HVT B;  2ASY A;  4TN2 A;  1F3V A;  1HBN B;  4DV1 J;  4RU2 A;  4LMZ A;  1RHR B;  2E1P A;  4QU7 A;  4CLK A;  2Z2M A;  3GMG A;  3TA1 A;  3QJJ A;  4C98 A;  5B0C A;  3LW5 C;  3SI8 A;  4PXD A;  3M8S A;  4OX9 F;  4ZHR A;  1AW0 A;  4UW2 A;  3UCU P;  1IKY B;  2V8V A;  1ZBT A;  3C19 A;  1LK7 A;  3J81 U;  1FE4 A;  3HZE A;  1XEZ A;  2XUL A;  2R2R A;  2CPD A;  4DQP A;  3PR4 A;  2RSQ A;  3J7A N;  1S0N A;  2GCF A;  4QZV B;  3A3O B;  1AZS A;  1T03 A;  2NSC A;  1U49 A;  2LKZ A;  3NCQ A;  5CYM B;  1J5E F;  1H2T Z;  2IM3 A;  1UAW A;  3OUY B;  3MEG A;  4K4T A;  4QPX A;  1S76 D;  2EBG A;  3KLG A;  2UXD J;  3I4P A;  5L39 A;  5IWA F;  3FUY A;  3BYR A;  5L1J A;  2XY5 A;  4RR5 A;  1SC3 B;  2XYP B;  5D3G B;  3FVY A;  1ACM B;  1KN6 A;  4ER8 A;  4DDF A;  3SCK E;  2H51 B;  3D1H A;  5HQL A;  3KFW X;  3EUN A;  4BS2 A;  4B3M J;  3MMB B;  4X4S A;  4YQW A;  3GV8 B;  1TK0 A;  1KVK A;  2ZUA A;  1TKX B;  3DDI A;  2NPI A;  4JYA F;  5B08 A;  1FJG F;  2BKP A;  2OD4 A;  1HHT P;  2QN6 B;  2HNZ B;  2JNJ A;  3PRD A;  1RJJ A;  4C2M A;  2QLW A;  5BR8 F;  1KQS R;  1RAA B;  2UUT A;  4CDI A;  2DH7 A;  2GA7 A;  2CXE A;  2LQ5 A;  2YWW A;  4RLE A;  4DL3 A;  1L3S A;  3SQG B;  1WF1 A;  3DMJ A;  3M8Z A;  4RL1 A;  4A8S A;  2PC6 A;  4L72 B;  2DHA A;  2QL7 B;  1FES A;  2PD1 A;  3RAQ A;  3WX4 A;  1NK9 A;  1DBD A;  2IRX A;  2BRK A;  3CME S;  4CLT A;  1NJX A;  5H9E K;  5H1S V;  2Y1J A;  2E5L F;  2MXY A;  2FJV A;  4F4X A;  2IHR 1;  3IM8 A;  1X4B A;  1D09 B;  1KOH A;  2QYG A;  1NLK L;  1XR7 A;  4Y28 C;  3CCL S;  3GIJ A;  1RP5 A;  4XPE A;  4NXM J;  1RHK B;  1WI6 A;  2EBE A;  4Q8F A;  1U1O A;  3D66 A;  2OML A;  4ID5 B;  1Q82 T;  1Q7Y T;  1AXQ A;  3I0R B;  3NOC A;  4IR9 A;  2RDJ A;  2IYG A;  4FNI A;  2L41 A;  2DGV A;  2HHU A;  2C22 A;  4ICL A;  2D41 A;  4QWB A;  5RUB A;  5KFW A;  3D9B A;  3J81 Y;  4CLL A;  1H98 A;  2X1F A;  3A3P B;  2AW0 A;  1HNI A;  4ZLJ A;  4PPD A;  2IDE A;  3R6L B;  2UUA J;  2KT2 A;  2F8E X;  4A8K A;  4PXB A;  4DV7 F;  1S49 A;  2ZC4 A;  3W62 A;  2HS0 A;  1RWV B;  4J9S A;  4ZCK A;  4I4B A;  3RRK A;  2WOM A;  1LWC B;  1S7I A;  1P9Q C;  3QT8 A;  4OHX A;  1GNK A;  2XWX A;  3T5H A;  3DOL A;  4K4Y A;  1DJ0 A;  1VRU A;  4QQB A;  4FS2 A;  3TAM A;  3B4M A;  1HYS A;  3K17 A;  4Q0B A;  3LAN A;  1L3V A;  3O2I A;  4L6V 3;  3W2V B;  2NSB A;  1WHW A;  4WYW A;  3M9M B;  2EKY A;  2H5E A;  1Z2Z A;  4ZPC A;  4F2R A;  5IV3 A;  1JLE A;  1HWJ A;  1U7L A;  1D9F A;  1RYR A;  1PO6 A;  2RB7 A;  2V5H G;  4U8V A;  2R7S A;  3V81 A;  3MM5 B;  1P8G A;  4IDK A;  1R0A A;  3TOQ A;  4EFA C;  2VA3 A;  1EZZ B;  4PRF A;  1KQK A;  3DGV A;  2M2B A;  3BKT A;  3MHY A;  1FT8 A;  1VRT A;  4ZVU B;  2ZBQ A;  2ADC A;  1RTI A;  4LRF A;  1LW0 A;  3NMA A;  3IO1 A;  3KLE A;  4YB7 A;  2WVF A;  1REG X;  2EW9 A;  3CJ8 A;  1RCX B;  2HQ3 A;  3BF4 A;  2I9S A;  4YR2 A;  2LLZ A;  1RA7 A;  5L46 A;  1QY7 A;  1VQS A;  4CTA B;  5HRO B;  2E5H A;  1I1G A;  2YQ1 A;  4UOH A;  2DPJ A;  2B7C B;  4MFB B;  4QR2 A;  3Q0A A;  1I5O B;  3KG1 A;  5D0R A;  3BN7 A;  3CDU A;  2H1Y A;  2MTL A;  1U2F A;  2Z8Q A;  4P7V A;  4DZ6 A;  3KHL A;  3B8H A;  1G7C B;  2E7V A;  1ZS6 A;  4LUB A;  2KXH A;  4GMK A;  3FJ2 A;  5J2N A;  1U26 A;  5DGA A;  2UXC J;  3BDE A;  3BBC A;  1RT5 A;  2XC9 A;  4Q8E A;  1RBO B;  5D4N A;  4KQZ A;  2W2M P;  3N5F A;  3MAH A;  1QUV A;  2FGC A;  1RWK B;  5KFO A;  2QSF A;  3CC2 S;  2R7R A;  5ETO A;  4KGX B;  5ETS A;  1A7G E;  3EGZ A;  4OJ3 A;  3JSY A;  4TU9 A;  3SMZ A;  1HR0 F;  3DC2 A;  1ZOT A;  1HNZ F;  1NK7 A;  1P27 B;  2BV3 A;  3CCE S;  3X1L B;  3PKY A;  3C14 A;  4DUY F;  1RKJ A;  3CJ4 A;  2Z58 B;  3UD5 A;  3H4D A;  5IQ6 A;  1WEL A;  4IFV A;  3KJV B;  2DNQ A;  4MIA A;  2VIC A;  2LU1 A;  2K3I A;  4YDX A;  2OI2 A;  4TQR A;  4CNZ A;  2VBX A;  1URN A;  1WHY A;  1K1Q A;  2ASD A;  2YKQ A;  1JNR B;  3RBD A;  2KYZ A;  4ZPV R;  1MRO A;  4I68 A;  1TL7 B;  5G4D A;  2I6W A;  4DWI A;  1LEO A;  2VZ9 A;  3GJQ B;  3QFH A;  1FI4 A;  2LQB A;  3GTY X;  3CNQ P;  3RYL A;  2W7O A;  2EC2 A;  2DNP A;  2HHH F;  3NKY A;  2XLI A;  1IR2 A;  1ZM4 A;  2QMW A;  2NS1 B;  3QNW B;  3R5G A;  1K47 A;  3DDK A;  2GJI A;  2ZC3 A;  4OZ3 A;  1R8H A;  2OPR B;  2PE8 A;  3QIP A;  3W2V A;  2IA6 A;  5AE2 A;  2KKH A;  4CLZ A;  2RUS A;  4MKV A;  2V2Q A;  2BRL A;  3C6U A;  3HI9 A;  1HWL A;  3AAW B;  2DRB A;  3VQS A;  4LF4 F;  2HUR A;  3KDN A;  3DLK A;  2HG4 A;  2CNK B;  2AP6 A;  5AT1 B;  2D3O R;  2G9O A;  3KJN B;  3TQ1 A;  3KXD A;  3GSD A;  2FUG 9;  3M30 B;  4DL2 A;  4DU8 A;  1XNR J;  3VGS A;  4WIQ A;  2RUG A;  1ZTW A;  2FLN A;  1RZM A;  3LF0 A;  4OYW A;  1TP7 A;  1NPR A;  2LP4 A;  1S1W A;  5I42 A;  4B3R F;  5L1L A;  3MMC B;  4MKY A;  3HPO A;  5KFA A;  2KVQ E;  1U2R A;  3MCS A;  1WSV A;  5MLC V;  3RW6 A;  4X4P A;  3DM2 A;  2ZM6 J;  4ZVT B;  1KKH A;  1U1K A;  1IM6 A;  3IBW A;  3TZW A;  4EWT A;  5HVH A;  2JC1 A;  2GAG C;  1HHQ A;  2DGO A;  5L9N A;  2ZOF A;  4C8O A;  1GXL A;  3H5U A;  2ZD1 B;  4Q44 A;  3MEC A;  2I1R A;  1YBU A;  4EO6 A;  1SJQ A;  2BJE A;  4G1P A;  2GIQ A;  4FP9 A;  2AJ0 A;  2CZ9 A;  1WI8 A;  2IY5 B;  5ETM A;  1S1T B;  2R2T A;  2GNK A;  1UCN A;  2F4F A;  5A8K B;  1Y4Z B;  2KJW A;  4FDF A;  2CNL B;  1NB2 A;  2NQP A;  1PBA A;  2L9D A;  7FD1 A;  1H3D A;  3DYA A;  2N3O A;  2C2E A;  4WBF A;  4RNF A;  5IM0 A;  3QZ7 A;  2VB6 A;  3EPI A;  2Q6C A;  3ITH A;  2YH0 A;  2B7B B;  1PAE X;  3SIP B;  1YZ7 A;  4OJ1 A;  4ETX A;  3TR5 A;  3RBZ A;  2FY1 A;  1T3O A;  1NJY A;  1SI9 A;  2E66 A;  4DV2 J;  2Y8Y A;  2UU9 J;  1ZAW A;  4AYB D;  2PII A;  1FWL A;  2G0C A;  4DPU A;  3MUR P;  3DLE A;  3HHL A;  1FVS A;  1FF2 A;  4OHW A;  3JTN A;  1DTT A;  1L3K A;  1M0S A;  3TYT A;  1U2C A;  2G4B A;  2E5J A;  2BM0 A;  3ZO7 A;  4OYB A;  2LEB A;  2IDL A;  2OGU A;  3TJ8 A;  5ETV A;  1FJ7 A;  3M1V A;  1VJW A;  2B4P A;  2OPS A;  2MKI A;  4UUX A;  2X1A A;  5LXY A;  2YH1 A;  3PKM A;  2H4W B;  3QLH B;  3PO4 A;  1WG5 A;  1IBK F;  5JUM A;  3DRP B;  3MUT P;  1KDN A;  3QWP A;  4LFB F;  2KRB A;  3G6X A;  1UZH A;  2RQM A;  1LWF B;  1TMM A;  2Z30 B;  2HZA A;  4WU2 A;  2YWF A;  1R7I A;  1HBO A;  2BJ3 A;  3SEO A;  2WB4 A;  2WBR A;  3CT9 A;  3H90 A;  4HHU A;  4ED2 A;  2GML A;  4DL6 A;  5DDR C;  1KTQ A;  4C11 B;  5CCL A;  1MLA A;  1TL3 B;  4ZJL A;  5FDL B;  3R5A A;  1M5O C;  3Q83 A;  2RS8 A;  2PI4 A;  2EG1 A;  1FRM A;  4PQU A;  2W4D A;  4RW7 B;  1D9A A;  2XTJ P;  3LGN A;  4OYI A;  1RBL A;  4LF7 F;  2CVE A;  3DLB A;  2C2N A;  1T7P A;  1JXV A;  3CJQ A;  4KYZ A;  3CDE A;  4ED6 A;  1RHQ B;  2BMB A;  1UP1 A;  2NPF A;  9ATC B;  3FKB A;  1CSJ A;  4ECS A;  3VF0 B;  1RU2 A;  3I9Z A;  4NRT A;  3Q2T C;  1C0U A;  4M63 A;  4QPT A;  1NDP A;  3AA8 A;  1NJW A;  1SKS A;  1C0T A;  4LVN P;  2KHC A;  4IFY A;  4DCJ B;  1LFW A;  1BHN A;  4DJB A;  5BXI A;  2MMY A;  1KLN A;  2MST A;  2LDI A;  4NLQ A;  4NAS A;  3T1H F;  2G2Z A;  5K5M A;  2B9X A;  2MKK A;  3FRY A;  1Y11 A;  3F0N A;  2LA4 A;  1LWE A;  1FK9 A;  2VAS A;  1UZD A;  4H4K C;  3BH6 B;  3AOB A;  2CG8 A;  3W9I A;  2EI5 A;  1GXU A;  2DO0 A;  4J9R A;  1TVR B;  6FD1 A;  5IC6 B;  3SBM A;  4O3O A;  3MED A;  2ZEJ A;  4DL5 A;  1RYS A;  1N0U A;  4Y2M A;  4J9K A;  3M6U A;  4A48 A;  3V2U C;  4M5K A;  2OSR A;  3PAC A;  5U47 A;  4B3O A;  1D8Y A;  1RDR A;  1HD0 A;  4LF5 J;  2AZ3 A;  3OTC A;  5EGY A;  1M5K C;  1NME B;  2JX2 A;  4LRA A;  5IOL A;  3D54 A;  2XNQ A;  2CRL A;  3DU5 A;  4USU A;  3PW0 A;  4JI7 F;  1IKX A;  4ECW A;  2M5Y A;  4WFX A;  3M2R A;  3ILO A;  1VDH A;  2NXJ A;  4XK8 C;  5LOQ A;  2DNH A;  1TL1 A;  2DNK A;  1LXJ A;  1V5I B;  3K58 A;  2RD5 C;  4OHY A;  1RKI A;  3OR2 A;  1KFD A;  1WC0 A;  3UDV A;  1SH0 A;  5KFX A;  4QU6 A;  1GK8 A;  2LEA A;  4LT6 A;  1IBM F;  4J9M A;  5HBM B;  3BGR A;  4TXS A;  2XLK A;  2YX4 A;  4QOT A;  4F67 A;  1MWZ A;  1SJF A;  1GMU A;  5LSL A;  4O0N A;  2ZH5 A;  2C3M A;  2DHS A;  2VQE J;  2KT3 A;  2FVP A;  3TAP A;  3VGU A;  3KYL A;  2GJF A;  3RR7 A;  1VQ9 S;  5DDP C;  2FDN A;  1UL3 A;  2FZK B;  1Y7P A;  2NYI A;  3UVJ B;  4F3M A;  5JVG Q;  1E6Y B;  5FD1 A;  3KKF A;  1J5E J;  3FMW A;  3KG4 A;  2W7P A;  2XS2 A;  4KH1 B;  3M8Y A;  3F56 A;  1H7X A;  3U02 A;  1YIJ S;  4ZVG A;  4U7U K;  4FYW B;  1S1X A;  2HFZ A;  3MUV P;  3V6H A;  1A0O B;  1AUS L;  2FHJ A;  4M1K A;  4P75 A;  4RW7 A;  2V2V A;  1NHU A;  1S6Q B;  3D67 A;  3MCN A;  3DI6 B;  5CYQ B;  5DG8 A;  3NMR A;  4ZPW R;  3K2Y A;  3LP1 A;  2YX7 A;  1VQL S;  2MYF A;  3DXS X;  4FXW A;  3AJ2 A;  2HBZ B;  2HFV A;  3WIU A;  1GAO A;  1SH3 A;  5KFK A;  4CH0 S;  2DNY A;  2XSJ A;  1VQ5 S;  2YNF A;  2ZDP A;  3VV2 B;  2KFN A;  3EVO A;  3HT0 A;  2Y1L B;  4X62 J;  1NJI T;  5I4M A;  4RWW A;  1RAO A;  4ZVR B;  4X65 F;  1RTD B;  2IJF A;  4I67 A;  3UNG C;  1YVF A;  2OKQ A;  3AB2 B;  1Z2L A;  5F8J A;  2HZV A;  3CDB A;  2PEB A;  1U8S A;  3T1A A;  5DGB A;  2BE2 B;  3G2X A;  1SC6 A;  4ZP8 A;  1U8W A;  2CVI A;  1H72 C;  2VPW B;  3QQC D;  2HQI A;  1SL0 A;  2XWY A;  5EX0 A;  2DR9 A;  3RU0 A;  1V3S A;  5GMD A;  3G96 A;  1HI8 A;  4P2X A;  4NLW A;  1IJF B;  4HH0 A;  1C4C A;  1TVR A;  3HHK A;  4DCP B;  4B08 A;  3GR1 A;  1TEL A;  4YEA A;  3CCR S;  2O3D A;  4KC5 A;  3IA0 A;  3KK3 B;  2DR7 A;  3BH7 B;  1X9M A;  4H4M A;  3OXL A;  3CCT A;  4OHV A;  1RTJ B;  4K4V A;  1AB8 A;  3L9Z A;  4EBC A;  4ZN1 A;  1M1K T;  3KTQ A;  5DRK A;  2K3K A;  3C15 B;  4LRB A;  3QGH A;  2XMT A;  2ADB A;  3DLG A;  2OPP B;  3PEH A;  4LRE A;  2Q79 A;  4LR8 A;  2BKO A;  4DS4 A;  3E01 B;  1BQN B;  2PMZ D;  4GKJ F;  3BBF A;  4TLQ A;  3PR5 B;  1BQM A;  2I5J B;  4G65 A;  4Q7A A;  3HFK A;  1HQE A;  1YK9 A;  5I3U B;  2JJ4 D;  3GIM A;  3BGL A;  1B70 B;  2Y1R I;  4DV7 J;  2V9K A;  3CUL A;  5LMN J;  1TAU A;  5EDW A;  3WQP A;  4AL7 A;  4C8N A;  1F9F A;  1UVM A;  4QIE A;  3UNY A;  1B0P A;  2JEF A;  4P71 A;  2BX6 A;  4JV5 J;  1R3N A;  4LF8 F;  2GHW A;  2K2P A;  1FKA F;  1H7W A;  1OO0 B;  4MAK A;  3LP0 A;  4QWA A;  2V8P A;  5DS7 A;  2F9J A;  4V19 J;  4ZVP B;  1V5V A;  4JI3 F;  3LP2 A;  2O66 A;  3TX8 A;  8RUC A;  4DR7 F;  1SL2 A;  5FJ4 A;  2JZ5 A;  2HKE A;  4NRU A;  1WEZ A;  3M6W A;  2V9W A;  2Q3P A;  3DRS B;  4HTJ A;  3RRH A;  4QIG A;  4EK2 A;  1HNV B;  1RHM B;  5HAO A;  3BBB A;  4C7Q A;  1IBL J;  3PJW A;  1RI7 A;  2UUC J;  3IXQ A;  4CO0 A;  3LOU A;  1HNW F;  1N36 F;  2GVD A;  2LU2 A;  1HQ2 A;  3OSP A;  2DB1 A;  2VOO A;  4QR1 A;  1XC9 A;  4Y3C A;  1U6B A;  1VI7 A;  4X66 F;  5D8H B;  1PBU A;  2CDR B;  3UDC A;  3PCO B;  2VDI A;  1FHT A;  4ZP6 A;  3J7Y I;  4PYD A;  4FZV A;  2OPQ A;  3K5P A;  2C28 A;  2HWI A;  1ITP A;  1S77 D;  2DCL A;  5LXR A;  1UVI A;  1SV5 B;  3OTE A;  2V63 A;  1FJE B;  3QT5 A;  5J1P A;  1Y5L B;  4H4O B;  4F3O A;  3IRX A;  3X3U A;  3WC0 A;  5KFH A;  1TQL A;  4HHH A;  3U1M A;  2BAN B;  2Q66 A;  2CQ3 A;  2YKA A;  5EWE A;  4IUF A;  2L08 A;  2K7K A;  4QWD A;  4DZD A;  3CCW A;  3SFU A;  2DGW A;  5B0G A;  4DPW A;  3FGV A;  2W8K A;  1LFP A;  3ET6 A;  2R8I A;  4LBP A;  1XK8 A;  2JVR A;  2UVR A;  1UVJ A;  1JJC B;  2WSC C;  4TU7 A;  4WFY A;  3ILJ A;  1QAJ A;  2QA2 A;  5KG1 A;  1EET A;  2CDQ A;  4OJH A;  4DUZ F;  5GAD U;  4QJV A;  2QTW A;  5KT6 A;  2FVQ A;  3HUL A;  3CJ2 A;  2AYM A;  3PYG A;  4K4W A;  1NDK A;  3TUZ C;  1CUL B;  4OI4 A;  3DLH A;  2KTQ A;  5HVF A;  2O01 C;  1Z1Z A;  4R5P B;  2B3T B;  3HJF A;  4DQQ A;  4MK9 A;  1BMQ B;  2IJN A;  4ILR A;  2DEJ A;  3MPW A;  3TAQ A;  4N41 A;  4DV4 F;  4DV3 J;  3QAT A;  4M5D B;  1YJ7 A;  2LQJ A;  3UWT A;  4K4X A;  1CJK B;  5DG7 A;  4KO0 A;  3W9H A;  3D6H B;  2VG7 B;  2R3V A;  4IH6 A;  5D15 A;  1S9F A;  2OEM A;  2HHH J;  4WFN Q;  2MZS A;  1FKO B;  1ICE B;  1FEH A;  2YKM A;  4NYP A;  5F8N A;  3UO0 A;  1RT7 B;  2OIH A;  4B9T A;  3KUH A;  1OSC A;  1JKH A;  1FJC A;  1BUX A;  1JLB B;  3DHX A;  5KFD A;  4ZOS A;  4RW8 B;  4DFM A;  4NLO A;  3ZZO A;  2HEK A;  5DM6 Q;  4KE5 A;  3JS9 A;  3FK4 A;  2LMI A;  1K44 A;  1RU1 A;  4B9V A;  1AFJ A;  4DR4 J;  5GAH U;  1FE0 A;  5A6W A;  2HK2 A;  3D1O A;  3GYX B;  1R8C A;  2HSE B;  4LIR A;  4RUB A;  4YHH J;  3W9J A;  3D1Q A;  5KFQ A;  2KU7 A;  4PG4 A;  2OTJ S;  2HQD A;  5L9X A;  3N6N A;  2K1R A;  3IS9 A;  4ED3 A;  3HCX A;  1S79 A;  4P10 A;  1XMQ F;  3MAA B;  2MZR A;  4C6A A;  4KT0 C;  2QC3 A;  5C42 B;  3CD7 A;  1U0H B;  5KG7 A;  4ED4 A;  3OL8 A;  1HWU A;  1VQN S;  1CEZ A;  2KXN B;  4M5H A;  1QAY A;  2EEY A;  1WNE A;  5B0B A;  2W4C A;  1YBA A;  4DV1 F;  1UET A;  4FXV A;  4K7Q A;  3PJ9 A;  2RQC A;  1BLU A;  5D0H A;  3MZI A;  4NLG A;  4MT1 A;  3MI7 X;  4DF4 A;  2DHG A;  2DTJ A;  5LL6 d;  4RZR A;  3CTR A;  4NLU A;  2GVZ A;  1FFG B;  2EXU A;  4PPZ A;  4XAK A;  4O3N A;  4C8L A;  3RB4 A;  2KHD A;  3R9L A;  3CCU S;  4FYV B;  4ES1 A;  2AD9 A;  1NU4 A;  2CQD A;  1MU2 B;  1UTA A;  1RT2 A;  3NRB A;  2DR8 A;  3K8W A;  1N5Y B;  2LXU A;  2GO9 A;  1WC5 A;  2VON A;  2ZNY A;  3Q8R B;  1XN9 A;  1TTH B;  2BAN A;  4CWB A;  3HO1 A;  2N82 B;  2DY9 A;  2AEJ A;  2HBQ B;  3K57 A;  2RU9 A;  4F04 B;  2BOP A;  2MQQ A;  3ONQ A;  1APS A;  1W2I A;  3CJR A;  3W64 A;  3QAE A;  4YN3 B;  3F44 A;  2KVI A;  2UXD F;  1X9S A;  2KZZ A;  4ZVF A;  3WBZ A;  2KH9 A;  4TQS A;  5JMN A;  2W9A A;  1DQA A;  4RBU A;  2VC1 A;  2ROE A;  4C3L A;  1R43 A;  5GAG U;  2ATL A;  5G0R B;  3KJQ B;  1TKT B;  4XPC A;  5KG2 A;  3IP0 A;  3CJK B;  4B3M F;  2A6M A;  1B7F A;  4MJK A;  2EFG A;  1Q5Y A;  3MM7 B;  4LSL B;  4TY8 A;  4JI8 F;  1UWB B;  2AT1 B;  2PSZ A;  4YP3 A;  2RIL A;  5J2M B;  4F4K A;  4M5D A;  3OR1 A;  3UQS A;  5A8W B;  3ICL A;  2CJY B;  3GCW P;  3L09 A;  2CZ4 A;  2VG7 A;  3NXZ A;  1SC1 B;  2ACY A;  3TA2 A;  1TV6 B;  1XNQ J;  5HO4 A;  3BZQ A;  2MY7 A;  2F63 A;  2DRA A;  2BJ1 A;  1UEU A;  5DLG A;  4GO5 X;  3TX0 A;  1YQH A;  2RF2 A;  5HAN A;  4B3T J;  1RAC B;  2G13 A;  2J9D E;  5KG0 A;  5M2R A;  1U1Q A;  5KFI A;  1IM4 A;  2HND A;  3JSR A;  3W66 A;  3TVK A;  1HQU B;  4KKO B;  3JYT B;  4DPT A;  1FX2 A;  2Z56 B;  3U27 A;  1KEK A;  3TEH B;  1DQ8 A;  1WDD A;  1CJU B;  3C2P A;  2YBV A;  5CAA A;  5FII A;  1CS4 B;  2D9O A;  4J5O A;  1M1H A;  1FTC A;  3R7B B;  4AT1 B;  4P74 A;  3OD2 A;  5EX3 A;  2WSE C;  3CED A;  4S0M A;  4BHQ A;  3KHG A;  3JTP A;  4BC9 A;  2FJX A;  3GPA A;  1F9E B;  2VHG A;  1PKU A;  1W26 A;  2UUA F;  4MMO A;  3EVM A;  5F9L A;  4IRC A;  1QSS A;  5ETR A;  1VHF A;  3R6G B;  3TI0 A;  3IG1 B;  1JLG B;  2CZV C;  3TZX A;  4LF7 J;  1EIY B;  5E3P A;  1Y5I B;  2P9G A;  1RXO B;  3BSC A;  4YB5 A;  4DPY A;  2XMW A;  3H98 A;  1EB0 A;  3D0H E;  2ATC B;  4NCG B;  3DKD A;  4WCE Q;  2R7W A;  2HIY A;  2R8G A;  3PHT A;  1O5J A;  4FBT A;  3MM6 B;  2YY3 A;  1K9M T;  3DGP B;  3CDW A;  3OQ2 A;  3N6L A;  4NI2 B;  3K8V A;  3ZZU A;  2FGO A;  1ZZN A;  1HAR A;  3TZY A;  3T19 A;  3HT3 A;  1IKV A;  1EQ0 A;  2MKC A;  4AXI A;  2FHK A;  3J7Z T;  2QGF B;  4CH7 A;  4PQA A;  3EIC A;  3E51 A;  3OFE A;  5T7L B;  2O5D A;  2YNI B;  4CLY A;  2NYH A;  1JJH A;  2FYX A;  3UDL A;  4ECZ A;  3D6F B;  3C3L A;  3PFO A;  3JQM A;  3PHE A;  4HYK A;  2MLZ A;  3CUN A;  4JI1 J;  3TA0 A;  5G0R A;  1WSR A;  4UQG A;  1VIO A;  4O4G B;  4LF9 J;  5K8P A;  1N0V C;  4DG1 A;  2V4J B;  1U48 A;  4KAI A;  4PKD B;  2CPX A;  1U1M A;  2RKI B;  4CLP A;  2AJ1 A;  3TUI C;  2XMU A;  2HGN A;  5CXT A;  2FHM A;  1VC5 A;  4C0H A;  1KLM B;  2L48 A;  4KV8 A;  1LNQ A;  4NZ0 A;  2B9Y A;  3VAF A;  3DOM A;  4GKK J;  4DL0 C;  5J2M A;  3MEE A;  4YUD A;  5F41 A;  4P2S A;  2DXF A;  5KAK A;  5A8W A;  2R9L A;  4J9P A;  5LMU J;  3NAI A;  2D69 A;  2DGS A;  2C3Y A;  1F2H A;  2AU0 A;  4WWS A;  2CJ9 A;  4K2X A;  4X4O A;  3M8P B;  4A8Q A;  2JDJ A;  4YFU A;  4DR3 J;  2UXC F;  2M7S A;  3IRW P;  1G6B A;  4Y2I A;  2I0X A;  1Q79 A;  1VS3 A;  2FVC A;  2GGP B;  4CI0 B;  4RW4 A;  4PCQ A;  1DHM A;  3S6E A;  5K9F A;  4ED8 A;  2XHW A;  3JAM U;  1T9Y A;  2HK3 A;  4Y0F A;  2FLL A;  1T9X A;  3J80 U;  4P2F A;  4ED7 A;  3JSM B;  2CYY A;  4DV6 F;  2F65 A;  4YOE A;  4JV2 A;  5KFB A;  4JBC A;  1NBE B;  1MG7 A;  3KK2 A;  2DXE A;  3P5T L;  2LDY A;  2MLY A;  3V4I B;  1EKS A;  1J27 A;  2KT5 A;  4KHP J;  2IBO A;  3EZU A;  1RWO B;  4EU0 A;  2GHV C;  2PDA A;  4Z7C A;  3PYD A;  5IFM A;  1S9G B;  4C8K A;  1NK4 A;  4J9V A;  4F4A A;  4QWE A;  4LFA J;  3VAG A;  3EXC X;  2D3O 1;  4W90 B;  3IC1 A;  4FVC A;  3TNV A;  5DJB A;  1LV5 A;  1PJ7 A;  1HKA A;  2Z2Y B;  3CD0 A;  1NH7 A;  2A10 A;  4NLR A;  3OVB A;  5DQH A;  2DK2 A;  1CQM A;  4ZPT R;  4IG0 B;  1Y9O A;  2E9Z A;  4R0J A;  4MKB A;  4N8N A;  1RTH A;  3PRV A;  4OJG A;  3OLB A;  2DNN A;  2V69 A;  2CQ1 A;  2RIJ A;  2UV8 G;  3FFI B;  4NLS A;  3VCD A;  3P3D A;  1TZ0 A;  2N4C A;  1Q81 T;  1PYS B;  3CC4 S;  1HHS A;  2UUB J;  2FVS A;  1IKW B;  2LCW A;  1B99 A;  1N8R T;  1OSD A;  3E2E A;  3HM9 A;  5KT2 A;  2VG5 A;  5E5N A;  3I5C A;  3ZC4 A;  4B9S A;  2DNZ A;  4DQS A;  3BYP A;  4JI4 J;  1JLC A;  1FRH A;  3I32 A;  2KYX A;  3Q22 A;  3OVS A;  3CD5 A;  2GIF A;  4ZCM A;  2DH8 A;  1BE4 A;  1FDD A;  4EBE A;  4USH A;  4PWD B;  1XNR F;  3W8P A;  3FBC A;  3CGI A;  4FYY B;  4MH8 A;  3G4S S;  1T3N A;  1T05 B;  2V8H A;  4RO0 A;  4NXN J;  3OBI A;  1T8E A;  5CZV A;  2V50 A;  2QMX A;  3NY0 A;  2C2R A;  1UPM B;  2DIT A;  2IYI A;  1Q78 A;  3I4H X;  1U6F A;  3DOK B;  3JAM Y;  4M5J A;  3J80 Y;  2ZM6 F;  6AT1 B;  4GKJ J;  4JI5 J;  2QV6 A;  3WDO A;  5D0G A;  1WKJ A;  4NWB A;  4R0E A;  2YKO A;  1H73 A;  5CD4 H;  4LIW A;  3ZFV A;  3V5R A;  3D2W A;  4ZVQ B;  2A18 A;  3MM8 A;  2YTC A;  2RQK A;  3K0J A;  3CC7 S;  3LPY A;  4NX9 A;  1SIZ A;  2PA3 A;  3PRB A;  4LF8 J;  3MMJ A;  2B43 A;  2RDI A;  3HK2 A;  2P6S A;  4U7C A;  4I7F A;  1BGX T;  1Q4R A;  2XZW A;  2VG6 B;  3H0P A;  2FQQ B;  2MQO A;  2N4D A;  3W61 A;  1RT6 B;  2F8H A;  1P1T A;  4BDP A;  4B3S J;  1U0S A;  2V2Z A;  3SSR A;  4FXD A;  5F8M A;  5KFT A;  3V4I A;  3LWM A;  4JB8 B;  3GSI A;  2HNY B;  3SZ2 A;  4DV2 F;  2KI2 A;  2XM3 A;  3BO2 A;  2UU9 F;  3GII A;  3PX6 A;  4WYL A;  2H54 B;  1Y00 A;  5KFZ A;  4BWM A;  1KVI A;  1GMW D;  2KN4 A;  2VFS A;  5J1E B;  4R8U B;  3POT B;  3HZG A;  1KS2 A;  1M5P C;  3K5M A;  3R1L A;  2HQF A;  3ZZZ A;  4CT9 A;  3GFY A;  5D78 A;  4X66 J;  1R6Y A;  1T9W A;  2YVS A;  1HMV A;  2KXF A;  2RU3 A;  4JI0 F;  2IM1 A;  2VUG A;  4RW6 A;  2GS8 A;  8ATC B;  4ZHR B;  4UOF A;  2DY1 A;  4P73 A;  1N6Q A;  3Q8Y A;  3IBF B;  3BRE A;  4DR5 F;  1PYO B;  3PFE A;  1IKW A;  2IC3 A;  2MZT A;  2XG8 A;  3NLC A;  2ASJ A;  3MFI A;  3T5J A;  1M5S A;  1AZS B;  1X5O A;  4OV1 A;  1T03 B;  3L95 X;  1TMJ A;  1F2G A;  4I0W A;  4CT8 A;  1SUQ A;  5F0U A;  2HVH A;  3MEG B;  4HL9 A;  5A0Y A;  2BKN A;  4N47 A;  2W4P A;  1J2V A;  2R8J A;  3VTI A;  1VQM S;  4ZCI A;  2YKN B;  4Z7Y A;  2MGZ A;  1MML A;  3H7H B;  3GV7 B;  2OUG A;  3CXC R;  1R6V A;  2UP1 A;  1PIL A;  3ZZ0 A;  3HLU A;  4DUZ J;  4OFZ A;  2XB2 D;  1CQN A;  3W65 A;  1ZH5 A;  4K2J A;  1WOP A;  1F9H A;  3LAL A;  3PZP A;  3NCR A;  3BGU A;  1SQF A;  3HSZ A;  3IAS 9;  4W98 A;  1C1C A;  2PFD A;  2E29 A;  1IQT A;  2PO4 A;  2ZJR Q;  3HSJ A;  2BEF A;  3MR6 A;  2JSX A;  2GZO A;  2BVZ A;  3JQJ A;  3G8T A;  1YSJ A;  2Y0B B;  2YPZ A;  3DRX A;  3MR2 A;  1IJE B;  3NG8 A;  4OYX A;  3Q89 A;  1N5Q A;  3TEG A;  2CQG A;  2J5A A;  4F7V A;  1HW9 A;  3MDF A;  1TAQ A;  5M2P A;  2FD2 A;  2XMK A;  3C16 A;  2W2N P;  2ZKT A;  3QYY A;  3DMJ B;  3NWG A;  2LYV A;  4I1T A;  1JLA A;  2BAC A;  2R42 A;  2A2D A;  3VVT A;  3LGM A;  2AWZ A;  1FD8 A;  3W60 A;  3THP A;  2VJU A;  3G82 A;  1AYE A;  2DNL A;  1OPI A;  1RAG B;  2H48 B;  2GFF A;  1IWA A;  3PW4 A;  1FCA A;  2PGC A;  4RKU C;  1D1U A;  1MNE A;  1CJV A;  4CLF A;  3MWB A;  2CWK A;  3GIL A;  2CFX A;  4DV0 J;  2XCP A;  1VQ8 S;  3TJ9 A;  4RNM A; 
#chains in the Genus database with same CATH homology
 1BHN A;  2HVE A;  3EM1 A;  2ZUA A;  1LWX A;  5BXI A;  3B54 A;  4C6A A;  1PAE X;  3FBF A;  3DDI A;  4W98 A;  4ANC A;  3FBB A;  1B4S A;  3ETM A;  3NGS A;  3DKD A;  4KPC A;  3NGU A;  4F4A A;  4UOF A;  2BEF A;  2DXF A;  2AZ1 A;  1BE4 A;  2HVD A;  3EJM A;  3Q86 A;  3VGT A;  5CAB A;  4DI6 A;  3BH7 B;  3Q8Y A;  3WX8 A;  1S5Z A;  1XQI A;  1VYA A;  2DYA A;  4EK2 A;  1F3F A;  3Q8U A;  3BBB A;  1F6T A;  1MN7 A;  3PJ9 A;  3BH6 B;  5C7P A;  3ZTO A;  3FBC A;  3Q89 A;  4O0N A;  3VVU A;  3FBE A;  3Q83 A;  4F36 A;  1NDC A;  5CAA A;  4AND A;  3NGR A;  1NSK L;  3EE3 A;  1HHQ A;  3VGV A;  3FCW A;  4ENO A;  3VGU A;  3MPD A;  3EVO A;  1HLW A;  4DUT A;  1XIQ A;  3BBF A;  3R9L A;  1NHK L;  3Q8V A;  1BUX A;  4CP5 A;  3GP9 A;  3PRV A;  2NCK L;  4S0M A;  2HUR A;  1EHW A;  4FKX A;  4UOH A;  1S59 A;  3VVT A;  3ZTP A;  3EIC A;  1S57 A;  2B8P A;  3FCV A;  4ANE A;  1NSQ A;  1NDL A;  1JXV A;  3GPA A;  2VU5 A;  1NDK A;  3ENA A;  1PKU A;  1HIY A;  2AZ3 A;  3JS9 A;  1NUE A;  4HR2 A;  1K44 A;  1UCN A;  3L7U A;  3G2X A;  1NLK L;  3EVM A;  3ZTS A;  1WKL A;  4DZ6 A;  1U8W A;  1B99 A;  4FKY A;  2DY9 A;  1LEO A;  5IOL A;  3FKB A;  3ZTR A;  3VGS A;  1NB2 A;  1ZS6 A;  3ELH A;  2BX6 A;  3EVW A;  2B8Q A;  1WKJ A;  1NPK A;  3NGT A;  3ZTQ A;  2DXD A;  3B6B A;  2CWK A;  1NSP A;  3FC9 A;  4WBF A;  3EMT A;  1KDN A;  1NDP A;  1WKK A;  4UOG A;  2DXE A;  3BBC A;  1W7W A;  1MN9 A;  1NCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...